2EPBA

Solution structure of chromo domain 2 in chromodomain-helicase-dna-binding protein 6
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
68
structure length
68
Chain Sequence
GSSGSSGNPDYVEVDRILEVAHTKDAETGEEVTHYLVKWCSLPYEESTWELEEDVDPAKVKEFESLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromodomain-helicase-DNA-binding protein 6
publication title Solution structure of chromo domain 2 in Chromodomain-helicase-DNA-binding protein 6
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 68
sequence length 68
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2epbA00
1E0BA 2BDNA 1NR4A 1VMPA 2K28A 1ILPA 2L9HA 1KNAA 2B2UC 2L4NA 3GV3A 2B2TC 1DOLA 2Q8RE 5DNFA 2KVMA 3SVMA 4IUQA 1EL0A 1LV9A 2B2WC 1X32A 1WTQA 1C8CA 1ML0D 2RVLA 4ZAIA 1WD1A 2FINB 1G91A 1WTWA 2HCIA 2MP1A 2B2VA 2L12A 1EIHA 4CJ0B 3I3CA 3Q6SA 2HDMA 3ONAB 2B2YA 2KUMA 5EPKA 4R9WA 5CMDA 2X6GA 1BF4A 2HDLA 4IUVA 1G6ZA 1BO0A 2H1EA 2FHTA 2N88A 4UAIA 2J7ZA 1F9RA 1KNEA 1O7YA 1F9QA 1JICA 4DN4M 1HA6A 2L11A 3DEPA 3HP3A 4X3UA 2DY7A 5D65A 1JE4A 1AZPA 3GV6A 2N55A 4X3KA 1EIGA 3FDTA 4MHEA 1WTRA 1GUWA 1M8AA 1RTNA 1NAPA 3DM1A 2KEEA 4NW2A 1WVLA 4HCSA 1O7ZA 5EQ0A 2Q8TA 1RTOA 1U4PA 4ZKBB 1MSGA 4OIKA 1SAPA 1CA5A 5EKIA 3I91A 4R8IA 2SDFA 2B2YC 4X3TA 1WTVA 1RJTA 1B50A 2K04A 3FPUB 4CJ2C 1PFNA 5COYA 1IKLA 5E4WC 4LMQD 4XT1B 4CJ1B 4IURA 3R93A 2K1BA 2KOLA 1X3QA 2VXWA 5T1IA 1F9PA 4RAUC 1J9OA 1PLFA 1PDQA 2DY8A 4QUCA 5CORA 1X3PA 5AFWA 1MGSA 3I8ZA 3D6WA 3QO2A 2HCCA 1EQTA 2B2UA 1G2SA 2R3ZA 1DONA 1ILQA 4IUUA 2B2TA 4OIJA 1PFMA 4QUFA 2NZ1D 3LWEA 1G2TA 3MTSA 3TN2A 1A15A 1HUMA 4HSVA 4ZK9B 2B2WA 1CA6A 2RSNA 1HUNA 1XYIA 1XX8A 1PFBA 2D9UA 2RSOA 4O42A 1BNZA 1F9SA 1DOMA 1IL8A 1U4MA 4HEDA 1RODA 2HUGA 3I90A 5D14A 3UI2A 1QE6A 2B2VC 1F2LA 1QNKA 1HFNA 2M2LA 1SDFA 4IUPA 1WTXA 2JYOA 2NWGA 2KECA 3H91A 1WTOA 4RA8A 2FJ2A 2KEDA 4ZLTF 2NYZD 1WD0A 5E4XA 1VMCA 3P7JA 2X69A 4U68A 2MGSA 4XDXA 1AP0A 2MJ8A 2X6LA 2XIWA 3IFDA 4MN3A 2MPMA 2JP1A 4RWSC 5JJZA 5EPLA 1MSHA 1AZQA 1NCVA 1B3AA 2EOTA 2K05A 1ZXTA 1EOTA 2FMMA 1SSOA 2L1BA 1O80A 1ESRA 2CVRA 1B53A 3IL8A 1RHPA 3MWYW 5EPJA 1HRJA 1B2TA 1CM9A 1B4OA 3F2UA 3KUPA 5CBAE 2IL8A 1U4LA 2RA4A 1QG7A 1MI2A 1S4ZA 1DZ1A 1Q3LA 2FFKB 1ICWA 3TZDA 2EPBA 1BBXC 4ZKCB 5T1GA 3G7LA 1U4RA 1WTPA 5CBEE 2K01A 2K03A 1HFGA 4X3SA 1IKMA 5EJWA 3N52A 4HAEA 3KBXA 1DOKA 1J8IA 4IUTA 1NR2A 1HHVA 3DEOA 2EE1A 4XT3B 1TVXA
chains in the Genus database with same CATH superfamily
4O0AA 4A3IH 5C3XA 2L4NA 4A75A 3GP7A 5J1ZA 3J81i 2YU9H 4F8MA 4FXGC 1EY4A 2EYFA 5C6AA 3MVVA 4ME5A 3A56A 5C44G 1L1OA 4V0BA 5DAUA 2L55A 2B2VA 4A3IB 1Z7TA 1KAAA 5EPKA 5IY0A 4DR6Q 2XVSA 1X56A 1SNPA 1Q12A 2R93B 2YU9B 2CH4A 2JA6B 2N88A 4E6IA 4G7ZC 3OW7A 1GHJA 1T5XD 2L11A 2EYHA 1VCIA 4JVZA 1HXYD 2D0OA 1HQMC 3OWFA 2MHVA 1AZPA 3UDXA 4OO1I 1HR0Q 3I72A 4ILWA 5BN4A 5IIFA 4OWTB 1FJGQ 3DM1A 1MD2D 1IXRA 4A3BB 3I4NH 3HOYB 5FLXL 4GOPB 3BZCA 1BXTA 1SAPA 4LUOA 2F0IA 2DGYA 3CQZB 1EY5A 4PMCA 4XT1B 3D8GA 4H7BA 2F0DA 3NELA 4HJ7A 2VQFQ 1J9OA 1ZYRD 3N6RA 4A3LG 3EA6A 3HOXH 1G2SA 2JXMB 3S1RH 1Y8PB 4WJ4A 1A15A 4K8JA 5FLXc 4A3KG 5LMNL 5CGKA 3EFXD 4LF5L 4DF7A 3DHQA 3PF5A 4UP7A 4X66L 5LMUQ 4F87A 1F2LA 1OXUA 2K52A 3HOXB 2XRQD 1BBWA 1LTBD 2LS01 4X65L 4ZUJA 1XXGA 1MHWC 3GTGH 5JJZA 4LFAL 1RF2D 2EYJA 1EOTA 2LMCB 1VQOA 4Y7NH 2UXDQ 3VR2A 5C0XG 5BR8L 3GTGB 1R9TH 3TS2A 5IWAQ 5GROA 1SNDA 1QOHA 2F0GA 4A3EG 1PRTC 4Y7NB 2ZM6Q 3T13A 3C1FA 3FKIH 4RG1A 1GUNA 3P75A 2AHOB 2L9HA 2VQEQ 2JA8B 4JI6Q 1LTAD 1PRTB 1JORA 2B8GA 2YV5A 3CAMA 2F3WA 2EDGA 4RKBA 1B8AA 1PTOF 4BBSG 1FL0A 3FKIB 3UE0A 4DAYB 2HDMA 3CCRA 4HIOA 1Q86C 2QCPX 1N34Q 3VDYA 2JA5G 3SK4A 3SEBA 3VYTA 4PZ7A 4DAPA 2M9VA 1WI5A 3E0JA 1N32L 1LO5D 2O2LD 1IBLL 2J7ZA 1XNRQ 1MIUA 3CHBD 4HJ5A 1S5ED 3DEPA 4X64Q 2VW9A 1N33Q 1K3BC 3CD6A 2SNMA 2N55A 1QUQA 1JJCB 3NP8A 5IYCH 1M8AA 4GKJQ 1GUWA 1KL9A 5M3FB 3NENA 1OXSC 2WIIB 1MSGA 3QOJA 5KEEA 1CA5A 5FO9B 3NHHA 3A5UA 1WTVA 5LMNW 2ENBA 4LF6Q 1F2YA 5LL6X 4NKLA 1BUVT 1XJVA 3H15A 3VYUA 1PLFA 1Q46A 4LF8L 4YCWA 5AFWA 3M7GA 1SMYD 1EQTA 2KBNA 4KKUA 5IGCA 5IP9G 4A3JG 4BA1I 2KCCA 4HSVA 4LF9L 2Z9HA 1CI3M 4DR1Q 5EBCA 1C0AA 3VR3A 4IOCA 5D14A 4JBJA 1STHA 3ERSX 2LXKA 4DFAA 4JPBW 3KFUA 4L63B 1UE7A 5C4XH 4DV4L 1E3PA 3H0GB 2XSCA 1RL2A 1YNXA 5C3EH 1MSHA 3OMCA 2O5IC 1D1KA 1C7YA 1ESRA 3KK7A 1HNWL 1CM9A 1LM0A 1MJEA 2J4XA 4FF4A 1QG7A 1HNXL 2A74C 1K0SA 3E3XA 2Q2TA 1C4QA 1F2MA 3KDFB 3T1YQ 2IWHA 4JYAQ 2VB2X 1VQIA 2HQEA 5K5PA 1Q8KA 2BDOA 4ID6A 4XT3B 1XMQL 3CCEA 4P75A 4NXNQ 4JG2A 1JWMD 1ILPA 5FLMG 2AKWB 1X9NA 1EZ8A 1BCPB 2WAQE 1PH1A 3T4AC 1I3QH 3H3VH 1AE2A 4QIWB 4BY1G 4X62Q 3FHWA 1G8ZD 2FINB 1E1OA 2K7VA 3H3VC 3URYA 1Y14B 1I5FA 1ET9A 2YTYA 4R9WA 3K5NA 1LT6D 1NE3A 2VY3A 1ICFB 5IGDA 3VYRA 3K57A 3G71A 1E2VA 3U58A 1CSQA 1LT3D 3QOLA 3K0XA 4ZYSA 4K6LA 2ZT9C 4BY7G 1UNSA 1EIGA 3MAQA 2LSSA 1X3GA 1GUGA 1NAPA 4CDEC 4POFA 1WVLA 5FKAC 3AB9A 3EJIA 3BS1A 3HOWB 3OMGA 4GNXC 3NK9A 4DR2Q 3L3OC 4K8IA 4C2MB 4DK6C 4IJLA 1EEFD 3U4VA 2I5HA 2Z6KA 2KOLA 4GKKQ 4GN3B 3OWEB 1X3PA 4DV0L 2CCZA 2WAQG 5DM73 5I4DA 3DXJC 5E1FA 1EYAA 1VF5C 3HKZE 5I9OA 1XYIA 5G3LF 1W2BA 1AH9A 1U4MA 5IYDG 5JJLA 4O2DA 2JA7H 3S24A 4K0KL 2JYOA 2NN6G 3EQLC 2PI2A 2BE5D 2K5DA 3K0YA 4LFBL 2ALYB 3EBEA 5GAHC 4OXPA 2X69A 4LF7Q 1TWAH 1HNZQ 3TRZA 4JOIC 1HTLD 5J39A 4DV1Q 5CV6A 2I0QA 1STBA 3BVGA 2JSOA 1TWFH 1YNJD 1VQHA 1TWAB 2CH4W 1RKNA 3RN2A 4A3FH 3C1EA 4X3SA 2RKSA 2WKCA 2NB0A 4HAEA 3J7YW 4AQYQ 4UP9A 5JOBA 3ZYYX 4RGOS 3CCSA 1VMPA 3AYHB 3GV3A 2XGTA 4A3FB 4DR3L 2MO0A 3HKZG 1J5EL 1QB5D 4CGYB 4RHRA 1EL0A 2F1MA 3QWNA 4YHHQ 1X32A 1P8LA 1ENCA 2Q8IB 1NMFA 2JE6I 1N9WA 4WORA 1WTWA 1BVSA 2KHJA 2WKDA 1DM0B 3PO2H 1CZWA 1YNNC 1BCPF 2UXCQ 1TWCB 5D3DA 1K28A 4UAIA 2PZUA 3J7AF 1I6HH 2LKVA 3KF6B 3NBHA 5CV4A 2WACA 5M5XH 1WFQA 4DUZL 4A93B 3GTJH 3VR5A 4PZ6A 3D0FA 1K73C 4KLKA 2EVBA 5M9OA 1RTOA 5C44H 4OIKA 1I6HB 4IZ8A 4KHPQ 3PUYA 5M5XB 1PFNA 5E4WC 3GTJB 1E24A 1V1QA 4A3MG 2R7ZG 4YY3L 5C4JH 3ITPA 1Q1EA 4KV6A 4CKEA 2UXBQ 5JEAG 3M7NA 2EJMA 1PH6A 2E5LQ 5KNDA 2QEJC 4YWLA 1DGSA 1SNCA 2D62A 3FMCA 1SMYC 3GO5A 3I7FA 3PIP3 4LF4Q 3NWSA 4DA2A 3H3VI 4ZK9B 1Q81C 3HOZG 2MO1A 3A7LA 4TQUS 3K59A 3UI2A 3VR4A 4Q0FA 2UUCQ 1VQ6A 1SXTA 1HFNA 4QL5A 4XQNA 1TY2A 3D4DA 4RA8A 1D6EC 3PGZA 4B3ML 2F0EA 5F2DA 1CT1D 4DK0A 1X3FA 2FMCA 3IFDA 4A3LH 1KHIA 2HHHQ 3K7AH 3KYHC 1O80A 5GAGC 4JI5Q 1B7YB 2CHBD 4RHSA 1DZ1A 4XXEA 2FFKB 3BVMA 1XPUA 4DKAC 4PMBA 2ZJPA 3DUZA 1HFGA 1B44D 3K7AB 1H9JA 4A76A 1NR2A 5CV9A 2AUKA 4M1UB 4QF4A 2BDNA 2R92B 1L0YB 1ENAA 3R3OA 2RDGA 3U50C 5L37A 4IUQA 1SNQA 3NEMA 3KF8A 5BN3A 4BXXH 5C0XH 1A3UA 3IAYA 2KCNA 3ER0A 2VUMB 2F0NA 4ME3A 3GTQB 1AE3A 2HDLA 5FO8B 1PRTD 4A3EH 2YTXA 3CRLC 3Q24A 2EYMA 5GQOA 1D2BA 1QVFA 4KD3A 4OELB 1HR0L 3L0OA 1FJGL 4S3SA 2UUAQ 3HOUG 3RUZA 4K5VA 4A3EB 1E1TA 4QQBX 2EXZA 1O7LA 5AJ3Q 2OWOA 1SR3A 2Z8LA 1Y1VG 2F4VL 1H9SB 3G48A 4R8IA 2L15A 2JA5H 4CJ2C 4G7OC 2K1BA 2K50A 2A73B 3CP0A 1VQPA 4RAUC 3W5OA 4HMIA 3D6WA 4MTNA 3T1HQ 2R3ZA 2XRSD 1SE4A 2JA5B 3A0JA 5K36H 2B2WA 2EQSA 4XYQA 3MEHA 5LMUL 4C3JG 3S17H 3HRZC 4F88A 1RODA 3I90A 2GA4B 5IOCA 5C0XJ 1A3VA 3NSWA 1MKHA 4ZLTF 4HMJA 1WCMG 5E4XA 2KHIA 3QB3A 4AH6A 2PQEA 5IP9H 1SEBD 2Y0SE 1AZQA 2EOTA 1Y1WG 1ZXTA 2CVRA 2UXDL 4N9TA 4B3RQ 5A35A 1TWGB 3J80L 2Z4HA 1B4OA 1NY4A 1DCZA 2F0LA 1S4ZA 4DR5Q 5IWAL 1KD1C 1RDPD 1YNJC 5T1GA 4Z9CB 5JPMC 3J7ZC 2DNCA 4IO9A 2K01A 4LUVA 2BH2A 2ZM6L 2N3SA 2QILA 3BZDB 2EE1A 2ID0A 3KJOA 1TVXA 2VQEL 3QG1A 1DOLA 2E74C 3AEVA 3PV0A 3L2PA 2DN8A 2A6ED 1UE5A 1HR0W 2EYPA 1A2TA 3MXPA 3A5ZB 4WFN3 4U673 1G51A 2NTSA 3G6JB 3RZDB 4LWCA 4OL7A 5HY6A 3ONAB 2V4DA 5GADC 4ALPA 3S1MH 4YCVA 4DV6Q 1OTCA 1XNRL 3CKIB 4PG3A 1TS2A 1ENFA 4X64L 1KNEA 1JICA 3X3NA 3VYSA 2NUCA 3OTOL 5FLMH 2E2JB 5HGQA 3S1MB 3OIQA 3RMHA 3KLSA 2HQLA 4NW2A 4BY1H 4HCSA 4H0LC 2L5TA 1JWUD 1V1PA 4H44C 5KRUA 1KLUD 1YI2A 2K04A 3FPUB 1TT2A 2PI2E 4ABNA 4DV2Q 5DEHA 2E2HH 1P16A 4DAVA 1B9MA 1CQFA 4BY1B 1UEAB 2LXJA 3M4QA 1MGSA 1DONA 3TQYA 2B2TA 1EZ6A 4BY7H 3LWEA 1G2TA 4DR1L 2HT1A 2E2HB 3STBC 4JI0Q 4I7ZC 2RSOA 1A2UA 5J3BA 4HR7B 3A8JE 5C0XI 4NXML 1TR5A 1YHQA 1ONLA 3I56A 2HUGA 4A3CG 3MEFA 2OTLA 2KECA 1S5DD 1SE8A 2AWOA 4BY7B 4O1NA 3DMUA 3VA7A 3J80E 1QZHA 4G57A 1GJXA 4TKOB 3MA2B 4UP8A 2M00A 1TS5A 3I4NB 4KD4A 3SHLA 4H13C 4PMWA 2NVXH 4IPGA 4RH6A 1A6XA 5IODA 2PW5A 3MC0B 2QKIC 3FP9A 1D1IA 3ULPA 5IYDH 3HEJA 3T1YL 2EPBA 3SK5A 4JYAL 2ES2A 2NN6H 4HSPA 3N52A 2PQAA 3S1RB 2ZJQA 2JN4A 3NTHA 3I4OA 2FXQA 3R8BA 1HHVA 4OEMB 4NXNL 1L2FA 5E3FA 1E0BA 2E2IH 4OX9L 1JOKA 1VQAA 1NBWA 4ZCKA 4B08A 3EVQA 3SVMA 4X62L 4WJ3M 3G6EA 4M8AA 5KYLA 1C8CA 2RVLA 2H5XA 3PO3G 3CPWA 4RKLA 3I4MH 3I73A 4HTHA 4HJ9A 3WOFA 4Q5VA 3JAML 4JI2L 4DR4Q 1FGBD 2IHEA 1H9RA 2F3IA 4C3IH 1YHBA 4DV7Q 2EY2A 1KDCA 3I4MB 1NTGA 4KK7A 2R7DA 1R9TB 1S3OA 2IX1A 1KC8C 4UDUC 2K5QA 1SNOA 2F0JA 4C3IB 1PA6A 2Q8TA 5JPNC 4DXFA 5TSSA 4DR2L 2K5HA 1PZJD 5HURA 4GLAC 5J22A 1KRTA 1EQQA 1YNND 1K8GA 1TIID 4JI3L 2H4OA 1LYLA 4IPDA 4GKKL 4DV5Q 3GTLH 1SNMA 3J81j 1QWYA 2QDBA 1XWEA 5E7NA 2DY8A 1EYDA 3MFGA 1A3TA 2B2UA 1VQNA 1EOVA 3MTSA 2BA1A 3M4OH 1PXUA 4PNYA 2WP8J 3H94A 4XYOA 3GTLB 1XTCD 4XQQA 2Q2UA 3K5LA 5FK9C 1I6VC 1L1OC 1GUSA 1QE6A 2B2VC 2M2LA 3Q22A 3HS0C 4A3MH 5ELOA 4LF7L 1HNZL 1L1OB 1YJ9A 4A3GG 5JEAH 4DV1L 2RF4A 5IT9L 1K8MA 2Q2IA 5LL6S 4N8FA 5C4ZA 2UU9Q 3S2DH 2AMCB 2F0KA 4IN3A 3UDIA 2KHSA 4WJWA 4A3MB 2IPKD 5IP7G 3HOZH 1NSNS 3HOVH 1SBBB 4EVOA 1IZ6A 2BCOA 1CFMA 5C5LA 3A55A 4AQYL 3CXCA 2N49A 4IUTA 2CKZB 1YJWA 2JJQA 3PCOB 3HOVB 3EROA 3DWPA 2OEOA 5D3IB 5KNCA 1Q90A 4YHHL 4I65A 3JAME 2NTTA 3C2PA 1ML0D 5I6YA 4ZAIA 3ULLA 5C4XB 1LLRD 1EY0A 2A6EC 2CQAA 4B3TQ 1I50H 4EQ5A 5C3EB 3PUXA 2B2YA 2UXCL 1U0LA 1BF4A 3FEWX 1G6ZA 4XIGS 4AIMA 2IY5B 4NMZA 4DV3Q 2ICEC 2NVYH 1PH9A 1HA6A 5JVH3 1WYDA 1CKNA 2O4XA 1I50B 5JEAJ 5FOBB 4JI4Q 2AWNA 2TMPA 3NQTA 1A63A 2AQ2B 4C1NK 5CC4A 4KHPL 1U4PA 1EY8A 2KCTA 2NVYB 1FGUA 4JK1C 1X65A 1CKMA 2ZJRA 2NN6I 3NQIA 5COYA 2UXBL 1PRTF 4IURA 3R93A 2NZOA 4HIDA 1I3QB 1F9PA 3MHBA 3PUWA 2A69C 1PDQA 3NXWA 4KKTA 4QUCA 3PIPA 3T16A 1STAA 2XN9C 4A3IG 2E5LL 3MXNA 4B9WA 1EYCA 4LF4L 5I2XA 2RHQB 3PUVA 2Z6BA 1QJOA 2R93G 5FJ8G 2JA6G 1SMXA 3A7AB 5FO7B 3HOUH 3B6YA 2UUCL 2KA7A 3W2DA 1F9SA 1Y1VH 5IT9E 1IL2A 4FNFA 2DNEA 1WTXA 3GTOH 1CSPA 1LTLA 2ZTDA 3OW2A 1JT8A 2NYZD 2VB3X 3WOEA 4A3BG 4JBKA 3M4PA 4IJHA 1JR0D 4GNXB 3HOUB 1DXMA 2ICIA 4L5QA 4B9XA 3HOYG 1O7IA 1PYSB 2O5JC 1AP0A 1JJGA 2HHHL 1PZID 2MPMA 3D4WA 4EQNA 2FMMA 4DN4M 1SSOA 1AFPA 3IL8A 4JI5L 3GTOB 1SYBA 1XTDA 2IX0A 1NNXA 1EEID 3F2BA 1U4LA 4C3JH 2ZXOA 1A8VA 2RDFA 4QB4A 1JB3A 1QUQB 1U4RA 1LT4D 3T53B 3H6MA 1V43A 1WCMH 4RCOA 4HN7A 2A68C 3DEOA 1SLJA 4C3JB 3VR6A 1IBLQ 5KIXA 2F0QA 4OHJA 1Y1WH 1PZKD 3I4LA 3PSIA 2JA7B 2Q8RE 4J6HA 3S14H 2DJGC 1GUOA 1WCMB 2A1AA 3F8TA 3CCLA 1EIHA 4K6DA 1JMCA 1Y1WB 2F0WA 1VQFA 4QCLA 5GAEC 4QJFA 3S14B 2UUBQ 1CTMA 1W6JA 1TWFB 2K4KA 3HP3A 1LT5D 1A0IA 2UUAL 3AFQA 1E7ZA 3CPFA 3UDGA 4LUZA 5EBDA 5AJ3L 1UE6A 2IX3A 3CCJA 1KIXA 2A6HD 3U4ZA 2JA8G 5A2QL 2AUJD 4YWMA 1R4PB 3R2TA 2B2YC 1VQGA 4ULLA 3RNUA 4BA2I 4BBRG 3J81E 3S16H 4J8QA 3TDQA 5M3MH 1X3QA 1Y8NB 3NBIA 2RDHA 5T1IA 1JWSD 1MBYA 5ELDA 3U9OA 3K5OA 3T1HL 2PZTA 5CORA 1KDAA 4J15A 1W6KA 4TVAB 1PFMA 2IT1A 3AQQA 3PO2B 2F0MA 4AYBE 2WINB 1UUPA 1KQSA 1HNWQ 4L5SA 5M3MB 2R61A 2QF7A 4LFCQ 1GUTA 2Y0SB 5JJKA 4RGNA 3RLNA 1XNQQ 2FJ2A 2N78A 5M3FG 3U9SA 1FR3A 3DWQA 3BDLA 5JJIA 3OHXC 5C44B 2JQOA 4QGUA 5EPLA 1RD9D 3OYYA 4B3RL 1B53A 2VZAA 3MWYW 3STBD 1QNUA 4FXKC 1YEZA 3HGBA 1R4QB 1ZEQX 3SXHA 2K33A 1KLGD 5C4JB 1VQMA 4FF2A 4PQXA 4KY6A 4OWXB 4A3CH 3ND8A 1S5BD 4L5RC 2EXDA 1VQ9A 1EU4A 3K81C 2Z6KC 3S9WA 2B3GA 2DJFC 4J1MA 1HZ9A 1KNAA 1S40A 4AYBG 2V1CC 1SN8A 5DNFA 1JQYD 2KVMA 3H0GG 1BKBA 4IQZA 1SYDA 4A3KH 3GTPH 3IRBA 3K7UC 1PH2A 1IBML 4A3DG 2RCFA 1JCKB 4DV6L 2QDLA 1I4GA 5EGTA 3GTKH 5CMDA 1VQJA 1O78A 4R4CA 1RIPA 1GD7A 1K9MC 2K14A 4A3KB 2WV6D 5CYUA 3HG9A 1HPCA 5A2QE 4APVA 4X3UA 2MQHA 1II3A 4C3HG 3NUCA 1EFWA 5I6WA 4MHEA 1BBUA 1VQLA 1O7ZA 2PYKA 4IOAA 4C56C 3BVZA 1EY7A 3PUZA 4DV2L 1L0WA 1RJTA 4DR6L 5LHY1 3JAMi 4RGTA 4PV1C 1DD2A 1IKLA 1AEXA 4JI8Q 3SDZA 4YCUA 5NUCA 2VXWA 1PH4A 1BDOA 5JVG3 1TQOA 2BOSA 3I8ZA 3OPOA 3UE1A 1CQVA 4HJ8A 1OO9B 2AQ1B 4JI0L 2NZ1D 1CA6A 2YTVA 4NB3A 1YITA 2ATWA 4Y52H 3TP8A 4BBSH 4P74A 2F03A 3K8AA 1TXYA 4DUYQ 2GVAA 5EAYA 2KEDA 2VQFL 4YWKA 1WD0A 3S2HH 3HOWG 1GOZA 2RHSB 4HJAA 3BU2A 4UHVA 4FF1A 3OSOA 4DNRB 4GOPA 4BBSB 1NCVA 3BZKA 1B3AA 2K05A 3FPPA 1HCZA 2RCNA 1HRJA 2L0CA 4ZRZA 3F2CA 2HIVA 1IBKQ 1J5EQ 5M5WH 4DK3C 4KJNA 3NBHB 1X54A 3DLLA 3C46A 2RQXA 1G6PA 1EYGA 2G9DA 3ERQA 1GKHA 3RZOH 3GQBA 5EJWA 1M1KC 1ASYA 1DOKA 1KAWA 3CCMA 2XTIA 4A3GH 2HIXA 4JI7Q 1F2ZA 3TREA 3PF4A 2PMZE 4GLVB 3S17B 2F0TA 1PHJA 3P20A 1VDZA 1EWHA 3RZOB 2OXPA 4A3JH 5KYIA 1M90C 4RFBA 1SJED 4L8JA 1WTQA 1EQRA 5ELNA 4A3GB 1T5EA 3KLRA 3KBGA 4NDXA 4NPSA 3NWTA 4DR4L 2KUMA 1QVCA 1A62A 2K75A 1F77A 4A3JB 4ODGA 2OF1A 2PW7A 2FHTA 4YY3Q 2F0FA 1NUCA 1HZAA 2KJXA 4JI6L 1IHZA 2PPBC 1JE4A 3J80c 4X3KA 1RTNA 1Y8OB 4DNTB 3TP6A 4K2KA 1JB7A 4MNOA 1N34L 4A3FG 2A6HC 2E75C 4DV5L 2SDFA 2CWPA 4DAMA 4B3SQ 4KHZA 2C9OA 2WFWA 2EZVA 3LWUA 1N33L 3PIO3 3OOCA 3WWVA 4EQPA 1JJ2A 2HCCA 1EFID 1XMOQ 1VQEA 4KTAA 3J7A5 4DAYA 4GKJL 1I94Q 1SRUA 1HUNA 1PTOH 2JEAI 3MXUA 5IGGA 3A8IE 4IFDI 1V8QA 1X3EA 4HEDA 1AN8A 1PYWD 4C1NI 1E2ZA 3Q8DA 1PTOC 5H1SE 1HZBA 4LF6L 4A93G 4IUPA 4KJOA 3KF8B 5HGTA 3KJPA 2A69D 1EIYB 2Q2HA 4XDXA 4FXDA 3X3MA 2UU9L 2GVBA 4HIMA 3MZ5A 5FJ8H 3KLSX 2JA6H 2R93H 1ET6A 5IGEA 2WB1E 1PH5A 4FYDA 3L9AX 4JI1Q 4RGMA 1KDBA 1Q1BA 4JV5Q 2DUDA 2F4IA 2ZXRA 3UDFA 1WTPA 3RR5A 2K32A 1EIFA 4POGA 3G4SA 4A3BH 3HOYH 2K6AA 3CMEA 1SFOH 4GOPC 3K5MA 3CQZH 2D0PA 1LUZA 3TBIB 1Y69U 3CC7A 3A8KE 1IW7D 4DR7Q 1DYQA 2B2WC 1TS3A 4B3TL 3S15H 1SYEA 2XNAC 5BN5A 1E22A 1PH7A 2HCIA 3SE0A 4GS3A 3ICEA 2EJFC 3E6ZX 4IFDG 3I3CA 1HA5A 1SFOB 1Q82C 2F4VQ 5DLQE 2WAQB 2NVXB 4IUVA 4K5WA 4DV3L 2A68D 2H1EA 2PCFB 5CV8A 3TMEA 3EN2A 3TEHB 1ZKOA 4DNIA 3S15B 3I70A 5ELFA 4X6AH 4JI4L 1SYFA 2F0VA 4KN7C 3W1GA 5C4HA 1V1OA 3KDFA 2WB1G 4LJZC 2ZXPA 4MZ9A 1JOOA 1LTSD 1K83H 3M3YH 2PO4A 2R92G 2PNRC 1STYA 3TP5A 3AMUA 4R4OA 2XWBB 3IKJA 2NBFA 1HZCA 2E2IB 2MNAA 1FNUA 1VS0A 1FD7D 1EY9A 4PZ8A 4CHTB 3GTMH 1I4QA 2EY5A 2VNUD 1K83B 3M3YB 3CU7A 5KGUA 2VUMG 4IUUA 1WJJA 2LY7A 4OO1G 1HUMA 1LTRD 1Z9FA 1XX8A 2B63G 2D9UA 3BG3A 4BXXG 5ELEA 3GTMB 4L6TB 4GZYC 1H9MA 4XQJA 2JA8H 2C35B 1D5XC 3JAMc 1SDFA 5IE8A 1WTOA 1HQRD 4BBRH 3HKZB 4JCVE 4CBVA 1N36Q 3P7JA 4RWSC 3D31A 3NTIA 2OCEA 3WDNA 3PQIA 4BBRB 2ZTCA 1CZGA 1XPOA 4CDFC 4GNXA 1PFSA 4GLXA 5ELBA 1ICWA 3TZDA 1BBXC 1N8RC 3I2ZA 3DM3A 5CBEE 3BYYB 2K03A 1UE1A 3KLWA 3V2TA 5M3FH 2R7ZH 3SK8A 4TSSA 2D5DA 1YVCA 3M4OB 1V1PB 2K5NA 3M85A 1T9HA 3M4YA 5FLXE 1STEA 1TY0A 2IW3A 3OTOQ 2K5WA 1I4RA 1IYJB 1GXDC 2B2TC 3M9BA 2SEBD 3LX0A 5K36G 3BJUA 1OXTA 1SJHD 4CKBA 4JBMA 2R7ZB 5ELCA 3CC2A 2MUYA 1WOCA 2MP1A 1EUJA 1TKWB 1JE5A 2F0SA 4R4QA 2UUBL 4RMFA 3S2DB 2E76C 5IT9c 2F0UA 3Q0AA 3HOZB 1F9RA 4G4KA 4JOIA 4BWGB 1C9OA 2R6GA 1VQDA 3HFZB 1OXXK 3FDTA 3H0GH 1WTRA 1D8LA 3AU7A 2SNSA 3FVQA 3VA5A 5JAVA 4A3DH 4NXMQ 3ULJA 1SE3A 4AYBB 2B8FA 4DXGA 3IFTA 3BYTB 3F1ZA 3EIVA 3S1NH 4MIUA 1UAPA 3RLFA 4A3DB 3LGJA 3E0EA 2PQAB 4C3HH 1BR9A 4LFCL 2RSNA 1VQ5A 3MFYA 4KY5A 1PFBA 5IYBG 2EY6A 4OONA 3CCVA 1DOMA 3S1NB 1HH2P 4YIJA 5LMNQ 1TU2B 4LF5Q 1XNQL 3QR8A 4KN4C 5EKKA 3KF6A 4X66Q 3H91A 4C3HB 1QVGA 1BCPC 1B70B 3SK6A 3J7AV 2CQOA 4X65Q 1PH3A 2JP1A 2XWJB 1M4VA 4R1JA 1QILA 4F7XA 4OX9Q 4ZKCB 4LFAQ 3RN5A 2NVTH 4HIKA 4L5TA 3Q23A 3J81L 1H95A 1D5ZC 1S5CD 5CBAE 3KUPA 1I4PA 3P1HA 2RA4A 1Q3LA 1GVPA 5CV5A 4CDDC 3G7LA 2CW0D 5BR8Q 2OQKA 2EY1A 1SYGA 1YZ6A 2NVTB 1JOQA 3CCUA 1UEBA 3HOWH 3R2IA 4JI2Q 1Z6HA 3CMAA 1I4XA 2TSSA 1NR4A 4C2MH 2B2UC 1Y1VB 3J81c 3DWAA 1W3SA 2F52A 1Q7YC 2ZTEA 2P5ZX 4UY8C 1IW7C 4IALA 1G91A 3I4NG 1U5KA 3A54A 4G7HC 4LK1C 3Q6SA 2N8NA 1EWIA 4KY7A 4JI3Q 3CF5A 1K8OA 3NPPA 4N9PA 1SYCA 1O7YA 1ZYRC 1AW7A 1K3RA 1Q8IA 1N32Q 3HOXG 1LTGD 1E2WA 3L7ZC 3GV6A 4GN4B 3J80i 2I07B 4N8X1 4XTCS 5EQ0A 1EQVA 2VS1A 5CV7A 1SE2A 1VQKA 1B50A 4JI8L 2K5VA 3W3AA 1JC7A 2B29A 4FO2A 1NMGA 3BDOA 1VQ8A 2HD3A 1B1ZA 3K80C 3FRPB 4LF8Q 2GN5A 3T51B 4NP5A 4QUFA 1TS4A 2I5MX 3TN2A 1PH8A 1KABA 3CRKC 4LF9Q 3I4MG 5DM63 4DUYL 1KTKA 3T56B 1UWVA 3AFPA 2AQ3B 1NJIC 2PZWA 4C3IG 3F2DA 2BH8A 2MGSA 2XIWA 2KCMA 1LTTD 4DV4Q 3FKIG 1V9PA 3GD7A 1VQ4A 4ZQ3A 2KQ3A 4P73A 4LNQA 1G291 3H09A 1IBKL 3I91A 4CJ1B 1H9SA 2ASBA 1TWCH 1CUKA 3C3LA 1WTHA 2J0TD 1CKNB 2PMZB 4WRDA 2Z1CA 1PV4A 3S16B 2EYOA 1PTOD 4A93H 1HNXQ 3W1BA 2A5HA 4H02A 5I2YA 4EX5A 4JW0A 4DU9A 3KBXA 4JI7L 4MTKA 2C5CA 2BA0A 3E9HA 4QY7A 1LACA 1CKOA 2D2CC 3V05A 1VQBA 1XMQQ 1OXVA 2F0HA 1STNA 4IPHA 1LV9A 4KI0A 5IYCG 4DR5L 2JK8A 2B39A 3MXNB 1WD1A 3K6OA 4OWWB 2IHFA 2L12A 1RCVD 1ESFA 1QCBD 2OQ0A 3D3RA 1BO0A 1LABA 4HCEA 1H9KA 1HJPA 1FVIA 1EY6A 3ND9A 2RBMA 1C48A 4QIWE 5CR3A 4K14A 3QIAA 3CW2C 3ZJYC 2A8VA 2NZHA 3QJYA 2EJGC 2YYZA 4ZUIA 3HOVG 4IFDH 5EKIA 3RD4A 4B3SL 1SROA 3HZXA 3PIOA 1BQQT 5M5YH 2KENA 4R8NA 5IGFA 1X6OA 5C4XG 3CC4A 1Z47A 1PMRA 1XMOL 3GTPB 4JBWA 3E5SA 2OT2A 2LFNA 5C3EG 2VL6A 1ILQA 4DV0Q 1I94L 4OIJA 3KOJA 2EIFA 4GN5A 3GTKB 2Z4IA 1FYCA 1B9NA 3PMFA 5M5YB 3E9IA 4RCNA 3PO3H 2NVQH 2R92H 1K8AC 4FVMA 4KKSA 4R4IA 3JC66 2A19A 1CHPD 2WB1B 4K0KQ 1TWHH 3RLOA 3I55A 1GHKA 1VF7A 1YBYA 2G5DA 1PYBA 4MN3A 4LFBQ 3PO3B 2VUMH 2NVQB 3CCQA 3GTQH 2E2DC 1YIJA 2L1BA 4X3TA 5EPJA 4OO1H 1KRSA 2I46A 4P72A 1K0RA 1B2TA 1QZGA 2B63H 1YJNA 1TWHB 4QMGA 2IL8A 4JI1L 4DGZA 1IYUA 4JV5L 1MI2A 3SR1A 5C3WA 4K2LA 1D5MC 3SGIA 4I7AA 2CFMA 1IKMA 4IFDJ 2CW0C 2F0OA 2JEBI 3TS0A 1L0XB 2B63B 5I9PA 3D6CA 4CKCA 3HKSA 2EYLA 2G9HD 5EKLA 2K28A 4KHVA 4DR7L 1GM5A 4DR3Q 3MXGA 1B3QA 4BS9A 3S2HB 3NE5B 1ASZA 2MFIA 4CJ0B 2R7FA 3BDCA 1J6QA 2X6GA 4OGQC 2F3VA 1XPRA 4DK1A 5M5WB 2E8GA 1F9QA 2QEXA 4FF3A 2IJ0A 3OIPA 4P71A 1EU3A 2DY7A 5D65A 3GDEA 4CDCC 3S1QH 4DUZQ 1IYVA 1FNVA 1STGA 5IP7H 2KEEA 5G3LD 4ZKBB 2OTJA 1PVOA 3LNNA 2JA7G 3O13A 1TWGH 3S1QB 4LMQD 1S5FD 1HTPA 5KNBA 4EGVA 4DV7L 2BE5C 1EWCA 4UPAA 1CHQD 3V96A 4KMUC 5IGBA 3QO2A 5ISRA 3D4RA 4LW1A 1YHAA 4FDBA 4DPGA 3A74A 3TSSA 2JA9A 4O42A 1BNZA 1IL8A 1FNWA 2PNHA 4FP5D 1QNKA 2CWAA 1D7QA 2SOBA 1KXLA 1N36L 2NWGA 1U9RA 1CK1A 4A4IA 1VMCA 4U68A 4IUNA 2MJ8A 2F0PA 2X6LA 3RZDH 4B3MQ 1I4HA 1GO3E 4IPCA 4TRDA 1RHPA 1BOSA 1X55A 2QGQA 1VQ7A 2Z0SA 5IYBH 2I5LX 3F2UA 4JC0A 2E2JH 4EQOA 1MJCA 3TP7A 3NTKA 1IBMQ 3PO2G 2QW7A 5C5MA 4P2CB 1BCPD 1LTID 3K58A 1VQCA 2QA4A 5M3MG 4V190 3TZUA 1J8IA 4LAAA 1S72A 4K5XA 2Y0SG 4R4TA 1PTOB 1DJRD
chains in the Genus database with same CATH topology
5C3XA 2L4NA 3GP7A 5J1ZA 4F8MA 4FXGC 1EY4A 2EYFA 5C6AA 3MVVA 4ME5A 3A56A 4V0BA 5DAUA 2L55A 2B2VA 4A3IB 1Z7TA 1KAAA 5EPKA 2XVSA 1SNPA 1Q12A 2R93B 2YU9B 2JA6B 2N88A 4E6IA 4G7ZC 3OW7A 1GHJA 1T5XD 2L11A 2EYHA 1VCIA 1HXYD 1HQMC 3OWFA 2MHVA 1AZPA 4OO1I 3I72A 4ILWA 5BN4A 5IIFA 3DM1A 1MD2D 4A3BB 3HOYB 5FLXL 1BXTA 1SAPA 2F0IA 3CQZB 1EY5A 4PMCA 4XT1B 3D8GA 4H7BA 2F0DA 1J9OA 1ZYRD 3N6RA 3EA6A 1G2SA 2JXMB 1Y8PB 1A15A 4K8JA 5CGKA 3EFXD 4DF7A 3DHQA 4F87A 1F2LA 1OXUA 3HOXB 2XRQD 1LTBD 2LS01 4ZUJA 1XXGA 5JJZA 1RF2D 2EYJA 1EOTA 2LMCB 3VR2A 5C0XG 3GTGB 1SNDA 1QOHA 2F0GA 1PRTC 4Y7NB 3T13A 3C1FA 1GUNA 3P75A 2L9HA 2JA8B 1LTAD 1PRTB 1JORA 2B8GA 2F3WA 2EDGA 4RKBA 1PTOF 3FKIB 2HDMA 2QCPX 3SK4A 3SEBA 3VYTA 4DAPA 2M9VA 3E0JA 1LO5D 2O2LD 2J7ZA 3CHBD 1S5ED 3DEPA 2SNMA 2N55A 3NP8A 1GUWA 1M8AA 5M3FB 1OXSC 2WIIB 1MSGA 3QOJA 5KEEA 1CA5A 5FO9B 3NHHA 1WTVA 2ENBA 1F2YA 5LL6X 4NKLA 1BUVT 3VYUA 1PLFA 5AFWA 3M7GA 1SMYD 1EQTA 5IGCA 4KKUA 4BA1I 2KCCA 4HSVA 1CI3M 5EBCA 3VR3A 5D14A 1STHA 4DFAA 4L63B 3H0GB 2XSCA 1MSHA 3OMCA 2O5IC 1D1KA 1ESRA 3KK7A 1CM9A 4FF4A 2J4XA 1QG7A 2A74C 1C4QA 1F2MA 2IWHA 2VB2X 2HQEA 5K5PA 2BDOA 4ID6A 4XT3B 1JWMD 1ILPA 1EZ8A 1BCPB 3T4AC 4QIWB 1G8ZD 2FINB 2K7VA 3H3VC 3URYA 1ET9A 4R9WA 3K5NA 1LT6D 5IGDA 3VYRA 3K57A 1E2VA 1LT3D 3QOLA 4ZYSA 4K6LA 2ZT9C 1UNSA 1EIGA 3MAQA 1GUGA 1NAPA 1WVLA 5FKAC 3AB9A 3EJIA 3BS1A 3HOWB 3OMGA 3NK9A 3L3OC 4K8IA 4C2MB 1EEFD 2KOLA 1PTOB 3OWEB 1X3PA 5DM73 5I4DA 3DXJC 5E1FA 1EYAA 1VF5C 1XYIA 5I9OA 5G3LF 1U4MA 2JYOA 2NN6G 3EQLC 2BE5D 2K5DA 3K0YA 2X69A 1HTLD 5J39A 5CV6A 1STBA 3BVGA 2JSOA 1YNJD 1TWAB 1RKNA 3C1EA 4X3SA 2RKSA 2WKCA 2NB0A 4HAEA 3J7YW 5JOBA 3ZYYX 4RGOS 1VMPA 3GV3A 4A3FB 1QB5D 4CGYB 4RHRA 1EL0A 2F1MA 3QWNA 1X32A 1ENCA 2Q8IB 2JE6I 1WTWA 4WORA 2WKDA 1DM0B 1CZWA 1YNNC 1BCPF 1TWCB 5D3DA 4UAIA 2PZUA 3J7AF 2LKVA 3NBHA 5CV4A 2WACA 4A93B 3VR5A 2EVBA 5M9OA 1RTOA 4OIKA 1I6HB 4IZ8A 3PUYA 5M5XB 1PFNA 5E4WC 3GTJB 3ITPA 1Q1EA 4KV6A 4CKEA 5JEAG 3M7NA 2EJMA 5KNDA 2QEJC 1SNCA 2D62A 3FMCA 1SMYC 3GO5A 3PIP3 3NWSA 4DA2A 4ZK9B 3A7LA 4TQUS 3K59A 3UI2A 3VR4A 4Q0FA 1SXTA 1HFNA 4XQNA 1TY2A 3D4DA 4RA8A 1D6EC 2F0EA 5F2DA 1CT1D 4DK0A 2FMCA 3IFDA 1O80A 1DZ1A 2CHBD 4RHSA 4XXEA 2FFKB 3BVMA 4PMBA 3DUZA 1HFGA 1B44D 3K7AB 1H9JA 5CV9A 2AUKA 4M1UB 4QF4A 2BDNA 2R92B 1L0YB 1ENAA 3R3OA 2RDGA 4IUQA 1SNQA 3KF8A 5BN3A 5C0XH 1A3UA 3IAYA 2KCNA 2VUMB 2F0NA 3GTQB 2HDLA 5FO8B 1PRTD 3CRLC 3Q24A 2EYMA 1D2BA 4KD3A 4S3SA 3RUZA 4K5VA 4A3EB 2EXZA 1O7LA 2Z8LA 1H9SB 4R8IA 4CJ2C 4G7OC 2K1BA 2A73B 4RAUC 4HMIA 3D6WA 2R3ZA 2XRSD 1SE4A 2JA5B 5K36H 2B2WA 4XYQA 3MEHA 4C3JG 3HRZC 4F88A 1RODA 3I90A 2GA4B 5IOCA 5C0XJ 1A3VA 3NSWA 4ZLTF 4HMJA 5E4XA 3QB3A 2PQEA 1SEBD 1AZQA 2EOTA 1ZXTA 2CVRA 4N9TA 5A35A 1TWGB 3J80L 2Z4HA 1B4OA 1DCZA 2F0LA 1S4ZA 1RDPD 1YNJC 5T1GA 4Z9CB 5JPMC 2DNCA 2K01A 2QILA 3BZDB 2EE1A 2ID0A 1TVXA 1DOLA 3QG1A 2E74C 3PV0A 2DN8A 2A6ED 2EYPA 1A2TA 3MXPA 4WFN3 4U673 2NTSA 3G6JB 3RZDB 4OL7A 3ONAB 2V4DA 3CKIB 1TS2A 1ENFA 1KNEA 1JICA 3X3NA 3VYSA 2NUCA 2E2JB 3S1MB 3OIQA 3RMHA 3KLSA 4NW2A 4HCSA 4H0LC 2L5TA 1JWUD 1V1PA 4H44C 5KRUA 1KLUD 2K04A 3FPUB 1TT2A 4ABNA 5DEHA 4DAVA 1B9MA 1CQFA 4BY1B 1UEAB 1MGSA 1DONA 2B2TA 1EZ6A 3LWEA 1G2TA 2E2HB 4I7ZC 2RSOA 1A2UA 4HR7B 3A8JE 5C0XI 1TR5A 1ONLA 2HUGA 2KECA 1S5DD 2AWOA 4BY7B 4O1NA 3DMUA 3VA7A 3J80E 4G57A 1GJXA 4TKOB 3MA2B 2M00A 1TS5A 3I4NB 4KD4A 3SHLA 4H13C 4PMWA 4RH6A 1A6XA 5IODA 2PW5A 3MC0B 2QKIC 1D1IA 3HEJA 2EPBA 3SK5A 2NN6H 4HSPA 3N52A 3S1RB 3NTHA 3R8BA 1HHVA 5E3FA 1E0BA 1JOKA 4B08A 3EVQA 3SVMA 4M8AA 5KYLA 1C8CA 2RVLA 4RKLA 3I73A 4HTHA 3WOFA 4Q5VA 3JAML 1FGBD 1H9RA 2EY2A 1KDCA 3I4MB 4KK7A 1R9TB 2IX1A 4UDUC 2K5QA 1SNOA 2F0JA 4C3IB 2Q8TA 5JPNC 4DXFA 5TSSA 1PZJD 5HURA 5J22A 1YNND 1TIID 2H4OA 1SNMA 1QWYA 2QDBA 1XWEA 2DY8A 1EYDA 3MFGA 1A3TA 2B2UA 3MTSA 2BA1A 1PXUA 4PNYA 2WP8J 3H94A 4XYOA 3GTLB 1XTCD 4XQQA 3K5LA 5FK9C 1I6VC 1GUSA 1QE6A 2B2VC 2M2LA 3Q22A 3HS0C 5JEAH 5IT9L 1K8MA 5LL6S 5C4ZA 2F0KA 4IN3A 2KHSA 4WJWA 4A3MB 2IPKD 1NSNS 1SBBB 4EVOA 2BCOA 1CFMA 5C5LA 3A55A 4IUTA 3HOVB 3EROA 3DWPA 2OEOA 5D3IB 5KNCA 1Q90A 4I65A 3JAME 2NTTA 3C2PA 1ML0D 5I6YA 4ZAIA 5C4XB 1LLRD 1EY0A 2A6EC 2CQAA 5C3EB 3PUXA 2B2YA 1BF4A 3FEWX 1G6ZA 4XIGS 4NMZA 2ICEC 1HA6A 5JVH3 2O4XA 1I50B 5JEAJ 5FOBB 2AWNA 2TMPA 3NQTA 2AQ2B 4C1NK 5CC4A 1U4PA 1EY8A 2NVYB 4JK1C 2NN6I 3NQIA 5COYA 1PRTF 4IURA 3R93A 1I3QB 1F9PA 3MHBA 3PUWA 2A69C 1PDQA 3NXWA 4KKTA 4QUCA 3T16A 1STAA 2XN9C 3MXNA 4B9WA 1EYCA 5I2XA 3PUVA 1QJOA 5FO7B 3A7AB 2KA7A 3W2DA 1F9SA 5IT9E 4FNFA 2DNEA 1WTXA 2NYZD 2VB3X 3WOEA 1JR0D 3HOUB 2O5JC 1DXMA 2ICIA 4B9XA 1AP0A 1PZID 2MPMA 3D4WA 4EQNA 2FMMA 4DN4M 1SSOA 1AFPA 3IL8A 3GTOB 1SYBA 2IX0A 1EEID 1U4LA 2ZXOA 2RDFA 4QB4A 1JB3A 1U4RA 1LT4D 3T53B 3H6MA 1V43A 4RCOA 4HN7A 2A68C 3DEOA 4C3JB 3VR6A 5KIXA 2F0QA 4OHJA 1PZKD 3I4LA 2JA7B 2Q8RE 4J6HA 1GUOA 1WCMB 1EIHA 4K6DA 1Y1WB 2F0WA 4QCLA 3S14B 1CTMA 1W6JA 1TWFB 3HP3A 1LT5D 5EBDA 2IX3A 2A6HD 5A2QL 2AUJD 1R4PB 3R2TA 2B2YC 4ULLA 4BA2I 3J81E 4J8QA 3TDQA 1X3QA 1Y8NB 3NBIA 2RDHA 3U9OA 1JWSD 1MBYA 5T1IA 5ELDA 3K5OA 2PZTA 5CORA 1KDAA 1W6KA 1PFMA 2IT1A 3PO2B 2F0MA 2WINB 1UUPA 5M3MB 2R61A 2QF7A 1GUTA 2Y0SB 4RGNA 2FJ2A 3U9SA 1FR3A 3DWQA 3BDLA 3OHXC 5C44B 5EPLA 1RD9D 1B53A 3MWYW 1QNUA 4FXKC 3HGBA 1R4QB 1ZEQX 3SXHA 2K33A 1KLGD 5C4JB 4FF2A 4PQXA 4KY6A 3ND8A 1S5BD 1EU4A 3S9WA 4J1MA 1KNAA 5DNFA 1JQYD 2KVMA 4IQZA 1SYDA 1JCKB 1I4GA 5EGTA 5CMDA 1O78A 4A3KB 2WV6D 5CYUA 3HG9A 1HPCA 5A2QE 4X3UA 1II3A 4C3HG 3NUCA 5I6WA 4MHEA 1O7ZA 2PYKA 4C56C 3BVZA 1EY7A 3PUZA 1RJTA 5LHY1 4RGTA 4PV1C 1DD2A 1IKLA 1AEXA 3SDZA 5NUCA 2VXWA 1BDOA 5JVG3 1TQOA 2BOSA 3I8ZA 3OPOA 1CQVA 1OO9B 2AQ1B 2NZ1D 1CA6A 3TP8A 2F03A 2KEDA 1WD0A 1GOZA 4FF1A 3OSOA 4DNRB 4BBSB 1NCVA 1B3AA 2K05A 3FPPA 1HCZA 1HRJA 2L0CA 4ZRZA 4KJNA 3C46A 2RQXA 2G9DA 3ERQA 3GQBA 5EJWA 1DOKA 1F2ZA 3S17B 2F0TA 3P20A 1VDZA 1EWHA 3RZOB 2OXPA 5KYIA 4RFBA 1SJED 4L8JA 1WTQA 4A3GB 1T5EA 3KLRA 3KBGA 4NDXA 3NWTA 2KUMA 1F77A 4A3JB 4ODGA 2OF1A 2PW7A 2FHTA 2F0FA 1NUCA 2KJXA 1IHZA 2PPBC 1JE4A 4X3KA 1RTNA 1Y8OB 4DNTB 3TP6A 4K2KA 2A6HC 2E75C 2SDFA 4KHZA 2C9OA 2EZVA 3LWUA 3PIO3 3OOCA 4EQPA 2HCCA 1EFID 4KTAA 4DAYA 1HUNA 1PTOH 2JEAI 3MXUA 5IGGA 3A8IE 4IFDI 1V8QA 4HEDA 1AN8A 1PYWD 4C1NI 1E2ZA 1PTOC 4IUPA 4KJOA 5HGTA 2A69D 4XDXA 4FXDA 3X3MA 3MZ5A 3KLSX 1ET6A 5IGEA 4FYDA 3L9AX 4RGMA 1KDBA 1Q1BA 2F4IA 2ZXRA 1WTPA 2K32A 2K6AA 3K5MA 3TBIB 1Y69U 3A8KE 1IW7D 1DYQA 2B2WC 1TS3A 1SYEA 2XNAC 5BN5A 2HCIA 3SE0A 2EJFC 3E6ZX 4IFDG 3I3CA 1HA5A 1SFOB 2NVXB 2WAQB 4IUVA 4K5WA 2A68D 2H1EA 2PCFB 5CV8A 3TMEA 1ZKOA 3S15B 3I70A 5ELFA 1SYFA 2F0VA 4KN7C 5C4HA 1V1OA 4LJZC 2ZXPA 1JOOA 1LTSD 2PO4A 2PNRC 1STYA 3TP5A 3AMUA 2XWBB 3IKJA 2NBFA 2E2IB 1FNUA 1FD7D 1EY9A 4CHTB 1I4QA 2EY5A 2VNUD 1K83B 3M3YB 3CU7A 5KGUA 4IUUA 2LY7A 4OO1G 1HUMA 1LTRD 1XX8A 2D9UA 3BG3A 5ELEA 3GTMB 4L6TB 4GZYC 1H9MA 4XQJA 1D5XC 1SDFA 1WTOA 1HQRD 3HKZB 4CBVA 3P7JA 4RWSC 3D31A 3NTIA 3WDNA 4BBRB 1CZGA 5ELBA 1ICWA 3TZDA 1BBXC 5CBEE 3BYYB 2K03A 3V2TA 3SK8A 4TSSA 2D5DA 3M4OB 1V1PB 3M85A 5FLXE 3M4YA 1STEA 1TY0A 2IW3A 2K5WA 1I4RA 1GXDC 2B2TC 2SEBD 3LX0A 5K36G 1OXTA 1SJHD 4CKBA 2R7ZB 5ELCA 2MUYA 2MP1A 1TKWB 2F0SA 3S2DB 2E76C 2F0UA 3Q0AA 3HOZB 1F9RA 4G4KA 4BWGB 2R6GA 1OXXK 3FDTA 1WTRA 3AU7A 2SNSA 3FVQA 3VA5A 5JAVA 1SE3A 4AYBB 2B8FA 4DXGA 3IFTA 3BYTB 4MIUA 1UAPA 3RLFA 4A3DB 1BR9A 2RSNA 3MFYA 4KY5A 1PFBA 2EY6A 1DOMA 3S1NB 4YIJA 1TU2B 4KN4C 5EKKA 3H91A 4C3HB 1BCPC 3SK6A 3J7AV 2JP1A 2XWJB 1M4VA 1QILA 4F7XA 4ZKCB 3Q23A 3J81L 1S5CD 1D5ZC 5CBAE 3KUPA 1I4PA 3P1HA 2RA4A 1Q3LA 5CV5A 3G7LA 2CW0D 2EY1A 1SYGA 2NVTB 1JOQA 3R2IA 1Z6HA 1I4XA 2TSSA 1NR4A 2B2UC 1Y1VB 3DWAA 1IW7C 4IALA 1G91A 3A54A 4G7HC 4LK1C 3Q6SA 4KY7A 1K8OA 3NPPA 4N9PA 1SYCA 1O7YA 1ZYRC 1AW7A 1Q8IA 1LTGD 1E2WA 3L7ZC 3GV6A 2I07B 4XTCS 5EQ0A 1EQVA 5CV7A 1SE2A 1B50A 3W3AA 1JC7A 4FO2A 3BDOA 1B1ZA 3FRPB 3T51B 4NP5A 4QUFA 1TS4A 3TN2A 1KABA 3CRKC 5DM63 1KTKA 3T56B 2AQ3B 2PZWA 4C3IG 2MGSA 2XIWA 1LTTD 3GD7A 4ZQ3A 2KQ3A 1G291 3H09A 3I91A 4CJ1B 1H9SA 3C3LA 2J0TD 2PMZB 4WRDA 3S16B 2Z1CA 2EYOA 1PTOD 2A5HA 5I2YA 4DU9A 3KBXA 2C5CA 2BA0A 1LACA 2D2CC 3V05A 1OXVA 2F0HA 1STNA 1LV9A 4KI0A 2B39A 1WD1A 3K6OA 2L12A 1RCVD 1ESFA 1QCBD 3D3RA 1BO0A 1LABA 4HCEA 1H9KA 1EY6A 5CR3A 2RBMA 1C48A 3ND9A 4K14A 3QIAA 3QJYA 2EJGC 2YYZA 4ZUIA 4IFDH 5EKIA 3RD4A 3HZXA 1BQQT 4R8NA 5IGFA 1Z47A 1PMRA 3GTPB 4JBWA 3E5SA 2OT2A 2LFNA 1ILQA 4OIJA 3GTKB 2Z4IA 1FYCA 1B9NA 3PMFA 5M5YB 4RCNA 4FVMA 4KKSA 1CHPD 2WB1B 1GHKA 1VF7A 4MN3A 3PO3B 2NVQB 2E2DC 2L1BA 4X3TA 5EPJA 4OO1H 2I46A 1B2TA 1TWHB 4QMGA 2IL8A 4DGZA 1IYUA 1MI2A 3SR1A 5C3WA 4K2LA 1D5MC 1IKMA 4IFDJ 2CW0C 2F0OA 2JEBI 1L0XB 2B63B 5I9PA 3D6CA 4CKCA 2EYLA 2G9HD 5EKLA 2K28A 4KHVA 3MXGA 4BS9A 3S2HB 3NE5B 4CJ0B 3BDCA 2X6GA 4OGQC 2F3VA 4DK1A 5M5WB 1F9QA 4FF3A 2IJ0A 3OIPA 1EU3A 2DY7A 5D65A 1IYVA 1FNVA 1STGA 2KEEA 5G3LD 4ZKBB 3LNNA 3O13A 3S1QB 4LMQD 1S5FD 5KNBA 1HTPA 4EGVA 2BE5C 1EWCA 1CHQD 3V96A 4KMUC 5IGBA 3QO2A 5ISRA 3D4RA 3TSSA 4O42A 1BNZA 1IL8A 1FNWA 4FP5D 1QNKA 2SOBA 2NWGA 1U9RA 1CK1A 1VMCA 4U68A 4IUNA 2MJ8A 2F0PA 2X6LA 1I4HA 4TRDA 1RHPA 1BOSA 3F2UA 4EQOA 3TP7A 3NTKA 5C5MA 4P2CB 1BCPD 1LTID 3K58A 4V190 1J8IA 3TZUA 4LAAA 4K5XA 1NR2A 1DJRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E0B A;  2BDN A;  1NR4 A;  1VMP A;  2K28 A;  1ILP A;  2L9H A;  1KNA A;  2B2U C;  2L4N A;  3GV3 A;  2B2T C;  1DOL A;  2Q8R E;  5DNF A;  2KVM A;  3SVM A;  4IUQ A;  1EL0 A;  1LV9 A;  2B2W C;  1X32 A;  1WTQ A;  1C8C A;  1ML0 D;  2RVL A;  4ZAI A;  1WD1 A;  2FIN B;  1G91 A;  1WTW A;  2HCI A;  2MP1 A;  2B2V A;  2L12 A;  1EIH A;  4CJ0 B;  3I3C A;  3Q6S A;  2HDM A;  3ONA B;  2B2Y A;  2KUM A;  5EPK A;  4R9W A;  5CMD A;  2X6G A;  1BF4 A;  2HDL A;  4IUV A;  1G6Z A;  1BO0 A;  2H1E A;  2FHT A;  2N88 A;  4UAI A;  2J7Z A;  1F9R A;  1KNE A;  1O7Y A;  1F9Q A;  1JIC A;  4DN4 M;  1HA6 A;  2L11 A;  3DEP A;  3HP3 A;  4X3U A;  2DY7 A;  5D65 A;  1JE4 A;  1AZP A;  3GV6 A;  2N55 A;  4X3K A;  1EIG A;  3FDT A;  4MHE A;  1WTR A;  1GUW A;  1M8A A;  1RTN A;  1NAP A;  3DM1 A;  2KEE A;  4NW2 A;  1WVL A;  4HCS A;  1O7Z A;  5EQ0 A;  2Q8T A;  1RTO A;  1U4P A;  4ZKB B;  1MSG A;  4OIK A;  1SAP A;  1CA5 A;  5EKI A;  3I91 A;  4R8I A;  2SDF A;  2B2Y C;  4X3T A;  1WTV A;  1RJT A;  1B50 A;  2K04 A;  3FPU B;  4CJ2 C;  1PFN A;  5COY A;  1IKL A;  5E4W C;  4LMQ D;  4XT1 B;  4CJ1 B;  4IUR A;  3R93 A;  2K1B A;  2KOL A;  1X3Q A;  2VXW A;  5T1I A;  1F9P A;  4RAU C;  1J9O A;  1PLF A;  1PDQ A;  2DY8 A;  4QUC A;  5COR A;  1X3P A;  5AFW A;  1MGS A;  3I8Z A;  3D6W A;  3QO2 A;  2HCC A;  1EQT A;  2B2U A;  1G2S A;  2R3Z A;  1DON A;  1ILQ A;  4IUU A;  2B2T A;  4OIJ A;  1PFM A;  4QUF A;  2NZ1 D;  3LWE A;  1G2T A;  3MTS A;  3TN2 A;  1A15 A;  1HUM A;  4HSV A;  4ZK9 B;  2B2W A;  1CA6 A;  2RSN A;  1HUN A;  1XYI A;  1XX8 A;  1PFB A;  2D9U A;  2RSO A;  4O42 A;  1BNZ A;  1F9S A;  1DOM A;  1IL8 A;  1U4M A;  4HED A;  1ROD A;  2HUG A;  3I90 A;  5D14 A;  3UI2 A;  1QE6 A;  2B2V C;  1F2L A;  1QNK A;  1HFN A;  2M2L A;  1SDF A;  4IUP A;  1WTX A;  2JYO A;  2NWG A;  2KEC A;  3H91 A;  1WTO A;  4RA8 A;  2FJ2 A;  2KED A;  4ZLT F;  2NYZ D;  1WD0 A;  5E4X A;  1VMC A;  3P7J A;  2X69 A;  4U68 A;  2MGS A;  4XDX A;  1AP0 A;  2MJ8 A;  2X6L A;  2XIW A;  3IFD A;  4MN3 A;  2MPM A;  2JP1 A;  4RWS C;  5JJZ A;  5EPL A;  1MSH A;  1AZQ A;  1NCV A;  1B3A A;  2EOT A;  2K05 A;  1ZXT A;  1EOT A;  2FMM A;  1SSO A;  2L1B A;  1O80 A;  1ESR A;  2CVR A;  1B53 A;  3IL8 A;  1RHP A;  3MWY W;  5EPJ A;  1HRJ A;  1B2T A;  1CM9 A;  1B4O A;  3F2U A;  3KUP A;  5CBA E;  2IL8 A;  1U4L A;  2RA4 A;  1QG7 A;  1MI2 A;  1S4Z A;  1DZ1 A;  1Q3L A;  2FFK B;  1ICW A;  3TZD A;  2EPB A;  1BBX C;  4ZKC B;  5T1G A;  3G7L A;  1U4R A;  1WTP A;  5CBE E;  2K01 A;  2K03 A;  1HFG A;  4X3S A;  1IKM A;  5EJW A;  3N52 A;  4HAE A;  3KBX A;  1DOK A;  1J8I A;  4IUT A;  1NR2 A;  1HHV A;  3DEO A;  2EE1 A;  4XT3 B;  1TVX A; 
#chains in the Genus database with same CATH topology
 4O0A A;  4A3I H;  5C3X A;  2L4N A;  4A75 A;  3GP7 A;  5J1Z A;  3J81 i;  2YU9 H;  4F8M A;  4FXG C;  1EY4 A;  2EYF A;  5C6A A;  3MVV A;  4ME5 A;  3A56 A;  5C44 G;  1L1O A;  4V0B A;  5DAU A;  2L55 A;  2B2V A;  4A3I B;  1Z7T A;  1KAA A;  5EPK A;  5IY0 A;  4DR6 Q;  2XVS A;  1X56 A;  1SNP A;  1Q12 A;  2R93 B;  2YU9 B;  2CH4 A;  2JA6 B;  2N88 A;  4E6I A;  4G7Z C;  3OW7 A;  1GHJ A;  1T5X D;  2L11 A;  2EYH A;  1VCI A;  4JVZ A;  1HXY D;  2D0O A;  1HQM C;  3OWF A;  2MHV A;  1AZP A;  3UDX A;  4OO1 I;  1HR0 Q;  3I72 A;  4ILW A;  5BN4 A;  5IIF A;  4OWT B;  1FJG Q;  3DM1 A;  1MD2 D;  1IXR A;  4A3B B;  3I4N H;  3HOY B;  5FLX L;  4GOP B;  3BZC A;  1BXT A;  1SAP A;  4LUO A;  2F0I A;  2DGY A;  3CQZ B;  1EY5 A;  4PMC A;  4XT1 B;  3D8G A;  4H7B A;  2F0D A;  3NEL A;  4HJ7 A;  2VQF Q;  1J9O A;  1ZYR D;  3N6R A;  4A3L G;  3EA6 A;  3HOX H;  1G2S A;  2JXM B;  3S1R H;  1Y8P B;  4WJ4 A;  1A15 A;  4K8J A;  5FLX c;  4A3K G;  5LMN L;  5CGK A;  3EFX D;  4LF5 L;  4DF7 A;  3DHQ A;  3PF5 A;  4UP7 A;  4X66 L;  5LMU Q;  4F87 A;  1F2L A;  1OXU A;  2K52 A;  3HOX B;  2XRQ D;  1BBW A;  1LTB D;  2LS0 1;  4X65 L;  4ZUJ A;  1XXG A;  1MHW C;  3GTG H;  5JJZ A;  4LFA L;  1RF2 D;  2EYJ A;  1EOT A;  2LMC B;  1VQO A;  4Y7N H;  2UXD Q;  3VR2 A;  5C0X G;  5BR8 L;  3GTG B;  1R9T H;  3TS2 A;  5IWA Q;  5GRO A;  1SND A;  1QOH A;  2F0G A;  4A3E G;  1PRT C;  4Y7N B;  2ZM6 Q;  3T13 A;  3C1F A;  3FKI H;  4RG1 A;  1GUN A;  3P75 A;  2AHO B;  2L9H A;  2VQE Q;  2JA8 B;  4JI6 Q;  1LTA D;  1PRT B;  1JOR A;  2B8G A;  2YV5 A;  3CAM A;  2F3W A;  2EDG A;  4RKB A;  1B8A A;  1PTO F;  4BBS G;  1FL0 A;  3FKI B;  3UE0 A;  4DAY B;  2HDM A;  3CCR A;  4HIO A;  1Q86 C;  2QCP X;  1N34 Q;  3VDY A;  2JA5 G;  3SK4 A;  3SEB A;  3VYT A;  4PZ7 A;  4DAP A;  2M9V A;  1WI5 A;  3E0J A;  1N32 L;  1LO5 D;  2O2L D;  1IBL L;  2J7Z A;  1XNR Q;  1MIU A;  3CHB D;  4HJ5 A;  1S5E D;  3DEP A;  4X64 Q;  2VW9 A;  1N33 Q;  1K3B C;  3CD6 A;  2SNM A;  2N55 A;  1QUQ A;  1JJC B;  3NP8 A;  5IYC H;  1M8A A;  4GKJ Q;  1GUW A;  1KL9 A;  5M3F B;  3NEN A;  1OXS C;  2WII B;  1MSG A;  3QOJ A;  5KEE A;  1CA5 A;  5FO9 B;  3NHH A;  3A5U A;  1WTV A;  5LMN W;  2ENB A;  4LF6 Q;  1F2Y A;  5LL6 X;  4NKL A;  1BUV T;  1XJV A;  3H15 A;  3VYU A;  1PLF A;  1Q46 A;  4LF8 L;  4YCW A;  5AFW A;  3M7G A;  1SMY D;  1EQT A;  2KBN A;  4KKU A;  5IGC A;  5IP9 G;  4A3J G;  4BA1 I;  2KCC A;  4HSV A;  4LF9 L;  2Z9H A;  1CI3 M;  4DR1 Q;  5EBC A;  1C0A A;  3VR3 A;  4IOC A;  5D14 A;  4JBJ A;  1STH A;  3ERS X;  2LXK A;  4DFA A;  4JPB W;  3KFU A;  4L63 B;  1UE7 A;  5C4X H;  4DV4 L;  1E3P A;  3H0G B;  2XSC A;  1RL2 A;  1YNX A;  5C3E H;  1MSH A;  3OMC A;  2O5I C;  1D1K A;  1C7Y A;  1ESR A;  3KK7 A;  1HNW L;  1CM9 A;  1LM0 A;  1MJE A;  2J4X A;  4FF4 A;  1QG7 A;  1HNX L;  2A74 C;  1K0S A;  3E3X A;  2Q2T A;  1C4Q A;  1F2M A;  3KDF B;  3T1Y Q;  2IWH A;  4JYA Q;  2VB2 X;  1VQI A;  2HQE A;  5K5P A;  1Q8K A;  2BDO A;  4ID6 A;  4XT3 B;  1XMQ L;  3CCE A;  4P75 A;  4NXN Q;  4JG2 A;  1JWM D;  1ILP A;  5FLM G;  2AKW B;  1X9N A;  1EZ8 A;  1BCP B;  2WAQ E;  1PH1 A;  3T4A C;  1I3Q H;  3H3V H;  1AE2 A;  4QIW B;  4BY1 G;  4X62 Q;  3FHW A;  1G8Z D;  2FIN B;  1E1O A;  2K7V A;  3H3V C;  3URY A;  1Y14 B;  1I5F A;  1ET9 A;  2YTY A;  4R9W A;  3K5N A;  1LT6 D;  1NE3 A;  2VY3 A;  1ICF B;  5IGD A;  3VYR A;  3K57 A;  3G71 A;  1E2V A;  3U58 A;  1CSQ A;  1LT3 D;  3QOL A;  3K0X A;  4ZYS A;  4K6L A;  2ZT9 C;  4BY7 G;  1UNS A;  1EIG A;  3MAQ A;  2LSS A;  1X3G A;  1GUG A;  1NAP A;  4CDE C;  4POF A;  1WVL A;  5FKA C;  3AB9 A;  3EJI A;  3BS1 A;  3HOW B;  3OMG A;  4GNX C;  3NK9 A;  4DR2 Q;  3L3O C;  4K8I A;  4C2M B;  4DK6 C;  4IJL A;  1EEF D;  3U4V A;  2I5H A;  2Z6K A;  2KOL A;  4GKK Q;  4GN3 B;  3OWE B;  1X3P A;  4DV0 L;  2CCZ A;  2WAQ G;  5DM7 3;  5I4D A;  3DXJ C;  5E1F A;  1EYA A;  1VF5 C;  3HKZ E;  5I9O A;  1XYI A;  5G3L F;  1W2B A;  1AH9 A;  1U4M A;  5IYD G;  5JJL A;  4O2D A;  2JA7 H;  3S24 A;  4K0K L;  2JYO A;  2NN6 G;  3EQL C;  2PI2 A;  2BE5 D;  2K5D A;  3K0Y A;  4LFB L;  2ALY B;  3EBE A;  5GAH C;  4OXP A;  2X69 A;  4LF7 Q;  1TWA H;  1HNZ Q;  3TRZ A;  4JOI C;  1HTL D;  5J39 A;  4DV1 Q;  5CV6 A;  2I0Q A;  1STB A;  3BVG A;  2JSO A;  1TWF H;  1YNJ D;  1VQH A;  1TWA B;  2CH4 W;  1RKN A;  3RN2 A;  4A3F H;  3C1E A;  4X3S A;  2RKS A;  2WKC A;  2NB0 A;  4HAE A;  3J7Y W;  4AQY Q;  4UP9 A;  5JOB A;  3ZYY X;  4RGO S;  3CCS A;  1VMP A;  3AYH B;  3GV3 A;  2XGT A;  4A3F B;  4DR3 L;  2MO0 A;  3HKZ G;  1J5E L;  1QB5 D;  4CGY B;  4RHR A;  1EL0 A;  2F1M A;  3QWN A;  4YHH Q;  1X32 A;  1P8L A;  1ENC A;  2Q8I B;  1NMF A;  2JE6 I;  1N9W A;  4WOR A;  1WTW A;  1BVS A;  2KHJ A;  2WKD A;  1DM0 B;  3PO2 H;  1CZW A;  1YNN C;  1BCP F;  2UXC Q;  1TWC B;  5D3D A;  1K28 A;  4UAI A;  2PZU A;  3J7A F;  1I6H H;  2LKV A;  3KF6 B;  3NBH A;  5CV4 A;  2WAC A;  5M5X H;  1WFQ A;  4DUZ L;  4A93 B;  3GTJ H;  3VR5 A;  4PZ6 A;  3D0F A;  1K73 C;  4KLK A;  2EVB A;  5M9O A;  1RTO A;  5C44 H;  4OIK A;  1I6H B;  4IZ8 A;  4KHP Q;  3PUY A;  5M5X B;  1PFN A;  5E4W C;  3GTJ B;  1E24 A;  1V1Q A;  4A3M G;  2R7Z G;  4YY3 L;  5C4J H;  3ITP A;  1Q1E A;  4KV6 A;  4CKE A;  2UXB Q;  5JEA G;  3M7N A;  2EJM A;  1PH6 A;  2E5L Q;  5KND A;  2QEJ C;  4YWL A;  1DGS A;  1SNC A;  2D62 A;  3FMC A;  1SMY C;  3GO5 A;  3I7F A;  3PIP 3;  4LF4 Q;  3NWS A;  4DA2 A;  3H3V I;  4ZK9 B;  1Q81 C;  3HOZ G;  2MO1 A;  3A7L A;  4TQU S;  3K59 A;  3UI2 A;  3VR4 A;  4Q0F A;  2UUC Q;  1VQ6 A;  1SXT A;  1HFN A;  4QL5 A;  4XQN A;  1TY2 A;  3D4D A;  4RA8 A;  1D6E C;  3PGZ A;  4B3M L;  2F0E A;  5F2D A;  1CT1 D;  4DK0 A;  1X3F A;  2FMC A;  3IFD A;  4A3L H;  1KHI A;  2HHH Q;  3K7A H;  3KYH C;  1O80 A;  5GAG C;  4JI5 Q;  1B7Y B;  2CHB D;  4RHS A;  1DZ1 A;  4XXE A;  2FFK B;  3BVM A;  1XPU A;  4DKA C;  4PMB A;  2ZJP A;  3DUZ A;  1HFG A;  1B44 D;  3K7A B;  1H9J A;  4A76 A;  1NR2 A;  5CV9 A;  2AUK A;  4M1U B;  4QF4 A;  2BDN A;  2R92 B;  1L0Y B;  1ENA A;  3R3O A;  2RDG A;  3U50 C;  5L37 A;  4IUQ A;  1SNQ A;  3NEM A;  3KF8 A;  5BN3 A;  4BXX H;  5C0X H;  1A3U A;  3IAY A;  2KCN A;  3ER0 A;  2VUM B;  2F0N A;  4ME3 A;  3GTQ B;  1AE3 A;  2HDL A;  5FO8 B;  1PRT D;  4A3E H;  2YTX A;  3CRL C;  3Q24 A;  2EYM A;  5GQO A;  1D2B A;  1QVF A;  4KD3 A;  4OEL B;  1HR0 L;  3L0O A;  1FJG L;  4S3S A;  2UUA Q;  3HOU G;  3RUZ A;  4K5V A;  4A3E B;  1E1T A;  4QQB X;  2EXZ A;  1O7L A;  5AJ3 Q;  2OWO A;  1SR3 A;  2Z8L A;  1Y1V G;  2F4V L;  1H9S B;  3G48 A;  4R8I A;  2L15 A;  2JA5 H;  4CJ2 C;  4G7O C;  2K1B A;  2K50 A;  2A73 B;  3CP0 A;  1VQP A;  4RAU C;  3W5O A;  4HMI A;  3D6W A;  4MTN A;  3T1H Q;  2R3Z A;  2XRS D;  1SE4 A;  2JA5 B;  3A0J A;  5K36 H;  2B2W A;  2EQS A;  4XYQ A;  3MEH A;  5LMU L;  4C3J G;  3S17 H;  3HRZ C;  4F88 A;  1ROD A;  3I90 A;  2GA4 B;  5IOC A;  5C0X J;  1A3V A;  3NSW A;  1MKH A;  4ZLT F;  4HMJ A;  1WCM G;  5E4X A;  2KHI A;  3QB3 A;  4AH6 A;  2PQE A;  5IP9 H;  1SEB D;  2Y0S E;  1AZQ A;  2EOT A;  1Y1W G;  1ZXT A;  2CVR A;  2UXD L;  4N9T A;  4B3R Q;  5A35 A;  1TWG B;  3J80 L;  2Z4H A;  1B4O A;  1NY4 A;  1DCZ A;  2F0L A;  1S4Z A;  4DR5 Q;  5IWA L;  1KD1 C;  1RDP D;  1YNJ C;  5T1G A;  4Z9C B;  5JPM C;  3J7Z C;  2DNC A;  4IO9 A;  2K01 A;  4LUV A;  2BH2 A;  2ZM6 L;  2N3S A;  2QIL A;  3BZD B;  2EE1 A;  2ID0 A;  3KJO A;  1TVX A;  2VQE L;  3QG1 A;  1DOL A;  2E74 C;  3AEV A;  3PV0 A;  3L2P A;  2DN8 A;  2A6E D;  1UE5 A;  1HR0 W;  2EYP A;  1A2T A;  3MXP A;  3A5Z B;  4WFN 3;  4U67 3;  1G51 A;  2NTS A;  3G6J B;  3RZD B;  4LWC A;  4OL7 A;  5HY6 A;  3ONA B;  2V4D A;  5GAD C;  4ALP A;  3S1M H;  4YCV A;  4DV6 Q;  1OTC A;  1XNR L;  3CKI B;  4PG3 A;  1TS2 A;  1ENF A;  4X64 L;  1KNE A;  1JIC A;  3X3N A;  3VYS A;  2NUC A;  3OTO L;  5FLM H;  2E2J B;  5HGQ A;  3S1M B;  3OIQ A;  3RMH A;  3KLS A;  2HQL A;  4NW2 A;  4BY1 H;  4HCS A;  4H0L C;  2L5T A;  1JWU D;  1V1P A;  4H44 C;  5KRU A;  1KLU D;  1YI2 A;  2K04 A;  3FPU B;  1TT2 A;  2PI2 E;  4ABN A;  4DV2 Q;  5DEH A;  2E2H H;  1P16 A;  4DAV A;  1B9M A;  1CQF A;  4BY1 B;  1UEA B;  2LXJ A;  3M4Q A;  1MGS A;  1DON A;  3TQY A;  2B2T A;  1EZ6 A;  4BY7 H;  3LWE A;  1G2T A;  4DR1 L;  2HT1 A;  2E2H B;  3STB C;  4JI0 Q;  4I7Z C;  2RSO A;  1A2U A;  5J3B A;  4HR7 B;  3A8J E;  5C0X I;  4NXM L;  1TR5 A;  1YHQ A;  1ONL A;  3I56 A;  2HUG A;  4A3C G;  3MEF A;  2OTL A;  2KEC A;  1S5D D;  1SE8 A;  2AWO A;  4BY7 B;  4O1N A;  3DMU A;  3VA7 A;  3J80 E;  1QZH A;  4G57 A;  1GJX A;  4TKO B;  3MA2 B;  4UP8 A;  2M00 A;  1TS5 A;  3I4N B;  4KD4 A;  3SHL A;  4H13 C;  4PMW A;  2NVX H;  4IPG A;  4RH6 A;  1A6X A;  5IOD A;  2PW5 A;  3MC0 B;  2QKI C;  3FP9 A;  1D1I A;  3ULP A;  5IYD H;  3HEJ A;  3T1Y L;  2EPB A;  3SK5 A;  4JYA L;  2ES2 A;  2NN6 H;  4HSP A;  3N52 A;  2PQA A;  3S1R B;  2ZJQ A;  2JN4 A;  3NTH A;  3I4O A;  2FXQ A;  3R8B A;  1HHV A;  4OEM B;  4NXN L;  1L2F A;  5E3F A;  1E0B A;  2E2I H;  4OX9 L;  1JOK A;  1VQA A;  1NBW A;  4ZCK A;  4B08 A;  3EVQ A;  3SVM A;  4X62 L;  4WJ3 M;  3G6E A;  4M8A A;  5KYL A;  1C8C A;  2RVL A;  2H5X A;  3PO3 G;  3CPW A;  4RKL A;  3I4M H;  3I73 A;  4HTH A;  4HJ9 A;  3WOF A;  4Q5V A;  3JAM L;  4JI2 L;  4DR4 Q;  1FGB D;  2IHE A;  1H9R A;  2F3I A;  4C3I H;  1YHB A;  4DV7 Q;  2EY2 A;  1KDC A;  3I4M B;  1NTG A;  4KK7 A;  2R7D A;  1R9T B;  1S3O A;  2IX1 A;  1KC8 C;  4UDU C;  2K5Q A;  1SNO A;  2F0J A;  4C3I B;  1PA6 A;  2Q8T A;  5JPN C;  4DXF A;  5TSS A;  4DR2 L;  2K5H A;  1PZJ D;  5HUR A;  4GLA C;  5J22 A;  1KRT A;  1EQQ A;  1YNN D;  1K8G A;  1TII D;  4JI3 L;  2H4O A;  1LYL A;  4IPD A;  4GKK L;  4DV5 Q;  3GTL H;  1SNM A;  3J81 j;  1QWY A;  2QDB A;  1XWE A;  5E7N A;  2DY8 A;  1EYD A;  3MFG A;  1A3T A;  2B2U A;  1VQN A;  1EOV A;  3MTS A;  2BA1 A;  3M4O H;  1PXU A;  4PNY A;  2WP8 J;  3H94 A;  4XYO A;  3GTL B;  1XTC D;  4XQQ A;  2Q2U A;  3K5L A;  5FK9 C;  1I6V C;  1L1O C;  1GUS A;  1QE6 A;  2B2V C;  2M2L A;  3Q22 A;  3HS0 C;  4A3M H;  5ELO A;  4LF7 L;  1HNZ L;  1L1O B;  1YJ9 A;  4A3G G;  5JEA H;  4DV1 L;  2RF4 A;  5IT9 L;  1K8M A;  2Q2I A;  5LL6 S;  4N8F A;  5C4Z A;  2UU9 Q;  3S2D H;  2AMC B;  2F0K A;  4IN3 A;  3UDI A;  2KHS A;  4WJW A;  4A3M B;  2IPK D;  5IP7 G;  3HOZ H;  1NSN S;  3HOV H;  1SBB B;  4EVO A;  1IZ6 A;  2BCO A;  1CFM A;  5C5L A;  3A55 A;  4AQY L;  3CXC A;  2N49 A;  4IUT A;  2CKZ B;  1YJW A;  2JJQ A;  3PCO B;  3HOV B;  3ERO A;  3DWP A;  2OEO A;  5D3I B;  5KNC A;  1Q90 A;  4YHH L;  4I65 A;  3JAM E;  2NTT A;  3C2P A;  1ML0 D;  5I6Y A;  4ZAI A;  3ULL A;  5C4X B;  1LLR D;  1EY0 A;  2A6E C;  2CQA A;  4B3T Q;  1I50 H;  4EQ5 A;  5C3E B;  3PUX A;  2B2Y A;  2UXC L;  1U0L A;  1BF4 A;  3FEW X;  1G6Z A;  4XIG S;  4AIM A;  2IY5 B;  4NMZ A;  4DV3 Q;  2ICE C;  2NVY H;  1PH9 A;  1HA6 A;  5JVH 3;  1WYD A;  1CKN A;  2O4X A;  1I50 B;  5JEA J;  5FOB B;  4JI4 Q;  2AWN A;  2TMP A;  3NQT A;  1A63 A;  2AQ2 B;  4C1N K;  5CC4 A;  4KHP L;  1U4P A;  1EY8 A;  2KCT A;  2NVY B;  1FGU A;  4JK1 C;  1X65 A;  1CKM A;  2ZJR A;  2NN6 I;  3NQI A;  5COY A;  2UXB L;  1PRT F;  4IUR A;  3R93 A;  2NZO A;  4HID A;  1I3Q B;  1F9P A;  3MHB A;  3PUW A;  2A69 C;  1PDQ A;  3NXW A;  4KKT A;  4QUC A;  3PIP A;  3T16 A;  1STA A;  2XN9 C;  4A3I G;  2E5L L;  3MXN A;  4B9W A;  1EYC A;  4LF4 L;  5I2X A;  2RHQ B;  3PUV A;  2Z6B A;  1QJO A;  2R93 G;  5FJ8 G;  2JA6 G;  1SMX A;  3A7A B;  5FO7 B;  3HOU H;  3B6Y A;  2UUC L;  2KA7 A;  3W2D A;  1F9S A;  1Y1V H;  5IT9 E;  1IL2 A;  4FNF A;  2DNE A;  1WTX A;  3GTO H;  1CSP A;  1LTL A;  2ZTD A;  3OW2 A;  1JT8 A;  2NYZ D;  2VB3 X;  3WOE A;  4A3B G;  4JBK A;  3M4P A;  4IJH A;  1JR0 D;  4GNX B;  3HOU B;  1DXM A;  2ICI A;  4L5Q A;  4B9X A;  3HOY G;  1O7I A;  1PYS B;  2O5J C;  1AP0 A;  1JJG A;  2HHH L;  1PZI D;  2MPM A;  3D4W A;  4EQN A;  2FMM A;  4DN4 M;  1SSO A;  1AFP A;  3IL8 A;  4JI5 L;  3GTO B;  1SYB A;  1XTD A;  2IX0 A;  1NNX A;  1EEI D;  3F2B A;  1U4L A;  4C3J H;  2ZXO A;  1A8V A;  2RDF A;  4QB4 A;  1JB3 A;  1QUQ B;  1U4R A;  1LT4 D;  3T53 B;  3H6M A;  1V43 A;  1WCM H;  4RCO A;  4HN7 A;  2A68 C;  3DEO A;  1SLJ A;  4C3J B;  3VR6 A;  1IBL Q;  5KIX A;  2F0Q A;  4OHJ A;  1Y1W H;  1PZK D;  3I4L A;  3PSI A;  2JA7 B;  2Q8R E;  4J6H A;  3S14 H;  2DJG C;  1GUO A;  1WCM B;  2A1A A;  3F8T A;  3CCL A;  1EIH A;  4K6D A;  1JMC A;  1Y1W B;  2F0W A;  1VQF A;  4QCL A;  5GAE C;  4QJF A;  3S14 B;  2UUB Q;  1CTM A;  1W6J A;  1TWF B;  2K4K A;  3HP3 A;  1LT5 D;  1A0I A;  2UUA L;  3AFQ A;  1E7Z A;  3CPF A;  3UDG A;  4LUZ A;  5EBD A;  5AJ3 L;  1UE6 A;  2IX3 A;  3CCJ A;  1KIX A;  2A6H D;  3U4Z A;  2JA8 G;  5A2Q L;  2AUJ D;  4YWM A;  1R4P B;  3R2T A;  2B2Y C;  1VQG A;  4ULL A;  3RNU A;  4BA2 I;  4BBR G;  3J81 E;  3S16 H;  4J8Q A;  3TDQ A;  5M3M H;  1X3Q A;  1Y8N B;  3NBI A;  2RDH A;  5T1I A;  1JWS D;  1MBY A;  5ELD A;  3U9O A;  3K5O A;  3T1H L;  2PZT A;  5COR A;  1KDA A;  4J15 A;  1W6K A;  4TVA B;  1PFM A;  2IT1 A;  3AQQ A;  3PO2 B;  2F0M A;  4AYB E;  2WIN B;  1UUP A;  1KQS A;  1HNW Q;  4L5S A;  5M3M B;  2R61 A;  2QF7 A;  4LFC Q;  1GUT A;  2Y0S B;  5JJK A;  4RGN A;  3RLN A;  1XNQ Q;  2FJ2 A;  2N78 A;  5M3F G;  3U9S A;  1FR3 A;  3DWQ A;  3BDL A;  5JJI A;  3OHX C;  5C44 B;  2JQO A;  4QGU A;  5EPL A;  1RD9 D;  3OYY A;  4B3R L;  1B53 A;  2VZA A;  3MWY W;  3STB D;  1QNU A;  4FXK C;  1YEZ A;  3HGB A;  1R4Q B;  1ZEQ X;  3SXH A;  2K33 A;  1KLG D;  5C4J B;  1VQM A;  4FF2 A;  4PQX A;  4KY6 A;  4OWX B;  4A3C H;  3ND8 A;  1S5B D;  4L5R C;  2EXD A;  1VQ9 A;  1EU4 A;  3K81 C;  2Z6K C;  3S9W A;  2B3G A;  2DJF C;  4J1M A;  1HZ9 A;  1KNA A;  1S40 A;  4AYB G;  2V1C C;  1SN8 A;  5DNF A;  1JQY D;  2KVM A;  3H0G G;  1BKB A;  4IQZ A;  1SYD A;  4A3K H;  3GTP H;  3IRB A;  3K7U C;  1PH2 A;  1IBM L;  4A3D G;  2RCF A;  1JCK B;  4DV6 L;  2QDL A;  1I4G A;  5EGT A;  3GTK H;  5CMD A;  1VQJ A;  1O78 A;  4R4C A;  1RIP A;  1GD7 A;  1K9M C;  2K14 A;  4A3K B;  2WV6 D;  5CYU A;  3HG9 A;  1HPC A;  5A2Q E;  4APV A;  4X3U A;  2MQH A;  1II3 A;  4C3H G;  3NUC A;  1EFW A;  5I6W A;  4MHE A;  1BBU A;  1VQL A;  1O7Z A;  2PYK A;  4IOA A;  4C56 C;  3BVZ A;  1EY7 A;  3PUZ A;  4DV2 L;  1L0W A;  1RJT A;  4DR6 L;  5LHY 1;  3JAM i;  4RGT A;  4PV1 C;  1DD2 A;  1IKL A;  1AEX A;  4JI8 Q;  3SDZ A;  4YCU A;  5NUC A;  2VXW A;  1PH4 A;  1BDO A;  5JVG 3;  1TQO A;  2BOS A;  3I8Z A;  3OPO A;  3UE1 A;  1CQV A;  4HJ8 A;  1OO9 B;  2AQ1 B;  4JI0 L;  2NZ1 D;  1CA6 A;  2YTV A;  4NB3 A;  1YIT A;  2ATW A;  4Y52 H;  3TP8 A;  4BBS H;  4P74 A;  2F03 A;  3K8A A;  1TXY A;  4DUY Q;  2GVA A;  5EAY A;  2KED A;  2VQF L;  4YWK A;  1WD0 A;  3S2H H;  3HOW G;  1GOZ A;  2RHS B;  4HJA A;  3BU2 A;  4UHV A;  4FF1 A;  3OSO A;  4DNR B;  4GOP A;  4BBS B;  1NCV A;  3BZK A;  1B3A A;  2K05 A;  3FPP A;  1HCZ A;  2RCN A;  1HRJ A;  2L0C A;  4ZRZ A;  3F2C A;  2HIV A;  1IBK Q;  1J5E Q;  5M5W H;  4DK3 C;  4KJN A;  3NBH B;  1X54 A;  3DLL A;  3C46 A;  2RQX A;  1G6P A;  1EYG A;  2G9D A;  3ERQ A;  1GKH A;  3RZO H;  3GQB A;  5EJW A;  1M1K C;  1ASY A;  1DOK A;  1KAW A;  3CCM A;  2XTI A;  4A3G H;  2HIX A;  4JI7 Q;  1F2Z A;  3TRE A;  3PF4 A;  2PMZ E;  4GLV B;  3S17 B;  2F0T A;  1PHJ A;  3P20 A;  1VDZ A;  1EWH A;  3RZO B;  2OXP A;  4A3J H;  5KYI A;  1M90 C;  4RFB A;  1SJE D;  4L8J A;  1WTQ A;  1EQR A;  5ELN A;  4A3G B;  1T5E A;  3KLR A;  3KBG A;  4NDX A;  4NPS A;  3NWT A;  4DR4 L;  2KUM A;  1QVC A;  1A62 A;  2K75 A;  1F77 A;  4A3J B;  4ODG A;  2OF1 A;  2PW7 A;  2FHT A;  4YY3 Q;  2F0F A;  1NUC A;  1HZA A;  2KJX A;  4JI6 L;  1IHZ A;  2PPB C;  1JE4 A;  3J80 c;  4X3K A;  1RTN A;  1Y8O B;  4DNT B;  3TP6 A;  4K2K A;  1JB7 A;  4MNO A;  1N34 L;  4A3F G;  2A6H C;  2E75 C;  4DV5 L;  2SDF A;  2CWP A;  4DAM A;  4B3S Q;  4KHZ A;  2C9O A;  2WFW A;  2EZV A;  3LWU A;  1N33 L;  3PIO 3;  3OOC A;  3WWV A;  4EQP A;  1JJ2 A;  2HCC A;  1EFI D;  1XMO Q;  1VQE A;  4KTA A;  3J7A 5;  4DAY A;  4GKJ L;  1I94 Q;  1SRU A;  1HUN A;  1PTO H;  2JEA I;  3MXU A;  5IGG A;  3A8I E;  4IFD I;  1V8Q A;  1X3E A;  4HED A;  1AN8 A;  1PYW D;  4C1N I;  1E2Z A;  3Q8D A;  1PTO C;  5H1S E;  1HZB A;  4LF6 L;  4A93 G;  4IUP A;  4KJO A;  3KF8 B;  5HGT A;  3KJP A;  2A69 D;  1EIY B;  2Q2H A;  4XDX A;  4FXD A;  3X3M A;  2UU9 L;  2GVB A;  4HIM A;  3MZ5 A;  5FJ8 H;  3KLS X;  2JA6 H;  2R93 H;  1ET6 A;  5IGE A;  2WB1 E;  1PH5 A;  4FYD A;  3L9A X;  4JI1 Q;  4RGM A;  1KDB A;  1Q1B A;  4JV5 Q;  2DUD A;  2F4I A;  2ZXR A;  3UDF A;  1WTP A;  3RR5 A;  2K32 A;  1EIF A;  4POG A;  3G4S A;  4A3B H;  3HOY H;  2K6A A;  3CME A;  1SFO H;  4GOP C;  3K5M A;  3CQZ H;  2D0P A;  1LUZ A;  3TBI B;  1Y69 U;  3CC7 A;  3A8K E;  1IW7 D;  4DR7 Q;  1DYQ A;  2B2W C;  1TS3 A;  4B3T L;  3S15 H;  1SYE A;  2XNA C;  5BN5 A;  1E22 A;  1PH7 A;  2HCI A;  3SE0 A;  4GS3 A;  3ICE A;  2EJF C;  3E6Z X;  4IFD G;  3I3C A;  1HA5 A;  1SFO B;  1Q82 C;  2F4V Q;  5DLQ E;  2WAQ B;  2NVX B;  4IUV A;  4K5W A;  4DV3 L;  2A68 D;  2H1E A;  2PCF B;  5CV8 A;  3TME A;  3EN2 A;  3TEH B;  1ZKO A;  4DNI A;  3S15 B;  3I70 A;  5ELF A;  4X6A H;  4JI4 L;  1SYF A;  2F0V A;  4KN7 C;  3W1G A;  5C4H A;  1V1O A;  3KDF A;  2WB1 G;  4LJZ C;  2ZXP A;  4MZ9 A;  1JOO A;  1LTS D;  1K83 H;  3M3Y H;  2PO4 A;  2R92 G;  2PNR C;  1STY A;  3TP5 A;  3AMU A;  4R4O A;  2XWB B;  3IKJ A;  2NBF A;  1HZC A;  2E2I B;  2MNA A;  1FNU A;  1VS0 A;  1FD7 D;  1EY9 A;  4PZ8 A;  4CHT B;  3GTM H;  1I4Q A;  2EY5 A;  2VNU D;  1K83 B;  3M3Y B;  3CU7 A;  5KGU A;  2VUM G;  4IUU A;  1WJJ A;  2LY7 A;  4OO1 G;  1HUM A;  1LTR D;  1Z9F A;  1XX8 A;  2B63 G;  2D9U A;  3BG3 A;  4BXX G;  5ELE A;  3GTM B;  4L6T B;  4GZY C;  1H9M A;  4XQJ A;  2JA8 H;  2C35 B;  1D5X C;  3JAM c;  1SDF A;  5IE8 A;  1WTO A;  1HQR D;  4BBR H;  3HKZ B;  4JCV E;  4CBV A;  1N36 Q;  3P7J A;  4RWS C;  3D31 A;  3NTI A;  2OCE A;  3WDN A;  3PQI A;  4BBR B;  2ZTC A;  1CZG A;  1XPO A;  4CDF C;  4GNX A;  1PFS A;  4GLX A;  5ELB A;  1ICW A;  3TZD A;  1BBX C;  1N8R C;  3I2Z A;  3DM3 A;  5CBE E;  3BYY B;  2K03 A;  1UE1 A;  3KLW A;  3V2T A;  5M3F H;  2R7Z H;  3SK8 A;  4TSS A;  2D5D A;  1YVC A;  3M4O B;  1V1P B;  2K5N A;  3M85 A;  1T9H A;  3M4Y A;  5FLX E;  1STE A;  1TY0 A;  2IW3 A;  3OTO Q;  2K5W A;  1I4R A;  1IYJ B;  1GXD C;  2B2T C;  3M9B A;  2SEB D;  3LX0 A;  5K36 G;  3BJU A;  1OXT A;  1SJH D;  4CKB A;  4JBM A;  2R7Z B;  5ELC A;  3CC2 A;  2MUY A;  1WOC A;  2MP1 A;  1EUJ A;  1TKW B;  1JE5 A;  2F0S A;  4R4Q A;  2UUB L;  4RMF A;  3S2D B;  2E76 C;  5IT9 c;  2F0U A;  3Q0A A;  3HOZ B;  1F9R A;  4G4K A;  4JOI A;  4BWG B;  1C9O A;  2R6G A;  1VQD A;  3HFZ B;  1OXX K;  3FDT A;  3H0G H;  1WTR A;  1D8L A;  3AU7 A;  2SNS A;  3FVQ A;  3VA5 A;  5JAV A;  4A3D H;  4NXM Q;  3ULJ A;  1SE3 A;  4AYB B;  2B8F A;  4DXG A;  3IFT A;  3BYT B;  3F1Z A;  3EIV A;  3S1N H;  4MIU A;  1UAP A;  3RLF A;  4A3D B;  3LGJ A;  3E0E A;  2PQA B;  4C3H H;  1BR9 A;  4LFC L;  2RSN A;  1VQ5 A;  3MFY A;  4KY5 A;  1PFB A;  5IYB G;  2EY6 A;  4OON A;  3CCV A;  1DOM A;  3S1N B;  1HH2 P;  4YIJ A;  5LMN Q;  1TU2 B;  4LF5 Q;  1XNQ L;  3QR8 A;  4KN4 C;  5EKK A;  3KF6 A;  4X66 Q;  3H91 A;  4C3H B;  1QVG A;  1BCP C;  1B70 B;  3SK6 A;  3J7A V;  2CQO A;  4X65 Q;  1PH3 A;  2JP1 A;  2XWJ B;  1M4V A;  4R1J A;  1QIL A;  4F7X A;  4OX9 Q;  4ZKC B;  4LFA Q;  3RN5 A;  2NVT H;  4HIK A;  4L5T A;  3Q23 A;  3J81 L;  1H95 A;  1D5Z C;  1S5C D;  5CBA E;  3KUP A;  1I4P A;  3P1H A;  2RA4 A;  1Q3L A;  1GVP A;  5CV5 A;  4CDD C;  3G7L A;  2CW0 D;  5BR8 Q;  2OQK A;  2EY1 A;  1SYG A;  1YZ6 A;  2NVT B;  1JOQ A;  3CCU A;  1UEB A;  3HOW H;  3R2I A;  4JI2 Q;  1Z6H A;  3CMA A;  1I4X A;  2TSS A;  1NR4 A;  4C2M H;  2B2U C;  1Y1V B;  3J81 c;  3DWA A;  1W3S A;  2F52 A;  1Q7Y C;  2ZTE A;  2P5Z X;  4UY8 C;  1IW7 C;  4IAL A;  1G91 A;  3I4N G;  1U5K A;  3A54 A;  4G7H C;  4LK1 C;  3Q6S A;  2N8N A;  1EWI A;  4KY7 A;  4JI3 Q;  3CF5 A;  1K8O A;  3NPP A;  4N9P A;  1SYC A;  1O7Y A;  1ZYR C;  1AW7 A;  1K3R A;  1Q8I A;  1N32 Q;  3HOX G;  1LTG D;  1E2W A;  3L7Z C;  3GV6 A;  4GN4 B;  3J80 i;  2I07 B;  4N8X 1;  4XTC S;  5EQ0 A;  1EQV A;  2VS1 A;  5CV7 A;  1SE2 A;  1VQK A;  1B50 A;  4JI8 L;  2K5V A;  3W3A A;  1JC7 A;  2B29 A;  4FO2 A;  1NMG A;  3BDO A;  1VQ8 A;  2HD3 A;  1B1Z A;  3K80 C;  3FRP B;  4LF8 Q;  2GN5 A;  3T51 B;  4NP5 A;  4QUF A;  1TS4 A;  2I5M X;  3TN2 A;  1PH8 A;  1KAB A;  3CRK C;  4LF9 Q;  3I4M G;  5DM6 3;  4DUY L;  1KTK A;  3T56 B;  1UWV A;  3AFP A;  2AQ3 B;  1NJI C;  2PZW A;  4C3I G;  3F2D A;  2BH8 A;  2MGS A;  2XIW A;  2KCM A;  1LTT D;  4DV4 Q;  3FKI G;  1V9P A;  3GD7 A;  1VQ4 A;  4ZQ3 A;  2KQ3 A;  4P73 A;  4LNQ A;  1G29 1;  3H09 A;  1IBK L;  3I91 A;  4CJ1 B;  1H9S A;  2ASB A;  1TWC H;  1CUK A;  3C3L A;  1WTH A;  2J0T D;  1CKN B;  2PMZ B;  4WRD A;  2Z1C A;  1PV4 A;  3S16 B;  2EYO A;  1PTO D;  4A93 H;  1HNX Q;  3W1B A;  2A5H A;  4H02 A;  5I2Y A;  4EX5 A;  4JW0 A;  4DU9 A;  3KBX A;  4JI7 L;  4MTK A;  2C5C A;  2BA0 A;  3E9H A;  4QY7 A;  1LAC A;  1CKO A;  2D2C C;  3V05 A;  1VQB A;  1XMQ Q;  1OXV A;  2F0H A;  1STN A;  4IPH A;  1LV9 A;  4KI0 A;  5IYC G;  4DR5 L;  2JK8 A;  2B39 A;  3MXN B;  1WD1 A;  3K6O A;  4OWW B;  2IHF A;  2L12 A;  1RCV D;  1ESF A;  1QCB D;  2OQ0 A;  3D3R A;  1BO0 A;  1LAB A;  4HCE A;  1H9K A;  1HJP A;  1FVI A;  1EY6 A;  3ND9 A;  2RBM A;  1C48 A;  4QIW E;  5CR3 A;  4K14 A;  3QIA A;  3CW2 C;  3ZJY C;  2A8V A;  2NZH A;  3QJY A;  2EJG C;  2YYZ A;  4ZUI A;  3HOV G;  4IFD H;  5EKI A;  3RD4 A;  4B3S L;  1SRO A;  3HZX A;  3PIO A;  1BQQ T;  5M5Y H;  2KEN A;  4R8N A;  5IGF A;  1X6O A;  5C4X G;  3CC4 A;  1Z47 A;  1PMR A;  1XMO L;  3GTP B;  4JBW A;  3E5S A;  2OT2 A;  2LFN A;  5C3E G;  2VL6 A;  1ILQ A;  4DV0 Q;  1I94 L;  4OIJ A;  3KOJ A;  2EIF A;  4GN5 A;  3GTK B;  2Z4I A;  1FYC A;  1B9N A;  3PMF A;  5M5Y B;  3E9I A;  4RCN A;  3PO3 H;  2NVQ H;  2R92 H;  1K8A C;  4FVM A;  4KKS A;  4R4I A;  3JC6 6;  2A19 A;  1CHP D;  2WB1 B;  4K0K Q;  1TWH H;  3RLO A;  3I55 A;  1GHK A;  1VF7 A;  1YBY A;  2G5D A;  1PYB A;  4MN3 A;  4LFB Q;  3PO3 B;  2VUM H;  2NVQ B;  3CCQ A;  3GTQ H;  2E2D C;  1YIJ A;  2L1B A;  4X3T A;  5EPJ A;  4OO1 H;  1KRS A;  2I46 A;  4P72 A;  1K0R A;  1B2T A;  1QZG A;  2B63 H;  1YJN A;  1TWH B;  4QMG A;  2IL8 A;  4JI1 L;  4DGZ A;  1IYU A;  4JV5 L;  1MI2 A;  3SR1 A;  5C3W A;  4K2L A;  1D5M C;  3SGI A;  4I7A A;  2CFM A;  1IKM A;  4IFD J;  2CW0 C;  2F0O A;  2JEB I;  3TS0 A;  1L0X B;  2B63 B;  5I9P A;  3D6C A;  4CKC A;  3HKS A;  2EYL A;  2G9H D;  5EKL A;  2K28 A;  4KHV A;  4DR7 L;  1GM5 A;  4DR3 Q;  3MXG A;  1B3Q A;  4BS9 A;  3S2H B;  3NE5 B;  1ASZ A;  2MFI A;  4CJ0 B;  2R7F A;  3BDC A;  1J6Q A;  2X6G A;  4OGQ C;  2F3V A;  1XPR A;  4DK1 A;  5M5W B;  2E8G A;  1F9Q A;  2QEX A;  4FF3 A;  2IJ0 A;  3OIP A;  4P71 A;  1EU3 A;  2DY7 A;  5D65 A;  3GDE A;  4CDC C;  3S1Q H;  4DUZ Q;  1IYV A;  1FNV A;  1STG A;  5IP7 H;  2KEE A;  5G3L D;  4ZKB B;  2OTJ A;  1PVO A;  3LNN A;  2JA7 G;  3O13 A;  1TWG H;  3S1Q B;  4LMQ D;  1S5F D;  1HTP A;  5KNB A;  4EGV A;  4DV7 L;  2BE5 C;  1EWC A;  4UPA A;  1CHQ D;  3V96 A;  4KMU C;  5IGB A;  3QO2 A;  5ISR A;  3D4R A;  4LW1 A;  1YHA A;  4FDB A;  4DPG A;  3A74 A;  3TSS A;  2JA9 A;  4O42 A;  1BNZ A;  1IL8 A;  1FNW A;  2PNH A;  4FP5 D;  1QNK A;  2CWA A;  1D7Q A;  2SOB A;  1KXL A;  1N36 L;  2NWG A;  1U9R A;  1CK1 A;  4A4I A;  1VMC A;  4U68 A;  4IUN A;  2MJ8 A;  2F0P A;  2X6L A;  3RZD H;  4B3M Q;  1I4H A;  1GO3 E;  4IPC A;  4TRD A;  1RHP A;  1BOS A;  1X55 A;  2QGQ A;  1VQ7 A;  2Z0S A;  5IYB H;  2I5L X;  3F2U A;  4JC0 A;  2E2J H;  4EQO A;  1MJC A;  3TP7 A;  3NTK A;  1IBM Q;  3PO2 G;  2QW7 A;  5C5M A;  4P2C B;  1BCP D;  1LTI D;  3K58 A;  1VQC A;  2QA4 A;  5M3M G;  4V19 0;  3TZU A;  1J8I A;  4LAA A;  1S72 A;  4K5X A;  2Y0S G;  4R4T A;  1PTO B;  1DJR D; 
#chains in the Genus database with same CATH homology
 5C3X A;  2L4N A;  3GP7 A;  5J1Z A;  4F8M A;  4FXG C;  1EY4 A;  2EYF A;  5C6A A;  3MVV A;  4ME5 A;  3A56 A;  4V0B A;  5DAU A;  2L55 A;  2B2V A;  4A3I B;  1Z7T A;  1KAA A;  5EPK A;  2XVS A;  1SNP A;  1Q12 A;  2R93 B;  2YU9 B;  2JA6 B;  2N88 A;  4E6I A;  4G7Z C;  3OW7 A;  1GHJ A;  1T5X D;  2L11 A;  2EYH A;  1VCI A;  1HXY D;  1HQM C;  3OWF A;  2MHV A;  1AZP A;  4OO1 I;  3I72 A;  4ILW A;  5BN4 A;  5IIF A;  3DM1 A;  1MD2 D;  4A3B B;  3HOY B;  5FLX L;  1BXT A;  1SAP A;  2F0I A;  3CQZ B;  1EY5 A;  4PMC A;  4XT1 B;  3D8G A;  4H7B A;  2F0D A;  1J9O A;  1ZYR D;  3N6R A;  3EA6 A;  1G2S A;  2JXM B;  1Y8P B;  1A15 A;  4K8J A;  5CGK A;  3EFX D;  4DF7 A;  3DHQ A;  4F87 A;  1F2L A;  1OXU A;  3HOX B;  2XRQ D;  1LTB D;  2LS0 1;  4ZUJ A;  1XXG A;  5JJZ A;  1RF2 D;  2EYJ A;  1EOT A;  2LMC B;  3VR2 A;  5C0X G;  3GTG B;  1SND A;  1QOH A;  2F0G A;  1PRT C;  4Y7N B;  3T13 A;  3C1F A;  1GUN A;  3P75 A;  2L9H A;  2JA8 B;  1LTA D;  1PRT B;  1JOR A;  2B8G A;  2F3W A;  2EDG A;  4RKB A;  1PTO F;  3FKI B;  2HDM A;  2QCP X;  3SK4 A;  3SEB A;  3VYT A;  4DAP A;  2M9V A;  3E0J A;  1LO5 D;  2O2L D;  2J7Z A;  3CHB D;  1S5E D;  3DEP A;  2SNM A;  2N55 A;  3NP8 A;  1GUW A;  1M8A A;  5M3F B;  1OXS C;  2WII B;  1MSG A;  3QOJ A;  5KEE A;  1CA5 A;  5FO9 B;  3NHH A;  1WTV A;  2ENB A;  1F2Y A;  5LL6 X;  4NKL A;  1BUV T;  3VYU A;  1PLF A;  5AFW A;  3M7G A;  1SMY D;  1EQT A;  5IGC A;  4KKU A;  4BA1 I;  2KCC A;  4HSV A;  1CI3 M;  5EBC A;  3VR3 A;  5D14 A;  1STH A;  4DFA A;  4L63 B;  3H0G B;  2XSC A;  1MSH A;  3OMC A;  2O5I C;  1D1K A;  1ESR A;  3KK7 A;  1CM9 A;  4FF4 A;  2J4X A;  1QG7 A;  2A74 C;  1C4Q A;  1F2M A;  2IWH A;  2VB2 X;  2HQE A;  5K5P A;  2BDO A;  4ID6 A;  4XT3 B;  1JWM D;  1ILP A;  1EZ8 A;  1BCP B;  3T4A C;  4QIW B;  1G8Z D;  2FIN B;  2K7V A;  3H3V C;  3URY A;  1ET9 A;  4R9W A;  3K5N A;  1LT6 D;  5IGD A;  3VYR A;  3K57 A;  1E2V A;  1LT3 D;  3QOL A;  4ZYS A;  4K6L A;  2ZT9 C;  1UNS A;  1EIG A;  3MAQ A;  1GUG A;  1NAP A;  1WVL A;  5FKA C;  3AB9 A;  3EJI A;  3BS1 A;  3HOW B;  3OMG A;  3NK9 A;  3L3O C;  4K8I A;  4C2M B;  1EEF D;  2KOL A;  1PTO B;  3OWE B;  1X3P A;  5DM7 3;  5I4D A;  3DXJ C;  5E1F A;  1EYA A;  1VF5 C;  1XYI A;  5I9O A;  5G3L F;  1U4M A;  2JYO A;  2NN6 G;  3EQL C;  2BE5 D;  2K5D A;  3K0Y A;  2X69 A;  1HTL D;  5J39 A;  5CV6 A;  1STB A;  3BVG A;  2JSO A;  1YNJ D;  1TWA B;  1RKN A;  3C1E A;  4X3S A;  2RKS A;  2WKC A;  2NB0 A;  4HAE A;  3J7Y W;  5JOB A;  3ZYY X;  4RGO S;  1VMP A;  3GV3 A;  4A3F B;  1QB5 D;  4CGY B;  4RHR A;  1EL0 A;  2F1M A;  3QWN A;  1X32 A;  1ENC A;  2Q8I B;  2JE6 I;  1WTW A;  4WOR A;  2WKD A;  1DM0 B;  1CZW A;  1YNN C;  1BCP F;  1TWC B;  5D3D A;  4UAI A;  2PZU A;  3J7A F;  2LKV A;  3NBH A;  5CV4 A;  2WAC A;  4A93 B;  3VR5 A;  2EVB A;  5M9O A;  1RTO A;  4OIK A;  1I6H B;  4IZ8 A;  3PUY A;  5M5X B;  1PFN A;  5E4W C;  3GTJ B;  3ITP A;  1Q1E A;  4KV6 A;  4CKE A;  5JEA G;  3M7N A;  2EJM A;  5KND A;  2QEJ C;  1SNC A;  2D62 A;  3FMC A;  1SMY C;  3GO5 A;  3PIP 3;  3NWS A;  4DA2 A;  4ZK9 B;  3A7L A;  4TQU S;  3K59 A;  3UI2 A;  3VR4 A;  4Q0F A;  1SXT A;  1HFN A;  4XQN A;  1TY2 A;  3D4D A;  4RA8 A;  1D6E C;  2F0E A;  5F2D A;  1CT1 D;  4DK0 A;  2FMC A;  3IFD A;  1O80 A;  1DZ1 A;  2CHB D;  4RHS A;  4XXE A;  2FFK B;  3BVM A;  4PMB A;  3DUZ A;  1HFG A;  1B44 D;  3K7A B;  1H9J A;  5CV9 A;  2AUK A;  4M1U B;  4QF4 A;  2BDN A;  2R92 B;  1L0Y B;  1ENA A;  3R3O A;  2RDG A;  4IUQ A;  1SNQ A;  3KF8 A;  5BN3 A;  5C0X H;  1A3U A;  3IAY A;  2KCN A;  2VUM B;  2F0N A;  3GTQ B;  2HDL A;  5FO8 B;  1PRT D;  3CRL C;  3Q24 A;  2EYM A;  1D2B A;  4KD3 A;  4S3S A;  3RUZ A;  4K5V A;  4A3E B;  2EXZ A;  1O7L A;  2Z8L A;  1H9S B;  4R8I A;  4CJ2 C;  4G7O C;  2K1B A;  2A73 B;  4RAU C;  4HMI A;  3D6W A;  2R3Z A;  2XRS D;  1SE4 A;  2JA5 B;  5K36 H;  2B2W A;  4XYQ A;  3MEH A;  4C3J G;  3HRZ C;  4F88 A;  1ROD A;  3I90 A;  2GA4 B;  5IOC A;  5C0X J;  1A3V A;  3NSW A;  4ZLT F;  4HMJ A;  5E4X A;  3QB3 A;  2PQE A;  1SEB D;  1AZQ A;  2EOT A;  1ZXT A;  2CVR A;  4N9T A;  5A35 A;  1TWG B;  3J80 L;  2Z4H A;  1B4O A;  1DCZ A;  2F0L A;  1S4Z A;  1RDP D;  1YNJ C;  5T1G A;  4Z9C B;  5JPM C;  2DNC A;  2K01 A;  2QIL A;  3BZD B;  2EE1 A;  2ID0 A;  1TVX A;  1DOL A;  3QG1 A;  2E74 C;  3PV0 A;  2DN8 A;  2A6E D;  2EYP A;  1A2T A;  3MXP A;  4WFN 3;  4U67 3;  2NTS A;  3G6J B;  3RZD B;  4OL7 A;  3ONA B;  2V4D A;  3CKI B;  1TS2 A;  1ENF A;  1KNE A;  1JIC A;  3X3N A;  3VYS A;  2NUC A;  2E2J B;  3S1M B;  3OIQ A;  3RMH A;  3KLS A;  4NW2 A;  4HCS A;  4H0L C;  2L5T A;  1JWU D;  1V1P A;  4H44 C;  5KRU A;  1KLU D;  2K04 A;  3FPU B;  1TT2 A;  4ABN A;  5DEH A;  4DAV A;  1B9M A;  1CQF A;  4BY1 B;  1UEA B;  1MGS A;  1DON A;  2B2T A;  1EZ6 A;  3LWE A;  1G2T A;  2E2H B;  4I7Z C;  2RSO A;  1A2U A;  4HR7 B;  3A8J E;  5C0X I;  1TR5 A;  1ONL A;  2HUG A;  2KEC A;  1S5D D;  2AWO A;  4BY7 B;  4O1N A;  3DMU A;  3VA7 A;  3J80 E;  4G57 A;  1GJX A;  4TKO B;  3MA2 B;  2M00 A;  1TS5 A;  3I4N B;  4KD4 A;  3SHL A;  4H13 C;  4PMW A;  4RH6 A;  1A6X A;  5IOD A;  2PW5 A;  3MC0 B;  2QKI C;  1D1I A;  3HEJ A;  2EPB A;  3SK5 A;  2NN6 H;  4HSP A;  3N52 A;  3S1R B;  3NTH A;  3R8B A;  1HHV A;  5E3F A;  1E0B A;  1JOK A;  4B08 A;  3EVQ A;  3SVM A;  4M8A A;  5KYL A;  1C8C A;  2RVL A;  4RKL A;  3I73 A;  4HTH A;  3WOF A;  4Q5V A;  3JAM L;  1FGB D;  1H9R A;  2EY2 A;  1KDC A;  3I4M B;  4KK7 A;  1R9T B;  2IX1 A;  4UDU C;  2K5Q A;  1SNO A;  2F0J A;  4C3I B;  2Q8T A;  5JPN C;  4DXF A;  5TSS A;  1PZJ D;  5HUR A;  5J22 A;  1YNN D;  1TII D;  2H4O A;  1SNM A;  1QWY A;  2QDB A;  1XWE A;  2DY8 A;  1EYD A;  3MFG A;  1A3T A;  2B2U A;  3MTS A;  2BA1 A;  1PXU A;  4PNY A;  2WP8 J;  3H94 A;  4XYO A;  3GTL B;  1XTC D;  4XQQ A;  3K5L A;  5FK9 C;  1I6V C;  1GUS A;  1QE6 A;  2B2V C;  2M2L A;  3Q22 A;  3HS0 C;  5JEA H;  5IT9 L;  1K8M A;  5LL6 S;  5C4Z A;  2F0K A;  4IN3 A;  2KHS A;  4WJW A;  4A3M B;  2IPK D;  1NSN S;  1SBB B;  4EVO A;  2BCO A;  1CFM A;  5C5L A;  3A55 A;  4IUT A;  3HOV B;  3ERO A;  3DWP A;  2OEO A;  5D3I B;  5KNC A;  1Q90 A;  4I65 A;  3JAM E;  2NTT A;  3C2P A;  1ML0 D;  5I6Y A;  4ZAI A;  5C4X B;  1LLR D;  1EY0 A;  2A6E C;  2CQA A;  5C3E B;  3PUX A;  2B2Y A;  1BF4 A;  3FEW X;  1G6Z A;  4XIG S;  4NMZ A;  2ICE C;  1HA6 A;  5JVH 3;  2O4X A;  1I50 B;  5JEA J;  5FOB B;  2AWN A;  2TMP A;  3NQT A;  2AQ2 B;  4C1N K;  5CC4 A;  1U4P A;  1EY8 A;  2NVY B;  4JK1 C;  2NN6 I;  3NQI A;  5COY A;  1PRT F;  4IUR A;  3R93 A;  1I3Q B;  1F9P A;  3MHB A;  3PUW A;  2A69 C;  1PDQ A;  3NXW A;  4KKT A;  4QUC A;  3T16 A;  1STA A;  2XN9 C;  3MXN A;  4B9W A;  1EYC A;  5I2X A;  3PUV A;  1QJO A;  5FO7 B;  3A7A B;  2KA7 A;  3W2D A;  1F9S A;  5IT9 E;  4FNF A;  2DNE A;  1WTX A;  2NYZ D;  2VB3 X;  3WOE A;  1JR0 D;  3HOU B;  2O5J C;  1DXM A;  2ICI A;  4B9X A;  1AP0 A;  1PZI D;  2MPM A;  3D4W A;  4EQN A;  2FMM A;  4DN4 M;  1SSO A;  1AFP A;  3IL8 A;  3GTO B;  1SYB A;  2IX0 A;  1EEI D;  1U4L A;  2ZXO A;  2RDF A;  4QB4 A;  1JB3 A;  1U4R A;  1LT4 D;  3T53 B;  3H6M A;  1V43 A;  4RCO A;  4HN7 A;  2A68 C;  3DEO A;  4C3J B;  3VR6 A;  5KIX A;  2F0Q A;  4OHJ A;  1PZK D;  3I4L A;  2JA7 B;  2Q8R E;  4J6H A;  1GUO A;  1WCM B;  1EIH A;  4K6D A;  1Y1W B;  2F0W A;  4QCL A;  3S14 B;  1CTM A;  1W6J A;  1TWF B;  3HP3 A;  1LT5 D;  5EBD A;  2IX3 A;  2A6H D;  5A2Q L;  2AUJ D;  1R4P B;  3R2T A;  2B2Y C;  4ULL A;  4BA2 I;  3J81 E;  4J8Q A;  3TDQ A;  1X3Q A;  1Y8N B;  3NBI A;  2RDH A;  3U9O A;  1JWS D;  1MBY A;  5T1I A;  5ELD A;  3K5O A;  2PZT A;  5COR A;  1KDA A;  1W6K A;  1PFM A;  2IT1 A;  3PO2 B;  2F0M A;  2WIN B;  1UUP A;  5M3M B;  2R61 A;  2QF7 A;  1GUT A;  2Y0S B;  4RGN A;  2FJ2 A;  3U9S A;  1FR3 A;  3DWQ A;  3BDL A;  3OHX C;  5C44 B;  5EPL A;  1RD9 D;  1B53 A;  3MWY W;  1QNU A;  4FXK C;  3HGB A;  1R4Q B;  1ZEQ X;  3SXH A;  2K33 A;  1KLG D;  5C4J B;  4FF2 A;  4PQX A;  4KY6 A;  3ND8 A;  1S5B D;  1EU4 A;  3S9W A;  4J1M A;  1KNA A;  5DNF A;  1JQY D;  2KVM A;  4IQZ A;  1SYD A;  1JCK B;  1I4G A;  5EGT A;  5CMD A;  1O78 A;  4A3K B;  2WV6 D;  5CYU A;  3HG9 A;  1HPC A;  5A2Q E;  4X3U A;  1II3 A;  4C3H G;  3NUC A;  5I6W A;  4MHE A;  1O7Z A;  2PYK A;  4C56 C;  3BVZ A;  1EY7 A;  3PUZ A;  1RJT A;  5LHY 1;  4RGT A;  4PV1 C;  1DD2 A;  1IKL A;  1AEX A;  3SDZ A;  5NUC A;  2VXW A;  1BDO A;  5JVG 3;  1TQO A;  2BOS A;  3I8Z A;  3OPO A;  1CQV A;  1OO9 B;  2AQ1 B;  2NZ1 D;  1CA6 A;  3TP8 A;  2F03 A;  2KED A;  1WD0 A;  1GOZ A;  4FF1 A;  3OSO A;  4DNR B;  4BBS B;  1NCV A;  1B3A A;  2K05 A;  3FPP A;  1HCZ A;  1HRJ A;  2L0C A;  4ZRZ A;  4KJN A;  3C46 A;  2RQX A;  2G9D A;  3ERQ A;  3GQB A;  5EJW A;  1DOK A;  1F2Z A;  3S17 B;  2F0T A;  3P20 A;  1VDZ A;  1EWH A;  3RZO B;  2OXP A;  5KYI A;  4RFB A;  1SJE D;  4L8J A;  1WTQ A;  4A3G B;  1T5E A;  3KLR A;  3KBG A;  4NDX A;  3NWT A;  2KUM A;  1F77 A;  4A3J B;  4ODG A;  2OF1 A;  2PW7 A;  2FHT A;  2F0F A;  1NUC A;  2KJX A;  1IHZ A;  2PPB C;  1JE4 A;  4X3K A;  1RTN A;  1Y8O B;  4DNT B;  3TP6 A;  4K2K A;  2A6H C;  2E75 C;  2SDF A;  4KHZ A;  2C9O A;  2EZV A;  3LWU A;  3PIO 3;  3OOC A;  4EQP A;  2HCC A;  1EFI D;  4KTA A;  4DAY A;  1HUN A;  1PTO H;  2JEA I;  3MXU A;  5IGG A;  3A8I E;  4IFD I;  1V8Q A;  4HED A;  1AN8 A;  1PYW D;  4C1N I;  1E2Z A;  1PTO C;  4IUP A;  4KJO A;  5HGT A;  2A69 D;  4XDX A;  4FXD A;  3X3M A;  3MZ5 A;  3KLS X;  1ET6 A;  5IGE A;  4FYD A;  3L9A X;  4RGM A;  1KDB A;  1Q1B A;  2F4I A;  2ZXR A;  1WTP A;  2K32 A;  2K6A A;  3K5M A;  3TBI B;  1Y69 U;  3A8K E;  1IW7 D;  1DYQ A;  2B2W C;  1TS3 A;  1SYE A;  2XNA C;  5BN5 A;  2HCI A;  3SE0 A;  2EJF C;  3E6Z X;  4IFD G;  3I3C A;  1HA5 A;  1SFO B;  2NVX B;  2WAQ B;  4IUV A;  4K5W A;  2A68 D;  2H1E A;  2PCF B;  5CV8 A;  3TME A;  1ZKO A;  3S15 B;  3I70 A;  5ELF A;  1SYF A;  2F0V A;  4KN7 C;  5C4H A;  1V1O A;  4LJZ C;  2ZXP A;  1JOO A;  1LTS D;  2PO4 A;  2PNR C;  1STY A;  3TP5 A;  3AMU A;  2XWB B;  3IKJ A;  2NBF A;  2E2I B;  1FNU A;  1FD7 D;  1EY9 A;  4CHT B;  1I4Q A;  2EY5 A;  2VNU D;  1K83 B;  3M3Y B;  3CU7 A;  5KGU A;  4IUU A;  2LY7 A;  4OO1 G;  1HUM A;  1LTR D;  1XX8 A;  2D9U A;  3BG3 A;  5ELE A;  3GTM B;  4L6T B;  4GZY C;  1H9M A;  4XQJ A;  1D5X C;  1SDF A;  1WTO A;  1HQR D;  3HKZ B;  4CBV A;  3P7J A;  4RWS C;  3D31 A;  3NTI A;  3WDN A;  4BBR B;  1CZG A;  5ELB A;  1ICW A;  3TZD A;  1BBX C;  5CBE E;  3BYY B;  2K03 A;  3V2T A;  3SK8 A;  4TSS A;  2D5D A;  3M4O B;  1V1P B;  3M85 A;  5FLX E;  3M4Y A;  1STE A;  1TY0 A;  2IW3 A;  2K5W A;  1I4R A;  1GXD C;  2B2T C;  2SEB D;  3LX0 A;  5K36 G;  1OXT A;  1SJH D;  4CKB A;  2R7Z B;  5ELC A;  2MUY A;  2MP1 A;  1TKW B;  2F0S A;  3S2D B;  2E76 C;  2F0U A;  3Q0A A;  3HOZ B;  1F9R A;  4G4K A;  4BWG B;  2R6G A;  1OXX K;  3FDT A;  1WTR A;  3AU7 A;  2SNS A;  3FVQ A;  3VA5 A;  5JAV A;  1SE3 A;  4AYB B;  2B8F A;  4DXG A;  3IFT A;  3BYT B;  4MIU A;  1UAP A;  3RLF A;  4A3D B;  1BR9 A;  2RSN A;  3MFY A;  4KY5 A;  1PFB A;  2EY6 A;  1DOM A;  3S1N B;  4YIJ A;  1TU2 B;  4KN4 C;  5EKK A;  3H91 A;  4C3H B;  1BCP C;  3SK6 A;  3J7A V;  2JP1 A;  2XWJ B;  1M4V A;  1QIL A;  4F7X A;  4ZKC B;  3Q23 A;  3J81 L;  1S5C D;  1D5Z C;  5CBA E;  3KUP A;  1I4P A;  3P1H A;  2RA4 A;  1Q3L A;  5CV5 A;  3G7L A;  2CW0 D;  2EY1 A;  1SYG A;  2NVT B;  1JOQ A;  3R2I A;  1Z6H A;  1I4X A;  2TSS A;  1NR4 A;  2B2U C;  1Y1V B;  3DWA A;  1IW7 C;  4IAL A;  1G91 A;  3A54 A;  4G7H C;  4LK1 C;  3Q6S A;  4KY7 A;  1K8O A;  3NPP A;  4N9P A;  1SYC A;  1O7Y A;  1ZYR C;  1AW7 A;  1Q8I A;  1LTG D;  1E2W A;  3L7Z C;  3GV6 A;  2I07 B;  4XTC S;  5EQ0 A;  1EQV A;  5CV7 A;  1SE2 A;  1B50 A;  3W3A A;  1JC7 A;  4FO2 A;  3BDO A;  1B1Z A;  3FRP B;  3T51 B;  4NP5 A;  4QUF A;  1TS4 A;  3TN2 A;  1KAB A;  3CRK C;  5DM6 3;  1KTK A;  3T56 B;  2AQ3 B;  2PZW A;  4C3I G;  2MGS A;  2XIW A;  1LTT D;  3GD7 A;  4ZQ3 A;  2KQ3 A;  1G29 1;  3H09 A;  3I91 A;  4CJ1 B;  1H9S A;  3C3L A;  2J0T D;  2PMZ B;  4WRD A;  3S16 B;  2Z1C A;  2EYO A;  1PTO D;  2A5H A;  5I2Y A;  4DU9 A;  3KBX A;  2C5C A;  2BA0 A;  1LAC A;  2D2C C;  3V05 A;  1OXV A;  2F0H A;  1STN A;  1LV9 A;  4KI0 A;  2B39 A;  1WD1 A;  3K6O A;  2L12 A;  1RCV D;  1ESF A;  1QCB D;  3D3R A;  1BO0 A;  1LAB A;  4HCE A;  1H9K A;  1EY6 A;  5CR3 A;  2RBM A;  1C48 A;  3ND9 A;  4K14 A;  3QIA A;  3QJY A;  2EJG C;  2YYZ A;  4ZUI A;  4IFD H;  5EKI A;  3RD4 A;  3HZX A;  1BQQ T;  4R8N A;  5IGF A;  1Z47 A;  1PMR A;  3GTP B;  4JBW A;  3E5S A;  2OT2 A;  2LFN A;  1ILQ A;  4OIJ A;  3GTK B;  2Z4I A;  1FYC A;  1B9N A;  3PMF A;  5M5Y B;  4RCN A;  4FVM A;  4KKS A;  1CHP D;  2WB1 B;  1GHK A;  1VF7 A;  4MN3 A;  3PO3 B;  2NVQ B;  2E2D C;  2L1B A;  4X3T A;  5EPJ A;  4OO1 H;  2I46 A;  1B2T A;  1TWH B;  4QMG A;  2IL8 A;  4DGZ A;  1IYU A;  1MI2 A;  3SR1 A;  5C3W A;  4K2L A;  1D5M C;  1IKM A;  4IFD J;  2CW0 C;  2F0O A;  2JEB I;  1L0X B;  2B63 B;  5I9P A;  3D6C A;  4CKC A;  2EYL A;  2G9H D;  5EKL A;  2K28 A;  4KHV A;  3MXG A;  4BS9 A;  3S2H B;  3NE5 B;  4CJ0 B;  3BDC A;  2X6G A;  4OGQ C;  2F3V A;  4DK1 A;  5M5W B;  1F9Q A;  4FF3 A;  2IJ0 A;  3OIP A;  1EU3 A;  2DY7 A;  5D65 A;  1IYV A;  1FNV A;  1STG A;  2KEE A;  5G3L D;  4ZKB B;  3LNN A;  3O13 A;  3S1Q B;  4LMQ D;  1S5F D;  5KNB A;  1HTP A;  4EGV A;  2BE5 C;  1EWC A;  1CHQ D;  3V96 A;  4KMU C;  5IGB A;  3QO2 A;  5ISR A;  3D4R A;  3TSS A;  4O42 A;  1BNZ A;  1IL8 A;  1FNW A;  4FP5 D;  1QNK A;  2SOB A;  2NWG A;  1U9R A;  1CK1 A;  1VMC A;  4U68 A;  4IUN A;  2MJ8 A;  2F0P A;  2X6L A;  1I4H A;  4TRD A;  1RHP A;  1BOS A;  3F2U A;  4EQO A;  3TP7 A;  3NTK A;  5C5M A;  4P2C B;  1BCP D;  1LTI D;  3K58 A;  4V19 0;  1J8I A;  3TZU A;  4LAA A;  4K5X A;  1NR2 A;  1DJR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...