2EPBA

Solution structure of chromo domain 2 in chromodomain-helicase-dna-binding protein 6
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
68
structure length
68
Chain Sequence
GSSGSSGNPDYVEVDRILEVAHTKDAETGEEVTHYLVKWCSLPYEESTWELEEDVDPAKVKEFESLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of chromo domain 2 in Chromodomain-helicase-DNA-binding protein 6
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Chromodomain-helicase-DNA-binding protein 6
total genus 5
structure length 68
sequence length 68
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2epbA00
2KECA 1IKMA 3Q6SA 1PLFA 1ILPA 1IL8A 2N55A 1VMCA 1CM9A 2B2TA 2JP1A 3KUPA 3IFDA 5EKIA 1KNEA 1O80A 2FMMA 1F9PA 1BBXC 4O42A 4X3KA 2J7ZA 2BDNA 1TVXA 2IL8A 2B2YA 2FFKB 2XIWA 3R93A 1DOLA 2RA4A 1IKLA 4IUTA 1AZPA 2NWGA 1DOMA 3DM1A 2CVRA 1WTOA 4IUUA 1DOKA 1MI2A 1PDQA 2HDLA 1F9RA 5JJZA 2X6LA 1NR4A 1SDFA 3FPUB 1M8AA 3GV3A 1WTXA 4X3UA 4HAEA 2FINB 2B2UC 2EOTA 2K03A 3LWEA 2B2VC 5CBEE 5T1IA 1B53A 5CORA 4IUQA 2K05A 1NR2A 4RA8A 1C8CA 1X3PA 1HFNA 1RTOA 1WTRA 1QE6A 1QNKA 4R9WA 1ML0D 1U4LA 1EOTA 1AP0A 2RVLA 4CJ0B 3P7JA 3G7LA 1GUWA 2B2WA 1HFGA 1U4PA 2M2LA 1VMPA 3KBXA 3N52A 1O7YA 1SSOA 5E4XA 4NW2A 5COYA 2B2UA 2KVMA 1EIGA 2HDMA 1ZXTA 2X6GA 2EPBA 4U68A 5EPKA 1PFBA 2DY7A 4OIKA 3FDTA 3ONAB 4OIJA 1B3AA 5EJWA 4X3SA 2KEDA 1B2TA 2B2WC 1J9OA 4ZK9B 2B2YC 1XX8A 1CA6A 3I8ZA 4ZLTF 2L1BA 1G2SA 2JYOA 1RJTA 2Q8RE 2HUGA 2FJ2A 4ZKBB 1ESRA 4DN4M 4XDXA 5CMDA 1MSHA 2B2VA 2X69A 2FHTA 3MWYW 1F9QA 2L11A 4ZKCB 5CBAE 1BF4A 1ICWA 1PFNA 2DY8A 2MGSA 1AZQA 1EQTA 1BNZA 2K04A 2Q8TA 2K01A 1A15A 1BO0A 5D14A 1B4OA 2K28A 1RHPA 2NYZD 2KUMA 4HCSA 4HSVA 1G2TA 1WD0A 2L12A 3UI2A 3I91A 3HP3A 1EIHA 3H91A 1X32A 1HUMA 2L4NA 1WD1A 4IUVA 1X3QA 2N88A 5AFWA 1XYIA 1S4ZA 3TN2A 2EE1A 1PFMA 1LV9A 2H1EA 4UAIA 1HHVA 2VXWA 3I3CA 2B2TC 3TZDA 1WTQA 1HRJA 3D6WA 3DEOA 4CJ2C 1CA5A 2HCIA 2L9HA 1JICA 2RSNA 4HEDA 1EL0A 1J8IA 1MSGA 1RTNA 4CJ1B 2MPMA 3IL8A 2RSOA 2KEEA 1DONA 3MTSA 1U4RA 1DZ1A 1QG7A 4X3TA 1WTVA 2KOLA 4MHEA 1JE4A 5EPJA 4XT1B 4XT3B 1G91A 1WTWA 1E0BA 1WVLA 1F9SA 1Q3LA 1MGSA 3F2UA 1KNAA 1RODA 2D9UA 3QO2A 1SAPA 2MP1A 2SDFA 3DEPA 1O7ZA 3I90A 4LMQD 4QUFA 2MJ8A 5T1GA 5EQ0A 1NCVA 1B50A 4RWSC 1WTPA 1HA6A 4MN3A 3SVMA 4IUPA 1HUNA 2NZ1D 5EPLA 5D65A 5DNFA 2K1BA 3GV6A 1NAPA 4QUCA 2HCCA 4IURA 4RAUC 2R3ZA 1U4MA 1ILQA 1G6ZA 5E4WC 4R8IA 4ZAIA 1F2LA
chains in the Genus database with same CATH superfamily
5DLQE 1PZKD 5IWAL 1TR5A 4DR3L 4Y7NH 1XPOA 4C2MH 4OEMB 2QDBA 3DWPA 1S5ED 2BDNA 3K5OA 4GN3B 1VQJA 4NXML 3EVQA 3M3YH 2LMCB 1B44D 4XYQA 1EY4A 1KDCA 4N8FA 3S24A 5A2QL 3RR5A 3NBHA 4J15A 3K7AB 1EY9A 4X3UA 1YJWA 1GJXA 3NTIA 3PO3H 1FL0A 5KRUA 1PH6A 1VQ9A 1N33L 2HT1A 3CPFA 1GM5A 1C8CA 1V43A 3T1HL 3GTJH 3GTJB 1PH7A 5KYLA 4C3JH 1VF5C 3G7LA 1SFOH 2B2WA 2H4OA 1HFGA 5C44H 4MTNA 3FP9A 3ZYYX 2JA6G 5JJIA 3KLSX 4HJ8A 1R9TH 4A3BG 5I2YA 2A5HA 3PUXA 1NMGA 2VQEL 1XX8A 3BVMA 5GADC 5IOCA 1HJPA 3JAMi 1C4QA 4FVMA 2RKSA 1MSHA 2K52A 4WJ3M 2MGSA 4G7OC 1AZQA 2K04A 2K01A 4O1NA 1TXYA 4CBVA 1LTBD 2J4XA 1CHPD 2K28A 2K5WA 2KHSA 3TEHB 2A8VA 5CV5A 2TMPA 1QB5D 1TY0A 1X3QA 2MO0A 5IODA 4A3FH 2E2HB 2XVSA 1PTOC 1X6OA 5F2DA 4N8X1 1EL0A 1RTNA 1U5KA 4CJ1B 2PI2A 4X66L 4X3TA 5KNCA 1N9WA 4L6TB 4DPGA 1RODA 2F0SA 4IZ8A 1SAPA 1TWHH 2JE6I 1PTOB 4PZ6A 3HKSA 1PRTB 2NZ1D 4JI1Q 5D65A 1ZKOA 5IP7G 4KY6A 4DV5L 1C7YA 1K83B 3H0GB 3F2CA 1W6JA 4A3FG 4JI8Q 5DAUA 3HOZB 3S1MB 4DR7L 5I9OA 3J7YW 4RGOS 4EQPA 4P2CB 2ICIA 2KBNA 3ERQA 1G291 4PV1C 4OWWB 3VYTA 1WTOA 3I4MB 1IBKQ 1D5MC 4WRDA 1SYCA 3RLNA 4XTCS 4LW1A 1OXUA 5C3EG 2UXCQ 5CGKA 2B2VC 2ZT9C 1AE3A 1R4PB 3H3VI 3KLRA 4R9WA 3FHWA 3GTMH 3A56A 1AP0A 4AH6A 1XNRL 4XQQA 5FO9B 2LXJA 2EY5A 5IGCA 5CV4A 1OXVA 4DAYB 4IPHA 3RZOB 5FLXL 4OIKA 1I3QB 3CQZB 2ZJRA 5M5WH 3MXNA 5G3LF 1CUKA 4TRDA 2DNCA 3S15H 1PVOA 2B2VA 4JI3Q 2L11A 4DXFA 5M3MH 2YU9H 3LNNA 1A63A 1SFOB 3T1YL 1DGSA 3TP5A 2UXDL 2BDOA 3STBD 1BDOA 5AFWA 3ND9A 5BN5A 4DF7A 1XYIA 4JI6L 3J80E 1S40A 4JI8L 3ERSX 1A3TA 1T5XD 2PI2E 3T1YQ 4BS9A 5C3XA 1FVIA 4DNIA 3F8TA 4Q5VA 1EZ6A 1VQ4A 3HGBA 5IIFA 1JE4A 2F3IA 2F0LA 5BN3A 1EFWA 1Q3LA 2A68C 3M4YA 1JR0D 2ATWA 1LT3D 1Y8OB 3M9BA 3I7FA 4QUFA 5FKAC 3L7ZC 2IHEA 4UP9A 3HOZH 3S1NB 1PRTF 3I55A 1R9TB 3KDFA 3TZUA 1SE2A 2FMCA 2Z1CA 2JA8B 1VQIA 4OL7A 2N55A 5LMUL 2RDFA 5GAGC 1B9NA 5LL6X 1VQCA 3I4MH 2Q8IB 4X3KA 4DV1Q 3SE0A 4A3KH 2V4DA 1TWHB 4BBSH 2XIWA 3R93A 3GTGB 3JAML 4YY3Q 3SK5A 5GAEC 2UXCL 1WCMG 1AE2A 1MI2A 4IPGA 1BKBA 3TMEA 4RFBA 4DR5L 2RF4A 2QW7A 5CBEE 1L0YB 5CORA 2F0NA 4YWMA 3ICEA 3HOZG 2R93H 1WTRA 4FXKC 4YCWA 1HXYD 4DR6L 2K5VA 3BJUA 1PYWD 1JCKB 2B8FA 3QG1A 4E6IA 1PH9A 1EQQA 4K0KL 2AUJD 1PMRA 4RHRA 1C48A 1EIGA 1UAPA 3M7GA 1Y1VH 2ZM6Q 4JVZA 4LF8Q 3T56B 1EY0A 2B2WC 4UHVA 3P1HA 3VA5A 1CA6A 4DK3C 3SEBA 4KMUC 3UDIA 1AW7A 2BOSA 1TWCH 3LWUA 3OIQA 3BZKA 4QY7A 3SR1A 4BY1H 4C3JG 2QKIC 3HOYH 2Q2HA 2E8GA 2HD3A 3G48A 2D2CC 2O4XA 2JA6H 1IW7D 1BXTA 1X55A 4K8JA 4BY7H 3NSWA 1G2TA 1AEXA 1YEZA 3PUWA 3HP3A 3HRZC 1DXMA 1BR9A 1CSQA 3EJIA 3MEHA 1MHWC 1E2VA 3I56A 4KN4C 3RLOA 4RG1A 3PCOB 4APVA 1SLJA 4K6LA 1J8IA 3OW7A 4J6HA 5M3FH 2QEXA 1EYAA 2AQ1B 1PRTD 1W6KA 4DUYQ 1B3QA 5C44B 4DV3L 1GUTA 2PQEA 2G9DA 2MP1A 4RGTA 1Q7YC 1O7ZA 1IBLL 3PO3G 4PMWA 3K0YA 1HA6A 4QB4A 3CD6A 3SK4A 3GV6A 4U673 3G6JB 1STYA 3RZOH 4R8IA 4WFN3 2OWOA 3CRKC 1I4HA 1PZJD 3K0XA 1CFMA 3BZCA 2EDGA 4K14A 1VQKA 2F0JA 1OXSC 2A1AA 4DAMA 3G4SA 1E2ZA 2CKZB 1O7IA 4FF1A 3CF5A 2KJXA 1GUSA 1AZPA 4FF3A 3TS0A 5H1SE 3HOVB 4WJ4A 4ALPA 5JJZA 3EA6A 3O13A 4GKJL 2FINB 1N8RC 2F52A 3R3OA 3HOXG 4YCUA 3K5LA 4JI4Q 3OTOQ 4UP8A 1FJGL 1CZGA 2SNSA 1RTOA 3NUCA 5C4HA 1JORA 4LF5L 4A3MG 4LUOA 1JOOA 3QJYA 1GUWA 5LMUQ 4MTKA 4DV4L 4NXMQ 3JAMc 4JW0A 2HDMA 2EPBA 3KFUA 1CQFA 4PG3A 3ONAB 4B3TQ 4TSSA 3DWQA 5JVH3 3NTKA 1HCZA 4RH6A 1I4XA 3J80c 2NB0A 3KYHC 3L3OC 1RJTA 4HIDA 2I0QA 1FJGQ 1EU3A 3HOWG 1WOCA 4JI5L 2HIVA 1VQ5A 1PH5A 4JYAL 4JI2Q 5C3WA 2XRQD 4A93G 4IN3A 4EQ5A 3A74A 2M9VA 4OXPA 5C4ZA 2R7DA 4H13C 2UUCQ 2LSSA 1D5XC 1EIHA 1IHZA 5DM73 3SGIA 1HZBA 2F03A 3H3VC 2I5MX 5ELDA 2K7VA 1S4ZA 4IFDH 1BVSA 1BCPB 2LKVA 4DV4Q 4HIOA 1IYVA 2MFIA 4RCNA 2RSNA 3QOLA 4MZ9A 5M5XB 2KEEA 1RF2D 3BYTB 1GXDC 2EY2A 3S1MH 4JBWA 3OPOA 2PZUA 4YCVA 3T4AC 4GKJQ 2VB2X 3PUVA 4BY7B 1G51A 5EQ0A 3NP8A 1PH3A 2F0DA 3MXGA 4JI5Q 1PXUA 4B3ML 2KHJA 1NAPA 4M1UB 2FHTA 2LXKA 1RDPD 4IO9A 1A2UA 1PLFA 1Z47A 1OXXK 1TWCB 3C1EA 2L0CA 3DXJC 3MXNB 3NXWA 1PH1A 1DD2A 1KDAA 1T5EA 2B3GA 4IJLA 3IFDA 2MNAA 3GTQH 3R8BA 3ITPA 4B9WA 4HN7A 3BVGA 2MQHA 2NVQB 2B29A 4KK7A 3HKZB 3U4ZA 2RA4A 1NUCA 1K73C 2O2LD 4DGZA 4I65A 5LHY1 4RCOA 3NPPA 4JOIC 1NJIC 4KV6A 1TS5A 1WTXA 3V05A 3RZDB 1F2YA 2A6HC 2NTTA 3CCUA 5KNBA 4IUQA 4A3MH 5C5MA 4NB3A 1ZYRD 2C9OA 1Y8NB 3BYYB 4LFBQ 3KLWA 2UU9Q 1UE6A 4XXEA 4B3MQ 2M2LA 4HJ5A 2OF1A 1XMQQ 1B70B 2JEAI 1SNMA 4RMFA 1NY4A 4ZK9B 2B2YC 1N34L 4EX5A 4FF4A 1YNXA 2K5HA 3FPPA 2JA8H 5ISRA 1KLUD 4LF5Q 4NP5A 2QDLA 2P5ZX 1PFNA 4DA2A 3R2TA 2K14A 4HSPA 4JOIA 4DV7L 1WTHA 2F0MA 4A3GG 3PO2B 5EKKA 1EYGA 4HSVA 1N32L 3I91A 4IFDG 3ER0A 1CKNA 1LTRD 2ZM6L 4DR2Q 4JG2A 1PFMA 4LFAL 3S2HH 4P75A 1U9RA 3NHHA 2Y0SB 2ENBA 2HCIA 1I4QA 2NUCA 1EUJA 5JEAG 3F2DA 4A93B 1TWGB 5FLMG 4RGNA 2AQ3B 3QO2A 3S1RH 1E7ZA 5HGTA 3IFTA 1QVFA 3NELA 1XJVA 3BU2A 3CU7A 5T1GA 2EXDA 2PW7A 4IFDJ 1MIUA 3NWTA 2E75C 2M00A 4IFDI 4JC0A 2OTJA 2UUCL 3I4NG 4K5XA 1K83H 1W3SA 2JJQA 2WKDA 1KRTA 4BWGB 1STBA 1L1OA 3HKZE 1RL2A 1VMCA 4TVAB 5LMNW 1JC7A 4AYBE 3VR3A 1KNEA 4C3HH 2FMMA 4JI6Q 5M5WB 4GZYC 1N36Q 1OTCA 4QQBX 1Z6HA 4KJNA 2VUMH 1Y1VB 3D4DA 3A55A 4NXNQ 1STHA 1EQRA 2AKWB 5IYBH 3F2BA 5M5YH 1VQHA 1GO3E 1X3PA 2E2DC 1LYLA 4CJ0B 3PIP3 1PA6A 2A73B 2VS1A 2B2UA 1H9SB 2KVMA 1C9OA 2NN6G 1ZXTA 2N49A 4ME5A 1IBML 1X3GA 1B3AA 2F0GA 1LTTD 3HS0C 3Q8DA 3U9SA 4K2LA 3DM3A 4WJWA 3S17H 4B08A 2KCCA 1HNWQ 4H7BA 4OX9L 3J7ZC 3X3MA 2UXBQ 4HCEA 5I9PA 5LMNQ 1B9MA 1EWCA 1KL9A 1Z9FA 5C44G 1UE5A 5D3DA 3KF8B 4HIKA 1SYGA 4BBRB 2KUMA 1YI2A 2Y0SE 5M9OA 1SJED 4X65Q 2R92H 4LF4Q 1IL2A 3K57A 4KD3A 3GTMB 3WWVA 1X9NA 1VQMA 5BR8L 3MVVA 1VQBA 1KXLA 4KHPQ 4GNXC 3DEOA 3TREA 4HEDA 3E9HA 4DV1L 4DV2L 3FRPB 2A68D 1CK1A 1QVGA 1I4GA 3SXHA 4K8IA 4XT3B 1VQ6A 1WTWA 3S14H 1UUPA 1KNAA 4LF8L 1YZ6A 2EYOA 4KY7A 3ZJYC 4B3SL 5ELNA 1LTLA 1IYUA 2L15A 4C2MB 5M5XH 2IY5B 5EPLA 1EWIA 1L1OB 1Q81C 4RAUC 2R3ZA 4GNXB 1H9RA 1RCVD 3A8JE 2CCZA 4BBRH 4UP7A 4DAPA 1YHQA 5JOBA 4R4IA 1S5DD 3NK9A 1DCZA 1V9PA 3KUPA 2YTYA 2F4VL 4KHZA 1VF7A 4O42A 3CC7A 2ICEC 4A4IA 2XGTA 2L5TA 2VUMG 4DUZL 5D3IB 3CAMA 3PMFA 2I46A 3A8KE 3QIAA 3IKJA 1X3EA 4GLVB 1WCMB 1WFQA 2E74C 2X6LA 3HOWH 2EOTA 4LJZC 1JWSD 4A75A 3AFQA 4WORA 4ZRZA 1EOTA 1LO5D 3PUZA 2G9HD 3A54A 3K7AH 1VMPA 4LF4L 3CQZH 1O7YA 5K36G 2JA5H 5HGQA 4DR2L 3D6CA 3I72A 2IW3A 4U68A 5EPKA 3FDTA 4OONA 3VA7A 1B2TA 3KDFB 1KHIA 2CW0D 1EY5A 3CXCA 2QA4A 3CC2A 1X56A 3GTOH 5NUCA 4C1NK 3I8ZA 1FGBD 1WJJA 2BH8A 1K3RA 1L0WA 4FF2A 1Q1BA 1F9QA 2JSOA 4QF4A 4C3HB 1V1PA 5GQOA 4OGQC 2JA6B 2WINB 2R92G 1Y1WH 5IT9L 1B4OA 3R2IA 5C5LA 1A2TA 1QZHA 4HCSA 2NBFA 2GVBA 3M4OH 3H09A 5FO7B 3UDGA 3S17B 4JYAQ 5HY6A 3TP6A 1HNZQ 1LV9A 1HHVA 4DR3Q 2B2TC 1JWMD 1CA5A 2ZJPA 1PRTC 4GOPA 1SNDA 3H3VH 2UUAL 4ZYSA 4HJ9A 3JAME 4ZUIA 4A3IB 5HURA 2F0OA 4ULLA 2NVXB 4A3EG 2WAQE 5IT9c 2C5CA 2EY1A 4BY1B 2MJ8A 3MFGA 4AYBB 3J81E 5JVG3 2NVYH 3VYSA 2WAQG 1WTPA 1J6QA 2OT2A 1B7YB 2K33A 3RNUA 1F2LA 2KECA 4Q0FA 4LFCQ 1EOVA 3PO2H 3JC66 3HFZB 4JI3L 4X62L 3GTLH 2YU9B 3QWNA 4C3JB 4LUZA 2XRSD 2KENA 2QEJC 4JCVE 3J81c 1VQPA 2DNEA 4DR1Q 3DUZA 1SXTA 2K5DA 4IUUA 2IJ0A 3FPUB 4PMBA 1JWUD 2B2UC 2HHHL 2UXBL 3CCMA 2DN8A 2E2IB 3S1NH 4H0LC 2N78A 5FJ8H 1VQOA 2K05A 3CCRA 4A76A 3WOFA 1QE6A 2QGQA 1ML0D 1E24A 4Y52H 3WDNA 2HQLA 3URYA 1HH2P 1TWGH 1Q86C 3PO2G 4A3GB 5E4XA 1NBWA 1IBMQ 1RKNA 5IGBA 5LL6S 3KF6A 1PYBA 4GLAC 5G3LD 4LNQA 2FXQA 1CT1D 4H44C 1VQDA 2KEDA 4OHJA 3STBC 2DJFC 1K8AC 1BUVT 1J9OA 4OO1H 4FYDA 2WAQB 5KEEA 3FEWX 2L1BA 3ULJA 2BE5D 5CV9A 1HNXL 5E1FA 2HUGA 2EJFC 2KCTA 4CKBA 5FLMH 1N34Q 3VR5A 5ELBA 2N3SA 1I6HB 4A93H 3OIPA 1DYQA 1SRUA 3A7LA 3EQLC 4TKOB 4DR4L 1JT8A 2V1CC 4BBSB 2NN6H 4A3JH 2PNRC 4JI1L 1UEAB 1SMXA 2RCFA 3S15B 3PF5A 4B3TL 5J3BA 4EQOA 4IUVA 1JJGA 4LFBL 5E3FA 5I2XA 1D1KA 4DAVA 4HJ7A 3MHBA 1JMCA 1CTMA 4K5VA 1XNQQ 3IL8A 2RSOA 4MHEA 1ET9A 4GOPB 1EFID 5EPJA 2OEOA 3NWSA 2D9UA 4BY7G 3BG3A 1YNNC 4BA2I 5IYBG 2RCNA 4LMQD 3VYUA 4NMZA 4V0BA 2PW5A 2SOBA 1B50A 4B3RL 3L9AX 1I50H 4OWXB 3S1QB 5DNFA 1GKHA 3M7NA 3Q23A 2C35B 2CFMA 4A3LH 1QWYA 2ZXOA 1IL8A 2E5LL 1XMOQ 5C6AA 4X6AH 5EKIA 2HIXA 4GKKQ 4B3RQ 1T9HA 2NVXH 4DV2Q 3F1ZA 4JV5L 2BA0A 4JPBW 4A3IH 1TVXA 2VB3X 3OHXC 2R93G 2HHHQ 2D62A 2NWGA 1C0AA 1RD9D 4IPCA 2A6HD 4GN4B 1F9RA 5FOBB 2WACA 4BXXH 4PZ7A 3M4QA 1Q8KA 1E1OA 1LACA 3I73A 1HFNA 5C4XG 1AFPA 5GROA 1I50B 2RVLA 4JI0Q 4S3SA 1FNUA 1PTOF 4BA1I 4A3LG 3NE5B 2KCMA 4A3DG 5C3EH 1CKOA 1IW7C 4R4OA 4ILWA 2R7ZH 3QOJA 4J1MA 4R1JA 4CDCC 4O0AA 1E3PA 3Q0AA 1D7QA 4GN5A 1NTGA 4M8AA 1VCIA 3KLSA 2JA8G 2HQEA 1FNWA 4DV7Q 4YIJA 1UE1A 1EQVA 1KLGD 4LF9L 4CHTB 2UUBQ 4KN7C 2VW9A 4LF6Q 2EYMA 3KJOA 3TP8A 3RUZA 3FMCA 3MXPA 1WI5A 4YHHQ 3NBIA 1KABA 2JA5G 1A15A 1V1QA 3HOUH 2Z4HA 1EYCA 1PZID 3FKIB 1TS3A 1KTKA 2K4KA 4A3BB 5ELFA 2Z9HA 2DGYA 1XTDA 1QNUA 1VQ8A 2E2HH 3MZ5A 4EGVA 4OWTB 4JI4L 2NN6I 2PZTA 3CHBD 4X64Q 2VNUD 1YHAA 5I4DA 3S16B 3BS1A 1KIXA 2CH4A 4LF7L 1YNJD 3M4PA 3F2UA 1SYFA 1KDBA 4DNTB 3K7UC 1D5ZC 3J81i 5TSSA 1KAWA 1HZCA 3J81j 2KCNA 1SYEA 3MAQA 3GTKB 4P72A 2L55A 1XNRQ 2H5XA 3OWEB 3HOUG 4NKLA 2HCCA 3CC4A 3A0JA 4LF9Q 2OTLA 2WB1E 3V2TA 5IYDH 2ZTCA 4C3HG 3HOVH 1MBYA 1TWFH 3M85A 2I5LX 4A3IG 4CKEA 1Q46A 1BBXC 1CI3M 2WV6D 1XXGA 1XMQL 1K3BC 2F0UA 1DOLA 2PO4A 4IPDA 3PF4A 3PO3B 3TDQA 1EY6A 2CVRA 2CHBD 2NZOA 3K5MA 1SDFA 1SEBD 2BA1A 3D3RA 4JBMA 4P74A 1YIJA 3GP7A 1TS4A 2ZTEA 1VQGA 1STAA 3BDLA 1Y1WG 1D6EC 2RBMA 1EWHA 5CR3A 4DV0Q 2NVYB 1H9SA 2F0QA 3SK8A 3CMEA 1HA5A 1NMFA 3W1GA 5IWAQ 5IYDG 3H94A 1VQEA 5DM63 4IUNA 2X6GA 5C4JB 4EQNA 4NXNL 2GA4B 2Z4IA 1MKHA 3D4RA 3BDOA 2NVTH 2RHQB 1OXTA 4JI2L 2FJ2A 4J8QA 4JI0L 2B63H 3A5UA 1GHJA 3CCLA 5C4XB 1ICWA 2EJMA 1F2MA 3UE1A 1P16A 5D14A 3HOYB 4QGUA 1WD0A 5J22A 4O2DA 1HUMA 4BY1G 1D2BA 4K5WA 3S2DB 1O7LA 5JJKA 2F0IA 3LGJA 5CYUA 3HZXA 3TZDA 1STEA 2PMZE 1YITA 4LF7Q 2L9HA 2MHVA 5IP9G 5C4JH 1A3VA 2EVBA 4KKSA 5CV8A 2PQAA 4I7ZC 1G8ZD 5IGDA 1LTGD 4JI7L 3HG9A 1MGSA 3E6ZX 1J5EL 3SHLA 3J81L 2IHFA 2PPBC 2R93B 4DU9A 2JQOA 2VZAA 4MN3A 2E5LQ 4IURA 4PQXA 2R7ZB 4C1NI 1ILPA 1FNVA 1KAAA 5JEAH 2JP1A 1A62A 3D0FA 1F9PA 2E76C 3I4OA 5KNDA 4A3KB 4RGMA 5CV7A 1LTSD 4FP5D 2EIFA 4DV5Q 1A6XA 1EEFD 1VQFA 1IKLA 5IYCH 1PDQA 1M8AA 2CWPA 4HAEA 2SEBD 3S2HB 4PMCA 2K03A 1PTOD 5T1IA 2R61A 3H15A 4G7ZC 1VDZA 1H9MA 2EYLA 1GD7A 2WP8J 5K36H 4OELB 2B8GA 5FK9C 3HOXH 3GQBA 3DLLA 1GOZA 1YJNA 4Z9CB 2DY7A 5EBDA 3S16H 2K75A 1ONLA 2K32A 2WFWA 3RLFA 1SNQA 5L37A 4X62Q 4QMGA 3EROA 1TIID 3KF6B 3CCSA 3TBIB 1M4VA 3CCJA 4CKCA 1TKWB 4LFCL 1R4QB 2OXPA 3I4NB 2NVQH 4XDXA 2IX0A 2QCPX 4A3BH 5AJ3L 3GTQB 4L5TA 4DR5Q 3AMUA 1QUQB 4A3DH 5ELEA 1EY7A 3CP0A 5J1ZA 1DM0B 2ID0A 4UDUC 1D1IA 4EVOA 3OYYA 1Q1EA 1U0LA 2E2JB 2VXWA 3I3CA 2B39A 4A3JB 3D6WA 2ZXRA 3OOCA 2Z8LA 1VQAA 5K5PA 1JQYD 1ZYRC 2DJGC 2Z6KA 1XNQL 1LTAD 2B63B 1QILA 4JBJA 2UUBL 4DR1L 2D0PA 2CH4W 3CCEA 1XPUA 4BXXG 1HPCA 4CDFC 5KIXA 2UXDQ 2AWOA 3ND8A 2AMCB 3V96A 3G71A 1G6ZA 4FDBA 4H02A 5E4WC 1ENAA 2CQOA 1FYCA 1HTLD 2KA7A 3WOEA 1D8LA 3GTLB 2NZHA 4K2KA 2J7ZA 1DJRD 5JJLA 2YYZA 2N8NA 2FFKB 1NE3A 2R92B 1YBYA 1DOMA 3TP7A 5M3MB 1B8AA 3UDXA 3K59A 5M3FB 3TQYA 2XWBB 4DR6Q 3T51B 1I94Q 1SN8A 4UPAA 3H0GG 3HOXB 1JOQA 4LFAQ 3OW2A 1GVPA 1QOHA 4RHSA 2EYPA 4GKKL 2ALYB 2ZXPA 3K58A 3GO5A 1LT5D 1K0SA 3RN2A 4XQJA 2XSCA 4YY3L 2A6EC 3OMGA 1IBLQ 1E1TA 2D5DA 3EIVA 4HJAA 4OO1G 4OIJA 1BCPC 1EYDA 3PIO3 5IGEA 2K6AA 4A3CH 1E22A 1Z7TA 1HZ9A 4ZLTF 1ENFA 4X64L 1YJ9A 4ME3A 4LAAA 4KLKA 5JPNC 3BDCA 3OMCA 1Y1WB 4ZKBB 1ESRA 2F0HA 2WIIB 3K81C 4FNFA 3CMAA 2JA7H 3IRBA 1SYDA 4B3SQ 2QILA 4F7XA 4POFA 1S5BD 3L2PA 2AHOB 2AWNA 3T53B 3KF8A 3H91A 2R6GA 5M3MG 4UAIA 1JB3A 2LS01 5IP7H 4DUYL 3MC0B 1JICA 1X3FA 4JV5Q 4AQYL 1Y8PB 5CV6A 1QG7A 1WTVA 1SNPA 3MXUA 3NTHA 3SDZA 4RKBA 4XT1B 3G6EA 4AIMA 3I90A 1XWEA 2F1MA 2JA7G 2A69D 1SROA 1S5CD 3KJPA 4RWSC 3MFYA 4L5QA 2EYJA 1PH2A 5GAHC 4NPSA 4ID6A 4IUPA 1IXRA 3SVMA 3CCVA 4OX9Q 1FGUA 2CQAA 3S14B 1H95A 1M1KC 4DKAC 4GOPC 4GLXA 3Q6SA 3OWFA 4G4KA 4N9TA 1KD1C 2K50A 2B2TA 5IGGA 1O80A 2PYKA 4L8JA 3E0JA 2ES2A 2LFNA 1A8VA 1E2WA 4A3EH 1SE3A 1NNXA 2XNAC 1EEID 4ZQ3A 4IOCA 1DOKA 4YWLA 5J39A 5IY0A 4ZUJA 3GD7A 3GV3A 1EIYB 3RZDH 1SJHD 1QZGA 3PIPA 1B53A 1K28A 3EBEA 4R4CA 1UE7A 3BZDB 5EAYA 3PIOA 1IBKL 5JAVA 2YTVA 3DWAA 1I5FA 2F0EA 1V1OA 3X3NA 5COYA 1HNWL 5A2QE 2VL6A 1QVCA 1FD7D 3RMHA 1PYSB 5LMNL 5IP9H 1TY2A 5E7NA 1TT2A 2Q2IA 3I2ZA 3SK6A 1L0XB 3I4LA 2PZWA 1PFSA 3NQTA 3T1HQ 4YWKA 3DMUA 3MWYW 4FXGC 2DY8A 1STNA 4N9PA 2YV5A 1BBUA 1JJ2A 1JOKA 4QIWB 3EN2A 3N6RA 3W1BA 1LM0A 5A35A 1QUQA 1HNZL 4DR4Q 1X32A 1BQQT 2Z6BA 3E9IA 1WD1A 4X66Q 4QCLA 2N88A 1TQOA 1TWAB 5ELOA 4LWCA 3MEFA 3TN2A 2EE1A 3K6OA 4CDEC 2QF7A 3NBHB 1ICFB 1UWVA 1YNJC 3M4OB 1RIPA 5JPMC 1DONA 1VS0A 3PSIA 5IYCG 1DZ1A 4RKLA 2IX3A 4UY8C 1G91A 1WVLA 3K80C 2E2JH 2PQAB 4A3KG 5M5YB 2JA5B 2IX1A 1TS2A 4BBSG 3ULPA 2SDFA 3DEPA 1PTOH 1PV4A 1Y14B 3UE0A 3J7AV 1BCPD 4NDXA 2CW0C 5M3FG 4DNRB 1ENCA 1HQRD 4QUCA 3LX0A 1F77A 1ILQA 3HOUB 2RDGA 1IKMA 1XTCD 3OSOA 1LT6D 1QCBD 1CSPA 3H6MA 2WB1G 4XYOA 4GNXA 4KHPL 2XTIA 1HZAA 4R8NA 3E0EA 1I6VC 3C1FA 1ASYA 4A3FB 1AN8A 4IQZA 1S3OA 4IOAA 3KOJA 3P20A 3U9OA 2F4IA 2PNHA 5FLXc 1MJEA 3DM1A 1I4RA 2HDLA 3J7A5 4QIWE 4DR7Q 4OO1I 3D4WA 3J80i 3FKIG 4B9XA 4DUZQ 5C3EB 2PCFB 2IT1A 3D31A 2Y0SG 3B6YA 5FO8B 1SYBA 1BBWA 2RQXA 3W5OA 4A3EB 2IWHA 1U4PA 3A5ZB 4QJFA 3KBXA 3AB9A 3KBGA 3N52A 2E2IH 1SSOA 4XIGS 4NW2A 5DEHA 3D8GA 2VQFL 1II3A 4LK1C 3GTPH 1I4PA 5EJWA 4KHVA 4X3SA 1KRSA 3AQQA 1GHKA 2Q2TA 1LLRD 4A3GH 2OQKA 3VR2A 2UUAQ 1W2BA 1G2SA 2JYOA 2Q2UA 4DK6C 3CKIB 2D0OA 5CMDA 4JK1C 2OCEA 1I94L 3W3AA 3W2DA 4A3MB 1UEBA 1Q82C 3E3XA 5BN4A 4FXDA 2EY6A 1BNZA 1Q12A 4ABNA 3I70A 3CPWA 2LY7A 3TSSA 2GN5A 2A6ED 3ULLA 3PV0A 1BO0A 1V1PB 2A19A 1YNND 1RHPA 4DXGA 1CKNB 1EY8A 1LTID 4MIUA 4C56C 4V190 2L4NA 2XN9C 3VDYA 2EJGC 4HMJA 5C0XH 3S2DH 3T16A 2OQ0A 4HTHA 4A3CG 3AFPA 3Q22A 2ZJQA 1WTQA 1HRJA 1Q8IA 1WYDA 4CJ2C 4P73A 1L1OC 1IZ6A 3J7AF 4KJOA 3K5NA 1MSGA 4FO2A 3BVZA 3MTSA 1U4RA 4ODGA 2F4VQ 1EIFA 1SE8A 3QB3A 5JEAJ 4PNYA 1E0BA 4PZ8A 1SNCA 1K0RA 4R4QA 4XQNA 3VYRA 4HMIA 4F88A 3U4VA 2YTXA 1A3UA 3H0GH 4P71A 1NCVA 4DAYA 4DK0A 3A8IE 1SMYD 1TWFB 3AU7A 1HUNA 4L63B 2Z6KC 1PH4A 5KYIA 1XMOL 1UNSA 3P75A 1JE5A 2ASBA 2BE5C 4L5SA 1B1ZA 1JJCB 3VR6A 2I07B 1CM9A 3K8AA 2O5IC 5C0XI 3NENA 5IE8A 1FR3A 1K8OA 2JK8A 3U58A 2A74C 2B2YA 2K5NA 3GTGH 1SR3A 5CC4A 1VQNA 1K8GA 4KKUA 4DV0L 1P8LA 1WCMH 1NR4A 1PHJA 3FVQA 5I6WA 1G6PA 2O5JC 2KHIA 3PGZA 4POGA 1M90C 1EU4A 3NQIA 2UU9L 4IJHA 1S72A 2EYHA 4F8MA 1ASZA 5IT9E 3P7JA 2NVTB 2VUMB 5FJ8G 1PFBA 3E5SA 3T13A 1Y1VG 4HIMA 2XWJB 4F87A 2EZVA 3IAYA 3GTOB 2MO1A 1CQVA 1O78A 2Q8RE 2CWAA 1CHQD 1GUGA 4YHHL 1QJOA 2SNMA 2BCOA 1MJCA 3PQIA 1HR0W 1SBBB 4DV6L 3TRZA 4A3DB 2F3VA 3GTPB 2VQFQ 4K6DA 1I6HH 2JXMB 2L12A 4KI0A 1LUZA 2JA7B 1SNOA 1VQ7A 1HR0Q 2F0WA 4R4TA 1LABA 1Y69U 2H1EA 4QL5A 4I7AA 1N32Q 4KKTA 1J5EQ 4C3IG 1SE4A 1BCPF 3EFXD 4DK1A 2EXZA 3OTOL 2F0VA 3CRLC 4A3JG 1LT4D 3HEJA 1L2FA 1NSNS 2B63G 2IPKD 5AJ3Q 1ET6A 2WB1B 2AUKA 3MA2B 1F9SA 4BBRG 4AYBG 5IGFA 1H9JA 3HOVG 2I5HA 3HKZG 1V8QA 3C3LA 1HQMC 4ZCKA 4KD4A 2TSSA 1TU2B 2Z0SA 4LF6L 5KGUA 1VQLA 3GDEA 1U4MA 2RDHA 4ZAIA 3RN5A 2GVAA 4DFAA 3S1QH 2JA9A 2ZTDA 3RD4A 2F0KA 4TQUS 2J0TD 2IL8A 1N33Q 3AEVA 4K0KQ 1A0IA 1GUNA 4IUTA 1X54A 2R7FA 1AH9A 1N36L 3UDFA 1HTPA 1HR0L 2DUDA 3U50C 4CGYB 3J80L 3LWEA 2JEBI 4MNOA 3M3YB 2F0TA 1KC8C 1K8MA 1NR2A 4RA8A 5I6YA 3L0OA 1HNXQ 4DV6Q 1YHBA 3A7AB 3QR8A 4AQYQ 1QNKA 1MD2D 1U4LA 3DHQA 3AYHB 3Q24A 2WKCA 1Q90A 2VY3A 1JB7A 5FLXE 3I4MG 2G5DA 1SMYC 2PMZB 5C4XH 3C46A 3FKIH 1ZEQX 1H9KA 1TWAH 1CZWA 5EBCA 1GUOA 1STGA 2MUYA 4G7HC 2AQ2B 4DN4M 2R7ZG 4JI7Q 2X69A 1XPRA 4ZKCB 3TS2A 1I3QH 5CBAE 2VQEQ 1BF4A 1EQTA 2Q8TA 1ESFA 1X65A 2EYFA 2NYZD 1S5FD 2NTSA 3UI2A 5BR8Q 5C0XJ 1YVCA 4IALA 4Y7NB 4C3IH 4C3IB 3C2PA 2KQ3A 2F3WA 1K9MC 3GTKH 4KY5A 3CCQA 4X65L 1BOSA 4HR7B 2RHSB 1OO9B 3I4NH 1CKMA 4G57A 1KQSA 2EQSA 3S9WA 1PH8A 2MPMA 3HOWB 4GS3A 3KK7A 4CDDC 5EGTA 2KOLA 5ELCA 5EKLA 3CW2C 2BH2A 2JN4A 3HOYG 4JBKA 1F2ZA 4L5RC 4KTAA 4DV3Q 5C0XG 2K5QA 3VR4A 4LUVA 2K1BA 3S1RB 2A69C 1EZ8A 3PUYA 2F0FA 1IYJB 3NEMA 2F0PA
chains in the Genus database with same CATH topology
1PZKD 1TR5A 2QDBA 3DWPA 1S5ED 2BDNA 3K5OA 3EVQA 2LMCB 1B44D 4XYQA 1EY4A 1KDCA 5A2QL 3NBHA 3K7AB 1EY9A 4X3UA 1GJXA 3NTIA 5KRUA 1C8CA 1V43A 3GTJB 5KYLA 1VF5C 3G7LA 2B2WA 2H4OA 1HFGA 3ZYYX 3KLSX 5I2YA 2A5HA 3PUXA 1XX8A 3BVMA 5IOCA 1C4QA 4FVMA 2RKSA 1MSHA 2MGSA 4G7OC 1AZQA 2K04A 2K01A 4O1NA 4CBVA 1LTBD 2J4XA 1CHPD 2K28A 2K5WA 2KHSA 5CV5A 2TMPA 1QB5D 1TY0A 1X3QA 5IODA 2E2HB 2XVSA 1PTOC 5F2DA 1EL0A 1RTNA 4CJ1B 4X3TA 5KNCA 4L6TB 1RODA 2F0SA 4IZ8A 1SAPA 2JE6I 1PTOB 1PRTB 2NZ1D 5D65A 1ZKOA 4KY6A 1K83B 3H0GB 1W6JA 5DAUA 3HOZB 3S1MB 5I9OA 3J7YW 4RGOS 4EQPA 4P2CB 2ICIA 3ERQA 1G291 4PV1C 3VYTA 1WTOA 3I4MB 1D5MC 4WRDA 1SYCA 4XTCS 1OXUA 5CGKA 2B2VC 2ZT9C 1R4PB 3KLRA 4R9WA 3A56A 1AP0A 4XQQA 5FO9B 2EY5A 5IGCA 5CV4A 1OXVA 3RZOB 5FLXL 4OIKA 1I3QB 3CQZB 3MXNA 4TRDA 2DNCA 2B2VA 2L11A 4DXFA 3LNNA 1SFOB 3TP5A 2BDOA 1BDOA 5AFWA 3ND9A 5BN5A 4DF7A 1XYIA 3J80E 1A3TA 1T5XD 4BS9A 5C3XA 4Q5VA 1EZ6A 3HGBA 5IIFA 1JE4A 2F0LA 5BN3A 1Q3LA 2A68C 3M4YA 1JR0D 1LT3D 1Y8OB 4QUFA 5FKAC 3L7ZC 3S1NB 1PRTF 1R9TB 3TZUA 1SE2A 2FMCA 2Z1CA 2JA8B 4OL7A 2N55A 2RDFA 1B9NA 5LL6X 2Q8IB 4X3KA 3SE0A 2V4DA 1TWHB 2XIWA 3R93A 3GTGB 3JAML 3SK5A 1MI2A 3TMEA 4RFBA 5CBEE 1L0YB 5CORA 2F0NA 1WTRA 4FXKC 1HXYD 1PYWD 1JCKB 2B8FA 3QG1A 4E6IA 2AUJD 1PMRA 4RHRA 1C48A 1EIGA 1UAPA 3M7GA 3T56B 1EY0A 2B2WC 3P1HA 3VA5A 1CA6A 3SEBA 4KMUC 1AW7A 2BOSA 3LWUA 3OIQA 3SR1A 4C3JG 2QKIC 2D2CC 2O4XA 1IW7D 1BXTA 4K8JA 3NSWA 1G2TA 1AEXA 3PUWA 3HP3A 3HRZC 1DXMA 1BR9A 3EJIA 3MEHA 1E2VA 4KN4C 4K6LA 1J8IA 3OW7A 4J6HA 1EYAA 2AQ1B 1PRTD 1W6KA 5C44B 1GUTA 2PQEA 2G9DA 2MP1A 4RGTA 1O7ZA 4PMWA 3K0YA 1HA6A 4QB4A 3SK4A 3GV6A 4U673 3G6JB 1STYA 4R8IA 4WFN3 3CRKC 1I4HA 1PZJD 1CFMA 2EDGA 4K14A 2F0JA 1OXSC 1E2ZA 4FF1A 2KJXA 1GUSA 1AZPA 4FF3A 3HOVB 5JJZA 3EA6A 3O13A 2FINB 3R3OA 3K5LA 1CZGA 2SNSA 1RTOA 3NUCA 5C4HA 1JORA 1JOOA 3QJYA 1GUWA 2HDMA 2EPBA 1CQFA 3ONAB 4TSSA 3DWQA 5JVH3 3NTKA 1HCZA 4RH6A 1I4XA 2NB0A 3L3OC 1RJTA 1EU3A 5C3WA 2XRQD 4IN3A 2M9VA 5C4ZA 4H13C 1D5XC 1EIHA 1IHZA 5DM73 2F03A 3H3VC 5ELDA 2K7VA 1S4ZA 4IFDH 1BCPB 2LKVA 1IYVA 4RCNA 2RSNA 3QOLA 5M5XB 2KEEA 1RF2D 3BYTB 1GXDC 2EY2A 4JBWA 3OPOA 2PZUA 3T4AC 2VB2X 3PUVA 4BY7B 5EQ0A 3NP8A 2F0DA 3MXGA 1PXUA 1NAPA 4M1UB 2FHTA 1RDPD 1A2UA 1PLFA 1Z47A 1OXXK 1TWCB 3C1EA 2L0CA 3DXJC 3NXWA 1DD2A 1KDAA 1T5EA 3IFDA 3R8BA 3ITPA 4B9WA 4HN7A 3BVGA 2NVQB 4KK7A 3HKZB 2RA4A 1NUCA 2O2LD 4DGZA 4I65A 5LHY1 4RCOA 3NPPA 4KV6A 1TS5A 1WTXA 3V05A 3RZDB 1F2YA 2A6HC 2NTTA 5KNBA 4IUQA 5C5MA 1ZYRD 2C9OA 1Y8NB 3BYYB 4XXEA 2M2LA 2OF1A 2JEAI 1SNMA 4ZK9B 2B2YC 4FF4A 3FPPA 5ISRA 1KLUD 4NP5A 1PFNA 4DA2A 3R2TA 4HSPA 2F0MA 3PO2B 5EKKA 4HSVA 3I91A 4IFDG 1LTRD 1PFMA 1U9RA 3NHHA 2Y0SB 2ENBA 2HCIA 1I4QA 2NUCA 5JEAG 4A93B 1TWGB 4RGNA 2AQ3B 3QO2A 5HGTA 3IFTA 3CU7A 5T1GA 2PW7A 4IFDJ 3NWTA 2E75C 2M00A 4IFDI 4K5XA 2WKDA 4BWGB 1STBA 1VMCA 1JC7A 3VR3A 1KNEA 2FMMA 5M5WB 4GZYC 1Z6HA 4KJNA 1Y1VB 3D4DA 3A55A 1STHA 1X3PA 2E2DC 4CJ0B 3PIP3 2A73B 2B2UA 1H9SB 2KVMA 2NN6G 1ZXTA 4ME5A 1B3AA 2F0GA 1LTTD 3HS0C 3U9SA 4K2LA 4WJWA 4B08A 2KCCA 4H7BA 3X3MA 4HCEA 5I9PA 1B9MA 1EWCA 5D3DA 1SYGA 4BBRB 2KUMA 5M9OA 1SJED 3K57A 4KD3A 3GTMB 3MVVA 3DEOA 4HEDA 3FRPB 2A68D 1CK1A 1I4GA 3SXHA 4K8IA 4XT3B 1WTWA 1UUPA 1KNAA 2EYOA 4KY7A 1IYUA 4C2MB 5EPLA 4RAUC 2R3ZA 1H9RA 1RCVD 3A8JE 4DAPA 5JOBA 1S5DD 3NK9A 1DCZA 3KUPA 4KHZA 1VF7A 4O42A 2ICEC 2L5TA 5D3IB 3PMFA 2I46A 3A8KE 3QIAA 3IKJA 1WCMB 2E74C 2X6LA 2EOTA 4LJZC 1JWSD 4WORA 4ZRZA 1EOTA 1LO5D 3PUZA 2G9HD 3A54A 1VMPA 1O7YA 5K36G 3D6CA 3I72A 2IW3A 4U68A 5EPKA 3FDTA 3VA7A 1B2TA 2CW0D 1EY5A 5NUCA 4C1NK 3I8ZA 1FGBD 4FF2A 1Q1BA 1F9QA 2JSOA 4QF4A 4C3HB 1V1PA 4OGQC 2JA6B 2WINB 5IT9L 1B4OA 3R2IA 5C5LA 1A2TA 4HCSA 2NBFA 3H09A 5FO7B 3S17B 3TP6A 1LV9A 1HHVA 2B2TC 1JWMD 1CA5A 1PRTC 1SNDA 4ZYSA 3JAME 4ZUIA 4A3IB 5HURA 2F0OA 4ULLA 2NVXB 2C5CA 2EY1A 4BY1B 2MJ8A 3MFGA 4AYBB 3J81E 5JVG3 3VYSA 1WTPA 2OT2A 2K33A 1F2LA 2KECA 4Q0FA 2YU9B 3QWNA 4C3JB 2XRSD 2QEJC 2DNEA 3DUZA 1SXTA 2K5DA 4IUUA 2IJ0A 3FPUB 4PMBA 1JWUD 2B2UC 2E2IB 2DN8A 4H0LC 2K05A 3WOFA 1QE6A 1ML0D 3WDNA 3URYA 4A3GB 5E4XA 1RKNA 5IGBA 5LL6S 5G3LD 1CT1D 4H44C 2KEDA 4OHJA 1BUVT 1J9OA 4OO1H 4FYDA 2WAQB 5KEEA 3FEWX 2L1BA 2BE5D 5CV9A 5E1FA 4CKBA 2HUGA 2EJFC 3VR5A 5ELBA 1I6HB 3OIPA 1DYQA 3A7LA 3EQLC 4TKOB 4BBSB 2NN6H 2PNRC 1UEAB 3S15B 4EQOA 4IUVA 4DAVA 5E3FA 1D1KA 5I2XA 3MHBA 1CTMA 4K5VA 3IL8A 2RSOA 4MHEA 1ET9A 1EFID 5EPJA 2OEOA 3NWSA 2D9UA 3BG3A 1YNNC 4BA2I 4LMQD 3VYUA 4NMZA 4V0BA 2PW5A 2SOBA 1B50A 3L9AX 3S1QB 5DNFA 3M7NA 3Q23A 1QWYA 2ZXOA 1IL8A 5C6AA 5EKIA 2BA0A 1TVXA 2VB3X 3OHXC 2D62A 2NWGA 1RD9D 2A6HD 1F9RA 5FOBB 2WACA 1LACA 3I73A 1HFNA 1AFPA 1I50B 2RVLA 4S3SA 1FNUA 1PTOF 4BA1I 3NE5B 1IW7C 4ILWA 3QOJA 4J1MA 3Q0AA 4M8AA 1VCIA 3KLSA 2HQEA 1FNWA 4YIJA 1EQVA 1KLGD 4CHTB 4KN7C 2EYMA 3TP8A 3RUZA 3FMCA 3MXPA 3NBIA 1KABA 1A15A 2Z4HA 1EYCA 1PZID 3FKIB 1TS3A 1KTKA 4A3BB 5ELFA 1QNUA 3MZ5A 4EGVA 2NN6I 2PZTA 3CHBD 2VNUD 5I4DA 3S16B 3BS1A 1YNJD 3F2UA 1SYFA 1KDBA 4DNTB 1D5ZC 5TSSA 2KCNA 1SYEA 3MAQA 3GTKB 2L55A 3OWEB 4NKLA 2HCCA 3V2TA 4C3HG 1MBYA 3M85A 4CKEA 1BBXC 1CI3M 2WV6D 1XXGA 2F0UA 1DOLA 2PO4A 3PO3B 3TDQA 1EY6A 2CVRA 2CHBD 3K5MA 1SDFA 1SEBD 2BA1A 3D3RA 3GP7A 1TS4A 1STAA 3BDLA 1D6EC 2RBMA 1EWHA 5CR3A 2NVYB 1H9SA 2F0QA 3SK8A 1HA5A 3H94A 5DM63 4IUNA 2X6GA 5C4JB 4EQNA 2GA4B 2Z4IA 3D4RA 3BDOA 1OXTA 2FJ2A 4J8QA 1GHJA 5C4XB 1ICWA 2EJMA 1F2MA 5D14A 3HOYB 1WD0A 5J22A 1HUMA 1D2BA 4K5WA 3S2DB 1O7LA 2F0IA 5CYUA 3HZXA 3TZDA 1STEA 2L9HA 2MHVA 1A3VA 2EVBA 4KKSA 5CV8A 4I7ZC 1G8ZD 5IGDA 1LTGD 3HG9A 1MGSA 3E6ZX 3SHLA 3J81L 2PPBC 2R93B 4DU9A 4MN3A 4IURA 4PQXA 2R7ZB 4C1NI 1ILPA 1FNVA 1KAAA 5JEAH 2JP1A 1F9PA 2E76C 5KNDA 4A3KB 4RGMA 5CV7A 1LTSD 4FP5D 1A6XA 1EEFD 1IKLA 1PDQA 1M8AA 4HAEA 2SEBD 3S2HB 4PMCA 2K03A 1PTOD 5T1IA 2R61A 4G7ZC 1VDZA 1H9MA 2EYLA 2WP8J 5K36H 2B8GA 5FK9C 3GQBA 1GOZA 4Z9CB 2DY7A 5EBDA 1ONLA 2K32A 3RLFA 1SNQA 4QMGA 3EROA 1TIID 3TBIB 1M4VA 4CKCA 1TKWB 1R4QB 3I4NB 2OXPA 4XDXA 2IX0A 2QCPX 3GTQB 3AMUA 5ELEA 1EY7A 5J1ZA 1DM0B 2ID0A 4UDUC 1D1IA 4EVOA 1Q1EA 2E2JB 2VXWA 3I3CA 2B39A 4A3JB 3D6WA 2ZXRA 3OOCA 2Z8LA 5K5PA 1JQYD 1ZYRC 1LTAD 2B63B 1QILA 1HPCA 5KIXA 2AWOA 3ND8A 3V96A 1G6ZA 5E4WC 1ENAA 1FYCA 1HTLD 2KA7A 3WOEA 3GTLB 4K2KA 2J7ZA 1DJRD 2YYZA 2FFKB 2R92B 1DOMA 3TP7A 5M3MB 3K59A 5M3FB 2XWBB 3T51B 3HOXB 1JOQA 1QOHA 4RHSA 2EYPA 3K58A 2ZXPA 3GO5A 1LT5D 4XQJA 2XSCA 2A6EC 3OMGA 2D5DA 4OO1G 4OIJA 1BCPC 1EYDA 3PIO3 5IGEA 2K6AA 1Z7TA 4ZLTF 1ENFA 4LAAA 5JPNC 1Y1WB 3BDCA 3OMCA 4ZKBB 1ESRA 2F0HA 2WIIB 4FNFA 1SYDA 2QILA 4F7XA 1S5BD 2AWNA 3T53B 3KF8A 3H91A 2R6GA 4UAIA 1JB3A 2LS01 3MC0B 1JICA 1Y8PB 5CV6A 1QG7A 1WTVA 1SNPA 3MXUA 3SDZA 3NTHA 4RKBA 4XT1B 3I90A 1XWEA 2F1MA 2A69D 1S5CD 4RWSC 3MFYA 2EYJA 3SVMA 4ID6A 4IUPA 3S14B 2CQAA 3Q6SA 3OWFA 4G4KA 4N9TA 5IGGA 2B2TA 1O80A 2PYKA 4L8JA 3E0JA 2LFNA 1E2WA 1SE3A 2XNAC 1EEID 4ZQ3A 1DOKA 5J39A 4ZUJA 3GD7A 3GV3A 1SJHD 1B53A 3BZDB 5JAVA 3DWAA 2F0EA 1V1OA 3X3NA 5COYA 5A2QE 1FD7D 3RMHA 1TY2A 1TT2A 3SK6A 1L0XB 3I4LA 2PZWA 3NQTA 3DMUA 3MWYW 4FXGC 2DY8A 1STNA 4N9PA 1JOKA 4QIWB 3N6RA 5A35A 1X32A 1BQQT 1WD1A 4QCLA 2N88A 1TQOA 1TWAB 3TN2A 2EE1A 3K6OA 2QF7A 1YNJC 3M4OB 5JPMC 1DONA 1DZ1A 4RKLA 2IX3A 1G91A 1WVLA 5M5YB 2JA5B 2IX1A 1TS2A 2SDFA 3DEPA 1PTOH 3J7AV 1BCPD 4NDXA 2CW0C 4DNRB 1ENCA 1HQRD 4QUCA 3LX0A 1F77A 1ILQA 3HOUB 2RDGA 1IKMA 1XTCD 3OSOA 1LT6D 1QCBD 3H6MA 4XYOA 4R8NA 1I6VC 3C1FA 4A3FB 1AN8A 4IQZA 3P20A 3U9OA 2F4IA 3DM1A 1I4RA 2HDLA 4OO1I 3D4WA 4B9XA 5C3EB 2PCFB 2IT1A 3D31A 5FO8B 1SYBA 2RQXA 4A3EB 2IWHA 1U4PA 3KBXA 3AB9A 3KBGA 3N52A 1SSOA 4XIGS 4NW2A 5DEHA 3D8GA 1II3A 4LK1C 1I4PA 5EJWA 4KHVA 4X3SA 1GHKA 1LLRD 3VR2A 1G2SA 2JYOA 3CKIB 5CMDA 4JK1C 3W3AA 3W2DA 4A3MB 5BN4A 4FXDA 2EY6A 1BNZA 1Q12A 4ABNA 3I70A 2LY7A 3TSSA 2A6ED 3PV0A 1BO0A 1V1PB 1YNND 1RHPA 4DXGA 1EY8A 1LTID 4MIUA 4C56C 4V190 2L4NA 2XN9C 2EJGC 4HMJA 5C0XH 3T16A 4HTHA 3Q22A 1WTQA 1HRJA 1Q8IA 4CJ2C 3J7AF 4KJOA 3K5NA 1MSGA 4FO2A 3BVZA 3MTSA 1U4RA 4ODGA 5JEAJ 3QB3A 4PNYA 1E0BA 1SNCA 4XQNA 3VYRA 4HMIA 4F88A 1A3UA 1NCVA 4DAYA 4DK0A 3A8IE 1SMYD 1TWFB 3AU7A 1HUNA 4L63B 5KYIA 1UNSA 3P75A 2BE5C 1B1ZA 3VR6A 2I07B 1CM9A 2O5IC 5C0XI 1FR3A 1K8OA 2A74C 2B2YA 5CC4A 4KKUA 1NR4A 3FVQA 5I6WA 2O5JC 1EU4A 3NQIA 2EYHA 4F8MA 5IT9E 3P7JA 2NVTB 2VUMB 1PFBA 3E5SA 3T13A 2XWJB 4F87A 2EZVA 3IAYA 3GTOB 1CQVA 1O78A 2Q8RE 1CHQD 1GUGA 1QJOA 2SNMA 2BCOA 1SBBB 4A3DB 2F3VA 3GTPB 4K6DA 2JXMB 2L12A 4KI0A 2JA7B 1SNOA 2F0WA 1LABA 1Y69U 2H1EA 4KKTA 4C3IG 1SE4A 1BCPF 3EFXD 4DK1A 2EXZA 2F0VA 3CRLC 1LT4D 3HEJA 1NSNS 2IPKD 1ET6A 2WB1B 2AUKA 3MA2B 1F9SA 5IGFA 1H9JA 1V8QA 3C3LA 1HQMC 4KD4A 2TSSA 1TU2B 5KGUA 1U4MA 2RDHA 4ZAIA 4DFAA 3RD4A 2F0KA 4TQUS 2J0TD 2IL8A 1GUNA 4IUTA 1HTPA 4CGYB 3J80L 3LWEA 2JEBI 3M3YB 2F0TA 1K8MA 1NR2A 4RA8A 5I6YA 3A7AB 1QNKA 1MD2D 1U4LA 3DHQA 3Q24A 2WKCA 1Q90A 5FLXE 1SMYC 2PMZB 3C46A 1ZEQX 1H9KA 1CZWA 5EBCA 1GUOA 4G7HC 1STGA 2MUYA 2AQ2B 4DN4M 2X69A 4ZKCB 5CBAE 1BF4A 1EQTA 2Q8TA 1ESFA 2EYFA 2NYZD 1S5FD 2NTSA 3UI2A 5C0XJ 4IALA 4Y7NB 4C3IB 3C2PA 2KQ3A 2F3WA 4KY5A 1BOSA 4HR7B 1OO9B 4G57A 3S9WA 2MPMA 3HOWB 3KK7A 5EGTA 2KOLA 5ELCA 5EKLA 1F2ZA 4KTAA 5C0XG 2K5QA 3VR4A 2K1BA 3S1RB 2A69C 1EZ8A 3PUYA 2F0FA 5G3LF 2F0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEC A;  1IKM A;  3Q6S A;  1PLF A;  1ILP A;  1IL8 A;  2N55 A;  1VMC A;  1CM9 A;  2B2T A;  2JP1 A;  3KUP A;  3IFD A;  5EKI A;  1KNE A;  1O80 A;  2FMM A;  1F9P A;  1BBX C;  4O42 A;  4X3K A;  2J7Z A;  2BDN A;  1TVX A;  2IL8 A;  2B2Y A;  2FFK B;  2XIW A;  3R93 A;  1DOL A;  2RA4 A;  1IKL A;  4IUT A;  1AZP A;  2NWG A;  1DOM A;  3DM1 A;  2CVR A;  1WTO A;  4IUU A;  1DOK A;  1MI2 A;  1PDQ A;  2HDL A;  1F9R A;  5JJZ A;  2X6L A;  1NR4 A;  1SDF A;  3FPU B;  1M8A A;  3GV3 A;  1WTX A;  4X3U A;  4HAE A;  2FIN B;  2B2U C;  2EOT A;  2K03 A;  3LWE A;  2B2V C;  5CBE E;  5T1I A;  1B53 A;  5COR A;  4IUQ A;  2K05 A;  1NR2 A;  4RA8 A;  1C8C A;  1X3P A;  1HFN A;  1RTO A;  1WTR A;  1QE6 A;  1QNK A;  4R9W A;  1ML0 D;  1U4L A;  1EOT A;  1AP0 A;  2RVL A;  4CJ0 B;  3P7J A;  3G7L A;  1GUW A;  2B2W A;  1HFG A;  1U4P A;  2M2L A;  1VMP A;  3KBX A;  3N52 A;  1O7Y A;  1SSO A;  5E4X A;  4NW2 A;  5COY A;  2B2U A;  2KVM A;  1EIG A;  2HDM A;  1ZXT A;  2X6G A;  2EPB A;  4U68 A;  5EPK A;  1PFB A;  2DY7 A;  4OIK A;  3FDT A;  3ONA B;  4OIJ A;  1B3A A;  5EJW A;  4X3S A;  2KED A;  1B2T A;  2B2W C;  1J9O A;  4ZK9 B;  2B2Y C;  1XX8 A;  1CA6 A;  3I8Z A;  4ZLT F;  2L1B A;  1G2S A;  2JYO A;  1RJT A;  2Q8R E;  2HUG A;  2FJ2 A;  4ZKB B;  1ESR A;  4DN4 M;  4XDX A;  5CMD A;  1MSH A;  2B2V A;  2X69 A;  2FHT A;  3MWY W;  1F9Q A;  2L11 A;  4ZKC B;  5CBA E;  1BF4 A;  1ICW A;  1PFN A;  2DY8 A;  2MGS A;  1AZQ A;  1EQT A;  1BNZ A;  2K04 A;  2Q8T A;  2K01 A;  1A15 A;  1BO0 A;  5D14 A;  1B4O A;  2K28 A;  1RHP A;  2NYZ D;  2KUM A;  4HCS A;  4HSV A;  1G2T A;  1WD0 A;  2L12 A;  3UI2 A;  3I91 A;  3HP3 A;  1EIH A;  3H91 A;  1X32 A;  1HUM A;  2L4N A;  1WD1 A;  4IUV A;  1X3Q A;  2N88 A;  5AFW A;  1XYI A;  1S4Z A;  3TN2 A;  2EE1 A;  1PFM A;  1LV9 A;  2H1E A;  4UAI A;  1HHV A;  2VXW A;  3I3C A;  2B2T C;  3TZD A;  1WTQ A;  1HRJ A;  3D6W A;  3DEO A;  4CJ2 C;  1CA5 A;  2HCI A;  2L9H A;  1JIC A;  2RSN A;  4HED A;  1EL0 A;  1J8I A;  1MSG A;  1RTN A;  4CJ1 B;  2MPM A;  3IL8 A;  2RSO A;  2KEE A;  1DON A;  3MTS A;  1U4R A;  1DZ1 A;  1QG7 A;  4X3T A;  1WTV A;  2KOL A;  4MHE A;  1JE4 A;  5EPJ A;  4XT1 B;  4XT3 B;  1G91 A;  1WTW A;  1E0B A;  1WVL A;  1F9S A;  1Q3L A;  1MGS A;  3F2U A;  1KNA A;  1ROD A;  2D9U A;  3QO2 A;  1SAP A;  2MP1 A;  2SDF A;  3DEP A;  1O7Z A;  3I90 A;  4LMQ D;  4QUF A;  2MJ8 A;  5T1G A;  5EQ0 A;  1NCV A;  1B50 A;  4RWS C;  1WTP A;  1HA6 A;  4MN3 A;  3SVM A;  4IUP A;  1HUN A;  2NZ1 D;  5EPL A;  5D65 A;  5DNF A;  2K1B A;  3GV6 A;  1NAP A;  4QUC A;  2HCC A;  4IUR A;  4RAU C;  2R3Z A;  1U4M A;  1ILQ A;  1G6Z A;  5E4W C;  4R8I A;  4ZAI A;  1F2L A; 
#chains in the Genus database with same CATH topology
 5DLQ E;  1PZK D;  5IWA L;  1TR5 A;  4DR3 L;  4Y7N H;  1XPO A;  4C2M H;  4OEM B;  2QDB A;  3DWP A;  1S5E D;  2BDN A;  3K5O A;  4GN3 B;  1VQJ A;  4NXM L;  3EVQ A;  3M3Y H;  2LMC B;  1B44 D;  4XYQ A;  1EY4 A;  1KDC A;  4N8F A;  3S24 A;  5A2Q L;  3RR5 A;  3NBH A;  4J15 A;  3K7A B;  1EY9 A;  4X3U A;  1YJW A;  1GJX A;  3NTI A;  3PO3 H;  1FL0 A;  5KRU A;  1PH6 A;  1VQ9 A;  1N33 L;  2HT1 A;  3CPF A;  1GM5 A;  1C8C A;  1V43 A;  3T1H L;  3GTJ H;  3GTJ B;  1PH7 A;  5KYL A;  4C3J H;  1VF5 C;  3G7L A;  1SFO H;  2B2W A;  2H4O A;  1HFG A;  5C44 H;  4MTN A;  3FP9 A;  3ZYY X;  2JA6 G;  5JJI A;  3KLS X;  4HJ8 A;  1R9T H;  4A3B G;  5I2Y A;  2A5H A;  3PUX A;  1NMG A;  2VQE L;  1XX8 A;  3BVM A;  5GAD C;  5IOC A;  1HJP A;  3JAM i;  1C4Q A;  4FVM A;  2RKS A;  1MSH A;  2K52 A;  4WJ3 M;  2MGS A;  4G7O C;  1AZQ A;  2K04 A;  2K01 A;  4O1N A;  1TXY A;  4CBV A;  1LTB D;  2J4X A;  1CHP D;  2K28 A;  2K5W A;  2KHS A;  3TEH B;  2A8V A;  5CV5 A;  2TMP A;  1QB5 D;  1TY0 A;  1X3Q A;  2MO0 A;  5IOD A;  4A3F H;  2E2H B;  2XVS A;  1PTO C;  1X6O A;  5F2D A;  4N8X 1;  1EL0 A;  1RTN A;  1U5K A;  4CJ1 B;  2PI2 A;  4X66 L;  4X3T A;  5KNC A;  1N9W A;  4L6T B;  4DPG A;  1ROD A;  2F0S A;  4IZ8 A;  1SAP A;  1TWH H;  2JE6 I;  1PTO B;  4PZ6 A;  3HKS A;  1PRT B;  2NZ1 D;  4JI1 Q;  5D65 A;  1ZKO A;  5IP7 G;  4KY6 A;  4DV5 L;  1C7Y A;  1K83 B;  3H0G B;  3F2C A;  1W6J A;  4A3F G;  4JI8 Q;  5DAU A;  3HOZ B;  3S1M B;  4DR7 L;  5I9O A;  3J7Y W;  4RGO S;  4EQP A;  4P2C B;  2ICI A;  2KBN A;  3ERQ A;  1G29 1;  4PV1 C;  4OWW B;  3VYT A;  1WTO A;  3I4M B;  1IBK Q;  1D5M C;  4WRD A;  1SYC A;  3RLN A;  4XTC S;  4LW1 A;  1OXU A;  5C3E G;  2UXC Q;  5CGK A;  2B2V C;  2ZT9 C;  1AE3 A;  1R4P B;  3H3V I;  3KLR A;  4R9W A;  3FHW A;  3GTM H;  3A56 A;  1AP0 A;  4AH6 A;  1XNR L;  4XQQ A;  5FO9 B;  2LXJ A;  2EY5 A;  5IGC A;  5CV4 A;  1OXV A;  4DAY B;  4IPH A;  3RZO B;  5FLX L;  4OIK A;  1I3Q B;  3CQZ B;  2ZJR A;  5M5W H;  3MXN A;  5G3L F;  1CUK A;  4TRD A;  2DNC A;  3S15 H;  1PVO A;  2B2V A;  4JI3 Q;  2L11 A;  4DXF A;  5M3M H;  2YU9 H;  3LNN A;  1A63 A;  1SFO B;  3T1Y L;  1DGS A;  3TP5 A;  2UXD L;  2BDO A;  3STB D;  1BDO A;  5AFW A;  3ND9 A;  5BN5 A;  4DF7 A;  1XYI A;  4JI6 L;  3J80 E;  1S40 A;  4JI8 L;  3ERS X;  1A3T A;  1T5X D;  2PI2 E;  3T1Y Q;  4BS9 A;  5C3X A;  1FVI A;  4DNI A;  3F8T A;  4Q5V A;  1EZ6 A;  1VQ4 A;  3HGB A;  5IIF A;  1JE4 A;  2F3I A;  2F0L A;  5BN3 A;  1EFW A;  1Q3L A;  2A68 C;  3M4Y A;  1JR0 D;  2ATW A;  1LT3 D;  1Y8O B;  3M9B A;  3I7F A;  4QUF A;  5FKA C;  3L7Z C;  2IHE A;  4UP9 A;  3HOZ H;  3S1N B;  1PRT F;  3I55 A;  1R9T B;  3KDF A;  3TZU A;  1SE2 A;  2FMC A;  2Z1C A;  2JA8 B;  1VQI A;  4OL7 A;  2N55 A;  5LMU L;  2RDF A;  5GAG C;  1B9N A;  5LL6 X;  1VQC A;  3I4M H;  2Q8I B;  4X3K A;  4DV1 Q;  3SE0 A;  4A3K H;  2V4D A;  1TWH B;  4BBS H;  2XIW A;  3R93 A;  3GTG B;  3JAM L;  4YY3 Q;  3SK5 A;  5GAE C;  2UXC L;  1WCM G;  1AE2 A;  1MI2 A;  4IPG A;  1BKB A;  3TME A;  4RFB A;  4DR5 L;  2RF4 A;  2QW7 A;  5CBE E;  1L0Y B;  5COR A;  2F0N A;  4YWM A;  3ICE A;  3HOZ G;  2R93 H;  1WTR A;  4FXK C;  4YCW A;  1HXY D;  4DR6 L;  2K5V A;  3BJU A;  1PYW D;  1JCK B;  2B8F A;  3QG1 A;  4E6I A;  1PH9 A;  1EQQ A;  4K0K L;  2AUJ D;  1PMR A;  4RHR A;  1C48 A;  1EIG A;  1UAP A;  3M7G A;  1Y1V H;  2ZM6 Q;  4JVZ A;  4LF8 Q;  3T56 B;  1EY0 A;  2B2W C;  4UHV A;  3P1H A;  3VA5 A;  1CA6 A;  4DK3 C;  3SEB A;  4KMU C;  3UDI A;  1AW7 A;  2BOS A;  1TWC H;  3LWU A;  3OIQ A;  3BZK A;  4QY7 A;  3SR1 A;  4BY1 H;  4C3J G;  2QKI C;  3HOY H;  2Q2H A;  2E8G A;  2HD3 A;  3G48 A;  2D2C C;  2O4X A;  2JA6 H;  1IW7 D;  1BXT A;  1X55 A;  4K8J A;  4BY7 H;  3NSW A;  1G2T A;  1AEX A;  1YEZ A;  3PUW A;  3HP3 A;  3HRZ C;  1DXM A;  1BR9 A;  1CSQ A;  3EJI A;  3MEH A;  1MHW C;  1E2V A;  3I56 A;  4KN4 C;  3RLO A;  4RG1 A;  3PCO B;  4APV A;  1SLJ A;  4K6L A;  1J8I A;  3OW7 A;  4J6H A;  5M3F H;  2QEX A;  1EYA A;  2AQ1 B;  1PRT D;  1W6K A;  4DUY Q;  1B3Q A;  5C44 B;  4DV3 L;  1GUT A;  2PQE A;  2G9D A;  2MP1 A;  4RGT A;  1Q7Y C;  1O7Z A;  1IBL L;  3PO3 G;  4PMW A;  3K0Y A;  1HA6 A;  4QB4 A;  3CD6 A;  3SK4 A;  3GV6 A;  4U67 3;  3G6J B;  1STY A;  3RZO H;  4R8I A;  4WFN 3;  2OWO A;  3CRK C;  1I4H A;  1PZJ D;  3K0X A;  1CFM A;  3BZC A;  2EDG A;  4K14 A;  1VQK A;  2F0J A;  1OXS C;  2A1A A;  4DAM A;  3G4S A;  1E2Z A;  2CKZ B;  1O7I A;  4FF1 A;  3CF5 A;  2KJX A;  1GUS A;  1AZP A;  4FF3 A;  3TS0 A;  5H1S E;  3HOV B;  4WJ4 A;  4ALP A;  5JJZ A;  3EA6 A;  3O13 A;  4GKJ L;  2FIN B;  1N8R C;  2F52 A;  3R3O A;  3HOX G;  4YCU A;  3K5L A;  4JI4 Q;  3OTO Q;  4UP8 A;  1FJG L;  1CZG A;  2SNS A;  1RTO A;  3NUC A;  5C4H A;  1JOR A;  4LF5 L;  4A3M G;  4LUO A;  1JOO A;  3QJY A;  1GUW A;  5LMU Q;  4MTK A;  4DV4 L;  4NXM Q;  3JAM c;  4JW0 A;  2HDM A;  2EPB A;  3KFU A;  1CQF A;  4PG3 A;  3ONA B;  4B3T Q;  4TSS A;  3DWQ A;  5JVH 3;  3NTK A;  1HCZ A;  4RH6 A;  1I4X A;  3J80 c;  2NB0 A;  3KYH C;  3L3O C;  1RJT A;  4HID A;  2I0Q A;  1FJG Q;  1EU3 A;  3HOW G;  1WOC A;  4JI5 L;  2HIV A;  1VQ5 A;  1PH5 A;  4JYA L;  4JI2 Q;  5C3W A;  2XRQ D;  4A93 G;  4IN3 A;  4EQ5 A;  3A74 A;  2M9V A;  4OXP A;  5C4Z A;  2R7D A;  4H13 C;  2UUC Q;  2LSS A;  1D5X C;  1EIH A;  1IHZ A;  5DM7 3;  3SGI A;  1HZB A;  2F03 A;  3H3V C;  2I5M X;  5ELD A;  2K7V A;  1S4Z A;  4IFD H;  1BVS A;  1BCP B;  2LKV A;  4DV4 Q;  4HIO A;  1IYV A;  2MFI A;  4RCN A;  2RSN A;  3QOL A;  4MZ9 A;  5M5X B;  2KEE A;  1RF2 D;  3BYT B;  1GXD C;  2EY2 A;  3S1M H;  4JBW A;  3OPO A;  2PZU A;  4YCV A;  3T4A C;  4GKJ Q;  2VB2 X;  3PUV A;  4BY7 B;  1G51 A;  5EQ0 A;  3NP8 A;  1PH3 A;  2F0D A;  3MXG A;  4JI5 Q;  1PXU A;  4B3M L;  2KHJ A;  1NAP A;  4M1U B;  2FHT A;  2LXK A;  1RDP D;  4IO9 A;  1A2U A;  1PLF A;  1Z47 A;  1OXX K;  1TWC B;  3C1E A;  2L0C A;  3DXJ C;  3MXN B;  3NXW A;  1PH1 A;  1DD2 A;  1KDA A;  1T5E A;  2B3G A;  4IJL A;  3IFD A;  2MNA A;  3GTQ H;  3R8B A;  3ITP A;  4B9W A;  4HN7 A;  3BVG A;  2MQH A;  2NVQ B;  2B29 A;  4KK7 A;  3HKZ B;  3U4Z A;  2RA4 A;  1NUC A;  1K73 C;  2O2L D;  4DGZ A;  4I65 A;  5LHY 1;  4RCO A;  3NPP A;  4JOI C;  1NJI C;  4KV6 A;  1TS5 A;  1WTX A;  3V05 A;  3RZD B;  1F2Y A;  2A6H C;  2NTT A;  3CCU A;  5KNB A;  4IUQ A;  4A3M H;  5C5M A;  4NB3 A;  1ZYR D;  2C9O A;  1Y8N B;  3BYY B;  4LFB Q;  3KLW A;  2UU9 Q;  1UE6 A;  4XXE A;  4B3M Q;  2M2L A;  4HJ5 A;  2OF1 A;  1XMQ Q;  1B70 B;  2JEA I;  1SNM A;  4RMF A;  1NY4 A;  4ZK9 B;  2B2Y C;  1N34 L;  4EX5 A;  4FF4 A;  1YNX A;  2K5H A;  3FPP A;  2JA8 H;  5ISR A;  1KLU D;  4LF5 Q;  4NP5 A;  2QDL A;  2P5Z X;  1PFN A;  4DA2 A;  3R2T A;  2K14 A;  4HSP A;  4JOI A;  4DV7 L;  1WTH A;  2F0M A;  4A3G G;  3PO2 B;  5EKK A;  1EYG A;  4HSV A;  1N32 L;  3I91 A;  4IFD G;  3ER0 A;  1CKN A;  1LTR D;  2ZM6 L;  4DR2 Q;  4JG2 A;  1PFM A;  4LFA L;  3S2H H;  4P75 A;  1U9R A;  3NHH A;  2Y0S B;  2ENB A;  2HCI A;  1I4Q A;  2NUC A;  1EUJ A;  5JEA G;  3F2D A;  4A93 B;  1TWG B;  5FLM G;  4RGN A;  2AQ3 B;  3QO2 A;  3S1R H;  1E7Z A;  5HGT A;  3IFT A;  1QVF A;  3NEL A;  1XJV A;  3BU2 A;  3CU7 A;  5T1G A;  2EXD A;  2PW7 A;  4IFD J;  1MIU A;  3NWT A;  2E75 C;  2M00 A;  4IFD I;  4JC0 A;  2OTJ A;  2UUC L;  3I4N G;  4K5X A;  1K83 H;  1W3S A;  2JJQ A;  2WKD A;  1KRT A;  4BWG B;  1STB A;  1L1O A;  3HKZ E;  1RL2 A;  1VMC A;  4TVA B;  5LMN W;  1JC7 A;  4AYB E;  3VR3 A;  1KNE A;  4C3H H;  2FMM A;  4JI6 Q;  5M5W B;  4GZY C;  1N36 Q;  1OTC A;  4QQB X;  1Z6H A;  4KJN A;  2VUM H;  1Y1V B;  3D4D A;  3A55 A;  4NXN Q;  1STH A;  1EQR A;  2AKW B;  5IYB H;  3F2B A;  5M5Y H;  1VQH A;  1GO3 E;  1X3P A;  2E2D C;  1LYL A;  4CJ0 B;  3PIP 3;  1PA6 A;  2A73 B;  2VS1 A;  2B2U A;  1H9S B;  2KVM A;  1C9O A;  2NN6 G;  1ZXT A;  2N49 A;  4ME5 A;  1IBM L;  1X3G A;  1B3A A;  2F0G A;  1LTT D;  3HS0 C;  3Q8D A;  3U9S A;  4K2L A;  3DM3 A;  4WJW A;  3S17 H;  4B08 A;  2KCC A;  1HNW Q;  4H7B A;  4OX9 L;  3J7Z C;  3X3M A;  2UXB Q;  4HCE A;  5I9P A;  5LMN Q;  1B9M A;  1EWC A;  1KL9 A;  1Z9F A;  5C44 G;  1UE5 A;  5D3D A;  3KF8 B;  4HIK A;  1SYG A;  4BBR B;  2KUM A;  1YI2 A;  2Y0S E;  5M9O A;  1SJE D;  4X65 Q;  2R92 H;  4LF4 Q;  1IL2 A;  3K57 A;  4KD3 A;  3GTM B;  3WWV A;  1X9N A;  1VQM A;  5BR8 L;  3MVV A;  1VQB A;  1KXL A;  4KHP Q;  4GNX C;  3DEO A;  3TRE A;  4HED A;  3E9H A;  4DV1 L;  4DV2 L;  3FRP B;  2A68 D;  1CK1 A;  1QVG A;  1I4G A;  3SXH A;  4K8I A;  4XT3 B;  1VQ6 A;  1WTW A;  3S14 H;  1UUP A;  1KNA A;  4LF8 L;  1YZ6 A;  2EYO A;  4KY7 A;  3ZJY C;  4B3S L;  5ELN A;  1LTL A;  1IYU A;  2L15 A;  4C2M B;  5M5X H;  2IY5 B;  5EPL A;  1EWI A;  1L1O B;  1Q81 C;  4RAU C;  2R3Z A;  4GNX B;  1H9R A;  1RCV D;  3A8J E;  2CCZ A;  4BBR H;  4UP7 A;  4DAP A;  1YHQ A;  5JOB A;  4R4I A;  1S5D D;  3NK9 A;  1DCZ A;  1V9P A;  3KUP A;  2YTY A;  2F4V L;  4KHZ A;  1VF7 A;  4O42 A;  3CC7 A;  2ICE C;  4A4I A;  2XGT A;  2L5T A;  2VUM G;  4DUZ L;  5D3I B;  3CAM A;  3PMF A;  2I46 A;  3A8K E;  3QIA A;  3IKJ A;  1X3E A;  4GLV B;  1WCM B;  1WFQ A;  2E74 C;  2X6L A;  3HOW H;  2EOT A;  4LJZ C;  1JWS D;  4A75 A;  3AFQ A;  4WOR A;  4ZRZ A;  1EOT A;  1LO5 D;  3PUZ A;  2G9H D;  3A54 A;  3K7A H;  1VMP A;  4LF4 L;  3CQZ H;  1O7Y A;  5K36 G;  2JA5 H;  5HGQ A;  4DR2 L;  3D6C A;  3I72 A;  2IW3 A;  4U68 A;  5EPK A;  3FDT A;  4OON A;  3VA7 A;  1B2T A;  3KDF B;  1KHI A;  2CW0 D;  1EY5 A;  3CXC A;  2QA4 A;  3CC2 A;  1X56 A;  3GTO H;  5NUC A;  4C1N K;  3I8Z A;  1FGB D;  1WJJ A;  2BH8 A;  1K3R A;  1L0W A;  4FF2 A;  1Q1B A;  1F9Q A;  2JSO A;  4QF4 A;  4C3H B;  1V1P A;  5GQO A;  4OGQ C;  2JA6 B;  2WIN B;  2R92 G;  1Y1W H;  5IT9 L;  1B4O A;  3R2I A;  5C5L A;  1A2T A;  1QZH A;  4HCS A;  2NBF A;  2GVB A;  3M4O H;  3H09 A;  5FO7 B;  3UDG A;  3S17 B;  4JYA Q;  5HY6 A;  3TP6 A;  1HNZ Q;  1LV9 A;  1HHV A;  4DR3 Q;  2B2T C;  1JWM D;  1CA5 A;  2ZJP A;  1PRT C;  4GOP A;  1SND A;  3H3V H;  2UUA L;  4ZYS A;  4HJ9 A;  3JAM E;  4ZUI A;  4A3I B;  5HUR A;  2F0O A;  4ULL A;  2NVX B;  4A3E G;  2WAQ E;  5IT9 c;  2C5C A;  2EY1 A;  4BY1 B;  2MJ8 A;  3MFG A;  4AYB B;  3J81 E;  5JVG 3;  2NVY H;  3VYS A;  2WAQ G;  1WTP A;  1J6Q A;  2OT2 A;  1B7Y B;  2K33 A;  3RNU A;  1F2L A;  2KEC A;  4Q0F A;  4LFC Q;  1EOV A;  3PO2 H;  3JC6 6;  3HFZ B;  4JI3 L;  4X62 L;  3GTL H;  2YU9 B;  3QWN A;  4C3J B;  4LUZ A;  2XRS D;  2KEN A;  2QEJ C;  4JCV E;  3J81 c;  1VQP A;  2DNE A;  4DR1 Q;  3DUZ A;  1SXT A;  2K5D A;  4IUU A;  2IJ0 A;  3FPU B;  4PMB A;  1JWU D;  2B2U C;  2HHH L;  2UXB L;  3CCM A;  2DN8 A;  2E2I B;  3S1N H;  4H0L C;  2N78 A;  5FJ8 H;  1VQO A;  2K05 A;  3CCR A;  4A76 A;  3WOF A;  1QE6 A;  2QGQ A;  1ML0 D;  1E24 A;  4Y52 H;  3WDN A;  2HQL A;  3URY A;  1HH2 P;  1TWG H;  1Q86 C;  3PO2 G;  4A3G B;  5E4X A;  1NBW A;  1IBM Q;  1RKN A;  5IGB A;  5LL6 S;  3KF6 A;  1PYB A;  4GLA C;  5G3L D;  4LNQ A;  2FXQ A;  1CT1 D;  4H44 C;  1VQD A;  2KED A;  4OHJ A;  3STB C;  2DJF C;  1K8A C;  1BUV T;  1J9O A;  4OO1 H;  4FYD A;  2WAQ B;  5KEE A;  3FEW X;  2L1B A;  3ULJ A;  2BE5 D;  5CV9 A;  1HNX L;  5E1F A;  2HUG A;  2EJF C;  2KCT A;  4CKB A;  5FLM H;  1N34 Q;  3VR5 A;  5ELB A;  2N3S A;  1I6H B;  4A93 H;  3OIP A;  1DYQ A;  1SRU A;  3A7L A;  3EQL C;  4TKO B;  4DR4 L;  1JT8 A;  2V1C C;  4BBS B;  2NN6 H;  4A3J H;  2PNR C;  4JI1 L;  1UEA B;  1SMX A;  2RCF A;  3S15 B;  3PF5 A;  4B3T L;  5J3B A;  4EQO A;  4IUV A;  1JJG A;  4LFB L;  5E3F A;  5I2X A;  1D1K A;  4DAV A;  4HJ7 A;  3MHB A;  1JMC A;  1CTM A;  4K5V A;  1XNQ Q;  3IL8 A;  2RSO A;  4MHE A;  1ET9 A;  4GOP B;  1EFI D;  5EPJ A;  2OEO A;  3NWS A;  2D9U A;  4BY7 G;  3BG3 A;  1YNN C;  4BA2 I;  5IYB G;  2RCN A;  4LMQ D;  3VYU A;  4NMZ A;  4V0B A;  2PW5 A;  2SOB A;  1B50 A;  4B3R L;  3L9A X;  1I50 H;  4OWX B;  3S1Q B;  5DNF A;  1GKH A;  3M7N A;  3Q23 A;  2C35 B;  2CFM A;  4A3L H;  1QWY A;  2ZXO A;  1IL8 A;  2E5L L;  1XMO Q;  5C6A A;  4X6A H;  5EKI A;  2HIX A;  4GKK Q;  4B3R Q;  1T9H A;  2NVX H;  4DV2 Q;  3F1Z A;  4JV5 L;  2BA0 A;  4JPB W;  4A3I H;  1TVX A;  2VB3 X;  3OHX C;  2R93 G;  2HHH Q;  2D62 A;  2NWG A;  1C0A A;  1RD9 D;  4IPC A;  2A6H D;  4GN4 B;  1F9R A;  5FOB B;  2WAC A;  4BXX H;  4PZ7 A;  3M4Q A;  1Q8K A;  1E1O A;  1LAC A;  3I73 A;  1HFN A;  5C4X G;  1AFP A;  5GRO A;  1I50 B;  2RVL A;  4JI0 Q;  4S3S A;  1FNU A;  1PTO F;  4BA1 I;  4A3L G;  3NE5 B;  2KCM A;  4A3D G;  5C3E H;  1CKO A;  1IW7 C;  4R4O A;  4ILW A;  2R7Z H;  3QOJ A;  4J1M A;  4R1J A;  4CDC C;  4O0A A;  1E3P A;  3Q0A A;  1D7Q A;  4GN5 A;  1NTG A;  4M8A A;  1VCI A;  3KLS A;  2JA8 G;  2HQE A;  1FNW A;  4DV7 Q;  4YIJ A;  1UE1 A;  1EQV A;  1KLG D;  4LF9 L;  4CHT B;  2UUB Q;  4KN7 C;  2VW9 A;  4LF6 Q;  2EYM A;  3KJO A;  3TP8 A;  3RUZ A;  3FMC A;  3MXP A;  1WI5 A;  4YHH Q;  3NBI A;  1KAB A;  2JA5 G;  1A15 A;  1V1Q A;  3HOU H;  2Z4H A;  1EYC A;  1PZI D;  3FKI B;  1TS3 A;  1KTK A;  2K4K A;  4A3B B;  5ELF A;  2Z9H A;  2DGY A;  1XTD A;  1QNU A;  1VQ8 A;  2E2H H;  3MZ5 A;  4EGV A;  4OWT B;  4JI4 L;  2NN6 I;  2PZT A;  3CHB D;  4X64 Q;  2VNU D;  1YHA A;  5I4D A;  3S16 B;  3BS1 A;  1KIX A;  2CH4 A;  4LF7 L;  1YNJ D;  3M4P A;  3F2U A;  1SYF A;  1KDB A;  4DNT B;  3K7U C;  1D5Z C;  3J81 i;  5TSS A;  1KAW A;  1HZC A;  3J81 j;  2KCN A;  1SYE A;  3MAQ A;  3GTK B;  4P72 A;  2L55 A;  1XNR Q;  2H5X A;  3OWE B;  3HOU G;  4NKL A;  2HCC A;  3CC4 A;  3A0J A;  4LF9 Q;  2OTL A;  2WB1 E;  3V2T A;  5IYD H;  2ZTC A;  4C3H G;  3HOV H;  1MBY A;  1TWF H;  3M85 A;  2I5L X;  4A3I G;  4CKE A;  1Q46 A;  1BBX C;  1CI3 M;  2WV6 D;  1XXG A;  1XMQ L;  1K3B C;  2F0U A;  1DOL A;  2PO4 A;  4IPD A;  3PF4 A;  3PO3 B;  3TDQ A;  1EY6 A;  2CVR A;  2CHB D;  2NZO A;  3K5M A;  1SDF A;  1SEB D;  2BA1 A;  3D3R A;  4JBM A;  4P74 A;  1YIJ A;  3GP7 A;  1TS4 A;  2ZTE A;  1VQG A;  1STA A;  3BDL A;  1Y1W G;  1D6E C;  2RBM A;  1EWH A;  5CR3 A;  4DV0 Q;  2NVY B;  1H9S A;  2F0Q A;  3SK8 A;  3CME A;  1HA5 A;  1NMF A;  3W1G A;  5IWA Q;  5IYD G;  3H94 A;  1VQE A;  5DM6 3;  4IUN A;  2X6G A;  5C4J B;  4EQN A;  4NXN L;  2GA4 B;  2Z4I A;  1MKH A;  3D4R A;  3BDO A;  2NVT H;  2RHQ B;  1OXT A;  4JI2 L;  2FJ2 A;  4J8Q A;  4JI0 L;  2B63 H;  3A5U A;  1GHJ A;  3CCL A;  5C4X B;  1ICW A;  2EJM A;  1F2M A;  3UE1 A;  1P16 A;  5D14 A;  3HOY B;  4QGU A;  1WD0 A;  5J22 A;  4O2D A;  1HUM A;  4BY1 G;  1D2B A;  4K5W A;  3S2D B;  1O7L A;  5JJK A;  2F0I A;  3LGJ A;  5CYU A;  3HZX A;  3TZD A;  1STE A;  2PMZ E;  1YIT A;  4LF7 Q;  2L9H A;  2MHV A;  5IP9 G;  5C4J H;  1A3V A;  2EVB A;  4KKS A;  5CV8 A;  2PQA A;  4I7Z C;  1G8Z D;  5IGD A;  1LTG D;  4JI7 L;  3HG9 A;  1MGS A;  3E6Z X;  1J5E L;  3SHL A;  3J81 L;  2IHF A;  2PPB C;  2R93 B;  4DU9 A;  2JQO A;  2VZA A;  4MN3 A;  2E5L Q;  4IUR A;  4PQX A;  2R7Z B;  4C1N I;  1ILP A;  1FNV A;  1KAA A;  5JEA H;  2JP1 A;  1A62 A;  3D0F A;  1F9P A;  2E76 C;  3I4O A;  5KND A;  4A3K B;  4RGM A;  5CV7 A;  1LTS D;  4FP5 D;  2EIF A;  4DV5 Q;  1A6X A;  1EEF D;  1VQF A;  1IKL A;  5IYC H;  1PDQ A;  1M8A A;  2CWP A;  4HAE A;  2SEB D;  3S2H B;  4PMC A;  2K03 A;  1PTO D;  5T1I A;  2R61 A;  3H15 A;  4G7Z C;  1VDZ A;  1H9M A;  2EYL A;  1GD7 A;  2WP8 J;  5K36 H;  4OEL B;  2B8G A;  5FK9 C;  3HOX H;  3GQB A;  3DLL A;  1GOZ A;  1YJN A;  4Z9C B;  2DY7 A;  5EBD A;  3S16 H;  2K75 A;  1ONL A;  2K32 A;  2WFW A;  3RLF A;  1SNQ A;  5L37 A;  4X62 Q;  4QMG A;  3ERO A;  1TII D;  3KF6 B;  3CCS A;  3TBI B;  1M4V A;  3CCJ A;  4CKC A;  1TKW B;  4LFC L;  1R4Q B;  2OXP A;  3I4N B;  2NVQ H;  4XDX A;  2IX0 A;  2QCP X;  4A3B H;  5AJ3 L;  3GTQ B;  4L5T A;  4DR5 Q;  3AMU A;  1QUQ B;  4A3D H;  5ELE A;  1EY7 A;  3CP0 A;  5J1Z A;  1DM0 B;  2ID0 A;  4UDU C;  1D1I A;  4EVO A;  3OYY A;  1Q1E A;  1U0L A;  2E2J B;  2VXW A;  3I3C A;  2B39 A;  4A3J B;  3D6W A;  2ZXR A;  3OOC A;  2Z8L A;  1VQA A;  5K5P A;  1JQY D;  1ZYR C;  2DJG C;  2Z6K A;  1XNQ L;  1LTA D;  2B63 B;  1QIL A;  4JBJ A;  2UUB L;  4DR1 L;  2D0P A;  2CH4 W;  3CCE A;  1XPU A;  4BXX G;  1HPC A;  4CDF C;  5KIX A;  2UXD Q;  2AWO A;  3ND8 A;  2AMC B;  3V96 A;  3G71 A;  1G6Z A;  4FDB A;  4H02 A;  5E4W C;  1ENA A;  2CQO A;  1FYC A;  1HTL D;  2KA7 A;  3WOE A;  1D8L A;  3GTL B;  2NZH A;  4K2K A;  2J7Z A;  1DJR D;  5JJL A;  2YYZ A;  2N8N A;  2FFK B;  1NE3 A;  2R92 B;  1YBY A;  1DOM A;  3TP7 A;  5M3M B;  1B8A A;  3UDX A;  3K59 A;  5M3F B;  3TQY A;  2XWB B;  4DR6 Q;  3T51 B;  1I94 Q;  1SN8 A;  4UPA A;  3H0G G;  3HOX B;  1JOQ A;  4LFA Q;  3OW2 A;  1GVP A;  1QOH A;  4RHS A;  2EYP A;  4GKK L;  2ALY B;  2ZXP A;  3K58 A;  3GO5 A;  1LT5 D;  1K0S A;  3RN2 A;  4XQJ A;  2XSC A;  4YY3 L;  2A6E C;  3OMG A;  1IBL Q;  1E1T A;  2D5D A;  3EIV A;  4HJA A;  4OO1 G;  4OIJ A;  1BCP C;  1EYD A;  3PIO 3;  5IGE A;  2K6A A;  4A3C H;  1E22 A;  1Z7T A;  1HZ9 A;  4ZLT F;  1ENF A;  4X64 L;  1YJ9 A;  4ME3 A;  4LAA A;  4KLK A;  5JPN C;  3BDC A;  3OMC A;  1Y1W B;  4ZKB B;  1ESR A;  2F0H A;  2WII B;  3K81 C;  4FNF A;  3CMA A;  2JA7 H;  3IRB A;  1SYD A;  4B3S Q;  2QIL A;  4F7X A;  4POF A;  1S5B D;  3L2P A;  2AHO B;  2AWN A;  3T53 B;  3KF8 A;  3H91 A;  2R6G A;  5M3M G;  4UAI A;  1JB3 A;  2LS0 1;  5IP7 H;  4DUY L;  3MC0 B;  1JIC A;  1X3F A;  4JV5 Q;  4AQY L;  1Y8P B;  5CV6 A;  1QG7 A;  1WTV A;  1SNP A;  3MXU A;  3NTH A;  3SDZ A;  4RKB A;  4XT1 B;  3G6E A;  4AIM A;  3I90 A;  1XWE A;  2F1M A;  2JA7 G;  2A69 D;  1SRO A;  1S5C D;  3KJP A;  4RWS C;  3MFY A;  4L5Q A;  2EYJ A;  1PH2 A;  5GAH C;  4NPS A;  4ID6 A;  4IUP A;  1IXR A;  3SVM A;  3CCV A;  4OX9 Q;  1FGU A;  2CQA A;  3S14 B;  1H95 A;  1M1K C;  4DKA C;  4GOP C;  4GLX A;  3Q6S A;  3OWF A;  4G4K A;  4N9T A;  1KD1 C;  2K50 A;  2B2T A;  5IGG A;  1O80 A;  2PYK A;  4L8J A;  3E0J A;  2ES2 A;  2LFN A;  1A8V A;  1E2W A;  4A3E H;  1SE3 A;  1NNX A;  2XNA C;  1EEI D;  4ZQ3 A;  4IOC A;  1DOK A;  4YWL A;  5J39 A;  5IY0 A;  4ZUJ A;  3GD7 A;  3GV3 A;  1EIY B;  3RZD H;  1SJH D;  1QZG A;  3PIP A;  1B53 A;  1K28 A;  3EBE A;  4R4C A;  1UE7 A;  3BZD B;  5EAY A;  3PIO A;  1IBK L;  5JAV A;  2YTV A;  3DWA A;  1I5F A;  2F0E A;  1V1O A;  3X3N A;  5COY A;  1HNW L;  5A2Q E;  2VL6 A;  1QVC A;  1FD7 D;  3RMH A;  1PYS B;  5LMN L;  5IP9 H;  1TY2 A;  5E7N A;  1TT2 A;  2Q2I A;  3I2Z A;  3SK6 A;  1L0X B;  3I4L A;  2PZW A;  1PFS A;  3NQT A;  3T1H Q;  4YWK A;  3DMU A;  3MWY W;  4FXG C;  2DY8 A;  1STN A;  4N9P A;  2YV5 A;  1BBU A;  1JJ2 A;  1JOK A;  4QIW B;  3EN2 A;  3N6R A;  3W1B A;  1LM0 A;  5A35 A;  1QUQ A;  1HNZ L;  4DR4 Q;  1X32 A;  1BQQ T;  2Z6B A;  3E9I A;  1WD1 A;  4X66 Q;  4QCL A;  2N88 A;  1TQO A;  1TWA B;  5ELO A;  4LWC A;  3MEF A;  3TN2 A;  2EE1 A;  3K6O A;  4CDE C;  2QF7 A;  3NBH B;  1ICF B;  1UWV A;  1YNJ C;  3M4O B;  1RIP A;  5JPM C;  1DON A;  1VS0 A;  3PSI A;  5IYC G;  1DZ1 A;  4RKL A;  2IX3 A;  4UY8 C;  1G91 A;  1WVL A;  3K80 C;  2E2J H;  2PQA B;  4A3K G;  5M5Y B;  2JA5 B;  2IX1 A;  1TS2 A;  4BBS G;  3ULP A;  2SDF A;  3DEP A;  1PTO H;  1PV4 A;  1Y14 B;  3UE0 A;  3J7A V;  1BCP D;  4NDX A;  2CW0 C;  5M3F G;  4DNR B;  1ENC A;  1HQR D;  4QUC A;  3LX0 A;  1F77 A;  1ILQ A;  3HOU B;  2RDG A;  1IKM A;  1XTC D;  3OSO A;  1LT6 D;  1QCB D;  1CSP A;  3H6M A;  2WB1 G;  4XYO A;  4GNX A;  4KHP L;  2XTI A;  1HZA A;  4R8N A;  3E0E A;  1I6V C;  3C1F A;  1ASY A;  4A3F B;  1AN8 A;  4IQZ A;  1S3O A;  4IOA A;  3KOJ A;  3P20 A;  3U9O A;  2F4I A;  2PNH A;  5FLX c;  1MJE A;  3DM1 A;  1I4R A;  2HDL A;  3J7A 5;  4QIW E;  4DR7 Q;  4OO1 I;  3D4W A;  3J80 i;  3FKI G;  4B9X A;  4DUZ Q;  5C3E B;  2PCF B;  2IT1 A;  3D31 A;  2Y0S G;  3B6Y A;  5FO8 B;  1SYB A;  1BBW A;  2RQX A;  3W5O A;  4A3E B;  2IWH A;  1U4P A;  3A5Z B;  4QJF A;  3KBX A;  3AB9 A;  3KBG A;  3N52 A;  2E2I H;  1SSO A;  4XIG S;  4NW2 A;  5DEH A;  3D8G A;  2VQF L;  1II3 A;  4LK1 C;  3GTP H;  1I4P A;  5EJW A;  4KHV A;  4X3S A;  1KRS A;  3AQQ A;  1GHK A;  2Q2T A;  1LLR D;  4A3G H;  2OQK A;  3VR2 A;  2UUA Q;  1W2B A;  1G2S A;  2JYO A;  2Q2U A;  4DK6 C;  3CKI B;  2D0O A;  5CMD A;  4JK1 C;  2OCE A;  1I94 L;  3W3A A;  3W2D A;  4A3M B;  1UEB A;  1Q82 C;  3E3X A;  5BN4 A;  4FXD A;  2EY6 A;  1BNZ A;  1Q12 A;  4ABN A;  3I70 A;  3CPW A;  2LY7 A;  3TSS A;  2GN5 A;  2A6E D;  3ULL A;  3PV0 A;  1BO0 A;  1V1P B;  2A19 A;  1YNN D;  1RHP A;  4DXG A;  1CKN B;  1EY8 A;  1LTI D;  4MIU A;  4C56 C;  4V19 0;  2L4N A;  2XN9 C;  3VDY A;  2EJG C;  4HMJ A;  5C0X H;  3S2D H;  3T16 A;  2OQ0 A;  4HTH A;  4A3C G;  3AFP A;  3Q22 A;  2ZJQ A;  1WTQ A;  1HRJ A;  1Q8I A;  1WYD A;  4CJ2 C;  4P73 A;  1L1O C;  1IZ6 A;  3J7A F;  4KJO A;  3K5N A;  1MSG A;  4FO2 A;  3BVZ A;  3MTS A;  1U4R A;  4ODG A;  2F4V Q;  1EIF A;  1SE8 A;  3QB3 A;  5JEA J;  4PNY A;  1E0B A;  4PZ8 A;  1SNC A;  1K0R A;  4R4Q A;  4XQN A;  3VYR A;  4HMI A;  4F88 A;  3U4V A;  2YTX A;  1A3U A;  3H0G H;  4P71 A;  1NCV A;  4DAY A;  4DK0 A;  3A8I E;  1SMY D;  1TWF B;  3AU7 A;  1HUN A;  4L63 B;  2Z6K C;  1PH4 A;  5KYI A;  1XMO L;  1UNS A;  3P75 A;  1JE5 A;  2ASB A;  2BE5 C;  4L5S A;  1B1Z A;  1JJC B;  3VR6 A;  2I07 B;  1CM9 A;  3K8A A;  2O5I C;  5C0X I;  3NEN A;  5IE8 A;  1FR3 A;  1K8O A;  2JK8 A;  3U58 A;  2A74 C;  2B2Y A;  2K5N A;  3GTG H;  1SR3 A;  5CC4 A;  1VQN A;  1K8G A;  4KKU A;  4DV0 L;  1P8L A;  1WCM H;  1NR4 A;  1PHJ A;  3FVQ A;  5I6W A;  1G6P A;  2O5J C;  2KHI A;  3PGZ A;  4POG A;  1M90 C;  1EU4 A;  3NQI A;  2UU9 L;  4IJH A;  1S72 A;  2EYH A;  4F8M A;  1ASZ A;  5IT9 E;  3P7J A;  2NVT B;  2VUM B;  5FJ8 G;  1PFB A;  3E5S A;  3T13 A;  1Y1V G;  4HIM A;  2XWJ B;  4F87 A;  2EZV A;  3IAY A;  3GTO B;  2MO1 A;  1CQV A;  1O78 A;  2Q8R E;  2CWA A;  1CHQ D;  1GUG A;  4YHH L;  1QJO A;  2SNM A;  2BCO A;  1MJC A;  3PQI A;  1HR0 W;  1SBB B;  4DV6 L;  3TRZ A;  4A3D B;  2F3V A;  3GTP B;  2VQF Q;  4K6D A;  1I6H H;  2JXM B;  2L12 A;  4KI0 A;  1LUZ A;  2JA7 B;  1SNO A;  1VQ7 A;  1HR0 Q;  2F0W A;  4R4T A;  1LAB A;  1Y69 U;  2H1E A;  4QL5 A;  4I7A A;  1N32 Q;  4KKT A;  1J5E Q;  4C3I G;  1SE4 A;  1BCP F;  3EFX D;  4DK1 A;  2EXZ A;  3OTO L;  2F0V A;  3CRL C;  4A3J G;  1LT4 D;  3HEJ A;  1L2F A;  1NSN S;  2B63 G;  2IPK D;  5AJ3 Q;  1ET6 A;  2WB1 B;  2AUK A;  3MA2 B;  1F9S A;  4BBR G;  4AYB G;  5IGF A;  1H9J A;  3HOV G;  2I5H A;  3HKZ G;  1V8Q A;  3C3L A;  1HQM C;  4ZCK A;  4KD4 A;  2TSS A;  1TU2 B;  2Z0S A;  4LF6 L;  5KGU A;  1VQL A;  3GDE A;  1U4M A;  2RDH A;  4ZAI A;  3RN5 A;  2GVA A;  4DFA A;  3S1Q H;  2JA9 A;  2ZTD A;  3RD4 A;  2F0K A;  4TQU S;  2J0T D;  2IL8 A;  1N33 Q;  3AEV A;  4K0K Q;  1A0I A;  1GUN A;  4IUT A;  1X54 A;  2R7F A;  1AH9 A;  1N36 L;  3UDF A;  1HTP A;  1HR0 L;  2DUD A;  3U50 C;  4CGY B;  3J80 L;  3LWE A;  2JEB I;  4MNO A;  3M3Y B;  2F0T A;  1KC8 C;  1K8M A;  1NR2 A;  4RA8 A;  5I6Y A;  3L0O A;  1HNX Q;  4DV6 Q;  1YHB A;  3A7A B;  3QR8 A;  4AQY Q;  1QNK A;  1MD2 D;  1U4L A;  3DHQ A;  3AYH B;  3Q24 A;  2WKC A;  1Q90 A;  2VY3 A;  1JB7 A;  5FLX E;  3I4M G;  2G5D A;  1SMY C;  2PMZ B;  5C4X H;  3C46 A;  3FKI H;  1ZEQ X;  1H9K A;  1TWA H;  1CZW A;  5EBC A;  1GUO A;  1STG A;  2MUY A;  4G7H C;  2AQ2 B;  4DN4 M;  2R7Z G;  4JI7 Q;  2X69 A;  1XPR A;  4ZKC B;  3TS2 A;  1I3Q H;  5CBA E;  2VQE Q;  1BF4 A;  1EQT A;  2Q8T A;  1ESF A;  1X65 A;  2EYF A;  2NYZ D;  1S5F D;  2NTS A;  3UI2 A;  5BR8 Q;  5C0X J;  1YVC A;  4IAL A;  4Y7N B;  4C3I H;  4C3I B;  3C2P A;  2KQ3 A;  2F3W A;  1K9M C;  3GTK H;  4KY5 A;  3CCQ A;  4X65 L;  1BOS A;  4HR7 B;  2RHS B;  1OO9 B;  3I4N H;  1CKM A;  4G57 A;  1KQS A;  2EQS A;  3S9W A;  1PH8 A;  2MPM A;  3HOW B;  4GS3 A;  3KK7 A;  4CDD C;  5EGT A;  2KOL A;  5ELC A;  5EKL A;  3CW2 C;  2BH2 A;  2JN4 A;  3HOY G;  4JBK A;  1F2Z A;  4L5R C;  4KTA A;  4DV3 Q;  5C0X G;  2K5Q A;  3VR4 A;  4LUV A;  2K1B A;  3S1R B;  2A69 C;  1EZ8 A;  3PUY A;  2F0F A;  1IYJ B;  3NEM A;  2F0P A; 
#chains in the Genus database with same CATH homology
 1PZK D;  1TR5 A;  2QDB A;  3DWP A;  1S5E D;  2BDN A;  3K5O A;  3EVQ A;  2LMC B;  1B44 D;  4XYQ A;  1EY4 A;  1KDC A;  5A2Q L;  3NBH A;  3K7A B;  1EY9 A;  4X3U A;  1GJX A;  3NTI A;  5KRU A;  1C8C A;  1V43 A;  3GTJ B;  5KYL A;  1VF5 C;  3G7L A;  2B2W A;  2H4O A;  1HFG A;  3ZYY X;  3KLS X;  5I2Y A;  2A5H A;  3PUX A;  1XX8 A;  3BVM A;  5IOC A;  1C4Q A;  4FVM A;  2RKS A;  1MSH A;  2MGS A;  4G7O C;  1AZQ A;  2K04 A;  2K01 A;  4O1N A;  4CBV A;  1LTB D;  2J4X A;  1CHP D;  2K28 A;  2K5W A;  2KHS A;  5CV5 A;  2TMP A;  1QB5 D;  1TY0 A;  1X3Q A;  5IOD A;  2E2H B;  2XVS A;  1PTO C;  5F2D A;  1EL0 A;  1RTN A;  4CJ1 B;  4X3T A;  5KNC A;  4L6T B;  1ROD A;  2F0S A;  4IZ8 A;  1SAP A;  2JE6 I;  1PTO B;  1PRT B;  2NZ1 D;  5D65 A;  1ZKO A;  4KY6 A;  1K83 B;  3H0G B;  1W6J A;  5DAU A;  3HOZ B;  3S1M B;  5I9O A;  3J7Y W;  4RGO S;  4EQP A;  4P2C B;  2ICI A;  3ERQ A;  1G29 1;  4PV1 C;  3VYT A;  1WTO A;  3I4M B;  1D5M C;  4WRD A;  1SYC A;  4XTC S;  1OXU A;  5CGK A;  2B2V C;  2ZT9 C;  1R4P B;  3KLR A;  4R9W A;  3A56 A;  1AP0 A;  4XQQ A;  5FO9 B;  2EY5 A;  5IGC A;  5CV4 A;  1OXV A;  3RZO B;  5FLX L;  4OIK A;  1I3Q B;  3CQZ B;  3MXN A;  4TRD A;  2DNC A;  2B2V A;  2L11 A;  4DXF A;  3LNN A;  1SFO B;  3TP5 A;  2BDO A;  1BDO A;  5AFW A;  3ND9 A;  5BN5 A;  4DF7 A;  1XYI A;  3J80 E;  1A3T A;  1T5X D;  4BS9 A;  5C3X A;  4Q5V A;  1EZ6 A;  3HGB A;  5IIF A;  1JE4 A;  2F0L A;  5BN3 A;  1Q3L A;  2A68 C;  3M4Y A;  1JR0 D;  1LT3 D;  1Y8O B;  4QUF A;  5FKA C;  3L7Z C;  3S1N B;  1PRT F;  1R9T B;  3TZU A;  1SE2 A;  2FMC A;  2Z1C A;  2JA8 B;  4OL7 A;  2N55 A;  2RDF A;  1B9N A;  5LL6 X;  2Q8I B;  4X3K A;  3SE0 A;  2V4D A;  1TWH B;  2XIW A;  3R93 A;  3GTG B;  3JAM L;  3SK5 A;  1MI2 A;  3TME A;  4RFB A;  5CBE E;  1L0Y B;  5COR A;  2F0N A;  1WTR A;  4FXK C;  1HXY D;  1PYW D;  1JCK B;  2B8F A;  3QG1 A;  4E6I A;  2AUJ D;  1PMR A;  4RHR A;  1C48 A;  1EIG A;  1UAP A;  3M7G A;  3T56 B;  1EY0 A;  2B2W C;  3P1H A;  3VA5 A;  1CA6 A;  3SEB A;  4KMU C;  1AW7 A;  2BOS A;  3LWU A;  3OIQ A;  3SR1 A;  4C3J G;  2QKI C;  2D2C C;  2O4X A;  1IW7 D;  1BXT A;  4K8J A;  3NSW A;  1G2T A;  1AEX A;  3PUW A;  3HP3 A;  3HRZ C;  1DXM A;  1BR9 A;  3EJI A;  3MEH A;  1E2V A;  4KN4 C;  4K6L A;  1J8I A;  3OW7 A;  4J6H A;  1EYA A;  2AQ1 B;  1PRT D;  1W6K A;  5C44 B;  1GUT A;  2PQE A;  2G9D A;  2MP1 A;  4RGT A;  1O7Z A;  4PMW A;  3K0Y A;  1HA6 A;  4QB4 A;  3SK4 A;  3GV6 A;  4U67 3;  3G6J B;  1STY A;  4R8I A;  4WFN 3;  3CRK C;  1I4H A;  1PZJ D;  1CFM A;  2EDG A;  4K14 A;  2F0J A;  1OXS C;  1E2Z A;  4FF1 A;  2KJX A;  1GUS A;  1AZP A;  4FF3 A;  3HOV B;  5JJZ A;  3EA6 A;  3O13 A;  2FIN B;  3R3O A;  3K5L A;  1CZG A;  2SNS A;  1RTO A;  3NUC A;  5C4H A;  1JOR A;  1JOO A;  3QJY A;  1GUW A;  2HDM A;  2EPB A;  1CQF A;  3ONA B;  4TSS A;  3DWQ A;  5JVH 3;  3NTK A;  1HCZ A;  4RH6 A;  1I4X A;  2NB0 A;  3L3O C;  1RJT A;  1EU3 A;  5C3W A;  2XRQ D;  4IN3 A;  2M9V A;  5C4Z A;  4H13 C;  1D5X C;  1EIH A;  1IHZ A;  5DM7 3;  2F03 A;  3H3V C;  5ELD A;  2K7V A;  1S4Z A;  4IFD H;  1BCP B;  2LKV A;  1IYV A;  4RCN A;  2RSN A;  3QOL A;  5M5X B;  2KEE A;  1RF2 D;  3BYT B;  1GXD C;  2EY2 A;  4JBW A;  3OPO A;  2PZU A;  3T4A C;  2VB2 X;  3PUV A;  4BY7 B;  5EQ0 A;  3NP8 A;  2F0D A;  3MXG A;  1PXU A;  1NAP A;  4M1U B;  2FHT A;  1RDP D;  1A2U A;  1PLF A;  1Z47 A;  1OXX K;  1TWC B;  3C1E A;  2L0C A;  3DXJ C;  3NXW A;  1DD2 A;  1KDA A;  1T5E A;  3IFD A;  3R8B A;  3ITP A;  4B9W A;  4HN7 A;  3BVG A;  2NVQ B;  4KK7 A;  3HKZ B;  2RA4 A;  1NUC A;  2O2L D;  4DGZ A;  4I65 A;  5LHY 1;  4RCO A;  3NPP A;  4KV6 A;  1TS5 A;  1WTX A;  3V05 A;  3RZD B;  1F2Y A;  2A6H C;  2NTT A;  5KNB A;  4IUQ A;  5C5M A;  1ZYR D;  2C9O A;  1Y8N B;  3BYY B;  4XXE A;  2M2L A;  2OF1 A;  2JEA I;  1SNM A;  4ZK9 B;  2B2Y C;  4FF4 A;  3FPP A;  5ISR A;  1KLU D;  4NP5 A;  1PFN A;  4DA2 A;  3R2T A;  4HSP A;  2F0M A;  3PO2 B;  5EKK A;  4HSV A;  3I91 A;  4IFD G;  1LTR D;  1PFM A;  1U9R A;  3NHH A;  2Y0S B;  2ENB A;  2HCI A;  1I4Q A;  2NUC A;  5JEA G;  4A93 B;  1TWG B;  4RGN A;  2AQ3 B;  3QO2 A;  5HGT A;  3IFT A;  3CU7 A;  5T1G A;  2PW7 A;  4IFD J;  3NWT A;  2E75 C;  2M00 A;  4IFD I;  4K5X A;  2WKD A;  4BWG B;  1STB A;  1VMC A;  1JC7 A;  3VR3 A;  1KNE A;  2FMM A;  5M5W B;  4GZY C;  1Z6H A;  4KJN A;  1Y1V B;  3D4D A;  3A55 A;  1STH A;  1X3P A;  2E2D C;  4CJ0 B;  3PIP 3;  2A73 B;  2B2U A;  1H9S B;  2KVM A;  2NN6 G;  1ZXT A;  4ME5 A;  1B3A A;  2F0G A;  1LTT D;  3HS0 C;  3U9S A;  4K2L A;  4WJW A;  4B08 A;  2KCC A;  4H7B A;  3X3M A;  4HCE A;  5I9P A;  1B9M A;  1EWC A;  5D3D A;  1SYG A;  4BBR B;  2KUM A;  5M9O A;  1SJE D;  3K57 A;  4KD3 A;  3GTM B;  3MVV A;  3DEO A;  4HED A;  3FRP B;  2A68 D;  1CK1 A;  1I4G A;  3SXH A;  4K8I A;  4XT3 B;  1WTW A;  1UUP A;  1KNA A;  2EYO A;  4KY7 A;  1IYU A;  4C2M B;  5EPL A;  4RAU C;  2R3Z A;  1H9R A;  1RCV D;  3A8J E;  4DAP A;  5JOB A;  1S5D D;  3NK9 A;  1DCZ A;  3KUP A;  4KHZ A;  1VF7 A;  4O42 A;  2ICE C;  2L5T A;  5D3I B;  3PMF A;  2I46 A;  3A8K E;  3QIA A;  3IKJ A;  1WCM B;  2E74 C;  2X6L A;  2EOT A;  4LJZ C;  1JWS D;  4WOR A;  4ZRZ A;  1EOT A;  1LO5 D;  3PUZ A;  2G9H D;  3A54 A;  1VMP A;  1O7Y A;  5K36 G;  3D6C A;  3I72 A;  2IW3 A;  4U68 A;  5EPK A;  3FDT A;  3VA7 A;  1B2T A;  2CW0 D;  1EY5 A;  5NUC A;  4C1N K;  3I8Z A;  1FGB D;  4FF2 A;  1Q1B A;  1F9Q A;  2JSO A;  4QF4 A;  4C3H B;  1V1P A;  4OGQ C;  2JA6 B;  2WIN B;  5IT9 L;  1B4O A;  3R2I A;  5C5L A;  1A2T A;  4HCS A;  2NBF A;  3H09 A;  5FO7 B;  3S17 B;  3TP6 A;  1LV9 A;  1HHV A;  2B2T C;  1JWM D;  1CA5 A;  1PRT C;  1SND A;  4ZYS A;  3JAM E;  4ZUI A;  4A3I B;  5HUR A;  2F0O A;  4ULL A;  2NVX B;  2C5C A;  2EY1 A;  4BY1 B;  2MJ8 A;  3MFG A;  4AYB B;  3J81 E;  5JVG 3;  3VYS A;  1WTP A;  2OT2 A;  2K33 A;  1F2L A;  2KEC A;  4Q0F A;  2YU9 B;  3QWN A;  4C3J B;  2XRS D;  2QEJ C;  2DNE A;  3DUZ A;  1SXT A;  2K5D A;  4IUU A;  2IJ0 A;  3FPU B;  4PMB A;  1JWU D;  2B2U C;  2E2I B;  2DN8 A;  4H0L C;  2K05 A;  3WOF A;  1QE6 A;  1ML0 D;  3WDN A;  3URY A;  4A3G B;  5E4X A;  1RKN A;  5IGB A;  5LL6 S;  5G3L D;  1CT1 D;  4H44 C;  2KED A;  4OHJ A;  1BUV T;  1J9O A;  4OO1 H;  4FYD A;  2WAQ B;  5KEE A;  3FEW X;  2L1B A;  2BE5 D;  5CV9 A;  5E1F A;  4CKB A;  2HUG A;  2EJF C;  3VR5 A;  5ELB A;  1I6H B;  3OIP A;  1DYQ A;  3A7L A;  3EQL C;  4TKO B;  4BBS B;  2NN6 H;  2PNR C;  1UEA B;  3S15 B;  4EQO A;  4IUV A;  4DAV A;  5E3F A;  1D1K A;  5I2X A;  3MHB A;  1CTM A;  4K5V A;  3IL8 A;  2RSO A;  4MHE A;  1ET9 A;  1EFI D;  5EPJ A;  2OEO A;  3NWS A;  2D9U A;  3BG3 A;  1YNN C;  4BA2 I;  4LMQ D;  3VYU A;  4NMZ A;  4V0B A;  2PW5 A;  2SOB A;  1B50 A;  3L9A X;  3S1Q B;  5DNF A;  3M7N A;  3Q23 A;  1QWY A;  2ZXO A;  1IL8 A;  5C6A A;  5EKI A;  2BA0 A;  1TVX A;  2VB3 X;  3OHX C;  2D62 A;  2NWG A;  1RD9 D;  2A6H D;  1F9R A;  5FOB B;  2WAC A;  1LAC A;  3I73 A;  1HFN A;  1AFP A;  1I50 B;  2RVL A;  4S3S A;  1FNU A;  1PTO F;  4BA1 I;  3NE5 B;  1IW7 C;  4ILW A;  3QOJ A;  4J1M A;  3Q0A A;  4M8A A;  1VCI A;  3KLS A;  2HQE A;  1FNW A;  4YIJ A;  1EQV A;  1KLG D;  4CHT B;  4KN7 C;  2EYM A;  3TP8 A;  3RUZ A;  3FMC A;  3MXP A;  3NBI A;  1KAB A;  1A15 A;  2Z4H A;  1EYC A;  1PZI D;  3FKI B;  1TS3 A;  1KTK A;  4A3B B;  5ELF A;  1QNU A;  3MZ5 A;  4EGV A;  2NN6 I;  2PZT A;  3CHB D;  2VNU D;  5I4D A;  3S16 B;  3BS1 A;  1YNJ D;  3F2U A;  1SYF A;  1KDB A;  4DNT B;  1D5Z C;  5TSS A;  2KCN A;  1SYE A;  3MAQ A;  3GTK B;  2L55 A;  3OWE B;  4NKL A;  2HCC A;  3V2T A;  4C3H G;  1MBY A;  3M85 A;  4CKE A;  1BBX C;  1CI3 M;  2WV6 D;  1XXG A;  2F0U A;  1DOL A;  2PO4 A;  3PO3 B;  3TDQ A;  1EY6 A;  2CVR A;  2CHB D;  3K5M A;  1SDF A;  1SEB D;  2BA1 A;  3D3R A;  3GP7 A;  1TS4 A;  1STA A;  3BDL A;  1D6E C;  2RBM A;  1EWH A;  5CR3 A;  2NVY B;  1H9S A;  2F0Q A;  3SK8 A;  1HA5 A;  3H94 A;  5DM6 3;  4IUN A;  2X6G A;  5C4J B;  4EQN A;  2GA4 B;  2Z4I A;  3D4R A;  3BDO A;  1OXT A;  2FJ2 A;  4J8Q A;  1GHJ A;  5C4X B;  1ICW A;  2EJM A;  1F2M A;  5D14 A;  3HOY B;  1WD0 A;  5J22 A;  1HUM A;  1D2B A;  4K5W A;  3S2D B;  1O7L A;  2F0I A;  5CYU A;  3HZX A;  3TZD A;  1STE A;  2L9H A;  2MHV A;  1A3V A;  2EVB A;  4KKS A;  5CV8 A;  4I7Z C;  1G8Z D;  5IGD A;  1LTG D;  3HG9 A;  1MGS A;  3E6Z X;  3SHL A;  3J81 L;  2PPB C;  2R93 B;  4DU9 A;  4MN3 A;  4IUR A;  4PQX A;  2R7Z B;  4C1N I;  1ILP A;  1FNV A;  1KAA A;  5JEA H;  2JP1 A;  1F9P A;  2E76 C;  5KND A;  4A3K B;  4RGM A;  5CV7 A;  1LTS D;  4FP5 D;  1A6X A;  1EEF D;  1IKL A;  1PDQ A;  1M8A A;  4HAE A;  2SEB D;  3S2H B;  4PMC A;  2K03 A;  1PTO D;  5T1I A;  2R61 A;  4G7Z C;  1VDZ A;  1H9M A;  2EYL A;  2WP8 J;  5K36 H;  2B8G A;  5FK9 C;  3GQB A;  1GOZ A;  4Z9C B;  2DY7 A;  5EBD A;  1ONL A;  2K32 A;  3RLF A;  1SNQ A;  4QMG A;  3ERO A;  1TII D;  3TBI B;  1M4V A;  4CKC A;  1TKW B;  1R4Q B;  3I4N B;  2OXP A;  4XDX A;  2IX0 A;  2QCP X;  3GTQ B;  3AMU A;  5ELE A;  1EY7 A;  5J1Z A;  1DM0 B;  2ID0 A;  4UDU C;  1D1I A;  4EVO A;  1Q1E A;  2E2J B;  2VXW A;  3I3C A;  2B39 A;  4A3J B;  3D6W A;  2ZXR A;  3OOC A;  2Z8L A;  5K5P A;  1JQY D;  1ZYR C;  1LTA D;  2B63 B;  1QIL A;  1HPC A;  5KIX A;  2AWO A;  3ND8 A;  3V96 A;  1G6Z A;  5E4W C;  1ENA A;  1FYC A;  1HTL D;  2KA7 A;  3WOE A;  3GTL B;  4K2K A;  2J7Z A;  1DJR D;  2YYZ A;  2FFK B;  2R92 B;  1DOM A;  3TP7 A;  5M3M B;  3K59 A;  5M3F B;  2XWB B;  3T51 B;  3HOX B;  1JOQ A;  1QOH A;  4RHS A;  2EYP A;  3K58 A;  2ZXP A;  3GO5 A;  1LT5 D;  4XQJ A;  2XSC A;  2A6E C;  3OMG A;  2D5D A;  4OO1 G;  4OIJ A;  1BCP C;  1EYD A;  3PIO 3;  5IGE A;  2K6A A;  1Z7T A;  4ZLT F;  1ENF A;  4LAA A;  5JPN C;  1Y1W B;  3BDC A;  3OMC A;  4ZKB B;  1ESR A;  2F0H A;  2WII B;  4FNF A;  1SYD A;  2QIL A;  4F7X A;  1S5B D;  2AWN A;  3T53 B;  3KF8 A;  3H91 A;  2R6G A;  4UAI A;  1JB3 A;  2LS0 1;  3MC0 B;  1JIC A;  1Y8P B;  5CV6 A;  1QG7 A;  1WTV A;  1SNP A;  3MXU A;  3SDZ A;  3NTH A;  4RKB A;  4XT1 B;  3I90 A;  1XWE A;  2F1M A;  2A69 D;  1S5C D;  4RWS C;  3MFY A;  2EYJ A;  3SVM A;  4ID6 A;  4IUP A;  3S14 B;  2CQA A;  3Q6S A;  3OWF A;  4G4K A;  4N9T A;  5IGG A;  2B2T A;  1O80 A;  2PYK A;  4L8J A;  3E0J A;  2LFN A;  1E2W A;  1SE3 A;  2XNA C;  1EEI D;  4ZQ3 A;  1DOK A;  5J39 A;  4ZUJ A;  3GD7 A;  3GV3 A;  1SJH D;  1B53 A;  3BZD B;  5JAV A;  3DWA A;  2F0E A;  1V1O A;  3X3N A;  5COY A;  5A2Q E;  1FD7 D;  3RMH A;  1TY2 A;  1TT2 A;  3SK6 A;  1L0X B;  3I4L A;  2PZW A;  3NQT A;  3DMU A;  3MWY W;  4FXG C;  2DY8 A;  1STN A;  4N9P A;  1JOK A;  4QIW B;  3N6R A;  5A35 A;  1X32 A;  1BQQ T;  1WD1 A;  4QCL A;  2N88 A;  1TQO A;  1TWA B;  3TN2 A;  2EE1 A;  3K6O A;  2QF7 A;  1YNJ C;  3M4O B;  5JPM C;  1DON A;  1DZ1 A;  4RKL A;  2IX3 A;  1G91 A;  1WVL A;  5M5Y B;  2JA5 B;  2IX1 A;  1TS2 A;  2SDF A;  3DEP A;  1PTO H;  3J7A V;  1BCP D;  4NDX A;  2CW0 C;  4DNR B;  1ENC A;  1HQR D;  4QUC A;  3LX0 A;  1F77 A;  1ILQ A;  3HOU B;  2RDG A;  1IKM A;  1XTC D;  3OSO A;  1LT6 D;  1QCB D;  3H6M A;  4XYO A;  4R8N A;  1I6V C;  3C1F A;  4A3F B;  1AN8 A;  4IQZ A;  3P20 A;  3U9O A;  2F4I A;  3DM1 A;  1I4R A;  2HDL A;  4OO1 I;  3D4W A;  4B9X A;  5C3E B;  2PCF B;  2IT1 A;  3D31 A;  5FO8 B;  1SYB A;  2RQX A;  4A3E B;  2IWH A;  1U4P A;  3KBX A;  3AB9 A;  3KBG A;  3N52 A;  1SSO A;  4XIG S;  4NW2 A;  5DEH A;  3D8G A;  1II3 A;  4LK1 C;  1I4P A;  5EJW A;  4KHV A;  4X3S A;  1GHK A;  1LLR D;  3VR2 A;  1G2S A;  2JYO A;  3CKI B;  5CMD A;  4JK1 C;  3W3A A;  3W2D A;  4A3M B;  5BN4 A;  4FXD A;  2EY6 A;  1BNZ A;  1Q12 A;  4ABN A;  3I70 A;  2LY7 A;  3TSS A;  2A6E D;  3PV0 A;  1BO0 A;  1V1P B;  1YNN D;  1RHP A;  4DXG A;  1EY8 A;  1LTI D;  4MIU A;  4C56 C;  4V19 0;  2L4N A;  2XN9 C;  2EJG C;  4HMJ A;  5C0X H;  3T16 A;  4HTH A;  3Q22 A;  1WTQ A;  1HRJ A;  1Q8I A;  4CJ2 C;  3J7A F;  4KJO A;  3K5N A;  1MSG A;  4FO2 A;  3BVZ A;  3MTS A;  1U4R A;  4ODG A;  5JEA J;  3QB3 A;  4PNY A;  1E0B A;  1SNC A;  4XQN A;  3VYR A;  4HMI A;  4F88 A;  1A3U A;  1NCV A;  4DAY A;  4DK0 A;  3A8I E;  1SMY D;  1TWF B;  3AU7 A;  1HUN A;  4L63 B;  5KYI A;  1UNS A;  3P75 A;  2BE5 C;  1B1Z A;  3VR6 A;  2I07 B;  1CM9 A;  2O5I C;  5C0X I;  1FR3 A;  1K8O A;  2A74 C;  2B2Y A;  5CC4 A;  4KKU A;  1NR4 A;  3FVQ A;  5I6W A;  2O5J C;  1EU4 A;  3NQI A;  2EYH A;  4F8M A;  5IT9 E;  3P7J A;  2NVT B;  2VUM B;  1PFB A;  3E5S A;  3T13 A;  2XWJ B;  4F87 A;  2EZV A;  3IAY A;  3GTO B;  1CQV A;  1O78 A;  2Q8R E;  1CHQ D;  1GUG A;  1QJO A;  2SNM A;  2BCO A;  1SBB B;  4A3D B;  2F3V A;  3GTP B;  4K6D A;  2JXM B;  2L12 A;  4KI0 A;  2JA7 B;  1SNO A;  2F0W A;  1LAB A;  1Y69 U;  2H1E A;  4KKT A;  4C3I G;  1SE4 A;  1BCP F;  3EFX D;  4DK1 A;  2EXZ A;  2F0V A;  3CRL C;  1LT4 D;  3HEJ A;  1NSN S;  2IPK D;  1ET6 A;  2WB1 B;  2AUK A;  3MA2 B;  1F9S A;  5IGF A;  1H9J A;  1V8Q A;  3C3L A;  1HQM C;  4KD4 A;  2TSS A;  1TU2 B;  5KGU A;  1U4M A;  2RDH A;  4ZAI A;  4DFA A;  3RD4 A;  2F0K A;  4TQU S;  2J0T D;  2IL8 A;  1GUN A;  4IUT A;  1HTP A;  4CGY B;  3J80 L;  3LWE A;  2JEB I;  3M3Y B;  2F0T A;  1K8M A;  1NR2 A;  4RA8 A;  5I6Y A;  3A7A B;  1QNK A;  1MD2 D;  1U4L A;  3DHQ A;  3Q24 A;  2WKC A;  1Q90 A;  5FLX E;  1SMY C;  2PMZ B;  3C46 A;  1ZEQ X;  1H9K A;  1CZW A;  5EBC A;  1GUO A;  4G7H C;  1STG A;  2MUY A;  2AQ2 B;  4DN4 M;  2X69 A;  4ZKC B;  5CBA E;  1BF4 A;  1EQT A;  2Q8T A;  1ESF A;  2EYF A;  2NYZ D;  1S5F D;  2NTS A;  3UI2 A;  5C0X J;  4IAL A;  4Y7N B;  4C3I B;  3C2P A;  2KQ3 A;  2F3W A;  4KY5 A;  1BOS A;  4HR7 B;  1OO9 B;  4G57 A;  3S9W A;  2MPM A;  3HOW B;  3KK7 A;  5EGT A;  2KOL A;  5ELC A;  5EKL A;  1F2Z A;  4KTA A;  5C0X G;  2K5Q A;  3VR4 A;  2K1B A;  3S1R B;  2A69 C;  1EZ8 A;  3PUY A;  2F0F A;  5G3L F;  2F0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...