2EPBA

Solution structure of chromo domain 2 in chromodomain-helicase-dna-binding protein 6
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
68
structure length
68
Chain Sequence
GSSGSSGNPDYVEVDRILEVAHTKDAETGEEVTHYLVKWCSLPYEESTWELEEDVDPAKVKEFESLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of chromo domain 2 in Chromodomain-helicase-DNA-binding protein 6
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Chromodomain-helicase-DNA-binding protein 6
total genus 5
structure length 68
sequence length 68
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2epbA00
1MGSA 1WTPA 3DEOA 2B2UA 1PFMA 4XT3B 2NWGA 3DEPA 4QUCA 3DM1A 1HFGA 4RA8A 1VMPA 2D9UA 1RTNA 3GV3A 4XT1B 5EJWA 1AZQA 2RA4A 1HUNA 3ONAB 1QG7A 2KEDA 2KOLA 1F9QA 1EQTA 5D65A 4OIJA 1BF4A 4ZAIA 2B2WA 2Q8TA 2EE1A 2X6GA 1HA6A 1B53A 5AFWA 4ZK9B 1X3PA 1WTXA 1ML0D 2B2YA 2FJ2A 4NW2A 1EOTA 3KUPA 2HCIA 1ILPA 1WD0A 1RTOA 4OIKA 4IURA 1DZ1A 2JP1A 1SAPA 2L1BA 1X3QA 3IFDA 1S4ZA 2IL8A 1G2SA 4RAUC 1Q3LA 2B2TA 3P7JA 5DNFA 1CA6A 2RVLA 2MJ8A 5EPLA 1CA5A 4LMQD 4X3UA 1IL8A 4CJ0B 4IUQA 3I90A 2KECA 1PFNA 5CORA 4ZKCB 2RSOA 1GUWA 1HHVA 1DONA 2K05A 1DOKA 3MWYW 1O7ZA 5JJZA 1WVLA 2DY7A 3QO2A 5D14A 3R93A 2K28A 2EOTA 1WTWA 5CMDA 2R3ZA 2BDNA 2K1BA 4HCSA 2N88A 2L4NA 4X3TA 3SVMA 4IUVA 2MP1A 1U4MA 2MGSA 4XDXA 1JICA 1G2TA 2L11A 1HUMA 1F9RA 4CJ2C 2X69A 4IUPA 1MI2A 1QNKA 5EKIA 3TN2A 2N55A 3G7LA 3Q6SA 2JYOA 4U68A 3LWEA 1G6ZA 1RODA 1VMCA 1NR4A 3UI2A 2EPBA 1BNZA 1A15A 2FHTA 2CVRA 5EPKA 1BO0A 2KUMA 2NYZD 3I3CA 1M8AA 2FMMA 1QE6A 3KBXA 1LV9A 3TZDA 1XYIA 4X3SA 1HRJA 2HDLA 3FDTA 4RWSC 1O80A 1NCVA 1RHPA 5E4WC 5CBEE 1BBXC 4IUUA 1EL0A 1TVXA 3GV6A 1EIHA 2B2UC 1ZXTA 2FINB 1WTOA 1AZPA 1J8IA 1J9OA 2NZ1D 4MN3A 1E0BA 4O42A 1WD1A 2X6LA 1KNAA 1U4LA 1ICWA 5E4XA 2MPMA 1F2LA 2SDFA 2XIWA 2K03A 1XX8A 1U4RA 2B2WC 5EPJA 2HCCA 1IKLA 1F9SA 2L9HA 4IUTA 1MSHA 4HAEA 1EIGA 2J7ZA 4MHEA 3HP3A 1WTQA 4R9WA 2B2VC 3N52A 3D6WA 2DY8A 1KNEA 1B2TA 1G91A 2KEEA 1PDQA 5EQ0A 4ZKBB 4ZLTF 4X3KA 2K04A 1RJTA 5T1GA 2B2TC 1WTRA 5CBAE 1B50A 1C8CA 1JE4A 1U4PA 4R8IA 1IKMA 1HFNA 1NR2A 1CM9A 1AP0A 1ESRA 2B2YC 4QUFA 1PFBA 3IL8A 1F9PA 1B4OA 1O7YA 4UAIA 2KVMA 2B2VA 2RSNA 3FPUB 3MTSA 1MSGA 1DOMA 1NAPA 3H91A 3I8ZA 1PLFA 1WTVA 2HDMA 2L12A 2VXWA 1SDFA 2FFKB 2M2LA 4HSVA 2H1EA 3I91A 1ILQA 4CJ1B 2K01A 2HUGA 5COYA 5T1IA 4DN4M 1B3AA 4HEDA 1X32A 3F2UA 1DOLA 2Q8RE 1SSOA
chains in the Genus database with same CATH superfamily
5ELFA 2A5HA 5JPMC 2EDGA 4BBSB 5FOBB 2ZM6Q 2E2HH 2RA4A 1I6HH 2MQHA 1EQTA 1BF4A 3W1GA 2F0MA 3BG3A 1BCPB 3JAMi 4AYBB 5AFWA 3OSOA 2KA7A 3S2HH 1EY4A 2B8GA 1DZ1A 3HOXH 4AIMA 2E76C 5I9PA 5CV4A 1GD7A 3PO2G 2SNSA 2IY5B 4JV5L 4A3DH 1B9MA 1TS3A 2EVBA 4NXNQ 4RCNA 1UNSA 1UUPA 1I3QH 1LT6D 4Y7NH 1DONA 3ITPA 1SMYD 5IY0A 1UEAB 2LFNA 1WTWA 1QJOA 2EYMA 2N88A 2G5DA 5FLXE 2KQ3A 1JICA 4XDXA 1ONLA 4IPCA 4CJ2C 2BE5C 1MI2A 4GN3B 2IX1A 4IFDJ 2A69D 4YCUA 4YWKA 1L1OC 3I55A 4GS3A 2ES2A 2NZHA 2CVRA 3A8IE 1Q7YC 3GTLH 4GKKQ 2HHHQ 4KKTA 1Y8OB 3TZDA 1XNQQ 2BE5D 4CHTB 2KHIA 3PUXA 2F0TA 1OXTA 5FKAC 3M3YB 4CDEC 2ID0A 4DV1L 3MXPA 2X6LA 4DR2L 1U4LA 1HR0Q 2BA1A 2E8GA 4GNXC 3LX0A 1E1OA 1U4RA 2L9HA 5FLMG 3A8JE 4JI2Q 5J3BA 3EVQA 4MHEA 4DV3L 4R9WA 2E2IH 1XNRQ 2ZJPA 4KHPQ 2F0DA 1JMCA 2R92G 4ZKBB 3CRKC 5DM73 3T4AC 4PMBA 1Y14B 3HOUG 3EJIA 4ZCKA 5C3XA 2PQAB 1CM9A 1AP0A 1H9JA 4LFAL 2BDOA 2ATWA 1SNQA 1GM5A 3M85A 4IZ8A 3GTQB 1EY0A 2EY1A 3S16B 3KFUA 4DUZL 3QWNA 4QCLA 2K14A 1LLRD 1I94L 1VQKA 1STHA 3HOXG 3LWEA 1K8AC 3A5ZB 5JEAH 3GTMH 4DV4L 1XMQQ 1HTPA 4JI3L 5C0XG 1XPOA 1RTNA 2WB1G 3BS1A 1HUNA 1IW7D 1ASZA 1WFQA 4ZRZA 2QDBA 3T53B 1H9KA 4TQUS 5ELCA 2F0WA 4DXGA 3PQIA 1HA6A 3CD6A 3HOYH 1EOTA 3B6YA 4QIWE 5M9OA 1RTOA 2CQAA 4OX9Q 3S1RH 3HOYB 2AHOB 5LMNW 4G7OC 1YHQA 2JEAI 3HOZG 1IL8A 5G3LF 1HNWQ 1BCPC 1II3A 4XQJA 2H5XA 4IALA 2EJMA 4K0KL 3IAYA 1CSQA 1PRTB 3CRLC 4GOPC 1PH8A 1Y1VB 4GN4B 4A3KH 4N8FA 4OL7A 1T5EA 3HEJA 4KLKA 4X66L 1IBLQ 3JAMc 4XYOA 5JVG3 1NMGA 1U4MA 4KV6A 4L5RC 2UU9Q 1YHAA 2E2DC 3KLSX 1VQCA 4I7ZC 5IGFA 2X69A 5HY6A 1JORA 1QNKA 2Z0SA 4X66Q 3UDGA 2A8VA 4OO1I 4KD4A 5GAHC 3D3RA 3FVQA 3CAMA 4DAYA 3T1YL 2FMMA 1PZJD 5AJ3Q 3GTGB 2B63G 3HKZB 1VQHA 2R6GA 1UAPA 4DUYL 1MBYA 1WI5A 2F0SA 4Q0FA 1N32L 4DA2A 3VYUA 1YHBA 1AW7A 1YNNC 3CCJA 2HQEA 3RLFA 1TQOA 2XIWA 4DUYQ 1XPUA 1C4QA 3KF8B 3HGBA 1IKLA 1F9SA 2V1CC 3D6CA 4V190 4DV6L 4KJNA 1EIGA 2J7ZA 4X62Q 2A68D 3FPPA 4HTHA 3KYHC 2EYPA 4DU9A 1EWIA 1B7YB 1CUKA 1K3BC 2JA8H 5IP9G 1MHWC 3VA7A 1GVPA 1JE4A 4A3DG 4R8IA 3MAQA 4B3ML 2UXDQ 3F8TA 3K57A 1FGUA 2YTVA 5LMNL 3MA2B 2WV6D 3CC7A 1O7YA 1T5XD 5LL6X 2WKCA 3IRBA 2EXDA 2KHJA 3A0JA 3NTHA 1ZKOA 1PXUA 2HT1A 2H1EA 1J6QA 5KNBA 3OMCA 3F2UA 5C44B 4HIDA 5LL6S 3DEOA 2Z4HA 2IT1A 3CCUA 1ZYRC 3S2HB 2DN8A 3RLOA 3QOJA 1A6XA 2EE1A 1KXLA 2ALYB 3IKJA 4NW2A 3PUYA 4IFDI 4IUNA 3J80E 1UWVA 3U4VA 1F77A 2RHSB 4KD3A 1J5EL 4A3JG 3S1MH 4CJ0B 3V96A 1XMOL 5CORA 1CQFA 4AYBE 3T1HL 1KDCA 3I73A 4HIKA 5D14A 4CDCC 1T9HA 3J7AV 1PYSB 3DHQA 4P73A 4X3TA 5KNDA 1DD2A 4DNIA 2QCPX 4KY7A 2F4VQ 1TXYA 1BDOA 2F3IA 2K52A 5C4HA 1SFOB 2A68C 1I4QA 4OWTB 4KN4C 1LACA 3GTOB 3BDLA 1BBWA 1SFOH 5C3WA 3C3LA 4PNYA 2BA0A 2F1MA 1IBLL 1CKMA 1TVXA 1S5BD 2K5HA 1D8LA 4BY1B 4KHZA 3S2DB 3SGIA 1AE2A 2NVXB 1SMYC 2MPMA 4JW0A 1F2LA 1RIPA 1Q86C 1VQ8A 3CPWA 5JEAG 2C35B 4DK3C 4DFAA 4L5QA 4EGVA 4OEMB 1EFWA 4DAMA 3W1BA 3TEHB 3STBC 3HKSA 1VQ7A 1E24A 2YU9B 3E0EA 1SE8A 3HRZC 2E2IB 2WP8J 4JYAL 1ENCA 4DUZQ 2EY2A 1PFBA 1F9PA 3TRZA 3WOFA 5FLMH 2F0FA 1M4VA 3BJUA 1LTBD 2YYZA 3PIOA 2JJQA 1D6EC 4LFBL 3H15A 2UXCL 2M2LA 5JOBA 3DWPA 4GLAC 4DAPA 4CJ1B 3CMEA 1VQGA 1SEBD 4DN4M 2JA7G 1B3AA 4P2CB 4DF7A 5IP7H 3UDFA 4QIWB 5HGTA 1VMPA 2EYOA 4HCEA 3MHBA 1S3OA 3ONAB 4RKBA 2HD3A 4HMJA 4HIMA 1KLUD 4NKLA 2CWPA 3W2DA 4A3EH 3W5OA 4PG3A 1KLGD 1SR3A 4JPBW 4LJZC 3J81i 2NUCA 4GOPA 2N49A 1CA5A 1MJCA 4X65Q 4IUQA 1PYBA 3I90A 4C3JG 2RSOA 4LF9L 4JOIC 2ASBA 3LNNA 3M4OB 1UEBA 4RHSA 4DV5L 1L1OA 1DOKA 5JJLA 4MNOA 5KGUA 3ERQA 4CDFC 3L9AX 2JA8B 4FO2A 4LUOA 5IGCA 4DKAC 2L11A 1JWSD 3ND9A 2I0QA 1JJGA 3L0OA 4LF7L 4JI6L 2EIFA 1M8AA 3E5SA 4LFAQ 1VF5C 1YNJD 2QF7A 1RHPA 1E3PA 2UUBQ 4IOAA 2B2UC 5IOCA 3D0FA 3UE0A 2XTIA 4DR1Q 2VZAA 3OPOA 1HR0L 3FP9A 5IIFA 1MSHA 2AKWB 1Q46A 3A8KE 1SMXA 1KRSA 4JI2L 2ICEC 3H6MA 5IODA 3R3OA 4FF4A 3NENA 2PZUA 5FO8B 2WKDA 4ZUIA 2KBNA 1VQIA 4DR3L 4QUFA 4B3SL 5E1FA 1B4OA 3Q8DA 1SYDA 3TQYA 1N33Q 3S15B 1HNXQ 4DR3Q 4HSVA 4A3EG 1I50B 1VQNA 4LF4Q 4K6LA 1BQQT 4POFA 5JJKA 3PIO3 1EU4A 2Z6KA 4JVZA 2G9HD 1PFMA 1VQAA 3BDCA 1PH6A 1XNRL 5HURA 3DM1A 3GTOH 4KHPL 2BH8A 4G4KA 3MEHA 1FJGL 3WDNA 4KJOA 2ZJRA 4IOCA 1PTOB 2X6GA 2OCEA 4YCVA 1Y69U 2MO0A 3I4MH 4A3IB 1X3PA 1WTXA 1J5EQ 2K50A 4YCWA 1CKOA 1L2FA 4OIKA 1PRTC 1BXTA 1HQRD 1EQRA 3AYHB 4RAUC 1LTRD 2EQSA 2E2JB 4L8JA 1B44D 3S24A 3MEFA 1YITA 5CMDA 3HOVB 1HA5A 3GTPH 5KEEA 4C3IH 3HOWG 2DJGC 1QVCA 2A6HD 1WYDA 2LSSA 3UI2A 2I5MX 1X65A 2WFWA 2QEXA 3NBHB 4S3SA 4YIJA 4YY3Q 4IO9A 2TSSA 1K8OA 2EJFC 2AQ2B 2QILA 4PQXA 4HIOA 5IP7G 4OWWB 1PH1A 1SNMA 5C4ZA 4FYDA 1KDBA 2F3VA 3SK5A 5DAUA 1V8QA 4C3IG 3L7ZC 1SLJA 1HZ9A 4HAEA 4EQOA 1E7ZA 4DR5Q 3QOLA 4A3GB 2B2VC 4NPSA 2HIVA 1A0IA 4ZLTF 4QJFA 2XN9C 5BN3A 1N32Q 3CC2A 4F88A 4B3MQ 3GDEA 3EIVA 4PMCA 3SDZA 2UU9L 1EWCA 1IBMQ 3IL8A 3HKZG 2QDLA 2OXPA 5KYLA 2AUJD 2F0NA 1TWAB 2YTXA 1IW7C 3NTIA 5C3EH 2RF4A 2F03A 3M7NA 3I8ZA 2JA5H 2L12A 1ZEQX 3I91A 4A3JH 2K01A 1GHKA 4NXNL 4K14A 4DV0Q 2VQEQ 2AWOA 1WOCA 3FRPB 4FXGC 1A3TA 4RKLA 3S14H 1EZ8A 2NWGA 4DV2Q 1LABA 3J80L 4U673 3CW2C 4P74A 1ET9A 2KOLA 2L0CA 3BVZA 5EBDA 5J22A 3W3AA 5J39A 4ZK9B 3Q24A 1ILPA 4KI0A 1WD0A 4DV1Q 2HIXA 1TWGH 4CKCA 4PZ6A 1CA6A 1VQPA 3WOEA 3M4OH 3CF5A 3GTJH 3AB9A 4DR7L 2I5LX 5C4JH 1GHJA 2ZJQA 1YEZA 2O2LD 5BN5A 2C9OA 3CP0A 1PH5A 4XQNA 2GN5A 1HPCA 2EOTA 4GZYC 2WAQB 3S9WA 4EX5A 3ICEA 2R93H 3KDFB 4R4CA 4PZ7A 4ZYSA 2UUAL 2M9VA 3OMGA 2B63B 4KY5A 4Z9CB 1DJRD 1XXGA 2WIIB 1G291 2CH4W 3QJYA 3GD7A 1TY0A 3J81j 1TT2A 4JI3Q 1BBXC 1GUOA 1WTOA 3OWEB 4DR2Q 1E0BA 4WORA 4A3GH 1S5ED 2VS1A 5L37A 2QEJC 4HN7A 4UP8A 3S1QH 1STBA 3CQZH 5CV6A 3HP3A 4YY3L 4R4OA 3NWTA 2Q2IA 5TSSA 5CV5A 3DM3A 4IQZA 1RKNA 1FYCA 3PO3B 2OTJA 3EQLC 1C8CA 1YNND 3HOYG 4GLVB 1EY6A 3F2BA 1CQVA 1I3QB 1B70B 4P72A 5G3LD 1NAPA 2KJXA 1BOSA 1VCIA 2P5ZX 1SYGA 4EQPA 1SYEA 3AQQA 2DNEA 3EROA 4BS9A 4HMIA 4GNXA 2ICIA 3G6EA 4FXDA 3PUVA 3OW2A 4HEDA 2BOSA 4WJ4A 1OTCA 4BA1I 3D8GA 1KRTA 3J7YW 2D9UA 5CR3A 1IBKL 4K0KQ 4KN7C 4OIJA 2Q8TA 2LKVA 4LUVA 4B9WA 5ELOA 1U0LA 3L2PA 3PO2B 1NE3A 3WWVA 4JI1L 5K5PA 3CCLA 2K4KA 4AQYQ 4DV0L 3RZOH 5K36G 4B3RQ 3I4MB 3GTMB 2B2TA 3M7GA 4F87A 1E22A 2Z4IA 1V1OA 1D1IA 3EA6A 3RUZA 3H3VI 5ELNA 4KY6A 1YZ6A 4IJHA 4ALPA 3NPPA 2K05A 4R1JA 4A3CH 3NBIA 2L4NA 4DV7L 5LMNQ 2EYLA 4K6DA 1Q82C 5IP9H 2B3GA 2NN6I 3G7LA 2JA6H 4A3BG 3J7A5 1TWHB 1VMCA 1HZBA 2JA6B 3T1YQ 4ME3A 2JA5B 3A7AB 2KCNA 1K8GA 4HR7B 4X3SA 3NUCA 2WACA 1Y1WH 1DXMA 4QL5A 4XXEA 1KHIA 5GROA 2K5VA 2YTYA 1EQQA 4A3DB 3PUWA 1KNAA 4C1NK 1LTSD 3FHWA 1PH2A 1N36L 3M4QA 1SXTA 3RLNA 5LHY1 2F0GA 4ABNA 3GTGH 2OEOA 1P8LA 4AH6A 5C0XI 2ZTEA 5D3DA 5JJIA 1JE5A 2KEEA 2B2TC 1U5KA 4JI5L 4QB4A 3OW7A 4CKBA 1K0RA 1IYUA 1VQ6A 1CFMA 2WAQE 1HZAA 2KCTA 3EBEA 2IJ0A 1DGSA 2DJFC 3BVGA 3MTSA 2CWAA 2Z9HA 1SYCA 4OO1H 1FR3A 4OELB 1CI3M 1C7YA 3NQIA 4JI6Q 2H4OA 2F0QA 5C3EB 2F0EA 3AEVA 4EQ5A 4X64L 3HZXA 3OIPA 4FXKC 3IFDA 1SSOA 4QMGA 1CHPD 1SRUA 1V1PB 2B2UA 2IHEA 2PNRC 1WTPA 4DPGA 2DNCA 4QUCA 3U50C 1JR0D 1N33L 4K2KA 4UP7A 1QG7A 5IYCH 4DXFA 4E6IA 4C3IB 1ZYRD 2FMCA 2B2YA 2Y0SB 2IWHA 3HOZB 2WAQG 1LTAD 4IURA 3MFGA 2Q8IB 1SAPA 3PCOB 2KHSA 5CV8A 1X3QA 4PMWA 3G48A 3J7ZC 1PH7A 2I07B 1PVOA 5CGKA 2E74C 2Y0SG 3S1NB 4A3BH 4RGOS 1UE1A 3K8AA 1IYVA 2MUYA 4BA2I 5JEAJ 1GUWA 4K5XA 5I2XA 2L5TA 2NVXH 3UDIA 1F2ZA 1I5FA 1O7IA 3K5LA 3Q22A 4LFCQ 2BH2A 3PO3H 5JAVA 1KABA 2MP1A 5IGGA 1H95A 1G2TA 3T56B 3OTOL 1HR0W 4IUPA 4A93B 1Q1EA 4B9XA 3Q6SA 4A3IG 1JWUD 2A74C 3V2TA 1A15A 1GUNA 5FLXL 5M5XB 1CKNA 1W6JA 4RGNA 3NQTA 1JJ2A 2D0OA 1ZXTA 4C3JB 3RN2A 1HCZA 1I4GA 4G57A 3K59A 4JYAQ 5BR8L 3MZ5A 3PF5A 2JSOA 3TMEA 2O5IC 1LTLA 1QCBD 4AQYL 3K7UC 2A19A 3KLSA 1G51A 1NJIC 2F0HA 1HQMC 2JQOA 3BVMA 4A3IH 2UXBQ 4OHJA 1NY4A 3CQZB 3JAML 1WCMB 2WB1B 1I6VC 5IE8A 1U4PA 4DAYB 4LF5Q 3T13A 2NVTH 1JCKB 1TU2B 4A3GG 1AFPA 3JC66 4CDDC 2Z8LA 1PFSA 4WJ3M 1SJED 1I4PA 4DGZA 4JC0A 5I2YA 4R8NA 1TIID 3ND8A 3HOXB 1N36Q 2EY6A 2PYKA 4CBVA 1PH4A 2PNHA 2OTLA 3ULJA 4GKJL 2B8FA 1JQYD 2VXWA 1VQMA 4LW1A 1BUVT 4XTCS 3S15H 3KF8A 2HUGA 4KTAA 4R4TA 4A3CG 2NTSA 4MIUA 5DEHA 1GXDC 2ZXOA 2AMCB 1EZ6A 2EZVA 5EJWA 1EEFD 4PV1C 3H0GG 2PZTA 2RKSA 2PPBC 1SYFA 2FXQA 3K81C 3R2IA 3HOWB 4BBRB 1ML0D 3OYYA 1K0SA 5FK9C 2QA4A 1VQDA 4IPDA 3T16A 1S72A 3L3OC 2CFMA 3GQBA 1ET6A 3CC4A 4JI5Q 5FO7B 2A6HC 4O0AA 4X3UA 3KK7A 1EWHA 4NMZA 1EYAA 1KAWA 2GA4B 2KECA 1RD9D 5F2DA 1WCMH 4A3EB 4CGYB 1IBML 2GVBA 5AJ3L 4A3KG 1B9NA 1OXUA 5M3FB 4HCSA 1LUZA 1JOOA 1F2YA 4IUVA 1RF2D 4JI8L 5HGQA 3C1EA 5EKIA 3TN2A 1D5XC 4C2MH 1H9RA 5NUCA 1G6ZA 1PZKD 1IHZA 1BR9A 1EYDA 2MFIA 5FO9B 2L55A 2A1AA 4DK1A 4JK1C 1X54A 2CH4A 2ZTDA 5IYDG 4RHRA 1YI2A 3MVVA 1EL0A 4IUUA 4GOPB 1XTCD 3NK9A 4MZ9A 1SNOA 3K5OA 5ELDA 3R8BA 1G6PA 2PI2E 4C56C 2JEBI 1RL2A 5E4XA 5C0XJ 2NVYH 4KHVA 1YNJC 1EIYB 1ENFA 1XMOQ 4KK7A 3A7LA 2HCCA 4H0LC 2N3SA 2IX3A 4A3MG 3SXHA 3BDOA 1VQOA 4AYBG 1HNZL 3I4LA 2PZWA 2DY8A 2UUAQ 5IYCG 4BY7H 3GO5A 4K8JA 4ZQ3A 3S1QB 1RJTA 3TDQA 2NB0A 3NXWA 4ID6A 3K5MA 4H13C 2LY7A 1PTOH 3SHLA 1L0YB 4C3HG 1STYA 1Q1BA 4JI1Q 1XTDA 1NNXA 2RSNA 4K5VA 3T1HQ 2MHVA 3A56A 3DXJC 1E2WA 1V1QA 1SDFA 1QZHA 4C3HB 1TWFB 1X9NA 1XMQL 1YJWA 4A3MH 1VQ4A 4HJAA 1MGSA 5M3MB 3KJPA 4NDXA 1YVCA 2O4XA 3UDXA 4WJWA 3DUZA 1X6OA 1F2MA 5C6AA 1A2TA 2VUMB 3HOVH 3MC0B 4UP9A 3SR1A 1YJNA 5E3FA 3AFQA 3VR4A 5GQOA 3ULPA 1LO5D 5IGEA 3SE0A 5BR8Q 1B53A 4B3SQ 4FDBA 4GNXB 3TREA 3S1NH 3J80c 3D4WA 1S4ZA 1PYWD 4FNFA 1HNXL 1N34Q 1YBYA 4LFCL 5IT9L 1PFNA 2B39A 1Q81C 3GTJB 4XIGS 3HG9A 1CZWA 3MWYW 2DY7A 3QO2A 2K28A 3P20A 1N34L 3GTLB 2K7VA 3ZJYC 4F7XA 3D4RA 2R7ZH 2MGSA 4A3LH 2K5DA 4JG2A 3BZCA 5C3EG 4DV4Q 3VYSA 4RGTA 3PGZA 4MTKA 4A3FG 4NXMQ 2SOBA 2D2CC 2NYZD 1FGBD 4N8X1 4PZ8A 4RWSC 4RG1A 3M4YA 5E4WC 2ZXRA 1GUTA 1EIHA 3CCVA 4R4QA 5M3FH 4Q5VA 3I4NG 2NZ1D 3H0GH 4QGUA 1OXXK 3I7FA 3PIP3 3K0XA 1R4PB 5ELEA 1KIXA 3PSIA 2B2WC 1TWHH 2K33A 3HOUH 1YJ9A 1V1PA 2PMZB 1VQFA 3N52A 2DUDA 4UHVA 4JV5Q 1JJCB 5IGBA 3TS0A 1XWEA 1TY2A 3H3VH 4DR7Q 4UY8C 1WTRA 5C44G 3V05A 4O2DA 5ELBA 2VQEL 2E75C 1C48A 1FNUA 1NR2A 1XJVA 4WFN3 1QOHA 4JI0Q 2JK8A 3NBHA 3KJOA 1KD1C 1E2ZA 3U9OA 4LF9Q 3HOVG 4LF6L 1S5DD 3VYRA 3D31A 4UPAA 1SE2A 3J81E 1EY5A 4FF2A 4V0BA 1VQJA 4JI0L 4HJ7A 4LF7Q 2ZM6L 4Y7NB 4BXXG 2F3WA 2R7FA 3J81c 2K6AA 2LMCB 5C4JB 2OWOA 5BN4A 1LTID 1DOLA 1RDPD 2Q8RE 2JE6I 2VB2X 2HHHL 2XRQD 1XNQL 3J81L 1NUCA 1SROA 4XT1B 4POGA 1V43A 4NB3A 2UUBL 1QWYA 1W2BA 2YU9H 5D3IB 5EKLA 1AEXA 3KF6B 1F9QA 5D65A 5H1SE 3BYYB 4UDUC 4JBWA 5KRUA 3OOCA 4OO1G 1CSPA 2F0LA 3ERSX 3OWFA 4OWXB 3TP6A 2R92H 2KENA 4J8QA 2UXDL 1SN8A 2SEBD 1K83B 4LF6Q 1C9OA 2E2JH 2VUMH 1DYQA 1A62A 2VY3A 3Q23A 1BCPF 1KDAA 3R93A 2XWBB 2IX0A 2L15A 3KOJA 3S1RB 2R3ZA 4J1MA 3SVMA 4DAVA 2HQLA 3J80i 3OHXC 3U4ZA 1EYGA 1Q90A 3SEBA 4U68A 5EBCA 1FJGQ 2NZOA 1PRTD 2EPBA 5FJ8H 4C3HH 1DCZA 5C0XH 2YV5A 1X3FA 4FP5D 2N8NA 3C1FA 4A3KB 4DR4Q 5E7NA 3FDTA 2HDLA 2ZT9C 3M3YH 2RHQB 1QZGA 1KQSA 2R93B 1I94Q 2F0PA 2Y0SE 2E5LL 1GJXA 4P75A 1B1ZA 4RMFA 1J8IA 2V4DA 1B3QA 3IFTA 3KLRA 4MN3A 4O42A 1VQ9A 5IYBG 4A93H 1CZGA 3TSSA 3U58A 1KTKA 4XQQA 2A6ED 3Q0AA 1K83H 3AFPA 1L0WA 3D6WA 5K36H 2SNMA 1HNWL 4H02A 1X56A 3S17B 1D5MC 5I9OA 4B3RL 4LF5L 3ZYYX 1SYBA 1PA6A 1OXVA 1ESRA 5EGTA 1TWGB 3E9IA 3EFXD 2KVMA 2PO4A 1CT1D 1IYJB 1DOMA 2TMPA 4A3MB 1IBKQ 2VNUD 1STGA 1HH2P 2HDMA 3PV0A 3TBIB 2CHBD 2R7ZG 1X3EA 4JOIA 2K5QA 4LAAA 4LF8Q 4BY7G 1OO9B 3VR3A 5COYA 2IW3A 1IZ6A 1R9TH 1PMRA 2JN4A 3FKIG 3RR5A 3DEPA 3P75A 2ENBA 4OGQC 1AZQA 1P16A 2G9DA 3MFYA 3K5NA 2JA6G 1JC7A 2NBFA 5GADC 2QGQA 1LYLA 4DR6Q 3UE1A 4LK1C 3NSWA 4EVOA 3E9HA 5M3FG 3I4NH 4LMQD 4FF1A 1V9PA 5I6WA 5GAGC 5CV9A 1JB7A 4GKJQ 4KMUC 5JJZA 4YWMA 2BDNA 2E2HB 2K1BA 1BVSA 2F0JA 3AU7A 2C5CA 1SNCA 1Y1WB 5I4DA 1A3VA 1TR5A 4LWCA 4H7BA 1H9SA 4A93G 4BBRG 2R7ZB 5ISRA 1RODA 3K7AB 4GN5A 2PCFB 3SK6A 4BXXH 2FHTA 4BBSH 2F0IA 3I3CA 4RGMA 4GKKL 4A3FB 3KBXA 5LMUL 3H0GB 3QG1A 2PMZE 1O80A 1NCVA 4JBJA 3GV6A 3DLLA 1YIJA 1EY9A 1IXRA 1B8AA 4ULLA 2XWJB 1GKHA 2D5DA 4FVMA 5EPJA 3U9SA 4LNQA 3H94A 4IUTA 3PO2H 1HXYD 4DV5Q 3RN5A 4BBRH 4NP5A 2A69C 2IPKD 1KNEA 1EY8A 3VR6A 4K5WA 5IT9c 3RZDB 1AN8A 2K04A 4WRDA 2VQFL 5CBAE 2E5LQ 1Q12A 2RCNA 3K80C 1STNA 3NE5B 4R4IA 1N9WA 3TS2A 4EQNA 3JAME 1QNUA 3G71A 1MIUA 4JI4L 1Q8KA 1PTOF 2NN6H 3E0JA 1PLFA 4A75A 1SE3A 1W3SA 2EYFA 3HS0C 2VUMG 2RDHA 3CU7A 1QB5D 1XPRA 4DK6C 1MD2D 2JA5G 1HFGA 4IPHA 3BZDB 5A2QE 2JA9A 1K9MC 1S5FD 4ZAIA 3PIPA 2WB1E 3RMHA 3KUPA 4ZUJA 1QVFA 2R61A 3FEWX 3LWUA 2NVQB 2F0KA 1RCVD 1G2SA 5A2QL 1Q3LA 5DNFA 3S16H 1JOQA 5EPLA 3TZUA 4A76A 4BY1H 3S2DH 2I46A 3T51B 3J7AF 4C3JH 3RZDH 1CK1A 3CMAA 2RCFA 1D2BA 1JWMD 1SE4A 2D0PA 1GUGA 1NBWA 1QUQB 1TWCB 2K75A 2M00A 3M4PA 3VR2A 3H3VC 5M5XH 2CW0D 2F0VA 4TSSA 5C5MA 4MTNA 2QW7A 3QB3A 3H09A 4C1NI 3E6ZX 3X3NA 2VL6A 4J15A 4RCOA 2AWNA 1NR4A 1D7QA 1VQ5A 2GVAA 2WINB 4IFDG 2AQ3B 1BO0A 3VA5A 2KUMA 5IWAQ 2VW9A 1VQEA 2OT2A 5IYDH 3A55A 1ICFB 4HJ5A 4L63B 4JCVE 1EYCA 2XSCA 1AZPA 1L1OB 3MXNA 3I4OA 1WD1A 4OXPA 1R4QB 1PTOC 1UE5A 1WTHA 1I4HA 4HJ8A 3A5UA 3HOZH 1OXSC 4XYQA 4A3FH 3KF6A 2I5HA 1K28A 1A8VA 4N9PA 5C4XH 1FD7D 4K2LA 1B50A 3DWAA 1IKMA 1Y1VH 1HFNA 5IYBH 5DLQE 1FNVA 1I4XA 1LTTD 4L6TB 3PF4A 1Q8IA 3N6RA 1ENAA 1FVIA 2UUCL 1UE6A 2IHFA 3F2CA 4IN3A 5C5LA 5T1IA 4YHHL 4K8IA 5CC4A 1A3UA 1X32A 1Y1WG 2XRSD 2XVSA 2PQEA 4XT3B 3KBGA 4DK0A 2QKIC 4X6AH 4RA8A 3GV3A 2J4XA 3PO3G 2KEDA 5GAEC 5KYIA 2B2WA 3RNUA 3NHHA 3G4SA 2R7DA 1M1KC 2A73B 2FJ2A 3X3MA 4BWGB 2HCIA 4J6HA 2Z6KC 4LF4L 1VQBA 4IJLA 1VDZA 1PH3A 5C4XB 1JT8A 4DV7Q 2RVLA 1TKWB 3GTQH 2KCCA 2F52A 1LT3D 5DM63 2CCZA 4DV3Q 4O1NA 3BU2A 2Q2UA 3HOWH 2Q2TA 2UUCQ 1O7ZA 1L0XB 3RD4A 2N78A 1GOZA 1NSNS 4A4IA 2LXJA 4B08A 1KL9A 4DNRB 1I6HB 3M9BA 1Y8NB 2RDGA 3BYTB 5IT9E 3GP7A 2OQKA 1F9RA 1ASYA 2AQ1B 1HTLD 3NEMA 4I65A 2NVTB 1BCPD 2JXMB 1BNZA 4JI4Q 3VDYA 5EPKA 5A35A 5M5YB 4DR1L 1HRJA 3C46A 3OIQA 1EFID 1ESFA 2EYJA 3I4MG 3MXGA 1SJHD 1MKHA 2LS01 2O5JC 4G7HC 2K03A 2OQ0A 3LGJA 3GTPB 1XX8A 2D62A 3STBD 3S1MB 4DR4L 2F4VL 4B3TL 3CCMA 4LUZA 1B2TA 1PDQA 2NVQH 4X3KA 5T1GA 2JA8G 1JB3A 1JOKA 3E3XA 4X64Q 4BY1G 1KAAA 1CKNB 2NVYB 1O7LA 3OTOQ 3TP8A 2B2YC 5EKKA 2B2VA 3PMFA 1GUSA 1STEA 3MXNB 3H91A 4APVA 1TWCH 5I6YA 4A3LG 1Z47A 2F0OA 2MO1A 1ILQA 3F1ZA 3DWQA 1EU3A 5KNCA 3R2TA 3URYA 5M3MG 2EJGC 2XNAC 5FLXc 4C2MB 1PHJA 1CHQD 1Z9FA 2F4IA 2B29A 5IGDA 4P71A 1VS0A 1D5ZC 1YNXA 4NXML 4A3BB 1TS5A 4JBMA 1FL0A 1STAA 3VR5A 3FKIB 1EUJA 3PUZA 3K6OA 1TWAH 1KC8C 3I70A 2JP1A 3ULLA 1EY7A 1U9RA 2EYHA 4HJ9A 4BBSG 1CTMA 4ILWA 3P7JA 3K0YA 4QY7A 5M3MH 2R92B 1QVGA 5M5WB 4QQBX 1X3GA 4RFBA 2F0UA 4ZKCB 1HHVA 1Z6HA 2R93G 2Z1CA 1I50H 3AMUA 1LT4D 1W6KA 4LFBQ 2UXCQ 4Y52H 4G7ZC 4CKEA 1HJPA 1WJJA 3NELA 3HOUB 3QIAA 3NWSA 3HKZE 5C4XG 3HFZB 4X62L 2RDFA 5C44H 4QF4A 2JYOA 2RBMA 3CPFA 1QILA 1NTGA 1QE6A 1TS4A 1XYIA 1LV9A 1K8MA 2A6EC 5KIXA 1Y8PB 4X65L 1EIFA 1EQVA 3ER0A 5CBEE 1R9TB 1A2UA 2OF1A 3K7AH 4YHHQ 2FINB 5FJ8G 2CW0C 1FNWA 4TKOB 3SK4A 4ME5A 1ICWA 2PW7A 2SDFA 1QUQA 5JVH3 2AUKA 4IFDH 4KKUA 1LTGD 1WTQA 1O78A 3EN2A 2PW5A 4DNTB 2KCMA 1G91A 4I7AA 3CCQA 2VQFQ 3K58A 5M5WH 2RQXA 1SNPA 2K5NA 3I4NB 2NTTA 2ZXPA 3C2PA 1AE3A 1IL2A 1PV4A 1PZID 2VB3X 4JI7Q 1VQLA 1LT5D 1MSGA 1UE7A 1GO3E 4A3JB 1LM0A 3BZKA 5LMUQ 1Z7TA 4JI7L 2EXZA 2JA7H 1S5CD 3DMUA 1EOVA 4JI8Q 2CQOA 4IPGA 5J1ZA 1G8ZD 4L5SA 4M8AA 3FKIH 3CHBD 1EEID 2XGTA 3RZOB 3KLWA 2K5WA 2BCOA 3TP7A 2EY5A 3MXUA 1E1TA 2PQAA 1PRTF 4L5TA 4H44C 4N9TA 2NN6G 4FF3A 2L1BA 1N8RC 2IL8A 4GLXA 3FMCA 1H9MA 2MJ8A 2ZTCA 2Z6BA 1AH9A 1H9SB 2K32A 3P1HA 3S17H 1TWFH 5CV7A 1HNZQ 4OONA 3NTKA 3A74A 1WVLA 1M90C 1SBBB 1S40A 1E2VA 3CCSA 3CCRA 2LXKA 3G6JB 1WCMG 1DM0B 3QR8A 3D4DA 3GTKB 1X55A 4TVAB 1HUMA 1TS2A 1SNDA 1PH9A 2N55A 2Q2HA 3GTKH 3NP8A 5JPNC 2J0TD 5IWAL 1A63A 1Y1VG 3CKIB 1PTOD 3F2DA 1I4RA 1VF7A 2DGYA 4BY7B 4HSPA 4JBKA 1J9OA 3I72A 4TRDA 4YWLA 4B3TQ 2MNAA 3A54A 1BKBA 3TP5A 4RH6A 4DR6L 2CKZB 1NMFA 1HZCA 3KDFA 4DV2L 3I2ZA 1D1KA 5EQ0A 4F8MA 4KKSA 4DV6Q 3I56A 3CCEA 4ODGA 2UXBL 3CXCA 3S14B 1K73C 1C0AA 4UAIA 3FPUB 3VYTA 2JA7B 1K3RA 5EAYA 2B63H 5CYUA 4DR5L 2PI2A 5M5YH 1WTVA 1MJEA 2FFKB 1BBUA 4LF8L 3O13A 3SK8A 4M1UB 4OX9L
chains in the Genus database with same CATH topology
5ELFA 2A5HA 5JPMC 2EDGA 4BBSB 5FOBB 2RA4A 1EQTA 1BF4A 2F0MA 3BG3A 1BCPB 4AYBB 5AFWA 3OSOA 2KA7A 1EY4A 2B8GA 1DZ1A 2E76C 5I9PA 5CV4A 2SNSA 1B9MA 1TS3A 2EVBA 4RCNA 1UNSA 1UUPA 1LT6D 1DONA 3ITPA 1SMYD 1UEAB 2LFNA 1WTWA 1QJOA 2EYMA 2N88A 5FLXE 2KQ3A 1JICA 4XDXA 1ONLA 4CJ2C 2BE5C 1MI2A 2IX1A 4IFDJ 2A69D 2CVRA 3A8IE 4KKTA 1Y8OB 3TZDA 2BE5D 4CHTB 3PUXA 2F0TA 1OXTA 5FKAC 3M3YB 2ID0A 3MXPA 2X6LA 1U4LA 2BA1A 3LX0A 1U4RA 2L9HA 3A8JE 3EVQA 4MHEA 4R9WA 2F0DA 4ZKBB 3CRKC 5DM73 3T4AC 4PMBA 3EJIA 5C3XA 1CM9A 1AP0A 1H9JA 2BDOA 1SNQA 3M85A 4IZ8A 3GTQB 1EY0A 2EY1A 3S16B 3QWNA 4QCLA 1LLRD 1STHA 3LWEA 5JEAH 1HTPA 5C0XG 1RTNA 3BS1A 1HUNA 1IW7D 4ZRZA 2QDBA 3T53B 1H9KA 4TQUS 5ELCA 2F0WA 4DXGA 1HA6A 1EOTA 5M9OA 1RTOA 2CQAA 3HOYB 4G7OC 2JEAI 1IL8A 5G3LF 1BCPC 1II3A 4XQJA 4IALA 2EJMA 3IAYA 1PRTB 3CRLC 1Y1VB 4OL7A 1T5EA 3HEJA 4XYOA 5JVG3 1U4MA 4KV6A 2E2DC 3KLSX 4I7ZC 5IGFA 2X69A 1JORA 1QNKA 4OO1I 4KD4A 3D3RA 3FVQA 4DAYA 2FMMA 1PZJD 3GTGB 3HKZB 2R6GA 1UAPA 1MBYA 2F0SA 4Q0FA 4DA2A 3VYUA 1AW7A 1YNNC 2HQEA 3RLFA 1TQOA 2XIWA 1C4QA 3HGBA 1IKLA 1F9SA 3D6CA 4V190 4KJNA 1EIGA 2J7ZA 2A68D 3FPPA 4HTHA 2EYPA 4DU9A 3VA7A 1JE4A 4R8IA 3MAQA 3K57A 3MA2B 2WV6D 1O7YA 1T5XD 5LL6X 2WKCA 3NTHA 1ZKOA 1PXUA 2H1EA 5KNBA 3OMCA 3F2UA 5C44B 5LL6S 3DEOA 2Z4HA 2IT1A 1ZYRC 3S2HB 2DN8A 3QOJA 1A6XA 2EE1A 3IKJA 4NW2A 3PUYA 4IFDI 4IUNA 3J80E 1F77A 4KD3A 4CJ0B 3V96A 5CORA 1CQFA 1KDCA 3I73A 5D14A 3J7AV 3DHQA 4X3TA 5KNDA 1DD2A 2QCPX 4KY7A 5C4HA 1BDOA 1SFOB 2A68C 1I4QA 4KN4C 1LACA 3GTOB 3BDLA 5C3WA 3C3LA 4PNYA 2BA0A 2F1MA 1TVXA 1S5BD 4BY1B 4KHZA 3S2DB 2NVXB 1SMYC 2MPMA 1F2LA 5JEAG 4DFAA 4EGVA 2YU9B 3HRZC 2E2IB 2WP8J 1ENCA 2EY2A 1PFBA 1F9PA 3WOFA 2F0FA 1M4VA 1LTBD 2YYZA 1D6EC 2M2LA 5JOBA 3DWPA 4DAPA 4CJ1B 1SEBD 4DN4M 1B3AA 4P2CB 4DF7A 4QIWB 5HGTA 1VMPA 2EYOA 4HCEA 3MHBA 3ONAB 4RKBA 4HMJA 1KLUD 4NKLA 3W2DA 1KLGD 4LJZC 2NUCA 1CA5A 4IUQA 3I90A 4C3JG 2RSOA 3LNNA 3M4OB 4RHSA 1DOKA 5KGUA 3ERQA 3L9AX 2JA8B 4FO2A 5IGCA 2L11A 1JWSD 3ND9A 1M8AA 3E5SA 1VF5C 1YNJD 2QF7A 1RHPA 2B2UC 5IOCA 3OPOA 5IIFA 1MSHA 3A8KE 2ICEC 3H6MA 5IODA 3R3OA 4FF4A 2PZUA 5FO8B 2WKDA 4ZUIA 4QUFA 5E1FA 1B4OA 1SYDA 3S15B 4HSVA 1I50B 4K6LA 1BQQT 3PIO3 1EU4A 2G9HD 1PFMA 3BDCA 5HURA 3DM1A 4G4KA 3MEHA 3WDNA 4KJOA 1PTOB 2X6GA 1Y69U 4A3IB 1X3PA 1WTXA 4OIKA 1PRTC 1BXTA 1HQRD 4RAUC 1LTRD 2E2JB 4L8JA 1B44D 5CMDA 3HOVB 1HA5A 5KEEA 2A6HD 3UI2A 4S3SA 4YIJA 2TSSA 1K8OA 2EJFC 2AQ2B 2QILA 4PQXA 1SNMA 5C4ZA 4FYDA 1KDBA 2F3VA 3SK5A 5DAUA 1V8QA 4C3IG 3L7ZC 4HAEA 4EQOA 3QOLA 4A3GB 2B2VC 4ZLTF 2XN9C 5BN3A 4F88A 4PMCA 3SDZA 1EWCA 3IL8A 2OXPA 5KYLA 2AUJD 2F0NA 1TWAB 1IW7C 3NTIA 2F03A 3M7NA 3I8ZA 2L12A 1ZEQX 3I91A 2K01A 1GHKA 4K14A 2AWOA 3FRPB 4FXGC 1A3TA 4RKLA 1EZ8A 2NWGA 1LABA 3J80L 4U673 1ET9A 2KOLA 2L0CA 3BVZA 5EBDA 5J22A 3W3AA 5J39A 4ZK9B 3Q24A 1ILPA 4KI0A 1WD0A 4CKCA 1CA6A 3WOEA 3AB9A 1GHJA 2O2LD 5BN5A 2C9OA 4XQNA 4GZYC 1HPCA 2EOTA 2WAQB 3S9WA 4ZYSA 2M9VA 3OMGA 2B63B 4KY5A 4Z9CB 1DJRD 1XXGA 2WIIB 1G291 3QJYA 3GD7A 1TY0A 1TT2A 1BBXC 1GUOA 1WTOA 3OWEB 1E0BA 4WORA 1S5ED 2QEJC 4HN7A 1STBA 5CV6A 3HP3A 3NWTA 5TSSA 5CV5A 4IQZA 1RKNA 1FYCA 3PO3B 3EQLC 1C8CA 1YNND 1EY6A 1CQVA 1I3QB 5G3LD 1NAPA 2KJXA 1VCIA 1BOSA 1SYGA 4EQPA 1SYEA 2DNEA 3EROA 4BS9A 4HMIA 2ICIA 4FXDA 3PUVA 4HEDA 2BOSA 4BA1I 3D8GA 3J7YW 2D9UA 5CR3A 4KN7C 4OIJA 2Q8TA 2LKVA 4B9WA 3PO2B 5K5PA 5K36G 3I4MB 3GTMB 2B2TA 3M7GA 4F87A 2Z4IA 1V1OA 1D1IA 3EA6A 3RUZA 4KY6A 3NPPA 2K05A 3NBIA 2L4NA 2EYLA 4K6DA 2NN6I 3G7LA 1TWHB 1VMCA 2JA6B 2JA5B 3A7AB 2KCNA 4HR7B 4X3SA 3NUCA 2WACA 1DXMA 4XXEA 4A3DB 3PUWA 1KNAA 4C1NK 1LTSD 1SXTA 5LHY1 2F0GA 4ABNA 2OEOA 5C0XI 5D3DA 2KEEA 2B2TC 4QB4A 3OW7A 4CKBA 1IYUA 1CFMA 2IJ0A 3BVGA 3MTSA 1SYCA 4OO1H 1FR3A 1CI3M 3NQIA 2H4OA 2F0QA 5C3EB 2F0EA 3HZXA 3OIPA 4FXKC 3IFDA 1SSOA 4QMGA 1CHPD 1V1PB 2PNRC 2B2UA 1WTPA 2DNCA 4QUCA 1JR0D 4K2KA 1QG7A 4DXFA 4E6IA 4C3IB 1ZYRD 2FMCA 2B2YA 2Y0SB 2IWHA 3HOZB 1LTAD 4IURA 3MFGA 2Q8IB 1SAPA 5CV8A 2KHSA 1X3QA 4PMWA 2I07B 5CGKA 2E74C 3S1NB 4RGOS 1IYVA 2MUYA 4BA2I 5JEAJ 1GUWA 4K5XA 5I2XA 2L5TA 1F2ZA 3K5LA 3Q22A 5JAVA 1KABA 2MP1A 5IGGA 1G2TA 3T56B 4A93B 4IUPA 1Q1EA 4B9XA 3Q6SA 1JWUD 2A74C 3V2TA 1A15A 1GUNA 5FLXL 5M5XB 1W6JA 4RGNA 3NQTA 1ZXTA 4C3JB 1HCZA 1I4GA 4G57A 3K59A 3MZ5A 2JSOA 3TMEA 2O5IC 1QCBD 3KLSA 2F0HA 1HQMC 3BVMA 4OHJA 3CQZB 3JAML 1WCMB 2WB1B 1I6VC 1U4PA 3T13A 1JCKB 1TU2B 1AFPA 2Z8LA 1SJED 1I4PA 4DGZA 5I2YA 4R8NA 1TIID 3ND8A 3HOXB 2EY6A 2PYKA 4CBVA 2B8FA 1JQYD 2VXWA 1BUVT 4XTCS 3KF8A 2HUGA 4KTAA 2NTSA 4MIUA 5DEHA 1GXDC 2ZXOA 1EZ6A 2EZVA 5EJWA 1EEFD 4PV1C 2PZTA 2RKSA 2PPBC 1SYFA 3R2IA 3HOWB 4BBRB 1ML0D 5FK9C 3T16A 3L3OC 3GQBA 1ET6A 5FO7B 2A6HC 4X3UA 3KK7A 1EWHA 4NMZA 1EYAA 2GA4B 2KECA 5F2DA 1RD9D 4A3EB 4CGYB 1B9NA 1OXUA 5M3FB 4HCSA 1JOOA 1F2YA 4IUVA 1RF2D 3C1EA 5EKIA 3TN2A 1D5XC 1H9RA 5NUCA 1G6ZA 1PZKD 1IHZA 1BR9A 1EYDA 5FO9B 2L55A 4DK1A 4JK1C 4RHRA 1EL0A 3MVVA 4IUUA 1XTCD 3NK9A 3R8BA 1SNOA 3K5OA 5ELDA 4C56C 2JEBI 5E4XA 5C0XJ 4KHVA 1YNJC 1ENFA 4KK7A 3A7LA 2HCCA 4H0LC 2IX3A 3SXHA 3BDOA 3I4LA 2PZWA 2DY8A 3GO5A 4K8JA 4ZQ3A 3S1QB 1RJTA 3TDQA 2NB0A 3NXWA 4ID6A 3K5MA 4H13C 2LY7A 1PTOH 3SHLA 1L0YB 4C3HG 1STYA 1Q1BA 2RSNA 4K5VA 2MHVA 3A56A 3DXJC 1E2WA 1SDFA 4C3HB 1TWFB 1MGSA 5M3MB 4NDXA 2O4XA 4WJWA 3DUZA 5C6AA 1F2MA 1A2TA 2VUMB 3MC0B 3SR1A 5E3FA 3VR4A 1LO5D 5IGEA 3SE0A 1B53A 3D4WA 1S4ZA 1PYWD 4FNFA 5IT9L 1PFNA 2B39A 3GTJB 4XIGS 3HG9A 1CZWA 3MWYW 2DY7A 3QO2A 2K28A 3P20A 3GTLB 2K7VA 4F7XA 3D4RA 2MGSA 2K5DA 3VYSA 4RGTA 2SOBA 2D2CC 2NYZD 1FGBD 4RWSC 3M4YA 5E4WC 2ZXRA 1GUTA 1EIHA 4Q5VA 2NZ1D 1OXXK 3PIP3 1R4PB 5ELEA 2B2WC 2K33A 1V1PA 2PMZB 3N52A 5IGBA 1XWEA 1TY2A 1WTRA 3V05A 5ELBA 2E75C 1C48A 1FNUA 1NR2A 4WFN3 1QOHA 3NBHA 1E2ZA 3U9OA 1S5DD 3VYRA 3D31A 1SE2A 3J81E 1EY5A 4FF2A 4V0BA 4Y7NB 2F3WA 2K6AA 2LMCB 5C4JB 5BN4A 1LTID 1RDPD 1DOLA 2Q8RE 2JE6I 2VB2X 2XRQD 3J81L 1NUCA 4XT1B 1V43A 1QWYA 5D3IB 5EKLA 1AEXA 1F9QA 5D65A 3BYYB 4UDUC 4JBWA 5KRUA 3OOCA 4OO1G 2F0LA 3OWFA 3TP6A 4J8QA 2SEBD 1K83B 1DYQA 3Q23A 1BCPF 1KDAA 3R93A 2XWBB 2IX0A 3S1RB 2R3ZA 4J1MA 3SVMA 4DAVA 3OHXC 1Q90A 3SEBA 4U68A 5EBCA 1PRTD 2EPBA 1DCZA 5C0XH 4FP5D 3C1FA 4A3KB 2HDLA 3FDTA 2ZT9C 2R93B 2F0PA 1GJXA 1B1ZA 1J8IA 2V4DA 3IFTA 3KLRA 4MN3A 4O42A 1CZGA 3TSSA 1KTKA 4XQQA 2A6ED 3Q0AA 3D6WA 5K36H 2SNMA 3S17B 1D5MC 5I9OA 3ZYYX 1SYBA 1OXVA 1ESRA 5EGTA 1TWGB 3EFXD 2KVMA 2PO4A 1CT1D 1DOMA 4A3MB 2TMPA 2VNUD 1STGA 2HDMA 3PV0A 3TBIB 2CHBD 2K5QA 4LAAA 1OO9B 3VR3A 5COYA 2IW3A 1PMRA 3DEPA 3P75A 2ENBA 4OGQC 1AZQA 2G9DA 3MFYA 3K5NA 1JC7A 2NBFA 4LK1C 3NSWA 4EVOA 4LMQD 4FF1A 5I6WA 5CV9A 4KMUC 5JJZA 2BDNA 2E2HB 2K1BA 3AU7A 2F0JA 2C5CA 1SNCA 1Y1WB 5I4DA 1A3VA 1TR5A 4H7BA 1H9SA 2R7ZB 5ISRA 1RODA 3K7AB 2PCFB 3SK6A 2FHTA 2F0IA 3I3CA 4RGMA 4A3FB 3KBXA 3H0GB 3QG1A 1O80A 1NCVA 3GV6A 1EY9A 4ULLA 2XWJB 2D5DA 4FVMA 5EPJA 3U9SA 3H94A 4IUTA 1HXYD 4NP5A 2A69C 2IPKD 1KNEA 1EY8A 3VR6A 4K5WA 3RZDB 1AN8A 2K04A 4WRDA 5CBAE 1Q12A 1STNA 3NE5B 4EQNA 3JAME 1QNUA 1PTOF 2NN6H 3E0JA 1PLFA 1SE3A 2EYFA 3HS0C 2RDHA 3CU7A 1QB5D 1MD2D 1HFGA 3BZDB 5A2QE 1S5FD 4ZAIA 3RMHA 3KUPA 4ZUJA 2R61A 3FEWX 3LWUA 2NVQB 2F0KA 1RCVD 1G2SA 5A2QL 1Q3LA 5DNFA 1JOQA 5EPLA 3TZUA 2I46A 3T51B 3J7AF 1CK1A 1D2BA 1JWMD 1SE4A 1GUGA 1TWCB 2M00A 3VR2A 3H3VC 2CW0D 2F0VA 4TSSA 5C5MA 3QB3A 3H09A 4C1NI 3E6ZX 3X3NA 4RCOA 2AWNA 1NR4A 2WINB 4IFDG 2AQ3B 1BO0A 3VA5A 2KUMA 2OT2A 3A55A 4L63B 1EYCA 2XSCA 1AZPA 3MXNA 1WD1A 1R4QB 1PTOC 1I4HA 1OXSC 4XYQA 4N9PA 1FD7D 4K2LA 1B50A 3DWAA 1IKMA 1HFNA 1FNVA 1I4XA 1LTTD 4L6TB 1Q8IA 3N6RA 1ENAA 4IN3A 5C5LA 5T1IA 4K8IA 5CC4A 1A3UA 1X32A 2XRSD 2XVSA 2PQEA 4XT3B 3KBGA 4DK0A 2QKIC 4RA8A 3GV3A 2J4XA 2KEDA 5KYIA 2B2WA 3NHHA 2A73B 2FJ2A 3X3MA 4BWGB 2HCIA 4J6HA 1VDZA 5C4XB 2RVLA 1TKWB 2KCCA 1LT3D 5DM63 4O1NA 1O7ZA 1L0XB 3RD4A 1GOZA 1NSNS 4B08A 1I6HB 4DNRB 1Y8NB 2RDGA 3BYTB 5IT9E 3GP7A 1F9RA 2AQ1B 1HTLD 4I65A 2NVTB 1BCPD 2JXMB 1BNZA 5EPKA 5A35A 5M5YB 1HRJA 3C46A 3OIQA 1EFID 1ESFA 2EYJA 3MXGA 1SJHD 2LS01 2O5JC 4G7HC 2K03A 3GTPB 1XX8A 2D62A 3S1MB 1B2TA 1PDQA 4X3KA 5T1GA 1JB3A 1JOKA 1KAAA 2NVYB 1O7LA 3TP8A 2B2YC 5EKKA 2B2VA 3PMFA 1STEA 1GUSA 3H91A 5I6YA 1Z47A 2F0OA 1ILQA 3DWQA 1EU3A 5KNCA 3R2TA 3URYA 2EJGC 2XNAC 4C2MB 1CHQD 2F4IA 5IGDA 1D5ZC 4A3BB 1TS5A 1STAA 3VR5A 3FKIB 3PUZA 3K6OA 3I70A 2JP1A 1EY7A 1U9RA 2EYHA 1CTMA 4ILWA 3P7JA 3K0YA 2R92B 5M5WB 4RFBA 2F0UA 4ZKCB 1HHVA 1Z6HA 2Z1CA 3AMUA 1LT4D 1W6KA 4G7ZC 4CKEA 3HOUB 3QIAA 3NWSA 2RDFA 4QF4A 2JYOA 2RBMA 1QILA 1QE6A 1TS4A 1XYIA 1LV9A 1K8MA 5KIXA 2A6EC 1Y8PB 5CBEE 1EQVA 1R9TB 1A2UA 2OF1A 2FINB 2CW0C 1FNWA 4TKOB 3SK4A 4ME5A 1ICWA 2PW7A 2SDFA 5JVH3 2AUKA 4IFDH 4KKUA 1LTGD 1WTQA 1O78A 2PW5A 4DNTB 1G91A 3K58A 2RQXA 1SNPA 3I4NB 2NTTA 2ZXPA 3C2PA 1PZID 2VB3X 1LT5D 1MSGA 4A3JB 1Z7TA 2EXZA 1S5CD 3DMUA 5J1ZA 1G8ZD 4M8AA 3CHBD 1EEID 3RZOB 2K5WA 2BCOA 3TP7A 2EY5A 3MXUA 1PRTF 4H44C 4N9TA 2NN6G 4FF3A 2L1BA 2IL8A 3FMCA 1H9MA 2MJ8A 1H9SB 2K32A 3P1HA 5CV7A 3NTKA 1WVLA 1SBBB 1E2VA 3G6JB 1DM0B 3D4DA 3GTKB 1HUMA 1TS2A 1SNDA 2N55A 3NP8A 5JPNC 2J0TD 3CKIB 1PTOD 1I4RA 1VF7A 4BY7B 4HSPA 1J9OA 3I72A 4TRDA 3A54A 3TP5A 4RH6A 1D1KA 5EQ0A 4F8MA 4KKSA 4ODGA 3S14B 4UAIA 3FPUB 3VYTA 2JA7B 5CYUA 1WTVA 2FFKB 3O13A 3SK8A 4M1UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MGS A;  1WTP A;  3DEO A;  2B2U A;  1PFM A;  4XT3 B;  2NWG A;  3DEP A;  4QUC A;  3DM1 A;  1HFG A;  4RA8 A;  1VMP A;  2D9U A;  1RTN A;  3GV3 A;  4XT1 B;  5EJW A;  1AZQ A;  2RA4 A;  1HUN A;  3ONA B;  1QG7 A;  2KED A;  2KOL A;  1F9Q A;  1EQT A;  5D65 A;  4OIJ A;  1BF4 A;  4ZAI A;  2B2W A;  2Q8T A;  2EE1 A;  2X6G A;  1HA6 A;  1B53 A;  5AFW A;  4ZK9 B;  1X3P A;  1WTX A;  1ML0 D;  2B2Y A;  2FJ2 A;  4NW2 A;  1EOT A;  3KUP A;  2HCI A;  1ILP A;  1WD0 A;  1RTO A;  4OIK A;  4IUR A;  1DZ1 A;  2JP1 A;  1SAP A;  2L1B A;  1X3Q A;  3IFD A;  1S4Z A;  2IL8 A;  1G2S A;  4RAU C;  1Q3L A;  2B2T A;  3P7J A;  5DNF A;  1CA6 A;  2RVL A;  2MJ8 A;  5EPL A;  1CA5 A;  4LMQ D;  4X3U A;  1IL8 A;  4CJ0 B;  4IUQ A;  3I90 A;  2KEC A;  1PFN A;  5COR A;  4ZKC B;  2RSO A;  1GUW A;  1HHV A;  1DON A;  2K05 A;  1DOK A;  3MWY W;  1O7Z A;  5JJZ A;  1WVL A;  2DY7 A;  3QO2 A;  5D14 A;  3R93 A;  2K28 A;  2EOT A;  1WTW A;  5CMD A;  2R3Z A;  2BDN A;  2K1B A;  4HCS A;  2N88 A;  2L4N A;  4X3T A;  3SVM A;  4IUV A;  2MP1 A;  1U4M A;  2MGS A;  4XDX A;  1JIC A;  1G2T A;  2L11 A;  1HUM A;  1F9R A;  4CJ2 C;  2X69 A;  4IUP A;  1MI2 A;  1QNK A;  5EKI A;  3TN2 A;  2N55 A;  3G7L A;  3Q6S A;  2JYO A;  4U68 A;  3LWE A;  1G6Z A;  1ROD A;  1VMC A;  1NR4 A;  3UI2 A;  2EPB A;  1BNZ A;  1A15 A;  2FHT A;  2CVR A;  5EPK A;  1BO0 A;  2KUM A;  2NYZ D;  3I3C A;  1M8A A;  2FMM A;  1QE6 A;  3KBX A;  1LV9 A;  3TZD A;  1XYI A;  4X3S A;  1HRJ A;  2HDL A;  3FDT A;  4RWS C;  1O80 A;  1NCV A;  1RHP A;  5E4W C;  5CBE E;  1BBX C;  4IUU A;  1EL0 A;  1TVX A;  3GV6 A;  1EIH A;  2B2U C;  1ZXT A;  2FIN B;  1WTO A;  1AZP A;  1J8I A;  1J9O A;  2NZ1 D;  4MN3 A;  1E0B A;  4O42 A;  1WD1 A;  2X6L A;  1KNA A;  1U4L A;  1ICW A;  5E4X A;  2MPM A;  1F2L A;  2SDF A;  2XIW A;  2K03 A;  1XX8 A;  1U4R A;  2B2W C;  5EPJ A;  2HCC A;  1IKL A;  1F9S A;  2L9H A;  4IUT A;  1MSH A;  4HAE A;  1EIG A;  2J7Z A;  4MHE A;  3HP3 A;  1WTQ A;  4R9W A;  2B2V C;  3N52 A;  3D6W A;  2DY8 A;  1KNE A;  1B2T A;  1G91 A;  2KEE A;  1PDQ A;  5EQ0 A;  4ZKB B;  4ZLT F;  4X3K A;  2K04 A;  1RJT A;  5T1G A;  2B2T C;  1WTR A;  5CBA E;  1B50 A;  1C8C A;  1JE4 A;  1U4P A;  4R8I A;  1IKM A;  1HFN A;  1NR2 A;  1CM9 A;  1AP0 A;  1ESR A;  2B2Y C;  4QUF A;  1PFB A;  3IL8 A;  1F9P A;  1B4O A;  1O7Y A;  4UAI A;  2KVM A;  2B2V A;  2RSN A;  3FPU B;  3MTS A;  1MSG A;  1DOM A;  1NAP A;  3H91 A;  3I8Z A;  1PLF A;  1WTV A;  2HDM A;  2L12 A;  2VXW A;  1SDF A;  2FFK B;  2M2L A;  4HSV A;  2H1E A;  3I91 A;  1ILQ A;  4CJ1 B;  2K01 A;  2HUG A;  5COY A;  5T1I A;  4DN4 M;  1B3A A;  4HED A;  1X32 A;  3F2U A;  1DOL A;  2Q8R E;  1SSO A; 
#chains in the Genus database with same CATH topology
 5ELF A;  2A5H A;  5JPM C;  2EDG A;  4BBS B;  5FOB B;  2ZM6 Q;  2E2H H;  2RA4 A;  1I6H H;  2MQH A;  1EQT A;  1BF4 A;  3W1G A;  2F0M A;  3BG3 A;  1BCP B;  3JAM i;  4AYB B;  5AFW A;  3OSO A;  2KA7 A;  3S2H H;  1EY4 A;  2B8G A;  1DZ1 A;  3HOX H;  4AIM A;  2E76 C;  5I9P A;  5CV4 A;  1GD7 A;  3PO2 G;  2SNS A;  2IY5 B;  4JV5 L;  4A3D H;  1B9M A;  1TS3 A;  2EVB A;  4NXN Q;  4RCN A;  1UNS A;  1UUP A;  1I3Q H;  1LT6 D;  4Y7N H;  1DON A;  3ITP A;  1SMY D;  5IY0 A;  1UEA B;  2LFN A;  1WTW A;  1QJO A;  2EYM A;  2N88 A;  2G5D A;  5FLX E;  2KQ3 A;  1JIC A;  4XDX A;  1ONL A;  4IPC A;  4CJ2 C;  2BE5 C;  1MI2 A;  4GN3 B;  2IX1 A;  4IFD J;  2A69 D;  4YCU A;  4YWK A;  1L1O C;  3I55 A;  4GS3 A;  2ES2 A;  2NZH A;  2CVR A;  3A8I E;  1Q7Y C;  3GTL H;  4GKK Q;  2HHH Q;  4KKT A;  1Y8O B;  3TZD A;  1XNQ Q;  2BE5 D;  4CHT B;  2KHI A;  3PUX A;  2F0T A;  1OXT A;  5FKA C;  3M3Y B;  4CDE C;  2ID0 A;  4DV1 L;  3MXP A;  2X6L A;  4DR2 L;  1U4L A;  1HR0 Q;  2BA1 A;  2E8G A;  4GNX C;  3LX0 A;  1E1O A;  1U4R A;  2L9H A;  5FLM G;  3A8J E;  4JI2 Q;  5J3B A;  3EVQ A;  4MHE A;  4DV3 L;  4R9W A;  2E2I H;  1XNR Q;  2ZJP A;  4KHP Q;  2F0D A;  1JMC A;  2R92 G;  4ZKB B;  3CRK C;  5DM7 3;  3T4A C;  4PMB A;  1Y14 B;  3HOU G;  3EJI A;  4ZCK A;  5C3X A;  2PQA B;  1CM9 A;  1AP0 A;  1H9J A;  4LFA L;  2BDO A;  2ATW A;  1SNQ A;  1GM5 A;  3M85 A;  4IZ8 A;  3GTQ B;  1EY0 A;  2EY1 A;  3S16 B;  3KFU A;  4DUZ L;  3QWN A;  4QCL A;  2K14 A;  1LLR D;  1I94 L;  1VQK A;  1STH A;  3HOX G;  3LWE A;  1K8A C;  3A5Z B;  5JEA H;  3GTM H;  4DV4 L;  1XMQ Q;  1HTP A;  4JI3 L;  5C0X G;  1XPO A;  1RTN A;  2WB1 G;  3BS1 A;  1HUN A;  1IW7 D;  1ASZ A;  1WFQ A;  4ZRZ A;  2QDB A;  3T53 B;  1H9K A;  4TQU S;  5ELC A;  2F0W A;  4DXG A;  3PQI A;  1HA6 A;  3CD6 A;  3HOY H;  1EOT A;  3B6Y A;  4QIW E;  5M9O A;  1RTO A;  2CQA A;  4OX9 Q;  3S1R H;  3HOY B;  2AHO B;  5LMN W;  4G7O C;  1YHQ A;  2JEA I;  3HOZ G;  1IL8 A;  5G3L F;  1HNW Q;  1BCP C;  1II3 A;  4XQJ A;  2H5X A;  4IAL A;  2EJM A;  4K0K L;  3IAY A;  1CSQ A;  1PRT B;  3CRL C;  4GOP C;  1PH8 A;  1Y1V B;  4GN4 B;  4A3K H;  4N8F A;  4OL7 A;  1T5E A;  3HEJ A;  4KLK A;  4X66 L;  1IBL Q;  3JAM c;  4XYO A;  5JVG 3;  1NMG A;  1U4M A;  4KV6 A;  4L5R C;  2UU9 Q;  1YHA A;  2E2D C;  3KLS X;  1VQC A;  4I7Z C;  5IGF A;  2X69 A;  5HY6 A;  1JOR A;  1QNK A;  2Z0S A;  4X66 Q;  3UDG A;  2A8V A;  4OO1 I;  4KD4 A;  5GAH C;  3D3R A;  3FVQ A;  3CAM A;  4DAY A;  3T1Y L;  2FMM A;  1PZJ D;  5AJ3 Q;  3GTG B;  2B63 G;  3HKZ B;  1VQH A;  2R6G A;  1UAP A;  4DUY L;  1MBY A;  1WI5 A;  2F0S A;  4Q0F A;  1N32 L;  4DA2 A;  3VYU A;  1YHB A;  1AW7 A;  1YNN C;  3CCJ A;  2HQE A;  3RLF A;  1TQO A;  2XIW A;  4DUY Q;  1XPU A;  1C4Q A;  3KF8 B;  3HGB A;  1IKL A;  1F9S A;  2V1C C;  3D6C A;  4V19 0;  4DV6 L;  4KJN A;  1EIG A;  2J7Z A;  4X62 Q;  2A68 D;  3FPP A;  4HTH A;  3KYH C;  2EYP A;  4DU9 A;  1EWI A;  1B7Y B;  1CUK A;  1K3B C;  2JA8 H;  5IP9 G;  1MHW C;  3VA7 A;  1GVP A;  1JE4 A;  4A3D G;  4R8I A;  3MAQ A;  4B3M L;  2UXD Q;  3F8T A;  3K57 A;  1FGU A;  2YTV A;  5LMN L;  3MA2 B;  2WV6 D;  3CC7 A;  1O7Y A;  1T5X D;  5LL6 X;  2WKC A;  3IRB A;  2EXD A;  2KHJ A;  3A0J A;  3NTH A;  1ZKO A;  1PXU A;  2HT1 A;  2H1E A;  1J6Q A;  5KNB A;  3OMC A;  3F2U A;  5C44 B;  4HID A;  5LL6 S;  3DEO A;  2Z4H A;  2IT1 A;  3CCU A;  1ZYR C;  3S2H B;  2DN8 A;  3RLO A;  3QOJ A;  1A6X A;  2EE1 A;  1KXL A;  2ALY B;  3IKJ A;  4NW2 A;  3PUY A;  4IFD I;  4IUN A;  3J80 E;  1UWV A;  3U4V A;  1F77 A;  2RHS B;  4KD3 A;  1J5E L;  4A3J G;  3S1M H;  4CJ0 B;  3V96 A;  1XMO L;  5COR A;  1CQF A;  4AYB E;  3T1H L;  1KDC A;  3I73 A;  4HIK A;  5D14 A;  4CDC C;  1T9H A;  3J7A V;  1PYS B;  3DHQ A;  4P73 A;  4X3T A;  5KND A;  1DD2 A;  4DNI A;  2QCP X;  4KY7 A;  2F4V Q;  1TXY A;  1BDO A;  2F3I A;  2K52 A;  5C4H A;  1SFO B;  2A68 C;  1I4Q A;  4OWT B;  4KN4 C;  1LAC A;  3GTO B;  3BDL A;  1BBW A;  1SFO H;  5C3W A;  3C3L A;  4PNY A;  2BA0 A;  2F1M A;  1IBL L;  1CKM A;  1TVX A;  1S5B D;  2K5H A;  1D8L A;  4BY1 B;  4KHZ A;  3S2D B;  3SGI A;  1AE2 A;  2NVX B;  1SMY C;  2MPM A;  4JW0 A;  1F2L A;  1RIP A;  1Q86 C;  1VQ8 A;  3CPW A;  5JEA G;  2C35 B;  4DK3 C;  4DFA A;  4L5Q A;  4EGV A;  4OEM B;  1EFW A;  4DAM A;  3W1B A;  3TEH B;  3STB C;  3HKS A;  1VQ7 A;  1E24 A;  2YU9 B;  3E0E A;  1SE8 A;  3HRZ C;  2E2I B;  2WP8 J;  4JYA L;  1ENC A;  4DUZ Q;  2EY2 A;  1PFB A;  1F9P A;  3TRZ A;  3WOF A;  5FLM H;  2F0F A;  1M4V A;  3BJU A;  1LTB D;  2YYZ A;  3PIO A;  2JJQ A;  1D6E C;  4LFB L;  3H15 A;  2UXC L;  2M2L A;  5JOB A;  3DWP A;  4GLA C;  4DAP A;  4CJ1 B;  3CME A;  1VQG A;  1SEB D;  4DN4 M;  2JA7 G;  1B3A A;  4P2C B;  4DF7 A;  5IP7 H;  3UDF A;  4QIW B;  5HGT A;  1VMP A;  2EYO A;  4HCE A;  3MHB A;  1S3O A;  3ONA B;  4RKB A;  2HD3 A;  4HMJ A;  4HIM A;  1KLU D;  4NKL A;  2CWP A;  3W2D A;  4A3E H;  3W5O A;  4PG3 A;  1KLG D;  1SR3 A;  4JPB W;  4LJZ C;  3J81 i;  2NUC A;  4GOP A;  2N49 A;  1CA5 A;  1MJC A;  4X65 Q;  4IUQ A;  1PYB A;  3I90 A;  4C3J G;  2RSO A;  4LF9 L;  4JOI C;  2ASB A;  3LNN A;  3M4O B;  1UEB A;  4RHS A;  4DV5 L;  1L1O A;  1DOK A;  5JJL A;  4MNO A;  5KGU A;  3ERQ A;  4CDF C;  3L9A X;  2JA8 B;  4FO2 A;  4LUO A;  5IGC A;  4DKA C;  2L11 A;  1JWS D;  3ND9 A;  2I0Q A;  1JJG A;  3L0O A;  4LF7 L;  4JI6 L;  2EIF A;  1M8A A;  3E5S A;  4LFA Q;  1VF5 C;  1YNJ D;  2QF7 A;  1RHP A;  1E3P A;  2UUB Q;  4IOA A;  2B2U C;  5IOC A;  3D0F A;  3UE0 A;  2XTI A;  4DR1 Q;  2VZA A;  3OPO A;  1HR0 L;  3FP9 A;  5IIF A;  1MSH A;  2AKW B;  1Q46 A;  3A8K E;  1SMX A;  1KRS A;  4JI2 L;  2ICE C;  3H6M A;  5IOD A;  3R3O A;  4FF4 A;  3NEN A;  2PZU A;  5FO8 B;  2WKD A;  4ZUI A;  2KBN A;  1VQI A;  4DR3 L;  4QUF A;  4B3S L;  5E1F A;  1B4O A;  3Q8D A;  1SYD A;  3TQY A;  1N33 Q;  3S15 B;  1HNX Q;  4DR3 Q;  4HSV A;  4A3E G;  1I50 B;  1VQN A;  4LF4 Q;  4K6L A;  1BQQ T;  4POF A;  5JJK A;  3PIO 3;  1EU4 A;  2Z6K A;  4JVZ A;  2G9H D;  1PFM A;  1VQA A;  3BDC A;  1PH6 A;  1XNR L;  5HUR A;  3DM1 A;  3GTO H;  4KHP L;  2BH8 A;  4G4K A;  3MEH A;  1FJG L;  3WDN A;  4KJO A;  2ZJR A;  4IOC A;  1PTO B;  2X6G A;  2OCE A;  4YCV A;  1Y69 U;  2MO0 A;  3I4M H;  4A3I B;  1X3P A;  1WTX A;  1J5E Q;  2K50 A;  4YCW A;  1CKO A;  1L2F A;  4OIK A;  1PRT C;  1BXT A;  1HQR D;  1EQR A;  3AYH B;  4RAU C;  1LTR D;  2EQS A;  2E2J B;  4L8J A;  1B44 D;  3S24 A;  3MEF A;  1YIT A;  5CMD A;  3HOV B;  1HA5 A;  3GTP H;  5KEE A;  4C3I H;  3HOW G;  2DJG C;  1QVC A;  2A6H D;  1WYD A;  2LSS A;  3UI2 A;  2I5M X;  1X65 A;  2WFW A;  2QEX A;  3NBH B;  4S3S A;  4YIJ A;  4YY3 Q;  4IO9 A;  2TSS A;  1K8O A;  2EJF C;  2AQ2 B;  2QIL A;  4PQX A;  4HIO A;  5IP7 G;  4OWW B;  1PH1 A;  1SNM A;  5C4Z A;  4FYD A;  1KDB A;  2F3V A;  3SK5 A;  5DAU A;  1V8Q A;  4C3I G;  3L7Z C;  1SLJ A;  1HZ9 A;  4HAE A;  4EQO A;  1E7Z A;  4DR5 Q;  3QOL A;  4A3G B;  2B2V C;  4NPS A;  2HIV A;  1A0I A;  4ZLT F;  4QJF A;  2XN9 C;  5BN3 A;  1N32 Q;  3CC2 A;  4F88 A;  4B3M Q;  3GDE A;  3EIV A;  4PMC A;  3SDZ A;  2UU9 L;  1EWC A;  1IBM Q;  3IL8 A;  3HKZ G;  2QDL A;  2OXP A;  5KYL A;  2AUJ D;  2F0N A;  1TWA B;  2YTX A;  1IW7 C;  3NTI A;  5C3E H;  2RF4 A;  2F03 A;  3M7N A;  3I8Z A;  2JA5 H;  2L12 A;  1ZEQ X;  3I91 A;  4A3J H;  2K01 A;  1GHK A;  4NXN L;  4K14 A;  4DV0 Q;  2VQE Q;  2AWO A;  1WOC A;  3FRP B;  4FXG C;  1A3T A;  4RKL A;  3S14 H;  1EZ8 A;  2NWG A;  4DV2 Q;  1LAB A;  3J80 L;  4U67 3;  3CW2 C;  4P74 A;  1ET9 A;  2KOL A;  2L0C A;  3BVZ A;  5EBD A;  5J22 A;  3W3A A;  5J39 A;  4ZK9 B;  3Q24 A;  1ILP A;  4KI0 A;  1WD0 A;  4DV1 Q;  2HIX A;  1TWG H;  4CKC A;  4PZ6 A;  1CA6 A;  1VQP A;  3WOE A;  3M4O H;  3CF5 A;  3GTJ H;  3AB9 A;  4DR7 L;  2I5L X;  5C4J H;  1GHJ A;  2ZJQ A;  1YEZ A;  2O2L D;  5BN5 A;  2C9O A;  3CP0 A;  1PH5 A;  4XQN A;  2GN5 A;  1HPC A;  2EOT A;  4GZY C;  2WAQ B;  3S9W A;  4EX5 A;  3ICE A;  2R93 H;  3KDF B;  4R4C A;  4PZ7 A;  4ZYS A;  2UUA L;  2M9V A;  3OMG A;  2B63 B;  4KY5 A;  4Z9C B;  1DJR D;  1XXG A;  2WII B;  1G29 1;  2CH4 W;  3QJY A;  3GD7 A;  1TY0 A;  3J81 j;  1TT2 A;  4JI3 Q;  1BBX C;  1GUO A;  1WTO A;  3OWE B;  4DR2 Q;  1E0B A;  4WOR A;  4A3G H;  1S5E D;  2VS1 A;  5L37 A;  2QEJ C;  4HN7 A;  4UP8 A;  3S1Q H;  1STB A;  3CQZ H;  5CV6 A;  3HP3 A;  4YY3 L;  4R4O A;  3NWT A;  2Q2I A;  5TSS A;  5CV5 A;  3DM3 A;  4IQZ A;  1RKN A;  1FYC A;  3PO3 B;  2OTJ A;  3EQL C;  1C8C A;  1YNN D;  3HOY G;  4GLV B;  1EY6 A;  3F2B A;  1CQV A;  1I3Q B;  1B70 B;  4P72 A;  5G3L D;  1NAP A;  2KJX A;  1BOS A;  1VCI A;  2P5Z X;  1SYG A;  4EQP A;  1SYE A;  3AQQ A;  2DNE A;  3ERO A;  4BS9 A;  4HMI A;  4GNX A;  2ICI A;  3G6E A;  4FXD A;  3PUV A;  3OW2 A;  4HED A;  2BOS A;  4WJ4 A;  1OTC A;  4BA1 I;  3D8G A;  1KRT A;  3J7Y W;  2D9U A;  5CR3 A;  1IBK L;  4K0K Q;  4KN7 C;  4OIJ A;  2Q8T A;  2LKV A;  4LUV A;  4B9W A;  5ELO A;  1U0L A;  3L2P A;  3PO2 B;  1NE3 A;  3WWV A;  4JI1 L;  5K5P A;  3CCL A;  2K4K A;  4AQY Q;  4DV0 L;  3RZO H;  5K36 G;  4B3R Q;  3I4M B;  3GTM B;  2B2T A;  3M7G A;  4F87 A;  1E22 A;  2Z4I A;  1V1O A;  1D1I A;  3EA6 A;  3RUZ A;  3H3V I;  5ELN A;  4KY6 A;  1YZ6 A;  4IJH A;  4ALP A;  3NPP A;  2K05 A;  4R1J A;  4A3C H;  3NBI A;  2L4N A;  4DV7 L;  5LMN Q;  2EYL A;  4K6D A;  1Q82 C;  5IP9 H;  2B3G A;  2NN6 I;  3G7L A;  2JA6 H;  4A3B G;  3J7A 5;  1TWH B;  1VMC A;  1HZB A;  2JA6 B;  3T1Y Q;  4ME3 A;  2JA5 B;  3A7A B;  2KCN A;  1K8G A;  4HR7 B;  4X3S A;  3NUC A;  2WAC A;  1Y1W H;  1DXM A;  4QL5 A;  4XXE A;  1KHI A;  5GRO A;  2K5V A;  2YTY A;  1EQQ A;  4A3D B;  3PUW A;  1KNA A;  4C1N K;  1LTS D;  3FHW A;  1PH2 A;  1N36 L;  3M4Q A;  1SXT A;  3RLN A;  5LHY 1;  2F0G A;  4ABN A;  3GTG H;  2OEO A;  1P8L A;  4AH6 A;  5C0X I;  2ZTE A;  5D3D A;  5JJI A;  1JE5 A;  2KEE A;  2B2T C;  1U5K A;  4JI5 L;  4QB4 A;  3OW7 A;  4CKB A;  1K0R A;  1IYU A;  1VQ6 A;  1CFM A;  2WAQ E;  1HZA A;  2KCT A;  3EBE A;  2IJ0 A;  1DGS A;  2DJF C;  3BVG A;  3MTS A;  2CWA A;  2Z9H A;  1SYC A;  4OO1 H;  1FR3 A;  4OEL B;  1CI3 M;  1C7Y A;  3NQI A;  4JI6 Q;  2H4O A;  2F0Q A;  5C3E B;  2F0E A;  3AEV A;  4EQ5 A;  4X64 L;  3HZX A;  3OIP A;  4FXK C;  3IFD A;  1SSO A;  4QMG A;  1CHP D;  1SRU A;  1V1P B;  2B2U A;  2IHE A;  2PNR C;  1WTP A;  4DPG A;  2DNC A;  4QUC A;  3U50 C;  1JR0 D;  1N33 L;  4K2K A;  4UP7 A;  1QG7 A;  5IYC H;  4DXF A;  4E6I A;  4C3I B;  1ZYR D;  2FMC A;  2B2Y A;  2Y0S B;  2IWH A;  3HOZ B;  2WAQ G;  1LTA D;  4IUR A;  3MFG A;  2Q8I B;  1SAP A;  3PCO B;  2KHS A;  5CV8 A;  1X3Q A;  4PMW A;  3G48 A;  3J7Z C;  1PH7 A;  2I07 B;  1PVO A;  5CGK A;  2E74 C;  2Y0S G;  3S1N B;  4A3B H;  4RGO S;  1UE1 A;  3K8A A;  1IYV A;  2MUY A;  4BA2 I;  5JEA J;  1GUW A;  4K5X A;  5I2X A;  2L5T A;  2NVX H;  3UDI A;  1F2Z A;  1I5F A;  1O7I A;  3K5L A;  3Q22 A;  4LFC Q;  2BH2 A;  3PO3 H;  5JAV A;  1KAB A;  2MP1 A;  5IGG A;  1H95 A;  1G2T A;  3T56 B;  3OTO L;  1HR0 W;  4IUP A;  4A93 B;  1Q1E A;  4B9X A;  3Q6S A;  4A3I G;  1JWU D;  2A74 C;  3V2T A;  1A15 A;  1GUN A;  5FLX L;  5M5X B;  1CKN A;  1W6J A;  4RGN A;  3NQT A;  1JJ2 A;  2D0O A;  1ZXT A;  4C3J B;  3RN2 A;  1HCZ A;  1I4G A;  4G57 A;  3K59 A;  4JYA Q;  5BR8 L;  3MZ5 A;  3PF5 A;  2JSO A;  3TME A;  2O5I C;  1LTL A;  1QCB D;  4AQY L;  3K7U C;  2A19 A;  3KLS A;  1G51 A;  1NJI C;  2F0H A;  1HQM C;  2JQO A;  3BVM A;  4A3I H;  2UXB Q;  4OHJ A;  1NY4 A;  3CQZ B;  3JAM L;  1WCM B;  2WB1 B;  1I6V C;  5IE8 A;  1U4P A;  4DAY B;  4LF5 Q;  3T13 A;  2NVT H;  1JCK B;  1TU2 B;  4A3G G;  1AFP A;  3JC6 6;  4CDD C;  2Z8L A;  1PFS A;  4WJ3 M;  1SJE D;  1I4P A;  4DGZ A;  4JC0 A;  5I2Y A;  4R8N A;  1TII D;  3ND8 A;  3HOX B;  1N36 Q;  2EY6 A;  2PYK A;  4CBV A;  1PH4 A;  2PNH A;  2OTL A;  3ULJ A;  4GKJ L;  2B8F A;  1JQY D;  2VXW A;  1VQM A;  4LW1 A;  1BUV T;  4XTC S;  3S15 H;  3KF8 A;  2HUG A;  4KTA A;  4R4T A;  4A3C G;  2NTS A;  4MIU A;  5DEH A;  1GXD C;  2ZXO A;  2AMC B;  1EZ6 A;  2EZV A;  5EJW A;  1EEF D;  4PV1 C;  3H0G G;  2PZT A;  2RKS A;  2PPB C;  1SYF A;  2FXQ A;  3K81 C;  3R2I A;  3HOW B;  4BBR B;  1ML0 D;  3OYY A;  1K0S A;  5FK9 C;  2QA4 A;  1VQD A;  4IPD A;  3T16 A;  1S72 A;  3L3O C;  2CFM A;  3GQB A;  1ET6 A;  3CC4 A;  4JI5 Q;  5FO7 B;  2A6H C;  4O0A A;  4X3U A;  3KK7 A;  1EWH A;  4NMZ A;  1EYA A;  1KAW A;  2GA4 B;  2KEC A;  1RD9 D;  5F2D A;  1WCM H;  4A3E B;  4CGY B;  1IBM L;  2GVB A;  5AJ3 L;  4A3K G;  1B9N A;  1OXU A;  5M3F B;  4HCS A;  1LUZ A;  1JOO A;  1F2Y A;  4IUV A;  1RF2 D;  4JI8 L;  5HGQ A;  3C1E A;  5EKI A;  3TN2 A;  1D5X C;  4C2M H;  1H9R A;  5NUC A;  1G6Z A;  1PZK D;  1IHZ A;  1BR9 A;  1EYD A;  2MFI A;  5FO9 B;  2L55 A;  2A1A A;  4DK1 A;  4JK1 C;  1X54 A;  2CH4 A;  2ZTD A;  5IYD G;  4RHR A;  1YI2 A;  3MVV A;  1EL0 A;  4IUU A;  4GOP B;  1XTC D;  3NK9 A;  4MZ9 A;  1SNO A;  3K5O A;  5ELD A;  3R8B A;  1G6P A;  2PI2 E;  4C56 C;  2JEB I;  1RL2 A;  5E4X A;  5C0X J;  2NVY H;  4KHV A;  1YNJ C;  1EIY B;  1ENF A;  1XMO Q;  4KK7 A;  3A7L A;  2HCC A;  4H0L C;  2N3S A;  2IX3 A;  4A3M G;  3SXH A;  3BDO A;  1VQO A;  4AYB G;  1HNZ L;  3I4L A;  2PZW A;  2DY8 A;  2UUA Q;  5IYC G;  4BY7 H;  3GO5 A;  4K8J A;  4ZQ3 A;  3S1Q B;  1RJT A;  3TDQ A;  2NB0 A;  3NXW A;  4ID6 A;  3K5M A;  4H13 C;  2LY7 A;  1PTO H;  3SHL A;  1L0Y B;  4C3H G;  1STY A;  1Q1B A;  4JI1 Q;  1XTD A;  1NNX A;  2RSN A;  4K5V A;  3T1H Q;  2MHV A;  3A56 A;  3DXJ C;  1E2W A;  1V1Q A;  1SDF A;  1QZH A;  4C3H B;  1TWF B;  1X9N A;  1XMQ L;  1YJW A;  4A3M H;  1VQ4 A;  4HJA A;  1MGS A;  5M3M B;  3KJP A;  4NDX A;  1YVC A;  2O4X A;  3UDX A;  4WJW A;  3DUZ A;  1X6O A;  1F2M A;  5C6A A;  1A2T A;  2VUM B;  3HOV H;  3MC0 B;  4UP9 A;  3SR1 A;  1YJN A;  5E3F A;  3AFQ A;  3VR4 A;  5GQO A;  3ULP A;  1LO5 D;  5IGE A;  3SE0 A;  5BR8 Q;  1B53 A;  4B3S Q;  4FDB A;  4GNX B;  3TRE A;  3S1N H;  3J80 c;  3D4W A;  1S4Z A;  1PYW D;  4FNF A;  1HNX L;  1N34 Q;  1YBY A;  4LFC L;  5IT9 L;  1PFN A;  2B39 A;  1Q81 C;  3GTJ B;  4XIG S;  3HG9 A;  1CZW A;  3MWY W;  2DY7 A;  3QO2 A;  2K28 A;  3P20 A;  1N34 L;  3GTL B;  2K7V A;  3ZJY C;  4F7X A;  3D4R A;  2R7Z H;  2MGS A;  4A3L H;  2K5D A;  4JG2 A;  3BZC A;  5C3E G;  4DV4 Q;  3VYS A;  4RGT A;  3PGZ A;  4MTK A;  4A3F G;  4NXM Q;  2SOB A;  2D2C C;  2NYZ D;  1FGB D;  4N8X 1;  4PZ8 A;  4RWS C;  4RG1 A;  3M4Y A;  5E4W C;  2ZXR A;  1GUT A;  1EIH A;  3CCV A;  4R4Q A;  5M3F H;  4Q5V A;  3I4N G;  2NZ1 D;  3H0G H;  4QGU A;  1OXX K;  3I7F A;  3PIP 3;  3K0X A;  1R4P B;  5ELE A;  1KIX A;  3PSI A;  2B2W C;  1TWH H;  2K33 A;  3HOU H;  1YJ9 A;  1V1P A;  2PMZ B;  1VQF A;  3N52 A;  2DUD A;  4UHV A;  4JV5 Q;  1JJC B;  5IGB A;  3TS0 A;  1XWE A;  1TY2 A;  3H3V H;  4DR7 Q;  4UY8 C;  1WTR A;  5C44 G;  3V05 A;  4O2D A;  5ELB A;  2VQE L;  2E75 C;  1C48 A;  1FNU A;  1NR2 A;  1XJV A;  4WFN 3;  1QOH A;  4JI0 Q;  2JK8 A;  3NBH A;  3KJO A;  1KD1 C;  1E2Z A;  3U9O A;  4LF9 Q;  3HOV G;  4LF6 L;  1S5D D;  3VYR A;  3D31 A;  4UPA A;  1SE2 A;  3J81 E;  1EY5 A;  4FF2 A;  4V0B A;  1VQJ A;  4JI0 L;  4HJ7 A;  4LF7 Q;  2ZM6 L;  4Y7N B;  4BXX G;  2F3W A;  2R7F A;  3J81 c;  2K6A A;  2LMC B;  5C4J B;  2OWO A;  5BN4 A;  1LTI D;  1DOL A;  1RDP D;  2Q8R E;  2JE6 I;  2VB2 X;  2HHH L;  2XRQ D;  1XNQ L;  3J81 L;  1NUC A;  1SRO A;  4XT1 B;  4POG A;  1V43 A;  4NB3 A;  2UUB L;  1QWY A;  1W2B A;  2YU9 H;  5D3I B;  5EKL A;  1AEX A;  3KF6 B;  1F9Q A;  5D65 A;  5H1S E;  3BYY B;  4UDU C;  4JBW A;  5KRU A;  3OOC A;  4OO1 G;  1CSP A;  2F0L A;  3ERS X;  3OWF A;  4OWX B;  3TP6 A;  2R92 H;  2KEN A;  4J8Q A;  2UXD L;  1SN8 A;  2SEB D;  1K83 B;  4LF6 Q;  1C9O A;  2E2J H;  2VUM H;  1DYQ A;  1A62 A;  2VY3 A;  3Q23 A;  1BCP F;  1KDA A;  3R93 A;  2XWB B;  2IX0 A;  2L15 A;  3KOJ A;  3S1R B;  2R3Z A;  4J1M A;  3SVM A;  4DAV A;  2HQL A;  3J80 i;  3OHX C;  3U4Z A;  1EYG A;  1Q90 A;  3SEB A;  4U68 A;  5EBC A;  1FJG Q;  2NZO A;  1PRT D;  2EPB A;  5FJ8 H;  4C3H H;  1DCZ A;  5C0X H;  2YV5 A;  1X3F A;  4FP5 D;  2N8N A;  3C1F A;  4A3K B;  4DR4 Q;  5E7N A;  3FDT A;  2HDL A;  2ZT9 C;  3M3Y H;  2RHQ B;  1QZG A;  1KQS A;  2R93 B;  1I94 Q;  2F0P A;  2Y0S E;  2E5L L;  1GJX A;  4P75 A;  1B1Z A;  4RMF A;  1J8I A;  2V4D A;  1B3Q A;  3IFT A;  3KLR A;  4MN3 A;  4O42 A;  1VQ9 A;  5IYB G;  4A93 H;  1CZG A;  3TSS A;  3U58 A;  1KTK A;  4XQQ A;  2A6E D;  3Q0A A;  1K83 H;  3AFP A;  1L0W A;  3D6W A;  5K36 H;  2SNM A;  1HNW L;  4H02 A;  1X56 A;  3S17 B;  1D5M C;  5I9O A;  4B3R L;  4LF5 L;  3ZYY X;  1SYB A;  1PA6 A;  1OXV A;  1ESR A;  5EGT A;  1TWG B;  3E9I A;  3EFX D;  2KVM A;  2PO4 A;  1CT1 D;  1IYJ B;  1DOM A;  2TMP A;  4A3M B;  1IBK Q;  2VNU D;  1STG A;  1HH2 P;  2HDM A;  3PV0 A;  3TBI B;  2CHB D;  2R7Z G;  1X3E A;  4JOI A;  2K5Q A;  4LAA A;  4LF8 Q;  4BY7 G;  1OO9 B;  3VR3 A;  5COY A;  2IW3 A;  1IZ6 A;  1R9T H;  1PMR A;  2JN4 A;  3FKI G;  3RR5 A;  3DEP A;  3P75 A;  2ENB A;  4OGQ C;  1AZQ A;  1P16 A;  2G9D A;  3MFY A;  3K5N A;  2JA6 G;  1JC7 A;  2NBF A;  5GAD C;  2QGQ A;  1LYL A;  4DR6 Q;  3UE1 A;  4LK1 C;  3NSW A;  4EVO A;  3E9H A;  5M3F G;  3I4N H;  4LMQ D;  4FF1 A;  1V9P A;  5I6W A;  5GAG C;  5CV9 A;  1JB7 A;  4GKJ Q;  4KMU C;  5JJZ A;  4YWM A;  2BDN A;  2E2H B;  2K1B A;  1BVS A;  2F0J A;  3AU7 A;  2C5C A;  1SNC A;  1Y1W B;  5I4D A;  1A3V A;  1TR5 A;  4LWC A;  4H7B A;  1H9S A;  4A93 G;  4BBR G;  2R7Z B;  5ISR A;  1ROD A;  3K7A B;  4GN5 A;  2PCF B;  3SK6 A;  4BXX H;  2FHT A;  4BBS H;  2F0I A;  3I3C A;  4RGM A;  4GKK L;  4A3F B;  3KBX A;  5LMU L;  3H0G B;  3QG1 A;  2PMZ E;  1O80 A;  1NCV A;  4JBJ A;  3GV6 A;  3DLL A;  1YIJ A;  1EY9 A;  1IXR A;  1B8A A;  4ULL A;  2XWJ B;  1GKH A;  2D5D A;  4FVM A;  5EPJ A;  3U9S A;  4LNQ A;  3H94 A;  4IUT A;  3PO2 H;  1HXY D;  4DV5 Q;  3RN5 A;  4BBR H;  4NP5 A;  2A69 C;  2IPK D;  1KNE A;  1EY8 A;  3VR6 A;  4K5W A;  5IT9 c;  3RZD B;  1AN8 A;  2K04 A;  4WRD A;  2VQF L;  5CBA E;  2E5L Q;  1Q12 A;  2RCN A;  3K80 C;  1STN A;  3NE5 B;  4R4I A;  1N9W A;  3TS2 A;  4EQN A;  3JAM E;  1QNU A;  3G71 A;  1MIU A;  4JI4 L;  1Q8K A;  1PTO F;  2NN6 H;  3E0J A;  1PLF A;  4A75 A;  1SE3 A;  1W3S A;  2EYF A;  3HS0 C;  2VUM G;  2RDH A;  3CU7 A;  1QB5 D;  1XPR A;  4DK6 C;  1MD2 D;  2JA5 G;  1HFG A;  4IPH A;  3BZD B;  5A2Q E;  2JA9 A;  1K9M C;  1S5F D;  4ZAI A;  3PIP A;  2WB1 E;  3RMH A;  3KUP A;  4ZUJ A;  1QVF A;  2R61 A;  3FEW X;  3LWU A;  2NVQ B;  2F0K A;  1RCV D;  1G2S A;  5A2Q L;  1Q3L A;  5DNF A;  3S16 H;  1JOQ A;  5EPL A;  3TZU A;  4A76 A;  4BY1 H;  3S2D H;  2I46 A;  3T51 B;  3J7A F;  4C3J H;  3RZD H;  1CK1 A;  3CMA A;  2RCF A;  1D2B A;  1JWM D;  1SE4 A;  2D0P A;  1GUG A;  1NBW A;  1QUQ B;  1TWC B;  2K75 A;  2M00 A;  3M4P A;  3VR2 A;  3H3V C;  5M5X H;  2CW0 D;  2F0V A;  4TSS A;  5C5M A;  4MTN A;  2QW7 A;  3QB3 A;  3H09 A;  4C1N I;  3E6Z X;  3X3N A;  2VL6 A;  4J15 A;  4RCO A;  2AWN A;  1NR4 A;  1D7Q A;  1VQ5 A;  2GVA A;  2WIN B;  4IFD G;  2AQ3 B;  1BO0 A;  3VA5 A;  2KUM A;  5IWA Q;  2VW9 A;  1VQE A;  2OT2 A;  5IYD H;  3A55 A;  1ICF B;  4HJ5 A;  4L63 B;  4JCV E;  1EYC A;  2XSC A;  1AZP A;  1L1O B;  3MXN A;  3I4O A;  1WD1 A;  4OXP A;  1R4Q B;  1PTO C;  1UE5 A;  1WTH A;  1I4H A;  4HJ8 A;  3A5U A;  3HOZ H;  1OXS C;  4XYQ A;  4A3F H;  3KF6 A;  2I5H A;  1K28 A;  1A8V A;  4N9P A;  5C4X H;  1FD7 D;  4K2L A;  1B50 A;  3DWA A;  1IKM A;  1Y1V H;  1HFN A;  5IYB H;  5DLQ E;  1FNV A;  1I4X A;  1LTT D;  4L6T B;  3PF4 A;  1Q8I A;  3N6R A;  1ENA A;  1FVI A;  2UUC L;  1UE6 A;  2IHF A;  3F2C A;  4IN3 A;  5C5L A;  5T1I A;  4YHH L;  4K8I A;  5CC4 A;  1A3U A;  1X32 A;  1Y1W G;  2XRS D;  2XVS A;  2PQE A;  4XT3 B;  3KBG A;  4DK0 A;  2QKI C;  4X6A H;  4RA8 A;  3GV3 A;  2J4X A;  3PO3 G;  2KED A;  5GAE C;  5KYI A;  2B2W A;  3RNU A;  3NHH A;  3G4S A;  2R7D A;  1M1K C;  2A73 B;  2FJ2 A;  3X3M A;  4BWG B;  2HCI A;  4J6H A;  2Z6K C;  4LF4 L;  1VQB A;  4IJL A;  1VDZ A;  1PH3 A;  5C4X B;  1JT8 A;  4DV7 Q;  2RVL A;  1TKW B;  3GTQ H;  2KCC A;  2F52 A;  1LT3 D;  5DM6 3;  2CCZ A;  4DV3 Q;  4O1N A;  3BU2 A;  2Q2U A;  3HOW H;  2Q2T A;  2UUC Q;  1O7Z A;  1L0X B;  3RD4 A;  2N78 A;  1GOZ A;  1NSN S;  4A4I A;  2LXJ A;  4B08 A;  1KL9 A;  4DNR B;  1I6H B;  3M9B A;  1Y8N B;  2RDG A;  3BYT B;  5IT9 E;  3GP7 A;  2OQK A;  1F9R A;  1ASY A;  2AQ1 B;  1HTL D;  3NEM A;  4I65 A;  2NVT B;  1BCP D;  2JXM B;  1BNZ A;  4JI4 Q;  3VDY A;  5EPK A;  5A35 A;  5M5Y B;  4DR1 L;  1HRJ A;  3C46 A;  3OIQ A;  1EFI D;  1ESF A;  2EYJ A;  3I4M G;  3MXG A;  1SJH D;  1MKH A;  2LS0 1;  2O5J C;  4G7H C;  2K03 A;  2OQ0 A;  3LGJ A;  3GTP B;  1XX8 A;  2D62 A;  3STB D;  3S1M B;  4DR4 L;  2F4V L;  4B3T L;  3CCM A;  4LUZ A;  1B2T A;  1PDQ A;  2NVQ H;  4X3K A;  5T1G A;  2JA8 G;  1JB3 A;  1JOK A;  3E3X A;  4X64 Q;  4BY1 G;  1KAA A;  1CKN B;  2NVY B;  1O7L A;  3OTO Q;  3TP8 A;  2B2Y C;  5EKK A;  2B2V A;  3PMF A;  1GUS A;  1STE A;  3MXN B;  3H91 A;  4APV A;  1TWC H;  5I6Y A;  4A3L G;  1Z47 A;  2F0O A;  2MO1 A;  1ILQ A;  3F1Z A;  3DWQ A;  1EU3 A;  5KNC A;  3R2T A;  3URY A;  5M3M G;  2EJG C;  2XNA C;  5FLX c;  4C2M B;  1PHJ A;  1CHQ D;  1Z9F A;  2F4I A;  2B29 A;  5IGD A;  4P71 A;  1VS0 A;  1D5Z C;  1YNX A;  4NXM L;  4A3B B;  1TS5 A;  4JBM A;  1FL0 A;  1STA A;  3VR5 A;  3FKI B;  1EUJ A;  3PUZ A;  3K6O A;  1TWA H;  1KC8 C;  3I70 A;  2JP1 A;  3ULL A;  1EY7 A;  1U9R A;  2EYH A;  4HJ9 A;  4BBS G;  1CTM A;  4ILW A;  3P7J A;  3K0Y A;  4QY7 A;  5M3M H;  2R92 B;  1QVG A;  5M5W B;  4QQB X;  1X3G A;  4RFB A;  2F0U A;  4ZKC B;  1HHV A;  1Z6H A;  2R93 G;  2Z1C A;  1I50 H;  3AMU A;  1LT4 D;  1W6K A;  4LFB Q;  2UXC Q;  4Y52 H;  4G7Z C;  4CKE A;  1HJP A;  1WJJ A;  3NEL A;  3HOU B;  3QIA A;  3NWS A;  3HKZ E;  5C4X G;  3HFZ B;  4X62 L;  2RDF A;  5C44 H;  4QF4 A;  2JYO A;  2RBM A;  3CPF A;  1QIL A;  1NTG A;  1QE6 A;  1TS4 A;  1XYI A;  1LV9 A;  1K8M A;  2A6E C;  5KIX A;  1Y8P B;  4X65 L;  1EIF A;  1EQV A;  3ER0 A;  5CBE E;  1R9T B;  1A2U A;  2OF1 A;  3K7A H;  4YHH Q;  2FIN B;  5FJ8 G;  2CW0 C;  1FNW A;  4TKO B;  3SK4 A;  4ME5 A;  1ICW A;  2PW7 A;  2SDF A;  1QUQ A;  5JVH 3;  2AUK A;  4IFD H;  4KKU A;  1LTG D;  1WTQ A;  1O78 A;  3EN2 A;  2PW5 A;  4DNT B;  2KCM A;  1G91 A;  4I7A A;  3CCQ A;  2VQF Q;  3K58 A;  5M5W H;  2RQX A;  1SNP A;  2K5N A;  3I4N B;  2NTT A;  2ZXP A;  3C2P A;  1AE3 A;  1IL2 A;  1PV4 A;  1PZI D;  2VB3 X;  4JI7 Q;  1VQL A;  1LT5 D;  1MSG A;  1UE7 A;  1GO3 E;  4A3J B;  1LM0 A;  3BZK A;  5LMU Q;  1Z7T A;  4JI7 L;  2EXZ A;  2JA7 H;  1S5C D;  3DMU A;  1EOV A;  4JI8 Q;  2CQO A;  4IPG A;  5J1Z A;  1G8Z D;  4L5S A;  4M8A A;  3FKI H;  3CHB D;  1EEI D;  2XGT A;  3RZO B;  3KLW A;  2K5W A;  2BCO A;  3TP7 A;  2EY5 A;  3MXU A;  1E1T A;  2PQA A;  1PRT F;  4L5T A;  4H44 C;  4N9T A;  2NN6 G;  4FF3 A;  2L1B A;  1N8R C;  2IL8 A;  4GLX A;  3FMC A;  1H9M A;  2MJ8 A;  2ZTC A;  2Z6B A;  1AH9 A;  1H9S B;  2K32 A;  3P1H A;  3S17 H;  1TWF H;  5CV7 A;  1HNZ Q;  4OON A;  3NTK A;  3A74 A;  1WVL A;  1M90 C;  1SBB B;  1S40 A;  1E2V A;  3CCS A;  3CCR A;  2LXK A;  3G6J B;  1WCM G;  1DM0 B;  3QR8 A;  3D4D A;  3GTK B;  1X55 A;  4TVA B;  1HUM A;  1TS2 A;  1SND A;  1PH9 A;  2N55 A;  2Q2H A;  3GTK H;  3NP8 A;  5JPN C;  2J0T D;  5IWA L;  1A63 A;  1Y1V G;  3CKI B;  1PTO D;  3F2D A;  1I4R A;  1VF7 A;  2DGY A;  4BY7 B;  4HSP A;  4JBK A;  1J9O A;  3I72 A;  4TRD A;  4YWL A;  4B3T Q;  2MNA A;  3A54 A;  1BKB A;  3TP5 A;  4RH6 A;  4DR6 L;  2CKZ B;  1NMF A;  1HZC A;  3KDF A;  4DV2 L;  3I2Z A;  1D1K A;  5EQ0 A;  4F8M A;  4KKS A;  4DV6 Q;  3I56 A;  3CCE A;  4ODG A;  2UXB L;  3CXC A;  3S14 B;  1K73 C;  1C0A A;  4UAI A;  3FPU B;  3VYT A;  2JA7 B;  1K3R A;  5EAY A;  2B63 H;  5CYU A;  4DR5 L;  2PI2 A;  5M5Y H;  1WTV A;  1MJE A;  2FFK B;  1BBU A;  4LF8 L;  3O13 A;  3SK8 A;  4M1U B;  4OX9 L; 
#chains in the Genus database with same CATH homology
 5ELF A;  2A5H A;  5JPM C;  2EDG A;  4BBS B;  5FOB B;  2RA4 A;  1EQT A;  1BF4 A;  2F0M A;  3BG3 A;  1BCP B;  4AYB B;  5AFW A;  3OSO A;  2KA7 A;  1EY4 A;  2B8G A;  1DZ1 A;  2E76 C;  5I9P A;  5CV4 A;  2SNS A;  1B9M A;  1TS3 A;  2EVB A;  4RCN A;  1UNS A;  1UUP A;  1LT6 D;  1DON A;  3ITP A;  1SMY D;  1UEA B;  2LFN A;  1WTW A;  1QJO A;  2EYM A;  2N88 A;  5FLX E;  2KQ3 A;  1JIC A;  4XDX A;  1ONL A;  4CJ2 C;  2BE5 C;  1MI2 A;  2IX1 A;  4IFD J;  2A69 D;  2CVR A;  3A8I E;  4KKT A;  1Y8O B;  3TZD A;  2BE5 D;  4CHT B;  3PUX A;  2F0T A;  1OXT A;  5FKA C;  3M3Y B;  2ID0 A;  3MXP A;  2X6L A;  1U4L A;  2BA1 A;  3LX0 A;  1U4R A;  2L9H A;  3A8J E;  3EVQ A;  4MHE A;  4R9W A;  2F0D A;  4ZKB B;  3CRK C;  5DM7 3;  3T4A C;  4PMB A;  3EJI A;  5C3X A;  1CM9 A;  1AP0 A;  1H9J A;  2BDO A;  1SNQ A;  3M85 A;  4IZ8 A;  3GTQ B;  1EY0 A;  2EY1 A;  3S16 B;  3QWN A;  4QCL A;  1LLR D;  1STH A;  3LWE A;  5JEA H;  1HTP A;  5C0X G;  1RTN A;  3BS1 A;  1HUN A;  1IW7 D;  4ZRZ A;  2QDB A;  3T53 B;  1H9K A;  4TQU S;  5ELC A;  2F0W A;  4DXG A;  1HA6 A;  1EOT A;  5M9O A;  1RTO A;  2CQA A;  3HOY B;  4G7O C;  2JEA I;  1IL8 A;  5G3L F;  1BCP C;  1II3 A;  4XQJ A;  4IAL A;  2EJM A;  3IAY A;  1PRT B;  3CRL C;  1Y1V B;  4OL7 A;  1T5E A;  3HEJ A;  4XYO A;  5JVG 3;  1U4M A;  4KV6 A;  2E2D C;  3KLS X;  4I7Z C;  5IGF A;  2X69 A;  1JOR A;  1QNK A;  4OO1 I;  4KD4 A;  3D3R A;  3FVQ A;  4DAY A;  2FMM A;  1PZJ D;  3GTG B;  3HKZ B;  2R6G A;  1UAP A;  1MBY A;  2F0S A;  4Q0F A;  4DA2 A;  3VYU A;  1AW7 A;  1YNN C;  2HQE A;  3RLF A;  1TQO A;  2XIW A;  1C4Q A;  3HGB A;  1IKL A;  1F9S A;  3D6C A;  4V19 0;  4KJN A;  1EIG A;  2J7Z A;  2A68 D;  3FPP A;  4HTH A;  2EYP A;  4DU9 A;  3VA7 A;  1JE4 A;  4R8I A;  3MAQ A;  3K57 A;  3MA2 B;  2WV6 D;  1O7Y A;  1T5X D;  5LL6 X;  2WKC A;  3NTH A;  1ZKO A;  1PXU A;  2H1E A;  5KNB A;  3OMC A;  3F2U A;  5C44 B;  5LL6 S;  3DEO A;  2Z4H A;  2IT1 A;  1ZYR C;  3S2H B;  2DN8 A;  3QOJ A;  1A6X A;  2EE1 A;  3IKJ A;  4NW2 A;  3PUY A;  4IFD I;  4IUN A;  3J80 E;  1F77 A;  4KD3 A;  4CJ0 B;  3V96 A;  5COR A;  1CQF A;  1KDC A;  3I73 A;  5D14 A;  3J7A V;  3DHQ A;  4X3T A;  5KND A;  1DD2 A;  2QCP X;  4KY7 A;  5C4H A;  1BDO A;  1SFO B;  2A68 C;  1I4Q A;  4KN4 C;  1LAC A;  3GTO B;  3BDL A;  5C3W A;  3C3L A;  4PNY A;  2BA0 A;  2F1M A;  1TVX A;  1S5B D;  4BY1 B;  4KHZ A;  3S2D B;  2NVX B;  1SMY C;  2MPM A;  1F2L A;  5JEA G;  4DFA A;  4EGV A;  2YU9 B;  3HRZ C;  2E2I B;  2WP8 J;  1ENC A;  2EY2 A;  1PFB A;  1F9P A;  3WOF A;  2F0F A;  1M4V A;  1LTB D;  2YYZ A;  1D6E C;  2M2L A;  5JOB A;  3DWP A;  4DAP A;  4CJ1 B;  1SEB D;  4DN4 M;  1B3A A;  4P2C B;  4DF7 A;  4QIW B;  5HGT A;  1VMP A;  2EYO A;  4HCE A;  3MHB A;  3ONA B;  4RKB A;  4HMJ A;  1KLU D;  4NKL A;  3W2D A;  1KLG D;  4LJZ C;  2NUC A;  1CA5 A;  4IUQ A;  3I90 A;  4C3J G;  2RSO A;  3LNN A;  3M4O B;  4RHS A;  1DOK A;  5KGU A;  3ERQ A;  3L9A X;  2JA8 B;  4FO2 A;  5IGC A;  2L11 A;  1JWS D;  3ND9 A;  1M8A A;  3E5S A;  1VF5 C;  1YNJ D;  2QF7 A;  1RHP A;  2B2U C;  5IOC A;  3OPO A;  5IIF A;  1MSH A;  3A8K E;  2ICE C;  3H6M A;  5IOD A;  3R3O A;  4FF4 A;  2PZU A;  5FO8 B;  2WKD A;  4ZUI A;  4QUF A;  5E1F A;  1B4O A;  1SYD A;  3S15 B;  4HSV A;  1I50 B;  4K6L A;  1BQQ T;  3PIO 3;  1EU4 A;  2G9H D;  1PFM A;  3BDC A;  5HUR A;  3DM1 A;  4G4K A;  3MEH A;  3WDN A;  4KJO A;  1PTO B;  2X6G A;  1Y69 U;  4A3I B;  1X3P A;  1WTX A;  4OIK A;  1PRT C;  1BXT A;  1HQR D;  4RAU C;  1LTR D;  2E2J B;  4L8J A;  1B44 D;  5CMD A;  3HOV B;  1HA5 A;  5KEE A;  2A6H D;  3UI2 A;  4S3S A;  4YIJ A;  2TSS A;  1K8O A;  2EJF C;  2AQ2 B;  2QIL A;  4PQX A;  1SNM A;  5C4Z A;  4FYD A;  1KDB A;  2F3V A;  3SK5 A;  5DAU A;  1V8Q A;  4C3I G;  3L7Z C;  4HAE A;  4EQO A;  3QOL A;  4A3G B;  2B2V C;  4ZLT F;  2XN9 C;  5BN3 A;  4F88 A;  4PMC A;  3SDZ A;  1EWC A;  3IL8 A;  2OXP A;  5KYL A;  2AUJ D;  2F0N A;  1TWA B;  1IW7 C;  3NTI A;  2F03 A;  3M7N A;  3I8Z A;  2L12 A;  1ZEQ X;  3I91 A;  2K01 A;  1GHK A;  4K14 A;  2AWO A;  3FRP B;  4FXG C;  1A3T A;  4RKL A;  1EZ8 A;  2NWG A;  1LAB A;  3J80 L;  4U67 3;  1ET9 A;  2KOL A;  2L0C A;  3BVZ A;  5EBD A;  5J22 A;  3W3A A;  5J39 A;  4ZK9 B;  3Q24 A;  1ILP A;  4KI0 A;  1WD0 A;  4CKC A;  1CA6 A;  3WOE A;  3AB9 A;  1GHJ A;  2O2L D;  5BN5 A;  2C9O A;  4XQN A;  4GZY C;  1HPC A;  2EOT A;  2WAQ B;  3S9W A;  4ZYS A;  2M9V A;  3OMG A;  2B63 B;  4KY5 A;  4Z9C B;  1DJR D;  1XXG A;  2WII B;  1G29 1;  3QJY A;  3GD7 A;  1TY0 A;  1TT2 A;  1BBX C;  1GUO A;  1WTO A;  3OWE B;  1E0B A;  4WOR A;  1S5E D;  2QEJ C;  4HN7 A;  1STB A;  5CV6 A;  3HP3 A;  3NWT A;  5TSS A;  5CV5 A;  4IQZ A;  1RKN A;  1FYC A;  3PO3 B;  3EQL C;  1C8C A;  1YNN D;  1EY6 A;  1CQV A;  1I3Q B;  5G3L D;  1NAP A;  2KJX A;  1VCI A;  1BOS A;  1SYG A;  4EQP A;  1SYE A;  2DNE A;  3ERO A;  4BS9 A;  4HMI A;  2ICI A;  4FXD A;  3PUV A;  4HED A;  2BOS A;  4BA1 I;  3D8G A;  3J7Y W;  2D9U A;  5CR3 A;  4KN7 C;  4OIJ A;  2Q8T A;  2LKV A;  4B9W A;  3PO2 B;  5K5P A;  5K36 G;  3I4M B;  3GTM B;  2B2T A;  3M7G A;  4F87 A;  2Z4I A;  1V1O A;  1D1I A;  3EA6 A;  3RUZ A;  4KY6 A;  3NPP A;  2K05 A;  3NBI A;  2L4N A;  2EYL A;  4K6D A;  2NN6 I;  3G7L A;  1TWH B;  1VMC A;  2JA6 B;  2JA5 B;  3A7A B;  2KCN A;  4HR7 B;  4X3S A;  3NUC A;  2WAC A;  1DXM A;  4XXE A;  4A3D B;  3PUW A;  1KNA A;  4C1N K;  1LTS D;  1SXT A;  5LHY 1;  2F0G A;  4ABN A;  2OEO A;  5C0X I;  5D3D A;  2KEE A;  2B2T C;  4QB4 A;  3OW7 A;  4CKB A;  1IYU A;  1CFM A;  2IJ0 A;  3BVG A;  3MTS A;  1SYC A;  4OO1 H;  1FR3 A;  1CI3 M;  3NQI A;  2H4O A;  2F0Q A;  5C3E B;  2F0E A;  3HZX A;  3OIP A;  4FXK C;  3IFD A;  1SSO A;  4QMG A;  1CHP D;  1V1P B;  2PNR C;  2B2U A;  1WTP A;  2DNC A;  4QUC A;  1JR0 D;  4K2K A;  1QG7 A;  4DXF A;  4E6I A;  4C3I B;  1ZYR D;  2FMC A;  2B2Y A;  2Y0S B;  2IWH A;  3HOZ B;  1LTA D;  4IUR A;  3MFG A;  2Q8I B;  1SAP A;  5CV8 A;  2KHS A;  1X3Q A;  4PMW A;  2I07 B;  5CGK A;  2E74 C;  3S1N B;  4RGO S;  1IYV A;  2MUY A;  4BA2 I;  5JEA J;  1GUW A;  4K5X A;  5I2X A;  2L5T A;  1F2Z A;  3K5L A;  3Q22 A;  5JAV A;  1KAB A;  2MP1 A;  5IGG A;  1G2T A;  3T56 B;  4A93 B;  4IUP A;  1Q1E A;  4B9X A;  3Q6S A;  1JWU D;  2A74 C;  3V2T A;  1A15 A;  1GUN A;  5FLX L;  5M5X B;  1W6J A;  4RGN A;  3NQT A;  1ZXT A;  4C3J B;  1HCZ A;  1I4G A;  4G57 A;  3K59 A;  3MZ5 A;  2JSO A;  3TME A;  2O5I C;  1QCB D;  3KLS A;  2F0H A;  1HQM C;  3BVM A;  4OHJ A;  3CQZ B;  3JAM L;  1WCM B;  2WB1 B;  1I6V C;  1U4P A;  3T13 A;  1JCK B;  1TU2 B;  1AFP A;  2Z8L A;  1SJE D;  1I4P A;  4DGZ A;  5I2Y A;  4R8N A;  1TII D;  3ND8 A;  3HOX B;  2EY6 A;  2PYK A;  4CBV A;  2B8F A;  1JQY D;  2VXW A;  1BUV T;  4XTC S;  3KF8 A;  2HUG A;  4KTA A;  2NTS A;  4MIU A;  5DEH A;  1GXD C;  2ZXO A;  1EZ6 A;  2EZV A;  5EJW A;  1EEF D;  4PV1 C;  2PZT A;  2RKS A;  2PPB C;  1SYF A;  3R2I A;  3HOW B;  4BBR B;  1ML0 D;  5FK9 C;  3T16 A;  3L3O C;  3GQB A;  1ET6 A;  5FO7 B;  2A6H C;  4X3U A;  3KK7 A;  1EWH A;  4NMZ A;  1EYA A;  2GA4 B;  2KEC A;  5F2D A;  1RD9 D;  4A3E B;  4CGY B;  1B9N A;  1OXU A;  5M3F B;  4HCS A;  1JOO A;  1F2Y A;  4IUV A;  1RF2 D;  3C1E A;  5EKI A;  3TN2 A;  1D5X C;  1H9R A;  5NUC A;  1G6Z A;  1PZK D;  1IHZ A;  1BR9 A;  1EYD A;  5FO9 B;  2L55 A;  4DK1 A;  4JK1 C;  4RHR A;  1EL0 A;  3MVV A;  4IUU A;  1XTC D;  3NK9 A;  3R8B A;  1SNO A;  3K5O A;  5ELD A;  4C56 C;  2JEB I;  5E4X A;  5C0X J;  4KHV A;  1YNJ C;  1ENF A;  4KK7 A;  3A7L A;  2HCC A;  4H0L C;  2IX3 A;  3SXH A;  3BDO A;  3I4L A;  2PZW A;  2DY8 A;  3GO5 A;  4K8J A;  4ZQ3 A;  3S1Q B;  1RJT A;  3TDQ A;  2NB0 A;  3NXW A;  4ID6 A;  3K5M A;  4H13 C;  2LY7 A;  1PTO H;  3SHL A;  1L0Y B;  4C3H G;  1STY A;  1Q1B A;  2RSN A;  4K5V A;  2MHV A;  3A56 A;  3DXJ C;  1E2W A;  1SDF A;  4C3H B;  1TWF B;  1MGS A;  5M3M B;  4NDX A;  2O4X A;  4WJW A;  3DUZ A;  5C6A A;  1F2M A;  1A2T A;  2VUM B;  3MC0 B;  3SR1 A;  5E3F A;  3VR4 A;  1LO5 D;  5IGE A;  3SE0 A;  1B53 A;  3D4W A;  1S4Z A;  1PYW D;  4FNF A;  5IT9 L;  1PFN A;  2B39 A;  3GTJ B;  4XIG S;  3HG9 A;  1CZW A;  3MWY W;  2DY7 A;  3QO2 A;  2K28 A;  3P20 A;  3GTL B;  2K7V A;  4F7X A;  3D4R A;  2MGS A;  2K5D A;  3VYS A;  4RGT A;  2SOB A;  2D2C C;  2NYZ D;  1FGB D;  4RWS C;  3M4Y A;  5E4W C;  2ZXR A;  1GUT A;  1EIH A;  4Q5V A;  2NZ1 D;  1OXX K;  3PIP 3;  1R4P B;  5ELE A;  2B2W C;  2K33 A;  1V1P A;  2PMZ B;  3N52 A;  5IGB A;  1XWE A;  1TY2 A;  1WTR A;  3V05 A;  5ELB A;  2E75 C;  1C48 A;  1FNU A;  1NR2 A;  4WFN 3;  1QOH A;  3NBH A;  1E2Z A;  3U9O A;  1S5D D;  3VYR A;  3D31 A;  1SE2 A;  3J81 E;  1EY5 A;  4FF2 A;  4V0B A;  4Y7N B;  2F3W A;  2K6A A;  2LMC B;  5C4J B;  5BN4 A;  1LTI D;  1RDP D;  1DOL A;  2Q8R E;  2JE6 I;  2VB2 X;  2XRQ D;  3J81 L;  1NUC A;  4XT1 B;  1V43 A;  1QWY A;  5D3I B;  5EKL A;  1AEX A;  1F9Q A;  5D65 A;  3BYY B;  4UDU C;  4JBW A;  5KRU A;  3OOC A;  4OO1 G;  2F0L A;  3OWF A;  3TP6 A;  4J8Q A;  2SEB D;  1K83 B;  1DYQ A;  3Q23 A;  1BCP F;  1KDA A;  3R93 A;  2XWB B;  2IX0 A;  3S1R B;  2R3Z A;  4J1M A;  3SVM A;  4DAV A;  3OHX C;  1Q90 A;  3SEB A;  4U68 A;  5EBC A;  1PRT D;  2EPB A;  1DCZ A;  5C0X H;  4FP5 D;  3C1F A;  4A3K B;  2HDL A;  3FDT A;  2ZT9 C;  2R93 B;  2F0P A;  1GJX A;  1B1Z A;  1J8I A;  2V4D A;  3IFT A;  3KLR A;  4MN3 A;  4O42 A;  1CZG A;  3TSS A;  1KTK A;  4XQQ A;  2A6E D;  3Q0A A;  3D6W A;  5K36 H;  2SNM A;  3S17 B;  1D5M C;  5I9O A;  3ZYY X;  1SYB A;  1OXV A;  1ESR A;  5EGT A;  1TWG B;  3EFX D;  2KVM A;  2PO4 A;  1CT1 D;  1DOM A;  4A3M B;  2TMP A;  2VNU D;  1STG A;  2HDM A;  3PV0 A;  3TBI B;  2CHB D;  2K5Q A;  4LAA A;  1OO9 B;  3VR3 A;  5COY A;  2IW3 A;  1PMR A;  3DEP A;  3P75 A;  2ENB A;  4OGQ C;  1AZQ A;  2G9D A;  3MFY A;  3K5N A;  1JC7 A;  2NBF A;  4LK1 C;  3NSW A;  4EVO A;  4LMQ D;  4FF1 A;  5I6W A;  5CV9 A;  4KMU C;  5JJZ A;  2BDN A;  2E2H B;  2K1B A;  3AU7 A;  2F0J A;  2C5C A;  1SNC A;  1Y1W B;  5I4D A;  1A3V A;  1TR5 A;  4H7B A;  1H9S A;  2R7Z B;  5ISR A;  1ROD A;  3K7A B;  2PCF B;  3SK6 A;  2FHT A;  2F0I A;  3I3C A;  4RGM A;  4A3F B;  3KBX A;  3H0G B;  3QG1 A;  1O80 A;  1NCV A;  3GV6 A;  1EY9 A;  4ULL A;  2XWJ B;  2D5D A;  4FVM A;  5EPJ A;  3U9S A;  3H94 A;  4IUT A;  1HXY D;  4NP5 A;  2A69 C;  2IPK D;  1KNE A;  1EY8 A;  3VR6 A;  4K5W A;  3RZD B;  1AN8 A;  2K04 A;  4WRD A;  5CBA E;  1Q12 A;  1STN A;  3NE5 B;  4EQN A;  3JAM E;  1QNU A;  1PTO F;  2NN6 H;  3E0J A;  1PLF A;  1SE3 A;  2EYF A;  3HS0 C;  2RDH A;  3CU7 A;  1QB5 D;  1MD2 D;  1HFG A;  3BZD B;  5A2Q E;  1S5F D;  4ZAI A;  3RMH A;  3KUP A;  4ZUJ A;  2R61 A;  3FEW X;  3LWU A;  2NVQ B;  2F0K A;  1RCV D;  1G2S A;  5A2Q L;  1Q3L A;  5DNF A;  1JOQ A;  5EPL A;  3TZU A;  2I46 A;  3T51 B;  3J7A F;  1CK1 A;  1D2B A;  1JWM D;  1SE4 A;  1GUG A;  1TWC B;  2M00 A;  3VR2 A;  3H3V C;  2CW0 D;  2F0V A;  4TSS A;  5C5M A;  3QB3 A;  3H09 A;  4C1N I;  3E6Z X;  3X3N A;  4RCO A;  2AWN A;  1NR4 A;  2WIN B;  4IFD G;  2AQ3 B;  1BO0 A;  3VA5 A;  2KUM A;  2OT2 A;  3A55 A;  4L63 B;  1EYC A;  2XSC A;  1AZP A;  3MXN A;  1WD1 A;  1R4Q B;  1PTO C;  1I4H A;  1OXS C;  4XYQ A;  4N9P A;  1FD7 D;  4K2L A;  1B50 A;  3DWA A;  1IKM A;  1HFN A;  1FNV A;  1I4X A;  1LTT D;  4L6T B;  1Q8I A;  3N6R A;  1ENA A;  4IN3 A;  5C5L A;  5T1I A;  4K8I A;  5CC4 A;  1A3U A;  1X32 A;  2XRS D;  2XVS A;  2PQE A;  4XT3 B;  3KBG A;  4DK0 A;  2QKI C;  4RA8 A;  3GV3 A;  2J4X A;  2KED A;  5KYI A;  2B2W A;  3NHH A;  2A73 B;  2FJ2 A;  3X3M A;  4BWG B;  2HCI A;  4J6H A;  1VDZ A;  5C4X B;  2RVL A;  1TKW B;  2KCC A;  1LT3 D;  5DM6 3;  4O1N A;  1O7Z A;  1L0X B;  3RD4 A;  1GOZ A;  1NSN S;  4B08 A;  1I6H B;  4DNR B;  1Y8N B;  2RDG A;  3BYT B;  5IT9 E;  3GP7 A;  1F9R A;  2AQ1 B;  1HTL D;  4I65 A;  2NVT B;  1BCP D;  2JXM B;  1BNZ A;  5EPK A;  5A35 A;  5M5Y B;  1HRJ A;  3C46 A;  3OIQ A;  1EFI D;  1ESF A;  2EYJ A;  3MXG A;  1SJH D;  2LS0 1;  2O5J C;  4G7H C;  2K03 A;  3GTP B;  1XX8 A;  2D62 A;  3S1M B;  1B2T A;  1PDQ A;  4X3K A;  5T1G A;  1JB3 A;  1JOK A;  1KAA A;  2NVY B;  1O7L A;  3TP8 A;  2B2Y C;  5EKK A;  2B2V A;  3PMF A;  1STE A;  1GUS A;  3H91 A;  5I6Y A;  1Z47 A;  2F0O A;  1ILQ A;  3DWQ A;  1EU3 A;  5KNC A;  3R2T A;  3URY A;  2EJG C;  2XNA C;  4C2M B;  1CHQ D;  2F4I A;  5IGD A;  1D5Z C;  4A3B B;  1TS5 A;  1STA A;  3VR5 A;  3FKI B;  3PUZ A;  3K6O A;  3I70 A;  2JP1 A;  1EY7 A;  1U9R A;  2EYH A;  1CTM A;  4ILW A;  3P7J A;  3K0Y A;  2R92 B;  5M5W B;  4RFB A;  2F0U A;  4ZKC B;  1HHV A;  1Z6H A;  2Z1C A;  3AMU A;  1LT4 D;  1W6K A;  4G7Z C;  4CKE A;  3HOU B;  3QIA A;  3NWS A;  2RDF A;  4QF4 A;  2JYO A;  2RBM A;  1QIL A;  1QE6 A;  1TS4 A;  1XYI A;  1LV9 A;  1K8M A;  5KIX A;  2A6E C;  1Y8P B;  5CBE E;  1EQV A;  1R9T B;  1A2U A;  2OF1 A;  2FIN B;  2CW0 C;  1FNW A;  4TKO B;  3SK4 A;  4ME5 A;  1ICW A;  2PW7 A;  2SDF A;  5JVH 3;  2AUK A;  4IFD H;  4KKU A;  1LTG D;  1WTQ A;  1O78 A;  2PW5 A;  4DNT B;  1G91 A;  3K58 A;  2RQX A;  1SNP A;  3I4N B;  2NTT A;  2ZXP A;  3C2P A;  1PZI D;  2VB3 X;  1LT5 D;  1MSG A;  4A3J B;  1Z7T A;  2EXZ A;  1S5C D;  3DMU A;  5J1Z A;  1G8Z D;  4M8A A;  3CHB D;  1EEI D;  3RZO B;  2K5W A;  2BCO A;  3TP7 A;  2EY5 A;  3MXU A;  1PRT F;  4H44 C;  4N9T A;  2NN6 G;  4FF3 A;  2L1B A;  2IL8 A;  3FMC A;  1H9M A;  2MJ8 A;  1H9S B;  2K32 A;  3P1H A;  5CV7 A;  3NTK A;  1WVL A;  1SBB B;  1E2V A;  3G6J B;  1DM0 B;  3D4D A;  3GTK B;  1HUM A;  1TS2 A;  1SND A;  2N55 A;  3NP8 A;  5JPN C;  2J0T D;  3CKI B;  1PTO D;  1I4R A;  1VF7 A;  4BY7 B;  4HSP A;  1J9O A;  3I72 A;  4TRD A;  3A54 A;  3TP5 A;  4RH6 A;  1D1K A;  5EQ0 A;  4F8M A;  4KKS A;  4ODG A;  3S14 B;  4UAI A;  3FPU B;  3VYT A;  2JA7 B;  5CYU A;  1WTV A;  2FFK B;  3O13 A;  3SK8 A;  4M1U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...