2EPBA

Solution structure of chromo domain 2 in chromodomain-helicase-dna-binding protein 6
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
68
structure length
68
Chain Sequence
b'GSSGSSGNPDYVEVDRILEVAHTKDAETGEEVTHYLVKWCSLPYEESTWELEEDVDPAKVKEFESLQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromodomain-helicase-DNA-binding protein 6
molecule tags Transcription
source organism Homo sapiens
publication title Solution structure of chromo domain 2 in Chromodomain-helicase-DNA-binding protein 6
rcsb
total genus 5
structure length 68
sequence length 68
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2epbA00
2H1EA 1XYIA 1B4OA 3GV6A 4RA8A 4OIJA 1PDQA 2B2WC 2HCCA 5EPKA 1CA5A 3SVMA 3LWEA 1U4RA 4IUQA 1HHVA 4RWSC 1DOKA 1WTPA 1QNKA 2FMMA 2NYZD 2KUMA 1JICA 3DEPA 1BNZA 1IKMA 1HRJA 5EQ0A 1MSHA 3FPUB 2L11A 1A15A 4MHEA 1NAPA 3MTSA 2FFKB 3N52A 1Q3LA 4XT1B 5AFWA 4ZAIA 1KNAA 2MP1A 1JE4A 2EPBA 3DEOA 3F2UA 4IUTA 2K28A 2B2TA 2J7ZA 2RSOA 5EPLA 1G2SA 2FJ2A 1B53A 3IFDA 3Q6SA 2EOTA 3QO2A 1NR4A 1B3AA 5CMDA 1ILQA 2IL8A 3D6WA 3I8ZA 1WTXA 1O7YA 2K01A 1EIGA 2K04A 3TZDA 3FDTA 4X3UA 1BO0A 1O7ZA 2KOLA 2CVRA 4HSVA 4U68A 4ZK9B 3I90A 3UI2A 2D9UA 2L9HA 2K1BA 5D65A 2M2LA 1RTOA 1F9PA 2K03A 1B50A 4HAEA 3MWYW 5D14A 1WD1A 4X3TA 3KUPA 1F2LA 4UAIA 2X69A 1ZXTA 4X3SA 3ONAB 2MJ8A 4QUCA 1PFMA 2R3ZA 1VMPA 2SDFA 4NW2A 1AZQA 4IUPA 1G6ZA 1ESRA 4XT3B 2JYOA 4MN3A 4ZKBB 1AP0A 1HUNA 3KBXA 4ZKCB 1QE6A 1WD0A 1X3QA 5T1GA 5JJZA 1HFGA 2HCIA 2HUGA 2BDNA 2L1BA 2MGSA 3P7JA 3H91A 2HDLA 4CJ0B 1PLFA 1U4PA 1IL8A 4HCSA 3TN2A 1MI2A 1ML0D 3R93A 2B2UA 1WTRA 3IL8A 5E4XA 4ZLTF 3I91A 4LMQD 2B2UC 1X3PA 2NZ1D 4O42A 4OIKA 5T1IA 1CM9A 1LV9A 1PFNA 1QG7A 4HEDA 1PFBA 2B2TC 4IUVA 1X32A 1KNEA 1HA6A 2B2VA 2NWGA 2FINB 1RHPA 2KVMA 2RVLA 2B2VC 1CA6A 4XDXA 5CBAE 1BF4A 2XIWA 2RSNA 2Q8TA 1U4LA 1GUWA 4R8IA 2DY8A 4RAUC 3GV3A 1WTOA 2B2YC 1RTNA 1G91A 1G2TA 1J9OA 2VXWA 1DOLA 4CJ1B 1EQTA 5COYA 4R9WA 1HUMA 1XX8A 2KEDA 4X3KA 3G7LA 1MGSA 1O80A 1EL0A 1U4MA 3DM1A 2X6LA 1M8AA 1AZPA 1C8CA 1EOTA 4QUFA 1IKLA 4CJ2C 1SDFA 1F9SA 1BBXC 1WTWA 1DZ1A 2FHTA 1EIHA 2K05A 2X6GA 1WTVA 1ICWA 2B2YA 2MPMA 2KEEA 5DNFA 2HDMA 2L12A 2N55A 5EJWA 3I3CA 1ILPA 2RA4A 2EE1A 2N88A 4IUUA 5CBEE 1J8IA 4IURA 5E4WC 2L4NA 5EPJA 1TVXA 1B2TA 1VMCA 1DOMA 2Q8RE 5EKIA 1WTQA 2B2WA 1HFNA 1F9RA 2DY7A 4DN4M 1S4ZA 1RJTA 1WVLA 3HP3A 1RODA 1DONA 1SSOA 2JP1A 1MSGA 1F9QA 1E0BA 1NCVA 2KECA 5CORA 1NR2A 1SAPA
chains in the Genus database with same CATH superfamily
5CV6A 4AYBG 4F8MA 1D5ZC 4KKTA 1T5XD 4DV6L 3FHWA 3S2HB 3PIO3 3D31A 1HNZQ 2NYZD 2BH8A 5M3FH 4NXML 4ZUIA 3HKZG 2WB1B 3CC7A 3OYYA 1TS4A 5IGFA 3RLFA 4JG2A 1CSPA 4A3EG 4A3KG 2F0SA 3AFPA 2ASBA 5CMDA 2UXBL 3RMHA 2SNSA 3TMEA 1STYA 3R2TA 5HY6A 2UUAL 4A3DH 4DA2A 5C0XJ 1KRSA 1TWAB 1Z6HA 4V0BA 3H3VI 4OO1G 4HIKA 4Q5VA 2B63H 3EBEA 4YWLA 2E2JB 1V1OA 3ER0A 1Q1EA 1I6HB 4AQYL 4LAAA 3BZDB 3OWFA 1N36Q 3J81c 4JK1C 5JVG3 2NVQH 3ONAB 1EYGA 1VMPA 2NVYB 2F0DA 3A5ZB 2JA7B 1G8ZD 5M5XB 1HFGA 4FXKC 1VQ9A 4BA2I 1Z7TA 1Y1WH 2R7ZB 4IFDJ 4EVOA 3FEWX 1QG7A 2O4XA 2EJGC 4RKBA 1HA6A 2UU9L 2B2VA 4RFBA 1RHPA 2RVLA 3VYRA 4K6LA 5C3WA 3K0XA 1K0SA 1VQCA 1HXYD 3PIPA 4AH6A 2DGYA 4GZYC 1C0AA 1BCPF 1JR0D 2F0NA 3HOUG 3T1HL 4H0LC 2E2JH 4GKJQ 2QKIC 1VS0A 4J15A 5M3FG 3TREA 1EWHA 1IKLA 4N8FA 4B08A 1JT8A 2VS1A 2HHHQ 3E6ZX 1EIHA 3NTIA 3KFUA 1S5FD 2OCEA 5JPNC 1WCMB 1SYDA 3S9WA 2N55A 4DUZL 4KY6A 1ILPA 4CKEA 4A3KH 1V9PA 3HOZG 4GKJL 1H95A 1C4QA 1PTOF 3HOVB 4K5WA 2A74C 2AHOB 1EY6A 1P8LA 2CHBD 3S1RB 4X65Q 2VUMG 1EUJA 4LW1A 3NQTA 1SAPA 3BZKA 4V190 3ZJYC 1L2FA 4GLAC 1K8GA 4A3CG 1KQSA 1QB5D 3I4MH 1K83B 4IFDG 2BDOA 1N34L 1JICA 1VF5C 2UUBQ 3W3AA 5A2QL 1PTOD 1LLRD 2A68D 2UUCQ 2WFWA 2KCMA 3DEOA 1L0XB 5ELDA 4B3TQ 1BKBA 2EOTA 5AJ3L 4XQNA 3D6WA 3I8ZA 4A3GB 3KK7A 3UDIA 3CQZH 3TZDA 1LTTD 3P20A 3G71A 1K9MC 1BO0A 1O7ZA 1SFOB 4C56C 1N32L 1SYBA 3K5MA 4M8AA 1IZ6A 2Y0SG 5TSSA 3S1MH 1A3TA 3G6JB 3CP0A 2HT1A 1YIJA 1UE6A 1RL2A 5E7NA 4YY3L 1KDCA 3DWAA 1PLFA 2Z8LA 1IL8A 2E8GA 4R1JA 4DXFA 3CCLA 2B2UA 5IP9H 1Q90A 2R92G 3K58A 1PFBA 3MXUA 3E0JA 1PH2A 5F2DA 4G7HC 1ASYA 2NB0A 3J7YW 4L63B 4PQXA 3I56A 3M9BA 1PH9A 4A3MB 1STAA 1GHKA 4X62Q 1QUQA 5FLXE 1J9OA 1IBKQ 2KEDA 1EU3A 3FP9A 1XXGA 1TY0A 1HR0Q 1PA6A 2IX1A 1LTRD 2CH4W 1EFID 4JI1L 4LFAL 5IYBG 1K83H 3I4MB 2IHFA 1L0WA 3V2TA 5IT9E 2CKZB 1RF2D 3I3CA 2KCNA 4A75A 1E7ZA 4O0AA 4QMGA 1GJXA 1G291 3CAMA 3GTLH 2F4VL 2WINB 1YNJC 4ULLA 1Q81C 1WVLA 1O78A 2RF4A 2GN5A 1HQRD 3QWNA 1KHIA 1EY9A 2BE5C 4KHZA 1DM0B 1YJWA 1HR0L 5J22A 3AB9A 2A5HA 1XYIA 1CQFA 4DV2L 4A93B 2EY5A 1HQMC 1GKHA 1LACA 4BXXH 3GTPB 1NMFA 3C2PA 1HNXQ 1YNNC 2NVQB 4UDUC 4BA1I 3DHQA 1RIPA 2F03A 2K5DA 3Q24A 1FR3A 3F2UA 3OMGA 2I5HA 2NBFA 3CCUA 4A76A 2O2LD 4JI7L 3HS0C 1EEID 2Z6KC 4YY3Q 3SK6A 1BR9A 5M5WB 4POGA 4OX9L 4O1NA 2F1MA 1CUKA 1V43A 4FXGC 5GQOA 3CD6A 3S15H 1ZXTA 2E2DC 1HZAA 5M3MG 1IBLL 3IKJA 1LT5D 1STGA 2F0KA 4LF4Q 1IYUA 3P7JA 2HDLA 3U58A 5DM73 3FKIG 4L5QA 2Z1CA 4KI0A 4OIKA 3T56B 2KCTA 2XNAC 1MJCA 4P2CB 2B29A 1QZHA 5CV9A 2UXDQ 3S2DB 1A2UA 2YYZA 2YTXA 3PMFA 2D62A 3I4OA 1VCIA 1BF4A 2D0OA 1PH7A 1N34Q 2Q8TA 2A69C 3S1QB 2B2YC 3VDYA 5DAUA 3E0EA 3PF5A 1X3EA 3SK8A 3QR8A 1B9MA 3C1FA 4X3KA 3GTMB 3BYTB 1TWGB 1STHA 4YCUA 5IP7H 1M8AA 1ZEQX 3CHBD 4JBMA 2CQOA 1T9HA 1ZYRD 1BBXC 1GUNA 2NTTA 3R8BA 1Q82C 4DF7A 5C4XG 5ELCA 5ELOA 5IP7G 4BBSH 4B3SL 5A35A 3RLNA 2EDGA 4LF9Q 4YCVA 2DNEA 4X66Q 4DUZQ 1UEAB 1BCPD 1A8VA 1L1OC 2AUKA 2PI2E 1SSOA 4GN4B 3K7AH 3LNNA 1L1OB 1GD7A 1F2MA 2M9VA 3UE0A 2A68C 2EYJA 3GV6A 1GM5A 3KJPA 1SFOH 2Q2HA 1D1KA 1QZGA 4JVZA 3L7ZC 4C1NK 2KENA 3DEPA 1T5EA 1TU2B 2JA5B 1EOVA 4A3MG 3DWPA 5LMNW 1JWUD 3MTSA 3N52A 1XMOQ 4LF6L 3KBGA 4LK1C 5KNCA 4DAVA 1JE4A 1JJGA 2J4XA 1TQOA 2NUCA 2Q2TA 2B2TA 3CPWA 1HH2P 3QO2A 1G2SA 2OXPA 2Z4HA 4LUZA 2JA6B 1UE1A 4OO1I 4JPBW 5DM63 1HTLD 3X3NA 5IE8A 1EYAA 3KYHC 4HSVA 3T53B 1N8RC 1VQNA 2L9HA 1JB3A 4GLVB 3F8TA 4K0KL 1SBBB 1FGUA 4DV7L 3M4QA 4DV7Q 2RDGA 4ALPA 1ENAA 4NW2A 2F0UA 3PV0A 4MNOA 1HUNA 3QG1A 1VQGA 2DNCA 5T1GA 3I73A 1A62A 3CCRA 3SHLA 1J6QA 4GN3B 1JORA 3H91A 1TWFB 2WIIB 5KNDA 3JAML 4JI4L 1CQVA 4IPHA 1JE5A 4K5VA 4HEDA 4HJAA 3GTGH 1TKWB 4FVMA 4G7OC 2NWGA 5C4JB 4QCLA 2KVMA 3GTQH 1H9KA 5HGQA 1JJCB 2F0MA 4B3RL 1HTPA 4RAUC 4OELB 3EFXD 4BY7G 4DV6Q 1DOLA 3RZOH 5M5YB 4A3JB 2JA9A 1DD2A 2EY2A 2ES2A 2X6LA 1KD1C 3CRLC 4EGVA 4DPGA 2UXCQ 1UEBA 4KMUC 1KIXA 4FXDA 4H13C 1WTWA 4LNQA 1SJED 1TS3A 2DUDA 4OWWB 1S5ED 1M1KC 5EJWA 1I4XA 3ULJA 1DJRD 2CCZA 3U4VA 2K5NA 2N88A 5IP9G 1B8AA 3S17H 1K8OA 2XGTA 2IT1A 3R2IA 5C44B 1TVXA 4RGNA 2B2WA 3KDFB 1BVSA 1GVPA 3D6CA 3SK5A 3HP3A 3VR5A 4WJWA 1DONA 3JAMc 2PO4A 1IXRA 2JP1A 5FLMH 4DGZA 1NCVA 1SNPA 2R7DA 4JI6Q 3KDFA 1U5KA 3GTOH 3MEFA 4C3JG 1RD9D 4EQ5A 3SVMA 4DV0L 2OTLA 2L5TA 2YV5A 3NBHB 3E9HA 3KLSX 4ZQ3A 1QNUA 2CWAA 5I6WA 5I6YA 3CMAA 2BCOA 2KUMA 1HRJA 1EYCA 2QILA 2M00A 5EQ0A 1KABA 1Q3LA 4ZUJA 4LF7L 1KNAA 3KOJA 3LWUA 4YWMA 2WAQG 5I9OA 1KLGD 5M5XH 3J80i 4GKKQ 4KKUA 4LF5L 2ENBA 5CC4A 3K7AB 2F0FA 2IL8A 1NY4A 1SN8A 3MXGA 4OXPA 2NN6H 3PO3G 1YNND 2KA7A 1IL2A 1FD7D 4ZK9B 1LTBD 3U9OA 3A5UA 1EWIA 3NQIA 2B63B 5IY0A 1YHBA 3G48A 4RCOA 2B39A 2X69A 2JQOA 3T51B 4KLKA 3NWSA 3UDFA 4C3IG 4ZKBB 4MN3A 1M90C 2GVBA 4CKCA 4BXXG 1FVIA 1GHJA 3G4SA 3F2DA 4FF1A 1S40A 2VNUD 4KY5A 4ZLTF 2H4OA 1C9OA 2B2UC 1X3PA 3BVMA 4O2DA 1ONLA 3MEHA 3PCOB 3PIP3 2Z9HA 4C2MB 2RHQB 3K80C 3WOFA 3HG9A 3X3MA 1S5CD 2JSOA 3P1HA 2HQEA 1FNUA 4QJFA 2ICIA 2XRQD 3CU7A 3I70A 4PZ7A 1VQEA 1MHWC 1HCZA 3NELA 2PPBC 4XDXA 3PO2G 1AH9A 4PV1C 2PMZB 2F0IA 1E2ZA 1VQPA 2ZM6Q 4F88A 1VQ6A 3G7LA 4HIMA 1AEXA 3EQLC 1KRTA 3DM1A 1SROA 5G3LD 2F0HA 2O5IC 2K14A 3QIAA 1WTHA 3WWVA 2YTVA 4R4OA 1XMQQ 5JPMC 2CQAA 5FKAC 2IJ0A 1H9SA 4C3JB 1DOMA 1X56A 1EY8A 3ITPA 1F9RA 2EYMA 4RGTA 3PO3H 3W5OA 1GUTA 1NR2A 5FO9B 4A3JH 4JC0A 3BU2A 3DM3A 2EXDA 1II3A 1SMYC 2PZWA 4EX5A 4KN7C 1XWEA 4KK7A 3SK4A 4RMFA 5JEAG 5IOCA 1IKMA 3KF6B 3WDNA 2L11A 1X3GA 1G6PA 1NAPA 3L0OA 5L37A 1CHPD 2L0CA 3GTGB 2PZUA 3HOYH 3J81j 4A93H 2F0VA 3BVGA 4YIJA 5JEAH 1BOSA 2E2IB 1TR5A 2J7ZA 5EPLA 1B53A 1ILQA 1F77A 4QF4A 5IGEA 3PGZA 4N9PA 3S24A 4K0KQ 2ZXPA 3VR4A 2KOLA 1JMCA 3K57A 1WCMH 5D65A 2AUJD 5LMNL 4A3IG 3TQYA 1YJ9A 2YU9H 3DWQA 2MUYA 1YZ6A 1AP0A 4GNXB 1BXTA 1I50B 1OO9B 2KJXA 4IOAA 2YU9B 4HCSA 4GNXA 1MI2A 5CR3A 3A8KE 1VQHA 4L8JA 3K5NA 4B9WA 2R7FA 1CM9A 2K5WA 2EYOA 3SE0A 4BY1G 2F0EA 5H1SE 2F0JA 5ELBA 4P73A 3TRZA 2ATWA 2I07B 5IYCH 3W1GA 1G91A 1RTNA 4DV0Q 1AE2A 4CJ1B 1RCVD 4BY1H 5C0XG 2J0TD 3WOEA 4JI6L 2JA7H 3CW2C 3F1ZA 1HJPA 1YITA 1SDFA 4B3SQ 2K05A 1EY5A 1SE2A 3KF6A 2NVXH 5IGDA 5I2XA 5DLQE 1SNDA 4CHTB 3M3YB 2WAQE 3JAME 1I3QB 2L4NA 4ILWA 1KLUD 4ZYSA 2PQAB 1KL9A 1SMYD 4A3DG 2XSCA 4H7BA 1HZBA 2JA5H 4DV1Q 1PRTC 3NEMA 4DFAA 2C5CA 1WCMG 2R61A 5C4XB 3VR2A 3H3VH 2NZHA 1B4OA 3G6EA 1K3RA 4JW0A 4HIDA 1BCPC 4XYOA 3T1HQ 2XWBB 1H9SB 5E3FA 2BA0A 1ET9A 3ND8A 2A6EC 1EZ6A 3CCEA 3HKSA 3Q8DA 4MHEA 4FF2A 4G57A 4LFBL 3MVVA 2UU9Q 3OIPA 4RH6A 2RHSB 1QJOA 3GTKH 2NN6I 2K75A 2C9OA 1CKNA 4BY7B 4JI4Q 4C3HG 2VB3X 5C3EB 2EIFA 1I4PA 1WTXA 3W2DA 3Q22A 3BYYB 3HOVH 4C2MH 2V1CC 3JAMi 1PH6A 5C5LA 5LMNQ 5K36H 3CXCA 4XYQA 3GTMH 2K33A 5FLMG 5IYCG 2D9UA 3V96A 2K1BA 3I2ZA 4OONA 1VQAA 1LABA 5J1ZA 4DNRB 1PH4A 4AQYQ 3KUPA 5D3IB 1D5XC 4XTCS 1FL0A 3E5SA 2AQ1B 2VUMB 1CKOA 4NMZA 1EQVA 1G51A 2P5ZX 4XQJA 2ZXRA 3TDQA 3URYA 2ALYB 3J81E 1PFNA 1A0IA 4KJOA 2LXKA 4YCWA 5FO7B 2FINB 1CK1A 3STBC 5C44H 2V4DA 3S15B 1HNZL 2AMCB 3HKZB 4KY7A 3L2PA 2PI2A 3U50C 4HTHA 1PTOH 1SE8A 1AZPA 1I4HA 4DK6C 4DR5Q 3RZDH 3S16H 1R9TB 1XMQL 4DV1L 5NUCA 3A54A 5EBDA 1GXDC 1SYCA 2CH4A 1W2BA 1PV4A 3RZOB 2HDMA 5FO8B 2CW0C 4LF9L 2EE1A 2RQXA 1PHJA 2PMZE 4LFAQ 1Z9FA 1VMCA 5C4ZA 3GTPH 4UP9A 1KAAA 4C3IB 3BJUA 1CT1D 3DLLA 2LKVA 1VQ7A 3M4OB 4DR4Q 3NUCA 1VQJA 4RGMA 4Y52H 5FJ8G 2HCCA 3KLWA 4JYAL 2XWJB 1Y14B 3RD4A 4WRDA 1W6KA 2XTIA 3CRKC 1ZYRC 1JC7A 1Y1VG 5M3FB 5M5YH 2O5JC 2UXDL 1A15A 1PH5A 2IX0A 1TIID 4JOIC 1CZWA 4IN3A 4TSSA 1N33L 3I55A 1I50H 4E6IA 2RSOA 1FYCA 1Y1VH 2FJ2A 5KNBA 1B3AA 1CKNB 1BCPB 3QOLA 3AEVA 4Q0FA 4ODGA 5CYUA 2IHEA 1IW7D 4DUYQ 4CDEC 1IBLQ 1SEBD 5FOBB 3AYHB 3H0GB 3I90A 4XXEA 4DUYL 1PYWD 1KDBA 5C3EG 4R4IA 3MXNB 5IYBH 3GO5A 4OX9Q 2KCCA 3NE5B 1LTSD 2AWOA 1AFPA 3OTOL 3HOYB 3TSSA 3NBIA 5C4HA 3DUZA 1QVFA 4PMBA 4PG3A 4H44C 2I5LX 2RBMA 5ELEA 1QVGA 3T4AC 1Q46A 3NXWA 1TY2A 1HZ9A 4DR4L 1LTGD 5E1FA 4X65L 4NPSA 2VXWA 4A3IH 2LFNA 1GUOA 1I5FA 3NSWA 2F0QA 2K52A 4WFN3 3C46A 2R93B 5IIFA 2KHSA 1EL0A 1Q1BA 1PH1A 5KRUA 4LWCA 1F9SA 2FHTA 2FMCA 1Y8OB 1KXLA 2I0QA 2HHHL 3NPPA 3HEJA 3U4ZA 2FXQA 1JJ2A 3S1QH 1F2YA 4NP5A 4F87A 2MFIA 1WTQA 2N3SA 2DY7A 1CTMA 1RJTA 4KHPQ 4JBJA 2BOSA 1SYEA 1F9QA 3GTKB 1R4PB 1TWCB 4RGOS 3AFQA 5LMUQ 4DR6L 3D4WA 1B7YB 2B8GA 2EJMA 2MQHA 3Q0AA 4L5SA 3TBIB 1MBYA 1PYSB 1SYFA 1U4RA 4G7ZC 4AIMA 4X62L 1EYDA 3D4DA 4KV6A 4A3EH 1WJJA 5FLXc 4M1UB 4BBRG 4A3LH 3FKIH 2EPBA 4HSPA 2R7ZH 3I72A 4HJ7A 4OO1H 1STEA 3FMCA 3Q6SA 3HGBA 2ZJRA 2D2CC 2RDHA 3TS0A 1PTOC 2ZJQA 2K01A 1VQFA 1EIGA 2K04A 2R7ZG 1NNXA 4X3UA 1Q7YC 3GTOB 1EQQA 2Z4IA 4R8NA 2M2LA 4DR3Q 4L5TA 2F0TA 1F9PA 4CDDC 4JV5L 3S14B 3MWYW 1WD1A 4C1NI 2UUAQ 4K8JA 1N32Q 2F0OA 1AZQA 2N49A 5I4DA 4BY1B 5JJZA 3A55A 4OEMB 4CJ0B 3VR6A 1VQKA 5C0XI 3A8IE 1GUGA 3IL8A 5J39A 3QB3A 3MA2B 4LMQD 1JB7A 2NZ1D 3A7AB 1B44D 4R4CA 1VF7A 3J7AF 2L55A 4WJ4A 1V1PA 2E74C 2NTSA 2EYLA 1F2ZA 2JEBI 3RNUA 3HZXA 1P16A 3CCVA 5JVH3 4UPAA 3K5LA 4IFDI 1EOTA 5IT9c 4A3DB 4AYBE 3PUWA 1U0LA 4ME5A 1K73C 1DZ1A 3A8JE 2B2YA 2LS01 2JA7G 4POFA 4A3LG 2TMPA 5DNFA 2L12A 2E5LL 2A8VA 5BR8L 1E2WA 3NTKA 5KIXA 4DR1L 5EPJA 4KJNA 3HKZE 2K4KA 1NBWA 3F2CA 1JCKB 2LXJA 4GOPA 1M4VA 1E0BA 3GTJB 1HA5A 1MKHA 1XPOA 1JOKA 3A56A 1VQBA 4OIJA 1TWHB 3H3VC 1MD2D 2PQAA 1B1ZA 1UUPA 1HHVA 4RWSC 3AMUA 3TP7A 1LYLA 3TEHB 3KJOA 3M4PA 4P72A 1BBUA 2OTJA 4J6HA 1MSHA 2LMCB 2LSSA 3SDZA 4JCVE 4DN4M 2VB2X 1N9WA 2EY6A 5ELNA 3GDEA 4IALA 1U9RA 2CWPA 3RN2A 5BN4A 1SNOA 2QEJC 4K8IA 1SRUA 4JI3L 1XPUA 2CVRA 1V1PB 1PYBA 4DV5L 1QWYA 4WJ3M 1B50A 5FJ8H 1JWSD 3NBHA 3PUVA 1IYJB 4P71A 4UAIA 4DKAC 4RHSA 1Q86C 3V05A 3KF8A 1X65A 3T13A 1QVCA 4DV4L 1QE6A 3PUXA 2RKSA 4X6AH 2HUGA 3T16A 4HMIA 1HPCA 1CZGA 1Y1VB 1TWHH 1Q8IA 1KAWA 1KTKA 3I4NB 3CQZB 2Z0SA 4QIWB 4HMJA 1UE5A 2ZXOA 1EIYB 1KNEA 2A6HD 3H94A 4DV2Q 1XMOL 4LF6Q 3P75A 2PNHA 3M7GA 2IY5B 5LMUL 2Q2UA 5K5PA 4K5XA 3CCJA 4A3KB 1PXUA 1EU4A 1SNMA 2EYPA 4A3CH 1G2TA 1KDAA 4PZ8A 4KHPL 1X55A 2PCFB 3VR3A 3A74A 4JI8L 1PRTB 1VDZA 3HFZB 4NXNL 2QCPX 3PIOA 2ZJPA 4L5RC 4LFCQ 4A3GG 4LUVA 3CPFA 1Y69U 4X66L 4C3HB 4YHHL 2N8NA 5GAGC 3CC2A 5ELFA 3T1YQ 1AN8A 4DAYA 2SEBD 3CC4A 3RZDB 3S16B 3ULLA 1PVOA 1EEFD 1JOQA 4JI8Q 1Y1WB 4JI5L 1Y8PB 1ZKOA 2B2WC 1WTPA 4C3IH 2FMMA 2G5DA 1VQLA 3SGIA 3OOCA 3VYUA 1D5MC 3FPUB 1EIFA 5ISRA 4ZAIA 4K2KA 5GAEC 3CCMA 4DK3C 1NSNS 2ICEC 4G4KA 2HIVA 1HR0W 4BBSG 2B3GA 1TWAH 1R9TH 5EAYA 4LF4L 1FJGL 3K81C 4ID6A 3BDCA 3STBD 4K6DA 2A1AA 4U68A 3IRBA 3PSIA 4X64L 4PNYA 1XTDA 4FYDA 1SR3A 4R4TA 3J80L 5CV4A 2MJ8A 4LF5Q 1EY0A 1X3QA 1L1OA 2ID0A 1STBA 3S14H 3QOJA 4OWXB 5C3EH 1EWCA 4JI7Q 3TN2A 3UDXA 3HOZB 4JOIA 2ZTCA 3MXNA 1IYVA 4J8QA 5M3MH 1D8LA 1K3BC 5KGUA 1K8MA 4RG1A 1LV9A 4IPCA 4CBVA 3EN2A 4IUVA 1HNWQ 2R93G 1X32A 5I2YA 4MTNA 3K6OA 1B70B 4FF3A 3BDLA 2MO1A 1GO3E 1Z47A 4XQQA 2AKWB 3I7FA 3GV3A 1H9JA 4R4QA 1XNRL 3L3OC 2EY1A 2OQ0A 5C4XH 4A3EB 3D8GA 2Q2IA 4QUFA 2RCNA 3GTLB 4CJ2C 3S2HH 2PYKA 2OF1A 1TS5A 3A0JA 1SMXA 5IYDH 3JC66 4IZ8A 5GROA 1STNA 2F4VQ 1H9MA 5IWAQ 1EY7A 3K0YA 5BR8Q 4JI2L 4XIGS 3RLOA 2E5LQ 1ENFA 3OHXC 5IYDG 4DV3Q 1YNXA 2IPKD 4Y7NH 4ZRZA 4JI1Q 3ULPA 4B3RQ 2KECA 4DAYB 2XVSA 1E22A 4A3MH 4BBRB 3HOXB 4CDFC 1IBKL 1SNCA 1DOKA 2DJFC 2KHJA 4I7ZC 4J1MA 2Z6KA 5C5MA 5IT9L 1I3QH 1MJEA 1IBML 3HOVG 4GOPC 2H5XA 2EVBA 5BN5A 4IUTA 3H0GH 2IX3A 4U673 4Y7NB 4IOCA 2N78A 1NR4A 5EBCA 1ESFA 1JOOA 4HCEA 2RDFA 5CV5A 2Z6BA 2D0PA 2BH2A 3BVZA 5C0XH 4GS3A 2K03A 2F0PA 4HAEA 4CKBA 1V1QA 1L0YB 3HOWB 3D3RA 1PFMA 2R3ZA 2SDFA 1ESRA 1E3PA 2D5DA 3GD7A 3KBXA 2F3WA 2BE5D 5C6AA 2MGSA 1DYQA 1O7LA 3EA6A 5AJ3Q 1OXTA 4IO9A 2VQEQ 4NXMQ 5IGGA 3SXHA 4S3SA 2UUCL 4HJ9A 3GTQB 1E2VA 1HZCA 4A3BH 4HR7B 2B2VC 1Y1WG 4GNXC 2NN6G 3VA7A 1YBYA 2NVTH 1GUWA 3SR1A 4IJHA 4RCNA 3S1RH 3KLRA 4IQZA 3E9IA 1TWFH 2OEOA 1A2TA 2C35B 3K8AA 4EQNA 2DN8A 1KC8C 4A4IA 5C3XA 1C8CA 1GUSA 2SOBA 1XTCD 1CI3M 1PTOB 5LL6X 3HOUH 1Y8NB 2X6GA 4DV3L 2F0WA 3RN5A 1J5EQ 3HOWH 4P75A 3AU7A 4DNTB 4NB3A 3CCSA 5JAVA 3NTHA 3H0GG 3CMEA 3M4OH 5BN3A 3H09A 2XN9C 1B9NA 3BG3A 2PQEA 1A6XA 1ENCA 3PQIA 4LJZC 1SYGA 2NVYH 3HOWG 1S72A 1MSGA 3UDGA 5LHY1 1PZKD 4DR2Q 2EXZA 1ET6A 2ZTEA 4RA8A 1PH8A 1VQ5A 3NHHA 1XNRQ 1I94L 5EPKA 4IUQA 3BZCA 1D1IA 1QNKA 4MTKA 4N9TA 2VUMH 1EY4A 4GLXA 1CKMA 4C3JH 1WI5A 4B3MQ 3I4MG 1HNWL 2MP1A 4KHVA 1X9NA 2OWOA 3NENA 1S3OA 2Y0SB 2ZT9C 4FO2A 3IAYA 1QUQB 4A3BG 5IGCA 2QF7A 2VQFQ 4BY7H 2K50A 3FPPA 3UI2A 3PUZA 2VQFL 3S1NB 3BDOA 1UNSA 1X54A 1LO5D 2QW7A 1AW7A 3O13A 1N36L 2K32A 1D7QA 3MXPA 3M7NA 1JWMD 2R92B 4IUPA 4UP8A 4WORA 2AWNA 4I7AA 2E76C 1FJGQ 1ASZA 2HCIA 5LL6S 2L1BA 3OW2A 4LUOA 2UXBQ 2K5HA 3CCQA 5JEAJ 2A69D 4A3FH 3I91A 5HURA 4AYBB 1N33Q 1YHQA 5T1IA 3HRZC 1VQOA 3D0FA 1YVCA 3L9AX 4TQUS 1RKNA 2MHVA 2E75C 3I4NH 1I94Q 2QDLA 3D4RA 2L15A 4K2LA 4DR2L 4ZCKA 3J7A5 1O7IA 4TVAB 1K8AC 4JYAQ 4CDCC 4KD4A 5JJKA 3I4NG 3TP6A 2NVXB 1HUMA 2VZAA 2LY7A 1MGSA 4F7XA 1OTCA 3F2BA 3LGJA 3NWTA 4UY8C 5JJIA 1TT2A 1ICWA 2KEEA 3ICEA 3MFYA 3S17B 4DR7L 3GP7A 4DR7Q 5E4WC 2QDBA 4YHHQ 2RCFA 2F0LA 4A3GH 2Q8RE 3NP8A 2JXMB 1S4ZA 3HOUB 2R6GA 2R93H 4OWTB 5M5WH 2G9DA 3C1EA 4A3IB 4DR5L 1D2BA 3EJIA 4APVA 2GVAA 3H15A 3OW7A 4QUCA 2B8FA 1I4GA 1PFSA 1PDQA 2JK8A 1YNJD 1OXSC 1W6JA 2EQSA 3A7LA 2EZVA 2WKCA 2YTYA 4QGUA 2JE6I 3K59A 4A3BB 3VA5A 2QEXA 1Q8KA 3KLSA 3QJYA 4DU9A 5J3BA 1LM0A 4KN4C 3GTJH 1DXMA 1TXYA 2MO0A 3H6MA 1ICFB 5M9OA 2PNRC 3HOYG 3EROA 5CV7A 3DMUA 4DV4Q 4Z9CB 1PZJD 2F4IA 2F3VA 5KYLA 5GAHC 4P74A 4QIWE 4L6TB 2A73B 2KHIA 4X3TA 1EZ8A 2NVTB 3OSOA 1F2LA 4DV5Q 5CV8A 4B3TL 5C4JH 3RUZA 3AQQA 4HJ5A 4ZKCB 2NZOA 1WD0A 3M85A 1LTLA 1IBMQ 4DK0A 1YJNA 3MHBA 4NDXA 4GOPB 1U4PA 1C48A 2OQKA 1Q12A 2UUBL 4UHVA 2JA8G 1R4QB 3ZYYX 4LFBQ 2VY3A 1S5DD 2QGQA 1CA6A 1JQYD 1UAPA 1RDPD 1K0RA 2XIWA 4H02A 4R8IA 2DY8A 3FVQA 5D3DA 2AQ2B 4LF8L 3SEBA 1EQTA 1XJVA 4R9WA 4YWKA 1D6EC 5GADC 1VQIA 1MIUA 3MAQA 1YEZA 1A3VA 1LTAD 2JJQA 1AE3A 1E1OA 5JJLA 3TZUA 2MPMA 1NJIC 1YHAA 1V8QA 4OL7A 4DR1Q 1UE7A 4IJLA 3CKIB 4IURA 1FNVA 1LT3D 4MZ9A 1OXXK 3VYTA 3PO3B 3NK9A 1J5EL 2WB1E 2GA4B 4LF8Q 4RKLA 2B63G 1H9RA 1SXTA 4UP7A 4NKLA 2HQLA 5CORA 1DCZA 3FRPB 2H1EA 4A3FB 1LT6D 3ERQA 2WV6D 2VL6A 5DEHA 4HN7A 4TRDA 1I4RA 4DAPA 1BNZA 3S2DH 1SNQA 1SJHD 2A6ED 1DGSA 5AFWA 2EYFA 4I65A 3OMCA 5M3MB 3MC0B 5KYIA 3MFGA 3OWEB 2JA8H 2BA1A 3LX0A 2VQEL 5IGBA 2ZTDA 2K5QA 4HIOA 5FLXL 4OGQC 1PRTD 1E24A 1VQMA 3K7UC 1TWGH 1SE3A 3FDTA 3GQBA 1FGBD 1LT4D 4FNFA 4PMWA 3C3LA 1YI2A 1RTOA 3B6YA 5D14A 4JV5Q 3DXJC 3U9SA 1QILA 4X3SA 4DR3L 1BQQT 4HJ8A 5K36G 4XT3B 4PZ6A 2PW5A 3K5OA 4BS9A 2R92H 1BBWA 5EGTA 4PMCA 2Y0SE 3PF4A 1FNWA 1WFQA 3M3YH 4FF4A 4DK1A 1ML0D 3KF8B 3HOZH 4N8X1 5IODA 2AQ3B 2B2TC 1NMGA 2JA5G 3EVQA 1A3UA 4ME3A 1EQRA 3J81L 1NTGA 3M4YA 3TS2A 3J7ZC 1K28A 4EQPA 2IW3A 2I46A 3I4LA 4RHRA 1GOZA 5COYA 4CGYB 4IFDH 2JN4A 3R3OA 4EQOA 4DR6Q 2DJGC 1BUVT 1U4MA 5C44G 1XNQL 1UWVA 3EIVA 1WTVA 2CW0D 5G3LF 1QOHA 4IPDA 4LFCL 1I6HH 4JI2Q 3RR5A 2EYHA 4A3FG 4C3HH 5CBEE 5IWAL 1J8IA 1VQDA 1WOCA 1B2TA 1PRTF 4JBWA 2TSSA 4DNIA 2JEAI 2XRSD 5KEEA 2OT2A 1PH3A 2K5VA 3PO2H 4KTAA 2WKDA 1EFWA 2PZTA 1SE4A 3OPOA 2ZM6L 3J7AV 1CA5A 4JI0Q 3LWEA 3FKIB 1LTID 2A6HC 3J80E 2PW7A 2Q8IB 4OHJA 2CFMA 1S5BD 2HIXA 4BWGB 4XT1B 2FFKB 4MIUA 2VW9A 2E2IH 4FP5D 4JBKA 3PO2B 4QQBX 3N6RA 4ABNA 2F52A 2G9HD 2KQ3A 3OIQA 3VYSA 2K28A 4GN5A 1I6VC 5HGTA 1TWCH 3IFDA 3OTOQ 1NUCA 5FK9C 1O7YA 1B3QA 2HD3A 3UE1A 1W3SA 4QY7A 1VQ8A 2F3IA 4JI3Q 4A3JG 1A63A 4KD3A 1CHQD 4KKSA 2E2HB 3HOXG 4X64Q 4FDBA 3Q23A 1G6ZA 3ERSX 2K7VA 4TKOB 2JYOA 1OXUA 1X3FA 3PUYA 3IFTA 2BDNA 2K6AA 4B3ML 3TP8A 1IHZA 2JA6G 1PZID 1LUZA 2MNAA 3HOXH 3R93A 4DAMA 1TS2A 1WTRA 1HNXL 1CFMA 5E4XA 4BBRH 4A93G 1X6OA 4IUNA 4O42A 1C7YA 4GKKL 2A19A 2KBNA 3E3XA 1NE3A 1SLJA 5I9PA 5EKLA 5A2QE 4B9XA 4LF7Q 2JA6H 4JI0L 1XPRA 1QCBD 2WAQB 3CF5A 3S1MB 1WYDA 5CBAE 1OXVA 2RSNA 4DXGA 1VQ4A 1U4LA 4K14A 4BBSB 1I4QA 2EJFC 1WTOA 2I5MX 4QL5A 5JOBA 2SNMA 1CSQA 1XX8A 4JI5Q 1O80A 1BDOA 2WP8J 3W1BA 3BS1A 3ND9A 2WACA 3TP5A 3T1YL 2E2HH 2RA4A 1XNQQ 3J80c 1IW7C 4IUUA 1E1TA 2QA4A 1PMRA 1HFNA 5EKKA 5EKIA 2WB1G 3MZ5A 5CGKA 4IPGA 4QB4A 2JA8B 3J81i 1RODA 2F0GA 4NXNQ 2UXCL 2IWHA 3S1NH
chains in the Genus database with same CATH topology
5CV6A 4F8MA 1D5ZC 4KKTA 1T5XD 3S2HB 3PIO3 3D31A 2NYZD 4ZUIA 2WB1B 1TS4A 5IGFA 3RLFA 2F0SA 5CMDA 3RMHA 2SNSA 3TMEA 1STYA 3R2TA 4DA2A 5C0XJ 1TWAB 1Z6HA 4V0BA 4OO1G 4Q5VA 2E2JB 1V1OA 1Q1EA 1I6HB 4LAAA 3BZDB 3OWFA 4JK1C 5JVG3 3ONAB 1VMPA 2NVYB 2F0DA 2JA7B 1G8ZD 5M5XB 1HFGA 4FXKC 4BA2I 1Z7TA 2R7ZB 4IFDJ 4EVOA 3FEWX 1QG7A 2O4XA 2EJGC 4RKBA 1HA6A 2B2VA 4RFBA 1RHPA 2RVLA 3VYRA 4K6LA 5C3WA 1HXYD 4GZYC 1BCPF 1JR0D 2F0NA 4H0LC 2QKIC 1EWHA 1IKLA 4B08A 3E6ZX 1EIHA 3NTIA 1S5FD 5JPNC 1WCMB 1SYDA 3S9WA 2N55A 4KY6A 1ILPA 4CKEA 1C4QA 1PTOF 3HOVB 4K5WA 2A74C 1EY6A 2CHBD 3S1RB 3NQTA 1SAPA 4V190 1QB5D 1K83B 4IFDG 2BDOA 1JICA 1VF5C 3W3AA 5A2QL 1PTOD 1LLRD 2A68D 3DEOA 1L0XB 5ELDA 2EOTA 4XQNA 3D6WA 3I8ZA 4A3GB 3KK7A 3TZDA 1LTTD 3P20A 1BO0A 1O7ZA 1SFOB 4C56C 1SYBA 3K5MA 4M8AA 5TSSA 1A3TA 3G6JB 1KDCA 3DWAA 1PLFA 2Z8LA 1IL8A 4DXFA 2B2UA 1Q90A 3K58A 1PFBA 3MXUA 3E0JA 5F2DA 4G7HC 2NB0A 3J7YW 4L63B 4PQXA 4A3MB 1STAA 1GHKA 5FLXE 1J9OA 2KEDA 1EU3A 1XXGA 1TY0A 2IX1A 1LTRD 1EFID 3I4MB 3V2TA 5IT9E 1RF2D 3I3CA 2KCNA 4QMGA 1GJXA 1G291 2WINB 1YNJC 4ULLA 1WVLA 1O78A 1HQRD 3QWNA 1EY9A 2BE5C 4KHZA 1DM0B 5J22A 3AB9A 2A5HA 1XYIA 1CQFA 4A93B 2EY5A 1HQMC 1LACA 3GTPB 3C2PA 1YNNC 2NVQB 4UDUC 4BA1I 3DHQA 2F03A 2K5DA 3Q24A 1FR3A 3F2UA 3OMGA 2NBFA 2O2LD 3HS0C 1EEID 3SK6A 1BR9A 5M5WB 4O1NA 2F1MA 1V43A 4FXGC 1ZXTA 2E2DC 3IKJA 1LT5D 1STGA 2F0KA 1IYUA 3P7JA 2HDLA 5DM73 2Z1CA 4KI0A 4OIKA 3T56B 2XNAC 4P2CB 5CV9A 3S2DB 1A2UA 2YYZA 3PMFA 2D62A 1VCIA 1BF4A 2Q8TA 2A69C 3S1QB 2B2YC 5DAUA 3SK8A 1B9MA 3C1FA 4X3KA 3GTMB 3BYTB 1TWGB 1STHA 1M8AA 1ZEQX 3CHBD 1ZYRD 1BBXC 1GUNA 2NTTA 3R8BA 4DF7A 5ELCA 5A35A 2EDGA 2DNEA 1UEAB 1BCPD 2AUKA 1SSOA 3LNNA 1F2MA 2M9VA 2A68C 2EYJA 3GV6A 1D1KA 3L7ZC 4C1NK 3DEPA 1T5EA 1TU2B 2JA5B 3DWPA 1JWUD 3MTSA 3N52A 3KBGA 4LK1C 5KNCA 4DAVA 1JE4A 2J4XA 1TQOA 2NUCA 2B2TA 1G2SA 3QO2A 2OXPA 2Z4HA 2JA6B 4OO1I 5DM63 1HTLD 3X3NA 1EYAA 4HSVA 3T53B 2L9HA 1JB3A 1SBBB 2RDGA 1ENAA 2F0UA 3PV0A 4NW2A 1HUNA 3QG1A 2DNCA 5T1GA 3I73A 3SHLA 1JORA 3H91A 1TWFB 2WIIB 5KNDA 3JAML 1CQVA 4K5VA 4HEDA 1TKWB 4FVMA 4G7OC 2NWGA 5C4JB 4QCLA 2KVMA 1H9KA 2F0MA 1HTPA 4RAUC 3EFXD 1DOLA 5M5YB 4A3JB 1DD2A 2EY2A 2X6LA 3CRLC 4EGVA 4KMUC 4FXDA 4H13C 1WTWA 1SJED 1TS3A 1S5ED 5EJWA 1I4XA 1DJRD 2N88A 1K8OA 3R2IA 2IT1A 5C44B 1TVXA 4RGNA 2B2WA 3D6CA 3SK5A 3HP3A 3VR5A 4WJWA 1DONA 2PO4A 2JP1A 4DGZA 1NCVA 1SNPA 4C3JG 1RD9D 3SVMA 2L5TA 3KLSX 4ZQ3A 5I6WA 1QNUA 5I6YA 2BCOA 2KUMA 1HRJA 1EYCA 2QILA 2M00A 5EQ0A 1KABA 1Q3LA 4ZUJA 1KNAA 3LWUA 5I9OA 1KLGD 4KKUA 2ENBA 5CC4A 3K7AB 2F0FA 2IL8A 3MXGA 2NN6H 1YNND 2KA7A 1FD7D 4ZK9B 1LTBD 3U9OA 3NQIA 2B63B 4RCOA 2B39A 2X69A 3T51B 3NWSA 4C3IG 4ZKBB 4MN3A 4CKCA 1GHJA 4FF1A 2VNUD 4KY5A 4ZLTF 2H4OA 2B2UC 1X3PA 3BVMA 1ONLA 3MEHA 3PIP3 4C2MB 3WOFA 3HG9A 3X3MA 1S5CD 2JSOA 3P1HA 2HQEA 1FNUA 2ICIA 2XRQD 3CU7A 3I70A 2PPBC 1HCZA 4XDXA 4PV1C 2PMZB 2F0IA 1E2ZA 4F88A 3G7LA 1AEXA 3EQLC 3DM1A 5G3LD 2F0HA 2O5IC 3QIAA 5JPMC 2CQAA 5FKAC 2IJ0A 1H9SA 4C3JB 1DOMA 1EY8A 3ITPA 1F9RA 2EYMA 4RGTA 1GUTA 1NR2A 5FO9B 1II3A 1SMYC 2PZWA 4KN7C 1XWEA 4KK7A 3SK4A 5JEAG 5IOCA 1IKMA 3WDNA 2L11A 1NAPA 1CHPD 2L0CA 3GTGB 2PZUA 2F0VA 3BVGA 4YIJA 5JEAH 1BOSA 2E2IB 1TR5A 2J7ZA 5EPLA 1B53A 1ILQA 1F77A 4QF4A 5IGEA 4N9PA 2ZXPA 3VR4A 2KOLA 3K57A 5D65A 2AUJD 3DWQA 2MUYA 1AP0A 1BXTA 1I50B 1OO9B 2KJXA 2YU9B 4HCSA 1MI2A 5CR3A 3A8KE 4L8JA 3K5NA 4B9WA 1CM9A 2K5WA 2EYOA 3SE0A 2F0EA 2F0JA 5ELBA 2I07B 1G91A 1RTNA 4CJ1B 1RCVD 5C0XG 2J0TD 3WOEA 1SDFA 2K05A 1EY5A 1SE2A 5IGDA 5I2XA 1SNDA 4CHTB 3M3YB 3JAME 1I3QB 2L4NA 4ILWA 1KLUD 4ZYSA 1SMYD 2XSCA 4H7BA 1PRTC 4DFAA 2C5CA 2R61A 5C4XB 3VR2A 1B4OA 1BCPC 4XYOA 2XWBB 1H9SB 5E3FA 2BA0A 1ET9A 3ND8A 2A6EC 1EZ6A 4MHEA 4FF2A 4G57A 3MVVA 3OIPA 4RH6A 1QJOA 2NN6I 2C9OA 4BY7B 4C3HG 2VB3X 5C3EB 1I4PA 1WTXA 3W2DA 3Q22A 3BYYB 5C5LA 5K36H 4XYQA 2K33A 2D9UA 3V96A 2K1BA 1LABA 5J1ZA 4DNRB 3KUPA 5D3IB 1D5XC 4XTCS 3E5SA 2AQ1B 2VUMB 4NMZA 1EQVA 4XQJA 2ZXRA 3TDQA 3URYA 3J81E 1PFNA 4KJOA 5FO7B 2FINB 1CK1A 2V4DA 3S15B 3HKZB 4KY7A 4HTHA 1PTOH 1AZPA 1I4HA 1R9TB 5NUCA 3A54A 5EBDA 1GXDC 1SYCA 3RZOB 2HDMA 5FO8B 2CW0C 2EE1A 2RQXA 1VMCA 5C4ZA 1KAAA 4C3IB 1CT1D 2LKVA 3M4OB 3NUCA 4RGMA 2HCCA 2XWJB 3RD4A 4WRDA 1W6KA 3CRKC 1ZYRC 1JC7A 5M3FB 2O5JC 1A15A 2IX0A 1TIID 1CZWA 4IN3A 4TSSA 4E6IA 2RSOA 1FYCA 2FJ2A 5KNBA 1B3AA 1BCPB 3QOLA 4Q0FA 4ODGA 5CYUA 1IW7D 1SEBD 5FOBB 3H0GB 3I90A 4XXEA 1PYWD 1KDBA 3GO5A 2KCCA 3NE5B 1LTSD 2AWOA 1AFPA 3HOYB 3TSSA 3NBIA 5C4HA 3DUZA 4PMBA 4H44C 2RBMA 5ELEA 3T4AC 3NXWA 1TY2A 1LTGD 5E1FA 2VXWA 2LFNA 1GUOA 2F0QA 3NSWA 4WFN3 3C46A 2R93B 5IIFA 2KHSA 1EL0A 1Q1BA 5KRUA 1F9SA 2FHTA 2FMCA 1Y8OB 3NPPA 3HEJA 1F2YA 4NP5A 4F87A 1WTQA 2DY7A 1CTMA 1RJTA 2BOSA 1SYEA 1F9QA 3GTKB 1R4PB 1TWCB 4RGOS 3D4WA 2B8GA 2EJMA 3Q0AA 3TBIB 1MBYA 1SYFA 1U4RA 4G7ZC 1EYDA 3D4DA 4KV6A 4M1UB 2EPBA 4HSPA 3I72A 4OO1H 1STEA 3FMCA 3Q6SA 3HGBA 2D2CC 2RDHA 1PTOC 2K01A 1EIGA 2K04A 4X3UA 3GTOB 2Z4IA 4R8NA 2M2LA 2F0TA 1F9PA 3S14B 3MWYW 1WD1A 4C1NI 4K8JA 2F0OA 1AZQA 5I4DA 4BY1B 5JJZA 3A55A 4CJ0B 3VR6A 5C0XI 3A8IE 1GUGA 3IL8A 5J39A 3QB3A 3MA2B 4LMQD 2NZ1D 3A7AB 1B44D 1VF7A 3J7AF 2L55A 1V1PA 2E74C 2NTSA 2EYLA 1F2ZA 2JEBI 3HZXA 5JVH3 3K5LA 4IFDI 1EOTA 4A3DB 3PUWA 4ME5A 1DZ1A 3A8JE 2B2YA 2LS01 2TMPA 5DNFA 2L12A 1E2WA 3NTKA 5KIXA 5EPJA 4KJNA 1JCKB 1M4VA 1E0BA 3GTJB 1HA5A 1JOKA 3A56A 4OIJA 1TWHB 3H3VC 1MD2D 1B1ZA 1UUPA 1HHVA 4RWSC 3AMUA 3TP7A 4J6HA 1MSHA 2LMCB 3SDZA 4DN4M 2VB2X 2EY6A 4IALA 1U9RA 5BN4A 1SNOA 2QEJC 4K8IA 2CVRA 1V1PB 1QWYA 1B50A 1JWSD 3NBHA 3PUVA 4UAIA 4RHSA 3V05A 3KF8A 3T13A 1QE6A 3PUXA 2RKSA 2HUGA 3T16A 4HMIA 1HPCA 1CZGA 1Y1VB 1Q8IA 1KTKA 3I4NB 3CQZB 4QIWB 4HMJA 2ZXOA 1KNEA 2A6HD 3H94A 3P75A 3M7GA 5K5PA 4K5XA 4A3KB 1PXUA 1EU4A 1SNMA 2EYPA 1G2TA 1KDAA 2PCFB 3VR3A 1PRTB 1VDZA 2QCPX 1Y69U 4C3HB 5ELFA 1AN8A 4DAYA 2SEBD 3RZDB 3S16B 1EEFD 1JOQA 1Y1WB 1Y8PB 1ZKOA 2B2WC 1WTPA 2FMMA 3VYUA 3OOCA 1D5MC 3FPUB 5ISRA 4ZAIA 4K2KA 1NSNS 2ICEC 4G4KA 4ID6A 3BDCA 4K6DA 4U68A 4PNYA 4FYDA 3J80L 5CV4A 2MJ8A 1EY0A 1X3QA 2ID0A 1STBA 3QOJA 1EWCA 3TN2A 3HOZB 3MXNA 1IYVA 4J8QA 5KGUA 1K8MA 1LV9A 4CBVA 4IUVA 1X32A 5I2YA 3K6OA 4FF3A 3BDLA 1Z47A 4XQQA 3GV3A 1H9JA 3L3OC 2EY1A 4A3EB 3D8GA 4QUFA 3GTLB 4CJ2C 2PYKA 2OF1A 1TS5A 4IZ8A 1STNA 1H9MA 1EY7A 3K0YA 4XIGS 1ENFA 3OHXC 2IPKD 4ZRZA 2KECA 2XVSA 4BBRB 3HOXB 1SNCA 1DOKA 4I7ZC 4J1MA 5C5MA 5IT9L 4Y7NB 5BN5A 2EVBA 4IUTA 4U673 2IX3A 1NR4A 5EBCA 1ESFA 1JOOA 4HCEA 2RDFA 5CV5A 3BVZA 5C0XH 2K03A 2F0PA 4HAEA 4CKBA 1L0YB 3HOWB 3D3RA 1PFMA 2R3ZA 2SDFA 1ESRA 2D5DA 3GD7A 3KBXA 2F3WA 2BE5D 5C6AA 2MGSA 1DYQA 1O7LA 3EA6A 1OXTA 5IGGA 3SXHA 4S3SA 3GTQB 1E2VA 4HR7B 2B2VC 2NN6G 3VA7A 1GUWA 3SR1A 4RCNA 3KLRA 4IQZA 2OEOA 1A2TA 4EQNA 2DN8A 1C8CA 5C3XA 1GUSA 2SOBA 1XTCD 1CI3M 1PTOB 5LL6X 1Y8NB 2X6GA 2F0WA 3AU7A 4DNTB 5JAVA 3NTHA 5BN3A 3H09A 2XN9C 1B9NA 3BG3A 2PQEA 1A6XA 1ENCA 1SYGA 4LJZC 1MSGA 5LHY1 1PZKD 2EXZA 1ET6A 4RA8A 3NHHA 5EPKA 4IUQA 1D1IA 1QNKA 4N9TA 1EY4A 2MP1A 4KHVA 2Y0SB 2ZT9C 4FO2A 3IAYA 5IGCA 2QF7A 3FPPA 3UI2A 3PUZA 3S1NB 3BDOA 1UNSA 1LO5D 3O13A 1AW7A 2K32A 3MXPA 3M7NA 1JWMD 2R92B 4IUPA 4WORA 2AWNA 2E76C 2HCIA 5LL6S 2L1BA 5JEAJ 2A69D 3I91A 5HURA 4AYBB 5T1IA 3HRZC 3L9AX 4TQUS 1RKNA 2MHVA 2E75C 3D4RA 4K2LA 4KD4A 3TP6A 2NVXB 1HUMA 2LY7A 1MGSA 4F7XA 3NWTA 1TT2A 1ICWA 2KEEA 3MFYA 3S17B 3GP7A 5E4WC 2QDBA 2F0LA 2Q8RE 3NP8A 2JXMB 1S4ZA 3HOUB 2R6GA 2G9DA 3C1EA 4A3IB 1D2BA 3EJIA 3OW7A 4QUCA 2B8FA 1I4GA 1PDQA 1YNJD 1OXSC 1W6JA 3A7LA 2EZVA 2WKCA 2JE6I 3K59A 4A3BB 3VA5A 3KLSA 3QJYA 4DU9A 4KN4C 1DXMA 3H6MA 5M9OA 2PNRC 3EROA 5CV7A 3DMUA 4Z9CB 1PZJD 2F4IA 2F3VA 5KYLA 4L6TB 2A73B 4X3TA 1EZ8A 2NVTB 3OSOA 1F2LA 5CV8A 3RUZA 4ZKCB 1WD0A 3M85A 4DK0A 3MHBA 4NDXA 1U4PA 1C48A 1Q12A 1R4QB 3ZYYX 1S5DD 1CA6A 1JQYD 1UAPA 1RDPD 2XIWA 4R8IA 2DY8A 3FVQA 5D3DA 2AQ2B 3SEBA 1EQTA 4R9WA 1D6EC 3MAQA 1A3VA 1LTAD 3TZUA 2MPMA 1V8QA 4OL7A 3CKIB 4IURA 1FNVA 1LT3D 1OXXK 3VYTA 3PO3B 3NK9A 2GA4B 4RKLA 1SXTA 1H9RA 4NKLA 5CORA 1DCZA 3FRPB 2H1EA 4A3FB 1LT6D 3ERQA 2WV6D 5DEHA 4HN7A 4TRDA 1I4RA 4DAPA 1BNZA 1SNQA 1SJHD 2A6ED 5AFWA 2EYFA 4I65A 3OMCA 5M3MB 3MC0B 5KYIA 3MFGA 3OWEB 2BA1A 3LX0A 5IGBA 2K5QA 5FLXL 4OGQC 1PRTD 1SE3A 3FDTA 3GQBA 1FGBD 1LT4D 4FNFA 4PMWA 3C3LA 1RTOA 5D14A 3DXJC 3U9SA 1QILA 4X3SA 1BQQT 5K36G 4XT3B 2PW5A 3K5OA 4BS9A 5EGTA 4PMCA 1FNWA 4FF4A 4DK1A 1ML0D 5IODA 2AQ3B 2B2TC 3EVQA 1A3UA 3J81L 3M4YA 4EQPA 2IW3A 2I46A 3I4LA 4RHRA 1GOZA 5COYA 4CGYB 4IFDH 3R3OA 4EQOA 1BUVT 1U4MA 1WTVA 2CW0D 5G3LF 1QOHA 2EYHA 5CBEE 1J8IA 1B2TA 1PRTF 4JBWA 2TSSA 2JEAI 2XRSD 5KEEA 2OT2A 4KTAA 2WKDA 2PZTA 1SE4A 3OPOA 3J7AV 1CA5A 3LWEA 3FKIB 1LTID 2A6HC 3J80E 2PW7A 2Q8IB 4OHJA 1S5BD 4BWGB 4XT1B 2FFKB 4MIUA 4FP5D 3PO2B 3N6RA 4ABNA 2G9HD 2KQ3A 3OIQA 3VYSA 2K28A 1I6VC 5HGTA 3IFDA 1NUCA 5FK9C 1O7YA 4KD3A 1CHQD 4KKSA 2E2HB 3Q23A 1G6ZA 2K7VA 4TKOB 2JYOA 1OXUA 3PUYA 3IFTA 2BDNA 2K6AA 3TP8A 1IHZA 1PZID 3R93A 1WTRA 1TS2A 1CFMA 5E4XA 4IUNA 4O42A 5I9PA 5A2QE 5EKLA 4B9XA 1QCBD 2WAQB 3S1MB 5CBAE 1OXVA 2RSNA 4DXGA 1U4LA 4K14A 4BBSB 1I4QA 2EJFC 1WTOA 5JOBA 2SNMA 1XX8A 1O80A 1BDOA 2WP8J 3BS1A 3ND9A 2WACA 3TP5A 2RA4A 1IW7C 4IUUA 1PMRA 1HFNA 5EKKA 5EKIA 3MZ5A 5CGKA 4QB4A 2JA8B 1RODA 2F0GA 2IWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H1E A;  1XYI A;  1B4O A;  3GV6 A;  4RA8 A;  4OIJ A;  1PDQ A;  2B2W C;  2HCC A;  5EPK A;  1CA5 A;  3SVM A;  3LWE A;  1U4R A;  4IUQ A;  1HHV A;  4RWS C;  1DOK A;  1WTP A;  1QNK A;  2FMM A;  2NYZ D;  2KUM A;  1JIC A;  3DEP A;  1BNZ A;  1IKM A;  1HRJ A;  5EQ0 A;  1MSH A;  3FPU B;  2L11 A;  1A15 A;  4MHE A;  1NAP A;  3MTS A;  2FFK B;  3N52 A;  1Q3L A;  4XT1 B;  5AFW A;  4ZAI A;  1KNA A;  2MP1 A;  1JE4 A;  2EPB A;  3DEO A;  3F2U A;  4IUT A;  2K28 A;  2B2T A;  2J7Z A;  2RSO A;  5EPL A;  1G2S A;  2FJ2 A;  1B53 A;  3IFD A;  3Q6S A;  2EOT A;  3QO2 A;  1NR4 A;  1B3A A;  5CMD A;  1ILQ A;  2IL8 A;  3D6W A;  3I8Z A;  1WTX A;  1O7Y A;  2K01 A;  1EIG A;  2K04 A;  3TZD A;  3FDT A;  4X3U A;  1BO0 A;  1O7Z A;  2KOL A;  2CVR A;  4HSV A;  4U68 A;  4ZK9 B;  3I90 A;  3UI2 A;  2D9U A;  2L9H A;  2K1B A;  5D65 A;  2M2L A;  1RTO A;  1F9P A;  2K03 A;  1B50 A;  4HAE A;  3MWY W;  5D14 A;  1WD1 A;  4X3T A;  3KUP A;  1F2L A;  4UAI A;  2X69 A;  1ZXT A;  4X3S A;  3ONA B;  2MJ8 A;  4QUC A;  1PFM A;  2R3Z A;  1VMP A;  2SDF A;  4NW2 A;  1AZQ A;  4IUP A;  1G6Z A;  1ESR A;  4XT3 B;  2JYO A;  4MN3 A;  4ZKB B;  1AP0 A;  1HUN A;  3KBX A;  4ZKC B;  1QE6 A;  1WD0 A;  1X3Q A;  5T1G A;  5JJZ A;  1HFG A;  2HCI A;  2HUG A;  2BDN A;  2L1B A;  2MGS A;  3P7J A;  3H91 A;  2HDL A;  4CJ0 B;  1PLF A;  1U4P A;  1IL8 A;  4HCS A;  3TN2 A;  1MI2 A;  1ML0 D;  3R93 A;  2B2U A;  1WTR A;  3IL8 A;  5E4X A;  4ZLT F;  3I91 A;  4LMQ D;  2B2U C;  1X3P A;  2NZ1 D;  4O42 A;  4OIK A;  5T1I A;  1CM9 A;  1LV9 A;  1PFN A;  1QG7 A;  4HED A;  1PFB A;  2B2T C;  4IUV A;  1X32 A;  1KNE A;  1HA6 A;  2B2V A;  2NWG A;  2FIN B;  1RHP A;  2KVM A;  2RVL A;  2B2V C;  1CA6 A;  4XDX A;  5CBA E;  1BF4 A;  2XIW A;  2RSN A;  2Q8T A;  1U4L A;  1GUW A;  4R8I A;  2DY8 A;  4RAU C;  3GV3 A;  1WTO A;  2B2Y C;  1RTN A;  1G91 A;  1G2T A;  1J9O A;  2VXW A;  1DOL A;  4CJ1 B;  1EQT A;  5COY A;  4R9W A;  1HUM A;  1XX8 A;  2KED A;  4X3K A;  3G7L A;  1MGS A;  1O80 A;  1EL0 A;  1U4M A;  3DM1 A;  2X6L A;  1M8A A;  1AZP A;  1C8C A;  1EOT A;  4QUF A;  1IKL A;  4CJ2 C;  1SDF A;  1F9S A;  1BBX C;  1WTW A;  1DZ1 A;  2FHT A;  1EIH A;  2K05 A;  2X6G A;  1WTV A;  1ICW A;  2B2Y A;  2MPM A;  2KEE A;  5DNF A;  2HDM A;  2L12 A;  2N55 A;  5EJW A;  3I3C A;  1ILP A;  2RA4 A;  2EE1 A;  2N88 A;  4IUU A;  5CBE E;  1J8I A;  4IUR A;  5E4W C;  2L4N A;  5EPJ A;  1TVX A;  1B2T A;  1VMC A;  1DOM A;  2Q8R E;  5EKI A;  1WTQ A;  2B2W A;  1HFN A;  1F9R A;  2DY7 A;  4DN4 M;  1S4Z A;  1RJT A;  1WVL A;  3HP3 A;  1ROD A;  1DON A;  1SSO A;  2JP1 A;  1MSG A;  1F9Q A;  1E0B A;  1NCV A;  2KEC A;  5COR A;  1NR2 A;  1SAP A; 
#chains in the Genus database with same CATH topology
 5CV6 A;  4AYB G;  4F8M A;  1D5Z C;  4KKT A;  1T5X D;  4DV6 L;  3FHW A;  3S2H B;  3PIO 3;  3D31 A;  1HNZ Q;  2NYZ D;  2BH8 A;  5M3F H;  4NXM L;  4ZUI A;  3HKZ G;  2WB1 B;  3CC7 A;  3OYY A;  1TS4 A;  5IGF A;  3RLF A;  4JG2 A;  1CSP A;  4A3E G;  4A3K G;  2F0S A;  3AFP A;  2ASB A;  5CMD A;  2UXB L;  3RMH A;  2SNS A;  3TME A;  1STY A;  3R2T A;  5HY6 A;  2UUA L;  4A3D H;  4DA2 A;  5C0X J;  1KRS A;  1TWA B;  1Z6H A;  4V0B A;  3H3V I;  4OO1 G;  4HIK A;  4Q5V A;  2B63 H;  3EBE A;  4YWL A;  2E2J B;  1V1O A;  3ER0 A;  1Q1E A;  1I6H B;  4AQY L;  4LAA A;  3BZD B;  3OWF A;  1N36 Q;  3J81 c;  4JK1 C;  5JVG 3;  2NVQ H;  3ONA B;  1EYG A;  1VMP A;  2NVY B;  2F0D A;  3A5Z B;  2JA7 B;  1G8Z D;  5M5X B;  1HFG A;  4FXK C;  1VQ9 A;  4BA2 I;  1Z7T A;  1Y1W H;  2R7Z B;  4IFD J;  4EVO A;  3FEW X;  1QG7 A;  2O4X A;  2EJG C;  4RKB A;  1HA6 A;  2UU9 L;  2B2V A;  4RFB A;  1RHP A;  2RVL A;  3VYR A;  4K6L A;  5C3W A;  3K0X A;  1K0S A;  1VQC A;  1HXY D;  3PIP A;  4AH6 A;  2DGY A;  4GZY C;  1C0A A;  1BCP F;  1JR0 D;  2F0N A;  3HOU G;  3T1H L;  4H0L C;  2E2J H;  4GKJ Q;  2QKI C;  1VS0 A;  4J15 A;  5M3F G;  3TRE A;  1EWH A;  1IKL A;  4N8F A;  4B08 A;  1JT8 A;  2VS1 A;  2HHH Q;  3E6Z X;  1EIH A;  3NTI A;  3KFU A;  1S5F D;  2OCE A;  5JPN C;  1WCM B;  1SYD A;  3S9W A;  2N55 A;  4DUZ L;  4KY6 A;  1ILP A;  4CKE A;  4A3K H;  1V9P A;  3HOZ G;  4GKJ L;  1H95 A;  1C4Q A;  1PTO F;  3HOV B;  4K5W A;  2A74 C;  2AHO B;  1EY6 A;  1P8L A;  2CHB D;  3S1R B;  4X65 Q;  2VUM G;  1EUJ A;  4LW1 A;  3NQT A;  1SAP A;  3BZK A;  4V19 0;  3ZJY C;  1L2F A;  4GLA C;  1K8G A;  4A3C G;  1KQS A;  1QB5 D;  3I4M H;  1K83 B;  4IFD G;  2BDO A;  1N34 L;  1JIC A;  1VF5 C;  2UUB Q;  3W3A A;  5A2Q L;  1PTO D;  1LLR D;  2A68 D;  2UUC Q;  2WFW A;  2KCM A;  3DEO A;  1L0X B;  5ELD A;  4B3T Q;  1BKB A;  2EOT A;  5AJ3 L;  4XQN A;  3D6W A;  3I8Z A;  4A3G B;  3KK7 A;  3UDI A;  3CQZ H;  3TZD A;  1LTT D;  3P20 A;  3G71 A;  1K9M C;  1BO0 A;  1O7Z A;  1SFO B;  4C56 C;  1N32 L;  1SYB A;  3K5M A;  4M8A A;  1IZ6 A;  2Y0S G;  5TSS A;  3S1M H;  1A3T A;  3G6J B;  3CP0 A;  2HT1 A;  1YIJ A;  1UE6 A;  1RL2 A;  5E7N A;  4YY3 L;  1KDC A;  3DWA A;  1PLF A;  2Z8L A;  1IL8 A;  2E8G A;  4R1J A;  4DXF A;  3CCL A;  2B2U A;  5IP9 H;  1Q90 A;  2R92 G;  3K58 A;  1PFB A;  3MXU A;  3E0J A;  1PH2 A;  5F2D A;  4G7H C;  1ASY A;  2NB0 A;  3J7Y W;  4L63 B;  4PQX A;  3I56 A;  3M9B A;  1PH9 A;  4A3M B;  1STA A;  1GHK A;  4X62 Q;  1QUQ A;  5FLX E;  1J9O A;  1IBK Q;  2KED A;  1EU3 A;  3FP9 A;  1XXG A;  1TY0 A;  1HR0 Q;  1PA6 A;  2IX1 A;  1LTR D;  2CH4 W;  1EFI D;  4JI1 L;  4LFA L;  5IYB G;  1K83 H;  3I4M B;  2IHF A;  1L0W A;  3V2T A;  5IT9 E;  2CKZ B;  1RF2 D;  3I3C A;  2KCN A;  4A75 A;  1E7Z A;  4O0A A;  4QMG A;  1GJX A;  1G29 1;  3CAM A;  3GTL H;  2F4V L;  2WIN B;  1YNJ C;  4ULL A;  1Q81 C;  1WVL A;  1O78 A;  2RF4 A;  2GN5 A;  1HQR D;  3QWN A;  1KHI A;  1EY9 A;  2BE5 C;  4KHZ A;  1DM0 B;  1YJW A;  1HR0 L;  5J22 A;  3AB9 A;  2A5H A;  1XYI A;  1CQF A;  4DV2 L;  4A93 B;  2EY5 A;  1HQM C;  1GKH A;  1LAC A;  4BXX H;  3GTP B;  1NMF A;  3C2P A;  1HNX Q;  1YNN C;  2NVQ B;  4UDU C;  4BA1 I;  3DHQ A;  1RIP A;  2F03 A;  2K5D A;  3Q24 A;  1FR3 A;  3F2U A;  3OMG A;  2I5H A;  2NBF A;  3CCU A;  4A76 A;  2O2L D;  4JI7 L;  3HS0 C;  1EEI D;  2Z6K C;  4YY3 Q;  3SK6 A;  1BR9 A;  5M5W B;  4POG A;  4OX9 L;  4O1N A;  2F1M A;  1CUK A;  1V43 A;  4FXG C;  5GQO A;  3CD6 A;  3S15 H;  1ZXT A;  2E2D C;  1HZA A;  5M3M G;  1IBL L;  3IKJ A;  1LT5 D;  1STG A;  2F0K A;  4LF4 Q;  1IYU A;  3P7J A;  2HDL A;  3U58 A;  5DM7 3;  3FKI G;  4L5Q A;  2Z1C A;  4KI0 A;  4OIK A;  3T56 B;  2KCT A;  2XNA C;  1MJC A;  4P2C B;  2B29 A;  1QZH A;  5CV9 A;  2UXD Q;  3S2D B;  1A2U A;  2YYZ A;  2YTX A;  3PMF A;  2D62 A;  3I4O A;  1VCI A;  1BF4 A;  2D0O A;  1PH7 A;  1N34 Q;  2Q8T A;  2A69 C;  3S1Q B;  2B2Y C;  3VDY A;  5DAU A;  3E0E A;  3PF5 A;  1X3E A;  3SK8 A;  3QR8 A;  1B9M A;  3C1F A;  4X3K A;  3GTM B;  3BYT B;  1TWG B;  1STH A;  4YCU A;  5IP7 H;  1M8A A;  1ZEQ X;  3CHB D;  4JBM A;  2CQO A;  1T9H A;  1ZYR D;  1BBX C;  1GUN A;  2NTT A;  3R8B A;  1Q82 C;  4DF7 A;  5C4X G;  5ELC A;  5ELO A;  5IP7 G;  4BBS H;  4B3S L;  5A35 A;  3RLN A;  2EDG A;  4LF9 Q;  4YCV A;  2DNE A;  4X66 Q;  4DUZ Q;  1UEA B;  1BCP D;  1A8V A;  1L1O C;  2AUK A;  2PI2 E;  1SSO A;  4GN4 B;  3K7A H;  3LNN A;  1L1O B;  1GD7 A;  1F2M A;  2M9V A;  3UE0 A;  2A68 C;  2EYJ A;  3GV6 A;  1GM5 A;  3KJP A;  1SFO H;  2Q2H A;  1D1K A;  1QZG A;  4JVZ A;  3L7Z C;  4C1N K;  2KEN A;  3DEP A;  1T5E A;  1TU2 B;  2JA5 B;  1EOV A;  4A3M G;  3DWP A;  5LMN W;  1JWU D;  3MTS A;  3N52 A;  1XMO Q;  4LF6 L;  3KBG A;  4LK1 C;  5KNC A;  4DAV A;  1JE4 A;  1JJG A;  2J4X A;  1TQO A;  2NUC A;  2Q2T A;  2B2T A;  3CPW A;  1HH2 P;  3QO2 A;  1G2S A;  2OXP A;  2Z4H A;  4LUZ A;  2JA6 B;  1UE1 A;  4OO1 I;  4JPB W;  5DM6 3;  1HTL D;  3X3N A;  5IE8 A;  1EYA A;  3KYH C;  4HSV A;  3T53 B;  1N8R C;  1VQN A;  2L9H A;  1JB3 A;  4GLV B;  3F8T A;  4K0K L;  1SBB B;  1FGU A;  4DV7 L;  3M4Q A;  4DV7 Q;  2RDG A;  4ALP A;  1ENA A;  4NW2 A;  2F0U A;  3PV0 A;  4MNO A;  1HUN A;  3QG1 A;  1VQG A;  2DNC A;  5T1G A;  3I73 A;  1A62 A;  3CCR A;  3SHL A;  1J6Q A;  4GN3 B;  1JOR A;  3H91 A;  1TWF B;  2WII B;  5KND A;  3JAM L;  4JI4 L;  1CQV A;  4IPH A;  1JE5 A;  4K5V A;  4HED A;  4HJA A;  3GTG H;  1TKW B;  4FVM A;  4G7O C;  2NWG A;  5C4J B;  4QCL A;  2KVM A;  3GTQ H;  1H9K A;  5HGQ A;  1JJC B;  2F0M A;  4B3R L;  1HTP A;  4RAU C;  4OEL B;  3EFX D;  4BY7 G;  4DV6 Q;  1DOL A;  3RZO H;  5M5Y B;  4A3J B;  2JA9 A;  1DD2 A;  2EY2 A;  2ES2 A;  2X6L A;  1KD1 C;  3CRL C;  4EGV A;  4DPG A;  2UXC Q;  1UEB A;  4KMU C;  1KIX A;  4FXD A;  4H13 C;  1WTW A;  4LNQ A;  1SJE D;  1TS3 A;  2DUD A;  4OWW B;  1S5E D;  1M1K C;  5EJW A;  1I4X A;  3ULJ A;  1DJR D;  2CCZ A;  3U4V A;  2K5N A;  2N88 A;  5IP9 G;  1B8A A;  3S17 H;  1K8O A;  2XGT A;  2IT1 A;  3R2I A;  5C44 B;  1TVX A;  4RGN A;  2B2W A;  3KDF B;  1BVS A;  1GVP A;  3D6C A;  3SK5 A;  3HP3 A;  3VR5 A;  4WJW A;  1DON A;  3JAM c;  2PO4 A;  1IXR A;  2JP1 A;  5FLM H;  4DGZ A;  1NCV A;  1SNP A;  2R7D A;  4JI6 Q;  3KDF A;  1U5K A;  3GTO H;  3MEF A;  4C3J G;  1RD9 D;  4EQ5 A;  3SVM A;  4DV0 L;  2OTL A;  2L5T A;  2YV5 A;  3NBH B;  3E9H A;  3KLS X;  4ZQ3 A;  1QNU A;  2CWA A;  5I6W A;  5I6Y A;  3CMA A;  2BCO A;  2KUM A;  1HRJ A;  1EYC A;  2QIL A;  2M00 A;  5EQ0 A;  1KAB A;  1Q3L A;  4ZUJ A;  4LF7 L;  1KNA A;  3KOJ A;  3LWU A;  4YWM A;  2WAQ G;  5I9O A;  1KLG D;  5M5X H;  3J80 i;  4GKK Q;  4KKU A;  4LF5 L;  2ENB A;  5CC4 A;  3K7A B;  2F0F A;  2IL8 A;  1NY4 A;  1SN8 A;  3MXG A;  4OXP A;  2NN6 H;  3PO3 G;  1YNN D;  2KA7 A;  1IL2 A;  1FD7 D;  4ZK9 B;  1LTB D;  3U9O A;  3A5U A;  1EWI A;  3NQI A;  2B63 B;  5IY0 A;  1YHB A;  3G48 A;  4RCO A;  2B39 A;  2X69 A;  2JQO A;  3T51 B;  4KLK A;  3NWS A;  3UDF A;  4C3I G;  4ZKB B;  4MN3 A;  1M90 C;  2GVB A;  4CKC A;  4BXX G;  1FVI A;  1GHJ A;  3G4S A;  3F2D A;  4FF1 A;  1S40 A;  2VNU D;  4KY5 A;  4ZLT F;  2H4O A;  1C9O A;  2B2U C;  1X3P A;  3BVM A;  4O2D A;  1ONL A;  3MEH A;  3PCO B;  3PIP 3;  2Z9H A;  4C2M B;  2RHQ B;  3K80 C;  3WOF A;  3HG9 A;  3X3M A;  1S5C D;  2JSO A;  3P1H A;  2HQE A;  1FNU A;  4QJF A;  2ICI A;  2XRQ D;  3CU7 A;  3I70 A;  4PZ7 A;  1VQE A;  1MHW C;  1HCZ A;  3NEL A;  2PPB C;  4XDX A;  3PO2 G;  1AH9 A;  4PV1 C;  2PMZ B;  2F0I A;  1E2Z A;  1VQP A;  2ZM6 Q;  4F88 A;  1VQ6 A;  3G7L A;  4HIM A;  1AEX A;  3EQL C;  1KRT A;  3DM1 A;  1SRO A;  5G3L D;  2F0H A;  2O5I C;  2K14 A;  3QIA A;  1WTH A;  3WWV A;  2YTV A;  4R4O A;  1XMQ Q;  5JPM C;  2CQA A;  5FKA C;  2IJ0 A;  1H9S A;  4C3J B;  1DOM A;  1X56 A;  1EY8 A;  3ITP A;  1F9R A;  2EYM A;  4RGT A;  3PO3 H;  3W5O A;  1GUT A;  1NR2 A;  5FO9 B;  4A3J H;  4JC0 A;  3BU2 A;  3DM3 A;  2EXD A;  1II3 A;  1SMY C;  2PZW A;  4EX5 A;  4KN7 C;  1XWE A;  4KK7 A;  3SK4 A;  4RMF A;  5JEA G;  5IOC A;  1IKM A;  3KF6 B;  3WDN A;  2L11 A;  1X3G A;  1G6P A;  1NAP A;  3L0O A;  5L37 A;  1CHP D;  2L0C A;  3GTG B;  2PZU A;  3HOY H;  3J81 j;  4A93 H;  2F0V A;  3BVG A;  4YIJ A;  5JEA H;  1BOS A;  2E2I B;  1TR5 A;  2J7Z A;  5EPL A;  1B53 A;  1ILQ A;  1F77 A;  4QF4 A;  5IGE A;  3PGZ A;  4N9P A;  3S24 A;  4K0K Q;  2ZXP A;  3VR4 A;  2KOL A;  1JMC A;  3K57 A;  1WCM H;  5D65 A;  2AUJ D;  5LMN L;  4A3I G;  3TQY A;  1YJ9 A;  2YU9 H;  3DWQ A;  2MUY A;  1YZ6 A;  1AP0 A;  4GNX B;  1BXT A;  1I50 B;  1OO9 B;  2KJX A;  4IOA A;  2YU9 B;  4HCS A;  4GNX A;  1MI2 A;  5CR3 A;  3A8K E;  1VQH A;  4L8J A;  3K5N A;  4B9W A;  2R7F A;  1CM9 A;  2K5W A;  2EYO A;  3SE0 A;  4BY1 G;  2F0E A;  5H1S E;  2F0J A;  5ELB A;  4P73 A;  3TRZ A;  2ATW A;  2I07 B;  5IYC H;  3W1G A;  1G91 A;  1RTN A;  4DV0 Q;  1AE2 A;  4CJ1 B;  1RCV D;  4BY1 H;  5C0X G;  2J0T D;  3WOE A;  4JI6 L;  2JA7 H;  3CW2 C;  3F1Z A;  1HJP A;  1YIT A;  1SDF A;  4B3S Q;  2K05 A;  1EY5 A;  1SE2 A;  3KF6 A;  2NVX H;  5IGD A;  5I2X A;  5DLQ E;  1SND A;  4CHT B;  3M3Y B;  2WAQ E;  3JAM E;  1I3Q B;  2L4N A;  4ILW A;  1KLU D;  4ZYS A;  2PQA B;  1KL9 A;  1SMY D;  4A3D G;  2XSC A;  4H7B A;  1HZB A;  2JA5 H;  4DV1 Q;  1PRT C;  3NEM A;  4DFA A;  2C5C A;  1WCM G;  2R61 A;  5C4X B;  3VR2 A;  3H3V H;  2NZH A;  1B4O A;  3G6E A;  1K3R A;  4JW0 A;  4HID A;  1BCP C;  4XYO A;  3T1H Q;  2XWB B;  1H9S B;  5E3F A;  2BA0 A;  1ET9 A;  3ND8 A;  2A6E C;  1EZ6 A;  3CCE A;  3HKS A;  3Q8D A;  4MHE A;  4FF2 A;  4G57 A;  4LFB L;  3MVV A;  2UU9 Q;  3OIP A;  4RH6 A;  2RHS B;  1QJO A;  3GTK H;  2NN6 I;  2K75 A;  2C9O A;  1CKN A;  4BY7 B;  4JI4 Q;  4C3H G;  2VB3 X;  5C3E B;  2EIF A;  1I4P A;  1WTX A;  3W2D A;  3Q22 A;  3BYY B;  3HOV H;  4C2M H;  2V1C C;  3JAM i;  1PH6 A;  5C5L A;  5LMN Q;  5K36 H;  3CXC A;  4XYQ A;  3GTM H;  2K33 A;  5FLM G;  5IYC G;  2D9U A;  3V96 A;  2K1B A;  3I2Z A;  4OON A;  1VQA A;  1LAB A;  5J1Z A;  4DNR B;  1PH4 A;  4AQY Q;  3KUP A;  5D3I B;  1D5X C;  4XTC S;  1FL0 A;  3E5S A;  2AQ1 B;  2VUM B;  1CKO A;  4NMZ A;  1EQV A;  1G51 A;  2P5Z X;  4XQJ A;  2ZXR A;  3TDQ A;  3URY A;  2ALY B;  3J81 E;  1PFN A;  1A0I A;  4KJO A;  2LXK A;  4YCW A;  5FO7 B;  2FIN B;  1CK1 A;  3STB C;  5C44 H;  2V4D A;  3S15 B;  1HNZ L;  2AMC B;  3HKZ B;  4KY7 A;  3L2P A;  2PI2 A;  3U50 C;  4HTH A;  1PTO H;  1SE8 A;  1AZP A;  1I4H A;  4DK6 C;  4DR5 Q;  3RZD H;  3S16 H;  1R9T B;  1XMQ L;  4DV1 L;  5NUC A;  3A54 A;  5EBD A;  1GXD C;  1SYC A;  2CH4 A;  1W2B A;  1PV4 A;  3RZO B;  2HDM A;  5FO8 B;  2CW0 C;  4LF9 L;  2EE1 A;  2RQX A;  1PHJ A;  2PMZ E;  4LFA Q;  1Z9F A;  1VMC A;  5C4Z A;  3GTP H;  4UP9 A;  1KAA A;  4C3I B;  3BJU A;  1CT1 D;  3DLL A;  2LKV A;  1VQ7 A;  3M4O B;  4DR4 Q;  3NUC A;  1VQJ A;  4RGM A;  4Y52 H;  5FJ8 G;  2HCC A;  3KLW A;  4JYA L;  2XWJ B;  1Y14 B;  3RD4 A;  4WRD A;  1W6K A;  2XTI A;  3CRK C;  1ZYR C;  1JC7 A;  1Y1V G;  5M3F B;  5M5Y H;  2O5J C;  2UXD L;  1A15 A;  1PH5 A;  2IX0 A;  1TII D;  4JOI C;  1CZW A;  4IN3 A;  4TSS A;  1N33 L;  3I55 A;  1I50 H;  4E6I A;  2RSO A;  1FYC A;  1Y1V H;  2FJ2 A;  5KNB A;  1B3A A;  1CKN B;  1BCP B;  3QOL A;  3AEV A;  4Q0F A;  4ODG A;  5CYU A;  2IHE A;  1IW7 D;  4DUY Q;  4CDE C;  1IBL Q;  1SEB D;  5FOB B;  3AYH B;  3H0G B;  3I90 A;  4XXE A;  4DUY L;  1PYW D;  1KDB A;  5C3E G;  4R4I A;  3MXN B;  5IYB H;  3GO5 A;  4OX9 Q;  2KCC A;  3NE5 B;  1LTS D;  2AWO A;  1AFP A;  3OTO L;  3HOY B;  3TSS A;  3NBI A;  5C4H A;  3DUZ A;  1QVF A;  4PMB A;  4PG3 A;  4H44 C;  2I5L X;  2RBM A;  5ELE A;  1QVG A;  3T4A C;  1Q46 A;  3NXW A;  1TY2 A;  1HZ9 A;  4DR4 L;  1LTG D;  5E1F A;  4X65 L;  4NPS A;  2VXW A;  4A3I H;  2LFN A;  1GUO A;  1I5F A;  3NSW A;  2F0Q A;  2K52 A;  4WFN 3;  3C46 A;  2R93 B;  5IIF A;  2KHS A;  1EL0 A;  1Q1B A;  1PH1 A;  5KRU A;  4LWC A;  1F9S A;  2FHT A;  2FMC A;  1Y8O B;  1KXL A;  2I0Q A;  2HHH L;  3NPP A;  3HEJ A;  3U4Z A;  2FXQ A;  1JJ2 A;  3S1Q H;  1F2Y A;  4NP5 A;  4F87 A;  2MFI A;  1WTQ A;  2N3S A;  2DY7 A;  1CTM A;  1RJT A;  4KHP Q;  4JBJ A;  2BOS A;  1SYE A;  1F9Q A;  3GTK B;  1R4P B;  1TWC B;  4RGO S;  3AFQ A;  5LMU Q;  4DR6 L;  3D4W A;  1B7Y B;  2B8G A;  2EJM A;  2MQH A;  3Q0A A;  4L5S A;  3TBI B;  1MBY A;  1PYS B;  1SYF A;  1U4R A;  4G7Z C;  4AIM A;  4X62 L;  1EYD A;  3D4D A;  4KV6 A;  4A3E H;  1WJJ A;  5FLX c;  4M1U B;  4BBR G;  4A3L H;  3FKI H;  2EPB A;  4HSP A;  2R7Z H;  3I72 A;  4HJ7 A;  4OO1 H;  1STE A;  3FMC A;  3Q6S A;  3HGB A;  2ZJR A;  2D2C C;  2RDH A;  3TS0 A;  1PTO C;  2ZJQ A;  2K01 A;  1VQF A;  1EIG A;  2K04 A;  2R7Z G;  1NNX A;  4X3U A;  1Q7Y C;  3GTO B;  1EQQ A;  2Z4I A;  4R8N A;  2M2L A;  4DR3 Q;  4L5T A;  2F0T A;  1F9P A;  4CDD C;  4JV5 L;  3S14 B;  3MWY W;  1WD1 A;  4C1N I;  2UUA Q;  4K8J A;  1N32 Q;  2F0O A;  1AZQ A;  2N49 A;  5I4D A;  4BY1 B;  5JJZ A;  3A55 A;  4OEM B;  4CJ0 B;  3VR6 A;  1VQK A;  5C0X I;  3A8I E;  1GUG A;  3IL8 A;  5J39 A;  3QB3 A;  3MA2 B;  4LMQ D;  1JB7 A;  2NZ1 D;  3A7A B;  1B44 D;  4R4C A;  1VF7 A;  3J7A F;  2L55 A;  4WJ4 A;  1V1P A;  2E74 C;  2NTS A;  2EYL A;  1F2Z A;  2JEB I;  3RNU A;  3HZX A;  1P16 A;  3CCV A;  5JVH 3;  4UPA A;  3K5L A;  4IFD I;  1EOT A;  5IT9 c;  4A3D B;  4AYB E;  3PUW A;  1U0L A;  4ME5 A;  1K73 C;  1DZ1 A;  3A8J E;  2B2Y A;  2LS0 1;  2JA7 G;  4POF A;  4A3L G;  2TMP A;  5DNF A;  2L12 A;  2E5L L;  2A8V A;  5BR8 L;  1E2W A;  3NTK A;  5KIX A;  4DR1 L;  5EPJ A;  4KJN A;  3HKZ E;  2K4K A;  1NBW A;  3F2C A;  1JCK B;  2LXJ A;  4GOP A;  1M4V A;  1E0B A;  3GTJ B;  1HA5 A;  1MKH A;  1XPO A;  1JOK A;  3A56 A;  1VQB A;  4OIJ A;  1TWH B;  3H3V C;  1MD2 D;  2PQA A;  1B1Z A;  1UUP A;  1HHV A;  4RWS C;  3AMU A;  3TP7 A;  1LYL A;  3TEH B;  3KJO A;  3M4P A;  4P72 A;  1BBU A;  2OTJ A;  4J6H A;  1MSH A;  2LMC B;  2LSS A;  3SDZ A;  4JCV E;  4DN4 M;  2VB2 X;  1N9W A;  2EY6 A;  5ELN A;  3GDE A;  4IAL A;  1U9R A;  2CWP A;  3RN2 A;  5BN4 A;  1SNO A;  2QEJ C;  4K8I A;  1SRU A;  4JI3 L;  1XPU A;  2CVR A;  1V1P B;  1PYB A;  4DV5 L;  1QWY A;  4WJ3 M;  1B50 A;  5FJ8 H;  1JWS D;  3NBH A;  3PUV A;  1IYJ B;  4P71 A;  4UAI A;  4DKA C;  4RHS A;  1Q86 C;  3V05 A;  3KF8 A;  1X65 A;  3T13 A;  1QVC A;  4DV4 L;  1QE6 A;  3PUX A;  2RKS A;  4X6A H;  2HUG A;  3T16 A;  4HMI A;  1HPC A;  1CZG A;  1Y1V B;  1TWH H;  1Q8I A;  1KAW A;  1KTK A;  3I4N B;  3CQZ B;  2Z0S A;  4QIW B;  4HMJ A;  1UE5 A;  2ZXO A;  1EIY B;  1KNE A;  2A6H D;  3H94 A;  4DV2 Q;  1XMO L;  4LF6 Q;  3P75 A;  2PNH A;  3M7G A;  2IY5 B;  5LMU L;  2Q2U A;  5K5P A;  4K5X A;  3CCJ A;  4A3K B;  1PXU A;  1EU4 A;  1SNM A;  2EYP A;  4A3C H;  1G2T A;  1KDA A;  4PZ8 A;  4KHP L;  1X55 A;  2PCF B;  3VR3 A;  3A74 A;  4JI8 L;  1PRT B;  1VDZ A;  3HFZ B;  4NXN L;  2QCP X;  3PIO A;  2ZJP A;  4L5R C;  4LFC Q;  4A3G G;  4LUV A;  3CPF A;  1Y69 U;  4X66 L;  4C3H B;  4YHH L;  2N8N A;  5GAG C;  3CC2 A;  5ELF A;  3T1Y Q;  1AN8 A;  4DAY A;  2SEB D;  3CC4 A;  3RZD B;  3S16 B;  3ULL A;  1PVO A;  1EEF D;  1JOQ A;  4JI8 Q;  1Y1W B;  4JI5 L;  1Y8P B;  1ZKO A;  2B2W C;  1WTP A;  4C3I H;  2FMM A;  2G5D A;  1VQL A;  3SGI A;  3OOC A;  3VYU A;  1D5M C;  3FPU B;  1EIF A;  5ISR A;  4ZAI A;  4K2K A;  5GAE C;  3CCM A;  4DK3 C;  1NSN S;  2ICE C;  4G4K A;  2HIV A;  1HR0 W;  4BBS G;  2B3G A;  1TWA H;  1R9T H;  5EAY A;  4LF4 L;  1FJG L;  3K81 C;  4ID6 A;  3BDC A;  3STB D;  4K6D A;  2A1A A;  4U68 A;  3IRB A;  3PSI A;  4X64 L;  4PNY A;  1XTD A;  4FYD A;  1SR3 A;  4R4T A;  3J80 L;  5CV4 A;  2MJ8 A;  4LF5 Q;  1EY0 A;  1X3Q A;  1L1O A;  2ID0 A;  1STB A;  3S14 H;  3QOJ A;  4OWX B;  5C3E H;  1EWC A;  4JI7 Q;  3TN2 A;  3UDX A;  3HOZ B;  4JOI A;  2ZTC A;  3MXN A;  1IYV A;  4J8Q A;  5M3M H;  1D8L A;  1K3B C;  5KGU A;  1K8M A;  4RG1 A;  1LV9 A;  4IPC A;  4CBV A;  3EN2 A;  4IUV A;  1HNW Q;  2R93 G;  1X32 A;  5I2Y A;  4MTN A;  3K6O A;  1B70 B;  4FF3 A;  3BDL A;  2MO1 A;  1GO3 E;  1Z47 A;  4XQQ A;  2AKW B;  3I7F A;  3GV3 A;  1H9J A;  4R4Q A;  1XNR L;  3L3O C;  2EY1 A;  2OQ0 A;  5C4X H;  4A3E B;  3D8G A;  2Q2I A;  4QUF A;  2RCN A;  3GTL B;  4CJ2 C;  3S2H H;  2PYK A;  2OF1 A;  1TS5 A;  3A0J A;  1SMX A;  5IYD H;  3JC6 6;  4IZ8 A;  5GRO A;  1STN A;  2F4V Q;  1H9M A;  5IWA Q;  1EY7 A;  3K0Y A;  5BR8 Q;  4JI2 L;  4XIG S;  3RLO A;  2E5L Q;  1ENF A;  3OHX C;  5IYD G;  4DV3 Q;  1YNX A;  2IPK D;  4Y7N H;  4ZRZ A;  4JI1 Q;  3ULP A;  4B3R Q;  2KEC A;  4DAY B;  2XVS A;  1E22 A;  4A3M H;  4BBR B;  3HOX B;  4CDF C;  1IBK L;  1SNC A;  1DOK A;  2DJF C;  2KHJ A;  4I7Z C;  4J1M A;  2Z6K A;  5C5M A;  5IT9 L;  1I3Q H;  1MJE A;  1IBM L;  3HOV G;  4GOP C;  2H5X A;  2EVB A;  5BN5 A;  4IUT A;  3H0G H;  2IX3 A;  4U67 3;  4Y7N B;  4IOC A;  2N78 A;  1NR4 A;  5EBC A;  1ESF A;  1JOO A;  4HCE A;  2RDF A;  5CV5 A;  2Z6B A;  2D0P A;  2BH2 A;  3BVZ A;  5C0X H;  4GS3 A;  2K03 A;  2F0P A;  4HAE A;  4CKB A;  1V1Q A;  1L0Y B;  3HOW B;  3D3R A;  1PFM A;  2R3Z A;  2SDF A;  1ESR A;  1E3P A;  2D5D A;  3GD7 A;  3KBX A;  2F3W A;  2BE5 D;  5C6A A;  2MGS A;  1DYQ A;  1O7L A;  3EA6 A;  5AJ3 Q;  1OXT A;  4IO9 A;  2VQE Q;  4NXM Q;  5IGG A;  3SXH A;  4S3S A;  2UUC L;  4HJ9 A;  3GTQ B;  1E2V A;  1HZC A;  4A3B H;  4HR7 B;  2B2V C;  1Y1W G;  4GNX C;  2NN6 G;  3VA7 A;  1YBY A;  2NVT H;  1GUW A;  3SR1 A;  4IJH A;  4RCN A;  3S1R H;  3KLR A;  4IQZ A;  3E9I A;  1TWF H;  2OEO A;  1A2T A;  2C35 B;  3K8A A;  4EQN A;  2DN8 A;  1KC8 C;  4A4I A;  5C3X A;  1C8C A;  1GUS A;  2SOB A;  1XTC D;  1CI3 M;  1PTO B;  5LL6 X;  3HOU H;  1Y8N B;  2X6G A;  4DV3 L;  2F0W A;  3RN5 A;  1J5E Q;  3HOW H;  4P75 A;  3AU7 A;  4DNT B;  4NB3 A;  3CCS A;  5JAV A;  3NTH A;  3H0G G;  3CME A;  3M4O H;  5BN3 A;  3H09 A;  2XN9 C;  1B9N A;  3BG3 A;  2PQE A;  1A6X A;  1ENC A;  3PQI A;  4LJZ C;  1SYG A;  2NVY H;  3HOW G;  1S72 A;  1MSG A;  3UDG A;  5LHY 1;  1PZK D;  4DR2 Q;  2EXZ A;  1ET6 A;  2ZTE A;  4RA8 A;  1PH8 A;  1VQ5 A;  3NHH A;  1XNR Q;  1I94 L;  5EPK A;  4IUQ A;  3BZC A;  1D1I A;  1QNK A;  4MTK A;  4N9T A;  2VUM H;  1EY4 A;  4GLX A;  1CKM A;  4C3J H;  1WI5 A;  4B3M Q;  3I4M G;  1HNW L;  2MP1 A;  4KHV A;  1X9N A;  2OWO A;  3NEN A;  1S3O A;  2Y0S B;  2ZT9 C;  4FO2 A;  3IAY A;  1QUQ B;  4A3B G;  5IGC A;  2QF7 A;  2VQF Q;  4BY7 H;  2K50 A;  3FPP A;  3UI2 A;  3PUZ A;  2VQF L;  3S1N B;  3BDO A;  1UNS A;  1X54 A;  1LO5 D;  2QW7 A;  1AW7 A;  3O13 A;  1N36 L;  2K32 A;  1D7Q A;  3MXP A;  3M7N A;  1JWM D;  2R92 B;  4IUP A;  4UP8 A;  4WOR A;  2AWN A;  4I7A A;  2E76 C;  1FJG Q;  1ASZ A;  2HCI A;  5LL6 S;  2L1B A;  3OW2 A;  4LUO A;  2UXB Q;  2K5H A;  3CCQ A;  5JEA J;  2A69 D;  4A3F H;  3I91 A;  5HUR A;  4AYB B;  1N33 Q;  1YHQ A;  5T1I A;  3HRZ C;  1VQO A;  3D0F A;  1YVC A;  3L9A X;  4TQU S;  1RKN A;  2MHV A;  2E75 C;  3I4N H;  1I94 Q;  2QDL A;  3D4R A;  2L15 A;  4K2L A;  4DR2 L;  4ZCK A;  3J7A 5;  1O7I A;  4TVA B;  1K8A C;  4JYA Q;  4CDC C;  4KD4 A;  5JJK A;  3I4N G;  3TP6 A;  2NVX B;  1HUM A;  2VZA A;  2LY7 A;  1MGS A;  4F7X A;  1OTC A;  3F2B A;  3LGJ A;  3NWT A;  4UY8 C;  5JJI A;  1TT2 A;  1ICW A;  2KEE A;  3ICE A;  3MFY A;  3S17 B;  4DR7 L;  3GP7 A;  4DR7 Q;  5E4W C;  2QDB A;  4YHH Q;  2RCF A;  2F0L A;  4A3G H;  2Q8R E;  3NP8 A;  2JXM B;  1S4Z A;  3HOU B;  2R6G A;  2R93 H;  4OWT B;  5M5W H;  2G9D A;  3C1E A;  4A3I B;  4DR5 L;  1D2B A;  3EJI A;  4APV A;  2GVA A;  3H15 A;  3OW7 A;  4QUC A;  2B8F A;  1I4G A;  1PFS A;  1PDQ A;  2JK8 A;  1YNJ D;  1OXS C;  1W6J A;  2EQS A;  3A7L A;  2EZV A;  2WKC A;  2YTY A;  4QGU A;  2JE6 I;  3K59 A;  4A3B B;  3VA5 A;  2QEX A;  1Q8K A;  3KLS A;  3QJY A;  4DU9 A;  5J3B A;  1LM0 A;  4KN4 C;  3GTJ H;  1DXM A;  1TXY A;  2MO0 A;  3H6M A;  1ICF B;  5M9O A;  2PNR C;  3HOY G;  3ERO A;  5CV7 A;  3DMU A;  4DV4 Q;  4Z9C B;  1PZJ D;  2F4I A;  2F3V A;  5KYL A;  5GAH C;  4P74 A;  4QIW E;  4L6T B;  2A73 B;  2KHI A;  4X3T A;  1EZ8 A;  2NVT B;  3OSO A;  1F2L A;  4DV5 Q;  5CV8 A;  4B3T L;  5C4J H;  3RUZ A;  3AQQ A;  4HJ5 A;  4ZKC B;  2NZO A;  1WD0 A;  3M85 A;  1LTL A;  1IBM Q;  4DK0 A;  1YJN A;  3MHB A;  4NDX A;  4GOP B;  1U4P A;  1C48 A;  2OQK A;  1Q12 A;  2UUB L;  4UHV A;  2JA8 G;  1R4Q B;  3ZYY X;  4LFB Q;  2VY3 A;  1S5D D;  2QGQ A;  1CA6 A;  1JQY D;  1UAP A;  1RDP D;  1K0R A;  2XIW A;  4H02 A;  4R8I A;  2DY8 A;  3FVQ A;  5D3D A;  2AQ2 B;  4LF8 L;  3SEB A;  1EQT A;  1XJV A;  4R9W A;  4YWK A;  1D6E C;  5GAD C;  1VQI A;  1MIU A;  3MAQ A;  1YEZ A;  1A3V A;  1LTA D;  2JJQ A;  1AE3 A;  1E1O A;  5JJL A;  3TZU A;  2MPM A;  1NJI C;  1YHA A;  1V8Q A;  4OL7 A;  4DR1 Q;  1UE7 A;  4IJL A;  3CKI B;  4IUR A;  1FNV A;  1LT3 D;  4MZ9 A;  1OXX K;  3VYT A;  3PO3 B;  3NK9 A;  1J5E L;  2WB1 E;  2GA4 B;  4LF8 Q;  4RKL A;  2B63 G;  1H9R A;  1SXT A;  4UP7 A;  4NKL A;  2HQL A;  5COR A;  1DCZ A;  3FRP B;  2H1E A;  4A3F B;  1LT6 D;  3ERQ A;  2WV6 D;  2VL6 A;  5DEH A;  4HN7 A;  4TRD A;  1I4R A;  4DAP A;  1BNZ A;  3S2D H;  1SNQ A;  1SJH D;  2A6E D;  1DGS A;  5AFW A;  2EYF A;  4I65 A;  3OMC A;  5M3M B;  3MC0 B;  5KYI A;  3MFG A;  3OWE B;  2JA8 H;  2BA1 A;  3LX0 A;  2VQE L;  5IGB A;  2ZTD A;  2K5Q A;  4HIO A;  5FLX L;  4OGQ C;  1PRT D;  1E24 A;  1VQM A;  3K7U C;  1TWG H;  1SE3 A;  3FDT A;  3GQB A;  1FGB D;  1LT4 D;  4FNF A;  4PMW A;  3C3L A;  1YI2 A;  1RTO A;  3B6Y A;  5D14 A;  4JV5 Q;  3DXJ C;  3U9S A;  1QIL A;  4X3S A;  4DR3 L;  1BQQ T;  4HJ8 A;  5K36 G;  4XT3 B;  4PZ6 A;  2PW5 A;  3K5O A;  4BS9 A;  2R92 H;  1BBW A;  5EGT A;  4PMC A;  2Y0S E;  3PF4 A;  1FNW A;  1WFQ A;  3M3Y H;  4FF4 A;  4DK1 A;  1ML0 D;  3KF8 B;  3HOZ H;  4N8X 1;  5IOD A;  2AQ3 B;  2B2T C;  1NMG A;  2JA5 G;  3EVQ A;  1A3U A;  4ME3 A;  1EQR A;  3J81 L;  1NTG A;  3M4Y A;  3TS2 A;  3J7Z C;  1K28 A;  4EQP A;  2IW3 A;  2I46 A;  3I4L A;  4RHR A;  1GOZ A;  5COY A;  4CGY B;  4IFD H;  2JN4 A;  3R3O A;  4EQO A;  4DR6 Q;  2DJG C;  1BUV T;  1U4M A;  5C44 G;  1XNQ L;  1UWV A;  3EIV A;  1WTV A;  2CW0 D;  5G3L F;  1QOH A;  4IPD A;  4LFC L;  1I6H H;  4JI2 Q;  3RR5 A;  2EYH A;  4A3F G;  4C3H H;  5CBE E;  5IWA L;  1J8I A;  1VQD A;  1WOC A;  1B2T A;  1PRT F;  4JBW A;  2TSS A;  4DNI A;  2JEA I;  2XRS D;  5KEE A;  2OT2 A;  1PH3 A;  2K5V A;  3PO2 H;  4KTA A;  2WKD A;  1EFW A;  2PZT A;  1SE4 A;  3OPO A;  2ZM6 L;  3J7A V;  1CA5 A;  4JI0 Q;  3LWE A;  3FKI B;  1LTI D;  2A6H C;  3J80 E;  2PW7 A;  2Q8I B;  4OHJ A;  2CFM A;  1S5B D;  2HIX A;  4BWG B;  4XT1 B;  2FFK B;  4MIU A;  2VW9 A;  2E2I H;  4FP5 D;  4JBK A;  3PO2 B;  4QQB X;  3N6R A;  4ABN A;  2F52 A;  2G9H D;  2KQ3 A;  3OIQ A;  3VYS A;  2K28 A;  4GN5 A;  1I6V C;  5HGT A;  1TWC H;  3IFD A;  3OTO Q;  1NUC A;  5FK9 C;  1O7Y A;  1B3Q A;  2HD3 A;  3UE1 A;  1W3S A;  4QY7 A;  1VQ8 A;  2F3I A;  4JI3 Q;  4A3J G;  1A63 A;  4KD3 A;  1CHQ D;  4KKS A;  2E2H B;  3HOX G;  4X64 Q;  4FDB A;  3Q23 A;  1G6Z A;  3ERS X;  2K7V A;  4TKO B;  2JYO A;  1OXU A;  1X3F A;  3PUY A;  3IFT A;  2BDN A;  2K6A A;  4B3M L;  3TP8 A;  1IHZ A;  2JA6 G;  1PZI D;  1LUZ A;  2MNA A;  3HOX H;  3R93 A;  4DAM A;  1TS2 A;  1WTR A;  1HNX L;  1CFM A;  5E4X A;  4BBR H;  4A93 G;  1X6O A;  4IUN A;  4O42 A;  1C7Y A;  4GKK L;  2A19 A;  2KBN A;  3E3X A;  1NE3 A;  1SLJ A;  5I9P A;  5EKL A;  5A2Q E;  4B9X A;  4LF7 Q;  2JA6 H;  4JI0 L;  1XPR A;  1QCB D;  2WAQ B;  3CF5 A;  3S1M B;  1WYD A;  5CBA E;  1OXV A;  2RSN A;  4DXG A;  1VQ4 A;  1U4L A;  4K14 A;  4BBS B;  1I4Q A;  2EJF C;  1WTO A;  2I5M X;  4QL5 A;  5JOB A;  2SNM A;  1CSQ A;  1XX8 A;  4JI5 Q;  1O80 A;  1BDO A;  2WP8 J;  3W1B A;  3BS1 A;  3ND9 A;  2WAC A;  3TP5 A;  3T1Y L;  2E2H H;  2RA4 A;  1XNQ Q;  3J80 c;  1IW7 C;  4IUU A;  1E1T A;  2QA4 A;  1PMR A;  1HFN A;  5EKK A;  5EKI A;  2WB1 G;  3MZ5 A;  5CGK A;  4IPG A;  4QB4 A;  2JA8 B;  3J81 i;  1ROD A;  2F0G A;  4NXN Q;  2UXC L;  2IWH A;  3S1N H; 
#chains in the Genus database with same CATH homology
 5CV6 A;  4F8M A;  1D5Z C;  4KKT A;  1T5X D;  3S2H B;  3PIO 3;  3D31 A;  2NYZ D;  4ZUI A;  2WB1 B;  1TS4 A;  5IGF A;  3RLF A;  2F0S A;  5CMD A;  3RMH A;  2SNS A;  3TME A;  1STY A;  3R2T A;  4DA2 A;  5C0X J;  1TWA B;  1Z6H A;  4V0B A;  4OO1 G;  4Q5V A;  2E2J B;  1V1O A;  1Q1E A;  1I6H B;  4LAA A;  3BZD B;  3OWF A;  4JK1 C;  5JVG 3;  3ONA B;  1VMP A;  2NVY B;  2F0D A;  2JA7 B;  1G8Z D;  5M5X B;  1HFG A;  4FXK C;  4BA2 I;  1Z7T A;  2R7Z B;  4IFD J;  4EVO A;  3FEW X;  1QG7 A;  2O4X A;  2EJG C;  4RKB A;  1HA6 A;  2B2V A;  4RFB A;  1RHP A;  2RVL A;  3VYR A;  4K6L A;  5C3W A;  1HXY D;  4GZY C;  1BCP F;  1JR0 D;  2F0N A;  4H0L C;  2QKI C;  1EWH A;  1IKL A;  4B08 A;  3E6Z X;  1EIH A;  3NTI A;  1S5F D;  5JPN C;  1WCM B;  1SYD A;  3S9W A;  2N55 A;  4KY6 A;  1ILP A;  4CKE A;  1C4Q A;  1PTO F;  3HOV B;  4K5W A;  2A74 C;  1EY6 A;  2CHB D;  3S1R B;  3NQT A;  1SAP A;  4V19 0;  1QB5 D;  1K83 B;  4IFD G;  2BDO A;  1JIC A;  1VF5 C;  3W3A A;  5A2Q L;  1PTO D;  1LLR D;  2A68 D;  3DEO A;  1L0X B;  5ELD A;  2EOT A;  4XQN A;  3D6W A;  3I8Z A;  4A3G B;  3KK7 A;  3TZD A;  1LTT D;  3P20 A;  1BO0 A;  1O7Z A;  1SFO B;  4C56 C;  1SYB A;  3K5M A;  4M8A A;  5TSS A;  1A3T A;  3G6J B;  1KDC A;  3DWA A;  1PLF A;  2Z8L A;  1IL8 A;  4DXF A;  2B2U A;  1Q90 A;  3K58 A;  1PFB A;  3MXU A;  3E0J A;  5F2D A;  4G7H C;  2NB0 A;  3J7Y W;  4L63 B;  4PQX A;  4A3M B;  1STA A;  1GHK A;  5FLX E;  1J9O A;  2KED A;  1EU3 A;  1XXG A;  1TY0 A;  2IX1 A;  1LTR D;  1EFI D;  3I4M B;  3V2T A;  5IT9 E;  1RF2 D;  3I3C A;  2KCN A;  4QMG A;  1GJX A;  1G29 1;  2WIN B;  1YNJ C;  4ULL A;  1WVL A;  1O78 A;  1HQR D;  3QWN A;  1EY9 A;  2BE5 C;  4KHZ A;  1DM0 B;  5J22 A;  3AB9 A;  2A5H A;  1XYI A;  1CQF A;  4A93 B;  2EY5 A;  1HQM C;  1LAC A;  3GTP B;  3C2P A;  1YNN C;  2NVQ B;  4UDU C;  4BA1 I;  3DHQ A;  2F03 A;  2K5D A;  3Q24 A;  1FR3 A;  3F2U A;  3OMG A;  2NBF A;  2O2L D;  3HS0 C;  1EEI D;  3SK6 A;  1BR9 A;  5M5W B;  4O1N A;  2F1M A;  1V43 A;  4FXG C;  1ZXT A;  2E2D C;  3IKJ A;  1LT5 D;  1STG A;  2F0K A;  1IYU A;  3P7J A;  2HDL A;  5DM7 3;  2Z1C A;  4KI0 A;  4OIK A;  3T56 B;  2XNA C;  4P2C B;  5CV9 A;  3S2D B;  1A2U A;  2YYZ A;  3PMF A;  2D62 A;  1VCI A;  1BF4 A;  2Q8T A;  2A69 C;  3S1Q B;  2B2Y C;  5DAU A;  3SK8 A;  1B9M A;  3C1F A;  4X3K A;  3GTM B;  3BYT B;  1TWG B;  1STH A;  1M8A A;  1ZEQ X;  3CHB D;  1ZYR D;  1BBX C;  1GUN A;  2NTT A;  3R8B A;  4DF7 A;  5ELC A;  5A35 A;  2EDG A;  2DNE A;  1UEA B;  1BCP D;  2AUK A;  1SSO A;  3LNN A;  1F2M A;  2M9V A;  2A68 C;  2EYJ A;  3GV6 A;  1D1K A;  3L7Z C;  4C1N K;  3DEP A;  1T5E A;  1TU2 B;  2JA5 B;  3DWP A;  1JWU D;  3MTS A;  3N52 A;  3KBG A;  4LK1 C;  5KNC A;  4DAV A;  1JE4 A;  2J4X A;  1TQO A;  2NUC A;  2B2T A;  1G2S A;  3QO2 A;  2OXP A;  2Z4H A;  2JA6 B;  4OO1 I;  5DM6 3;  1HTL D;  3X3N A;  1EYA A;  4HSV A;  3T53 B;  2L9H A;  1JB3 A;  1SBB B;  2RDG A;  1ENA A;  2F0U A;  3PV0 A;  4NW2 A;  1HUN A;  3QG1 A;  2DNC A;  5T1G A;  3I73 A;  3SHL A;  1JOR A;  3H91 A;  1TWF B;  2WII B;  5KND A;  3JAM L;  1CQV A;  4K5V A;  4HED A;  1TKW B;  4FVM A;  4G7O C;  2NWG A;  5C4J B;  4QCL A;  2KVM A;  1H9K A;  2F0M A;  1HTP A;  4RAU C;  3EFX D;  1DOL A;  5M5Y B;  4A3J B;  1DD2 A;  2EY2 A;  2X6L A;  3CRL C;  4EGV A;  4KMU C;  4FXD A;  4H13 C;  1WTW A;  1SJE D;  1TS3 A;  1S5E D;  5EJW A;  1I4X A;  1DJR D;  2N88 A;  1K8O A;  3R2I A;  2IT1 A;  5C44 B;  1TVX A;  4RGN A;  2B2W A;  3D6C A;  3SK5 A;  3HP3 A;  3VR5 A;  4WJW A;  1DON A;  2PO4 A;  2JP1 A;  4DGZ A;  1NCV A;  1SNP A;  4C3J G;  1RD9 D;  3SVM A;  2L5T A;  3KLS X;  4ZQ3 A;  5I6W A;  1QNU A;  5I6Y A;  2BCO A;  2KUM A;  1HRJ A;  1EYC A;  2QIL A;  2M00 A;  5EQ0 A;  1KAB A;  1Q3L A;  4ZUJ A;  1KNA A;  3LWU A;  5I9O A;  1KLG D;  4KKU A;  2ENB A;  5CC4 A;  3K7A B;  2F0F A;  2IL8 A;  3MXG A;  2NN6 H;  1YNN D;  2KA7 A;  1FD7 D;  4ZK9 B;  1LTB D;  3U9O A;  3NQI A;  2B63 B;  4RCO A;  2B39 A;  2X69 A;  3T51 B;  3NWS A;  4C3I G;  4ZKB B;  4MN3 A;  4CKC A;  1GHJ A;  4FF1 A;  2VNU D;  4KY5 A;  4ZLT F;  2H4O A;  2B2U C;  1X3P A;  3BVM A;  1ONL A;  3MEH A;  3PIP 3;  4C2M B;  3WOF A;  3HG9 A;  3X3M A;  1S5C D;  2JSO A;  3P1H A;  2HQE A;  1FNU A;  2ICI A;  2XRQ D;  3CU7 A;  3I70 A;  2PPB C;  1HCZ A;  4XDX A;  4PV1 C;  2PMZ B;  2F0I A;  1E2Z A;  4F88 A;  3G7L A;  1AEX A;  3EQL C;  3DM1 A;  5G3L D;  2F0H A;  2O5I C;  3QIA A;  5JPM C;  2CQA A;  5FKA C;  2IJ0 A;  1H9S A;  4C3J B;  1DOM A;  1EY8 A;  3ITP A;  1F9R A;  2EYM A;  4RGT A;  1GUT A;  1NR2 A;  5FO9 B;  1II3 A;  1SMY C;  2PZW A;  4KN7 C;  1XWE A;  4KK7 A;  3SK4 A;  5JEA G;  5IOC A;  1IKM A;  3WDN A;  2L11 A;  1NAP A;  1CHP D;  2L0C A;  3GTG B;  2PZU A;  2F0V A;  3BVG A;  4YIJ A;  5JEA H;  1BOS A;  2E2I B;  1TR5 A;  2J7Z A;  5EPL A;  1B53 A;  1ILQ A;  1F77 A;  4QF4 A;  5IGE A;  4N9P A;  2ZXP A;  3VR4 A;  2KOL A;  3K57 A;  5D65 A;  2AUJ D;  3DWQ A;  2MUY A;  1AP0 A;  1BXT A;  1I50 B;  1OO9 B;  2KJX A;  2YU9 B;  4HCS A;  1MI2 A;  5CR3 A;  3A8K E;  4L8J A;  3K5N A;  4B9W A;  1CM9 A;  2K5W A;  2EYO A;  3SE0 A;  2F0E A;  2F0J A;  5ELB A;  2I07 B;  1G91 A;  1RTN A;  4CJ1 B;  1RCV D;  5C0X G;  2J0T D;  3WOE A;  1SDF A;  2K05 A;  1EY5 A;  1SE2 A;  5IGD A;  5I2X A;  1SND A;  4CHT B;  3M3Y B;  3JAM E;  1I3Q B;  2L4N A;  4ILW A;  1KLU D;  4ZYS A;  1SMY D;  2XSC A;  4H7B A;  1PRT C;  4DFA A;  2C5C A;  2R61 A;  5C4X B;  3VR2 A;  1B4O A;  1BCP C;  4XYO A;  2XWB B;  1H9S B;  5E3F A;  2BA0 A;  1ET9 A;  3ND8 A;  2A6E C;  1EZ6 A;  4MHE A;  4FF2 A;  4G57 A;  3MVV A;  3OIP A;  4RH6 A;  1QJO A;  2NN6 I;  2C9O A;  4BY7 B;  4C3H G;  2VB3 X;  5C3E B;  1I4P A;  1WTX A;  3W2D A;  3Q22 A;  3BYY B;  5C5L A;  5K36 H;  4XYQ A;  2K33 A;  2D9U A;  3V96 A;  2K1B A;  1LAB A;  5J1Z A;  4DNR B;  3KUP A;  5D3I B;  1D5X C;  4XTC S;  3E5S A;  2AQ1 B;  2VUM B;  4NMZ A;  1EQV A;  4XQJ A;  2ZXR A;  3TDQ A;  3URY A;  3J81 E;  1PFN A;  4KJO A;  5FO7 B;  2FIN B;  1CK1 A;  2V4D A;  3S15 B;  3HKZ B;  4KY7 A;  4HTH A;  1PTO H;  1AZP A;  1I4H A;  1R9T B;  5NUC A;  3A54 A;  5EBD A;  1GXD C;  1SYC A;  3RZO B;  2HDM A;  5FO8 B;  2CW0 C;  2EE1 A;  2RQX A;  1VMC A;  5C4Z A;  1KAA A;  4C3I B;  1CT1 D;  2LKV A;  3M4O B;  3NUC A;  4RGM A;  2HCC A;  2XWJ B;  3RD4 A;  4WRD A;  1W6K A;  3CRK C;  1ZYR C;  1JC7 A;  5M3F B;  2O5J C;  1A15 A;  2IX0 A;  1TII D;  1CZW A;  4IN3 A;  4TSS A;  4E6I A;  2RSO A;  1FYC A;  2FJ2 A;  5KNB A;  1B3A A;  1BCP B;  3QOL A;  4Q0F A;  4ODG A;  5CYU A;  1IW7 D;  1SEB D;  5FOB B;  3H0G B;  3I90 A;  4XXE A;  1PYW D;  1KDB A;  3GO5 A;  2KCC A;  3NE5 B;  1LTS D;  2AWO A;  1AFP A;  3HOY B;  3TSS A;  3NBI A;  5C4H A;  3DUZ A;  4PMB A;  4H44 C;  2RBM A;  5ELE A;  3T4A C;  3NXW A;  1TY2 A;  1LTG D;  5E1F A;  2VXW A;  2LFN A;  1GUO A;  2F0Q A;  3NSW A;  4WFN 3;  3C46 A;  2R93 B;  5IIF A;  2KHS A;  1EL0 A;  1Q1B A;  5KRU A;  1F9S A;  2FHT A;  2FMC A;  1Y8O B;  3NPP A;  3HEJ A;  1F2Y A;  4NP5 A;  4F87 A;  1WTQ A;  2DY7 A;  1CTM A;  1RJT A;  2BOS A;  1SYE A;  1F9Q A;  3GTK B;  1R4P B;  1TWC B;  4RGO S;  3D4W A;  2B8G A;  2EJM A;  3Q0A A;  3TBI B;  1MBY A;  1SYF A;  1U4R A;  4G7Z C;  1EYD A;  3D4D A;  4KV6 A;  4M1U B;  2EPB A;  4HSP A;  3I72 A;  4OO1 H;  1STE A;  3FMC A;  3Q6S A;  3HGB A;  2D2C C;  2RDH A;  1PTO C;  2K01 A;  1EIG A;  2K04 A;  4X3U A;  3GTO B;  2Z4I A;  4R8N A;  2M2L A;  2F0T A;  1F9P A;  3S14 B;  3MWY W;  1WD1 A;  4C1N I;  4K8J A;  2F0O A;  1AZQ A;  5I4D A;  4BY1 B;  5JJZ A;  3A55 A;  4CJ0 B;  3VR6 A;  5C0X I;  3A8I E;  1GUG A;  3IL8 A;  5J39 A;  3QB3 A;  3MA2 B;  4LMQ D;  2NZ1 D;  3A7A B;  1B44 D;  1VF7 A;  3J7A F;  2L55 A;  1V1P A;  2E74 C;  2NTS A;  2EYL A;  1F2Z A;  2JEB I;  3HZX A;  5JVH 3;  3K5L A;  4IFD I;  1EOT A;  4A3D B;  3PUW A;  4ME5 A;  1DZ1 A;  3A8J E;  2B2Y A;  2LS0 1;  2TMP A;  5DNF A;  2L12 A;  1E2W A;  3NTK A;  5KIX A;  5EPJ A;  4KJN A;  1JCK B;  1M4V A;  1E0B A;  3GTJ B;  1HA5 A;  1JOK A;  3A56 A;  4OIJ A;  1TWH B;  3H3V C;  1MD2 D;  1B1Z A;  1UUP A;  1HHV A;  4RWS C;  3AMU A;  3TP7 A;  4J6H A;  1MSH A;  2LMC B;  3SDZ A;  4DN4 M;  2VB2 X;  2EY6 A;  4IAL A;  1U9R A;  5BN4 A;  1SNO A;  2QEJ C;  4K8I A;  2CVR A;  1V1P B;  1QWY A;  1B50 A;  1JWS D;  3NBH A;  3PUV A;  4UAI A;  4RHS A;  3V05 A;  3KF8 A;  3T13 A;  1QE6 A;  3PUX A;  2RKS A;  2HUG A;  3T16 A;  4HMI A;  1HPC A;  1CZG A;  1Y1V B;  1Q8I A;  1KTK A;  3I4N B;  3CQZ B;  4QIW B;  4HMJ A;  2ZXO A;  1KNE A;  2A6H D;  3H94 A;  3P75 A;  3M7G A;  5K5P A;  4K5X A;  4A3K B;  1PXU A;  1EU4 A;  1SNM A;  2EYP A;  1G2T A;  1KDA A;  2PCF B;  3VR3 A;  1PRT B;  1VDZ A;  2QCP X;  1Y69 U;  4C3H B;  5ELF A;  1AN8 A;  4DAY A;  2SEB D;  3RZD B;  3S16 B;  1EEF D;  1JOQ A;  1Y1W B;  1Y8P B;  1ZKO A;  2B2W C;  1WTP A;  2FMM A;  3VYU A;  3OOC A;  1D5M C;  3FPU B;  5ISR A;  4ZAI A;  4K2K A;  1NSN S;  2ICE C;  4G4K A;  4ID6 A;  3BDC A;  4K6D A;  4U68 A;  4PNY A;  4FYD A;  3J80 L;  5CV4 A;  2MJ8 A;  1EY0 A;  1X3Q A;  2ID0 A;  1STB A;  3QOJ A;  1EWC A;  3TN2 A;  3HOZ B;  3MXN A;  1IYV A;  4J8Q A;  5KGU A;  1K8M A;  1LV9 A;  4CBV A;  4IUV A;  1X32 A;  5I2Y A;  3K6O A;  4FF3 A;  3BDL A;  1Z47 A;  4XQQ A;  3GV3 A;  1H9J A;  3L3O C;  2EY1 A;  4A3E B;  3D8G A;  4QUF A;  3GTL B;  4CJ2 C;  2PYK A;  2OF1 A;  1TS5 A;  4IZ8 A;  1STN A;  1H9M A;  1EY7 A;  3K0Y A;  4XIG S;  1ENF A;  3OHX C;  2IPK D;  4ZRZ A;  2KEC A;  2XVS A;  4BBR B;  3HOX B;  1SNC A;  1DOK A;  4I7Z C;  4J1M A;  5C5M A;  5IT9 L;  4Y7N B;  5BN5 A;  2EVB A;  4IUT A;  4U67 3;  2IX3 A;  1NR4 A;  5EBC A;  1ESF A;  1JOO A;  4HCE A;  2RDF A;  5CV5 A;  3BVZ A;  5C0X H;  2K03 A;  2F0P A;  4HAE A;  4CKB A;  1L0Y B;  3HOW B;  3D3R A;  1PFM A;  2R3Z A;  2SDF A;  1ESR A;  2D5D A;  3GD7 A;  3KBX A;  2F3W A;  2BE5 D;  5C6A A;  2MGS A;  1DYQ A;  1O7L A;  3EA6 A;  1OXT A;  5IGG A;  3SXH A;  4S3S A;  3GTQ B;  1E2V A;  4HR7 B;  2B2V C;  2NN6 G;  3VA7 A;  1GUW A;  3SR1 A;  4RCN A;  3KLR A;  4IQZ A;  2OEO A;  1A2T A;  4EQN A;  2DN8 A;  1C8C A;  5C3X A;  1GUS A;  2SOB A;  1XTC D;  1CI3 M;  1PTO B;  5LL6 X;  1Y8N B;  2X6G A;  2F0W A;  3AU7 A;  4DNT B;  5JAV A;  3NTH A;  5BN3 A;  3H09 A;  2XN9 C;  1B9N A;  3BG3 A;  2PQE A;  1A6X A;  1ENC A;  1SYG A;  4LJZ C;  1MSG A;  5LHY 1;  1PZK D;  2EXZ A;  1ET6 A;  4RA8 A;  3NHH A;  5EPK A;  4IUQ A;  1D1I A;  1QNK A;  4N9T A;  1EY4 A;  2MP1 A;  4KHV A;  2Y0S B;  2ZT9 C;  4FO2 A;  3IAY A;  5IGC A;  2QF7 A;  3FPP A;  3UI2 A;  3PUZ A;  3S1N B;  3BDO A;  1UNS A;  1LO5 D;  3O13 A;  1AW7 A;  2K32 A;  3MXP A;  3M7N A;  1JWM D;  2R92 B;  4IUP A;  4WOR A;  2AWN A;  2E76 C;  2HCI A;  5LL6 S;  2L1B A;  5JEA J;  2A69 D;  3I91 A;  5HUR A;  4AYB B;  5T1I A;  3HRZ C;  3L9A X;  4TQU S;  1RKN A;  2MHV A;  2E75 C;  3D4R A;  4K2L A;  4KD4 A;  3TP6 A;  2NVX B;  1HUM A;  2LY7 A;  1MGS A;  4F7X A;  3NWT A;  1TT2 A;  1ICW A;  2KEE A;  3MFY A;  3S17 B;  3GP7 A;  5E4W C;  2QDB A;  2F0L A;  2Q8R E;  3NP8 A;  2JXM B;  1S4Z A;  3HOU B;  2R6G A;  2G9D A;  3C1E A;  4A3I B;  1D2B A;  3EJI A;  3OW7 A;  4QUC A;  2B8F A;  1I4G A;  1PDQ A;  1YNJ D;  1OXS C;  1W6J A;  3A7L A;  2EZV A;  2WKC A;  2JE6 I;  3K59 A;  4A3B B;  3VA5 A;  3KLS A;  3QJY A;  4DU9 A;  4KN4 C;  1DXM A;  3H6M A;  5M9O A;  2PNR C;  3ERO A;  5CV7 A;  3DMU A;  4Z9C B;  1PZJ D;  2F4I A;  2F3V A;  5KYL A;  4L6T B;  2A73 B;  4X3T A;  1EZ8 A;  2NVT B;  3OSO A;  1F2L A;  5CV8 A;  3RUZ A;  4ZKC B;  1WD0 A;  3M85 A;  4DK0 A;  3MHB A;  4NDX A;  1U4P A;  1C48 A;  1Q12 A;  1R4Q B;  3ZYY X;  1S5D D;  1CA6 A;  1JQY D;  1UAP A;  1RDP D;  2XIW A;  4R8I A;  2DY8 A;  3FVQ A;  5D3D A;  2AQ2 B;  3SEB A;  1EQT A;  4R9W A;  1D6E C;  3MAQ A;  1A3V A;  1LTA D;  3TZU A;  2MPM A;  1V8Q A;  4OL7 A;  3CKI B;  4IUR A;  1FNV A;  1LT3 D;  1OXX K;  3VYT A;  3PO3 B;  3NK9 A;  2GA4 B;  4RKL A;  1SXT A;  1H9R A;  4NKL A;  5COR A;  1DCZ A;  3FRP B;  2H1E A;  4A3F B;  1LT6 D;  3ERQ A;  2WV6 D;  5DEH A;  4HN7 A;  4TRD A;  1I4R A;  4DAP A;  1BNZ A;  1SNQ A;  1SJH D;  2A6E D;  5AFW A;  2EYF A;  4I65 A;  3OMC A;  5M3M B;  3MC0 B;  5KYI A;  3MFG A;  3OWE B;  2BA1 A;  3LX0 A;  5IGB A;  2K5Q A;  5FLX L;  4OGQ C;  1PRT D;  1SE3 A;  3FDT A;  3GQB A;  1FGB D;  1LT4 D;  4FNF A;  4PMW A;  3C3L A;  1RTO A;  5D14 A;  3DXJ C;  3U9S A;  1QIL A;  4X3S A;  1BQQ T;  5K36 G;  4XT3 B;  2PW5 A;  3K5O A;  4BS9 A;  5EGT A;  4PMC A;  1FNW A;  4FF4 A;  4DK1 A;  1ML0 D;  5IOD A;  2AQ3 B;  2B2T C;  3EVQ A;  1A3U A;  3J81 L;  3M4Y A;  4EQP A;  2IW3 A;  2I46 A;  3I4L A;  4RHR A;  1GOZ A;  5COY A;  4CGY B;  4IFD H;  3R3O A;  4EQO A;  1BUV T;  1U4M A;  1WTV A;  2CW0 D;  5G3L F;  1QOH A;  2EYH A;  5CBE E;  1J8I A;  1B2T A;  1PRT F;  4JBW A;  2TSS A;  2JEA I;  2XRS D;  5KEE A;  2OT2 A;  4KTA A;  2WKD A;  2PZT A;  1SE4 A;  3OPO A;  3J7A V;  1CA5 A;  3LWE A;  3FKI B;  1LTI D;  2A6H C;  3J80 E;  2PW7 A;  2Q8I B;  4OHJ A;  1S5B D;  4BWG B;  4XT1 B;  2FFK B;  4MIU A;  4FP5 D;  3PO2 B;  3N6R A;  4ABN A;  2G9H D;  2KQ3 A;  3OIQ A;  3VYS A;  2K28 A;  1I6V C;  5HGT A;  3IFD A;  1NUC A;  5FK9 C;  1O7Y A;  4KD3 A;  1CHQ D;  4KKS A;  2E2H B;  3Q23 A;  1G6Z A;  2K7V A;  4TKO B;  2JYO A;  1OXU A;  3PUY A;  3IFT A;  2BDN A;  2K6A A;  3TP8 A;  1IHZ A;  1PZI D;  3R93 A;  1WTR A;  1TS2 A;  1CFM A;  5E4X A;  4IUN A;  4O42 A;  5I9P A;  5A2Q E;  5EKL A;  4B9X A;  1QCB D;  2WAQ B;  3S1M B;  5CBA E;  1OXV A;  2RSN A;  4DXG A;  1U4L A;  4K14 A;  4BBS B;  1I4Q A;  2EJF C;  1WTO A;  5JOB A;  2SNM A;  1XX8 A;  1O80 A;  1BDO A;  2WP8 J;  3BS1 A;  3ND9 A;  2WAC A;  3TP5 A;  2RA4 A;  1IW7 C;  4IUU A;  1PMR A;  1HFN A;  5EKK A;  5EKI A;  3MZ5 A;  5CGK A;  4QB4 A;  2JA8 B;  1ROD A;  2F0G A;  2IWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...