2EPBA

Solution structure of chromo domain 2 in chromodomain-helicase-dna-binding protein 6
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
68
structure length
68
Chain Sequence
GSSGSSGNPDYVEVDRILEVAHTKDAETGEEVTHYLVKWCSLPYEESTWELEEDVDPAKVKEFESLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Chromodomain-helicase-DNA-binding protein 6
publication title Solution structure of chromo domain 2 in Chromodomain-helicase-DNA-binding protein 6
rcsb
source organism Homo sapiens
total genus 5
structure length 68
sequence length 68
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2epbA00
3Q6SA 2B2UA 4IUPA 5EJWA 1BO0A 5EPLA 2B2TA 2RA4A 2J7ZA 2X6LA 2K01A 2MGSA 4R9WA 2MJ8A 5T1IA 1KNAA 4XDXA 1F9SA 1XX8A 1JE4A 3MWYW 1PDQA 2L12A 2CVRA 4IUQA 5T1GA 4X3KA 4IUVA 1HFNA 1WTOA 3DM1A 1MGSA 2RVLA 1EIGA 2L4NA 2L11A 1F9PA 2X69A 2L9HA 1WTXA 1JICA 3I3CA 3FDTA 4OIKA 3D6WA 1XYIA 2K04A 4MN3A 4QUCA 2K03A 1CM9A 1DOKA 1U4LA 1ICWA 2IL8A 4ZAIA 1CA6A 5EPKA 1AZPA 3IFDA 3LWEA 2RSNA 4IUTA 2SDFA 2KOLA 5CORA 3TN2A 4ZLTF 4XT1B 1SDFA 2MPMA 3KBXA 1HUNA 1B2TA 2HDLA 5EKIA 1HA6A 4IURA 5EQ0A 1DOMA 3G7LA 1KNEA 3H91A 2DY7A 1HUMA 1WTWA 4HCSA 1BNZA 1EOTA 1WTQA 2KUMA 4RWSC 3KUPA 2B2YC 1PFNA 1MI2A 1WTRA 1MSHA 1QG7A 1RHPA 2RSOA 4X3UA 2FINB 3DEOA 3N52A 1X32A 3P7JA 2HCIA 5COYA 1SAPA 2K1BA 1G6ZA 2HCCA 1MSGA 1AZQA 4XT3B 1EQTA 2B2VC 2FHTA 1HRJA 2H1EA 2VXWA 3I8ZA 4HEDA 4CJ2C 3IL8A 4HAEA 1X3PA 2FMMA 1WD0A 1SSOA 1C8CA 4LMQD 3TZDA 4ZKCB 1IKMA 1GUWA 1AP0A 1WVLA 1G2SA 2N88A 2DY8A 1B3AA 4X3SA 4DN4M 1PLFA 1B4OA 1NAPA 1EL0A 3MTSA 1NCVA 1RTOA 4CJ1B 3FPUB 4O42A 5D14A 5JJZA 2FFKB 2HUGA 1B50A 4NW2A 4X3TA 2M2LA 2XIWA 1ZXTA 1X3QA 1PFMA 3F2UA 4ZKBB 2KVMA 1DONA 1IKLA 1Q3LA 3GV3A 2NWGA 2HDMA 3I91A 5E4XA 5EPJA 1NR4A 1O80A 1B53A 1BF4A 4RA8A 5AFWA 2FJ2A 2L1BA 5E4WC 2B2VA 2N55A 4ZK9B 2NYZD 5D65A 1DZ1A 1S4ZA 1VMCA 2K28A 2Q8RE 1F9QA 1DOLA 2B2WC 1E0BA 3I90A 1U4MA 4MHEA 2Q8TA 4CJ0B 4HSVA 3GV6A 2D9UA 1PFBA 1A15A 3HP3A 1G91A 2B2UC 3R93A 1F9RA 2JYOA 2B2TC 4R8IA 1WTPA 2R3ZA 2X6GA 1CA5A 4RAUC 1IL8A 1ILQA 4QUFA 1EIHA 3ONAB 2EPBA 1BBXC 2B2YA 5DNFA 4OIJA 4IUUA 4U68A 2KECA 2BDNA 1WD1A 1QE6A 1HFGA 2NZ1D 1J8IA 2MP1A 2KEDA 1LV9A 1F2LA 1NR2A 1QNKA 1U4PA 2JP1A 2K05A 3UI2A 1U4RA 1ML0D 1O7YA 1HHVA 1O7ZA 1TVXA 2KEEA 1WTVA 1RODA 3SVMA 5CBEE 2EOTA 5CBAE 5CMDA 2B2WA 1RTNA 1ESRA 2EE1A 3DEPA 3QO2A 1ILPA 1G2TA 1J9OA 1M8AA 1RJTA 4UAIA 1VMPA
chains in the Genus database with same CATH superfamily
2F0NA 3Q24A 1BO0A 3KLRA 3S9WA 5DM63 1CSPA 5FLXc 1SNQA 1F9SA 1Q8IA 5EKKA 2PZWA 3DMUA 4A4IA 3L2PA 1TR5A 3C1EA 3DM1A 1EU3A 1KLGD 3G4SA 2X69A 5E1FA 2L9HA 3C2PA 2F4VQ 1YJNA 4L5TA 5HY6A 2F0OA 4XQNA 2JA6B 2QKIC 3J7AV 4DUZQ 1Q90A 2YTXA 1Y69U 1GUNA 1HNZL 1FR3A 3QOJA 5EPKA 4IUTA 4H7BA 2F3IA 3TSSA 4DR3Q 3ZYYX 1WFQA 2UUBL 3VA5A 2SNSA 3UDGA 4RHRA 1HUMA 2A73B 5I6YA 1HTPA 3PSIA 2B2YC 2BDOA 3BDLA 5A35A 4LW1A 3NPPA 2HCIA 3FPPA 1DCZA 1J5EL 1T9HA 4DNTB 2XWJB 3AYHB 5JEAG 4HAEA 2UUCQ 1M90C 4AYBB 5JVG3 4TQUS 1N36L 2NB0A 2IPKD 2OQ0A 2CCZA 4FYDA 4OGQC 2NTTA 5JPNC 4DV3L 1EYDA 4DV1Q 4FXGC 1PYBA 3WDNA 1STHA 3MFGA 1ENCA 5HGTA 3I91A 1E2ZA 4B3SQ 2F0JA 2R7FA 5FO8B 3HOUG 1GM5A 1L2FA 2NYZD 3CQZH 4IN3A 1PTOD 3HOXG 4FF3A 4EQ5A 4MHEA 2L15A 2HQLA 1Q81C 1KQSA 1EY5A 1RKNA 2N78A 4XQQA 1EIHA 4NKLA 2EPBA 2KA7A 1CHPD 3TEHB 2KECA 3W1BA 4AYBE 4C1NI 1XXGA 3S16H 1VQ8A 2F0UA 3WWVA 5CBEE 3S15B 1ESRA 5J39A 1HZCA 2KQ3A 3HOVB 5CV8A 2RHSB 1B44D 4NPSA 5JEAH 4DR7Q 2JA7B 2CWPA 1IBLQ 3KF6A 4MTKA 5CV7A 2F1MA 2E75C 4MZ9A 2IY5B 4BBRB 2UUBQ 2I5LX 4U673 3GTLB 1HR0W 2L11A 2E8GA 4A3JG 1Y8OB 1FD7D 4M8AA 4OIKA 3VYRA 3BZDB 3FVQA 1SE4A 2ICEC 2IL8A 3HOUH 1VQAA 5M5YB 1XNRQ 1IYVA 3U4ZA 3BVZA 5C44G 2E2HH 3QG1A 4BA2I 4LF4L 4DU9A 3HOXH 2FXQA 3Q8DA 1MJCA 2UXBL 2BOSA 2JN4A 3CW2C 4J1MA 1PA6A 2KUMA 2WFWA 2Z6KC 1O7LA 2WKCA 3K80C 4DV3Q 4A3GB 3VR6A 1SXTA 2JE6I 2IW3A 3S1QH 1SFOH 3X3MA 4HJ8A 1EEID 2HHHQ 3FRPB 2ES2A 1ZKOA 2R7ZG 1HNXL 4LMQD 1A3UA 4JI6L 1YHQA 4G7OC 3M4YA 4X3SA 4DN4M 1STNA 4B3RL 3RD4A 4A3EH 3KK7A 3HGBA 2GVAA 3MVVA 2KHSA 4LUOA 5C5LA 2KHIA 5J3BA 4IO9A 2BH2A 1O80A 3TP5A 5CC4A 4DAYB 3PUWA 2YTYA 2QEJC 1V8QA 3P20A 2EYMA 4A3JH 1S4ZA 2Q2HA 1EY6A 2QILA 3PUVA 4CJ0B 4HSVA 1EYGA 3V96A 1HXYD 3R8BA 2UXCL 1ZYRC 3KDFA 4CHTB 4EGVA 2SOBA 4JOIA 1Y1WB 4QUFA 5FOBB 1I3QB 1SJHD 2B2YA 1WCMB 5FLXL 1PXUA 3MAQA 1JOKA 2FMCA 5KYIA 4X64L 3IAYA 3T4AC 4EX5A 1O7YA 1DD2A 2O5JC 3RZOB 1K83H 2F0LA 1K8AC 5CBAE 3MA2B 2F0FA 1VQ7A 5G3LD 3D6CA 1PV4A 3F8TA 4HJ5A 5M3FB 5D3DA 2ZTDA 1TIID 4JK1C 4KKUA 5T1IA 2R93B 2JA8B 4JI0Q 3N6RA 4X3KA 5BN5A 4XYOA 3TS2A 1WTHA 3Q0AA 1MJEA 1PYWD 1LLRD 1KD1C 1UWVA 3CCLA 4QUCA 3K5LA 2NVTB 1CA6A 4N9PA 1LUZA 4R4OA 4JI2Q 2KOLA 1EFWA 3QOLA 1SDFA 1H9MA 1IYUA 2XGTA 4RCNA 3MZ5A 1H9KA 1XPRA 3CMEA 1KDBA 1YNNC 2F0PA 2EY5A 3RUZA 4POFA 2WB1B 4JI6Q 4G4KA 3HZXA 1QG7A 4B3TL 2MNAA 2EYJA 2FINB 1E22A 5DM73 5KNBA 2A69D 1R4PB 1VQ4A 2K1BA 3KFUA 2Q2TA 1JJ2A 2FHTA 2LXJA 4QQBX 3IL8A 3A8KE 2Q2UA 2EVBA 2F3WA 4A3MB 3D3RA 4RHSA 3O13A 4DK6C 4DR4L 2EDGA 2Z6BA 3HOYG 4KN4C 3FPUB 5FKAC 4PQXA 3D31A 2C9OA 2A6HD 2VUMG 5J1ZA 4OO1H 5DEHA 3E0JA 2LY7A 1IKLA 3X3NA 1YJ9A 2E2DC 2CH4A 1IZ6A 4JBJA 5IODA 4OHJA 3H3VC 1HNWL 1HR0L 4IJHA 2PW7A 3S2HH 1EU4A 1FYCA 3SDZA 1VQHA 1DZ1A 2WB1E 3S1MH 3EQLC 4PMCA 1U4MA 1IXRA 2I5HA 1XMQL 4JI5Q 5I2YA 2B39A 4B08A 2EYOA 4LFCL 3R93A 3OMGA 3SK6A 4WRDA 2R3ZA 4RAUC 1EQQA 1KC8C 2UUAL 3RN5A 3T1YL 1VQOA 4FF1A 2EYHA 3UDIA 4KHPL 2MP1A 2WKDA 2KEDA 4JI7Q 2VQEQ 1UEBA 1LTSD 3UI2A 4BWGB 5IT9c 3MFYA 1PMRA 4GNXA 1M1KC 3SVMA 1FVIA 1XMOL 4KHVA 2ZJRA 2B2WA 1U9RA 4K2KA 1K8OA 3H09A 1A0IA 5GQOA 1I4RA 3QJYA 2F0TA 4YWLA 2B2TA 3CQZB 3J81i 4Y52H 2J7ZA 3CCUA 2J0TD 3A74A 1X65A 3HOYH 3J81c 3K59A 4TVAB 2VUMH 2RVLA 3D8GA 4DFAA 1Y1VG 1QOHA 3VYSA 4A76A 3PQIA 2PCFB 4XQJA 3NWSA 1LYLA 3EROA 1HZAA 1ICWA 4UHVA 1X9NA 2N49A 1YHBA 4HTHA 5C0XI 4IFDI 5KEEA 1IW7C 2F4IA 3NE5B 3PUYA 3J7AF 4FP5D 1W2BA 1JOQA 5HURA 4LF8Q 3W5OA 1AEXA 4CDDC 1RHPA 1TS4A 4BXXG 1X32A 2EYLA 1U0LA 3STBC 4GKKQ 3KF8B 3ICEA 3A54A 4LFAL 1A2UA 1FNUA 1D5ZC 2ZXPA 1SMXA 2G5DA 3E6ZX 2LXKA 2F0HA 1C8CA 2RHQB 1TWFH 4HMJA 4K8IA 3HOUB 5C4JH 2UU9L 2F0VA 3BG3A 5JJZA 2QW7A 3HFZB 3M4QA 3J80i 2E2HB 1WJJA 3SK8A 3HOXB 3ULLA 1NY4A 2NN6I 1HH2P 5C6AA 2HIXA 3J80c 1ESFA 4JI3L 2UUAQ 2ID0A 2IT1A 3T1HQ 1Y1VH 3NP8A 3VR2A 5C4HA 4H13C 2K28A 3FHWA 1DOLA 1X6OA 3S1QB 1SFOB 2OXPA 1EWCA 1WI5A 3HP3A 3SXHA 4KN7C 5KYLA 4R4IA 2QA4A 2KBNA 3HEJA 5ELCA 3HG9A 3H15A 2F03A 4BA1I 1QE6A 4X65L 3KLSX 4L5RC 5GAGC 1YIJA 3NEMA 4BBSG 2ALYB 1EIYB 4BXXH 3KLSA 1KRTA 2KEEA 2PQAA 4GLXA 4JYAQ 1K73C 2EOTA 1CUKA 1QUQB 3NQTA 4ZQ3A 1G2TA 3UE0A 4YHHL 1V1PA 4NDXA 2GA4B 3GTGH 4DR5L 4A3JB 2X6LA 3HOWG 5L37A 2ZJPA 2C5CA 2E5LQ 1N33Q 1QJOA 3MWYW 5T1GA 4QY7A 2R92G 3CCQA 4PV1C 1KAWA 5C44B 5M5YH 1CKMA 2UXDL 1Q12A 1PRTB 3IRBA 3FDTA 5EAYA 3VR4A 4ZAIA 2E2JB 3T51B 1I94L 4DK3C 5CORA 1LT5D 1LACA 2F0MA 2K52A 2NVQH 1PZID 1K83B 1G51A 5JAVA 5IWAQ 3HS0C 1KNEA 3DUZA 3H91A 2DY7A 4C3IG 4LF7Q 2GN5A 2P5ZX 1EQVA 1BCPB 1F2MA 1I6VC 1OXSC 2AUKA 2R7ZB 2G9HD 1VQKA 1AE3A 5C3WA 5COYA 1B70B 1RDPD 4RH6A 1KABA 4CGYB 3EIVA 1PH7A 3J7YW 2F0EA 5ISRA 2K75A 3S17H 2A6ED 4JI3Q 3T13A 3K6OA 4QMGA 5CYUA 3J81E 1N32Q 2K5WA 3F1ZA 3HKSA 4AIMA 3HOWH 3F2UA 1EZ8A 4YWKA 2NWGA 2BE5C 2CWAA 1V9PA 2TSSA 1WYDA 2A6EC 2FJ2A 4CKEA 4HN7A 1PH1A 5A2QE 2VQFL 1KDCA 4A75A 3L9AX 3H3VI 3K57A 3HKZG 2CW0C 4A3DG 4A3KG 1PTOF 1EY4A 3ONAB 2L0CA 4C3IH 3I2ZA 3RZOH 1EUJA 5JJLA 2Z9HA 1IHZA 3PO2G 3J81L 4GN3B 4QB4A 2O4XA 3KLWA 1X55A 1O7ZA 3CKIB 1N34L 1NE3A 4KHZA 4RFBA 4FF2A 3NBIA 1S3OA 1BUVT 4N8FA 3Q6SA 3T16A 5IE8A 3S2HB 1EQRA 5A2QL 5EPLA 1SYBA 4H44C 5LHY1 1QZHA 3S1MB 5KNCA 1SR3A 4KJNA 1K9MC 1JE4A 4DV0Q 2L12A 4OWWB 2YTVA 3F2DA 4DV6L 1TS5A 4Z9CB 1T5EA 1YHAA 3I3CA 4MN3A 3I56A 1D7QA 2RF4A 2HIVA 4YWMA 2PNRC 4KY6A 2SDFA 2BCOA 1QB5D 1H9SB 1I4HA 1RIPA 1SNMA 1XPOA 2LMCB 1N8RC 2MQHA 3DWAA 3AQQA 1O7IA 4A3DH 3LWUA 4J15A 4A3KH 2CFMA 3A7AB 5D3IB 1IBKQ 1SE3A 1OXTA 2JEAI 4JI1L 4ABNA 3PO2H 4DAVA 4DUYQ 1K8GA 1OXUA 4A3MH 3HOYB 4FXDA 3W2DA 2DJFC 2IHFA 4B3ML 2VUMB 2K50A 5I9PA 1G2SA 1W6KA 3Q22A 4A3IH 2PYKA 4NXNQ 5KGUA 1TWGH 3NBHA 4CKCA 1NCVA 1SMYD 4APVA 1DYQA 4EVOA 4DXGA 2JA5G 4JOIC 4JI4Q 1A8VA 2SEBD 3I70A 5E4XA 4TSSA 1Y8NB 5K36G 3NK9A 5ELBA 5AFWA 4P73A 4L5QA 1K8MA 4KK7A 5E3FA 1CT1D 4C3HG 4EQNA 4UY8C 2NVYH 2D9UA 4XXEA 4KD4A 3E5SA 3GTMB 3LX0A 1SE2A 3J7A5 2ENBA 1ILQA 1VQPA 1H9RA 1TWFB 1X3GA 2AHOB 5DNFA 3MEHA 4XTCS 1HFGA 5C4JB 4NMZA 5AJ3Q 1K3BC 4GLAC 4LFBL 4KD3A 1SYDA 3I73A 3DEPA 4L8JA 1FGUA 1RJTA 1WTXA 1XWEA 1W6JA 1CKNB 2K5HA 2NVXH 1JB3A 1Y1VB 1GHKA 2KENA 2EY6A 2E2IB 2RDFA 1SN8A 1ENAA 3DWQA 5IGCA 1QZGA 5G3LF 2A68D 1PDQA 2JA5H 1WTOA 4NXML 5C4XG 5I4DA 1HPCA 1PTOC 1CSQA 5LMNW 3J7ZC 5K36H 4DNRB 2ZTCA 1TWAH 3H6MA 1JJGA 1NSNS 2RSNA 3KBXA 4LUZA 2EJMA 1N9WA 2D5DA 5H1SE 4IURA 5IGFA 1JWMD 3G7LA 2NBFA 1WTWA 1HNZQ 3JAMc 4HJ9A 2OEOA 3GTGB 1MSHA 2PO4A 1SNCA 4WJWA 3DEOA 4LJZC 3NTKA 2ZXOA 4DPGA 3S1RH 4K8JA 2YYZA 2VS1A 2F0DA 2H1EA 1YNJD 3I8ZA 5CGKA 5C0XG 4IFDG 4F88A 3CRKC 1B9MA 4HMIA 4P2CB 4ME5A 1MBYA 3F2BA 1KLUD 1C48A 2BH8A 2N88A 1PLFA 1PRTD 1J5EQ 1UUPA 4JG2A 1GD7A 1T5XD 3I4OA 4TKOB 1NMFA 2NVQB 1N36Q 3U9SA 4LF9L 1KL9A 1VS0A 3KOJA 1JJCB 2G9DA 4QF4A 2EXDA 5GROA 5BN3A 4Y7NH 2B2VA 4X62L 5C4XH 1CTMA 1BCPD 2MFIA 4GNXC 4DR6L 4AQYL 3SHLA 2ZM6L 2B2WC 2VB3X 2D2CC 1LTBD 4QGUA 5FLXE 3E9HA 4GKJL 4BBSB 4OL7A 2B2TC 2MO1A 3GO5A 3NXWA 4DV7L 1CA5A 1OO9B 3I55A 3RNUA 3S17B 4JCVE 2DNEA 1EZ6A 2NN6G 1Q1EA 1QCBD 5JEAJ 4DR1L 1NR2A 4WFN3 4OX9L 1RCVD 2XN9C 4HR7B 3HOWB 1CFMA 4EQOA 2EJFC 1K3RA 2VW9A 4ZUIA 1EEFD 2ASBA 1MHWC 5C0XH 3K5MA 4IFDH 3I4NG 3TBIB 2R61A 2AKWB 4UP7A 3GTPH 2PI2E 2KCMA 1MKHA 4QJFA 5C44H 1HZBA 3AB9A 4XIGS 2E2JH 1MGSA 1GHJA 1TWHB 1MD2D 1QILA 4JV5L 1JICA 4C3IB 5IIFA 4FXKC 2PMZB 5CV5A 1UNSA 2NZHA 2H5XA 3LWEA 4ME3A 3BDOA 5C3EG 1B2TA 3DXJC 1Q86C 4MNOA 2F0SA 1VCIA 3ULJA 3TS0A 2I0QA 2R7ZH 4O1NA 2B63G 4CDCC 2N3SA 4DV5L 1JORA 3A8IE 1KDAA 2CQOA 3I4LA 4LF4Q 3H0GG 1TU2B 1S40A 4A3FG 2VY3A 4HIDA 2UXBQ 4F7XA 1C0AA 1XNQL 2A74C 2CQAA 4GOPC 4HEDA 2XWBB 3SR1A 2PW5A 1BOSA 3ER0A 1D6EC 4Q0FA 1S5CD 4DV4L 3RZDH 4N9TA 1NAPA 1KHIA 3GTKH 4DR6Q 3BZCA 4AQYQ 1DXMA 3I4NH 1PH2A 4NW2A 2PMZE 1HNXQ 2A8VA 1VDZA 3P75A 1PFMA 3RMHA 2EY2A 5DLQE 3B6YA 1Q3LA 1DONA 5EPJA 2B29A 1NR4A 3HKZB 4B3RQ 1STAA 3BJUA 3K5NA 1A3TA 4A3DB 1SNDA 4A3KB 4JBWA 5LMNL 3CPWA 4RKBA 1ONLA 2Q8TA 2DGYA 4DR2L 2OTLA 1GXDC 4OX9Q 3KF6B 3PO2B 1K0SA 4AH6A 2EXZA 5C3EH 1JMCA 1Q8KA 2K5NA 2A69C 5M5WH 3HRZC 5JVH3 3CPFA 3OYYA 1LT3D 1FL0A 4OIJA 4A3IB 2B63H 5IYDG 1TWGB 3D0FA 4PZ6A 2UXCQ 3PIPA 3PO3G 4ALPA 3K8AA 3H0GH 1QVFA 5I9OA 2Q8IB 4A3FH 3QO2A 2K6AA 4XYQA 1M8AA 4BY1G 1QUQA 4X64Q 1STEA 5KRUA 4Q5VA 2A6HC 1E2VA 3HKZE 5EJWA 2JA6G 4LUVA 3GTQH 2NVYB 3OIQA 2O2LD 4FDBA 1LABA 1HFNA 1STGA 3W1GA 4LK1C 5M5XH 3PCOB 4OXPA 4E6IA 4WJ3M 5F2DA 1Z9FA 1TQOA 4OWTB 1JWSD 4I7ZC 3U9OA 4JBKA 5LL6X 4ZRZA 2B8FA 2JJQA 2K14A 1S5DD 4HCSA 4RGMA 5CV9A 5BR8L 1AH9A 1STBA 1PH8A 2NVXB 1PH9A 2XTIA 4X3UA 1BQQT 1EYCA 3N52A 1G291 3QIAA 1L1OA 4FVMA 5IYDH 2ICIA 2RKSA 1TY0A 1B3QA 3PO3H 1W3SA 1ASYA 1Q46A 2JA5B 5GAHC 4B3TQ 1K28A 4R4QA 2AQ2B 3KDFB 3TZDA 4JI8L 4ZKCB 1AP0A 3M9BA 2KJXA 4BY1H 1EL0A 2DJGC 1TWAB 2OT2A 5LMNQ 3H3VH 2PNHA 1D1IA 2CH4W 1VQFA 3ZJYC 2MHVA 1NBWA 2JXMB 1SNOA 3H94A 4DR4Q 1B53A 4PMWA 2KCTA 3LGJA 2L1BA 1QVCA 2OCEA 4OONA 3BU2A 3GTMH 3GTOB 1F9QA 1YEZA 3URYA 2D62A 3BVGA 2A5HA 2HD3A 1BDOA 4DXFA 3CXCA 3J81j 3U4VA 3S1RB 1M4VA 3U50C 1HNWQ 3OPOA 4RMFA 1HR0Q 4RKLA 2JYOA 3K58A 3I4MG 2KHJA 1RF2D 1STYA 4WJ4A 1SROA 1XMQQ 1Y14B 3QWNA 2XRSD 4YY3L 4K5WA 4P75A 4LFCQ 2F0GA 1U4RA 4PMBA 1C4QA 1HHVA 1YZ6A 4GOPA 3T1YQ 4PNYA 3RR5A 3CMAA 3A7LA 4KHPQ 2E2IH 4TRDA 2WV6D 4Y7NB 4GN5A 5C4XB 3HOZG 1BBUA 1HTLD 1XMOQ 3A5UA 4C56C 5FO9B 1P8LA 4P74A 1Q7YC 1EY7A 1A6XA 3EA6A 3CHBD 1VQGA 1EY8A 2KCCA 3V05A 1KRSA 4R4TA 2K33A 3TREA 1GKHA 3QB3A 2QGQA 1H9SA 1BNZA 3SE0A 5M3MG 3ITPA 4BY7G 3I4MH 3GTPB 2F52A 4K6LA 4J6HA 4MIUA 4HCEA 1F2YA 4CBVA 1CK1A 2DUDA 1B1ZA 1A3VA 3OSOA 1BXTA 1EWHA 3GP7A 1EWIA 1UE7A 1SNPA 2Z4IA 3MXGA 5IYBG 1WVLA 1B4OA 4OO1I 1C9OA 3K0XA 4LFAQ 1UE1A 1G6PA 3AFPA 3HOZH 1ZXTA 4ZKBB 5IT9E 3A55A 3AU7A 5LMUL 2HDMA 4LF5L 3PIOA 2D0PA 2UU9Q 4IJLA 2JA9A 1Y8PB 3NUCA 3U58A 3E3XA 1S5ED 4BBSH 1UE6A 2Z0SA 3ND9A 1HZ9A 1B7YB 3MXNB 1A63A 2AWNA 3SEBA 4L63B 1LTID 1D1KA 3V2TA 4F8MA 2JK8A 4G57A 4A93G 1HQRD 5KNDA 4CDEC 3PF5A 3RZDB 1WD1A 1NTGA 3BYTB 3GTKB 3WOFA 4S3SA 4BY7H 1LV9A 2K4KA 3CU7A 4A3CG 2JP1A 3K7UC 2K05A 3I4NB 2AUJD 4X66L 4DK1A 3CRLC 2B8GA 2R92H 4HIKA 1UE5A 1VQBA 5IT9L 4X65Q 1J9OA 4OELB 3L3OC 4GS3A 1KIXA 4UP9A 3ULPA 4KMUC 1CKNA 3R3OA 5FO7B 2K5VA 5LL6S 5IYBH 1TWHH 4ZYSA 4YHHQ 4IUVA 1XTDA 5C3EB 4DR5Q 1EIGA 2L4NA 5M5WB 1CQFA 1F9PA 3WOEA 4DR3L 5JJKA 3M4PA 3GQBA 2B63B 4RG1A 1VQ6A 3IFDA 3TN2A 5EBCA 4XT1B 4IQZA 3CD6A 1CHQD 3G6EA 2UXDQ 3H0GB 5EKIA 1DJRD 3AMUA 4A3FB 2JEBI 1I94Q 4OWXB 1H9JA 1VQNA 4KKSA 1AFPA 3KUPA 3J80E 1PFNA 2VB2X 3GTJH 4I65A 3TRZA 1GOZA 2F0QA 1UAPA 2L55A 4IZ8A 3KJOA 1PHJA 2UUCL 3GTQB 4KKTA 1SAPA 3S14H 4PG3A 1ENFA 2QEXA 4A3CH 2B2VC 1HRJA 4LF6L 4DV1L 1X3PA 4HJAA 2JQOA 3CAMA 3EBEA 5M5XB 3ND8A 1VQ9A 4B3SL 5IP7G 3S1NH 1I6HH 4A3BG 5NUCA 1RD9D 1BVSA 1I5FA 3OMCA 4O0AA 1PRTF 2EYPA 1PH5A 4DAPA 2PQAB 4HSPA 2AWOA 4JW0A 5HGQA 2PI2A 3SK5A 2QDBA 3J80L 5D65A 4LAAA 3M4OH 2PPBC 1LTLA 4X66Q 2K5QA 4KY5A 2LSSA 3PO3B 5GADC 1EYAA 3C46A 2E74C 3DHQA 2VQFQ 1SYGA 1F9RA 1BCPF 1I4QA 1IL8A 5EBDA 4IUUA 4PZ8A 3CCSA 4J8QA 2BDNA 3TDQA 4WORA 4BY1B 1U4PA 3C1FA 1ZEQX 3NTIA 2IWHA 4DR7L 1IBLL 1LTAD 5BN4A 4C1NK 4DAYA 1SMYC 1ILPA 2YU9H 1FNWA 1QWYA 4IALA 3VR5A 3KBGA 2MO0A 1VMPA 1AN8A 2VNUD 1X54A 1PH4A 5IGEA 3R2IA 1JT8A 1ET6A 1N34Q 2K01A 4R9WA 3NWTA 1QVGA 1RL2A 1S5BD 3CCVA 2CVRA 3FKIG 3RLOA 5IP7H 2K32A 4A3BH 1XNRL 3QR8A 4ILWA 1XYIA 3BVMA 3K7AH 2EYFA 3M3YH 1SRUA 2R7DA 5ELNA 1HUNA 2C35B 4DV6Q 5CV4A 2HDLA 1PFSA 3KYHC 2I46A 3D4DA 3S24A 4LF6Q 2A19A 4KLKA 3M7NA 3VDYA 4LNQA 2HHHL 1GUTA 2RSOA 3OW2A 1LTRD 3TZUA 4YCUA 2I5MX 4G7HC 1E7ZA 2NZOA 2RCFA 4LWCA 2QCPX 4YCVA 5IGGA 3NELA 2ZJQA 1JQYD 4F87A 1GUWA 1GO3E 2WINB 3JAMi 1LO5D 4JI1Q 4C3HH 2A68C 1YJWA 1NJIC 1FJGL 2AQ3B 1ASZA 5FJ8G 2ZTEA 2LFNA 4KY7A 4B3MQ 2FFKB 2HUGA 1B50A 1Q82C 3D4RA 4X3TA 4FO2A 1S72A 1TT2A 5ELOA 1OTCA 4MTNA 3GTOH 2OWOA 3EFXD 5JJIA 3TMEA 3FKIH 5E4WC 1O78A 1TWCH 1F77A 4ULLA 3I4MB 1DGSA 2EJGC 3I90A 2K7VA 1E0BA 4A3EG 4ZUJA 2AMCB 1PFBA 2QDLA 3K81C 1A15A 2R6GA 1I4XA 3TQYA 2X6GA 5IYCG 1L0WA 2N8NA 1EY9A 1CZGA 1BBXC 2RDGA 1R9TH 1D8LA 1R4QB 4PZ7A 2ATWA 1IYJB 4KTAA 1YNJC 2F0IA 5IGBA 1QNKA 3T56B 3HOZB 1WTVA 1RODA 1X3EA 1PRTC 2F0WA 3PIO3 4P72A 2JSOA 1GUOA 4UAIA 5EKLA 4JI0L 5C3XA 2OQKA 2B2UA 4YCWA 4G7ZC 1PTOH 1CI3M 3DLLA 4JPBW 4LFBQ 2MGSA 4R8NA 2MJ8A 3BS1A 5I6WA 3DM3A 1KNAA 3Q23A 3CCMA 1KXLA 5FJ8H 1OXXK 1BCPC 4JI2L 1NNXA 1GUGA 4V190 1II3A 1L1OC 2E76C 3A8JE 2ZT9C 3D6WA 3EN2A 1CM9A 1DOKA 1BKBA 4I7AA 5M3MB 5GAEC 1TKWB 4BY7B 1GVPA 1PVOA 4NXMQ 2RDHA 3JC66 4X6AH 3NBHB 2NUCA 2R92B 3A5ZB 2M9VA 1DOMA 1JCKB 4V0BA 1WOCA 1K0RA 5IY0A 5DAUA 1WTQA 3CF5A 2H4OA 3OWEB 1ZYRD 2HT1A 2PZTA 4GLVB 5IYCH 1FJGQ 4K5VA 3OW7A 1NMGA 1TS2A 4FF4A 1ET9A 1DM0B 1MSGA 3E0EA 3T53B 3UDFA 1SSOA 3AEVA 1HCZA 4K5XA 3EJIA 3BZKA 2LS01 1RTOA 5IOCA 1D2BA 3UDXA 1VQJA 1E24A 2DN8A 2IHEA 2WAQG 3I7FA 4IUNA 4UPAA 2Y0SG 3K0YA 4JI5L 3F2CA 5CV6A 4K6DA 3S2DH 2NN6H 1SJED 4B9XA 3GTJB 4ODGA 4A93B 1E2WA 3KF8A 1P16A 2Q8RE 4LF9Q 2SNMA 1CQVA 4NB3A 4GZYC 3S14B 4C3JG 2IJ0A 4JI7L 1G91A 4X62Q 2VQEL 4DGZA 4OO1G 5IP9G 1WTPA 3AFQA 2CHBD 1V43A 2ZM6Q 3R2TA 5C0XJ 3SK4A 4IFDJ 1YNND 3BDCA 1E3PA 2EIFA 3DWPA 1J8IA 4GKJQ 4O2DA 3S1NB 1I6HB 3NENA 2YV5A 2Q2IA 3OTOL 4DV7Q 1JR0D 1ML0D 1A62A 1TVXA 4IPGA 4ID6A 3FP9A 1U5KA 1SBBB 4DR1Q 3G71A 1YI2A 3JAME 3CCRA 3M4OB 1PZJD 1VQ5A 2DNCA 2I07B 4K0KL 2HQEA 3GDEA 1EIFA 2PQEA 1ICFB 2EZVA 1PH6A 3PF4A 5C4ZA 1XPUA 3CCJA 4A3LG 3M7GA 2K03A 1LTGD 1VF7A 4LF8L 4QIWB 1L0XB 2K5DA 2WACA 4JV5Q 5K5PA 1I4PA 4NP5A 1XTCD 1JE5A 4C3JH 2YU9B 4IOAA 4GKKL 2KCNA 4C2MH 2VL6A 4RWSC 2Z4HA 1HA5A 3MC0B 5IP9H 3JAML 5C5MA 1G6ZA 5ELFA 4UP8A 1BBWA 4XT3B 4DV5Q 1SLJA 3E9IA 4K2LA 3M85A 4A3BB 2RBMA 2O5IC 2FMMA 4UDUC 1VQIA 1WD0A 1I50H 1JOOA 4B9WA 1IBML 2DY8A 1B3AA 1MIUA 4BS9A 4HIOA 3K7AB 4RCOA 1XNQQ 3MTSA 4O42A 3M3YB 5D14A 4KJOA 1PYSB 3I72A 3T1HL 3TP6A 2Z6KA 4AYBG 3L0OA 4QL5A 4DV4Q 3EVQA 4QIWE 2IX0A 1E1OA 1J6QA 4RA8A 1IL2A 4IPDA 1SEBD 2J4XA 4HJ7A 5FK9C 5JOBA 1EFID 4A3LH 3OTOQ 2D0OA 3OIPA 1SYEA 3MXUA 3OOCA 1VQEA 3MXNA 1TXYA 5FLMG 1IW7D 3RLFA 4JYAL 4DR2Q 4RGNA 1XJVA 1LM0A 2JA6H 2LKVA 4C3HB 1KAAA 5ELDA 5I2XA 4DAMA 4K0KQ 3CC2A 1OXVA 3G48A 4FNFA 1LT6D 4RGOS 3STBD 2E5LL 1TY2A 1N33L 3S16B 2A1AA 3FKIB 1TWCB 5E7NA 3NTHA 2GVBA 4XDXA 3ERSX 3VYUA 3HOVG 4IUQA 1SYFA 4L6TB 4DV2L 1D5MC 3FMCA 2JA7G 4YIJA 1D5XC 3IFTA 3RLNA 5IWAL 1Q1BA 4JVZA 2B3GA 3NHHA 1R9TB 4LF7L 1U4LA 4EQPA 1H95A 4BBRG 5KIXA 3OWFA 4ZLTF 5J22A 1NUCA 2Z8LA 1HA6A 5EQ0A 3CCEA 4P71A 5IGDA 3CP0A 3A0JA 4DK0A 2WIIB 1MI2A 2Z1CA 3NSWA 5TSSA 4RGTA 1PTOB 1IBMQ 1F2ZA 5FLMH 1X56A 4DF7A 3P7JA 1SE8A 2ZXRA 5BR8Q 1AZQA 1EQTA 1N32L 2VXWA 1G8ZD 1VF5C 3ERQA 3IKJA 1LTTD 3TP7A 3K5OA 1VQMA 1I4GA 4A3GG 1IKMA 4KV6A 1JC7A 1B8AA 4JC0A 2IX3A 3PGZA 1SYCA 4HIMA 2TMPA 1HQMC 3FEWX 3KJPA 3LNNA 1X3QA 4IPHA 4JI8Q 3CC4A 4A3EB 3S15H 1BF4A 3P1HA 3CC7A 3SGIA 3HOVH 1GUSA 4H02A 1BR9A 2AQ1B 4ZK9B 2JA7H 3PV0A 1KTKA 3NQIA 2F3VA 1LT4D 4OEMB 4BBRH 4M1UB 4R8IA 3GTLH 3VA7A 2OTJA 2MUYA 3GD7A 4DA2A 5M9OA 1V1OA 1F2LA 2XSCA 1TS3A 4GNXB 1Y1WG 2XNAC 1JWUD 1WCMG 1Z7TA 4YY3Q 4DV2Q 1C7YA 2BA0A 4R4CA 4DV0L 1QNUA 3MEFA 3S2DB 2OF1A 4IUPA 1Z47A 2RA4A 3PUZA 4IOCA 3RN2A 4A3GH 2VZAA 1L0YB 1UEAB 1XX8A 3MXPA 1GJXA 1L1OB 2RQXA 1S5FD 5M3MH 5M3FG 2XRQD 1YNXA 1V1QA 3A56A 4K14A 2K04A 2M00A 3D4WA 2R93G 2JA8G 1CKOA 4N8X1 2BE5D 1JB7A 1AZPA 1EOVA 2MPMA 3VYTA 1IBKL 1E1TA 2V1CC 1FGBD 2F4VL 1EOTA 4DUYL 1VQDA 5CR3A 1WTRA 2CW0D 3PMFA 4DUZL 2WP8J 2NTSA 1EY0A 2RCNA 3OHXC 2HCCA 4NXNL 2QF7A 4CJ2C 2WB1G 3TP8A 3PIP3 2WAQB 1YVCA 1Y1WH 2EQSA 1VQCA 4JI4L 2IX1A 3C3LA 1I3QH 1YITA 2Y0SB 1WCMH 3BYYB 4ZCKA 1FNVA 4QCLA 4CJ1B 4GN4B 1HJPA 2PZUA 2M2LA 2XIWA 1B9NA 2L5TA 4CDFC 2KVMA 4IPCA 4A3MG 3GV3A 4A93H 4C3JB 4DNIA 1Z6HA 2V4DA 1AW7A 3G6JB 4C2MB 4GOPB 4L5SA 5M3FH 2N55A 3UE1A 4H0LC 3VR3A 4A3IG 1PH3A 1VMCA 5LMUQ 2F0KA 3L7ZC 3GV6A 4LF5Q 2JA8H 1A2TA 2R93H 2EY1A 2B2UC 5EGTA 2BA1A 4KI0A 5AJ3L 1VQLA 3W3AA 4R1JA 1I50B 4CKBA 2WAQE 2CKZB 4U68A 4JBMA 5ELEA 2NVTH 2NZ1D 4POGA 1PZKD 1YBYA 1CZWA 1X3FA 2Y0SE 5JPMC 4DKAC 1AE2A 3MHBA 5CMDA 1RTNA 2EE1A 2XVSA 3PUXA 1V1PB
chains in the Genus database with same CATH topology
2F0NA 3Q24A 1BO0A 3KLRA 3S9WA 5DM63 1SNQA 1F9SA 1Q8IA 5EKKA 2PZWA 3DMUA 1TR5A 3C1EA 3DM1A 1EU3A 1KLGD 2X69A 5E1FA 2L9HA 3C2PA 2F0OA 4XQNA 2JA6B 2QKIC 3J7AV 1Q90A 1Y69U 1GUNA 1FR3A 3QOJA 5EPKA 4IUTA 4H7BA 3TSSA 3ZYYX 3VA5A 2SNSA 4RHRA 1HUMA 2A73B 5I6YA 1HTPA 2B2YC 2BDOA 3BDLA 5A35A 3NPPA 2HCIA 3FPPA 1DCZA 4DNTB 2XWJB 5JEAG 4HAEA 4AYBB 5JVG3 4TQUS 2NB0A 2IPKD 4FYDA 4OGQC 2NTTA 5JPNC 1EYDA 4FXGC 3WDNA 1STHA 3MFGA 1ENCA 5HGTA 3I91A 1E2ZA 2F0JA 5FO8B 2NYZD 4IN3A 1PTOD 4FF3A 4MHEA 1EY5A 1RKNA 4XQQA 1EIHA 4NKLA 2EPBA 2KA7A 1CHPD 2KECA 4C1NI 1XXGA 2F0UA 5CBEE 3S15B 1ESRA 5J39A 2KQ3A 3HOVB 5CV8A 1B44D 5JEAH 2JA7B 5CV7A 2F1MA 2E75C 4BBRB 4U673 3GTLB 2L11A 1Y8OB 1FD7D 3VYRA 4M8AA 4OIKA 3BZDB 3FVQA 1SE4A 2ICEC 2IL8A 5M5YB 1IYVA 3BVZA 3QG1A 4BA2I 4DU9A 2BOSA 4J1MA 2KUMA 1O7LA 2WKCA 4A3GB 3VR6A 1SXTA 2JE6I 2IW3A 3X3MA 1EEID 3FRPB 1ZKOA 4LMQD 1A3UA 4G7OC 3M4YA 4X3SA 4DN4M 1STNA 3RD4A 3KK7A 3HGBA 3MVVA 2KHSA 5C5LA 1O80A 3TP5A 5CC4A 3PUWA 2QEJC 1V8QA 3P20A 2EYMA 1S4ZA 1EY6A 2QILA 3PUVA 4CJ0B 4HSVA 3V96A 1HXYD 3R8BA 1ZYRC 4CHTB 4EGVA 2SOBA 1Y1WB 4QUFA 5FOBB 1I3QB 1SJHD 2B2YA 1WCMB 5FLXL 1PXUA 3MAQA 1JOKA 2FMCA 5KYIA 3IAYA 3T4AC 1O7YA 1DD2A 2O5JC 3RZOB 2F0LA 5CBAE 3MA2B 2F0FA 5G3LD 3D6CA 5M3FB 5D3DA 1TIID 4JK1C 4KKUA 5T1IA 2R93B 2JA8B 3N6RA 4X3KA 5BN5A 4XYOA 3Q0AA 1PYWD 1LLRD 4QUCA 3K5LA 2NVTB 1CA6A 4N9PA 2KOLA 3QOLA 1SDFA 1H9MA 1IYUA 4RCNA 3MZ5A 1H9KA 1KDBA 1YNNC 2F0PA 2EY5A 3RUZA 2WB1B 4G4KA 3HZXA 1QG7A 2EYJA 2FINB 5KNBA 5DM73 2A69D 1R4PB 2K1BA 2FHTA 3IL8A 3A8KE 2EVBA 2F3WA 4A3MB 3D3RA 4RHSA 3O13A 2EDGA 4KN4C 3FPUB 5FKAC 4PQXA 3D31A 2C9OA 2A6HD 5J1ZA 4OO1H 5DEHA 3E0JA 2LY7A 1IKLA 3X3NA 2E2DC 5IODA 4OHJA 3H3VC 2PW7A 1EU4A 1FYCA 3SDZA 1DZ1A 3EQLC 4PMCA 1U4MA 5I2YA 2B39A 4B08A 2EYOA 3R93A 3OMGA 3SK6A 4WRDA 2R3ZA 4RAUC 4FF1A 2EYHA 2MP1A 2WKDA 2KEDA 1LTSD 3UI2A 4BWGB 3MFYA 1PMRA 3SVMA 4KHVA 2B2WA 1U9RA 4K2KA 1K8OA 3H09A 1I4RA 3QJYA 2F0TA 2B2TA 3CQZB 2J7ZA 2J0TD 3K59A 2RVLA 3D8GA 4DFAA 1QOHA 3VYSA 2PCFB 4XQJA 3NWSA 3EROA 1ICWA 5C0XI 4HTHA 4IFDI 5KEEA 1IW7C 2F4IA 3NE5B 3PUYA 3J7AF 4FP5D 1JOQA 5HURA 1AEXA 1RHPA 1TS4A 1X32A 2EYLA 3A54A 1A2UA 1FNUA 1D5ZC 2ZXPA 3E6ZX 2F0HA 1C8CA 4HMJA 4K8IA 3HOUB 2F0VA 3BG3A 5JJZA 2E2HB 3SK8A 3HOXB 2NN6I 5C6AA 1ESFA 2ID0A 2IT1A 3NP8A 3VR2A 5C4HA 4H13C 2K28A 1DOLA 3S1QB 1SFOB 2OXPA 1EWCA 3HP3A 5KYLA 3SXHA 4KN7C 3HEJA 5ELCA 3HG9A 2F03A 4BA1I 1QE6A 3KLSX 3KLSA 2KEEA 2EOTA 3NQTA 4ZQ3A 1G2TA 1V1PA 4NDXA 2GA4B 4A3JB 2X6LA 2C5CA 1QJOA 3MWYW 5T1GA 4PV1C 5C44B 1Q12A 1PRTB 3FDTA 3VR4A 4ZAIA 2E2JB 3T51B 5CORA 1LT5D 1LACA 2F0MA 1PZID 1K83B 5JAVA 3HS0C 1KNEA 3DUZA 3H91A 2DY7A 4C3IG 1EQVA 1BCPB 1F2MA 1I6VC 1OXSC 2AUKA 2R7ZB 2G9HD 5C3WA 5COYA 1RDPD 4RH6A 1KABA 4CGYB 3J7YW 2F0EA 5ISRA 2A6ED 3T13A 3K6OA 4QMGA 5CYUA 3J81E 2K5WA 3F2UA 1EZ8A 2NWGA 2BE5C 2TSSA 2A6EC 2FJ2A 4CKEA 4HN7A 5A2QE 1KDCA 3L9AX 3K57A 2CW0C 1PTOF 1EY4A 3ONAB 2L0CA 1IHZA 3J81L 4QB4A 2O4XA 1O7ZA 3CKIB 4KHZA 4RFBA 4FF2A 3NBIA 1BUVT 3Q6SA 3T16A 3S2HB 5A2QL 5EPLA 1SYBA 4H44C 5LHY1 3S1MB 5KNCA 4KJNA 1JE4A 2L12A 1TS5A 4Z9CB 1T5EA 3I3CA 4MN3A 2PNRC 4KY6A 2SDFA 2BCOA 1QB5D 1H9SB 1I4HA 1SNMA 2LMCB 3DWAA 3LWUA 3A7AB 5D3IB 1SE3A 1OXTA 2JEAI 4ABNA 4DAVA 3HOYB 1OXUA 4FXDA 3W2DA 2VUMB 5I9PA 1G2SA 1W6KA 3Q22A 2PYKA 5KGUA 3NBHA 4CKCA 1NCVA 1SMYD 1DYQA 4EVOA 4DXGA 2SEBD 3I70A 5E4XA 4TSSA 1Y8NB 5K36G 3NK9A 5ELBA 5AFWA 1K8MA 4KK7A 5E3FA 1CT1D 4C3HG 4EQNA 2D9UA 4XXEA 4KD4A 3E5SA 3GTMB 3LX0A 1SE2A 2ENBA 1ILQA 1H9RA 1TWFB 5DNFA 3MEHA 4XTCS 1HFGA 5C4JB 4NMZA 4KD3A 1SYDA 3I73A 3DEPA 4L8JA 1RJTA 1WTXA 1XWEA 1W6JA 1JB3A 1Y1VB 1GHKA 2E2IB 2EY6A 2RDFA 1ENAA 3DWQA 5IGCA 5G3LF 2A68D 1PDQA 1WTOA 5I4DA 1HPCA 1PTOC 5K36H 4DNRB 3H6MA 1NSNS 2RSNA 3KBXA 2EJMA 2D5DA 4IURA 5IGFA 1JWMD 3G7LA 2NBFA 1WTWA 2OEOA 3GTGB 1MSHA 2PO4A 1SNCA 4WJWA 3DEOA 4LJZC 3NTKA 2ZXOA 4K8JA 2YYZA 2F0DA 2H1EA 1YNJD 3I8ZA 5CGKA 5C0XG 4IFDG 4F88A 3CRKC 1B9MA 4HMIA 4P2CB 4ME5A 1MBYA 1KLUD 1C48A 2N88A 1PLFA 1PRTD 1UUPA 1T5XD 4TKOB 2NVQB 3U9SA 2G9DA 4QF4A 5BN3A 2B2VA 1CTMA 1BCPD 3SHLA 2B2WC 2VB3X 2D2CC 1LTBD 5FLXE 4BBSB 4OL7A 2B2TC 3GO5A 3NXWA 1CA5A 1OO9B 3S17B 2DNEA 1EZ6A 2NN6G 1Q1EA 1QCBD 5JEAJ 1NR2A 4WFN3 1RCVD 2XN9C 4HR7B 3HOWB 1CFMA 4EQOA 2EJFC 4ZUIA 1EEFD 5C0XH 3K5MA 4IFDH 3TBIB 2R61A 3AB9A 4XIGS 1MGSA 1GHJA 1TWHB 1MD2D 1QILA 1JICA 4C3IB 5IIFA 4FXKC 2PMZB 5CV5A 1UNSA 3LWEA 3BDOA 1B2TA 3DXJC 2F0SA 1VCIA 4O1NA 1JORA 3A8IE 1KDAA 3I4LA 1TU2B 4F7XA 2A74C 2CQAA 4HEDA 2XWBB 3SR1A 2PW5A 1BOSA 1D6EC 4Q0FA 1S5CD 4N9TA 1NAPA 1DXMA 4NW2A 1VDZA 3P75A 1PFMA 3RMHA 2EY2A 1DONA 1Q3LA 5EPJA 1NR4A 3HKZB 1STAA 3K5NA 1A3TA 4A3DB 1SNDA 4A3KB 4JBWA 4RKBA 1ONLA 2Q8TA 3PO2B 1GXDC 2EXZA 2A69C 3HRZC 5JVH3 1LT3D 4OIJA 4A3IB 1TWGB 5I9OA 2Q8IB 3QO2A 2K6AA 4XYQA 1M8AA 1STEA 5KRUA 4Q5VA 2A6HC 1E2VA 5EJWA 2NVYB 3OIQA 2O2LD 1LABA 1HFNA 1STGA 4LK1C 4E6IA 5F2DA 1TQOA 1JWSD 4I7ZC 3U9OA 5LL6X 4ZRZA 2B8FA 1S5DD 4HCSA 4RGMA 5CV9A 1STBA 2NVXB 4X3UA 1BQQT 1EYCA 3N52A 1G291 3QIAA 4FVMA 2ICIA 2RKSA 1TY0A 2JA5B 2AQ2B 3TZDA 4ZKCB 1AP0A 2KJXA 1EL0A 1TWAB 2OT2A 1D1IA 2MHVA 2JXMB 1SNOA 3H94A 1B53A 4PMWA 2L1BA 3GTOB 1F9QA 3URYA 4DXFA 2D62A 3BVGA 2A5HA 1BDOA 3S1RB 1M4VA 3OPOA 4RKLA 2JYOA 3K58A 1RF2D 1STYA 3QWNA 2XRSD 4K5WA 2F0GA 1U4RA 4PMBA 1C4QA 1HHVA 4PNYA 3A7LA 4TRDA 2WV6D 4Y7NB 5C4XB 1HTLD 4C56C 5FO9B 1EY7A 1A6XA 3EA6A 3CHBD 1EY8A 2KCCA 3V05A 2K33A 3QB3A 1H9SA 1BNZA 3SE0A 3ITPA 3GTPB 4K6LA 4J6HA 4MIUA 4HCEA 1F2YA 4CBVA 1CK1A 1B1ZA 1A3VA 3OSOA 1BXTA 1EWHA 3GP7A 1SNPA 2Z4IA 3MXGA 1WVLA 1B4OA 4OO1I 1ZXTA 4ZKBB 5IT9E 3A55A 3AU7A 2HDMA 1Y8PB 3NUCA 1S5ED 3ND9A 2AWNA 3SEBA 4L63B 1LTID 1D1KA 3V2TA 4F8MA 4G57A 1HQRD 5KNDA 3RZDB 1WD1A 3BYTB 3GTKB 3WOFA 4S3SA 1LV9A 3CU7A 2JP1A 3I4NB 2K05A 2AUJD 4DK1A 3CRLC 2B8GA 5IT9L 1J9OA 3L3OC 4KMUC 3R3OA 5FO7B 5LL6S 4ZYSA 4IUVA 5C3EB 1EIGA 2L4NA 5M5WB 1CQFA 1F9PA 3WOEA 3GQBA 2B63B 3IFDA 3TN2A 5EBCA 4XT1B 4IQZA 1CHQD 3H0GB 5EKIA 1DJRD 3AMUA 4A3FB 2JEBI 1H9JA 4KKSA 1AFPA 3KUPA 3J80E 1PFNA 2VB2X 4I65A 1GOZA 2F0QA 1UAPA 2L55A 4IZ8A 3GTQB 4KKTA 1SAPA 1ENFA 2B2VC 1HRJA 1X3PA 5M5XB 3ND8A 5NUCA 1RD9D 3OMCA 1PRTF 2EYPA 4DAPA 4HSPA 2AWOA 3SK5A 2QDBA 3J80L 5D65A 4LAAA 2PPBC 2K5QA 4KY5A 3PO3B 1EYAA 3C46A 2E74C 3DHQA 1SYGA 1F9RA 1BCPF 1I4QA 1IL8A 5EBDA 4IUUA 4J8QA 2BDNA 3TDQA 4WORA 4BY1B 1U4PA 3C1FA 1ZEQX 3NTIA 2IWHA 1LTAD 5BN4A 4C1NK 4DAYA 1SMYC 1ILPA 1FNWA 1QWYA 4IALA 3VR5A 3KBGA 1VMPA 1AN8A 2VNUD 5IGEA 3R2IA 1ET6A 2K01A 4R9WA 3NWTA 1S5BD 2CVRA 2K32A 4ILWA 1XYIA 3BVMA 2EYFA 1HUNA 5CV4A 2HDLA 2I46A 3D4DA 3M7NA 1GUTA 2RSOA 1LTRD 3TZUA 4G7HC 2QCPX 5IGGA 1JQYD 4F87A 1GUWA 2WINB 1LO5D 2A68C 2AQ3B 2LFNA 4KY7A 2FFKB 2HUGA 1B50A 3D4RA 4X3TA 4FO2A 1TT2A 3EFXD 3TMEA 5E4WC 1O78A 1F77A 4ULLA 3I4MB 2EJGC 3I90A 2K7VA 1E0BA 4ZUJA 1PFBA 1A15A 2R6GA 1I4XA 2X6GA 1EY9A 1CZGA 1BBXC 2RDGA 1R4QB 4KTAA 1YNJC 2F0IA 5IGBA 1QNKA 3T56B 3HOZB 1WTVA 1RODA 1PRTC 2F0WA 3PIO3 2JSOA 1GUOA 4UAIA 5EKLA 5C3XA 2B2UA 4G7ZC 1PTOH 1CI3M 2MGSA 4R8NA 2MJ8A 3BS1A 5I6WA 1KNAA 3Q23A 1OXXK 1BCPC 1GUGA 4V190 1II3A 2E76C 3A8JE 2ZT9C 3D6WA 1CM9A 1DOKA 5M3MB 1TKWB 4BY7B 2RDHA 2NUCA 2R92B 2M9VA 1DOMA 1JCKB 4V0BA 5DAUA 1WTQA 2H4OA 3OWEB 1ZYRD 2PZTA 4K5VA 3OW7A 1TS2A 4FF4A 1ET9A 1DM0B 1MSGA 3T53B 1SSOA 1HCZA 4K5XA 3EJIA 2LS01 1RTOA 5IOCA 1D2BA 2DN8A 4IUNA 3K0YA 5CV6A 4K6DA 2NN6H 1SJED 4B9XA 3GTJB 4ODGA 4A93B 1E2WA 3KF8A 2Q8RE 2SNMA 1CQVA 4GZYC 3S14B 4C3JG 2IJ0A 1G91A 4DGZA 4OO1G 1WTPA 2CHBD 1V43A 3R2TA 5C0XJ 3SK4A 4IFDJ 1YNND 3BDCA 3DWPA 1J8IA 3S1NB 1I6HB 1JR0D 1ML0D 1TVXA 4ID6A 1SBBB 3JAME 3M4OB 1PZJD 2DNCA 2I07B 2HQEA 2PQEA 2EZVA 5C4ZA 3M7GA 2K03A 1LTGD 1VF7A 4QIWB 1L0XB 2K5DA 2WACA 5K5PA 1I4PA 4NP5A 1XTCD 2YU9B 2KCNA 4RWSC 2Z4HA 1HA5A 3MC0B 3JAML 5C5MA 1G6ZA 5ELFA 4XT3B 4K2LA 3M85A 4A3BB 2RBMA 2O5IC 2FMMA 4UDUC 1WD0A 1JOOA 4B9WA 2DY8A 1B3AA 4BS9A 3K7AB 4RCOA 3MTSA 4O42A 3M3YB 5D14A 4KJOA 3I72A 3TP6A 3EVQA 2IX0A 4RA8A 1SEBD 2J4XA 5FK9C 5JOBA 1EFID 3OIPA 1SYEA 3MXUA 3OOCA 3MXNA 1IW7D 3RLFA 4RGNA 2LKVA 4C3HB 1KAAA 5ELDA 5I2XA 1OXVA 4FNFA 1LT6D 4RGOS 1TY2A 3S16B 3FKIB 1TWCB 3NTHA 4XDXA 3VYUA 4IUQA 1SYFA 4L6TB 1D5MC 3FMCA 4YIJA 1D5XC 3IFTA 1Q1BA 3NHHA 1R9TB 1U4LA 4EQPA 5KIXA 3OWFA 4ZLTF 5J22A 1NUCA 2Z8LA 1HA6A 5EQ0A 5IGDA 4DK0A 2WIIB 1MI2A 2Z1CA 3NSWA 5TSSA 4RGTA 1PTOB 1F2ZA 4DF7A 3P7JA 2ZXRA 1AZQA 1EQTA 2VXWA 1G8ZD 1VF5C 3ERQA 3IKJA 1LTTD 3TP7A 3K5OA 1I4GA 1IKMA 4KV6A 1JC7A 2IX3A 1SYCA 2TMPA 1HQMC 3FEWX 3LNNA 1X3QA 4A3EB 1BF4A 3P1HA 1GUSA 1BR9A 2AQ1B 4ZK9B 3PV0A 1KTKA 3NQIA 2F3VA 1LT4D 4M1UB 4R8IA 3VA7A 2MUYA 3GD7A 4DA2A 5M9OA 1V1OA 1F2LA 2XSCA 1TS3A 2XNAC 1JWUD 1Z7TA 2BA0A 1QNUA 3S2DB 2OF1A 4IUPA 1Z47A 2RA4A 3PUZA 1L0YB 1UEAB 1XX8A 3MXPA 1GJXA 2RQXA 1S5FD 2XRQD 3A56A 4K14A 2K04A 2M00A 3D4WA 2BE5D 1AZPA 2MPMA 3VYTA 1FGBD 1EOTA 5CR3A 1WTRA 2CW0D 3PMFA 2WP8J 2NTSA 1EY0A 3OHXC 2HCCA 2QF7A 4CJ2C 3TP8A 3PIP3 2WAQB 2IX1A 3C3LA 2Y0SB 3BYYB 1FNVA 4QCLA 4CJ1B 2PZUA 2M2LA 2XIWA 1B9NA 2L5TA 2KVMA 3GV3A 4C3JB 1Z6HA 2V4DA 1AW7A 3G6JB 4C2MB 2N55A 4H0LC 3VR3A 1VMCA 2F0KA 3L7ZC 3GV6A 1A2TA 2EY1A 2B2UC 5EGTA 2BA1A 4KI0A 3W3AA 1I50B 4CKBA 4U68A 5ELEA 2NZ1D 1PZKD 1CZWA 5JPMC 3MHBA 5CMDA 1RTNA 2EE1A 2XVSA 3PUXA 1V1PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6S A;  2B2U A;  4IUP A;  5EJW A;  1BO0 A;  5EPL A;  2B2T A;  2RA4 A;  2J7Z A;  2X6L A;  2K01 A;  2MGS A;  4R9W A;  2MJ8 A;  5T1I A;  1KNA A;  4XDX A;  1F9S A;  1XX8 A;  1JE4 A;  3MWY W;  1PDQ A;  2L12 A;  2CVR A;  4IUQ A;  5T1G A;  4X3K A;  4IUV A;  1HFN A;  1WTO A;  3DM1 A;  1MGS A;  2RVL A;  1EIG A;  2L4N A;  2L11 A;  1F9P A;  2X69 A;  2L9H A;  1WTX A;  1JIC A;  3I3C A;  3FDT A;  4OIK A;  3D6W A;  1XYI A;  2K04 A;  4MN3 A;  4QUC A;  2K03 A;  1CM9 A;  1DOK A;  1U4L A;  1ICW A;  2IL8 A;  4ZAI A;  1CA6 A;  5EPK A;  1AZP A;  3IFD A;  3LWE A;  2RSN A;  4IUT A;  2SDF A;  2KOL A;  5COR A;  3TN2 A;  4ZLT F;  4XT1 B;  1SDF A;  2MPM A;  3KBX A;  1HUN A;  1B2T A;  2HDL A;  5EKI A;  1HA6 A;  4IUR A;  5EQ0 A;  1DOM A;  3G7L A;  1KNE A;  3H91 A;  2DY7 A;  1HUM A;  1WTW A;  4HCS A;  1BNZ A;  1EOT A;  1WTQ A;  2KUM A;  4RWS C;  3KUP A;  2B2Y C;  1PFN A;  1MI2 A;  1WTR A;  1MSH A;  1QG7 A;  1RHP A;  2RSO A;  4X3U A;  2FIN B;  3DEO A;  3N52 A;  1X32 A;  3P7J A;  2HCI A;  5COY A;  1SAP A;  2K1B A;  1G6Z A;  2HCC A;  1MSG A;  1AZQ A;  4XT3 B;  1EQT A;  2B2V C;  2FHT A;  1HRJ A;  2H1E A;  2VXW A;  3I8Z A;  4HED A;  4CJ2 C;  3IL8 A;  4HAE A;  1X3P A;  2FMM A;  1WD0 A;  1SSO A;  1C8C A;  4LMQ D;  3TZD A;  4ZKC B;  1IKM A;  1GUW A;  1AP0 A;  1WVL A;  1G2S A;  2N88 A;  2DY8 A;  1B3A A;  4X3S A;  4DN4 M;  1PLF A;  1B4O A;  1NAP A;  1EL0 A;  3MTS A;  1NCV A;  1RTO A;  4CJ1 B;  3FPU B;  4O42 A;  5D14 A;  5JJZ A;  2FFK B;  2HUG A;  1B50 A;  4NW2 A;  4X3T A;  2M2L A;  2XIW A;  1ZXT A;  1X3Q A;  1PFM A;  3F2U A;  4ZKB B;  2KVM A;  1DON A;  1IKL A;  1Q3L A;  3GV3 A;  2NWG A;  2HDM A;  3I91 A;  5E4X A;  5EPJ A;  1NR4 A;  1O80 A;  1B53 A;  1BF4 A;  4RA8 A;  5AFW A;  2FJ2 A;  2L1B A;  5E4W C;  2B2V A;  2N55 A;  4ZK9 B;  2NYZ D;  5D65 A;  1DZ1 A;  1S4Z A;  1VMC A;  2K28 A;  2Q8R E;  1F9Q A;  1DOL A;  2B2W C;  1E0B A;  3I90 A;  1U4M A;  4MHE A;  2Q8T A;  4CJ0 B;  4HSV A;  3GV6 A;  2D9U A;  1PFB A;  1A15 A;  3HP3 A;  1G91 A;  2B2U C;  3R93 A;  1F9R A;  2JYO A;  2B2T C;  4R8I A;  1WTP A;  2R3Z A;  2X6G A;  1CA5 A;  4RAU C;  1IL8 A;  1ILQ A;  4QUF A;  1EIH A;  3ONA B;  2EPB A;  1BBX C;  2B2Y A;  5DNF A;  4OIJ A;  4IUU A;  4U68 A;  2KEC A;  2BDN A;  1WD1 A;  1QE6 A;  1HFG A;  2NZ1 D;  1J8I A;  2MP1 A;  2KED A;  1LV9 A;  1F2L A;  1NR2 A;  1QNK A;  1U4P A;  2JP1 A;  2K05 A;  3UI2 A;  1U4R A;  1ML0 D;  1O7Y A;  1HHV A;  1O7Z A;  1TVX A;  2KEE A;  1WTV A;  1ROD A;  3SVM A;  5CBE E;  2EOT A;  5CBA E;  5CMD A;  2B2W A;  1RTN A;  1ESR A;  2EE1 A;  3DEP A;  3QO2 A;  1ILP A;  1G2T A;  1J9O A;  1M8A A;  1RJT A;  4UAI A;  1VMP A; 
#chains in the Genus database with same CATH topology
 2F0N A;  3Q24 A;  1BO0 A;  3KLR A;  3S9W A;  5DM6 3;  1CSP A;  5FLX c;  1SNQ A;  1F9S A;  1Q8I A;  5EKK A;  2PZW A;  3DMU A;  4A4I A;  3L2P A;  1TR5 A;  3C1E A;  3DM1 A;  1EU3 A;  1KLG D;  3G4S A;  2X69 A;  5E1F A;  2L9H A;  3C2P A;  2F4V Q;  1YJN A;  4L5T A;  5HY6 A;  2F0O A;  4XQN A;  2JA6 B;  2QKI C;  3J7A V;  4DUZ Q;  1Q90 A;  2YTX A;  1Y69 U;  1GUN A;  1HNZ L;  1FR3 A;  3QOJ A;  5EPK A;  4IUT A;  4H7B A;  2F3I A;  3TSS A;  4DR3 Q;  3ZYY X;  1WFQ A;  2UUB L;  3VA5 A;  2SNS A;  3UDG A;  4RHR A;  1HUM A;  2A73 B;  5I6Y A;  1HTP A;  3PSI A;  2B2Y C;  2BDO A;  3BDL A;  5A35 A;  4LW1 A;  3NPP A;  2HCI A;  3FPP A;  1DCZ A;  1J5E L;  1T9H A;  4DNT B;  2XWJ B;  3AYH B;  5JEA G;  4HAE A;  2UUC Q;  1M90 C;  4AYB B;  5JVG 3;  4TQU S;  1N36 L;  2NB0 A;  2IPK D;  2OQ0 A;  2CCZ A;  4FYD A;  4OGQ C;  2NTT A;  5JPN C;  4DV3 L;  1EYD A;  4DV1 Q;  4FXG C;  1PYB A;  3WDN A;  1STH A;  3MFG A;  1ENC A;  5HGT A;  3I91 A;  1E2Z A;  4B3S Q;  2F0J A;  2R7F A;  5FO8 B;  3HOU G;  1GM5 A;  1L2F A;  2NYZ D;  3CQZ H;  4IN3 A;  1PTO D;  3HOX G;  4FF3 A;  4EQ5 A;  4MHE A;  2L15 A;  2HQL A;  1Q81 C;  1KQS A;  1EY5 A;  1RKN A;  2N78 A;  4XQQ A;  1EIH A;  4NKL A;  2EPB A;  2KA7 A;  1CHP D;  3TEH B;  2KEC A;  3W1B A;  4AYB E;  4C1N I;  1XXG A;  3S16 H;  1VQ8 A;  2F0U A;  3WWV A;  5CBE E;  3S15 B;  1ESR A;  5J39 A;  1HZC A;  2KQ3 A;  3HOV B;  5CV8 A;  2RHS B;  1B44 D;  4NPS A;  5JEA H;  4DR7 Q;  2JA7 B;  2CWP A;  1IBL Q;  3KF6 A;  4MTK A;  5CV7 A;  2F1M A;  2E75 C;  4MZ9 A;  2IY5 B;  4BBR B;  2UUB Q;  2I5L X;  4U67 3;  3GTL B;  1HR0 W;  2L11 A;  2E8G A;  4A3J G;  1Y8O B;  1FD7 D;  4M8A A;  4OIK A;  3VYR A;  3BZD B;  3FVQ A;  1SE4 A;  2ICE C;  2IL8 A;  3HOU H;  1VQA A;  5M5Y B;  1XNR Q;  1IYV A;  3U4Z A;  3BVZ A;  5C44 G;  2E2H H;  3QG1 A;  4BA2 I;  4LF4 L;  4DU9 A;  3HOX H;  2FXQ A;  3Q8D A;  1MJC A;  2UXB L;  2BOS A;  2JN4 A;  3CW2 C;  4J1M A;  1PA6 A;  2KUM A;  2WFW A;  2Z6K C;  1O7L A;  2WKC A;  3K80 C;  4DV3 Q;  4A3G B;  3VR6 A;  1SXT A;  2JE6 I;  2IW3 A;  3S1Q H;  1SFO H;  3X3M A;  4HJ8 A;  1EEI D;  2HHH Q;  3FRP B;  2ES2 A;  1ZKO A;  2R7Z G;  1HNX L;  4LMQ D;  1A3U A;  4JI6 L;  1YHQ A;  4G7O C;  3M4Y A;  4X3S A;  4DN4 M;  1STN A;  4B3R L;  3RD4 A;  4A3E H;  3KK7 A;  3HGB A;  2GVA A;  3MVV A;  2KHS A;  4LUO A;  5C5L A;  2KHI A;  5J3B A;  4IO9 A;  2BH2 A;  1O80 A;  3TP5 A;  5CC4 A;  4DAY B;  3PUW A;  2YTY A;  2QEJ C;  1V8Q A;  3P20 A;  2EYM A;  4A3J H;  1S4Z A;  2Q2H A;  1EY6 A;  2QIL A;  3PUV A;  4CJ0 B;  4HSV A;  1EYG A;  3V96 A;  1HXY D;  3R8B A;  2UXC L;  1ZYR C;  3KDF A;  4CHT B;  4EGV A;  2SOB A;  4JOI A;  1Y1W B;  4QUF A;  5FOB B;  1I3Q B;  1SJH D;  2B2Y A;  1WCM B;  5FLX L;  1PXU A;  3MAQ A;  1JOK A;  2FMC A;  5KYI A;  4X64 L;  3IAY A;  3T4A C;  4EX5 A;  1O7Y A;  1DD2 A;  2O5J C;  3RZO B;  1K83 H;  2F0L A;  1K8A C;  5CBA E;  3MA2 B;  2F0F A;  1VQ7 A;  5G3L D;  3D6C A;  1PV4 A;  3F8T A;  4HJ5 A;  5M3F B;  5D3D A;  2ZTD A;  1TII D;  4JK1 C;  4KKU A;  5T1I A;  2R93 B;  2JA8 B;  4JI0 Q;  3N6R A;  4X3K A;  5BN5 A;  4XYO A;  3TS2 A;  1WTH A;  3Q0A A;  1MJE A;  1PYW D;  1LLR D;  1KD1 C;  1UWV A;  3CCL A;  4QUC A;  3K5L A;  2NVT B;  1CA6 A;  4N9P A;  1LUZ A;  4R4O A;  4JI2 Q;  2KOL A;  1EFW A;  3QOL A;  1SDF A;  1H9M A;  1IYU A;  2XGT A;  4RCN A;  3MZ5 A;  1H9K A;  1XPR A;  3CME A;  1KDB A;  1YNN C;  2F0P A;  2EY5 A;  3RUZ A;  4POF A;  2WB1 B;  4JI6 Q;  4G4K A;  3HZX A;  1QG7 A;  4B3T L;  2MNA A;  2EYJ A;  2FIN B;  1E22 A;  5DM7 3;  5KNB A;  2A69 D;  1R4P B;  1VQ4 A;  2K1B A;  3KFU A;  2Q2T A;  1JJ2 A;  2FHT A;  2LXJ A;  4QQB X;  3IL8 A;  3A8K E;  2Q2U A;  2EVB A;  2F3W A;  4A3M B;  3D3R A;  4RHS A;  3O13 A;  4DK6 C;  4DR4 L;  2EDG A;  2Z6B A;  3HOY G;  4KN4 C;  3FPU B;  5FKA C;  4PQX A;  3D31 A;  2C9O A;  2A6H D;  2VUM G;  5J1Z A;  4OO1 H;  5DEH A;  3E0J A;  2LY7 A;  1IKL A;  3X3N A;  1YJ9 A;  2E2D C;  2CH4 A;  1IZ6 A;  4JBJ A;  5IOD A;  4OHJ A;  3H3V C;  1HNW L;  1HR0 L;  4IJH A;  2PW7 A;  3S2H H;  1EU4 A;  1FYC A;  3SDZ A;  1VQH A;  1DZ1 A;  2WB1 E;  3S1M H;  3EQL C;  4PMC A;  1U4M A;  1IXR A;  2I5H A;  1XMQ L;  4JI5 Q;  5I2Y A;  2B39 A;  4B08 A;  2EYO A;  4LFC L;  3R93 A;  3OMG A;  3SK6 A;  4WRD A;  2R3Z A;  4RAU C;  1EQQ A;  1KC8 C;  2UUA L;  3RN5 A;  3T1Y L;  1VQO A;  4FF1 A;  2EYH A;  3UDI A;  4KHP L;  2MP1 A;  2WKD A;  2KED A;  4JI7 Q;  2VQE Q;  1UEB A;  1LTS D;  3UI2 A;  4BWG B;  5IT9 c;  3MFY A;  1PMR A;  4GNX A;  1M1K C;  3SVM A;  1FVI A;  1XMO L;  4KHV A;  2ZJR A;  2B2W A;  1U9R A;  4K2K A;  1K8O A;  3H09 A;  1A0I A;  5GQO A;  1I4R A;  3QJY A;  2F0T A;  4YWL A;  2B2T A;  3CQZ B;  3J81 i;  4Y52 H;  2J7Z A;  3CCU A;  2J0T D;  3A74 A;  1X65 A;  3HOY H;  3J81 c;  3K59 A;  4TVA B;  2VUM H;  2RVL A;  3D8G A;  4DFA A;  1Y1V G;  1QOH A;  3VYS A;  4A76 A;  3PQI A;  2PCF B;  4XQJ A;  3NWS A;  1LYL A;  3ERO A;  1HZA A;  1ICW A;  4UHV A;  1X9N A;  2N49 A;  1YHB A;  4HTH A;  5C0X I;  4IFD I;  5KEE A;  1IW7 C;  2F4I A;  3NE5 B;  3PUY A;  3J7A F;  4FP5 D;  1W2B A;  1JOQ A;  5HUR A;  4LF8 Q;  3W5O A;  1AEX A;  4CDD C;  1RHP A;  1TS4 A;  4BXX G;  1X32 A;  2EYL A;  1U0L A;  3STB C;  4GKK Q;  3KF8 B;  3ICE A;  3A54 A;  4LFA L;  1A2U A;  1FNU A;  1D5Z C;  2ZXP A;  1SMX A;  2G5D A;  3E6Z X;  2LXK A;  2F0H A;  1C8C A;  2RHQ B;  1TWF H;  4HMJ A;  4K8I A;  3HOU B;  5C4J H;  2UU9 L;  2F0V A;  3BG3 A;  5JJZ A;  2QW7 A;  3HFZ B;  3M4Q A;  3J80 i;  2E2H B;  1WJJ A;  3SK8 A;  3HOX B;  3ULL A;  1NY4 A;  2NN6 I;  1HH2 P;  5C6A A;  2HIX A;  3J80 c;  1ESF A;  4JI3 L;  2UUA Q;  2ID0 A;  2IT1 A;  3T1H Q;  1Y1V H;  3NP8 A;  3VR2 A;  5C4H A;  4H13 C;  2K28 A;  3FHW A;  1DOL A;  1X6O A;  3S1Q B;  1SFO B;  2OXP A;  1EWC A;  1WI5 A;  3HP3 A;  3SXH A;  4KN7 C;  5KYL A;  4R4I A;  2QA4 A;  2KBN A;  3HEJ A;  5ELC A;  3HG9 A;  3H15 A;  2F03 A;  4BA1 I;  1QE6 A;  4X65 L;  3KLS X;  4L5R C;  5GAG C;  1YIJ A;  3NEM A;  4BBS G;  2ALY B;  1EIY B;  4BXX H;  3KLS A;  1KRT A;  2KEE A;  2PQA A;  4GLX A;  4JYA Q;  1K73 C;  2EOT A;  1CUK A;  1QUQ B;  3NQT A;  4ZQ3 A;  1G2T A;  3UE0 A;  4YHH L;  1V1P A;  4NDX A;  2GA4 B;  3GTG H;  4DR5 L;  4A3J B;  2X6L A;  3HOW G;  5L37 A;  2ZJP A;  2C5C A;  2E5L Q;  1N33 Q;  1QJO A;  3MWY W;  5T1G A;  4QY7 A;  2R92 G;  3CCQ A;  4PV1 C;  1KAW A;  5C44 B;  5M5Y H;  1CKM A;  2UXD L;  1Q12 A;  1PRT B;  3IRB A;  3FDT A;  5EAY A;  3VR4 A;  4ZAI A;  2E2J B;  3T51 B;  1I94 L;  4DK3 C;  5COR A;  1LT5 D;  1LAC A;  2F0M A;  2K52 A;  2NVQ H;  1PZI D;  1K83 B;  1G51 A;  5JAV A;  5IWA Q;  3HS0 C;  1KNE A;  3DUZ A;  3H91 A;  2DY7 A;  4C3I G;  4LF7 Q;  2GN5 A;  2P5Z X;  1EQV A;  1BCP B;  1F2M A;  1I6V C;  1OXS C;  2AUK A;  2R7Z B;  2G9H D;  1VQK A;  1AE3 A;  5C3W A;  5COY A;  1B70 B;  1RDP D;  4RH6 A;  1KAB A;  4CGY B;  3EIV A;  1PH7 A;  3J7Y W;  2F0E A;  5ISR A;  2K75 A;  3S17 H;  2A6E D;  4JI3 Q;  3T13 A;  3K6O A;  4QMG A;  5CYU A;  3J81 E;  1N32 Q;  2K5W A;  3F1Z A;  3HKS A;  4AIM A;  3HOW H;  3F2U A;  1EZ8 A;  4YWK A;  2NWG A;  2BE5 C;  2CWA A;  1V9P A;  2TSS A;  1WYD A;  2A6E C;  2FJ2 A;  4CKE A;  4HN7 A;  1PH1 A;  5A2Q E;  2VQF L;  1KDC A;  4A75 A;  3L9A X;  3H3V I;  3K57 A;  3HKZ G;  2CW0 C;  4A3D G;  4A3K G;  1PTO F;  1EY4 A;  3ONA B;  2L0C A;  4C3I H;  3I2Z A;  3RZO H;  1EUJ A;  5JJL A;  2Z9H A;  1IHZ A;  3PO2 G;  3J81 L;  4GN3 B;  4QB4 A;  2O4X A;  3KLW A;  1X55 A;  1O7Z A;  3CKI B;  1N34 L;  1NE3 A;  4KHZ A;  4RFB A;  4FF2 A;  3NBI A;  1S3O A;  1BUV T;  4N8F A;  3Q6S A;  3T16 A;  5IE8 A;  3S2H B;  1EQR A;  5A2Q L;  5EPL A;  1SYB A;  4H44 C;  5LHY 1;  1QZH A;  3S1M B;  5KNC A;  1SR3 A;  4KJN A;  1K9M C;  1JE4 A;  4DV0 Q;  2L12 A;  4OWW B;  2YTV A;  3F2D A;  4DV6 L;  1TS5 A;  4Z9C B;  1T5E A;  1YHA A;  3I3C A;  4MN3 A;  3I56 A;  1D7Q A;  2RF4 A;  2HIV A;  4YWM A;  2PNR C;  4KY6 A;  2SDF A;  2BCO A;  1QB5 D;  1H9S B;  1I4H A;  1RIP A;  1SNM A;  1XPO A;  2LMC B;  1N8R C;  2MQH A;  3DWA A;  3AQQ A;  1O7I A;  4A3D H;  3LWU A;  4J15 A;  4A3K H;  2CFM A;  3A7A B;  5D3I B;  1IBK Q;  1SE3 A;  1OXT A;  2JEA I;  4JI1 L;  4ABN A;  3PO2 H;  4DAV A;  4DUY Q;  1K8G A;  1OXU A;  4A3M H;  3HOY B;  4FXD A;  3W2D A;  2DJF C;  2IHF A;  4B3M L;  2VUM B;  2K50 A;  5I9P A;  1G2S A;  1W6K A;  3Q22 A;  4A3I H;  2PYK A;  4NXN Q;  5KGU A;  1TWG H;  3NBH A;  4CKC A;  1NCV A;  1SMY D;  4APV A;  1DYQ A;  4EVO A;  4DXG A;  2JA5 G;  4JOI C;  4JI4 Q;  1A8V A;  2SEB D;  3I70 A;  5E4X A;  4TSS A;  1Y8N B;  5K36 G;  3NK9 A;  5ELB A;  5AFW A;  4P73 A;  4L5Q A;  1K8M A;  4KK7 A;  5E3F A;  1CT1 D;  4C3H G;  4EQN A;  4UY8 C;  2NVY H;  2D9U A;  4XXE A;  4KD4 A;  3E5S A;  3GTM B;  3LX0 A;  1SE2 A;  3J7A 5;  2ENB A;  1ILQ A;  1VQP A;  1H9R A;  1TWF B;  1X3G A;  2AHO B;  5DNF A;  3MEH A;  4XTC S;  1HFG A;  5C4J B;  4NMZ A;  5AJ3 Q;  1K3B C;  4GLA C;  4LFB L;  4KD3 A;  1SYD A;  3I73 A;  3DEP A;  4L8J A;  1FGU A;  1RJT A;  1WTX A;  1XWE A;  1W6J A;  1CKN B;  2K5H A;  2NVX H;  1JB3 A;  1Y1V B;  1GHK A;  2KEN A;  2EY6 A;  2E2I B;  2RDF A;  1SN8 A;  1ENA A;  3DWQ A;  5IGC A;  1QZG A;  5G3L F;  2A68 D;  1PDQ A;  2JA5 H;  1WTO A;  4NXM L;  5C4X G;  5I4D A;  1HPC A;  1PTO C;  1CSQ A;  5LMN W;  3J7Z C;  5K36 H;  4DNR B;  2ZTC A;  1TWA H;  3H6M A;  1JJG A;  1NSN S;  2RSN A;  3KBX A;  4LUZ A;  2EJM A;  1N9W A;  2D5D A;  5H1S E;  4IUR A;  5IGF A;  1JWM D;  3G7L A;  2NBF A;  1WTW A;  1HNZ Q;  3JAM c;  4HJ9 A;  2OEO A;  3GTG B;  1MSH A;  2PO4 A;  1SNC A;  4WJW A;  3DEO A;  4LJZ C;  3NTK A;  2ZXO A;  4DPG A;  3S1R H;  4K8J A;  2YYZ A;  2VS1 A;  2F0D A;  2H1E A;  1YNJ D;  3I8Z A;  5CGK A;  5C0X G;  4IFD G;  4F88 A;  3CRK C;  1B9M A;  4HMI A;  4P2C B;  4ME5 A;  1MBY A;  3F2B A;  1KLU D;  1C48 A;  2BH8 A;  2N88 A;  1PLF A;  1PRT D;  1J5E Q;  1UUP A;  4JG2 A;  1GD7 A;  1T5X D;  3I4O A;  4TKO B;  1NMF A;  2NVQ B;  1N36 Q;  3U9S A;  4LF9 L;  1KL9 A;  1VS0 A;  3KOJ A;  1JJC B;  2G9D A;  4QF4 A;  2EXD A;  5GRO A;  5BN3 A;  4Y7N H;  2B2V A;  4X62 L;  5C4X H;  1CTM A;  1BCP D;  2MFI A;  4GNX C;  4DR6 L;  4AQY L;  3SHL A;  2ZM6 L;  2B2W C;  2VB3 X;  2D2C C;  1LTB D;  4QGU A;  5FLX E;  3E9H A;  4GKJ L;  4BBS B;  4OL7 A;  2B2T C;  2MO1 A;  3GO5 A;  3NXW A;  4DV7 L;  1CA5 A;  1OO9 B;  3I55 A;  3RNU A;  3S17 B;  4JCV E;  2DNE A;  1EZ6 A;  2NN6 G;  1Q1E A;  1QCB D;  5JEA J;  4DR1 L;  1NR2 A;  4WFN 3;  4OX9 L;  1RCV D;  2XN9 C;  4HR7 B;  3HOW B;  1CFM A;  4EQO A;  2EJF C;  1K3R A;  2VW9 A;  4ZUI A;  1EEF D;  2ASB A;  1MHW C;  5C0X H;  3K5M A;  4IFD H;  3I4N G;  3TBI B;  2R61 A;  2AKW B;  4UP7 A;  3GTP H;  2PI2 E;  2KCM A;  1MKH A;  4QJF A;  5C44 H;  1HZB A;  3AB9 A;  4XIG S;  2E2J H;  1MGS A;  1GHJ A;  1TWH B;  1MD2 D;  1QIL A;  4JV5 L;  1JIC A;  4C3I B;  5IIF A;  4FXK C;  2PMZ B;  5CV5 A;  1UNS A;  2NZH A;  2H5X A;  3LWE A;  4ME3 A;  3BDO A;  5C3E G;  1B2T A;  3DXJ C;  1Q86 C;  4MNO A;  2F0S A;  1VCI A;  3ULJ A;  3TS0 A;  2I0Q A;  2R7Z H;  4O1N A;  2B63 G;  4CDC C;  2N3S A;  4DV5 L;  1JOR A;  3A8I E;  1KDA A;  2CQO A;  3I4L A;  4LF4 Q;  3H0G G;  1TU2 B;  1S40 A;  4A3F G;  2VY3 A;  4HID A;  2UXB Q;  4F7X A;  1C0A A;  1XNQ L;  2A74 C;  2CQA A;  4GOP C;  4HED A;  2XWB B;  3SR1 A;  2PW5 A;  1BOS A;  3ER0 A;  1D6E C;  4Q0F A;  1S5C D;  4DV4 L;  3RZD H;  4N9T A;  1NAP A;  1KHI A;  3GTK H;  4DR6 Q;  3BZC A;  4AQY Q;  1DXM A;  3I4N H;  1PH2 A;  4NW2 A;  2PMZ E;  1HNX Q;  2A8V A;  1VDZ A;  3P75 A;  1PFM A;  3RMH A;  2EY2 A;  5DLQ E;  3B6Y A;  1Q3L A;  1DON A;  5EPJ A;  2B29 A;  1NR4 A;  3HKZ B;  4B3R Q;  1STA A;  3BJU A;  3K5N A;  1A3T A;  4A3D B;  1SND A;  4A3K B;  4JBW A;  5LMN L;  3CPW A;  4RKB A;  1ONL A;  2Q8T A;  2DGY A;  4DR2 L;  2OTL A;  1GXD C;  4OX9 Q;  3KF6 B;  3PO2 B;  1K0S A;  4AH6 A;  2EXZ A;  5C3E H;  1JMC A;  1Q8K A;  2K5N A;  2A69 C;  5M5W H;  3HRZ C;  5JVH 3;  3CPF A;  3OYY A;  1LT3 D;  1FL0 A;  4OIJ A;  4A3I B;  2B63 H;  5IYD G;  1TWG B;  3D0F A;  4PZ6 A;  2UXC Q;  3PIP A;  3PO3 G;  4ALP A;  3K8A A;  3H0G H;  1QVF A;  5I9O A;  2Q8I B;  4A3F H;  3QO2 A;  2K6A A;  4XYQ A;  1M8A A;  4BY1 G;  1QUQ A;  4X64 Q;  1STE A;  5KRU A;  4Q5V A;  2A6H C;  1E2V A;  3HKZ E;  5EJW A;  2JA6 G;  4LUV A;  3GTQ H;  2NVY B;  3OIQ A;  2O2L D;  4FDB A;  1LAB A;  1HFN A;  1STG A;  3W1G A;  4LK1 C;  5M5X H;  3PCO B;  4OXP A;  4E6I A;  4WJ3 M;  5F2D A;  1Z9F A;  1TQO A;  4OWT B;  1JWS D;  4I7Z C;  3U9O A;  4JBK A;  5LL6 X;  4ZRZ A;  2B8F A;  2JJQ A;  2K14 A;  1S5D D;  4HCS A;  4RGM A;  5CV9 A;  5BR8 L;  1AH9 A;  1STB A;  1PH8 A;  2NVX B;  1PH9 A;  2XTI A;  4X3U A;  1BQQ T;  1EYC A;  3N52 A;  1G29 1;  3QIA A;  1L1O A;  4FVM A;  5IYD H;  2ICI A;  2RKS A;  1TY0 A;  1B3Q A;  3PO3 H;  1W3S A;  1ASY A;  1Q46 A;  2JA5 B;  5GAH C;  4B3T Q;  1K28 A;  4R4Q A;  2AQ2 B;  3KDF B;  3TZD A;  4JI8 L;  4ZKC B;  1AP0 A;  3M9B A;  2KJX A;  4BY1 H;  1EL0 A;  2DJG C;  1TWA B;  2OT2 A;  5LMN Q;  3H3V H;  2PNH A;  1D1I A;  2CH4 W;  1VQF A;  3ZJY C;  2MHV A;  1NBW A;  2JXM B;  1SNO A;  3H94 A;  4DR4 Q;  1B53 A;  4PMW A;  2KCT A;  3LGJ A;  2L1B A;  1QVC A;  2OCE A;  4OON A;  3BU2 A;  3GTM H;  3GTO B;  1F9Q A;  1YEZ A;  3URY A;  2D62 A;  3BVG A;  2A5H A;  2HD3 A;  1BDO A;  4DXF A;  3CXC A;  3J81 j;  3U4V A;  3S1R B;  1M4V A;  3U50 C;  1HNW Q;  3OPO A;  4RMF A;  1HR0 Q;  4RKL A;  2JYO A;  3K58 A;  3I4M G;  2KHJ A;  1RF2 D;  1STY A;  4WJ4 A;  1SRO A;  1XMQ Q;  1Y14 B;  3QWN A;  2XRS D;  4YY3 L;  4K5W A;  4P75 A;  4LFC Q;  2F0G A;  1U4R A;  4PMB A;  1C4Q A;  1HHV A;  1YZ6 A;  4GOP A;  3T1Y Q;  4PNY A;  3RR5 A;  3CMA A;  3A7L A;  4KHP Q;  2E2I H;  4TRD A;  2WV6 D;  4Y7N B;  4GN5 A;  5C4X B;  3HOZ G;  1BBU A;  1HTL D;  1XMO Q;  3A5U A;  4C56 C;  5FO9 B;  1P8L A;  4P74 A;  1Q7Y C;  1EY7 A;  1A6X A;  3EA6 A;  3CHB D;  1VQG A;  1EY8 A;  2KCC A;  3V05 A;  1KRS A;  4R4T A;  2K33 A;  3TRE A;  1GKH A;  3QB3 A;  2QGQ A;  1H9S A;  1BNZ A;  3SE0 A;  5M3M G;  3ITP A;  4BY7 G;  3I4M H;  3GTP B;  2F52 A;  4K6L A;  4J6H A;  4MIU A;  4HCE A;  1F2Y A;  4CBV A;  1CK1 A;  2DUD A;  1B1Z A;  1A3V A;  3OSO A;  1BXT A;  1EWH A;  3GP7 A;  1EWI A;  1UE7 A;  1SNP A;  2Z4I A;  3MXG A;  5IYB G;  1WVL A;  1B4O A;  4OO1 I;  1C9O A;  3K0X A;  4LFA Q;  1UE1 A;  1G6P A;  3AFP A;  3HOZ H;  1ZXT A;  4ZKB B;  5IT9 E;  3A55 A;  3AU7 A;  5LMU L;  2HDM A;  4LF5 L;  3PIO A;  2D0P A;  2UU9 Q;  4IJL A;  2JA9 A;  1Y8P B;  3NUC A;  3U58 A;  3E3X A;  1S5E D;  4BBS H;  1UE6 A;  2Z0S A;  3ND9 A;  1HZ9 A;  1B7Y B;  3MXN B;  1A63 A;  2AWN A;  3SEB A;  4L63 B;  1LTI D;  1D1K A;  3V2T A;  4F8M A;  2JK8 A;  4G57 A;  4A93 G;  1HQR D;  5KND A;  4CDE C;  3PF5 A;  3RZD B;  1WD1 A;  1NTG A;  3BYT B;  3GTK B;  3WOF A;  4S3S A;  4BY7 H;  1LV9 A;  2K4K A;  3CU7 A;  4A3C G;  2JP1 A;  3K7U C;  2K05 A;  3I4N B;  2AUJ D;  4X66 L;  4DK1 A;  3CRL C;  2B8G A;  2R92 H;  4HIK A;  1UE5 A;  1VQB A;  5IT9 L;  4X65 Q;  1J9O A;  4OEL B;  3L3O C;  4GS3 A;  1KIX A;  4UP9 A;  3ULP A;  4KMU C;  1CKN A;  3R3O A;  5FO7 B;  2K5V A;  5LL6 S;  5IYB H;  1TWH H;  4ZYS A;  4YHH Q;  4IUV A;  1XTD A;  5C3E B;  4DR5 Q;  1EIG A;  2L4N A;  5M5W B;  1CQF A;  1F9P A;  3WOE A;  4DR3 L;  5JJK A;  3M4P A;  3GQB A;  2B63 B;  4RG1 A;  1VQ6 A;  3IFD A;  3TN2 A;  5EBC A;  4XT1 B;  4IQZ A;  3CD6 A;  1CHQ D;  3G6E A;  2UXD Q;  3H0G B;  5EKI A;  1DJR D;  3AMU A;  4A3F B;  2JEB I;  1I94 Q;  4OWX B;  1H9J A;  1VQN A;  4KKS A;  1AFP A;  3KUP A;  3J80 E;  1PFN A;  2VB2 X;  3GTJ H;  4I65 A;  3TRZ A;  1GOZ A;  2F0Q A;  1UAP A;  2L55 A;  4IZ8 A;  3KJO A;  1PHJ A;  2UUC L;  3GTQ B;  4KKT A;  1SAP A;  3S14 H;  4PG3 A;  1ENF A;  2QEX A;  4A3C H;  2B2V C;  1HRJ A;  4LF6 L;  4DV1 L;  1X3P A;  4HJA A;  2JQO A;  3CAM A;  3EBE A;  5M5X B;  3ND8 A;  1VQ9 A;  4B3S L;  5IP7 G;  3S1N H;  1I6H H;  4A3B G;  5NUC A;  1RD9 D;  1BVS A;  1I5F A;  3OMC A;  4O0A A;  1PRT F;  2EYP A;  1PH5 A;  4DAP A;  2PQA B;  4HSP A;  2AWO A;  4JW0 A;  5HGQ A;  2PI2 A;  3SK5 A;  2QDB A;  3J80 L;  5D65 A;  4LAA A;  3M4O H;  2PPB C;  1LTL A;  4X66 Q;  2K5Q A;  4KY5 A;  2LSS A;  3PO3 B;  5GAD C;  1EYA A;  3C46 A;  2E74 C;  3DHQ A;  2VQF Q;  1SYG A;  1F9R A;  1BCP F;  1I4Q A;  1IL8 A;  5EBD A;  4IUU A;  4PZ8 A;  3CCS A;  4J8Q A;  2BDN A;  3TDQ A;  4WOR A;  4BY1 B;  1U4P A;  3C1F A;  1ZEQ X;  3NTI A;  2IWH A;  4DR7 L;  1IBL L;  1LTA D;  5BN4 A;  4C1N K;  4DAY A;  1SMY C;  1ILP A;  2YU9 H;  1FNW A;  1QWY A;  4IAL A;  3VR5 A;  3KBG A;  2MO0 A;  1VMP A;  1AN8 A;  2VNU D;  1X54 A;  1PH4 A;  5IGE A;  3R2I A;  1JT8 A;  1ET6 A;  1N34 Q;  2K01 A;  4R9W A;  3NWT A;  1QVG A;  1RL2 A;  1S5B D;  3CCV A;  2CVR A;  3FKI G;  3RLO A;  5IP7 H;  2K32 A;  4A3B H;  1XNR L;  3QR8 A;  4ILW A;  1XYI A;  3BVM A;  3K7A H;  2EYF A;  3M3Y H;  1SRU A;  2R7D A;  5ELN A;  1HUN A;  2C35 B;  4DV6 Q;  5CV4 A;  2HDL A;  1PFS A;  3KYH C;  2I46 A;  3D4D A;  3S24 A;  4LF6 Q;  2A19 A;  4KLK A;  3M7N A;  3VDY A;  4LNQ A;  2HHH L;  1GUT A;  2RSO A;  3OW2 A;  1LTR D;  3TZU A;  4YCU A;  2I5M X;  4G7H C;  1E7Z A;  2NZO A;  2RCF A;  4LWC A;  2QCP X;  4YCV A;  5IGG A;  3NEL A;  2ZJQ A;  1JQY D;  4F87 A;  1GUW A;  1GO3 E;  2WIN B;  3JAM i;  1LO5 D;  4JI1 Q;  4C3H H;  2A68 C;  1YJW A;  1NJI C;  1FJG L;  2AQ3 B;  1ASZ A;  5FJ8 G;  2ZTE A;  2LFN A;  4KY7 A;  4B3M Q;  2FFK B;  2HUG A;  1B50 A;  1Q82 C;  3D4R A;  4X3T A;  4FO2 A;  1S72 A;  1TT2 A;  5ELO A;  1OTC A;  4MTN A;  3GTO H;  2OWO A;  3EFX D;  5JJI A;  3TME A;  3FKI H;  5E4W C;  1O78 A;  1TWC H;  1F77 A;  4ULL A;  3I4M B;  1DGS A;  2EJG C;  3I90 A;  2K7V A;  1E0B A;  4A3E G;  4ZUJ A;  2AMC B;  1PFB A;  2QDL A;  3K81 C;  1A15 A;  2R6G A;  1I4X A;  3TQY A;  2X6G A;  5IYC G;  1L0W A;  2N8N A;  1EY9 A;  1CZG A;  1BBX C;  2RDG A;  1R9T H;  1D8L A;  1R4Q B;  4PZ7 A;  2ATW A;  1IYJ B;  4KTA A;  1YNJ C;  2F0I A;  5IGB A;  1QNK A;  3T56 B;  3HOZ B;  1WTV A;  1ROD A;  1X3E A;  1PRT C;  2F0W A;  3PIO 3;  4P72 A;  2JSO A;  1GUO A;  4UAI A;  5EKL A;  4JI0 L;  5C3X A;  2OQK A;  2B2U A;  4YCW A;  4G7Z C;  1PTO H;  1CI3 M;  3DLL A;  4JPB W;  4LFB Q;  2MGS A;  4R8N A;  2MJ8 A;  3BS1 A;  5I6W A;  3DM3 A;  1KNA A;  3Q23 A;  3CCM A;  1KXL A;  5FJ8 H;  1OXX K;  1BCP C;  4JI2 L;  1NNX A;  1GUG A;  4V19 0;  1II3 A;  1L1O C;  2E76 C;  3A8J E;  2ZT9 C;  3D6W A;  3EN2 A;  1CM9 A;  1DOK A;  1BKB A;  4I7A A;  5M3M B;  5GAE C;  1TKW B;  4BY7 B;  1GVP A;  1PVO A;  4NXM Q;  2RDH A;  3JC6 6;  4X6A H;  3NBH B;  2NUC A;  2R92 B;  3A5Z B;  2M9V A;  1DOM A;  1JCK B;  4V0B A;  1WOC A;  1K0R A;  5IY0 A;  5DAU A;  1WTQ A;  3CF5 A;  2H4O A;  3OWE B;  1ZYR D;  2HT1 A;  2PZT A;  4GLV B;  5IYC H;  1FJG Q;  4K5V A;  3OW7 A;  1NMG A;  1TS2 A;  4FF4 A;  1ET9 A;  1DM0 B;  1MSG A;  3E0E A;  3T53 B;  3UDF A;  1SSO A;  3AEV A;  1HCZ A;  4K5X A;  3EJI A;  3BZK A;  2LS0 1;  1RTO A;  5IOC A;  1D2B A;  3UDX A;  1VQJ A;  1E24 A;  2DN8 A;  2IHE A;  2WAQ G;  3I7F A;  4IUN A;  4UPA A;  2Y0S G;  3K0Y A;  4JI5 L;  3F2C A;  5CV6 A;  4K6D A;  3S2D H;  2NN6 H;  1SJE D;  4B9X A;  3GTJ B;  4ODG A;  4A93 B;  1E2W A;  3KF8 A;  1P16 A;  2Q8R E;  4LF9 Q;  2SNM A;  1CQV A;  4NB3 A;  4GZY C;  3S14 B;  4C3J G;  2IJ0 A;  4JI7 L;  1G91 A;  4X62 Q;  2VQE L;  4DGZ A;  4OO1 G;  5IP9 G;  1WTP A;  3AFQ A;  2CHB D;  1V43 A;  2ZM6 Q;  3R2T A;  5C0X J;  3SK4 A;  4IFD J;  1YNN D;  3BDC A;  1E3P A;  2EIF A;  3DWP A;  1J8I A;  4GKJ Q;  4O2D A;  3S1N B;  1I6H B;  3NEN A;  2YV5 A;  2Q2I A;  3OTO L;  4DV7 Q;  1JR0 D;  1ML0 D;  1A62 A;  1TVX A;  4IPG A;  4ID6 A;  3FP9 A;  1U5K A;  1SBB B;  4DR1 Q;  3G71 A;  1YI2 A;  3JAM E;  3CCR A;  3M4O B;  1PZJ D;  1VQ5 A;  2DNC A;  2I07 B;  4K0K L;  2HQE A;  3GDE A;  1EIF A;  2PQE A;  1ICF B;  2EZV A;  1PH6 A;  3PF4 A;  5C4Z A;  1XPU A;  3CCJ A;  4A3L G;  3M7G A;  2K03 A;  1LTG D;  1VF7 A;  4LF8 L;  4QIW B;  1L0X B;  2K5D A;  2WAC A;  4JV5 Q;  5K5P A;  1I4P A;  4NP5 A;  1XTC D;  1JE5 A;  4C3J H;  2YU9 B;  4IOA A;  4GKK L;  2KCN A;  4C2M H;  2VL6 A;  4RWS C;  2Z4H A;  1HA5 A;  3MC0 B;  5IP9 H;  3JAM L;  5C5M A;  1G6Z A;  5ELF A;  4UP8 A;  1BBW A;  4XT3 B;  4DV5 Q;  1SLJ A;  3E9I A;  4K2L A;  3M85 A;  4A3B B;  2RBM A;  2O5I C;  2FMM A;  4UDU C;  1VQI A;  1WD0 A;  1I50 H;  1JOO A;  4B9W A;  1IBM L;  2DY8 A;  1B3A A;  1MIU A;  4BS9 A;  4HIO A;  3K7A B;  4RCO A;  1XNQ Q;  3MTS A;  4O42 A;  3M3Y B;  5D14 A;  4KJO A;  1PYS B;  3I72 A;  3T1H L;  3TP6 A;  2Z6K A;  4AYB G;  3L0O A;  4QL5 A;  4DV4 Q;  3EVQ A;  4QIW E;  2IX0 A;  1E1O A;  1J6Q A;  4RA8 A;  1IL2 A;  4IPD A;  1SEB D;  2J4X A;  4HJ7 A;  5FK9 C;  5JOB A;  1EFI D;  4A3L H;  3OTO Q;  2D0O A;  3OIP A;  1SYE A;  3MXU A;  3OOC A;  1VQE A;  3MXN A;  1TXY A;  5FLM G;  1IW7 D;  3RLF A;  4JYA L;  4DR2 Q;  4RGN A;  1XJV A;  1LM0 A;  2JA6 H;  2LKV A;  4C3H B;  1KAA A;  5ELD A;  5I2X A;  4DAM A;  4K0K Q;  3CC2 A;  1OXV A;  3G48 A;  4FNF A;  1LT6 D;  4RGO S;  3STB D;  2E5L L;  1TY2 A;  1N33 L;  3S16 B;  2A1A A;  3FKI B;  1TWC B;  5E7N A;  3NTH A;  2GVB A;  4XDX A;  3ERS X;  3VYU A;  3HOV G;  4IUQ A;  1SYF A;  4L6T B;  4DV2 L;  1D5M C;  3FMC A;  2JA7 G;  4YIJ A;  1D5X C;  3IFT A;  3RLN A;  5IWA L;  1Q1B A;  4JVZ A;  2B3G A;  3NHH A;  1R9T B;  4LF7 L;  1U4L A;  4EQP A;  1H95 A;  4BBR G;  5KIX A;  3OWF A;  4ZLT F;  5J22 A;  1NUC A;  2Z8L A;  1HA6 A;  5EQ0 A;  3CCE A;  4P71 A;  5IGD A;  3CP0 A;  3A0J A;  4DK0 A;  2WII B;  1MI2 A;  2Z1C A;  3NSW A;  5TSS A;  4RGT A;  1PTO B;  1IBM Q;  1F2Z A;  5FLM H;  1X56 A;  4DF7 A;  3P7J A;  1SE8 A;  2ZXR A;  5BR8 Q;  1AZQ A;  1EQT A;  1N32 L;  2VXW A;  1G8Z D;  1VF5 C;  3ERQ A;  3IKJ A;  1LTT D;  3TP7 A;  3K5O A;  1VQM A;  1I4G A;  4A3G G;  1IKM A;  4KV6 A;  1JC7 A;  1B8A A;  4JC0 A;  2IX3 A;  3PGZ A;  1SYC A;  4HIM A;  2TMP A;  1HQM C;  3FEW X;  3KJP A;  3LNN A;  1X3Q A;  4IPH A;  4JI8 Q;  3CC4 A;  4A3E B;  3S15 H;  1BF4 A;  3P1H A;  3CC7 A;  3SGI A;  3HOV H;  1GUS A;  4H02 A;  1BR9 A;  2AQ1 B;  4ZK9 B;  2JA7 H;  3PV0 A;  1KTK A;  3NQI A;  2F3V A;  1LT4 D;  4OEM B;  4BBR H;  4M1U B;  4R8I A;  3GTL H;  3VA7 A;  2OTJ A;  2MUY A;  3GD7 A;  4DA2 A;  5M9O A;  1V1O A;  1F2L A;  2XSC A;  1TS3 A;  4GNX B;  1Y1W G;  2XNA C;  1JWU D;  1WCM G;  1Z7T A;  4YY3 Q;  4DV2 Q;  1C7Y A;  2BA0 A;  4R4C A;  4DV0 L;  1QNU A;  3MEF A;  3S2D B;  2OF1 A;  4IUP A;  1Z47 A;  2RA4 A;  3PUZ A;  4IOC A;  3RN2 A;  4A3G H;  2VZA A;  1L0Y B;  1UEA B;  1XX8 A;  3MXP A;  1GJX A;  1L1O B;  2RQX A;  1S5F D;  5M3M H;  5M3F G;  2XRQ D;  1YNX A;  1V1Q A;  3A56 A;  4K14 A;  2K04 A;  2M00 A;  3D4W A;  2R93 G;  2JA8 G;  1CKO A;  4N8X 1;  2BE5 D;  1JB7 A;  1AZP A;  1EOV A;  2MPM A;  3VYT A;  1IBK L;  1E1T A;  2V1C C;  1FGB D;  2F4V L;  1EOT A;  4DUY L;  1VQD A;  5CR3 A;  1WTR A;  2CW0 D;  3PMF A;  4DUZ L;  2WP8 J;  2NTS A;  1EY0 A;  2RCN A;  3OHX C;  2HCC A;  4NXN L;  2QF7 A;  4CJ2 C;  2WB1 G;  3TP8 A;  3PIP 3;  2WAQ B;  1YVC A;  1Y1W H;  2EQS A;  1VQC A;  4JI4 L;  2IX1 A;  3C3L A;  1I3Q H;  1YIT A;  2Y0S B;  1WCM H;  3BYY B;  4ZCK A;  1FNV A;  4QCL A;  4CJ1 B;  4GN4 B;  1HJP A;  2PZU A;  2M2L A;  2XIW A;  1B9N A;  2L5T A;  4CDF C;  2KVM A;  4IPC A;  4A3M G;  3GV3 A;  4A93 H;  4C3J B;  4DNI A;  1Z6H A;  2V4D A;  1AW7 A;  3G6J B;  4C2M B;  4GOP B;  4L5S A;  5M3F H;  2N55 A;  3UE1 A;  4H0L C;  3VR3 A;  4A3I G;  1PH3 A;  1VMC A;  5LMU Q;  2F0K A;  3L7Z C;  3GV6 A;  4LF5 Q;  2JA8 H;  1A2T A;  2R93 H;  2EY1 A;  2B2U C;  5EGT A;  2BA1 A;  4KI0 A;  5AJ3 L;  1VQL A;  3W3A A;  4R1J A;  1I50 B;  4CKB A;  2WAQ E;  2CKZ B;  4U68 A;  4JBM A;  5ELE A;  2NVT H;  2NZ1 D;  4POG A;  1PZK D;  1YBY A;  1CZW A;  1X3F A;  2Y0S E;  5JPM C;  4DKA C;  1AE2 A;  3MHB A;  5CMD A;  1RTN A;  2EE1 A;  2XVS A;  3PUX A;  1V1P B; 
#chains in the Genus database with same CATH homology
 2F0N A;  3Q24 A;  1BO0 A;  3KLR A;  3S9W A;  5DM6 3;  1SNQ A;  1F9S A;  1Q8I A;  5EKK A;  2PZW A;  3DMU A;  1TR5 A;  3C1E A;  3DM1 A;  1EU3 A;  1KLG D;  2X69 A;  5E1F A;  2L9H A;  3C2P A;  2F0O A;  4XQN A;  2JA6 B;  2QKI C;  3J7A V;  1Q90 A;  1Y69 U;  1GUN A;  1FR3 A;  3QOJ A;  5EPK A;  4IUT A;  4H7B A;  3TSS A;  3ZYY X;  3VA5 A;  2SNS A;  4RHR A;  1HUM A;  2A73 B;  5I6Y A;  1HTP A;  2B2Y C;  2BDO A;  3BDL A;  5A35 A;  3NPP A;  2HCI A;  3FPP A;  1DCZ A;  4DNT B;  2XWJ B;  5JEA G;  4HAE A;  4AYB B;  5JVG 3;  4TQU S;  2NB0 A;  2IPK D;  4FYD A;  4OGQ C;  2NTT A;  5JPN C;  1EYD A;  4FXG C;  3WDN A;  1STH A;  3MFG A;  1ENC A;  5HGT A;  3I91 A;  1E2Z A;  2F0J A;  5FO8 B;  2NYZ D;  4IN3 A;  1PTO D;  4FF3 A;  4MHE A;  1EY5 A;  1RKN A;  4XQQ A;  1EIH A;  4NKL A;  2EPB A;  2KA7 A;  1CHP D;  2KEC A;  4C1N I;  1XXG A;  2F0U A;  5CBE E;  3S15 B;  1ESR A;  5J39 A;  2KQ3 A;  3HOV B;  5CV8 A;  1B44 D;  5JEA H;  2JA7 B;  5CV7 A;  2F1M A;  2E75 C;  4BBR B;  4U67 3;  3GTL B;  2L11 A;  1Y8O B;  1FD7 D;  3VYR A;  4M8A A;  4OIK A;  3BZD B;  3FVQ A;  1SE4 A;  2ICE C;  2IL8 A;  5M5Y B;  1IYV A;  3BVZ A;  3QG1 A;  4BA2 I;  4DU9 A;  2BOS A;  4J1M A;  2KUM A;  1O7L A;  2WKC A;  4A3G B;  3VR6 A;  1SXT A;  2JE6 I;  2IW3 A;  3X3M A;  1EEI D;  3FRP B;  1ZKO A;  4LMQ D;  1A3U A;  4G7O C;  3M4Y A;  4X3S A;  4DN4 M;  1STN A;  3RD4 A;  3KK7 A;  3HGB A;  3MVV A;  2KHS A;  5C5L A;  1O80 A;  3TP5 A;  5CC4 A;  3PUW A;  2QEJ C;  1V8Q A;  3P20 A;  2EYM A;  1S4Z A;  1EY6 A;  2QIL A;  3PUV A;  4CJ0 B;  4HSV A;  3V96 A;  1HXY D;  3R8B A;  1ZYR C;  4CHT B;  4EGV A;  2SOB A;  1Y1W B;  4QUF A;  5FOB B;  1I3Q B;  1SJH D;  2B2Y A;  1WCM B;  5FLX L;  1PXU A;  3MAQ A;  1JOK A;  2FMC A;  5KYI A;  3IAY A;  3T4A C;  1O7Y A;  1DD2 A;  2O5J C;  3RZO B;  2F0L A;  5CBA E;  3MA2 B;  2F0F A;  5G3L D;  3D6C A;  5M3F B;  5D3D A;  1TII D;  4JK1 C;  4KKU A;  5T1I A;  2R93 B;  2JA8 B;  3N6R A;  4X3K A;  5BN5 A;  4XYO A;  3Q0A A;  1PYW D;  1LLR D;  4QUC A;  3K5L A;  2NVT B;  1CA6 A;  4N9P A;  2KOL A;  3QOL A;  1SDF A;  1H9M A;  1IYU A;  4RCN A;  3MZ5 A;  1H9K A;  1KDB A;  1YNN C;  2F0P A;  2EY5 A;  3RUZ A;  2WB1 B;  4G4K A;  3HZX A;  1QG7 A;  2EYJ A;  2FIN B;  5KNB A;  5DM7 3;  2A69 D;  1R4P B;  2K1B A;  2FHT A;  3IL8 A;  3A8K E;  2EVB A;  2F3W A;  4A3M B;  3D3R A;  4RHS A;  3O13 A;  2EDG A;  4KN4 C;  3FPU B;  5FKA C;  4PQX A;  3D31 A;  2C9O A;  2A6H D;  5J1Z A;  4OO1 H;  5DEH A;  3E0J A;  2LY7 A;  1IKL A;  3X3N A;  2E2D C;  5IOD A;  4OHJ A;  3H3V C;  2PW7 A;  1EU4 A;  1FYC A;  3SDZ A;  1DZ1 A;  3EQL C;  4PMC A;  1U4M A;  5I2Y A;  2B39 A;  4B08 A;  2EYO A;  3R93 A;  3OMG A;  3SK6 A;  4WRD A;  2R3Z A;  4RAU C;  4FF1 A;  2EYH A;  2MP1 A;  2WKD A;  2KED A;  1LTS D;  3UI2 A;  4BWG B;  3MFY A;  1PMR A;  3SVM A;  4KHV A;  2B2W A;  1U9R A;  4K2K A;  1K8O A;  3H09 A;  1I4R A;  3QJY A;  2F0T A;  2B2T A;  3CQZ B;  2J7Z A;  2J0T D;  3K59 A;  2RVL A;  3D8G A;  4DFA A;  1QOH A;  3VYS A;  2PCF B;  4XQJ A;  3NWS A;  3ERO A;  1ICW A;  5C0X I;  4HTH A;  4IFD I;  5KEE A;  1IW7 C;  2F4I A;  3NE5 B;  3PUY A;  3J7A F;  4FP5 D;  1JOQ A;  5HUR A;  1AEX A;  1RHP A;  1TS4 A;  1X32 A;  2EYL A;  3A54 A;  1A2U A;  1FNU A;  1D5Z C;  2ZXP A;  3E6Z X;  2F0H A;  1C8C A;  4HMJ A;  4K8I A;  3HOU B;  2F0V A;  3BG3 A;  5JJZ A;  2E2H B;  3SK8 A;  3HOX B;  2NN6 I;  5C6A A;  1ESF A;  2ID0 A;  2IT1 A;  3NP8 A;  3VR2 A;  5C4H A;  4H13 C;  2K28 A;  1DOL A;  3S1Q B;  1SFO B;  2OXP A;  1EWC A;  3HP3 A;  5KYL A;  3SXH A;  4KN7 C;  3HEJ A;  5ELC A;  3HG9 A;  2F03 A;  4BA1 I;  1QE6 A;  3KLS X;  3KLS A;  2KEE A;  2EOT A;  3NQT A;  4ZQ3 A;  1G2T A;  1V1P A;  4NDX A;  2GA4 B;  4A3J B;  2X6L A;  2C5C A;  1QJO A;  3MWY W;  5T1G A;  4PV1 C;  5C44 B;  1Q12 A;  1PRT B;  3FDT A;  3VR4 A;  4ZAI A;  2E2J B;  3T51 B;  5COR A;  1LT5 D;  1LAC A;  2F0M A;  1PZI D;  1K83 B;  5JAV A;  3HS0 C;  1KNE A;  3DUZ A;  3H91 A;  2DY7 A;  4C3I G;  1EQV A;  1BCP B;  1F2M A;  1I6V C;  1OXS C;  2AUK A;  2R7Z B;  2G9H D;  5C3W A;  5COY A;  1RDP D;  4RH6 A;  1KAB A;  4CGY B;  3J7Y W;  2F0E A;  5ISR A;  2A6E D;  3T13 A;  3K6O A;  4QMG A;  5CYU A;  3J81 E;  2K5W A;  3F2U A;  1EZ8 A;  2NWG A;  2BE5 C;  2TSS A;  2A6E C;  2FJ2 A;  4CKE A;  4HN7 A;  5A2Q E;  1KDC A;  3L9A X;  3K57 A;  2CW0 C;  1PTO F;  1EY4 A;  3ONA B;  2L0C A;  1IHZ A;  3J81 L;  4QB4 A;  2O4X A;  1O7Z A;  3CKI B;  4KHZ A;  4RFB A;  4FF2 A;  3NBI A;  1BUV T;  3Q6S A;  3T16 A;  3S2H B;  5A2Q L;  5EPL A;  1SYB A;  4H44 C;  5LHY 1;  3S1M B;  5KNC A;  4KJN A;  1JE4 A;  2L12 A;  1TS5 A;  4Z9C B;  1T5E A;  3I3C A;  4MN3 A;  2PNR C;  4KY6 A;  2SDF A;  2BCO A;  1QB5 D;  1H9S B;  1I4H A;  1SNM A;  2LMC B;  3DWA A;  3LWU A;  3A7A B;  5D3I B;  1SE3 A;  1OXT A;  2JEA I;  4ABN A;  4DAV A;  3HOY B;  1OXU A;  4FXD A;  3W2D A;  2VUM B;  5I9P A;  1G2S A;  1W6K A;  3Q22 A;  2PYK A;  5KGU A;  3NBH A;  4CKC A;  1NCV A;  1SMY D;  1DYQ A;  4EVO A;  4DXG A;  2SEB D;  3I70 A;  5E4X A;  4TSS A;  1Y8N B;  5K36 G;  3NK9 A;  5ELB A;  5AFW A;  1K8M A;  4KK7 A;  5E3F A;  1CT1 D;  4C3H G;  4EQN A;  2D9U A;  4XXE A;  4KD4 A;  3E5S A;  3GTM B;  3LX0 A;  1SE2 A;  2ENB A;  1ILQ A;  1H9R A;  1TWF B;  5DNF A;  3MEH A;  4XTC S;  1HFG A;  5C4J B;  4NMZ A;  4KD3 A;  1SYD A;  3I73 A;  3DEP A;  4L8J A;  1RJT A;  1WTX A;  1XWE A;  1W6J A;  1JB3 A;  1Y1V B;  1GHK A;  2E2I B;  2EY6 A;  2RDF A;  1ENA A;  3DWQ A;  5IGC A;  5G3L F;  2A68 D;  1PDQ A;  1WTO A;  5I4D A;  1HPC A;  1PTO C;  5K36 H;  4DNR B;  3H6M A;  1NSN S;  2RSN A;  3KBX A;  2EJM A;  2D5D A;  4IUR A;  5IGF A;  1JWM D;  3G7L A;  2NBF A;  1WTW A;  2OEO A;  3GTG B;  1MSH A;  2PO4 A;  1SNC A;  4WJW A;  3DEO A;  4LJZ C;  3NTK A;  2ZXO A;  4K8J A;  2YYZ A;  2F0D A;  2H1E A;  1YNJ D;  3I8Z A;  5CGK A;  5C0X G;  4IFD G;  4F88 A;  3CRK C;  1B9M A;  4HMI A;  4P2C B;  4ME5 A;  1MBY A;  1KLU D;  1C48 A;  2N88 A;  1PLF A;  1PRT D;  1UUP A;  1T5X D;  4TKO B;  2NVQ B;  3U9S A;  2G9D A;  4QF4 A;  5BN3 A;  2B2V A;  1CTM A;  1BCP D;  3SHL A;  2B2W C;  2VB3 X;  2D2C C;  1LTB D;  5FLX E;  4BBS B;  4OL7 A;  2B2T C;  3GO5 A;  3NXW A;  1CA5 A;  1OO9 B;  3S17 B;  2DNE A;  1EZ6 A;  2NN6 G;  1Q1E A;  1QCB D;  5JEA J;  1NR2 A;  4WFN 3;  1RCV D;  2XN9 C;  4HR7 B;  3HOW B;  1CFM A;  4EQO A;  2EJF C;  4ZUI A;  1EEF D;  5C0X H;  3K5M A;  4IFD H;  3TBI B;  2R61 A;  3AB9 A;  4XIG S;  1MGS A;  1GHJ A;  1TWH B;  1MD2 D;  1QIL A;  1JIC A;  4C3I B;  5IIF A;  4FXK C;  2PMZ B;  5CV5 A;  1UNS A;  3LWE A;  3BDO A;  1B2T A;  3DXJ C;  2F0S A;  1VCI A;  4O1N A;  1JOR A;  3A8I E;  1KDA A;  3I4L A;  1TU2 B;  4F7X A;  2A74 C;  2CQA A;  4HED A;  2XWB B;  3SR1 A;  2PW5 A;  1BOS A;  1D6E C;  4Q0F A;  1S5C D;  4N9T A;  1NAP A;  1DXM A;  4NW2 A;  1VDZ A;  3P75 A;  1PFM A;  3RMH A;  2EY2 A;  1DON A;  1Q3L A;  5EPJ A;  1NR4 A;  3HKZ B;  1STA A;  3K5N A;  1A3T A;  4A3D B;  1SND A;  4A3K B;  4JBW A;  4RKB A;  1ONL A;  2Q8T A;  3PO2 B;  1GXD C;  2EXZ A;  2A69 C;  3HRZ C;  5JVH 3;  1LT3 D;  4OIJ A;  4A3I B;  1TWG B;  5I9O A;  2Q8I B;  3QO2 A;  2K6A A;  4XYQ A;  1M8A A;  1STE A;  5KRU A;  4Q5V A;  2A6H C;  1E2V A;  5EJW A;  2NVY B;  3OIQ A;  2O2L D;  1LAB A;  1HFN A;  1STG A;  4LK1 C;  4E6I A;  5F2D A;  1TQO A;  1JWS D;  4I7Z C;  3U9O A;  5LL6 X;  4ZRZ A;  2B8F A;  1S5D D;  4HCS A;  4RGM A;  5CV9 A;  1STB A;  2NVX B;  4X3U A;  1BQQ T;  1EYC A;  3N52 A;  1G29 1;  3QIA A;  4FVM A;  2ICI A;  2RKS A;  1TY0 A;  2JA5 B;  2AQ2 B;  3TZD A;  4ZKC B;  1AP0 A;  2KJX A;  1EL0 A;  1TWA B;  2OT2 A;  1D1I A;  2MHV A;  2JXM B;  1SNO A;  3H94 A;  1B53 A;  4PMW A;  2L1B A;  3GTO B;  1F9Q A;  3URY A;  4DXF A;  2D62 A;  3BVG A;  2A5H A;  1BDO A;  3S1R B;  1M4V A;  3OPO A;  4RKL A;  2JYO A;  3K58 A;  1RF2 D;  1STY A;  3QWN A;  2XRS D;  4K5W A;  2F0G A;  1U4R A;  4PMB A;  1C4Q A;  1HHV A;  4PNY A;  3A7L A;  4TRD A;  2WV6 D;  4Y7N B;  5C4X B;  1HTL D;  4C56 C;  5FO9 B;  1EY7 A;  1A6X A;  3EA6 A;  3CHB D;  1EY8 A;  2KCC A;  3V05 A;  2K33 A;  3QB3 A;  1H9S A;  1BNZ A;  3SE0 A;  3ITP A;  3GTP B;  4K6L A;  4J6H A;  4MIU A;  4HCE A;  1F2Y A;  4CBV A;  1CK1 A;  1B1Z A;  1A3V A;  3OSO A;  1BXT A;  1EWH A;  3GP7 A;  1SNP A;  2Z4I A;  3MXG A;  1WVL A;  1B4O A;  4OO1 I;  1ZXT A;  4ZKB B;  5IT9 E;  3A55 A;  3AU7 A;  2HDM A;  1Y8P B;  3NUC A;  1S5E D;  3ND9 A;  2AWN A;  3SEB A;  4L63 B;  1LTI D;  1D1K A;  3V2T A;  4F8M A;  4G57 A;  1HQR D;  5KND A;  3RZD B;  1WD1 A;  3BYT B;  3GTK B;  3WOF A;  4S3S A;  1LV9 A;  3CU7 A;  2JP1 A;  3I4N B;  2K05 A;  2AUJ D;  4DK1 A;  3CRL C;  2B8G A;  5IT9 L;  1J9O A;  3L3O C;  4KMU C;  3R3O A;  5FO7 B;  5LL6 S;  4ZYS A;  4IUV A;  5C3E B;  1EIG A;  2L4N A;  5M5W B;  1CQF A;  1F9P A;  3WOE A;  3GQB A;  2B63 B;  3IFD A;  3TN2 A;  5EBC A;  4XT1 B;  4IQZ A;  1CHQ D;  3H0G B;  5EKI A;  1DJR D;  3AMU A;  4A3F B;  2JEB I;  1H9J A;  4KKS A;  1AFP A;  3KUP A;  3J80 E;  1PFN A;  2VB2 X;  4I65 A;  1GOZ A;  2F0Q A;  1UAP A;  2L55 A;  4IZ8 A;  3GTQ B;  4KKT A;  1SAP A;  1ENF A;  2B2V C;  1HRJ A;  1X3P A;  5M5X B;  3ND8 A;  5NUC A;  1RD9 D;  3OMC A;  1PRT F;  2EYP A;  4DAP A;  4HSP A;  2AWO A;  3SK5 A;  2QDB A;  3J80 L;  5D65 A;  4LAA A;  2PPB C;  2K5Q A;  4KY5 A;  3PO3 B;  1EYA A;  3C46 A;  2E74 C;  3DHQ A;  1SYG A;  1F9R A;  1BCP F;  1I4Q A;  1IL8 A;  5EBD A;  4IUU A;  4J8Q A;  2BDN A;  3TDQ A;  4WOR A;  4BY1 B;  1U4P A;  3C1F A;  1ZEQ X;  3NTI A;  2IWH A;  1LTA D;  5BN4 A;  4C1N K;  4DAY A;  1SMY C;  1ILP A;  1FNW A;  1QWY A;  4IAL A;  3VR5 A;  3KBG A;  1VMP A;  1AN8 A;  2VNU D;  5IGE A;  3R2I A;  1ET6 A;  2K01 A;  4R9W A;  3NWT A;  1S5B D;  2CVR A;  2K32 A;  4ILW A;  1XYI A;  3BVM A;  2EYF A;  1HUN A;  5CV4 A;  2HDL A;  2I46 A;  3D4D A;  3M7N A;  1GUT A;  2RSO A;  1LTR D;  3TZU A;  4G7H C;  2QCP X;  5IGG A;  1JQY D;  4F87 A;  1GUW A;  2WIN B;  1LO5 D;  2A68 C;  2AQ3 B;  2LFN A;  4KY7 A;  2FFK B;  2HUG A;  1B50 A;  3D4R A;  4X3T A;  4FO2 A;  1TT2 A;  3EFX D;  3TME A;  5E4W C;  1O78 A;  1F77 A;  4ULL A;  3I4M B;  2EJG C;  3I90 A;  2K7V A;  1E0B A;  4ZUJ A;  1PFB A;  1A15 A;  2R6G A;  1I4X A;  2X6G A;  1EY9 A;  1CZG A;  1BBX C;  2RDG A;  1R4Q B;  4KTA A;  1YNJ C;  2F0I A;  5IGB A;  1QNK A;  3T56 B;  3HOZ B;  1WTV A;  1ROD A;  1PRT C;  2F0W A;  3PIO 3;  2JSO A;  1GUO A;  4UAI A;  5EKL A;  5C3X A;  2B2U A;  4G7Z C;  1PTO H;  1CI3 M;  2MGS A;  4R8N A;  2MJ8 A;  3BS1 A;  5I6W A;  1KNA A;  3Q23 A;  1OXX K;  1BCP C;  1GUG A;  4V19 0;  1II3 A;  2E76 C;  3A8J E;  2ZT9 C;  3D6W A;  1CM9 A;  1DOK A;  5M3M B;  1TKW B;  4BY7 B;  2RDH A;  2NUC A;  2R92 B;  2M9V A;  1DOM A;  1JCK B;  4V0B A;  5DAU A;  1WTQ A;  2H4O A;  3OWE B;  1ZYR D;  2PZT A;  4K5V A;  3OW7 A;  1TS2 A;  4FF4 A;  1ET9 A;  1DM0 B;  1MSG A;  3T53 B;  1SSO A;  1HCZ A;  4K5X A;  3EJI A;  2LS0 1;  1RTO A;  5IOC A;  1D2B A;  2DN8 A;  4IUN A;  3K0Y A;  5CV6 A;  4K6D A;  2NN6 H;  1SJE D;  4B9X A;  3GTJ B;  4ODG A;  4A93 B;  1E2W A;  3KF8 A;  2Q8R E;  2SNM A;  1CQV A;  4GZY C;  3S14 B;  4C3J G;  2IJ0 A;  1G91 A;  4DGZ A;  4OO1 G;  1WTP A;  2CHB D;  1V43 A;  3R2T A;  5C0X J;  3SK4 A;  4IFD J;  1YNN D;  3BDC A;  3DWP A;  1J8I A;  3S1N B;  1I6H B;  1JR0 D;  1ML0 D;  1TVX A;  4ID6 A;  1SBB B;  3JAM E;  3M4O B;  1PZJ D;  2DNC A;  2I07 B;  2HQE A;  2PQE A;  2EZV A;  5C4Z A;  3M7G A;  2K03 A;  1LTG D;  1VF7 A;  4QIW B;  1L0X B;  2K5D A;  2WAC A;  5K5P A;  1I4P A;  4NP5 A;  1XTC D;  2YU9 B;  2KCN A;  4RWS C;  2Z4H A;  1HA5 A;  3MC0 B;  3JAM L;  5C5M A;  1G6Z A;  5ELF A;  4XT3 B;  4K2L A;  3M85 A;  4A3B B;  2RBM A;  2O5I C;  2FMM A;  4UDU C;  1WD0 A;  1JOO A;  4B9W A;  2DY8 A;  1B3A A;  4BS9 A;  3K7A B;  4RCO A;  3MTS A;  4O42 A;  3M3Y B;  5D14 A;  4KJO A;  3I72 A;  3TP6 A;  3EVQ A;  2IX0 A;  4RA8 A;  1SEB D;  2J4X A;  5FK9 C;  5JOB A;  1EFI D;  3OIP A;  1SYE A;  3MXU A;  3OOC A;  3MXN A;  1IW7 D;  3RLF A;  4RGN A;  2LKV A;  4C3H B;  1KAA A;  5ELD A;  5I2X A;  1OXV A;  4FNF A;  1LT6 D;  4RGO S;  1TY2 A;  3S16 B;  3FKI B;  1TWC B;  3NTH A;  4XDX A;  3VYU A;  4IUQ A;  1SYF A;  4L6T B;  1D5M C;  3FMC A;  4YIJ A;  1D5X C;  3IFT A;  1Q1B A;  3NHH A;  1R9T B;  1U4L A;  4EQP A;  5KIX A;  3OWF A;  4ZLT F;  5J22 A;  1NUC A;  2Z8L A;  1HA6 A;  5EQ0 A;  5IGD A;  4DK0 A;  2WII B;  1MI2 A;  2Z1C A;  3NSW A;  5TSS A;  4RGT A;  1PTO B;  1F2Z A;  4DF7 A;  3P7J A;  2ZXR A;  1AZQ A;  1EQT A;  2VXW A;  1G8Z D;  1VF5 C;  3ERQ A;  3IKJ A;  1LTT D;  3TP7 A;  3K5O A;  1I4G A;  1IKM A;  4KV6 A;  1JC7 A;  2IX3 A;  1SYC A;  2TMP A;  1HQM C;  3FEW X;  3LNN A;  1X3Q A;  4A3E B;  1BF4 A;  3P1H A;  1GUS A;  1BR9 A;  2AQ1 B;  4ZK9 B;  3PV0 A;  1KTK A;  3NQI A;  2F3V A;  1LT4 D;  4M1U B;  4R8I A;  3VA7 A;  2MUY A;  3GD7 A;  4DA2 A;  5M9O A;  1V1O A;  1F2L A;  2XSC A;  1TS3 A;  2XNA C;  1JWU D;  1Z7T A;  2BA0 A;  1QNU A;  3S2D B;  2OF1 A;  4IUP A;  1Z47 A;  2RA4 A;  3PUZ A;  1L0Y B;  1UEA B;  1XX8 A;  3MXP A;  1GJX A;  2RQX A;  1S5F D;  2XRQ D;  3A56 A;  4K14 A;  2K04 A;  2M00 A;  3D4W A;  2BE5 D;  1AZP A;  2MPM A;  3VYT A;  1FGB D;  1EOT A;  5CR3 A;  1WTR A;  2CW0 D;  3PMF A;  2WP8 J;  2NTS A;  1EY0 A;  3OHX C;  2HCC A;  2QF7 A;  4CJ2 C;  3TP8 A;  3PIP 3;  2WAQ B;  2IX1 A;  3C3L A;  2Y0S B;  3BYY B;  1FNV A;  4QCL A;  4CJ1 B;  2PZU A;  2M2L A;  2XIW A;  1B9N A;  2L5T A;  2KVM A;  3GV3 A;  4C3J B;  1Z6H A;  2V4D A;  1AW7 A;  3G6J B;  4C2M B;  2N55 A;  4H0L C;  3VR3 A;  1VMC A;  2F0K A;  3L7Z C;  3GV6 A;  1A2T A;  2EY1 A;  2B2U C;  5EGT A;  2BA1 A;  4KI0 A;  3W3A A;  1I50 B;  4CKB A;  4U68 A;  5ELE A;  2NZ1 D;  1PZK D;  1CZW A;  5JPM C;  3MHB A;  5CMD A;  1RTN A;  2EE1 A;  2XVS A;  3PUX A;  1V1P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...