3SXHA

Crystal structure of staphylococcal nuclease variant delta+phs i92al103a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEAAVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92AL103A at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sxhA00
1EY6A 2F0TA 1EY5A 4EQNA 5IGDA 5E1FA 3TP5A 1EY9A 2KHSA 3BDLA 3OMGA 5HURA 5EGTA 2RDFA 3DHQA 2F3WA 4KD3A 3U9OA 4IALA 3SXHA 4N9PA 2EY5A 5C3WA 2F0EA 3EJIA 1STHA 3VA5A 4RKLA 5F2DA 1STAA 3NK9A 1AEXA 3MHBA 1EY4A 4PMBA 5JAVA 3SR1A 2F0SA 1EQVA 2EXZA 3TMEA 4J1MA 5IGCA 4DFAA 3MVVA 3V2TA 3OWFA 1JOKA 2PW7A 4R8NA 4K2LA 4KHVA 2RKSA 4IZ8A 4KY7A 3RUZA 2M00A 4TRDA 3OSOA 5E3FA 5KYIA 1A3TA 4K5VA 4K5WA 3SHLA 4EQOA 2PQEA 1A3UA 3LX0A 4F7XA 2OEOA 3QB3A 1SNQA 5EKKA 3DMUA 3BDCA 2F0HA 5NUCA 3D4DA 4NMZA 4DGZA 4EQPA 1STBA 4DU9A 5C3XA 5C4ZA 4WORA 5IGBA 5CV9A 2O4XA 2PZUA 1EZ6A 1A2UA 1IHZA 3MEHA 4YIJA 1SYBA 4HMIA 5CV8A 5KIXA 1NSNS 2F0LA 3P75A 2F3VA 4NP5A 4B9XA 2WACA 3SK6A 3P1HA 3PMFA 4DF7A 4K14A 1JOQA 4H7BA 5IIFA 3C1EA 4KV6A 3SK8A 5HGTA 3TP6A 5IOCA 4K8JA 2EYJA 4K6DA 5ISRA 4HMJA 5I9OA 4KY6A 3T13A 5IODA 4KD4A 4ODGA 4RKBA 5I6WA 5KYLA 4ID6A 5J1ZA 4KJOA 3S9WA 5M9OA 4G57A 4K2KA 1EZ8A 5CV5A 4HTHA 2QDBA 4MIUA 3NXWA 2F0GA 5EKLA 1RKNA 1ENCA 2ENBA 3E5SA 2EY6A 1TQOA 2SOBA 4K8IA 5CGKA 1KABA 5DEHA 1EYDA 2RBMA 5CR3A 2F0WA 4PNYA 1SNDA 2EYMA 2F0DA 5J39A 4IUNA 1JOOA 2F0UA 1KAAA 1SNCA 2EYHA 3TP7A 4ZUIA 1SNMA 3MXPA 2F0IA 1SNPA 4ZUJA 4K5XA 3D8GA 3SK5A 5CC4A 1SYFA 2F0QA 3EVQA 4B9WA 3OMCA 3SK4A 5C6AA 3NUCA 1TT2A 1II3A 2F0NA 4WRDA 2F0PA 4E6IA 2PZWA 5CV4A 1EYAA 5KEEA 3QOLA 3R3OA 2F0VA 4QB4A 1EY8A 4KY5A 2F0FA 3H6MA 3C1FA 3D6CA 1KDBA 2F0JA 3HZXA 4NKLA 4F8MA 5J22A 2PYKA 2PZTA 5C5LA 2SNSA 4QMGA 1EYCA 3ITPA 4J6HA 4KTAA 4ME5A 5IGGA 2SNMA 3ERQA 1JORA 1U9RA 2F0MA 5KGUA 2F0KA 1A3VA 1NUCA 5KRUA 4OL7A 1STGA 3MZ5A 3NP8A 3QOJA 1KDAA 4NDXA 5I6YA 3D4WA 5C4HA 5IGFA 5DAUA 1F2MA 2PW5A 3NQTA 2F0OA 2HQEA 2EY2A 1F2YA 4LAAA 5CV7A 1F2ZA 2EYPA 2NUCA 4EVOA 4S3SA 2OF1A 1SYEA 1KDCA 1STYA 1SYDA 2EY1A 1A2TA 1SYCA 3EROA 3TP8A 1ENAA 4N9TA 1SYGA 2EYLA 4ZQ3A 2OXPA 3HEJA 1STNA 4I65A 5JOBA 5C5MA 3T16A 1EY0A 2EYFA 3NHHA 5I9PA 1TR5A 4KJNA 1EY7A 5IGEA 5K5PA 2EYOA 1SNOA 4QF4A 5CV6A 4PMCA 2KQ3A 2LKVA
chains in the Genus database with same CATH superfamily
3AEVA 1X54A 1W2BA 1X3QA 2ZXPA 1Y1VG 2IL8A 4RHRA 2G5DA 2M2LA 3M4OH 2RSNA 1N8RC 4RKLA 2N55A 3CKIB 3K7AB 3MHBA 3O13A 5C4XB 2UUAQ 2WV6D 3TRZA 1DCZA 2CW0D 3HFZB 2IHFA 3A8IE 4JI8L 1JOKA 2A6ED 1PV4A 5M3MH 2IPKD 3W3AA 1QOHA 4A3LG 4AYBE 4HR7B 2E2JH 1FNVA 4UPAA 3GV3A 2UU9Q 3I4MG 3U4ZA 2F0HA 1VQHA 2C9OA 4QL5A 1UAPA 2DJGC 5NUCA 5KNDA 3CXCA 2NWGA 3J80E 1C0AA 4DN4M 1HRJA 4OONA 5KIXA 2JA9A 1PH2A 1PXUA 2B2WA 2PQAA 2EYJA 1H9KA 5I9OA 1XMQL 1LT3D 4KN4C 3S14H 2IT1A 2NVXB 4ILWA 4R9WA 4F88A 3HKZE 2NYZD 1Q7YC 5CR3A 1MBYA 1E2VA 1PH9A 1TVXA 1KAAA 2JQOA 4H0LC 4BA1I 3KF6B 4ZUJA 3IL8A 1I3QB 3K7UC 4TVAB 1JWSD 5DM73 1A62A 1GOZA 2F0PA 3H3VC 1CT1D 2P5ZX 4BBRG 3EQLC 5KEEA 1NY4A 3CPWA 1LT5D 4CDEC 1TWGB 4L8JA 1NR4A 5C5LA 1KRTA 1ZXTA 2SNMA 1OXTA 2RQXA 1NUCA 2DN8A 3KUPA 3M4QA 3D4WA 1JB3A 1E0BA 1V1PB 3I91A 5DNFA 1SBBB 1JWMD 2ZM6L 2EYPA 2LS01 2OF1A 3NE5B 1J9OA 5ELFA 1B9NA 1E1TA 3MEFA 4A93H 2K04A 3I4LA 4DUYL 4ZQ3A 4I65A 3K80C 2JEAI 1YVCA 3QWNA 2L0CA 4CJ0B 4JCVE 5L37A 4DV6Q 2A73B 2EE1A 1EY6A 2D0PA 2D9UA 3S1RH 5C4JB 1H9SA 4DR5Q 4JI6L 3SXHA 4J8QA 5BR8Q 3JAML 1SMYD 1K8OA 3M3YB 1T5XD 1X55A 1ET9A 3WOFA 4A3MG 1SLJA 2LMCB 1AE3A 2JA8H 1PRTB 3F1ZA 5M3MB 1Y1WH 1GUSA 4DNRB 3C46A 3HOZH 2EZVA 1BBXC 2K75A 4C3IG 3Q24A 3KF8A 4LK1C 2L5TA 4IPHA 1JQYD 1L1OA 5EPLA 5JPNC 1VQPA 1J8IA 1L0XB 2EQSA 5HY6A 2Z6KC 3K8AA 4P71A 3GTQH 3OHXC 4P72A 4RGNA 1K83B 1S5BD 2ZJQA 4A3JH 5BN5A 2K5HA 3H3VI 2K7VA 1DYQA 1PYBA 4ZK9B 2K05A 2L11A 1JOQA 3VYTA 2I5HA 2KVMA 3J7AF 4KV6A 2KENA 5IYCH 2JEBI 4OO1H 1KXLA 2B2TA 4B3TQ 5LL6X 1NMGA 4RG1A 2IX1A 4G57A 1HNZQ 2QDBA 3K58A 3E5SA 1GXDC 1HA5A 4OELB 5DEHA 2DY8A 1LTLA 1V1QA 1DXMA 2RVLA 4CDCC 1WOCA 1YNJC 2KECA 3ULLA 2F0IA 2ZT9C 5FO7B 1SYFA 4DXGA 4LNQA 2WFWA 1O78A 1SE3A 1TT2A 3TN2A 4A3EG 4DXFA 3FDTA 2R7ZB 4QB4A 3I4MH 1BBWA 1ICFB 4AYBB 4A3DB 3E0JA 1RTNA 5I6YA 3I55A 3VR6A 2AWOA 1S5DD 3L2PA 1NR2A 5CV7A 1F2ZA 4JC0A 2CVRA 1BCPD 1BQQT 1CK1A 3U9SA 3UI2A 1ZKOA 3KDFB 2WIIB 3KFUA 4UP9A 2Z6KA 3PGZA 1OO9B 1TR5A 1EIYB 3K5LA 1N33L 1VQ7A 5M5YH 4L5QA 2K33A 3GTJB 3S16B 2K5NA 2LY7A 2KHIA 2GVAA 4BXXH 5FLXc 1WD0A 1VQ9A 4N9PA 1STHA 5M5WB 2AHOB 1CM9A 1TWFB 4DFAA 1I3QH 3MVVA 3DEOA 3V2TA 2RHSB 2B29A 2Y0SB 3RMHA 1RIPA 2LFNA 3MWYW 2L1BA 2XWBB 1X3FA 2M00A 1X3PA 3VDYA 4PG3A 4O2DA 1Z9FA 1EIGA 1CA6A 2OEOA 4HN7A 2VNUD 4IJLA 4A76A 1L0YB 1NTGA 4I7AA 2OQ0A 4EQPA 3S14B 3HOVB 4A3DH 3C3LA 3PO2B 4R1JA 1IYJB 3PUXA 4QJFA 1SJHD 2VB3X 3SGIA 1N36Q 2N78A 3T1YL 1ZYRD 5M3FB 2K5DA 4WJ3M 4K6DA 4LF9L 3T13A 3M4PA 1QCBD 1C7YA 4JBKA 1SN8A 3BYYB 1EQTA 1KNAA 2Q2HA 3GTGH 4JI7L 1RKNA 1ENCA 1XTDA 3GV6A 3I4NG 1KNEA 3F8TA 3NBHA 2F0WA 5K36H 1Y1WG 3K57A 1MIUA 1VQEA 2BH8A 3QR8A 4H44C 1SNMA 1AZQA 3N6RA 4FNFA 2CFMA 1I4HA 2F0QA 3TDQA 4CKBA 3S1MB 3J81j 1A6XA 3S2DH 5CV4A 4GN3B 4FXGC 5IP7G 1FGBD 2WAQB 3S2DB 4J6HA 4CJ2C 2VUMG 1SSOA 4JI2L 2B63B 2ZTDA 1P16A 1PDQA 3PIPA 2F0KA 1VQMA 2QKIC 3J81L 3QJYA 3OOCA 4YWKA 1KQSA 5GAHC 4R8IA 1V1PA 4RFBA 1XYIA 3D31A 1VQJA 2PW5A 3NQTA 3CPFA 1J6QA 4DV2Q 3CCVA 1LTSD 2ASBA 3D0FA 1BNZA 3BVGA 1UNSA 3V96A 5JJIA 1SYCA 4DR1Q 3S16H 1EY0A 5I9PA 4XQJA 3WWVA 1QILA 2K52A 4A3FB 1XMQQ 4XDXA 5M3FH 2LKVA 5IYBG 2MP1A 1VF7A 3TP5A 1H9SB 3Q8DA 1ICWA 3AFQA 4IALA 1HUNA 3FPUB 2C5CA 5F2DA 1STAA 4A3EH 2FINB 1XNQL 2HDMA 3LWEA 1Y8OB 2EXZA 4YHHL 4IUTA 1K3RA 4DNIA 5FKAC 1GUTA 1MJCA 2ICIA 3RLOA 4KHZA 3OW7A 1L1OB 4M1UB 1SNQA 4HJ7A 4IO9A 5HGQA 5I2XA 1LT4D 1HZCA 3J80c 2A6HD 5IGBA 4C1NI 1MGSA 2RSOA 4O1NA 2K50A 3DWPA 3KBGA 1VS0A 4DA2A 2UUBQ 1NSNS 2F3VA 1HFNA 1DOKA 1V43A 1Q1EA 3P7JA 4C3JH 1YJ9A 1LLRD 3HOVG 5A35A 5ISRA 4DK0A 4CKEA 4RGOS 1CFMA 4RGMA 5I6WA 1BDOA 2HD3A 3HRZC 4KJOA 5M9OA 4LFCL 1EZ8A 1EOTA 5J3BA 1XMOL 4A3GG 1D8LA 1B70B 3TS0A 3GP7A 5LMUL 3GO5A 4DV2L 5D14A 4C1NK 4NXMQ 2KBNA 1S5FD 3I8ZA 3SK5A 4WRDA 5D65A 2JA6B 3GTOB 3R3OA 5EQ0A 2IW3A 4QIWB 3PO3H 1TWHB 4L6TB 2A8VA 4EX5A 1YITA 2PYKA 1JC7A 3I72A 4OIKA 1B4OA 3PF4A 5KRUA 2VQEQ 3FKIG 4O42A 2ZJRA 3HOUH 4B3RL 4PZ6A 1M8AA 4HJAA 4K0KQ 3V05A 5BN3A 1CKNB 4L5TA 4DAYA 3KDFA 2N8NA 1SYDA 1IKLA 3HOYG 2J0TD 1Q86C 3HEJA 2EPBA 3TREA 2E5LL 4QF4A 3I4NH 4IUUA 1O7YA 2K32A 5K36G 1X56A 1X65A 1CZGA 2KEDA 2RDFA 3G6JB 4GZYC 2R7DA 1W3SA 3F2DA 5E7NA 4BA2I 2BE5D 5LMNQ 3GTLH 2I5MX 3OTOQ 1K0RA 1WVLA 4OIJA 4JBMA 3NK9A 1AEXA 3GTPH 1KLUD 2QDLA 4JYAQ 3DEPA 1O7LA 4FF4A 3E9IA 5IP7H 1BKBA 1NMFA 4AH6A 4GS3A 1QZHA 1Y1VB 1TY2A 4EQOA 3QB3A 1TWFH 1RHPA 2VXWA 1BOSA 2HUGA 1Y1WB 2K5VA 1QE6A 4V0BA 5C3EH 5CV9A 2HQLA 2E2JB 2GA4B 1EIFA 4P73A 4GLXA 4BBSG 4ME3A 2NTTA 4JI4Q 3H91A 4MTKA 3CQZB 1LTGD 4B3TL 5M3FG 1BCPC 1KL9A 1IBKL 1RD9D 3NWTA 3NSWA 2NVTH 1MSGA 4HSPA 1PH8A 2B2UA 1ENFA 2EVBA 3BZCA 2KA7A 1H95A 2E2IH 2EIFA 3NBHB 2FJ2A 1LABA 2EYMA 2AKWB 5AFWA 3D8GA 4LWCA 4RGTA 3NUCA 2VS1A 1EYAA 4DNTB 1CTMA 1EY8A 4X3KA 3I4MB 4F8MA 5GADC 1PTOB 5KNCA 1PRTF 1U4RA 2K01A 2SDFA 1HTLD 1A3VA 4KN7C 5C44H 1VQ4A 1BBUA 3KK7A 4C3JG 2UXBL 3RN2A 2F0OA 5ELEA 5CYUA 1JICA 3BU2A 3KLWA 1IXRA 2CW0C 3FHWA 4LF6L 2Q2IA 5DLQE 1IYVA 2V4DA 4LFAQ 2ZJPA 4LJZC 1R4QB 2NZOA 2L55A 3MXGA 2XGTA 4BS9A 4X64L 2KQ3A 2WAQG 3A54A 2R61A 4L5RC 3FPPA 4KHPL 2BA1A 1XPUA 4KD3A 3GTPB 1DONA 2UUCQ 2EY5A 4ULLA 3UDFA 2Q2TA 4NXML 2NVTB 4OO1I 4RHSA 4JI4L 3SR1A 4R4TA 2JA5H 4JBWA 1SFOB 3MAQA 1JB7A 3TSSA 4KY7A 3VR4A 2ZTEA 1F77A 5E3FA 2CWPA 4RCOA 1A3TA 4K5WA 3FKIH 4XYOA 4AYBG 4A3DG 2XIWA 1GUWA 4H13C 4A3MB 1GHJA 2H5XA 2CQAA 5G3LD 1DOMA 1WTWA 3HOYH 4KLKA 1B7YB 1V8QA 3RD4A 4KKSA 1VQ8A 2WAQE 5E4WC 3L9AX 4RWSC 3ZJYC 2EXDA 4XTCS 2E2IB 5BN4A 3PUWA 3R93A 5AJ3L 4P2CB 3HKZG 1U5KA 2VY3A 1XPRA 4B3RQ 2KCTA 4R4QA 1CKOA 1II3A 3P20A 3ULJA 4OGQC 3UE0A 2R93B 4DAVA 2VUMH 2WB1B 2K5QA 2F0FA 2HHHL 1QUQB 3HZXA 1F2LA 1QZGA 5C0XG 3GD7A 3M4YA 2Q8IB 3ERSX 4OL7A 3A5ZB 1STGA 2QCPX 2K14A 1Z6HA 3MFGA 3TZDA 4R4IA 5DAUA 5GAGC 2HQEA 1ML0D 2K1BA 1CKNA 1MSHA 1PMRA 4DAYB 4A3BH 3H94A 1SYEA 1Q8KA 1KDCA 1VDZA 3OIQA 4QQBX 4MZ9A 5JOBA 3T16A 2GVBA 3T4AC 5FOBB 3W1GA 2B2WC 4HAEA 4HJ5A 1PH7A 2F0TA 5IGDA 1EY5A 2O2LD 4LFCQ 2UU9L 2R3ZA 3HOZB 1QNUA 1U4PA 4UHVA 1ESRA 1KRSA 1HR0Q 3HOWH 4LF7Q 3FKIB 1NAPA 2BE5C 1WYDA 4JOIA 2K4KA 4YHHQ 1LTTD 2PI2E 4A3FG 4B3SQ 4IPCA 3OIPA 1SFOH 1SE2A 3T1HQ 3AFPA 5CMDA 1D1IA 3HOUB 3HOZG 2XNAC 4X3SA 4QY7A 4X3UA 4OWTB 3SHLA 4ZLTF 4JI3Q 3S1QB 1XNRQ 3T51B 3X3NA 2Z1CA 1PH1A 3K81C 1DZ1A 4WJWA 2F0LA 1Q3LA 4XYQA 3S2HH 3GTKH 2VW9A 1AE2A 4K14A 1PTOC 3QIAA 1JMCA 2TSSA 5JJLA 4TQUS 5COYA 4KKUA 4L63B 3EFXD 1QVGA 3I3CA 1GM5A 4JVZA 1RL2A 1PH5A 3BZDB 4OX9Q 4OO1G 1FD7D 2F0GA 1SAPA 4RCNA 4DV4Q 4K8IA 2VL6A 3STBC 1U4MA 1I4QA 4IPDA 3GTJH 1C48A 2VZAA 4JK1C 2QF7A 2IHEA 3VR5A 2EYHA 1Y1VH 4RAUC 1LTRD 4F87A 1Z7TA 3A7LA 2DNEA 1PFBA 5IP9H 5IWAL 3PO3G 1UE7A 3E0EA 1SJED 4DAPA 2NBFA 1HZ9A 3PIP3 1HNXQ 1SR3A 3CCMA 4LF8L 1KHIA 3ULPA 3MTSA 1D2BA 2PZTA 1HHVA 5M3MG 5IGGA 3HOUG 2A68C 4A3KH 5T1IA 4DV0L 1EWHA 4Q5VA 3G71A 1Q81C 4U673 1TWHH 1D5XC 1PA6A 3TQYA 4GNXA 1HJPA 4XIGS 3KYHC 1K73C 4NPSA 3GDEA 3GQBA 3CD6A 3EROA 2WB1E 3EIVA 4DR3L 4YCWA 2DY7A 3WDNA 1KIXA 1SNOA 3W5OA 4JI3L 3DUZA 4PMCA 1E7ZA 4R4OA 1EWIA 3CAMA 2PMZE 1NE3A 4K6LA 2KHSA 3NEMA 1B44D 1VQ5A 1EFID 4JI1L 1E24A 4DR6Q 1G291 1VQBA 3UDIA 4MNOA 2JXMB 3RR5A 3PO3B 4UP8A 2IWHA 4B08A 2HT1A 4Y7NH 1EQVA 5IT9E 2FFKB 2MO1A 4EGVA 2XTIA 1Q46A 1F9SA 2TMPA 5C0XH 2VQFL 4Q0FA 5D3IB 3BJUA 4UAIA 1GUNA 3PF5A 4MHEA 2A69D 2BCOA 3D4RA 3K5NA 5EPJA 1PRTD 2A5HA 4BBSH 1OXVA 4N8FA 5GROA 4DV6L 2HHHQ 3MEHA 2IJ0A 3KBXA 2NB0A 1Q1BA 1IW7C 1TS3A 2NN6I 4G4KA 4FF1A 1ILQA 1Y8NB 3C1EA 1X3EA 3CU7A 1XX8A 3GTMB 2DNCA 1XPOA 1YHQA 4KD4A 4RKBA 1SXTA 5CBAE 1X9NA 2ICEC 4IPGA 5CV5A 1GHKA 5IY0A 4TKOB 3BDOA 4X64Q 2SOBA 4ZYSA 1QG7A 5C4JH 1HFGA 4CDFC 4X3TA 1SE8A 1MJEA 4A3FH 4LF8Q 2JJQA 3HKSA 3A55A 3TP7A 3CRLC 1AN8A 3IRBA 1VQAA 3I70A 2F1MA 2NTSA 2N3SA 1FVIA 3BG3A 1SRUA 2JA8G 2AQ2B 2NVYB 3U50C 2PMZB 2CWAA 1LM0A 2OWOA 3G48A 2NVYH 1QUQA 1SMXA 1CHPD 2SNSA 1MD2D 1ILPA 1U9RA 5ELNA 4PZ7A 1I4PA 3M9BA 1EQQA 1I4GA 4GOPA 3DLLA 3CCEA 4A3JB 2PPBC 3HOYB 5ELDA 2ZM6Q 4DV1L 2ATWA 4LAAA 1AW7A 2JA7G 5FLMG 2GN5A 2MHVA 1EU3A 3NTIA 1EU4A 3CCRA 3J7A5 5FJ8G 4N9TA 1YJNA 3LWUA 2XWJB 4A75A 4G7ZC 2YU9H 2YTVA 1E2ZA 2Z8LA 3PCOB 4LUOA 1BCPB 1PYSB 3TEHB 3AB9A 1J5EL 3GTGB 4X65Q 3U9OA 2E2HH 5C3WA 4DR6L 2IY5B 1P8LA 1K9MC 2ZXOA 1JCKB 4DR4L 3S1NH 2QEJC 2YTXA 1IBMQ 1GUOA 1LACA 1S72A 2Y0SG 2UUCL 4CDDC 4A3KG 2FXQA 3PV0A 5BR8L 1WD1A 3PO2H 1YBYA 2LXJA 4A3GB 2AQ1B 1VQGA 4F7XA 3LX0A 5JVH3 2RDGA 5IE8A 5JPMC 3VYSA 1YI2A 3S15H 3R2IA 1R4PB 3ICEA 1X6OA 3AQQA 3D6WA 3IKJA 4O0AA 1D5MC 4DAMA 1XMOQ 5LMUQ 3PQIA 1PTOD 3ER0A 4JW0A 1K8MA 5HGTA 2B2VC 4A3CG 5EAYA 4JI5L 5C4XH 1B8AA 2O5IC 3M3YH 3HOVH 4G7HC 4K2KA 3RZOB 4HTHA 1XTCD 3GTOH 1B53A 1RCVD 2EY6A 4GN4B 1KABA 4DR3Q 3S17H 2M9VA 2RBMA 4A3GH 2JN4A 4K0KL 2EJGC 1D7QA 5IYDG 1N34Q 3H0GB 5CC4A 1QWYA 3SK4A 4A3KB 1XNRL 4YCVA 4JI1Q 2OTLA 1JT8A 1MKHA 1TS5A 3NBIA 3T1HL 1WFQA 3K5OA 3GTQB 3VR3A 3SE0A 3AU7A 4HJ9A 1I50H 1K0SA 2DGYA 3SDZA 5EBDA 1IL8A 4IOCA 5KGUA 2A68D 4B3ML 4NDXA 4A3BG 5IGFA 2DJFC 2PNHA 4GNXB 5HURA 1HTPA 1WCMG 2R7ZH 1M1KC 1QVFA 4LW1A 2WINB 4S3SA 3FP9A 4NB3A 4NXNL 1EEID 1HR0W 1WTVA 1A63A 4DR2Q 1D1KA 1CSPA 3OTOL 1I6HH 4DV3Q 1HNWQ 4HSVA 1YJWA 2YYZA 4EQNA 4FXKC 5IWAQ 1GVPA 1SE4A 3HOWG 3BDLA 1NBWA 1DM0B 1Y8PB 4R4CA 3EJIA 1YNXA 4POFA 2PI2A 3KJOA 1HUMA 4IUVA 1HNWL 2B39A 4LF4L 1BO0A 1EY4A 2UUBL 2R92H 3W2DA 4DK1A 2WB1G 4JI2Q 3QG1A 3H3VH 3H0GH 2CH4A 3PUZA 4TRDA 2QW7A 5M5WH 1QB5D 5IT9c 1YHBA 2X69A 2PQEA 5EKKA 5JVG3 1VMPA 1YZ6A 3D4DA 5C3XA 1STBA 5D3DA 2MGSA 5M5YB 3BZKA 3JC66 5CV8A 3I90A 3OW2A 1C8CA 4L5SA 3K59A 4A3IG 4FF3A 4ABNA 2A1AA 3W1BA 4H7BA 1D6EC 1K8GA 3LGJA 3LNNA 5IOCA 4DV7Q 4X6AH 1ASYA 1TWCB 4HIMA 5GAEC 1I4RA 1CHQD 3G7LA 1N36L 4A3BB 5IYBH 1JOOA 5IP9G 1XXGA 2E2DC 1SMYC 1DJRD 1LV9A 1KD1C 4AQYL 2EJMA 4NXNQ 1FJGQ 5GQOA 3VA7A 4A3LH 2E8GA 4RMFA 2NZHA 4V190 4APVA 5FK9C 2WP8J 1CI3M 1JE4A 4P74A 2JP1A 2NN6H 3FMCA 3ZYYX 1VQLA 2X6GA 4OX9L 2V1CC 3H09A 1VQKA 2MO0A 3QOJA 1L1OC 4GOPB 2Z6BA 4B3MQ 4M8AA 4JV5Q 5CBEE 1HZBA 1F2YA 5C44G 4DUZL 2A19A 4IJHA 1VMCA 3D3RA 1RF2D 5LMNW 3NWSA 2K6AA 5EPKA 3A74A 4OEMB 2PCFB 2EYOA 3VYUA 4DPGA 3UE1A 2NVQH 1TWAH 2JA5B 3Q6SA 3MC0B 3S17B 5JEAG 3K0YA 2JA6G 4KHPQ 4X62L 5A2QL 4JI5Q 1VQOA 2F0EA 3RZOH 3A56A 4LFBL 2H4OA 1VQFA 2XRSD 1N34L 2Q8RE 3A0JA 1CQVA 3JAMi 4C2MB 3C2PA 3CCLA 4LF4Q 3J7YW 2XRQD 3PSIA 4N8X1 4IZ8A 2JA5G 2L12A 1PTOH 2D5DA 2XVSA 4CKCA 4JI0L 4Z9CB 3DMUA 1L0WA 3I4OA 2O5JC 4FF2A 1WCMH 2BH2A 2O4XA 1UUPA 2MNAA 4HMIA 2UXCL 4B9XA 3A5UA 1TY0A 3SK6A 4OWWB 1T5EA 4UP7A 2EOTA 1UE6A 1UEBA 3M7GA 3TP6A 4DV3L 3L3OC 5KYLA 5IODA 4FVMA 3Q22A 4MTNA 4IN3A 3M4OB 2A6HC 2KJXA 2C35B 2I46A 1QNKA 3DM3A 1AZPA 4LUVA 4LFAL 3FRPB 2AWNA 1KC8C 4IFDI 2JSOA 3H15A 4OWXB 1BUVT 3BVZA 4H02A 4IFDG 2QA4A 2PO4A 4DKAC 1IBKQ 4RA8A 2JA8B 3PIOA 4LF6Q 2A69C 4QUFA 4GKKQ 4KY5A 2F0JA 3HOWB 1K28A 3ITPA 2J4XA 2ID0A 1MHWC 3IAYA 5FLXE 1EUJA 4XQNA 3PIO3 4CGYB 4YY3Q 3CCSA 2UXDL 3NP8A 2Z0SA 4XXEA 2KEEA 1RODA 3NTHA 4DV1Q 1G6ZA 5FLMH 4UY8C 4XQQA 1F2MA 1B50A 2NUCA 5FJ8H 4G7OC 5IYCG 5KNBA 1K83H 1WI5A 2QGQA 1CZWA 3HP3A 3SEBA 3TP8A 1RDPD 3S9WA 2OXPA 2NVQB 3S2HB 4PQXA 2EYFA 3NHHA 3I56A 2Z4IA 1BF4A 1YIJA 4QIWE 2F52A 4FXDA 2G9HD 3MXUA 5EGTA 2F3WA 2RCNA 4ZAIA 3MA2B 2A74C 3PUYA 1DGSA 3DM1A 1VQNA 1I6HB 3VA5A 4BWGB 3JAMc 5C0XI 4A3IB 1S5CD 3I2ZA 1HNZL 3Q23A 4J1MA 4LMQD 1IZ6A 2ALYB 1PYWD 3J81E 2JYOA 4R8NA 4K2LA 2NN6G 3KLSA 2UXBQ 1PZKD 3CMAA 1S5ED 4KI0A 1I94L 3B6YA 3HG9A 4BBSB 2YV5A 1IW7D 3I73A 4IOAA 5JJKA 1TU2B 1GJXA 4DU9A 1FR3A 5C4ZA 1X32A 2VQFQ 1A2UA 1PH4A 4NP5A 2HIXA 4A3CH 1PZJD 3EA6A 4C3HG 3SK8A 2D2CC 1WJJA 4KY6A 1KTKA 5JEAH 3CW2C 3CF5A 4ID6A 4GOPC 4MIUA 2B8FA 3CQZH 2FHTA 5T1GA 3IFDA 1H9RA 3NELA 3RLNA 2N88A 2F0UA 1HXYD 1LTID 2CH4W 2KOLA 2FMCA 4BBRH 3RNUA 1HQRD 1F9QA 1FL0A 3OMCA 1EYGA 3OYYA 3F2CA 4DV7L 4E6IA 1SEBD 4X62Q 4IFDJ 4TSSA 1G6PA 4KK7A 1FNWA 1PH6A 3S15B 3SVMA 3E3XA 1KLGD 1F9PA 1M4VA 2F0MA 1ONLA 1C9OA 3HGBA 2I0QA 5E4XA 3A8KE 3TS2A 4LF7L 1KAWA 1S4ZA 3FEWX 3L7ZC 4A93G 4PZ8A 1V1OA 3STBD 2KUMA 4KMUC 1Q82C 1PTOF 1AH9A 2EY1A 4HCEA 1A0IA 2EYLA 5C5MA 1IBLL 3EN2A 1STNA 3R8BA 4GLVB 4C56C 5K5PA 5H1SE 5LMNL 2B2YC 1XNQQ 2L4NA 3NQIA 2MUYA 1O7ZA 4C3JB 1M90C 1EY9A 2F4VL 3OMGA 5EKIA 1WTPA 2AUJD 1JJ2A 4GN5A 3K7AH 2E5LQ 4U68A 2B8GA 4PMBA 1ET6A 1ZYRC 2UXCQ 2K5WA 3TMEA 1IKMA 3OWFA 3F2BA 3VR2A 2F03A 4XT1B 1YNND 1DOLA 1AFPA 4UDUC 3BDCA 4MN3A 4YY3L 1LO5D 1LTAD 4DK6C 3WOEA 2ZTCA 1CUKA 1XJVA 1N33Q 1SYBA 3CCJA 4GKKL 1Z47A 1EEFD 2RF4A 4DV5Q 5DM63 1PHJA 4B3SL 1K8AC 1JR0D 1EIHA 4JPBW 3J7ZC 1JJCB 2MPMA 4HIDA 4K8JA 2Z4HA 2EJFC 5FO9B 2NZ1D 4FDBA 5G3LF 3CCQA 1H9MA 1LT6D 2AUKA 1UEAB 4ODGA 5C0XJ 1TWCH 4ZKCB 4DV5L 2RHQB 1GO3E 3MFYA 3S1MH 4Y52H 1EQRA 4IURA 1Y14B 4PV1C 3J80L 2B3GA 4LUZA 3ONAB 3K6OA 1Q12A 4ZCKA 4DR1L 1TKWB 5I4DA 4PNYA 3ND8A 1Y69U 3AYHB 2YU9B 2Q8TA 1HR0L 4BY7H 4BY1G 2JA7B 1PFNA 2E74C 3CHBD 5C6AA 2JK8A 3T1YQ 2B63H 1HA6A 1FGUA 4HIKA 1I50B 3IFTA 3HOXB 3QOLA 2F0VA 2PNRC 1I6VC 3H6MA 4HCSA 1CSQA 4ME5A 4PMWA 2L15A 4DV4L 3J7AV 3R2TA 3ERQA 3K0XA 4AIMA 1F9RA 2R92B 3J81c 4C3HH 3CMEA 3A8JE 4DR7Q 1WTHA 4EVOA 2VUMB 1Q90A 2F4IA 4KKTA 4FO2A 2F4VQ 4OHJA 4OXPA 1CKMA 4QCLA 1ENAA 1BXTA 1SYGA 2AQ3B 2JA7H 1IBLQ 1EL0A 1EY7A 5CV6A 4BXXG 4WFN3 1OXXK 3J81i 2CHBD 2BOSA 1G2TA 1X3GA 1VCIA 1PFSA 2N49A 2VB2X 3F2UA 1A8VA 2R93H 3KLSX 3OWEB 5JJZA 2HCCA 3BS1A 3BVMA 2F0SA 1D5ZC 2MFIA 3CCUA 3OPOA 1EWCA 3BYTB 1IBML 1QVCA 1TWAB 2PW7A 2KHJA 1YEZA 2RKSA 3RUZA 3N52A 1B9MA 4HEDA 3OSOA 1VQ6A 2QILA 2KCNA 1A3UA 2RA4A 1R9TB 1I4XA 2OCEA 1NNXA 1R9TH 2F3IA 3A7AB 4NMZA 1GUGA 2Q2UA 2OT2A 1AP0A 1HZAA 2E76C 2PZUA 5A2QE 3X3MA 3P75A 2R7FA 2WACA 2XN9C 2RCFA 3P1HA 3PMFA 4XT3B 4EQ5A 3HS0C 2BDNA 4HMJA 4GKJL 3M7NA 4CBVA 1U0LA 2I5LX 1RTOA 4WJ4A 1TIID 1BR9A 1PFMA 1HCZA 4HJ8A 2HCIA 1N32Q 1HQMC 1HPCA 1TQOA 3RZDB 1PRTC 1SNDA 3S24A 4J15A 3T56B 3K5MA 1QJOA 2OTJA 1IL2A 4IFDH 3EVQA 1EFWA 5M5XH 2F0NA 5IYDH 2PZWA 1E2WA 3HOXG 3E9HA 1CQFA 3DWAA 4X66L 3GTLB 3D6CA 1O80A 4DR4Q 5J22A 1WTRA 5C3EG 1EYCA 1MI2A 5C44B 1JORA 2B2TC 3DWQA 1KDAA 3I4NB 5C4HA 3AMUA 1ESFA 5ELOA 2CCZA 2EY2A 1VQCA 1S3OA 2A6EC 2H1EA 5EBCA 4DR5L 4JI6Q 1HH2P 1A2TA 2UXDQ 3CRKC 1SROA 1OXUA 3MXNA 1O7IA 2WKDA 1TS4A 2RDHA 4KJNA 1Q8IA 3GTMH 1VF5C 2B2VA 1E22A 1STEA 5E1FA 4BY7G 3DHQA 4C2MH 1JWUD 5FLXL 3JAME 2K28A 3T53B 4NW2A 1CA5A 2QEXA 1SDFA 5TSSA 1OTCA 5JEAJ 4KHVA 1YNNC 1TWGH 4BY7B 4A3EB 1T9HA 2KCMA 1H9JA 2EDGA 3H0GG 5I2YA 1WTXA 4JG2A 3S1QH 3S1NB 2CQOA 4DGZA 4WORA 2VQEL 1EZ6A 1IHZA 2D0OA 3CC2A 1I94Q 4DF7A 1J5EQ 1OXSC 1L2FA 3E6ZX 2PQAB 4P75A 2BDOA 4IUQA 4A3IH 1NCVA 2CKZB 1VQIA 1VQDA 5C3EB 4GKJQ 5J1ZA 3TZUA 3NENA 4A93B 2WKCA 4RH6A 5EKLA 2R93G 5CGKA 1G51A 3NTKA 2LSSA 1N32L 2HDLA 5J39A 1S40A 1PVOA 2F0DA 4CJ1B 2MQHA 1SNCA 2OQKA 3MXPA 3KF6A 1SNPA 1N9WA 1ASZA 2FMMA 2D62A 1PZID 2ZXRA 1I5FA 4IQZA 2LXKA 4JOIC 1TXYA 1LYLA 1TS2A 1E3PA 3NPPA 1GD7A 4YWMA 2KCCA 1G2SA 1B1ZA 1JE5A 3PO2G 4QUCA 3RLFA 1XWEA 3I7FA 3Q0AA 4ZKBB 5ELCA 2IX3A 4JV5L 1WCMB 1U4LA 3KJPA 4ZRZA 2XSCA 2B2UC 1A15A 1GKHA 2K03A 4C3HB 4I7ZC 3CP0A 5CORA 5C4XG 4X65L 1UE1A 5FO8B 4CHTB 3GTKB 4Y7NB 1C4QA 3G6EA 4DR7L 3KLRA 2JE6I 2JA6H 1BVSA 4JYAL 3HOXH 5JAVA 5ELBA 2E2HB 3U4VA 5M5XB 5IGCA 2HIVA 3KOJA 3KF8B 4LF5Q 3M85A 5KYIA 4AQYQ 5IT9L 2L9HA 4K5VA 3FVQA 4FYDA 1FJGL 4JI0Q 3RN5A 1FYCA 1G91A 2DUDA 4DK3C 1LTBD 4DUYQ 4YWLA 3TBIB 4YIJA 5LL6S 4X66Q 1BCPF 1G8ZD 2MJ8A 3UDGA 4FP5D 2UUAL 3S1RB 2I07B 1PLFA 4ALPA 3G4SA 4GNXC 1ZEQX 5IIFA 2R7ZG 1IYUA 4GLAC 1WTOA 5EJWA 1UE5A 4JI8Q 1FNUA 1DD2A 1RJTA 5LHY1 1LUZA 1JJGA 4LF9Q 4POGA 3ND9A 1K3BC 3NXWA 3PUVA 4A4IA 2ENBA 1UWVA 4BY1H 4LFBQ 1EYDA 1HNXL 2YTYA 4IUNA 1YNJD 3CC4A 2B63G 1B3QA 3QO2A 4ZUIA 4BY1B 4K5XA 1NJIC 2B2YA 4DUZQ 4B9WA 3CC7A 1WTQA 3RZDH 2BA0A 4QGUA 4A3MH 4DV0Q 1E1OA 2J7ZA 4BBRB 2R92G 2G9DA 4C3IB 2R6GA 3VYRA 2X6LA 3C1FA 4NKLA 1KDBA 4C3IH 2Z9HA 1YHAA 4IUPA 4KTAA 4JBJA 4QMGA 5AJ3Q 2Y0SE 3DXJC 3EBEA 3MZ5A 3URYA 1EOVA 1B2TA 2E75C 1W6JA 1V9PA 3J80i 2ES2A 1PH3A 4A3JG 1STYA 3UDXA 4DR2L 3HKZB 2NVXH 4LF5L 4HIOA 3MXNB 5IGEA 3L0OA 2AMCB 1B3AA 2IX0A 4YCUA 2SEBD 3U58A 1W6KA 4JI7Q
chains in the Genus database with same CATH topology
1X3QA 2ZXPA 2IL8A 4RHRA 2M2LA 2RSNA 4RKLA 2N55A 3CKIB 3K7AB 3MHBA 3O13A 5C4XB 2WV6D 1DCZA 2CW0D 3A8IE 1JOKA 2A6ED 2IPKD 3W3AA 1QOHA 4HR7B 1FNVA 3GV3A 2F0HA 2C9OA 1UAPA 5NUCA 5KNDA 2NWGA 3J80E 4DN4M 1HRJA 5KIXA 1PXUA 2B2WA 2EYJA 1H9KA 5I9OA 1LT3D 4KN4C 2IT1A 2NVXB 4ILWA 4R9WA 4F88A 2NYZD 5CR3A 1MBYA 1E2VA 1TVXA 1KAAA 4H0LC 4BA1I 4ZUJA 3IL8A 1I3QB 1JWSD 5DM73 1GOZA 2F0PA 3H3VC 1CT1D 3EQLC 5KEEA 1LT5D 1TWGB 4L8JA 1NR4A 5C5LA 1ZXTA 2SNMA 1OXTA 2RQXA 1NUCA 2DN8A 3KUPA 3D4WA 1JB3A 1E0BA 1V1PB 3I91A 5DNFA 1SBBB 1JWMD 2EYPA 2LS01 2OF1A 3NE5B 1J9OA 5ELFA 1B9NA 2K04A 3I4LA 4ZQ3A 4I65A 2JEAI 3QWNA 2L0CA 4CJ0B 2A73B 2EE1A 1EY6A 2D9UA 5C4JB 1H9SA 3SXHA 4J8QA 3JAML 1SMYD 1K8OA 3M3YB 1T5XD 1ET9A 3WOFA 2LMCB 1PRTB 5M3MB 1GUSA 4DNRB 3C46A 2EZVA 1BBXC 4C3IG 3Q24A 3KF8A 4LK1C 2L5TA 1JQYD 5EPLA 5JPNC 1J8IA 1L0XB 3OHXC 4RGNA 1K83B 1S5BD 5BN5A 2K7VA 1DYQA 4ZK9B 2K05A 2L11A 1JOQA 3VYTA 2KVMA 3J7AF 4KV6A 2JEBI 4OO1H 2B2TA 5LL6X 2IX1A 4G57A 2QDBA 3K58A 3E5SA 1GXDC 1HA5A 5DEHA 2DY8A 1DXMA 2RVLA 1YNJC 2KECA 2F0IA 2ZT9C 5FO7B 1SYFA 4DXGA 1O78A 1SE3A 1TT2A 3TN2A 4DXFA 3FDTA 2R7ZB 4QB4A 4AYBB 4A3DB 3E0JA 1RTNA 5I6YA 3VR6A 2AWOA 1S5DD 1NR2A 5CV7A 1F2ZA 2CVRA 1BCPD 1BQQT 1CK1A 3U9SA 3UI2A 1ZKOA 2WIIB 1OO9B 1TR5A 3K5LA 2K33A 3GTJB 3S16B 2LY7A 1WD0A 4N9PA 1STHA 5M5WB 1CM9A 1TWFB 4DFAA 3MVVA 3DEOA 3V2TA 2Y0SB 3RMHA 2LFNA 3MWYW 2L1BA 2XWBB 2M00A 1X3PA 1CA6A 1EIGA 2OEOA 4HN7A 2VNUD 1L0YB 4EQPA 3S14B 3HOVB 3C3LA 3PO2B 3PUXA 1SJHD 2VB3X 1ZYRD 5M3FB 2K5DA 4K6DA 3T13A 1QCBD 3BYYB 1EQTA 1KNAA 1RKNA 1ENCA 3GV6A 1KNEA 3NBHA 2F0WA 5K36H 3K57A 4H44C 1SNMA 1AZQA 3N6RA 4FNFA 1I4HA 2F0QA 3TDQA 4CKBA 3S1MB 1A6XA 5CV4A 4FXGC 1FGBD 2WAQB 3S2DB 4J6HA 4CJ2C 1SSOA 2B63B 1PDQA 2F0KA 2QKIC 3J81L 3QJYA 3OOCA 4R8IA 1V1PA 4RFBA 1XYIA 3D31A 2PW5A 3NQTA 1LTSD 1BNZA 3BVGA 1UNSA 3V96A 1SYCA 1EY0A 5I9PA 4XQJA 1QILA 4A3FB 4XDXA 2LKVA 2MP1A 1VF7A 3TP5A 1H9SB 1ICWA 4IALA 1HUNA 3FPUB 2C5CA 5F2DA 1STAA 2FINB 2HDMA 3LWEA 1Y8OB 2EXZA 4IUTA 5FKAC 1GUTA 2ICIA 4KHZA 3OW7A 4M1UB 1SNQA 5I2XA 1LT4D 2A6HD 5IGBA 4C1NI 1MGSA 2RSOA 4O1NA 3DWPA 3KBGA 4DA2A 1NSNS 2F3VA 1HFNA 1DOKA 1V43A 1Q1EA 3P7JA 1LLRD 5A35A 5ISRA 4DK0A 4CKEA 4RGOS 1CFMA 4RGMA 5I6WA 1BDOA 3HRZC 4KJOA 5M9OA 1EZ8A 1EOTA 3GP7A 3GO5A 5D14A 4C1NK 1S5FD 3I8ZA 3SK5A 4WRDA 5D65A 2JA6B 3GTOB 3R3OA 5EQ0A 2IW3A 4QIWB 1TWHB 4L6TB 2PYKA 1JC7A 3I72A 4OIKA 1B4OA 5KRUA 4O42A 1M8AA 3V05A 5BN3A 4DAYA 1SYDA 1IKLA 2J0TD 3HEJA 2EPBA 4QF4A 4IUUA 1O7YA 2K32A 5K36G 1CZGA 2KEDA 2RDFA 3G6JB 4GZYC 4BA2I 2BE5D 1WVLA 4OIJA 3NK9A 1AEXA 1KLUD 3DEPA 1O7LA 4FF4A 1Y1VB 1TY2A 4EQOA 3QB3A 1RHPA 2VXWA 1BOSA 2HUGA 1Y1WB 1QE6A 4V0BA 2E2JB 5CV9A 2GA4B 2NTTA 3H91A 3CQZB 1LTGD 1BCPC 1RD9D 3NSWA 3NWTA 1MSGA 4HSPA 2B2UA 1ENFA 2EVBA 2KA7A 2FJ2A 1LABA 2EYMA 5AFWA 3D8GA 4RGTA 3NUCA 1EYAA 4DNTB 1CTMA 1EY8A 4X3KA 3I4MB 4F8MA 1PTOB 5KNCA 1PRTF 1U4RA 2K01A 2SDFA 1HTLD 1A3VA 4KN7C 3KK7A 4C3JG 2F0OA 5ELEA 5CYUA 1JICA 2CW0C 1IYVA 2V4DA 4LJZC 1R4QB 2L55A 3MXGA 4BS9A 2KQ3A 3A54A 2R61A 3FPPA 2BA1A 4KD3A 3GTPB 1DONA 2EY5A 4ULLA 2NVTB 4OO1I 4RHSA 3SR1A 4JBWA 1SFOB 3MAQA 3TSSA 4KY7A 3VR4A 1F77A 5E3FA 4RCOA 1A3TA 4K5WA 4XYOA 2XIWA 1GUWA 4H13C 4A3MB 1GHJA 2CQAA 5G3LD 1DOMA 1WTWA 1V8QA 3RD4A 4KKSA 5E4WC 3L9AX 4RWSC 4XTCS 2E2IB 5BN4A 3PUWA 3R93A 4P2CB 1II3A 3P20A 4OGQC 2R93B 4DAVA 2WB1B 2K5QA 2F0FA 3HZXA 1F2LA 5C0XG 3GD7A 3M4YA 2Q8IB 4OL7A 1STGA 2QCPX 1Z6HA 3MFGA 3TZDA 5DAUA 2HQEA 1ML0D 2K1BA 1MSHA 1PMRA 3H94A 1SYEA 1KDCA 1VDZA 3OIQA 5JOBA 3T16A 3T4AC 5FOBB 2B2WC 4HAEA 2F0TA 5IGDA 1EY5A 2O2LD 2R3ZA 3HOZB 1QNUA 1U4PA 1ESRA 3FKIB 1NAPA 2BE5C 1LTTD 3OIPA 1SE2A 5CMDA 1D1IA 3HOUB 2XNAC 4X3SA 4X3UA 3SHLA 4ZLTF 3S1QB 3T51B 3X3NA 2Z1CA 1DZ1A 4WJWA 2F0LA 1Q3LA 4XYQA 4K14A 1PTOC 3QIAA 2TSSA 4TQUS 5COYA 4KKUA 4L63B 3EFXD 3I3CA 3BZDB 4OO1G 1FD7D 2F0GA 1SAPA 4RCNA 4K8IA 1U4MA 1I4QA 1C48A 4JK1C 2QF7A 3VR5A 2EYHA 4RAUC 1LTRD 4F87A 1Z7TA 3A7LA 2DNEA 1PFBA 1SJED 4DAPA 2NBFA 3PIP3 3MTSA 1D2BA 2PZTA 1HHVA 5IGGA 2A68C 5T1IA 1EWHA 4Q5VA 4U673 1D5XC 4XIGS 3GQBA 3EROA 2DY7A 3WDNA 1SNOA 3DUZA 4PMCA 4K6LA 2KHSA 1B44D 1EFID 1G291 2JXMB 3PO3B 2IWHA 4B08A 1EQVA 5IT9E 2FFKB 4EGVA 1F9SA 2TMPA 5C0XH 4Q0FA 5D3IB 4UAIA 1GUNA 4MHEA 2A69D 2BCOA 3D4RA 3K5NA 5EPJA 1PRTD 2A5HA 1OXVA 3MEHA 2IJ0A 3KBXA 2NB0A 1Q1BA 1IW7C 1TS3A 4FF1A 2NN6I 4G4KA 1ILQA 1Y8NB 3C1EA 3CU7A 1XX8A 3GTMB 2DNCA 4KD4A 4RKBA 1SXTA 5CBAE 2ICEC 1GHKA 5CV5A 4TKOB 3BDOA 2SOBA 4ZYSA 1QG7A 1HFGA 4X3TA 3A55A 3TP7A 3CRLC 1AN8A 3I70A 2F1MA 2NTSA 3BG3A 2AQ2B 2NVYB 2PMZB 1CHPD 2SNSA 1MD2D 1ILPA 1U9RA 1I4PA 1I4GA 4A3JB 2PPBC 3HOYB 5ELDA 4LAAA 1AW7A 2MHVA 1EU3A 3NTIA 1EU4A 4N9TA 3LWUA 2XWJB 4G7ZC 1E2ZA 2Z8LA 1BCPB 3AB9A 3GTGB 3U9OA 5C3WA 2ZXOA 1JCKB 2QEJC 1GUOA 1LACA 3PV0A 1WD1A 4A3GB 2AQ1B 4F7XA 3LX0A 5JVH3 2RDGA 5JPMC 3VYSA 3R2IA 1R4PB 3D6WA 3IKJA 1D5MC 1PTOD 1K8MA 5HGTA 2B2VC 2O5IC 4G7HC 4K2KA 3RZOB 4HTHA 1XTCD 1B53A 1RCVD 2EY6A 1KABA 2M9VA 2RBMA 2EJGC 3H0GB 5CC4A 1QWYA 3SK4A 4A3KB 1TS5A 3NBIA 3K5OA 3GTQB 3VR3A 3SE0A 3AU7A 3SDZA 5EBDA 1IL8A 5KGUA 2A68D 4NDXA 5IGFA 5HURA 1HTPA 2WINB 4S3SA 1EEID 1WTVA 1D1KA 4HSVA 2YYZA 4EQNA 4FXKC 1SE4A 3BDLA 1DM0B 1Y8PB 3EJIA 1HUMA 4IUVA 2B39A 1BO0A 1EY4A 3W2DA 4DK1A 3QG1A 3PUZA 4TRDA 1QB5D 2X69A 2PQEA 5EKKA 5JVG3 1VMPA 3D4DA 5C3XA 1STBA 5D3DA 2MGSA 5M5YB 5CV8A 3I90A 1C8CA 4FF3A 3K59A 4ABNA 4H7BA 1D6EC 3LNNA 5IOCA 1TWCB 1I4RA 1CHQD 3G7LA 4A3BB 1JOOA 1XXGA 2E2DC 1SMYC 1DJRD 1LV9A 2EJMA 3VA7A 4V190 5FK9C 2WP8J 1CI3M 1JE4A 2JP1A 2NN6H 3FMCA 3ZYYX 2X6GA 3H09A 3QOJA 4M8AA 5CBEE 1F2YA 1VMCA 3D3RA 1RF2D 3NWSA 2K6AA 5EPKA 2PCFB 2EYOA 3VYUA 2JA5B 3Q6SA 3MC0B 3S17B 5JEAG 3K0YA 5A2QL 2F0EA 3A56A 2H4OA 2XRSD 2Q8RE 1CQVA 4C2MB 3C2PA 3J7YW 2XRQD 4IZ8A 2L12A 1PTOH 2D5DA 2XVSA 4CKCA 4Z9CB 3DMUA 2O5JC 4FF2A 2O4XA 1UUPA 4HMIA 4B9XA 1TY0A 3SK6A 1T5EA 2EOTA 3TP6A 3M7GA 3L3OC 5KYLA 5IODA 4FVMA 3Q22A 4IN3A 3M4OB 2A6HC 2KJXA 2I46A 1QNKA 1AZPA 3FRPB 2AWNA 4IFDI 2JSOA 1BUVT 3BVZA 4IFDG 2PO4A 4RA8A 2JA8B 2A69C 4QUFA 4KY5A 2F0JA 3HOWB 3ITPA 2J4XA 2ID0A 3IAYA 5FLXE 4XQNA 3PIO3 4CGYB 3NP8A 4XXEA 2KEEA 1RODA 3NTHA 1G6ZA 4XQQA 1F2MA 1B50A 2NUCA 4G7OC 5KNBA 1CZWA 3HP3A 3SEBA 3TP8A 1RDPD 3S9WA 2OXPA 2NVQB 3S2HB 4PQXA 2EYFA 3NHHA 2Z4IA 1BF4A 4FXDA 2G9HD 3MXUA 5EGTA 2F3WA 4ZAIA 3MA2B 2A74C 3PUYA 3DM1A 1I6HB 3VA5A 4BWGB 5C0XI 4A3IB 1S5CD 3Q23A 4J1MA 4LMQD 1PYWD 3J81E 2JYOA 4R8NA 4K2LA 2NN6G 3KLSA 1PZKD 1S5ED 4KI0A 3HG9A 4BBSB 1IW7D 3I73A 1GJXA 1TU2B 4DU9A 1FR3A 5C4ZA 1X32A 1A2UA 4NP5A 1PZJD 3EA6A 4C3HG 3SK8A 2D2CC 4KY6A 1KTKA 5JEAH 4ID6A 4MIUA 2B8FA 2FHTA 5T1GA 3IFDA 1H9RA 2N88A 2F0UA 1HXYD 1LTID 2KOLA 2FMCA 1HQRD 1F9QA 3OMCA 4E6IA 1SEBD 4IFDJ 4TSSA 4KK7A 1FNWA 3S15B 3SVMA 1KLGD 1F9PA 1M4VA 2F0MA 1ONLA 3HGBA 5E4XA 3A8KE 1S4ZA 3FEWX 3L7ZC 1V1OA 2KUMA 4KMUC 1PTOF 2EY1A 4HCEA 2EYLA 5C5MA 1STNA 3R8BA 4C56C 5K5PA 2B2YC 2L4NA 3NQIA 2MUYA 1O7ZA 4C3JB 1EY9A 3OMGA 5EKIA 1WTPA 2AUJD 4U68A 2B8GA 4PMBA 1ET6A 1ZYRC 2K5WA 3TMEA 1IKMA 3OWFA 3VR2A 2F03A 4XT1B 1YNND 1DOLA 1AFPA 4UDUC 3BDCA 4MN3A 1LO5D 1LTAD 3WOEA 1SYBA 1Z47A 1EEFD 5DM63 1JR0D 1EIHA 2MPMA 4K8JA 2Z4HA 2EJFC 5FO9B 2NZ1D 5G3LF 1H9MA 1LT6D 2AUKA 1UEAB 4ODGA 5C0XJ 4ZKCB 3MFYA 4IURA 4PV1C 3J80L 3ONAB 3K6OA 1Q12A 1TKWB 5I4DA 4PNYA 3ND8A 1Y69U 2YU9B 2Q8TA 2JA7B 1PFNA 2E74C 3CHBD 5C6AA 1HA6A 1I50B 3IFTA 3HOXB 3QOLA 2F0VA 2PNRC 1I6VC 3H6MA 4HCSA 4ME5A 4PMWA 3J7AV 3R2TA 3ERQA 1F9RA 2R92B 3A8JE 4EVOA 2VUMB 1Q90A 2F4IA 4KKTA 4FO2A 4OHJA 4QCLA 1ENAA 1BXTA 1SYGA 2AQ3B 1EL0A 1EY7A 5CV6A 4WFN3 1OXXK 2CHBD 2BOSA 1G2TA 1VCIA 2VB2X 3F2UA 3KLSX 3OWEB 5JJZA 2HCCA 3BS1A 3BVMA 2F0SA 1D5ZC 3OPOA 1EWCA 3BYTB 1TWAB 2PW7A 2RKSA 3RUZA 3N52A 1B9MA 4HEDA 3OSOA 2QILA 2KCNA 1A3UA 2RA4A 1R9TB 1I4XA 3A7AB 4NMZA 1GUGA 2OT2A 1AP0A 2E76C 2PZUA 5A2QE 3X3MA 3P75A 2WACA 2XN9C 3P1HA 3PMFA 4XT3B 3HS0C 2BDNA 4HMJA 3M7NA 4CBVA 1RTOA 1TIID 1BR9A 1PFMA 1HCZA 2HCIA 1HQMC 1HPCA 1TQOA 3RZDB 1PRTC 1SNDA 3T56B 3K5MA 1QJOA 4IFDH 3EVQA 2F0NA 2PZWA 1E2WA 1CQFA 3DWAA 3GTLB 3D6CA 1O80A 5J22A 1WTRA 1EYCA 1MI2A 5C44B 1JORA 2B2TC 3DWQA 1KDAA 3I4NB 5C4HA 3AMUA 1ESFA 2EY2A 2A6EC 2H1EA 5EBCA 1A2TA 3CRKC 1OXUA 3MXNA 2WKDA 1TS4A 2RDHA 4KJNA 1Q8IA 1VF5C 2B2VA 1STEA 5E1FA 3DHQA 1JWUD 5FLXL 3JAME 2K28A 3T53B 4NW2A 1CA5A 1SDFA 5TSSA 5JEAJ 4KHVA 1YNNC 4BY7B 4A3EB 1H9JA 2EDGA 5I2YA 1WTXA 3S1NB 4DGZA 4WORA 1EZ6A 1IHZA 4DF7A 1OXSC 3E6ZX 2BDOA 4IUQA 1NCVA 5C3EB 5J1ZA 3TZUA 4A93B 2WKCA 4RH6A 5EKLA 5CGKA 3NTKA 2HDLA 5J39A 2F0DA 4CJ1B 1SNCA 3MXPA 1SNPA 2FMMA 2D62A 1PZID 2ZXRA 4IQZA 1TS2A 3NPPA 2KCCA 1G2SA 1B1ZA 4QUCA 3RLFA 1XWEA 3Q0AA 4ZKBB 5ELCA 2IX3A 1WCMB 1U4LA 4ZRZA 2XSCA 2B2UC 1A15A 2K03A 4C3HB 4I7ZC 5CORA 5FO8B 4CHTB 3GTKB 4Y7NB 1C4QA 3KLRA 2JE6I 5JAVA 5ELBA 2E2HB 5M5XB 5IGCA 3M85A 5KYIA 5IT9L 2L9HA 4K5VA 3FVQA 4FYDA 1FYCA 1G91A 1LTBD 3TBIB 4YIJA 5LL6S 1BCPF 1G8ZD 2MJ8A 4FP5D 3S1RB 2I07B 1PLFA 1ZEQX 5IIFA 1IYUA 1WTOA 5EJWA 1DD2A 1FNUA 1RJTA 5LHY1 3ND9A 3NXWA 3PUVA 2ENBA 1EYDA 4IUNA 1YNJD 3QO2A 4ZUIA 4BY1B 4K5XA 2B2YA 4B9WA 1WTQA 2BA0A 2J7ZA 4BBRB 4C3IB 2G9DA 2R6GA 3VYRA 2X6LA 3C1FA 4NKLA 1KDBA 4QMGA 4IUPA 4KTAA 3DXJC 3MZ5A 3URYA 1B2TA 2E75C 1W6JA 1STYA 3HKZB 5IGEA 1B3AA 2IX0A 2SEBD 1W6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY6 A;  2F0T A;  1EY5 A;  4EQN A;  5IGD A;  5E1F A;  3TP5 A;  1EY9 A;  2KHS A;  3BDL A;  3OMG A;  5HUR A;  5EGT A;  2RDF A;  3DHQ A;  2F3W A;  4KD3 A;  3U9O A;  4IAL A;  3SXH A;  4N9P A;  2EY5 A;  5C3W A;  2F0E A;  3EJI A;  1STH A;  3VA5 A;  4RKL A;  5F2D A;  1STA A;  3NK9 A;  1AEX A;  3MHB A;  1EY4 A;  4PMB A;  5JAV A;  3SR1 A;  2F0S A;  1EQV A;  2EXZ A;  3TME A;  4J1M A;  5IGC A;  4DFA A;  3MVV A;  3V2T A;  3OWF A;  1JOK A;  2PW7 A;  4R8N A;  4K2L A;  4KHV A;  2RKS A;  4IZ8 A;  4KY7 A;  3RUZ A;  2M00 A;  4TRD A;  3OSO A;  5E3F A;  5KYI A;  1A3T A;  4K5V A;  4K5W A;  3SHL A;  4EQO A;  2PQE A;  1A3U A;  3LX0 A;  4F7X A;  2OEO A;  3QB3 A;  1SNQ A;  5EKK A;  3DMU A;  3BDC A;  2F0H A;  5NUC A;  3D4D A;  4NMZ A;  4DGZ A;  4EQP A;  1STB A;  4DU9 A;  5C3X A;  5C4Z A;  4WOR A;  5IGB A;  5CV9 A;  2O4X A;  2PZU A;  1EZ6 A;  1A2U A;  1IHZ A;  3MEH A;  4YIJ A;  1SYB A;  4HMI A;  5CV8 A;  5KIX A;  1NSN S;  2F0L A;  3P75 A;  2F3V A;  4NP5 A;  4B9X A;  2WAC A;  3SK6 A;  3P1H A;  3PMF A;  4DF7 A;  4K14 A;  1JOQ A;  4H7B A;  5IIF A;  3C1E A;  4KV6 A;  3SK8 A;  5HGT A;  3TP6 A;  5IOC A;  4K8J A;  2EYJ A;  4K6D A;  5ISR A;  4HMJ A;  5I9O A;  4KY6 A;  3T13 A;  5IOD A;  4KD4 A;  4ODG A;  4RKB A;  5I6W A;  5KYL A;  4ID6 A;  5J1Z A;  4KJO A;  3S9W A;  5M9O A;  4G57 A;  4K2K A;  1EZ8 A;  5CV5 A;  4HTH A;  2QDB A;  4MIU A;  3NXW A;  2F0G A;  5EKL A;  1RKN A;  1ENC A;  2ENB A;  3E5S A;  2EY6 A;  1TQO A;  2SOB A;  4K8I A;  5CGK A;  1KAB A;  5DEH A;  1EYD A;  2RBM A;  5CR3 A;  2F0W A;  4PNY A;  1SND A;  2EYM A;  2F0D A;  5J39 A;  4IUN A;  1JOO A;  2F0U A;  1KAA A;  1SNC A;  2EYH A;  3TP7 A;  4ZUI A;  1SNM A;  3MXP A;  2F0I A;  1SNP A;  4ZUJ A;  4K5X A;  3D8G A;  3SK5 A;  5CC4 A;  1SYF A;  2F0Q A;  3EVQ A;  4B9W A;  3OMC A;  3SK4 A;  5C6A A;  3NUC A;  1TT2 A;  1II3 A;  2F0N A;  4WRD A;  2F0P A;  4E6I A;  2PZW A;  5CV4 A;  1EYA A;  5KEE A;  3QOL A;  3R3O A;  2F0V A;  4QB4 A;  1EY8 A;  4KY5 A;  2F0F A;  3H6M A;  3C1F A;  3D6C A;  1KDB A;  2F0J A;  3HZX A;  4NKL A;  4F8M A;  5J22 A;  2PYK A;  2PZT A;  5C5L A;  2SNS A;  4QMG A;  1EYC A;  3ITP A;  4J6H A;  4KTA A;  4ME5 A;  5IGG A;  2SNM A;  3ERQ A;  1JOR A;  1U9R A;  2F0M A;  5KGU A;  2F0K A;  1A3V A;  1NUC A;  5KRU A;  4OL7 A;  1STG A;  3MZ5 A;  3NP8 A;  3QOJ A;  1KDA A;  4NDX A;  5I6Y A;  3D4W A;  5C4H A;  5IGF A;  5DAU A;  1F2M A;  2PW5 A;  3NQT A;  2F0O A;  2HQE A;  2EY2 A;  1F2Y A;  4LAA A;  5CV7 A;  1F2Z A;  2EYP A;  2NUC A;  4EVO A;  4S3S A;  2OF1 A;  1SYE A;  1KDC A;  1STY A;  1SYD A;  2EY1 A;  1A2T A;  1SYC A;  3ERO A;  3TP8 A;  1ENA A;  4N9T A;  1SYG A;  2EYL A;  4ZQ3 A;  2OXP A;  3HEJ A;  1STN A;  4I65 A;  5JOB A;  5C5M A;  3T16 A;  1EY0 A;  2EYF A;  3NHH A;  5I9P A;  1TR5 A;  4KJN A;  1EY7 A;  5IGE A;  5K5P A;  2EYO A;  1SNO A;  4QF4 A;  5CV6 A;  4PMC A;  2KQ3 A;  2LKV A; 
#chains in the Genus database with same CATH topology
 3AEV A;  1X54 A;  1W2B A;  1X3Q A;  2ZXP A;  1Y1V G;  2IL8 A;  4RHR A;  2G5D A;  2M2L A;  3M4O H;  2RSN A;  1N8R C;  4RKL A;  2N55 A;  3CKI B;  3K7A B;  3MHB A;  3O13 A;  5C4X B;  2UUA Q;  2WV6 D;  3TRZ A;  1DCZ A;  2CW0 D;  3HFZ B;  2IHF A;  3A8I E;  4JI8 L;  1JOK A;  2A6E D;  1PV4 A;  5M3M H;  2IPK D;  3W3A A;  1QOH A;  4A3L G;  4AYB E;  4HR7 B;  2E2J H;  1FNV A;  4UPA A;  3GV3 A;  2UU9 Q;  3I4M G;  3U4Z A;  2F0H A;  1VQH A;  2C9O A;  4QL5 A;  1UAP A;  2DJG C;  5NUC A;  5KND A;  3CXC A;  2NWG A;  3J80 E;  1C0A A;  4DN4 M;  1HRJ A;  4OON A;  5KIX A;  2JA9 A;  1PH2 A;  1PXU A;  2B2W A;  2PQA A;  2EYJ A;  1H9K A;  5I9O A;  1XMQ L;  1LT3 D;  4KN4 C;  3S14 H;  2IT1 A;  2NVX B;  4ILW A;  4R9W A;  4F88 A;  3HKZ E;  2NYZ D;  1Q7Y C;  5CR3 A;  1MBY A;  1E2V A;  1PH9 A;  1TVX A;  1KAA A;  2JQO A;  4H0L C;  4BA1 I;  3KF6 B;  4ZUJ A;  3IL8 A;  1I3Q B;  3K7U C;  4TVA B;  1JWS D;  5DM7 3;  1A62 A;  1GOZ A;  2F0P A;  3H3V C;  1CT1 D;  2P5Z X;  4BBR G;  3EQL C;  5KEE A;  1NY4 A;  3CPW A;  1LT5 D;  4CDE C;  1TWG B;  4L8J A;  1NR4 A;  5C5L A;  1KRT A;  1ZXT A;  2SNM A;  1OXT A;  2RQX A;  1NUC A;  2DN8 A;  3KUP A;  3M4Q A;  3D4W A;  1JB3 A;  1E0B A;  1V1P B;  3I91 A;  5DNF A;  1SBB B;  1JWM D;  2ZM6 L;  2EYP A;  2LS0 1;  2OF1 A;  3NE5 B;  1J9O A;  5ELF A;  1B9N A;  1E1T A;  3MEF A;  4A93 H;  2K04 A;  3I4L A;  4DUY L;  4ZQ3 A;  4I65 A;  3K80 C;  2JEA I;  1YVC A;  3QWN A;  2L0C A;  4CJ0 B;  4JCV E;  5L37 A;  4DV6 Q;  2A73 B;  2EE1 A;  1EY6 A;  2D0P A;  2D9U A;  3S1R H;  5C4J B;  1H9S A;  4DR5 Q;  4JI6 L;  3SXH A;  4J8Q A;  5BR8 Q;  3JAM L;  1SMY D;  1K8O A;  3M3Y B;  1T5X D;  1X55 A;  1ET9 A;  3WOF A;  4A3M G;  1SLJ A;  2LMC B;  1AE3 A;  2JA8 H;  1PRT B;  3F1Z A;  5M3M B;  1Y1W H;  1GUS A;  4DNR B;  3C46 A;  3HOZ H;  2EZV A;  1BBX C;  2K75 A;  4C3I G;  3Q24 A;  3KF8 A;  4LK1 C;  2L5T A;  4IPH A;  1JQY D;  1L1O A;  5EPL A;  5JPN C;  1VQP A;  1J8I A;  1L0X B;  2EQS A;  5HY6 A;  2Z6K C;  3K8A A;  4P71 A;  3GTQ H;  3OHX C;  4P72 A;  4RGN A;  1K83 B;  1S5B D;  2ZJQ A;  4A3J H;  5BN5 A;  2K5H A;  3H3V I;  2K7V A;  1DYQ A;  1PYB A;  4ZK9 B;  2K05 A;  2L11 A;  1JOQ A;  3VYT A;  2I5H A;  2KVM A;  3J7A F;  4KV6 A;  2KEN A;  5IYC H;  2JEB I;  4OO1 H;  1KXL A;  2B2T A;  4B3T Q;  5LL6 X;  1NMG A;  4RG1 A;  2IX1 A;  4G57 A;  1HNZ Q;  2QDB A;  3K58 A;  3E5S A;  1GXD C;  1HA5 A;  4OEL B;  5DEH A;  2DY8 A;  1LTL A;  1V1Q A;  1DXM A;  2RVL A;  4CDC C;  1WOC A;  1YNJ C;  2KEC A;  3ULL A;  2F0I A;  2ZT9 C;  5FO7 B;  1SYF A;  4DXG A;  4LNQ A;  2WFW A;  1O78 A;  1SE3 A;  1TT2 A;  3TN2 A;  4A3E G;  4DXF A;  3FDT A;  2R7Z B;  4QB4 A;  3I4M H;  1BBW A;  1ICF B;  4AYB B;  4A3D B;  3E0J A;  1RTN A;  5I6Y A;  3I55 A;  3VR6 A;  2AWO A;  1S5D D;  3L2P A;  1NR2 A;  5CV7 A;  1F2Z A;  4JC0 A;  2CVR A;  1BCP D;  1BQQ T;  1CK1 A;  3U9S A;  3UI2 A;  1ZKO A;  3KDF B;  2WII B;  3KFU A;  4UP9 A;  2Z6K A;  3PGZ A;  1OO9 B;  1TR5 A;  1EIY B;  3K5L A;  1N33 L;  1VQ7 A;  5M5Y H;  4L5Q A;  2K33 A;  3GTJ B;  3S16 B;  2K5N A;  2LY7 A;  2KHI A;  2GVA A;  4BXX H;  5FLX c;  1WD0 A;  1VQ9 A;  4N9P A;  1STH A;  5M5W B;  2AHO B;  1CM9 A;  1TWF B;  4DFA A;  1I3Q H;  3MVV A;  3DEO A;  3V2T A;  2RHS B;  2B29 A;  2Y0S B;  3RMH A;  1RIP A;  2LFN A;  3MWY W;  2L1B A;  2XWB B;  1X3F A;  2M00 A;  1X3P A;  3VDY A;  4PG3 A;  4O2D A;  1Z9F A;  1EIG A;  1CA6 A;  2OEO A;  4HN7 A;  2VNU D;  4IJL A;  4A76 A;  1L0Y B;  1NTG A;  4I7A A;  2OQ0 A;  4EQP A;  3S14 B;  3HOV B;  4A3D H;  3C3L A;  3PO2 B;  4R1J A;  1IYJ B;  3PUX A;  4QJF A;  1SJH D;  2VB3 X;  3SGI A;  1N36 Q;  2N78 A;  3T1Y L;  1ZYR D;  5M3F B;  2K5D A;  4WJ3 M;  4K6D A;  4LF9 L;  3T13 A;  3M4P A;  1QCB D;  1C7Y A;  4JBK A;  1SN8 A;  3BYY B;  1EQT A;  1KNA A;  2Q2H A;  3GTG H;  4JI7 L;  1RKN A;  1ENC A;  1XTD A;  3GV6 A;  3I4N G;  1KNE A;  3F8T A;  3NBH A;  2F0W A;  5K36 H;  1Y1W G;  3K57 A;  1MIU A;  1VQE A;  2BH8 A;  3QR8 A;  4H44 C;  1SNM A;  1AZQ A;  3N6R A;  4FNF A;  2CFM A;  1I4H A;  2F0Q A;  3TDQ A;  4CKB A;  3S1M B;  3J81 j;  1A6X A;  3S2D H;  5CV4 A;  4GN3 B;  4FXG C;  5IP7 G;  1FGB D;  2WAQ B;  3S2D B;  4J6H A;  4CJ2 C;  2VUM G;  1SSO A;  4JI2 L;  2B63 B;  2ZTD A;  1P16 A;  1PDQ A;  3PIP A;  2F0K A;  1VQM A;  2QKI C;  3J81 L;  3QJY A;  3OOC A;  4YWK A;  1KQS A;  5GAH C;  4R8I A;  1V1P A;  4RFB A;  1XYI A;  3D31 A;  1VQJ A;  2PW5 A;  3NQT A;  3CPF A;  1J6Q A;  4DV2 Q;  3CCV A;  1LTS D;  2ASB A;  3D0F A;  1BNZ A;  3BVG A;  1UNS A;  3V96 A;  5JJI A;  1SYC A;  4DR1 Q;  3S16 H;  1EY0 A;  5I9P A;  4XQJ A;  3WWV A;  1QIL A;  2K52 A;  4A3F B;  1XMQ Q;  4XDX A;  5M3F H;  2LKV A;  5IYB G;  2MP1 A;  1VF7 A;  3TP5 A;  1H9S B;  3Q8D A;  1ICW A;  3AFQ A;  4IAL A;  1HUN A;  3FPU B;  2C5C A;  5F2D A;  1STA A;  4A3E H;  2FIN B;  1XNQ L;  2HDM A;  3LWE A;  1Y8O B;  2EXZ A;  4YHH L;  4IUT A;  1K3R A;  4DNI A;  5FKA C;  1GUT A;  1MJC A;  2ICI A;  3RLO A;  4KHZ A;  3OW7 A;  1L1O B;  4M1U B;  1SNQ A;  4HJ7 A;  4IO9 A;  5HGQ A;  5I2X A;  1LT4 D;  1HZC A;  3J80 c;  2A6H D;  5IGB A;  4C1N I;  1MGS A;  2RSO A;  4O1N A;  2K50 A;  3DWP A;  3KBG A;  1VS0 A;  4DA2 A;  2UUB Q;  1NSN S;  2F3V A;  1HFN A;  1DOK A;  1V43 A;  1Q1E A;  3P7J A;  4C3J H;  1YJ9 A;  1LLR D;  3HOV G;  5A35 A;  5ISR A;  4DK0 A;  4CKE A;  4RGO S;  1CFM A;  4RGM A;  5I6W A;  1BDO A;  2HD3 A;  3HRZ C;  4KJO A;  5M9O A;  4LFC L;  1EZ8 A;  1EOT A;  5J3B A;  1XMO L;  4A3G G;  1D8L A;  1B70 B;  3TS0 A;  3GP7 A;  5LMU L;  3GO5 A;  4DV2 L;  5D14 A;  4C1N K;  4NXM Q;  2KBN A;  1S5F D;  3I8Z A;  3SK5 A;  4WRD A;  5D65 A;  2JA6 B;  3GTO B;  3R3O A;  5EQ0 A;  2IW3 A;  4QIW B;  3PO3 H;  1TWH B;  4L6T B;  2A8V A;  4EX5 A;  1YIT A;  2PYK A;  1JC7 A;  3I72 A;  4OIK A;  1B4O A;  3PF4 A;  5KRU A;  2VQE Q;  3FKI G;  4O42 A;  2ZJR A;  3HOU H;  4B3R L;  4PZ6 A;  1M8A A;  4HJA A;  4K0K Q;  3V05 A;  5BN3 A;  1CKN B;  4L5T A;  4DAY A;  3KDF A;  2N8N A;  1SYD A;  1IKL A;  3HOY G;  2J0T D;  1Q86 C;  3HEJ A;  2EPB A;  3TRE A;  2E5L L;  4QF4 A;  3I4N H;  4IUU A;  1O7Y A;  2K32 A;  5K36 G;  1X56 A;  1X65 A;  1CZG A;  2KED A;  2RDF A;  3G6J B;  4GZY C;  2R7D A;  1W3S A;  3F2D A;  5E7N A;  4BA2 I;  2BE5 D;  5LMN Q;  3GTL H;  2I5M X;  3OTO Q;  1K0R A;  1WVL A;  4OIJ A;  4JBM A;  3NK9 A;  1AEX A;  3GTP H;  1KLU D;  2QDL A;  4JYA Q;  3DEP A;  1O7L A;  4FF4 A;  3E9I A;  5IP7 H;  1BKB A;  1NMF A;  4AH6 A;  4GS3 A;  1QZH A;  1Y1V B;  1TY2 A;  4EQO A;  3QB3 A;  1TWF H;  1RHP A;  2VXW A;  1BOS A;  2HUG A;  1Y1W B;  2K5V A;  1QE6 A;  4V0B A;  5C3E H;  5CV9 A;  2HQL A;  2E2J B;  2GA4 B;  1EIF A;  4P73 A;  4GLX A;  4BBS G;  4ME3 A;  2NTT A;  4JI4 Q;  3H91 A;  4MTK A;  3CQZ B;  1LTG D;  4B3T L;  5M3F G;  1BCP C;  1KL9 A;  1IBK L;  1RD9 D;  3NWT A;  3NSW A;  2NVT H;  1MSG A;  4HSP A;  1PH8 A;  2B2U A;  1ENF A;  2EVB A;  3BZC A;  2KA7 A;  1H95 A;  2E2I H;  2EIF A;  3NBH B;  2FJ2 A;  1LAB A;  2EYM A;  2AKW B;  5AFW A;  3D8G A;  4LWC A;  4RGT A;  3NUC A;  2VS1 A;  1EYA A;  4DNT B;  1CTM A;  1EY8 A;  4X3K A;  3I4M B;  4F8M A;  5GAD C;  1PTO B;  5KNC A;  1PRT F;  1U4R A;  2K01 A;  2SDF A;  1HTL D;  1A3V A;  4KN7 C;  5C44 H;  1VQ4 A;  1BBU A;  3KK7 A;  4C3J G;  2UXB L;  3RN2 A;  2F0O A;  5ELE A;  5CYU A;  1JIC A;  3BU2 A;  3KLW A;  1IXR A;  2CW0 C;  3FHW A;  4LF6 L;  2Q2I A;  5DLQ E;  1IYV A;  2V4D A;  4LFA Q;  2ZJP A;  4LJZ C;  1R4Q B;  2NZO A;  2L55 A;  3MXG A;  2XGT A;  4BS9 A;  4X64 L;  2KQ3 A;  2WAQ G;  3A54 A;  2R61 A;  4L5R C;  3FPP A;  4KHP L;  2BA1 A;  1XPU A;  4KD3 A;  3GTP B;  1DON A;  2UUC Q;  2EY5 A;  4ULL A;  3UDF A;  2Q2T A;  4NXM L;  2NVT B;  4OO1 I;  4RHS A;  4JI4 L;  3SR1 A;  4R4T A;  2JA5 H;  4JBW A;  1SFO B;  3MAQ A;  1JB7 A;  3TSS A;  4KY7 A;  3VR4 A;  2ZTE A;  1F77 A;  5E3F A;  2CWP A;  4RCO A;  1A3T A;  4K5W A;  3FKI H;  4XYO A;  4AYB G;  4A3D G;  2XIW A;  1GUW A;  4H13 C;  4A3M B;  1GHJ A;  2H5X A;  2CQA A;  5G3L D;  1DOM A;  1WTW A;  3HOY H;  4KLK A;  1B7Y B;  1V8Q A;  3RD4 A;  4KKS A;  1VQ8 A;  2WAQ E;  5E4W C;  3L9A X;  4RWS C;  3ZJY C;  2EXD A;  4XTC S;  2E2I B;  5BN4 A;  3PUW A;  3R93 A;  5AJ3 L;  4P2C B;  3HKZ G;  1U5K A;  2VY3 A;  1XPR A;  4B3R Q;  2KCT A;  4R4Q A;  1CKO A;  1II3 A;  3P20 A;  3ULJ A;  4OGQ C;  3UE0 A;  2R93 B;  4DAV A;  2VUM H;  2WB1 B;  2K5Q A;  2F0F A;  2HHH L;  1QUQ B;  3HZX A;  1F2L A;  1QZG A;  5C0X G;  3GD7 A;  3M4Y A;  2Q8I B;  3ERS X;  4OL7 A;  3A5Z B;  1STG A;  2QCP X;  2K14 A;  1Z6H A;  3MFG A;  3TZD A;  4R4I A;  5DAU A;  5GAG C;  2HQE A;  1ML0 D;  2K1B A;  1CKN A;  1MSH A;  1PMR A;  4DAY B;  4A3B H;  3H94 A;  1SYE A;  1Q8K A;  1KDC A;  1VDZ A;  3OIQ A;  4QQB X;  4MZ9 A;  5JOB A;  3T16 A;  2GVB A;  3T4A C;  5FOB B;  3W1G A;  2B2W C;  4HAE A;  4HJ5 A;  1PH7 A;  2F0T A;  5IGD A;  1EY5 A;  2O2L D;  4LFC Q;  2UU9 L;  2R3Z A;  3HOZ B;  1QNU A;  1U4P A;  4UHV A;  1ESR A;  1KRS A;  1HR0 Q;  3HOW H;  4LF7 Q;  3FKI B;  1NAP A;  2BE5 C;  1WYD A;  4JOI A;  2K4K A;  4YHH Q;  1LTT D;  2PI2 E;  4A3F G;  4B3S Q;  4IPC A;  3OIP A;  1SFO H;  1SE2 A;  3T1H Q;  3AFP A;  5CMD A;  1D1I A;  3HOU B;  3HOZ G;  2XNA C;  4X3S A;  4QY7 A;  4X3U A;  4OWT B;  3SHL A;  4ZLT F;  4JI3 Q;  3S1Q B;  1XNR Q;  3T51 B;  3X3N A;  2Z1C A;  1PH1 A;  3K81 C;  1DZ1 A;  4WJW A;  2F0L A;  1Q3L A;  4XYQ A;  3S2H H;  3GTK H;  2VW9 A;  1AE2 A;  4K14 A;  1PTO C;  3QIA A;  1JMC A;  2TSS A;  5JJL A;  4TQU S;  5COY A;  4KKU A;  4L63 B;  3EFX D;  1QVG A;  3I3C A;  1GM5 A;  4JVZ A;  1RL2 A;  1PH5 A;  3BZD B;  4OX9 Q;  4OO1 G;  1FD7 D;  2F0G A;  1SAP A;  4RCN A;  4DV4 Q;  4K8I A;  2VL6 A;  3STB C;  1U4M A;  1I4Q A;  4IPD A;  3GTJ H;  1C48 A;  2VZA A;  4JK1 C;  2QF7 A;  2IHE A;  3VR5 A;  2EYH A;  1Y1V H;  4RAU C;  1LTR D;  4F87 A;  1Z7T A;  3A7L A;  2DNE A;  1PFB A;  5IP9 H;  5IWA L;  3PO3 G;  1UE7 A;  3E0E A;  1SJE D;  4DAP A;  2NBF A;  1HZ9 A;  3PIP 3;  1HNX Q;  1SR3 A;  3CCM A;  4LF8 L;  1KHI A;  3ULP A;  3MTS A;  1D2B A;  2PZT A;  1HHV A;  5M3M G;  5IGG A;  3HOU G;  2A68 C;  4A3K H;  5T1I A;  4DV0 L;  1EWH A;  4Q5V A;  3G71 A;  1Q81 C;  4U67 3;  1TWH H;  1D5X C;  1PA6 A;  3TQY A;  4GNX A;  1HJP A;  4XIG S;  3KYH C;  1K73 C;  4NPS A;  3GDE A;  3GQB A;  3CD6 A;  3ERO A;  2WB1 E;  3EIV A;  4DR3 L;  4YCW A;  2DY7 A;  3WDN A;  1KIX A;  1SNO A;  3W5O A;  4JI3 L;  3DUZ A;  4PMC A;  1E7Z A;  4R4O A;  1EWI A;  3CAM A;  2PMZ E;  1NE3 A;  4K6L A;  2KHS A;  3NEM A;  1B44 D;  1VQ5 A;  1EFI D;  4JI1 L;  1E24 A;  4DR6 Q;  1G29 1;  1VQB A;  3UDI A;  4MNO A;  2JXM B;  3RR5 A;  3PO3 B;  4UP8 A;  2IWH A;  4B08 A;  2HT1 A;  4Y7N H;  1EQV A;  5IT9 E;  2FFK B;  2MO1 A;  4EGV A;  2XTI A;  1Q46 A;  1F9S A;  2TMP A;  5C0X H;  2VQF L;  4Q0F A;  5D3I B;  3BJU A;  4UAI A;  1GUN A;  3PF5 A;  4MHE A;  2A69 D;  2BCO A;  3D4R A;  3K5N A;  5EPJ A;  1PRT D;  2A5H A;  4BBS H;  1OXV A;  4N8F A;  5GRO A;  4DV6 L;  2HHH Q;  3MEH A;  2IJ0 A;  3KBX A;  2NB0 A;  1Q1B A;  1IW7 C;  1TS3 A;  2NN6 I;  4G4K A;  4FF1 A;  1ILQ A;  1Y8N B;  3C1E A;  1X3E A;  3CU7 A;  1XX8 A;  3GTM B;  2DNC A;  1XPO A;  1YHQ A;  4KD4 A;  4RKB A;  1SXT A;  5CBA E;  1X9N A;  2ICE C;  4IPG A;  5CV5 A;  1GHK A;  5IY0 A;  4TKO B;  3BDO A;  4X64 Q;  2SOB A;  4ZYS A;  1QG7 A;  5C4J H;  1HFG A;  4CDF C;  4X3T A;  1SE8 A;  1MJE A;  4A3F H;  4LF8 Q;  2JJQ A;  3HKS A;  3A55 A;  3TP7 A;  3CRL C;  1AN8 A;  3IRB A;  1VQA A;  3I70 A;  2F1M A;  2NTS A;  2N3S A;  1FVI A;  3BG3 A;  1SRU A;  2JA8 G;  2AQ2 B;  2NVY B;  3U50 C;  2PMZ B;  2CWA A;  1LM0 A;  2OWO A;  3G48 A;  2NVY H;  1QUQ A;  1SMX A;  1CHP D;  2SNS A;  1MD2 D;  1ILP A;  1U9R A;  5ELN A;  4PZ7 A;  1I4P A;  3M9B A;  1EQQ A;  1I4G A;  4GOP A;  3DLL A;  3CCE A;  4A3J B;  2PPB C;  3HOY B;  5ELD A;  2ZM6 Q;  4DV1 L;  2ATW A;  4LAA A;  1AW7 A;  2JA7 G;  5FLM G;  2GN5 A;  2MHV A;  1EU3 A;  3NTI A;  1EU4 A;  3CCR A;  3J7A 5;  5FJ8 G;  4N9T A;  1YJN A;  3LWU A;  2XWJ B;  4A75 A;  4G7Z C;  2YU9 H;  2YTV A;  1E2Z A;  2Z8L A;  3PCO B;  4LUO A;  1BCP B;  1PYS B;  3TEH B;  3AB9 A;  1J5E L;  3GTG B;  4X65 Q;  3U9O A;  2E2H H;  5C3W A;  4DR6 L;  2IY5 B;  1P8L A;  1K9M C;  2ZXO A;  1JCK B;  4DR4 L;  3S1N H;  2QEJ C;  2YTX A;  1IBM Q;  1GUO A;  1LAC A;  1S72 A;  2Y0S G;  2UUC L;  4CDD C;  4A3K G;  2FXQ A;  3PV0 A;  5BR8 L;  1WD1 A;  3PO2 H;  1YBY A;  2LXJ A;  4A3G B;  2AQ1 B;  1VQG A;  4F7X A;  3LX0 A;  5JVH 3;  2RDG A;  5IE8 A;  5JPM C;  3VYS A;  1YI2 A;  3S15 H;  3R2I A;  1R4P B;  3ICE A;  1X6O A;  3AQQ A;  3D6W A;  3IKJ A;  4O0A A;  1D5M C;  4DAM A;  1XMO Q;  5LMU Q;  3PQI A;  1PTO D;  3ER0 A;  4JW0 A;  1K8M A;  5HGT A;  2B2V C;  4A3C G;  5EAY A;  4JI5 L;  5C4X H;  1B8A A;  2O5I C;  3M3Y H;  3HOV H;  4G7H C;  4K2K A;  3RZO B;  4HTH A;  1XTC D;  3GTO H;  1B53 A;  1RCV D;  2EY6 A;  4GN4 B;  1KAB A;  4DR3 Q;  3S17 H;  2M9V A;  2RBM A;  4A3G H;  2JN4 A;  4K0K L;  2EJG C;  1D7Q A;  5IYD G;  1N34 Q;  3H0G B;  5CC4 A;  1QWY A;  3SK4 A;  4A3K B;  1XNR L;  4YCV A;  4JI1 Q;  2OTL A;  1JT8 A;  1MKH A;  1TS5 A;  3NBI A;  3T1H L;  1WFQ A;  3K5O A;  3GTQ B;  3VR3 A;  3SE0 A;  3AU7 A;  4HJ9 A;  1I50 H;  1K0S A;  2DGY A;  3SDZ A;  5EBD A;  1IL8 A;  4IOC A;  5KGU A;  2A68 D;  4B3M L;  4NDX A;  4A3B G;  5IGF A;  2DJF C;  2PNH A;  4GNX B;  5HUR A;  1HTP A;  1WCM G;  2R7Z H;  1M1K C;  1QVF A;  4LW1 A;  2WIN B;  4S3S A;  3FP9 A;  4NB3 A;  4NXN L;  1EEI D;  1HR0 W;  1WTV A;  1A63 A;  4DR2 Q;  1D1K A;  1CSP A;  3OTO L;  1I6H H;  4DV3 Q;  1HNW Q;  4HSV A;  1YJW A;  2YYZ A;  4EQN A;  4FXK C;  5IWA Q;  1GVP A;  1SE4 A;  3HOW G;  3BDL A;  1NBW A;  1DM0 B;  1Y8P B;  4R4C A;  3EJI A;  1YNX A;  4POF A;  2PI2 A;  3KJO A;  1HUM A;  4IUV A;  1HNW L;  2B39 A;  4LF4 L;  1BO0 A;  1EY4 A;  2UUB L;  2R92 H;  3W2D A;  4DK1 A;  2WB1 G;  4JI2 Q;  3QG1 A;  3H3V H;  3H0G H;  2CH4 A;  3PUZ A;  4TRD A;  2QW7 A;  5M5W H;  1QB5 D;  5IT9 c;  1YHB A;  2X69 A;  2PQE A;  5EKK A;  5JVG 3;  1VMP A;  1YZ6 A;  3D4D A;  5C3X A;  1STB A;  5D3D A;  2MGS A;  5M5Y B;  3BZK A;  3JC6 6;  5CV8 A;  3I90 A;  3OW2 A;  1C8C A;  4L5S A;  3K59 A;  4A3I G;  4FF3 A;  4ABN A;  2A1A A;  3W1B A;  4H7B A;  1D6E C;  1K8G A;  3LGJ A;  3LNN A;  5IOC A;  4DV7 Q;  4X6A H;  1ASY A;  1TWC B;  4HIM A;  5GAE C;  1I4R A;  1CHQ D;  3G7L A;  1N36 L;  4A3B B;  5IYB H;  1JOO A;  5IP9 G;  1XXG A;  2E2D C;  1SMY C;  1DJR D;  1LV9 A;  1KD1 C;  4AQY L;  2EJM A;  4NXN Q;  1FJG Q;  5GQO A;  3VA7 A;  4A3L H;  2E8G A;  4RMF A;  2NZH A;  4V19 0;  4APV A;  5FK9 C;  2WP8 J;  1CI3 M;  1JE4 A;  4P74 A;  2JP1 A;  2NN6 H;  3FMC A;  3ZYY X;  1VQL A;  2X6G A;  4OX9 L;  2V1C C;  3H09 A;  1VQK A;  2MO0 A;  3QOJ A;  1L1O C;  4GOP B;  2Z6B A;  4B3M Q;  4M8A A;  4JV5 Q;  5CBE E;  1HZB A;  1F2Y A;  5C44 G;  4DUZ L;  2A19 A;  4IJH A;  1VMC A;  3D3R A;  1RF2 D;  5LMN W;  3NWS A;  2K6A A;  5EPK A;  3A74 A;  4OEM B;  2PCF B;  2EYO A;  3VYU A;  4DPG A;  3UE1 A;  2NVQ H;  1TWA H;  2JA5 B;  3Q6S A;  3MC0 B;  3S17 B;  5JEA G;  3K0Y A;  2JA6 G;  4KHP Q;  4X62 L;  5A2Q L;  4JI5 Q;  1VQO A;  2F0E A;  3RZO H;  3A56 A;  4LFB L;  2H4O A;  1VQF A;  2XRS D;  1N34 L;  2Q8R E;  3A0J A;  1CQV A;  3JAM i;  4C2M B;  3C2P A;  3CCL A;  4LF4 Q;  3J7Y W;  2XRQ D;  3PSI A;  4N8X 1;  4IZ8 A;  2JA5 G;  2L12 A;  1PTO H;  2D5D A;  2XVS A;  4CKC A;  4JI0 L;  4Z9C B;  3DMU A;  1L0W A;  3I4O A;  2O5J C;  4FF2 A;  1WCM H;  2BH2 A;  2O4X A;  1UUP A;  2MNA A;  4HMI A;  2UXC L;  4B9X A;  3A5U A;  1TY0 A;  3SK6 A;  4OWW B;  1T5E A;  4UP7 A;  2EOT A;  1UE6 A;  1UEB A;  3M7G A;  3TP6 A;  4DV3 L;  3L3O C;  5KYL A;  5IOD A;  4FVM A;  3Q22 A;  4MTN A;  4IN3 A;  3M4O B;  2A6H C;  2KJX A;  2C35 B;  2I46 A;  1QNK A;  3DM3 A;  1AZP A;  4LUV A;  4LFA L;  3FRP B;  2AWN A;  1KC8 C;  4IFD I;  2JSO A;  3H15 A;  4OWX B;  1BUV T;  3BVZ A;  4H02 A;  4IFD G;  2QA4 A;  2PO4 A;  4DKA C;  1IBK Q;  4RA8 A;  2JA8 B;  3PIO A;  4LF6 Q;  2A69 C;  4QUF A;  4GKK Q;  4KY5 A;  2F0J A;  3HOW B;  1K28 A;  3ITP A;  2J4X A;  2ID0 A;  1MHW C;  3IAY A;  5FLX E;  1EUJ A;  4XQN A;  3PIO 3;  4CGY B;  4YY3 Q;  3CCS A;  2UXD L;  3NP8 A;  2Z0S A;  4XXE A;  2KEE A;  1ROD A;  3NTH A;  4DV1 Q;  1G6Z A;  5FLM H;  4UY8 C;  4XQQ A;  1F2M A;  1B50 A;  2NUC A;  5FJ8 H;  4G7O C;  5IYC G;  5KNB A;  1K83 H;  1WI5 A;  2QGQ A;  1CZW A;  3HP3 A;  3SEB A;  3TP8 A;  1RDP D;  3S9W A;  2OXP A;  2NVQ B;  3S2H B;  4PQX A;  2EYF A;  3NHH A;  3I56 A;  2Z4I A;  1BF4 A;  1YIJ A;  4QIW E;  2F52 A;  4FXD A;  2G9H D;  3MXU A;  5EGT A;  2F3W A;  2RCN A;  4ZAI A;  3MA2 B;  2A74 C;  3PUY A;  1DGS A;  3DM1 A;  1VQN A;  1I6H B;  3VA5 A;  4BWG B;  3JAM c;  5C0X I;  4A3I B;  1S5C D;  3I2Z A;  1HNZ L;  3Q23 A;  4J1M A;  4LMQ D;  1IZ6 A;  2ALY B;  1PYW D;  3J81 E;  2JYO A;  4R8N A;  4K2L A;  2NN6 G;  3KLS A;  2UXB Q;  1PZK D;  3CMA A;  1S5E D;  4KI0 A;  1I94 L;  3B6Y A;  3HG9 A;  4BBS B;  2YV5 A;  1IW7 D;  3I73 A;  4IOA A;  5JJK A;  1TU2 B;  1GJX A;  4DU9 A;  1FR3 A;  5C4Z A;  1X32 A;  2VQF Q;  1A2U A;  1PH4 A;  4NP5 A;  2HIX A;  4A3C H;  1PZJ D;  3EA6 A;  4C3H G;  3SK8 A;  2D2C C;  1WJJ A;  4KY6 A;  1KTK A;  5JEA H;  3CW2 C;  3CF5 A;  4ID6 A;  4GOP C;  4MIU A;  2B8F A;  3CQZ H;  2FHT A;  5T1G A;  3IFD A;  1H9R A;  3NEL A;  3RLN A;  2N88 A;  2F0U A;  1HXY D;  1LTI D;  2CH4 W;  2KOL A;  2FMC A;  4BBR H;  3RNU A;  1HQR D;  1F9Q A;  1FL0 A;  3OMC A;  1EYG A;  3OYY A;  3F2C A;  4DV7 L;  4E6I A;  1SEB D;  4X62 Q;  4IFD J;  4TSS A;  1G6P A;  4KK7 A;  1FNW A;  1PH6 A;  3S15 B;  3SVM A;  3E3X A;  1KLG D;  1F9P A;  1M4V A;  2F0M A;  1ONL A;  1C9O A;  3HGB A;  2I0Q A;  5E4X A;  3A8K E;  3TS2 A;  4LF7 L;  1KAW A;  1S4Z A;  3FEW X;  3L7Z C;  4A93 G;  4PZ8 A;  1V1O A;  3STB D;  2KUM A;  4KMU C;  1Q82 C;  1PTO F;  1AH9 A;  2EY1 A;  4HCE A;  1A0I A;  2EYL A;  5C5M A;  1IBL L;  3EN2 A;  1STN A;  3R8B A;  4GLV B;  4C56 C;  5K5P A;  5H1S E;  5LMN L;  2B2Y C;  1XNQ Q;  2L4N A;  3NQI A;  2MUY A;  1O7Z A;  4C3J B;  1M90 C;  1EY9 A;  2F4V L;  3OMG A;  5EKI A;  1WTP A;  2AUJ D;  1JJ2 A;  4GN5 A;  3K7A H;  2E5L Q;  4U68 A;  2B8G A;  4PMB A;  1ET6 A;  1ZYR C;  2UXC Q;  2K5W A;  3TME A;  1IKM A;  3OWF A;  3F2B A;  3VR2 A;  2F03 A;  4XT1 B;  1YNN D;  1DOL A;  1AFP A;  4UDU C;  3BDC A;  4MN3 A;  4YY3 L;  1LO5 D;  1LTA D;  4DK6 C;  3WOE A;  2ZTC A;  1CUK A;  1XJV A;  1N33 Q;  1SYB A;  3CCJ A;  4GKK L;  1Z47 A;  1EEF D;  2RF4 A;  4DV5 Q;  5DM6 3;  1PHJ A;  4B3S L;  1K8A C;  1JR0 D;  1EIH A;  4JPB W;  3J7Z C;  1JJC B;  2MPM A;  4HID A;  4K8J A;  2Z4H A;  2EJF C;  5FO9 B;  2NZ1 D;  4FDB A;  5G3L F;  3CCQ A;  1H9M A;  1LT6 D;  2AUK A;  1UEA B;  4ODG A;  5C0X J;  1TWC H;  4ZKC B;  4DV5 L;  2RHQ B;  1GO3 E;  3MFY A;  3S1M H;  4Y52 H;  1EQR A;  4IUR A;  1Y14 B;  4PV1 C;  3J80 L;  2B3G A;  4LUZ A;  3ONA B;  3K6O A;  1Q12 A;  4ZCK A;  4DR1 L;  1TKW B;  5I4D A;  4PNY A;  3ND8 A;  1Y69 U;  3AYH B;  2YU9 B;  2Q8T A;  1HR0 L;  4BY7 H;  4BY1 G;  2JA7 B;  1PFN A;  2E74 C;  3CHB D;  5C6A A;  2JK8 A;  3T1Y Q;  2B63 H;  1HA6 A;  1FGU A;  4HIK A;  1I50 B;  3IFT A;  3HOX B;  3QOL A;  2F0V A;  2PNR C;  1I6V C;  3H6M A;  4HCS A;  1CSQ A;  4ME5 A;  4PMW A;  2L15 A;  4DV4 L;  3J7A V;  3R2T A;  3ERQ A;  3K0X A;  4AIM A;  1F9R A;  2R92 B;  3J81 c;  4C3H H;  3CME A;  3A8J E;  4DR7 Q;  1WTH A;  4EVO A;  2VUM B;  1Q90 A;  2F4I A;  4KKT A;  4FO2 A;  2F4V Q;  4OHJ A;  4OXP A;  1CKM A;  4QCL A;  1ENA A;  1BXT A;  1SYG A;  2AQ3 B;  2JA7 H;  1IBL Q;  1EL0 A;  1EY7 A;  5CV6 A;  4BXX G;  4WFN 3;  1OXX K;  3J81 i;  2CHB D;  2BOS A;  1G2T A;  1X3G A;  1VCI A;  1PFS A;  2N49 A;  2VB2 X;  3F2U A;  1A8V A;  2R93 H;  3KLS X;  3OWE B;  5JJZ A;  2HCC A;  3BS1 A;  3BVM A;  2F0S A;  1D5Z C;  2MFI A;  3CCU A;  3OPO A;  1EWC A;  3BYT B;  1IBM L;  1QVC A;  1TWA B;  2PW7 A;  2KHJ A;  1YEZ A;  2RKS A;  3RUZ A;  3N52 A;  1B9M A;  4HED A;  3OSO A;  1VQ6 A;  2QIL A;  2KCN A;  1A3U A;  2RA4 A;  1R9T B;  1I4X A;  2OCE A;  1NNX A;  1R9T H;  2F3I A;  3A7A B;  4NMZ A;  1GUG A;  2Q2U A;  2OT2 A;  1AP0 A;  1HZA A;  2E76 C;  2PZU A;  5A2Q E;  3X3M A;  3P75 A;  2R7F A;  2WAC A;  2XN9 C;  2RCF A;  3P1H A;  3PMF A;  4XT3 B;  4EQ5 A;  3HS0 C;  2BDN A;  4HMJ A;  4GKJ L;  3M7N A;  4CBV A;  1U0L A;  2I5L X;  1RTO A;  4WJ4 A;  1TII D;  1BR9 A;  1PFM A;  1HCZ A;  4HJ8 A;  2HCI A;  1N32 Q;  1HQM C;  1HPC A;  1TQO A;  3RZD B;  1PRT C;  1SND A;  3S24 A;  4J15 A;  3T56 B;  3K5M A;  1QJO A;  2OTJ A;  1IL2 A;  4IFD H;  3EVQ A;  1EFW A;  5M5X H;  2F0N A;  5IYD H;  2PZW A;  1E2W A;  3HOX G;  3E9H A;  1CQF A;  3DWA A;  4X66 L;  3GTL B;  3D6C A;  1O80 A;  4DR4 Q;  5J22 A;  1WTR A;  5C3E G;  1EYC A;  1MI2 A;  5C44 B;  1JOR A;  2B2T C;  3DWQ A;  1KDA A;  3I4N B;  5C4H A;  3AMU A;  1ESF A;  5ELO A;  2CCZ A;  2EY2 A;  1VQC A;  1S3O A;  2A6E C;  2H1E A;  5EBC A;  4DR5 L;  4JI6 Q;  1HH2 P;  1A2T A;  2UXD Q;  3CRK C;  1SRO A;  1OXU A;  3MXN A;  1O7I A;  2WKD A;  1TS4 A;  2RDH A;  4KJN A;  1Q8I A;  3GTM H;  1VF5 C;  2B2V A;  1E22 A;  1STE A;  5E1F A;  4BY7 G;  3DHQ A;  4C2M H;  1JWU D;  5FLX L;  3JAM E;  2K28 A;  3T53 B;  4NW2 A;  1CA5 A;  2QEX A;  1SDF A;  5TSS A;  1OTC A;  5JEA J;  4KHV A;  1YNN C;  1TWG H;  4BY7 B;  4A3E B;  1T9H A;  2KCM A;  1H9J A;  2EDG A;  3H0G G;  5I2Y A;  1WTX A;  4JG2 A;  3S1Q H;  3S1N B;  2CQO A;  4DGZ A;  4WOR A;  2VQE L;  1EZ6 A;  1IHZ A;  2D0O A;  3CC2 A;  1I94 Q;  4DF7 A;  1J5E Q;  1OXS C;  1L2F A;  3E6Z X;  2PQA B;  4P75 A;  2BDO A;  4IUQ A;  4A3I H;  1NCV A;  2CKZ B;  1VQI A;  1VQD A;  5C3E B;  4GKJ Q;  5J1Z A;  3TZU A;  3NEN A;  4A93 B;  2WKC A;  4RH6 A;  5EKL A;  2R93 G;  5CGK A;  1G51 A;  3NTK A;  2LSS A;  1N32 L;  2HDL A;  5J39 A;  1S40 A;  1PVO A;  2F0D A;  4CJ1 B;  2MQH A;  1SNC A;  2OQK A;  3MXP A;  3KF6 A;  1SNP A;  1N9W A;  1ASZ A;  2FMM A;  2D62 A;  1PZI D;  2ZXR A;  1I5F A;  4IQZ A;  2LXK A;  4JOI C;  1TXY A;  1LYL A;  1TS2 A;  1E3P A;  3NPP A;  1GD7 A;  4YWM A;  2KCC A;  1G2S A;  1B1Z A;  1JE5 A;  3PO2 G;  4QUC A;  3RLF A;  1XWE A;  3I7F A;  3Q0A A;  4ZKB B;  5ELC A;  2IX3 A;  4JV5 L;  1WCM B;  1U4L A;  3KJP A;  4ZRZ A;  2XSC A;  2B2U C;  1A15 A;  1GKH A;  2K03 A;  4C3H B;  4I7Z C;  3CP0 A;  5COR A;  5C4X G;  4X65 L;  1UE1 A;  5FO8 B;  4CHT B;  3GTK B;  4Y7N B;  1C4Q A;  3G6E A;  4DR7 L;  3KLR A;  2JE6 I;  2JA6 H;  1BVS A;  4JYA L;  3HOX H;  5JAV A;  5ELB A;  2E2H B;  3U4V A;  5M5X B;  5IGC A;  2HIV A;  3KOJ A;  3KF8 B;  4LF5 Q;  3M85 A;  5KYI A;  4AQY Q;  5IT9 L;  2L9H A;  4K5V A;  3FVQ A;  4FYD A;  1FJG L;  4JI0 Q;  3RN5 A;  1FYC A;  1G91 A;  2DUD A;  4DK3 C;  1LTB D;  4DUY Q;  4YWL A;  3TBI B;  4YIJ A;  5LL6 S;  4X66 Q;  1BCP F;  1G8Z D;  2MJ8 A;  3UDG A;  4FP5 D;  2UUA L;  3S1R B;  2I07 B;  1PLF A;  4ALP A;  3G4S A;  4GNX C;  1ZEQ X;  5IIF A;  2R7Z G;  1IYU A;  4GLA C;  1WTO A;  5EJW A;  1UE5 A;  4JI8 Q;  1FNU A;  1DD2 A;  1RJT A;  5LHY 1;  1LUZ A;  1JJG A;  4LF9 Q;  4POG A;  3ND9 A;  1K3B C;  3NXW A;  3PUV A;  4A4I A;  2ENB A;  1UWV A;  4BY1 H;  4LFB Q;  1EYD A;  1HNX L;  2YTY A;  4IUN A;  1YNJ D;  3CC4 A;  2B63 G;  1B3Q A;  3QO2 A;  4ZUI A;  4BY1 B;  4K5X A;  1NJI C;  2B2Y A;  4DUZ Q;  4B9W A;  3CC7 A;  1WTQ A;  3RZD H;  2BA0 A;  4QGU A;  4A3M H;  4DV0 Q;  1E1O A;  2J7Z A;  4BBR B;  2R92 G;  2G9D A;  4C3I B;  2R6G A;  3VYR A;  2X6L A;  3C1F A;  4NKL A;  1KDB A;  4C3I H;  2Z9H A;  1YHA A;  4IUP A;  4KTA A;  4JBJ A;  4QMG A;  5AJ3 Q;  2Y0S E;  3DXJ C;  3EBE A;  3MZ5 A;  3URY A;  1EOV A;  1B2T A;  2E75 C;  1W6J A;  1V9P A;  3J80 i;  2ES2 A;  1PH3 A;  4A3J G;  1STY A;  3UDX A;  4DR2 L;  3HKZ B;  2NVX H;  4LF5 L;  4HIO A;  3MXN B;  5IGE A;  3L0O A;  2AMC B;  1B3A A;  2IX0 A;  4YCU A;  2SEB D;  3U58 A;  1W6K A;  4JI7 Q; 
#chains in the Genus database with same CATH homology
 1X3Q A;  2ZXP A;  2IL8 A;  4RHR A;  2M2L A;  2RSN A;  4RKL A;  2N55 A;  3CKI B;  3K7A B;  3MHB A;  3O13 A;  5C4X B;  2WV6 D;  1DCZ A;  2CW0 D;  3A8I E;  1JOK A;  2A6E D;  2IPK D;  3W3A A;  1QOH A;  4HR7 B;  1FNV A;  3GV3 A;  2F0H A;  2C9O A;  1UAP A;  5NUC A;  5KND A;  2NWG A;  3J80 E;  4DN4 M;  1HRJ A;  5KIX A;  1PXU A;  2B2W A;  2EYJ A;  1H9K A;  5I9O A;  1LT3 D;  4KN4 C;  2IT1 A;  2NVX B;  4ILW A;  4R9W A;  4F88 A;  2NYZ D;  5CR3 A;  1MBY A;  1E2V A;  1TVX A;  1KAA A;  4H0L C;  4BA1 I;  4ZUJ A;  3IL8 A;  1I3Q B;  1JWS D;  5DM7 3;  1GOZ A;  2F0P A;  3H3V C;  1CT1 D;  3EQL C;  5KEE A;  1LT5 D;  1TWG B;  4L8J A;  1NR4 A;  5C5L A;  1ZXT A;  2SNM A;  1OXT A;  2RQX A;  1NUC A;  2DN8 A;  3KUP A;  3D4W A;  1JB3 A;  1E0B A;  1V1P B;  3I91 A;  5DNF A;  1SBB B;  1JWM D;  2EYP A;  2LS0 1;  2OF1 A;  3NE5 B;  1J9O A;  5ELF A;  1B9N A;  2K04 A;  3I4L A;  4ZQ3 A;  4I65 A;  2JEA I;  3QWN A;  2L0C A;  4CJ0 B;  2A73 B;  2EE1 A;  1EY6 A;  2D9U A;  5C4J B;  1H9S A;  3SXH A;  4J8Q A;  3JAM L;  1SMY D;  1K8O A;  3M3Y B;  1T5X D;  1ET9 A;  3WOF A;  2LMC B;  1PRT B;  5M3M B;  1GUS A;  4DNR B;  3C46 A;  2EZV A;  1BBX C;  4C3I G;  3Q24 A;  3KF8 A;  4LK1 C;  2L5T A;  1JQY D;  5EPL A;  5JPN C;  1J8I A;  1L0X B;  3OHX C;  4RGN A;  1K83 B;  1S5B D;  5BN5 A;  2K7V A;  1DYQ A;  4ZK9 B;  2K05 A;  2L11 A;  1JOQ A;  3VYT A;  2KVM A;  3J7A F;  4KV6 A;  2JEB I;  4OO1 H;  2B2T A;  5LL6 X;  2IX1 A;  4G57 A;  2QDB A;  3K58 A;  3E5S A;  1GXD C;  1HA5 A;  5DEH A;  2DY8 A;  1DXM A;  2RVL A;  1YNJ C;  2KEC A;  2F0I A;  2ZT9 C;  5FO7 B;  1SYF A;  4DXG A;  1O78 A;  1SE3 A;  1TT2 A;  3TN2 A;  4DXF A;  3FDT A;  2R7Z B;  4QB4 A;  4AYB B;  4A3D B;  3E0J A;  1RTN A;  5I6Y A;  3VR6 A;  2AWO A;  1S5D D;  1NR2 A;  5CV7 A;  1F2Z A;  2CVR A;  1BCP D;  1BQQ T;  1CK1 A;  3U9S A;  3UI2 A;  1ZKO A;  2WII B;  1OO9 B;  1TR5 A;  3K5L A;  2K33 A;  3GTJ B;  3S16 B;  2LY7 A;  1WD0 A;  4N9P A;  1STH A;  5M5W B;  1CM9 A;  1TWF B;  4DFA A;  3MVV A;  3DEO A;  3V2T A;  2Y0S B;  3RMH A;  2LFN A;  3MWY W;  2L1B A;  2XWB B;  2M00 A;  1X3P A;  1CA6 A;  1EIG A;  2OEO A;  4HN7 A;  2VNU D;  1L0Y B;  4EQP A;  3S14 B;  3HOV B;  3C3L A;  3PO2 B;  3PUX A;  1SJH D;  2VB3 X;  1ZYR D;  5M3F B;  2K5D A;  4K6D A;  3T13 A;  1QCB D;  3BYY B;  1EQT A;  1KNA A;  1RKN A;  1ENC A;  3GV6 A;  1KNE A;  3NBH A;  2F0W A;  5K36 H;  3K57 A;  4H44 C;  1SNM A;  1AZQ A;  3N6R A;  4FNF A;  1I4H A;  2F0Q A;  3TDQ A;  4CKB A;  3S1M B;  1A6X A;  5CV4 A;  4FXG C;  1FGB D;  2WAQ B;  3S2D B;  4J6H A;  4CJ2 C;  1SSO A;  2B63 B;  1PDQ A;  2F0K A;  2QKI C;  3J81 L;  3QJY A;  3OOC A;  4R8I A;  1V1P A;  4RFB A;  1XYI A;  3D31 A;  2PW5 A;  3NQT A;  1LTS D;  1BNZ A;  3BVG A;  1UNS A;  3V96 A;  1SYC A;  1EY0 A;  5I9P A;  4XQJ A;  1QIL A;  4A3F B;  4XDX A;  2LKV A;  2MP1 A;  1VF7 A;  3TP5 A;  1H9S B;  1ICW A;  4IAL A;  1HUN A;  3FPU B;  2C5C A;  5F2D A;  1STA A;  2FIN B;  2HDM A;  3LWE A;  1Y8O B;  2EXZ A;  4IUT A;  5FKA C;  1GUT A;  2ICI A;  4KHZ A;  3OW7 A;  4M1U B;  1SNQ A;  5I2X A;  1LT4 D;  2A6H D;  5IGB A;  4C1N I;  1MGS A;  2RSO A;  4O1N A;  3DWP A;  3KBG A;  4DA2 A;  1NSN S;  2F3V A;  1HFN A;  1DOK A;  1V43 A;  1Q1E A;  3P7J A;  1LLR D;  5A35 A;  5ISR A;  4DK0 A;  4CKE A;  4RGO S;  1CFM A;  4RGM A;  5I6W A;  1BDO A;  3HRZ C;  4KJO A;  5M9O A;  1EZ8 A;  1EOT A;  3GP7 A;  3GO5 A;  5D14 A;  4C1N K;  1S5F D;  3I8Z A;  3SK5 A;  4WRD A;  5D65 A;  2JA6 B;  3GTO B;  3R3O A;  5EQ0 A;  2IW3 A;  4QIW B;  1TWH B;  4L6T B;  2PYK A;  1JC7 A;  3I72 A;  4OIK A;  1B4O A;  5KRU A;  4O42 A;  1M8A A;  3V05 A;  5BN3 A;  4DAY A;  1SYD A;  1IKL A;  2J0T D;  3HEJ A;  2EPB A;  4QF4 A;  4IUU A;  1O7Y A;  2K32 A;  5K36 G;  1CZG A;  2KED A;  2RDF A;  3G6J B;  4GZY C;  4BA2 I;  2BE5 D;  1WVL A;  4OIJ A;  3NK9 A;  1AEX A;  1KLU D;  3DEP A;  1O7L A;  4FF4 A;  1Y1V B;  1TY2 A;  4EQO A;  3QB3 A;  1RHP A;  2VXW A;  1BOS A;  2HUG A;  1Y1W B;  1QE6 A;  4V0B A;  2E2J B;  5CV9 A;  2GA4 B;  2NTT A;  3H91 A;  3CQZ B;  1LTG D;  1BCP C;  1RD9 D;  3NSW A;  3NWT A;  1MSG A;  4HSP A;  2B2U A;  1ENF A;  2EVB A;  2KA7 A;  2FJ2 A;  1LAB A;  2EYM A;  5AFW A;  3D8G A;  4RGT A;  3NUC A;  1EYA A;  4DNT B;  1CTM A;  1EY8 A;  4X3K A;  3I4M B;  4F8M A;  1PTO B;  5KNC A;  1PRT F;  1U4R A;  2K01 A;  2SDF A;  1HTL D;  1A3V A;  4KN7 C;  3KK7 A;  4C3J G;  2F0O A;  5ELE A;  5CYU A;  1JIC A;  2CW0 C;  1IYV A;  2V4D A;  4LJZ C;  1R4Q B;  2L55 A;  3MXG A;  4BS9 A;  2KQ3 A;  3A54 A;  2R61 A;  3FPP A;  2BA1 A;  4KD3 A;  3GTP B;  1DON A;  2EY5 A;  4ULL A;  2NVT B;  4OO1 I;  4RHS A;  3SR1 A;  4JBW A;  1SFO B;  3MAQ A;  3TSS A;  4KY7 A;  3VR4 A;  1F77 A;  5E3F A;  4RCO A;  1A3T A;  4K5W A;  4XYO A;  2XIW A;  1GUW A;  4H13 C;  4A3M B;  1GHJ A;  2CQA A;  5G3L D;  1DOM A;  1WTW A;  1V8Q A;  3RD4 A;  4KKS A;  5E4W C;  3L9A X;  4RWS C;  4XTC S;  2E2I B;  5BN4 A;  3PUW A;  3R93 A;  4P2C B;  1II3 A;  3P20 A;  4OGQ C;  2R93 B;  4DAV A;  2WB1 B;  2K5Q A;  2F0F A;  3HZX A;  1F2L A;  5C0X G;  3GD7 A;  3M4Y A;  2Q8I B;  4OL7 A;  1STG A;  2QCP X;  1Z6H A;  3MFG A;  3TZD A;  5DAU A;  2HQE A;  1ML0 D;  2K1B A;  1MSH A;  1PMR A;  3H94 A;  1SYE A;  1KDC A;  1VDZ A;  3OIQ A;  5JOB A;  3T16 A;  3T4A C;  5FOB B;  2B2W C;  4HAE A;  2F0T A;  5IGD A;  1EY5 A;  2O2L D;  2R3Z A;  3HOZ B;  1QNU A;  1U4P A;  1ESR A;  3FKI B;  1NAP A;  2BE5 C;  1LTT D;  3OIP A;  1SE2 A;  5CMD A;  1D1I A;  3HOU B;  2XNA C;  4X3S A;  4X3U A;  3SHL A;  4ZLT F;  3S1Q B;  3T51 B;  3X3N A;  2Z1C A;  1DZ1 A;  4WJW A;  2F0L A;  1Q3L A;  4XYQ A;  4K14 A;  1PTO C;  3QIA A;  2TSS A;  4TQU S;  5COY A;  4KKU A;  4L63 B;  3EFX D;  3I3C A;  3BZD B;  4OO1 G;  1FD7 D;  2F0G A;  1SAP A;  4RCN A;  4K8I A;  1U4M A;  1I4Q A;  1C48 A;  4JK1 C;  2QF7 A;  3VR5 A;  2EYH A;  4RAU C;  1LTR D;  4F87 A;  1Z7T A;  3A7L A;  2DNE A;  1PFB A;  1SJE D;  4DAP A;  2NBF A;  3PIP 3;  3MTS A;  1D2B A;  2PZT A;  1HHV A;  5IGG A;  2A68 C;  5T1I A;  1EWH A;  4Q5V A;  4U67 3;  1D5X C;  4XIG S;  3GQB A;  3ERO A;  2DY7 A;  3WDN A;  1SNO A;  3DUZ A;  4PMC A;  4K6L A;  2KHS A;  1B44 D;  1EFI D;  1G29 1;  2JXM B;  3PO3 B;  2IWH A;  4B08 A;  1EQV A;  5IT9 E;  2FFK B;  4EGV A;  1F9S A;  2TMP A;  5C0X H;  4Q0F A;  5D3I B;  4UAI A;  1GUN A;  4MHE A;  2A69 D;  2BCO A;  3D4R A;  3K5N A;  5EPJ A;  1PRT D;  2A5H A;  1OXV A;  3MEH A;  2IJ0 A;  3KBX A;  2NB0 A;  1Q1B A;  1IW7 C;  1TS3 A;  4FF1 A;  2NN6 I;  4G4K A;  1ILQ A;  1Y8N B;  3C1E A;  3CU7 A;  1XX8 A;  3GTM B;  2DNC A;  4KD4 A;  4RKB A;  1SXT A;  5CBA E;  2ICE C;  1GHK A;  5CV5 A;  4TKO B;  3BDO A;  2SOB A;  4ZYS A;  1QG7 A;  1HFG A;  4X3T A;  3A55 A;  3TP7 A;  3CRL C;  1AN8 A;  3I70 A;  2F1M A;  2NTS A;  3BG3 A;  2AQ2 B;  2NVY B;  2PMZ B;  1CHP D;  2SNS A;  1MD2 D;  1ILP A;  1U9R A;  1I4P A;  1I4G A;  4A3J B;  2PPB C;  3HOY B;  5ELD A;  4LAA A;  1AW7 A;  2MHV A;  1EU3 A;  3NTI A;  1EU4 A;  4N9T A;  3LWU A;  2XWJ B;  4G7Z C;  1E2Z A;  2Z8L A;  1BCP B;  3AB9 A;  3GTG B;  3U9O A;  5C3W A;  2ZXO A;  1JCK B;  2QEJ C;  1GUO A;  1LAC A;  3PV0 A;  1WD1 A;  4A3G B;  2AQ1 B;  4F7X A;  3LX0 A;  5JVH 3;  2RDG A;  5JPM C;  3VYS A;  3R2I A;  1R4P B;  3D6W A;  3IKJ A;  1D5M C;  1PTO D;  1K8M A;  5HGT A;  2B2V C;  2O5I C;  4G7H C;  4K2K A;  3RZO B;  4HTH A;  1XTC D;  1B53 A;  1RCV D;  2EY6 A;  1KAB A;  2M9V A;  2RBM A;  2EJG C;  3H0G B;  5CC4 A;  1QWY A;  3SK4 A;  4A3K B;  1TS5 A;  3NBI A;  3K5O A;  3GTQ B;  3VR3 A;  3SE0 A;  3AU7 A;  3SDZ A;  5EBD A;  1IL8 A;  5KGU A;  2A68 D;  4NDX A;  5IGF A;  5HUR A;  1HTP A;  2WIN B;  4S3S A;  1EEI D;  1WTV A;  1D1K A;  4HSV A;  2YYZ A;  4EQN A;  4FXK C;  1SE4 A;  3BDL A;  1DM0 B;  1Y8P B;  3EJI A;  1HUM A;  4IUV A;  2B39 A;  1BO0 A;  1EY4 A;  3W2D A;  4DK1 A;  3QG1 A;  3PUZ A;  4TRD A;  1QB5 D;  2X69 A;  2PQE A;  5EKK A;  5JVG 3;  1VMP A;  3D4D A;  5C3X A;  1STB A;  5D3D A;  2MGS A;  5M5Y B;  5CV8 A;  3I90 A;  1C8C A;  4FF3 A;  3K59 A;  4ABN A;  4H7B A;  1D6E C;  3LNN A;  5IOC A;  1TWC B;  1I4R A;  1CHQ D;  3G7L A;  4A3B B;  1JOO A;  1XXG A;  2E2D C;  1SMY C;  1DJR D;  1LV9 A;  2EJM A;  3VA7 A;  4V19 0;  5FK9 C;  2WP8 J;  1CI3 M;  1JE4 A;  2JP1 A;  2NN6 H;  3FMC A;  3ZYY X;  2X6G A;  3H09 A;  3QOJ A;  4M8A A;  5CBE E;  1F2Y A;  1VMC A;  3D3R A;  1RF2 D;  3NWS A;  2K6A A;  5EPK A;  2PCF B;  2EYO A;  3VYU A;  2JA5 B;  3Q6S A;  3MC0 B;  3S17 B;  5JEA G;  3K0Y A;  5A2Q L;  2F0E A;  3A56 A;  2H4O A;  2XRS D;  2Q8R E;  1CQV A;  4C2M B;  3C2P A;  3J7Y W;  2XRQ D;  4IZ8 A;  2L12 A;  1PTO H;  2D5D A;  2XVS A;  4CKC A;  4Z9C B;  3DMU A;  2O5J C;  4FF2 A;  2O4X A;  1UUP A;  4HMI A;  4B9X A;  1TY0 A;  3SK6 A;  1T5E A;  2EOT A;  3TP6 A;  3M7G A;  3L3O C;  5KYL A;  5IOD A;  4FVM A;  3Q22 A;  4IN3 A;  3M4O B;  2A6H C;  2KJX A;  2I46 A;  1QNK A;  1AZP A;  3FRP B;  2AWN A;  4IFD I;  2JSO A;  1BUV T;  3BVZ A;  4IFD G;  2PO4 A;  4RA8 A;  2JA8 B;  2A69 C;  4QUF A;  4KY5 A;  2F0J A;  3HOW B;  3ITP A;  2J4X A;  2ID0 A;  3IAY A;  5FLX E;  4XQN A;  3PIO 3;  4CGY B;  3NP8 A;  4XXE A;  2KEE A;  1ROD A;  3NTH A;  1G6Z A;  4XQQ A;  1F2M A;  1B50 A;  2NUC A;  4G7O C;  5KNB A;  1CZW A;  3HP3 A;  3SEB A;  3TP8 A;  1RDP D;  3S9W A;  2OXP A;  2NVQ B;  3S2H B;  4PQX A;  2EYF A;  3NHH A;  2Z4I A;  1BF4 A;  4FXD A;  2G9H D;  3MXU A;  5EGT A;  2F3W A;  4ZAI A;  3MA2 B;  2A74 C;  3PUY A;  3DM1 A;  1I6H B;  3VA5 A;  4BWG B;  5C0X I;  4A3I B;  1S5C D;  3Q23 A;  4J1M A;  4LMQ D;  1PYW D;  3J81 E;  2JYO A;  4R8N A;  4K2L A;  2NN6 G;  3KLS A;  1PZK D;  1S5E D;  4KI0 A;  3HG9 A;  4BBS B;  1IW7 D;  3I73 A;  1GJX A;  1TU2 B;  4DU9 A;  1FR3 A;  5C4Z A;  1X32 A;  1A2U A;  4NP5 A;  1PZJ D;  3EA6 A;  4C3H G;  3SK8 A;  2D2C C;  4KY6 A;  1KTK A;  5JEA H;  4ID6 A;  4MIU A;  2B8F A;  2FHT A;  5T1G A;  3IFD A;  1H9R A;  2N88 A;  2F0U A;  1HXY D;  1LTI D;  2KOL A;  2FMC A;  1HQR D;  1F9Q A;  3OMC A;  4E6I A;  1SEB D;  4IFD J;  4TSS A;  4KK7 A;  1FNW A;  3S15 B;  3SVM A;  1KLG D;  1F9P A;  1M4V A;  2F0M A;  1ONL A;  3HGB A;  5E4X A;  3A8K E;  1S4Z A;  3FEW X;  3L7Z C;  1V1O A;  2KUM A;  4KMU C;  1PTO F;  2EY1 A;  4HCE A;  2EYL A;  5C5M A;  1STN A;  3R8B A;  4C56 C;  5K5P A;  2B2Y C;  2L4N A;  3NQI A;  2MUY A;  1O7Z A;  4C3J B;  1EY9 A;  3OMG A;  5EKI A;  1WTP A;  2AUJ D;  4U68 A;  2B8G A;  4PMB A;  1ET6 A;  1ZYR C;  2K5W A;  3TME A;  1IKM A;  3OWF A;  3VR2 A;  2F03 A;  4XT1 B;  1YNN D;  1DOL A;  1AFP A;  4UDU C;  3BDC A;  4MN3 A;  1LO5 D;  1LTA D;  3WOE A;  1SYB A;  1Z47 A;  1EEF D;  5DM6 3;  1JR0 D;  1EIH A;  2MPM A;  4K8J A;  2Z4H A;  2EJF C;  5FO9 B;  2NZ1 D;  5G3L F;  1H9M A;  1LT6 D;  2AUK A;  1UEA B;  4ODG A;  5C0X J;  4ZKC B;  3MFY A;  4IUR A;  4PV1 C;  3J80 L;  3ONA B;  3K6O A;  1Q12 A;  1TKW B;  5I4D A;  4PNY A;  3ND8 A;  1Y69 U;  2YU9 B;  2Q8T A;  2JA7 B;  1PFN A;  2E74 C;  3CHB D;  5C6A A;  1HA6 A;  1I50 B;  3IFT A;  3HOX B;  3QOL A;  2F0V A;  2PNR C;  1I6V C;  3H6M A;  4HCS A;  4ME5 A;  4PMW A;  3J7A V;  3R2T A;  3ERQ A;  1F9R A;  2R92 B;  3A8J E;  4EVO A;  2VUM B;  1Q90 A;  2F4I A;  4KKT A;  4FO2 A;  4OHJ A;  4QCL A;  1ENA A;  1BXT A;  1SYG A;  2AQ3 B;  1EL0 A;  1EY7 A;  5CV6 A;  4WFN 3;  1OXX K;  2CHB D;  2BOS A;  1G2T A;  1VCI A;  2VB2 X;  3F2U A;  3KLS X;  3OWE B;  5JJZ A;  2HCC A;  3BS1 A;  3BVM A;  2F0S A;  1D5Z C;  3OPO A;  1EWC A;  3BYT B;  1TWA B;  2PW7 A;  2RKS A;  3RUZ A;  3N52 A;  1B9M A;  4HED A;  3OSO A;  2QIL A;  2KCN A;  1A3U A;  2RA4 A;  1R9T B;  1I4X A;  3A7A B;  4NMZ A;  1GUG A;  2OT2 A;  1AP0 A;  2E76 C;  2PZU A;  5A2Q E;  3X3M A;  3P75 A;  2WAC A;  2XN9 C;  3P1H A;  3PMF A;  4XT3 B;  3HS0 C;  2BDN A;  4HMJ A;  3M7N A;  4CBV A;  1RTO A;  1TII D;  1BR9 A;  1PFM A;  1HCZ A;  2HCI A;  1HQM C;  1HPC A;  1TQO A;  3RZD B;  1PRT C;  1SND A;  3T56 B;  3K5M A;  1QJO A;  4IFD H;  3EVQ A;  2F0N A;  2PZW A;  1E2W A;  1CQF A;  3DWA A;  3GTL B;  3D6C A;  1O80 A;  5J22 A;  1WTR A;  1EYC A;  1MI2 A;  5C44 B;  1JOR A;  2B2T C;  3DWQ A;  1KDA A;  3I4N B;  5C4H A;  3AMU A;  1ESF A;  2EY2 A;  2A6E C;  2H1E A;  5EBC A;  1A2T A;  3CRK C;  1OXU A;  3MXN A;  2WKD A;  1TS4 A;  2RDH A;  4KJN A;  1Q8I A;  1VF5 C;  2B2V A;  1STE A;  5E1F A;  3DHQ A;  1JWU D;  5FLX L;  3JAM E;  2K28 A;  3T53 B;  4NW2 A;  1CA5 A;  1SDF A;  5TSS A;  5JEA J;  4KHV A;  1YNN C;  4BY7 B;  4A3E B;  1H9J A;  2EDG A;  5I2Y A;  1WTX A;  3S1N B;  4DGZ A;  4WOR A;  1EZ6 A;  1IHZ A;  4DF7 A;  1OXS C;  3E6Z X;  2BDO A;  4IUQ A;  1NCV A;  5C3E B;  5J1Z A;  3TZU A;  4A93 B;  2WKC A;  4RH6 A;  5EKL A;  5CGK A;  3NTK A;  2HDL A;  5J39 A;  2F0D A;  4CJ1 B;  1SNC A;  3MXP A;  1SNP A;  2FMM A;  2D62 A;  1PZI D;  2ZXR A;  4IQZ A;  1TS2 A;  3NPP A;  2KCC A;  1G2S A;  1B1Z A;  4QUC A;  3RLF A;  1XWE A;  3Q0A A;  4ZKB B;  5ELC A;  2IX3 A;  1WCM B;  1U4L A;  4ZRZ A;  2XSC A;  2B2U C;  1A15 A;  2K03 A;  4C3H B;  4I7Z C;  5COR A;  5FO8 B;  4CHT B;  3GTK B;  4Y7N B;  1C4Q A;  3KLR A;  2JE6 I;  5JAV A;  5ELB A;  2E2H B;  5M5X B;  5IGC A;  3M85 A;  5KYI A;  5IT9 L;  2L9H A;  4K5V A;  3FVQ A;  4FYD A;  1FYC A;  1G91 A;  1LTB D;  3TBI B;  4YIJ A;  5LL6 S;  1BCP F;  1G8Z D;  2MJ8 A;  4FP5 D;  3S1R B;  2I07 B;  1PLF A;  1ZEQ X;  5IIF A;  1IYU A;  1WTO A;  5EJW A;  1DD2 A;  1FNU A;  1RJT A;  5LHY 1;  3ND9 A;  3NXW A;  3PUV A;  2ENB A;  1EYD A;  4IUN A;  1YNJ D;  3QO2 A;  4ZUI A;  4BY1 B;  4K5X A;  2B2Y A;  4B9W A;  1WTQ A;  2BA0 A;  2J7Z A;  4BBR B;  4C3I B;  2G9D A;  2R6G A;  3VYR A;  2X6L A;  3C1F A;  4NKL A;  1KDB A;  4QMG A;  4IUP A;  4KTA A;  3DXJ C;  3MZ5 A;  3URY A;  1B2T A;  2E75 C;  1W6J A;  1STY A;  3HKZ B;  5IGE A;  1B3A A;  2IX0 A;  2SEB D;  1W6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...