3SXHA

Crystal structure of staphylococcal nuclease variant delta+phs i92al103a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEAAVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92AL103A at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sxhA00
1SYEA 4I65A 4KY5A 5CV7A 1SYBA 1JOQA 4ZQ3A 1F2YA 1SYFA 3OSOA 1STNA 1EY4A 2M00A 4IALA 4J6HA 5J1ZA 2EYFA 5JOBA 2EYPA 5IGBA 2SOBA 3SK4A 4B9XA 2F0KA 4HTHA 1EY7A 3DMUA 2PQEA 4QMGA 5CV8A 1KDCA 3NP8A 4NKLA 5C4ZA 5HGTA 5KYIA 1SNQA 1IHZA 4ZUIA 3SHLA 4G57A 1II3A 4LAAA 3RUZA 1EY9A 1A3TA 1EYDA 3V2TA 3T16A 2F0UA 3MVVA 2KQ3A 3T13A 1TQOA 4OL7A 1JOKA 2OXPA 4K2KA 4K5WA 4KD4A 2PW5A 4NDXA 2F0LA 5DAUA 2F0QA 1SNCA 3D4WA 5E3FA 1SNDA 1STHA 1STYA 2PZUA 3EROA 4K8JA 2EYOA 4KJNA 5EGTA 5IGGA 5KGUA 5KEEA 3SK6A 3VA5A 1F2ZA 1A2TA 5C3XA 2WACA 4MIUA 4E6IA 2F0JA 5IGFA 1EY8A 1KDAA 1A2UA 3H6MA 3NUCA 3EVQA 3PMFA 2F0MA 3NXWA 3QOJA 4PMBA 4KHVA 5HURA 3ERQA 5CR3A 2QDBA 5E1FA 4WRDA 1TT2A 2KHSA 4K5XA 1EQVA 4ODGA 5J22A 3S9WA 2OF1A 1A3VA 1ENAA 1JOOA 4NMZA 5IGCA 5IOCA 2F0EA 2PYKA 5CV4A 4DGZA 5C5LA 4ID6A 4RKLA 4WORA 4F7XA 5F2DA 5C5MA 5CC4A 1NUCA 4J1MA 2F0TA 2O4XA 4IZ8A 2F0WA 4K5VA 5NUCA 5CGKA 1STGA 4NP5A 1SNPA 5EKKA 2ENBA 2PW7A 3D6CA 4DU9A 1F2MA 4K2LA 1EZ6A 2EY1A 2RKSA 3P1HA 3TP7A 5C3WA 2F0DA 1ENCA 5JAVA 1TR5A 3MZ5A 2PZTA 3R3OA 1SYCA 2F0FA 4N9PA 2EYLA 3C1EA 5ISRA 4HMIA 3MXPA 4KD3A 3SR1A 5CV5A 5C4HA 1EY5A 2EYMA 4EQOA 4RKBA 2EY6A 5CV6A 4F8MA 3OMCA 4KY7A 3TP8A 5KYLA 2EY5A 2F3WA 2EYJA 3HEJA 2F0NA 2F0HA 4K6DA 1KAAA 1STAA 4EQNA 5K5PA 1SYGA 2HQEA 3ITPA 4QF4A 5I9OA 5DEHA 3BDCA 1AEXA 4R8NA 3DHQA 5I6YA 5KIXA 3SXHA 2EXZA 3EJIA 5IGDA 3C1FA 1RKNA 2F0SA 1EY6A 2F0IA 3NHHA 4KV6A 3BDLA 1SNOA 1JORA 4H7BA 4PMCA 5CV9A 5I9PA 1KDBA 2LKVA 5M9OA 1EY0A 2F0GA 5I6WA 3HZXA 5C6AA 3MEHA 3NQTA 1SNMA 4HMJA 2EY2A 2F0PA 1STBA 4KTAA 3TP6A 2F0OA 4EQPA 3QOLA 2RDFA 3MHBA 4KY6A 3LX0A 5KRUA 3OWFA 3D8GA 3E5SA 3SK8A 4DFAA 3TP5A 3OMGA 1A3UA 2EYHA 4YIJA 1EZ8A 2SNMA 4B9WA 3U9OA 5IIFA 4QB4A 5IGEA 4EVOA 4K8IA 4ZUJA 2F3VA 3QB3A 1NSNS 4KJOA 2OEOA 4N9TA 4PNYA 3TMEA 2NUCA 4K14A 4ME5A 4DF7A 2PZWA 1SYDA 1KABA 2F0VA 5IODA 1EYCA 5EKLA 4TRDA 3SK5A 4IUNA 3P75A 1U9RA 3D4DA 2RBMA 4S3SA 3NK9A 5J39A 2SNSA 1EYAA
chains in the Genus database with same CATH superfamily
3T1YL 2OWOA 1SYBA 5J1ZA 5M9OA 1UE6A 4L6TB 2EYPA 3HGBA 4B3SQ 1VS0A 4OEMB 1EOTA 5IYCG 3DMUA 2B8FA 5CV8A 2JA5G 1KDCA 4ZUIA 4G57A 3SE0A 1CKOA 4Y7NH 1EY9A 2A69D 2IJ0A 2Q8IB 2YYZA 3ER0A 5ELEA 3U4VA 1SE2A 1X65A 4YY3Q 5C0XG 1DONA 3GTKH 1UE5A 4IJLA 3JAML 4JW0A 1L2FA 1IBLL 4A3IH 3CCQA 3ICEA 4OWWB 4JI4Q 5IGFA 1PHJA 5M3MH 1SAPA 4IUTA 1A15A 1TWGB 4BWGB 4K0KQ 1TT2A 3CC4A 3G6EA 2N3SA 4LFAQ 2ZJQA 2O2LD 3GO5A 2BDNA 1N9WA 1S4ZA 1JWUD 2O4XA 4P72A 4I7AA 1L0YB 4LMQD 4NP5A 2DNEA 2B2UA 2PO4A 4V190 3C46A 2IY5B 1YHBA 3IAYA 4DK0A 4LF7Q 3KJPA 1I4XA 2EYMA 4EQOA 4NW2A 1BR9A 2L9HA 2A1AA 4F8MA 1F9RA 3L7ZC 1K8OA 1ASZA 3TEHB 3M85A 2Z1CA 3CMEA 4DV1Q 2RCFA 2Q8RE 2B63H 3EN2A 3C1FA 1VQJA 1A0IA 4KV6A 1L0WA 2BH8A 3OIPA 4HIKA 3PV0A 3CCLA 2BDOA 5I6WA 2AQ3B 4CDCC 4DAYA 3U50C 2KHJA 1FGBD 3KBXA 1KRSA 4KKTA 4H44C 5GADC 4BY7B 1NR2A 4KLKA 4DV6Q 1JWMD 3PO2B 3NTIA 3PUXA 4HIDA 1D8LA 4KJOA 1KLUD 1QVCA 4AYBG 5M3FB 4KHPQ 4QQBX 5ELOA 2VY3A 1AN8A 1EIYB 1RHPA 2B8GA 2O5JC 5K36G 5C4XB 1EYCA 1QUQA 4NXMQ 4O42A 1B4OA 1JB7A 1VMCA 1P8LA 3PO3H 3H3VH 1S5BD 1WTWA 3NPPA 2NVQH 1CSPA 3W2DA 4DR4Q 1DM0B 1TWAH 1Y1WB 3K8AA 4HIOA 5D3DA 3H15A 1G6PA 2B3GA 5E7NA 3KLWA 2VB2X 3W1BA 1MGSA 3K6OA 2MUYA 1JJGA 4G7OC 1XJVA 2AQ2B 1STHA 4IURA 3KFUA 2WB1B 2ES2A 1A2TA 3TREA 1KDAA 4HAEA 4O2DA 3NXWA 3VYTA 2M2LA 1IYUA 2HDMA 4A93G 3Q8DA 3TS2A 4BY7G 1EQVA 1ENAA 1JOOA 4NMZA 4FP5D 2F0EA 2N55A 1TY2A 4FF3A 4X66L 2H5XA 4DKAC 1BVSA 2BCOA 3I90A 5C5MA 1QNUA 5C0XI 3PO2G 1QVGA 4C3IH 3X3NA 4X62Q 1ENCA 4GKKL 1K3BC 1YZ6A 1VQ5A 5C4XG 3M4YA 3I2ZA 3R3OA 3T51B 5GAGC 1IYJB 3S17B 5C4HA 2R92B 1JR0D 1VF7A 1IXRA 4FNFA 1TY0A 4RKBA 5EPKA 1A6XA 1W3SA 3S15H 4DK6C 1KAAA 4KKSA 3K59A 1BUVT 2RHSB 3IFDA 4QF4A 1E2VA 1ENFA 1LTAD 3EJIA 2EDGA 3ND9A 5J3BA 3RMHA 2LKVA 3HOVH 2HD3A 3A54A 2F0GA 1I94Q 3OWEB 3R2IA 1PTOH 4OXPA 3PIPA 1EL0A 4DN4M 4DR5L 1JMCA 1C0AA 3MHBA 2WB1G 2RHQB 3PF5A 4X3TA 1PZID 2XGTA 3D4RA 3KF6B 4XQJA 2F3IA 3EQLC 2UUBQ 1VQEA 2YV5A 5IP7H 2A68C 1FD7D 4Q0FA 5LMUL 5IIFA 2CFMA 4TVAB 2IT1A 1GHJA 1PLFA 4DF7A 4Q5VA 2CW0C 2PZWA 1TU2B 4CDEC 4JK1C 3CQZH 2E74C 4O0AA 1RF2D 2RBMA 1SYEA 3A5UA 4Y7NB 3RD4A 5IGBA 1EY4A 3K5LA 5BN5A 1TIID 2EJGC 1PYSB 1QJOA 2RF4A 2PQEA 3I4LA 1I4GA 4PMWA 3BU2A 4DV3Q 3CC2A 2JK8A 2HCIA 1HA5A 1CKNB 3V2TA 3URYA 4AIMA 3J80c 5IYBG 1Q8KA 4DR3L 2QILA 4YCUA 2XSCA 4FF4A 4DR1Q 1YHQA 5H1SE 5A2QE 2Y0SG 4ZKCB 4KJNA 3TDQA 5I2YA 1I6HH 1F2ZA 2WACA 5IT9E 1TWHB 1YEZA 2ICIA 3QOJA 3WOFA 1W2BA 3I73A 4DV7Q 1GUNA 3Q0AA 5BN4A 4BS9A 2QDBA 1IZ6A 1V8QA 1H9MA 4K5XA 1M8AA 2QGQA 1XNRL 4KN4C 1B50A 1SE3A 1B8AA 4F7XA 5NUCA 5JEAJ 4DNIA 4RGNA 1IBML 1E24A 2UU9Q 4XT1B 1NMGA 1KC8C 1PH4A 4A76A 3CCJA 4ZAIA 4B3MQ 3DXJC 5DM73 2EYLA 3FKIB 4CJ2C 5ISRA 1YITA 2B63B 3S14B 3F1ZA 5AJ3Q 5FOBB 4KY7A 1FGUA 2EY5A 1SRUA 2EYJA 5GAEC 2K14A 1LT3D 1K3RA 2Z4IA 1Q86C 1UEBA 1SYGA 4DR7Q 1SDFA 4R8NA 5LL6S 2OTLA 4AQYL 1OXVA 1KRTA 3CCSA 1GUWA 1RKNA 4UY8C 1PFBA 1XTCD 5CV9A 1KDBA 1X6OA 1B3QA 4LK1C 1HPCA 5M3MG 1SJED 1NAPA 4MNOA 1EFID 3NE5B 2WAQE 5T1GA 3PIP3 2F0PA 1C9OA 2UXBQ 4G7ZC 3D8GA 4M8AA 1AE2A 1GUSA 4DV5Q 2JN4A 1K9MC 3S2DH 3CU7A 4DV2Q 1DYQA 1XMOQ 1U4PA 2TSSA 4YWKA 2VUMH 1R4QB 4JI6L 3TBIB 2NVQB 1Y8PB 2WKDA 1MIUA 1S5DD 1I50B 1TWAB 3P75A 1C7YA 1DGSA 5CBEE 1S3OA 4HSPA 4JI2L 1RDPD 3CCVA 4J6HA 3FKIG 3SK4A 2B63G 1MJEA 3P20A 2IX0A 3J81c 4YHHL 1X3FA 3PQIA 2F03A 1YJNA 3MXUA 1JT8A 2HDLA 5M5WH 1LT4D 1DOKA 1PH5A 4K5WA 4K2KA 3H3VC 1PFSA 2PW5A 3P7JA 5DAUA 4JI7L 3NSWA 1XWEA 3EROA 5CYUA 5EGTA 4JI1Q 2DY7A 1ONLA 2ZM6Q 2JEAI 1LTRD 4HMIA 3PMFA 3HKZB 4A75A 3K0XA 3HOYB 1BBUA 4C3IB 1D2BA 2SDFA 2BH2A 3GTOH 1SR3A 2MFIA 1CSQA 2KCMA 5T1IA 4DGZA 5JVG3 4LF9L 4DA2A 1GM5A 5FLMH 1DCZA 2A6EC 4K5VA 3QR8A 1QVFA 5CBAE 1PH8A 1LLRD 3VYUA 3PO3G 1MKHA 2D5DA 3S15B 5KNCA 2Q8TA 2LFNA 4ZRZA 1SYCA 2FFKB 4A3DH 3GP7A 3SEBA 4GOPA 1EY5A 3I72A 1I4PA 4L63B 3RLNA 3UDFA 3OMCA 1SMYC 1WTHA 4APVA 3HOVB 2KJXA 1IW7D 3W3AA 1Q81C 3E0JA 2F52A 2EXZA 2F0IA 4RWSC 1LTGD 3I4NB 4XYQA 4WJWA 2RSNA 1FYCA 1T5XD 3VDYA 1TWGH 4IPHA 2NN6H 3T1YQ 4UP8A 2MGSA 1GXDC 2DY8A 1N33L 1ESRA 2ZT9C 1RODA 4A3BB 4IPCA 2CCZA 4JV5Q 3U9SA 3PUYA 4H13C 1YJ9A 4C3IG 4EVOA 2WIIB 1SE4A 3QB3A 1NSNS 4JOIC 1PTOC 3KDFA 2L0CA 1X32A 4RGMA 4XT3B 1O7ZA 4X6AH 1OXUA 2K32A 1IBLQ 3SK5A 3BVGA 1EYAA 4I65A 3NBHA 1TWFH 2DGYA 2IX3A 3KBGA 2QDLA 2A6HC 3DEOA 1QNKA 3NWSA 2RDHA 2X69A 4OX9Q 2BOSA 3OIQA 5HGTA 1SNQA 2I07B 3HOVG 2RQXA 3GTPB 1HNWQ 1VQ8A 3IKJA 4R4IA 2B2TA 1VQOA 1T5EA 1TQOA 5JPNC 1GUGA 2OXPA 3HRZC 4CBVA 1PH2A 2F0QA 5DLQE 2KEEA 4POGA 3CHBD 4V0BA 3PF4A 5IP7G 4E6IA 2G9HD 5M3FH 3M4OB 3NUCA 2E5LL 1D7QA 1Q3LA 1PRTD 1Q7YC 2VXWA 4DV4L 4R4TA 3GTMH 2DJFC 1UWVA 1QILA 3M4QA 3PIOA 1E3PA 1J9OA 2GN5A 2LXKA 2FHTA 4WFN3 1BBWA 4DU9A 2NZHA 1EWIA 1LTBD 4CGYB 5C44H 1HQRD 1Y1WH 1S5CD 4FXDA 3FEWX 3HFZB 3MXPA 2ICEC 4RG1A 2EY6A 1KQSA 1G91A 1O7IA 3L9AX 1G2TA 1L1OC 1HQMC 2F0NA 1FNVA 1U4RA 3HOZB 3GQBA 2DUDA 4PV1C 2B2WC 4HJAA 2QW7A 3H3VI 3CXCA 2A73B 1XPUA 3KF8B 1RJTA 4P71A 2LY7A 3T1HL 2P5ZX 4P73A 2Z8LA 4GKJL 1JJ2A 2EY2A 1E7ZA 3QWNA 2VQEQ 5KRUA 3UE0A 3A8IE 4HR7B 4B08A 2R7ZB 5C0XJ 4QB4A 2QCPX 2F3VA 1Y14B 3G71A 4JOIA 3OTOL 3S17H 2R92H 2K01A 3KOJA 5IODA 5EKLA 3BJUA 1E1OA 3F2UA 4IUNA 1AH9A 4IN3A 2UXDL 1O80A 2E75C 2R7FA 1Q90A 4KKUA 4C56C 1F2YA 3A7AB 5M5WB 3MA2B 4GN5A 4CKEA 3GD7A 4B9XA 5E4XA 1W6KA 5KYIA 4IFDG 3N6RA 2JYOA 1Q8IA 1HNXQ 1BCPC 2HQLA 4POFA 1J6QA 5KEEA 1E2ZA 3J7YW 3M4PA 1CFMA 1N8RC 1VQ9A 2K05A 3WDNA 1VQGA 1LACA 2UUCL 2K5DA 2VUMG 1M90C 3X3MA 5CV4A 1V1QA 4IUVA 4OHJA 4A3DB 4RKLA 4U68A 4WORA 2CQAA 3PIO3 1OTCA 3STBD 4GNXB 3GDEA 4LF6L 2ATWA 2EZVA 1YNXA 4DR5Q 2JEBI 2F4VL 3OHXC 2OTJA 2JA9A 1WCMH 2Q2UA 3K5OA 2LSSA 2Q2HA 1QG7A 1YNNC 1FJGQ 1VQ6A 1L1OA 2CH4W 3NELA 5FO7B 3OW7A 2D62A 3ITPA 1N34L 2IX1A 3K7UC 4C1NK 3FPUB 4DUYL 1TWHH 4JBWA 3M9BA 5FLXc 1OXTA 1PRTF 4O1NA 4H02A 4GNXC 1AP0A 3OOCA 5LL6X 4IUPA 1WI5A 3K7AH 5A2QL 4L5QA 3I91A 2RVLA 4RH6A 4X65L 5IT9L 2JJQA 5FLMG 1SFOB 3HOWB 2SNMA 1NJIC 4DV0L 4RFBA 5ELDA 3FKIH 1B44D 1TWFB 4DR3Q 5IE8A 3S14H 2NUCA 4K14A 3T53B 1AE3A 4LF4L 1DOLA 4A3DG 4ZK9B 2XVSA 4X3KA 4IQZA 4AYBE 3D6WA 1X3PA 3U4ZA 5ELBA 4G7HC 2L15A 2QKIC 1ML0D 5CV7A 4LF8L 1JOQA 1J5EL 5JEAH 4X3SA 4BBSH 3I4OA 3UDGA 4WJ3M 2A8VA 3VR2A 2VL6A 1UEAB 4A3GH 2HIXA 4NKLA 1DJRD 3GTGB 3SHLA 2KOLA 5DNFA 1Q1BA 5LMNQ 1IBMQ 4UP7A 1HXYD 2NN6G 3RN2A 4QCLA 1CHPD 4QGUA 4HJ9A 2EE1A 3I7FA 1NCVA 4K8JA 1SROA 3GTMB 1XMQQ 1QE6A 2E8GA 4H0LC 4EQ5A 3M7GA 1HHVA 3KLSX 4X64L 2WV6D 3DWQA 4DR6Q 3CCUA 4MHEA 1N32L 5JJLA 3S9WA 1I50H 4AQYQ 4OGQC 5C44B 4JBMA 3V96A 1D1IA 4ID6A 1LT5D 2PQAB 1EIGA 2E2JH 5CC4A 1VQ4A 1VMPA 1SNPA 1B9MA 3E0EA 1N36L 1EZ6A 3JAMc 1PFNA 2HHHQ 3F2BA 4PZ7A 2PZTA 1PV4A 4A3KB 4JBKA 1Y69U 1GVPA 2L12A 5M5YB 4JI3L 2HUGA 4ZYSA 3W5OA 3UDXA 3K58A 4IPGA 5FLXE 2ZXPA 4JBJA 2XRSD 2ZJPA 2D2CC 4JI6Q 3FPPA 2Z0SA 3SGIA 3SXHA 1GUTA 3BYTB 4JYAL 2PI2E 1VQLA 5I9PA 4DR2Q 3HOYH 3I4MB 4GNXA 2KVMA 4JI2Q 5M3FG 3SDZA 4BBRB 2YTYA 2VZAA 3Q6SA 3QOLA 1EU3A 2RDFA 5JVH3 1K73C 2JA6H 1LTSD 3ONAB 3E5SA 3H0GB 4HIMA 1BBXC 3AEVA 4YHHQ 1A3UA 4JI5Q 2V1CC 5IY0A 3E6ZX 4DXGA 3LWEA 5CORA 1CQVA 2WB1E 1EU4A 3EBEA 5CMDA 4K8IA 1VQPA 1G51A 4IOCA 3J80i 5C44G 1Y1WG 1WTRA 3IRBA 3Q24A 1WTQA 2CVRA 5J39A 4HCEA 4KY5A 4RHRA 1PXUA 4OONA 2M00A 1HRJA 1NE3A 4A3KG 2SOBA 3I4NH 1TKWB 1ILPA 2F0KA 1WTVA 4LFBQ 4LF9Q 2OQKA 5IWAQ 4GN3B 2Z6KC 3SVMA 4ZCKA 1JWSD 1WTOA 3CP0A 1JOKA 4OL7A 4A3BH 2F0LA 1YIJA 1EIHA 4B9WA 4YY3L 4P75A 3BG3A 1PH7A 4RHSA 1K83B 3J7A5 2UXCL 4BBRG 1A2UA 3T16A 4HJ8A 4R9WA 1QZGA 2Y0SE 1MBYA 2R92G 2NN6I 1K8AC 2AUJD 3DLLA 5JPMC 4LFAL 1WCMB 3GV6A 4IZ8A 5EBDA 5C4JH 2PW7A 2EY1A 3P1HA 3TP7A 4QIWE 3TS0A 2I5HA 1VQKA 1JQYD 4UAIA 2B2VC 3GTPH 1G291 2EXDA 4DXFA 2IHFA 3MXGA 1HR0Q 4FF2A 4GZYC 3J81L 2XTIA 1S72A 5K5PA 2PI2A 5E4WC 3BDCA 3NQIA 3DHQA 5FO9B 4R4QA 3M4OH 2KCTA 1CHQD 3K7AB 3BDLA 1RD9D 1JORA 1E0BA 1HZBA 1DOMA 1GUOA 1H9SB 2D0PA 5BN3A 3NQTA 2K04A 2ZTDA 3CAMA 1TS5A 5LMNW 1X9NA 4OWTB 1H95A 1RCVD 1X56A 4UP9A 3CCMA 1XX8A 2IWHA 3TP5A 3J81i 2WAQB 1KNAA 3S24A 4ABNA 4DV6L 5EJWA 4DK1A 4KK7A 4BBSB 1KABA 4LUVA 2F0VA 1WCMG 2LS01 2A6ED 4IFDH 3NENA 4NXML 1VQBA 4DAVA 4A3GB 5LHY1 3HOZH 4S3SA 3PGZA 2E5LQ 4OIKA 1UE1A 1M1KC 4ZQ3A 3EIVA 1ZYRD 1XNQQ 5BR8L 3H94A 2WFWA 2OT2A 4QL5A 4HTHA 3I70A 4DR4L 4JI0Q 2E2HB 2Z6KA 4HN7A 1IL2A 1CM9A 2NTSA 2KQ3A 4L5SA 4KD4A 1O7YA 2A5HA 5KNBA 4XQNA 3D4WA 5E3FA 2BE5D 3GTQB 1LTID 2R7ZH 3MC0B 1I3QB 3VA5A 1R4PB 2E2JB 1EQTA 1HUMA 4NB3A 2KCCA 1NY4A 2UUAL 3ERQA 1HFGA 1B1ZA 1SJHD 4JG2A 2CH4A 1M4VA 3KF6A 5IGCA 1D5ZC 3J80E 3NEMA 1FNWA 1IL8A 3CRLC 4F87A 2WAQG 2FXQA 4B3TL 3T1HQ 3RN5A 4GKJQ 4RGTA 2ZXRA 1JE4A 5JEAG 4BBSG 1VF5C 4RGOS 1PZKD 1JB3A 2GVBA 3SR1A 3F2CA 4A3GG 1IKMA 5CV6A 1YNJD 3S1QB 5IYDH 1CZWA 2MO0A 2XNAC 2F3WA 3DUZA 2F0HA 3QG1A 1MJCA 3LGJA 2RCNA 1GOZA 2A6HD 1JCKB 3DWPA 1VQHA 2A74C 4KMUC 5KIXA 2PMZB 2B39A 3KLSA 1VCIA 3KK7A 3VR4A 4LJZC 2K28A 3NHHA 4FYDA 1KD1C 1CKNA 2JA6B 2G9DA 2UXDQ 1WJJA 4FVMA 3L2PA 3K5NA 2AMCB 1SNMA 4HMJA 3H09A 3MEFA 1STBA 4KTAA 1Y8OB 3A8JE 4C2MH 4KY6A 1F77A 4OO1H 1HJPA 4BXXH 1V1PB 1VQCA 4X3UA 4CHTB 1I4QA 3C3LA 1QWYA 5D65A 1GD7A 3I3CA 1LTTD 2HCCA 4JI8Q 4A3EH 2SEBD 3KJOA 3DM3A 1D1KA 4XTCS 1WD1A 3DWAA 1EEID 1U4LA 4DUZL 2EVBA 3U58A 1VQMA 1UUPA 4R4CA 5EQ0A 1H9RA 3A7LA 1EQQA 1BQQT 3NP8A 1J8IA 3HS0C 2N88A 3HKZG 1B2TA 4IJHA 4LAAA 3HOYG 4J15A 4TKOB 4R8IA 2TMPA 3KUPA 2I0QA 4HEDA 1MI2A 3CD6A 2F4VQ 4OELB 1SFOH 3HOWH 2Z4HA 4EGVA 1KNEA 1CUKA 2JA6G 4DR1L 1NR4A 3NWTA 3S1MB 3J81E 4XIGS 2F0MA 4FDBA 5C4JB 4DV7L 5E1FA 3R2TA 1N34Q 4PQXA 2OF1A 5C3EB 1EQRA 1E2WA 1FVIA 5CGKA 5EKKA 1IBKL 1EFWA 4MZ9A 4A3JB 1GJXA 1HZCA 1X3GA 1NBWA 3I4NG 3GTGH 1ESFA 1SXTA 2EOTA 2NB0A 4B3ML 3KLRA 1KL9A 1HZAA 4X65Q 3E9IA 3FP9A 4OWXB 3TP8A 5FJ8H 5AJ3L 3KYHC 1PFMA 2ZJRA 4K6DA 4QY7A 1QB5D 5EBCA 4A3BG 1JC7A 4LF4Q 2X6LA 2QF7A 1RTOA 3TN2A 3EFXD 4GS3A 2I46A 1WYDA 1CT1D 2ASBA 2OQ0A 3MEHA 2E2DC 1A8VA 1J5EQ 1VQNA 3HKSA 3TP6A 3A56A 1ASYA 1BOSA 1IW7C 4TSSA 4XYOA 3CKIB 1G8ZD 1YVCA 4NXNL 2EYHA 4P2CB 2R93B 5GQOA 1PTOF 4L8JA 3MXNB 4ZUJA 4A3KH 4IUQA 4DV2L 3CMAA 4N9TA 1XMOL 5M5YH 5C3EG 1BXTA 4ZLTF 1ET9A 4MTKA 1LV9A 4UDUC 5JJIA 1U9RA 3NK9A 2FMCA 3S1RH 5JOBA 1NTGA 1JJCB 3I4MH 3CRKC 3BVMA 1KHIA 4LFCL 1EYGA 4BBRH 5G3LF 5KNDA 3HOUB 1A3TA 3AQQA 5FLXL 3I56A 2EQSA 3CW2C 3ZYYX 1B70B 1PRTB 3H0GH 1PVOA 4DAYB 4CJ0B 1CKMA 3O13A 2IHEA 2MJ8A 4JI3Q 3G7LA 2Q2TA 3L3OC 1UNSA 3HOXH 2ZM6L 5HURA 1GKHA 4N8X1 1BO0A 4B3RL 4J8QA 1VQIA 2KHSA 1HCZA 1YBYA 5GAHC 1A3VA 3E3XA 4X66Q 2YU9B 1HNZL 5C5LA 4LWCA 4JYAQ 1NUCA 1QUQB 3HOZG 1YI2A 4A3CH 3V05A 4GKKQ 2DN8A 1PMRA 1HUNA 1H9KA 4KHZA 3BDOA 4IUUA 4PG3A 1R9TB 5L37A 1F9PA 5KYLA 1TS3A 3FHWA 4GLVB 4C3JH 1AEXA 1NMFA 1K83H 1SMXA 4C2MB 2FMMA 1EWHA 3J81j 2R7ZG 1EY6A 3J7AV 3ULPA 1SNOA 3Q22A 1HFNA 2AWOA 1VQDA 1EWCA 2X6GA 3R8BA 1TS2A 2R6GA 1YHAA 3IL8A 1K28A 2V4DA 1HA6A 3ZJYC 3TSSA 1HTPA 2EPBA 4A3EB 3ULJA 5LMUQ 3AB9A 3E9HA 1LABA 2ALYB 1F9QA 4JV5L 1I4HA 4TQUS 2K6AA 2JA8H 4BA2I 2B2WA 3TMEA 5JJKA 3QJYA 2MQHA 4LW1A 3D0FA 1XTDA 3BZKA 5IYDG 2UXCQ 3TRZA 4C3HH 4FF1A 1ICWA 3OSOA 2K75A 2I5MX 1AZPA 3G6JB 2L11A 1PA6A 1K0SA 2CWAA 4QMGA 4AYBB 3S16H 4R4OA 4OX9L 1TWCB 4LNQA 1KLGD 3ND8A 3UE1A 1BCPF 1B9NA 1HNWL 3MXNA 4JVZA 3AMUA 3D3RA 5EKIA 2DNCA 3VYRA 3K0YA 2XIWA 2O5IC 4N8FA 3JAMi 2MHVA 2PZUA 5IGGA 4OO1G 3GTJB 1ET6A 1Y8NB 3KF8A 2NZ1D 5KGUA 4BXXG 2B2YC 1V43A 3GV3A 1LO5D 2VQFL 1VQ7A 2A19A 2NVYH 4PMBA 1Z6HA 1VQFA 5CR3A 3VA7A 2HIVA 4A3FH 1XNRQ 2QEJC 1SLJA 3BVZA 1RIPA 5J22A 3RNUA 4A3EG 1MSHA 3BZCA 2JQOA 5EPLA 2RSOA 3BZDB 2VW9A 2VB3X 1WD0A 3N52A 3J7AF 1C4QA 3QO2A 2EJMA 1CZGA 1ICFB 2E2HH 1S5FD 2JP1A 4A93B 5JJZA 2KUMA 3MTSA 3H91A 4LF5L 5I2XA 4IFDI 3STBC 1PZJD 2QEXA 2A69C 2VNUD 3GTQH 5I9OA 2NVTB 3RLFA 1I3QH 2XWJB 1SEBD 3HOWG 5I6YA 2K5WA 3MWYW 2A68D 2PCFB 5IGDA 4A4IA 3UI2A 3QIAA 5M5XB 1MD2D 2K52A 1OO9B 5C6AA 5HGQA 1PYBA 1PH3A 2CW0D 3A8KE 5A35A 2OCEA 3D31A 4EQPA 5BR8Q 3J7ZC 4CJ1B 2CKZB 3EA6A 3SK8A 2H1EA 3OMGA 4M1UB 2VQEL 1Y1VH 3U9OA 3OYYA 4DAMA 3CPFA 4LUZA 2Q2IA 2Z9HA 5EPJA 3S1RB 3J80L 3S1NB 3S1QH 1A62A 1U0LA 1LUZA 4A3LH 2RDGA 2IL8A 1O78A 2JA7H 1Z7TA 2SNSA 4AH6A 3C2PA 4MTNA 5FJ8G 2UUAQ 1K0RA 4UHVA 5ELNA 3TZDA 1STNA 3VR6A 1KAWA 3GTLH 4JPBW 2I5LX 5IT9c 2L55A 3A5ZB 2KENA 4HJ7A 3I8ZA 1QCBD 1K8GA 1W6JA 2YTXA 4B3TQ 4MN3A 2F0UA 3HOXB 4A3MB 1WTXA 1JICA 4JI7Q 2AUKA 2XN9C 1V9PA 2CWPA 1HNXL 2VS1A 2B2YA 3SK6A 4F88A 5C3XA 1X55A 3AFPA 1EY8A 3EVQA 4GLXA 1SBBB 1UE7A 2J4XA 3F8TA 4UPAA 2NVXB 4ODGA 4NPSA 4XDXA 4B3SL 4BY1H 4RAUC 1D5MC 2KCNA 3WWVA 3K5MA 3AU7A 2C9OA 2E2IH 4J1MA 1AZQA 1Z47A 2Y0SB 3D6CA 4ILWA 4HJ5A 4R1JA 4OO1I 2J0TD 4QJFA 1FR3A 1MHWC 3A55A 2NBFA 3BYYB 2Z6BA 4C3JB 4K6LA 1WVLA 3I4MG 3A74A 3MFYA 4KD3A 5CV5A 3ULLA 1AFPA 1BKBA 2C35B 4JI4L 4EX5A 5IP9H 4QIWB 3I55A 1FJGL 1LYLA 2F1MA 1JE5A 4K0KL 3H0GG 2R3ZA 1DXMA 3M3YH 2EIFA 1STEA 3PCOB 1B53A 4L5TA 3JAME 3S1MH 4H7BA 4PMCA 4DUZQ 4U673 3HOXG 3HZXA 4A3MG 5D14A 4YCVA 5C3EH 5AFWA 1N33Q 2JA8B 4CKBA 4KN7C 1Q82C 4LF7L 3TQYA 1FL0A 1ZXTA 3CF5A 4A3JH 1SSOA 4YIJA 3GTKB 1EZ8A 5FO8B 4A3CG 1XXGA 2N49A 4A3IB 1B7YB 4C3HB 4DV1L 5M3MB 4PNYA 1O7LA 4ME5A 2NTTA 1SYDA 3LNNA 2PQAA 4P74A 1E22A 2ZTEA 4TRDA 3G4SA 2AKWB 1CA5A 2FINB 2MNAA 4GOPB 3S16B 1S40A 1C8CA 1ILQA 1Z9FA 4C3JG 2EYFA 2L5TA 4XXEA 3FMCA 1EY7A 3DM1A 2R7DA 1RTNA 1IHZA 3NTHA 1GHKA 1UAPA 1IBKQ 5LMNL 2NVYB 1QOHA 4KHPL 3PUVA 1U4MA 4ZKBB 4A3FB 2HT1A 2R93H 1SNDA 2KECA 1G6ZA 1TVXA 2WKCA 4GOPC 1HTLD 1EOVA 3H6MA 1XMQL 2JA8G 2L4NA 4KHVA 1Q12A 4CDFC 4DV4Q 2K33A 3CCEA 1X3QA 4WRDA 4L5RC 2IW3A 4DR6L 2D9UA 4Y52H 1IKLA 1OXSC 3F2DA 5TSSA 1SMYD 3KDFB 1VQAA 2D0OA 1PH9A 1RL2A 4HSVA 2PPBC 4A3IG 3S2HH 2K7VA 4C3HG 4LUOA 4IO9A 1PH1A 3NBHB 5ELFA 4HCSA 2YTVA 3MAQA 1XPOA 4N9PA 2HHHL 1U5KA 1PYWD 3HOUH 5ELCA 5I4DA 4NXNQ 2K50A 3B6YA 3WOEA 1EUJA 3HEJA 1DD2A 3RZDH 1AW7A 3DEPA 3PO3B 4DAPA 3M7NA 3VR3A 1ZKOA 5IYCH 2JA5H 5FK9C 2DJGC 2MO1A 2K4KA 4DR2L 1ZEQX 2GVAA 1Y1VB 2YU9H 3K81C 1PTOD 1BNZA 4X62L 4A3FG 2B2VA 1SN8A 5C0XH 1I6VC 1PDQA 2CHBD 3UDIA 3NTKA 2E76C 4LFCQ 1E1TA 3OWFA 2K5VA 4JI5L 2KEDA 2MP1A 3NBIA 1FNUA 3FVQA 3OTOQ 2JA7B 1KXLA 2AHOB 2RA4A 1OXXK 4JC0A 1R9TH 2B2TC 1EEFD 3L0OA 3GTLB 2MPMA 3K57A 2KBNA 1I94L 2AWNA 5G3LD 3FRPB 1SYFA 4ME3A 4B3RQ 3RZOH 1I5FA 2BA0A 2LXJA 3VYSA 1HNZQ 1QZHA 5C4ZA 1MSGA 2C5CA 4LFBL 2UUBL 3W1GA 2NYZD 1II3A 5IWAL 1LT6D 3G48A 1SE8A 1LTLA 3IFTA 3HKZE 1ZYRC 1KIXA 1STYA 1WFQA 4BY1B 2PMZE 1Y1VG 1H9SA 2F0JA 4YCWA 3RLOA 2E2IB 4FO2A 4JCVE 4YWMA 2UUCQ 2CQOA 2NWGA 5EAYA 1PTOB 2PYKA 4OIJA 4A3LG 1Q1EA 2XRQD 1G2SA 5F2DA 2F0TA 2JXMB 2F0WA 4DNTB 4DV3L 2L1BA 2BE5C 4LF6Q 2JA7G 4RCNA 2ENBA 2XWBB 4BA1I 4K2LA 1HR0W 1TWCH 4GN4B 4KI0A 3FDTA 3AFQA 3C1EA 5K36H 1CTMA 2NZOA 4I7ZC 4RCOA 3M3YB 3CQZB 3T56B 3ERSX 1HR0L 1BF4A 4EQNA 1X3EA 1STAA 3BS1A 1GO3E 1IYVA 1LM0A 2HQEA 3GTJH 5DEHA 4DUYQ 1DZ1A 3PUZA 1F9SA 2B29A 3A0JA 4RMFA 1C48A 2K5NA 3OW2A 2UU9L 2JSOA 1CA6A 1YNJC 1WOCA 4Z9CB 4ALPA 2WINB 2F4IA 5GROA 4BY1G 3LX0A 1F2LA 1D6EC 2EJFC 2ZXOA 4DV0Q 5HY6A 1P16A 1YJWA 1I6HB 1CK1A 5IGEA 1K8MA 2GA4B 1CQFA 4A93H 4DR7L 4BY7H 1BDOA 1PH6A 4YWLA 3Q23A 1Q46A 1EIFA 3CPWA 4C1NI 2VQFQ 3PO2H 3D4DA 4LF8Q 5IP9G 2NVTH 1BCPD 1L1OB 3AYHB 2R61A 3K80C 3RUZA 4DK3C 4FXKC 1XPRA 4IALA 4IFDJ 5C4XH 1XNQL 2UXBL 4PZ8A 5M5XH 1T9HA 4DV5L 4G4KA 4JI0L 2N78A 4QUFA 1EYDA 1HH2P 3MVVA 3T13A 4XQQA 4GLAC 4NDXA 1XYIA 2ZTCA 1SNCA 4IPDA 2EYOA 4A3JG 1L0XB 2K1BA 4MIUA 4X64Q 3R93A 4LF5Q 2PNHA 3S2HB 3S1NH 2PNRC 1N32Q 5DM63 1TXYA 2H4OA 1VDZA 5IOCA 1V1PA 1YNND 4FXGC 1V1OA 5D3IB 1N36Q 1STGA 2G5DA 4DNRB 1F2MA 2K5QA 1S5ED 2B2UC 2RKSA 4QUCA 5C3WA 3S2DB 2F0DA 2N8NA 3LWUA 3RZDB 5JAVA 1TR5A 3MZ5A 1NNXA 2F0FA 2LMCB 4JI1L 2VUMB 2FJ2A 2JA5B 3HP3A 4A3MH 4RA8A 1I4RA 1BCPB 1HZ9A 1TS4A 2R93G 2F0SA 1KTKA 4CKCA 2KA7A 4WJ4A 3PSIA 5FKAC 4CDDC 1EY0A 2NVXH 2IPKD 2J7ZA 2BA1A 1PRTC 2AQ1B 3CC7A 5IYBH 3OPOA 2F0OA 1X54A 3CCRA 1A63A 3PUWA 4DFAA 2M9VA 2WP8J 2K03A 1WTPA 4PZ6A 3VR5A 2JE6I 3TZUA 2QA4A 1H9JA 2OEOA 3MFGA 4IOAA 3RR5A 2ID0A 3JC66 3T4AC 3RZOB 2KHIA 2K5HA 4JI8L 4ULLA 3HOUG 3GTOB 1CI3M 1D5XC 3HG9A 4DPGA 5COYA 1B3AA
chains in the Genus database with same CATH topology
1SYBA 5J1ZA 5M9OA 4L6TB 2EYPA 3HGBA 1EOTA 3DMUA 2B8FA 5CV8A 1KDCA 4ZUIA 4G57A 3SE0A 1EY9A 2A69D 2IJ0A 2Q8IB 2YYZA 5ELEA 1SE2A 5C0XG 1DONA 3JAML 5IGFA 1SAPA 4IUTA 1A15A 1TWGB 4BWGB 1TT2A 2O2LD 3GO5A 2BDNA 1S4ZA 1JWUD 2O4XA 1L0YB 4LMQD 4NP5A 2DNEA 2B2UA 2PO4A 4V190 3C46A 3IAYA 4DK0A 1I4XA 2EYMA 4EQOA 4NW2A 1BR9A 2L9HA 4F8MA 1F9RA 3L7ZC 1K8OA 3M85A 2Z1CA 2Q8RE 3C1FA 4KV6A 3OIPA 3PV0A 2BDOA 5I6WA 2AQ3B 4DAYA 1FGBD 3KBXA 4KKTA 4H44C 4BY7B 1NR2A 1JWMD 3PO2B 3NTIA 3PUXA 4KJOA 1KLUD 5M3FB 1AN8A 1RHPA 2B8GA 2O5JC 5K36G 5C4XB 1EYCA 4O42A 1B4OA 1VMCA 1S5BD 1WTWA 3NPPA 3W2DA 1DM0B 1Y1WB 5D3DA 2VB2X 1MGSA 3K6OA 2MUYA 4G7OC 2AQ2B 1STHA 4IURA 2WB1B 1A2TA 1KDAA 4HAEA 3NXWA 3VYTA 2M2LA 1IYUA 2HDMA 1EQVA 1ENAA 1JOOA 4NMZA 4FP5D 2F0EA 2N55A 1TY2A 4FF3A 5C5MA 2BCOA 3I90A 1QNUA 5C0XI 3X3NA 1ENCA 3M4YA 3R3OA 3T51B 3S17B 5C4HA 2R92B 1JR0D 1VF7A 4FNFA 4RKBA 1TY0A 5EPKA 1A6XA 1KAAA 4KKSA 3K59A 1BUVT 3IFDA 4QF4A 1E2VA 1ENFA 1LTAD 3EJIA 2EDGA 3ND9A 3RMHA 2LKVA 3A54A 2F0GA 3OWEB 3R2IA 1PTOH 1EL0A 4DN4M 3MHBA 4X3TA 1PZID 3D4RA 4XQJA 3EQLC 2A68C 1FD7D 4Q0FA 5IIFA 2IT1A 1GHJA 1PLFA 4DF7A 4Q5VA 2CW0C 2PZWA 1TU2B 4JK1C 2E74C 1RF2D 2RBMA 1SYEA 4Y7NB 3RD4A 5IGBA 1EY4A 3K5LA 5BN5A 1TIID 2EJGC 1QJOA 2PQEA 3I4LA 1I4GA 4PMWA 2HCIA 1HA5A 3V2TA 3URYA 2QILA 2XSCA 4FF4A 5A2QE 4ZKCB 4KJNA 3TDQA 5I2YA 1F2ZA 2WACA 5IT9E 1TWHB 2ICIA 3QOJA 3WOFA 3I73A 1GUNA 3Q0AA 5BN4A 4BS9A 2QDBA 1V8QA 1H9MA 4K5XA 1M8AA 4KN4C 1B50A 1SE3A 4F7XA 5NUCA 5JEAJ 4RGNA 4XT1B 4ZAIA 3DXJC 5DM73 2EYLA 3FKIB 4CJ2C 5ISRA 2B63B 3S14B 5FOBB 4KY7A 2EY5A 2EYJA 1LT3D 2Z4IA 1SYGA 1SDFA 4R8NA 5LL6S 1OXVA 1GUWA 1RKNA 1PFBA 1XTCD 5CV9A 1KDBA 4LK1C 1HPCA 1SJED 1NAPA 1EFID 3NE5B 5T1GA 3PIP3 2F0PA 4G7ZC 3D8GA 4M8AA 1GUSA 3CU7A 1DYQA 1U4PA 2TSSA 1R4QB 3TBIB 2NVQB 1Y8PB 2WKDA 1S5DD 1I50B 1TWAB 3P75A 5CBEE 4HSPA 1RDPD 4J6HA 3SK4A 3P20A 2IX0A 2F03A 3MXUA 2HDLA 1LT4D 1DOKA 4K5WA 4K2KA 3H3VC 3P7JA 2PW5A 5DAUA 3NSWA 1XWEA 3EROA 5CYUA 5EGTA 2DY7A 1ONLA 2JEAI 1LTRD 4HMIA 3PMFA 3HKZB 3HOYB 4C3IB 1D2BA 2SDFA 5T1IA 4DGZA 5JVG3 4DA2A 1DCZA 2A6EC 4K5VA 5CBAE 1LLRD 3VYUA 2D5DA 3S15B 5KNCA 2Q8TA 2LFNA 4ZRZA 1SYCA 2FFKB 3GP7A 3SEBA 1EY5A 3I72A 1I4PA 4L63B 3OMCA 1SMYC 3HOVB 2KJXA 1IW7D 3W3AA 3E0JA 2EXZA 2F0IA 4RWSC 1LTGD 3I4NB 4XYQA 4WJWA 2RSNA 1FYCA 1T5XD 2NN6H 2MGSA 1GXDC 2DY8A 1ESRA 2ZT9C 1RODA 4A3BB 3U9SA 3PUYA 4H13C 4C3IG 4EVOA 2WIIB 1SE4A 3QB3A 1NSNS 1PTOC 2L0CA 1X32A 4RGMA 4XT3B 1O7ZA 1OXUA 2K32A 3SK5A 3BVGA 1EYAA 4I65A 3NBHA 2IX3A 3KBGA 2A6HC 3DEOA 1QNKA 3NWSA 2RDHA 2X69A 2BOSA 3OIQA 5HGTA 1SNQA 2I07B 3GTPB 2RQXA 3IKJA 2B2TA 1T5EA 1TQOA 5JPNC 1GUGA 2OXPA 3HRZC 4CBVA 2F0QA 2KEEA 3CHBD 4V0BA 4E6IA 2G9HD 3M4OB 3NUCA 1Q3LA 1PRTD 2VXWA 1QILA 1J9OA 2FHTA 4WFN3 4DU9A 1LTBD 4CGYB 1HQRD 1S5CD 4FXDA 3FEWX 3MXPA 2ICEC 2EY6A 1G91A 3L9AX 1G2TA 1HQMC 2F0NA 1FNVA 1U4RA 3HOZB 3GQBA 4PV1C 2B2WC 2A73B 1RJTA 2LY7A 2Z8LA 2EY2A 3QWNA 5KRUA 3A8IE 4HR7B 4B08A 2R7ZB 5C0XJ 4QB4A 2QCPX 2F3VA 2K01A 5IODA 5EKLA 3F2UA 4IUNA 4IN3A 1O80A 2E75C 1Q90A 4KKUA 4C56C 1F2YA 3A7AB 5M5WB 3MA2B 4CKEA 3GD7A 4B9XA 5E4XA 1W6KA 5KYIA 4IFDG 3N6RA 2JYOA 1Q8IA 1BCPC 5KEEA 1E2ZA 3J7YW 1CFMA 2K05A 3WDNA 1LACA 2K5DA 3X3MA 5CV4A 4IUVA 4OHJA 4A3DB 4RKLA 4U68A 4WORA 2CQAA 3PIO3 2EZVA 2JEBI 3OHXC 3K5OA 1QG7A 1YNNC 5FO7B 3OW7A 2D62A 3ITPA 2IX1A 4C1NK 3FPUB 4JBWA 1OXTA 1PRTF 4O1NA 1AP0A 3OOCA 5LL6X 4IUPA 5A2QL 3I91A 2RVLA 4RH6A 5IT9L 1SFOB 3HOWB 2SNMA 4RFBA 5ELDA 1B44D 1TWFB 2NUCA 4K14A 3T53B 1DOLA 4ZK9B 2XVSA 4X3KA 4IQZA 3D6WA 1X3PA 5ELBA 4G7HC 2QKIC 1ML0D 5CV7A 1JOQA 5JEAH 4X3SA 3VR2A 1UEAB 4NKLA 1DJRD 3GTGB 3SHLA 2KOLA 5DNFA 1Q1BA 1HXYD 2NN6G 4QCLA 1CHPD 2EE1A 3GTMB 1NCVA 4K8JA 1QE6A 4H0LC 3M7GA 1HHVA 3KLSX 2WV6D 3DWQA 4MHEA 3S9WA 4OGQC 5C44B 3V96A 1D1IA 4ID6A 1LT5D 1EIGA 5CC4A 1VMPA 1SNPA 1B9MA 1EZ6A 1PFNA 2PZTA 4A3KB 1Y69U 2L12A 5M5YB 2HUGA 4ZYSA 3K58A 5FLXE 2ZXPA 2XRSD 2D2CC 3FPPA 3SXHA 1GUTA 3BYTB 5I9PA 3I4MB 2KVMA 3SDZA 4BBRB 3Q6SA 3QOLA 1EU3A 2RDFA 5JVH3 1LTSD 3ONAB 3E5SA 3H0GB 1BBXC 1A3UA 3E6ZX 4DXGA 3LWEA 5CORA 1CQVA 1EU4A 5CMDA 4K8IA 1WTRA 3Q24A 1WTQA 2CVRA 5J39A 4HCEA 4KY5A 4RHRA 1PXUA 2M00A 1HRJA 2SOBA 1TKWB 1ILPA 2F0KA 1WTVA 3SVMA 1JWSD 1WTOA 4OL7A 1JOKA 2F0LA 1EIHA 4B9WA 3BG3A 4RHSA 1K83B 1A2UA 3T16A 4R9WA 1MBYA 2NN6I 2AUJD 5JPMC 1WCMB 3GV6A 4IZ8A 5EBDA 2PW7A 2EY1A 3P1HA 3TP7A 1JQYD 4UAIA 2B2VC 1G291 4DXFA 3MXGA 4FF2A 4GZYC 3J81L 5K5PA 5E4WC 3BDCA 3NQIA 3DHQA 5FO9B 1CHQD 3K7AB 3BDLA 1RD9D 1JORA 1E0BA 1DOMA 1GUOA 1H9SB 5BN3A 3NQTA 2K04A 1TS5A 1RCVD 1XX8A 2IWHA 3TP5A 2WAQB 1KNAA 4ABNA 5EJWA 4DK1A 4KK7A 4BBSB 1KABA 2F0VA 4IFDH 2LS01 2A6ED 4A3GB 4DAVA 5LHY1 4S3SA 4OIKA 4ZQ3A 1ZYRD 3H94A 2OT2A 4HTHA 3I70A 2E2HB 4HN7A 1CM9A 2NTSA 2KQ3A 4KD4A 1O7YA 2A5HA 5KNBA 4XQNA 3D4WA 5E3FA 2BE5D 3GTQB 1LTID 3MC0B 1I3QB 3VA5A 1R4PB 2E2JB 1EQTA 1HUMA 2KCCA 3ERQA 1HFGA 1B1ZA 1SJHD 1M4VA 5IGCA 1D5ZC 3J80E 1FNWA 1IL8A 3CRLC 4F87A 4RGTA 2ZXRA 1JE4A 5JEAG 1VF5C 4RGOS 1PZKD 1JB3A 3SR1A 1IKMA 5CV6A 1YNJD 3S1QB 1CZWA 2XNAC 2F3WA 3DUZA 2F0HA 3QG1A 1GOZA 2A6HD 1JCKB 3DWPA 2A74C 4KMUC 5KIXA 2PMZB 2B39A 1VCIA 3KK7A 3KLSA 3VR4A 4LJZC 2K28A 3NHHA 4FYDA 2JA6B 2G9DA 4FVMA 3K5NA 1SNMA 4HMJA 3H09A 1STBA 4KTAA 1Y8OB 3A8JE 4KY6A 1F77A 4OO1H 1V1PB 4X3UA 4CHTB 1I4QA 3C3LA 1QWYA 5D65A 3I3CA 1LTTD 2HCCA 2SEBD 1D1KA 4XTCS 1WD1A 3DWAA 1EEID 1U4LA 2EVBA 1UUPA 5EQ0A 1H9RA 3A7LA 1BQQT 3NP8A 1J8IA 3HS0C 2N88A 1B2TA 4LAAA 4TKOB 4R8IA 2TMPA 3KUPA 4HEDA 1MI2A 2Z4HA 4EGVA 1KNEA 1NR4A 3NWTA 3S1MB 3J81E 4XIGS 2F0MA 5C4JB 5E1FA 3R2TA 4PQXA 2OF1A 5C3EB 1E2WA 5CGKA 5EKKA 4A3JB 1GJXA 1ESFA 1SXTA 2EOTA 2NB0A 3KLRA 3TP8A 1PFMA 4K6DA 1QB5D 5EBCA 1JC7A 2X6LA 2QF7A 1RTOA 3TN2A 3EFXD 2I46A 1CT1D 3MEHA 2E2DC 3TP6A 3A56A 1BOSA 1IW7C 4TSSA 4XYOA 3CKIB 1G8ZD 2EYHA 4P2CB 2R93B 1PTOF 4L8JA 4ZUJA 4IUQA 4N9TA 1BXTA 4ZLTF 1ET9A 1LV9A 4UDUC 1U9RA 3NK9A 2FMCA 5JOBA 3CRKC 3BVMA 5G3LF 5KNDA 3HOUB 1A3TA 5FLXL 3ZYYX 1PRTB 4CJ0B 3O13A 2MJ8A 3G7LA 3L3OC 1UNSA 5HURA 1BO0A 4J8QA 2KHSA 1HCZA 2YU9B 1A3VA 5C5LA 1NUCA 3V05A 2DN8A 1PMRA 1HUNA 1H9KA 4KHZA 3BDOA 4IUUA 1R9TB 1F9PA 5KYLA 1TS3A 1AEXA 4C2MB 2FMMA 1EWHA 1EY6A 3J7AV 1SNOA 3Q22A 1HFNA 2AWOA 1EWCA 2X6GA 3R8BA 1TS2A 2R6GA 3IL8A 2V4DA 1HA6A 3TSSA 1HTPA 2EPBA 4A3EB 3AB9A 1LABA 1F9QA 1I4HA 4TQUS 2K6AA 4BA2I 2B2WA 3TMEA 3QJYA 4FF1A 1ICWA 3OSOA 1AZPA 3G6JB 2L11A 4QMGA 4AYBB 1TWCB 1KLGD 3ND8A 1BCPF 1B9NA 3MXNA 3AMUA 3D3RA 5EKIA 2DNCA 3VYRA 3K0YA 2XIWA 2O5IC 2MHVA 2PZUA 5IGGA 4OO1G 3GTJB 5KGUA 1ET6A 1Y8NB 2NZ1D 3KF8A 2B2YC 1V43A 3GV3A 1LO5D 4PMBA 1Z6HA 5CR3A 3VA7A 2QEJC 3BVZA 5J22A 1MSHA 5EPLA 2RSOA 3BZDB 2VB3X 1WD0A 3N52A 3J7AF 1C4QA 3QO2A 2EJMA 1CZGA 1S5FD 2JP1A 4A93B 5JJZA 2KUMA 3MTSA 3H91A 5I2XA 4IFDI 1PZJD 2VNUD 2A69C 5I9OA 2NVTB 3RLFA 2XWJB 1SEBD 5I6YA 2K5WA 3MWYW 2A68D 2PCFB 5IGDA 3UI2A 3QIAA 5M5XB 1MD2D 1OO9B 5C6AA 2CW0D 5A35A 3A8KE 3D31A 4EQPA 4CJ1B 3EA6A 3SK8A 2H1EA 3OMGA 4M1UB 3U9OA 5EPJA 3S1RB 3J80L 3S1NB 2RDGA 2IL8A 1O78A 1Z7TA 2SNSA 3C2PA 3TZDA 1STNA 3VR6A 2L55A 3I8ZA 1QCBD 1W6JA 4MN3A 2F0UA 3HOXB 4A3MB 1WTXA 1JICA 2AUKA 2XN9C 2B2YA 3SK6A 4F88A 5C3XA 1EY8A 3EVQA 1SBBB 2J4XA 2NVXB 4ODGA 4XDXA 4RAUC 1D5MC 2KCNA 3K5MA 3AU7A 2C9OA 4J1MA 1AZQA 1Z47A 2Y0SB 3D6CA 4ILWA 4OO1I 2J0TD 1FR3A 3A55A 2NBFA 3BYYB 4C3JB 4K6LA 1WVLA 3MFYA 4KD3A 5CV5A 1AFPA 4QIWB 2F1MA 2R3ZA 1DXMA 1STEA 1B53A 3JAME 4H7BA 4PMCA 4U673 3HZXA 5D14A 2JA8B 5AFWA 4CKBA 4KN7C 1ZXTA 1SSOA 4YIJA 3GTKB 1EZ8A 5FO8B 1XXGA 4A3IB 4C3HB 5M3MB 4PNYA 1O7LA 4ME5A 2NTTA 1SYDA 3LNNA 4TRDA 1CA5A 2FINB 3S16B 1C8CA 1ILQA 4C3JG 2EYFA 2L5TA 4XXEA 3FMCA 1EY7A 3DM1A 1RTNA 1IHZA 3NTHA 1GHKA 1UAPA 2NVYB 1QOHA 3PUVA 1U4MA 4ZKBB 4A3FB 1SNDA 2KECA 1G6ZA 1TVXA 2WKCA 1HTLD 3H6MA 2L4NA 4KHVA 1Q12A 2K33A 1X3QA 4WRDA 2IW3A 2D9UA 1IKLA 1OXSC 5TSSA 1SMYD 4HSVA 2PPBC 2K7VA 4C3HG 5ELFA 4HCSA 3MAQA 4N9PA 1PYWD 5ELCA 5I4DA 3WOEA 3HEJA 1DD2A 1AW7A 3DEPA 3PO3B 4DAPA 3M7NA 3VR3A 1ZKOA 5FK9C 1ZEQX 1Y1VB 1PTOD 1BNZA 2B2VA 5C0XH 1I6VC 1PDQA 2CHBD 3NTKA 2E76C 3OWFA 2KEDA 2MP1A 3NBIA 1FNUA 3FVQA 2JA7B 2RA4A 1OXXK 2B2TC 1EEFD 3GTLB 2MPMA 3K57A 2AWNA 5G3LD 3FRPB 1SYFA 2BA0A 3VYSA 5C4ZA 1MSGA 2C5CA 2NYZD 1II3A 1LT6D 3IFTA 1ZYRC 1STYA 4BY1B 2F0JA 1H9SA 2E2IB 4FO2A 2NWGA 1PTOB 2PYKA 4OIJA 1Q1EA 2XRQD 1G2SA 5F2DA 2F0TA 2JXMB 2F0WA 4DNTB 2L1BA 2BE5C 4RCNA 2ENBA 2XWBB 4BA1I 4K2LA 4KI0A 3FDTA 3C1EA 5K36H 1CTMA 4I7ZC 4RCOA 3M3YB 3CQZB 3T56B 1BF4A 4EQNA 3BS1A 1STAA 1IYVA 2HQEA 5DEHA 1DZ1A 3PUZA 1F9SA 1C48A 2JSOA 1CA6A 1YNJC 4Z9CB 2WINB 2F4IA 3LX0A 1F2LA 1D6EC 2EJFC 2ZXOA 1I6HB 1CK1A 5IGEA 1K8MA 2GA4B 1CQFA 1BDOA 3Q23A 4C1NI 3D4DA 1BCPD 2R61A 3RUZA 4FXKC 4IFDJ 4IALA 4G4KA 4QUFA 1EYDA 3MVVA 3T13A 4XQQA 4NDXA 1XYIA 1SNCA 2EYOA 1L0XB 2K1BA 4MIUA 3R93A 3S2HB 2PNRC 5DM63 2H4OA 1VDZA 5IOCA 1V1PA 1YNND 4FXGC 1V1OA 5D3IB 1STGA 4DNRB 1F2MA 2K5QA 1S5ED 2B2UC 2RKSA 4QUCA 5C3WA 3S2DB 2F0DA 3LWUA 3RZDB 5JAVA 1TR5A 3MZ5A 2F0FA 2LMCB 2VUMB 2FJ2A 2JA5B 3HP3A 4RA8A 1I4RA 1BCPB 1TS4A 2F0SA 1KTKA 4CKCA 2KA7A 5FKAC 1EY0A 2IPKD 2J7ZA 2BA1A 1PRTC 2AQ1B 3OPOA 2F0OA 3PUWA 4DFAA 2M9VA 2WP8J 2K03A 1WTPA 3VR5A 2JE6I 3TZUA 1H9JA 2OEOA 3MFGA 2ID0A 3T4AC 3RZOB 4ULLA 3GTOB 1CI3M 1D5XC 3HG9A 5COYA 1B3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYE A;  4I65 A;  4KY5 A;  5CV7 A;  1SYB A;  1JOQ A;  4ZQ3 A;  1F2Y A;  1SYF A;  3OSO A;  1STN A;  1EY4 A;  2M00 A;  4IAL A;  4J6H A;  5J1Z A;  2EYF A;  5JOB A;  2EYP A;  5IGB A;  2SOB A;  3SK4 A;  4B9X A;  2F0K A;  4HTH A;  1EY7 A;  3DMU A;  2PQE A;  4QMG A;  5CV8 A;  1KDC A;  3NP8 A;  4NKL A;  5C4Z A;  5HGT A;  5KYI A;  1SNQ A;  1IHZ A;  4ZUI A;  3SHL A;  4G57 A;  1II3 A;  4LAA A;  3RUZ A;  1EY9 A;  1A3T A;  1EYD A;  3V2T A;  3T16 A;  2F0U A;  3MVV A;  2KQ3 A;  3T13 A;  1TQO A;  4OL7 A;  1JOK A;  2OXP A;  4K2K A;  4K5W A;  4KD4 A;  2PW5 A;  4NDX A;  2F0L A;  5DAU A;  2F0Q A;  1SNC A;  3D4W A;  5E3F A;  1SND A;  1STH A;  1STY A;  2PZU A;  3ERO A;  4K8J A;  2EYO A;  4KJN A;  5EGT A;  5IGG A;  5KGU A;  5KEE A;  3SK6 A;  3VA5 A;  1F2Z A;  1A2T A;  5C3X A;  2WAC A;  4MIU A;  4E6I A;  2F0J A;  5IGF A;  1EY8 A;  1KDA A;  1A2U A;  3H6M A;  3NUC A;  3EVQ A;  3PMF A;  2F0M A;  3NXW A;  3QOJ A;  4PMB A;  4KHV A;  5HUR A;  3ERQ A;  5CR3 A;  2QDB A;  5E1F A;  4WRD A;  1TT2 A;  2KHS A;  4K5X A;  1EQV A;  4ODG A;  5J22 A;  3S9W A;  2OF1 A;  1A3V A;  1ENA A;  1JOO A;  4NMZ A;  5IGC A;  5IOC A;  2F0E A;  2PYK A;  5CV4 A;  4DGZ A;  5C5L A;  4ID6 A;  4RKL A;  4WOR A;  4F7X A;  5F2D A;  5C5M A;  5CC4 A;  1NUC A;  4J1M A;  2F0T A;  2O4X A;  4IZ8 A;  2F0W A;  4K5V A;  5NUC A;  5CGK A;  1STG A;  4NP5 A;  1SNP A;  5EKK A;  2ENB A;  2PW7 A;  3D6C A;  4DU9 A;  1F2M A;  4K2L A;  1EZ6 A;  2EY1 A;  2RKS A;  3P1H A;  3TP7 A;  5C3W A;  2F0D A;  1ENC A;  5JAV A;  1TR5 A;  3MZ5 A;  2PZT A;  3R3O A;  1SYC A;  2F0F A;  4N9P A;  2EYL A;  3C1E A;  5ISR A;  4HMI A;  3MXP A;  4KD3 A;  3SR1 A;  5CV5 A;  5C4H A;  1EY5 A;  2EYM A;  4EQO A;  4RKB A;  2EY6 A;  5CV6 A;  4F8M A;  3OMC A;  4KY7 A;  3TP8 A;  5KYL A;  2EY5 A;  2F3W A;  2EYJ A;  3HEJ A;  2F0N A;  2F0H A;  4K6D A;  1KAA A;  1STA A;  4EQN A;  5K5P A;  1SYG A;  2HQE A;  3ITP A;  4QF4 A;  5I9O A;  5DEH A;  3BDC A;  1AEX A;  4R8N A;  3DHQ A;  5I6Y A;  5KIX A;  3SXH A;  2EXZ A;  3EJI A;  5IGD A;  3C1F A;  1RKN A;  2F0S A;  1EY6 A;  2F0I A;  3NHH A;  4KV6 A;  3BDL A;  1SNO A;  1JOR A;  4H7B A;  4PMC A;  5CV9 A;  5I9P A;  1KDB A;  2LKV A;  5M9O A;  1EY0 A;  2F0G A;  5I6W A;  3HZX A;  5C6A A;  3MEH A;  3NQT A;  1SNM A;  4HMJ A;  2EY2 A;  2F0P A;  1STB A;  4KTA A;  3TP6 A;  2F0O A;  4EQP A;  3QOL A;  2RDF A;  3MHB A;  4KY6 A;  3LX0 A;  5KRU A;  3OWF A;  3D8G A;  3E5S A;  3SK8 A;  4DFA A;  3TP5 A;  3OMG A;  1A3U A;  2EYH A;  4YIJ A;  1EZ8 A;  2SNM A;  4B9W A;  3U9O A;  5IIF A;  4QB4 A;  5IGE A;  4EVO A;  4K8I A;  4ZUJ A;  2F3V A;  3QB3 A;  1NSN S;  4KJO A;  2OEO A;  4N9T A;  4PNY A;  3TME A;  2NUC A;  4K14 A;  4ME5 A;  4DF7 A;  2PZW A;  1SYD A;  1KAB A;  2F0V A;  5IOD A;  1EYC A;  5EKL A;  4TRD A;  3SK5 A;  4IUN A;  3P75 A;  1U9R A;  3D4D A;  2RBM A;  4S3S A;  3NK9 A;  5J39 A;  2SNS A;  1EYA A; 
#chains in the Genus database with same CATH topology
 3T1Y L;  2OWO A;  1SYB A;  5J1Z A;  5M9O A;  1UE6 A;  4L6T B;  2EYP A;  3HGB A;  4B3S Q;  1VS0 A;  4OEM B;  1EOT A;  5IYC G;  3DMU A;  2B8F A;  5CV8 A;  2JA5 G;  1KDC A;  4ZUI A;  4G57 A;  3SE0 A;  1CKO A;  4Y7N H;  1EY9 A;  2A69 D;  2IJ0 A;  2Q8I B;  2YYZ A;  3ER0 A;  5ELE A;  3U4V A;  1SE2 A;  1X65 A;  4YY3 Q;  5C0X G;  1DON A;  3GTK H;  1UE5 A;  4IJL A;  3JAM L;  4JW0 A;  1L2F A;  1IBL L;  4A3I H;  3CCQ A;  3ICE A;  4OWW B;  4JI4 Q;  5IGF A;  1PHJ A;  5M3M H;  1SAP A;  4IUT A;  1A15 A;  1TWG B;  4BWG B;  4K0K Q;  1TT2 A;  3CC4 A;  3G6E A;  2N3S A;  4LFA Q;  2ZJQ A;  2O2L D;  3GO5 A;  2BDN A;  1N9W A;  1S4Z A;  1JWU D;  2O4X A;  4P72 A;  4I7A A;  1L0Y B;  4LMQ D;  4NP5 A;  2DNE A;  2B2U A;  2PO4 A;  4V19 0;  3C46 A;  2IY5 B;  1YHB A;  3IAY A;  4DK0 A;  4LF7 Q;  3KJP A;  1I4X A;  2EYM A;  4EQO A;  4NW2 A;  1BR9 A;  2L9H A;  2A1A A;  4F8M A;  1F9R A;  3L7Z C;  1K8O A;  1ASZ A;  3TEH B;  3M85 A;  2Z1C A;  3CME A;  4DV1 Q;  2RCF A;  2Q8R E;  2B63 H;  3EN2 A;  3C1F A;  1VQJ A;  1A0I A;  4KV6 A;  1L0W A;  2BH8 A;  3OIP A;  4HIK A;  3PV0 A;  3CCL A;  2BDO A;  5I6W A;  2AQ3 B;  4CDC C;  4DAY A;  3U50 C;  2KHJ A;  1FGB D;  3KBX A;  1KRS A;  4KKT A;  4H44 C;  5GAD C;  4BY7 B;  1NR2 A;  4KLK A;  4DV6 Q;  1JWM D;  3PO2 B;  3NTI A;  3PUX A;  4HID A;  1D8L A;  4KJO A;  1KLU D;  1QVC A;  4AYB G;  5M3F B;  4KHP Q;  4QQB X;  5ELO A;  2VY3 A;  1AN8 A;  1EIY B;  1RHP A;  2B8G A;  2O5J C;  5K36 G;  5C4X B;  1EYC A;  1QUQ A;  4NXM Q;  4O42 A;  1B4O A;  1JB7 A;  1VMC A;  1P8L A;  3PO3 H;  3H3V H;  1S5B D;  1WTW A;  3NPP A;  2NVQ H;  1CSP A;  3W2D A;  4DR4 Q;  1DM0 B;  1TWA H;  1Y1W B;  3K8A A;  4HIO A;  5D3D A;  3H15 A;  1G6P A;  2B3G A;  5E7N A;  3KLW A;  2VB2 X;  3W1B A;  1MGS A;  3K6O A;  2MUY A;  1JJG A;  4G7O C;  1XJV A;  2AQ2 B;  1STH A;  4IUR A;  3KFU A;  2WB1 B;  2ES2 A;  1A2T A;  3TRE A;  1KDA A;  4HAE A;  4O2D A;  3NXW A;  3VYT A;  2M2L A;  1IYU A;  2HDM A;  4A93 G;  3Q8D A;  3TS2 A;  4BY7 G;  1EQV A;  1ENA A;  1JOO A;  4NMZ A;  4FP5 D;  2F0E A;  2N55 A;  1TY2 A;  4FF3 A;  4X66 L;  2H5X A;  4DKA C;  1BVS A;  2BCO A;  3I90 A;  5C5M A;  1QNU A;  5C0X I;  3PO2 G;  1QVG A;  4C3I H;  3X3N A;  4X62 Q;  1ENC A;  4GKK L;  1K3B C;  1YZ6 A;  1VQ5 A;  5C4X G;  3M4Y A;  3I2Z A;  3R3O A;  3T51 B;  5GAG C;  1IYJ B;  3S17 B;  5C4H A;  2R92 B;  1JR0 D;  1VF7 A;  1IXR A;  4FNF A;  1TY0 A;  4RKB A;  5EPK A;  1A6X A;  1W3S A;  3S15 H;  4DK6 C;  1KAA A;  4KKS A;  3K59 A;  1BUV T;  2RHS B;  3IFD A;  4QF4 A;  1E2V A;  1ENF A;  1LTA D;  3EJI A;  2EDG A;  3ND9 A;  5J3B A;  3RMH A;  2LKV A;  3HOV H;  2HD3 A;  3A54 A;  2F0G A;  1I94 Q;  3OWE B;  3R2I A;  1PTO H;  4OXP A;  3PIP A;  1EL0 A;  4DN4 M;  4DR5 L;  1JMC A;  1C0A A;  3MHB A;  2WB1 G;  2RHQ B;  3PF5 A;  4X3T A;  1PZI D;  2XGT A;  3D4R A;  3KF6 B;  4XQJ A;  2F3I A;  3EQL C;  2UUB Q;  1VQE A;  2YV5 A;  5IP7 H;  2A68 C;  1FD7 D;  4Q0F A;  5LMU L;  5IIF A;  2CFM A;  4TVA B;  2IT1 A;  1GHJ A;  1PLF A;  4DF7 A;  4Q5V A;  2CW0 C;  2PZW A;  1TU2 B;  4CDE C;  4JK1 C;  3CQZ H;  2E74 C;  4O0A A;  1RF2 D;  2RBM A;  1SYE A;  3A5U A;  4Y7N B;  3RD4 A;  5IGB A;  1EY4 A;  3K5L A;  5BN5 A;  1TII D;  2EJG C;  1PYS B;  1QJO A;  2RF4 A;  2PQE A;  3I4L A;  1I4G A;  4PMW A;  3BU2 A;  4DV3 Q;  3CC2 A;  2JK8 A;  2HCI A;  1HA5 A;  1CKN B;  3V2T A;  3URY A;  4AIM A;  3J80 c;  5IYB G;  1Q8K A;  4DR3 L;  2QIL A;  4YCU A;  2XSC A;  4FF4 A;  4DR1 Q;  1YHQ A;  5H1S E;  5A2Q E;  2Y0S G;  4ZKC B;  4KJN A;  3TDQ A;  5I2Y A;  1I6H H;  1F2Z A;  2WAC A;  5IT9 E;  1TWH B;  1YEZ A;  2ICI A;  3QOJ A;  3WOF A;  1W2B A;  3I73 A;  4DV7 Q;  1GUN A;  3Q0A A;  5BN4 A;  4BS9 A;  2QDB A;  1IZ6 A;  1V8Q A;  1H9M A;  4K5X A;  1M8A A;  2QGQ A;  1XNR L;  4KN4 C;  1B50 A;  1SE3 A;  1B8A A;  4F7X A;  5NUC A;  5JEA J;  4DNI A;  4RGN A;  1IBM L;  1E24 A;  2UU9 Q;  4XT1 B;  1NMG A;  1KC8 C;  1PH4 A;  4A76 A;  3CCJ A;  4ZAI A;  4B3M Q;  3DXJ C;  5DM7 3;  2EYL A;  3FKI B;  4CJ2 C;  5ISR A;  1YIT A;  2B63 B;  3S14 B;  3F1Z A;  5AJ3 Q;  5FOB B;  4KY7 A;  1FGU A;  2EY5 A;  1SRU A;  2EYJ A;  5GAE C;  2K14 A;  1LT3 D;  1K3R A;  2Z4I A;  1Q86 C;  1UEB A;  1SYG A;  4DR7 Q;  1SDF A;  4R8N A;  5LL6 S;  2OTL A;  4AQY L;  1OXV A;  1KRT A;  3CCS A;  1GUW A;  1RKN A;  4UY8 C;  1PFB A;  1XTC D;  5CV9 A;  1KDB A;  1X6O A;  1B3Q A;  4LK1 C;  1HPC A;  5M3M G;  1SJE D;  1NAP A;  4MNO A;  1EFI D;  3NE5 B;  2WAQ E;  5T1G A;  3PIP 3;  2F0P A;  1C9O A;  2UXB Q;  4G7Z C;  3D8G A;  4M8A A;  1AE2 A;  1GUS A;  4DV5 Q;  2JN4 A;  1K9M C;  3S2D H;  3CU7 A;  4DV2 Q;  1DYQ A;  1XMO Q;  1U4P A;  2TSS A;  4YWK A;  2VUM H;  1R4Q B;  4JI6 L;  3TBI B;  2NVQ B;  1Y8P B;  2WKD A;  1MIU A;  1S5D D;  1I50 B;  1TWA B;  3P75 A;  1C7Y A;  1DGS A;  5CBE E;  1S3O A;  4HSP A;  4JI2 L;  1RDP D;  3CCV A;  4J6H A;  3FKI G;  3SK4 A;  2B63 G;  1MJE A;  3P20 A;  2IX0 A;  3J81 c;  4YHH L;  1X3F A;  3PQI A;  2F03 A;  1YJN A;  3MXU A;  1JT8 A;  2HDL A;  5M5W H;  1LT4 D;  1DOK A;  1PH5 A;  4K5W A;  4K2K A;  3H3V C;  1PFS A;  2PW5 A;  3P7J A;  5DAU A;  4JI7 L;  3NSW A;  1XWE A;  3ERO A;  5CYU A;  5EGT A;  4JI1 Q;  2DY7 A;  1ONL A;  2ZM6 Q;  2JEA I;  1LTR D;  4HMI A;  3PMF A;  3HKZ B;  4A75 A;  3K0X A;  3HOY B;  1BBU A;  4C3I B;  1D2B A;  2SDF A;  2BH2 A;  3GTO H;  1SR3 A;  2MFI A;  1CSQ A;  2KCM A;  5T1I A;  4DGZ A;  5JVG 3;  4LF9 L;  4DA2 A;  1GM5 A;  5FLM H;  1DCZ A;  2A6E C;  4K5V A;  3QR8 A;  1QVF A;  5CBA E;  1PH8 A;  1LLR D;  3VYU A;  3PO3 G;  1MKH A;  2D5D A;  3S15 B;  5KNC A;  2Q8T A;  2LFN A;  4ZRZ A;  1SYC A;  2FFK B;  4A3D H;  3GP7 A;  3SEB A;  4GOP A;  1EY5 A;  3I72 A;  1I4P A;  4L63 B;  3RLN A;  3UDF A;  3OMC A;  1SMY C;  1WTH A;  4APV A;  3HOV B;  2KJX A;  1IW7 D;  3W3A A;  1Q81 C;  3E0J A;  2F52 A;  2EXZ A;  2F0I A;  4RWS C;  1LTG D;  3I4N B;  4XYQ A;  4WJW A;  2RSN A;  1FYC A;  1T5X D;  3VDY A;  1TWG H;  4IPH A;  2NN6 H;  3T1Y Q;  4UP8 A;  2MGS A;  1GXD C;  2DY8 A;  1N33 L;  1ESR A;  2ZT9 C;  1ROD A;  4A3B B;  4IPC A;  2CCZ A;  4JV5 Q;  3U9S A;  3PUY A;  4H13 C;  1YJ9 A;  4C3I G;  4EVO A;  2WII B;  1SE4 A;  3QB3 A;  1NSN S;  4JOI C;  1PTO C;  3KDF A;  2L0C A;  1X32 A;  4RGM A;  4XT3 B;  1O7Z A;  4X6A H;  1OXU A;  2K32 A;  1IBL Q;  3SK5 A;  3BVG A;  1EYA A;  4I65 A;  3NBH A;  1TWF H;  2DGY A;  2IX3 A;  3KBG A;  2QDL A;  2A6H C;  3DEO A;  1QNK A;  3NWS A;  2RDH A;  2X69 A;  4OX9 Q;  2BOS A;  3OIQ A;  5HGT A;  1SNQ A;  2I07 B;  3HOV G;  2RQX A;  3GTP B;  1HNW Q;  1VQ8 A;  3IKJ A;  4R4I A;  2B2T A;  1VQO A;  1T5E A;  1TQO A;  5JPN C;  1GUG A;  2OXP A;  3HRZ C;  4CBV A;  1PH2 A;  2F0Q A;  5DLQ E;  2KEE A;  4POG A;  3CHB D;  4V0B A;  3PF4 A;  5IP7 G;  4E6I A;  2G9H D;  5M3F H;  3M4O B;  3NUC A;  2E5L L;  1D7Q A;  1Q3L A;  1PRT D;  1Q7Y C;  2VXW A;  4DV4 L;  4R4T A;  3GTM H;  2DJF C;  1UWV A;  1QIL A;  3M4Q A;  3PIO A;  1E3P A;  1J9O A;  2GN5 A;  2LXK A;  2FHT A;  4WFN 3;  1BBW A;  4DU9 A;  2NZH A;  1EWI A;  1LTB D;  4CGY B;  5C44 H;  1HQR D;  1Y1W H;  1S5C D;  4FXD A;  3FEW X;  3HFZ B;  3MXP A;  2ICE C;  4RG1 A;  2EY6 A;  1KQS A;  1G91 A;  1O7I A;  3L9A X;  1G2T A;  1L1O C;  1HQM C;  2F0N A;  1FNV A;  1U4R A;  3HOZ B;  3GQB A;  2DUD A;  4PV1 C;  2B2W C;  4HJA A;  2QW7 A;  3H3V I;  3CXC A;  2A73 B;  1XPU A;  3KF8 B;  1RJT A;  4P71 A;  2LY7 A;  3T1H L;  2P5Z X;  4P73 A;  2Z8L A;  4GKJ L;  1JJ2 A;  2EY2 A;  1E7Z A;  3QWN A;  2VQE Q;  5KRU A;  3UE0 A;  3A8I E;  4HR7 B;  4B08 A;  2R7Z B;  5C0X J;  4QB4 A;  2QCP X;  2F3V A;  1Y14 B;  3G71 A;  4JOI A;  3OTO L;  3S17 H;  2R92 H;  2K01 A;  3KOJ A;  5IOD A;  5EKL A;  3BJU A;  1E1O A;  3F2U A;  4IUN A;  1AH9 A;  4IN3 A;  2UXD L;  1O80 A;  2E75 C;  2R7F A;  1Q90 A;  4KKU A;  4C56 C;  1F2Y A;  3A7A B;  5M5W B;  3MA2 B;  4GN5 A;  4CKE A;  3GD7 A;  4B9X A;  5E4X A;  1W6K A;  5KYI A;  4IFD G;  3N6R A;  2JYO A;  1Q8I A;  1HNX Q;  1BCP C;  2HQL A;  4POF A;  1J6Q A;  5KEE A;  1E2Z A;  3J7Y W;  3M4P A;  1CFM A;  1N8R C;  1VQ9 A;  2K05 A;  3WDN A;  1VQG A;  1LAC A;  2UUC L;  2K5D A;  2VUM G;  1M90 C;  3X3M A;  5CV4 A;  1V1Q A;  4IUV A;  4OHJ A;  4A3D B;  4RKL A;  4U68 A;  4WOR A;  2CQA A;  3PIO 3;  1OTC A;  3STB D;  4GNX B;  3GDE A;  4LF6 L;  2ATW A;  2EZV A;  1YNX A;  4DR5 Q;  2JEB I;  2F4V L;  3OHX C;  2OTJ A;  2JA9 A;  1WCM H;  2Q2U A;  3K5O A;  2LSS A;  2Q2H A;  1QG7 A;  1YNN C;  1FJG Q;  1VQ6 A;  1L1O A;  2CH4 W;  3NEL A;  5FO7 B;  3OW7 A;  2D62 A;  3ITP A;  1N34 L;  2IX1 A;  3K7U C;  4C1N K;  3FPU B;  4DUY L;  1TWH H;  4JBW A;  3M9B A;  5FLX c;  1OXT A;  1PRT F;  4O1N A;  4H02 A;  4GNX C;  1AP0 A;  3OOC A;  5LL6 X;  4IUP A;  1WI5 A;  3K7A H;  5A2Q L;  4L5Q A;  3I91 A;  2RVL A;  4RH6 A;  4X65 L;  5IT9 L;  2JJQ A;  5FLM G;  1SFO B;  3HOW B;  2SNM A;  1NJI C;  4DV0 L;  4RFB A;  5ELD A;  3FKI H;  1B44 D;  1TWF B;  4DR3 Q;  5IE8 A;  3S14 H;  2NUC A;  4K14 A;  3T53 B;  1AE3 A;  4LF4 L;  1DOL A;  4A3D G;  4ZK9 B;  2XVS A;  4X3K A;  4IQZ A;  4AYB E;  3D6W A;  1X3P A;  3U4Z A;  5ELB A;  4G7H C;  2L15 A;  2QKI C;  1ML0 D;  5CV7 A;  4LF8 L;  1JOQ A;  1J5E L;  5JEA H;  4X3S A;  4BBS H;  3I4O A;  3UDG A;  4WJ3 M;  2A8V A;  3VR2 A;  2VL6 A;  1UEA B;  4A3G H;  2HIX A;  4NKL A;  1DJR D;  3GTG B;  3SHL A;  2KOL A;  5DNF A;  1Q1B A;  5LMN Q;  1IBM Q;  4UP7 A;  1HXY D;  2NN6 G;  3RN2 A;  4QCL A;  1CHP D;  4QGU A;  4HJ9 A;  2EE1 A;  3I7F A;  1NCV A;  4K8J A;  1SRO A;  3GTM B;  1XMQ Q;  1QE6 A;  2E8G A;  4H0L C;  4EQ5 A;  3M7G A;  1HHV A;  3KLS X;  4X64 L;  2WV6 D;  3DWQ A;  4DR6 Q;  3CCU A;  4MHE A;  1N32 L;  5JJL A;  3S9W A;  1I50 H;  4AQY Q;  4OGQ C;  5C44 B;  4JBM A;  3V96 A;  1D1I A;  4ID6 A;  1LT5 D;  2PQA B;  1EIG A;  2E2J H;  5CC4 A;  1VQ4 A;  1VMP A;  1SNP A;  1B9M A;  3E0E A;  1N36 L;  1EZ6 A;  3JAM c;  1PFN A;  2HHH Q;  3F2B A;  4PZ7 A;  2PZT A;  1PV4 A;  4A3K B;  4JBK A;  1Y69 U;  1GVP A;  2L12 A;  5M5Y B;  4JI3 L;  2HUG A;  4ZYS A;  3W5O A;  3UDX A;  3K58 A;  4IPG A;  5FLX E;  2ZXP A;  4JBJ A;  2XRS D;  2ZJP A;  2D2C C;  4JI6 Q;  3FPP A;  2Z0S A;  3SGI A;  3SXH A;  1GUT A;  3BYT B;  4JYA L;  2PI2 E;  1VQL A;  5I9P A;  4DR2 Q;  3HOY H;  3I4M B;  4GNX A;  2KVM A;  4JI2 Q;  5M3F G;  3SDZ A;  4BBR B;  2YTY A;  2VZA A;  3Q6S A;  3QOL A;  1EU3 A;  2RDF A;  5JVH 3;  1K73 C;  2JA6 H;  1LTS D;  3ONA B;  3E5S A;  3H0G B;  4HIM A;  1BBX C;  3AEV A;  4YHH Q;  1A3U A;  4JI5 Q;  2V1C C;  5IY0 A;  3E6Z X;  4DXG A;  3LWE A;  5COR A;  1CQV A;  2WB1 E;  1EU4 A;  3EBE A;  5CMD A;  4K8I A;  1VQP A;  1G51 A;  4IOC A;  3J80 i;  5C44 G;  1Y1W G;  1WTR A;  3IRB A;  3Q24 A;  1WTQ A;  2CVR A;  5J39 A;  4HCE A;  4KY5 A;  4RHR A;  1PXU A;  4OON A;  2M00 A;  1HRJ A;  1NE3 A;  4A3K G;  2SOB A;  3I4N H;  1TKW B;  1ILP A;  2F0K A;  1WTV A;  4LFB Q;  4LF9 Q;  2OQK A;  5IWA Q;  4GN3 B;  2Z6K C;  3SVM A;  4ZCK A;  1JWS D;  1WTO A;  3CP0 A;  1JOK A;  4OL7 A;  4A3B H;  2F0L A;  1YIJ A;  1EIH A;  4B9W A;  4YY3 L;  4P75 A;  3BG3 A;  1PH7 A;  4RHS A;  1K83 B;  3J7A 5;  2UXC L;  4BBR G;  1A2U A;  3T16 A;  4HJ8 A;  4R9W A;  1QZG A;  2Y0S E;  1MBY A;  2R92 G;  2NN6 I;  1K8A C;  2AUJ D;  3DLL A;  5JPM C;  4LFA L;  1WCM B;  3GV6 A;  4IZ8 A;  5EBD A;  5C4J H;  2PW7 A;  2EY1 A;  3P1H A;  3TP7 A;  4QIW E;  3TS0 A;  2I5H A;  1VQK A;  1JQY D;  4UAI A;  2B2V C;  3GTP H;  1G29 1;  2EXD A;  4DXF A;  2IHF A;  3MXG A;  1HR0 Q;  4FF2 A;  4GZY C;  3J81 L;  2XTI A;  1S72 A;  5K5P A;  2PI2 A;  5E4W C;  3BDC A;  3NQI A;  3DHQ A;  5FO9 B;  4R4Q A;  3M4O H;  2KCT A;  1CHQ D;  3K7A B;  3BDL A;  1RD9 D;  1JOR A;  1E0B A;  1HZB A;  1DOM A;  1GUO A;  1H9S B;  2D0P A;  5BN3 A;  3NQT A;  2K04 A;  2ZTD A;  3CAM A;  1TS5 A;  5LMN W;  1X9N A;  4OWT B;  1H95 A;  1RCV D;  1X56 A;  4UP9 A;  3CCM A;  1XX8 A;  2IWH A;  3TP5 A;  3J81 i;  2WAQ B;  1KNA A;  3S24 A;  4ABN A;  4DV6 L;  5EJW A;  4DK1 A;  4KK7 A;  4BBS B;  1KAB A;  4LUV A;  2F0V A;  1WCM G;  2LS0 1;  2A6E D;  4IFD H;  3NEN A;  4NXM L;  1VQB A;  4DAV A;  4A3G B;  5LHY 1;  3HOZ H;  4S3S A;  3PGZ A;  2E5L Q;  4OIK A;  1UE1 A;  1M1K C;  4ZQ3 A;  3EIV A;  1ZYR D;  1XNQ Q;  5BR8 L;  3H94 A;  2WFW A;  2OT2 A;  4QL5 A;  4HTH A;  3I70 A;  4DR4 L;  4JI0 Q;  2E2H B;  2Z6K A;  4HN7 A;  1IL2 A;  1CM9 A;  2NTS A;  2KQ3 A;  4L5S A;  4KD4 A;  1O7Y A;  2A5H A;  5KNB A;  4XQN A;  3D4W A;  5E3F A;  2BE5 D;  3GTQ B;  1LTI D;  2R7Z H;  3MC0 B;  1I3Q B;  3VA5 A;  1R4P B;  2E2J B;  1EQT A;  1HUM A;  4NB3 A;  2KCC A;  1NY4 A;  2UUA L;  3ERQ A;  1HFG A;  1B1Z A;  1SJH D;  4JG2 A;  2CH4 A;  1M4V A;  3KF6 A;  5IGC A;  1D5Z C;  3J80 E;  3NEM A;  1FNW A;  1IL8 A;  3CRL C;  4F87 A;  2WAQ G;  2FXQ A;  4B3T L;  3T1H Q;  3RN5 A;  4GKJ Q;  4RGT A;  2ZXR A;  1JE4 A;  5JEA G;  4BBS G;  1VF5 C;  4RGO S;  1PZK D;  1JB3 A;  2GVB A;  3SR1 A;  3F2C A;  4A3G G;  1IKM A;  5CV6 A;  1YNJ D;  3S1Q B;  5IYD H;  1CZW A;  2MO0 A;  2XNA C;  2F3W A;  3DUZ A;  2F0H A;  3QG1 A;  1MJC A;  3LGJ A;  2RCN A;  1GOZ A;  2A6H D;  1JCK B;  3DWP A;  1VQH A;  2A74 C;  4KMU C;  5KIX A;  2PMZ B;  2B39 A;  3KLS A;  1VCI A;  3KK7 A;  3VR4 A;  4LJZ C;  2K28 A;  3NHH A;  4FYD A;  1KD1 C;  1CKN A;  2JA6 B;  2G9D A;  2UXD Q;  1WJJ A;  4FVM A;  3L2P A;  3K5N A;  2AMC B;  1SNM A;  4HMJ A;  3H09 A;  3MEF A;  1STB A;  4KTA A;  1Y8O B;  3A8J E;  4C2M H;  4KY6 A;  1F77 A;  4OO1 H;  1HJP A;  4BXX H;  1V1P B;  1VQC A;  4X3U A;  4CHT B;  1I4Q A;  3C3L A;  1QWY A;  5D65 A;  1GD7 A;  3I3C A;  1LTT D;  2HCC A;  4JI8 Q;  4A3E H;  2SEB D;  3KJO A;  3DM3 A;  1D1K A;  4XTC S;  1WD1 A;  3DWA A;  1EEI D;  1U4L A;  4DUZ L;  2EVB A;  3U58 A;  1VQM A;  1UUP A;  4R4C A;  5EQ0 A;  1H9R A;  3A7L A;  1EQQ A;  1BQQ T;  3NP8 A;  1J8I A;  3HS0 C;  2N88 A;  3HKZ G;  1B2T A;  4IJH A;  4LAA A;  3HOY G;  4J15 A;  4TKO B;  4R8I A;  2TMP A;  3KUP A;  2I0Q A;  4HED A;  1MI2 A;  3CD6 A;  2F4V Q;  4OEL B;  1SFO H;  3HOW H;  2Z4H A;  4EGV A;  1KNE A;  1CUK A;  2JA6 G;  4DR1 L;  1NR4 A;  3NWT A;  3S1M B;  3J81 E;  4XIG S;  2F0M A;  4FDB A;  5C4J B;  4DV7 L;  5E1F A;  3R2T A;  1N34 Q;  4PQX A;  2OF1 A;  5C3E B;  1EQR A;  1E2W A;  1FVI A;  5CGK A;  5EKK A;  1IBK L;  1EFW A;  4MZ9 A;  4A3J B;  1GJX A;  1HZC A;  1X3G A;  1NBW A;  3I4N G;  3GTG H;  1ESF A;  1SXT A;  2EOT A;  2NB0 A;  4B3M L;  3KLR A;  1KL9 A;  1HZA A;  4X65 Q;  3E9I A;  3FP9 A;  4OWX B;  3TP8 A;  5FJ8 H;  5AJ3 L;  3KYH C;  1PFM A;  2ZJR A;  4K6D A;  4QY7 A;  1QB5 D;  5EBC A;  4A3B G;  1JC7 A;  4LF4 Q;  2X6L A;  2QF7 A;  1RTO A;  3TN2 A;  3EFX D;  4GS3 A;  2I46 A;  1WYD A;  1CT1 D;  2ASB A;  2OQ0 A;  3MEH A;  2E2D C;  1A8V A;  1J5E Q;  1VQN A;  3HKS A;  3TP6 A;  3A56 A;  1ASY A;  1BOS A;  1IW7 C;  4TSS A;  4XYO A;  3CKI B;  1G8Z D;  1YVC A;  4NXN L;  2EYH A;  4P2C B;  2R93 B;  5GQO A;  1PTO F;  4L8J A;  3MXN B;  4ZUJ A;  4A3K H;  4IUQ A;  4DV2 L;  3CMA A;  4N9T A;  1XMO L;  5M5Y H;  5C3E G;  1BXT A;  4ZLT F;  1ET9 A;  4MTK A;  1LV9 A;  4UDU C;  5JJI A;  1U9R A;  3NK9 A;  2FMC A;  3S1R H;  5JOB A;  1NTG A;  1JJC B;  3I4M H;  3CRK C;  3BVM A;  1KHI A;  4LFC L;  1EYG A;  4BBR H;  5G3L F;  5KND A;  3HOU B;  1A3T A;  3AQQ A;  5FLX L;  3I56 A;  2EQS A;  3CW2 C;  3ZYY X;  1B70 B;  1PRT B;  3H0G H;  1PVO A;  4DAY B;  4CJ0 B;  1CKM A;  3O13 A;  2IHE A;  2MJ8 A;  4JI3 Q;  3G7L A;  2Q2T A;  3L3O C;  1UNS A;  3HOX H;  2ZM6 L;  5HUR A;  1GKH A;  4N8X 1;  1BO0 A;  4B3R L;  4J8Q A;  1VQI A;  2KHS A;  1HCZ A;  1YBY A;  5GAH C;  1A3V A;  3E3X A;  4X66 Q;  2YU9 B;  1HNZ L;  5C5L A;  4LWC A;  4JYA Q;  1NUC A;  1QUQ B;  3HOZ G;  1YI2 A;  4A3C H;  3V05 A;  4GKK Q;  2DN8 A;  1PMR A;  1HUN A;  1H9K A;  4KHZ A;  3BDO A;  4IUU A;  4PG3 A;  1R9T B;  5L37 A;  1F9P A;  5KYL A;  1TS3 A;  3FHW A;  4GLV B;  4C3J H;  1AEX A;  1NMF A;  1K83 H;  1SMX A;  4C2M B;  2FMM A;  1EWH A;  3J81 j;  2R7Z G;  1EY6 A;  3J7A V;  3ULP A;  1SNO A;  3Q22 A;  1HFN A;  2AWO A;  1VQD A;  1EWC A;  2X6G A;  3R8B A;  1TS2 A;  2R6G A;  1YHA A;  3IL8 A;  1K28 A;  2V4D A;  1HA6 A;  3ZJY C;  3TSS A;  1HTP A;  2EPB A;  4A3E B;  3ULJ A;  5LMU Q;  3AB9 A;  3E9H A;  1LAB A;  2ALY B;  1F9Q A;  4JV5 L;  1I4H A;  4TQU S;  2K6A A;  2JA8 H;  4BA2 I;  2B2W A;  3TME A;  5JJK A;  3QJY A;  2MQH A;  4LW1 A;  3D0F A;  1XTD A;  3BZK A;  5IYD G;  2UXC Q;  3TRZ A;  4C3H H;  4FF1 A;  1ICW A;  3OSO A;  2K75 A;  2I5M X;  1AZP A;  3G6J B;  2L11 A;  1PA6 A;  1K0S A;  2CWA A;  4QMG A;  4AYB B;  3S16 H;  4R4O A;  4OX9 L;  1TWC B;  4LNQ A;  1KLG D;  3ND8 A;  3UE1 A;  1BCP F;  1B9N A;  1HNW L;  3MXN A;  4JVZ A;  3AMU A;  3D3R A;  5EKI A;  2DNC A;  3VYR A;  3K0Y A;  2XIW A;  2O5I C;  4N8F A;  3JAM i;  2MHV A;  2PZU A;  5IGG A;  4OO1 G;  3GTJ B;  1ET6 A;  1Y8N B;  3KF8 A;  2NZ1 D;  5KGU A;  4BXX G;  2B2Y C;  1V43 A;  3GV3 A;  1LO5 D;  2VQF L;  1VQ7 A;  2A19 A;  2NVY H;  4PMB A;  1Z6H A;  1VQF A;  5CR3 A;  3VA7 A;  2HIV A;  4A3F H;  1XNR Q;  2QEJ C;  1SLJ A;  3BVZ A;  1RIP A;  5J22 A;  3RNU A;  4A3E G;  1MSH A;  3BZC A;  2JQO A;  5EPL A;  2RSO A;  3BZD B;  2VW9 A;  2VB3 X;  1WD0 A;  3N52 A;  3J7A F;  1C4Q A;  3QO2 A;  2EJM A;  1CZG A;  1ICF B;  2E2H H;  1S5F D;  2JP1 A;  4A93 B;  5JJZ A;  2KUM A;  3MTS A;  3H91 A;  4LF5 L;  5I2X A;  4IFD I;  3STB C;  1PZJ D;  2QEX A;  2A69 C;  2VNU D;  3GTQ H;  5I9O A;  2NVT B;  3RLF A;  1I3Q H;  2XWJ B;  1SEB D;  3HOW G;  5I6Y A;  2K5W A;  3MWY W;  2A68 D;  2PCF B;  5IGD A;  4A4I A;  3UI2 A;  3QIA A;  5M5X B;  1MD2 D;  2K52 A;  1OO9 B;  5C6A A;  5HGQ A;  1PYB A;  1PH3 A;  2CW0 D;  3A8K E;  5A35 A;  2OCE A;  3D31 A;  4EQP A;  5BR8 Q;  3J7Z C;  4CJ1 B;  2CKZ B;  3EA6 A;  3SK8 A;  2H1E A;  3OMG A;  4M1U B;  2VQE L;  1Y1V H;  3U9O A;  3OYY A;  4DAM A;  3CPF A;  4LUZ A;  2Q2I A;  2Z9H A;  5EPJ A;  3S1R B;  3J80 L;  3S1N B;  3S1Q H;  1A62 A;  1U0L A;  1LUZ A;  4A3L H;  2RDG A;  2IL8 A;  1O78 A;  2JA7 H;  1Z7T A;  2SNS A;  4AH6 A;  3C2P A;  4MTN A;  5FJ8 G;  2UUA Q;  1K0R A;  4UHV A;  5ELN A;  3TZD A;  1STN A;  3VR6 A;  1KAW A;  3GTL H;  4JPB W;  2I5L X;  5IT9 c;  2L55 A;  3A5Z B;  2KEN A;  4HJ7 A;  3I8Z A;  1QCB D;  1K8G A;  1W6J A;  2YTX A;  4B3T Q;  4MN3 A;  2F0U A;  3HOX B;  4A3M B;  1WTX A;  1JIC A;  4JI7 Q;  2AUK A;  2XN9 C;  1V9P A;  2CWP A;  1HNX L;  2VS1 A;  2B2Y A;  3SK6 A;  4F88 A;  5C3X A;  1X55 A;  3AFP A;  1EY8 A;  3EVQ A;  4GLX A;  1SBB B;  1UE7 A;  2J4X A;  3F8T A;  4UPA A;  2NVX B;  4ODG A;  4NPS A;  4XDX A;  4B3S L;  4BY1 H;  4RAU C;  1D5M C;  2KCN A;  3WWV A;  3K5M A;  3AU7 A;  2C9O A;  2E2I H;  4J1M A;  1AZQ A;  1Z47 A;  2Y0S B;  3D6C A;  4ILW A;  4HJ5 A;  4R1J A;  4OO1 I;  2J0T D;  4QJF A;  1FR3 A;  1MHW C;  3A55 A;  2NBF A;  3BYY B;  2Z6B A;  4C3J B;  4K6L A;  1WVL A;  3I4M G;  3A74 A;  3MFY A;  4KD3 A;  5CV5 A;  3ULL A;  1AFP A;  1BKB A;  2C35 B;  4JI4 L;  4EX5 A;  5IP9 H;  4QIW B;  3I55 A;  1FJG L;  1LYL A;  2F1M A;  1JE5 A;  4K0K L;  3H0G G;  2R3Z A;  1DXM A;  3M3Y H;  2EIF A;  1STE A;  3PCO B;  1B53 A;  4L5T A;  3JAM E;  3S1M H;  4H7B A;  4PMC A;  4DUZ Q;  4U67 3;  3HOX G;  3HZX A;  4A3M G;  5D14 A;  4YCV A;  5C3E H;  5AFW A;  1N33 Q;  2JA8 B;  4CKB A;  4KN7 C;  1Q82 C;  4LF7 L;  3TQY A;  1FL0 A;  1ZXT A;  3CF5 A;  4A3J H;  1SSO A;  4YIJ A;  3GTK B;  1EZ8 A;  5FO8 B;  4A3C G;  1XXG A;  2N49 A;  4A3I B;  1B7Y B;  4C3H B;  4DV1 L;  5M3M B;  4PNY A;  1O7L A;  4ME5 A;  2NTT A;  1SYD A;  3LNN A;  2PQA A;  4P74 A;  1E22 A;  2ZTE A;  4TRD A;  3G4S A;  2AKW B;  1CA5 A;  2FIN B;  2MNA A;  4GOP B;  3S16 B;  1S40 A;  1C8C A;  1ILQ A;  1Z9F A;  4C3J G;  2EYF A;  2L5T A;  4XXE A;  3FMC A;  1EY7 A;  3DM1 A;  2R7D A;  1RTN A;  1IHZ A;  3NTH A;  1GHK A;  1UAP A;  1IBK Q;  5LMN L;  2NVY B;  1QOH A;  4KHP L;  3PUV A;  1U4M A;  4ZKB B;  4A3F B;  2HT1 A;  2R93 H;  1SND A;  2KEC A;  1G6Z A;  1TVX A;  2WKC A;  4GOP C;  1HTL D;  1EOV A;  3H6M A;  1XMQ L;  2JA8 G;  2L4N A;  4KHV A;  1Q12 A;  4CDF C;  4DV4 Q;  2K33 A;  3CCE A;  1X3Q A;  4WRD A;  4L5R C;  2IW3 A;  4DR6 L;  2D9U A;  4Y52 H;  1IKL A;  1OXS C;  3F2D A;  5TSS A;  1SMY D;  3KDF B;  1VQA A;  2D0O A;  1PH9 A;  1RL2 A;  4HSV A;  2PPB C;  4A3I G;  3S2H H;  2K7V A;  4C3H G;  4LUO A;  4IO9 A;  1PH1 A;  3NBH B;  5ELF A;  4HCS A;  2YTV A;  3MAQ A;  1XPO A;  4N9P A;  2HHH L;  1U5K A;  1PYW D;  3HOU H;  5ELC A;  5I4D A;  4NXN Q;  2K50 A;  3B6Y A;  3WOE A;  1EUJ A;  3HEJ A;  1DD2 A;  3RZD H;  1AW7 A;  3DEP A;  3PO3 B;  4DAP A;  3M7N A;  3VR3 A;  1ZKO A;  5IYC H;  2JA5 H;  5FK9 C;  2DJG C;  2MO1 A;  2K4K A;  4DR2 L;  1ZEQ X;  2GVA A;  1Y1V B;  2YU9 H;  3K81 C;  1PTO D;  1BNZ A;  4X62 L;  4A3F G;  2B2V A;  1SN8 A;  5C0X H;  1I6V C;  1PDQ A;  2CHB D;  3UDI A;  3NTK A;  2E76 C;  4LFC Q;  1E1T A;  3OWF A;  2K5V A;  4JI5 L;  2KED A;  2MP1 A;  3NBI A;  1FNU A;  3FVQ A;  3OTO Q;  2JA7 B;  1KXL A;  2AHO B;  2RA4 A;  1OXX K;  4JC0 A;  1R9T H;  2B2T C;  1EEF D;  3L0O A;  3GTL B;  2MPM A;  3K57 A;  2KBN A;  1I94 L;  2AWN A;  5G3L D;  3FRP B;  1SYF A;  4ME3 A;  4B3R Q;  3RZO H;  1I5F A;  2BA0 A;  2LXJ A;  3VYS A;  1HNZ Q;  1QZH A;  5C4Z A;  1MSG A;  2C5C A;  4LFB L;  2UUB L;  3W1G A;  2NYZ D;  1II3 A;  5IWA L;  1LT6 D;  3G48 A;  1SE8 A;  1LTL A;  3IFT A;  3HKZ E;  1ZYR C;  1KIX A;  1STY A;  1WFQ A;  4BY1 B;  2PMZ E;  1Y1V G;  1H9S A;  2F0J A;  4YCW A;  3RLO A;  2E2I B;  4FO2 A;  4JCV E;  4YWM A;  2UUC Q;  2CQO A;  2NWG A;  5EAY A;  1PTO B;  2PYK A;  4OIJ A;  4A3L G;  1Q1E A;  2XRQ D;  1G2S A;  5F2D A;  2F0T A;  2JXM B;  2F0W A;  4DNT B;  4DV3 L;  2L1B A;  2BE5 C;  4LF6 Q;  2JA7 G;  4RCN A;  2ENB A;  2XWB B;  4BA1 I;  4K2L A;  1HR0 W;  1TWC H;  4GN4 B;  4KI0 A;  3FDT A;  3AFQ A;  3C1E A;  5K36 H;  1CTM A;  2NZO A;  4I7Z C;  4RCO A;  3M3Y B;  3CQZ B;  3T56 B;  3ERS X;  1HR0 L;  1BF4 A;  4EQN A;  1X3E A;  1STA A;  3BS1 A;  1GO3 E;  1IYV A;  1LM0 A;  2HQE A;  3GTJ H;  5DEH A;  4DUY Q;  1DZ1 A;  3PUZ A;  1F9S A;  2B29 A;  3A0J A;  4RMF A;  1C48 A;  2K5N A;  3OW2 A;  2UU9 L;  2JSO A;  1CA6 A;  1YNJ C;  1WOC A;  4Z9C B;  4ALP A;  2WIN B;  2F4I A;  5GRO A;  4BY1 G;  3LX0 A;  1F2L A;  1D6E C;  2EJF C;  2ZXO A;  4DV0 Q;  5HY6 A;  1P16 A;  1YJW A;  1I6H B;  1CK1 A;  5IGE A;  1K8M A;  2GA4 B;  1CQF A;  4A93 H;  4DR7 L;  4BY7 H;  1BDO A;  1PH6 A;  4YWL A;  3Q23 A;  1Q46 A;  1EIF A;  3CPW A;  4C1N I;  2VQF Q;  3PO2 H;  3D4D A;  4LF8 Q;  5IP9 G;  2NVT H;  1BCP D;  1L1O B;  3AYH B;  2R61 A;  3K80 C;  3RUZ A;  4DK3 C;  4FXK C;  1XPR A;  4IAL A;  4IFD J;  5C4X H;  1XNQ L;  2UXB L;  4PZ8 A;  5M5X H;  1T9H A;  4DV5 L;  4G4K A;  4JI0 L;  2N78 A;  4QUF A;  1EYD A;  1HH2 P;  3MVV A;  3T13 A;  4XQQ A;  4GLA C;  4NDX A;  1XYI A;  2ZTC A;  1SNC A;  4IPD A;  2EYO A;  4A3J G;  1L0X B;  2K1B A;  4MIU A;  4X64 Q;  3R93 A;  4LF5 Q;  2PNH A;  3S2H B;  3S1N H;  2PNR C;  1N32 Q;  5DM6 3;  1TXY A;  2H4O A;  1VDZ A;  5IOC A;  1V1P A;  1YNN D;  4FXG C;  1V1O A;  5D3I B;  1N36 Q;  1STG A;  2G5D A;  4DNR B;  1F2M A;  2K5Q A;  1S5E D;  2B2U C;  2RKS A;  4QUC A;  5C3W A;  3S2D B;  2F0D A;  2N8N A;  3LWU A;  3RZD B;  5JAV A;  1TR5 A;  3MZ5 A;  1NNX A;  2F0F A;  2LMC B;  4JI1 L;  2VUM B;  2FJ2 A;  2JA5 B;  3HP3 A;  4A3M H;  4RA8 A;  1I4R A;  1BCP B;  1HZ9 A;  1TS4 A;  2R93 G;  2F0S A;  1KTK A;  4CKC A;  2KA7 A;  4WJ4 A;  3PSI A;  5FKA C;  4CDD C;  1EY0 A;  2NVX H;  2IPK D;  2J7Z A;  2BA1 A;  1PRT C;  2AQ1 B;  3CC7 A;  5IYB H;  3OPO A;  2F0O A;  1X54 A;  3CCR A;  1A63 A;  3PUW A;  4DFA A;  2M9V A;  2WP8 J;  2K03 A;  1WTP A;  4PZ6 A;  3VR5 A;  2JE6 I;  3TZU A;  2QA4 A;  1H9J A;  2OEO A;  3MFG A;  4IOA A;  3RR5 A;  2ID0 A;  3JC6 6;  3T4A C;  3RZO B;  2KHI A;  2K5H A;  4JI8 L;  4ULL A;  3HOU G;  3GTO B;  1CI3 M;  1D5X C;  3HG9 A;  4DPG A;  5COY A;  1B3A A; 
#chains in the Genus database with same CATH homology
 1SYB A;  5J1Z A;  5M9O A;  4L6T B;  2EYP A;  3HGB A;  1EOT A;  3DMU A;  2B8F A;  5CV8 A;  1KDC A;  4ZUI A;  4G57 A;  3SE0 A;  1EY9 A;  2A69 D;  2IJ0 A;  2Q8I B;  2YYZ A;  5ELE A;  1SE2 A;  5C0X G;  1DON A;  3JAM L;  5IGF A;  1SAP A;  4IUT A;  1A15 A;  1TWG B;  4BWG B;  1TT2 A;  2O2L D;  3GO5 A;  2BDN A;  1S4Z A;  1JWU D;  2O4X A;  1L0Y B;  4LMQ D;  4NP5 A;  2DNE A;  2B2U A;  2PO4 A;  4V19 0;  3C46 A;  3IAY A;  4DK0 A;  1I4X A;  2EYM A;  4EQO A;  4NW2 A;  1BR9 A;  2L9H A;  4F8M A;  1F9R A;  3L7Z C;  1K8O A;  3M85 A;  2Z1C A;  2Q8R E;  3C1F A;  4KV6 A;  3OIP A;  3PV0 A;  2BDO A;  5I6W A;  2AQ3 B;  4DAY A;  1FGB D;  3KBX A;  4KKT A;  4H44 C;  4BY7 B;  1NR2 A;  1JWM D;  3PO2 B;  3NTI A;  3PUX A;  4KJO A;  1KLU D;  5M3F B;  1AN8 A;  1RHP A;  2B8G A;  2O5J C;  5K36 G;  5C4X B;  1EYC A;  4O42 A;  1B4O A;  1VMC A;  1S5B D;  1WTW A;  3NPP A;  3W2D A;  1DM0 B;  1Y1W B;  5D3D A;  2VB2 X;  1MGS A;  3K6O A;  2MUY A;  4G7O C;  2AQ2 B;  1STH A;  4IUR A;  2WB1 B;  1A2T A;  1KDA A;  4HAE A;  3NXW A;  3VYT A;  2M2L A;  1IYU A;  2HDM A;  1EQV A;  1ENA A;  1JOO A;  4NMZ A;  4FP5 D;  2F0E A;  2N55 A;  1TY2 A;  4FF3 A;  5C5M A;  2BCO A;  3I90 A;  1QNU A;  5C0X I;  3X3N A;  1ENC A;  3M4Y A;  3R3O A;  3T51 B;  3S17 B;  5C4H A;  2R92 B;  1JR0 D;  1VF7 A;  4FNF A;  4RKB A;  1TY0 A;  5EPK A;  1A6X A;  1KAA A;  4KKS A;  3K59 A;  1BUV T;  3IFD A;  4QF4 A;  1E2V A;  1ENF A;  1LTA D;  3EJI A;  2EDG A;  3ND9 A;  3RMH A;  2LKV A;  3A54 A;  2F0G A;  3OWE B;  3R2I A;  1PTO H;  1EL0 A;  4DN4 M;  3MHB A;  4X3T A;  1PZI D;  3D4R A;  4XQJ A;  3EQL C;  2A68 C;  1FD7 D;  4Q0F A;  5IIF A;  2IT1 A;  1GHJ A;  1PLF A;  4DF7 A;  4Q5V A;  2CW0 C;  2PZW A;  1TU2 B;  4JK1 C;  2E74 C;  1RF2 D;  2RBM A;  1SYE A;  4Y7N B;  3RD4 A;  5IGB A;  1EY4 A;  3K5L A;  5BN5 A;  1TII D;  2EJG C;  1QJO A;  2PQE A;  3I4L A;  1I4G A;  4PMW A;  2HCI A;  1HA5 A;  3V2T A;  3URY A;  2QIL A;  2XSC A;  4FF4 A;  5A2Q E;  4ZKC B;  4KJN A;  3TDQ A;  5I2Y A;  1F2Z A;  2WAC A;  5IT9 E;  1TWH B;  2ICI A;  3QOJ A;  3WOF A;  3I73 A;  1GUN A;  3Q0A A;  5BN4 A;  4BS9 A;  2QDB A;  1V8Q A;  1H9M A;  4K5X A;  1M8A A;  4KN4 C;  1B50 A;  1SE3 A;  4F7X A;  5NUC A;  5JEA J;  4RGN A;  4XT1 B;  4ZAI A;  3DXJ C;  5DM7 3;  2EYL A;  3FKI B;  4CJ2 C;  5ISR A;  2B63 B;  3S14 B;  5FOB B;  4KY7 A;  2EY5 A;  2EYJ A;  1LT3 D;  2Z4I A;  1SYG A;  1SDF A;  4R8N A;  5LL6 S;  1OXV A;  1GUW A;  1RKN A;  1PFB A;  1XTC D;  5CV9 A;  1KDB A;  4LK1 C;  1HPC A;  1SJE D;  1NAP A;  1EFI D;  3NE5 B;  5T1G A;  3PIP 3;  2F0P A;  4G7Z C;  3D8G A;  4M8A A;  1GUS A;  3CU7 A;  1DYQ A;  1U4P A;  2TSS A;  1R4Q B;  3TBI B;  2NVQ B;  1Y8P B;  2WKD A;  1S5D D;  1I50 B;  1TWA B;  3P75 A;  5CBE E;  4HSP A;  1RDP D;  4J6H A;  3SK4 A;  3P20 A;  2IX0 A;  2F03 A;  3MXU A;  2HDL A;  1LT4 D;  1DOK A;  4K5W A;  4K2K A;  3H3V C;  3P7J A;  2PW5 A;  5DAU A;  3NSW A;  1XWE A;  3ERO A;  5CYU A;  5EGT A;  2DY7 A;  1ONL A;  2JEA I;  1LTR D;  4HMI A;  3PMF A;  3HKZ B;  3HOY B;  4C3I B;  1D2B A;  2SDF A;  5T1I A;  4DGZ A;  5JVG 3;  4DA2 A;  1DCZ A;  2A6E C;  4K5V A;  5CBA E;  1LLR D;  3VYU A;  2D5D A;  3S15 B;  5KNC A;  2Q8T A;  2LFN A;  4ZRZ A;  1SYC A;  2FFK B;  3GP7 A;  3SEB A;  1EY5 A;  3I72 A;  1I4P A;  4L63 B;  3OMC A;  1SMY C;  3HOV B;  2KJX A;  1IW7 D;  3W3A A;  3E0J A;  2EXZ A;  2F0I A;  4RWS C;  1LTG D;  3I4N B;  4XYQ A;  4WJW A;  2RSN A;  1FYC A;  1T5X D;  2NN6 H;  2MGS A;  1GXD C;  2DY8 A;  1ESR A;  2ZT9 C;  1ROD A;  4A3B B;  3U9S A;  3PUY A;  4H13 C;  4C3I G;  4EVO A;  2WII B;  1SE4 A;  3QB3 A;  1NSN S;  1PTO C;  2L0C A;  1X32 A;  4RGM A;  4XT3 B;  1O7Z A;  1OXU A;  2K32 A;  3SK5 A;  3BVG A;  1EYA A;  4I65 A;  3NBH A;  2IX3 A;  3KBG A;  2A6H C;  3DEO A;  1QNK A;  3NWS A;  2RDH A;  2X69 A;  2BOS A;  3OIQ A;  5HGT A;  1SNQ A;  2I07 B;  3GTP B;  2RQX A;  3IKJ A;  2B2T A;  1T5E A;  1TQO A;  5JPN C;  1GUG A;  2OXP A;  3HRZ C;  4CBV A;  2F0Q A;  2KEE A;  3CHB D;  4V0B A;  4E6I A;  2G9H D;  3M4O B;  3NUC A;  1Q3L A;  1PRT D;  2VXW A;  1QIL A;  1J9O A;  2FHT A;  4WFN 3;  4DU9 A;  1LTB D;  4CGY B;  1HQR D;  1S5C D;  4FXD A;  3FEW X;  3MXP A;  2ICE C;  2EY6 A;  1G91 A;  3L9A X;  1G2T A;  1HQM C;  2F0N A;  1FNV A;  1U4R A;  3HOZ B;  3GQB A;  4PV1 C;  2B2W C;  2A73 B;  1RJT A;  2LY7 A;  2Z8L A;  2EY2 A;  3QWN A;  5KRU A;  3A8I E;  4HR7 B;  4B08 A;  2R7Z B;  5C0X J;  4QB4 A;  2QCP X;  2F3V A;  2K01 A;  5IOD A;  5EKL A;  3F2U A;  4IUN A;  4IN3 A;  1O80 A;  2E75 C;  1Q90 A;  4KKU A;  4C56 C;  1F2Y A;  3A7A B;  5M5W B;  3MA2 B;  4CKE A;  3GD7 A;  4B9X A;  5E4X A;  1W6K A;  5KYI A;  4IFD G;  3N6R A;  2JYO A;  1Q8I A;  1BCP C;  5KEE A;  1E2Z A;  3J7Y W;  1CFM A;  2K05 A;  3WDN A;  1LAC A;  2K5D A;  3X3M A;  5CV4 A;  4IUV A;  4OHJ A;  4A3D B;  4RKL A;  4U68 A;  4WOR A;  2CQA A;  3PIO 3;  2EZV A;  2JEB I;  3OHX C;  3K5O A;  1QG7 A;  1YNN C;  5FO7 B;  3OW7 A;  2D62 A;  3ITP A;  2IX1 A;  4C1N K;  3FPU B;  4JBW A;  1OXT A;  1PRT F;  4O1N A;  1AP0 A;  3OOC A;  5LL6 X;  4IUP A;  5A2Q L;  3I91 A;  2RVL A;  4RH6 A;  5IT9 L;  1SFO B;  3HOW B;  2SNM A;  4RFB A;  5ELD A;  1B44 D;  1TWF B;  2NUC A;  4K14 A;  3T53 B;  1DOL A;  4ZK9 B;  2XVS A;  4X3K A;  4IQZ A;  3D6W A;  1X3P A;  5ELB A;  4G7H C;  2QKI C;  1ML0 D;  5CV7 A;  1JOQ A;  5JEA H;  4X3S A;  3VR2 A;  1UEA B;  4NKL A;  1DJR D;  3GTG B;  3SHL A;  2KOL A;  5DNF A;  1Q1B A;  1HXY D;  2NN6 G;  4QCL A;  1CHP D;  2EE1 A;  3GTM B;  1NCV A;  4K8J A;  1QE6 A;  4H0L C;  3M7G A;  1HHV A;  3KLS X;  2WV6 D;  3DWQ A;  4MHE A;  3S9W A;  4OGQ C;  5C44 B;  3V96 A;  1D1I A;  4ID6 A;  1LT5 D;  1EIG A;  5CC4 A;  1VMP A;  1SNP A;  1B9M A;  1EZ6 A;  1PFN A;  2PZT A;  4A3K B;  1Y69 U;  2L12 A;  5M5Y B;  2HUG A;  4ZYS A;  3K58 A;  5FLX E;  2ZXP A;  2XRS D;  2D2C C;  3FPP A;  3SXH A;  1GUT A;  3BYT B;  5I9P A;  3I4M B;  2KVM A;  3SDZ A;  4BBR B;  3Q6S A;  3QOL A;  1EU3 A;  2RDF A;  5JVH 3;  1LTS D;  3ONA B;  3E5S A;  3H0G B;  1BBX C;  1A3U A;  3E6Z X;  4DXG A;  3LWE A;  5COR A;  1CQV A;  1EU4 A;  5CMD A;  4K8I A;  1WTR A;  3Q24 A;  1WTQ A;  2CVR A;  5J39 A;  4HCE A;  4KY5 A;  4RHR A;  1PXU A;  2M00 A;  1HRJ A;  2SOB A;  1TKW B;  1ILP A;  2F0K A;  1WTV A;  3SVM A;  1JWS D;  1WTO A;  4OL7 A;  1JOK A;  2F0L A;  1EIH A;  4B9W A;  3BG3 A;  4RHS A;  1K83 B;  1A2U A;  3T16 A;  4R9W A;  1MBY A;  2NN6 I;  2AUJ D;  5JPM C;  1WCM B;  3GV6 A;  4IZ8 A;  5EBD A;  2PW7 A;  2EY1 A;  3P1H A;  3TP7 A;  1JQY D;  4UAI A;  2B2V C;  1G29 1;  4DXF A;  3MXG A;  4FF2 A;  4GZY C;  3J81 L;  5K5P A;  5E4W C;  3BDC A;  3NQI A;  3DHQ A;  5FO9 B;  1CHQ D;  3K7A B;  3BDL A;  1RD9 D;  1JOR A;  1E0B A;  1DOM A;  1GUO A;  1H9S B;  5BN3 A;  3NQT A;  2K04 A;  1TS5 A;  1RCV D;  1XX8 A;  2IWH A;  3TP5 A;  2WAQ B;  1KNA A;  4ABN A;  5EJW A;  4DK1 A;  4KK7 A;  4BBS B;  1KAB A;  2F0V A;  4IFD H;  2LS0 1;  2A6E D;  4A3G B;  4DAV A;  5LHY 1;  4S3S A;  4OIK A;  4ZQ3 A;  1ZYR D;  3H94 A;  2OT2 A;  4HTH A;  3I70 A;  2E2H B;  4HN7 A;  1CM9 A;  2NTS A;  2KQ3 A;  4KD4 A;  1O7Y A;  2A5H A;  5KNB A;  4XQN A;  3D4W A;  5E3F A;  2BE5 D;  3GTQ B;  1LTI D;  3MC0 B;  1I3Q B;  3VA5 A;  1R4P B;  2E2J B;  1EQT A;  1HUM A;  2KCC A;  3ERQ A;  1HFG A;  1B1Z A;  1SJH D;  1M4V A;  5IGC A;  1D5Z C;  3J80 E;  1FNW A;  1IL8 A;  3CRL C;  4F87 A;  4RGT A;  2ZXR A;  1JE4 A;  5JEA G;  1VF5 C;  4RGO S;  1PZK D;  1JB3 A;  3SR1 A;  1IKM A;  5CV6 A;  1YNJ D;  3S1Q B;  1CZW A;  2XNA C;  2F3W A;  3DUZ A;  2F0H A;  3QG1 A;  1GOZ A;  2A6H D;  1JCK B;  3DWP A;  2A74 C;  4KMU C;  5KIX A;  2PMZ B;  2B39 A;  1VCI A;  3KK7 A;  3KLS A;  3VR4 A;  4LJZ C;  2K28 A;  3NHH A;  4FYD A;  2JA6 B;  2G9D A;  4FVM A;  3K5N A;  1SNM A;  4HMJ A;  3H09 A;  1STB A;  4KTA A;  1Y8O B;  3A8J E;  4KY6 A;  1F77 A;  4OO1 H;  1V1P B;  4X3U A;  4CHT B;  1I4Q A;  3C3L A;  1QWY A;  5D65 A;  3I3C A;  1LTT D;  2HCC A;  2SEB D;  1D1K A;  4XTC S;  1WD1 A;  3DWA A;  1EEI D;  1U4L A;  2EVB A;  1UUP A;  5EQ0 A;  1H9R A;  3A7L A;  1BQQ T;  3NP8 A;  1J8I A;  3HS0 C;  2N88 A;  1B2T A;  4LAA A;  4TKO B;  4R8I A;  2TMP A;  3KUP A;  4HED A;  1MI2 A;  2Z4H A;  4EGV A;  1KNE A;  1NR4 A;  3NWT A;  3S1M B;  3J81 E;  4XIG S;  2F0M A;  5C4J B;  5E1F A;  3R2T A;  4PQX A;  2OF1 A;  5C3E B;  1E2W A;  5CGK A;  5EKK A;  4A3J B;  1GJX A;  1ESF A;  1SXT A;  2EOT A;  2NB0 A;  3KLR A;  3TP8 A;  1PFM A;  4K6D A;  1QB5 D;  5EBC A;  1JC7 A;  2X6L A;  2QF7 A;  1RTO A;  3TN2 A;  3EFX D;  2I46 A;  1CT1 D;  3MEH A;  2E2D C;  3TP6 A;  3A56 A;  1BOS A;  1IW7 C;  4TSS A;  4XYO A;  3CKI B;  1G8Z D;  2EYH A;  4P2C B;  2R93 B;  1PTO F;  4L8J A;  4ZUJ A;  4IUQ A;  4N9T A;  1BXT A;  4ZLT F;  1ET9 A;  1LV9 A;  4UDU C;  1U9R A;  3NK9 A;  2FMC A;  5JOB A;  3CRK C;  3BVM A;  5G3L F;  5KND A;  3HOU B;  1A3T A;  5FLX L;  3ZYY X;  1PRT B;  4CJ0 B;  3O13 A;  2MJ8 A;  3G7L A;  3L3O C;  1UNS A;  5HUR A;  1BO0 A;  4J8Q A;  2KHS A;  1HCZ A;  2YU9 B;  1A3V A;  5C5L A;  1NUC A;  3V05 A;  2DN8 A;  1PMR A;  1HUN A;  1H9K A;  4KHZ A;  3BDO A;  4IUU A;  1R9T B;  1F9P A;  5KYL A;  1TS3 A;  1AEX A;  4C2M B;  2FMM A;  1EWH A;  1EY6 A;  3J7A V;  1SNO A;  3Q22 A;  1HFN A;  2AWO A;  1EWC A;  2X6G A;  3R8B A;  1TS2 A;  2R6G A;  3IL8 A;  2V4D A;  1HA6 A;  3TSS A;  1HTP A;  2EPB A;  4A3E B;  3AB9 A;  1LAB A;  1F9Q A;  1I4H A;  4TQU S;  2K6A A;  4BA2 I;  2B2W A;  3TME A;  3QJY A;  4FF1 A;  1ICW A;  3OSO A;  1AZP A;  3G6J B;  2L11 A;  4QMG A;  4AYB B;  1TWC B;  1KLG D;  3ND8 A;  1BCP F;  1B9N A;  3MXN A;  3AMU A;  3D3R A;  5EKI A;  2DNC A;  3VYR A;  3K0Y A;  2XIW A;  2O5I C;  2MHV A;  2PZU A;  5IGG A;  4OO1 G;  3GTJ B;  5KGU A;  1ET6 A;  1Y8N B;  2NZ1 D;  3KF8 A;  2B2Y C;  1V43 A;  3GV3 A;  1LO5 D;  4PMB A;  1Z6H A;  5CR3 A;  3VA7 A;  2QEJ C;  3BVZ A;  5J22 A;  1MSH A;  5EPL A;  2RSO A;  3BZD B;  2VB3 X;  1WD0 A;  3N52 A;  3J7A F;  1C4Q A;  3QO2 A;  2EJM A;  1CZG A;  1S5F D;  2JP1 A;  4A93 B;  5JJZ A;  2KUM A;  3MTS A;  3H91 A;  5I2X A;  4IFD I;  1PZJ D;  2VNU D;  2A69 C;  5I9O A;  2NVT B;  3RLF A;  2XWJ B;  1SEB D;  5I6Y A;  2K5W A;  3MWY W;  2A68 D;  2PCF B;  5IGD A;  3UI2 A;  3QIA A;  5M5X B;  1MD2 D;  1OO9 B;  5C6A A;  2CW0 D;  5A35 A;  3A8K E;  3D31 A;  4EQP A;  4CJ1 B;  3EA6 A;  3SK8 A;  2H1E A;  3OMG A;  4M1U B;  3U9O A;  5EPJ A;  3S1R B;  3J80 L;  3S1N B;  2RDG A;  2IL8 A;  1O78 A;  1Z7T A;  2SNS A;  3C2P A;  3TZD A;  1STN A;  3VR6 A;  2L55 A;  3I8Z A;  1QCB D;  1W6J A;  4MN3 A;  2F0U A;  3HOX B;  4A3M B;  1WTX A;  1JIC A;  2AUK A;  2XN9 C;  2B2Y A;  3SK6 A;  4F88 A;  5C3X A;  1EY8 A;  3EVQ A;  1SBB B;  2J4X A;  2NVX B;  4ODG A;  4XDX A;  4RAU C;  1D5M C;  2KCN A;  3K5M A;  3AU7 A;  2C9O A;  4J1M A;  1AZQ A;  1Z47 A;  2Y0S B;  3D6C A;  4ILW A;  4OO1 I;  2J0T D;  1FR3 A;  3A55 A;  2NBF A;  3BYY B;  4C3J B;  4K6L A;  1WVL A;  3MFY A;  4KD3 A;  5CV5 A;  1AFP A;  4QIW B;  2F1M A;  2R3Z A;  1DXM A;  1STE A;  1B53 A;  3JAM E;  4H7B A;  4PMC A;  4U67 3;  3HZX A;  5D14 A;  2JA8 B;  5AFW A;  4CKB A;  4KN7 C;  1ZXT A;  1SSO A;  4YIJ A;  3GTK B;  1EZ8 A;  5FO8 B;  1XXG A;  4A3I B;  4C3H B;  5M3M B;  4PNY A;  1O7L A;  4ME5 A;  2NTT A;  1SYD A;  3LNN A;  4TRD A;  1CA5 A;  2FIN B;  3S16 B;  1C8C A;  1ILQ A;  4C3J G;  2EYF A;  2L5T A;  4XXE A;  3FMC A;  1EY7 A;  3DM1 A;  1RTN A;  1IHZ A;  3NTH A;  1GHK A;  1UAP A;  2NVY B;  1QOH A;  3PUV A;  1U4M A;  4ZKB B;  4A3F B;  1SND A;  2KEC A;  1G6Z A;  1TVX A;  2WKC A;  1HTL D;  3H6M A;  2L4N A;  4KHV A;  1Q12 A;  2K33 A;  1X3Q A;  4WRD A;  2IW3 A;  2D9U A;  1IKL A;  1OXS C;  5TSS A;  1SMY D;  4HSV A;  2PPB C;  2K7V A;  4C3H G;  5ELF A;  4HCS A;  3MAQ A;  4N9P A;  1PYW D;  5ELC A;  5I4D A;  3WOE A;  3HEJ A;  1DD2 A;  1AW7 A;  3DEP A;  3PO3 B;  4DAP A;  3M7N A;  3VR3 A;  1ZKO A;  5FK9 C;  1ZEQ X;  1Y1V B;  1PTO D;  1BNZ A;  2B2V A;  5C0X H;  1I6V C;  1PDQ A;  2CHB D;  3NTK A;  2E76 C;  3OWF A;  2KED A;  2MP1 A;  3NBI A;  1FNU A;  3FVQ A;  2JA7 B;  2RA4 A;  1OXX K;  2B2T C;  1EEF D;  3GTL B;  2MPM A;  3K57 A;  2AWN A;  5G3L D;  3FRP B;  1SYF A;  2BA0 A;  3VYS A;  5C4Z A;  1MSG A;  2C5C A;  2NYZ D;  1II3 A;  1LT6 D;  3IFT A;  1ZYR C;  1STY A;  4BY1 B;  2F0J A;  1H9S A;  2E2I B;  4FO2 A;  2NWG A;  1PTO B;  2PYK A;  4OIJ A;  1Q1E A;  2XRQ D;  1G2S A;  5F2D A;  2F0T A;  2JXM B;  2F0W A;  4DNT B;  2L1B A;  2BE5 C;  4RCN A;  2ENB A;  2XWB B;  4BA1 I;  4K2L A;  4KI0 A;  3FDT A;  3C1E A;  5K36 H;  1CTM A;  4I7Z C;  4RCO A;  3M3Y B;  3CQZ B;  3T56 B;  1BF4 A;  4EQN A;  3BS1 A;  1STA A;  1IYV A;  2HQE A;  5DEH A;  1DZ1 A;  3PUZ A;  1F9S A;  1C48 A;  2JSO A;  1CA6 A;  1YNJ C;  4Z9C B;  2WIN B;  2F4I A;  3LX0 A;  1F2L A;  1D6E C;  2EJF C;  2ZXO A;  1I6H B;  1CK1 A;  5IGE A;  1K8M A;  2GA4 B;  1CQF A;  1BDO A;  3Q23 A;  4C1N I;  3D4D A;  1BCP D;  2R61 A;  3RUZ A;  4FXK C;  4IFD J;  4IAL A;  4G4K A;  4QUF A;  1EYD A;  3MVV A;  3T13 A;  4XQQ A;  4NDX A;  1XYI A;  1SNC A;  2EYO A;  1L0X B;  2K1B A;  4MIU A;  3R93 A;  3S2H B;  2PNR C;  5DM6 3;  2H4O A;  1VDZ A;  5IOC A;  1V1P A;  1YNN D;  4FXG C;  1V1O A;  5D3I B;  1STG A;  4DNR B;  1F2M A;  2K5Q A;  1S5E D;  2B2U C;  2RKS A;  4QUC A;  5C3W A;  3S2D B;  2F0D A;  3LWU A;  3RZD B;  5JAV A;  1TR5 A;  3MZ5 A;  2F0F A;  2LMC B;  2VUM B;  2FJ2 A;  2JA5 B;  3HP3 A;  4RA8 A;  1I4R A;  1BCP B;  1TS4 A;  2F0S A;  1KTK A;  4CKC A;  2KA7 A;  5FKA C;  1EY0 A;  2IPK D;  2J7Z A;  2BA1 A;  1PRT C;  2AQ1 B;  3OPO A;  2F0O A;  3PUW A;  4DFA A;  2M9V A;  2WP8 J;  2K03 A;  1WTP A;  3VR5 A;  2JE6 I;  3TZU A;  1H9J A;  2OEO A;  3MFG A;  2ID0 A;  3T4A C;  3RZO B;  4ULL A;  3GTO B;  1CI3 M;  1D5X C;  3HG9 A;  5COY A;  1B3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...