3SXHA

Crystal structure of staphylococcal nuclease variant delta+phs i92al103a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEAAVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92AL103A at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sxhA00
1II3A 4K2LA 2PZTA 1A2UA 2EY1A 1JOOA 2F0FA 2F3WA 2PQEA 4KD4A 5CV4A 1JOKA 3TP6A 5KYIA 2ENBA 1A2TA 1JORA 5C4ZA 4N9PA 3EJIA 1EY6A 4DFAA 1U9RA 2F0SA 2QDBA 3E5SA 4K5VA 4NDXA 4OL7A 5E1FA 1STAA 2EYJA 2EYMA 2F3VA 3DMUA 3PMFA 4YIJA 3T13A 3T16A 2NUCA 4F8MA 4PMBA 2EYLA 3OWFA 5IGFA 5K5PA 3H6MA 5EGTA 1SNDA 4NKLA 4R8NA 4LAAA 5CV8A 4EVOA 3QOLA 5I9PA 4IALA 4KY7A 4J1MA 5IIFA 2F0NA 2KHSA 4G57A 5DEHA 2EY6A 5I6WA 4KHVA 3MVVA 5KEEA 1SYEA 2EXZA 3EVQA 1EY8A 4K5WA 3SK5A 4H7BA 1TR5A 3C1EA 5IGEA 2F0VA 2OEOA 3ITPA 4NP5A 5CV7A 2F0PA 2RBMA 5F2DA 4ZQ3A 1SNPA 2M00A 3NUCA 3P75A 2LKVA 2OXPA 1EY9A 4ODGA 4E6IA 1TQOA 5IGBA 5C6AA 1EYAA 3MXPA 4HTHA 3SHLA 3S9WA 3OMGA 3TP7A 4S3SA 1SYBA 3VA5A 5J22A 3DHQA 5KYLA 5C4HA 2EY2A 5M9OA 1A3VA 3MHBA 5CC4A 2RDFA 1JOQA 3NQTA 3RUZA 1KDAA 2EYHA 4KJNA 5C5MA 5CR3A 1EY7A 4K14A 5J39A 3TP5A 5KGUA 3SK4A 3SXHA 2RKSA 1EZ6A 2F0DA 4KY6A 4KJOA 3D4WA 1EQVA 5I9OA 5CV6A 2F0JA 4KD3A 5C5LA 2EYPA 4PMCA 5C3WA 5HURA 3SK8A 3QB3A 3EROA 3V2TA 4K5XA 5IGCA 3BDCA 1SNOA 2PW7A 1A3TA 3TMEA 4DGZA 4TRDA 1STGA 2F0KA 3D6CA 5EKLA 2EYFA 2PZWA 1A3UA 1SYGA 4DU9A 5IGGA 3MZ5A 3NHHA 3U9OA 5JAVA 4IZ8A 5E3FA 4EQNA 2PZUA 4WORA 3LX0A 5KRUA 2F0HA 2SNMA 4QMGA 3P1HA 4ME5A 1ENAA 2OF1A 3D8GA 4RKBA 5NUCA 4K8JA 4B9WA 2F0OA 2KQ3A 2SOBA 4K8IA 5J1ZA 5KIXA 1EY4A 1EY0A 4EQOA 1NUCA 1SYDA 2SNSA 4QB4A 1KDBA 2F0UA 4ZUIA 5IODA 5ISRA 4KV6A 1AEXA 3SR1A 3R3OA 3ERQA 4KTAA 2O4XA 2PYKA 4DF7A 4KY5A 3SK6A 5IOCA 2EYOA 1F2MA 5CV9A 1SNCA 4QF4A 1SNMA 3OMCA 1STNA 1EZ8A 2F0QA 2HQEA 1EYCA 3MEHA 1ENCA 1SYFA 3QOJA 4B9XA 1NSNS 5JOBA 2EY5A 3TP8A 1IHZA 5EKKA 4ID6A 1SNQA 4K6DA 2F0GA 3C1FA 3HZXA 3NP8A 2F0MA 2F0TA 1EY5A 3D4DA 5CV5A 3OSOA 4HMJA 1EYDA 3NK9A 2F0EA 1F2ZA 5DAUA 5I6YA 1KABA 1STBA 4WRDA 4NMZA 4EQPA 2F0WA 4RKLA 4F7XA 1STHA 5CGKA 1STYA 4PNYA 5HGTA 1TT2A 4IUNA 2F0LA 4K2KA 1RKNA 1F2YA 2WACA 4MIUA 4ZUJA 5IGDA 4HMIA 5C3XA 2F0IA 3NXWA 1KDCA 1KAAA 2PW5A 3BDLA 4N9TA 1SYCA 4I65A 4J6HA 3HEJA
chains in the Genus database with same CATH superfamily
2B39A 2K75A 1QNKA 4K2LA 1DONA 3NBHB 1EWHA 4LMQD 4ALPA 2F0FA 3J81j 2NVXB 5A2QL 3CCSA 3KLSA 2BDNA 3CF5A 1O7ZA 3CPFA 2F3VA 4PMBA 2JA5H 4TKOB 2B2WA 1TWAB 4IQZA 1SNDA 4NKLA 3S15B 1EU4A 3IKJA 1Q12A 4DR1L 1TWGB 1WYDA 5DEHA 1CI3M 3ICEA 1FJGL 1YNND 3RLFA 2NVYH 5J3BA 3STBD 1DD2A 3BJUA 3EIVA 3ND9A 5JJKA 1PH9A 3NTHA 2J0TD 2E5LQ 4XQJA 3MTSA 2B2VC 4BY1H 3G7LA 5FLXL 1LTSD 3RUZA 5IP7H 1YJWA 3J7AV 2E2JB 2K52A 4BA1I 2KCTA 2B2YA 5CV6A 4A3BH 1OXUA 2A1AA 1TS3A 5GQOA 4DR1Q 4DA2A 3RN5A 3TBIB 3NQIA 3IRBA 4POFA 4R8IA 4RA8A 4CDCC 5C44H 1BCPF 4WORA 2TSSA 2XRQD 3J81E 2K5NA 3ULJA 3CCQA 1GXDC 5J1ZA 1LT6D 1WCMH 2I46A 3KDFA 2BH2A 2NVQB 5BR8Q 1I4GA 1YNJC 2L12A 4JYAQ 2NTSA 3RMHA 2PQAB 1OXXK 4A3JH 3GD7A 1WI5A 1BDOA 1ENCA 1QUQA 2OTLA 2M2LA 4DV5Q 3IL8A 1I50H 3NP8A 4DAYA 1TS4A 4A93B 3F2CA 1X55A 2Q8RE 4XYOA 1WTHA 4CDFC 4UDUC 1TVXA 4JI4Q 2JXMB 2AMCB 4IUTA 4OO1G 4RHSA 3I8ZA 4KN4C 3FPUB 3S1RB 3S24A 1EFID 1UE1A 3A56A 3S1QH 1RDPD 3DLLA 1PH1A 4KKTA 3N6RA 1X3GA 1L0WA 3SVMA 4BBSG 1WTXA 4TVAB 5FO8B 4NXNL 3PIPA 1HR0L 1SE8A 1EY6A 3I4OA 1G291 4NXML 3DMUA 3HOYB 4K6LA 2EYLA 3KF6B 2RA4A 2NYZD 1TWHB 1W3SA 1VQNA 3OIQA 5I6WA 4A3FH 3CRLC 4ZK9B 3NEMA 2AWOA 3TDQA 1TR5A 3I90A 1QILA 3MXUA 2UXBL 2CKZB 1A8VA 5F2DA 4YY3Q 1MJCA 4PV1C 4GLXA 5IT9c 5C6AA 2NZ1D 1H9KA 4OWXB 3GTOB 5KYLA 2CFMA 3OHXC 5IWAL 1W6KA 4HCEA 4RCNA 4JI8L 1CHPD 4FP5D 4IFDG 1HQRD 4PG3A 1RL2A 4OGQC 4LF4L 3M7GA 2N55A 4JYAL 4X65L 2A68C 2A69D 5C0XG 4C1NI 1JWSD 2O2LD 2FINB 1SNOA 1R4PB 3GDEA 4LF7Q 1Y8OB 4DV6Q 1Q46A 2AQ3B 5D3IB 1N32L 4B08A 3JAMc 1JJCB 2SNMA 4FF3A 1XJVA 4YWMA 2OT2A 2VNUD 1EY4A 1PZJD 3CCVA 2SNSA 2UUAL 3DWAA 1QVGA 3AEVA 4LF4Q 1B53A 1RODA 1BBXC 2RSNA 1EIGA 5IYDH 3BG3A 3GTMH 3RZDB 3BVMA 3G48A 4YWLA 2JA5B 3TP8A 4A3MB 1ZKOA 4K6DA 2DGYA 4B3ML 2F0TA 1O7YA 2OTJA 4IPGA 1TWCB 3H09A 5KNBA 4EX5A 4JI2Q 2X6GA 1K0SA 3UDFA 2EPBA 4L5SA 4ILWA 3A54A 1Y14B 4LWCA 1BF4A 2PCFB 1FNVA 3HKZG 3CC7A 1VQEA 1IYJB 2L1BA 3SEBA 2JN4A 1HR0W 1M8AA 4FDBA 4JW0A 2CW0D 4N9TA 5FLMH 1IBML 4IN3A 4C56C 3GQBA 4ZKBB 3HOVH 2F3WA 5GAEC 5KNDA 5M3MG 1Z7TA 2KUMA 2WP8J 2F0SA 4DFAA 2KEDA 2QDBA 2YU9H 1YJ9A 1L2FA 2O5IC 5EAYA 1D1KA 3MXGA 3AB9A 5K5PA 1XTCD 2NB0A 1A0IA 3V96A 1V1PB 1DCZA 3CCRA 1Q3LA 1WTOA 3URYA 4DR2L 4JI4L 1U0LA 1PH6A 5AFWA 5GADC 1S3OA 2Z8LA 4GOPA 2R93G 1DM0B 4LF6Q 4HIDA 4IUQA 5JVH3 4A3IB 2DY7A 1E2ZA 1XNRQ 1FVIA 4S3SA 3PCOB 4UP9A 2R92H 3EFXD 2HUGA 3X3NA 4L8JA 3CW2C 4A3JG 3S1QB 2HHHL 3BU2A 1I4PA 3J7AF 4KJOA 3I2ZA 3M3YB 1TWHH 1PFBA 1UEBA 3SK8A 4OEMB 1PFSA 3AQQA 4O2DA 1SYGA 2E74C 2JA6B 3OTOQ 2Z9HA 1OTCA 4UP7A 3VYSA 5DM63 2PZUA 1BBWA 3RZOH 3MEFA 4NPSA 3P1HA 5M5YH 3PIO3 2H1EA 1S72A 2QA4A 1J5EL 2FMMA 1IZ6A 2DUDA 3PF4A 4GNXB 2VB3X 2FFKB 1CHQD 2ALYB 2N49A 5IT9L 4A3EG 1H95A 3KFUA 2JJQA 2AUJD 2PYKA 4KY5A 2B2TC 2B63H 1F9PA 3PO3H 3EBEA 4A3KB 3Q24A 1YI2A 1CT1D 3HGBA 1YBYA 3RD4A 3LNNA 3RN2A 5L37A 4QQBX 5JVG3 3FEWX 5EKKA 1LABA 3BVZA 4GNXA 2A6HD 2IJ0A 2JA9A 1LUZA 4HMJA 4DPGA 1X56A 3BZDB 4EQ5A 5M5XB 5M3FB 1MHWC 1FJGQ 4BBRB 1J5EQ 1PDQA 3PUXA 4PQXA 2UUAQ 3HOUB 4C3HH 4MZ9A 1SYCA 4I65A 2RCFA 1RD9D 1A2UA 2EY1A 2I0QA 2N88A 2PQEA 3I7FA 4LUVA 3BVGA 5M5XH 2B8FA 3E5SA 4LF7L 3F2UA 2WAQE 3ONAB 3RZDH 1I94L 3NELA 5GAHC 3K58A 1EWCA 3VA7A 4A3IH 4A3LH 1K3RA 2HDLA 5I2XA 2HHHQ 3QOLA 4YWKA 4A93H 1XPOA 3KUPA 3EVQA 1VQBA 3GTMB 5IE8A 1ET6A 3C1EA 5D65A 2RBMA 4P2CB 3ZJYC 3E9HA 3H0GB 3M4QA 3PO2H 5IP9H 1B3QA 1B9NA 3MXPA 5LMNL 3S17B 5JEAG 5J22A 1J8IA 3HOXB 4AYBG 3FRPB 3HOYG 1HZAA 5J39A 2QCPX 1HHVA 2VB2X 1B70B 1PH3A 1K83H 5FKAC 2K1BA 3N52A 3HOZB 1EIYB 1I6VC 1CK1A 1S5FD 4DAVA 4DV1L 4C3JB 3HRZC 4H0LC 4BY7G 1Y8PB 4GKJL 4DV3Q 2C35B 1WOCA 2KA7A 3HKSA 4DAYB 2J4XA 1QVFA 1QG7A 3MZ5A 1R9TB 1HR0Q 4DV1Q 3OW2A 1GO3E 1NCVA 1X3EA 2CH4A 1QUQB 2AWNA 5ELDA 5EPKA 2OF1A 4ME3A 4B9WA 4HJAA 3Q22A 1IW7C 3NWTA 4EQOA 5K36G 3AU7A 1SJED 1IKLA 2BA0A 4P73A 4G4KA 5CV9A 4FXKC 4RMFA 3TZUA 3Q23A 3D0FA 4BBRH 4DV4L 4HCSA 4DK6C 4X3KA 2R92B 2R7FA 1NMGA 4OONA 4HIKA 4P71A 4OIJA 3KYHC 4JK1C 1C9OA 4TQUS 5DAUA 5AJ3L 1C7YA 1KL9A 1STYA 3TREA 1BOSA 2XTIA 1TWFH 3VR5A 1JQYD 4QGUA 1PTOB 2ZXPA 2NN6H 5C0XJ 1W2BA 2B63G 2RDGA 1XMQQ 4N8FA 2UXCL 4CBVA 3KLSX 4A76A 1U9RA 4POGA 1IBLQ 3F8TA 2BCOA 1WVLA 1N34L 2HIXA 1MBYA 2VS1A 4R8NA 5I9PA 1KTKA 2F0NA 2E2HH 5ELEA 3K59A 3MVVA 3E0JA 3K0YA 4FF1A 2L0CA 5CBEE 2BH8A 2F0VA 2IX3A 1Y1WB 2PMZB 3FKIG 3VR6A 5DLQE 5FO7B 4KK7A 3F1ZA 4QUCA 1N36L 1L1OB 1G2TA 1K28A 2F1MA 4LW1A 3TP7A 1MIUA 2UXBQ 3DHQA 2X69A 1GVPA 1NAPA 3CCJA 2DJGC 3KF6A 3BS1A 1SBBB 3SE0A 2VZAA 1YHBA 3I4NG 2JA6G 4BWGB 1XPUA 2F0DA 3S2DB 2WIIB 5I9OA 3D4WA 2ZTDA 4JOIC 2PI2E 2EDGA 4TRDA 2ES2A 2EYFA 1SMYD 3BZCA 1DZ1A 5CBAE 4IFDI 3UDGA 4A3JB 3GTGH 5A35A 2F4IA 4RCOA 1KIXA 3H0GH 1TWGH 1MI2A 2F0HA 4A4IA 3RR5A 2KQ3A 1SYDA 3JC66 1UE6A 3GTJH 5M5WB 3MXNA 1AEXA 1TS2A 3R3OA 4KTAA 4JI1L 3D3RA 4RAUC 3STBC 3U4ZA 3HOVG 2EYOA 1V1QA 1CZGA 1B2TA 1F9QA 2NWGA 2CWPA 1ENFA 4DKAC 1SXTA 1HZ9A 3WOEA 1EOVA 5KNCA 2D5DA 3M3YH 5JPNC 2I5HA 5ELBA 1PTOF 1EYDA 3S16H 2DY8A 2Y0SB 1JMCA 2SDFA 5I6YA 1B4OA 1Y1VG 1K83B 4DR2Q 4YHHL 3Q6SA 3G6EA 1G91A 1BXTA 2ZT9C 4KHPQ 1RKNA 2M9VA 2UUBQ 1SROA 4RHRA 1R4QB 1Q82C 1HRJA 3TS2A 4X3UA 3TP6A 2ENBA 1A2TA 3WWVA 1MGSA 4N9PA 2LXJA 4LK1C 3HKZB 2PQAA 1EYGA 2Q2TA 1AN8A 1MSGA 1M1KC 1KQSA 3H6MA 4XT1B 3VR2A 4IPHA 1VQ5A 2KVMA 3TRZA 2CQAA 4DNRB 2F4VL 2YTXA 2WB1G 1K73C 1LV9A 4CDDC 5IGEA 2E5LL 1HZCA 4NP5A 3BDOA 1I50B 1KRTA 3NUCA 1VQ4A 4FF4A 3T1HL 3K5NA 3CC2A 1AE3A 4DUYQ 1CQFA 3GTQB 1LACA 5M9OA 2JE6I 1A3VA 3MHBA 3CCEA 1JOQA 4LUZA 4NW2A 4KJNA 1S5CD 3BYTB 1ICWA 1BBUA 1VF7A 4DR5Q 2HQLA 5I2YA 1XNQQ 2L5TA 3GTLB 1Q81C 1PHJA 2JA6H 4LFBQ 2PW7A 1UE7A 2V1CC 3I70A 1GUOA 3TQYA 2A6HC 2ZXRA 4DR7L 2Z6KC 3G6JB 5E3FA 3KOJA 4LFAQ 5ELOA 1Q1EA 2K5VA 1EY0A 1X32A 4LUOA 1G2SA 3IAYA 4UY8C 3PO3B 1LTLA 1HUMA 3SK6A 2K5WA 5EQ0A 2ICIA 4IOAA 2O5JC 1AH9A 2QGQA 1EZ8A 3GTPB 3MEHA 3R2IA 3KJOA 5JOBA 1GHKA 1IHZA 3OW7A 1TY2A 5C3EH 2ASBA 1Q8IA 1KD1C 5G3LD 2X6LA 1TIID 1JWMD 1IBKL 4ZCKA 1Q90A 2F0WA 2Z1CA 5HGTA 2J7ZA 1MKHA 2AHOB 4K2KA 3PUZA 4ZUJA 4LF8L 4RGTA 4DV7L 2NVXH 1KDCA 1I4XA 4L6TB 4RFBA 1II3A 3PSIA 3KLWA 4KD4A 2NVTH 4QUFA 4N8X1 3GTKH 2CH4W 4DR4Q 4XIGS 2PNRC 2JEAI 5C4JB 3T16A 2JA8H 3KF8A 1SSOA 3GO5A 4EVOA 2IHEA 3PIOA 4GOPC 2KHSA 1AW7A 4QIWB 1VQFA 5KEEA 4A3GB 1PZKD 2R93B 4JI7Q 1NR2A 1QZHA 2OEOA 2XNAC 1KC8C 1E1TA 1SNPA 4GZYC 3S17H 1AFPA 1D1IA 1DOLA 4E6IA 2OXPA 1Z6HA 3DM3A 3S1NB 1QJOA 1X3FA 4AQYL 1PTOH 3NTKA 2VUMG 2JA7G 1K8AC 2DNEA 2R7DA 2EYHA 5T1GA 5BN5A 2RHSB 5FLXc 4JBWA 1EZ6A 5IY0A 1LYLA 5M3MB 1S5DD 2Z0SA 4MNOA 1S5BD 3HP3A 1K0RA 1DJRD 4MHEA 1N9WA 2Y0SE 5TSSA 1VMCA 3EROA 3W5OA 4UHVA 1A3TA 4DGZA 1I3QB 1CKNB 1RJTA 5C44B 4DV0Q 1F9RA 1VQGA 1A3UA 4OO1I 4QCLA 4IZ8A 5ELFA 5IYDG 3K5LA 5HY6A 4JI5L 1SR3A 2NVQH 5C0XI 3C2PA 2E8GA 1Y8NB 1O78A 1UNSA 5ISRA 3R93A 1QZGA 4A3MG 3T56B 4QF4A 3OMCA 5E4XA 3T53B 4X62Q 2Q2IA 3W2DA 3MXNB 5FJ8G 4A3LG 1HA6A 5H1SE 4DAMA 1EY5A 4HEDA 4F88A 3HOWB 2HCCA 2A69C 4Z9CB 1V43A 2KBNA 1FD7D 1KNAA 4F7XA 1K8OA 2R61A 3QJYA 1PXUA 2QEJC 3E9IA 1HPCA 4IUNA 4RGOS 4IFDH 2OWOA 3VYRA 2KHIA 1ZYRC 3H91A 4K0KQ 3J7YW 1O7IA 4UPAA 2MO0A 1HNWL 2LXKA 4DR6Q 1A63A 1WFQA 2B8GA 5M5YB 3S15H 5CORA 3EA6A 3FKIH 2IX1A 3MC0B 3S1NH 1SMXA 4L5RC 5JEAJ 2B2UC 3LWEA 3B6YA 4GKKQ 3MWYW 2K50A 4UP8A 1S40A 3I56A 3DUZA 1VQPA 4HSVA 2KHJA 1CKOA 2K5HA 2M00A 1BCPC 1IL8A 5D14A 5IGBA 1I6HB 1XPRA 4P74A 3VA5A 1NJIC 3VDYA 1ILPA 3GTKB 3H3VH 3NTIA 1KDAA 2F03A 2K33A 3HOUH 3W1BA 1R9TH 1NR4A 2UU9L 4A3BB 1LO5D 4OO1H 1BR9A 1XMOQ 2NZHA 2LY7A 4KI0A 2V4DA 1D2BA 2ID0A 1IL2A 5C3EB 1L1OC 1LTBD 3A8JE 2WKCA 1L0YB 2JA8B 4Y52H 2E75C 2PZWA 3TN2A 2B2UA 1GM5A 5IYCG 5IGGA 1G8ZD 1UUPA 1QNUA 3I55A 4HR7B 1QWYA 4QMGA 5C3XA 1E7ZA 5NUCA 1D5MC 1D6EC 1RF2D 3HG9A 2R93H 4RGNA 2G9DA 1YJNA 1VMPA 4KV6A 3OYYA 1TKWB 3ERSX 4B3TL 3H94A 1U4LA 2Q8IB 3SGIA 2O4XA 4IO9A 2HCIA 1EFWA 2B2TA 1VQAA 1HA5A 5C44G 2N3SA 3A8KE 2BE5D 4B9XA 2R7ZH 2LS01 1SNQA 1QCBD 3CCLA 2QILA 5C4XH 2XN9C 4G7OC 1CZWA 5FK9C 4DUZL 4PZ6A 4R4QA 4LF5L 4A3GH 2IY5B 4RKLA 1M4VA 4WJWA 3D31A 1FL0A 2A74C 4ZLTF 3S2HH 5E7NA 1TS5A 3MA2B 5EPLA 5IP7G 4MIUA 2A6ED 4CKEA 1C8CA 2VY3A 4LFCL 4BY1G 4R4OA 2ATWA 1YHQA 1X9NA 2PZTA 3DXJC 1I4RA 3L3OC 2K01A 1JOKA 4GN3B 1UWVA 2JEBI 5IP9G 3BZKA 3I73A 1EOTA 2MJ8A 2EIFA 3R8BA 3T13A 3CQZB 2D62A 1ML0D 4J15A 1A6XA 2TMPA 1LLRD 1PH2A 4J1MA 3NENA 1SFOH 2RHQB 1T5EA 4PZ7A 3FVQA 1A62A 1CFMA 1HTLD 3A55A 2ZJPA 1YHAA 2K14A 4B3SQ 1V1PA 4I7AA 3J81L 2B2WC 2IWHA 1PVOA 1SE3A 1EY9A 4ODGA 4C3IB 1A15A 2MPMA 3T1YL 2UU9Q 1LM0A 3PUYA 1GOZA 1IBKQ 3J7A5 1SFOB 4JOIA 3ND8A 4MTNA 1WD0A 1H9SB 1CUKA 2B2YC 4RH6A 1BVSA 1JE4A 3CMAA 5HURA 1C48A 4IJLA 3NPPA 4FF2A 4CJ1B 1E24A 3GTQH 3L0OA 2EJGC 3AYHB 4OXPA 1Y1WG 3PUVA 1UAPA 1EQQA 5EBDA 4XQQA 4OWWB 3W3AA 5I4DA 3PO3G 2I5LX 3S14B 5C4XB 4QB4A 1QVCA 3HOXH 5CMDA 3SR1A 3P20A 4OX9Q 4LF9L 2ZM6Q 2WFWA 1PRTD 2MNAA 1CSQA 1I6HH 3U58A 3HOZH 2B63B 2F0GA 3HZXA 2F0MA 2DJFC 4DV2Q 1VQHA 2VL6A 1SJHD 4CJ0B 3M4OB 3S2DH 1XWEA 4XTCS 1WJJA 1TT2A 2MO1A 2BA1A 2UXDQ 1F2YA 4GN4B 3KDFB 1KLGD 4GNXC 2F0IA 5JJLA 1G6PA 2F3IA 2OCEA 4B3TQ 4J6HA 2A73B 2CCZA 1I5FA 2Q2UA 1X6OA 1CKMA 1YIJA 5BN3A 5CV4A 1KXLA 1V9PA 2F4VQ 3L9AX 2CHBD 4DNIA 1ILQA 4O42A 1HNZQ 4IFDJ 1OXTA 4GLVB 3OWFA 3KBGA 3FPPA 3TSSA 2QF7A 3P7JA 4G57A 4HAEA 1XYIA 3H3VC 4B3RL 1SYEA 3J7ZC 4H44C 1HTPA 3SK5A 4DNTB 2CWAA 1JT8A 1PH5A 2WAQG 1CTMA 2EQSA 2UUBL 1GJXA 1J9OA 2SEBD 2CVRA 1EYAA 1VCIA 2QDLA 1KHIA 3Q0AA 1EQTA 4DXGA 3OOCA 4CKBA 4EGVA 4HJ7A 4X3SA 1OXSC 2K32A 1GUSA 2KCCA 3S1RH 5E4WC 1B7YB 1LT5D 4QL5A 2MP1A 2EE1A 3CP0A 1Y1VB 3SXHA 1GD7A 2A19A 4AYBB 3HOXG 4KY6A 4LF9Q 1EQVA 1GHJA 2EYPA 4BXXG 2WV6D 2CW0C 2AKWB 4IPCA 5IGCA 5LL6S 1XX8A 5EKLA 1KRSA 1K8MA 1RCVD 3M85A 4R9WA 4DU9A 3HOVB 1PH8A 4EQNA 2G5DA 1OO9B 2YU9B 4RKBA 4ABNA 4JI6L 5IODA 1KDBA 2F0UA 3ULPA 2YTYA 3ERQA 1N33L 1STNA 2R7ZG 1JJGA 4ZYSA 1S4ZA 1JC7A 1Q7YC 3FHWA 1F77A 2B29A 1L0XB 4R4IA 5LHY1 3PIP3 5M3FH 1VQLA 3I91A 5C0XH 4JVZA 2BE5C 4EQPA 3C3LA 1KAWA 5M3FG 4JPBW 4AYBE 3E3XA 3GTGB 4B3RQ 2WACA 2AQ2B 3GTLH 1HJPA 4YCVA 4C3IH 5GAGC 2A6EC 3HOWG 1BNZA 2MUYA 1EWIA 4P72A 4HIOA 4AH6A 3M4YA 4X64L 5KYIA 3FKIB 1DYQA 1JB3A 4OL7A 1STAA 4QY7A 2UUCL 1VQDA 2PMZE 4LFAL 3ZYYX 3I4MG 4FO2A 5EGTA 2K05A 2C9OA 1LTID 2CQOA 2JYOA 2K6AA 4NB3A 2UXCQ 2EY6A 2IHFA 4LFCQ 3CD6A 3GTPH 2E2IH 1KLUD 1EU3A 2LKVA 2XGTA 1SMYC 5EKIA 1TQOA 1YNXA 3S16B 2VQEQ 4A3EH 3R2TA 3J80c 1ESFA 1K3BC 5AJ3Q 1YNJD 4JBJA 5CC4A 4KLKA 2ZJQA 3NQTA 2ZM6L 3CU7A 5LMNW 4OX9L 2WKDA 4U673 1LT4D 1DOMA 4KD3A 3FDTA 1D8LA 4HJ5A 2B2VA 4WFN3 1NTGA 1VQKA 1BCPD 3JAME 1ESRA 1GUTA 5JAVA 1SE4A 5GROA 5IYBH 3H3VI 2OQ0A 5M5WH 3GTJB 3OPOA 4G7ZC 2F0OA 4XYQA 3FMCA 3QWNA 3QIAA 1E2WA 2BDOA 1VQIA 2R7ZB 5LMUQ 1GKHA 1EEID 2HQEA 1EYCA 1SYFA 3CAMA 3CHBD 2EY5A 4DK3C 1H9JA 4C3JG 2K5DA 4HJ9A 1QOHA 5LMUL 5IT9E 1PRTB 1YNNC 1Q1BA 3VR4A 3S2HB 1ZYRD 2EOTA 5K36H 4RGMA 1N33Q 1XXGA 4A3BG 4B3SL 1VQ6A 3HS0C 4JI3L 1NMFA 2C5CA 2VW9A 3WOFA 4X6AH 4JI6Q 1CQVA 1X3QA 4JI0L 3S14H 5EJWA 1NNXA 2AQ1B 3NSWA 3K7UC 1U5KA 3O13A 2QEXA 4DK0A 4X3TA 5C4ZA 1WD1A 4BY7H 3H15A 2G9HD 2RQXA 2EYJA 1VQMA 1EUJA 2NUCA 1LTTD 5DNFA 3Q8DA 5IGFA 3GV3A 1ZXTA 3HOYH 1BCPB 5DM73 2GN5A 1VQ8A 1JE5A 1YZ6A 2XWBB 1ONLA 3GV6A 1YITA 2VUMH 4I7ZC 3M9BA 5JEAH 4DR5L 1HXYD 2WAQB 3LWUA 1SAPA 5CYUA 3DEOA 1WTPA 4DR3Q 2JK8A 1UEAB 3RNUA 3FP9A 1J6QA 1MD2D 2A8VA 2KENA 4BBRG 4O0AA 5A2QE 3T1HQ 3M4PA 4F87A 1JJ2A 2K04A 5KGUA 1CM9A 2KCNA 5D3DA 1SEBD 2VQFQ 2JA8G 4MN3A 1ICFB 5C3WA 1AP0A 2D9UA 4ZRZA 1GUGA 3V2TA 1L1OA 1M90C 4JI5Q 4X64Q 2IT1A 3T51B 3NHHA 3KF8B 2ICEC 1EQRA 1HQMC 1Z47A 3U4VA 1BQQT 5HGQA 2KJXA 5IYCH 2VQFL 4DV0L 1E1OA 1AZQA 1Y69U 2K28A 3OTOL 4CDEC 3TEHB 3I4LA 3UDIA 1N8RC 3MFGA 1XMOL 4XT3B 1E22A 1XMQL 4O1NA 3S1MH 3PUWA 2IW3A 2PNHA 3U50C 1G51A 2EJFC 1GUNA 1JR0D 4DR3L 4BBSB 1HUNA 5EBCA 1FR3A 4FXGC 2YTVA 3M4OH 3K5MA 1SLJA 3NK9A 2XIWA 5BN4A 3MAQA 1XTDA 4MTKA 1STBA 3K7AH 3A74A 2L55A 4KHZA 4JG2A 4DK1A 2E2IB 2XWJB 1LTGD 3CQZH 4C3JH 4A93G 4JI1Q 1U4PA 4CKCA 1DXMA 1E0BA 4A3IG 3KK7A 1JOOA 2WB1E 3QO2A 4H13C 3I4MH 3A7AB 2LFNA 4K5VA 2L15A 5E1FA 2EZVA 5JJZA 3PMFA 1OXVA 2ZTEA 4JI0Q 2E76C 3NE5B 4XQNA 4FVMA 4DR4L 2NN6I 3ULLA 1PTOD 4KY7A 5IIFA 4JI3Q 2XVSA 1SRUA 2Q2HA 4U68A 4KHVA 4C3IG 4JBKA 1U4MA 4LF8Q 2B3GA 3ITPA 1EIHA 2D0PA 3K8AA 1VQ9A 5LL6X 1FNWA 1E2VA 4HTHA 3SHLA 3S9WA 4GS3A 1SE2A 1SYBA 3A7LA 3F2BA 2RSOA 1LTRD 1N36Q 3V05A 3TS0A 1B50A 1V1OA 3QG1A 1AZPA 1X3PA 4A3CH 4IOCA 4C2MB 3IFDA 2F0JA 1U4RA 3QB3A 5M3MH 3A5ZB 2K5QA 4K5XA 2LMCB 3TMEA 4BY1B 1F2LA 2F0KA 3D6CA 3JAMi 4G7HC 1E3PA 2E2JH 1IBLL 2JSOA 4LJZC 1O7LA 4L5QA 2BOSA 3LX0A 1I94Q 2D0OA 5KRUA 1W6JA 5EPJA 3AFQA 4DV6L 2SOBA 4K8IA 2PPBC 4LFBL 2UXDL 2VUMB 2JA7B 1PZID 4IUPA 3CC4A 1Q8KA 4DF7A 4XDXA 1FNUA 2XSCA 4L5TA 4DV2L 4X65Q 2F0QA 3HOWH 4DUZQ 2AUKA 2N8NA 2VQEL 3PQIA 4P75A 4A75A 1JWUD 4TSSA 2FJ2A 3C1FA 4R4CA 1STEA 1LTAD 2RCNA 4JI8Q 3F2DA 4DUYL 2F0EA 1F2ZA 5IWAQ 1KABA 5FOBB 4NMZA 4YCUA 3HKZE 3SDZA 3I4MB 5CGKA 1YVCA 4DV4Q 1BUVT 1V8QA 2F0LA 4ULLA 1P8LA 5IGDA 3DM1A 3CXCA 3MFYA 4YY3L 1KAAA 3CCUA 3D4RA 3K5OA 2UUCQ 2A68D 4V0BA 1FGBD 4C3HG 2D2CC 1K9MC 4Q0FA 4OWTB 3J81i 1IKMA 4F8MA 3NWSA 2N78A 1D5ZC 3L2PA 3I4NH 1VF5C 4QIWE 1WTVA 4LAAA 3VYTA 5FLMG 2MGSA 3K57A 3RZOB 4NXNQ 3BYYB 2F52A 4GLAC 3G71A 1EY8A 2WINB 1C4QA 3K80C 2VXWA 1Y1VH 4ZQ3A 3P75A 2Q8TA 4DAPA 1EEFD 1RTNA 2DN8A 5G3LF 3A5UA 5JJIA 3OMGA 1I4QA 1C0AA 4DXFA 4J8QA 2L9HA 1FYCA 5C4HA 1DGSA 1BO0A 1MJEA 4JC0A 1F9SA 3S1MB 2IPKD 3J80i 4CJ2C 2JP1A 3SK4A 4LF6L 4GKKL 2IL8A 3CRKC 2Z4HA 4HIMA 2GVAA 1YEZA 5C5LA 2ZTCA 1DOKA 3CMEA 3D6WA 5FLXE 3H0GG 4R1JA 4JBMA 1RHPA 4FNFA 3GP7A 3HFZB 4IJHA 3U9SA 3J80E 2NVTB 3LGJA 3A8IE 2YV5A 4OHJA 1SN8A 2MHVA 4M8AA 5FO9B 3KJPA 2QW7A 4WJ4A 3D8GA 4UAIA 1SDFA 4K0KL 3AFPA 4JCVE 4ZKCB 2HD3A 4ZUIA 1PH4A 2OQKA 4Y7NB 4RG1A 3NBIA 2HT1A 5IOCA 5IYBG 1ASYA 2KOLA 2Z6KA 2NBFA 4LNQA 1H9RA 4ID6A 4CGYB 1RTOA 1JCKB 3QR8A 3OSOA 2KECA 4X62L 3KBXA 4A3DG 2ZJRA 4WRDA 1X65A 3W1GA 4C2MH 1STHA 4B3MQ 3UE0A 3IFTA 3PF5A 4HMIA 2E2DC 4FXDA 1H9SA 3NXWA 2PW5A 1WTQA 3CKIB 3HEJA 3M7NA 4IPDA 4AIMA 1HNZL 1TWCH 1JB7A 4A3FB 4APVA 2H4OA 4A3KG 1B1ZA 3EJIA 2I5MX 2L4NA 1ASZA 1G6ZA 1CA5A 4BBSH 1N32Q 4A3EB 2Y0SG 2EXDA 4L63B 1PLFA 1Y1WH 1VDZA 1AE2A 1VQJA 2L11A 4YCWA 4KHPL 4K5WA 2EVBA 2E2HB 2I07B 1X54A 1NY4A 4C1NK 1S5ED 4A3GG 5ELCA 2FHTA 4HN7A 4BA2I 1PYWD 5C4XG 3VYUA 4XXEA 3AMUA 1T5XD 4KN7C 1EY7A 1PRTC 1LT3D 4K14A 3J80L 1VQOA 2RDHA 2QKIC 2NTTA 4JV5Q 1B9MA 4PMCA 1TWFB 2RVLA 1PH7A 1WTWA 1PFNA 3I72A 3BDCA 3UI2A 2IX0A 1P16A 4Y7NH 1D5XC 1STGA 1VS0A 4DR6L 1HNWQ 2NVYB 1QB5D 3I4NB 2K7VA 3U9OA 2XRSD 4M1UB 1HH2P 4OELB 1ZEQX 1VQCA 5ELNA 4GOPB 1ENAA 4K8JA 4GKJQ 1NUCA 4DV7Q 1PRTF 1IBMQ 1HFGA 3RLOA 3DEPA 2MFIA 4IUVA 3RLNA 3JAML 2HDMA 3C46A 1SNCA 4QJFA 2K03A 2MQHA 1NE3A 4X66Q 3K0XA 3T1YQ 4A3FG 3QOJA 1D7QA 4OIKA 4IURA 1IYVA 4JI2L 3VR3A 5CV5A 2RF4A 3PO2G 4KMUC 4BXXH 4PZ8A 2FXQA 2P5ZX 3K6OA 1PV4A 3A0JA 3K81C 4PNYA 4A3KH 4A3CG 3CCMA 4A3DB 3WDNA 1EL0A 3BDLA 3I3CA 2JA7H 1HZBA 1I3QH 2PI2A 1K8GA 1WCMB 1N34Q 4V190 2JA5G 3KLRA 1H9MA 1JORA 1CA6A 1PMRA 4DR7Q 4NDXA 2EYMA 3UDXA 4YIJA 2YYZA 1HFNA 4PMWA 4A3DH 3OWEB 1UE5A 1CKNA 2GA4B 5C4JH 1PFMA 1XNQL 5CV8A 4KKSA 4IALA 1VQ7A 1PYSB 1CSPA 1Q86C 1PA6A 1ET9A 2R92G 4LF5Q 2EXZA 4H7BA 1TXYA 5CV7A 2F0PA 3J81c 2K4KA 2DNCA 4AQYQ 1MSHA 2Z4IA 4RWSC 5JPMC 2FMCA 2WB1B 3TZDA 4ZAIA 1I4HA 1WCMG 3DWQA 2HIVA 4CHTB 4H02A 2EY2A 3UE1A 3HOUG 2R6GA 4JI7L 2RDFA 2KCMA 5C5MA 5CR3A 4HJ8A 3PGZA 2ZXOA 3TP5A 5BR8L 3E0EA 4R4TA 2RKSA 1IYUA 3PV0A 5T1IA 3X3MA 4X66L 4A3MH 3PO2B 1PYBA 2A5HA 2GVBA 4BY7B 4HSPA 5C3EG 1GUWA 1PTOC 1WTRA 5COYA 3HOZG 2Z6BA 1QE6A 4WJ3M 3L7ZC 3CPWA 2KEEA 3E6ZX 4NXMQ 3ER0A 4DV3L 1NBWA 3G4SA 1B44D 3NBHA 2LSSA 1B8AA 1EIFA 4ME5A 1HCZA 5KIXA 2PO4A 4IUUA 3T4AC 1T9HA 3OIPA 2EJMA 2JQOA 3K7AB 1F2MA 4GN5A 4BS9A 1HNXQ 4YHHQ 1SNMA 2NN6G 4JV5L 1IW7D 2H5XA 1NSNS 1TY0A 1O80A 4C3HB 5LMNQ 1JICA 3D4DA 1Z9FA 1XNRL 4DN4M 4FYDA 4KKUA 3EN2A 4DV5L 1IXRA 1RIPA 2NZOA 3GTOH 1BKBA 1TU2B 1FGUA 4Q5VA 1KNEA 3EQLC 1B3AA 1TWAH 5FJ8H 2R3ZA 3DWPA 1HNXL
chains in the Genus database with same CATH topology
2B39A 1QNKA 4K2LA 1DONA 1EWHA 4LMQD 2NVXB 2F0FA 5A2QL 3KLSA 2BDNA 1O7ZA 2F3VA 4PMBA 4TKOB 2B2WA 1TWAB 4IQZA 1SNDA 4NKLA 3S15B 1EU4A 3IKJA 1Q12A 1TWGB 5DEHA 1CI3M 1YNND 3RLFA 1DD2A 3ND9A 3NTHA 2J0TD 4XQJA 3MTSA 2B2VC 3G7LA 5FLXL 1LTSD 3RUZA 3J7AV 2E2JB 4BA1I 2B2YA 5CV6A 1OXUA 1TS3A 4DA2A 3TBIB 3NQIA 4R8IA 4RA8A 1BCPF 4WORA 2TSSA 2XRQD 3J81E 1GXDC 5J1ZA 1LT6D 2I46A 2NVQB 1I4GA 1YNJC 2L12A 2NTSA 3RMHA 1OXXK 3GD7A 1BDOA 1ENCA 2M2LA 3IL8A 3NP8A 4DAYA 1TS4A 4A93B 2Q8RE 4XYOA 4UDUC 1TVXA 2JXMB 4IUTA 4OO1G 4RHSA 3I8ZA 4KN4C 3FPUB 3S1RB 1EFID 3A56A 1RDPD 4KKTA 3N6RA 3SVMA 1WTXA 5FO8B 1EY6A 1G291 3DMUA 3HOYB 4K6LA 2EYLA 2RA4A 2NYZD 1TWHB 3OIQA 5I6WA 3CRLC 4ZK9B 2AWOA 3TDQA 1TR5A 3I90A 1QILA 3MXUA 5F2DA 4PV1C 5C6AA 2NZ1D 1H9KA 3GTOB 5KYLA 3OHXC 1W6KA 4HCEA 4RCNA 1CHPD 4FP5D 4IFDG 1HQRD 4OGQC 3M7GA 2N55A 2A68C 2A69D 5C0XG 4C1NI 1JWSD 2O2LD 2FINB 1SNOA 1R4PB 1Y8OB 2AQ3B 5D3IB 4B08A 4FF3A 2SNMA 2OT2A 2VNUD 1EY4A 1PZJD 2SNSA 3DWAA 1B53A 1RODA 1BBXC 2RSNA 1EIGA 3BG3A 3RZDB 3BVMA 2JA5B 4A3MB 3TP8A 1ZKOA 4K6DA 2F0TA 1O7YA 1TWCB 3H09A 5KNBA 2X6GA 2EPBA 4ILWA 3A54A 1BF4A 2PCFB 1FNVA 2L1BA 3SEBA 1M8AA 2CW0D 4N9TA 4IN3A 4C56C 3GQBA 4ZKBB 2F3WA 5KNDA 1Z7TA 2KUMA 2WP8J 2F0SA 4DFAA 2KEDA 2QDBA 2O5IC 1D1KA 3MXGA 3AB9A 5K5PA 1XTCD 2NB0A 3V96A 1V1PB 1DCZA 1Q3LA 1WTOA 3URYA 5AFWA 2Z8LA 1DM0B 4IUQA 5JVH3 4A3IB 2DY7A 1E2ZA 4S3SA 3EFXD 2HUGA 3X3NA 4L8JA 3S1QB 1I4PA 3J7AF 4KJOA 3M3YB 1PFBA 3SK8A 1SYGA 2E74C 2JA6B 3VYSA 5DM63 2PZUA 3P1HA 3PIO3 2H1EA 2FMMA 2VB3X 2FFKB 1CHQD 5IT9L 2AUJD 2PYKA 4KY5A 2B2TC 1F9PA 4A3KB 3Q24A 1CT1D 3HGBA 3RD4A 3LNNA 5JVG3 3FEWX 5EKKA 1LABA 3BVZA 2A6HD 2IJ0A 4HMJA 3BZDB 5M5XB 5M3FB 4BBRB 1PDQA 3PUXA 4PQXA 3HOUB 1SYCA 4I65A 1RD9D 1A2UA 2EY1A 2N88A 2PQEA 3BVGA 2B8FA 3E5SA 3F2UA 3ONAB 3K58A 1EWCA 3VA7A 2HDLA 5I2XA 3QOLA 3KUPA 3EVQA 3GTMB 1ET6A 3C1EA 5D65A 2RBMA 4P2CB 3H0GB 1B9NA 3MXPA 3S17B 5JEAG 5J22A 1J8IA 3HOXB 3FRPB 5J39A 1HHVA 2QCPX 2VB2X 5FKAC 2K1BA 3N52A 3HOZB 1I6VC 1CK1A 1S5FD 4DAVA 4C3JB 3HRZC 4H0LC 1Y8PB 2KA7A 2J4XA 1QG7A 1R9TB 3MZ5A 1NCVA 2AWNA 5ELDA 5EPKA 2OF1A 4B9WA 3Q22A 1IW7C 3NWTA 4EQOA 5K36G 3AU7A 1SJED 1IKLA 2BA0A 4G4KA 5CV9A 4FXKC 3Q23A 3TZUA 4HCSA 4X3KA 2R92B 4OIJA 5DAUA 4JK1C 4TQUS 1STYA 1BOSA 3VR5A 1JQYD 1PTOB 2ZXPA 2NN6H 5C0XJ 2RDGA 4CBVA 3KLSX 1U9RA 2BCOA 1WVLA 1MBYA 4R8NA 5I9PA 1KTKA 2F0NA 5ELEA 3K59A 3MVVA 3E0JA 3K0YA 4FF1A 2L0CA 5CBEE 2F0VA 2IX3A 1Y1WB 2PMZB 3VR6A 5FO7B 4KK7A 1G2TA 4QUCA 2F1MA 3TP7A 3DHQA 2X69A 1NAPA 3BS1A 1SBBB 3SE0A 4BWGB 2F0DA 3S2DB 2WIIB 5I9OA 3D4WA 2EDGA 4TRDA 2EYFA 1SMYD 1DZ1A 5CBAE 4IFDI 4A3JB 5A35A 2F4IA 4RCOA 2F0HA 1MI2A 2KQ3A 1SYDA 5M5WB 3MXNA 1AEXA 1TS2A 3R3OA 4KTAA 3D3RA 4RAUC 1B2TA 2EYOA 1CZGA 1F9QA 2NWGA 1ENFA 1SXTA 3WOEA 5KNCA 2D5DA 5JPNC 5ELBA 1PTOF 1EYDA 2DY8A 2Y0SB 2SDFA 5I6YA 1B4OA 1K83B 1G91A 3Q6SA 1BXTA 2ZT9C 1RKNA 2M9VA 4RHRA 1R4QB 1HRJA 4X3UA 3TP6A 2ENBA 1A2TA 1MGSA 4N9PA 4LK1C 3HKZB 1AN8A 1MSGA 3H6MA 4XT1B 3VR2A 2KVMA 2CQAA 4DNRB 1LV9A 5IGEA 4NP5A 3BDOA 1I50B 3NUCA 4FF4A 3K5NA 1CQFA 3GTQB 1LACA 5M9OA 2JE6I 1A3VA 3MHBA 1JOQA 4NW2A 4KJNA 1S5CD 3BYTB 1ICWA 1VF7A 5I2YA 2L5TA 3GTLB 2PW7A 3I70A 1GUOA 2A6HC 2ZXRA 3G6JB 5E3FA 1Q1EA 1EY0A 1X32A 1G2SA 3IAYA 3PO3B 1HUMA 3SK6A 2K5WA 5EQ0A 2ICIA 2O5JC 1EZ8A 3GTPB 3MEHA 3R2IA 5JOBA 1GHKA 1IHZA 3OW7A 1TY2A 1Q8IA 5G3LD 2X6LA 1TIID 1JWMD 1Q90A 2F0WA 2Z1CA 5HGTA 2J7ZA 4K2KA 3PUZA 4ZUJA 4RGTA 1KDCA 1I4XA 4L6TB 4RFBA 1II3A 4KD4A 4QUFA 4XIGS 2PNRC 2JEAI 5C4JB 3T16A 3KF8A 1SSOA 3GO5A 4EVOA 2KHSA 1AW7A 4QIWB 4A3GB 5KEEA 2R93B 1PZKD 1NR2A 2OEOA 2XNAC 1SNPA 4GZYC 1AFPA 1D1IA 1DOLA 4E6IA 2OXPA 1Z6HA 3S1NB 1QJOA 1PTOH 3NTKA 2DNEA 2EYHA 5T1GA 5BN5A 4JBWA 1EZ6A 5M3MB 1S5DD 1S5BD 3HP3A 1DJRD 4MHEA 5TSSA 1VMCA 3EROA 4DGZA 1A3TA 1I3QB 1RJTA 5C44B 1F9RA 4OO1I 1A3UA 4QCLA 4IZ8A 5ELFA 3K5LA 5C0XI 3C2PA 1Y8NB 1O78A 1UNSA 5ISRA 3R93A 3T56B 4QF4A 3OMCA 5E4XA 3T53B 3W2DA 1HA6A 3HOWB 1EY5A 4HEDA 4F88A 2HCCA 2A69C 4Z9CB 1V43A 1FD7D 1KNAA 4F7XA 1K8OA 2R61A 3QJYA 1PXUA 2QEJC 1HPCA 4IUNA 4RGOS 4IFDH 3VYRA 1ZYRC 3H91A 3J7YW 2B8GA 5M5YB 5CORA 3EA6A 2IX1A 3MC0B 5JEAJ 2B2UC 3LWEA 3MWYW 3DUZA 4HSVA 2M00A 1BCPC 1IL8A 5D14A 5IGBA 1I6HB 3VA5A 1ILPA 3GTKB 3NTIA 1KDAA 2F03A 2K33A 1NR4A 4A3BB 1LO5D 4OO1H 1BR9A 2LY7A 4KI0A 2V4DA 1D2BA 2ID0A 5C3EB 1LTBD 3A8JE 2WKCA 1L0YB 2JA8B 2E75C 2PZWA 3TN2A 2B2UA 5IGGA 1G8ZD 1UUPA 1QNUA 4HR7B 1QWYA 4QMGA 5C3XA 5NUCA 1D5MC 1D6EC 1RF2D 3HG9A 4RGNA 2G9DA 1VMPA 4KV6A 1TKWB 3H94A 1U4LA 2Q8IB 2O4XA 2HCIA 2B2TA 1HA5A 3A8KE 2BE5D 4B9XA 2LS01 1SNQA 1QCBD 2QILA 2XN9C 4G7OC 1CZWA 5FK9C 4RKLA 1M4VA 4WJWA 3D31A 2A74C 4ZLTF 1TS5A 3MA2B 5EPLA 4MIUA 2A6ED 4CKEA 1C8CA 2PZTA 3DXJC 1I4RA 3L3OC 2K01A 1JOKA 2JEBI 3I73A 1EOTA 2MJ8A 3R8BA 3T13A 3CQZB 2D62A 1ML0D 1A6XA 2TMPA 1LLRD 4J1MA 1T5EA 3FVQA 3A55A 1CFMA 1HTLD 1V1PA 3J81L 2B2WC 2IWHA 1SE3A 1EY9A 4ODGA 4C3IB 1A15A 2MPMA 3PUYA 1GOZA 1SFOB 3ND8A 1WD0A 1H9SB 2B2YC 4RH6A 1JE4A 5HURA 1C48A 3NPPA 4FF2A 4CJ1B 2EJGC 3PUVA 1UAPA 5EBDA 4XQQA 3W3AA 5I4DA 3S14B 5C4XB 4QB4A 5CMDA 3SR1A 3P20A 1PRTD 2B63B 2F0GA 3HZXA 2F0MA 1SJHD 4CJ0B 3M4OB 1XWEA 4XTCS 1TT2A 2BA1A 1F2YA 1KLGD 2F0IA 4J6HA 2A73B 5BN3A 5CV4A 3L9AX 2CHBD 1ILQA 4O42A 4IFDJ 1OXTA 3OWFA 3KBGA 3FPPA 3TSSA 2QF7A 3P7JA 4G57A 4HAEA 1XYIA 3H3VC 1SYEA 4H44C 1HTPA 3SK5A 4DNTB 1CTMA 1GJXA 1J9OA 2SEBD 2CVRA 1EYAA 1VCIA 3Q0AA 1EQTA 4DXGA 3OOCA 4CKBA 4EGVA 4X3SA 1OXSC 2K32A 1GUSA 2KCCA 5E4WC 1LT5D 2MP1A 2EE1A 1Y1VB 3SXHA 4AYBB 4KY6A 1EQVA 1GHJA 2EYPA 2WV6D 2CW0C 5IGCA 5LL6S 1XX8A 5EKLA 1K8MA 1RCVD 3M85A 4R9WA 4DU9A 3HOVB 4EQNA 1OO9B 2YU9B 4RKBA 4ABNA 5IODA 1KDBA 2F0UA 3ERQA 1STNA 4ZYSA 1S4ZA 1JC7A 1F77A 1L0XB 5LHY1 3PIP3 3I91A 5C0XH 2BE5C 4EQPA 3C3LA 3GTGB 2WACA 2AQ2B 2A6EC 1BNZA 2MUYA 3M4YA 5KYIA 3FKIB 1DYQA 1JB3A 4OL7A 1STAA 3ZYYX 4FO2A 5EGTA 2K05A 2C9OA 1LTID 2JYOA 2K6AA 2EY6A 1KLUD 1EU3A 2LKVA 1SMYC 5EKIA 1TQOA 3S16B 3R2TA 1ESFA 1YNJD 5CC4A 3NQTA 3CU7A 2WKDA 4U673 1LT4D 1DOMA 4KD3A 3FDTA 2B2VA 4WFN3 1BCPD 3JAME 1ESRA 1GUTA 5JAVA 1SE4A 3GTJB 3OPOA 4G7ZC 2F0OA 4XYQA 3FMCA 3QWNA 3QIAA 1E2WA 2BDOA 2R7ZB 1EEID 2HQEA 1EYCA 1SYFA 3CHBD 2EY5A 1H9JA 4C3JG 2K5DA 5IT9E 1QOHA 1PRTB 1YNNC 1Q1BA 3VR4A 3S2HB 1ZYRD 2EOTA 5K36H 4RGMA 1XXGA 3HS0C 2C5CA 3WOFA 1CQVA 1X3QA 5EJWA 2AQ1B 3NSWA 1WD1A 3O13A 4DK0A 4X3TA 5C4ZA 2G9HD 2RQXA 2EYJA 2NUCA 1LTTD 5DNFA 5IGFA 3GV3A 1ZXTA 1BCPB 5DM73 2XWBB 1ONLA 3GV6A 4I7ZC 5JEAH 1HXYD 2WAQB 3LWUA 1SAPA 5CYUA 3DEOA 1WTPA 1UEAB 1MD2D 5A2QE 4F87A 2K04A 5KGUA 1CM9A 2KCNA 5D3DA 1SEBD 4MN3A 5C3WA 1AP0A 2D9UA 4ZRZA 1GUGA 3V2TA 2IT1A 3T51B 3NHHA 2ICEC 1Z47A 1HQMC 1BQQT 2KJXA 1AZQA 1Y69U 2K28A 3I4LA 3MFGA 4XT3B 4O1NA 2IW3A 3PUWA 2EJFC 1GUNA 1JR0D 4BBSB 1HUNA 5EBCA 1FR3A 4FXGC 3K5MA 3NK9A 2XIWA 5BN4A 3MAQA 1STBA 2L55A 4KHZA 4DK1A 2E2IB 2XWJB 1LTGD 1U4PA 4CKCA 1DXMA 1E0BA 3KK7A 1JOOA 3QO2A 4H13C 3A7AB 2LFNA 4K5VA 5E1FA 2EZVA 5JJZA 3PMFA 1OXVA 2E76C 3NE5B 4XQNA 4FVMA 2NN6I 1PTOD 4KY7A 5IIFA 2XVSA 4U68A 4KHVA 4C3IG 1U4MA 3ITPA 1EIHA 5LL6X 1FNWA 1E2VA 4HTHA 3SHLA 3S9WA 1SE2A 1SYBA 3A7LA 2RSOA 1LTRD 3V05A 1B50A 1V1OA 3QG1A 1AZPA 1X3PA 4C2MB 3IFDA 2F0JA 1U4RA 3QB3A 4K5XA 2K5QA 2LMCB 3TMEA 4BY1B 1F2LA 2F0KA 3D6CA 4G7HC 2JSOA 4LJZC 1O7LA 2BOSA 3LX0A 5KRUA 1W6JA 5EPJA 2JA7B 2SOBA 4K8IA 2PPBC 2VUMB 1PZID 4IUPA 4DF7A 4XDXA 1FNUA 2XSCA 2F0QA 2AUKA 1JWUD 4TSSA 2FJ2A 3C1FA 1STEA 1LTAD 2F0EA 1F2ZA 1KABA 5FOBB 4NMZA 3SDZA 3I4MB 5CGKA 1BUVT 1V8QA 2F0LA 4ULLA 5IGDA 3DM1A 3MFYA 1KAAA 3D4RA 3K5OA 2A68D 4V0BA 1FGBD 4C3HG 2D2CC 4Q0FA 1IKMA 4F8MA 3NWSA 1D5ZC 1VF5C 1WTVA 4LAAA 3VYTA 2MGSA 3K57A 3RZOB 3BYYB 1EY8A 2WINB 1C4QA 2VXWA 4ZQ3A 3P75A 2Q8TA 4DAPA 1EEFD 1RTNA 2DN8A 5G3LF 3OMGA 1I4QA 4DXFA 4J8QA 2L9HA 1FYCA 5C4HA 1BO0A 3S1MB 1F9SA 2IPKD 4CJ2C 2JP1A 3SK4A 2IL8A 3CRKC 2Z4HA 5C5LA 1DOKA 3D6WA 5FLXE 1RHPA 4FNFA 3GP7A 3U9SA 3J80E 2NVTB 3A8IE 4OHJA 2MHVA 4M8AA 5FO9B 3D8GA 4UAIA 1SDFA 4ZKCB 4ZUIA 4Y7NB 3NBIA 5IOCA 2KOLA 2NBFA 1H9RA 4ID6A 4CGYB 1RTOA 1JCKB 3OSOA 2KECA 3KBXA 4WRDA 1STHA 3IFTA 4HMIA 2E2DC 4FXDA 1H9SA 3NXWA 2PW5A 1WTQA 3CKIB 3HEJA 3M7NA 4A3FB 2H4OA 1B1ZA 3EJIA 2L4NA 1G6ZA 1CA5A 4A3EB 4L63B 1PLFA 1VDZA 2L11A 4K5WA 2EVBA 2E2HB 2I07B 4C1NK 1S5ED 5ELCA 2FHTA 4HN7A 4BA2I 1PYWD 3VYUA 4XXEA 3AMUA 1T5XD 4KN7C 1EY7A 1PRTC 1LT3D 4K14A 3J80L 2RDHA 2QKIC 2NTTA 1B9MA 4PMCA 1TWFB 2RVLA 1WTWA 1PFNA 3I72A 3BDCA 3UI2A 2IX0A 1D5XC 1STGA 2NVYB 1QB5D 3I4NB 2K7VA 3U9OA 2XRSD 4M1UB 1ZEQX 1ENAA 4K8JA 1NUCA 1PRTF 1HFGA 3DEPA 4IUVA 3JAML 2HDMA 3C46A 1SNCA 2K03A 3QOJA 4OIKA 4IURA 1IYVA 3VR3A 5CV5A 4KMUC 3K6OA 4PNYA 4A3DB 3WDNA 1EL0A 3BDLA 3I3CA 1WCMB 4V190 3KLRA 1H9MA 1JORA 1CA6A 1PMRA 4NDXA 2EYMA 4YIJA 2YYZA 1HFNA 4PMWA 3OWEB 2GA4B 1PFMA 5CV8A 4KKSA 4IALA 1ET9A 2EXZA 4H7BA 5CV7A 2F0PA 2DNCA 1MSHA 2Z4IA 4RWSC 5JPMC 2FMCA 2WB1B 3TZDA 4ZAIA 1I4HA 3DWQA 4CHTB 2EY2A 2R6GA 2RDFA 5C5MA 5CR3A 2ZXOA 3TP5A 5T1IA 2RKSA 1IYUA 3PV0A 3X3MA 3PO2B 2A5HA 4BY7B 4HSPA 1GUWA 1PTOC 1WTRA 5COYA 1QE6A 3L7ZC 2KEEA 3E6ZX 1B44D 3NBHA 4ME5A 1HCZA 5KIXA 2PO4A 4IUUA 3T4AC 3OIPA 2EJMA 3K7AB 1F2MA 4BS9A 1SNMA 2NN6G 1IW7D 1NSNS 1TY0A 1O80A 4C3HB 1JICA 3D4DA 4DN4M 4FYDA 4KKUA 1TU2B 4Q5VA 1KNEA 3EQLC 1B3AA 2R3ZA 3DWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1II3 A;  4K2L A;  2PZT A;  1A2U A;  2EY1 A;  1JOO A;  2F0F A;  2F3W A;  2PQE A;  4KD4 A;  5CV4 A;  1JOK A;  3TP6 A;  5KYI A;  2ENB A;  1A2T A;  1JOR A;  5C4Z A;  4N9P A;  3EJI A;  1EY6 A;  4DFA A;  1U9R A;  2F0S A;  2QDB A;  3E5S A;  4K5V A;  4NDX A;  4OL7 A;  5E1F A;  1STA A;  2EYJ A;  2EYM A;  2F3V A;  3DMU A;  3PMF A;  4YIJ A;  3T13 A;  3T16 A;  2NUC A;  4F8M A;  4PMB A;  2EYL A;  3OWF A;  5IGF A;  5K5P A;  3H6M A;  5EGT A;  1SND A;  4NKL A;  4R8N A;  4LAA A;  5CV8 A;  4EVO A;  3QOL A;  5I9P A;  4IAL A;  4KY7 A;  4J1M A;  5IIF A;  2F0N A;  2KHS A;  4G57 A;  5DEH A;  2EY6 A;  5I6W A;  4KHV A;  3MVV A;  5KEE A;  1SYE A;  2EXZ A;  3EVQ A;  1EY8 A;  4K5W A;  3SK5 A;  4H7B A;  1TR5 A;  3C1E A;  5IGE A;  2F0V A;  2OEO A;  3ITP A;  4NP5 A;  5CV7 A;  2F0P A;  2RBM A;  5F2D A;  4ZQ3 A;  1SNP A;  2M00 A;  3NUC A;  3P75 A;  2LKV A;  2OXP A;  1EY9 A;  4ODG A;  4E6I A;  1TQO A;  5IGB A;  5C6A A;  1EYA A;  3MXP A;  4HTH A;  3SHL A;  3S9W A;  3OMG A;  3TP7 A;  4S3S A;  1SYB A;  3VA5 A;  5J22 A;  3DHQ A;  5KYL A;  5C4H A;  2EY2 A;  5M9O A;  1A3V A;  3MHB A;  5CC4 A;  2RDF A;  1JOQ A;  3NQT A;  3RUZ A;  1KDA A;  2EYH A;  4KJN A;  5C5M A;  5CR3 A;  1EY7 A;  4K14 A;  5J39 A;  3TP5 A;  5KGU A;  3SK4 A;  3SXH A;  2RKS A;  1EZ6 A;  2F0D A;  4KY6 A;  4KJO A;  3D4W A;  1EQV A;  5I9O A;  5CV6 A;  2F0J A;  4KD3 A;  5C5L A;  2EYP A;  4PMC A;  5C3W A;  5HUR A;  3SK8 A;  3QB3 A;  3ERO A;  3V2T A;  4K5X A;  5IGC A;  3BDC A;  1SNO A;  2PW7 A;  1A3T A;  3TME A;  4DGZ A;  4TRD A;  1STG A;  2F0K A;  3D6C A;  5EKL A;  2EYF A;  2PZW A;  1A3U A;  1SYG A;  4DU9 A;  5IGG A;  3MZ5 A;  3NHH A;  3U9O A;  5JAV A;  4IZ8 A;  5E3F A;  4EQN A;  2PZU A;  4WOR A;  3LX0 A;  5KRU A;  2F0H A;  2SNM A;  4QMG A;  3P1H A;  4ME5 A;  1ENA A;  2OF1 A;  3D8G A;  4RKB A;  5NUC A;  4K8J A;  4B9W A;  2F0O A;  2KQ3 A;  2SOB A;  4K8I A;  5J1Z A;  5KIX A;  1EY4 A;  1EY0 A;  4EQO A;  1NUC A;  1SYD A;  2SNS A;  4QB4 A;  1KDB A;  2F0U A;  4ZUI A;  5IOD A;  5ISR A;  4KV6 A;  1AEX A;  3SR1 A;  3R3O A;  3ERQ A;  4KTA A;  2O4X A;  2PYK A;  4DF7 A;  4KY5 A;  3SK6 A;  5IOC A;  2EYO A;  1F2M A;  5CV9 A;  1SNC A;  4QF4 A;  1SNM A;  3OMC A;  1STN A;  1EZ8 A;  2F0Q A;  2HQE A;  1EYC A;  3MEH A;  1ENC A;  1SYF A;  3QOJ A;  4B9X A;  1NSN S;  5JOB A;  2EY5 A;  3TP8 A;  1IHZ A;  5EKK A;  4ID6 A;  1SNQ A;  4K6D A;  2F0G A;  3C1F A;  3HZX A;  3NP8 A;  2F0M A;  2F0T A;  1EY5 A;  3D4D A;  5CV5 A;  3OSO A;  4HMJ A;  1EYD A;  3NK9 A;  2F0E A;  1F2Z A;  5DAU A;  5I6Y A;  1KAB A;  1STB A;  4WRD A;  4NMZ A;  4EQP A;  2F0W A;  4RKL A;  4F7X A;  1STH A;  5CGK A;  1STY A;  4PNY A;  5HGT A;  1TT2 A;  4IUN A;  2F0L A;  4K2K A;  1RKN A;  1F2Y A;  2WAC A;  4MIU A;  4ZUJ A;  5IGD A;  4HMI A;  5C3X A;  2F0I A;  3NXW A;  1KDC A;  1KAA A;  2PW5 A;  3BDL A;  4N9T A;  1SYC A;  4I65 A;  4J6H A;  3HEJ A; 
#chains in the Genus database with same CATH topology
 2B39 A;  2K75 A;  1QNK A;  4K2L A;  1DON A;  3NBH B;  1EWH A;  4LMQ D;  4ALP A;  2F0F A;  3J81 j;  2NVX B;  5A2Q L;  3CCS A;  3KLS A;  2BDN A;  3CF5 A;  1O7Z A;  3CPF A;  2F3V A;  4PMB A;  2JA5 H;  4TKO B;  2B2W A;  1TWA B;  4IQZ A;  1SND A;  4NKL A;  3S15 B;  1EU4 A;  3IKJ A;  1Q12 A;  4DR1 L;  1TWG B;  1WYD A;  5DEH A;  1CI3 M;  3ICE A;  1FJG L;  1YNN D;  3RLF A;  2NVY H;  5J3B A;  3STB D;  1DD2 A;  3BJU A;  3EIV A;  3ND9 A;  5JJK A;  1PH9 A;  3NTH A;  2J0T D;  2E5L Q;  4XQJ A;  3MTS A;  2B2V C;  4BY1 H;  3G7L A;  5FLX L;  1LTS D;  3RUZ A;  5IP7 H;  1YJW A;  3J7A V;  2E2J B;  2K52 A;  4BA1 I;  2KCT A;  2B2Y A;  5CV6 A;  4A3B H;  1OXU A;  2A1A A;  1TS3 A;  5GQO A;  4DR1 Q;  4DA2 A;  3RN5 A;  3TBI B;  3NQI A;  3IRB A;  4POF A;  4R8I A;  4RA8 A;  4CDC C;  5C44 H;  1BCP F;  4WOR A;  2TSS A;  2XRQ D;  3J81 E;  2K5N A;  3ULJ A;  3CCQ A;  1GXD C;  5J1Z A;  1LT6 D;  1WCM H;  2I46 A;  3KDF A;  2BH2 A;  2NVQ B;  5BR8 Q;  1I4G A;  1YNJ C;  2L12 A;  4JYA Q;  2NTS A;  3RMH A;  2PQA B;  1OXX K;  4A3J H;  3GD7 A;  1WI5 A;  1BDO A;  1ENC A;  1QUQ A;  2OTL A;  2M2L A;  4DV5 Q;  3IL8 A;  1I50 H;  3NP8 A;  4DAY A;  1TS4 A;  4A93 B;  3F2C A;  1X55 A;  2Q8R E;  4XYO A;  1WTH A;  4CDF C;  4UDU C;  1TVX A;  4JI4 Q;  2JXM B;  2AMC B;  4IUT A;  4OO1 G;  4RHS A;  3I8Z A;  4KN4 C;  3FPU B;  3S1R B;  3S24 A;  1EFI D;  1UE1 A;  3A56 A;  3S1Q H;  1RDP D;  3DLL A;  1PH1 A;  4KKT A;  3N6R A;  1X3G A;  1L0W A;  3SVM A;  4BBS G;  1WTX A;  4TVA B;  5FO8 B;  4NXN L;  3PIP A;  1HR0 L;  1SE8 A;  1EY6 A;  3I4O A;  1G29 1;  4NXM L;  3DMU A;  3HOY B;  4K6L A;  2EYL A;  3KF6 B;  2RA4 A;  2NYZ D;  1TWH B;  1W3S A;  1VQN A;  3OIQ A;  5I6W A;  4A3F H;  3CRL C;  4ZK9 B;  3NEM A;  2AWO A;  3TDQ A;  1TR5 A;  3I90 A;  1QIL A;  3MXU A;  2UXB L;  2CKZ B;  1A8V A;  5F2D A;  4YY3 Q;  1MJC A;  4PV1 C;  4GLX A;  5IT9 c;  5C6A A;  2NZ1 D;  1H9K A;  4OWX B;  3GTO B;  5KYL A;  2CFM A;  3OHX C;  5IWA L;  1W6K A;  4HCE A;  4RCN A;  4JI8 L;  1CHP D;  4FP5 D;  4IFD G;  1HQR D;  4PG3 A;  1RL2 A;  4OGQ C;  4LF4 L;  3M7G A;  2N55 A;  4JYA L;  4X65 L;  2A68 C;  2A69 D;  5C0X G;  4C1N I;  1JWS D;  2O2L D;  2FIN B;  1SNO A;  1R4P B;  3GDE A;  4LF7 Q;  1Y8O B;  4DV6 Q;  1Q46 A;  2AQ3 B;  5D3I B;  1N32 L;  4B08 A;  3JAM c;  1JJC B;  2SNM A;  4FF3 A;  1XJV A;  4YWM A;  2OT2 A;  2VNU D;  1EY4 A;  1PZJ D;  3CCV A;  2SNS A;  2UUA L;  3DWA A;  1QVG A;  3AEV A;  4LF4 Q;  1B53 A;  1ROD A;  1BBX C;  2RSN A;  1EIG A;  5IYD H;  3BG3 A;  3GTM H;  3RZD B;  3BVM A;  3G48 A;  4YWL A;  2JA5 B;  3TP8 A;  4A3M B;  1ZKO A;  4K6D A;  2DGY A;  4B3M L;  2F0T A;  1O7Y A;  2OTJ A;  4IPG A;  1TWC B;  3H09 A;  5KNB A;  4EX5 A;  4JI2 Q;  2X6G A;  1K0S A;  3UDF A;  2EPB A;  4L5S A;  4ILW A;  3A54 A;  1Y14 B;  4LWC A;  1BF4 A;  2PCF B;  1FNV A;  3HKZ G;  3CC7 A;  1VQE A;  1IYJ B;  2L1B A;  3SEB A;  2JN4 A;  1HR0 W;  1M8A A;  4FDB A;  4JW0 A;  2CW0 D;  4N9T A;  5FLM H;  1IBM L;  4IN3 A;  4C56 C;  3GQB A;  4ZKB B;  3HOV H;  2F3W A;  5GAE C;  5KND A;  5M3M G;  1Z7T A;  2KUM A;  2WP8 J;  2F0S A;  4DFA A;  2KED A;  2QDB A;  2YU9 H;  1YJ9 A;  1L2F A;  2O5I C;  5EAY A;  1D1K A;  3MXG A;  3AB9 A;  5K5P A;  1XTC D;  2NB0 A;  1A0I A;  3V96 A;  1V1P B;  1DCZ A;  3CCR A;  1Q3L A;  1WTO A;  3URY A;  4DR2 L;  4JI4 L;  1U0L A;  1PH6 A;  5AFW A;  5GAD C;  1S3O A;  2Z8L A;  4GOP A;  2R93 G;  1DM0 B;  4LF6 Q;  4HID A;  4IUQ A;  5JVH 3;  4A3I B;  2DY7 A;  1E2Z A;  1XNR Q;  1FVI A;  4S3S A;  3PCO B;  4UP9 A;  2R92 H;  3EFX D;  2HUG A;  3X3N A;  4L8J A;  3CW2 C;  4A3J G;  3S1Q B;  2HHH L;  3BU2 A;  1I4P A;  3J7A F;  4KJO A;  3I2Z A;  3M3Y B;  1TWH H;  1PFB A;  1UEB A;  3SK8 A;  4OEM B;  1PFS A;  3AQQ A;  4O2D A;  1SYG A;  2E74 C;  2JA6 B;  3OTO Q;  2Z9H A;  1OTC A;  4UP7 A;  3VYS A;  5DM6 3;  2PZU A;  1BBW A;  3RZO H;  3MEF A;  4NPS A;  3P1H A;  5M5Y H;  3PIO 3;  2H1E A;  1S72 A;  2QA4 A;  1J5E L;  2FMM A;  1IZ6 A;  2DUD A;  3PF4 A;  4GNX B;  2VB3 X;  2FFK B;  1CHQ D;  2ALY B;  2N49 A;  5IT9 L;  4A3E G;  1H95 A;  3KFU A;  2JJQ A;  2AUJ D;  2PYK A;  4KY5 A;  2B2T C;  2B63 H;  1F9P A;  3PO3 H;  3EBE A;  4A3K B;  3Q24 A;  1YI2 A;  1CT1 D;  3HGB A;  1YBY A;  3RD4 A;  3LNN A;  3RN2 A;  5L37 A;  4QQB X;  5JVG 3;  3FEW X;  5EKK A;  1LAB A;  3BVZ A;  4GNX A;  2A6H D;  2IJ0 A;  2JA9 A;  1LUZ A;  4HMJ A;  4DPG A;  1X56 A;  3BZD B;  4EQ5 A;  5M5X B;  5M3F B;  1MHW C;  1FJG Q;  4BBR B;  1J5E Q;  1PDQ A;  3PUX A;  4PQX A;  2UUA Q;  3HOU B;  4C3H H;  4MZ9 A;  1SYC A;  4I65 A;  2RCF A;  1RD9 D;  1A2U A;  2EY1 A;  2I0Q A;  2N88 A;  2PQE A;  3I7F A;  4LUV A;  3BVG A;  5M5X H;  2B8F A;  3E5S A;  4LF7 L;  3F2U A;  2WAQ E;  3ONA B;  3RZD H;  1I94 L;  3NEL A;  5GAH C;  3K58 A;  1EWC A;  3VA7 A;  4A3I H;  4A3L H;  1K3R A;  2HDL A;  5I2X A;  2HHH Q;  3QOL A;  4YWK A;  4A93 H;  1XPO A;  3KUP A;  3EVQ A;  1VQB A;  3GTM B;  5IE8 A;  1ET6 A;  3C1E A;  5D65 A;  2RBM A;  4P2C B;  3ZJY C;  3E9H A;  3H0G B;  3M4Q A;  3PO2 H;  5IP9 H;  1B3Q A;  1B9N A;  3MXP A;  5LMN L;  3S17 B;  5JEA G;  5J22 A;  1J8I A;  3HOX B;  4AYB G;  3FRP B;  3HOY G;  1HZA A;  5J39 A;  2QCP X;  1HHV A;  2VB2 X;  1B70 B;  1PH3 A;  1K83 H;  5FKA C;  2K1B A;  3N52 A;  3HOZ B;  1EIY B;  1I6V C;  1CK1 A;  1S5F D;  4DAV A;  4DV1 L;  4C3J B;  3HRZ C;  4H0L C;  4BY7 G;  1Y8P B;  4GKJ L;  4DV3 Q;  2C35 B;  1WOC A;  2KA7 A;  3HKS A;  4DAY B;  2J4X A;  1QVF A;  1QG7 A;  3MZ5 A;  1R9T B;  1HR0 Q;  4DV1 Q;  3OW2 A;  1GO3 E;  1NCV A;  1X3E A;  2CH4 A;  1QUQ B;  2AWN A;  5ELD A;  5EPK A;  2OF1 A;  4ME3 A;  4B9W A;  4HJA A;  3Q22 A;  1IW7 C;  3NWT A;  4EQO A;  5K36 G;  3AU7 A;  1SJE D;  1IKL A;  2BA0 A;  4P73 A;  4G4K A;  5CV9 A;  4FXK C;  4RMF A;  3TZU A;  3Q23 A;  3D0F A;  4BBR H;  4DV4 L;  4HCS A;  4DK6 C;  4X3K A;  2R92 B;  2R7F A;  1NMG A;  4OON A;  4HIK A;  4P71 A;  4OIJ A;  3KYH C;  4JK1 C;  1C9O A;  4TQU S;  5DAU A;  5AJ3 L;  1C7Y A;  1KL9 A;  1STY A;  3TRE A;  1BOS A;  2XTI A;  1TWF H;  3VR5 A;  1JQY D;  4QGU A;  1PTO B;  2ZXP A;  2NN6 H;  5C0X J;  1W2B A;  2B63 G;  2RDG A;  1XMQ Q;  4N8F A;  2UXC L;  4CBV A;  3KLS X;  4A76 A;  1U9R A;  4POG A;  1IBL Q;  3F8T A;  2BCO A;  1WVL A;  1N34 L;  2HIX A;  1MBY A;  2VS1 A;  4R8N A;  5I9P A;  1KTK A;  2F0N A;  2E2H H;  5ELE A;  3K59 A;  3MVV A;  3E0J A;  3K0Y A;  4FF1 A;  2L0C A;  5CBE E;  2BH8 A;  2F0V A;  2IX3 A;  1Y1W B;  2PMZ B;  3FKI G;  3VR6 A;  5DLQ E;  5FO7 B;  4KK7 A;  3F1Z A;  4QUC A;  1N36 L;  1L1O B;  1G2T A;  1K28 A;  2F1M A;  4LW1 A;  3TP7 A;  1MIU A;  2UXB Q;  3DHQ A;  2X69 A;  1GVP A;  1NAP A;  3CCJ A;  2DJG C;  3KF6 A;  3BS1 A;  1SBB B;  3SE0 A;  2VZA A;  1YHB A;  3I4N G;  2JA6 G;  4BWG B;  1XPU A;  2F0D A;  3S2D B;  2WII B;  5I9O A;  3D4W A;  2ZTD A;  4JOI C;  2PI2 E;  2EDG A;  4TRD A;  2ES2 A;  2EYF A;  1SMY D;  3BZC A;  1DZ1 A;  5CBA E;  4IFD I;  3UDG A;  4A3J B;  3GTG H;  5A35 A;  2F4I A;  4RCO A;  1KIX A;  3H0G H;  1TWG H;  1MI2 A;  2F0H A;  4A4I A;  3RR5 A;  2KQ3 A;  1SYD A;  3JC6 6;  1UE6 A;  3GTJ H;  5M5W B;  3MXN A;  1AEX A;  1TS2 A;  3R3O A;  4KTA A;  4JI1 L;  3D3R A;  4RAU C;  3STB C;  3U4Z A;  3HOV G;  2EYO A;  1V1Q A;  1CZG A;  1B2T A;  1F9Q A;  2NWG A;  2CWP A;  1ENF A;  4DKA C;  1SXT A;  1HZ9 A;  3WOE A;  1EOV A;  5KNC A;  2D5D A;  3M3Y H;  5JPN C;  2I5H A;  5ELB A;  1PTO F;  1EYD A;  3S16 H;  2DY8 A;  2Y0S B;  1JMC A;  2SDF A;  5I6Y A;  1B4O A;  1Y1V G;  1K83 B;  4DR2 Q;  4YHH L;  3Q6S A;  3G6E A;  1G91 A;  1BXT A;  2ZT9 C;  4KHP Q;  1RKN A;  2M9V A;  2UUB Q;  1SRO A;  4RHR A;  1R4Q B;  1Q82 C;  1HRJ A;  3TS2 A;  4X3U A;  3TP6 A;  2ENB A;  1A2T A;  3WWV A;  1MGS A;  4N9P A;  2LXJ A;  4LK1 C;  3HKZ B;  2PQA A;  1EYG A;  2Q2T A;  1AN8 A;  1MSG A;  1M1K C;  1KQS A;  3H6M A;  4XT1 B;  3VR2 A;  4IPH A;  1VQ5 A;  2KVM A;  3TRZ A;  2CQA A;  4DNR B;  2F4V L;  2YTX A;  2WB1 G;  1K73 C;  1LV9 A;  4CDD C;  5IGE A;  2E5L L;  1HZC A;  4NP5 A;  3BDO A;  1I50 B;  1KRT A;  3NUC A;  1VQ4 A;  4FF4 A;  3T1H L;  3K5N A;  3CC2 A;  1AE3 A;  4DUY Q;  1CQF A;  3GTQ B;  1LAC A;  5M9O A;  2JE6 I;  1A3V A;  3MHB A;  3CCE A;  1JOQ A;  4LUZ A;  4NW2 A;  4KJN A;  1S5C D;  3BYT B;  1ICW A;  1BBU A;  1VF7 A;  4DR5 Q;  2HQL A;  5I2Y A;  1XNQ Q;  2L5T A;  3GTL B;  1Q81 C;  1PHJ A;  2JA6 H;  4LFB Q;  2PW7 A;  1UE7 A;  2V1C C;  3I70 A;  1GUO A;  3TQY A;  2A6H C;  2ZXR A;  4DR7 L;  2Z6K C;  3G6J B;  5E3F A;  3KOJ A;  4LFA Q;  5ELO A;  1Q1E A;  2K5V A;  1EY0 A;  1X32 A;  4LUO A;  1G2S A;  3IAY A;  4UY8 C;  3PO3 B;  1LTL A;  1HUM A;  3SK6 A;  2K5W A;  5EQ0 A;  2ICI A;  4IOA A;  2O5J C;  1AH9 A;  2QGQ A;  1EZ8 A;  3GTP B;  3MEH A;  3R2I A;  3KJO A;  5JOB A;  1GHK A;  1IHZ A;  3OW7 A;  1TY2 A;  5C3E H;  2ASB A;  1Q8I A;  1KD1 C;  5G3L D;  2X6L A;  1TII D;  1JWM D;  1IBK L;  4ZCK A;  1Q90 A;  2F0W A;  2Z1C A;  5HGT A;  2J7Z A;  1MKH A;  2AHO B;  4K2K A;  3PUZ A;  4ZUJ A;  4LF8 L;  4RGT A;  4DV7 L;  2NVX H;  1KDC A;  1I4X A;  4L6T B;  4RFB A;  1II3 A;  3PSI A;  3KLW A;  4KD4 A;  2NVT H;  4QUF A;  4N8X 1;  3GTK H;  2CH4 W;  4DR4 Q;  4XIG S;  2PNR C;  2JEA I;  5C4J B;  3T16 A;  2JA8 H;  3KF8 A;  1SSO A;  3GO5 A;  4EVO A;  2IHE A;  3PIO A;  4GOP C;  2KHS A;  1AW7 A;  4QIW B;  1VQF A;  5KEE A;  4A3G B;  1PZK D;  2R93 B;  4JI7 Q;  1NR2 A;  1QZH A;  2OEO A;  2XNA C;  1KC8 C;  1E1T A;  1SNP A;  4GZY C;  3S17 H;  1AFP A;  1D1I A;  1DOL A;  4E6I A;  2OXP A;  1Z6H A;  3DM3 A;  3S1N B;  1QJO A;  1X3F A;  4AQY L;  1PTO H;  3NTK A;  2VUM G;  2JA7 G;  1K8A C;  2DNE A;  2R7D A;  2EYH A;  5T1G A;  5BN5 A;  2RHS B;  5FLX c;  4JBW A;  1EZ6 A;  5IY0 A;  1LYL A;  5M3M B;  1S5D D;  2Z0S A;  4MNO A;  1S5B D;  3HP3 A;  1K0R A;  1DJR D;  4MHE A;  1N9W A;  2Y0S E;  5TSS A;  1VMC A;  3ERO A;  3W5O A;  4UHV A;  1A3T A;  4DGZ A;  1I3Q B;  1CKN B;  1RJT A;  5C44 B;  4DV0 Q;  1F9R A;  1VQG A;  1A3U A;  4OO1 I;  4QCL A;  4IZ8 A;  5ELF A;  5IYD G;  3K5L A;  5HY6 A;  4JI5 L;  1SR3 A;  2NVQ H;  5C0X I;  3C2P A;  2E8G A;  1Y8N B;  1O78 A;  1UNS A;  5ISR A;  3R93 A;  1QZG A;  4A3M G;  3T56 B;  4QF4 A;  3OMC A;  5E4X A;  3T53 B;  4X62 Q;  2Q2I A;  3W2D A;  3MXN B;  5FJ8 G;  4A3L G;  1HA6 A;  5H1S E;  4DAM A;  1EY5 A;  4HED A;  4F88 A;  3HOW B;  2HCC A;  2A69 C;  4Z9C B;  1V43 A;  2KBN A;  1FD7 D;  1KNA A;  4F7X A;  1K8O A;  2R61 A;  3QJY A;  1PXU A;  2QEJ C;  3E9I A;  1HPC A;  4IUN A;  4RGO S;  4IFD H;  2OWO A;  3VYR A;  2KHI A;  1ZYR C;  3H91 A;  4K0K Q;  3J7Y W;  1O7I A;  4UPA A;  2MO0 A;  1HNW L;  2LXK A;  4DR6 Q;  1A63 A;  1WFQ A;  2B8G A;  5M5Y B;  3S15 H;  5COR A;  3EA6 A;  3FKI H;  2IX1 A;  3MC0 B;  3S1N H;  1SMX A;  4L5R C;  5JEA J;  2B2U C;  3LWE A;  3B6Y A;  4GKK Q;  3MWY W;  2K50 A;  4UP8 A;  1S40 A;  3I56 A;  3DUZ A;  1VQP A;  4HSV A;  2KHJ A;  1CKO A;  2K5H A;  2M00 A;  1BCP C;  1IL8 A;  5D14 A;  5IGB A;  1I6H B;  1XPR A;  4P74 A;  3VA5 A;  1NJI C;  3VDY A;  1ILP A;  3GTK B;  3H3V H;  3NTI A;  1KDA A;  2F03 A;  2K33 A;  3HOU H;  3W1B A;  1R9T H;  1NR4 A;  2UU9 L;  4A3B B;  1LO5 D;  4OO1 H;  1BR9 A;  1XMO Q;  2NZH A;  2LY7 A;  4KI0 A;  2V4D A;  1D2B A;  2ID0 A;  1IL2 A;  5C3E B;  1L1O C;  1LTB D;  3A8J E;  2WKC A;  1L0Y B;  2JA8 B;  4Y52 H;  2E75 C;  2PZW A;  3TN2 A;  2B2U A;  1GM5 A;  5IYC G;  5IGG A;  1G8Z D;  1UUP A;  1QNU A;  3I55 A;  4HR7 B;  1QWY A;  4QMG A;  5C3X A;  1E7Z A;  5NUC A;  1D5M C;  1D6E C;  1RF2 D;  3HG9 A;  2R93 H;  4RGN A;  2G9D A;  1YJN A;  1VMP A;  4KV6 A;  3OYY A;  1TKW B;  3ERS X;  4B3T L;  3H94 A;  1U4L A;  2Q8I B;  3SGI A;  2O4X A;  4IO9 A;  2HCI A;  1EFW A;  2B2T A;  1VQA A;  1HA5 A;  5C44 G;  2N3S A;  3A8K E;  2BE5 D;  4B9X A;  2R7Z H;  2LS0 1;  1SNQ A;  1QCB D;  3CCL A;  2QIL A;  5C4X H;  2XN9 C;  4G7O C;  1CZW A;  5FK9 C;  4DUZ L;  4PZ6 A;  4R4Q A;  4LF5 L;  4A3G H;  2IY5 B;  4RKL A;  1M4V A;  4WJW A;  3D31 A;  1FL0 A;  2A74 C;  4ZLT F;  3S2H H;  5E7N A;  1TS5 A;  3MA2 B;  5EPL A;  5IP7 G;  4MIU A;  2A6E D;  4CKE A;  1C8C A;  2VY3 A;  4LFC L;  4BY1 G;  4R4O A;  2ATW A;  1YHQ A;  1X9N A;  2PZT A;  3DXJ C;  1I4R A;  3L3O C;  2K01 A;  1JOK A;  4GN3 B;  1UWV A;  2JEB I;  5IP9 G;  3BZK A;  3I73 A;  1EOT A;  2MJ8 A;  2EIF A;  3R8B A;  3T13 A;  3CQZ B;  2D62 A;  1ML0 D;  4J15 A;  1A6X A;  2TMP A;  1LLR D;  1PH2 A;  4J1M A;  3NEN A;  1SFO H;  2RHQ B;  1T5E A;  4PZ7 A;  3FVQ A;  1A62 A;  1CFM A;  1HTL D;  3A55 A;  2ZJP A;  1YHA A;  2K14 A;  4B3S Q;  1V1P A;  4I7A A;  3J81 L;  2B2W C;  2IWH A;  1PVO A;  1SE3 A;  1EY9 A;  4ODG A;  4C3I B;  1A15 A;  2MPM A;  3T1Y L;  2UU9 Q;  1LM0 A;  3PUY A;  1GOZ A;  1IBK Q;  3J7A 5;  1SFO B;  4JOI A;  3ND8 A;  4MTN A;  1WD0 A;  1H9S B;  1CUK A;  2B2Y C;  4RH6 A;  1BVS A;  1JE4 A;  3CMA A;  5HUR A;  1C48 A;  4IJL A;  3NPP A;  4FF2 A;  4CJ1 B;  1E24 A;  3GTQ H;  3L0O A;  2EJG C;  3AYH B;  4OXP A;  1Y1W G;  3PUV A;  1UAP A;  1EQQ A;  5EBD A;  4XQQ A;  4OWW B;  3W3A A;  5I4D A;  3PO3 G;  2I5L X;  3S14 B;  5C4X B;  4QB4 A;  1QVC A;  3HOX H;  5CMD A;  3SR1 A;  3P20 A;  4OX9 Q;  4LF9 L;  2ZM6 Q;  2WFW A;  1PRT D;  2MNA A;  1CSQ A;  1I6H H;  3U58 A;  3HOZ H;  2B63 B;  2F0G A;  3HZX A;  2F0M A;  2DJF C;  4DV2 Q;  1VQH A;  2VL6 A;  1SJH D;  4CJ0 B;  3M4O B;  3S2D H;  1XWE A;  4XTC S;  1WJJ A;  1TT2 A;  2MO1 A;  2BA1 A;  2UXD Q;  1F2Y A;  4GN4 B;  3KDF B;  1KLG D;  4GNX C;  2F0I A;  5JJL A;  1G6P A;  2F3I A;  2OCE A;  4B3T Q;  4J6H A;  2A73 B;  2CCZ A;  1I5F A;  2Q2U A;  1X6O A;  1CKM A;  1YIJ A;  5BN3 A;  5CV4 A;  1KXL A;  1V9P A;  2F4V Q;  3L9A X;  2CHB D;  4DNI A;  1ILQ A;  4O42 A;  1HNZ Q;  4IFD J;  1OXT A;  4GLV B;  3OWF A;  3KBG A;  3FPP A;  3TSS A;  2QF7 A;  3P7J A;  4G57 A;  4HAE A;  1XYI A;  3H3V C;  4B3R L;  1SYE A;  3J7Z C;  4H44 C;  1HTP A;  3SK5 A;  4DNT B;  2CWA A;  1JT8 A;  1PH5 A;  2WAQ G;  1CTM A;  2EQS A;  2UUB L;  1GJX A;  1J9O A;  2SEB D;  2CVR A;  1EYA A;  1VCI A;  2QDL A;  1KHI A;  3Q0A A;  1EQT A;  4DXG A;  3OOC A;  4CKB A;  4EGV A;  4HJ7 A;  4X3S A;  1OXS C;  2K32 A;  1GUS A;  2KCC A;  3S1R H;  5E4W C;  1B7Y B;  1LT5 D;  4QL5 A;  2MP1 A;  2EE1 A;  3CP0 A;  1Y1V B;  3SXH A;  1GD7 A;  2A19 A;  4AYB B;  3HOX G;  4KY6 A;  4LF9 Q;  1EQV A;  1GHJ A;  2EYP A;  4BXX G;  2WV6 D;  2CW0 C;  2AKW B;  4IPC A;  5IGC A;  5LL6 S;  1XX8 A;  5EKL A;  1KRS A;  1K8M A;  1RCV D;  3M85 A;  4R9W A;  4DU9 A;  3HOV B;  1PH8 A;  4EQN A;  2G5D A;  1OO9 B;  2YU9 B;  4RKB A;  4ABN A;  4JI6 L;  5IOD A;  1KDB A;  2F0U A;  3ULP A;  2YTY A;  3ERQ A;  1N33 L;  1STN A;  2R7Z G;  1JJG A;  4ZYS A;  1S4Z A;  1JC7 A;  1Q7Y C;  3FHW A;  1F77 A;  2B29 A;  1L0X B;  4R4I A;  5LHY 1;  3PIP 3;  5M3F H;  1VQL A;  3I91 A;  5C0X H;  4JVZ A;  2BE5 C;  4EQP A;  3C3L A;  1KAW A;  5M3F G;  4JPB W;  4AYB E;  3E3X A;  3GTG B;  4B3R Q;  2WAC A;  2AQ2 B;  3GTL H;  1HJP A;  4YCV A;  4C3I H;  5GAG C;  2A6E C;  3HOW G;  1BNZ A;  2MUY A;  1EWI A;  4P72 A;  4HIO A;  4AH6 A;  3M4Y A;  4X64 L;  5KYI A;  3FKI B;  1DYQ A;  1JB3 A;  4OL7 A;  1STA A;  4QY7 A;  2UUC L;  1VQD A;  2PMZ E;  4LFA L;  3ZYY X;  3I4M G;  4FO2 A;  5EGT A;  2K05 A;  2C9O A;  1LTI D;  2CQO A;  2JYO A;  2K6A A;  4NB3 A;  2UXC Q;  2EY6 A;  2IHF A;  4LFC Q;  3CD6 A;  3GTP H;  2E2I H;  1KLU D;  1EU3 A;  2LKV A;  2XGT A;  1SMY C;  5EKI A;  1TQO A;  1YNX A;  3S16 B;  2VQE Q;  4A3E H;  3R2T A;  3J80 c;  1ESF A;  1K3B C;  5AJ3 Q;  1YNJ D;  4JBJ A;  5CC4 A;  4KLK A;  2ZJQ A;  3NQT A;  2ZM6 L;  3CU7 A;  5LMN W;  4OX9 L;  2WKD A;  4U67 3;  1LT4 D;  1DOM A;  4KD3 A;  3FDT A;  1D8L A;  4HJ5 A;  2B2V A;  4WFN 3;  1NTG A;  1VQK A;  1BCP D;  3JAM E;  1ESR A;  1GUT A;  5JAV A;  1SE4 A;  5GRO A;  5IYB H;  3H3V I;  2OQ0 A;  5M5W H;  3GTJ B;  3OPO A;  4G7Z C;  2F0O A;  4XYQ A;  3FMC A;  3QWN A;  3QIA A;  1E2W A;  2BDO A;  1VQI A;  2R7Z B;  5LMU Q;  1GKH A;  1EEI D;  2HQE A;  1EYC A;  1SYF A;  3CAM A;  3CHB D;  2EY5 A;  4DK3 C;  1H9J A;  4C3J G;  2K5D A;  4HJ9 A;  1QOH A;  5LMU L;  5IT9 E;  1PRT B;  1YNN C;  1Q1B A;  3VR4 A;  3S2H B;  1ZYR D;  2EOT A;  5K36 H;  4RGM A;  1N33 Q;  1XXG A;  4A3B G;  4B3S L;  1VQ6 A;  3HS0 C;  4JI3 L;  1NMF A;  2C5C A;  2VW9 A;  3WOF A;  4X6A H;  4JI6 Q;  1CQV A;  1X3Q A;  4JI0 L;  3S14 H;  5EJW A;  1NNX A;  2AQ1 B;  3NSW A;  3K7U C;  1U5K A;  3O13 A;  2QEX A;  4DK0 A;  4X3T A;  5C4Z A;  1WD1 A;  4BY7 H;  3H15 A;  2G9H D;  2RQX A;  2EYJ A;  1VQM A;  1EUJ A;  2NUC A;  1LTT D;  5DNF A;  3Q8D A;  5IGF A;  3GV3 A;  1ZXT A;  3HOY H;  1BCP B;  5DM7 3;  2GN5 A;  1VQ8 A;  1JE5 A;  1YZ6 A;  2XWB B;  1ONL A;  3GV6 A;  1YIT A;  2VUM H;  4I7Z C;  3M9B A;  5JEA H;  4DR5 L;  1HXY D;  2WAQ B;  3LWU A;  1SAP A;  5CYU A;  3DEO A;  1WTP A;  4DR3 Q;  2JK8 A;  1UEA B;  3RNU A;  3FP9 A;  1J6Q A;  1MD2 D;  2A8V A;  2KEN A;  4BBR G;  4O0A A;  5A2Q E;  3T1H Q;  3M4P A;  4F87 A;  1JJ2 A;  2K04 A;  5KGU A;  1CM9 A;  2KCN A;  5D3D A;  1SEB D;  2VQF Q;  2JA8 G;  4MN3 A;  1ICF B;  5C3W A;  1AP0 A;  2D9U A;  4ZRZ A;  1GUG A;  3V2T A;  1L1O A;  1M90 C;  4JI5 Q;  4X64 Q;  2IT1 A;  3T51 B;  3NHH A;  3KF8 B;  2ICE C;  1EQR A;  1HQM C;  1Z47 A;  3U4V A;  1BQQ T;  5HGQ A;  2KJX A;  5IYC H;  2VQF L;  4DV0 L;  1E1O A;  1AZQ A;  1Y69 U;  2K28 A;  3OTO L;  4CDE C;  3TEH B;  3I4L A;  3UDI A;  1N8R C;  3MFG A;  1XMO L;  4XT3 B;  1E22 A;  1XMQ L;  4O1N A;  3S1M H;  3PUW A;  2IW3 A;  2PNH A;  3U50 C;  1G51 A;  2EJF C;  1GUN A;  1JR0 D;  4DR3 L;  4BBS B;  1HUN A;  5EBC A;  1FR3 A;  4FXG C;  2YTV A;  3M4O H;  3K5M A;  1SLJ A;  3NK9 A;  2XIW A;  5BN4 A;  3MAQ A;  1XTD A;  4MTK A;  1STB A;  3K7A H;  3A74 A;  2L55 A;  4KHZ A;  4JG2 A;  4DK1 A;  2E2I B;  2XWJ B;  1LTG D;  3CQZ H;  4C3J H;  4A93 G;  4JI1 Q;  1U4P A;  4CKC A;  1DXM A;  1E0B A;  4A3I G;  3KK7 A;  1JOO A;  2WB1 E;  3QO2 A;  4H13 C;  3I4M H;  3A7A B;  2LFN A;  4K5V A;  2L15 A;  5E1F A;  2EZV A;  5JJZ A;  3PMF A;  1OXV A;  2ZTE A;  4JI0 Q;  2E76 C;  3NE5 B;  4XQN A;  4FVM A;  4DR4 L;  2NN6 I;  3ULL A;  1PTO D;  4KY7 A;  5IIF A;  4JI3 Q;  2XVS A;  1SRU A;  2Q2H A;  4U68 A;  4KHV A;  4C3I G;  4JBK A;  1U4M A;  4LF8 Q;  2B3G A;  3ITP A;  1EIH A;  2D0P A;  3K8A A;  1VQ9 A;  5LL6 X;  1FNW A;  1E2V A;  4HTH A;  3SHL A;  3S9W A;  4GS3 A;  1SE2 A;  1SYB A;  3A7L A;  3F2B A;  2RSO A;  1LTR D;  1N36 Q;  3V05 A;  3TS0 A;  1B50 A;  1V1O A;  3QG1 A;  1AZP A;  1X3P A;  4A3C H;  4IOC A;  4C2M B;  3IFD A;  2F0J A;  1U4R A;  3QB3 A;  5M3M H;  3A5Z B;  2K5Q A;  4K5X A;  2LMC B;  3TME A;  4BY1 B;  1F2L A;  2F0K A;  3D6C A;  3JAM i;  4G7H C;  1E3P A;  2E2J H;  1IBL L;  2JSO A;  4LJZ C;  1O7L A;  4L5Q A;  2BOS A;  3LX0 A;  1I94 Q;  2D0O A;  5KRU A;  1W6J A;  5EPJ A;  3AFQ A;  4DV6 L;  2SOB A;  4K8I A;  2PPB C;  4LFB L;  2UXD L;  2VUM B;  2JA7 B;  1PZI D;  4IUP A;  3CC4 A;  1Q8K A;  4DF7 A;  4XDX A;  1FNU A;  2XSC A;  4L5T A;  4DV2 L;  4X65 Q;  2F0Q A;  3HOW H;  4DUZ Q;  2AUK A;  2N8N A;  2VQE L;  3PQI A;  4P75 A;  4A75 A;  1JWU D;  4TSS A;  2FJ2 A;  3C1F A;  4R4C A;  1STE A;  1LTA D;  2RCN A;  4JI8 Q;  3F2D A;  4DUY L;  2F0E A;  1F2Z A;  5IWA Q;  1KAB A;  5FOB B;  4NMZ A;  4YCU A;  3HKZ E;  3SDZ A;  3I4M B;  5CGK A;  1YVC A;  4DV4 Q;  1BUV T;  1V8Q A;  2F0L A;  4ULL A;  1P8L A;  5IGD A;  3DM1 A;  3CXC A;  3MFY A;  4YY3 L;  1KAA A;  3CCU A;  3D4R A;  3K5O A;  2UUC Q;  2A68 D;  4V0B A;  1FGB D;  4C3H G;  2D2C C;  1K9M C;  4Q0F A;  4OWT B;  3J81 i;  1IKM A;  4F8M A;  3NWS A;  2N78 A;  1D5Z C;  3L2P A;  3I4N H;  1VF5 C;  4QIW E;  1WTV A;  4LAA A;  3VYT A;  5FLM G;  2MGS A;  3K57 A;  3RZO B;  4NXN Q;  3BYY B;  2F52 A;  4GLA C;  3G71 A;  1EY8 A;  2WIN B;  1C4Q A;  3K80 C;  2VXW A;  1Y1V H;  4ZQ3 A;  3P75 A;  2Q8T A;  4DAP A;  1EEF D;  1RTN A;  2DN8 A;  5G3L F;  3A5U A;  5JJI A;  3OMG A;  1I4Q A;  1C0A A;  4DXF A;  4J8Q A;  2L9H A;  1FYC A;  5C4H A;  1DGS A;  1BO0 A;  1MJE A;  4JC0 A;  1F9S A;  3S1M B;  2IPK D;  3J80 i;  4CJ2 C;  2JP1 A;  3SK4 A;  4LF6 L;  4GKK L;  2IL8 A;  3CRK C;  2Z4H A;  4HIM A;  2GVA A;  1YEZ A;  5C5L A;  2ZTC A;  1DOK A;  3CME A;  3D6W A;  5FLX E;  3H0G G;  4R1J A;  4JBM A;  1RHP A;  4FNF A;  3GP7 A;  3HFZ B;  4IJH A;  3U9S A;  3J80 E;  2NVT B;  3LGJ A;  3A8I E;  2YV5 A;  4OHJ A;  1SN8 A;  2MHV A;  4M8A A;  5FO9 B;  3KJP A;  2QW7 A;  4WJ4 A;  3D8G A;  4UAI A;  1SDF A;  4K0K L;  3AFP A;  4JCV E;  4ZKC B;  2HD3 A;  4ZUI A;  1PH4 A;  2OQK A;  4Y7N B;  4RG1 A;  3NBI A;  2HT1 A;  5IOC A;  5IYB G;  1ASY A;  2KOL A;  2Z6K A;  2NBF A;  4LNQ A;  1H9R A;  4ID6 A;  4CGY B;  1RTO A;  1JCK B;  3QR8 A;  3OSO A;  2KEC A;  4X62 L;  3KBX A;  4A3D G;  2ZJR A;  4WRD A;  1X65 A;  3W1G A;  4C2M H;  1STH A;  4B3M Q;  3UE0 A;  3IFT A;  3PF5 A;  4HMI A;  2E2D C;  4FXD A;  1H9S A;  3NXW A;  2PW5 A;  1WTQ A;  3CKI B;  3HEJ A;  3M7N A;  4IPD A;  4AIM A;  1HNZ L;  1TWC H;  1JB7 A;  4A3F B;  4APV A;  2H4O A;  4A3K G;  1B1Z A;  3EJI A;  2I5M X;  2L4N A;  1ASZ A;  1G6Z A;  1CA5 A;  4BBS H;  1N32 Q;  4A3E B;  2Y0S G;  2EXD A;  4L63 B;  1PLF A;  1Y1W H;  1VDZ A;  1AE2 A;  1VQJ A;  2L11 A;  4YCW A;  4KHP L;  4K5W A;  2EVB A;  2E2H B;  2I07 B;  1X54 A;  1NY4 A;  4C1N K;  1S5E D;  4A3G G;  5ELC A;  2FHT A;  4HN7 A;  4BA2 I;  1PYW D;  5C4X G;  3VYU A;  4XXE A;  3AMU A;  1T5X D;  4KN7 C;  1EY7 A;  1PRT C;  1LT3 D;  4K14 A;  3J80 L;  1VQO A;  2RDH A;  2QKI C;  2NTT A;  4JV5 Q;  1B9M A;  4PMC A;  1TWF B;  2RVL A;  1PH7 A;  1WTW A;  1PFN A;  3I72 A;  3BDC A;  3UI2 A;  2IX0 A;  1P16 A;  4Y7N H;  1D5X C;  1STG A;  1VS0 A;  4DR6 L;  1HNW Q;  2NVY B;  1QB5 D;  3I4N B;  2K7V A;  3U9O A;  2XRS D;  4M1U B;  1HH2 P;  4OEL B;  1ZEQ X;  1VQC A;  5ELN A;  4GOP B;  1ENA A;  4K8J A;  4GKJ Q;  1NUC A;  4DV7 Q;  1PRT F;  1IBM Q;  1HFG A;  3RLO A;  3DEP A;  2MFI A;  4IUV A;  3RLN A;  3JAM L;  2HDM A;  3C46 A;  1SNC A;  4QJF A;  2K03 A;  2MQH A;  1NE3 A;  4X66 Q;  3K0X A;  3T1Y Q;  4A3F G;  3QOJ A;  1D7Q A;  4OIK A;  4IUR A;  1IYV A;  4JI2 L;  3VR3 A;  5CV5 A;  2RF4 A;  3PO2 G;  4KMU C;  4BXX H;  4PZ8 A;  2FXQ A;  2P5Z X;  3K6O A;  1PV4 A;  3A0J A;  3K81 C;  4PNY A;  4A3K H;  4A3C G;  3CCM A;  4A3D B;  3WDN A;  1EL0 A;  3BDL A;  3I3C A;  2JA7 H;  1HZB A;  1I3Q H;  2PI2 A;  1K8G A;  1WCM B;  1N34 Q;  4V19 0;  2JA5 G;  3KLR A;  1H9M A;  1JOR A;  1CA6 A;  1PMR A;  4DR7 Q;  4NDX A;  2EYM A;  3UDX A;  4YIJ A;  2YYZ A;  1HFN A;  4PMW A;  4A3D H;  3OWE B;  1UE5 A;  1CKN A;  2GA4 B;  5C4J H;  1PFM A;  1XNQ L;  5CV8 A;  4KKS A;  4IAL A;  1VQ7 A;  1PYS B;  1CSP A;  1Q86 C;  1PA6 A;  1ET9 A;  2R92 G;  4LF5 Q;  2EXZ A;  4H7B A;  1TXY A;  5CV7 A;  2F0P A;  3J81 c;  2K4K A;  2DNC A;  4AQY Q;  1MSH A;  2Z4I A;  4RWS C;  5JPM C;  2FMC A;  2WB1 B;  3TZD A;  4ZAI A;  1I4H A;  1WCM G;  3DWQ A;  2HIV A;  4CHT B;  4H02 A;  2EY2 A;  3UE1 A;  3HOU G;  2R6G A;  4JI7 L;  2RDF A;  2KCM A;  5C5M A;  5CR3 A;  4HJ8 A;  3PGZ A;  2ZXO A;  3TP5 A;  5BR8 L;  3E0E A;  4R4T A;  2RKS A;  1IYU A;  3PV0 A;  5T1I A;  3X3M A;  4X66 L;  4A3M H;  3PO2 B;  1PYB A;  2A5H A;  2GVB A;  4BY7 B;  4HSP A;  5C3E G;  1GUW A;  1PTO C;  1WTR A;  5COY A;  3HOZ G;  2Z6B A;  1QE6 A;  4WJ3 M;  3L7Z C;  3CPW A;  2KEE A;  3E6Z X;  4NXM Q;  3ER0 A;  4DV3 L;  1NBW A;  3G4S A;  1B44 D;  3NBH A;  2LSS A;  1B8A A;  1EIF A;  4ME5 A;  1HCZ A;  5KIX A;  2PO4 A;  4IUU A;  3T4A C;  1T9H A;  3OIP A;  2EJM A;  2JQO A;  3K7A B;  1F2M A;  4GN5 A;  4BS9 A;  1HNX Q;  4YHH Q;  1SNM A;  2NN6 G;  4JV5 L;  1IW7 D;  2H5X A;  1NSN S;  1TY0 A;  1O80 A;  4C3H B;  5LMN Q;  1JIC A;  3D4D A;  1Z9F A;  1XNR L;  4DN4 M;  4FYD A;  4KKU A;  3EN2 A;  4DV5 L;  1IXR A;  1RIP A;  2NZO A;  3GTO H;  1BKB A;  1TU2 B;  1FGU A;  4Q5V A;  1KNE A;  3EQL C;  1B3A A;  1TWA H;  5FJ8 H;  2R3Z A;  3DWP A;  1HNX L; 
#chains in the Genus database with same CATH homology
 2B39 A;  1QNK A;  4K2L A;  1DON A;  1EWH A;  4LMQ D;  2NVX B;  2F0F A;  5A2Q L;  3KLS A;  2BDN A;  1O7Z A;  2F3V A;  4PMB A;  4TKO B;  2B2W A;  1TWA B;  4IQZ A;  1SND A;  4NKL A;  3S15 B;  1EU4 A;  3IKJ A;  1Q12 A;  1TWG B;  5DEH A;  1CI3 M;  1YNN D;  3RLF A;  1DD2 A;  3ND9 A;  3NTH A;  2J0T D;  4XQJ A;  3MTS A;  2B2V C;  3G7L A;  5FLX L;  1LTS D;  3RUZ A;  3J7A V;  2E2J B;  4BA1 I;  2B2Y A;  5CV6 A;  1OXU A;  1TS3 A;  4DA2 A;  3TBI B;  3NQI A;  4R8I A;  4RA8 A;  1BCP F;  4WOR A;  2TSS A;  2XRQ D;  3J81 E;  1GXD C;  5J1Z A;  1LT6 D;  2I46 A;  2NVQ B;  1I4G A;  1YNJ C;  2L12 A;  2NTS A;  3RMH A;  1OXX K;  3GD7 A;  1BDO A;  1ENC A;  2M2L A;  3IL8 A;  3NP8 A;  4DAY A;  1TS4 A;  4A93 B;  2Q8R E;  4XYO A;  4UDU C;  1TVX A;  2JXM B;  4IUT A;  4OO1 G;  4RHS A;  3I8Z A;  4KN4 C;  3FPU B;  3S1R B;  1EFI D;  3A56 A;  1RDP D;  4KKT A;  3N6R A;  3SVM A;  1WTX A;  5FO8 B;  1EY6 A;  1G29 1;  3DMU A;  3HOY B;  4K6L A;  2EYL A;  2RA4 A;  2NYZ D;  1TWH B;  3OIQ A;  5I6W A;  3CRL C;  4ZK9 B;  2AWO A;  3TDQ A;  1TR5 A;  3I90 A;  1QIL A;  3MXU A;  5F2D A;  4PV1 C;  5C6A A;  2NZ1 D;  1H9K A;  3GTO B;  5KYL A;  3OHX C;  1W6K A;  4HCE A;  4RCN A;  1CHP D;  4FP5 D;  4IFD G;  1HQR D;  4OGQ C;  3M7G A;  2N55 A;  2A68 C;  2A69 D;  5C0X G;  4C1N I;  1JWS D;  2O2L D;  2FIN B;  1SNO A;  1R4P B;  1Y8O B;  2AQ3 B;  5D3I B;  4B08 A;  4FF3 A;  2SNM A;  2OT2 A;  2VNU D;  1EY4 A;  1PZJ D;  2SNS A;  3DWA A;  1B53 A;  1ROD A;  1BBX C;  2RSN A;  1EIG A;  3BG3 A;  3RZD B;  3BVM A;  2JA5 B;  4A3M B;  3TP8 A;  1ZKO A;  4K6D A;  2F0T A;  1O7Y A;  1TWC B;  3H09 A;  5KNB A;  2X6G A;  2EPB A;  4ILW A;  3A54 A;  1BF4 A;  2PCF B;  1FNV A;  2L1B A;  3SEB A;  1M8A A;  2CW0 D;  4N9T A;  4IN3 A;  4C56 C;  3GQB A;  4ZKB B;  2F3W A;  5KND A;  1Z7T A;  2KUM A;  2WP8 J;  2F0S A;  4DFA A;  2KED A;  2QDB A;  2O5I C;  1D1K A;  3MXG A;  3AB9 A;  5K5P A;  1XTC D;  2NB0 A;  3V96 A;  1V1P B;  1DCZ A;  1Q3L A;  1WTO A;  3URY A;  5AFW A;  2Z8L A;  1DM0 B;  4IUQ A;  5JVH 3;  4A3I B;  2DY7 A;  1E2Z A;  4S3S A;  3EFX D;  2HUG A;  3X3N A;  4L8J A;  3S1Q B;  1I4P A;  3J7A F;  4KJO A;  3M3Y B;  1PFB A;  3SK8 A;  1SYG A;  2E74 C;  2JA6 B;  3VYS A;  5DM6 3;  2PZU A;  3P1H A;  3PIO 3;  2H1E A;  2FMM A;  2VB3 X;  2FFK B;  1CHQ D;  5IT9 L;  2AUJ D;  2PYK A;  4KY5 A;  2B2T C;  1F9P A;  4A3K B;  3Q24 A;  1CT1 D;  3HGB A;  3RD4 A;  3LNN A;  5JVG 3;  3FEW X;  5EKK A;  1LAB A;  3BVZ A;  2A6H D;  2IJ0 A;  4HMJ A;  3BZD B;  5M5X B;  5M3F B;  4BBR B;  1PDQ A;  3PUX A;  4PQX A;  3HOU B;  1SYC A;  4I65 A;  1RD9 D;  1A2U A;  2EY1 A;  2N88 A;  2PQE A;  3BVG A;  2B8F A;  3E5S A;  3F2U A;  3ONA B;  3K58 A;  1EWC A;  3VA7 A;  2HDL A;  5I2X A;  3QOL A;  3KUP A;  3EVQ A;  3GTM B;  1ET6 A;  3C1E A;  5D65 A;  2RBM A;  4P2C B;  3H0G B;  1B9N A;  3MXP A;  3S17 B;  5JEA G;  5J22 A;  1J8I A;  3HOX B;  3FRP B;  5J39 A;  1HHV A;  2QCP X;  2VB2 X;  5FKA C;  2K1B A;  3N52 A;  3HOZ B;  1I6V C;  1CK1 A;  1S5F D;  4DAV A;  4C3J B;  3HRZ C;  4H0L C;  1Y8P B;  2KA7 A;  2J4X A;  1QG7 A;  1R9T B;  3MZ5 A;  1NCV A;  2AWN A;  5ELD A;  5EPK A;  2OF1 A;  4B9W A;  3Q22 A;  1IW7 C;  3NWT A;  4EQO A;  5K36 G;  3AU7 A;  1SJE D;  1IKL A;  2BA0 A;  4G4K A;  5CV9 A;  4FXK C;  3Q23 A;  3TZU A;  4HCS A;  4X3K A;  2R92 B;  4OIJ A;  5DAU A;  4JK1 C;  4TQU S;  1STY A;  1BOS A;  3VR5 A;  1JQY D;  1PTO B;  2ZXP A;  2NN6 H;  5C0X J;  2RDG A;  4CBV A;  3KLS X;  1U9R A;  2BCO A;  1WVL A;  1MBY A;  4R8N A;  5I9P A;  1KTK A;  2F0N A;  5ELE A;  3K59 A;  3MVV A;  3E0J A;  3K0Y A;  4FF1 A;  2L0C A;  5CBE E;  2F0V A;  2IX3 A;  1Y1W B;  2PMZ B;  3VR6 A;  5FO7 B;  4KK7 A;  1G2T A;  4QUC A;  2F1M A;  3TP7 A;  3DHQ A;  2X69 A;  1NAP A;  3BS1 A;  1SBB B;  3SE0 A;  4BWG B;  2F0D A;  3S2D B;  2WII B;  5I9O A;  3D4W A;  2EDG A;  4TRD A;  2EYF A;  1SMY D;  1DZ1 A;  5CBA E;  4IFD I;  4A3J B;  5A35 A;  2F4I A;  4RCO A;  2F0H A;  1MI2 A;  2KQ3 A;  1SYD A;  5M5W B;  3MXN A;  1AEX A;  1TS2 A;  3R3O A;  4KTA A;  3D3R A;  4RAU C;  1B2T A;  2EYO A;  1CZG A;  1F9Q A;  2NWG A;  1ENF A;  1SXT A;  3WOE A;  5KNC A;  2D5D A;  5JPN C;  5ELB A;  1PTO F;  1EYD A;  2DY8 A;  2Y0S B;  2SDF A;  5I6Y A;  1B4O A;  1K83 B;  1G91 A;  3Q6S A;  1BXT A;  2ZT9 C;  1RKN A;  2M9V A;  4RHR A;  1R4Q B;  1HRJ A;  4X3U A;  3TP6 A;  2ENB A;  1A2T A;  1MGS A;  4N9P A;  4LK1 C;  3HKZ B;  1AN8 A;  1MSG A;  3H6M A;  4XT1 B;  3VR2 A;  2KVM A;  2CQA A;  4DNR B;  1LV9 A;  5IGE A;  4NP5 A;  3BDO A;  1I50 B;  3NUC A;  4FF4 A;  3K5N A;  1CQF A;  3GTQ B;  1LAC A;  5M9O A;  2JE6 I;  1A3V A;  3MHB A;  1JOQ A;  4NW2 A;  4KJN A;  1S5C D;  3BYT B;  1ICW A;  1VF7 A;  5I2Y A;  2L5T A;  3GTL B;  2PW7 A;  3I70 A;  1GUO A;  2A6H C;  2ZXR A;  3G6J B;  5E3F A;  1Q1E A;  1EY0 A;  1X32 A;  1G2S A;  3IAY A;  3PO3 B;  1HUM A;  3SK6 A;  2K5W A;  5EQ0 A;  2ICI A;  2O5J C;  1EZ8 A;  3GTP B;  3MEH A;  3R2I A;  5JOB A;  1GHK A;  1IHZ A;  3OW7 A;  1TY2 A;  1Q8I A;  5G3L D;  2X6L A;  1TII D;  1JWM D;  1Q90 A;  2F0W A;  2Z1C A;  5HGT A;  2J7Z A;  4K2K A;  3PUZ A;  4ZUJ A;  4RGT A;  1KDC A;  1I4X A;  4L6T B;  4RFB A;  1II3 A;  4KD4 A;  4QUF A;  4XIG S;  2PNR C;  2JEA I;  5C4J B;  3T16 A;  3KF8 A;  1SSO A;  3GO5 A;  4EVO A;  2KHS A;  1AW7 A;  4QIW B;  4A3G B;  5KEE A;  2R93 B;  1PZK D;  1NR2 A;  2OEO A;  2XNA C;  1SNP A;  4GZY C;  1AFP A;  1D1I A;  1DOL A;  4E6I A;  2OXP A;  1Z6H A;  3S1N B;  1QJO A;  1PTO H;  3NTK A;  2DNE A;  2EYH A;  5T1G A;  5BN5 A;  4JBW A;  1EZ6 A;  5M3M B;  1S5D D;  1S5B D;  3HP3 A;  1DJR D;  4MHE A;  5TSS A;  1VMC A;  3ERO A;  4DGZ A;  1A3T A;  1I3Q B;  1RJT A;  5C44 B;  1F9R A;  4OO1 I;  1A3U A;  4QCL A;  4IZ8 A;  5ELF A;  3K5L A;  5C0X I;  3C2P A;  1Y8N B;  1O78 A;  1UNS A;  5ISR A;  3R93 A;  3T56 B;  4QF4 A;  3OMC A;  5E4X A;  3T53 B;  3W2D A;  1HA6 A;  3HOW B;  1EY5 A;  4HED A;  4F88 A;  2HCC A;  2A69 C;  4Z9C B;  1V43 A;  1FD7 D;  1KNA A;  4F7X A;  1K8O A;  2R61 A;  3QJY A;  1PXU A;  2QEJ C;  1HPC A;  4IUN A;  4RGO S;  4IFD H;  3VYR A;  1ZYR C;  3H91 A;  3J7Y W;  2B8G A;  5M5Y B;  5COR A;  3EA6 A;  2IX1 A;  3MC0 B;  5JEA J;  2B2U C;  3LWE A;  3MWY W;  3DUZ A;  4HSV A;  2M00 A;  1BCP C;  1IL8 A;  5D14 A;  5IGB A;  1I6H B;  3VA5 A;  1ILP A;  3GTK B;  3NTI A;  1KDA A;  2F03 A;  2K33 A;  1NR4 A;  4A3B B;  1LO5 D;  4OO1 H;  1BR9 A;  2LY7 A;  4KI0 A;  2V4D A;  1D2B A;  2ID0 A;  5C3E B;  1LTB D;  3A8J E;  2WKC A;  1L0Y B;  2JA8 B;  2E75 C;  2PZW A;  3TN2 A;  2B2U A;  5IGG A;  1G8Z D;  1UUP A;  1QNU A;  4HR7 B;  1QWY A;  4QMG A;  5C3X A;  5NUC A;  1D5M C;  1D6E C;  1RF2 D;  3HG9 A;  4RGN A;  2G9D A;  1VMP A;  4KV6 A;  1TKW B;  3H94 A;  1U4L A;  2Q8I B;  2O4X A;  2HCI A;  2B2T A;  1HA5 A;  3A8K E;  2BE5 D;  4B9X A;  2LS0 1;  1SNQ A;  1QCB D;  2QIL A;  2XN9 C;  4G7O C;  1CZW A;  5FK9 C;  4RKL A;  1M4V A;  4WJW A;  3D31 A;  2A74 C;  4ZLT F;  1TS5 A;  3MA2 B;  5EPL A;  4MIU A;  2A6E D;  4CKE A;  1C8C A;  2PZT A;  3DXJ C;  1I4R A;  3L3O C;  2K01 A;  1JOK A;  2JEB I;  3I73 A;  1EOT A;  2MJ8 A;  3R8B A;  3T13 A;  3CQZ B;  2D62 A;  1ML0 D;  1A6X A;  2TMP A;  1LLR D;  4J1M A;  1T5E A;  3FVQ A;  3A55 A;  1CFM A;  1HTL D;  1V1P A;  3J81 L;  2B2W C;  2IWH A;  1SE3 A;  1EY9 A;  4ODG A;  4C3I B;  1A15 A;  2MPM A;  3PUY A;  1GOZ A;  1SFO B;  3ND8 A;  1WD0 A;  1H9S B;  2B2Y C;  4RH6 A;  1JE4 A;  5HUR A;  1C48 A;  3NPP A;  4FF2 A;  4CJ1 B;  2EJG C;  3PUV A;  1UAP A;  5EBD A;  4XQQ A;  3W3A A;  5I4D A;  3S14 B;  5C4X B;  4QB4 A;  5CMD A;  3SR1 A;  3P20 A;  1PRT D;  2B63 B;  2F0G A;  3HZX A;  2F0M A;  1SJH D;  4CJ0 B;  3M4O B;  1XWE A;  4XTC S;  1TT2 A;  2BA1 A;  1F2Y A;  1KLG D;  2F0I A;  4J6H A;  2A73 B;  5BN3 A;  5CV4 A;  3L9A X;  2CHB D;  1ILQ A;  4O42 A;  4IFD J;  1OXT A;  3OWF A;  3KBG A;  3FPP A;  3TSS A;  2QF7 A;  3P7J A;  4G57 A;  4HAE A;  1XYI A;  3H3V C;  1SYE A;  4H44 C;  1HTP A;  3SK5 A;  4DNT B;  1CTM A;  1GJX A;  1J9O A;  2SEB D;  2CVR A;  1EYA A;  1VCI A;  3Q0A A;  1EQT A;  4DXG A;  3OOC A;  4CKB A;  4EGV A;  4X3S A;  1OXS C;  2K32 A;  1GUS A;  2KCC A;  5E4W C;  1LT5 D;  2MP1 A;  2EE1 A;  1Y1V B;  3SXH A;  4AYB B;  4KY6 A;  1EQV A;  1GHJ A;  2EYP A;  2WV6 D;  2CW0 C;  5IGC A;  5LL6 S;  1XX8 A;  5EKL A;  1K8M A;  1RCV D;  3M85 A;  4R9W A;  4DU9 A;  3HOV B;  4EQN A;  1OO9 B;  2YU9 B;  4RKB A;  4ABN A;  5IOD A;  1KDB A;  2F0U A;  3ERQ A;  1STN A;  4ZYS A;  1S4Z A;  1JC7 A;  1F77 A;  1L0X B;  5LHY 1;  3PIP 3;  3I91 A;  5C0X H;  2BE5 C;  4EQP A;  3C3L A;  3GTG B;  2WAC A;  2AQ2 B;  2A6E C;  1BNZ A;  2MUY A;  3M4Y A;  5KYI A;  3FKI B;  1DYQ A;  1JB3 A;  4OL7 A;  1STA A;  3ZYY X;  4FO2 A;  5EGT A;  2K05 A;  2C9O A;  1LTI D;  2JYO A;  2K6A A;  2EY6 A;  1KLU D;  1EU3 A;  2LKV A;  1SMY C;  5EKI A;  1TQO A;  3S16 B;  3R2T A;  1ESF A;  1YNJ D;  5CC4 A;  3NQT A;  3CU7 A;  2WKD A;  4U67 3;  1LT4 D;  1DOM A;  4KD3 A;  3FDT A;  2B2V A;  4WFN 3;  1BCP D;  3JAM E;  1ESR A;  1GUT A;  5JAV A;  1SE4 A;  3GTJ B;  3OPO A;  4G7Z C;  2F0O A;  4XYQ A;  3FMC A;  3QWN A;  3QIA A;  1E2W A;  2BDO A;  2R7Z B;  1EEI D;  2HQE A;  1EYC A;  1SYF A;  3CHB D;  2EY5 A;  1H9J A;  4C3J G;  2K5D A;  5IT9 E;  1QOH A;  1PRT B;  1YNN C;  1Q1B A;  3VR4 A;  3S2H B;  1ZYR D;  2EOT A;  5K36 H;  4RGM A;  1XXG A;  3HS0 C;  2C5C A;  3WOF A;  1CQV A;  1X3Q A;  5EJW A;  2AQ1 B;  3NSW A;  1WD1 A;  3O13 A;  4DK0 A;  4X3T A;  5C4Z A;  2G9H D;  2RQX A;  2EYJ A;  2NUC A;  1LTT D;  5DNF A;  5IGF A;  3GV3 A;  1ZXT A;  1BCP B;  5DM7 3;  2XWB B;  1ONL A;  3GV6 A;  4I7Z C;  5JEA H;  1HXY D;  2WAQ B;  3LWU A;  1SAP A;  5CYU A;  3DEO A;  1WTP A;  1UEA B;  1MD2 D;  5A2Q E;  4F87 A;  2K04 A;  5KGU A;  1CM9 A;  2KCN A;  5D3D A;  1SEB D;  4MN3 A;  5C3W A;  1AP0 A;  2D9U A;  4ZRZ A;  1GUG A;  3V2T A;  2IT1 A;  3T51 B;  3NHH A;  2ICE C;  1Z47 A;  1HQM C;  1BQQ T;  2KJX A;  1AZQ A;  1Y69 U;  2K28 A;  3I4L A;  3MFG A;  4XT3 B;  4O1N A;  2IW3 A;  3PUW A;  2EJF C;  1GUN A;  1JR0 D;  4BBS B;  1HUN A;  5EBC A;  1FR3 A;  4FXG C;  3K5M A;  3NK9 A;  2XIW A;  5BN4 A;  3MAQ A;  1STB A;  2L55 A;  4KHZ A;  4DK1 A;  2E2I B;  2XWJ B;  1LTG D;  1U4P A;  4CKC A;  1DXM A;  1E0B A;  3KK7 A;  1JOO A;  3QO2 A;  4H13 C;  3A7A B;  2LFN A;  4K5V A;  5E1F A;  2EZV A;  5JJZ A;  3PMF A;  1OXV A;  2E76 C;  3NE5 B;  4XQN A;  4FVM A;  2NN6 I;  1PTO D;  4KY7 A;  5IIF A;  2XVS A;  4U68 A;  4KHV A;  4C3I G;  1U4M A;  3ITP A;  1EIH A;  5LL6 X;  1FNW A;  1E2V A;  4HTH A;  3SHL A;  3S9W A;  1SE2 A;  1SYB A;  3A7L A;  2RSO A;  1LTR D;  3V05 A;  1B50 A;  1V1O A;  3QG1 A;  1AZP A;  1X3P A;  4C2M B;  3IFD A;  2F0J A;  1U4R A;  3QB3 A;  4K5X A;  2K5Q A;  2LMC B;  3TME A;  4BY1 B;  1F2L A;  2F0K A;  3D6C A;  4G7H C;  2JSO A;  4LJZ C;  1O7L A;  2BOS A;  3LX0 A;  5KRU A;  1W6J A;  5EPJ A;  2JA7 B;  2SOB A;  4K8I A;  2PPB C;  2VUM B;  1PZI D;  4IUP A;  4DF7 A;  4XDX A;  1FNU A;  2XSC A;  2F0Q A;  2AUK A;  1JWU D;  4TSS A;  2FJ2 A;  3C1F A;  1STE A;  1LTA D;  2F0E A;  1F2Z A;  1KAB A;  5FOB B;  4NMZ A;  3SDZ A;  3I4M B;  5CGK A;  1BUV T;  1V8Q A;  2F0L A;  4ULL A;  5IGD A;  3DM1 A;  3MFY A;  1KAA A;  3D4R A;  3K5O A;  2A68 D;  4V0B A;  1FGB D;  4C3H G;  2D2C C;  4Q0F A;  1IKM A;  4F8M A;  3NWS A;  1D5Z C;  1VF5 C;  1WTV A;  4LAA A;  3VYT A;  2MGS A;  3K57 A;  3RZO B;  3BYY B;  1EY8 A;  2WIN B;  1C4Q A;  2VXW A;  4ZQ3 A;  3P75 A;  2Q8T A;  4DAP A;  1EEF D;  1RTN A;  2DN8 A;  5G3L F;  3OMG A;  1I4Q A;  4DXF A;  4J8Q A;  2L9H A;  1FYC A;  5C4H A;  1BO0 A;  3S1M B;  1F9S A;  2IPK D;  4CJ2 C;  2JP1 A;  3SK4 A;  2IL8 A;  3CRK C;  2Z4H A;  5C5L A;  1DOK A;  3D6W A;  5FLX E;  1RHP A;  4FNF A;  3GP7 A;  3U9S A;  3J80 E;  2NVT B;  3A8I E;  4OHJ A;  2MHV A;  4M8A A;  5FO9 B;  3D8G A;  4UAI A;  1SDF A;  4ZKC B;  4ZUI A;  4Y7N B;  3NBI A;  5IOC A;  2KOL A;  2NBF A;  1H9R A;  4ID6 A;  4CGY B;  1RTO A;  1JCK B;  3OSO A;  2KEC A;  3KBX A;  4WRD A;  1STH A;  3IFT A;  4HMI A;  2E2D C;  4FXD A;  1H9S A;  3NXW A;  2PW5 A;  1WTQ A;  3CKI B;  3HEJ A;  3M7N A;  4A3F B;  2H4O A;  1B1Z A;  3EJI A;  2L4N A;  1G6Z A;  1CA5 A;  4A3E B;  4L63 B;  1PLF A;  1VDZ A;  2L11 A;  4K5W A;  2EVB A;  2E2H B;  2I07 B;  4C1N K;  1S5E D;  5ELC A;  2FHT A;  4HN7 A;  4BA2 I;  1PYW D;  3VYU A;  4XXE A;  3AMU A;  1T5X D;  4KN7 C;  1EY7 A;  1PRT C;  1LT3 D;  4K14 A;  3J80 L;  2RDH A;  2QKI C;  2NTT A;  1B9M A;  4PMC A;  1TWF B;  2RVL A;  1WTW A;  1PFN A;  3I72 A;  3BDC A;  3UI2 A;  2IX0 A;  1D5X C;  1STG A;  2NVY B;  1QB5 D;  3I4N B;  2K7V A;  3U9O A;  2XRS D;  4M1U B;  1ZEQ X;  1ENA A;  4K8J A;  1NUC A;  1PRT F;  1HFG A;  3DEP A;  4IUV A;  3JAM L;  2HDM A;  3C46 A;  1SNC A;  2K03 A;  3QOJ A;  4OIK A;  4IUR A;  1IYV A;  3VR3 A;  5CV5 A;  4KMU C;  3K6O A;  4PNY A;  4A3D B;  3WDN A;  1EL0 A;  3BDL A;  3I3C A;  1WCM B;  4V19 0;  3KLR A;  1H9M A;  1JOR A;  1CA6 A;  1PMR A;  4NDX A;  2EYM A;  4YIJ A;  2YYZ A;  1HFN A;  4PMW A;  3OWE B;  2GA4 B;  1PFM A;  5CV8 A;  4KKS A;  4IAL A;  1ET9 A;  2EXZ A;  4H7B A;  5CV7 A;  2F0P A;  2DNC A;  1MSH A;  2Z4I A;  4RWS C;  5JPM C;  2FMC A;  2WB1 B;  3TZD A;  4ZAI A;  1I4H A;  3DWQ A;  4CHT B;  2EY2 A;  2R6G A;  2RDF A;  5C5M A;  5CR3 A;  2ZXO A;  3TP5 A;  5T1I A;  2RKS A;  1IYU A;  3PV0 A;  3X3M A;  3PO2 B;  2A5H A;  4BY7 B;  4HSP A;  1GUW A;  1PTO C;  1WTR A;  5COY A;  1QE6 A;  3L7Z C;  2KEE A;  3E6Z X;  1B44 D;  3NBH A;  4ME5 A;  1HCZ A;  5KIX A;  2PO4 A;  4IUU A;  3T4A C;  3OIP A;  2EJM A;  3K7A B;  1F2M A;  4BS9 A;  1SNM A;  2NN6 G;  1IW7 D;  1NSN S;  1TY0 A;  1O80 A;  4C3H B;  1JIC A;  3D4D A;  4DN4 M;  4FYD A;  4KKU A;  1TU2 B;  4Q5V A;  1KNE A;  3EQL C;  1B3A A;  2R3Z A;  3DWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...