3SXHA

Crystal structure of staphylococcal nuclease variant delta+phs i92al103a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEAAVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92AL103A at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sxhA00
4DFAA 2EY2A 1SYBA 4I65A 4KTAA 4LAAA 5C4HA 2F0PA 4EQOA 3VA5A 5C3XA 1JOOA 3V2TA 3QB3A 3NP8A 2F0NA 5CR3A 3MVVA 1SNPA 4KJOA 5IIFA 1A3TA 2EYLA 1A3VA 1EZ8A 1A2UA 3E5SA 3ERQA 4NDXA 5CV4A 2OXPA 3HEJA 1SYCA 3NK9A 3SHLA 3TMEA 2F0LA 4N9TA 1EYCA 5NUCA 4ID6A 3HZXA 5C6AA 3SR1A 4F7XA 4QB4A 4H7BA 2PZUA 2ENBA 2OEOA 4IZ8A 1NUCA 5KGUA 4ME5A 5CV6A 1JORA 1EZ6A 4QMGA 3BDCA 1RKNA 5K5PA 1EY7A 5JOBA 2SOBA 2PQEA 4J6HA 3D4WA 1STNA 3P75A 4RKLA 3LX0A 5EKLA 3D8GA 2O4XA 3DHQA 1F2MA 4QF4A 5C3WA 3NHHA 1F2ZA 3H6MA 3ITPA 1EY4A 3MXPA 2F0HA 3PMFA 3R3OA 4TRDA 2F0SA 1EY9A 4NP5A 5CV8A 1TQOA 1EY6A 5CV9A 5J1ZA 1EYDA 5CC4A 4PMCA 4B9WA 3QOJA 1EY5A 3C1FA 3NUCA 1EQVA 4KD3A 1EYAA 1SYEA 1KDAA 3D4DA 5KYIA 1A3UA 5DAUA 2LKVA 5J22A 3EJIA 5KIXA 2F0FA 3D6CA 1SYGA 4DGZA 4ZQ3A 5IGBA 3OMGA 4J1MA 1STBA 4ZUIA 4S3SA 4DU9A 3TP7A 3EVQA 2PYKA 3T16A 1TT2A 1NSNS 3MEHA 2F0DA 3SK8A 1AEXA 4K5VA 5C5LA 3TP8A 4DF7A 4K5XA 5DEHA 1SNOA 4B9XA 3SXHA 2F0OA 1SNQA 5EGTA 3NXWA 5IGEA 1ENCA 3QOLA 4PMBA 2F3WA 3T13A 1F2YA 1U9RA 3S9WA 1KDCA 3TP5A 4K8IA 3TP6A 4WORA 4OL7A 5I9PA 4KD4A 5I9OA 2PZTA 5IGFA 3MHBA 4NKLA 4K6DA 4ZUJA 2M00A 1TR5A 4EQPA 3P1HA 5CV5A 4KY5A 4MIUA 1KDBA 2HQEA 5KYLA 4IALA 4EVOA 4HMIA 3NQTA 2F0EA 1JOQA 5E3FA 2F3VA 2PZWA 2WACA 4EQNA 2F0GA 5HURA 2KQ3A 2SNSA 5IGGA 4RKBA 5E1FA 5F2DA 4NMZA 2EYJA 4G57A 4HMJA 1SNCA 4ODGA 4R8NA 1KABA 2QDBA 5I6WA 4E6IA 4K2KA 5KEEA 3U9OA 1A2TA 4K5WA 2F0KA 2EYOA 3C1EA 2F0WA 2RKSA 4KV6A 2OF1A 1SNMA 3DMUA 3EROA 2EXZA 2F0UA 1ENAA 2KHSA 3OMCA 2F0VA 1SYFA 5IGCA 4KY7A 2F0MA 3BDLA 2EY6A 3RUZA 5I6YA 5C4ZA 4KHVA 3OSOA 4K2LA 2EY1A 1STAA 2F0TA 5EKKA 5CGKA 1STGA 5KRUA 2PW5A 2EY5A 4KJNA 2PW7A 5IGDA 5M9OA 5HGTA 4YIJA 5IODA 3MZ5A 4IUNA 5IOCA 4F8MA 5CV7A 5C5MA 1SYDA 5JAVA 4KY6A 2NUCA 1STYA 1II3A 2F0JA 3SK6A 3OWFA 4HTHA 4K8JA 1STHA 2EYPA 1SNDA 2SNMA 3SK5A 2F0QA 2RDFA 1EY0A 4WRDA 2EYHA 2EYFA 2RBMA 2F0IA 1EY8A 2EYMA 1JOKA 4PNYA 1IHZA 1KAAA 5ISRA 3SK4A 5J39A 4N9PA 4K14A
chains in the Genus database with same CATH superfamily
4C3HB 1AN8A 4JBKA 4EQOA 1ET6A 4LF9Q 1YHBA 2BDOA 3VA5A 4JYAQ 4IN3A 3T4AC 1UE7A 1M1KC 1CUKA 1MIUA 1A3TA 3ERQA 4KHPL 1Q3LA 1IBKQ 4J15A 4HSVA 1VQLA 2C9OA 1TWFH 4MTNA 2CQOA 3RZOH 1ILPA 1HCZA 3NBIA 4C3IG 2B8GA 4Y7NH 5IYBH 3HGBA 4DAYA 1ENFA 2AMCB 2WKDA 1WI5A 3S16B 3PMFA 3S1NH 1HFGA 1BVSA 4V0BA 1EY6A 2GVBA 1TXYA 5CC4A 4BWGB 1I6VC 4QL5A 2K5QA 1RD9D 3CMAA 3K5OA 1Y1VG 5K36H 3EJIA 5DNFA 5IT9E 3G6JB 4KKSA 1Y14B 1MD2D 4G7ZC 4OHJA 3EVQA 2N49A 1RTNA 1TT2A 3RLFA 1VQIA 2DN8A 3D4RA 2GA4B 4JBWA 1RIPA 1N36Q 2R61A 1HUMA 1KDCA 1CTMA 5C0XI 2G9DA 3S17B 5C0XG 1KDBA 5EJWA 5GADC 1S3OA 1NBWA 2BA1A 4DN4M 3D31A 1SE8A 4ODGA 1VDZA 1KABA 3DWAA 1D5XC 3A55A 4BBRB 2BE5D 3A7AB 4GNXA 4B3RQ 4KV6A 3EROA 1B2TA 3GTKH 1PH2A 1MBYA 3S14B 3KDFB 4RGTA 4BY7B 1HNWL 2KA7A 4LF4Q 1Z6HA 2B63B 2HCCA 4OWXB 1OO9B 4R9WA 4P74A 2O2LD 3CD6A 3SK6A 2UXCL 5A2QL 1LTSD 3AEVA 2E2JB 3LNNA 2B2WC 2EYFA 2IX1A 5ELNA 4X64L 3BVMA 5LMNW 1F9SA 3HFZB 2CH4W 1K73C 1J5EL 2H5XA 4A3DH 1ASYA 3VR3A 1EZ8A 1L0XB 3HEJA 4TQUS 4NB3A 1LABA 1PFNA 2ZJPA 2K5HA 2YV5A 4B3SQ 1EQRA 5LL6S 1RKNA 2LXKA 1I4XA 5M3FB 1EIFA 4HAEA 2ZXPA 4RGMA 3P75A 3DHQA 2XVSA 2R92B 4YCWA 3H6MA 2ZJQA 2I5LX 4KK7A 4M8AA 1LYLA 5LMNQ 4NXNL 5ELDA 3MA2B 4DV0L 3M7GA 1OXVA 4FF3A 2B2VC 5J22A 1LM0A 2EXDA 4JI4Q 1IZ6A 2NVTH 5GROA 2F03A 2UUCL 5EBDA 1L1OB 1XNRL 1PFSA 2XTIA 4K5XA 1K0SA 1I5FA 4C3IH 4U673 2A8VA 2D5DA 1FYCA 3J81E 2ICIA 1YHQA 2JA7G 4A3GB 2JA8G 1I94Q 1KIXA 2MO1A 2M00A 5KYLA 3KJPA 4OO1G 1QOHA 5JEAJ 4JCVE 2B8FA 4TSSA 2KQ3A 4L5TA 1PH3A 1V1PB 3F8TA 2D2CC 4CJ1B 1BF4A 1SNMA 1SJHD 4YHHQ 2F0UA 1SAPA 5FO8B 2HUGA 3CQZH 4KY7A 3BDLA 2NVYH 1FNWA 5KRUA 2PW5A 1VQ9A 4DV2Q 1K8OA 2E5LQ 1KHIA 5BN3A 3HS0C 1VQPA 1AP0A 4R1JA 1NMGA 3E6ZX 2ZTEA 3HOWG 3OWFA 4HTHA 4IUVA 1STHA 3L2PA 1NMFA 1EOVA 1V8QA 3BJUA 5DM73 2HCIA 4RA8A 4C3JB 4A93H 1PVOA 1OXXK 1S5CD 3S1MH 4IUUA 1EIHA 2B39A 3N52A 4JK1C 2K50A 4UY8C 5H1SE 3K59A 3DEPA 3MXNA 5NUCA 4DR3Q 4TVAB 1FVIA 1GUNA 4R4QA 4DR2Q 1EZ6A 2BOSA 4IOAA 4LMQD 1N33Q 1TS3A 3U4ZA 2K4KA 3C3LA 2Z8LA 1BBXC 4FF1A 4V190 4BXXG 1M90C 5C3EB 3R3OA 4IPGA 1WTPA 2ES2A 3QO2A 2NB0A 5J1ZA 4IJHA 3T1YQ 4DUZL 2K33A 5C4XB 1VF7A 3QOJA 3E3XA 4DUYQ 1ESFA 4FNFA 2JSOA 1B44D 4XT1B 1W6JA 2K1BA 3SDZA 5IGBA 3GV3A 4HCEA 1DYQA 4GNXC 1XJVA 4L6TB 1U4MA 5BN5A 1EFID 4DF7A 4B3TQ 5DEHA 1SNOA 4JI3L 3CP0A 4QJFA 3UDFA 2MNAA 2E2HH 1KTKA 3OTOQ 1B70B 1PH5A 1EIYB 5IGEA 4DR1Q 3G7LA 4KHPQ 1GKHA 1EQTA 2SDFA 1XMQQ 1CKNB 3I4LA 2CQAA 3I7FA 5CV5A 1TWCB 3NQTA 3DUZA 1TWHH 5E1FA 4YWLA 4DR7L 3IL8A 1CHPD 1DXMA 2FHTA 4A76A 2AQ3B 1K8AC 4YCUA 1SSOA 5LMUL 1PTOD 1VQOA 1PXUA 1JWMD 2EXZA 2UXDQ 2B2TA 2KHSA 2L4NA 5AJ3L 1OXUA 4LJZC 3OSOA 4A3CG 4HN7A 1Y8OB 3J7AF 3B6YA 2N78A 4LF9L 3CRLC 1JWSD 3HOZH 5GAGC 4TKOB 1H9KA 2JA8H 4DK3C 3GTJH 1IBKL 4OO1H 1DM0B 2EYMA 4PNYA 1U0LA 1GUWA 5D3IB 1X9NA 1D5ZC 1TS5A 4DAYB 1I50H 3HOYB 1HZ9A 1SNPA 4OXPA 3FPPA 1X3FA 3SHLA 3GTQH 1BCPD 3VR4A 4XIGS 3H91A 4CJ0B 3ICEA 1I4GA 1LLRD 4H7BA 4RWSC 3UDXA 4H44C 2EDGA 4IZ8A 3S1RB 3GTGH 4YWMA 2HQLA 1WOCA 4A3KB 1ML0D 2LY7A 3RNUA 2JA6B 2LMCB 2WB1E 3CAMA 4HJ7A 5M5WB 3HOWH 3I73A 2R3ZA 1EY9A 5CV8A 1H95A 1I4PA 4PMCA 4F88A 1XTDA 1X3QA 3KLRA 3BZKA 3W3AA 1AZQA 4RCOA 2UXCQ 1N36L 1K0RA 3H0GB 3Q23A 2RVLA 2OTJA 5KIXA 3FP9A 1PZID 1SYGA 4X64Q 4JI2Q 4LFBQ 3U58A 2RHSB 1HJPA 2I46A 4L5QA 1JJCB 4RGNA 1Y1VB 1CHQD 2WB1B 2RSOA 1EWHA 3ER0A 3QOLA 1V1QA 3KOJA 5FO9B 4DV1Q 3H3VC 1U9RA 2VXWA 3TP5A 2EQSA 1JE5A 2Q2HA 3BYYB 4B3RL 1VQDA 4Q5VA 4HJ5A 1JOQA 4BXXH 1YJWA 1UEBA 1AE3A 2D62A 2XGTA 3K7AB 2UU9Q 5E3FA 2PZWA 2QF7A 3VYTA 2M2LA 3KUPA 4XQNA 2QCPX 4IOCA 4LF4L 4RH6A 5IP9G 2NTSA 4P71A 2O5JC 3OW2A 2Y0SE 3M3YH 1E24A 3TN2A 4DV0Q 1C7YA 1YVCA 3I72A 1JICA 1V9PA 1YEZA 4O2DA 3OMCA 3PO2G 5IGCA 1NR2A 5BN4A 1YJNA 1D2BA 1Q81C 2VL6A 2KEDA 1STGA 1RJTA 2LXJA 5HGTA 1P8LA 3SGIA 3GTLH 3L0OA 4YCVA 1H9JA 1VQFA 4A3EG 3ULPA 2SNMA 3J7ZC 4UP9A 4MNOA 2QGQA 2Y0SB 3PUVA 4JI8L 2HT1A 2MPMA 3HOUH 3F2DA 1MJEA 2JE6I 1PRTD 4B3SL 2BH2A 5CR3A 3MVVA 2R7ZB 3I70A 2HIXA 3RD4A 3AMUA 4EGVA 3STBC 4QCLA 2R7FA 1WVLA 3BU2A 4XT3B 1SRUA 1CQFA 4A3CH 3RR5A 2B2UA 2K7VA 5I4DA 1D7QA 4J6HA 2PQEA 2UXBQ 5EKLA 1YNND 4JI4L 3PIPA 4DK1A 3BVGA 3N6RA 2OWOA 3NUCA 1QILA 4OGQC 1PH8A 2IHEA 1ONLA 4R4CA 2R93G 2KHJA 1QVFA 3J80E 4RGOS 1I94L 4UAIA 4GN5A 1DCZA 4DU9A 2Q8IB 3K5MA 1CI3M 4JBJA 2A69C 1AEXA 2C5CA 2XIWA 4HEDA 2TSSA 2WAQG 1A15A 3CXCA 1EU4A 4PMBA 3S2DH 2MO0A 4DV7L 4IPDA 3TP6A 2B63H 4DR6L 1U4PA 3OPOA 1LTID 2MHVA 2PI2A 1TKWB 3IKJA 4YY3Q 1FNVA 2JA7B 4P73A 1Q7YC 1ZYRD 2A6ED 4K2KA 1ZKOA 2EE1A 3CCMA 1PFBA 5EQ0A 1KLGD 2F0WA 3AU7A 2OTLA 3O13A 1JWUD 5C4ZA 3ERSX 4KHVA 5EKKA 4PMWA 1IL2A 1HHVA 3LWEA 4HIMA 2P5ZX 4KI0A 1EL0A 2UUBL 4XDXA 1CA6A 4JI3Q 3AYHB 2F0JA 4ZKCB 1C9OA 1SNDA 2DGYA 3GDEA 3ULJA 1G91A 1QJOA 1S4ZA 1A63A 2EY2A 1SYBA 5C4HA 3PIO3 4DR2L 4BA2I 5M5YB 3V2TA 5IP9H 3DM1A 2FMMA 1ET9A 2HD3A 2CHBD 1HR0W 4C1NK 3E5SA 1K28A 4WJWA 4X6AH 5FO7B 1XTCD 2JXMB 2N88A 3I4OA 4JC0A 3PUWA 5ELEA 2AKWB 4RAUC 4DUYL 1WTRA 5C44G 2NBFA 3FKIB 3TEHB 4UP7A 5AJ3Q 2B2YC 2IJ0A 3L3OC 4RKLA 3D8GA 4X3SA 2X6GA 4QF4A 3C2PA 4A3EH 1I3QH 1IBLL 1JCKB 4RMFA 2QDLA 2ZJRA 4R4IA 4UDUC 4B3TL 4KD3A 3CCVA 3OTOL 2X69A 4A3BB 1VQJA 4DR1L 4DXFA 4CKBA 2YTVA 1VF5C 4FP5D 1HR0Q 1XMQL 4RHSA 1PZKD 5COYA 3J80c 4A3JB 3E9IA 3Q24A 2J7ZA 2EIFA 3HOXB 5D3DA 1SE4A 5FLXc 3A0JA 2ZTCA 4BBSG 1R9TB 1L1OC 5G3LF 4EQPA 2UXDL 4MIUA 2PQAA 2WP8J 4Y52H 5EPKA 2F3VA 1DOMA 1VQNA 1XWEA 1EEID 1PTOF 3GTOH 1PTOB 3GTMB 5D14A 5FK9C 1IKMA 1PFMA 2A68C 2R93H 3C46A 3I55A 1ZEQX 2IY5B 2K04A 2IL8A 5CBAE 5M3MG 4U68A 1E2ZA 2A1AA 3M85A 4A3IB 4CGYB 4KJNA 5IGDA 2F1MA 1IYJB 4A3MG 2AHOB 4A93G 1STYA 2B2UC 1II3A 2CFMA 2WV6D 4Q0FA 4LF5Q 1IHZA 2QEXA 2VUMG 4CBVA 3WOFA 1IW7C 2DNCA 4DKAC 2JA9A 3A8KE 3JAMc 4DNRB 5E4WC 3T53B 1LACA 2EYLA 1A2UA 2ZXOA 2ALYB 1Y1WG 3S1QH 1Q8IA 4DV4Q 4KLKA 1I4QA 4EX5A 3F1ZA 1N32Q 1Y8PB 1JORA 1SMYC 1Q86C 3G71A 1VQGA 3MEFA 4LNQA 2A74C 3ZJYC 1Z47A 4HSPA 4HIKA 3I4MB 1K83H 1F2ZA 3MXGA 4JI2L 3K6OA 4LFBL 4IFDG 4N8FA 2PPBC 3C1FA 1FGBD 1Q1BA 1SYEA 5DAUA 2RHQB 4DV1L 2AUJD 3M4PA 1I6HB 1LT4D 4JI8Q 4B08A 1SFOB 3OWEB 2XWBB 3EA6A 2NVQH 2PYKA 1QZGA 4JVZA 1YNJC 1L0YB 3PIP3 2UU9L 4K5VA 3J80L 3TP8A 3PF5A 2VB2X 3R8BA 4C2MH 1MI2A 3SE0A 1NCVA 1D5MC 1LTLA 2NZHA 3S9WA 5C44H 5I9PA 3K8AA 2EZVA 2DUDA 5FLXL 3G4SA 3K5LA 2G9HD 1G6ZA 1XXGA 4DV5Q 1EOTA 5FLMH 5CORA 1A6XA 2VNUD 2Z9HA 2F0GA 5F2DA 1QG7A 2SEBD 4G57A 1VQ7A 1WCMG 4R8NA 2DY8A 3D0FA 1WTOA 4E6IA 4DNTB 1ILQA 1X6OA 2NN6H 4K5WA 4CKCA 2Z1CA 5IT9c 2R7DA 1YI2A 2DY7A 2ZM6L 3S15H 3M4OB 3HOYH 1MGSA 4AYBG 3HOZG 5KNDA 3GTPB 1A62A 2F0MA 2VQEQ 4K2LA 1HXYD 4L5SA 3CPWA 4OO1I 3I4NB 2HHHL 4QUFA 3I91A 5CV7A 3SEBA 1EU3A 3PO2B 1B50A 5C4JH 2RDGA 1E7ZA 3A54A 4BBSH 3GV6A 1EY0A 4O42A 3IFDA 1PRTB 2JEAI 3Q0AA 3VR6A 1YJ9A 1D1IA 3BZDB 4DV7Q 4WFN3 1Q12A 4DR6Q 5GQOA 5I6WA 1Y8NB 1JJ2A 1PMRA 4G7HC 1MSGA 5FJ8G 4BY1H 1N34L 4JG2A 3R2TA 4IUPA 3CCRA 2Z6KA 2UXBL 4ZAIA 3JAML 3RN2A 2JA5G 1LO5D 5M3MH 2EJGC 4I7AA 4QB4A 1TWFB 1FNUA 2PZUA 2ENBA 3AFQA 3RZOB 2DNEA 5KGUA 2I5MX 4ME5A 4Y7NB 3BDCA 5K5PA 1DONA 2R6GA 1WTHA 4JI7Q 2PI2E 5M5XH 4A3MH 2ZXRA 3GO5A 2VS1A 4CJ2C 3NHHA 5CBEE 2F0HA 1GO3E 1TWAH 2UUBQ 3S1NB 5CMDA 3HKZG 4UP8A 1WD1A 4JI5Q 2GN5A 3RLNA 3PO3H 1EYAA 3HKSA 1XPOA 2E2IH 3R2IA 2VUMH 5IYCG 2IX0A 1H9SA 2F52A 4DK6C 2K32A 1JR0D 4DGZA 2NVXH 1C48A 4ZQ3A 4J1MA 1STBA 1BBUA 1WTXA 3EN2A 1LTTD 3RZDH 5JVH3 4A3FB 4RCNA 3F2UA 1Y1WH 1FGUA 1PYSB 4YY3L 2F0OA 4IURA 4HIDA 1NTGA 2YU9H 4H13C 3GQBA 4AH6A 1TS4A 1B3AA 4KD4A 1PYWD 3F2BA 4CDFC 1O7LA 3VYSA 4LK1C 2V1CC 4C3HG 4ZRZA 4IFDH 1P16A 5JPMC 3AQQA 3NE5B 3M9BA 2AQ1B 1E3PA 1IBLQ 1SE2A 1AH9A 2NYZD 2RKSA 3KK7A 4MZ9A 5IT9L 1CT1D 1S5ED 3STBD 3GTKB 2E75C 3F2CA 3NENA 1PV4A 2BE5C 1CKMA 3P7JA 1VQCA 1E1OA 5M9OA 4GN4B 1BNZA 3HOVB 3D3RA 5BR8Q 4LF6Q 3J81c 1E2VA 1Z7TA 4OWTB 3HOUG 1KRTA 4K8JA 4XQJA 1F9RA 4N8X1 5IGGA 1SBBB 2KJXA 4DFAA 1O80A 1LTGD 1QNKA 3U9SA 3NEMA 1HH2P 2IHFA 1BO0A 4JI6L 1K8MA 3NP8A 1WCMH 2CCZA 5E4XA 1KLUD 1EYGA 1JMCA 1A3VA 3AFPA 3G6EA 2I07B 2OXPA 4A3DB 2A69D 1KL9A 2LFNA 4A3LH 3QWNA 1TU2B 1VS0A 3KLWA 3CCSA 3TZDA 2MP1A 4X3TA 1BBWA 2RSNA 1HR0L 1NY4A 1X3PA 4GKKL 1MKHA 2A6HD 4TRDA 4M1UB 4NP5A 5LHY1 1WFQA 4DXGA 4ULLA 3CC4A 1PH7A 4BBRG 2CWPA 1GUTA 2OQKA 3K5NA 2L5TA 3NTHA 3H3VH 4LFAL 1BR9A 2AUKA 5FJ8H 1Q8KA 1TY0A 1YZ6A 4PZ7A 2PMZE 4IJLA 1HZBA 2O5IC 1GUOA 3RN5A 2M9VA 2PQAB 3EBEA 2NVTB 3M4YA 2AWOA 2B63G 2JA5H 4A4IA 1U4LA 3S24A 4AIMA 1B9NA 1H9MA 4ZLTF 4C3IB 4DPGA 3TDQA 1NNXA 1VCIA 4JOIA 1XX8A 5AFWA 4C56C 1DOLA 1YITA 2L9HA 4ZKBB 2Z6BA 3A5UA 4K0KQ 3E0EA 3MAQA 2Z4HA 5CYUA 2E76C 2PMZB 3S2HH 5KNCA 1TWGH 3CKIB 5KEEA 5IYCH 3A7LA 1LTAD 1A2TA 2RDHA 3UI2A 4HCSA 5M5YH 1K3RA 1X65A 2Z6KC 2EY6A 5M3FG 4LF5L 3CQZB 3QR8A 2PW7A 4QQBX 3HRZC 4ZK9B 4K6LA 4P75A 1CQVA 1RODA 3J81L 1AFPA 1HUNA 2K5WA 5JPNC 1X56A 3WWVA 1EUJA 4F87A 2K05A 4FDBA 1F9PA 2RF4A 2XSCA 4C3HH 4DV4L 1VQ6A 4OIKA 1BOSA 1G291 2XNAC 4KN7C 1N32L 4A93B 3S1MB 2F0NA 3A74A 1YBYA 2I5HA 1PHJA 4KJOA 5IIFA 1F9QA 4AQYQ 1GHKA 4HIOA 5FKAC 2X6LA 4N9TA 1LTRD 5JJIA 2ID0A 3SR1A 2QKIC 1Q90A 2OEOA 2Z0SA 2ZM6Q 4A3GG 5CV6A 1XMOQ 4JI0L 1S5DD 3URYA 4QY7A 3S16H 3J7YW 3ITPA 4A75A 4CHTB 3UDIA 1HRJA 1G6PA 2HHHQ 1UE5A 4LFCL 3CCJA 5J3BA 3FPUB 3NQIA 1VQMA 3OYYA 1A3UA 4DAPA 3OIQA 2PO4A 5ELOA 2K6AA 2F0FA 3VR5A 4X66L 1QNUA 1FR3A 3A5ZB 1CSPA 3TP7A 4O0AA 4DV5L 3SK8A 1HTPA 3CMEA 3TQYA 1N34Q 4DR4L 1FD7D 3RMHA 1ZXTA 1SE3A 2E2HB 5IYDG 3QG1A 5T1IA 3S17H 3RLOA 3MFGA 4OL7A 1X3GA 1HNXQ 4XQQA 1KNEA 4C3JG 2QEJC 3PUXA 1STEA 3NWTA 3R93A 3K7UC 4EVOA 3ND8A 1UAPA 1HNZQ 4X65L 2VQEL 1JQYD 2SNSA 1TWHB 2EYJA 4BBRH 2IT1A 4FVMA 3U9OA 2KBNA 2F0KA 2B2TC 2OF1A 2VQFQ 3S14H 4BY7H 4LW1A 5IP7G 1PTOC 4ILWA 2EY1A 1T5XD 1SMYD 1CKOA 1VQBA 4YIJA 5IODA 1CFMA 4GKJQ 4FF2A 2ZTDA 1HPCA 1QVCA 1NR4A 5JAVA 1VMCA 1WJJA 4L5RC 2E2JH 2EYPA 1BQQT 2RDFA 3TSSA 2JA8B 1JOKA 3GTJB 1KAAA 4DV6Q 1CA5A 1VQKA 1TIID 3FHWA 4JI7L 1B8AA 1I50B 1UNSA 1FL0A 3U50C 2JP1A 4NDXA 2RQXA 3T51B 2JJQA 1FJGQ 3MXUA 1XPUA 2KENA 1YNJD 1EYCA 3GTQB 1EWIA 4JI5L 3IAYA 4IFDJ 2K03A 5JJZA 5M3FH 4QMGA 5TSSA 1BCPC 3FVQA 1VQEA 1S72A 2G5DA 1H9SB 1EY7A 3GTGB 5JJKA 4PZ8A 2KCMA 2R92H 1CSQA 2K01A 3EIVA 3HOWB 3BS1A 2E2DC 1JB3A 1UEAB 1LUZA 3MC0B 2FJ2A 1PH6A 2Q2UA 2QA4A 4OEMB 2A5HA 1XNQQ 1ICWA 4WJ4A 2UUAQ 2XRQD 4JI1L 1X32A 4PQXA 5E7NA 2K52A 4ME3A 3D6CA 4X62Q 3KFUA 3OMGA 2HDMA 4ZUIA 2OCEA 1GVPA 3T16A 2DJGC 3ND9A 5EBCA 1KC8C 4ALPA 4JI6Q 2F4VQ 1E2WA 5FLMG 4A3GH 4B3ML 4HR7B 4DV3Q 3PF4A 1S5FD 3MHBA 4KMUC 3KBGA 3K58A 1TR5A 4JW0A 2NN6I 5IE8A 2NN6G 1SLJA 4OWWB 3NELA 4H02A 4FF4A 1RHPA 1YHAA 3HOYG 2JQOA 4GKKQ 3CCLA 3E0JA 3UE0A 1QB5D 5BR8L 4LF6L 2BCOA 3ZYYX 2WIIB 3DMUA 1JC7A 3M3YB 2PCFB 2EVBA 1V1OA 5I6YA 4LFAQ 2H1EA 1N9WA 1L0WA 3ONAB 4A3KG 2EY5A 3W1GA 5DM63 1QE6A 2F3IA 5ELBA 2JA6G 5IYDH 1LV9A 1WTWA 3GTLB 1SYDA 2VY3A 3K0YA 3X3NA 3K81C 2MJ8A 2KHIA 4X3KA 4NPSA 3KF6A 1PA6A 4BY1G 4C3JH 4UPAA 4HJ9A 5ISRA 4DAVA 3H0GG 3SK4A 4HJAA 4FO2A 1VMPA 1HA6A 3M4QA 3A8IE 4I65A 3HOUB 3KBXA 1GXDC 2VW9A 2KVMA 2EJFC 4MTKA 1PRTC 2RA4A 2WB1G 4LWCA 4ID6A 3OIPA 1LT5D 1IBML 3TZUA 2IX3A 4F7XA 5IP7H 4A3FH 2QILA 3J81i 2YTYA 4QIWE 3T1HL 2L1BA 2KOLA 3FRPB 4IPCA 2SOBA 2IWHA 1BKBA 2L0CA 3BG3A 3PO3G 1STNA 5C3EH 1DOKA 3MXPA 2OT2A 4DAMA 3DWPA 2F0SA 5C4XH 4OX9Q 1BCPF 1RCVD 4B9WA 1EY5A 1YNNC 1BCPB 1KDAA 1GM5A 2FINB 4DK0A 1AW7A 2KEEA 4FXGC 1GJXA 5GAHC 4NXMQ 4QIWB 1IYUA 1G51A 4K0KL 2L12A 1CZWA 4KN4C 4B9XA 4P2CB 3T56B 2Q8RE 4IFDI 3G48A 4L63B 3S2DB 3HOVH 2WFWA 5IGFA 1B7YB 3J81j 1BXTA 1TWCH 1KAWA 2Y0SG 2D9UA 4PV1C 1H9RA 4LF8Q 1F77A 3KJOA 4IALA 4OIJA 2LS01 3V96A 4JI0Q 1DGSA 2WACA 3VDYA 2MGSA 4RKBA 1K9MC 2R7ZG 2J0TD 1X3EA 1SNCA 4GN3B 1SJED 4LFCQ 1IL8A 4QUCA 1VQ5A 4JV5Q 1JE4A 3VA7A 1ZYRC 1JB7A 2A6EC 1VQ8A 4QGUA 4X66Q 4GOPB 1CZGA 3TS2A 1EWCA 4IUNA 3UE1A 1A8VA 4DR4Q 4KY6A 2NUCA 1O7ZA 4AQYL 5EPJA 4CDEC 1RF2D 2CW0C 3KF8A 3CCEA 2BH8A 1TVXA 1YNXA 4ZCKA 3W1BA 1Y69U 1EY8A 4N9PA 3U4VA 1GUSA 3OHXC 4KTAA 1B53A 4DA2A 1XMOL 2NWGA 1XYIA 4CKEA 2MQHA 4LUVA 1E1TA 4A3LG 1QWYA 4X65Q 1TY2A 5CV4A 2F0LA 1KXLA 2XN9C 1EEFD 2F4IA 3S1RH 4GS3A 1J8IA 4GZYC 2EOTA 4A3KH 4NW2A 1PRTF 3LWUA 3DWQA 4IUQA 1DD2A 2JA6H 3L9AX 3K0XA 3LX0A 5HY6A 5M5WH 3NTKA 4LF7L 4KKUA 2B3GA 4OONA 3H3VI 2TMPA 3MWYW 2CWAA 1WYDA 3H15A 4A3EB 1I3QB 3H0GH 5EKIA 3CF5A 2KCTA 1BDOA 2K75A 3NBHA 4FXKC 1HNXL 3CRKC 1T9HA 4APVA 3EFXD 1Y1VH 1NSNS 1KQSA 3HP3A 5EAYA 1UWVA 5IWAL 1HNZL 1M8AA 1OXTA 1AZPA 1SNQA 2KUMA 5EGTA 4DNIA 4J8QA 1X54A 4POGA 4WORA 4DR5L 1HQRD 4IUTA 1MJCA 3BDOA 2VQFL 1QZHA 1O7IA 3K7AH 4OELB 2CKZB 5IY0A 2WAQE 3PCOB 4PG3A 1CK1A 2KCCA 4LUZA 5HURA 5C0XH 4NMZA 1QUQB 3GTOB 3CU7A 2QDBA 5ELCA 4GKJL 3AB9A 1SXTA 4IO9A 2R93B 1O7YA 3SVMA 1U5KA 4CDDC 1R4QB 1TS2A 4RG1A 4JI1Q 4POFA 3H94A 2V4DA 3FKIG 1XPRA 4DV6L 1IXRA 1W2BA 3MFYA 2WAQB 3TRZA 3PUYA 4PZ6A 4MHEA 1HFNA 3JC66 3I8ZA 1FJGL 4G4KA 2BA0A 4B3MQ 4A3BG 2FXQA 5J39A 3DM3A 2QW7A 2EPBA 2D0PA 3IFTA 2R7ZH 3QB3A 3DLLA 2KECA 3NWSA 2JN4A 4A3JG 3TMEA 3NK9A 1NJIC 2VZAA 3MTSA 5KNBA 2EJMA 1VQ4A 3HOXG 3S1QB 3J7AV 4RHRA 2E74C 1XNQL 1WTVA 1Z9FA 2N3SA 2UUAL 2BDNA 1RL2A 1GD7A 1X55A 1HZAA 4X62L 2O4XA 1W3SA 1MSHA 1NE3A 1EY4A 1K83B 2XWJB 1TQOA 1EYDA 2F4VL 2D0OA 1EIGA 1D6EC 1EQVA 1WD0A 1SN8A 3KLSX 3DXJC 2LKVA 3NTIA 2N55A 4DV3L 5G3LD 1IYVA 3CC2A 3GD7A 3X3MA 1S40A 4A3IG 4FXDA 1ESRA 2NVQB 1RDPD 1J6QA 2Z4IA 3SXHA 1DJRD 2L11A 3HG9A 2F3WA 4C2MB 1F2YA 1BUVT 3I56A 3PIOA 5A35A 4K8IA 5C44B 1IBMQ 4R4OA 4NKLA 4JYAL 4ZUJA 3T1HQ 1RTOA 2PNHA 4EQNA 2JA7H 1D1KA 5DLQE 3CCUA 4BY7G 1AE2A 1PLFA 3QIAA 2LSSA 1L2FA 1E22A 4Z9CB 5JEAG 1V43A 3D6WA 3P20A 1ENAA 3KF6B 2XRSD 4MN3A 3S15B 4EQ5A 3W2DA 1B3QA 1JJGA 3TREA 5CGKA 3WOEA 2IW3A 1I4HA 3FMCA 1HA5A 3VYRA 3I4MG 5C5MA 3VYUA 4CDCC 3ULLA 2I0QA 1JT8A 5C4JB 4R4TA 2J4XA 1PYBA 1CM9A 3SK5A 4C1NI 3PGZA 4BBSB 4HJ8A 3KDFA 1SMXA 2F0IA 1HNWQ 1K3BC 2DJFC 3KYHC 4LAAA 2F0PA 3J80i 1KNAA 5L37A 5C3XA 2L15A 2IPKD 4BY1B 1G2SA 1J9OA 2WKCA 2NVYB 2MFIA 4P72A 1EFWA 1SYCA 5GAEC 4IPHA 1F2LA 3DEOA 2NZOA 2R92G 4OX9L 4XXEA 5C6AA 2Q8TA 4I7ZC 3W5OA 5M3MB 2GVAA 3FKIH 3TBIB 2YTXA 1J5EQ 2Q2TA 3CW2C 3VR2A 1IKLA 2RCNA 1OXSC 3CPFA 4A3MB 5M5XB 3KLSA 4NXML 1F2MA 2B2YA 4GOPA 2K14A 3NSWA 5CV9A 2K5VA 4GNXB 1B4OA 2A73B 1TWAB 3A56A 3BVZA 4R8IA 4A3BH 1K8GA 5I2XA 5KYIA 3PO3B 4BA1I 1M4VA 4LUOA 1PH1A 2E2IB 2VUMB 1HQMC 2RCFA 1C0AA 1QCBD 3PSIA 1ASZA 3OOCA 4KHZA 2ATWA 1T5EA 2K5NA 3K80C 2NVXB 4LF8L 3NPPA 4ZYSA 4A3JH 4NXNQ 3RZDB 3I4NG 3Q22A 3HOXH 1Y1WB 4GLAC 2N8NA 3T13A 2YU9B 3Q8DA 2CVRA 4UHVA 3LGJA 4XYQA 5I9OA 1R9TH 2JEBI 2PZTA 2ASBA 1A0IA 1LTBD 4K6DA 4JV5L 4KY5A 4JPBW 3BZCA 2UUCQ 4HMIA 2F0EA 1L1OA 1XNRQ 2A68D 3I3CA 3JAMi 4WJ3M 1PTOH 3GTMH 3UDGA 4HMJA 4LF7Q 1EQQA 4KKTA 4XYOA 3IRBA 2A19A 5EPLA 2K28A 1W6KA 1LT3D 2FMCA 1DZ1A 3WDNA 2F0VA 3BYTB 3KF8B 1PH9A 4A3IH 2NZ1D 2F0TA 5IYBG 1E0BA 5D65A 1QVGA 1V1PA 3CHBD 5A2QE 3PUZA 3M7NA 3MZ5A 5IOCA 5LMNL 1R4PB 3PQIA 4F8MA 5JVG3 5IWAQ 4AYBE 1Q46A 2F0QA 1HTLD 1IW7D 2EYHA 3I90A 1SR3A 4DR5Q 3CCQA 2AQ2B 2MUYA 5K36G 1JOOA 3TS0A 3FEWX 1Q1EA 4A3FG 1WCMB 5JEAH 1GOZA 1QUQA 3A8JE 1UE1A 3HZXA 1ICFB 5C3EG 3EQLC 1UUPA 4AYBB 3HOZB 4IQZA 1NAPA 3L7ZC 1NUCA 3CC7A 3E9HA 5C4XG 3QJYA 3H09A 5C0XJ 5JOBA 1U4RA 5FLXE 3D4WA 3I4MH 2WINB 3NBHB 2PNRC 2B2WA 5C3WA 4X3UA 1YIJA 5T1GA 2H4OA 1C4QA 1LT6D 1VQHA 4YHHL 2NTTA 2A6HC 5JJLA 3D4DA 1G8ZD 2E8GA 2Q2IA 1UE6A 4H0LC 1I6HH 1S5BD 1WTQA 1SFOH 5LL6X 3OW7A 1HZCA 3GP7A 1O78A 4DV2L 3Q6SA 4S3SA 5ELFA 2E5LL 4GLXA 1G2TA 3HKZE 4RFBA 2FFKB 3MEHA 2F0DA 4DUZQ 3HOVG 5C5LA 2B29A 2CH4A 1PDQA 2L55A 1PH4A 2JA5B 1GUGA 3NXWA 1ENCA 1C8CA 1PZJD 4JOIC 3K57A 2C35B 3PV0A 1KD1C 2JYOA 1D8LA 1GHJA 3P1HA 2CW0D 1SROA 2HQEA 2YYZA 2K5DA 2B2VA 4O1NA 3MXNB 3HKZB 2ZT9C 2ICEC 4DR3L 3S2HB 4A3DG 1TWGB 1Q82C 1CKNA 2EYOA 3C1EA 3JAME 1SEBD 3M4OH 1OTCA 1SDFA 1N33L 3GTPH 4BS9A 4XTCS 4G7OC 1SYFA 2OQ0A 3RUZA 4GLVB 1MHWC 1STAA 3J7A5 3I4NH 2KCNA 2HDLA 2AWNA 5HGQA 4DR7Q 4FYDA 1B1ZA 3T1YL 3PO2H 3FDTA 5LMUQ 4YWKA 3I2ZA 5FOBB 1VQAA 3V05A 1B9MA 4WRDA 1KRSA 2VB3X 1I4RA 4GOPC 2RBMA 5I2YA 4ABNA 4JBMA 1N8RC 2HIVA 4L8JA 2JK8A 4K14A
chains in the Genus database with same CATH topology
4C3HB 1AN8A 4EQOA 1ET6A 2BDOA 3VA5A 4IN3A 3T4AC 1A3TA 3ERQA 1Q3LA 4HSVA 2C9OA 1ILPA 1HCZA 3NBIA 4C3IG 2B8GA 3HGBA 4DAYA 1ENFA 2WKDA 3S16B 3PMFA 1HFGA 4V0BA 1EY6A 5CC4A 4BWGB 1I6VC 2K5QA 1RD9D 3K5OA 5K36H 3EJIA 5DNFA 5IT9E 3G6JB 4KKSA 4G7ZC 1MD2D 4OHJA 3EVQA 1RTNA 1TT2A 3RLFA 2DN8A 3D4RA 2GA4B 4JBWA 2R61A 1HUMA 1KDCA 1CTMA 5C0XI 2G9DA 3S17B 5C0XG 1KDBA 5EJWA 2BA1A 4DN4M 3D31A 4ODGA 1VDZA 1KABA 3DWAA 1D5XC 3A55A 4BBRB 2BE5D 3A7AB 4KV6A 3EROA 1B2TA 1MBYA 3S14B 4RGTA 4BY7B 2KA7A 1Z6HA 2B63B 2HCCA 1OO9B 4R9WA 2O2LD 3SK6A 5A2QL 1LTSD 2E2JB 3LNNA 2B2WC 2EYFA 2IX1A 3BVMA 1F9SA 3VR3A 1EZ8A 1L0XB 3HEJA 4TQUS 1LABA 1PFNA 5LL6S 1RKNA 5M3FB 1I4XA 4HAEA 2ZXPA 4RGMA 3P75A 3DHQA 2XVSA 2R92B 3H6MA 4M8AA 4KK7A 5ELDA 3MA2B 3M7GA 1OXVA 4FF3A 2B2VC 5J22A 2F03A 5EBDA 4K5XA 4U673 2D5DA 1FYCA 3J81E 2ICIA 4A3GB 2M00A 5KYLA 4OO1G 1QOHA 5JEAJ 2B8FA 4TSSA 2KQ3A 1V1PB 2D2CC 4CJ1B 1BF4A 1SNMA 1SJHD 2F0UA 1SAPA 5FO8B 2HUGA 4KY7A 3BDLA 1FNWA 5KRUA 2PW5A 1K8OA 5BN3A 3HS0C 1AP0A 3E6ZX 3OWFA 4HTHA 4IUVA 1STHA 1V8QA 5DM73 2HCIA 4RA8A 4C3JB 1OXXK 1S5CD 4IUUA 1EIHA 2B39A 3N52A 4JK1C 3K59A 3DEPA 3MXNA 5NUCA 1GUNA 1EZ6A 2BOSA 4LMQD 1TS3A 3C3LA 2Z8LA 1BBXC 4FF1A 4V190 5C3EB 3R3OA 1WTPA 3QO2A 2NB0A 5J1ZA 2K33A 5C4XB 1VF7A 3QOJA 1ESFA 4FNFA 2JSOA 1B44D 4XT1B 1W6JA 2K1BA 3SDZA 5IGBA 3GV3A 4HCEA 1DYQA 4L6TB 1U4MA 5BN5A 1EFID 4DF7A 5DEHA 1SNOA 1KTKA 5IGEA 3G7LA 1EQTA 2SDFA 3I4LA 2CQAA 5CV5A 1TWCB 3NQTA 3DUZA 5E1FA 3IL8A 1CHPD 1DXMA 2FHTA 2AQ3B 1SSOA 1PTOD 1PXUA 1JWMD 2EXZA 2B2TA 2KHSA 2L4NA 1OXUA 4LJZC 3OSOA 4HN7A 1Y8OB 3J7AF 3CRLC 1JWSD 4TKOB 1H9KA 4OO1H 1DM0B 2EYMA 4PNYA 1GUWA 5D3IB 1D5ZC 1TS5A 3HOYB 1SNPA 3FPPA 3SHLA 1BCPD 3VR4A 4XIGS 3H91A 4CJ0B 1I4GA 4H7BA 1LLRD 4RWSC 4H44C 2EDGA 4IZ8A 3S1RB 4A3KB 1ML0D 2LY7A 2JA6B 2LMCB 5M5WB 3I73A 2R3ZA 1EY9A 5CV8A 1I4PA 4PMCA 4F88A 1X3QA 3KLRA 3W3AA 1AZQA 4RCOA 3H0GB 3Q23A 2RVLA 5KIXA 1PZID 1SYGA 2I46A 4RGNA 1Y1VB 1CHQD 2WB1B 2RSOA 1EWHA 3QOLA 5FO9B 3H3VC 1U9RA 2VXWA 3TP5A 3BYYB 4Q5VA 1JOQA 2D62A 3K7AB 5E3FA 2PZWA 2QF7A 3VYTA 2M2LA 3KUPA 4XQNA 2QCPX 4RH6A 2NTSA 2O5JC 3TN2A 3I72A 1JICA 3OMCA 5IGCA 1NR2A 5BN4A 1D2BA 2KEDA 1STGA 1RJTA 5HGTA 1H9JA 2SNMA 3PUVA 2Y0SB 2MPMA 2JE6I 1PRTD 5CR3A 3MVVA 2R7ZB 3I70A 3RD4A 3AMUA 4EGVA 4QCLA 1WVLA 4XT3B 1CQFA 5I4DA 2B2UA 2K7VA 4J6HA 2PQEA 5EKLA 1YNND 4DK1A 3BVGA 3N6RA 3NUCA 1QILA 4OGQC 1ONLA 3J80E 4RGOS 4UAIA 1DCZA 4DU9A 2Q8IB 3K5MA 1CI3M 2A69C 1AEXA 2C5CA 2XIWA 4HEDA 2TSSA 1A15A 1EU4A 4PMBA 3TP6A 1U4PA 3OPOA 1LTID 2MHVA 1TKWB 3IKJA 1FNVA 2JA7B 1ZYRD 2A6ED 4K2KA 1ZKOA 2EE1A 1PFBA 5EQ0A 1KLGD 2F0WA 3AU7A 3O13A 1JWUD 5C4ZA 4KHVA 5EKKA 4PMWA 1HHVA 3LWEA 4KI0A 1EL0A 4XDXA 1CA6A 2F0JA 4ZKCB 1SNDA 1G91A 1QJOA 1S4ZA 2EY2A 1SYBA 5C4HA 3PIO3 4BA2I 5M5YB 3V2TA 3DM1A 2FMMA 1ET9A 2CHBD 4C1NK 3E5SA 4WJWA 5FO7B 1XTCD 2JXMB 2N88A 3PUWA 5ELEA 4RAUC 1WTRA 2NBFA 3FKIB 2B2YC 2IJ0A 3L3OC 4RKLA 3D8GA 4X3SA 2X6GA 4QF4A 3C2PA 1JCKB 4UDUC 4KD3A 2X69A 4A3BB 4DXFA 4CKBA 1VF5C 4FP5D 4RHSA 1PZKD 5COYA 4A3JB 3Q24A 2J7ZA 3HOXB 5D3DA 1SE4A 1R9TB 5G3LF 4EQPA 4MIUA 2WP8J 5EPKA 2F3VA 1DOMA 1XWEA 1EEID 1PTOF 1PTOB 3GTMB 5D14A 5FK9C 1IKMA 1PFMA 2A68C 3C46A 1ZEQX 2K04A 2IL8A 5CBAE 4U68A 1E2ZA 3M85A 4A3IB 4CGYB 4KJNA 5IGDA 2F1MA 1STYA 2B2UC 1II3A 2WV6D 4Q0FA 1IHZA 4CBVA 3WOFA 1IW7C 2DNCA 3A8KE 4DNRB 5E4WC 3T53B 1LACA 2EYLA 1A2UA 2ZXOA 1Q8IA 1I4QA 1Y8PB 1JORA 1SMYC 2A74C 1Z47A 4HSPA 3I4MB 1F2ZA 3MXGA 3K6OA 4IFDG 2PPBC 3C1FA 1FGBD 1Q1BA 1SYEA 5DAUA 2AUJD 1I6HB 1LT4D 4B08A 1SFOB 3OWEB 2XWBB 3EA6A 2PYKA 1YNJC 1L0YB 3PIP3 4K5VA 3J80L 3TP8A 2VB2X 3R8BA 1MI2A 3SE0A 1NCVA 1D5MC 3S9WA 5I9PA 2EZVA 3K5LA 5FLXL 2G9HD 1G6ZA 1XXGA 1EOTA 5CORA 1A6XA 2VNUD 2F0GA 5F2DA 1QG7A 2SEBD 4G57A 4R8NA 2DY8A 1WTOA 4E6IA 4DNTB 1ILQA 4K5WA 2NN6H 4CKCA 2Z1CA 2DY7A 3M4OB 1MGSA 5KNDA 3GTPB 2F0MA 4K2LA 1HXYD 4OO1I 3I4NB 4QUFA 3I91A 5CV7A 3SEBA 1EU3A 3PO2B 1B50A 2RDGA 3A54A 3GV6A 1EY0A 4O42A 3IFDA 1PRTB 2JEAI 3Q0AA 3VR6A 1D1IA 3BZDB 4WFN3 1Q12A 5I6WA 1Y8NB 1PMRA 4G7HC 1MSGA 3R2TA 4IUPA 4ZAIA 3JAML 1LO5D 2EJGC 4QB4A 1TWFB 1FNUA 2PZUA 2ENBA 3RZOB 2DNEA 5KGUA 4ME5A 4Y7NB 3BDCA 5K5PA 1DONA 2R6GA 2ZXRA 3GO5A 4CJ2C 3NHHA 5CBEE 2F0HA 3S1NB 5CMDA 1WD1A 1EYAA 3R2IA 2IX0A 1H9SA 2K32A 1JR0D 4DGZA 1C48A 4ZQ3A 4J1MA 1STBA 1WTXA 1LTTD 5JVH3 4A3FB 4RCNA 3F2UA 2F0OA 4IURA 4H13C 3GQBA 1TS4A 1B3AA 4KD4A 1PYWD 1O7LA 3VYSA 4LK1C 4C3HG 4ZRZA 4IFDH 5JPMC 3NE5B 2AQ1B 1SE2A 2NYZD 2RKSA 3KK7A 5IT9L 1CT1D 1S5ED 3GTKB 2E75C 2BE5C 3P7JA 5M9OA 1BNZA 3HOVB 3D3RA 1E2VA 1Z7TA 4K8JA 4XQJA 1F9RA 5IGGA 1SBBB 2KJXA 4DFAA 1O80A 1LTGD 1QNKA 3U9SA 1BO0A 1K8MA 3NP8A 5E4XA 1KLUD 1A3VA 2I07B 2OXPA 4A3DB 2A69D 2LFNA 3QWNA 1TU2B 3TZDA 2MP1A 4X3TA 2RSNA 1X3PA 2A6HD 4TRDA 4M1UB 4NP5A 5LHY1 4DXGA 4ULLA 1GUTA 3K5NA 2L5TA 3NTHA 1BR9A 2AUKA 1TY0A 2O5IC 1GUOA 2M9VA 2NVTB 3M4YA 2AWOA 1U4LA 1B9NA 1H9MA 4ZLTF 4C3IB 3TDQA 1VCIA 1XX8A 5AFWA 4C56C 1DOLA 2L9HA 4ZKBB 3MAQA 2Z4HA 5CYUA 2E76C 2PMZB 5KNCA 3CKIB 5KEEA 3A7LA 1LTAD 1A2TA 2RDHA 3UI2A 4HCSA 2EY6A 3CQZB 2PW7A 3HRZC 4ZK9B 4K6LA 1CQVA 1RODA 3J81L 1AFPA 1HUNA 2K5WA 5JPNC 4F87A 2K05A 1F9PA 2XSCA 4OIKA 1BOSA 1G291 2XNAC 4KN7C 4A93B 3S1MB 2F0NA 4KJOA 5IIFA 1F9QA 1GHKA 5FKAC 2X6LA 4N9TA 1LTRD 2ID0A 3SR1A 2QKIC 1Q90A 2OEOA 5CV6A 1S5DD 3URYA 3J7YW 3ITPA 4CHTB 1HRJA 3FPUB 3NQIA 1A3UA 4DAPA 3OIQA 2PO4A 2K6AA 2F0FA 3VR5A 1QNUA 1FR3A 3TP7A 3SK8A 1HTPA 1FD7D 3RMHA 1ZXTA 1SE3A 2E2HB 3QG1A 5T1IA 3MFGA 4OL7A 4XQQA 1KNEA 4C3JG 2QEJC 3PUXA 1STEA 3NWTA 3R93A 4EVOA 3ND8A 1UAPA 1JQYD 2SNSA 1TWHB 2EYJA 2IT1A 4FVMA 3U9OA 2F0KA 2B2TC 2OF1A 1PTOC 4ILWA 2EY1A 1T5XD 1SMYD 4YIJA 5IODA 1CFMA 4FF2A 1HPCA 5JAVA 1NR4A 1VMCA 2EYPA 1BQQT 2RDFA 3TSSA 2JA8B 1JOKA 3GTJB 1KAAA 1CA5A 1TIID 1I50B 1UNSA 2JP1A 4NDXA 2RQXA 3T51B 3MXUA 1YNJD 1EYCA 3GTQB 3IAYA 4IFDJ 2K03A 5JJZA 4QMGA 5TSSA 1BCPC 3FVQA 1H9SB 1EY7A 3GTGB 2K01A 3HOWB 3BS1A 2E2DC 1JB3A 1UEAB 3MC0B 2FJ2A 2A5HA 1ICWA 2XRQD 1X32A 4PQXA 3D6CA 3OMGA 2HDMA 4ZUIA 3T16A 3ND9A 5EBCA 1E2WA 4HR7B 1S5FD 3MHBA 4KMUC 3KBGA 3K58A 1TR5A 2NN6I 2NN6G 4FF4A 1RHPA 3E0JA 1QB5D 2BCOA 3ZYYX 2WIIB 3DMUA 1JC7A 3M3YB 2PCFB 2EVBA 1V1OA 5I6YA 2H1EA 3ONAB 2EY5A 5DM63 1QE6A 5ELBA 1LV9A 1WTWA 3GTLB 1SYDA 3K0YA 3X3NA 2MJ8A 4X3KA 5ISRA 4DAVA 3SK4A 4FO2A 1VMPA 1HA6A 3A8IE 4I65A 3HOUB 3KBXA 1GXDC 2KVMA 2EJFC 1PRTC 2RA4A 4ID6A 3OIPA 1LT5D 3TZUA 2IX3A 4F7XA 2QILA 2L1BA 2KOLA 3FRPB 2SOBA 2IWHA 2L0CA 3BG3A 1STNA 1DOKA 3MXPA 2OT2A 3DWPA 2F0SA 1BCPF 1RCVD 4B9WA 1EY5A 1YNNC 1BCPB 1KDAA 2FINB 4DK0A 1AW7A 2KEEA 4FXGC 1GJXA 4QIWB 1IYUA 2L12A 1CZWA 4KN4C 4B9XA 4P2CB 3T56B 2Q8RE 4IFDI 4L63B 3S2DB 5IGFA 1BXTA 4PV1C 2D9UA 1H9RA 1F77A 4IALA 4OIJA 2LS01 3V96A 2WACA 2MGSA 4RKBA 2J0TD 1SNCA 1SJED 1IL8A 4QUCA 1JE4A 3VA7A 1ZYRC 2A6EC 1CZGA 1EWCA 4IUNA 4KY6A 2NUCA 1O7ZA 5EPJA 1RF2D 2CW0C 3KF8A 1Y69U 1TVXA 1EY8A 4N9PA 1GUSA 3OHXC 4KTAA 1B53A 4DA2A 2NWGA 1XYIA 4CKEA 1QWYA 1TY2A 5CV4A 2F0LA 2XN9C 1EEFD 2F4IA 1J8IA 4GZYC 2EOTA 4NW2A 1PRTF 3LWUA 3DWQA 4IUQA 1DD2A 3L9AX 3LX0A 3NTKA 4KKUA 2TMPA 3MWYW 4A3EB 1I3QB 5EKIA 1BDOA 3NBHA 4FXKC 3CRKC 3EFXD 1NSNS 3HP3A 1M8AA 1OXTA 1AZPA 1SNQA 2KUMA 5EGTA 4J8QA 4WORA 1HQRD 4IUTA 3BDOA 1CK1A 2KCCA 5HURA 5C0XH 4NMZA 3GTOB 3CU7A 2QDBA 5ELCA 3AB9A 1SXTA 2R93B 1O7YA 3SVMA 1R4QB 1TS2A 3H94A 2V4DA 3MFYA 2WAQB 3PUYA 4MHEA 1HFNA 3I8ZA 4G4KA 2BA0A 5J39A 2EPBA 3IFTA 3QB3A 2KECA 3NWSA 3TMEA 3NK9A 3MTSA 5KNBA 2EJMA 3S1QB 3J7AV 4RHRA 2E74C 1WTVA 2BDNA 2O4XA 1MSHA 1EY4A 1K83B 2XWJB 1TQOA 1EYDA 1EIGA 1D6EC 1EQVA 1WD0A 3KLSX 3DXJC 2LKVA 3NTIA 2N55A 5G3LD 1IYVA 3GD7A 3X3MA 4FXDA 1ESRA 2NVQB 1RDPD 3SXHA 2Z4IA 1DJRD 2L11A 3HG9A 2F3WA 4C2MB 1F2YA 1BUVT 5A35A 4K8IA 5C44B 4NKLA 4ZUJA 1RTOA 4EQNA 1D1KA 1PLFA 3QIAA 4Z9CB 5JEAG 1V43A 3D6WA 3P20A 1ENAA 2XRSD 4MN3A 3S15B 3W2DA 5CGKA 3WOEA 2IW3A 1I4HA 3FMCA 1HA5A 3VYRA 5C5MA 3VYUA 5C4JB 2J4XA 3SK5A 1CM9A 4C1NI 4BBSB 2F0IA 4LAAA 2F0PA 1KNAA 5C3XA 2IPKD 4BY1B 1G2SA 1J9OA 2WKCA 2NVYB 1SYCA 1F2LA 3DEOA 4XXEA 5C6AA 2Q8TA 4I7ZC 5M3MB 3TBIB 3VR2A 1IKLA 1OXSC 4A3MB 5M5XB 3KLSA 1F2MA 2B2YA 3NSWA 5CV9A 1B4OA 2A73B 1TWAB 3A56A 3BVZA 4R8IA 5I2XA 5KYIA 3PO3B 4BA1I 1M4VA 2E2IB 2VUMB 1HQMC 1QCBD 3OOCA 4KHZA 1T5EA 2NVXB 3NPPA 4ZYSA 3RZDB 3Q22A 1Y1WB 3T13A 2YU9B 2CVRA 4XYQA 5I9OA 2JEBI 2PZTA 1LTBD 4K6DA 4KY5A 4HMIA 2F0EA 2A68D 3I3CA 1PTOH 4HMJA 4KKTA 4XYOA 5EPLA 2K28A 1W6KA 1LT3D 2FMCA 1DZ1A 3WDNA 2F0VA 3BYTB 2NZ1D 2F0TA 1E0BA 5D65A 1V1PA 3CHBD 5A2QE 3PUZA 3M7NA 3MZ5A 5IOCA 1R4PB 4F8MA 5JVG3 2F0QA 1HTLD 1IW7D 2EYHA 3I90A 2AQ2B 2MUYA 5K36G 1JOOA 3FEWX 1Q1EA 1WCMB 5JEAH 1GOZA 3A8JE 3HZXA 4AYBB 3EQLC 1UUPA 3HOZB 4IQZA 1NAPA 3L7ZC 1NUCA 3QJYA 3H09A 5C0XJ 5JOBA 1U4RA 5FLXE 3D4WA 2WINB 2PNRC 2B2WA 5C3WA 4X3UA 5T1GA 2H4OA 1C4QA 1LT6D 2NTTA 2A6HC 3D4DA 1G8ZD 4H0LC 1S5BD 1WTQA 5LL6X 3OW7A 3GP7A 1O78A 3Q6SA 4S3SA 5ELFA 1G2TA 4RFBA 2FFKB 3MEHA 2F0DA 5C5LA 1PDQA 2L55A 2JA5B 1GUGA 3NXWA 1ENCA 1C8CA 1PZJD 3K57A 3PV0A 2JYOA 1GHJA 3P1HA 2CW0D 2HQEA 2YYZA 2K5DA 2B2VA 4O1NA 3HKZB 2ZT9C 2ICEC 3S2HB 1TWGB 2EYOA 3C1EA 3JAME 1SEBD 1SDFA 4BS9A 4XTCS 4G7OC 1SYFA 3RUZA 1STAA 2KCNA 2HDLA 2AWNA 4FYDA 1B1ZA 3FDTA 5FOBB 3V05A 1B9MA 4WRDA 2VB3X 1I4RA 2RBMA 5I2YA 4ABNA 4L8JA 4K14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DFA A;  2EY2 A;  1SYB A;  4I65 A;  4KTA A;  4LAA A;  5C4H A;  2F0P A;  4EQO A;  3VA5 A;  5C3X A;  1JOO A;  3V2T A;  3QB3 A;  3NP8 A;  2F0N A;  5CR3 A;  3MVV A;  1SNP A;  4KJO A;  5IIF A;  1A3T A;  2EYL A;  1A3V A;  1EZ8 A;  1A2U A;  3E5S A;  3ERQ A;  4NDX A;  5CV4 A;  2OXP A;  3HEJ A;  1SYC A;  3NK9 A;  3SHL A;  3TME A;  2F0L A;  4N9T A;  1EYC A;  5NUC A;  4ID6 A;  3HZX A;  5C6A A;  3SR1 A;  4F7X A;  4QB4 A;  4H7B A;  2PZU A;  2ENB A;  2OEO A;  4IZ8 A;  1NUC A;  5KGU A;  4ME5 A;  5CV6 A;  1JOR A;  1EZ6 A;  4QMG A;  3BDC A;  1RKN A;  5K5P A;  1EY7 A;  5JOB A;  2SOB A;  2PQE A;  4J6H A;  3D4W A;  1STN A;  3P75 A;  4RKL A;  3LX0 A;  5EKL A;  3D8G A;  2O4X A;  3DHQ A;  1F2M A;  4QF4 A;  5C3W A;  3NHH A;  1F2Z A;  3H6M A;  3ITP A;  1EY4 A;  3MXP A;  2F0H A;  3PMF A;  3R3O A;  4TRD A;  2F0S A;  1EY9 A;  4NP5 A;  5CV8 A;  1TQO A;  1EY6 A;  5CV9 A;  5J1Z A;  1EYD A;  5CC4 A;  4PMC A;  4B9W A;  3QOJ A;  1EY5 A;  3C1F A;  3NUC A;  1EQV A;  4KD3 A;  1EYA A;  1SYE A;  1KDA A;  3D4D A;  5KYI A;  1A3U A;  5DAU A;  2LKV A;  5J22 A;  3EJI A;  5KIX A;  2F0F A;  3D6C A;  1SYG A;  4DGZ A;  4ZQ3 A;  5IGB A;  3OMG A;  4J1M A;  1STB A;  4ZUI A;  4S3S A;  4DU9 A;  3TP7 A;  3EVQ A;  2PYK A;  3T16 A;  1TT2 A;  1NSN S;  3MEH A;  2F0D A;  3SK8 A;  1AEX A;  4K5V A;  5C5L A;  3TP8 A;  4DF7 A;  4K5X A;  5DEH A;  1SNO A;  4B9X A;  3SXH A;  2F0O A;  1SNQ A;  5EGT A;  3NXW A;  5IGE A;  1ENC A;  3QOL A;  4PMB A;  2F3W A;  3T13 A;  1F2Y A;  1U9R A;  3S9W A;  1KDC A;  3TP5 A;  4K8I A;  3TP6 A;  4WOR A;  4OL7 A;  5I9P A;  4KD4 A;  5I9O A;  2PZT A;  5IGF A;  3MHB A;  4NKL A;  4K6D A;  4ZUJ A;  2M00 A;  1TR5 A;  4EQP A;  3P1H A;  5CV5 A;  4KY5 A;  4MIU A;  1KDB A;  2HQE A;  5KYL A;  4IAL A;  4EVO A;  4HMI A;  3NQT A;  2F0E A;  1JOQ A;  5E3F A;  2F3V A;  2PZW A;  2WAC A;  4EQN A;  2F0G A;  5HUR A;  2KQ3 A;  2SNS A;  5IGG A;  4RKB A;  5E1F A;  5F2D A;  4NMZ A;  2EYJ A;  4G57 A;  4HMJ A;  1SNC A;  4ODG A;  4R8N A;  1KAB A;  2QDB A;  5I6W A;  4E6I A;  4K2K A;  5KEE A;  3U9O A;  1A2T A;  4K5W A;  2F0K A;  2EYO A;  3C1E A;  2F0W A;  2RKS A;  4KV6 A;  2OF1 A;  1SNM A;  3DMU A;  3ERO A;  2EXZ A;  2F0U A;  1ENA A;  2KHS A;  3OMC A;  2F0V A;  1SYF A;  5IGC A;  4KY7 A;  2F0M A;  3BDL A;  2EY6 A;  3RUZ A;  5I6Y A;  5C4Z A;  4KHV A;  3OSO A;  4K2L A;  2EY1 A;  1STA A;  2F0T A;  5EKK A;  5CGK A;  1STG A;  5KRU A;  2PW5 A;  2EY5 A;  4KJN A;  2PW7 A;  5IGD A;  5M9O A;  5HGT A;  4YIJ A;  5IOD A;  3MZ5 A;  4IUN A;  5IOC A;  4F8M A;  5CV7 A;  5C5M A;  1SYD A;  5JAV A;  4KY6 A;  2NUC A;  1STY A;  1II3 A;  2F0J A;  3SK6 A;  3OWF A;  4HTH A;  4K8J A;  1STH A;  2EYP A;  1SND A;  2SNM A;  3SK5 A;  2F0Q A;  2RDF A;  1EY0 A;  4WRD A;  2EYH A;  2EYF A;  2RBM A;  2F0I A;  1EY8 A;  2EYM A;  1JOK A;  4PNY A;  1IHZ A;  1KAA A;  5ISR A;  3SK4 A;  5J39 A;  4N9P A;  4K14 A; 
#chains in the Genus database with same CATH topology
 4C3H B;  1AN8 A;  4JBK A;  4EQO A;  1ET6 A;  4LF9 Q;  1YHB A;  2BDO A;  3VA5 A;  4JYA Q;  4IN3 A;  3T4A C;  1UE7 A;  1M1K C;  1CUK A;  1MIU A;  1A3T A;  3ERQ A;  4KHP L;  1Q3L A;  1IBK Q;  4J15 A;  4HSV A;  1VQL A;  2C9O A;  1TWF H;  4MTN A;  2CQO A;  3RZO H;  1ILP A;  1HCZ A;  3NBI A;  4C3I G;  2B8G A;  4Y7N H;  5IYB H;  3HGB A;  4DAY A;  1ENF A;  2AMC B;  2WKD A;  1WI5 A;  3S16 B;  3PMF A;  3S1N H;  1HFG A;  1BVS A;  4V0B A;  1EY6 A;  2GVB A;  1TXY A;  5CC4 A;  4BWG B;  1I6V C;  4QL5 A;  2K5Q A;  1RD9 D;  3CMA A;  3K5O A;  1Y1V G;  5K36 H;  3EJI A;  5DNF A;  5IT9 E;  3G6J B;  4KKS A;  1Y14 B;  1MD2 D;  4G7Z C;  4OHJ A;  3EVQ A;  2N49 A;  1RTN A;  1TT2 A;  3RLF A;  1VQI A;  2DN8 A;  3D4R A;  2GA4 B;  4JBW A;  1RIP A;  1N36 Q;  2R61 A;  1HUM A;  1KDC A;  1CTM A;  5C0X I;  2G9D A;  3S17 B;  5C0X G;  1KDB A;  5EJW A;  5GAD C;  1S3O A;  1NBW A;  2BA1 A;  4DN4 M;  3D31 A;  1SE8 A;  4ODG A;  1VDZ A;  1KAB A;  3DWA A;  1D5X C;  3A55 A;  4BBR B;  2BE5 D;  3A7A B;  4GNX A;  4B3R Q;  4KV6 A;  3ERO A;  1B2T A;  3GTK H;  1PH2 A;  1MBY A;  3S14 B;  3KDF B;  4RGT A;  4BY7 B;  1HNW L;  2KA7 A;  4LF4 Q;  1Z6H A;  2B63 B;  2HCC A;  4OWX B;  1OO9 B;  4R9W A;  4P74 A;  2O2L D;  3CD6 A;  3SK6 A;  2UXC L;  5A2Q L;  1LTS D;  3AEV A;  2E2J B;  3LNN A;  2B2W C;  2EYF A;  2IX1 A;  5ELN A;  4X64 L;  3BVM A;  5LMN W;  1F9S A;  3HFZ B;  2CH4 W;  1K73 C;  1J5E L;  2H5X A;  4A3D H;  1ASY A;  3VR3 A;  1EZ8 A;  1L0X B;  3HEJ A;  4TQU S;  4NB3 A;  1LAB A;  1PFN A;  2ZJP A;  2K5H A;  2YV5 A;  4B3S Q;  1EQR A;  5LL6 S;  1RKN A;  2LXK A;  1I4X A;  5M3F B;  1EIF A;  4HAE A;  2ZXP A;  4RGM A;  3P75 A;  3DHQ A;  2XVS A;  2R92 B;  4YCW A;  3H6M A;  2ZJQ A;  2I5L X;  4KK7 A;  4M8A A;  1LYL A;  5LMN Q;  4NXN L;  5ELD A;  3MA2 B;  4DV0 L;  3M7G A;  1OXV A;  4FF3 A;  2B2V C;  5J22 A;  1LM0 A;  2EXD A;  4JI4 Q;  1IZ6 A;  2NVT H;  5GRO A;  2F03 A;  2UUC L;  5EBD A;  1L1O B;  1XNR L;  1PFS A;  2XTI A;  4K5X A;  1K0S A;  1I5F A;  4C3I H;  4U67 3;  2A8V A;  2D5D A;  1FYC A;  3J81 E;  2ICI A;  1YHQ A;  2JA7 G;  4A3G B;  2JA8 G;  1I94 Q;  1KIX A;  2MO1 A;  2M00 A;  5KYL A;  3KJP A;  4OO1 G;  1QOH A;  5JEA J;  4JCV E;  2B8F A;  4TSS A;  2KQ3 A;  4L5T A;  1PH3 A;  1V1P B;  3F8T A;  2D2C C;  4CJ1 B;  1BF4 A;  1SNM A;  1SJH D;  4YHH Q;  2F0U A;  1SAP A;  5FO8 B;  2HUG A;  3CQZ H;  4KY7 A;  3BDL A;  2NVY H;  1FNW A;  5KRU A;  2PW5 A;  1VQ9 A;  4DV2 Q;  1K8O A;  2E5L Q;  1KHI A;  5BN3 A;  3HS0 C;  1VQP A;  1AP0 A;  4R1J A;  1NMG A;  3E6Z X;  2ZTE A;  3HOW G;  3OWF A;  4HTH A;  4IUV A;  1STH A;  3L2P A;  1NMF A;  1EOV A;  1V8Q A;  3BJU A;  5DM7 3;  2HCI A;  4RA8 A;  4C3J B;  4A93 H;  1PVO A;  1OXX K;  1S5C D;  3S1M H;  4IUU A;  1EIH A;  2B39 A;  3N52 A;  4JK1 C;  2K50 A;  4UY8 C;  5H1S E;  3K59 A;  3DEP A;  3MXN A;  5NUC A;  4DR3 Q;  4TVA B;  1FVI A;  1GUN A;  4R4Q A;  4DR2 Q;  1EZ6 A;  2BOS A;  4IOA A;  4LMQ D;  1N33 Q;  1TS3 A;  3U4Z A;  2K4K A;  3C3L A;  2Z8L A;  1BBX C;  4FF1 A;  4V19 0;  4BXX G;  1M90 C;  5C3E B;  3R3O A;  4IPG A;  1WTP A;  2ES2 A;  3QO2 A;  2NB0 A;  5J1Z A;  4IJH A;  3T1Y Q;  4DUZ L;  2K33 A;  5C4X B;  1VF7 A;  3QOJ A;  3E3X A;  4DUY Q;  1ESF A;  4FNF A;  2JSO A;  1B44 D;  4XT1 B;  1W6J A;  2K1B A;  3SDZ A;  5IGB A;  3GV3 A;  4HCE A;  1DYQ A;  4GNX C;  1XJV A;  4L6T B;  1U4M A;  5BN5 A;  1EFI D;  4DF7 A;  4B3T Q;  5DEH A;  1SNO A;  4JI3 L;  3CP0 A;  4QJF A;  3UDF A;  2MNA A;  2E2H H;  1KTK A;  3OTO Q;  1B70 B;  1PH5 A;  1EIY B;  5IGE A;  4DR1 Q;  3G7L A;  4KHP Q;  1GKH A;  1EQT A;  2SDF A;  1XMQ Q;  1CKN B;  3I4L A;  2CQA A;  3I7F A;  5CV5 A;  1TWC B;  3NQT A;  3DUZ A;  1TWH H;  5E1F A;  4YWL A;  4DR7 L;  3IL8 A;  1CHP D;  1DXM A;  2FHT A;  4A76 A;  2AQ3 B;  1K8A C;  4YCU A;  1SSO A;  5LMU L;  1PTO D;  1VQO A;  1PXU A;  1JWM D;  2EXZ A;  2UXD Q;  2B2T A;  2KHS A;  2L4N A;  5AJ3 L;  1OXU A;  4LJZ C;  3OSO A;  4A3C G;  4HN7 A;  1Y8O B;  3J7A F;  3B6Y A;  2N78 A;  4LF9 L;  3CRL C;  1JWS D;  3HOZ H;  5GAG C;  4TKO B;  1H9K A;  2JA8 H;  4DK3 C;  3GTJ H;  1IBK L;  4OO1 H;  1DM0 B;  2EYM A;  4PNY A;  1U0L A;  1GUW A;  5D3I B;  1X9N A;  1D5Z C;  1TS5 A;  4DAY B;  1I50 H;  3HOY B;  1HZ9 A;  1SNP A;  4OXP A;  3FPP A;  1X3F A;  3SHL A;  3GTQ H;  1BCP D;  3VR4 A;  4XIG S;  3H91 A;  4CJ0 B;  3ICE A;  1I4G A;  1LLR D;  4H7B A;  4RWS C;  3UDX A;  4H44 C;  2EDG A;  4IZ8 A;  3S1R B;  3GTG H;  4YWM A;  2HQL A;  1WOC A;  4A3K B;  1ML0 D;  2LY7 A;  3RNU A;  2JA6 B;  2LMC B;  2WB1 E;  3CAM A;  4HJ7 A;  5M5W B;  3HOW H;  3I73 A;  2R3Z A;  1EY9 A;  5CV8 A;  1H95 A;  1I4P A;  4PMC A;  4F88 A;  1XTD A;  1X3Q A;  3KLR A;  3BZK A;  3W3A A;  1AZQ A;  4RCO A;  2UXC Q;  1N36 L;  1K0R A;  3H0G B;  3Q23 A;  2RVL A;  2OTJ A;  5KIX A;  3FP9 A;  1PZI D;  1SYG A;  4X64 Q;  4JI2 Q;  4LFB Q;  3U58 A;  2RHS B;  1HJP A;  2I46 A;  4L5Q A;  1JJC B;  4RGN A;  1Y1V B;  1CHQ D;  2WB1 B;  2RSO A;  1EWH A;  3ER0 A;  3QOL A;  1V1Q A;  3KOJ A;  5FO9 B;  4DV1 Q;  3H3V C;  1U9R A;  2VXW A;  3TP5 A;  2EQS A;  1JE5 A;  2Q2H A;  3BYY B;  4B3R L;  1VQD A;  4Q5V A;  4HJ5 A;  1JOQ A;  4BXX H;  1YJW A;  1UEB A;  1AE3 A;  2D62 A;  2XGT A;  3K7A B;  2UU9 Q;  5E3F A;  2PZW A;  2QF7 A;  3VYT A;  2M2L A;  3KUP A;  4XQN A;  2QCP X;  4IOC A;  4LF4 L;  4RH6 A;  5IP9 G;  2NTS A;  4P71 A;  2O5J C;  3OW2 A;  2Y0S E;  3M3Y H;  1E24 A;  3TN2 A;  4DV0 Q;  1C7Y A;  1YVC A;  3I72 A;  1JIC A;  1V9P A;  1YEZ A;  4O2D A;  3OMC A;  3PO2 G;  5IGC A;  1NR2 A;  5BN4 A;  1YJN A;  1D2B A;  1Q81 C;  2VL6 A;  2KED A;  1STG A;  1RJT A;  2LXJ A;  5HGT A;  1P8L A;  3SGI A;  3GTL H;  3L0O A;  4YCV A;  1H9J A;  1VQF A;  4A3E G;  3ULP A;  2SNM A;  3J7Z C;  4UP9 A;  4MNO A;  2QGQ A;  2Y0S B;  3PUV A;  4JI8 L;  2HT1 A;  2MPM A;  3HOU H;  3F2D A;  1MJE A;  2JE6 I;  1PRT D;  4B3S L;  2BH2 A;  5CR3 A;  3MVV A;  2R7Z B;  3I70 A;  2HIX A;  3RD4 A;  3AMU A;  4EGV A;  3STB C;  4QCL A;  2R7F A;  1WVL A;  3BU2 A;  4XT3 B;  1SRU A;  1CQF A;  4A3C H;  3RR5 A;  2B2U A;  2K7V A;  5I4D A;  1D7Q A;  4J6H A;  2PQE A;  2UXB Q;  5EKL A;  1YNN D;  4JI4 L;  3PIP A;  4DK1 A;  3BVG A;  3N6R A;  2OWO A;  3NUC A;  1QIL A;  4OGQ C;  1PH8 A;  2IHE A;  1ONL A;  4R4C A;  2R93 G;  2KHJ A;  1QVF A;  3J80 E;  4RGO S;  1I94 L;  4UAI A;  4GN5 A;  1DCZ A;  4DU9 A;  2Q8I B;  3K5M A;  1CI3 M;  4JBJ A;  2A69 C;  1AEX A;  2C5C A;  2XIW A;  4HED A;  2TSS A;  2WAQ G;  1A15 A;  3CXC A;  1EU4 A;  4PMB A;  3S2D H;  2MO0 A;  4DV7 L;  4IPD A;  3TP6 A;  2B63 H;  4DR6 L;  1U4P A;  3OPO A;  1LTI D;  2MHV A;  2PI2 A;  1TKW B;  3IKJ A;  4YY3 Q;  1FNV A;  2JA7 B;  4P73 A;  1Q7Y C;  1ZYR D;  2A6E D;  4K2K A;  1ZKO A;  2EE1 A;  3CCM A;  1PFB A;  5EQ0 A;  1KLG D;  2F0W A;  3AU7 A;  2OTL A;  3O13 A;  1JWU D;  5C4Z A;  3ERS X;  4KHV A;  5EKK A;  4PMW A;  1IL2 A;  1HHV A;  3LWE A;  4HIM A;  2P5Z X;  4KI0 A;  1EL0 A;  2UUB L;  4XDX A;  1CA6 A;  4JI3 Q;  3AYH B;  2F0J A;  4ZKC B;  1C9O A;  1SND A;  2DGY A;  3GDE A;  3ULJ A;  1G91 A;  1QJO A;  1S4Z A;  1A63 A;  2EY2 A;  1SYB A;  5C4H A;  3PIO 3;  4DR2 L;  4BA2 I;  5M5Y B;  3V2T A;  5IP9 H;  3DM1 A;  2FMM A;  1ET9 A;  2HD3 A;  2CHB D;  1HR0 W;  4C1N K;  3E5S A;  1K28 A;  4WJW A;  4X6A H;  5FO7 B;  1XTC D;  2JXM B;  2N88 A;  3I4O A;  4JC0 A;  3PUW A;  5ELE A;  2AKW B;  4RAU C;  4DUY L;  1WTR A;  5C44 G;  2NBF A;  3FKI B;  3TEH B;  4UP7 A;  5AJ3 Q;  2B2Y C;  2IJ0 A;  3L3O C;  4RKL A;  3D8G A;  4X3S A;  2X6G A;  4QF4 A;  3C2P A;  4A3E H;  1I3Q H;  1IBL L;  1JCK B;  4RMF A;  2QDL A;  2ZJR A;  4R4I A;  4UDU C;  4B3T L;  4KD3 A;  3CCV A;  3OTO L;  2X69 A;  4A3B B;  1VQJ A;  4DR1 L;  4DXF A;  4CKB A;  2YTV A;  1VF5 C;  4FP5 D;  1HR0 Q;  1XMQ L;  4RHS A;  1PZK D;  5COY A;  3J80 c;  4A3J B;  3E9I A;  3Q24 A;  2J7Z A;  2EIF A;  3HOX B;  5D3D A;  1SE4 A;  5FLX c;  3A0J A;  2ZTC A;  4BBS G;  1R9T B;  1L1O C;  5G3L F;  4EQP A;  2UXD L;  4MIU A;  2PQA A;  2WP8 J;  4Y52 H;  5EPK A;  2F3V A;  1DOM A;  1VQN A;  1XWE A;  1EEI D;  1PTO F;  3GTO H;  1PTO B;  3GTM B;  5D14 A;  5FK9 C;  1IKM A;  1PFM A;  2A68 C;  2R93 H;  3C46 A;  3I55 A;  1ZEQ X;  2IY5 B;  2K04 A;  2IL8 A;  5CBA E;  5M3M G;  4U68 A;  1E2Z A;  2A1A A;  3M85 A;  4A3I B;  4CGY B;  4KJN A;  5IGD A;  2F1M A;  1IYJ B;  4A3M G;  2AHO B;  4A93 G;  1STY A;  2B2U C;  1II3 A;  2CFM A;  2WV6 D;  4Q0F A;  4LF5 Q;  1IHZ A;  2QEX A;  2VUM G;  4CBV A;  3WOF A;  1IW7 C;  2DNC A;  4DKA C;  2JA9 A;  3A8K E;  3JAM c;  4DNR B;  5E4W C;  3T53 B;  1LAC A;  2EYL A;  1A2U A;  2ZXO A;  2ALY B;  1Y1W G;  3S1Q H;  1Q8I A;  4DV4 Q;  4KLK A;  1I4Q A;  4EX5 A;  3F1Z A;  1N32 Q;  1Y8P B;  1JOR A;  1SMY C;  1Q86 C;  3G71 A;  1VQG A;  3MEF A;  4LNQ A;  2A74 C;  3ZJY C;  1Z47 A;  4HSP A;  4HIK A;  3I4M B;  1K83 H;  1F2Z A;  3MXG A;  4JI2 L;  3K6O A;  4LFB L;  4IFD G;  4N8F A;  2PPB C;  3C1F A;  1FGB D;  1Q1B A;  1SYE A;  5DAU A;  2RHQ B;  4DV1 L;  2AUJ D;  3M4P A;  1I6H B;  1LT4 D;  4JI8 Q;  4B08 A;  1SFO B;  3OWE B;  2XWB B;  3EA6 A;  2NVQ H;  2PYK A;  1QZG A;  4JVZ A;  1YNJ C;  1L0Y B;  3PIP 3;  2UU9 L;  4K5V A;  3J80 L;  3TP8 A;  3PF5 A;  2VB2 X;  3R8B A;  4C2M H;  1MI2 A;  3SE0 A;  1NCV A;  1D5M C;  1LTL A;  2NZH A;  3S9W A;  5C44 H;  5I9P A;  3K8A A;  2EZV A;  2DUD A;  5FLX L;  3G4S A;  3K5L A;  2G9H D;  1G6Z A;  1XXG A;  4DV5 Q;  1EOT A;  5FLM H;  5COR A;  1A6X A;  2VNU D;  2Z9H A;  2F0G A;  5F2D A;  1QG7 A;  2SEB D;  4G57 A;  1VQ7 A;  1WCM G;  4R8N A;  2DY8 A;  3D0F A;  1WTO A;  4E6I A;  4DNT B;  1ILQ A;  1X6O A;  2NN6 H;  4K5W A;  4CKC A;  2Z1C A;  5IT9 c;  2R7D A;  1YI2 A;  2DY7 A;  2ZM6 L;  3S15 H;  3M4O B;  3HOY H;  1MGS A;  4AYB G;  3HOZ G;  5KND A;  3GTP B;  1A62 A;  2F0M A;  2VQE Q;  4K2L A;  1HXY D;  4L5S A;  3CPW A;  4OO1 I;  3I4N B;  2HHH L;  4QUF A;  3I91 A;  5CV7 A;  3SEB A;  1EU3 A;  3PO2 B;  1B50 A;  5C4J H;  2RDG A;  1E7Z A;  3A54 A;  4BBS H;  3GV6 A;  1EY0 A;  4O42 A;  3IFD A;  1PRT B;  2JEA I;  3Q0A A;  3VR6 A;  1YJ9 A;  1D1I A;  3BZD B;  4DV7 Q;  4WFN 3;  1Q12 A;  4DR6 Q;  5GQO A;  5I6W A;  1Y8N B;  1JJ2 A;  1PMR A;  4G7H C;  1MSG A;  5FJ8 G;  4BY1 H;  1N34 L;  4JG2 A;  3R2T A;  4IUP A;  3CCR A;  2Z6K A;  2UXB L;  4ZAI A;  3JAM L;  3RN2 A;  2JA5 G;  1LO5 D;  5M3M H;  2EJG C;  4I7A A;  4QB4 A;  1TWF B;  1FNU A;  2PZU A;  2ENB A;  3AFQ A;  3RZO B;  2DNE A;  5KGU A;  2I5M X;  4ME5 A;  4Y7N B;  3BDC A;  5K5P A;  1DON A;  2R6G A;  1WTH A;  4JI7 Q;  2PI2 E;  5M5X H;  4A3M H;  2ZXR A;  3GO5 A;  2VS1 A;  4CJ2 C;  3NHH A;  5CBE E;  2F0H A;  1GO3 E;  1TWA H;  2UUB Q;  3S1N B;  5CMD A;  3HKZ G;  4UP8 A;  1WD1 A;  4JI5 Q;  2GN5 A;  3RLN A;  3PO3 H;  1EYA A;  3HKS A;  1XPO A;  2E2I H;  3R2I A;  2VUM H;  5IYC G;  2IX0 A;  1H9S A;  2F52 A;  4DK6 C;  2K32 A;  1JR0 D;  4DGZ A;  2NVX H;  1C48 A;  4ZQ3 A;  4J1M A;  1STB A;  1BBU A;  1WTX A;  3EN2 A;  1LTT D;  3RZD H;  5JVH 3;  4A3F B;  4RCN A;  3F2U A;  1Y1W H;  1FGU A;  1PYS B;  4YY3 L;  2F0O A;  4IUR A;  4HID A;  1NTG A;  2YU9 H;  4H13 C;  3GQB A;  4AH6 A;  1TS4 A;  1B3A A;  4KD4 A;  1PYW D;  3F2B A;  4CDF C;  1O7L A;  3VYS A;  4LK1 C;  2V1C C;  4C3H G;  4ZRZ A;  4IFD H;  1P16 A;  5JPM C;  3AQQ A;  3NE5 B;  3M9B A;  2AQ1 B;  1E3P A;  1IBL Q;  1SE2 A;  1AH9 A;  2NYZ D;  2RKS A;  3KK7 A;  4MZ9 A;  5IT9 L;  1CT1 D;  1S5E D;  3STB D;  3GTK B;  2E75 C;  3F2C A;  3NEN A;  1PV4 A;  2BE5 C;  1CKM A;  3P7J A;  1VQC A;  1E1O A;  5M9O A;  4GN4 B;  1BNZ A;  3HOV B;  3D3R A;  5BR8 Q;  4LF6 Q;  3J81 c;  1E2V A;  1Z7T A;  4OWT B;  3HOU G;  1KRT A;  4K8J A;  4XQJ A;  1F9R A;  4N8X 1;  5IGG A;  1SBB B;  2KJX A;  4DFA A;  1O80 A;  1LTG D;  1QNK A;  3U9S A;  3NEM A;  1HH2 P;  2IHF A;  1BO0 A;  4JI6 L;  1K8M A;  3NP8 A;  1WCM H;  2CCZ A;  5E4X A;  1KLU D;  1EYG A;  1JMC A;  1A3V A;  3AFP A;  3G6E A;  2I07 B;  2OXP A;  4A3D B;  2A69 D;  1KL9 A;  2LFN A;  4A3L H;  3QWN A;  1TU2 B;  1VS0 A;  3KLW A;  3CCS A;  3TZD A;  2MP1 A;  4X3T A;  1BBW A;  2RSN A;  1HR0 L;  1NY4 A;  1X3P A;  4GKK L;  1MKH A;  2A6H D;  4TRD A;  4M1U B;  4NP5 A;  5LHY 1;  1WFQ A;  4DXG A;  4ULL A;  3CC4 A;  1PH7 A;  4BBR G;  2CWP A;  1GUT A;  2OQK A;  3K5N A;  2L5T A;  3NTH A;  3H3V H;  4LFA L;  1BR9 A;  2AUK A;  5FJ8 H;  1Q8K A;  1TY0 A;  1YZ6 A;  4PZ7 A;  2PMZ E;  4IJL A;  1HZB A;  2O5I C;  1GUO A;  3RN5 A;  2M9V A;  2PQA B;  3EBE A;  2NVT B;  3M4Y A;  2AWO A;  2B63 G;  2JA5 H;  4A4I A;  1U4L A;  3S24 A;  4AIM A;  1B9N A;  1H9M A;  4ZLT F;  4C3I B;  4DPG A;  3TDQ A;  1NNX A;  1VCI A;  4JOI A;  1XX8 A;  5AFW A;  4C56 C;  1DOL A;  1YIT A;  2L9H A;  4ZKB B;  2Z6B A;  3A5U A;  4K0K Q;  3E0E A;  3MAQ A;  2Z4H A;  5CYU A;  2E76 C;  2PMZ B;  3S2H H;  5KNC A;  1TWG H;  3CKI B;  5KEE A;  5IYC H;  3A7L A;  1LTA D;  1A2T A;  2RDH A;  3UI2 A;  4HCS A;  5M5Y H;  1K3R A;  1X65 A;  2Z6K C;  2EY6 A;  5M3F G;  4LF5 L;  3CQZ B;  3QR8 A;  2PW7 A;  4QQB X;  3HRZ C;  4ZK9 B;  4K6L A;  4P75 A;  1CQV A;  1ROD A;  3J81 L;  1AFP A;  1HUN A;  2K5W A;  5JPN C;  1X56 A;  3WWV A;  1EUJ A;  4F87 A;  2K05 A;  4FDB A;  1F9P A;  2RF4 A;  2XSC A;  4C3H H;  4DV4 L;  1VQ6 A;  4OIK A;  1BOS A;  1G29 1;  2XNA C;  4KN7 C;  1N32 L;  4A93 B;  3S1M B;  2F0N A;  3A74 A;  1YBY A;  2I5H A;  1PHJ A;  4KJO A;  5IIF A;  1F9Q A;  4AQY Q;  1GHK A;  4HIO A;  5FKA C;  2X6L A;  4N9T A;  1LTR D;  5JJI A;  2ID0 A;  3SR1 A;  2QKI C;  1Q90 A;  2OEO A;  2Z0S A;  2ZM6 Q;  4A3G G;  5CV6 A;  1XMO Q;  4JI0 L;  1S5D D;  3URY A;  4QY7 A;  3S16 H;  3J7Y W;  3ITP A;  4A75 A;  4CHT B;  3UDI A;  1HRJ A;  1G6P A;  2HHH Q;  1UE5 A;  4LFC L;  3CCJ A;  5J3B A;  3FPU B;  3NQI A;  1VQM A;  3OYY A;  1A3U A;  4DAP A;  3OIQ A;  2PO4 A;  5ELO A;  2K6A A;  2F0F A;  3VR5 A;  4X66 L;  1QNU A;  1FR3 A;  3A5Z B;  1CSP A;  3TP7 A;  4O0A A;  4DV5 L;  3SK8 A;  1HTP A;  3CME A;  3TQY A;  1N34 Q;  4DR4 L;  1FD7 D;  3RMH A;  1ZXT A;  1SE3 A;  2E2H B;  5IYD G;  3QG1 A;  5T1I A;  3S17 H;  3RLO A;  3MFG A;  4OL7 A;  1X3G A;  1HNX Q;  4XQQ A;  1KNE A;  4C3J G;  2QEJ C;  3PUX A;  1STE A;  3NWT A;  3R93 A;  3K7U C;  4EVO A;  3ND8 A;  1UAP A;  1HNZ Q;  4X65 L;  2VQE L;  1JQY D;  2SNS A;  1TWH B;  2EYJ A;  4BBR H;  2IT1 A;  4FVM A;  3U9O A;  2KBN A;  2F0K A;  2B2T C;  2OF1 A;  2VQF Q;  3S14 H;  4BY7 H;  4LW1 A;  5IP7 G;  1PTO C;  4ILW A;  2EY1 A;  1T5X D;  1SMY D;  1CKO A;  1VQB A;  4YIJ A;  5IOD A;  1CFM A;  4GKJ Q;  4FF2 A;  2ZTD A;  1HPC A;  1QVC A;  1NR4 A;  5JAV A;  1VMC A;  1WJJ A;  4L5R C;  2E2J H;  2EYP A;  1BQQ T;  2RDF A;  3TSS A;  2JA8 B;  1JOK A;  3GTJ B;  1KAA A;  4DV6 Q;  1CA5 A;  1VQK A;  1TII D;  3FHW A;  4JI7 L;  1B8A A;  1I50 B;  1UNS A;  1FL0 A;  3U50 C;  2JP1 A;  4NDX A;  2RQX A;  3T51 B;  2JJQ A;  1FJG Q;  3MXU A;  1XPU A;  2KEN A;  1YNJ D;  1EYC A;  3GTQ B;  1EWI A;  4JI5 L;  3IAY A;  4IFD J;  2K03 A;  5JJZ A;  5M3F H;  4QMG A;  5TSS A;  1BCP C;  3FVQ A;  1VQE A;  1S72 A;  2G5D A;  1H9S B;  1EY7 A;  3GTG B;  5JJK A;  4PZ8 A;  2KCM A;  2R92 H;  1CSQ A;  2K01 A;  3EIV A;  3HOW B;  3BS1 A;  2E2D C;  1JB3 A;  1UEA B;  1LUZ A;  3MC0 B;  2FJ2 A;  1PH6 A;  2Q2U A;  2QA4 A;  4OEM B;  2A5H A;  1XNQ Q;  1ICW A;  4WJ4 A;  2UUA Q;  2XRQ D;  4JI1 L;  1X32 A;  4PQX A;  5E7N A;  2K52 A;  4ME3 A;  3D6C A;  4X62 Q;  3KFU A;  3OMG A;  2HDM A;  4ZUI A;  2OCE A;  1GVP A;  3T16 A;  2DJG C;  3ND9 A;  5EBC A;  1KC8 C;  4ALP A;  4JI6 Q;  2F4V Q;  1E2W A;  5FLM G;  4A3G H;  4B3M L;  4HR7 B;  4DV3 Q;  3PF4 A;  1S5F D;  3MHB A;  4KMU C;  3KBG A;  3K58 A;  1TR5 A;  4JW0 A;  2NN6 I;  5IE8 A;  2NN6 G;  1SLJ A;  4OWW B;  3NEL A;  4H02 A;  4FF4 A;  1RHP A;  1YHA A;  3HOY G;  2JQO A;  4GKK Q;  3CCL A;  3E0J A;  3UE0 A;  1QB5 D;  5BR8 L;  4LF6 L;  2BCO A;  3ZYY X;  2WII B;  3DMU A;  1JC7 A;  3M3Y B;  2PCF B;  2EVB A;  1V1O A;  5I6Y A;  4LFA Q;  2H1E A;  1N9W A;  1L0W A;  3ONA B;  4A3K G;  2EY5 A;  3W1G A;  5DM6 3;  1QE6 A;  2F3I A;  5ELB A;  2JA6 G;  5IYD H;  1LV9 A;  1WTW A;  3GTL B;  1SYD A;  2VY3 A;  3K0Y A;  3X3N A;  3K81 C;  2MJ8 A;  2KHI A;  4X3K A;  4NPS A;  3KF6 A;  1PA6 A;  4BY1 G;  4C3J H;  4UPA A;  4HJ9 A;  5ISR A;  4DAV A;  3H0G G;  3SK4 A;  4HJA A;  4FO2 A;  1VMP A;  1HA6 A;  3M4Q A;  3A8I E;  4I65 A;  3HOU B;  3KBX A;  1GXD C;  2VW9 A;  2KVM A;  2EJF C;  4MTK A;  1PRT C;  2RA4 A;  2WB1 G;  4LWC A;  4ID6 A;  3OIP A;  1LT5 D;  1IBM L;  3TZU A;  2IX3 A;  4F7X A;  5IP7 H;  4A3F H;  2QIL A;  3J81 i;  2YTY A;  4QIW E;  3T1H L;  2L1B A;  2KOL A;  3FRP B;  4IPC A;  2SOB A;  2IWH A;  1BKB A;  2L0C A;  3BG3 A;  3PO3 G;  1STN A;  5C3E H;  1DOK A;  3MXP A;  2OT2 A;  4DAM A;  3DWP A;  2F0S A;  5C4X H;  4OX9 Q;  1BCP F;  1RCV D;  4B9W A;  1EY5 A;  1YNN C;  1BCP B;  1KDA A;  1GM5 A;  2FIN B;  4DK0 A;  1AW7 A;  2KEE A;  4FXG C;  1GJX A;  5GAH C;  4NXM Q;  4QIW B;  1IYU A;  1G51 A;  4K0K L;  2L12 A;  1CZW A;  4KN4 C;  4B9X A;  4P2C B;  3T56 B;  2Q8R E;  4IFD I;  3G48 A;  4L63 B;  3S2D B;  3HOV H;  2WFW A;  5IGF A;  1B7Y B;  3J81 j;  1BXT A;  1TWC H;  1KAW A;  2Y0S G;  2D9U A;  4PV1 C;  1H9R A;  4LF8 Q;  1F77 A;  3KJO A;  4IAL A;  4OIJ A;  2LS0 1;  3V96 A;  4JI0 Q;  1DGS A;  2WAC A;  3VDY A;  2MGS A;  4RKB A;  1K9M C;  2R7Z G;  2J0T D;  1X3E A;  1SNC A;  4GN3 B;  1SJE D;  4LFC Q;  1IL8 A;  4QUC A;  1VQ5 A;  4JV5 Q;  1JE4 A;  3VA7 A;  1ZYR C;  1JB7 A;  2A6E C;  1VQ8 A;  4QGU A;  4X66 Q;  4GOP B;  1CZG A;  3TS2 A;  1EWC A;  4IUN A;  3UE1 A;  1A8V A;  4DR4 Q;  4KY6 A;  2NUC A;  1O7Z A;  4AQY L;  5EPJ A;  4CDE C;  1RF2 D;  2CW0 C;  3KF8 A;  3CCE A;  2BH8 A;  1TVX A;  1YNX A;  4ZCK A;  3W1B A;  1Y69 U;  1EY8 A;  4N9P A;  3U4V A;  1GUS A;  3OHX C;  4KTA A;  1B53 A;  4DA2 A;  1XMO L;  2NWG A;  1XYI A;  4CKE A;  2MQH A;  4LUV A;  1E1T A;  4A3L G;  1QWY A;  4X65 Q;  1TY2 A;  5CV4 A;  2F0L A;  1KXL A;  2XN9 C;  1EEF D;  2F4I A;  3S1R H;  4GS3 A;  1J8I A;  4GZY C;  2EOT A;  4A3K H;  4NW2 A;  1PRT F;  3LWU A;  3DWQ A;  4IUQ A;  1DD2 A;  2JA6 H;  3L9A X;  3K0X A;  3LX0 A;  5HY6 A;  5M5W H;  3NTK A;  4LF7 L;  4KKU A;  2B3G A;  4OON A;  3H3V I;  2TMP A;  3MWY W;  2CWA A;  1WYD A;  3H15 A;  4A3E B;  1I3Q B;  3H0G H;  5EKI A;  3CF5 A;  2KCT A;  1BDO A;  2K75 A;  3NBH A;  4FXK C;  1HNX L;  3CRK C;  1T9H A;  4APV A;  3EFX D;  1Y1V H;  1NSN S;  1KQS A;  3HP3 A;  5EAY A;  1UWV A;  5IWA L;  1HNZ L;  1M8A A;  1OXT A;  1AZP A;  1SNQ A;  2KUM A;  5EGT A;  4DNI A;  4J8Q A;  1X54 A;  4POG A;  4WOR A;  4DR5 L;  1HQR D;  4IUT A;  1MJC A;  3BDO A;  2VQF L;  1QZH A;  1O7I A;  3K7A H;  4OEL B;  2CKZ B;  5IY0 A;  2WAQ E;  3PCO B;  4PG3 A;  1CK1 A;  2KCC A;  4LUZ A;  5HUR A;  5C0X H;  4NMZ A;  1QUQ B;  3GTO B;  3CU7 A;  2QDB A;  5ELC A;  4GKJ L;  3AB9 A;  1SXT A;  4IO9 A;  2R93 B;  1O7Y A;  3SVM A;  1U5K A;  4CDD C;  1R4Q B;  1TS2 A;  4RG1 A;  4JI1 Q;  4POF A;  3H94 A;  2V4D A;  3FKI G;  1XPR A;  4DV6 L;  1IXR A;  1W2B A;  3MFY A;  2WAQ B;  3TRZ A;  3PUY A;  4PZ6 A;  4MHE A;  1HFN A;  3JC6 6;  3I8Z A;  1FJG L;  4G4K A;  2BA0 A;  4B3M Q;  4A3B G;  2FXQ A;  5J39 A;  3DM3 A;  2QW7 A;  2EPB A;  2D0P A;  3IFT A;  2R7Z H;  3QB3 A;  3DLL A;  2KEC A;  3NWS A;  2JN4 A;  4A3J G;  3TME A;  3NK9 A;  1NJI C;  2VZA A;  3MTS A;  5KNB A;  2EJM A;  1VQ4 A;  3HOX G;  3S1Q B;  3J7A V;  4RHR A;  2E74 C;  1XNQ L;  1WTV A;  1Z9F A;  2N3S A;  2UUA L;  2BDN A;  1RL2 A;  1GD7 A;  1X55 A;  1HZA A;  4X62 L;  2O4X A;  1W3S A;  1MSH A;  1NE3 A;  1EY4 A;  1K83 B;  2XWJ B;  1TQO A;  1EYD A;  2F4V L;  2D0O A;  1EIG A;  1D6E C;  1EQV A;  1WD0 A;  1SN8 A;  3KLS X;  3DXJ C;  2LKV A;  3NTI A;  2N55 A;  4DV3 L;  5G3L D;  1IYV A;  3CC2 A;  3GD7 A;  3X3M A;  1S40 A;  4A3I G;  4FXD A;  1ESR A;  2NVQ B;  1RDP D;  1J6Q A;  2Z4I A;  3SXH A;  1DJR D;  2L11 A;  3HG9 A;  2F3W A;  4C2M B;  1F2Y A;  1BUV T;  3I56 A;  3PIO A;  5A35 A;  4K8I A;  5C44 B;  1IBM Q;  4R4O A;  4NKL A;  4JYA L;  4ZUJ A;  3T1H Q;  1RTO A;  2PNH A;  4EQN A;  2JA7 H;  1D1K A;  5DLQ E;  3CCU A;  4BY7 G;  1AE2 A;  1PLF A;  3QIA A;  2LSS A;  1L2F A;  1E22 A;  4Z9C B;  5JEA G;  1V43 A;  3D6W A;  3P20 A;  1ENA A;  3KF6 B;  2XRS D;  4MN3 A;  3S15 B;  4EQ5 A;  3W2D A;  1B3Q A;  1JJG A;  3TRE A;  5CGK A;  3WOE A;  2IW3 A;  1I4H A;  3FMC A;  1HA5 A;  3VYR A;  3I4M G;  5C5M A;  3VYU A;  4CDC C;  3ULL A;  2I0Q A;  1JT8 A;  5C4J B;  4R4T A;  2J4X A;  1PYB A;  1CM9 A;  3SK5 A;  4C1N I;  3PGZ A;  4BBS B;  4HJ8 A;  3KDF A;  1SMX A;  2F0I A;  1HNW Q;  1K3B C;  2DJF C;  3KYH C;  4LAA A;  2F0P A;  3J80 i;  1KNA A;  5L37 A;  5C3X A;  2L15 A;  2IPK D;  4BY1 B;  1G2S A;  1J9O A;  2WKC A;  2NVY B;  2MFI A;  4P72 A;  1EFW A;  1SYC A;  5GAE C;  4IPH A;  1F2L A;  3DEO A;  2NZO A;  2R92 G;  4OX9 L;  4XXE A;  5C6A A;  2Q8T A;  4I7Z C;  3W5O A;  5M3M B;  2GVA A;  3FKI H;  3TBI B;  2YTX A;  1J5E Q;  2Q2T A;  3CW2 C;  3VR2 A;  1IKL A;  2RCN A;  1OXS C;  3CPF A;  4A3M B;  5M5X B;  3KLS A;  4NXM L;  1F2M A;  2B2Y A;  4GOP A;  2K14 A;  3NSW A;  5CV9 A;  2K5V A;  4GNX B;  1B4O A;  2A73 B;  1TWA B;  3A56 A;  3BVZ A;  4R8I A;  4A3B H;  1K8G A;  5I2X A;  5KYI A;  3PO3 B;  4BA1 I;  1M4V A;  4LUO A;  1PH1 A;  2E2I B;  2VUM B;  1HQM C;  2RCF A;  1C0A A;  1QCB D;  3PSI A;  1ASZ A;  3OOC A;  4KHZ A;  2ATW A;  1T5E A;  2K5N A;  3K80 C;  2NVX B;  4LF8 L;  3NPP A;  4ZYS A;  4A3J H;  4NXN Q;  3RZD B;  3I4N G;  3Q22 A;  3HOX H;  1Y1W B;  4GLA C;  2N8N A;  3T13 A;  2YU9 B;  3Q8D A;  2CVR A;  4UHV A;  3LGJ A;  4XYQ A;  5I9O A;  1R9T H;  2JEB I;  2PZT A;  2ASB A;  1A0I A;  1LTB D;  4K6D A;  4JV5 L;  4KY5 A;  4JPB W;  3BZC A;  2UUC Q;  4HMI A;  2F0E A;  1L1O A;  1XNR Q;  2A68 D;  3I3C A;  3JAM i;  4WJ3 M;  1PTO H;  3GTM H;  3UDG A;  4HMJ A;  4LF7 Q;  1EQQ A;  4KKT A;  4XYO A;  3IRB A;  2A19 A;  5EPL A;  2K28 A;  1W6K A;  1LT3 D;  2FMC A;  1DZ1 A;  3WDN A;  2F0V A;  3BYT B;  3KF8 B;  1PH9 A;  4A3I H;  2NZ1 D;  2F0T A;  5IYB G;  1E0B A;  5D65 A;  1QVG A;  1V1P A;  3CHB D;  5A2Q E;  3PUZ A;  3M7N A;  3MZ5 A;  5IOC A;  5LMN L;  1R4P B;  3PQI A;  4F8M A;  5JVG 3;  5IWA Q;  4AYB E;  1Q46 A;  2F0Q A;  1HTL D;  1IW7 D;  2EYH A;  3I90 A;  1SR3 A;  4DR5 Q;  3CCQ A;  2AQ2 B;  2MUY A;  5K36 G;  1JOO A;  3TS0 A;  3FEW X;  1Q1E A;  4A3F G;  1WCM B;  5JEA H;  1GOZ A;  1QUQ A;  3A8J E;  1UE1 A;  3HZX A;  1ICF B;  5C3E G;  3EQL C;  1UUP A;  4AYB B;  3HOZ B;  4IQZ A;  1NAP A;  3L7Z C;  1NUC A;  3CC7 A;  3E9H A;  5C4X G;  3QJY A;  3H09 A;  5C0X J;  5JOB A;  1U4R A;  5FLX E;  3D4W A;  3I4M H;  2WIN B;  3NBH B;  2PNR C;  2B2W A;  5C3W A;  4X3U A;  1YIJ A;  5T1G A;  2H4O A;  1C4Q A;  1LT6 D;  1VQH A;  4YHH L;  2NTT A;  2A6H C;  5JJL A;  3D4D A;  1G8Z D;  2E8G A;  2Q2I A;  1UE6 A;  4H0L C;  1I6H H;  1S5B D;  1WTQ A;  1SFO H;  5LL6 X;  3OW7 A;  1HZC A;  3GP7 A;  1O78 A;  4DV2 L;  3Q6S A;  4S3S A;  5ELF A;  2E5L L;  4GLX A;  1G2T A;  3HKZ E;  4RFB A;  2FFK B;  3MEH A;  2F0D A;  4DUZ Q;  3HOV G;  5C5L A;  2B29 A;  2CH4 A;  1PDQ A;  2L55 A;  1PH4 A;  2JA5 B;  1GUG A;  3NXW A;  1ENC A;  1C8C A;  1PZJ D;  4JOI C;  3K57 A;  2C35 B;  3PV0 A;  1KD1 C;  2JYO A;  1D8L A;  1GHJ A;  3P1H A;  2CW0 D;  1SRO A;  2HQE A;  2YYZ A;  2K5D A;  2B2V A;  4O1N A;  3MXN B;  3HKZ B;  2ZT9 C;  2ICE C;  4DR3 L;  3S2H B;  4A3D G;  1TWG B;  1Q82 C;  1CKN A;  2EYO A;  3C1E A;  3JAM E;  1SEB D;  3M4O H;  1OTC A;  1SDF A;  1N33 L;  3GTP H;  4BS9 A;  4XTC S;  4G7O C;  1SYF A;  2OQ0 A;  3RUZ A;  4GLV B;  1MHW C;  1STA A;  3J7A 5;  3I4N H;  2KCN A;  2HDL A;  2AWN A;  5HGQ A;  4DR7 Q;  4FYD A;  1B1Z A;  3T1Y L;  3PO2 H;  3FDT A;  5LMU Q;  4YWK A;  3I2Z A;  5FOB B;  1VQA A;  3V05 A;  1B9M A;  4WRD A;  1KRS A;  2VB3 X;  1I4R A;  4GOP C;  2RBM A;  5I2Y A;  4ABN A;  4JBM A;  1N8R C;  2HIV A;  4L8J A;  2JK8 A;  4K14 A; 
#chains in the Genus database with same CATH homology
 4C3H B;  1AN8 A;  4EQO A;  1ET6 A;  2BDO A;  3VA5 A;  4IN3 A;  3T4A C;  1A3T A;  3ERQ A;  1Q3L A;  4HSV A;  2C9O A;  1ILP A;  1HCZ A;  3NBI A;  4C3I G;  2B8G A;  3HGB A;  4DAY A;  1ENF A;  2WKD A;  3S16 B;  3PMF A;  1HFG A;  4V0B A;  1EY6 A;  5CC4 A;  4BWG B;  1I6V C;  2K5Q A;  1RD9 D;  3K5O A;  5K36 H;  3EJI A;  5DNF A;  5IT9 E;  3G6J B;  4KKS A;  4G7Z C;  1MD2 D;  4OHJ A;  3EVQ A;  1RTN A;  1TT2 A;  3RLF A;  2DN8 A;  3D4R A;  2GA4 B;  4JBW A;  2R61 A;  1HUM A;  1KDC A;  1CTM A;  5C0X I;  2G9D A;  3S17 B;  5C0X G;  1KDB A;  5EJW A;  2BA1 A;  4DN4 M;  3D31 A;  4ODG A;  1VDZ A;  1KAB A;  3DWA A;  1D5X C;  3A55 A;  4BBR B;  2BE5 D;  3A7A B;  4KV6 A;  3ERO A;  1B2T A;  1MBY A;  3S14 B;  4RGT A;  4BY7 B;  2KA7 A;  1Z6H A;  2B63 B;  2HCC A;  1OO9 B;  4R9W A;  2O2L D;  3SK6 A;  5A2Q L;  1LTS D;  2E2J B;  3LNN A;  2B2W C;  2EYF A;  2IX1 A;  3BVM A;  1F9S A;  3VR3 A;  1EZ8 A;  1L0X B;  3HEJ A;  4TQU S;  1LAB A;  1PFN A;  5LL6 S;  1RKN A;  5M3F B;  1I4X A;  4HAE A;  2ZXP A;  4RGM A;  3P75 A;  3DHQ A;  2XVS A;  2R92 B;  3H6M A;  4M8A A;  4KK7 A;  5ELD A;  3MA2 B;  3M7G A;  1OXV A;  4FF3 A;  2B2V C;  5J22 A;  2F03 A;  5EBD A;  4K5X A;  4U67 3;  2D5D A;  1FYC A;  3J81 E;  2ICI A;  4A3G B;  2M00 A;  5KYL A;  4OO1 G;  1QOH A;  5JEA J;  2B8F A;  4TSS A;  2KQ3 A;  1V1P B;  2D2C C;  4CJ1 B;  1BF4 A;  1SNM A;  1SJH D;  2F0U A;  1SAP A;  5FO8 B;  2HUG A;  4KY7 A;  3BDL A;  1FNW A;  5KRU A;  2PW5 A;  1K8O A;  5BN3 A;  3HS0 C;  1AP0 A;  3E6Z X;  3OWF A;  4HTH A;  4IUV A;  1STH A;  1V8Q A;  5DM7 3;  2HCI A;  4RA8 A;  4C3J B;  1OXX K;  1S5C D;  4IUU A;  1EIH A;  2B39 A;  3N52 A;  4JK1 C;  3K59 A;  3DEP A;  3MXN A;  5NUC A;  1GUN A;  1EZ6 A;  2BOS A;  4LMQ D;  1TS3 A;  3C3L A;  2Z8L A;  1BBX C;  4FF1 A;  4V19 0;  5C3E B;  3R3O A;  1WTP A;  3QO2 A;  2NB0 A;  5J1Z A;  2K33 A;  5C4X B;  1VF7 A;  3QOJ A;  1ESF A;  4FNF A;  2JSO A;  1B44 D;  4XT1 B;  1W6J A;  2K1B A;  3SDZ A;  5IGB A;  3GV3 A;  4HCE A;  1DYQ A;  4L6T B;  1U4M A;  5BN5 A;  1EFI D;  4DF7 A;  5DEH A;  1SNO A;  1KTK A;  5IGE A;  3G7L A;  1EQT A;  2SDF A;  3I4L A;  2CQA A;  5CV5 A;  1TWC B;  3NQT A;  3DUZ A;  5E1F A;  3IL8 A;  1CHP D;  1DXM A;  2FHT A;  2AQ3 B;  1SSO A;  1PTO D;  1PXU A;  1JWM D;  2EXZ A;  2B2T A;  2KHS A;  2L4N A;  1OXU A;  4LJZ C;  3OSO A;  4HN7 A;  1Y8O B;  3J7A F;  3CRL C;  1JWS D;  4TKO B;  1H9K A;  4OO1 H;  1DM0 B;  2EYM A;  4PNY A;  1GUW A;  5D3I B;  1D5Z C;  1TS5 A;  3HOY B;  1SNP A;  3FPP A;  3SHL A;  1BCP D;  3VR4 A;  4XIG S;  3H91 A;  4CJ0 B;  1I4G A;  4H7B A;  1LLR D;  4RWS C;  4H44 C;  2EDG A;  4IZ8 A;  3S1R B;  4A3K B;  1ML0 D;  2LY7 A;  2JA6 B;  2LMC B;  5M5W B;  3I73 A;  2R3Z A;  1EY9 A;  5CV8 A;  1I4P A;  4PMC A;  4F88 A;  1X3Q A;  3KLR A;  3W3A A;  1AZQ A;  4RCO A;  3H0G B;  3Q23 A;  2RVL A;  5KIX A;  1PZI D;  1SYG A;  2I46 A;  4RGN A;  1Y1V B;  1CHQ D;  2WB1 B;  2RSO A;  1EWH A;  3QOL A;  5FO9 B;  3H3V C;  1U9R A;  2VXW A;  3TP5 A;  3BYY B;  4Q5V A;  1JOQ A;  2D62 A;  3K7A B;  5E3F A;  2PZW A;  2QF7 A;  3VYT A;  2M2L A;  3KUP A;  4XQN A;  2QCP X;  4RH6 A;  2NTS A;  2O5J C;  3TN2 A;  3I72 A;  1JIC A;  3OMC A;  5IGC A;  1NR2 A;  5BN4 A;  1D2B A;  2KED A;  1STG A;  1RJT A;  5HGT A;  1H9J A;  2SNM A;  3PUV A;  2Y0S B;  2MPM A;  2JE6 I;  1PRT D;  5CR3 A;  3MVV A;  2R7Z B;  3I70 A;  3RD4 A;  3AMU A;  4EGV A;  4QCL A;  1WVL A;  4XT3 B;  1CQF A;  5I4D A;  2B2U A;  2K7V A;  4J6H A;  2PQE A;  5EKL A;  1YNN D;  4DK1 A;  3BVG A;  3N6R A;  3NUC A;  1QIL A;  4OGQ C;  1ONL A;  3J80 E;  4RGO S;  4UAI A;  1DCZ A;  4DU9 A;  2Q8I B;  3K5M A;  1CI3 M;  2A69 C;  1AEX A;  2C5C A;  2XIW A;  4HED A;  2TSS A;  1A15 A;  1EU4 A;  4PMB A;  3TP6 A;  1U4P A;  3OPO A;  1LTI D;  2MHV A;  1TKW B;  3IKJ A;  1FNV A;  2JA7 B;  1ZYR D;  2A6E D;  4K2K A;  1ZKO A;  2EE1 A;  1PFB A;  5EQ0 A;  1KLG D;  2F0W A;  3AU7 A;  3O13 A;  1JWU D;  5C4Z A;  4KHV A;  5EKK A;  4PMW A;  1HHV A;  3LWE A;  4KI0 A;  1EL0 A;  4XDX A;  1CA6 A;  2F0J A;  4ZKC B;  1SND A;  1G91 A;  1QJO A;  1S4Z A;  2EY2 A;  1SYB A;  5C4H A;  3PIO 3;  4BA2 I;  5M5Y B;  3V2T A;  3DM1 A;  2FMM A;  1ET9 A;  2CHB D;  4C1N K;  3E5S A;  4WJW A;  5FO7 B;  1XTC D;  2JXM B;  2N88 A;  3PUW A;  5ELE A;  4RAU C;  1WTR A;  2NBF A;  3FKI B;  2B2Y C;  2IJ0 A;  3L3O C;  4RKL A;  3D8G A;  4X3S A;  2X6G A;  4QF4 A;  3C2P A;  1JCK B;  4UDU C;  4KD3 A;  2X69 A;  4A3B B;  4DXF A;  4CKB A;  1VF5 C;  4FP5 D;  4RHS A;  1PZK D;  5COY A;  4A3J B;  3Q24 A;  2J7Z A;  3HOX B;  5D3D A;  1SE4 A;  1R9T B;  5G3L F;  4EQP A;  4MIU A;  2WP8 J;  5EPK A;  2F3V A;  1DOM A;  1XWE A;  1EEI D;  1PTO F;  1PTO B;  3GTM B;  5D14 A;  5FK9 C;  1IKM A;  1PFM A;  2A68 C;  3C46 A;  1ZEQ X;  2K04 A;  2IL8 A;  5CBA E;  4U68 A;  1E2Z A;  3M85 A;  4A3I B;  4CGY B;  4KJN A;  5IGD A;  2F1M A;  1STY A;  2B2U C;  1II3 A;  2WV6 D;  4Q0F A;  1IHZ A;  4CBV A;  3WOF A;  1IW7 C;  2DNC A;  3A8K E;  4DNR B;  5E4W C;  3T53 B;  1LAC A;  2EYL A;  1A2U A;  2ZXO A;  1Q8I A;  1I4Q A;  1Y8P B;  1JOR A;  1SMY C;  2A74 C;  1Z47 A;  4HSP A;  3I4M B;  1F2Z A;  3MXG A;  3K6O A;  4IFD G;  2PPB C;  3C1F A;  1FGB D;  1Q1B A;  1SYE A;  5DAU A;  2AUJ D;  1I6H B;  1LT4 D;  4B08 A;  1SFO B;  3OWE B;  2XWB B;  3EA6 A;  2PYK A;  1YNJ C;  1L0Y B;  3PIP 3;  4K5V A;  3J80 L;  3TP8 A;  2VB2 X;  3R8B A;  1MI2 A;  3SE0 A;  1NCV A;  1D5M C;  3S9W A;  5I9P A;  2EZV A;  3K5L A;  5FLX L;  2G9H D;  1G6Z A;  1XXG A;  1EOT A;  5COR A;  1A6X A;  2VNU D;  2F0G A;  5F2D A;  1QG7 A;  2SEB D;  4G57 A;  4R8N A;  2DY8 A;  1WTO A;  4E6I A;  4DNT B;  1ILQ A;  4K5W A;  2NN6 H;  4CKC A;  2Z1C A;  2DY7 A;  3M4O B;  1MGS A;  5KND A;  3GTP B;  2F0M A;  4K2L A;  1HXY D;  4OO1 I;  3I4N B;  4QUF A;  3I91 A;  5CV7 A;  3SEB A;  1EU3 A;  3PO2 B;  1B50 A;  2RDG A;  3A54 A;  3GV6 A;  1EY0 A;  4O42 A;  3IFD A;  1PRT B;  2JEA I;  3Q0A A;  3VR6 A;  1D1I A;  3BZD B;  4WFN 3;  1Q12 A;  5I6W A;  1Y8N B;  1PMR A;  4G7H C;  1MSG A;  3R2T A;  4IUP A;  4ZAI A;  3JAM L;  1LO5 D;  2EJG C;  4QB4 A;  1TWF B;  1FNU A;  2PZU A;  2ENB A;  3RZO B;  2DNE A;  5KGU A;  4ME5 A;  4Y7N B;  3BDC A;  5K5P A;  1DON A;  2R6G A;  2ZXR A;  3GO5 A;  4CJ2 C;  3NHH A;  5CBE E;  2F0H A;  3S1N B;  5CMD A;  1WD1 A;  1EYA A;  3R2I A;  2IX0 A;  1H9S A;  2K32 A;  1JR0 D;  4DGZ A;  1C48 A;  4ZQ3 A;  4J1M A;  1STB A;  1WTX A;  1LTT D;  5JVH 3;  4A3F B;  4RCN A;  3F2U A;  2F0O A;  4IUR A;  4H13 C;  3GQB A;  1TS4 A;  1B3A A;  4KD4 A;  1PYW D;  1O7L A;  3VYS A;  4LK1 C;  4C3H G;  4ZRZ A;  4IFD H;  5JPM C;  3NE5 B;  2AQ1 B;  1SE2 A;  2NYZ D;  2RKS A;  3KK7 A;  5IT9 L;  1CT1 D;  1S5E D;  3GTK B;  2E75 C;  2BE5 C;  3P7J A;  5M9O A;  1BNZ A;  3HOV B;  3D3R A;  1E2V A;  1Z7T A;  4K8J A;  4XQJ A;  1F9R A;  5IGG A;  1SBB B;  2KJX A;  4DFA A;  1O80 A;  1LTG D;  1QNK A;  3U9S A;  1BO0 A;  1K8M A;  3NP8 A;  5E4X A;  1KLU D;  1A3V A;  2I07 B;  2OXP A;  4A3D B;  2A69 D;  2LFN A;  3QWN A;  1TU2 B;  3TZD A;  2MP1 A;  4X3T A;  2RSN A;  1X3P A;  2A6H D;  4TRD A;  4M1U B;  4NP5 A;  5LHY 1;  4DXG A;  4ULL A;  1GUT A;  3K5N A;  2L5T A;  3NTH A;  1BR9 A;  2AUK A;  1TY0 A;  2O5I C;  1GUO A;  2M9V A;  2NVT B;  3M4Y A;  2AWO A;  1U4L A;  1B9N A;  1H9M A;  4ZLT F;  4C3I B;  3TDQ A;  1VCI A;  1XX8 A;  5AFW A;  4C56 C;  1DOL A;  2L9H A;  4ZKB B;  3MAQ A;  2Z4H A;  5CYU A;  2E76 C;  2PMZ B;  5KNC A;  3CKI B;  5KEE A;  3A7L A;  1LTA D;  1A2T A;  2RDH A;  3UI2 A;  4HCS A;  2EY6 A;  3CQZ B;  2PW7 A;  3HRZ C;  4ZK9 B;  4K6L A;  1CQV A;  1ROD A;  3J81 L;  1AFP A;  1HUN A;  2K5W A;  5JPN C;  4F87 A;  2K05 A;  1F9P A;  2XSC A;  4OIK A;  1BOS A;  1G29 1;  2XNA C;  4KN7 C;  4A93 B;  3S1M B;  2F0N A;  4KJO A;  5IIF A;  1F9Q A;  1GHK A;  5FKA C;  2X6L A;  4N9T A;  1LTR D;  2ID0 A;  3SR1 A;  2QKI C;  1Q90 A;  2OEO A;  5CV6 A;  1S5D D;  3URY A;  3J7Y W;  3ITP A;  4CHT B;  1HRJ A;  3FPU B;  3NQI A;  1A3U A;  4DAP A;  3OIQ A;  2PO4 A;  2K6A A;  2F0F A;  3VR5 A;  1QNU A;  1FR3 A;  3TP7 A;  3SK8 A;  1HTP A;  1FD7 D;  3RMH A;  1ZXT A;  1SE3 A;  2E2H B;  3QG1 A;  5T1I A;  3MFG A;  4OL7 A;  4XQQ A;  1KNE A;  4C3J G;  2QEJ C;  3PUX A;  1STE A;  3NWT A;  3R93 A;  4EVO A;  3ND8 A;  1UAP A;  1JQY D;  2SNS A;  1TWH B;  2EYJ A;  2IT1 A;  4FVM A;  3U9O A;  2F0K A;  2B2T C;  2OF1 A;  1PTO C;  4ILW A;  2EY1 A;  1T5X D;  1SMY D;  4YIJ A;  5IOD A;  1CFM A;  4FF2 A;  1HPC A;  5JAV A;  1NR4 A;  1VMC A;  2EYP A;  1BQQ T;  2RDF A;  3TSS A;  2JA8 B;  1JOK A;  3GTJ B;  1KAA A;  1CA5 A;  1TII D;  1I50 B;  1UNS A;  2JP1 A;  4NDX A;  2RQX A;  3T51 B;  3MXU A;  1YNJ D;  1EYC A;  3GTQ B;  3IAY A;  4IFD J;  2K03 A;  5JJZ A;  4QMG A;  5TSS A;  1BCP C;  3FVQ A;  1H9S B;  1EY7 A;  3GTG B;  2K01 A;  3HOW B;  3BS1 A;  2E2D C;  1JB3 A;  1UEA B;  3MC0 B;  2FJ2 A;  2A5H A;  1ICW A;  2XRQ D;  1X32 A;  4PQX A;  3D6C A;  3OMG A;  2HDM A;  4ZUI A;  3T16 A;  3ND9 A;  5EBC A;  1E2W A;  4HR7 B;  1S5F D;  3MHB A;  4KMU C;  3KBG A;  3K58 A;  1TR5 A;  2NN6 I;  2NN6 G;  4FF4 A;  1RHP A;  3E0J A;  1QB5 D;  2BCO A;  3ZYY X;  2WII B;  3DMU A;  1JC7 A;  3M3Y B;  2PCF B;  2EVB A;  1V1O A;  5I6Y A;  2H1E A;  3ONA B;  2EY5 A;  5DM6 3;  1QE6 A;  5ELB A;  1LV9 A;  1WTW A;  3GTL B;  1SYD A;  3K0Y A;  3X3N A;  2MJ8 A;  4X3K A;  5ISR A;  4DAV A;  3SK4 A;  4FO2 A;  1VMP A;  1HA6 A;  3A8I E;  4I65 A;  3HOU B;  3KBX A;  1GXD C;  2KVM A;  2EJF C;  1PRT C;  2RA4 A;  4ID6 A;  3OIP A;  1LT5 D;  3TZU A;  2IX3 A;  4F7X A;  2QIL A;  2L1B A;  2KOL A;  3FRP B;  2SOB A;  2IWH A;  2L0C A;  3BG3 A;  1STN A;  1DOK A;  3MXP A;  2OT2 A;  3DWP A;  2F0S A;  1BCP F;  1RCV D;  4B9W A;  1EY5 A;  1YNN C;  1BCP B;  1KDA A;  2FIN B;  4DK0 A;  1AW7 A;  2KEE A;  4FXG C;  1GJX A;  4QIW B;  1IYU A;  2L12 A;  1CZW A;  4KN4 C;  4B9X A;  4P2C B;  3T56 B;  2Q8R E;  4IFD I;  4L63 B;  3S2D B;  5IGF A;  1BXT A;  4PV1 C;  2D9U A;  1H9R A;  1F77 A;  4IAL A;  4OIJ A;  2LS0 1;  3V96 A;  2WAC A;  2MGS A;  4RKB A;  2J0T D;  1SNC A;  1SJE D;  1IL8 A;  4QUC A;  1JE4 A;  3VA7 A;  1ZYR C;  2A6E C;  1CZG A;  1EWC A;  4IUN A;  4KY6 A;  2NUC A;  1O7Z A;  5EPJ A;  1RF2 D;  2CW0 C;  3KF8 A;  1Y69 U;  1TVX A;  1EY8 A;  4N9P A;  1GUS A;  3OHX C;  4KTA A;  1B53 A;  4DA2 A;  2NWG A;  1XYI A;  4CKE A;  1QWY A;  1TY2 A;  5CV4 A;  2F0L A;  2XN9 C;  1EEF D;  2F4I A;  1J8I A;  4GZY C;  2EOT A;  4NW2 A;  1PRT F;  3LWU A;  3DWQ A;  4IUQ A;  1DD2 A;  3L9A X;  3LX0 A;  3NTK A;  4KKU A;  2TMP A;  3MWY W;  4A3E B;  1I3Q B;  5EKI A;  1BDO A;  3NBH A;  4FXK C;  3CRK C;  3EFX D;  1NSN S;  3HP3 A;  1M8A A;  1OXT A;  1AZP A;  1SNQ A;  2KUM A;  5EGT A;  4J8Q A;  4WOR A;  1HQR D;  4IUT A;  3BDO A;  1CK1 A;  2KCC A;  5HUR A;  5C0X H;  4NMZ A;  3GTO B;  3CU7 A;  2QDB A;  5ELC A;  3AB9 A;  1SXT A;  2R93 B;  1O7Y A;  3SVM A;  1R4Q B;  1TS2 A;  3H94 A;  2V4D A;  3MFY A;  2WAQ B;  3PUY A;  4MHE A;  1HFN A;  3I8Z A;  4G4K A;  2BA0 A;  5J39 A;  2EPB A;  3IFT A;  3QB3 A;  2KEC A;  3NWS A;  3TME A;  3NK9 A;  3MTS A;  5KNB A;  2EJM A;  3S1Q B;  3J7A V;  4RHR A;  2E74 C;  1WTV A;  2BDN A;  2O4X A;  1MSH A;  1EY4 A;  1K83 B;  2XWJ B;  1TQO A;  1EYD A;  1EIG A;  1D6E C;  1EQV A;  1WD0 A;  3KLS X;  3DXJ C;  2LKV A;  3NTI A;  2N55 A;  5G3L D;  1IYV A;  3GD7 A;  3X3M A;  4FXD A;  1ESR A;  2NVQ B;  1RDP D;  3SXH A;  2Z4I A;  1DJR D;  2L11 A;  3HG9 A;  2F3W A;  4C2M B;  1F2Y A;  1BUV T;  5A35 A;  4K8I A;  5C44 B;  4NKL A;  4ZUJ A;  1RTO A;  4EQN A;  1D1K A;  1PLF A;  3QIA A;  4Z9C B;  5JEA G;  1V43 A;  3D6W A;  3P20 A;  1ENA A;  2XRS D;  4MN3 A;  3S15 B;  3W2D A;  5CGK A;  3WOE A;  2IW3 A;  1I4H A;  3FMC A;  1HA5 A;  3VYR A;  5C5M A;  3VYU A;  5C4J B;  2J4X A;  3SK5 A;  1CM9 A;  4C1N I;  4BBS B;  2F0I A;  4LAA A;  2F0P A;  1KNA A;  5C3X A;  2IPK D;  4BY1 B;  1G2S A;  1J9O A;  2WKC A;  2NVY B;  1SYC A;  1F2L A;  3DEO A;  4XXE A;  5C6A A;  2Q8T A;  4I7Z C;  5M3M B;  3TBI B;  3VR2 A;  1IKL A;  1OXS C;  4A3M B;  5M5X B;  3KLS A;  1F2M A;  2B2Y A;  3NSW A;  5CV9 A;  1B4O A;  2A73 B;  1TWA B;  3A56 A;  3BVZ A;  4R8I A;  5I2X A;  5KYI A;  3PO3 B;  4BA1 I;  1M4V A;  2E2I B;  2VUM B;  1HQM C;  1QCB D;  3OOC A;  4KHZ A;  1T5E A;  2NVX B;  3NPP A;  4ZYS A;  3RZD B;  3Q22 A;  1Y1W B;  3T13 A;  2YU9 B;  2CVR A;  4XYQ A;  5I9O A;  2JEB I;  2PZT A;  1LTB D;  4K6D A;  4KY5 A;  4HMI A;  2F0E A;  2A68 D;  3I3C A;  1PTO H;  4HMJ A;  4KKT A;  4XYO A;  5EPL A;  2K28 A;  1W6K A;  1LT3 D;  2FMC A;  1DZ1 A;  3WDN A;  2F0V A;  3BYT B;  2NZ1 D;  2F0T A;  1E0B A;  5D65 A;  1V1P A;  3CHB D;  5A2Q E;  3PUZ A;  3M7N A;  3MZ5 A;  5IOC A;  1R4P B;  4F8M A;  5JVG 3;  2F0Q A;  1HTL D;  1IW7 D;  2EYH A;  3I90 A;  2AQ2 B;  2MUY A;  5K36 G;  1JOO A;  3FEW X;  1Q1E A;  1WCM B;  5JEA H;  1GOZ A;  3A8J E;  3HZX A;  4AYB B;  3EQL C;  1UUP A;  3HOZ B;  4IQZ A;  1NAP A;  3L7Z C;  1NUC A;  3QJY A;  3H09 A;  5C0X J;  5JOB A;  1U4R A;  5FLX E;  3D4W A;  2WIN B;  2PNR C;  2B2W A;  5C3W A;  4X3U A;  5T1G A;  2H4O A;  1C4Q A;  1LT6 D;  2NTT A;  2A6H C;  3D4D A;  1G8Z D;  4H0L C;  1S5B D;  1WTQ A;  5LL6 X;  3OW7 A;  3GP7 A;  1O78 A;  3Q6S A;  4S3S A;  5ELF A;  1G2T A;  4RFB A;  2FFK B;  3MEH A;  2F0D A;  5C5L A;  1PDQ A;  2L55 A;  2JA5 B;  1GUG A;  3NXW A;  1ENC A;  1C8C A;  1PZJ D;  3K57 A;  3PV0 A;  2JYO A;  1GHJ A;  3P1H A;  2CW0 D;  2HQE A;  2YYZ A;  2K5D A;  2B2V A;  4O1N A;  3HKZ B;  2ZT9 C;  2ICE C;  3S2H B;  1TWG B;  2EYO A;  3C1E A;  3JAM E;  1SEB D;  1SDF A;  4BS9 A;  4XTC S;  4G7O C;  1SYF A;  3RUZ A;  1STA A;  2KCN A;  2HDL A;  2AWN A;  4FYD A;  1B1Z A;  3FDT A;  5FOB B;  3V05 A;  1B9M A;  4WRD A;  2VB3 X;  1I4R A;  2RBM A;  5I2Y A;  4ABN A;  4L8J A;  4K14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...