5E4XA

Crystal structure of cpsrp43 chromodomain 3
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
50
structure length
50
Chain Sequence
b'YAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Signal recognition particle 43 kDa protein, chloroplastic
publication title Structural basis for cpSRP43 chromodomain selectivity and dynamics in Alb3 insertase interaction.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 4
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2015-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5e4xA00
1NR4A 1F9QA 2FMMA 2RSNA 3MTSA 1PFMA 1B53A 4X3SA 2HDMA 1EOTA 1SDFA 1F9PA 1X3QA 1U4PA 4IUQA 3DEPA 1ML0D 2MP1A 2N88A 3HP3A 2L11A 5DNFA 1XX8A 1MSHA 3H91A 2NYZD 2VXWA 2L12A 2FINB 1EIHA 1QG7A 4IUPA 2JP1A 2XIWA 1AZQA 3Q6SA 2MPMA 1QE6A 2HDLA 5EPLA 1PFBA 3IL8A 1ZXTA 4X3KA 2KVMA 3IFDA 2X69A 4RAUC 2DY7A 4ZKBB 1HHVA 2K01A 1AZPA 1DZ1A 1HA6A 2EPBA 5T1GA 2DY8A 3TN2A 3F2UA 3I91A 1IL8A 1EIGA 1JICA 3QO2A 1KNAA 1EL0A 1XYIA 4IURA 4R9WA 1SSOA 3R93A 1O7ZA 1TVXA 1G2TA 5D65A 1C8CA 4UAIA 1DONA 1WTWA 1PDQA 1S4ZA 1U4LA 4U68A 4ZK9B 2B2VA 2CVRA 3ONAB 1MGSA 2NZ1D 3TZDA 2K05A 1O7YA 4IUUA 3D6WA 2SDFA 1WTQA 3I90A 4MN3A 4QUCA 1F9RA 2RVLA 5EQ0A 2MJ8A 2Q8TA 1RODA 1G91A 1CM9A 3G7LA 3UI2A 4CJ2C 1HUNA 1LV9A 2B2UA 5CMDA 1F9SA 2KUMA 1IKLA 2FFKB 4XDXA 4HSVA 2B2UC 2M2LA 2L9HA 1KNEA 1HUMA 2B2TA 2EOTA 1A15A 2IL8A 4IUTA 4OIJA 4R8IA 1O80A 1NCVA 2B2TC 5COYA 1BO0A 1ICWA 2X6GA 1WTRA 3MWYW 1RTOA 1ESRA 1ILQA 2Q8RE 1J9OA 2RSOA 4HEDA 1ILPA 1B4OA 1PFNA 1IKMA 1RJTA 1BF4A 2B2WA 2D9UA 2R3ZA 1AP0A 1NR2A 3FDTA 4X3TA 1Q3LA 3KBXA 3I3CA 1HFGA 1M8AA 2B2YA 5E4XA 3SVMA 2B2VC 1JE4A 1SAPA 1RHPA 3N52A 4DN4M 1B50A 3FPUB 2B2YC 2K28A 5EJWA 1CA6A 2MGSA 1X3PA 1PLFA 4QUFA 4ZLTF 2HUGA 4XT3B 2K04A 1WVLA 5AFWA 4HCSA 3DEOA 1U4RA 2KOLA 2FHTA 2HCIA 2HCCA 1DOKA 1E0BA 1DOLA 2K03A 4HAEA 2X6LA 1VMCA 1NAPA 5E4WC 4CJ0B 1WD0A 4OIKA 2EE1A 5EKIA 1DOMA 4ZKCB 3KUPA 3P7JA 1QNKA 1MI2A 1F2LA 5D14A 3LWEA 1WTVA 1RTNA 2KECA 1CA5A 2L1BA 2FJ2A 1GUWA 1BBXC 1X32A 4RA8A 4CJ1B 4NW2A 5JJZA 1WTPA 1HRJA 2J7ZA 5EPKA 5CBEE 2B2WC 1EQTA 1VMPA 5EPJA 5T1IA 1HFNA 4MHEA 3GV3A 4XT1B 2NWGA 2K1BA 1WD1A 3I8ZA 2RA4A 4ZAIA 2N55A 1BNZA 4O42A 4X3UA 2JYOA 4LMQD 1MSGA 4IUVA 1WTXA 1G6ZA 5CBAE 3DM1A 5CORA 2L4NA 2H1EA 1B3AA 1U4MA 2KEEA 2KEDA 1WTOA 1B2TA 3GV6A 4RWSC 1J8IA 1G2SA 2BDNA
chains in the Genus database with same CATH superfamily
2AWNA 1X54A 2JA8B 3WOEA 1F9PA 4JCVE 1XMOL 2AQ2B 1MSHA 3E9IA 3VR2A 3S2DB 2H5XA 1PRTB 1BBUA 2QDLA 2A74C 1QE6A 3PIP3 2IX0A 2Q2TA 1AE2A 4BWGB 3GTKB 3EIVA 4FO2A 3T1YQ 2F0FA 2EPBA 1VQGA 1Y69U 4K6DA 4KY7A 2QEXA 3QO2A 1EY9A 3D31A 4NKLA 4UAIA 2ICEC 4BBSB 4DNIA 2MO1A 1LO5D 2A69D 2F0QA 3JC66 2NB0A 2KCTA 3V05A 4YWKA 2B3GA 3BVZA 1VQLA 2F0EA 4A76A 3K59A 2KUMA 1NMGA 2P5ZX 4HSVA 5CV7A 2M2LA 5EJWA 2IL8A 3S1RH 1R4PB 1VQCA 3MXUA 4YY3L 3AMUA 2JA6B 5C4JH 4B9XA 1LTID 1CQFA 4DK3C 2RSOA 1ILPA 1EWCA 1NUCA 1IKMA 1ESFA 1AP0A 3S16B 1SXTA 5C3EG 4JBKA 1KQSA 2ZXRA 2B2YA 5C3EH 1RHPA 3FPUB 3UE1A 1IYJB 5IT9c 1VQ6A 5I4DA 1KRTA 5ELDA 3E9HA 2EY1A 3HOWH 4GN5A 2QW7A 3HOXG 3QB3A 5C44G 1DOLA 2VB2X 2AWOA 5TSSA 5KYIA 5C44H 2XN9C 2NVXH 5C4HA 1I3QB 3LWEA 4LFAQ 4ZUIA 4A93H 1TU2B 2R7FA 1CA5A 1BBXC 1X32A 3U9SA 4JI4L 3G6JB 3F1ZA 2QEJC 1VQKA 5HY6A 2JA8G 1ZKOA 1Y8NB 1XPOA 5EPJA 5IGFA 1EY8A 3GV3A 2JA8H 5BN3A 3S2DH 4N9TA 1X6OA 1VQOA 2UUAL 4KJNA 2NVYB 2PO4A 4LMQD 4HIDA 1PH8A 1WTXA 2PPBC 4DNTB 3GO5A 1PTOH 2UXBQ 1QB5D 2GA4B 4LUVA 3GTKH 1FD7D 4A3CH 1NR4A 2F0GA 4N8X1 1N34L 3NXWA 1A0IA 1TS3A 4DUZL 2EY5A 1LACA 4ODGA 1AFPA 3D0FA 1DXMA 4BBSG 4RGTA 1EYGA 4BBSH 1ZXTA 4B3RL 3LGJA 3SGIA 1HHVA 5J22A 4BXXG 2VS1A 3HGBA 2F0PA 3OOCA 1H9KA 4FF2A 4NXNL 1EIGA 4DV7L 1KABA 4DNRB 4IPHA 1B70B 4IURA 5IYBG 1QZGA 1NE3A 1TVXA 5NUCA 1CSPA 4CHTB 4EX5A 2JA6H 4B3SL 5LMUL 1XTDA 4TSSA 3MXNA 5EQ0A 3S16H 1F9SA 1TWHB 4KJOA 3DWPA 3S15B 5LL6X 1B9MA 4S3SA 2Z6KC 3ITPA 4NPSA 1M1KC 4TVAB 4ILWA 4FP5D 3R2TA 4JI6L 2WAQE 1W3SA 4L5TA 3S14B 1I3QH 1PYSB 1KDAA 1A8VA 1IW7C 2B2YC 1SE3A 4OX9Q 1JT8A 3STBC 4B9WA 2K04A 1SYEA 2Y0SE 2WV6D 4XTCS 4O2DA 4JW0A 1F2MA 1PH3A 2C9OA 1DOMA 2FXQA 2NVYH 5IGGA 2VNUD 3KK7A 3BDLA 1XMOQ 2RF4A 1VQ5A 1CQVA 1A62A 1NBWA 1Y8OB 3FPPA 1CFMA 3DMUA 2NTSA 2V1CC 3PV0A 4QIWB 3NBIA 4Y7NB 3FRPB 5JVH3 3H3VC 3HKSA 2N55A 4OO1G 3QG1A 3GTMB 3EN2A 4DKAC 2F4IA 1BBWA 1KDCA 3D3RA 1AEXA 4P74A 3Q23A 1JB3A 2HQLA 2KEDA 1EEFD 4OXPA 3HOVB 4K5VA 1J8IA 3M4QA 1VQDA 1QUQA 3S24A 1HPCA 1SYDA 2ZJQA 1SDFA 1X3QA 1VQNA 4JBMA 3RZOB 2E74C 3NWTA 4DAMA 5FJ8G 1I94L 4GN3B 4CKBA 1TY2A 2HDLA 1RL2A 4X3KA 4JI1L 2X69A 4YY3Q 2K5VA 1YI2A 4EQPA 3RD4A 2O2LD 2J0TD 4KV6A 4OGQC 1EOVA 3CC2A 2PNHA 3H0GG 3ULJA 1TWHH 4NXML 3A8IE 3S15H 5IGDA 1WTWA 2WFWA 4WJ4A 2C35B 4KN7C 1HR0L 5HURA 3V2TA 1UAPA 3X3NA 4JV5L 4L5QA 4A3MB 5C5LA 1HR0W 5JVG3 5M5WB 3MZ5A 1SNPA 1EQRA 3S14H 1HZBA 3K58A 1VQBA 2OWOA 3N6RA 1SNMA 1HNXL 3TREA 2B2TA 4DAVA 3HOYB 1AN8A 2MO0A 1VF5C 3CXCA 4JI4Q 1K28A 1EU4A 4C3JB 5IOCA 2D9UA 3VYUA 1BVSA 2JXMB 4DR7L 1XPRA 1FL0A 4DN4M 1LT6D 2UUAQ 2HUGA 4IPDA 2R7ZB 1A63A 2H4OA 2UUCL 2UXDL 3WWVA 2K03A 4Y7NH 2DJFC 5EKIA 3J7AF 1N34Q 3JAML 3KUPA 1L0XB 3GTMH 1X55A 4DUZQ 3PUVA 1GUWA 1KD1C 4RA8A 1RIPA 2Q8IB 2BDOA 3J81i 5IYCG 3HOVH 1GKHA 1Q1BA 4K0KL 4B3RQ 4XT1B 3MFYA 3RZOH 2A73B 5G3LF 4O42A 4NXNQ 3D8GA 3HOZG 2EJGC 1C4QA 1GUOA 4DV7Q 2G9DA 2A5HA 3DM1A 5CBAE 1MD2D 4OO1I 3VR5A 2YV5A 1EEID 1DCZA 1V43A 2AQ3B 3LWUA 4X65L 4G7OC 1BKBA 2A1AA 4B3SQ 2F3WA 5LMUQ 3S1NB 4L63B 2N88A 3Q8DA 3T1HL 2UUBL 3UDXA 1HNWL 1WOCA 4JI8L 2F0IA 2XIWA 3KLWA 4EGVA 2DN8A 4A3MG 1GUTA 4GN4B 4JI3Q 1GHJA 4A3MH 3FHWA 4GKJL 5M5WH 1A3VA 4A3KB 2IHFA 1PA6A 1JICA 3OPOA 4JI6Q 3MEFA 4R9WA 1YVCA 3HOYH 4A3FB 2EQSA 3PUZA 4C3JG 4JI5L 1YHQA 3L9AX 2SDFA 4C3JH 1PYWD 2IPKD 2MJ8A 2Q8TA 3I4OA 3E0EA 3HG9A 3VR6A 3G7LA 2EYJA 3PIO3 4QJFA 3GTJB 5F2DA 1K3BC 4IQZA 2JA9A 1JJ2A 2L0CA 2B2TC 3NUCA 2R7ZH 4HJ5A 1VQPA 1CHPD 1RTOA 2I0QA 1IHZA 1KIXA 4QMGA 4YWMA 5I6WA 3U58A 3STBD 2CWAA 4KMUC 1W6KA 4FXGC 5E4XA 1B7YB 2C5CA 2B2VC 2ATWA 1IXRA 2L5TA 2NBFA 4FDBA 2O5IC 2EDGA 2VQFL 3CCUA 4GZYC 4C2MB 1XJVA 1F2YA 1JOQA 3B6YA 3KDFA 5E1FA 3A0JA 5FOBB 4OIKA 3F2BA 3NTIA 3HKZB 4PZ8A 3WDNA 3KF6A 4H13C 4DV2L 1PVOA 5JPMC 3K7UC 2F0DA 4A3EB 4LFCL 2L1BA 1X56A 1G8ZD 1TIID 1I94Q 3KOJA 5JJZA 2DNCA 2KENA 1O7IA 2A68D 3KJPA 2YTXA 4N9PA 4JI1Q 2RDHA 5K5PA 3S1NH 5T1IA 1S40A 5ELFA 4EVOA 4LF4L 4L8JA 1CHQD 1JWSD 2V4DA 1WCMB 4NXMQ 2K32A 1KTKA 1V1PB 4BY1B 3ERSX 3CC4A 5CORA 1EY4A 1O7LA 2CQAA 1VF7A 2L4NA 3Q22A 1B3AA 3MVVA 2EYFA 3FVQA 4P72A 4HIOA 1HR0Q 3D6CA 4JOIA 2JEBI 1FGUA 4A3KH 2A6HD 4KHZA 5G3LD 3HP3A 2O5JC 1GHKA 1EY0A 3H15A 2RDFA 5IYDH 1P16A 2JP1A 3Q0AA 4A3FH 5ELCA 3A5ZB 1HNXQ 3CW2C 4F87A 5BR8L 3M7NA 2WINB 3ICEA 3J7A5 2LY7A 5C6AA 1YBYA 3VDYA 4GS3A 1FR3A 1EZ6A 2DY8A 4FXDA 2IWHA 3GTJH 3VYSA 4F8MA 1G6PA 2SEBD 4UPAA 3BZKA 4DR7Q 1HZ9A 2PNRC 3PO2B 3NELA 1DD2A 4G57A 3RLOA 3BYTB 5CV4A 3CCLA 2PW7A 3K8AA 4JVZA 4K5WA 2UUCQ 1NTGA 2UXDQ 3I4NG 2B2UA 4YHHL 5CV9A 3VA7A 3BYYB 1HUMA 4IUTA 3IAYA 3EA6A 2RHSB 1LT3D 1N8RC 1VQ7A 4R1JA 3M7GA 4C2MH 4DV0L 1ILQA 3M9BA 1J9OA 1ASYA 2JSOA 5GAEC 1PFNA 1V9PA 2ZXOA 3E5SA 4K0KQ 1K3RA 1CKMA 4X3TA 4A3EG 2VQEL 4CKEA 2TSSA 4ZUJA 4A3EH 4B3ML 1PH1A 1NY4A 1K8OA 2JK8A 2K28A 2HQEA 3BZDB 4KTAA 3PF5A 5ELOA 2D62A 3HFZB 2HCCA 3AEVA 3G6EA 2ALYB 4CDEC 1CZWA 4X65Q 4HMIA 1J5EL 4R4CA 3CPFA 4R4TA 4BY7B 1WCMH 4NMZA 1SYCA 2UUBQ 3T1HQ 1Y14B 4BY1H 1HNWQ 2KBNA 2MQHA 2UXCL 4JI8Q 1WTPA 2G5DA 2B29A 3TS2A 1F77A 2XTIA 4MHEA 2F4VL 4X64L 1NMFA 4GKJQ 3H6MA 1ZYRC 5ELEA 5C4JB 1ASZA 4GOPB 2JYOA 1MSGA 4C56C 2NZOA 2KCMA 1GXDC 3DLLA 1CUKA 3G48A 5A2QE 2PI2E 4GNXB 2ES2A 2YU9H 4JI5Q 1PXUA 4JOIC 5DAUA 3M4YA 3PMFA 3PO2G 3VR4A 3PO2H 3HOXB 3P75A 2KVMA 3IFDA 2IJ0A 4GLVB 1GD7A 1I6VC 4QB4A 2Z6BA 3KF8A 1H9RA 4A3JG 4PZ6A 1FVIA 4LWCA 3KLSX 1I4RA 5KNDA 2ID0A 4HSPA 1L1OA 4QF4A 2VL6A 3OYYA 1PH4A 2CH4W 3CP0A 3ER0A 1TY0A 4IZ8A 3SDZA 3U4VA 3L0OA 4IN3A 2NZ1D 1IL2A 3A54A 2DUDA 3J80c 1I6HB 1U9RA 2VQFQ 4KK7A 1F9RA 4CJ2C 1PTOB 3CCMA 2XGTA 1JORA 1NSNS 1N33L 3TMEA 2B2UC 1BXTA 1EIFA 1KNEA 3EFXD 4AIMA 1S5DD 4DV2Q 3CMAA 1Q1EA 4LFCQ 3U50C 4WORA 5IIFA 4HMJA 4K8IA 4BS9A 1UWVA 5BN5A 1EWIA 2VZAA 4B3TL 4BY7G 1VQFA 2NUCA 3OW2A 2IT1A 3KBXA 4LF4Q 4BY7H 3C1EA 1SBBB 1I50H 4C1NK 3BDOA 1SAPA 4LW1A 5CV6A 4XT3B 2PQEA 1BCPD 3SEBA 4KD4A 4IO9A 4PNYA 4HAEA 4CDDC 3I70A 5JJKA 2WAQB 4RFBA 1EIYB 4FF1A 3A7AB 3K5NA 5ELBA 4DAYA 4CJ1B 4H44C 1HXYD 4I65A 1UUPA 2Y0SB 3L2PA 5DLQE 5BR8Q 3H3VH 1CI3M 3NTHA 4G4KA 2K1BA 2DGYA 2OT2A 3PO3B 1LTTD 1S5FD 2RCNA 3TQYA 1KAAA 5M5YB 1PH7A 1CKNB 3LX0A 3HOXH 1E2VA 2D2CC 3SHLA 2EYOA 3RUZA 4PZ7A 2J4XA 2BDNA 4YCWA 2F0VA 3MC0B 1ONLA 5HGQA 3G71A 1PFMA 2HDMA 1HZCA 2LKVA 2ZT9C 1EFID 1XNRL 1CSQA 4X6AH 1C9OA 2K33A 4Z9CB 4K14A 1X3GA 5HGTA 4YHHQ 3BG3A 3J7ZC 2EJMA 3K0XA 4KN4C 1STBA 4POGA 1UE5A 2HIVA 1I6HH 1DZ1A 1Y1WG 3KLRA 4DV0Q 4WJWA 3DM3A 1QVGA 3P1HA 1QILA 4KKUA 3I91A 1LLRD 1L1OC 1STAA 5KEEA 2D0OA 4KD3A 5D65A 2VQEQ 1EU3A 4B3MQ 1U4LA 4U68A 4JI7Q 2K14A 1M90C 3BU2A 2RDGA 4XYQA 1VQIA 3QOJA 5FO8B 2BA1A 2E5LL 3W1GA 1EZ8A 1FNUA 1XNQL 1J5EQ 1DM0B 3A55A 1IBKL 1PH9A 2K5QA 2WB1G 1VS0A 2CFMA 3A5UA 2KA7A 2QF7A 1QZHA 3S1MB 4BXXH 2KJXA 4OL7A 2UXCQ 2Z4HA 2WAQG 4ULLA 1RJTA 1BF4A 5IYBH 4CDFC 1XMQL 3CQZB 2F4VQ 4X64Q 2IX1A 3K5OA 1ICFB 3L3OC 3SK5A 4J1MA 3CKIB 4UY8C 2Y0SG 1OXVA 4DK0A 2R93G 5J39A 1PZJD 2F0WA 2KOLA 2HCIA 3G4SA 1HQMC 3PO3G 4WJ3M 1VMCA 2E75C 3H0GB 4P2CB 2CQOA 4JI3L 3PO3H 1MI2A 3SK6A 2K4KA 5M5YH 2WB1E 2KECA 4HJ8A 1MBYA 3T56B 4RGMA 1ZYRD 4H7BA 1VQ8A 5EPKA 4RKBA 1VMPA 4JI2L 2N3SA 3H3VI 3I8ZA 3OWFA 1SMYD 3MAQA 1FYCA 3DUZA 3CRKC 3FKIB 3TZUA 5D3IB 1CKOA 5I9PA 5AJ3L 1B9NA 2H1EA 1WTOA 3GTPB 2XRQD 3W3AA 1B2TA 3GV6A 1VDZA 2QKIC 3CRLC 1EOTA 4M8AA 2PQAB 4DFAA 3H91A 4DV6L 2E2IB 4XIGS 1N33Q 5EPLA 5ISRA 1XWEA 2DY7A 1Q8KA 5C5MA 1A3UA 5M9OA 2A68C 1T5XD 4OO1H 3SR1A 2PCFB 5LHY1 5KYLA 1YITA 4B3TQ 3RN2A 5IT9E 5C4ZA 5FK9C 5IWAL 2F0SA 3S1MH 1WTHA 4ABNA 3AFQA 1WI5A 3EVQA 1TWGB 3I90A 4K8JA 4MN3A 1CT1D 3HOZB 5FJ8H 4POFA 3CQZH 4HN7A 1Z6HA 5JEAJ 1KXLA 2A6HC 1NJIC 1IKLA 4GLAC 4LFBL 1H9SB 4OIJA 1HZAA 3SK8A 2F0NA 5JJIA 3TP8A 1BO0A 1ICWA 4LF6L 4A3DG 5CGKA 3IFTA 5D3DA 4K2LA 2DJGC 1JE5A 3H0GH 5EKKA 2B2WA 5ELNA 1D7QA 4P73A 1V1QA 2LFNA 2NVTB 2ICIA 3GP7A 5JEAG 1R4QB 2MGSA 4QUFA 1HCZA 4X66L 2A8VA 4CBVA 1U4RA 3HOUB 2GVAA 4IOCA 2SNMA 4RGNA 4YCUA 1NAPA 1PRTC 3FKIG 4YIJA 3MXGA 1ENAA 3FKIH 2FJ2A 1XNRQ 3PIPA 3T13A 3GTPH 1HRJA 4HJ9A 1E24A 1YIJA 4IJHA 2R7DA 5J3BA 1LUZA 4R4QA 1YJ9A 5A2QL 2D0PA 3U9OA 1YJNA 3JAMi 1LTAD 1RD9D 2E2IH 2B63B 3K6OA 3M4PA 2KHIA 2QA4A 2CCZA 3SXHA 2ENBA 5M5XB 3R8BA 4RWSC 3E3XA 4I7AA 1B44D 3I56A 1EUJA 2XSCA 1Z9FA 3S17B 1XX8A 1ENFA 1TS5A 2E5LQ 1B8AA 5JOBA 1SFOB 5IYCH 2Q2HA 1XNQQ 2M9VA 4O1NA 1SE2A 4JBJA 1KHIA 1IBKQ 5GAGC 5DM63 4RAUC 1PMRA 4C1NI 1TWGH 3OHXC 3HEJA 3QJYA 3HOZH 2PW5A 4LF7L 2I5LX 3NBHB 1EL0A 1KNAA 1PH5A 2IW3A 3CD6A 2K52A 4IALA 4XYOA 1XMQQ 3R93A 1Q90A 3ND8A 4HIKA 3LNNA 2JJQA 4HJAA 5IP9G 2E8GA 3QR8A 4JPBW 3V96A 1LT4D 2L55A 3C1FA 5C4XG 1JC7A 3ND9A 1STNA 3GTLB 1V8QA 4X62L 1Q12A 1QCBD 1TR5A 1P8LA 1U0LA 2FMCA 2NVTH 3GDEA 3HOUG 4LAAA 1JJCB 3M85A 5BN4A 3HOUH 2A19A 1EFWA 2A6ED 3OIPA 5C0XJ 3FDTA 1LTBD 4JI2Q 1Q3LA 2RKSA 3M3YB 3I3CA 1HFGA 3N52A 1QJOA 1YEZA 2WKDA 2ASBA 2ZJPA 4C3IG 2VUMG 5AJ3Q 4BBRB 1BDOA 5E4WC 1STYA 2B63G 3P7JA 4PG3A 1ET9A 5D14A 2OTJA 2B63H 5C0XG 4UP9A 4OELB 4R4OA 1D5MC 4DV6Q 4NW2A 5M5XH 1Q46A 5CBEE 3FMCA 3TDQA 3I4NB 1HFNA 3S17H 1BOSA 1BQQT 1S5BD 3WOFA 2IX3A 2I07B 3D4RA 4G7HC 2WACA 4IUVA 1SFOH 4FVMA 5IWAQ 1GM5A 1I4PA 3M4OB 3DWQA 1JR0D 1K8MA 4A3BG 4C3HG 1BCPC 1STHA 1F9QA 1TS2A 2K5DA 4MTKA 4AQYL 1B53A 1G51A 3GTOB 1ML0D 1YZ6A 2I5HA 1EY6A 2L12A 1AZQA 3BS1A 2MPMA 4LFBQ 3IL8A 3D4DA 4KI0A 3J81j 1MJCA 5C3XA 4J8QA 1K0RA 4LF6Q 4V190 1IYUA 3GTLH 1IL8A 3A7LA 5EKLA 2F0MA 2K75A 4PMBA 4J6HA 3ULLA 1PDQA 4LF9L 4YWLA 1RF2D 4X66Q 3J81c 1A3TA 4RHRA 4TKOB 1F2ZA 3K5LA 3M3YH 5IY0A 4MNOA 4ZQ3A 2L9HA 3CHBD 2YU9B 4BBRG 1VQMA 1FJGL 3QWNA 4A4IA 3Q24A 5FO7B 1SR3A 2BCOA 4BBRH 1D1KA 3I4MB 2NTTA 4O0AA 4AH6A 1B4OA 1MHWC 1GVPA 1AE3A 2NN6G 3OMGA 4IOAA 5H1SE 4A3IG 3SVMA 4H0LC 4DF7A 2F03A 1CK1A 2RQXA 4ZCKA 1VQHA 1PRTD 1PLFA 1X3PA 4A3JB 2Z4IA 4TRDA 1Q86C 2RBMA 2PZUA 1PZKD 3DEOA 1PTOD 2PMZB 2R92B 1H95A 3I4NH 3HZXA 1L0WA 5M3MG 4L6TB 4CJ0B 3TBIB 1S5ED 1LM0A 3I55A 4RGOS 1BCPF 1RTNA 4V0BA 1S72A 1MIUA 5IODA 3NE5B 2YTVA 3M4OH 4IJLA 1RKNA 5C0XI 1YHAA 1RCVD 2ZM6L 4H02A 4JI7L 2Z9HA 2MFIA 4A3LG 2EIFA 3GTOH 1IBML 2F0KA 3AFPA 4LF7Q 1LT5D 1Y1VG 2HHHL 1G6ZA 1D2BA 1KL9A 5C3WA 1I4QA 1PZID 3RLNA 3CCVA 4DV3L 2KEEA 3CAMA 4DPGA 3NPPA 3W2DA 2EZVA 2F1MA 1I50B 1Q81C 2CW0C 1U4PA 2OXPA 4ZRZA 2VXWA 3DHQA 4X62Q 3CU7A 3QIAA 4IUPA 2AUKA 4JI0L 5IT9L 3X3MA 3K57A 1X3EA 2QGQA 3P20A 3CCRA 2D5DA 3HRZC 2OQKA 1RDPD 1DGSA 3TN2A 4K5XA 1PH6A 1XYIA 4M1UB 3OIQA 1SSOA 1O7ZA 1SMYC 2E2JB 3I4MG 4LK1C 4FNFA 1MGSA 4IFDJ 1SJED 3I4MH 1VCIA 2XVSA 3D6WA 1XPUA 1WTQA 1LTSD 4DK1A 4EQ5A 4DR2L 3UI2A 4L5RC 2JA5B 1OXSC 1L2FA 5FLMG 1B3QA 2AMCB 1GJXA 1TWAB 2WKCA 3NEMA 2E2HB 4A3JH 1O80A 2R92G 1M4VA 2R92H 2K5WA 5FLXc 4KY5A 2E76C 2WIIB 3QOLA 1V1PA 3CC7A 2VY3A 5KNBA 1KAWA 4IFDG 1SRUA 2Q2IA 3UE0A 1M8AA 4U673 3GD7A 4XXEA 4KKSA 4ZLTF 2NN6I 4ME5A 1Y1WB 1SE8A 1GO3E 1VQJA 2AKWB 2ZTCA 5GADC 2DNEA 1H9JA 1T9HA 3J81E 1HNZL 2EE1A 1TKWB 4AYBG 5KIXA 1QNKA 4ZYSA 4AQYQ 3MXNB 3CCQA 3S2HB 2PMZE 5JJLA 3AQQA 2J7ZA 3BVMA 1XXGA 2SOBA 5J1ZA 1BR9A 1YNND 5I9OA 3IRBA 2RA4A 4ZAIA 1BNZA 4HTHA 2B8GA 2WB1B 5KNCA 3GTQB 3SK4A 3I4LA 2IY5B 3UDIA 4LF9Q 3PUWA 5DM73 4DV4L 1BUVT 4AYBE 2KHSA 3NK9A 2LS01 4A75A 3PIOA 1DJRD 4UP8A 2L11A 2E2JH 2R93B 3TP6A 5EBDA 1OXTA 1FJGQ 1AZPA 2F3VA 2Z6KA 1R9TB 2KCCA 2JA5G 1SMXA 3KJOA 2CKZB 4GLXA 2JA5H 3KFUA 1LTLA 1YJWA 2PZWA 1OTCA 1EYDA 1JOOA 1TWAH 2E2HH 4A3GB 1E1TA 1K8GA 3BVGA 3ZYYX 2JA7B 3KLSA 3HOWG 2VW9A 1H9MA 4QUCA 2RVLA 1TWFB 1CM9A 4FXKC 1YNXA 4DGZA 1QUQB 4Q5VA 4A93G 1Y1WH 1C48A 4KY6A 3OWEB 1G291 1ESRA 5A35A 4GOPA 2Z8LA 3VYTA 3RZDB 2ZM6Q 1JOKA 3GTGB 2F52A 3S2HH 2F0TA 4EQOA 4Y52H 1JE4A 4K2KA 1IBMQ 3NENA 1B50A 2K5NA 4DA2A 3OTOL 4GNXA 4IFDI 4LUZA 2HHHQ 1Q7YC 5M3FB 1IZ6A 4DV3Q 3E0JA 1WD0A 3RN5A 4A3CG 4LJZC 4ZKCB 3TP5A 1X65A 2I46A 1F2LA 4KLKA 2IHEA 4WFN3 2BE5C 2UU9L 3I72A 3GTQH 4MTNA 1TS4A 1E3PA 3MHBA 4JI0Q 1TWCB 2B8FA 1KC8C 1Z7TA 1CTMA 3UDGA 4EQNA 3TSSA 4J15A 4JC0A 2A6EC 1L0YB 5FLXE 4N8FA 2TMPA 3DWAA 4RHSA 3PF4A 5IGBA 4X3UA 2R93H 2CWPA 1QWYA 4DV5L 1GUNA 2CW0D 3J80E 1UE7A 4A3DB 3H09A 1E2ZA 3R2IA 2JA6G 4QQBX 5EAYA 1R9TH 4HCEA 4APVA 1JJGA 4DR2Q 4A3GG 3URYA 1FNWA 4PQXA 4A3GH 2JA7G 5CC4A 1BCPB 4MZ9A 4JYAL 4BA2I 5LL6S 2R61A 2JA7H 3K80C 1W6JA 2K01A 2ZTDA 1Z47A 2BH2A 2M00A 4OHJA 1TWFH 4DUYL 3A8KE 3MFGA 3F2UA 1E2WA 3TRZA 1OXUA 2EYPA 1D6EC 5JAVA 1K9MC 4ALPA 3CCJA 4IUUA 1STGA 1EWHA 2GVBA 5GAHC 1MKHA 1PHJA 3K7AB 1HH2P 1XTCD 3RZDH 3PUXA 1WFQA 3GTGH 1SJHD 1G91A 1E1OA 2NZHA 1HNZQ 5E3FA 2LXJA 2G9HD 5M3FG 5CV5A 4R8IA 2BH8A 1NNXA 1VQAA 1HJPA 5M3FH 3MEHA 1WTRA 1PYBA 2ZJRA 3MXPA 4IUNA 2AQ1B 4FF4A 4DR1L 1CKNA 4JK1C 4GOPC 1I5FA 3J7YW 1SLJA 3RNUA 5JPNC 3R3OA 4PV1C 4GNXC 5AFWA 1TWCH 3ERQA 2OQ0A 2GN5A 1Q8IA 1JWUD 2X6LA 4DV4Q 4KHPL 1GOZA 2JE6I 1WTVA 2EJFC 2ZTEA 4LNQA 4DR3L 1K83B 4A3DH 3ULPA 5C4XB 2MNAA 3I7FA 5LMNL 1QVFA 1EQQA 1LTGD 4RKLA 1U5KA 3S9WA 2QDBA 2E2DC 5LMNW 1SYFA 5JEAH 3TS0A 1C7YA 3HS0C 5IE8A 4DV1L 4LF5L 5I2XA 1B1ZA 1N36L 1UE6A 1D8LA 1GUGA 1X9NA 4OWWB 1LYLA 1QVCA 1HUNA 1PTOC 1A6XA 2FMMA 3EBEA 2F0UA 4DR4L 3BDCA 2CH4A 5DNFA 2B39A 3KDFB 2FINB 1EQVA 2F0OA 4C3IB 4NDXA 4OWXB 5KGUA 2VUMB 4B08A 1UEBA 3KF6B 3NQIA 4RCNA 2PZTA 4QY7A 2XRSD 3K7AH 1TQOA 2XWBB 2KCNA 1II3A 1I4GA 4JG2A 2VB3X 1I4XA 1YNJC 3VYRA 2MUYA 2OEOA 3PUYA 1G2TA 1T5EA 4R4IA 1DONA 2F0LA 2N8NA 1S4ZA 2B2VA 3OTOQ 2ZXPA 2K05A 4IPGA 4DK6C 1HQRD 1Q82C 3U4ZA 4ME3A 1STEA 2XWJB 3OSOA 4LUOA 5GROA 5CMDA 2RCFA 4BA1I 1K73C 2QCPX 4PMCA 5IGEA 3OMCA 2UU9Q 5I2YA 1NCVA 1VQEA 4A3BB 4C3HB 1PV4A 2I5MX 5CR3A 2F3IA 3HOVG 3VA5A 4CDCC 1CZGA 1S3OA 5IP9H 4DR6L 1HA5A 3F2CA 3J81L 2HT1A 3S1QB 1K83H 1CA6A 4L5SA 2NVQB 3KBGA 2BA0A 4CGYB 5C4XH 4DV5Q 5KRUA 2MHVA 2PQAA 2BE5D 2EXZA 1D1IA 1DOKA 1E0BA 1JQYD 4QIWE 3IKJA 5FKAC 1PRTF 2K7VA 1JB7A 1PTOF 3RR5A 4IPCA 3C3LA 3NP8A 4DR5L 4Q0FA 1A2UA 4GKKL 2B2WC 4JYAQ 1EQTA 1SE4A 1K0SA 1J6QA 1SYBA 1IBLL 1V1OA 3L7ZC 5CYUA 1WD1A 4DUYQ 3F2DA 1JCKB 5EGTA 4C3IH 2VUMH 1ET6A 4CKCA 3HOYG 5EBCA 4F7XA 1G2SA 3MTSA 2RSNA 1H9SA 2LMCB 4PMWA 4JBWA 3W5OA 2F0HA 3A74A 3H94A 5C0XH 4A3IB 1GUSA 3DEPA 4TQUS 4QGUA 5IGCA 3T16A 1D5ZC 3Q6SA 4DAPA 4LF8L 1SROA 3FP9A 4WRDA 1HTPA 5M3MB 1TXYA 2R7ZG 3I73A 1SNOA 1WJJA 4UDUC 1HA6A 3RMHA 2R6GA 2OCEA 1ENCA 2RHQB 1SNDA 1YNNC 4DR1Q 4G7ZC 3CF5A 1IW7D 1PFSA 1N32L 3DXJC 4ZK9B 4A3BH 2CHBD 1Y8PB 4C3HH 3CMEA 2BOSA 4KKTA 3OW7A 4OWTB 1KLGD 4HIMA 1C0AA 4YCVA 1Y1VB 4KHPQ 2A69C 4OEMB 4RMFA 3S1QH 3TEHB 2NVQH 3NHHA 1LABA 3JAMc 1IYVA 3T1YL 4DR3Q 5K36G 1SYGA 5FO9B 5K36H 2Z1CA 1TT2A 2AHOB 4DU9A 1DYQA 1EY7A 5LMNQ 2O4XA 1WYDA 2K6AA 3TP7A 1FNVA 3KF8B 3PGZA 3BJUA 4DV1Q 1L1OB 2JQOA 4LF5Q 4XQQA 4HCSA 1N36Q 2FHTA 3NQTA 4MIUA 1EY5A 1PH2A 1KDBA 3GQBA 4UHVA 4FF3A 4DR4Q 5GQOA 1EYCA 1X3FA 5DEHA 2XNAC 4A3KG 1I4HA 2EY6A 2EYHA 2Z0SA 3BZCA 3FEWX 3NSWA 5FLXL 4JV5Q 3J80i 5IYDG 1ZEQX 4A3FG 3NBHA 4DXFA 3SE0A 3J80L 2NN6H 3CCSA 4A3IH 1W2BA 3F8TA 1AH9A 2EYMA 3D4WA 3K5MA 2EVBA 1KLUD 4HJ7A 3KYHC 3VR3A 5M3MH 2JEAI 3PSIA 4X3SA 1SNQA 4LFAL 4IUQA 3MA2B 2MP1A 1SEBD 1HTLD 2EXDA 4HR7B 2NYZD 1EIHA 3T51B 4E6IA 5IP7G 2HD3A 1O78A 1QG7A 1JWMD 1PFBA 5IP7H 1AW7A 4XQJA 3A8JE 4K6LA 1QNUA 1YNJD 4ZKBB 4F88A 4A3LH 3ZJYC 3W1BA 4AYBB 3AB9A 1SN8A 5T1GA 4DAYB 1LTRD 1Y1VH 2K5HA 2YTYA 1A2TA 3C2PA 3HKZG 3CPWA 2K50A 2OTLA 2SNSA 4R8NA 3K81C 1C8CA 2UXBL 2OF1A 4DR6Q 2EY2A 4OONA 2CVRA 3ONAB 1KRSA 3TZDA 1O7YA 3T53B 1UNSA 4QCLA 4ID6A 1RODA 2KQ3A 3C46A 1LV9A 4DXGA 4P75A 4NB3A 2FFKB 4XDXA 2F0JA 2EOTA 4RG1A 1A15A 1S5CD 1OO9B 3E6ZX 1WCMG 1FGBD 4NP5A 2L15A 5COYA 1UEAB 4BY1G 4FYDA 3AU7A 1E7ZA 1D5XC 3MWYW 4DR5Q 1VQ4A 4GKKQ 2Q8RE 4HEDA 5E7NA 2HIXA 2KHJA 2R3ZA 3PCOB 1NR2A 3HKZE 1UE1A 4I7ZC 4XQNA 1IBLQ 3A56A 5I6YA 3CCEA 3EQLC 2JN4A 3S1RB 2N78A 4P71A 2EYLA 3RLFA 3UDFA 1WVLA 2YYZA 4RCOA 1E22A 5FLMH 3PQIA 4KHVA 1VQ9A 3EROA 2Q2UA 2WP8J 5C3EB 2PI2A 1N9WA 3J7AV 2LSSA 2LXKA 3HOWB 4UP7A 2N49A 1MJEA 4QL5A 3NWSA 3JAME 4LF8Q 3K0YA 4IFDH 2PYKA 1SNCA 3I2ZA 2AUJD 2NWGA 5C44B 1JMCA 5CV8A 2NVXB 4OX9L 1OXXK 4A93B 3NTKA 1YHBA 1EYAA 2QILA 1K8AC 3T4AC 4RH6A 3EJIA 1N32Q 1U4MA 5L37A 1QOHA 3O13A 2X6GA 3AYHB
chains in the Genus database with same CATH topology
2AWNA 2JA8B 3WOEA 1F9PA 3S2DB 2AQ2B 1MSHA 3VR2A 1PRTB 2A74C 1QE6A 3PIP3 2IX0A 4BWGB 3GTKB 4FO2A 2F0FA 2EPBA 1Y69U 4K6DA 4KY7A 3QO2A 1EY9A 3D31A 4NKLA 4UAIA 2ICEC 4BBSB 1LO5D 2A69D 2F0QA 2NB0A 3V05A 3BVZA 2F0EA 3K59A 2KUMA 4HSVA 5CV7A 2M2LA 5EJWA 2IL8A 1R4PB 3MXUA 3AMUA 2JA6B 4B9XA 1LTID 1CQFA 2RSOA 1ILPA 1EWCA 1NUCA 1IKMA 1ESFA 1AP0A 3S16B 1SXTA 2ZXRA 2B2YA 1RHPA 3FPUB 5I4DA 5ELDA 2EY1A 3QB3A 1DOLA 2VB2X 2AWOA 5TSSA 5KYIA 2XN9C 5C4HA 1I3QB 3LWEA 4ZUIA 1TU2B 1CA5A 1BBXC 1X32A 3U9SA 3G6JB 2QEJC 1ZKOA 1Y8NB 5EPJA 5IGFA 1EY8A 3GV3A 5BN3A 4N9TA 4KJNA 2NVYB 2PO4A 4LMQD 1WTXA 2PPBC 4DNTB 3GO5A 1PTOH 1QB5D 2GA4B 1FD7D 1NR4A 2F0GA 3NXWA 1TS3A 2EY5A 1LACA 4ODGA 1AFPA 1DXMA 4RGTA 1ZXTA 1HHVA 5J22A 3HGBA 2F0PA 3OOCA 1H9KA 4FF2A 1EIGA 1KABA 4DNRB 4IURA 1TVXA 5NUCA 4CHTB 4TSSA 3MXNA 5EQ0A 1F9SA 1TWHB 4KJOA 3DWPA 3S15B 5LL6X 1B9MA 4S3SA 3ITPA 4ILWA 4FP5D 3R2TA 3S14B 1KDAA 1IW7C 2B2YC 1SE3A 4B9WA 2K04A 1SYEA 2WV6D 4XTCS 1F2MA 2C9OA 1DOMA 5IGGA 2VNUD 3KK7A 3BDLA 1CQVA 1Y8OB 3FPPA 1CFMA 3DMUA 2NTSA 3PV0A 4QIWB 3NBIA 4Y7NB 3FRPB 5JVH3 3H3VC 2N55A 4OO1G 3QG1A 3GTMB 2F4IA 1KDCA 3D3RA 1AEXA 3Q23A 1JB3A 2KEDA 1EEFD 3HOVB 4K5VA 1J8IA 1HPCA 1SYDA 1SDFA 1X3QA 3RZOB 2E74C 3NWTA 4CKBA 1TY2A 2HDLA 4X3KA 2X69A 4EQPA 3RD4A 2O2LD 2J0TD 4KV6A 4OGQC 3A8IE 5IGDA 1WTWA 4KN7C 5HURA 3V2TA 1UAPA 3X3NA 4A3MB 5C5LA 5JVG3 5M5WB 3MZ5A 1SNPA 3K58A 3N6RA 1SNMA 2B2TA 4DAVA 3HOYB 1AN8A 1VF5C 1EU4A 4C3JB 5IOCA 2D9UA 3VYUA 2JXMB 4DN4M 1LT6D 2HUGA 2R7ZB 2H4OA 2K03A 5EKIA 3J7AF 3JAML 3KUPA 1L0XB 3PUVA 1GUWA 4RA8A 2Q8IB 2BDOA 1Q1BA 4XT1B 3MFYA 2A73B 5G3LF 4O42A 3D8GA 2EJGC 1C4QA 1GUOA 2G9DA 2A5HA 3DM1A 5CBAE 1MD2D 4OO1I 3VR5A 1EEID 1DCZA 1V43A 2AQ3B 3LWUA 4G7OC 2F3WA 3S1NB 4L63B 2N88A 2F0IA 2XIWA 4EGVA 2DN8A 1GUTA 1GHJA 1A3VA 4A3KB 1JICA 3OPOA 4R9WA 4A3FB 3PUZA 4C3JG 3L9AX 2SDFA 1PYWD 2IPKD 2MJ8A 2Q8TA 3HG9A 3VR6A 3G7LA 2EYJA 3PIO3 3GTJB 5F2DA 4IQZA 2L0CA 2B2TC 3NUCA 1CHPD 1RTOA 1IHZA 4QMGA 5I6WA 4KMUC 1W6KA 4FXGC 5E4XA 2C5CA 2B2VC 2L5TA 2NBFA 2O5IC 2EDGA 4GZYC 4C2MB 1F2YA 1JOQA 5E1FA 5FOBB 4OIKA 3NTIA 3HKZB 3WDNA 4H13C 5JPMC 2F0DA 4A3EB 2L1BA 1G8ZD 1TIID 5JJZA 2DNCA 2A68D 4N9PA 2RDHA 5K5PA 5T1IA 5ELFA 4EVOA 4L8JA 1CHQD 1JWSD 2V4DA 1WCMB 2K32A 1KTKA 1V1PB 4BY1B 5CORA 1EY4A 1O7LA 2CQAA 1VF7A 2L4NA 3Q22A 1B3AA 3MVVA 2EYFA 3FVQA 3D6CA 2JEBI 2A6HD 4KHZA 5G3LD 3HP3A 2O5JC 1GHKA 1EY0A 2RDFA 2JP1A 3Q0AA 5ELCA 4F87A 3M7NA 2WINB 2LY7A 5C6AA 1FR3A 1EZ6A 2DY8A 4FXDA 2IWHA 3VYSA 4F8MA 2SEBD 2PNRC 3PO2B 1DD2A 4G57A 3BYTB 5CV4A 2PW7A 4K5WA 2B2UA 5CV9A 3VA7A 3BYYB 1HUMA 4IUTA 3IAYA 3EA6A 1LT3D 3M7GA 1ILQA 1J9OA 2JSOA 1PFNA 2ZXOA 3E5SA 4X3TA 4CKEA 2TSSA 4ZUJA 1K8OA 2K28A 3BZDB 2HQEA 4KTAA 2D62A 2HCCA 1CZWA 4HMIA 4BY7B 4NMZA 1SYCA 1WTPA 1F77A 4MHEA 3H6MA 1ZYRC 5ELEA 5C4JB 2JYOA 1MSGA 4C56C 1GXDC 5A2QE 1PXUA 5DAUA 3M4YA 3PMFA 3VR4A 3HOXB 3P75A 2KVMA 3IFDA 2IJ0A 1I6VC 4QB4A 3KF8A 1H9RA 3KLSX 1I4RA 5KNDA 2ID0A 4HSPA 4QF4A 1TY0A 4IZ8A 3SDZA 4IN3A 2NZ1D 3A54A 1I6HB 1U9RA 4KK7A 1F9RA 4CJ2C 1PTOB 1JORA 1NSNS 3TMEA 2B2UC 1BXTA 3EFXD 1KNEA 1S5DD 1Q1EA 4WORA 5IIFA 4HMJA 4K8IA 4BS9A 5BN5A 2NUCA 2IT1A 3KBXA 3C1EA 1SBBB 4C1NK 3BDOA 1SAPA 5CV6A 4XT3B 2PQEA 1BCPD 3SEBA 4KD4A 4PNYA 4HAEA 3I70A 2WAQB 4RFBA 4FF1A 3A7AB 3K5NA 5ELBA 4DAYA 4CJ1B 4H44C 1HXYD 4I65A 1UUPA 2Y0SB 1CI3M 3NTHA 4G4KA 2K1BA 2OT2A 3PO3B 1LTTD 1S5FD 5M5YB 1KAAA 3LX0A 1E2VA 2D2CC 3SHLA 2EYOA 3RUZA 2J4XA 2BDNA 2F0VA 3MC0B 1ONLA 1PFMA 2HDMA 2LKVA 2ZT9C 1EFID 2K33A 4Z9CB 4K14A 5HGTA 3BG3A 2EJMA 4KN4C 1STBA 1DZ1A 3KLRA 4WJWA 3P1HA 1QILA 4KKUA 3I91A 1LLRD 1STAA 5KEEA 4KD3A 5D65A 1EU3A 1U4LA 4U68A 2RDGA 4XYQA 3QOJA 5FO8B 2BA1A 1EZ8A 1FNUA 1DM0B 3A55A 2K5QA 2KA7A 2QF7A 3S1MB 2KJXA 4OL7A 2Z4HA 4ULLA 1RJTA 1BF4A 3CQZB 2IX1A 3K5OA 3L3OC 3SK5A 4J1MA 3CKIB 1OXVA 4DK0A 5J39A 1PZJD 2F0WA 2KOLA 2HCIA 1HQMC 1VMCA 2E75C 3H0GB 4P2CB 1MI2A 3SK6A 2KECA 1MBYA 3T56B 4RGMA 1ZYRD 4H7BA 5EPKA 4RKBA 1VMPA 3I8ZA 3OWFA 1SMYD 3MAQA 1FYCA 3DUZA 3CRKC 3FKIB 3TZUA 5D3IB 5I9PA 1B9NA 2H1EA 1WTOA 3GTPB 2XRQD 3W3AA 1B2TA 3GV6A 1VDZA 2QKIC 3CRLC 1EOTA 4M8AA 4DFAA 3H91A 2E2IB 4XIGS 5EPLA 5ISRA 1XWEA 2DY7A 5M9OA 5C5MA 1A3UA 2A68C 1T5XD 4OO1H 3SR1A 2PCFB 5LHY1 5KYLA 5IT9E 5C4ZA 5FK9C 2F0SA 4ABNA 3EVQA 1TWGB 3I90A 4K8JA 4MN3A 1CT1D 3HOZB 4HN7A 5JEAJ 1Z6HA 2A6HC 1IKLA 1H9SB 4OIJA 3SK8A 2F0NA 3TP8A 1BO0A 1ICWA 5CGKA 3IFTA 5D3DA 4K2LA 5EKKA 2B2WA 2LFNA 2NVTB 2ICIA 3GP7A 5JEAG 1R4QB 2MGSA 4QUFA 1HCZA 4CBVA 1U4RA 3HOUB 2SNMA 4RGNA 1NAPA 1PRTC 4YIJA 3MXGA 1ENAA 2FJ2A 3T13A 1HRJA 5A2QL 3U9OA 1LTAD 1RD9D 2B63B 3K6OA 3SXHA 2ENBA 5M5XB 3R8BA 4RWSC 1B44D 2XSCA 3S17B 1XX8A 1ENFA 1TS5A 5JOBA 1SFOB 2M9VA 4O1NA 1SE2A 5DM63 4RAUC 1PMRA 4C1NI 3OHXC 3HEJA 3QJYA 2PW5A 1EL0A 1KNAA 2IW3A 4IALA 4XYOA 3R93A 1Q90A 3ND8A 3LNNA 3V96A 1LT4D 2L55A 3C1FA 1JC7A 3ND9A 1STNA 3GTLB 1V8QA 1Q12A 1QCBD 1TR5A 2FMCA 4LAAA 3M85A 5BN4A 2A6ED 3OIPA 5C0XJ 3FDTA 1LTBD 1Q3LA 2RKSA 3M3YB 3I3CA 1HFGA 3N52A 1QJOA 2WKDA 4C3IG 4BBRB 1BDOA 5E4WC 1STYA 3P7JA 1ET9A 5D14A 5C0XG 1D5MC 4NW2A 5CBEE 3FMCA 3TDQA 3I4NB 1HFNA 1BOSA 1BQQT 1S5BD 3WOFA 2IX3A 2I07B 3D4RA 4G7HC 2WACA 4IUVA 4FVMA 1I4PA 3M4OB 3DWQA 1JR0D 1K8MA 4C3HG 1STHA 1BCPC 1F9QA 1TS2A 2K5DA 1B53A 3GTOB 1ML0D 1EY6A 2L12A 1AZQA 3BS1A 2MPMA 3IL8A 3D4DA 4KI0A 5C3XA 4J8QA 4V190 1IYUA 1IL8A 3A7LA 5EKLA 2F0MA 4PMBA 4J6HA 1PDQA 1RF2D 1A3TA 4RHRA 4TKOB 1F2ZA 3K5LA 4ZQ3A 2L9HA 3CHBD 2YU9B 3QWNA 3Q24A 5FO7B 2BCOA 3I4MB 1D1KA 2NTTA 1B4OA 2NN6G 3OMGA 3SVMA 4H0LC 4DF7A 2F03A 1CK1A 2RQXA 1PRTD 1PLFA 1X3PA 4A3JB 2Z4IA 4TRDA 2PZUA 1PZKD 2RBMA 3DEOA 1PTOD 2PMZB 2R92B 3HZXA 4L6TB 4CJ0B 3TBIB 1S5ED 4RGOS 1BCPF 1RTNA 4V0BA 5IODA 3NE5B 1RKNA 5C0XI 1RCVD 2F0KA 1LT5D 1G6ZA 1D2BA 5C3WA 1I4QA 1PZID 2KEEA 3NPPA 3W2DA 2EZVA 2F1MA 1I50B 2CW0C 1U4PA 2OXPA 4ZRZA 2VXWA 3DHQA 3CU7A 3QIAA 4IUPA 2AUKA 5IT9L 3X3MA 3K57A 3P20A 2D5DA 3HRZC 1RDPD 3TN2A 4K5XA 1XYIA 4M1UB 3OIQA 1SSOA 1O7ZA 1SMYC 2E2JB 4LK1C 4FNFA 1MGSA 4IFDJ 1SJED 1VCIA 2XVSA 3D6WA 1WTQA 1LTSD 4DK1A 3UI2A 2JA5B 1OXSC 1GJXA 1TWAB 2WKCA 2E2HB 1O80A 1M4VA 2K5WA 4KY5A 2E76C 2WIIB 3QOLA 1V1PA 5KNBA 4IFDG 1M8AA 4U673 3GD7A 4XXEA 4KKSA 4ZLTF 2NN6I 4ME5A 1Y1WB 2DNEA 1H9JA 3J81E 2EE1A 1TKWB 5KIXA 1QNKA 4ZYSA 3S2HB 2J7ZA 3BVMA 1XXGA 2SOBA 5J1ZA 1BR9A 1YNND 5I9OA 2RA4A 4ZAIA 1BNZA 4HTHA 2B8GA 5KNCA 2WB1B 3GTQB 3SK4A 3I4LA 3PUWA 5DM73 1BUVT 2KHSA 3NK9A 2LS01 1DJRD 2L11A 2R93B 3TP6A 5EBDA 1OXTA 1AZPA 2F3VA 1R9TB 2KCCA 2PZWA 1EYDA 1JOOA 4A3GB 3BVGA 3ZYYX 2JA7B 3KLSA 1H9MA 4QUCA 2RVLA 1TWFB 1CM9A 4FXKC 4DGZA 4Q5VA 1C48A 4KY6A 3OWEB 1G291 1ESRA 5A35A 2Z8LA 3VYTA 3RZDB 1JOKA 3GTGB 2F0TA 4EQOA 1JE4A 4K2KA 1B50A 4IFDI 4DA2A 5M3FB 3E0JA 1WD0A 4LJZC 4ZKCB 3TP5A 2I46A 1F2LA 4WFN3 2BE5C 3I72A 1TS4A 3MHBA 1TWCB 2B8FA 1Z7TA 1CTMA 4EQNA 3TSSA 2A6EC 1L0YB 5FLXE 2TMPA 3DWAA 4RHSA 5IGBA 4X3UA 1QWYA 1GUNA 2CW0D 3J80E 4A3DB 3H09A 1E2ZA 3R2IA 4HCEA 3URYA 1FNWA 4PQXA 5CC4A 1BCPB 4BA2I 5LL6S 2R61A 1W6JA 2K01A 1Z47A 2M00A 4OHJA 3A8KE 3MFGA 3F2UA 1E2WA 1OXUA 2EYPA 1D6EC 5JAVA 4IUUA 1STGA 1EWHA 3K7AB 1XTCD 3PUXA 1SJHD 1G91A 5E3FA 2G9HD 5CV5A 4R8IA 3MEHA 1WTRA 3MXPA 4IUNA 2AQ1B 4FF4A 4JK1C 3J7YW 5JPNC 3R3OA 4PV1C 5AFWA 3ERQA 1Q8IA 1JWUD 2X6LA 1GOZA 2JE6I 1WTVA 2EJFC 1K83B 5C4XB 1LTGD 4RKLA 3S9WA 2QDBA 2E2DC 1SYFA 5JEAH 3HS0C 5I2XA 1B1ZA 1GUGA 1HUNA 1PTOC 1A6XA 2FMMA 2F0UA 3BDCA 5DNFA 2B39A 2FINB 1EQVA 2F0OA 4C3IB 4NDXA 2VUMB 5KGUA 4B08A 3NQIA 4RCNA 2PZTA 2XRSD 1TQOA 2XWBB 2KCNA 1II3A 1I4GA 2VB3X 1I4XA 1YNJC 3VYRA 2MUYA 2OEOA 3PUYA 1G2TA 1T5EA 1DONA 2F0LA 1S4ZA 2B2VA 2ZXPA 2K05A 1HQRD 1STEA 2XWJB 3OSOA 5CMDA 4BA1I 2QCPX 4PMCA 5IGEA 3OMCA 5I2YA 1NCVA 4A3BB 4C3HB 5CR3A 3VA5A 1CZGA 1HA5A 3J81L 3S1QB 1CA6A 2NVQB 3KBGA 2BA0A 4CGYB 5KRUA 2MHVA 2BE5D 2EXZA 1D1IA 1DOKA 1E0BA 1JQYD 3IKJA 5FKAC 1PRTF 2K7VA 1PTOF 3C3LA 3NP8A 4Q0FA 1A2UA 2B2WC 1EQTA 1SE4A 1SYBA 1V1OA 3L7ZC 5CYUA 1WD1A 1JCKB 5EGTA 1ET6A 4CKCA 5EBCA 4F7XA 1G2SA 3MTSA 2RSNA 1H9SA 2LMCB 4PMWA 4JBWA 2F0HA 3H94A 5C0XH 4A3IB 1GUSA 3DEPA 4TQUS 5IGCA 3T16A 1D5ZC 3Q6SA 4DAPA 4WRDA 1HTPA 5M3MB 3I73A 1SNOA 4UDUC 1HA6A 3RMHA 2R6GA 1ENCA 1SNDA 1YNNC 4G7ZC 1IW7D 3DXJC 4ZK9B 2CHBD 1Y8PB 2BOSA 4KKTA 3OW7A 1KLGD 1Y1VB 2A69C 3NHHA 1LABA 1IYVA 5K36G 1SYGA 5FO9B 5K36H 2Z1CA 1TT2A 4DU9A 1DYQA 1EY7A 2O4XA 2K6AA 3TP7A 1FNVA 4XQQA 4HCSA 2FHTA 3NQTA 4MIUA 1EY5A 1KDBA 3GQBA 4FF3A 1EYCA 5DEHA 2XNAC 1I4HA 2EY6A 2EYHA 3NSWA 3FEWX 5FLXL 1ZEQX 3NBHA 4DXFA 3SE0A 3J80L 2NN6H 2EYMA 3D4WA 3K5MA 2EVBA 1KLUD 3VR3A 2JEAI 4X3SA 1SNQA 4IUQA 3MA2B 2MP1A 1SEBD 1HTLD 4HR7B 2NYZD 1EIHA 3T51B 4E6IA 1O78A 1QG7A 1JWMD 1PFBA 1AW7A 4XQJA 3A8JE 4K6LA 1QNUA 1YNJD 4ZKBB 4F88A 4AYBB 3AB9A 5T1GA 1LTRD 1A2TA 3C2PA 2SNSA 4R8NA 1C8CA 2OF1A 2EY2A 2CVRA 3ONAB 3TZDA 1O7YA 3T53B 1UNSA 4QCLA 4ID6A 1RODA 2KQ3A 3C46A 1LV9A 4DXGA 2FFKB 4XDXA 2F0JA 2EOTA 1A15A 1S5CD 1OO9B 3E6ZX 1FGBD 4NP5A 5COYA 1UEAB 4FYDA 3AU7A 1D5XC 3MWYW 2Q8RE 4HEDA 2R3ZA 1NR2A 4I7ZC 4XQNA 3A56A 5I6YA 3EQLC 3S1RB 2EYLA 3RLFA 1WVLA 2YYZA 4RCOA 4KHVA 3EROA 2WP8J 5C3EB 3J7AV 3HOWB 3NWSA 3JAME 3K0YA 4IFDH 2PYKA 1SNCA 2AUJD 2NWGA 5C44B 5CV8A 2NVXB 1OXXK 4A93B 3NTKA 1EYAA 2QILA 3T4AC 4RH6A 3EJIA 1U4MA 1QOHA 3O13A 2X6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NR4 A;  1F9Q A;  2FMM A;  2RSN A;  3MTS A;  1PFM A;  1B53 A;  4X3S A;  2HDM A;  1EOT A;  1SDF A;  1F9P A;  1X3Q A;  1U4P A;  4IUQ A;  3DEP A;  1ML0 D;  2MP1 A;  2N88 A;  3HP3 A;  2L11 A;  5DNF A;  1XX8 A;  1MSH A;  3H91 A;  2NYZ D;  2VXW A;  2L12 A;  2FIN B;  1EIH A;  1QG7 A;  4IUP A;  2JP1 A;  2XIW A;  1AZQ A;  3Q6S A;  2MPM A;  1QE6 A;  2HDL A;  5EPL A;  1PFB A;  3IL8 A;  1ZXT A;  4X3K A;  2KVM A;  3IFD A;  2X69 A;  4RAU C;  2DY7 A;  4ZKB B;  1HHV A;  2K01 A;  1AZP A;  1DZ1 A;  1HA6 A;  2EPB A;  5T1G A;  2DY8 A;  3TN2 A;  3F2U A;  3I91 A;  1IL8 A;  1EIG A;  1JIC A;  3QO2 A;  1KNA A;  1EL0 A;  1XYI A;  4IUR A;  4R9W A;  1SSO A;  3R93 A;  1O7Z A;  1TVX A;  1G2T A;  5D65 A;  1C8C A;  4UAI A;  1DON A;  1WTW A;  1PDQ A;  1S4Z A;  1U4L A;  4U68 A;  4ZK9 B;  2B2V A;  2CVR A;  3ONA B;  1MGS A;  2NZ1 D;  3TZD A;  2K05 A;  1O7Y A;  4IUU A;  3D6W A;  2SDF A;  1WTQ A;  3I90 A;  4MN3 A;  4QUC A;  1F9R A;  2RVL A;  5EQ0 A;  2MJ8 A;  2Q8T A;  1ROD A;  1G91 A;  1CM9 A;  3G7L A;  3UI2 A;  4CJ2 C;  1HUN A;  1LV9 A;  2B2U A;  5CMD A;  1F9S A;  2KUM A;  1IKL A;  2FFK B;  4XDX A;  4HSV A;  2B2U C;  2M2L A;  2L9H A;  1KNE A;  1HUM A;  2B2T A;  2EOT A;  1A15 A;  2IL8 A;  4IUT A;  4OIJ A;  4R8I A;  1O80 A;  1NCV A;  2B2T C;  5COY A;  1BO0 A;  1ICW A;  2X6G A;  1WTR A;  3MWY W;  1RTO A;  1ESR A;  1ILQ A;  2Q8R E;  1J9O A;  2RSO A;  4HED A;  1ILP A;  1B4O A;  1PFN A;  1IKM A;  1RJT A;  1BF4 A;  2B2W A;  2D9U A;  2R3Z A;  1AP0 A;  1NR2 A;  3FDT A;  4X3T A;  1Q3L A;  3KBX A;  3I3C A;  1HFG A;  1M8A A;  2B2Y A;  5E4X A;  3SVM A;  2B2V C;  1JE4 A;  1SAP A;  1RHP A;  3N52 A;  4DN4 M;  1B50 A;  3FPU B;  2B2Y C;  2K28 A;  5EJW A;  1CA6 A;  2MGS A;  1X3P A;  1PLF A;  4QUF A;  4ZLT F;  2HUG A;  4XT3 B;  2K04 A;  1WVL A;  5AFW A;  4HCS A;  3DEO A;  1U4R A;  2KOL A;  2FHT A;  2HCI A;  2HCC A;  1DOK A;  1E0B A;  1DOL A;  2K03 A;  4HAE A;  2X6L A;  1VMC A;  1NAP A;  5E4W C;  4CJ0 B;  1WD0 A;  4OIK A;  2EE1 A;  5EKI A;  1DOM A;  4ZKC B;  3KUP A;  3P7J A;  1QNK A;  1MI2 A;  1F2L A;  5D14 A;  3LWE A;  1WTV A;  1RTN A;  2KEC A;  1CA5 A;  2L1B A;  2FJ2 A;  1GUW A;  1BBX C;  1X32 A;  4RA8 A;  4CJ1 B;  4NW2 A;  5JJZ A;  1WTP A;  1HRJ A;  2J7Z A;  5EPK A;  5CBE E;  2B2W C;  1EQT A;  1VMP A;  5EPJ A;  5T1I A;  1HFN A;  4MHE A;  3GV3 A;  4XT1 B;  2NWG A;  2K1B A;  1WD1 A;  3I8Z A;  2RA4 A;  4ZAI A;  2N55 A;  1BNZ A;  4O42 A;  4X3U A;  2JYO A;  4LMQ D;  1MSG A;  4IUV A;  1WTX A;  1G6Z A;  5CBA E;  3DM1 A;  5COR A;  2L4N A;  2H1E A;  1B3A A;  1U4M A;  2KEE A;  2KED A;  1WTO A;  1B2T A;  3GV6 A;  4RWS C;  1J8I A;  1G2S A;  2BDN A; 
#chains in the Genus database with same CATH topology
 2AWN A;  1X54 A;  2JA8 B;  3WOE A;  1F9P A;  4JCV E;  1XMO L;  2AQ2 B;  1MSH A;  3E9I A;  3VR2 A;  3S2D B;  2H5X A;  1PRT B;  1BBU A;  2QDL A;  2A74 C;  1QE6 A;  3PIP 3;  2IX0 A;  2Q2T A;  1AE2 A;  4BWG B;  3GTK B;  3EIV A;  4FO2 A;  3T1Y Q;  2F0F A;  2EPB A;  1VQG A;  1Y69 U;  4K6D A;  4KY7 A;  2QEX A;  3QO2 A;  1EY9 A;  3D31 A;  4NKL A;  4UAI A;  2ICE C;  4BBS B;  4DNI A;  2MO1 A;  1LO5 D;  2A69 D;  2F0Q A;  3JC6 6;  2NB0 A;  2KCT A;  3V05 A;  4YWK A;  2B3G A;  3BVZ A;  1VQL A;  2F0E A;  4A76 A;  3K59 A;  2KUM A;  1NMG A;  2P5Z X;  4HSV A;  5CV7 A;  2M2L A;  5EJW A;  2IL8 A;  3S1R H;  1R4P B;  1VQC A;  3MXU A;  4YY3 L;  3AMU A;  2JA6 B;  5C4J H;  4B9X A;  1LTI D;  1CQF A;  4DK3 C;  2RSO A;  1ILP A;  1EWC A;  1NUC A;  1IKM A;  1ESF A;  1AP0 A;  3S16 B;  1SXT A;  5C3E G;  4JBK A;  1KQS A;  2ZXR A;  2B2Y A;  5C3E H;  1RHP A;  3FPU B;  3UE1 A;  1IYJ B;  5IT9 c;  1VQ6 A;  5I4D A;  1KRT A;  5ELD A;  3E9H A;  2EY1 A;  3HOW H;  4GN5 A;  2QW7 A;  3HOX G;  3QB3 A;  5C44 G;  1DOL A;  2VB2 X;  2AWO A;  5TSS A;  5KYI A;  5C44 H;  2XN9 C;  2NVX H;  5C4H A;  1I3Q B;  3LWE A;  4LFA Q;  4ZUI A;  4A93 H;  1TU2 B;  2R7F A;  1CA5 A;  1BBX C;  1X32 A;  3U9S A;  4JI4 L;  3G6J B;  3F1Z A;  2QEJ C;  1VQK A;  5HY6 A;  2JA8 G;  1ZKO A;  1Y8N B;  1XPO A;  5EPJ A;  5IGF A;  1EY8 A;  3GV3 A;  2JA8 H;  5BN3 A;  3S2D H;  4N9T A;  1X6O A;  1VQO A;  2UUA L;  4KJN A;  2NVY B;  2PO4 A;  4LMQ D;  4HID A;  1PH8 A;  1WTX A;  2PPB C;  4DNT B;  3GO5 A;  1PTO H;  2UXB Q;  1QB5 D;  2GA4 B;  4LUV A;  3GTK H;  1FD7 D;  4A3C H;  1NR4 A;  2F0G A;  4N8X 1;  1N34 L;  3NXW A;  1A0I A;  1TS3 A;  4DUZ L;  2EY5 A;  1LAC A;  4ODG A;  1AFP A;  3D0F A;  1DXM A;  4BBS G;  4RGT A;  1EYG A;  4BBS H;  1ZXT A;  4B3R L;  3LGJ A;  3SGI A;  1HHV A;  5J22 A;  4BXX G;  2VS1 A;  3HGB A;  2F0P A;  3OOC A;  1H9K A;  4FF2 A;  4NXN L;  1EIG A;  4DV7 L;  1KAB A;  4DNR B;  4IPH A;  1B70 B;  4IUR A;  5IYB G;  1QZG A;  1NE3 A;  1TVX A;  5NUC A;  1CSP A;  4CHT B;  4EX5 A;  2JA6 H;  4B3S L;  5LMU L;  1XTD A;  4TSS A;  3MXN A;  5EQ0 A;  3S16 H;  1F9S A;  1TWH B;  4KJO A;  3DWP A;  3S15 B;  5LL6 X;  1B9M A;  4S3S A;  2Z6K C;  3ITP A;  4NPS A;  1M1K C;  4TVA B;  4ILW A;  4FP5 D;  3R2T A;  4JI6 L;  2WAQ E;  1W3S A;  4L5T A;  3S14 B;  1I3Q H;  1PYS B;  1KDA A;  1A8V A;  1IW7 C;  2B2Y C;  1SE3 A;  4OX9 Q;  1JT8 A;  3STB C;  4B9W A;  2K04 A;  1SYE A;  2Y0S E;  2WV6 D;  4XTC S;  4O2D A;  4JW0 A;  1F2M A;  1PH3 A;  2C9O A;  1DOM A;  2FXQ A;  2NVY H;  5IGG A;  2VNU D;  3KK7 A;  3BDL A;  1XMO Q;  2RF4 A;  1VQ5 A;  1CQV A;  1A62 A;  1NBW A;  1Y8O B;  3FPP A;  1CFM A;  3DMU A;  2NTS A;  2V1C C;  3PV0 A;  4QIW B;  3NBI A;  4Y7N B;  3FRP B;  5JVH 3;  3H3V C;  3HKS A;  2N55 A;  4OO1 G;  3QG1 A;  3GTM B;  3EN2 A;  4DKA C;  2F4I A;  1BBW A;  1KDC A;  3D3R A;  1AEX A;  4P74 A;  3Q23 A;  1JB3 A;  2HQL A;  2KED A;  1EEF D;  4OXP A;  3HOV B;  4K5V A;  1J8I A;  3M4Q A;  1VQD A;  1QUQ A;  3S24 A;  1HPC A;  1SYD A;  2ZJQ A;  1SDF A;  1X3Q A;  1VQN A;  4JBM A;  3RZO B;  2E74 C;  3NWT A;  4DAM A;  5FJ8 G;  1I94 L;  4GN3 B;  4CKB A;  1TY2 A;  2HDL A;  1RL2 A;  4X3K A;  4JI1 L;  2X69 A;  4YY3 Q;  2K5V A;  1YI2 A;  4EQP A;  3RD4 A;  2O2L D;  2J0T D;  4KV6 A;  4OGQ C;  1EOV A;  3CC2 A;  2PNH A;  3H0G G;  3ULJ A;  1TWH H;  4NXM L;  3A8I E;  3S15 H;  5IGD A;  1WTW A;  2WFW A;  4WJ4 A;  2C35 B;  4KN7 C;  1HR0 L;  5HUR A;  3V2T A;  1UAP A;  3X3N A;  4JV5 L;  4L5Q A;  4A3M B;  5C5L A;  1HR0 W;  5JVG 3;  5M5W B;  3MZ5 A;  1SNP A;  1EQR A;  3S14 H;  1HZB A;  3K58 A;  1VQB A;  2OWO A;  3N6R A;  1SNM A;  1HNX L;  3TRE A;  2B2T A;  4DAV A;  3HOY B;  1AN8 A;  2MO0 A;  1VF5 C;  3CXC A;  4JI4 Q;  1K28 A;  1EU4 A;  4C3J B;  5IOC A;  2D9U A;  3VYU A;  1BVS A;  2JXM B;  4DR7 L;  1XPR A;  1FL0 A;  4DN4 M;  1LT6 D;  2UUA Q;  2HUG A;  4IPD A;  2R7Z B;  1A63 A;  2H4O A;  2UUC L;  2UXD L;  3WWV A;  2K03 A;  4Y7N H;  2DJF C;  5EKI A;  3J7A F;  1N34 Q;  3JAM L;  3KUP A;  1L0X B;  3GTM H;  1X55 A;  4DUZ Q;  3PUV A;  1GUW A;  1KD1 C;  4RA8 A;  1RIP A;  2Q8I B;  2BDO A;  3J81 i;  5IYC G;  3HOV H;  1GKH A;  1Q1B A;  4K0K L;  4B3R Q;  4XT1 B;  3MFY A;  3RZO H;  2A73 B;  5G3L F;  4O42 A;  4NXN Q;  3D8G A;  3HOZ G;  2EJG C;  1C4Q A;  1GUO A;  4DV7 Q;  2G9D A;  2A5H A;  3DM1 A;  5CBA E;  1MD2 D;  4OO1 I;  3VR5 A;  2YV5 A;  1EEI D;  1DCZ A;  1V43 A;  2AQ3 B;  3LWU A;  4X65 L;  4G7O C;  1BKB A;  2A1A A;  4B3S Q;  2F3W A;  5LMU Q;  3S1N B;  4L63 B;  2N88 A;  3Q8D A;  3T1H L;  2UUB L;  3UDX A;  1HNW L;  1WOC A;  4JI8 L;  2F0I A;  2XIW A;  3KLW A;  4EGV A;  2DN8 A;  4A3M G;  1GUT A;  4GN4 B;  4JI3 Q;  1GHJ A;  4A3M H;  3FHW A;  4GKJ L;  5M5W H;  1A3V A;  4A3K B;  2IHF A;  1PA6 A;  1JIC A;  3OPO A;  4JI6 Q;  3MEF A;  4R9W A;  1YVC A;  3HOY H;  4A3F B;  2EQS A;  3PUZ A;  4C3J G;  4JI5 L;  1YHQ A;  3L9A X;  2SDF A;  4C3J H;  1PYW D;  2IPK D;  2MJ8 A;  2Q8T A;  3I4O A;  3E0E A;  3HG9 A;  3VR6 A;  3G7L A;  2EYJ A;  3PIO 3;  4QJF A;  3GTJ B;  5F2D A;  1K3B C;  4IQZ A;  2JA9 A;  1JJ2 A;  2L0C A;  2B2T C;  3NUC A;  2R7Z H;  4HJ5 A;  1VQP A;  1CHP D;  1RTO A;  2I0Q A;  1IHZ A;  1KIX A;  4QMG A;  4YWM A;  5I6W A;  3U58 A;  3STB D;  2CWA A;  4KMU C;  1W6K A;  4FXG C;  5E4X A;  1B7Y B;  2C5C A;  2B2V C;  2ATW A;  1IXR A;  2L5T A;  2NBF A;  4FDB A;  2O5I C;  2EDG A;  2VQF L;  3CCU A;  4GZY C;  4C2M B;  1XJV A;  1F2Y A;  1JOQ A;  3B6Y A;  3KDF A;  5E1F A;  3A0J A;  5FOB B;  4OIK A;  3F2B A;  3NTI A;  3HKZ B;  4PZ8 A;  3WDN A;  3KF6 A;  4H13 C;  4DV2 L;  1PVO A;  5JPM C;  3K7U C;  2F0D A;  4A3E B;  4LFC L;  2L1B A;  1X56 A;  1G8Z D;  1TII D;  1I94 Q;  3KOJ A;  5JJZ A;  2DNC A;  2KEN A;  1O7I A;  2A68 D;  3KJP A;  2YTX A;  4N9P A;  4JI1 Q;  2RDH A;  5K5P A;  3S1N H;  5T1I A;  1S40 A;  5ELF A;  4EVO A;  4LF4 L;  4L8J A;  1CHQ D;  1JWS D;  2V4D A;  1WCM B;  4NXM Q;  2K32 A;  1KTK A;  1V1P B;  4BY1 B;  3ERS X;  3CC4 A;  5COR A;  1EY4 A;  1O7L A;  2CQA A;  1VF7 A;  2L4N A;  3Q22 A;  1B3A A;  3MVV A;  2EYF A;  3FVQ A;  4P72 A;  4HIO A;  1HR0 Q;  3D6C A;  4JOI A;  2JEB I;  1FGU A;  4A3K H;  2A6H D;  4KHZ A;  5G3L D;  3HP3 A;  2O5J C;  1GHK A;  1EY0 A;  3H15 A;  2RDF A;  5IYD H;  1P16 A;  2JP1 A;  3Q0A A;  4A3F H;  5ELC A;  3A5Z B;  1HNX Q;  3CW2 C;  4F87 A;  5BR8 L;  3M7N A;  2WIN B;  3ICE A;  3J7A 5;  2LY7 A;  5C6A A;  1YBY A;  3VDY A;  4GS3 A;  1FR3 A;  1EZ6 A;  2DY8 A;  4FXD A;  2IWH A;  3GTJ H;  3VYS A;  4F8M A;  1G6P A;  2SEB D;  4UPA A;  3BZK A;  4DR7 Q;  1HZ9 A;  2PNR C;  3PO2 B;  3NEL A;  1DD2 A;  4G57 A;  3RLO A;  3BYT B;  5CV4 A;  3CCL A;  2PW7 A;  3K8A A;  4JVZ A;  4K5W A;  2UUC Q;  1NTG A;  2UXD Q;  3I4N G;  2B2U A;  4YHH L;  5CV9 A;  3VA7 A;  3BYY B;  1HUM A;  4IUT A;  3IAY A;  3EA6 A;  2RHS B;  1LT3 D;  1N8R C;  1VQ7 A;  4R1J A;  3M7G A;  4C2M H;  4DV0 L;  1ILQ A;  3M9B A;  1J9O A;  1ASY A;  2JSO A;  5GAE C;  1PFN A;  1V9P A;  2ZXO A;  3E5S A;  4K0K Q;  1K3R A;  1CKM A;  4X3T A;  4A3E G;  2VQE L;  4CKE A;  2TSS A;  4ZUJ A;  4A3E H;  4B3M L;  1PH1 A;  1NY4 A;  1K8O A;  2JK8 A;  2K28 A;  2HQE A;  3BZD B;  4KTA A;  3PF5 A;  5ELO A;  2D62 A;  3HFZ B;  2HCC A;  3AEV A;  3G6E A;  2ALY B;  4CDE C;  1CZW A;  4X65 Q;  4HMI A;  1J5E L;  4R4C A;  3CPF A;  4R4T A;  4BY7 B;  1WCM H;  4NMZ A;  1SYC A;  2UUB Q;  3T1H Q;  1Y14 B;  4BY1 H;  1HNW Q;  2KBN A;  2MQH A;  2UXC L;  4JI8 Q;  1WTP A;  2G5D A;  2B29 A;  3TS2 A;  1F77 A;  2XTI A;  4MHE A;  2F4V L;  4X64 L;  1NMF A;  4GKJ Q;  3H6M A;  1ZYR C;  5ELE A;  5C4J B;  1ASZ A;  4GOP B;  2JYO A;  1MSG A;  4C56 C;  2NZO A;  2KCM A;  1GXD C;  3DLL A;  1CUK A;  3G48 A;  5A2Q E;  2PI2 E;  4GNX B;  2ES2 A;  2YU9 H;  4JI5 Q;  1PXU A;  4JOI C;  5DAU A;  3M4Y A;  3PMF A;  3PO2 G;  3VR4 A;  3PO2 H;  3HOX B;  3P75 A;  2KVM A;  3IFD A;  2IJ0 A;  4GLV B;  1GD7 A;  1I6V C;  4QB4 A;  2Z6B A;  3KF8 A;  1H9R A;  4A3J G;  4PZ6 A;  1FVI A;  4LWC A;  3KLS X;  1I4R A;  5KND A;  2ID0 A;  4HSP A;  1L1O A;  4QF4 A;  2VL6 A;  3OYY A;  1PH4 A;  2CH4 W;  3CP0 A;  3ER0 A;  1TY0 A;  4IZ8 A;  3SDZ A;  3U4V A;  3L0O A;  4IN3 A;  2NZ1 D;  1IL2 A;  3A54 A;  2DUD A;  3J80 c;  1I6H B;  1U9R A;  2VQF Q;  4KK7 A;  1F9R A;  4CJ2 C;  1PTO B;  3CCM A;  2XGT A;  1JOR A;  1NSN S;  1N33 L;  3TME A;  2B2U C;  1BXT A;  1EIF A;  1KNE A;  3EFX D;  4AIM A;  1S5D D;  4DV2 Q;  3CMA A;  1Q1E A;  4LFC Q;  3U50 C;  4WOR A;  5IIF A;  4HMJ A;  4K8I A;  4BS9 A;  1UWV A;  5BN5 A;  1EWI A;  2VZA A;  4B3T L;  4BY7 G;  1VQF A;  2NUC A;  3OW2 A;  2IT1 A;  3KBX A;  4LF4 Q;  4BY7 H;  3C1E A;  1SBB B;  1I50 H;  4C1N K;  3BDO A;  1SAP A;  4LW1 A;  5CV6 A;  4XT3 B;  2PQE A;  1BCP D;  3SEB A;  4KD4 A;  4IO9 A;  4PNY A;  4HAE A;  4CDD C;  3I70 A;  5JJK A;  2WAQ B;  4RFB A;  1EIY B;  4FF1 A;  3A7A B;  3K5N A;  5ELB A;  4DAY A;  4CJ1 B;  4H44 C;  1HXY D;  4I65 A;  1UUP A;  2Y0S B;  3L2P A;  5DLQ E;  5BR8 Q;  3H3V H;  1CI3 M;  3NTH A;  4G4K A;  2K1B A;  2DGY A;  2OT2 A;  3PO3 B;  1LTT D;  1S5F D;  2RCN A;  3TQY A;  1KAA A;  5M5Y B;  1PH7 A;  1CKN B;  3LX0 A;  3HOX H;  1E2V A;  2D2C C;  3SHL A;  2EYO A;  3RUZ A;  4PZ7 A;  2J4X A;  2BDN A;  4YCW A;  2F0V A;  3MC0 B;  1ONL A;  5HGQ A;  3G71 A;  1PFM A;  2HDM A;  1HZC A;  2LKV A;  2ZT9 C;  1EFI D;  1XNR L;  1CSQ A;  4X6A H;  1C9O A;  2K33 A;  4Z9C B;  4K14 A;  1X3G A;  5HGT A;  4YHH Q;  3BG3 A;  3J7Z C;  2EJM A;  3K0X A;  4KN4 C;  1STB A;  4POG A;  1UE5 A;  2HIV A;  1I6H H;  1DZ1 A;  1Y1W G;  3KLR A;  4DV0 Q;  4WJW A;  3DM3 A;  1QVG A;  3P1H A;  1QIL A;  4KKU A;  3I91 A;  1LLR D;  1L1O C;  1STA A;  5KEE A;  2D0O A;  4KD3 A;  5D65 A;  2VQE Q;  1EU3 A;  4B3M Q;  1U4L A;  4U68 A;  4JI7 Q;  2K14 A;  1M90 C;  3BU2 A;  2RDG A;  4XYQ A;  1VQI A;  3QOJ A;  5FO8 B;  2BA1 A;  2E5L L;  3W1G A;  1EZ8 A;  1FNU A;  1XNQ L;  1J5E Q;  1DM0 B;  3A55 A;  1IBK L;  1PH9 A;  2K5Q A;  2WB1 G;  1VS0 A;  2CFM A;  3A5U A;  2KA7 A;  2QF7 A;  1QZH A;  3S1M B;  4BXX H;  2KJX A;  4OL7 A;  2UXC Q;  2Z4H A;  2WAQ G;  4ULL A;  1RJT A;  1BF4 A;  5IYB H;  4CDF C;  1XMQ L;  3CQZ B;  2F4V Q;  4X64 Q;  2IX1 A;  3K5O A;  1ICF B;  3L3O C;  3SK5 A;  4J1M A;  3CKI B;  4UY8 C;  2Y0S G;  1OXV A;  4DK0 A;  2R93 G;  5J39 A;  1PZJ D;  2F0W A;  2KOL A;  2HCI A;  3G4S A;  1HQM C;  3PO3 G;  4WJ3 M;  1VMC A;  2E75 C;  3H0G B;  4P2C B;  2CQO A;  4JI3 L;  3PO3 H;  1MI2 A;  3SK6 A;  2K4K A;  5M5Y H;  2WB1 E;  2KEC A;  4HJ8 A;  1MBY A;  3T56 B;  4RGM A;  1ZYR D;  4H7B A;  1VQ8 A;  5EPK A;  4RKB A;  1VMP A;  4JI2 L;  2N3S A;  3H3V I;  3I8Z A;  3OWF A;  1SMY D;  3MAQ A;  1FYC A;  3DUZ A;  3CRK C;  3FKI B;  3TZU A;  5D3I B;  1CKO A;  5I9P A;  5AJ3 L;  1B9N A;  2H1E A;  1WTO A;  3GTP B;  2XRQ D;  3W3A A;  1B2T A;  3GV6 A;  1VDZ A;  2QKI C;  3CRL C;  1EOT A;  4M8A A;  2PQA B;  4DFA A;  3H91 A;  4DV6 L;  2E2I B;  4XIG S;  1N33 Q;  5EPL A;  5ISR A;  1XWE A;  2DY7 A;  1Q8K A;  5C5M A;  1A3U A;  5M9O A;  2A68 C;  1T5X D;  4OO1 H;  3SR1 A;  2PCF B;  5LHY 1;  5KYL A;  1YIT A;  4B3T Q;  3RN2 A;  5IT9 E;  5C4Z A;  5FK9 C;  5IWA L;  2F0S A;  3S1M H;  1WTH A;  4ABN A;  3AFQ A;  1WI5 A;  3EVQ A;  1TWG B;  3I90 A;  4K8J A;  4MN3 A;  1CT1 D;  3HOZ B;  5FJ8 H;  4POF A;  3CQZ H;  4HN7 A;  1Z6H A;  5JEA J;  1KXL A;  2A6H C;  1NJI C;  1IKL A;  4GLA C;  4LFB L;  1H9S B;  4OIJ A;  1HZA A;  3SK8 A;  2F0N A;  5JJI A;  3TP8 A;  1BO0 A;  1ICW A;  4LF6 L;  4A3D G;  5CGK A;  3IFT A;  5D3D A;  4K2L A;  2DJG C;  1JE5 A;  3H0G H;  5EKK A;  2B2W A;  5ELN A;  1D7Q A;  4P73 A;  1V1Q A;  2LFN A;  2NVT B;  2ICI A;  3GP7 A;  5JEA G;  1R4Q B;  2MGS A;  4QUF A;  1HCZ A;  4X66 L;  2A8V A;  4CBV A;  1U4R A;  3HOU B;  2GVA A;  4IOC A;  2SNM A;  4RGN A;  4YCU A;  1NAP A;  1PRT C;  3FKI G;  4YIJ A;  3MXG A;  1ENA A;  3FKI H;  2FJ2 A;  1XNR Q;  3PIP A;  3T13 A;  3GTP H;  1HRJ A;  4HJ9 A;  1E24 A;  1YIJ A;  4IJH A;  2R7D A;  5J3B A;  1LUZ A;  4R4Q A;  1YJ9 A;  5A2Q L;  2D0P A;  3U9O A;  1YJN A;  3JAM i;  1LTA D;  1RD9 D;  2E2I H;  2B63 B;  3K6O A;  3M4P A;  2KHI A;  2QA4 A;  2CCZ A;  3SXH A;  2ENB A;  5M5X B;  3R8B A;  4RWS C;  3E3X A;  4I7A A;  1B44 D;  3I56 A;  1EUJ A;  2XSC A;  1Z9F A;  3S17 B;  1XX8 A;  1ENF A;  1TS5 A;  2E5L Q;  1B8A A;  5JOB A;  1SFO B;  5IYC H;  2Q2H A;  1XNQ Q;  2M9V A;  4O1N A;  1SE2 A;  4JBJ A;  1KHI A;  1IBK Q;  5GAG C;  5DM6 3;  4RAU C;  1PMR A;  4C1N I;  1TWG H;  3OHX C;  3HEJ A;  3QJY A;  3HOZ H;  2PW5 A;  4LF7 L;  2I5L X;  3NBH B;  1EL0 A;  1KNA A;  1PH5 A;  2IW3 A;  3CD6 A;  2K52 A;  4IAL A;  4XYO A;  1XMQ Q;  3R93 A;  1Q90 A;  3ND8 A;  4HIK A;  3LNN A;  2JJQ A;  4HJA A;  5IP9 G;  2E8G A;  3QR8 A;  4JPB W;  3V96 A;  1LT4 D;  2L55 A;  3C1F A;  5C4X G;  1JC7 A;  3ND9 A;  1STN A;  3GTL B;  1V8Q A;  4X62 L;  1Q12 A;  1QCB D;  1TR5 A;  1P8L A;  1U0L A;  2FMC A;  2NVT H;  3GDE A;  3HOU G;  4LAA A;  1JJC B;  3M85 A;  5BN4 A;  3HOU H;  2A19 A;  1EFW A;  2A6E D;  3OIP A;  5C0X J;  3FDT A;  1LTB D;  4JI2 Q;  1Q3L A;  2RKS A;  3M3Y B;  3I3C A;  1HFG A;  3N52 A;  1QJO A;  1YEZ A;  2WKD A;  2ASB A;  2ZJP A;  4C3I G;  2VUM G;  5AJ3 Q;  4BBR B;  1BDO A;  5E4W C;  1STY A;  2B63 G;  3P7J A;  4PG3 A;  1ET9 A;  5D14 A;  2OTJ A;  2B63 H;  5C0X G;  4UP9 A;  4OEL B;  4R4O A;  1D5M C;  4DV6 Q;  4NW2 A;  5M5X H;  1Q46 A;  5CBE E;  3FMC A;  3TDQ A;  3I4N B;  1HFN A;  3S17 H;  1BOS A;  1BQQ T;  1S5B D;  3WOF A;  2IX3 A;  2I07 B;  3D4R A;  4G7H C;  2WAC A;  4IUV A;  1SFO H;  4FVM A;  5IWA Q;  1GM5 A;  1I4P A;  3M4O B;  3DWQ A;  1JR0 D;  1K8M A;  4A3B G;  4C3H G;  1BCP C;  1STH A;  1F9Q A;  1TS2 A;  2K5D A;  4MTK A;  4AQY L;  1B53 A;  1G51 A;  3GTO B;  1ML0 D;  1YZ6 A;  2I5H A;  1EY6 A;  2L12 A;  1AZQ A;  3BS1 A;  2MPM A;  4LFB Q;  3IL8 A;  3D4D A;  4KI0 A;  3J81 j;  1MJC A;  5C3X A;  4J8Q A;  1K0R A;  4LF6 Q;  4V19 0;  1IYU A;  3GTL H;  1IL8 A;  3A7L A;  5EKL A;  2F0M A;  2K75 A;  4PMB A;  4J6H A;  3ULL A;  1PDQ A;  4LF9 L;  4YWL A;  1RF2 D;  4X66 Q;  3J81 c;  1A3T A;  4RHR A;  4TKO B;  1F2Z A;  3K5L A;  3M3Y H;  5IY0 A;  4MNO A;  4ZQ3 A;  2L9H A;  3CHB D;  2YU9 B;  4BBR G;  1VQM A;  1FJG L;  3QWN A;  4A4I A;  3Q24 A;  5FO7 B;  1SR3 A;  2BCO A;  4BBR H;  1D1K A;  3I4M B;  2NTT A;  4O0A A;  4AH6 A;  1B4O A;  1MHW C;  1GVP A;  1AE3 A;  2NN6 G;  3OMG A;  4IOA A;  5H1S E;  4A3I G;  3SVM A;  4H0L C;  4DF7 A;  2F03 A;  1CK1 A;  2RQX A;  4ZCK A;  1VQH A;  1PRT D;  1PLF A;  1X3P A;  4A3J B;  2Z4I A;  4TRD A;  1Q86 C;  2RBM A;  2PZU A;  1PZK D;  3DEO A;  1PTO D;  2PMZ B;  2R92 B;  1H95 A;  3I4N H;  3HZX A;  1L0W A;  5M3M G;  4L6T B;  4CJ0 B;  3TBI B;  1S5E D;  1LM0 A;  3I55 A;  4RGO S;  1BCP F;  1RTN A;  4V0B A;  1S72 A;  1MIU A;  5IOD A;  3NE5 B;  2YTV A;  3M4O H;  4IJL A;  1RKN A;  5C0X I;  1YHA A;  1RCV D;  2ZM6 L;  4H02 A;  4JI7 L;  2Z9H A;  2MFI A;  4A3L G;  2EIF A;  3GTO H;  1IBM L;  2F0K A;  3AFP A;  4LF7 Q;  1LT5 D;  1Y1V G;  2HHH L;  1G6Z A;  1D2B A;  1KL9 A;  5C3W A;  1I4Q A;  1PZI D;  3RLN A;  3CCV A;  4DV3 L;  2KEE A;  3CAM A;  4DPG A;  3NPP A;  3W2D A;  2EZV A;  2F1M A;  1I50 B;  1Q81 C;  2CW0 C;  1U4P A;  2OXP A;  4ZRZ A;  2VXW A;  3DHQ A;  4X62 Q;  3CU7 A;  3QIA A;  4IUP A;  2AUK A;  4JI0 L;  5IT9 L;  3X3M A;  3K57 A;  1X3E A;  2QGQ A;  3P20 A;  3CCR A;  2D5D A;  3HRZ C;  2OQK A;  1RDP D;  1DGS A;  3TN2 A;  4K5X A;  1PH6 A;  1XYI A;  4M1U B;  3OIQ A;  1SSO A;  1O7Z A;  1SMY C;  2E2J B;  3I4M G;  4LK1 C;  4FNF A;  1MGS A;  4IFD J;  1SJE D;  3I4M H;  1VCI A;  2XVS A;  3D6W A;  1XPU A;  1WTQ A;  1LTS D;  4DK1 A;  4EQ5 A;  4DR2 L;  3UI2 A;  4L5R C;  2JA5 B;  1OXS C;  1L2F A;  5FLM G;  1B3Q A;  2AMC B;  1GJX A;  1TWA B;  2WKC A;  3NEM A;  2E2H B;  4A3J H;  1O80 A;  2R92 G;  1M4V A;  2R92 H;  2K5W A;  5FLX c;  4KY5 A;  2E76 C;  2WII B;  3QOL A;  1V1P A;  3CC7 A;  2VY3 A;  5KNB A;  1KAW A;  4IFD G;  1SRU A;  2Q2I A;  3UE0 A;  1M8A A;  4U67 3;  3GD7 A;  4XXE A;  4KKS A;  4ZLT F;  2NN6 I;  4ME5 A;  1Y1W B;  1SE8 A;  1GO3 E;  1VQJ A;  2AKW B;  2ZTC A;  5GAD C;  2DNE A;  1H9J A;  1T9H A;  3J81 E;  1HNZ L;  2EE1 A;  1TKW B;  4AYB G;  5KIX A;  1QNK A;  4ZYS A;  4AQY Q;  3MXN B;  3CCQ A;  3S2H B;  2PMZ E;  5JJL A;  3AQQ A;  2J7Z A;  3BVM A;  1XXG A;  2SOB A;  5J1Z A;  1BR9 A;  1YNN D;  5I9O A;  3IRB A;  2RA4 A;  4ZAI A;  1BNZ A;  4HTH A;  2B8G A;  2WB1 B;  5KNC A;  3GTQ B;  3SK4 A;  3I4L A;  2IY5 B;  3UDI A;  4LF9 Q;  3PUW A;  5DM7 3;  4DV4 L;  1BUV T;  4AYB E;  2KHS A;  3NK9 A;  2LS0 1;  4A75 A;  3PIO A;  1DJR D;  4UP8 A;  2L11 A;  2E2J H;  2R93 B;  3TP6 A;  5EBD A;  1OXT A;  1FJG Q;  1AZP A;  2F3V A;  2Z6K A;  1R9T B;  2KCC A;  2JA5 G;  1SMX A;  3KJO A;  2CKZ B;  4GLX A;  2JA5 H;  3KFU A;  1LTL A;  1YJW A;  2PZW A;  1OTC A;  1EYD A;  1JOO A;  1TWA H;  2E2H H;  4A3G B;  1E1T A;  1K8G A;  3BVG A;  3ZYY X;  2JA7 B;  3KLS A;  3HOW G;  2VW9 A;  1H9M A;  4QUC A;  2RVL A;  1TWF B;  1CM9 A;  4FXK C;  1YNX A;  4DGZ A;  1QUQ B;  4Q5V A;  4A93 G;  1Y1W H;  1C48 A;  4KY6 A;  3OWE B;  1G29 1;  1ESR A;  5A35 A;  4GOP A;  2Z8L A;  3VYT A;  3RZD B;  2ZM6 Q;  1JOK A;  3GTG B;  2F52 A;  3S2H H;  2F0T A;  4EQO A;  4Y52 H;  1JE4 A;  4K2K A;  1IBM Q;  3NEN A;  1B50 A;  2K5N A;  4DA2 A;  3OTO L;  4GNX A;  4IFD I;  4LUZ A;  2HHH Q;  1Q7Y C;  5M3F B;  1IZ6 A;  4DV3 Q;  3E0J A;  1WD0 A;  3RN5 A;  4A3C G;  4LJZ C;  4ZKC B;  3TP5 A;  1X65 A;  2I46 A;  1F2L A;  4KLK A;  2IHE A;  4WFN 3;  2BE5 C;  2UU9 L;  3I72 A;  3GTQ H;  4MTN A;  1TS4 A;  1E3P A;  3MHB A;  4JI0 Q;  1TWC B;  2B8F A;  1KC8 C;  1Z7T A;  1CTM A;  3UDG A;  4EQN A;  3TSS A;  4J15 A;  4JC0 A;  2A6E C;  1L0Y B;  5FLX E;  4N8F A;  2TMP A;  3DWA A;  4RHS A;  3PF4 A;  5IGB A;  4X3U A;  2R93 H;  2CWP A;  1QWY A;  4DV5 L;  1GUN A;  2CW0 D;  3J80 E;  1UE7 A;  4A3D B;  3H09 A;  1E2Z A;  3R2I A;  2JA6 G;  4QQB X;  5EAY A;  1R9T H;  4HCE A;  4APV A;  1JJG A;  4DR2 Q;  4A3G G;  3URY A;  1FNW A;  4PQX A;  4A3G H;  2JA7 G;  5CC4 A;  1BCP B;  4MZ9 A;  4JYA L;  4BA2 I;  5LL6 S;  2R61 A;  2JA7 H;  3K80 C;  1W6J A;  2K01 A;  2ZTD A;  1Z47 A;  2BH2 A;  2M00 A;  4OHJ A;  1TWF H;  4DUY L;  3A8K E;  3MFG A;  3F2U A;  1E2W A;  3TRZ A;  1OXU A;  2EYP A;  1D6E C;  5JAV A;  1K9M C;  4ALP A;  3CCJ A;  4IUU A;  1STG A;  1EWH A;  2GVB A;  5GAH C;  1MKH A;  1PHJ A;  3K7A B;  1HH2 P;  1XTC D;  3RZD H;  3PUX A;  1WFQ A;  3GTG H;  1SJH D;  1G91 A;  1E1O A;  2NZH A;  1HNZ Q;  5E3F A;  2LXJ A;  2G9H D;  5M3F G;  5CV5 A;  4R8I A;  2BH8 A;  1NNX A;  1VQA A;  1HJP A;  5M3F H;  3MEH A;  1WTR A;  1PYB A;  2ZJR A;  3MXP A;  4IUN A;  2AQ1 B;  4FF4 A;  4DR1 L;  1CKN A;  4JK1 C;  4GOP C;  1I5F A;  3J7Y W;  1SLJ A;  3RNU A;  5JPN C;  3R3O A;  4PV1 C;  4GNX C;  5AFW A;  1TWC H;  3ERQ A;  2OQ0 A;  2GN5 A;  1Q8I A;  1JWU D;  2X6L A;  4DV4 Q;  4KHP L;  1GOZ A;  2JE6 I;  1WTV A;  2EJF C;  2ZTE A;  4LNQ A;  4DR3 L;  1K83 B;  4A3D H;  3ULP A;  5C4X B;  2MNA A;  3I7F A;  5LMN L;  1QVF A;  1EQQ A;  1LTG D;  4RKL A;  1U5K A;  3S9W A;  2QDB A;  2E2D C;  5LMN W;  1SYF A;  5JEA H;  3TS0 A;  1C7Y A;  3HS0 C;  5IE8 A;  4DV1 L;  4LF5 L;  5I2X A;  1B1Z A;  1N36 L;  1UE6 A;  1D8L A;  1GUG A;  1X9N A;  4OWW B;  1LYL A;  1QVC A;  1HUN A;  1PTO C;  1A6X A;  2FMM A;  3EBE A;  2F0U A;  4DR4 L;  3BDC A;  2CH4 A;  5DNF A;  2B39 A;  3KDF B;  2FIN B;  1EQV A;  2F0O A;  4C3I B;  4NDX A;  4OWX B;  5KGU A;  2VUM B;  4B08 A;  1UEB A;  3KF6 B;  3NQI A;  4RCN A;  2PZT A;  4QY7 A;  2XRS D;  3K7A H;  1TQO A;  2XWB B;  2KCN A;  1II3 A;  1I4G A;  4JG2 A;  2VB3 X;  1I4X A;  1YNJ C;  3VYR A;  2MUY A;  2OEO A;  3PUY A;  1G2T A;  1T5E A;  4R4I A;  1DON A;  2F0L A;  2N8N A;  1S4Z A;  2B2V A;  3OTO Q;  2ZXP A;  2K05 A;  4IPG A;  4DK6 C;  1HQR D;  1Q82 C;  3U4Z A;  4ME3 A;  1STE A;  2XWJ B;  3OSO A;  4LUO A;  5GRO A;  5CMD A;  2RCF A;  4BA1 I;  1K73 C;  2QCP X;  4PMC A;  5IGE A;  3OMC A;  2UU9 Q;  5I2Y A;  1NCV A;  1VQE A;  4A3B B;  4C3H B;  1PV4 A;  2I5M X;  5CR3 A;  2F3I A;  3HOV G;  3VA5 A;  4CDC C;  1CZG A;  1S3O A;  5IP9 H;  4DR6 L;  1HA5 A;  3F2C A;  3J81 L;  2HT1 A;  3S1Q B;  1K83 H;  1CA6 A;  4L5S A;  2NVQ B;  3KBG A;  2BA0 A;  4CGY B;  5C4X H;  4DV5 Q;  5KRU A;  2MHV A;  2PQA A;  2BE5 D;  2EXZ A;  1D1I A;  1DOK A;  1E0B A;  1JQY D;  4QIW E;  3IKJ A;  5FKA C;  1PRT F;  2K7V A;  1JB7 A;  1PTO F;  3RR5 A;  4IPC A;  3C3L A;  3NP8 A;  4DR5 L;  4Q0F A;  1A2U A;  4GKK L;  2B2W C;  4JYA Q;  1EQT A;  1SE4 A;  1K0S A;  1J6Q A;  1SYB A;  1IBL L;  1V1O A;  3L7Z C;  5CYU A;  1WD1 A;  4DUY Q;  3F2D A;  1JCK B;  5EGT A;  4C3I H;  2VUM H;  1ET6 A;  4CKC A;  3HOY G;  5EBC A;  4F7X A;  1G2S A;  3MTS A;  2RSN A;  1H9S A;  2LMC B;  4PMW A;  4JBW A;  3W5O A;  2F0H A;  3A74 A;  3H94 A;  5C0X H;  4A3I B;  1GUS A;  3DEP A;  4TQU S;  4QGU A;  5IGC A;  3T16 A;  1D5Z C;  3Q6S A;  4DAP A;  4LF8 L;  1SRO A;  3FP9 A;  4WRD A;  1HTP A;  5M3M B;  1TXY A;  2R7Z G;  3I73 A;  1SNO A;  1WJJ A;  4UDU C;  1HA6 A;  3RMH A;  2R6G A;  2OCE A;  1ENC A;  2RHQ B;  1SND A;  1YNN C;  4DR1 Q;  4G7Z C;  3CF5 A;  1IW7 D;  1PFS A;  1N32 L;  3DXJ C;  4ZK9 B;  4A3B H;  2CHB D;  1Y8P B;  4C3H H;  3CME A;  2BOS A;  4KKT A;  3OW7 A;  4OWT B;  1KLG D;  4HIM A;  1C0A A;  4YCV A;  1Y1V B;  4KHP Q;  2A69 C;  4OEM B;  4RMF A;  3S1Q H;  3TEH B;  2NVQ H;  3NHH A;  1LAB A;  3JAM c;  1IYV A;  3T1Y L;  4DR3 Q;  5K36 G;  1SYG A;  5FO9 B;  5K36 H;  2Z1C A;  1TT2 A;  2AHO B;  4DU9 A;  1DYQ A;  1EY7 A;  5LMN Q;  2O4X A;  1WYD A;  2K6A A;  3TP7 A;  1FNV A;  3KF8 B;  3PGZ A;  3BJU A;  4DV1 Q;  1L1O B;  2JQO A;  4LF5 Q;  4XQQ A;  4HCS A;  1N36 Q;  2FHT A;  3NQT A;  4MIU A;  1EY5 A;  1PH2 A;  1KDB A;  3GQB A;  4UHV A;  4FF3 A;  4DR4 Q;  5GQO A;  1EYC A;  1X3F A;  5DEH A;  2XNA C;  4A3K G;  1I4H A;  2EY6 A;  2EYH A;  2Z0S A;  3BZC A;  3FEW X;  3NSW A;  5FLX L;  4JV5 Q;  3J80 i;  5IYD G;  1ZEQ X;  4A3F G;  3NBH A;  4DXF A;  3SE0 A;  3J80 L;  2NN6 H;  3CCS A;  4A3I H;  1W2B A;  3F8T A;  1AH9 A;  2EYM A;  3D4W A;  3K5M A;  2EVB A;  1KLU D;  4HJ7 A;  3KYH C;  3VR3 A;  5M3M H;  2JEA I;  3PSI A;  4X3S A;  1SNQ A;  4LFA L;  4IUQ A;  3MA2 B;  2MP1 A;  1SEB D;  1HTL D;  2EXD A;  4HR7 B;  2NYZ D;  1EIH A;  3T51 B;  4E6I A;  5IP7 G;  2HD3 A;  1O78 A;  1QG7 A;  1JWM D;  1PFB A;  5IP7 H;  1AW7 A;  4XQJ A;  3A8J E;  4K6L A;  1QNU A;  1YNJ D;  4ZKB B;  4F88 A;  4A3L H;  3ZJY C;  3W1B A;  4AYB B;  3AB9 A;  1SN8 A;  5T1G A;  4DAY B;  1LTR D;  1Y1V H;  2K5H A;  2YTY A;  1A2T A;  3C2P A;  3HKZ G;  3CPW A;  2K50 A;  2OTL A;  2SNS A;  4R8N A;  3K81 C;  1C8C A;  2UXB L;  2OF1 A;  4DR6 Q;  2EY2 A;  4OON A;  2CVR A;  3ONA B;  1KRS A;  3TZD A;  1O7Y A;  3T53 B;  1UNS A;  4QCL A;  4ID6 A;  1ROD A;  2KQ3 A;  3C46 A;  1LV9 A;  4DXG A;  4P75 A;  4NB3 A;  2FFK B;  4XDX A;  2F0J A;  2EOT A;  4RG1 A;  1A15 A;  1S5C D;  1OO9 B;  3E6Z X;  1WCM G;  1FGB D;  4NP5 A;  2L15 A;  5COY A;  1UEA B;  4BY1 G;  4FYD A;  3AU7 A;  1E7Z A;  1D5X C;  3MWY W;  4DR5 Q;  1VQ4 A;  4GKK Q;  2Q8R E;  4HED A;  5E7N A;  2HIX A;  2KHJ A;  2R3Z A;  3PCO B;  1NR2 A;  3HKZ E;  1UE1 A;  4I7Z C;  4XQN A;  1IBL Q;  3A56 A;  5I6Y A;  3CCE A;  3EQL C;  2JN4 A;  3S1R B;  2N78 A;  4P71 A;  2EYL A;  3RLF A;  3UDF A;  1WVL A;  2YYZ A;  4RCO A;  1E22 A;  5FLM H;  3PQI A;  4KHV A;  1VQ9 A;  3ERO A;  2Q2U A;  2WP8 J;  5C3E B;  2PI2 A;  1N9W A;  3J7A V;  2LSS A;  2LXK A;  3HOW B;  4UP7 A;  2N49 A;  1MJE A;  4QL5 A;  3NWS A;  3JAM E;  4LF8 Q;  3K0Y A;  4IFD H;  2PYK A;  1SNC A;  3I2Z A;  2AUJ D;  2NWG A;  5C44 B;  1JMC A;  5CV8 A;  2NVX B;  4OX9 L;  1OXX K;  4A93 B;  3NTK A;  1YHB A;  1EYA A;  2QIL A;  1K8A C;  3T4A C;  4RH6 A;  3EJI A;  1N32 Q;  1U4M A;  5L37 A;  1QOH A;  3O13 A;  2X6G A;  3AYH B; 
#chains in the Genus database with same CATH homology
 2AWN A;  2JA8 B;  3WOE A;  1F9P A;  3S2D B;  2AQ2 B;  1MSH A;  3VR2 A;  1PRT B;  2A74 C;  1QE6 A;  3PIP 3;  2IX0 A;  4BWG B;  3GTK B;  4FO2 A;  2F0F A;  2EPB A;  1Y69 U;  4K6D A;  4KY7 A;  3QO2 A;  1EY9 A;  3D31 A;  4NKL A;  4UAI A;  2ICE C;  4BBS B;  1LO5 D;  2A69 D;  2F0Q A;  2NB0 A;  3V05 A;  3BVZ A;  2F0E A;  3K59 A;  2KUM A;  4HSV A;  5CV7 A;  2M2L A;  5EJW A;  2IL8 A;  1R4P B;  3MXU A;  3AMU A;  2JA6 B;  4B9X A;  1LTI D;  1CQF A;  2RSO A;  1ILP A;  1EWC A;  1NUC A;  1IKM A;  1ESF A;  1AP0 A;  3S16 B;  1SXT A;  2ZXR A;  2B2Y A;  1RHP A;  3FPU B;  5I4D A;  5ELD A;  2EY1 A;  3QB3 A;  1DOL A;  2VB2 X;  2AWO A;  5TSS A;  5KYI A;  2XN9 C;  5C4H A;  1I3Q B;  3LWE A;  4ZUI A;  1TU2 B;  1CA5 A;  1BBX C;  1X32 A;  3U9S A;  3G6J B;  2QEJ C;  1ZKO A;  1Y8N B;  5EPJ A;  5IGF A;  1EY8 A;  3GV3 A;  5BN3 A;  4N9T A;  4KJN A;  2NVY B;  2PO4 A;  4LMQ D;  1WTX A;  2PPB C;  4DNT B;  3GO5 A;  1PTO H;  1QB5 D;  2GA4 B;  1FD7 D;  1NR4 A;  2F0G A;  3NXW A;  1TS3 A;  2EY5 A;  1LAC A;  4ODG A;  1AFP A;  1DXM A;  4RGT A;  1ZXT A;  1HHV A;  5J22 A;  3HGB A;  2F0P A;  3OOC A;  1H9K A;  4FF2 A;  1EIG A;  1KAB A;  4DNR B;  4IUR A;  1TVX A;  5NUC A;  4CHT B;  4TSS A;  3MXN A;  5EQ0 A;  1F9S A;  1TWH B;  4KJO A;  3DWP A;  3S15 B;  5LL6 X;  1B9M A;  4S3S A;  3ITP A;  4ILW A;  4FP5 D;  3R2T A;  3S14 B;  1KDA A;  1IW7 C;  2B2Y C;  1SE3 A;  4B9W A;  2K04 A;  1SYE A;  2WV6 D;  4XTC S;  1F2M A;  2C9O A;  1DOM A;  5IGG A;  2VNU D;  3KK7 A;  3BDL A;  1CQV A;  1Y8O B;  3FPP A;  1CFM A;  3DMU A;  2NTS A;  3PV0 A;  4QIW B;  3NBI A;  4Y7N B;  3FRP B;  5JVH 3;  3H3V C;  2N55 A;  4OO1 G;  3QG1 A;  3GTM B;  2F4I A;  1KDC A;  3D3R A;  1AEX A;  3Q23 A;  1JB3 A;  2KED A;  1EEF D;  3HOV B;  4K5V A;  1J8I A;  1HPC A;  1SYD A;  1SDF A;  1X3Q A;  3RZO B;  2E74 C;  3NWT A;  4CKB A;  1TY2 A;  2HDL A;  4X3K A;  2X69 A;  4EQP A;  3RD4 A;  2O2L D;  2J0T D;  4KV6 A;  4OGQ C;  3A8I E;  5IGD A;  1WTW A;  4KN7 C;  5HUR A;  3V2T A;  1UAP A;  3X3N A;  4A3M B;  5C5L A;  5JVG 3;  5M5W B;  3MZ5 A;  1SNP A;  3K58 A;  3N6R A;  1SNM A;  2B2T A;  4DAV A;  3HOY B;  1AN8 A;  1VF5 C;  1EU4 A;  4C3J B;  5IOC A;  2D9U A;  3VYU A;  2JXM B;  4DN4 M;  1LT6 D;  2HUG A;  2R7Z B;  2H4O A;  2K03 A;  5EKI A;  3J7A F;  3JAM L;  3KUP A;  1L0X B;  3PUV A;  1GUW A;  4RA8 A;  2Q8I B;  2BDO A;  1Q1B A;  4XT1 B;  3MFY A;  2A73 B;  5G3L F;  4O42 A;  3D8G A;  2EJG C;  1C4Q A;  1GUO A;  2G9D A;  2A5H A;  3DM1 A;  5CBA E;  1MD2 D;  4OO1 I;  3VR5 A;  1EEI D;  1DCZ A;  1V43 A;  2AQ3 B;  3LWU A;  4G7O C;  2F3W A;  3S1N B;  4L63 B;  2N88 A;  2F0I A;  2XIW A;  4EGV A;  2DN8 A;  1GUT A;  1GHJ A;  1A3V A;  4A3K B;  1JIC A;  3OPO A;  4R9W A;  4A3F B;  3PUZ A;  4C3J G;  3L9A X;  2SDF A;  1PYW D;  2IPK D;  2MJ8 A;  2Q8T A;  3HG9 A;  3VR6 A;  3G7L A;  2EYJ A;  3PIO 3;  3GTJ B;  5F2D A;  4IQZ A;  2L0C A;  2B2T C;  3NUC A;  1CHP D;  1RTO A;  1IHZ A;  4QMG A;  5I6W A;  4KMU C;  1W6K A;  4FXG C;  5E4X A;  2C5C A;  2B2V C;  2L5T A;  2NBF A;  2O5I C;  2EDG A;  4GZY C;  4C2M B;  1F2Y A;  1JOQ A;  5E1F A;  5FOB B;  4OIK A;  3NTI A;  3HKZ B;  3WDN A;  4H13 C;  5JPM C;  2F0D A;  4A3E B;  2L1B A;  1G8Z D;  1TII D;  5JJZ A;  2DNC A;  2A68 D;  4N9P A;  2RDH A;  5K5P A;  5T1I A;  5ELF A;  4EVO A;  4L8J A;  1CHQ D;  1JWS D;  2V4D A;  1WCM B;  2K32 A;  1KTK A;  1V1P B;  4BY1 B;  5COR A;  1EY4 A;  1O7L A;  2CQA A;  1VF7 A;  2L4N A;  3Q22 A;  1B3A A;  3MVV A;  2EYF A;  3FVQ A;  3D6C A;  2JEB I;  2A6H D;  4KHZ A;  5G3L D;  3HP3 A;  2O5J C;  1GHK A;  1EY0 A;  2RDF A;  2JP1 A;  3Q0A A;  5ELC A;  4F87 A;  3M7N A;  2WIN B;  2LY7 A;  5C6A A;  1FR3 A;  1EZ6 A;  2DY8 A;  4FXD A;  2IWH A;  3VYS A;  4F8M A;  2SEB D;  2PNR C;  3PO2 B;  1DD2 A;  4G57 A;  3BYT B;  5CV4 A;  2PW7 A;  4K5W A;  2B2U A;  5CV9 A;  3VA7 A;  3BYY B;  1HUM A;  4IUT A;  3IAY A;  3EA6 A;  1LT3 D;  3M7G A;  1ILQ A;  1J9O A;  2JSO A;  1PFN A;  2ZXO A;  3E5S A;  4X3T A;  4CKE A;  2TSS A;  4ZUJ A;  1K8O A;  2K28 A;  3BZD B;  2HQE A;  4KTA A;  2D62 A;  2HCC A;  1CZW A;  4HMI A;  4BY7 B;  4NMZ A;  1SYC A;  1WTP A;  1F77 A;  4MHE A;  3H6M A;  1ZYR C;  5ELE A;  5C4J B;  2JYO A;  1MSG A;  4C56 C;  1GXD C;  5A2Q E;  1PXU A;  5DAU A;  3M4Y A;  3PMF A;  3VR4 A;  3HOX B;  3P75 A;  2KVM A;  3IFD A;  2IJ0 A;  1I6V C;  4QB4 A;  3KF8 A;  1H9R A;  3KLS X;  1I4R A;  5KND A;  2ID0 A;  4HSP A;  4QF4 A;  1TY0 A;  4IZ8 A;  3SDZ A;  4IN3 A;  2NZ1 D;  3A54 A;  1I6H B;  1U9R A;  4KK7 A;  1F9R A;  4CJ2 C;  1PTO B;  1JOR A;  1NSN S;  3TME A;  2B2U C;  1BXT A;  3EFX D;  1KNE A;  1S5D D;  1Q1E A;  4WOR A;  5IIF A;  4HMJ A;  4K8I A;  4BS9 A;  5BN5 A;  2NUC A;  2IT1 A;  3KBX A;  3C1E A;  1SBB B;  4C1N K;  3BDO A;  1SAP A;  5CV6 A;  4XT3 B;  2PQE A;  1BCP D;  3SEB A;  4KD4 A;  4PNY A;  4HAE A;  3I70 A;  2WAQ B;  4RFB A;  4FF1 A;  3A7A B;  3K5N A;  5ELB A;  4DAY A;  4CJ1 B;  4H44 C;  1HXY D;  4I65 A;  1UUP A;  2Y0S B;  1CI3 M;  3NTH A;  4G4K A;  2K1B A;  2OT2 A;  3PO3 B;  1LTT D;  1S5F D;  5M5Y B;  1KAA A;  3LX0 A;  1E2V A;  2D2C C;  3SHL A;  2EYO A;  3RUZ A;  2J4X A;  2BDN A;  2F0V A;  3MC0 B;  1ONL A;  1PFM A;  2HDM A;  2LKV A;  2ZT9 C;  1EFI D;  2K33 A;  4Z9C B;  4K14 A;  5HGT A;  3BG3 A;  2EJM A;  4KN4 C;  1STB A;  1DZ1 A;  3KLR A;  4WJW A;  3P1H A;  1QIL A;  4KKU A;  3I91 A;  1LLR D;  1STA A;  5KEE A;  4KD3 A;  5D65 A;  1EU3 A;  1U4L A;  4U68 A;  2RDG A;  4XYQ A;  3QOJ A;  5FO8 B;  2BA1 A;  1EZ8 A;  1FNU A;  1DM0 B;  3A55 A;  2K5Q A;  2KA7 A;  2QF7 A;  3S1M B;  2KJX A;  4OL7 A;  2Z4H A;  4ULL A;  1RJT A;  1BF4 A;  3CQZ B;  2IX1 A;  3K5O A;  3L3O C;  3SK5 A;  4J1M A;  3CKI B;  1OXV A;  4DK0 A;  5J39 A;  1PZJ D;  2F0W A;  2KOL A;  2HCI A;  1HQM C;  1VMC A;  2E75 C;  3H0G B;  4P2C B;  1MI2 A;  3SK6 A;  2KEC A;  1MBY A;  3T56 B;  4RGM A;  1ZYR D;  4H7B A;  5EPK A;  4RKB A;  1VMP A;  3I8Z A;  3OWF A;  1SMY D;  3MAQ A;  1FYC A;  3DUZ A;  3CRK C;  3FKI B;  3TZU A;  5D3I B;  5I9P A;  1B9N A;  2H1E A;  1WTO A;  3GTP B;  2XRQ D;  3W3A A;  1B2T A;  3GV6 A;  1VDZ A;  2QKI C;  3CRL C;  1EOT A;  4M8A A;  4DFA A;  3H91 A;  2E2I B;  4XIG S;  5EPL A;  5ISR A;  1XWE A;  2DY7 A;  5M9O A;  5C5M A;  1A3U A;  2A68 C;  1T5X D;  4OO1 H;  3SR1 A;  2PCF B;  5LHY 1;  5KYL A;  5IT9 E;  5C4Z A;  5FK9 C;  2F0S A;  4ABN A;  3EVQ A;  1TWG B;  3I90 A;  4K8J A;  4MN3 A;  1CT1 D;  3HOZ B;  4HN7 A;  5JEA J;  1Z6H A;  2A6H C;  1IKL A;  1H9S B;  4OIJ A;  3SK8 A;  2F0N A;  3TP8 A;  1BO0 A;  1ICW A;  5CGK A;  3IFT A;  5D3D A;  4K2L A;  5EKK A;  2B2W A;  2LFN A;  2NVT B;  2ICI A;  3GP7 A;  5JEA G;  1R4Q B;  2MGS A;  4QUF A;  1HCZ A;  4CBV A;  1U4R A;  3HOU B;  2SNM A;  4RGN A;  1NAP A;  1PRT C;  4YIJ A;  3MXG A;  1ENA A;  2FJ2 A;  3T13 A;  1HRJ A;  5A2Q L;  3U9O A;  1LTA D;  1RD9 D;  2B63 B;  3K6O A;  3SXH A;  2ENB A;  5M5X B;  3R8B A;  4RWS C;  1B44 D;  2XSC A;  3S17 B;  1XX8 A;  1ENF A;  1TS5 A;  5JOB A;  1SFO B;  2M9V A;  4O1N A;  1SE2 A;  5DM6 3;  4RAU C;  1PMR A;  4C1N I;  3OHX C;  3HEJ A;  3QJY A;  2PW5 A;  1EL0 A;  1KNA A;  2IW3 A;  4IAL A;  4XYO A;  3R93 A;  1Q90 A;  3ND8 A;  3LNN A;  3V96 A;  1LT4 D;  2L55 A;  3C1F A;  1JC7 A;  3ND9 A;  1STN A;  3GTL B;  1V8Q A;  1Q12 A;  1QCB D;  1TR5 A;  2FMC A;  4LAA A;  3M85 A;  5BN4 A;  2A6E D;  3OIP A;  5C0X J;  3FDT A;  1LTB D;  1Q3L A;  2RKS A;  3M3Y B;  3I3C A;  1HFG A;  3N52 A;  1QJO A;  2WKD A;  4C3I G;  4BBR B;  1BDO A;  5E4W C;  1STY A;  3P7J A;  1ET9 A;  5D14 A;  5C0X G;  1D5M C;  4NW2 A;  5CBE E;  3FMC A;  3TDQ A;  3I4N B;  1HFN A;  1BOS A;  1BQQ T;  1S5B D;  3WOF A;  2IX3 A;  2I07 B;  3D4R A;  4G7H C;  2WAC A;  4IUV A;  4FVM A;  1I4P A;  3M4O B;  3DWQ A;  1JR0 D;  1K8M A;  4C3H G;  1STH A;  1BCP C;  1F9Q A;  1TS2 A;  2K5D A;  1B53 A;  3GTO B;  1ML0 D;  1EY6 A;  2L12 A;  1AZQ A;  3BS1 A;  2MPM A;  3IL8 A;  3D4D A;  4KI0 A;  5C3X A;  4J8Q A;  4V19 0;  1IYU A;  1IL8 A;  3A7L A;  5EKL A;  2F0M A;  4PMB A;  4J6H A;  1PDQ A;  1RF2 D;  1A3T A;  4RHR A;  4TKO B;  1F2Z A;  3K5L A;  4ZQ3 A;  2L9H A;  3CHB D;  2YU9 B;  3QWN A;  3Q24 A;  5FO7 B;  2BCO A;  3I4M B;  1D1K A;  2NTT A;  1B4O A;  2NN6 G;  3OMG A;  3SVM A;  4H0L C;  4DF7 A;  2F03 A;  1CK1 A;  2RQX A;  1PRT D;  1PLF A;  1X3P A;  4A3J B;  2Z4I A;  4TRD A;  2PZU A;  1PZK D;  2RBM A;  3DEO A;  1PTO D;  2PMZ B;  2R92 B;  3HZX A;  4L6T B;  4CJ0 B;  3TBI B;  1S5E D;  4RGO S;  1BCP F;  1RTN A;  4V0B A;  5IOD A;  3NE5 B;  1RKN A;  5C0X I;  1RCV D;  2F0K A;  1LT5 D;  1G6Z A;  1D2B A;  5C3W A;  1I4Q A;  1PZI D;  2KEE A;  3NPP A;  3W2D A;  2EZV A;  2F1M A;  1I50 B;  2CW0 C;  1U4P A;  2OXP A;  4ZRZ A;  2VXW A;  3DHQ A;  3CU7 A;  3QIA A;  4IUP A;  2AUK A;  5IT9 L;  3X3M A;  3K57 A;  3P20 A;  2D5D A;  3HRZ C;  1RDP D;  3TN2 A;  4K5X A;  1XYI A;  4M1U B;  3OIQ A;  1SSO A;  1O7Z A;  1SMY C;  2E2J B;  4LK1 C;  4FNF A;  1MGS A;  4IFD J;  1SJE D;  1VCI A;  2XVS A;  3D6W A;  1WTQ A;  1LTS D;  4DK1 A;  3UI2 A;  2JA5 B;  1OXS C;  1GJX A;  1TWA B;  2WKC A;  2E2H B;  1O80 A;  1M4V A;  2K5W A;  4KY5 A;  2E76 C;  2WII B;  3QOL A;  1V1P A;  5KNB A;  4IFD G;  1M8A A;  4U67 3;  3GD7 A;  4XXE A;  4KKS A;  4ZLT F;  2NN6 I;  4ME5 A;  1Y1W B;  2DNE A;  1H9J A;  3J81 E;  2EE1 A;  1TKW B;  5KIX A;  1QNK A;  4ZYS A;  3S2H B;  2J7Z A;  3BVM A;  1XXG A;  2SOB A;  5J1Z A;  1BR9 A;  1YNN D;  5I9O A;  2RA4 A;  4ZAI A;  1BNZ A;  4HTH A;  2B8G A;  5KNC A;  2WB1 B;  3GTQ B;  3SK4 A;  3I4L A;  3PUW A;  5DM7 3;  1BUV T;  2KHS A;  3NK9 A;  2LS0 1;  1DJR D;  2L11 A;  2R93 B;  3TP6 A;  5EBD A;  1OXT A;  1AZP A;  2F3V A;  1R9T B;  2KCC A;  2PZW A;  1EYD A;  1JOO A;  4A3G B;  3BVG A;  3ZYY X;  2JA7 B;  3KLS A;  1H9M A;  4QUC A;  2RVL A;  1TWF B;  1CM9 A;  4FXK C;  4DGZ A;  4Q5V A;  1C48 A;  4KY6 A;  3OWE B;  1G29 1;  1ESR A;  5A35 A;  2Z8L A;  3VYT A;  3RZD B;  1JOK A;  3GTG B;  2F0T A;  4EQO A;  1JE4 A;  4K2K A;  1B50 A;  4IFD I;  4DA2 A;  5M3F B;  3E0J A;  1WD0 A;  4LJZ C;  4ZKC B;  3TP5 A;  2I46 A;  1F2L A;  4WFN 3;  2BE5 C;  3I72 A;  1TS4 A;  3MHB A;  1TWC B;  2B8F A;  1Z7T A;  1CTM A;  4EQN A;  3TSS A;  2A6E C;  1L0Y B;  5FLX E;  2TMP A;  3DWA A;  4RHS A;  5IGB A;  4X3U A;  1QWY A;  1GUN A;  2CW0 D;  3J80 E;  4A3D B;  3H09 A;  1E2Z A;  3R2I A;  4HCE A;  3URY A;  1FNW A;  4PQX A;  5CC4 A;  1BCP B;  4BA2 I;  5LL6 S;  2R61 A;  1W6J A;  2K01 A;  1Z47 A;  2M00 A;  4OHJ A;  3A8K E;  3MFG A;  3F2U A;  1E2W A;  1OXU A;  2EYP A;  1D6E C;  5JAV A;  4IUU A;  1STG A;  1EWH A;  3K7A B;  1XTC D;  3PUX A;  1SJH D;  1G91 A;  5E3F A;  2G9H D;  5CV5 A;  4R8I A;  3MEH A;  1WTR A;  3MXP A;  4IUN A;  2AQ1 B;  4FF4 A;  4JK1 C;  3J7Y W;  5JPN C;  3R3O A;  4PV1 C;  5AFW A;  3ERQ A;  1Q8I A;  1JWU D;  2X6L A;  1GOZ A;  2JE6 I;  1WTV A;  2EJF C;  1K83 B;  5C4X B;  1LTG D;  4RKL A;  3S9W A;  2QDB A;  2E2D C;  1SYF A;  5JEA H;  3HS0 C;  5I2X A;  1B1Z A;  1GUG A;  1HUN A;  1PTO C;  1A6X A;  2FMM A;  2F0U A;  3BDC A;  5DNF A;  2B39 A;  2FIN B;  1EQV A;  2F0O A;  4C3I B;  4NDX A;  2VUM B;  5KGU A;  4B08 A;  3NQI A;  4RCN A;  2PZT A;  2XRS D;  1TQO A;  2XWB B;  2KCN A;  1II3 A;  1I4G A;  2VB3 X;  1I4X A;  1YNJ C;  3VYR A;  2MUY A;  2OEO A;  3PUY A;  1G2T A;  1T5E A;  1DON A;  2F0L A;  1S4Z A;  2B2V A;  2ZXP A;  2K05 A;  1HQR D;  1STE A;  2XWJ B;  3OSO A;  5CMD A;  4BA1 I;  2QCP X;  4PMC A;  5IGE A;  3OMC A;  5I2Y A;  1NCV A;  4A3B B;  4C3H B;  5CR3 A;  3VA5 A;  1CZG A;  1HA5 A;  3J81 L;  3S1Q B;  1CA6 A;  2NVQ B;  3KBG A;  2BA0 A;  4CGY B;  5KRU A;  2MHV A;  2BE5 D;  2EXZ A;  1D1I A;  1DOK A;  1E0B A;  1JQY D;  3IKJ A;  5FKA C;  1PRT F;  2K7V A;  1PTO F;  3C3L A;  3NP8 A;  4Q0F A;  1A2U A;  2B2W C;  1EQT A;  1SE4 A;  1SYB A;  1V1O A;  3L7Z C;  5CYU A;  1WD1 A;  1JCK B;  5EGT A;  1ET6 A;  4CKC A;  5EBC A;  4F7X A;  1G2S A;  3MTS A;  2RSN A;  1H9S A;  2LMC B;  4PMW A;  4JBW A;  2F0H A;  3H94 A;  5C0X H;  4A3I B;  1GUS A;  3DEP A;  4TQU S;  5IGC A;  3T16 A;  1D5Z C;  3Q6S A;  4DAP A;  4WRD A;  1HTP A;  5M3M B;  3I73 A;  1SNO A;  4UDU C;  1HA6 A;  3RMH A;  2R6G A;  1ENC A;  1SND A;  1YNN C;  4G7Z C;  1IW7 D;  3DXJ C;  4ZK9 B;  2CHB D;  1Y8P B;  2BOS A;  4KKT A;  3OW7 A;  1KLG D;  1Y1V B;  2A69 C;  3NHH A;  1LAB A;  1IYV A;  5K36 G;  1SYG A;  5FO9 B;  5K36 H;  2Z1C A;  1TT2 A;  4DU9 A;  1DYQ A;  1EY7 A;  2O4X A;  2K6A A;  3TP7 A;  1FNV A;  4XQQ A;  4HCS A;  2FHT A;  3NQT A;  4MIU A;  1EY5 A;  1KDB A;  3GQB A;  4FF3 A;  1EYC A;  5DEH A;  2XNA C;  1I4H A;  2EY6 A;  2EYH A;  3NSW A;  3FEW X;  5FLX L;  1ZEQ X;  3NBH A;  4DXF A;  3SE0 A;  3J80 L;  2NN6 H;  2EYM A;  3D4W A;  3K5M A;  2EVB A;  1KLU D;  3VR3 A;  2JEA I;  4X3S A;  1SNQ A;  4IUQ A;  3MA2 B;  2MP1 A;  1SEB D;  1HTL D;  4HR7 B;  2NYZ D;  1EIH A;  3T51 B;  4E6I A;  1O78 A;  1QG7 A;  1JWM D;  1PFB A;  1AW7 A;  4XQJ A;  3A8J E;  4K6L A;  1QNU A;  1YNJ D;  4ZKB B;  4F88 A;  4AYB B;  3AB9 A;  5T1G A;  1LTR D;  1A2T A;  3C2P A;  2SNS A;  4R8N A;  1C8C A;  2OF1 A;  2EY2 A;  2CVR A;  3ONA B;  3TZD A;  1O7Y A;  3T53 B;  1UNS A;  4QCL A;  4ID6 A;  1ROD A;  2KQ3 A;  3C46 A;  1LV9 A;  4DXG A;  2FFK B;  4XDX A;  2F0J A;  2EOT A;  1A15 A;  1S5C D;  1OO9 B;  3E6Z X;  1FGB D;  4NP5 A;  5COY A;  1UEA B;  4FYD A;  3AU7 A;  1D5X C;  3MWY W;  2Q8R E;  4HED A;  2R3Z A;  1NR2 A;  4I7Z C;  4XQN A;  3A56 A;  5I6Y A;  3EQL C;  3S1R B;  2EYL A;  3RLF A;  1WVL A;  2YYZ A;  4RCO A;  4KHV A;  3ERO A;  2WP8 J;  5C3E B;  3J7A V;  3HOW B;  3NWS A;  3JAM E;  3K0Y A;  4IFD H;  2PYK A;  1SNC A;  2AUJ D;  2NWG A;  5C44 B;  5CV8 A;  2NVX B;  1OXX K;  4A93 B;  3NTK A;  1EYA A;  2QIL A;  3T4A C;  4RH6 A;  3EJI A;  1U4M A;  1QOH A;  3O13 A;  2X6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...