5E4XA

Crystal structure of cpsrp43 chromodomain 3
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
50
structure length
50
Chain Sequence
b'YAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Signal recognition particle 43 kDa protein, chloroplastic
publication title Structural basis for cpSRP43 chromodomain selectivity and dynamics in Alb3 insertase interaction.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 4
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2015-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5e4xA00
1JE4A 2NWGA 3LWEA 3DEPA 5EPJA 1U4LA 5COYA 4QUCA 5JJZA 3MWYW 2B2VA 1G2TA 2B2WA 2X6GA 5EJWA 4IUVA 1RHPA 2K03A 1RJTA 2KOLA 4MHEA 1VMCA 2X6LA 2EE1A 1EQTA 4RAUC 3Q6SA 2SDFA 1WTOA 1NR4A 1XX8A 1KNAA 1MSGA 4CJ2C 4HAEA 1NAPA 2JP1A 2RSNA 3QO2A 1PDQA 1HUNA 3R93A 2L9HA 4X3UA 3H91A 1U4RA 1X3PA 2HCIA 1WD0A 3I8ZA 3KBXA 4X3KA 2RA4A 1RTOA 1F9QA 1VMPA 4R8IA 4ZLTF 1AZPA 2L11A 2L4NA 1G91A 1HFGA 1O7ZA 1AZQA 1CA6A 1WTWA 1S4ZA 1HUMA 1B4OA 1MI2A 1X3QA 1U4PA 2FINB 2MP1A 3DM1A 1ICWA 2D9UA 2K28A 5DNFA 1BNZA 4CJ1B 1E0BA 4HCSA 4IUQA 3I91A 1ESRA 1MSHA 2B2YC 1WVLA 2FFKB 1EIGA 4HEDA 2R3ZA 4R9WA 2FMMA 2B2TA 3UI2A 1HA6A 4RWSC 4UAIA 3P7JA 1HFNA 1X32A 2B2UC 2HDMA 4IUTA 4ZKCB 1WTXA 1WTRA 2KEDA 2N88A 2HUGA 5AFWA 4MN3A 1Q3LA 5E4WC 1WTPA 1IKLA 2K04A 1F9RA 1DONA 1EOTA 3KUPA 1G2SA 3F2UA 2IL8A 5D65A 4LMQD 3TZDA 2K1BA 1SAPA 1B50A 1O7YA 1ZXTA 5EPKA 2EPBA 1DZ1A 1F9PA 1ML0D 4DN4M 5EPLA 4ZK9B 1RTNA 1DOKA 3FDTA 1PFMA 1IKMA 2VXWA 4XT1B 1JICA 3G7LA 5CORA 1C8CA 1QNKA 1F9SA 2HCCA 2DY8A 1QG7A 4IUUA 1TVXA 2RSOA 4U68A 2X69A 4XT3B 2MPMA 2XIWA 3GV3A 2EOTA 1CA5A 2K05A 1B3AA 2L1BA 1HHVA 1DOMA 1F2LA 1U4MA 2B2WC 2B2VC 2Q8RE 4IURA 4X3SA 3FPUB 3IFDA 1EL0A 1A15A 3N52A 1G6ZA 5T1GA 1PFNA 2J7ZA 3I90A 2FJ2A 1PLFA 2DY7A 3D6WA 3SVMA 2B2YA 2M2LA 1SDFA 2N55A 3HP3A 2RVLA 3TN2A 2NYZD 4X3TA 1J8IA 3GV6A 4QUFA 2CVRA 1B53A 1NCVA 3ONAB 2B2UA 5D14A 5EQ0A 4CJ0B 1AP0A 5CBEE 1BBXC 1BF4A 1HRJA 2FHTA 2MGSA 5E4XA 1QE6A 4RA8A 1WTQA 1WTVA 4HSVA 1CM9A 1SSOA 3MTSA 4XDXA 5CMDA 1WD1A 1EIHA 2BDNA 4O42A 3DEOA 2H1EA 1NR2A 2NZ1D 1ILQA 2KEEA 4OIJA 5T1IA 1J9OA 2KUMA 3IL8A 4IUPA 1BO0A 1LV9A 2Q8TA 1IL8A 4ZKBB 1O80A 2KECA 2K01A 1KNEA 1PFBA 2JYOA 2L12A 2MJ8A 4NW2A 4OIKA 1GUWA 1RODA 4ZAIA 1ILPA 5EKIA 2HDLA 1B2TA 2B2TC 5CBAE 1DOLA 1MGSA 1XYIA 2KVMA 1M8AA 3I3CA
chains in the Genus database with same CATH superfamily
4A3BH 3LWEA 3MVVA 2E75C 2K6AA 3I55A 2XRSD 1I94Q 3VR4A 1IYVA 1V43A 3U50C 1H9MA 4IQZA 1NTGA 1KNAA 3HOWH 1KABA 3G48A 1IBML 5A2QE 2NZOA 1U4RA 1FL0A 3EFXD 4BA1I 3X3MA 1TWAH 2KHJA 4RKLA 4X62L 2EY6A 3NE5B 4OX9Q 2UXDL 2F4VQ 3RMHA 3S1RH 2FINB 2RDHA 1B4OA 4LUZA 1PTOD 1STAA 2N8NA 5C4XH 3B6YA 3K7AB 4KKUA 2VL6A 2AWNA 2EQSA 4YCVA 2RHQB 2K5DA 2FMMA 3KJOA 1LT5D 3MXUA 3C1EA 2XN9C 4R4IA 3GTQB 2KEDA 4MN3A 3A8IE 1Q3LA 1WTPA 4ZCKA 4OWWB 4PMWA 4RGMA 4EVOA 3VA7A 3HOVG 2CWPA 4F87A 4A3GB 4HIMA 5M3MH 1GM5A 5C5LA 1D5MC 2YU9B 4GNXC 4JI6Q 4XT1B 1G6ZA 3G7LA 2NBFA 2R7DA 1EYAA 4F88A 1N36Q 1E1OA 4A3GG 1LUZA 3S17H 2EY5A 3HOXH 4RGOS 1GO3E 2EY1A 1VF7A 3JAME 2SNMA 4DUYQ 1SNQA 3D6WA 1SDFA 3M4OB 4DR4Q 2K14A 1JJ2A 1S5FD 1PA6A 4A4IA 4LF5Q 1MJEA 2JA7H 5KIXA 1JOKA 4QL5A 2FHTA 4LUOA 2DNCA 4C2MB 2K5VA 4EQNA 4IO9A 2Q8IB 4A93G 4XDXA 3K7UC 1XMQQ 5IT9c 2Q2HA 2R7ZB 4QGUA 3OOCA 2WFWA 1O80A 1KNEA 4U673 3PO3H 3S15H 2F0HA 1Q12A 3ND8A 4BBSH 2XTIA 1EYCA 1A3UA 5TSSA 4POGA 3ERQA 1JB3A 2R7ZG 1G8ZD 4NXMQ 2F0VA 2QF7A 3M3YB 2K03A 3NTKA 1RJTA 2KOLA 5J3BA 4JI7L 1PTOF 1LTID 1K73C 1IBLQ 3RNUA 1MSGA 4N9PA 2JP1A 2IY5B 2ZT9C 3TP7A 2XWBB 1YVCA 3D4DA 3L7ZC 1QJOA 3PUZA 3F2CA 1RTOA 1Z7TA 4KK7A 1EY5A 4PNYA 2HD3A 2LSSA 1B7YB 4DNIA 3CXCA 3DM1A 5DM63 1JT8A 2L55A 4DK0A 3KBGA 2F0WA 4CJ1B 2NTSA 4PG3A 2EYLA 2AQ1B 4R9WA 4HJ5A 5E7NA 3IFTA 1A8VA 2EYOA 3CPWA 3GTKB 3CF5A 1FGBD 2Y0SB 4L63B 3NENA 3K81C 1PZKD 4P75A 1EOTA 1Q81C 1DXMA 4X65Q 5D65A 4DPGA 4OWTB 1VQAA 3WOEA 3HOZH 5EBDA 5G3LD 4YHHQ 2L0CA 5D3IB 2VXWA 2Y0SG 2RF4A 3NHHA 1KAWA 1D5ZC 1AFPA 3V05A 4JG2A 1HJPA 1CA5A 3GV3A 2EOTA 4YWKA 4A3BB 2EYHA 2F0EA 3OIQA 5M3FH 1SEBD 4IFDI 1QUQA 4IN3A 1V9PA 4DR7Q 4I7ZC 4QIWB 3HP3A 1BVSA 5JJKA 3QOJA 1A6XA 1TS5A 4HIOA 2BH8A 2UXBL 3S1NB 1K8MA 1YNJC 3HOWB 1STYA 2A6ED 2UUAQ 2K33A 4A3BG 3I56A 1SNDA 1UE7A 5NUCA 4JI5L 1TWAB 4AH6A 3K5OA 4O42A 1EWHA 1ILQA 1F2MA 5T1IA 3HS0C 1TS2A 3H0GH 3S1RB 5IIFA 2GN5A 1STEA 5C4XB 1X9NA 3KLSX 4CKEA 3HOWG 3M4QA 3FEWX 1Y14B 4DA2A 1HA5A 1CQFA 5JJZA 4A3MB 4WJ3M 1J6QA 4BY7H 5JEAJ 4C3JH 1RD9D 3MXNB 1YIJA 1LT3D 4MHEA 3UE1A 5C4XG 3GQBA 2WB1E 1NR4A 1II3A 3U9SA 1PXUA 2E76C 3F8TA 4LF8L 4ZQ3A 2Z6KA 5HY6A 1JMCA 2LXJA 4A3MG 4H02A 1CQVA 4DNRB 1I5FA 1LTAD 2BA1A 1TWGB 3CD6A 3S2HH 2ASBA 4B3RQ 2IT1A 3S17B 4QCLA 1BCPC 4KY5A 3HOXB 5G3LF 2AQ2B 4K2KA 3NBHA 5ELCA 4IPHA 4UAIA 1B3QA 3BDCA 1VQPA 4DV3L 2JA5H 2F0IA 1QZHA 3NELA 1OO9B 4LWCA 5IYBH 3GTPH 4XQJA 4HJ7A 2VUMB 2F0QA 1VQLA 2K1BA 2XVSA 1VQOA 1B50A 4IFDJ 3AU7A 3CRKC 5JJLA 2SEBD 4DAPA 1RTNA 1DOKA 3GD7A 4PZ7A 2E2JH 3S15B 4FO2A 3CP0A 1QG7A 3PSIA 5EKLA 1F2ZA 4LF9L 2VUMG 4BBSB 1HZCA 4IJLA 4DV2L 3CCJA 4JI1L 1LACA 1MHWC 3C1FA 1EY4A 1YZ6A 1N34L 3N6RA 3ULJA 2OQ0A 2JEBI 2UXCL 1SYGA 1J8IA 3AB9A 4LJZC 5ELBA 4CHTB 5BR8Q 2B2UA 1WYDA 4BBSG 3TEHB 5FLXL 5CBEE 3HGBA 1I4XA 5C4JH 2BDNA 4G7OC 4DK3C 4V0BA 2P5ZX 3TMEA 4IUPA 4DV5Q 3OTOQ 5LMNL 1K83H 1D8LA 1DJRD 3M4PA 1JB7A 2IX1A 4ZYSA 4GKKL 4Y52H 5CBAE 4EQPA 4K0KL 1Y8OB 4IPCA 4CKBA 4P74A 1ONLA 3I2ZA 3GTOH 1TWCH 3LX0A 2EYFA 2QGQA 1ICFB 4FF2A 4DR6L 1CZGA 3PF5A 4GS3A 1PH8A 1B70B 1E2VA 4C3HB 1XPUA 4JI4Q 3Q8DA 3NPPA 1EY6A 3GTGH 3CU7A 2PMZE 4ODGA 2L11A 1YITA 1HFGA 4LFCL 5IGBA 4GKJQ 2NVQH 1K8GA 4DR2L 5C4ZA 1L0XB 1PHJA 5CYUA 4C3HG 5M3FB 2A73B 2B2YC 2N3SA 3E0EA 4OL7A 4AYBE 5C44H 5C3EB 2EDGA 4XYQA 3R3OA 1SYCA 3OWFA 5C0XI 4IOAA 1F9RA 1QB5D 3A0JA 2RDGA 3KUPA 4BXXH 2IL8A 5M3FG 1EIFA 1VQ6A 2QCPX 4JOIC 3RLNA 1VQKA 1O7YA 2EPBA 3D4WA 3OMCA 2OQKA 2VQEQ 4UHVA 3H0GB 4HR7B 5C3EG 3J80L 3BVMA 5E3FA 4B3SQ 1Q8KA 5JAVA 3DXJC 4NMZA 1KDCA 3M7GA 1L1OB 1LTTD 2ZTDA 2L1BA 2MHVA 1IBKL 3L9AX 1F2LA 4ID6A 2B2WC 1O78A 2KHSA 3VYTA 1U5KA 5C3XA 1FNVA 4JI2L 3H0GG 4Z9CB 4JBKA 1M4VA 1D6EC 2D62A 3M7NA 4C3JB 3KYHC 4G4KA 1KXLA 4RHRA 3GV6A 2CVRA 1U0LA 1K8AC 3SK5A 2BH2A 4RFBA 1AE2A 4BWGB 5C0XG 1QE6A 1YHBA 2EYPA 1WTVA 1SSOA 2RDFA 5I6WA 5I4DA 5JVG3 4LF7Q 4O1NA 2H4OA 1EEID 1X6OA 1SNPA 1JJCB 3K7AH 2JYOA 1KTKA 4NW2A 3HOVH 3AYHB 2B2TC 4J6HA 4POFA 3ZJYC 1FJGQ 1JE4A 1LLRD 1CSQA 3GTQH 1BR9A 1G6PA 2B2VA 2WINB 2JA5B 4LFBQ 2YV5A 1J5EL 1C4QA 3G4SA 3E3XA 1SNMA 3H3VC 1XXGA 4DXFA 3M85A 2AKWB 2AMCB 1W2BA 1SE4A 1X56A 2C35B 4B3MQ 3MEFA 2K75A 4A3EB 5LMUQ 1ET9A 2HCIA 2YU9H 1Y69U 4JI3Q 3BYTB 4MTKA 2JA5G 3P1HA 2A74C 4XYOA 4IUNA 2UUCQ 1YHQA 4DR5L 2MP1A 2PZWA 2D9UA 5KGUA 2E74C 2KA7A 4A93H 4HCSA 3V96A 4A3EG 4A3DG 2MFIA 1X3GA 3CW2C 5IOCA 3HZXA 1A3TA 1EYGA 4OXPA 3VYRA 1B9MA 1PH7A 4FXKC 1BOSA 2AQ3B 1GVPA 2K7VA 2OTJA 3K8AA 2K50A 1ESFA 4GN4B 4JI0L 2MO0A 4UPAA 2R7ZH 1IHZA 2UU9L 1BBUA 2CQOA 4OGQC 3TP5A 1N32L 5IWAL 1D2BA 1KQSA 1HNZQ 3QB3A 3T1HL 1JQYD 2K05A 2F0UA 4RCOA 3VYSA 4IURA 3E5SA 1Q86C 3J81i 3MAQA 2KCMA 4R1JA 4DV0Q 2A6HC 1TWCB 3M3YH 1I6HB 2UUBQ 1STHA 2KQ3A 4NXNL 3NBIA 3PIPA 1PRTB 4IZ8A 4NPSA 1TS3A 3KDFB 4UDUC 4JV5Q 4DNTB 3GTGB 3MTSA 5CMDA 4GLVB 1NY4A 3BZDB 2Z4IA 3PUYA 2Z8LA 3OIPA 1LV9A 2ZXRA 3CKIB 3Q23A 3GTMB 1KDBA 2Y0SE 4OIKA 1ILPA 1B2TA 3NP8A 2ICEC 3NEMA 1V1QA 4WORA 1MGSA 2PMZB 5L37A 2ID0A 5CV9A 3A5ZB 2SOBA 2PQEA 5EKKA 1HNWL 4DR1Q 1QOHA 4RMFA 4QF4A 1R9TB 3GTLH 1VMCA 4RAUC 4JI8L 1EQTA 4AYBB 1BQQT 4DAVA 1XX8A 1YEZA 1EIYB 1KL9A 5KYLA 1F77A 4RKBA 4C56C 2QKIC 1TS4A 4BXXG 1G91A 4K5VA 5EAYA 4AYBG 3NTHA 1MI2A 4XTCS 1PRTD 4A3JH 3C3LA 3U58A 4KY6A 1NSNS 2YYZA 4GOPC 3C46A 5C5MA 1BXTA 3NWTA 5K36H 5IT9L 1L0WA 3SXHA 1N9WA 1WTHA 3S1NH 4J8QA 2RCNA 3FHWA 2JSOA 1PV4A 2M9VA 2PYKA 4BA2I 1TKWB 3H3VI 1BKBA 2IHEA 2DJGC 3ND9A 1G291 4JW0A 3TS0A 3QWNA 2EXZA 4DN4M 4X62Q 1B44D 3HOVB 4IFDH 2UXDQ 4TRDA 1C8CA 1HTPA 2VQFL 2NTTA 3MXNA 2KBNA 4XT3B 2XIWA 2K4KA 2Q8RE 3SHLA 1A2TA 4K8JA 4L5QA 1I50H 3JAMi 1SYEA 1K3BC 2ZM6L 3CMEA 4HJAA 4A3MH 2F0GA 1PLFA 4DAYB 2M2LA 1LT4D 2F0FA 3DUZA 1R4PB 2RVLA 1FVIA 1LM0A 1VDZA 1H9RA 3HOUH 1GHJA 2AUJD 2F0LA 5C3WA 4LFAL 1BBXC 3AMUA 1L0YB 1SJHD 4RCNA 2A69C 1JORA 1VQGA 1I4PA 1TWGH 2F0SA 5JOBA 3FKIG 3TRZA 2NVXB 2ALYB 2Q8TA 1E22A 1P8LA 3F2BA 2RKSA 3T13A 3PIP3 4JBMA 4A93B 2NVTB 4LF6L 3CHBD 3D0FA 5IYCH 4X64L 1K0SA 1IYUA 4HJ8A 3PV0A 1N36L 3O13A 3ER0A 5GAGC 2BE5D 2VS1A 3UDGA 5I2XA 3NUCA 2XRQD 2VUMH 3KF8B 1PRTF 3A8KE 2O2LD 4A3CH 4DR4L 2HT1A 3IAYA 1P16A 1ENFA 1X54A 4GN5A 4QJFA 3A56A 3TP8A 1K0RA 1TU2B 1JC7A 1F9QA 3CCLA 5IT9E 3PUWA 3EN2A 1HUMA 5KNBA 2MO1A 2CCZA 2K28A 2IWHA 3I4LA 3DMUA 4B08A 5FO9B 3UI2A 1GD7A 4K14A 1WTXA 1NUCA 2A68C 1Q7YC 5KNCA 4B3TL 3KJPA 4GLXA 1SMYC 1SAPA 1PYWD 1E2WA 3OHXC 3Q0AA 3NQTA 4ZK9B 2PO4A 3FDTA 1IBLL 1R4QB 2R92B 2FMCA 3AFQA 5CORA 5AJ3Q 1SNCA 2EJGC 4IUUA 2OWOA 1TVXA 2JE6I 2QA4A 1VQ7A 2YTYA 1XWEA 1JCKB 3FPUB 4FVMA 3MEHA 1M1KC 4LF4L 2M00A 3EVQA 3SE0A 3W5OA 1XNRL 1PH9A 2N55A 1S40A 2F0PA 2R92G 4DV6L 4X3TA 3GTLB 2CW0C 3M4YA 2OXPA 5DAUA 1GUSA 4C3HH 2NN6I 2F3VA 4N8FA 3S2DH 1UEBA 1NBWA 1NNXA 4YY3L 1N33L 1TT2A 1YNND 5M5XB 3MC0B 1H9SB 5HGQA 4A3JB 4GOPB 5JEAG 3K6OA 3J7ZC 1IL2A 2PZTA 1LYLA 4JC0A 2L9HA 3HRZC 2G9HD 2F0MA 5KYIA 5C3EH 1EY9A 3K0XA 3X3NA 5F2DA 2N49A 3I70A 1YJWA 4IUVA 5IGEA 2UXBQ 2WV6D 4A3JG 3KLWA 2LS01 2I46A 1KHIA 1L1OA 3BZCA 4EQ5A 4JI5Q 5ELOA 4HTHA 1S5BD 2E2DC 5K36G 2NN6G 4ILWA 4GN3B 3I8ZA 3DWAA 2F4IA 4OONA 4XQNA 4DV1L 4ZLTF 3MFYA 2NUCA 1O7ZA 4ZRZA 5C0XH 1OTCA 5CV8A 3W3AA 1V1PA 1I50B 1D1KA 3I91A 2FFKB 4HEDA 1PYBA 2JA8H 4IFDG 2PI2E 3KLSA 2CQAA 2OCEA 4ZKCB 3DLLA 3I7FA 4YWLA 3HOUB 1B9NA 4GNXB 1SXTA 1HZAA 2PCFB 3R2IA 1GXDC 4APVA 1FYCA 1I4RA 1VQJA 2B29A 3BVGA 5EPKA 3I4OA 1HNXL 2NZHA 2RQXA 2IPKD 4A3FG 2WACA 5LL6S 1JICA 1ZEQX 2F3IA 3HOUG 3NSWA 1F9SA 3WDNA 2GA4B 3OYYA 1VQ4A 2B63B 4LUVA 1LTSD 1DOMA 1GKHA 5IGGA 3EBEA 3K5NA 1L2FA 2DY7A 1OXXK 4DV3Q 3RZOB 3LNNA 1SE2A 2WKCA 3EROA 4MIUA 2ZJQA 4ZUJA 4A3EH 2B63G 4JVZA 3URYA 5IYCG 4A3DH 5ISRA 3T1YL 3BS1A 4DV7L 2AUKA 1D1IA 1ASZA 1C9OA 3KFUA 1GJXA 1HZ9A 3IL8A 1JWUD 4YWMA 4LF9Q 4DV2Q 2I07B 3J7AF 4A3CG 1CK1A 4JI1Q 2A69D 1FD7D 5CV6A 2KCNA 1JJGA 4CDFC 1XYIA 1ENCA 3CCMA 4DUZQ 1TWFH 2K32A 1N34Q 2NWGA 2RBMA 4BBRB 5IYDG 5E1FA 2UXCQ 3PIO3 4CBVA 4LNQA 1S5ED 4PZ6A 1STBA 5J39A 1EWCA 4J1MA 5GAEC 4CJ2C 1DD2A 3EIVA 4DF7A 3KOJA 3L3OC 1T5EA 2ZJRA 1XPRA 2ZXOA 1YBYA 1E24A 1HXYD 3PGZA 1SR3A 2Z1CA 4BBRG 3U9OA 3ERSX 1XMOL 3CCUA 5LMNQ 3OW7A 2XWJB 5CGKA 5JPMC 2GVAA 3HEJA 3AFPA 2PZUA 3G71A 4GKKQ 1ICWA 4K0KQ 3KDFA 5EBCA 1I6HH 1H95A 1FR3A 1VCIA 2LMCB 3CCSA 2IX3A 1HA6A 2VW9A 3D6CA 1HR0L 2XNAC 2B2UC 4RH6A 2A19A 2ENBA 5E4WC 4DR6Q 1XJVA 3OPOA 3F2UA 1SRUA 3S2DB 3H94A 1HPCA 3KF6A 4CDCC 4A76A 1ZXTA 2NB0A 5M5WH 1UEAB 2ZTCA 4K2LA 2E8GA 3GTMH 1PFMA 4AQYL 1PZID 4LFCQ 1SMXA 1IKMA 1Z9FA 3E0JA 1CKNB 1JWSD 1E7ZA 4M1UB 4JOIA 4FXGC 4TVAB 3P75A 1B3AA 1U4MA 4GLAC 2V1CC 1EQRA 3RZDB 3CQZB 4CGYB 4RHSA 3MZ5A 3I90A 2K5NA 1R9TH 5C4HA 3SK4A 3S16H 2K5QA 4A3IB 3MHBA 4OELB 1B53A 4FDBA 1WOCA 4KI0A 4L5SA 3A54A 1SJED 2EVBA 2R6GA 1WD1A 3A55A 1ET6A 5LMNW 3T51B 2CW0D 5H1SE 3HKZE 1DGSA 1E3PA 2NVYB 4A3IG 1PYSB 4ZKBB 1SFOB 3RLOA 1PFBA 5FLXE 3RD4A 4JYAL 3K0YA 1IBKQ 4P2CB 4M8AA 2JA8B 3T56B 4JI2Q 1EYDA 2VZAA 1HCZA 5IP7H 3IRBA 3QR8A 5I6YA 1RHPA 4RGNA 3GDEA 1KAAA 1WI5A 2BA0A 3QO2A 1YNXA 1PDQA 2JA8G 3R93A 5BN4A 1HUNA 1BCPB 1YNJD 2JQOA 5IP9H 3K59A 4G7ZC 2E2HH 4DAYA 4KJOA 3F2DA 1OXUA 3HKSA 3IKJA 3P20A 1WTWA 1EOVA 4DGZA 4G7HC 4LF7L 2A1AA 1O7LA 1RIPA 3I72A 2C5CA 1ESRA 3H3VH 1LT6D 1EIGA 3FKIH 3SR1A 4KHPL 5CV4A 3P7JA 1EU3A 1X32A 4IUTA 4CKCA 3T4AC 2VY3A 3J80i 1IKLA 4A3DB 4KKTA 3S1MH 4HN7A 3TZDA 1DYQA 2R7FA 5JVH3 2B39A 4WJ4A 2NVXH 1I4GA 4WRDA 5EPLA 2F1MA 5GQOA 4DR5Q 4B3ML 1QNKA 4AIMA 3TBIB 2NVTH 5LMUL 1VQ8A 3KF8A 5FO7B 1YJ9A 2B8FA 2QEXA 5KNDA 1TWFB 1WFQA 1UNSA 2B2VC 5DM73 2UUCL 1Q46A 1C0AA 3J80E 1BCPD 5ELNA 2J7ZA 3CC7A 2FJ2A 4FNFA 4DFAA 1Q82C 1CTMA 4A75A 1LTRD 3UDXA 1IW7C 1D5XC 2D2CC 4R4TA 4L6TB 5EQ0A 2MQHA 3CCQA 1XNQL 4Q0FA 1Y1VB 1VQEA 4Y7NB 2PNHA 4O0AA 5E4XA 3CMAA 1EIHA 3KK7A 3BZKA 1AE3A 2NZ1D 1N32Q 2KUMA 3K58A 5IWAQ 1TY0A 1GUNA 2R61A 1IL8A 2K01A 3T1HQ 4ZAIA 1G51A 5EKIA 3BYYB 1Y1VG 1S72A 1PMRA 1U9RA 1RKNA 1EEFD 4QQBX 4DV4L 4KN4C 4NXNQ 2HHHL 2X6GA 4ULLA 5J22A 1ENAA 1MJCA 1UUPA 4EGVA 2Z4HA 5D3DA 2LFNA 3Q6SA 1ZKOA 2WP8J 4K6DA 5M5WB 4FF4A 4NP5A 1GUGA 1Y1WH 2C9OA 4L5RC 1LTLA 4A3KB 1KRTA 2R92H 2R93G 2AWOA 3PCOB 3SGIA 4X66L 4KY7A 4PMCA 4K5WA 3HOYH 1HH2P 2E5LL 3J81c 1E0BA 1MSHA 3EA6A 1WVLA 3W2DA 2R3ZA 1FNUA 4A3KG 4KTAA 3ULPA 3S9WA 1HNWQ 1Q90A 4RWSC 4ABNA 3S16B 2A6EC 5JEAH 1MD2D 1H9SA 1VQBA 4JI8Q 4EX5A 2IX0A 5BN5A 1PZJD 3I4MG 1QILA 1NE3A 3PO2H 4DR1L 1QVGA 1BCPF 4MNOA 5M5XH 1F9PA 3GO5A 4UY8C 4P73A 4UP8A 4DR3L 4A3LG 5ELDA 1EY8A 1Y8PB 3QG1A 1JOOA 2DN8A 2A8VA 2RSOA 1ZYRC 3D8GA 4Q5VA 4TKOB 2NN6H 3HKZB 2JEAI 3E6ZX 2ZXPA 2KENA 2ZJPA 4KV6A 3VR3A 1IBMQ 4BS9A 3KLRA 2PPBC 1I94L 1LTGD 2IW3A 4QUFA 4CJ0B 5CC4A 3TQYA 1AP0A 4GZYC 3HKZG 4ME5A 1YI2A 2B8GA 3QOLA 2E2HB 1CM9A 5IP7G 1K8OA 2CFMA 4PQXA 4KN7C 2H1EA 1T9HA 1J9OA 5IGDA 2VQFQ 3AEVA 2MJ8A 4RG1A 5K5PA 5I9PA 2IJ0A 4OX9L 1GUWA 1OXTA 1D7QA 3D31A 4GNXA 2F4VL 1A62A 3FKIB 1XTDA 2YTXA 5IP9G 2KVMA 4N8X1 3UE0A 2ZM6Q 2BCOA 3DEPA 1N8RC 3RN5A 3M9BA 4A3FH 1M90C 2ZTEA 3RR5A 2XGTA 5FK9C 1G2TA 4KD4A 2HIVA 3K80C 3A7LA 1NMFA 3LWUA 5M9OA 3ICEA 3OMGA 3S1MB 1ASYA 4LFAQ 5IGFA 2EXDA 2L5TA 1K28A 2F03A 4PZ8A 3WWVA 4JK1C 1X3PA 2QEJC 1EZ6A 1I3QH 3TSSA 4OO1I 4X3KA 1O7IA 2OT2A 2B63H 1AZQA 4JI6L 3MXGA 3C2PA 1F2YA 4EQOA 3Q24A 4LF6Q 4X64Q 4R4OA 5FJ8H 3JAMc 4HSPA 2FXQA 4JCVE 3RZOH 1KIXA 3T53B 1S5CD 2F0JA 5A35A 1MIUA 4R4CA 4DUYL 1WTRA 2N88A 3VR5A 4L8JA 2OF1A 2G5DA 5JJIA 2CHBD 2EJFC 1LO5D 1G2SA 3MA2B 3TP6A 4LF5L 1EUJA 3GTJH 2PNRC 5IYDH 1DZ1A 2CKZB 3S1QB 1PVOA 4FXDA 1XMQL 4LK1C 3WOFA 3VYUA 1VQDA 1YHAA 4OO1G 4YCWA 5DEHA 2V4DA 1VQNA 1Q1BA 1HHVA 4JI7Q 4BBRH 1KRSA 1CKOA 4K5XA 1PFNA 1X55A 4CDDC 1EQVA 1Z47A 2DNEA 2KCCA 4B3TQ 1SE8A 5CV5A 5I2YA 4NXML 4PMBA 1E2ZA 3ONAB 3W1GA 3NXWA 5FLMH 1SLJA 1TQOA 3DWQA 4OWXB 1Y1WB 1V1OA 5ELEA 1BDOA 4DKAC 1IW7D 1DCZA 2Z0SA 2KEEA 3E9IA 2H5XA 3RLFA 4YIJA 2BOSA 4IJHA 3HOYB 3PUXA 1DOLA 1Y1WG 4XIGS 4TSSA 3FMCA 1OXVA 4LF4Q 4J15A 5AJ3L 3PF4A 1CT1D 3CC4A 1XNRQ 4C1NK 2VB3X 4DV6Q 3OW2A 1RL2A 1A63A 1NMGA 4R8NA 5EJWA 5C6AA 1EY0A 3L2PA 3TREA 3HOYG 1CKNA 2A6HD 3PIOA 3PO2B 4O2DA 4HCEA 2DUDA 3FRPB 4X65L 2OTLA 1N33Q 4YY3Q 2RHSB 2N78A 4H13C 4FYDA 4JBJA 1KD1C 3KBXA 4YHHL 2D0PA 3VR6A 4R8IA 1LABA 3S14B 2EYMA 3G6EA 1S4ZA 4LW1A 4UP9A 3PO2G 3RZDH 2EY2A 3CQZH 3RUZA 3STBC 3UDFA 2PQAB 2B3GA 5HURA 4HMJA 3T16A 1CHPD 1PH6A 1HFNA 4A3IH 5KEEA 2F0TA 4QMGA 4DR7L 4ALPA 2F52A 1E1TA 2OEOA 4LMQD 3D4RA 2UUAL 3J7AV 3LGJA 1IYJB 1X3EA 4QY7A 4DV1Q 1SFOH 2NVYH 3NK9A 2K5HA 2WAQE 1CI3M 5IE8A 1HQMC 4XXEA 2TMPA 3J81j 2Z6BA 4NDXA 1JE5A 1UE5A 4U68A 1IZ6A 2X69A 3QIAA 1CFMA 2PI2A 3HG9A 3A74A 1FNWA 4X3SA 4A3FB 3AQQA 1SN8A 3NWSA 2J0TD 1A15A 1PH2A 1VS0A 2VNUD 1EL0A 5T1GA 1VQMA 4WFN3 1EZ8A 1WCMH 1X65A 1RDPD 1L1OC 1ZYRD 2JA6H 2CWAA 1S3OA 1NCVA 1K3RA 4LF8Q 2G9DA 2HQLA 1WJJA 3VA5A 3QJYA 4RGTA 1EQQA 4OHJA 1I3QB 4RA8A 1A3VA 1HNXQ 1RF2D 4KJNA 4L5TA 2KJXA 1VQFA 3MFGA 4OIJA 1Q1EA 1SYBA 5M3MB 4UP7A 2KECA 4R4QA 4X6AH 4TQUS 1QCBD 2RCFA 1QNUA 2EZVA 3BG3A 1UAPA 4B3RL 5JPNC 3I4NH 5EPJA 2O5IC 4N9TA 5COYA 2QILA 2LXKA 1NJIC 5M3MG 2Z6KC 1LTBD 1AEXA 3OWEB 5FJ8G 3GTJB 3FPPA 3T1YQ 2E2IH 1UE1A 2F0DA 4DV7Q 2JA7B 4JBWA 3HOXG 2Q2TA 3DHQA 2RA4A 4C1NI 4HIKA 2F3WA 4NB3A 1CSPA 1IXRA 1VMPA 1EY7A 1DM0B 4I65A 2XSCA 1X3QA 5J1ZA 1EFID 1U4PA 4CDEC 3DWPA 2VB2X 3PO3B 4IUQA 1VF5C 2JA7G 3K57A 1HTLD 3K5MA 2QDLA 4DUZL 2ES2A 1Y1VH 3NTIA 2K04A 4Y7NH 1PH3A 4S3SA 3D3RA 5BR8L 2EYJA 3PO3G 3EQLC 4FP5D 4C3IH 1AH9A 2SNSA 2HIXA 1XMOQ 4FF3A 4H7BA 4DK1A 3CCRA 1TWHH 1SE3A 3J7A5 5FLMG 4DV5L 1XTCD 3OTOL 2L15A 4F8MA 2YTVA 2O4XA 5IODA 2LKVA 2J4XA 2MPMA 2MUYA 2F0OA 4JPBW 4YCUA 3RN2A 2R93H 5GROA 1I4QA 3IFDA 1HR0Q 3TDQA 1W6KA 3DM3A 3CRLC 2B2YA 1QVFA 2Q2UA 4DXGA 4B9WA 1C48A 2K52A 4KKSA 2QDBA 1H9KA 1UWVA 2A68D 5LHY1 2JA9A 4A3KH 4H44C 1BF4A 5HGTA 2MGSA 4BY1H 3JC66 1VQHA 4JI4L 4DR2Q 5BN3A 3HOZB 1SMYD 4AQYQ 1W3SA 1PRTC 4P71A 1SBBB 3FVQA 3I4MH 4K8IA 4GKJL 2I5HA 1OXSC 1TR5A 1W6JA 1TY2A 4NKLA 2WKDA 3I3CA 4A3LH 1V8QA 4DK6C 3HOZG 1KLUD 2B2WA 4HMIA 3ZYYX 3UDIA 4G57A 4HJ9A 2EJMA 3BJUA 3EJIA 1WTOA 1PTOH 1NAPA 1CKMA 1PTOC 3BDOA 4X3UA 3H91A 1WD0A 1QUQB 4WJWA 2VQEL 5FKAC 2CH4W 1GUOA 1AZPA 3TS2A 2L4NA 4JYAQ 4B3SL 4QB4A 4PV1C 4KHZA 3ULLA 1BNZA 1UE6A 5M5YH 5FLXc 1JR0D 4IPGA 4XQQA 5DNFA 2WAQB 2A5HA 5GAHC 1HQRD 1AW7A 2Z9HA 1HR0W 3VDYA 2B2TA 2PW7A 1WCMB 3OSOA 3U4ZA 2EIFA 2I5LX 1SYFA 3V2TA 2CH4A 2JA6B 5AFWA 1K9MC 1JOQA 2F0NA 1MKHA 1XPOA 3HFZB 4BY7B 3STBD 2WAQG 3SDZA 1S5DD 3Q22A 1WCMG 1ML0D 5CV7A 1Y8NB 3PQIA 5CR3A 2HQEA 1V1PB 2WIIB 1EU4A 1HZBA 2JN4A 1EFWA 5DLQE 2JA6G 1KC8C 3CCEA 4HIDA 2LY7A 2DY8A 3TZUA 2DGYA 2WB1B 2KCTA 2IHFA 3CPFA 4BY7G 4C3JG 3K5LA 4KHVA 3S2HB 1CUKA 5I9OA 4KHPQ 3I4NB 1J5EQ 3R2TA 2BE5C 1FJGL 3N52A 1BUVT 2DJFC 5IGCA 1BBWA 5EGTA 4ZUIA 3TN2A 3BU2A 4LFBL 2WB1G 1CZWA 3U4VA 5D14A 1GOZA 2E2IB 3R8BA 3J81L 3I4NG 3GTPB 1VQ9A 2GVBA 1QZGA 4A3GH 3NBHB 1WTQA 4HSVA 2PW5A 1Z6HA 2ICIA 4IOCA 1B1ZA 4KLKA 1SNOA 4MTNA 4JI3L 4I7AA 4E6IA 4H0LC 3G6JB 3I73A 2MNAA 3GP7A 3MXPA 2E2JB 1RODA 1TXYA 2HDLA 2F0KA 4ME3A 1Q8IA 5IYBG 3ITPA 5C0XJ 1T5XD 2L12A 1VQCA 1U4LA 4QUCA 3J80c 3MWYW 4OO1H 1VQIA 4JI0Q 2QW7A 3F1ZA 2D0OA 1FGUA 3M4OH 3BVZA 1XNQQ 2UU9Q 2X6LA 2EE1A 2AHOB 2K5WA 2SDFA 4IALA 3A5UA 1H9JA 3VR2A 4C3IB 4HAEA 1KLGD 2RSNA 1GUTA 3H6MA 5IY0A 3S1QH 4KD3A 4F7XA 4C2MH 3CAMA 1TWHB 1A2UA 1TIID 2Q2IA 4V190 3PMFA 1I4HA 2D5DA 5C4JB 3PUVA 2ATWA 3H09A 1CA6A 1K83B 4C3IG 2R93B 5A2QL 4P72A 3SEBA 1HNZL 1A0IA 4DV4Q 3E9HA 5FO8B 1QVCA 2HHHQ 3SK8A 2HDMA 4DV0L 2HUGA 2JXMB 1CHQD 2UUBL 3W1BA 3S24A 3CCVA 3GTOB 1DONA 1PH5A 4KMUC 1STNA 4BY1B 1VQ5A 1YNNC 3H15A 1SROA 4JV5L 3FP9A 3A8JE 1GHKA 3SK6A 3NQIA 2I5MX 4MZ9A 4X66Q 4FF1A 1STGA 5ELFA 1RCVD 2BDOA 3I4MB 4LAAA 2HCCA 1YJNA 1EWIA 2E5LQ 4OEMB 1B8AA 1JWMD 1KDAA 1X3FA 4BY1G 4DU9A 5KRUA 1PH4A 5LL6X 2NVQB 4DAMA 3L0OA 2I0QA 2JK8A 3J81E 1PH1A 4IPDA 2TSSA 1I6VC 3KF6B 4GOPA 3SVMA 2KHIA 3BDLA 2NYZD 3GTKH 5C44B 1QWYA 1MBYA 3CC2A 2O5JC 1AN8A 1PTOB 3J7YW 3JAML 1HRJA 1PFSA 3A7AB 2PQAA 1SYDA 4DR3Q 5GADC 3S14H 3DEOA 1NR2A 4B9XA 1BO0A 5C44G 5M5YB 2JJQA 5FOBB 4K6LA 4QIWE 1C7YA 1M8AA
chains in the Genus database with same CATH topology
3LWEA 3MVVA 2E75C 2K6AA 2XRSD 3VR4A 1IYVA 1V43A 1H9MA 4IQZA 1KNAA 1KABA 5A2QE 1U4RA 3EFXD 4BA1I 3X3MA 4RKLA 2EY6A 3NE5B 3RMHA 2FINB 2RDHA 1B4OA 1PTOD 1STAA 3K7AB 4KKUA 2AWNA 2K5DA 2FMMA 1LT5D 3MXUA 3C1EA 2XN9C 3GTQB 2KEDA 4MN3A 3A8IE 1Q3LA 1WTPA 4PMWA 4RGMA 4EVOA 3VA7A 4F87A 4A3GB 5C5LA 1D5MC 2YU9B 1G6ZA 4XT1B 3G7LA 2NBFA 1EYAA 4F88A 2EY5A 4RGOS 2EY1A 1VF7A 3JAME 2SNMA 1SNQA 3D6WA 1SDFA 3M4OB 1S5FD 5KIXA 1JOKA 2FHTA 4C2MB 2DNCA 4EQNA 2Q8IB 4XDXA 2R7ZB 3OOCA 1O80A 1KNEA 4U673 2F0HA 1Q12A 3ND8A 1EYCA 1A3UA 5TSSA 3ERQA 1JB3A 1G8ZD 2F0VA 2QF7A 3M3YB 2K03A 3NTKA 1RJTA 2KOLA 1PTOF 1LTID 1MSGA 4N9PA 2JP1A 2ZT9C 3TP7A 2XWBB 3D4DA 3L7ZC 1QJOA 3PUZA 1RTOA 1Z7TA 4KK7A 1EY5A 4PNYA 3DM1A 5DM63 2L55A 4DK0A 3KBGA 2F0WA 4CJ1B 2NTSA 2EYLA 2AQ1B 4R9WA 3IFTA 2EYOA 3GTKB 1FGBD 2Y0SB 4L63B 1PZKD 1EOTA 1DXMA 5D65A 3WOEA 5EBDA 5G3LD 2L0CA 5D3IB 2VXWA 3NHHA 1AFPA 1D5ZC 3V05A 1CA5A 3GV3A 2EOTA 4A3BB 2EYHA 2F0EA 3OIQA 1SEBD 4IFDI 4IN3A 4I7ZC 4QIWB 3HP3A 3QOJA 1A6XA 1TS5A 3S1NB 1K8MA 1YNJC 3HOWB 1STYA 2A6ED 2K33A 1SNDA 5NUCA 1TWAB 3K5OA 4O42A 1EWHA 1ILQA 1F2MA 5T1IA 3HS0C 1TS2A 3S1RB 5IIFA 1STEA 5C4XB 3KLSX 4CKEA 3FEWX 4DA2A 1HA5A 1CQFA 5JJZA 4A3MB 5JEAJ 1RD9D 1LT3D 4MHEA 3GQBA 1NR4A 1II3A 3U9SA 1PXUA 2E76C 4ZQ3A 1CQVA 4DNRB 1LTAD 2BA1A 1TWGB 2IT1A 3S17B 4QCLA 1BCPC 4KY5A 3HOXB 5G3LF 2AQ2B 4K2KA 3NBHA 5ELCA 4UAIA 3BDCA 2F0IA 1OO9B 4XQJA 2VUMB 2F0QA 2K1BA 2XVSA 1B50A 4IFDJ 3AU7A 3CRKC 2SEBD 4DAPA 1RTNA 1DOKA 3GD7A 3S15B 4FO2A 1QG7A 5EKLA 1F2ZA 4BBSB 1LACA 3C1FA 1EY4A 3N6RA 2JEBI 1SYGA 1J8IA 3AB9A 4LJZC 5ELBA 4CHTB 2B2UA 5FLXL 5CBEE 3HGBA 1I4XA 2BDNA 4G7OC 4V0BA 3TMEA 4IUPA 1DJRD 2IX1A 4ZYSA 5CBAE 4EQPA 1Y8OB 4CKBA 1ONLA 3LX0A 2EYFA 4FF2A 1CZGA 1E2VA 4C3HB 3NPPA 1EY6A 3CU7A 4ODGA 2L11A 1HFGA 5IGBA 5C4ZA 1L0XB 5CYUA 4C3HG 5M3FB 2A73B 2B2YC 4OL7A 5C3EB 2EDGA 4XYQA 3R3OA 1SYCA 3OWFA 5C0XI 1F9RA 1QB5D 2RDGA 3KUPA 2IL8A 2QCPX 1O7YA 2EPBA 3D4WA 3OMCA 3H0GB 4HR7B 3J80L 3BVMA 5E3FA 5JAVA 3DXJC 4NMZA 1KDCA 3M7GA 1LTTD 2L1BA 2MHVA 3L9AX 1F2LA 4ID6A 2B2WC 1O78A 2KHSA 3VYTA 5C3XA 1FNVA 4Z9CB 1M4VA 1D6EC 2D62A 3M7NA 4C3JB 4G4KA 4RHRA 3GV6A 2CVRA 3SK5A 4RFBA 4BWGB 5C0XG 1QE6A 2EYPA 1WTVA 1SSOA 2RDFA 5I6WA 5I4DA 5JVG3 4O1NA 2H4OA 1EEID 1SNPA 4NW2A 2JYOA 1KTKA 2B2TC 4J6HA 1JE4A 1LLRD 1BR9A 2B2VA 2WINB 2JA5B 1C4QA 1SNMA 3H3VC 1XXGA 4DXFA 3M85A 1SE4A 4A3EB 1ET9A 2HCIA 1Y69U 3BYTB 3P1HA 2A74C 4XYOA 4IUNA 2MP1A 2PZWA 2D9UA 5KGUA 2E74C 2KA7A 4HCSA 3V96A 5IOCA 3HZXA 1A3TA 3VYRA 1B9MA 4FXKC 1BOSA 2AQ3B 2K7VA 1ESFA 1IHZA 4OGQC 3TP5A 1D2BA 3QB3A 1JQYD 2K05A 2F0UA 4RCOA 3VYSA 4IURA 3E5SA 3MAQA 1I6HB 2A6HC 1TWCB 1STHA 2KQ3A 3NBIA 1PRTB 4IZ8A 1TS3A 4UDUC 4DNTB 3GTGB 3MTSA 5CMDA 3BZDB 2Z4IA 3PUYA 2Z8LA 3OIPA 1LV9A 2ZXRA 3CKIB 3Q23A 3GTMB 1KDBA 4OIKA 1ILPA 1B2TA 3NP8A 2ICEC 4WORA 1MGSA 2PMZB 2ID0A 5CV9A 2SOBA 2PQEA 5EKKA 1QOHA 4QF4A 1R9TB 1VMCA 4RAUC 1EQTA 4AYBB 1BQQT 4DAVA 1XX8A 5KYLA 1F77A 4RKBA 4C56C 2QKIC 1TS4A 1G91A 4K5VA 3NTHA 1MI2A 4XTCS 1PRTD 3C3LA 4KY6A 1NSNS 2YYZA 3C46A 5C5MA 1BXTA 3NWTA 5K36H 5IT9L 3SXHA 4J8QA 2JSOA 2M9VA 2PYKA 4BA2I 1TKWB 3ND9A 1G291 3QWNA 2EXZA 4DN4M 1B44D 3HOVB 4IFDH 4TRDA 1C8CA 1HTPA 2NTTA 3MXNA 4XT3B 2XIWA 2Q8RE 3SHLA 1A2TA 4K8JA 1SYEA 2F0GA 1PLFA 2M2LA 1LT4D 2F0FA 3DUZA 1R4PB 2RVLA 1VDZA 1H9RA 1GHJA 2AUJD 2F0LA 5C3WA 1BBXC 3AMUA 1L0YB 1SJHD 4RCNA 2A69C 1JORA 1I4PA 2F0SA 5JOBA 2NVXB 2Q8TA 2RKSA 3T13A 3PIP3 4A93B 2NVTB 3CHBD 1IYUA 3PV0A 3O13A 2BE5D 5I2XA 3NUCA 2XRQD 1PRTF 3A8KE 2O2LD 3IAYA 1ENFA 3A56A 3TP8A 1TU2B 1JC7A 1F9QA 5IT9E 3PUWA 1HUMA 5KNBA 2K28A 2IWHA 3I4LA 3DMUA 4B08A 5FO9B 3UI2A 4K14A 1WTXA 1NUCA 2A68C 5KNCA 1SMYC 1SAPA 1PYWD 1E2WA 3OHXC 3Q0AA 3NQTA 4ZK9B 2PO4A 3FDTA 1R4QB 2R92B 2FMCA 5CORA 1SNCA 2EJGC 4IUUA 1TVXA 2JE6I 1XWEA 1JCKB 3FPUB 4FVMA 3MEHA 2M00A 3EVQA 3SE0A 2N55A 2F0PA 4X3TA 3GTLB 2CW0C 3M4YA 2OXPA 5DAUA 1GUSA 2NN6I 2F3VA 1TT2A 1YNND 5M5XB 3MC0B 1H9SB 4A3JB 5JEAG 3K6OA 2PZTA 2L9HA 3HRZC 2G9HD 2F0MA 5KYIA 1EY9A 3X3NA 5F2DA 3I70A 4IUVA 5IGEA 2WV6D 2LS01 2I46A 4HTHA 1S5BD 2E2DC 5K36G 2NN6G 4ILWA 3I8ZA 3DWAA 2F4IA 4XQNA 4ZLTF 3MFYA 2NUCA 1O7ZA 4ZRZA 5C0XH 5CV8A 3W3AA 1V1PA 1I50B 1D1KA 3I91A 2FFKB 4HEDA 4IFDG 3KLSA 2CQAA 4ZKCB 3HOUB 1B9NA 1SXTA 2PCFB 3R2IA 1GXDC 1FYCA 1I4RA 3BVGA 5EPKA 2RQXA 2IPKD 2WACA 5LL6S 1JICA 1ZEQX 3NSWA 1F9SA 3WDNA 2GA4B 2B63B 1LTSD 1DOMA 5IGGA 3K5NA 2DY7A 1OXXK 3RZOB 3LNNA 1SE2A 2WKCA 3EROA 4MIUA 4ZUJA 3URYA 5ISRA 3BS1A 2AUKA 1D1IA 1GJXA 3IL8A 1JWUD 2I07B 3J7AF 1CK1A 2A69D 1FD7D 5CV6A 2KCNA 1XYIA 1ENCA 2K32A 2NWGA 2RBMA 4BBRB 5E1FA 3PIO3 4CBVA 1S5ED 1STBA 5J39A 1EWCA 4J1MA 4CJ2C 1DD2A 4DF7A 3L3OC 1T5EA 2ZXOA 1HXYD 2Z1CA 3U9OA 3OW7A 2XWJB 5CGKA 5JPMC 3HEJA 2PZUA 1ICWA 5EBCA 1FR3A 1VCIA 2LMCB 2IX3A 1HA6A 3D6CA 2XNAC 2B2UC 4RH6A 2ENBA 5E4WC 3OPOA 3F2UA 3S2DB 3H94A 1HPCA 1ZXTA 2NB0A 1UEAB 4K2LA 1PFMA 1PZID 1IKMA 3E0JA 1JWSD 4M1UB 4FXGC 3P75A 1B3AA 1U4MA 3RZDB 3CQZB 4CGYB 4RHSA 3MZ5A 3I90A 5C4HA 3SK4A 2K5QA 4A3IB 3MHBA 1B53A 4KI0A 3A54A 1SJED 2EVBA 2R6GA 1WD1A 3A55A 1ET6A 3T51B 2CW0D 1SFOB 2NVYB 4ZKBB 1PFBA 5FLXE 3RD4A 3K0YA 4P2CB 4M8AA 2JA8B 3T56B 1EYDA 1HCZA 5I6YA 1RHPA 4RGNA 1KAAA 2BA0A 3QO2A 1PDQA 1HUNA 3R93A 5BN4A 1BCPB 1YNJD 3K59A 4G7ZC 4DAYA 4KJOA 1OXUA 3IKJA 3P20A 1WTWA 4DGZA 4G7HC 1O7LA 3I72A 2C5CA 1ESRA 1LT6D 1EIGA 3SR1A 5CV4A 3P7JA 1EU3A 1X32A 4IUTA 4CKCA 3T4AC 1IKLA 4A3DB 4KKTA 4HN7A 3TZDA 1DYQA 5JVH3 2B39A 1I4GA 4WRDA 5EPLA 2F1MA 1QNKA 3TBIB 3KF8A 5FO7B 2B8FA 5KNDA 1TWFB 1UNSA 2B2VC 5DM73 3J80E 1BCPD 2J7ZA 2FJ2A 4FNFA 4DFAA 1CTMA 1LTRD 1IW7C 1D5XC 2D2CC 4L6TB 5EQ0A 4Q0FA 1Y1VB 4Y7NB 5E4XA 1EIHA 3KK7A 2NZ1D 2KUMA 3K58A 1TY0A 1GUNA 2R61A 1IL8A 2K01A 4ZAIA 5EKIA 3BYYB 1PMRA 1U9RA 1RKNA 1EEFD 4KN4C 2X6GA 4ULLA 5J22A 1ENAA 1UUPA 4EGVA 2Z4HA 5D3DA 2LFNA 3Q6SA 1ZKOA 2WP8J 4K6DA 5M5WB 4FF4A 4NP5A 1GUGA 2C9OA 4A3KB 2AWOA 4KY7A 4PMCA 4K5WA 1E0BA 1MSHA 3EA6A 1WVLA 3W2DA 2R3ZA 1FNUA 4KTAA 3S9WA 1Q90A 4RWSC 4ABNA 3S16B 2A6EC 5JEAH 1MD2D 1H9SA 2IX0A 5BN5A 1PZJD 1QILA 1BCPF 1F9PA 3GO5A 5ELDA 1EY8A 1Y8PB 3QG1A 1JOOA 2DN8A 2RSOA 1ZYRC 3D8GA 4Q5VA 4TKOB 2NN6H 3HKZB 2JEAI 3E6ZX 2ZXPA 4KV6A 3VR3A 4BS9A 3KLRA 2PPBC 1LTGD 2IW3A 4QUFA 4CJ0B 5CC4A 1AP0A 4GZYC 4ME5A 2B8GA 3QOLA 2E2HB 1CM9A 1K8OA 4PQXA 4KN7C 2H1EA 1J9OA 5IGDA 2MJ8A 5K5PA 5I9PA 2IJ0A 1GUWA 1OXTA 3D31A 3FKIB 2KVMA 2BCOA 3DEPA 1G2TA 5FK9C 4KD4A 3A7LA 3LWUA 5M9OA 3OMGA 3S1MB 5IGFA 2L5TA 2F03A 4JK1C 1X3PA 2QEJC 1EZ6A 3TSSA 4OO1I 4X3KA 2OT2A 1AZQA 3MXGA 3C2PA 1F2YA 4EQOA 3Q24A 4HSPA 3T53B 1S5CD 2F0JA 5A35A 1WTRA 2N88A 3VR5A 4L8JA 2OF1A 2CHBD 2EJFC 1LO5D 1G2SA 3MA2B 3TP6A 2PNRC 1DZ1A 3S1QB 4FXDA 4LK1C 3WOFA 3VYUA 4OO1G 5DEHA 2V4DA 1Q1BA 1HHVA 4K5XA 1PFNA 1EQVA 1Z47A 2DNEA 2KCCA 5CV5A 5I2YA 4PMBA 1E2ZA 3ONAB 3NXWA 1TQOA 3DWQA 1Y1WB 1V1OA 5ELEA 1BDOA 1IW7D 1DCZA 2KEEA 3RLFA 4YIJA 2BOSA 3HOYB 3PUXA 1DOLA 4XIGS 4TSSA 3FMCA 1OXVA 1CT1D 4C1NK 2VB3X 4R8NA 5EJWA 5C6AA 1EY0A 2A6HD 3PO2B 4HCEA 3FRPB 4FYDA 4H13C 3KBXA 3VR6A 4R8IA 1LABA 3S14B 2EYMA 1S4ZA 2EY2A 3RUZA 5HURA 4HMJA 3T16A 1CHPD 1HFNA 5KEEA 2F0TA 4QMGA 2OEOA 4LMQD 3D4RA 3J7AV 3NK9A 1CI3M 1HQMC 4XXEA 2TMPA 4NDXA 4U68A 2X69A 3QIAA 1CFMA 3HG9A 1FNWA 4X3SA 4A3FB 2VNUD 3NWSA 2J0TD 1A15A 1EL0A 5T1GA 4WFN3 1EZ8A 1RDPD 1ZYRD 1NCVA 2G9DA 3VA5A 3QJYA 4RGTA 4OHJA 1I3QB 4RA8A 1A3VA 1RF2D 4KJNA 2KJXA 3MFGA 4OIJA 1Q1EA 1SYBA 5M3MB 2KECA 4TQUS 1QCBD 1QNUA 2EZVA 3BG3A 1UAPA 5JPNC 5EPJA 2O5IC 4N9TA 5COYA 2QILA 1LTBD 1AEXA 3OWEB 3GTJB 3FPPA 2F0DA 2JA7B 4JBWA 3DHQA 2RA4A 4C1NI 2F3WA 1VMPA 1EY7A 1DM0B 4I65A 2XSCA 1X3QA 5J1ZA 1EFID 1U4PA 3DWPA 2VB2X 3PO3B 4IUQA 1VF5C 3K57A 1HTLD 3K5MA 3NTIA 2K04A 4S3SA 3D3RA 2EYJA 3EQLC 4FP5D 2SNSA 4FF3A 4H7BA 4DK1A 1SE3A 1XTCD 4F8MA 2O4XA 5IODA 2LKVA 2J4XA 2MPMA 2MUYA 2F0OA 1I4QA 3IFDA 3TDQA 1W6KA 2B2YA 3CRLC 4DXGA 4B9WA 1C48A 4KKSA 2QDBA 1H9KA 2A68D 5LHY1 1BF4A 4H44C 5HGTA 2MGSA 5BN3A 3HOZB 1SMYD 1PRTC 1SBBB 3FVQA 4K8IA 1OXSC 1TR5A 1W6JA 1TY2A 4NKLA 2WKDA 3I3CA 1V8QA 1KLUD 2B2WA 4HMIA 3ZYYX 4G57A 2EJMA 3EJIA 1WTOA 1PTOH 1NAPA 1PTOC 3BDOA 4X3UA 3H91A 1WD0A 4WJWA 5FKAC 1GUOA 1AZPA 2L4NA 4QB4A 4PV1C 4KHZA 1BNZA 1JR0D 4XQQA 5DNFA 2WAQB 2A5HA 1HQRD 1AW7A 2B2TA 2PW7A 1WCMB 3OSOA 1SYFA 3V2TA 2JA6B 5AFWA 1JOQA 2F0NA 4BY7B 3SDZA 1S5DD 3Q22A 1ML0D 5CV7A 1Y8NB 5CR3A 2HQEA 1V1PB 2WIIB 1EU4A 2LY7A 2DY8A 3TZUA 2WB1B 4C3JG 3K5LA 4KHVA 3S2HB 5I9OA 3I4NB 3R2TA 2BE5C 3N52A 1BUVT 5IGCA 5EGTA 4ZUIA 3TN2A 1CZWA 5D14A 1GOZA 2E2IB 3R8BA 3J81L 3GTPB 1WTQA 4HSVA 2PW5A 1Z6HA 2ICIA 1B1ZA 1SNOA 4E6IA 4H0LC 3G6JB 3I73A 3GP7A 3MXPA 2E2JB 1RODA 2HDLA 2F0KA 1Q8IA 3ITPA 5C0XJ 1T5XD 2L12A 1U4LA 4QUCA 3MWYW 4OO1H 3BVZA 2X6LA 2EE1A 2K5WA 2SDFA 4IALA 1H9JA 3VR2A 4C3IB 4HAEA 1KLGD 2RSNA 1GUTA 3H6MA 4KD3A 4F7XA 1TWHB 1A2UA 1TIID 4V190 3PMFA 1I4HA 2D5DA 5C4JB 3PUVA 3H09A 1CA6A 1K83B 4C3IG 2R93B 5A2QL 3SEBA 5FO8B 3SK8A 2HDMA 2HUGA 2JXMB 1CHQD 1DONA 3GTOB 4KMUC 1STNA 4BY1B 1YNNC 1GHKA 3A8JE 3SK6A 3NQIA 4FF1A 1STGA 5ELFA 1RCVD 2BDOA 3I4MB 4LAAA 2HCCA 1KDAA 1JWMD 4DU9A 5KRUA 5LL6X 2NVQB 3J81E 2TSSA 1I6VC 3SVMA 3BDLA 2NYZD 5C44B 1QWYA 1MBYA 2O5JC 1AN8A 1PTOB 3J7YW 3JAML 1HRJA 3A7AB 1SYDA 3DEOA 1NR2A 4B9XA 1BO0A 5M5YB 5FOBB 4K6LA 1M8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JE4 A;  2NWG A;  3LWE A;  3DEP A;  5EPJ A;  1U4L A;  5COY A;  4QUC A;  5JJZ A;  3MWY W;  2B2V A;  1G2T A;  2B2W A;  2X6G A;  5EJW A;  4IUV A;  1RHP A;  2K03 A;  1RJT A;  2KOL A;  4MHE A;  1VMC A;  2X6L A;  2EE1 A;  1EQT A;  4RAU C;  3Q6S A;  2SDF A;  1WTO A;  1NR4 A;  1XX8 A;  1KNA A;  1MSG A;  4CJ2 C;  4HAE A;  1NAP A;  2JP1 A;  2RSN A;  3QO2 A;  1PDQ A;  1HUN A;  3R93 A;  2L9H A;  4X3U A;  3H91 A;  1U4R A;  1X3P A;  2HCI A;  1WD0 A;  3I8Z A;  3KBX A;  4X3K A;  2RA4 A;  1RTO A;  1F9Q A;  1VMP A;  4R8I A;  4ZLT F;  1AZP A;  2L11 A;  2L4N A;  1G91 A;  1HFG A;  1O7Z A;  1AZQ A;  1CA6 A;  1WTW A;  1S4Z A;  1HUM A;  1B4O A;  1MI2 A;  1X3Q A;  1U4P A;  2FIN B;  2MP1 A;  3DM1 A;  1ICW A;  2D9U A;  2K28 A;  5DNF A;  1BNZ A;  4CJ1 B;  1E0B A;  4HCS A;  4IUQ A;  3I91 A;  1ESR A;  1MSH A;  2B2Y C;  1WVL A;  2FFK B;  1EIG A;  4HED A;  2R3Z A;  4R9W A;  2FMM A;  2B2T A;  3UI2 A;  1HA6 A;  4RWS C;  4UAI A;  3P7J A;  1HFN A;  1X32 A;  2B2U C;  2HDM A;  4IUT A;  4ZKC B;  1WTX A;  1WTR A;  2KED A;  2N88 A;  2HUG A;  5AFW A;  4MN3 A;  1Q3L A;  5E4W C;  1WTP A;  1IKL A;  2K04 A;  1F9R A;  1DON A;  1EOT A;  3KUP A;  1G2S A;  3F2U A;  2IL8 A;  5D65 A;  4LMQ D;  3TZD A;  2K1B A;  1SAP A;  1B50 A;  1O7Y A;  1ZXT A;  5EPK A;  2EPB A;  1DZ1 A;  1F9P A;  1ML0 D;  4DN4 M;  5EPL A;  4ZK9 B;  1RTN A;  1DOK A;  3FDT A;  1PFM A;  1IKM A;  2VXW A;  4XT1 B;  1JIC A;  3G7L A;  5COR A;  1C8C A;  1QNK A;  1F9S A;  2HCC A;  2DY8 A;  1QG7 A;  4IUU A;  1TVX A;  2RSO A;  4U68 A;  2X69 A;  4XT3 B;  2MPM A;  2XIW A;  3GV3 A;  2EOT A;  1CA5 A;  2K05 A;  1B3A A;  2L1B A;  1HHV A;  1DOM A;  1F2L A;  1U4M A;  2B2W C;  2B2V C;  2Q8R E;  4IUR A;  4X3S A;  3FPU B;  3IFD A;  1EL0 A;  1A15 A;  3N52 A;  1G6Z A;  5T1G A;  1PFN A;  2J7Z A;  3I90 A;  2FJ2 A;  1PLF A;  2DY7 A;  3D6W A;  3SVM A;  2B2Y A;  2M2L A;  1SDF A;  2N55 A;  3HP3 A;  2RVL A;  3TN2 A;  2NYZ D;  4X3T A;  1J8I A;  3GV6 A;  4QUF A;  2CVR A;  1B53 A;  1NCV A;  3ONA B;  2B2U A;  5D14 A;  5EQ0 A;  4CJ0 B;  1AP0 A;  5CBE E;  1BBX C;  1BF4 A;  1HRJ A;  2FHT A;  2MGS A;  5E4X A;  1QE6 A;  4RA8 A;  1WTQ A;  1WTV A;  4HSV A;  1CM9 A;  1SSO A;  3MTS A;  4XDX A;  5CMD A;  1WD1 A;  1EIH A;  2BDN A;  4O42 A;  3DEO A;  2H1E A;  1NR2 A;  2NZ1 D;  1ILQ A;  2KEE A;  4OIJ A;  5T1I A;  1J9O A;  2KUM A;  3IL8 A;  4IUP A;  1BO0 A;  1LV9 A;  2Q8T A;  1IL8 A;  4ZKB B;  1O80 A;  2KEC A;  2K01 A;  1KNE A;  1PFB A;  2JYO A;  2L12 A;  2MJ8 A;  4NW2 A;  4OIK A;  1GUW A;  1ROD A;  4ZAI A;  1ILP A;  5EKI A;  2HDL A;  1B2T A;  2B2T C;  5CBA E;  1DOL A;  1MGS A;  1XYI A;  2KVM A;  1M8A A;  3I3C A; 
#chains in the Genus database with same CATH topology
 4A3B H;  3LWE A;  3MVV A;  2E75 C;  2K6A A;  3I55 A;  2XRS D;  1I94 Q;  3VR4 A;  1IYV A;  1V43 A;  3U50 C;  1H9M A;  4IQZ A;  1NTG A;  1KNA A;  3HOW H;  1KAB A;  3G48 A;  1IBM L;  5A2Q E;  2NZO A;  1U4R A;  1FL0 A;  3EFX D;  4BA1 I;  3X3M A;  1TWA H;  2KHJ A;  4RKL A;  4X62 L;  2EY6 A;  3NE5 B;  4OX9 Q;  2UXD L;  2F4V Q;  3RMH A;  3S1R H;  2FIN B;  2RDH A;  1B4O A;  4LUZ A;  1PTO D;  1STA A;  2N8N A;  5C4X H;  3B6Y A;  3K7A B;  4KKU A;  2VL6 A;  2AWN A;  2EQS A;  4YCV A;  2RHQ B;  2K5D A;  2FMM A;  3KJO A;  1LT5 D;  3MXU A;  3C1E A;  2XN9 C;  4R4I A;  3GTQ B;  2KED A;  4MN3 A;  3A8I E;  1Q3L A;  1WTP A;  4ZCK A;  4OWW B;  4PMW A;  4RGM A;  4EVO A;  3VA7 A;  3HOV G;  2CWP A;  4F87 A;  4A3G B;  4HIM A;  5M3M H;  1GM5 A;  5C5L A;  1D5M C;  2YU9 B;  4GNX C;  4JI6 Q;  4XT1 B;  1G6Z A;  3G7L A;  2NBF A;  2R7D A;  1EYA A;  4F88 A;  1N36 Q;  1E1O A;  4A3G G;  1LUZ A;  3S17 H;  2EY5 A;  3HOX H;  4RGO S;  1GO3 E;  2EY1 A;  1VF7 A;  3JAM E;  2SNM A;  4DUY Q;  1SNQ A;  3D6W A;  1SDF A;  3M4O B;  4DR4 Q;  2K14 A;  1JJ2 A;  1S5F D;  1PA6 A;  4A4I A;  4LF5 Q;  1MJE A;  2JA7 H;  5KIX A;  1JOK A;  4QL5 A;  2FHT A;  4LUO A;  2DNC A;  4C2M B;  2K5V A;  4EQN A;  4IO9 A;  2Q8I B;  4A93 G;  4XDX A;  3K7U C;  1XMQ Q;  5IT9 c;  2Q2H A;  2R7Z B;  4QGU A;  3OOC A;  2WFW A;  1O80 A;  1KNE A;  4U67 3;  3PO3 H;  3S15 H;  2F0H A;  1Q12 A;  3ND8 A;  4BBS H;  2XTI A;  1EYC A;  1A3U A;  5TSS A;  4POG A;  3ERQ A;  1JB3 A;  2R7Z G;  1G8Z D;  4NXM Q;  2F0V A;  2QF7 A;  3M3Y B;  2K03 A;  3NTK A;  1RJT A;  2KOL A;  5J3B A;  4JI7 L;  1PTO F;  1LTI D;  1K73 C;  1IBL Q;  3RNU A;  1MSG A;  4N9P A;  2JP1 A;  2IY5 B;  2ZT9 C;  3TP7 A;  2XWB B;  1YVC A;  3D4D A;  3L7Z C;  1QJO A;  3PUZ A;  3F2C A;  1RTO A;  1Z7T A;  4KK7 A;  1EY5 A;  4PNY A;  2HD3 A;  2LSS A;  1B7Y B;  4DNI A;  3CXC A;  3DM1 A;  5DM6 3;  1JT8 A;  2L55 A;  4DK0 A;  3KBG A;  2F0W A;  4CJ1 B;  2NTS A;  4PG3 A;  2EYL A;  2AQ1 B;  4R9W A;  4HJ5 A;  5E7N A;  3IFT A;  1A8V A;  2EYO A;  3CPW A;  3GTK B;  3CF5 A;  1FGB D;  2Y0S B;  4L63 B;  3NEN A;  3K81 C;  1PZK D;  4P75 A;  1EOT A;  1Q81 C;  1DXM A;  4X65 Q;  5D65 A;  4DPG A;  4OWT B;  1VQA A;  3WOE A;  3HOZ H;  5EBD A;  5G3L D;  4YHH Q;  2L0C A;  5D3I B;  2VXW A;  2Y0S G;  2RF4 A;  3NHH A;  1KAW A;  1D5Z C;  1AFP A;  3V05 A;  4JG2 A;  1HJP A;  1CA5 A;  3GV3 A;  2EOT A;  4YWK A;  4A3B B;  2EYH A;  2F0E A;  3OIQ A;  5M3F H;  1SEB D;  4IFD I;  1QUQ A;  4IN3 A;  1V9P A;  4DR7 Q;  4I7Z C;  4QIW B;  3HP3 A;  1BVS A;  5JJK A;  3QOJ A;  1A6X A;  1TS5 A;  4HIO A;  2BH8 A;  2UXB L;  3S1N B;  1K8M A;  1YNJ C;  3HOW B;  1STY A;  2A6E D;  2UUA Q;  2K33 A;  4A3B G;  3I56 A;  1SND A;  1UE7 A;  5NUC A;  4JI5 L;  1TWA B;  4AH6 A;  3K5O A;  4O42 A;  1EWH A;  1ILQ A;  1F2M A;  5T1I A;  3HS0 C;  1TS2 A;  3H0G H;  3S1R B;  5IIF A;  2GN5 A;  1STE A;  5C4X B;  1X9N A;  3KLS X;  4CKE A;  3HOW G;  3M4Q A;  3FEW X;  1Y14 B;  4DA2 A;  1HA5 A;  1CQF A;  5JJZ A;  4A3M B;  4WJ3 M;  1J6Q A;  4BY7 H;  5JEA J;  4C3J H;  1RD9 D;  3MXN B;  1YIJ A;  1LT3 D;  4MHE A;  3UE1 A;  5C4X G;  3GQB A;  2WB1 E;  1NR4 A;  1II3 A;  3U9S A;  1PXU A;  2E76 C;  3F8T A;  4LF8 L;  4ZQ3 A;  2Z6K A;  5HY6 A;  1JMC A;  2LXJ A;  4A3M G;  4H02 A;  1CQV A;  4DNR B;  1I5F A;  1LTA D;  2BA1 A;  1TWG B;  3CD6 A;  3S2H H;  2ASB A;  4B3R Q;  2IT1 A;  3S17 B;  4QCL A;  1BCP C;  4KY5 A;  3HOX B;  5G3L F;  2AQ2 B;  4K2K A;  3NBH A;  5ELC A;  4IPH A;  4UAI A;  1B3Q A;  3BDC A;  1VQP A;  4DV3 L;  2JA5 H;  2F0I A;  1QZH A;  3NEL A;  1OO9 B;  4LWC A;  5IYB H;  3GTP H;  4XQJ A;  4HJ7 A;  2VUM B;  2F0Q A;  1VQL A;  2K1B A;  2XVS A;  1VQO A;  1B50 A;  4IFD J;  3AU7 A;  3CRK C;  5JJL A;  2SEB D;  4DAP A;  1RTN A;  1DOK A;  3GD7 A;  4PZ7 A;  2E2J H;  3S15 B;  4FO2 A;  3CP0 A;  1QG7 A;  3PSI A;  5EKL A;  1F2Z A;  4LF9 L;  2VUM G;  4BBS B;  1HZC A;  4IJL A;  4DV2 L;  3CCJ A;  4JI1 L;  1LAC A;  1MHW C;  3C1F A;  1EY4 A;  1YZ6 A;  1N34 L;  3N6R A;  3ULJ A;  2OQ0 A;  2JEB I;  2UXC L;  1SYG A;  1J8I A;  3AB9 A;  4LJZ C;  5ELB A;  4CHT B;  5BR8 Q;  2B2U A;  1WYD A;  4BBS G;  3TEH B;  5FLX L;  5CBE E;  3HGB A;  1I4X A;  5C4J H;  2BDN A;  4G7O C;  4DK3 C;  4V0B A;  2P5Z X;  3TME A;  4IUP A;  4DV5 Q;  3OTO Q;  5LMN L;  1K83 H;  1D8L A;  1DJR D;  3M4P A;  1JB7 A;  2IX1 A;  4ZYS A;  4GKK L;  4Y52 H;  5CBA E;  4EQP A;  4K0K L;  1Y8O B;  4IPC A;  4CKB A;  4P74 A;  1ONL A;  3I2Z A;  3GTO H;  1TWC H;  3LX0 A;  2EYF A;  2QGQ A;  1ICF B;  4FF2 A;  4DR6 L;  1CZG A;  3PF5 A;  4GS3 A;  1PH8 A;  1B70 B;  1E2V A;  4C3H B;  1XPU A;  4JI4 Q;  3Q8D A;  3NPP A;  1EY6 A;  3GTG H;  3CU7 A;  2PMZ E;  4ODG A;  2L11 A;  1YIT A;  1HFG A;  4LFC L;  5IGB A;  4GKJ Q;  2NVQ H;  1K8G A;  4DR2 L;  5C4Z A;  1L0X B;  1PHJ A;  5CYU A;  4C3H G;  5M3F B;  2A73 B;  2B2Y C;  2N3S A;  3E0E A;  4OL7 A;  4AYB E;  5C44 H;  5C3E B;  2EDG A;  4XYQ A;  3R3O A;  1SYC A;  3OWF A;  5C0X I;  4IOA A;  1F9R A;  1QB5 D;  3A0J A;  2RDG A;  3KUP A;  4BXX H;  2IL8 A;  5M3F G;  1EIF A;  1VQ6 A;  2QCP X;  4JOI C;  3RLN A;  1VQK A;  1O7Y A;  2EPB A;  3D4W A;  3OMC A;  2OQK A;  2VQE Q;  4UHV A;  3H0G B;  4HR7 B;  5C3E G;  3J80 L;  3BVM A;  5E3F A;  4B3S Q;  1Q8K A;  5JAV A;  3DXJ C;  4NMZ A;  1KDC A;  3M7G A;  1L1O B;  1LTT D;  2ZTD A;  2L1B A;  2MHV A;  1IBK L;  3L9A X;  1F2L A;  4ID6 A;  2B2W C;  1O78 A;  2KHS A;  3VYT A;  1U5K A;  5C3X A;  1FNV A;  4JI2 L;  3H0G G;  4Z9C B;  4JBK A;  1M4V A;  1D6E C;  2D62 A;  3M7N A;  4C3J B;  3KYH C;  4G4K A;  1KXL A;  4RHR A;  3GV6 A;  2CVR A;  1U0L A;  1K8A C;  3SK5 A;  2BH2 A;  4RFB A;  1AE2 A;  4BWG B;  5C0X G;  1QE6 A;  1YHB A;  2EYP A;  1WTV A;  1SSO A;  2RDF A;  5I6W A;  5I4D A;  5JVG 3;  4LF7 Q;  4O1N A;  2H4O A;  1EEI D;  1X6O A;  1SNP A;  1JJC B;  3K7A H;  2JYO A;  1KTK A;  4NW2 A;  3HOV H;  3AYH B;  2B2T C;  4J6H A;  4POF A;  3ZJY C;  1FJG Q;  1JE4 A;  1LLR D;  1CSQ A;  3GTQ H;  1BR9 A;  1G6P A;  2B2V A;  2WIN B;  2JA5 B;  4LFB Q;  2YV5 A;  1J5E L;  1C4Q A;  3G4S A;  3E3X A;  1SNM A;  3H3V C;  1XXG A;  4DXF A;  3M85 A;  2AKW B;  2AMC B;  1W2B A;  1SE4 A;  1X56 A;  2C35 B;  4B3M Q;  3MEF A;  2K75 A;  4A3E B;  5LMU Q;  1ET9 A;  2HCI A;  2YU9 H;  1Y69 U;  4JI3 Q;  3BYT B;  4MTK A;  2JA5 G;  3P1H A;  2A74 C;  4XYO A;  4IUN A;  2UUC Q;  1YHQ A;  4DR5 L;  2MP1 A;  2PZW A;  2D9U A;  5KGU A;  2E74 C;  2KA7 A;  4A93 H;  4HCS A;  3V96 A;  4A3E G;  4A3D G;  2MFI A;  1X3G A;  3CW2 C;  5IOC A;  3HZX A;  1A3T A;  1EYG A;  4OXP A;  3VYR A;  1B9M A;  1PH7 A;  4FXK C;  1BOS A;  2AQ3 B;  1GVP A;  2K7V A;  2OTJ A;  3K8A A;  2K50 A;  1ESF A;  4GN4 B;  4JI0 L;  2MO0 A;  4UPA A;  2R7Z H;  1IHZ A;  2UU9 L;  1BBU A;  2CQO A;  4OGQ C;  3TP5 A;  1N32 L;  5IWA L;  1D2B A;  1KQS A;  1HNZ Q;  3QB3 A;  3T1H L;  1JQY D;  2K05 A;  2F0U A;  4RCO A;  3VYS A;  4IUR A;  3E5S A;  1Q86 C;  3J81 i;  3MAQ A;  2KCM A;  4R1J A;  4DV0 Q;  2A6H C;  1TWC B;  3M3Y H;  1I6H B;  2UUB Q;  1STH A;  2KQ3 A;  4NXN L;  3NBI A;  3PIP A;  1PRT B;  4IZ8 A;  4NPS A;  1TS3 A;  3KDF B;  4UDU C;  4JV5 Q;  4DNT B;  3GTG B;  3MTS A;  5CMD A;  4GLV B;  1NY4 A;  3BZD B;  2Z4I A;  3PUY A;  2Z8L A;  3OIP A;  1LV9 A;  2ZXR A;  3CKI B;  3Q23 A;  3GTM B;  1KDB A;  2Y0S E;  4OIK A;  1ILP A;  1B2T A;  3NP8 A;  2ICE C;  3NEM A;  1V1Q A;  4WOR A;  1MGS A;  2PMZ B;  5L37 A;  2ID0 A;  5CV9 A;  3A5Z B;  2SOB A;  2PQE A;  5EKK A;  1HNW L;  4DR1 Q;  1QOH A;  4RMF A;  4QF4 A;  1R9T B;  3GTL H;  1VMC A;  4RAU C;  4JI8 L;  1EQT A;  4AYB B;  1BQQ T;  4DAV A;  1XX8 A;  1YEZ A;  1EIY B;  1KL9 A;  5KYL A;  1F77 A;  4RKB A;  4C56 C;  2QKI C;  1TS4 A;  4BXX G;  1G91 A;  4K5V A;  5EAY A;  4AYB G;  3NTH A;  1MI2 A;  4XTC S;  1PRT D;  4A3J H;  3C3L A;  3U58 A;  4KY6 A;  1NSN S;  2YYZ A;  4GOP C;  3C46 A;  5C5M A;  1BXT A;  3NWT A;  5K36 H;  5IT9 L;  1L0W A;  3SXH A;  1N9W A;  1WTH A;  3S1N H;  4J8Q A;  2RCN A;  3FHW A;  2JSO A;  1PV4 A;  2M9V A;  2PYK A;  4BA2 I;  1TKW B;  3H3V I;  1BKB A;  2IHE A;  2DJG C;  3ND9 A;  1G29 1;  4JW0 A;  3TS0 A;  3QWN A;  2EXZ A;  4DN4 M;  4X62 Q;  1B44 D;  3HOV B;  4IFD H;  2UXD Q;  4TRD A;  1C8C A;  1HTP A;  2VQF L;  2NTT A;  3MXN A;  2KBN A;  4XT3 B;  2XIW A;  2K4K A;  2Q8R E;  3SHL A;  1A2T A;  4K8J A;  4L5Q A;  1I50 H;  3JAM i;  1SYE A;  1K3B C;  2ZM6 L;  3CME A;  4HJA A;  4A3M H;  2F0G A;  1PLF A;  4DAY B;  2M2L A;  1LT4 D;  2F0F A;  3DUZ A;  1R4P B;  2RVL A;  1FVI A;  1LM0 A;  1VDZ A;  1H9R A;  3HOU H;  1GHJ A;  2AUJ D;  2F0L A;  5C3W A;  4LFA L;  1BBX C;  3AMU A;  1L0Y B;  1SJH D;  4RCN A;  2A69 C;  1JOR A;  1VQG A;  1I4P A;  1TWG H;  2F0S A;  5JOB A;  3FKI G;  3TRZ A;  2NVX B;  2ALY B;  2Q8T A;  1E22 A;  1P8L A;  3F2B A;  2RKS A;  3T13 A;  3PIP 3;  4JBM A;  4A93 B;  2NVT B;  4LF6 L;  3CHB D;  3D0F A;  5IYC H;  4X64 L;  1K0S A;  1IYU A;  4HJ8 A;  3PV0 A;  1N36 L;  3O13 A;  3ER0 A;  5GAG C;  2BE5 D;  2VS1 A;  3UDG A;  5I2X A;  3NUC A;  2XRQ D;  2VUM H;  3KF8 B;  1PRT F;  3A8K E;  2O2L D;  4A3C H;  4DR4 L;  2HT1 A;  3IAY A;  1P16 A;  1ENF A;  1X54 A;  4GN5 A;  4QJF A;  3A56 A;  3TP8 A;  1K0R A;  1TU2 B;  1JC7 A;  1F9Q A;  3CCL A;  5IT9 E;  3PUW A;  3EN2 A;  1HUM A;  5KNB A;  2MO1 A;  2CCZ A;  2K28 A;  2IWH A;  3I4L A;  3DMU A;  4B08 A;  5FO9 B;  3UI2 A;  1GD7 A;  4K14 A;  1WTX A;  1NUC A;  2A68 C;  1Q7Y C;  5KNC A;  4B3T L;  3KJP A;  4GLX A;  1SMY C;  1SAP A;  1PYW D;  1E2W A;  3OHX C;  3Q0A A;  3NQT A;  4ZK9 B;  2PO4 A;  3FDT A;  1IBL L;  1R4Q B;  2R92 B;  2FMC A;  3AFQ A;  5COR A;  5AJ3 Q;  1SNC A;  2EJG C;  4IUU A;  2OWO A;  1TVX A;  2JE6 I;  2QA4 A;  1VQ7 A;  2YTY A;  1XWE A;  1JCK B;  3FPU B;  4FVM A;  3MEH A;  1M1K C;  4LF4 L;  2M00 A;  3EVQ A;  3SE0 A;  3W5O A;  1XNR L;  1PH9 A;  2N55 A;  1S40 A;  2F0P A;  2R92 G;  4DV6 L;  4X3T A;  3GTL B;  2CW0 C;  3M4Y A;  2OXP A;  5DAU A;  1GUS A;  4C3H H;  2NN6 I;  2F3V A;  4N8F A;  3S2D H;  1UEB A;  1NBW A;  1NNX A;  4YY3 L;  1N33 L;  1TT2 A;  1YNN D;  5M5X B;  3MC0 B;  1H9S B;  5HGQ A;  4A3J B;  4GOP B;  5JEA G;  3K6O A;  3J7Z C;  1IL2 A;  2PZT A;  1LYL A;  4JC0 A;  2L9H A;  3HRZ C;  2G9H D;  2F0M A;  5KYI A;  5C3E H;  1EY9 A;  3K0X A;  3X3N A;  5F2D A;  2N49 A;  3I70 A;  1YJW A;  4IUV A;  5IGE A;  2UXB Q;  2WV6 D;  4A3J G;  3KLW A;  2LS0 1;  2I46 A;  1KHI A;  1L1O A;  3BZC A;  4EQ5 A;  4JI5 Q;  5ELO A;  4HTH A;  1S5B D;  2E2D C;  5K36 G;  2NN6 G;  4ILW A;  4GN3 B;  3I8Z A;  3DWA A;  2F4I A;  4OON A;  4XQN A;  4DV1 L;  4ZLT F;  3MFY A;  2NUC A;  1O7Z A;  4ZRZ A;  5C0X H;  1OTC A;  5CV8 A;  3W3A A;  1V1P A;  1I50 B;  1D1K A;  3I91 A;  2FFK B;  4HED A;  1PYB A;  2JA8 H;  4IFD G;  2PI2 E;  3KLS A;  2CQA A;  2OCE A;  4ZKC B;  3DLL A;  3I7F A;  4YWL A;  3HOU B;  1B9N A;  4GNX B;  1SXT A;  1HZA A;  2PCF B;  3R2I A;  1GXD C;  4APV A;  1FYC A;  1I4R A;  1VQJ A;  2B29 A;  3BVG A;  5EPK A;  3I4O A;  1HNX L;  2NZH A;  2RQX A;  2IPK D;  4A3F G;  2WAC A;  5LL6 S;  1JIC A;  1ZEQ X;  2F3I A;  3HOU G;  3NSW A;  1F9S A;  3WDN A;  2GA4 B;  3OYY A;  1VQ4 A;  2B63 B;  4LUV A;  1LTS D;  1DOM A;  1GKH A;  5IGG A;  3EBE A;  3K5N A;  1L2F A;  2DY7 A;  1OXX K;  4DV3 Q;  3RZO B;  3LNN A;  1SE2 A;  2WKC A;  3ERO A;  4MIU A;  2ZJQ A;  4ZUJ A;  4A3E H;  2B63 G;  4JVZ A;  3URY A;  5IYC G;  4A3D H;  5ISR A;  3T1Y L;  3BS1 A;  4DV7 L;  2AUK A;  1D1I A;  1ASZ A;  1C9O A;  3KFU A;  1GJX A;  1HZ9 A;  3IL8 A;  1JWU D;  4YWM A;  4LF9 Q;  4DV2 Q;  2I07 B;  3J7A F;  4A3C G;  1CK1 A;  4JI1 Q;  2A69 D;  1FD7 D;  5CV6 A;  2KCN A;  1JJG A;  4CDF C;  1XYI A;  1ENC A;  3CCM A;  4DUZ Q;  1TWF H;  2K32 A;  1N34 Q;  2NWG A;  2RBM A;  4BBR B;  5IYD G;  5E1F A;  2UXC Q;  3PIO 3;  4CBV A;  4LNQ A;  1S5E D;  4PZ6 A;  1STB A;  5J39 A;  1EWC A;  4J1M A;  5GAE C;  4CJ2 C;  1DD2 A;  3EIV A;  4DF7 A;  3KOJ A;  3L3O C;  1T5E A;  2ZJR A;  1XPR A;  2ZXO A;  1YBY A;  1E24 A;  1HXY D;  3PGZ A;  1SR3 A;  2Z1C A;  4BBR G;  3U9O A;  3ERS X;  1XMO L;  3CCU A;  5LMN Q;  3OW7 A;  2XWJ B;  5CGK A;  5JPM C;  2GVA A;  3HEJ A;  3AFP A;  2PZU A;  3G71 A;  4GKK Q;  1ICW A;  4K0K Q;  3KDF A;  5EBC A;  1I6H H;  1H95 A;  1FR3 A;  1VCI A;  2LMC B;  3CCS A;  2IX3 A;  1HA6 A;  2VW9 A;  3D6C A;  1HR0 L;  2XNA C;  2B2U C;  4RH6 A;  2A19 A;  2ENB A;  5E4W C;  4DR6 Q;  1XJV A;  3OPO A;  3F2U A;  1SRU A;  3S2D B;  3H94 A;  1HPC A;  3KF6 A;  4CDC C;  4A76 A;  1ZXT A;  2NB0 A;  5M5W H;  1UEA B;  2ZTC A;  4K2L A;  2E8G A;  3GTM H;  1PFM A;  4AQY L;  1PZI D;  4LFC Q;  1SMX A;  1IKM A;  1Z9F A;  3E0J A;  1CKN B;  1JWS D;  1E7Z A;  4M1U B;  4JOI A;  4FXG C;  4TVA B;  3P75 A;  1B3A A;  1U4M A;  4GLA C;  2V1C C;  1EQR A;  3RZD B;  3CQZ B;  4CGY B;  4RHS A;  3MZ5 A;  3I90 A;  2K5N A;  1R9T H;  5C4H A;  3SK4 A;  3S16 H;  2K5Q A;  4A3I B;  3MHB A;  4OEL B;  1B53 A;  4FDB A;  1WOC A;  4KI0 A;  4L5S A;  3A54 A;  1SJE D;  2EVB A;  2R6G A;  1WD1 A;  3A55 A;  1ET6 A;  5LMN W;  3T51 B;  2CW0 D;  5H1S E;  3HKZ E;  1DGS A;  1E3P A;  2NVY B;  4A3I G;  1PYS B;  4ZKB B;  1SFO B;  3RLO A;  1PFB A;  5FLX E;  3RD4 A;  4JYA L;  3K0Y A;  1IBK Q;  4P2C B;  4M8A A;  2JA8 B;  3T56 B;  4JI2 Q;  1EYD A;  2VZA A;  1HCZ A;  5IP7 H;  3IRB A;  3QR8 A;  5I6Y A;  1RHP A;  4RGN A;  3GDE A;  1KAA A;  1WI5 A;  2BA0 A;  3QO2 A;  1YNX A;  1PDQ A;  2JA8 G;  3R93 A;  5BN4 A;  1HUN A;  1BCP B;  1YNJ D;  2JQO A;  5IP9 H;  3K59 A;  4G7Z C;  2E2H H;  4DAY A;  4KJO A;  3F2D A;  1OXU A;  3HKS A;  3IKJ A;  3P20 A;  1WTW A;  1EOV A;  4DGZ A;  4G7H C;  4LF7 L;  2A1A A;  1O7L A;  1RIP A;  3I72 A;  2C5C A;  1ESR A;  3H3V H;  1LT6 D;  1EIG A;  3FKI H;  3SR1 A;  4KHP L;  5CV4 A;  3P7J A;  1EU3 A;  1X32 A;  4IUT A;  4CKC A;  3T4A C;  2VY3 A;  3J80 i;  1IKL A;  4A3D B;  4KKT A;  3S1M H;  4HN7 A;  3TZD A;  1DYQ A;  2R7F A;  5JVH 3;  2B39 A;  4WJ4 A;  2NVX H;  1I4G A;  4WRD A;  5EPL A;  2F1M A;  5GQO A;  4DR5 Q;  4B3M L;  1QNK A;  4AIM A;  3TBI B;  2NVT H;  5LMU L;  1VQ8 A;  3KF8 A;  5FO7 B;  1YJ9 A;  2B8F A;  2QEX A;  5KND A;  1TWF B;  1WFQ A;  1UNS A;  2B2V C;  5DM7 3;  2UUC L;  1Q46 A;  1C0A A;  3J80 E;  1BCP D;  5ELN A;  2J7Z A;  3CC7 A;  2FJ2 A;  4FNF A;  4DFA A;  1Q82 C;  1CTM A;  4A75 A;  1LTR D;  3UDX A;  1IW7 C;  1D5X C;  2D2C C;  4R4T A;  4L6T B;  5EQ0 A;  2MQH A;  3CCQ A;  1XNQ L;  4Q0F A;  1Y1V B;  1VQE A;  4Y7N B;  2PNH A;  4O0A A;  5E4X A;  3CMA A;  1EIH A;  3KK7 A;  3BZK A;  1AE3 A;  2NZ1 D;  1N32 Q;  2KUM A;  3K58 A;  5IWA Q;  1TY0 A;  1GUN A;  2R61 A;  1IL8 A;  2K01 A;  3T1H Q;  4ZAI A;  1G51 A;  5EKI A;  3BYY B;  1Y1V G;  1S72 A;  1PMR A;  1U9R A;  1RKN A;  1EEF D;  4QQB X;  4DV4 L;  4KN4 C;  4NXN Q;  2HHH L;  2X6G A;  4ULL A;  5J22 A;  1ENA A;  1MJC A;  1UUP A;  4EGV A;  2Z4H A;  5D3D A;  2LFN A;  3Q6S A;  1ZKO A;  2WP8 J;  4K6D A;  5M5W B;  4FF4 A;  4NP5 A;  1GUG A;  1Y1W H;  2C9O A;  4L5R C;  1LTL A;  4A3K B;  1KRT A;  2R92 H;  2R93 G;  2AWO A;  3PCO B;  3SGI A;  4X66 L;  4KY7 A;  4PMC A;  4K5W A;  3HOY H;  1HH2 P;  2E5L L;  3J81 c;  1E0B A;  1MSH A;  3EA6 A;  1WVL A;  3W2D A;  2R3Z A;  1FNU A;  4A3K G;  4KTA A;  3ULP A;  3S9W A;  1HNW Q;  1Q90 A;  4RWS C;  4ABN A;  3S16 B;  2A6E C;  5JEA H;  1MD2 D;  1H9S A;  1VQB A;  4JI8 Q;  4EX5 A;  2IX0 A;  5BN5 A;  1PZJ D;  3I4M G;  1QIL A;  1NE3 A;  3PO2 H;  4DR1 L;  1QVG A;  1BCP F;  4MNO A;  5M5X H;  1F9P A;  3GO5 A;  4UY8 C;  4P73 A;  4UP8 A;  4DR3 L;  4A3L G;  5ELD A;  1EY8 A;  1Y8P B;  3QG1 A;  1JOO A;  2DN8 A;  2A8V A;  2RSO A;  1ZYR C;  3D8G A;  4Q5V A;  4TKO B;  2NN6 H;  3HKZ B;  2JEA I;  3E6Z X;  2ZXP A;  2KEN A;  2ZJP A;  4KV6 A;  3VR3 A;  1IBM Q;  4BS9 A;  3KLR A;  2PPB C;  1I94 L;  1LTG D;  2IW3 A;  4QUF A;  4CJ0 B;  5CC4 A;  3TQY A;  1AP0 A;  4GZY C;  3HKZ G;  4ME5 A;  1YI2 A;  2B8G A;  3QOL A;  2E2H B;  1CM9 A;  5IP7 G;  1K8O A;  2CFM A;  4PQX A;  4KN7 C;  2H1E A;  1T9H A;  1J9O A;  5IGD A;  2VQF Q;  3AEV A;  2MJ8 A;  4RG1 A;  5K5P A;  5I9P A;  2IJ0 A;  4OX9 L;  1GUW A;  1OXT A;  1D7Q A;  3D31 A;  4GNX A;  2F4V L;  1A62 A;  3FKI B;  1XTD A;  2YTX A;  5IP9 G;  2KVM A;  4N8X 1;  3UE0 A;  2ZM6 Q;  2BCO A;  3DEP A;  1N8R C;  3RN5 A;  3M9B A;  4A3F H;  1M90 C;  2ZTE A;  3RR5 A;  2XGT A;  5FK9 C;  1G2T A;  4KD4 A;  2HIV A;  3K80 C;  3A7L A;  1NMF A;  3LWU A;  5M9O A;  3ICE A;  3OMG A;  3S1M B;  1ASY A;  4LFA Q;  5IGF A;  2EXD A;  2L5T A;  1K28 A;  2F03 A;  4PZ8 A;  3WWV A;  4JK1 C;  1X3P A;  2QEJ C;  1EZ6 A;  1I3Q H;  3TSS A;  4OO1 I;  4X3K A;  1O7I A;  2OT2 A;  2B63 H;  1AZQ A;  4JI6 L;  3MXG A;  3C2P A;  1F2Y A;  4EQO A;  3Q24 A;  4LF6 Q;  4X64 Q;  4R4O A;  5FJ8 H;  3JAM c;  4HSP A;  2FXQ A;  4JCV E;  3RZO H;  1KIX A;  3T53 B;  1S5C D;  2F0J A;  5A35 A;  1MIU A;  4R4C A;  4DUY L;  1WTR A;  2N88 A;  3VR5 A;  4L8J A;  2OF1 A;  2G5D A;  5JJI A;  2CHB D;  2EJF C;  1LO5 D;  1G2S A;  3MA2 B;  3TP6 A;  4LF5 L;  1EUJ A;  3GTJ H;  2PNR C;  5IYD H;  1DZ1 A;  2CKZ B;  3S1Q B;  1PVO A;  4FXD A;  1XMQ L;  4LK1 C;  3WOF A;  3VYU A;  1VQD A;  1YHA A;  4OO1 G;  4YCW A;  5DEH A;  2V4D A;  1VQN A;  1Q1B A;  1HHV A;  4JI7 Q;  4BBR H;  1KRS A;  1CKO A;  4K5X A;  1PFN A;  1X55 A;  4CDD C;  1EQV A;  1Z47 A;  2DNE A;  2KCC A;  4B3T Q;  1SE8 A;  5CV5 A;  5I2Y A;  4NXM L;  4PMB A;  1E2Z A;  3ONA B;  3W1G A;  3NXW A;  5FLM H;  1SLJ A;  1TQO A;  3DWQ A;  4OWX B;  1Y1W B;  1V1O A;  5ELE A;  1BDO A;  4DKA C;  1IW7 D;  1DCZ A;  2Z0S A;  2KEE A;  3E9I A;  2H5X A;  3RLF A;  4YIJ A;  2BOS A;  4IJH A;  3HOY B;  3PUX A;  1DOL A;  1Y1W G;  4XIG S;  4TSS A;  3FMC A;  1OXV A;  4LF4 Q;  4J15 A;  5AJ3 L;  3PF4 A;  1CT1 D;  3CC4 A;  1XNR Q;  4C1N K;  2VB3 X;  4DV6 Q;  3OW2 A;  1RL2 A;  1A63 A;  1NMG A;  4R8N A;  5EJW A;  5C6A A;  1EY0 A;  3L2P A;  3TRE A;  3HOY G;  1CKN A;  2A6H D;  3PIO A;  3PO2 B;  4O2D A;  4HCE A;  2DUD A;  3FRP B;  4X65 L;  2OTL A;  1N33 Q;  4YY3 Q;  2RHS B;  2N78 A;  4H13 C;  4FYD A;  4JBJ A;  1KD1 C;  3KBX A;  4YHH L;  2D0P A;  3VR6 A;  4R8I A;  1LAB A;  3S14 B;  2EYM A;  3G6E A;  1S4Z A;  4LW1 A;  4UP9 A;  3PO2 G;  3RZD H;  2EY2 A;  3CQZ H;  3RUZ A;  3STB C;  3UDF A;  2PQA B;  2B3G A;  5HUR A;  4HMJ A;  3T16 A;  1CHP D;  1PH6 A;  1HFN A;  4A3I H;  5KEE A;  2F0T A;  4QMG A;  4DR7 L;  4ALP A;  2F52 A;  1E1T A;  2OEO A;  4LMQ D;  3D4R A;  2UUA L;  3J7A V;  3LGJ A;  1IYJ B;  1X3E A;  4QY7 A;  4DV1 Q;  1SFO H;  2NVY H;  3NK9 A;  2K5H A;  2WAQ E;  1CI3 M;  5IE8 A;  1HQM C;  4XXE A;  2TMP A;  3J81 j;  2Z6B A;  4NDX A;  1JE5 A;  1UE5 A;  4U68 A;  1IZ6 A;  2X69 A;  3QIA A;  1CFM A;  2PI2 A;  3HG9 A;  3A74 A;  1FNW A;  4X3S A;  4A3F B;  3AQQ A;  1SN8 A;  3NWS A;  2J0T D;  1A15 A;  1PH2 A;  1VS0 A;  2VNU D;  1EL0 A;  5T1G A;  1VQM A;  4WFN 3;  1EZ8 A;  1WCM H;  1X65 A;  1RDP D;  1L1O C;  1ZYR D;  2JA6 H;  2CWA A;  1S3O A;  1NCV A;  1K3R A;  4LF8 Q;  2G9D A;  2HQL A;  1WJJ A;  3VA5 A;  3QJY A;  4RGT A;  1EQQ A;  4OHJ A;  1I3Q B;  4RA8 A;  1A3V A;  1HNX Q;  1RF2 D;  4KJN A;  4L5T A;  2KJX A;  1VQF A;  3MFG A;  4OIJ A;  1Q1E A;  1SYB A;  5M3M B;  4UP7 A;  2KEC A;  4R4Q A;  4X6A H;  4TQU S;  1QCB D;  2RCF A;  1QNU A;  2EZV A;  3BG3 A;  1UAP A;  4B3R L;  5JPN C;  3I4N H;  5EPJ A;  2O5I C;  4N9T A;  5COY A;  2QIL A;  2LXK A;  1NJI C;  5M3M G;  2Z6K C;  1LTB D;  1AEX A;  3OWE B;  5FJ8 G;  3GTJ B;  3FPP A;  3T1Y Q;  2E2I H;  1UE1 A;  2F0D A;  4DV7 Q;  2JA7 B;  4JBW A;  3HOX G;  2Q2T A;  3DHQ A;  2RA4 A;  4C1N I;  4HIK A;  2F3W A;  4NB3 A;  1CSP A;  1IXR A;  1VMP A;  1EY7 A;  1DM0 B;  4I65 A;  2XSC A;  1X3Q A;  5J1Z A;  1EFI D;  1U4P A;  4CDE C;  3DWP A;  2VB2 X;  3PO3 B;  4IUQ A;  1VF5 C;  2JA7 G;  3K57 A;  1HTL D;  3K5M A;  2QDL A;  4DUZ L;  2ES2 A;  1Y1V H;  3NTI A;  2K04 A;  4Y7N H;  1PH3 A;  4S3S A;  3D3R A;  5BR8 L;  2EYJ A;  3PO3 G;  3EQL C;  4FP5 D;  4C3I H;  1AH9 A;  2SNS A;  2HIX A;  1XMO Q;  4FF3 A;  4H7B A;  4DK1 A;  3CCR A;  1TWH H;  1SE3 A;  3J7A 5;  5FLM G;  4DV5 L;  1XTC D;  3OTO L;  2L15 A;  4F8M A;  2YTV A;  2O4X A;  5IOD A;  2LKV A;  2J4X A;  2MPM A;  2MUY A;  2F0O A;  4JPB W;  4YCU A;  3RN2 A;  2R93 H;  5GRO A;  1I4Q A;  3IFD A;  1HR0 Q;  3TDQ A;  1W6K A;  3DM3 A;  3CRL C;  2B2Y A;  1QVF A;  2Q2U A;  4DXG A;  4B9W A;  1C48 A;  2K52 A;  4KKS A;  2QDB A;  1H9K A;  1UWV A;  2A68 D;  5LHY 1;  2JA9 A;  4A3K H;  4H44 C;  1BF4 A;  5HGT A;  2MGS A;  4BY1 H;  3JC6 6;  1VQH A;  4JI4 L;  4DR2 Q;  5BN3 A;  3HOZ B;  1SMY D;  4AQY Q;  1W3S A;  1PRT C;  4P71 A;  1SBB B;  3FVQ A;  3I4M H;  4K8I A;  4GKJ L;  2I5H A;  1OXS C;  1TR5 A;  1W6J A;  1TY2 A;  4NKL A;  2WKD A;  3I3C A;  4A3L H;  1V8Q A;  4DK6 C;  3HOZ G;  1KLU D;  2B2W A;  4HMI A;  3ZYY X;  3UDI A;  4G57 A;  4HJ9 A;  2EJM A;  3BJU A;  3EJI A;  1WTO A;  1PTO H;  1NAP A;  1CKM A;  1PTO C;  3BDO A;  4X3U A;  3H91 A;  1WD0 A;  1QUQ B;  4WJW A;  2VQE L;  5FKA C;  2CH4 W;  1GUO A;  1AZP A;  3TS2 A;  2L4N A;  4JYA Q;  4B3S L;  4QB4 A;  4PV1 C;  4KHZ A;  3ULL A;  1BNZ A;  1UE6 A;  5M5Y H;  5FLX c;  1JR0 D;  4IPG A;  4XQQ A;  5DNF A;  2WAQ B;  2A5H A;  5GAH C;  1HQR D;  1AW7 A;  2Z9H A;  1HR0 W;  3VDY A;  2B2T A;  2PW7 A;  1WCM B;  3OSO A;  3U4Z A;  2EIF A;  2I5L X;  1SYF A;  3V2T A;  2CH4 A;  2JA6 B;  5AFW A;  1K9M C;  1JOQ A;  2F0N A;  1MKH A;  1XPO A;  3HFZ B;  4BY7 B;  3STB D;  2WAQ G;  3SDZ A;  1S5D D;  3Q22 A;  1WCM G;  1ML0 D;  5CV7 A;  1Y8N B;  3PQI A;  5CR3 A;  2HQE A;  1V1P B;  2WII B;  1EU4 A;  1HZB A;  2JN4 A;  1EFW A;  5DLQ E;  2JA6 G;  1KC8 C;  3CCE A;  4HID A;  2LY7 A;  2DY8 A;  3TZU A;  2DGY A;  2WB1 B;  2KCT A;  2IHF A;  3CPF A;  4BY7 G;  4C3J G;  3K5L A;  4KHV A;  3S2H B;  1CUK A;  5I9O A;  4KHP Q;  3I4N B;  1J5E Q;  3R2T A;  2BE5 C;  1FJG L;  3N52 A;  1BUV T;  2DJF C;  5IGC A;  1BBW A;  5EGT A;  4ZUI A;  3TN2 A;  3BU2 A;  4LFB L;  2WB1 G;  1CZW A;  3U4V A;  5D14 A;  1GOZ A;  2E2I B;  3R8B A;  3J81 L;  3I4N G;  3GTP B;  1VQ9 A;  2GVB A;  1QZG A;  4A3G H;  3NBH B;  1WTQ A;  4HSV A;  2PW5 A;  1Z6H A;  2ICI A;  4IOC A;  1B1Z A;  4KLK A;  1SNO A;  4MTN A;  4JI3 L;  4I7A A;  4E6I A;  4H0L C;  3G6J B;  3I73 A;  2MNA A;  3GP7 A;  3MXP A;  2E2J B;  1ROD A;  1TXY A;  2HDL A;  2F0K A;  4ME3 A;  1Q8I A;  5IYB G;  3ITP A;  5C0X J;  1T5X D;  2L12 A;  1VQC A;  1U4L A;  4QUC A;  3J80 c;  3MWY W;  4OO1 H;  1VQI A;  4JI0 Q;  2QW7 A;  3F1Z A;  2D0O A;  1FGU A;  3M4O H;  3BVZ A;  1XNQ Q;  2UU9 Q;  2X6L A;  2EE1 A;  2AHO B;  2K5W A;  2SDF A;  4IAL A;  3A5U A;  1H9J A;  3VR2 A;  4C3I B;  4HAE A;  1KLG D;  2RSN A;  1GUT A;  3H6M A;  5IY0 A;  3S1Q H;  4KD3 A;  4F7X A;  4C2M H;  3CAM A;  1TWH B;  1A2U A;  1TII D;  2Q2I A;  4V19 0;  3PMF A;  1I4H A;  2D5D A;  5C4J B;  3PUV A;  2ATW A;  3H09 A;  1CA6 A;  1K83 B;  4C3I G;  2R93 B;  5A2Q L;  4P72 A;  3SEB A;  1HNZ L;  1A0I A;  4DV4 Q;  3E9H A;  5FO8 B;  1QVC A;  2HHH Q;  3SK8 A;  2HDM A;  4DV0 L;  2HUG A;  2JXM B;  1CHQ D;  2UUB L;  3W1B A;  3S24 A;  3CCV A;  3GTO B;  1DON A;  1PH5 A;  4KMU C;  1STN A;  4BY1 B;  1VQ5 A;  1YNN C;  3H15 A;  1SRO A;  4JV5 L;  3FP9 A;  3A8J E;  1GHK A;  3SK6 A;  3NQI A;  2I5M X;  4MZ9 A;  4X66 Q;  4FF1 A;  1STG A;  5ELF A;  1RCV D;  2BDO A;  3I4M B;  4LAA A;  2HCC A;  1YJN A;  1EWI A;  2E5L Q;  4OEM B;  1B8A A;  1JWM D;  1KDA A;  1X3F A;  4BY1 G;  4DU9 A;  5KRU A;  1PH4 A;  5LL6 X;  2NVQ B;  4DAM A;  3L0O A;  2I0Q A;  2JK8 A;  3J81 E;  1PH1 A;  4IPD A;  2TSS A;  1I6V C;  3KF6 B;  4GOP A;  3SVM A;  2KHI A;  3BDL A;  2NYZ D;  3GTK H;  5C44 B;  1QWY A;  1MBY A;  3CC2 A;  2O5J C;  1AN8 A;  1PTO B;  3J7Y W;  3JAM L;  1HRJ A;  1PFS A;  3A7A B;  2PQA A;  1SYD A;  4DR3 Q;  5GAD C;  3S14 H;  3DEO A;  1NR2 A;  4B9X A;  1BO0 A;  5C44 G;  5M5Y B;  2JJQ A;  5FOB B;  4K6L A;  4QIW E;  1C7Y A;  1M8A A; 
#chains in the Genus database with same CATH homology
 3LWE A;  3MVV A;  2E75 C;  2K6A A;  2XRS D;  3VR4 A;  1IYV A;  1V43 A;  1H9M A;  4IQZ A;  1KNA A;  1KAB A;  5A2Q E;  1U4R A;  3EFX D;  4BA1 I;  3X3M A;  4RKL A;  2EY6 A;  3NE5 B;  3RMH A;  2FIN B;  2RDH A;  1B4O A;  1PTO D;  1STA A;  3K7A B;  4KKU A;  2AWN A;  2K5D A;  2FMM A;  1LT5 D;  3MXU A;  3C1E A;  2XN9 C;  3GTQ B;  2KED A;  4MN3 A;  3A8I E;  1Q3L A;  1WTP A;  4PMW A;  4RGM A;  4EVO A;  3VA7 A;  4F87 A;  4A3G B;  5C5L A;  1D5M C;  2YU9 B;  1G6Z A;  4XT1 B;  3G7L A;  2NBF A;  1EYA A;  4F88 A;  2EY5 A;  4RGO S;  2EY1 A;  1VF7 A;  3JAM E;  2SNM A;  1SNQ A;  3D6W A;  1SDF A;  3M4O B;  1S5F D;  5KIX A;  1JOK A;  2FHT A;  4C2M B;  2DNC A;  4EQN A;  2Q8I B;  4XDX A;  2R7Z B;  3OOC A;  1O80 A;  1KNE A;  4U67 3;  2F0H A;  1Q12 A;  3ND8 A;  1EYC A;  1A3U A;  5TSS A;  3ERQ A;  1JB3 A;  1G8Z D;  2F0V A;  2QF7 A;  3M3Y B;  2K03 A;  3NTK A;  1RJT A;  2KOL A;  1PTO F;  1LTI D;  1MSG A;  4N9P A;  2JP1 A;  2ZT9 C;  3TP7 A;  2XWB B;  3D4D A;  3L7Z C;  1QJO A;  3PUZ A;  1RTO A;  1Z7T A;  4KK7 A;  1EY5 A;  4PNY A;  3DM1 A;  5DM6 3;  2L55 A;  4DK0 A;  3KBG A;  2F0W A;  4CJ1 B;  2NTS A;  2EYL A;  2AQ1 B;  4R9W A;  3IFT A;  2EYO A;  3GTK B;  1FGB D;  2Y0S B;  4L63 B;  1PZK D;  1EOT A;  1DXM A;  5D65 A;  3WOE A;  5EBD A;  5G3L D;  2L0C A;  5D3I B;  2VXW A;  3NHH A;  1AFP A;  1D5Z C;  3V05 A;  1CA5 A;  3GV3 A;  2EOT A;  4A3B B;  2EYH A;  2F0E A;  3OIQ A;  1SEB D;  4IFD I;  4IN3 A;  4I7Z C;  4QIW B;  3HP3 A;  3QOJ A;  1A6X A;  1TS5 A;  3S1N B;  1K8M A;  1YNJ C;  3HOW B;  1STY A;  2A6E D;  2K33 A;  1SND A;  5NUC A;  1TWA B;  3K5O A;  4O42 A;  1EWH A;  1ILQ A;  1F2M A;  5T1I A;  3HS0 C;  1TS2 A;  3S1R B;  5IIF A;  1STE A;  5C4X B;  3KLS X;  4CKE A;  3FEW X;  4DA2 A;  1HA5 A;  1CQF A;  5JJZ A;  4A3M B;  5JEA J;  1RD9 D;  1LT3 D;  4MHE A;  3GQB A;  1NR4 A;  1II3 A;  3U9S A;  1PXU A;  2E76 C;  4ZQ3 A;  1CQV A;  4DNR B;  1LTA D;  2BA1 A;  1TWG B;  2IT1 A;  3S17 B;  4QCL A;  1BCP C;  4KY5 A;  3HOX B;  5G3L F;  2AQ2 B;  4K2K A;  3NBH A;  5ELC A;  4UAI A;  3BDC A;  2F0I A;  1OO9 B;  4XQJ A;  2VUM B;  2F0Q A;  2K1B A;  2XVS A;  1B50 A;  4IFD J;  3AU7 A;  3CRK C;  2SEB D;  4DAP A;  1RTN A;  1DOK A;  3GD7 A;  3S15 B;  4FO2 A;  1QG7 A;  5EKL A;  1F2Z A;  4BBS B;  1LAC A;  3C1F A;  1EY4 A;  3N6R A;  2JEB I;  1SYG A;  1J8I A;  3AB9 A;  4LJZ C;  5ELB A;  4CHT B;  2B2U A;  5FLX L;  5CBE E;  3HGB A;  1I4X A;  2BDN A;  4G7O C;  4V0B A;  3TME A;  4IUP A;  1DJR D;  2IX1 A;  4ZYS A;  5CBA E;  4EQP A;  1Y8O B;  4CKB A;  1ONL A;  3LX0 A;  2EYF A;  4FF2 A;  1CZG A;  1E2V A;  4C3H B;  3NPP A;  1EY6 A;  3CU7 A;  4ODG A;  2L11 A;  1HFG A;  5IGB A;  5C4Z A;  1L0X B;  5CYU A;  4C3H G;  5M3F B;  2A73 B;  2B2Y C;  4OL7 A;  5C3E B;  2EDG A;  4XYQ A;  3R3O A;  1SYC A;  3OWF A;  5C0X I;  1F9R A;  1QB5 D;  2RDG A;  3KUP A;  2IL8 A;  2QCP X;  1O7Y A;  2EPB A;  3D4W A;  3OMC A;  3H0G B;  4HR7 B;  3J80 L;  3BVM A;  5E3F A;  5JAV A;  3DXJ C;  4NMZ A;  1KDC A;  3M7G A;  1LTT D;  2L1B A;  2MHV A;  3L9A X;  1F2L A;  4ID6 A;  2B2W C;  1O78 A;  2KHS A;  3VYT A;  5C3X A;  1FNV A;  4Z9C B;  1M4V A;  1D6E C;  2D62 A;  3M7N A;  4C3J B;  4G4K A;  4RHR A;  3GV6 A;  2CVR A;  3SK5 A;  4RFB A;  4BWG B;  5C0X G;  1QE6 A;  2EYP A;  1WTV A;  1SSO A;  2RDF A;  5I6W A;  5I4D A;  5JVG 3;  4O1N A;  2H4O A;  1EEI D;  1SNP A;  4NW2 A;  2JYO A;  1KTK A;  2B2T C;  4J6H A;  1JE4 A;  1LLR D;  1BR9 A;  2B2V A;  2WIN B;  2JA5 B;  1C4Q A;  1SNM A;  3H3V C;  1XXG A;  4DXF A;  3M85 A;  1SE4 A;  4A3E B;  1ET9 A;  2HCI A;  1Y69 U;  3BYT B;  3P1H A;  2A74 C;  4XYO A;  4IUN A;  2MP1 A;  2PZW A;  2D9U A;  5KGU A;  2E74 C;  2KA7 A;  4HCS A;  3V96 A;  5IOC A;  3HZX A;  1A3T A;  3VYR A;  1B9M A;  4FXK C;  1BOS A;  2AQ3 B;  2K7V A;  1ESF A;  1IHZ A;  4OGQ C;  3TP5 A;  1D2B A;  3QB3 A;  1JQY D;  2K05 A;  2F0U A;  4RCO A;  3VYS A;  4IUR A;  3E5S A;  3MAQ A;  1I6H B;  2A6H C;  1TWC B;  1STH A;  2KQ3 A;  3NBI A;  1PRT B;  4IZ8 A;  1TS3 A;  4UDU C;  4DNT B;  3GTG B;  3MTS A;  5CMD A;  3BZD B;  2Z4I A;  3PUY A;  2Z8L A;  3OIP A;  1LV9 A;  2ZXR A;  3CKI B;  3Q23 A;  3GTM B;  1KDB A;  4OIK A;  1ILP A;  1B2T A;  3NP8 A;  2ICE C;  4WOR A;  1MGS A;  2PMZ B;  2ID0 A;  5CV9 A;  2SOB A;  2PQE A;  5EKK A;  1QOH A;  4QF4 A;  1R9T B;  1VMC A;  4RAU C;  1EQT A;  4AYB B;  1BQQ T;  4DAV A;  1XX8 A;  5KYL A;  1F77 A;  4RKB A;  4C56 C;  2QKI C;  1TS4 A;  1G91 A;  4K5V A;  3NTH A;  1MI2 A;  4XTC S;  1PRT D;  3C3L A;  4KY6 A;  1NSN S;  2YYZ A;  3C46 A;  5C5M A;  1BXT A;  3NWT A;  5K36 H;  5IT9 L;  3SXH A;  4J8Q A;  2JSO A;  2M9V A;  2PYK A;  4BA2 I;  1TKW B;  3ND9 A;  1G29 1;  3QWN A;  2EXZ A;  4DN4 M;  1B44 D;  3HOV B;  4IFD H;  4TRD A;  1C8C A;  1HTP A;  2NTT A;  3MXN A;  4XT3 B;  2XIW A;  2Q8R E;  3SHL A;  1A2T A;  4K8J A;  1SYE A;  2F0G A;  1PLF A;  2M2L A;  1LT4 D;  2F0F A;  3DUZ A;  1R4P B;  2RVL A;  1VDZ A;  1H9R A;  1GHJ A;  2AUJ D;  2F0L A;  5C3W A;  1BBX C;  3AMU A;  1L0Y B;  1SJH D;  4RCN A;  2A69 C;  1JOR A;  1I4P A;  2F0S A;  5JOB A;  2NVX B;  2Q8T A;  2RKS A;  3T13 A;  3PIP 3;  4A93 B;  2NVT B;  3CHB D;  1IYU A;  3PV0 A;  3O13 A;  2BE5 D;  5I2X A;  3NUC A;  2XRQ D;  1PRT F;  3A8K E;  2O2L D;  3IAY A;  1ENF A;  3A56 A;  3TP8 A;  1TU2 B;  1JC7 A;  1F9Q A;  5IT9 E;  3PUW A;  1HUM A;  5KNB A;  2K28 A;  2IWH A;  3I4L A;  3DMU A;  4B08 A;  5FO9 B;  3UI2 A;  4K14 A;  1WTX A;  1NUC A;  2A68 C;  5KNC A;  1SMY C;  1SAP A;  1PYW D;  1E2W A;  3OHX C;  3Q0A A;  3NQT A;  4ZK9 B;  2PO4 A;  3FDT A;  1R4Q B;  2R92 B;  2FMC A;  5COR A;  1SNC A;  2EJG C;  4IUU A;  1TVX A;  2JE6 I;  1XWE A;  1JCK B;  3FPU B;  4FVM A;  3MEH A;  2M00 A;  3EVQ A;  3SE0 A;  2N55 A;  2F0P A;  4X3T A;  3GTL B;  2CW0 C;  3M4Y A;  2OXP A;  5DAU A;  1GUS A;  2NN6 I;  2F3V A;  1TT2 A;  1YNN D;  5M5X B;  3MC0 B;  1H9S B;  4A3J B;  5JEA G;  3K6O A;  2PZT A;  2L9H A;  3HRZ C;  2G9H D;  2F0M A;  5KYI A;  1EY9 A;  3X3N A;  5F2D A;  3I70 A;  4IUV A;  5IGE A;  2WV6 D;  2LS0 1;  2I46 A;  4HTH A;  1S5B D;  2E2D C;  5K36 G;  2NN6 G;  4ILW A;  3I8Z A;  3DWA A;  2F4I A;  4XQN A;  4ZLT F;  3MFY A;  2NUC A;  1O7Z A;  4ZRZ A;  5C0X H;  5CV8 A;  3W3A A;  1V1P A;  1I50 B;  1D1K A;  3I91 A;  2FFK B;  4HED A;  4IFD G;  3KLS A;  2CQA A;  4ZKC B;  3HOU B;  1B9N A;  1SXT A;  2PCF B;  3R2I A;  1GXD C;  1FYC A;  1I4R A;  3BVG A;  5EPK A;  2RQX A;  2IPK D;  2WAC A;  5LL6 S;  1JIC A;  1ZEQ X;  3NSW A;  1F9S A;  3WDN A;  2GA4 B;  2B63 B;  1LTS D;  1DOM A;  5IGG A;  3K5N A;  2DY7 A;  1OXX K;  3RZO B;  3LNN A;  1SE2 A;  2WKC A;  3ERO A;  4MIU A;  4ZUJ A;  3URY A;  5ISR A;  3BS1 A;  2AUK A;  1D1I A;  1GJX A;  3IL8 A;  1JWU D;  2I07 B;  3J7A F;  1CK1 A;  2A69 D;  1FD7 D;  5CV6 A;  2KCN A;  1XYI A;  1ENC A;  2K32 A;  2NWG A;  2RBM A;  4BBR B;  5E1F A;  3PIO 3;  4CBV A;  1S5E D;  1STB A;  5J39 A;  1EWC A;  4J1M A;  4CJ2 C;  1DD2 A;  4DF7 A;  3L3O C;  1T5E A;  2ZXO A;  1HXY D;  2Z1C A;  3U9O A;  3OW7 A;  2XWJ B;  5CGK A;  5JPM C;  3HEJ A;  2PZU A;  1ICW A;  5EBC A;  1FR3 A;  1VCI A;  2LMC B;  2IX3 A;  1HA6 A;  3D6C A;  2XNA C;  2B2U C;  4RH6 A;  2ENB A;  5E4W C;  3OPO A;  3F2U A;  3S2D B;  3H94 A;  1HPC A;  1ZXT A;  2NB0 A;  1UEA B;  4K2L A;  1PFM A;  1PZI D;  1IKM A;  3E0J A;  1JWS D;  4M1U B;  4FXG C;  3P75 A;  1B3A A;  1U4M A;  3RZD B;  3CQZ B;  4CGY B;  4RHS A;  3MZ5 A;  3I90 A;  5C4H A;  3SK4 A;  2K5Q A;  4A3I B;  3MHB A;  1B53 A;  4KI0 A;  3A54 A;  1SJE D;  2EVB A;  2R6G A;  1WD1 A;  3A55 A;  1ET6 A;  3T51 B;  2CW0 D;  1SFO B;  2NVY B;  4ZKB B;  1PFB A;  5FLX E;  3RD4 A;  3K0Y A;  4P2C B;  4M8A A;  2JA8 B;  3T56 B;  1EYD A;  1HCZ A;  5I6Y A;  1RHP A;  4RGN A;  1KAA A;  2BA0 A;  3QO2 A;  1PDQ A;  1HUN A;  3R93 A;  5BN4 A;  1BCP B;  1YNJ D;  3K59 A;  4G7Z C;  4DAY A;  4KJO A;  1OXU A;  3IKJ A;  3P20 A;  1WTW A;  4DGZ A;  4G7H C;  1O7L A;  3I72 A;  2C5C A;  1ESR A;  1LT6 D;  1EIG A;  3SR1 A;  5CV4 A;  3P7J A;  1EU3 A;  1X32 A;  4IUT A;  4CKC A;  3T4A C;  1IKL A;  4A3D B;  4KKT A;  4HN7 A;  3TZD A;  1DYQ A;  5JVH 3;  2B39 A;  1I4G A;  4WRD A;  5EPL A;  2F1M A;  1QNK A;  3TBI B;  3KF8 A;  5FO7 B;  2B8F A;  5KND A;  1TWF B;  1UNS A;  2B2V C;  5DM7 3;  3J80 E;  1BCP D;  2J7Z A;  2FJ2 A;  4FNF A;  4DFA A;  1CTM A;  1LTR D;  1IW7 C;  1D5X C;  2D2C C;  4L6T B;  5EQ0 A;  4Q0F A;  1Y1V B;  4Y7N B;  5E4X A;  1EIH A;  3KK7 A;  2NZ1 D;  2KUM A;  3K58 A;  1TY0 A;  1GUN A;  2R61 A;  1IL8 A;  2K01 A;  4ZAI A;  5EKI A;  3BYY B;  1PMR A;  1U9R A;  1RKN A;  1EEF D;  4KN4 C;  2X6G A;  4ULL A;  5J22 A;  1ENA A;  1UUP A;  4EGV A;  2Z4H A;  5D3D A;  2LFN A;  3Q6S A;  1ZKO A;  2WP8 J;  4K6D A;  5M5W B;  4FF4 A;  4NP5 A;  1GUG A;  2C9O A;  4A3K B;  2AWO A;  4KY7 A;  4PMC A;  4K5W A;  1E0B A;  1MSH A;  3EA6 A;  1WVL A;  3W2D A;  2R3Z A;  1FNU A;  4KTA A;  3S9W A;  1Q90 A;  4RWS C;  4ABN A;  3S16 B;  2A6E C;  5JEA H;  1MD2 D;  1H9S A;  2IX0 A;  5BN5 A;  1PZJ D;  1QIL A;  1BCP F;  1F9P A;  3GO5 A;  5ELD A;  1EY8 A;  1Y8P B;  3QG1 A;  1JOO A;  2DN8 A;  2RSO A;  1ZYR C;  3D8G A;  4Q5V A;  4TKO B;  2NN6 H;  3HKZ B;  2JEA I;  3E6Z X;  2ZXP A;  4KV6 A;  3VR3 A;  4BS9 A;  3KLR A;  2PPB C;  1LTG D;  2IW3 A;  4QUF A;  4CJ0 B;  5CC4 A;  1AP0 A;  4GZY C;  4ME5 A;  2B8G A;  3QOL A;  2E2H B;  1CM9 A;  1K8O A;  4PQX A;  4KN7 C;  2H1E A;  1J9O A;  5IGD A;  2MJ8 A;  5K5P A;  5I9P A;  2IJ0 A;  1GUW A;  1OXT A;  3D31 A;  3FKI B;  2KVM A;  2BCO A;  3DEP A;  1G2T A;  5FK9 C;  4KD4 A;  3A7L A;  3LWU A;  5M9O A;  3OMG A;  3S1M B;  5IGF A;  2L5T A;  2F03 A;  4JK1 C;  1X3P A;  2QEJ C;  1EZ6 A;  3TSS A;  4OO1 I;  4X3K A;  2OT2 A;  1AZQ A;  3MXG A;  3C2P A;  1F2Y A;  4EQO A;  3Q24 A;  4HSP A;  3T53 B;  1S5C D;  2F0J A;  5A35 A;  1WTR A;  2N88 A;  3VR5 A;  4L8J A;  2OF1 A;  2CHB D;  2EJF C;  1LO5 D;  1G2S A;  3MA2 B;  3TP6 A;  2PNR C;  1DZ1 A;  3S1Q B;  4FXD A;  4LK1 C;  3WOF A;  3VYU A;  4OO1 G;  5DEH A;  2V4D A;  1Q1B A;  1HHV A;  4K5X A;  1PFN A;  1EQV A;  1Z47 A;  2DNE A;  2KCC A;  5CV5 A;  5I2Y A;  4PMB A;  1E2Z A;  3ONA B;  3NXW A;  1TQO A;  3DWQ A;  1Y1W B;  1V1O A;  5ELE A;  1BDO A;  1IW7 D;  1DCZ A;  2KEE A;  3RLF A;  4YIJ A;  2BOS A;  3HOY B;  3PUX A;  1DOL A;  4XIG S;  4TSS A;  3FMC A;  1OXV A;  1CT1 D;  4C1N K;  2VB3 X;  4R8N A;  5EJW A;  5C6A A;  1EY0 A;  2A6H D;  3PO2 B;  4HCE A;  3FRP B;  4FYD A;  4H13 C;  3KBX A;  3VR6 A;  4R8I A;  1LAB A;  3S14 B;  2EYM A;  1S4Z A;  2EY2 A;  3RUZ A;  5HUR A;  4HMJ A;  3T16 A;  1CHP D;  1HFN A;  5KEE A;  2F0T A;  4QMG A;  2OEO A;  4LMQ D;  3D4R A;  3J7A V;  3NK9 A;  1CI3 M;  1HQM C;  4XXE A;  2TMP A;  4NDX A;  4U68 A;  2X69 A;  3QIA A;  1CFM A;  3HG9 A;  1FNW A;  4X3S A;  4A3F B;  2VNU D;  3NWS A;  2J0T D;  1A15 A;  1EL0 A;  5T1G A;  4WFN 3;  1EZ8 A;  1RDP D;  1ZYR D;  1NCV A;  2G9D A;  3VA5 A;  3QJY A;  4RGT A;  4OHJ A;  1I3Q B;  4RA8 A;  1A3V A;  1RF2 D;  4KJN A;  2KJX A;  3MFG A;  4OIJ A;  1Q1E A;  1SYB A;  5M3M B;  2KEC A;  4TQU S;  1QCB D;  1QNU A;  2EZV A;  3BG3 A;  1UAP A;  5JPN C;  5EPJ A;  2O5I C;  4N9T A;  5COY A;  2QIL A;  1LTB D;  1AEX A;  3OWE B;  3GTJ B;  3FPP A;  2F0D A;  2JA7 B;  4JBW A;  3DHQ A;  2RA4 A;  4C1N I;  2F3W A;  1VMP A;  1EY7 A;  1DM0 B;  4I65 A;  2XSC A;  1X3Q A;  5J1Z A;  1EFI D;  1U4P A;  3DWP A;  2VB2 X;  3PO3 B;  4IUQ A;  1VF5 C;  3K57 A;  1HTL D;  3K5M A;  3NTI A;  2K04 A;  4S3S A;  3D3R A;  2EYJ A;  3EQL C;  4FP5 D;  2SNS A;  4FF3 A;  4H7B A;  4DK1 A;  1SE3 A;  1XTC D;  4F8M A;  2O4X A;  5IOD A;  2LKV A;  2J4X A;  2MPM A;  2MUY A;  2F0O A;  1I4Q A;  3IFD A;  3TDQ A;  1W6K A;  2B2Y A;  3CRL C;  4DXG A;  4B9W A;  1C48 A;  4KKS A;  2QDB A;  1H9K A;  2A68 D;  5LHY 1;  1BF4 A;  4H44 C;  5HGT A;  2MGS A;  5BN3 A;  3HOZ B;  1SMY D;  1PRT C;  1SBB B;  3FVQ A;  4K8I A;  1OXS C;  1TR5 A;  1W6J A;  1TY2 A;  4NKL A;  2WKD A;  3I3C A;  1V8Q A;  1KLU D;  2B2W A;  4HMI A;  3ZYY X;  4G57 A;  2EJM A;  3EJI A;  1WTO A;  1PTO H;  1NAP A;  1PTO C;  3BDO A;  4X3U A;  3H91 A;  1WD0 A;  4WJW A;  5FKA C;  1GUO A;  1AZP A;  2L4N A;  4QB4 A;  4PV1 C;  4KHZ A;  1BNZ A;  1JR0 D;  4XQQ A;  5DNF A;  2WAQ B;  2A5H A;  1HQR D;  1AW7 A;  2B2T A;  2PW7 A;  1WCM B;  3OSO A;  1SYF A;  3V2T A;  2JA6 B;  5AFW A;  1JOQ A;  2F0N A;  4BY7 B;  3SDZ A;  1S5D D;  3Q22 A;  1ML0 D;  5CV7 A;  1Y8N B;  5CR3 A;  2HQE A;  1V1P B;  2WII B;  1EU4 A;  2LY7 A;  2DY8 A;  3TZU A;  2WB1 B;  4C3J G;  3K5L A;  4KHV A;  3S2H B;  5I9O A;  3I4N B;  3R2T A;  2BE5 C;  3N52 A;  1BUV T;  5IGC A;  5EGT A;  4ZUI A;  3TN2 A;  1CZW A;  5D14 A;  1GOZ A;  2E2I B;  3R8B A;  3J81 L;  3GTP B;  1WTQ A;  4HSV A;  2PW5 A;  1Z6H A;  2ICI A;  1B1Z A;  1SNO A;  4E6I A;  4H0L C;  3G6J B;  3I73 A;  3GP7 A;  3MXP A;  2E2J B;  1ROD A;  2HDL A;  2F0K A;  1Q8I A;  3ITP A;  5C0X J;  1T5X D;  2L12 A;  1U4L A;  4QUC A;  3MWY W;  4OO1 H;  3BVZ A;  2X6L A;  2EE1 A;  2K5W A;  2SDF A;  4IAL A;  1H9J A;  3VR2 A;  4C3I B;  4HAE A;  1KLG D;  2RSN A;  1GUT A;  3H6M A;  4KD3 A;  4F7X A;  1TWH B;  1A2U A;  1TII D;  4V19 0;  3PMF A;  1I4H A;  2D5D A;  5C4J B;  3PUV A;  3H09 A;  1CA6 A;  1K83 B;  4C3I G;  2R93 B;  5A2Q L;  3SEB A;  5FO8 B;  3SK8 A;  2HDM A;  2HUG A;  2JXM B;  1CHQ D;  1DON A;  3GTO B;  4KMU C;  1STN A;  4BY1 B;  1YNN C;  1GHK A;  3A8J E;  3SK6 A;  3NQI A;  4FF1 A;  1STG A;  5ELF A;  1RCV D;  2BDO A;  3I4M B;  4LAA A;  2HCC A;  1KDA A;  1JWM D;  4DU9 A;  5KRU A;  5LL6 X;  2NVQ B;  3J81 E;  2TSS A;  1I6V C;  3SVM A;  3BDL A;  2NYZ D;  5C44 B;  1QWY A;  1MBY A;  2O5J C;  1AN8 A;  1PTO B;  3J7Y W;  3JAM L;  1HRJ A;  3A7A B;  1SYD A;  3DEO A;  1NR2 A;  4B9X A;  1BO0 A;  5M5Y B;  5FOB B;  4K6L A;  1M8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...