5E4XA

Crystal structure of cpsrp43 chromodomain 3
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
50
structure length
50
Chain Sequence
YAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Signal recognition particle 43 kDa protein, chloroplastic
publication title Structural basis for cpSRP43 chromodomain selectivity and dynamics in Alb3 insertase interaction.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 4
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2015-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5e4xA00
4X3KA 1PLFA 4U68A 1KNEA 1VMPA 2FJ2A 4XT3B 1AZQA 3ONAB 1F9SA 3F2UA 5DNFA 1DOLA 1B4OA 1BO0A 2X69A 1G2TA 1QNKA 2K1BA 2KVMA 1KNAA 1NR2A 3GV3A 1X3QA 4HEDA 2HDLA 2K28A 4HAEA 3FPUB 4X3TA 4MHEA 3UI2A 1BBXC 4DN4M 1F9QA 5CBAE 1MGSA 2Q8TA 4IUTA 3TZDA 4HSVA 4X3UA 2L4NA 1ICWA 1VMCA 1O7ZA 5EQ0A 1ILQA 2JP1A 3KBXA 1WTPA 1NR4A 5D14A 1RTOA 1J8IA 1WVLA 1SDFA 2B2WA 3DEPA 1DOMA 2EE1A 2L1BA 1WTRA 2JYOA 1MI2A 1ZXTA 4CJ1B 1DOKA 4ZK9B 1U4PA 1RJTA 1CM9A 1U4MA 2B2VA 2NYZD 2KUMA 4RWSC 5T1IA 1DONA 5T1GA 2B2UC 2BDNA 2MGSA 3FDTA 3P7JA 4IUPA 5AFWA 4R8IA 1O80A 5CORA 2KOLA 2B2YA 5JJZA 1PFNA 2R3ZA 1QG7A 2X6LA 1EIGA 4ZKCB 1MSHA 2MP1A 3R93A 4OIJA 2B2TA 1AP0A 1WTQA 3N52A 2H1EA 1CA5A 1RTNA 1AZPA 1WTXA 1HFNA 5CMDA 3HP3A 2FHTA 1X3PA 1G91A 5EJWA 5CBEE 1HHVA 3G7LA 1X32A 1HFGA 1EOTA 5EKIA 1WTVA 2Q8RE 2CVRA 1JE4A 5E4XA 5EPJA 3IFDA 1A15A 2L9HA 1U4LA 3D6WA 1IL8A 1HA6A 4ZKBB 1F2LA 2DY8A 2HCCA 4HCSA 1Q3LA 1PFBA 2FFKB 2L11A 2B2WC 3DEOA 1GUWA 1U4RA 3MTSA 1EL0A 1HRJA 2DY7A 1G6ZA 1WTWA 1HUNA 1B3AA 1SAPA 2HCIA 2J7ZA 1B53A 2K01A 1G2SA 4IUVA 1MSGA 2B2VC 2XIWA 4MN3A 5D65A 4IUQA 5COYA 2HUGA 4QUCA 4RA8A 2N88A 1O7YA 4O42A 2B2YC 4QUFA 3LWEA 4UAIA 4RAUC 2FMMA 3DM1A 4R9WA 1B50A 4XT1B 1J9OA 3IL8A 2KECA 2B2TC 1HUMA 2RSNA 3I90A 1M8AA 2SDFA 2K03A 1NCVA 1IKLA 1E0BA 2MPMA 2NZ1D 5E4WC 2L12A 3Q6SA 2RA4A 1XYIA 1S4ZA 1DZ1A 2RSOA 2EPBA 3H91A 2RVLA 1PDQA 4X3SA 1XX8A 3I8ZA 1RODA 4ZAIA 1QE6A 5EPLA 3MWYW 4XDXA 4CJ2C 3TN2A 4ZLTF 1EQTA 2M2LA 3SVMA 1LV9A 2MJ8A 2KEEA 2VXWA 3GV6A 4IURA 4OIKA 4NW2A 1C8CA 2EOTA 1BNZA 2FINB 4LMQD 1WTOA 4IUUA 1PFMA 5EPKA 4CJ0B 1BF4A 1WD1A 1B2TA 2D9UA 2HDMA 2K04A 1ESRA 1NAPA 1RHPA 2B2UA 2NWGA 3I91A 1JICA 2K05A 2IL8A 2N55A 1F9PA 3QO2A 1TVXA 1CA6A 2KEDA 2X6GA 1ILPA 1SSOA 1EIHA 1WD0A 1IKMA 3I3CA 1F9RA 3KUPA 1ML0D
chains in the Genus database with same CATH superfamily
1Q90A 5DNFA 4DV5Q 2AUKA 3CCJA 1DGSA 2X69A 4B08A 2JA6H 1EU3A 3VYSA 1BQQT 2AUJD 3ER0A 5HGQA 3TZDA 1X6OA 3KDFA 1O7ZA 2OEOA 1EY8A 1YNJC 5D14A 3J80c 4FF3A 4KY6A 1CZWA 3GTPB 3RZDB 5IGBA 2JYOA 2R92G 3A0JA 3GTOH 3ERSX 1HCZA 4KTAA 5M3FB 1Q12A 3M7NA 1Q82C 2KUMA 2JA7B 1XNRL 2NVYH 1KAWA 2MQHA 3FDTA 3HOXH 1SNOA 1VQ8A 1PZKD 2YV5A 2KOLA 3CCRA 2CKZB 1RL2A 3CCUA 5JPMC 4AIMA 3CRLC 3I4NG 4BBRG 3N52A 3IRBA 4CHTB 5G3LD 2A74C 4EQPA 1B9NA 1D8LA 4Q0FA 4TQUS 2JA5B 2EJMA 2JXMB 4P71A 2ZTDA 3TS2A 5E4XA 4A3KG 2I5MX 2VQEL 2L9HA 4QIWE 1U4LA 2CWPA 3L9AX 3D6WA 4KHPL 2UXBL 2EDGA 4QJFA 1PYBA 1VQ5A 3WOEA 3K0YA 1QOHA 2K01A 4B3RL 1BCPB 2XIWA 2NVXH 1UEAB 3W1BA 2ZXOA 4MN3A 2JE6I 1PH5A 5KGUA 3RN2A 4ZRZA 2NTSA 3V05A 3F2DA 1J9OA 3U9OA 2RCFA 3NXWA 4A3EB 1EEID 1UE1A 2K03A 4JI6L 1W3SA 2UUCL 1SBBB 3F1ZA 5F2DA 1L1OC 3OIQA 3S17B 1VQJA 1GHJA 1SE2A 2EY1A 3S1NH 4HJ7A 3CC7A 3GV6A 5K36H 4DV1Q 1YNXA 4NW2A 4JBKA 1E1OA 2VL6A 3BYYB 3ULPA 4A3DH 1B2TA 3K7UC 3MXGA 2K04A 2Z6KA 3H09A 3SK8A 1SJHD 5KNBA 4P75A 4JI8L 3JAML 2BE5D 1IKMA 3I3CA 4X3KA 3EROA 3DWAA 2QEJC 3H0GH 2MO0A 1XPOA 5C6AA 2R7ZG 4YHHL 1KNAA 1ET9A 1X3QA 2L15A 3E0EA 4N9PA 2XN9C 5CC4A 4DR2Q 3RZOB 3BVGA 3TDQA 4DXFA 4X6AH 3KLWA 2P5ZX 1VMCA 1ILQA 3KBXA 1RCVD 2AQ3B 3BDLA 5CGKA 5FLXE 4JI0L 1LTTD 3CC2A 3STBD 1TWCB 3PIPA 2XVSA 3M9BA 2Q8IB 4LUZA 1YZ6A 2TSSA 1CQVA 1QNUA 2BDNA 1K0RA 1GXDC 3NPPA 3NQTA 5BN5A 5JJIA 4GLVB 1Z47A 1WCMG 4YY3L 1ET6A 5H1SE 2IWHA 4BY7G 5M5XH 4O0AA 3NQIA 1K3BC 3S1MB 1JOQA 5C44G 1PMRA 1B3QA 1GOZA 2D0PA 2YTVA 1SLJA 5IE8A 4HIKA 4JI4L 3PO2G 4P73A 4DKAC 3PIP3 2ZTCA 5G3LF 1WFQA 1V1OA 3R2TA 3P20A 5LMNL 4H13C 3EIVA 5IWAQ 5IYCG 5M5WH 5KRUA 4DV4L 1LACA 2L11A 3A8JE 2IHEA 3BDOA 1TWHB 1Z7TA 5FK9C 1B3AA 1WYDA 4PG3A 4BXXH 3GDEA 2HT1A 4A3IB 3I4MB 1EEFD 1LO5D 1STNA 2DJGC 5BN4A 1PRTC 3HEJA 4A3JH 1TXYA 5LL6X 4HJ5A 2KBNA 4DUYQ 1HUMA 2PZTA 3I90A 3MXPA 2DGYA 4GOPC 5M5YB 1SNDA 4GNXB 4ZAIA 5FLMH 1ESFA 3DXJC 3MWYW 3NSWA 4L5QA 3I4LA 4JI2Q 2R7DA 5BR8L 4A3BG 3VR6A 3H6MA 1YI2A 2D0OA 3DHQA 2B8GA 3E5SA 3NBIA 1RHPA 1D1KA 5JEAG 1EQQA 2K05A 2IX3A 2I5LX 1IYVA 2UXCL 2KEDA 3A55A 3FMCA 2F0LA 1P8LA 1V8QA 5FJ8H 4IQZA 4K2KA 2NVTB 1ML0D 4LFBL 3A56A 3H3VI 4RHRA 4RG1A 5C3WA 4HJ9A 2Z4IA 2KHSA 4A3FB 2ES2A 1STHA 2XGTA 4GKKQ 1S5BD 2RBMA 4B9WA 3RZDH 3GTPH 1R4PB 3D4DA 4IPGA 4BY1B 4UP8A 3U4ZA 2L4NA 4JVZA 5M3FH 2RCNA 3HOYB 1M90C 2JA7H 3S1QB 1AE2A 2PPBC 3ZJYC 1I4QA 1K0SA 5EGTA 5FO7B 1HXYD 3BZDB 2K6AA 1BKBA 4DF7A 1CM9A 2NYZD 1KDCA 5T1IA 3PF4A 1CZGA 1T9HA 2EYPA 4IUPA 2FXQA 4J1MA 1O80A 2AMCB 2E76C 4CBVA 1K8AC 4I7ZC 4FF1A 2IX1A 5FLXL 2JA5H 2ID0A 1DJRD 2E2JB 1N34L 4LF5Q 2R93G 3MZ5A 1Y69U 1IW7D 1G91A 2SEBD 4ZCKA 2V4DA 1LABA 3VA5A 1Q1BA 2EJFC 3I7FA 2A19A 3HOWB 5AJ3L 3NP8A 4KHPQ 2UXBQ 1II3A 2PMZE 2DY7A 3EFXD 2NB0A 3BDCA 2HCIA 4DR4L 1VQFA 1EYGA 4A3LG 1MSGA 2B2VC 1JQYD 4UP9A 1S3OA 3J80i 1X56A 4IO9A 4R4CA 5IOCA 1CTMA 3FHWA 5GAHC 3S17H 3DM1A 2F1MA 4DUZQ 1NCVA 3KYHC 4JI6Q 1STEA 2WV6D 1UE5A 3H91A 2E75C 2AQ2B 2UUCQ 1B7YB 1C4QA 1GUGA 2KEEA 5C4HA 4PV1C 4OX9L 1JORA 4DR3Q 3PUWA 1NTGA 2BDOA 2EYMA 3BS1A 1KRSA 5C3EG 1X55A 2IPKD 1CA6A 1FD7D 1B8AA 3D8GA 1TR5A 4FP5D 2JA8H 3RZOH 4JI8Q 5JVH3 3KF8A 2LXJA 3IFTA 1VMPA 2FJ2A 2VQFL 1F9SA 1WOCA 4GLXA 4K14A 5NUCA 1E22A 1STYA 4WFN3 4HJAA 3D4RA 4HEDA 4UHVA 4PZ8A 3GTMB 1TWCH 3HOUB 1F2YA 3OPOA 4X62L 4B3MQ 2R92B 1HH2P 1AW7A 4DA2A 2JK8A 5GAGC 4F8MA 1K83B 3TZUA 2A69C 4JI0Q 1XMQQ 4DR6L 1VQMA 5CV4A 1V9PA 1STGA 3Q23A 3J81i 3T51B 2WKDA 3S1MH 3I4NB 4IPHA 1PFNA 1QG7A 2NN6G 1V43A 1P16A 2ICIA 2IW3A 4JBJA 1LYLA 1LTBD 1L1OA 2KHJA 4WORA 1BCPC 2EQSA 3NUCA 4JI4Q 1X32A 1HFGA 1R9TB 4BBSG 3D0FA 1WTVA 1VQCA 1NMFA 4RFBA 5ISRA 2PO4A 1MJEA 4XYQA 3HOVG 2HQLA 4A3IH 3I4MH 2B63B 1PFBA 1ICFB 4LWCA 3S15H 1HRJA 3V2TA 3CCEA 2PQEA 4L5SA 1LTRD 4J6HA 3CRKC 5M5YH 3DWQA 5EBDA 4F88A 1IYJB 4GKJQ 3CMEA 2VY3A 1J5EQ 2A5HA 5CV7A 1LTLA 3S2DB 1LT6D 4XDXA 1CHPD 1X3FA 4NB3A 1KIXA 2EYJA 4DK0A 4IURA 4OGQC 4LFAL 2J4XA 5BR8Q 1HQMC 3U9SA 2D9UA 1Y1VG 2KQ3A 5KIXA 2NVTH 1CQFA 1T5EA 3MVVA 3I91A 5I2YA 3T4AC 4TRDA 3G71A 3HRZC 1GUNA 3T1YL 4A3FH 3AQQA 4GN3B 2UXCQ 4YCWA 5KNCA 5C4XG 2YTYA 4BY1H 1CFMA 3HOYH 1VDZA 3NWTA 3S1QH 4LFBQ 3KF6B 2CCZA 3LGJA 4DV1L 3UE1A 1I4PA 1KABA 2Z6BA 3AFQA 4C1NI 3L7ZC 1SE4A 1JWSD 1V1PB 1TWAB 2JEAI 3URYA 1EUJA 2G5DA 1YBYA 2MO1A 1YHBA 1ZXTA 3T16A 1DD2A 3E3XA 2E2JH 4HMIA 4IPCA 1C9OA 1TKWB 3D3RA 2LXKA 2MGSA 3FKIG 1E3PA 4L63B 2KCMA 1PH6A 4BY7B 2MP1A 2PQAB 4GOPA 2DUDA 5C0XG 3PO2B 1PYWD 3PIOA 3OTOL 3C46A 5IYDH 3I73A 1ZEQX 3HOWH 4QY7A 4OO1H 1EY5A 3Q8DA 3L2PA 1JJCB 1ZKOA 3MHBA 3EVQA 3NK9A 4DR1Q 4HIDA 1QWYA 2LY7A 1F2LA 1VQOA 1X9NA 1N8RC 4DK6C 5AJ3Q 5DM73 1HR0Q 1B53A 4U673 5I4DA 4C3IG 4GNXC 4DR4Q 5DAUA 2R61A 1EOVA 2F0VA 3PIO3 1MJCA 2GVBA 2CWAA 3CCLA 2ZXRA 2RDHA 4IFDJ 3LWEA 4EX5A 5EAYA 5IY0A 3IL8A 2CH4W 2QW7A 4GS3A 3CCVA 1SEBD 1XTDA 2KHIA 5IWAL 1LM0A 1S4ZA 2RSOA 4X64Q 3DWPA 2A68D 2CQAA 3T1HQ 1PH8A 5IP7H 4FF4A 3SVMA 1LV9A 4OIKA 1I4RA 4OWTB 1ONLA 1WTOA 1EIFA 3H94A 3KLSX 4OX9Q 1F2ZA 3LNNA 1CKNB 3K8AA 1SRUA 2CFMA 1EY6A 3SGIA 3UDXA 2N55A 3NEMA 1GKHA 4DUYL 1VQ7A 1EY9A 2ZM6Q 1EIHA 4DNRB 1SYEA 3GTMH 1PLFA 4XT3B 1VQPA 3HOUH 2BCOA 4DNIA 4LUOA 3A7AB 2R92H 4JI2L 4C3HG 4C2MB 1J6QA 3JAME 1PH9A 1K83H 3M4QA 3PUVA 1GHKA 5IYBG 4JOIC 1FNVA 1ICWA 5EQ0A 1UE7A 3OWFA 3J7ZC 1DYQA 1SYDA 4DV0Q 3U58A 3I4NH 5LMNW 4K0KQ 2B2VA 3B6YA 4WRDA 3W5OA 5K5PA 1JE5A 3G4SA 3A74A 1GVPA 4B3SL 5AFWA 4A93B 4ME3A 4LF6L 1NUCA 1I94Q 3C1EA 4JBWA 3O13A 4GKKL 1PH3A 2R93B 4KN4C 1R9TH 2KJXA 2Q2TA 4KK7A 2H1EA 2F3IA 4XQNA 4DXGA 3HZXA 5CMDA 2FHTA 5EJWA 2B63H 3I55A 4H02A 1XMOL 1QVFA 4PMWA 5KYIA 1S72A 4XQJA 1QUQB 1A3UA 2B2WC 1N33Q 1EL0A 1WTWA 2J7ZA 1TS3A 3NTIA 2UUAQ 1U5KA 2OXPA 1VQ9A 4LF5L 3WOFA 4HIMA 4DV3L 2VS1A 5ELEA 3S2DH 4R4TA 5FKAC 4XT1B 1X65A 2B2TC 1FR3A 5IP9G 4BA1I 1XX8A 1QE6A 2B39A 2Z0SA 4H0LC 4PMBA 2D5DA 3M4OB 2K14A 1UUPA 3EN2A 3TSSA 1OXUA 1IXRA 1GO3E 1KDAA 1H9RA 3UE0A 3HG9A 2F0TA 4LFAQ 5C3EB 3GQBA 5HURA 5CV9A 4R4IA 2QCPX 1HA5A 2IL8A 1HNXQ 3MEHA 3PSIA 2TMPA 2ASBA 3KFUA 4L5RC 2JA6G 4DUZL 3T1YQ 1WD0A 2YTXA 4XYOA 4HIOA 2F0UA 2EY6A 3HFZB 5FO9B 1R4QB 1G2TA 1TWAH 5I6WA 1YJ9A 4HCEA 3KOJA 3J81c 1IBLL 1BBXC 4L8JA 3HOZB 2Q8TA 4DR3L 4X3UA 3K5OA 4AYBG 5E7NA 2CH4A 4XIGS 3HOXG 1RTOA 1I3QB 4B9XA 4JG2A 2EY5A 4JI5Q 3J7AV 4BY7H 2ATWA 1VQAA 1X3EA 3PUYA 3PO3G 4DR7L 4LF7L 3PO2H 5IGEA 2SOBA 2XSCA 4EQOA 2ICEC 1LUZA 3K58A 1Q8IA 2JA8B 1SYBA 2IHFA 1NE3A 4DAPA 2I46A 3QJYA 4V0BA 2BE5C 2UXDL 4X65Q 3GP7A 4B3ML 3S2HB 3OTOQ 2RQXA 3S14B 4R4OA 1XMQL 5J3BA 1RIPA 5KEEA 2PZWA 1NNXA 2NUCA 1B9MA 4LK1C 1EYDA 1TT2A 4PMCA 1LTAD 2PNRC 2NVQB 3STBC 4POGA 4QIWB 1SNMA 4LNQA 5I6YA 3BZKA 5CV6A 2L0CA 1FGBD 2B2YC 3TQYA 1STAA 5IIFA 5LL6S 3TEHB 5JPNC 4Q5VA 5K36G 3QB3A 2NZ1D 5JEAH 3W3AA 4A3DG 1H9JA 2BH8A 4ZLTF 3QG1A 2R7FA 3SR1A 3NTHA 1C8CA 2KA7A 2FINB 3M4PA 4GN5A 4M1UB 5EPKA 1D5ZC 1B1ZA 2WB1G 5C0XJ 3BYTB 1ESRA 4R8NA 4GKJL 3S15B 3H0GG 1TS4A 1J5EL 2Y0SG 3RN5A 2PI2E 4C2MH 5J22A 1PH7A 1KQSA 3FVQA 3ONAB 1GUSA 3F2UA 1EY4A 4OL7A 4EQNA 5C5MA 2K1BA 3J80L 4X3TA 5BN3A 4DN4M 3CXCA 1S5CD 5LMUL 5L37A 4DV6Q 3MC0B 1WTPA 1G51A 4ILWA 4A3MG 2VUMB 1OTCA 4A93H 4OONA 2E2HB 1JJ2A 1Y1WG 1CKMA 5IGCA 2R93H 1DOKA 2ALYB 4A3CH 4GNXA 1U4MA 1OXSC 4NPSA 4G4KA 1FNWA 4F7XA 5JJZA 4B3SQ 4LF6Q 3SK5A 4ZKCB 3R2IA 4LF9L 2OTLA 3VR5A 1JC7A 1UE6A 2A6HD 2EYLA 2N8NA 2HD3A 3Q24A 1CA5A 4ZYSA 2F0DA 1K3RA 5A35A 4IFDG 2WFWA 1A62A 2EJGC 1YNND 4YCUA 3F8TA 1HQRD 3D4WA 2KENA 4IFDI 1TWFB 5JAVA 2F0FA 3HKZG 1XMOQ 5J1ZA 4K5XA 4GZYC 2K5WA 4CGYB 1KHIA 5C3XA 4ZKBB 4K5VA 4ZUIA 4KN7C 4P74A 3AFPA 3Q0AA 1SAPA 3WDNA 2ZT9C 4KV6A 1I5FA 2L5TA 1H9SB 4RA8A 5C4JB 4DAMA 4DV3Q 4RAUC 3KLRA 2FMMA 1L2FA 1XXGA 1XJVA 3M4OH 3EBEA 1K73C 4DR1L 4JBMA 4POFA 3J81L 1HNZQ 1EQRA 4FVMA 5JJLA 5LHY1 1SYCA 3AEVA 1HZAA 1PDQA 4JOIA 4LFCQ 5TSSA 5C3EH 1IW7C 2OQ0A 1HR0L 4JI1Q 1PH1A 5FJ8G 4UDUC 4RKBA 3K5LA 4KY5A 3K80C 3M7GA 3RNUA 2QDLA 3W2DA 3F2CA 2LSSA 1TVXA 1K9MC 4KKSA 1N36L 4IOCA 2K4KA 1SSOA 1PV4A 2AWOA 3A8KE 3PGZA 3HOZH 4X64L 4C3HB 4U68A 1KNEA 3RMHA 5M3FG 4FXGC 2JA7G 2D2CC 1C0AA 2QGQA 1QNKA 4QMGA 3K81C 4OWXB 2ENBA 3T1HL 1I3QH 2K5NA 1XPRA 1F2MA 3K5NA 1UAPA 4MHEA 4V190 1F9QA 1IBLQ 1MGSA 1YHQA 1ZYRD 1N9WA 2LKVA 2F4VQ 1EFID 1PH2A 1J8IA 2B2WA 1D5MC 2JA5G 2ZM6L 1TY2A 1FL0A 4A76A 4RWSC 1U9RA 1TWGB 4DR7Q 3RR5A 4LF7Q 3OW7A 4R8IA 3S2HH 1H9KA 2PYKA 3S14H 4OIJA 2B2TA 1K8MA 3AMUA 3BU2A 1RTNA 4DAYB 1Y14B 2UXDQ 2IX0A 1BBWA 4DV0L 2QF7A 2WP8J 3G7LA 1JMCA 3GTLB 4K0KL 1H9MA 1VCIA 2Q8RE 1JE4A 2NVQH 4ID6A 3F2BA 5I2XA 4A3EG 3E9IA 4EVOA 1D5XC 1HNWQ 1IL8A 2A6ED 2DY8A 2F0KA 1I94L 1GUWA 4C3JG 3SE0A 4BBRB 3VDYA 2F0IA 1EFWA 4AH6A 1S5ED 4B3TL 4QB4A 2NN6I 4O42A 1E24A 2PMZB 2F0WA 4DFAA 3CPWA 3GTJB 4X66L 4NXNL 1VF5C 4UY8C 3CD6A 4R9WA 4A3KB 4NXMQ 3BJUA 4CKEA 1NY4A 3CC4A 2K50A 2MPMA 4TSSA 3W1GA 1PTOD 4LF4Q 3K57A 3TN2A 1N33L 3TBIB 3M3YB 2EYHA 3NE5B 2UUAL 5C4XH 5IT9c 1BNZA 4H7BA 4IUUA 3BVMA 2IJ0A 3VR4A 2HDMA 2BH2A 4OEMB 1HJPA 3P1HA 3GTGB 1H95A 4K6DA 4ZUJA 3I4OA 2WB1E 2IT1A 5JVG3 5JOBA 5M3MG 1DM0B 5FOBB 1DOLA 1JOOA 4DV2Q 2KVMA 3BZCA 2VUMH 4CDDC 2HDLA 2E2HH 2K28A 4CKBA 4DK1A 4HSVA 3MXNB 5LMUQ 4KD3A 3HGBA 4EQ5A 1Q81C 3FP9A 1HNXL 4NKLA 3SDZA 3PO3B 2L1BA 1XNQL 4LUVA 4RGTA 4WJWA 3KJOA 3ULLA 3CMAA 2NZHA 1RJTA 4I65A 1ASZA 2Z4HA 3K6OA 2R7ZB 3OWEB 5EBCA 2B2YA 1BVSA 2EYOA 1SMYD 1MSHA 4LF9Q 3RLFA 1AP0A 1JR0D 1I4HA 1TWFH 2I5HA 4CDCC 1BUVT 2EXZA 2Q2HA 4WJ3M 1LLRD 1HHVA 3S16H 1AE3A 4JI5L 1EQVA 1EOTA 1D2BA 2CVRA 4IN3A 3UDGA 1RDPD 3PMFA 5C4JH 2I07B 2RDGA 3KF6A 4Y7NB 1RD9D 5I9PA 5GQOA 1WCMB 4ALPA 3HKZE 2PW7A 1JWMD 2K5QA 2AQ1B 4TVAB 5A2QL 5C44B 4X65L 4CKCA 1V1PA 4QGUA 1JB3A 3NBHB 1K8GA 1SN8A 3EQLC 4FDBA 5E1FA 5C0XI 3GO5A 2NBFA 1U0LA 5DM63 4BS9A 4OXPA 1TQOA 3CW2C 4P72A 3PCOB 1SFOB 4DNTB 1DZ1A 5D3DA 2G9HD 4F87A 1IBMQ 2KCNA 2HIVA 1V1QA 5EPLA 3PV0A 1YJWA 3TP8A 1AH9A 1Q8KA 2JEBI 2MJ8A 2RF4A 2VXWA 5FO8B 2WB1B 2PQAA 4A3FG 1MBYA 2QKIC 2XWBB 3G48A 4YCVA 4RKLA 4LAAA 3C1FA 4C3HH 3J7AF 4FNFA 3HOYG 4HJ8A 2J0TD 3KK7A 2GA4B 1CUKA 4HMJA 2CW0D 1HTPA 4JYAQ 5IYBH 1N36Q 3KUPA 4JK1C 3QOJA 4N8FA 5ELCA 3ERQA 1IBKQ 2ZJQA 1A63A 1SXTA 1EIYB 2E5LQ 1K28A 4A3BB 2WACA 4L6TB 4YWLA 4KHZA 1W6JA 4A3MB 5JJKA 3PF5A 2C35B 1Y1WB 1TWGH 2MUYA 2A68C 2BA0A 2UU9L 1X3GA 2OT2A 2G9DA 2KCTA 1CK1A 1DONA 1EY7A 1STBA 3P7JA 3NENA 3R8BA 4MTKA 3HOWG 1QVGA 4KJNA 3EA6A 1M1KC 1IL2A 3GTLH 4DV6L 2GN5A 5GAEC 1CKNA 2EZVA 4IALA 1SNQA 2E8GA 1G291 3HKZB 2AWNA 4J15A 3ZYYX 2K33A 2F0MA 1CSQA 4BBRH 1HPCA 5IT9L 3IFDA 3QR8A 2LMCB 1SE3A 3VR2A 3FPPA 2AKWB 1LT3D 3GTJH 5ELDA 4A3KH 1SR3A 2BOSA 3Q22A 2OCEA 3N6RA 4P2CB 4B3TQ 1IHZA 2H4OA 1AEXA 1PYSB 2YU9B 4QCLA 4H44C 5KNDA 2JSOA 3KDFB 4A3GG 3FEWX 2E74C 4UAIA 2ZTEA 4K8IA 3SK4A 4X66Q 4NXNQ 5IP7G 1CT1D 5CV5A 3M3YH 2SDFA 3K5MA 1E0BA 2LFNA 1JCKB 2R6GA 2RVLA 4KD4A 3I8ZA 1YNJD 1RF2D 1KC8C 1B70B 2M2LA 5DLQE 3I70A 1C48A 1VQEA 2GVAA 3E9HA 3GTGH 4CJ0B 3J7A5 1LT4D 1EZ8A 4ABNA 3TRZA 3HOUG 3X3NA 1HNZL 1ENAA 1YVCA 1UWVA 4LFCL 4UP7A 1A2TA 1QUQA 1JWUD 1B4OA 5C4ZA 1VQ6A 1UEBA 4GN4B 4XTCS 4JI1L 3PO3H 1FGUA 3CQZH 5CBAE 4K6LA 3SK6A 3RUZA 1NMGA 1MKHA 2R7ZH 2MNAA 1EWIA 1SDFA 2RHSB 3TREA 3J80E 2NZOA 2DJFC 1XNQQ 2F52A 4RCOA 3CF5A 4K2LA 1CKOA 2K75A 2CQOA 1TS5A 4M8AA 1GJXA 3NTKA 2EY2A 1SROA 2R3ZA 2B63G 1PTOB 3D6CA 2SNSA 3MXUA 4ZQ3A 4EGVA 2QA4A 2F4VL 1F77A 1AFPA 1QILA 3HP3A 2XRQD 5FLXc 1SJED 5CR3A 1KLUD 4Y7NH 1QJOA 4Z9CB 5CV8A 2YYZA 4FYDA 1WCMH 4PZ7A 2H5XA 1A15A 3NELA 1E1TA 4C3JB 5C44H 1HA6A 2RKSA 1HR0W 3DEOA 1LTGD 4AQYL 2F03A 1MD2D 2F3VA 5IYCH 4DR5L 1I4GA 4KKTA 1VF7A 4QUCA 2WKCA 1SFOH 2EXDA 1O7YA 1E2WA 2K7VA 4BBSB 3A7LA 2Z9HA 1BBUA 1PVOA 4FF2A 3HOVB 3CKIB 1KD1C 1M8AA 4FXDA 2WAQG 4HSPA 1XYIA 1HNWL 1VQIA 5IGFA 1EQTA 4MTNA 1G6PA 3J81E 4IJHA 1ENCA 4IJLA 4LW1A 1O7LA 1HZ9A 1L0YB 1I6VC 2HQEA 1JICA 1TU2B 1XTCD 2Z1CA 4NXML 2F0OA 4LF8Q 4A3BH 2A1AA 5M3MB 3TS0A 1F9RA 3SEBA 1NJIC 4JI3Q 4A3MH 4LF4L 2EYFA 1Y1WH 1Y8NB 1CHQD 3GV3A 3H3VH 1Z6HA 1FJGQ 1Y1VB 3FRPB 2F0GA 2F0QA 4DAVA 1D1IA 3MFYA 4C56C 3OW2A 1WVLA 3T56B 1PZJD 2WIIB 3D31A 2UU9Q 2F4IA 5C4XB 2VB2X 1N32Q 4ZK9B 2HIXA 1U4PA 1TS2A 2HHHQ 4IFDH 1PRTD 4DV2L 4R4QA 2BA1A 2LS01 5DEHA 3RLOA 4PQXA 1EIGA 1FNUA 4DK3C 2VW9A 3CAMA 2F0SA 1KXLA 3QWNA 4J8QA 1HFNA 1E7ZA 4G7OC 1BDOA 3GTKB 3K7AB 3U50C 3A8IE 4JPBW 1E2ZA 1Q7YC 1MHWC 3CCQA 3KJPA 1VQHA 3GD7A 3FKIB 2JA9A 3JAMi 2SNMA 1BR9A 2YU9H 3L0OA 1OXVA 1ENFA 1G2SA 3OHXC 3OIPA 4HN7A 2HUGA 2V1CC 4BA2I 3EJIA 4JV5Q 4QL5A 4JCVE 4JI7Q 2XTIA 5GADC 4A3LH 3SXHA 1KDBA 4JW0A 1I50B 2A6HC 3I2ZA 5E4WC 3SHLA 1FVIA 2OTJA 2O4XA 1VQNA 2RA4A 3RLNA 4BXXG 3S16B 4RMFA 4C3IB 1YNNC 2A73B 4KJOA 4N8X1 1KLGD 3VYTA 4A3JG 2E2IB 3ITPA 4LMQD 1OO9B 1PFMA 1PA6A 3HKSA 3T53B 1WD1A 4UPAA 2N49A 4NP5A 1AN8A 2NWGA 1OXXK 3VA7A 1F9PA 5FLMG 2X6GA 3UDFA 1ILPA 2DNCA 4RHSA 1KL9A 5EKLA 4FO2A 4YWMA 3DUZA 1I4XA 1IBML 1XNRQ 3L3OC 2C5CA 1QVCA 1WJJA 3H3VC 4K8JA 5ELOA 4A93G 5GROA 4BWGB 1H9SA 4A3CG 4L5TA 4ODGA 4YIJA 4DV7L 1O78A 3C2PA 4WJ4A 3GTQB 4KLKA 1NR4A 1S40A 4O1NA 4JYAL 1MI2A 1PTOH 3S1RB 2OWOA 1IZ6A 3AYHB 3K0XA 3T13A 3R3OA 2VQEQ 1IBKL 2B2UC 1QB5D 3UDIA 2PI2A 4C1NK 3TP6A 4JC0A 4KMUC 2E5LL 5CORA 3OMGA 4FXKC 4A3EH 1PRTF 2O5IC 4B3RQ 2PZUA 1W2BA 3ICEA 3U4VA 4C3JH 1A3TA 1M4VA 1D7QA 2NN6H 3TP5A 3DMUA 5KYLA 4RCNA 2UUBL 1W6KA 3HS0C 1LTID 4IOAA 1C7YA 1ZYRC 4AYBE 3KF8B 1MIUA 4CDFC 2HCCA 2B3GA 3MTSA 4BBSH 1VS0A 1G6ZA 1HZCA 4OHJA 1EZ6A 5HY6A 3DLLA 4IUVA 4GLAC 4AQYQ 3HOVH 4A3GB 4MIUA 5D65A 5COYA 5EKKA 4DR5Q 1VQ4A 1YHAA 2K32A 3H15A 4QUFA 3KLSA 2JQOA 3M4YA 1EU4A 1ASYA 1A6XA 2F0JA 4YWKA 1IKLA 5A2QE 3LWUA 1VQKA 4G57A 1A8VA 1RODA 2QILA 1GUOA 4NDXA 2A69D 4YHHQ 3E0JA 5I9OA 2WAQE 2EOTA 4DAYA 1BF4A 5M3MH 1JB7A 3MAQA 2PW5A 4HTHA 3HOZG 3V96A 2DNEA 2A6EC 2B29A 1PXUA 1LTSD 1EYCA 1L1OB 3OMCA 4RGNA 4A4IA 3OYYA 3VR3A 1VQLA 1SYGA 2ZJPA 2CHBD 4R1JA 1Y1VH 4DV5L 2MFIA 2QEXA 1AZQA 4KY7A 5E3FA 3TP7A 1BO0A 1BCPD 2RDFA 1L0WA 3C3LA 1NR2A 3J7YW 4DGZA 1L0XB 4LJZC 3FPUB 1B44D 3UI2A 1I6HB 1XPUA 2JA8G 4YY3Q 2F3WA 1G8ZD 3PUXA 4G7HC 1Q46A 2I0QA 2JP1A 1PTOC 2PCFB 1XWEA 2JA6B 4MNOA 1KRTA 1PFSA 1DOMA 2EE1A 1TWHH 3CP0A 3X3MA 5ELBA 1T5XD 1HTLD 2F0PA 1EWHA 3A5UA 3I72A 2D62A 5LMNQ 1VQGA 3G6JB 2Z6KC 2PNHA 4QF4A 2EVBA 5IGDA 2M00A 4DV4Q 2X6LA 2Y0SE 3GTOB 3GTKH 3K7AH 3R93A 4AYBB 1WTQA 3NHHA 2NVYB 1SYFA 4IPDA 3WWVA 2K5HA 3HOXB 1WTXA 4DPGA 4RGOS 3FKIH 4OELB 1X3PA 2RHQB 1O7IA 2QDBA 4HR7B 4IUNA 3CQZB 5EKIA 4IZ8A 4G7ZC 5C0XH 5EPJA 3A5ZB 3ULJA 4APVA 2XRSD 2NTTA 2EIFA 3NWSA 1KAAA 4HCSA 4S3SA 1U4RA 1S5FD 2Q2UA 1UNSA 4ULLA 3E6ZX 3PUZA 5IT9E 3P75A 3MXNA 1I50H 1Y8PB 3I56A 2E2DC 4XQQA 1Q86C 4A3IG 3I4MG 4DU9A 3CU7A 2WAQB 1Z9FA 2KECA 4C3IH 5M9OA 2NVXB 1QZHA 1SMYC 1EY0A 3J81j 2VB3X 4PZ6A 2E2IH 2L55A 4I7AA 2L12A 3Q6SA 1YITA 2EPBA 4X3SA 1GD7A 4NMZA 1QZGA 2C9OA 4CJ2C 2MHVA 1EWCA 3JC66 1BXTA 1PRTB 2ZXPA 3BG3A 1SE8A 2Z8LA 5D3IB 1PZID 2OF1A 1HZBA 4GOPB 3CPFA 1NAPA 2JN4A 4ME5A 4KI0A 3S1NB 2AHOB 1A2UA 1SNCA 2VUMG 4A3DB 3QOLA 1OXTA 3MA2B 1DXMA 1K8OA 3ND8A 3BVZA 3GTQH 1WI5A 1BOSA 4DR2L 1SMXA 2A8VA 2ZJRA 4HAEA 3CCMA 1X54A 1PTOF 1BCPF 2DN8A 3S1RH 4IUTA 1N34Q 4A75A 2KCCA 4OWWB 3NBHA 3H0GB 4DV7Q 4KKUA 2Y0SB 1CSPA 3RD4A 3AU7A 5JEAJ 4BY1G 4RH6A 1KTKA 4LF8L 2M9VA 3DEPA 1WTRA 3KBGA 4CJ1B 5CYUA 1D6EC 1GM5A 4JI3L 2F0HA 3MFGA 5T1GA 2F0NA 1A0IA 5ELNA 1VQDA 2O5JC 5IODA 1RKNA 3DM3A 3JAMc 4PNYA 1FJGL 2OQKA 2CW0C 2Q2IA 1AZPA 1CI3M 1YEZA 3IAYA 2IY5B 3S9WA 4O2DA 2K52A 5CBEE 3QIAA 2F0EA 1EYAA 4TKOB 1S5DD 1N32L 3TMEA 1WTHA 2FMCA 5M5XB 2UUBQ 4QQBX 2HHHL 1Q1EA 1PH4A 4A3GH 1GUTA 2K5DA 3CHBD 4KHVA 1SNPA 1Q3LA 1FYCA 2FFKB 3LX0A 3M85A 1HUNA 5HGTA 5IYDG 1NSNS 5C5LA 2O2LD 4OO1G 3G6EA 3OOCA 5M5WB 2VZAA 4IUQA 1QCBD 4OO1I 2N88A 1JT8A 4Y52H 4RGMA 1E2VA 3S24A 4CDEC 1B50A 1VQBA 1YJNA 2RSNA 1TIID 2VNUD 3ND9A 2B8FA 4XXEA 1JJGA 2XNAC 2JJQA 4MZ9A 3VYRA 2VQFQ 3CCSA 4A3JB 2N78A 2K5VA 1PHJA 1JOKA 1YIJA 2XWJB 3A54A 1IYUA 1LT5D 3AB9A 4N9TA 5IP9H 1Y8OB 5J39A 3PQIA 3VYUA 3MEFA 2WINB 1TY0A 4JV5L 4K5WA 2B2UA 4X62Q 3OSOA 3K59A 4JI7L 3IKJA 3QO2A 1A3VA 1NBWA 1DCZA 5ELFA 4E6IA 4DR6Q 5IGGA 1I6HH 2N3SA
chains in the Genus database with same CATH topology
1Q90A 5DNFA 2AUKA 2X69A 4B08A 1EU3A 3VYSA 1BQQT 2AUJD 3TZDA 1O7ZA 2OEOA 1EY8A 1YNJC 5D14A 4FF3A 4KY6A 1CZWA 3GTPB 3RZDB 5IGBA 2JYOA 1HCZA 4KTAA 5M3FB 1Q12A 3M7NA 2KUMA 2JA7B 3FDTA 1SNOA 1PZKD 2KOLA 5JPMC 3CRLC 3N52A 4CHTB 5G3LD 2A74C 4EQPA 1B9NA 4Q0FA 4TQUS 2JA5B 2EJMA 2JXMB 5E4XA 2L9HA 1U4LA 3L9AX 3D6WA 2EDGA 3WOEA 3K0YA 1QOHA 2K01A 1BCPB 2XIWA 1UEAB 2ZXOA 4MN3A 2JE6I 5KGUA 4ZRZA 2NTSA 3V05A 1J9OA 3U9OA 3NXWA 4A3EB 1EEID 2K03A 1SBBB 5F2DA 3OIQA 3S17B 1GHJA 1SE2A 2EY1A 3GV6A 5K36H 4NW2A 3BYYB 1B2TA 3MXGA 2K04A 3H09A 3SK8A 1SJHD 5KNBA 3JAML 2BE5D 1IKMA 3I3CA 4X3KA 3EROA 3DWAA 2QEJC 5C6AA 1KNAA 1ET9A 1X3QA 4N9PA 2XN9C 5CC4A 3RZOB 3BVGA 3TDQA 4DXFA 1VMCA 1ILQA 3KBXA 1RCVD 2AQ3B 3BDLA 5CGKA 5FLXE 1LTTD 1TWCB 2XVSA 2Q8IB 2TSSA 1CQVA 1QNUA 2BDNA 1GXDC 3NPPA 3NQTA 5BN5A 1Z47A 1ET6A 2IWHA 3NQIA 3S1MB 1JOQA 1PMRA 1GOZA 3PIP3 5G3LF 1V1OA 3R2TA 3P20A 4H13C 5KRUA 1LACA 2L11A 3A8JE 3BDOA 1TWHB 1Z7TA 5FK9C 1B3AA 4A3IB 3I4MB 1EEFD 1LO5D 1STNA 5BN4A 1PRTC 3HEJA 5LL6X 1HUMA 2PZTA 3I90A 3MXPA 5M5YB 1SNDA 4ZAIA 1ESFA 3DXJC 3MWYW 3NSWA 3I4LA 3VR6A 3H6MA 3DHQA 2B8GA 3E5SA 3NBIA 1RHPA 1D1KA 5JEAG 2K05A 2IX3A 1IYVA 2KEDA 3A55A 3FMCA 2F0LA 1V8QA 4IQZA 4K2KA 2NVTB 1ML0D 3A56A 4RHRA 5C3WA 2Z4IA 2KHSA 4A3FB 1STHA 1S5BD 2RBMA 4B9WA 1R4PB 3D4DA 4BY1B 3HOYB 2L4NA 3S1QB 2PPBC 1I4QA 5EGTA 5FO7B 1HXYD 3BZDB 2K6AA 4DF7A 1CM9A 2NYZD 1KDCA 5T1IA 1CZGA 4IUPA 2EYPA 4J1MA 1O80A 4CBVA 2E76C 4I7ZC 4FF1A 2IX1A 5FLXL 2ID0A 1DJRD 2E2JB 3MZ5A 1Y69U 1IW7D 1G91A 2SEBD 2V4DA 1LABA 3VA5A 1Q1BA 2EJFC 3HOWB 3NP8A 1II3A 2DY7A 3EFXD 2NB0A 3BDCA 2HCIA 1MSGA 2B2VC 1JQYD 5IOCA 1CTMA 3DM1A 2F1MA 1NCVA 1STEA 2WV6D 3H91A 2E75C 2AQ2B 1C4QA 1GUGA 2KEEA 5C4HA 4PV1C 1JORA 3PUWA 2BDOA 2EYMA 3BS1A 2IPKD 1CA6A 1FD7D 4FP5D 3D8GA 1TR5A 5JVH3 3KF8A 3IFTA 1VMPA 2FJ2A 1F9SA 4K14A 5NUCA 1STYA 4WFN3 3D4RA 4HEDA 3GTMB 3HOUB 1F2YA 3OPOA 2R92B 1AW7A 4DA2A 4F8MA 1K83B 3TZUA 2A69C 5CV4A 1STGA 3Q23A 3T51B 2WKDA 3I4NB 1PFNA 1QG7A 2NN6G 1V43A 2ICIA 2IW3A 1LTBD 4WORA 1BCPC 3NUCA 1X32A 1HFGA 1R9TB 1WTVA 4RFBA 5ISRA 2PO4A 4XYQA 2B63B 1PFBA 1HRJA 3V2TA 2PQEA 1LTRD 4J6HA 3CRKC 3DWQA 5EBDA 4F88A 2A5HA 5CV7A 3S2DB 1LT6D 4XDXA 1CHPD 2EYJA 4DK0A 4IURA 4OGQC 2J4XA 1HQMC 3U9SA 2D9UA 2KQ3A 5KIXA 1CQFA 1T5EA 3MVVA 5I2YA 3I91A 3T4AC 4TRDA 3HRZC 1GUNA 5KNCA 1CFMA 1VDZA 3NWTA 1I4PA 1KABA 4C1NI 3L7ZC 1SE4A 1JWSD 1V1PB 1TWAB 2JEAI 3URYA 1ZXTA 3T16A 1DD2A 4HMIA 1TKWB 3D3RA 2MGSA 4L63B 4BY7B 2MP1A 5C0XG 3PO2B 1PYWD 3C46A 3I73A 1ZEQX 4OO1H 1EY5A 1ZKOA 3MHBA 3EVQA 3NK9A 1QWYA 2LY7A 1F2LA 5DM73 1B53A 4U673 5I4DA 4C3IG 5DAUA 2R61A 2F0VA 3PIO3 2ZXRA 2RDHA 4IFDJ 3LWEA 3IL8A 1SEBD 1S4ZA 2RSOA 3DWPA 2A68D 2CQAA 4FF4A 3SVMA 1LV9A 4OIKA 1I4RA 1ONLA 1WTOA 3H94A 3KLSX 1F2ZA 3LNNA 1EY6A 2N55A 1EY9A 1EIHA 4DNRB 1SYEA 1PLFA 4XT3B 2BCOA 3A7AB 4C3HG 4C2MB 3JAME 3PUVA 1GHKA 1FNVA 1ICWA 5EQ0A 3OWFA 1DYQA 1SYDA 2B2VA 4WRDA 5K5PA 4A93B 5AFWA 1NUCA 3C1EA 4JBWA 3O13A 2R93B 4KN4C 2KJXA 4KK7A 2H1EA 4XQNA 4DXGA 3HZXA 5CMDA 2FHTA 5EJWA 4PMWA 5KYIA 4XQJA 1A3UA 2B2WC 1EL0A 1WTWA 2J7ZA 1TS3A 3NTIA 2OXPA 3WOFA 5ELEA 5FKAC 4XT1B 2B2TC 1FR3A 4BA1I 1XX8A 1QE6A 2B39A 4H0LC 4PMBA 2D5DA 3M4OB 1UUPA 3TSSA 1OXUA 1KDAA 1H9RA 3HG9A 2F0TA 5C3EB 3GQBA 5HURA 5CV9A 2QCPX 1HA5A 2IL8A 3MEHA 2TMPA 1WD0A 4XYOA 5FO9B 2F0UA 2EY6A 1R4QB 1G2TA 5I6WA 4HCEA 1BBXC 4L8JA 3HOZB 2Q8TA 4X3UA 3K5OA 4XIGS 1RTOA 1I3QB 4B9XA 2EY5A 3J7AV 3PUYA 5IGEA 2SOBA 2XSCA 4EQOA 2ICEC 3K58A 1Q8IA 2JA8B 1SYBA 4DAPA 2I46A 3QJYA 4V0BA 2BE5C 3GP7A 3S2HB 2RQXA 3S14B 5KEEA 2PZWA 2NUCA 1B9MA 4LK1C 1EYDA 1TT2A 4PMCA 1LTAD 2PNRC 2NVQB 4QIWB 1SNMA 5I6YA 5CV6A 2L0CA 1FGBD 2B2YC 1STAA 5IIFA 5LL6S 5JPNC 4Q5VA 5K36G 3QB3A 2NZ1D 5JEAH 3W3AA 1H9JA 4ZLTF 3QG1A 3SR1A 3NTHA 1C8CA 2KA7A 2FINB 4M1UB 5EPKA 1D5ZC 1B1ZA 5C0XJ 3BYTB 1ESRA 4R8NA 3S15B 1TS4A 5J22A 3FVQA 1GUSA 3ONAB 3F2UA 1EY4A 4OL7A 4EQNA 5C5MA 2K1BA 3J80L 4X3TA 5BN3A 4DN4M 1S5CD 3MC0B 1WTPA 4ILWA 2VUMB 2E2HB 5IGCA 1DOKA 1U4MA 1OXSC 4G4KA 1FNWA 4F7XA 5JJZA 3SK5A 4ZKCB 3R2IA 3VR5A 1JC7A 2A6HD 2EYLA 3Q24A 1CA5A 4ZYSA 2F0DA 5A35A 4IFDG 2EJGC 1YNND 1HQRD 3D4WA 4IFDI 1TWFB 5JAVA 2F0FA 5J1ZA 4K5XA 4GZYC 2K5WA 4CGYB 5C3XA 4ZKBB 4K5VA 4ZUIA 4KN7C 3Q0AA 1SAPA 3WDNA 2ZT9C 4KV6A 2L5TA 1H9SB 4RA8A 5C4JB 4RAUC 3KLRA 2FMMA 1XXGA 3J81L 4FVMA 5LHY1 1SYCA 1PDQA 5TSSA 1IW7C 4UDUC 4RKBA 3K5LA 4KY5A 3M7GA 3W2DA 1TVXA 4KKSA 1SSOA 2AWOA 3A8KE 4C3HB 4U68A 1KNEA 3RMHA 4FXGC 2D2CC 4QMGA 1QNKA 2ENBA 1F2MA 3K5NA 1UAPA 4MHEA 4V190 1F9QA 1MGSA 1ZYRD 2LKVA 1EFID 1J8IA 2B2WA 1D5MC 1TY2A 4RWSC 1U9RA 1TWGB 3OW7A 4R8IA 1H9KA 2PYKA 4OIJA 2B2TA 1K8MA 3AMUA 1RTNA 2IX0A 2QF7A 2WP8J 3G7LA 3GTLB 1H9MA 1VCIA 2Q8RE 1JE4A 4ID6A 5I2XA 4EVOA 1D5XC 1IL8A 2A6ED 2DY8A 2F0KA 1GUWA 4C3JG 3SE0A 4BBRB 2F0IA 1S5ED 4QB4A 2NN6I 4O42A 2PMZB 2F0WA 4DFAA 3GTJB 1VF5C 4R9WA 4A3KB 4CKEA 2MPMA 4TSSA 1PTOD 3K57A 3TN2A 3TBIB 3M3YB 2EYHA 3NE5B 1BNZA 4H7BA 4IUUA 3BVMA 2IJ0A 3VR4A 2HDMA 3P1HA 3GTGB 4K6DA 4ZUJA 2IT1A 5JVG3 5JOBA 1DM0B 5FOBB 1DOLA 1JOOA 2KVMA 2HDLA 2K28A 4CKBA 4DK1A 4HSVA 4KD3A 3HGBA 4NKLA 3SDZA 3PO3B 2L1BA 4RGTA 4WJWA 1RJTA 4I65A 2Z4HA 3K6OA 2R7ZB 3OWEB 5EBCA 2B2YA 2EYOA 1SMYD 1MSHA 3RLFA 1AP0A 1JR0D 1I4HA 1BUVT 2EXZA 1LLRD 1HHVA 1EQVA 1EOTA 1D2BA 2CVRA 4IN3A 1RDPD 3PMFA 4Y7NB 2I07B 2RDGA 1RD9D 5I9PA 1WCMB 2PW7A 1JWMD 2K5QA 2AQ1B 5A2QL 5C44B 4CKCA 1V1PA 1JB3A 3EQLC 5C0XI 5E1FA 3GO5A 2NBFA 5DM63 4BS9A 1TQOA 1SFOB 4DNTB 1DZ1A 5D3DA 2G9HD 4F87A 2KCNA 5EPLA 3PV0A 3TP8A 2MJ8A 2JEBI 2VXWA 5FO8B 2WB1B 1MBYA 2QKIC 2XWBB 4RKLA 4LAAA 3C1FA 3J7AF 4FNFA 2J0TD 3KK7A 2GA4B 4HMJA 2CW0D 1HTPA 3KUPA 4JK1C 3QOJA 5ELCA 3ERQA 1SXTA 4A3BB 2WACA 4L6TB 4KHZA 1W6JA 4A3MB 1Y1WB 2MUYA 2A68C 2BA0A 2OT2A 2G9DA 1CK1A 1DONA 1EY7A 1STBA 3P7JA 3R8BA 4KJNA 3EA6A 2EZVA 4IALA 1SNQA 1G291 3HKZB 2AWNA 3ZYYX 2K33A 2F0MA 1HPCA 5IT9L 3IFDA 2LMCB 1SE3A 3VR2A 3FPPA 1LT3D 5ELDA 2BOSA 3Q22A 3N6RA 4P2CB 1IHZA 2H4OA 1AEXA 2YU9B 4QCLA 4H44C 5KNDA 2JSOA 3FEWX 2E74C 4UAIA 4K8IA 3SK4A 1CT1D 5CV5A 2SDFA 3K5MA 1E0BA 2LFNA 1JCKB 2R6GA 2RVLA 4KD4A 3I8ZA 1YNJD 1RF2D 2M2LA 3I70A 1C48A 4CJ0B 1LT4D 1EZ8A 4ABNA 3X3NA 1ENAA 1A2TA 1JWUD 1B4OA 5C4ZA 4XTCS 5CBAE 4K6LA 3SK6A 3RUZA 1SDFA 3J80E 4RCOA 4K2LA 1TS5A 4M8AA 1GJXA 3NTKA 2EY2A 2R3ZA 1PTOB 3D6CA 2SNSA 3MXUA 4ZQ3A 4EGVA 1F77A 1AFPA 1QILA 3HP3A 2XRQD 1SJED 5CR3A 1KLUD 4Z9CB 1QJOA 5CV8A 2YYZA 4FYDA 1A15A 4C3JB 1HA6A 2RKSA 3DEOA 1LTGD 2F03A 1MD2D 2F3VA 1I4GA 4KKTA 1VF7A 4QUCA 2WKCA 1O7YA 1E2WA 2K7VA 4BBSB 3A7LA 4FF2A 3HOVB 3CKIB 1M8AA 4FXDA 4HSPA 1XYIA 5IGFA 1EQTA 3J81E 1ENCA 1O7LA 1L0YB 1I6VC 2HQEA 1JICA 1TU2B 1XTCD 2Z1CA 2F0OA 5M3MB 1F9RA 3SEBA 2EYFA 1Y8NB 1CHQD 3GV3A 1Z6HA 1Y1VB 3FRPB 2F0GA 2F0QA 4DAVA 1D1IA 3MFYA 4C56C 1WVLA 3T56B 1PZJD 2WIIB 3D31A 2F4IA 5C4XB 2VB2X 4ZK9B 1U4PA 1TS2A 4IFDH 1PRTD 2BA1A 2LS01 5DEHA 4PQXA 1EIGA 1FNUA 2F0SA 3QWNA 4J8QA 1HFNA 4G7OC 1BDOA 3GTKB 3K7AB 3A8IE 1E2ZA 3GD7A 3FKIB 2SNMA 1BR9A 1OXVA 1ENFA 1G2SA 3OHXC 3OIPA 4HN7A 2HUGA 4BA2I 3EJIA 3SXHA 1KDBA 1I50B 2A6HC 5E4WC 3SHLA 2O4XA 2RA4A 3S16B 4C3IB 1YNNC 2A73B 4KJOA 1KLGD 3VYTA 2E2IB 3ITPA 4LMQD 1OO9B 1PFMA 3T53B 1WD1A 4NP5A 1AN8A 2NWGA 1OXXK 3VA7A 1F9PA 2X6GA 1ILPA 2DNCA 4RHSA 5EKLA 4FO2A 3DUZA 1I4XA 3L3OC 2C5CA 3H3VC 4K8JA 4BWGB 1H9SA 4ODGA 4YIJA 1O78A 3C2PA 3GTQB 1NR4A 4O1NA 1MI2A 1PTOH 3S1RB 3T13A 3R3OA 2B2UC 1QB5D 4C1NK 3TP6A 4KMUC 5CORA 3OMGA 4FXKC 1PRTF 2O5IC 2PZUA 1A3TA 1M4VA 2NN6H 3TP5A 3DMUA 5KYLA 4RCNA 1W6KA 3HS0C 1LTID 1ZYRC 2HCCA 3MTSA 1G6ZA 4OHJA 1EZ6A 4IUVA 4A3GB 4MIUA 5D65A 5COYA 5EKKA 2K32A 4QUFA 3KLSA 3M4YA 1EU4A 1A6XA 2F0JA 1IKLA 5A2QE 3LWUA 4G57A 1RODA 2QILA 1GUOA 4NDXA 2A69D 3E0JA 5I9OA 2EOTA 4DAYA 1BF4A 3MAQA 2PW5A 4HTHA 3V96A 2DNEA 2A6EC 1PXUA 1LTSD 1EYCA 3OMCA 4RGNA 3VR3A 1SYGA 2CHBD 1AZQA 4KY7A 5E3FA 3TP7A 1BO0A 1BCPD 2RDFA 3C3LA 1NR2A 3J7YW 4DGZA 1L0XB 4LJZC 3FPUB 1B44D 3UI2A 1I6HB 2F3WA 1G8ZD 3PUXA 4G7HC 2JP1A 1PTOC 2PCFB 1XWEA 2JA6B 1DOMA 2EE1A 3X3MA 5ELBA 1T5XD 1HTLD 2F0PA 1EWHA 3I72A 2D62A 3G6JB 4QF4A 2EVBA 5IGDA 2M00A 2X6LA 3GTOB 3R93A 4AYBB 1WTQA 3NHHA 2NVYB 1SYFA 3HOXB 1WTXA 4RGOS 1X3PA 2QDBA 4HR7B 4IUNA 3CQZB 5EKIA 4IZ8A 4G7ZC 5C0XH 5EPJA 2XRSD 2NTTA 3NWSA 1KAAA 4HCSA 4S3SA 1U4RA 1S5FD 1UNSA 4ULLA 3E6ZX 3PUZA 5IT9E 3P75A 3MXNA 1Y8PB 2E2DC 4XQQA 4DU9A 3CU7A 2WAQB 2KECA 5M9OA 2NVXB 1SMYC 1EY0A 2VB3X 2L55A 2L12A 3Q6SA 2EPBA 4X3SA 4NMZA 2C9OA 4CJ2C 2MHVA 1EWCA 1BXTA 1PRTB 2ZXPA 3BG3A 2Z8LA 5D3IB 1PZID 2OF1A 1NAPA 4ME5A 4KI0A 3S1NB 1A2UA 1SNCA 4A3DB 3QOLA 1OXTA 3MA2B 1DXMA 1K8OA 3ND8A 3BVZA 1BOSA 4HAEA 1PTOF 1BCPF 2DN8A 4IUTA 2KCCA 3NBHA 3H0GB 4KKUA 2Y0SB 3RD4A 3AU7A 5JEAJ 4RH6A 1KTKA 2M9VA 3DEPA 1WTRA 3KBGA 4CJ1B 5CYUA 1D6EC 2F0HA 3MFGA 5T1GA 2F0NA 2O5JC 5IODA 1RKNA 4PNYA 2CW0C 1AZPA 1CI3M 3IAYA 3S9WA 5CBEE 3QIAA 2F0EA 1EYAA 4TKOB 1S5DD 3TMEA 2FMCA 5M5XB 1Q1EA 1GUTA 2K5DA 3CHBD 4KHVA 1SNPA 1Q3LA 1FYCA 2FFKB 3LX0A 3M85A 1HUNA 5HGTA 1NSNS 5C5LA 2O2LD 4OO1G 3OOCA 5M5WB 4IUQA 1QCBD 4OO1I 2N88A 4RGMA 1E2VA 1B50A 2RSNA 1TIID 2VNUD 3ND9A 2B8FA 4XXEA 2XNAC 3VYRA 4A3JB 1JOKA 2XWJB 3A54A 1IYUA 1LT5D 3AB9A 4N9TA 5J39A 1Y8OB 3VYUA 2WINB 1TY0A 4K5WA 2B2UA 3OSOA 3K59A 3IKJA 3QO2A 1A3VA 1DCZA 5ELFA 4E6IA 5IGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3K A;  1PLF A;  4U68 A;  1KNE A;  1VMP A;  2FJ2 A;  4XT3 B;  1AZQ A;  3ONA B;  1F9S A;  3F2U A;  5DNF A;  1DOL A;  1B4O A;  1BO0 A;  2X69 A;  1G2T A;  1QNK A;  2K1B A;  2KVM A;  1KNA A;  1NR2 A;  3GV3 A;  1X3Q A;  4HED A;  2HDL A;  2K28 A;  4HAE A;  3FPU B;  4X3T A;  4MHE A;  3UI2 A;  1BBX C;  4DN4 M;  1F9Q A;  5CBA E;  1MGS A;  2Q8T A;  4IUT A;  3TZD A;  4HSV A;  4X3U A;  2L4N A;  1ICW A;  1VMC A;  1O7Z A;  5EQ0 A;  1ILQ A;  2JP1 A;  3KBX A;  1WTP A;  1NR4 A;  5D14 A;  1RTO A;  1J8I A;  1WVL A;  1SDF A;  2B2W A;  3DEP A;  1DOM A;  2EE1 A;  2L1B A;  1WTR A;  2JYO A;  1MI2 A;  1ZXT A;  4CJ1 B;  1DOK A;  4ZK9 B;  1U4P A;  1RJT A;  1CM9 A;  1U4M A;  2B2V A;  2NYZ D;  2KUM A;  4RWS C;  5T1I A;  1DON A;  5T1G A;  2B2U C;  2BDN A;  2MGS A;  3FDT A;  3P7J A;  4IUP A;  5AFW A;  4R8I A;  1O80 A;  5COR A;  2KOL A;  2B2Y A;  5JJZ A;  1PFN A;  2R3Z A;  1QG7 A;  2X6L A;  1EIG A;  4ZKC B;  1MSH A;  2MP1 A;  3R93 A;  4OIJ A;  2B2T A;  1AP0 A;  1WTQ A;  3N52 A;  2H1E A;  1CA5 A;  1RTN A;  1AZP A;  1WTX A;  1HFN A;  5CMD A;  3HP3 A;  2FHT A;  1X3P A;  1G91 A;  5EJW A;  5CBE E;  1HHV A;  3G7L A;  1X32 A;  1HFG A;  1EOT A;  5EKI A;  1WTV A;  2Q8R E;  2CVR A;  1JE4 A;  5E4X A;  5EPJ A;  3IFD A;  1A15 A;  2L9H A;  1U4L A;  3D6W A;  1IL8 A;  1HA6 A;  4ZKB B;  1F2L A;  2DY8 A;  2HCC A;  4HCS A;  1Q3L A;  1PFB A;  2FFK B;  2L11 A;  2B2W C;  3DEO A;  1GUW A;  1U4R A;  3MTS A;  1EL0 A;  1HRJ A;  2DY7 A;  1G6Z A;  1WTW A;  1HUN A;  1B3A A;  1SAP A;  2HCI A;  2J7Z A;  1B53 A;  2K01 A;  1G2S A;  4IUV A;  1MSG A;  2B2V C;  2XIW A;  4MN3 A;  5D65 A;  4IUQ A;  5COY A;  2HUG A;  4QUC A;  4RA8 A;  2N88 A;  1O7Y A;  4O42 A;  2B2Y C;  4QUF A;  3LWE A;  4UAI A;  4RAU C;  2FMM A;  3DM1 A;  4R9W A;  1B50 A;  4XT1 B;  1J9O A;  3IL8 A;  2KEC A;  2B2T C;  1HUM A;  2RSN A;  3I90 A;  1M8A A;  2SDF A;  2K03 A;  1NCV A;  1IKL A;  1E0B A;  2MPM A;  2NZ1 D;  5E4W C;  2L12 A;  3Q6S A;  2RA4 A;  1XYI A;  1S4Z A;  1DZ1 A;  2RSO A;  2EPB A;  3H91 A;  2RVL A;  1PDQ A;  4X3S A;  1XX8 A;  3I8Z A;  1ROD A;  4ZAI A;  1QE6 A;  5EPL A;  3MWY W;  4XDX A;  4CJ2 C;  3TN2 A;  4ZLT F;  1EQT A;  2M2L A;  3SVM A;  1LV9 A;  2MJ8 A;  2KEE A;  2VXW A;  3GV6 A;  4IUR A;  4OIK A;  4NW2 A;  1C8C A;  2EOT A;  1BNZ A;  2FIN B;  4LMQ D;  1WTO A;  4IUU A;  1PFM A;  5EPK A;  4CJ0 B;  1BF4 A;  1WD1 A;  1B2T A;  2D9U A;  2HDM A;  2K04 A;  1ESR A;  1NAP A;  1RHP A;  2B2U A;  2NWG A;  3I91 A;  1JIC A;  2K05 A;  2IL8 A;  2N55 A;  1F9P A;  3QO2 A;  1TVX A;  1CA6 A;  2KED A;  2X6G A;  1ILP A;  1SSO A;  1EIH A;  1WD0 A;  1IKM A;  3I3C A;  1F9R A;  3KUP A;  1ML0 D; 
#chains in the Genus database with same CATH topology
 1Q90 A;  5DNF A;  4DV5 Q;  2AUK A;  3CCJ A;  1DGS A;  2X69 A;  4B08 A;  2JA6 H;  1EU3 A;  3VYS A;  1BQQ T;  2AUJ D;  3ER0 A;  5HGQ A;  3TZD A;  1X6O A;  3KDF A;  1O7Z A;  2OEO A;  1EY8 A;  1YNJ C;  5D14 A;  3J80 c;  4FF3 A;  4KY6 A;  1CZW A;  3GTP B;  3RZD B;  5IGB A;  2JYO A;  2R92 G;  3A0J A;  3GTO H;  3ERS X;  1HCZ A;  4KTA A;  5M3F B;  1Q12 A;  3M7N A;  1Q82 C;  2KUM A;  2JA7 B;  1XNR L;  2NVY H;  1KAW A;  2MQH A;  3FDT A;  3HOX H;  1SNO A;  1VQ8 A;  1PZK D;  2YV5 A;  2KOL A;  3CCR A;  2CKZ B;  1RL2 A;  3CCU A;  5JPM C;  4AIM A;  3CRL C;  3I4N G;  4BBR G;  3N52 A;  3IRB A;  4CHT B;  5G3L D;  2A74 C;  4EQP A;  1B9N A;  1D8L A;  4Q0F A;  4TQU S;  2JA5 B;  2EJM A;  2JXM B;  4P71 A;  2ZTD A;  3TS2 A;  5E4X A;  4A3K G;  2I5M X;  2VQE L;  2L9H A;  4QIW E;  1U4L A;  2CWP A;  3L9A X;  3D6W A;  4KHP L;  2UXB L;  2EDG A;  4QJF A;  1PYB A;  1VQ5 A;  3WOE A;  3K0Y A;  1QOH A;  2K01 A;  4B3R L;  1BCP B;  2XIW A;  2NVX H;  1UEA B;  3W1B A;  2ZXO A;  4MN3 A;  2JE6 I;  1PH5 A;  5KGU A;  3RN2 A;  4ZRZ A;  2NTS A;  3V05 A;  3F2D A;  1J9O A;  3U9O A;  2RCF A;  3NXW A;  4A3E B;  1EEI D;  1UE1 A;  2K03 A;  4JI6 L;  1W3S A;  2UUC L;  1SBB B;  3F1Z A;  5F2D A;  1L1O C;  3OIQ A;  3S17 B;  1VQJ A;  1GHJ A;  1SE2 A;  2EY1 A;  3S1N H;  4HJ7 A;  3CC7 A;  3GV6 A;  5K36 H;  4DV1 Q;  1YNX A;  4NW2 A;  4JBK A;  1E1O A;  2VL6 A;  3BYY B;  3ULP A;  4A3D H;  1B2T A;  3K7U C;  3MXG A;  2K04 A;  2Z6K A;  3H09 A;  3SK8 A;  1SJH D;  5KNB A;  4P75 A;  4JI8 L;  3JAM L;  2BE5 D;  1IKM A;  3I3C A;  4X3K A;  3ERO A;  3DWA A;  2QEJ C;  3H0G H;  2MO0 A;  1XPO A;  5C6A A;  2R7Z G;  4YHH L;  1KNA A;  1ET9 A;  1X3Q A;  2L15 A;  3E0E A;  4N9P A;  2XN9 C;  5CC4 A;  4DR2 Q;  3RZO B;  3BVG A;  3TDQ A;  4DXF A;  4X6A H;  3KLW A;  2P5Z X;  1VMC A;  1ILQ A;  3KBX A;  1RCV D;  2AQ3 B;  3BDL A;  5CGK A;  5FLX E;  4JI0 L;  1LTT D;  3CC2 A;  3STB D;  1TWC B;  3PIP A;  2XVS A;  3M9B A;  2Q8I B;  4LUZ A;  1YZ6 A;  2TSS A;  1CQV A;  1QNU A;  2BDN A;  1K0R A;  1GXD C;  3NPP A;  3NQT A;  5BN5 A;  5JJI A;  4GLV B;  1Z47 A;  1WCM G;  4YY3 L;  1ET6 A;  5H1S E;  2IWH A;  4BY7 G;  5M5X H;  4O0A A;  3NQI A;  1K3B C;  3S1M B;  1JOQ A;  5C44 G;  1PMR A;  1B3Q A;  1GOZ A;  2D0P A;  2YTV A;  1SLJ A;  5IE8 A;  4HIK A;  4JI4 L;  3PO2 G;  4P73 A;  4DKA C;  3PIP 3;  2ZTC A;  5G3L F;  1WFQ A;  1V1O A;  3R2T A;  3P20 A;  5LMN L;  4H13 C;  3EIV A;  5IWA Q;  5IYC G;  5M5W H;  5KRU A;  4DV4 L;  1LAC A;  2L11 A;  3A8J E;  2IHE A;  3BDO A;  1TWH B;  1Z7T A;  5FK9 C;  1B3A A;  1WYD A;  4PG3 A;  4BXX H;  3GDE A;  2HT1 A;  4A3I B;  3I4M B;  1EEF D;  1LO5 D;  1STN A;  2DJG C;  5BN4 A;  1PRT C;  3HEJ A;  4A3J H;  1TXY A;  5LL6 X;  4HJ5 A;  2KBN A;  4DUY Q;  1HUM A;  2PZT A;  3I90 A;  3MXP A;  2DGY A;  4GOP C;  5M5Y B;  1SND A;  4GNX B;  4ZAI A;  5FLM H;  1ESF A;  3DXJ C;  3MWY W;  3NSW A;  4L5Q A;  3I4L A;  4JI2 Q;  2R7D A;  5BR8 L;  4A3B G;  3VR6 A;  3H6M A;  1YI2 A;  2D0O A;  3DHQ A;  2B8G A;  3E5S A;  3NBI A;  1RHP A;  1D1K A;  5JEA G;  1EQQ A;  2K05 A;  2IX3 A;  2I5L X;  1IYV A;  2UXC L;  2KED A;  3A55 A;  3FMC A;  2F0L A;  1P8L A;  1V8Q A;  5FJ8 H;  4IQZ A;  4K2K A;  2NVT B;  1ML0 D;  4LFB L;  3A56 A;  3H3V I;  4RHR A;  4RG1 A;  5C3W A;  4HJ9 A;  2Z4I A;  2KHS A;  4A3F B;  2ES2 A;  1STH A;  2XGT A;  4GKK Q;  1S5B D;  2RBM A;  4B9W A;  3RZD H;  3GTP H;  1R4P B;  3D4D A;  4IPG A;  4BY1 B;  4UP8 A;  3U4Z A;  2L4N A;  4JVZ A;  5M3F H;  2RCN A;  3HOY B;  1M90 C;  2JA7 H;  3S1Q B;  1AE2 A;  2PPB C;  3ZJY C;  1I4Q A;  1K0S A;  5EGT A;  5FO7 B;  1HXY D;  3BZD B;  2K6A A;  1BKB A;  4DF7 A;  1CM9 A;  2NYZ D;  1KDC A;  5T1I A;  3PF4 A;  1CZG A;  1T9H A;  2EYP A;  4IUP A;  2FXQ A;  4J1M A;  1O80 A;  2AMC B;  2E76 C;  4CBV A;  1K8A C;  4I7Z C;  4FF1 A;  2IX1 A;  5FLX L;  2JA5 H;  2ID0 A;  1DJR D;  2E2J B;  1N34 L;  4LF5 Q;  2R93 G;  3MZ5 A;  1Y69 U;  1IW7 D;  1G91 A;  2SEB D;  4ZCK A;  2V4D A;  1LAB A;  3VA5 A;  1Q1B A;  2EJF C;  3I7F A;  2A19 A;  3HOW B;  5AJ3 L;  3NP8 A;  4KHP Q;  2UXB Q;  1II3 A;  2PMZ E;  2DY7 A;  3EFX D;  2NB0 A;  3BDC A;  2HCI A;  4DR4 L;  1VQF A;  1EYG A;  4A3L G;  1MSG A;  2B2V C;  1JQY D;  4UP9 A;  1S3O A;  3J80 i;  1X56 A;  4IO9 A;  4R4C A;  5IOC A;  1CTM A;  3FHW A;  5GAH C;  3S17 H;  3DM1 A;  2F1M A;  4DUZ Q;  1NCV A;  3KYH C;  4JI6 Q;  1STE A;  2WV6 D;  1UE5 A;  3H91 A;  2E75 C;  2AQ2 B;  2UUC Q;  1B7Y B;  1C4Q A;  1GUG A;  2KEE A;  5C4H A;  4PV1 C;  4OX9 L;  1JOR A;  4DR3 Q;  3PUW A;  1NTG A;  2BDO A;  2EYM A;  3BS1 A;  1KRS A;  5C3E G;  1X55 A;  2IPK D;  1CA6 A;  1FD7 D;  1B8A A;  3D8G A;  1TR5 A;  4FP5 D;  2JA8 H;  3RZO H;  4JI8 Q;  5JVH 3;  3KF8 A;  2LXJ A;  3IFT A;  1VMP A;  2FJ2 A;  2VQF L;  1F9S A;  1WOC A;  4GLX A;  4K14 A;  5NUC A;  1E22 A;  1STY A;  4WFN 3;  4HJA A;  3D4R A;  4HED A;  4UHV A;  4PZ8 A;  3GTM B;  1TWC H;  3HOU B;  1F2Y A;  3OPO A;  4X62 L;  4B3M Q;  2R92 B;  1HH2 P;  1AW7 A;  4DA2 A;  2JK8 A;  5GAG C;  4F8M A;  1K83 B;  3TZU A;  2A69 C;  4JI0 Q;  1XMQ Q;  4DR6 L;  1VQM A;  5CV4 A;  1V9P A;  1STG A;  3Q23 A;  3J81 i;  3T51 B;  2WKD A;  3S1M H;  3I4N B;  4IPH A;  1PFN A;  1QG7 A;  2NN6 G;  1V43 A;  1P16 A;  2ICI A;  2IW3 A;  4JBJ A;  1LYL A;  1LTB D;  1L1O A;  2KHJ A;  4WOR A;  1BCP C;  2EQS A;  3NUC A;  4JI4 Q;  1X32 A;  1HFG A;  1R9T B;  4BBS G;  3D0F A;  1WTV A;  1VQC A;  1NMF A;  4RFB A;  5ISR A;  2PO4 A;  1MJE A;  4XYQ A;  3HOV G;  2HQL A;  4A3I H;  3I4M H;  2B63 B;  1PFB A;  1ICF B;  4LWC A;  3S15 H;  1HRJ A;  3V2T A;  3CCE A;  2PQE A;  4L5S A;  1LTR D;  4J6H A;  3CRK C;  5M5Y H;  3DWQ A;  5EBD A;  4F88 A;  1IYJ B;  4GKJ Q;  3CME A;  2VY3 A;  1J5E Q;  2A5H A;  5CV7 A;  1LTL A;  3S2D B;  1LT6 D;  4XDX A;  1CHP D;  1X3F A;  4NB3 A;  1KIX A;  2EYJ A;  4DK0 A;  4IUR A;  4OGQ C;  4LFA L;  2J4X A;  5BR8 Q;  1HQM C;  3U9S A;  2D9U A;  1Y1V G;  2KQ3 A;  5KIX A;  2NVT H;  1CQF A;  1T5E A;  3MVV A;  3I91 A;  5I2Y A;  3T4A C;  4TRD A;  3G71 A;  3HRZ C;  1GUN A;  3T1Y L;  4A3F H;  3AQQ A;  4GN3 B;  2UXC Q;  4YCW A;  5KNC A;  5C4X G;  2YTY A;  4BY1 H;  1CFM A;  3HOY H;  1VDZ A;  3NWT A;  3S1Q H;  4LFB Q;  3KF6 B;  2CCZ A;  3LGJ A;  4DV1 L;  3UE1 A;  1I4P A;  1KAB A;  2Z6B A;  3AFQ A;  4C1N I;  3L7Z C;  1SE4 A;  1JWS D;  1V1P B;  1TWA B;  2JEA I;  3URY A;  1EUJ A;  2G5D A;  1YBY A;  2MO1 A;  1YHB A;  1ZXT A;  3T16 A;  1DD2 A;  3E3X A;  2E2J H;  4HMI A;  4IPC A;  1C9O A;  1TKW B;  3D3R A;  2LXK A;  2MGS A;  3FKI G;  1E3P A;  4L63 B;  2KCM A;  1PH6 A;  4BY7 B;  2MP1 A;  2PQA B;  4GOP A;  2DUD A;  5C0X G;  3PO2 B;  1PYW D;  3PIO A;  3OTO L;  3C46 A;  5IYD H;  3I73 A;  1ZEQ X;  3HOW H;  4QY7 A;  4OO1 H;  1EY5 A;  3Q8D A;  3L2P A;  1JJC B;  1ZKO A;  3MHB A;  3EVQ A;  3NK9 A;  4DR1 Q;  4HID A;  1QWY A;  2LY7 A;  1F2L A;  1VQO A;  1X9N A;  1N8R C;  4DK6 C;  5AJ3 Q;  5DM7 3;  1HR0 Q;  1B53 A;  4U67 3;  5I4D A;  4C3I G;  4GNX C;  4DR4 Q;  5DAU A;  2R61 A;  1EOV A;  2F0V A;  3PIO 3;  1MJC A;  2GVB A;  2CWA A;  3CCL A;  2ZXR A;  2RDH A;  4IFD J;  3LWE A;  4EX5 A;  5EAY A;  5IY0 A;  3IL8 A;  2CH4 W;  2QW7 A;  4GS3 A;  3CCV A;  1SEB D;  1XTD A;  2KHI A;  5IWA L;  1LM0 A;  1S4Z A;  2RSO A;  4X64 Q;  3DWP A;  2A68 D;  2CQA A;  3T1H Q;  1PH8 A;  5IP7 H;  4FF4 A;  3SVM A;  1LV9 A;  4OIK A;  1I4R A;  4OWT B;  1ONL A;  1WTO A;  1EIF A;  3H94 A;  3KLS X;  4OX9 Q;  1F2Z A;  3LNN A;  1CKN B;  3K8A A;  1SRU A;  2CFM A;  1EY6 A;  3SGI A;  3UDX A;  2N55 A;  3NEM A;  1GKH A;  4DUY L;  1VQ7 A;  1EY9 A;  2ZM6 Q;  1EIH A;  4DNR B;  1SYE A;  3GTM H;  1PLF A;  4XT3 B;  1VQP A;  3HOU H;  2BCO A;  4DNI A;  4LUO A;  3A7A B;  2R92 H;  4JI2 L;  4C3H G;  4C2M B;  1J6Q A;  3JAM E;  1PH9 A;  1K83 H;  3M4Q A;  3PUV A;  1GHK A;  5IYB G;  4JOI C;  1FNV A;  1ICW A;  5EQ0 A;  1UE7 A;  3OWF A;  3J7Z C;  1DYQ A;  1SYD A;  4DV0 Q;  3U58 A;  3I4N H;  5LMN W;  4K0K Q;  2B2V A;  3B6Y A;  4WRD A;  3W5O A;  5K5P A;  1JE5 A;  3G4S A;  3A74 A;  1GVP A;  4B3S L;  5AFW A;  4A93 B;  4ME3 A;  4LF6 L;  1NUC A;  1I94 Q;  3C1E A;  4JBW A;  3O13 A;  4GKK L;  1PH3 A;  2R93 B;  4KN4 C;  1R9T H;  2KJX A;  2Q2T A;  4KK7 A;  2H1E A;  2F3I A;  4XQN A;  4DXG A;  3HZX A;  5CMD A;  2FHT A;  5EJW A;  2B63 H;  3I55 A;  4H02 A;  1XMO L;  1QVF A;  4PMW A;  5KYI A;  1S72 A;  4XQJ A;  1QUQ B;  1A3U A;  2B2W C;  1N33 Q;  1EL0 A;  1WTW A;  2J7Z A;  1TS3 A;  3NTI A;  2UUA Q;  1U5K A;  2OXP A;  1VQ9 A;  4LF5 L;  3WOF A;  4HIM A;  4DV3 L;  2VS1 A;  5ELE A;  3S2D H;  4R4T A;  5FKA C;  4XT1 B;  1X65 A;  2B2T C;  1FR3 A;  5IP9 G;  4BA1 I;  1XX8 A;  1QE6 A;  2B39 A;  2Z0S A;  4H0L C;  4PMB A;  2D5D A;  3M4O B;  2K14 A;  1UUP A;  3EN2 A;  3TSS A;  1OXU A;  1IXR A;  1GO3 E;  1KDA A;  1H9R A;  3UE0 A;  3HG9 A;  2F0T A;  4LFA Q;  5C3E B;  3GQB A;  5HUR A;  5CV9 A;  4R4I A;  2QCP X;  1HA5 A;  2IL8 A;  1HNX Q;  3MEH A;  3PSI A;  2TMP A;  2ASB A;  3KFU A;  4L5R C;  2JA6 G;  4DUZ L;  3T1Y Q;  1WD0 A;  2YTX A;  4XYO A;  4HIO A;  2F0U A;  2EY6 A;  3HFZ B;  5FO9 B;  1R4Q B;  1G2T A;  1TWA H;  5I6W A;  1YJ9 A;  4HCE A;  3KOJ A;  3J81 c;  1IBL L;  1BBX C;  4L8J A;  3HOZ B;  2Q8T A;  4DR3 L;  4X3U A;  3K5O A;  4AYB G;  5E7N A;  2CH4 A;  4XIG S;  3HOX G;  1RTO A;  1I3Q B;  4B9X A;  4JG2 A;  2EY5 A;  4JI5 Q;  3J7A V;  4BY7 H;  2ATW A;  1VQA A;  1X3E A;  3PUY A;  3PO3 G;  4DR7 L;  4LF7 L;  3PO2 H;  5IGE A;  2SOB A;  2XSC A;  4EQO A;  2ICE C;  1LUZ A;  3K58 A;  1Q8I A;  2JA8 B;  1SYB A;  2IHF A;  1NE3 A;  4DAP A;  2I46 A;  3QJY A;  4V0B A;  2BE5 C;  2UXD L;  4X65 Q;  3GP7 A;  4B3M L;  3S2H B;  3OTO Q;  2RQX A;  3S14 B;  4R4O A;  1XMQ L;  5J3B A;  1RIP A;  5KEE A;  2PZW A;  1NNX A;  2NUC A;  1B9M A;  4LK1 C;  1EYD A;  1TT2 A;  4PMC A;  1LTA D;  2PNR C;  2NVQ B;  3STB C;  4POG A;  4QIW B;  1SNM A;  4LNQ A;  5I6Y A;  3BZK A;  5CV6 A;  2L0C A;  1FGB D;  2B2Y C;  3TQY A;  1STA A;  5IIF A;  5LL6 S;  3TEH B;  5JPN C;  4Q5V A;  5K36 G;  3QB3 A;  2NZ1 D;  5JEA H;  3W3A A;  4A3D G;  1H9J A;  2BH8 A;  4ZLT F;  3QG1 A;  2R7F A;  3SR1 A;  3NTH A;  1C8C A;  2KA7 A;  2FIN B;  3M4P A;  4GN5 A;  4M1U B;  5EPK A;  1D5Z C;  1B1Z A;  2WB1 G;  5C0X J;  3BYT B;  1ESR A;  4R8N A;  4GKJ L;  3S15 B;  3H0G G;  1TS4 A;  1J5E L;  2Y0S G;  3RN5 A;  2PI2 E;  4C2M H;  5J22 A;  1PH7 A;  1KQS A;  3FVQ A;  3ONA B;  1GUS A;  3F2U A;  1EY4 A;  4OL7 A;  4EQN A;  5C5M A;  2K1B A;  3J80 L;  4X3T A;  5BN3 A;  4DN4 M;  3CXC A;  1S5C D;  5LMU L;  5L37 A;  4DV6 Q;  3MC0 B;  1WTP A;  1G51 A;  4ILW A;  4A3M G;  2VUM B;  1OTC A;  4A93 H;  4OON A;  2E2H B;  1JJ2 A;  1Y1W G;  1CKM A;  5IGC A;  2R93 H;  1DOK A;  2ALY B;  4A3C H;  4GNX A;  1U4M A;  1OXS C;  4NPS A;  4G4K A;  1FNW A;  4F7X A;  5JJZ A;  4B3S Q;  4LF6 Q;  3SK5 A;  4ZKC B;  3R2I A;  4LF9 L;  2OTL A;  3VR5 A;  1JC7 A;  1UE6 A;  2A6H D;  2EYL A;  2N8N A;  2HD3 A;  3Q24 A;  1CA5 A;  4ZYS A;  2F0D A;  1K3R A;  5A35 A;  4IFD G;  2WFW A;  1A62 A;  2EJG C;  1YNN D;  4YCU A;  3F8T A;  1HQR D;  3D4W A;  2KEN A;  4IFD I;  1TWF B;  5JAV A;  2F0F A;  3HKZ G;  1XMO Q;  5J1Z A;  4K5X A;  4GZY C;  2K5W A;  4CGY B;  1KHI A;  5C3X A;  4ZKB B;  4K5V A;  4ZUI A;  4KN7 C;  4P74 A;  3AFP A;  3Q0A A;  1SAP A;  3WDN A;  2ZT9 C;  4KV6 A;  1I5F A;  2L5T A;  1H9S B;  4RA8 A;  5C4J B;  4DAM A;  4DV3 Q;  4RAU C;  3KLR A;  2FMM A;  1L2F A;  1XXG A;  1XJV A;  3M4O H;  3EBE A;  1K73 C;  4DR1 L;  4JBM A;  4POF A;  3J81 L;  1HNZ Q;  1EQR A;  4FVM A;  5JJL A;  5LHY 1;  1SYC A;  3AEV A;  1HZA A;  1PDQ A;  4JOI A;  4LFC Q;  5TSS A;  5C3E H;  1IW7 C;  2OQ0 A;  1HR0 L;  4JI1 Q;  1PH1 A;  5FJ8 G;  4UDU C;  4RKB A;  3K5L A;  4KY5 A;  3K80 C;  3M7G A;  3RNU A;  2QDL A;  3W2D A;  3F2C A;  2LSS A;  1TVX A;  1K9M C;  4KKS A;  1N36 L;  4IOC A;  2K4K A;  1SSO A;  1PV4 A;  2AWO A;  3A8K E;  3PGZ A;  3HOZ H;  4X64 L;  4C3H B;  4U68 A;  1KNE A;  3RMH A;  5M3F G;  4FXG C;  2JA7 G;  2D2C C;  1C0A A;  2QGQ A;  1QNK A;  4QMG A;  3K81 C;  4OWX B;  2ENB A;  3T1H L;  1I3Q H;  2K5N A;  1XPR A;  1F2M A;  3K5N A;  1UAP A;  4MHE A;  4V19 0;  1F9Q A;  1IBL Q;  1MGS A;  1YHQ A;  1ZYR D;  1N9W A;  2LKV A;  2F4V Q;  1EFI D;  1PH2 A;  1J8I A;  2B2W A;  1D5M C;  2JA5 G;  2ZM6 L;  1TY2 A;  1FL0 A;  4A76 A;  4RWS C;  1U9R A;  1TWG B;  4DR7 Q;  3RR5 A;  4LF7 Q;  3OW7 A;  4R8I A;  3S2H H;  1H9K A;  2PYK A;  3S14 H;  4OIJ A;  2B2T A;  1K8M A;  3AMU A;  3BU2 A;  1RTN A;  4DAY B;  1Y14 B;  2UXD Q;  2IX0 A;  1BBW A;  4DV0 L;  2QF7 A;  2WP8 J;  3G7L A;  1JMC A;  3GTL B;  4K0K L;  1H9M A;  1VCI A;  2Q8R E;  1JE4 A;  2NVQ H;  4ID6 A;  3F2B A;  5I2X A;  4A3E G;  3E9I A;  4EVO A;  1D5X C;  1HNW Q;  1IL8 A;  2A6E D;  2DY8 A;  2F0K A;  1I94 L;  1GUW A;  4C3J G;  3SE0 A;  4BBR B;  3VDY A;  2F0I A;  1EFW A;  4AH6 A;  1S5E D;  4B3T L;  4QB4 A;  2NN6 I;  4O42 A;  1E24 A;  2PMZ B;  2F0W A;  4DFA A;  3CPW A;  3GTJ B;  4X66 L;  4NXN L;  1VF5 C;  4UY8 C;  3CD6 A;  4R9W A;  4A3K B;  4NXM Q;  3BJU A;  4CKE A;  1NY4 A;  3CC4 A;  2K50 A;  2MPM A;  4TSS A;  3W1G A;  1PTO D;  4LF4 Q;  3K57 A;  3TN2 A;  1N33 L;  3TBI B;  3M3Y B;  2EYH A;  3NE5 B;  2UUA L;  5C4X H;  5IT9 c;  1BNZ A;  4H7B A;  4IUU A;  3BVM A;  2IJ0 A;  3VR4 A;  2HDM A;  2BH2 A;  4OEM B;  1HJP A;  3P1H A;  3GTG B;  1H95 A;  4K6D A;  4ZUJ A;  3I4O A;  2WB1 E;  2IT1 A;  5JVG 3;  5JOB A;  5M3M G;  1DM0 B;  5FOB B;  1DOL A;  1JOO A;  4DV2 Q;  2KVM A;  3BZC A;  2VUM H;  4CDD C;  2HDL A;  2E2H H;  2K28 A;  4CKB A;  4DK1 A;  4HSV A;  3MXN B;  5LMU Q;  4KD3 A;  3HGB A;  4EQ5 A;  1Q81 C;  3FP9 A;  1HNX L;  4NKL A;  3SDZ A;  3PO3 B;  2L1B A;  1XNQ L;  4LUV A;  4RGT A;  4WJW A;  3KJO A;  3ULL A;  3CMA A;  2NZH A;  1RJT A;  4I65 A;  1ASZ A;  2Z4H A;  3K6O A;  2R7Z B;  3OWE B;  5EBC A;  2B2Y A;  1BVS A;  2EYO A;  1SMY D;  1MSH A;  4LF9 Q;  3RLF A;  1AP0 A;  1JR0 D;  1I4H A;  1TWF H;  2I5H A;  4CDC C;  1BUV T;  2EXZ A;  2Q2H A;  4WJ3 M;  1LLR D;  1HHV A;  3S16 H;  1AE3 A;  4JI5 L;  1EQV A;  1EOT A;  1D2B A;  2CVR A;  4IN3 A;  3UDG A;  1RDP D;  3PMF A;  5C4J H;  2I07 B;  2RDG A;  3KF6 A;  4Y7N B;  1RD9 D;  5I9P A;  5GQO A;  1WCM B;  4ALP A;  3HKZ E;  2PW7 A;  1JWM D;  2K5Q A;  2AQ1 B;  4TVA B;  5A2Q L;  5C44 B;  4X65 L;  4CKC A;  1V1P A;  4QGU A;  1JB3 A;  3NBH B;  1K8G A;  1SN8 A;  3EQL C;  4FDB A;  5E1F A;  5C0X I;  3GO5 A;  2NBF A;  1U0L A;  5DM6 3;  4BS9 A;  4OXP A;  1TQO A;  3CW2 C;  4P72 A;  3PCO B;  1SFO B;  4DNT B;  1DZ1 A;  5D3D A;  2G9H D;  4F87 A;  1IBM Q;  2KCN A;  2HIV A;  1V1Q A;  5EPL A;  3PV0 A;  1YJW A;  3TP8 A;  1AH9 A;  1Q8K A;  2JEB I;  2MJ8 A;  2RF4 A;  2VXW A;  5FO8 B;  2WB1 B;  2PQA A;  4A3F G;  1MBY A;  2QKI C;  2XWB B;  3G48 A;  4YCV A;  4RKL A;  4LAA A;  3C1F A;  4C3H H;  3J7A F;  4FNF A;  3HOY G;  4HJ8 A;  2J0T D;  3KK7 A;  2GA4 B;  1CUK A;  4HMJ A;  2CW0 D;  1HTP A;  4JYA Q;  5IYB H;  1N36 Q;  3KUP A;  4JK1 C;  3QOJ A;  4N8F A;  5ELC A;  3ERQ A;  1IBK Q;  2ZJQ A;  1A63 A;  1SXT A;  1EIY B;  2E5L Q;  1K28 A;  4A3B B;  2WAC A;  4L6T B;  4YWL A;  4KHZ A;  1W6J A;  4A3M B;  5JJK A;  3PF5 A;  2C35 B;  1Y1W B;  1TWG H;  2MUY A;  2A68 C;  2BA0 A;  2UU9 L;  1X3G A;  2OT2 A;  2G9D A;  2KCT A;  1CK1 A;  1DON A;  1EY7 A;  1STB A;  3P7J A;  3NEN A;  3R8B A;  4MTK A;  3HOW G;  1QVG A;  4KJN A;  3EA6 A;  1M1K C;  1IL2 A;  3GTL H;  4DV6 L;  2GN5 A;  5GAE C;  1CKN A;  2EZV A;  4IAL A;  1SNQ A;  2E8G A;  1G29 1;  3HKZ B;  2AWN A;  4J15 A;  3ZYY X;  2K33 A;  2F0M A;  1CSQ A;  4BBR H;  1HPC A;  5IT9 L;  3IFD A;  3QR8 A;  2LMC B;  1SE3 A;  3VR2 A;  3FPP A;  2AKW B;  1LT3 D;  3GTJ H;  5ELD A;  4A3K H;  1SR3 A;  2BOS A;  3Q22 A;  2OCE A;  3N6R A;  4P2C B;  4B3T Q;  1IHZ A;  2H4O A;  1AEX A;  1PYS B;  2YU9 B;  4QCL A;  4H44 C;  5KND A;  2JSO A;  3KDF B;  4A3G G;  3FEW X;  2E74 C;  4UAI A;  2ZTE A;  4K8I A;  3SK4 A;  4X66 Q;  4NXN Q;  5IP7 G;  1CT1 D;  5CV5 A;  3M3Y H;  2SDF A;  3K5M A;  1E0B A;  2LFN A;  1JCK B;  2R6G A;  2RVL A;  4KD4 A;  3I8Z A;  1YNJ D;  1RF2 D;  1KC8 C;  1B70 B;  2M2L A;  5DLQ E;  3I70 A;  1C48 A;  1VQE A;  2GVA A;  3E9H A;  3GTG H;  4CJ0 B;  3J7A 5;  1LT4 D;  1EZ8 A;  4ABN A;  3TRZ A;  3HOU G;  3X3N A;  1HNZ L;  1ENA A;  1YVC A;  1UWV A;  4LFC L;  4UP7 A;  1A2T A;  1QUQ A;  1JWU D;  1B4O A;  5C4Z A;  1VQ6 A;  1UEB A;  4GN4 B;  4XTC S;  4JI1 L;  3PO3 H;  1FGU A;  3CQZ H;  5CBA E;  4K6L A;  3SK6 A;  3RUZ A;  1NMG A;  1MKH A;  2R7Z H;  2MNA A;  1EWI A;  1SDF A;  2RHS B;  3TRE A;  3J80 E;  2NZO A;  2DJF C;  1XNQ Q;  2F52 A;  4RCO A;  3CF5 A;  4K2L A;  1CKO A;  2K75 A;  2CQO A;  1TS5 A;  4M8A A;  1GJX A;  3NTK A;  2EY2 A;  1SRO A;  2R3Z A;  2B63 G;  1PTO B;  3D6C A;  2SNS A;  3MXU A;  4ZQ3 A;  4EGV A;  2QA4 A;  2F4V L;  1F77 A;  1AFP A;  1QIL A;  3HP3 A;  2XRQ D;  5FLX c;  1SJE D;  5CR3 A;  1KLU D;  4Y7N H;  1QJO A;  4Z9C B;  5CV8 A;  2YYZ A;  4FYD A;  1WCM H;  4PZ7 A;  2H5X A;  1A15 A;  3NEL A;  1E1T A;  4C3J B;  5C44 H;  1HA6 A;  2RKS A;  1HR0 W;  3DEO A;  1LTG D;  4AQY L;  2F03 A;  1MD2 D;  2F3V A;  5IYC H;  4DR5 L;  1I4G A;  4KKT A;  1VF7 A;  4QUC A;  2WKC A;  1SFO H;  2EXD A;  1O7Y A;  1E2W A;  2K7V A;  4BBS B;  3A7L A;  2Z9H A;  1BBU A;  1PVO A;  4FF2 A;  3HOV B;  3CKI B;  1KD1 C;  1M8A A;  4FXD A;  2WAQ G;  4HSP A;  1XYI A;  1HNW L;  1VQI A;  5IGF A;  1EQT A;  4MTN A;  1G6P A;  3J81 E;  4IJH A;  1ENC A;  4IJL A;  4LW1 A;  1O7L A;  1HZ9 A;  1L0Y B;  1I6V C;  2HQE A;  1JIC A;  1TU2 B;  1XTC D;  2Z1C A;  4NXM L;  2F0O A;  4LF8 Q;  4A3B H;  2A1A A;  5M3M B;  3TS0 A;  1F9R A;  3SEB A;  1NJI C;  4JI3 Q;  4A3M H;  4LF4 L;  2EYF A;  1Y1W H;  1Y8N B;  1CHQ D;  3GV3 A;  3H3V H;  1Z6H A;  1FJG Q;  1Y1V B;  3FRP B;  2F0G A;  2F0Q A;  4DAV A;  1D1I A;  3MFY A;  4C56 C;  3OW2 A;  1WVL A;  3T56 B;  1PZJ D;  2WII B;  3D31 A;  2UU9 Q;  2F4I A;  5C4X B;  2VB2 X;  1N32 Q;  4ZK9 B;  2HIX A;  1U4P A;  1TS2 A;  2HHH Q;  4IFD H;  1PRT D;  4DV2 L;  4R4Q A;  2BA1 A;  2LS0 1;  5DEH A;  3RLO A;  4PQX A;  1EIG A;  1FNU A;  4DK3 C;  2VW9 A;  3CAM A;  2F0S A;  1KXL A;  3QWN A;  4J8Q A;  1HFN A;  1E7Z A;  4G7O C;  1BDO A;  3GTK B;  3K7A B;  3U50 C;  3A8I E;  4JPB W;  1E2Z A;  1Q7Y C;  1MHW C;  3CCQ A;  3KJP A;  1VQH A;  3GD7 A;  3FKI B;  2JA9 A;  3JAM i;  2SNM A;  1BR9 A;  2YU9 H;  3L0O A;  1OXV A;  1ENF A;  1G2S A;  3OHX C;  3OIP A;  4HN7 A;  2HUG A;  2V1C C;  4BA2 I;  3EJI A;  4JV5 Q;  4QL5 A;  4JCV E;  4JI7 Q;  2XTI A;  5GAD C;  4A3L H;  3SXH A;  1KDB A;  4JW0 A;  1I50 B;  2A6H C;  3I2Z A;  5E4W C;  3SHL A;  1FVI A;  2OTJ A;  2O4X A;  1VQN A;  2RA4 A;  3RLN A;  4BXX G;  3S16 B;  4RMF A;  4C3I B;  1YNN C;  2A73 B;  4KJO A;  4N8X 1;  1KLG D;  3VYT A;  4A3J G;  2E2I B;  3ITP A;  4LMQ D;  1OO9 B;  1PFM A;  1PA6 A;  3HKS A;  3T53 B;  1WD1 A;  4UPA A;  2N49 A;  4NP5 A;  1AN8 A;  2NWG A;  1OXX K;  3VA7 A;  1F9P A;  5FLM G;  2X6G A;  3UDF A;  1ILP A;  2DNC A;  4RHS A;  1KL9 A;  5EKL A;  4FO2 A;  4YWM A;  3DUZ A;  1I4X A;  1IBM L;  1XNR Q;  3L3O C;  2C5C A;  1QVC A;  1WJJ A;  3H3V C;  4K8J A;  5ELO A;  4A93 G;  5GRO A;  4BWG B;  1H9S A;  4A3C G;  4L5T A;  4ODG A;  4YIJ A;  4DV7 L;  1O78 A;  3C2P A;  4WJ4 A;  3GTQ B;  4KLK A;  1NR4 A;  1S40 A;  4O1N A;  4JYA L;  1MI2 A;  1PTO H;  3S1R B;  2OWO A;  1IZ6 A;  3AYH B;  3K0X A;  3T13 A;  3R3O A;  2VQE Q;  1IBK L;  2B2U C;  1QB5 D;  3UDI A;  2PI2 A;  4C1N K;  3TP6 A;  4JC0 A;  4KMU C;  2E5L L;  5COR A;  3OMG A;  4FXK C;  4A3E H;  1PRT F;  2O5I C;  4B3R Q;  2PZU A;  1W2B A;  3ICE A;  3U4V A;  4C3J H;  1A3T A;  1M4V A;  1D7Q A;  2NN6 H;  3TP5 A;  3DMU A;  5KYL A;  4RCN A;  2UUB L;  1W6K A;  3HS0 C;  1LTI D;  4IOA A;  1C7Y A;  1ZYR C;  4AYB E;  3KF8 B;  1MIU A;  4CDF C;  2HCC A;  2B3G A;  3MTS A;  4BBS H;  1VS0 A;  1G6Z A;  1HZC A;  4OHJ A;  1EZ6 A;  5HY6 A;  3DLL A;  4IUV A;  4GLA C;  4AQY Q;  3HOV H;  4A3G B;  4MIU A;  5D65 A;  5COY A;  5EKK A;  4DR5 Q;  1VQ4 A;  1YHA A;  2K32 A;  3H15 A;  4QUF A;  3KLS A;  2JQO A;  3M4Y A;  1EU4 A;  1ASY A;  1A6X A;  2F0J A;  4YWK A;  1IKL A;  5A2Q E;  3LWU A;  1VQK A;  4G57 A;  1A8V A;  1ROD A;  2QIL A;  1GUO A;  4NDX A;  2A69 D;  4YHH Q;  3E0J A;  5I9O A;  2WAQ E;  2EOT A;  4DAY A;  1BF4 A;  5M3M H;  1JB7 A;  3MAQ A;  2PW5 A;  4HTH A;  3HOZ G;  3V96 A;  2DNE A;  2A6E C;  2B29 A;  1PXU A;  1LTS D;  1EYC A;  1L1O B;  3OMC A;  4RGN A;  4A4I A;  3OYY A;  3VR3 A;  1VQL A;  1SYG A;  2ZJP A;  2CHB D;  4R1J A;  1Y1V H;  4DV5 L;  2MFI A;  2QEX A;  1AZQ A;  4KY7 A;  5E3F A;  3TP7 A;  1BO0 A;  1BCP D;  2RDF A;  1L0W A;  3C3L A;  1NR2 A;  3J7Y W;  4DGZ A;  1L0X B;  4LJZ C;  3FPU B;  1B44 D;  3UI2 A;  1I6H B;  1XPU A;  2JA8 G;  4YY3 Q;  2F3W A;  1G8Z D;  3PUX A;  4G7H C;  1Q46 A;  2I0Q A;  2JP1 A;  1PTO C;  2PCF B;  1XWE A;  2JA6 B;  4MNO A;  1KRT A;  1PFS A;  1DOM A;  2EE1 A;  1TWH H;  3CP0 A;  3X3M A;  5ELB A;  1T5X D;  1HTL D;  2F0P A;  1EWH A;  3A5U A;  3I72 A;  2D62 A;  5LMN Q;  1VQG A;  3G6J B;  2Z6K C;  2PNH A;  4QF4 A;  2EVB A;  5IGD A;  2M00 A;  4DV4 Q;  2X6L A;  2Y0S E;  3GTO B;  3GTK H;  3K7A H;  3R93 A;  4AYB B;  1WTQ A;  3NHH A;  2NVY B;  1SYF A;  4IPD A;  3WWV A;  2K5H A;  3HOX B;  1WTX A;  4DPG A;  4RGO S;  3FKI H;  4OEL B;  1X3P A;  2RHQ B;  1O7I A;  2QDB A;  4HR7 B;  4IUN A;  3CQZ B;  5EKI A;  4IZ8 A;  4G7Z C;  5C0X H;  5EPJ A;  3A5Z B;  3ULJ A;  4APV A;  2XRS D;  2NTT A;  2EIF A;  3NWS A;  1KAA A;  4HCS A;  4S3S A;  1U4R A;  1S5F D;  2Q2U A;  1UNS A;  4ULL A;  3E6Z X;  3PUZ A;  5IT9 E;  3P75 A;  3MXN A;  1I50 H;  1Y8P B;  3I56 A;  2E2D C;  4XQQ A;  1Q86 C;  4A3I G;  3I4M G;  4DU9 A;  3CU7 A;  2WAQ B;  1Z9F A;  2KEC A;  4C3I H;  5M9O A;  2NVX B;  1QZH A;  1SMY C;  1EY0 A;  3J81 j;  2VB3 X;  4PZ6 A;  2E2I H;  2L55 A;  4I7A A;  2L12 A;  3Q6S A;  1YIT A;  2EPB A;  4X3S A;  1GD7 A;  4NMZ A;  1QZG A;  2C9O A;  4CJ2 C;  2MHV A;  1EWC A;  3JC6 6;  1BXT A;  1PRT B;  2ZXP A;  3BG3 A;  1SE8 A;  2Z8L A;  5D3I B;  1PZI D;  2OF1 A;  1HZB A;  4GOP B;  3CPF A;  1NAP A;  2JN4 A;  4ME5 A;  4KI0 A;  3S1N B;  2AHO B;  1A2U A;  1SNC A;  2VUM G;  4A3D B;  3QOL A;  1OXT A;  3MA2 B;  1DXM A;  1K8O A;  3ND8 A;  3BVZ A;  3GTQ H;  1WI5 A;  1BOS A;  4DR2 L;  1SMX A;  2A8V A;  2ZJR A;  4HAE A;  3CCM A;  1X54 A;  1PTO F;  1BCP F;  2DN8 A;  3S1R H;  4IUT A;  1N34 Q;  4A75 A;  2KCC A;  4OWW B;  3NBH A;  3H0G B;  4DV7 Q;  4KKU A;  2Y0S B;  1CSP A;  3RD4 A;  3AU7 A;  5JEA J;  4BY1 G;  4RH6 A;  1KTK A;  4LF8 L;  2M9V A;  3DEP A;  1WTR A;  3KBG A;  4CJ1 B;  5CYU A;  1D6E C;  1GM5 A;  4JI3 L;  2F0H A;  3MFG A;  5T1G A;  2F0N A;  1A0I A;  5ELN A;  1VQD A;  2O5J C;  5IOD A;  1RKN A;  3DM3 A;  3JAM c;  4PNY A;  1FJG L;  2OQK A;  2CW0 C;  2Q2I A;  1AZP A;  1CI3 M;  1YEZ A;  3IAY A;  2IY5 B;  3S9W A;  4O2D A;  2K52 A;  5CBE E;  3QIA A;  2F0E A;  1EYA A;  4TKO B;  1S5D D;  1N32 L;  3TME A;  1WTH A;  2FMC A;  5M5X B;  2UUB Q;  4QQB X;  2HHH L;  1Q1E A;  1PH4 A;  4A3G H;  1GUT A;  2K5D A;  3CHB D;  4KHV A;  1SNP A;  1Q3L A;  1FYC A;  2FFK B;  3LX0 A;  3M85 A;  1HUN A;  5HGT A;  5IYD G;  1NSN S;  5C5L A;  2O2L D;  4OO1 G;  3G6E A;  3OOC A;  5M5W B;  2VZA A;  4IUQ A;  1QCB D;  4OO1 I;  2N88 A;  1JT8 A;  4Y52 H;  4RGM A;  1E2V A;  3S24 A;  4CDE C;  1B50 A;  1VQB A;  1YJN A;  2RSN A;  1TII D;  2VNU D;  3ND9 A;  2B8F A;  4XXE A;  1JJG A;  2XNA C;  2JJQ A;  4MZ9 A;  3VYR A;  2VQF Q;  3CCS A;  4A3J B;  2N78 A;  2K5V A;  1PHJ A;  1JOK A;  1YIJ A;  2XWJ B;  3A54 A;  1IYU A;  1LT5 D;  3AB9 A;  4N9T A;  5IP9 H;  1Y8O B;  5J39 A;  3PQI A;  3VYU A;  3MEF A;  2WIN B;  1TY0 A;  4JV5 L;  4K5W A;  2B2U A;  4X62 Q;  3OSO A;  3K59 A;  4JI7 L;  3IKJ A;  3QO2 A;  1A3V A;  1NBW A;  1DCZ A;  5ELF A;  4E6I A;  4DR6 Q;  5IGG A;  1I6H H;  2N3S A; 
#chains in the Genus database with same CATH homology
 1Q90 A;  5DNF A;  2AUK A;  2X69 A;  4B08 A;  1EU3 A;  3VYS A;  1BQQ T;  2AUJ D;  3TZD A;  1O7Z A;  2OEO A;  1EY8 A;  1YNJ C;  5D14 A;  4FF3 A;  4KY6 A;  1CZW A;  3GTP B;  3RZD B;  5IGB A;  2JYO A;  1HCZ A;  4KTA A;  5M3F B;  1Q12 A;  3M7N A;  2KUM A;  2JA7 B;  3FDT A;  1SNO A;  1PZK D;  2KOL A;  5JPM C;  3CRL C;  3N52 A;  4CHT B;  5G3L D;  2A74 C;  4EQP A;  1B9N A;  4Q0F A;  4TQU S;  2JA5 B;  2EJM A;  2JXM B;  5E4X A;  2L9H A;  1U4L A;  3L9A X;  3D6W A;  2EDG A;  3WOE A;  3K0Y A;  1QOH A;  2K01 A;  1BCP B;  2XIW A;  1UEA B;  2ZXO A;  4MN3 A;  2JE6 I;  5KGU A;  4ZRZ A;  2NTS A;  3V05 A;  1J9O A;  3U9O A;  3NXW A;  4A3E B;  1EEI D;  2K03 A;  1SBB B;  5F2D A;  3OIQ A;  3S17 B;  1GHJ A;  1SE2 A;  2EY1 A;  3GV6 A;  5K36 H;  4NW2 A;  3BYY B;  1B2T A;  3MXG A;  2K04 A;  3H09 A;  3SK8 A;  1SJH D;  5KNB A;  3JAM L;  2BE5 D;  1IKM A;  3I3C A;  4X3K A;  3ERO A;  3DWA A;  2QEJ C;  5C6A A;  1KNA A;  1ET9 A;  1X3Q A;  4N9P A;  2XN9 C;  5CC4 A;  3RZO B;  3BVG A;  3TDQ A;  4DXF A;  1VMC A;  1ILQ A;  3KBX A;  1RCV D;  2AQ3 B;  3BDL A;  5CGK A;  5FLX E;  1LTT D;  1TWC B;  2XVS A;  2Q8I B;  2TSS A;  1CQV A;  1QNU A;  2BDN A;  1GXD C;  3NPP A;  3NQT A;  5BN5 A;  1Z47 A;  1ET6 A;  2IWH A;  3NQI A;  3S1M B;  1JOQ A;  1PMR A;  1GOZ A;  3PIP 3;  5G3L F;  1V1O A;  3R2T A;  3P20 A;  4H13 C;  5KRU A;  1LAC A;  2L11 A;  3A8J E;  3BDO A;  1TWH B;  1Z7T A;  5FK9 C;  1B3A A;  4A3I B;  3I4M B;  1EEF D;  1LO5 D;  1STN A;  5BN4 A;  1PRT C;  3HEJ A;  5LL6 X;  1HUM A;  2PZT A;  3I90 A;  3MXP A;  5M5Y B;  1SND A;  4ZAI A;  1ESF A;  3DXJ C;  3MWY W;  3NSW A;  3I4L A;  3VR6 A;  3H6M A;  3DHQ A;  2B8G A;  3E5S A;  3NBI A;  1RHP A;  1D1K A;  5JEA G;  2K05 A;  2IX3 A;  1IYV A;  2KED A;  3A55 A;  3FMC A;  2F0L A;  1V8Q A;  4IQZ A;  4K2K A;  2NVT B;  1ML0 D;  3A56 A;  4RHR A;  5C3W A;  2Z4I A;  2KHS A;  4A3F B;  1STH A;  1S5B D;  2RBM A;  4B9W A;  1R4P B;  3D4D A;  4BY1 B;  3HOY B;  2L4N A;  3S1Q B;  2PPB C;  1I4Q A;  5EGT A;  5FO7 B;  1HXY D;  3BZD B;  2K6A A;  4DF7 A;  1CM9 A;  2NYZ D;  1KDC A;  5T1I A;  1CZG A;  4IUP A;  2EYP A;  4J1M A;  1O80 A;  4CBV A;  2E76 C;  4I7Z C;  4FF1 A;  2IX1 A;  5FLX L;  2ID0 A;  1DJR D;  2E2J B;  3MZ5 A;  1Y69 U;  1IW7 D;  1G91 A;  2SEB D;  2V4D A;  1LAB A;  3VA5 A;  1Q1B A;  2EJF C;  3HOW B;  3NP8 A;  1II3 A;  2DY7 A;  3EFX D;  2NB0 A;  3BDC A;  2HCI A;  1MSG A;  2B2V C;  1JQY D;  5IOC A;  1CTM A;  3DM1 A;  2F1M A;  1NCV A;  1STE A;  2WV6 D;  3H91 A;  2E75 C;  2AQ2 B;  1C4Q A;  1GUG A;  2KEE A;  5C4H A;  4PV1 C;  1JOR A;  3PUW A;  2BDO A;  2EYM A;  3BS1 A;  2IPK D;  1CA6 A;  1FD7 D;  4FP5 D;  3D8G A;  1TR5 A;  5JVH 3;  3KF8 A;  3IFT A;  1VMP A;  2FJ2 A;  1F9S A;  4K14 A;  5NUC A;  1STY A;  4WFN 3;  3D4R A;  4HED A;  3GTM B;  3HOU B;  1F2Y A;  3OPO A;  2R92 B;  1AW7 A;  4DA2 A;  4F8M A;  1K83 B;  3TZU A;  2A69 C;  5CV4 A;  1STG A;  3Q23 A;  3T51 B;  2WKD A;  3I4N B;  1PFN A;  1QG7 A;  2NN6 G;  1V43 A;  2ICI A;  2IW3 A;  1LTB D;  4WOR A;  1BCP C;  3NUC A;  1X32 A;  1HFG A;  1R9T B;  1WTV A;  4RFB A;  5ISR A;  2PO4 A;  4XYQ A;  2B63 B;  1PFB A;  1HRJ A;  3V2T A;  2PQE A;  1LTR D;  4J6H A;  3CRK C;  3DWQ A;  5EBD A;  4F88 A;  2A5H A;  5CV7 A;  3S2D B;  1LT6 D;  4XDX A;  1CHP D;  2EYJ A;  4DK0 A;  4IUR A;  4OGQ C;  2J4X A;  1HQM C;  3U9S A;  2D9U A;  2KQ3 A;  5KIX A;  1CQF A;  1T5E A;  3MVV A;  5I2Y A;  3I91 A;  3T4A C;  4TRD A;  3HRZ C;  1GUN A;  5KNC A;  1CFM A;  1VDZ A;  3NWT A;  1I4P A;  1KAB A;  4C1N I;  3L7Z C;  1SE4 A;  1JWS D;  1V1P B;  1TWA B;  2JEA I;  3URY A;  1ZXT A;  3T16 A;  1DD2 A;  4HMI A;  1TKW B;  3D3R A;  2MGS A;  4L63 B;  4BY7 B;  2MP1 A;  5C0X G;  3PO2 B;  1PYW D;  3C46 A;  3I73 A;  1ZEQ X;  4OO1 H;  1EY5 A;  1ZKO A;  3MHB A;  3EVQ A;  3NK9 A;  1QWY A;  2LY7 A;  1F2L A;  5DM7 3;  1B53 A;  4U67 3;  5I4D A;  4C3I G;  5DAU A;  2R61 A;  2F0V A;  3PIO 3;  2ZXR A;  2RDH A;  4IFD J;  3LWE A;  3IL8 A;  1SEB D;  1S4Z A;  2RSO A;  3DWP A;  2A68 D;  2CQA A;  4FF4 A;  3SVM A;  1LV9 A;  4OIK A;  1I4R A;  1ONL A;  1WTO A;  3H94 A;  3KLS X;  1F2Z A;  3LNN A;  1EY6 A;  2N55 A;  1EY9 A;  1EIH A;  4DNR B;  1SYE A;  1PLF A;  4XT3 B;  2BCO A;  3A7A B;  4C3H G;  4C2M B;  3JAM E;  3PUV A;  1GHK A;  1FNV A;  1ICW A;  5EQ0 A;  3OWF A;  1DYQ A;  1SYD A;  2B2V A;  4WRD A;  5K5P A;  4A93 B;  5AFW A;  1NUC A;  3C1E A;  4JBW A;  3O13 A;  2R93 B;  4KN4 C;  2KJX A;  4KK7 A;  2H1E A;  4XQN A;  4DXG A;  3HZX A;  5CMD A;  2FHT A;  5EJW A;  4PMW A;  5KYI A;  4XQJ A;  1A3U A;  2B2W C;  1EL0 A;  1WTW A;  2J7Z A;  1TS3 A;  3NTI A;  2OXP A;  3WOF A;  5ELE A;  5FKA C;  4XT1 B;  2B2T C;  1FR3 A;  4BA1 I;  1XX8 A;  1QE6 A;  2B39 A;  4H0L C;  4PMB A;  2D5D A;  3M4O B;  1UUP A;  3TSS A;  1OXU A;  1KDA A;  1H9R A;  3HG9 A;  2F0T A;  5C3E B;  3GQB A;  5HUR A;  5CV9 A;  2QCP X;  1HA5 A;  2IL8 A;  3MEH A;  2TMP A;  1WD0 A;  4XYO A;  5FO9 B;  2F0U A;  2EY6 A;  1R4Q B;  1G2T A;  5I6W A;  4HCE A;  1BBX C;  4L8J A;  3HOZ B;  2Q8T A;  4X3U A;  3K5O A;  4XIG S;  1RTO A;  1I3Q B;  4B9X A;  2EY5 A;  3J7A V;  3PUY A;  5IGE A;  2SOB A;  2XSC A;  4EQO A;  2ICE C;  3K58 A;  1Q8I A;  2JA8 B;  1SYB A;  4DAP A;  2I46 A;  3QJY A;  4V0B A;  2BE5 C;  3GP7 A;  3S2H B;  2RQX A;  3S14 B;  5KEE A;  2PZW A;  2NUC A;  1B9M A;  4LK1 C;  1EYD A;  1TT2 A;  4PMC A;  1LTA D;  2PNR C;  2NVQ B;  4QIW B;  1SNM A;  5I6Y A;  5CV6 A;  2L0C A;  1FGB D;  2B2Y C;  1STA A;  5IIF A;  5LL6 S;  5JPN C;  4Q5V A;  5K36 G;  3QB3 A;  2NZ1 D;  5JEA H;  3W3A A;  1H9J A;  4ZLT F;  3QG1 A;  3SR1 A;  3NTH A;  1C8C A;  2KA7 A;  2FIN B;  4M1U B;  5EPK A;  1D5Z C;  1B1Z A;  5C0X J;  3BYT B;  1ESR A;  4R8N A;  3S15 B;  1TS4 A;  5J22 A;  3FVQ A;  1GUS A;  3ONA B;  3F2U A;  1EY4 A;  4OL7 A;  4EQN A;  5C5M A;  2K1B A;  3J80 L;  4X3T A;  5BN3 A;  4DN4 M;  1S5C D;  3MC0 B;  1WTP A;  4ILW A;  2VUM B;  2E2H B;  5IGC A;  1DOK A;  1U4M A;  1OXS C;  4G4K A;  1FNW A;  4F7X A;  5JJZ A;  3SK5 A;  4ZKC B;  3R2I A;  3VR5 A;  1JC7 A;  2A6H D;  2EYL A;  3Q24 A;  1CA5 A;  4ZYS A;  2F0D A;  5A35 A;  4IFD G;  2EJG C;  1YNN D;  1HQR D;  3D4W A;  4IFD I;  1TWF B;  5JAV A;  2F0F A;  5J1Z A;  4K5X A;  4GZY C;  2K5W A;  4CGY B;  5C3X A;  4ZKB B;  4K5V A;  4ZUI A;  4KN7 C;  3Q0A A;  1SAP A;  3WDN A;  2ZT9 C;  4KV6 A;  2L5T A;  1H9S B;  4RA8 A;  5C4J B;  4RAU C;  3KLR A;  2FMM A;  1XXG A;  3J81 L;  4FVM A;  5LHY 1;  1SYC A;  1PDQ A;  5TSS A;  1IW7 C;  4UDU C;  4RKB A;  3K5L A;  4KY5 A;  3M7G A;  3W2D A;  1TVX A;  4KKS A;  1SSO A;  2AWO A;  3A8K E;  4C3H B;  4U68 A;  1KNE A;  3RMH A;  4FXG C;  2D2C C;  4QMG A;  1QNK A;  2ENB A;  1F2M A;  3K5N A;  1UAP A;  4MHE A;  4V19 0;  1F9Q A;  1MGS A;  1ZYR D;  2LKV A;  1EFI D;  1J8I A;  2B2W A;  1D5M C;  1TY2 A;  4RWS C;  1U9R A;  1TWG B;  3OW7 A;  4R8I A;  1H9K A;  2PYK A;  4OIJ A;  2B2T A;  1K8M A;  3AMU A;  1RTN A;  2IX0 A;  2QF7 A;  2WP8 J;  3G7L A;  3GTL B;  1H9M A;  1VCI A;  2Q8R E;  1JE4 A;  4ID6 A;  5I2X A;  4EVO A;  1D5X C;  1IL8 A;  2A6E D;  2DY8 A;  2F0K A;  1GUW A;  4C3J G;  3SE0 A;  4BBR B;  2F0I A;  1S5E D;  4QB4 A;  2NN6 I;  4O42 A;  2PMZ B;  2F0W A;  4DFA A;  3GTJ B;  1VF5 C;  4R9W A;  4A3K B;  4CKE A;  2MPM A;  4TSS A;  1PTO D;  3K57 A;  3TN2 A;  3TBI B;  3M3Y B;  2EYH A;  3NE5 B;  1BNZ A;  4H7B A;  4IUU A;  3BVM A;  2IJ0 A;  3VR4 A;  2HDM A;  3P1H A;  3GTG B;  4K6D A;  4ZUJ A;  2IT1 A;  5JVG 3;  5JOB A;  1DM0 B;  5FOB B;  1DOL A;  1JOO A;  2KVM A;  2HDL A;  2K28 A;  4CKB A;  4DK1 A;  4HSV A;  4KD3 A;  3HGB A;  4NKL A;  3SDZ A;  3PO3 B;  2L1B A;  4RGT A;  4WJW A;  1RJT A;  4I65 A;  2Z4H A;  3K6O A;  2R7Z B;  3OWE B;  5EBC A;  2B2Y A;  2EYO A;  1SMY D;  1MSH A;  3RLF A;  1AP0 A;  1JR0 D;  1I4H A;  1BUV T;  2EXZ A;  1LLR D;  1HHV A;  1EQV A;  1EOT A;  1D2B A;  2CVR A;  4IN3 A;  1RDP D;  3PMF A;  4Y7N B;  2I07 B;  2RDG A;  1RD9 D;  5I9P A;  1WCM B;  2PW7 A;  1JWM D;  2K5Q A;  2AQ1 B;  5A2Q L;  5C44 B;  4CKC A;  1V1P A;  1JB3 A;  3EQL C;  5C0X I;  5E1F A;  3GO5 A;  2NBF A;  5DM6 3;  4BS9 A;  1TQO A;  1SFO B;  4DNT B;  1DZ1 A;  5D3D A;  2G9H D;  4F87 A;  2KCN A;  5EPL A;  3PV0 A;  3TP8 A;  2MJ8 A;  2JEB I;  2VXW A;  5FO8 B;  2WB1 B;  1MBY A;  2QKI C;  2XWB B;  4RKL A;  4LAA A;  3C1F A;  3J7A F;  4FNF A;  2J0T D;  3KK7 A;  2GA4 B;  4HMJ A;  2CW0 D;  1HTP A;  3KUP A;  4JK1 C;  3QOJ A;  5ELC A;  3ERQ A;  1SXT A;  4A3B B;  2WAC A;  4L6T B;  4KHZ A;  1W6J A;  4A3M B;  1Y1W B;  2MUY A;  2A68 C;  2BA0 A;  2OT2 A;  2G9D A;  1CK1 A;  1DON A;  1EY7 A;  1STB A;  3P7J A;  3R8B A;  4KJN A;  3EA6 A;  2EZV A;  4IAL A;  1SNQ A;  1G29 1;  3HKZ B;  2AWN A;  3ZYY X;  2K33 A;  2F0M A;  1HPC A;  5IT9 L;  3IFD A;  2LMC B;  1SE3 A;  3VR2 A;  3FPP A;  1LT3 D;  5ELD A;  2BOS A;  3Q22 A;  3N6R A;  4P2C B;  1IHZ A;  2H4O A;  1AEX A;  2YU9 B;  4QCL A;  4H44 C;  5KND A;  2JSO A;  3FEW X;  2E74 C;  4UAI A;  4K8I A;  3SK4 A;  1CT1 D;  5CV5 A;  2SDF A;  3K5M A;  1E0B A;  2LFN A;  1JCK B;  2R6G A;  2RVL A;  4KD4 A;  3I8Z A;  1YNJ D;  1RF2 D;  2M2L A;  3I70 A;  1C48 A;  4CJ0 B;  1LT4 D;  1EZ8 A;  4ABN A;  3X3N A;  1ENA A;  1A2T A;  1JWU D;  1B4O A;  5C4Z A;  4XTC S;  5CBA E;  4K6L A;  3SK6 A;  3RUZ A;  1SDF A;  3J80 E;  4RCO A;  4K2L A;  1TS5 A;  4M8A A;  1GJX A;  3NTK A;  2EY2 A;  2R3Z A;  1PTO B;  3D6C A;  2SNS A;  3MXU A;  4ZQ3 A;  4EGV A;  1F77 A;  1AFP A;  1QIL A;  3HP3 A;  2XRQ D;  1SJE D;  5CR3 A;  1KLU D;  4Z9C B;  1QJO A;  5CV8 A;  2YYZ A;  4FYD A;  1A15 A;  4C3J B;  1HA6 A;  2RKS A;  3DEO A;  1LTG D;  2F03 A;  1MD2 D;  2F3V A;  1I4G A;  4KKT A;  1VF7 A;  4QUC A;  2WKC A;  1O7Y A;  1E2W A;  2K7V A;  4BBS B;  3A7L A;  4FF2 A;  3HOV B;  3CKI B;  1M8A A;  4FXD A;  4HSP A;  1XYI A;  5IGF A;  1EQT A;  3J81 E;  1ENC A;  1O7L A;  1L0Y B;  1I6V C;  2HQE A;  1JIC A;  1TU2 B;  1XTC D;  2Z1C A;  2F0O A;  5M3M B;  1F9R A;  3SEB A;  2EYF A;  1Y8N B;  1CHQ D;  3GV3 A;  1Z6H A;  1Y1V B;  3FRP B;  2F0G A;  2F0Q A;  4DAV A;  1D1I A;  3MFY A;  4C56 C;  1WVL A;  3T56 B;  1PZJ D;  2WII B;  3D31 A;  2F4I A;  5C4X B;  2VB2 X;  4ZK9 B;  1U4P A;  1TS2 A;  4IFD H;  1PRT D;  2BA1 A;  2LS0 1;  5DEH A;  4PQX A;  1EIG A;  1FNU A;  2F0S A;  3QWN A;  4J8Q A;  1HFN A;  4G7O C;  1BDO A;  3GTK B;  3K7A B;  3A8I E;  1E2Z A;  3GD7 A;  3FKI B;  2SNM A;  1BR9 A;  1OXV A;  1ENF A;  1G2S A;  3OHX C;  3OIP A;  4HN7 A;  2HUG A;  4BA2 I;  3EJI A;  3SXH A;  1KDB A;  1I50 B;  2A6H C;  5E4W C;  3SHL A;  2O4X A;  2RA4 A;  3S16 B;  4C3I B;  1YNN C;  2A73 B;  4KJO A;  1KLG D;  3VYT A;  2E2I B;  3ITP A;  4LMQ D;  1OO9 B;  1PFM A;  3T53 B;  1WD1 A;  4NP5 A;  1AN8 A;  2NWG A;  1OXX K;  3VA7 A;  1F9P A;  2X6G A;  1ILP A;  2DNC A;  4RHS A;  5EKL A;  4FO2 A;  3DUZ A;  1I4X A;  3L3O C;  2C5C A;  3H3V C;  4K8J A;  4BWG B;  1H9S A;  4ODG A;  4YIJ A;  1O78 A;  3C2P A;  3GTQ B;  1NR4 A;  4O1N A;  1MI2 A;  1PTO H;  3S1R B;  3T13 A;  3R3O A;  2B2U C;  1QB5 D;  4C1N K;  3TP6 A;  4KMU C;  5COR A;  3OMG A;  4FXK C;  1PRT F;  2O5I C;  2PZU A;  1A3T A;  1M4V A;  2NN6 H;  3TP5 A;  3DMU A;  5KYL A;  4RCN A;  1W6K A;  3HS0 C;  1LTI D;  1ZYR C;  2HCC A;  3MTS A;  1G6Z A;  4OHJ A;  1EZ6 A;  4IUV A;  4A3G B;  4MIU A;  5D65 A;  5COY A;  5EKK A;  2K32 A;  4QUF A;  3KLS A;  3M4Y A;  1EU4 A;  1A6X A;  2F0J A;  1IKL A;  5A2Q E;  3LWU A;  4G57 A;  1ROD A;  2QIL A;  1GUO A;  4NDX A;  2A69 D;  3E0J A;  5I9O A;  2EOT A;  4DAY A;  1BF4 A;  3MAQ A;  2PW5 A;  4HTH A;  3V96 A;  2DNE A;  2A6E C;  1PXU A;  1LTS D;  1EYC A;  3OMC A;  4RGN A;  3VR3 A;  1SYG A;  2CHB D;  1AZQ A;  4KY7 A;  5E3F A;  3TP7 A;  1BO0 A;  1BCP D;  2RDF A;  3C3L A;  1NR2 A;  3J7Y W;  4DGZ A;  1L0X B;  4LJZ C;  3FPU B;  1B44 D;  3UI2 A;  1I6H B;  2F3W A;  1G8Z D;  3PUX A;  4G7H C;  2JP1 A;  1PTO C;  2PCF B;  1XWE A;  2JA6 B;  1DOM A;  2EE1 A;  3X3M A;  5ELB A;  1T5X D;  1HTL D;  2F0P A;  1EWH A;  3I72 A;  2D62 A;  3G6J B;  4QF4 A;  2EVB A;  5IGD A;  2M00 A;  2X6L A;  3GTO B;  3R93 A;  4AYB B;  1WTQ A;  3NHH A;  2NVY B;  1SYF A;  3HOX B;  1WTX A;  4RGO S;  1X3P A;  2QDB A;  4HR7 B;  4IUN A;  3CQZ B;  5EKI A;  4IZ8 A;  4G7Z C;  5C0X H;  5EPJ A;  2XRS D;  2NTT A;  3NWS A;  1KAA A;  4HCS A;  4S3S A;  1U4R A;  1S5F D;  1UNS A;  4ULL A;  3E6Z X;  3PUZ A;  5IT9 E;  3P75 A;  3MXN A;  1Y8P B;  2E2D C;  4XQQ A;  4DU9 A;  3CU7 A;  2WAQ B;  2KEC A;  5M9O A;  2NVX B;  1SMY C;  1EY0 A;  2VB3 X;  2L55 A;  2L12 A;  3Q6S A;  2EPB A;  4X3S A;  4NMZ A;  2C9O A;  4CJ2 C;  2MHV A;  1EWC A;  1BXT A;  1PRT B;  2ZXP A;  3BG3 A;  2Z8L A;  5D3I B;  1PZI D;  2OF1 A;  1NAP A;  4ME5 A;  4KI0 A;  3S1N B;  1A2U A;  1SNC A;  4A3D B;  3QOL A;  1OXT A;  3MA2 B;  1DXM A;  1K8O A;  3ND8 A;  3BVZ A;  1BOS A;  4HAE A;  1PTO F;  1BCP F;  2DN8 A;  4IUT A;  2KCC A;  3NBH A;  3H0G B;  4KKU A;  2Y0S B;  3RD4 A;  3AU7 A;  5JEA J;  4RH6 A;  1KTK A;  2M9V A;  3DEP A;  1WTR A;  3KBG A;  4CJ1 B;  5CYU A;  1D6E C;  2F0H A;  3MFG A;  5T1G A;  2F0N A;  2O5J C;  5IOD A;  1RKN A;  4PNY A;  2CW0 C;  1AZP A;  1CI3 M;  3IAY A;  3S9W A;  5CBE E;  3QIA A;  2F0E A;  1EYA A;  4TKO B;  1S5D D;  3TME A;  2FMC A;  5M5X B;  1Q1E A;  1GUT A;  2K5D A;  3CHB D;  4KHV A;  1SNP A;  1Q3L A;  1FYC A;  2FFK B;  3LX0 A;  3M85 A;  1HUN A;  5HGT A;  1NSN S;  5C5L A;  2O2L D;  4OO1 G;  3OOC A;  5M5W B;  4IUQ A;  1QCB D;  4OO1 I;  2N88 A;  4RGM A;  1E2V A;  1B50 A;  2RSN A;  1TII D;  2VNU D;  3ND9 A;  2B8F A;  4XXE A;  2XNA C;  3VYR A;  4A3J B;  1JOK A;  2XWJ B;  3A54 A;  1IYU A;  1LT5 D;  3AB9 A;  4N9T A;  5J39 A;  1Y8O B;  3VYU A;  2WIN B;  1TY0 A;  4K5W A;  2B2U A;  3OSO A;  3K59 A;  3IKJ A;  3QO2 A;  1A3V A;  1DCZ A;  5ELF A;  4E6I A;  5IGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...