2QDBA

Crystal structure of staphylococcal nuclease variant e75q/d21n/t33v/t41i/s59a/p117g/s128a at 100 k
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
125
Chain Sequence
KLHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIPYGPEAAAFTKKMVENAKKIEVQFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQHLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Electrostatic effects in a network of polar and ionizable groups in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 36
structure length 125
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qdbA00
4TRDA 3OMGA 4H7BA 3QB3A 1F2MA 4DGZA 5CGKA 3P75A 1TR5A 3RUZA 1EQVA 5DAUA 1SYEA 2EYJA 5E1FA 4E6IA 2F3WA 2O4XA 4K5XA 4DU9A 5C5MA 4EQPA 5IGGA 2RBMA 5CV9A 3NHHA 2WACA 3T16A 5I6WA 1EY0A 3SK8A 1EYCA 2PZWA 1A2TA 2F0PA 2PQEA 3HEJA 1ENAA 2EY2A 4KY6A 4NKLA 2EYFA 5EKLA 2EXZA 2HQEA 5KEEA 4B9WA 1KDCA 1SNPA 3D4DA 1SNCA 4KV6A 2EYMA 4K2KA 5NUCA 2OXPA 2F0WA 3EJIA 2EYPA 2F0JA 4KHVA 4ME5A 1STAA 3DMUA 5CV8A 1KDAA 2SNSA 2EY1A 3BDCA 2F0KA 2F0OA 5JOBA 5I6YA 1JOQA 3QOJA 5C5LA 2PW7A 4K5WA 4IUNA 4RKLA 1SYCA 4NDXA 3VA5A 5C4ZA 1NUCA 2RKSA 4KY5A 5CV7A 1STHA 3OSOA 3V2TA 1AEXA 4PMBA 4KTAA 5KIXA 4IALA 3LX0A 1ENCA 3DHQA 4B9XA 5IGCA 2PYKA 3ERQA 4NMZA 3R3OA 2KHSA 2RDFA 1STNA 5JAVA 3SXHA 1EY8A 1SYFA 3HZXA 4ZUIA 4ID6A 5CV6A 1EYDA 1STBA 4K2LA 2F0LA 1KABA 3MZ5A 3TMEA 2F0HA 5M9OA 1EZ8A 2ENBA 1EYAA 2PZTA 5E3FA 5EKKA 4F7XA 4N9PA 5ISRA 1II3A 4DF7A 5J1ZA 4RKBA 4K8IA 1EY5A 1STGA 2F0EA 2LKVA 4QMGA 3MVVA 2F3VA 3NP8A 4N9TA 5DEHA 4DFAA 4EQNA 3E5SA 5C6AA 5IOCA 3PMFA 4EVOA 3SK6A 4WORA 3TP7A 2F0NA 2SOBA 5J39A 4QB4A 1EY7A 1JOKA 5CC4A 4S3SA 5IODA 2F0IA 4ZQ3A 2F0SA 1TT2A 4PMCA 5KYLA 3EVQA 4MIUA 5I9PA 1SNQA 4KD3A 5KGUA 3C1EA 2F0UA 3MEHA 1EY9A 1KAAA 4K6DA 4OL7A 3SK4A 3TP8A 4KJNA 1SNOA 5K5PA 2EY6A 3QOLA 2F0FA 3OMCA 4ODGA 1F2YA 2PZUA 1A3VA 3D4WA 1EY4A 2EYLA 2SNMA 2F0GA 1IHZA 4K14A 2F0QA 3NQTA 5EGTA 4PNYA 5C4HA 4IZ8A 4K8JA 3SHLA 1TQOA 1STYA 3P1HA 5C3WA 5C3XA 1JOOA 1SYDA 1F2ZA 1A3TA 2F0DA 1KDBA 3SK5A 2M00A 5IIFA 2F0MA 1SYBA 2OEOA 4HMIA 1EZ6A 5KYIA 3EROA 4G57A 5IGDA 3NK9A 2EYOA 1A2UA 3MHBA 4LAAA 3SR1A 4KY7A 3T13A 4K5VA 5HURA 4QF4A 1A3UA 5CV5A 4HMJA 5CR3A 4F8MA 5KRUA 3ITPA 2KQ3A 2NUCA 2EYHA 1U9RA 1RKNA 2F0TA 4J1MA 3H6MA 4WRDA 1NSNS 2EY5A 2OF1A 1SNMA 3NUCA 5IGBA 2F0VA 3OWFA 5CV4A 5I9OA 5IGFA 1EY6A 5HGTA 1JORA 4ZUJA 4EQOA 2QDBA 3BDLA 5J22A 4KD4A 4HTHA 5IGEA 3TP5A 4KJOA 3D8GA 1SNDA 4NP5A 4R8NA 3C1FA 3U9OA 3TP6A 4YIJA 3NXWA 3MXPA 5F2DA 3D6CA 4J6HA 4I65A 1SYGA 2PW5A 3S9WA
chains in the Genus database with same CATH superfamily
2EOTA 1F2MA 3K0YA 3R2IA 4APVA 5C4XH 1EQTA 2O4XA 4DU9A 1GO3E 3I4NH 1GD7A 2AKWB 1YNND 1PRTF 1UEBA 4QCLA 4QQBX 2R93H 4F88A 5M3MH 4L6TB 3GTPB 3J81L 3PO2B 3D4DA 4KV6A 3RZOB 5IWAL 4A3EH 3FVQA 1YNJD 1NTGA 4P71A 1KXLA 3ONAB 2VW9A 3M9BA 1B1ZA 4HIDA 5C0XI 1M1KC 4NDXA 4HN7A 4KTAA 3I4MH 1IYJB 4LF5L 1FJGQ 4FXDA 3HZXA 4RCNA 3I4OA 3GTQB 1O78A 2CFMA 4DV0L 4JI0L 2F0HA 3M7NA 4DAYA 4DAVA 3S14H 4C3HB 4B3RQ 1YHBA 3Q24A 3F2UA 2WAQB 4OGQC 3L2PA 3K81C 4IOCA 1VQIA 2QGQA 1NMFA 2WIIB 2CCZA 1NY4A 1FD7D 4JVZA 4X64Q 4JV5Q 1RDPD 3QO2A 1JOKA 3CW2C 1QZHA 2ZJQA 4PMCA 3D0FA 4MIUA 4NXML 2E2IH 1XMQL 2B8GA 2JA6G 5ELDA 3SK4A 3EQLC 4GN3B 2K03A 3CCQA 1TWHB 3QJYA 3L7ZC 5DLQE 2MO1A 4KKSA 5I2XA 1D8LA 1TWFB 2GVAA 1DOMA 4P75A 3PUXA 4PQXA 4DV1Q 4HMIA 3S1NH 4CKEA 4GOPB 4IJLA 2R7ZH 3T13A 1NMGA 1XTCD 2KENA 3UDGA 4JI6Q 2NUCA 3FMCA 1RD9D 4DR2L 1I4RA 2PNHA 1NSNS 1CZWA 2CWAA 3J80E 4EQOA 1BCPB 2L5TA 5J22A 3MWYW 1B2TA 4C3IB 3WOEA 1IXRA 2E76C 2NZHA 3I56A 1Q82C 4XQJA 5IYDH 1V1PB 4YY3Q 1BCPF 3H3VC 2BDNA 1TY2A 1SE8A 4DR7Q 1EOVA 2F3IA 1NCVA 1FYCA 4KMUC 2VQEL 2AQ3B 1LUZA 1EQVA 3IRBA 4A3BB 1SYEA 1Y8PB 3A54A 4EQPA 1UWVA 2L9HA 2RDGA 1MKHA 5CV9A 5A35A 2Y0SE 2KCNA 3SK8A 1O7ZA 1EUJA 1YHAA 3SE0A 4DR1L 3HOYG 2XWJB 1PDQA 1Q12A 1KRTA 1XJVA 1BBXC 2B2VC 2B2YA 2K32A 3RUZA 2F0JA 1E22A 4JI5L 1STAA 3TZUA 4QIWE 3I4NG 5T1IA 3DLLA 1W6JA 2JXMB 5CV7A 2R93G 3GQBA 5KIXA 4QUCA 3HOWB 1ILQA 4OX9L 4OONA 2VUMB 1I50H 2D2CC 3CRLC 3IKJA 4A3EG 1HR0Q 1D6EC 2F0LA 3S24A 4QJFA 1SJHD 2PZTA 3J7ZC 1QVCA 5JEAG 1JCKB 2B63H 3S1QH 1YVCA 4QMGA 2ICIA 3I4MG 1EEFD 2F3VA 3K80C 1U5KA 4GLVB 2A73B 2QA4A 2ZJPA 1BR9A 1L2FA 5BN4A 1PLFA 4BBSH 3TP7A 4XYOA 5HGQA 2KHIA 2PI2E 5IYCG 1TWCH 2UXBL 1VQ7A 3NBIA 1TS4A 3CF5A 3H3VH 1SNQA 4DUYQ 1GUWA 2JSOA 4B3SQ 2D62A 4POFA 2SNMA 3BYYB 2OTJA 3EA6A 3HOZH 1MIUA 2DUDA 1TQOA 3W1GA 3NELA 4MZ9A 2B2WA 4FVMA 3OTOQ 1G291 2UUAQ 4KI0A 1W6KA 3T51B 3GP7A 3BJUA 1IYVA 2KVMA 1Q7YC 5IGBA 3NUCA 4HIOA 1U4MA 3PUYA 1DGSA 3BDLA 4XT3B 1STEA 3FHWA 2KA7A 2R7ZG 3A74A 5FO9B 1HZ9A 1F9PA 4G7HC 1FJGL 1O80A 1U4PA 1SYGA 1R4QB 4CJ0B 3AFPA 1OXUA 3K8AA 5DAUA 4B3RL 1MBYA 1I4QA 4K5XA 1Y8OB 4N8X1 1LLRD 5DM73 1VS0A 2A69D 3M4OH 1A2TA 2F0PA 3PV0A 2CW0D 4X64L 4DR6Q 5E7NA 1OXXK 4KN4C 4JV5L 4A3MH 3A56A 4P72A 1JT8A 5NUCA 3PO3H 4MNOA 4V190 4ILWA 5I6YA 4GZYC 1ASZA 2BA0A 2ATWA 1VF7A 2VXWA 1UNSA 3GTGB 2EJMA 1TXYA 3DHQA 5JPMC 3S2HB 2BOSA 3FPUB 4J15A 1LTSD 4R9WA 1SFOB 1BBWA 1J8IA 3OW7A 1EZ8A 2UXCL 1ZYRD 4JI6L 2XTIA 2A1AA 3DEPA 1BQQT 5DNFA 4X3TA 4DFAA 4JI7Q 2NZ1D 3KYHC 3NQIA 1TWAH 2C5CA 3T1HQ 1EY7A 3GTMH 2K5DA 4ZQ3A 2F0SA 2LS01 4YY3L 3GTJH 2JJQA 2L0CA 4X66Q 3DUZA 3HS0C 2K7VA 3K5MA 3CU7A 1JJCB 2D0PA 1KAAA 2IY5B 3TP8A 1K8AC 4R4TA 2A6HC 2MGSA 1RTOA 3J81j 1HR0W 2BH2A 2F0QA 5HY6A 3HOYB 1IBMQ 4X62Q 1STYA 1Z47A 1E1TA 1VQLA 3A55A 1JOOA 1SE4A 5C3EG 2K52A 5KYIA 2RHSB 3NK9A 3I4NB 1SMXA 1D5ZC 1UUPA 4QF4A 5HURA 1P8LA 3JAMc 3KOJA 4F8MA 2R93B 2R3ZA 3HOUH 1L0XB 2ZXRA 3VR3A 4DAYB 1JORA 2PMZB 3EIVA 1DM0B 4A3EB 1CHPD 4BBRH 2A68D 5IP7H 1BDOA 3K0XA 1D1IA 4BA2I 5E1FA 1QVFA 1PYWD 4A3DH 2EPBA 5CBAE 1CSQA 3GV3A 1WI5A 2DJGC 1EU4A 1EIYB 5EKLA 4NKLA 3CRKC 3ULJA 2QEXA 2VZAA 3KBXA 1V8QA 4R4OA 4OWXB 4A75A 1LT3D 1VQGA 5IP9H 1KL9A 4A3CH 1Z7TA 4DAMA 4DUYL 2SNSA 4DV7Q 1LTGD 2I46A 4DV5Q 2HD3A 3HKZG 4BXXG 5LMNQ 4QY7A 3TN2A 1KQSA 4YCVA 1JJ2A 1Q8KA 1KD1C 4KY5A 4B3SL 3V2TA 2RQXA 2QKIC 2E2IB 2A69C 3LX0A 1RJTA 2F52A 1XPUA 3NTHA 2CW0C 1IL2A 3E0JA 4B3TL 2AQ1B 2C9OA 3ULPA 5EQ0A 1X3QA 1IW7C 3CC7A 1Q90A 2K33A 3OTOL 4CDCC 5EKKA 4IFDJ 1EOTA 4N9PA 4JI3Q 3NBHA 4RKBA 2E2DC 5E4XA 1TVXA 1EY5A 3B6YA 4ZRZA 1J5EL 4N9TA 4RGOS 1GUSA 2XN9C 3LGJA 4BY1H 2R7ZB 2E2JH 3FKIH 4LFAQ 3X3NA 2IT1A 3AYHB 1TT2A 1Y69U 5M5WH 2H4OA 5KGUA 2F0UA 2NTSA 1EY9A 1B3QA 3KLWA 3OMCA 1F2YA 4IFDH 1A3VA 3T56B 2F0GA 4HSVA 5FLXE 3NWSA 5EGTA 2NN6I 4R4IA 2FJ2A 2A6ED 4IZ8A 3CCSA 2F0DA 3STBD 4CDFC 2F0MA 2OEOA 4KKUA 1CZGA 4DR6L 4IOAA 3SR1A 1PTOD 1I4XA 4JCVE 2H1EA 4L63B 2NB0A 1HHVA 3PGZA 5IWAQ 3ITPA 2KQ3A 4OEMB 3D6WA 1VQPA 3PUVA 5KNDA 2HCIA 5ELCA 3UE1A 4CDEC 5EJWA 4O1NA 4GN4B 3WWVA 4HSPA 4DR4L 1CK1A 1Y14B 2TMPA 1SNDA 5COYA 1WTOA 4NXNL 1D7QA 4IUUA 4GNXC 3NXWA 3MXPA 3KUPA 2VNUD 3S2DH 2A74C 2JYOA 4H7BA 4CBVA 4DV0Q 1TR5A 2KJXA 1I50B 4DPGA 2BA1A 2OTLA 4R1JA 4JI7L 3DWPA 4G7ZC 4JBJA 3PIP3 3K6OA 1M90C 3T1HL 4X3UA 1KDCA 1F9SA 3CCEA 4X6AH 2EYPA 3ND9A 3X3MA 4IN3A 1XMQQ 1K9MC 1GOZA 4ZAIA 4KN7C 1C0AA 5C3EB 3DM3A 4RMFA 4PMBA 1RTNA 2PCFB 1HPCA 3MXNA 2RSNA 1X55A 3A0JA 2V4DA 1DOLA 4R8IA 5LMUQ 4X62L 2EIFA 2OQ0A 4KK7A 1MGSA 4A3CG 1STBA 3L0OA 3CCJA 4ME3A 2ENBA 3CP0A 3Q23A 5E3FA 1VQNA 3RNUA 3K7UC 4ZK9B 4X65L 3BYTB 1K83H 4XTCS 2XWBB 4DR2Q 5IOCA 4N8FA 1R9TB 3SK6A 2SOBA 1P16A 4QB4A 1EL0A 5LMNW 1XTDA 3ICEA 5JJLA 4A3FG 3DEOA 4KD3A 2O5IC 2MJ8A 1K0RA 3M85A 5BN5A 3BU2A 4BY1G 2VQEQ 2KEDA 1IHZA 3CCUA 3DWQA 1PH5A 1VQ5A 4A3LH 3NSWA 3LNNA 2MUYA 1SYBA 1GUNA 1JB3A 5IGDA 3HKZB 2R92G 3I2ZA 4K5VA 1CT1D 5CV5A 2EJGC 3M4OB 1H95A 2IPKD 4DV7L 1H9RA 1ONLA 4DAPA 3KLRA 5A2QL 2JA9A 3E3XA 3L3OC 1ENFA 1I3QH 1S5FD 3TP5A 2NBFA 3C3LA 1HTLD 4DR3Q 3AU7A 1DJRD 4I65A 3J80c 4UAIA 2AHOB 3BZDB 1WTXA 3HOXH 5M3FH 3TS2A 1TU2B 4IQZA 3AEVA 4JI3L 4LJZC 3NHHA 1NR4A 1TS5A 2PQEA 3HEJA 4OHJA 1PH3A 2NVXH 1K8MA 5IT9c 4A93H 1SNPA 2EYMA 4LWCA 1VQ9A 3U58A 1B4OA 2UXBQ 1T9HA 1A8VA 4U68A 1TWAB 3QOJA 4JW0A 3S17B 2JN4A 3P20A 1WTPA 1VMPA 1YEZA 5C4ZA 1NUCA 3OSOA 3GTJB 4AYBG 1AZPA 3N6RA 4IUTA 5IGCA 1HJPA 1PRTB 1SROA 1PZJD 4IPHA 3R3OA 2I5HA 1HZCA 1CKNA 1NE3A 2YU9B 2G9DA 2D0OA 4P73A 1L0WA 5LHY1 1E1OA 5FK9C 4C2MH 3BVZA 4OO1H 4FYDA 1B70B 2EVBA 3O13A 1JWUD 1B8AA 3S15B 3C1EA 4DNRB 4KKTA 2L12A 3A8KE 3QOLA 2NVYH 3K5NA 4C3JH 3F2DA 1CA5A 2JA8G 4JI4Q 2JEBI 3JAML 1ZXTA 2CQAA 4PNYA 5C4HA 1JC7A 2Q8IB 1V9PA 1SSOA 1SYDA 2LXJA 1XXGA 1EZ6A 2EE1A 3VR2A 4M1UB 1RCVD 3F1ZA 5D65A 3PIO3 1U9RA 1G2TA 1X54A 3GTOH 3IAYA 2OF1A 2Z9HA 5IGFA 3K5LA 2I07B 1MHWC 2JA7H 3NBHB 1JMCA 1EIGA 3PSIA 4TQUS 1CKOA 1A62A 1LT4D 3C1FA 5LMUL 5F2DA 2M2LA 4J6HA 1GM5A 4TRDA 4OELB 3TREA 1Y1WG 4DGZA 1WTHA 3P75A 2DGYA 3PCOB 3GTKB 1AW7A 2UXCQ 1IBLL 2K28A 3VYSA 1QG7A 1CFMA 2D9UA 3VR5A 2O5JC 1SMYD 4A3FB 1YJNA 1I6HB 2XRSD 2HQEA 4O0AA 2NZOA 4C1NI 2ZM6L 1CTMA 5M3FG 4JI1L 1GKHA 4HJ7A 4MN3A 4XDXA 5CV8A 1C8CA 2E2JB 1JOQA 2DY8A 2RA4A 2SEBD 5GAGC 1S72A 4LW1A 1PRTD 1ZKOA 1SN8A 5M5WB 3J7AV 2R92B 4A93G 4MTKA 2CQOA 3Q0AA 1HZBA 2F4IA 3CPFA 3D31A 3TMEA 3TZDA 3T53B 2NVQB 1PA6A 1TWGH 1O7IA 5M5XB 4PG3A 4HAEA 2J7ZA 2EDGA 3ERSX 1SBBB 5C4XG 1G6ZA 5DEHA 5C6AA 2ICEC 3JAMi 3HKSA 1WJJA 5ELBA 1YNNC 3CKIB 5M3MG 4UP7A 1WTRA 4R4QA 2A19A 1UE1A 4DR3L 1EQQA 4LF9Q 1VQAA 3K5OA 4IJHA 4AQYL 2V1CC 2Q2UA 3TS0A 1B44D 1YNJC 5I2YA 2X6GA 4OO1G 3S2DB 2UU9Q 1WVLA 4RHSA 2N78A 1KDBA 3DXJC 1GUOA 2KUMA 3HFZB 3MXNB 4G7OC 3HOVH 3S1RB 4XT1B 4ZYSA 4C3JG 4FP5D 4HEDA 4AYBB 2EYHA 4FNFA 4LFCQ 3IFTA 2HQLA 3HRZC 1QNUA 3AFQA 2F0VA 4Y52H 1EY6A 1VQDA 1I4PA 1KNAA 2Q2TA 2IJ0A 3MXUA 3D8GA 4NP5A 1U0LA 2WAQE 2RF4A 4O2DA 2I0QA 4YIJA 1YIJA 2F1MA 4B3TQ 1OO9B 3KLSX 4B08A 2HHHQ 3FDTA 2JP1A 2XIWA 2EYJA 1ASYA 4HJ9A 5G3LF 1RL2A 1WYDA 2ZXOA 4YWLA 2R7DA 4DXFA 5EBDA 4O42A 1J5EQ 1B3AA 1BCPD 1MJEA 2EY2A 4GKKQ 2KBNA 2CVRA 3I7FA 1WTVA 1S4ZA 1PZID 4OWTB 4A3KH 3EJIA 2F0WA 2JA8B 2WB1G 3DMUA 3HGBA 1VMCA 1Q1EA 4I7ZC 4DV6L 2PW7A 1PFBA 4FDBA 1EWHA 1PZKD 1PH1A 2B2VA 3HP3A 3M3YH 2CHBD 3NEMA 1NR2A 4WFN3 4JI4L 1TS2A 3FRPB 1F9QA 1GHJA 3ERQA 2Q2HA 3D4RA 3AQQA 1FL0A 5C0XJ 4HCSA 5IYDG 4JOIC 1KABA 2Z0SA 2JE6I 4A76A 1XMOL 2JA6B 4RFBA 4F7XA 3DM1A 2K1BA 1YITA 1PH9A 3PQIA 4B3ML 4EQNA 3PMFA 5JVG3 2FMCA 3AMUA 1F77A 1LABA 1RF2D 4JG2A 4DXGA 3PIOA 1OXTA 1Y1WB 4DR4Q 1S5DD 4NXNQ 4UP8A 5C0XH 1SAPA 3CMEA 1XWEA 2EQSA 1VQ6A 1BF4A 1SNOA 4A3GH 3Q6SA 3I73A 5GADC 2EYLA 3T4AC 2I5MX 2R61A 3PUZA 4CHTB 1SJED 2EZVA 1VQOA 1TIID 2A5HA 4OIJA 5C3WA 3Q22A 5M3FB 4LF6Q 3P7JA 5FLXc 1GHKA 1HA6A 2LMCB 4KY7A 2Z4HA 2FINB 5KNBA 2AMCB 2RSOA 2BE5D 3RLNA 5GAEC 1CKNB 5GAHC 2HUGA 3J80L 2B63G 4A93B 3UI2A 3K7AH 5I9OA 2FFKB 1LTBD 4KJOA 2Q8TA 4BBSG 3NTKA 2K6AA 3HOVG 3U9OA 2D5DA 1PYSB 2PW5A 2CH4A 2MO0A 1BVSA 5C4XB 5IT9L 3M4QA 1NNXA 3MFYA 1YNXA 4JBKA 1C48A 1B7YB 3CHBD 2AUKA 3OOCA 3F2BA 4DV3L 3T16A 4IO9A 4AYBE 4X65Q 4RHRA 1E24A 5M3MB 1N36Q 3HOZG 2UUCQ 2KEEA 4LF8L 5KEEA 4JYAL 3MTSA 4GOPC 3PO2H 2WKCA 3BVGA 4KHVA 1V43A 4BWGB 3QIAA 4C56C 1LT6D 3BDCA 2F0OA 4C2MB 1X56A 1VQCA 1UEAB 4LF9L 1H9KA 4K5WA 4KHZA 3N52A 1JE5A 3R2TA 4L8JA 4OIKA 4V0BA 1N32Q 3I4MB 2RKSA 3RR5A 3RN2A 3H91A 3G6JB 3F2CA 2MPMA 2UU9L 2RDFA 2WFWA 2ALYB 2NVYB 4A3KG 4C3JB 1G2SA 3ND8A 5CV6A 4PZ7A 4ZKCB 1A6XA 3S14B 1VQHA 3GTQH 3BVMA 1S40A 3VYRA 1D1KA 1HCZA 3R8BA 4C3HH 3BZCA 2DNCA 4LFCL 1YJWA 4EVOA 4WORA 1EWCA 3GTLH 4FF4A 3OHXC 5L37A 2LY7A 3OPOA 1JE4A 4GN5A 2X69A 2J4XA 3GTOB 4A3MG 4R4CA 3S1MH 4OL7A 2HHHL 3PO3G 1L1OC 3SEBA 5K5PA 1JR0D 1Q8IA 3J80i 3TQYA 4Q0FA 5A2QE 1DYQA 1CA6A 3NQTA 1TWFH 4GKJL 4FF3A 3S1NB 4UHVA 2WB1B 2M00A 3CQZH 5IIFA 1HRJA 2GVBA 1PH7A 5C0XG 3EROA 4GKKL 1HNWQ 1VQ8A 4H0LC 4A3GG 4CKCA 2DY7A 5ELNA 2IL8A 2IX0A 2KOLA 5JVH3 1HA5A 2AWNA 1ZYRC 1XNQQ 2VQFL 3TEHB 3PF5A 3H09A 5LL6S 2B2UC 5EPKA 1SR3A 4C3IH 2HIVA 4QGUA 4LF7Q 3GV6A 2K5WA 1YI2A 3RZDH 1B9MA 4YCUA 5D3IB 2Y0SG 2F4VQ 5J3BA 1JICA 3C2PA 4RA8A 1I94L 1CHQD 1T5EA 4A3BH 2LSSA 2OT2A 4POGA 2PZWA 4EQ5A 4DNIA 4DV4Q 4WJWA 4EGVA 1CSPA 1GUTA 1XYIA 1ENAA 2EYFA 2EXZA 4IPCA 2Z6KC 1AE2A 3J81E 1LTID 4OWWB 1PH2A 1QUQA 3W2DA 4IUNA 4BS9A 4GLAC 3VA5A 1X6OA 3I55A 2HT1A 2E5LQ 3HOUG 5DM63 2QDLA 4NMZA 2KHSA 2FMMA 5IYBH 4QL5A 4X3KA 4BBRG 4ZUIA 4LF6L 4ID6A 4HJ8A 1K3BC 2A68C 4DR5Q 5IP7G 2Z8LA 2B63B 2PMZE 4BA1I 3SDZA 3I91A 3I3CA 5ISRA 3S1QB 4DUZL 5J1ZA 3K58A 1LO5D 4L5QA 1L1OA 1H9JA 3NP8A 4BBSB 1A0IA 4WJ4A 3U9SA 3BS1A 4A3DG 3E5SA 2JA5H 3HOVB 1H9SA 3WDNA 4DK6C 1TWCB 5K36H 1MSGA 1VCIA 1QCBD 5C44H 5I9PA 3KJOA 1WOCA 3L9AX 3E0EA 5IP9G 5CMDA 1VDZA 2F0FA 2L1BA 4JBMA 2QCPX 3HOZB 2WV6D 3H15A 1IBLQ 1A63A 3SVMA 4K8JA 2ZTDA 1DONA 4CJ2C 2K5NA 4I7AA 1I4HA 1N36L 1HH2P 4P2CB 2UUCL 1QNKA 2EYOA 2B2TC 4WJ3M 1X32A 2ZM6Q 1HXYD 4JI1Q 1RKNA 1EFID 3QWNA 1O7YA 1L0YB 5JJKA 1N32L 3V05A 4GS3A 4A3KB 1HFNA 5KNCA 1PH4A 2WP8J 2RDHA 1EIHA 4R8NA 1IYUA 5T1GA 3FKIG 5EKIA 1HNXQ 3TP6A 1MJCA 3OW2A 4X3SA 5ELEA 5FOBB 1OXVA 3M3YB 5JJZA 1JWSD 2WB1E 4M8AA 1G6PA 1IL8A 1XNRL 5AJ3Q 4Z9CB 5CBEE 1U4LA 5C5MA 1N34Q 1PYBA 4GNXA 4K0KQ 4IFDG 1N8RC 4PZ6A 4A3MB 4KY6A 2E2HH 2CKZB 3PO3B 3KF6A 2A6EC 1I6VC 4Q5VA 1N9WA 3KLSA 4K2KA 2BCOA 4UP9A 1X65A 3HG9A 3STBC 1W2BA 5JOBA 2EY1A 4A3BG 3H3VI 1RIPA 4RGMA 1PTOC 3T1YL 3M4PA 4RG1A 4U673 3Q8DA 5FKAC 4JI8L 3KDFA 2K50A 4AQYQ 2ZTCA 1SDFA 2PO4A 2KCTA 2R6GA 2DJFC 1KLUD 4A3GB 1QE6A 1EQRA 1HNWL 1XX8A 3GDEA 1QVGA 4XIGS 1BBUA 2K04A 4K8IA 4YWMA 4Y7NH 1X3GA 2PPBC 2CWPA 3VYUA 1XNQL 3GTMB 5CC4A 2Y0SB 4HIMA 1UE5A 1TY0A 4LF7L 4LMQD 4RWSC 1EWIA 1JJGA 1CQVA 3OYYA 3NWTA 4CKBA 5FLXL 2F4VL 2JA5G 1CKMA 4IURA 2WKDA 1RODA 3M4YA 3G6EA 2K5VA 5K36G 4QIWB 3SHLA 4UY8C 2EJFC 4TSSA 5C44G 1KAWA 5IODA 1F2ZA 2QEJC 4DV4L 3RLOA 5JEAJ 1QZGA 1Y8NB 2K01A 1OTCA 1Q1BA 3FEWX 1FGUA 1X3FA 3W1BA 1ICFB 3CXCA 3HOUB 1VQFA 1PTOH 3H6MA 4WRDA 3D3RA 4FF1A 4DV6Q 2R7FA 5CV4A 4BBRB 4IUPA 4ZUJA 3ER0A 1KIXA 2E5LL 4HTHA 3JC66 1LYLA 1DXMA 4YHHQ 1LT5D 2IWHA 3K57A 1GUGA 4IPGA 5JEAH 1DZ1A 5BR8Q 4DR5L 4A3DB 2NN6H 1XMOQ 2KCMA 4IUQA 3G4SA 2RVLA 2B2YC 1I5FA 1B50A 1PVOA 1GJXA 1DD2A 1ZEQX 5IYCH 1G91A 4B3MQ 3PIPA 4LUOA 4A3LG 1JWMD 2HDLA 3ULLA 1HFGA 3U4VA 2B39A 2RHQB 2H5XA 3W3AA 1LTTD 1Z9FA 3R93A 3OIQA 1M8AA 3BZKA 1AN8A 1MD2D 4ME5A 1HTPA 3UE0A 2F0KA 3GTLB 1SRUA 1VQKA 2X6LA 2HIXA 4RKLA 3SGIA 2YTYA 4L5RC 1EIFA 1EYGA 2B8FA 4ULLA 1J6QA 1K28A 3HKZE 2K5HA 3S1MB 2ASBA 3SXHA 1IKMA 1CUKA 4PZ8A 1LTRD 2EXDA 1K0SA 1D5XC 3MA2B 3TSSA 4CGYB 4H44C 4BY1B 2F0EA 4MHEA 5C4JH 3CQZB 3HOXG 2L15A 3NE5B 4EX5A 1LTAD 4FXGC 4MTNA 1OXSC 3FKIB 5AFWA 5EAYA 1F9RA 4A3IH 4A3JH 2NTTA 1HNXL 5BN3A 2ZTEA 1PFMA 3MEHA 2K4KA 1BNZA 2IW3A 2SDFA 2EY6A 2B2WC 4ODGA 3A7LA 1EY4A 5AJ3L 1NJIC 3GO5A 4LK1C 1N34L 3MFGA 2RCNA 3J81i 3RZDB 4K0KL 2N3SA 4DV3Q 1QUQB 3KF8A 3RLFA 3PUWA 2IX1A 1PV4A 2TSSA 1AFPA 5GQOA 5IT9E 4LF8Q 5FJ8H 4HMJA 4JYAQ 4JI2Q 1PHJA 4LNQA 3E9IA 4G4KA 3A5UA 2VS1A 4HR7B 1QOHA 4LF4L 5JPNC 4UDUC 2QDBA 1HNZQ 4KD4A 4H13C 5IGEA 1S5BD 4IPDA 3VYTA 1L1OB 1CI3M 1FNVA 1ET6A 1DOKA 4KLKA 1KRSA 1NAPA 1H9SB 1UE6A 1VQJA 1HQMC 3S9WA 2E75C 4DKAC 1QJOA 3OMGA 4BY7H 4H02A 2KECA 2F3WA 1S3OA 3UDFA 5LL6X 1C9OA 2Z4IA 3AB9A 3UDIA 1HUMA 1T5XD 1YBYA 4XQQA 1IZ6A 3S16H 2A6HD 3OWEB 1Y1VH 3CPWA 2JA5B 2NN6G 1X3EA 4DK0A 1Q46A 1CM9A 2ES2A 5C44B 4A4IA 1PFSA 2O2LD 1YHQA 3NTIA 4ALPA 4B9XA 5C3EH 4IFDI 2DN8A 2PYKA 1SEBD 2JA7G 3A5ZB 5JAVA 1SYFA 4GKJQ 1PH8A 5H1SE 2N8NA 1EEID 1U4RA 5D14A 4K6LA 4DF7A 1PXUA 1K83B 3MVVA 2RCFA 1ILPA 4YWKA 3RN5A 2VQFQ 1R9TH 3CAMA 4GNXB 4TKOB 1R4PB 1UAPA 5M5YH 4YHHL 1LM0A 1SMYC 1S5ED 4L5SA 4NPSA 5BR8L 2WINB 3H0GH 3KF6B 3BDOA 3D4WA 1IBKQ 1IKLA 4K14A 2JEAI 1I94Q 2IX3A 4DV2Q 4A3IG 2YV5A 4A3JG 1QB5D 3WOFA 1PRTC 1AH9A 3KDFB 1WD0A 1B53A 4LAAA 2L55A 1WCMH 4BXXH 3VDYA 2YTXA 3A8IE 3V96A 2XGTA 2B29A 3VA7A 2E2HB 2EY5A 2OQKA 1E2VA 1I3QB 5HGTA 2CH4W 1IW7D 2L4NA 1K3RA 2PQAA 3UDXA 2FXQA 2NVTH 4KHPQ 5FJ8G 4C1NK 3F8TA 1ICWA 1KHIA 2YYZA 1V1QA 4ZLTF 1AZQA 3HOXB 4AIMA 1W3SA 1MI2A 4E6IA 1Q81C 3IFDA 5IGGA 4DUZQ 2RBMA 5I6WA 2MP1A 2NVXB 4DV1L 2I5LX 3M7GA 4FXKC 2Q2IA 1Q86C 2MQHA 1C4QA 4P74A 4Y7NB 1NBWA 1TKWB 3KK7A 1YJ9A 2ZJRA 1N33Q 4BY7G 2OXPA 5IY0A 1VQ4A 5G3LD 3J7A5 2UXDQ 4DN4M 2G9HD 2JQOA 4CDDC 3S17H 2E8GA 5I4DA 3J81c 1STHA 5EPJA 1EFWA 1AEXA 4HJ5A 1ENCA 3C46A 1STNA 4DR7L 1X9NA 3CC2A 1Y1VG 3NENA 2P5ZX 2LXKA 3MZ5A 3TDQA 2C35B 3MEFA 1K8GA 2YU9H 1O7LA 4PV1C 3MAQA 1WTQA 1LTLA 4QUFA 3GTPH 4JI2L 1STGA 1BOSA 3RZOH 1K73C 3FPPA 4JOIA 5ELFA 2XVSA 4OXPA 1X3PA 2BH8A 4PMWA 5J39A 1HNZL 4LFBQ 4NW2A 4S3SA 5FO8B 2BDOA 1PTOB 1QWYA 1BCPC 5GROA 4JC0A 2K75A 5FLMH 1PTOF 2Z1CA 4J8QA 3S15H 1A15A 3VR4A 2VB2X 1XNRQ 1F2LA 1M4VA 1WFQA 1HR0L 5JJIA 3GD7A 1FGBD 1A3TA 4G57A 2VY3A 2PI2A 1A3UA 3H0GG 2UUBQ 5CR3A 4HIKA 4XXEA 5KRUA 4DA2A 2VL6A 2IHEA 1QILA 2JA7B 5FO7B 2NWGA 3LWEA 3T1YQ 2NYZD 1VQEA 4JI8Q 1JB7A 3W5OA 1K8OA 1TWHH 4L5TA 3KBGA 3KFUA 3FP9A 1WCMG 3OIPA 3TRZA 1BXTA 1G8ZD 1GXDC 4AH6A 1KNEA 1G51A 4RGTA 1BKBA 1H9MA 5D3DA 2AWOA 3TBIB 3GTKH 2K5QA 2G5DA 1CQFA 2OCEA 4RAUC 2WACA 1C7YA 1EY0A 4YCWA 1V1OA 1J9OA 1WD1A 2JK8A 1LV9A 2UUAL 4A3FH 1I6HH 5C4JB 4OO1I 1SNCA 1XPOA 2Q8RE 3KF8B 1XPRA 4A3IB 3I90A 1MSHA 3G48A 2GA4B 4A3JB 3QG1A 3URYA 2Z6BA 1SYCA 1KC8C 1YZ6A 3H94A 3CD6A 2BE5C 1D5MC 4IUVA 4GOPA 1IBKL 3RMHA 1DCZA 1E0BA 2B3GA 3CMAA 4DV2L 2N88A 1GVPA 2HDMA 2R92H 4HCEA 3I70A 4K2LA 1TWGB 1TS3A 2K05A 1LACA 1FNUA 1II3A 2NVQH 2QW7A 2LKVA 5M5XH 3E6ZX 1V1PA 3G7LA 1JQYD 2DNEA 3I72A 2F0NA 1E3PA 2YTVA 1HZAA 5KYLA 1UE7A 4KHPL 3HOWH 5E4WC 1SXTA 3PO2G 4K6DA 5CORA 3MXGA 3VR6A 2VUMH 3BG3A 4NB3A 2J0TD 3G71A 4LF5Q 2ID0A 3CCMA 4BY7B 2ZT9C 3JAME 1E7ZA 2MNAA 2KCCA 1AP0A 3SK5A 4DNTB 3EFXD 4JI0Q 3J7YW 1E2WA 1KLGD 4UPAA 2MHVA 3MHBA 5FLMG 1D2BA 1FNWA 2PNRC 1SLJA 4RH6A 1N33L 1ET9A 4JK1C 2XSCA 3S1RH 2ZXPA 3K59A 2UXDL 4J1MA 4C3HG 3S16B 2WAQG 3NPPA 1Y1VB 3A8JE 2XRQD 1PH6A 4FF2A 4LUVA 4ABNA 4X66L 4NXMQ 2QF7A 3D6CA 1VQBA 3QB3A 5CGKA 1BUVT 1AE3A 1PMRA 2B2UA 4RCOA 1IBML 3CC4A 3U50C 1EYCA 4DK1A 2K14A 1ML0D 1VQMA 1I4GA 2IHFA 2N49A 4LFBL 4B9WA 1Z6HA 4FO2A 3MC0B 2FHTA 2F03A 1B9NA 1KDAA 1WTWA 2JA8H 5C5LA 3KJPA 5M5YB 1VF5C 2Z6KA 1EU3A 2GN5A 4IALA 3CCRA 2HCCA 2XNAC 1EY8A 3H0GB 3QR8A 1HQRD 1EYDA 3CCVA 4C3IG 2E74C 2PQAB 4LUZA 5M9OA 1EYAA 3LWUA 5CYUA 1S5CD 3ZJYC 2JA6H 4CJ1B 2UUBL 3PF4A 4TVAB 1ESRA 1SE3A 1WCMB 2AUJD 3ZYYX 4DR1Q 4LF4Q 3DWAA 4GLXA 2F0IA 2VB3X 3EN2A 3EVQA 1Y1WH 3GTGH 4JI5Q 1HUNA 4DV5L 3U4ZA 2KHJA 5LMNL 3S2HH 3CCLA 4ZCKA 2M9VA 4DK3C 4KJNA 1SFOH 4ZKBB 2PZUA 1SE2A 2AQ2B 4HJAA 2NVTB 4XQNA 5EBCA 1Q3LA 5EPLA 4JPBW 4OX9Q 2A8VA 3EBEA 2LFNA 2QILA 2N55A 1ESFA 3P1HA 5C3XA 3I4LA 3I8ZA 3HOWG 5IYBG 1A2UA 3A7AB 2VUMG 1FVIA 5IE8A 2OWOA 2F0TA 3K7AB 2L11A 1SNMA 3E9HA 3OWFA 4F87A 4LFAL 4RGNA 3RD4A 1PFNA 1KTKA 2MFIA 2B2TA 1E2ZA 5TSSA 3IL8A 4XYQA 1FR3A 1RHPA 5ELOA 3HOYH 4JBWA 3J7AF 1BO0A
chains in the Genus database with same CATH topology
2EOTA 1F2MA 3K0YA 3R2IA 1EQTA 2O4XA 4DU9A 1YNND 1PRTF 4QCLA 4F88A 4L6TB 3GTPB 3J81L 3PO2B 3D4DA 4KV6A 3RZOB 3FVQA 1YNJD 3ONAB 1B1ZA 5C0XI 4NDXA 4HN7A 4KTAA 4FXDA 3HZXA 4RCNA 3GTQB 1O78A 2F0HA 3M7NA 4DAYA 4DAVA 4C3HB 3Q24A 3F2UA 2WAQB 4OGQC 2WIIB 1FD7D 1RDPD 3QO2A 1JOKA 4PMCA 4MIUA 2B8GA 5ELDA 3SK4A 3EQLC 2K03A 1TWHB 3QJYA 3L7ZC 4KKSA 5I2XA 1TWFB 1DOMA 3PUXA 4PQXA 4HMIA 4CKEA 3T13A 1XTCD 2NUCA 3FMCA 1RD9D 1I4RA 1NSNS 1CZWA 3J80E 4EQOA 1BCPB 2L5TA 5J22A 3MWYW 1B2TA 4C3IB 3WOEA 2E76C 4XQJA 1V1PB 1BCPF 3H3VC 2BDNA 1TY2A 1NCVA 1FYCA 4KMUC 2AQ3B 1EQVA 4A3BB 1SYEA 1Y8PB 3A54A 4EQPA 2L9HA 2RDGA 5CV9A 5A35A 2KCNA 3SK8A 1O7ZA 3SE0A 2XWJB 1PDQA 1Q12A 1BBXC 2B2VC 2B2YA 2K32A 3RUZA 2F0JA 1STAA 3TZUA 5T1IA 1W6JA 2JXMB 5CV7A 3GQBA 5KIXA 4QUCA 3HOWB 1ILQA 2VUMB 2D2CC 3CRLC 3IKJA 1D6EC 2F0LA 1SJHD 2PZTA 5JEAG 1JCKB 4QMGA 2ICIA 1EEFD 2F3VA 2A73B 1BR9A 5BN4A 1PLFA 3TP7A 4XYOA 3NBIA 1TS4A 1SNQA 1GUWA 2JSOA 2D62A 2SNMA 3BYYB 3EA6A 1TQOA 2B2WA 4FVMA 1G291 4KI0A 1W6KA 3T51B 3GP7A 1IYVA 2KVMA 5IGBA 3NUCA 1U4MA 3PUYA 3BDLA 4XT3B 1STEA 2KA7A 5FO9B 1F9PA 4G7HC 1O80A 1U4PA 1SYGA 1R4QB 4CJ0B 1OXUA 5DAUA 1MBYA 1I4QA 4K5XA 1Y8OB 5DM73 1LLRD 2A69D 1A2TA 2F0PA 3PV0A 2CW0D 1OXXK 4KN4C 3A56A 5NUCA 4V190 4ILWA 5I6YA 4GZYC 2BA0A 1VF7A 2VXWA 1UNSA 3GTGB 2EJMA 3DHQA 5JPMC 3S2HB 2BOSA 3FPUB 1LTSD 4R9WA 1SFOB 1J8IA 3OW7A 1EZ8A 1ZYRD 3DEPA 1BQQT 5DNFA 4X3TA 4DFAA 2NZ1D 3NQIA 2C5CA 1EY7A 2K5DA 4ZQ3A 2F0SA 2LS01 2L0CA 3DUZA 3HS0C 2K7VA 3K5MA 3CU7A 1KAAA 3TP8A 2A6HC 2MGSA 1RTOA 2F0QA 3HOYB 1STYA 1Z47A 1JOOA 1SE4A 3A55A 5KYIA 3NK9A 3I4NB 5HURA 1D5ZC 1UUPA 4QF4A 4F8MA 2R93B 2R3ZA 1L0XB 2ZXRA 3VR3A 1JORA 2PMZB 1DM0B 4A3EB 1CHPD 2A68D 1BDOA 1D1IA 4BA2I 5E1FA 1PYWD 2EPBA 5CBAE 3GV3A 1EU4A 5EKLA 4NKLA 3CRKC 3KBXA 1V8QA 1LT3D 1Z7TA 2SNSA 1LTGD 2I46A 3TN2A 4KY5A 3V2TA 2RQXA 2QKIC 2E2IB 2A69C 3LX0A 1RJTA 3NTHA 2CW0C 3E0JA 2AQ1B 2C9OA 5EQ0A 1X3QA 1IW7C 1Q90A 2K33A 5EKKA 4IFDJ 1EOTA 4N9PA 3NBHA 4RKBA 2E2DC 5E4XA 1TVXA 1EY5A 4ZRZA 4N9TA 4RGOS 1GUSA 2XN9C 2R7ZB 3X3NA 2IT1A 1TT2A 1Y69U 2H4OA 5KGUA 2F0UA 2NTSA 1EY9A 3OMCA 1F2YA 4IFDH 1A3VA 3T56B 2F0GA 4HSVA 5FLXE 3NWSA 5EGTA 2NN6I 2FJ2A 2A6ED 4IZ8A 2F0DA 2F0MA 2OEOA 4KKUA 1CZGA 3SR1A 1PTOD 1I4XA 4L63B 2H1EA 1HHVA 2NB0A 3ITPA 2KQ3A 3D6WA 3PUVA 5KNDA 2HCIA 5ELCA 5EJWA 4O1NA 4HSPA 1CK1A 2TMPA 1SNDA 5COYA 1WTOA 4IUUA 3NXWA 3MXPA 3KUPA 2VNUD 2A74C 2JYOA 4H7BA 4CBVA 1TR5A 2KJXA 1I50B 2BA1A 3DWPA 4G7ZC 3PIP3 3K6OA 4X3UA 1KDCA 1F9SA 2EYPA 3ND9A 3X3MA 4IN3A 1GOZA 4ZAIA 4KN7C 5C3EB 4PMBA 1RTNA 2PCFB 1HPCA 3MXNA 2RSNA 2V4DA 1DOLA 4R8IA 4KK7A 1MGSA 1STBA 2ENBA 3Q23A 5E3FA 4ZK9B 3BYTB 4XTCS 2XWBB 5IOCA 1R9TB 3SK6A 2SOBA 4QB4A 1EL0A 3DEOA 4KD3A 2O5IC 2MJ8A 3M85A 5BN5A 2KEDA 1IHZA 3DWQA 3NSWA 3LNNA 2MUYA 1SYBA 1GUNA 1JB3A 5IGDA 3HKZB 4K5VA 1CT1D 5CV5A 2EJGC 3M4OB 2IPKD 1H9RA 1ONLA 4DAPA 3KLRA 5A2QL 3L3OC 1ENFA 1S5FD 3TP5A 2NBFA 3C3LA 1HTLD 3AU7A 1DJRD 4I65A 4UAIA 3BZDB 1WTXA 1TU2B 4IQZA 4LJZC 3NHHA 1NR4A 1TS5A 2PQEA 3HEJA 4OHJA 1K8MA 1SNPA 2EYMA 1B4OA 4U68A 1TWAB 3QOJA 3S17B 3P20A 1WTPA 1VMPA 5C4ZA 1NUCA 3OSOA 3GTJB 1AZPA 3N6RA 4IUTA 5IGCA 1PRTB 1PZJD 3R3OA 2YU9B 2G9DA 5LHY1 5FK9C 3BVZA 4OO1H 4FYDA 2EVBA 3O13A 1JWUD 3S15B 3C1EA 4DNRB 4KKTA 2L12A 3A8KE 3QOLA 3K5NA 1CA5A 2JEBI 3JAML 1ZXTA 2CQAA 4PNYA 5C4HA 1JC7A 2Q8IB 1SSOA 1SYDA 1XXGA 1EZ6A 2EE1A 3VR2A 4M1UB 1RCVD 5D65A 3PIO3 1U9RA 1G2TA 3IAYA 2OF1A 5IGFA 3K5LA 2I07B 1EIGA 4TQUS 1LT4D 3C1FA 5F2DA 2M2LA 4J6HA 4TRDA 4DGZA 3P75A 3GTKB 1AW7A 2K28A 3VYSA 1QG7A 1CFMA 2D9UA 3VR5A 2O5JC 1SMYD 4A3FB 1I6HB 2XRSD 2HQEA 4C1NI 1CTMA 4MN3A 4XDXA 5CV8A 1C8CA 2E2JB 1JOQA 2DY8A 2RA4A 2SEBD 1PRTD 1ZKOA 5M5WB 3J7AV 2R92B 3Q0AA 2F4IA 3D31A 3TMEA 3TZDA 3T53B 2NVQB 5M5XB 4HAEA 2J7ZA 2EDGA 1SBBB 1G6ZA 5DEHA 5C6AA 2ICEC 5ELBA 1YNNC 3CKIB 1WTRA 3K5OA 1B44D 1YNJC 5I2YA 2X6GA 4OO1G 3S2DB 1WVLA 4RHSA 1KDBA 3DXJC 1GUOA 2KUMA 4G7OC 3S1RB 4XT1B 4ZYSA 4C3JG 4FP5D 4HEDA 4AYBB 2EYHA 4FNFA 3IFTA 3HRZC 1QNUA 2F0VA 1EY6A 1I4PA 1KNAA 2IJ0A 3MXUA 3D8GA 4NP5A 4YIJA 2F1MA 1OO9B 3KLSX 4B08A 3FDTA 2JP1A 2XIWA 2EYJA 5G3LF 2ZXOA 4DXFA 5EBDA 4O42A 1B3AA 1BCPD 2EY2A 2CVRA 1WTVA 1S4ZA 1PZID 2F0WA 3EJIA 2JA8B 3DMUA 3HGBA 1VMCA 1Q1EA 4I7ZC 2PW7A 1PFBA 1EWHA 1PZKD 2B2VA 3HP3A 2CHBD 1NR2A 4WFN3 1TS2A 3FRPB 1F9QA 1GHJA 3ERQA 3D4RA 5C0XJ 4HCSA 1KABA 2JE6I 2JA6B 4RFBA 4F7XA 3DM1A 2K1BA 4EQNA 3PMFA 5JVG3 2FMCA 3AMUA 1F77A 1LABA 1RF2D 4DXGA 1OXTA 1Y1WB 1S5DD 5C0XH 1SAPA 1XWEA 1BF4A 1SNOA 3Q6SA 3I73A 2EYLA 3T4AC 2R61A 3PUZA 4CHTB 1SJED 2EZVA 1TIID 2A5HA 4OIJA 5C3WA 3Q22A 5M3FB 3P7JA 1GHKA 1HA6A 2LMCB 4KY7A 2Z4HA 2FINB 5KNBA 2RSOA 2BE5D 2HUGA 3J80L 4A93B 3UI2A 5I9OA 2FFKB 1LTBD 4KJOA 2Q8TA 3NTKA 2K6AA 3U9OA 2D5DA 2PW5A 5C4XB 5IT9L 3MFYA 1C48A 3CHBD 2AUKA 3OOCA 3T16A 4RHRA 5M3MB 2KEEA 5KEEA 3MTSA 2WKCA 3BVGA 4KHVA 1V43A 4BWGB 3QIAA 4C56C 1LT6D 3BDCA 2F0OA 4C2MB 1UEAB 1H9KA 4K5WA 4KHZA 3N52A 4L8JA 3R2TA 4OIKA 4V0BA 3I4MB 2RKSA 3H91A 3G6JB 2MPMA 2RDFA 2NVYB 4C3JB 1G2SA 3ND8A 5CV6A 4ZKCB 1A6XA 3S14B 3BVMA 3VYRA 1D1KA 1HCZA 3R8BA 2DNCA 4EVOA 4WORA 1EWCA 4FF4A 3OHXC 2LY7A 3OPOA 1JE4A 2X69A 2J4XA 3GTOB 4OL7A 3SEBA 5K5PA 1JR0D 1Q8IA 4Q0FA 5A2QE 1DYQA 1CA6A 3NQTA 4FF3A 3S1NB 2WB1B 2M00A 5IIFA 1HRJA 5C0XG 3EROA 4H0LC 4CKCA 2DY7A 2IL8A 2IX0A 2KOLA 5JVH3 1HA5A 2AWNA 1ZYRC 3H09A 5LL6S 2B2UC 5EPKA 3GV6A 2K5WA 1B9MA 5D3IB 1JICA 3C2PA 4RA8A 1CHQD 1T5EA 2OT2A 2PZWA 4WJWA 4EGVA 1GUTA 1XYIA 1ENAA 2EYFA 2EXZA 3J81E 1LTID 3W2DA 4IUNA 4BS9A 3VA5A 5DM63 4NMZA 2KHSA 2FMMA 4X3KA 4ZUIA 4ID6A 2A68C 2Z8LA 2B63B 4BA1I 3SDZA 3I91A 3I3CA 5ISRA 3S1QB 5J1ZA 3K58A 1LO5D 3NP8A 1H9JA 4BBSB 3U9SA 3BS1A 3E5SA 3HOVB 1H9SA 3WDNA 1TWCB 5K36H 1MSGA 1VCIA 1QCBD 5I9PA 3L9AX 5CMDA 1VDZA 2F0FA 2L1BA 2QCPX 3HOZB 2WV6D 3SVMA 4K8JA 1DONA 4CJ2C 1I4HA 4P2CB 1QNKA 2EYOA 2B2TC 1X32A 1HXYD 1RKNA 1EFID 3QWNA 1O7YA 1L0YB 3V05A 4A3KB 1HFNA 5KNCA 2WP8J 2RDHA 1EIHA 4R8NA 1IYUA 5T1GA 5EKIA 3TP6A 5FOBB 4X3SA 5ELEA 1OXVA 3M3YB 5JJZA 1JWSD 4M8AA 1IL8A 4Z9CB 5CBEE 1U4LA 5C5MA 4IFDG 4A3MB 4KY6A 3PO3B 2A6EC 1I6VC 4Q5VA 3KLSA 4K2KA 2BCOA 3HG9A 5JOBA 2EY1A 4RGMA 1PTOC 4U673 5FKAC 1SDFA 2PO4A 2R6GA 1KLUD 4A3GB 1QE6A 1XX8A 4XIGS 2K04A 4K8IA 2PPBC 3VYUA 3GTMB 5CC4A 2Y0SB 1TY0A 4LMQD 4RWSC 1CQVA 3NWTA 4CKBA 5FLXL 4IURA 2WKDA 1RODA 3M4YA 5K36G 4QIWB 3SHLA 2EJFC 4TSSA 5IODA 1F2ZA 2QEJC 5JEAJ 1Y8NB 2K01A 1Q1BA 3FEWX 3HOUB 1PTOH 3H6MA 4WRDA 3D3RA 4FF1A 5CV4A 4BBRB 4IUPA 4ZUJA 4HTHA 1DXMA 1LT5D 2IWHA 3K57A 1GUGA 5JEAH 1DZ1A 4A3DB 2NN6H 4IUQA 2RVLA 2B2YC 1B50A 1GJXA 1DD2A 1ZEQX 1G91A 1JWMD 2HDLA 1HFGA 2B39A 3W3AA 1LTTD 3R93A 3OIQA 1M8AA 1AN8A 1MD2D 4ME5A 1HTPA 2F0KA 3GTLB 2X6LA 4RKLA 4ULLA 2B8FA 3S1MB 3SXHA 1IKMA 1LTRD 1D5XC 3MA2B 3TSSA 4CGYB 4H44C 4BY1B 2F0EA 4MHEA 3CQZB 3NE5B 1LTAD 4FXGC 1OXSC 3FKIB 5AFWA 1F9RA 2NTTA 5BN3A 1PFMA 3MEHA 1BNZA 2IW3A 2SDFA 2EY6A 4ODGA 2B2WC 3A7LA 1EY4A 3GO5A 4LK1C 3MFGA 3RZDB 3KF8A 3RLFA 3PUWA 2IX1A 2TSSA 1AFPA 5IT9E 4HMJA 4G4KA 4HR7B 1QOHA 5JPNC 4UDUC 2QDBA 4KD4A 4H13C 5IGEA 1S5BD 3VYTA 1CI3M 1FNVA 1ET6A 1DOKA 1NAPA 1H9SB 1HQMC 3S9WA 2E75C 1QJOA 3OMGA 2KECA 2F3WA 5LL6X 2Z4IA 3AB9A 1HUMA 1T5XD 4XQQA 2A6HD 3OWEB 2JA5B 2NN6G 4DK0A 1CM9A 5C44B 2O2LD 3NTIA 4B9XA 4IFDI 2DN8A 2PYKA 1SEBD 5JAVA 1SYFA 1EEID 1U4RA 5D14A 4K6LA 4DF7A 1PXUA 1K83B 3MVVA 1ILPA 4TKOB 1R4PB 1UAPA 1SMYC 1S5ED 2WINB 3BDOA 3D4WA 1IKLA 4K14A 2JEAI 2IX3A 1QB5D 3WOFA 1PRTC 1WD0A 1B53A 4LAAA 2L55A 3A8IE 3V96A 3VA7A 2E2HB 2EY5A 1E2VA 1I3QB 5HGTA 1IW7D 2L4NA 4C1NK 1ICWA 2YYZA 4ZLTF 1AZQA 3HOXB 1MI2A 4E6IA 3IFDA 5IGGA 2RBMA 5I6WA 2MP1A 2NVXB 3M7GA 4FXKC 1C4QA 4Y7NB 1TKWB 3KK7A 2OXPA 5G3LD 4DN4M 2G9HD 5I4DA 1STHA 5EPJA 1AEXA 1ENCA 3C46A 1STNA 3MZ5A 3TDQA 1O7LA 4PV1C 3MAQA 1WTQA 4QUFA 1STGA 1BOSA 3FPPA 5ELFA 2XVSA 4PMWA 1X3PA 5J39A 4NW2A 4S3SA 5FO8B 2BDOA 1PTOB 1QWYA 1BCPC 1PTOF 2Z1CA 4J8QA 1A15A 3VR4A 2VB2X 1F2LA 1M4VA 3GD7A 1FGBD 1A3TA 4G57A 1A3UA 5CR3A 4XXEA 5KRUA 4DA2A 1QILA 2JA7B 5FO7B 2NWGA 3LWEA 2NYZD 1K8OA 3KBGA 3OIPA 1BXTA 1G8ZD 1GXDC 1KNEA 4RGTA 1H9MA 5D3DA 2AWOA 3TBIB 2K5QA 1CQFA 4RAUC 2WACA 1EY0A 1V1OA 1J9OA 1WD1A 1LV9A 5C4JB 4OO1I 1SNCA 2Q8RE 4A3IB 3I90A 1MSHA 2GA4B 4A3JB 3QG1A 3URYA 1SYCA 3H94A 2BE5C 1D5MC 4IUVA 3RMHA 1DCZA 1E0BA 2N88A 2HDMA 4HCEA 3I70A 4K2LA 1TWGB 1TS3A 2K05A 1LACA 1FNUA 1II3A 2LKVA 3E6ZX 1V1PA 3G7LA 1JQYD 2DNEA 3I72A 2F0NA 5KYLA 5E4WC 1SXTA 4K6DA 5CORA 3MXGA 3VR6A 3BG3A 2J0TD 2ID0A 4BY7B 2ZT9C 3JAME 1AP0A 2KCCA 3SK5A 4DNTB 3EFXD 3J7YW 1E2WA 1KLGD 2MHVA 3MHBA 1D2BA 1FNWA 2PNRC 4RH6A 1ET9A 4JK1C 2XSCA 2ZXPA 3K59A 4J1MA 4C3HG 3S16B 3NPPA 1Y1VB 3A8JE 2XRQD 4FF2A 4ABNA 2QF7A 3D6CA 3QB3A 5CGKA 1BUVT 1PMRA 2B2UA 4RCOA 1EYCA 4DK1A 1ML0D 1I4GA 4B9WA 1Z6HA 3MC0B 4FO2A 2FHTA 2F03A 1B9NA 1KDAA 1WTWA 5C5LA 5M5YB 1VF5C 1EU3A 4IALA 2HCCA 2XNAC 1EY8A 3H0GB 1HQRD 1EYDA 4C3IG 2E74C 5M9OA 1EYAA 3LWUA 5CYUA 1S5CD 4CJ1B 1ESRA 1SE3A 1WCMB 2AUJD 3ZYYX 3DWAA 2F0IA 2VB3X 3EVQA 1HUNA 2M9VA 4KJNA 4ZKBB 2PZUA 1SE2A 2AQ2B 2NVTB 4XQNA 5EBCA 1Q3LA 5EPLA 2LFNA 2QILA 2N55A 1ESFA 3P1HA 5C3XA 3I4LA 3I8ZA 1A2UA 3A7AB 2F0TA 3K7AB 2L11A 1SNMA 3OWFA 4F87A 4RGNA 3RD4A 1PFNA 1KTKA 2B2TA 1E2ZA 5TSSA 3IL8A 4XYQA 1FR3A 1RHPA 4JBWA 3J7AF 1BO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TRD A;  3OMG A;  4H7B A;  3QB3 A;  1F2M A;  4DGZ A;  5CGK A;  3P75 A;  1TR5 A;  3RUZ A;  1EQV A;  5DAU A;  1SYE A;  2EYJ A;  5E1F A;  4E6I A;  2F3W A;  2O4X A;  4K5X A;  4DU9 A;  5C5M A;  4EQP A;  5IGG A;  2RBM A;  5CV9 A;  3NHH A;  2WAC A;  3T16 A;  5I6W A;  1EY0 A;  3SK8 A;  1EYC A;  2PZW A;  1A2T A;  2F0P A;  2PQE A;  3HEJ A;  1ENA A;  2EY2 A;  4KY6 A;  4NKL A;  2EYF A;  5EKL A;  2EXZ A;  2HQE A;  5KEE A;  4B9W A;  1KDC A;  1SNP A;  3D4D A;  1SNC A;  4KV6 A;  2EYM A;  4K2K A;  5NUC A;  2OXP A;  2F0W A;  3EJI A;  2EYP A;  2F0J A;  4KHV A;  4ME5 A;  1STA A;  3DMU A;  5CV8 A;  1KDA A;  2SNS A;  2EY1 A;  3BDC A;  2F0K A;  2F0O A;  5JOB A;  5I6Y A;  1JOQ A;  3QOJ A;  5C5L A;  2PW7 A;  4K5W A;  4IUN A;  4RKL A;  1SYC A;  4NDX A;  3VA5 A;  5C4Z A;  1NUC A;  2RKS A;  4KY5 A;  5CV7 A;  1STH A;  3OSO A;  3V2T A;  1AEX A;  4PMB A;  4KTA A;  5KIX A;  4IAL A;  3LX0 A;  1ENC A;  3DHQ A;  4B9X A;  5IGC A;  2PYK A;  3ERQ A;  4NMZ A;  3R3O A;  2KHS A;  2RDF A;  1STN A;  5JAV A;  3SXH A;  1EY8 A;  1SYF A;  3HZX A;  4ZUI A;  4ID6 A;  5CV6 A;  1EYD A;  1STB A;  4K2L A;  2F0L A;  1KAB A;  3MZ5 A;  3TME A;  2F0H A;  5M9O A;  1EZ8 A;  2ENB A;  1EYA A;  2PZT A;  5E3F A;  5EKK A;  4F7X A;  4N9P A;  5ISR A;  1II3 A;  4DF7 A;  5J1Z A;  4RKB A;  4K8I A;  1EY5 A;  1STG A;  2F0E A;  2LKV A;  4QMG A;  3MVV A;  2F3V A;  3NP8 A;  4N9T A;  5DEH A;  4DFA A;  4EQN A;  3E5S A;  5C6A A;  5IOC A;  3PMF A;  4EVO A;  3SK6 A;  4WOR A;  3TP7 A;  2F0N A;  2SOB A;  5J39 A;  4QB4 A;  1EY7 A;  1JOK A;  5CC4 A;  4S3S A;  5IOD A;  2F0I A;  4ZQ3 A;  2F0S A;  1TT2 A;  4PMC A;  5KYL A;  3EVQ A;  4MIU A;  5I9P A;  1SNQ A;  4KD3 A;  5KGU A;  3C1E A;  2F0U A;  3MEH A;  1EY9 A;  1KAA A;  4K6D A;  4OL7 A;  3SK4 A;  3TP8 A;  4KJN A;  1SNO A;  5K5P A;  2EY6 A;  3QOL A;  2F0F A;  3OMC A;  4ODG A;  1F2Y A;  2PZU A;  1A3V A;  3D4W A;  1EY4 A;  2EYL A;  2SNM A;  2F0G A;  1IHZ A;  4K14 A;  2F0Q A;  3NQT A;  5EGT A;  4PNY A;  5C4H A;  4IZ8 A;  4K8J A;  3SHL A;  1TQO A;  1STY A;  3P1H A;  5C3W A;  5C3X A;  1JOO A;  1SYD A;  1F2Z A;  1A3T A;  2F0D A;  1KDB A;  3SK5 A;  2M00 A;  5IIF A;  2F0M A;  1SYB A;  2OEO A;  4HMI A;  1EZ6 A;  5KYI A;  3ERO A;  4G57 A;  5IGD A;  3NK9 A;  2EYO A;  1A2U A;  3MHB A;  4LAA A;  3SR1 A;  4KY7 A;  3T13 A;  4K5V A;  5HUR A;  4QF4 A;  1A3U A;  5CV5 A;  4HMJ A;  5CR3 A;  4F8M A;  5KRU A;  3ITP A;  2KQ3 A;  2NUC A;  2EYH A;  1U9R A;  1RKN A;  2F0T A;  4J1M A;  3H6M A;  4WRD A;  1NSN S;  2EY5 A;  2OF1 A;  1SNM A;  3NUC A;  5IGB A;  2F0V A;  3OWF A;  5CV4 A;  5I9O A;  5IGF A;  1EY6 A;  5HGT A;  1JOR A;  4ZUJ A;  4EQO A;  2QDB A;  3BDL A;  5J22 A;  4KD4 A;  4HTH A;  5IGE A;  3TP5 A;  4KJO A;  3D8G A;  1SND A;  4NP5 A;  4R8N A;  3C1F A;  3U9O A;  3TP6 A;  4YIJ A;  3NXW A;  3MXP A;  5F2D A;  3D6C A;  4J6H A;  4I65 A;  1SYG A;  2PW5 A;  3S9W A; 
#chains in the Genus database with same CATH topology
 2EOT A;  1F2M A;  3K0Y A;  3R2I A;  4APV A;  5C4X H;  1EQT A;  2O4X A;  4DU9 A;  1GO3 E;  3I4N H;  1GD7 A;  2AKW B;  1YNN D;  1PRT F;  1UEB A;  4QCL A;  4QQB X;  2R93 H;  4F88 A;  5M3M H;  4L6T B;  3GTP B;  3J81 L;  3PO2 B;  3D4D A;  4KV6 A;  3RZO B;  5IWA L;  4A3E H;  3FVQ A;  1YNJ D;  1NTG A;  4P71 A;  1KXL A;  3ONA B;  2VW9 A;  3M9B A;  1B1Z A;  4HID A;  5C0X I;  1M1K C;  4NDX A;  4HN7 A;  4KTA A;  3I4M H;  1IYJ B;  4LF5 L;  1FJG Q;  4FXD A;  3HZX A;  4RCN A;  3I4O A;  3GTQ B;  1O78 A;  2CFM A;  4DV0 L;  4JI0 L;  2F0H A;  3M7N A;  4DAY A;  4DAV A;  3S14 H;  4C3H B;  4B3R Q;  1YHB A;  3Q24 A;  3F2U A;  2WAQ B;  4OGQ C;  3L2P A;  3K81 C;  4IOC A;  1VQI A;  2QGQ A;  1NMF A;  2WII B;  2CCZ A;  1NY4 A;  1FD7 D;  4JVZ A;  4X64 Q;  4JV5 Q;  1RDP D;  3QO2 A;  1JOK A;  3CW2 C;  1QZH A;  2ZJQ A;  4PMC A;  3D0F A;  4MIU A;  4NXM L;  2E2I H;  1XMQ L;  2B8G A;  2JA6 G;  5ELD A;  3SK4 A;  3EQL C;  4GN3 B;  2K03 A;  3CCQ A;  1TWH B;  3QJY A;  3L7Z C;  5DLQ E;  2MO1 A;  4KKS A;  5I2X A;  1D8L A;  1TWF B;  2GVA A;  1DOM A;  4P75 A;  3PUX A;  4PQX A;  4DV1 Q;  4HMI A;  3S1N H;  4CKE A;  4GOP B;  4IJL A;  2R7Z H;  3T13 A;  1NMG A;  1XTC D;  2KEN A;  3UDG A;  4JI6 Q;  2NUC A;  3FMC A;  1RD9 D;  4DR2 L;  1I4R A;  2PNH A;  1NSN S;  1CZW A;  2CWA A;  3J80 E;  4EQO A;  1BCP B;  2L5T A;  5J22 A;  3MWY W;  1B2T A;  4C3I B;  3WOE A;  1IXR A;  2E76 C;  2NZH A;  3I56 A;  1Q82 C;  4XQJ A;  5IYD H;  1V1P B;  4YY3 Q;  1BCP F;  3H3V C;  2BDN A;  1TY2 A;  1SE8 A;  4DR7 Q;  1EOV A;  2F3I A;  1NCV A;  1FYC A;  4KMU C;  2VQE L;  2AQ3 B;  1LUZ A;  1EQV A;  3IRB A;  4A3B B;  1SYE A;  1Y8P B;  3A54 A;  4EQP A;  1UWV A;  2L9H A;  2RDG A;  1MKH A;  5CV9 A;  5A35 A;  2Y0S E;  2KCN A;  3SK8 A;  1O7Z A;  1EUJ A;  1YHA A;  3SE0 A;  4DR1 L;  3HOY G;  2XWJ B;  1PDQ A;  1Q12 A;  1KRT A;  1XJV A;  1BBX C;  2B2V C;  2B2Y A;  2K32 A;  3RUZ A;  2F0J A;  1E22 A;  4JI5 L;  1STA A;  3TZU A;  4QIW E;  3I4N G;  5T1I A;  3DLL A;  1W6J A;  2JXM B;  5CV7 A;  2R93 G;  3GQB A;  5KIX A;  4QUC A;  3HOW B;  1ILQ A;  4OX9 L;  4OON A;  2VUM B;  1I50 H;  2D2C C;  3CRL C;  3IKJ A;  4A3E G;  1HR0 Q;  1D6E C;  2F0L A;  3S24 A;  4QJF A;  1SJH D;  2PZT A;  3J7Z C;  1QVC A;  5JEA G;  1JCK B;  2B63 H;  3S1Q H;  1YVC A;  4QMG A;  2ICI A;  3I4M G;  1EEF D;  2F3V A;  3K80 C;  1U5K A;  4GLV B;  2A73 B;  2QA4 A;  2ZJP A;  1BR9 A;  1L2F A;  5BN4 A;  1PLF A;  4BBS H;  3TP7 A;  4XYO A;  5HGQ A;  2KHI A;  2PI2 E;  5IYC G;  1TWC H;  2UXB L;  1VQ7 A;  3NBI A;  1TS4 A;  3CF5 A;  3H3V H;  1SNQ A;  4DUY Q;  1GUW A;  2JSO A;  4B3S Q;  2D62 A;  4POF A;  2SNM A;  3BYY B;  2OTJ A;  3EA6 A;  3HOZ H;  1MIU A;  2DUD A;  1TQO A;  3W1G A;  3NEL A;  4MZ9 A;  2B2W A;  4FVM A;  3OTO Q;  1G29 1;  2UUA Q;  4KI0 A;  1W6K A;  3T51 B;  3GP7 A;  3BJU A;  1IYV A;  2KVM A;  1Q7Y C;  5IGB A;  3NUC A;  4HIO A;  1U4M A;  3PUY A;  1DGS A;  3BDL A;  4XT3 B;  1STE A;  3FHW A;  2KA7 A;  2R7Z G;  3A74 A;  5FO9 B;  1HZ9 A;  1F9P A;  4G7H C;  1FJG L;  1O80 A;  1U4P A;  1SYG A;  1R4Q B;  4CJ0 B;  3AFP A;  1OXU A;  3K8A A;  5DAU A;  4B3R L;  1MBY A;  1I4Q A;  4K5X A;  1Y8O B;  4N8X 1;  1LLR D;  5DM7 3;  1VS0 A;  2A69 D;  3M4O H;  1A2T A;  2F0P A;  3PV0 A;  2CW0 D;  4X64 L;  4DR6 Q;  5E7N A;  1OXX K;  4KN4 C;  4JV5 L;  4A3M H;  3A56 A;  4P72 A;  1JT8 A;  5NUC A;  3PO3 H;  4MNO A;  4V19 0;  4ILW A;  5I6Y A;  4GZY C;  1ASZ A;  2BA0 A;  2ATW A;  1VF7 A;  2VXW A;  1UNS A;  3GTG B;  2EJM A;  1TXY A;  3DHQ A;  5JPM C;  3S2H B;  2BOS A;  3FPU B;  4J15 A;  1LTS D;  4R9W A;  1SFO B;  1BBW A;  1J8I A;  3OW7 A;  1EZ8 A;  2UXC L;  1ZYR D;  4JI6 L;  2XTI A;  2A1A A;  3DEP A;  1BQQ T;  5DNF A;  4X3T A;  4DFA A;  4JI7 Q;  2NZ1 D;  3KYH C;  3NQI A;  1TWA H;  2C5C A;  3T1H Q;  1EY7 A;  3GTM H;  2K5D A;  4ZQ3 A;  2F0S A;  2LS0 1;  4YY3 L;  3GTJ H;  2JJQ A;  2L0C A;  4X66 Q;  3DUZ A;  3HS0 C;  2K7V A;  3K5M A;  3CU7 A;  1JJC B;  2D0P A;  1KAA A;  2IY5 B;  3TP8 A;  1K8A C;  4R4T A;  2A6H C;  2MGS A;  1RTO A;  3J81 j;  1HR0 W;  2BH2 A;  2F0Q A;  5HY6 A;  3HOY B;  1IBM Q;  4X62 Q;  1STY A;  1Z47 A;  1E1T A;  1VQL A;  3A55 A;  1JOO A;  1SE4 A;  5C3E G;  2K52 A;  5KYI A;  2RHS B;  3NK9 A;  3I4N B;  1SMX A;  1D5Z C;  1UUP A;  4QF4 A;  5HUR A;  1P8L A;  3JAM c;  3KOJ A;  4F8M A;  2R93 B;  2R3Z A;  3HOU H;  1L0X B;  2ZXR A;  3VR3 A;  4DAY B;  1JOR A;  2PMZ B;  3EIV A;  1DM0 B;  4A3E B;  1CHP D;  4BBR H;  2A68 D;  5IP7 H;  1BDO A;  3K0X A;  1D1I A;  4BA2 I;  5E1F A;  1QVF A;  1PYW D;  4A3D H;  2EPB A;  5CBA E;  1CSQ A;  3GV3 A;  1WI5 A;  2DJG C;  1EU4 A;  1EIY B;  5EKL A;  4NKL A;  3CRK C;  3ULJ A;  2QEX A;  2VZA A;  3KBX A;  1V8Q A;  4R4O A;  4OWX B;  4A75 A;  1LT3 D;  1VQG A;  5IP9 H;  1KL9 A;  4A3C H;  1Z7T A;  4DAM A;  4DUY L;  2SNS A;  4DV7 Q;  1LTG D;  2I46 A;  4DV5 Q;  2HD3 A;  3HKZ G;  4BXX G;  5LMN Q;  4QY7 A;  3TN2 A;  1KQS A;  4YCV A;  1JJ2 A;  1Q8K A;  1KD1 C;  4KY5 A;  4B3S L;  3V2T A;  2RQX A;  2QKI C;  2E2I B;  2A69 C;  3LX0 A;  1RJT A;  2F52 A;  1XPU A;  3NTH A;  2CW0 C;  1IL2 A;  3E0J A;  4B3T L;  2AQ1 B;  2C9O A;  3ULP A;  5EQ0 A;  1X3Q A;  1IW7 C;  3CC7 A;  1Q90 A;  2K33 A;  3OTO L;  4CDC C;  5EKK A;  4IFD J;  1EOT A;  4N9P A;  4JI3 Q;  3NBH A;  4RKB A;  2E2D C;  5E4X A;  1TVX A;  1EY5 A;  3B6Y A;  4ZRZ A;  1J5E L;  4N9T A;  4RGO S;  1GUS A;  2XN9 C;  3LGJ A;  4BY1 H;  2R7Z B;  2E2J H;  3FKI H;  4LFA Q;  3X3N A;  2IT1 A;  3AYH B;  1TT2 A;  1Y69 U;  5M5W H;  2H4O A;  5KGU A;  2F0U A;  2NTS A;  1EY9 A;  1B3Q A;  3KLW A;  3OMC A;  1F2Y A;  4IFD H;  1A3V A;  3T56 B;  2F0G A;  4HSV A;  5FLX E;  3NWS A;  5EGT A;  2NN6 I;  4R4I A;  2FJ2 A;  2A6E D;  4IZ8 A;  3CCS A;  2F0D A;  3STB D;  4CDF C;  2F0M A;  2OEO A;  4KKU A;  1CZG A;  4DR6 L;  4IOA A;  3SR1 A;  1PTO D;  1I4X A;  4JCV E;  2H1E A;  4L63 B;  2NB0 A;  1HHV A;  3PGZ A;  5IWA Q;  3ITP A;  2KQ3 A;  4OEM B;  3D6W A;  1VQP A;  3PUV A;  5KND A;  2HCI A;  5ELC A;  3UE1 A;  4CDE C;  5EJW A;  4O1N A;  4GN4 B;  3WWV A;  4HSP A;  4DR4 L;  1CK1 A;  1Y14 B;  2TMP A;  1SND A;  5COY A;  1WTO A;  4NXN L;  1D7Q A;  4IUU A;  4GNX C;  3NXW A;  3MXP A;  3KUP A;  2VNU D;  3S2D H;  2A74 C;  2JYO A;  4H7B A;  4CBV A;  4DV0 Q;  1TR5 A;  2KJX A;  1I50 B;  4DPG A;  2BA1 A;  2OTL A;  4R1J A;  4JI7 L;  3DWP A;  4G7Z C;  4JBJ A;  3PIP 3;  3K6O A;  1M90 C;  3T1H L;  4X3U A;  1KDC A;  1F9S A;  3CCE A;  4X6A H;  2EYP A;  3ND9 A;  3X3M A;  4IN3 A;  1XMQ Q;  1K9M C;  1GOZ A;  4ZAI A;  4KN7 C;  1C0A A;  5C3E B;  3DM3 A;  4RMF A;  4PMB A;  1RTN A;  2PCF B;  1HPC A;  3MXN A;  2RSN A;  1X55 A;  3A0J A;  2V4D A;  1DOL A;  4R8I A;  5LMU Q;  4X62 L;  2EIF A;  2OQ0 A;  4KK7 A;  1MGS A;  4A3C G;  1STB A;  3L0O A;  3CCJ A;  4ME3 A;  2ENB A;  3CP0 A;  3Q23 A;  5E3F A;  1VQN A;  3RNU A;  3K7U C;  4ZK9 B;  4X65 L;  3BYT B;  1K83 H;  4XTC S;  2XWB B;  4DR2 Q;  5IOC A;  4N8F A;  1R9T B;  3SK6 A;  2SOB A;  1P16 A;  4QB4 A;  1EL0 A;  5LMN W;  1XTD A;  3ICE A;  5JJL A;  4A3F G;  3DEO A;  4KD3 A;  2O5I C;  2MJ8 A;  1K0R A;  3M85 A;  5BN5 A;  3BU2 A;  4BY1 G;  2VQE Q;  2KED A;  1IHZ A;  3CCU A;  3DWQ A;  1PH5 A;  1VQ5 A;  4A3L H;  3NSW A;  3LNN A;  2MUY A;  1SYB A;  1GUN A;  1JB3 A;  5IGD A;  3HKZ B;  2R92 G;  3I2Z A;  4K5V A;  1CT1 D;  5CV5 A;  2EJG C;  3M4O B;  1H95 A;  2IPK D;  4DV7 L;  1H9R A;  1ONL A;  4DAP A;  3KLR A;  5A2Q L;  2JA9 A;  3E3X A;  3L3O C;  1ENF A;  1I3Q H;  1S5F D;  3TP5 A;  2NBF A;  3C3L A;  1HTL D;  4DR3 Q;  3AU7 A;  1DJR D;  4I65 A;  3J80 c;  4UAI A;  2AHO B;  3BZD B;  1WTX A;  3HOX H;  5M3F H;  3TS2 A;  1TU2 B;  4IQZ A;  3AEV A;  4JI3 L;  4LJZ C;  3NHH A;  1NR4 A;  1TS5 A;  2PQE A;  3HEJ A;  4OHJ A;  1PH3 A;  2NVX H;  1K8M A;  5IT9 c;  4A93 H;  1SNP A;  2EYM A;  4LWC A;  1VQ9 A;  3U58 A;  1B4O A;  2UXB Q;  1T9H A;  1A8V A;  4U68 A;  1TWA B;  3QOJ A;  4JW0 A;  3S17 B;  2JN4 A;  3P20 A;  1WTP A;  1VMP A;  1YEZ A;  5C4Z A;  1NUC A;  3OSO A;  3GTJ B;  4AYB G;  1AZP A;  3N6R A;  4IUT A;  5IGC A;  1HJP A;  1PRT B;  1SRO A;  1PZJ D;  4IPH A;  3R3O A;  2I5H A;  1HZC A;  1CKN A;  1NE3 A;  2YU9 B;  2G9D A;  2D0O A;  4P73 A;  1L0W A;  5LHY 1;  1E1O A;  5FK9 C;  4C2M H;  3BVZ A;  4OO1 H;  4FYD A;  1B70 B;  2EVB A;  3O13 A;  1JWU D;  1B8A A;  3S15 B;  3C1E A;  4DNR B;  4KKT A;  2L12 A;  3A8K E;  3QOL A;  2NVY H;  3K5N A;  4C3J H;  3F2D A;  1CA5 A;  2JA8 G;  4JI4 Q;  2JEB I;  3JAM L;  1ZXT A;  2CQA A;  4PNY A;  5C4H A;  1JC7 A;  2Q8I B;  1V9P A;  1SSO A;  1SYD A;  2LXJ A;  1XXG A;  1EZ6 A;  2EE1 A;  3VR2 A;  4M1U B;  1RCV D;  3F1Z A;  5D65 A;  3PIO 3;  1U9R A;  1G2T A;  1X54 A;  3GTO H;  3IAY A;  2OF1 A;  2Z9H A;  5IGF A;  3K5L A;  2I07 B;  1MHW C;  2JA7 H;  3NBH B;  1JMC A;  1EIG A;  3PSI A;  4TQU S;  1CKO A;  1A62 A;  1LT4 D;  3C1F A;  5LMU L;  5F2D A;  2M2L A;  4J6H A;  1GM5 A;  4TRD A;  4OEL B;  3TRE A;  1Y1W G;  4DGZ A;  1WTH A;  3P75 A;  2DGY A;  3PCO B;  3GTK B;  1AW7 A;  2UXC Q;  1IBL L;  2K28 A;  3VYS A;  1QG7 A;  1CFM A;  2D9U A;  3VR5 A;  2O5J C;  1SMY D;  4A3F B;  1YJN A;  1I6H B;  2XRS D;  2HQE A;  4O0A A;  2NZO A;  4C1N I;  2ZM6 L;  1CTM A;  5M3F G;  4JI1 L;  1GKH A;  4HJ7 A;  4MN3 A;  4XDX A;  5CV8 A;  1C8C A;  2E2J B;  1JOQ A;  2DY8 A;  2RA4 A;  2SEB D;  5GAG C;  1S72 A;  4LW1 A;  1PRT D;  1ZKO A;  1SN8 A;  5M5W B;  3J7A V;  2R92 B;  4A93 G;  4MTK A;  2CQO A;  3Q0A A;  1HZB A;  2F4I A;  3CPF A;  3D31 A;  3TME A;  3TZD A;  3T53 B;  2NVQ B;  1PA6 A;  1TWG H;  1O7I A;  5M5X B;  4PG3 A;  4HAE A;  2J7Z A;  2EDG A;  3ERS X;  1SBB B;  5C4X G;  1G6Z A;  5DEH A;  5C6A A;  2ICE C;  3JAM i;  3HKS A;  1WJJ A;  5ELB A;  1YNN C;  3CKI B;  5M3M G;  4UP7 A;  1WTR A;  4R4Q A;  2A19 A;  1UE1 A;  4DR3 L;  1EQQ A;  4LF9 Q;  1VQA A;  3K5O A;  4IJH A;  4AQY L;  2V1C C;  2Q2U A;  3TS0 A;  1B44 D;  1YNJ C;  5I2Y A;  2X6G A;  4OO1 G;  3S2D B;  2UU9 Q;  1WVL A;  4RHS A;  2N78 A;  1KDB A;  3DXJ C;  1GUO A;  2KUM A;  3HFZ B;  3MXN B;  4G7O C;  3HOV H;  3S1R B;  4XT1 B;  4ZYS A;  4C3J G;  4FP5 D;  4HED A;  4AYB B;  2EYH A;  4FNF A;  4LFC Q;  3IFT A;  2HQL A;  3HRZ C;  1QNU A;  3AFQ A;  2F0V A;  4Y52 H;  1EY6 A;  1VQD A;  1I4P A;  1KNA A;  2Q2T A;  2IJ0 A;  3MXU A;  3D8G A;  4NP5 A;  1U0L A;  2WAQ E;  2RF4 A;  4O2D A;  2I0Q A;  4YIJ A;  1YIJ A;  2F1M A;  4B3T Q;  1OO9 B;  3KLS X;  4B08 A;  2HHH Q;  3FDT A;  2JP1 A;  2XIW A;  2EYJ A;  1ASY A;  4HJ9 A;  5G3L F;  1RL2 A;  1WYD A;  2ZXO A;  4YWL A;  2R7D A;  4DXF A;  5EBD A;  4O42 A;  1J5E Q;  1B3A A;  1BCP D;  1MJE A;  2EY2 A;  4GKK Q;  2KBN A;  2CVR A;  3I7F A;  1WTV A;  1S4Z A;  1PZI D;  4OWT B;  4A3K H;  3EJI A;  2F0W A;  2JA8 B;  2WB1 G;  3DMU A;  3HGB A;  1VMC A;  1Q1E A;  4I7Z C;  4DV6 L;  2PW7 A;  1PFB A;  4FDB A;  1EWH A;  1PZK D;  1PH1 A;  2B2V A;  3HP3 A;  3M3Y H;  2CHB D;  3NEM A;  1NR2 A;  4WFN 3;  4JI4 L;  1TS2 A;  3FRP B;  1F9Q A;  1GHJ A;  3ERQ A;  2Q2H A;  3D4R A;  3AQQ A;  1FL0 A;  5C0X J;  4HCS A;  5IYD G;  4JOI C;  1KAB A;  2Z0S A;  2JE6 I;  4A76 A;  1XMO L;  2JA6 B;  4RFB A;  4F7X A;  3DM1 A;  2K1B A;  1YIT A;  1PH9 A;  3PQI A;  4B3M L;  4EQN A;  3PMF A;  5JVG 3;  2FMC A;  3AMU A;  1F77 A;  1LAB A;  1RF2 D;  4JG2 A;  4DXG A;  3PIO A;  1OXT A;  1Y1W B;  4DR4 Q;  1S5D D;  4NXN Q;  4UP8 A;  5C0X H;  1SAP A;  3CME A;  1XWE A;  2EQS A;  1VQ6 A;  1BF4 A;  1SNO A;  4A3G H;  3Q6S A;  3I73 A;  5GAD C;  2EYL A;  3T4A C;  2I5M X;  2R61 A;  3PUZ A;  4CHT B;  1SJE D;  2EZV A;  1VQO A;  1TII D;  2A5H A;  4OIJ A;  5C3W A;  3Q22 A;  5M3F B;  4LF6 Q;  3P7J A;  5FLX c;  1GHK A;  1HA6 A;  2LMC B;  4KY7 A;  2Z4H A;  2FIN B;  5KNB A;  2AMC B;  2RSO A;  2BE5 D;  3RLN A;  5GAE C;  1CKN B;  5GAH C;  2HUG A;  3J80 L;  2B63 G;  4A93 B;  3UI2 A;  3K7A H;  5I9O A;  2FFK B;  1LTB D;  4KJO A;  2Q8T A;  4BBS G;  3NTK A;  2K6A A;  3HOV G;  3U9O A;  2D5D A;  1PYS B;  2PW5 A;  2CH4 A;  2MO0 A;  1BVS A;  5C4X B;  5IT9 L;  3M4Q A;  1NNX A;  3MFY A;  1YNX A;  4JBK A;  1C48 A;  1B7Y B;  3CHB D;  2AUK A;  3OOC A;  3F2B A;  4DV3 L;  3T16 A;  4IO9 A;  4AYB E;  4X65 Q;  4RHR A;  1E24 A;  5M3M B;  1N36 Q;  3HOZ G;  2UUC Q;  2KEE A;  4LF8 L;  5KEE A;  4JYA L;  3MTS A;  4GOP C;  3PO2 H;  2WKC A;  3BVG A;  4KHV A;  1V43 A;  4BWG B;  3QIA A;  4C56 C;  1LT6 D;  3BDC A;  2F0O A;  4C2M B;  1X56 A;  1VQC A;  1UEA B;  4LF9 L;  1H9K A;  4K5W A;  4KHZ A;  3N52 A;  1JE5 A;  3R2T A;  4L8J A;  4OIK A;  4V0B A;  1N32 Q;  3I4M B;  2RKS A;  3RR5 A;  3RN2 A;  3H91 A;  3G6J B;  3F2C A;  2MPM A;  2UU9 L;  2RDF A;  2WFW A;  2ALY B;  2NVY B;  4A3K G;  4C3J B;  1G2S A;  3ND8 A;  5CV6 A;  4PZ7 A;  4ZKC B;  1A6X A;  3S14 B;  1VQH A;  3GTQ H;  3BVM A;  1S40 A;  3VYR A;  1D1K A;  1HCZ A;  3R8B A;  4C3H H;  3BZC A;  2DNC A;  4LFC L;  1YJW A;  4EVO A;  4WOR A;  1EWC A;  3GTL H;  4FF4 A;  3OHX C;  5L37 A;  2LY7 A;  3OPO A;  1JE4 A;  4GN5 A;  2X69 A;  2J4X A;  3GTO B;  4A3M G;  4R4C A;  3S1M H;  4OL7 A;  2HHH L;  3PO3 G;  1L1O C;  3SEB A;  5K5P A;  1JR0 D;  1Q8I A;  3J80 i;  3TQY A;  4Q0F A;  5A2Q E;  1DYQ A;  1CA6 A;  3NQT A;  1TWF H;  4GKJ L;  4FF3 A;  3S1N B;  4UHV A;  2WB1 B;  2M00 A;  3CQZ H;  5IIF A;  1HRJ A;  2GVB A;  1PH7 A;  5C0X G;  3ERO A;  4GKK L;  1HNW Q;  1VQ8 A;  4H0L C;  4A3G G;  4CKC A;  2DY7 A;  5ELN A;  2IL8 A;  2IX0 A;  2KOL A;  5JVH 3;  1HA5 A;  2AWN A;  1ZYR C;  1XNQ Q;  2VQF L;  3TEH B;  3PF5 A;  3H09 A;  5LL6 S;  2B2U C;  5EPK A;  1SR3 A;  4C3I H;  2HIV A;  4QGU A;  4LF7 Q;  3GV6 A;  2K5W A;  1YI2 A;  3RZD H;  1B9M A;  4YCU A;  5D3I B;  2Y0S G;  2F4V Q;  5J3B A;  1JIC A;  3C2P A;  4RA8 A;  1I94 L;  1CHQ D;  1T5E A;  4A3B H;  2LSS A;  2OT2 A;  4POG A;  2PZW A;  4EQ5 A;  4DNI A;  4DV4 Q;  4WJW A;  4EGV A;  1CSP A;  1GUT A;  1XYI A;  1ENA A;  2EYF A;  2EXZ A;  4IPC A;  2Z6K C;  1AE2 A;  3J81 E;  1LTI D;  4OWW B;  1PH2 A;  1QUQ A;  3W2D A;  4IUN A;  4BS9 A;  4GLA C;  3VA5 A;  1X6O A;  3I55 A;  2HT1 A;  2E5L Q;  3HOU G;  5DM6 3;  2QDL A;  4NMZ A;  2KHS A;  2FMM A;  5IYB H;  4QL5 A;  4X3K A;  4BBR G;  4ZUI A;  4LF6 L;  4ID6 A;  4HJ8 A;  1K3B C;  2A68 C;  4DR5 Q;  5IP7 G;  2Z8L A;  2B63 B;  2PMZ E;  4BA1 I;  3SDZ A;  3I91 A;  3I3C A;  5ISR A;  3S1Q B;  4DUZ L;  5J1Z A;  3K58 A;  1LO5 D;  4L5Q A;  1L1O A;  1H9J A;  3NP8 A;  4BBS B;  1A0I A;  4WJ4 A;  3U9S A;  3BS1 A;  4A3D G;  3E5S A;  2JA5 H;  3HOV B;  1H9S A;  3WDN A;  4DK6 C;  1TWC B;  5K36 H;  1MSG A;  1VCI A;  1QCB D;  5C44 H;  5I9P A;  3KJO A;  1WOC A;  3L9A X;  3E0E A;  5IP9 G;  5CMD A;  1VDZ A;  2F0F A;  2L1B A;  4JBM A;  2QCP X;  3HOZ B;  2WV6 D;  3H15 A;  1IBL Q;  1A63 A;  3SVM A;  4K8J A;  2ZTD A;  1DON A;  4CJ2 C;  2K5N A;  4I7A A;  1I4H A;  1N36 L;  1HH2 P;  4P2C B;  2UUC L;  1QNK A;  2EYO A;  2B2T C;  4WJ3 M;  1X32 A;  2ZM6 Q;  1HXY D;  4JI1 Q;  1RKN A;  1EFI D;  3QWN A;  1O7Y A;  1L0Y B;  5JJK A;  1N32 L;  3V05 A;  4GS3 A;  4A3K B;  1HFN A;  5KNC A;  1PH4 A;  2WP8 J;  2RDH A;  1EIH A;  4R8N A;  1IYU A;  5T1G A;  3FKI G;  5EKI A;  1HNX Q;  3TP6 A;  1MJC A;  3OW2 A;  4X3S A;  5ELE A;  5FOB B;  1OXV A;  3M3Y B;  5JJZ A;  1JWS D;  2WB1 E;  4M8A A;  1G6P A;  1IL8 A;  1XNR L;  5AJ3 Q;  4Z9C B;  5CBE E;  1U4L A;  5C5M A;  1N34 Q;  1PYB A;  4GNX A;  4K0K Q;  4IFD G;  1N8R C;  4PZ6 A;  4A3M B;  4KY6 A;  2E2H H;  2CKZ B;  3PO3 B;  3KF6 A;  2A6E C;  1I6V C;  4Q5V A;  1N9W A;  3KLS A;  4K2K A;  2BCO A;  4UP9 A;  1X65 A;  3HG9 A;  3STB C;  1W2B A;  5JOB A;  2EY1 A;  4A3B G;  3H3V I;  1RIP A;  4RGM A;  1PTO C;  3T1Y L;  3M4P A;  4RG1 A;  4U67 3;  3Q8D A;  5FKA C;  4JI8 L;  3KDF A;  2K50 A;  4AQY Q;  2ZTC A;  1SDF A;  2PO4 A;  2KCT A;  2R6G A;  2DJF C;  1KLU D;  4A3G B;  1QE6 A;  1EQR A;  1HNW L;  1XX8 A;  3GDE A;  1QVG A;  4XIG S;  1BBU A;  2K04 A;  4K8I A;  4YWM A;  4Y7N H;  1X3G A;  2PPB C;  2CWP A;  3VYU A;  1XNQ L;  3GTM B;  5CC4 A;  2Y0S B;  4HIM A;  1UE5 A;  1TY0 A;  4LF7 L;  4LMQ D;  4RWS C;  1EWI A;  1JJG A;  1CQV A;  3OYY A;  3NWT A;  4CKB A;  5FLX L;  2F4V L;  2JA5 G;  1CKM A;  4IUR A;  2WKD A;  1ROD A;  3M4Y A;  3G6E A;  2K5V A;  5K36 G;  4QIW B;  3SHL A;  4UY8 C;  2EJF C;  4TSS A;  5C44 G;  1KAW A;  5IOD A;  1F2Z A;  2QEJ C;  4DV4 L;  3RLO A;  5JEA J;  1QZG A;  1Y8N B;  2K01 A;  1OTC A;  1Q1B A;  3FEW X;  1FGU A;  1X3F A;  3W1B A;  1ICF B;  3CXC A;  3HOU B;  1VQF A;  1PTO H;  3H6M A;  4WRD A;  3D3R A;  4FF1 A;  4DV6 Q;  2R7F A;  5CV4 A;  4BBR B;  4IUP A;  4ZUJ A;  3ER0 A;  1KIX A;  2E5L L;  4HTH A;  3JC6 6;  1LYL A;  1DXM A;  4YHH Q;  1LT5 D;  2IWH A;  3K57 A;  1GUG A;  4IPG A;  5JEA H;  1DZ1 A;  5BR8 Q;  4DR5 L;  4A3D B;  2NN6 H;  1XMO Q;  2KCM A;  4IUQ A;  3G4S A;  2RVL A;  2B2Y C;  1I5F A;  1B50 A;  1PVO A;  1GJX A;  1DD2 A;  1ZEQ X;  5IYC H;  1G91 A;  4B3M Q;  3PIP A;  4LUO A;  4A3L G;  1JWM D;  2HDL A;  3ULL A;  1HFG A;  3U4V A;  2B39 A;  2RHQ B;  2H5X A;  3W3A A;  1LTT D;  1Z9F A;  3R93 A;  3OIQ A;  1M8A A;  3BZK A;  1AN8 A;  1MD2 D;  4ME5 A;  1HTP A;  3UE0 A;  2F0K A;  3GTL B;  1SRU A;  1VQK A;  2X6L A;  2HIX A;  4RKL A;  3SGI A;  2YTY A;  4L5R C;  1EIF A;  1EYG A;  2B8F A;  4ULL A;  1J6Q A;  1K28 A;  3HKZ E;  2K5H A;  3S1M B;  2ASB A;  3SXH A;  1IKM A;  1CUK A;  4PZ8 A;  1LTR D;  2EXD A;  1K0S A;  1D5X C;  3MA2 B;  3TSS A;  4CGY B;  4H44 C;  4BY1 B;  2F0E A;  4MHE A;  5C4J H;  3CQZ B;  3HOX G;  2L15 A;  3NE5 B;  4EX5 A;  1LTA D;  4FXG C;  4MTN A;  1OXS C;  3FKI B;  5AFW A;  5EAY A;  1F9R A;  4A3I H;  4A3J H;  2NTT A;  1HNX L;  5BN3 A;  2ZTE A;  1PFM A;  3MEH A;  2K4K A;  1BNZ A;  2IW3 A;  2SDF A;  2EY6 A;  2B2W C;  4ODG A;  3A7L A;  1EY4 A;  5AJ3 L;  1NJI C;  3GO5 A;  4LK1 C;  1N34 L;  3MFG A;  2RCN A;  3J81 i;  3RZD B;  4K0K L;  2N3S A;  4DV3 Q;  1QUQ B;  3KF8 A;  3RLF A;  3PUW A;  2IX1 A;  1PV4 A;  2TSS A;  1AFP A;  5GQO A;  5IT9 E;  4LF8 Q;  5FJ8 H;  4HMJ A;  4JYA Q;  4JI2 Q;  1PHJ A;  4LNQ A;  3E9I A;  4G4K A;  3A5U A;  2VS1 A;  4HR7 B;  1QOH A;  4LF4 L;  5JPN C;  4UDU C;  2QDB A;  1HNZ Q;  4KD4 A;  4H13 C;  5IGE A;  1S5B D;  4IPD A;  3VYT A;  1L1O B;  1CI3 M;  1FNV A;  1ET6 A;  1DOK A;  4KLK A;  1KRS A;  1NAP A;  1H9S B;  1UE6 A;  1VQJ A;  1HQM C;  3S9W A;  2E75 C;  4DKA C;  1QJO A;  3OMG A;  4BY7 H;  4H02 A;  2KEC A;  2F3W A;  1S3O A;  3UDF A;  5LL6 X;  1C9O A;  2Z4I A;  3AB9 A;  3UDI A;  1HUM A;  1T5X D;  1YBY A;  4XQQ A;  1IZ6 A;  3S16 H;  2A6H D;  3OWE B;  1Y1V H;  3CPW A;  2JA5 B;  2NN6 G;  1X3E A;  4DK0 A;  1Q46 A;  1CM9 A;  2ES2 A;  5C44 B;  4A4I A;  1PFS A;  2O2L D;  1YHQ A;  3NTI A;  4ALP A;  4B9X A;  5C3E H;  4IFD I;  2DN8 A;  2PYK A;  1SEB D;  2JA7 G;  3A5Z B;  5JAV A;  1SYF A;  4GKJ Q;  1PH8 A;  5H1S E;  2N8N A;  1EEI D;  1U4R A;  5D14 A;  4K6L A;  4DF7 A;  1PXU A;  1K83 B;  3MVV A;  2RCF A;  1ILP A;  4YWK A;  3RN5 A;  2VQF Q;  1R9T H;  3CAM A;  4GNX B;  4TKO B;  1R4P B;  1UAP A;  5M5Y H;  4YHH L;  1LM0 A;  1SMY C;  1S5E D;  4L5S A;  4NPS A;  5BR8 L;  2WIN B;  3H0G H;  3KF6 B;  3BDO A;  3D4W A;  1IBK Q;  1IKL A;  4K14 A;  2JEA I;  1I94 Q;  2IX3 A;  4DV2 Q;  4A3I G;  2YV5 A;  4A3J G;  1QB5 D;  3WOF A;  1PRT C;  1AH9 A;  3KDF B;  1WD0 A;  1B53 A;  4LAA A;  2L55 A;  1WCM H;  4BXX H;  3VDY A;  2YTX A;  3A8I E;  3V96 A;  2XGT A;  2B29 A;  3VA7 A;  2E2H B;  2EY5 A;  2OQK A;  1E2V A;  1I3Q B;  5HGT A;  2CH4 W;  1IW7 D;  2L4N A;  1K3R A;  2PQA A;  3UDX A;  2FXQ A;  2NVT H;  4KHP Q;  5FJ8 G;  4C1N K;  3F8T A;  1ICW A;  1KHI A;  2YYZ A;  1V1Q A;  4ZLT F;  1AZQ A;  3HOX B;  4AIM A;  1W3S A;  1MI2 A;  4E6I A;  1Q81 C;  3IFD A;  5IGG A;  4DUZ Q;  2RBM A;  5I6W A;  2MP1 A;  2NVX B;  4DV1 L;  2I5L X;  3M7G A;  4FXK C;  2Q2I A;  1Q86 C;  2MQH A;  1C4Q A;  4P74 A;  4Y7N B;  1NBW A;  1TKW B;  3KK7 A;  1YJ9 A;  2ZJR A;  1N33 Q;  4BY7 G;  2OXP A;  5IY0 A;  1VQ4 A;  5G3L D;  3J7A 5;  2UXD Q;  4DN4 M;  2G9H D;  2JQO A;  4CDD C;  3S17 H;  2E8G A;  5I4D A;  3J81 c;  1STH A;  5EPJ A;  1EFW A;  1AEX A;  4HJ5 A;  1ENC A;  3C46 A;  1STN A;  4DR7 L;  1X9N A;  3CC2 A;  1Y1V G;  3NEN A;  2P5Z X;  2LXK A;  3MZ5 A;  3TDQ A;  2C35 B;  3MEF A;  1K8G A;  2YU9 H;  1O7L A;  4PV1 C;  3MAQ A;  1WTQ A;  1LTL A;  4QUF A;  3GTP H;  4JI2 L;  1STG A;  1BOS A;  3RZO H;  1K73 C;  3FPP A;  4JOI A;  5ELF A;  2XVS A;  4OXP A;  1X3P A;  2BH8 A;  4PMW A;  5J39 A;  1HNZ L;  4LFB Q;  4NW2 A;  4S3S A;  5FO8 B;  2BDO A;  1PTO B;  1QWY A;  1BCP C;  5GRO A;  4JC0 A;  2K75 A;  5FLM H;  1PTO F;  2Z1C A;  4J8Q A;  3S15 H;  1A15 A;  3VR4 A;  2VB2 X;  1XNR Q;  1F2L A;  1M4V A;  1WFQ A;  1HR0 L;  5JJI A;  3GD7 A;  1FGB D;  1A3T A;  4G57 A;  2VY3 A;  2PI2 A;  1A3U A;  3H0G G;  2UUB Q;  5CR3 A;  4HIK A;  4XXE A;  5KRU A;  4DA2 A;  2VL6 A;  2IHE A;  1QIL A;  2JA7 B;  5FO7 B;  2NWG A;  3LWE A;  3T1Y Q;  2NYZ D;  1VQE A;  4JI8 Q;  1JB7 A;  3W5O A;  1K8O A;  1TWH H;  4L5T A;  3KBG A;  3KFU A;  3FP9 A;  1WCM G;  3OIP A;  3TRZ A;  1BXT A;  1G8Z D;  1GXD C;  4AH6 A;  1KNE A;  1G51 A;  4RGT A;  1BKB A;  1H9M A;  5D3D A;  2AWO A;  3TBI B;  3GTK H;  2K5Q A;  2G5D A;  1CQF A;  2OCE A;  4RAU C;  2WAC A;  1C7Y A;  1EY0 A;  4YCW A;  1V1O A;  1J9O A;  1WD1 A;  2JK8 A;  1LV9 A;  2UUA L;  4A3F H;  1I6H H;  5C4J B;  4OO1 I;  1SNC A;  1XPO A;  2Q8R E;  3KF8 B;  1XPR A;  4A3I B;  3I90 A;  1MSH A;  3G48 A;  2GA4 B;  4A3J B;  3QG1 A;  3URY A;  2Z6B A;  1SYC A;  1KC8 C;  1YZ6 A;  3H94 A;  3CD6 A;  2BE5 C;  1D5M C;  4IUV A;  4GOP A;  1IBK L;  3RMH A;  1DCZ A;  1E0B A;  2B3G A;  3CMA A;  4DV2 L;  2N88 A;  1GVP A;  2HDM A;  2R92 H;  4HCE A;  3I70 A;  4K2L A;  1TWG B;  1TS3 A;  2K05 A;  1LAC A;  1FNU A;  1II3 A;  2NVQ H;  2QW7 A;  2LKV A;  5M5X H;  3E6Z X;  1V1P A;  3G7L A;  1JQY D;  2DNE A;  3I72 A;  2F0N A;  1E3P A;  2YTV A;  1HZA A;  5KYL A;  1UE7 A;  4KHP L;  3HOW H;  5E4W C;  1SXT A;  3PO2 G;  4K6D A;  5COR A;  3MXG A;  3VR6 A;  2VUM H;  3BG3 A;  4NB3 A;  2J0T D;  3G71 A;  4LF5 Q;  2ID0 A;  3CCM A;  4BY7 B;  2ZT9 C;  3JAM E;  1E7Z A;  2MNA A;  2KCC A;  1AP0 A;  3SK5 A;  4DNT B;  3EFX D;  4JI0 Q;  3J7Y W;  1E2W A;  1KLG D;  4UPA A;  2MHV A;  3MHB A;  5FLM G;  1D2B A;  1FNW A;  2PNR C;  1SLJ A;  4RH6 A;  1N33 L;  1ET9 A;  4JK1 C;  2XSC A;  3S1R H;  2ZXP A;  3K59 A;  2UXD L;  4J1M A;  4C3H G;  3S16 B;  2WAQ G;  3NPP A;  1Y1V B;  3A8J E;  2XRQ D;  1PH6 A;  4FF2 A;  4LUV A;  4ABN A;  4X66 L;  4NXM Q;  2QF7 A;  3D6C A;  1VQB A;  3QB3 A;  5CGK A;  1BUV T;  1AE3 A;  1PMR A;  2B2U A;  4RCO A;  1IBM L;  3CC4 A;  3U50 C;  1EYC A;  4DK1 A;  2K14 A;  1ML0 D;  1VQM A;  1I4G A;  2IHF A;  2N49 A;  4LFB L;  4B9W A;  1Z6H A;  4FO2 A;  3MC0 B;  2FHT A;  2F03 A;  1B9N A;  1KDA A;  1WTW A;  2JA8 H;  5C5L A;  3KJP A;  5M5Y B;  1VF5 C;  2Z6K A;  1EU3 A;  2GN5 A;  4IAL A;  3CCR A;  2HCC A;  2XNA C;  1EY8 A;  3H0G B;  3QR8 A;  1HQR D;  1EYD A;  3CCV A;  4C3I G;  2E74 C;  2PQA B;  4LUZ A;  5M9O A;  1EYA A;  3LWU A;  5CYU A;  1S5C D;  3ZJY C;  2JA6 H;  4CJ1 B;  2UUB L;  3PF4 A;  4TVA B;  1ESR A;  1SE3 A;  1WCM B;  2AUJ D;  3ZYY X;  4DR1 Q;  4LF4 Q;  3DWA A;  4GLX A;  2F0I A;  2VB3 X;  3EN2 A;  3EVQ A;  1Y1W H;  3GTG H;  4JI5 Q;  1HUN A;  4DV5 L;  3U4Z A;  2KHJ A;  5LMN L;  3S2H H;  3CCL A;  4ZCK A;  2M9V A;  4DK3 C;  4KJN A;  1SFO H;  4ZKB B;  2PZU A;  1SE2 A;  2AQ2 B;  4HJA A;  2NVT B;  4XQN A;  5EBC A;  1Q3L A;  5EPL A;  4JPB W;  4OX9 Q;  2A8V A;  3EBE A;  2LFN A;  2QIL A;  2N55 A;  1ESF A;  3P1H A;  5C3X A;  3I4L A;  3I8Z A;  3HOW G;  5IYB G;  1A2U A;  3A7A B;  2VUM G;  1FVI A;  5IE8 A;  2OWO A;  2F0T A;  3K7A B;  2L11 A;  1SNM A;  3E9H A;  3OWF A;  4F87 A;  4LFA L;  4RGN A;  3RD4 A;  1PFN A;  1KTK A;  2MFI A;  2B2T A;  1E2Z A;  5TSS A;  3IL8 A;  4XYQ A;  1FR3 A;  1RHP A;  5ELO A;  3HOY H;  4JBW A;  3J7A F;  1BO0 A; 
#chains in the Genus database with same CATH homology
 2EOT A;  1F2M A;  3K0Y A;  3R2I A;  1EQT A;  2O4X A;  4DU9 A;  1YNN D;  1PRT F;  4QCL A;  4F88 A;  4L6T B;  3GTP B;  3J81 L;  3PO2 B;  3D4D A;  4KV6 A;  3RZO B;  3FVQ A;  1YNJ D;  3ONA B;  1B1Z A;  5C0X I;  4NDX A;  4HN7 A;  4KTA A;  4FXD A;  3HZX A;  4RCN A;  3GTQ B;  1O78 A;  2F0H A;  3M7N A;  4DAY A;  4DAV A;  4C3H B;  3Q24 A;  3F2U A;  2WAQ B;  4OGQ C;  2WII B;  1FD7 D;  1RDP D;  3QO2 A;  1JOK A;  4PMC A;  4MIU A;  2B8G A;  5ELD A;  3SK4 A;  3EQL C;  2K03 A;  1TWH B;  3QJY A;  3L7Z C;  4KKS A;  5I2X A;  1TWF B;  1DOM A;  3PUX A;  4PQX A;  4HMI A;  4CKE A;  3T13 A;  1XTC D;  2NUC A;  3FMC A;  1RD9 D;  1I4R A;  1NSN S;  1CZW A;  3J80 E;  4EQO A;  1BCP B;  2L5T A;  5J22 A;  3MWY W;  1B2T A;  4C3I B;  3WOE A;  2E76 C;  4XQJ A;  1V1P B;  1BCP F;  3H3V C;  2BDN A;  1TY2 A;  1NCV A;  1FYC A;  4KMU C;  2AQ3 B;  1EQV A;  4A3B B;  1SYE A;  1Y8P B;  3A54 A;  4EQP A;  2L9H A;  2RDG A;  5CV9 A;  5A35 A;  2KCN A;  3SK8 A;  1O7Z A;  3SE0 A;  2XWJ B;  1PDQ A;  1Q12 A;  1BBX C;  2B2V C;  2B2Y A;  2K32 A;  3RUZ A;  2F0J A;  1STA A;  3TZU A;  5T1I A;  1W6J A;  2JXM B;  5CV7 A;  3GQB A;  5KIX A;  4QUC A;  3HOW B;  1ILQ A;  2VUM B;  2D2C C;  3CRL C;  3IKJ A;  1D6E C;  2F0L A;  1SJH D;  2PZT A;  5JEA G;  1JCK B;  4QMG A;  2ICI A;  1EEF D;  2F3V A;  2A73 B;  1BR9 A;  5BN4 A;  1PLF A;  3TP7 A;  4XYO A;  3NBI A;  1TS4 A;  1SNQ A;  1GUW A;  2JSO A;  2D62 A;  2SNM A;  3BYY B;  3EA6 A;  1TQO A;  2B2W A;  4FVM A;  1G29 1;  4KI0 A;  1W6K A;  3T51 B;  3GP7 A;  1IYV A;  2KVM A;  5IGB A;  3NUC A;  1U4M A;  3PUY A;  3BDL A;  4XT3 B;  1STE A;  2KA7 A;  5FO9 B;  1F9P A;  4G7H C;  1O80 A;  1U4P A;  1SYG A;  1R4Q B;  4CJ0 B;  1OXU A;  5DAU A;  1MBY A;  1I4Q A;  4K5X A;  1Y8O B;  5DM7 3;  1LLR D;  2A69 D;  1A2T A;  2F0P A;  3PV0 A;  2CW0 D;  1OXX K;  4KN4 C;  3A56 A;  5NUC A;  4V19 0;  4ILW A;  5I6Y A;  4GZY C;  2BA0 A;  1VF7 A;  2VXW A;  1UNS A;  3GTG B;  2EJM A;  3DHQ A;  5JPM C;  3S2H B;  2BOS A;  3FPU B;  1LTS D;  4R9W A;  1SFO B;  1J8I A;  3OW7 A;  1EZ8 A;  1ZYR D;  3DEP A;  1BQQ T;  5DNF A;  4X3T A;  4DFA A;  2NZ1 D;  3NQI A;  2C5C A;  1EY7 A;  2K5D A;  4ZQ3 A;  2F0S A;  2LS0 1;  2L0C A;  3DUZ A;  3HS0 C;  2K7V A;  3K5M A;  3CU7 A;  1KAA A;  3TP8 A;  2A6H C;  2MGS A;  1RTO A;  2F0Q A;  3HOY B;  1STY A;  1Z47 A;  1JOO A;  1SE4 A;  3A55 A;  5KYI A;  3NK9 A;  3I4N B;  5HUR A;  1D5Z C;  1UUP A;  4QF4 A;  4F8M A;  2R93 B;  2R3Z A;  1L0X B;  2ZXR A;  3VR3 A;  1JOR A;  2PMZ B;  1DM0 B;  4A3E B;  1CHP D;  2A68 D;  1BDO A;  1D1I A;  4BA2 I;  5E1F A;  1PYW D;  2EPB A;  5CBA E;  3GV3 A;  1EU4 A;  5EKL A;  4NKL A;  3CRK C;  3KBX A;  1V8Q A;  1LT3 D;  1Z7T A;  2SNS A;  1LTG D;  2I46 A;  3TN2 A;  4KY5 A;  3V2T A;  2RQX A;  2QKI C;  2E2I B;  2A69 C;  3LX0 A;  1RJT A;  3NTH A;  2CW0 C;  3E0J A;  2AQ1 B;  2C9O A;  5EQ0 A;  1X3Q A;  1IW7 C;  1Q90 A;  2K33 A;  5EKK A;  4IFD J;  1EOT A;  4N9P A;  3NBH A;  4RKB A;  2E2D C;  5E4X A;  1TVX A;  1EY5 A;  4ZRZ A;  4N9T A;  4RGO S;  1GUS A;  2XN9 C;  2R7Z B;  3X3N A;  2IT1 A;  1TT2 A;  1Y69 U;  2H4O A;  5KGU A;  2F0U A;  2NTS A;  1EY9 A;  3OMC A;  1F2Y A;  4IFD H;  1A3V A;  3T56 B;  2F0G A;  4HSV A;  5FLX E;  3NWS A;  5EGT A;  2NN6 I;  2FJ2 A;  2A6E D;  4IZ8 A;  2F0D A;  2F0M A;  2OEO A;  4KKU A;  1CZG A;  3SR1 A;  1PTO D;  1I4X A;  4L63 B;  2H1E A;  1HHV A;  2NB0 A;  3ITP A;  2KQ3 A;  3D6W A;  3PUV A;  5KND A;  2HCI A;  5ELC A;  5EJW A;  4O1N A;  4HSP A;  1CK1 A;  2TMP A;  1SND A;  5COY A;  1WTO A;  4IUU A;  3NXW A;  3MXP A;  3KUP A;  2VNU D;  2A74 C;  2JYO A;  4H7B A;  4CBV A;  1TR5 A;  2KJX A;  1I50 B;  2BA1 A;  3DWP A;  4G7Z C;  3PIP 3;  3K6O A;  4X3U A;  1KDC A;  1F9S A;  2EYP A;  3ND9 A;  3X3M A;  4IN3 A;  1GOZ A;  4ZAI A;  4KN7 C;  5C3E B;  4PMB A;  1RTN A;  2PCF B;  1HPC A;  3MXN A;  2RSN A;  2V4D A;  1DOL A;  4R8I A;  4KK7 A;  1MGS A;  1STB A;  2ENB A;  3Q23 A;  5E3F A;  4ZK9 B;  3BYT B;  4XTC S;  2XWB B;  5IOC A;  1R9T B;  3SK6 A;  2SOB A;  4QB4 A;  1EL0 A;  3DEO A;  4KD3 A;  2O5I C;  2MJ8 A;  3M85 A;  5BN5 A;  2KED A;  1IHZ A;  3DWQ A;  3NSW A;  3LNN A;  2MUY A;  1SYB A;  1GUN A;  1JB3 A;  5IGD A;  3HKZ B;  4K5V A;  1CT1 D;  5CV5 A;  2EJG C;  3M4O B;  2IPK D;  1H9R A;  1ONL A;  4DAP A;  3KLR A;  5A2Q L;  3L3O C;  1ENF A;  1S5F D;  3TP5 A;  2NBF A;  3C3L A;  1HTL D;  3AU7 A;  1DJR D;  4I65 A;  4UAI A;  3BZD B;  1WTX A;  1TU2 B;  4IQZ A;  4LJZ C;  3NHH A;  1NR4 A;  1TS5 A;  2PQE A;  3HEJ A;  4OHJ A;  1K8M A;  1SNP A;  2EYM A;  1B4O A;  4U68 A;  1TWA B;  3QOJ A;  3S17 B;  3P20 A;  1WTP A;  1VMP A;  5C4Z A;  1NUC A;  3OSO A;  3GTJ B;  1AZP A;  3N6R A;  4IUT A;  5IGC A;  1PRT B;  1PZJ D;  3R3O A;  2YU9 B;  2G9D A;  5LHY 1;  5FK9 C;  3BVZ A;  4OO1 H;  4FYD A;  2EVB A;  3O13 A;  1JWU D;  3S15 B;  3C1E A;  4DNR B;  4KKT A;  2L12 A;  3A8K E;  3QOL A;  3K5N A;  1CA5 A;  2JEB I;  3JAM L;  1ZXT A;  2CQA A;  4PNY A;  5C4H A;  1JC7 A;  2Q8I B;  1SSO A;  1SYD A;  1XXG A;  1EZ6 A;  2EE1 A;  3VR2 A;  4M1U B;  1RCV D;  5D65 A;  3PIO 3;  1U9R A;  1G2T A;  3IAY A;  2OF1 A;  5IGF A;  3K5L A;  2I07 B;  1EIG A;  4TQU S;  1LT4 D;  3C1F A;  5F2D A;  2M2L A;  4J6H A;  4TRD A;  4DGZ A;  3P75 A;  3GTK B;  1AW7 A;  2K28 A;  3VYS A;  1QG7 A;  1CFM A;  2D9U A;  3VR5 A;  2O5J C;  1SMY D;  4A3F B;  1I6H B;  2XRS D;  2HQE A;  4C1N I;  1CTM A;  4MN3 A;  4XDX A;  5CV8 A;  1C8C A;  2E2J B;  1JOQ A;  2DY8 A;  2RA4 A;  2SEB D;  1PRT D;  1ZKO A;  5M5W B;  3J7A V;  2R92 B;  3Q0A A;  2F4I A;  3D31 A;  3TME A;  3TZD A;  3T53 B;  2NVQ B;  5M5X B;  4HAE A;  2J7Z A;  2EDG A;  1SBB B;  1G6Z A;  5DEH A;  5C6A A;  2ICE C;  5ELB A;  1YNN C;  3CKI B;  1WTR A;  3K5O A;  1B44 D;  1YNJ C;  5I2Y A;  2X6G A;  4OO1 G;  3S2D B;  1WVL A;  4RHS A;  1KDB A;  3DXJ C;  1GUO A;  2KUM A;  4G7O C;  3S1R B;  4XT1 B;  4ZYS A;  4C3J G;  4FP5 D;  4HED A;  4AYB B;  2EYH A;  4FNF A;  3IFT A;  3HRZ C;  1QNU A;  2F0V A;  1EY6 A;  1I4P A;  1KNA A;  2IJ0 A;  3MXU A;  3D8G A;  4NP5 A;  4YIJ A;  2F1M A;  1OO9 B;  3KLS X;  4B08 A;  3FDT A;  2JP1 A;  2XIW A;  2EYJ A;  5G3L F;  2ZXO A;  4DXF A;  5EBD A;  4O42 A;  1B3A A;  1BCP D;  2EY2 A;  2CVR A;  1WTV A;  1S4Z A;  1PZI D;  2F0W A;  3EJI A;  2JA8 B;  3DMU A;  3HGB A;  1VMC A;  1Q1E A;  4I7Z C;  2PW7 A;  1PFB A;  1EWH A;  1PZK D;  2B2V A;  3HP3 A;  2CHB D;  1NR2 A;  4WFN 3;  1TS2 A;  3FRP B;  1F9Q A;  1GHJ A;  3ERQ A;  3D4R A;  5C0X J;  4HCS A;  1KAB A;  2JE6 I;  2JA6 B;  4RFB A;  4F7X A;  3DM1 A;  2K1B A;  4EQN A;  3PMF A;  5JVG 3;  2FMC A;  3AMU A;  1F77 A;  1LAB A;  1RF2 D;  4DXG A;  1OXT A;  1Y1W B;  1S5D D;  5C0X H;  1SAP A;  1XWE A;  1BF4 A;  1SNO A;  3Q6S A;  3I73 A;  2EYL A;  3T4A C;  2R61 A;  3PUZ A;  4CHT B;  1SJE D;  2EZV A;  1TII D;  2A5H A;  4OIJ A;  5C3W A;  3Q22 A;  5M3F B;  3P7J A;  1GHK A;  1HA6 A;  2LMC B;  4KY7 A;  2Z4H A;  2FIN B;  5KNB A;  2RSO A;  2BE5 D;  2HUG A;  3J80 L;  4A93 B;  3UI2 A;  5I9O A;  2FFK B;  1LTB D;  4KJO A;  2Q8T A;  3NTK A;  2K6A A;  3U9O A;  2D5D A;  2PW5 A;  5C4X B;  5IT9 L;  3MFY A;  1C48 A;  3CHB D;  2AUK A;  3OOC A;  3T16 A;  4RHR A;  5M3M B;  2KEE A;  5KEE A;  3MTS A;  2WKC A;  3BVG A;  4KHV A;  1V43 A;  4BWG B;  3QIA A;  4C56 C;  1LT6 D;  3BDC A;  2F0O A;  4C2M B;  1UEA B;  1H9K A;  4K5W A;  4KHZ A;  3N52 A;  4L8J A;  3R2T A;  4OIK A;  4V0B A;  3I4M B;  2RKS A;  3H91 A;  3G6J B;  2MPM A;  2RDF A;  2NVY B;  4C3J B;  1G2S A;  3ND8 A;  5CV6 A;  4ZKC B;  1A6X A;  3S14 B;  3BVM A;  3VYR A;  1D1K A;  1HCZ A;  3R8B A;  2DNC A;  4EVO A;  4WOR A;  1EWC A;  4FF4 A;  3OHX C;  2LY7 A;  3OPO A;  1JE4 A;  2X69 A;  2J4X A;  3GTO B;  4OL7 A;  3SEB A;  5K5P A;  1JR0 D;  1Q8I A;  4Q0F A;  5A2Q E;  1DYQ A;  1CA6 A;  3NQT A;  4FF3 A;  3S1N B;  2WB1 B;  2M00 A;  5IIF A;  1HRJ A;  5C0X G;  3ERO A;  4H0L C;  4CKC A;  2DY7 A;  2IL8 A;  2IX0 A;  2KOL A;  5JVH 3;  1HA5 A;  2AWN A;  1ZYR C;  3H09 A;  5LL6 S;  2B2U C;  5EPK A;  3GV6 A;  2K5W A;  1B9M A;  5D3I B;  1JIC A;  3C2P A;  4RA8 A;  1CHQ D;  1T5E A;  2OT2 A;  2PZW A;  4WJW A;  4EGV A;  1GUT A;  1XYI A;  1ENA A;  2EYF A;  2EXZ A;  3J81 E;  1LTI D;  3W2D A;  4IUN A;  4BS9 A;  3VA5 A;  5DM6 3;  4NMZ A;  2KHS A;  2FMM A;  4X3K A;  4ZUI A;  4ID6 A;  2A68 C;  2Z8L A;  2B63 B;  4BA1 I;  3SDZ A;  3I91 A;  3I3C A;  5ISR A;  3S1Q B;  5J1Z A;  3K58 A;  1LO5 D;  3NP8 A;  1H9J A;  4BBS B;  3U9S A;  3BS1 A;  3E5S A;  3HOV B;  1H9S A;  3WDN A;  1TWC B;  5K36 H;  1MSG A;  1VCI A;  1QCB D;  5I9P A;  3L9A X;  5CMD A;  1VDZ A;  2F0F A;  2L1B A;  2QCP X;  3HOZ B;  2WV6 D;  3SVM A;  4K8J A;  1DON A;  4CJ2 C;  1I4H A;  4P2C B;  1QNK A;  2EYO A;  2B2T C;  1X32 A;  1HXY D;  1RKN A;  1EFI D;  3QWN A;  1O7Y A;  1L0Y B;  3V05 A;  4A3K B;  1HFN A;  5KNC A;  2WP8 J;  2RDH A;  1EIH A;  4R8N A;  1IYU A;  5T1G A;  5EKI A;  3TP6 A;  5FOB B;  4X3S A;  5ELE A;  1OXV A;  3M3Y B;  5JJZ A;  1JWS D;  4M8A A;  1IL8 A;  4Z9C B;  5CBE E;  1U4L A;  5C5M A;  4IFD G;  4A3M B;  4KY6 A;  3PO3 B;  2A6E C;  1I6V C;  4Q5V A;  3KLS A;  4K2K A;  2BCO A;  3HG9 A;  5JOB A;  2EY1 A;  4RGM A;  1PTO C;  4U67 3;  5FKA C;  1SDF A;  2PO4 A;  2R6G A;  1KLU D;  4A3G B;  1QE6 A;  1XX8 A;  4XIG S;  2K04 A;  4K8I A;  2PPB C;  3VYU A;  3GTM B;  5CC4 A;  2Y0S B;  1TY0 A;  4LMQ D;  4RWS C;  1CQV A;  3NWT A;  4CKB A;  5FLX L;  4IUR A;  2WKD A;  1ROD A;  3M4Y A;  5K36 G;  4QIW B;  3SHL A;  2EJF C;  4TSS A;  5IOD A;  1F2Z A;  2QEJ C;  5JEA J;  1Y8N B;  2K01 A;  1Q1B A;  3FEW X;  3HOU B;  1PTO H;  3H6M A;  4WRD A;  3D3R A;  4FF1 A;  5CV4 A;  4BBR B;  4IUP A;  4ZUJ A;  4HTH A;  1DXM A;  1LT5 D;  2IWH A;  3K57 A;  1GUG A;  5JEA H;  1DZ1 A;  4A3D B;  2NN6 H;  4IUQ A;  2RVL A;  2B2Y C;  1B50 A;  1GJX A;  1DD2 A;  1ZEQ X;  1G91 A;  1JWM D;  2HDL A;  1HFG A;  2B39 A;  3W3A A;  1LTT D;  3R93 A;  3OIQ A;  1M8A A;  1AN8 A;  1MD2 D;  4ME5 A;  1HTP A;  2F0K A;  3GTL B;  2X6L A;  4RKL A;  4ULL A;  2B8F A;  3S1M B;  3SXH A;  1IKM A;  1LTR D;  1D5X C;  3MA2 B;  3TSS A;  4CGY B;  4H44 C;  4BY1 B;  2F0E A;  4MHE A;  3CQZ B;  3NE5 B;  1LTA D;  4FXG C;  1OXS C;  3FKI B;  5AFW A;  1F9R A;  2NTT A;  5BN3 A;  1PFM A;  3MEH A;  1BNZ A;  2IW3 A;  2SDF A;  2EY6 A;  4ODG A;  2B2W C;  3A7L A;  1EY4 A;  3GO5 A;  4LK1 C;  3MFG A;  3RZD B;  3KF8 A;  3RLF A;  3PUW A;  2IX1 A;  2TSS A;  1AFP A;  5IT9 E;  4HMJ A;  4G4K A;  4HR7 B;  1QOH A;  5JPN C;  4UDU C;  2QDB A;  4KD4 A;  4H13 C;  5IGE A;  1S5B D;  3VYT A;  1CI3 M;  1FNV A;  1ET6 A;  1DOK A;  1NAP A;  1H9S B;  1HQM C;  3S9W A;  2E75 C;  1QJO A;  3OMG A;  2KEC A;  2F3W A;  5LL6 X;  2Z4I A;  3AB9 A;  1HUM A;  1T5X D;  4XQQ A;  2A6H D;  3OWE B;  2JA5 B;  2NN6 G;  4DK0 A;  1CM9 A;  5C44 B;  2O2L D;  3NTI A;  4B9X A;  4IFD I;  2DN8 A;  2PYK A;  1SEB D;  5JAV A;  1SYF A;  1EEI D;  1U4R A;  5D14 A;  4K6L A;  4DF7 A;  1PXU A;  1K83 B;  3MVV A;  1ILP A;  4TKO B;  1R4P B;  1UAP A;  1SMY C;  1S5E D;  2WIN B;  3BDO A;  3D4W A;  1IKL A;  4K14 A;  2JEA I;  2IX3 A;  1QB5 D;  3WOF A;  1PRT C;  1WD0 A;  1B53 A;  4LAA A;  2L55 A;  3A8I E;  3V96 A;  3VA7 A;  2E2H B;  2EY5 A;  1E2V A;  1I3Q B;  5HGT A;  1IW7 D;  2L4N A;  4C1N K;  1ICW A;  2YYZ A;  4ZLT F;  1AZQ A;  3HOX B;  1MI2 A;  4E6I A;  3IFD A;  5IGG A;  2RBM A;  5I6W A;  2MP1 A;  2NVX B;  3M7G A;  4FXK C;  1C4Q A;  4Y7N B;  1TKW B;  3KK7 A;  2OXP A;  5G3L D;  4DN4 M;  2G9H D;  5I4D A;  1STH A;  5EPJ A;  1AEX A;  1ENC A;  3C46 A;  1STN A;  3MZ5 A;  3TDQ A;  1O7L A;  4PV1 C;  3MAQ A;  1WTQ A;  4QUF A;  1STG A;  1BOS A;  3FPP A;  5ELF A;  2XVS A;  4PMW A;  1X3P A;  5J39 A;  4NW2 A;  4S3S A;  5FO8 B;  2BDO A;  1PTO B;  1QWY A;  1BCP C;  1PTO F;  2Z1C A;  4J8Q A;  1A15 A;  3VR4 A;  2VB2 X;  1F2L A;  1M4V A;  3GD7 A;  1FGB D;  1A3T A;  4G57 A;  1A3U A;  5CR3 A;  4XXE A;  5KRU A;  4DA2 A;  1QIL A;  2JA7 B;  5FO7 B;  2NWG A;  3LWE A;  2NYZ D;  1K8O A;  3KBG A;  3OIP A;  1BXT A;  1G8Z D;  1GXD C;  1KNE A;  4RGT A;  1H9M A;  5D3D A;  2AWO A;  3TBI B;  2K5Q A;  1CQF A;  4RAU C;  2WAC A;  1EY0 A;  1V1O A;  1J9O A;  1WD1 A;  1LV9 A;  5C4J B;  4OO1 I;  1SNC A;  2Q8R E;  4A3I B;  3I90 A;  1MSH A;  2GA4 B;  4A3J B;  3QG1 A;  3URY A;  1SYC A;  3H94 A;  2BE5 C;  1D5M C;  4IUV A;  3RMH A;  1DCZ A;  1E0B A;  2N88 A;  2HDM A;  4HCE A;  3I70 A;  4K2L A;  1TWG B;  1TS3 A;  2K05 A;  1LAC A;  1FNU A;  1II3 A;  2LKV A;  3E6Z X;  1V1P A;  3G7L A;  1JQY D;  2DNE A;  3I72 A;  2F0N A;  5KYL A;  5E4W C;  1SXT A;  4K6D A;  5COR A;  3MXG A;  3VR6 A;  3BG3 A;  2J0T D;  2ID0 A;  4BY7 B;  2ZT9 C;  3JAM E;  1AP0 A;  2KCC A;  3SK5 A;  4DNT B;  3EFX D;  3J7Y W;  1E2W A;  1KLG D;  2MHV A;  3MHB A;  1D2B A;  1FNW A;  2PNR C;  4RH6 A;  1ET9 A;  4JK1 C;  2XSC A;  2ZXP A;  3K59 A;  4J1M A;  4C3H G;  3S16 B;  3NPP A;  1Y1V B;  3A8J E;  2XRQ D;  4FF2 A;  4ABN A;  2QF7 A;  3D6C A;  3QB3 A;  5CGK A;  1BUV T;  1PMR A;  2B2U A;  4RCO A;  1EYC A;  4DK1 A;  1ML0 D;  1I4G A;  4B9W A;  1Z6H A;  3MC0 B;  4FO2 A;  2FHT A;  2F03 A;  1B9N A;  1KDA A;  1WTW A;  5C5L A;  5M5Y B;  1VF5 C;  1EU3 A;  4IAL A;  2HCC A;  2XNA C;  1EY8 A;  3H0G B;  1HQR D;  1EYD A;  4C3I G;  2E74 C;  5M9O A;  1EYA A;  3LWU A;  5CYU A;  1S5C D;  4CJ1 B;  1ESR A;  1SE3 A;  1WCM B;  2AUJ D;  3ZYY X;  3DWA A;  2F0I A;  2VB3 X;  3EVQ A;  1HUN A;  2M9V A;  4KJN A;  4ZKB B;  2PZU A;  1SE2 A;  2AQ2 B;  2NVT B;  4XQN A;  5EBC A;  1Q3L A;  5EPL A;  2LFN A;  2QIL A;  2N55 A;  1ESF A;  3P1H A;  5C3X A;  3I4L A;  3I8Z A;  1A2U A;  3A7A B;  2F0T A;  3K7A B;  2L11 A;  1SNM A;  3OWF A;  4F87 A;  4RGN A;  3RD4 A;  1PFN A;  1KTK A;  2B2T A;  1E2Z A;  5TSS A;  3IL8 A;  4XYQ A;  1FR3 A;  1RHP A;  4JBW A;  3J7A F;  1BO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...