2QDBA

Crystal structure of staphylococcal nuclease variant e75q/d21n/t33v/t41i/s59a/p117g/s128a at 100 k
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
125
Chain Sequence
b'KLHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIPYGPEAAAFTKKMVENAKKIEVQFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQHLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Electrostatic effects in a network of polar and ionizable groups in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 125
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qdbA00
3DMUA 2F0KA 3NXWA 2RKSA 1EY4A 1SNPA 2EYPA 3NHHA 4QB4A 4QMGA 2KHSA 1SNQA 3NUCA 4QF4A 4YIJA 5C4HA 1JOQA 3P1HA 5CV6A 2F0SA 2M00A 5CC4A 5EGTA 2F0TA 3S9WA 5IGCA 4G57A 1STNA 2EYJA 5I9PA 1EYCA 4N9PA 5DEHA 5F2DA 1AEXA 4NDXA 3BDLA 4K5VA 4KD4A 2PYKA 1SNMA 3TMEA 1EQVA 4EVOA 4K8JA 4KV6A 2PZTA 4B9WA 2F3WA 3C1EA 3E5SA 3NP8A 3OMGA 5EKKA 4ID6A 3EVQA 5CV8A 4DFAA 2LKVA 1A3VA 1NUCA 4EQPA 1A2TA 2EYLA 1EY5A 3NK9A 1SNCA 4I65A 5IGEA 2EY5A 4RKLA 4F8MA 4NP5A 3H6MA 1A2UA 2F0JA 2F3VA 3MXPA 4ZQ3A 3ERQA 5C5MA 2F0NA 5IGFA 5KGUA 5CV9A 2O4XA 5IGDA 1STBA 5C5LA 2EY2A 3SK8A 1U9RA 1JORA 3U9OA 3D6CA 4PMBA 1KDCA 1STHA 1SYDA 2F0PA 2F0MA 4RKBA 3SK5A 5IODA 1NSNS 2EYOA 4WORA 1EYDA 5CV7A 1EYAA 3DHQA 2RDFA 5J39A 3TP7A 1A3UA 4NMZA 4J6HA 5C6AA 2F0UA 3EJIA 2ENBA 1SYBA 4H7BA 4LAAA 4N9TA 3TP8A 2OXPA 2F0OA 2PZWA 4DGZA 1TT2A 1TR5A 5NUCA 1ENCA 1ENAA 5C3WA 4KD3A 1IHZA 1JOOA 2PW5A 4ME5A 4MIUA 3OSOA 2HQEA 4ZUIA 1F2ZA 3BDCA 3C1FA 2F0QA 3D8GA 4EQNA 5KRUA 5ISRA 4DU9A 3P75A 5HURA 4IALA 5J22A 4K2LA 4B9XA 3SK4A 2PZUA 2PQEA 1RKNA 1EY0A 1SYCA 5HGTA 4KY5A 5C4ZA 1KDAA 2PW7A 2WACA 3D4WA 1EY9A 2F0GA 5CGKA 4KJNA 4IZ8A 3NQTA 3MZ5A 3MVVA 3SR1A 5IGBA 4HMJA 4DF7A 2F0EA 3PMFA 2F0HA 5CR3A 3RUZA 3EROA 1EY6A 1KDBA 2NUCA 1F2MA 3QOLA 1SYEA 4J1MA 4K5WA 2RBMA 1A3TA 5K5PA 4E6IA 2F0VA 5KEEA 3SXHA 3MEHA 1TQOA 4KTAA 4NKLA 1STAA 4ODGA 5EKLA 4KHVA 5KYLA 4HTHA 2QDBA 1KAAA 3HEJA 4TRDA 4WRDA 5JOBA 5I6YA 5E1FA 5IOCA 1EZ8A 2EYMA 5KYIA 5J1ZA 4HMIA 5DAUA 2OEOA 4K2KA 1SNDA 3V2TA 2EXZA 4K6DA 5I9OA 3LX0A 2EY1A 2F0DA 2F0FA 4K14A 3QOJA 4R8NA 5CV4A 3T13A 2F0WA 1F2YA 3D4DA 4KY7A 4ZUJA 1II3A 1SYFA 2F0IA 4K8IA 3MHBA 2SOBA 5IGGA 1EY7A 4OL7A 1STYA 2EYFA 2F0LA 2KQ3A 2OF1A 2SNSA 4PNYA 1SYGA 3TP5A 1EZ6A 1EY8A 5CV5A 5C3XA 1STGA 4KY6A 3T16A 2EYHA 4K5XA 3SK6A 1KABA 3TP6A 5JAVA 2EY6A 3OWFA 1JOKA 4KJOA 3SHLA 3OMCA 3ITPA 4F7XA 3HZXA 5E3FA 4EQOA 5I6WA 5M9OA 4S3SA 1SNOA 5IIFA 4PMCA 4IUNA 3R3OA 3VA5A 3QB3A 2SNMA 5KIXA
chains in the Genus database with same CATH superfamily
2IX1A 2E2HH 2B2VC 1CI3M 3K5NA 1X65A 3CU7A 4C3JH 2PMZB 2XSCA 3GO5A 2VQEL 4QGUA 4A93H 5T1GA 1F2LA 4ZYSA 2Z4HA 1WTHA 1N34Q 4YHHQ 2UUAL 3NP8A 3HKZG 2O5JC 1A3VA 2JA9A 4HR7B 5IGEA 4Y7NH 2EY5A 1X3PA 4ZQ3A 4C3HB 3RD4A 2F0NA 5BR8L 1EIGA 3W1BA 4ZRZA 1GM5A 1KRTA 2K5QA 3HOVG 2MHVA 2NVXB 1LABA 3DHQA 1LM0A 1GKHA 1HQMC 1JQYD 4HJ7A 3G7LA 2KHIA 3PO3B 1C48A 4DV2Q 3F2DA 1W2BA 4WJ4A 2ZJRA 1GUWA 2OQ0A 5M5WB 1F2ZA 1XTCD 2DNCA 3KFUA 3IRBA 1I6VC 1RHPA 5LMUQ 1VQ5A 1JWUD 2PZUA 4DR5L 2I5HA 3UDXA 1SYCA 4A3DB 4XTCS 3F2CA 4NXNL 1EQQA 1A0IA 4FF3A 1LT5D 2TSSA 5CR3A 3PF4A 1HHVA 3E0JA 1BCPB 3AU7A 2I0QA 1PMRA 3NBIA 2F1MA 4DR1L 1C4QA 3PQIA 1ET9A 1C0AA 1QNKA 3JAML 2E2DC 4L5TA 3JAMi 3CCVA 2BE5D 2QGQA 3GTLH 2MJ8A 2PO4A 4HJ9A 1YNJC 1QUQA 4X65Q 4A3IG 5CV4A 1XPOA 1O7ZA 1J8IA 1NCVA 1BNZA 2PI2A 3STBC 1XXGA 2SOBA 1EWIA 4UAIA 1E1OA 3S1MH 1VQ4A 1SMYC 1SJHD 4C1NI 4JI7L 1PFSA 1HUNA 1V8QA 4A3CG 1HCZA 4CBVA 4KLKA 1ESFA 3U4VA 5KNCA 3LWUA 1U0LA 5EPKA 3K5MA 1L1OA 3PV0A 3S2DH 1EOVA 1I50B 5D3DA 4BY1G 2CWPA 2E5LL 4JBMA 1B4OA 5M3MH 1PFNA 2FMMA 5GAHC 3F2BA 2F0SA 5CC4A 1LTTD 1AW7A 4LNQA 3AYHB 1E2ZA 4RGMA 3VR3A 1PH8A 3BS1A 5IY0A 2EQSA 1I4PA 1SJED 2A68D 3VR6A 2HCIA 2VQFL 1AN8A 5LMNQ 2K33A 4OO1H 3HOVB 1L0XB 1I6HH 2GVAA 5M5XH 2K1BA 1O7IA 2Q8RE 2EY2A 2SEBD 2CH4W 1I3QB 1MD2D 2KCMA 2RHSB 1YZ6A 3GTGB 3TP7A 3JAME 3GTJB 1O7LA 4P72A 1VQNA 3HG9A 2N8NA 4MNOA 3DWAA 1NY4A 4V0BA 2WKDA 4GNXB 4RH6A 4ME5A 3FPUB 2D0OA 2LFNA 1R9TH 1RDPD 4POGA 3H94A 4K2LA 4O0AA 1BUVT 4B9XA 1SMXA 5EPLA 2L11A 3CF5A 2FHTA 1VQ7A 2H5XA 3MZ5A 2CH4A 1XNRQ 2ES2A 1VQPA 1B9NA 1XPUA 1F9QA 1G8ZD 3HOZG 3DEPA 3NWSA 3WOEA 2L15A 3K7AH 4OIKA 4A3IB 4IFDG 2RDHA 4AQYQ 4I7ZC 3OYYA 2NZ1D 4B3TQ 1B53A 1EZ8A 3E9HA 4CDDC 2EOTA 3ULLA 3V2TA 4A93G 3J81c 2F0DA 5A2QL 1DZ1A 2QEXA 2WAQE 3FP9A 1ZXTA 2B8GA 4O2DA 2KUMA 1QB5D 4PNYA 1S5DD 1H9MA 5COYA 1MGSA 4JI3L 3G6EA 1EQRA 2BH8A 2JA7B 3SK6A 1XMOL 4GKKQ 4JI5L 4BY1B 1SE3A 2L4NA 3OHXC 3H3VH 4JI6L 2R92H 2FJ2A 4XQNA 1YIJA 1SNPA 1JOQA 4A4IA 4GNXC 2KEEA 2K4KA 2AWOA 1IBKQ 2F0TA 2MFIA 2IY5B 1FR3A 1YEZA 4DUZL 2JJQA 1KQSA 2CQOA 3I4MG 4LWCA 3FEWX 2B63H 1HPCA 3K0YA 5CV8A 4PV1C 3P7JA 1MHWC 1A2TA 4DAVA 4F8MA 4IURA 2VNUD 1MJCA 1I4RA 1KRSA 2PMZE 1AZQA 2UUBL 1JORA 4DR7Q 2F0MA 1K8AC 4JI4L 3U50C 1V1OA 3S24A 4HIMA 3S15B 2JQOA 3I7FA 1XTDA 4F87A 1X3QA 1SYBA 4GOPB 1GHKA 4IN3A 3A5ZB 4BY7H 1NMGA 5EKIA 2XGTA 5A2QE 1JE4A 4KD3A 1QNUA 1EIFA 1F9SA 1GUGA 1SROA 4DR6Q 1CZGA 2LS01 1TWAB 4KN4C 4V190 5JEAH 4JI8Q 2AQ3B 4A75A 4XT1B 2UU9L 1G6PA 2VL6A 4JYAQ 3KLWA 3K81C 5IGBA 1D5MC 2A69D 2K32A 3RZOB 4XYQA 1YI2A 4DUYQ 2RBMA 5JEAJ 4DR2L 3MEHA 5KYLA 1X6OA 1UWVA 2Y0SG 2SDFA 1YJWA 4HTHA 1B50A 4RGOS 3C46A 2I5LX 1EFWA 2JA8G 1K8MA 3CMAA 3KUPA 3OWEB 1XX8A 2F0FA 1LLRD 4R9WA 1JB7A 2X6LA 4U673 1VQDA 1PH6A 3RLOA 3W5OA 3J7YW 3FDTA 4B3SL 1U4LA 4K8IA 3NENA 5C44G 1F77A 1YNXA 3WOFA 3KJPA 4PZ6A 4OO1G 4L63B 1PLFA 3HOWB 1ENFA 4ZKBB 2B8FA 1HUMA 4LUVA 5I6WA 3PIPA 3M3YH 4DXGA 2E8GA 4LF7L 1Q46A 1Y1WB 3CHBD 4GOPC 5JVH3 3HOXB 1ILQA 4H0LC 4QMGA 1S72A 2A5HA 3I4MB 1IL2A 1L0YB 1Y8NB 5GADC 1VQIA 2RQXA 4N9PA 2YV5A 1AP0A 4A3BG 3VR5A 3M4YA 5GAEC 1TS3A 3GTPB 5EKKA 4LFAQ 2K7VA 1HR0W 1XNQL 1QUQB 2NN6H 3BZDB 1WTXA 1CSPA 4IPHA 1SE8A 5GAGC 3D31A 1U4RA 4IUPA 1A6XA 3TDQA 4JI2L 4DV5Q 3B6YA 4X3KA 1E2VA 1G6ZA 1YHAA 1IZ6A 1STHA 3I2ZA 2D62A 4GN4B 5AJ3L 1RTNA 1VQBA 2H1EA 5ELEA 2R6GA 1M4VA 5J39A 4NMZA 3HGBA 4J6HA 2ICEC 1A62A 1HTPA 1PTOF 2F0OA 2TMPA 4R4TA 4DGZA 5NUCA 1NR4A 1Q81C 1BDOA 3U58A 5C3WA 3MXGA 4YY3L 2F0QA 2ZTDA 5JJKA 5FLMH 3G48A 4DU9A 3BYYB 3S16H 3S14B 4JPBW 1XPRA 3PIOA 4IPDA 3OW7A 1SR3A 4CKBA 1I5FA 2YTXA 3WWVA 4KJNA 1PZJD 4DF7A 1YVCA 4LF4Q 3K5OA 2JA8B 2WINB 2IPKD 1TQOA 2R92G 4ODGA 2D0PA 2IW3A 3L3OC 1O7YA 4TRDA 1TS4A 5IOCA 4K0KQ 1LTID 5C44B 3X3MA 4MN3A 3A8JE 3CKIB 1B9MA 4AH6A 3UDFA 1BVSA 1SYFA 3MHBA 1YJNA 2F0LA 4M1UB 3J81L 1CA5A 2PCFB 4OONA 2K50A 1Y1VH 3RZDH 4QY7A 3T4AC 1TWCB 1TWGB 2R7ZG 3A7LA 4JK1C 4IOCA 2RF4A 2K5NA 4APVA 1S5ED 1S40A 5IWAL 3MC0B 4A3EH 4A3BB 2KVMA 2RKSA 1DOKA 3J80L 1EEID 2KHSA 3AQQA 3PO2B 4TQUS 4BBSB 5CV6A 2VUMG 2L1BA 3ONAB 2EJGC 5EGTA 5C4XG 3PUVA 1D6EC 4LF6L 4K5VA 2I07B 2X69A 3S1RB 2UXDQ 4PZ8A 1N32L 4A3MH 1EU4A 4UP8A 3KF6B 4NP5A 3ERQA 1VQOA 4FXGC 1YNJD 3TZDA 3T1HL 4WJ3M 1FGUA 3STBD 1J5EQ 3PUYA 1HNZL 4LF8Q 4FXKC 1HNXQ 4HIOA 3I3CA 4GLXA 5FO8B 3TP8A 1HZ9A 1TR5A 4L6TB 1SE4A 4KMUC 2OTJA 1IHZA 2ICIA 4GLVB 3BDCA 3GV6A 3R2IA 4A3LH 4KI0A 1VS0A 3J81E 3RN2A 3ZYYX 1WFQA 4ZAIA 1EY0A 2HD3A 2XVSA 1H9JA 1R4PB 3I4NH 2AUJD 3L0OA 5TSSA 2ZTCA 1P16A 5FLXc 3CCQA 4RCNA 1KLUD 4EX5A 3MXUA 3SE0A 3J80E 1QOHA 4JCVE 2QDBA 1KAAA 5FK9C 1BCPD 4X3TA 4K2KA 5I9OA 2CKZB 3ND8A 5K36H 2UUCQ 1SFOH 2A73B 1YNNC 2UXBL 2Q2IA 1TY0A 1GHJA 2HIXA 3S1NH 2R7ZB 3KLSA 4QL5A 4RHRA 3VDYA 1CSQA 2B3GA 1XMQQ 5D3IB 4KY6A 3T16A 4A3FG 4PQXA 2MO1A 4J15A 4H13C 2VUMB 3U4ZA 2KEDA 3A5UA 3RR5A 5CBEE 4JI0L 5C4XB 3HOYH 4DV1Q 2CCZA 2SNMA 5DNFA 1V9PA 4DXFA 1PXUA 3EA6A 4NXML 2MQHA 3NUCA 4QF4A 2QILA 4KHZA 5DEHA 4P75A 4NDXA 4YCVA 1SNMA 2NVYH 4UHVA 1OXSC 3EVQA 2F4VQ 1DYQA 4DFAA 1NUCA 4WFN3 2YU9H 4RAUC 3MXNA 3H6MA 1H9RA 1VQCA 2L5TA 1E2WA 1X3GA 1SSOA 1U4PA 1PH4A 4BBRB 4UP9A 3U9OA 5C3EG 3D6CA 4B3MQ 4DV6Q 1CKNA 1LACA 4OWWB 1LT6D 4POFA 4LFBL 1LUZA 1A15A 3S2HH 3D3RA 2UXCQ 3NQIA 3P20A 4Q5VA 4GKJL 2PI2E 4N9TA 5M3FH 2OXPA 1N36Q 2JP1A 2PQAB 4N8FA 5IYBH 3C1FA 2AUKA 3QR8A 3R2TA 4EQNA 2HDMA 4O1NA 5ISRA 3AB9A 4C2MB 2XN9C 3OPOA 1TY2A 1VMCA 5LMNW 5ELFA 3M4OH 1NAPA 3DWQA 1BR9A 4IUUA 2K28A 4H02A 2BCOA 3SDZA 3KOJA 1HQRD 3I90A 3EROA 3J7ZC 4DV0Q 4XXEA 1G91A 1JE5A 1WTRA 1AZPA 1NTGA 3IL8A 2HDLA 4LK1C 2V1CC 5KYIA 4DR4L 1WTVA 1OXUA 5J1ZA 1Y14B 1XJVA 1E22A 3N52A 3DM1A 4ULLA 2VZAA 4KKSA 1LTBD 3KJOA 1IBMQ 1PRTF 1GVPA 1B3QA 1M8AA 1CHPD 4A3FB 1OXTA 1S5CD 3GTMB 1LTSD 1II3A 1EY7A 3EIVA 3H09A 4RHSA 2KQ3A 2YYZA 4B08A 5CV5A 1CKOA 1PTOC 4K5XA 5IYCH 4X62Q 2B2WC 1HNWQ 5JJLA 2RCFA 4S3SA 4CJ1B 2ZM6Q 4DR3Q 2JA6H 2NVQB 3VA5A 2A6EC 4X64L 2B39A 1HFGA 2JA5B 2CHBD 4DAPA 5T1IA 1DM0B 2Q2UA 3BU2A 2Z0SA 5FKAC 1LTLA 4QUFA 1F9PA 3W2DA 4EVOA 2MO0A 1VQLA 2Z1CA 3LWEA 3GTOB 1K3RA 4B9WA 2E2IH 2F3WA 1WTWA 1JICA 5C3EB 3ZJYC 1WTQA 1GUNA 1BF4A 2D5DA 4QCLA 1IKLA 1DOMA 2F0JA 4UY8C 5C5MA 4FP5D 1SXTA 1T5EA 1DJRD 4DV4L 1QG7A 3AFPA 4OELB 3HKZB 1WJJA 4DV7L 3OTOQ 1TWFB 5CORA 3I72A 4LAAA 3S17H 1ESRA 1TWHH 4Y52H 4IJLA 4FNFA 3PF5A 4LFCL 4OWTB 3ULPA 5K36G 1RL2A 2ZJQA 3P75A 5J22A 2O2LD 1FJGL 1ILPA 1I4XA 4LF9Q 1CZWA 1HRJA 4LF5Q 2DJFC 2KJXA 1QZGA 3BVZA 5CGKA 1CQVA 5C0XG 2F4IA 1ZKOA 1Q86C 4HMJA 4OX9L 2J4XA 3TQYA 1X3EA 3CMEA 3V96A 5HGQA 2LXKA 1SBBB 3FKIG 1T9HA 5FJ8H 4E6IA 5KEEA 2YTYA 3MFGA 3CRLC 2E76C 5I2XA 1PV4A 4DKAC 3CP0A 3S1QB 4HJ5A 2R93H 1K83H 4MTNA 1X32A 1WTOA 4B3RL 2N49A 2IHEA 2JEBI 1FL0A 1S3OA 2QCPX 5IGGA 2EYFA 2JE6I 1RODA 2WB1E 1WD0A 2NVTH 1FNWA 3TP6A 1YITA 4C3IH 2EY6A 4JC0A 4BBSH 3SHLA 4IPGA 4JV5Q 1EIYB 4DV3L 5JJZA 4IUNA 3R3OA 2MP1A 4C3JG 4XYOA 5IT9c 3DMUA 1EY4A 4CKEA 2A6HD 3UDGA 2R61A 2WP8J 3BZCA 3CC2A 3GTKB 3KF6A 1XYIA 1FYCA 2AQ1B 2K5VA 4A3KH 5M5YB 5ELCA 3I91A 1J9OA 5AFWA 5EJWA 4K8JA 3E9IA 2B29A 4ZLTF 4A3GH 4L5QA 1G2SA 4I65A 3GTQB 1CKMA 4KHPQ 1A2UA 2XWBB 5IGFA 2N78A 2LSSA 1C9OA 4PMWA 3HOUH 4RGTA 1TIID 5FOBB 3M7NA 1DGSA 1HXYD 2RVLA 3TS2A 1EYAA 2QEJC 4QIWB 1IBLQ 1GO3E 1Q7YC 4NB3A 4BXXH 1MBYA 1HR0L 3H0GH 4HCEA 3GDEA 1TT2A 3CAMA 4Z9CB 1E1TA 2PW5A 2RCNA 4X6AH 3Q23A 3VR4A 3L2PA 5GROA 2VQEQ 2I46A 4WJWA 1J6QA 2EVBA 3RN5A 5BN4A 2FFKB 1D5ZC 3FKIB 1BKBA 3D4WA 1EUJA 5KNBA 3SR1A 2UUAQ 3MXNB 5IYCG 3V05A 1WI5A 2F0HA 2DGYA 4IO9A 4O42A 2IHFA 3QOLA 2LMCB 3CQZB 4J1MA 4IJHA 1PA6A 1MSHA 2JA6G 1PRTB 3DEOA 3M7GA 2IJ0A 4KTAA 5LL6S 5BR8Q 3CPWA 1UNSA 4ILWA 1CKNB 1H9SB 2HHHL 2NZHA 2K05A 2PNRC 3UDIA 5E1FA 4HMIA 4UDUC 3VA7A 4MHEA 1F2YA 3HOZB 4R4IA 1NBWA 3G4SA 1VMPA 2E2HB 4M8AA 3KBXA 3K80C 2WFWA 4CJ0B 2E2JH 4A93B 5JAVA 1WCMH 2NBFA 2VW9A 4EQOA 1K9MC 4FDBA 1PFBA 5M3MG 4DR5Q 3KYHC 4JI1L 4LMQD 4NXNQ 3CCSA 3PIP3 3SGIA 4Y7NB 4RCOA 2AHOB 3A54A 4NPSA 1HA6A 4G57A 1I94L 2XNAC 4X66L 4DR1Q 2N55A 1YBYA 3A7AB 4OHJA 5E4XA 4A3JH 1WOCA 1U4MA 1S5FD 1XMQL 4EQPA 2B2WA 3NSWA 1PH7A 1E0BA 1MSGA 4EQ5A 1IL8A 2J0TD 1XWEA 4U68A 3K0XA 1PRTC 5IE8A 2PQAA 2EYOA 1YNND 4WORA 4JI7Q 1EYGA 5EBCA 1N33L 1A3UA 2AQ2B 3G6JB 1HZBA 2D2CC 4C3HH 2F0UA 3MEFA 1L2FA 2K52A 1PH2A 3OIPA 2KOLA 1VQ9A 4LW1A 2BDOA 2HQEA 2R93G 2E5LQ 2VS1A 2NVXH 4HJAA 1BO0A 4IALA 3HKZE 2P5ZX 1OXXK 1IXRA 1SEBD 3SK4A 3HRZC 3PO3H 1RKNA 2IX3A 1UE7A 1X56A 2DJGC 5D14A 3TREA 2NTTA 3A8KE 3NQTA 3PIO3 3GTLB 1PYBA 4C3IG 5M5WH 3HKSA 4EGVA 3RLNA 1MIUA 2VQFQ 4DNIA 1N34L 4YHHL 1STAA 3S1MB 3OOCA 2QDLA 4A3DH 3CCLA 3I4OA 3W1GA 4LUZA 4TVAB 1TVXA 2MPMA 3K57A 1KNAA 4TSSA 3KLRA 3KDFA 4AYBG 3D4DA 3IFTA 4PG3A 4UP7A 2G9DA 3S2DB 2Y0SB 2LXJA 2ID0A 1L0WA 3ERSX 5M3MB 1EIHA 4FYDA 3HOUG 4CDFC 4DV0L 1N8RC 5EPJA 2JA5H 4ME3A 4KJOA 4DV2L 3GV3A 4Q0FA 2A8VA 4H44C 2EYPA 5C4HA 5IP9H 5LMUL 4HIKA 4JOIA 1I6HB 3FVQA 4RG1A 5M5XB 4HJ8A 2B63G 1HJPA 3EN2A 4CKCA 3J81i 3DM3A 2Z8LA 3E5SA 1EEFD 2HQLA 3OMGA 2BA0A 3I73A 4KK7A 1I50H 2CVRA 1VQHA 2XRSD 2EYLA 1CA6A 1OTCA 1FGBD 1SAPA 1IYUA 1U9RA 1B70B 2EXDA 1SYDA 3J80i 5LL6X 1R9TB 4R4OA 1SRUA 3E3XA 3JAMc 4JI3Q 3A0JA 3CC7A 4X65L 2VB2X 1T5XD 1RTOA 4BY7G 4XT3B 1XMOQ 3MWYW 4JI5Q 3HOVH 4ALPA 4H7BA 3E0EA 2K01A 2WV6D 4L5SA 2ALYB 2QW7A 1JCKB 2VY3A 2G5DA 2HT1A 4JI6Q 1I3QH 1YHQA 5JEAG 4FF1A 2WAQG 1BCPF 3AFQA 3K5LA 5HURA 1W6JA 3GTGH 3CW2C 3GTJH 3K7AB 4KN7C 1MJEA 4DUZQ 1X3FA 2PW7A 1QCBD 2WACA 1C7YA 1UE6A 3AMUA 5C4JB 3F1ZA 5E4WC 5E7NA 5IP7H 1SMYD 4HCSA 3IKJA 1GUTA 5ELOA 1Y69U 2ZT9C 1EY6A 2IT1A 5EBDA 3TRZA 1ICFB 5EKLA 4KHVA 4DK1A 2UUBQ 3PUXA 4WRDA 3HEJA 4AYBB 1DOLA 3CCEA 1LYLA 4K6DA 2KCCA 3VR2A 1B3AA 5LMNL 4JI4Q 2HIVA 3QJYA 3QOJA 4R8NA 1DONA 3ND9A 1JJGA 4GLAC 2XTIA 4A3IH 1PH1A 2R92B 1KL9A 2L12A 4OL7A 1EL0A 4TKOB 5G3LF 1SLJA 3KF8B 1NNXA 1S4ZA 1Z6HA 4A3CH 2B2UC 2KCTA 4L5RC 2UU9Q 2EDGA 1TS2A 2B63B 2IX0A 3MAQA 3RLFA 5DLQE 5CBAE 3F2UA 3KLSX 4PZ7A 4C3HG 3P1HA 2JA7H 4BY1H 3S9WA 2NN6G 4DR2Q 3TMEA 1EQVA 3TN2A 4CJ2C 3I56A 5FO9B 5L37A 4KV6A 2K14A 2GN5A 1XNRL 1OXVA 1EY5A 1FNUA 2B2TA 2KENA 4YWMA 3MXPA 2QF7A 4AQYL 1Q8IA 4MZ9A 4BY7B 4B3SQ 1TS5A 4B3TL 1K0RA 3O13A 1UE5A 5IODA 1CTMA 2RDFA 4DK6C 1S5BD 2BH2A 1Q12A 2GA4B 4QUCA 5C6AA 2WAQB 4BA1I 1PVOA 5BN5A 2ZJPA 2HUGA 3F8TA 1ZYRC 5FLMG 1Y8OB 2BOSA 3JC66 4A76A 1QZHA 4QQBX 4LF7Q 3H3VC 3OSOA 1O78A 5A35A 2JN4A 2VXWA 4GKKL 2OCEA 3S15H 5I2YA 1D8LA 5I4DA 2RHQB 4FVMA 3T53B 1Q82C 1PTOB 3CCRA 2BDNA 2A1AA 5FO7B 1R4QB 3T56B 1H9SA 1JJCB 3PGZA 3PMFA 1XNQQ 4DAMA 1IBKL 1HFNA 4G4KA 1TWAH 2PNHA 4JI2Q 1K0SA 3SEBA 2CQAA 3QO2A 4GN5A 5D65A 5JOBA 2OEOA 5AJ3Q 4IFDH 1QVCA 3CPFA 3N6RA 3EFXD 3RZOH 1ONLA 2F0WA 3M3YB 4DR7L 2F0IA 2C5CA 2K6AA 1Y1VG 3K59A 3SVMA 3E6ZX 1YHBA 4IFDJ 1I4GA 4YY3Q 1QVGA 1Z9FA 2EPBA 4XQJA 3ITPA 3G71A 4A3EG 2XIWA 2E75C 2K04A 4PMCA 2QKIC 4DR6L 5BN3A 2Y0SE 4QB4A 5HY6A 4RGNA 4JI8L 1STNA 3HOWH 5I9PA 4A3MG 1A63A 1SDFA 2B2YA 4JYAL 2PZTA 1PH5A 4GS3A 1Y1WH 3UI2A 3HOXH 4DAYA 2KBNA 3KDFB 1W6KA 4DUYL 1BXTA 1AE3A 4J8QA 1LTGD 1VQMA 3I4MH 2F3VA 1KAWA 2L9HA 3IFDA 1D1KA 5C5LA 5IP7G 2DUDA 3ULJA 3GTPH 3CCJA 1VQEA 5C0XI 1K3BC 3S16B 5CV7A 1VQAA 4DPGA 2XRQD 3VYSA 1Y8PB 5CYUA 4P74A 3DLLA 3HS0C 1K8OA 1CT1D 4GN3B 1QILA 1X54A 4A3LG 1DCZA 4MIUA 4ZUIA 4CHTB 5IWAQ 1GJXA 1LT3D 1RD9D 4P73A 3Q0AA 3OW2A 4LJZC 3MA2B 5ELBA 4JG2A 2K03A 3I4NG 2RDGA 4KY5A 4LF6Q 1FNVA 2RSOA 4X3SA 2K5WA 1N32Q 1NE3A 1Q1EA 3RUZA 4HAEA 2Q8IB 1PDQA 1STEA 3S14H 2FINB 1TKWB 2F0VA 5KNDA 2D9UA 2F03A 4L8JA 4IFDI 1W3SA 3T1HQ 4LFAL 2X6GA 1KXLA 3C2PA 2JA7G 1KNEA 1V43A 1ZEQX 1Y1VB 2EXZA 3RZDB 1OO9B 1HNZQ 1TXYA 5ELNA 1PRTD 3H91A 5IYDH 1JB3A 1BBUA 4DV5L 2OQKA 5LHY1 2JA8H 3DUZA 3R8BA 1STYA 1UEAB 4A3EB 1IW7C 2ZTEA 5H1SE 1EZ6A 4AYBE 2O5IC 5C44H 1NJIC 3HOYG 1QWYA 1G2TA 3TS0A 4C56C 1JOKA 1VQFA 2N3SA 3CD6A 3EBEA 1PH9A 4CGYB 1LO5D 1BCPC 5FLXL 4A3MB 4RFBA 2G9HD 4YCWA 1WVLA 4HN7A 1JT8A 4OEMB 4BWGB 1VQ6A 2MGSA 4DA2A 2AMCB 4JOIC 4JW0A 1TWCH 2R3ZA 5F2DA 5JPNC 1TWGH 2KA7A 4R8IA 3PSIA 3CCUA 3KBGA 3RMHA 4A3BH 2LKVA 4GZYC 4LF4L 2WIIB 3PO2H 2B2UA 3TBIB 2O4XA 5IGDA 3DXJC 3S1RH 1VQ8A 1HTLD 4PMBA 4OWXB 2UXBQ 4K0KL 1Z7TA 1P8LA 3SK5A 2IL8A 1MI2A 2NTSA 3PCOB 1G51A 1E24A 5M3FG 1M1KC 2CW0C 1N9WA 1EQTA 2KECA 4DNRB 3X3NA 2H4OA 2Z6KC 1O80A 3T1YQ 3HP3A 1GUOA 1PZKD 2ZXRA 5IYBG 1IYJB 1M90C 5DM63 4G7ZC 1PYWD 1SN8A 4JI0Q 1ENCA 5GQOA 4OXPA 4X3UA 3I4NB 5JJIA 2DY8A 3BYTB 3D8GA 2M9VA 4KKTA 5C4JH 4NXMQ 1V1QA 4YWKA 1LT4D 1VCIA 3GD7A 3QWNA 3NWTA 2CWAA 1LTAD 2PQEA 2BA1A 3GQBA 3QIAA 5HGTA 5EQ0A 1DXMA 2EJFC 1BBXC 1KDAA 3D6WA 2FXQA 3BJUA 4P2CB 4XQQA 3AEVA 3NELA 1I4QA 1BBWA 3PUWA 4FO2A 2AWNA 5FLXE 3A74A 2EE1A 1SFOB 3J80c 2UXDL 1QJOA 4I7AA 4FF4A 3DWPA 3S1NB 3HFZB 1KD1C 3LNNA 2EY1A 1JC7A 3NPPA 5DM73 1X9NA 3HOWG 4LFBQ 5ELDA 4YWLA 2IWHA 5JPMC 4JBJA 3BVGA 3KF8A 3A55A 4GKJQ 4BS9A 3L9AX 1E3PA 4HEDA 3HOYB 4DK3C 3A56A 1Y1WG 3CC4A 2R7DA 3HOXG 1J5EL 4CDCC 4ABNA 4LF8L 4OO1I 1HNXL 1STGA 3OIQA 3URYA 1VF5C 3M4PA 3J7A5 4F7XA 5E3FA 4ZKCB 2NVYB 3UE0A 3FMCA 1SNOA 1EOTA 3M4QA 2F0KA 2B2VA 3NXWA 4LUOA 3NHHA 2R7ZH 4R1JA 4IPCA 2YU9B 4ZCKA 3IAYA 4NW2A 2EZVA 2VUMH 2E74C 3I4LA 5C4XH 4RMFA 3C1EA 3CCMA 3M9BA 4C3JB 4DR4Q 3J81j 4FF2A 3S2HB 3NK9A 4IUVA 1V1PA 2B2TC 4IUQA 4MTKA 5M3FB 1YJ9A 2BE5C 2OTLA 4IOAA 3MFYA 1JMCA 3K58A 1GOZA 4AIMA 1EYDA 2K75A 3Q8DA 2UUCL 1D7QA 1CUKA 2ENBA 2L55A 1CK1A 2GVBA 1QE6A 3NBHA 3M4OB 3PUZA 4BBRH 1D5XC 1PTOH 5IYDG 1JOOA 4ZK9B 4X64Q 4F88A 4HSPA 3C3LA 1GUSA 2ZXPA 4DV1L 4DAYB 3NEMA 2C9OA 1EY9A 1B44D 1D2BA 5FJ8G 2F0EA 3VYUA 4K6LA 2OWOA 1KDBA 2NUCA 4K5WA 3H3VI 1Q1BA 1WYDA 4C2MH 4NKLA 3FHWA 2Q8TA 2WKCA 2A68C 3RNUA 2I5MX 2F4VL 4DV4Q 2ASBA 2EYMA 1VDZA 5DAUA 1PHJA 1VQGA 3KK7A 2FMCA 4K14A 4DV7Q 1U5KA 1SE2A 4RWSC 4KY7A 2V4DA 4ZUJA 3I55A 4B3ML 2JA6B 3GP7A 2L0CA 1FVIA 4OGQC 4RA8A 2PPBC 4DV6L 2Z4IA 3K7UC 3PO2G 1EY8A 4UPAA 4LFCQ 4BBSG 1BQQT 1ZYRD 2F3IA 4R4QA 2EYHA 2UXCL 1KABA 3NE5B 1FJGQ 3OMCA 2JK8A 3HZXA 4A3FH 4R4CA 1N36L 3GTMH 1PFMA 1IYVA 3T51B 2JSOA 2E2IB 1WD1A 2Z6BA 3A8IE 1ML0D 1SNQA 4YIJA 4A3KG 3BVMA 4OX9Q 1H95A 3I70A 2A74C 2CFMA 4XDXA 2M00A 1GXDC 1EU3A 5IGCA 4HSVA 2EYJA 2RA4A 3QG1A 1AEXA 1UE1A 1L1OB 4KD4A 4A3GG 1PZID 2B2YC 2NVQH 2DNEA 2K5DA 3CXCA 3L7ZC 2NB0A 3W3AA 1ASYA 1ET6A 1SNCA 4RKLA 5KGUA 3S17B 2MUYA 4YCUA 1TWHB 4B3RQ 3J7AF 3SK8A 1E7ZA 3GTOH 2F0PA 4RKBA 2J7ZA 1AFPA 4BXXG 2A6HC 3H0GG 4IUTA 3K8AA 1CFMA 5C3EH 1IBML 4CDEC 2DN8A 5J3BA 3TZUA 2HCCA 1KLGD 1TU2B 5IT9L 3EJIA 2QA4A 1ASZA 4G7OC 2EIFA 2PZWA 3NTKA 1UUPA 1ENAA 2KCNA 3H15A 1PYSB 4DV3Q 3TSSA 1G291 1MKHA 1K8GA 1JWMD 3BG3A 3NTHA 1KC8C 4X62L 1A8VA 1KTKA 4GOPA 1AH9A 2JXMB 1TWFH 1HNWL 1RIPA 1B1ZA 2ZM6L 4DR3L 3FPPA 4C1NK 2WB1G 1KIXA 2KHJA 2A19A 3MVVA 1JJ2A 1NMFA 2Z6KA 2EJMA 2R93B 1K83B 1F2MA 1SYEA 1PTOD 5K5PA 2XWJB 4IQZA 2Z9HA 1L1OC 1HZCA 2A6ED 1JWSD 2K5HA 2NVTB 3LX0A 4QIWE 4C3IB 1GD7A 4DNTB 1I4HA 1HR0Q 4JBKA 2R7FA 2NN6I 3J7AV 2OF1A 1X55A 1WCMG 2AKWB 3OTOL 3Q24A 3S1QH 3BDOA 1CQFA 5CMDA 1C8CA 1LV9A 3OWFA 2ATWA 4A3KB 2JYOA 1AE2A 3D0FA 4HIDA 1HA5A 3MTSA 3BZKA 2NYZD 3QB3A 4DN4M 2NZOA 4A3GB 5C4ZA 5IT9E 2NWGA 4OIJA 4XIGS 2VB3X 4GNXA 2YTVA 4LF9L 3HOUB 1DD2A 4LF5L 1JR0D 3R93A 4A3JG 1EYCA 4BBRG 2MNAA 1Q90A 1Q8KA 3BDLA 2PYKA 3LGJA 2A69C 2HHHQ 2RSNA 4KKUA 4DK0A 1IKMA 1F9RA 1B8AA 1KHIA 4ID6A 1QVFA 3H0GB 3GTKH 5CV9A 1Q3LA 1STBA 5M5YH 2C35B 1LTRD 1KDCA 2LY7A 1B2TA 1NSNS 1K28A 4JBWA 3UE1A 1IW7D 2Q2TA 1UEBA 3GTQH 1UAPA 2OT2A 3VYTA 3Q22A 1D1IA 1BOSA 2JEAI 1VQKA 4JI1Q 5KRUA 2WB1B 4BA2I 3D4RA 3PO3G 3ER0A 2N88A 4FXDA 3CRKC 4JV5L 1I94Q 4X66Q 2F0GA 2F52A 4IZ8A 1V1PB 1RCVD 3K6OA 1NR2A 1EWHA 3Q6SA 1ICWA 1CM9A 5EAYA 4G7HC 4QJFA 1H9KA 5C0XH 1A3TA 1RF2D 4A3DG 1B7YB 3T1YL 1Z47A 3SXHA 1RJTA 3I8ZA 3FRPB 3FKIH 5I6YA 1VF7A 1VQJA 1HH2P 1HZAA 1SNDA 3VYRA 2E2JB 2Q2HA 3U9SA 4KHPL 5C0XJ 1WCMB 3NBHB 1N33Q 3CQZH 3T13A 4N8X1 2CW0D 1K73C 1EFID 1FD7D 1CHQD 3TP5A 3M85A 2SNSA 3NTIA 1SYGA 2JA5G 3TEHB 5G3LD 5C3XA 1IBLL 2DY7A 3ICEA 4P71A 5JVG3 1PH3A 1WTPA 2M2LA 4A3JB 1EWCA 3EQLC 3HOZH 5M9OA 5IIFA 2ZXOA 5IP9G 3WDNA 4JVZA 5KIXA
chains in the Genus database with same CATH topology
2IX1A 2B2VC 1CI3M 3K5NA 3CU7A 2PMZB 2XSCA 3GO5A 5T1GA 1F2LA 4ZYSA 2Z4HA 3NP8A 2O5JC 1A3VA 4HR7B 5IGEA 2EY5A 1X3PA 4ZQ3A 4C3HB 3RD4A 2F0NA 1EIGA 4ZRZA 2K5QA 2MHVA 2NVXB 1LABA 3DHQA 1HQMC 1JQYD 3G7LA 3PO3B 1C48A 1GUWA 5M5WB 1F2ZA 1XTCD 2DNCA 1I6VC 1RHPA 1JWUD 2PZUA 1SYCA 4A3DB 4XTCS 4FF3A 1LT5D 2TSSA 5CR3A 1HHVA 3E0JA 1BCPB 3AU7A 1PMRA 3NBIA 2F1MA 1C4QA 1ET9A 1QNKA 3JAML 2E2DC 2BE5D 2MJ8A 2PO4A 1YNJC 5CV4A 1O7ZA 1J8IA 1NCVA 1BNZA 1XXGA 2SOBA 4UAIA 1SMYC 1SJHD 4C1NI 1HUNA 1V8QA 1HCZA 4CBVA 1ESFA 5KNCA 3LWUA 5EPKA 3K5MA 3PV0A 1I50B 5D3DA 1B4OA 1PFNA 2FMMA 2F0SA 5CC4A 1LTTD 1AW7A 1E2ZA 4RGMA 3VR3A 3BS1A 1I4PA 1SJED 2A68D 3VR6A 2HCIA 1AN8A 2K33A 4OO1H 3HOVB 1L0XB 2K1BA 2Q8RE 2EY2A 2SEBD 1I3QB 1MD2D 3GTGB 3TP7A 3JAME 3GTJB 1O7LA 3HG9A 3DWAA 4V0BA 2WKDA 4RH6A 4ME5A 3FPUB 2LFNA 1RDPD 3H94A 4K2LA 1BUVT 4B9XA 5EPLA 2L11A 2FHTA 3MZ5A 1B9NA 1F9QA 1G8ZD 3DEPA 3NWSA 3WOEA 4OIKA 4A3IB 4IFDG 2RDHA 4I7ZC 2NZ1D 1B53A 1EZ8A 2EOTA 3V2TA 2F0DA 5A2QL 1DZ1A 1ZXTA 2B8GA 2KUMA 1QB5D 4PNYA 1S5DD 1H9MA 5COYA 1MGSA 2JA7B 3SK6A 4BY1B 1SE3A 2L4NA 3OHXC 2FJ2A 4XQNA 1SNPA 1JOQA 2KEEA 2AWOA 2F0TA 1FR3A 3FEWX 1HPCA 3K0YA 5CV8A 4PV1C 3P7JA 1A2TA 4DAVA 4F8MA 4IURA 2VNUD 1I4RA 1AZQA 1JORA 2F0MA 1V1OA 3S15B 4F87A 1X3QA 1SYBA 1GHKA 4IN3A 5EKIA 5A2QE 1JE4A 4KD3A 1QNUA 1F9SA 1GUGA 1CZGA 2LS01 1TWAB 4KN4C 4V190 5JEAH 2AQ3B 4XT1B 5IGBA 1D5MC 2A69D 2K32A 3RZOB 4XYQA 2RBMA 5JEAJ 3MEHA 5KYLA 2SDFA 4HTHA 1B50A 4RGOS 3C46A 1K8MA 3KUPA 3OWEB 1XX8A 2F0FA 1LLRD 4R9WA 2X6LA 4U673 3J7YW 3FDTA 1U4LA 4K8IA 1F77A 3WOFA 4OO1G 4L63B 1PLFA 3HOWB 1ENFA 4ZKBB 2B8FA 1HUMA 5I6WA 4DXGA 1Y1WB 3CHBD 5JVH3 3HOXB 1ILQA 4H0LC 4QMGA 2A5HA 3I4MB 1L0YB 1Y8NB 2RQXA 4N9PA 1AP0A 3VR5A 3M4YA 1TS3A 3GTPB 5EKKA 2K7VA 2NN6H 3BZDB 1WTXA 3D31A 1U4RA 4IUPA 1A6XA 3TDQA 4X3KA 1E2VA 1G6ZA 1STHA 2D62A 1RTNA 2H1EA 5ELEA 2R6GA 1M4VA 5J39A 4NMZA 3HGBA 4J6HA 2ICEC 1HTPA 1PTOF 2F0OA 2TMPA 4DGZA 5NUCA 1NR4A 1BDOA 5C3WA 3MXGA 2F0QA 4DU9A 3BYYB 3S14B 3OW7A 4CKBA 4KJNA 1PZJD 4DF7A 3K5OA 2JA8B 2WINB 2IPKD 1TQOA 4ODGA 2IW3A 3L3OC 1O7YA 4TRDA 1TS4A 5IOCA 1LTID 5C44B 3X3MA 4MN3A 3A8JE 3CKIB 1B9MA 1SYFA 3MHBA 2F0LA 4M1UB 3J81L 1CA5A 2PCFB 3T4AC 1TWCB 1TWGB 3A7LA 4JK1C 1S5ED 3MC0B 4A3BB 2KVMA 2RKSA 1DOKA 3J80L 1EEID 2KHSA 3PO2B 4TQUS 4BBSB 5CV6A 2L1BA 3ONAB 2EJGC 5EGTA 3PUVA 1D6EC 4K5VA 2I07B 2X69A 3S1RB 1EU4A 4NP5A 3ERQA 4FXGC 1YNJD 3TZDA 3PUYA 4FXKC 3I3CA 5FO8B 3TP8A 1TR5A 4L6TB 1SE4A 4KMUC 1IHZA 2ICIA 3BDCA 3GV6A 3R2IA 4KI0A 3J81E 3ZYYX 4ZAIA 1EY0A 2XVSA 1H9JA 1R4PB 2AUJD 5TSSA 4RCNA 1KLUD 3MXUA 3SE0A 3J80E 1QOHA 2QDBA 1KAAA 5FK9C 1BCPD 4X3TA 4K2KA 5I9OA 3ND8A 5K36H 2A73B 1YNNC 1TY0A 1GHJA 2R7ZB 3KLSA 4RHRA 5D3IB 4KY6A 3T16A 4PQXA 4H13C 2VUMB 2KEDA 5CBEE 5C4XB 2SNMA 5DNFA 4DXFA 1PXUA 3EA6A 3NUCA 4QF4A 2QILA 4KHZA 5DEHA 4NDXA 1SNMA 1OXSC 3EVQA 1DYQA 4DFAA 1NUCA 4WFN3 4RAUC 3MXNA 3H6MA 1H9RA 2L5TA 1E2WA 1SSOA 1U4PA 4BBRB 3U9OA 3D6CA 1LACA 1LT6D 1A15A 3D3RA 3NQIA 3P20A 4Q5VA 4N9TA 2OXPA 2JP1A 3C1FA 2AUKA 3R2TA 4EQNA 2HDMA 4O1NA 5ISRA 3AB9A 4C2MB 2XN9C 3OPOA 1TY2A 1VMCA 5ELFA 1NAPA 3DWQA 1BR9A 4IUUA 2K28A 2BCOA 3SDZA 1HQRD 3I90A 3EROA 4XXEA 1G91A 1WTRA 1AZPA 3IL8A 2HDLA 4LK1C 5KYIA 1WTVA 1OXUA 5J1ZA 3N52A 3DM1A 4ULLA 4KKSA 1LTBD 1PRTF 1M8AA 1CHPD 4A3FB 1OXTA 1S5CD 3GTMB 1LTSD 1II3A 1EY7A 3H09A 4RHSA 2KQ3A 2YYZA 4B08A 5CV5A 1PTOC 4K5XA 2B2WC 4S3SA 4CJ1B 2NVQB 3VA5A 2A6EC 2B39A 1HFGA 2JA5B 2CHBD 4DAPA 5T1IA 1DM0B 5FKAC 4QUFA 1F9PA 3W2DA 4EVOA 3GTOB 2Z1CA 3LWEA 4B9WA 2F3WA 1WTWA 1JICA 5C3EB 1WTQA 1GUNA 1BF4A 2D5DA 4QCLA 1IKLA 1DOMA 2F0JA 5C5MA 4FP5D 1SXTA 1T5EA 1DJRD 1QG7A 3HKZB 1TWFB 5CORA 3I72A 4LAAA 1ESRA 4FNFA 5K36G 3P75A 5J22A 2O2LD 1ILPA 1I4XA 1CZWA 1HRJA 2KJXA 3BVZA 5CGKA 1CQVA 5C0XG 2F4IA 1ZKOA 4HMJA 2J4XA 3V96A 1SBBB 4E6IA 5KEEA 3MFGA 3CRLC 2E76C 5I2XA 3S1QB 1X32A 1WTOA 2JEBI 2QCPX 5IGGA 2EYFA 2JE6I 1RODA 1WD0A 1FNWA 3TP6A 2EY6A 3SHLA 5JJZA 4IUNA 3R3OA 2MP1A 4C3JG 4XYOA 3DMUA 1EY4A 4CKEA 2A6HD 2R61A 2WP8J 3GTKB 1XYIA 1FYCA 2AQ1B 5M5YB 5ELCA 3I91A 1J9OA 5AFWA 5EJWA 4K8JA 4ZLTF 1G2SA 4I65A 3GTQB 1A2UA 2XWBB 5IGFA 4PMWA 4RGTA 1TIID 5FOBB 3M7NA 1HXYD 2RVLA 1EYAA 2QEJC 4QIWB 1MBYA 4HCEA 1TT2A 4Z9CB 2PW5A 3Q23A 3VR4A 2I46A 4WJWA 2EVBA 5BN4A 2FFKB 1D5ZC 3FKIB 3D4WA 5KNBA 3SR1A 3V05A 2F0HA 4O42A 3QOLA 2LMCB 4J1MA 3CQZB 1MSHA 1PRTB 3DEOA 3M7GA 2IJ0A 5LL6S 4KTAA 1UNSA 4ILWA 1H9SB 2K05A 2PNRC 5E1FA 4HMIA 4UDUC 3VA7A 4MHEA 1F2YA 3HOZB 1VMPA 2E2HB 4M8AA 3KBXA 4CJ0B 4A93B 5JAVA 2NBFA 4EQOA 1PFBA 4LMQD 3PIP3 4Y7NB 4RCOA 3A54A 1HA6A 4G57A 2XNAC 2N55A 3A7AB 4OHJA 5E4XA 1U4MA 1S5FD 4EQPA 2B2WA 3NSWA 1E0BA 1MSGA 1IL8A 2J0TD 1XWEA 4U68A 1PRTC 2EYOA 1YNND 4WORA 5EBCA 1A3UA 2AQ2B 3G6JB 2D2CC 2F0UA 3OIPA 2KOLA 2BDOA 2HQEA 1BO0A 4IALA 1OXXK 1SEBD 3SK4A 3HRZC 1RKNA 2IX3A 5D14A 2NTTA 3A8KE 3NQTA 3PIO3 3GTLB 4C3IG 4EGVA 1STAA 3S1MB 3OOCA 1TVXA 2MPMA 3K57A 1KNAA 4TSSA 3KLRA 3D4DA 3IFTA 2G9DA 3S2DB 2Y0SB 2ID0A 5M3MB 1EIHA 4FYDA 5EPJA 4KJOA 3GV3A 4Q0FA 4H44C 2EYPA 5C4HA 1I6HB 3FVQA 5M5XB 4CKCA 2Z8LA 3E5SA 4KK7A 1EEFD 3OMGA 2BA0A 3I73A 5BN3A 2CVRA 2XRSD 2EYLA 1CA6A 1FGBD 1SAPA 1IYUA 1U9RA 1SYDA 5LL6X 1R9TB 2VB2X 1T5XD 1RTOA 4XT3B 3MWYW 4H7BA 2K01A 2WV6D 1JCKB 5JEAG 4FF1A 1BCPF 3K5LA 5HURA 1W6JA 3K7AB 4KN7C 2PW7A 2WACA 1QCBD 3AMUA 5C4JB 5E4WC 1SMYD 4HCSA 3IKJA 1GUTA 1Y69U 2ZT9C 1EY6A 2IT1A 5EBDA 5EKLA 4KHVA 4DK1A 3PUXA 4WRDA 3HEJA 4AYBB 1DOLA 4K6DA 2KCCA 3VR2A 1B3AA 3QJYA 3QOJA 4R8NA 1DONA 3ND9A 2R92B 2L12A 4OL7A 1EL0A 4TKOB 5G3LF 1S4ZA 1Z6HA 2B2UC 2EDGA 1TS2A 2B63B 2IX0A 3MAQA 3RLFA 5CBAE 3F2UA 3KLSX 4C3HG 3P1HA 3S9WA 2NN6G 3TMEA 1EQVA 3TN2A 4CJ2C 5FO9B 4KV6A 1OXVA 1EY5A 1FNUA 2B2TA 3MXPA 2QF7A 1Q8IA 4BY7B 1TS5A 3O13A 5IODA 1CTMA 2RDFA 1S5BD 4QUCA 1Q12A 2GA4B 5C6AA 2WAQB 4BA1I 5BN5A 2HUGA 1ZYRC 1Y8OB 2BOSA 3H3VC 3OSOA 1O78A 5A35A 2VXWA 5I2YA 5I4DA 4FVMA 3T53B 1PTOB 2BDNA 5FO7B 1R4QB 3T56B 1H9SA 3PMFA 1HFNA 4G4KA 3SEBA 2CQAA 3QO2A 5D65A 5JOBA 2OEOA 4IFDH 3N6RA 3EFXD 1ONLA 2F0WA 3M3YB 2F0IA 2C5CA 2K6AA 3K59A 3SVMA 3E6ZX 4IFDJ 1I4GA 2EPBA 4XQJA 3ITPA 2XIWA 2E75C 2K04A 4PMCA 2QKIC 4QB4A 4RGNA 1STNA 5I9PA 1SDFA 2B2YA 2PZTA 3UI2A 4DAYA 1W6KA 1BXTA 4J8QA 1LTGD 2F3VA 2L9HA 3IFDA 1D1KA 5C5LA 5C0XI 3S16B 5CV7A 2XRQD 3VYSA 1Y8PB 5CYUA 3HS0C 1K8OA 1CT1D 1QILA 1DCZA 4MIUA 4ZUIA 4CHTB 1GJXA 1LT3D 1RD9D 3Q0AA 4LJZC 3MA2B 5ELBA 2K03A 2RDGA 4KY5A 1FNVA 2RSOA 4X3SA 2K5WA 1Q1EA 3RUZA 4HAEA 2Q8IB 1PDQA 1STEA 2FINB 1TKWB 2F0VA 5KNDA 2D9UA 2F03A 4L8JA 4IFDI 2X6GA 3C2PA 1KNEA 1V43A 1ZEQX 1Y1VB 2EXZA 3RZDB 1OO9B 1PRTD 3H91A 1JB3A 5LHY1 3DUZA 3R8BA 1STYA 1UEAB 4A3EB 1IW7C 1EZ6A 2O5IC 1QWYA 1G2TA 4C56C 1JOKA 4CGYB 1LO5D 1BCPC 5FLXL 4A3MB 4RFBA 2G9HD 1WVLA 4HN7A 4BWGB 2MGSA 4DA2A 2R3ZA 5F2DA 5JPNC 2KA7A 4R8IA 3KBGA 3RMHA 2LKVA 4GZYC 2WIIB 2B2UA 3TBIB 2O4XA 5IGDA 3DXJC 1HTLD 4PMBA 1Z7TA 3SK5A 2IL8A 1MI2A 2NTSA 2CW0C 1EQTA 2KECA 4DNRB 3X3NA 2H4OA 1O80A 3HP3A 1GUOA 1PZKD 2ZXRA 5DM63 4G7ZC 1PYWD 1ENCA 4X3UA 3I4NB 2DY8A 3BYTB 3D8GA 2M9VA 4KKTA 1LT4D 1VCIA 3GD7A 3QWNA 3NWTA 1LTAD 2PQEA 2BA1A 3GQBA 3QIAA 5HGTA 5EQ0A 1DXMA 2EJFC 1BBXC 1KDAA 3D6WA 4P2CB 4XQQA 1I4QA 3PUWA 4FO2A 2AWNA 5FLXE 2EE1A 1SFOB 1QJOA 4FF4A 3DWPA 3S1NB 3LNNA 2EY1A 1JC7A 3NPPA 5DM73 5ELDA 5JPMC 2IWHA 3BVGA 3KF8A 3A55A 4BS9A 3L9AX 4HEDA 3HOYB 3A56A 4ABNA 4OO1I 1STGA 3OIQA 3URYA 1VF5C 4F7XA 5E3FA 4ZKCB 2NVYB 3FMCA 1SNOA 1EOTA 2F0KA 2B2VA 3NXWA 3NHHA 2YU9B 3IAYA 4NW2A 2EZVA 2E74C 3I4LA 3C1EA 4C3JB 3S2HB 4FF2A 3NK9A 4IUVA 1V1PA 2B2TC 4IUQA 5M3FB 2BE5C 3MFYA 3K58A 1GOZA 1EYDA 2ENBA 2L55A 1CK1A 3M4OB 1QE6A 3NBHA 3PUZA 1D5XC 1PTOH 1JOOA 4ZK9B 4F88A 4HSPA 3C3LA 1GUSA 2ZXPA 2C9OA 1EY9A 1B44D 1D2BA 2F0EA 3VYUA 4K6LA 1KDBA 2NUCA 4K5WA 1Q1BA 4NKLA 2Q8TA 2WKCA 2A68C 2EYMA 1VDZA 5DAUA 3KK7A 2FMCA 4K14A 1SE2A 4RWSC 4KY7A 2V4DA 4ZUJA 2JA6B 3GP7A 2L0CA 2PPBC 4OGQC 4RA8A 2Z4IA 1EY8A 1BQQT 1ZYRD 2EYHA 1KABA 3NE5B 3OMCA 3HZXA 1PFMA 1IYVA 3T51B 2JSOA 2E2IB 1WD1A 4YIJA 3A8IE 1ML0D 1SNQA 3BVMA 2A74C 3I70A 4XDXA 2M00A 1GXDC 1EU3A 5IGCA 4HSVA 2EYJA 2RA4A 3QG1A 1AEXA 4KD4A 1PZID 2B2YC 2DNEA 2K5DA 3L7ZC 2NB0A 3W3AA 1ET6A 1SNCA 4RKLA 5KGUA 3S17B 2MUYA 1TWHB 3J7AF 3SK8A 2F0PA 4RKBA 2J7ZA 1AFPA 2A6HC 4IUTA 1CFMA 2DN8A 3TZUA 2HCCA 1KLGD 1TU2B 5IT9L 3EJIA 4G7OC 2PZWA 3NTKA 1UUPA 1ENAA 2KCNA 3TSSA 1G291 1JWMD 3BG3A 3NTHA 1KTKA 2JXMB 1B1ZA 3FPPA 4C1NK 3MVVA 2EJMA 2R93B 1K83B 1F2MA 1SYEA 1PTOD 5K5PA 2XWJB 4IQZA 2A6ED 1JWSD 2NVTB 3LX0A 4C3IB 4DNTB 1I4HA 2NN6I 3J7AV 2OF1A 3Q24A 3BDOA 1CQFA 5CMDA 1C8CA 1LV9A 3OWFA 4A3KB 2JYOA 1HA5A 3MTSA 2NYZD 3QB3A 4DN4M 4A3GB 5C4ZA 5IT9E 2NWGA 4OIJA 4XIGS 2VB3X 3HOUB 1DD2A 1JR0D 3R93A 1EYCA 1Q90A 3BDLA 2PYKA 2A69C 2RSNA 4KKUA 4DK0A 1IKMA 1F9RA 4ID6A 3H0GB 5CV9A 1Q3LA 1STBA 1LTRD 1KDCA 2LY7A 1B2TA 1NSNS 4JBWA 1IW7D 1UAPA 2OT2A 3VYTA 3Q22A 1D1IA 1BOSA 2JEAI 5KRUA 2WB1B 4BA2I 3D4RA 2N88A 4FXDA 3CRKC 2F0GA 4IZ8A 1V1PB 1RCVD 3K6OA 1NR2A 1EWHA 3Q6SA 1ICWA 1CM9A 4G7HC 1H9KA 5C0XH 1A3TA 1RF2D 1Z47A 3SXHA 1RJTA 3I8ZA 3FRPB 5I6YA 1VF7A 3VYRA 1SNDA 2E2JB 3U9SA 5C0XJ 1WCMB 3T13A 2CW0D 1EFID 1FD7D 3TP5A 1CHQD 3M85A 2SNSA 3NTIA 1SYGA 5G3LD 5C3XA 2DY7A 5JVG3 1WTPA 2M2LA 4A3JB 1EWCA 3EQLC 5M9OA 5IIFA 2ZXOA 3WDNA 5KIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMU A;  2F0K A;  3NXW A;  2RKS A;  1EY4 A;  1SNP A;  2EYP A;  3NHH A;  4QB4 A;  4QMG A;  2KHS A;  1SNQ A;  3NUC A;  4QF4 A;  4YIJ A;  5C4H A;  1JOQ A;  3P1H A;  5CV6 A;  2F0S A;  2M00 A;  5CC4 A;  5EGT A;  2F0T A;  3S9W A;  5IGC A;  4G57 A;  1STN A;  2EYJ A;  5I9P A;  1EYC A;  4N9P A;  5DEH A;  5F2D A;  1AEX A;  4NDX A;  3BDL A;  4K5V A;  4KD4 A;  2PYK A;  1SNM A;  3TME A;  1EQV A;  4EVO A;  4K8J A;  4KV6 A;  2PZT A;  4B9W A;  2F3W A;  3C1E A;  3E5S A;  3NP8 A;  3OMG A;  5EKK A;  4ID6 A;  3EVQ A;  5CV8 A;  4DFA A;  2LKV A;  1A3V A;  1NUC A;  4EQP A;  1A2T A;  2EYL A;  1EY5 A;  3NK9 A;  1SNC A;  4I65 A;  5IGE A;  2EY5 A;  4RKL A;  4F8M A;  4NP5 A;  3H6M A;  1A2U A;  2F0J A;  2F3V A;  3MXP A;  4ZQ3 A;  3ERQ A;  5C5M A;  2F0N A;  5IGF A;  5KGU A;  5CV9 A;  2O4X A;  5IGD A;  1STB A;  5C5L A;  2EY2 A;  3SK8 A;  1U9R A;  1JOR A;  3U9O A;  3D6C A;  4PMB A;  1KDC A;  1STH A;  1SYD A;  2F0P A;  2F0M A;  4RKB A;  3SK5 A;  5IOD A;  1NSN S;  2EYO A;  4WOR A;  1EYD A;  5CV7 A;  1EYA A;  3DHQ A;  2RDF A;  5J39 A;  3TP7 A;  1A3U A;  4NMZ A;  4J6H A;  5C6A A;  2F0U A;  3EJI A;  2ENB A;  1SYB A;  4H7B A;  4LAA A;  4N9T A;  3TP8 A;  2OXP A;  2F0O A;  2PZW A;  4DGZ A;  1TT2 A;  1TR5 A;  5NUC A;  1ENC A;  1ENA A;  5C3W A;  4KD3 A;  1IHZ A;  1JOO A;  2PW5 A;  4ME5 A;  4MIU A;  3OSO A;  2HQE A;  4ZUI A;  1F2Z A;  3BDC A;  3C1F A;  2F0Q A;  3D8G A;  4EQN A;  5KRU A;  5ISR A;  4DU9 A;  3P75 A;  5HUR A;  4IAL A;  5J22 A;  4K2L A;  4B9X A;  3SK4 A;  2PZU A;  2PQE A;  1RKN A;  1EY0 A;  1SYC A;  5HGT A;  4KY5 A;  5C4Z A;  1KDA A;  2PW7 A;  2WAC A;  3D4W A;  1EY9 A;  2F0G A;  5CGK A;  4KJN A;  4IZ8 A;  3NQT A;  3MZ5 A;  3MVV A;  3SR1 A;  5IGB A;  4HMJ A;  4DF7 A;  2F0E A;  3PMF A;  2F0H A;  5CR3 A;  3RUZ A;  3ERO A;  1EY6 A;  1KDB A;  2NUC A;  1F2M A;  3QOL A;  1SYE A;  4J1M A;  4K5W A;  2RBM A;  1A3T A;  5K5P A;  4E6I A;  2F0V A;  5KEE A;  3SXH A;  3MEH A;  1TQO A;  4KTA A;  4NKL A;  1STA A;  4ODG A;  5EKL A;  4KHV A;  5KYL A;  4HTH A;  2QDB A;  1KAA A;  3HEJ A;  4TRD A;  4WRD A;  5JOB A;  5I6Y A;  5E1F A;  5IOC A;  1EZ8 A;  2EYM A;  5KYI A;  5J1Z A;  4HMI A;  5DAU A;  2OEO A;  4K2K A;  1SND A;  3V2T A;  2EXZ A;  4K6D A;  5I9O A;  3LX0 A;  2EY1 A;  2F0D A;  2F0F A;  4K14 A;  3QOJ A;  4R8N A;  5CV4 A;  3T13 A;  2F0W A;  1F2Y A;  3D4D A;  4KY7 A;  4ZUJ A;  1II3 A;  1SYF A;  2F0I A;  4K8I A;  3MHB A;  2SOB A;  5IGG A;  1EY7 A;  4OL7 A;  1STY A;  2EYF A;  2F0L A;  2KQ3 A;  2OF1 A;  2SNS A;  4PNY A;  1SYG A;  3TP5 A;  1EZ6 A;  1EY8 A;  5CV5 A;  5C3X A;  1STG A;  4KY6 A;  3T16 A;  2EYH A;  4K5X A;  3SK6 A;  1KAB A;  3TP6 A;  5JAV A;  2EY6 A;  3OWF A;  1JOK A;  4KJO A;  3SHL A;  3OMC A;  3ITP A;  4F7X A;  3HZX A;  5E3F A;  4EQO A;  5I6W A;  5M9O A;  4S3S A;  1SNO A;  5IIF A;  4PMC A;  4IUN A;  3R3O A;  3VA5 A;  3QB3 A;  2SNM A;  5KIX A; 
#chains in the Genus database with same CATH topology
 2IX1 A;  2E2H H;  2B2V C;  1CI3 M;  3K5N A;  1X65 A;  3CU7 A;  4C3J H;  2PMZ B;  2XSC A;  3GO5 A;  2VQE L;  4QGU A;  4A93 H;  5T1G A;  1F2L A;  4ZYS A;  2Z4H A;  1WTH A;  1N34 Q;  4YHH Q;  2UUA L;  3NP8 A;  3HKZ G;  2O5J C;  1A3V A;  2JA9 A;  4HR7 B;  5IGE A;  4Y7N H;  2EY5 A;  1X3P A;  4ZQ3 A;  4C3H B;  3RD4 A;  2F0N A;  5BR8 L;  1EIG A;  3W1B A;  4ZRZ A;  1GM5 A;  1KRT A;  2K5Q A;  3HOV G;  2MHV A;  2NVX B;  1LAB A;  3DHQ A;  1LM0 A;  1GKH A;  1HQM C;  1JQY D;  4HJ7 A;  3G7L A;  2KHI A;  3PO3 B;  1C48 A;  4DV2 Q;  3F2D A;  1W2B A;  4WJ4 A;  2ZJR A;  1GUW A;  2OQ0 A;  5M5W B;  1F2Z A;  1XTC D;  2DNC A;  3KFU A;  3IRB A;  1I6V C;  1RHP A;  5LMU Q;  1VQ5 A;  1JWU D;  2PZU A;  4DR5 L;  2I5H A;  3UDX A;  1SYC A;  4A3D B;  4XTC S;  3F2C A;  4NXN L;  1EQQ A;  1A0I A;  4FF3 A;  1LT5 D;  2TSS A;  5CR3 A;  3PF4 A;  1HHV A;  3E0J A;  1BCP B;  3AU7 A;  2I0Q A;  1PMR A;  3NBI A;  2F1M A;  4DR1 L;  1C4Q A;  3PQI A;  1ET9 A;  1C0A A;  1QNK A;  3JAM L;  2E2D C;  4L5T A;  3JAM i;  3CCV A;  2BE5 D;  2QGQ A;  3GTL H;  2MJ8 A;  2PO4 A;  4HJ9 A;  1YNJ C;  1QUQ A;  4X65 Q;  4A3I G;  5CV4 A;  1XPO A;  1O7Z A;  1J8I A;  1NCV A;  1BNZ A;  2PI2 A;  3STB C;  1XXG A;  2SOB A;  1EWI A;  4UAI A;  1E1O A;  3S1M H;  1VQ4 A;  1SMY C;  1SJH D;  4C1N I;  4JI7 L;  1PFS A;  1HUN A;  1V8Q A;  4A3C G;  1HCZ A;  4CBV A;  4KLK A;  1ESF A;  3U4V A;  5KNC A;  3LWU A;  1U0L A;  5EPK A;  3K5M A;  1L1O A;  3PV0 A;  3S2D H;  1EOV A;  1I50 B;  5D3D A;  4BY1 G;  2CWP A;  2E5L L;  4JBM A;  1B4O A;  5M3M H;  1PFN A;  2FMM A;  5GAH C;  3F2B A;  2F0S A;  5CC4 A;  1LTT D;  1AW7 A;  4LNQ A;  3AYH B;  1E2Z A;  4RGM A;  3VR3 A;  1PH8 A;  3BS1 A;  5IY0 A;  2EQS A;  1I4P A;  1SJE D;  2A68 D;  3VR6 A;  2HCI A;  2VQF L;  1AN8 A;  5LMN Q;  2K33 A;  4OO1 H;  3HOV B;  1L0X B;  1I6H H;  2GVA A;  5M5X H;  2K1B A;  1O7I A;  2Q8R E;  2EY2 A;  2SEB D;  2CH4 W;  1I3Q B;  1MD2 D;  2KCM A;  2RHS B;  1YZ6 A;  3GTG B;  3TP7 A;  3JAM E;  3GTJ B;  1O7L A;  4P72 A;  1VQN A;  3HG9 A;  2N8N A;  4MNO A;  3DWA A;  1NY4 A;  4V0B A;  2WKD A;  4GNX B;  4RH6 A;  4ME5 A;  3FPU B;  2D0O A;  2LFN A;  1R9T H;  1RDP D;  4POG A;  3H94 A;  4K2L A;  4O0A A;  1BUV T;  4B9X A;  1SMX A;  5EPL A;  2L11 A;  3CF5 A;  2FHT A;  1VQ7 A;  2H5X A;  3MZ5 A;  2CH4 A;  1XNR Q;  2ES2 A;  1VQP A;  1B9N A;  1XPU A;  1F9Q A;  1G8Z D;  3HOZ G;  3DEP A;  3NWS A;  3WOE A;  2L15 A;  3K7A H;  4OIK A;  4A3I B;  4IFD G;  2RDH A;  4AQY Q;  4I7Z C;  3OYY A;  2NZ1 D;  4B3T Q;  1B53 A;  1EZ8 A;  3E9H A;  4CDD C;  2EOT A;  3ULL A;  3V2T A;  4A93 G;  3J81 c;  2F0D A;  5A2Q L;  1DZ1 A;  2QEX A;  2WAQ E;  3FP9 A;  1ZXT A;  2B8G A;  4O2D A;  2KUM A;  1QB5 D;  4PNY A;  1S5D D;  1H9M A;  5COY A;  1MGS A;  4JI3 L;  3G6E A;  1EQR A;  2BH8 A;  2JA7 B;  3SK6 A;  1XMO L;  4GKK Q;  4JI5 L;  4BY1 B;  1SE3 A;  2L4N A;  3OHX C;  3H3V H;  4JI6 L;  2R92 H;  2FJ2 A;  4XQN A;  1YIJ A;  1SNP A;  1JOQ A;  4A4I A;  4GNX C;  2KEE A;  2K4K A;  2AWO A;  1IBK Q;  2F0T A;  2MFI A;  2IY5 B;  1FR3 A;  1YEZ A;  4DUZ L;  2JJQ A;  1KQS A;  2CQO A;  3I4M G;  4LWC A;  3FEW X;  2B63 H;  1HPC A;  3K0Y A;  5CV8 A;  4PV1 C;  3P7J A;  1MHW C;  1A2T A;  4DAV A;  4F8M A;  4IUR A;  2VNU D;  1MJC A;  1I4R A;  1KRS A;  2PMZ E;  1AZQ A;  2UUB L;  1JOR A;  4DR7 Q;  2F0M A;  1K8A C;  4JI4 L;  3U50 C;  1V1O A;  3S24 A;  4HIM A;  3S15 B;  2JQO A;  3I7F A;  1XTD A;  4F87 A;  1X3Q A;  1SYB A;  4GOP B;  1GHK A;  4IN3 A;  3A5Z B;  4BY7 H;  1NMG A;  5EKI A;  2XGT A;  5A2Q E;  1JE4 A;  4KD3 A;  1QNU A;  1EIF A;  1F9S A;  1GUG A;  1SRO A;  4DR6 Q;  1CZG A;  2LS0 1;  1TWA B;  4KN4 C;  4V19 0;  5JEA H;  4JI8 Q;  2AQ3 B;  4A75 A;  4XT1 B;  2UU9 L;  1G6P A;  2VL6 A;  4JYA Q;  3KLW A;  3K81 C;  5IGB A;  1D5M C;  2A69 D;  2K32 A;  3RZO B;  4XYQ A;  1YI2 A;  4DUY Q;  2RBM A;  5JEA J;  4DR2 L;  3MEH A;  5KYL A;  1X6O A;  1UWV A;  2Y0S G;  2SDF A;  1YJW A;  4HTH A;  1B50 A;  4RGO S;  3C46 A;  2I5L X;  1EFW A;  2JA8 G;  1K8M A;  3CMA A;  3KUP A;  3OWE B;  1XX8 A;  2F0F A;  1LLR D;  4R9W A;  1JB7 A;  2X6L A;  4U67 3;  1VQD A;  1PH6 A;  3RLO A;  3W5O A;  3J7Y W;  3FDT A;  4B3S L;  1U4L A;  4K8I A;  3NEN A;  5C44 G;  1F77 A;  1YNX A;  3WOF A;  3KJP A;  4PZ6 A;  4OO1 G;  4L63 B;  1PLF A;  3HOW B;  1ENF A;  4ZKB B;  2B8F A;  1HUM A;  4LUV A;  5I6W A;  3PIP A;  3M3Y H;  4DXG A;  2E8G A;  4LF7 L;  1Q46 A;  1Y1W B;  3CHB D;  4GOP C;  5JVH 3;  3HOX B;  1ILQ A;  4H0L C;  4QMG A;  1S72 A;  2A5H A;  3I4M B;  1IL2 A;  1L0Y B;  1Y8N B;  5GAD C;  1VQI A;  2RQX A;  4N9P A;  2YV5 A;  1AP0 A;  4A3B G;  3VR5 A;  3M4Y A;  5GAE C;  1TS3 A;  3GTP B;  5EKK A;  4LFA Q;  2K7V A;  1HR0 W;  1XNQ L;  1QUQ B;  2NN6 H;  3BZD B;  1WTX A;  1CSP A;  4IPH A;  1SE8 A;  5GAG C;  3D31 A;  1U4R A;  4IUP A;  1A6X A;  3TDQ A;  4JI2 L;  4DV5 Q;  3B6Y A;  4X3K A;  1E2V A;  1G6Z A;  1YHA A;  1IZ6 A;  1STH A;  3I2Z A;  2D62 A;  4GN4 B;  5AJ3 L;  1RTN A;  1VQB A;  2H1E A;  5ELE A;  2R6G A;  1M4V A;  5J39 A;  4NMZ A;  3HGB A;  4J6H A;  2ICE C;  1A62 A;  1HTP A;  1PTO F;  2F0O A;  2TMP A;  4R4T A;  4DGZ A;  5NUC A;  1NR4 A;  1Q81 C;  1BDO A;  3U58 A;  5C3W A;  3MXG A;  4YY3 L;  2F0Q A;  2ZTD A;  5JJK A;  5FLM H;  3G48 A;  4DU9 A;  3BYY B;  3S16 H;  3S14 B;  4JPB W;  1XPR A;  3PIO A;  4IPD A;  3OW7 A;  1SR3 A;  4CKB A;  1I5F A;  2YTX A;  3WWV A;  4KJN A;  1PZJ D;  4DF7 A;  1YVC A;  4LF4 Q;  3K5O A;  2JA8 B;  2WIN B;  2IPK D;  1TQO A;  2R92 G;  4ODG A;  2D0P A;  2IW3 A;  3L3O C;  1O7Y A;  4TRD A;  1TS4 A;  5IOC A;  4K0K Q;  1LTI D;  5C44 B;  3X3M A;  4MN3 A;  3A8J E;  3CKI B;  1B9M A;  4AH6 A;  3UDF A;  1BVS A;  1SYF A;  3MHB A;  1YJN A;  2F0L A;  4M1U B;  3J81 L;  1CA5 A;  2PCF B;  4OON A;  2K50 A;  1Y1V H;  3RZD H;  4QY7 A;  3T4A C;  1TWC B;  1TWG B;  2R7Z G;  3A7L A;  4JK1 C;  4IOC A;  2RF4 A;  2K5N A;  4APV A;  1S5E D;  1S40 A;  5IWA L;  3MC0 B;  4A3E H;  4A3B B;  2KVM A;  2RKS A;  1DOK A;  3J80 L;  1EEI D;  2KHS A;  3AQQ A;  3PO2 B;  4TQU S;  4BBS B;  5CV6 A;  2VUM G;  2L1B A;  3ONA B;  2EJG C;  5EGT A;  5C4X G;  3PUV A;  1D6E C;  4LF6 L;  4K5V A;  2I07 B;  2X69 A;  3S1R B;  2UXD Q;  4PZ8 A;  1N32 L;  4A3M H;  1EU4 A;  4UP8 A;  3KF6 B;  4NP5 A;  3ERQ A;  1VQO A;  4FXG C;  1YNJ D;  3TZD A;  3T1H L;  4WJ3 M;  1FGU A;  3STB D;  1J5E Q;  3PUY A;  1HNZ L;  4LF8 Q;  4FXK C;  1HNX Q;  4HIO A;  3I3C A;  4GLX A;  5FO8 B;  3TP8 A;  1HZ9 A;  1TR5 A;  4L6T B;  1SE4 A;  4KMU C;  2OTJ A;  1IHZ A;  2ICI A;  4GLV B;  3BDC A;  3GV6 A;  3R2I A;  4A3L H;  4KI0 A;  1VS0 A;  3J81 E;  3RN2 A;  3ZYY X;  1WFQ A;  4ZAI A;  1EY0 A;  2HD3 A;  2XVS A;  1H9J A;  1R4P B;  3I4N H;  2AUJ D;  3L0O A;  5TSS A;  2ZTC A;  1P16 A;  5FLX c;  3CCQ A;  4RCN A;  1KLU D;  4EX5 A;  3MXU A;  3SE0 A;  3J80 E;  1QOH A;  4JCV E;  2QDB A;  1KAA A;  5FK9 C;  1BCP D;  4X3T A;  4K2K A;  5I9O A;  2CKZ B;  3ND8 A;  5K36 H;  2UUC Q;  1SFO H;  2A73 B;  1YNN C;  2UXB L;  2Q2I A;  1TY0 A;  1GHJ A;  2HIX A;  3S1N H;  2R7Z B;  3KLS A;  4QL5 A;  4RHR A;  3VDY A;  1CSQ A;  2B3G A;  1XMQ Q;  5D3I B;  4KY6 A;  3T16 A;  4A3F G;  4PQX A;  2MO1 A;  4J15 A;  4H13 C;  2VUM B;  3U4Z A;  2KED A;  3A5U A;  3RR5 A;  5CBE E;  4JI0 L;  5C4X B;  3HOY H;  4DV1 Q;  2CCZ A;  2SNM A;  5DNF A;  1V9P A;  4DXF A;  1PXU A;  3EA6 A;  4NXM L;  2MQH A;  3NUC A;  4QF4 A;  2QIL A;  4KHZ A;  5DEH A;  4P75 A;  4NDX A;  4YCV A;  1SNM A;  2NVY H;  4UHV A;  1OXS C;  3EVQ A;  2F4V Q;  1DYQ A;  4DFA A;  1NUC A;  4WFN 3;  2YU9 H;  4RAU C;  3MXN A;  3H6M A;  1H9R A;  1VQC A;  2L5T A;  1E2W A;  1X3G A;  1SSO A;  1U4P A;  1PH4 A;  4BBR B;  4UP9 A;  3U9O A;  5C3E G;  3D6C A;  4B3M Q;  4DV6 Q;  1CKN A;  1LAC A;  4OWW B;  1LT6 D;  4POF A;  4LFB L;  1LUZ A;  1A15 A;  3S2H H;  3D3R A;  2UXC Q;  3NQI A;  3P20 A;  4Q5V A;  4GKJ L;  2PI2 E;  4N9T A;  5M3F H;  2OXP A;  1N36 Q;  2JP1 A;  2PQA B;  4N8F A;  5IYB H;  3C1F A;  2AUK A;  3QR8 A;  3R2T A;  4EQN A;  2HDM A;  4O1N A;  5ISR A;  3AB9 A;  4C2M B;  2XN9 C;  3OPO A;  1TY2 A;  1VMC A;  5LMN W;  5ELF A;  3M4O H;  1NAP A;  3DWQ A;  1BR9 A;  4IUU A;  2K28 A;  4H02 A;  2BCO A;  3SDZ A;  3KOJ A;  1HQR D;  3I90 A;  3ERO A;  3J7Z C;  4DV0 Q;  4XXE A;  1G91 A;  1JE5 A;  1WTR A;  1AZP A;  1NTG A;  3IL8 A;  2HDL A;  4LK1 C;  2V1C C;  5KYI A;  4DR4 L;  1WTV A;  1OXU A;  5J1Z A;  1Y14 B;  1XJV A;  1E22 A;  3N52 A;  3DM1 A;  4ULL A;  2VZA A;  4KKS A;  1LTB D;  3KJO A;  1IBM Q;  1PRT F;  1GVP A;  1B3Q A;  1M8A A;  1CHP D;  4A3F B;  1OXT A;  1S5C D;  3GTM B;  1LTS D;  1II3 A;  1EY7 A;  3EIV A;  3H09 A;  4RHS A;  2KQ3 A;  2YYZ A;  4B08 A;  5CV5 A;  1CKO A;  1PTO C;  4K5X A;  5IYC H;  4X62 Q;  2B2W C;  1HNW Q;  5JJL A;  2RCF A;  4S3S A;  4CJ1 B;  2ZM6 Q;  4DR3 Q;  2JA6 H;  2NVQ B;  3VA5 A;  2A6E C;  4X64 L;  2B39 A;  1HFG A;  2JA5 B;  2CHB D;  4DAP A;  5T1I A;  1DM0 B;  2Q2U A;  3BU2 A;  2Z0S A;  5FKA C;  1LTL A;  4QUF A;  1F9P A;  3W2D A;  4EVO A;  2MO0 A;  1VQL A;  2Z1C A;  3LWE A;  3GTO B;  1K3R A;  4B9W A;  2E2I H;  2F3W A;  1WTW A;  1JIC A;  5C3E B;  3ZJY C;  1WTQ A;  1GUN A;  1BF4 A;  2D5D A;  4QCL A;  1IKL A;  1DOM A;  2F0J A;  4UY8 C;  5C5M A;  4FP5 D;  1SXT A;  1T5E A;  1DJR D;  4DV4 L;  1QG7 A;  3AFP A;  4OEL B;  3HKZ B;  1WJJ A;  4DV7 L;  3OTO Q;  1TWF B;  5COR A;  3I72 A;  4LAA A;  3S17 H;  1ESR A;  1TWH H;  4Y52 H;  4IJL A;  4FNF A;  3PF5 A;  4LFC L;  4OWT B;  3ULP A;  5K36 G;  1RL2 A;  2ZJQ A;  3P75 A;  5J22 A;  2O2L D;  1FJG L;  1ILP A;  1I4X A;  4LF9 Q;  1CZW A;  1HRJ A;  4LF5 Q;  2DJF C;  2KJX A;  1QZG A;  3BVZ A;  5CGK A;  1CQV A;  5C0X G;  2F4I A;  1ZKO A;  1Q86 C;  4HMJ A;  4OX9 L;  2J4X A;  3TQY A;  1X3E A;  3CME A;  3V96 A;  5HGQ A;  2LXK A;  1SBB B;  3FKI G;  1T9H A;  5FJ8 H;  4E6I A;  5KEE A;  2YTY A;  3MFG A;  3CRL C;  2E76 C;  5I2X A;  1PV4 A;  4DKA C;  3CP0 A;  3S1Q B;  4HJ5 A;  2R93 H;  1K83 H;  4MTN A;  1X32 A;  1WTO A;  4B3R L;  2N49 A;  2IHE A;  2JEB I;  1FL0 A;  1S3O A;  2QCP X;  5IGG A;  2EYF A;  2JE6 I;  1ROD A;  2WB1 E;  1WD0 A;  2NVT H;  1FNW A;  3TP6 A;  1YIT A;  4C3I H;  2EY6 A;  4JC0 A;  4BBS H;  3SHL A;  4IPG A;  4JV5 Q;  1EIY B;  4DV3 L;  5JJZ A;  4IUN A;  3R3O A;  2MP1 A;  4C3J G;  4XYO A;  5IT9 c;  3DMU A;  1EY4 A;  4CKE A;  2A6H D;  3UDG A;  2R61 A;  2WP8 J;  3BZC A;  3CC2 A;  3GTK B;  3KF6 A;  1XYI A;  1FYC A;  2AQ1 B;  2K5V A;  4A3K H;  5M5Y B;  5ELC A;  3I91 A;  1J9O A;  5AFW A;  5EJW A;  4K8J A;  3E9I A;  2B29 A;  4ZLT F;  4A3G H;  4L5Q A;  1G2S A;  4I65 A;  3GTQ B;  1CKM A;  4KHP Q;  1A2U A;  2XWB B;  5IGF A;  2N78 A;  2LSS A;  1C9O A;  4PMW A;  3HOU H;  4RGT A;  1TII D;  5FOB B;  3M7N A;  1DGS A;  1HXY D;  2RVL A;  3TS2 A;  1EYA A;  2QEJ C;  4QIW B;  1IBL Q;  1GO3 E;  1Q7Y C;  4NB3 A;  4BXX H;  1MBY A;  1HR0 L;  3H0G H;  4HCE A;  3GDE A;  1TT2 A;  3CAM A;  4Z9C B;  1E1T A;  2PW5 A;  2RCN A;  4X6A H;  3Q23 A;  3VR4 A;  3L2P A;  5GRO A;  2VQE Q;  2I46 A;  4WJW A;  1J6Q A;  2EVB A;  3RN5 A;  5BN4 A;  2FFK B;  1D5Z C;  3FKI B;  1BKB A;  3D4W A;  1EUJ A;  5KNB A;  3SR1 A;  2UUA Q;  3MXN B;  5IYC G;  3V05 A;  1WI5 A;  2F0H A;  2DGY A;  4IO9 A;  4O42 A;  2IHF A;  3QOL A;  2LMC B;  3CQZ B;  4J1M A;  4IJH A;  1PA6 A;  1MSH A;  2JA6 G;  1PRT B;  3DEO A;  3M7G A;  2IJ0 A;  4KTA A;  5LL6 S;  5BR8 Q;  3CPW A;  1UNS A;  4ILW A;  1CKN B;  1H9S B;  2HHH L;  2NZH A;  2K05 A;  2PNR C;  3UDI A;  5E1F A;  4HMI A;  4UDU C;  3VA7 A;  4MHE A;  1F2Y A;  3HOZ B;  4R4I A;  1NBW A;  3G4S A;  1VMP A;  2E2H B;  4M8A A;  3KBX A;  3K80 C;  2WFW A;  4CJ0 B;  2E2J H;  4A93 B;  5JAV A;  1WCM H;  2NBF A;  2VW9 A;  4EQO A;  1K9M C;  4FDB A;  1PFB A;  5M3M G;  4DR5 Q;  3KYH C;  4JI1 L;  4LMQ D;  4NXN Q;  3CCS A;  3PIP 3;  3SGI A;  4Y7N B;  4RCO A;  2AHO B;  3A54 A;  4NPS A;  1HA6 A;  4G57 A;  1I94 L;  2XNA C;  4X66 L;  4DR1 Q;  2N55 A;  1YBY A;  3A7A B;  4OHJ A;  5E4X A;  4A3J H;  1WOC A;  1U4M A;  1S5F D;  1XMQ L;  4EQP A;  2B2W A;  3NSW A;  1PH7 A;  1E0B A;  1MSG A;  4EQ5 A;  1IL8 A;  2J0T D;  1XWE A;  4U68 A;  3K0X A;  1PRT C;  5IE8 A;  2PQA A;  2EYO A;  1YNN D;  4WOR A;  4JI7 Q;  1EYG A;  5EBC A;  1N33 L;  1A3U A;  2AQ2 B;  3G6J B;  1HZB A;  2D2C C;  4C3H H;  2F0U A;  3MEF A;  1L2F A;  2K52 A;  1PH2 A;  3OIP A;  2KOL A;  1VQ9 A;  4LW1 A;  2BDO A;  2HQE A;  2R93 G;  2E5L Q;  2VS1 A;  2NVX H;  4HJA A;  1BO0 A;  4IAL A;  3HKZ E;  2P5Z X;  1OXX K;  1IXR A;  1SEB D;  3SK4 A;  3HRZ C;  3PO3 H;  1RKN A;  2IX3 A;  1UE7 A;  1X56 A;  2DJG C;  5D14 A;  3TRE A;  2NTT A;  3A8K E;  3NQT A;  3PIO 3;  3GTL B;  1PYB A;  4C3I G;  5M5W H;  3HKS A;  4EGV A;  3RLN A;  1MIU A;  2VQF Q;  4DNI A;  1N34 L;  4YHH L;  1STA A;  3S1M B;  3OOC A;  2QDL A;  4A3D H;  3CCL A;  3I4O A;  3W1G A;  4LUZ A;  4TVA B;  1TVX A;  2MPM A;  3K57 A;  1KNA A;  4TSS A;  3KLR A;  3KDF A;  4AYB G;  3D4D A;  3IFT A;  4PG3 A;  4UP7 A;  2G9D A;  3S2D B;  2Y0S B;  2LXJ A;  2ID0 A;  1L0W A;  3ERS X;  5M3M B;  1EIH A;  4FYD A;  3HOU G;  4CDF C;  4DV0 L;  1N8R C;  5EPJ A;  2JA5 H;  4ME3 A;  4KJO A;  4DV2 L;  3GV3 A;  4Q0F A;  2A8V A;  4H44 C;  2EYP A;  5C4H A;  5IP9 H;  5LMU L;  4HIK A;  4JOI A;  1I6H B;  3FVQ A;  4RG1 A;  5M5X B;  4HJ8 A;  2B63 G;  1HJP A;  3EN2 A;  4CKC A;  3J81 i;  3DM3 A;  2Z8L A;  3E5S A;  1EEF D;  2HQL A;  3OMG A;  2BA0 A;  3I73 A;  4KK7 A;  1I50 H;  2CVR A;  1VQH A;  2XRS D;  2EYL A;  1CA6 A;  1OTC A;  1FGB D;  1SAP A;  1IYU A;  1U9R A;  1B70 B;  2EXD A;  1SYD A;  3J80 i;  5LL6 X;  1R9T B;  4R4O A;  1SRU A;  3E3X A;  3JAM c;  4JI3 Q;  3A0J A;  3CC7 A;  4X65 L;  2VB2 X;  1T5X D;  1RTO A;  4BY7 G;  4XT3 B;  1XMO Q;  3MWY W;  4JI5 Q;  3HOV H;  4ALP A;  4H7B A;  3E0E A;  2K01 A;  2WV6 D;  4L5S A;  2ALY B;  2QW7 A;  1JCK B;  2VY3 A;  2G5D A;  2HT1 A;  4JI6 Q;  1I3Q H;  1YHQ A;  5JEA G;  4FF1 A;  2WAQ G;  1BCP F;  3AFQ A;  3K5L A;  5HUR A;  1W6J A;  3GTG H;  3CW2 C;  3GTJ H;  3K7A B;  4KN7 C;  1MJE A;  4DUZ Q;  1X3F A;  2PW7 A;  1QCB D;  2WAC A;  1C7Y A;  1UE6 A;  3AMU A;  5C4J B;  3F1Z A;  5E4W C;  5E7N A;  5IP7 H;  1SMY D;  4HCS A;  3IKJ A;  1GUT A;  5ELO A;  1Y69 U;  2ZT9 C;  1EY6 A;  2IT1 A;  5EBD A;  3TRZ A;  1ICF B;  5EKL A;  4KHV A;  4DK1 A;  2UUB Q;  3PUX A;  4WRD A;  3HEJ A;  4AYB B;  1DOL A;  3CCE A;  1LYL A;  4K6D A;  2KCC A;  3VR2 A;  1B3A A;  5LMN L;  4JI4 Q;  2HIV A;  3QJY A;  3QOJ A;  4R8N A;  1DON A;  3ND9 A;  1JJG A;  4GLA C;  2XTI A;  4A3I H;  1PH1 A;  2R92 B;  1KL9 A;  2L12 A;  4OL7 A;  1EL0 A;  4TKO B;  5G3L F;  1SLJ A;  3KF8 B;  1NNX A;  1S4Z A;  1Z6H A;  4A3C H;  2B2U C;  2KCT A;  4L5R C;  2UU9 Q;  2EDG A;  1TS2 A;  2B63 B;  2IX0 A;  3MAQ A;  3RLF A;  5DLQ E;  5CBA E;  3F2U A;  3KLS X;  4PZ7 A;  4C3H G;  3P1H A;  2JA7 H;  4BY1 H;  3S9W A;  2NN6 G;  4DR2 Q;  3TME A;  1EQV A;  3TN2 A;  4CJ2 C;  3I56 A;  5FO9 B;  5L37 A;  4KV6 A;  2K14 A;  2GN5 A;  1XNR L;  1OXV A;  1EY5 A;  1FNU A;  2B2T A;  2KEN A;  4YWM A;  3MXP A;  2QF7 A;  4AQY L;  1Q8I A;  4MZ9 A;  4BY7 B;  4B3S Q;  1TS5 A;  4B3T L;  1K0R A;  3O13 A;  1UE5 A;  5IOD A;  1CTM A;  2RDF A;  4DK6 C;  1S5B D;  2BH2 A;  1Q12 A;  2GA4 B;  4QUC A;  5C6A A;  2WAQ B;  4BA1 I;  1PVO A;  5BN5 A;  2ZJP A;  2HUG A;  3F8T A;  1ZYR C;  5FLM G;  1Y8O B;  2BOS A;  3JC6 6;  4A76 A;  1QZH A;  4QQB X;  4LF7 Q;  3H3V C;  3OSO A;  1O78 A;  5A35 A;  2JN4 A;  2VXW A;  4GKK L;  2OCE A;  3S15 H;  5I2Y A;  1D8L A;  5I4D A;  2RHQ B;  4FVM A;  3T53 B;  1Q82 C;  1PTO B;  3CCR A;  2BDN A;  2A1A A;  5FO7 B;  1R4Q B;  3T56 B;  1H9S A;  1JJC B;  3PGZ A;  3PMF A;  1XNQ Q;  4DAM A;  1IBK L;  1HFN A;  4G4K A;  1TWA H;  2PNH A;  4JI2 Q;  1K0S A;  3SEB A;  2CQA A;  3QO2 A;  4GN5 A;  5D65 A;  5JOB A;  2OEO A;  5AJ3 Q;  4IFD H;  1QVC A;  3CPF A;  3N6R A;  3EFX D;  3RZO H;  1ONL A;  2F0W A;  3M3Y B;  4DR7 L;  2F0I A;  2C5C A;  2K6A A;  1Y1V G;  3K59 A;  3SVM A;  3E6Z X;  1YHB A;  4IFD J;  1I4G A;  4YY3 Q;  1QVG A;  1Z9F A;  2EPB A;  4XQJ A;  3ITP A;  3G71 A;  4A3E G;  2XIW A;  2E75 C;  2K04 A;  4PMC A;  2QKI C;  4DR6 L;  5BN3 A;  2Y0S E;  4QB4 A;  5HY6 A;  4RGN A;  4JI8 L;  1STN A;  3HOW H;  5I9P A;  4A3M G;  1A63 A;  1SDF A;  2B2Y A;  4JYA L;  2PZT A;  1PH5 A;  4GS3 A;  1Y1W H;  3UI2 A;  3HOX H;  4DAY A;  2KBN A;  3KDF B;  1W6K A;  4DUY L;  1BXT A;  1AE3 A;  4J8Q A;  1LTG D;  1VQM A;  3I4M H;  2F3V A;  1KAW A;  2L9H A;  3IFD A;  1D1K A;  5C5L A;  5IP7 G;  2DUD A;  3ULJ A;  3GTP H;  3CCJ A;  1VQE A;  5C0X I;  1K3B C;  3S16 B;  5CV7 A;  1VQA A;  4DPG A;  2XRQ D;  3VYS A;  1Y8P B;  5CYU A;  4P74 A;  3DLL A;  3HS0 C;  1K8O A;  1CT1 D;  4GN3 B;  1QIL A;  1X54 A;  4A3L G;  1DCZ A;  4MIU A;  4ZUI A;  4CHT B;  5IWA Q;  1GJX A;  1LT3 D;  1RD9 D;  4P73 A;  3Q0A A;  3OW2 A;  4LJZ C;  3MA2 B;  5ELB A;  4JG2 A;  2K03 A;  3I4N G;  2RDG A;  4KY5 A;  4LF6 Q;  1FNV A;  2RSO A;  4X3S A;  2K5W A;  1N32 Q;  1NE3 A;  1Q1E A;  3RUZ A;  4HAE A;  2Q8I B;  1PDQ A;  1STE A;  3S14 H;  2FIN B;  1TKW B;  2F0V A;  5KND A;  2D9U A;  2F03 A;  4L8J A;  4IFD I;  1W3S A;  3T1H Q;  4LFA L;  2X6G A;  1KXL A;  3C2P A;  2JA7 G;  1KNE A;  1V43 A;  1ZEQ X;  1Y1V B;  2EXZ A;  3RZD B;  1OO9 B;  1HNZ Q;  1TXY A;  5ELN A;  1PRT D;  3H91 A;  5IYD H;  1JB3 A;  1BBU A;  4DV5 L;  2OQK A;  5LHY 1;  2JA8 H;  3DUZ A;  3R8B A;  1STY A;  1UEA B;  4A3E B;  1IW7 C;  2ZTE A;  5H1S E;  1EZ6 A;  4AYB E;  2O5I C;  5C44 H;  1NJI C;  3HOY G;  1QWY A;  1G2T A;  3TS0 A;  4C56 C;  1JOK A;  1VQF A;  2N3S A;  3CD6 A;  3EBE A;  1PH9 A;  4CGY B;  1LO5 D;  1BCP C;  5FLX L;  4A3M B;  4RFB A;  2G9H D;  4YCW A;  1WVL A;  4HN7 A;  1JT8 A;  4OEM B;  4BWG B;  1VQ6 A;  2MGS A;  4DA2 A;  2AMC B;  4JOI C;  4JW0 A;  1TWC H;  2R3Z A;  5F2D A;  5JPN C;  1TWG H;  2KA7 A;  4R8I A;  3PSI A;  3CCU A;  3KBG A;  3RMH A;  4A3B H;  2LKV A;  4GZY C;  4LF4 L;  2WII B;  3PO2 H;  2B2U A;  3TBI B;  2O4X A;  5IGD A;  3DXJ C;  3S1R H;  1VQ8 A;  1HTL D;  4PMB A;  4OWX B;  2UXB Q;  4K0K L;  1Z7T A;  1P8L A;  3SK5 A;  2IL8 A;  1MI2 A;  2NTS A;  3PCO B;  1G51 A;  1E24 A;  5M3F G;  1M1K C;  2CW0 C;  1N9W A;  1EQT A;  2KEC A;  4DNR B;  3X3N A;  2H4O A;  2Z6K C;  1O80 A;  3T1Y Q;  3HP3 A;  1GUO A;  1PZK D;  2ZXR A;  5IYB G;  1IYJ B;  1M90 C;  5DM6 3;  4G7Z C;  1PYW D;  1SN8 A;  4JI0 Q;  1ENC A;  5GQO A;  4OXP A;  4X3U A;  3I4N B;  5JJI A;  2DY8 A;  3BYT B;  3D8G A;  2M9V A;  4KKT A;  5C4J H;  4NXM Q;  1V1Q A;  4YWK A;  1LT4 D;  1VCI A;  3GD7 A;  3QWN A;  3NWT A;  2CWA A;  1LTA D;  2PQE A;  2BA1 A;  3GQB A;  3QIA A;  5HGT A;  5EQ0 A;  1DXM A;  2EJF C;  1BBX C;  1KDA A;  3D6W A;  2FXQ A;  3BJU A;  4P2C B;  4XQQ A;  3AEV A;  3NEL A;  1I4Q A;  1BBW A;  3PUW A;  4FO2 A;  2AWN A;  5FLX E;  3A74 A;  2EE1 A;  1SFO B;  3J80 c;  2UXD L;  1QJO A;  4I7A A;  4FF4 A;  3DWP A;  3S1N B;  3HFZ B;  1KD1 C;  3LNN A;  2EY1 A;  1JC7 A;  3NPP A;  5DM7 3;  1X9N A;  3HOW G;  4LFB Q;  5ELD A;  4YWL A;  2IWH A;  5JPM C;  4JBJ A;  3BVG A;  3KF8 A;  3A55 A;  4GKJ Q;  4BS9 A;  3L9A X;  1E3P A;  4HED A;  3HOY B;  4DK3 C;  3A56 A;  1Y1W G;  3CC4 A;  2R7D A;  3HOX G;  1J5E L;  4CDC C;  4ABN A;  4LF8 L;  4OO1 I;  1HNX L;  1STG A;  3OIQ A;  3URY A;  1VF5 C;  3M4P A;  3J7A 5;  4F7X A;  5E3F A;  4ZKC B;  2NVY B;  3UE0 A;  3FMC A;  1SNO A;  1EOT A;  3M4Q A;  2F0K A;  2B2V A;  3NXW A;  4LUO A;  3NHH A;  2R7Z H;  4R1J A;  4IPC A;  2YU9 B;  4ZCK A;  3IAY A;  4NW2 A;  2EZV A;  2VUM H;  2E74 C;  3I4L A;  5C4X H;  4RMF A;  3C1E A;  3CCM A;  3M9B A;  4C3J B;  4DR4 Q;  3J81 j;  4FF2 A;  3S2H B;  3NK9 A;  4IUV A;  1V1P A;  2B2T C;  4IUQ A;  4MTK A;  5M3F B;  1YJ9 A;  2BE5 C;  2OTL A;  4IOA A;  3MFY A;  1JMC A;  3K58 A;  1GOZ A;  4AIM A;  1EYD A;  2K75 A;  3Q8D A;  2UUC L;  1D7Q A;  1CUK A;  2ENB A;  2L55 A;  1CK1 A;  2GVB A;  1QE6 A;  3NBH A;  3M4O B;  3PUZ A;  4BBR H;  1D5X C;  1PTO H;  5IYD G;  1JOO A;  4ZK9 B;  4X64 Q;  4F88 A;  4HSP A;  3C3L A;  1GUS A;  2ZXP A;  4DV1 L;  4DAY B;  3NEM A;  2C9O A;  1EY9 A;  1B44 D;  1D2B A;  5FJ8 G;  2F0E A;  3VYU A;  4K6L A;  2OWO A;  1KDB A;  2NUC A;  4K5W A;  3H3V I;  1Q1B A;  1WYD A;  4C2M H;  4NKL A;  3FHW A;  2Q8T A;  2WKC A;  2A68 C;  3RNU A;  2I5M X;  2F4V L;  4DV4 Q;  2ASB A;  2EYM A;  1VDZ A;  5DAU A;  1PHJ A;  1VQG A;  3KK7 A;  2FMC A;  4K14 A;  4DV7 Q;  1U5K A;  1SE2 A;  4RWS C;  4KY7 A;  2V4D A;  4ZUJ A;  3I55 A;  4B3M L;  2JA6 B;  3GP7 A;  2L0C A;  1FVI A;  4OGQ C;  4RA8 A;  2PPB C;  4DV6 L;  2Z4I A;  3K7U C;  3PO2 G;  1EY8 A;  4UPA A;  4LFC Q;  4BBS G;  1BQQ T;  1ZYR D;  2F3I A;  4R4Q A;  2EYH A;  2UXC L;  1KAB A;  3NE5 B;  1FJG Q;  3OMC A;  2JK8 A;  3HZX A;  4A3F H;  4R4C A;  1N36 L;  3GTM H;  1PFM A;  1IYV A;  3T51 B;  2JSO A;  2E2I B;  1WD1 A;  2Z6B A;  3A8I E;  1ML0 D;  1SNQ A;  4YIJ A;  4A3K G;  3BVM A;  4OX9 Q;  1H95 A;  3I70 A;  2A74 C;  2CFM A;  4XDX A;  2M00 A;  1GXD C;  1EU3 A;  5IGC A;  4HSV A;  2EYJ A;  2RA4 A;  3QG1 A;  1AEX A;  1UE1 A;  1L1O B;  4KD4 A;  4A3G G;  1PZI D;  2B2Y C;  2NVQ H;  2DNE A;  2K5D A;  3CXC A;  3L7Z C;  2NB0 A;  3W3A A;  1ASY A;  1ET6 A;  1SNC A;  4RKL A;  5KGU A;  3S17 B;  2MUY A;  4YCU A;  1TWH B;  4B3R Q;  3J7A F;  3SK8 A;  1E7Z A;  3GTO H;  2F0P A;  4RKB A;  2J7Z A;  1AFP A;  4BXX G;  2A6H C;  3H0G G;  4IUT A;  3K8A A;  1CFM A;  5C3E H;  1IBM L;  4CDE C;  2DN8 A;  5J3B A;  3TZU A;  2HCC A;  1KLG D;  1TU2 B;  5IT9 L;  3EJI A;  2QA4 A;  1ASZ A;  4G7O C;  2EIF A;  2PZW A;  3NTK A;  1UUP A;  1ENA A;  2KCN A;  3H15 A;  1PYS B;  4DV3 Q;  3TSS A;  1G29 1;  1MKH A;  1K8G A;  1JWM D;  3BG3 A;  3NTH A;  1KC8 C;  4X62 L;  1A8V A;  1KTK A;  4GOP A;  1AH9 A;  2JXM B;  1TWF H;  1HNW L;  1RIP A;  1B1Z A;  2ZM6 L;  4DR3 L;  3FPP A;  4C1N K;  2WB1 G;  1KIX A;  2KHJ A;  2A19 A;  3MVV A;  1JJ2 A;  1NMF A;  2Z6K A;  2EJM A;  2R93 B;  1K83 B;  1F2M A;  1SYE A;  1PTO D;  5K5P A;  2XWJ B;  4IQZ A;  2Z9H A;  1L1O C;  1HZC A;  2A6E D;  1JWS D;  2K5H A;  2NVT B;  3LX0 A;  4QIW E;  4C3I B;  1GD7 A;  4DNT B;  1I4H A;  1HR0 Q;  4JBK A;  2R7F A;  2NN6 I;  3J7A V;  2OF1 A;  1X55 A;  1WCM G;  2AKW B;  3OTO L;  3Q24 A;  3S1Q H;  3BDO A;  1CQF A;  5CMD A;  1C8C A;  1LV9 A;  3OWF A;  2ATW A;  4A3K B;  2JYO A;  1AE2 A;  3D0F A;  4HID A;  1HA5 A;  3MTS A;  3BZK A;  2NYZ D;  3QB3 A;  4DN4 M;  2NZO A;  4A3G B;  5C4Z A;  5IT9 E;  2NWG A;  4OIJ A;  4XIG S;  2VB3 X;  4GNX A;  2YTV A;  4LF9 L;  3HOU B;  1DD2 A;  4LF5 L;  1JR0 D;  3R93 A;  4A3J G;  1EYC A;  4BBR G;  2MNA A;  1Q90 A;  1Q8K A;  3BDL A;  2PYK A;  3LGJ A;  2A69 C;  2HHH Q;  2RSN A;  4KKU A;  4DK0 A;  1IKM A;  1F9R A;  1B8A A;  1KHI A;  4ID6 A;  1QVF A;  3H0G B;  3GTK H;  5CV9 A;  1Q3L A;  1STB A;  5M5Y H;  2C35 B;  1LTR D;  1KDC A;  2LY7 A;  1B2T A;  1NSN S;  1K28 A;  4JBW A;  3UE1 A;  1IW7 D;  2Q2T A;  1UEB A;  3GTQ H;  1UAP A;  2OT2 A;  3VYT A;  3Q22 A;  1D1I A;  1BOS A;  2JEA I;  1VQK A;  4JI1 Q;  5KRU A;  2WB1 B;  4BA2 I;  3D4R A;  3PO3 G;  3ER0 A;  2N88 A;  4FXD A;  3CRK C;  4JV5 L;  1I94 Q;  4X66 Q;  2F0G A;  2F52 A;  4IZ8 A;  1V1P B;  1RCV D;  3K6O A;  1NR2 A;  1EWH A;  3Q6S A;  1ICW A;  1CM9 A;  5EAY A;  4G7H C;  4QJF A;  1H9K A;  5C0X H;  1A3T A;  1RF2 D;  4A3D G;  1B7Y B;  3T1Y L;  1Z47 A;  3SXH A;  1RJT A;  3I8Z A;  3FRP B;  3FKI H;  5I6Y A;  1VF7 A;  1VQJ A;  1HH2 P;  1HZA A;  1SND A;  3VYR A;  2E2J B;  2Q2H A;  3U9S A;  4KHP L;  5C0X J;  1WCM B;  3NBH B;  1N33 Q;  3CQZ H;  3T13 A;  4N8X 1;  2CW0 D;  1K73 C;  1EFI D;  1FD7 D;  1CHQ D;  3TP5 A;  3M85 A;  2SNS A;  3NTI A;  1SYG A;  2JA5 G;  3TEH B;  5G3L D;  5C3X A;  1IBL L;  2DY7 A;  3ICE A;  4P71 A;  5JVG 3;  1PH3 A;  1WTP A;  2M2L A;  4A3J B;  1EWC A;  3EQL C;  3HOZ H;  5M9O A;  5IIF A;  2ZXO A;  5IP9 G;  3WDN A;  4JVZ A;  5KIX A; 
#chains in the Genus database with same CATH homology
 2IX1 A;  2B2V C;  1CI3 M;  3K5N A;  3CU7 A;  2PMZ B;  2XSC A;  3GO5 A;  5T1G A;  1F2L A;  4ZYS A;  2Z4H A;  3NP8 A;  2O5J C;  1A3V A;  4HR7 B;  5IGE A;  2EY5 A;  1X3P A;  4ZQ3 A;  4C3H B;  3RD4 A;  2F0N A;  1EIG A;  4ZRZ A;  2K5Q A;  2MHV A;  2NVX B;  1LAB A;  3DHQ A;  1HQM C;  1JQY D;  3G7L A;  3PO3 B;  1C48 A;  1GUW A;  5M5W B;  1F2Z A;  1XTC D;  2DNC A;  1I6V C;  1RHP A;  1JWU D;  2PZU A;  1SYC A;  4A3D B;  4XTC S;  4FF3 A;  1LT5 D;  2TSS A;  5CR3 A;  1HHV A;  3E0J A;  1BCP B;  3AU7 A;  1PMR A;  3NBI A;  2F1M A;  1C4Q A;  1ET9 A;  1QNK A;  3JAM L;  2E2D C;  2BE5 D;  2MJ8 A;  2PO4 A;  1YNJ C;  5CV4 A;  1O7Z A;  1J8I A;  1NCV A;  1BNZ A;  1XXG A;  2SOB A;  4UAI A;  1SMY C;  1SJH D;  4C1N I;  1HUN A;  1V8Q A;  1HCZ A;  4CBV A;  1ESF A;  5KNC A;  3LWU A;  5EPK A;  3K5M A;  3PV0 A;  1I50 B;  5D3D A;  1B4O A;  1PFN A;  2FMM A;  2F0S A;  5CC4 A;  1LTT D;  1AW7 A;  1E2Z A;  4RGM A;  3VR3 A;  3BS1 A;  1I4P A;  1SJE D;  2A68 D;  3VR6 A;  2HCI A;  1AN8 A;  2K33 A;  4OO1 H;  3HOV B;  1L0X B;  2K1B A;  2Q8R E;  2EY2 A;  2SEB D;  1I3Q B;  1MD2 D;  3GTG B;  3TP7 A;  3JAM E;  3GTJ B;  1O7L A;  3HG9 A;  3DWA A;  4V0B A;  2WKD A;  4RH6 A;  4ME5 A;  3FPU B;  2LFN A;  1RDP D;  3H94 A;  4K2L A;  1BUV T;  4B9X A;  5EPL A;  2L11 A;  2FHT A;  3MZ5 A;  1B9N A;  1F9Q A;  1G8Z D;  3DEP A;  3NWS A;  3WOE A;  4OIK A;  4A3I B;  4IFD G;  2RDH A;  4I7Z C;  2NZ1 D;  1B53 A;  1EZ8 A;  2EOT A;  3V2T A;  2F0D A;  5A2Q L;  1DZ1 A;  1ZXT A;  2B8G A;  2KUM A;  1QB5 D;  4PNY A;  1S5D D;  1H9M A;  5COY A;  1MGS A;  2JA7 B;  3SK6 A;  4BY1 B;  1SE3 A;  2L4N A;  3OHX C;  2FJ2 A;  4XQN A;  1SNP A;  1JOQ A;  2KEE A;  2AWO A;  2F0T A;  1FR3 A;  3FEW X;  1HPC A;  3K0Y A;  5CV8 A;  4PV1 C;  3P7J A;  1A2T A;  4DAV A;  4F8M A;  4IUR A;  2VNU D;  1I4R A;  1AZQ A;  1JOR A;  2F0M A;  1V1O A;  3S15 B;  4F87 A;  1X3Q A;  1SYB A;  1GHK A;  4IN3 A;  5EKI A;  5A2Q E;  1JE4 A;  4KD3 A;  1QNU A;  1F9S A;  1GUG A;  1CZG A;  2LS0 1;  1TWA B;  4KN4 C;  4V19 0;  5JEA H;  2AQ3 B;  4XT1 B;  5IGB A;  1D5M C;  2A69 D;  2K32 A;  3RZO B;  4XYQ A;  2RBM A;  5JEA J;  3MEH A;  5KYL A;  2SDF A;  4HTH A;  1B50 A;  4RGO S;  3C46 A;  1K8M A;  3KUP A;  3OWE B;  1XX8 A;  2F0F A;  1LLR D;  4R9W A;  2X6L A;  4U67 3;  3J7Y W;  3FDT A;  1U4L A;  4K8I A;  1F77 A;  3WOF A;  4OO1 G;  4L63 B;  1PLF A;  3HOW B;  1ENF A;  4ZKB B;  2B8F A;  1HUM A;  5I6W A;  4DXG A;  1Y1W B;  3CHB D;  5JVH 3;  3HOX B;  1ILQ A;  4H0L C;  4QMG A;  2A5H A;  3I4M B;  1L0Y B;  1Y8N B;  2RQX A;  4N9P A;  1AP0 A;  3VR5 A;  3M4Y A;  1TS3 A;  3GTP B;  5EKK A;  2K7V A;  2NN6 H;  3BZD B;  1WTX A;  3D31 A;  1U4R A;  4IUP A;  1A6X A;  3TDQ A;  4X3K A;  1E2V A;  1G6Z A;  1STH A;  2D62 A;  1RTN A;  2H1E A;  5ELE A;  2R6G A;  1M4V A;  5J39 A;  4NMZ A;  3HGB A;  4J6H A;  2ICE C;  1HTP A;  1PTO F;  2F0O A;  2TMP A;  4DGZ A;  5NUC A;  1NR4 A;  1BDO A;  5C3W A;  3MXG A;  2F0Q A;  4DU9 A;  3BYY B;  3S14 B;  3OW7 A;  4CKB A;  4KJN A;  1PZJ D;  4DF7 A;  3K5O A;  2JA8 B;  2WIN B;  2IPK D;  1TQO A;  4ODG A;  2IW3 A;  3L3O C;  1O7Y A;  4TRD A;  1TS4 A;  5IOC A;  1LTI D;  5C44 B;  3X3M A;  4MN3 A;  3A8J E;  3CKI B;  1B9M A;  1SYF A;  3MHB A;  2F0L A;  4M1U B;  3J81 L;  1CA5 A;  2PCF B;  3T4A C;  1TWC B;  1TWG B;  3A7L A;  4JK1 C;  1S5E D;  3MC0 B;  4A3B B;  2KVM A;  2RKS A;  1DOK A;  3J80 L;  1EEI D;  2KHS A;  3PO2 B;  4TQU S;  4BBS B;  5CV6 A;  2L1B A;  3ONA B;  2EJG C;  5EGT A;  3PUV A;  1D6E C;  4K5V A;  2I07 B;  2X69 A;  3S1R B;  1EU4 A;  4NP5 A;  3ERQ A;  4FXG C;  1YNJ D;  3TZD A;  3PUY A;  4FXK C;  3I3C A;  5FO8 B;  3TP8 A;  1TR5 A;  4L6T B;  1SE4 A;  4KMU C;  1IHZ A;  2ICI A;  3BDC A;  3GV6 A;  3R2I A;  4KI0 A;  3J81 E;  3ZYY X;  4ZAI A;  1EY0 A;  2XVS A;  1H9J A;  1R4P B;  2AUJ D;  5TSS A;  4RCN A;  1KLU D;  3MXU A;  3SE0 A;  3J80 E;  1QOH A;  2QDB A;  1KAA A;  5FK9 C;  1BCP D;  4X3T A;  4K2K A;  5I9O A;  3ND8 A;  5K36 H;  2A73 B;  1YNN C;  1TY0 A;  1GHJ A;  2R7Z B;  3KLS A;  4RHR A;  5D3I B;  4KY6 A;  3T16 A;  4PQX A;  4H13 C;  2VUM B;  2KED A;  5CBE E;  5C4X B;  2SNM A;  5DNF A;  4DXF A;  1PXU A;  3EA6 A;  3NUC A;  4QF4 A;  2QIL A;  4KHZ A;  5DEH A;  4NDX A;  1SNM A;  1OXS C;  3EVQ A;  1DYQ A;  4DFA A;  1NUC A;  4WFN 3;  4RAU C;  3MXN A;  3H6M A;  1H9R A;  2L5T A;  1E2W A;  1SSO A;  1U4P A;  4BBR B;  3U9O A;  3D6C A;  1LAC A;  1LT6 D;  1A15 A;  3D3R A;  3NQI A;  3P20 A;  4Q5V A;  4N9T A;  2OXP A;  2JP1 A;  3C1F A;  2AUK A;  3R2T A;  4EQN A;  2HDM A;  4O1N A;  5ISR A;  3AB9 A;  4C2M B;  2XN9 C;  3OPO A;  1TY2 A;  1VMC A;  5ELF A;  1NAP A;  3DWQ A;  1BR9 A;  4IUU A;  2K28 A;  2BCO A;  3SDZ A;  1HQR D;  3I90 A;  3ERO A;  4XXE A;  1G91 A;  1WTR A;  1AZP A;  3IL8 A;  2HDL A;  4LK1 C;  5KYI A;  1WTV A;  1OXU A;  5J1Z A;  3N52 A;  3DM1 A;  4ULL A;  4KKS A;  1LTB D;  1PRT F;  1M8A A;  1CHP D;  4A3F B;  1OXT A;  1S5C D;  3GTM B;  1LTS D;  1II3 A;  1EY7 A;  3H09 A;  4RHS A;  2KQ3 A;  2YYZ A;  4B08 A;  5CV5 A;  1PTO C;  4K5X A;  2B2W C;  4S3S A;  4CJ1 B;  2NVQ B;  3VA5 A;  2A6E C;  2B39 A;  1HFG A;  2JA5 B;  2CHB D;  4DAP A;  5T1I A;  1DM0 B;  5FKA C;  4QUF A;  1F9P A;  3W2D A;  4EVO A;  3GTO B;  2Z1C A;  3LWE A;  4B9W A;  2F3W A;  1WTW A;  1JIC A;  5C3E B;  1WTQ A;  1GUN A;  1BF4 A;  2D5D A;  4QCL A;  1IKL A;  1DOM A;  2F0J A;  5C5M A;  4FP5 D;  1SXT A;  1T5E A;  1DJR D;  1QG7 A;  3HKZ B;  1TWF B;  5COR A;  3I72 A;  4LAA A;  1ESR A;  4FNF A;  5K36 G;  3P75 A;  5J22 A;  2O2L D;  1ILP A;  1I4X A;  1CZW A;  1HRJ A;  2KJX A;  3BVZ A;  5CGK A;  1CQV A;  5C0X G;  2F4I A;  1ZKO A;  4HMJ A;  2J4X A;  3V96 A;  1SBB B;  4E6I A;  5KEE A;  3MFG A;  3CRL C;  2E76 C;  5I2X A;  3S1Q B;  1X32 A;  1WTO A;  2JEB I;  2QCP X;  5IGG A;  2EYF A;  2JE6 I;  1ROD A;  1WD0 A;  1FNW A;  3TP6 A;  2EY6 A;  3SHL A;  5JJZ A;  4IUN A;  3R3O A;  2MP1 A;  4C3J G;  4XYO A;  3DMU A;  1EY4 A;  4CKE A;  2A6H D;  2R61 A;  2WP8 J;  3GTK B;  1XYI A;  1FYC A;  2AQ1 B;  5M5Y B;  5ELC A;  3I91 A;  1J9O A;  5AFW A;  5EJW A;  4K8J A;  4ZLT F;  1G2S A;  4I65 A;  3GTQ B;  1A2U A;  2XWB B;  5IGF A;  4PMW A;  4RGT A;  1TII D;  5FOB B;  3M7N A;  1HXY D;  2RVL A;  1EYA A;  2QEJ C;  4QIW B;  1MBY A;  4HCE A;  1TT2 A;  4Z9C B;  2PW5 A;  3Q23 A;  3VR4 A;  2I46 A;  4WJW A;  2EVB A;  5BN4 A;  2FFK B;  1D5Z C;  3FKI B;  3D4W A;  5KNB A;  3SR1 A;  3V05 A;  2F0H A;  4O42 A;  3QOL A;  2LMC B;  4J1M A;  3CQZ B;  1MSH A;  1PRT B;  3DEO A;  3M7G A;  2IJ0 A;  5LL6 S;  4KTA A;  1UNS A;  4ILW A;  1H9S B;  2K05 A;  2PNR C;  5E1F A;  4HMI A;  4UDU C;  3VA7 A;  4MHE A;  1F2Y A;  3HOZ B;  1VMP A;  2E2H B;  4M8A A;  3KBX A;  4CJ0 B;  4A93 B;  5JAV A;  2NBF A;  4EQO A;  1PFB A;  4LMQ D;  3PIP 3;  4Y7N B;  4RCO A;  3A54 A;  1HA6 A;  4G57 A;  2XNA C;  2N55 A;  3A7A B;  4OHJ A;  5E4X A;  1U4M A;  1S5F D;  4EQP A;  2B2W A;  3NSW A;  1E0B A;  1MSG A;  1IL8 A;  2J0T D;  1XWE A;  4U68 A;  1PRT C;  2EYO A;  1YNN D;  4WOR A;  5EBC A;  1A3U A;  2AQ2 B;  3G6J B;  2D2C C;  2F0U A;  3OIP A;  2KOL A;  2BDO A;  2HQE A;  1BO0 A;  4IAL A;  1OXX K;  1SEB D;  3SK4 A;  3HRZ C;  1RKN A;  2IX3 A;  5D14 A;  2NTT A;  3A8K E;  3NQT A;  3PIO 3;  3GTL B;  4C3I G;  4EGV A;  1STA A;  3S1M B;  3OOC A;  1TVX A;  2MPM A;  3K57 A;  1KNA A;  4TSS A;  3KLR A;  3D4D A;  3IFT A;  2G9D A;  3S2D B;  2Y0S B;  2ID0 A;  5M3M B;  1EIH A;  4FYD A;  5EPJ A;  4KJO A;  3GV3 A;  4Q0F A;  4H44 C;  2EYP A;  5C4H A;  1I6H B;  3FVQ A;  5M5X B;  4CKC A;  2Z8L A;  3E5S A;  4KK7 A;  1EEF D;  3OMG A;  2BA0 A;  3I73 A;  5BN3 A;  2CVR A;  2XRS D;  2EYL A;  1CA6 A;  1FGB D;  1SAP A;  1IYU A;  1U9R A;  1SYD A;  5LL6 X;  1R9T B;  2VB2 X;  1T5X D;  1RTO A;  4XT3 B;  3MWY W;  4H7B A;  2K01 A;  2WV6 D;  1JCK B;  5JEA G;  4FF1 A;  1BCP F;  3K5L A;  5HUR A;  1W6J A;  3K7A B;  4KN7 C;  2PW7 A;  2WAC A;  1QCB D;  3AMU A;  5C4J B;  5E4W C;  1SMY D;  4HCS A;  3IKJ A;  1GUT A;  1Y69 U;  2ZT9 C;  1EY6 A;  2IT1 A;  5EBD A;  5EKL A;  4KHV A;  4DK1 A;  3PUX A;  4WRD A;  3HEJ A;  4AYB B;  1DOL A;  4K6D A;  2KCC A;  3VR2 A;  1B3A A;  3QJY A;  3QOJ A;  4R8N A;  1DON A;  3ND9 A;  2R92 B;  2L12 A;  4OL7 A;  1EL0 A;  4TKO B;  5G3L F;  1S4Z A;  1Z6H A;  2B2U C;  2EDG A;  1TS2 A;  2B63 B;  2IX0 A;  3MAQ A;  3RLF A;  5CBA E;  3F2U A;  3KLS X;  4C3H G;  3P1H A;  3S9W A;  2NN6 G;  3TME A;  1EQV A;  3TN2 A;  4CJ2 C;  5FO9 B;  4KV6 A;  1OXV A;  1EY5 A;  1FNU A;  2B2T A;  3MXP A;  2QF7 A;  1Q8I A;  4BY7 B;  1TS5 A;  3O13 A;  5IOD A;  1CTM A;  2RDF A;  1S5B D;  4QUC A;  1Q12 A;  2GA4 B;  5C6A A;  2WAQ B;  4BA1 I;  5BN5 A;  2HUG A;  1ZYR C;  1Y8O B;  2BOS A;  3H3V C;  3OSO A;  1O78 A;  5A35 A;  2VXW A;  5I2Y A;  5I4D A;  4FVM A;  3T53 B;  1PTO B;  2BDN A;  5FO7 B;  1R4Q B;  3T56 B;  1H9S A;  3PMF A;  1HFN A;  4G4K A;  3SEB A;  2CQA A;  3QO2 A;  5D65 A;  5JOB A;  2OEO A;  4IFD H;  3N6R A;  3EFX D;  1ONL A;  2F0W A;  3M3Y B;  2F0I A;  2C5C A;  2K6A A;  3K59 A;  3SVM A;  3E6Z X;  4IFD J;  1I4G A;  2EPB A;  4XQJ A;  3ITP A;  2XIW A;  2E75 C;  2K04 A;  4PMC A;  2QKI C;  4QB4 A;  4RGN A;  1STN A;  5I9P A;  1SDF A;  2B2Y A;  2PZT A;  3UI2 A;  4DAY A;  1W6K A;  1BXT A;  4J8Q A;  1LTG D;  2F3V A;  2L9H A;  3IFD A;  1D1K A;  5C5L A;  5C0X I;  3S16 B;  5CV7 A;  2XRQ D;  3VYS A;  1Y8P B;  5CYU A;  3HS0 C;  1K8O A;  1CT1 D;  1QIL A;  1DCZ A;  4MIU A;  4ZUI A;  4CHT B;  1GJX A;  1LT3 D;  1RD9 D;  3Q0A A;  4LJZ C;  3MA2 B;  5ELB A;  2K03 A;  2RDG A;  4KY5 A;  1FNV A;  2RSO A;  4X3S A;  2K5W A;  1Q1E A;  3RUZ A;  4HAE A;  2Q8I B;  1PDQ A;  1STE A;  2FIN B;  1TKW B;  2F0V A;  5KND A;  2D9U A;  2F03 A;  4L8J A;  4IFD I;  2X6G A;  3C2P A;  1KNE A;  1V43 A;  1ZEQ X;  1Y1V B;  2EXZ A;  3RZD B;  1OO9 B;  1PRT D;  3H91 A;  1JB3 A;  5LHY 1;  3DUZ A;  3R8B A;  1STY A;  1UEA B;  4A3E B;  1IW7 C;  1EZ6 A;  2O5I C;  1QWY A;  1G2T A;  4C56 C;  1JOK A;  4CGY B;  1LO5 D;  1BCP C;  5FLX L;  4A3M B;  4RFB A;  2G9H D;  1WVL A;  4HN7 A;  4BWG B;  2MGS A;  4DA2 A;  2R3Z A;  5F2D A;  5JPN C;  2KA7 A;  4R8I A;  3KBG A;  3RMH A;  2LKV A;  4GZY C;  2WII B;  2B2U A;  3TBI B;  2O4X A;  5IGD A;  3DXJ C;  1HTL D;  4PMB A;  1Z7T A;  3SK5 A;  2IL8 A;  1MI2 A;  2NTS A;  2CW0 C;  1EQT A;  2KEC A;  4DNR B;  3X3N A;  2H4O A;  1O80 A;  3HP3 A;  1GUO A;  1PZK D;  2ZXR A;  5DM6 3;  4G7Z C;  1PYW D;  1ENC A;  4X3U A;  3I4N B;  2DY8 A;  3BYT B;  3D8G A;  2M9V A;  4KKT A;  1LT4 D;  1VCI A;  3GD7 A;  3QWN A;  3NWT A;  1LTA D;  2PQE A;  2BA1 A;  3GQB A;  3QIA A;  5HGT A;  5EQ0 A;  1DXM A;  2EJF C;  1BBX C;  1KDA A;  3D6W A;  4P2C B;  4XQQ A;  1I4Q A;  3PUW A;  4FO2 A;  2AWN A;  5FLX E;  2EE1 A;  1SFO B;  1QJO A;  4FF4 A;  3DWP A;  3S1N B;  3LNN A;  2EY1 A;  1JC7 A;  3NPP A;  5DM7 3;  5ELD A;  5JPM C;  2IWH A;  3BVG A;  3KF8 A;  3A55 A;  4BS9 A;  3L9A X;  4HED A;  3HOY B;  3A56 A;  4ABN A;  4OO1 I;  1STG A;  3OIQ A;  3URY A;  1VF5 C;  4F7X A;  5E3F A;  4ZKC B;  2NVY B;  3FMC A;  1SNO A;  1EOT A;  2F0K A;  2B2V A;  3NXW A;  3NHH A;  2YU9 B;  3IAY A;  4NW2 A;  2EZV A;  2E74 C;  3I4L A;  3C1E A;  4C3J B;  3S2H B;  4FF2 A;  3NK9 A;  4IUV A;  1V1P A;  2B2T C;  4IUQ A;  5M3F B;  2BE5 C;  3MFY A;  3K58 A;  1GOZ A;  1EYD A;  2ENB A;  2L55 A;  1CK1 A;  3M4O B;  1QE6 A;  3NBH A;  3PUZ A;  1D5X C;  1PTO H;  1JOO A;  4ZK9 B;  4F88 A;  4HSP A;  3C3L A;  1GUS A;  2ZXP A;  2C9O A;  1EY9 A;  1B44 D;  1D2B A;  2F0E A;  3VYU A;  4K6L A;  1KDB A;  2NUC A;  4K5W A;  1Q1B A;  4NKL A;  2Q8T A;  2WKC A;  2A68 C;  2EYM A;  1VDZ A;  5DAU A;  3KK7 A;  2FMC A;  4K14 A;  1SE2 A;  4RWS C;  4KY7 A;  2V4D A;  4ZUJ A;  2JA6 B;  3GP7 A;  2L0C A;  2PPB C;  4OGQ C;  4RA8 A;  2Z4I A;  1EY8 A;  1BQQ T;  1ZYR D;  2EYH A;  1KAB A;  3NE5 B;  3OMC A;  3HZX A;  1PFM A;  1IYV A;  3T51 B;  2JSO A;  2E2I B;  1WD1 A;  4YIJ A;  3A8I E;  1ML0 D;  1SNQ A;  3BVM A;  2A74 C;  3I70 A;  4XDX A;  2M00 A;  1GXD C;  1EU3 A;  5IGC A;  4HSV A;  2EYJ A;  2RA4 A;  3QG1 A;  1AEX A;  4KD4 A;  1PZI D;  2B2Y C;  2DNE A;  2K5D A;  3L7Z C;  2NB0 A;  3W3A A;  1ET6 A;  1SNC A;  4RKL A;  5KGU A;  3S17 B;  2MUY A;  1TWH B;  3J7A F;  3SK8 A;  2F0P A;  4RKB A;  2J7Z A;  1AFP A;  2A6H C;  4IUT A;  1CFM A;  2DN8 A;  3TZU A;  2HCC A;  1KLG D;  1TU2 B;  5IT9 L;  3EJI A;  4G7O C;  2PZW A;  3NTK A;  1UUP A;  1ENA A;  2KCN A;  3TSS A;  1G29 1;  1JWM D;  3BG3 A;  3NTH A;  1KTK A;  2JXM B;  1B1Z A;  3FPP A;  4C1N K;  3MVV A;  2EJM A;  2R93 B;  1K83 B;  1F2M A;  1SYE A;  1PTO D;  5K5P A;  2XWJ B;  4IQZ A;  2A6E D;  1JWS D;  2NVT B;  3LX0 A;  4C3I B;  4DNT B;  1I4H A;  2NN6 I;  3J7A V;  2OF1 A;  3Q24 A;  3BDO A;  1CQF A;  5CMD A;  1C8C A;  1LV9 A;  3OWF A;  4A3K B;  2JYO A;  1HA5 A;  3MTS A;  2NYZ D;  3QB3 A;  4DN4 M;  4A3G B;  5C4Z A;  5IT9 E;  2NWG A;  4OIJ A;  4XIG S;  2VB3 X;  3HOU B;  1DD2 A;  1JR0 D;  3R93 A;  1EYC A;  1Q90 A;  3BDL A;  2PYK A;  2A69 C;  2RSN A;  4KKU A;  4DK0 A;  1IKM A;  1F9R A;  4ID6 A;  3H0G B;  5CV9 A;  1Q3L A;  1STB A;  1LTR D;  1KDC A;  2LY7 A;  1B2T A;  1NSN S;  4JBW A;  1IW7 D;  1UAP A;  2OT2 A;  3VYT A;  3Q22 A;  1D1I A;  1BOS A;  2JEA I;  5KRU A;  2WB1 B;  4BA2 I;  3D4R A;  2N88 A;  4FXD A;  3CRK C;  2F0G A;  4IZ8 A;  1V1P B;  1RCV D;  3K6O A;  1NR2 A;  1EWH A;  3Q6S A;  1ICW A;  1CM9 A;  4G7H C;  1H9K A;  5C0X H;  1A3T A;  1RF2 D;  1Z47 A;  3SXH A;  1RJT A;  3I8Z A;  3FRP B;  5I6Y A;  1VF7 A;  3VYR A;  1SND A;  2E2J B;  3U9S A;  5C0X J;  1WCM B;  3T13 A;  2CW0 D;  1EFI D;  1FD7 D;  3TP5 A;  1CHQ D;  3M85 A;  2SNS A;  3NTI A;  1SYG A;  5G3L D;  5C3X A;  2DY7 A;  5JVG 3;  1WTP A;  2M2L A;  4A3J B;  1EWC A;  3EQL C;  5M9O A;  5IIF A;  2ZXO A;  3WDN A;  5KIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...