2QDBA

Crystal structure of staphylococcal nuclease variant e75q/d21n/t33v/t41i/s59a/p117g/s128a at 100 k
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
125
Chain Sequence
KLHKEPATLIKAIDGNTVKLMYKGQPMVFRLLLVDIPYGPEAAAFTKKMVENAKKIEVQFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQHLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Electrostatic effects in a network of polar and ionizable groups in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 125
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2qdbA00
3T16A 1SNMA 5C5LA 3RUZA 2F0FA 5J1ZA 1A2UA 1KDCA 1SNQA 1TT2A 3MHBA 3QB3A 4QF4A 3SK4A 4K5XA 3NXWA 3TP5A 1U9RA 2EYHA 4B9XA 4EQPA 2PW7A 5C3XA 4IALA 1KDBA 2M00A 1F2ZA 5IODA 1SNDA 2EYFA 5CC4A 1A3VA 3PMFA 2F0PA 4HMJA 5ISRA 1ENCA 5F2DA 5HGTA 1F2YA 2F0WA 2F0SA 3SXHA 3T13A 2OEOA 1STGA 3EVQA 2QDBA 5CV8A 3SR1A 3D4WA 1JOQA 5I6WA 3HEJA 3TP8A 3SK5A 1EYCA 1EY0A 2F0MA 3DMUA 5I9OA 4ODGA 3SHLA 5CR3A 3TP6A 4KY5A 2O4XA 2LKVA 4EQNA 4QB4A 1TQOA 3BDCA 4KY7A 1EZ8A 2PW5A 4KJNA 1JOKA 2EYMA 4QMGA 3SK8A 1EY4A 2F0GA 4ZQ3A 3D6CA 1A3TA 4E6IA 2F0LA 2PZWA 5CGKA 5C4ZA 2EXZA 1SNOA 4EVOA 5CV6A 3SK6A 5I9PA 2EY6A 5DEHA 3MZ5A 3TP7A 5KIXA 4KTAA 2SOBA 1EYAA 4K14A 4I65A 1SYCA 4K2LA 5KYIA 4K8JA 5IGGA 5CV5A 1STNA 2OXPA 5CV9A 3R3OA 3V2TA 4RKBA 1STYA 4KHVA 1NUCA 5IGBA 2EYLA 1JORA 4K2KA 4WORA 1EY8A 1RKNA 1EY7A 1SYGA 2EYOA 3QOLA 5J39A 5EGTA 1KAAA 2EY2A 1SYDA 5HURA 3OMCA 2ENBA 3NP8A 2F0EA 2PYKA 5IGEA 3DHQA 2F0IA 4HMIA 4KJOA 4IZ8A 5EKLA 1SYBA 5NUCA 4RKLA 4DF7A 4DGZA 2NUCA 1EY5A 4KD3A 4S3SA 5C5MA 4J1MA 4KY6A 3H6MA 2F0JA 2OF1A 3OMGA 2SNMA 3C1EA 3EJIA 3HZXA 4KV6A 4N9TA 5DAUA 4DFAA 5IGDA 5IOCA 2F0KA 4B9WA 5K5PA 4EQOA 3NK9A 3OWFA 5CV7A 3U9OA 4HTHA 2EYPA 5EKKA 5E1FA 1EY9A 5KYLA 5KEEA 4J6HA 2F3WA 4YIJA 1EYDA 5JAVA 5J22A 1F2MA 1KDAA 3S9WA 4K8IA 4LAAA 1NSNS 3E5SA 2F0NA 4K6DA 4ME5A 1AEXA 3P75A 5C3WA 5KGUA 3ERQA 4WRDA 1EQVA 1SNCA 4ZUJA 5C4HA 4OL7A 1A2TA 2PZUA 4PMBA 4DU9A 4N9PA 1ENAA 1KABA 4K5WA 5I6YA 2F0UA 2RBMA 4MIUA 1A3UA 3NHHA 3D4DA 4PNYA 4ZUIA 2F0DA 3LX0A 3TMEA 3VA5A 4F7XA 3OSOA 2PQEA 3P1HA 4H7BA 5CV4A 1STAA 4ID6A 1IHZA 2EYJA 3QOJA 2F0TA 2KQ3A 1II3A 4TRDA 3C1FA 1STBA 5E3FA 1STHA 2KHSA 5IGFA 3BDLA 2EY1A 4NKLA 5JOBA 4K5VA 1TR5A 4R8NA 4KD4A 1SYFA 2RDFA 4NDXA 4F8MA 5IIFA 5KRUA 2F0VA 2WACA 3EROA 5C6AA 3NQTA 1SYEA 2F3VA 3MVVA 1JOOA 3ITPA 4G57A 4IUNA 2SNSA 2F0OA 5IGCA 2RKSA 3NUCA 1EY6A 3MEHA 3MXPA 2PZTA 2HQEA 4NMZA 4PMCA 3D8GA 1SNPA 2F0HA 5M9OA 1EZ6A 4NP5A 2EY5A 2F0QA
chains in the Genus database with same CATH superfamily
3DXJC 4IPDA 4ZKBB 1QZHA 5T1IA 2MO1A 4B9XA 1RDPD 2NBFA 4BA1I 1WCMG 2K4KA 4HJ9A 4A3GG 2JA5G 4UY8C 1GKHA 2IHEA 3NE5B 1TWHB 2A6ED 3T13A 3K7UC 3KBGA 1HZBA 1WFQA 1Y8NB 1AP0A 3HKSA 4BY7G 4KKUA 4GLAC 3EQLC 1Q90A 4JI3L 3M4PA 4EQNA 4QB4A 4JW0A 4KY7A 4RCNA 3TS2A 4DK3C 1MSGA 3GTGB 1O7LA 4ZQ3A 1IXRA 1YJNA 1EQTA 1D5ZC 2I46A 3PGZA 2RVLA 4EVOA 3J80c 2Y0SG 1EU3A 4X65Q 1QCBD 3KBXA 4K2LA 1PYBA 2UXCQ 1WCMB 1ESFA 4A3GB 2JA7G 3CCQA 1ZXTA 2D9UA 3OMCA 4NXNQ 4BY7B 1ASZA 1ICWA 1QUQA 3ULLA 4DR1Q 4S3SA 1MBYA 4L5SA 2JA9A 5G3LF 1I3QB 4R9WA 3S1NH 3NK9A 2B39A 4LF7L 4OWTB 1BO0A 3BVZA 1H9MA 3OPOA 1PFBA 2Y0SB 4OX9L 4F87A 1X32A 4LW1A 2EXDA 5C3WA 2JA7B 2R7ZG 5GQOA 1A2TA 4DV5L 1VQAA 1VQNA 2MNAA 3A5ZB 3NEMA 2PI2E 3P1HA 2PQEA 4IPGA 3M3YH 2IL8A 5LHY1 2EYJA 5HGQA 2NVXB 5E3FA 1VQGA 3NTIA 4POGA 4JI2L 2NTTA 4NKLA 3HOXG 3J81c 5JVH3 1SRUA 3L0OA 4ULLA 1VQMA 4A3LG 3CP0A 2F0VA 3W1GA 2B63G 1G51A 1DOMA 1SYEA 2A1AA 3IAYA 1K28A 2E2DC 1HZAA 2CW0D 3EN2A 5GADC 2F0HA 4MNOA 4BBSB 4OXPA 3WDNA 3PUXA 2IWHA 1A2UA 1KDCA 4OONA 4QF4A 1PFSA 1WTOA 5I2XA 2X6GA 4JPBW 2ZXPA 3PIPA 1LT6D 1W3SA 4A3JG 3S16H 3HG9A 3HOXB 1SE4A 4IJHA 2IHFA 1IW7C 2RHQB 5ELBA 1RTOA 2B63B 1AZQA 3KFUA 2A5HA 1EZ8A 2LXKA 3GTQB 4GKKQ 1QJOA 2E5LL 3D6CA 3DUZA 3CCLA 3J7A5 4JI4Q 4JBWA 4UP7A 2N55A 4OGQC 5M3FH 1X9NA 3NWSA 3A74A 1LTTD 4OELB 3F2CA 1CKOA 2OQ0A 3GTKB 5IGBA 1B4OA 3TZDA 4A3IB 3K80C 4A3JB 1RKNA 3GV3A 2EYOA 4QJFA 4TVAB 1LO5D 3TZUA 3ND8A 5M5YH 1UUPA 4RH6A 4DV3Q 2NVYB 1GUGA 2I07B 1HHVA 1V1PA 2N88A 4RKLA 4O1NA 4I7ZC 1Z7TA 1N33L 4KY6A 1GUNA 2I5MX 3I8ZA 3C1EA 1WYDA 1O80A 2YTYA 4APVA 3BDOA 4B3ML 4DXGA 1Y69U 4YIJA 3PF4A 4CKBA 3F2DA 3VR4A 5FLXc 2NTSA 3I4MH 1DOKA 2B8FA 2JSOA 1A62A 1Z9FA 2JQOA 3ERQA 3VYRA 1CZGA 1SNCA 1IBKL 4OL7A 4FDBA 3S15H 3FRPB 1EU4A 5JEAJ 4AQYQ 3CW2C 4QIWB 3VR3A 1EOTA 4B3SQ 4FF3A 1BCPB 1RIPA 4DK6C 4TRDA 1O7ZA 1U5KA 4LF6Q 2BE5D 4DNIA 3IKJA 3IRBA 2AWNA 2K28A 4X64Q 2EDGA 1J5EQ 3L9AX 1Q7YC 3VR6A 4R4CA 5E7NA 2B3GA 4H13C 3I4LA 4Q5VA 2HUGA 1L1OA 1EZ6A 1KHIA 3SK4A 5IGDA 3MWYW 4OIKA 1K0SA 1C4QA 1HPCA 2R3ZA 2L5TA 5CC4A 1VQBA 2LFNA 2RCFA 5HGTA 1EIFA 1IYUA 2UU9L 3FDTA 1N9WA 2MHVA 2MPMA 3HEJA 4PZ8A 3VR5A 3STBD 2F0MA 2R7FA 1QZGA 3T1YL 3M4YA 3SHLA 3VYTA 1VQ9A 2ASBA 2LKVA 5A35A 4A3MH 2Z4IA 5E4WC 3JAME 4IFDH 1K8OA 4RWSC 2F0LA 3UI2A 1LTSD 4X66Q 1EIGA 2Z0SA 2E2IH 1JE4A 4GLVB 2V1CC 5DEHA 4A76A 1YJWA 1FNUA 2I0QA 3C46A 3GQBA 3BVMA 1NMGA 5IWAQ 2EYLA 2R93H 1LT5D 3BZDB 2B2WC 1DZ1A 4C1NI 3J7YW 1N8RC 4TKOB 2F0EA 3DHQA 2A69D 5NUCA 5FJ8G 1D7QA 1EYGA 1L0XB 3ULPA 2NUCA 3U9SA 1Q8IA 2J0TD 4DR7Q 4RGNA 2EE1A 1XPOA 4B9WA 2E2HH 2AQ3B 2CQOA 3CCEA 4A3FG 1CT1D 4ZRZA 1S5FD 1EWIA 1DXMA 2DGYA 4DR5Q 3T56B 4JI8Q 3WWVA 1I4RA 4C1NK 4YWMA 4RGTA 1BCPC 4JI0L 3LNNA 1YIJA 1PRTD 1NTGA 1PMRA 3WOFA 2Z8LA 3H3VH 2K1BA 2Q8TA 3G7LA 1JMCA 5C44H 4JBKA 5IP9H 1PTOH 2GN5A 2B2VC 2NZHA 3M4OB 1B3AA 5CV4A 5E4XA 2F4VL 3S1QH 2CWAA 4DR6L 1II3A 2KCMA 2F4IA 4P73A 2DJFC 3G6JB 3T51B 3KJOA 4XQQA 1NCVA 4R1JA 3HGBA 2C35B 2UUAL 5COYA 4A3FB 1SROA 3Q23A 3CHBD 4DV1L 1WTXA 1WTVA 5M3FG 1LT3D 1TIID 1BVSA 5M9OA 3BZKA 2I5LX 1R4PB 1HNXL 2D5DA 3T1HL 4OWWB 4P2CB 4U673 1PYWD 2FMCA 3FPPA 4X3UA 2CVRA 3OHXC 4JI7Q 3KK7A 1D1KA 2QW7A 2HDMA 3E0EA 3SE0A 3TP8A 3AB9A 1FJGL 1YHQA 2H5XA 2O5IC 1KLGD 1ENFA 1RF2D 2PW5A 4KJNA 5M3FB 2JA6G 5A2QL 4NXML 1XTDA 3NTHA 5T1GA 5EPLA 2XNAC 4KTAA 4MZ9A 4GLXA 4G7OC 5FO8B 1PA6A 1EQQA 5CV5A 4KKSA 1GD7A 1STYA 5IT9L 1B8AA 3AEVA 4CGYB 2N49A 4R4OA 3OYYA 5C0XJ 2ENBA 1F9SA 5EKLA 4DUYL 2YTVA 2QCPX 1GM5A 4BBRH 3J7AV 4B3RQ 3I90A 4GOPA 4N9TA 5DAUA 4WJ4A 2JA6B 4UAIA 4ZKCB 1T5XD 4EX5A 1CM9A 1DOLA 1DGSA 1Y8PB 5JAVA 4HJAA 1F2MA 2TMPA 4KMUC 2OWOA 1N34L 3VA7A 3D4RA 1JJCB 4RFBA 3H0GH 4RHSA 1CKNA 3PIO3 3J80i 3HOZH 3S2DH 3LX0A 4L5TA 3VA5A 2VB3X 3K58A 1KQSA 1EUJA 1HFGA 4DK0A 3MXGA 2JYOA 1VQHA 4DV2Q 4OWXB 3DM1A 2WAQG 1S5BD 1W2BA 1KAWA 1FYCA 2KEDA 3NQTA 3S14H 2CH4A 1BDOA 3OW7A 3RZDB 3RLOA 1KNEA 2A68D 4N8X1 1Q81C 3NENA 1S5ED 4JG2A 4DKAC 5GROA 1WVLA 2KJXA 3LWUA 4JOIA 1TT2A 4KHPL 3NXWA 2R93G 5C3XA 4BS9A 5M3MB 3SEBA 4DV6Q 1H95A 2F0WA 4HIOA 5D14A 5CV8A 3SR1A 1KIXA 3D3RA 2WAQB 1IBMQ 2Z6KA 1HUMA 3KLSA 3P7JA 5L37A 5C4XG 3L7ZC 3TDQA 3AFPA 1ZKOA 5EPKA 4HCSA 2CWPA 4BWGB 1HFNA 3J81i 3FMCA 3S1RB 4E6IA 1JJGA 2B2TC 4DR3Q 4ILWA 1CK1A 1L0YB 3RNUA 4A3KH 5IP9G 4DN4M 1HNZL 1XMOQ 3MXNA 1SYGA 1XNRQ 1PH8A 1F9RA 3GTOH 1QWYA 1BUVT 5JJIA 1UEBA 4A3BB 2RSOA 4DAVA 2QILA 5C4XB 3A5UA 5KNCA 2L0CA 1ZYRD 4GS3A 4XDXA 1IZ6A 3K0XA 4B3TQ 5JJLA 4LFBL 4JC0A 3A0JA 1X3QA 1PZJD 1NR2A 2K32A 1M90C 3OIQA 1KDAA 3I7FA 1J9OA 3QJYA 2UXBQ 1YNND 1PTOB 4IPCA 4FO2A 3PF5A 3GD7A 1WTRA 1KXLA 3T4AC 2VS1A 2UUCQ 1G6ZA 5I6YA 1PZKD 4AH6A 2XRQD 3ONAB 4IOCA 1CA5A 3KLRA 3OTOQ 2IX0A 3DEOA 4LF5Q 2EY1A 1X3PA 2IX1A 4GKKL 4KD4A 5LMNW 5K36H 3AU7A 3HKZG 4M8AA 2NYZD 1SMYD 4A4IA 5FOBB 3MXPA 4LFAQ 1BBXC 2HT1A 3N52A 3EFXD 1Z6HA 4KN4C 1BXTA 5FK9C 4JI5L 4JV5L 2F0FA 5EPJA 3KOJA 3GV6A 3QB3A 3CQZB 4DV0Q 1NJIC 1STEA 1E1OA 1J8IA 1XJVA 2A6HC 2WP8J 2QDBA 3DLLA 1HR0W 3HOVH 1C0AA 4YHHQ 3S2HB 2XIWA 1MGSA 3BS1A 1WTQA 3GTMH 5IYCH 1U4LA 5J3BA 3HKZB 3DMUA 4YWLA 1HA6A 3NWTA 1XPUA 1B9NA 4A3DH 4QMGA 4C2MB 3QR8A 2FJ2A 1B7YB 1WI5A 1YNJD 5KIXA 2IY5B 2BA1A 5BR8L 3G48A 1GUOA 1TWFB 3H0GG 3ZJYC 4UP9A 2CKZB 4KHVA 3HOZG 1LTRD 2YTXA 3KF6B 4FXGC 1YITA 4O42A 1P8LA 1G2TA 1PZID 2Z6BA 1SYDA 2JXMB 4DV4Q 2F0IA 4KJOA 2GVAA 4IQZA 4UDUC 1EY5A 3AQQA 1J5EL 4KI0A 3H3VC 3Q0AA 3BG3A 3CC4A 1YHBA 3A7LA 3OMGA 2N8NA 5IOCA 1PTOC 2NZOA 2NVTH 4DV7Q 5CV7A 3MTSA 3H94A 1HQRD 2N3SA 4WJWA 1E24A 4K8IA 2Y0SE 4C3JH 2IW3A 1N32Q 3PQIA 2JA5B 1Y1VH 3GTLH 3HOZB 4A93G 5JEAH 2R6GA 5C4HA 4DA2A 5M5WB 4FYDA 1XX8A 2NVQB 4IPHA 2UUBQ 3EBEA 4MIUA 2FINB 4J8QA 1LV9A 1RODA 3JAMc 2PQAB 2F0TA 2VUMG 2WINB 1U4PA 1STBA 2FXQA 3R2TA 5D3IB 1GXDC 3A8IE 2VQEQ 1HNWQ 1XXGA 4POFA 4ZK9B 1PTOF 4BY1H 4H0LC 3PIOA 3JC66 2B2YA 3NPPA 4MN3A 5DLQE 1EWHA 1TS2A 3CF5A 1JOOA 1GO3E 2DUDA 2Q2TA 4IOAA 4A93B 1AE3A 1SNMA 1S40A 4V0BA 4ALPA 2VB2X 1S72A 4L63B 3MFYA 2KHIA 1SAPA 3NSWA 2VUMB 4DAYB 1WTPA 1A3VA 1MJCA 2D0PA 1AN8A 1Q86C 1FNWA 3I2ZA 5IGFA 1CFMA 1DONA 2KUMA 1JOQA 4YWKA 3PCOB 4OO1H 1EYCA 4UPAA 1QOHA 3CC2A 2D2CC 4KY5A 4IJLA 1OXTA 2XVSA 4LFCQ 1TQOA 3EA6A 4JYAQ 2R7ZB 2EYMA 3TREA 1ASYA 4H44C 4HEDA 3PO3H 4HIMA 5AJ3L 1XMQQ 3GTOB 4K8JA 4G7ZC 2Q8IB 1T9HA 4HR7B 2B2UA 4YY3L 2EY2A 1A8VA 4LF9Q 4YCUA 4HMIA 1IBLQ 3S17H 3NBHA 3MXUA 1TWGH 2ZXRA 3CAMA 3BYYB 2K75A 3CRLC 4JI1Q 1A15A 4DR4L 4J1MA 1K83H 3M7GA 3H6MA 4X62L 2OF1A 5K36G 4DNRB 3DWAA 1N36L 5A2QE 1I5FA 3CXCA 3TSSA 4DUZQ 2Q2UA 3GTPB 2YU9H 3Q24A 1HZCA 1NSNS 4L8JA 3P75A 5IT9E 2PI2A 5ELDA 1YBYA 4ZUJA 1K8AC 4CKCA 1SFOB 4K5WA 1G8ZD 2F0UA 4CDEC 1SDFA 4IUVA 2F0DA 4HSPA 1STAA 2PNHA 1E2VA 2JK8A 4R4TA 4QUFA 1K8GA 3HOVG 4QIWE 3RMHA 3K5NA 1V8QA 5IYCG 5DNFA 3FKIH 1LTGD 1SR3A 3SDZA 2HQLA 2RDFA 1D8LA 5G3LD 5EAYA 3RN2A 4A3DG 4BXXH 2IX3A 2E2JB 4CJ0B 4RA8A 3K59A 4RMFA 2E8GA 1GUSA 1SNPA 1VQCA 4K0KQ 1HCZA 3GDEA 4LUOA 5CMDA 4IUPA 2DNCA 1MI2A 1EIHA 1PFNA 1AZPA 2XGTA 3HOVB 1I6HH 2WKDA 2WB1G 2H4OA 3ERSX 3K57A 3GTMB 4GKJL 3NQIA 2OEOA 4KLKA 5I6WA 1UE6A 3GP7A 4A3DB 2BH8A 2QA4A 4BA2I 2DJGC 1JE5A 1VQ7A 1XNQL 4C3JG 4Y7NH 2ZTEA 2EXZA 1SNOA 4C3HH 4QY7A 1Y1VG 3AFQA 2Z4HA 2WIIB 2J4XA 1YNXA 3IFDA 5KYIA 3K5LA 5IGGA 1PH5A 4JI3Q 2G9DA 3KYHC 5C0XH 2WB1B 4WORA 2K52A 4I7AA 5J39A 4HJ8A 4C3IH 1SLJA 1CHPD 2L12A 3ER0A 1E3PA 3J7ZC 2ZJRA 3HOUH 2IJ0A 1EIYB 2BH2A 4LUVA 3FPUB 1JB7A 3HZXA 3KUPA 2UXDL 1TWCH 4HTHA 5EQ0A 5C4JH 3HOYH 3G71A 1TS3A 4XIGS 2MO0A 1SMXA 3A54A 1I94L 1D1IA 2K01A 1WTWA 4LMQD 3HOWH 3M85A 5M5XH 1WTHA 3L2PA 2CCZA 1A0IA 1KABA 1MIUA 3E6ZX 4LF7Q 5C6AA 2QEXA 3S1NB 1IBML 1PV4A 2CH4W 1TY2A 4OX9Q 3QOJA 4DAMA 2I5HA 5FO7B 2ZM6L 4GN3B 2MUYA 5LMNL 1S3OA 2Z1CA 3TS0A 1CQFA 1IW7D 4P74A 4DV5Q 1Q8KA 1I50H 4WFN3 2YYZA 2JJQA 4CDFC 2JP1A 4G57A 4FF4A 1D2BA 4JI2Q 3M3YB 1XWEA 4HIKA 4GNXB 3U58A 1XMOL 2RF4A 1JCKB 1EWCA 3NTKA 3I4NH 3ND9A 1PH4A 1UE5A 4HJ5A 2G9HD 1M4VA 2EYFA 1HR0L 1BBUA 1HRJA 4CHTB 1PDQA 4B3TL 1STGA 2CHBD 4JI6L 2R92H 4RGOS 3SK5A 4CDDC 3QO2A 5CBEE 3TP6A 3RZOH 2O4XA 1Y1WH 1VQ4A 2L11A 2EJFC 4XYOA 3PO2H 1ONLA 3F8TA 2YV5A 3VR2A 1JJ2A 1BBWA 3S16B 4PG3A 4CDCC 4H02A 3MZ5A 3URYA 2D0OA 1VMPA 4K14A 3Q8DA 1BQQT 3OTOL 4FXKC 2JEAI 3QWNA 4LF5L 3QOLA 4UHVA 3I4OA 2E5LQ 1KAAA 2K14A 1E22A 1F77A 4PQXA 1SXTA 1TKWB 4GN5A 1HJPA 1KTKA 5LMUL 1I4PA 4LNQA 2E76C 5H1SE 1DYQA 1VQPA 4IURA 1TWAH 2DNEA 2YU9B 3I4MG 3S1MH 3OWEB 4U68A 5EKKA 2C9OA 1EY9A 2J7ZA 1F2LA 5D3DA 1H9SB 3S9WA 5M5YB 4LAAA 2F0NA 1RTNA 4P71A 1N33Q 1CZWA 5ELOA 1AW7A 4XQNA 1I4GA 2WKCA 3HP3A 1PLFA 3F1ZA 3VYUA 1OO9B 1LM0A 3KDFB 2PZUA 2VZAA 4LF8L 2SEBD 4B3MQ 4FF2A 2OCEA 1A3UA 4ZUIA 4YHHL 2HHHL 2EIFA 1SSOA 2NN6H 4ID6A 1R4QB 2RQXA 4V190 5BN4A 2L9HA 4JCVE 4GNXC 1EOVA 3OW2A 1IBKQ 2G5DA 3I4MB 2ICEC 2H1EA 3KF8A 2F3IA 1BKBA 4XT3B 5KRUA 2PMZE 4OEMB 1VMCA 3S15B 2AQ1B 1TWHH 1U4MA 2F0OA 1EY6A 4A75A 2NZ1D 3CCRA 1HZ9A 1SEBD 1FL0A 1SE3A 2L4NA 5C0XG 4HSVA 1Z47A 2XN9C 1MHWC 3GTGH 4C3IG 5BN5A 1ENCA 3HOUG 2PMZB 4A3MG 3R8BA 3D4WA 1AE2A 1ESRA 1SBBB 4OHJA 4IUTA 1WCMH 4IFDG 4X65L 3CCMA 4A3GH 2WAQE 3JAMi 3Q22A 3HOYG 5IE8A 2UXCL 5CYUA 1T5EA 1BOSA 2GVBA 3BDCA 1XYIA 2L55A 3M7NA 2LY7A 4O2DA 4BY7H 1O7YA 2EZVA 5CORA 2UU9Q 4NXNL 2UUBL 4CJ2C 3HOWG 1S5CD 1BCPD 4DR1L 4LF4Q 5BN3A 4I65A 3T1YQ 1QB5D 1K3BC 1UNSA 4C3IB 1NUCA 1EY8A 3HOUB 3K6OA 2O5JC 1VCIA 4A3MB 1HNWL 1PH1A 2A6EC 2MJ8A 4OIJA 5HURA 2LS01 1VF7A 2ES2A 4TQUS 2JA7H 4KD3A 4IFDI 3HOYB 3J80L 2E2IB 5IYDH 2IPKD 3CRKC 4EQOA 3OWFA 2K05A 5D65A 1VQ6A 4UP8A 2NVXH 5GAGC 3O13A 2JE6I 2L15A 4GN4B 4J6HA 4B08A 3A7AB 2R93B 5C44G 3HOWB 1LABA 3UDFA 1M8AA 4WRDA 1QILA 3EIVA 1GHKA 3V05A 2E2HB 1CTMA 4H7BA 1K9MC 1OXVA 4BBSH 2KQ3A 3K5OA 2R92G 5CBAE 1I50B 4LWCA 2KCNA 3I72A 4JYAL 1A6XA 1Y1WG 2Q2IA 1WD1A 3H15A 2AMCB 2WACA 2EOTA 4EQ5A 1P16A 3KLWA 2Z9HA 5C44B 3HOXH 3H3VI 4JOIC 2F4VQ 3ITPA 2AWOA 4DR6Q 2RKSA 2SDFA 3IFTA 2HQEA 4PMCA 3B6YA 4A3LH 3S1QB 1Q1EA 1QNKA 4AYBG 5C5LA 3RUZA 5J1ZA 2UUAQ 1CSPA 5I4DA 3J81L 1NMFA 1D6EC 3GTQH 1TVXA 4DV1Q 3RLFA 4FXDA 5IODA 2BCOA 4Z9CB 5EKIA 5ISRA 1KD1C 4JBMA 3RD4A 4JI4L 1HNXQ 1Y1WB 1ET9A 3GTKH 3F2UA 5IT9c 4AIMA 1EY0A 2N78A 3OIPA 4A3IH 4A3JH 1I6VC 1KNAA 3HKZE 1PYSB 2NVYH 2QDLA 1EY4A 5FLMH 2R61A 2CW0C 4ZLTF 4DV3L 4FF1A 2CQAA 5I9PA 4AYBB 1RJTA 4A3EH 1FJGQ 3E0JA 3K7AH 1C48A 1B9MA 1UE7A 2K7VA 4DR2Q 1V43A 1FVIA 4BBRG 1Q82C 1Q1BA 1JORA 1BR9A 4NXMQ 3HFZB 4X6AH 1VQDA 1F9QA 1WOCA 2XRSD 5IP7H 3NP8A 2PNRC 1TXYA 4MHEA 2KVMA 3KLSX 2F1MA 1KLUD 2V4DA 2SNMA 3EJIA 2BA0A 2EQSA 3TBIB 1S4ZA 3H09A 1Y8OB 1YZ6A 5JJKA 1X3EA 4DUYQ 4AQYL 5J22A 3W5OA 1LLRD 1NBWA 1OXXK 4CBVA 4B3SL 3BU2A 4BBRB 5KGUA 2NB0A 1EQVA 4LF6L 1JICA 1X6OA 3W2DA 5IYBH 3J81j 4X64L 3VDYA 4O0AA 3D4DA 4HJ7A 3P20A 4F7XA 2K5QA 2CFMA 1QUQB 1N34Q 3D0FA 1DJRD 4XQJA 2VXWA 2KA7A 1VF5C 1PVOA 5FLXL 4Q0FA 1NY4A 3R2IA 1LTBD 4LUZA 3RLNA 2BOSA 1EFID 3H0GB 2AKWB 3CC7A 4IUNA 4CJ1B 3S2DB 3GTJH 5JVG3 1OTCA 2EY5A 5GAEC 1F9PA 1NE3A 1KL9A 2PO4A 1L2FA 4NW2A 1SNQA 1FGUA 1LT4D 1PXUA 4EGVA 1KDBA 2M00A 4A3CH 3V96A 1SNDA 2A8VA 4IUUA 2VY3A 3KF6A 1KRSA 1PRTB 2F0SA 3S14B 2K50A 4MTKA 4X66L 1HH2P 5IYDG 2KHJA 1OXUA 5JPMC 2BE5C 1DCZA 4KHPQ 1ML0D 5KNBA 1IYVA 5CR3A 3X3MA 5IWAL 3NBIA 4DXFA 2K6AA 2VL6A 4A3KG 1I4QA 1A3TA 4DNTB 5CGKA 4XT1B 3E3XA 2ICIA 1JC7A 2IT1A 5CV6A 1WJJA 1EYAA 4RAUC 1STNA 3UE0A 4R8IA 4DR7L 1K0RA 4CKEA 1EY7A 4X3SA 2KEEA 4BBSG 5EGTA 4DR5L 4JI8L 4DF7A 4X3KA 2PQAA 3PUWA 2K5NA 3LWEA 3NBHB 3W3AA 3STBC 2F0JA 1FD7D 1HNZQ 5LL6S 2F0KA 2KOLA 4A3KB 3M4OH 5FJ8H 1IL8A 2ATWA 1B50A 3T53B 4C56C 1JWSD 3E5SA 3I56A 4K6DA 4ME5A 3IL8A 1RD9D 2RDGA 4A3FH 5FO9B 4LFBQ 1GUTA 4DU9A 4N9PA 1PH2A 3NHHA 1WD0A 1V1PB 3RR5A 2EPBA 2A69C 2K5DA 4DAYA 2B2YC 1X54A 1Y14B 2A6HD 2KHSA 5IY0A 2VQFQ 1EEID 1E2WA 4A3IG 3CCVA 1AFPA 1C9OA 1DD2A 2JA8H 4JVZA 3DWQA 3QIAA 2ZT9C 1HA5A 3EROA 3NELA 4WJ3M 5FLMG 2MGSA 3QG1A 1VQOA 3MA2B 4JI7L 1K8MA 1A63A 1KC8C 4A3EG 2AUKA 3CU7A 5TSSA 1PRTC 3I70A 1IYJB 3K81C 2K5VA 3T16A 2DY8A 4NB3A 2K03A 3MAQA 1X56A 3MHBA 2ALYB 1S5DD 3TP5A 4EQPA 2O2LD 3S24A 4IALA 1R9TH 5IP7G 1I4HA 2OTLA 3UE1A 1F2YA 1CI3M 3FHWA 4JI5Q 4JV5Q 1V9PA 4XXEA 1IKMA 1PTOD 1VDZA 1K3RA 1X55A 2EJGC 1C8CA 1ICFB 1CUKA 4A3EB 1YI2A 3K7AB 2X69A 4LK1C 1L1OB 4M1UB 2B2UC 1PRTF 1FGBD 3I73A 1GUWA 1SE8A 2X6LA 2JA6H 1BNZA 4B3RL 1X65A 5IYBG 1G6PA 1G91A 2D62A 3R3OA 4QL5A 1PH7A 3D6WA 2WB1E 2HDLA 3CPWA 2KBNA 1H9JA 2PYKA 2RSNA 1SYBA 5BR8Q 2LSSA 3GO5A 1QNUA 4PZ7A 4MTNA 2B2WA 4KV6A 4N8FA 4DFAA 5LL6X 4XTCS 1SJED 3U9OA 1H9KA 1QG7A 1EQRA 5KYLA 5JEAG 2F3WA 4PV1C 5C3EH 1ILQA 1JQYD 1QE6A 5I2YA 4FNFA 1DM0B 2DN8A 4DV2L 1HXYD 3UDXA 1G291 4A3CG 2NVTB 1UWVA 4Y52H 2L1BA 2LXJA 3RZDH 3E9HA 1GOZA 3OSOA 1NNXA 4BY1G 1IHZA 4F88A 1GHJA 3J80E 1QVGA 2JEBI 3BVGA 4K5VA 1B53A 4C3JB 4FP5D 2E74C 2B2VA 3AMUA 3BYTB 4KN7C 1ILPA 1Y1VB 5IIFA 3GTLB 3GTJB 5M3MH 2QKIC 1E2ZA 1VQIA 1B1ZA 4LF4L 3Q6SA 3MVVA 2SNSA 2GA4B 1TS5A 3NUCA 1RL2A 2ZTCA 3MC0B 4DV6L 2FFKB 3E9IA 3FVQA 3I3CA 1TY0A 3FP9A 4DK1A 5DM73 5DM63 2QEJC 1HUNA 4PZ6A 2M9VA 1PFMA 1VQKA 3TRZA 1ET6A 1PHJA 4BY1B 3S1RH 1F2ZA 4OO1G 4NPSA 3I91A 2F0PA 5F2DA 4LJZC 3A8JE 3FEWX 4QCLA 2Q8RE 4K6LA 4XYQA 1V1OA 3ULJA 1L1OC 4DR3L 1JWMD 1HQMC 3CCJA 3PO3G 5I9OA 4QQBX 4IO9A 3MFGA 3BJUA 3VYSA 2DY7A 1Q12A 1XNRL 3CPFA 3A56A 2PZWA 4A3BH 5AFWA 2ID0A 1SN8A 2A68C 5C4ZA 5C4XH 4DAPA 3PUZA 5ELFA 2EY6A 5FKAC 3J81E 2KECA 1PH9A 2A74C 1B70B 2K04A 3LGJA 2OXPA 3PV0A 1YJ9A 1X3GA 3H91A 3M4QA 4OO1I 5HY6A 5EBCA 2FMMA 2HIXA 3M9BA 5AJ3Q 1GJXA 2UXBL 3PO3B 2JA8G 5GAHC 2Q2HA 3PSIA 2E75C 2P5ZX 5K5PA 5EJWA 2UUCL 3PUVA 4JBJA 1E0BA 2EYPA 4YY3Q 5E1FA 2F03A 4HIDA 2RCNA 5KEEA 2BDNA 3L3OC 2ZJQA 1YEZA 2HIVA 4ZYSA 2XSCA 1O7IA 1Q46A 4DR4Q 1AH9A 1BF4A 1TU2B 4X62Q 3S17B 2AQ2B 1TWGB 2K5WA 4GNXA 3D31A 3U4ZA 1N36Q 4RGMA 1K83B 1ENAA 1BCPF 1GVPA 4R4IA 2MQHA 2AHOB 2MP1A 3FKIG 3TMEA 2B29A 1QVFA 4HCEA 4BXXG 1MKHA 4X3TA 2JA8B 3ZYYX 4LFAL 4GOPB 5JOBA 1ZYRC 3CQZH 4KHZA 3DM3A 1IL2A 4NDXA 4F8MA 3N6RA 4DV0L 3KF8B 1W6KA 1UE1A 2QGQA 2F3VA 4DR2L 1MSHA 3MEHA 1EEFD 4RCOA 1YNNC 1LTID 4L6TB 3S2HH 1D5MC 2KENA 1LTLA 2F0QA 4G4KA 1U0LA 1LACA 2KCTA 2XWBB 3CCSA 1CKNB 3U4VA 1R9TB 1M1KC 2OTJA 3KJPA 3FKIB 2A73B 3G6EA 1NAPA 3X3NA 2PW7A 4C2MH 2JN4A 1PH3A 4ABNA 4HAEA 3G4SA 1MJEA 2BDOA 3CKIB 2OQKA 5FLXE 4FVMA 1TWFH 2ZXOA 2EJMA 1UEAB 1O78A 4C3HG 3RN5A 1SE2A 2ZJPA 1XTCD 2HD3A 1SMYC 5C3EG 4QUCA 1EL0A 1JOKA 1YVCA 2F0GA 4GKJQ 1I6HB 3DWPA 4DV4L 2C5CA 2XTIA 3PUYA 1H9RA 1H9SA 2ZTDA 4IFDJ 2SOBA 1X3FA 1OXSC 2PPBC 3V2TA 4RKBA 4DV7L 3KDFA 2B2TA 1XNQQ 1V1QA 3A8KE 1RHPA 5IGEA 2JA5H 1CSQA 4DGZA 2K5HA 4Y7NB 4C3HB 1CA6A 1N32L 5M5WH 3C2PA 2NVQH 2VW9A 4P72A 5M3MG 2K33A 5C3EB 4P75A 3K5MA 1VQ5A 3W1BA 1VQ8A 1I3QH 2R7DA 3F2BA 3CMAA 1YNJC 5C0XI 1EYDA 5ELNA 4ZCKA 1Q3LA 1AEXA 2VQEL 4GOPC 2UXDQ 3MXNB 3K0YA 1KRTA 1FR3A 1LUZA 4PNYA 4R4QA 1TWCB 1CHQD 5C4JB 4A93H 3DEPA 1I94Q 1NR4A 1STHA 2PCFB 3UDIA 4GZYC 1XPRA 1K73C 2VNUD 1G2SA 1SYFA 1RCVD 2QF7A 2VUMH 5M5XB 3A55A 3PIP3 4HN7A 4TSSA 1PH6A 1E1TA 4A3BG 3CD6A 1VQEA 3I4NG 4L5RC 2ZM6Q 5LMNQ 2PZTA 1EFWA 1LYLA 3TN2A 3JAML 1JWUD 2FHTA 3C3LA 4NP5A 4RHRA 1ZEQX 4KKTA 1B3QA 1E7ZA 1FNVA 4IN3A 4K5XA 3K8AA 1U9RA 1HTPA 2EYHA 3SVMA 2R7ZH 4J15A 4JI0Q 4LFCL 3CCUA 5EBDA 3PMFA 1LTAD 4HMJA 3SXHA 1TS4A 2OT2A 3U50C 3EVQA 1JT8A 1I4XA 3PO2G 2NWGA 1XMQL 2M2LA 2WFWA 3OOCA 3AYHB 2RDHA 4ODGA 1VQJA 4YCWA 1HR0Q 1VQFA 3I4NB 3SK8A 2B63H 4YCVA 4DPGA 4JK1C 4RG1A 2RA4A 4G7HC 4LF9L 1D5XC 3SK6A 4JI6Q 1IBLL 2B8GA 3TP7A 2KCCA 2Z6KC 4AYBE 4JI1L 1SYCA 2R92B 3J7AF 5CV9A 1JR0D 2VQFL 2EVBA 2F52A 4K2KA 4ZAIA 3GTPH 3UDGA 3RZOB 1B2TA 1MD2D 2MFIA 4DUZL 3T1HQ 4IZ8A 3PO2B 1W6JA 2AUJD 4L5QA 5C5MA 1CQVA 1IKLA 1SFOH 3HRZC 4PMWA 2RHSB 3HS0C 2HCIA 1YHAA 4QGUA 3SGIA 4ME3A 5LMUQ 1HTLD 2NN6G 5ELCA 1J6QA 3R93A 3I55A 3TQYA 2E2JH 4PMBA 3TEHB 4KK7A 1TWAB 2RBMA 1VS0A 3S1MB 1B44D 4IUQA 2WV6D 1VQLA 2A19A 5JPNC 1CKMA 1SJHD 1U4RA 3C1FA 1L0WA 4K0KL 2TSSA 3BDLA 1TR5A 4R8NA 1JB3A 5JJZA 4LF8Q 5KNDA 1QVCA 2XWJB 2HHHQ 1UAPA 1C7YA 2HCCA 3CMEA 5IGCA 5ELEA 3BZCA 4NMZA 3WOEA 3D8GA 3MEFA 2LMCB 3ICEA 2NN6I
chains in the Genus database with same CATH topology
3DXJC 4ZKBB 5T1IA 4B9XA 1RDPD 2NBFA 4BA1I 3NE5B 1TWHB 2A6ED 3T13A 3KBGA 1Y8NB 1AP0A 4KKUA 3EQLC 1Q90A 4EQNA 4QB4A 4KY7A 4RCNA 1MSGA 3GTGB 1O7LA 4ZQ3A 1EQTA 1D5ZC 2I46A 2RVLA 4EVOA 1EU3A 1QCBD 3KBXA 4K2LA 1WCMB 1ESFA 4A3GB 1ZXTA 2D9UA 3OMCA 4BY7B 1ICWA 4S3SA 1MBYA 5G3LF 1I3QB 4R9WA 3NK9A 2B39A 1BO0A 3BVZA 1H9MA 3OPOA 1PFBA 2Y0SB 4F87A 1X32A 5C3WA 2JA7B 1A2TA 3P1HA 2PQEA 2IL8A 5LHY1 2EYJA 2NVXB 5E3FA 3NTIA 2NTTA 4NKLA 5JVH3 4ULLA 2F0VA 1DOMA 1SYEA 3IAYA 2E2DC 2CW0D 2F0HA 4BBSB 3WDNA 3PUXA 2IWHA 1A2UA 1KDCA 4QF4A 1WTOA 5I2XA 2X6GA 2ZXPA 1LT6D 3HG9A 3HOXB 1SE4A 1IW7C 5ELBA 1RTOA 2B63B 1AZQA 2A5HA 1EZ8A 3GTQB 1QJOA 3D6CA 3DUZA 4JBWA 2N55A 4OGQC 3NWSA 1LTTD 3GTKB 5IGBA 1B4OA 3TZDA 4A3IB 4A3JB 1RKNA 3GV3A 2EYOA 3TZUA 1LO5D 3ND8A 1UUPA 4RH6A 2NVYB 1GUGA 2I07B 1HHVA 1V1PA 2N88A 4RKLA 4O1NA 4I7ZC 1Z7TA 4KY6A 1GUNA 3I8ZA 3C1EA 1O80A 3BDOA 4DXGA 1Y69U 4YIJA 4CKBA 3VR4A 2NTSA 1DOKA 2B8FA 2JSOA 3ERQA 3VYRA 1CZGA 1SNCA 4OL7A 3FRPB 1EU4A 5JEAJ 4QIWB 3VR3A 1EOTA 4FF3A 1BCPB 4TRDA 1O7ZA 2BE5D 3IKJA 2AWNA 2K28A 2EDGA 3L9AX 3VR6A 4H13C 3I4LA 4Q5VA 2HUGA 1EZ6A 3SK4A 5IGDA 3MWYW 4OIKA 1C4QA 1HPCA 2R3ZA 2L5TA 5CC4A 2LFNA 5HGTA 1IYUA 3FDTA 2MHVA 2MPMA 3HEJA 3VR5A 2F0MA 3M4YA 3SHLA 3VYTA 2LKVA 5A35A 2Z4IA 5E4WC 3JAME 4IFDH 1K8OA 4RWSC 2F0LA 3UI2A 1LTSD 1EIGA 1JE4A 5DEHA 1FNUA 3C46A 3GQBA 3BVMA 2EYLA 1LT5D 3BZDB 2B2WC 1DZ1A 4C1NI 3J7YW 4TKOB 2F0EA 3DHQA 2A69D 5NUCA 1L0XB 2NUCA 3U9SA 1Q8IA 2J0TD 4RGNA 2EE1A 4B9WA 2AQ3B 1CT1D 4ZRZA 1S5FD 1DXMA 3T56B 1I4RA 4C1NK 4RGTA 1BCPC 3LNNA 1PRTD 1PMRA 3WOFA 2Z8LA 2K1BA 2Q8TA 3G7LA 1PTOH 2B2VC 3M4OB 1B3AA 5CV4A 5E4XA 1II3A 2F4IA 3G6JB 3T51B 4XQQA 1NCVA 3HGBA 5COYA 4A3FB 3Q23A 3CHBD 1WTXA 1WTVA 1LT3D 1TIID 5M9OA 1R4PB 2D5DA 4P2CB 4U673 1PYWD 2FMCA 3FPPA 4X3UA 2CVRA 3OHXC 3KK7A 1D1KA 2HDMA 3SE0A 3TP8A 3AB9A 2O5IC 1KLGD 1ENFA 1RF2D 2PW5A 4KJNA 5M3FB 5A2QL 3NTHA 5T1GA 5EPLA 2XNAC 4KTAA 4G7OC 5FO8B 5CV5A 4KKSA 1STYA 5IT9L 4CGYB 5C0XJ 2ENBA 1F9SA 5EKLA 2QCPX 3J7AV 3I90A 4N9TA 5DAUA 2JA6B 4UAIA 4ZKCB 1T5XD 1CM9A 1DOLA 1Y8PB 5JAVA 1F2MA 2TMPA 4KMUC 3VA7A 3D4RA 4RFBA 4RHSA 3PIO3 3LX0A 3VA5A 2VB3X 3K58A 1HFGA 4DK0A 3MXGA 2JYOA 3DM1A 1S5BD 1FYCA 2KEDA 3NQTA 1BDOA 3OW7A 3RZDB 1KNEA 2A68D 1S5ED 1WVLA 2KJXA 3LWUA 1TT2A 3NXWA 5C3XA 4BS9A 5M3MB 3SEBA 2F0WA 5D14A 5CV8A 3SR1A 3D3RA 2WAQB 1HUMA 3KLSA 3P7JA 3L7ZC 3TDQA 1ZKOA 5EPKA 4HCSA 4BWGB 1HFNA 3FMCA 3S1RB 4E6IA 2B2TC 4ILWA 1CK1A 1L0YB 4DN4M 3MXNA 1SYGA 1F9RA 1QWYA 1BUVT 4A3BB 2RSOA 4DAVA 2QILA 5C4XB 5KNCA 2L0CA 1ZYRD 4XDXA 1X3QA 1PZJD 1NR2A 2K32A 3OIQA 1KDAA 1J9OA 3QJYA 1YNND 1PTOB 4FO2A 3GD7A 1WTRA 3T4AC 1G6ZA 5I6YA 1PZKD 2XRQD 3ONAB 1CA5A 3KLRA 2IX0A 3DEOA 2EY1A 1X3PA 2IX1A 4KD4A 5K36H 3AU7A 4M8AA 2NYZD 1SMYD 5FOBB 3MXPA 1BBXC 3N52A 3EFXD 1Z6HA 4KN4C 1BXTA 5FK9C 2F0FA 5EPJA 3GV6A 3QB3A 3CQZB 1STEA 1J8IA 2A6HC 2WP8J 2QDBA 3S2HB 2XIWA 1MGSA 3BS1A 1WTQA 1U4LA 3HKZB 3DMUA 1HA6A 3NWTA 1B9NA 4QMGA 4C2MB 2FJ2A 1YNJD 5KIXA 2BA1A 1GUOA 1TWFB 4KHVA 1LTRD 4FXGC 4O42A 1G2TA 1PZID 1SYDA 2JXMB 2F0IA 4KJOA 4IQZA 4UDUC 1EY5A 4KI0A 3H3VC 3Q0AA 3BG3A 3A7LA 3OMGA 5IOCA 1PTOC 5CV7A 3MTSA 3H94A 1HQRD 4WJWA 4K8IA 2IW3A 2JA5B 3HOZB 5JEAH 2R6GA 5C4HA 4DA2A 5M5WB 4FYDA 1XX8A 2NVQB 4MIUA 2FINB 4J8QA 1LV9A 1RODA 2F0TA 2WINB 1U4PA 1STBA 3R2TA 5D3IB 1GXDC 3A8IE 1XXGA 4ZK9B 1PTOF 4H0LC 2B2YA 3NPPA 4MN3A 1EWHA 1TS2A 1JOOA 4A93B 1SNMA 4V0BA 2VB2X 4L63B 3MFYA 1SAPA 3NSWA 2VUMB 1WTPA 1A3VA 1AN8A 1FNWA 5IGFA 1CFMA 1DONA 2KUMA 1JOQA 4OO1H 1EYCA 1QOHA 2D2CC 4KY5A 1OXTA 2XVSA 1TQOA 3EA6A 2R7ZB 2EYMA 4H44C 4HEDA 3GTOB 4K8JA 4G7ZC 2Q8IB 4HR7B 2B2UA 2EY2A 4HMIA 3NBHA 3MXUA 2ZXRA 3BYYB 3CRLC 1A15A 4J1MA 3M7GA 3H6MA 2OF1A 5K36G 4DNRB 3DWAA 5A2QE 3TSSA 3GTPB 3Q24A 1NSNS 4L8JA 3P75A 5IT9E 5ELDA 4ZUJA 4CKCA 1SFOB 4K5WA 1G8ZD 2F0UA 1SDFA 4IUVA 2F0DA 4HSPA 1STAA 1E2VA 4QUFA 3RMHA 3K5NA 1V8QA 5DNFA 1LTGD 3SDZA 2RDFA 5G3LD 2IX3A 2E2JB 4CJ0B 4RA8A 3K59A 1GUSA 1SNPA 1HCZA 5CMDA 4IUPA 2DNCA 1MI2A 1EIHA 1PFNA 1AZPA 3HOVB 2WKDA 2H4OA 3K57A 3GTMB 3NQIA 2OEOA 5I6WA 3GP7A 4A3DB 4BA2I 4C3JG 2EXZA 1SNOA 2Z4HA 2WIIB 2J4XA 3IFDA 5KYIA 3K5LA 5IGGA 2G9DA 5C0XH 2WB1B 4WORA 5J39A 1CHPD 2L12A 2IJ0A 3FPUB 3HZXA 3KUPA 4HTHA 5EQ0A 1TS3A 4XIGS 3A54A 1D1IA 2K01A 1WTWA 4LMQD 3M85A 1KABA 3E6ZX 5C6AA 3S1NB 1TY2A 3QOJA 5FO7B 2MUYA 2Z1CA 1CQFA 1IW7D 4WFN3 2YYZA 2JP1A 4G57A 4FF4A 1D2BA 3M3YB 1XWEA 1JCKB 1EWCA 3NTKA 3ND9A 2G9HD 1M4VA 2EYFA 1HRJA 4CHTB 1PDQA 1STGA 2CHBD 4RGOS 3SK5A 3QO2A 5CBEE 3TP6A 2O4XA 2L11A 2EJFC 4XYOA 1ONLA 3VR2A 3S16B 3MZ5A 3URYA 1VMPA 4K14A 1BQQT 4FXKC 2JEAI 3QWNA 3QOLA 1KAAA 4PQXA 1F77A 1SXTA 1TKWB 1KTKA 1I4PA 2E76C 1DYQA 4IURA 2DNEA 2YU9B 3OWEB 4U68A 5EKKA 2C9OA 1EY9A 2J7ZA 1F2LA 5D3DA 1H9SB 3S9WA 5M5YB 4LAAA 2F0NA 1RTNA 1CZWA 1AW7A 4XQNA 1I4GA 2WKCA 3HP3A 1PLFA 3VYUA 1OO9B 2PZUA 2SEBD 4FF2A 1A3UA 4ZUIA 1SSOA 2NN6H 4ID6A 1R4QB 2RQXA 4V190 5BN4A 2L9HA 3I4MB 2ICEC 2H1EA 3KF8A 4XT3B 5KRUA 1VMCA 3S15B 2AQ1B 1U4MA 2F0OA 1EY6A 2NZ1D 1SEBD 1SE3A 2L4NA 5C0XG 4HSVA 1Z47A 2XN9C 4C3IG 5BN5A 1ENCA 2PMZB 3R8BA 3D4WA 1ESRA 1SBBB 4OHJA 4IUTA 4IFDG 3Q22A 5CYUA 1T5EA 1BOSA 3BDCA 1XYIA 2L55A 3M7NA 2LY7A 1O7YA 2EZVA 5CORA 4CJ2C 1S5CD 1BCPD 5BN3A 4I65A 1QB5D 1UNSA 4C3IB 1NUCA 1EY8A 3HOUB 3K6OA 2O5JC 1VCIA 4A3MB 2A6EC 2MJ8A 4OIJA 5HURA 2LS01 1VF7A 4TQUS 4KD3A 4IFDI 3HOYB 3J80L 2E2IB 2IPKD 3CRKC 4EQOA 3OWFA 2K05A 5D65A 3O13A 2JE6I 4J6HA 4B08A 3A7AB 2R93B 3HOWB 1LABA 1M8AA 4WRDA 1QILA 1GHKA 3V05A 2E2HB 1CTMA 4H7BA 1OXVA 2KQ3A 3K5OA 5CBAE 1I50B 2KCNA 3I72A 1A6XA 1WD1A 2WACA 2EOTA 5C44B 3ITPA 2AWOA 2RKSA 2SDFA 3IFTA 2HQEA 4PMCA 3S1QB 1Q1EA 1QNKA 5C5LA 3RUZA 5J1ZA 5I4DA 3J81L 1D6EC 1TVXA 3RLFA 4FXDA 5IODA 2BCOA 4Z9CB 5EKIA 5ISRA 3RD4A 1Y1WB 1ET9A 3F2UA 1EY0A 3OIPA 1I6VC 1KNAA 1EY4A 2R61A 2CW0C 4ZLTF 4FF1A 2CQAA 5I9PA 4AYBB 1RJTA 3E0JA 1C48A 1B9MA 2K7VA 1V43A 1Q1BA 1JORA 1BR9A 1F9QA 2XRSD 3NP8A 2PNRC 4MHEA 2KVMA 3KLSX 2F1MA 1KLUD 2V4DA 2SNMA 3EJIA 2BA0A 3TBIB 1S4ZA 3H09A 1Y8OB 5J22A 1LLRD 1OXXK 4CBVA 4BBRB 5KGUA 2NB0A 1EQVA 1JICA 3W2DA 3D4DA 3P20A 4F7XA 2K5QA 1DJRD 4XQJA 2VXWA 2KA7A 1VF5C 5FLXL 4Q0FA 3R2IA 1LTBD 2BOSA 1EFID 3H0GB 4IUNA 4CJ1B 3S2DB 5JVG3 2EY5A 1F9PA 2PO4A 4NW2A 1SNQA 1PXUA 1LT4D 4EGVA 1KDBA 2M00A 3V96A 1SNDA 4IUUA 1PRTB 2F0SA 3S14B 1OXUA 5JPMC 2BE5C 1DCZA 1ML0D 5KNBA 1IYVA 5CR3A 3X3MA 3NBIA 4DXFA 2K6AA 1I4QA 1A3TA 4DNTB 5CGKA 4XT1B 2ICIA 1JC7A 2IT1A 5CV6A 1EYAA 4RAUC 1STNA 4R8IA 4CKEA 1EY7A 4X3SA 2KEEA 5EGTA 4DF7A 4X3KA 3PUWA 3LWEA 3W3AA 2F0JA 1FD7D 5LL6S 2F0KA 2KOLA 4A3KB 1IL8A 1B50A 3T53B 4C56C 1JWSD 3E5SA 4K6DA 4ME5A 3IL8A 1RD9D 2RDGA 5FO9B 1GUTA 4DU9A 4N9PA 3NHHA 1WD0A 1V1PB 2EPBA 2A69C 2K5DA 4DAYA 2B2YC 2A6HD 2KHSA 1EEID 1E2WA 1AFPA 1DD2A 3DWQA 3QIAA 2ZT9C 1HA5A 3EROA 2MGSA 3QG1A 3MA2B 1K8MA 2AUKA 3CU7A 5TSSA 1PRTC 3I70A 3T16A 2DY8A 2K03A 3MAQA 3MHBA 1S5DD 3TP5A 4EQPA 2O2LD 4IALA 1I4HA 1F2YA 1CI3M 4XXEA 1IKMA 1PTOD 1VDZA 2EJGC 1C8CA 4A3EB 3K7AB 2X69A 4LK1C 4M1UB 2B2UC 1PRTF 1FGBD 3I73A 1GUWA 2X6LA 1BNZA 1G91A 2D62A 3R3OA 3D6WA 2HDLA 1H9JA 2PYKA 2RSNA 1SYBA 3GO5A 1QNUA 2B2WA 4KV6A 4DFAA 5LL6X 4XTCS 1SJED 3U9OA 1H9KA 1QG7A 5KYLA 5JEAG 2F3WA 4PV1C 1ILQA 1JQYD 1QE6A 5I2YA 4FNFA 1DM0B 2DN8A 1HXYD 1G291 2NVTB 2L1BA 1GOZA 3OSOA 1IHZA 4F88A 1GHJA 3J80E 2JEBI 3BVGA 4K5VA 1B53A 4C3JB 4FP5D 2E74C 2B2VA 3AMUA 3BYTB 4KN7C 1ILPA 1Y1VB 5IIFA 3GTLB 3GTJB 2QKIC 1E2ZA 1B1ZA 3Q6SA 3MVVA 2SNSA 2GA4B 1TS5A 3NUCA 3MC0B 2FFKB 3FVQA 3I3CA 1TY0A 4DK1A 5DM73 5DM63 2QEJC 1HUNA 2M9VA 1PFMA 1ET6A 4BY1B 1F2ZA 4OO1G 3I91A 2F0PA 5F2DA 4LJZC 3A8JE 3FEWX 4QCLA 2Q8RE 4K6LA 4XYQA 1V1OA 1JWMD 1HQMC 5I9OA 3MFGA 3VYSA 2DY7A 1Q12A 3A56A 2PZWA 5AFWA 2ID0A 5C4ZA 2A68C 4DAPA 3PUZA 5ELFA 2EY6A 5FKAC 3J81E 2KECA 2A74C 2K04A 2OXPA 3PV0A 3H91A 4OO1I 5EBCA 2FMMA 1GJXA 3PO3B 2E75C 5K5PA 5EJWA 3PUVA 1E0BA 2EYPA 5E1FA 2F03A 5KEEA 2BDNA 3L3OC 4ZYSA 2XSCA 1BF4A 1TU2B 3S17B 2AQ2B 1TWGB 2K5WA 3D31A 4RGMA 1K83B 1ENAA 1BCPF 2MP1A 3TMEA 4HCEA 4X3TA 2JA8B 3ZYYX 5JOBA 1ZYRC 4KHZA 4NDXA 4F8MA 3N6RA 1W6KA 2F3VA 1MSHA 3MEHA 1EEFD 4RCOA 1YNNC 1LTID 4L6TB 1D5MC 2F0QA 4G4KA 1LACA 1R9TB 2XWBB 3FKIB 2A73B 1NAPA 3X3NA 2PW7A 4ABNA 4HAEA 2BDOA 3CKIB 5FLXE 4FVMA 2ZXOA 2EJMA 1UEAB 1O78A 4C3HG 1SE2A 1XTCD 1SMYC 4QUCA 1EL0A 1JOKA 2F0GA 1I6HB 3DWPA 2C5CA 3PUYA 1H9RA 1H9SA 4IFDJ 2SOBA 1OXSC 2PPBC 3V2TA 4RKBA 2B2TA 3A8KE 1RHPA 5IGEA 4DGZA 4Y7NB 4C3HB 1CA6A 3C2PA 2K33A 5C3EB 3K5MA 1YNJC 5C0XI 1EYDA 1Q3LA 1AEXA 3K0YA 1FR3A 4PNYA 1TWCB 1CHQD 5C4JB 3DEPA 1NR4A 1STHA 2PCFB 4GZYC 2VNUD 1G2SA 1SYFA 1RCVD 2QF7A 5M5XB 3A55A 3PIP3 4HN7A 4TSSA 2PZTA 3TN2A 3JAML 1JWUD 2FHTA 3C3LA 4NP5A 4RHRA 1ZEQX 4KKTA 1FNVA 4IN3A 4K5XA 1U9RA 1HTPA 2EYHA 3SVMA 5EBDA 3PMFA 1LTAD 4HMJA 3SXHA 1TS4A 2OT2A 3EVQA 1I4XA 2NWGA 2M2LA 3OOCA 4ODGA 2RDHA 3I4NB 3SK8A 4JK1C 4G7HC 2RA4A 1D5XC 3SK6A 2B8GA 3TP7A 2KCCA 1SYCA 2R92B 3J7AF 5CV9A 1JR0D 2EVBA 4K2KA 4ZAIA 3RZOB 1B2TA 1MD2D 4IZ8A 3PO2B 1W6JA 2AUJD 5C5MA 1CQVA 1IKLA 3HRZC 4PMWA 3HS0C 2HCIA 1HTLD 2NN6G 5ELCA 3R93A 4PMBA 4KK7A 1TWAB 2RBMA 3S1MB 1B44D 4IUQA 2WV6D 5JPNC 1SJHD 1U4RA 3C1FA 2TSSA 3BDLA 1TR5A 4R8NA 1JB3A 5JJZA 5KNDA 2XWJB 1UAPA 2HCCA 5IGCA 5ELEA 4NMZA 3WOEA 3D8GA 2LMCB 2NN6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T16 A;  1SNM A;  5C5L A;  3RUZ A;  2F0F A;  5J1Z A;  1A2U A;  1KDC A;  1SNQ A;  1TT2 A;  3MHB A;  3QB3 A;  4QF4 A;  3SK4 A;  4K5X A;  3NXW A;  3TP5 A;  1U9R A;  2EYH A;  4B9X A;  4EQP A;  2PW7 A;  5C3X A;  4IAL A;  1KDB A;  2M00 A;  1F2Z A;  5IOD A;  1SND A;  2EYF A;  5CC4 A;  1A3V A;  3PMF A;  2F0P A;  4HMJ A;  5ISR A;  1ENC A;  5F2D A;  5HGT A;  1F2Y A;  2F0W A;  2F0S A;  3SXH A;  3T13 A;  2OEO A;  1STG A;  3EVQ A;  2QDB A;  5CV8 A;  3SR1 A;  3D4W A;  1JOQ A;  5I6W A;  3HEJ A;  3TP8 A;  3SK5 A;  1EYC A;  1EY0 A;  2F0M A;  3DMU A;  5I9O A;  4ODG A;  3SHL A;  5CR3 A;  3TP6 A;  4KY5 A;  2O4X A;  2LKV A;  4EQN A;  4QB4 A;  1TQO A;  3BDC A;  4KY7 A;  1EZ8 A;  2PW5 A;  4KJN A;  1JOK A;  2EYM A;  4QMG A;  3SK8 A;  1EY4 A;  2F0G A;  4ZQ3 A;  3D6C A;  1A3T A;  4E6I A;  2F0L A;  2PZW A;  5CGK A;  5C4Z A;  2EXZ A;  1SNO A;  4EVO A;  5CV6 A;  3SK6 A;  5I9P A;  2EY6 A;  5DEH A;  3MZ5 A;  3TP7 A;  5KIX A;  4KTA A;  2SOB A;  1EYA A;  4K14 A;  4I65 A;  1SYC A;  4K2L A;  5KYI A;  4K8J A;  5IGG A;  5CV5 A;  1STN A;  2OXP A;  5CV9 A;  3R3O A;  3V2T A;  4RKB A;  1STY A;  4KHV A;  1NUC A;  5IGB A;  2EYL A;  1JOR A;  4K2K A;  4WOR A;  1EY8 A;  1RKN A;  1EY7 A;  1SYG A;  2EYO A;  3QOL A;  5J39 A;  5EGT A;  1KAA A;  2EY2 A;  1SYD A;  5HUR A;  3OMC A;  2ENB A;  3NP8 A;  2F0E A;  2PYK A;  5IGE A;  3DHQ A;  2F0I A;  4HMI A;  4KJO A;  4IZ8 A;  5EKL A;  1SYB A;  5NUC A;  4RKL A;  4DF7 A;  4DGZ A;  2NUC A;  1EY5 A;  4KD3 A;  4S3S A;  5C5M A;  4J1M A;  4KY6 A;  3H6M A;  2F0J A;  2OF1 A;  3OMG A;  2SNM A;  3C1E A;  3EJI A;  3HZX A;  4KV6 A;  4N9T A;  5DAU A;  4DFA A;  5IGD A;  5IOC A;  2F0K A;  4B9W A;  5K5P A;  4EQO A;  3NK9 A;  3OWF A;  5CV7 A;  3U9O A;  4HTH A;  2EYP A;  5EKK A;  5E1F A;  1EY9 A;  5KYL A;  5KEE A;  4J6H A;  2F3W A;  4YIJ A;  1EYD A;  5JAV A;  5J22 A;  1F2M A;  1KDA A;  3S9W A;  4K8I A;  4LAA A;  1NSN S;  3E5S A;  2F0N A;  4K6D A;  4ME5 A;  1AEX A;  3P75 A;  5C3W A;  5KGU A;  3ERQ A;  4WRD A;  1EQV A;  1SNC A;  4ZUJ A;  5C4H A;  4OL7 A;  1A2T A;  2PZU A;  4PMB A;  4DU9 A;  4N9P A;  1ENA A;  1KAB A;  4K5W A;  5I6Y A;  2F0U A;  2RBM A;  4MIU A;  1A3U A;  3NHH A;  3D4D A;  4PNY A;  4ZUI A;  2F0D A;  3LX0 A;  3TME A;  3VA5 A;  4F7X A;  3OSO A;  2PQE A;  3P1H A;  4H7B A;  5CV4 A;  1STA A;  4ID6 A;  1IHZ A;  2EYJ A;  3QOJ A;  2F0T A;  2KQ3 A;  1II3 A;  4TRD A;  3C1F A;  1STB A;  5E3F A;  1STH A;  2KHS A;  5IGF A;  3BDL A;  2EY1 A;  4NKL A;  5JOB A;  4K5V A;  1TR5 A;  4R8N A;  4KD4 A;  1SYF A;  2RDF A;  4NDX A;  4F8M A;  5IIF A;  5KRU A;  2F0V A;  2WAC A;  3ERO A;  5C6A A;  3NQT A;  1SYE A;  2F3V A;  3MVV A;  1JOO A;  3ITP A;  4G57 A;  4IUN A;  2SNS A;  2F0O A;  5IGC A;  2RKS A;  3NUC A;  1EY6 A;  3MEH A;  3MXP A;  2PZT A;  2HQE A;  4NMZ A;  4PMC A;  3D8G A;  1SNP A;  2F0H A;  5M9O A;  1EZ6 A;  4NP5 A;  2EY5 A;  2F0Q A; 
#chains in the Genus database with same CATH topology
 3DXJ C;  4IPD A;  4ZKB B;  1QZH A;  5T1I A;  2MO1 A;  4B9X A;  1RDP D;  2NBF A;  4BA1 I;  1WCM G;  2K4K A;  4HJ9 A;  4A3G G;  2JA5 G;  4UY8 C;  1GKH A;  2IHE A;  3NE5 B;  1TWH B;  2A6E D;  3T13 A;  3K7U C;  3KBG A;  1HZB A;  1WFQ A;  1Y8N B;  1AP0 A;  3HKS A;  4BY7 G;  4KKU A;  4GLA C;  3EQL C;  1Q90 A;  4JI3 L;  3M4P A;  4EQN A;  4QB4 A;  4JW0 A;  4KY7 A;  4RCN A;  3TS2 A;  4DK3 C;  1MSG A;  3GTG B;  1O7L A;  4ZQ3 A;  1IXR A;  1YJN A;  1EQT A;  1D5Z C;  2I46 A;  3PGZ A;  2RVL A;  4EVO A;  3J80 c;  2Y0S G;  1EU3 A;  4X65 Q;  1QCB D;  3KBX A;  4K2L A;  1PYB A;  2UXC Q;  1WCM B;  1ESF A;  4A3G B;  2JA7 G;  3CCQ A;  1ZXT A;  2D9U A;  3OMC A;  4NXN Q;  4BY7 B;  1ASZ A;  1ICW A;  1QUQ A;  3ULL A;  4DR1 Q;  4S3S A;  1MBY A;  4L5S A;  2JA9 A;  5G3L F;  1I3Q B;  4R9W A;  3S1N H;  3NK9 A;  2B39 A;  4LF7 L;  4OWT B;  1BO0 A;  3BVZ A;  1H9M A;  3OPO A;  1PFB A;  2Y0S B;  4OX9 L;  4F87 A;  1X32 A;  4LW1 A;  2EXD A;  5C3W A;  2JA7 B;  2R7Z G;  5GQO A;  1A2T A;  4DV5 L;  1VQA A;  1VQN A;  2MNA A;  3A5Z B;  3NEM A;  2PI2 E;  3P1H A;  2PQE A;  4IPG A;  3M3Y H;  2IL8 A;  5LHY 1;  2EYJ A;  5HGQ A;  2NVX B;  5E3F A;  1VQG A;  3NTI A;  4POG A;  4JI2 L;  2NTT A;  4NKL A;  3HOX G;  3J81 c;  5JVH 3;  1SRU A;  3L0O A;  4ULL A;  1VQM A;  4A3L G;  3CP0 A;  2F0V A;  3W1G A;  2B63 G;  1G51 A;  1DOM A;  1SYE A;  2A1A A;  3IAY A;  1K28 A;  2E2D C;  1HZA A;  2CW0 D;  3EN2 A;  5GAD C;  2F0H A;  4MNO A;  4BBS B;  4OXP A;  3WDN A;  3PUX A;  2IWH A;  1A2U A;  1KDC A;  4OON A;  4QF4 A;  1PFS A;  1WTO A;  5I2X A;  2X6G A;  4JPB W;  2ZXP A;  3PIP A;  1LT6 D;  1W3S A;  4A3J G;  3S16 H;  3HG9 A;  3HOX B;  1SE4 A;  4IJH A;  2IHF A;  1IW7 C;  2RHQ B;  5ELB A;  1RTO A;  2B63 B;  1AZQ A;  3KFU A;  2A5H A;  1EZ8 A;  2LXK A;  3GTQ B;  4GKK Q;  1QJO A;  2E5L L;  3D6C A;  3DUZ A;  3CCL A;  3J7A 5;  4JI4 Q;  4JBW A;  4UP7 A;  2N55 A;  4OGQ C;  5M3F H;  1X9N A;  3NWS A;  3A74 A;  1LTT D;  4OEL B;  3F2C A;  1CKO A;  2OQ0 A;  3GTK B;  5IGB A;  1B4O A;  3TZD A;  4A3I B;  3K80 C;  4A3J B;  1RKN A;  3GV3 A;  2EYO A;  4QJF A;  4TVA B;  1LO5 D;  3TZU A;  3ND8 A;  5M5Y H;  1UUP A;  4RH6 A;  4DV3 Q;  2NVY B;  1GUG A;  2I07 B;  1HHV A;  1V1P A;  2N88 A;  4RKL A;  4O1N A;  4I7Z C;  1Z7T A;  1N33 L;  4KY6 A;  1GUN A;  2I5M X;  3I8Z A;  3C1E A;  1WYD A;  1O80 A;  2YTY A;  4APV A;  3BDO A;  4B3M L;  4DXG A;  1Y69 U;  4YIJ A;  3PF4 A;  4CKB A;  3F2D A;  3VR4 A;  5FLX c;  2NTS A;  3I4M H;  1DOK A;  2B8F A;  2JSO A;  1A62 A;  1Z9F A;  2JQO A;  3ERQ A;  3VYR A;  1CZG A;  1SNC A;  1IBK L;  4OL7 A;  4FDB A;  3S15 H;  3FRP B;  1EU4 A;  5JEA J;  4AQY Q;  3CW2 C;  4QIW B;  3VR3 A;  1EOT A;  4B3S Q;  4FF3 A;  1BCP B;  1RIP A;  4DK6 C;  4TRD A;  1O7Z A;  1U5K A;  4LF6 Q;  2BE5 D;  4DNI A;  3IKJ A;  3IRB A;  2AWN A;  2K28 A;  4X64 Q;  2EDG A;  1J5E Q;  3L9A X;  1Q7Y C;  3VR6 A;  4R4C A;  5E7N A;  2B3G A;  4H13 C;  3I4L A;  4Q5V A;  2HUG A;  1L1O A;  1EZ6 A;  1KHI A;  3SK4 A;  5IGD A;  3MWY W;  4OIK A;  1K0S A;  1C4Q A;  1HPC A;  2R3Z A;  2L5T A;  5CC4 A;  1VQB A;  2LFN A;  2RCF A;  5HGT A;  1EIF A;  1IYU A;  2UU9 L;  3FDT A;  1N9W A;  2MHV A;  2MPM A;  3HEJ A;  4PZ8 A;  3VR5 A;  3STB D;  2F0M A;  2R7F A;  1QZG A;  3T1Y L;  3M4Y A;  3SHL A;  3VYT A;  1VQ9 A;  2ASB A;  2LKV A;  5A35 A;  4A3M H;  2Z4I A;  5E4W C;  3JAM E;  4IFD H;  1K8O A;  4RWS C;  2F0L A;  3UI2 A;  1LTS D;  4X66 Q;  1EIG A;  2Z0S A;  2E2I H;  1JE4 A;  4GLV B;  2V1C C;  5DEH A;  4A76 A;  1YJW A;  1FNU A;  2I0Q A;  3C46 A;  3GQB A;  3BVM A;  1NMG A;  5IWA Q;  2EYL A;  2R93 H;  1LT5 D;  3BZD B;  2B2W C;  1DZ1 A;  4C1N I;  3J7Y W;  1N8R C;  4TKO B;  2F0E A;  3DHQ A;  2A69 D;  5NUC A;  5FJ8 G;  1D7Q A;  1EYG A;  1L0X B;  3ULP A;  2NUC A;  3U9S A;  1Q8I A;  2J0T D;  4DR7 Q;  4RGN A;  2EE1 A;  1XPO A;  4B9W A;  2E2H H;  2AQ3 B;  2CQO A;  3CCE A;  4A3F G;  1CT1 D;  4ZRZ A;  1S5F D;  1EWI A;  1DXM A;  2DGY A;  4DR5 Q;  3T56 B;  4JI8 Q;  3WWV A;  1I4R A;  4C1N K;  4YWM A;  4RGT A;  1BCP C;  4JI0 L;  3LNN A;  1YIJ A;  1PRT D;  1NTG A;  1PMR A;  3WOF A;  2Z8L A;  3H3V H;  2K1B A;  2Q8T A;  3G7L A;  1JMC A;  5C44 H;  4JBK A;  5IP9 H;  1PTO H;  2GN5 A;  2B2V C;  2NZH A;  3M4O B;  1B3A A;  5CV4 A;  5E4X A;  2F4V L;  3S1Q H;  2CWA A;  4DR6 L;  1II3 A;  2KCM A;  2F4I A;  4P73 A;  2DJF C;  3G6J B;  3T51 B;  3KJO A;  4XQQ A;  1NCV A;  4R1J A;  3HGB A;  2C35 B;  2UUA L;  5COY A;  4A3F B;  1SRO A;  3Q23 A;  3CHB D;  4DV1 L;  1WTX A;  1WTV A;  5M3F G;  1LT3 D;  1TII D;  1BVS A;  5M9O A;  3BZK A;  2I5L X;  1R4P B;  1HNX L;  2D5D A;  3T1H L;  4OWW B;  4P2C B;  4U67 3;  1PYW D;  2FMC A;  3FPP A;  4X3U A;  2CVR A;  3OHX C;  4JI7 Q;  3KK7 A;  1D1K A;  2QW7 A;  2HDM A;  3E0E A;  3SE0 A;  3TP8 A;  3AB9 A;  1FJG L;  1YHQ A;  2H5X A;  2O5I C;  1KLG D;  1ENF A;  1RF2 D;  2PW5 A;  4KJN A;  5M3F B;  2JA6 G;  5A2Q L;  4NXM L;  1XTD A;  3NTH A;  5T1G A;  5EPL A;  2XNA C;  4KTA A;  4MZ9 A;  4GLX A;  4G7O C;  5FO8 B;  1PA6 A;  1EQQ A;  5CV5 A;  4KKS A;  1GD7 A;  1STY A;  5IT9 L;  1B8A A;  3AEV A;  4CGY B;  2N49 A;  4R4O A;  3OYY A;  5C0X J;  2ENB A;  1F9S A;  5EKL A;  4DUY L;  2YTV A;  2QCP X;  1GM5 A;  4BBR H;  3J7A V;  4B3R Q;  3I90 A;  4GOP A;  4N9T A;  5DAU A;  4WJ4 A;  2JA6 B;  4UAI A;  4ZKC B;  1T5X D;  4EX5 A;  1CM9 A;  1DOL A;  1DGS A;  1Y8P B;  5JAV A;  4HJA A;  1F2M A;  2TMP A;  4KMU C;  2OWO A;  1N34 L;  3VA7 A;  3D4R A;  1JJC B;  4RFB A;  3H0G H;  4RHS A;  1CKN A;  3PIO 3;  3J80 i;  3HOZ H;  3S2D H;  3LX0 A;  4L5T A;  3VA5 A;  2VB3 X;  3K58 A;  1KQS A;  1EUJ A;  1HFG A;  4DK0 A;  3MXG A;  2JYO A;  1VQH A;  4DV2 Q;  4OWX B;  3DM1 A;  2WAQ G;  1S5B D;  1W2B A;  1KAW A;  1FYC A;  2KED A;  3NQT A;  3S14 H;  2CH4 A;  1BDO A;  3OW7 A;  3RZD B;  3RLO A;  1KNE A;  2A68 D;  4N8X 1;  1Q81 C;  3NEN A;  1S5E D;  4JG2 A;  4DKA C;  5GRO A;  1WVL A;  2KJX A;  3LWU A;  4JOI A;  1TT2 A;  4KHP L;  3NXW A;  2R93 G;  5C3X A;  4BS9 A;  5M3M B;  3SEB A;  4DV6 Q;  1H95 A;  2F0W A;  4HIO A;  5D14 A;  5CV8 A;  3SR1 A;  1KIX A;  3D3R A;  2WAQ B;  1IBM Q;  2Z6K A;  1HUM A;  3KLS A;  3P7J A;  5L37 A;  5C4X G;  3L7Z C;  3TDQ A;  3AFP A;  1ZKO A;  5EPK A;  4HCS A;  2CWP A;  4BWG B;  1HFN A;  3J81 i;  3FMC A;  3S1R B;  4E6I A;  1JJG A;  2B2T C;  4DR3 Q;  4ILW A;  1CK1 A;  1L0Y B;  3RNU A;  4A3K H;  5IP9 G;  4DN4 M;  1HNZ L;  1XMO Q;  3MXN A;  1SYG A;  1XNR Q;  1PH8 A;  1F9R A;  3GTO H;  1QWY A;  1BUV T;  5JJI A;  1UEB A;  4A3B B;  2RSO A;  4DAV A;  2QIL A;  5C4X B;  3A5U A;  5KNC A;  2L0C A;  1ZYR D;  4GS3 A;  4XDX A;  1IZ6 A;  3K0X A;  4B3T Q;  5JJL A;  4LFB L;  4JC0 A;  3A0J A;  1X3Q A;  1PZJ D;  1NR2 A;  2K32 A;  1M90 C;  3OIQ A;  1KDA A;  3I7F A;  1J9O A;  3QJY A;  2UXB Q;  1YNN D;  1PTO B;  4IPC A;  4FO2 A;  3PF5 A;  3GD7 A;  1WTR A;  1KXL A;  3T4A C;  2VS1 A;  2UUC Q;  1G6Z A;  5I6Y A;  1PZK D;  4AH6 A;  2XRQ D;  3ONA B;  4IOC A;  1CA5 A;  3KLR A;  3OTO Q;  2IX0 A;  3DEO A;  4LF5 Q;  2EY1 A;  1X3P A;  2IX1 A;  4GKK L;  4KD4 A;  5LMN W;  5K36 H;  3AU7 A;  3HKZ G;  4M8A A;  2NYZ D;  1SMY D;  4A4I A;  5FOB B;  3MXP A;  4LFA Q;  1BBX C;  2HT1 A;  3N52 A;  3EFX D;  1Z6H A;  4KN4 C;  1BXT A;  5FK9 C;  4JI5 L;  4JV5 L;  2F0F A;  5EPJ A;  3KOJ A;  3GV6 A;  3QB3 A;  3CQZ B;  4DV0 Q;  1NJI C;  1STE A;  1E1O A;  1J8I A;  1XJV A;  2A6H C;  2WP8 J;  2QDB A;  3DLL A;  1HR0 W;  3HOV H;  1C0A A;  4YHH Q;  3S2H B;  2XIW A;  1MGS A;  3BS1 A;  1WTQ A;  3GTM H;  5IYC H;  1U4L A;  5J3B A;  3HKZ B;  3DMU A;  4YWL A;  1HA6 A;  3NWT A;  1XPU A;  1B9N A;  4A3D H;  4QMG A;  4C2M B;  3QR8 A;  2FJ2 A;  1B7Y B;  1WI5 A;  1YNJ D;  5KIX A;  2IY5 B;  2BA1 A;  5BR8 L;  3G48 A;  1GUO A;  1TWF B;  3H0G G;  3ZJY C;  4UP9 A;  2CKZ B;  4KHV A;  3HOZ G;  1LTR D;  2YTX A;  3KF6 B;  4FXG C;  1YIT A;  4O42 A;  1P8L A;  1G2T A;  1PZI D;  2Z6B A;  1SYD A;  2JXM B;  4DV4 Q;  2F0I A;  4KJO A;  2GVA A;  4IQZ A;  4UDU C;  1EY5 A;  3AQQ A;  1J5E L;  4KI0 A;  3H3V C;  3Q0A A;  3BG3 A;  3CC4 A;  1YHB A;  3A7L A;  3OMG A;  2N8N A;  5IOC A;  1PTO C;  2NZO A;  2NVT H;  4DV7 Q;  5CV7 A;  3MTS A;  3H94 A;  1HQR D;  2N3S A;  4WJW A;  1E24 A;  4K8I A;  2Y0S E;  4C3J H;  2IW3 A;  1N32 Q;  3PQI A;  2JA5 B;  1Y1V H;  3GTL H;  3HOZ B;  4A93 G;  5JEA H;  2R6G A;  5C4H A;  4DA2 A;  5M5W B;  4FYD A;  1XX8 A;  2NVQ B;  4IPH A;  2UUB Q;  3EBE A;  4MIU A;  2FIN B;  4J8Q A;  1LV9 A;  1ROD A;  3JAM c;  2PQA B;  2F0T A;  2VUM G;  2WIN B;  1U4P A;  1STB A;  2FXQ A;  3R2T A;  5D3I B;  1GXD C;  3A8I E;  2VQE Q;  1HNW Q;  1XXG A;  4POF A;  4ZK9 B;  1PTO F;  4BY1 H;  4H0L C;  3PIO A;  3JC6 6;  2B2Y A;  3NPP A;  4MN3 A;  5DLQ E;  1EWH A;  1TS2 A;  3CF5 A;  1JOO A;  1GO3 E;  2DUD A;  2Q2T A;  4IOA A;  4A93 B;  1AE3 A;  1SNM A;  1S40 A;  4V0B A;  4ALP A;  2VB2 X;  1S72 A;  4L63 B;  3MFY A;  2KHI A;  1SAP A;  3NSW A;  2VUM B;  4DAY B;  1WTP A;  1A3V A;  1MJC A;  2D0P A;  1AN8 A;  1Q86 C;  1FNW A;  3I2Z A;  5IGF A;  1CFM A;  1DON A;  2KUM A;  1JOQ A;  4YWK A;  3PCO B;  4OO1 H;  1EYC A;  4UPA A;  1QOH A;  3CC2 A;  2D2C C;  4KY5 A;  4IJL A;  1OXT A;  2XVS A;  4LFC Q;  1TQO A;  3EA6 A;  4JYA Q;  2R7Z B;  2EYM A;  3TRE A;  1ASY A;  4H44 C;  4HED A;  3PO3 H;  4HIM A;  5AJ3 L;  1XMQ Q;  3GTO B;  4K8J A;  4G7Z C;  2Q8I B;  1T9H A;  4HR7 B;  2B2U A;  4YY3 L;  2EY2 A;  1A8V A;  4LF9 Q;  4YCU A;  4HMI A;  1IBL Q;  3S17 H;  3NBH A;  3MXU A;  1TWG H;  2ZXR A;  3CAM A;  3BYY B;  2K75 A;  3CRL C;  4JI1 Q;  1A15 A;  4DR4 L;  4J1M A;  1K83 H;  3M7G A;  3H6M A;  4X62 L;  2OF1 A;  5K36 G;  4DNR B;  3DWA A;  1N36 L;  5A2Q E;  1I5F A;  3CXC A;  3TSS A;  4DUZ Q;  2Q2U A;  3GTP B;  2YU9 H;  3Q24 A;  1HZC A;  1NSN S;  4L8J A;  3P75 A;  5IT9 E;  2PI2 A;  5ELD A;  1YBY A;  4ZUJ A;  1K8A C;  4CKC A;  1SFO B;  4K5W A;  1G8Z D;  2F0U A;  4CDE C;  1SDF A;  4IUV A;  2F0D A;  4HSP A;  1STA A;  2PNH A;  1E2V A;  2JK8 A;  4R4T A;  4QUF A;  1K8G A;  3HOV G;  4QIW E;  3RMH A;  3K5N A;  1V8Q A;  5IYC G;  5DNF A;  3FKI H;  1LTG D;  1SR3 A;  3SDZ A;  2HQL A;  2RDF A;  1D8L A;  5G3L D;  5EAY A;  3RN2 A;  4A3D G;  4BXX H;  2IX3 A;  2E2J B;  4CJ0 B;  4RA8 A;  3K59 A;  4RMF A;  2E8G A;  1GUS A;  1SNP A;  1VQC A;  4K0K Q;  1HCZ A;  3GDE A;  4LUO A;  5CMD A;  4IUP A;  2DNC A;  1MI2 A;  1EIH A;  1PFN A;  1AZP A;  2XGT A;  3HOV B;  1I6H H;  2WKD A;  2WB1 G;  2H4O A;  3ERS X;  3K57 A;  3GTM B;  4GKJ L;  3NQI A;  2OEO A;  4KLK A;  5I6W A;  1UE6 A;  3GP7 A;  4A3D B;  2BH8 A;  2QA4 A;  4BA2 I;  2DJG C;  1JE5 A;  1VQ7 A;  1XNQ L;  4C3J G;  4Y7N H;  2ZTE A;  2EXZ A;  1SNO A;  4C3H H;  4QY7 A;  1Y1V G;  3AFQ A;  2Z4H A;  2WII B;  2J4X A;  1YNX A;  3IFD A;  5KYI A;  3K5L A;  5IGG A;  1PH5 A;  4JI3 Q;  2G9D A;  3KYH C;  5C0X H;  2WB1 B;  4WOR A;  2K52 A;  4I7A A;  5J39 A;  4HJ8 A;  4C3I H;  1SLJ A;  1CHP D;  2L12 A;  3ER0 A;  1E3P A;  3J7Z C;  2ZJR A;  3HOU H;  2IJ0 A;  1EIY B;  2BH2 A;  4LUV A;  3FPU B;  1JB7 A;  3HZX A;  3KUP A;  2UXD L;  1TWC H;  4HTH A;  5EQ0 A;  5C4J H;  3HOY H;  3G71 A;  1TS3 A;  4XIG S;  2MO0 A;  1SMX A;  3A54 A;  1I94 L;  1D1I A;  2K01 A;  1WTW A;  4LMQ D;  3HOW H;  3M85 A;  5M5X H;  1WTH A;  3L2P A;  2CCZ A;  1A0I A;  1KAB A;  1MIU A;  3E6Z X;  4LF7 Q;  5C6A A;  2QEX A;  3S1N B;  1IBM L;  1PV4 A;  2CH4 W;  1TY2 A;  4OX9 Q;  3QOJ A;  4DAM A;  2I5H A;  5FO7 B;  2ZM6 L;  4GN3 B;  2MUY A;  5LMN L;  1S3O A;  2Z1C A;  3TS0 A;  1CQF A;  1IW7 D;  4P74 A;  4DV5 Q;  1Q8K A;  1I50 H;  4WFN 3;  2YYZ A;  2JJQ A;  4CDF C;  2JP1 A;  4G57 A;  4FF4 A;  1D2B A;  4JI2 Q;  3M3Y B;  1XWE A;  4HIK A;  4GNX B;  3U58 A;  1XMO L;  2RF4 A;  1JCK B;  1EWC A;  3NTK A;  3I4N H;  3ND9 A;  1PH4 A;  1UE5 A;  4HJ5 A;  2G9H D;  1M4V A;  2EYF A;  1HR0 L;  1BBU A;  1HRJ A;  4CHT B;  1PDQ A;  4B3T L;  1STG A;  2CHB D;  4JI6 L;  2R92 H;  4RGO S;  3SK5 A;  4CDD C;  3QO2 A;  5CBE E;  3TP6 A;  3RZO H;  2O4X A;  1Y1W H;  1VQ4 A;  2L11 A;  2EJF C;  4XYO A;  3PO2 H;  1ONL A;  3F8T A;  2YV5 A;  3VR2 A;  1JJ2 A;  1BBW A;  3S16 B;  4PG3 A;  4CDC C;  4H02 A;  3MZ5 A;  3URY A;  2D0O A;  1VMP A;  4K14 A;  3Q8D A;  1BQQ T;  3OTO L;  4FXK C;  2JEA I;  3QWN A;  4LF5 L;  3QOL A;  4UHV A;  3I4O A;  2E5L Q;  1KAA A;  2K14 A;  1E22 A;  1F77 A;  4PQX A;  1SXT A;  1TKW B;  4GN5 A;  1HJP A;  1KTK A;  5LMU L;  1I4P A;  4LNQ A;  2E76 C;  5H1S E;  1DYQ A;  1VQP A;  4IUR A;  1TWA H;  2DNE A;  2YU9 B;  3I4M G;  3S1M H;  3OWE B;  4U68 A;  5EKK A;  2C9O A;  1EY9 A;  2J7Z A;  1F2L A;  5D3D A;  1H9S B;  3S9W A;  5M5Y B;  4LAA A;  2F0N A;  1RTN A;  4P71 A;  1N33 Q;  1CZW A;  5ELO A;  1AW7 A;  4XQN A;  1I4G A;  2WKC A;  3HP3 A;  1PLF A;  3F1Z A;  3VYU A;  1OO9 B;  1LM0 A;  3KDF B;  2PZU A;  2VZA A;  4LF8 L;  2SEB D;  4B3M Q;  4FF2 A;  2OCE A;  1A3U A;  4ZUI A;  4YHH L;  2HHH L;  2EIF A;  1SSO A;  2NN6 H;  4ID6 A;  1R4Q B;  2RQX A;  4V19 0;  5BN4 A;  2L9H A;  4JCV E;  4GNX C;  1EOV A;  3OW2 A;  1IBK Q;  2G5D A;  3I4M B;  2ICE C;  2H1E A;  3KF8 A;  2F3I A;  1BKB A;  4XT3 B;  5KRU A;  2PMZ E;  4OEM B;  1VMC A;  3S15 B;  2AQ1 B;  1TWH H;  1U4M A;  2F0O A;  1EY6 A;  4A75 A;  2NZ1 D;  3CCR A;  1HZ9 A;  1SEB D;  1FL0 A;  1SE3 A;  2L4N A;  5C0X G;  4HSV A;  1Z47 A;  2XN9 C;  1MHW C;  3GTG H;  4C3I G;  5BN5 A;  1ENC A;  3HOU G;  2PMZ B;  4A3M G;  3R8B A;  3D4W A;  1AE2 A;  1ESR A;  1SBB B;  4OHJ A;  4IUT A;  1WCM H;  4IFD G;  4X65 L;  3CCM A;  4A3G H;  2WAQ E;  3JAM i;  3Q22 A;  3HOY G;  5IE8 A;  2UXC L;  5CYU A;  1T5E A;  1BOS A;  2GVB A;  3BDC A;  1XYI A;  2L55 A;  3M7N A;  2LY7 A;  4O2D A;  4BY7 H;  1O7Y A;  2EZV A;  5COR A;  2UU9 Q;  4NXN L;  2UUB L;  4CJ2 C;  3HOW G;  1S5C D;  1BCP D;  4DR1 L;  4LF4 Q;  5BN3 A;  4I65 A;  3T1Y Q;  1QB5 D;  1K3B C;  1UNS A;  4C3I B;  1NUC A;  1EY8 A;  3HOU B;  3K6O A;  2O5J C;  1VCI A;  4A3M B;  1HNW L;  1PH1 A;  2A6E C;  2MJ8 A;  4OIJ A;  5HUR A;  2LS0 1;  1VF7 A;  2ES2 A;  4TQU S;  2JA7 H;  4KD3 A;  4IFD I;  3HOY B;  3J80 L;  2E2I B;  5IYD H;  2IPK D;  3CRK C;  4EQO A;  3OWF A;  2K05 A;  5D65 A;  1VQ6 A;  4UP8 A;  2NVX H;  5GAG C;  3O13 A;  2JE6 I;  2L15 A;  4GN4 B;  4J6H A;  4B08 A;  3A7A B;  2R93 B;  5C44 G;  3HOW B;  1LAB A;  3UDF A;  1M8A A;  4WRD A;  1QIL A;  3EIV A;  1GHK A;  3V05 A;  2E2H B;  1CTM A;  4H7B A;  1K9M C;  1OXV A;  4BBS H;  2KQ3 A;  3K5O A;  2R92 G;  5CBA E;  1I50 B;  4LWC A;  2KCN A;  3I72 A;  4JYA L;  1A6X A;  1Y1W G;  2Q2I A;  1WD1 A;  3H15 A;  2AMC B;  2WAC A;  2EOT A;  4EQ5 A;  1P16 A;  3KLW A;  2Z9H A;  5C44 B;  3HOX H;  3H3V I;  4JOI C;  2F4V Q;  3ITP A;  2AWO A;  4DR6 Q;  2RKS A;  2SDF A;  3IFT A;  2HQE A;  4PMC A;  3B6Y A;  4A3L H;  3S1Q B;  1Q1E A;  1QNK A;  4AYB G;  5C5L A;  3RUZ A;  5J1Z A;  2UUA Q;  1CSP A;  5I4D A;  3J81 L;  1NMF A;  1D6E C;  3GTQ H;  1TVX A;  4DV1 Q;  3RLF A;  4FXD A;  5IOD A;  2BCO A;  4Z9C B;  5EKI A;  5ISR A;  1KD1 C;  4JBM A;  3RD4 A;  4JI4 L;  1HNX Q;  1Y1W B;  1ET9 A;  3GTK H;  3F2U A;  5IT9 c;  4AIM A;  1EY0 A;  2N78 A;  3OIP A;  4A3I H;  4A3J H;  1I6V C;  1KNA A;  3HKZ E;  1PYS B;  2NVY H;  2QDL A;  1EY4 A;  5FLM H;  2R61 A;  2CW0 C;  4ZLT F;  4DV3 L;  4FF1 A;  2CQA A;  5I9P A;  4AYB B;  1RJT A;  4A3E H;  1FJG Q;  3E0J A;  3K7A H;  1C48 A;  1B9M A;  1UE7 A;  2K7V A;  4DR2 Q;  1V43 A;  1FVI A;  4BBR G;  1Q82 C;  1Q1B A;  1JOR A;  1BR9 A;  4NXM Q;  3HFZ B;  4X6A H;  1VQD A;  1F9Q A;  1WOC A;  2XRS D;  5IP7 H;  3NP8 A;  2PNR C;  1TXY A;  4MHE A;  2KVM A;  3KLS X;  2F1M A;  1KLU D;  2V4D A;  2SNM A;  3EJI A;  2BA0 A;  2EQS A;  3TBI B;  1S4Z A;  3H09 A;  1Y8O B;  1YZ6 A;  5JJK A;  1X3E A;  4DUY Q;  4AQY L;  5J22 A;  3W5O A;  1LLR D;  1NBW A;  1OXX K;  4CBV A;  4B3S L;  3BU2 A;  4BBR B;  5KGU A;  2NB0 A;  1EQV A;  4LF6 L;  1JIC A;  1X6O A;  3W2D A;  5IYB H;  3J81 j;  4X64 L;  3VDY A;  4O0A A;  3D4D A;  4HJ7 A;  3P20 A;  4F7X A;  2K5Q A;  2CFM A;  1QUQ B;  1N34 Q;  3D0F A;  1DJR D;  4XQJ A;  2VXW A;  2KA7 A;  1VF5 C;  1PVO A;  5FLX L;  4Q0F A;  1NY4 A;  3R2I A;  1LTB D;  4LUZ A;  3RLN A;  2BOS A;  1EFI D;  3H0G B;  2AKW B;  3CC7 A;  4IUN A;  4CJ1 B;  3S2D B;  3GTJ H;  5JVG 3;  1OTC A;  2EY5 A;  5GAE C;  1F9P A;  1NE3 A;  1KL9 A;  2PO4 A;  1L2F A;  4NW2 A;  1SNQ A;  1FGU A;  1LT4 D;  1PXU A;  4EGV A;  1KDB A;  2M00 A;  4A3C H;  3V96 A;  1SND A;  2A8V A;  4IUU A;  2VY3 A;  3KF6 A;  1KRS A;  1PRT B;  2F0S A;  3S14 B;  2K50 A;  4MTK A;  4X66 L;  1HH2 P;  5IYD G;  2KHJ A;  1OXU A;  5JPM C;  2BE5 C;  1DCZ A;  4KHP Q;  1ML0 D;  5KNB A;  1IYV A;  5CR3 A;  3X3M A;  5IWA L;  3NBI A;  4DXF A;  2K6A A;  2VL6 A;  4A3K G;  1I4Q A;  1A3T A;  4DNT B;  5CGK A;  4XT1 B;  3E3X A;  2ICI A;  1JC7 A;  2IT1 A;  5CV6 A;  1WJJ A;  1EYA A;  4RAU C;  1STN A;  3UE0 A;  4R8I A;  4DR7 L;  1K0R A;  4CKE A;  1EY7 A;  4X3S A;  2KEE A;  4BBS G;  5EGT A;  4DR5 L;  4JI8 L;  4DF7 A;  4X3K A;  2PQA A;  3PUW A;  2K5N A;  3LWE A;  3NBH B;  3W3A A;  3STB C;  2F0J A;  1FD7 D;  1HNZ Q;  5LL6 S;  2F0K A;  2KOL A;  4A3K B;  3M4O H;  5FJ8 H;  1IL8 A;  2ATW A;  1B50 A;  3T53 B;  4C56 C;  1JWS D;  3E5S A;  3I56 A;  4K6D A;  4ME5 A;  3IL8 A;  1RD9 D;  2RDG A;  4A3F H;  5FO9 B;  4LFB Q;  1GUT A;  4DU9 A;  4N9P A;  1PH2 A;  3NHH A;  1WD0 A;  1V1P B;  3RR5 A;  2EPB A;  2A69 C;  2K5D A;  4DAY A;  2B2Y C;  1X54 A;  1Y14 B;  2A6H D;  2KHS A;  5IY0 A;  2VQF Q;  1EEI D;  1E2W A;  4A3I G;  3CCV A;  1AFP A;  1C9O A;  1DD2 A;  2JA8 H;  4JVZ A;  3DWQ A;  3QIA A;  2ZT9 C;  1HA5 A;  3ERO A;  3NEL A;  4WJ3 M;  5FLM G;  2MGS A;  3QG1 A;  1VQO A;  3MA2 B;  4JI7 L;  1K8M A;  1A63 A;  1KC8 C;  4A3E G;  2AUK A;  3CU7 A;  5TSS A;  1PRT C;  3I70 A;  1IYJ B;  3K81 C;  2K5V A;  3T16 A;  2DY8 A;  4NB3 A;  2K03 A;  3MAQ A;  1X56 A;  3MHB A;  2ALY B;  1S5D D;  3TP5 A;  4EQP A;  2O2L D;  3S24 A;  4IAL A;  1R9T H;  5IP7 G;  1I4H A;  2OTL A;  3UE1 A;  1F2Y A;  1CI3 M;  3FHW A;  4JI5 Q;  4JV5 Q;  1V9P A;  4XXE A;  1IKM A;  1PTO D;  1VDZ A;  1K3R A;  1X55 A;  2EJG C;  1C8C A;  1ICF B;  1CUK A;  4A3E B;  1YI2 A;  3K7A B;  2X69 A;  4LK1 C;  1L1O B;  4M1U B;  2B2U C;  1PRT F;  1FGB D;  3I73 A;  1GUW A;  1SE8 A;  2X6L A;  2JA6 H;  1BNZ A;  4B3R L;  1X65 A;  5IYB G;  1G6P A;  1G91 A;  2D62 A;  3R3O A;  4QL5 A;  1PH7 A;  3D6W A;  2WB1 E;  2HDL A;  3CPW A;  2KBN A;  1H9J A;  2PYK A;  2RSN A;  1SYB A;  5BR8 Q;  2LSS A;  3GO5 A;  1QNU A;  4PZ7 A;  4MTN A;  2B2W A;  4KV6 A;  4N8F A;  4DFA A;  5LL6 X;  4XTC S;  1SJE D;  3U9O A;  1H9K A;  1QG7 A;  1EQR A;  5KYL A;  5JEA G;  2F3W A;  4PV1 C;  5C3E H;  1ILQ A;  1JQY D;  1QE6 A;  5I2Y A;  4FNF A;  1DM0 B;  2DN8 A;  4DV2 L;  1HXY D;  3UDX A;  1G29 1;  4A3C G;  2NVT B;  1UWV A;  4Y52 H;  2L1B A;  2LXJ A;  3RZD H;  3E9H A;  1GOZ A;  3OSO A;  1NNX A;  4BY1 G;  1IHZ A;  4F88 A;  1GHJ A;  3J80 E;  1QVG A;  2JEB I;  3BVG A;  4K5V A;  1B53 A;  4C3J B;  4FP5 D;  2E74 C;  2B2V A;  3AMU A;  3BYT B;  4KN7 C;  1ILP A;  1Y1V B;  5IIF A;  3GTL B;  3GTJ B;  5M3M H;  2QKI C;  1E2Z A;  1VQI A;  1B1Z A;  4LF4 L;  3Q6S A;  3MVV A;  2SNS A;  2GA4 B;  1TS5 A;  3NUC A;  1RL2 A;  2ZTC A;  3MC0 B;  4DV6 L;  2FFK B;  3E9I A;  3FVQ A;  3I3C A;  1TY0 A;  3FP9 A;  4DK1 A;  5DM7 3;  5DM6 3;  2QEJ C;  1HUN A;  4PZ6 A;  2M9V A;  1PFM A;  1VQK A;  3TRZ A;  1ET6 A;  1PHJ A;  4BY1 B;  3S1R H;  1F2Z A;  4OO1 G;  4NPS A;  3I91 A;  2F0P A;  5F2D A;  4LJZ C;  3A8J E;  3FEW X;  4QCL A;  2Q8R E;  4K6L A;  4XYQ A;  1V1O A;  3ULJ A;  1L1O C;  4DR3 L;  1JWM D;  1HQM C;  3CCJ A;  3PO3 G;  5I9O A;  4QQB X;  4IO9 A;  3MFG A;  3BJU A;  3VYS A;  2DY7 A;  1Q12 A;  1XNR L;  3CPF A;  3A56 A;  2PZW A;  4A3B H;  5AFW A;  2ID0 A;  1SN8 A;  2A68 C;  5C4Z A;  5C4X H;  4DAP A;  3PUZ A;  5ELF A;  2EY6 A;  5FKA C;  3J81 E;  2KEC A;  1PH9 A;  2A74 C;  1B70 B;  2K04 A;  3LGJ A;  2OXP A;  3PV0 A;  1YJ9 A;  1X3G A;  3H91 A;  3M4Q A;  4OO1 I;  5HY6 A;  5EBC A;  2FMM A;  2HIX A;  3M9B A;  5AJ3 Q;  1GJX A;  2UXB L;  3PO3 B;  2JA8 G;  5GAH C;  2Q2H A;  3PSI A;  2E75 C;  2P5Z X;  5K5P A;  5EJW A;  2UUC L;  3PUV A;  4JBJ A;  1E0B A;  2EYP A;  4YY3 Q;  5E1F A;  2F03 A;  4HID A;  2RCN A;  5KEE A;  2BDN A;  3L3O C;  2ZJQ A;  1YEZ A;  2HIV A;  4ZYS A;  2XSC A;  1O7I A;  1Q46 A;  4DR4 Q;  1AH9 A;  1BF4 A;  1TU2 B;  4X62 Q;  3S17 B;  2AQ2 B;  1TWG B;  2K5W A;  4GNX A;  3D31 A;  3U4Z A;  1N36 Q;  4RGM A;  1K83 B;  1ENA A;  1BCP F;  1GVP A;  4R4I A;  2MQH A;  2AHO B;  2MP1 A;  3FKI G;  3TME A;  2B29 A;  1QVF A;  4HCE A;  4BXX G;  1MKH A;  4X3T A;  2JA8 B;  3ZYY X;  4LFA L;  4GOP B;  5JOB A;  1ZYR C;  3CQZ H;  4KHZ A;  3DM3 A;  1IL2 A;  4NDX A;  4F8M A;  3N6R A;  4DV0 L;  3KF8 B;  1W6K A;  1UE1 A;  2QGQ A;  2F3V A;  4DR2 L;  1MSH A;  3MEH A;  1EEF D;  4RCO A;  1YNN C;  1LTI D;  4L6T B;  3S2H H;  1D5M C;  2KEN A;  1LTL A;  2F0Q A;  4G4K A;  1U0L A;  1LAC A;  2KCT A;  2XWB B;  3CCS A;  1CKN B;  3U4V A;  1R9T B;  1M1K C;  2OTJ A;  3KJP A;  3FKI B;  2A73 B;  3G6E A;  1NAP A;  3X3N A;  2PW7 A;  4C2M H;  2JN4 A;  1PH3 A;  4ABN A;  4HAE A;  3G4S A;  1MJE A;  2BDO A;  3CKI B;  2OQK A;  5FLX E;  4FVM A;  1TWF H;  2ZXO A;  2EJM A;  1UEA B;  1O78 A;  4C3H G;  3RN5 A;  1SE2 A;  2ZJP A;  1XTC D;  2HD3 A;  1SMY C;  5C3E G;  4QUC A;  1EL0 A;  1JOK A;  1YVC A;  2F0G A;  4GKJ Q;  1I6H B;  3DWP A;  4DV4 L;  2C5C A;  2XTI A;  3PUY A;  1H9R A;  1H9S A;  2ZTD A;  4IFD J;  2SOB A;  1X3F A;  1OXS C;  2PPB C;  3V2T A;  4RKB A;  4DV7 L;  3KDF A;  2B2T A;  1XNQ Q;  1V1Q A;  3A8K E;  1RHP A;  5IGE A;  2JA5 H;  1CSQ A;  4DGZ A;  2K5H A;  4Y7N B;  4C3H B;  1CA6 A;  1N32 L;  5M5W H;  3C2P A;  2NVQ H;  2VW9 A;  4P72 A;  5M3M G;  2K33 A;  5C3E B;  4P75 A;  3K5M A;  1VQ5 A;  3W1B A;  1VQ8 A;  1I3Q H;  2R7D A;  3F2B A;  3CMA A;  1YNJ C;  5C0X I;  1EYD A;  5ELN A;  4ZCK A;  1Q3L A;  1AEX A;  2VQE L;  4GOP C;  2UXD Q;  3MXN B;  3K0Y A;  1KRT A;  1FR3 A;  1LUZ A;  4PNY A;  4R4Q A;  1TWC B;  1CHQ D;  5C4J B;  4A93 H;  3DEP A;  1I94 Q;  1NR4 A;  1STH A;  2PCF B;  3UDI A;  4GZY C;  1XPR A;  1K73 C;  2VNU D;  1G2S A;  1SYF A;  1RCV D;  2QF7 A;  2VUM H;  5M5X B;  3A55 A;  3PIP 3;  4HN7 A;  4TSS A;  1PH6 A;  1E1T A;  4A3B G;  3CD6 A;  1VQE A;  3I4N G;  4L5R C;  2ZM6 Q;  5LMN Q;  2PZT A;  1EFW A;  1LYL A;  3TN2 A;  3JAM L;  1JWU D;  2FHT A;  3C3L A;  4NP5 A;  4RHR A;  1ZEQ X;  4KKT A;  1B3Q A;  1E7Z A;  1FNV A;  4IN3 A;  4K5X A;  3K8A A;  1U9R A;  1HTP A;  2EYH A;  3SVM A;  2R7Z H;  4J15 A;  4JI0 Q;  4LFC L;  3CCU A;  5EBD A;  3PMF A;  1LTA D;  4HMJ A;  3SXH A;  1TS4 A;  2OT2 A;  3U50 C;  3EVQ A;  1JT8 A;  1I4X A;  3PO2 G;  2NWG A;  1XMQ L;  2M2L A;  2WFW A;  3OOC A;  3AYH B;  2RDH A;  4ODG A;  1VQJ A;  4YCW A;  1HR0 Q;  1VQF A;  3I4N B;  3SK8 A;  2B63 H;  4YCV A;  4DPG A;  4JK1 C;  4RG1 A;  2RA4 A;  4G7H C;  4LF9 L;  1D5X C;  3SK6 A;  4JI6 Q;  1IBL L;  2B8G A;  3TP7 A;  2KCC A;  2Z6K C;  4AYB E;  4JI1 L;  1SYC A;  2R92 B;  3J7A F;  5CV9 A;  1JR0 D;  2VQF L;  2EVB A;  2F52 A;  4K2K A;  4ZAI A;  3GTP H;  3UDG A;  3RZO B;  1B2T A;  1MD2 D;  2MFI A;  4DUZ L;  3T1H Q;  4IZ8 A;  3PO2 B;  1W6J A;  2AUJ D;  4L5Q A;  5C5M A;  1CQV A;  1IKL A;  1SFO H;  3HRZ C;  4PMW A;  2RHS B;  3HS0 C;  2HCI A;  1YHA A;  4QGU A;  3SGI A;  4ME3 A;  5LMU Q;  1HTL D;  2NN6 G;  5ELC A;  1J6Q A;  3R93 A;  3I55 A;  3TQY A;  2E2J H;  4PMB A;  3TEH B;  4KK7 A;  1TWA B;  2RBM A;  1VS0 A;  3S1M B;  1B44 D;  4IUQ A;  2WV6 D;  1VQL A;  2A19 A;  5JPN C;  1CKM A;  1SJH D;  1U4R A;  3C1F A;  1L0W A;  4K0K L;  2TSS A;  3BDL A;  1TR5 A;  4R8N A;  1JB3 A;  5JJZ A;  4LF8 Q;  5KND A;  1QVC A;  2XWJ B;  2HHH Q;  1UAP A;  1C7Y A;  2HCC A;  3CME A;  5IGC A;  5ELE A;  3BZC A;  4NMZ A;  3WOE A;  3D8G A;  3MEF A;  2LMC B;  3ICE A;  2NN6 I; 
#chains in the Genus database with same CATH homology
 3DXJ C;  4ZKB B;  5T1I A;  4B9X A;  1RDP D;  2NBF A;  4BA1 I;  3NE5 B;  1TWH B;  2A6E D;  3T13 A;  3KBG A;  1Y8N B;  1AP0 A;  4KKU A;  3EQL C;  1Q90 A;  4EQN A;  4QB4 A;  4KY7 A;  4RCN A;  1MSG A;  3GTG B;  1O7L A;  4ZQ3 A;  1EQT A;  1D5Z C;  2I46 A;  2RVL A;  4EVO A;  1EU3 A;  1QCB D;  3KBX A;  4K2L A;  1WCM B;  1ESF A;  4A3G B;  1ZXT A;  2D9U A;  3OMC A;  4BY7 B;  1ICW A;  4S3S A;  1MBY A;  5G3L F;  1I3Q B;  4R9W A;  3NK9 A;  2B39 A;  1BO0 A;  3BVZ A;  1H9M A;  3OPO A;  1PFB A;  2Y0S B;  4F87 A;  1X32 A;  5C3W A;  2JA7 B;  1A2T A;  3P1H A;  2PQE A;  2IL8 A;  5LHY 1;  2EYJ A;  2NVX B;  5E3F A;  3NTI A;  2NTT A;  4NKL A;  5JVH 3;  4ULL A;  2F0V A;  1DOM A;  1SYE A;  3IAY A;  2E2D C;  2CW0 D;  2F0H A;  4BBS B;  3WDN A;  3PUX A;  2IWH A;  1A2U A;  1KDC A;  4QF4 A;  1WTO A;  5I2X A;  2X6G A;  2ZXP A;  1LT6 D;  3HG9 A;  3HOX B;  1SE4 A;  1IW7 C;  5ELB A;  1RTO A;  2B63 B;  1AZQ A;  2A5H A;  1EZ8 A;  3GTQ B;  1QJO A;  3D6C A;  3DUZ A;  4JBW A;  2N55 A;  4OGQ C;  3NWS A;  1LTT D;  3GTK B;  5IGB A;  1B4O A;  3TZD A;  4A3I B;  4A3J B;  1RKN A;  3GV3 A;  2EYO A;  3TZU A;  1LO5 D;  3ND8 A;  1UUP A;  4RH6 A;  2NVY B;  1GUG A;  2I07 B;  1HHV A;  1V1P A;  2N88 A;  4RKL A;  4O1N A;  4I7Z C;  1Z7T A;  4KY6 A;  1GUN A;  3I8Z A;  3C1E A;  1O80 A;  3BDO A;  4DXG A;  1Y69 U;  4YIJ A;  4CKB A;  3VR4 A;  2NTS A;  1DOK A;  2B8F A;  2JSO A;  3ERQ A;  3VYR A;  1CZG A;  1SNC A;  4OL7 A;  3FRP B;  1EU4 A;  5JEA J;  4QIW B;  3VR3 A;  1EOT A;  4FF3 A;  1BCP B;  4TRD A;  1O7Z A;  2BE5 D;  3IKJ A;  2AWN A;  2K28 A;  2EDG A;  3L9A X;  3VR6 A;  4H13 C;  3I4L A;  4Q5V A;  2HUG A;  1EZ6 A;  3SK4 A;  5IGD A;  3MWY W;  4OIK A;  1C4Q A;  1HPC A;  2R3Z A;  2L5T A;  5CC4 A;  2LFN A;  5HGT A;  1IYU A;  3FDT A;  2MHV A;  2MPM A;  3HEJ A;  3VR5 A;  2F0M A;  3M4Y A;  3SHL A;  3VYT A;  2LKV A;  5A35 A;  2Z4I A;  5E4W C;  3JAM E;  4IFD H;  1K8O A;  4RWS C;  2F0L A;  3UI2 A;  1LTS D;  1EIG A;  1JE4 A;  5DEH A;  1FNU A;  3C46 A;  3GQB A;  3BVM A;  2EYL A;  1LT5 D;  3BZD B;  2B2W C;  1DZ1 A;  4C1N I;  3J7Y W;  4TKO B;  2F0E A;  3DHQ A;  2A69 D;  5NUC A;  1L0X B;  2NUC A;  3U9S A;  1Q8I A;  2J0T D;  4RGN A;  2EE1 A;  4B9W A;  2AQ3 B;  1CT1 D;  4ZRZ A;  1S5F D;  1DXM A;  3T56 B;  1I4R A;  4C1N K;  4RGT A;  1BCP C;  3LNN A;  1PRT D;  1PMR A;  3WOF A;  2Z8L A;  2K1B A;  2Q8T A;  3G7L A;  1PTO H;  2B2V C;  3M4O B;  1B3A A;  5CV4 A;  5E4X A;  1II3 A;  2F4I A;  3G6J B;  3T51 B;  4XQQ A;  1NCV A;  3HGB A;  5COY A;  4A3F B;  3Q23 A;  3CHB D;  1WTX A;  1WTV A;  1LT3 D;  1TII D;  5M9O A;  1R4P B;  2D5D A;  4P2C B;  4U67 3;  1PYW D;  2FMC A;  3FPP A;  4X3U A;  2CVR A;  3OHX C;  3KK7 A;  1D1K A;  2HDM A;  3SE0 A;  3TP8 A;  3AB9 A;  2O5I C;  1KLG D;  1ENF A;  1RF2 D;  2PW5 A;  4KJN A;  5M3F B;  5A2Q L;  3NTH A;  5T1G A;  5EPL A;  2XNA C;  4KTA A;  4G7O C;  5FO8 B;  5CV5 A;  4KKS A;  1STY A;  5IT9 L;  4CGY B;  5C0X J;  2ENB A;  1F9S A;  5EKL A;  2QCP X;  3J7A V;  3I90 A;  4N9T A;  5DAU A;  2JA6 B;  4UAI A;  4ZKC B;  1T5X D;  1CM9 A;  1DOL A;  1Y8P B;  5JAV A;  1F2M A;  2TMP A;  4KMU C;  3VA7 A;  3D4R A;  4RFB A;  4RHS A;  3PIO 3;  3LX0 A;  3VA5 A;  2VB3 X;  3K58 A;  1HFG A;  4DK0 A;  3MXG A;  2JYO A;  3DM1 A;  1S5B D;  1FYC A;  2KED A;  3NQT A;  1BDO A;  3OW7 A;  3RZD B;  1KNE A;  2A68 D;  1S5E D;  1WVL A;  2KJX A;  3LWU A;  1TT2 A;  3NXW A;  5C3X A;  4BS9 A;  5M3M B;  3SEB A;  2F0W A;  5D14 A;  5CV8 A;  3SR1 A;  3D3R A;  2WAQ B;  1HUM A;  3KLS A;  3P7J A;  3L7Z C;  3TDQ A;  1ZKO A;  5EPK A;  4HCS A;  4BWG B;  1HFN A;  3FMC A;  3S1R B;  4E6I A;  2B2T C;  4ILW A;  1CK1 A;  1L0Y B;  4DN4 M;  3MXN A;  1SYG A;  1F9R A;  1QWY A;  1BUV T;  4A3B B;  2RSO A;  4DAV A;  2QIL A;  5C4X B;  5KNC A;  2L0C A;  1ZYR D;  4XDX A;  1X3Q A;  1PZJ D;  1NR2 A;  2K32 A;  3OIQ A;  1KDA A;  1J9O A;  3QJY A;  1YNN D;  1PTO B;  4FO2 A;  3GD7 A;  1WTR A;  3T4A C;  1G6Z A;  5I6Y A;  1PZK D;  2XRQ D;  3ONA B;  1CA5 A;  3KLR A;  2IX0 A;  3DEO A;  2EY1 A;  1X3P A;  2IX1 A;  4KD4 A;  5K36 H;  3AU7 A;  4M8A A;  2NYZ D;  1SMY D;  5FOB B;  3MXP A;  1BBX C;  3N52 A;  3EFX D;  1Z6H A;  4KN4 C;  1BXT A;  5FK9 C;  2F0F A;  5EPJ A;  3GV6 A;  3QB3 A;  3CQZ B;  1STE A;  1J8I A;  2A6H C;  2WP8 J;  2QDB A;  3S2H B;  2XIW A;  1MGS A;  3BS1 A;  1WTQ A;  1U4L A;  3HKZ B;  3DMU A;  1HA6 A;  3NWT A;  1B9N A;  4QMG A;  4C2M B;  2FJ2 A;  1YNJ D;  5KIX A;  2BA1 A;  1GUO A;  1TWF B;  4KHV A;  1LTR D;  4FXG C;  4O42 A;  1G2T A;  1PZI D;  1SYD A;  2JXM B;  2F0I A;  4KJO A;  4IQZ A;  4UDU C;  1EY5 A;  4KI0 A;  3H3V C;  3Q0A A;  3BG3 A;  3A7L A;  3OMG A;  5IOC A;  1PTO C;  5CV7 A;  3MTS A;  3H94 A;  1HQR D;  4WJW A;  4K8I A;  2IW3 A;  2JA5 B;  3HOZ B;  5JEA H;  2R6G A;  5C4H A;  4DA2 A;  5M5W B;  4FYD A;  1XX8 A;  2NVQ B;  4MIU A;  2FIN B;  4J8Q A;  1LV9 A;  1ROD A;  2F0T A;  2WIN B;  1U4P A;  1STB A;  3R2T A;  5D3I B;  1GXD C;  3A8I E;  1XXG A;  4ZK9 B;  1PTO F;  4H0L C;  2B2Y A;  3NPP A;  4MN3 A;  1EWH A;  1TS2 A;  1JOO A;  4A93 B;  1SNM A;  4V0B A;  2VB2 X;  4L63 B;  3MFY A;  1SAP A;  3NSW A;  2VUM B;  1WTP A;  1A3V A;  1AN8 A;  1FNW A;  5IGF A;  1CFM A;  1DON A;  2KUM A;  1JOQ A;  4OO1 H;  1EYC A;  1QOH A;  2D2C C;  4KY5 A;  1OXT A;  2XVS A;  1TQO A;  3EA6 A;  2R7Z B;  2EYM A;  4H44 C;  4HED A;  3GTO B;  4K8J A;  4G7Z C;  2Q8I B;  4HR7 B;  2B2U A;  2EY2 A;  4HMI A;  3NBH A;  3MXU A;  2ZXR A;  3BYY B;  3CRL C;  1A15 A;  4J1M A;  3M7G A;  3H6M A;  2OF1 A;  5K36 G;  4DNR B;  3DWA A;  5A2Q E;  3TSS A;  3GTP B;  3Q24 A;  1NSN S;  4L8J A;  3P75 A;  5IT9 E;  5ELD A;  4ZUJ A;  4CKC A;  1SFO B;  4K5W A;  1G8Z D;  2F0U A;  1SDF A;  4IUV A;  2F0D A;  4HSP A;  1STA A;  1E2V A;  4QUF A;  3RMH A;  3K5N A;  1V8Q A;  5DNF A;  1LTG D;  3SDZ A;  2RDF A;  5G3L D;  2IX3 A;  2E2J B;  4CJ0 B;  4RA8 A;  3K59 A;  1GUS A;  1SNP A;  1HCZ A;  5CMD A;  4IUP A;  2DNC A;  1MI2 A;  1EIH A;  1PFN A;  1AZP A;  3HOV B;  2WKD A;  2H4O A;  3K57 A;  3GTM B;  3NQI A;  2OEO A;  5I6W A;  3GP7 A;  4A3D B;  4BA2 I;  4C3J G;  2EXZ A;  1SNO A;  2Z4H A;  2WII B;  2J4X A;  3IFD A;  5KYI A;  3K5L A;  5IGG A;  2G9D A;  5C0X H;  2WB1 B;  4WOR A;  5J39 A;  1CHP D;  2L12 A;  2IJ0 A;  3FPU B;  3HZX A;  3KUP A;  4HTH A;  5EQ0 A;  1TS3 A;  4XIG S;  3A54 A;  1D1I A;  2K01 A;  1WTW A;  4LMQ D;  3M85 A;  1KAB A;  3E6Z X;  5C6A A;  3S1N B;  1TY2 A;  3QOJ A;  5FO7 B;  2MUY A;  2Z1C A;  1CQF A;  1IW7 D;  4WFN 3;  2YYZ A;  2JP1 A;  4G57 A;  4FF4 A;  1D2B A;  3M3Y B;  1XWE A;  1JCK B;  1EWC A;  3NTK A;  3ND9 A;  2G9H D;  1M4V A;  2EYF A;  1HRJ A;  4CHT B;  1PDQ A;  1STG A;  2CHB D;  4RGO S;  3SK5 A;  3QO2 A;  5CBE E;  3TP6 A;  2O4X A;  2L11 A;  2EJF C;  4XYO A;  1ONL A;  3VR2 A;  3S16 B;  3MZ5 A;  3URY A;  1VMP A;  4K14 A;  1BQQ T;  4FXK C;  2JEA I;  3QWN A;  3QOL A;  1KAA A;  4PQX A;  1F77 A;  1SXT A;  1TKW B;  1KTK A;  1I4P A;  2E76 C;  1DYQ A;  4IUR A;  2DNE A;  2YU9 B;  3OWE B;  4U68 A;  5EKK A;  2C9O A;  1EY9 A;  2J7Z A;  1F2L A;  5D3D A;  1H9S B;  3S9W A;  5M5Y B;  4LAA A;  2F0N A;  1RTN A;  1CZW A;  1AW7 A;  4XQN A;  1I4G A;  2WKC A;  3HP3 A;  1PLF A;  3VYU A;  1OO9 B;  2PZU A;  2SEB D;  4FF2 A;  1A3U A;  4ZUI A;  1SSO A;  2NN6 H;  4ID6 A;  1R4Q B;  2RQX A;  4V19 0;  5BN4 A;  2L9H A;  3I4M B;  2ICE C;  2H1E A;  3KF8 A;  4XT3 B;  5KRU A;  1VMC A;  3S15 B;  2AQ1 B;  1U4M A;  2F0O A;  1EY6 A;  2NZ1 D;  1SEB D;  1SE3 A;  2L4N A;  5C0X G;  4HSV A;  1Z47 A;  2XN9 C;  4C3I G;  5BN5 A;  1ENC A;  2PMZ B;  3R8B A;  3D4W A;  1ESR A;  1SBB B;  4OHJ A;  4IUT A;  4IFD G;  3Q22 A;  5CYU A;  1T5E A;  1BOS A;  3BDC A;  1XYI A;  2L55 A;  3M7N A;  2LY7 A;  1O7Y A;  2EZV A;  5COR A;  4CJ2 C;  1S5C D;  1BCP D;  5BN3 A;  4I65 A;  1QB5 D;  1UNS A;  4C3I B;  1NUC A;  1EY8 A;  3HOU B;  3K6O A;  2O5J C;  1VCI A;  4A3M B;  2A6E C;  2MJ8 A;  4OIJ A;  5HUR A;  2LS0 1;  1VF7 A;  4TQU S;  4KD3 A;  4IFD I;  3HOY B;  3J80 L;  2E2I B;  2IPK D;  3CRK C;  4EQO A;  3OWF A;  2K05 A;  5D65 A;  3O13 A;  2JE6 I;  4J6H A;  4B08 A;  3A7A B;  2R93 B;  3HOW B;  1LAB A;  1M8A A;  4WRD A;  1QIL A;  1GHK A;  3V05 A;  2E2H B;  1CTM A;  4H7B A;  1OXV A;  2KQ3 A;  3K5O A;  5CBA E;  1I50 B;  2KCN A;  3I72 A;  1A6X A;  1WD1 A;  2WAC A;  2EOT A;  5C44 B;  3ITP A;  2AWO A;  2RKS A;  2SDF A;  3IFT A;  2HQE A;  4PMC A;  3S1Q B;  1Q1E A;  1QNK A;  5C5L A;  3RUZ A;  5J1Z A;  5I4D A;  3J81 L;  1D6E C;  1TVX A;  3RLF A;  4FXD A;  5IOD A;  2BCO A;  4Z9C B;  5EKI A;  5ISR A;  3RD4 A;  1Y1W B;  1ET9 A;  3F2U A;  1EY0 A;  3OIP A;  1I6V C;  1KNA A;  1EY4 A;  2R61 A;  2CW0 C;  4ZLT F;  4FF1 A;  2CQA A;  5I9P A;  4AYB B;  1RJT A;  3E0J A;  1C48 A;  1B9M A;  2K7V A;  1V43 A;  1Q1B A;  1JOR A;  1BR9 A;  1F9Q A;  2XRS D;  3NP8 A;  2PNR C;  4MHE A;  2KVM A;  3KLS X;  2F1M A;  1KLU D;  2V4D A;  2SNM A;  3EJI A;  2BA0 A;  3TBI B;  1S4Z A;  3H09 A;  1Y8O B;  5J22 A;  1LLR D;  1OXX K;  4CBV A;  4BBR B;  5KGU A;  2NB0 A;  1EQV A;  1JIC A;  3W2D A;  3D4D A;  3P20 A;  4F7X A;  2K5Q A;  1DJR D;  4XQJ A;  2VXW A;  2KA7 A;  1VF5 C;  5FLX L;  4Q0F A;  3R2I A;  1LTB D;  2BOS A;  1EFI D;  3H0G B;  4IUN A;  4CJ1 B;  3S2D B;  5JVG 3;  2EY5 A;  1F9P A;  2PO4 A;  4NW2 A;  1SNQ A;  1PXU A;  1LT4 D;  4EGV A;  1KDB A;  2M00 A;  3V96 A;  1SND A;  4IUU A;  1PRT B;  2F0S A;  3S14 B;  1OXU A;  5JPM C;  2BE5 C;  1DCZ A;  1ML0 D;  5KNB A;  1IYV A;  5CR3 A;  3X3M A;  3NBI A;  4DXF A;  2K6A A;  1I4Q A;  1A3T A;  4DNT B;  5CGK A;  4XT1 B;  2ICI A;  1JC7 A;  2IT1 A;  5CV6 A;  1EYA A;  4RAU C;  1STN A;  4R8I A;  4CKE A;  1EY7 A;  4X3S A;  2KEE A;  5EGT A;  4DF7 A;  4X3K A;  3PUW A;  3LWE A;  3W3A A;  2F0J A;  1FD7 D;  5LL6 S;  2F0K A;  2KOL A;  4A3K B;  1IL8 A;  1B50 A;  3T53 B;  4C56 C;  1JWS D;  3E5S A;  4K6D A;  4ME5 A;  3IL8 A;  1RD9 D;  2RDG A;  5FO9 B;  1GUT A;  4DU9 A;  4N9P A;  3NHH A;  1WD0 A;  1V1P B;  2EPB A;  2A69 C;  2K5D A;  4DAY A;  2B2Y C;  2A6H D;  2KHS A;  1EEI D;  1E2W A;  1AFP A;  1DD2 A;  3DWQ A;  3QIA A;  2ZT9 C;  1HA5 A;  3ERO A;  2MGS A;  3QG1 A;  3MA2 B;  1K8M A;  2AUK A;  3CU7 A;  5TSS A;  1PRT C;  3I70 A;  3T16 A;  2DY8 A;  2K03 A;  3MAQ A;  3MHB A;  1S5D D;  3TP5 A;  4EQP A;  2O2L D;  4IAL A;  1I4H A;  1F2Y A;  1CI3 M;  4XXE A;  1IKM A;  1PTO D;  1VDZ A;  2EJG C;  1C8C A;  4A3E B;  3K7A B;  2X69 A;  4LK1 C;  4M1U B;  2B2U C;  1PRT F;  1FGB D;  3I73 A;  1GUW A;  2X6L A;  1BNZ A;  1G91 A;  2D62 A;  3R3O A;  3D6W A;  2HDL A;  1H9J A;  2PYK A;  2RSN A;  1SYB A;  3GO5 A;  1QNU A;  2B2W A;  4KV6 A;  4DFA A;  5LL6 X;  4XTC S;  1SJE D;  3U9O A;  1H9K A;  1QG7 A;  5KYL A;  5JEA G;  2F3W A;  4PV1 C;  1ILQ A;  1JQY D;  1QE6 A;  5I2Y A;  4FNF A;  1DM0 B;  2DN8 A;  1HXY D;  1G29 1;  2NVT B;  2L1B A;  1GOZ A;  3OSO A;  1IHZ A;  4F88 A;  1GHJ A;  3J80 E;  2JEB I;  3BVG A;  4K5V A;  1B53 A;  4C3J B;  4FP5 D;  2E74 C;  2B2V A;  3AMU A;  3BYT B;  4KN7 C;  1ILP A;  1Y1V B;  5IIF A;  3GTL B;  3GTJ B;  2QKI C;  1E2Z A;  1B1Z A;  3Q6S A;  3MVV A;  2SNS A;  2GA4 B;  1TS5 A;  3NUC A;  3MC0 B;  2FFK B;  3FVQ A;  3I3C A;  1TY0 A;  4DK1 A;  5DM7 3;  5DM6 3;  2QEJ C;  1HUN A;  2M9V A;  1PFM A;  1ET6 A;  4BY1 B;  1F2Z A;  4OO1 G;  3I91 A;  2F0P A;  5F2D A;  4LJZ C;  3A8J E;  3FEW X;  4QCL A;  2Q8R E;  4K6L A;  4XYQ A;  1V1O A;  1JWM D;  1HQM C;  5I9O A;  3MFG A;  3VYS A;  2DY7 A;  1Q12 A;  3A56 A;  2PZW A;  5AFW A;  2ID0 A;  5C4Z A;  2A68 C;  4DAP A;  3PUZ A;  5ELF A;  2EY6 A;  5FKA C;  3J81 E;  2KEC A;  2A74 C;  2K04 A;  2OXP A;  3PV0 A;  3H91 A;  4OO1 I;  5EBC A;  2FMM A;  1GJX A;  3PO3 B;  2E75 C;  5K5P A;  5EJW A;  3PUV A;  1E0B A;  2EYP A;  5E1F A;  2F03 A;  5KEE A;  2BDN A;  3L3O C;  4ZYS A;  2XSC A;  1BF4 A;  1TU2 B;  3S17 B;  2AQ2 B;  1TWG B;  2K5W A;  3D31 A;  4RGM A;  1K83 B;  1ENA A;  1BCP F;  2MP1 A;  3TME A;  4HCE A;  4X3T A;  2JA8 B;  3ZYY X;  5JOB A;  1ZYR C;  4KHZ A;  4NDX A;  4F8M A;  3N6R A;  1W6K A;  2F3V A;  1MSH A;  3MEH A;  1EEF D;  4RCO A;  1YNN C;  1LTI D;  4L6T B;  1D5M C;  2F0Q A;  4G4K A;  1LAC A;  1R9T B;  2XWB B;  3FKI B;  2A73 B;  1NAP A;  3X3N A;  2PW7 A;  4ABN A;  4HAE A;  2BDO A;  3CKI B;  5FLX E;  4FVM A;  2ZXO A;  2EJM A;  1UEA B;  1O78 A;  4C3H G;  1SE2 A;  1XTC D;  1SMY C;  4QUC A;  1EL0 A;  1JOK A;  2F0G A;  1I6H B;  3DWP A;  2C5C A;  3PUY A;  1H9R A;  1H9S A;  4IFD J;  2SOB A;  1OXS C;  2PPB C;  3V2T A;  4RKB A;  2B2T A;  3A8K E;  1RHP A;  5IGE A;  4DGZ A;  4Y7N B;  4C3H B;  1CA6 A;  3C2P A;  2K33 A;  5C3E B;  3K5M A;  1YNJ C;  5C0X I;  1EYD A;  1Q3L A;  1AEX A;  3K0Y A;  1FR3 A;  4PNY A;  1TWC B;  1CHQ D;  5C4J B;  3DEP A;  1NR4 A;  1STH A;  2PCF B;  4GZY C;  2VNU D;  1G2S A;  1SYF A;  1RCV D;  2QF7 A;  5M5X B;  3A55 A;  3PIP 3;  4HN7 A;  4TSS A;  2PZT A;  3TN2 A;  3JAM L;  1JWU D;  2FHT A;  3C3L A;  4NP5 A;  4RHR A;  1ZEQ X;  4KKT A;  1FNV A;  4IN3 A;  4K5X A;  1U9R A;  1HTP A;  2EYH A;  3SVM A;  5EBD A;  3PMF A;  1LTA D;  4HMJ A;  3SXH A;  1TS4 A;  2OT2 A;  3EVQ A;  1I4X A;  2NWG A;  2M2L A;  3OOC A;  4ODG A;  2RDH A;  3I4N B;  3SK8 A;  4JK1 C;  4G7H C;  2RA4 A;  1D5X C;  3SK6 A;  2B8G A;  3TP7 A;  2KCC A;  1SYC A;  2R92 B;  3J7A F;  5CV9 A;  1JR0 D;  2EVB A;  4K2K A;  4ZAI A;  3RZO B;  1B2T A;  1MD2 D;  4IZ8 A;  3PO2 B;  1W6J A;  2AUJ D;  5C5M A;  1CQV A;  1IKL A;  3HRZ C;  4PMW A;  3HS0 C;  2HCI A;  1HTL D;  2NN6 G;  5ELC A;  3R93 A;  4PMB A;  4KK7 A;  1TWA B;  2RBM A;  3S1M B;  1B44 D;  4IUQ A;  2WV6 D;  5JPN C;  1SJH D;  1U4R A;  3C1F A;  2TSS A;  3BDL A;  1TR5 A;  4R8N A;  1JB3 A;  5JJZ A;  5KND A;  2XWJ B;  1UAP A;  2HCC A;  5IGC A;  5ELE A;  4NMZ A;  3WOE A;  3D8G A;  2LMC B;  2NN6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...