2Y0SG

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
110
structure length
110
Chain Sequence
QEIILSCEINSIERGSLKNLSIIHMSCNDFNISFDIIDSINIFSQKEKVKAFISKNRLSYTNDDFCGHGYIVTELKDSSSNNGNRYITIISLFGLLVKIISNKESFLKIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
total genus 14
structure length 110
sequence length 110
chains with identical sequence V
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF16992 RNA_pol_RpbG DNA-directed RNA polymerase, subunit G
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2y0sG00
1A62A 3CP0A 3CCUA 1ASZA 1PH4A 3K7UC 2MFIA 3CCSA 4NXML 1N33Q 4GKJQ 1V1QA 2E2HH 1Q81C 3NENA 1IBMQ 4A3BH 2K52A 1Y1WG 4A93G 4A3MH 1C7YA 3VDYA 4A3CG 2R7DA 3EN2A 1Q7YC 2K14A 2BA0A 2F52A 4YCWA 1SE8A 5C3EG 3CCRA 5C4JH 3W1BA 3G4SA 2VQFQ 4O2DA 5FLMH 1P8LA 3HOVH 3HKZG 1QZHA 1PH7A 4JI6L 4BBRG 2N8NA 1X3GA 4GLXA 1K8GA 1Q82C 1G291 3CAMA 2K4KA 1QUQB 3T1HL 3PUYA 4NXMQ 3S16H 1LUZA 5BR8L 3A74A 3GTLH 2IHFA 3HOXG 3GO5A 1Y1WH 4A93H 3HOZG 2ALYB 4OONA 4HIOA 4AH6A 4A3CH 3TRZA 2I5HA 5LMUL 4HJ5A 4GNXA 5C3EH 2MO1A 1OXTA 1L2FA 3M4PA 5LMNQ 1YNXA 4BBSG 2UXCQ 4MZ9A 2IT1A 4A4IA 4B3TQ 3PO3G 4DUZQ 4POFA 2GVAA 3CXCA 2ZTCA 4GLVB 3RR5A 2A8VA 4GN4B 4HJ7A 3HFZB 4BBRH 4JI6Q 4OO1G 4QQBX 4KI0A 1EIFA 1TWFH 4R4TA 1YHQA 1YEZA 3T1HQ 5GAHC 4AYBE 1KL9A 5LMNW 1QVGA 1MKHA 5BR8Q 2IX0A 1PYSB 1K8AC 3CMEA 1BVSA 3TREA 1ASYA 2AKWB 2UUAQ 4YCVA 3HOZH 3CW2C 1IBKL 5C0XJ 5LMUQ 1CUKA 4AQYL 3WWVA 2R6GA 4GN5A 3M4QA 3A5ZB 3JAMc 4BBSH 1L1OC 1VQ6A 1C9OA 4IFDI 4X62Q 3AFPA 3STBD 3GTMH 3Q8DA 1IXRA 4DUYL 1PH1A 3PO3H 4LF4Q 3UDXA 4X65Q 3CPWA 4JG2A 4OXPA 2VS1A 1OTCA 2EXDA 2NN6I 2HHHQ 2ASBA 4YWLA 2JK8A 2WP8J 1MIUA 4H02A 4GOPC 3KF6A 1H95A 3KF8B 4POGA 1UE7A 2DUDA 4LFAL 4PZ6A 3J7ZC 1Q12A 1A8VA 3AEVA 1VQFA 1IBKQ 1YVCA 4XTCS 3AFQA 1SFOH 1WCMH 2Q2HA 4KLKA 4DV2L 4JI0L 2KBNA 3GTPH 5DLQE 4LF7Q 4PG3A 4TVAB 4DUYQ 1SR3A 2WAQG 2CFMA 2HT1A 4DV1Q 4K0KL 5IY0A 2B63G 1KC8C 1I50H 2YYZA 4IJLA 3S1NH 4A3LG 4LFAQ 4QL5A 1Z9FA 1TWCH 2CQOA 4MNOA 2F4VL 3CQZH 3PCOB 1E3PA 3U4ZA 5E7NA 3SGIA 4C3IH 1VQEA 3K7AH 1S3OA 2VZAA 4AIMA 4DV2Q 2DGYA 4JI8Q 4JI0Q 3KYHC 4DV0Q 4IPDA 3PIOA 4B3SQ 1I5FA 1OXSC 1PA6A 3F1ZA 3S2HH 4IPHA 1YJWA 4R4OA 1G6PA 4JCVE 3I55A 3F2CA 1K83H 5JEAG 3T1YL 5GAEC 2JA9A 3PIPA 1XNQQ 2B63H 2JA5G 4K0KQ 1UWVA 1CKNB 1VQBA 4DK3C 2H5XA 2WB1E 2HIVA 5IP9G 4A3LH 3M85A 1S40A 1QZGA 2BH2A 2AWOA 2F4VQ 2A1AA 3PV0A 4JI7L 3H15A 1XPUA 3RZDH 3RLFA 4GKKL 1IL2A 1KRSA 4QGUA 1SN8A 4HIMA 1KXLA 1HJPA 5IP7G 2BA1A 3G6EA 2IY5B 5EAYA 2JA8G 3CC7A 3PUXA 1Q86C 4JI3Q 4A3IG 1WJJA 1NMFA 4LW1A 3U4VA 3KJOA 2ZM6Q 1VQHA 3GTQH 1WYDA 3GTOH 3BZKA 1PHJA 5IYDH 4UP7A 2KENA 2JA5H 1T9HA 2ZJQA 4JI1L 2LSSA 1SLJA 2Y0SE 2YTVA 3BZCA 4PMWA 5IP9H 2VQEQ 2N49A 1N34Q 2L15A 3S2DH 4OWWB 3UE0A 3RZOH 3HOWG 3S17H 3L2PA 4JI7Q 1KIXA 5AJ3Q 3E0EA 1YI2A 1VQMA 2CWAA 3TS0A 2YV5A 3UE1A 4IFDG 3J81i 1VQOA 1N36L 3UDFA 4JI4L 3UDIA 2NVTH 5FJ8G 2I5MX 2JA8H 4A3KG 5IYCH 1EFWA 4A3IH 4OX9Q 2OWOA 1A0IA 2NN6G 5C0XI 4L5QA 5HGQA 3M7NA 4DR4L 3D0FA 4DAYB 1Q1BA 2V1CC 1HR0L 2R93G 3CF5A 3FHWA 5ELNA 2UXBL 2NVYH 4JI1Q 1FJGL 1D7QA 4DV4L 4JBMA 2KCMA 3K81C 4TQUS 5C44G 3HOWH 4X66L 1PFSA 4RMFA 1HZBA 3A5UA 4R4IA 1I6HH 1YHBA 3KDFA 4P72A 2QA4A 4YWMA 3EBEA 1N36Q 2E2JH 4JI4Q 2NVQH 3M3YH 1IBLL 5IYBG 2UUBL 1EQQA 5FJ8H 1OXXK 3CCMA 4DV7L 3S1MH 4A3KH 4DR6L 4B3RL 3S24A 4B3ML 4DR1L 1K9MC 2UU9L 1L1OA 1HNXL 2D0OA 2B29A 2ZJRA 3NBHB 1OXVA 3BU2A 1UE5A 1HR0Q 1EIYB 2R93H 4J15A 1SRUA 2AMCB 2UXBQ 3J80i 1M90C 3KFUA 4DV4Q 1WI5A 3OW2A 3PSIA 5HY6A 3KDFB 5C44H 2RHSB 3HOXH 5M3FG 2WFWA 4GNXB 4MTNA 4GOPA 2I0QA 2JA7G 4UY8C 1RL2A 4P74A 1WFQA 3RN2A 2CCZA 2K75A 2N3SA 5IYBH 1IBLQ 2ID0A 4DV7Q 2YU9H 3KOJA 1KRTA 4A75A 1PYBA 2JA6G 2R7FA 1J6QA 1NMGA 3MEFA 4DR1Q 2UU9Q 3ERSX 1XTDA 3K8AA 1QVCA 3I4MG 4DR2L 4DV6L 1BBWA 5GAGC 4UP9A 4L5SA 3MXNB 3RN5A 1VS0A 2PI2A 3AQQA 3ULLA 4AYBG 4KHPL 1RIPA 5K36G 3CCVA 2MO0A 5M3FH 4DR7Q 4LF6L 4LFCL 1E24A 2JA7H 1U5KA 1N8RC 1LTLA 4AQYQ 2R7ZG 1EOVA 3E9HA 4NPSA 2AWNA 2LXKA 3F2BA 4HIDA 2PQAA 2E5LL 2JA6H 4A3GG 3PF5A 1GD7A 1TWAH 5GROA 3JAMi 3GTKH 3I4MH 1JE5A 3KF6B 4JOIC 4R4QA 2MQHA 3B6YA 1GO3E 3K0XA 2IX1A 4HJ8A 1I94L 1O7IA 1YZ6A 2VL6A 5GADC 1HNZL 4KHPQ 3RNUA 4WJ4A 4LF6Q 3HOYG 3S1QH 4DR7L 1J5EL 4JI2L 1EYGA 2UXDL 3J7A5 1PH3A 2R7ZH 1GKHA 4O0AA 1G51A 1FVIA 4OWXB 4BY1G 4BA2I 2E5LQ 4A3GH 4UPAA 2CKZB 4DV3L 3S1RH 1SROA 2PMZE 5C0XG 3W1GA 1C0AA 4DV5L 1V43A 3PGZA 1VQ4A 2VUMG 1K3RA 3RLOA 1I94Q 1HNZQ 3U58A 5GQOA 3H0GG 4IPCA 3I2ZA 3HOYH 4A3EG 1VCIA 3I7FA 2XTIA 3OTOL 2UXDQ 4JI5L 1NE3A 3EIVA 2K50A 1XPOA 4IO9A 1BBUA 4C3HH 1YIJA 1W2BA 1N32L 1PVOA 4BY1H 2RHQB 4FDBA 2KHJA 4DV3Q 4BXXG 1VQCA 3E9IA 5M3MG 3CCEA 4LNQA 2AHOB 4BA1I 1HZCA 2PI2E 3NEMA 1QVFA 3DM3A 2VUMH 2Z0SA 3T1YQ 5C4XG 1N33L 1GVPA 1HZAA 1XNRL 4X64L 1UE6A 2NZOA 2WB1G 4YY3L 5ELOA 1KD1C 4A3EH 4GLAC 1VQDA 4DR3L 1VQGA 3S14H 2EIFA 4P73A 3U50C 3OTOQ 2VNUD 1XMOL 4GKKQ 1N32Q 2JEBI 4LF9L 4WJ3M 4QY7A 2JE6I 4RG1A 1R9TH 1XMQL 2B3GA 1VQ9A 3ER0A 5IP7H 5M5WH 4BXXH 5M3MH 3CC2A 1IYJB 3HKZE 4IPGA 3CD6A 3PUWA 2OTJA 2E8GA 5C4XH 3H3VI 1VQKA 4JBKA 1LYLA 2YTYA 4P71A 4X64Q 1XNRQ 1B70B 3I4NG 2Y0SG 2HQLA 1XJVA 5M5XH 1AE2A 1QUQA 2Z6KC 3A0JA 4YY3Q 4Y7NH 1VQLA 1Y14B 4DR3Q 3FP9A 1AH9A 1XMOQ 4DKAC 1MJCA 1JJ2A 4LF9Q 5LMNL 4YHHL 3UDGA 1XMQQ 2UXCL 2RF4A 4B3TL 1E7ZA 2D0PA 4DUZL 2ES2A 2LXJA 4APVA 3J80c 4JBJA 3M4OH 4GN3B 1AE3A 1VQ7A 2HIXA 2ATWA 5JJLA 1N9WA 4KHZA 2F3IA 1YITA 4DR4Q 4JV5L 2OQKA 4LUOA 5IT9c 1XPRA 1PH8A 1W3SA 3I4NH 4GS3A 4EQ5A 1FJGQ 1NTGA 2PNHA 1IZ6A 4QIWE 1JB7A 3CCJA 4X66Q 2UUAL 3D31A 1GM5A 4DK6C 4LUVA 4A76A 4LF5L 2FXQA 4BY7G 4OWTB 1VQIA 2IHEA 3PUZA 4NXNL 4UP8A 1TWGH 3L0OA 4IJHA 4C2MH 2Q2UA 4YHHQ 1EWIA 1L1OB 1HR0W 4X62L 2UUBQ 2A19A 5IWAL 4DR6Q 4B3RQ 4LF4L 4X65L 3TEHB 2OQ0A 1JT8A 4B3MQ 1P16A 1NJIC 1HNXQ 1K0RA 1JJGA 2E2IH 1Q46A 2HHHL 4JV5Q 4EX5A 4YCUA 3ZJYC 2VW9A 2KHIA 4GOPB 1EUJA 4JOIA 1VQJA 3PUVA 2KCTA 2CWPA 3HKSA 3ICEA 4JYAL 1E1TA 4ME3A 4GNXC 2JEAI 1PH9A 4LFBL 4DNIA 4LF5Q 4BY7H 1VQAA 4IOCA 4A3FH 2UUCL 4NXNQ 3CC4A 1WCMG 1X56A 2RCNA 1KQSA 1KHIA 1X3EA 4LF7L 2Q2TA 3HOUG 5IWAQ 1E22A 1K73C 1D8LA 2I5LX 5JEAJ 2OTLA 1JJCB 1X65A 2WAQE 3I56A 3DLLA 3CCQA 4DR2Q 4DV6Q 4DV1L 1UE1A 3TQYA 1I3QH 3KLWA 4JYAQ 1L0WA 1BKBA 3ULPA 1UEBA 4JC0A 1E1OA 4LFCQ 4A3DG 4LFBQ 2N78A 2ZTEA 1CSQA 2PQAB 1PH5A 2UUCQ 3PF4A 1U0LA 3J81j 1M1KC 1CSPA 4JI8L 2JQOA 2ZJPA 3HOUH 1S72A 5JJKA 4DV0L 4IOAA 1CKOA 1MJEA 4YWKA 4B3SL 2K5HA 1YBYA 1VQPA 4A3JG 2C35B 1VQ8A 4LUZA 3L7ZC 1TXYA 3G71A 3M9BA 5IE8A 3CPFA 2GVBA 4PZ8A 1SMXA 2EQSA 3I4OA 4DAMA 2OCEA 1HH2P 1KAWA 3OYYA 2YTXA 5J3BA 2NVXH 3GTJH 4OO1I 2R92G 1A63A 4HJ9A 4ALPA 4A3FG 1XNQL 2VY3A 4R1JA 3K80C 4IFDJ 1FL0A 3AYHB 3G48A 1PH6A 1VQNA 1TWHH 5M5YH 1PH2A 3W5OA 4A3DH 3CCLA 3IRBA 1J5EQ 5JJIA 1CKNA 4JI2Q 1YJNA 1EQRA 4LWCA 2Q2IA 1VQ5A 4LF8L 4JBWA 1Q8KA 4P75A 3STBC 1OXUA 2BH8A 1Q1EA 3JC66 1NY4A 2XGTA 3LGJA 4A3JH 4DR5L 3PO2G 1FGUA 4JI3L 3FKIG 4HIKA 2ZM6L 4DV5Q 1HNWL 2JJQA 5FLXc 4QJFA 4DPGA 3GTGH 1Y1VG 1YJ9A 3H3VH 1Z47A 4HJAA 3TS2A 1NBWA 5IYDG 2R92H 1X54A 3BJUA 4GKJL 4PZ7A 1PV4A 1N34L 2K5NA 2VQEL 2NZHA 5H1SE 3H0GH 2D62A 2K5VA 3J81c 1IBML 2QEXA 4A3BG 3ULJA 4Y52H 1HZ9A 2ZTDA 3GDEA 3RLNA 1X9NA 1B7YB 4A3MG 1JMCA 5AJ3L 2GN5A 4JI5Q 4LF8Q 3F8TA 3GD7A 4L5RC 1X55A 3NELA 4L5TA 1X3FA 1V9PA 1YHAA 2Z6KA 4R4CA 2MNAA 1DGSA 1WOCA 1B8AA 2QGQA 1X6OA 3KJPA 3S15H 4C3JH 2VQFL 1CKMA 5IYCG 3F2DA 4DR5Q 3PO2H 3FKIH 5FLMG 4NB3A 4OX9L 4X6AH 1HNWQ 3HOVG 1LM0A 3CMAA 1Y1VH 4XIGS
chains in the Genus database with same CATH superfamily
1S4ZA 3K7UC 3PIP3 4B08A 5JVH3 5DEHA 1N33Q 3GV3A 4AYBB 3MHBA 4H44C 4L6TB 2NYZD 4HR7B 1F2YA 3CQZB 4F88A 1Y1WG 4A93G 4A3MH 2DJFC 4ZUJA 2R7ZB 4YCWA 4UHVA 1EQVA 3HGBA 3W1BA 2VQFQ 1LACA 4O2DA 1P8LA 4JI6L 1YNJD 1RHPA 4GLXA 4YIJA 2MGSA 1LUZA 3NPPA 4ZLTF 4N9TA 4OONA 4A3CH 4AH6A 3FEWX 3DUZA 5LMUL 4HJ5A 4C3HB 1DOKA 5C3EH 2MO1A 1OXTA 3KBGA 4BY1B 1YNXA 2UXCQ 4DUZQ 2GVAA 3D4WA 2RQXA 2AUKA 3UI2A 2N55A 4BBRH 4JI6Q 4OO1G 1TWFH 4R4TA 1KL9A 1MKHA 1RODA 3CMEA 1BVSA 1AZQA 2K01A 3HOZH 1BR9A 2Q8RE 5LMUQ 3JAMc 3PMFA 4X62Q 4DUYL 4A3IB 4OXPA 1PFMA 3OWEB 3V2TA 1HFGA 1ESRA 1GHJA 4H02A 4KHVA 3DWQA 5E3FA 4Y7NB 3J7ZC 5I9PA 1VQFA 2B2WA 4OHJA 4IN3A 1K28A 3GTPH 4Q0FA 4PG3A 1MHWC 4TVAB 4DUYQ 2XVSA 4IQZA 3U9OA 4HAEA 2HT1A 1VDZA 4K0KL 1Y8PB 2B39A 1KDAA 1EY8A 5IY0A 4CBVA 3S1NH 3EQLC 4QL5A 2Q8IB 4K6DA 4AIMA 4RFBA 2DGYA 4JI8Q 3E0JA 1KLUD 1I4PA 1PA6A 4QUCA 1V1PA 4HTHA 4FF2A 3EA6A 4IPHA 1G6PA 4JCVE 5FK9C 3F2CA 1K83H 4K0KQ 3PIPA 1XNQQ 2B63H 1QJOA 3CKIB 1VQBA 2H5XA 3BVGA 3RUZA 4A3LH 3M85A 2BH2A 3I91A 1IL2A 2EY6A 5C3XA 4HIMA 1HJPA 2WKDA 2BA1A 3G6EA 1K0SA 3EJIA 1Q90A 1SNMA 1F2MA 3I72A 3GTQH 2ZXPA 2EY5A 5IGFA 3NWTA 5JAVA 2ZT9C 5JEAH 4GZYC 2JA5H 2ZJQA 3BYYB 1SLJA 3BZCA 1N34Q 1PTOD 1H9RA 3UE0A 2IX3A 2J7ZA 3NUCA 2L55A 3FRPB 5LL6S 1VQMA 2QEJC 2YV5A 3UE1A 5F2DA 4LMQD 1VQOA 4JI4L 4IUNA 4RWSC 4QF4A 3RMHA 5KYLA 5IYCH 3MAQA 3SVMA 2CHBD 2OWOA 1Y8OB 4L5QA 2NVXB 4KMUC 3CF5A 2R93G 3FHWA 3NK9A 2NVYH 1FJGL 4ZKCB 5IIFA 5C44G 3HOYB 5M5YB 3MFGA 4X66L 4RMFA 4HMIA 4ZYSA 1F2LA 4P72A 3M3YH 4JI4Q 1IBLL 4DR6L 1OXXK 1CK1A 1M4VA 2HDLA 4DR1L 4RCNA 1L1OA 5IT9E 3P1HA 3NBHB 1OXVA 2QCPX 4FF3A 1SRUA 2RSNA 4GNXB 3KDFB 2RHSB 1TS4A 2Z9HA 4TRDA 2O4XA 2CCZA 2K75A 1FYCA 1IBLQ 2ID0A 2YU9H 1F2ZA 4A75A 1PYBA 3MEFA 4DR1Q 4K5XA 3MC0B 1ICFB 3URYA 5BN5A 1U4PA 4HEDA 2E2HB 2PI2A 4KHPL 2C9OA 4A3BB 5M3FH 2QW7A 4MHEA 1H9SB 2DNCA 1HTPA 4IALA 2F0HA 4NPSA 2AWNA 2NTTA 2FJ2A 2E5LL 2JA6H 1JOKA 1TWAH 2EDGA 3HOVB 4PQXA 3I4MH 2EE1A 4R4QA 4K5WA 1GO3E 3N52A 1MSHA 2K33A 2IX1A 3AMUA 1O7IA 4KHPQ 4OIKA 2F4IA 3TBIB 3GTLB 5K36H 2VB3X 1Y1WB 4A93B 1J5EL 2B2TA 4JI2L 1U4MA 1PH3A 3VA5A 3K5LA 2R7ZH 1EWHA 2OT2A 1G51A 3HS0C 5JPNC 2E5LQ 1LO5D 4F7XA 2ENBA 3I70A 2PMZE 4KJNA 3OMCA 4JPBW 4NMZA 3W1GA 1HA6A 1SAPA 2IW3A 3PGZA 2VUMG 2EYHA 1NR2A 5CV6A 3T13A 3H0GG 3ND8A 4IPCA 1SE3A 4A3EG 1VCIA 3I7FA 4JI5L 4IO9A 1FNUA 2MP1A 2X6LA 4C3HH 1YIJA 1W2BA 2TMPA 4BY1H 3C3LA 2KHJA 4XQNA 1CA5A 1GJXA 1D5XC 4BA1I 1HZCA 3NEMA 4KY7A 2TSSA 3K0YA 4R8IA 3NWSA 2Z0SA 3J81E 5C4XG 4TKOB 2CVRA 4X64L 1B3AA 5LL6X 1TS5A 4N9PA 4GLAC 1VQGA 2EIFA 3G7LA 4P73A 5IT9L 1XMOL 1WCMB 4IUQA 4E6IA 3D8GA 3IKJA 4QUFA 1R4QB 1O7LA 1VMPA 4HCSA 2KUMA 2A6EC 5I9OA 2F0SA 3A8KE 1IW7C 3H3VI 2O5IC 1SDFA 4JBKA 4X64Q 1B70B 4QMGA 1DCZA 1HQRD 2O2LD 4Y7NH 1TWCB 3R8BA 1Y14B 3FP9A 1AH9A 5L37A 1XMOQ 1B4OA 4J8QA 4YHHL 2LS01 1E7ZA 2D0PA 3S2HB 1JQYD 4GN3B 2HIXA 1SNOA 4ZUIA 1WD0A 4G7HC 1XPRA 2L11A 3NTKA 1PTOB 3I4NH 1GUGA 3D31A 4DK6C 4A76A 3NQTA 4M8AA 2IHEA 3PUZA 2A69C 4YHHQ 4CJ1B 1HR0W 2A19A 4KTAA 4LF4L 3TEHB 3I73A 1I4XA 3O13A 1NJIC 1K0RA 1JJGA 5CV7A 1A6XA 1EYDA 1RTNA 2E75C 2K5QA 2NWGA 5EKLA 2F0FA 2HCIA 3VR2A 1K3BC 2PO4A 2CWPA 3HKSA 3S2DB 3JAME 1VQAA 2BCOA 3W2DA 1CZWA 2NVTB 1D8LA 2I5LX 1ET9A 5DNFA 3DLLA 3CCQA 4DV6Q 2CH4A 2EXZA 1SSOA 3T16A 1UE1A 2Z1CA 1BCPC 4MIUA 1E1OA 5C4HA 1GUOA 4DN4M 1SMYC 4KY6A 1PH5A 3PF4A 1M1KC 1QCBD 2JQOA 2E2JB 3J81L 1MJEA 4A3JG 3HKZB 3C1FA 3M9BA 3N6RA 4DK0A 1SMXA 2F0JA 1KAWA 2NVXH 1PFBA 1A63A 4OO1I 4HJ9A 1EEFD 4R1JA 5IGGA 1IW7D 3I8ZA 1O7ZA 3HOXB 5C44B 1PH2A 5M5YH 3WDNA 5JJIA 3CCLA 1S5DD 1EQRA 4LWCA 2Q2IA 5C6AA 2Z4IA 4LF8L 4JBWA 1SBBB 1PRTC 3OIQA 1Q1EA 1BOSA 2XGTA 4C3JG 2LKVA 3PO2G 4XYOA 4JI3L 5I2YA 1HXYD 4DPGA 3MEHA 1Y1VG 1YJ9A 2RBMA 3H3VH 4CDEC 3SDZA 3AU7A 2F0IA 2K5NA 3J80L 4Y52H 2KVMA 1EY4A 4QIWB 4F8MA 5AJ3L 4LF8Q 3L3OC 1YHAA 4R4CA 4X3TA 1B8AA 4P2CB 1WTOA 2A69D 2GA4B 1MD2D 3QWNA 3VYSA 4OX9L 3GTKB 1I4QA 1J8IA 5J39A 1A62A 2RCFA 3CCUA 1UAPA 5E4XA 4NXML 2E2HH 1AZPA 5CORA 1HFNA 1Q3LA 1SE2A 4A3BH 2BOSA 2L0CA 3VDYA 1Q7YC 2KHSA 2BA0A 1G8ZD 1STYA 3D6WA 5IGEA 1O78A 4NP5A 3P7JA 4CKBA 1D5ZC 1CM9A 2WAQB 3HOVH 3JAML 2N8NA 1X3GA 2K4KA 3NP8A 3PUYA 4NXMQ 5BR8L 1E2WA 3A74A 5C5LA 3GTLH 3GO5A 1BCPD 1Y1WH 4A93H 2ALYB 4PMCA 4Q5VA 4LJZC 4GNXA 3A7LA 5LMNQ 1SMYD 4B3TQ 3PO3G 1H9JA 4POFA 4N8X1 4GN4B 4HJ7A 2VUMB 1EIFA 3SHLA 4IUVA 4CGYB 4C1NI 5BR8Q 1LT4D 4XT3B 4PV1C 4YCVA 4A3EB 3S14B 1IBKL 3TZDA 3VR4A 3VR5A 2R6GA 3A5ZB 1AEXA 3R2IA 1PRTD 3Q8DA 2F0QA 5G3LF 1HRJA 4X65Q 1YNJC 2VS1A 4OO1H 3HRZC 2EXDA 2HHHQ 4FF4A 2WV6D 5C4XB 2WP8J 1MIUA 4JVZA 1H95A 3KK7A 3KF8B 1TQOA 2DUDA 2XN9C 3C46A 3AEVA 1IBKQ 1YVCA 4X3SA 4C3IG 1WCMH 1A2UA 3AB9A 4NW2A 1QOHA 4LF7Q 4RHRA 2PNRC 3TP5A 4DF7A 1DXMA 4DV1Q 1KC8C 2G9HD 4IJLA 4MNOA 1TWCH 2CQOA 3SK5A 1E3PA 3U4ZA 4C2MB 1TWGB 3S9WA 4DV0Q 4B3SQ 1OXSC 3F1ZA 4HSVA 3S2HH 2EYPA 4C1NK 2E2IB 3I55A 1A2TA 2K1BA 3T1YL 5GAEC 2JA9A 1PTOH 4IZ8A 4DK3C 5IP9G 1QZGA 5M3FB 3TMEA 2F3VA 1RJTA 3H15A 1XPUA 4GKKL 4RH6A 1KRSA 1UNSA 1KXLA 3J7AF 4U673 5IP7G 5I6YA 1FR3A 3CC7A 1XYIA 4CJ0B 3U4VA 2ZM6Q 4LW1A 3KJOA 1WYDA 3BZKA 5IYDH 4PNYA 5ELEA 5I4DA 4JI1L 2LSSA 1I3QB 2VQEQ 4KD4A 1HQMC 3S2DH 2L15A 4RGOS 4DAVA 1JWUD 4R8NA 3TS0A 1HCZA 3DHQA 3UDIA 4FXGC 2NVTH 5FJ8G 2I5MX 5DM73 4A3KG 5E1FA 2NN6G 5CV5A 4KY5A 4DR4L 4DAYB 4FXKC 4MTKA 2V1CC 3BS1A 5ELNA 1ICWA 4JI1Q 2BDNA 1D7QA 2NBFA 4DV4L 4TQUS 1HZBA 3A5UA 4R4IA 2E2JH 2IY5B 1CFMA 5IYBG 2UUBL 1F9PA 2LY7A 3CCMA 1EQQA 4B3RL 5DAUA 4A3JB 1FGBD 4G57A 4DFAA 1JC7A 1B3QA 1TKWB 1WTQA 3J7AV 3BU2A 2R93H 1PTOC 1EIYB 4J15A 2AMCB 3MA2B 3U9SA 4DV4Q 1WI5A 3PSIA 3P75A 2JSOA 5C44H 3HOXH 2I0QA 1FNVA 2DJGC 2QDLA 1JCKB 2ICIA 2PW5A 3S15B 1QWYA 4C3JB 4X3KA 3PO2B 2WIIB 2PMZB 3ERSX 3BG3A 2B2VC 3TP6A 1QVCA 1YNND 1Y1VB 4DR2L 5GAGC 4UP9A 4L5SA 1VS0A 2NZ1D 3Q23A 3OMGA 3AQQA 1H9KA 1AW7A 1BCPB 2MO0A 4LF6L 3BDOA 1E24A 3KLSA 1N8RC 1LTLA 1TT2A 2EYLA 1VMCA 1IKLA 1EOVA 2LXKA 1EY6A 3TZUA 3K57A 2AQ2B 1LT3D 3GTKH 1I4RA 3QG1A 3KF6B 4RA8A 2B8GA 2F0KA 2MQHA 4G7ZC 4HJ8A 1HNZL 3I4NB 1EYCA 4DU9A 2Y0SB 4LF6Q 5JPMC 4B9XA 1LTBD 1NNXA 4F87A 1PRTB 3PQIA 4OWXB 4BA2I 2PZTA 4UPAA 2CKZB 4DV3L 2F03A 1SROA 3TP7A 1C0AA 2Z8LA 1V43A 1K3RA 1LV9A 3WOFA 5KNCA 5A2QE 1II3A 1HNZQ 4O1NA 4K8IA 1JR0D 3I2ZA 2IJ0A 5EQ0A 3OTOL 3EIVA 2K50A 1XPOA 1BBUA 1CI3M 1S5BD 2RHQB 3PO3B 3Q22A 2F1MA 4DV3Q 4BXXG 1I6VC 3OW7A 3TP8A 4FYDA 2AHOB 2PI2E 1NUCA 2VUMH 1LTSD 4OL7A 1GVPA 4ME5A 1ML0D 4YY3L 3C2PA 1Y8NB 4A3EH 3S14H 1VQDA 4DR3L 3OTOQ 3SXHA 1SFOB 4DK1A 4LF9L 4WJ3M 4QY7A 2JE6I 1XMQL 4CDCC 1K8MA 5ISRA 3CC2A 1IYJB 2KECA 4IPGA 1HHVA 1EY9A 4WRDA 3CD6A 3PUWA 1DD2A 1E0BA 3T56B 2E8GA 5C4XH 2L12A 3NBIA 1XJVA 4YY3Q 4DR3Q 4C3IB 1MJCA 1JJ2A 4LF9Q 1XMQQ 3UDGA 1MI2A 4JBJA 2ATWA 2EY2A 4JV5L 1DJRD 4LUOA 4RCOA 1WTRA 1W3SA 2AUJD 3H91A 1FJGQ 4DXGA 3NHHA 3CCJA 3CU7A 4X66Q 2UUAL 1GM5A 4LF5L 4BY7G 4OWTB 1VQIA 2Q2UA 4UP8A 1TWGH 3L0OA 4IJHA 4PMBA 4C2MH 4DR6Q 5IWAL 3A7AB 4TSSA 2OQ0A 1TY2A 2FMCA 1Z6HA 1P16A 1LTAD 4CHTB 2E2IH 1Q46A 4JV5Q 4EX5A 3ZYYX 1GUNA 4IURA 2N88A 1EUJA 3PUVA 2KCTA 1E1TA 4H0LC 1I4GA 4LFBL 4DNIA 4LF5Q 3KF8A 1EIHA 4IOCA 1SNDA 2Q2TA 5A2QL 5IWAQ 1CT1D 1G91A 1JJCB 3FDTA 4CKEA 2RVLA 3QOJA 5HURA 2PPBC 3V05A 3TQYA 1I3QH 1EQTA 3KLWA 3ULPA 5ELCA 1EYAA 1LT5D 1FNWA 4LFBQ 2B2YC 2N78A 2PQAB 1QE6A 4WJWA 1U0LA 3BVZA 2ZJPA 5JJKA 1QB5D 1S72A 2F0UA 1CKOA 4IOAA 2K5HA 3R3OA 1VQ8A 2C35B 4J6HA 3L7ZC 5IE8A 2F0EA 4XQQA 1JB3A 1VF7A 3OYYA 5ELDA 2YTXA 3D4RA 3DEPA 5J3BA 2EYOA 3GV6A 2VY3A 4BS9A 4IFDJ 1JOQA 1S5ED 4XQJA 1J5EQ 4JI2Q 5KNDA 1VQ5A 1Q8KA 2EJGC 4P75A 5HGTA 3K59A 2BH8A 4G4KA 3LGJA 4A3JH 2ZXOA 3FKIG 3BDCA 2CH4W 2JJQA 5FLXc 1Z47A 3TS2A 1NBWA 4JK1C 5H1SE 2KEDA 1TR5A 4KKSA 2QEXA 3ULJA 1NSNS 1HZ9A 3RLNA 4JI5Q 3GD7A 4V190 3IFDA 1DGSA 4V0BA 2QGQA 1X6OA 3KJPA 3S15H 4C3JH 4QB4A 3PO2H 5IYCG 3F2DA 5FLMG 3MWYW 3CMAA 1Y1VH 4XIGS 3E6ZX 2MFIA 1DONA 1V1QA 3HEJA 5EKKA 2A73B 3NENA 4I65A 4DAYA 4M1UB 1LT6D 2K52A 2A5HA 3S1QB 1C7YA 3NXWA 2K14A 2VB2X 4KKUA 1WTPA 2F52A 1SE8A 2PQEA 1PZKD 1S5FD 1XTCD 3DM1A 3CCRA 1EIGA 4ID6A 3M4YA 2K6AA 2D5DA 3E3XA 2PCFB 1K8GA 4ILWA 1Q82C 2ZXRA 3CAMA 3T1HL 1PMRA 1TS3A 1C48A 2M2LA 2IHFA 3I3CA 4HIOA 3TRZA 4OEMB 3M4PA 1L2FA 4BBSG 1L0YB 1C8CA 3RD4A 3CXCA 2ZTCA 4GLVB 1B44D 1ET6A 1W6JA 3E5SA 4QQBX 5FKAC 5CV4A 3T1HQ 5GAHC 5LMNW 1QVGA 1PYSB 3SEBA 3TREA 3VYUA 1ASYA 1SYBA 2AKWB 3CW2C 3SK4A 1KAAA 5C0XJ 2E74C 2SNSA 4AQYL 3WWVA 1C9OA 5LHY1 3PO3H 3AFPA 1IXRA 3NTHA 2XWJB 4LF4Q 4EVOA 4JG2A 4K2KA 4S3SA 1OTCA 3K5NA 2NN6I 1DYQA 4YWLA 1ENFA 1F77A 2DY8A 4KJOA 4L8JA 4GOPC 2JN4A 2DY7A 1TIID 3KF6A 4K6LA 4OIJA 3FVQA 3DMUA 1UE7A 5M5XB 4LFAL 2SDFA 2KQ3A 4ZKBB 4DA2A 4ODGA 4XTCS 3AFQA 1SFOH 2Q2HA 4DV2L 2KBNA 5DLQE 1PXUA 2WKCA 1SR3A 4RGTA 2CFMA 1CHQD 2C5CA 2R93B 2QKIC 2YYZA 4LFAQ 5CR3A 2AQ3B 4I7AA 2RA4A 2CW0D 2KA7A 5E7NA 3SGIA 4C3IH 4DV2Q 3X3MA 3KYHC 4DNTB 4IPDA 5AFWA 3PIOA 1Q8IA 3EVQA 5IGDA 1HUMA 1CKNB 5J22A 2WB1E 2HIVA 3VR3A 2XSCA 3TSSA 4BY7B 2F0DA 1O80A 2K5WA 1B2TA 3P20A 4EQNA 3D3RA 1RDPD 2JA8G 4RHSA 3PUXA 1Q86C 4IUTA 4JI3Q 4A3IG 2M00A 1WJJA 1NMFA 1JOOA 3X3NA 2I07B 3GTOH 1DZ1A 2FMMA 4UP7A 5IP9H 2QF7A 3WOEA 3SK8A 4OWWB 1U9RA 2PYKA 3HOWG 1UUPA 5AJ3Q 3E0EA 1YI2A 2CWAA 4IFDG 3J81i 2LFNA 3UDFA 2RKSA 2H1EA 2QDBA 4OX9Q 5FO9B 1A0IA 2B2UC 1F9SA 1KDBA 1IKMA 1Q1BA 1SYCA 3GTJB 1HR0L 2A74C 3V96A 2UXBL 3HP3A 2KCNA 3NBHA 4JBMA 1TWHB 1PFSA 1D1IA 3KDFA 3EBEA 5FJ8H 4A3KH 2OF1A 3OIPA 4B3ML 4NDXA 1K9MC 2UU9L 1A3UA 2NN6H 3BZDB 2D0OA 1HNXL 2E2DC 1SJED 2A68C 1UE5A 1HR0Q 2UXBQ 3J80i 1M90C 4FVMA 3KFUA 3H0GB 4ULLA 5IODA 2WFWA 4MTNA 3MFYA 2JA7G 1T5XD 3EROA 4DXFA 1EEID 1PZID 1RL2A 4P74A 4UY8C 1H9SA 1U4LA 2N3SA 5IYBH 1A3VA 1KRTA 3OHXC 2IWHA 2PZUA 3FKIB 2UU9Q 1M8AA 1XTDA 3A55A 4RKBA 2DNEA 3IL8A 1BBWA 2IL8A 3Q6SA 3MXNB 4KN7C 1KNEA 1EY7A 4H7BA 2D2CC 1Y69U 1CQVA 3NE5B 1PTOF 3CCVA 2Z6BA 4LFCL 3A56A 1QG7A 1NR4A 3F2BA 5C4JB 2PQAA 4A3GG 3PF5A 1AP0A 1O7YA 5GROA 3JAMi 2Q8TA 1ZYRC 4JOIC 4O42A 3B6YA 5CV9A 1JE4A 2AQ1B 2VL6A 5GADC 3S16B 1RD9D 3TDQA 4WJ4A 3HOYG 3S1QH 1DOMA 3K58A 1EYGA 1WTHA 2G9DA 5COYA 2UXDL 2EZVA 1B9NA 1GKHA 4FO2A 2XRQD 1FVIA 3KLRA 1B50A 2FHTA 3T51B 1YNNC 5C0XG 3H6MA 5EJWA 3HG9A 4DV5L 1X3PA 2D9UA 1TVXA 5IOCA 3RLOA 1PLFA 1B1ZA 1SYGA 5GQOA 3F2UA 1LLRD 4LK1C 1RCVD 3LWUA 2UXDQ 3EFXD 4KD3A 2WACA 4FXDA 4BBSB 1N32L 4N8FA 1B53A 3GTMB 5FLXE 2OXPA 3ERQA 3E9IA 5M3MG 5DM63 5A35A 5JOBA 1QVFA 1J9OA 3T1YQ 4JW0A 3A54A 1N33L 2A68D 1UE6A 2WB1G 1WTWA 3MTSA 2MJ8A 2NTSA 2LMCB 4K14A 3U50C 4GKKQ 5D14A 1N32Q 1A3TA 2B3GA 3VR6A 4BXXH 3HKZE 1ILPA 5JVG3 2L4NA 3ONAB 3G6JB 4IUUA 2OTJA 4CDDC 4DNRB 1I50B 4P71A 1QNUA 1SJHD 1BBXC 5M5XH 1AE2A 1C4QA 1CQFA 2Z6KC 3A0JA 1VQLA 4B9WA 2SEBD 2JP1A 1KDCA 3SK6A 3K7AB 3K5MA 2UXCL 2RF4A 4XXEA 2F0LA 1ILQA 2L9HA 3SE0A 4DUZL 2ES2A 1CZGA 1BQQT 2HDMA 1LM0A 3J80c 1AE3A 4K2LA 1N9WA 2L1BA 4DR4Q 1PH8A 1ZYRD 4K5VA 2B2VA 1D6EC 1IZ6A 4QIWE 4R9WA 1ESFA 3RZDB 4A3FG 3FPUB 2E76C 2KOLA 3OSOA 4X62L 2UUBQ 4B3RQ 2NB0A 5I2XA 3H94A 4ZRZA 1E2VA 1U4RA 3LWEA 2VW9A 4GOPB 1MSGA 4JYAL 1XWEA 3RZOB 3T4AC 3S17B 2SNMA 1PH9A 1V8QA 4BY7H 5ELBA 1WCMG 1X56A 2RCNA 1X3EA 3W3AA 3HOUG 1K73C 1NCVA 5JEAJ 2JA8B 3DWAA 3QR8A 1UEAB 1X65A 2WAQE 2I46A 1BUVT 1EZ8A 4DR2Q 2FFKB 5EGTA 1BF4A 2A6HC 2HUGA 2ICEC 1GOZA 1LTRD 3QOLA 2PW7A 4JYAQ 5FLXL 3HOWB 4A3DG 4RGMA 5C4ZA 1CSQA 1I6HB 1WTXA 3J81j 1STAA 3MXUA 4LAAA 4JI8L 4CKCA 2NVQB 3QB3A 4YWKA 3S1MB 1YBYA 4EQOA 1VQPA 2EYMA 1BO0A 4LUZA 3G71A 2GVBA 4PZ8A 2EQSA 4DAMA 2OCEA 1HH2P 1LTTD 3VYTA 3GTJH 2R92G 1XNQL 2L5TA 2B2WC 3ITPA 3K80C 1FL0A 3G48A 4RAUC 1OO9B 1TWHH 1CKNA 1D1KA 1JORA 3STBC 2MHVA 3JC66 1STHA 2SOBA 1NY4A 4DR5L 1FGUA 4HIKA 1JICA 2KCCA 3L9AX 5IYDG 1EY5A 3BJUA 5EBCA 5CMDA 4GKJL 3QJYA 1N34L 1IBML 2F3WA 3H0GH 3C1EA 3GDEA 3J7YW 4A3MG 5T1IA 2JA7B 5CV8A 3F8TA 4L5RC 1X55A 3NELA 5T1GA 2MNAA 5G3LD 1SNQA 1CKMA 1STNA 4DR5Q 3FKIH 4NB3A 4OGQC 2K7VA 5EPKA 1ASZA 3CP0A 2BDOA 1PH4A 1I4HA 3LNNA 3CCSA 4GKJQ 1Q81C 3Q0AA 4EQPA 1IBMQ 1STBA 4A3CG 2R7DA 3EN2A 2JXMB 5CBEE 5C3EG 1SEBD 5C4JH 3DXJC 4UDUC 4A3GB 1RTOA 3S1RB 3G4SA 5FLMH 1SYEA 3HKZG 1QZHA 1STEA 1X32A 1PH7A 2O5JC 4BBRG 1G291 1QUQB 2CQAA 3S16H 2A6HD 3HOXG 3HOZG 1EY0A 4RKLA 4ZAIA 2I5HA 4HMJA 4MZ9A 2IT1A 4A4IA 1STGA 2NUCA 2RDGA 5M9OA 1PYWD 3RR5A 1GUWA 2A8VA 3HFZB 4KI0A 3GTOB 3NSWA 1YHQA 1YEZA 4AYBE 2IX0A 1K8AC 2J4XA 3D6CA 3MXNA 1NAPA 5KRUA 1G2SA 2UUAQ 3OOCA 1CUKA 4GN5A 3M4QA 1GUTA 3MZ5A 4BBSH 1L1OC 1R9TB 1VQ6A 4IFDI 5M5WB 2B2YA 3STBD 3GTMH 1PH1A 3UDXA 5M3MB 3CPWA 1F9RA 2K05A 4DAPA 2ASBA 1CHPD 4XDXA 3LX0A 5K5PA 2JK8A 5CGKA 4KN4C 2EYFA 1F9QA 1FD7D 4K8JA 2WB1B 1BNZA 4POGA 3NQIA 4PZ6A 1Q12A 1A8VA 1TY0A 1QNKA 2F0OA 1ZXTA 3MVVA 1IYVA 4KLKA 4JI0L 2BE5C 4A3KB 3M4OB 3DEOA 2WAQG 1K8OA 5KEEA 1G6ZA 1EOTA 1KABA 1EU3A 2B63G 1I50H 2M9VA 5KGUA 1LTGD 3IFTA 4A3LG 2EPBA 5JJZA 1Z9FA 2F4VL 1WVLA 3CQZH 3PCOB 1BCPF 3HZXA 1VQEA 1PZJD 1S3OA 2VZAA 3K7AH 4JI0Q 3KLSX 3T53B 1TU2B 1I5FA 2R61A 2K28A 4FF1A 4FP5D 1YJWA 1KNAA 4R4OA 1S5CD 4ABNA 5JEAG 4ZCKA 2JA5G 2B2TC 1UWVA 4Z9CB 1QILA 2IPKD 2K5DA 1S40A 1D5MC 1V1OA 2AWOA 2F4VQ 3I90A 2A1AA 3PV0A 4JI7L 1SXTA 3RZDH 2KEEA 3RLFA 4A3FB 1SYDA 1RF2D 4QGUA 1SN8A 3VYRA 3PIO3 5EAYA 1PRTF 1VQHA 1HUNA 5EKIA 1IHZA 2V4DA 1PHJA 2KENA 1T9HA 2Y0SE 2YTVA 5D3DA 4PMWA 2N49A 2CW0C 3RZOH 3BDLA 3S17H 3L2PA 4JI7Q 1KIXA 2HCCA 2XIWA 4NKLA 1N36L 3HOUB 2JA8H 4BWGB 2RDHA 2X6GA 1EFWA 4A3IH 5C0XI 3TN2A 5FOBB 5HGQA 3M7NA 5C3WA 3D0FA 4CDFC 1XXGA 4H13C 2XRSD 3SR1A 2KCMA 3K81C 2XWBB 2EVBA 3HOWH 4A3DB 5KIXA 2F0VA 3R2TA 1I6HH 1YHBA 5CC4A 4IFDH 5KNBA 4HSPA 2QA4A 4YWMA 1N36Q 2NVQH 3J80E 4DV7L 2BE5D 1TS2A 3S1MH 3FPPA 3S24A 1CA6A 1WD1A 4HCEA 2F0PA 5E4WC 2B29A 2ZJRA 3GTGB 5BN4A 3NTIA 3QIAA 4C56C 1A15A 2R92B 4CJ2C 2K32A 2B8FA 3OW2A 1CTMA 1DM0B 2HD3A 5HY6A 5M3FG 4DR7L 4GOPA 3CRKC 3RN2A 1WFQA 1HTLD 1BXTA 4DV7Q 2K04A 3KOJA 2JA6G 2R7FA 1J6QA 1NMGA 3FMCA 3K8AA 3I4MG 4HN7A 4DV6L 5FO7B 2PZWA 3RN5A 5NUCA 3ULLA 2RDFA 4AYBG 1RIPA 3MXPA 4KKTA 5K36G 4DR7Q 1VF5C 4A3MB 2JA7H 1U5KA 1LABA 4AQYQ 2R7ZG 3E9HA 4WORA 4HIDA 4X3UA 2KJXA 1GD7A 1JWSD 3A8IE 4XYQA 1JE5A 1WTVA 3K0XA 1I94L 1YZ6A 2EJMA 2WINB 3RNUA 2P5ZX 5C5MA 2K03A 5J1ZA 4KK7A 3J7A5 2QILA 4OELB 1EWCA 4O0AA 3ND9A 4C3HG 5C3EB 2H4OA 4BY1G 1IYUA 1EFID 5FO8B 2MPMA 5EBDA 3S1RH 4A3GH 3CRLC 4BBRB 3KUPA 1VQ4A 1W6KA 1TWFB 2A6ED 1I94Q 3OPOA 3U58A 4KV6A 1ZKOA 3K5OA 4L63B 3HOYH 3HOZB 2XTIA 3KBXA 1NE3A 3DWPA 1PVOA 1V1PB 1X3QA 5CBAE 4FDBA 1E2ZA 1VQCA 2F0TA 4LNQA 3GP7A 5C0XH 3CCEA 3H09A 1GHKA 4WFN3 3OWFA 3DM3A 3D4DA 2R3ZA 3A8JE 1HZAA 1AN8A 2B2UA 4RGNA 1XNRL 2NZOA 5ELOA 2FINB 1KD1C 4G7OC 2VNUD 1BDOA 1EU4A 3GTPB 2JEBI 2OEOA 4RG1A 1R9TH 4I7ZC 1VQ9A 1L0XB 3ER0A 5IP7H 5M5WH 3MXGA 5M3MH 4FNFA 1SNCA 5KYIA 1VQKA 1R4PB 1XNRQ 1LYLA 2YTYA 3I4NG 5CYUA 2Y0SG 2HQLA 3S1NB 1QUQA 1SYFA 4DKAC 5LMNL 4B3TL 4UAIA 2F0WA 2LXJA 4APVA 3QO2A 3M4OH 1PFNA 1VQ7A 3VA7A 5JJLA 4KHZA 1G2TA 2F3IA 2Z4HA 1YITA 2OQKA 5IT9c 1K83B 2J0TD 2B63B 4GS3A 4EQ5A 1GXDC 1NTGA 5BN3A 2F0NA 2PNHA 2HQEA 1JB7A 5ELFA 3BYTB 3K6OA 4LUVA 1AFPA 2FXQA 4NXNL 1H9MA 1EZ6A 1EWIA 1L1OB 1ENAA 4X65L 1JWMD 1JT8A 4B3MQ 1HNXQ 3GTQB 3H3VC 2HHHL 4YCUA 3ZJYC 5EPJA 2JA5B 4DGZA 4QCLA 2KHIA 4JOIA 1VQJA 3ICEA 4ME3A 4GNXC 2JEAI 1MBYA 2EJFC 5EPLA 4A3FH 2UUCL 4NXNQ 3CC4A 4U68A 1ONLA 1KQSA 1KHIA 4LF7L 3IAYA 1E22A 4J1MA 2OTLA 3GQBA 1DOLA 3I56A 2EOTA 1MGSA 5TSSA 4DV1L 1EL0A 2NVYB 1L0WA 1BKBA 1IL8A 1UEBA 4JC0A 4LFCQ 2F0GA 3I4LA 2ZTEA 3BVMA 2UUCQ 1HPCA 5IGCA 1SE4A 3M3YB 1CSPA 1ENCA 3HOUH 1XX8A 4DV0L 5IGBA 2XNAC 4B3SL 1KTKA 2EY1A 1GUSA 1TXYA 1B9MA 1SNPA 3CPFA 5I6WA 3I4OA 4ALPA 1LTID 1RKNA 3AYHB 1PH6A 2MUYA 1VQNA 4A3DH 3W5OA 3IRBA 3M7GA 1YJNA 1PDQA 4XT1B 1OXUA 4MN3A 2JYOA 2YU9B 1T5EA 1HA5A 2ZM6L 4DV5Q 1HNWL 4QJFA 3R93A 1D2BA 3GTGH 1Z7TA 4HJAA 2R92H 1X54A 2EYJA 4PZ7A 1PV4A 2G5DA 2VQEL 2NZHA 3J81c 2D62A 2K5VA 4IUPA 4A3BG 2F0MA 3Q24A 2ZTDA 1X9NA 4EGVA 1B7YB 1JMCA 2GN5A 2RSOA 2X69A 5D3IB 4L5TA 1X3FA 1V9PA 2Z6KA 4ZK9B 1WOCA 1ZEQX 2JA6B 2VXWA 2VQFL 3CHBD 1TWAB 4X6AH 1HNWQ 4ZQ3A 3HOVG 3I4MB 2DN8A 1KLGD 5D65A
chains in the Genus database with same CATH topology
1A62A 3CP0A 3CCUA 1ASZA 1PH4A 3K7UC 2MFIA 3CCSA 4NXML 1N33Q 4GKJQ 1V1QA 2E2HH 1Q81C 3NENA 1IBMQ 4A3BH 2K52A 1Y1WG 4A93G 4A3MH 1C7YA 3VDYA 4A3CG 2R7DA 3EN2A 1Q7YC 2K14A 2BA0A 2F52A 4YCWA 1SE8A 5C3EG 3CCRA 5C4JH 3W1BA 3G4SA 2VQFQ 4O2DA 5FLMH 1P8LA 3HOVH 3HKZG 1QZHA 1PH7A 4JI6L 4BBRG 2N8NA 1X3GA 4GLXA 1K8GA 1Q82C 1G291 3CAMA 2K4KA 1QUQB 3T1HL 3PUYA 4NXMQ 3S16H 1LUZA 5BR8L 3A74A 3GTLH 2IHFA 3HOXG 3GO5A 1Y1WH 4A93H 3HOZG 2ALYB 4OONA 4HIOA 4AH6A 4A3CH 3TRZA 2I5HA 5LMUL 4HJ5A 4GNXA 5C3EH 2MO1A 1OXTA 1L2FA 3M4PA 5LMNQ 1YNXA 4BBSG 2UXCQ 4MZ9A 2IT1A 4A4IA 4B3TQ 3PO3G 4DUZQ 4POFA 2GVAA 3CXCA 2ZTCA 4GLVB 3RR5A 2A8VA 4GN4B 4HJ7A 3HFZB 4BBRH 4JI6Q 4OO1G 4QQBX 4KI0A 1EIFA 1TWFH 4R4TA 1YHQA 1YEZA 3T1HQ 5GAHC 4AYBE 1KL9A 5LMNW 1QVGA 1MKHA 5BR8Q 2IX0A 1PYSB 1K8AC 3CMEA 1BVSA 3TREA 1ASYA 2AKWB 2UUAQ 4YCVA 3HOZH 3CW2C 1IBKL 5C0XJ 5LMUQ 1CUKA 4AQYL 3WWVA 2R6GA 4GN5A 3M4QA 3A5ZB 3JAMc 4BBSH 1L1OC 1VQ6A 1C9OA 4IFDI 4X62Q 3AFPA 3STBD 3GTMH 3Q8DA 1IXRA 4DUYL 1PH1A 3PO3H 4LF4Q 3UDXA 4X65Q 3CPWA 4JG2A 4OXPA 2VS1A 1OTCA 2EXDA 2NN6I 2HHHQ 2ASBA 4YWLA 2JK8A 2WP8J 1MIUA 4H02A 4GOPC 3KF6A 1H95A 3KF8B 4POGA 1UE7A 2DUDA 4LFAL 4PZ6A 3J7ZC 1Q12A 1A8VA 3AEVA 1VQFA 1IBKQ 1YVCA 4XTCS 3AFQA 1SFOH 1WCMH 2Q2HA 4KLKA 4DV2L 4JI0L 2KBNA 3GTPH 5DLQE 4LF7Q 4PG3A 4TVAB 4DUYQ 1SR3A 2WAQG 2CFMA 2HT1A 4DV1Q 4K0KL 5IY0A 2B63G 1KC8C 1I50H 2YYZA 4IJLA 3S1NH 4A3LG 4LFAQ 4QL5A 1Z9FA 1TWCH 2CQOA 4MNOA 2F4VL 3CQZH 3PCOB 1E3PA 3U4ZA 5E7NA 3SGIA 4C3IH 1VQEA 3K7AH 1S3OA 2VZAA 4AIMA 4DV2Q 2DGYA 4JI8Q 4JI0Q 3KYHC 4DV0Q 4IPDA 3PIOA 4B3SQ 1I5FA 1OXSC 1PA6A 3F1ZA 3S2HH 4IPHA 1YJWA 4R4OA 1G6PA 4JCVE 3I55A 3F2CA 1K83H 5JEAG 3T1YL 5GAEC 2JA9A 3PIPA 1XNQQ 2B63H 2JA5G 4K0KQ 1UWVA 1CKNB 1VQBA 4DK3C 2H5XA 2WB1E 2HIVA 5IP9G 4A3LH 3M85A 1S40A 1QZGA 2BH2A 2AWOA 2F4VQ 2A1AA 3PV0A 4JI7L 3H15A 1XPUA 3RZDH 3RLFA 4GKKL 1IL2A 1KRSA 4QGUA 1SN8A 4HIMA 1KXLA 1HJPA 5IP7G 2BA1A 3G6EA 2IY5B 5EAYA 2JA8G 3CC7A 3PUXA 1Q86C 4JI3Q 4A3IG 1WJJA 1NMFA 4LW1A 3U4VA 3KJOA 2ZM6Q 1VQHA 3GTQH 1WYDA 3GTOH 3BZKA 1PHJA 5IYDH 4UP7A 2KENA 2JA5H 1T9HA 2ZJQA 4JI1L 2LSSA 1SLJA 2Y0SE 2YTVA 3BZCA 4PMWA 5IP9H 2VQEQ 2N49A 1N34Q 2L15A 3S2DH 4OWWB 3UE0A 3RZOH 3HOWG 3S17H 3L2PA 4JI7Q 1KIXA 5AJ3Q 3E0EA 1YI2A 1VQMA 2CWAA 3TS0A 2YV5A 3UE1A 4IFDG 3J81i 1VQOA 1N36L 3UDFA 4JI4L 3UDIA 2NVTH 5FJ8G 2I5MX 2JA8H 4A3KG 5IYCH 1EFWA 4A3IH 4OX9Q 2OWOA 1A0IA 2NN6G 5C0XI 4L5QA 5HGQA 3M7NA 4DR4L 3D0FA 4DAYB 1Q1BA 2V1CC 1HR0L 2R93G 3CF5A 3FHWA 5ELNA 2UXBL 2NVYH 4JI1Q 1FJGL 1D7QA 4DV4L 4JBMA 2KCMA 3K81C 4TQUS 5C44G 3HOWH 4X66L 1PFSA 4RMFA 1HZBA 3A5UA 4R4IA 1I6HH 1YHBA 3KDFA 4P72A 2QA4A 4YWMA 3EBEA 1N36Q 2E2JH 4JI4Q 2NVQH 3M3YH 1IBLL 5IYBG 2UUBL 1EQQA 5FJ8H 1OXXK 3CCMA 4DV7L 3S1MH 4A3KH 4DR6L 4B3RL 3S24A 4B3ML 4DR1L 1K9MC 2UU9L 1L1OA 1HNXL 2D0OA 2B29A 2ZJRA 3NBHB 1OXVA 3BU2A 1UE5A 1HR0Q 1EIYB 2R93H 4J15A 1SRUA 2AMCB 2UXBQ 3J80i 1M90C 3KFUA 4DV4Q 1WI5A 3OW2A 3PSIA 5HY6A 3KDFB 5C44H 2RHSB 3HOXH 5M3FG 2WFWA 4GNXB 4MTNA 4GOPA 2I0QA 2JA7G 4UY8C 1RL2A 4P74A 1WFQA 3RN2A 2CCZA 2K75A 2N3SA 5IYBH 1IBLQ 2ID0A 4DV7Q 2YU9H 3KOJA 1KRTA 4A75A 1PYBA 2JA6G 2R7FA 1J6QA 1NMGA 3MEFA 4DR1Q 2UU9Q 3ERSX 1XTDA 3K8AA 1QVCA 3I4MG 4DR2L 4DV6L 1BBWA 5GAGC 4UP9A 4L5SA 3MXNB 3RN5A 1VS0A 2PI2A 3AQQA 3ULLA 4AYBG 4KHPL 1RIPA 5K36G 3CCVA 2MO0A 5M3FH 4DR7Q 4LF6L 4LFCL 1E24A 2JA7H 1U5KA 1N8RC 1LTLA 4AQYQ 2R7ZG 1EOVA 3E9HA 4NPSA 2AWNA 2LXKA 3F2BA 4HIDA 2PQAA 2E5LL 2JA6H 4A3GG 3PF5A 1GD7A 1TWAH 5GROA 3JAMi 3GTKH 3I4MH 1JE5A 3KF6B 4JOIC 4R4QA 2MQHA 3B6YA 1GO3E 3K0XA 2IX1A 4HJ8A 1I94L 1O7IA 1YZ6A 2VL6A 5GADC 1HNZL 4KHPQ 3RNUA 4WJ4A 4LF6Q 3HOYG 3S1QH 4DR7L 1J5EL 4JI2L 1EYGA 2UXDL 3J7A5 1PH3A 2R7ZH 1GKHA 4O0AA 1G51A 1FVIA 4OWXB 4BY1G 4BA2I 2E5LQ 4A3GH 4UPAA 2CKZB 4DV3L 3S1RH 1SROA 2PMZE 5C0XG 3W1GA 1C0AA 4DV5L 1V43A 3PGZA 1VQ4A 2VUMG 1K3RA 3RLOA 1I94Q 1HNZQ 3U58A 5GQOA 3H0GG 4IPCA 3I2ZA 3HOYH 4A3EG 1VCIA 3I7FA 2XTIA 3OTOL 2UXDQ 4JI5L 1NE3A 3EIVA 2K50A 1XPOA 4IO9A 1BBUA 4C3HH 1YIJA 1W2BA 1N32L 1PVOA 4BY1H 2RHQB 4FDBA 2KHJA 4DV3Q 4BXXG 1VQCA 3E9IA 5M3MG 3CCEA 4LNQA 2AHOB 4BA1I 1HZCA 2PI2E 3NEMA 1QVFA 3DM3A 2VUMH 2Z0SA 3T1YQ 5C4XG 1N33L 1GVPA 1HZAA 1XNRL 4X64L 1UE6A 2NZOA 2WB1G 4YY3L 5ELOA 1KD1C 4A3EH 4GLAC 1VQDA 4DR3L 1VQGA 3S14H 2EIFA 4P73A 3U50C 3OTOQ 2VNUD 1XMOL 4GKKQ 1N32Q 2JEBI 4LF9L 4WJ3M 4QY7A 2JE6I 4RG1A 1R9TH 1XMQL 2B3GA 1VQ9A 3ER0A 5IP7H 5M5WH 4BXXH 5M3MH 3CC2A 1IYJB 3HKZE 4IPGA 3CD6A 3PUWA 2OTJA 2E8GA 5C4XH 3H3VI 1VQKA 4JBKA 1LYLA 2YTYA 4P71A 4X64Q 1XNRQ 1B70B 3I4NG 2Y0SG 2HQLA 1XJVA 5M5XH 1AE2A 1QUQA 2Z6KC 3A0JA 4YY3Q 4Y7NH 1VQLA 1Y14B 4DR3Q 3FP9A 1AH9A 1XMOQ 4DKAC 1MJCA 1JJ2A 4LF9Q 5LMNL 4YHHL 3UDGA 1XMQQ 2UXCL 2RF4A 4B3TL 1E7ZA 2D0PA 4DUZL 2ES2A 2LXJA 4APVA 3J80c 4JBJA 3M4OH 4GN3B 1AE3A 1VQ7A 2HIXA 2ATWA 5JJLA 1N9WA 4KHZA 2F3IA 1YITA 4DR4Q 4JV5L 2OQKA 4LUOA 5IT9c 1XPRA 1PH8A 1W3SA 3I4NH 4GS3A 4EQ5A 1FJGQ 1NTGA 2PNHA 1IZ6A 4QIWE 1JB7A 3CCJA 4X66Q 2UUAL 3D31A 1GM5A 4DK6C 4LUVA 4A76A 4LF5L 2FXQA 4BY7G 4OWTB 1VQIA 2IHEA 3PUZA 4NXNL 4UP8A 1TWGH 3L0OA 4IJHA 4C2MH 2Q2UA 4YHHQ 1EWIA 1L1OB 1HR0W 4X62L 2UUBQ 2A19A 5IWAL 4DR6Q 4B3RQ 4LF4L 4X65L 3TEHB 2OQ0A 1JT8A 4B3MQ 1P16A 1NJIC 1HNXQ 1K0RA 1JJGA 2E2IH 1Q46A 2HHHL 4JV5Q 4EX5A 4YCUA 3ZJYC 2VW9A 2KHIA 4GOPB 1EUJA 4JOIA 1VQJA 3PUVA 2KCTA 2CWPA 3HKSA 3ICEA 4JYAL 1E1TA 4ME3A 4GNXC 2JEAI 1PH9A 4LFBL 4DNIA 4LF5Q 4BY7H 1VQAA 4IOCA 4A3FH 2UUCL 4NXNQ 3CC4A 1WCMG 1X56A 2RCNA 1KQSA 1KHIA 1X3EA 4LF7L 2Q2TA 3HOUG 5IWAQ 1E22A 1K73C 1D8LA 2I5LX 5JEAJ 2OTLA 1JJCB 1X65A 2WAQE 3I56A 3DLLA 3CCQA 4DR2Q 4DV6Q 4DV1L 1UE1A 3TQYA 1I3QH 3KLWA 4JYAQ 1L0WA 1BKBA 3ULPA 1UEBA 4JC0A 1E1OA 4LFCQ 4A3DG 4LFBQ 2N78A 2ZTEA 1CSQA 2PQAB 1PH5A 2UUCQ 3PF4A 1U0LA 3J81j 1M1KC 1CSPA 4JI8L 2JQOA 2ZJPA 3HOUH 1S72A 5JJKA 4DV0L 4IOAA 1CKOA 1MJEA 4YWKA 4B3SL 2K5HA 1YBYA 1VQPA 4A3JG 2C35B 1VQ8A 4LUZA 3L7ZC 1TXYA 3G71A 3M9BA 5IE8A 3CPFA 2GVBA 4PZ8A 1SMXA 2EQSA 3I4OA 4DAMA 2OCEA 1HH2P 1KAWA 3OYYA 2YTXA 5J3BA 2NVXH 3GTJH 4OO1I 2R92G 1A63A 4HJ9A 4ALPA 4A3FG 1XNQL 2VY3A 4R1JA 3K80C 4IFDJ 1FL0A 3AYHB 3G48A 1PH6A 1VQNA 1TWHH 5M5YH 1PH2A 3W5OA 4A3DH 3CCLA 3IRBA 1J5EQ 5JJIA 1CKNA 4JI2Q 1YJNA 1EQRA 4LWCA 2Q2IA 1VQ5A 4LF8L 4JBWA 1Q8KA 4P75A 3STBC 1OXUA 2BH8A 1Q1EA 3JC66 1NY4A 2XGTA 3LGJA 4A3JH 4DR5L 3PO2G 1FGUA 4JI3L 3FKIG 4HIKA 2ZM6L 4DV5Q 1HNWL 2JJQA 5FLXc 4QJFA 4DPGA 3GTGH 1Y1VG 1YJ9A 3H3VH 1Z47A 4HJAA 3TS2A 1NBWA 5IYDG 2R92H 1X54A 3BJUA 4GKJL 4PZ7A 1PV4A 1N34L 2K5NA 2VQEL 2NZHA 5H1SE 3H0GH 2D62A 2K5VA 3J81c 1IBML 2QEXA 4A3BG 3ULJA 4Y52H 1HZ9A 2ZTDA 3GDEA 3RLNA 1X9NA 1B7YB 4A3MG 1JMCA 5AJ3L 2GN5A 4JI5Q 4LF8Q 3F8TA 3GD7A 4L5RC 1X55A 3NELA 4L5TA 1X3FA 1V9PA 1YHAA 2Z6KA 4R4CA 2MNAA 1DGSA 1WOCA 1B8AA 2QGQA 1X6OA 3KJPA 3S15H 4C3JH 2VQFL 1CKMA 5IYCG 3F2DA 4DR5Q 3PO2H 3FKIH 5FLMG 4NB3A 4OX9L 4X6AH 1HNWQ 3HOVG 1LM0A 3CMAA 1Y1VH 4XIGS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A62 A;  3CP0 A;  3CCU A;  1ASZ A;  1PH4 A;  3K7U C;  2MFI A;  3CCS A;  4NXM L;  1N33 Q;  4GKJ Q;  1V1Q A;  2E2H H;  1Q81 C;  3NEN A;  1IBM Q;  4A3B H;  2K52 A;  1Y1W G;  4A93 G;  4A3M H;  1C7Y A;  3VDY A;  4A3C G;  2R7D A;  3EN2 A;  1Q7Y C;  2K14 A;  2BA0 A;  2F52 A;  4YCW A;  1SE8 A;  5C3E G;  3CCR A;  5C4J H;  3W1B A;  3G4S A;  2VQF Q;  4O2D A;  5FLM H;  1P8L A;  3HOV H;  3HKZ G;  1QZH A;  1PH7 A;  4JI6 L;  4BBR G;  2N8N A;  1X3G A;  4GLX A;  1K8G A;  1Q82 C;  1G29 1;  3CAM A;  2K4K A;  1QUQ B;  3T1H L;  3PUY A;  4NXM Q;  3S16 H;  1LUZ A;  5BR8 L;  3A74 A;  3GTL H;  2IHF A;  3HOX G;  3GO5 A;  1Y1W H;  4A93 H;  3HOZ G;  2ALY B;  4OON A;  4HIO A;  4AH6 A;  4A3C H;  3TRZ A;  2I5H A;  5LMU L;  4HJ5 A;  4GNX A;  5C3E H;  2MO1 A;  1OXT A;  1L2F A;  3M4P A;  5LMN Q;  1YNX A;  4BBS G;  2UXC Q;  4MZ9 A;  2IT1 A;  4A4I A;  4B3T Q;  3PO3 G;  4DUZ Q;  4POF A;  2GVA A;  3CXC A;  2ZTC A;  4GLV B;  3RR5 A;  2A8V A;  4GN4 B;  4HJ7 A;  3HFZ B;  4BBR H;  4JI6 Q;  4OO1 G;  4QQB X;  4KI0 A;  1EIF A;  1TWF H;  4R4T A;  1YHQ A;  1YEZ A;  3T1H Q;  5GAH C;  4AYB E;  1KL9 A;  5LMN W;  1QVG A;  1MKH A;  5BR8 Q;  2IX0 A;  1PYS B;  1K8A C;  3CME A;  1BVS A;  3TRE A;  1ASY A;  2AKW B;  2UUA Q;  4YCV A;  3HOZ H;  3CW2 C;  1IBK L;  5C0X J;  5LMU Q;  1CUK A;  4AQY L;  3WWV A;  2R6G A;  4GN5 A;  3M4Q A;  3A5Z B;  3JAM c;  4BBS H;  1L1O C;  1VQ6 A;  1C9O A;  4IFD I;  4X62 Q;  3AFP A;  3STB D;  3GTM H;  3Q8D A;  1IXR A;  4DUY L;  1PH1 A;  3PO3 H;  4LF4 Q;  3UDX A;  4X65 Q;  3CPW A;  4JG2 A;  4OXP A;  2VS1 A;  1OTC A;  2EXD A;  2NN6 I;  2HHH Q;  2ASB A;  4YWL A;  2JK8 A;  2WP8 J;  1MIU A;  4H02 A;  4GOP C;  3KF6 A;  1H95 A;  3KF8 B;  4POG A;  1UE7 A;  2DUD A;  4LFA L;  4PZ6 A;  3J7Z C;  1Q12 A;  1A8V A;  3AEV A;  1VQF A;  1IBK Q;  1YVC A;  4XTC S;  3AFQ A;  1SFO H;  1WCM H;  2Q2H A;  4KLK A;  4DV2 L;  4JI0 L;  2KBN A;  3GTP H;  5DLQ E;  4LF7 Q;  4PG3 A;  4TVA B;  4DUY Q;  1SR3 A;  2WAQ G;  2CFM A;  2HT1 A;  4DV1 Q;  4K0K L;  5IY0 A;  2B63 G;  1KC8 C;  1I50 H;  2YYZ A;  4IJL A;  3S1N H;  4A3L G;  4LFA Q;  4QL5 A;  1Z9F A;  1TWC H;  2CQO A;  4MNO A;  2F4V L;  3CQZ H;  3PCO B;  1E3P A;  3U4Z A;  5E7N A;  3SGI A;  4C3I H;  1VQE A;  3K7A H;  1S3O A;  2VZA A;  4AIM A;  4DV2 Q;  2DGY A;  4JI8 Q;  4JI0 Q;  3KYH C;  4DV0 Q;  4IPD A;  3PIO A;  4B3S Q;  1I5F A;  1OXS C;  1PA6 A;  3F1Z A;  3S2H H;  4IPH A;  1YJW A;  4R4O A;  1G6P A;  4JCV E;  3I55 A;  3F2C A;  1K83 H;  5JEA G;  3T1Y L;  5GAE C;  2JA9 A;  3PIP A;  1XNQ Q;  2B63 H;  2JA5 G;  4K0K Q;  1UWV A;  1CKN B;  1VQB A;  4DK3 C;  2H5X A;  2WB1 E;  2HIV A;  5IP9 G;  4A3L H;  3M85 A;  1S40 A;  1QZG A;  2BH2 A;  2AWO A;  2F4V Q;  2A1A A;  3PV0 A;  4JI7 L;  3H15 A;  1XPU A;  3RZD H;  3RLF A;  4GKK L;  1IL2 A;  1KRS A;  4QGU A;  1SN8 A;  4HIM A;  1KXL A;  1HJP A;  5IP7 G;  2BA1 A;  3G6E A;  2IY5 B;  5EAY A;  2JA8 G;  3CC7 A;  3PUX A;  1Q86 C;  4JI3 Q;  4A3I G;  1WJJ A;  1NMF A;  4LW1 A;  3U4V A;  3KJO A;  2ZM6 Q;  1VQH A;  3GTQ H;  1WYD A;  3GTO H;  3BZK A;  1PHJ A;  5IYD H;  4UP7 A;  2KEN A;  2JA5 H;  1T9H A;  2ZJQ A;  4JI1 L;  2LSS A;  1SLJ A;  2Y0S E;  2YTV A;  3BZC A;  4PMW A;  5IP9 H;  2VQE Q;  2N49 A;  1N34 Q;  2L15 A;  3S2D H;  4OWW B;  3UE0 A;  3RZO H;  3HOW G;  3S17 H;  3L2P A;  4JI7 Q;  1KIX A;  5AJ3 Q;  3E0E A;  1YI2 A;  1VQM A;  2CWA A;  3TS0 A;  2YV5 A;  3UE1 A;  4IFD G;  3J81 i;  1VQO A;  1N36 L;  3UDF A;  4JI4 L;  3UDI A;  2NVT H;  5FJ8 G;  2I5M X;  2JA8 H;  4A3K G;  5IYC H;  1EFW A;  4A3I H;  4OX9 Q;  2OWO A;  1A0I A;  2NN6 G;  5C0X I;  4L5Q A;  5HGQ A;  3M7N A;  4DR4 L;  3D0F A;  4DAY B;  1Q1B A;  2V1C C;  1HR0 L;  2R93 G;  3CF5 A;  3FHW A;  5ELN A;  2UXB L;  2NVY H;  4JI1 Q;  1FJG L;  1D7Q A;  4DV4 L;  4JBM A;  2KCM A;  3K81 C;  4TQU S;  5C44 G;  3HOW H;  4X66 L;  1PFS A;  4RMF A;  1HZB A;  3A5U A;  4R4I A;  1I6H H;  1YHB A;  3KDF A;  4P72 A;  2QA4 A;  4YWM A;  3EBE A;  1N36 Q;  2E2J H;  4JI4 Q;  2NVQ H;  3M3Y H;  1IBL L;  5IYB G;  2UUB L;  1EQQ A;  5FJ8 H;  1OXX K;  3CCM A;  4DV7 L;  3S1M H;  4A3K H;  4DR6 L;  4B3R L;  3S24 A;  4B3M L;  4DR1 L;  1K9M C;  2UU9 L;  1L1O A;  1HNX L;  2D0O A;  2B29 A;  2ZJR A;  3NBH B;  1OXV A;  3BU2 A;  1UE5 A;  1HR0 Q;  1EIY B;  2R93 H;  4J15 A;  1SRU A;  2AMC B;  2UXB Q;  3J80 i;  1M90 C;  3KFU A;  4DV4 Q;  1WI5 A;  3OW2 A;  3PSI A;  5HY6 A;  3KDF B;  5C44 H;  2RHS B;  3HOX H;  5M3F G;  2WFW A;  4GNX B;  4MTN A;  4GOP A;  2I0Q A;  2JA7 G;  4UY8 C;  1RL2 A;  4P74 A;  1WFQ A;  3RN2 A;  2CCZ A;  2K75 A;  2N3S A;  5IYB H;  1IBL Q;  2ID0 A;  4DV7 Q;  2YU9 H;  3KOJ A;  1KRT A;  4A75 A;  1PYB A;  2JA6 G;  2R7F A;  1J6Q A;  1NMG A;  3MEF A;  4DR1 Q;  2UU9 Q;  3ERS X;  1XTD A;  3K8A A;  1QVC A;  3I4M G;  4DR2 L;  4DV6 L;  1BBW A;  5GAG C;  4UP9 A;  4L5S A;  3MXN B;  3RN5 A;  1VS0 A;  2PI2 A;  3AQQ A;  3ULL A;  4AYB G;  4KHP L;  1RIP A;  5K36 G;  3CCV A;  2MO0 A;  5M3F H;  4DR7 Q;  4LF6 L;  4LFC L;  1E24 A;  2JA7 H;  1U5K A;  1N8R C;  1LTL A;  4AQY Q;  2R7Z G;  1EOV A;  3E9H A;  4NPS A;  2AWN A;  2LXK A;  3F2B A;  4HID A;  2PQA A;  2E5L L;  2JA6 H;  4A3G G;  3PF5 A;  1GD7 A;  1TWA H;  5GRO A;  3JAM i;  3GTK H;  3I4M H;  1JE5 A;  3KF6 B;  4JOI C;  4R4Q A;  2MQH A;  3B6Y A;  1GO3 E;  3K0X A;  2IX1 A;  4HJ8 A;  1I94 L;  1O7I A;  1YZ6 A;  2VL6 A;  5GAD C;  1HNZ L;  4KHP Q;  3RNU A;  4WJ4 A;  4LF6 Q;  3HOY G;  3S1Q H;  4DR7 L;  1J5E L;  4JI2 L;  1EYG A;  2UXD L;  3J7A 5;  1PH3 A;  2R7Z H;  1GKH A;  4O0A A;  1G51 A;  1FVI A;  4OWX B;  4BY1 G;  4BA2 I;  2E5L Q;  4A3G H;  4UPA A;  2CKZ B;  4DV3 L;  3S1R H;  1SRO A;  2PMZ E;  5C0X G;  3W1G A;  1C0A A;  4DV5 L;  1V43 A;  3PGZ A;  1VQ4 A;  2VUM G;  1K3R A;  3RLO A;  1I94 Q;  1HNZ Q;  3U58 A;  5GQO A;  3H0G G;  4IPC A;  3I2Z A;  3HOY H;  4A3E G;  1VCI A;  3I7F A;  2XTI A;  3OTO L;  2UXD Q;  4JI5 L;  1NE3 A;  3EIV A;  2K50 A;  1XPO A;  4IO9 A;  1BBU A;  4C3H H;  1YIJ A;  1W2B A;  1N32 L;  1PVO A;  4BY1 H;  2RHQ B;  4FDB A;  2KHJ A;  4DV3 Q;  4BXX G;  1VQC A;  3E9I A;  5M3M G;  3CCE A;  4LNQ A;  2AHO B;  4BA1 I;  1HZC A;  2PI2 E;  3NEM A;  1QVF A;  3DM3 A;  2VUM H;  2Z0S A;  3T1Y Q;  5C4X G;  1N33 L;  1GVP A;  1HZA A;  1XNR L;  4X64 L;  1UE6 A;  2NZO A;  2WB1 G;  4YY3 L;  5ELO A;  1KD1 C;  4A3E H;  4GLA C;  1VQD A;  4DR3 L;  1VQG A;  3S14 H;  2EIF A;  4P73 A;  3U50 C;  3OTO Q;  2VNU D;  1XMO L;  4GKK Q;  1N32 Q;  2JEB I;  4LF9 L;  4WJ3 M;  4QY7 A;  2JE6 I;  4RG1 A;  1R9T H;  1XMQ L;  2B3G A;  1VQ9 A;  3ER0 A;  5IP7 H;  5M5W H;  4BXX H;  5M3M H;  3CC2 A;  1IYJ B;  3HKZ E;  4IPG A;  3CD6 A;  3PUW A;  2OTJ A;  2E8G A;  5C4X H;  3H3V I;  1VQK A;  4JBK A;  1LYL A;  2YTY A;  4P71 A;  4X64 Q;  1XNR Q;  1B70 B;  3I4N G;  2Y0S G;  2HQL A;  1XJV A;  5M5X H;  1AE2 A;  1QUQ A;  2Z6K C;  3A0J A;  4YY3 Q;  4Y7N H;  1VQL A;  1Y14 B;  4DR3 Q;  3FP9 A;  1AH9 A;  1XMO Q;  4DKA C;  1MJC A;  1JJ2 A;  4LF9 Q;  5LMN L;  4YHH L;  3UDG A;  1XMQ Q;  2UXC L;  2RF4 A;  4B3T L;  1E7Z A;  2D0P A;  4DUZ L;  2ES2 A;  2LXJ A;  4APV A;  3J80 c;  4JBJ A;  3M4O H;  4GN3 B;  1AE3 A;  1VQ7 A;  2HIX A;  2ATW A;  5JJL A;  1N9W A;  4KHZ A;  2F3I A;  1YIT A;  4DR4 Q;  4JV5 L;  2OQK A;  4LUO A;  5IT9 c;  1XPR A;  1PH8 A;  1W3S A;  3I4N H;  4GS3 A;  4EQ5 A;  1FJG Q;  1NTG A;  2PNH A;  1IZ6 A;  4QIW E;  1JB7 A;  3CCJ A;  4X66 Q;  2UUA L;  3D31 A;  1GM5 A;  4DK6 C;  4LUV A;  4A76 A;  4LF5 L;  2FXQ A;  4BY7 G;  4OWT B;  1VQI A;  2IHE A;  3PUZ A;  4NXN L;  4UP8 A;  1TWG H;  3L0O A;  4IJH A;  4C2M H;  2Q2U A;  4YHH Q;  1EWI A;  1L1O B;  1HR0 W;  4X62 L;  2UUB Q;  2A19 A;  5IWA L;  4DR6 Q;  4B3R Q;  4LF4 L;  4X65 L;  3TEH B;  2OQ0 A;  1JT8 A;  4B3M Q;  1P16 A;  1NJI C;  1HNX Q;  1K0R A;  1JJG A;  2E2I H;  1Q46 A;  2HHH L;  4JV5 Q;  4EX5 A;  4YCU A;  3ZJY C;  2VW9 A;  2KHI A;  4GOP B;  1EUJ A;  4JOI A;  1VQJ A;  3PUV A;  2KCT A;  2CWP A;  3HKS A;  3ICE A;  4JYA L;  1E1T A;  4ME3 A;  4GNX C;  2JEA I;  1PH9 A;  4LFB L;  4DNI A;  4LF5 Q;  4BY7 H;  1VQA A;  4IOC A;  4A3F H;  2UUC L;  4NXN Q;  3CC4 A;  1WCM G;  1X56 A;  2RCN A;  1KQS A;  1KHI A;  1X3E A;  4LF7 L;  2Q2T A;  3HOU G;  5IWA Q;  1E22 A;  1K73 C;  1D8L A;  2I5L X;  5JEA J;  2OTL A;  1JJC B;  1X65 A;  2WAQ E;  3I56 A;  3DLL A;  3CCQ A;  4DR2 Q;  4DV6 Q;  4DV1 L;  1UE1 A;  3TQY A;  1I3Q H;  3KLW A;  4JYA Q;  1L0W A;  1BKB A;  3ULP A;  1UEB A;  4JC0 A;  1E1O A;  4LFC Q;  4A3D G;  4LFB Q;  2N78 A;  2ZTE A;  1CSQ A;  2PQA B;  1PH5 A;  2UUC Q;  3PF4 A;  1U0L A;  3J81 j;  1M1K C;  1CSP A;  4JI8 L;  2JQO A;  2ZJP A;  3HOU H;  1S72 A;  5JJK A;  4DV0 L;  4IOA A;  1CKO A;  1MJE A;  4YWK A;  4B3S L;  2K5H A;  1YBY A;  1VQP A;  4A3J G;  2C35 B;  1VQ8 A;  4LUZ A;  3L7Z C;  1TXY A;  3G71 A;  3M9B A;  5IE8 A;  3CPF A;  2GVB A;  4PZ8 A;  1SMX A;  2EQS A;  3I4O A;  4DAM A;  2OCE A;  1HH2 P;  1KAW A;  3OYY A;  2YTX A;  5J3B A;  2NVX H;  3GTJ H;  4OO1 I;  2R92 G;  1A63 A;  4HJ9 A;  4ALP A;  4A3F G;  1XNQ L;  2VY3 A;  4R1J A;  3K80 C;  4IFD J;  1FL0 A;  3AYH B;  3G48 A;  1PH6 A;  1VQN A;  1TWH H;  5M5Y H;  1PH2 A;  3W5O A;  4A3D H;  3CCL A;  3IRB A;  1J5E Q;  5JJI A;  1CKN A;  4JI2 Q;  1YJN A;  1EQR A;  4LWC A;  2Q2I A;  1VQ5 A;  4LF8 L;  4JBW A;  1Q8K A;  4P75 A;  3STB C;  1OXU A;  2BH8 A;  1Q1E A;  3JC6 6;  1NY4 A;  2XGT A;  3LGJ A;  4A3J H;  4DR5 L;  3PO2 G;  1FGU A;  4JI3 L;  3FKI G;  4HIK A;  2ZM6 L;  4DV5 Q;  1HNW L;  2JJQ A;  5FLX c;  4QJF A;  4DPG A;  3GTG H;  1Y1V G;  1YJ9 A;  3H3V H;  1Z47 A;  4HJA A;  3TS2 A;  1NBW A;  5IYD G;  2R92 H;  1X54 A;  3BJU A;  4GKJ L;  4PZ7 A;  1PV4 A;  1N34 L;  2K5N A;  2VQE L;  2NZH A;  5H1S E;  3H0G H;  2D62 A;  2K5V A;  3J81 c;  1IBM L;  2QEX A;  4A3B G;  3ULJ A;  4Y52 H;  1HZ9 A;  2ZTD A;  3GDE A;  3RLN A;  1X9N A;  1B7Y B;  4A3M G;  1JMC A;  5AJ3 L;  2GN5 A;  4JI5 Q;  4LF8 Q;  3F8T A;  3GD7 A;  4L5R C;  1X55 A;  3NEL A;  4L5T A;  1X3F A;  1V9P A;  1YHA A;  2Z6K A;  4R4C A;  2MNA A;  1DGS A;  1WOC A;  1B8A A;  2QGQ A;  1X6O A;  3KJP A;  3S15 H;  4C3J H;  2VQF L;  1CKM A;  5IYC G;  3F2D A;  4DR5 Q;  3PO2 H;  3FKI H;  5FLM G;  4NB3 A;  4OX9 L;  4X6A H;  1HNW Q;  3HOV G;  1LM0 A;  3CMA A;  1Y1V H;  4XIG S; 
#chains in the Genus database with same CATH topology
 1S4Z A;  3K7U C;  3PIP 3;  4B08 A;  5JVH 3;  5DEH A;  1N33 Q;  3GV3 A;  4AYB B;  3MHB A;  4H44 C;  4L6T B;  2NYZ D;  4HR7 B;  1F2Y A;  3CQZ B;  4F88 A;  1Y1W G;  4A93 G;  4A3M H;  2DJF C;  4ZUJ A;  2R7Z B;  4YCW A;  4UHV A;  1EQV A;  3HGB A;  3W1B A;  2VQF Q;  1LAC A;  4O2D A;  1P8L A;  4JI6 L;  1YNJ D;  1RHP A;  4GLX A;  4YIJ A;  2MGS A;  1LUZ A;  3NPP A;  4ZLT F;  4N9T A;  4OON A;  4A3C H;  4AH6 A;  3FEW X;  3DUZ A;  5LMU L;  4HJ5 A;  4C3H B;  1DOK A;  5C3E H;  2MO1 A;  1OXT A;  3KBG A;  4BY1 B;  1YNX A;  2UXC Q;  4DUZ Q;  2GVA A;  3D4W A;  2RQX A;  2AUK A;  3UI2 A;  2N55 A;  4BBR H;  4JI6 Q;  4OO1 G;  1TWF H;  4R4T A;  1KL9 A;  1MKH A;  1ROD A;  3CME A;  1BVS A;  1AZQ A;  2K01 A;  3HOZ H;  1BR9 A;  2Q8R E;  5LMU Q;  3JAM c;  3PMF A;  4X62 Q;  4DUY L;  4A3I B;  4OXP A;  1PFM A;  3OWE B;  3V2T A;  1HFG A;  1ESR A;  1GHJ A;  4H02 A;  4KHV A;  3DWQ A;  5E3F A;  4Y7N B;  3J7Z C;  5I9P A;  1VQF A;  2B2W A;  4OHJ A;  4IN3 A;  1K28 A;  3GTP H;  4Q0F A;  4PG3 A;  1MHW C;  4TVA B;  4DUY Q;  2XVS A;  4IQZ A;  3U9O A;  4HAE A;  2HT1 A;  1VDZ A;  4K0K L;  1Y8P B;  2B39 A;  1KDA A;  1EY8 A;  5IY0 A;  4CBV A;  3S1N H;  3EQL C;  4QL5 A;  2Q8I B;  4K6D A;  4AIM A;  4RFB A;  2DGY A;  4JI8 Q;  3E0J A;  1KLU D;  1I4P A;  1PA6 A;  4QUC A;  1V1P A;  4HTH A;  4FF2 A;  3EA6 A;  4IPH A;  1G6P A;  4JCV E;  5FK9 C;  3F2C A;  1K83 H;  4K0K Q;  3PIP A;  1XNQ Q;  2B63 H;  1QJO A;  3CKI B;  1VQB A;  2H5X A;  3BVG A;  3RUZ A;  4A3L H;  3M85 A;  2BH2 A;  3I91 A;  1IL2 A;  2EY6 A;  5C3X A;  4HIM A;  1HJP A;  2WKD A;  2BA1 A;  3G6E A;  1K0S A;  3EJI A;  1Q90 A;  1SNM A;  1F2M A;  3I72 A;  3GTQ H;  2ZXP A;  2EY5 A;  5IGF A;  3NWT A;  5JAV A;  2ZT9 C;  5JEA H;  4GZY C;  2JA5 H;  2ZJQ A;  3BYY B;  1SLJ A;  3BZC A;  1N34 Q;  1PTO D;  1H9R A;  3UE0 A;  2IX3 A;  2J7Z A;  3NUC A;  2L55 A;  3FRP B;  5LL6 S;  1VQM A;  2QEJ C;  2YV5 A;  3UE1 A;  5F2D A;  4LMQ D;  1VQO A;  4JI4 L;  4IUN A;  4RWS C;  4QF4 A;  3RMH A;  5KYL A;  5IYC H;  3MAQ A;  3SVM A;  2CHB D;  2OWO A;  1Y8O B;  4L5Q A;  2NVX B;  4KMU C;  3CF5 A;  2R93 G;  3FHW A;  3NK9 A;  2NVY H;  1FJG L;  4ZKC B;  5IIF A;  5C44 G;  3HOY B;  5M5Y B;  3MFG A;  4X66 L;  4RMF A;  4HMI A;  4ZYS A;  1F2L A;  4P72 A;  3M3Y H;  4JI4 Q;  1IBL L;  4DR6 L;  1OXX K;  1CK1 A;  1M4V A;  2HDL A;  4DR1 L;  4RCN A;  1L1O A;  5IT9 E;  3P1H A;  3NBH B;  1OXV A;  2QCP X;  4FF3 A;  1SRU A;  2RSN A;  4GNX B;  3KDF B;  2RHS B;  1TS4 A;  2Z9H A;  4TRD A;  2O4X A;  2CCZ A;  2K75 A;  1FYC A;  1IBL Q;  2ID0 A;  2YU9 H;  1F2Z A;  4A75 A;  1PYB A;  3MEF A;  4DR1 Q;  4K5X A;  3MC0 B;  1ICF B;  3URY A;  5BN5 A;  1U4P A;  4HED A;  2E2H B;  2PI2 A;  4KHP L;  2C9O A;  4A3B B;  5M3F H;  2QW7 A;  4MHE A;  1H9S B;  2DNC A;  1HTP A;  4IAL A;  2F0H A;  4NPS A;  2AWN A;  2NTT A;  2FJ2 A;  2E5L L;  2JA6 H;  1JOK A;  1TWA H;  2EDG A;  3HOV B;  4PQX A;  3I4M H;  2EE1 A;  4R4Q A;  4K5W A;  1GO3 E;  3N52 A;  1MSH A;  2K33 A;  2IX1 A;  3AMU A;  1O7I A;  4KHP Q;  4OIK A;  2F4I A;  3TBI B;  3GTL B;  5K36 H;  2VB3 X;  1Y1W B;  4A93 B;  1J5E L;  2B2T A;  4JI2 L;  1U4M A;  1PH3 A;  3VA5 A;  3K5L A;  2R7Z H;  1EWH A;  2OT2 A;  1G51 A;  3HS0 C;  5JPN C;  2E5L Q;  1LO5 D;  4F7X A;  2ENB A;  3I70 A;  2PMZ E;  4KJN A;  3OMC A;  4JPB W;  4NMZ A;  3W1G A;  1HA6 A;  1SAP A;  2IW3 A;  3PGZ A;  2VUM G;  2EYH A;  1NR2 A;  5CV6 A;  3T13 A;  3H0G G;  3ND8 A;  4IPC A;  1SE3 A;  4A3E G;  1VCI A;  3I7F A;  4JI5 L;  4IO9 A;  1FNU A;  2MP1 A;  2X6L A;  4C3H H;  1YIJ A;  1W2B A;  2TMP A;  4BY1 H;  3C3L A;  2KHJ A;  4XQN A;  1CA5 A;  1GJX A;  1D5X C;  4BA1 I;  1HZC A;  3NEM A;  4KY7 A;  2TSS A;  3K0Y A;  4R8I A;  3NWS A;  2Z0S A;  3J81 E;  5C4X G;  4TKO B;  2CVR A;  4X64 L;  1B3A A;  5LL6 X;  1TS5 A;  4N9P A;  4GLA C;  1VQG A;  2EIF A;  3G7L A;  4P73 A;  5IT9 L;  1XMO L;  1WCM B;  4IUQ A;  4E6I A;  3D8G A;  3IKJ A;  4QUF A;  1R4Q B;  1O7L A;  1VMP A;  4HCS A;  2KUM A;  2A6E C;  5I9O A;  2F0S A;  3A8K E;  1IW7 C;  3H3V I;  2O5I C;  1SDF A;  4JBK A;  4X64 Q;  1B70 B;  4QMG A;  1DCZ A;  1HQR D;  2O2L D;  4Y7N H;  1TWC B;  3R8B A;  1Y14 B;  3FP9 A;  1AH9 A;  5L37 A;  1XMO Q;  1B4O A;  4J8Q A;  4YHH L;  2LS0 1;  1E7Z A;  2D0P A;  3S2H B;  1JQY D;  4GN3 B;  2HIX A;  1SNO A;  4ZUI A;  1WD0 A;  4G7H C;  1XPR A;  2L11 A;  3NTK A;  1PTO B;  3I4N H;  1GUG A;  3D31 A;  4DK6 C;  4A76 A;  3NQT A;  4M8A A;  2IHE A;  3PUZ A;  2A69 C;  4YHH Q;  4CJ1 B;  1HR0 W;  2A19 A;  4KTA A;  4LF4 L;  3TEH B;  3I73 A;  1I4X A;  3O13 A;  1NJI C;  1K0R A;  1JJG A;  5CV7 A;  1A6X A;  1EYD A;  1RTN A;  2E75 C;  2K5Q A;  2NWG A;  5EKL A;  2F0F A;  2HCI A;  3VR2 A;  1K3B C;  2PO4 A;  2CWP A;  3HKS A;  3S2D B;  3JAM E;  1VQA A;  2BCO A;  3W2D A;  1CZW A;  2NVT B;  1D8L A;  2I5L X;  1ET9 A;  5DNF A;  3DLL A;  3CCQ A;  4DV6 Q;  2CH4 A;  2EXZ A;  1SSO A;  3T16 A;  1UE1 A;  2Z1C A;  1BCP C;  4MIU A;  1E1O A;  5C4H A;  1GUO A;  4DN4 M;  1SMY C;  4KY6 A;  1PH5 A;  3PF4 A;  1M1K C;  1QCB D;  2JQO A;  2E2J B;  3J81 L;  1MJE A;  4A3J G;  3HKZ B;  3C1F A;  3M9B A;  3N6R A;  4DK0 A;  1SMX A;  2F0J A;  1KAW A;  2NVX H;  1PFB A;  1A63 A;  4OO1 I;  4HJ9 A;  1EEF D;  4R1J A;  5IGG A;  1IW7 D;  3I8Z A;  1O7Z A;  3HOX B;  5C44 B;  1PH2 A;  5M5Y H;  3WDN A;  5JJI A;  3CCL A;  1S5D D;  1EQR A;  4LWC A;  2Q2I A;  5C6A A;  2Z4I A;  4LF8 L;  4JBW A;  1SBB B;  1PRT C;  3OIQ A;  1Q1E A;  1BOS A;  2XGT A;  4C3J G;  2LKV A;  3PO2 G;  4XYO A;  4JI3 L;  5I2Y A;  1HXY D;  4DPG A;  3MEH A;  1Y1V G;  1YJ9 A;  2RBM A;  3H3V H;  4CDE C;  3SDZ A;  3AU7 A;  2F0I A;  2K5N A;  3J80 L;  4Y52 H;  2KVM A;  1EY4 A;  4QIW B;  4F8M A;  5AJ3 L;  4LF8 Q;  3L3O C;  1YHA A;  4R4C A;  4X3T A;  1B8A A;  4P2C B;  1WTO A;  2A69 D;  2GA4 B;  1MD2 D;  3QWN A;  3VYS A;  4OX9 L;  3GTK B;  1I4Q A;  1J8I A;  5J39 A;  1A62 A;  2RCF A;  3CCU A;  1UAP A;  5E4X A;  4NXM L;  2E2H H;  1AZP A;  5COR A;  1HFN A;  1Q3L A;  1SE2 A;  4A3B H;  2BOS A;  2L0C A;  3VDY A;  1Q7Y C;  2KHS A;  2BA0 A;  1G8Z D;  1STY A;  3D6W A;  5IGE A;  1O78 A;  4NP5 A;  3P7J A;  4CKB A;  1D5Z C;  1CM9 A;  2WAQ B;  3HOV H;  3JAM L;  2N8N A;  1X3G A;  2K4K A;  3NP8 A;  3PUY A;  4NXM Q;  5BR8 L;  1E2W A;  3A74 A;  5C5L A;  3GTL H;  3GO5 A;  1BCP D;  1Y1W H;  4A93 H;  2ALY B;  4PMC A;  4Q5V A;  4LJZ C;  4GNX A;  3A7L A;  5LMN Q;  1SMY D;  4B3T Q;  3PO3 G;  1H9J A;  4POF A;  4N8X 1;  4GN4 B;  4HJ7 A;  2VUM B;  1EIF A;  3SHL A;  4IUV A;  4CGY B;  4C1N I;  5BR8 Q;  1LT4 D;  4XT3 B;  4PV1 C;  4YCV A;  4A3E B;  3S14 B;  1IBK L;  3TZD A;  3VR4 A;  3VR5 A;  2R6G A;  3A5Z B;  1AEX A;  3R2I A;  1PRT D;  3Q8D A;  2F0Q A;  5G3L F;  1HRJ A;  4X65 Q;  1YNJ C;  2VS1 A;  4OO1 H;  3HRZ C;  2EXD A;  2HHH Q;  4FF4 A;  2WV6 D;  5C4X B;  2WP8 J;  1MIU A;  4JVZ A;  1H95 A;  3KK7 A;  3KF8 B;  1TQO A;  2DUD A;  2XN9 C;  3C46 A;  3AEV A;  1IBK Q;  1YVC A;  4X3S A;  4C3I G;  1WCM H;  1A2U A;  3AB9 A;  4NW2 A;  1QOH A;  4LF7 Q;  4RHR A;  2PNR C;  3TP5 A;  4DF7 A;  1DXM A;  4DV1 Q;  1KC8 C;  2G9H D;  4IJL A;  4MNO A;  1TWC H;  2CQO A;  3SK5 A;  1E3P A;  3U4Z A;  4C2M B;  1TWG B;  3S9W A;  4DV0 Q;  4B3S Q;  1OXS C;  3F1Z A;  4HSV A;  3S2H H;  2EYP A;  4C1N K;  2E2I B;  3I55 A;  1A2T A;  2K1B A;  3T1Y L;  5GAE C;  2JA9 A;  1PTO H;  4IZ8 A;  4DK3 C;  5IP9 G;  1QZG A;  5M3F B;  3TME A;  2F3V A;  1RJT A;  3H15 A;  1XPU A;  4GKK L;  4RH6 A;  1KRS A;  1UNS A;  1KXL A;  3J7A F;  4U67 3;  5IP7 G;  5I6Y A;  1FR3 A;  3CC7 A;  1XYI A;  4CJ0 B;  3U4V A;  2ZM6 Q;  4LW1 A;  3KJO A;  1WYD A;  3BZK A;  5IYD H;  4PNY A;  5ELE A;  5I4D A;  4JI1 L;  2LSS A;  1I3Q B;  2VQE Q;  4KD4 A;  1HQM C;  3S2D H;  2L15 A;  4RGO S;  4DAV A;  1JWU D;  4R8N A;  3TS0 A;  1HCZ A;  3DHQ A;  3UDI A;  4FXG C;  2NVT H;  5FJ8 G;  2I5M X;  5DM7 3;  4A3K G;  5E1F A;  2NN6 G;  5CV5 A;  4KY5 A;  4DR4 L;  4DAY B;  4FXK C;  4MTK A;  2V1C C;  3BS1 A;  5ELN A;  1ICW A;  4JI1 Q;  2BDN A;  1D7Q A;  2NBF A;  4DV4 L;  4TQU S;  1HZB A;  3A5U A;  4R4I A;  2E2J H;  2IY5 B;  1CFM A;  5IYB G;  2UUB L;  1F9P A;  2LY7 A;  3CCM A;  1EQQ A;  4B3R L;  5DAU A;  4A3J B;  1FGB D;  4G57 A;  4DFA A;  1JC7 A;  1B3Q A;  1TKW B;  1WTQ A;  3J7A V;  3BU2 A;  2R93 H;  1PTO C;  1EIY B;  4J15 A;  2AMC B;  3MA2 B;  3U9S A;  4DV4 Q;  1WI5 A;  3PSI A;  3P75 A;  2JSO A;  5C44 H;  3HOX H;  2I0Q A;  1FNV A;  2DJG C;  2QDL A;  1JCK B;  2ICI A;  2PW5 A;  3S15 B;  1QWY A;  4C3J B;  4X3K A;  3PO2 B;  2WII B;  2PMZ B;  3ERS X;  3BG3 A;  2B2V C;  3TP6 A;  1QVC A;  1YNN D;  1Y1V B;  4DR2 L;  5GAG C;  4UP9 A;  4L5S A;  1VS0 A;  2NZ1 D;  3Q23 A;  3OMG A;  3AQQ A;  1H9K A;  1AW7 A;  1BCP B;  2MO0 A;  4LF6 L;  3BDO A;  1E24 A;  3KLS A;  1N8R C;  1LTL A;  1TT2 A;  2EYL A;  1VMC A;  1IKL A;  1EOV A;  2LXK A;  1EY6 A;  3TZU A;  3K57 A;  2AQ2 B;  1LT3 D;  3GTK H;  1I4R A;  3QG1 A;  3KF6 B;  4RA8 A;  2B8G A;  2F0K A;  2MQH A;  4G7Z C;  4HJ8 A;  1HNZ L;  3I4N B;  1EYC A;  4DU9 A;  2Y0S B;  4LF6 Q;  5JPM C;  4B9X A;  1LTB D;  1NNX A;  4F87 A;  1PRT B;  3PQI A;  4OWX B;  4BA2 I;  2PZT A;  4UPA A;  2CKZ B;  4DV3 L;  2F03 A;  1SRO A;  3TP7 A;  1C0A A;  2Z8L A;  1V43 A;  1K3R A;  1LV9 A;  3WOF A;  5KNC A;  5A2Q E;  1II3 A;  1HNZ Q;  4O1N A;  4K8I A;  1JR0 D;  3I2Z A;  2IJ0 A;  5EQ0 A;  3OTO L;  3EIV A;  2K50 A;  1XPO A;  1BBU A;  1CI3 M;  1S5B D;  2RHQ B;  3PO3 B;  3Q22 A;  2F1M A;  4DV3 Q;  4BXX G;  1I6V C;  3OW7 A;  3TP8 A;  4FYD A;  2AHO B;  2PI2 E;  1NUC A;  2VUM H;  1LTS D;  4OL7 A;  1GVP A;  4ME5 A;  1ML0 D;  4YY3 L;  3C2P A;  1Y8N B;  4A3E H;  3S14 H;  1VQD A;  4DR3 L;  3OTO Q;  3SXH A;  1SFO B;  4DK1 A;  4LF9 L;  4WJ3 M;  4QY7 A;  2JE6 I;  1XMQ L;  4CDC C;  1K8M A;  5ISR A;  3CC2 A;  1IYJ B;  2KEC A;  4IPG A;  1HHV A;  1EY9 A;  4WRD A;  3CD6 A;  3PUW A;  1DD2 A;  1E0B A;  3T56 B;  2E8G A;  5C4X H;  2L12 A;  3NBI A;  1XJV A;  4YY3 Q;  4DR3 Q;  4C3I B;  1MJC A;  1JJ2 A;  4LF9 Q;  1XMQ Q;  3UDG A;  1MI2 A;  4JBJ A;  2ATW A;  2EY2 A;  4JV5 L;  1DJR D;  4LUO A;  4RCO A;  1WTR A;  1W3S A;  2AUJ D;  3H91 A;  1FJG Q;  4DXG A;  3NHH A;  3CCJ A;  3CU7 A;  4X66 Q;  2UUA L;  1GM5 A;  4LF5 L;  4BY7 G;  4OWT B;  1VQI A;  2Q2U A;  4UP8 A;  1TWG H;  3L0O A;  4IJH A;  4PMB A;  4C2M H;  4DR6 Q;  5IWA L;  3A7A B;  4TSS A;  2OQ0 A;  1TY2 A;  2FMC A;  1Z6H A;  1P16 A;  1LTA D;  4CHT B;  2E2I H;  1Q46 A;  4JV5 Q;  4EX5 A;  3ZYY X;  1GUN A;  4IUR A;  2N88 A;  1EUJ A;  3PUV A;  2KCT A;  1E1T A;  4H0L C;  1I4G A;  4LFB L;  4DNI A;  4LF5 Q;  3KF8 A;  1EIH A;  4IOC A;  1SND A;  2Q2T A;  5A2Q L;  5IWA Q;  1CT1 D;  1G91 A;  1JJC B;  3FDT A;  4CKE A;  2RVL A;  3QOJ A;  5HUR A;  2PPB C;  3V05 A;  3TQY A;  1I3Q H;  1EQT A;  3KLW A;  3ULP A;  5ELC A;  1EYA A;  1LT5 D;  1FNW A;  4LFB Q;  2B2Y C;  2N78 A;  2PQA B;  1QE6 A;  4WJW A;  1U0L A;  3BVZ A;  2ZJP A;  5JJK A;  1QB5 D;  1S72 A;  2F0U A;  1CKO A;  4IOA A;  2K5H A;  3R3O A;  1VQ8 A;  2C35 B;  4J6H A;  3L7Z C;  5IE8 A;  2F0E A;  4XQQ A;  1JB3 A;  1VF7 A;  3OYY A;  5ELD A;  2YTX A;  3D4R A;  3DEP A;  5J3B A;  2EYO A;  3GV6 A;  2VY3 A;  4BS9 A;  4IFD J;  1JOQ A;  1S5E D;  4XQJ A;  1J5E Q;  4JI2 Q;  5KND A;  1VQ5 A;  1Q8K A;  2EJG C;  4P75 A;  5HGT A;  3K59 A;  2BH8 A;  4G4K A;  3LGJ A;  4A3J H;  2ZXO A;  3FKI G;  3BDC A;  2CH4 W;  2JJQ A;  5FLX c;  1Z47 A;  3TS2 A;  1NBW A;  4JK1 C;  5H1S E;  2KED A;  1TR5 A;  4KKS A;  2QEX A;  3ULJ A;  1NSN S;  1HZ9 A;  3RLN A;  4JI5 Q;  3GD7 A;  4V19 0;  3IFD A;  1DGS A;  4V0B A;  2QGQ A;  1X6O A;  3KJP A;  3S15 H;  4C3J H;  4QB4 A;  3PO2 H;  5IYC G;  3F2D A;  5FLM G;  3MWY W;  3CMA A;  1Y1V H;  4XIG S;  3E6Z X;  2MFI A;  1DON A;  1V1Q A;  3HEJ A;  5EKK A;  2A73 B;  3NEN A;  4I65 A;  4DAY A;  4M1U B;  1LT6 D;  2K52 A;  2A5H A;  3S1Q B;  1C7Y A;  3NXW A;  2K14 A;  2VB2 X;  4KKU A;  1WTP A;  2F52 A;  1SE8 A;  2PQE A;  1PZK D;  1S5F D;  1XTC D;  3DM1 A;  3CCR A;  1EIG A;  4ID6 A;  3M4Y A;  2K6A A;  2D5D A;  3E3X A;  2PCF B;  1K8G A;  4ILW A;  1Q82 C;  2ZXR A;  3CAM A;  3T1H L;  1PMR A;  1TS3 A;  1C48 A;  2M2L A;  2IHF A;  3I3C A;  4HIO A;  3TRZ A;  4OEM B;  3M4P A;  1L2F A;  4BBS G;  1L0Y B;  1C8C A;  3RD4 A;  3CXC A;  2ZTC A;  4GLV B;  1B44 D;  1ET6 A;  1W6J A;  3E5S A;  4QQB X;  5FKA C;  5CV4 A;  3T1H Q;  5GAH C;  5LMN W;  1QVG A;  1PYS B;  3SEB A;  3TRE A;  3VYU A;  1ASY A;  1SYB A;  2AKW B;  3CW2 C;  3SK4 A;  1KAA A;  5C0X J;  2E74 C;  2SNS A;  4AQY L;  3WWV A;  1C9O A;  5LHY 1;  3PO3 H;  3AFP A;  1IXR A;  3NTH A;  2XWJ B;  4LF4 Q;  4EVO A;  4JG2 A;  4K2K A;  4S3S A;  1OTC A;  3K5N A;  2NN6 I;  1DYQ A;  4YWL A;  1ENF A;  1F77 A;  2DY8 A;  4KJO A;  4L8J A;  4GOP C;  2JN4 A;  2DY7 A;  1TII D;  3KF6 A;  4K6L A;  4OIJ A;  3FVQ A;  3DMU A;  1UE7 A;  5M5X B;  4LFA L;  2SDF A;  2KQ3 A;  4ZKB B;  4DA2 A;  4ODG A;  4XTC S;  3AFQ A;  1SFO H;  2Q2H A;  4DV2 L;  2KBN A;  5DLQ E;  1PXU A;  2WKC A;  1SR3 A;  4RGT A;  2CFM A;  1CHQ D;  2C5C A;  2R93 B;  2QKI C;  2YYZ A;  4LFA Q;  5CR3 A;  2AQ3 B;  4I7A A;  2RA4 A;  2CW0 D;  2KA7 A;  5E7N A;  3SGI A;  4C3I H;  4DV2 Q;  3X3M A;  3KYH C;  4DNT B;  4IPD A;  5AFW A;  3PIO A;  1Q8I A;  3EVQ A;  5IGD A;  1HUM A;  1CKN B;  5J22 A;  2WB1 E;  2HIV A;  3VR3 A;  2XSC A;  3TSS A;  4BY7 B;  2F0D A;  1O80 A;  2K5W A;  1B2T A;  3P20 A;  4EQN A;  3D3R A;  1RDP D;  2JA8 G;  4RHS A;  3PUX A;  1Q86 C;  4IUT A;  4JI3 Q;  4A3I G;  2M00 A;  1WJJ A;  1NMF A;  1JOO A;  3X3N A;  2I07 B;  3GTO H;  1DZ1 A;  2FMM A;  4UP7 A;  5IP9 H;  2QF7 A;  3WOE A;  3SK8 A;  4OWW B;  1U9R A;  2PYK A;  3HOW G;  1UUP A;  5AJ3 Q;  3E0E A;  1YI2 A;  2CWA A;  4IFD G;  3J81 i;  2LFN A;  3UDF A;  2RKS A;  2H1E A;  2QDB A;  4OX9 Q;  5FO9 B;  1A0I A;  2B2U C;  1F9S A;  1KDB A;  1IKM A;  1Q1B A;  1SYC A;  3GTJ B;  1HR0 L;  2A74 C;  3V96 A;  2UXB L;  3HP3 A;  2KCN A;  3NBH A;  4JBM A;  1TWH B;  1PFS A;  1D1I A;  3KDF A;  3EBE A;  5FJ8 H;  4A3K H;  2OF1 A;  3OIP A;  4B3M L;  4NDX A;  1K9M C;  2UU9 L;  1A3U A;  2NN6 H;  3BZD B;  2D0O A;  1HNX L;  2E2D C;  1SJE D;  2A68 C;  1UE5 A;  1HR0 Q;  2UXB Q;  3J80 i;  1M90 C;  4FVM A;  3KFU A;  3H0G B;  4ULL A;  5IOD A;  2WFW A;  4MTN A;  3MFY A;  2JA7 G;  1T5X D;  3ERO A;  4DXF A;  1EEI D;  1PZI D;  1RL2 A;  4P74 A;  4UY8 C;  1H9S A;  1U4L A;  2N3S A;  5IYB H;  1A3V A;  1KRT A;  3OHX C;  2IWH A;  2PZU A;  3FKI B;  2UU9 Q;  1M8A A;  1XTD A;  3A55 A;  4RKB A;  2DNE A;  3IL8 A;  1BBW A;  2IL8 A;  3Q6S A;  3MXN B;  4KN7 C;  1KNE A;  1EY7 A;  4H7B A;  2D2C C;  1Y69 U;  1CQV A;  3NE5 B;  1PTO F;  3CCV A;  2Z6B A;  4LFC L;  3A56 A;  1QG7 A;  1NR4 A;  3F2B A;  5C4J B;  2PQA A;  4A3G G;  3PF5 A;  1AP0 A;  1O7Y A;  5GRO A;  3JAM i;  2Q8T A;  1ZYR C;  4JOI C;  4O42 A;  3B6Y A;  5CV9 A;  1JE4 A;  2AQ1 B;  2VL6 A;  5GAD C;  3S16 B;  1RD9 D;  3TDQ A;  4WJ4 A;  3HOY G;  3S1Q H;  1DOM A;  3K58 A;  1EYG A;  1WTH A;  2G9D A;  5COY A;  2UXD L;  2EZV A;  1B9N A;  1GKH A;  4FO2 A;  2XRQ D;  1FVI A;  3KLR A;  1B50 A;  2FHT A;  3T51 B;  1YNN C;  5C0X G;  3H6M A;  5EJW A;  3HG9 A;  4DV5 L;  1X3P A;  2D9U A;  1TVX A;  5IOC A;  3RLO A;  1PLF A;  1B1Z A;  1SYG A;  5GQO A;  3F2U A;  1LLR D;  4LK1 C;  1RCV D;  3LWU A;  2UXD Q;  3EFX D;  4KD3 A;  2WAC A;  4FXD A;  4BBS B;  1N32 L;  4N8F A;  1B53 A;  3GTM B;  5FLX E;  2OXP A;  3ERQ A;  3E9I A;  5M3M G;  5DM6 3;  5A35 A;  5JOB A;  1QVF A;  1J9O A;  3T1Y Q;  4JW0 A;  3A54 A;  1N33 L;  2A68 D;  1UE6 A;  2WB1 G;  1WTW A;  3MTS A;  2MJ8 A;  2NTS A;  2LMC B;  4K14 A;  3U50 C;  4GKK Q;  5D14 A;  1N32 Q;  1A3T A;  2B3G A;  3VR6 A;  4BXX H;  3HKZ E;  1ILP A;  5JVG 3;  2L4N A;  3ONA B;  3G6J B;  4IUU A;  2OTJ A;  4CDD C;  4DNR B;  1I50 B;  4P71 A;  1QNU A;  1SJH D;  1BBX C;  5M5X H;  1AE2 A;  1C4Q A;  1CQF A;  2Z6K C;  3A0J A;  1VQL A;  4B9W A;  2SEB D;  2JP1 A;  1KDC A;  3SK6 A;  3K7A B;  3K5M A;  2UXC L;  2RF4 A;  4XXE A;  2F0L A;  1ILQ A;  2L9H A;  3SE0 A;  4DUZ L;  2ES2 A;  1CZG A;  1BQQ T;  2HDM A;  1LM0 A;  3J80 c;  1AE3 A;  4K2L A;  1N9W A;  2L1B A;  4DR4 Q;  1PH8 A;  1ZYR D;  4K5V A;  2B2V A;  1D6E C;  1IZ6 A;  4QIW E;  4R9W A;  1ESF A;  3RZD B;  4A3F G;  3FPU B;  2E76 C;  2KOL A;  3OSO A;  4X62 L;  2UUB Q;  4B3R Q;  2NB0 A;  5I2X A;  3H94 A;  4ZRZ A;  1E2V A;  1U4R A;  3LWE A;  2VW9 A;  4GOP B;  1MSG A;  4JYA L;  1XWE A;  3RZO B;  3T4A C;  3S17 B;  2SNM A;  1PH9 A;  1V8Q A;  4BY7 H;  5ELB A;  1WCM G;  1X56 A;  2RCN A;  1X3E A;  3W3A A;  3HOU G;  1K73 C;  1NCV A;  5JEA J;  2JA8 B;  3DWA A;  3QR8 A;  1UEA B;  1X65 A;  2WAQ E;  2I46 A;  1BUV T;  1EZ8 A;  4DR2 Q;  2FFK B;  5EGT A;  1BF4 A;  2A6H C;  2HUG A;  2ICE C;  1GOZ A;  1LTR D;  3QOL A;  2PW7 A;  4JYA Q;  5FLX L;  3HOW B;  4A3D G;  4RGM A;  5C4Z A;  1CSQ A;  1I6H B;  1WTX A;  3J81 j;  1STA A;  3MXU A;  4LAA A;  4JI8 L;  4CKC A;  2NVQ B;  3QB3 A;  4YWK A;  3S1M B;  1YBY A;  4EQO A;  1VQP A;  2EYM A;  1BO0 A;  4LUZ A;  3G71 A;  2GVB A;  4PZ8 A;  2EQS A;  4DAM A;  2OCE A;  1HH2 P;  1LTT D;  3VYT A;  3GTJ H;  2R92 G;  1XNQ L;  2L5T A;  2B2W C;  3ITP A;  3K80 C;  1FL0 A;  3G48 A;  4RAU C;  1OO9 B;  1TWH H;  1CKN A;  1D1K A;  1JOR A;  3STB C;  2MHV A;  3JC6 6;  1STH A;  2SOB A;  1NY4 A;  4DR5 L;  1FGU A;  4HIK A;  1JIC A;  2KCC A;  3L9A X;  5IYD G;  1EY5 A;  3BJU A;  5EBC A;  5CMD A;  4GKJ L;  3QJY A;  1N34 L;  1IBM L;  2F3W A;  3H0G H;  3C1E A;  3GDE A;  3J7Y W;  4A3M G;  5T1I A;  2JA7 B;  5CV8 A;  3F8T A;  4L5R C;  1X55 A;  3NEL A;  5T1G A;  2MNA A;  5G3L D;  1SNQ A;  1CKM A;  1STN A;  4DR5 Q;  3FKI H;  4NB3 A;  4OGQ C;  2K7V A;  5EPK A;  1ASZ A;  3CP0 A;  2BDO A;  1PH4 A;  1I4H A;  3LNN A;  3CCS A;  4GKJ Q;  1Q81 C;  3Q0A A;  4EQP A;  1IBM Q;  1STB A;  4A3C G;  2R7D A;  3EN2 A;  2JXM B;  5CBE E;  5C3E G;  1SEB D;  5C4J H;  3DXJ C;  4UDU C;  4A3G B;  1RTO A;  3S1R B;  3G4S A;  5FLM H;  1SYE A;  3HKZ G;  1QZH A;  1STE A;  1X32 A;  1PH7 A;  2O5J C;  4BBR G;  1G29 1;  1QUQ B;  2CQA A;  3S16 H;  2A6H D;  3HOX G;  3HOZ G;  1EY0 A;  4RKL A;  4ZAI A;  2I5H A;  4HMJ A;  4MZ9 A;  2IT1 A;  4A4I A;  1STG A;  2NUC A;  2RDG A;  5M9O A;  1PYW D;  3RR5 A;  1GUW A;  2A8V A;  3HFZ B;  4KI0 A;  3GTO B;  3NSW A;  1YHQ A;  1YEZ A;  4AYB E;  2IX0 A;  1K8A C;  2J4X A;  3D6C A;  3MXN A;  1NAP A;  5KRU A;  1G2S A;  2UUA Q;  3OOC A;  1CUK A;  4GN5 A;  3M4Q A;  1GUT A;  3MZ5 A;  4BBS H;  1L1O C;  1R9T B;  1VQ6 A;  4IFD I;  5M5W B;  2B2Y A;  3STB D;  3GTM H;  1PH1 A;  3UDX A;  5M3M B;  3CPW A;  1F9R A;  2K05 A;  4DAP A;  2ASB A;  1CHP D;  4XDX A;  3LX0 A;  5K5P A;  2JK8 A;  5CGK A;  4KN4 C;  2EYF A;  1F9Q A;  1FD7 D;  4K8J A;  2WB1 B;  1BNZ A;  4POG A;  3NQI A;  4PZ6 A;  1Q12 A;  1A8V A;  1TY0 A;  1QNK A;  2F0O A;  1ZXT A;  3MVV A;  1IYV A;  4KLK A;  4JI0 L;  2BE5 C;  4A3K B;  3M4O B;  3DEO A;  2WAQ G;  1K8O A;  5KEE A;  1G6Z A;  1EOT A;  1KAB A;  1EU3 A;  2B63 G;  1I50 H;  2M9V A;  5KGU A;  1LTG D;  3IFT A;  4A3L G;  2EPB A;  5JJZ A;  1Z9F A;  2F4V L;  1WVL A;  3CQZ H;  3PCO B;  1BCP F;  3HZX A;  1VQE A;  1PZJ D;  1S3O A;  2VZA A;  3K7A H;  4JI0 Q;  3KLS X;  3T53 B;  1TU2 B;  1I5F A;  2R61 A;  2K28 A;  4FF1 A;  4FP5 D;  1YJW A;  1KNA A;  4R4O A;  1S5C D;  4ABN A;  5JEA G;  4ZCK A;  2JA5 G;  2B2T C;  1UWV A;  4Z9C B;  1QIL A;  2IPK D;  2K5D A;  1S40 A;  1D5M C;  1V1O A;  2AWO A;  2F4V Q;  3I90 A;  2A1A A;  3PV0 A;  4JI7 L;  1SXT A;  3RZD H;  2KEE A;  3RLF A;  4A3F B;  1SYD A;  1RF2 D;  4QGU A;  1SN8 A;  3VYR A;  3PIO 3;  5EAY A;  1PRT F;  1VQH A;  1HUN A;  5EKI A;  1IHZ A;  2V4D A;  1PHJ A;  2KEN A;  1T9H A;  2Y0S E;  2YTV A;  5D3D A;  4PMW A;  2N49 A;  2CW0 C;  3RZO H;  3BDL A;  3S17 H;  3L2P A;  4JI7 Q;  1KIX A;  2HCC A;  2XIW A;  4NKL A;  1N36 L;  3HOU B;  2JA8 H;  4BWG B;  2RDH A;  2X6G A;  1EFW A;  4A3I H;  5C0X I;  3TN2 A;  5FOB B;  5HGQ A;  3M7N A;  5C3W A;  3D0F A;  4CDF C;  1XXG A;  4H13 C;  2XRS D;  3SR1 A;  2KCM A;  3K81 C;  2XWB B;  2EVB A;  3HOW H;  4A3D B;  5KIX A;  2F0V A;  3R2T A;  1I6H H;  1YHB A;  5CC4 A;  4IFD H;  5KNB A;  4HSP A;  2QA4 A;  4YWM A;  1N36 Q;  2NVQ H;  3J80 E;  4DV7 L;  2BE5 D;  1TS2 A;  3S1M H;  3FPP A;  3S24 A;  1CA6 A;  1WD1 A;  4HCE A;  2F0P A;  5E4W C;  2B29 A;  2ZJR A;  3GTG B;  5BN4 A;  3NTI A;  3QIA A;  4C56 C;  1A15 A;  2R92 B;  4CJ2 C;  2K32 A;  2B8F A;  3OW2 A;  1CTM A;  1DM0 B;  2HD3 A;  5HY6 A;  5M3F G;  4DR7 L;  4GOP A;  3CRK C;  3RN2 A;  1WFQ A;  1HTL D;  1BXT A;  4DV7 Q;  2K04 A;  3KOJ A;  2JA6 G;  2R7F A;  1J6Q A;  1NMG A;  3FMC A;  3K8A A;  3I4M G;  4HN7 A;  4DV6 L;  5FO7 B;  2PZW A;  3RN5 A;  5NUC A;  3ULL A;  2RDF A;  4AYB G;  1RIP A;  3MXP A;  4KKT A;  5K36 G;  4DR7 Q;  1VF5 C;  4A3M B;  2JA7 H;  1U5K A;  1LAB A;  4AQY Q;  2R7Z G;  3E9H A;  4WOR A;  4HID A;  4X3U A;  2KJX A;  1GD7 A;  1JWS D;  3A8I E;  4XYQ A;  1JE5 A;  1WTV A;  3K0X A;  1I94 L;  1YZ6 A;  2EJM A;  2WIN B;  3RNU A;  2P5Z X;  5C5M A;  2K03 A;  5J1Z A;  4KK7 A;  3J7A 5;  2QIL A;  4OEL B;  1EWC A;  4O0A A;  3ND9 A;  4C3H G;  5C3E B;  2H4O A;  4BY1 G;  1IYU A;  1EFI D;  5FO8 B;  2MPM A;  5EBD A;  3S1R H;  4A3G H;  3CRL C;  4BBR B;  3KUP A;  1VQ4 A;  1W6K A;  1TWF B;  2A6E D;  1I94 Q;  3OPO A;  3U58 A;  4KV6 A;  1ZKO A;  3K5O A;  4L63 B;  3HOY H;  3HOZ B;  2XTI A;  3KBX A;  1NE3 A;  3DWP A;  1PVO A;  1V1P B;  1X3Q A;  5CBA E;  4FDB A;  1E2Z A;  1VQC A;  2F0T A;  4LNQ A;  3GP7 A;  5C0X H;  3CCE A;  3H09 A;  1GHK A;  4WFN 3;  3OWF A;  3DM3 A;  3D4D A;  2R3Z A;  3A8J E;  1HZA A;  1AN8 A;  2B2U A;  4RGN A;  1XNR L;  2NZO A;  5ELO A;  2FIN B;  1KD1 C;  4G7O C;  2VNU D;  1BDO A;  1EU4 A;  3GTP B;  2JEB I;  2OEO A;  4RG1 A;  1R9T H;  4I7Z C;  1VQ9 A;  1L0X B;  3ER0 A;  5IP7 H;  5M5W H;  3MXG A;  5M3M H;  4FNF A;  1SNC A;  5KYI A;  1VQK A;  1R4P B;  1XNR Q;  1LYL A;  2YTY A;  3I4N G;  5CYU A;  2Y0S G;  2HQL A;  3S1N B;  1QUQ A;  1SYF A;  4DKA C;  5LMN L;  4B3T L;  4UAI A;  2F0W A;  2LXJ A;  4APV A;  3QO2 A;  3M4O H;  1PFN A;  1VQ7 A;  3VA7 A;  5JJL A;  4KHZ A;  1G2T A;  2F3I A;  2Z4H A;  1YIT A;  2OQK A;  5IT9 c;  1K83 B;  2J0T D;  2B63 B;  4GS3 A;  4EQ5 A;  1GXD C;  1NTG A;  5BN3 A;  2F0N A;  2PNH A;  2HQE A;  1JB7 A;  5ELF A;  3BYT B;  3K6O A;  4LUV A;  1AFP A;  2FXQ A;  4NXN L;  1H9M A;  1EZ6 A;  1EWI A;  1L1O B;  1ENA A;  4X65 L;  1JWM D;  1JT8 A;  4B3M Q;  1HNX Q;  3GTQ B;  3H3V C;  2HHH L;  4YCU A;  3ZJY C;  5EPJ A;  2JA5 B;  4DGZ A;  4QCL A;  2KHI A;  4JOI A;  1VQJ A;  3ICE A;  4ME3 A;  4GNX C;  2JEA I;  1MBY A;  2EJF C;  5EPL A;  4A3F H;  2UUC L;  4NXN Q;  3CC4 A;  4U68 A;  1ONL A;  1KQS A;  1KHI A;  4LF7 L;  3IAY A;  1E22 A;  4J1M A;  2OTL A;  3GQB A;  1DOL A;  3I56 A;  2EOT A;  1MGS A;  5TSS A;  4DV1 L;  1EL0 A;  2NVY B;  1L0W A;  1BKB A;  1IL8 A;  1UEB A;  4JC0 A;  4LFC Q;  2F0G A;  3I4L A;  2ZTE A;  3BVM A;  2UUC Q;  1HPC A;  5IGC A;  1SE4 A;  3M3Y B;  1CSP A;  1ENC A;  3HOU H;  1XX8 A;  4DV0 L;  5IGB A;  2XNA C;  4B3S L;  1KTK A;  2EY1 A;  1GUS A;  1TXY A;  1B9M A;  1SNP A;  3CPF A;  5I6W A;  3I4O A;  4ALP A;  1LTI D;  1RKN A;  3AYH B;  1PH6 A;  2MUY A;  1VQN A;  4A3D H;  3W5O A;  3IRB A;  3M7G A;  1YJN A;  1PDQ A;  4XT1 B;  1OXU A;  4MN3 A;  2JYO A;  2YU9 B;  1T5E A;  1HA5 A;  2ZM6 L;  4DV5 Q;  1HNW L;  4QJF A;  3R93 A;  1D2B A;  3GTG H;  1Z7T A;  4HJA A;  2R92 H;  1X54 A;  2EYJ A;  4PZ7 A;  1PV4 A;  2G5D A;  2VQE L;  2NZH A;  3J81 c;  2D62 A;  2K5V A;  4IUP A;  4A3B G;  2F0M A;  3Q24 A;  2ZTD A;  1X9N A;  4EGV A;  1B7Y B;  1JMC A;  2GN5 A;  2RSO A;  2X69 A;  5D3I B;  4L5T A;  1X3F A;  1V9P A;  2Z6K A;  4ZK9 B;  1WOC A;  1ZEQ X;  2JA6 B;  2VXW A;  2VQF L;  3CHB D;  1TWA B;  4X6A H;  1HNW Q;  4ZQ3 A;  3HOV G;  3I4M B;  2DN8 A;  1KLG D;  5D65 A; 
#chains in the Genus database with same CATH homology
 1A62 A;  3CP0 A;  3CCU A;  1ASZ A;  1PH4 A;  3K7U C;  2MFI A;  3CCS A;  4NXM L;  1N33 Q;  4GKJ Q;  1V1Q A;  2E2H H;  1Q81 C;  3NEN A;  1IBM Q;  4A3B H;  2K52 A;  1Y1W G;  4A93 G;  4A3M H;  1C7Y A;  3VDY A;  4A3C G;  2R7D A;  3EN2 A;  1Q7Y C;  2K14 A;  2BA0 A;  2F52 A;  4YCW A;  1SE8 A;  5C3E G;  3CCR A;  5C4J H;  3W1B A;  3G4S A;  2VQF Q;  4O2D A;  5FLM H;  1P8L A;  3HOV H;  3HKZ G;  1QZH A;  1PH7 A;  4JI6 L;  4BBR G;  2N8N A;  1X3G A;  4GLX A;  1K8G A;  1Q82 C;  1G29 1;  3CAM A;  2K4K A;  1QUQ B;  3T1H L;  3PUY A;  4NXM Q;  3S16 H;  1LUZ A;  5BR8 L;  3A74 A;  3GTL H;  2IHF A;  3HOX G;  3GO5 A;  1Y1W H;  4A93 H;  3HOZ G;  2ALY B;  4OON A;  4HIO A;  4AH6 A;  4A3C H;  3TRZ A;  2I5H A;  5LMU L;  4HJ5 A;  4GNX A;  5C3E H;  2MO1 A;  1OXT A;  1L2F A;  3M4P A;  5LMN Q;  1YNX A;  4BBS G;  2UXC Q;  4MZ9 A;  2IT1 A;  4A4I A;  4B3T Q;  3PO3 G;  4DUZ Q;  4POF A;  2GVA A;  3CXC A;  2ZTC A;  4GLV B;  3RR5 A;  2A8V A;  4GN4 B;  4HJ7 A;  3HFZ B;  4BBR H;  4JI6 Q;  4OO1 G;  4QQB X;  4KI0 A;  1EIF A;  1TWF H;  4R4T A;  1YHQ A;  1YEZ A;  3T1H Q;  5GAH C;  4AYB E;  1KL9 A;  5LMN W;  1QVG A;  1MKH A;  5BR8 Q;  2IX0 A;  1PYS B;  1K8A C;  3CME A;  1BVS A;  3TRE A;  1ASY A;  2AKW B;  2UUA Q;  4YCV A;  3HOZ H;  3CW2 C;  1IBK L;  5C0X J;  5LMU Q;  1CUK A;  4AQY L;  3WWV A;  2R6G A;  4GN5 A;  3M4Q A;  3A5Z B;  3JAM c;  4BBS H;  1L1O C;  1VQ6 A;  1C9O A;  4IFD I;  4X62 Q;  3AFP A;  3STB D;  3GTM H;  3Q8D A;  1IXR A;  4DUY L;  1PH1 A;  3PO3 H;  4LF4 Q;  3UDX A;  4X65 Q;  3CPW A;  4JG2 A;  4OXP A;  2VS1 A;  1OTC A;  2EXD A;  2NN6 I;  2HHH Q;  2ASB A;  4YWL A;  2JK8 A;  2WP8 J;  1MIU A;  4H02 A;  4GOP C;  3KF6 A;  1H95 A;  3KF8 B;  4POG A;  1UE7 A;  2DUD A;  4LFA L;  4PZ6 A;  3J7Z C;  1Q12 A;  1A8V A;  3AEV A;  1VQF A;  1IBK Q;  1YVC A;  4XTC S;  3AFQ A;  1SFO H;  1WCM H;  2Q2H A;  4KLK A;  4DV2 L;  4JI0 L;  2KBN A;  3GTP H;  5DLQ E;  4LF7 Q;  4PG3 A;  4TVA B;  4DUY Q;  1SR3 A;  2WAQ G;  2CFM A;  2HT1 A;  4DV1 Q;  4K0K L;  5IY0 A;  2B63 G;  1KC8 C;  1I50 H;  2YYZ A;  4IJL A;  3S1N H;  4A3L G;  4LFA Q;  4QL5 A;  1Z9F A;  1TWC H;  2CQO A;  4MNO A;  2F4V L;  3CQZ H;  3PCO B;  1E3P A;  3U4Z A;  5E7N A;  3SGI A;  4C3I H;  1VQE A;  3K7A H;  1S3O A;  2VZA A;  4AIM A;  4DV2 Q;  2DGY A;  4JI8 Q;  4JI0 Q;  3KYH C;  4DV0 Q;  4IPD A;  3PIO A;  4B3S Q;  1I5F A;  1OXS C;  1PA6 A;  3F1Z A;  3S2H H;  4IPH A;  1YJW A;  4R4O A;  1G6P A;  4JCV E;  3I55 A;  3F2C A;  1K83 H;  5JEA G;  3T1Y L;  5GAE C;  2JA9 A;  3PIP A;  1XNQ Q;  2B63 H;  2JA5 G;  4K0K Q;  1UWV A;  1CKN B;  1VQB A;  4DK3 C;  2H5X A;  2WB1 E;  2HIV A;  5IP9 G;  4A3L H;  3M85 A;  1S40 A;  1QZG A;  2BH2 A;  2AWO A;  2F4V Q;  2A1A A;  3PV0 A;  4JI7 L;  3H15 A;  1XPU A;  3RZD H;  3RLF A;  4GKK L;  1IL2 A;  1KRS A;  4QGU A;  1SN8 A;  4HIM A;  1KXL A;  1HJP A;  5IP7 G;  2BA1 A;  3G6E A;  2IY5 B;  5EAY A;  2JA8 G;  3CC7 A;  3PUX A;  1Q86 C;  4JI3 Q;  4A3I G;  1WJJ A;  1NMF A;  4LW1 A;  3U4V A;  3KJO A;  2ZM6 Q;  1VQH A;  3GTQ H;  1WYD A;  3GTO H;  3BZK A;  1PHJ A;  5IYD H;  4UP7 A;  2KEN A;  2JA5 H;  1T9H A;  2ZJQ A;  4JI1 L;  2LSS A;  1SLJ A;  2Y0S E;  2YTV A;  3BZC A;  4PMW A;  5IP9 H;  2VQE Q;  2N49 A;  1N34 Q;  2L15 A;  3S2D H;  4OWW B;  3UE0 A;  3RZO H;  3HOW G;  3S17 H;  3L2P A;  4JI7 Q;  1KIX A;  5AJ3 Q;  3E0E A;  1YI2 A;  1VQM A;  2CWA A;  3TS0 A;  2YV5 A;  3UE1 A;  4IFD G;  3J81 i;  1VQO A;  1N36 L;  3UDF A;  4JI4 L;  3UDI A;  2NVT H;  5FJ8 G;  2I5M X;  2JA8 H;  4A3K G;  5IYC H;  1EFW A;  4A3I H;  4OX9 Q;  2OWO A;  1A0I A;  2NN6 G;  5C0X I;  4L5Q A;  5HGQ A;  3M7N A;  4DR4 L;  3D0F A;  4DAY B;  1Q1B A;  2V1C C;  1HR0 L;  2R93 G;  3CF5 A;  3FHW A;  5ELN A;  2UXB L;  2NVY H;  4JI1 Q;  1FJG L;  1D7Q A;  4DV4 L;  4JBM A;  2KCM A;  3K81 C;  4TQU S;  5C44 G;  3HOW H;  4X66 L;  1PFS A;  4RMF A;  1HZB A;  3A5U A;  4R4I A;  1I6H H;  1YHB A;  3KDF A;  4P72 A;  2QA4 A;  4YWM A;  3EBE A;  1N36 Q;  2E2J H;  4JI4 Q;  2NVQ H;  3M3Y H;  1IBL L;  5IYB G;  2UUB L;  1EQQ A;  5FJ8 H;  1OXX K;  3CCM A;  4DV7 L;  3S1M H;  4A3K H;  4DR6 L;  4B3R L;  3S24 A;  4B3M L;  4DR1 L;  1K9M C;  2UU9 L;  1L1O A;  1HNX L;  2D0O A;  2B29 A;  2ZJR A;  3NBH B;  1OXV A;  3BU2 A;  1UE5 A;  1HR0 Q;  1EIY B;  2R93 H;  4J15 A;  1SRU A;  2AMC B;  2UXB Q;  3J80 i;  1M90 C;  3KFU A;  4DV4 Q;  1WI5 A;  3OW2 A;  3PSI A;  5HY6 A;  3KDF B;  5C44 H;  2RHS B;  3HOX H;  5M3F G;  2WFW A;  4GNX B;  4MTN A;  4GOP A;  2I0Q A;  2JA7 G;  4UY8 C;  1RL2 A;  4P74 A;  1WFQ A;  3RN2 A;  2CCZ A;  2K75 A;  2N3S A;  5IYB H;  1IBL Q;  2ID0 A;  4DV7 Q;  2YU9 H;  3KOJ A;  1KRT A;  4A75 A;  1PYB A;  2JA6 G;  2R7F A;  1J6Q A;  1NMG A;  3MEF A;  4DR1 Q;  2UU9 Q;  3ERS X;  1XTD A;  3K8A A;  1QVC A;  3I4M G;  4DR2 L;  4DV6 L;  1BBW A;  5GAG C;  4UP9 A;  4L5S A;  3MXN B;  3RN5 A;  1VS0 A;  2PI2 A;  3AQQ A;  3ULL A;  4AYB G;  4KHP L;  1RIP A;  5K36 G;  3CCV A;  2MO0 A;  5M3F H;  4DR7 Q;  4LF6 L;  4LFC L;  1E24 A;  2JA7 H;  1U5K A;  1N8R C;  1LTL A;  4AQY Q;  2R7Z G;  1EOV A;  3E9H A;  4NPS A;  2AWN A;  2LXK A;  3F2B A;  4HID A;  2PQA A;  2E5L L;  2JA6 H;  4A3G G;  3PF5 A;  1GD7 A;  1TWA H;  5GRO A;  3JAM i;  3GTK H;  3I4M H;  1JE5 A;  3KF6 B;  4JOI C;  4R4Q A;  2MQH A;  3B6Y A;  1GO3 E;  3K0X A;  2IX1 A;  4HJ8 A;  1I94 L;  1O7I A;  1YZ6 A;  2VL6 A;  5GAD C;  1HNZ L;  4KHP Q;  3RNU A;  4WJ4 A;  4LF6 Q;  3HOY G;  3S1Q H;  4DR7 L;  1J5E L;  4JI2 L;  1EYG A;  2UXD L;  3J7A 5;  1PH3 A;  2R7Z H;  1GKH A;  4O0A A;  1G51 A;  1FVI A;  4OWX B;  4BY1 G;  4BA2 I;  2E5L Q;  4A3G H;  4UPA A;  2CKZ B;  4DV3 L;  3S1R H;  1SRO A;  2PMZ E;  5C0X G;  3W1G A;  1C0A A;  4DV5 L;  1V43 A;  3PGZ A;  1VQ4 A;  2VUM G;  1K3R A;  3RLO A;  1I94 Q;  1HNZ Q;  3U58 A;  5GQO A;  3H0G G;  4IPC A;  3I2Z A;  3HOY H;  4A3E G;  1VCI A;  3I7F A;  2XTI A;  3OTO L;  2UXD Q;  4JI5 L;  1NE3 A;  3EIV A;  2K50 A;  1XPO A;  4IO9 A;  1BBU A;  4C3H H;  1YIJ A;  1W2B A;  1N32 L;  1PVO A;  4BY1 H;  2RHQ B;  4FDB A;  2KHJ A;  4DV3 Q;  4BXX G;  1VQC A;  3E9I A;  5M3M G;  3CCE A;  4LNQ A;  2AHO B;  4BA1 I;  1HZC A;  2PI2 E;  3NEM A;  1QVF A;  3DM3 A;  2VUM H;  2Z0S A;  3T1Y Q;  5C4X G;  1N33 L;  1GVP A;  1HZA A;  1XNR L;  4X64 L;  1UE6 A;  2NZO A;  2WB1 G;  4YY3 L;  5ELO A;  1KD1 C;  4A3E H;  4GLA C;  1VQD A;  4DR3 L;  1VQG A;  3S14 H;  2EIF A;  4P73 A;  3U50 C;  3OTO Q;  2VNU D;  1XMO L;  4GKK Q;  1N32 Q;  2JEB I;  4LF9 L;  4WJ3 M;  4QY7 A;  2JE6 I;  4RG1 A;  1R9T H;  1XMQ L;  2B3G A;  1VQ9 A;  3ER0 A;  5IP7 H;  5M5W H;  4BXX H;  5M3M H;  3CC2 A;  1IYJ B;  3HKZ E;  4IPG A;  3CD6 A;  3PUW A;  2OTJ A;  2E8G A;  5C4X H;  3H3V I;  1VQK A;  4JBK A;  1LYL A;  2YTY A;  4P71 A;  4X64 Q;  1XNR Q;  1B70 B;  3I4N G;  2Y0S G;  2HQL A;  1XJV A;  5M5X H;  1AE2 A;  1QUQ A;  2Z6K C;  3A0J A;  4YY3 Q;  4Y7N H;  1VQL A;  1Y14 B;  4DR3 Q;  3FP9 A;  1AH9 A;  1XMO Q;  4DKA C;  1MJC A;  1JJ2 A;  4LF9 Q;  5LMN L;  4YHH L;  3UDG A;  1XMQ Q;  2UXC L;  2RF4 A;  4B3T L;  1E7Z A;  2D0P A;  4DUZ L;  2ES2 A;  2LXJ A;  4APV A;  3J80 c;  4JBJ A;  3M4O H;  4GN3 B;  1AE3 A;  1VQ7 A;  2HIX A;  2ATW A;  5JJL A;  1N9W A;  4KHZ A;  2F3I A;  1YIT A;  4DR4 Q;  4JV5 L;  2OQK A;  4LUO A;  5IT9 c;  1XPR A;  1PH8 A;  1W3S A;  3I4N H;  4GS3 A;  4EQ5 A;  1FJG Q;  1NTG A;  2PNH A;  1IZ6 A;  4QIW E;  1JB7 A;  3CCJ A;  4X66 Q;  2UUA L;  3D31 A;  1GM5 A;  4DK6 C;  4LUV A;  4A76 A;  4LF5 L;  2FXQ A;  4BY7 G;  4OWT B;  1VQI A;  2IHE A;  3PUZ A;  4NXN L;  4UP8 A;  1TWG H;  3L0O A;  4IJH A;  4C2M H;  2Q2U A;  4YHH Q;  1EWI A;  1L1O B;  1HR0 W;  4X62 L;  2UUB Q;  2A19 A;  5IWA L;  4DR6 Q;  4B3R Q;  4LF4 L;  4X65 L;  3TEH B;  2OQ0 A;  1JT8 A;  4B3M Q;  1P16 A;  1NJI C;  1HNX Q;  1K0R A;  1JJG A;  2E2I H;  1Q46 A;  2HHH L;  4JV5 Q;  4EX5 A;  4YCU A;  3ZJY C;  2VW9 A;  2KHI A;  4GOP B;  1EUJ A;  4JOI A;  1VQJ A;  3PUV A;  2KCT A;  2CWP A;  3HKS A;  3ICE A;  4JYA L;  1E1T A;  4ME3 A;  4GNX C;  2JEA I;  1PH9 A;  4LFB L;  4DNI A;  4LF5 Q;  4BY7 H;  1VQA A;  4IOC A;  4A3F H;  2UUC L;  4NXN Q;  3CC4 A;  1WCM G;  1X56 A;  2RCN A;  1KQS A;  1KHI A;  1X3E A;  4LF7 L;  2Q2T A;  3HOU G;  5IWA Q;  1E22 A;  1K73 C;  1D8L A;  2I5L X;  5JEA J;  2OTL A;  1JJC B;  1X65 A;  2WAQ E;  3I56 A;  3DLL A;  3CCQ A;  4DR2 Q;  4DV6 Q;  4DV1 L;  1UE1 A;  3TQY A;  1I3Q H;  3KLW A;  4JYA Q;  1L0W A;  1BKB A;  3ULP A;  1UEB A;  4JC0 A;  1E1O A;  4LFC Q;  4A3D G;  4LFB Q;  2N78 A;  2ZTE A;  1CSQ A;  2PQA B;  1PH5 A;  2UUC Q;  3PF4 A;  1U0L A;  3J81 j;  1M1K C;  1CSP A;  4JI8 L;  2JQO A;  2ZJP A;  3HOU H;  1S72 A;  5JJK A;  4DV0 L;  4IOA A;  1CKO A;  1MJE A;  4YWK A;  4B3S L;  2K5H A;  1YBY A;  1VQP A;  4A3J G;  2C35 B;  1VQ8 A;  4LUZ A;  3L7Z C;  1TXY A;  3G71 A;  3M9B A;  5IE8 A;  3CPF A;  2GVB A;  4PZ8 A;  1SMX A;  2EQS A;  3I4O A;  4DAM A;  2OCE A;  1HH2 P;  1KAW A;  3OYY A;  2YTX A;  5J3B A;  2NVX H;  3GTJ H;  4OO1 I;  2R92 G;  1A63 A;  4HJ9 A;  4ALP A;  4A3F G;  1XNQ L;  2VY3 A;  4R1J A;  3K80 C;  4IFD J;  1FL0 A;  3AYH B;  3G48 A;  1PH6 A;  1VQN A;  1TWH H;  5M5Y H;  1PH2 A;  3W5O A;  4A3D H;  3CCL A;  3IRB A;  1J5E Q;  5JJI A;  1CKN A;  4JI2 Q;  1YJN A;  1EQR A;  4LWC A;  2Q2I A;  1VQ5 A;  4LF8 L;  4JBW A;  1Q8K A;  4P75 A;  3STB C;  1OXU A;  2BH8 A;  1Q1E A;  3JC6 6;  1NY4 A;  2XGT A;  3LGJ A;  4A3J H;  4DR5 L;  3PO2 G;  1FGU A;  4JI3 L;  3FKI G;  4HIK A;  2ZM6 L;  4DV5 Q;  1HNW L;  2JJQ A;  5FLX c;  4QJF A;  4DPG A;  3GTG H;  1Y1V G;  1YJ9 A;  3H3V H;  1Z47 A;  4HJA A;  3TS2 A;  1NBW A;  5IYD G;  2R92 H;  1X54 A;  3BJU A;  4GKJ L;  4PZ7 A;  1PV4 A;  1N34 L;  2K5N A;  2VQE L;  2NZH A;  5H1S E;  3H0G H;  2D62 A;  2K5V A;  3J81 c;  1IBM L;  2QEX A;  4A3B G;  3ULJ A;  4Y52 H;  1HZ9 A;  2ZTD A;  3GDE A;  3RLN A;  1X9N A;  1B7Y B;  4A3M G;  1JMC A;  5AJ3 L;  2GN5 A;  4JI5 Q;  4LF8 Q;  3F8T A;  3GD7 A;  4L5R C;  1X55 A;  3NEL A;  4L5T A;  1X3F A;  1V9P A;  1YHA A;  2Z6K A;  4R4C A;  2MNA A;  1DGS A;  1WOC A;  1B8A A;  2QGQ A;  1X6O A;  3KJP A;  3S15 H;  4C3J H;  2VQF L;  1CKM A;  5IYC G;  3F2D A;  4DR5 Q;  3PO2 H;  3FKI H;  5FLM G;  4NB3 A;  4OX9 L;  4X6A H;  1HNW Q;  3HOV G;  1LM0 A;  3CMA A;  1Y1V H;  4XIG S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...