2Y0SG

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
110
structure length
110
Chain Sequence
QEIILSCEINSIERGSLKNLSIIHMSCNDFNISFDIIDSINIFSQKEKVKAFISKNRLSYTNDDFCGHGYIVTELKDSSSNNGNRYITIISLFGLLVKIISNKESFLKIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 14
structure length 110
sequence length 110
chains with identical sequence V
ec nomenclature
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF16992 RNA_pol_RpbG DNA-directed RNA polymerase, subunit G
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2y0sG00
3E0EA 3CMAA 4DR6L 4DR2Q 3B6YA 5C4JH 1HNZL 3GO5A 3I4OA 1HNXQ 4DUZL 1Q82C 1Z9FA 2AWNA 2KHJA 4FDBA 4JI6L 1HR0L 4A3DH 2VNUD 1SLJA 2JK8A 3JC66 5M3MH 1E1TA 4HJAA 1A62A 3PUZA 3PO2H 1SR3A 3HOYH 1KL9A 4DNIA 4HJ9A 2D0OA 3OTOQ 3G71A 5C0XG 2QEXA 2HHHQ 3FKIG 3VDYA 3ICEA 1A63A 5IE8A 3K8AA 1TWGH 5IT9c 3CC2A 4LF6L 3U4ZA 3PUWA 1C9OA 1L2FA 4LW1A 4B3MQ 4PZ7A 3EIVA 5DLQE 1VCIA 1B70B 2RHSB 3NBHB 4BXXH 5JJKA 4QY7A 1PFSA 2WB1G 1CSQA 1L0WA 2E5LQ 1EWIA 1ASZA 3S15H 1QZGA 2NN6I 4A3KG 1IBMQ 2EXDA 3CPWA 2VUMG 2PMZE 1PHJA 1FJGQ 4C3JH 3KDFB 3GTGH 1D7QA 2NN6G 2EQSA 4A3BH 4A4IA 4BY7G 4AH6A 2K5HA 4A3EH 1SRUA 1I6HH 2I5LX 2K52A 1QUQB 4LF5L 1V9PA 5M5YH 4RG1A 4X62L 1E7ZA 1I94L 1LTLA 2WAQG 1KC8C 4R4QA 1U0LA 5FLMG 1CKMA 2JA6H 2Q2UA 1IL2A 3U50C 2NZOA 4DR5L 1IBLQ 1HZBA 4X6AH 3AFPA 1PYBA 5JEAJ 3GTJH 5BR8L 2B3GA 4LFAQ 2N78A 1CKNB 1Q7YC 2I5MX 2JA6G 2QGQA 2BH2A 4NXNQ 2JEAI 5FLXc 3TEHB 1I5FA 2ATWA 2E2HH 3HKSA 4JBJA 1N33L 4IJLA 2VW9A 1Q8KA 4IO9A 1Y14B 4BY1G 4A3BG 4GKKL 4JV5Q 5M3FG 1YITA 4A3MH 4B3RQ 1GD7A 3PO3G 4DKAC 1CSPA 1MKHA 4R4OA 4BBRH 4GLXA 1HNZQ 3EN2A 1JJ2A 4DUZQ 4IPCA 1N32Q 4GN5A 2MO1A 1OXVA 4AYBE 1AE3A 1AE2A 1UWVA 1PH4A 3H0GG 2OTJA 1YBYA 4K0KQ 2R93H 1S72A 1PH9A 1HJPA 3HOZG 4JG2A 4DV3L 4C3HH 4GOPB 4WJ3M 3PUXA 2HHHL 2GN5A 3PO3H 4A3MG 3UE1A 3T1YL 5IYCG 3M4PA 4A3LH 3EBEA 1YJNA 1VQ7A 1GVPA 2KENA 5GADC 1X3GA 4JI7L 2PQAA 4YWLA 4B3ML 3J81c 4AQYL 3RR5A 4YY3Q 4OWWB 4DR7L 3PUYA 1W2BA 1E3PA 4GNXC 4OONA 1M1KC 4UP8A 4IPHA 4UY8C 2K5VA 5M3MG 1VQOA 1WCMG 1OXXK 4JI8L 2KHIA 4AYBG 1VQMA 1A0IA 4DR4L 2CKZB 4APVA 1FJGL 2K75A 3F8TA 2N3SA 3GD7A 2R92G 3OW2A 1WOCA 3G48A 3I55A 1Q81C 2JA5H 2IHEA 4EQ5A 3KF8B 1UE5A 2UU9L 4LFBL 1I3QH 1SE8A 2UUCL 3HFZB 2R7ZH 2ZM6L 1JMCA 1KHIA 5K36G 4XIGS 3CMEA 4JI0Q 2UXBL 3UDIA 4DV6Q 2JA8H 3S2HH 4DR5Q 4A3IG 3KLWA 1J5EQ 4BA1I 1JJGA 1VQDA 5BR8Q 5EAYA 1JT8A 4LFAL 3GTQH 3S1QH 2L15A 4LF8L 3S1RH 4JC0A 2A1AA 2Z6KA 1ASYA 5M5WH 5M5XH 2YU9H 4GN3B 1G291 3KJOA 4BA2I 2QA4A 2UUAQ 3L0OA 3HOZH 3AFQA 4DAYB 1E1OA 4HIMA 4A93H 2DUDA 5IYDH 3NEMA 2HIXA 1L1OC 3H0GH 3H15A 1KQSA 2C35B 2WAQE 1PH7A 1EIYB 2ZTCA 5GAEC 5HGQA 3GTPH 3RLFA 1KXLA 4A3IH 2RHQB 3K80C 4JI1L 3TREA 1N34L 1X9NA 3ER0A 5IWAQ 4X64Q 1KIXA 4IOAA 4GKJQ 1YHAA 1T9HA 2V1CC 3M4OH 4DR6Q 3G4SA 2E2IH 3PIPA 1SN8A 2BA0A 2K14A 4QQBX 1IZ6A 4KHZA 4RMFA 1VQCA 2YTXA 5LMNQ 4A75A 3CF5A 4JI7Q 1PVOA 2GVAA 1CUKA 1EIFA 2XGTA 1VQBA 4MTNA 4XTCS 3BZCA 1UE1A 2CWPA 4C3IH 4YY3L 4DR1L 1E22A 5ELNA 1C7YA 4LUVA 3A0JA 1DGSA 5GROA 3OTOL 1K8GA 4LF4L 2AHOB 4JCVE 1Y1WH 1XMOQ 2XTIA 1FL0A 2B63G 4LF7L 4BBSH 4EX5A 3J81j 3RN5A 1VQPA 4B3SL 5C3EH 3CCSA 3K0XA 3F1ZA 4DR4Q 1EUJA 4POGA 1J6QA 1I50H 3E9IA 3M85A 1IXRA 4JBMA 4Y7NH 4GOPC 4A3FH 4X65L 3ULLA 3HOXG 1HZAA 4BY7H 2FXQA 2YYZA 3U4VA 4GLAC 3RZOH 4O2DA 4L5TA 3PV0A 4MNOA 2CQOA 3W1BA 2E5LL 3W1GA 1PH5A 1Z47A 2AMCB 1YI2A 2Q2TA 1PA6A 2CWAA 2F52A 2JE6I 2Z0SA 2MO0A 3BZKA 4DK6C 3RN2A 2LXJA 4YCUA 3KDFA 4A3KH 3JAMi 4JI0L 2UXBQ 2GVBA 3L7ZC 3CXCA 4YHHL 4QJFA 3M4QA 5IYDG 3CCQA 4DV6L 1YVCA 1HNWQ 4YWKA 2YV5A 1YZ6A 4DV5Q 1J5EL 1EFWA 1K0RA 2JA7G 4A93G 1K3RA 1HZCA 1NMFA 1S3OA 1UE7A 1N9WA 3I7FA 5ELOA 4R4IA 1X3FA 4HJ7A 4B3TQ 3M3YH 4GS3A 1V43A 1NBWA 1EQRA 1PH3A 5M3FH 1I94Q 3SGIA 1IBKQ 1XPUA 3GTLH 2VY3A 4A3GH 2WB1E 2VQEL 1VQ6A 4KHPQ 1Q12A 3MEFA 5C4XH 4GNXB 4JI2Q 3T1HQ 1HR0W 4NXMQ 3H3VI 2KCTA 3PO2G 3PF4A 1JJCB 5JJIA 3RZDH 2R7FA 4YCVA 1XJVA 1Q86C 3F2BA 2YTYA 4HIDA 4O0AA 1Q46A 1D8LA 2A19A 2KBNA 4IPGA 2H5XA 3AYHB 4C2MH 3S2DH 3PGZA 1L1OB 3UDGA 1XPRA 2OTLA 4A3CH 2IHFA 3PUVA 3KJPA 4JV5L 4JOIA 2R92H 1A8VA 4PZ6A 4R1JA 3LGJA 3CW2C 1X56A 2OQ0A 4DV1L 4JI5Q 3HOWG 1EOVA 1QVCA 4OO1G 5LMNL 3AEVA 1Y1VH 1N32L 3GTKH 3M7NA 5JJLA 3M9BA 4GN4B 1B7YB 1WCMH 3DM3A 4JI3L 4R4CA 1BBUA 3ULJA 4DR1Q 2UUBQ 4LUZA 1GO3E 2JA9A 2WP8J 1OXTA 2D0PA 3A5ZB 1N8RC 4IFDG 5H1SE 4LF7Q 2YTVA 4OWXB 3UDFA 3T1YQ 4JI4L 3HOVG 3CCMA 5IYCH 3OYYA 4P71A 2HQLA 1JE5A 3H3VH 1O7IA 4JYAQ 4PMWA 4IJHA 1K73C 5AJ3L 4OX9Q 4X65Q 3J80i 4B3RL 1U5KA 4DV2L 5LMUQ 1VQ4A 2UXCQ 4YCWA 3CP0A 3FP9A 3WWVA 4JI8Q 3A74A 4DV7L 4BBRG 3BJUA 4A76A 2ZTDA 4J15A 1KAWA 4JBKA 1LM0A 1VQNA 4LFCL 5IYBH 3CCUA 3CC4A 3S1NH 3IRBA 2I5HA 4YHHQ 1PH2A 2OCEA 3JAMc 1HNWL 4DV5L 1S40A 1VQ5A 4BY1H 3UE0A 4PG3A 1QVGA 2HT1A 1XMQL 3RNUA 1BBWA 3CCEA 1TWHH 3I2ZA 3I56A 3CCJA 2ASBA 1LYLA 1X65A 1TWCH 3F2CA 3ULPA 1MJEA 2UUCQ 2IX1A 2BA1A 3I4MG 1SROA 2VQFL 1KD1C 3GTMH 1XTDA 2VQEQ 3MXNB 4KHPL 4HIOA 5GQOA 3K7AH 3PSIA 4JI2L 4NXML 5C44G 5C0XI 1PH1A 3NELA 3J81i 1LUZA 4LF8Q 5GAGC 3U58A 5IP7H 3I4MH 2F4VQ 1KRSA 3S17H 2MQHA 1YIJA 3S16H 2K4KA 4DR3L 4QIWE 1NY4A 3D0FA 4QGUA 3S14H 2AKWB 1N36Q 2UUAL 3KFUA 1UEBA 3GTOH 4IFDI 1OXUA 1VQLA 2ZJPA 4JI5L 4DV1Q 1VQKA 1PV4A 1CKOA 4JI6Q 1EYGA 2R93G 1GM5A 2UUBL 1PYSB 5IWAL 4X64L 1CKNA 3CCLA 1FGUA 4GKJL 1VQAA 3TRZA 2E2JH 1XNQL 1RL2A 4JI4Q 3HKZG 3HOVH 1BKBA 1GKHA 3PF5A 2NVXH 2UXDL 2LSSA 4ALPA 1NJIC 4NPSA 4JYAL 4DV0Q 5AJ3Q 2NVTH 3J7A5 5FJ8G 4LF9Q 2Y0SG 1YNXA 3TS2A 1QVFA 1K83H 1YHBA 3PCOB 5C3EG 1QZHA 4PZ8A 3HKZE 3KOJA 4LF4Q 1XMOL 2VZAA 2NVYH 2PI2A 1Y1VG 1Y1WG 4IOCA 2B63H 5C44H 1C0AA 4B3SQ 3KYHC 4DV7Q 1IBML 3I4NG 2JEBI 4NB3A 2E8GA 1VS0A 4LFCQ 3FHWA 3KF6A 4IPDA 3NENA 4DUYL 2MFIA 2ALYB 3CC7A 1SFOH 1NMGA 4HJ5A 1WYDA 4JOIC 2CCZA 3W5OA 1PH8A 4LF5Q 3ERSX 2AWOA 4X62Q 4LWCA 4DAMA 1H95A 2IX0A 2JJQA 3HOUG 1IYJB 4A3JG 4X66Q 1YJWA 1K9MC 4H02A 2K5NA 5IYBG 2D62A 1VQHA 1V1QA 3CD6A 4A3GG 1VQIA 4DV4Q 5IP9G 4B3TL 2F4VL 1IBKL 1UE6A 4UPAA 5HY6A 2HIVA 4L5QA 4BXXG 1N33Q 3G6EA 2EIFA 2JA7H 3BU2A 3CAMA 1X55A 3T1HL 4GKKQ 3STBD 3ZJYC 3DLLA 5IP9H 4MZ9A 3RLOA 4TQUS 2ZJQA 3FKIH 5GAHC 2DGYA 3TQYA 1P16A 2LXKA 1WI5A 3J80c 1XNRL 3UDXA 2RF4A 1VQFA 2JA8G 4K0KL 3CCVA 2B29A 3HOUH 3CCRA 4A3DG 2BH8A 2ID0A 2I0QA 2R7ZG 1WFQA 4DV3Q 1X54A 3HOWH 4DPGA 2NVQH 3CQZH 1E24A 3K7UC 4DR2L 4GOPA 1XNQQ 1X3EA 1VQJA 4UP9A 4P73A 1HNXL 4P75A 1YJ9A 1JB7A 2N49A 4BBSG 2UXDQ 1W3SA 1HR0Q 4OWTB 3J7ZC 3Q8DA 4AQYQ 1G51A 4DV0L 4JI3Q 4IFDJ 4DR7Q 1MJCA 4AIMA 4LF9L 1M90C 3I4NH 2CFMA 3GDEA 4QL5A 2OQKA 1BVSA 2Q2HA 3E9HA 4GNXA 1VQ8A 1NTGA 1R9TH 2VL6A 4POFA 1RIPA 3TS0A 2ZTEA 4LF6Q 5C4XG 4HIKA 2Q2IA 4YWMA 3RLNA 2OWOA 2IY5B 5FJ8H 3S1MH 1G6PA 1VQ9A 4DUYQ 4A3EG 4OX9L 4HJ8A 4TVAB 5IY0A 4LNQA 1WJJA 4L5RC 4DV2Q 2K50A 4A3LG 4OXPA 2A8VA 1HZ9A 3PIOA 1K8AC 2UU9Q 5LMUL 2WFWA 4R4TA 3S24A 1KRTA 2VUMH 2UXCL 1AH9A 1B8AA 2PQAB 1FVIA 4P72A 5JEAG 2ZM6Q 2ES2A 2Y0SE 2R6GA 1XPOA 4OO1I 4GLVB 4X66L 1TWAH 2ZJRA 2NZHA 5J3BA 1PH6A 2RCNA 4L5SA 1L1OA 4Y52H 1NE3A 1VQGA 2R7DA 1QUQA 4UP7A 3STBC 1XMQQ 4P74A 1EQQA 5E7NA 2KCMA 4DV4L 2VS1A 1OTCA 3K81C 3A5UA 2VQFQ 1OXSC 3HOXH 1YEZA 4A3FG 4DK3C 1Q1BA 3F2DA 1VQEA 2Z6KC 4KI0A 1IBLL 3HOYG 2IT1A 3CPFA 4KLKA 4LUOA 2JQOA 5C0XJ 4WJ4A 3AQQA 5IP7G 1TWFH 1X6OA 3D31A 2F3IA 5LMNW 4A3JH 2N8NA 4NXNL 1TXYA 1MIUA 4ME3A 2PI2E 4JBWA 1YHQA 1XNRQ 4DR3Q 1P8LA 3L2PA 1SMXA 4JI1Q 5FLMH 1N34Q 1N36L 2JA5G 2PNHA 4LFBQ 3KF6B 1Q1EA 2MNAA 4A3CG 1HH2P
chains in the Genus database with same CATH superfamily
1SXTA 1KDBA 1SEBD 2F0VA 3D4RA 3E0EA 4XYOA 3MTSA 3CMAA 3KUPA 1EEID 3GO5A 1SNPA 3I4OA 1ENFA 1RHPA 4OGQC 1HNXQ 1Q82C 1Z9FA 2KHJA 1QJOA 4FDBA 2EPBA 4JI6L 5M5WB 1CI3M 5M3MH 1E1TA 4FF1A 3PUZA 4KTAA 2B2TA 3HOYH 4HJ9A 3I70A 2QEXA 4FF3A 1J8IA 1F2YA 3GTMB 3K8AA 1TWGH 5IT9c 1B9NA 1C9OA 2R7ZB 1L2FA 4B3MQ 2EY5A 1B70B 2RHSB 4QY7A 1PFSA 3PMFA 1RJTA 2E5LQ 1ASZA 1QZGA 3K5MA 2B2TC 2L0CA 2NN6I 4A3KG 5E1FA 3VR2A 3GTGH 2J4XA 2KQ3A 1KDCA 2EQSA 5JPNC 1LT6D 5HGTA 4A3EH 2G5DA 4BBRB 2E75C 3CRKC 3MAQA 2OEOA 3HP3A 4X62L 1PLFA 2WAQG 2K33A 5FLMG 3K5LA 2ZXRA 3SEBA 3U50C 1PYBA 5JEAJ 3GTJH 1QNUA 4LFAQ 2N78A 1CKNB 2JA6G 3R3OA 3HOXB 3MA2B 4ZUJA 1H9MA 5ISRA 3M7GA 1WCMB 4JBJA 5CV7A 3MWYW 4DFAA 4BS9A 1VMCA 4IO9A 1I6VC 4GKKL 4ZQ3A 3PO3G 4GLXA 1I4GA 1II3A 4NDXA 1ML0D 2MO1A 1OXVA 1PH4A 1AE3A 3OSOA 3KBXA 1PTOB 4K0KQ 2F0TA 1S72A 1HJPA 2Z6BA 2QCPX 2GN5A 1NAPA 3T1YL 5KRUA 5IYCG 1GVPA 4B3ML 4AQYL 1PTOD 1YNJD 2XNAC 4KD3A 1U4PA 3P20A 4MHEA 4XQJA 1SYGA 1VQOA 1HHVA 1B44D 4DXGA 2KHIA 2F0JA 1F9PA 1WD0A 4APVA 3MXGA 3F8TA 3GD7A 1MSGA 1WOCA 2O2LD 2RSOA 2JA5H 5KEEA 3KF8B 1K8MA 1I3QH 1SE8A 3PQIA 4QCLA 2R7ZH 3HRZC 1PZID 3I4LA 4XIGS 3UDIA 2JA8H 1CK1A 1SJED 4A3IG 1IKMA 5EAYA 1JT8A 4LFAL 3MVVA 3GTQH 5FKAC 4LF8L 3S1RH 2EZVA 5M5WH 2YU9H 1G291 4KK7A 3VYSA 3KJOA 2UUAQ 1ZEQX 4DAYB 4HIMA 1E1OA 4KMUC 5K5PA 4K5XA 1PZJD 3OWFA 1KQSA 2F0EA 2EVBA 5C0XH 3K57A 3RLFA 1ENAA 4JI1L 4A3MB 4X64Q 2JP1A 3E3XA 1AFPA 2V1CC 4FNFA 4DR6Q 2EJFC 3PIPA 2BA0A 4QIWB 5T1GA 2Y0SB 2YTXA 2K5QA 3CF5A 4A75A 5EJWA 2TSSA 1CUKA 4MTNA 4XTCS 3BZCA 1UE1A 3S1RB 3OTOL 1LV9A 1WTRA 2CVRA 2F0NA 4FF4A 3J81j 5CORA 3BYTB 3NXWA 1STEA 1TS3A 2XWBB 3K0XA 4B3SL 3N6RA 5FO8B 5IGGA 1IXRA 4RGNA 3IFTA 4GOPC 2RVLA 3HOXG 4BY7H 1A6XA 4GLAC 2AQ2B 3ERQA 1F2LA 2KEDA 1HRJA 1ICWA 1VF7A 3KDFA 1EY0A 1I3QB 3H91A 3IFDA 5IYDG 1HNWQ 2YV5A 3SK4A 2JA7G 2F0MA 2B8GA 1NUCA 1HZCA 1IL8A 4NP5A 1NMFA 1UE7A 1GOZA 1U4LA 3H6MA 1VMPA 2HUGA 4HJ7A 4B3TQ 4A3DB 4GS3A 1V43A 1PH3A 1I94Q 4MN3A 3SGIA 4DAVA 1EQTA 1V8QA 4A3GH 2M9VA 1MD2D 4RGMA 1Q12A 1BCPF 5C4XH 3J81E 3K0YA 4JI2Q 3HOWB 4E6IA 3PO2G 2KCTA 2VB2X 2R7FA 1TR5A 4EVOA 3O13A 3PIO3 3QIAA 2YTYA 2NWGA 1Q46A 2HCIA 2KBNA 1M4VA 4C2MH 3PGZA 4CGYB 3KJPA 4JOIA 2ICIA 3LGJA 3L9AX 4JK1C 2Z4HA 2OQ0A 1PTOH 4OO1G 1Y1VH 3M9BA 1B7YB 1WCMH 4R4CA 5NUCA 2A68D 3M4OB 1Q3LA 3A5ZB 1N8RC 4HTHA 2WACA 3UDFA 3ONAB 4JI4L 3HOVG 3OYYA 4P71A 1JCKB 4HSVA 3TDQA 4JYAQ 1K73C 3FVQA 1LTTD 2KVMA 1C4QA 4X3TA 1VQ4A 4BBRG 2EYMA 4A3GB 4LFCL 3CC4A 1B3AA 1TS2A 1PH2A 4AYBB 1HNWL 3KF8A 1S40A 3UE0A 4OHJA 1SYCA 1WVLA 4LFBQ 3CCEA 3S2HB 3CCJA 1CTMA 2F03A 1TWCH 2EDGA 1BCPD 4UDUC 2BA1A 2VXWA 1SROA 1KD1C 1KTKA 1STAA 1S5FD 1D6EC 3K7AH 1FD7D 3T4AC 4JI2L 1A15A 3RMHA 5C0XI 3J81i 5GAGC 3DMUA 1KRSA 2N55A 2CW0C 1YIJA 1S5CD 2K4KA 3S16H 2AKWB 1UEBA 4HSPA 4HR7B 3GTOH 1B1ZA 1OXUA 2ENBA 2B2VA 1CKOA 4BY1B 1EYGA 3HKZB 1BBXC 1PYSB 3SK5A 4OIKA 4NW2A 1CKNA 5CV5A 1RL2A 4JI4Q 3HOVH 3OMCA 3VR3A 2NTSA 4ALPA 4JYAL 2CH4A 4OIJA 3J7A5 5KNCA 4LF9Q 4LF4Q 1YHBA 5C3EG 3KOJA 1A3UA 3VR4A 2E2IB 2VZAA 1Y1VG 1Y1WG 2B63H 3IAYA 2JEBI 4NB3A 2E8GA 1VS0A 3NK9A 4LFCQ 3FHWA 4ZRZA 1DD2A 4KY6A 3CC7A 1EFID 1SFOH 1NMGA 4HJ5A 3QB3A 3BDOA 1WYDA 4HAEA 4JOIC 4N9TA 1PH8A 4LF5Q 3ERSX 1TWAB 3X3NA 1H95A 1SJHD 4XQNA 1YJWA 4H02A 2K5NA 2L55A 3WOFA 2RSNA 3MXUA 3CD6A 4PMCA 4A3GG 1VQIA 1UE6A 1DOLA 5HY6A 2HIVA 1N33Q 1KLUD 2JA7H 3CAMA 2R3ZA 3STBD 3DLLA 4MZ9A 4R8NA 1CZWA 3FKIH 5GAHC 1UEAB 1WI5A 1RODA 3UDXA 3CCVA 5C4JB 2ID0A 4G57A 4KKSA 1ENCA 4DV3Q 1BO0A 3CQZH 1E24A 3KK7A 3K7UC 4GOPA 1VQJA 4UP9A 3M4YA 2MPMA 5CBEE 1PTOF 2D9UA 5JOBA 1G51A 4LF9L 2DNEA 3I4NH 3E9HA 3T51B 1HPCA 1NTGA 2VL6A 4POFA 1RIPA 3WOEA 2Z1CA 2CQAA 2ZTEA 4X3KA 2F0PA 2Q2IA 2IY5B 3S1MH 1VQ9A 5EPLA 5CGKA 4TVAB 2JSOA 4L5RC 5EBDA 5TSSA 2R93B 4KKUA 4OXPA 2UU9Q 3PIOA 3GTJB 2F0KA 2A8VA 4R4TA 1AH9A 2VUMH 2ZM6Q 1DCZA 2LY7A 4I65A 1XPOA 4DK1A 1KAAA 2BE5C 5J3BA 2RCNA 3Q24A 2MJ8A 5FOBB 3MXPA 4FXGC 5G3LF 3GTKB 3H0GB 2VS1A 4KKTA 4DF7A 1OXSC 4DK3C 1VQEA 3J7YW 4WJ4A 2JQOA 3AQQA 1TWFH 4A3JH 2F3IA 2R92B 1MIUA 4G7OC 3A7LA 3L2PA 2JA5G 2PNHA 5C5LA 2A6HC 4A3CG 3R8BA 2JA8B 1A3VA 1PMRA 3B6YA 3S2DB 4DUZL 1B4OA 3Q6SA 4ZK9B 1SLJA 1CQVA 2A68C 2K28A 1A62A 2F1MA 1SR3A 3AMUA 1KL9A 3FDTA 2D0OA 3G71A 1B3QA 3DEPA 2HHHQ 2LFNA 3FKIG 5LL6S 3J80L 3PUWA 1GHKA 3PO2B 4LW1A 4CJ1B 2FHTA 3SVMA 4K2LA 3EIVA 1VCIA 3NBHB 5JJKA 2DNCA 2WB1G 2A6EC 2NYZD 3I4MB 3S15H 2QKIC 1T5XD 2VUMG 2JA7B 1PTOC 1YNJC 5ELDA 1D7QA 1O80A 2KECA 4A4IA 1S4ZA 4AH6A 1EY4A 1RKNA 2I5LX 2PW7A 1O7YA 1V9PA 5M5YH 4RG1A 2RDHA 3TZUA 1LTLA 3KLSA 1HFNA 1KC8C 3NTIA 4R4QA 2JA6H 1CKMA 2Q2UA 2I46A 3R2IA 5E4XA 2NZOA 3PO3B 4IUNA 2PQEA 4X6AH 4K14A 1LT3D 2KHSA 1Q7YC 2I5MX 1GHJA 1AEXA 1I5FA 2L12A 2L9HA 1AW7A 4IJLA 2VW9A 2JA6B 3T53B 2KUMA 4BY1G 2OF1A 5M3FG 2KEEA 4IUQA 1EZ6A 3AB9A 1LTAD 1JJ2A 4DUZQ 1ILPA 1N32Q 4JPBW 2E2HB 1UWVA 1AE2A 1QILA 3I90A 1PH9A 4GOPB 4WJ3M 3PUXA 1D2BA 2HHHL 4A3MG 3EBEA 3OMGA 4JI7L 4YWLA 1C48A 1TS4A 5EPJA 4DR7L 1W2BA 1GXDC 4IPHA 2K5VA 5M3MG 1NSNS 1OXXK 3DWAA 4RWSC 5M9OA 4AYBG 4PMBA 3LWUA 4FXDA 5EGTA 1JB3A 2K75A 2R92G 3OW2A 3G48A 5DM73 1Q81C 4EQ5A 3TP8A 4XT1B 1M8AA 2B2YA 1B53A 2XRQD 3K5NA 2UXBL 5KNBA 2BDNA 4CDDC 3NWSA 2A6ED 1GUNA 4JC0A 4GN3B 2HQEA 1CHQD 5I9OA 3A7AB 1F9RA 1EYAA 1JICA 2QF7A 4C3HG 3L0OA 3HOZH 3AFQA 4A93H 3H0GH 2WAQE 1LT4D 1EIYB 3TMEA 5A2QL 3UI2A 4O1NA 5HGQA 3GTPH 1KXLA 4NKLA 1X9NA 5IWAQ 3J7AF 2I07B 1KIXA 3NWTA 1T9HA 1F77A 2K03A 4TSSA 5CV6A 1SN8A 2LKVA 4KHZA 5C44B 3EA6A 4JI7Q 2O5IC 4DR1L 5KNDA 1HTLD 1PRTB 2P5ZX 4LUVA 3A0JA 5EBCA 1K8GA 2AHOB 4JCVE 3RN5A 1VQPA 1I4QA 1BQQT 4POGA 3SDZA 4JBMA 1JJGA 2YYZA 3RZOH 4L5TA 3PV0A 3W1BA 2CQOA 1U9RA 3NP8A 4FF2A 1CM9A 1PH5A 1Z47A 1XYIA 4ZLTF 4CDEC 1QCBD 1PA6A 2JE6I 3BZKA 3NPPA 4YCUA 3JAMi 4OEMB 1Q8IA 4DAYA 3J7AV 2GVBA 2UXBQ 4CDFC 4QJFA 3DWQA 3M4QA 5EKIA 3SR1A 1IHZA 4DV5Q 4A93G 1K0RA 1K3RA 4IQZA 4CJ0B 1N9WA 4H0LC 1L0YB 3M3YH 5M3FH 1Z6HA 3HZXA 4YIJA 3D8GA 1SBBB 2WB1E 1VQ6A 5ELOA 4KHPQ 2F0OA 5T1IA 4NXMQ 2B2WA 1QOHA 1STHA 4IALA 5JJIA 4RHRA 4YCVA 4HIDA 4QB4A 1DYQA 3ND8A 3AYHB 2PZWA 3S2DH 3TP5A 2PMZB 3UDGA 1XPRA 4RFBA 2OTLA 4JV5L 2R92H 1A8VA 5ELFA 2H4OA 2F0SA 3S1NB 4DV1L 4JI5Q 1IW7C 4C3HB 3M7NA 5LL6X 2C5CA 3ULJA 4FO2A 4JI3L 3Q0AA 4DR1Q 4LUZA 2JA9A 3DM1A 4IFDG 1PFNA 2MUYA 4OWXB 3J80E 1DONA 3H3VH 3I8ZA 3EFXD 4FP5D 3J80i 4B3RL 1U5KA 1STBA 5LMUQ 2UXCQ 3CP0A 3FP9A 4JI8Q 3S1NH 3NTHA 3GTLB 1LTGD 1HFGA 2OCEA 4DV5L 4BY1H 1VQ5A 3GP7A 1QVGA 1XMQL 3RNUA 3I2ZA 1LYLA 1NR2A 3OWEB 3ULPA 1MJEA 2UUCQ 2QDLA 1EIHA 3GTMH 2VQFL 4HMIA 5IGCA 4KHPL 5GQOA 3A55A 4NXML 1DXMA 5C44G 2SNMA 1D1IA 1FNVA 3GQBA 1E0BA 3BVMA 3NELA 4KHVA 3S17H 3NBHA 1KABA 1DOKA 4DR3L 2DJFC 1DJRD 1NY4A 2K32A 5KIXA 3NBIA 4QF4A 4IFDI 3FEWX 1IKLA 2XIWA 1VQLA 2ZJPA 1O7ZA 4JI5L 3J81L 4DV1Q 2DJGC 1XXGA 4JI6Q 4X3UA 1TVXA 3H09A 3CCLA 1SAPA 4GKJL 4J6HA 1VQAA 4M8AA 1XNQL 3HKZG 1WTQA 1BKBA 3KLSX 2UXDL 1PYWD 2LSSA 1XX8A 4NPSA 1PXUA 2EY1A 4DV0Q 4F7XA 1YNXA 3P75A 3SK8A 1K83H 3TS2A 1PFMA 5JJZA 1XMOL 4MIUA 2PI2A 3HS0C 3HEJA 4IOCA 5C44H 3KYHC 3I4NG 4IUTA 1G91A 1A3TA 2E74C 4IPDA 2MFIA 1S5BD 3OW7A 2L1BA 1AZQA 2AWOA 4X62Q 3MFYA 4DAMA 3C46A 4A3JG 4X66Q 5M5YB 1K9MC 4C2MB 2FINB 1VQHA 4C1NI 3G7LA 2KOLA 3C3LA 3I73A 4KV6A 5FK9C 1IBKL 4HCEA 4UPAA 2TMPA 1TIID 2EIFA 1DOMA 3BU2A 1X55A 4TKOB 3T1HL 4GKKQ 4U673 1CHPD 3A8JE 4TQUS 1TU2B 1EY7A 3GV3A 4H44C 1FNUA 3GTOB 2DGYA 3TQYA 1P16A 2K01A 1XNRL 2GA4B 2RF4A 4ZCKA 4K0KL 5K36H 4Z9CB 4DPGA 2NVQH 5CV4A 4I7ZC 1X3QA 4DR2L 1GUWA 1XNQQ 1HH2P 2N49A 3HOYB 2UXDQ 5C6AA 3Q8DA 4AQYQ 3TBIB 4DV0L 1NR4A 2F0FA 1IYUA 3K5OA 1LTID 3GDEA 4A3FB 3FPPA 4QL5A 1MHWC 4QUCA 1BVSA 2AUJD 5BN3A 4GNXA 3MEHA 3TS0A 4LF6Q 4HIKA 4YWMA 4ABNA 4A3EG 4OX9L 2DY8A 2NZ1D 1WTOA 4DV2Q 4A3LG 3V96A 1HZ9A 1K8AC 3S24A 2WB1B 1TY2A 1FVIA 3SXHA 5D65A 4OO1I 4X66L 1G8ZD 1QG7A 3I91A 3NUCA 1L1OA 1QUQA 5E7NA 2KCMA 1OTCA 3BVZA 1ZYRC 3A5UA 1Q1BA 4KI0A 3Q23A 3HOYG 1SMYC 2IT1A 2NUCA 3CPFA 4KLKA 4S3SA 1X6OA 5IGBA 3A54A 4NXNL 2PI2E 3EQLC 4JBWA 1XNRQ 5A35A 4JI1Q 1N36L 1FR3A 3KF6B 1Q1EA 2MNAA 1STNA 3I4NB 4CBVA 1JOQA 1IW7D 4DR2Q 4DR6L 5C4JH 3MFGA 4ILWA 1HQRD 1HNZL 2PYKA 2AWNA 1PRTD 2SEBD 4UAIA 2Z9HA 3JC66 4HJAA 4ZKCB 3CQZB 4DN4M 4WFN3 3OTOQ 4ID6A 1SNMA 3VDYA 3CC2A 1WTPA 4LF6L 4PZ7A 4K2KA 1EYDA 1PZKD 4M1UB 4DGZA 4CJ2C 1CSQA 1TY0A 5FO9B 3S17B 1L0WA 1EWIA 2XSCA 4IN3A 2RBMA 3U9OA 1FYCA 1IBMQ 2EXDA 4CHTB 1BR9A 3DHQA 2EE1A 3KDFB 1Y8PB 2VB3X 2F3WA 3L3OC 2NN6G 2M2LA 2FFKB 4B9WA 3V05A 2OT2A 1I6HH 5E3FA 1QUQB 1E7ZA 1I94L 2G9DA 1IL2A 1K3BC 4DR5L 1HZBA 5BR8L 4LK1C 2B3GA 2F0QA 2M00A 1SFOB 2BH2A 4NXNQ 3BZDB 1H9JA 1TS5A 2JYOA 5FLXc 1SYFA 3RD4A 3TEHB 2ATWA 4ME5A 3HKSA 2A69C 1HA6A 3V2TA 5LHY1 1Y14B 4A3BG 1JORA 4DXFA 1I4XA 4A3MH 4TRDA 1MKHA 1ESFA 2V4DA 4BBRH 1HNZQ 3EN2A 4IPCA 4GN5A 4AYBE 3H0GG 1YBYA 2WKDA 2R93H 3HOZG 4XXEA 1EY9A 2B8FA 4C3HH 1T5EA 1HQMC 4FXKC 4Q0FA 2E2DC 2IPKD 2K05A 3W3AA 4A3LH 1YJNA 1VQ7A 3K59A 2KENA 3J81c 3K58A 4YY3Q 4OWWB 3H3VC 2PZUA 3GTQB 3PUYA 1E3PA 4GNXC 1M1KC 3K6OA 4UY8C 1TWGB 3VYUA 1WCMG 2JA5B 3DXJC 1VQMA 1EWHA 5CR3A 1A0IA 1K0SA 3OIQA 2N3SA 4LAAA 3I55A 4LFBL 1JWUD 2HDLA 5C4ZA 4R8IA 1I50B 1JMCA 1KHIA 5K36G 3OPOA 2SNSA 2X6GA 1F9SA 1TKWB 3KLRA 4HCSA 4DV6Q 4DR5Q 3S2HH 2F0WA 1J5EQ 5BR8Q 5J39A 2QDBA 2A1AA 2Z6KA 5M5XH 1LO5D 3GV6A 2FMCA 2QEJC 4J8QA 2DUDA 1BF4A 5IYDH 3NEMA 2HIXA 3H15A 2C35B 2ZTCA 4N8FA 5GAEC 1D5ZC 4A3IH 3VA5A 3T16A 2AQ1B 3K80C 1N34L 3ER0A 5FLXL 5JPMC 3M4OH 3G4SA 1SSOA 1K8OA 4RCOA 2EYPA 5LMNQ 2B63B 2EYFA 1PVOA 2XGTA 1VQBA 4YY3L 4ODGA 5M5XB 4IZ8A 1C7YA 4LF4L 5GROA 2XVSA 3MC0B 2BDOA 4A3EB 1BCPC 2Q8RE 4LF7L 4BBSH 4EX5A 3URYA 4A93B 2KJXA 1J6QA 1I50H 3E9IA 3M85A 4Y7NH 4X65L 3ULLA 4K6LA 1HZAA 1AP0A 2E5LL 3W1GA 4G4KA 1G2TA 1RCVD 1U4RA 1H9SB 2Q2TA 2IWHA 3RN2A 4DK6C 2MO0A 4ZAIA 2B2UA 4U68A 4IUVA 4RGOS 1ET9A 3CXCA 4YHHL 5CV9A 4DV6L 1YVCA 5KYLA 1ESRA 1EFWA 1J5EL 1J9OA 3BS1A 3NQTA 1NCVA 3I7FA 1QB5D 1X3FA 1NBWA 1EQRA 5M3MB 4IURA 2VQEL 4GNXB 2NVQB 4K5WA 5IGEA 3H3VI 1O78A 3P7JA 3RZDH 1B9MA 1STGA 3ND9A 5I4DA 1GJXA 1XJVA 1YNND 4L6TB 2RA4A 1TWCB 4O0AA 1D8LA 4JW0A 2EYLA 1KNAA 2L11A 3OHXC 4A3CH 3EROA 3CRLC 2A6HD 4R1JA 5DNFA 2F0HA 4N9PA 3CW2C 1X56A 4F87A 1QVCA 3BDCA 1B50A 2MHVA 5LMNL 3GTKH 1HUNA 1BBUA 3CU7A 2WP8J 1OXTA 2D0PA 3E0JA 2DY7A 5IOCA 5H1SE 4LF7Q 2YTVA 3T1YQ 2R61A 3CCMA 5IYCH 2O4XA 1LTBD 2ICEC 1JE5A 1O7IA 2NVYB 4IJHA 4JVZA 5AJ3L 5ELBA 4X65Q 4KJNA 4MTKA 2HDMA 1I6HB 3FRPB 4YCWA 5C5MA 5COYA 3WDNA 4DV7L 4A76A 1VQNA 4IFDH 4JBKA 1KAWA 3CCUA 1BNZA 1ZYRD 2I5HA 4YHHQ 5IT9L 4CKBA 3JAMc 4PG3A 4OL7A 1UNSA 3I56A 2ASBA 1EQVA 4B9XA 3F2CA 2RDFA 3I4MG 1A2UA 2J7ZA 5E4WC 1EEFD 1XTDA 5EKLA 2VQEQ 3MXNB 4HIOA 3PSIA 2IW3A 3KBGA 4EQNA 4K8JA 2Z4IA 5IT9E 1LUZA 4LF8Q 3HGBA 3U58A 4EQOA 2F4VQ 3I4MH 3LX0A 3HG9A 4GZYC 3FKIB 1G6ZA 4QIWE 4QGUA 2UUAL 3KFUA 2C9OA 3H94A 3HOUB 1R4QB 1PRTF 3T13A 1GM5A 5EPKA 1SE2A 4X64L 5F2DA 1SE4A 1EU3A 3C2PA 2AQ3B 4DAPA 4G7ZC 4ULLA 1EOTA 3R93A 1NJIC 5AJ3Q 5FJ8G 3BDLA 4EQPA 3R2TA 1QZHA 1RD9D 1GUSA 1WTXA 2NVYH 5KGUA 1C0AA 4IUPA 4B3SQ 2L5TA 5I2YA 4DV7Q 2CW0D 2RKSA 1U4MA 1AN8A 3D3RA 3QJYA 4XYQA 1Y8NB 3GTGB 1R9TB 2IX0A 3HOUG 4QUFA 5HURA 4DV4Q 4B3TL 2LMCB 2F4VL 3RZDB 4BXXG 4C3JB 3ITPA 3G6EA 1WTHA 1CA5A 2A73B 2E2JB 3ZJYC 3LWEA 5IP9H 2ZJQA 3T56B 3S16B 4KY7A 3S14B 2LXKA 3J80c 5IIFA 1VQFA 2B2UC 3A56A 3K7AB 1WTWA 3CCRA 4A3DG 1WFQA 4A3KB 1DZ1A 4OO1H 2D5DA 1EIGA 4K8IA 1X3EA 4P73A 4P75A 1JB7A 4BBSG 2K1BA 1HR0Q 3M3YB 3I3CA 4DR7Q 1MJCA 4AIMA 1M90C 1TWHB 1HTPA 1SYEA 2OQKA 3QWNA 2F0DA 2IL8A 2JXMB 1VQ8A 2KCNA 1R9TH 4RH6A 2CH4W 2PW5A 5D14A 1PRTC 5C4XG 2OWOA 2K04A 3QOJA 4HJ8A 5IY0A 1KLGD 4LNQA 1WJJA 4K6DA 3A8KE 1ICFB 2WFWA 3D4WA 1B8AA 3D6CA 1JQYD 1E2ZA 1ET6A 5JEAG 2ES2A 2R6GA 4DNTB 2WV6D 3NTKA 5EQ0A 4ZKBB 1PH6A 4L5SA 5JEAH 4Y52H 1NE3A 2R7DA 1JC7A 4P74A 5A2QE 1K83B 4PQXA 1I4RA 3TP7A 4DV4L 4A3IB 1A2TA 1I4PA 2K5DA 3HOXH 1YEZA 2OXPA 2D2CC 2Z6KC 2ZT9C 1ILQA 2RCFA 3NSWA 4NMZA 4LUOA 1IBLL 4R9WA 1WD1A 2F0GA 1S5ED 5I6YA 2Z8LA 5IP7G 4WORA 5LMNW 5IGDA 3NQIA 1SNCA 4ME3A 1YHQA 1P8LA 5J22A 4RGTA 2F4IA 3VYTA 5C3XA 3QG1A 4C1NK 5FO7B 1XWEA 4L8JA 1CA6A 4A3DH 2CHBD 2VNUD 1HR0L 3S9WA 2JK8A 1KDAA 3PO2H 4XDXA 1QE6A 1Q90A 4DNIA 2MGSA 3BYYB 2XRSD 5C0XG 4L63B 1A63A 2K6AA 2WKCA 5IE8A 5J1ZA 3U4ZA 3P1HA 1W6JA 4PNYA 1Z7TA 1D5XC 4RA8A 5DLQE 4BXXH 4CKCA 1QWYA 1V1PA 2EJGC 2MP1A 3CPWA 2PMZE 2K5WA 1PHJA 1FJGQ 4DK0A 4C3JH 3VR5A 4CKEA 4A3BH 1BXTA 2Q8TA 3SHLA 4BY7G 2K5HA 1SRUA 2K52A 2NTTA 4LF5L 1TWFB 2H1EA 1W6KA 2LS01 1KNEA 5C3EB 1U0LA 2EJMA 4H13C 4X3SA 1IBLQ 3AFPA 5L37A 5JVH3 2IX3A 2QGQA 1X3PA 2JEAI 1DM0B 4C3IB 3JAML 3TN2A 2NVTB 2WINB 2E2HH 1E2WA 1LTSD 1EL0A 1N33L 1Q8KA 3TP6A 2BE5D 4JV5Q 2NN6H 5C3WA 1FGBD 1D1KA 1HA5A 1YITA 5CYUA 4DNRB 1GD7A 1D5MC 4DKAC 1CSPA 1OO9B 4R4OA 2YU9B 1EY5A 1JWSD 1H9RA 2OTJA 2BCOA 3VYRA 1RDPD 1Y1VB 1LACA 4JG2A 1SYBA 4DV3L 4WJWA 3PO3H 3UE1A 2IJ0A 3M4PA 4BWGB 1H9SA 2SOBA 5GADC 1X3GA 2KCCA 2PQAA 4IUUA 4LMQD 3RR5A 3DUZA 3VR6A 2RQXA 4V190 3S1QB 4B3RQ 3F2UA 4OONA 4UP8A 4JI8L 3NE5B 1B2TA 1GUTA 4RKBA 2CKZB 4DR4L 2BOSA 1FJGL 3CKIB 4C3IG 1V1OA 1FNWA 3TSSA 2IHEA 5DM63 1UE5A 2UU9L 2WAQB 1RTNA 2UUCL 2QW7A 5I6WA 3HFZB 2ZM6L 1PFBA 3OOCA 3CMEA 1RF2D 3N52A 4JI0Q 4XQQA 2X6LA 3KLWA 4BA1I 1VQDA 4EGVA 3RZOB 3S1QH 2L15A 1ASYA 1AZPA 1CFMA 2WIIB 1IYVA 4XT3B 4BA2I 2ZXPA 2QA4A 5I9PA 2PNRC 4PV1C 1L1OC 3EVQA 1PH7A 2EYJA 2RHQB 3TREA 4IOAA 4GKJQ 1YHAA 1E2VA 2E2IH 1EY8A 2K14A 4QQBX 1IZ6A 2SDFA 3D4DA 4RMFA 1VQCA 2GVAA 1EIFA 4C3IH 4V0BA 3VA7A 3ICEA 2CWPA 1E22A 5ELNA 4J1MA 1DGSA 3HOVB 1EY6A 1Y1WH 1XMOQ 2B63G 2XTIA 1FL0A 2NVXB 1GUOA 2FMMA 5C3EH 3CCSA 3F1ZA 4DR4Q 1EUJA 3OIPA 3E5SA 4A3FH 2FXQA 3U4VA 4O2DA 4MNOA 2AMCB 1YI2A 1SE3A 2PZTA 2CWAA 2F52A 2Z0SA 3C1FA 4A3KH 2LXJA 1MI2A 5FLXE 4K5VA 4JI0L 3L7ZC 3W2DA 2EY2A 5KYIA 2B2VC 3CCQA 3DEOA 4YWKA 1YZ6A 2O5JC 4KN4C 4C56C 1S3OA 4R4IA 1S5DD 3D6WA 1IBKQ 1EYCA 1XPUA 1JOKA 3GTLH 4DU9A 2K7VA 2VY3A 5BN4A 3MEFA 3NHHA 2XN9C 3T1HQ 1HR0W 4HMJA 4F88A 2B39A 3U9SA 3PF4A 2EY6A 1JJCB 1ONLA 1YNNC 1Q86C 3F2BA 3IKJA 2A19A 4IPGA 2H5XA 1JR0D 4DA2A 4B08A 1L1OB 4HN7A 1EWCA 2IHFA 3PUVA 1Y1WB 2NB0A 5JAVA 4PZ6A 4BBSB 2L4NA 3E6ZX 3SE0A 2EYOA 1GUGA 1EOVA 3HOWG 4ZUIA 3AEVA 1TQOA 1SNQA 1N32L 5JJLA 4GN4B 3DM3A 1LT5D 2UUBQ 5CV8A 1GO3E 1EU4A 1Y69U 4KJOA 1MGSA 1LTRD 2A69D 4RCNA 1R4PB 2HQLA 3BG3A 4PMWA 4OX9Q 1TT2A 1BDOA 4DV2L 1SNDA 1RTOA 2JN4A 1STYA 1HUMA 4KY5A 3WWVA 2QILA 3A74A 1ZKOA 3BJUA 2N88A 2ZTDA 4J15A 1LM0A 5IYBH 5EKKA 3IRBA 4KD4A 3G6JB 3S15B 3X3MA 2X69A 2EYHA 3ZYYX 2HT1A 1MBYA 1BBWA 5JVG3 1TWHH 1SNOA 2PPBC 1X65A 3TZDA 2IX1A 3FPUB 2HD3A 5CMDA 2A5HA 3FMCA 1ZXTA 1SYDA 3QR8A 1PH1A 1V1PB 2HCCA 1F2ZA 2E76C 1UUPA 5IP7H 2MQHA 4HEDA 2F0IA 4N8X1 4H7BA 5IGFA 5D3DA 3SK6A 3D0FA 3S14H 2FJ2A 1N36Q 4FYDA 2KA7A 1L0XB 1JE4A 4C3JG 1PDQA 1C8CA 1VQKA 2PCFB 1PV4A 4BY7B 1WTVA 3JAME 2R93G 1BOSA 2UUBL 5IWAL 1FGUA 4A3JB 3TRZA 2E2JH 5DAUA 1GKHA 3PF5A 2NVXH 3IL8A 2NVTH 3DWPA 2Y0SG 3MZ5A 1QVFA 3PCOB 4LJZC 4PZ8A 3HKZE 5G3LD 2NBFA 3BVGA 1F9QA 3HOZB 3MXNA 1IBML 3C1EA 1CQFA 3KF6A 5I2XA 3NENA 4DUYL 2ALYB 1LLRD 4P2CB 2VUMB 3MHBA 3EJIA 3QO2A 2CCZA 3RUZA 3W5OA 4A3BB 3LNNA 3I72A 4LWCA 1EZ8A 3S1MB 2JJQA 1IYJB 1SDFA 4ZYSA 3CHBD 5IYBG 2D62A 4WRDA 4UHVA 2J0TD 2B2WC 1V1QA 1BCPB 5IP9G 5CBAE 4L5QA 4RHSA 1X32A 5CC4A 4F8MA 4I7AA 1O7LA 1HXYD 3RLOA 1G2SA 5M3FB 1VF5C 2F3VA 1HCZA 2JA8G 1LABA 2B29A 2RDGA 3HOUH 2BH8A 2I0QA 2AUKA 2R7ZG 1X54A 3HOWH 5C4XB 2F0UA 1BUVT 5ELCA 1HNXL 2PO4A 1YJ9A 1W3SA 2XWJB 4OWTB 4Y7NB 3J7ZC 4JI3Q 4IFDJ 1SMYD 4RAUC 5D3IB 4G7HC 1F2MA 2CFMA 2Q2HA 1VDZA 3Q22A 1H9KA 1JWMD 4RKLA 2F0LA 3RLNA 1G6PA 5FJ8H 4DUYQ 1UAPA 2K50A 1QNKA 4KN7C 5LMUL 2UXCL 1KRTA 2PQAB 3QOLA 4P72A 4Q5VA 2Y0SE 2G9HD 4GLVB 5C4HA 1TWAH 2ZJRA 2NZHA 5BN5A 1K28A 2DN8A 1VQGA 4CDCC 1JOOA 4UP7A 1CZGA 3STBC 1XMQQ 1EQQA 1I4HA 2Q8IB 3GTPB 5IODA 2EOTA 3K81C 2VQFQ 4A3FG 3F2DA 1NNXA 2A74C 4QMGA 5C0XJ 1MSHA 1CT1D 4FVMA 3D31A 2N8NA 2EXZA 1TXYA 3PIP3 1XTCD 1Y8OB 4O42A 4DR3Q 2B2YC 4OELB 1SMXA 5AFWA 5FLMH 1N34Q 5ELEA 3AU7A 2ZXOA 3A8IE 5DEHA
chains in the Genus database with same CATH topology
3E0EA 3CMAA 4DR6L 4DR2Q 3B6YA 5C4JH 1HNZL 3GO5A 3I4OA 1HNXQ 4DUZL 1Q82C 1Z9FA 2AWNA 2KHJA 4FDBA 4JI6L 1HR0L 4A3DH 2VNUD 1SLJA 2JK8A 3JC66 5M3MH 1E1TA 4HJAA 1A62A 3PUZA 3PO2H 1SR3A 3HOYH 1KL9A 4DNIA 4HJ9A 2D0OA 3OTOQ 3G71A 5C0XG 2QEXA 2HHHQ 3FKIG 3VDYA 3ICEA 1A63A 5IE8A 3K8AA 1TWGH 5IT9c 3CC2A 4LF6L 3U4ZA 3PUWA 1C9OA 1L2FA 4LW1A 4B3MQ 4PZ7A 3EIVA 5DLQE 1VCIA 1B70B 2RHSB 3NBHB 4BXXH 5JJKA 4QY7A 1PFSA 2WB1G 1CSQA 1L0WA 2E5LQ 1EWIA 1ASZA 3S15H 1QZGA 2NN6I 4A3KG 1IBMQ 2EXDA 3CPWA 2VUMG 2PMZE 1PHJA 1FJGQ 4C3JH 3KDFB 3GTGH 1D7QA 2NN6G 2EQSA 4A3BH 4A4IA 4BY7G 4AH6A 2K5HA 4A3EH 1SRUA 1I6HH 2I5LX 2K52A 1QUQB 4LF5L 1V9PA 5M5YH 4RG1A 4X62L 1E7ZA 1I94L 1LTLA 2WAQG 1KC8C 4R4QA 1U0LA 5FLMG 1CKMA 2JA6H 2Q2UA 1IL2A 3U50C 2NZOA 4DR5L 1IBLQ 1HZBA 4X6AH 3AFPA 1PYBA 5JEAJ 3GTJH 5BR8L 2B3GA 4LFAQ 2N78A 1CKNB 1Q7YC 2I5MX 2JA6G 2QGQA 2BH2A 4NXNQ 2JEAI 5FLXc 3TEHB 1I5FA 2ATWA 2E2HH 3HKSA 4JBJA 1N33L 4IJLA 2VW9A 1Q8KA 4IO9A 1Y14B 4BY1G 4A3BG 4GKKL 4JV5Q 5M3FG 1YITA 4A3MH 4B3RQ 1GD7A 3PO3G 4DKAC 1CSPA 1MKHA 4R4OA 4BBRH 4GLXA 1HNZQ 3EN2A 1JJ2A 4DUZQ 4IPCA 1N32Q 4GN5A 2MO1A 1OXVA 4AYBE 1AE3A 1AE2A 1UWVA 1PH4A 3H0GG 2OTJA 1YBYA 4K0KQ 2R93H 1S72A 1PH9A 1HJPA 3HOZG 4JG2A 4DV3L 4C3HH 4GOPB 4WJ3M 3PUXA 2HHHL 2GN5A 3PO3H 4A3MG 3UE1A 3T1YL 5IYCG 3M4PA 4A3LH 3EBEA 1YJNA 1VQ7A 1GVPA 2KENA 5GADC 1X3GA 4JI7L 2PQAA 4YWLA 4B3ML 3J81c 4AQYL 3RR5A 4YY3Q 4OWWB 4DR7L 3PUYA 1W2BA 1E3PA 4GNXC 4OONA 1M1KC 4UP8A 4IPHA 4UY8C 2K5VA 5M3MG 1VQOA 1WCMG 1OXXK 4JI8L 2KHIA 4AYBG 1VQMA 1A0IA 4DR4L 2CKZB 4APVA 1FJGL 2K75A 3F8TA 2N3SA 3GD7A 2R92G 3OW2A 1WOCA 3G48A 3I55A 1Q81C 2JA5H 2IHEA 4EQ5A 3KF8B 1UE5A 2UU9L 4LFBL 1I3QH 1SE8A 2UUCL 3HFZB 2R7ZH 2ZM6L 1JMCA 1KHIA 5K36G 4XIGS 3CMEA 4JI0Q 2UXBL 3UDIA 4DV6Q 2JA8H 3S2HH 4DR5Q 4A3IG 3KLWA 1J5EQ 4BA1I 1JJGA 1VQDA 5BR8Q 5EAYA 1JT8A 4LFAL 3GTQH 3S1QH 2L15A 4LF8L 3S1RH 4JC0A 2A1AA 2Z6KA 1ASYA 5M5WH 5M5XH 2YU9H 4GN3B 1G291 3KJOA 4BA2I 2QA4A 2UUAQ 3L0OA 3HOZH 3AFQA 4DAYB 1E1OA 4HIMA 4A93H 2DUDA 5IYDH 3NEMA 2HIXA 1L1OC 3H0GH 3H15A 1KQSA 2C35B 2WAQE 1PH7A 1EIYB 2ZTCA 5GAEC 5HGQA 3GTPH 3RLFA 1KXLA 4A3IH 2RHQB 3K80C 4JI1L 3TREA 1N34L 1X9NA 3ER0A 5IWAQ 4X64Q 1KIXA 4IOAA 4GKJQ 1YHAA 1T9HA 2V1CC 3M4OH 4DR6Q 3G4SA 2E2IH 3PIPA 1SN8A 2BA0A 2K14A 4QQBX 1IZ6A 4KHZA 4RMFA 1VQCA 2YTXA 5LMNQ 4A75A 3CF5A 4JI7Q 1PVOA 2GVAA 1CUKA 1EIFA 2XGTA 1VQBA 4MTNA 4XTCS 3BZCA 1UE1A 2CWPA 4C3IH 4YY3L 4DR1L 1E22A 5ELNA 1C7YA 4LUVA 3A0JA 1DGSA 5GROA 3OTOL 1K8GA 4LF4L 2AHOB 4JCVE 1Y1WH 1XMOQ 2XTIA 1FL0A 2B63G 4LF7L 4BBSH 4EX5A 3J81j 3RN5A 1VQPA 4B3SL 5C3EH 3CCSA 3K0XA 3F1ZA 4DR4Q 1EUJA 4POGA 1J6QA 1I50H 3E9IA 3M85A 1IXRA 4JBMA 4Y7NH 4GOPC 4A3FH 4X65L 3ULLA 3HOXG 1HZAA 4BY7H 2FXQA 2YYZA 3U4VA 4GLAC 3RZOH 4O2DA 4L5TA 3PV0A 4MNOA 2CQOA 3W1BA 2E5LL 3W1GA 1PH5A 1Z47A 2AMCB 1YI2A 2Q2TA 1PA6A 2CWAA 2F52A 2JE6I 2Z0SA 2MO0A 3BZKA 4DK6C 3RN2A 2LXJA 4YCUA 3KDFA 4A3KH 3JAMi 4JI0L 2UXBQ 2GVBA 3L7ZC 3CXCA 4YHHL 4QJFA 3M4QA 5IYDG 3CCQA 4DV6L 1YVCA 1HNWQ 4YWKA 2YV5A 1YZ6A 4DV5Q 1J5EL 1EFWA 1K0RA 2JA7G 4A93G 1K3RA 1HZCA 1NMFA 1S3OA 1UE7A 1N9WA 3I7FA 5ELOA 4R4IA 1X3FA 4HJ7A 4B3TQ 3M3YH 4GS3A 1V43A 1NBWA 1EQRA 1PH3A 5M3FH 1I94Q 3SGIA 1IBKQ 1XPUA 3GTLH 2VY3A 4A3GH 2WB1E 2VQEL 1VQ6A 4KHPQ 1Q12A 3MEFA 5C4XH 4GNXB 4JI2Q 3T1HQ 1HR0W 4NXMQ 3H3VI 2KCTA 3PO2G 3PF4A 1JJCB 5JJIA 3RZDH 2R7FA 4YCVA 1XJVA 1Q86C 3F2BA 2YTYA 4HIDA 4O0AA 1Q46A 1D8LA 2A19A 2KBNA 4IPGA 2H5XA 3AYHB 4C2MH 3S2DH 3PGZA 1L1OB 3UDGA 1XPRA 2OTLA 4A3CH 2IHFA 3PUVA 3KJPA 4JV5L 4JOIA 2R92H 1A8VA 4PZ6A 4R1JA 3LGJA 3CW2C 1X56A 2OQ0A 4DV1L 4JI5Q 3HOWG 1EOVA 1QVCA 4OO1G 5LMNL 3AEVA 1Y1VH 1N32L 3GTKH 3M7NA 5JJLA 3M9BA 4GN4B 1B7YB 1WCMH 3DM3A 4JI3L 4R4CA 1BBUA 3ULJA 4DR1Q 2UUBQ 4LUZA 1GO3E 2JA9A 2WP8J 1OXTA 2D0PA 3A5ZB 1N8RC 4IFDG 5H1SE 4LF7Q 2YTVA 4OWXB 3UDFA 3T1YQ 4JI4L 3HOVG 3CCMA 5IYCH 3OYYA 4P71A 2HQLA 1JE5A 3H3VH 1O7IA 4JYAQ 4PMWA 4IJHA 1K73C 5AJ3L 4OX9Q 4X65Q 3J80i 4B3RL 1U5KA 4DV2L 5LMUQ 1VQ4A 2UXCQ 4YCWA 3CP0A 3FP9A 3WWVA 4JI8Q 3A74A 4DV7L 4BBRG 3BJUA 4A76A 2ZTDA 4J15A 1KAWA 4JBKA 1LM0A 1VQNA 4LFCL 5IYBH 3CCUA 3CC4A 3S1NH 3IRBA 2I5HA 4YHHQ 1PH2A 2OCEA 3JAMc 1HNWL 4DV5L 1S40A 1VQ5A 4BY1H 3UE0A 4PG3A 1QVGA 2HT1A 1XMQL 3RNUA 1BBWA 3CCEA 1TWHH 3I2ZA 3I56A 3CCJA 2ASBA 1LYLA 1X65A 1TWCH 3F2CA 3ULPA 1MJEA 2UUCQ 2IX1A 2BA1A 3I4MG 1SROA 2VQFL 1KD1C 3GTMH 1XTDA 2VQEQ 3MXNB 4KHPL 4HIOA 5GQOA 3K7AH 3PSIA 4JI2L 4NXML 5C44G 5C0XI 1PH1A 3NELA 3J81i 1LUZA 4LF8Q 5GAGC 3U58A 5IP7H 3I4MH 2F4VQ 1KRSA 3S17H 2MQHA 1YIJA 3S16H 2K4KA 4DR3L 4QIWE 1NY4A 3D0FA 4QGUA 3S14H 2AKWB 1N36Q 2UUAL 3KFUA 1UEBA 3GTOH 4IFDI 1OXUA 1VQLA 2ZJPA 4JI5L 4DV1Q 1VQKA 1PV4A 1CKOA 4JI6Q 1EYGA 2R93G 1GM5A 2UUBL 1PYSB 5IWAL 4X64L 1CKNA 3CCLA 1FGUA 4GKJL 1VQAA 3TRZA 2E2JH 1XNQL 1RL2A 4JI4Q 3HKZG 3HOVH 1BKBA 1GKHA 3PF5A 2NVXH 2UXDL 2LSSA 4ALPA 1NJIC 4NPSA 4JYAL 4DV0Q 5AJ3Q 2NVTH 3J7A5 5FJ8G 4LF9Q 2Y0SG 1YNXA 3TS2A 1QVFA 1K83H 1YHBA 3PCOB 5C3EG 1QZHA 4PZ8A 3HKZE 3KOJA 4LF4Q 1XMOL 2VZAA 2NVYH 2PI2A 1Y1VG 1Y1WG 4IOCA 2B63H 5C44H 1C0AA 4B3SQ 3KYHC 4DV7Q 1IBML 3I4NG 2JEBI 4NB3A 2E8GA 1VS0A 4LFCQ 3FHWA 3KF6A 4IPDA 3NENA 4DUYL 2MFIA 2ALYB 3CC7A 1SFOH 1NMGA 4HJ5A 1WYDA 4JOIC 2CCZA 3W5OA 1PH8A 4LF5Q 3ERSX 2AWOA 4X62Q 4LWCA 4DAMA 1H95A 2IX0A 2JJQA 3HOUG 1IYJB 4A3JG 4X66Q 1YJWA 1K9MC 4H02A 2K5NA 5IYBG 2D62A 1VQHA 1V1QA 3CD6A 4A3GG 1VQIA 4DV4Q 5IP9G 4B3TL 2F4VL 1IBKL 1UE6A 4UPAA 5HY6A 2HIVA 4L5QA 4BXXG 1N33Q 3G6EA 2EIFA 2JA7H 3BU2A 3CAMA 1X55A 3T1HL 4GKKQ 3STBD 3ZJYC 3DLLA 5IP9H 4MZ9A 3RLOA 4TQUS 2ZJQA 3FKIH 5GAHC 2DGYA 3TQYA 1P16A 2LXKA 1WI5A 3J80c 1XNRL 3UDXA 2RF4A 1VQFA 2JA8G 4K0KL 3CCVA 2B29A 3HOUH 3CCRA 4A3DG 2BH8A 2ID0A 2I0QA 2R7ZG 1WFQA 4DV3Q 1X54A 3HOWH 4DPGA 2NVQH 3CQZH 1E24A 3K7UC 4DR2L 4GOPA 1XNQQ 1X3EA 1VQJA 4UP9A 4P73A 1HNXL 4P75A 1YJ9A 1JB7A 2N49A 4BBSG 2UXDQ 1W3SA 1HR0Q 4OWTB 3J7ZC 3Q8DA 4AQYQ 1G51A 4DV0L 4JI3Q 4IFDJ 4DR7Q 1MJCA 4AIMA 4LF9L 1M90C 3I4NH 2CFMA 3GDEA 4QL5A 2OQKA 1BVSA 2Q2HA 3E9HA 4GNXA 1VQ8A 1NTGA 1R9TH 2VL6A 4POFA 1RIPA 3TS0A 2ZTEA 4LF6Q 5C4XG 4HIKA 2Q2IA 4YWMA 3RLNA 2OWOA 2IY5B 5FJ8H 3S1MH 1G6PA 1VQ9A 4DUYQ 4A3EG 4OX9L 4HJ8A 4TVAB 5IY0A 4LNQA 1WJJA 4L5RC 4DV2Q 2K50A 4A3LG 4OXPA 2A8VA 1HZ9A 3PIOA 1K8AC 2UU9Q 5LMUL 2WFWA 4R4TA 3S24A 1KRTA 2VUMH 2UXCL 1AH9A 1B8AA 2PQAB 1FVIA 4P72A 5JEAG 2ZM6Q 2ES2A 2Y0SE 2R6GA 1XPOA 4OO1I 4GLVB 4X66L 1TWAH 2ZJRA 2NZHA 5J3BA 1PH6A 2RCNA 4L5SA 1L1OA 4Y52H 1NE3A 1VQGA 2R7DA 1QUQA 4UP7A 3STBC 1XMQQ 4P74A 1EQQA 5E7NA 2KCMA 4DV4L 2VS1A 1OTCA 3K81C 3A5UA 2VQFQ 1OXSC 3HOXH 1YEZA 4A3FG 4DK3C 1Q1BA 3F2DA 1VQEA 2Z6KC 4KI0A 1IBLL 3HOYG 2IT1A 3CPFA 4KLKA 4LUOA 2JQOA 5C0XJ 4WJ4A 3AQQA 5IP7G 1TWFH 1X6OA 3D31A 2F3IA 5LMNW 4A3JH 2N8NA 4NXNL 1TXYA 1MIUA 4ME3A 2PI2E 4JBWA 1YHQA 1XNRQ 4DR3Q 1P8LA 3L2PA 1SMXA 4JI1Q 5FLMH 1N34Q 1N36L 2JA5G 2PNHA 4LFBQ 3KF6B 1Q1EA 2MNAA 4A3CG 1HH2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E0E A;  3CMA A;  4DR6 L;  4DR2 Q;  3B6Y A;  5C4J H;  1HNZ L;  3GO5 A;  3I4O A;  1HNX Q;  4DUZ L;  1Q82 C;  1Z9F A;  2AWN A;  2KHJ A;  4FDB A;  4JI6 L;  1HR0 L;  4A3D H;  2VNU D;  1SLJ A;  2JK8 A;  3JC6 6;  5M3M H;  1E1T A;  4HJA A;  1A62 A;  3PUZ A;  3PO2 H;  1SR3 A;  3HOY H;  1KL9 A;  4DNI A;  4HJ9 A;  2D0O A;  3OTO Q;  3G71 A;  5C0X G;  2QEX A;  2HHH Q;  3FKI G;  3VDY A;  3ICE A;  1A63 A;  5IE8 A;  3K8A A;  1TWG H;  5IT9 c;  3CC2 A;  4LF6 L;  3U4Z A;  3PUW A;  1C9O A;  1L2F A;  4LW1 A;  4B3M Q;  4PZ7 A;  3EIV A;  5DLQ E;  1VCI A;  1B70 B;  2RHS B;  3NBH B;  4BXX H;  5JJK A;  4QY7 A;  1PFS A;  2WB1 G;  1CSQ A;  1L0W A;  2E5L Q;  1EWI A;  1ASZ A;  3S15 H;  1QZG A;  2NN6 I;  4A3K G;  1IBM Q;  2EXD A;  3CPW A;  2VUM G;  2PMZ E;  1PHJ A;  1FJG Q;  4C3J H;  3KDF B;  3GTG H;  1D7Q A;  2NN6 G;  2EQS A;  4A3B H;  4A4I A;  4BY7 G;  4AH6 A;  2K5H A;  4A3E H;  1SRU A;  1I6H H;  2I5L X;  2K52 A;  1QUQ B;  4LF5 L;  1V9P A;  5M5Y H;  4RG1 A;  4X62 L;  1E7Z A;  1I94 L;  1LTL A;  2WAQ G;  1KC8 C;  4R4Q A;  1U0L A;  5FLM G;  1CKM A;  2JA6 H;  2Q2U A;  1IL2 A;  3U50 C;  2NZO A;  4DR5 L;  1IBL Q;  1HZB A;  4X6A H;  3AFP A;  1PYB A;  5JEA J;  3GTJ H;  5BR8 L;  2B3G A;  4LFA Q;  2N78 A;  1CKN B;  1Q7Y C;  2I5M X;  2JA6 G;  2QGQ A;  2BH2 A;  4NXN Q;  2JEA I;  5FLX c;  3TEH B;  1I5F A;  2ATW A;  2E2H H;  3HKS A;  4JBJ A;  1N33 L;  4IJL A;  2VW9 A;  1Q8K A;  4IO9 A;  1Y14 B;  4BY1 G;  4A3B G;  4GKK L;  4JV5 Q;  5M3F G;  1YIT A;  4A3M H;  4B3R Q;  1GD7 A;  3PO3 G;  4DKA C;  1CSP A;  1MKH A;  4R4O A;  4BBR H;  4GLX A;  1HNZ Q;  3EN2 A;  1JJ2 A;  4DUZ Q;  4IPC A;  1N32 Q;  4GN5 A;  2MO1 A;  1OXV A;  4AYB E;  1AE3 A;  1AE2 A;  1UWV A;  1PH4 A;  3H0G G;  2OTJ A;  1YBY A;  4K0K Q;  2R93 H;  1S72 A;  1PH9 A;  1HJP A;  3HOZ G;  4JG2 A;  4DV3 L;  4C3H H;  4GOP B;  4WJ3 M;  3PUX A;  2HHH L;  2GN5 A;  3PO3 H;  4A3M G;  3UE1 A;  3T1Y L;  5IYC G;  3M4P A;  4A3L H;  3EBE A;  1YJN A;  1VQ7 A;  1GVP A;  2KEN A;  5GAD C;  1X3G A;  4JI7 L;  2PQA A;  4YWL A;  4B3M L;  3J81 c;  4AQY L;  3RR5 A;  4YY3 Q;  4OWW B;  4DR7 L;  3PUY A;  1W2B A;  1E3P A;  4GNX C;  4OON A;  1M1K C;  4UP8 A;  4IPH A;  4UY8 C;  2K5V A;  5M3M G;  1VQO A;  1WCM G;  1OXX K;  4JI8 L;  2KHI A;  4AYB G;  1VQM A;  1A0I A;  4DR4 L;  2CKZ B;  4APV A;  1FJG L;  2K75 A;  3F8T A;  2N3S A;  3GD7 A;  2R92 G;  3OW2 A;  1WOC A;  3G48 A;  3I55 A;  1Q81 C;  2JA5 H;  2IHE A;  4EQ5 A;  3KF8 B;  1UE5 A;  2UU9 L;  4LFB L;  1I3Q H;  1SE8 A;  2UUC L;  3HFZ B;  2R7Z H;  2ZM6 L;  1JMC A;  1KHI A;  5K36 G;  4XIG S;  3CME A;  4JI0 Q;  2UXB L;  3UDI A;  4DV6 Q;  2JA8 H;  3S2H H;  4DR5 Q;  4A3I G;  3KLW A;  1J5E Q;  4BA1 I;  1JJG A;  1VQD A;  5BR8 Q;  5EAY A;  1JT8 A;  4LFA L;  3GTQ H;  3S1Q H;  2L15 A;  4LF8 L;  3S1R H;  4JC0 A;  2A1A A;  2Z6K A;  1ASY A;  5M5W H;  5M5X H;  2YU9 H;  4GN3 B;  1G29 1;  3KJO A;  4BA2 I;  2QA4 A;  2UUA Q;  3L0O A;  3HOZ H;  3AFQ A;  4DAY B;  1E1O A;  4HIM A;  4A93 H;  2DUD A;  5IYD H;  3NEM A;  2HIX A;  1L1O C;  3H0G H;  3H15 A;  1KQS A;  2C35 B;  2WAQ E;  1PH7 A;  1EIY B;  2ZTC A;  5GAE C;  5HGQ A;  3GTP H;  3RLF A;  1KXL A;  4A3I H;  2RHQ B;  3K80 C;  4JI1 L;  3TRE A;  1N34 L;  1X9N A;  3ER0 A;  5IWA Q;  4X64 Q;  1KIX A;  4IOA A;  4GKJ Q;  1YHA A;  1T9H A;  2V1C C;  3M4O H;  4DR6 Q;  3G4S A;  2E2I H;  3PIP A;  1SN8 A;  2BA0 A;  2K14 A;  4QQB X;  1IZ6 A;  4KHZ A;  4RMF A;  1VQC A;  2YTX A;  5LMN Q;  4A75 A;  3CF5 A;  4JI7 Q;  1PVO A;  2GVA A;  1CUK A;  1EIF A;  2XGT A;  1VQB A;  4MTN A;  4XTC S;  3BZC A;  1UE1 A;  2CWP A;  4C3I H;  4YY3 L;  4DR1 L;  1E22 A;  5ELN A;  1C7Y A;  4LUV A;  3A0J A;  1DGS A;  5GRO A;  3OTO L;  1K8G A;  4LF4 L;  2AHO B;  4JCV E;  1Y1W H;  1XMO Q;  2XTI A;  1FL0 A;  2B63 G;  4LF7 L;  4BBS H;  4EX5 A;  3J81 j;  3RN5 A;  1VQP A;  4B3S L;  5C3E H;  3CCS A;  3K0X A;  3F1Z A;  4DR4 Q;  1EUJ A;  4POG A;  1J6Q A;  1I50 H;  3E9I A;  3M85 A;  1IXR A;  4JBM A;  4Y7N H;  4GOP C;  4A3F H;  4X65 L;  3ULL A;  3HOX G;  1HZA A;  4BY7 H;  2FXQ A;  2YYZ A;  3U4V A;  4GLA C;  3RZO H;  4O2D A;  4L5T A;  3PV0 A;  4MNO A;  2CQO A;  3W1B A;  2E5L L;  3W1G A;  1PH5 A;  1Z47 A;  2AMC B;  1YI2 A;  2Q2T A;  1PA6 A;  2CWA A;  2F52 A;  2JE6 I;  2Z0S A;  2MO0 A;  3BZK A;  4DK6 C;  3RN2 A;  2LXJ A;  4YCU A;  3KDF A;  4A3K H;  3JAM i;  4JI0 L;  2UXB Q;  2GVB A;  3L7Z C;  3CXC A;  4YHH L;  4QJF A;  3M4Q A;  5IYD G;  3CCQ A;  4DV6 L;  1YVC A;  1HNW Q;  4YWK A;  2YV5 A;  1YZ6 A;  4DV5 Q;  1J5E L;  1EFW A;  1K0R A;  2JA7 G;  4A93 G;  1K3R A;  1HZC A;  1NMF A;  1S3O A;  1UE7 A;  1N9W A;  3I7F A;  5ELO A;  4R4I A;  1X3F A;  4HJ7 A;  4B3T Q;  3M3Y H;  4GS3 A;  1V43 A;  1NBW A;  1EQR A;  1PH3 A;  5M3F H;  1I94 Q;  3SGI A;  1IBK Q;  1XPU A;  3GTL H;  2VY3 A;  4A3G H;  2WB1 E;  2VQE L;  1VQ6 A;  4KHP Q;  1Q12 A;  3MEF A;  5C4X H;  4GNX B;  4JI2 Q;  3T1H Q;  1HR0 W;  4NXM Q;  3H3V I;  2KCT A;  3PO2 G;  3PF4 A;  1JJC B;  5JJI A;  3RZD H;  2R7F A;  4YCV A;  1XJV A;  1Q86 C;  3F2B A;  2YTY A;  4HID A;  4O0A A;  1Q46 A;  1D8L A;  2A19 A;  2KBN A;  4IPG A;  2H5X A;  3AYH B;  4C2M H;  3S2D H;  3PGZ A;  1L1O B;  3UDG A;  1XPR A;  2OTL A;  4A3C H;  2IHF A;  3PUV A;  3KJP A;  4JV5 L;  4JOI A;  2R92 H;  1A8V A;  4PZ6 A;  4R1J A;  3LGJ A;  3CW2 C;  1X56 A;  2OQ0 A;  4DV1 L;  4JI5 Q;  3HOW G;  1EOV A;  1QVC A;  4OO1 G;  5LMN L;  3AEV A;  1Y1V H;  1N32 L;  3GTK H;  3M7N A;  5JJL A;  3M9B A;  4GN4 B;  1B7Y B;  1WCM H;  3DM3 A;  4JI3 L;  4R4C A;  1BBU A;  3ULJ A;  4DR1 Q;  2UUB Q;  4LUZ A;  1GO3 E;  2JA9 A;  2WP8 J;  1OXT A;  2D0P A;  3A5Z B;  1N8R C;  4IFD G;  5H1S E;  4LF7 Q;  2YTV A;  4OWX B;  3UDF A;  3T1Y Q;  4JI4 L;  3HOV G;  3CCM A;  5IYC H;  3OYY A;  4P71 A;  2HQL A;  1JE5 A;  3H3V H;  1O7I A;  4JYA Q;  4PMW A;  4IJH A;  1K73 C;  5AJ3 L;  4OX9 Q;  4X65 Q;  3J80 i;  4B3R L;  1U5K A;  4DV2 L;  5LMU Q;  1VQ4 A;  2UXC Q;  4YCW A;  3CP0 A;  3FP9 A;  3WWV A;  4JI8 Q;  3A74 A;  4DV7 L;  4BBR G;  3BJU A;  4A76 A;  2ZTD A;  4J15 A;  1KAW A;  4JBK A;  1LM0 A;  1VQN A;  4LFC L;  5IYB H;  3CCU A;  3CC4 A;  3S1N H;  3IRB A;  2I5H A;  4YHH Q;  1PH2 A;  2OCE A;  3JAM c;  1HNW L;  4DV5 L;  1S40 A;  1VQ5 A;  4BY1 H;  3UE0 A;  4PG3 A;  1QVG A;  2HT1 A;  1XMQ L;  3RNU A;  1BBW A;  3CCE A;  1TWH H;  3I2Z A;  3I56 A;  3CCJ A;  2ASB A;  1LYL A;  1X65 A;  1TWC H;  3F2C A;  3ULP A;  1MJE A;  2UUC Q;  2IX1 A;  2BA1 A;  3I4M G;  1SRO A;  2VQF L;  1KD1 C;  3GTM H;  1XTD A;  2VQE Q;  3MXN B;  4KHP L;  4HIO A;  5GQO A;  3K7A H;  3PSI A;  4JI2 L;  4NXM L;  5C44 G;  5C0X I;  1PH1 A;  3NEL A;  3J81 i;  1LUZ A;  4LF8 Q;  5GAG C;  3U58 A;  5IP7 H;  3I4M H;  2F4V Q;  1KRS A;  3S17 H;  2MQH A;  1YIJ A;  3S16 H;  2K4K A;  4DR3 L;  4QIW E;  1NY4 A;  3D0F A;  4QGU A;  3S14 H;  2AKW B;  1N36 Q;  2UUA L;  3KFU A;  1UEB A;  3GTO H;  4IFD I;  1OXU A;  1VQL A;  2ZJP A;  4JI5 L;  4DV1 Q;  1VQK A;  1PV4 A;  1CKO A;  4JI6 Q;  1EYG A;  2R93 G;  1GM5 A;  2UUB L;  1PYS B;  5IWA L;  4X64 L;  1CKN A;  3CCL A;  1FGU A;  4GKJ L;  1VQA A;  3TRZ A;  2E2J H;  1XNQ L;  1RL2 A;  4JI4 Q;  3HKZ G;  3HOV H;  1BKB A;  1GKH A;  3PF5 A;  2NVX H;  2UXD L;  2LSS A;  4ALP A;  1NJI C;  4NPS A;  4JYA L;  4DV0 Q;  5AJ3 Q;  2NVT H;  3J7A 5;  5FJ8 G;  4LF9 Q;  2Y0S G;  1YNX A;  3TS2 A;  1QVF A;  1K83 H;  1YHB A;  3PCO B;  5C3E G;  1QZH A;  4PZ8 A;  3HKZ E;  3KOJ A;  4LF4 Q;  1XMO L;  2VZA A;  2NVY H;  2PI2 A;  1Y1V G;  1Y1W G;  4IOC A;  2B63 H;  5C44 H;  1C0A A;  4B3S Q;  3KYH C;  4DV7 Q;  1IBM L;  3I4N G;  2JEB I;  4NB3 A;  2E8G A;  1VS0 A;  4LFC Q;  3FHW A;  3KF6 A;  4IPD A;  3NEN A;  4DUY L;  2MFI A;  2ALY B;  3CC7 A;  1SFO H;  1NMG A;  4HJ5 A;  1WYD A;  4JOI C;  2CCZ A;  3W5O A;  1PH8 A;  4LF5 Q;  3ERS X;  2AWO A;  4X62 Q;  4LWC A;  4DAM A;  1H95 A;  2IX0 A;  2JJQ A;  3HOU G;  1IYJ B;  4A3J G;  4X66 Q;  1YJW A;  1K9M C;  4H02 A;  2K5N A;  5IYB G;  2D62 A;  1VQH A;  1V1Q A;  3CD6 A;  4A3G G;  1VQI A;  4DV4 Q;  5IP9 G;  4B3T L;  2F4V L;  1IBK L;  1UE6 A;  4UPA A;  5HY6 A;  2HIV A;  4L5Q A;  4BXX G;  1N33 Q;  3G6E A;  2EIF A;  2JA7 H;  3BU2 A;  3CAM A;  1X55 A;  3T1H L;  4GKK Q;  3STB D;  3ZJY C;  3DLL A;  5IP9 H;  4MZ9 A;  3RLO A;  4TQU S;  2ZJQ A;  3FKI H;  5GAH C;  2DGY A;  3TQY A;  1P16 A;  2LXK A;  1WI5 A;  3J80 c;  1XNR L;  3UDX A;  2RF4 A;  1VQF A;  2JA8 G;  4K0K L;  3CCV A;  2B29 A;  3HOU H;  3CCR A;  4A3D G;  2BH8 A;  2ID0 A;  2I0Q A;  2R7Z G;  1WFQ A;  4DV3 Q;  1X54 A;  3HOW H;  4DPG A;  2NVQ H;  3CQZ H;  1E24 A;  3K7U C;  4DR2 L;  4GOP A;  1XNQ Q;  1X3E A;  1VQJ A;  4UP9 A;  4P73 A;  1HNX L;  4P75 A;  1YJ9 A;  1JB7 A;  2N49 A;  4BBS G;  2UXD Q;  1W3S A;  1HR0 Q;  4OWT B;  3J7Z C;  3Q8D A;  4AQY Q;  1G51 A;  4DV0 L;  4JI3 Q;  4IFD J;  4DR7 Q;  1MJC A;  4AIM A;  4LF9 L;  1M90 C;  3I4N H;  2CFM A;  3GDE A;  4QL5 A;  2OQK A;  1BVS A;  2Q2H A;  3E9H A;  4GNX A;  1VQ8 A;  1NTG A;  1R9T H;  2VL6 A;  4POF A;  1RIP A;  3TS0 A;  2ZTE A;  4LF6 Q;  5C4X G;  4HIK A;  2Q2I A;  4YWM A;  3RLN A;  2OWO A;  2IY5 B;  5FJ8 H;  3S1M H;  1G6P A;  1VQ9 A;  4DUY Q;  4A3E G;  4OX9 L;  4HJ8 A;  4TVA B;  5IY0 A;  4LNQ A;  1WJJ A;  4L5R C;  4DV2 Q;  2K50 A;  4A3L G;  4OXP A;  2A8V A;  1HZ9 A;  3PIO A;  1K8A C;  2UU9 Q;  5LMU L;  2WFW A;  4R4T A;  3S24 A;  1KRT A;  2VUM H;  2UXC L;  1AH9 A;  1B8A A;  2PQA B;  1FVI A;  4P72 A;  5JEA G;  2ZM6 Q;  2ES2 A;  2Y0S E;  2R6G A;  1XPO A;  4OO1 I;  4GLV B;  4X66 L;  1TWA H;  2ZJR A;  2NZH A;  5J3B A;  1PH6 A;  2RCN A;  4L5S A;  1L1O A;  4Y52 H;  1NE3 A;  1VQG A;  2R7D A;  1QUQ A;  4UP7 A;  3STB C;  1XMQ Q;  4P74 A;  1EQQ A;  5E7N A;  2KCM A;  4DV4 L;  2VS1 A;  1OTC A;  3K81 C;  3A5U A;  2VQF Q;  1OXS C;  3HOX H;  1YEZ A;  4A3F G;  4DK3 C;  1Q1B A;  3F2D A;  1VQE A;  2Z6K C;  4KI0 A;  1IBL L;  3HOY G;  2IT1 A;  3CPF A;  4KLK A;  4LUO A;  2JQO A;  5C0X J;  4WJ4 A;  3AQQ A;  5IP7 G;  1TWF H;  1X6O A;  3D31 A;  2F3I A;  5LMN W;  4A3J H;  2N8N A;  4NXN L;  1TXY A;  1MIU A;  4ME3 A;  2PI2 E;  4JBW A;  1YHQ A;  1XNR Q;  4DR3 Q;  1P8L A;  3L2P A;  1SMX A;  4JI1 Q;  5FLM H;  1N34 Q;  1N36 L;  2JA5 G;  2PNH A;  4LFB Q;  3KF6 B;  1Q1E A;  2MNA A;  4A3C G;  1HH2 P; 
#chains in the Genus database with same CATH topology
 1SXT A;  1KDB A;  1SEB D;  2F0V A;  3D4R A;  3E0E A;  4XYO A;  3MTS A;  3CMA A;  3KUP A;  1EEI D;  3GO5 A;  1SNP A;  3I4O A;  1ENF A;  1RHP A;  4OGQ C;  1HNX Q;  1Q82 C;  1Z9F A;  2KHJ A;  1QJO A;  4FDB A;  2EPB A;  4JI6 L;  5M5W B;  1CI3 M;  5M3M H;  1E1T A;  4FF1 A;  3PUZ A;  4KTA A;  2B2T A;  3HOY H;  4HJ9 A;  3I70 A;  2QEX A;  4FF3 A;  1J8I A;  1F2Y A;  3GTM B;  3K8A A;  1TWG H;  5IT9 c;  1B9N A;  1C9O A;  2R7Z B;  1L2F A;  4B3M Q;  2EY5 A;  1B70 B;  2RHS B;  4QY7 A;  1PFS A;  3PMF A;  1RJT A;  2E5L Q;  1ASZ A;  1QZG A;  3K5M A;  2B2T C;  2L0C A;  2NN6 I;  4A3K G;  5E1F A;  3VR2 A;  3GTG H;  2J4X A;  2KQ3 A;  1KDC A;  2EQS A;  5JPN C;  1LT6 D;  5HGT A;  4A3E H;  2G5D A;  4BBR B;  2E75 C;  3CRK C;  3MAQ A;  2OEO A;  3HP3 A;  4X62 L;  1PLF A;  2WAQ G;  2K33 A;  5FLM G;  3K5L A;  2ZXR A;  3SEB A;  3U50 C;  1PYB A;  5JEA J;  3GTJ H;  1QNU A;  4LFA Q;  2N78 A;  1CKN B;  2JA6 G;  3R3O A;  3HOX B;  3MA2 B;  4ZUJ A;  1H9M A;  5ISR A;  3M7G A;  1WCM B;  4JBJ A;  5CV7 A;  3MWY W;  4DFA A;  4BS9 A;  1VMC A;  4IO9 A;  1I6V C;  4GKK L;  4ZQ3 A;  3PO3 G;  4GLX A;  1I4G A;  1II3 A;  4NDX A;  1ML0 D;  2MO1 A;  1OXV A;  1PH4 A;  1AE3 A;  3OSO A;  3KBX A;  1PTO B;  4K0K Q;  2F0T A;  1S72 A;  1HJP A;  2Z6B A;  2QCP X;  2GN5 A;  1NAP A;  3T1Y L;  5KRU A;  5IYC G;  1GVP A;  4B3M L;  4AQY L;  1PTO D;  1YNJ D;  2XNA C;  4KD3 A;  1U4P A;  3P20 A;  4MHE A;  4XQJ A;  1SYG A;  1VQO A;  1HHV A;  1B44 D;  4DXG A;  2KHI A;  2F0J A;  1F9P A;  1WD0 A;  4APV A;  3MXG A;  3F8T A;  3GD7 A;  1MSG A;  1WOC A;  2O2L D;  2RSO A;  2JA5 H;  5KEE A;  3KF8 B;  1K8M A;  1I3Q H;  1SE8 A;  3PQI A;  4QCL A;  2R7Z H;  3HRZ C;  1PZI D;  3I4L A;  4XIG S;  3UDI A;  2JA8 H;  1CK1 A;  1SJE D;  4A3I G;  1IKM A;  5EAY A;  1JT8 A;  4LFA L;  3MVV A;  3GTQ H;  5FKA C;  4LF8 L;  3S1R H;  2EZV A;  5M5W H;  2YU9 H;  1G29 1;  4KK7 A;  3VYS A;  3KJO A;  2UUA Q;  1ZEQ X;  4DAY B;  4HIM A;  1E1O A;  4KMU C;  5K5P A;  4K5X A;  1PZJ D;  3OWF A;  1KQS A;  2F0E A;  2EVB A;  5C0X H;  3K57 A;  3RLF A;  1ENA A;  4JI1 L;  4A3M B;  4X64 Q;  2JP1 A;  3E3X A;  1AFP A;  2V1C C;  4FNF A;  4DR6 Q;  2EJF C;  3PIP A;  2BA0 A;  4QIW B;  5T1G A;  2Y0S B;  2YTX A;  2K5Q A;  3CF5 A;  4A75 A;  5EJW A;  2TSS A;  1CUK A;  4MTN A;  4XTC S;  3BZC A;  1UE1 A;  3S1R B;  3OTO L;  1LV9 A;  1WTR A;  2CVR A;  2F0N A;  4FF4 A;  3J81 j;  5COR A;  3BYT B;  3NXW A;  1STE A;  1TS3 A;  2XWB B;  3K0X A;  4B3S L;  3N6R A;  5FO8 B;  5IGG A;  1IXR A;  4RGN A;  3IFT A;  4GOP C;  2RVL A;  3HOX G;  4BY7 H;  1A6X A;  4GLA C;  2AQ2 B;  3ERQ A;  1F2L A;  2KED A;  1HRJ A;  1ICW A;  1VF7 A;  3KDF A;  1EY0 A;  1I3Q B;  3H91 A;  3IFD A;  5IYD G;  1HNW Q;  2YV5 A;  3SK4 A;  2JA7 G;  2F0M A;  2B8G A;  1NUC A;  1HZC A;  1IL8 A;  4NP5 A;  1NMF A;  1UE7 A;  1GOZ A;  1U4L A;  3H6M A;  1VMP A;  2HUG A;  4HJ7 A;  4B3T Q;  4A3D B;  4GS3 A;  1V43 A;  1PH3 A;  1I94 Q;  4MN3 A;  3SGI A;  4DAV A;  1EQT A;  1V8Q A;  4A3G H;  2M9V A;  1MD2 D;  4RGM A;  1Q12 A;  1BCP F;  5C4X H;  3J81 E;  3K0Y A;  4JI2 Q;  3HOW B;  4E6I A;  3PO2 G;  2KCT A;  2VB2 X;  2R7F A;  1TR5 A;  4EVO A;  3O13 A;  3PIO 3;  3QIA A;  2YTY A;  2NWG A;  1Q46 A;  2HCI A;  2KBN A;  1M4V A;  4C2M H;  3PGZ A;  4CGY B;  3KJP A;  4JOI A;  2ICI A;  3LGJ A;  3L9A X;  4JK1 C;  2Z4H A;  2OQ0 A;  1PTO H;  4OO1 G;  1Y1V H;  3M9B A;  1B7Y B;  1WCM H;  4R4C A;  5NUC A;  2A68 D;  3M4O B;  1Q3L A;  3A5Z B;  1N8R C;  4HTH A;  2WAC A;  3UDF A;  3ONA B;  4JI4 L;  3HOV G;  3OYY A;  4P71 A;  1JCK B;  4HSV A;  3TDQ A;  4JYA Q;  1K73 C;  3FVQ A;  1LTT D;  2KVM A;  1C4Q A;  4X3T A;  1VQ4 A;  4BBR G;  2EYM A;  4A3G B;  4LFC L;  3CC4 A;  1B3A A;  1TS2 A;  1PH2 A;  4AYB B;  1HNW L;  3KF8 A;  1S40 A;  3UE0 A;  4OHJ A;  1SYC A;  1WVL A;  4LFB Q;  3CCE A;  3S2H B;  3CCJ A;  1CTM A;  2F03 A;  1TWC H;  2EDG A;  1BCP D;  4UDU C;  2BA1 A;  2VXW A;  1SRO A;  1KD1 C;  1KTK A;  1STA A;  1S5F D;  1D6E C;  3K7A H;  1FD7 D;  3T4A C;  4JI2 L;  1A15 A;  3RMH A;  5C0X I;  3J81 i;  5GAG C;  3DMU A;  1KRS A;  2N55 A;  2CW0 C;  1YIJ A;  1S5C D;  2K4K A;  3S16 H;  2AKW B;  1UEB A;  4HSP A;  4HR7 B;  3GTO H;  1B1Z A;  1OXU A;  2ENB A;  2B2V A;  1CKO A;  4BY1 B;  1EYG A;  3HKZ B;  1BBX C;  1PYS B;  3SK5 A;  4OIK A;  4NW2 A;  1CKN A;  5CV5 A;  1RL2 A;  4JI4 Q;  3HOV H;  3OMC A;  3VR3 A;  2NTS A;  4ALP A;  4JYA L;  2CH4 A;  4OIJ A;  3J7A 5;  5KNC A;  4LF9 Q;  4LF4 Q;  1YHB A;  5C3E G;  3KOJ A;  1A3U A;  3VR4 A;  2E2I B;  2VZA A;  1Y1V G;  1Y1W G;  2B63 H;  3IAY A;  2JEB I;  4NB3 A;  2E8G A;  1VS0 A;  3NK9 A;  4LFC Q;  3FHW A;  4ZRZ A;  1DD2 A;  4KY6 A;  3CC7 A;  1EFI D;  1SFO H;  1NMG A;  4HJ5 A;  3QB3 A;  3BDO A;  1WYD A;  4HAE A;  4JOI C;  4N9T A;  1PH8 A;  4LF5 Q;  3ERS X;  1TWA B;  3X3N A;  1H95 A;  1SJH D;  4XQN A;  1YJW A;  4H02 A;  2K5N A;  2L55 A;  3WOF A;  2RSN A;  3MXU A;  3CD6 A;  4PMC A;  4A3G G;  1VQI A;  1UE6 A;  1DOL A;  5HY6 A;  2HIV A;  1N33 Q;  1KLU D;  2JA7 H;  3CAM A;  2R3Z A;  3STB D;  3DLL A;  4MZ9 A;  4R8N A;  1CZW A;  3FKI H;  5GAH C;  1UEA B;  1WI5 A;  1ROD A;  3UDX A;  3CCV A;  5C4J B;  2ID0 A;  4G57 A;  4KKS A;  1ENC A;  4DV3 Q;  1BO0 A;  3CQZ H;  1E24 A;  3KK7 A;  3K7U C;  4GOP A;  1VQJ A;  4UP9 A;  3M4Y A;  2MPM A;  5CBE E;  1PTO F;  2D9U A;  5JOB A;  1G51 A;  4LF9 L;  2DNE A;  3I4N H;  3E9H A;  3T51 B;  1HPC A;  1NTG A;  2VL6 A;  4POF A;  1RIP A;  3WOE A;  2Z1C A;  2CQA A;  2ZTE A;  4X3K A;  2F0P A;  2Q2I A;  2IY5 B;  3S1M H;  1VQ9 A;  5EPL A;  5CGK A;  4TVA B;  2JSO A;  4L5R C;  5EBD A;  5TSS A;  2R93 B;  4KKU A;  4OXP A;  2UU9 Q;  3PIO A;  3GTJ B;  2F0K A;  2A8V A;  4R4T A;  1AH9 A;  2VUM H;  2ZM6 Q;  1DCZ A;  2LY7 A;  4I65 A;  1XPO A;  4DK1 A;  1KAA A;  2BE5 C;  5J3B A;  2RCN A;  3Q24 A;  2MJ8 A;  5FOB B;  3MXP A;  4FXG C;  5G3L F;  3GTK B;  3H0G B;  2VS1 A;  4KKT A;  4DF7 A;  1OXS C;  4DK3 C;  1VQE A;  3J7Y W;  4WJ4 A;  2JQO A;  3AQQ A;  1TWF H;  4A3J H;  2F3I A;  2R92 B;  1MIU A;  4G7O C;  3A7L A;  3L2P A;  2JA5 G;  2PNH A;  5C5L A;  2A6H C;  4A3C G;  3R8B A;  2JA8 B;  1A3V A;  1PMR A;  3B6Y A;  3S2D B;  4DUZ L;  1B4O A;  3Q6S A;  4ZK9 B;  1SLJ A;  1CQV A;  2A68 C;  2K28 A;  1A62 A;  2F1M A;  1SR3 A;  3AMU A;  1KL9 A;  3FDT A;  2D0O A;  3G71 A;  1B3Q A;  3DEP A;  2HHH Q;  2LFN A;  3FKI G;  5LL6 S;  3J80 L;  3PUW A;  1GHK A;  3PO2 B;  4LW1 A;  4CJ1 B;  2FHT A;  3SVM A;  4K2L A;  3EIV A;  1VCI A;  3NBH B;  5JJK A;  2DNC A;  2WB1 G;  2A6E C;  2NYZ D;  3I4M B;  3S15 H;  2QKI C;  1T5X D;  2VUM G;  2JA7 B;  1PTO C;  1YNJ C;  5ELD A;  1D7Q A;  1O80 A;  2KEC A;  4A4I A;  1S4Z A;  4AH6 A;  1EY4 A;  1RKN A;  2I5L X;  2PW7 A;  1O7Y A;  1V9P A;  5M5Y H;  4RG1 A;  2RDH A;  3TZU A;  1LTL A;  3KLS A;  1HFN A;  1KC8 C;  3NTI A;  4R4Q A;  2JA6 H;  1CKM A;  2Q2U A;  2I46 A;  3R2I A;  5E4X A;  2NZO A;  3PO3 B;  4IUN A;  2PQE A;  4X6A H;  4K14 A;  1LT3 D;  2KHS A;  1Q7Y C;  2I5M X;  1GHJ A;  1AEX A;  1I5F A;  2L12 A;  2L9H A;  1AW7 A;  4IJL A;  2VW9 A;  2JA6 B;  3T53 B;  2KUM A;  4BY1 G;  2OF1 A;  5M3F G;  2KEE A;  4IUQ A;  1EZ6 A;  3AB9 A;  1LTA D;  1JJ2 A;  4DUZ Q;  1ILP A;  1N32 Q;  4JPB W;  2E2H B;  1UWV A;  1AE2 A;  1QIL A;  3I90 A;  1PH9 A;  4GOP B;  4WJ3 M;  3PUX A;  1D2B A;  2HHH L;  4A3M G;  3EBE A;  3OMG A;  4JI7 L;  4YWL A;  1C48 A;  1TS4 A;  5EPJ A;  4DR7 L;  1W2B A;  1GXD C;  4IPH A;  2K5V A;  5M3M G;  1NSN S;  1OXX K;  3DWA A;  4RWS C;  5M9O A;  4AYB G;  4PMB A;  3LWU A;  4FXD A;  5EGT A;  1JB3 A;  2K75 A;  2R92 G;  3OW2 A;  3G48 A;  5DM7 3;  1Q81 C;  4EQ5 A;  3TP8 A;  4XT1 B;  1M8A A;  2B2Y A;  1B53 A;  2XRQ D;  3K5N A;  2UXB L;  5KNB A;  2BDN A;  4CDD C;  3NWS A;  2A6E D;  1GUN A;  4JC0 A;  4GN3 B;  2HQE A;  1CHQ D;  5I9O A;  3A7A B;  1F9R A;  1EYA A;  1JIC A;  2QF7 A;  4C3H G;  3L0O A;  3HOZ H;  3AFQ A;  4A93 H;  3H0G H;  2WAQ E;  1LT4 D;  1EIY B;  3TME A;  5A2Q L;  3UI2 A;  4O1N A;  5HGQ A;  3GTP H;  1KXL A;  4NKL A;  1X9N A;  5IWA Q;  3J7A F;  2I07 B;  1KIX A;  3NWT A;  1T9H A;  1F77 A;  2K03 A;  4TSS A;  5CV6 A;  1SN8 A;  2LKV A;  4KHZ A;  5C44 B;  3EA6 A;  4JI7 Q;  2O5I C;  4DR1 L;  5KND A;  1HTL D;  1PRT B;  2P5Z X;  4LUV A;  3A0J A;  5EBC A;  1K8G A;  2AHO B;  4JCV E;  3RN5 A;  1VQP A;  1I4Q A;  1BQQ T;  4POG A;  3SDZ A;  4JBM A;  1JJG A;  2YYZ A;  3RZO H;  4L5T A;  3PV0 A;  3W1B A;  2CQO A;  1U9R A;  3NP8 A;  4FF2 A;  1CM9 A;  1PH5 A;  1Z47 A;  1XYI A;  4ZLT F;  4CDE C;  1QCB D;  1PA6 A;  2JE6 I;  3BZK A;  3NPP A;  4YCU A;  3JAM i;  4OEM B;  1Q8I A;  4DAY A;  3J7A V;  2GVB A;  2UXB Q;  4CDF C;  4QJF A;  3DWQ A;  3M4Q A;  5EKI A;  3SR1 A;  1IHZ A;  4DV5 Q;  4A93 G;  1K0R A;  1K3R A;  4IQZ A;  4CJ0 B;  1N9W A;  4H0L C;  1L0Y B;  3M3Y H;  5M3F H;  1Z6H A;  3HZX A;  4YIJ A;  3D8G A;  1SBB B;  2WB1 E;  1VQ6 A;  5ELO A;  4KHP Q;  2F0O A;  5T1I A;  4NXM Q;  2B2W A;  1QOH A;  1STH A;  4IAL A;  5JJI A;  4RHR A;  4YCV A;  4HID A;  4QB4 A;  1DYQ A;  3ND8 A;  3AYH B;  2PZW A;  3S2D H;  3TP5 A;  2PMZ B;  3UDG A;  1XPR A;  4RFB A;  2OTL A;  4JV5 L;  2R92 H;  1A8V A;  5ELF A;  2H4O A;  2F0S A;  3S1N B;  4DV1 L;  4JI5 Q;  1IW7 C;  4C3H B;  3M7N A;  5LL6 X;  2C5C A;  3ULJ A;  4FO2 A;  4JI3 L;  3Q0A A;  4DR1 Q;  4LUZ A;  2JA9 A;  3DM1 A;  4IFD G;  1PFN A;  2MUY A;  4OWX B;  3J80 E;  1DON A;  3H3V H;  3I8Z A;  3EFX D;  4FP5 D;  3J80 i;  4B3R L;  1U5K A;  1STB A;  5LMU Q;  2UXC Q;  3CP0 A;  3FP9 A;  4JI8 Q;  3S1N H;  3NTH A;  3GTL B;  1LTG D;  1HFG A;  2OCE A;  4DV5 L;  4BY1 H;  1VQ5 A;  3GP7 A;  1QVG A;  1XMQ L;  3RNU A;  3I2Z A;  1LYL A;  1NR2 A;  3OWE B;  3ULP A;  1MJE A;  2UUC Q;  2QDL A;  1EIH A;  3GTM H;  2VQF L;  4HMI A;  5IGC A;  4KHP L;  5GQO A;  3A55 A;  4NXM L;  1DXM A;  5C44 G;  2SNM A;  1D1I A;  1FNV A;  3GQB A;  1E0B A;  3BVM A;  3NEL A;  4KHV A;  3S17 H;  3NBH A;  1KAB A;  1DOK A;  4DR3 L;  2DJF C;  1DJR D;  1NY4 A;  2K32 A;  5KIX A;  3NBI A;  4QF4 A;  4IFD I;  3FEW X;  1IKL A;  2XIW A;  1VQL A;  2ZJP A;  1O7Z A;  4JI5 L;  3J81 L;  4DV1 Q;  2DJG C;  1XXG A;  4JI6 Q;  4X3U A;  1TVX A;  3H09 A;  3CCL A;  1SAP A;  4GKJ L;  4J6H A;  1VQA A;  4M8A A;  1XNQ L;  3HKZ G;  1WTQ A;  1BKB A;  3KLS X;  2UXD L;  1PYW D;  2LSS A;  1XX8 A;  4NPS A;  1PXU A;  2EY1 A;  4DV0 Q;  4F7X A;  1YNX A;  3P75 A;  3SK8 A;  1K83 H;  3TS2 A;  1PFM A;  5JJZ A;  1XMO L;  4MIU A;  2PI2 A;  3HS0 C;  3HEJ A;  4IOC A;  5C44 H;  3KYH C;  3I4N G;  4IUT A;  1G91 A;  1A3T A;  2E74 C;  4IPD A;  2MFI A;  1S5B D;  3OW7 A;  2L1B A;  1AZQ A;  2AWO A;  4X62 Q;  3MFY A;  4DAM A;  3C46 A;  4A3J G;  4X66 Q;  5M5Y B;  1K9M C;  4C2M B;  2FIN B;  1VQH A;  4C1N I;  3G7L A;  2KOL A;  3C3L A;  3I73 A;  4KV6 A;  5FK9 C;  1IBK L;  4HCE A;  4UPA A;  2TMP A;  1TII D;  2EIF A;  1DOM A;  3BU2 A;  1X55 A;  4TKO B;  3T1H L;  4GKK Q;  4U67 3;  1CHP D;  3A8J E;  4TQU S;  1TU2 B;  1EY7 A;  3GV3 A;  4H44 C;  1FNU A;  3GTO B;  2DGY A;  3TQY A;  1P16 A;  2K01 A;  1XNR L;  2GA4 B;  2RF4 A;  4ZCK A;  4K0K L;  5K36 H;  4Z9C B;  4DPG A;  2NVQ H;  5CV4 A;  4I7Z C;  1X3Q A;  4DR2 L;  1GUW A;  1XNQ Q;  1HH2 P;  2N49 A;  3HOY B;  2UXD Q;  5C6A A;  3Q8D A;  4AQY Q;  3TBI B;  4DV0 L;  1NR4 A;  2F0F A;  1IYU A;  3K5O A;  1LTI D;  3GDE A;  4A3F B;  3FPP A;  4QL5 A;  1MHW C;  4QUC A;  1BVS A;  2AUJ D;  5BN3 A;  4GNX A;  3MEH A;  3TS0 A;  4LF6 Q;  4HIK A;  4YWM A;  4ABN A;  4A3E G;  4OX9 L;  2DY8 A;  2NZ1 D;  1WTO A;  4DV2 Q;  4A3L G;  3V96 A;  1HZ9 A;  1K8A C;  3S24 A;  2WB1 B;  1TY2 A;  1FVI A;  3SXH A;  5D65 A;  4OO1 I;  4X66 L;  1G8Z D;  1QG7 A;  3I91 A;  3NUC A;  1L1O A;  1QUQ A;  5E7N A;  2KCM A;  1OTC A;  3BVZ A;  1ZYR C;  3A5U A;  1Q1B A;  4KI0 A;  3Q23 A;  3HOY G;  1SMY C;  2IT1 A;  2NUC A;  3CPF A;  4KLK A;  4S3S A;  1X6O A;  5IGB A;  3A54 A;  4NXN L;  2PI2 E;  3EQL C;  4JBW A;  1XNR Q;  5A35 A;  4JI1 Q;  1N36 L;  1FR3 A;  3KF6 B;  1Q1E A;  2MNA A;  1STN A;  3I4N B;  4CBV A;  1JOQ A;  1IW7 D;  4DR2 Q;  4DR6 L;  5C4J H;  3MFG A;  4ILW A;  1HQR D;  1HNZ L;  2PYK A;  2AWN A;  1PRT D;  2SEB D;  4UAI A;  2Z9H A;  3JC6 6;  4HJA A;  4ZKC B;  3CQZ B;  4DN4 M;  4WFN 3;  3OTO Q;  4ID6 A;  1SNM A;  3VDY A;  3CC2 A;  1WTP A;  4LF6 L;  4PZ7 A;  4K2K A;  1EYD A;  1PZK D;  4M1U B;  4DGZ A;  4CJ2 C;  1CSQ A;  1TY0 A;  5FO9 B;  3S17 B;  1L0W A;  1EWI A;  2XSC A;  4IN3 A;  2RBM A;  3U9O A;  1FYC A;  1IBM Q;  2EXD A;  4CHT B;  1BR9 A;  3DHQ A;  2EE1 A;  3KDF B;  1Y8P B;  2VB3 X;  2F3W A;  3L3O C;  2NN6 G;  2M2L A;  2FFK B;  4B9W A;  3V05 A;  2OT2 A;  1I6H H;  5E3F A;  1QUQ B;  1E7Z A;  1I94 L;  2G9D A;  1IL2 A;  1K3B C;  4DR5 L;  1HZB A;  5BR8 L;  4LK1 C;  2B3G A;  2F0Q A;  2M00 A;  1SFO B;  2BH2 A;  4NXN Q;  3BZD B;  1H9J A;  1TS5 A;  2JYO A;  5FLX c;  1SYF A;  3RD4 A;  3TEH B;  2ATW A;  4ME5 A;  3HKS A;  2A69 C;  1HA6 A;  3V2T A;  5LHY 1;  1Y14 B;  4A3B G;  1JOR A;  4DXF A;  1I4X A;  4A3M H;  4TRD A;  1MKH A;  1ESF A;  2V4D A;  4BBR H;  1HNZ Q;  3EN2 A;  4IPC A;  4GN5 A;  4AYB E;  3H0G G;  1YBY A;  2WKD A;  2R93 H;  3HOZ G;  4XXE A;  1EY9 A;  2B8F A;  4C3H H;  1T5E A;  1HQM C;  4FXK C;  4Q0F A;  2E2D C;  2IPK D;  2K05 A;  3W3A A;  4A3L H;  1YJN A;  1VQ7 A;  3K59 A;  2KEN A;  3J81 c;  3K58 A;  4YY3 Q;  4OWW B;  3H3V C;  2PZU A;  3GTQ B;  3PUY A;  1E3P A;  4GNX C;  1M1K C;  3K6O A;  4UY8 C;  1TWG B;  3VYU A;  1WCM G;  2JA5 B;  3DXJ C;  1VQM A;  1EWH A;  5CR3 A;  1A0I A;  1K0S A;  3OIQ A;  2N3S A;  4LAA A;  3I55 A;  4LFB L;  1JWU D;  2HDL A;  5C4Z A;  4R8I A;  1I50 B;  1JMC A;  1KHI A;  5K36 G;  3OPO A;  2SNS A;  2X6G A;  1F9S A;  1TKW B;  3KLR A;  4HCS A;  4DV6 Q;  4DR5 Q;  3S2H H;  2F0W A;  1J5E Q;  5BR8 Q;  5J39 A;  2QDB A;  2A1A A;  2Z6K A;  5M5X H;  1LO5 D;  3GV6 A;  2FMC A;  2QEJ C;  4J8Q A;  2DUD A;  1BF4 A;  5IYD H;  3NEM A;  2HIX A;  3H15 A;  2C35 B;  2ZTC A;  4N8F A;  5GAE C;  1D5Z C;  4A3I H;  3VA5 A;  3T16 A;  2AQ1 B;  3K80 C;  1N34 L;  3ER0 A;  5FLX L;  5JPM C;  3M4O H;  3G4S A;  1SSO A;  1K8O A;  4RCO A;  2EYP A;  5LMN Q;  2B63 B;  2EYF A;  1PVO A;  2XGT A;  1VQB A;  4YY3 L;  4ODG A;  5M5X B;  4IZ8 A;  1C7Y A;  4LF4 L;  5GRO A;  2XVS A;  3MC0 B;  2BDO A;  4A3E B;  1BCP C;  2Q8R E;  4LF7 L;  4BBS H;  4EX5 A;  3URY A;  4A93 B;  2KJX A;  1J6Q A;  1I50 H;  3E9I A;  3M85 A;  4Y7N H;  4X65 L;  3ULL A;  4K6L A;  1HZA A;  1AP0 A;  2E5L L;  3W1G A;  4G4K A;  1G2T A;  1RCV D;  1U4R A;  1H9S B;  2Q2T A;  2IWH A;  3RN2 A;  4DK6 C;  2MO0 A;  4ZAI A;  2B2U A;  4U68 A;  4IUV A;  4RGO S;  1ET9 A;  3CXC A;  4YHH L;  5CV9 A;  4DV6 L;  1YVC A;  5KYL A;  1ESR A;  1EFW A;  1J5E L;  1J9O A;  3BS1 A;  3NQT A;  1NCV A;  3I7F A;  1QB5 D;  1X3F A;  1NBW A;  1EQR A;  5M3M B;  4IUR A;  2VQE L;  4GNX B;  2NVQ B;  4K5W A;  5IGE A;  3H3V I;  1O78 A;  3P7J A;  3RZD H;  1B9M A;  1STG A;  3ND9 A;  5I4D A;  1GJX A;  1XJV A;  1YNN D;  4L6T B;  2RA4 A;  1TWC B;  4O0A A;  1D8L A;  4JW0 A;  2EYL A;  1KNA A;  2L11 A;  3OHX C;  4A3C H;  3ERO A;  3CRL C;  2A6H D;  4R1J A;  5DNF A;  2F0H A;  4N9P A;  3CW2 C;  1X56 A;  4F87 A;  1QVC A;  3BDC A;  1B50 A;  2MHV A;  5LMN L;  3GTK H;  1HUN A;  1BBU A;  3CU7 A;  2WP8 J;  1OXT A;  2D0P A;  3E0J A;  2DY7 A;  5IOC A;  5H1S E;  4LF7 Q;  2YTV A;  3T1Y Q;  2R61 A;  3CCM A;  5IYC H;  2O4X A;  1LTB D;  2ICE C;  1JE5 A;  1O7I A;  2NVY B;  4IJH A;  4JVZ A;  5AJ3 L;  5ELB A;  4X65 Q;  4KJN A;  4MTK A;  2HDM A;  1I6H B;  3FRP B;  4YCW A;  5C5M A;  5COY A;  3WDN A;  4DV7 L;  4A76 A;  1VQN A;  4IFD H;  4JBK A;  1KAW A;  3CCU A;  1BNZ A;  1ZYR D;  2I5H A;  4YHH Q;  5IT9 L;  4CKB A;  3JAM c;  4PG3 A;  4OL7 A;  1UNS A;  3I56 A;  2ASB A;  1EQV A;  4B9X A;  3F2C A;  2RDF A;  3I4M G;  1A2U A;  2J7Z A;  5E4W C;  1EEF D;  1XTD A;  5EKL A;  2VQE Q;  3MXN B;  4HIO A;  3PSI A;  2IW3 A;  3KBG A;  4EQN A;  4K8J A;  2Z4I A;  5IT9 E;  1LUZ A;  4LF8 Q;  3HGB A;  3U58 A;  4EQO A;  2F4V Q;  3I4M H;  3LX0 A;  3HG9 A;  4GZY C;  3FKI B;  1G6Z A;  4QIW E;  4QGU A;  2UUA L;  3KFU A;  2C9O A;  3H94 A;  3HOU B;  1R4Q B;  1PRT F;  3T13 A;  1GM5 A;  5EPK A;  1SE2 A;  4X64 L;  5F2D A;  1SE4 A;  1EU3 A;  3C2P A;  2AQ3 B;  4DAP A;  4G7Z C;  4ULL A;  1EOT A;  3R93 A;  1NJI C;  5AJ3 Q;  5FJ8 G;  3BDL A;  4EQP A;  3R2T A;  1QZH A;  1RD9 D;  1GUS A;  1WTX A;  2NVY H;  5KGU A;  1C0A A;  4IUP A;  4B3S Q;  2L5T A;  5I2Y A;  4DV7 Q;  2CW0 D;  2RKS A;  1U4M A;  1AN8 A;  3D3R A;  3QJY A;  4XYQ A;  1Y8N B;  3GTG B;  1R9T B;  2IX0 A;  3HOU G;  4QUF A;  5HUR A;  4DV4 Q;  4B3T L;  2LMC B;  2F4V L;  3RZD B;  4BXX G;  4C3J B;  3ITP A;  3G6E A;  1WTH A;  1CA5 A;  2A73 B;  2E2J B;  3ZJY C;  3LWE A;  5IP9 H;  2ZJQ A;  3T56 B;  3S16 B;  4KY7 A;  3S14 B;  2LXK A;  3J80 c;  5IIF A;  1VQF A;  2B2U C;  3A56 A;  3K7A B;  1WTW A;  3CCR A;  4A3D G;  1WFQ A;  4A3K B;  1DZ1 A;  4OO1 H;  2D5D A;  1EIG A;  4K8I A;  1X3E A;  4P73 A;  4P75 A;  1JB7 A;  4BBS G;  2K1B A;  1HR0 Q;  3M3Y B;  3I3C A;  4DR7 Q;  1MJC A;  4AIM A;  1M90 C;  1TWH B;  1HTP A;  1SYE A;  2OQK A;  3QWN A;  2F0D A;  2IL8 A;  2JXM B;  1VQ8 A;  2KCN A;  1R9T H;  4RH6 A;  2CH4 W;  2PW5 A;  5D14 A;  1PRT C;  5C4X G;  2OWO A;  2K04 A;  3QOJ A;  4HJ8 A;  5IY0 A;  1KLG D;  4LNQ A;  1WJJ A;  4K6D A;  3A8K E;  1ICF B;  2WFW A;  3D4W A;  1B8A A;  3D6C A;  1JQY D;  1E2Z A;  1ET6 A;  5JEA G;  2ES2 A;  2R6G A;  4DNT B;  2WV6 D;  3NTK A;  5EQ0 A;  4ZKB B;  1PH6 A;  4L5S A;  5JEA H;  4Y52 H;  1NE3 A;  2R7D A;  1JC7 A;  4P74 A;  5A2Q E;  1K83 B;  4PQX A;  1I4R A;  3TP7 A;  4DV4 L;  4A3I B;  1A2T A;  1I4P A;  2K5D A;  3HOX H;  1YEZ A;  2OXP A;  2D2C C;  2Z6K C;  2ZT9 C;  1ILQ A;  2RCF A;  3NSW A;  4NMZ A;  4LUO A;  1IBL L;  4R9W A;  1WD1 A;  2F0G A;  1S5E D;  5I6Y A;  2Z8L A;  5IP7 G;  4WOR A;  5LMN W;  5IGD A;  3NQI A;  1SNC A;  4ME3 A;  1YHQ A;  1P8L A;  5J22 A;  4RGT A;  2F4I A;  3VYT A;  5C3X A;  3QG1 A;  4C1N K;  5FO7 B;  1XWE A;  4L8J A;  1CA6 A;  4A3D H;  2CHB D;  2VNU D;  1HR0 L;  3S9W A;  2JK8 A;  1KDA A;  3PO2 H;  4XDX A;  1QE6 A;  1Q90 A;  4DNI A;  2MGS A;  3BYY B;  2XRS D;  5C0X G;  4L63 B;  1A63 A;  2K6A A;  2WKC A;  5IE8 A;  5J1Z A;  3U4Z A;  3P1H A;  1W6J A;  4PNY A;  1Z7T A;  1D5X C;  4RA8 A;  5DLQ E;  4BXX H;  4CKC A;  1QWY A;  1V1P A;  2EJG C;  2MP1 A;  3CPW A;  2PMZ E;  2K5W A;  1PHJ A;  1FJG Q;  4DK0 A;  4C3J H;  3VR5 A;  4CKE A;  4A3B H;  1BXT A;  2Q8T A;  3SHL A;  4BY7 G;  2K5H A;  1SRU A;  2K52 A;  2NTT A;  4LF5 L;  1TWF B;  2H1E A;  1W6K A;  2LS0 1;  1KNE A;  5C3E B;  1U0L A;  2EJM A;  4H13 C;  4X3S A;  1IBL Q;  3AFP A;  5L37 A;  5JVH 3;  2IX3 A;  2QGQ A;  1X3P A;  2JEA I;  1DM0 B;  4C3I B;  3JAM L;  3TN2 A;  2NVT B;  2WIN B;  2E2H H;  1E2W A;  1LTS D;  1EL0 A;  1N33 L;  1Q8K A;  3TP6 A;  2BE5 D;  4JV5 Q;  2NN6 H;  5C3W A;  1FGB D;  1D1K A;  1HA5 A;  1YIT A;  5CYU A;  4DNR B;  1GD7 A;  1D5M C;  4DKA C;  1CSP A;  1OO9 B;  4R4O A;  2YU9 B;  1EY5 A;  1JWS D;  1H9R A;  2OTJ A;  2BCO A;  3VYR A;  1RDP D;  1Y1V B;  1LAC A;  4JG2 A;  1SYB A;  4DV3 L;  4WJW A;  3PO3 H;  3UE1 A;  2IJ0 A;  3M4P A;  4BWG B;  1H9S A;  2SOB A;  5GAD C;  1X3G A;  2KCC A;  2PQA A;  4IUU A;  4LMQ D;  3RR5 A;  3DUZ A;  3VR6 A;  2RQX A;  4V19 0;  3S1Q B;  4B3R Q;  3F2U A;  4OON A;  4UP8 A;  4JI8 L;  3NE5 B;  1B2T A;  1GUT A;  4RKB A;  2CKZ B;  4DR4 L;  2BOS A;  1FJG L;  3CKI B;  4C3I G;  1V1O A;  1FNW A;  3TSS A;  2IHE A;  5DM6 3;  1UE5 A;  2UU9 L;  2WAQ B;  1RTN A;  2UUC L;  2QW7 A;  5I6W A;  3HFZ B;  2ZM6 L;  1PFB A;  3OOC A;  3CME A;  1RF2 D;  3N52 A;  4JI0 Q;  4XQQ A;  2X6L A;  3KLW A;  4BA1 I;  1VQD A;  4EGV A;  3RZO B;  3S1Q H;  2L15 A;  1ASY A;  1AZP A;  1CFM A;  2WII B;  1IYV A;  4XT3 B;  4BA2 I;  2ZXP A;  2QA4 A;  5I9P A;  2PNR C;  4PV1 C;  1L1O C;  3EVQ A;  1PH7 A;  2EYJ A;  2RHQ B;  3TRE A;  4IOA A;  4GKJ Q;  1YHA A;  1E2V A;  2E2I H;  1EY8 A;  2K14 A;  4QQB X;  1IZ6 A;  2SDF A;  3D4D A;  4RMF A;  1VQC A;  2GVA A;  1EIF A;  4C3I H;  4V0B A;  3VA7 A;  3ICE A;  2CWP A;  1E22 A;  5ELN A;  4J1M A;  1DGS A;  3HOV B;  1EY6 A;  1Y1W H;  1XMO Q;  2B63 G;  2XTI A;  1FL0 A;  2NVX B;  1GUO A;  2FMM A;  5C3E H;  3CCS A;  3F1Z A;  4DR4 Q;  1EUJ A;  3OIP A;  3E5S A;  4A3F H;  2FXQ A;  3U4V A;  4O2D A;  4MNO A;  2AMC B;  1YI2 A;  1SE3 A;  2PZT A;  2CWA A;  2F52 A;  2Z0S A;  3C1F A;  4A3K H;  2LXJ A;  1MI2 A;  5FLX E;  4K5V A;  4JI0 L;  3L7Z C;  3W2D A;  2EY2 A;  5KYI A;  2B2V C;  3CCQ A;  3DEO A;  4YWK A;  1YZ6 A;  2O5J C;  4KN4 C;  4C56 C;  1S3O A;  4R4I A;  1S5D D;  3D6W A;  1IBK Q;  1EYC A;  1XPU A;  1JOK A;  3GTL H;  4DU9 A;  2K7V A;  2VY3 A;  5BN4 A;  3MEF A;  3NHH A;  2XN9 C;  3T1H Q;  1HR0 W;  4HMJ A;  4F88 A;  2B39 A;  3U9S A;  3PF4 A;  2EY6 A;  1JJC B;  1ONL A;  1YNN C;  1Q86 C;  3F2B A;  3IKJ A;  2A19 A;  4IPG A;  2H5X A;  1JR0 D;  4DA2 A;  4B08 A;  1L1O B;  4HN7 A;  1EWC A;  2IHF A;  3PUV A;  1Y1W B;  2NB0 A;  5JAV A;  4PZ6 A;  4BBS B;  2L4N A;  3E6Z X;  3SE0 A;  2EYO A;  1GUG A;  1EOV A;  3HOW G;  4ZUI A;  3AEV A;  1TQO A;  1SNQ A;  1N32 L;  5JJL A;  4GN4 B;  3DM3 A;  1LT5 D;  2UUB Q;  5CV8 A;  1GO3 E;  1EU4 A;  1Y69 U;  4KJO A;  1MGS A;  1LTR D;  2A69 D;  4RCN A;  1R4P B;  2HQL A;  3BG3 A;  4PMW A;  4OX9 Q;  1TT2 A;  1BDO A;  4DV2 L;  1SND A;  1RTO A;  2JN4 A;  1STY A;  1HUM A;  4KY5 A;  3WWV A;  2QIL A;  3A74 A;  1ZKO A;  3BJU A;  2N88 A;  2ZTD A;  4J15 A;  1LM0 A;  5IYB H;  5EKK A;  3IRB A;  4KD4 A;  3G6J B;  3S15 B;  3X3M A;  2X69 A;  2EYH A;  3ZYY X;  2HT1 A;  1MBY A;  1BBW A;  5JVG 3;  1TWH H;  1SNO A;  2PPB C;  1X65 A;  3TZD A;  2IX1 A;  3FPU B;  2HD3 A;  5CMD A;  2A5H A;  3FMC A;  1ZXT A;  1SYD A;  3QR8 A;  1PH1 A;  1V1P B;  2HCC A;  1F2Z A;  2E76 C;  1UUP A;  5IP7 H;  2MQH A;  4HED A;  2F0I A;  4N8X 1;  4H7B A;  5IGF A;  5D3D A;  3SK6 A;  3D0F A;  3S14 H;  2FJ2 A;  1N36 Q;  4FYD A;  2KA7 A;  1L0X B;  1JE4 A;  4C3J G;  1PDQ A;  1C8C A;  1VQK A;  2PCF B;  1PV4 A;  4BY7 B;  1WTV A;  3JAM E;  2R93 G;  1BOS A;  2UUB L;  5IWA L;  1FGU A;  4A3J B;  3TRZ A;  2E2J H;  5DAU A;  1GKH A;  3PF5 A;  2NVX H;  3IL8 A;  2NVT H;  3DWP A;  2Y0S G;  3MZ5 A;  1QVF A;  3PCO B;  4LJZ C;  4PZ8 A;  3HKZ E;  5G3L D;  2NBF A;  3BVG A;  1F9Q A;  3HOZ B;  3MXN A;  1IBM L;  3C1E A;  1CQF A;  3KF6 A;  5I2X A;  3NEN A;  4DUY L;  2ALY B;  1LLR D;  4P2C B;  2VUM B;  3MHB A;  3EJI A;  3QO2 A;  2CCZ A;  3RUZ A;  3W5O A;  4A3B B;  3LNN A;  3I72 A;  4LWC A;  1EZ8 A;  3S1M B;  2JJQ A;  1IYJ B;  1SDF A;  4ZYS A;  3CHB D;  5IYB G;  2D62 A;  4WRD A;  4UHV A;  2J0T D;  2B2W C;  1V1Q A;  1BCP B;  5IP9 G;  5CBA E;  4L5Q A;  4RHS A;  1X32 A;  5CC4 A;  4F8M A;  4I7A A;  1O7L A;  1HXY D;  3RLO A;  1G2S A;  5M3F B;  1VF5 C;  2F3V A;  1HCZ A;  2JA8 G;  1LAB A;  2B29 A;  2RDG A;  3HOU H;  2BH8 A;  2I0Q A;  2AUK A;  2R7Z G;  1X54 A;  3HOW H;  5C4X B;  2F0U A;  1BUV T;  5ELC A;  1HNX L;  2PO4 A;  1YJ9 A;  1W3S A;  2XWJ B;  4OWT B;  4Y7N B;  3J7Z C;  4JI3 Q;  4IFD J;  1SMY D;  4RAU C;  5D3I B;  4G7H C;  1F2M A;  2CFM A;  2Q2H A;  1VDZ A;  3Q22 A;  1H9K A;  1JWM D;  4RKL A;  2F0L A;  3RLN A;  1G6P A;  5FJ8 H;  4DUY Q;  1UAP A;  2K50 A;  1QNK A;  4KN7 C;  5LMU L;  2UXC L;  1KRT A;  2PQA B;  3QOL A;  4P72 A;  4Q5V A;  2Y0S E;  2G9H D;  4GLV B;  5C4H A;  1TWA H;  2ZJR A;  2NZH A;  5BN5 A;  1K28 A;  2DN8 A;  1VQG A;  4CDC C;  1JOO A;  4UP7 A;  1CZG A;  3STB C;  1XMQ Q;  1EQQ A;  1I4H A;  2Q8I B;  3GTP B;  5IOD A;  2EOT A;  3K81 C;  2VQF Q;  4A3F G;  3F2D A;  1NNX A;  2A74 C;  4QMG A;  5C0X J;  1MSH A;  1CT1 D;  4FVM A;  3D31 A;  2N8N A;  2EXZ A;  1TXY A;  3PIP 3;  1XTC D;  1Y8O B;  4O42 A;  4DR3 Q;  2B2Y C;  4OEL B;  1SMX A;  5AFW A;  5FLM H;  1N34 Q;  5ELE A;  3AU7 A;  2ZXO A;  3A8I E;  5DEH A; 
#chains in the Genus database with same CATH homology
 3E0E A;  3CMA A;  4DR6 L;  4DR2 Q;  3B6Y A;  5C4J H;  1HNZ L;  3GO5 A;  3I4O A;  1HNX Q;  4DUZ L;  1Q82 C;  1Z9F A;  2AWN A;  2KHJ A;  4FDB A;  4JI6 L;  1HR0 L;  4A3D H;  2VNU D;  1SLJ A;  2JK8 A;  3JC6 6;  5M3M H;  1E1T A;  4HJA A;  1A62 A;  3PUZ A;  3PO2 H;  1SR3 A;  3HOY H;  1KL9 A;  4DNI A;  4HJ9 A;  2D0O A;  3OTO Q;  3G71 A;  5C0X G;  2QEX A;  2HHH Q;  3FKI G;  3VDY A;  3ICE A;  1A63 A;  5IE8 A;  3K8A A;  1TWG H;  5IT9 c;  3CC2 A;  4LF6 L;  3U4Z A;  3PUW A;  1C9O A;  1L2F A;  4LW1 A;  4B3M Q;  4PZ7 A;  3EIV A;  5DLQ E;  1VCI A;  1B70 B;  2RHS B;  3NBH B;  4BXX H;  5JJK A;  4QY7 A;  1PFS A;  2WB1 G;  1CSQ A;  1L0W A;  2E5L Q;  1EWI A;  1ASZ A;  3S15 H;  1QZG A;  2NN6 I;  4A3K G;  1IBM Q;  2EXD A;  3CPW A;  2VUM G;  2PMZ E;  1PHJ A;  1FJG Q;  4C3J H;  3KDF B;  3GTG H;  1D7Q A;  2NN6 G;  2EQS A;  4A3B H;  4A4I A;  4BY7 G;  4AH6 A;  2K5H A;  4A3E H;  1SRU A;  1I6H H;  2I5L X;  2K52 A;  1QUQ B;  4LF5 L;  1V9P A;  5M5Y H;  4RG1 A;  4X62 L;  1E7Z A;  1I94 L;  1LTL A;  2WAQ G;  1KC8 C;  4R4Q A;  1U0L A;  5FLM G;  1CKM A;  2JA6 H;  2Q2U A;  1IL2 A;  3U50 C;  2NZO A;  4DR5 L;  1IBL Q;  1HZB A;  4X6A H;  3AFP A;  1PYB A;  5JEA J;  3GTJ H;  5BR8 L;  2B3G A;  4LFA Q;  2N78 A;  1CKN B;  1Q7Y C;  2I5M X;  2JA6 G;  2QGQ A;  2BH2 A;  4NXN Q;  2JEA I;  5FLX c;  3TEH B;  1I5F A;  2ATW A;  2E2H H;  3HKS A;  4JBJ A;  1N33 L;  4IJL A;  2VW9 A;  1Q8K A;  4IO9 A;  1Y14 B;  4BY1 G;  4A3B G;  4GKK L;  4JV5 Q;  5M3F G;  1YIT A;  4A3M H;  4B3R Q;  1GD7 A;  3PO3 G;  4DKA C;  1CSP A;  1MKH A;  4R4O A;  4BBR H;  4GLX A;  1HNZ Q;  3EN2 A;  1JJ2 A;  4DUZ Q;  4IPC A;  1N32 Q;  4GN5 A;  2MO1 A;  1OXV A;  4AYB E;  1AE3 A;  1AE2 A;  1UWV A;  1PH4 A;  3H0G G;  2OTJ A;  1YBY A;  4K0K Q;  2R93 H;  1S72 A;  1PH9 A;  1HJP A;  3HOZ G;  4JG2 A;  4DV3 L;  4C3H H;  4GOP B;  4WJ3 M;  3PUX A;  2HHH L;  2GN5 A;  3PO3 H;  4A3M G;  3UE1 A;  3T1Y L;  5IYC G;  3M4P A;  4A3L H;  3EBE A;  1YJN A;  1VQ7 A;  1GVP A;  2KEN A;  5GAD C;  1X3G A;  4JI7 L;  2PQA A;  4YWL A;  4B3M L;  3J81 c;  4AQY L;  3RR5 A;  4YY3 Q;  4OWW B;  4DR7 L;  3PUY A;  1W2B A;  1E3P A;  4GNX C;  4OON A;  1M1K C;  4UP8 A;  4IPH A;  4UY8 C;  2K5V A;  5M3M G;  1VQO A;  1WCM G;  1OXX K;  4JI8 L;  2KHI A;  4AYB G;  1VQM A;  1A0I A;  4DR4 L;  2CKZ B;  4APV A;  1FJG L;  2K75 A;  3F8T A;  2N3S A;  3GD7 A;  2R92 G;  3OW2 A;  1WOC A;  3G48 A;  3I55 A;  1Q81 C;  2JA5 H;  2IHE A;  4EQ5 A;  3KF8 B;  1UE5 A;  2UU9 L;  4LFB L;  1I3Q H;  1SE8 A;  2UUC L;  3HFZ B;  2R7Z H;  2ZM6 L;  1JMC A;  1KHI A;  5K36 G;  4XIG S;  3CME A;  4JI0 Q;  2UXB L;  3UDI A;  4DV6 Q;  2JA8 H;  3S2H H;  4DR5 Q;  4A3I G;  3KLW A;  1J5E Q;  4BA1 I;  1JJG A;  1VQD A;  5BR8 Q;  5EAY A;  1JT8 A;  4LFA L;  3GTQ H;  3S1Q H;  2L15 A;  4LF8 L;  3S1R H;  4JC0 A;  2A1A A;  2Z6K A;  1ASY A;  5M5W H;  5M5X H;  2YU9 H;  4GN3 B;  1G29 1;  3KJO A;  4BA2 I;  2QA4 A;  2UUA Q;  3L0O A;  3HOZ H;  3AFQ A;  4DAY B;  1E1O A;  4HIM A;  4A93 H;  2DUD A;  5IYD H;  3NEM A;  2HIX A;  1L1O C;  3H0G H;  3H15 A;  1KQS A;  2C35 B;  2WAQ E;  1PH7 A;  1EIY B;  2ZTC A;  5GAE C;  5HGQ A;  3GTP H;  3RLF A;  1KXL A;  4A3I H;  2RHQ B;  3K80 C;  4JI1 L;  3TRE A;  1N34 L;  1X9N A;  3ER0 A;  5IWA Q;  4X64 Q;  1KIX A;  4IOA A;  4GKJ Q;  1YHA A;  1T9H A;  2V1C C;  3M4O H;  4DR6 Q;  3G4S A;  2E2I H;  3PIP A;  1SN8 A;  2BA0 A;  2K14 A;  4QQB X;  1IZ6 A;  4KHZ A;  4RMF A;  1VQC A;  2YTX A;  5LMN Q;  4A75 A;  3CF5 A;  4JI7 Q;  1PVO A;  2GVA A;  1CUK A;  1EIF A;  2XGT A;  1VQB A;  4MTN A;  4XTC S;  3BZC A;  1UE1 A;  2CWP A;  4C3I H;  4YY3 L;  4DR1 L;  1E22 A;  5ELN A;  1C7Y A;  4LUV A;  3A0J A;  1DGS A;  5GRO A;  3OTO L;  1K8G A;  4LF4 L;  2AHO B;  4JCV E;  1Y1W H;  1XMO Q;  2XTI A;  1FL0 A;  2B63 G;  4LF7 L;  4BBS H;  4EX5 A;  3J81 j;  3RN5 A;  1VQP A;  4B3S L;  5C3E H;  3CCS A;  3K0X A;  3F1Z A;  4DR4 Q;  1EUJ A;  4POG A;  1J6Q A;  1I50 H;  3E9I A;  3M85 A;  1IXR A;  4JBM A;  4Y7N H;  4GOP C;  4A3F H;  4X65 L;  3ULL A;  3HOX G;  1HZA A;  4BY7 H;  2FXQ A;  2YYZ A;  3U4V A;  4GLA C;  3RZO H;  4O2D A;  4L5T A;  3PV0 A;  4MNO A;  2CQO A;  3W1B A;  2E5L L;  3W1G A;  1PH5 A;  1Z47 A;  2AMC B;  1YI2 A;  2Q2T A;  1PA6 A;  2CWA A;  2F52 A;  2JE6 I;  2Z0S A;  2MO0 A;  3BZK A;  4DK6 C;  3RN2 A;  2LXJ A;  4YCU A;  3KDF A;  4A3K H;  3JAM i;  4JI0 L;  2UXB Q;  2GVB A;  3L7Z C;  3CXC A;  4YHH L;  4QJF A;  3M4Q A;  5IYD G;  3CCQ A;  4DV6 L;  1YVC A;  1HNW Q;  4YWK A;  2YV5 A;  1YZ6 A;  4DV5 Q;  1J5E L;  1EFW A;  1K0R A;  2JA7 G;  4A93 G;  1K3R A;  1HZC A;  1NMF A;  1S3O A;  1UE7 A;  1N9W A;  3I7F A;  5ELO A;  4R4I A;  1X3F A;  4HJ7 A;  4B3T Q;  3M3Y H;  4GS3 A;  1V43 A;  1NBW A;  1EQR A;  1PH3 A;  5M3F H;  1I94 Q;  3SGI A;  1IBK Q;  1XPU A;  3GTL H;  2VY3 A;  4A3G H;  2WB1 E;  2VQE L;  1VQ6 A;  4KHP Q;  1Q12 A;  3MEF A;  5C4X H;  4GNX B;  4JI2 Q;  3T1H Q;  1HR0 W;  4NXM Q;  3H3V I;  2KCT A;  3PO2 G;  3PF4 A;  1JJC B;  5JJI A;  3RZD H;  2R7F A;  4YCV A;  1XJV A;  1Q86 C;  3F2B A;  2YTY A;  4HID A;  4O0A A;  1Q46 A;  1D8L A;  2A19 A;  2KBN A;  4IPG A;  2H5X A;  3AYH B;  4C2M H;  3S2D H;  3PGZ A;  1L1O B;  3UDG A;  1XPR A;  2OTL A;  4A3C H;  2IHF A;  3PUV A;  3KJP A;  4JV5 L;  4JOI A;  2R92 H;  1A8V A;  4PZ6 A;  4R1J A;  3LGJ A;  3CW2 C;  1X56 A;  2OQ0 A;  4DV1 L;  4JI5 Q;  3HOW G;  1EOV A;  1QVC A;  4OO1 G;  5LMN L;  3AEV A;  1Y1V H;  1N32 L;  3GTK H;  3M7N A;  5JJL A;  3M9B A;  4GN4 B;  1B7Y B;  1WCM H;  3DM3 A;  4JI3 L;  4R4C A;  1BBU A;  3ULJ A;  4DR1 Q;  2UUB Q;  4LUZ A;  1GO3 E;  2JA9 A;  2WP8 J;  1OXT A;  2D0P A;  3A5Z B;  1N8R C;  4IFD G;  5H1S E;  4LF7 Q;  2YTV A;  4OWX B;  3UDF A;  3T1Y Q;  4JI4 L;  3HOV G;  3CCM A;  5IYC H;  3OYY A;  4P71 A;  2HQL A;  1JE5 A;  3H3V H;  1O7I A;  4JYA Q;  4PMW A;  4IJH A;  1K73 C;  5AJ3 L;  4OX9 Q;  4X65 Q;  3J80 i;  4B3R L;  1U5K A;  4DV2 L;  5LMU Q;  1VQ4 A;  2UXC Q;  4YCW A;  3CP0 A;  3FP9 A;  3WWV A;  4JI8 Q;  3A74 A;  4DV7 L;  4BBR G;  3BJU A;  4A76 A;  2ZTD A;  4J15 A;  1KAW A;  4JBK A;  1LM0 A;  1VQN A;  4LFC L;  5IYB H;  3CCU A;  3CC4 A;  3S1N H;  3IRB A;  2I5H A;  4YHH Q;  1PH2 A;  2OCE A;  3JAM c;  1HNW L;  4DV5 L;  1S40 A;  1VQ5 A;  4BY1 H;  3UE0 A;  4PG3 A;  1QVG A;  2HT1 A;  1XMQ L;  3RNU A;  1BBW A;  3CCE A;  1TWH H;  3I2Z A;  3I56 A;  3CCJ A;  2ASB A;  1LYL A;  1X65 A;  1TWC H;  3F2C A;  3ULP A;  1MJE A;  2UUC Q;  2IX1 A;  2BA1 A;  3I4M G;  1SRO A;  2VQF L;  1KD1 C;  3GTM H;  1XTD A;  2VQE Q;  3MXN B;  4KHP L;  4HIO A;  5GQO A;  3K7A H;  3PSI A;  4JI2 L;  4NXM L;  5C44 G;  5C0X I;  1PH1 A;  3NEL A;  3J81 i;  1LUZ A;  4LF8 Q;  5GAG C;  3U58 A;  5IP7 H;  3I4M H;  2F4V Q;  1KRS A;  3S17 H;  2MQH A;  1YIJ A;  3S16 H;  2K4K A;  4DR3 L;  4QIW E;  1NY4 A;  3D0F A;  4QGU A;  3S14 H;  2AKW B;  1N36 Q;  2UUA L;  3KFU A;  1UEB A;  3GTO H;  4IFD I;  1OXU A;  1VQL A;  2ZJP A;  4JI5 L;  4DV1 Q;  1VQK A;  1PV4 A;  1CKO A;  4JI6 Q;  1EYG A;  2R93 G;  1GM5 A;  2UUB L;  1PYS B;  5IWA L;  4X64 L;  1CKN A;  3CCL A;  1FGU A;  4GKJ L;  1VQA A;  3TRZ A;  2E2J H;  1XNQ L;  1RL2 A;  4JI4 Q;  3HKZ G;  3HOV H;  1BKB A;  1GKH A;  3PF5 A;  2NVX H;  2UXD L;  2LSS A;  4ALP A;  1NJI C;  4NPS A;  4JYA L;  4DV0 Q;  5AJ3 Q;  2NVT H;  3J7A 5;  5FJ8 G;  4LF9 Q;  2Y0S G;  1YNX A;  3TS2 A;  1QVF A;  1K83 H;  1YHB A;  3PCO B;  5C3E G;  1QZH A;  4PZ8 A;  3HKZ E;  3KOJ A;  4LF4 Q;  1XMO L;  2VZA A;  2NVY H;  2PI2 A;  1Y1V G;  1Y1W G;  4IOC A;  2B63 H;  5C44 H;  1C0A A;  4B3S Q;  3KYH C;  4DV7 Q;  1IBM L;  3I4N G;  2JEB I;  4NB3 A;  2E8G A;  1VS0 A;  4LFC Q;  3FHW A;  3KF6 A;  4IPD A;  3NEN A;  4DUY L;  2MFI A;  2ALY B;  3CC7 A;  1SFO H;  1NMG A;  4HJ5 A;  1WYD A;  4JOI C;  2CCZ A;  3W5O A;  1PH8 A;  4LF5 Q;  3ERS X;  2AWO A;  4X62 Q;  4LWC A;  4DAM A;  1H95 A;  2IX0 A;  2JJQ A;  3HOU G;  1IYJ B;  4A3J G;  4X66 Q;  1YJW A;  1K9M C;  4H02 A;  2K5N A;  5IYB G;  2D62 A;  1VQH A;  1V1Q A;  3CD6 A;  4A3G G;  1VQI A;  4DV4 Q;  5IP9 G;  4B3T L;  2F4V L;  1IBK L;  1UE6 A;  4UPA A;  5HY6 A;  2HIV A;  4L5Q A;  4BXX G;  1N33 Q;  3G6E A;  2EIF A;  2JA7 H;  3BU2 A;  3CAM A;  1X55 A;  3T1H L;  4GKK Q;  3STB D;  3ZJY C;  3DLL A;  5IP9 H;  4MZ9 A;  3RLO A;  4TQU S;  2ZJQ A;  3FKI H;  5GAH C;  2DGY A;  3TQY A;  1P16 A;  2LXK A;  1WI5 A;  3J80 c;  1XNR L;  3UDX A;  2RF4 A;  1VQF A;  2JA8 G;  4K0K L;  3CCV A;  2B29 A;  3HOU H;  3CCR A;  4A3D G;  2BH8 A;  2ID0 A;  2I0Q A;  2R7Z G;  1WFQ A;  4DV3 Q;  1X54 A;  3HOW H;  4DPG A;  2NVQ H;  3CQZ H;  1E24 A;  3K7U C;  4DR2 L;  4GOP A;  1XNQ Q;  1X3E A;  1VQJ A;  4UP9 A;  4P73 A;  1HNX L;  4P75 A;  1YJ9 A;  1JB7 A;  2N49 A;  4BBS G;  2UXD Q;  1W3S A;  1HR0 Q;  4OWT B;  3J7Z C;  3Q8D A;  4AQY Q;  1G51 A;  4DV0 L;  4JI3 Q;  4IFD J;  4DR7 Q;  1MJC A;  4AIM A;  4LF9 L;  1M90 C;  3I4N H;  2CFM A;  3GDE A;  4QL5 A;  2OQK A;  1BVS A;  2Q2H A;  3E9H A;  4GNX A;  1VQ8 A;  1NTG A;  1R9T H;  2VL6 A;  4POF A;  1RIP A;  3TS0 A;  2ZTE A;  4LF6 Q;  5C4X G;  4HIK A;  2Q2I A;  4YWM A;  3RLN A;  2OWO A;  2IY5 B;  5FJ8 H;  3S1M H;  1G6P A;  1VQ9 A;  4DUY Q;  4A3E G;  4OX9 L;  4HJ8 A;  4TVA B;  5IY0 A;  4LNQ A;  1WJJ A;  4L5R C;  4DV2 Q;  2K50 A;  4A3L G;  4OXP A;  2A8V A;  1HZ9 A;  3PIO A;  1K8A C;  2UU9 Q;  5LMU L;  2WFW A;  4R4T A;  3S24 A;  1KRT A;  2VUM H;  2UXC L;  1AH9 A;  1B8A A;  2PQA B;  1FVI A;  4P72 A;  5JEA G;  2ZM6 Q;  2ES2 A;  2Y0S E;  2R6G A;  1XPO A;  4OO1 I;  4GLV B;  4X66 L;  1TWA H;  2ZJR A;  2NZH A;  5J3B A;  1PH6 A;  2RCN A;  4L5S A;  1L1O A;  4Y52 H;  1NE3 A;  1VQG A;  2R7D A;  1QUQ A;  4UP7 A;  3STB C;  1XMQ Q;  4P74 A;  1EQQ A;  5E7N A;  2KCM A;  4DV4 L;  2VS1 A;  1OTC A;  3K81 C;  3A5U A;  2VQF Q;  1OXS C;  3HOX H;  1YEZ A;  4A3F G;  4DK3 C;  1Q1B A;  3F2D A;  1VQE A;  2Z6K C;  4KI0 A;  1IBL L;  3HOY G;  2IT1 A;  3CPF A;  4KLK A;  4LUO A;  2JQO A;  5C0X J;  4WJ4 A;  3AQQ A;  5IP7 G;  1TWF H;  1X6O A;  3D31 A;  2F3I A;  5LMN W;  4A3J H;  2N8N A;  4NXN L;  1TXY A;  1MIU A;  4ME3 A;  2PI2 E;  4JBW A;  1YHQ A;  1XNR Q;  4DR3 Q;  1P8L A;  3L2P A;  1SMX A;  4JI1 Q;  5FLM H;  1N34 Q;  1N36 L;  2JA5 G;  2PNH A;  4LFB Q;  3KF6 B;  1Q1E A;  2MNA A;  4A3C G;  1HH2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...