2RA4A

Crystal structure of human monocyte chemoattractant protein 4 (mcp-4/ccl13)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
DALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small-inducible cytokine A13
publication title Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 12
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ra4A00
1X3PA 1A15A 2B2VC 4X3KA 3I8ZA 4R9WA 1EL0A 2M2LA 1PFMA 2SDFA 2EE1A 5EKIA 1SDFA 2HCIA 4HSVA 2HCCA 1ML0D 2KOLA 3MWYW 3Q6SA 5E4XA 2IL8A 3I3CA 1MSGA 2X69A 1MI2A 2FMMA 2KEDA 3KUPA 3TZDA 1EIGA 2B2UA 4CJ2C 2B2VA 1G91A 2B2TA 2EOTA 3N52A 1IL8A 1PFNA 1BNZA 2XIWA 3LWEA 1EQTA 5CBAE 1HHVA 1ILPA 1NR2A 4OIJA 1WTOA 5JJZA 4IUQA 1F9RA 4X3SA 1BBXC 1Q3LA 2HDLA 4ZLTF 2L11A 4CJ1B 1E0BA 4RAUC 4UAIA 2FJ2A 1QNKA 4XT3B 1ICWA 4ZK9B 5CMDA 1BF4A 2NWGA 4RA8A 1NR4A 2EPBA 1WVLA 3DEPA 1QG7A 2K05A 2N55A 2RSOA 3SVMA 1WTQA 1O80A 1G2TA 1VMCA 2KUMA 5EJWA 1J9OA 2JP1A 5T1GA 3P7JA 2X6GA 2KVMA 1NAPA 1AP0A 5EPKA 1TVXA 1HA6A 1ESRA 3G7LA 2HUGA 4MHEA 1CA5A 4HCSA 4O42A 1B4OA 1DOLA 2BDNA 1CA6A 3I91A 4ZKCB 2K01A 2Q8RE 3DEOA 4HAEA 1KNEA 4X3UA 1MGSA 1EIHA 2Q8TA 2R3ZA 3H91A 1AZPA 3DM1A 3GV3A 2FFKB 1HUMA 2MJ8A 3FPUB 2CVRA 1MSHA 4IUVA 1B3AA 4QUCA 1XYIA 1U4PA 1ZXTA 2K04A 3HP3A 2VXWA 2NZ1D 2K28A 1M8AA 1J8IA 1DZ1A 2B2WC 4CJ0B 1PFBA 2HDMA 4QUFA 1B50A 5COYA 1F2LA 2RSNA 5DNFA 1WTWA 4RWSC 2N88A 2L9HA 1IKLA 2K03A 2B2YC 4IUPA 1F9PA 5T1IA 1JE4A 1PLFA 3IFDA 3MTSA 3UI2A 3ONAB 2NYZD 1IKMA 5D65A 1RODA 1B2TA 1HFNA 1U4RA 1RTOA 5CORA 1DONA 2L1BA 5EQ0A 1WTPA 3GV6A 1U4LA 4LMQD 1ILQA 1JICA 2B2WA 1QE6A 2MP1A 4NW2A 4XT1B 1HUNA 2KECA 2H1EA 4OIKA 1U4MA 1RHPA 1WTRA 1WD1A 1DOMA 1LV9A 3TN2A 1PDQA 2RVLA 5AFWA 3I90A 2B2UC 3F2UA 4IUUA 2MPMA 2B2TC 2FINB 5EPLA 4DN4M 4ZAIA 4IUTA 1CM9A 1WD0A 1BO0A 1DOKA 2K1BA 5EPJA 1KNAA 2FHTA 2DY7A 1WTVA 2J7ZA 1O7ZA 3FDTA 2JYOA 1SSOA 4U68A 1AZQA 1HRJA 3R93A 4MN3A 1C8CA 1F9SA 5E4WC 1VMPA 4X3TA 1S4ZA 1X32A 1XX8A 1SAPA 1RTNA 1EOTA 3IL8A 1G2SA 1G6ZA 1NCVA 4XDXA 3D6WA 4HEDA 2MGSA 2D9UA 2L12A 1HFGA 3QO2A 5D14A 1RJTA 1F9QA 2X6LA 4ZKBB 1B53A 5CBEE 2L4NA 2DY8A 1GUWA 3KBXA 2KEEA 1X3QA 4IURA 4R8IA 1WTXA 2RA4A 1O7YA 2B2YA
chains in the Genus database with same CATH superfamily
1EY8A 4FF1A 2J4XA 3A8IE 4LFAL 4RHSA 4JI0L 1I5FA 3CPWA 3GP7A 2NVTH 1VQFA 5BN4A 2N78A 3V05A 2NZHA 3K7UC 2E5LQ 2B63H 5DEHA 2FMMA 3AEVA 4RGNA 4P72A 3OWFA 4A3IG 2OTLA 2ZJQA 3HKSA 3PIOA 1Y1WB 2I46A 1I6HH 4V0BA 1F9RA 3HKZG 5AJ3L 3PIPA 1K0RA 2EYJA 1OTCA 2BOSA 2AQ1B 1E2ZA 2C35B 2NVXB 3H0GH 4KHVA 1WVLA 4ZYSA 1QG7A 1I4QA 1DD2A 3NWTA 5FLXE 3GTKB 1XNRQ 3AMUA 3RNUA 2UU9Q 4MHEA 1UAPA 4A4IA 5I2YA 4GOPB 3KLSA 3T51B 2AKWB 3TP5A 5JEAH 2K01A 2XSCA 3CU7A 1B9NA 4GLXA 3KOJA 4DUZQ 1HUMA 2L15A 1Q90A 3SEBA 5LMNL 1ENCA 2A69D 1BCPC 1QVGA 1KQSA 5LMUL 5GAGC 2E2IH 2ICIA 2LXKA 4K8IA 3CC7A 5I2XA 1SE2A 1UEBA 4CKCA 3S9WA 4IUPA 4GZYC 3S1MH 3UI2A 4G7OC 2YTVA 3PV0A 2PYKA 1TWHH 4ULLA 1U4LA 3PUWA 5IIFA 4OIKA 4A3BH 4M1UB 1MHWC 5CV7A 4DR3Q 2F0HA 2F1MA 4RKLA 1YNJD 4ZAIA 1SNMA 5IGCA 1TWAH 4B08A 3CD6A 1GUNA 5IP9H 4QGUA 1O7ZA 2NN6G 1VMPA 3JC66 4BBSB 4ZUIA 3HOUB 4HEDA 3IKJA 4BS9A 5TSSA 4EVOA 2F0LA 2ZM6L 2G5DA 2B2YA 3EVQA 1DCZA 1X54A 2ZTEA 3RD4A 3RUZA 1W3SA 3ERQA 2R7FA 1ENAA 2ENBA 4NB3A 5IWAL 4BA2I 5CV9A 1V1PA 1SEBD 3E9IA 1E2WA 1PRTD 5K36G 1FJGQ 1LLRD 2ZXRA 2PZUA 1CHPD 5A2QE 2UUCL 5JOBA 4AYBG 5C4JB 1PRTC 4HJ9A 4QL5A 5C44B 3URYA 3IFTA 2KA7A 4LFAQ 1NR2A 4JI0Q 2WACA 2JA7H 1S3OA 4RAUC 2BA0A 3HS0C 4A3JH 1SNCA 4H13C 1NR4A 1SFOH 1SMXA 3LGJA 5FLMG 3VYRA 2K6AA 3S2DB 1VMCA 1NY4A 1STAA 1D5MC 3EN2A 2EXDA 1ESFA 4IJLA 5EPKA 1I3QH 3HEJA 5AJ3Q 3S1RB 1W6JA 1JR0D 4LF7L 2M00A 4KTAA 4QJFA 4E6IA 1R9TH 1GOZA 1QUQA 2R93B 3VDYA 4LFCL 1MSHA 4IUVA 3L3OC 1XYIA 2JA8H 2DNEA 2Y0SB 3J7AV 1ZXTA 4N9TA 1A62A 1TKWB 3ULPA 3LWUA 4UPAA 1GHKA 4A3CH 4JVZA 2OQKA 1XMQL 3F2DA 4C3JB 1EQQA 1EYCA 2D62A 5D65A 1YNXA 5LMNQ 3HOVB 4KI0A 3KK7A 3R2TA 1HXYD 1PTOB 5LMUQ 1UWVA 2CWAA 4LF4Q 2UXCQ 3HOYG 2N3SA 5M9OA 2AQ3B 1FNVA 5EPLA 4YHHL 2FINB 3NE5B 4K2KA 2XGTA 5IOCA 1Y69U 3OTOL 2Q2HA 2WB1B 5KYLA 3QJYA 4IZ8A 3FPPA 3E6ZX 3I4NH 1A8VA 1FD7D 4OWTB 2R7ZB 3NEMA 2LXJA 4G7ZC 3GTJH 1BKBA 2RDFA 3M7GA 2X6LA 4ZKBB 4LFBL 1GUWA 4G4KA 3RN5A 1FR3A 3BDCA 1EY5A 1HNWL 3L2PA 2RDGA 1PHJA 2L0CA 4GNXB 1STGA 4DV6L 4FNFA 3A54A 3OIQA 4HSVA 2IL8A 5C4XB 3H3VH 3K5MA 3T53B 2ZM6Q 3KF8B 2B2VA 5FJ8G 3K80C 2EOTA 1N34L 2F3VA 2XIWA 3PF4A 4ODGA 5M3MH 3HG9A 3KJPA 3AB9A 5D3DA 5IWAQ 2CFMA 4N8FA 3S14H 4RCNA 3S1QH 3MXGA 2UUCQ 2VQFL 3GTMB 2IPKD 3RZOB 4DK3C 1WCMG 3P7JA 3AYHB 1IZ6A 2PO4A 2JA9A 3UDGA 4OWXB 5NUCA 5JVG3 2D5DA 1SJED 4QY7A 1CT1D 3K59A 3S24A 2NVTB 2ES2A 2UXBL 3D8GA 3EFXD 2B63B 4LF7Q 2K28A 3K57A 4NMZA 2N88A 3MHBA 1NMFA 2F0SA 4CDFC 1I6HB 1F9PA 2L55A 4LFCQ 4BY7G 3NUCA 4OWWB 3H0GB 1I94L 1G291 4LK1C 5KGUA 4V190 3CCMA 1V9PA 1SBBB 2Q2TA 1WTRA 1Z6HA 2XRSD 3RR5A 3W1GA 3K5NA 1Q86C 4IUUA 1I4XA 1XMQQ 2A19A 4GOPC 5CYUA 4QIWB 4PMWA 1WJJA 2SNSA 2TSSA 3KDFB 1A2TA 1SNPA 2K5NA 2OEOA 1TS3A 5C3XA 4A3MH 4LF9L 4GN5A 2J7ZA 1Z7TA 3U9OA 1GUGA 3HFZB 1Q81C 2JA6G 3TRZA 4YHHQ 5M5XH 3H94A 1JB7A 2VUMH 2D9UA 3OTOQ 1SMYD 2CH4W 1VQNA 4Y52H 4DV1L 3KLSX 3A7AB 2K52A 2E2IB 1CKOA 1YVCA 3NK9A 3QWNA 1WTXA 4DV5L 1E2VA 1SMYC 3I73A 2B8FA 2EY5A 3S1MB 1I4HA 4JK1C 2AHOB 1IBLL 3NTHA 1TWHB 4DAPA 4A3DH 2ZXPA 3KLWA 1SRUA 2KOLA 3OIPA 5E4XA 4YCWA 3MZ5A 4DKAC 4A3BB 4LFBQ 2PMZB 1NTGA 5FLXc 1HJPA 1EIFA 1CFMA 5KNDA 2K33A 1TWFH 4A3LG 4U673 1EIYB 4EGVA 5CBAE 1X3FA 1ILPA 3PO2G 4DV6Q 1A3TA 1PZID 1TWAB 4UAIA 2HHHL 5CMDA 4OO1G 2NWGA 3I4MG 1K73C 1IL2A 3MXNA 1G2TA 1N34Q 1PH1A 1JQYD 3F2CA 4HSPA 3M4YA 1F77A 1S5DD 1HA6A 1CA5A 4F7XA 1K8AC 1DOLA 5C0XH 4KY5A 4JI7Q 1II3A 1O78A 2VQFQ 5IP7G 2Q2IA 3RLNA 1AW7A 5GAEC 4GN4B 1SNDA 1B44D 2A8VA 4B9XA 4A3EH 1E22A 3HP3A 3MFYA 1XPOA 2B8GA 4HJAA 2NUCA 4IOAA 4CJ0B 5C5MA 3D4WA 5G3LF 2EQSA 3D3RA 3BZDB 3GTOH 2JA7B 1MKHA 4ZQ3A 3A8KE 2UXBQ 4RGTA 1HFNA 3M9BA 4A3JB 2L1BA 1B9MA 2PNHA 1SFOB 4MTKA 4NW2A 4HR7B 1VQHA 1PDQA 5AFWA 3F2UA 2F0JA 3QR8A 1C0AA 1IW7D 1LABA 4DN4M 4BY1H 4DV7L 1I3QB 1D7QA 4J15A 4RKBA 1KIXA 1L1OB 3V2TA 1IW7C 2F0DA 2FHTA 1V8QA 4K5VA 2DY7A 5M5WH 1I94Q 4LUZA 1VQDA 1R9TB 2K5WA 4P73A 4K14A 1ZEQX 1PMRA 2JYOA 1WTHA 5E4WC 2IWHA 5M3FH 2JA8B 1HQMC 4XDXA 4LUVA 4LF5L 2H4OA 1KDBA 2A6EC 4YWLA 4LF9Q 2VS1A 1M4VA 3HOZH 1X3PA 1T9HA 5FO8B 1BBUA 1PTOD 2A74C 4C3HH 4X6AH 1EL0A 1TWCH 3MFGA 1IBML 3J81E 2EJMA 2E2DC 1JOQA 1A2UA 3NBIA 3LNNA 2HCIA 4JOIC 1OO9B 5EBDA 3PSIA 1Y8NB 1B70B 1J6QA 4WJWA 4DV1Q 2EJFC 2B2UA 3OYYA 2KHSA 1R4PB 1X56A 4DV5Q 1G91A 3E9HA 3W3AA 2ID0A 2Y0SE 4JI8Q 4DXFA 2H5XA 4A93H 1IBLQ 2E5LL 2Z9HA 3SR1A 4CJ1B 4XT3B 1M90C 3I4NB 4CDEC 1IYJB 4DAVA 4HMJA 4KHZA 4ME3A 1KHIA 1PYBA 2KUMA 1S5FD 3NTKA 5FK9C 3GTJB 2PZTA 3W5OA 5CV6A 1CTMA 3DHQA 2MFIA 3UE1A 2HUGA 4GLVB 3VYTA 3PMFA 1Y1WG 1B4OA 2HHHQ 4FXGC 1HZCA 4R8NA 4F88A 1EIHA 1PFSA 5LL6X 2EYLA 2B39A 4TVAB 1U4PA 1EWIA 1UE6A 3F8TA 4LJZC 2MHVA 4FF4A 2A73B 1F2LA 5M3MB 4HJ7A 1EU3A 3S14B 4ILWA 3S1QB 3DMUA 1RODA 1CQVA 4PZ8A 2NZOA 3GV6A 5ELNA 2MP1A 1HUNA 2RF4A 1XWEA 3PO3G 2BCOA 3CC2A 2O4XA 1L2FA 2RVLA 1XJVA 4O0AA 3F2BA 2NTSA 4A3FG 1ET6A 3D4DA 4B3TL 4L5SA 3CCJA 1I4RA 3QB3A 5JPNC 1WTVA 1H9SB 3ZYYX 3CCQA 2V4DA 2WINB 1TWGH 1VQEA 4R4IA 2FMCA 1X32A 4A75A 1JJGA 3BZKA 4KY6A 4DV7Q 4JBKA 4R1JA 3L0OA 1VQKA 3E0JA 2KEEA 2NN6H 5IGDA 4KKTA 2RA4A 1O7YA 4HIKA 4A3GH 3KYHC 4AQYL 4JI6L 1CI3M 1LTRD 1QZGA 3M3YH 4J8QA 4LF5Q 1K3BC 1KDAA 1JOOA 3X3NA 4BBSG 3BZCA 5E7NA 4JI1L 3HOUG 2ALYB 3TREA 4ZUJA 4OEMB 2QDLA 3FEWX 4BBRG 1WTOA 2DN8A 5JJZA 1IBMQ 2LY7A 1F2ZA 1IXRA 4A3MB 1EY9A 1QNKA 4Q0FA 3CHBD 3OMCA 4FF2A 3SK6A 3TQYA 1L0YB 1I50H 4L5TA 1Z47A 3N6RA 2PQAB 1VQBA 3HOWH 5FO9B 1Y14B 4POFA 4PMCA 5M5XB 3J81i 3DLLA 2VUMB 2EY6A 5C44G 3BYYB 2VL6A 5IGFA 1KNEA 3UDFA 3CCUA 3VA7A 4QIWE 3DM1A 4A3DB 2CHBD 4XXEA 3CCEA 2ICEC 4FF3A 3OMGA 5A35A 4C56C 2B2WC 1N32L 5DM73 4QUFA 5COYA 1TWFB 4TKOB 1OXSC 1H9KA 2L9HA 4EQNA 4I65A 1Y1VH 4YCVA 1IKMA 2K14A 2IJ0A 1PYSB 4CGYB 1LTGD 2BA1A 2EVBA 2R93G 2WKCA 4Z9CB 1WI5A 2Y0SG 2K32A 2KECA 4QF4A 3S17H 1MD2D 2KCNA 1BCPD 3I90A 1VCIA 2WKDA 3TBIB 4JYAL 1ZKOA 3K81C 2JA5B 5EPJA 2PMZE 2CQOA 2WIIB 1WFQA 1JCKB 4C3JG 3STBC 2KJXA 5JVH3 1E7ZA 4LF4L 2UXCL 3DM3A 1X55A 3HOVG 5D3IB 2A5HA 2CH4A 3R2IA 4A3EB 5BN5A 3CCVA 3D6WA 1IBKL 4B3TQ 2L4NA 2GN5A 5ELEA 2DY8A 5ELDA 2YTXA 3T1YL 4IURA 3U4ZA 4DNTB 4X62Q 1VQMA 4UHVA 3A8JE 4X3KA 3I8ZA 4XQJA 3GTOB 3K58A 3FRPB 5ELFA 5C3EH 4GKKL 3SE0A 5IYCH 3NPPA 2WAQB 3JAME 1FNWA 1JWMD 4F8MA 3VR3A 4ABNA 1EEFD 4BY1B 1L1OC 4AQYQ 5IYBG 4JI6Q 3EQLC 1EQVA 4LUOA 5M5WB 4K8JA 1E0BA 1DGSA 5FJ8H 4JI1Q 2I5HA 3SVMA 5C4XG 5M3FB 1C9OA 4P2CB 1O7IA 3J80E 4KKSA 4IUNA 1KC8C 1EWCA 2E2HH 3M4QA 4B3ML 4FXKC 4HN7A 3HOZB 4HAEA 3NSWA 3C1FA 4JC0A 4C3HB 5J22A 1TWCB 1VDZA 3CCLA 1WCMH 3E3XA 3FPUB 4DR6L 1RKNA 5FOBB 1E24A 4BA1I 2RHSB 4TRDA 3VA5A 2CW0C 4K2LA 1GJXA 3PUZA 3C3LA 1STBA 4NXNL 1X6OA 4A93B 3TP8A 4PV1C 2B29A 1L0XB 4IFDI 1K83H 1WTPA 2GA4B 3OW7A 1ILQA 1QE6A 2NVYH 1N32Q 1U4MA 4A3KH 1QNUA 1RHPA 4PG3A 3SHLA 1B7YB 3M7NA 4BY7H 1TU2B 4F87A 3K7AH 1AFPA 1PH3A 3NENA 3M4OH 4IUTA 1CM9A 2AQ2B 2A68D 3EJIA 5GADC 3FDTA 4H02A 1SSOA 3J81c 5EKLA 2R92G 3H0GG 2A68C 3H3VC 1KL9A 4GOPA 3IL8A 4JG2A 2AMCB 4FYDA 4JYAQ 2VB2X 3CRLC 3QO2A 1RF2D 3KBXA 1GUTA 1HQRD 1LUZA 4DFAA 5FLXL 3CC4A 2K5HA 1SXTA 5LHY1 2PNRC 3HOXH 1UNSA 4PZ6A 3D6CA 1IBKQ 4BXXH 2RDHA 3Q22A 3T1YQ 5EGTA 1QZHA 4HTHA 2F0IA 5JAVA 1PZJD 1QCBD 4MIUA 4OIJA 3SDZA 4X3SA 2HDLA 2F0KA 3VR2A 4GKKQ 1ICWA 1KD1C 4JV5L 4RA8A 4RH6A 1TWGB 1FVIA 2K05A 3T1HL 2IX0A 3PO2H 4A3BG 5T1GA 1LACA 2VB3X 1U5KA 3I4MH 1UE5A 2F0GA 1HR0W 3JAMi 4P75A 5JJIA 4C3IH 4A3GB 2C9OA 1A63A 4LW1A 2EXZA 3M3YB 3I70A 2EYPA 2I5MX 3A55A 1EFWA 2I5LX 3MXNB 5GROA 3TP7A 3OOCA 4JI7L 4IFDG 4B3MQ 1HNXQ 2HDMA 1B50A 4L8JA 2K75A 2JN4A 2LMCB 3VYSA 2K03A 2B2YC 3J80i 1OXVA 1JE4A 4OO1I 2NYZD 1DXMA 4DR6Q 1LT6D 4XYOA 2EIFA 1RTOA 4IPDA 2IX1A 1AE2A 1Q1EA 1HNZQ 1I50B 2ZXOA 3P75A 1DOMA 3NQTA 3HOWB 1EOVA 3NWSA 2K5DA 1VQGA 3NQIA 4OGQC 4NXNQ 5A2QL 1YEZA 4GS3A 1JT8A 1LTSD 1KNAA 3A74A 1EQRA 4RGMA 1LTID 4EX5A 2F0FA 4G7HC 1VQ6A 4DR4L 4A3JG 2PI2E 1HTLD 3FKIH 1HZ9A 2XTIA 2EY1A 3J81j 4DV0Q 5D14A 1GO3E 2PW5A 1RJTA 3HZXA 3TS0A 2E76C 1NNXA 1SNOA 2O2LD 2F0OA 4QB4A 5CGKA 1BDOA 1Y1VB 4R9WA 2M2LA 1TR5A 4HMIA 3D31A 2SDFA 2EE1A 4B3RL 3CPFA 2QF7A 1KAAA 2PQEA 5GQOA 2JA8G 2X69A 3S17B 1SJHD 3U58A 1EIGA 1K28A 3K5LA 3TEHB 4YWKA 4H44C 4O1NA 3J7ZC 4JOIA 3PCOB 2L11A 5C5LA 4RMFA 4YWMA 1VF7A 1CKNB 2DUDA 3G48A 4JI8L 1SYCA 1E3PA 4OXPA 2XWBB 5IYDG 4DUYL 1KRTA 4KD4A 1GM5A 4IN3A 3S16H 1UUPA 5I4DA 4JV5Q 2KQ3A 3ZJYC 1TS2A 1FL0A 4K5WA 3T1HQ 4DR1L 3I4NG 3SK5A 5ELBA 3MAQA 5C3EB 1X65A 2UUBL 2Z6KC 2A6HC 1E1TA 1J8IA 2D2CC 1VQ8A 4GNXA 4DR7Q 2BE5D 2QEXA 1VQ4A 3BG3A 4NKLA 4DU9A 5JJLA 2F3IA 5J1ZA 4IPGA 5T1IA 3CCSA 2BE5C 3H09A 3ONAB 1Q8KA 2HIVA 4X66L 2RCFA 3KF8A 3T13A 4DR5L 1GXDC 1ET9A 2AWNA 3DXJC 1CZGA 4JI5L 4DV3L 1JJCB 1LTBD 4KN4C 2VW9A 1AEXA 4POGA 2E2HB 2WAQE 4IPHA 2I07B 4NPSA 2ZTDA 1XTDA 3PO3H 2QEJC 3E0EA 5CV5A 4CHTB 1U9RA 1Q1BA 1Q12A 1WCMB 1C8CA 1F2YA 1S4ZA 5E3FA 1LT5D 5HY6A 3I4LA 3CW2C 3X3MA 1GD7A 4A3FH 1QJOA 2E2JH 1VQAA 3JAMc 2L12A 3MEHA 2BH2A 4CKBA 1QWYA 3NBHB 4IFDJ 3CMAA 3I72A 5H1SE 1SLJA 4DR4Q 3KBGA 2R7DA 3TZUA 1S72A 1EY6A 1K83B 3DWPA 4KK7A 2F0VA 3MC0B 3I56A 2PW7A 2LFNA 2NVYB 3BDLA 3NELA 4A3KB 3M85A 3J80c 3TZDA 4PZ7A 1FGUA 2K5QA 2B2TA 4BY7B 1PFNA 2A6ED 1R4QB 3K7AB 3ND8A 4LAAA 2HIXA 3K0YA 2F0MA 2MO1A 4IUQA 4OELB 3M4OB 4B3RQ 3J7AF 1I4GA 4FXDA 4IQZA 1EZ8A 3HOUH 1H9RA 2F0QA 3CP0A 1NSNS 3KDFA 1D8LA 3B6YA 2Q2UA 2YV5A 1C4QA 4BBRH 3WOFA 4EQPA 2UUAQ 1J9OA 2MNAA 1JOKA 4XYQA 3C46A 1MJCA 3KF6A 1TVXA 1XNQL 3GTQH 2BDNA 2DGYA 3R8BA 1PH8A 2OTJA 4JW0A 1AZPA 3PIO3 1STHA 3GV3A 1PH6A 1SROA 3PIP3 3HOXB 4DUYQ 1A3VA 1DJRD 4HIMA 1HH2P 1O7LA 1Q82C 2R61A 2VXWA 3FMCA 4A3IH 4UP8A 4JI2L 4CDDC 5ISRA 3G4SA 4DR1Q 3OW2A 2QCPX 2GVBA 1RIPA 2Z0SA 2UUBQ 2O5IC 3G6EA 4GKJL 1YHQA 4C2MH 2QA4A 2M9VA 4YY3L 3MVVA 1XPRA 4A3DG 3SK4A 1TIID 2B2WA 3ERSX 2XNAC 3TS2A 4DAYA 1WD1A 1Y8OB 5CR3A 3PO2B 2D0OA 5CV4A 3IRBA 2WB1E 1KLUD 1G51A 2RHQB 1FNUA 1I4PA 1VQ7A 2J0TD 4X66Q 1BO0A 3DUZA 5CC4A 3I4MB 4DR5Q 2HD3A 1DYQA 2QW7A 1YZ6A 4C3IB 4JI5Q 3TDQA 3R93A 4DV3Q 1EY0A 1F9SA 1K8GA 1V1QA 4OX9Q 4A76A 1SAPA 3T4AC 4DF7A 4AH6A 4J6HA 1PVOA 2P5ZX 2JA5G 2D0PA 2Z4HA 4IALA 5EAYA 4QQBX 5DAUA 5C0XG 1HZBA 3CXCA 2AWOA 4R4TA 4OL7A 1KDCA 4H0LC 1KAWA 4X62L 3VR4A 2JSOA 1MI2A 2KEDA 2ZTCA 3KUPA 4R4QA 2VZAA 5FO7B 3UDXA 1JC7A 1CSQA 1BNZA 1WOCA 1BBXC 1ENFA 1VQPA 5F2DA 3GTLH 1PZKD 1PH7A 3PUXA 1OXXK 3DWAA 5KYIA 3CQZH 1K9MC 2OCEA 3F1ZA 1E1OA 1Q46A 3FKIB 2PCFB 1ZYRC 5IYBH 3AFPA 1L1OA 4DR2L 2WAQG 2IY5B 1EU4A 5EJWA 4KHPL 2KVMA 2F52A 1LO5D 1AP0A 5J3BA 4BY1G 1X3GA 1HCZA 1CZWA 1XTCD 4X3UA 5C4XH 1MGSA 5ELCA 1YNNC 1BOSA 3OHXC 3NXWA 2MJ8A 5K36H 4P71A 3TSSA 1XPUA 1D6EC 5IGBA 5M3FG 3AQQA 5IT9E 1XNQQ 1M8AA 1DZ1A 1V1PB 2WP8J 1N9WA 2G9HD 1VQ5A 1WTWA 3K8AA 5JJKA 3HOZG 2HT1A 2QDBA 1XMOL 3HRZC 1JORA 1U4RA 1PXUA 1N36L 3ULJA 3VR6A 5FLMH 1J5EL 1BR9A 3W1BA 1YIJA 4AIMA 3QOJA 4JI2Q 4DXGA 3J81L 4WJ4A 2B2UC 1I6VC 4TSSA 1W2BA 2F4VL 1JWSD 2Z8LA 2KCMA 3S16B 1JB3A 2IW3A 4GKJQ 2N49A 4YY3Q 4A93G 3I7FA 2MUYA 3BYTB 3A7LA 5IE8A 2MO0A 4MN3A 2SOBA 1EOTA 2XWJB 3QOLA 4UP9A 4KD3A 1QUQB 1B53A 1SYDA 2NB0A 2Z6BA 4N8X1 3V96A 1OXTA 4L63B 2R92H 4HCEA 3A5ZB 5I9OA 3STBD 1PFMA 1D1IA 1S5CD 5EKIA 2YU9H 4I7AA 3J7A5 5KIXA 2KCTA 4L6TB 3OSOA 3HOYH 3CCRA 4CKEA 4R4CA 4IO9A 4JI3Q 4LF8Q 2CWPA 2E8GA 3NHHA 4QCLA 2RKSA 4XIGS 4LNQA 3RZDH 4KJNA 1D5ZC 2YTYA 3ITPA 2FJ2A 5G3LD 3PO3B 2WB1G 4Y7NH 3G6JB 2ATWA 4NP5A 4DV2Q 1MJEA 1O80A 5M5YH 1F2MA 2JK8A 2A69C 4A3FB 5J39A 1LT3D 2R7ZG 2E2JB 1M1KC 1H9SA 3R3OA 1ESRA 2F0WA 4EQ5A 4CDCC 1KTKA 4X65L 3BJUA 2E75C 4WFN3 5KNBA 4R4OA 5C0XJ 3GO5A 4DR2Q 2EY2A 1UEAB 2CVRA 3PGZA 4KY7A 1NJIC 1TY0A 4KHPQ 1N33L 2NBFA 1YI2A 1D5XC 2YYZA 1K3RA 3HGBA 3MXPA 2NVQH 1YNJC 1ASZA 1XXGA 1IKLA 3O13A 1CKMA 1PLFA 4A3GG 4I7ZC 4K0KL 3EA6A 4IFDH 1HNXL 3U50C 2DJFC 1SR3A 2OT2A 4ID6A 3BVGA 1EYGA 2QGQA 1G8ZD 3WWVA 2PI2A 2SEBD 4X64L 1LV9A 3MXUA 1PH2A 3EBEA 4BBRB 2VQEQ 2UXDQ 1EZ6A 2DJGC 2GVAA 2CW0D 3A5UA 3GTPH 4MTNA 1XMOQ 1C48A 3GTQB 2K1BA 1DOKA 1HNZL 2EYHA 2PQAA 1N36Q 1S40A 1ICFB 1J5EQ 1HRJA 2K50A 4OHJA 1T5EA 1RTNA 1HZAA 3T16A 1X9NA 2F4VQ 1D2BA 3HOWG 3WOEA 2F0PA 5IT9L 4A3IB 1STEA 3S15H 3E5SA 2B63G 3L7ZC 3HKZB 1QVCA 3K5OA 4DV0L 2KHJA 2HQEA 4WORA 4C2MB 3MWYW 3I3CA 4PQXA 2OXPA 3P1HA 1V1OA 5GAHC 4WRDA 3GD7A 2L5TA 3RMHA 4KJOA 2HQLA 2F3WA 4RHRA 1CK1A 1CUKA 5L37A 5IGEA 1L0WA 2QKIC 3AU7A 1VS0A 1H9MA 3A56A 5BR8L 1K8OA 1Y1VG 1YBYA 4OONA 1HA5A 4JI4L 3QG1A 4P74A 3C2PA 1P8LA 3NTIA 1X3EA 2JA6H 5JEAG 2JE6I 4L5QA 2JP1A 1PTOF 4APVA 3FP9A 3DWQA 4Q5VA 3W2DA 1HPCA 2EDGA 4ZKCB 2KBNA 3ND9A 4HIOA 3GTGH 4DGZA 1B1ZA 2PPBC 4DPGA 5IYDH 4RCOA 4QUCA 1CHQD 3I2ZA 4A3LH 5E1FA 2TMPA 3ER0A 4X65Q 1VQ9A 3H15A 5I6WA 4ZCKA 1CQFA 4OO1H 3GTLB 2IX3A 1A6XA 1B2TA 2JEBI 2Z6KA 1N33Q 3CAMA 5C3EG 4DR7L 5DLQE 3CQZB 3A0JA 1TQOA 1K8MA 5IP9G 5IYCG 3BVMA 3TN2A 1NUCA 5IGGA 4JPBW 5C3WA 2ZJRA 3UDIA 1KABA 4K0KQ 3JAML 2F0UA 2LS01 5IP7H 2RBMA 5LL6S 4S3SA 3H6MA 3BS1A 1OXUA 1AZQA 1NE3A 4X64Q 4HIDA 3M4PA 4X3TA 3G71A 4H7BA 1NCVA 3S1NH 4AYBB 1YITA 1C7YA 2EJGC 1W6KA 1BUVT 2WV6D 2XN9C 2K4KA 3CMEA 1AE3A 3J80L 2C5CA 2RQXA 5IODA 1VQIA 2HCCA 3Q6SA 2JA7G 3NP8A 3H3VI 4TQUS 1NMGA 1Z9FA 3SXHA 4HJ8A 4CJ2C 3LWEA 1HR0L 1PV4A 1LYLA 2CQAA 2AUJD 1PYWD 5CV8A 4ZK9B 4K6LA 2K5VA 4IJHA 2EPBA 3DEPA 1TS5A 4A3KG 3RN2A 4UP7A 1JE5A 3AFQA 3D0FA 3PUYA 5IT9c 1PA6A 1GKHA 1NAPA 1SNQA 2AUKA 5BR8Q 3S2HH 4RGOS 2EYMA 2B3GA 4KN7C 4O42A 4ME5A 2R92B 1ASYA 4JI4Q 3DEOA 2KENA 2O5JC 2UUAL 1EFID 2R3ZA 3H91A 2WFWA 4A3CG 1KRSA 3BDOA 1WYDA 2YU9B 3KFUA 3K0XA 1B3AA 3Q8DA 4EQOA 1MBYA 4PMBA 3HOYB 1SN8A 1IYVA 3KF6B 5DNFA 2IHFA 3RZDB 1QB5D 4FO2A 2XRQD 4O2DA 1T5XD 1BBWA 3QIAA 1DONA 2V1CC 4M8AA 4LMQD 4Y7NB 4HJ5A 1JICA 3HOXG 3PQIA 3RLFA 4BXXG 2MQHA 3KJOA 5M5YB 1BQQT 2A6HD 5JEAJ 3TP6A 1P16A 2F0TA 2K7VA 1Y1WH 1STYA 3FVQA 3UE0A 1SE8A 1SYFA 3OPOA 4UDUC 1LT4D 1EY7A 4KMUC 2NVXH 4KKUA 2NTTA 2LSSA 5C6AA 5I9PA 1CSPA 3CF5A 1YJWA 2EZVA 4JBMA 2ASBA 1KLGD 4DAMA 1SYBA 1HTPA 1HNWQ 2FXQA 3GTKH 4DAYB 2MGSA 1S5BD 1QILA 2NVQB 2VNUD 5HURA 5EBCA 4R8IA 4OX9L 5BN3A 1RCVD 2B2VC 2G9DA 4LF6L 1BXTA 1JJ2A 4JBWA 4C3IG 4KV6A 1BCPF 4B9WA 1SDFA 5M3MG 3RLOA 2RCNA 1ML0D 3BU2A 1SE3A 1MSGA 2F0EA 2JA5H 1BCPB 1UE7A 1IL8A 1D1KA 1EQTA 1HHVA 3GTPB 5K5PA 1SYGA 4G57A 1V43A 4ZLTF 4FDBA 1LTAD 1BF4A 4DA2A 4QMGA 2Z1CA 4DK1A 4MNOA 4K5XA 1EWHA 4MZ9A 1B8AA 1WTQA 2CKZB 3CRKC 1HR0Q 2X6GA 2QILA 1ONLA 5HGTA 1YJ9A 3G7LA 3S15B 5EKKA 2PZWA 5C0XI 1CA6A 3I91A 1IYUA 2Q8RE 2EYFA 2Q8TA 4XQNA 2E74C 2FFKB 4DK6C 4B3SL 2IHEA 2A1AA 4LWCA 4BBSH 3FKIG 2R6GA 4K6DA 3MEFA 1EYAA 3EROA 4L5RC 5KEEA 3GDEA 1AN8A 1Y8PB 1Q7YC 5FKAC 3GQBA 3WDNA 4RWSC 4NDXA 2OWOA 3EIVA 3I4OA 3MTSA 1MIUA 3PUVA 1PRTF 5CORA 5EQ0A 2JJQA 3HKZE 4FP5D 4A3MG 4XT1B 5I6YA 1RDPD 2JA6B 3U9SA 5C4JH 1AH9A 4GLAC 3ICEA 5C44H 1VF5C 5HGQA 1PRTB 2MPMA 4RG1A 2F03A 4DV4L 3U4VA 1QVFA 1CKNA 1UE1A 1STNA 2VUMG 1PTOC 4C1NK 3Q0AA 5IY0A 4DNIA 3GTGB 1IHZA 4NXML 1RD9D 4BWGB 1A0IA 4IPCA 1BVSA 3ULLA 1B3QA 3S2DH 4GN3B 5JPMC 1G6ZA 4PNYA 2BDOA 3KLRA 1HFGA 1SE4A 4ZRZA 3S1RH 1VQLA 3FHWA 1N8RC 5CBEE 1YJNA 4JCVE 4YCUA 2LKVA 1X3QA 1A3UA 3MA2B 1A15A 1PH5A 1S5ED 1LM0A 2Q8IB 1KXLA 1LTTD 1TT2A 2IT1A 2KHIA 2R93H 2VY3A 2CCZA 2I0QA 1EYDA 2OQ0A 1EUJA 1EEID 1TXYA 1FYCA 3BVZA 4JBJA 3T56B 4CBVA 1GHJA 3N52A 4GNXC 4LF6Q 1FGBD 1XNRL 1JMCA 3P20A 1Q3LA 4C3JH 2UU9L 5C4ZA 5KNCA 1GUOA 1G6PA 1SYEA 3HOVH 1EY4A 4YIJA 3C1EA 4JI3L 4C1NI 3Q24A 1VQOA 4LF8L 1K0SA 3I55A 1PTOH 2N55A 2RSOA 4DUZL 1U0LA 1DM0B 3D4RA 2XVSA 3S1NB 2F0NA 2DNCA 4A3EG 1TS4A 4HCSA 1GUSA 5DM63 3J7YW 1QOHA 3OWEB 4FVMA 3VYUA 4DV2L 5KRUA 1NBWA 1PH4A 2Z4IA 4DNRB 2R7ZH 5C4HA 3NBHA 5ELOA 2JQOA 2JEAI 4XQQA 1ZYRD 2K04A 4KLKA 3VR5A 2NZ1D 2ZT9C 4IOCA 1PFBA 2EYOA 4DR3L 1VQJA 3SK8A 2KCCA 2RSNA 1LTLA 3L9AX 1VQCA 2OF1A 4AYBE 3IFDA 4B3SQ 1GVPA 2N8NA 1Q8IA 1YNND 3SGIA 4N9PA 2F4IA 2BH8A 1RL2A 3CKIB 3TMEA 1TY2A 1H95A 2H1EA 4UY8C 2B2TC 1YHAA 1PH9A 3S2HB 1WD0A 4J1MA 4XTCS 2ZJPA 1H9JA 3IAYA 4WJ3M 2VQEL 2UXDL 3LX0A 4ALPA 4U68A 3GTMH 3K6OA 2JXMB 1XX8A 3RZOH 4C3HG 2SNMA 1G2SA 4DV4Q 4DK0A 4RFBA 1FJGL 3PF5A 1F9QA 2NN6I 1JWUD 5LMNW 3Q23A 1YHBA 4NXMQ
chains in the Genus database with same CATH topology
1EY8A 4FF1A 2J4XA 3A8IE 4RHSA 3GP7A 5BN4A 3V05A 5DEHA 2FMMA 4RGNA 3OWFA 1Y1WB 2I46A 4V0BA 1F9RA 2EYJA 2BOSA 2AQ1B 1E2ZA 2NVXB 4KHVA 1WVLA 4ZYSA 1QG7A 1I4QA 1DD2A 3NWTA 5FLXE 3GTKB 3AMUA 4MHEA 1UAPA 5I2YA 3KLSA 3T51B 3TP5A 5JEAH 2K01A 2XSCA 3CU7A 1B9NA 1HUMA 1Q90A 3SEBA 1ENCA 2A69D 1BCPC 2ICIA 4K8IA 5I2XA 1SE2A 4CKCA 3S9WA 4IUPA 4GZYC 3UI2A 4G7OC 3PV0A 2PYKA 4ULLA 1U4LA 3PUWA 5IIFA 4OIKA 4M1UB 5CV7A 2F0HA 2F1MA 4RKLA 1YNJD 4ZAIA 1SNMA 5IGCA 4B08A 1GUNA 1O7ZA 2NN6G 1VMPA 4BBSB 4ZUIA 3HOUB 4HEDA 3IKJA 4BS9A 5TSSA 4EVOA 2F0LA 2B2YA 3EVQA 1DCZA 3RD4A 3RUZA 3ERQA 1ENAA 2ENBA 4BA2I 5CV9A 1V1PA 1SEBD 1E2WA 1PRTD 5K36G 1LLRD 2ZXRA 2PZUA 1CHPD 5A2QE 5JOBA 5C4JB 1PRTC 5C44B 3URYA 3IFTA 2KA7A 1NR2A 2WACA 4RAUC 2BA0A 3HS0C 1SNCA 4H13C 1NR4A 3VYRA 2K6AA 3S2DB 1VMCA 1STAA 1D5MC 1ESFA 5EPKA 3S1RB 3HEJA 1W6JA 1JR0D 2M00A 4KTAA 4E6IA 1GOZA 2R93B 1MSHA 4IUVA 3L3OC 1XYIA 3J7AV 2DNEA 2Y0SB 1ZXTA 4N9TA 1TKWB 3LWUA 1GHKA 4C3JB 1EYCA 2D62A 5D65A 3HOVB 4KI0A 3KK7A 3R2TA 1HXYD 1PTOB 5M9OA 2AQ3B 1FNVA 5EPLA 2FINB 3NE5B 4K2KA 5IOCA 1Y69U 2WB1B 5KYLA 3QJYA 4IZ8A 3FPPA 3E6ZX 1FD7D 2R7ZB 4G7ZC 2RDFA 3M7GA 2X6LA 4ZKBB 1GUWA 4G4KA 1FR3A 3BDCA 1EY5A 2RDGA 2L0CA 1STGA 4FNFA 3A54A 3OIQA 4HSVA 2IL8A 5C4XB 3K5MA 3T53B 2B2VA 2EOTA 2F3VA 2XIWA 4ODGA 3HG9A 3AB9A 5D3DA 4RCNA 3MXGA 3GTMB 2IPKD 3RZOB 3P7JA 2PO4A 5NUCA 5JVG3 2D5DA 1SJED 1CT1D 3K59A 2NVTB 3D8GA 3EFXD 2B63B 2K28A 3K57A 4NMZA 2N88A 3MHBA 2F0SA 1I6HB 1F9PA 2L55A 3NUCA 3H0GB 1G291 4LK1C 5KGUA 4V190 1SBBB 1WTRA 1Z6HA 2XRSD 3K5NA 4IUUA 1I4XA 5CYUA 4QIWB 4PMWA 2SNSA 2TSSA 1A2TA 1SNPA 2OEOA 1TS3A 5C3XA 2J7ZA 1Z7TA 3U9OA 1GUGA 3H94A 2D9UA 1SMYD 3KLSX 3A7AB 2E2IB 3NK9A 3QWNA 1WTXA 1E2VA 1SMYC 3I73A 2B8FA 2EY5A 3S1MB 1I4HA 4JK1C 3NTHA 1TWHB 4DAPA 2ZXPA 2KOLA 3OIPA 5E4XA 3MZ5A 4A3BB 2PMZB 1CFMA 5KNDA 2K33A 4U673 4EGVA 5CBAE 1ILPA 1A3TA 1PZID 1TWAB 4UAIA 5CMDA 4OO1G 2NWGA 3MXNA 1G2TA 1JQYD 4HSPA 3M4YA 1F77A 1S5DD 1HA6A 1CA5A 4F7XA 1DOLA 5C0XH 4KY5A 1II3A 1O78A 1AW7A 1SNDA 1B44D 4B9XA 3HP3A 3MFYA 2B8GA 2NUCA 4CJ0B 5C5MA 3D4WA 5G3LF 3D3RA 3BZDB 2JA7B 4ZQ3A 3A8KE 4RGTA 1HFNA 4A3JB 2L1BA 1B9MA 1SFOB 4NW2A 4HR7B 1PDQA 5AFWA 3F2UA 2F0JA 1IW7D 1LABA 4DN4M 1I3QB 4RKBA 3V2TA 1IW7C 2F0DA 2FHTA 1V8QA 4K5VA 2DY7A 1R9TB 2K5WA 4K14A 1ZEQX 1PMRA 2JYOA 5E4WC 2IWHA 2JA8B 1HQMC 4XDXA 2H4OA 1KDBA 2A6EC 1M4VA 1X3PA 5FO8B 1PTOD 2A74C 1EL0A 3MFGA 3J81E 2EJMA 2E2DC 1JOQA 1A2UA 3NBIA 3LNNA 2HCIA 1OO9B 5EBDA 1Y8NB 4WJWA 2EJFC 2B2UA 2KHSA 1R4PB 1G91A 3W3AA 2ID0A 4DXFA 3SR1A 4CJ1B 4XT3B 3I4NB 4DAVA 4HMJA 4KHZA 2KUMA 1S5FD 3NTKA 5FK9C 3GTJB 2PZTA 5CV6A 1CTMA 3DHQA 2HUGA 3VYTA 3PMFA 1B4OA 4FXGC 4R8NA 4F88A 1EIHA 5LL6X 2EYLA 2B39A 1U4PA 4LJZC 2MHVA 4FF4A 2A73B 1F2LA 5M3MB 1EU3A 3S14B 4ILWA 3S1QB 3DMUA 1RODA 1CQVA 3GV6A 2MP1A 1HUNA 1XWEA 2BCOA 2O4XA 2RVLA 2NTSA 1ET6A 3D4DA 1I4RA 3QB3A 5JPNC 1WTVA 1H9SB 3ZYYX 2V4DA 2WINB 2FMCA 1X32A 4KY6A 3E0JA 2KEEA 2NN6H 5IGDA 4KKTA 2RA4A 1O7YA 1CI3M 1LTRD 4J8QA 1KDAA 1JOOA 3X3NA 4ZUJA 3FEWX 1WTOA 2DN8A 5JJZA 2LY7A 1F2ZA 4A3MB 1EY9A 1QNKA 4Q0FA 3CHBD 3OMCA 4FF2A 3SK6A 1L0YB 1Z47A 3N6RA 5FO9B 5M5XB 4PMCA 2VUMB 2EY6A 3BYYB 5IGFA 1KNEA 3VA7A 3DM1A 4A3DB 2CHBD 4XXEA 2ICEC 4FF3A 3OMGA 5A35A 4C56C 2B2WC 5DM73 4QUFA 5COYA 1TWFB 4TKOB 1OXSC 1H9KA 2L9HA 4EQNA 4I65A 1IKMA 2IJ0A 4CGYB 1LTGD 2BA1A 2EVBA 2WKCA 4Z9CB 2K32A 2KECA 4QF4A 1MD2D 2KCNA 1BCPD 3I90A 1VCIA 2WKDA 3TBIB 1ZKOA 2JA5B 5EPJA 2WIIB 1JCKB 4C3JG 5JVH3 2KJXA 5D3IB 2A5HA 3R2IA 4A3EB 5BN5A 3D6WA 2L4NA 5ELEA 2DY8A 5ELDA 4IURA 4DNTB 3A8JE 4X3KA 3I8ZA 4XQJA 3GTOB 3K58A 3FRPB 5ELFA 3SE0A 3NPPA 2WAQB 3JAME 1FNWA 1JWMD 4F8MA 3VR3A 4ABNA 1EEFD 4BY1B 3EQLC 1EQVA 5M5WB 4K8JA 1E0BA 3SVMA 5M3FB 4P2CB 3J80E 4KKSA 4IUNA 1EWCA 4FXKC 4HN7A 3HOZB 4HAEA 3NSWA 3C1FA 4C3HB 5J22A 1TWCB 1VDZA 3FPUB 1RKNA 5FOBB 4BA1I 4TRDA 3VA5A 2CW0C 4K2LA 1GJXA 3PUZA 3C3LA 1STBA 4A93B 3TP8A 4PV1C 1L0XB 4IFDI 1WTPA 2GA4B 3OW7A 1ILQA 1QE6A 1U4MA 1QNUA 1RHPA 3SHLA 3M7NA 1TU2B 4F87A 1AFPA 4IUTA 1CM9A 2AQ2B 2A68D 3EJIA 3FDTA 1SSOA 5EKLA 2A68C 3H3VC 3IL8A 4FYDA 2VB2X 3CRLC 3QO2A 1RF2D 3KBXA 1GUTA 1HQRD 4DFAA 5FLXL 1SXTA 5LHY1 2PNRC 1UNSA 3D6CA 2RDHA 3Q22A 5EGTA 4HTHA 2F0IA 5JAVA 1PZJD 1QCBD 4MIUA 4OIJA 3SDZA 4X3SA 2HDLA 2F0KA 3VR2A 1ICWA 4RA8A 4RH6A 1TWGB 2K05A 2IX0A 5T1GA 1LACA 2VB3X 2F0GA 4A3GB 2C9OA 2EXZA 3M3YB 3I70A 2EYPA 3A55A 3TP7A 3OOCA 4IFDG 2HDMA 1B50A 4L8JA 2LMCB 3VYSA 2K03A 2B2YC 1OXVA 1JE4A 4OO1I 2NYZD 1DXMA 1LT6D 4XYOA 1RTOA 2IX1A 1Q1EA 1I50B 2ZXOA 3P75A 1DOMA 3NQTA 3HOWB 3NWSA 2K5DA 3NQIA 4OGQC 5A2QL 1LTSD 1KNAA 4RGMA 1LTID 2F0FA 4G7HC 1HTLD 2EY1A 5D14A 2PW5A 1RJTA 3HZXA 2E76C 2O2LD 1SNOA 2F0OA 4QB4A 5CGKA 1BDOA 1Y1VB 4R9WA 2M2LA 1TR5A 4HMIA 3D31A 2SDFA 2EE1A 2QF7A 1KAAA 2PQEA 2X69A 3S17B 1SJHD 1EIGA 3K5LA 4H44C 4O1NA 2L11A 5C5LA 1VF7A 1SYCA 2XWBB 4KD4A 4IN3A 1UUPA 5I4DA 2KQ3A 1TS2A 4K5WA 3SK5A 5ELBA 3MAQA 5C3EB 2A6HC 1J8IA 2D2CC 2BE5D 3BG3A 4NKLA 4DU9A 5J1ZA 5T1IA 2BE5C 3H09A 3ONAB 3KF8A 3T13A 1GXDC 1ET9A 2AWNA 3DXJC 1CZGA 1LTBD 4KN4C 1AEXA 2E2HB 2I07B 2QEJC 5CV5A 4CHTB 1U9RA 1Q1BA 1Q12A 1WCMB 1C8CA 1F2YA 1S4ZA 5E3FA 1LT5D 3I4LA 3X3MA 1QJOA 2L12A 3MEHA 4CKBA 1QWYA 4IFDJ 3I72A 3KBGA 3TZUA 1EY6A 1K83B 3DWPA 4KK7A 2F0VA 3MC0B 2PW7A 2LFNA 2NVYB 3BDLA 4A3KB 3M85A 3TZDA 2K5QA 2B2TA 4BY7B 1PFNA 2A6ED 1R4QB 3K7AB 3ND8A 4LAAA 3K0YA 2F0MA 4IUQA 3M4OB 3J7AF 1I4GA 4FXDA 4IQZA 1EZ8A 1H9RA 2F0QA 1NSNS 1C4QA 4EQPA 3WOFA 1J9OA 1JOKA 4XYQA 3C46A 1TVXA 2BDNA 3R8BA 1AZPA 3PIO3 1STHA 3GV3A 3PIP3 3HOXB 1DJRD 1A3VA 1O7LA 2R61A 2VXWA 3FMCA 5ISRA 2QCPX 2O5IC 2M9VA 3MVVA 3SK4A 1TIID 2B2WA 2XNAC 4DAYA 1WD1A 1Y8OB 5CR3A 3PO2B 5CV4A 1KLUD 1FNUA 1I4PA 2J0TD 3I4MB 1BO0A 3DUZA 5CC4A 1DYQA 4C3IB 3TDQA 3R93A 1EY0A 1F9SA 1SAPA 3T4AC 4DF7A 4J6HA 2Z4HA 4IALA 5DAUA 5C0XG 2AWOA 4OL7A 1KDCA 4H0LC 3VR4A 2JSOA 1MI2A 2KEDA 3KUPA 5FO7B 1JC7A 1BNZA 1BBXC 1ENFA 5F2DA 1PZKD 3PUXA 1OXXK 3DWAA 5KYIA 3FKIB 2PCFB 1ZYRC 1EU4A 5EJWA 2KVMA 1LO5D 1AP0A 1HCZA 1CZWA 1XTCD 4X3UA 1MGSA 5ELCA 1YNNC 1BOSA 3OHXC 3NXWA 2MJ8A 5K36H 3TSSA 1D6EC 5IGBA 5IT9E 1M8AA 1DZ1A 1V1PB 2WP8J 2G9HD 1WTWA 2QDBA 3HRZC 1JORA 1U4RA 1PXUA 3VR6A 1BR9A 3QOJA 4DXGA 3J81L 2B2UC 1I6VC 4TSSA 1JWSD 2Z8LA 3S16B 1JB3A 2IW3A 2MUYA 3BYTB 3A7LA 4MN3A 2SOBA 1EOTA 2XWJB 3QOLA 4KD3A 1B53A 1SYDA 2NB0A 3V96A 1OXTA 4L63B 4HCEA 5I9OA 1PFMA 1D1IA 1S5CD 5EKIA 5KIXA 4L6TB 3OSOA 4CKEA 3NHHA 4QCLA 2RKSA 4XIGS 4KJNA 1D5ZC 3ITPA 2FJ2A 5G3LD 3PO3B 3G6JB 4NP5A 1O80A 1F2MA 2A69C 4A3FB 5J39A 1LT3D 2E2JB 1H9SA 3R3OA 1ESRA 2F0WA 1KTKA 2E75C 4WFN3 5KNBA 5C0XJ 3GO5A 2EY2A 1UEAB 2CVRA 4KY7A 1TY0A 2NBFA 1D5XC 2YYZA 3HGBA 3MXPA 1YNJC 1XXGA 1IKLA 3O13A 1PLFA 4I7ZC 3EA6A 4IFDH 2OT2A 4ID6A 3BVGA 1G8ZD 2SEBD 1LV9A 3MXUA 4BBRB 1EZ6A 2CW0D 1C48A 3GTQB 1DOKA 2K1BA 2EYHA 1HRJA 4OHJA 1T5EA 1RTNA 3T16A 1D2BA 3WOEA 2F0PA 5IT9L 4A3IB 1STEA 3E5SA 3L7ZC 3HKZB 3K5OA 2HQEA 4WORA 4C2MB 3MWYW 3I3CA 4PQXA 2OXPA 3P1HA 1V1OA 4WRDA 3GD7A 2L5TA 3RMHA 4KJOA 2F3WA 4RHRA 1CK1A 5IGEA 2QKIC 3AU7A 1H9MA 3A56A 1K8OA 1HA5A 3QG1A 3C2PA 3NTIA 5JEAG 2JE6I 2JP1A 1PTOF 3DWQA 4Q5VA 3W2DA 1HPCA 2EDGA 4ZKCB 3ND9A 4DGZA 1B1ZA 2PPBC 4RCOA 4QUCA 1CHQD 5E1FA 2TMPA 5I6WA 1CQFA 4OO1H 3GTLB 2IX3A 1A6XA 1B2TA 2JEBI 3CQZB 1TQOA 1K8MA 3BVMA 3TN2A 1NUCA 5IGGA 5C3WA 1KABA 3JAML 2F0UA 2LS01 2RBMA 5LL6S 4S3SA 3H6MA 3BS1A 1OXUA 1AZQA 4X3TA 4H7BA 1NCVA 4AYBB 2EJGC 1W6KA 1BUVT 2WV6D 2XN9C 3J80L 2C5CA 2RQXA 5IODA 2HCCA 3Q6SA 3NP8A 4TQUS 3SXHA 4CJ2C 3LWEA 2CQAA 2AUJD 1PYWD 5CV8A 4ZK9B 4K6LA 2EPBA 3DEPA 1TS5A 3PUYA 1NAPA 1SNQA 2AUKA 4RGOS 2EYMA 4KN7C 4O42A 4ME5A 2R92B 3DEOA 2O5JC 1EFID 2R3ZA 3H91A 3BDOA 2YU9B 1B3AA 4EQOA 1MBYA 4PMBA 3HOYB 1IYVA 5DNFA 3RZDB 1QB5D 4FO2A 2XRQD 1T5XD 3QIAA 1DONA 4M8AA 4LMQD 4Y7NB 1JICA 3RLFA 5M5YB 1BQQT 2A6HD 5JEAJ 3TP6A 2F0TA 2K7VA 1STYA 3FVQA 1SYFA 3OPOA 4UDUC 1LT4D 1EY7A 4KMUC 4KKUA 2NTTA 5C6AA 5I9PA 2EZVA 1KLGD 1SYBA 1HTPA 2MGSA 1S5BD 1QILA 2NVQB 2VNUD 5HURA 5EBCA 4R8IA 5BN3A 1RCVD 2B2VC 2G9DA 1BXTA 4JBWA 4C3IG 4KV6A 1BCPF 4B9WA 1SDFA 1ML0D 1SE3A 1MSGA 2F0EA 1BCPB 1IL8A 1D1KA 1EQTA 1HHVA 3GTPB 5K5PA 1SYGA 4G57A 1V43A 4ZLTF 1LTAD 1BF4A 4DA2A 4QMGA 2Z1CA 4DK1A 4K5XA 1EWHA 1WTQA 3CRKC 2X6GA 2QILA 1ONLA 5HGTA 3G7LA 3S15B 5EKKA 2PZWA 5C0XI 1CA6A 3I91A 1IYUA 2Q8RE 2EYFA 2Q8TA 4XQNA 2E74C 2FFKB 2R6GA 4K6DA 1EYAA 3EROA 5KEEA 1AN8A 1Y8PB 5FKAC 3GQBA 3WDNA 4RWSC 4NDXA 3MTSA 3PUVA 1PRTF 5CORA 5EQ0A 4FP5D 4XT1B 5I6YA 1RDPD 2JA6B 3U9SA 1VF5C 1PRTB 2MPMA 2F03A 1STNA 1PTOC 4C1NK 3Q0AA 3GTGB 1IHZA 1RD9D 4BWGB 5JPMC 1G6ZA 4PNYA 2BDOA 3KLRA 1HFGA 1SE4A 4ZRZA 5CBEE 2LKVA 1X3QA 1A3UA 3MA2B 1A15A 1S5ED 2Q8IB 1LTTD 1TT2A 2IT1A 1EYDA 1EEID 1FYCA 3BVZA 3T56B 4CBVA 1GHJA 3N52A 1FGBD 3P20A 1Q3LA 5C4ZA 5KNCA 1GUOA 1SYEA 1EY4A 4YIJA 3C1EA 4C1NI 3Q24A 1PTOH 2N55A 2RSOA 1DM0B 3D4RA 2XVSA 3S1NB 2F0NA 2DNCA 1TS4A 4HCSA 1GUSA 5DM63 3J7YW 1QOHA 3OWEB 4FVMA 3VYUA 5KRUA 2Z4IA 4DNRB 5C4HA 3NBHA 2JEAI 4XQQA 1ZYRD 2K04A 3VR5A 2NZ1D 2ZT9C 1PFBA 2EYOA 3SK8A 2KCCA 2RSNA 3L9AX 2OF1A 3IFDA 1Q8IA 1YNND 4N9PA 2F4IA 3CKIB 3TMEA 1TY2A 2H1EA 2B2TC 3S2HB 1WD0A 4XTCS 4J1MA 1H9JA 3IAYA 3LX0A 4U68A 3K6OA 2JXMB 1XX8A 4C3HG 2SNMA 1G2SA 4DK0A 4RFBA 1F9QA 2NN6I 1JWUD 3Q23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3P A;  1A15 A;  2B2V C;  4X3K A;  3I8Z A;  4R9W A;  1EL0 A;  2M2L A;  1PFM A;  2SDF A;  2EE1 A;  5EKI A;  1SDF A;  2HCI A;  4HSV A;  2HCC A;  1ML0 D;  2KOL A;  3MWY W;  3Q6S A;  5E4X A;  2IL8 A;  3I3C A;  1MSG A;  2X69 A;  1MI2 A;  2FMM A;  2KED A;  3KUP A;  3TZD A;  1EIG A;  2B2U A;  4CJ2 C;  2B2V A;  1G91 A;  2B2T A;  2EOT A;  3N52 A;  1IL8 A;  1PFN A;  1BNZ A;  2XIW A;  3LWE A;  1EQT A;  5CBA E;  1HHV A;  1ILP A;  1NR2 A;  4OIJ A;  1WTO A;  5JJZ A;  4IUQ A;  1F9R A;  4X3S A;  1BBX C;  1Q3L A;  2HDL A;  4ZLT F;  2L11 A;  4CJ1 B;  1E0B A;  4RAU C;  4UAI A;  2FJ2 A;  1QNK A;  4XT3 B;  1ICW A;  4ZK9 B;  5CMD A;  1BF4 A;  2NWG A;  4RA8 A;  1NR4 A;  2EPB A;  1WVL A;  3DEP A;  1QG7 A;  2K05 A;  2N55 A;  2RSO A;  3SVM A;  1WTQ A;  1O80 A;  1G2T A;  1VMC A;  2KUM A;  5EJW A;  1J9O A;  2JP1 A;  5T1G A;  3P7J A;  2X6G A;  2KVM A;  1NAP A;  1AP0 A;  5EPK A;  1TVX A;  1HA6 A;  1ESR A;  3G7L A;  2HUG A;  4MHE A;  1CA5 A;  4HCS A;  4O42 A;  1B4O A;  1DOL A;  2BDN A;  1CA6 A;  3I91 A;  4ZKC B;  2K01 A;  2Q8R E;  3DEO A;  4HAE A;  1KNE A;  4X3U A;  1MGS A;  1EIH A;  2Q8T A;  2R3Z A;  3H91 A;  1AZP A;  3DM1 A;  3GV3 A;  2FFK B;  1HUM A;  2MJ8 A;  3FPU B;  2CVR A;  1MSH A;  4IUV A;  1B3A A;  4QUC A;  1XYI A;  1U4P A;  1ZXT A;  2K04 A;  3HP3 A;  2VXW A;  2NZ1 D;  2K28 A;  1M8A A;  1J8I A;  1DZ1 A;  2B2W C;  4CJ0 B;  1PFB A;  2HDM A;  4QUF A;  1B50 A;  5COY A;  1F2L A;  2RSN A;  5DNF A;  1WTW A;  4RWS C;  2N88 A;  2L9H A;  1IKL A;  2K03 A;  2B2Y C;  4IUP A;  1F9P A;  5T1I A;  1JE4 A;  1PLF A;  3IFD A;  3MTS A;  3UI2 A;  3ONA B;  2NYZ D;  1IKM A;  5D65 A;  1ROD A;  1B2T A;  1HFN A;  1U4R A;  1RTO A;  5COR A;  1DON A;  2L1B A;  5EQ0 A;  1WTP A;  3GV6 A;  1U4L A;  4LMQ D;  1ILQ A;  1JIC A;  2B2W A;  1QE6 A;  2MP1 A;  4NW2 A;  4XT1 B;  1HUN A;  2KEC A;  2H1E A;  4OIK A;  1U4M A;  1RHP A;  1WTR A;  1WD1 A;  1DOM A;  1LV9 A;  3TN2 A;  1PDQ A;  2RVL A;  5AFW A;  3I90 A;  2B2U C;  3F2U A;  4IUU A;  2MPM A;  2B2T C;  2FIN B;  5EPL A;  4DN4 M;  4ZAI A;  4IUT A;  1CM9 A;  1WD0 A;  1BO0 A;  1DOK A;  2K1B A;  5EPJ A;  1KNA A;  2FHT A;  2DY7 A;  1WTV A;  2J7Z A;  1O7Z A;  3FDT A;  2JYO A;  1SSO A;  4U68 A;  1AZQ A;  1HRJ A;  3R93 A;  4MN3 A;  1C8C A;  1F9S A;  5E4W C;  1VMP A;  4X3T A;  1S4Z A;  1X32 A;  1XX8 A;  1SAP A;  1RTN A;  1EOT A;  3IL8 A;  1G2S A;  1G6Z A;  1NCV A;  4XDX A;  3D6W A;  4HED A;  2MGS A;  2D9U A;  2L12 A;  1HFG A;  3QO2 A;  5D14 A;  1RJT A;  1F9Q A;  2X6L A;  4ZKB B;  1B53 A;  5CBE E;  2L4N A;  2DY8 A;  1GUW A;  3KBX A;  2KEE A;  1X3Q A;  4IUR A;  4R8I A;  1WTX A;  2RA4 A;  1O7Y A;  2B2Y A; 
#chains in the Genus database with same CATH topology
 1EY8 A;  4FF1 A;  2J4X A;  3A8I E;  4LFA L;  4RHS A;  4JI0 L;  1I5F A;  3CPW A;  3GP7 A;  2NVT H;  1VQF A;  5BN4 A;  2N78 A;  3V05 A;  2NZH A;  3K7U C;  2E5L Q;  2B63 H;  5DEH A;  2FMM A;  3AEV A;  4RGN A;  4P72 A;  3OWF A;  4A3I G;  2OTL A;  2ZJQ A;  3HKS A;  3PIO A;  1Y1W B;  2I46 A;  1I6H H;  4V0B A;  1F9R A;  3HKZ G;  5AJ3 L;  3PIP A;  1K0R A;  2EYJ A;  1OTC A;  2BOS A;  2AQ1 B;  1E2Z A;  2C35 B;  2NVX B;  3H0G H;  4KHV A;  1WVL A;  4ZYS A;  1QG7 A;  1I4Q A;  1DD2 A;  3NWT A;  5FLX E;  3GTK B;  1XNR Q;  3AMU A;  3RNU A;  2UU9 Q;  4MHE A;  1UAP A;  4A4I A;  5I2Y A;  4GOP B;  3KLS A;  3T51 B;  2AKW B;  3TP5 A;  5JEA H;  2K01 A;  2XSC A;  3CU7 A;  1B9N A;  4GLX A;  3KOJ A;  4DUZ Q;  1HUM A;  2L15 A;  1Q90 A;  3SEB A;  5LMN L;  1ENC A;  2A69 D;  1BCP C;  1QVG A;  1KQS A;  5LMU L;  5GAG C;  2E2I H;  2ICI A;  2LXK A;  4K8I A;  3CC7 A;  5I2X A;  1SE2 A;  1UEB A;  4CKC A;  3S9W A;  4IUP A;  4GZY C;  3S1M H;  3UI2 A;  4G7O C;  2YTV A;  3PV0 A;  2PYK A;  1TWH H;  4ULL A;  1U4L A;  3PUW A;  5IIF A;  4OIK A;  4A3B H;  4M1U B;  1MHW C;  5CV7 A;  4DR3 Q;  2F0H A;  2F1M A;  4RKL A;  1YNJ D;  4ZAI A;  1SNM A;  5IGC A;  1TWA H;  4B08 A;  3CD6 A;  1GUN A;  5IP9 H;  4QGU A;  1O7Z A;  2NN6 G;  1VMP A;  3JC6 6;  4BBS B;  4ZUI A;  3HOU B;  4HED A;  3IKJ A;  4BS9 A;  5TSS A;  4EVO A;  2F0L A;  2ZM6 L;  2G5D A;  2B2Y A;  3EVQ A;  1DCZ A;  1X54 A;  2ZTE A;  3RD4 A;  3RUZ A;  1W3S A;  3ERQ A;  2R7F A;  1ENA A;  2ENB A;  4NB3 A;  5IWA L;  4BA2 I;  5CV9 A;  1V1P A;  1SEB D;  3E9I A;  1E2W A;  1PRT D;  5K36 G;  1FJG Q;  1LLR D;  2ZXR A;  2PZU A;  1CHP D;  5A2Q E;  2UUC L;  5JOB A;  4AYB G;  5C4J B;  1PRT C;  4HJ9 A;  4QL5 A;  5C44 B;  3URY A;  3IFT A;  2KA7 A;  4LFA Q;  1NR2 A;  4JI0 Q;  2WAC A;  2JA7 H;  1S3O A;  4RAU C;  2BA0 A;  3HS0 C;  4A3J H;  1SNC A;  4H13 C;  1NR4 A;  1SFO H;  1SMX A;  3LGJ A;  5FLM G;  3VYR A;  2K6A A;  3S2D B;  1VMC A;  1NY4 A;  1STA A;  1D5M C;  3EN2 A;  2EXD A;  1ESF A;  4IJL A;  5EPK A;  1I3Q H;  3HEJ A;  5AJ3 Q;  3S1R B;  1W6J A;  1JR0 D;  4LF7 L;  2M00 A;  4KTA A;  4QJF A;  4E6I A;  1R9T H;  1GOZ A;  1QUQ A;  2R93 B;  3VDY A;  4LFC L;  1MSH A;  4IUV A;  3L3O C;  1XYI A;  2JA8 H;  2DNE A;  2Y0S B;  3J7A V;  1ZXT A;  4N9T A;  1A62 A;  1TKW B;  3ULP A;  3LWU A;  4UPA A;  1GHK A;  4A3C H;  4JVZ A;  2OQK A;  1XMQ L;  3F2D A;  4C3J B;  1EQQ A;  1EYC A;  2D62 A;  5D65 A;  1YNX A;  5LMN Q;  3HOV B;  4KI0 A;  3KK7 A;  3R2T A;  1HXY D;  1PTO B;  5LMU Q;  1UWV A;  2CWA A;  4LF4 Q;  2UXC Q;  3HOY G;  2N3S A;  5M9O A;  2AQ3 B;  1FNV A;  5EPL A;  4YHH L;  2FIN B;  3NE5 B;  4K2K A;  2XGT A;  5IOC A;  1Y69 U;  3OTO L;  2Q2H A;  2WB1 B;  5KYL A;  3QJY A;  4IZ8 A;  3FPP A;  3E6Z X;  3I4N H;  1A8V A;  1FD7 D;  4OWT B;  2R7Z B;  3NEM A;  2LXJ A;  4G7Z C;  3GTJ H;  1BKB A;  2RDF A;  3M7G A;  2X6L A;  4ZKB B;  4LFB L;  1GUW A;  4G4K A;  3RN5 A;  1FR3 A;  3BDC A;  1EY5 A;  1HNW L;  3L2P A;  2RDG A;  1PHJ A;  2L0C A;  4GNX B;  1STG A;  4DV6 L;  4FNF A;  3A54 A;  3OIQ A;  4HSV A;  2IL8 A;  5C4X B;  3H3V H;  3K5M A;  3T53 B;  2ZM6 Q;  3KF8 B;  2B2V A;  5FJ8 G;  3K80 C;  2EOT A;  1N34 L;  2F3V A;  2XIW A;  3PF4 A;  4ODG A;  5M3M H;  3HG9 A;  3KJP A;  3AB9 A;  5D3D A;  5IWA Q;  2CFM A;  4N8F A;  3S14 H;  4RCN A;  3S1Q H;  3MXG A;  2UUC Q;  2VQF L;  3GTM B;  2IPK D;  3RZO B;  4DK3 C;  1WCM G;  3P7J A;  3AYH B;  1IZ6 A;  2PO4 A;  2JA9 A;  3UDG A;  4OWX B;  5NUC A;  5JVG 3;  2D5D A;  1SJE D;  4QY7 A;  1CT1 D;  3K59 A;  3S24 A;  2NVT B;  2ES2 A;  2UXB L;  3D8G A;  3EFX D;  2B63 B;  4LF7 Q;  2K28 A;  3K57 A;  4NMZ A;  2N88 A;  3MHB A;  1NMF A;  2F0S A;  4CDF C;  1I6H B;  1F9P A;  2L55 A;  4LFC Q;  4BY7 G;  3NUC A;  4OWW B;  3H0G B;  1I94 L;  1G29 1;  4LK1 C;  5KGU A;  4V19 0;  3CCM A;  1V9P A;  1SBB B;  2Q2T A;  1WTR A;  1Z6H A;  2XRS D;  3RR5 A;  3W1G A;  3K5N A;  1Q86 C;  4IUU A;  1I4X A;  1XMQ Q;  2A19 A;  4GOP C;  5CYU A;  4QIW B;  4PMW A;  1WJJ A;  2SNS A;  2TSS A;  3KDF B;  1A2T A;  1SNP A;  2K5N A;  2OEO A;  1TS3 A;  5C3X A;  4A3M H;  4LF9 L;  4GN5 A;  2J7Z A;  1Z7T A;  3U9O A;  1GUG A;  3HFZ B;  1Q81 C;  2JA6 G;  3TRZ A;  4YHH Q;  5M5X H;  3H94 A;  1JB7 A;  2VUM H;  2D9U A;  3OTO Q;  1SMY D;  2CH4 W;  1VQN A;  4Y52 H;  4DV1 L;  3KLS X;  3A7A B;  2K52 A;  2E2I B;  1CKO A;  1YVC A;  3NK9 A;  3QWN A;  1WTX A;  4DV5 L;  1E2V A;  1SMY C;  3I73 A;  2B8F A;  2EY5 A;  3S1M B;  1I4H A;  4JK1 C;  2AHO B;  1IBL L;  3NTH A;  1TWH B;  4DAP A;  4A3D H;  2ZXP A;  3KLW A;  1SRU A;  2KOL A;  3OIP A;  5E4X A;  4YCW A;  3MZ5 A;  4DKA C;  4A3B B;  4LFB Q;  2PMZ B;  1NTG A;  5FLX c;  1HJP A;  1EIF A;  1CFM A;  5KND A;  2K33 A;  1TWF H;  4A3L G;  4U67 3;  1EIY B;  4EGV A;  5CBA E;  1X3F A;  1ILP A;  3PO2 G;  4DV6 Q;  1A3T A;  1PZI D;  1TWA B;  4UAI A;  2HHH L;  5CMD A;  4OO1 G;  2NWG A;  3I4M G;  1K73 C;  1IL2 A;  3MXN A;  1G2T A;  1N34 Q;  1PH1 A;  1JQY D;  3F2C A;  4HSP A;  3M4Y A;  1F77 A;  1S5D D;  1HA6 A;  1CA5 A;  4F7X A;  1K8A C;  1DOL A;  5C0X H;  4KY5 A;  4JI7 Q;  1II3 A;  1O78 A;  2VQF Q;  5IP7 G;  2Q2I A;  3RLN A;  1AW7 A;  5GAE C;  4GN4 B;  1SND A;  1B44 D;  2A8V A;  4B9X A;  4A3E H;  1E22 A;  3HP3 A;  3MFY A;  1XPO A;  2B8G A;  4HJA A;  2NUC A;  4IOA A;  4CJ0 B;  5C5M A;  3D4W A;  5G3L F;  2EQS A;  3D3R A;  3BZD B;  3GTO H;  2JA7 B;  1MKH A;  4ZQ3 A;  3A8K E;  2UXB Q;  4RGT A;  1HFN A;  3M9B A;  4A3J B;  2L1B A;  1B9M A;  2PNH A;  1SFO B;  4MTK A;  4NW2 A;  4HR7 B;  1VQH A;  1PDQ A;  5AFW A;  3F2U A;  2F0J A;  3QR8 A;  1C0A A;  1IW7 D;  1LAB A;  4DN4 M;  4BY1 H;  4DV7 L;  1I3Q B;  1D7Q A;  4J15 A;  4RKB A;  1KIX A;  1L1O B;  3V2T A;  1IW7 C;  2F0D A;  2FHT A;  1V8Q A;  4K5V A;  2DY7 A;  5M5W H;  1I94 Q;  4LUZ A;  1VQD A;  1R9T B;  2K5W A;  4P73 A;  4K14 A;  1ZEQ X;  1PMR A;  2JYO A;  1WTH A;  5E4W C;  2IWH A;  5M3F H;  2JA8 B;  1HQM C;  4XDX A;  4LUV A;  4LF5 L;  2H4O A;  1KDB A;  2A6E C;  4YWL A;  4LF9 Q;  2VS1 A;  1M4V A;  3HOZ H;  1X3P A;  1T9H A;  5FO8 B;  1BBU A;  1PTO D;  2A74 C;  4C3H H;  4X6A H;  1EL0 A;  1TWC H;  3MFG A;  1IBM L;  3J81 E;  2EJM A;  2E2D C;  1JOQ A;  1A2U A;  3NBI A;  3LNN A;  2HCI A;  4JOI C;  1OO9 B;  5EBD A;  3PSI A;  1Y8N B;  1B70 B;  1J6Q A;  4WJW A;  4DV1 Q;  2EJF C;  2B2U A;  3OYY A;  2KHS A;  1R4P B;  1X56 A;  4DV5 Q;  1G91 A;  3E9H A;  3W3A A;  2ID0 A;  2Y0S E;  4JI8 Q;  4DXF A;  2H5X A;  4A93 H;  1IBL Q;  2E5L L;  2Z9H A;  3SR1 A;  4CJ1 B;  4XT3 B;  1M90 C;  3I4N B;  4CDE C;  1IYJ B;  4DAV A;  4HMJ A;  4KHZ A;  4ME3 A;  1KHI A;  1PYB A;  2KUM A;  1S5F D;  3NTK A;  5FK9 C;  3GTJ B;  2PZT A;  3W5O A;  5CV6 A;  1CTM A;  3DHQ A;  2MFI A;  3UE1 A;  2HUG A;  4GLV B;  3VYT A;  3PMF A;  1Y1W G;  1B4O A;  2HHH Q;  4FXG C;  1HZC A;  4R8N A;  4F88 A;  1EIH A;  1PFS A;  5LL6 X;  2EYL A;  2B39 A;  4TVA B;  1U4P A;  1EWI A;  1UE6 A;  3F8T A;  4LJZ C;  2MHV A;  4FF4 A;  2A73 B;  1F2L A;  5M3M B;  4HJ7 A;  1EU3 A;  3S14 B;  4ILW A;  3S1Q B;  3DMU A;  1ROD A;  1CQV A;  4PZ8 A;  2NZO A;  3GV6 A;  5ELN A;  2MP1 A;  1HUN A;  2RF4 A;  1XWE A;  3PO3 G;  2BCO A;  3CC2 A;  2O4X A;  1L2F A;  2RVL A;  1XJV A;  4O0A A;  3F2B A;  2NTS A;  4A3F G;  1ET6 A;  3D4D A;  4B3T L;  4L5S A;  3CCJ A;  1I4R A;  3QB3 A;  5JPN C;  1WTV A;  1H9S B;  3ZYY X;  3CCQ A;  2V4D A;  2WIN B;  1TWG H;  1VQE A;  4R4I A;  2FMC A;  1X32 A;  4A75 A;  1JJG A;  3BZK A;  4KY6 A;  4DV7 Q;  4JBK A;  4R1J A;  3L0O A;  1VQK A;  3E0J A;  2KEE A;  2NN6 H;  5IGD A;  4KKT A;  2RA4 A;  1O7Y A;  4HIK A;  4A3G H;  3KYH C;  4AQY L;  4JI6 L;  1CI3 M;  1LTR D;  1QZG A;  3M3Y H;  4J8Q A;  4LF5 Q;  1K3B C;  1KDA A;  1JOO A;  3X3N A;  4BBS G;  3BZC A;  5E7N A;  4JI1 L;  3HOU G;  2ALY B;  3TRE A;  4ZUJ A;  4OEM B;  2QDL A;  3FEW X;  4BBR G;  1WTO A;  2DN8 A;  5JJZ A;  1IBM Q;  2LY7 A;  1F2Z A;  1IXR A;  4A3M B;  1EY9 A;  1QNK A;  4Q0F A;  3CHB D;  3OMC A;  4FF2 A;  3SK6 A;  3TQY A;  1L0Y B;  1I50 H;  4L5T A;  1Z47 A;  3N6R A;  2PQA B;  1VQB A;  3HOW H;  5FO9 B;  1Y14 B;  4POF A;  4PMC A;  5M5X B;  3J81 i;  3DLL A;  2VUM B;  2EY6 A;  5C44 G;  3BYY B;  2VL6 A;  5IGF A;  1KNE A;  3UDF A;  3CCU A;  3VA7 A;  4QIW E;  3DM1 A;  4A3D B;  2CHB D;  4XXE A;  3CCE A;  2ICE C;  4FF3 A;  3OMG A;  5A35 A;  4C56 C;  2B2W C;  1N32 L;  5DM7 3;  4QUF A;  5COY A;  1TWF B;  4TKO B;  1OXS C;  1H9K A;  2L9H A;  4EQN A;  4I65 A;  1Y1V H;  4YCV A;  1IKM A;  2K14 A;  2IJ0 A;  1PYS B;  4CGY B;  1LTG D;  2BA1 A;  2EVB A;  2R93 G;  2WKC A;  4Z9C B;  1WI5 A;  2Y0S G;  2K32 A;  2KEC A;  4QF4 A;  3S17 H;  1MD2 D;  2KCN A;  1BCP D;  3I90 A;  1VCI A;  2WKD A;  3TBI B;  4JYA L;  1ZKO A;  3K81 C;  2JA5 B;  5EPJ A;  2PMZ E;  2CQO A;  2WII B;  1WFQ A;  1JCK B;  4C3J G;  3STB C;  2KJX A;  5JVH 3;  1E7Z A;  4LF4 L;  2UXC L;  3DM3 A;  1X55 A;  3HOV G;  5D3I B;  2A5H A;  2CH4 A;  3R2I A;  4A3E B;  5BN5 A;  3CCV A;  3D6W A;  1IBK L;  4B3T Q;  2L4N A;  2GN5 A;  5ELE A;  2DY8 A;  5ELD A;  2YTX A;  3T1Y L;  4IUR A;  3U4Z A;  4DNT B;  4X62 Q;  1VQM A;  4UHV A;  3A8J E;  4X3K A;  3I8Z A;  4XQJ A;  3GTO B;  3K58 A;  3FRP B;  5ELF A;  5C3E H;  4GKK L;  3SE0 A;  5IYC H;  3NPP A;  2WAQ B;  3JAM E;  1FNW A;  1JWM D;  4F8M A;  3VR3 A;  4ABN A;  1EEF D;  4BY1 B;  1L1O C;  4AQY Q;  5IYB G;  4JI6 Q;  3EQL C;  1EQV A;  4LUO A;  5M5W B;  4K8J A;  1E0B A;  1DGS A;  5FJ8 H;  4JI1 Q;  2I5H A;  3SVM A;  5C4X G;  5M3F B;  1C9O A;  4P2C B;  1O7I A;  3J80 E;  4KKS A;  4IUN A;  1KC8 C;  1EWC A;  2E2H H;  3M4Q A;  4B3M L;  4FXK C;  4HN7 A;  3HOZ B;  4HAE A;  3NSW A;  3C1F A;  4JC0 A;  4C3H B;  5J22 A;  1TWC B;  1VDZ A;  3CCL A;  1WCM H;  3E3X A;  3FPU B;  4DR6 L;  1RKN A;  5FOB B;  1E24 A;  4BA1 I;  2RHS B;  4TRD A;  3VA5 A;  2CW0 C;  4K2L A;  1GJX A;  3PUZ A;  3C3L A;  1STB A;  4NXN L;  1X6O A;  4A93 B;  3TP8 A;  4PV1 C;  2B29 A;  1L0X B;  4IFD I;  1K83 H;  1WTP A;  2GA4 B;  3OW7 A;  1ILQ A;  1QE6 A;  2NVY H;  1N32 Q;  1U4M A;  4A3K H;  1QNU A;  1RHP A;  4PG3 A;  3SHL A;  1B7Y B;  3M7N A;  4BY7 H;  1TU2 B;  4F87 A;  3K7A H;  1AFP A;  1PH3 A;  3NEN A;  3M4O H;  4IUT A;  1CM9 A;  2AQ2 B;  2A68 D;  3EJI A;  5GAD C;  3FDT A;  4H02 A;  1SSO A;  3J81 c;  5EKL A;  2R92 G;  3H0G G;  2A68 C;  3H3V C;  1KL9 A;  4GOP A;  3IL8 A;  4JG2 A;  2AMC B;  4FYD A;  4JYA Q;  2VB2 X;  3CRL C;  3QO2 A;  1RF2 D;  3KBX A;  1GUT A;  1HQR D;  1LUZ A;  4DFA A;  5FLX L;  3CC4 A;  2K5H A;  1SXT A;  5LHY 1;  2PNR C;  3HOX H;  1UNS A;  4PZ6 A;  3D6C A;  1IBK Q;  4BXX H;  2RDH A;  3Q22 A;  3T1Y Q;  5EGT A;  1QZH A;  4HTH A;  2F0I A;  5JAV A;  1PZJ D;  1QCB D;  4MIU A;  4OIJ A;  3SDZ A;  4X3S A;  2HDL A;  2F0K A;  3VR2 A;  4GKK Q;  1ICW A;  1KD1 C;  4JV5 L;  4RA8 A;  4RH6 A;  1TWG B;  1FVI A;  2K05 A;  3T1H L;  2IX0 A;  3PO2 H;  4A3B G;  5T1G A;  1LAC A;  2VB3 X;  1U5K A;  3I4M H;  1UE5 A;  2F0G A;  1HR0 W;  3JAM i;  4P75 A;  5JJI A;  4C3I H;  4A3G B;  2C9O A;  1A63 A;  4LW1 A;  2EXZ A;  3M3Y B;  3I70 A;  2EYP A;  2I5M X;  3A55 A;  1EFW A;  2I5L X;  3MXN B;  5GRO A;  3TP7 A;  3OOC A;  4JI7 L;  4IFD G;  4B3M Q;  1HNX Q;  2HDM A;  1B50 A;  4L8J A;  2K75 A;  2JN4 A;  2LMC B;  3VYS A;  2K03 A;  2B2Y C;  3J80 i;  1OXV A;  1JE4 A;  4OO1 I;  2NYZ D;  1DXM A;  4DR6 Q;  1LT6 D;  4XYO A;  2EIF A;  1RTO A;  4IPD A;  2IX1 A;  1AE2 A;  1Q1E A;  1HNZ Q;  1I50 B;  2ZXO A;  3P75 A;  1DOM A;  3NQT A;  3HOW B;  1EOV A;  3NWS A;  2K5D A;  1VQG A;  3NQI A;  4OGQ C;  4NXN Q;  5A2Q L;  1YEZ A;  4GS3 A;  1JT8 A;  1LTS D;  1KNA A;  3A74 A;  1EQR A;  4RGM A;  1LTI D;  4EX5 A;  2F0F A;  4G7H C;  1VQ6 A;  4DR4 L;  4A3J G;  2PI2 E;  1HTL D;  3FKI H;  1HZ9 A;  2XTI A;  2EY1 A;  3J81 j;  4DV0 Q;  5D14 A;  1GO3 E;  2PW5 A;  1RJT A;  3HZX A;  3TS0 A;  2E76 C;  1NNX A;  1SNO A;  2O2L D;  2F0O A;  4QB4 A;  5CGK A;  1BDO A;  1Y1V B;  4R9W A;  2M2L A;  1TR5 A;  4HMI A;  3D31 A;  2SDF A;  2EE1 A;  4B3R L;  3CPF A;  2QF7 A;  1KAA A;  2PQE A;  5GQO A;  2JA8 G;  2X69 A;  3S17 B;  1SJH D;  3U58 A;  1EIG A;  1K28 A;  3K5L A;  3TEH B;  4YWK A;  4H44 C;  4O1N A;  3J7Z C;  4JOI A;  3PCO B;  2L11 A;  5C5L A;  4RMF A;  4YWM A;  1VF7 A;  1CKN B;  2DUD A;  3G48 A;  4JI8 L;  1SYC A;  1E3P A;  4OXP A;  2XWB B;  5IYD G;  4DUY L;  1KRT A;  4KD4 A;  1GM5 A;  4IN3 A;  3S16 H;  1UUP A;  5I4D A;  4JV5 Q;  2KQ3 A;  3ZJY C;  1TS2 A;  1FL0 A;  4K5W A;  3T1H Q;  4DR1 L;  3I4N G;  3SK5 A;  5ELB A;  3MAQ A;  5C3E B;  1X65 A;  2UUB L;  2Z6K C;  2A6H C;  1E1T A;  1J8I A;  2D2C C;  1VQ8 A;  4GNX A;  4DR7 Q;  2BE5 D;  2QEX A;  1VQ4 A;  3BG3 A;  4NKL A;  4DU9 A;  5JJL A;  2F3I A;  5J1Z A;  4IPG A;  5T1I A;  3CCS A;  2BE5 C;  3H09 A;  3ONA B;  1Q8K A;  2HIV A;  4X66 L;  2RCF A;  3KF8 A;  3T13 A;  4DR5 L;  1GXD C;  1ET9 A;  2AWN A;  3DXJ C;  1CZG A;  4JI5 L;  4DV3 L;  1JJC B;  1LTB D;  4KN4 C;  2VW9 A;  1AEX A;  4POG A;  2E2H B;  2WAQ E;  4IPH A;  2I07 B;  4NPS A;  2ZTD A;  1XTD A;  3PO3 H;  2QEJ C;  3E0E A;  5CV5 A;  4CHT B;  1U9R A;  1Q1B A;  1Q12 A;  1WCM B;  1C8C A;  1F2Y A;  1S4Z A;  5E3F A;  1LT5 D;  5HY6 A;  3I4L A;  3CW2 C;  3X3M A;  1GD7 A;  4A3F H;  1QJO A;  2E2J H;  1VQA A;  3JAM c;  2L12 A;  3MEH A;  2BH2 A;  4CKB A;  1QWY A;  3NBH B;  4IFD J;  3CMA A;  3I72 A;  5H1S E;  1SLJ A;  4DR4 Q;  3KBG A;  2R7D A;  3TZU A;  1S72 A;  1EY6 A;  1K83 B;  3DWP A;  4KK7 A;  2F0V A;  3MC0 B;  3I56 A;  2PW7 A;  2LFN A;  2NVY B;  3BDL A;  3NEL A;  4A3K B;  3M85 A;  3J80 c;  3TZD A;  4PZ7 A;  1FGU A;  2K5Q A;  2B2T A;  4BY7 B;  1PFN A;  2A6E D;  1R4Q B;  3K7A B;  3ND8 A;  4LAA A;  2HIX A;  3K0Y A;  2F0M A;  2MO1 A;  4IUQ A;  4OEL B;  3M4O B;  4B3R Q;  3J7A F;  1I4G A;  4FXD A;  4IQZ A;  1EZ8 A;  3HOU H;  1H9R A;  2F0Q A;  3CP0 A;  1NSN S;  3KDF A;  1D8L A;  3B6Y A;  2Q2U A;  2YV5 A;  1C4Q A;  4BBR H;  3WOF A;  4EQP A;  2UUA Q;  1J9O A;  2MNA A;  1JOK A;  4XYQ A;  3C46 A;  1MJC A;  3KF6 A;  1TVX A;  1XNQ L;  3GTQ H;  2BDN A;  2DGY A;  3R8B A;  1PH8 A;  2OTJ A;  4JW0 A;  1AZP A;  3PIO 3;  1STH A;  3GV3 A;  1PH6 A;  1SRO A;  3PIP 3;  3HOX B;  4DUY Q;  1A3V A;  1DJR D;  4HIM A;  1HH2 P;  1O7L A;  1Q82 C;  2R61 A;  2VXW A;  3FMC A;  4A3I H;  4UP8 A;  4JI2 L;  4CDD C;  5ISR A;  3G4S A;  4DR1 Q;  3OW2 A;  2QCP X;  2GVB A;  1RIP A;  2Z0S A;  2UUB Q;  2O5I C;  3G6E A;  4GKJ L;  1YHQ A;  4C2M H;  2QA4 A;  2M9V A;  4YY3 L;  3MVV A;  1XPR A;  4A3D G;  3SK4 A;  1TII D;  2B2W A;  3ERS X;  2XNA C;  3TS2 A;  4DAY A;  1WD1 A;  1Y8O B;  5CR3 A;  3PO2 B;  2D0O A;  5CV4 A;  3IRB A;  2WB1 E;  1KLU D;  1G51 A;  2RHQ B;  1FNU A;  1I4P A;  1VQ7 A;  2J0T D;  4X66 Q;  1BO0 A;  3DUZ A;  5CC4 A;  3I4M B;  4DR5 Q;  2HD3 A;  1DYQ A;  2QW7 A;  1YZ6 A;  4C3I B;  4JI5 Q;  3TDQ A;  3R93 A;  4DV3 Q;  1EY0 A;  1F9S A;  1K8G A;  1V1Q A;  4OX9 Q;  4A76 A;  1SAP A;  3T4A C;  4DF7 A;  4AH6 A;  4J6H A;  1PVO A;  2P5Z X;  2JA5 G;  2D0P A;  2Z4H A;  4IAL A;  5EAY A;  4QQB X;  5DAU A;  5C0X G;  1HZB A;  3CXC A;  2AWO A;  4R4T A;  4OL7 A;  1KDC A;  4H0L C;  1KAW A;  4X62 L;  3VR4 A;  2JSO A;  1MI2 A;  2KED A;  2ZTC A;  3KUP A;  4R4Q A;  2VZA A;  5FO7 B;  3UDX A;  1JC7 A;  1CSQ A;  1BNZ A;  1WOC A;  1BBX C;  1ENF A;  1VQP A;  5F2D A;  3GTL H;  1PZK D;  1PH7 A;  3PUX A;  1OXX K;  3DWA A;  5KYI A;  3CQZ H;  1K9M C;  2OCE A;  3F1Z A;  1E1O A;  1Q46 A;  3FKI B;  2PCF B;  1ZYR C;  5IYB H;  3AFP A;  1L1O A;  4DR2 L;  2WAQ G;  2IY5 B;  1EU4 A;  5EJW A;  4KHP L;  2KVM A;  2F52 A;  1LO5 D;  1AP0 A;  5J3B A;  4BY1 G;  1X3G A;  1HCZ A;  1CZW A;  1XTC D;  4X3U A;  5C4X H;  1MGS A;  5ELC A;  1YNN C;  1BOS A;  3OHX C;  3NXW A;  2MJ8 A;  5K36 H;  4P71 A;  3TSS A;  1XPU A;  1D6E C;  5IGB A;  5M3F G;  3AQQ A;  5IT9 E;  1XNQ Q;  1M8A A;  1DZ1 A;  1V1P B;  2WP8 J;  1N9W A;  2G9H D;  1VQ5 A;  1WTW A;  3K8A A;  5JJK A;  3HOZ G;  2HT1 A;  2QDB A;  1XMO L;  3HRZ C;  1JOR A;  1U4R A;  1PXU A;  1N36 L;  3ULJ A;  3VR6 A;  5FLM H;  1J5E L;  1BR9 A;  3W1B A;  1YIJ A;  4AIM A;  3QOJ A;  4JI2 Q;  4DXG A;  3J81 L;  4WJ4 A;  2B2U C;  1I6V C;  4TSS A;  1W2B A;  2F4V L;  1JWS D;  2Z8L A;  2KCM A;  3S16 B;  1JB3 A;  2IW3 A;  4GKJ Q;  2N49 A;  4YY3 Q;  4A93 G;  3I7F A;  2MUY A;  3BYT B;  3A7L A;  5IE8 A;  2MO0 A;  4MN3 A;  2SOB A;  1EOT A;  2XWJ B;  3QOL A;  4UP9 A;  4KD3 A;  1QUQ B;  1B53 A;  1SYD A;  2NB0 A;  2Z6B A;  4N8X 1;  3V96 A;  1OXT A;  4L63 B;  2R92 H;  4HCE A;  3A5Z B;  5I9O A;  3STB D;  1PFM A;  1D1I A;  1S5C D;  5EKI A;  2YU9 H;  4I7A A;  3J7A 5;  5KIX A;  2KCT A;  4L6T B;  3OSO A;  3HOY H;  3CCR A;  4CKE A;  4R4C A;  4IO9 A;  4JI3 Q;  4LF8 Q;  2CWP A;  2E8G A;  3NHH A;  4QCL A;  2RKS A;  4XIG S;  4LNQ A;  3RZD H;  4KJN A;  1D5Z C;  2YTY A;  3ITP A;  2FJ2 A;  5G3L D;  3PO3 B;  2WB1 G;  4Y7N H;  3G6J B;  2ATW A;  4NP5 A;  4DV2 Q;  1MJE A;  1O80 A;  5M5Y H;  1F2M A;  2JK8 A;  2A69 C;  4A3F B;  5J39 A;  1LT3 D;  2R7Z G;  2E2J B;  1M1K C;  1H9S A;  3R3O A;  1ESR A;  2F0W A;  4EQ5 A;  4CDC C;  1KTK A;  4X65 L;  3BJU A;  2E75 C;  4WFN 3;  5KNB A;  4R4O A;  5C0X J;  3GO5 A;  4DR2 Q;  2EY2 A;  1UEA B;  2CVR A;  3PGZ A;  4KY7 A;  1NJI C;  1TY0 A;  4KHP Q;  1N33 L;  2NBF A;  1YI2 A;  1D5X C;  2YYZ A;  1K3R A;  3HGB A;  3MXP A;  2NVQ H;  1YNJ C;  1ASZ A;  1XXG A;  1IKL A;  3O13 A;  1CKM A;  1PLF A;  4A3G G;  4I7Z C;  4K0K L;  3EA6 A;  4IFD H;  1HNX L;  3U50 C;  2DJF C;  1SR3 A;  2OT2 A;  4ID6 A;  3BVG A;  1EYG A;  2QGQ A;  1G8Z D;  3WWV A;  2PI2 A;  2SEB D;  4X64 L;  1LV9 A;  3MXU A;  1PH2 A;  3EBE A;  4BBR B;  2VQE Q;  2UXD Q;  1EZ6 A;  2DJG C;  2GVA A;  2CW0 D;  3A5U A;  3GTP H;  4MTN A;  1XMO Q;  1C48 A;  3GTQ B;  2K1B A;  1DOK A;  1HNZ L;  2EYH A;  2PQA A;  1N36 Q;  1S40 A;  1ICF B;  1J5E Q;  1HRJ A;  2K50 A;  4OHJ A;  1T5E A;  1RTN A;  1HZA A;  3T16 A;  1X9N A;  2F4V Q;  1D2B A;  3HOW G;  3WOE A;  2F0P A;  5IT9 L;  4A3I B;  1STE A;  3S15 H;  3E5S A;  2B63 G;  3L7Z C;  3HKZ B;  1QVC A;  3K5O A;  4DV0 L;  2KHJ A;  2HQE A;  4WOR A;  4C2M B;  3MWY W;  3I3C A;  4PQX A;  2OXP A;  3P1H A;  1V1O A;  5GAH C;  4WRD A;  3GD7 A;  2L5T A;  3RMH A;  4KJO A;  2HQL A;  2F3W A;  4RHR A;  1CK1 A;  1CUK A;  5L37 A;  5IGE A;  1L0W A;  2QKI C;  3AU7 A;  1VS0 A;  1H9M A;  3A56 A;  5BR8 L;  1K8O A;  1Y1V G;  1YBY A;  4OON A;  1HA5 A;  4JI4 L;  3QG1 A;  4P74 A;  3C2P A;  1P8L A;  3NTI A;  1X3E A;  2JA6 H;  5JEA G;  2JE6 I;  4L5Q A;  2JP1 A;  1PTO F;  4APV A;  3FP9 A;  3DWQ A;  4Q5V A;  3W2D A;  1HPC A;  2EDG A;  4ZKC B;  2KBN A;  3ND9 A;  4HIO A;  3GTG H;  4DGZ A;  1B1Z A;  2PPB C;  4DPG A;  5IYD H;  4RCO A;  4QUC A;  1CHQ D;  3I2Z A;  4A3L H;  5E1F A;  2TMP A;  3ER0 A;  4X65 Q;  1VQ9 A;  3H15 A;  5I6W A;  4ZCK A;  1CQF A;  4OO1 H;  3GTL B;  2IX3 A;  1A6X A;  1B2T A;  2JEB I;  2Z6K A;  1N33 Q;  3CAM A;  5C3E G;  4DR7 L;  5DLQ E;  3CQZ B;  3A0J A;  1TQO A;  1K8M A;  5IP9 G;  5IYC G;  3BVM A;  3TN2 A;  1NUC A;  5IGG A;  4JPB W;  5C3W A;  2ZJR A;  3UDI A;  1KAB A;  4K0K Q;  3JAM L;  2F0U A;  2LS0 1;  5IP7 H;  2RBM A;  5LL6 S;  4S3S A;  3H6M A;  3BS1 A;  1OXU A;  1AZQ A;  1NE3 A;  4X64 Q;  4HID A;  3M4P A;  4X3T A;  3G71 A;  4H7B A;  1NCV A;  3S1N H;  4AYB B;  1YIT A;  1C7Y A;  2EJG C;  1W6K A;  1BUV T;  2WV6 D;  2XN9 C;  2K4K A;  3CME A;  1AE3 A;  3J80 L;  2C5C A;  2RQX A;  5IOD A;  1VQI A;  2HCC A;  3Q6S A;  2JA7 G;  3NP8 A;  3H3V I;  4TQU S;  1NMG A;  1Z9F A;  3SXH A;  4HJ8 A;  4CJ2 C;  3LWE A;  1HR0 L;  1PV4 A;  1LYL A;  2CQA A;  2AUJ D;  1PYW D;  5CV8 A;  4ZK9 B;  4K6L A;  2K5V A;  4IJH A;  2EPB A;  3DEP A;  1TS5 A;  4A3K G;  3RN2 A;  4UP7 A;  1JE5 A;  3AFQ A;  3D0F A;  3PUY A;  5IT9 c;  1PA6 A;  1GKH A;  1NAP A;  1SNQ A;  2AUK A;  5BR8 Q;  3S2H H;  4RGO S;  2EYM A;  2B3G A;  4KN7 C;  4O42 A;  4ME5 A;  2R92 B;  1ASY A;  4JI4 Q;  3DEO A;  2KEN A;  2O5J C;  2UUA L;  1EFI D;  2R3Z A;  3H91 A;  2WFW A;  4A3C G;  1KRS A;  3BDO A;  1WYD A;  2YU9 B;  3KFU A;  3K0X A;  1B3A A;  3Q8D A;  4EQO A;  1MBY A;  4PMB A;  3HOY B;  1SN8 A;  1IYV A;  3KF6 B;  5DNF A;  2IHF A;  3RZD B;  1QB5 D;  4FO2 A;  2XRQ D;  4O2D A;  1T5X D;  1BBW A;  3QIA A;  1DON A;  2V1C C;  4M8A A;  4LMQ D;  4Y7N B;  4HJ5 A;  1JIC A;  3HOX G;  3PQI A;  3RLF A;  4BXX G;  2MQH A;  3KJO A;  5M5Y B;  1BQQ T;  2A6H D;  5JEA J;  3TP6 A;  1P16 A;  2F0T A;  2K7V A;  1Y1W H;  1STY A;  3FVQ A;  3UE0 A;  1SE8 A;  1SYF A;  3OPO A;  4UDU C;  1LT4 D;  1EY7 A;  4KMU C;  2NVX H;  4KKU A;  2NTT A;  2LSS A;  5C6A A;  5I9P A;  1CSP A;  3CF5 A;  1YJW A;  2EZV A;  4JBM A;  2ASB A;  1KLG D;  4DAM A;  1SYB A;  1HTP A;  1HNW Q;  2FXQ A;  3GTK H;  4DAY B;  2MGS A;  1S5B D;  1QIL A;  2NVQ B;  2VNU D;  5HUR A;  5EBC A;  4R8I A;  4OX9 L;  5BN3 A;  1RCV D;  2B2V C;  2G9D A;  4LF6 L;  1BXT A;  1JJ2 A;  4JBW A;  4C3I G;  4KV6 A;  1BCP F;  4B9W A;  1SDF A;  5M3M G;  3RLO A;  2RCN A;  1ML0 D;  3BU2 A;  1SE3 A;  1MSG A;  2F0E A;  2JA5 H;  1BCP B;  1UE7 A;  1IL8 A;  1D1K A;  1EQT A;  1HHV A;  3GTP B;  5K5P A;  1SYG A;  4G57 A;  1V43 A;  4ZLT F;  4FDB A;  1LTA D;  1BF4 A;  4DA2 A;  4QMG A;  2Z1C A;  4DK1 A;  4MNO A;  4K5X A;  1EWH A;  4MZ9 A;  1B8A A;  1WTQ A;  2CKZ B;  3CRK C;  1HR0 Q;  2X6G A;  2QIL A;  1ONL A;  5HGT A;  1YJ9 A;  3G7L A;  3S15 B;  5EKK A;  2PZW A;  5C0X I;  1CA6 A;  3I91 A;  1IYU A;  2Q8R E;  2EYF A;  2Q8T A;  4XQN A;  2E74 C;  2FFK B;  4DK6 C;  4B3S L;  2IHE A;  2A1A A;  4LWC A;  4BBS H;  3FKI G;  2R6G A;  4K6D A;  3MEF A;  1EYA A;  3ERO A;  4L5R C;  5KEE A;  3GDE A;  1AN8 A;  1Y8P B;  1Q7Y C;  5FKA C;  3GQB A;  3WDN A;  4RWS C;  4NDX A;  2OWO A;  3EIV A;  3I4O A;  3MTS A;  1MIU A;  3PUV A;  1PRT F;  5COR A;  5EQ0 A;  2JJQ A;  3HKZ E;  4FP5 D;  4A3M G;  4XT1 B;  5I6Y A;  1RDP D;  2JA6 B;  3U9S A;  5C4J H;  1AH9 A;  4GLA C;  3ICE A;  5C44 H;  1VF5 C;  5HGQ A;  1PRT B;  2MPM A;  4RG1 A;  2F03 A;  4DV4 L;  3U4V A;  1QVF A;  1CKN A;  1UE1 A;  1STN A;  2VUM G;  1PTO C;  4C1N K;  3Q0A A;  5IY0 A;  4DNI A;  3GTG B;  1IHZ A;  4NXM L;  1RD9 D;  4BWG B;  1A0I A;  4IPC A;  1BVS A;  3ULL A;  1B3Q A;  3S2D H;  4GN3 B;  5JPM C;  1G6Z A;  4PNY A;  2BDO A;  3KLR A;  1HFG A;  1SE4 A;  4ZRZ A;  3S1R H;  1VQL A;  3FHW A;  1N8R C;  5CBE E;  1YJN A;  4JCV E;  4YCU A;  2LKV A;  1X3Q A;  1A3U A;  3MA2 B;  1A15 A;  1PH5 A;  1S5E D;  1LM0 A;  2Q8I B;  1KXL A;  1LTT D;  1TT2 A;  2IT1 A;  2KHI A;  2R93 H;  2VY3 A;  2CCZ A;  2I0Q A;  1EYD A;  2OQ0 A;  1EUJ A;  1EEI D;  1TXY A;  1FYC A;  3BVZ A;  4JBJ A;  3T56 B;  4CBV A;  1GHJ A;  3N52 A;  4GNX C;  4LF6 Q;  1FGB D;  1XNR L;  1JMC A;  3P20 A;  1Q3L A;  4C3J H;  2UU9 L;  5C4Z A;  5KNC A;  1GUO A;  1G6P A;  1SYE A;  3HOV H;  1EY4 A;  4YIJ A;  3C1E A;  4JI3 L;  4C1N I;  3Q24 A;  1VQO A;  4LF8 L;  1K0S A;  3I55 A;  1PTO H;  2N55 A;  2RSO A;  4DUZ L;  1U0L A;  1DM0 B;  3D4R A;  2XVS A;  3S1N B;  2F0N A;  2DNC A;  4A3E G;  1TS4 A;  4HCS A;  1GUS A;  5DM6 3;  3J7Y W;  1QOH A;  3OWE B;  4FVM A;  3VYU A;  4DV2 L;  5KRU A;  1NBW A;  1PH4 A;  2Z4I A;  4DNR B;  2R7Z H;  5C4H A;  3NBH A;  5ELO A;  2JQO A;  2JEA I;  4XQQ A;  1ZYR D;  2K04 A;  4KLK A;  3VR5 A;  2NZ1 D;  2ZT9 C;  4IOC A;  1PFB A;  2EYO A;  4DR3 L;  1VQJ A;  3SK8 A;  2KCC A;  2RSN A;  1LTL A;  3L9A X;  1VQC A;  2OF1 A;  4AYB E;  3IFD A;  4B3S Q;  1GVP A;  2N8N A;  1Q8I A;  1YNN D;  3SGI A;  4N9P A;  2F4I A;  2BH8 A;  1RL2 A;  3CKI B;  3TME A;  1TY2 A;  1H95 A;  2H1E A;  4UY8 C;  2B2T C;  1YHA A;  1PH9 A;  3S2H B;  1WD0 A;  4J1M A;  4XTC S;  2ZJP A;  1H9J A;  3IAY A;  4WJ3 M;  2VQE L;  2UXD L;  3LX0 A;  4ALP A;  4U68 A;  3GTM H;  3K6O A;  2JXM B;  1XX8 A;  3RZO H;  4C3H G;  2SNM A;  1G2S A;  4DV4 Q;  4DK0 A;  4RFB A;  1FJG L;  3PF5 A;  1F9Q A;  2NN6 I;  1JWU D;  5LMN W;  3Q23 A;  1YHB A;  4NXM Q; 
#chains in the Genus database with same CATH homology
 1EY8 A;  4FF1 A;  2J4X A;  3A8I E;  4RHS A;  3GP7 A;  5BN4 A;  3V05 A;  5DEH A;  2FMM A;  4RGN A;  3OWF A;  1Y1W B;  2I46 A;  4V0B A;  1F9R A;  2EYJ A;  2BOS A;  2AQ1 B;  1E2Z A;  2NVX B;  4KHV A;  1WVL A;  4ZYS A;  1QG7 A;  1I4Q A;  1DD2 A;  3NWT A;  5FLX E;  3GTK B;  3AMU A;  4MHE A;  1UAP A;  5I2Y A;  3KLS A;  3T51 B;  3TP5 A;  5JEA H;  2K01 A;  2XSC A;  3CU7 A;  1B9N A;  1HUM A;  1Q90 A;  3SEB A;  1ENC A;  2A69 D;  1BCP C;  2ICI A;  4K8I A;  5I2X A;  1SE2 A;  4CKC A;  3S9W A;  4IUP A;  4GZY C;  3UI2 A;  4G7O C;  3PV0 A;  2PYK A;  4ULL A;  1U4L A;  3PUW A;  5IIF A;  4OIK A;  4M1U B;  5CV7 A;  2F0H A;  2F1M A;  4RKL A;  1YNJ D;  4ZAI A;  1SNM A;  5IGC A;  4B08 A;  1GUN A;  1O7Z A;  2NN6 G;  1VMP A;  4BBS B;  4ZUI A;  3HOU B;  4HED A;  3IKJ A;  4BS9 A;  5TSS A;  4EVO A;  2F0L A;  2B2Y A;  3EVQ A;  1DCZ A;  3RD4 A;  3RUZ A;  3ERQ A;  1ENA A;  2ENB A;  4BA2 I;  5CV9 A;  1V1P A;  1SEB D;  1E2W A;  1PRT D;  5K36 G;  1LLR D;  2ZXR A;  2PZU A;  1CHP D;  5A2Q E;  5JOB A;  5C4J B;  1PRT C;  5C44 B;  3URY A;  3IFT A;  2KA7 A;  1NR2 A;  2WAC A;  4RAU C;  2BA0 A;  3HS0 C;  1SNC A;  4H13 C;  1NR4 A;  3VYR A;  2K6A A;  3S2D B;  1VMC A;  1STA A;  1D5M C;  1ESF A;  5EPK A;  3S1R B;  3HEJ A;  1W6J A;  1JR0 D;  2M00 A;  4KTA A;  4E6I A;  1GOZ A;  2R93 B;  1MSH A;  4IUV A;  3L3O C;  1XYI A;  3J7A V;  2DNE A;  2Y0S B;  1ZXT A;  4N9T A;  1TKW B;  3LWU A;  1GHK A;  4C3J B;  1EYC A;  2D62 A;  5D65 A;  3HOV B;  4KI0 A;  3KK7 A;  3R2T A;  1HXY D;  1PTO B;  5M9O A;  2AQ3 B;  1FNV A;  5EPL A;  2FIN B;  3NE5 B;  4K2K A;  5IOC A;  1Y69 U;  2WB1 B;  5KYL A;  3QJY A;  4IZ8 A;  3FPP A;  3E6Z X;  1FD7 D;  2R7Z B;  4G7Z C;  2RDF A;  3M7G A;  2X6L A;  4ZKB B;  1GUW A;  4G4K A;  1FR3 A;  3BDC A;  1EY5 A;  2RDG A;  2L0C A;  1STG A;  4FNF A;  3A54 A;  3OIQ A;  4HSV A;  2IL8 A;  5C4X B;  3K5M A;  3T53 B;  2B2V A;  2EOT A;  2F3V A;  2XIW A;  4ODG A;  3HG9 A;  3AB9 A;  5D3D A;  4RCN A;  3MXG A;  3GTM B;  2IPK D;  3RZO B;  3P7J A;  2PO4 A;  5NUC A;  5JVG 3;  2D5D A;  1SJE D;  1CT1 D;  3K59 A;  2NVT B;  3D8G A;  3EFX D;  2B63 B;  2K28 A;  3K57 A;  4NMZ A;  2N88 A;  3MHB A;  2F0S A;  1I6H B;  1F9P A;  2L55 A;  3NUC A;  3H0G B;  1G29 1;  4LK1 C;  5KGU A;  4V19 0;  1SBB B;  1WTR A;  1Z6H A;  2XRS D;  3K5N A;  4IUU A;  1I4X A;  5CYU A;  4QIW B;  4PMW A;  2SNS A;  2TSS A;  1A2T A;  1SNP A;  2OEO A;  1TS3 A;  5C3X A;  2J7Z A;  1Z7T A;  3U9O A;  1GUG A;  3H94 A;  2D9U A;  1SMY D;  3KLS X;  3A7A B;  2E2I B;  3NK9 A;  3QWN A;  1WTX A;  1E2V A;  1SMY C;  3I73 A;  2B8F A;  2EY5 A;  3S1M B;  1I4H A;  4JK1 C;  3NTH A;  1TWH B;  4DAP A;  2ZXP A;  2KOL A;  3OIP A;  5E4X A;  3MZ5 A;  4A3B B;  2PMZ B;  1CFM A;  5KND A;  2K33 A;  4U67 3;  4EGV A;  5CBA E;  1ILP A;  1A3T A;  1PZI D;  1TWA B;  4UAI A;  5CMD A;  4OO1 G;  2NWG A;  3MXN A;  1G2T A;  1JQY D;  4HSP A;  3M4Y A;  1F77 A;  1S5D D;  1HA6 A;  1CA5 A;  4F7X A;  1DOL A;  5C0X H;  4KY5 A;  1II3 A;  1O78 A;  1AW7 A;  1SND A;  1B44 D;  4B9X A;  3HP3 A;  3MFY A;  2B8G A;  2NUC A;  4CJ0 B;  5C5M A;  3D4W A;  5G3L F;  3D3R A;  3BZD B;  2JA7 B;  4ZQ3 A;  3A8K E;  4RGT A;  1HFN A;  4A3J B;  2L1B A;  1B9M A;  1SFO B;  4NW2 A;  4HR7 B;  1PDQ A;  5AFW A;  3F2U A;  2F0J A;  1IW7 D;  1LAB A;  4DN4 M;  1I3Q B;  4RKB A;  3V2T A;  1IW7 C;  2F0D A;  2FHT A;  1V8Q A;  4K5V A;  2DY7 A;  1R9T B;  2K5W A;  4K14 A;  1ZEQ X;  1PMR A;  2JYO A;  5E4W C;  2IWH A;  2JA8 B;  1HQM C;  4XDX A;  2H4O A;  1KDB A;  2A6E C;  1M4V A;  1X3P A;  5FO8 B;  1PTO D;  2A74 C;  1EL0 A;  3MFG A;  3J81 E;  2EJM A;  2E2D C;  1JOQ A;  1A2U A;  3NBI A;  3LNN A;  2HCI A;  1OO9 B;  5EBD A;  1Y8N B;  4WJW A;  2EJF C;  2B2U A;  2KHS A;  1R4P B;  1G91 A;  3W3A A;  2ID0 A;  4DXF A;  3SR1 A;  4CJ1 B;  4XT3 B;  3I4N B;  4DAV A;  4HMJ A;  4KHZ A;  2KUM A;  1S5F D;  3NTK A;  5FK9 C;  3GTJ B;  2PZT A;  5CV6 A;  1CTM A;  3DHQ A;  2HUG A;  3VYT A;  3PMF A;  1B4O A;  4FXG C;  4R8N A;  4F88 A;  1EIH A;  5LL6 X;  2EYL A;  2B39 A;  1U4P A;  4LJZ C;  2MHV A;  4FF4 A;  2A73 B;  1F2L A;  5M3M B;  1EU3 A;  3S14 B;  4ILW A;  3S1Q B;  3DMU A;  1ROD A;  1CQV A;  3GV6 A;  2MP1 A;  1HUN A;  1XWE A;  2BCO A;  2O4X A;  2RVL A;  2NTS A;  1ET6 A;  3D4D A;  1I4R A;  3QB3 A;  5JPN C;  1WTV A;  1H9S B;  3ZYY X;  2V4D A;  2WIN B;  2FMC A;  1X32 A;  4KY6 A;  3E0J A;  2KEE A;  2NN6 H;  5IGD A;  4KKT A;  2RA4 A;  1O7Y A;  1CI3 M;  1LTR D;  4J8Q A;  1KDA A;  1JOO A;  3X3N A;  4ZUJ A;  3FEW X;  1WTO A;  2DN8 A;  5JJZ A;  2LY7 A;  1F2Z A;  4A3M B;  1EY9 A;  1QNK A;  4Q0F A;  3CHB D;  3OMC A;  4FF2 A;  3SK6 A;  1L0Y B;  1Z47 A;  3N6R A;  5FO9 B;  5M5X B;  4PMC A;  2VUM B;  2EY6 A;  3BYY B;  5IGF A;  1KNE A;  3VA7 A;  3DM1 A;  4A3D B;  2CHB D;  4XXE A;  2ICE C;  4FF3 A;  3OMG A;  5A35 A;  4C56 C;  2B2W C;  5DM7 3;  4QUF A;  5COY A;  1TWF B;  4TKO B;  1OXS C;  1H9K A;  2L9H A;  4EQN A;  4I65 A;  1IKM A;  2IJ0 A;  4CGY B;  1LTG D;  2BA1 A;  2EVB A;  2WKC A;  4Z9C B;  2K32 A;  2KEC A;  4QF4 A;  1MD2 D;  2KCN A;  1BCP D;  3I90 A;  1VCI A;  2WKD A;  3TBI B;  1ZKO A;  2JA5 B;  5EPJ A;  2WII B;  1JCK B;  4C3J G;  5JVH 3;  2KJX A;  5D3I B;  2A5H A;  3R2I A;  4A3E B;  5BN5 A;  3D6W A;  2L4N A;  5ELE A;  2DY8 A;  5ELD A;  4IUR A;  4DNT B;  3A8J E;  4X3K A;  3I8Z A;  4XQJ A;  3GTO B;  3K58 A;  3FRP B;  5ELF A;  3SE0 A;  3NPP A;  2WAQ B;  3JAM E;  1FNW A;  1JWM D;  4F8M A;  3VR3 A;  4ABN A;  1EEF D;  4BY1 B;  3EQL C;  1EQV A;  5M5W B;  4K8J A;  1E0B A;  3SVM A;  5M3F B;  4P2C B;  3J80 E;  4KKS A;  4IUN A;  1EWC A;  4FXK C;  4HN7 A;  3HOZ B;  4HAE A;  3NSW A;  3C1F A;  4C3H B;  5J22 A;  1TWC B;  1VDZ A;  3FPU B;  1RKN A;  5FOB B;  4BA1 I;  4TRD A;  3VA5 A;  2CW0 C;  4K2L A;  1GJX A;  3PUZ A;  3C3L A;  1STB A;  4A93 B;  3TP8 A;  4PV1 C;  1L0X B;  4IFD I;  1WTP A;  2GA4 B;  3OW7 A;  1ILQ A;  1QE6 A;  1U4M A;  1QNU A;  1RHP A;  3SHL A;  3M7N A;  1TU2 B;  4F87 A;  1AFP A;  4IUT A;  1CM9 A;  2AQ2 B;  2A68 D;  3EJI A;  3FDT A;  1SSO A;  5EKL A;  2A68 C;  3H3V C;  3IL8 A;  4FYD A;  2VB2 X;  3CRL C;  3QO2 A;  1RF2 D;  3KBX A;  1GUT A;  1HQR D;  4DFA A;  5FLX L;  1SXT A;  5LHY 1;  2PNR C;  1UNS A;  3D6C A;  2RDH A;  3Q22 A;  5EGT A;  4HTH A;  2F0I A;  5JAV A;  1PZJ D;  1QCB D;  4MIU A;  4OIJ A;  3SDZ A;  4X3S A;  2HDL A;  2F0K A;  3VR2 A;  1ICW A;  4RA8 A;  4RH6 A;  1TWG B;  2K05 A;  2IX0 A;  5T1G A;  1LAC A;  2VB3 X;  2F0G A;  4A3G B;  2C9O A;  2EXZ A;  3M3Y B;  3I70 A;  2EYP A;  3A55 A;  3TP7 A;  3OOC A;  4IFD G;  2HDM A;  1B50 A;  4L8J A;  2LMC B;  3VYS A;  2K03 A;  2B2Y C;  1OXV A;  1JE4 A;  4OO1 I;  2NYZ D;  1DXM A;  1LT6 D;  4XYO A;  1RTO A;  2IX1 A;  1Q1E A;  1I50 B;  2ZXO A;  3P75 A;  1DOM A;  3NQT A;  3HOW B;  3NWS A;  2K5D A;  3NQI A;  4OGQ C;  5A2Q L;  1LTS D;  1KNA A;  4RGM A;  1LTI D;  2F0F A;  4G7H C;  1HTL D;  2EY1 A;  5D14 A;  2PW5 A;  1RJT A;  3HZX A;  2E76 C;  2O2L D;  1SNO A;  2F0O A;  4QB4 A;  5CGK A;  1BDO A;  1Y1V B;  4R9W A;  2M2L A;  1TR5 A;  4HMI A;  3D31 A;  2SDF A;  2EE1 A;  2QF7 A;  1KAA A;  2PQE A;  2X69 A;  3S17 B;  1SJH D;  1EIG A;  3K5L A;  4H44 C;  4O1N A;  2L11 A;  5C5L A;  1VF7 A;  1SYC A;  2XWB B;  4KD4 A;  4IN3 A;  1UUP A;  5I4D A;  2KQ3 A;  1TS2 A;  4K5W A;  3SK5 A;  5ELB A;  3MAQ A;  5C3E B;  2A6H C;  1J8I A;  2D2C C;  2BE5 D;  3BG3 A;  4NKL A;  4DU9 A;  5J1Z A;  5T1I A;  2BE5 C;  3H09 A;  3ONA B;  3KF8 A;  3T13 A;  1GXD C;  1ET9 A;  2AWN A;  3DXJ C;  1CZG A;  1LTB D;  4KN4 C;  1AEX A;  2E2H B;  2I07 B;  2QEJ C;  5CV5 A;  4CHT B;  1U9R A;  1Q1B A;  1Q12 A;  1WCM B;  1C8C A;  1F2Y A;  1S4Z A;  5E3F A;  1LT5 D;  3I4L A;  3X3M A;  1QJO A;  2L12 A;  3MEH A;  4CKB A;  1QWY A;  4IFD J;  3I72 A;  3KBG A;  3TZU A;  1EY6 A;  1K83 B;  3DWP A;  4KK7 A;  2F0V A;  3MC0 B;  2PW7 A;  2LFN A;  2NVY B;  3BDL A;  4A3K B;  3M85 A;  3TZD A;  2K5Q A;  2B2T A;  4BY7 B;  1PFN A;  2A6E D;  1R4Q B;  3K7A B;  3ND8 A;  4LAA A;  3K0Y A;  2F0M A;  4IUQ A;  3M4O B;  3J7A F;  1I4G A;  4FXD A;  4IQZ A;  1EZ8 A;  1H9R A;  2F0Q A;  1NSN S;  1C4Q A;  4EQP A;  3WOF A;  1J9O A;  1JOK A;  4XYQ A;  3C46 A;  1TVX A;  2BDN A;  3R8B A;  1AZP A;  3PIO 3;  1STH A;  3GV3 A;  3PIP 3;  3HOX B;  1DJR D;  1A3V A;  1O7L A;  2R61 A;  2VXW A;  3FMC A;  5ISR A;  2QCP X;  2O5I C;  2M9V A;  3MVV A;  3SK4 A;  1TII D;  2B2W A;  2XNA C;  4DAY A;  1WD1 A;  1Y8O B;  5CR3 A;  3PO2 B;  5CV4 A;  1KLU D;  1FNU A;  1I4P A;  2J0T D;  3I4M B;  1BO0 A;  3DUZ A;  5CC4 A;  1DYQ A;  4C3I B;  3TDQ A;  3R93 A;  1EY0 A;  1F9S A;  1SAP A;  3T4A C;  4DF7 A;  4J6H A;  2Z4H A;  4IAL A;  5DAU A;  5C0X G;  2AWO A;  4OL7 A;  1KDC A;  4H0L C;  3VR4 A;  2JSO A;  1MI2 A;  2KED A;  3KUP A;  5FO7 B;  1JC7 A;  1BNZ A;  1BBX C;  1ENF A;  5F2D A;  1PZK D;  3PUX A;  1OXX K;  3DWA A;  5KYI A;  3FKI B;  2PCF B;  1ZYR C;  1EU4 A;  5EJW A;  2KVM A;  1LO5 D;  1AP0 A;  1HCZ A;  1CZW A;  1XTC D;  4X3U A;  1MGS A;  5ELC A;  1YNN C;  1BOS A;  3OHX C;  3NXW A;  2MJ8 A;  5K36 H;  3TSS A;  1D6E C;  5IGB A;  5IT9 E;  1M8A A;  1DZ1 A;  1V1P B;  2WP8 J;  2G9H D;  1WTW A;  2QDB A;  3HRZ C;  1JOR A;  1U4R A;  1PXU A;  3VR6 A;  1BR9 A;  3QOJ A;  4DXG A;  3J81 L;  2B2U C;  1I6V C;  4TSS A;  1JWS D;  2Z8L A;  3S16 B;  1JB3 A;  2IW3 A;  2MUY A;  3BYT B;  3A7L A;  4MN3 A;  2SOB A;  1EOT A;  2XWJ B;  3QOL A;  4KD3 A;  1B53 A;  1SYD A;  2NB0 A;  3V96 A;  1OXT A;  4L63 B;  4HCE A;  5I9O A;  1PFM A;  1D1I A;  1S5C D;  5EKI A;  5KIX A;  4L6T B;  3OSO A;  4CKE A;  3NHH A;  4QCL A;  2RKS A;  4XIG S;  4KJN A;  1D5Z C;  3ITP A;  2FJ2 A;  5G3L D;  3PO3 B;  3G6J B;  4NP5 A;  1O80 A;  1F2M A;  2A69 C;  4A3F B;  5J39 A;  1LT3 D;  2E2J B;  1H9S A;  3R3O A;  1ESR A;  2F0W A;  1KTK A;  2E75 C;  4WFN 3;  5KNB A;  5C0X J;  3GO5 A;  2EY2 A;  1UEA B;  2CVR A;  4KY7 A;  1TY0 A;  2NBF A;  1D5X C;  2YYZ A;  3HGB A;  3MXP A;  1YNJ C;  1XXG A;  1IKL A;  3O13 A;  1PLF A;  4I7Z C;  3EA6 A;  4IFD H;  2OT2 A;  4ID6 A;  3BVG A;  1G8Z D;  2SEB D;  1LV9 A;  3MXU A;  4BBR B;  1EZ6 A;  2CW0 D;  1C48 A;  3GTQ B;  1DOK A;  2K1B A;  2EYH A;  1HRJ A;  4OHJ A;  1T5E A;  1RTN A;  3T16 A;  1D2B A;  3WOE A;  2F0P A;  5IT9 L;  4A3I B;  1STE A;  3E5S A;  3L7Z C;  3HKZ B;  3K5O A;  2HQE A;  4WOR A;  4C2M B;  3MWY W;  3I3C A;  4PQX A;  2OXP A;  3P1H A;  1V1O A;  4WRD A;  3GD7 A;  2L5T A;  3RMH A;  4KJO A;  2F3W A;  4RHR A;  1CK1 A;  5IGE A;  2QKI C;  3AU7 A;  1H9M A;  3A56 A;  1K8O A;  1HA5 A;  3QG1 A;  3C2P A;  3NTI A;  5JEA G;  2JE6 I;  2JP1 A;  1PTO F;  3DWQ A;  4Q5V A;  3W2D A;  1HPC A;  2EDG A;  4ZKC B;  3ND9 A;  4DGZ A;  1B1Z A;  2PPB C;  4RCO A;  4QUC A;  1CHQ D;  5E1F A;  2TMP A;  5I6W A;  1CQF A;  4OO1 H;  3GTL B;  2IX3 A;  1A6X A;  1B2T A;  2JEB I;  3CQZ B;  1TQO A;  1K8M A;  3BVM A;  3TN2 A;  1NUC A;  5IGG A;  5C3W A;  1KAB A;  3JAM L;  2F0U A;  2LS0 1;  2RBM A;  5LL6 S;  4S3S A;  3H6M A;  3BS1 A;  1OXU A;  1AZQ A;  4X3T A;  4H7B A;  1NCV A;  4AYB B;  2EJG C;  1W6K A;  1BUV T;  2WV6 D;  2XN9 C;  3J80 L;  2C5C A;  2RQX A;  5IOD A;  2HCC A;  3Q6S A;  3NP8 A;  4TQU S;  3SXH A;  4CJ2 C;  3LWE A;  2CQA A;  2AUJ D;  1PYW D;  5CV8 A;  4ZK9 B;  4K6L A;  2EPB A;  3DEP A;  1TS5 A;  3PUY A;  1NAP A;  1SNQ A;  2AUK A;  4RGO S;  2EYM A;  4KN7 C;  4O42 A;  4ME5 A;  2R92 B;  3DEO A;  2O5J C;  1EFI D;  2R3Z A;  3H91 A;  3BDO A;  2YU9 B;  1B3A A;  4EQO A;  1MBY A;  4PMB A;  3HOY B;  1IYV A;  5DNF A;  3RZD B;  1QB5 D;  4FO2 A;  2XRQ D;  1T5X D;  3QIA A;  1DON A;  4M8A A;  4LMQ D;  4Y7N B;  1JIC A;  3RLF A;  5M5Y B;  1BQQ T;  2A6H D;  5JEA J;  3TP6 A;  2F0T A;  2K7V A;  1STY A;  3FVQ A;  1SYF A;  3OPO A;  4UDU C;  1LT4 D;  1EY7 A;  4KMU C;  4KKU A;  2NTT A;  5C6A A;  5I9P A;  2EZV A;  1KLG D;  1SYB A;  1HTP A;  2MGS A;  1S5B D;  1QIL A;  2NVQ B;  2VNU D;  5HUR A;  5EBC A;  4R8I A;  5BN3 A;  1RCV D;  2B2V C;  2G9D A;  1BXT A;  4JBW A;  4C3I G;  4KV6 A;  1BCP F;  4B9W A;  1SDF A;  1ML0 D;  1SE3 A;  1MSG A;  2F0E A;  1BCP B;  1IL8 A;  1D1K A;  1EQT A;  1HHV A;  3GTP B;  5K5P A;  1SYG A;  4G57 A;  1V43 A;  4ZLT F;  1LTA D;  1BF4 A;  4DA2 A;  4QMG A;  2Z1C A;  4DK1 A;  4K5X A;  1EWH A;  1WTQ A;  3CRK C;  2X6G A;  2QIL A;  1ONL A;  5HGT A;  3G7L A;  3S15 B;  5EKK A;  2PZW A;  5C0X I;  1CA6 A;  3I91 A;  1IYU A;  2Q8R E;  2EYF A;  2Q8T A;  4XQN A;  2E74 C;  2FFK B;  2R6G A;  4K6D A;  1EYA A;  3ERO A;  5KEE A;  1AN8 A;  1Y8P B;  5FKA C;  3GQB A;  3WDN A;  4RWS C;  4NDX A;  3MTS A;  3PUV A;  1PRT F;  5COR A;  5EQ0 A;  4FP5 D;  4XT1 B;  5I6Y A;  1RDP D;  2JA6 B;  3U9S A;  1VF5 C;  1PRT B;  2MPM A;  2F03 A;  1STN A;  1PTO C;  4C1N K;  3Q0A A;  3GTG B;  1IHZ A;  1RD9 D;  4BWG B;  5JPM C;  1G6Z A;  4PNY A;  2BDO A;  3KLR A;  1HFG A;  1SE4 A;  4ZRZ A;  5CBE E;  2LKV A;  1X3Q A;  1A3U A;  3MA2 B;  1A15 A;  1S5E D;  2Q8I B;  1LTT D;  1TT2 A;  2IT1 A;  1EYD A;  1EEI D;  1FYC A;  3BVZ A;  3T56 B;  4CBV A;  1GHJ A;  3N52 A;  1FGB D;  3P20 A;  1Q3L A;  5C4Z A;  5KNC A;  1GUO A;  1SYE A;  1EY4 A;  4YIJ A;  3C1E A;  4C1N I;  3Q24 A;  1PTO H;  2N55 A;  2RSO A;  1DM0 B;  3D4R A;  2XVS A;  3S1N B;  2F0N A;  2DNC A;  1TS4 A;  4HCS A;  1GUS A;  5DM6 3;  3J7Y W;  1QOH A;  3OWE B;  4FVM A;  3VYU A;  5KRU A;  2Z4I A;  4DNR B;  5C4H A;  3NBH A;  2JEA I;  4XQQ A;  1ZYR D;  2K04 A;  3VR5 A;  2NZ1 D;  2ZT9 C;  1PFB A;  2EYO A;  3SK8 A;  2KCC A;  2RSN A;  3L9A X;  2OF1 A;  3IFD A;  1Q8I A;  1YNN D;  4N9P A;  2F4I A;  3CKI B;  3TME A;  1TY2 A;  2H1E A;  2B2T C;  3S2H B;  1WD0 A;  4XTC S;  4J1M A;  1H9J A;  3IAY A;  3LX0 A;  4U68 A;  3K6O A;  2JXM B;  1XX8 A;  4C3H G;  2SNM A;  1G2S A;  4DK0 A;  4RFB A;  1F9Q A;  2NN6 I;  1JWU D;  3Q23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...