2RA4A

Crystal structure of human monocyte chemoattractant protein 4 (mcp-4/ccl13)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
DALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Small-inducible cytokine A13
total genus 12
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ra4A00
3P7JA 2BDNA 1AZQA 3DM1A 2RSNA 2CVRA 3IFDA 3MWYW 5AFWA 1RODA 5EJWA 2H1EA 1MI2A 1PFNA 3UI2A 4ZKCB 4O42A 2EPBA 2KOLA 2B2UA 2N88A 1O7YA 1TVXA 1PLFA 1MSHA 1ZXTA 2NYZD 1EIHA 1O80A 2K28A 4OIJA 1SSOA 1ILPA 1J9OA 2L4NA 1RTOA 4IUTA 4CJ1B 3MTSA 1IKLA 2B2UC 1F9QA 5EPJA 4CJ2C 1WD1A 1F2LA 2MJ8A 1M8AA 4QUCA 4ZAIA 1B2TA 1A15A 1IKMA 1Q3LA 2KUMA 4HAEA 1F9PA 1WD0A 4X3KA 5EPLA 2FFKB 4QUFA 1WTVA 1HFNA 1U4PA 1HUMA 3ONAB 2K01A 1RJTA 1B53A 2IL8A 3Q6SA 1NR4A 4NW2A 1RHPA 4RWSC 2FJ2A 1MGSA 3H91A 1XYIA 1CA6A 2B2YA 2NWGA 3KBXA 4RAUC 2EOTA 5EKIA 1SDFA 1G91A 1LV9A 2VXWA 5CBEE 1NR2A 1HRJA 2KVMA 1AP0A 5CMDA 2Q8RE 4IUPA 5T1IA 2N55A 1F9RA 1BO0A 2JYOA 1JICA 3TN2A 1O7ZA 1S4ZA 3DEOA 4IUQA 1AZPA 2EE1A 2XIWA 3I91A 1PDQA 2B2WC 3IL8A 1C8CA 2B2VA 4HEDA 1ML0D 1NCVA 1EL0A 4R9WA 2RVLA 1WVLA 1IL8A 2HUGA 4IURA 1ILQA 1JE4A 2Q8TA 5JJZA 2L11A 1PFBA 2X6LA 2K03A 1QNKA 1HA6A 2MPMA 3FDTA 2HDLA 2J7ZA 2X69A 3G7LA 1ICWA 1RTNA 1X3PA 1PFMA 1BBXC 1BNZA 1DONA 1WTWA 4IUUA 1WTRA 1EOTA 3I90A 1QG7A 1B3AA 4ZK9B 2FINB 2B2TA 1NAPA 2K1BA 2B2WA 1ESRA 1DOKA 1SAPA 2JP1A 5E4WC 3I8ZA 5CBAE 4ZLTF 3F2UA 4R8IA 4U68A 1QE6A 1KNAA 1MSGA 1WTQA 2L1BA 4CJ0B 3GV3A 2D9UA 5DNFA 2DY8A 1E0BA 1U4RA 2X6GA 1X32A 4DN4M 1GUWA 2HDMA 3I3CA 1HUNA 4X3UA 4IUVA 2L12A 4UAIA 1G6ZA 4XT1B 1CA5A 1WTXA 1DZ1A 4HSVA 3HP3A 5T1GA 2B2YC 1BF4A 1VMPA 3R93A 1EIGA 2R3ZA 1G2TA 1HHVA 5EQ0A 5EPKA 4OIKA 3LWEA 2L9HA 5D65A 1CM9A 2NZ1D 2K04A 4X3TA 2SDFA 2M2LA 5E4XA 3SVMA 3TZDA 1HFGA 1XX8A 2RSOA 1WTPA 1U4LA 2B2VC 3D6WA 3KUPA 1J8IA 5D14A 4MHEA 2KECA 3FPUB 2FHTA 2K05A 4X3SA 2FMMA 1DOLA 4XDXA 3GV6A 1KNEA 1B50A 4RA8A 4ZKBB 1U4MA 2RA4A 1DOMA 4LMQD 2B2TC 2HCIA 1B4OA 1VMCA 1G2SA 2DY7A 4XT3B 2HCCA 2MGSA 3DEPA 2KEDA 2MP1A 1F9SA 3QO2A 5CORA 4HCSA 1X3QA 2KEEA 3N52A 4MN3A 5COYA 1WTOA 1EQTA
chains in the Genus database with same CATH superfamily
2KHSA 3P7JA 2NVTB 3PO3B 3OW7A 1IYVA 4HJ5A 4FXGC 2R7ZH 2PZTA 3UI2A 4LF6L 2SEBD 3PO3G 5CV4A 5F2DA 3J7A5 1EIHA 1EYDA 1Z47A 2B8GA 1OXXK 1SJHD 3KLSX 4CJ2C 4WJ4A 1SYGA 5G3LD 3KLSA 3J7YW 1D2BA 1ICFB 1EZ8A 4C56C 3PUXA 1HUMA 3J80L 4B3MQ 1B53A 4C2MB 4HJ9A 1FJGL 1NTGA 4N8X1 2VL6A 3W1BA 3G71A 1VQ7A 5M3FG 1YJWA 3GTLH 2EOTA 2R7ZB 5GAEC 1Y1WG 5EAYA 3ITPA 2R7ZG 3T1YL 3WOEA 5HY6A 4DAVA 1K3BC 1EY0A 1L1OA 2XNAC 4G7ZC 4IURA 4DR4L 5LMUQ 4B3SQ 1GJXA 2JJQA 4ZUIA 3J7ZC 1HNWQ 1TWHH 3BYYB 1N34L 4C1NK 5C3XA 2JA6B 1JJCB 1PH6A 2QDBA 1LLRD 5ELEA 1EIYB 2JA8H 1S5BD 4IO9A 3OHXC 3QJYA 3JAME 4C3IG 3PO2B 3AEVA 3K5NA 4A3GB 1AE3A 3L9AX 5C5LA 3CCLA 1JJGA 4IZ8A 5IGFA 1X32A 2PW5A 4BY7H 3ZYYX 1SRUA 3MEHA 1DD2A 1SYFA 1XPUA 1BDOA 5E7NA 1XMOQ 4JCVE 1X54A 4LF9L 3GP7A 2OQKA 1JOQA 3CC7A 2LSSA 2VQFL 4DR1L 2UUAQ 4OWXB 1E1OA 1CTMA 4JI2L 2EYPA 3S2HH 2A69D 3EJIA 4YWMA 1ZYRD 3GTLB 2RSOA 2UXDL 2F4VQ 2B2VC 3PIPA 2L0CA 2EYFA 1R4PB 5CV8A 4DV6L 3B6YA 2B29A 5KYLA 3MXGA 2KENA 4LMQD 3CC2A 4FO2A 1G2SA 3BDOA 4A3FH 1A3TA 5GROA 1E7ZA 1WTOA 2BDOA 3S17B 2CVRA 4DK6C 2BH8A 4N8FA 5C4ZA 1X9NA 3BZCA 3CRLC 5A2QL 2NTSA 1C48A 3TP6A 1LT5D 2A6HD 2Z1CA 5EPJA 4ZQ3A 3GD7A 4DK3C 3GTQH 3J81c 4A3MB 3SGIA 2WKCA 3NWTA 4I7ZC 1ASZA 3M9BA 2HQLA 3H91A 4DUYQ 1PH7A 4CDEC 2O5IC 2JA7B 2D62A 4AYBE 1JC7A 2L55A 5CMDA 4IPHA 4M8AA 1F9RA 4A3EG 4HMJA 1M90C 4NMZA 5LL6S 3KFUA 2I5HA 5M3FH 4QY7A 4PMCA 2HUGA 4CGYB 1FR3A 1ILQA 3OWFA 3T1HL 3Q23A 3SDZA 4TRDA 3T16A 1X3PA 2F0VA 1YEZA 4FF3A 2E2IB 2L15A 1WJJA 2B2WA 3S17H 3HG9A 1O78A 2AWOA 3VYRA 4HSPA 4UP9A 3VR6A 2ENBA 1K3RA 4G57A 2L1BA 4JI1Q 4A93H 1UAPA 1EFWA 2R92H 1EEID 3UE1A 1K73C 1WTXA 3S2DB 3IRBA 2B2YC 2KBNA 3M4QA 5AJ3L 3VYTA 3R93A 3DHQA 2LS01 4DKAC 3CMAA 2PQAB 1KLUD 2Y0SB 1H9SA 3J80E 4K0KL 1IBKL 3TRZA 2UUCL 4X65L 4UPAA 4IFDI 4CKEA 2E5LQ 3ZJYC 4X3SA 4XDXA 2QKIC 4JI1L 4JI6L 3BDCA 5KYIA 3GTKH 3A74A 1VQIA 1QNUA 1TR5A 2DY7A 3BZKA 2F0MA 3HOXG 4BA2I 2O5JC 4DGZA 3RZDB 2CKZB 1H9SB 1TXYA 1IYJB 2PQAA 3I55A 2XWJB 1PYSB 1I3QH 4A3BH 2K5NA 4X65Q 5LMNW 3K6OA 4YHHL 2D0OA 2K28A 3T51B 1STGA 4OELB 4EQNA 4LF7Q 1DCZA 4EX5A 4YY3L 1ONLA 1GOZA 1WTVA 2OTLA 4HR7B 4LF4L 1N36Q 1RJTA 1YIJA 2IL8A 3AFQA 1NR4A 3U50C 3RLFA 2YYZA 1UEBA 2JA8B 4R4IA 1BVSA 1QUQA 3NXWA 5EKIA 1AH9A 1XMQL 2Z9HA 4LFBL 1V1QA 2KCMA 4KKUA 3V05A 5ELDA 3W5OA 4AIMA 4RH6A 1Y1WB 2EE1A 1TY2A 3A7AB 1JQYD 3RLNA 4DV1L 4HTHA 5KRUA 4YY3Q 4FVMA 4CKBA 4WFN3 4DUZQ 1Q86C 4LF8Q 1STNA 2VW9A 2VQEL 5JJKA 1BBXC 4QB4A 2B63B 4LWCA 3NSWA 2FINB 1B7YB 1TIID 5DM73 1A2UA 1VCIA 2DJGC 2ZTCA 3I8ZA 4J6HA 2IX3A 4K2KA 3F2UA 3RD4A 4C2MH 2WACA 1I94L 2X6GA 1BBUA 3TBIB 4DAPA 4KJNA 1CK1A 2EYMA 2RDFA 4BWGB 5KEEA 4LF8L 1X3GA 3NBHA 4OWTB 1KRTA 3ND9A 4BBSG 1G2TA 3T13A 3U9SA 2VQEQ 3QG1A 2PI2A 2EXZA 2JQOA 1V43A 3TZDA 1HFGA 4DAYB 2A19A 2NVTH 1G8ZD 4TKOB 4DV7L 3JAMc 1EQVA 4DK1A 1TT2A 1XTCD 1I94Q 1EOVA 1VQBA 2LY7A 4B3TL 3PV0A 1BCPD 3NPPA 2PNHA 3OOCA 5COYA 1AZQA 3EVQA 2ICEC 4DXGA 4P73A 1BCPC 2G9HD 1JORA 4BXXG 2ICIA 3C2PA 3RZDH 1VQJA 4A3KB 3S14H 2F0WA 4A3JH 2SOBA 4K6LA 5G3LF 2AHOB 2I5MX 4JYAL 3JC66 1IKMA 2NN6I 5C3WA 5EPLA 5IGEA 3M85A 4XQJA 1VQ4A 1L1OB 1CKMA 1OXSC 4NP5A 5C3EG 2N3SA 4DV0L 2F0DA 3NENA 5HGQA 3CRKC 3OIPA 1Q82C 4KMUC 4KHPQ 1C0AA 1LABA 4YWLA 4P71A 3PUYA 4DR6L 1LACA 4A3JG 3Q8DA 3H0GH 1JE5A 2IHFA 3EBEA 3FVQA 3KF8B 2MPMA 5M9OA 3IAYA 4BBRH 2CW0C 5J3BA 4DXFA 1SNQA 5IWAL 1Q46A 2D5DA 3M7NA 1RIPA 2EXDA 2CCZA 4EQPA 2JP1A 2B63H 3HOVB 4B3ML 4Y52H 2I0QA 2VUMH 1KXLA 5C0XG 1MSGA 1HZAA 1FD7D 1VQMA 4DR7Q 1A3UA 5M3MH 4GOPB 1VQNA 1CT1D 1PTOF 5M3MB 1VQOA 3BJUA 3DMUA 2PYKA 4X62L 1M1KC 4LFAQ 1HZ9A 1CM9A 1PZJD 4KLKA 3TREA 4KN7C 4A3IG 4LUOA 1J5EQ 3KOJA 2K6AA 3CKIB 2ZTDA 1JWSD 3QOJA 5JVG3 1D6EC 1K83H 4K5XA 2FMMA 5I6YA 1B50A 3KBGA 3I4NH 2L5TA 1DOMA 1TWAH 1KHIA 1X65A 2YTYA 5GAGC 2B3GA 2WAQB 2N78A 3C1FA 3HKZG 5CBAE 1ZYRC 3I4OA 5JAVA 1C9OA 3TS0A 3HOZG 2XRQD 4A3FG 1J5EL 2Z6KC 3GQBA 2MO0A 5HURA 2K5VA 3A8IE 4MNOA 2UUAL 3EQLC 3GTMH 5J22A 2XRSD 5FKAC 3NTHA 2F03A 2KUMA 2N49A 1LUZA 3P1HA 4GKKL 1VQAA 2K33A 4QMGA 3CCMA 5IYDH 4IOCA 5DM63 4A3KH 3S14B 2NVYH 4NW2A 4DV6Q 2F0IA 4KY5A 2CH4A 1Y8OB 1MGSA 2B2YA 3Q24A 3I72A 3K5OA 1QCBD 1EYAA 1I4RA 1HQMC 1XNQQ 4DK0A 1BXTA 3HOWB 5H1SE 3SHLA 4DV3Q 2VB2X 1V1PA 4ABNA 3A7LA 3VR4A 4A3EB 5M5WB 4NXNL 4BY7G 2HT1A 3ERQA 3R2TA 4MZ9A 4BY7B 1YBYA 3E9IA 2RCNA 5KGUA 1RL2A 4RGNA 4A3JB 4NDXA 2HDLA 1PH3A 2JSOA 2A68D 3ULPA 2Z4IA 1B9MA 3SE0A 2NZOA 2G9DA 3E6ZX 2UUBL 1NAPA 4J8QA 4LW1A 2EYJA 1IW7C 1VQKA 5IYCH 5E3FA 4JI5L 1FNUA 3BVZA 4A3GG 2QEJC 4FXKC 2RHQB 5FO9B 4RCNA 4IUVA 1LTSD 3ND8A 4FF1A 1GHJA 1CZWA 3V96A 1E2VA 1EIGA 4L63B 1MKHA 2HD3A 4RKLA 2ZM6L 1S40A 2L9HA 3HRZC 5JPMC 4PNYA 4HJAA 1FNWA 2NVQB 1AW7A 2E76C 2ZJQA 1GVPA 1IHZA 1WOCA 5NUCA 4MHEA 1E2WA 2KECA 1STAA 3KLWA 4GOPA 1KNEA 1EUJA 2OT2A 3QWNA 1QB5D 2A6HC 3K58A 3DWQA 3J81j 4K8JA 1QWYA 2JEBI 3FRPB 3U4ZA 5C0XJ 3BVMA 3QO2A 1SYEA 2N88A 2ZM6Q 2YV5A 3PUZA 1S5DD 2DNEA 2IJ0A 2H1EA 4CDCC 1L0XB 1PFNA 3LWUA 5AJ3Q 2F3VA 4A3IH 4IOAA 3CXCA 4FNFA 5M5XB 2ZTEA 3F8TA 1HNWL 4OIJA 1S5CD 5EKKA 1LTID 5A2QE 3FP9A 4QJFA 2F0HA 1SYDA 2MJ8A 2QF7A 1TWCB 1EU3A 4GLVB 1HFNA 1ET6A 4DR3Q 4ME3A 4JV5L 3BZDB 5C3EB 4FF2A 3L0OA 5EBDA 1NR2A 2Q8RE 1KDCA 1XMOL 1QVGA 3VR5A 3S1NH 2F0QA 2K14A 2F1MA 2JA9A 4K14A 5EKLA 2EJGC 4IUQA 1IBLQ 4HIKA 1PH4A 1C8CA 1WTHA 1M4VA 1ML0D 1KIXA 1U0LA 2RVLA 1K0SA 4C3HG 5JJZA 1PHJA 1HA6A 1DYQA 2K03A 1PYWD 4YHHQ 2F4VL 2V4DA 4AYBG 4DA2A 1XTDA 2F52A 2QDLA 1XNRQ 3PF4A 2JA7H 2N8NA 3OPOA 5EBCA 2K7VA 4ZCKA 3A5ZB 1AFPA 3CCVA 2AKWB 4HIDA 4B3RQ 2BOSA 1VQCA 5GAHC 5IT9E 4YCWA 2KCTA 3CAMA 3BS1A 1VQDA 1VMPA 3STBC 4TQUS 3Q22A 4DV1Q 3HOWH 1WI5A 2K04A 5FJ8H 1EY5A 2LFNA 1SN8A 3CHBD 5EGTA 1EFID 4V0BA 4DUZL 1V8QA 1XNRL 3SK6A 2UU9L 2PCFB 3MC0B 4UHVA 4C3JB 1CQFA 3CCSA 1Y69U 2ZT9C 3HOUG 3AU7A 3NHHA 3STBD 1E1TA 3K5LA 1YNXA 3LGJA 4DNTB 4R4QA 4IJLA 3RUZA 1HNXQ 3P20A 3QOLA 2R92B 2VY3A 1GUGA 1SYCA 2WAQG 1VMCA 3I56A 1SNDA 4HMIA 4A3LG 4A75A 2HCCA 2MGSA 4F87A 3CPFA 2R92G 2F0OA 3GTPB 2KEEA 3J81L 1KLGD 1GHKA 1BCPB 1EY9A 4WJ3M 4HCEA 5ELNA 4M1UB 3S2HB 1BBWA 1WCMG 4JI3Q 1VF7A 1O7YA 3IKJA 1DM0B 1RTOA 3MTSA 2RHSB 5CV5A 4YCVA 1YZ6A 2F0UA 3NP8A 4A3KG 2DUDA 1SNCA 4IQZA 4NXML 3MFGA 4X3KA 4HIOA 1CSQA 5M5WH 1OO9B 1Z9FA 4PZ6A 2NVXH 3KJPA 1SNPA 1LT6D 1EWIA 1SE3A 4FXDA 2R93G 3SK8A 1IXRA 3KBXA 1OXVA 1YHQA 1P16A 1PRTF 4R4CA 3DLLA 2R7DA 4Y7NB 2EQSA 1JICA 4GNXB 2WB1B 2Z8LA 1HXYD 2Z6BA 4JI3L 3SK5A 2E2JH 2BH2A 3GTPH 2UXBL 1I4HA 5C4XB 3I91A 3I7FA 4G7OC 3HKZE 3MVVA 3G4SA 2F4IA 1E2ZA 2L11A 5IYCG 1SMYC 1O7LA 1JMCA 3F2DA 4A76A 1LT4D 1HR0W 3G7LA 3K81C 1HZCA 4H44C 3A5UA 4CDFC 2E5LL 4AYBB 3I90A 2NTTA 4KY6A 4GZYC 2CHBD 1NUCA 4NB3A 4POGA 1JWMD 4KY7A 4LF5Q 4PMWA 2HHHQ 3A56A 1RCVD 4CJ0B 3BVGA 1PH8A 3S2DH 2HDMA 4IALA 4A3DH 3NEMA 1Y8NB 3D4WA 2EVBA 2UXCL 4L5SA 1DZ1A 1ENAA 1CKOA 1BOSA 1GD7A 5M3MG 3GTJB 5EPKA 1PZKD 3S24A 4O2DA 4HIMA 2EIFA 3CP0A 5E4XA 3KF6B 4JI0Q 2ZJRA 1KD1C 5BN3A 3S16B 5ISRA 2HHHL 1HCZA 2FHTA 4DR5L 1BKBA 1E22A 5J39A 4AQYL 2IX0A 2B2TC 2HCIA 1AN8A 1STYA 1XMQQ 4LFBQ 1QJOA 2IY5B 1K9MC 2Y0SE 3N6RA 1EQRA 1F9SA 2WP8J 5CV9A 4DR7L 3CCJA 1JR0D 4X6AH 5LHY1 3PO2H 3HOXB 4POFA 3DM1A 2RSNA 3K7AB 3DWPA 4C3IH 4JI0L 4O42A 2VS1A 3VR2A 2NYZD 2E2HB 1MSHA 2V1CC 1LTBD 3GDEA 3OYYA 1IKLA 1F9QA 4A3MG 1A15A 2A6EC 1IBML 4A3DB 1PRTB 1SLJA 4J15A 1W2BA 1D5XC 2RKSA 1YHBA 5CYUA 5KIXA 2C35B 3F2BA 2CFMA 2YU9B 1XYIA 2WKDA 5C44B 3C1EA 3CCEA 1G91A 1JT8A 2AQ1B 5IP9G 2R93B 2KVMA 1AP0A 4CKCA 1Z6HA 5M5YB 1BO0A 2EY1A 2JN4A 1GUTA 3UDFA 2RBMA 1HH2P 3IL8A 1JWUD 3ERSX 1TS5A 2OXPA 2PZUA 1TWAB 2IX1A 1AE2A 2K4KA 5IP7H 4C3HB 2B63G 2X69A 4DV5Q 4FDBA 5FK9C 4GKKQ 1CSPA 2R93H 3F1ZA 3PO3H 3CC4A 2CW0D 5C4JB 4XYQA 2MUYA 1SMYD 1PTOD 5C6AA 1KABA 1I4QA 2EYOA 4UAIA 1VQPA 4Z9CB 4DV3L 1A2TA 1VQ8A 2VB3X 2YTVA 5IYBG 2A73B 1QOHA 4LFCL 4K6DA 3W1GA 4LF6Q 4KN4C 1U9RA 3I73A 3TMEA 4ALPA 4A3LH 4GS3A 5FO8B 4BBRB 1G51A 1YNJC 2NN6H 1CQVA 1NMFA 3H15A 4BA1I 3GTQB 1FGBD 1A8VA 1B8AA 1VQEA 4DV0Q 3HOYG 2KHJA 2OEOA 3NBIA 4JI8Q 3PGZA 1SNOA 1O7IA 1TWGB 4KHPL 1R4QB 4EQ5A 3NK9A 4RGTA 4X66L 3I70A 2WIIB 3PF5A 4JBKA 2CH4W 2EPBA 2KOLA 2YU9H 2F0LA 1PLFA 2NVYB 5KNCA 2J0TD 3R8BA 2KCCA 4DR4Q 1EY4A 1EY6A 4PZ7A 4IPGA 5DEHA 4B9XA 2A6ED 2VZAA 4JI8L 3Q6SA 3J81i 2JA7G 1YI2A 1CA6A 3VA5A 1SDFA 2A68C 1GUSA 1EEFD 1Q7YC 2K5WA 4J1MA 2KHIA 1Y1VH 5BN4A 1IL2A 3HFZB 4A3CG 2NBFA 4DF7A 1B3QA 3CD6A 1IL8A 3SR1A 2B39A 2XTIA 5ELFA 3MXPA 3K59A 3OMGA 1I6HB 2JA5H 4IPDA 5FLXc 2VQFQ 4DR1Q 3S1RB 4JI2Q 1B44D 3HOVG 3OSOA 3D6CA 4QIWB 1DGSA 1U5KA 3BDLA 3HZXA 1YVCA 1RF2D 1SYBA 1HR0L 3OTOQ 1GXDC 4KTAA 3UDIA 2F0TA 2F0PA 4P72A 3D0FA 3NE5B 3GTKB 3KF6A 5ELOA 3S9WA 5LMUL 4B3SL 2EY6A 2QW7A 2C5CA 1KC8C 1NBWA 4L8JA 3G6JB 4OIKA 3S16H 3E3XA 4Q5VA 2NUCA 1I3QB 5JEAG 1BQQT 3FKIH 5IT9c 1UE6A 3VYUA 1QZGA 1PRTC 5IP9H 5D14A 3OTOL 4LK1C 3A0JA 2K05A 3PUVA 2EZVA 2AQ2B 1PA6A 3CW2C 2CWPA 2GA4B 4P75A 2LXKA 1XNQL 3DEPA 3R3OA 4B3RL 2RF4A 5CORA 2PNRC 5LMNL 3HOZB 4Y7NH 2HQEA 3SK4A 3KDFA 4JI7L 4ZKCB 2F0SA 4IFDG 4XQQA 3ER0A 3J7AF 1XPOA 1ILPA 2NVXB 1J9OA 1N8RC 3JAMi 2RQXA 1YITA 2JA5G 4HAEA 4OO1H 2FFKB 2KQ3A 3F2CA 5M3FB 4KHVA 1L1OC 3K0XA 4DV2L 4RWSC 3IFTA 2GN5A 1V1PB 2ASBA 1KDAA 4A3CH 4DR2Q 1UUPA 1HRJA 1PFSA 1D1KA 1BR9A 4JI7Q 1STBA 1TQOA 2R7FA 5CV7A 3S1RH 3CPWA 4DNRB 2HIVA 1VQ5A 2B2VA 1EY8A 3OMCA 2QCPX 1PH2A 2P5ZX 1TS2A 1UWVA 1DXMA 2D2CC 3PUWA 1LO5D 1F2MA 2VNUD 2WB1E 4DV2Q 1CHQD 3J7AV 5FJ8G 1IBKQ 1EOTA 4ZK9B 1FL0A 4L5QA 2A69C 2I5LX 3FHWA 3CCRA 5HGTA 3NQTA 3GV3A 4GN5A 2IW3A 4XTCS 1U4RA 1STHA 2TSSA 2NZHA 1NNXA 2XSCA 4O1NA 3EFXD 3URYA 4DNIA 2O4XA 2UXBQ 4DAMA 1LM0A 3UDXA 4N9TA 1BCPF 4FYDA 4A3IB 3PIO3 2NN6G 4OHJA 5D65A 3H3VC 2M2LA 1VQ9A 1JB3A 4BBSH 4TVAB 4OGQC 5I9PA 1F77A 2FXQA 4PZ8A 1MIUA 3S1MB 1DOLA 1S72A 5FLMH 1B9NA 3EROA 1H9JA 2A8VA 5K5PA 4XT3B 1YNJD 4RFBA 2RDHA 2IWHA 1XWEA 1SJED 4GNXC 3K7UC 1LTTD 4QF4A 2GVBA 2OQ0A 3S1NB 3D3RA 1GUOA 1IBLL 1R9TB 3J81E 2ID0A 5AFWA 4IPCA 4ID6A 4RHRA 2O2LD 2BA1A 1K8OA 3M4YA 3RZOH 1I4XA 4F88A 1KQSA 2CWAA 3MXNA 3EA6A 1SE2A 1M8AA 4JI6Q 2RDGA 5IE8A 1D5ZC 2BE5C 2IPKD 1PRTD 5I2XA 5DLQE 3KYHC 3M7GA 1A3VA 1QUQB 1ENCA 1J6QA 2WB1G 5GADC 1EWCA 3TEHB 5C44G 2F0GA 5T1IA 1WCMH 4ODGA 2JYOA 3TN2A 2M00A 1ZEQX 3PQIA 5E1FA 2SNSA 4GNXA 2M9VA 1I50H 1I6HH 1Q1BA 3HOWG 2B2WC 1EZ6A 5L37A 2ZXOA 4FP5D 3M3YB 4IFDJ 1PFBA 2AUJD 4R1JA 4LF4Q 3FDTA 1S3OA 3FEWX 1Q1EA 4C3JH 1LTGD 1PFMA 1GM5A 1YHAA 5JJLA 4ULLA 2B2TA 2MNAA 3MA2B 1CZGA 3GTGH 3RR5A 2K5HA 1W3SA 1Q81C 4EVOA 2ATWA 1PTOH 2A1AA 5BN5A 2BE5D 1B1ZA 1EWHA 1HPCA 1QILA 5KNDA 1GUWA 4DN4M 3I3CA 3I2ZA 5IIFA 1I5FA 2Q2HA 4GN4B 4GOPC 4A4IA 3OIQA 4IFDH 1NY4A 1I50B 2R3ZA 2QILA 1TU2B 5FO7B 3SVMA 1CFMA 1ENFA 4QL5A 4YCUA 4C3JG 1N33L 3DXJC 1D8LA 5JEAJ 4NXMQ 1SEBD 4K5VA 1K8AC 2Z4HA 1EYCA 4TSSA 1FGUA 1SE8A 3K80C 3S1QH 1G291 3GTOH 4LJZC 3H6MA 3VDYA 3KDFB 3I4NB 1PZID 2Z0SA 2BA0A 1I4PA 1UE7A 1N9WA 3I4NG 1PMRA 4HCSA 4CDDC 2E8GA 2BDNA 1EIFA 4JVZA 4EQOA 2WV6D 3HKZB 1L2FA 2E75C 1TVXA 4UP7A 2TMPA 1TWHB 2HIXA 5J1ZA 4DV7Q 1QVCA 4H02A 1JOOA 1HNZL 4LFCQ 4QUCA 1WD0A 4KD4A 3I4MG 3H09A 1KAWA 1U4PA 2LXJA 2LMCB 1X3FA 3ONAB 4A3EH 3FPPA 3C46A 3S1MH 5I9OA 4LF5L 4RHSA 1T5EA 5M5XH 4B3TQ 1ESFA 3U4VA 2FJ2A 4MTKA 2NWGA 3HOVH 4PMBA 4IN3A 4IUPA 1JOKA 1RD9D 3ULLA 2N55A 1T5XD 4DPGA 1K8GA 1S4ZA 1X56A 2XIWA 1H9KA 2DN8A 1YJNA 2XWBB 5BR8L 4JYAQ 1PTOC 1AEXA 1PVOA 3BG3A 3M4OH 1K83B 2J7ZA 1QZHA 4LFAL 1MD2D 1ICWA 3DUZA 1TWFH 3K0YA 4E6IA 1BNZA 5ELCA 1WTRA 2EY2A 4Q0FA 1EU4A 4AQYQ 2JA6G 1ASYA 4R8IA 1JB7A 1WTQA 4L5RC 4WRDA 4QCLA 1HTLD 1C4QA 2PMZB 5BR8Q 2WINB 2L12A 5IOCA 5C0XH 1Y14B 3T1YQ 4DV4Q 1BF4A 2EJMA 1KRSA 4A3GH 4NPSA 3RN5A 3WWVA 4OWWB 4BBRG 3U58A 4OXPA 4RMFA 3J80i 3QIAA 5A35A 1SBBB 3FPUB 4G7HC 5D3IB 1H95A 3H0GB 3E0EA 1TS4A 2H4OA 5IYDG 1MJCA 4B9WA 2MP1A 4DV4L 1STEA 2F0EA 4JG2A 2AMCB 3N52A 1KL9A 2Z6KA 3W3AA 5IYBH 2GVAA 2MFIA 1MI2A 1JCKB 3RLOA 4ZYSA 1K8MA 4OEMB 2F3WA 1MJEA 3CCQA 2K52A 1IYUA 2B2UC 3CQZB 4RGMA 3M3YH 1F2LA 2DNCA 2EY5A 4LAAA 4ZAIA 1F9PA 2H5XA 3CQZH 4BXXH 3S15H 1Y1WH 4N9PA 5FLXE 4K8IA 5IGGA 1YNND 2NVQH 3U9OA 4H0LC 2IT1A 4GN3B 4JC0A 3L3OC 4L6TB 1TWGH 3NWSA 1C7YA 1ET9A 5CGKA 1P8LA 3ULJA 1VQ6A 1EL0A 4RGOS 4HJ8A 5C4XG 3CF5A 1F2YA 3I4MH 2X6LA 1QNKA 3VYSA 3FKIG 4UP8A 1NJIC 3VR3A 1DONA 4GLAC 1F2ZA 3X3NA 4LNQA 3TP7A 2QA4A 1SAPA 1E24A 5JOBA 2E2IH 4ZLTF 3Q0AA 1EQQA 2PQEA 4FF4A 4JPBW 2D9UA 5I4DA 4A3MH 5FLMG 3RMHA 3KK7A 2Q2UA 2K5DA 4OX9Q 4GKJL 1TWCH 1Y1VG 2OF1A 3WOFA 4I7AA 4HSVA 4XIGS 1D7QA 3GTOB 2XVSA 3HP3A 3QR8A 5CV6A 1Y1VB 1HQRD 1V1OA 5EQ0A 3M4PA 4X3TA 5CC4A 4JBJA 3LNNA 2UUBQ 1U4LA 3D6WA 5C3EH 2F0NA 2PPBC 1J8IA 5TSSA 1FJGQ 1SFOB 2XN9C 3M4OB 1N32Q 4JI5Q 4JOIC 3K5MA 1SROA 3HOUB 2K50A 1U4MA 4JK1C 3T56B 4OX9L 3T4AC 4GKJQ 2E2DC 3H0GG 5IODA 1GUNA 2D0PA 1X3QA 1Q8KA 3NELA 4IJHA 1WCMB 4BY1H 3MWYW 3NTKA 1VQFA 4PQXA 3SEBA 1FNVA 1VF5C 2KA7A 3LX0A 3MHBA 3EN2A 1XJVA 1A63A 3KF8A 1PYBA 2R6GA 2ES2A 2DJFC 4A3FB 1SSOA 4MTNA 4IUTA 1N34Q 4A3DG 1CKNA 4K0KQ 1N32L 1B2TA 1X6OA 2PO4A 4QUFA 1Q12A 5CR3A 4B08A 1MHWC 1SFOH 4F8MA 2CQOA 1Z7TA 3EIVA 1HR0Q 2AWNA 1SNMA 3NUCA 4G4KA 4OO1I 1I6VC 1IZ6A 2ZXPA 3K57A 1LV9A 2VXWA 5IT9L 2ZXRA 4DU9A 1PH5A 1R9TH 1HTPA 5IGDA 1T9HA 2JA6H 3HOXH 4WORA 4LF9Q 3FMCA 3TDQA 4H13C 3TP5A 4DFAA 1QVFA 1Q8IA 1LTAD 5JJIA 1AZPA 2ZJPA 1RDPD 1HA5A 3VA7A 1PDQA 5JPNC 1NCVA 4KI0A 4R9WA 1WVLA 2NB0A 2Q8TA 2I46A 2RCFA 4OONA 4DR3L 2UXDQ 1LYLA 3BYTB 4JV5Q 3L2PA 2EYHA 1A6XA 4R4TA 1PV4A 2MHVA 4UDUC 4A3BB 3MXNB 1YNNC 4JI4L 3A8JE 3TS2A 1V9PA 1CKNB 4BY1B 1ESRA 1TKWB 5E4WC 1N36L 3HOZH 3PIP3 4P2CB 3NQIA 3H3VH 1QE6A 1KNAA 4R4OA 2PZWA 5LMNQ 4RCOA 1HUNA 3HEJA 1Y8PB 1NSNS 1G6ZA 4XT1B 3BU2A 1SXTA 5T1GA 5JVH3 2JEAI 3PMFA 1XPRA 2BCOA 4BBSB 1SE4A 2SDFA 4JI4Q 3HS0C 1LTRD 4EGVA 2K32A 1WTPA 5IP7G 2WAQE 5FLXL 2QGQA 3I4LA 4AH6A 2PI2E 1FYCA 3G48A 4DAYA 4DUYL 4KHZA 2C9OA 4C1NI 4ZKBB 4JBMA 4DR2L 1W6JA 1VQHA 4RKBA 3HOUH 1CUKA 5C5MA 2Q8IB 1EY7A 3A8KE 5C4XH 2KEDA 4PG3A 1S5ED 1TS3A 4MN3A 4RG1A 1NMGA 1EQTA 3AFPA 3IFDA 3TZUA 1RODA 4JBWA 2YTXA 5EJWA 3K7AH 2VUMG 1WFQA 1XXGA 1X55A 3TP8A 2B2UA 3T1HQ 2UU9Q 4H7BA 2JA5B 2KCNA 2L4NA 2AUKA 1WD1A 4LUVA 1N33Q 2Q2TA 2E74C 2PMZE 4GLXA 1G6PA 1Q3LA 4KKSA 2JE6I 4KK7A 1HNXL 3HOYH 2EDGA 3SXHA 1KAAA 2K01A 3ICEA 1E3PA 2OCEA 3UDGA 1ZKOA 1GKHA 3KLRA 1JJ2A 1UE1A 2JA8G 5K36H 4XYOA 1O7ZA 3D4DA 3GTJH 2CQAA 4X64Q 1FVIA 2G5DA 3CU7A 3L7ZC 2UXCQ 2UUCQ 3PIOA 4P74A 2B8FA 3X3MA 1HNZQ 2AQ3B 1WTWA 4IUUA 4WJWA 4V190 3FKIB 1QG7A 3DWAA 4F7XA 1UNSA 1K28A 1VS0A 2K1BA 4ILWA 1A62A 1LT3D 5C44H 4S3SA 4CBVA 3S15B 3AYHB 5DNFA 1PH1A 2DY8A 1E0BA 3A55A 3TSSA 4X64L 1UEAB 5IGCA 1CA5A 2A74C 2F0FA 4A93B 4DR6Q 2J4XA 3H94A 1LTLA 2MQHA 3TQYA 3LWEA 3V2TA 3G6EA 4A93G 4I65A 4LF7L 2NZ1D 3CCUA 1NE3A 1D5MC 3W2DA 5IY0A 3KUPA 1VQGA 4JOIA 2KJXA 3E0JA 4ZRZA 5JEAH 5IWAQ 1OTCA 2SNMA 1PXUA 4R8NA 5C0XI 1YJ9A 1IBMQ 3K8AA 3PCOB 2RA4A 4IUNA 3RNUA 4JW0A 3MZ5A 3C3LA 1II3A 3S1QB 3MEFA 2EYLA 2E2HH 3UE0A 4HEDA 3JAML 3PSIA 2EJFC 1IW7D 1CHPD 4CHTB 3D31A 2FMCA 3P75A 1TWFB 1B70B 2IHEA 5KNBA 1S5FD 4X62Q 1ZXTA 5LL6X 3R2IA 5I6WA 3A54A 1O80A 5C4HA 4HJ7A 3MFYA 1UE5A 4CJ1B 4K5WA 4DR5Q 3I4MB 4KD3A 3MAQA 4O0AA 2JK8A 5FOBB 1DJRD 5D3DA 1I4GA 1HZBA 1WYDA 3H3VI 3O13A 3QB3A 2XGTA 1TY0A 3AQQA 1Q90A 2F0KA 1RHPA 4APVA 1BUVT 3GTGB 4UY8C 1HJPA 4QIWE 4RAUC 5CBEE 1X3EA 1SMXA 2R61A 3D4RA 3E5SA 2WFWA 1GO3E 2A5HA 4ZUJA 3GO5A 3DEOA 5IGBA 1PH9A 1H9RA 1RKNA 4YIJA 4PV1C 1JE4A 4YWKA 3T53B 3GTMB 1SR3A 5K36G 2Q2IA 3OWEB 3AMUA 1VQLA 4XQNA 1RTNA 2E2JB 5M5YH 4BY1G 2JXMB 4KJOA 2K5QA 4C3IB 3PO2G 1B3AA 4ME5A 3DM3A 4A3BG 2OTJA 1DOKA 1MBYA 1KTKA 4KV6A 4K2LA 5I2YA 4OL7A 4U68A 3E9HA 3HGBA 3HKSA 3OW2A 2F3IA 2QEXA 4QGUA 4L5TA 2K75A 2PW7A 4X3UA 4XXEA 2F0JA 1W6KA 4OO1G 3MXUA 3WDNA 1A0IA 2I07B 3J80c 1HHVA 3RZOB 1K0RA 4NXNQ 4NKLA 5C4JH 4DV5L 4X66Q 1OXTA 4QQBX 5ELBA 2LKVA 2Y0SG 1D1IA 3RN2A 1XX8A 1CI3M 3D8GA 1VDZA 1KDBA 1EYGA 3NTIA 2DGYA 2ALYB 4C3HH 1L0YB 4LUZA 5DAUA 4MIUA 3GV6A 3HOYB 4RA8A 4U673 4KKTA 3CMEA 2MO1A 1H9MA 1B4OA 3AB9A 2OWOA 1L0WA 1PTOB 3NBHB 5GQOA 3KJOA 4HN7A 2VUMB 4BS9A 1OXUA
chains in the Genus database with same CATH topology
2KHSA 3P7JA 2NVTB 3PO3B 3OW7A 1IYVA 4FXGC 2PZTA 3UI2A 2SEBD 5CV4A 5F2DA 1EIHA 1EYDA 1Z47A 2B8GA 1OXXK 1SJHD 3KLSX 4CJ2C 1SYGA 5G3LD 3KLSA 3J7YW 1D2BA 1EZ8A 4C56C 3PUXA 1HUMA 3J80L 1B53A 4C2MB 2EOTA 2R7ZB 3ITPA 3WOEA 4DAVA 2XNAC 1EY0A 4G7ZC 4IURA 1GJXA 4ZUIA 3BYYB 4C1NK 5C3XA 2JA6B 2QDBA 1LLRD 5ELEA 1S5BD 3OHXC 3QJYA 3JAME 4C3IG 3PO2B 3K5NA 4A3GB 3L9AX 5C5LA 4IZ8A 5IGFA 1X32A 2PW5A 1DD2A 3ZYYX 3MEHA 1SYFA 1BDOA 3GP7A 1JOQA 1CTMA 2EYPA 2A69D 3EJIA 3GTLB 1ZYRD 2RSOA 2B2VC 2L0CA 2EYFA 1R4PB 5CV8A 5KYLA 3MXGA 4LMQD 4FO2A 1G2SA 3BDOA 1A3TA 1WTOA 2BDOA 3S17B 2CVRA 5C4ZA 3CRLC 5A2QL 2NTSA 1C48A 3TP6A 1LT5D 2A6HD 2Z1CA 5EPJA 4ZQ3A 3GD7A 4A3MB 2WKCA 3NWTA 4I7ZC 3H91A 2O5IC 2JA7B 2D62A 1JC7A 2L55A 5CMDA 4M8AA 1F9RA 4HMJA 4NMZA 5LL6S 4PMCA 2HUGA 4CGYB 1FR3A 1ILQA 3OWFA 3Q23A 3SDZA 4TRDA 3T16A 1X3PA 2F0VA 4FF3A 2E2IB 2B2WA 3HG9A 1O78A 2AWOA 3VYRA 4HSPA 3VR6A 2ENBA 4G57A 2L1BA 1UAPA 1EEID 1WTXA 3S2DB 2B2YC 3VYTA 3R93A 3DHQA 2LS01 1KLUD 2Y0SB 1H9SA 3J80E 4IFDI 4CKEA 4X3SA 4XDXA 2QKIC 3BDCA 5KYIA 1QNUA 1TR5A 2DY7A 2F0MA 4BA2I 2O5JC 4DGZA 3RZDB 1H9SB 2XWJB 3K6OA 2K28A 3T51B 1STGA 4EQNA 1DCZA 1ONLA 1GOZA 1WTVA 4HR7B 1RJTA 2IL8A 1NR4A 3RLFA 2YYZA 2JA8B 3NXWA 5EKIA 4KKUA 3V05A 5ELDA 4RH6A 1Y1WB 2EE1A 1TY2A 3A7AB 1JQYD 4HTHA 5KRUA 4FVMA 4CKBA 4WFN3 1STNA 1BBXC 4QB4A 2B63B 3NSWA 2FINB 1TIID 5DM73 1A2UA 1VCIA 3I8ZA 4J6HA 2IX3A 4K2KA 3F2UA 3RD4A 2WACA 2X6GA 3TBIB 4DAPA 4KJNA 1CK1A 2EYMA 2RDFA 4BWGB 5KEEA 3NBHA 3ND9A 1G2TA 3T13A 3U9SA 3QG1A 2EXZA 1V43A 3TZDA 1HFGA 1G8ZD 4TKOB 1EQVA 4DK1A 1TT2A 1XTCD 2LY7A 3PV0A 1BCPD 3NPPA 3OOCA 5COYA 1AZQA 3EVQA 2ICEC 4DXGA 1BCPC 2G9HD 1JORA 2ICIA 3C2PA 4A3KB 2F0WA 2SOBA 4K6LA 5G3LF 1IKMA 2NN6I 5C3WA 5EPLA 5IGEA 3M85A 4XQJA 1OXSC 4NP5A 2F0DA 3CRKC 3OIPA 4KMUC 1LABA 3PUYA 1LACA 3FVQA 2MPMA 5M9OA 3IAYA 2CW0C 4DXFA 1SNQA 2D5DA 3M7NA 4EQPA 2JP1A 3HOVB 5C0XG 1MSGA 1FD7D 1A3UA 1CT1D 1PTOF 5M3MB 3DMUA 2PYKA 1PZJD 1CM9A 4KN7C 2K6AA 3CKIB 1JWSD 3QOJA 5JVG3 1D6EC 4K5XA 2FMMA 5I6YA 1B50A 3KBGA 2L5TA 1DOMA 2WAQB 3C1FA 5CBAE 1ZYRC 5JAVA 2XRQD 3GQBA 5HURA 3A8IE 3EQLC 5J22A 2XRSD 5FKAC 3NTHA 2F03A 2KUMA 3P1HA 2K33A 4QMGA 5DM63 3S14B 4NW2A 2F0IA 4KY5A 1Y8OB 1MGSA 2B2YA 3Q24A 3I72A 3K5OA 1QCBD 1EYAA 1I4RA 1HQMC 4DK0A 1BXTA 3HOWB 3SHLA 2VB2X 1V1PA 4ABNA 3A7LA 3VR4A 4A3EB 5M5WB 3ERQA 3R2TA 4BY7B 5KGUA 4RGNA 4A3JB 4NDXA 2HDLA 2JSOA 2A68D 2Z4IA 1B9MA 3SE0A 2G9DA 3E6ZX 1NAPA 4J8QA 2EYJA 1IW7C 5E3FA 1FNUA 3BVZA 2QEJC 4FXKC 5FO9B 4RCNA 4IUVA 1LTSD 3ND8A 4FF1A 1GHJA 1CZWA 3V96A 1E2VA 1EIGA 4L63B 4RKLA 2L9HA 3HRZC 5JPMC 4PNYA 1FNWA 2NVQB 1AW7A 2E76C 1IHZA 5NUCA 4MHEA 1E2WA 2KECA 1STAA 1KNEA 2OT2A 3QWNA 1QB5D 2A6HC 3K58A 3DWQA 4K8JA 1QWYA 2JEBI 3FRPB 5C0XJ 3BVMA 3QO2A 1SYEA 2N88A 3PUZA 1S5DD 2DNEA 2IJ0A 2H1EA 1L0XB 1PFNA 3LWUA 2F3VA 4FNFA 5M5XB 4OIJA 1S5CD 5EKKA 1LTID 5A2QE 2F0HA 1SYDA 2MJ8A 2QF7A 1TWCB 1EU3A 1HFNA 1ET6A 3BZDB 5C3EB 4FF2A 5EBDA 1NR2A 2Q8RE 1KDCA 3VR5A 2F0QA 2F1MA 5EKLA 4K14A 2EJGC 4IUQA 1C8CA 1M4VA 1ML0D 2RVLA 4C3HG 5JJZA 1HA6A 1DYQA 2K03A 1PYWD 2V4DA 4DA2A 3OPOA 5EBCA 2K7VA 1AFPA 2BOSA 5IT9E 3BS1A 1VMPA 4TQUS 3Q22A 2K04A 1EY5A 2LFNA 3CHBD 5EGTA 1EFID 4V0BA 1V8QA 3SK6A 2PCFB 3MC0B 4C3JB 1Y69U 1CQFA 2ZT9C 3AU7A 3NHHA 3K5LA 4DNTB 3RUZA 3P20A 3QOLA 2R92B 1GUGA 1SYCA 1VMCA 1SNDA 4HMIA 2HCCA 2MGSA 4F87A 2F0OA 3GTPB 2KEEA 3J81L 1KLGD 1GHKA 1BCPB 1EY9A 4HCEA 4M1UB 3S2HB 1VF7A 1O7YA 3IKJA 1DM0B 1RTOA 3MTSA 5CV5A 2F0UA 3NP8A 1SNCA 4IQZA 3MFGA 4X3KA 1OO9B 1SNPA 1LT6D 1SE3A 4FXDA 3SK8A 3KBXA 1OXVA 1PRTF 4Y7NB 1JICA 2WB1B 2Z8LA 1HXYD 3SK5A 1I4HA 5C4XB 3I91A 4G7OC 3MVVA 2F4IA 1E2ZA 2L11A 1SMYC 1O7LA 1LT4D 3G7LA 4H44C 4AYBB 3I90A 2NTTA 4KY6A 4GZYC 2CHBD 1NUCA 1JWMD 4KY7A 4PMWA 3A56A 1RCVD 4CJ0B 3BVGA 2HDMA 4IALA 1Y8NB 3D4WA 2EVBA 1DZ1A 1ENAA 1BOSA 3GTJB 5EPKA 1PZKD 5E4XA 5BN3A 3S16B 5ISRA 1HCZA 2FHTA 5J39A 2IX0A 2B2TC 2HCIA 1AN8A 1STYA 1QJOA 3N6RA 1F9SA 2WP8J 5CV9A 1JR0D 5LHY1 3HOXB 3DM1A 2RSNA 3K7AB 3DWPA 4O42A 3VR2A 2NYZD 2E2HB 1MSHA 1LTBD 1IKLA 1F9QA 1A15A 2A6EC 4A3DB 1PRTB 1D5XC 2RKSA 5CYUA 5KIXA 2YU9B 1XYIA 2WKDA 5C44B 3C1EA 1G91A 2AQ1B 2R93B 2KVMA 1AP0A 4CKCA 1Z6HA 5M5YB 1BO0A 2EY1A 1GUTA 2RBMA 3IL8A 1JWUD 1TS5A 2OXPA 2PZUA 1TWAB 2IX1A 4C3HB 2X69A 5FK9C 2CW0D 5C4JB 4XYQA 2MUYA 1SMYD 1PTOD 5C6AA 1KABA 1I4QA 2EYOA 4UAIA 4Z9CB 1A2TA 2VB3X 2A73B 1QOHA 4K6DA 4KN4C 1U9RA 3I73A 3TMEA 5FO8B 4BBRB 1YNJC 2NN6H 1CQVA 4BA1I 3GTQB 1FGBD 2OEOA 3NBIA 1SNOA 1TWGB 1R4QB 3NK9A 4RGTA 3I70A 2WIIB 2EPBA 2KOLA 2F0LA 1PLFA 2NVYB 5KNCA 2J0TD 3R8BA 2KCCA 1EY4A 1EY6A 5DEHA 4B9XA 2A6ED 3Q6SA 1CA6A 3VA5A 1SDFA 2A68C 1GUSA 1EEFD 2K5WA 4J1MA 5BN4A 2NBFA 4DF7A 1IL8A 3SR1A 2B39A 5ELFA 3MXPA 3K59A 3OMGA 1I6HB 3S1RB 1B44D 3OSOA 3D6CA 4QIWB 3BDLA 3HZXA 1RF2D 1SYBA 1GXDC 4KTAA 2F0TA 2F0PA 3NE5B 3GTKB 3S9WA 2EY6A 2C5CA 4L8JA 3G6JB 4OIKA 4Q5VA 2NUCA 1I3QB 5JEAG 1BQQT 3VYUA 1PRTC 5D14A 4LK1C 2EZVA 2K05A 3PUVA 2AQ2B 2GA4B 3DEPA 3R3OA 5CORA 2PNRC 3HOZB 2HQEA 3SK4A 4ZKCB 2F0SA 4IFDG 4XQQA 3J7AF 1ILPA 2NVXB 1J9OA 2RQXA 4HAEA 4OO1H 2FFKB 2KQ3A 5M3FB 4KHVA 4RWSC 3IFTA 1V1PB 1KDAA 1UUPA 1HRJA 1D1KA 1BR9A 1STBA 1TQOA 5CV7A 4DNRB 2B2VA 1EY8A 3OMCA 2QCPX 1TS2A 1DXMA 2D2CC 3PUWA 1LO5D 1F2MA 2VNUD 1CHQD 3J7AV 1EOTA 4ZK9B 2A69C 5HGTA 3NQTA 3GV3A 2IW3A 4XTCS 1U4RA 1STHA 2TSSA 2XSCA 4O1NA 3EFXD 3URYA 2O4XA 4N9TA 1BCPF 4FYDA 4A3IB 3PIO3 2NN6G 4OHJA 5D65A 3H3VC 2M2LA 1JB3A 4OGQC 5I9PA 1F77A 3S1MB 1DOLA 1B9NA 3EROA 1H9JA 5K5PA 4XT3B 1YNJD 4RFBA 2RDHA 2IWHA 1XWEA 1SJED 1LTTD 4QF4A 3S1NB 3D3RA 1GUOA 1R9TB 3J81E 2ID0A 5AFWA 4ID6A 4RHRA 2O2LD 2BA1A 1K8OA 3M4YA 1I4XA 4F88A 3MXNA 3EA6A 1SE2A 1M8AA 2RDGA 1D5ZC 2BE5C 2IPKD 1PRTD 5I2XA 3M7GA 1A3VA 1ENCA 1EWCA 2F0GA 5T1IA 4ODGA 2JYOA 3TN2A 2M00A 1ZEQX 5E1FA 2SNSA 2M9VA 1Q1BA 2B2WC 1EZ6A 2ZXOA 4FP5D 3M3YB 4IFDJ 1PFBA 2AUJD 3FDTA 3FEWX 1Q1EA 1LTGD 1PFMA 4ULLA 2B2TA 3MA2B 1CZGA 4EVOA 1PTOH 5BN5A 2BE5D 1B1ZA 1EWHA 1HPCA 1QILA 5KNDA 1GUWA 4DN4M 3I3CA 5IIFA 3OIQA 4IFDH 1I50B 2R3ZA 2QILA 1TU2B 5FO7B 3SVMA 1CFMA 1ENFA 4C3JG 3DXJC 5JEAJ 1SEBD 4K5VA 2Z4HA 1EYCA 4TSSA 1G291 4LJZC 3H6MA 3I4NB 1PZID 2BA0A 1I4PA 1PMRA 4HCSA 2BDNA 4EQOA 2WV6D 3HKZB 2E75C 1TVXA 2TMPA 1TWHB 5J1ZA 1JOOA 4QUCA 1WD0A 4KD4A 3H09A 1U4PA 3C46A 2LMCB 3ONAB 3FPPA 5I9OA 4RHSA 1T5EA 1ESFA 2FJ2A 2NWGA 4PMBA 4IN3A 1JOKA 4IUPA 1RD9D 2N55A 1T5XD 1S4ZA 2XIWA 1H9KA 2DN8A 2XWBB 1PTOC 1AEXA 3BG3A 1K83B 2J7ZA 1MD2D 1ICWA 3DUZA 3K0YA 4E6IA 1BNZA 5ELCA 1WTRA 2EY2A 4Q0FA 1EU4A 4R8IA 1WTQA 4WRDA 4QCLA 1HTLD 1C4QA 2PMZB 2WINB 2L12A 5IOCA 5C0XH 1BF4A 2EJMA 3QIAA 5A35A 1SBBB 3FPUB 4G7HC 5D3IB 3H0GB 1TS4A 2H4OA 4B9WA 2MP1A 1STEA 2F0EA 3N52A 3W3AA 1MI2A 1JCKB 4ZYSA 1K8MA 2F3WA 1IYUA 2B2UC 3CQZB 4RGMA 1F2LA 2DNCA 2EY5A 4LAAA 4ZAIA 1F9PA 4N9PA 5FLXE 4K8IA 5IGGA 1YNND 3U9OA 4H0LC 2IT1A 3L3OC 4L6TB 3NWSA 1ET9A 5CGKA 1EL0A 4RGOS 1F2YA 2X6LA 1QNKA 3VYSA 3VR3A 1DONA 1F2ZA 3X3NA 3TP7A 1SAPA 5JOBA 4ZLTF 3Q0AA 2PQEA 4FF4A 2D9UA 5I4DA 3RMHA 3KK7A 2K5DA 2OF1A 3WOFA 4HSVA 4XIGS 3GTOB 2XVSA 3HP3A 5CV6A 1Y1VB 1HQRD 1V1OA 5EQ0A 4X3TA 5CC4A 3LNNA 1U4LA 3D6WA 2PPBC 2F0NA 1J8IA 5TSSA 1SFOB 2XN9C 3M4OB 3K5MA 3HOUB 1U4MA 4JK1C 3T56B 3T4AC 2E2DC 5IODA 1GUNA 1X3QA 1WCMB 3MWYW 3NTKA 4PQXA 3SEBA 1FNVA 1VF5C 2KA7A 3LX0A 3MHBA 3KF8A 2R6GA 4A3FB 1SSOA 4IUTA 1B2TA 2PO4A 4QUFA 1Q12A 5CR3A 4B08A 4F8MA 1Z7TA 2AWNA 1SNMA 3NUCA 4G4KA 4OO1I 1I6VC 2ZXPA 3K57A 1LV9A 2VXWA 5IT9L 2ZXRA 4DU9A 1HTPA 5IGDA 4WORA 3FMCA 3TDQA 4H13C 3TP5A 4DFAA 1Q8IA 1LTAD 1AZPA 1RDPD 1HA5A 3VA7A 1PDQA 5JPNC 1NCVA 4KI0A 4R9WA 1WVLA 2NB0A 2Q8TA 2I46A 3BYTB 2EYHA 1A6XA 2MHVA 4UDUC 4A3BB 1YNNC 3A8JE 4BY1B 1ESRA 1TKWB 5E4WC 3PIP3 4P2CB 3NQIA 1QE6A 1KNAA 2PZWA 4RCOA 1HUNA 3HEJA 1Y8PB 1NSNS 1G6ZA 4XT1B 1SXTA 5T1GA 5JVH3 2JEAI 3PMFA 2BCOA 4BBSB 1SE4A 2SDFA 3HS0C 1LTRD 4EGVA 2K32A 1WTPA 5FLXL 3I4LA 1FYCA 4DAYA 4KHZA 2C9OA 4C1NI 4ZKBB 1W6JA 4RKBA 5C5MA 2Q8IB 1EY7A 3A8KE 2KEDA 1S5ED 1TS3A 4MN3A 1EQTA 3IFDA 3TZUA 1RODA 4JBWA 5EJWA 1XXGA 3TP8A 2B2UA 4H7BA 2JA5B 2KCNA 2L4NA 2AUKA 1WD1A 2E74C 1Q3LA 4KKSA 2JE6I 4KK7A 2EDGA 3SXHA 1KAAA 2K01A 1ZKOA 3KLRA 5K36H 4XYOA 1O7ZA 3D4DA 2CQAA 3CU7A 3L7ZC 2B8FA 3X3MA 2AQ3B 1WTWA 4IUUA 4WJWA 4V190 3FKIB 1QG7A 3DWAA 4F7XA 1UNSA 2K1BA 4ILWA 1LT3D 4S3SA 4CBVA 3S15B 5DNFA 2DY8A 1E0BA 3A55A 3TSSA 1UEAB 5IGCA 1CA5A 2A74C 2F0FA 4A93B 2J4XA 3H94A 3LWEA 3V2TA 4I65A 2NZ1D 1D5MC 3W2DA 3KUPA 2KJXA 3E0JA 4ZRZA 5JEAH 2SNMA 1PXUA 4R8NA 5C0XI 2RA4A 4IUNA 3MZ5A 3C3LA 1II3A 3S1QB 2EYLA 4HEDA 3JAML 2EJFC 1IW7D 1CHPD 4CHTB 3D31A 2FMCA 3P75A 1TWFB 5KNBA 1S5FD 1ZXTA 5LL6X 5I6WA 3R2IA 3A54A 1O80A 5C4HA 3MFYA 4CJ1B 4K5WA 3I4MB 4KD3A 3MAQA 5FOBB 1DJRD 5D3DA 1I4GA 3O13A 3QB3A 1TY0A 1Q90A 2F0KA 1RHPA 1BUVT 3GTGB 4RAUC 5CBEE 2R61A 3D4RA 3E5SA 4ZUJA 2A5HA 5IGBA 3GO5A 3DEOA 1H9RA 1RKNA 4YIJA 4PV1C 1JE4A 3T53B 3GTMB 5K36G 3OWEB 3AMUA 4XQNA 1RTNA 2E2JB 2JXMB 4KJOA 2K5QA 4C3IB 1B3AA 4ME5A 1DOKA 1MBYA 1KTKA 4KV6A 4K2LA 5I2YA 4OL7A 4U68A 3HGBA 2PW7A 4X3UA 4XXEA 2F0JA 1W6KA 4OO1G 3MXUA 3WDNA 2I07B 1HHVA 3RZOB 4NKLA 1OXTA 5ELBA 2LKVA 1D1IA 1XX8A 1CI3M 3D8GA 1VDZA 1KDBA 3NTIA 1L0YB 5DAUA 4MIUA 3GV6A 3HOYB 4RA8A 4U673 4KKTA 1H9MA 1B4OA 3AB9A 1PTOB 4HN7A 2VUMB 4BS9A 1OXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7J A;  2BDN A;  1AZQ A;  3DM1 A;  2RSN A;  2CVR A;  3IFD A;  3MWY W;  5AFW A;  1ROD A;  5EJW A;  2H1E A;  1MI2 A;  1PFN A;  3UI2 A;  4ZKC B;  4O42 A;  2EPB A;  2KOL A;  2B2U A;  2N88 A;  1O7Y A;  1TVX A;  1PLF A;  1MSH A;  1ZXT A;  2NYZ D;  1EIH A;  1O80 A;  2K28 A;  4OIJ A;  1SSO A;  1ILP A;  1J9O A;  2L4N A;  1RTO A;  4IUT A;  4CJ1 B;  3MTS A;  1IKL A;  2B2U C;  1F9Q A;  5EPJ A;  4CJ2 C;  1WD1 A;  1F2L A;  2MJ8 A;  1M8A A;  4QUC A;  4ZAI A;  1B2T A;  1A15 A;  1IKM A;  1Q3L A;  2KUM A;  4HAE A;  1F9P A;  1WD0 A;  4X3K A;  5EPL A;  2FFK B;  4QUF A;  1WTV A;  1HFN A;  1U4P A;  1HUM A;  3ONA B;  2K01 A;  1RJT A;  1B53 A;  2IL8 A;  3Q6S A;  1NR4 A;  4NW2 A;  1RHP A;  4RWS C;  2FJ2 A;  1MGS A;  3H91 A;  1XYI A;  1CA6 A;  2B2Y A;  2NWG A;  3KBX A;  4RAU C;  2EOT A;  5EKI A;  1SDF A;  1G91 A;  1LV9 A;  2VXW A;  5CBE E;  1NR2 A;  1HRJ A;  2KVM A;  1AP0 A;  5CMD A;  2Q8R E;  4IUP A;  5T1I A;  2N55 A;  1F9R A;  1BO0 A;  2JYO A;  1JIC A;  3TN2 A;  1O7Z A;  1S4Z A;  3DEO A;  4IUQ A;  1AZP A;  2EE1 A;  2XIW A;  3I91 A;  1PDQ A;  2B2W C;  3IL8 A;  1C8C A;  2B2V A;  4HED A;  1ML0 D;  1NCV A;  1EL0 A;  4R9W A;  2RVL A;  1WVL A;  1IL8 A;  2HUG A;  4IUR A;  1ILQ A;  1JE4 A;  2Q8T A;  5JJZ A;  2L11 A;  1PFB A;  2X6L A;  2K03 A;  1QNK A;  1HA6 A;  2MPM A;  3FDT A;  2HDL A;  2J7Z A;  2X69 A;  3G7L A;  1ICW A;  1RTN A;  1X3P A;  1PFM A;  1BBX C;  1BNZ A;  1DON A;  1WTW A;  4IUU A;  1WTR A;  1EOT A;  3I90 A;  1QG7 A;  1B3A A;  4ZK9 B;  2FIN B;  2B2T A;  1NAP A;  2K1B A;  2B2W A;  1ESR A;  1DOK A;  1SAP A;  2JP1 A;  5E4W C;  3I8Z A;  5CBA E;  4ZLT F;  3F2U A;  4R8I A;  4U68 A;  1QE6 A;  1KNA A;  1MSG A;  1WTQ A;  2L1B A;  4CJ0 B;  3GV3 A;  2D9U A;  5DNF A;  2DY8 A;  1E0B A;  1U4R A;  2X6G A;  1X32 A;  4DN4 M;  1GUW A;  2HDM A;  3I3C A;  1HUN A;  4X3U A;  4IUV A;  2L12 A;  4UAI A;  1G6Z A;  4XT1 B;  1CA5 A;  1WTX A;  1DZ1 A;  4HSV A;  3HP3 A;  5T1G A;  2B2Y C;  1BF4 A;  1VMP A;  3R93 A;  1EIG A;  2R3Z A;  1G2T A;  1HHV A;  5EQ0 A;  5EPK A;  4OIK A;  3LWE A;  2L9H A;  5D65 A;  1CM9 A;  2NZ1 D;  2K04 A;  4X3T A;  2SDF A;  2M2L A;  5E4X A;  3SVM A;  3TZD A;  1HFG A;  1XX8 A;  2RSO A;  1WTP A;  1U4L A;  2B2V C;  3D6W A;  3KUP A;  1J8I A;  5D14 A;  4MHE A;  2KEC A;  3FPU B;  2FHT A;  2K05 A;  4X3S A;  2FMM A;  1DOL A;  4XDX A;  3GV6 A;  1KNE A;  1B50 A;  4RA8 A;  4ZKB B;  1U4M A;  2RA4 A;  1DOM A;  4LMQ D;  2B2T C;  2HCI A;  1B4O A;  1VMC A;  1G2S A;  2DY7 A;  4XT3 B;  2HCC A;  2MGS A;  3DEP A;  2KED A;  2MP1 A;  1F9S A;  3QO2 A;  5COR A;  4HCS A;  1X3Q A;  2KEE A;  3N52 A;  4MN3 A;  5COY A;  1WTO A;  1EQT A; 
#chains in the Genus database with same CATH topology
 2KHS A;  3P7J A;  2NVT B;  3PO3 B;  3OW7 A;  1IYV A;  4HJ5 A;  4FXG C;  2R7Z H;  2PZT A;  3UI2 A;  4LF6 L;  2SEB D;  3PO3 G;  5CV4 A;  5F2D A;  3J7A 5;  1EIH A;  1EYD A;  1Z47 A;  2B8G A;  1OXX K;  1SJH D;  3KLS X;  4CJ2 C;  4WJ4 A;  1SYG A;  5G3L D;  3KLS A;  3J7Y W;  1D2B A;  1ICF B;  1EZ8 A;  4C56 C;  3PUX A;  1HUM A;  3J80 L;  4B3M Q;  1B53 A;  4C2M B;  4HJ9 A;  1FJG L;  1NTG A;  4N8X 1;  2VL6 A;  3W1B A;  3G71 A;  1VQ7 A;  5M3F G;  1YJW A;  3GTL H;  2EOT A;  2R7Z B;  5GAE C;  1Y1W G;  5EAY A;  3ITP A;  2R7Z G;  3T1Y L;  3WOE A;  5HY6 A;  4DAV A;  1K3B C;  1EY0 A;  1L1O A;  2XNA C;  4G7Z C;  4IUR A;  4DR4 L;  5LMU Q;  4B3S Q;  1GJX A;  2JJQ A;  4ZUI A;  3J7Z C;  1HNW Q;  1TWH H;  3BYY B;  1N34 L;  4C1N K;  5C3X A;  2JA6 B;  1JJC B;  1PH6 A;  2QDB A;  1LLR D;  5ELE A;  1EIY B;  2JA8 H;  1S5B D;  4IO9 A;  3OHX C;  3QJY A;  3JAM E;  4C3I G;  3PO2 B;  3AEV A;  3K5N A;  4A3G B;  1AE3 A;  3L9A X;  5C5L A;  3CCL A;  1JJG A;  4IZ8 A;  5IGF A;  1X32 A;  2PW5 A;  4BY7 H;  3ZYY X;  1SRU A;  3MEH A;  1DD2 A;  1SYF A;  1XPU A;  1BDO A;  5E7N A;  1XMO Q;  4JCV E;  1X54 A;  4LF9 L;  3GP7 A;  2OQK A;  1JOQ A;  3CC7 A;  2LSS A;  2VQF L;  4DR1 L;  2UUA Q;  4OWX B;  1E1O A;  1CTM A;  4JI2 L;  2EYP A;  3S2H H;  2A69 D;  3EJI A;  4YWM A;  1ZYR D;  3GTL B;  2RSO A;  2UXD L;  2F4V Q;  2B2V C;  3PIP A;  2L0C A;  2EYF A;  1R4P B;  5CV8 A;  4DV6 L;  3B6Y A;  2B29 A;  5KYL A;  3MXG A;  2KEN A;  4LMQ D;  3CC2 A;  4FO2 A;  1G2S A;  3BDO A;  4A3F H;  1A3T A;  5GRO A;  1E7Z A;  1WTO A;  2BDO A;  3S17 B;  2CVR A;  4DK6 C;  2BH8 A;  4N8F A;  5C4Z A;  1X9N A;  3BZC A;  3CRL C;  5A2Q L;  2NTS A;  1C48 A;  3TP6 A;  1LT5 D;  2A6H D;  2Z1C A;  5EPJ A;  4ZQ3 A;  3GD7 A;  4DK3 C;  3GTQ H;  3J81 c;  4A3M B;  3SGI A;  2WKC A;  3NWT A;  4I7Z C;  1ASZ A;  3M9B A;  2HQL A;  3H91 A;  4DUY Q;  1PH7 A;  4CDE C;  2O5I C;  2JA7 B;  2D62 A;  4AYB E;  1JC7 A;  2L55 A;  5CMD A;  4IPH A;  4M8A A;  1F9R A;  4A3E G;  4HMJ A;  1M90 C;  4NMZ A;  5LL6 S;  3KFU A;  2I5H A;  5M3F H;  4QY7 A;  4PMC A;  2HUG A;  4CGY B;  1FR3 A;  1ILQ A;  3OWF A;  3T1H L;  3Q23 A;  3SDZ A;  4TRD A;  3T16 A;  1X3P A;  2F0V A;  1YEZ A;  4FF3 A;  2E2I B;  2L15 A;  1WJJ A;  2B2W A;  3S17 H;  3HG9 A;  1O78 A;  2AWO A;  3VYR A;  4HSP A;  4UP9 A;  3VR6 A;  2ENB A;  1K3R A;  4G57 A;  2L1B A;  4JI1 Q;  4A93 H;  1UAP A;  1EFW A;  2R92 H;  1EEI D;  3UE1 A;  1K73 C;  1WTX A;  3S2D B;  3IRB A;  2B2Y C;  2KBN A;  3M4Q A;  5AJ3 L;  3VYT A;  3R93 A;  3DHQ A;  2LS0 1;  4DKA C;  3CMA A;  2PQA B;  1KLU D;  2Y0S B;  1H9S A;  3J80 E;  4K0K L;  1IBK L;  3TRZ A;  2UUC L;  4X65 L;  4UPA A;  4IFD I;  4CKE A;  2E5L Q;  3ZJY C;  4X3S A;  4XDX A;  2QKI C;  4JI1 L;  4JI6 L;  3BDC A;  5KYI A;  3GTK H;  3A74 A;  1VQI A;  1QNU A;  1TR5 A;  2DY7 A;  3BZK A;  2F0M A;  3HOX G;  4BA2 I;  2O5J C;  4DGZ A;  3RZD B;  2CKZ B;  1H9S B;  1TXY A;  1IYJ B;  2PQA A;  3I55 A;  2XWJ B;  1PYS B;  1I3Q H;  4A3B H;  2K5N A;  4X65 Q;  5LMN W;  3K6O A;  4YHH L;  2D0O A;  2K28 A;  3T51 B;  1STG A;  4OEL B;  4EQN A;  4LF7 Q;  1DCZ A;  4EX5 A;  4YY3 L;  1ONL A;  1GOZ A;  1WTV A;  2OTL A;  4HR7 B;  4LF4 L;  1N36 Q;  1RJT A;  1YIJ A;  2IL8 A;  3AFQ A;  1NR4 A;  3U50 C;  3RLF A;  2YYZ A;  1UEB A;  2JA8 B;  4R4I A;  1BVS A;  1QUQ A;  3NXW A;  5EKI A;  1AH9 A;  1XMQ L;  2Z9H A;  4LFB L;  1V1Q A;  2KCM A;  4KKU A;  3V05 A;  5ELD A;  3W5O A;  4AIM A;  4RH6 A;  1Y1W B;  2EE1 A;  1TY2 A;  3A7A B;  1JQY D;  3RLN A;  4DV1 L;  4HTH A;  5KRU A;  4YY3 Q;  4FVM A;  4CKB A;  4WFN 3;  4DUZ Q;  1Q86 C;  4LF8 Q;  1STN A;  2VW9 A;  2VQE L;  5JJK A;  1BBX C;  4QB4 A;  2B63 B;  4LWC A;  3NSW A;  2FIN B;  1B7Y B;  1TII D;  5DM7 3;  1A2U A;  1VCI A;  2DJG C;  2ZTC A;  3I8Z A;  4J6H A;  2IX3 A;  4K2K A;  3F2U A;  3RD4 A;  4C2M H;  2WAC A;  1I94 L;  2X6G A;  1BBU A;  3TBI B;  4DAP A;  4KJN A;  1CK1 A;  2EYM A;  2RDF A;  4BWG B;  5KEE A;  4LF8 L;  1X3G A;  3NBH A;  4OWT B;  1KRT A;  3ND9 A;  4BBS G;  1G2T A;  3T13 A;  3U9S A;  2VQE Q;  3QG1 A;  2PI2 A;  2EXZ A;  2JQO A;  1V43 A;  3TZD A;  1HFG A;  4DAY B;  2A19 A;  2NVT H;  1G8Z D;  4TKO B;  4DV7 L;  3JAM c;  1EQV A;  4DK1 A;  1TT2 A;  1XTC D;  1I94 Q;  1EOV A;  1VQB A;  2LY7 A;  4B3T L;  3PV0 A;  1BCP D;  3NPP A;  2PNH A;  3OOC A;  5COY A;  1AZQ A;  3EVQ A;  2ICE C;  4DXG A;  4P73 A;  1BCP C;  2G9H D;  1JOR A;  4BXX G;  2ICI A;  3C2P A;  3RZD H;  1VQJ A;  4A3K B;  3S14 H;  2F0W A;  4A3J H;  2SOB A;  4K6L A;  5G3L F;  2AHO B;  2I5M X;  4JYA L;  3JC6 6;  1IKM A;  2NN6 I;  5C3W A;  5EPL A;  5IGE A;  3M85 A;  4XQJ A;  1VQ4 A;  1L1O B;  1CKM A;  1OXS C;  4NP5 A;  5C3E G;  2N3S A;  4DV0 L;  2F0D A;  3NEN A;  5HGQ A;  3CRK C;  3OIP A;  1Q82 C;  4KMU C;  4KHP Q;  1C0A A;  1LAB A;  4YWL A;  4P71 A;  3PUY A;  4DR6 L;  1LAC A;  4A3J G;  3Q8D A;  3H0G H;  1JE5 A;  2IHF A;  3EBE A;  3FVQ A;  3KF8 B;  2MPM A;  5M9O A;  3IAY A;  4BBR H;  2CW0 C;  5J3B A;  4DXF A;  1SNQ A;  5IWA L;  1Q46 A;  2D5D A;  3M7N A;  1RIP A;  2EXD A;  2CCZ A;  4EQP A;  2JP1 A;  2B63 H;  3HOV B;  4B3M L;  4Y52 H;  2I0Q A;  2VUM H;  1KXL A;  5C0X G;  1MSG A;  1HZA A;  1FD7 D;  1VQM A;  4DR7 Q;  1A3U A;  5M3M H;  4GOP B;  1VQN A;  1CT1 D;  1PTO F;  5M3M B;  1VQO A;  3BJU A;  3DMU A;  2PYK A;  4X62 L;  1M1K C;  4LFA Q;  1HZ9 A;  1CM9 A;  1PZJ D;  4KLK A;  3TRE A;  4KN7 C;  4A3I G;  4LUO A;  1J5E Q;  3KOJ A;  2K6A A;  3CKI B;  2ZTD A;  1JWS D;  3QOJ A;  5JVG 3;  1D6E C;  1K83 H;  4K5X A;  2FMM A;  5I6Y A;  1B50 A;  3KBG A;  3I4N H;  2L5T A;  1DOM A;  1TWA H;  1KHI A;  1X65 A;  2YTY A;  5GAG C;  2B3G A;  2WAQ B;  2N78 A;  3C1F A;  3HKZ G;  5CBA E;  1ZYR C;  3I4O A;  5JAV A;  1C9O A;  3TS0 A;  3HOZ G;  2XRQ D;  4A3F G;  1J5E L;  2Z6K C;  3GQB A;  2MO0 A;  5HUR A;  2K5V A;  3A8I E;  4MNO A;  2UUA L;  3EQL C;  3GTM H;  5J22 A;  2XRS D;  5FKA C;  3NTH A;  2F03 A;  2KUM A;  2N49 A;  1LUZ A;  3P1H A;  4GKK L;  1VQA A;  2K33 A;  4QMG A;  3CCM A;  5IYD H;  4IOC A;  5DM6 3;  4A3K H;  3S14 B;  2NVY H;  4NW2 A;  4DV6 Q;  2F0I A;  4KY5 A;  2CH4 A;  1Y8O B;  1MGS A;  2B2Y A;  3Q24 A;  3I72 A;  3K5O A;  1QCB D;  1EYA A;  1I4R A;  1HQM C;  1XNQ Q;  4DK0 A;  1BXT A;  3HOW B;  5H1S E;  3SHL A;  4DV3 Q;  2VB2 X;  1V1P A;  4ABN A;  3A7L A;  3VR4 A;  4A3E B;  5M5W B;  4NXN L;  4BY7 G;  2HT1 A;  3ERQ A;  3R2T A;  4MZ9 A;  4BY7 B;  1YBY A;  3E9I A;  2RCN A;  5KGU A;  1RL2 A;  4RGN A;  4A3J B;  4NDX A;  2HDL A;  1PH3 A;  2JSO A;  2A68 D;  3ULP A;  2Z4I A;  1B9M A;  3SE0 A;  2NZO A;  2G9D A;  3E6Z X;  2UUB L;  1NAP A;  4J8Q A;  4LW1 A;  2EYJ A;  1IW7 C;  1VQK A;  5IYC H;  5E3F A;  4JI5 L;  1FNU A;  3BVZ A;  4A3G G;  2QEJ C;  4FXK C;  2RHQ B;  5FO9 B;  4RCN A;  4IUV A;  1LTS D;  3ND8 A;  4FF1 A;  1GHJ A;  1CZW A;  3V96 A;  1E2V A;  1EIG A;  4L63 B;  1MKH A;  2HD3 A;  4RKL A;  2ZM6 L;  1S40 A;  2L9H A;  3HRZ C;  5JPM C;  4PNY A;  4HJA A;  1FNW A;  2NVQ B;  1AW7 A;  2E76 C;  2ZJQ A;  1GVP A;  1IHZ A;  1WOC A;  5NUC A;  4MHE A;  1E2W A;  2KEC A;  1STA A;  3KLW A;  4GOP A;  1KNE A;  1EUJ A;  2OT2 A;  3QWN A;  1QB5 D;  2A6H C;  3K58 A;  3DWQ A;  3J81 j;  4K8J A;  1QWY A;  2JEB I;  3FRP B;  3U4Z A;  5C0X J;  3BVM A;  3QO2 A;  1SYE A;  2N88 A;  2ZM6 Q;  2YV5 A;  3PUZ A;  1S5D D;  2DNE A;  2IJ0 A;  2H1E A;  4CDC C;  1L0X B;  1PFN A;  3LWU A;  5AJ3 Q;  2F3V A;  4A3I H;  4IOA A;  3CXC A;  4FNF A;  5M5X B;  2ZTE A;  3F8T A;  1HNW L;  4OIJ A;  1S5C D;  5EKK A;  1LTI D;  5A2Q E;  3FP9 A;  4QJF A;  2F0H A;  1SYD A;  2MJ8 A;  2QF7 A;  1TWC B;  1EU3 A;  4GLV B;  1HFN A;  1ET6 A;  4DR3 Q;  4ME3 A;  4JV5 L;  3BZD B;  5C3E B;  4FF2 A;  3L0O A;  5EBD A;  1NR2 A;  2Q8R E;  1KDC A;  1XMO L;  1QVG A;  3VR5 A;  3S1N H;  2F0Q A;  2K14 A;  2F1M A;  2JA9 A;  4K14 A;  5EKL A;  2EJG C;  4IUQ A;  1IBL Q;  4HIK A;  1PH4 A;  1C8C A;  1WTH A;  1M4V A;  1ML0 D;  1KIX A;  1U0L A;  2RVL A;  1K0S A;  4C3H G;  5JJZ A;  1PHJ A;  1HA6 A;  1DYQ A;  2K03 A;  1PYW D;  4YHH Q;  2F4V L;  2V4D A;  4AYB G;  4DA2 A;  1XTD A;  2F52 A;  2QDL A;  1XNR Q;  3PF4 A;  2JA7 H;  2N8N A;  3OPO A;  5EBC A;  2K7V A;  4ZCK A;  3A5Z B;  1AFP A;  3CCV A;  2AKW B;  4HID A;  4B3R Q;  2BOS A;  1VQC A;  5GAH C;  5IT9 E;  4YCW A;  2KCT A;  3CAM A;  3BS1 A;  1VQD A;  1VMP A;  3STB C;  4TQU S;  3Q22 A;  4DV1 Q;  3HOW H;  1WI5 A;  2K04 A;  5FJ8 H;  1EY5 A;  2LFN A;  1SN8 A;  3CHB D;  5EGT A;  1EFI D;  4V0B A;  4DUZ L;  1V8Q A;  1XNR L;  3SK6 A;  2UU9 L;  2PCF B;  3MC0 B;  4UHV A;  4C3J B;  1CQF A;  3CCS A;  1Y69 U;  2ZT9 C;  3HOU G;  3AU7 A;  3NHH A;  3STB D;  1E1T A;  3K5L A;  1YNX A;  3LGJ A;  4DNT B;  4R4Q A;  4IJL A;  3RUZ A;  1HNX Q;  3P20 A;  3QOL A;  2R92 B;  2VY3 A;  1GUG A;  1SYC A;  2WAQ G;  1VMC A;  3I56 A;  1SND A;  4HMI A;  4A3L G;  4A75 A;  2HCC A;  2MGS A;  4F87 A;  3CPF A;  2R92 G;  2F0O A;  3GTP B;  2KEE A;  3J81 L;  1KLG D;  1GHK A;  1BCP B;  1EY9 A;  4WJ3 M;  4HCE A;  5ELN A;  4M1U B;  3S2H B;  1BBW A;  1WCM G;  4JI3 Q;  1VF7 A;  1O7Y A;  3IKJ A;  1DM0 B;  1RTO A;  3MTS A;  2RHS B;  5CV5 A;  4YCV A;  1YZ6 A;  2F0U A;  3NP8 A;  4A3K G;  2DUD A;  1SNC A;  4IQZ A;  4NXM L;  3MFG A;  4X3K A;  4HIO A;  1CSQ A;  5M5W H;  1OO9 B;  1Z9F A;  4PZ6 A;  2NVX H;  3KJP A;  1SNP A;  1LT6 D;  1EWI A;  1SE3 A;  4FXD A;  2R93 G;  3SK8 A;  1IXR A;  3KBX A;  1OXV A;  1YHQ A;  1P16 A;  1PRT F;  4R4C A;  3DLL A;  2R7D A;  4Y7N B;  2EQS A;  1JIC A;  4GNX B;  2WB1 B;  2Z8L A;  1HXY D;  2Z6B A;  4JI3 L;  3SK5 A;  2E2J H;  2BH2 A;  3GTP H;  2UXB L;  1I4H A;  5C4X B;  3I91 A;  3I7F A;  4G7O C;  3HKZ E;  3MVV A;  3G4S A;  2F4I A;  1E2Z A;  2L11 A;  5IYC G;  1SMY C;  1O7L A;  1JMC A;  3F2D A;  4A76 A;  1LT4 D;  1HR0 W;  3G7L A;  3K81 C;  1HZC A;  4H44 C;  3A5U A;  4CDF C;  2E5L L;  4AYB B;  3I90 A;  2NTT A;  4KY6 A;  4GZY C;  2CHB D;  1NUC A;  4NB3 A;  4POG A;  1JWM D;  4KY7 A;  4LF5 Q;  4PMW A;  2HHH Q;  3A56 A;  1RCV D;  4CJ0 B;  3BVG A;  1PH8 A;  3S2D H;  2HDM A;  4IAL A;  4A3D H;  3NEM A;  1Y8N B;  3D4W A;  2EVB A;  2UXC L;  4L5S A;  1DZ1 A;  1ENA A;  1CKO A;  1BOS A;  1GD7 A;  5M3M G;  3GTJ B;  5EPK A;  1PZK D;  3S24 A;  4O2D A;  4HIM A;  2EIF A;  3CP0 A;  5E4X A;  3KF6 B;  4JI0 Q;  2ZJR A;  1KD1 C;  5BN3 A;  3S16 B;  5ISR A;  2HHH L;  1HCZ A;  2FHT A;  4DR5 L;  1BKB A;  1E22 A;  5J39 A;  4AQY L;  2IX0 A;  2B2T C;  2HCI A;  1AN8 A;  1STY A;  1XMQ Q;  4LFB Q;  1QJO A;  2IY5 B;  1K9M C;  2Y0S E;  3N6R A;  1EQR A;  1F9S A;  2WP8 J;  5CV9 A;  4DR7 L;  3CCJ A;  1JR0 D;  4X6A H;  5LHY 1;  3PO2 H;  3HOX B;  4POF A;  3DM1 A;  2RSN A;  3K7A B;  3DWP A;  4C3I H;  4JI0 L;  4O42 A;  2VS1 A;  3VR2 A;  2NYZ D;  2E2H B;  1MSH A;  2V1C C;  1LTB D;  3GDE A;  3OYY A;  1IKL A;  1F9Q A;  4A3M G;  1A15 A;  2A6E C;  1IBM L;  4A3D B;  1PRT B;  1SLJ A;  4J15 A;  1W2B A;  1D5X C;  2RKS A;  1YHB A;  5CYU A;  5KIX A;  2C35 B;  3F2B A;  2CFM A;  2YU9 B;  1XYI A;  2WKD A;  5C44 B;  3C1E A;  3CCE A;  1G91 A;  1JT8 A;  2AQ1 B;  5IP9 G;  2R93 B;  2KVM A;  1AP0 A;  4CKC A;  1Z6H A;  5M5Y B;  1BO0 A;  2EY1 A;  2JN4 A;  1GUT A;  3UDF A;  2RBM A;  1HH2 P;  3IL8 A;  1JWU D;  3ERS X;  1TS5 A;  2OXP A;  2PZU A;  1TWA B;  2IX1 A;  1AE2 A;  2K4K A;  5IP7 H;  4C3H B;  2B63 G;  2X69 A;  4DV5 Q;  4FDB A;  5FK9 C;  4GKK Q;  1CSP A;  2R93 H;  3F1Z A;  3PO3 H;  3CC4 A;  2CW0 D;  5C4J B;  4XYQ A;  2MUY A;  1SMY D;  1PTO D;  5C6A A;  1KAB A;  1I4Q A;  2EYO A;  4UAI A;  1VQP A;  4Z9C B;  4DV3 L;  1A2T A;  1VQ8 A;  2VB3 X;  2YTV A;  5IYB G;  2A73 B;  1QOH A;  4LFC L;  4K6D A;  3W1G A;  4LF6 Q;  4KN4 C;  1U9R A;  3I73 A;  3TME A;  4ALP A;  4A3L H;  4GS3 A;  5FO8 B;  4BBR B;  1G51 A;  1YNJ C;  2NN6 H;  1CQV A;  1NMF A;  3H15 A;  4BA1 I;  3GTQ B;  1FGB D;  1A8V A;  1B8A A;  1VQE A;  4DV0 Q;  3HOY G;  2KHJ A;  2OEO A;  3NBI A;  4JI8 Q;  3PGZ A;  1SNO A;  1O7I A;  1TWG B;  4KHP L;  1R4Q B;  4EQ5 A;  3NK9 A;  4RGT A;  4X66 L;  3I70 A;  2WII B;  3PF5 A;  4JBK A;  2CH4 W;  2EPB A;  2KOL A;  2YU9 H;  2F0L A;  1PLF A;  2NVY B;  5KNC A;  2J0T D;  3R8B A;  2KCC A;  4DR4 Q;  1EY4 A;  1EY6 A;  4PZ7 A;  4IPG A;  5DEH A;  4B9X A;  2A6E D;  2VZA A;  4JI8 L;  3Q6S A;  3J81 i;  2JA7 G;  1YI2 A;  1CA6 A;  3VA5 A;  1SDF A;  2A68 C;  1GUS A;  1EEF D;  1Q7Y C;  2K5W A;  4J1M A;  2KHI A;  1Y1V H;  5BN4 A;  1IL2 A;  3HFZ B;  4A3C G;  2NBF A;  4DF7 A;  1B3Q A;  3CD6 A;  1IL8 A;  3SR1 A;  2B39 A;  2XTI A;  5ELF A;  3MXP A;  3K59 A;  3OMG A;  1I6H B;  2JA5 H;  4IPD A;  5FLX c;  2VQF Q;  4DR1 Q;  3S1R B;  4JI2 Q;  1B44 D;  3HOV G;  3OSO A;  3D6C A;  4QIW B;  1DGS A;  1U5K A;  3BDL A;  3HZX A;  1YVC A;  1RF2 D;  1SYB A;  1HR0 L;  3OTO Q;  1GXD C;  4KTA A;  3UDI A;  2F0T A;  2F0P A;  4P72 A;  3D0F A;  3NE5 B;  3GTK B;  3KF6 A;  5ELO A;  3S9W A;  5LMU L;  4B3S L;  2EY6 A;  2QW7 A;  2C5C A;  1KC8 C;  1NBW A;  4L8J A;  3G6J B;  4OIK A;  3S16 H;  3E3X A;  4Q5V A;  2NUC A;  1I3Q B;  5JEA G;  1BQQ T;  3FKI H;  5IT9 c;  1UE6 A;  3VYU A;  1QZG A;  1PRT C;  5IP9 H;  5D14 A;  3OTO L;  4LK1 C;  3A0J A;  2K05 A;  3PUV A;  2EZV A;  2AQ2 B;  1PA6 A;  3CW2 C;  2CWP A;  2GA4 B;  4P75 A;  2LXK A;  1XNQ L;  3DEP A;  3R3O A;  4B3R L;  2RF4 A;  5COR A;  2PNR C;  5LMN L;  3HOZ B;  4Y7N H;  2HQE A;  3SK4 A;  3KDF A;  4JI7 L;  4ZKC B;  2F0S A;  4IFD G;  4XQQ A;  3ER0 A;  3J7A F;  1XPO A;  1ILP A;  2NVX B;  1J9O A;  1N8R C;  3JAM i;  2RQX A;  1YIT A;  2JA5 G;  4HAE A;  4OO1 H;  2FFK B;  2KQ3 A;  3F2C A;  5M3F B;  4KHV A;  1L1O C;  3K0X A;  4DV2 L;  4RWS C;  3IFT A;  2GN5 A;  1V1P B;  2ASB A;  1KDA A;  4A3C H;  4DR2 Q;  1UUP A;  1HRJ A;  1PFS A;  1D1K A;  1BR9 A;  4JI7 Q;  1STB A;  1TQO A;  2R7F A;  5CV7 A;  3S1R H;  3CPW A;  4DNR B;  2HIV A;  1VQ5 A;  2B2V A;  1EY8 A;  3OMC A;  2QCP X;  1PH2 A;  2P5Z X;  1TS2 A;  1UWV A;  1DXM A;  2D2C C;  3PUW A;  1LO5 D;  1F2M A;  2VNU D;  2WB1 E;  4DV2 Q;  1CHQ D;  3J7A V;  5FJ8 G;  1IBK Q;  1EOT A;  4ZK9 B;  1FL0 A;  4L5Q A;  2A69 C;  2I5L X;  3FHW A;  3CCR A;  5HGT A;  3NQT A;  3GV3 A;  4GN5 A;  2IW3 A;  4XTC S;  1U4R A;  1STH A;  2TSS A;  2NZH A;  1NNX A;  2XSC A;  4O1N A;  3EFX D;  3URY A;  4DNI A;  2O4X A;  2UXB Q;  4DAM A;  1LM0 A;  3UDX A;  4N9T A;  1BCP F;  4FYD A;  4A3I B;  3PIO 3;  2NN6 G;  4OHJ A;  5D65 A;  3H3V C;  2M2L A;  1VQ9 A;  1JB3 A;  4BBS H;  4TVA B;  4OGQ C;  5I9P A;  1F77 A;  2FXQ A;  4PZ8 A;  1MIU A;  3S1M B;  1DOL A;  1S72 A;  5FLM H;  1B9N A;  3ERO A;  1H9J A;  2A8V A;  5K5P A;  4XT3 B;  1YNJ D;  4RFB A;  2RDH A;  2IWH A;  1XWE A;  1SJE D;  4GNX C;  3K7U C;  1LTT D;  4QF4 A;  2GVB A;  2OQ0 A;  3S1N B;  3D3R A;  1GUO A;  1IBL L;  1R9T B;  3J81 E;  2ID0 A;  5AFW A;  4IPC A;  4ID6 A;  4RHR A;  2O2L D;  2BA1 A;  1K8O A;  3M4Y A;  3RZO H;  1I4X A;  4F88 A;  1KQS A;  2CWA A;  3MXN A;  3EA6 A;  1SE2 A;  1M8A A;  4JI6 Q;  2RDG A;  5IE8 A;  1D5Z C;  2BE5 C;  2IPK D;  1PRT D;  5I2X A;  5DLQ E;  3KYH C;  3M7G A;  1A3V A;  1QUQ B;  1ENC A;  1J6Q A;  2WB1 G;  5GAD C;  1EWC A;  3TEH B;  5C44 G;  2F0G A;  5T1I A;  1WCM H;  4ODG A;  2JYO A;  3TN2 A;  2M00 A;  1ZEQ X;  3PQI A;  5E1F A;  2SNS A;  4GNX A;  2M9V A;  1I50 H;  1I6H H;  1Q1B A;  3HOW G;  2B2W C;  1EZ6 A;  5L37 A;  2ZXO A;  4FP5 D;  3M3Y B;  4IFD J;  1PFB A;  2AUJ D;  4R1J A;  4LF4 Q;  3FDT A;  1S3O A;  3FEW X;  1Q1E A;  4C3J H;  1LTG D;  1PFM A;  1GM5 A;  1YHA A;  5JJL A;  4ULL A;  2B2T A;  2MNA A;  3MA2 B;  1CZG A;  3GTG H;  3RR5 A;  2K5H A;  1W3S A;  1Q81 C;  4EVO A;  2ATW A;  1PTO H;  2A1A A;  5BN5 A;  2BE5 D;  1B1Z A;  1EWH A;  1HPC A;  1QIL A;  5KND A;  1GUW A;  4DN4 M;  3I3C A;  3I2Z A;  5IIF A;  1I5F A;  2Q2H A;  4GN4 B;  4GOP C;  4A4I A;  3OIQ A;  4IFD H;  1NY4 A;  1I50 B;  2R3Z A;  2QIL A;  1TU2 B;  5FO7 B;  3SVM A;  1CFM A;  1ENF A;  4QL5 A;  4YCU A;  4C3J G;  1N33 L;  3DXJ C;  1D8L A;  5JEA J;  4NXM Q;  1SEB D;  4K5V A;  1K8A C;  2Z4H A;  1EYC A;  4TSS A;  1FGU A;  1SE8 A;  3K80 C;  3S1Q H;  1G29 1;  3GTO H;  4LJZ C;  3H6M A;  3VDY A;  3KDF B;  3I4N B;  1PZI D;  2Z0S A;  2BA0 A;  1I4P A;  1UE7 A;  1N9W A;  3I4N G;  1PMR A;  4HCS A;  4CDD C;  2E8G A;  2BDN A;  1EIF A;  4JVZ A;  4EQO A;  2WV6 D;  3HKZ B;  1L2F A;  2E75 C;  1TVX A;  4UP7 A;  2TMP A;  1TWH B;  2HIX A;  5J1Z A;  4DV7 Q;  1QVC A;  4H02 A;  1JOO A;  1HNZ L;  4LFC Q;  4QUC A;  1WD0 A;  4KD4 A;  3I4M G;  3H09 A;  1KAW A;  1U4P A;  2LXJ A;  2LMC B;  1X3F A;  3ONA B;  4A3E H;  3FPP A;  3C46 A;  3S1M H;  5I9O A;  4LF5 L;  4RHS A;  1T5E A;  5M5X H;  4B3T Q;  1ESF A;  3U4V A;  2FJ2 A;  4MTK A;  2NWG A;  3HOV H;  4PMB A;  4IN3 A;  4IUP A;  1JOK A;  1RD9 D;  3ULL A;  2N55 A;  1T5X D;  4DPG A;  1K8G A;  1S4Z A;  1X56 A;  2XIW A;  1H9K A;  2DN8 A;  1YJN A;  2XWB B;  5BR8 L;  4JYA Q;  1PTO C;  1AEX A;  1PVO A;  3BG3 A;  3M4O H;  1K83 B;  2J7Z A;  1QZH A;  4LFA L;  1MD2 D;  1ICW A;  3DUZ A;  1TWF H;  3K0Y A;  4E6I A;  1BNZ A;  5ELC A;  1WTR A;  2EY2 A;  4Q0F A;  1EU4 A;  4AQY Q;  2JA6 G;  1ASY A;  4R8I A;  1JB7 A;  1WTQ A;  4L5R C;  4WRD A;  4QCL A;  1HTL D;  1C4Q A;  2PMZ B;  5BR8 Q;  2WIN B;  2L12 A;  5IOC A;  5C0X H;  1Y14 B;  3T1Y Q;  4DV4 Q;  1BF4 A;  2EJM A;  1KRS A;  4A3G H;  4NPS A;  3RN5 A;  3WWV A;  4OWW B;  4BBR G;  3U58 A;  4OXP A;  4RMF A;  3J80 i;  3QIA A;  5A35 A;  1SBB B;  3FPU B;  4G7H C;  5D3I B;  1H95 A;  3H0G B;  3E0E A;  1TS4 A;  2H4O A;  5IYD G;  1MJC A;  4B9W A;  2MP1 A;  4DV4 L;  1STE A;  2F0E A;  4JG2 A;  2AMC B;  3N52 A;  1KL9 A;  2Z6K A;  3W3A A;  5IYB H;  2GVA A;  2MFI A;  1MI2 A;  1JCK B;  3RLO A;  4ZYS A;  1K8M A;  4OEM B;  2F3W A;  1MJE A;  3CCQ A;  2K52 A;  1IYU A;  2B2U C;  3CQZ B;  4RGM A;  3M3Y H;  1F2L A;  2DNC A;  2EY5 A;  4LAA A;  4ZAI A;  1F9P A;  2H5X A;  3CQZ H;  4BXX H;  3S15 H;  1Y1W H;  4N9P A;  5FLX E;  4K8I A;  5IGG A;  1YNN D;  2NVQ H;  3U9O A;  4H0L C;  2IT1 A;  4GN3 B;  4JC0 A;  3L3O C;  4L6T B;  1TWG H;  3NWS A;  1C7Y A;  1ET9 A;  5CGK A;  1P8L A;  3ULJ A;  1VQ6 A;  1EL0 A;  4RGO S;  4HJ8 A;  5C4X G;  3CF5 A;  1F2Y A;  3I4M H;  2X6L A;  1QNK A;  3VYS A;  3FKI G;  4UP8 A;  1NJI C;  3VR3 A;  1DON A;  4GLA C;  1F2Z A;  3X3N A;  4LNQ A;  3TP7 A;  2QA4 A;  1SAP A;  1E24 A;  5JOB A;  2E2I H;  4ZLT F;  3Q0A A;  1EQQ A;  2PQE A;  4FF4 A;  4JPB W;  2D9U A;  5I4D A;  4A3M H;  5FLM G;  3RMH A;  3KK7 A;  2Q2U A;  2K5D A;  4OX9 Q;  4GKJ L;  1TWC H;  1Y1V G;  2OF1 A;  3WOF A;  4I7A A;  4HSV A;  4XIG S;  1D7Q A;  3GTO B;  2XVS A;  3HP3 A;  3QR8 A;  5CV6 A;  1Y1V B;  1HQR D;  1V1O A;  5EQ0 A;  3M4P A;  4X3T A;  5CC4 A;  4JBJ A;  3LNN A;  2UUB Q;  1U4L A;  3D6W A;  5C3E H;  2F0N A;  2PPB C;  1J8I A;  5TSS A;  1FJG Q;  1SFO B;  2XN9 C;  3M4O B;  1N32 Q;  4JI5 Q;  4JOI C;  3K5M A;  1SRO A;  3HOU B;  2K50 A;  1U4M A;  4JK1 C;  3T56 B;  4OX9 L;  3T4A C;  4GKJ Q;  2E2D C;  3H0G G;  5IOD A;  1GUN A;  2D0P A;  1X3Q A;  1Q8K A;  3NEL A;  4IJH A;  1WCM B;  4BY1 H;  3MWY W;  3NTK A;  1VQF A;  4PQX A;  3SEB A;  1FNV A;  1VF5 C;  2KA7 A;  3LX0 A;  3MHB A;  3EN2 A;  1XJV A;  1A63 A;  3KF8 A;  1PYB A;  2R6G A;  2ES2 A;  2DJF C;  4A3F B;  1SSO A;  4MTN A;  4IUT A;  1N34 Q;  4A3D G;  1CKN A;  4K0K Q;  1N32 L;  1B2T A;  1X6O A;  2PO4 A;  4QUF A;  1Q12 A;  5CR3 A;  4B08 A;  1MHW C;  1SFO H;  4F8M A;  2CQO A;  1Z7T A;  3EIV A;  1HR0 Q;  2AWN A;  1SNM A;  3NUC A;  4G4K A;  4OO1 I;  1I6V C;  1IZ6 A;  2ZXP A;  3K57 A;  1LV9 A;  2VXW A;  5IT9 L;  2ZXR A;  4DU9 A;  1PH5 A;  1R9T H;  1HTP A;  5IGD A;  1T9H A;  2JA6 H;  3HOX H;  4WOR A;  4LF9 Q;  3FMC A;  3TDQ A;  4H13 C;  3TP5 A;  4DFA A;  1QVF A;  1Q8I A;  1LTA D;  5JJI A;  1AZP A;  2ZJP A;  1RDP D;  1HA5 A;  3VA7 A;  1PDQ A;  5JPN C;  1NCV A;  4KI0 A;  4R9W A;  1WVL A;  2NB0 A;  2Q8T A;  2I46 A;  2RCF A;  4OON A;  4DR3 L;  2UXD Q;  1LYL A;  3BYT B;  4JV5 Q;  3L2P A;  2EYH A;  1A6X A;  4R4T A;  1PV4 A;  2MHV A;  4UDU C;  4A3B B;  3MXN B;  1YNN C;  4JI4 L;  3A8J E;  3TS2 A;  1V9P A;  1CKN B;  4BY1 B;  1ESR A;  1TKW B;  5E4W C;  1N36 L;  3HOZ H;  3PIP 3;  4P2C B;  3NQI A;  3H3V H;  1QE6 A;  1KNA A;  4R4O A;  2PZW A;  5LMN Q;  4RCO A;  1HUN A;  3HEJ A;  1Y8P B;  1NSN S;  1G6Z A;  4XT1 B;  3BU2 A;  1SXT A;  5T1G A;  5JVH 3;  2JEA I;  3PMF A;  1XPR A;  2BCO A;  4BBS B;  1SE4 A;  2SDF A;  4JI4 Q;  3HS0 C;  1LTR D;  4EGV A;  2K32 A;  1WTP A;  5IP7 G;  2WAQ E;  5FLX L;  2QGQ A;  3I4L A;  4AH6 A;  2PI2 E;  1FYC A;  3G48 A;  4DAY A;  4DUY L;  4KHZ A;  2C9O A;  4C1N I;  4ZKB B;  4JBM A;  4DR2 L;  1W6J A;  1VQH A;  4RKB A;  3HOU H;  1CUK A;  5C5M A;  2Q8I B;  1EY7 A;  3A8K E;  5C4X H;  2KED A;  4PG3 A;  1S5E D;  1TS3 A;  4MN3 A;  4RG1 A;  1NMG A;  1EQT A;  3AFP A;  3IFD A;  3TZU A;  1ROD A;  4JBW A;  2YTX A;  5EJW A;  3K7A H;  2VUM G;  1WFQ A;  1XXG A;  1X55 A;  3TP8 A;  2B2U A;  3T1H Q;  2UU9 Q;  4H7B A;  2JA5 B;  2KCN A;  2L4N A;  2AUK A;  1WD1 A;  4LUV A;  1N33 Q;  2Q2T A;  2E74 C;  2PMZ E;  4GLX A;  1G6P A;  1Q3L A;  4KKS A;  2JE6 I;  4KK7 A;  1HNX L;  3HOY H;  2EDG A;  3SXH A;  1KAA A;  2K01 A;  3ICE A;  1E3P A;  2OCE A;  3UDG A;  1ZKO A;  1GKH A;  3KLR A;  1JJ2 A;  1UE1 A;  2JA8 G;  5K36 H;  4XYO A;  1O7Z A;  3D4D A;  3GTJ H;  2CQA A;  4X64 Q;  1FVI A;  2G5D A;  3CU7 A;  3L7Z C;  2UXC Q;  2UUC Q;  3PIO A;  4P74 A;  2B8F A;  3X3M A;  1HNZ Q;  2AQ3 B;  1WTW A;  4IUU A;  4WJW A;  4V19 0;  3FKI B;  1QG7 A;  3DWA A;  4F7X A;  1UNS A;  1K28 A;  1VS0 A;  2K1B A;  4ILW A;  1A62 A;  1LT3 D;  5C44 H;  4S3S A;  4CBV A;  3S15 B;  3AYH B;  5DNF A;  1PH1 A;  2DY8 A;  1E0B A;  3A55 A;  3TSS A;  4X64 L;  1UEA B;  5IGC A;  1CA5 A;  2A74 C;  2F0F A;  4A93 B;  4DR6 Q;  2J4X A;  3H94 A;  1LTL A;  2MQH A;  3TQY A;  3LWE A;  3V2T A;  3G6E A;  4A93 G;  4I65 A;  4LF7 L;  2NZ1 D;  3CCU A;  1NE3 A;  1D5M C;  3W2D A;  5IY0 A;  3KUP A;  1VQG A;  4JOI A;  2KJX A;  3E0J A;  4ZRZ A;  5JEA H;  5IWA Q;  1OTC A;  2SNM A;  1PXU A;  4R8N A;  5C0X I;  1YJ9 A;  1IBM Q;  3K8A A;  3PCO B;  2RA4 A;  4IUN A;  3RNU A;  4JW0 A;  3MZ5 A;  3C3L A;  1II3 A;  3S1Q B;  3MEF A;  2EYL A;  2E2H H;  3UE0 A;  4HED A;  3JAM L;  3PSI A;  2EJF C;  1IW7 D;  1CHP D;  4CHT B;  3D31 A;  2FMC A;  3P75 A;  1TWF B;  1B70 B;  2IHE A;  5KNB A;  1S5F D;  4X62 Q;  1ZXT A;  5LL6 X;  3R2I A;  5I6W A;  3A54 A;  1O80 A;  5C4H A;  4HJ7 A;  3MFY A;  1UE5 A;  4CJ1 B;  4K5W A;  4DR5 Q;  3I4M B;  4KD3 A;  3MAQ A;  4O0A A;  2JK8 A;  5FOB B;  1DJR D;  5D3D A;  1I4G A;  1HZB A;  1WYD A;  3H3V I;  3O13 A;  3QB3 A;  2XGT A;  1TY0 A;  3AQQ A;  1Q90 A;  2F0K A;  1RHP A;  4APV A;  1BUV T;  3GTG B;  4UY8 C;  1HJP A;  4QIW E;  4RAU C;  5CBE E;  1X3E A;  1SMX A;  2R61 A;  3D4R A;  3E5S A;  2WFW A;  1GO3 E;  2A5H A;  4ZUJ A;  3GO5 A;  3DEO A;  5IGB A;  1PH9 A;  1H9R A;  1RKN A;  4YIJ A;  4PV1 C;  1JE4 A;  4YWK A;  3T53 B;  3GTM B;  1SR3 A;  5K36 G;  2Q2I A;  3OWE B;  3AMU A;  1VQL A;  4XQN A;  1RTN A;  2E2J B;  5M5Y H;  4BY1 G;  2JXM B;  4KJO A;  2K5Q A;  4C3I B;  3PO2 G;  1B3A A;  4ME5 A;  3DM3 A;  4A3B G;  2OTJ A;  1DOK A;  1MBY A;  1KTK A;  4KV6 A;  4K2L A;  5I2Y A;  4OL7 A;  4U68 A;  3E9H A;  3HGB A;  3HKS A;  3OW2 A;  2F3I A;  2QEX A;  4QGU A;  4L5T A;  2K75 A;  2PW7 A;  4X3U A;  4XXE A;  2F0J A;  1W6K A;  4OO1 G;  3MXU A;  3WDN A;  1A0I A;  2I07 B;  3J80 c;  1HHV A;  3RZO B;  1K0R A;  4NXN Q;  4NKL A;  5C4J H;  4DV5 L;  4X66 Q;  1OXT A;  4QQB X;  5ELB A;  2LKV A;  2Y0S G;  1D1I A;  3RN2 A;  1XX8 A;  1CI3 M;  3D8G A;  1VDZ A;  1KDB A;  1EYG A;  3NTI A;  2DGY A;  2ALY B;  4C3H H;  1L0Y B;  4LUZ A;  5DAU A;  4MIU A;  3GV6 A;  3HOY B;  4RA8 A;  4U67 3;  4KKT A;  3CME A;  2MO1 A;  1H9M A;  1B4O A;  3AB9 A;  2OWO A;  1L0W A;  1PTO B;  3NBH B;  5GQO A;  3KJO A;  4HN7 A;  2VUM B;  4BS9 A;  1OXU A; 
#chains in the Genus database with same CATH homology
 2KHS A;  3P7J A;  2NVT B;  3PO3 B;  3OW7 A;  1IYV A;  4FXG C;  2PZT A;  3UI2 A;  2SEB D;  5CV4 A;  5F2D A;  1EIH A;  1EYD A;  1Z47 A;  2B8G A;  1OXX K;  1SJH D;  3KLS X;  4CJ2 C;  1SYG A;  5G3L D;  3KLS A;  3J7Y W;  1D2B A;  1EZ8 A;  4C56 C;  3PUX A;  1HUM A;  3J80 L;  1B53 A;  4C2M B;  2EOT A;  2R7Z B;  3ITP A;  3WOE A;  4DAV A;  2XNA C;  1EY0 A;  4G7Z C;  4IUR A;  1GJX A;  4ZUI A;  3BYY B;  4C1N K;  5C3X A;  2JA6 B;  2QDB A;  1LLR D;  5ELE A;  1S5B D;  3OHX C;  3QJY A;  3JAM E;  4C3I G;  3PO2 B;  3K5N A;  4A3G B;  3L9A X;  5C5L A;  4IZ8 A;  5IGF A;  1X32 A;  2PW5 A;  1DD2 A;  3ZYY X;  3MEH A;  1SYF A;  1BDO A;  3GP7 A;  1JOQ A;  1CTM A;  2EYP A;  2A69 D;  3EJI A;  3GTL B;  1ZYR D;  2RSO A;  2B2V C;  2L0C A;  2EYF A;  1R4P B;  5CV8 A;  5KYL A;  3MXG A;  4LMQ D;  4FO2 A;  1G2S A;  3BDO A;  1A3T A;  1WTO A;  2BDO A;  3S17 B;  2CVR A;  5C4Z A;  3CRL C;  5A2Q L;  2NTS A;  1C48 A;  3TP6 A;  1LT5 D;  2A6H D;  2Z1C A;  5EPJ A;  4ZQ3 A;  3GD7 A;  4A3M B;  2WKC A;  3NWT A;  4I7Z C;  3H91 A;  2O5I C;  2JA7 B;  2D62 A;  1JC7 A;  2L55 A;  5CMD A;  4M8A A;  1F9R A;  4HMJ A;  4NMZ A;  5LL6 S;  4PMC A;  2HUG A;  4CGY B;  1FR3 A;  1ILQ A;  3OWF A;  3Q23 A;  3SDZ A;  4TRD A;  3T16 A;  1X3P A;  2F0V A;  4FF3 A;  2E2I B;  2B2W A;  3HG9 A;  1O78 A;  2AWO A;  3VYR A;  4HSP A;  3VR6 A;  2ENB A;  4G57 A;  2L1B A;  1UAP A;  1EEI D;  1WTX A;  3S2D B;  2B2Y C;  3VYT A;  3R93 A;  3DHQ A;  2LS0 1;  1KLU D;  2Y0S B;  1H9S A;  3J80 E;  4IFD I;  4CKE A;  4X3S A;  4XDX A;  2QKI C;  3BDC A;  5KYI A;  1QNU A;  1TR5 A;  2DY7 A;  2F0M A;  4BA2 I;  2O5J C;  4DGZ A;  3RZD B;  1H9S B;  2XWJ B;  3K6O A;  2K28 A;  3T51 B;  1STG A;  4EQN A;  1DCZ A;  1ONL A;  1GOZ A;  1WTV A;  4HR7 B;  1RJT A;  2IL8 A;  1NR4 A;  3RLF A;  2YYZ A;  2JA8 B;  3NXW A;  5EKI A;  4KKU A;  3V05 A;  5ELD A;  4RH6 A;  1Y1W B;  2EE1 A;  1TY2 A;  3A7A B;  1JQY D;  4HTH A;  5KRU A;  4FVM A;  4CKB A;  4WFN 3;  1STN A;  1BBX C;  4QB4 A;  2B63 B;  3NSW A;  2FIN B;  1TII D;  5DM7 3;  1A2U A;  1VCI A;  3I8Z A;  4J6H A;  2IX3 A;  4K2K A;  3F2U A;  3RD4 A;  2WAC A;  2X6G A;  3TBI B;  4DAP A;  4KJN A;  1CK1 A;  2EYM A;  2RDF A;  4BWG B;  5KEE A;  3NBH A;  3ND9 A;  1G2T A;  3T13 A;  3U9S A;  3QG1 A;  2EXZ A;  1V43 A;  3TZD A;  1HFG A;  1G8Z D;  4TKO B;  1EQV A;  4DK1 A;  1TT2 A;  1XTC D;  2LY7 A;  3PV0 A;  1BCP D;  3NPP A;  3OOC A;  5COY A;  1AZQ A;  3EVQ A;  2ICE C;  4DXG A;  1BCP C;  2G9H D;  1JOR A;  2ICI A;  3C2P A;  4A3K B;  2F0W A;  2SOB A;  4K6L A;  5G3L F;  1IKM A;  2NN6 I;  5C3W A;  5EPL A;  5IGE A;  3M85 A;  4XQJ A;  1OXS C;  4NP5 A;  2F0D A;  3CRK C;  3OIP A;  4KMU C;  1LAB A;  3PUY A;  1LAC A;  3FVQ A;  2MPM A;  5M9O A;  3IAY A;  2CW0 C;  4DXF A;  1SNQ A;  2D5D A;  3M7N A;  4EQP A;  2JP1 A;  3HOV B;  5C0X G;  1MSG A;  1FD7 D;  1A3U A;  1CT1 D;  1PTO F;  5M3M B;  3DMU A;  2PYK A;  1PZJ D;  1CM9 A;  4KN7 C;  2K6A A;  3CKI B;  1JWS D;  3QOJ A;  5JVG 3;  1D6E C;  4K5X A;  2FMM A;  5I6Y A;  1B50 A;  3KBG A;  2L5T A;  1DOM A;  2WAQ B;  3C1F A;  5CBA E;  1ZYR C;  5JAV A;  2XRQ D;  3GQB A;  5HUR A;  3A8I E;  3EQL C;  5J22 A;  2XRS D;  5FKA C;  3NTH A;  2F03 A;  2KUM A;  3P1H A;  2K33 A;  4QMG A;  5DM6 3;  3S14 B;  4NW2 A;  2F0I A;  4KY5 A;  1Y8O B;  1MGS A;  2B2Y A;  3Q24 A;  3I72 A;  3K5O A;  1QCB D;  1EYA A;  1I4R A;  1HQM C;  4DK0 A;  1BXT A;  3HOW B;  3SHL A;  2VB2 X;  1V1P A;  4ABN A;  3A7L A;  3VR4 A;  4A3E B;  5M5W B;  3ERQ A;  3R2T A;  4BY7 B;  5KGU A;  4RGN A;  4A3J B;  4NDX A;  2HDL A;  2JSO A;  2A68 D;  2Z4I A;  1B9M A;  3SE0 A;  2G9D A;  3E6Z X;  1NAP A;  4J8Q A;  2EYJ A;  1IW7 C;  5E3F A;  1FNU A;  3BVZ A;  2QEJ C;  4FXK C;  5FO9 B;  4RCN A;  4IUV A;  1LTS D;  3ND8 A;  4FF1 A;  1GHJ A;  1CZW A;  3V96 A;  1E2V A;  1EIG A;  4L63 B;  4RKL A;  2L9H A;  3HRZ C;  5JPM C;  4PNY A;  1FNW A;  2NVQ B;  1AW7 A;  2E76 C;  1IHZ A;  5NUC A;  4MHE A;  1E2W A;  2KEC A;  1STA A;  1KNE A;  2OT2 A;  3QWN A;  1QB5 D;  2A6H C;  3K58 A;  3DWQ A;  4K8J A;  1QWY A;  2JEB I;  3FRP B;  5C0X J;  3BVM A;  3QO2 A;  1SYE A;  2N88 A;  3PUZ A;  1S5D D;  2DNE A;  2IJ0 A;  2H1E A;  1L0X B;  1PFN A;  3LWU A;  2F3V A;  4FNF A;  5M5X B;  4OIJ A;  1S5C D;  5EKK A;  1LTI D;  5A2Q E;  2F0H A;  1SYD A;  2MJ8 A;  2QF7 A;  1TWC B;  1EU3 A;  1HFN A;  1ET6 A;  3BZD B;  5C3E B;  4FF2 A;  5EBD A;  1NR2 A;  2Q8R E;  1KDC A;  3VR5 A;  2F0Q A;  2F1M A;  5EKL A;  4K14 A;  2EJG C;  4IUQ A;  1C8C A;  1M4V A;  1ML0 D;  2RVL A;  4C3H G;  5JJZ A;  1HA6 A;  1DYQ A;  2K03 A;  1PYW D;  2V4D A;  4DA2 A;  3OPO A;  5EBC A;  2K7V A;  1AFP A;  2BOS A;  5IT9 E;  3BS1 A;  1VMP A;  4TQU S;  3Q22 A;  2K04 A;  1EY5 A;  2LFN A;  3CHB D;  5EGT A;  1EFI D;  4V0B A;  1V8Q A;  3SK6 A;  2PCF B;  3MC0 B;  4C3J B;  1Y69 U;  1CQF A;  2ZT9 C;  3AU7 A;  3NHH A;  3K5L A;  4DNT B;  3RUZ A;  3P20 A;  3QOL A;  2R92 B;  1GUG A;  1SYC A;  1VMC A;  1SND A;  4HMI A;  2HCC A;  2MGS A;  4F87 A;  2F0O A;  3GTP B;  2KEE A;  3J81 L;  1KLG D;  1GHK A;  1BCP B;  1EY9 A;  4HCE A;  4M1U B;  3S2H B;  1VF7 A;  1O7Y A;  3IKJ A;  1DM0 B;  1RTO A;  3MTS A;  5CV5 A;  2F0U A;  3NP8 A;  1SNC A;  4IQZ A;  3MFG A;  4X3K A;  1OO9 B;  1SNP A;  1LT6 D;  1SE3 A;  4FXD A;  3SK8 A;  3KBX A;  1OXV A;  1PRT F;  4Y7N B;  1JIC A;  2WB1 B;  2Z8L A;  1HXY D;  3SK5 A;  1I4H A;  5C4X B;  3I91 A;  4G7O C;  3MVV A;  2F4I A;  1E2Z A;  2L11 A;  1SMY C;  1O7L A;  1LT4 D;  3G7L A;  4H44 C;  4AYB B;  3I90 A;  2NTT A;  4KY6 A;  4GZY C;  2CHB D;  1NUC A;  1JWM D;  4KY7 A;  4PMW A;  3A56 A;  1RCV D;  4CJ0 B;  3BVG A;  2HDM A;  4IAL A;  1Y8N B;  3D4W A;  2EVB A;  1DZ1 A;  1ENA A;  1BOS A;  3GTJ B;  5EPK A;  1PZK D;  5E4X A;  5BN3 A;  3S16 B;  5ISR A;  1HCZ A;  2FHT A;  5J39 A;  2IX0 A;  2B2T C;  2HCI A;  1AN8 A;  1STY A;  1QJO A;  3N6R A;  1F9S A;  2WP8 J;  5CV9 A;  1JR0 D;  5LHY 1;  3HOX B;  3DM1 A;  2RSN A;  3K7A B;  3DWP A;  4O42 A;  3VR2 A;  2NYZ D;  2E2H B;  1MSH A;  1LTB D;  1IKL A;  1F9Q A;  1A15 A;  2A6E C;  4A3D B;  1PRT B;  1D5X C;  2RKS A;  5CYU A;  5KIX A;  2YU9 B;  1XYI A;  2WKD A;  5C44 B;  3C1E A;  1G91 A;  2AQ1 B;  2R93 B;  2KVM A;  1AP0 A;  4CKC A;  1Z6H A;  5M5Y B;  1BO0 A;  2EY1 A;  1GUT A;  2RBM A;  3IL8 A;  1JWU D;  1TS5 A;  2OXP A;  2PZU A;  1TWA B;  2IX1 A;  4C3H B;  2X69 A;  5FK9 C;  2CW0 D;  5C4J B;  4XYQ A;  2MUY A;  1SMY D;  1PTO D;  5C6A A;  1KAB A;  1I4Q A;  2EYO A;  4UAI A;  4Z9C B;  1A2T A;  2VB3 X;  2A73 B;  1QOH A;  4K6D A;  4KN4 C;  1U9R A;  3I73 A;  3TME A;  5FO8 B;  4BBR B;  1YNJ C;  2NN6 H;  1CQV A;  4BA1 I;  3GTQ B;  1FGB D;  2OEO A;  3NBI A;  1SNO A;  1TWG B;  1R4Q B;  3NK9 A;  4RGT A;  3I70 A;  2WII B;  2EPB A;  2KOL A;  2F0L A;  1PLF A;  2NVY B;  5KNC A;  2J0T D;  3R8B A;  2KCC A;  1EY4 A;  1EY6 A;  5DEH A;  4B9X A;  2A6E D;  3Q6S A;  1CA6 A;  3VA5 A;  1SDF A;  2A68 C;  1GUS A;  1EEF D;  2K5W A;  4J1M A;  5BN4 A;  2NBF A;  4DF7 A;  1IL8 A;  3SR1 A;  2B39 A;  5ELF A;  3MXP A;  3K59 A;  3OMG A;  1I6H B;  3S1R B;  1B44 D;  3OSO A;  3D6C A;  4QIW B;  3BDL A;  3HZX A;  1RF2 D;  1SYB A;  1GXD C;  4KTA A;  2F0T A;  2F0P A;  3NE5 B;  3GTK B;  3S9W A;  2EY6 A;  2C5C A;  4L8J A;  3G6J B;  4OIK A;  4Q5V A;  2NUC A;  1I3Q B;  5JEA G;  1BQQ T;  3VYU A;  1PRT C;  5D14 A;  4LK1 C;  2EZV A;  2K05 A;  3PUV A;  2AQ2 B;  2GA4 B;  3DEP A;  3R3O A;  5COR A;  2PNR C;  3HOZ B;  2HQE A;  3SK4 A;  4ZKC B;  2F0S A;  4IFD G;  4XQQ A;  3J7A F;  1ILP A;  2NVX B;  1J9O A;  2RQX A;  4HAE A;  4OO1 H;  2FFK B;  2KQ3 A;  5M3F B;  4KHV A;  4RWS C;  3IFT A;  1V1P B;  1KDA A;  1UUP A;  1HRJ A;  1D1K A;  1BR9 A;  1STB A;  1TQO A;  5CV7 A;  4DNR B;  2B2V A;  1EY8 A;  3OMC A;  2QCP X;  1TS2 A;  1DXM A;  2D2C C;  3PUW A;  1LO5 D;  1F2M A;  2VNU D;  1CHQ D;  3J7A V;  1EOT A;  4ZK9 B;  2A69 C;  5HGT A;  3NQT A;  3GV3 A;  2IW3 A;  4XTC S;  1U4R A;  1STH A;  2TSS A;  2XSC A;  4O1N A;  3EFX D;  3URY A;  2O4X A;  4N9T A;  1BCP F;  4FYD A;  4A3I B;  3PIO 3;  2NN6 G;  4OHJ A;  5D65 A;  3H3V C;  2M2L A;  1JB3 A;  4OGQ C;  5I9P A;  1F77 A;  3S1M B;  1DOL A;  1B9N A;  3ERO A;  1H9J A;  5K5P A;  4XT3 B;  1YNJ D;  4RFB A;  2RDH A;  2IWH A;  1XWE A;  1SJE D;  1LTT D;  4QF4 A;  3S1N B;  3D3R A;  1GUO A;  1R9T B;  3J81 E;  2ID0 A;  5AFW A;  4ID6 A;  4RHR A;  2O2L D;  2BA1 A;  1K8O A;  3M4Y A;  1I4X A;  4F88 A;  3MXN A;  3EA6 A;  1SE2 A;  1M8A A;  2RDG A;  1D5Z C;  2BE5 C;  2IPK D;  1PRT D;  5I2X A;  3M7G A;  1A3V A;  1ENC A;  1EWC A;  2F0G A;  5T1I A;  4ODG A;  2JYO A;  3TN2 A;  2M00 A;  1ZEQ X;  5E1F A;  2SNS A;  2M9V A;  1Q1B A;  2B2W C;  1EZ6 A;  2ZXO A;  4FP5 D;  3M3Y B;  4IFD J;  1PFB A;  2AUJ D;  3FDT A;  3FEW X;  1Q1E A;  1LTG D;  1PFM A;  4ULL A;  2B2T A;  3MA2 B;  1CZG A;  4EVO A;  1PTO H;  5BN5 A;  2BE5 D;  1B1Z A;  1EWH A;  1HPC A;  1QIL A;  5KND A;  1GUW A;  4DN4 M;  3I3C A;  5IIF A;  3OIQ A;  4IFD H;  1I50 B;  2R3Z A;  2QIL A;  1TU2 B;  5FO7 B;  3SVM A;  1CFM A;  1ENF A;  4C3J G;  3DXJ C;  5JEA J;  1SEB D;  4K5V A;  2Z4H A;  1EYC A;  4TSS A;  1G29 1;  4LJZ C;  3H6M A;  3I4N B;  1PZI D;  2BA0 A;  1I4P A;  1PMR A;  4HCS A;  2BDN A;  4EQO A;  2WV6 D;  3HKZ B;  2E75 C;  1TVX A;  2TMP A;  1TWH B;  5J1Z A;  1JOO A;  4QUC A;  1WD0 A;  4KD4 A;  3H09 A;  1U4P A;  3C46 A;  2LMC B;  3ONA B;  3FPP A;  5I9O A;  4RHS A;  1T5E A;  1ESF A;  2FJ2 A;  2NWG A;  4PMB A;  4IN3 A;  1JOK A;  4IUP A;  1RD9 D;  2N55 A;  1T5X D;  1S4Z A;  2XIW A;  1H9K A;  2DN8 A;  2XWB B;  1PTO C;  1AEX A;  3BG3 A;  1K83 B;  2J7Z A;  1MD2 D;  1ICW A;  3DUZ A;  3K0Y A;  4E6I A;  1BNZ A;  5ELC A;  1WTR A;  2EY2 A;  4Q0F A;  1EU4 A;  4R8I A;  1WTQ A;  4WRD A;  4QCL A;  1HTL D;  1C4Q A;  2PMZ B;  2WIN B;  2L12 A;  5IOC A;  5C0X H;  1BF4 A;  2EJM A;  3QIA A;  5A35 A;  1SBB B;  3FPU B;  4G7H C;  5D3I B;  3H0G B;  1TS4 A;  2H4O A;  4B9W A;  2MP1 A;  1STE A;  2F0E A;  3N52 A;  3W3A A;  1MI2 A;  1JCK B;  4ZYS A;  1K8M A;  2F3W A;  1IYU A;  2B2U C;  3CQZ B;  4RGM A;  1F2L A;  2DNC A;  2EY5 A;  4LAA A;  4ZAI A;  1F9P A;  4N9P A;  5FLX E;  4K8I A;  5IGG A;  1YNN D;  3U9O A;  4H0L C;  2IT1 A;  3L3O C;  4L6T B;  3NWS A;  1ET9 A;  5CGK A;  1EL0 A;  4RGO S;  1F2Y A;  2X6L A;  1QNK A;  3VYS A;  3VR3 A;  1DON A;  1F2Z A;  3X3N A;  3TP7 A;  1SAP A;  5JOB A;  4ZLT F;  3Q0A A;  2PQE A;  4FF4 A;  2D9U A;  5I4D A;  3RMH A;  3KK7 A;  2K5D A;  2OF1 A;  3WOF A;  4HSV A;  4XIG S;  3GTO B;  2XVS A;  3HP3 A;  5CV6 A;  1Y1V B;  1HQR D;  1V1O A;  5EQ0 A;  4X3T A;  5CC4 A;  3LNN A;  1U4L A;  3D6W A;  2PPB C;  2F0N A;  1J8I A;  5TSS A;  1SFO B;  2XN9 C;  3M4O B;  3K5M A;  3HOU B;  1U4M A;  4JK1 C;  3T56 B;  3T4A C;  2E2D C;  5IOD A;  1GUN A;  1X3Q A;  1WCM B;  3MWY W;  3NTK A;  4PQX A;  3SEB A;  1FNV A;  1VF5 C;  2KA7 A;  3LX0 A;  3MHB A;  3KF8 A;  2R6G A;  4A3F B;  1SSO A;  4IUT A;  1B2T A;  2PO4 A;  4QUF A;  1Q12 A;  5CR3 A;  4B08 A;  4F8M A;  1Z7T A;  2AWN A;  1SNM A;  3NUC A;  4G4K A;  4OO1 I;  1I6V C;  2ZXP A;  3K57 A;  1LV9 A;  2VXW A;  5IT9 L;  2ZXR A;  4DU9 A;  1HTP A;  5IGD A;  4WOR A;  3FMC A;  3TDQ A;  4H13 C;  3TP5 A;  4DFA A;  1Q8I A;  1LTA D;  1AZP A;  1RDP D;  1HA5 A;  3VA7 A;  1PDQ A;  5JPN C;  1NCV A;  4KI0 A;  4R9W A;  1WVL A;  2NB0 A;  2Q8T A;  2I46 A;  3BYT B;  2EYH A;  1A6X A;  2MHV A;  4UDU C;  4A3B B;  1YNN C;  3A8J E;  4BY1 B;  1ESR A;  1TKW B;  5E4W C;  3PIP 3;  4P2C B;  3NQI A;  1QE6 A;  1KNA A;  2PZW A;  4RCO A;  1HUN A;  3HEJ A;  1Y8P B;  1NSN S;  1G6Z A;  4XT1 B;  1SXT A;  5T1G A;  5JVH 3;  2JEA I;  3PMF A;  2BCO A;  4BBS B;  1SE4 A;  2SDF A;  3HS0 C;  1LTR D;  4EGV A;  2K32 A;  1WTP A;  5FLX L;  3I4L A;  1FYC A;  4DAY A;  4KHZ A;  2C9O A;  4C1N I;  4ZKB B;  1W6J A;  4RKB A;  5C5M A;  2Q8I B;  1EY7 A;  3A8K E;  2KED A;  1S5E D;  1TS3 A;  4MN3 A;  1EQT A;  3IFD A;  3TZU A;  1ROD A;  4JBW A;  5EJW A;  1XXG A;  3TP8 A;  2B2U A;  4H7B A;  2JA5 B;  2KCN A;  2L4N A;  2AUK A;  1WD1 A;  2E74 C;  1Q3L A;  4KKS A;  2JE6 I;  4KK7 A;  2EDG A;  3SXH A;  1KAA A;  2K01 A;  1ZKO A;  3KLR A;  5K36 H;  4XYO A;  1O7Z A;  3D4D A;  2CQA A;  3CU7 A;  3L7Z C;  2B8F A;  3X3M A;  2AQ3 B;  1WTW A;  4IUU A;  4WJW A;  4V19 0;  3FKI B;  1QG7 A;  3DWA A;  4F7X A;  1UNS A;  2K1B A;  4ILW A;  1LT3 D;  4S3S A;  4CBV A;  3S15 B;  5DNF A;  2DY8 A;  1E0B A;  3A55 A;  3TSS A;  1UEA B;  5IGC A;  1CA5 A;  2A74 C;  2F0F A;  4A93 B;  2J4X A;  3H94 A;  3LWE A;  3V2T A;  4I65 A;  2NZ1 D;  1D5M C;  3W2D A;  3KUP A;  2KJX A;  3E0J A;  4ZRZ A;  5JEA H;  2SNM A;  1PXU A;  4R8N A;  5C0X I;  2RA4 A;  4IUN A;  3MZ5 A;  3C3L A;  1II3 A;  3S1Q B;  2EYL A;  4HED A;  3JAM L;  2EJF C;  1IW7 D;  1CHP D;  4CHT B;  3D31 A;  2FMC A;  3P75 A;  1TWF B;  5KNB A;  1S5F D;  1ZXT A;  5LL6 X;  5I6W A;  3R2I A;  3A54 A;  1O80 A;  5C4H A;  3MFY A;  4CJ1 B;  4K5W A;  3I4M B;  4KD3 A;  3MAQ A;  5FOB B;  1DJR D;  5D3D A;  1I4G A;  3O13 A;  3QB3 A;  1TY0 A;  1Q90 A;  2F0K A;  1RHP A;  1BUV T;  3GTG B;  4RAU C;  5CBE E;  2R61 A;  3D4R A;  3E5S A;  4ZUJ A;  2A5H A;  5IGB A;  3GO5 A;  3DEO A;  1H9R A;  1RKN A;  4YIJ A;  4PV1 C;  1JE4 A;  3T53 B;  3GTM B;  5K36 G;  3OWE B;  3AMU A;  4XQN A;  1RTN A;  2E2J B;  2JXM B;  4KJO A;  2K5Q A;  4C3I B;  1B3A A;  4ME5 A;  1DOK A;  1MBY A;  1KTK A;  4KV6 A;  4K2L A;  5I2Y A;  4OL7 A;  4U68 A;  3HGB A;  2PW7 A;  4X3U A;  4XXE A;  2F0J A;  1W6K A;  4OO1 G;  3MXU A;  3WDN A;  2I07 B;  1HHV A;  3RZO B;  4NKL A;  1OXT A;  5ELB A;  2LKV A;  1D1I A;  1XX8 A;  1CI3 M;  3D8G A;  1VDZ A;  1KDB A;  3NTI A;  1L0Y B;  5DAU A;  4MIU A;  3GV6 A;  3HOY B;  4RA8 A;  4U67 3;  4KKT A;  1H9M A;  1B4O A;  3AB9 A;  1PTO B;  4HN7 A;  2VUM B;  4BS9 A;  1OXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...