2RA4A

Crystal structure of human monocyte chemoattractant protein 4 (mcp-4/ccl13)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
b'DALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small-inducible cytokine A13
molecule tags Cytokine
source organism Homo sapiens
publication title Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
pubmed doi rcsb
total genus 12
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ra4A00
1VMPA 1ML0D 1X3QA 1G2SA 4MN3A 1AP0A 2KEEA 2MJ8A 1ILPA 3I8ZA 2Q8TA 1CA5A 3Q6SA 1WD0A 2EOTA 2JP1A 2B2YA 1WTRA 1HFNA 2SDFA 2L9HA 1O7ZA 2DY7A 2B2UC 2HDMA 4X3SA 5CBAE 1EL0A 4U68A 1ZXTA 3FPUB 1QNKA 4IUPA 1DZ1A 1DOLA 3QO2A 3LWEA 4ZK9B 1X32A 5EKIA 4CJ2C 2FINB 1B2TA 4R9WA 2NWGA 3UI2A 2L11A 5CMDA 1CA6A 4ZKBB 2B2YC 2FFKB 5CBEE 2FJ2A 1BF4A 1G91A 2MGSA 2B2UA 1PFBA 1VMCA 1EQTA 1U4LA 1NR2A 1MSGA 2VXWA 1JE4A 1BO0A 1HUMA 1PDQA 1DOKA 1TVXA 2K03A 1GUWA 2RSNA 1C8CA 1WTWA 1Q3LA 2R3ZA 1HRJA 1WTVA 1PLFA 4R8IA 2MPMA 1NR4A 4IUQA 1B3AA 4RWSC 2KOLA 3KUPA 5DNFA 2H1EA 5T1GA 1NAPA 2X6LA 4CJ0B 2HCIA 1RHPA 3MTSA 1AZPA 1IL8A 2HUGA 2EPBA 1KNEA 2DY8A 4HEDA 5D14A 1WVLA 4ZKCB 1IKMA 2K28A 5COYA 5T1IA 2EE1A 4NW2A 1HHVA 1IKLA 1NCVA 1RODA 4X3UA 3IFDA 4OIJA 4IURA 1EIGA 5EPLA 1B53A 2K04A 3DEOA 5E4XA 1SAPA 4XT3B 1WTOA 3D6WA 1A15A 1U4MA 1ICWA 1QG7A 5D65A 3MWYW 3R93A 5JJZA 1O7YA 2X6GA 1PFNA 2MP1A 1MSHA 2IL8A 4QUFA 2CVRA 3IL8A 1G2TA 1PFMA 2B2VC 5EJWA 1J8IA 2K01A 2K1BA 5EQ0A 1U4PA 4ZAIA 1ESRA 3DEPA 1J9OA 1LV9A 3HP3A 4IUUA 5E4WC 2KEDA 2NZ1D 1AZQA 1DONA 2D9UA 4IUVA 2BDNA 4HSVA 2FHTA 3FDTA 3SVMA 1G6ZA 1HA6A 1F9QA 1F9PA 1EOTA 4QUCA 4RAUC 3I91A 3ONAB 1EIHA 4ZLTF 2HDLA 2KECA 2RSOA 1XYIA 1CM9A 3KBXA 4O42A 2B2VA 3G7LA 2L12A 1BBXC 4OIKA 1SDFA 2B2TA 2JYOA 1MI2A 2L1BA 4UAIA 1HUNA 4X3KA 1RJTA 4HAEA 3N52A 4XT1B 3F2UA 3I3CA 2N88A 1WD1A 1F9SA 2B2WA 1B4OA 2NYZD 3TN2A 5EPKA 3GV6A 5AFWA 1S4ZA 1U4RA 1WTQA 4IUTA 4RA8A 1BNZA 2B2TC 2HCCA 4DN4M 1M8AA 2Q8RE 3DM1A 3I90A 4HCSA 4LMQD 1F2LA 3P7JA 1E0BA 1MGSA 1O80A 1SSOA 5CORA 4X3TA 2XIWA 1RTNA 2N55A 1RTOA 1F9RA 1B50A 2FMMA 1JICA 1QE6A 2K05A 2J7ZA 2RA4A 2RVLA 1WTXA 3H91A 2KVMA 1X3PA 2B2WC 5EPJA 1ILQA 3GV3A 4MHEA 1KNAA 4XDXA 1DOMA 2L4NA 1XX8A 1HFGA 3TZDA 1WTPA 4CJ1B 2KUMA 2M2LA 2X69A
chains in the Genus database with same CATH superfamily
1YBYA 2EYMA 3CCLA 3GDEA 2IX3A 3KLSX 4KD4A 1AP0A 1PH3A 4OL7A 4JI0L 4LF6L 3S1RB 4OX9L 1KQSA 3LNNA 3NUCA 3TP8A 2CWAA 1EY4A 1BQQT 1S5DD 2PZUA 2WINB 4ZK9B 4IJHA 1CT1D 3H09A 2VZAA 1KAWA 1B7YB 4ZKBB 3DM3A 3KDFA 3M3YB 2A6EC 2D0OA 5HGTA 3JAME 3K7UC 4KHPQ 1EQTA 1PFBA 1WCMG 4IO9A 5C5LA 3GTQH 1BO0A 5M9OA 2B3GA 1HNXL 2D62A 1K8MA 1N8RC 3OWFA 2EYFA 1AH9A 1X3EA 2EY2A 4A3DG 4RWSC 1X56A 4A3FB 3D0FA 2YYZA 3H0GB 4TRDA 3RLFA 4ZRZA 1WVLA 1I50H 3ULPA 4WORA 5COYA 1Y1VG 4DK0A 1BCPF 5ELOA 1K83H 2JEAI 1HQRD 2KQ3A 1KABA 4JYAL 1G51A 2QGQA 2CFMA 4K6DA 3I4MG 4NDXA 4Y7NB 2X6GA 1MKHA 2RBMA 4ZUJA 3HOVG 1M4VA 1XNQL 2NZ1D 3T13A 3S2DH 5E3FA 4HSVA 1X54A 2VB2X 4R4QA 1G6ZA 2F0DA 2MQHA 3Q8DA 4ME5A 1XYIA 4ODGA 2E8GA 4OIKA 1B70B 2RDGA 1RD9D 1X3FA 2PCFB 3L3OC 4HTHA 4PV1C 1GJXA 5A2QL 1Q86C 3HKZE 4DV0L 2WV6D 4G7ZC 4LFBQ 1QILA 3TQYA 3A54A 1IBKL 1SLJA 1DD2A 3G6EA 1E0BA 3OIPA 4KLKA 1K9MC 4JI2L 1XPUA 3OMCA 2OTLA 4G4KA 2XRSD 4IOCA 3W3AA 2ICEC 2NVXB 2P5ZX 2B8GA 1JCKB 5HGQA 4DKAC 2HT1A 1FD7D 2X69A 4FO2A 1SNOA 2QF7A 4AIMA 2NTTA 2R6GA 3BDOA 2XN9C 4A3JB 2B2YA 1HH2P 2ZT9C 3MXPA 3I4NG 1ZXTA 4XYOA 5E1FA 1DZ1A 1QUQA 3LWEA 4CJ2C 2FINB 3UDXA 5C44G 1YHAA 3PO3H 1Q1BA 4DV3Q 1H95A 3K81C 2XGTA 4DR3L 2QW7A 3CC2A 4F88A 2IY5B 2R3ZA 2R7ZG 1SRUA 4TKOB 3BG3A 1CSQA 3NENA 3FP9A 2HCIA 3SXHA 5DEHA 2A5HA 1VQBA 2G9HD 4POFA 4ZKCB 4LUOA 2SNMA 3UDFA 2R92H 1CZGA 5IGGA 3K7AH 4L6TB 2Y0SB 5FOBB 4YHHQ 4FF3A 5EPLA 3F2DA 3H94A 4S3SA 3VA5A 1F2ZA 3D3RA 2CCZA 3KF8A 1O7YA 2IL8A 4IPGA 2HHHQ 3CMAA 1E2ZA 5IY0A 5EJWA 4JBKA 5I6YA 1BXTA 1VQPA 2GVBA 5HURA 2F0FA 3GTKB 4GKJL 5LMNW 3HKZG 2HDLA 5KYIA 2B2VA 4YY3L 2V4DA 3DWQA 1J6QA 2L1BA 3X3MA 4JK1C 5J39A 3U58A 3AYHB 2BA1A 4A3EG 1EYGA 4DK3C 4RGTA 1PTOB 3FHWA 3TMEA 4OWTB 3RZOB 1O78A 1II3A 1N32Q 3HZXA 3S16H 1QB5D 1KDAA 3KK7A 1R4QB 1RTNA 4JW0A 1B50A 1YJNA 5I9OA 1XNRQ 1ET9A 5I6WA 4DAMA 3PIP3 3GO5A 4QY7A 4DR7Q 1BKBA 3QWNA 5HY6A 2KUMA 2LS01 2UUBL 1PH7A 1VMPA 4R4TA 4K5XA 4K0KQ 4QGUA 3M4OB 1SYDA 1YNNC 2AUJD 2CWPA 4KV6A 3T1YL 4RGNA 5C0XI 4U68A 4HIDA 2ZTEA 1SJED 4XQJA 4WJ3M 4JI8Q 1LTLA 1X32A 2DN8A 2UXDQ 1LTSD 3GTMB 1AE2A 3A8KE 2E5LL 4LF9L 5JEAJ 1VQ6A 4Y52H 3PO2G 3JAMc 2WIIB 2B2UA 2MO0A 1GOZA 1ICFB 1GUSA 4DR2Q 3I4NH 4K8JA 1PZID 1GUWA 2A68D 5IODA 1Q3LA 1TU2B 1WCMB 1VQAA 2F0HA 4DV2L 2K33A 1VQ5A 4B3RQ 2WACA 1TWGH 3MC0B 4GNXB 1NAPA 4QIWE 2EYOA 4DR5L 4QF4A 3C1EA 2Q2UA 3S24A 2QEXA 4HJ7A 5EAYA 4DV6L 4P73A 4K14A 2EY5A 2AWOA 1QG7A 3M7GA 5BR8L 5LMNQ 1H9SA 1Z47A 1PFMA 1W6JA 3PMFA 2QDBA 3I4MB 4PZ6A 5D3DA 1UE7A 1XMQL 3SK6A 3H15A 1UE1A 4XQNA 4PNYA 3C46A 1HJPA 1I5FA 3STBC 3MXGA 2K5NA 1YNJC 4ME3A 4NXNQ 1HZCA 5C3XA 5M3FG 3F2UA 3HOZB 4DR4Q 1EZ6A 2BH8A 1VDZA 3RZDB 2NYZD 2IW3A 4EQOA 5M3FH 4DUYQ 2K7VA 4A3BH 3P7JA 4BY1H 1FNWA 3SK4A 1STYA 1XMOQ 4Q0FA 2PQAB 2RA4A 2EYLA 1I6HH 1Q1EA 2EVBA 3V05A 3OTOL 3UDGA 2TSSA 1UUPA 1PTOF 3GTGH 3OW2A 2NB0A 1Q81C 1E22A 4DGZA 1A62A 4A3DH 3PSIA 4JC0A 4B9XA 2Z6BA 4NXNL 4A3MB 1QZHA 1EU4A 4B3TQ 5C0XJ 1SE4A 3KLSA 4DPGA 2Y0SE 5KEEA 1GD7A 5AJ3L 4UP9A 3PO3B 4X3SA 5CBAE 3NBIA 1I94Q 1LT3D 3A74A 4QMGA 2R93B 5EKIA 4DV4Q 2O4XA 2OQ0A 1EIYB 3F2CA 2JA5B 2EJGC 4KKUA 3HOWG 5EBCA 2VY3A 3BDCA 4LW1A 4KD3A 1PDQA 2E2IH 1BDOA 1DOKA 5J1ZA 2OQKA 1G6PA 1MIUA 4LFAQ 1YZ6A 4UY8C 2GN5A 2WFWA 1TXYA 1GM5A 1EU3A 1A63A 2Q2IA 1H9SB 4LF5L 1I3QH 5T1GA 5FO9B 2R7ZB 1RHPA 5C5MA 3HOXB 5BN5A 1EY5A 2DY8A 2O5JC 2A1AA 1OXXK 1B3QA 2JN4A 2BOSA 1S72A 1FVIA 3PUWA 4KK7A 5IOCA 3RLNA 1PV4A 4IN3A 2IJ0A 2RKSA 1BCPD 4YWMA 1SAPA 4XT3B 1U4MA 1I4GA 1IYJB 4GN4B 4OONA 1K83B 1SBBB 4XQQA 2NBFA 4R4IA 5IWAQ 5JPNC 2ZM6L 3DEPA 4C3HH 1PH8A 2AKWB 2VL6A 1JMCA 4FP5D 4K8IA 4QUCA 4RAUC 3URYA 4JI2Q 1SE8A 2PQAA 4A3IH 2L12A 4FF4A 2BE5C 3KF8B 4V0BA 2YU9H 4R4OA 2MHVA 4P75A 2F0IA 3CW2C 1BR9A 4R1JA 4P71A 4BY7H 4A3CG 4B3MQ 3E0EA 4P72A 1JOKA 4UDUC 1ZYRC 4DK6C 2MUYA 3A8JE 3I90A 3AMUA 5IP9H 4HCSA 3PIO3 1M1KC 3A7LA 4FDBA 4LFCQ 1HR0Q 1L0YB 4GN3B 4XTCS 1IBLQ 3H0GH 1F2MA 2K14A 2NVQH 3MEHA 5DAUA 2I07B 1PTOD 2F0KA 1ML0D 2BE5D 4YCWA 3A5ZB 4JI3L 2F4VL 1CK1A 3S2DB 2XRQD 1YNND 2NVTB 2EQSA 1RDPD 2JP1A 4JPBW 2B2UC 4GKJQ 3DLLA 4KKSA 2R92G 4A3GB 2VNUD 4APVA 4OWWB 1H9MA 2FFKB 1P8LA 3U4ZA 3PUYA 2N78A 1GHKA 5M3MH 3TEHB 1STEA 3TREA 5C4XH 4KN7C 3R8BA 4KJOA 2VQEQ 1SMYD 1T5XD 1O7LA 4YHHL 3ULJA 4IFDG 3DHQA 1V1QA 3OHXC 3GTJH 4CDCC 2KOLA 1STBA 2F0VA 1N36Q 2BCOA 2JA7H 1JOOA 5E7NA 4CDEC 2EPBA 4DNIA 4ZQ3A 4F8MA 2Z4HA 1FL0A 5LMNL 1RCVD 5C44H 5I9PA 3K0YA 5T1IA 4A4IA 1HXYD 2ES2A 1CHQD 1KHIA 3BDLA 1VQHA 1EY9A 2F0QA 4NB3A 1K8AC 2R61A 1HUNA 4M1UB 4KI0A 2A68C 4IFDJ 1D5ZC 1HA5A 4KKTA 2ZTDA 1F77A 1KTKA 3MXNB 3H3VC 2KEDA 4JYAQ 2AQ3B 1PVOA 4CBVA 4X64Q 2K50A 3VR4A 1D7QA 2F03A 3M4QA 2NVXH 1N34Q 2WAQG 1PYWD 1WD1A 4HJ9A 4LUVA 5G3LF 4KY6A 1S4ZA 3ERSX 5C0XG 3OMGA 3JAMi 2ATWA 3HOZG 4JI1Q 2QILA 4BY7B 1TY0A 5FJ8H 2OWOA 2NN6H 1I4QA 2AQ1B 1E24A 2K05A 2OT2A 1GO3E 2KVMA 1ILQA 2EIFA 2Q2TA 3TP5A 1LABA 1EY8A 3P20A 4JV5L 2JXMB 3EVQA 2HIVA 1FNUA 2LXKA 1JWMD 3CRLC 2NUCA 5GROA 4EGVA 2VS1A 3VYUA 1P16A 1LT6D 3T1HL 4YCUA 2PW5A 4A3KB 3MFGA 1ENAA 1STHA 2KHJA 2NN6G 1STNA 3J7AF 5IGEA 4Y7NH 1E3PA 2CH4W 2ZXOA 2MNAA 3E9IA 1BUVT 1SNMA 4JOIC 3NP8A 1S5CD 1CA6A 1HZ9A 1PYSB 4A75A 1QVGA 3FKIB 2JA5G 2RSNA 2F0TA 1S5BD 2EXDA 1VQGA 3PIOA 2QA4A 2DJFC 5BN4A 3KLWA 4LF4Q 2N49A 1HR0W 3S1QH 1L1OC 4ZCKA 4JI7L 3PUXA 3UDIA 4NKLA 1S5ED 1TS5A 4DUZL 5IYDG 1EY6A 2R93H 5E4XA 1R9TB 1ESFA 4IPHA 4I65A 1PFNA 3V96A 4QUFA 3J7A5 2CVRA 1G2TA 1SMXA 1E1TA 1JOQA 3JC66 5JPMC 2CQOA 3E6ZX 2JA6H 4L63B 1D6EC 1BBWA 4DAYA 1HA6A 5JJLA 3MFYA 5BR8Q 4CHTB 3L9AX 3ONAB 1EIHA 1TWHB 5FLMH 1I3QB 3CCUA 3S2HB 3DWAA 1CI3M 1S3OA 3W5OA 2B8FA 3CXCA 3CCMA 3L0OA 4MZ9A 2N88A 3AB9A 2B2WA 4A3BB 5IT9c 1B4OA 2KENA 2ZJQA 1PZKD 3D6CA 5CC4A 2PZTA 4UP7A 4WFN3 1SSOA 2FMCA 2JA9A 2LXJA 1LTAD 2AWNA 2A6ED 3H91A 5EPJA 5IGFA 2KBNA 1STGA 4RCOA 5L37A 3EQLC 2K75A 2M2LA 2I0QA 1SNQA 4MN3A 3QOJA 2K5QA 3JAML 2KEEA 3HKSA 1GUNA 3CC4A 3B6YA 1FYCA 2EOTA 2JA5H 1FGUA 4LJZC 3GTGB 2L9HA 4QCLA 1O7ZA 1VS0A 2A6HC 1CSPA 2IWHA 4RHRA 3H3VH 2PI2A 4OHJA 4DR1L 4LF7L 3SHLA 1EQVA 1V43A 1CKOA 1LUZA 4I7AA 4JBJA 3GTLB 4DV0Q 1I4RA 4KJNA 2IHFA 3M4PA 2IX1A 2B2YC 2NN6I 1FNVA 4AQYQ 2R92B 4A3GG 3MTSA 3RZDH 4LNQA 1JE4A 1A3TA 1YHQA 1J5EL 5ELNA 4N9PA 3D31A 3TRZA 3EJIA 1LO5D 3BVZA 1K28A 3F2BA 1WTVA 4R8IA 2HQLA 1PRTB 2LY7A 5AJ3Q 2QCPX 1N32L 1PYBA 2B39A 1ENCA 4BXXH 5CV4A 2HUGA 4OGQC 4EQ5A 4CKBA 4JI6L 4B3RL 3I4MH 1IKLA 1RODA 2WKCA 1B9MA 4JI1L 4A93G 3LGJA 1EYAA 3NBHA 3GTLH 1KXLA 3CCSA 3TP7A 2OEOA 3E0JA 2A74C 3NEMA 1NE3A 3T53B 2B2VC 1PHJA 1QNUA 4FXDA 3KJOA 4BBSG 4OXPA 5IYBG 4IUUA 1EWCA 1QJOA 3I72A 4JI8L 2MFIA 4P2CB 3S1QB 4BBRG 3PCOB 2N8NA 2JK8A 3KBXA 3SK8A 3G7LA 1BBXC 1SDFA 1IBKQ 3KJPA 1L1OB 1TS2A 2YTVA 1UNSA 1WCMH 4EX5A 4LF8L 3N52A 1KAAA 1ZYRD 1R9TH 3J80L 2XWBB 5EPKA 2WAQB 1U4RA 4LK1C 3NHHA 1M8AA 2E2JB 1EWHA 1JORA 4X6AH 4X62Q 1QE6A 1STAA 1CQVA 3QR8A 5ELDA 4BY7G 2L4NA 3TZDA 1K3BC 2WB1G 3S2HH 2B63G 1OXTA 2WB1E 5DM63 1TT2A 1HQMC 4A3FG 1VQCA 2Q8TA 4DXFA 1JB7A 1MD2D 4YY3Q 1JWSD 4BY1G 3HOVH 3S1NH 4L5TA 4A3KG 3K5NA 1AW7A 1SN8A 3HG9A 4Q5VA 4PMBA 5CV8A 3KF6B 3S16B 1V8QA 4A3KH 5KNCA 1GVPA 3RZOH 4GLAC 4HEDA 4PZ7A 3SR1A 1T9HA 1HRJA 1DYQA 2F4VQ 1TR5A 4J8QA 4DNTB 2F4IA 1HZAA 1V1PA 3A56A 5LMUQ 3A55A 2KCTA 4CJ0B 4X65Q 1EOVA 1KNEA 3FKIH 1EZ8A 4B3ML 4B08A 3GTQB 4YIJA 4NW2A 1NCVA 5BN3A 4X3UA 1TKWB 4XYQA 2F0PA 3I4LA 1BVSA 1NMGA 3UE0A 3DXJC 2AHOB 3S17H 3U9OA 3J7YW 3K58A 1XNRL 1ICWA 4OELB 3A5UA 4I7ZC 4QL5A 1QVCA 3D4WA 3QOLA 5KIXA 1W6KA 4DAVA 4R4CA 3SVMA 1B8AA 1PRTC 1E2VA 4H13C 1KC8C 4ZLTF 1X3GA 3A8IE 3I73A 5J22A 4G57A 1JWUD 2JYOA 1PTOC 4DR2L 4GN5A 3DUZA 2I5HA 4C3JH 4BBSH 1CZWA 1GUTA 2AMCB 2L0CA 3RR5A 3CKIB 1TS3A 5IE8A 1JC7A 5KNDA 3M9BA 4H44C 1CKNA 2KCCA 3R3OA 4IUTA 3Q24A 2B2TC 3CHBD 1IW7D 3NXWA 5C44B 1Y1WB 4PG3A 4A3BG 3VR2A 1AE3A 3PF5A 1F9RA 1SJHD 3PUZA 2JA7B 2B2WC 4C3JB 5FLMG 2VW9A 1VQMA 4BXXG 4LF5Q 3AEVA 1KIXA 2PNRC 3FVQA 5LHY1 2DNCA 2NZOA 4TSSA 2CKZB 5JVH3 1SNDA 1DCZA 5JAVA 5IYCH 1EL0A 3C3LA 3R2TA 3CCEA 3KFUA 2PQEA 4TQUS 5IT9E 1LTBD 4R9WA 3UI2A 2L11A 4A3JH 3HEJA 2Z8LA 1KD1C 1TWAB 4QQBX 2NVTH 2HQEA 2R7FA 4UHVA 1AFPA 3I56A 1NR2A 4DAPA 1I50B 3NQTA 3NTHA 2UXCQ 1IXRA 3W1GA 1C8CA 4GNXC 1SMYC 1EYCA 2K6AA 1UEBA 1K8OA 4AYBB 3HRZC 3RD4A 1RIPA 3EN2A 1XMOL 4B9WA 3HKZB 5K36H 2SNSA 5IYBH 2A8VA 2AUKA 4ID6A 4JI7Q 2E75C 1IL8A 1EQQA 5C4XB 5CV9A 4A3EB 1EUJA 3CC7A 3VR5A 3IFDA 3VR3A 2G5DA 3RLOA 3H3VI 3WDNA 5D3IB 3MWYW 1U5KA 4WJ4A 2RHSB 1LTID 4IQZA 4DA2A 2A69C 3EBEA 3EA6A 3I70A 1NUCA 4YCVA 3KOJA 1Z9FA 4C56C 3QIAA 4GKKL 2BDNA 1A3UA 1F9PA 1FR3A 3T1HQ 2Z4IA 2RSOA 2PPBC 4A3FH 3NTKA 4FXKC 4ULLA 1N33Q 1B9NA 5IGBA 1MBYA 4BBRB 3K59A 2ZTCA 4GLVB 3J80E 4V190 1SNPA 3CD6A 2M00A 3GQBA 1YI2A 1SEBD 3BZDB 2E2JH 5LMUL 3LX0A 1BNZA 3M3YH 3NQIA 4DR1Q 4LF7Q 1V1OA 4J1MA 1MGSA 5GAHC 3GD7A 2J4XA 5FO8B 1WTXA 3PO2B 3N6RA 3S1MB 4KHVA 1WTPA 4Z9CB 2K5HA 1KDCA 2PW7A 4EVOA 3R2IA 1A2UA 1VQOA 2QEJC 4JBMA 3P75A 1SYGA 2DJGC 3KYHC 2WB1B 2JA8B 1D1IA 1VF7A 3I8ZA 3IFTA 2RDFA 4FYDA 1ILPA 3Q6SA 1VQEA 1V9PA 3D4RA 3RNUA 1QZGA 3S14B 2PO4A 4JI5L 1PXUA 1E7ZA 4RCNA 5C3EB 5CV5A 1RF2D 4HSPA 1LT4D 2XWJB 2EYPA 4A3LH 3UE1A 3CAMA 2VUMB 2UUAQ 2FJ2A 4BS9A 2KA7A 4DU9A 1BF4A 4A93H 1X9NA 2SEBD 4NMZA 2OCEA 4MNOA 2M9VA 1WTWA 3NWSA 4K2LA 1RL2A 2L15A 1EFID 4DV1Q 5LL6X 5C3WA 1I6HB 3CRKC 1IW7C 3PIPA 3CCVA 3J80c 2ASBA 1XNQQ 4IPDA 4PMCA 3KF6A 5D14A 4BWGB 2A73B 2K28A 3VA7A 1TWCB 2F0WA 2Q8IB 2D0PA 4HJ5A 4G7HC 5M3FB 1HHVA 4HR7B 3J81i 5C4JB 3OW7A 2PI2E 4IURA 1EIGA 1E1OA 5I2YA 2K04A 4WJWA 1AN8A 2VQFQ 5C0XH 4HIMA 3G71A 4RKBA 1UE5A 3IRBA 4A3LG 4XIGS 5C4HA 1VF5C 5EQ0A 1N9WA 4ZAIA 2PZWA 1HCZA 4PQXA 5NUCA 1C48A 2A69D 3J7ZC 2FXQA 4A3MH 2K4KA 1F9QA 2YTYA 4OEMB 3MEFA 1XPOA 1SYCA 1S5FD 3J80i 1NNXA 3H0GG 1KRTA 4C1NI 2GA4B 4A3MG 4UAIA 2PYKA 1NMFA 3OSOA 4H0LC 5IP9G 3BVMA 5TSSA 3RMHA 3CMEA 4JI3Q 1Y1VB 2F0GA 4RGOS 3M85A 1C9OA 1LTTD 3OYYA 2QDLA 1I4XA 2HCCA 3X3NA 2Q8RE 1G8ZD 3DWPA 4C3IB 3NK9A 4HN7A 3HOWB 4LUZA 2YU9B 3HOVB 3S1NB 1KNAA 3NE5B 4E6IA 2RCFA 2LSSA 4LAAA 4A76A 2JA7G 4IJLA 1XWEA 5KYLA 1TWHH 1GUGA 4NXML 1G2SA 4KY7A 1GKHA 1Q82C 3QG1A 4OX9Q 1VQFA 4K5WA 1WD0A 3K6OA 4DUZQ 4DV3L 4NPSA 5ELEA 2E74C 3VYSA 3V2TA 3VR6A 3PGZA 1NBWA 1NJIC 5F2DA 1TWFH 1C7YA 5CBEE 3CU7A 3IAYA 4FXGC 2GVAA 4B3SQ 1SXTA 1PTOH 1PH2A 5K36G 2ZXRA 3HOXH 4HMIA 3NELA 4RGMA 5CV6A 4B3SL 3L7ZC 3KUPA 5DNFA 2R7DA 1TQOA 3SE0A 1BCPB 1F2YA 1JR0D 4H02A 3HOWH 2UXDL 4A3JG 2K52A 4LFBL 1JT8A 1EYDA 2UU9L 3ICEA 4CDFC 3BYTB 4OIJA 2MO1A 1D5XC 4LFCL 2N3SA 4LFAL 1H9KA 1L1OA 1Q46A 1V1PB 2MP1A 1MSHA 3SGIA 4EQNA 1YHBA 5EGTA 5JOBA 1D8LA 4EQPA 1J8IA 2K01A 3K7AB 1D5MC 1I94L 1HTLD 2E76C 1TWCH 3J81L 1AZQA 1SYFA 3FDTA 4DR3Q 2TMPA 4G7OC 4ZUIA 4HJAA 2UUCQ 1I6VC 1SE2A 3TDQA 2K32A 4JI4L 4IZ8A 4HAEA 5IT9L 3CQZB 1OTCA 2F0OA 1KLGD 4KMUC 3A0JA 3SK5A 2IT1A 3GV6A 4HJ8A 4DV2Q 4KY5A 3PV0A 5JJKA 1O80A 1JICA 3MAQA 3HGBA 3S9WA 1X3PA 4PMWA 4BA1I 3GV3A 4XDXA 5GAGC 3G48A 4LF9Q 1QUQB 4YWKA 4YWLA 4DXGA 3S14H 2LMCB 1QWYA 3T56B 3HOYH 2EY1A 2F0EA 4JI4Q 2B63H 3MZ5A 3KDFB 1C0AA 2H5XA 1W2BA 1XTCD 2MJ8A 4BA2I 4DR6L 2ZJPA 1CA5A 2VUMH 1UWVA 3NTIA 2E2DC 4N8FA 4RMFA 2ALYB 2JA8G 3BVGA 3TZUA 1Y69U 1J5EQ 2JSOA 3J81j 2V1CC 5ISRA 1AEXA 1Z6HA 4H7BA 5C3EG 4DF7A 4AH6A 1N33L 1K3RA 1MHWC 1N36L 1MJCA 1U4LA 5IP7H 2H4OA 1UEAB 1K0RA 5IYCG 2VUMG 4A3IG 1EY0A 4LF6Q 1A6XA 4JBWA 2I5LX 4BBRH 1PLFA 3BS1A 4IUQA 4DV6Q 1G291 4R8NA 3M7NA 3S1MH 5IWAL 4C3HG 1KL9A 2JEBI 3PF4A 4DR5Q 1WOCA 2K5VA 2RF4A 4DV5L 4GZYC 1SNCA 1FJGL 2EE1A 4HIOA 3RUZA 2EXZA 5DLQE 5CGKA 1DGSA 1SR3A 5JJZA 1SFOB 1NTGA 1L2FA 3Q23A 4JI6Q 1L0WA 2HHHL 1EQRA 1VQKA 5KNBA 2F0MA 2D9UA 2EDGA 1EEID 3I55A 2UXCL 3I91A 1IHZA 3O13A 1A2TA 1BCPC 3NBHB 3T1YQ 2B2TA 1MI2A 4CKEA 3FRPB 2E2HB 2D2CC 1RJTA 4K6LA 1HZBA 2RHQB 1Z7TA 4OO1G 3T4AC 5H1SE 1F9SA 3CP0A 1C4QA 1EEFD 1Q8IA 4DV1L 3K5MA 4DAYB 4RFBA 2VB3X 3HS0C 4A3EH 1KRSA 5C4ZA 3DM1A 3MA2B 5CORA 1RKNA 2OXPA 2O2LD 4O1NA 1A8VA 1OO9B 2JJQA 4DR6Q 1XTDA 3EIVA 3I2ZA 4MHEA 1I4PA 3TBIB 4C3IG 2JE6I 3FKIG 4CGYB 4TVAB 1VQ7A 1CUKA 3AFPA 1X6OA 3HOYG 5J3BA 2BA0A 1OXUA 4C1NK 5G3LD 4RKLA 2IHEA 3FPPA 5EBDA 4JOIA 3J81c 5A35A 1TWAH 5IIFA 1HTPA 5GADC 2SDFA 3FMCA 5JVG3 2A6HD 2F52A 2HDMA 1VQLA 4GOPB 1QNKA 4JVZA 5FK9C 1DOLA 1SFOH 1PH5A 3QO2A 2XNAC 3PQIA 4M8AA 4DR4L 1EWIA 1VQIA 1U0LA 1Y1WH 2OTJA 1PH4A 3MXUA 1WJJA 1VQDA 1CHPD 3AFQA 3S1RH 2RCNA 1VMCA 3VYTA 2VXWA 3AQQA 4KTAA 1GXDC 4CDDC 2NTSA 3TS0A 2VQFL 2DNEA 3E5SA 3ERQA 4J6HA 1WFQA 2OF1A 3GTJB 1ENFA 2PNHA 4UP8A 4C2MB 4KN4C 3RN5A 3U50C 1B3AA 1VQ8A 4UPAA 1Y14B 2F0UA 2X6LA 1GHJA 4NXMQ 2UUBQ 1AZPA 1JJCB 4DNRB 4HMJA 3PO3G 4L8JA 1EY7A 1IKMA 1PRTF 5GQOA 2R93G 1IYUA 4A3GH 1B53A 3QB3A 1DM0B 2KHSA 1WTOA 3D6WA 1YEZA 4FF1A 2K5WA 4L5QA 2Z6KA 5ELCA 2I46A 2IPKD 1PH9A 1YJ9A 5ELBA 2YTXA 2F3IA 3J7AV 4IUNA 1U4PA 1Q7YC 2B29A 1DONA 1WI5A 1WTHA 4ABNA 1EOTA 2CH4A 4X66Q 1CM9A 1LM0A 2NVQB 3HOXG 2CW0D 5M5XB 4L5SA 1Q12A 1LACA 3HOUG 1ASZA 4X3KA 2KHIA 1YNJD 3PO2H 5FLXc 1I4HA 1OXSC 3D4DA 1CFMA 1H9RA 3W2DA 3ER0A 5AFWA 2Q2HA 1WTQA 2K5DA 2ZJRA 2EZVA 4DN4M 3W1BA 4LMQD 5FO7B 1FGBD 2RVLA 2UXBQ 1ASYA 1PZJD 3CQZH 1IZ6A 1M90C 1DOMA 2ICIA 3MHBA 3C2PA 2JA6G 5KGUA 1K73C 1X3QA 2HD3A 1TIID 3K5LA 3PUVA 5K5PA 4GKKQ 1X65A 3OOCA 4MTNA 5IYDH 3K57A 2LKVA 2EJFC 3BZKA 2EY6A 5CR3A 4GNXA 1ZEQX 2NWGA 3GP7A 5CMDA 3RN2A 1Y8PB 1SE3A 3ZJYC 3WWVA 4GS3A 2CQAA 3SEBA 1H9JA 4ALPA 2WP8J 1TY2A 3BYYB 3EFXD 4FNFA 5ELFA 4RHSA 2E2HH 3U9SA 4X66L 2MPMA 1HPCA 3ND8A 4DV7L 4A3IB 2F0JA 2H1EA 2JQOA 3NPPA 5FLXE 1HNZQ 4RG1A 2E2IB 2ENBA 5CYUA 4DFAA 4X64L 4KHZA 3J81E 4FF2A 4C3HB 3OWEB 4GOPC 2HIXA 1WYDA 3BZCA 1X55A 2UUCL 4LWCA 1ZKOA 3GTMH 4KHPL 1A15A 3R93A 1IL2A 4O0AA 1YNXA 3IL8A 4PZ8A 5JJIA 3CCRA 3G4SA 2K1BA 4FVMA 4NP5A 2A19A 2L55A 4IUVA 1VQNA 1Q90A 2B63B 4OWXB 4F87A 3S15H 1PH6A 2R7ZH 4JI0Q 3CCJA 3E3XA 1O7IA 4N9TA 4O42A 4CKCA 5FJ8G 5M3MG 1XXGA 3GTPH 1TS4A 2PMZE 1CQFA 2C5CA 4BY1B 3I4OA 3MXNA 3OIQA 3TN2A 3OTOQ 1F2LA 2LFNA 4JI5Q 4LF4L 1Q8KA 3HOUH 2N55A 3HOZH 2FMMA 1IBML 2KCMA 3MVVA 1W3SA 1D2BA 3GTOB 3VYRA 2BDOA 1EIFA 2F3WA 2QKIC 3L2PA 3P1HA 4U673 2E5LQ 2BH2A 3EROA 1VQ4A 5KRUA 4MTKA 1IBMQ 1SYEA 1YVCA 1D1KA 3K8AA 4HIKA 3HOYB 5M5WH 1UE6A 1PMRA 5IGDA 1WTRA 1JJ2A 3C1FA 2Z1CA 2DY7A 1PFSA 4K5VA 1HR0L 2SOBA 2D5DA 2PMZB 1VQ9A 3CF5A 1HNWQ 3KLRA 1XPRA 1QCBD 3S17B 3M4YA 1B2TA 1LT5D 2XVSA 2RDHA 4F7XA 4A3CH 3K5OA 4L5RC 5C4JH 3Q22A 2MGSA 5M5WB 1BBUA 1MSGA 2Z9HA 3KBGA 3TSSA 1TVXA 2F0LA 4JCVE 4X62L 4IOAA 3Q0AA 4A3DB 2CHBD 2WKDA 2KCNA 3VDYA 1UAPA 1K0SA 1VQJA 3FEWX 3LWUA 4QIWB 1NR4A 4AQYL 3GTOH 4X65L 2F1MA 3NSWA 4IALA 4LF8Q 1PH1A 4ILWA 2O5IC 4ZYSA 2Z6KC 5I4DA 2EYHA 3CPWA 1N34L 2G9DA 5CV7A 3WOFA 3DEOA 3STBD 1B1ZA 4OO1I 1YIJA 1HNZL 3E9HA 1CKMA 2YV5A 3DMUA 3GTPB 5DM73 1Y1WG 3IKJA 2I5MX 4DUYL 4DV7Q 5FLXL 3T51B 4C3JG 4IFDI 3HP3A 1J9OA 1LV9A 3S15B 3M4OH 5E4WC 1T5EA 1E2WA 1DJRD 2FHTA 3K0XA 5M5YH 2NVYH 2KECA 4RH6A 5LL6S 1K8GA 4DV5Q 4P74A 2IX0A 2F0NA 1CTMA 2C9OA 3BJUA 2EYJA 2DUDA 5GAEC 5A2QE 1MJEA 1NY4A 4XT1B 4N8X1 3I3CA 1A0IA 4C3IH 3ZYYX 3HOUB 2J0TD 3ULLA 1SROA 4OO1H 1L0XB 3U4VA 4X3TA 5I2XA 1RTOA 1QOHA 3F8TA 3BU2A 1TWGB 2VQEL 4DV4L 1XX8A 4AYBE 4CJ1B 2Z0SA 4JV5Q 1JB3A 2UUAL 4WRDA 2NVYB 3D8GA 5IGCA 3GTKH 5M5YB 4AYBG 1YJWA 2CW0C 2XTIA 4XXEA 4IFDH 3I4NB 2UXBL 1LTRD 2JA6B 1Y8OB 1JQYD 4B3TL 4K2KA 5C4XG 1HFNA 1TWFB 2ID0A 3FPUB 4IUPA 1GUOA 3TS2A 2XSCA 1KLUD 3CPFA 2L5TA 5JEAG 2WAQE 3SDZA 4QB4A 5EKKA 1G91A 1HUMA 4JG2A 2K03A 1Y1VH 2RQXA 1JJGA 4GOPA 2ZXPA 2KJXA 4MIUA 2F0SA 4IPCA 1VCIA 2Y0SG 4K0KL 1NSNS 1IBLL 3K80C 1A3VA 1PRTD 3TP6A 4DR7L 2EJMA 5IP7G 1XMQQ 4O2DA 1ET6A 1OXVA 2DGYA 3CCQA 5D65A 1R4PB 1XJVA 5C3EH 3QJYA 3A7AB 2UU9Q 3G6JB 1LTGD 3F1ZA 1LYLA 3HFZB 1ESRA 4J15A 1CKNB 5EKLA 1ONLA 1YITA 2JA8H 1HNWL 1IYVA 3I7FA 4HCEA 3T16A 1BOSA 2AQ2B 3H6MA 1SYBA 2C35B 2F3VA 4POGA 1LLRD 4DK1A 2ZM6Q 5FKAC 3OPOA 1KDBA 1EFWA 5JEAH 1QVFA 4QJFA 3ITPA 5M3MB 4A93B 1DXMA 1B44D 1JE5A 4RA8A 3AU7A 1U9RA 2XIWA 3ND9A 2J7ZA 1HNXQ 5C6AA 1FJGQ 4GLXA 4BBSB 1Y8NB 2NZHA 3NWTA 1HFGA 5M5XH 4C2MH 1PA6A 1S40A 3WOEA
chains in the Genus database with same CATH topology
2EYMA 2IX3A 3KLSX 4KD4A 1AP0A 4OL7A 3S1RB 3LNNA 3NUCA 3TP8A 1EY4A 1BQQT 1S5DD 2PZUA 2WINB 4ZK9B 1CT1D 3H09A 4ZKBB 3M3YB 2A6EC 5HGTA 3JAME 1EQTA 1PFBA 5C5LA 1BO0A 5M9OA 2D62A 1K8MA 3OWFA 2EYFA 2EY2A 4RWSC 4A3FB 3H0GB 2YYZA 4TRDA 3RLFA 4ZRZA 1WVLA 4WORA 5COYA 4DK0A 1BCPF 2JEAI 1HQRD 2KQ3A 1KABA 4K6DA 4NDXA 4Y7NB 2X6GA 2RBMA 4ZUJA 1M4VA 2NZ1D 3T13A 5E3FA 4HSVA 2VB2X 1G6ZA 2F0DA 4ME5A 1XYIA 4ODGA 4OIKA 2RDGA 1RD9D 2PCFB 3L3OC 4HTHA 4PV1C 1GJXA 5A2QL 2WV6D 4G7ZC 1QILA 3A54A 1DD2A 1E0BA 3OIPA 3OMCA 4G4KA 2XRSD 3W3AA 2ICEC 2NVXB 2B8GA 1JCKB 1FD7D 2X69A 4FO2A 1SNOA 2QF7A 2NTTA 2R6GA 3BDOA 2XN9C 4A3JB 2B2YA 2ZT9C 3MXPA 1ZXTA 4XYOA 5E1FA 1DZ1A 3LWEA 4CJ2C 2FINB 1Q1BA 4F88A 2R3ZA 4TKOB 3BG3A 2HCIA 3SXHA 5DEHA 2A5HA 2G9HD 4ZKCB 2SNMA 1CZGA 5IGGA 4L6TB 2Y0SB 5FOBB 4FF3A 5EPLA 3H94A 4S3SA 3VA5A 1F2ZA 3D3RA 3KF8A 1O7YA 2IL8A 1E2ZA 5EJWA 5I6YA 1BXTA 5HURA 2F0FA 3GTKB 2HDLA 5KYIA 2B2VA 2V4DA 3DWQA 2L1BA 3X3MA 4JK1C 5J39A 2BA1A 4RGTA 1PTOB 3TMEA 3RZOB 1O78A 1II3A 3HZXA 1QB5D 1KDAA 3KK7A 1R4QB 1RTNA 1B50A 5I9OA 1ET9A 5I6WA 3PIP3 3GO5A 3QWNA 2KUMA 2LS01 1VMPA 4K5XA 3M4OB 1SYDA 1YNNC 2AUJD 4KV6A 4RGNA 5C0XI 4U68A 1SJED 4XQJA 1X32A 2DN8A 1LTSD 3GTMB 3A8KE 5JEAJ 2WIIB 2B2UA 1GOZA 1GUSA 4K8JA 1PZID 1GUWA 2A68D 5IODA 1Q3LA 1TU2B 1WCMB 2F0HA 2K33A 2WACA 3MC0B 1NAPA 2EYOA 4QF4A 3C1EA 4K14A 2EY5A 2AWOA 1QG7A 3M7GA 1H9SA 1Z47A 1PFMA 1W6JA 3PMFA 2QDBA 3I4MB 5D3DA 3SK6A 4XQNA 4PNYA 3C46A 3MXGA 1YNJC 5C3XA 3F2UA 3HOZB 1EZ6A 1VDZA 3RZDB 2NYZD 2IW3A 4EQOA 2K7VA 3P7JA 1FNWA 3SK4A 1STYA 4Q0FA 2RA4A 2EYLA 1Q1EA 2EVBA 3V05A 2TSSA 1UUPA 1PTOF 2NB0A 4DGZA 4B9XA 4A3MB 1EU4A 5C0XJ 1SE4A 3KLSA 5KEEA 3PO3B 4X3SA 5CBAE 3NBIA 1LT3D 4QMGA 2R93B 5EKIA 2O4XA 2JA5B 2EJGC 4KKUA 5EBCA 3BDCA 4KD3A 1PDQA 1BDOA 1DOKA 5J1ZA 1EU3A 1H9SB 5T1GA 5FO9B 2R7ZB 1RHPA 5C5MA 3HOXB 5BN5A 1EY5A 2DY8A 2O5JC 1OXXK 2BOSA 3PUWA 4KK7A 5IOCA 4IN3A 2IJ0A 2RKSA 1BCPD 1SAPA 4XT3B 1U4MA 1I4GA 1K83B 1SBBB 4XQQA 2NBFA 5JPNC 3DEPA 4FP5D 4K8IA 4QUCA 4RAUC 3URYA 2L12A 4FF4A 2BE5C 4V0BA 2MHVA 2F0IA 1BR9A 1JOKA 4UDUC 1ZYRC 2MUYA 3A8JE 3AMUA 3I90A 4HCSA 3PIO3 3A7LA 1L0YB 4XTCS 1F2MA 3MEHA 5DAUA 2I07B 1PTOD 2F0KA 1ML0D 2BE5D 1CK1A 3S2DB 2XRQD 1YNND 2NVTB 1RDPD 2JP1A 2B2UC 4KKSA 4A3GB 2VNUD 1H9MA 2FFKB 3PUYA 1GHKA 1STEA 4KN7C 3R8BA 4KJOA 1SMYD 1T5XD 1O7LA 4IFDG 3DHQA 3OHXC 2KOLA 1STBA 2F0VA 2BCOA 1JOOA 2EPBA 4ZQ3A 4F8MA 2Z4HA 1RCVD 5I9PA 3K0YA 5T1IA 1HXYD 1CHQD 3BDLA 1EY9A 2F0QA 2R61A 1HUNA 4M1UB 4KI0A 2A68C 4IFDJ 1D5ZC 1HA5A 4KKTA 1F77A 1KTKA 3H3VC 2KEDA 2AQ3B 4CBVA 3VR4A 2F03A 1PYWD 1WD1A 5G3LF 4KY6A 1S4ZA 5C0XG 3OMGA 2QILA 4BY7B 1TY0A 2NN6H 1I4QA 2AQ1B 2K05A 2OT2A 2KVMA 1ILQA 3TP5A 1LABA 1EY8A 3P20A 2JXMB 3EVQA 1FNUA 1JWMD 3CRLC 2NUCA 4EGVA 3VYUA 1LT6D 2PW5A 4A3KB 3MFGA 1ENAA 1STHA 2NN6G 1STNA 3J7AF 5IGEA 2ZXOA 1BUVT 1SNMA 3NP8A 1S5CD 1CA6A 3FKIB 2RSNA 2F0TA 1S5BD 5BN4A 3PUXA 4NKLA 1S5ED 1TS5A 1EY6A 5E4XA 1R9TB 1ESFA 4I65A 1PFNA 3V96A 4QUFA 2CVRA 1G2TA 1JOQA 5JPMC 3E6ZX 4L63B 1D6EC 4DAYA 1HA6A 3MFYA 4CHTB 3L9AX 3ONAB 1EIHA 1TWHB 1I3QB 3S2HB 3DWAA 1CI3M 2B8FA 2N88A 3AB9A 2B2WA 4A3BB 1B4OA 1PZKD 3D6CA 5CC4A 2PZTA 4WFN3 1SSOA 2FMCA 1LTAD 2AWNA 2A6ED 3H91A 5EPJA 5IGFA 1STGA 4RCOA 3EQLC 2M2LA 1SNQA 4MN3A 3QOJA 2K5QA 3JAML 2KEEA 1GUNA 1FYCA 2EOTA 4LJZC 3GTGB 2L9HA 4QCLA 1O7ZA 2A6HC 2IWHA 4RHRA 4OHJA 3SHLA 1EQVA 1V43A 3GTLB 1I4RA 4KJNA 2IX1A 2B2YC 2NN6I 1FNVA 2R92B 3MTSA 1JE4A 1A3TA 4N9PA 3D31A 3EJIA 1LO5D 3BVZA 1WTVA 4R8IA 1PRTB 2LY7A 2QCPX 2B39A 1ENCA 5CV4A 2HUGA 4OGQC 4CKBA 1IKLA 1RODA 2WKCA 1B9MA 1EYAA 3NBHA 3TP7A 2OEOA 3E0JA 2A74C 3T53B 2B2VC 1QNUA 4FXDA 4IUUA 1EWCA 1QJOA 3I72A 4P2CB 3S1QB 3KBXA 3SK8A 3G7LA 1BBXC 1SDFA 1TS2A 1UNSA 3N52A 1KAAA 1ZYRD 3J80L 2XWBB 5EPKA 2WAQB 1U4RA 4LK1C 3NHHA 1M8AA 2E2JB 1EWHA 1JORA 1QE6A 1STAA 1CQVA 5ELDA 2L4NA 3TZDA 1OXTA 5DM63 1TT2A 1HQMC 2Q8TA 4DXFA 1MD2D 1JWSD 3K5NA 1AW7A 3HG9A 4Q5VA 4PMBA 5CV8A 3S16B 1V8QA 5KNCA 4HEDA 3SR1A 1HRJA 1DYQA 1TR5A 4J8QA 4DNTB 2F4IA 1V1PA 3A56A 3A55A 4CJ0B 1KNEA 1EZ8A 4B08A 3GTQB 4YIJA 4NW2A 1NCVA 5BN3A 4X3UA 1TKWB 4XYQA 2F0PA 3I4LA 3DXJC 3U9OA 3J7YW 3K58A 1ICWA 4I7ZC 3D4WA 3QOLA 5KIXA 1W6KA 4DAVA 3SVMA 1PRTC 1E2VA 4H13C 4ZLTF 3A8IE 3I73A 5J22A 4G57A 1JWUD 2JYOA 1PTOC 3DUZA 1CZWA 1GUTA 2L0CA 3CKIB 1TS3A 1JC7A 5KNDA 4H44C 2KCCA 3Q24A 3R3OA 4IUTA 2B2TC 3CHBD 1IW7D 1Y1WB 3NXWA 5C44B 3VR2A 1F9RA 1SJHD 3PUZA 2JA7B 2B2WC 4C3JB 2PNRC 3FVQA 5LHY1 2DNCA 4TSSA 5JVH3 1SNDA 1DCZA 5JAVA 1EL0A 3C3LA 3R2TA 2PQEA 4TQUS 5IT9E 1LTBD 4R9WA 3UI2A 2L11A 3HEJA 2Z8LA 1TWAB 2HQEA 1AFPA 1NR2A 4DAPA 1I50B 3NQTA 3NTHA 1C8CA 1SMYC 1EYCA 2K6AA 1K8OA 4AYBB 3HRZC 3RD4A 4B9WA 3HKZB 5K36H 2SNSA 2AUKA 4ID6A 2E75C 1IL8A 5C4XB 5CV9A 4A3EB 3VR5A 3IFDA 3VR3A 3WDNA 5D3IB 3MWYW 1LTID 4IQZA 4DA2A 2A69C 3EA6A 3I70A 1NUCA 4C56C 3QIAA 2BDNA 1A3UA 1F9PA 1FR3A 2Z4IA 2RSOA 2PPBC 3NTKA 4FXKC 4ULLA 1B9NA 5IGBA 1MBYA 4BBRB 3K59A 3J80E 4V190 1SNPA 2M00A 3GQBA 1SEBD 3BZDB 3LX0A 1BNZA 3NQIA 1V1OA 4J1MA 1MGSA 3GD7A 2J4XA 5FO8B 1WTXA 3PO2B 3N6RA 3S1MB 4KHVA 1WTPA 4Z9CB 1KDCA 2PW7A 4EVOA 3R2IA 1A2UA 2QEJC 3P75A 1SYGA 2WB1B 2JA8B 1D1IA 1VF7A 3I8ZA 3IFTA 2RDFA 4FYDA 1ILPA 3Q6SA 3D4RA 3S14B 2PO4A 1PXUA 4RCNA 5C3EB 5CV5A 1RF2D 4HSPA 1LT4D 2XWJB 2EYPA 2VUMB 2FJ2A 4BS9A 2KA7A 4DU9A 1BF4A 2SEBD 4NMZA 2M9VA 1WTWA 3NWSA 4K2LA 1EFID 5LL6X 5C3WA 1I6HB 3CRKC 1IW7C 4PMCA 5D14A 4BWGB 2A73B 2K28A 3VA7A 1TWCB 2F0WA 2Q8IB 5M3FB 4G7HC 1HHVA 4HR7B 5C4JB 3OW7A 4IURA 1EIGA 5I2YA 2K04A 4WJWA 1AN8A 5C0XH 4RKBA 4XIGS 5C4HA 1VF5C 5EQ0A 4ZAIA 2PZWA 1HCZA 4PQXA 5NUCA 1C48A 2A69D 1F9QA 1SYCA 1S5FD 4C1NI 2GA4B 4UAIA 2PYKA 3OSOA 4H0LC 3BVMA 5TSSA 3RMHA 1Y1VB 2F0GA 4RGOS 3M85A 1LTTD 1I4XA 2HCCA 3X3NA 2Q8RE 1G8ZD 3DWPA 4C3IB 3NK9A 4HN7A 3HOWB 2YU9B 3HOVB 3S1NB 1KNAA 3NE5B 4E6IA 4LAAA 1XWEA 5KYLA 1GUGA 1G2SA 4KY7A 3QG1A 4K5WA 1WD0A 3K6OA 5ELEA 2E74C 3VYSA 3V2TA 3VR6A 5F2DA 5CBEE 3CU7A 3IAYA 4FXGC 1SXTA 1PTOH 5K36G 2ZXRA 4HMIA 4RGMA 5CV6A 3L7ZC 3KUPA 5DNFA 1TQOA 3SE0A 1BCPB 1F2YA 1JR0D 1EYDA 3BYTB 4OIJA 1D5XC 1H9KA 1V1PB 2MP1A 1MSHA 4EQNA 5JOBA 5EGTA 4EQPA 1J8IA 2K01A 3K7AB 1D5MC 1HTLD 2E76C 3J81L 1AZQA 1SYFA 3FDTA 2TMPA 4G7OC 4ZUIA 1I6VC 1SE2A 3TDQA 2K32A 4IZ8A 4HAEA 5IT9L 3CQZB 2F0OA 1KLGD 4KMUC 3SK5A 2IT1A 3GV6A 4KY5A 3PV0A 1O80A 1JICA 3MAQA 3HGBA 3S9WA 1X3PA 4PMWA 4BA1I 3GV3A 4XDXA 4DXGA 2LMCB 1QWYA 3T56B 2EY1A 2F0EA 3MZ5A 1XTCD 2MJ8A 4BA2I 1CA5A 3NTIA 2E2DC 3BVGA 3TZUA 1Y69U 2JSOA 5ISRA 1AEXA 1Z6HA 4H7BA 4DF7A 1U4LA 2H4OA 1UEAB 1EY0A 1A6XA 4JBWA 1PLFA 3BS1A 4IUQA 1G291 4R8NA 3M7NA 4C3HG 2JEBI 4GZYC 1SNCA 2EE1A 3RUZA 2EXZA 5CGKA 5JJZA 1SFOB 3Q23A 5KNBA 2F0MA 2D9UA 2EDGA 1EEID 3I91A 1IHZA 3O13A 1A2TA 1BCPC 2B2TA 1MI2A 4CKEA 3FRPB 2E2HB 2D2CC 1RJTA 4K6LA 1Z7TA 4OO1G 3T4AC 1F9SA 1C4QA 1EEFD 1Q8IA 3K5MA 4RFBA 2VB3X 3HS0C 5C4ZA 3DM1A 3MA2B 5CORA 1RKNA 2OXPA 2O2LD 4O1NA 1OO9B 4MHEA 1I4PA 3TBIB 4C3IG 2JE6I 4CGYB 2BA0A 1OXUA 4C1NK 5G3LD 4RKLA 3FPPA 5EBDA 5A35A 5IIFA 1HTPA 2SDFA 3FMCA 5JVG3 2A6HD 2HDMA 1QNKA 5FK9C 1DOLA 3QO2A 2XNAC 4M8AA 3MXUA 1CHPD 1VMCA 3VYTA 2VXWA 4KTAA 1GXDC 2NTSA 2DNEA 3E5SA 3ERQA 4J6HA 2OF1A 3GTJB 1ENFA 4C2MB 4KN4C 1B3AA 2F0UA 2X6LA 1GHJA 1AZPA 4DNRB 4HMJA 4L8JA 1EY7A 1IKMA 1PRTF 1IYUA 1B53A 3QB3A 1DM0B 2KHSA 1WTOA 3D6WA 4FF1A 2K5WA 5ELCA 2I46A 2IPKD 5ELBA 3J7AV 4IUNA 1U4PA 1DONA 4ABNA 1EOTA 1CM9A 2NVQB 2CW0D 5M5XB 1Q12A 1LACA 4X3KA 1YNJD 1I4HA 1OXSC 3D4DA 1CFMA 1H9RA 3W2DA 5AFWA 1WTQA 2K5DA 2EZVA 4DN4M 4LMQD 5FO7B 1FGBD 2RVLA 1PZJD 1DOMA 2ICIA 3MHBA 3C2PA 5KGUA 1X3QA 1TIID 3K5LA 3PUVA 5K5PA 3OOCA 3K57A 2LKVA 2EJFC 2EY6A 5CR3A 1ZEQX 2NWGA 3GP7A 5CMDA 1Y8PB 1SE3A 2CQAA 3SEBA 1H9JA 2WP8J 1TY2A 3BYYB 3EFXD 4FNFA 5ELFA 4RHSA 3U9SA 2MPMA 1HPCA 3ND8A 4A3IB 2F0JA 2H1EA 3NPPA 5FLXE 2E2IB 2ENBA 5CYUA 4DFAA 4KHZA 3J81E 4FF2A 4C3HB 3OWEB 1ZKOA 1A15A 3R93A 3IL8A 2K1BA 4FVMA 4NP5A 2L55A 4IUVA 1Q90A 2B63B 4F87A 4N9TA 4O42A 4CKCA 1XXGA 1TS4A 1CQFA 2C5CA 4BY1B 3MXNA 3OIQA 3TN2A 1F2LA 2LFNA 2N55A 2FMMA 3MVVA 1D2BA 3GTOB 3VYRA 2BDOA 2F3WA 2QKIC 3P1HA 4U673 3EROA 5KRUA 1SYEA 1D1KA 3HOYB 1PMRA 5IGDA 1WTRA 3C1FA 2Z1CA 2DY7A 4K5VA 2SOBA 2D5DA 2PMZB 3KLRA 1B2TA 1QCBD 3S17B 3M4YA 1LT5D 2XVSA 2RDHA 4F7XA 3K5OA 3Q22A 2MGSA 5M5WB 1MSGA 3KBGA 3TSSA 1TVXA 2F0LA 3Q0AA 4A3DB 2CHBD 2WKDA 2KCNA 1UAPA 3FEWX 3LWUA 4QIWB 1NR4A 2F1MA 3NSWA 4IALA 4ILWA 2O5IC 4ZYSA 5I4DA 2EYHA 2G9DA 5CV7A 3WOFA 3DEOA 4OO1I 1B1ZA 3DMUA 3GTPB 5DM73 3IKJA 5FLXL 3T51B 4C3JG 4IFDI 3HP3A 1J9OA 1LV9A 3S15B 5E4WC 1T5EA 1E2WA 1DJRD 2FHTA 4RH6A 2KECA 5LL6S 2IX0A 2F0NA 1CTMA 2C9OA 2EYJA 5A2QE 4XT1B 3I3CA 3ZYYX 3HOUB 2J0TD 4OO1H 1L0XB 4X3TA 5I2XA 1RTOA 1QOHA 1TWGB 1XX8A 4CJ1B 1JB3A 4WRDA 2NVYB 3D8GA 5IGCA 5M5YB 2CW0C 4XXEA 4IFDH 3I4NB 1LTRD 2JA6B 1Y8OB 1JQYD 4K2KA 1HFNA 1TWFB 2ID0A 3FPUB 4IUPA 1GUOA 2XSCA 1KLUD 2L5TA 5JEAG 3SDZA 4QB4A 5EKKA 1G91A 1HUMA 2K03A 2RQXA 2ZXPA 2KJXA 2F0SA 4MIUA 1VCIA 1NSNS 1A3VA 1PRTD 3TP6A 2EJMA 1ET6A 1OXVA 5D65A 1R4PB 3QJYA 3A7AB 3G6JB 1LTGD 1ESRA 5EKLA 1ONLA 1IYVA 4HCEA 3T16A 1BOSA 2AQ2B 3H6MA 1SYBA 2F3VA 1LLRD 4DK1A 5FKAC 3OPOA 1KDBA 5JEAH 3ITPA 5M3MB 4A93B 1DXMA 1B44D 4RA8A 3AU7A 1U9RA 2XIWA 3ND9A 2J7ZA 5C6AA 4BBSB 1Y8NB 3NWTA 1HFGA 3WOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VMP A;  1ML0 D;  1X3Q A;  1G2S A;  4MN3 A;  1AP0 A;  2KEE A;  2MJ8 A;  1ILP A;  3I8Z A;  2Q8T A;  1CA5 A;  3Q6S A;  1WD0 A;  2EOT A;  2JP1 A;  2B2Y A;  1WTR A;  1HFN A;  2SDF A;  2L9H A;  1O7Z A;  2DY7 A;  2B2U C;  2HDM A;  4X3S A;  5CBA E;  1EL0 A;  4U68 A;  1ZXT A;  3FPU B;  1QNK A;  4IUP A;  1DZ1 A;  1DOL A;  3QO2 A;  3LWE A;  4ZK9 B;  1X32 A;  5EKI A;  4CJ2 C;  2FIN B;  1B2T A;  4R9W A;  2NWG A;  3UI2 A;  2L11 A;  5CMD A;  1CA6 A;  4ZKB B;  2B2Y C;  2FFK B;  5CBE E;  2FJ2 A;  1BF4 A;  1G91 A;  2MGS A;  2B2U A;  1PFB A;  1VMC A;  1EQT A;  1U4L A;  1NR2 A;  1MSG A;  2VXW A;  1JE4 A;  1BO0 A;  1HUM A;  1PDQ A;  1DOK A;  1TVX A;  2K03 A;  1GUW A;  2RSN A;  1C8C A;  1WTW A;  1Q3L A;  2R3Z A;  1HRJ A;  1WTV A;  1PLF A;  4R8I A;  2MPM A;  1NR4 A;  4IUQ A;  1B3A A;  4RWS C;  2KOL A;  3KUP A;  5DNF A;  2H1E A;  5T1G A;  1NAP A;  2X6L A;  4CJ0 B;  2HCI A;  1RHP A;  3MTS A;  1AZP A;  1IL8 A;  2HUG A;  2EPB A;  1KNE A;  2DY8 A;  4HED A;  5D14 A;  1WVL A;  4ZKC B;  1IKM A;  2K28 A;  5COY A;  5T1I A;  2EE1 A;  4NW2 A;  1HHV A;  1IKL A;  1NCV A;  1ROD A;  4X3U A;  3IFD A;  4OIJ A;  4IUR A;  1EIG A;  5EPL A;  1B53 A;  2K04 A;  3DEO A;  5E4X A;  1SAP A;  4XT3 B;  1WTO A;  3D6W A;  1A15 A;  1U4M A;  1ICW A;  1QG7 A;  5D65 A;  3MWY W;  3R93 A;  5JJZ A;  1O7Y A;  2X6G A;  1PFN A;  2MP1 A;  1MSH A;  2IL8 A;  4QUF A;  2CVR A;  3IL8 A;  1G2T A;  1PFM A;  2B2V C;  5EJW A;  1J8I A;  2K01 A;  2K1B A;  5EQ0 A;  1U4P A;  4ZAI A;  1ESR A;  3DEP A;  1J9O A;  1LV9 A;  3HP3 A;  4IUU A;  5E4W C;  2KED A;  2NZ1 D;  1AZQ A;  1DON A;  2D9U A;  4IUV A;  2BDN A;  4HSV A;  2FHT A;  3FDT A;  3SVM A;  1G6Z A;  1HA6 A;  1F9Q A;  1F9P A;  1EOT A;  4QUC A;  4RAU C;  3I91 A;  3ONA B;  1EIH A;  4ZLT F;  2HDL A;  2KEC A;  2RSO A;  1XYI A;  1CM9 A;  3KBX A;  4O42 A;  2B2V A;  3G7L A;  2L12 A;  1BBX C;  4OIK A;  1SDF A;  2B2T A;  2JYO A;  1MI2 A;  2L1B A;  4UAI A;  1HUN A;  4X3K A;  1RJT A;  4HAE A;  3N52 A;  4XT1 B;  3F2U A;  3I3C A;  2N88 A;  1WD1 A;  1F9S A;  2B2W A;  1B4O A;  2NYZ D;  3TN2 A;  5EPK A;  3GV6 A;  5AFW A;  1S4Z A;  1U4R A;  1WTQ A;  4IUT A;  4RA8 A;  1BNZ A;  2B2T C;  2HCC A;  4DN4 M;  1M8A A;  2Q8R E;  3DM1 A;  3I90 A;  4HCS A;  4LMQ D;  1F2L A;  3P7J A;  1E0B A;  1MGS A;  1O80 A;  1SSO A;  5COR A;  4X3T A;  2XIW A;  1RTN A;  2N55 A;  1RTO A;  1F9R A;  1B50 A;  2FMM A;  1JIC A;  1QE6 A;  2K05 A;  2J7Z A;  2RA4 A;  2RVL A;  1WTX A;  3H91 A;  2KVM A;  1X3P A;  2B2W C;  5EPJ A;  1ILQ A;  3GV3 A;  4MHE A;  1KNA A;  4XDX A;  1DOM A;  2L4N A;  1XX8 A;  1HFG A;  3TZD A;  1WTP A;  4CJ1 B;  2KUM A;  2M2L A;  2X69 A; 
#chains in the Genus database with same CATH topology
 1YBY A;  2EYM A;  3CCL A;  3GDE A;  2IX3 A;  3KLS X;  4KD4 A;  1AP0 A;  1PH3 A;  4OL7 A;  4JI0 L;  4LF6 L;  3S1R B;  4OX9 L;  1KQS A;  3LNN A;  3NUC A;  3TP8 A;  2CWA A;  1EY4 A;  1BQQ T;  1S5D D;  2PZU A;  2WIN B;  4ZK9 B;  4IJH A;  1CT1 D;  3H09 A;  2VZA A;  1KAW A;  1B7Y B;  4ZKB B;  3DM3 A;  3KDF A;  3M3Y B;  2A6E C;  2D0O A;  5HGT A;  3JAM E;  3K7U C;  4KHP Q;  1EQT A;  1PFB A;  1WCM G;  4IO9 A;  5C5L A;  3GTQ H;  1BO0 A;  5M9O A;  2B3G A;  1HNX L;  2D62 A;  1K8M A;  1N8R C;  3OWF A;  2EYF A;  1AH9 A;  1X3E A;  2EY2 A;  4A3D G;  4RWS C;  1X56 A;  4A3F B;  3D0F A;  2YYZ A;  3H0G B;  4TRD A;  3RLF A;  4ZRZ A;  1WVL A;  1I50 H;  3ULP A;  4WOR A;  5COY A;  1Y1V G;  4DK0 A;  1BCP F;  5ELO A;  1K83 H;  2JEA I;  1HQR D;  2KQ3 A;  1KAB A;  4JYA L;  1G51 A;  2QGQ A;  2CFM A;  4K6D A;  3I4M G;  4NDX A;  4Y7N B;  2X6G A;  1MKH A;  2RBM A;  4ZUJ A;  3HOV G;  1M4V A;  1XNQ L;  2NZ1 D;  3T13 A;  3S2D H;  5E3F A;  4HSV A;  1X54 A;  2VB2 X;  4R4Q A;  1G6Z A;  2F0D A;  2MQH A;  3Q8D A;  4ME5 A;  1XYI A;  4ODG A;  2E8G A;  4OIK A;  1B70 B;  2RDG A;  1RD9 D;  1X3F A;  2PCF B;  3L3O C;  4HTH A;  4PV1 C;  1GJX A;  5A2Q L;  1Q86 C;  3HKZ E;  4DV0 L;  2WV6 D;  4G7Z C;  4LFB Q;  1QIL A;  3TQY A;  3A54 A;  1IBK L;  1SLJ A;  1DD2 A;  3G6E A;  1E0B A;  3OIP A;  4KLK A;  1K9M C;  4JI2 L;  1XPU A;  3OMC A;  2OTL A;  4G4K A;  2XRS D;  4IOC A;  3W3A A;  2ICE C;  2NVX B;  2P5Z X;  2B8G A;  1JCK B;  5HGQ A;  4DKA C;  2HT1 A;  1FD7 D;  2X69 A;  4FO2 A;  1SNO A;  2QF7 A;  4AIM A;  2NTT A;  2R6G A;  3BDO A;  2XN9 C;  4A3J B;  2B2Y A;  1HH2 P;  2ZT9 C;  3MXP A;  3I4N G;  1ZXT A;  4XYO A;  5E1F A;  1DZ1 A;  1QUQ A;  3LWE A;  4CJ2 C;  2FIN B;  3UDX A;  5C44 G;  1YHA A;  3PO3 H;  1Q1B A;  4DV3 Q;  1H95 A;  3K81 C;  2XGT A;  4DR3 L;  2QW7 A;  3CC2 A;  4F88 A;  2IY5 B;  2R3Z A;  2R7Z G;  1SRU A;  4TKO B;  3BG3 A;  1CSQ A;  3NEN A;  3FP9 A;  2HCI A;  3SXH A;  5DEH A;  2A5H A;  1VQB A;  2G9H D;  4POF A;  4ZKC B;  4LUO A;  2SNM A;  3UDF A;  2R92 H;  1CZG A;  5IGG A;  3K7A H;  4L6T B;  2Y0S B;  5FOB B;  4YHH Q;  4FF3 A;  5EPL A;  3F2D A;  3H94 A;  4S3S A;  3VA5 A;  1F2Z A;  3D3R A;  2CCZ A;  3KF8 A;  1O7Y A;  2IL8 A;  4IPG A;  2HHH Q;  3CMA A;  1E2Z A;  5IY0 A;  5EJW A;  4JBK A;  5I6Y A;  1BXT A;  1VQP A;  2GVB A;  5HUR A;  2F0F A;  3GTK B;  4GKJ L;  5LMN W;  3HKZ G;  2HDL A;  5KYI A;  2B2V A;  4YY3 L;  2V4D A;  3DWQ A;  1J6Q A;  2L1B A;  3X3M A;  4JK1 C;  5J39 A;  3U58 A;  3AYH B;  2BA1 A;  4A3E G;  1EYG A;  4DK3 C;  4RGT A;  1PTO B;  3FHW A;  3TME A;  4OWT B;  3RZO B;  1O78 A;  1II3 A;  1N32 Q;  3HZX A;  3S16 H;  1QB5 D;  1KDA A;  3KK7 A;  1R4Q B;  1RTN A;  4JW0 A;  1B50 A;  1YJN A;  5I9O A;  1XNR Q;  1ET9 A;  5I6W A;  4DAM A;  3PIP 3;  3GO5 A;  4QY7 A;  4DR7 Q;  1BKB A;  3QWN A;  5HY6 A;  2KUM A;  2LS0 1;  2UUB L;  1PH7 A;  1VMP A;  4R4T A;  4K5X A;  4K0K Q;  4QGU A;  3M4O B;  1SYD A;  1YNN C;  2AUJ D;  2CWP A;  4KV6 A;  3T1Y L;  4RGN A;  5C0X I;  4U68 A;  4HID A;  2ZTE A;  1SJE D;  4XQJ A;  4WJ3 M;  4JI8 Q;  1LTL A;  1X32 A;  2DN8 A;  2UXD Q;  1LTS D;  3GTM B;  1AE2 A;  3A8K E;  2E5L L;  4LF9 L;  5JEA J;  1VQ6 A;  4Y52 H;  3PO2 G;  3JAM c;  2WII B;  2B2U A;  2MO0 A;  1GOZ A;  1ICF B;  1GUS A;  4DR2 Q;  3I4N H;  4K8J A;  1PZI D;  1GUW A;  2A68 D;  5IOD A;  1Q3L A;  1TU2 B;  1WCM B;  1VQA A;  2F0H A;  4DV2 L;  2K33 A;  1VQ5 A;  4B3R Q;  2WAC A;  1TWG H;  3MC0 B;  4GNX B;  1NAP A;  4QIW E;  2EYO A;  4DR5 L;  4QF4 A;  3C1E A;  2Q2U A;  3S24 A;  2QEX A;  4HJ7 A;  5EAY A;  4DV6 L;  4P73 A;  4K14 A;  2EY5 A;  2AWO A;  1QG7 A;  3M7G A;  5BR8 L;  5LMN Q;  1H9S A;  1Z47 A;  1PFM A;  1W6J A;  3PMF A;  2QDB A;  3I4M B;  4PZ6 A;  5D3D A;  1UE7 A;  1XMQ L;  3SK6 A;  3H15 A;  1UE1 A;  4XQN A;  4PNY A;  3C46 A;  1HJP A;  1I5F A;  3STB C;  3MXG A;  2K5N A;  1YNJ C;  4ME3 A;  4NXN Q;  1HZC A;  5C3X A;  5M3F G;  3F2U A;  3HOZ B;  4DR4 Q;  1EZ6 A;  2BH8 A;  1VDZ A;  3RZD B;  2NYZ D;  2IW3 A;  4EQO A;  5M3F H;  4DUY Q;  2K7V A;  4A3B H;  3P7J A;  4BY1 H;  1FNW A;  3SK4 A;  1STY A;  1XMO Q;  4Q0F A;  2PQA B;  2RA4 A;  2EYL A;  1I6H H;  1Q1E A;  2EVB A;  3V05 A;  3OTO L;  3UDG A;  2TSS A;  1UUP A;  1PTO F;  3GTG H;  3OW2 A;  2NB0 A;  1Q81 C;  1E22 A;  4DGZ A;  1A62 A;  4A3D H;  3PSI A;  4JC0 A;  4B9X A;  2Z6B A;  4NXN L;  4A3M B;  1QZH A;  1EU4 A;  4B3T Q;  5C0X J;  1SE4 A;  3KLS A;  4DPG A;  2Y0S E;  5KEE A;  1GD7 A;  5AJ3 L;  4UP9 A;  3PO3 B;  4X3S A;  5CBA E;  3NBI A;  1I94 Q;  1LT3 D;  3A74 A;  4QMG A;  2R93 B;  5EKI A;  4DV4 Q;  2O4X A;  2OQ0 A;  1EIY B;  3F2C A;  2JA5 B;  2EJG C;  4KKU A;  3HOW G;  5EBC A;  2VY3 A;  3BDC A;  4LW1 A;  4KD3 A;  1PDQ A;  2E2I H;  1BDO A;  1DOK A;  5J1Z A;  2OQK A;  1G6P A;  1MIU A;  4LFA Q;  1YZ6 A;  4UY8 C;  2GN5 A;  2WFW A;  1TXY A;  1GM5 A;  1EU3 A;  1A63 A;  2Q2I A;  1H9S B;  4LF5 L;  1I3Q H;  5T1G A;  5FO9 B;  2R7Z B;  1RHP A;  5C5M A;  3HOX B;  5BN5 A;  1EY5 A;  2DY8 A;  2O5J C;  2A1A A;  1OXX K;  1B3Q A;  2JN4 A;  2BOS A;  1S72 A;  1FVI A;  3PUW A;  4KK7 A;  5IOC A;  3RLN A;  1PV4 A;  4IN3 A;  2IJ0 A;  2RKS A;  1BCP D;  4YWM A;  1SAP A;  4XT3 B;  1U4M A;  1I4G A;  1IYJ B;  4GN4 B;  4OON A;  1K83 B;  1SBB B;  4XQQ A;  2NBF A;  4R4I A;  5IWA Q;  5JPN C;  2ZM6 L;  3DEP A;  4C3H H;  1PH8 A;  2AKW B;  2VL6 A;  1JMC A;  4FP5 D;  4K8I A;  4QUC A;  4RAU C;  3URY A;  4JI2 Q;  1SE8 A;  2PQA A;  4A3I H;  2L12 A;  4FF4 A;  2BE5 C;  3KF8 B;  4V0B A;  2YU9 H;  4R4O A;  2MHV A;  4P75 A;  2F0I A;  3CW2 C;  1BR9 A;  4R1J A;  4P71 A;  4BY7 H;  4A3C G;  4B3M Q;  3E0E A;  4P72 A;  1JOK A;  4UDU C;  1ZYR C;  4DK6 C;  2MUY A;  3A8J E;  3I90 A;  3AMU A;  5IP9 H;  4HCS A;  3PIO 3;  1M1K C;  3A7L A;  4FDB A;  4LFC Q;  1HR0 Q;  1L0Y B;  4GN3 B;  4XTC S;  1IBL Q;  3H0G H;  1F2M A;  2K14 A;  2NVQ H;  3MEH A;  5DAU A;  2I07 B;  1PTO D;  2F0K A;  1ML0 D;  2BE5 D;  4YCW A;  3A5Z B;  4JI3 L;  2F4V L;  1CK1 A;  3S2D B;  2XRQ D;  1YNN D;  2NVT B;  2EQS A;  1RDP D;  2JP1 A;  4JPB W;  2B2U C;  4GKJ Q;  3DLL A;  4KKS A;  2R92 G;  4A3G B;  2VNU D;  4APV A;  4OWW B;  1H9M A;  2FFK B;  1P8L A;  3U4Z A;  3PUY A;  2N78 A;  1GHK A;  5M3M H;  3TEH B;  1STE A;  3TRE A;  5C4X H;  4KN7 C;  3R8B A;  4KJO A;  2VQE Q;  1SMY D;  1T5X D;  1O7L A;  4YHH L;  3ULJ A;  4IFD G;  3DHQ A;  1V1Q A;  3OHX C;  3GTJ H;  4CDC C;  2KOL A;  1STB A;  2F0V A;  1N36 Q;  2BCO A;  2JA7 H;  1JOO A;  5E7N A;  4CDE C;  2EPB A;  4DNI A;  4ZQ3 A;  4F8M A;  2Z4H A;  1FL0 A;  5LMN L;  1RCV D;  5C44 H;  5I9P A;  3K0Y A;  5T1I A;  4A4I A;  1HXY D;  2ES2 A;  1CHQ D;  1KHI A;  3BDL A;  1VQH A;  1EY9 A;  2F0Q A;  4NB3 A;  1K8A C;  2R61 A;  1HUN A;  4M1U B;  4KI0 A;  2A68 C;  4IFD J;  1D5Z C;  1HA5 A;  4KKT A;  2ZTD A;  1F77 A;  1KTK A;  3MXN B;  3H3V C;  2KED A;  4JYA Q;  2AQ3 B;  1PVO A;  4CBV A;  4X64 Q;  2K50 A;  3VR4 A;  1D7Q A;  2F03 A;  3M4Q A;  2NVX H;  1N34 Q;  2WAQ G;  1PYW D;  1WD1 A;  4HJ9 A;  4LUV A;  5G3L F;  4KY6 A;  1S4Z A;  3ERS X;  5C0X G;  3OMG A;  3JAM i;  2ATW A;  3HOZ G;  4JI1 Q;  2QIL A;  4BY7 B;  1TY0 A;  5FJ8 H;  2OWO A;  2NN6 H;  1I4Q A;  2AQ1 B;  1E24 A;  2K05 A;  2OT2 A;  1GO3 E;  2KVM A;  1ILQ A;  2EIF A;  2Q2T A;  3TP5 A;  1LAB A;  1EY8 A;  3P20 A;  4JV5 L;  2JXM B;  3EVQ A;  2HIV A;  1FNU A;  2LXK A;  1JWM D;  3CRL C;  2NUC A;  5GRO A;  4EGV A;  2VS1 A;  3VYU A;  1P16 A;  1LT6 D;  3T1H L;  4YCU A;  2PW5 A;  4A3K B;  3MFG A;  1ENA A;  1STH A;  2KHJ A;  2NN6 G;  1STN A;  3J7A F;  5IGE A;  4Y7N H;  1E3P A;  2CH4 W;  2ZXO A;  2MNA A;  3E9I A;  1BUV T;  1SNM A;  4JOI C;  3NP8 A;  1S5C D;  1CA6 A;  1HZ9 A;  1PYS B;  4A75 A;  1QVG A;  3FKI B;  2JA5 G;  2RSN A;  2F0T A;  1S5B D;  2EXD A;  1VQG A;  3PIO A;  2QA4 A;  2DJF C;  5BN4 A;  3KLW A;  4LF4 Q;  2N49 A;  1HR0 W;  3S1Q H;  1L1O C;  4ZCK A;  4JI7 L;  3PUX A;  3UDI A;  4NKL A;  1S5E D;  1TS5 A;  4DUZ L;  5IYD G;  1EY6 A;  2R93 H;  5E4X A;  1R9T B;  1ESF A;  4IPH A;  4I65 A;  1PFN A;  3V96 A;  4QUF A;  3J7A 5;  2CVR A;  1G2T A;  1SMX A;  1E1T A;  1JOQ A;  3JC6 6;  5JPM C;  2CQO A;  3E6Z X;  2JA6 H;  4L63 B;  1D6E C;  1BBW A;  4DAY A;  1HA6 A;  5JJL A;  3MFY A;  5BR8 Q;  4CHT B;  3L9A X;  3ONA B;  1EIH A;  1TWH B;  5FLM H;  1I3Q B;  3CCU A;  3S2H B;  3DWA A;  1CI3 M;  1S3O A;  3W5O A;  2B8F A;  3CXC A;  3CCM A;  3L0O A;  4MZ9 A;  2N88 A;  3AB9 A;  2B2W A;  4A3B B;  5IT9 c;  1B4O A;  2KEN A;  2ZJQ A;  1PZK D;  3D6C A;  5CC4 A;  2PZT A;  4UP7 A;  4WFN 3;  1SSO A;  2FMC A;  2JA9 A;  2LXJ A;  1LTA D;  2AWN A;  2A6E D;  3H91 A;  5EPJ A;  5IGF A;  2KBN A;  1STG A;  4RCO A;  5L37 A;  3EQL C;  2K75 A;  2M2L A;  2I0Q A;  1SNQ A;  4MN3 A;  3QOJ A;  2K5Q A;  3JAM L;  2KEE A;  3HKS A;  1GUN A;  3CC4 A;  3B6Y A;  1FYC A;  2EOT A;  2JA5 H;  1FGU A;  4LJZ C;  3GTG B;  2L9H A;  4QCL A;  1O7Z A;  1VS0 A;  2A6H C;  1CSP A;  2IWH A;  4RHR A;  3H3V H;  2PI2 A;  4OHJ A;  4DR1 L;  4LF7 L;  3SHL A;  1EQV A;  1V43 A;  1CKO A;  1LUZ A;  4I7A A;  4JBJ A;  3GTL B;  4DV0 Q;  1I4R A;  4KJN A;  2IHF A;  3M4P A;  2IX1 A;  2B2Y C;  2NN6 I;  1FNV A;  4AQY Q;  2R92 B;  4A3G G;  3MTS A;  3RZD H;  4LNQ A;  1JE4 A;  1A3T A;  1YHQ A;  1J5E L;  5ELN A;  4N9P A;  3D31 A;  3TRZ A;  3EJI A;  1LO5 D;  3BVZ A;  1K28 A;  3F2B A;  1WTV A;  4R8I A;  2HQL A;  1PRT B;  2LY7 A;  5AJ3 Q;  2QCP X;  1N32 L;  1PYB A;  2B39 A;  1ENC A;  4BXX H;  5CV4 A;  2HUG A;  4OGQ C;  4EQ5 A;  4CKB A;  4JI6 L;  4B3R L;  3I4M H;  1IKL A;  1ROD A;  2WKC A;  1B9M A;  4JI1 L;  4A93 G;  3LGJ A;  1EYA A;  3NBH A;  3GTL H;  1KXL A;  3CCS A;  3TP7 A;  2OEO A;  3E0J A;  2A74 C;  3NEM A;  1NE3 A;  3T53 B;  2B2V C;  1PHJ A;  1QNU A;  4FXD A;  3KJO A;  4BBS G;  4OXP A;  5IYB G;  4IUU A;  1EWC A;  1QJO A;  3I72 A;  4JI8 L;  2MFI A;  4P2C B;  3S1Q B;  4BBR G;  3PCO B;  2N8N A;  2JK8 A;  3KBX A;  3SK8 A;  3G7L A;  1BBX C;  1SDF A;  1IBK Q;  3KJP A;  1L1O B;  1TS2 A;  2YTV A;  1UNS A;  1WCM H;  4EX5 A;  4LF8 L;  3N52 A;  1KAA A;  1ZYR D;  1R9T H;  3J80 L;  2XWB B;  5EPK A;  2WAQ B;  1U4R A;  4LK1 C;  3NHH A;  1M8A A;  2E2J B;  1EWH A;  1JOR A;  4X6A H;  4X62 Q;  1QE6 A;  1STA A;  1CQV A;  3QR8 A;  5ELD A;  4BY7 G;  2L4N A;  3TZD A;  1K3B C;  2WB1 G;  3S2H H;  2B63 G;  1OXT A;  2WB1 E;  5DM6 3;  1TT2 A;  1HQM C;  4A3F G;  1VQC A;  2Q8T A;  4DXF A;  1JB7 A;  1MD2 D;  4YY3 Q;  1JWS D;  4BY1 G;  3HOV H;  3S1N H;  4L5T A;  4A3K G;  3K5N A;  1AW7 A;  1SN8 A;  3HG9 A;  4Q5V A;  4PMB A;  5CV8 A;  3KF6 B;  3S16 B;  1V8Q A;  4A3K H;  5KNC A;  1GVP A;  3RZO H;  4GLA C;  4HED A;  4PZ7 A;  3SR1 A;  1T9H A;  1HRJ A;  1DYQ A;  2F4V Q;  1TR5 A;  4J8Q A;  4DNT B;  2F4I A;  1HZA A;  1V1P A;  3A56 A;  5LMU Q;  3A55 A;  2KCT A;  4CJ0 B;  4X65 Q;  1EOV A;  1KNE A;  3FKI H;  1EZ8 A;  4B3M L;  4B08 A;  3GTQ B;  4YIJ A;  4NW2 A;  1NCV A;  5BN3 A;  4X3U A;  1TKW B;  4XYQ A;  2F0P A;  3I4L A;  1BVS A;  1NMG A;  3UE0 A;  3DXJ C;  2AHO B;  3S17 H;  3U9O A;  3J7Y W;  3K58 A;  1XNR L;  1ICW A;  4OEL B;  3A5U A;  4I7Z C;  4QL5 A;  1QVC A;  3D4W A;  3QOL A;  5KIX A;  1W6K A;  4DAV A;  4R4C A;  3SVM A;  1B8A A;  1PRT C;  1E2V A;  4H13 C;  1KC8 C;  4ZLT F;  1X3G A;  3A8I E;  3I73 A;  5J22 A;  4G57 A;  1JWU D;  2JYO A;  1PTO C;  4DR2 L;  4GN5 A;  3DUZ A;  2I5H A;  4C3J H;  4BBS H;  1CZW A;  1GUT A;  2AMC B;  2L0C A;  3RR5 A;  3CKI B;  1TS3 A;  5IE8 A;  1JC7 A;  5KND A;  3M9B A;  4H44 C;  1CKN A;  2KCC A;  3R3O A;  4IUT A;  3Q24 A;  2B2T C;  3CHB D;  1IW7 D;  3NXW A;  5C44 B;  1Y1W B;  4PG3 A;  4A3B G;  3VR2 A;  1AE3 A;  3PF5 A;  1F9R A;  1SJH D;  3PUZ A;  2JA7 B;  2B2W C;  4C3J B;  5FLM G;  2VW9 A;  1VQM A;  4BXX G;  4LF5 Q;  3AEV A;  1KIX A;  2PNR C;  3FVQ A;  5LHY 1;  2DNC A;  2NZO A;  4TSS A;  2CKZ B;  5JVH 3;  1SND A;  1DCZ A;  5JAV A;  5IYC H;  1EL0 A;  3C3L A;  3R2T A;  3CCE A;  3KFU A;  2PQE A;  4TQU S;  5IT9 E;  1LTB D;  4R9W A;  3UI2 A;  2L11 A;  4A3J H;  3HEJ A;  2Z8L A;  1KD1 C;  1TWA B;  4QQB X;  2NVT H;  2HQE A;  2R7F A;  4UHV A;  1AFP A;  3I56 A;  1NR2 A;  4DAP A;  1I50 B;  3NQT A;  3NTH A;  2UXC Q;  1IXR A;  3W1G A;  1C8C A;  4GNX C;  1SMY C;  1EYC A;  2K6A A;  1UEB A;  1K8O A;  4AYB B;  3HRZ C;  3RD4 A;  1RIP A;  3EN2 A;  1XMO L;  4B9W A;  3HKZ B;  5K36 H;  2SNS A;  5IYB H;  2A8V A;  2AUK A;  4ID6 A;  4JI7 Q;  2E75 C;  1IL8 A;  1EQQ A;  5C4X B;  5CV9 A;  4A3E B;  1EUJ A;  3CC7 A;  3VR5 A;  3IFD A;  3VR3 A;  2G5D A;  3RLO A;  3H3V I;  3WDN A;  5D3I B;  3MWY W;  1U5K A;  4WJ4 A;  2RHS B;  1LTI D;  4IQZ A;  4DA2 A;  2A69 C;  3EBE A;  3EA6 A;  3I70 A;  1NUC A;  4YCV A;  3KOJ A;  1Z9F A;  4C56 C;  3QIA A;  4GKK L;  2BDN A;  1A3U A;  1F9P A;  1FR3 A;  3T1H Q;  2Z4I A;  2RSO A;  2PPB C;  4A3F H;  3NTK A;  4FXK C;  4ULL A;  1N33 Q;  1B9N A;  5IGB A;  1MBY A;  4BBR B;  3K59 A;  2ZTC A;  4GLV B;  3J80 E;  4V19 0;  1SNP A;  3CD6 A;  2M00 A;  3GQB A;  1YI2 A;  1SEB D;  3BZD B;  2E2J H;  5LMU L;  3LX0 A;  1BNZ A;  3M3Y H;  3NQI A;  4DR1 Q;  4LF7 Q;  1V1O A;  4J1M A;  1MGS A;  5GAH C;  3GD7 A;  2J4X A;  5FO8 B;  1WTX A;  3PO2 B;  3N6R A;  3S1M B;  4KHV A;  1WTP A;  4Z9C B;  2K5H A;  1KDC A;  2PW7 A;  4EVO A;  3R2I A;  1A2U A;  1VQO A;  2QEJ C;  4JBM A;  3P75 A;  1SYG A;  2DJG C;  3KYH C;  2WB1 B;  2JA8 B;  1D1I A;  1VF7 A;  3I8Z A;  3IFT A;  2RDF A;  4FYD A;  1ILP A;  3Q6S A;  1VQE A;  1V9P A;  3D4R A;  3RNU A;  1QZG A;  3S14 B;  2PO4 A;  4JI5 L;  1PXU A;  1E7Z A;  4RCN A;  5C3E B;  5CV5 A;  1RF2 D;  4HSP A;  1LT4 D;  2XWJ B;  2EYP A;  4A3L H;  3UE1 A;  3CAM A;  2VUM B;  2UUA Q;  2FJ2 A;  4BS9 A;  2KA7 A;  4DU9 A;  1BF4 A;  4A93 H;  1X9N A;  2SEB D;  4NMZ A;  2OCE A;  4MNO A;  2M9V A;  1WTW A;  3NWS A;  4K2L A;  1RL2 A;  2L15 A;  1EFI D;  4DV1 Q;  5LL6 X;  5C3W A;  1I6H B;  3CRK C;  1IW7 C;  3PIP A;  3CCV A;  3J80 c;  2ASB A;  1XNQ Q;  4IPD A;  4PMC A;  3KF6 A;  5D14 A;  4BWG B;  2A73 B;  2K28 A;  3VA7 A;  1TWC B;  2F0W A;  2Q8I B;  2D0P A;  4HJ5 A;  4G7H C;  5M3F B;  1HHV A;  4HR7 B;  3J81 i;  5C4J B;  3OW7 A;  2PI2 E;  4IUR A;  1EIG A;  1E1O A;  5I2Y A;  2K04 A;  4WJW A;  1AN8 A;  2VQF Q;  5C0X H;  4HIM A;  3G71 A;  4RKB A;  1UE5 A;  3IRB A;  4A3L G;  4XIG S;  5C4H A;  1VF5 C;  5EQ0 A;  1N9W A;  4ZAI A;  2PZW A;  1HCZ A;  4PQX A;  5NUC A;  1C48 A;  2A69 D;  3J7Z C;  2FXQ A;  4A3M H;  2K4K A;  1F9Q A;  2YTY A;  4OEM B;  3MEF A;  1XPO A;  1SYC A;  1S5F D;  3J80 i;  1NNX A;  3H0G G;  1KRT A;  4C1N I;  2GA4 B;  4A3M G;  4UAI A;  2PYK A;  1NMF A;  3OSO A;  4H0L C;  5IP9 G;  3BVM A;  5TSS A;  3RMH A;  3CME A;  4JI3 Q;  1Y1V B;  2F0G A;  4RGO S;  3M85 A;  1C9O A;  1LTT D;  3OYY A;  2QDL A;  1I4X A;  2HCC A;  3X3N A;  2Q8R E;  1G8Z D;  3DWP A;  4C3I B;  3NK9 A;  4HN7 A;  3HOW B;  4LUZ A;  2YU9 B;  3HOV B;  3S1N B;  1KNA A;  3NE5 B;  4E6I A;  2RCF A;  2LSS A;  4LAA A;  4A76 A;  2JA7 G;  4IJL A;  1XWE A;  5KYL A;  1TWH H;  1GUG A;  4NXM L;  1G2S A;  4KY7 A;  1GKH A;  1Q82 C;  3QG1 A;  4OX9 Q;  1VQF A;  4K5W A;  1WD0 A;  3K6O A;  4DUZ Q;  4DV3 L;  4NPS A;  5ELE A;  2E74 C;  3VYS A;  3V2T A;  3VR6 A;  3PGZ A;  1NBW A;  1NJI C;  5F2D A;  1TWF H;  1C7Y A;  5CBE E;  3CU7 A;  3IAY A;  4FXG C;  2GVA A;  4B3S Q;  1SXT A;  1PTO H;  1PH2 A;  5K36 G;  2ZXR A;  3HOX H;  4HMI A;  3NEL A;  4RGM A;  5CV6 A;  4B3S L;  3L7Z C;  3KUP A;  5DNF A;  2R7D A;  1TQO A;  3SE0 A;  1BCP B;  1F2Y A;  1JR0 D;  4H02 A;  3HOW H;  2UXD L;  4A3J G;  2K52 A;  4LFB L;  1JT8 A;  1EYD A;  2UU9 L;  3ICE A;  4CDF C;  3BYT B;  4OIJ A;  2MO1 A;  1D5X C;  4LFC L;  2N3S A;  4LFA L;  1H9K A;  1L1O A;  1Q46 A;  1V1P B;  2MP1 A;  1MSH A;  3SGI A;  4EQN A;  1YHB A;  5EGT A;  5JOB A;  1D8L A;  4EQP A;  1J8I A;  2K01 A;  3K7A B;  1D5M C;  1I94 L;  1HTL D;  2E76 C;  1TWC H;  3J81 L;  1AZQ A;  1SYF A;  3FDT A;  4DR3 Q;  2TMP A;  4G7O C;  4ZUI A;  4HJA A;  2UUC Q;  1I6V C;  1SE2 A;  3TDQ A;  2K32 A;  4JI4 L;  4IZ8 A;  4HAE A;  5IT9 L;  3CQZ B;  1OTC A;  2F0O A;  1KLG D;  4KMU C;  3A0J A;  3SK5 A;  2IT1 A;  3GV6 A;  4HJ8 A;  4DV2 Q;  4KY5 A;  3PV0 A;  5JJK A;  1O80 A;  1JIC A;  3MAQ A;  3HGB A;  3S9W A;  1X3P A;  4PMW A;  4BA1 I;  3GV3 A;  4XDX A;  5GAG C;  3G48 A;  4LF9 Q;  1QUQ B;  4YWK A;  4YWL A;  4DXG A;  3S14 H;  2LMC B;  1QWY A;  3T56 B;  3HOY H;  2EY1 A;  2F0E A;  4JI4 Q;  2B63 H;  3MZ5 A;  3KDF B;  1C0A A;  2H5X A;  1W2B A;  1XTC D;  2MJ8 A;  4BA2 I;  4DR6 L;  2ZJP A;  1CA5 A;  2VUM H;  1UWV A;  3NTI A;  2E2D C;  4N8F A;  4RMF A;  2ALY B;  2JA8 G;  3BVG A;  3TZU A;  1Y69 U;  1J5E Q;  2JSO A;  3J81 j;  2V1C C;  5ISR A;  1AEX A;  1Z6H A;  4H7B A;  5C3E G;  4DF7 A;  4AH6 A;  1N33 L;  1K3R A;  1MHW C;  1N36 L;  1MJC A;  1U4L A;  5IP7 H;  2H4O A;  1UEA B;  1K0R A;  5IYC G;  2VUM G;  4A3I G;  1EY0 A;  4LF6 Q;  1A6X A;  4JBW A;  2I5L X;  4BBR H;  1PLF A;  3BS1 A;  4IUQ A;  4DV6 Q;  1G29 1;  4R8N A;  3M7N A;  3S1M H;  5IWA L;  4C3H G;  1KL9 A;  2JEB I;  3PF4 A;  4DR5 Q;  1WOC A;  2K5V A;  2RF4 A;  4DV5 L;  4GZY C;  1SNC A;  1FJG L;  2EE1 A;  4HIO A;  3RUZ A;  2EXZ A;  5DLQ E;  5CGK A;  1DGS A;  1SR3 A;  5JJZ A;  1SFO B;  1NTG A;  1L2F A;  3Q23 A;  4JI6 Q;  1L0W A;  2HHH L;  1EQR A;  1VQK A;  5KNB A;  2F0M A;  2D9U A;  2EDG A;  1EEI D;  3I55 A;  2UXC L;  3I91 A;  1IHZ A;  3O13 A;  1A2T A;  1BCP C;  3NBH B;  3T1Y Q;  2B2T A;  1MI2 A;  4CKE A;  3FRP B;  2E2H B;  2D2C C;  1RJT A;  4K6L A;  1HZB A;  2RHQ B;  1Z7T A;  4OO1 G;  3T4A C;  5H1S E;  1F9S A;  3CP0 A;  1C4Q A;  1EEF D;  1Q8I A;  4DV1 L;  3K5M A;  4DAY B;  4RFB A;  2VB3 X;  3HS0 C;  4A3E H;  1KRS A;  5C4Z A;  3DM1 A;  3MA2 B;  5COR A;  1RKN A;  2OXP A;  2O2L D;  4O1N A;  1A8V A;  1OO9 B;  2JJQ A;  4DR6 Q;  1XTD A;  3EIV A;  3I2Z A;  4MHE A;  1I4P A;  3TBI B;  4C3I G;  2JE6 I;  3FKI G;  4CGY B;  4TVA B;  1VQ7 A;  1CUK A;  3AFP A;  1X6O A;  3HOY G;  5J3B A;  2BA0 A;  1OXU A;  4C1N K;  5G3L D;  4RKL A;  2IHE A;  3FPP A;  5EBD A;  4JOI A;  3J81 c;  5A35 A;  1TWA H;  5IIF A;  1HTP A;  5GAD C;  2SDF A;  3FMC A;  5JVG 3;  2A6H D;  2F52 A;  2HDM A;  1VQL A;  4GOP B;  1QNK A;  4JVZ A;  5FK9 C;  1DOL A;  1SFO H;  1PH5 A;  3QO2 A;  2XNA C;  3PQI A;  4M8A A;  4DR4 L;  1EWI A;  1VQI A;  1U0L A;  1Y1W H;  2OTJ A;  1PH4 A;  3MXU A;  1WJJ A;  1VQD A;  1CHP D;  3AFQ A;  3S1R H;  2RCN A;  1VMC A;  3VYT A;  2VXW A;  3AQQ A;  4KTA A;  1GXD C;  4CDD C;  2NTS A;  3TS0 A;  2VQF L;  2DNE A;  3E5S A;  3ERQ A;  4J6H A;  1WFQ A;  2OF1 A;  3GTJ B;  1ENF A;  2PNH A;  4UP8 A;  4C2M B;  4KN4 C;  3RN5 A;  3U50 C;  1B3A A;  1VQ8 A;  4UPA A;  1Y14 B;  2F0U A;  2X6L A;  1GHJ A;  4NXM Q;  2UUB Q;  1AZP A;  1JJC B;  4DNR B;  4HMJ A;  3PO3 G;  4L8J A;  1EY7 A;  1IKM A;  1PRT F;  5GQO A;  2R93 G;  1IYU A;  4A3G H;  1B53 A;  3QB3 A;  1DM0 B;  2KHS A;  1WTO A;  3D6W A;  1YEZ A;  4FF1 A;  2K5W A;  4L5Q A;  2Z6K A;  5ELC A;  2I46 A;  2IPK D;  1PH9 A;  1YJ9 A;  5ELB A;  2YTX A;  2F3I A;  3J7A V;  4IUN A;  1U4P A;  1Q7Y C;  2B29 A;  1DON A;  1WI5 A;  1WTH A;  4ABN A;  1EOT A;  2CH4 A;  4X66 Q;  1CM9 A;  1LM0 A;  2NVQ B;  3HOX G;  2CW0 D;  5M5X B;  4L5S A;  1Q12 A;  1LAC A;  3HOU G;  1ASZ A;  4X3K A;  2KHI A;  1YNJ D;  3PO2 H;  5FLX c;  1I4H A;  1OXS C;  3D4D A;  1CFM A;  1H9R A;  3W2D A;  3ER0 A;  5AFW A;  2Q2H A;  1WTQ A;  2K5D A;  2ZJR A;  2EZV A;  4DN4 M;  3W1B A;  4LMQ D;  5FO7 B;  1FGB D;  2RVL A;  2UXB Q;  1ASY A;  1PZJ D;  3CQZ H;  1IZ6 A;  1M90 C;  1DOM A;  2ICI A;  3MHB A;  3C2P A;  2JA6 G;  5KGU A;  1K73 C;  1X3Q A;  2HD3 A;  1TII D;  3K5L A;  3PUV A;  5K5P A;  4GKK Q;  1X65 A;  3OOC A;  4MTN A;  5IYD H;  3K57 A;  2LKV A;  2EJF C;  3BZK A;  2EY6 A;  5CR3 A;  4GNX A;  1ZEQ X;  2NWG A;  3GP7 A;  5CMD A;  3RN2 A;  1Y8P B;  1SE3 A;  3ZJY C;  3WWV A;  4GS3 A;  2CQA A;  3SEB A;  1H9J A;  4ALP A;  2WP8 J;  1TY2 A;  3BYY B;  3EFX D;  4FNF A;  5ELF A;  4RHS A;  2E2H H;  3U9S A;  4X66 L;  2MPM A;  1HPC A;  3ND8 A;  4DV7 L;  4A3I B;  2F0J A;  2H1E A;  2JQO A;  3NPP A;  5FLX E;  1HNZ Q;  4RG1 A;  2E2I B;  2ENB A;  5CYU A;  4DFA A;  4X64 L;  4KHZ A;  3J81 E;  4FF2 A;  4C3H B;  3OWE B;  4GOP C;  2HIX A;  1WYD A;  3BZC A;  1X55 A;  2UUC L;  4LWC A;  1ZKO A;  3GTM H;  4KHP L;  1A15 A;  3R93 A;  1IL2 A;  4O0A A;  1YNX A;  3IL8 A;  4PZ8 A;  5JJI A;  3CCR A;  3G4S A;  2K1B A;  4FVM A;  4NP5 A;  2A19 A;  2L55 A;  4IUV A;  1VQN A;  1Q90 A;  2B63 B;  4OWX B;  4F87 A;  3S15 H;  1PH6 A;  2R7Z H;  4JI0 Q;  3CCJ A;  3E3X A;  1O7I A;  4N9T A;  4O42 A;  4CKC A;  5FJ8 G;  5M3M G;  1XXG A;  3GTP H;  1TS4 A;  2PMZ E;  1CQF A;  2C5C A;  4BY1 B;  3I4O A;  3MXN A;  3OIQ A;  3TN2 A;  3OTO Q;  1F2L A;  2LFN A;  4JI5 Q;  4LF4 L;  1Q8K A;  3HOU H;  2N55 A;  3HOZ H;  2FMM A;  1IBM L;  2KCM A;  3MVV A;  1W3S A;  1D2B A;  3GTO B;  3VYR A;  2BDO A;  1EIF A;  2F3W A;  2QKI C;  3L2P A;  3P1H A;  4U67 3;  2E5L Q;  2BH2 A;  3ERO A;  1VQ4 A;  5KRU A;  4MTK A;  1IBM Q;  1SYE A;  1YVC A;  1D1K A;  3K8A A;  4HIK A;  3HOY B;  5M5W H;  1UE6 A;  1PMR A;  5IGD A;  1WTR A;  1JJ2 A;  3C1F A;  2Z1C A;  2DY7 A;  1PFS A;  4K5V A;  1HR0 L;  2SOB A;  2D5D A;  2PMZ B;  1VQ9 A;  3CF5 A;  1HNW Q;  3KLR A;  1XPR A;  1QCB D;  3S17 B;  3M4Y A;  1B2T A;  1LT5 D;  2XVS A;  2RDH A;  4F7X A;  4A3C H;  3K5O A;  4L5R C;  5C4J H;  3Q22 A;  2MGS A;  5M5W B;  1BBU A;  1MSG A;  2Z9H A;  3KBG A;  3TSS A;  1TVX A;  2F0L A;  4JCV E;  4X62 L;  4IOA A;  3Q0A A;  4A3D B;  2CHB D;  2WKD A;  2KCN A;  3VDY A;  1UAP A;  1K0S A;  1VQJ A;  3FEW X;  3LWU A;  4QIW B;  1NR4 A;  4AQY L;  3GTO H;  4X65 L;  2F1M A;  3NSW A;  4IAL A;  4LF8 Q;  1PH1 A;  4ILW A;  2O5I C;  4ZYS A;  2Z6K C;  5I4D A;  2EYH A;  3CPW A;  1N34 L;  2G9D A;  5CV7 A;  3WOF A;  3DEO A;  3STB D;  1B1Z A;  4OO1 I;  1YIJ A;  1HNZ L;  3E9H A;  1CKM A;  2YV5 A;  3DMU A;  3GTP B;  5DM7 3;  1Y1W G;  3IKJ A;  2I5M X;  4DUY L;  4DV7 Q;  5FLX L;  3T51 B;  4C3J G;  4IFD I;  3HP3 A;  1J9O A;  1LV9 A;  3S15 B;  3M4O H;  5E4W C;  1T5E A;  1E2W A;  1DJR D;  2FHT A;  3K0X A;  5M5Y H;  2NVY H;  2KEC A;  4RH6 A;  5LL6 S;  1K8G A;  4DV5 Q;  4P74 A;  2IX0 A;  2F0N A;  1CTM A;  2C9O A;  3BJU A;  2EYJ A;  2DUD A;  5GAE C;  5A2Q E;  1MJE A;  1NY4 A;  4XT1 B;  4N8X 1;  3I3C A;  1A0I A;  4C3I H;  3ZYY X;  3HOU B;  2J0T D;  3ULL A;  1SRO A;  4OO1 H;  1L0X B;  3U4V A;  4X3T A;  5I2X A;  1RTO A;  1QOH A;  3F8T A;  3BU2 A;  1TWG B;  2VQE L;  4DV4 L;  1XX8 A;  4AYB E;  4CJ1 B;  2Z0S A;  4JV5 Q;  1JB3 A;  2UUA L;  4WRD A;  2NVY B;  3D8G A;  5IGC A;  3GTK H;  5M5Y B;  4AYB G;  1YJW A;  2CW0 C;  2XTI A;  4XXE A;  4IFD H;  3I4N B;  2UXB L;  1LTR D;  2JA6 B;  1Y8O B;  1JQY D;  4B3T L;  4K2K A;  5C4X G;  1HFN A;  1TWF B;  2ID0 A;  3FPU B;  4IUP A;  1GUO A;  3TS2 A;  2XSC A;  1KLU D;  3CPF A;  2L5T A;  5JEA G;  2WAQ E;  3SDZ A;  4QB4 A;  5EKK A;  1G91 A;  1HUM A;  4JG2 A;  2K03 A;  1Y1V H;  2RQX A;  1JJG A;  4GOP A;  2ZXP A;  2KJX A;  4MIU A;  2F0S A;  4IPC A;  1VCI A;  2Y0S G;  4K0K L;  1NSN S;  1IBL L;  3K80 C;  1A3V A;  1PRT D;  3TP6 A;  4DR7 L;  2EJM A;  5IP7 G;  1XMQ Q;  4O2D A;  1ET6 A;  1OXV A;  2DGY A;  3CCQ A;  5D65 A;  1R4P B;  1XJV A;  5C3E H;  3QJY A;  3A7A B;  2UU9 Q;  3G6J B;  1LTG D;  3F1Z A;  1LYL A;  3HFZ B;  1ESR A;  4J15 A;  1CKN B;  5EKL A;  1ONL A;  1YIT A;  2JA8 H;  1HNW L;  1IYV A;  3I7F A;  4HCE A;  3T16 A;  1BOS A;  2AQ2 B;  3H6M A;  1SYB A;  2C35 B;  2F3V A;  4POG A;  1LLR D;  4DK1 A;  2ZM6 Q;  5FKA C;  3OPO A;  1KDB A;  1EFW A;  5JEA H;  1QVF A;  4QJF A;  3ITP A;  5M3M B;  4A93 B;  1DXM A;  1B44 D;  1JE5 A;  4RA8 A;  3AU7 A;  1U9R A;  2XIW A;  3ND9 A;  2J7Z A;  1HNX Q;  5C6A A;  1FJG Q;  4GLX A;  4BBS B;  1Y8N B;  2NZH A;  3NWT A;  1HFG A;  5M5X H;  4C2M H;  1PA6 A;  1S40 A;  3WOE A; 
#chains in the Genus database with same CATH homology
 2EYM A;  2IX3 A;  3KLS X;  4KD4 A;  1AP0 A;  4OL7 A;  3S1R B;  3LNN A;  3NUC A;  3TP8 A;  1EY4 A;  1BQQ T;  1S5D D;  2PZU A;  2WIN B;  4ZK9 B;  1CT1 D;  3H09 A;  4ZKB B;  3M3Y B;  2A6E C;  5HGT A;  3JAM E;  1EQT A;  1PFB A;  5C5L A;  1BO0 A;  5M9O A;  2D62 A;  1K8M A;  3OWF A;  2EYF A;  2EY2 A;  4RWS C;  4A3F B;  3H0G B;  2YYZ A;  4TRD A;  3RLF A;  4ZRZ A;  1WVL A;  4WOR A;  5COY A;  4DK0 A;  1BCP F;  2JEA I;  1HQR D;  2KQ3 A;  1KAB A;  4K6D A;  4NDX A;  4Y7N B;  2X6G A;  2RBM A;  4ZUJ A;  1M4V A;  2NZ1 D;  3T13 A;  5E3F A;  4HSV A;  2VB2 X;  1G6Z A;  2F0D A;  4ME5 A;  1XYI A;  4ODG A;  4OIK A;  2RDG A;  1RD9 D;  2PCF B;  3L3O C;  4HTH A;  4PV1 C;  1GJX A;  5A2Q L;  2WV6 D;  4G7Z C;  1QIL A;  3A54 A;  1DD2 A;  1E0B A;  3OIP A;  3OMC A;  4G4K A;  2XRS D;  3W3A A;  2ICE C;  2NVX B;  2B8G A;  1JCK B;  1FD7 D;  2X69 A;  4FO2 A;  1SNO A;  2QF7 A;  2NTT A;  2R6G A;  3BDO A;  2XN9 C;  4A3J B;  2B2Y A;  2ZT9 C;  3MXP A;  1ZXT A;  4XYO A;  5E1F A;  1DZ1 A;  3LWE A;  4CJ2 C;  2FIN B;  1Q1B A;  4F88 A;  2R3Z A;  4TKO B;  3BG3 A;  2HCI A;  3SXH A;  5DEH A;  2A5H A;  2G9H D;  4ZKC B;  2SNM A;  1CZG A;  5IGG A;  4L6T B;  2Y0S B;  5FOB B;  4FF3 A;  5EPL A;  3H94 A;  4S3S A;  3VA5 A;  1F2Z A;  3D3R A;  3KF8 A;  1O7Y A;  2IL8 A;  1E2Z A;  5EJW A;  5I6Y A;  1BXT A;  5HUR A;  2F0F A;  3GTK B;  2HDL A;  5KYI A;  2B2V A;  2V4D A;  3DWQ A;  2L1B A;  3X3M A;  4JK1 C;  5J39 A;  2BA1 A;  4RGT A;  1PTO B;  3TME A;  3RZO B;  1O78 A;  1II3 A;  3HZX A;  1QB5 D;  1KDA A;  3KK7 A;  1R4Q B;  1RTN A;  1B50 A;  5I9O A;  1ET9 A;  5I6W A;  3PIP 3;  3GO5 A;  3QWN A;  2KUM A;  2LS0 1;  1VMP A;  4K5X A;  3M4O B;  1SYD A;  1YNN C;  2AUJ D;  4KV6 A;  4RGN A;  5C0X I;  4U68 A;  1SJE D;  4XQJ A;  1X32 A;  2DN8 A;  1LTS D;  3GTM B;  3A8K E;  5JEA J;  2WII B;  2B2U A;  1GOZ A;  1GUS A;  4K8J A;  1PZI D;  1GUW A;  2A68 D;  5IOD A;  1Q3L A;  1TU2 B;  1WCM B;  2F0H A;  2K33 A;  2WAC A;  3MC0 B;  1NAP A;  2EYO A;  4QF4 A;  3C1E A;  4K14 A;  2EY5 A;  2AWO A;  1QG7 A;  3M7G A;  1H9S A;  1Z47 A;  1PFM A;  1W6J A;  3PMF A;  2QDB A;  3I4M B;  5D3D A;  3SK6 A;  4XQN A;  4PNY A;  3C46 A;  3MXG A;  1YNJ C;  5C3X A;  3F2U A;  3HOZ B;  1EZ6 A;  1VDZ A;  3RZD B;  2NYZ D;  2IW3 A;  4EQO A;  2K7V A;  3P7J A;  1FNW A;  3SK4 A;  1STY A;  4Q0F A;  2RA4 A;  2EYL A;  1Q1E A;  2EVB A;  3V05 A;  2TSS A;  1UUP A;  1PTO F;  2NB0 A;  4DGZ A;  4B9X A;  4A3M B;  1EU4 A;  5C0X J;  1SE4 A;  3KLS A;  5KEE A;  3PO3 B;  4X3S A;  5CBA E;  3NBI A;  1LT3 D;  4QMG A;  2R93 B;  5EKI A;  2O4X A;  2JA5 B;  2EJG C;  4KKU A;  5EBC A;  3BDC A;  4KD3 A;  1PDQ A;  1BDO A;  1DOK A;  5J1Z A;  1EU3 A;  1H9S B;  5T1G A;  5FO9 B;  2R7Z B;  1RHP A;  5C5M A;  3HOX B;  5BN5 A;  1EY5 A;  2DY8 A;  2O5J C;  1OXX K;  2BOS A;  3PUW A;  4KK7 A;  5IOC A;  4IN3 A;  2IJ0 A;  2RKS A;  1BCP D;  1SAP A;  4XT3 B;  1U4M A;  1I4G A;  1K83 B;  1SBB B;  4XQQ A;  2NBF A;  5JPN C;  3DEP A;  4FP5 D;  4K8I A;  4QUC A;  4RAU C;  3URY A;  2L12 A;  4FF4 A;  2BE5 C;  4V0B A;  2MHV A;  2F0I A;  1BR9 A;  1JOK A;  4UDU C;  1ZYR C;  2MUY A;  3A8J E;  3AMU A;  3I90 A;  4HCS A;  3PIO 3;  3A7L A;  1L0Y B;  4XTC S;  1F2M A;  3MEH A;  5DAU A;  2I07 B;  1PTO D;  2F0K A;  1ML0 D;  2BE5 D;  1CK1 A;  3S2D B;  2XRQ D;  1YNN D;  2NVT B;  1RDP D;  2JP1 A;  2B2U C;  4KKS A;  4A3G B;  2VNU D;  1H9M A;  2FFK B;  3PUY A;  1GHK A;  1STE A;  4KN7 C;  3R8B A;  4KJO A;  1SMY D;  1T5X D;  1O7L A;  4IFD G;  3DHQ A;  3OHX C;  2KOL A;  1STB A;  2F0V A;  2BCO A;  1JOO A;  2EPB A;  4ZQ3 A;  4F8M A;  2Z4H A;  1RCV D;  5I9P A;  3K0Y A;  5T1I A;  1HXY D;  1CHQ D;  3BDL A;  1EY9 A;  2F0Q A;  2R61 A;  1HUN A;  4M1U B;  4KI0 A;  2A68 C;  4IFD J;  1D5Z C;  1HA5 A;  4KKT A;  1F77 A;  1KTK A;  3H3V C;  2KED A;  2AQ3 B;  4CBV A;  3VR4 A;  2F03 A;  1PYW D;  1WD1 A;  5G3L F;  4KY6 A;  1S4Z A;  5C0X G;  3OMG A;  2QIL A;  4BY7 B;  1TY0 A;  2NN6 H;  1I4Q A;  2AQ1 B;  2K05 A;  2OT2 A;  2KVM A;  1ILQ A;  3TP5 A;  1LAB A;  1EY8 A;  3P20 A;  2JXM B;  3EVQ A;  1FNU A;  1JWM D;  3CRL C;  2NUC A;  4EGV A;  3VYU A;  1LT6 D;  2PW5 A;  4A3K B;  3MFG A;  1ENA A;  1STH A;  2NN6 G;  1STN A;  3J7A F;  5IGE A;  2ZXO A;  1BUV T;  1SNM A;  3NP8 A;  1S5C D;  1CA6 A;  3FKI B;  2RSN A;  2F0T A;  1S5B D;  5BN4 A;  3PUX A;  4NKL A;  1S5E D;  1TS5 A;  1EY6 A;  5E4X A;  1R9T B;  1ESF A;  4I65 A;  1PFN A;  3V96 A;  4QUF A;  2CVR A;  1G2T A;  1JOQ A;  5JPM C;  3E6Z X;  4L63 B;  1D6E C;  4DAY A;  1HA6 A;  3MFY A;  4CHT B;  3L9A X;  3ONA B;  1EIH A;  1TWH B;  1I3Q B;  3S2H B;  3DWA A;  1CI3 M;  2B8F A;  2N88 A;  3AB9 A;  2B2W A;  4A3B B;  1B4O A;  1PZK D;  3D6C A;  5CC4 A;  2PZT A;  4WFN 3;  1SSO A;  2FMC A;  1LTA D;  2AWN A;  2A6E D;  3H91 A;  5EPJ A;  5IGF A;  1STG A;  4RCO A;  3EQL C;  2M2L A;  1SNQ A;  4MN3 A;  3QOJ A;  2K5Q A;  3JAM L;  2KEE A;  1GUN A;  1FYC A;  2EOT A;  4LJZ C;  3GTG B;  2L9H A;  4QCL A;  1O7Z A;  2A6H C;  2IWH A;  4RHR A;  4OHJ A;  3SHL A;  1EQV A;  1V43 A;  3GTL B;  1I4R A;  4KJN A;  2IX1 A;  2B2Y C;  2NN6 I;  1FNV A;  2R92 B;  3MTS A;  1JE4 A;  1A3T A;  4N9P A;  3D31 A;  3EJI A;  1LO5 D;  3BVZ A;  1WTV A;  4R8I A;  1PRT B;  2LY7 A;  2QCP X;  2B39 A;  1ENC A;  5CV4 A;  2HUG A;  4OGQ C;  4CKB A;  1IKL A;  1ROD A;  2WKC A;  1B9M A;  1EYA A;  3NBH A;  3TP7 A;  2OEO A;  3E0J A;  2A74 C;  3T53 B;  2B2V C;  1QNU A;  4FXD A;  4IUU A;  1EWC A;  1QJO A;  3I72 A;  4P2C B;  3S1Q B;  3KBX A;  3SK8 A;  3G7L A;  1BBX C;  1SDF A;  1TS2 A;  1UNS A;  3N52 A;  1KAA A;  1ZYR D;  3J80 L;  2XWB B;  5EPK A;  2WAQ B;  1U4R A;  4LK1 C;  3NHH A;  1M8A A;  2E2J B;  1EWH A;  1JOR A;  1QE6 A;  1STA A;  1CQV A;  5ELD A;  2L4N A;  3TZD A;  1OXT A;  5DM6 3;  1TT2 A;  1HQM C;  2Q8T A;  4DXF A;  1MD2 D;  1JWS D;  3K5N A;  1AW7 A;  3HG9 A;  4Q5V A;  4PMB A;  5CV8 A;  3S16 B;  1V8Q A;  5KNC A;  4HED A;  3SR1 A;  1HRJ A;  1DYQ A;  1TR5 A;  4J8Q A;  4DNT B;  2F4I A;  1V1P A;  3A56 A;  3A55 A;  4CJ0 B;  1KNE A;  1EZ8 A;  4B08 A;  3GTQ B;  4YIJ A;  4NW2 A;  1NCV A;  5BN3 A;  4X3U A;  1TKW B;  4XYQ A;  2F0P A;  3I4L A;  3DXJ C;  3U9O A;  3J7Y W;  3K58 A;  1ICW A;  4I7Z C;  3D4W A;  3QOL A;  5KIX A;  1W6K A;  4DAV A;  3SVM A;  1PRT C;  1E2V A;  4H13 C;  4ZLT F;  3A8I E;  3I73 A;  5J22 A;  4G57 A;  1JWU D;  2JYO A;  1PTO C;  3DUZ A;  1CZW A;  1GUT A;  2L0C A;  3CKI B;  1TS3 A;  1JC7 A;  5KND A;  4H44 C;  2KCC A;  3Q24 A;  3R3O A;  4IUT A;  2B2T C;  3CHB D;  1IW7 D;  1Y1W B;  3NXW A;  5C44 B;  3VR2 A;  1F9R A;  1SJH D;  3PUZ A;  2JA7 B;  2B2W C;  4C3J B;  2PNR C;  3FVQ A;  5LHY 1;  2DNC A;  4TSS A;  5JVH 3;  1SND A;  1DCZ A;  5JAV A;  1EL0 A;  3C3L A;  3R2T A;  2PQE A;  4TQU S;  5IT9 E;  1LTB D;  4R9W A;  3UI2 A;  2L11 A;  3HEJ A;  2Z8L A;  1TWA B;  2HQE A;  1AFP A;  1NR2 A;  4DAP A;  1I50 B;  3NQT A;  3NTH A;  1C8C A;  1SMY C;  1EYC A;  2K6A A;  1K8O A;  4AYB B;  3HRZ C;  3RD4 A;  4B9W A;  3HKZ B;  5K36 H;  2SNS A;  2AUK A;  4ID6 A;  2E75 C;  1IL8 A;  5C4X B;  5CV9 A;  4A3E B;  3VR5 A;  3IFD A;  3VR3 A;  3WDN A;  5D3I B;  3MWY W;  1LTI D;  4IQZ A;  4DA2 A;  2A69 C;  3EA6 A;  3I70 A;  1NUC A;  4C56 C;  3QIA A;  2BDN A;  1A3U A;  1F9P A;  1FR3 A;  2Z4I A;  2RSO A;  2PPB C;  3NTK A;  4FXK C;  4ULL A;  1B9N A;  5IGB A;  1MBY A;  4BBR B;  3K59 A;  3J80 E;  4V19 0;  1SNP A;  2M00 A;  3GQB A;  1SEB D;  3BZD B;  3LX0 A;  1BNZ A;  3NQI A;  1V1O A;  4J1M A;  1MGS A;  3GD7 A;  2J4X A;  5FO8 B;  1WTX A;  3PO2 B;  3N6R A;  3S1M B;  4KHV A;  1WTP A;  4Z9C B;  1KDC A;  2PW7 A;  4EVO A;  3R2I A;  1A2U A;  2QEJ C;  3P75 A;  1SYG A;  2WB1 B;  2JA8 B;  1D1I A;  1VF7 A;  3I8Z A;  3IFT A;  2RDF A;  4FYD A;  1ILP A;  3Q6S A;  3D4R A;  3S14 B;  2PO4 A;  1PXU A;  4RCN A;  5C3E B;  5CV5 A;  1RF2 D;  4HSP A;  1LT4 D;  2XWJ B;  2EYP A;  2VUM B;  2FJ2 A;  4BS9 A;  2KA7 A;  4DU9 A;  1BF4 A;  2SEB D;  4NMZ A;  2M9V A;  1WTW A;  3NWS A;  4K2L A;  1EFI D;  5LL6 X;  5C3W A;  1I6H B;  3CRK C;  1IW7 C;  4PMC A;  5D14 A;  4BWG B;  2A73 B;  2K28 A;  3VA7 A;  1TWC B;  2F0W A;  2Q8I B;  5M3F B;  4G7H C;  1HHV A;  4HR7 B;  5C4J B;  3OW7 A;  4IUR A;  1EIG A;  5I2Y A;  2K04 A;  4WJW A;  1AN8 A;  5C0X H;  4RKB A;  4XIG S;  5C4H A;  1VF5 C;  5EQ0 A;  4ZAI A;  2PZW A;  1HCZ A;  4PQX A;  5NUC A;  1C48 A;  2A69 D;  1F9Q A;  1SYC A;  1S5F D;  4C1N I;  2GA4 B;  4UAI A;  2PYK A;  3OSO A;  4H0L C;  3BVM A;  5TSS A;  3RMH A;  1Y1V B;  2F0G A;  4RGO S;  3M85 A;  1LTT D;  1I4X A;  2HCC A;  3X3N A;  2Q8R E;  1G8Z D;  3DWP A;  4C3I B;  3NK9 A;  4HN7 A;  3HOW B;  2YU9 B;  3HOV B;  3S1N B;  1KNA A;  3NE5 B;  4E6I A;  4LAA A;  1XWE A;  5KYL A;  1GUG A;  1G2S A;  4KY7 A;  3QG1 A;  4K5W A;  1WD0 A;  3K6O A;  5ELE A;  2E74 C;  3VYS A;  3V2T A;  3VR6 A;  5F2D A;  5CBE E;  3CU7 A;  3IAY A;  4FXG C;  1SXT A;  1PTO H;  5K36 G;  2ZXR A;  4HMI A;  4RGM A;  5CV6 A;  3L7Z C;  3KUP A;  5DNF A;  1TQO A;  3SE0 A;  1BCP B;  1F2Y A;  1JR0 D;  1EYD A;  3BYT B;  4OIJ A;  1D5X C;  1H9K A;  1V1P B;  2MP1 A;  1MSH A;  4EQN A;  5JOB A;  5EGT A;  4EQP A;  1J8I A;  2K01 A;  3K7A B;  1D5M C;  1HTL D;  2E76 C;  3J81 L;  1AZQ A;  1SYF A;  3FDT A;  2TMP A;  4G7O C;  4ZUI A;  1I6V C;  1SE2 A;  3TDQ A;  2K32 A;  4IZ8 A;  4HAE A;  5IT9 L;  3CQZ B;  2F0O A;  1KLG D;  4KMU C;  3SK5 A;  2IT1 A;  3GV6 A;  4KY5 A;  3PV0 A;  1O80 A;  1JIC A;  3MAQ A;  3HGB A;  3S9W A;  1X3P A;  4PMW A;  4BA1 I;  3GV3 A;  4XDX A;  4DXG A;  2LMC B;  1QWY A;  3T56 B;  2EY1 A;  2F0E A;  3MZ5 A;  1XTC D;  2MJ8 A;  4BA2 I;  1CA5 A;  3NTI A;  2E2D C;  3BVG A;  3TZU A;  1Y69 U;  2JSO A;  5ISR A;  1AEX A;  1Z6H A;  4H7B A;  4DF7 A;  1U4L A;  2H4O A;  1UEA B;  1EY0 A;  1A6X A;  4JBW A;  1PLF A;  3BS1 A;  4IUQ A;  1G29 1;  4R8N A;  3M7N A;  4C3H G;  2JEB I;  4GZY C;  1SNC A;  2EE1 A;  3RUZ A;  2EXZ A;  5CGK A;  5JJZ A;  1SFO B;  3Q23 A;  5KNB A;  2F0M A;  2D9U A;  2EDG A;  1EEI D;  3I91 A;  1IHZ A;  3O13 A;  1A2T A;  1BCP C;  2B2T A;  1MI2 A;  4CKE A;  3FRP B;  2E2H B;  2D2C C;  1RJT A;  4K6L A;  1Z7T A;  4OO1 G;  3T4A C;  1F9S A;  1C4Q A;  1EEF D;  1Q8I A;  3K5M A;  4RFB A;  2VB3 X;  3HS0 C;  5C4Z A;  3DM1 A;  3MA2 B;  5COR A;  1RKN A;  2OXP A;  2O2L D;  4O1N A;  1OO9 B;  4MHE A;  1I4P A;  3TBI B;  4C3I G;  2JE6 I;  4CGY B;  2BA0 A;  1OXU A;  4C1N K;  5G3L D;  4RKL A;  3FPP A;  5EBD A;  5A35 A;  5IIF A;  1HTP A;  2SDF A;  3FMC A;  5JVG 3;  2A6H D;  2HDM A;  1QNK A;  5FK9 C;  1DOL A;  3QO2 A;  2XNA C;  4M8A A;  3MXU A;  1CHP D;  1VMC A;  3VYT A;  2VXW A;  4KTA A;  1GXD C;  2NTS A;  2DNE A;  3E5S A;  3ERQ A;  4J6H A;  2OF1 A;  3GTJ B;  1ENF A;  4C2M B;  4KN4 C;  1B3A A;  2F0U A;  2X6L A;  1GHJ A;  1AZP A;  4DNR B;  4HMJ A;  4L8J A;  1EY7 A;  1IKM A;  1PRT F;  1IYU A;  1B53 A;  3QB3 A;  1DM0 B;  2KHS A;  1WTO A;  3D6W A;  4FF1 A;  2K5W A;  5ELC A;  2I46 A;  2IPK D;  5ELB A;  3J7A V;  4IUN A;  1U4P A;  1DON A;  4ABN A;  1EOT A;  1CM9 A;  2NVQ B;  2CW0 D;  5M5X B;  1Q12 A;  1LAC A;  4X3K A;  1YNJ D;  1I4H A;  1OXS C;  3D4D A;  1CFM A;  1H9R A;  3W2D A;  5AFW A;  1WTQ A;  2K5D A;  2EZV A;  4DN4 M;  4LMQ D;  5FO7 B;  1FGB D;  2RVL A;  1PZJ D;  1DOM A;  2ICI A;  3MHB A;  3C2P A;  5KGU A;  1X3Q A;  1TII D;  3K5L A;  3PUV A;  5K5P A;  3OOC A;  3K57 A;  2LKV A;  2EJF C;  2EY6 A;  5CR3 A;  1ZEQ X;  2NWG A;  3GP7 A;  5CMD A;  1Y8P B;  1SE3 A;  2CQA A;  3SEB A;  1H9J A;  2WP8 J;  1TY2 A;  3BYY B;  3EFX D;  4FNF A;  5ELF A;  4RHS A;  3U9S A;  2MPM A;  1HPC A;  3ND8 A;  4A3I B;  2F0J A;  2H1E A;  3NPP A;  5FLX E;  2E2I B;  2ENB A;  5CYU A;  4DFA A;  4KHZ A;  3J81 E;  4FF2 A;  4C3H B;  3OWE B;  1ZKO A;  1A15 A;  3R93 A;  3IL8 A;  2K1B A;  4FVM A;  4NP5 A;  2L55 A;  4IUV A;  1Q90 A;  2B63 B;  4F87 A;  4N9T A;  4O42 A;  4CKC A;  1XXG A;  1TS4 A;  1CQF A;  2C5C A;  4BY1 B;  3MXN A;  3OIQ A;  3TN2 A;  1F2L A;  2LFN A;  2N55 A;  2FMM A;  3MVV A;  1D2B A;  3GTO B;  3VYR A;  2BDO A;  2F3W A;  2QKI C;  3P1H A;  4U67 3;  3ERO A;  5KRU A;  1SYE A;  1D1K A;  3HOY B;  1PMR A;  5IGD A;  1WTR A;  3C1F A;  2Z1C A;  2DY7 A;  4K5V A;  2SOB A;  2D5D A;  2PMZ B;  3KLR A;  1B2T A;  1QCB D;  3S17 B;  3M4Y A;  1LT5 D;  2XVS A;  2RDH A;  4F7X A;  3K5O A;  3Q22 A;  2MGS A;  5M5W B;  1MSG A;  3KBG A;  3TSS A;  1TVX A;  2F0L A;  3Q0A A;  4A3D B;  2CHB D;  2WKD A;  2KCN A;  1UAP A;  3FEW X;  3LWU A;  4QIW B;  1NR4 A;  2F1M A;  3NSW A;  4IAL A;  4ILW A;  2O5I C;  4ZYS A;  5I4D A;  2EYH A;  2G9D A;  5CV7 A;  3WOF A;  3DEO A;  4OO1 I;  1B1Z A;  3DMU A;  3GTP B;  5DM7 3;  3IKJ A;  5FLX L;  3T51 B;  4C3J G;  4IFD I;  3HP3 A;  1J9O A;  1LV9 A;  3S15 B;  5E4W C;  1T5E A;  1E2W A;  1DJR D;  2FHT A;  4RH6 A;  2KEC A;  5LL6 S;  2IX0 A;  2F0N A;  1CTM A;  2C9O A;  2EYJ A;  5A2Q E;  4XT1 B;  3I3C A;  3ZYY X;  3HOU B;  2J0T D;  4OO1 H;  1L0X B;  4X3T A;  5I2X A;  1RTO A;  1QOH A;  1TWG B;  1XX8 A;  4CJ1 B;  1JB3 A;  4WRD A;  2NVY B;  3D8G A;  5IGC A;  5M5Y B;  2CW0 C;  4XXE A;  4IFD H;  3I4N B;  1LTR D;  2JA6 B;  1Y8O B;  1JQY D;  4K2K A;  1HFN A;  1TWF B;  2ID0 A;  3FPU B;  4IUP A;  1GUO A;  2XSC A;  1KLU D;  2L5T A;  5JEA G;  3SDZ A;  4QB4 A;  5EKK A;  1G91 A;  1HUM A;  2K03 A;  2RQX A;  2ZXP A;  2KJX A;  2F0S A;  4MIU A;  1VCI A;  1NSN S;  1A3V A;  1PRT D;  3TP6 A;  2EJM A;  1ET6 A;  1OXV A;  5D65 A;  1R4P B;  3QJY A;  3A7A B;  3G6J B;  1LTG D;  1ESR A;  5EKL A;  1ONL A;  1IYV A;  4HCE A;  3T16 A;  1BOS A;  2AQ2 B;  3H6M A;  1SYB A;  2F3V A;  1LLR D;  4DK1 A;  5FKA C;  3OPO A;  1KDB A;  5JEA H;  3ITP A;  5M3M B;  4A93 B;  1DXM A;  1B44 D;  4RA8 A;  3AU7 A;  1U9R A;  2XIW A;  3ND9 A;  2J7Z A;  5C6A A;  4BBS B;  1Y8N B;  3NWT A;  1HFG A;  3WOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...