2RA4A

Crystal structure of human monocyte chemoattractant protein 4 (mcp-4/ccl13)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
DALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Small-inducible cytokine A13
total genus 12
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ra4A00
1J8IA 1IKLA 3FPUB 2JYOA 2K01A 4ZAIA 2B2UC 2N55A 4X3UA 1Q3LA 2B2TA 2K1BA 4QUCA 1SAPA 2HCIA 3IL8A 4ZKBB 2JP1A 1PFNA 3MTSA 2FFKB 2Q8RE 3GV3A 3IFDA 5EPLA 3LWEA 1VMCA 4RA8A 2BDNA 2B2YA 3HP3A 2B2VA 2RVLA 2KEDA 4QUFA 3DM1A 1DONA 1MSHA 2L4NA 4NW2A 1WVLA 2NZ1D 3D6WA 3GV6A 2VXWA 2X6LA 3KBXA 1CA6A 1WTVA 1JE4A 1WD1A 1G91A 4HSVA 1AZPA 5AFWA 4X3TA 2DY8A 2HDLA 1IL8A 1F2LA 1EIHA 1EIGA 4ZK9B 3SVMA 4HEDA 4IUUA 5T1GA 1BF4A 2XIWA 1BBXC 2R3ZA 2K05A 1SSOA 4MHEA 5T1IA 4ZKCB 3DEPA 1B50A 3KUPA 1XYIA 1B4OA 1X3QA 2KUMA 2MJ8A 2X6GA 3R93A 1MSGA 2EE1A 2KECA 3TN2A 1RTNA 1DZ1A 4RWSC 1GUWA 5CMDA 1KNEA 2H1EA 2L11A 4X3KA 1AZQA 4X3SA 4HAEA 3ONAB 2Q8TA 4DN4M 1ML0D 5COYA 1G6ZA 4U68A 2RSOA 1WTOA 2SDFA 2K04A 3I91A 1BNZA 1WTRA 1PDQA 4O42A 1WTWA 1NCVA 1HHVA 1BO0A 1F9QA 1S4ZA 3P7JA 1F9RA 2HCCA 1WTPA 1M8AA 1RTOA 1U4MA 4HCSA 4RAUC 1A15A 2KEEA 1HUNA 1O7YA 4ZLTF 1EOTA 1KNAA 5EPJA 1B3AA 1AP0A 3I90A 2NYZD 1F9SA 4CJ1B 1QNKA 2DY7A 1WTXA 3MWYW 2B2WA 2RA4A 4MN3A 5D65A 1U4RA 2MGSA 1LV9A 1TVXA 3TZDA 1O7ZA 1EQTA 4IUQA 4XT1B 1EL0A 4IUTA 1IKMA 1U4PA 1E0BA 5E4WC 3N52A 2HUGA 5DNFA 2HDMA 1HRJA 2CVRA 2FMMA 1U4LA 2K03A 5E4XA 5EJWA 4CJ0B 1MGSA 2J7ZA 1G2SA 1HFGA 2X69A 2L9HA 4R9WA 4R8IA 1ILPA 4XT3B 2B2VC 2B2YC 2EOTA 5EKIA 1HA6A 1CM9A 1DOKA 1NR2A 3Q6SA 4OIKA 1ICWA 5CORA 1ESRA 2FINB 5EPKA 4CJ2C 4IUVA 5EQ0A 5D14A 2B2TC 2NWGA 4LMQD 1ILQA 1RODA 5JJZA 2B2UA 4IUPA 1VMPA 3I8ZA 1NR4A 5CBEE 2D9UA 3G7LA 2KOLA 1HFNA 2B2WC 1SDFA 1J9OA 3DEOA 1NAPA 2K28A 1ZXTA 3F2UA 1PFBA 3H91A 1CA5A 3I3CA 2MP1A 2KVMA 2FHTA 2IL8A 4UAIA 3QO2A 2L12A 1F9PA 1DOMA 1QE6A 1WD0A 1RJTA 1JICA 2N88A 1B53A 4XDXA 1WTQA 1O80A 1QG7A 2RSNA 1PLFA 1RHPA 2FJ2A 1DOLA 1HUMA 3FDTA 5CBAE 2MPMA 1X32A 1PFMA 2L1BA 2M2LA 4OIJA 1MI2A 1XX8A 3UI2A 1B2TA 2EPBA 4IURA 1X3PA 1C8CA 1G2TA
chains in the Genus database with same CATH superfamily
1ZKOA 4GKJL 3ERSX 2F0NA 1X3EA 4RGNA 2B2TA 1V9PA 3IL8A 3TP7A 3I4NG 2EDGA 4X66Q 4K0KQ 1IXRA 3IAYA 2WB1G 4X64Q 2LMCB 3T1YQ 1IL2A 1M4VA 4I7AA 4OX9L 1Z9FA 2EJGC 3I4LA 4R8NA 1CA6A 1EY7A 2L15A 3J81L 4A3MB 4Y7NB 3MZ5A 4E6IA 1SYGA 4UDUC 4JI1Q 3HKZG 1JCKB 3R93A 1VQCA 3J7YW 1SYFA 3S1NB 3ER0A 4NP5A 3H0GG 2PNHA 3PCOB 1XNQL 1SMXA 2JXMB 1LT6D 1LUZA 2K75A 3G71A 1PDQA 2Z6KC 3CMAA 3GO5A 1X9NA 1AH9A 4RHSA 2CH4A 1R9TH 1ZYRD 3SK6A 4QY7A 1V1PB 5K36G 5J1ZA 1WCMB 1VDZA 4LFBL 3D8GA 3KOJA 5D3DA 4ODGA 1JJ2A 1NNXA 2EQSA 2E8GA 5D65A 4C3IB 2MGSA 4DV7L 1KD1C 3PF5A 1X6OA 1XWEA 4A3LG 3S1RH 2F3WA 1GVPA 1UE6A 2VZAA 3G4SA 1MHWC 5JVG3 3RZOH 3QR8A 4LNQA 3PUWA 4A3JH 1KC8C 1JWSD 1G2SA 5C4JB 3I72A 2K52A 5CV7A 3KK7A 4DUYQ 5KIXA 3D4RA 5IWAQ 2NN6G 1EY9A 2UXBQ 3BDCA 3ZJYC 1HR0Q 1UWVA 3OIQA 2VL6A 4B3TQ 2CWPA 4AYBE 5EGTA 4LK1C 4DAVA 1LTSD 3JAML 5JJKA 5JJLA 1EEFD 1BQQT 1EWHA 1O80A 2JA6B 1CKNA 2PQAA 4M8AA 1JWMD 1OTCA 3FKIH 3NPPA 1V43A 2UUCL 2K4KA 3VR4A 3ULPA 1L2FA 4NKLA 2N55A 3S15H 1SNMA 2E2HH 2HT1A 3IFDA 4XQNA 1YHAA 3ULLA 1LLRD 2F0MA 2KCTA 4IOCA 3NSWA 4KV6A 4TKOB 4G57A 3T1YL 2B63H 2JJQA 1VQ4A 3P1HA 2EXDA 3KBXA 3CD6A 3CCJA 3HOVG 1K28A 4YY3L 1JE4A 3GTPB 2ENBA 2J4XA 2A6EC 2WB1B 1SYBA 4O2DA 4K2LA 5JOBA 3KUPA 1XYIA 1M1KC 1KLUD 1I6HH 1E3PA 1S3OA 2EYHA 1KRSA 4EX5A 3I4MB 3FRPB 3S1RB 4DNTB 2F4VQ 5CMDA 2H1EA 2OQ0A 4JI2L 4PG3A 4XTCS 3CW2C 4JBJA 3W2DA 3T13A 4BBRB 2RCFA 1KDCA 4DR2Q 4DV4L 1LT4D 5C3EH 1VF7A 4DUYL 3PUVA 5M5XH 2CW0D 4KMUC 2DNCA 5ELDA 3MXUA 1UEBA 4FXDA 2NVXH 1N8RC 4FP5D 3K0XA 2F0FA 2NTSA 2K33A 1EOTA 2AQ2B 4HMJA 2JN4A 3F2BA 4JOIC 4EQPA 3OYYA 4DV7Q 2AUKA 1X65A 1H95A 2I5HA 3VYUA 4C3HH 3S17B 2K14A 2E74C 2MO1A 5ELFA 4DXGA 1PH5A 5M3FB 4LF9L 4KKTA 2XN9C 1C0AA 1WJJA 5D3IB 1D2BA 4C3HG 4C2MB 1K8AC 1CM9A 3HOXG 4GLVB 2GN5A 3KF8A 3TP8A 1LTRD 2JSOA 3QJYA 5C3XA 2P5ZX 5JJZA 1CSQA 2L0CA 3G7LA 1SDFA 1JWUD 3CCLA 2FMCA 4G4KA 5BN5A 1PFBA 5LMUL 3BYYB 1SLJA 3A74A 3F2DA 1KHIA 5ELNA 1JQYD 4QF4A 1TT2A 3A8IE 3RUZA 1OO9B 5C0XI 1Q7YC 1G6PA 2XSCA 1I94Q 3A8KE 2CHBD 4A3GG 1YJWA 2F52A 3OWFA 2MQHA 3I4OA 1GUTA 1HH2P 1C8CA 1T5XD 1HQRD 2PZTA 3URYA 3HOYG 4GN3B 3KDFA 1STYA 2YTYA 1AEXA 1N33L 3AYHB 4UP7A 1PZJD 4DK6C 1K0SA 3STBD 4KY5A 1MSHA 4N8FA 1PRTC 4EQNA 5C4JH 1NBWA 2XRSD 5EBDA 2EY1A 1KXLA 4LFAQ 1ZYRC 1IBKQ 5T1IA 2R92H 1TKWB 2EYLA 5E3FA 4DV0Q 4DR6Q 1VF5C 2R7ZG 2RDFA 1EFID 3TMEA 2K5HA 4L5TA 4X3KA 1I4GA 5IGGA 3K5OA 2R93G 5ELEA 5KGUA 3KLWA 2XVSA 4K5VA 2F0OA 4XYOA 2DJGC 4LF8L 2PYKA 4IZ8A 1YZ6A 1BNZA 3GD7A 4JI5Q 2R7FA 4CGYB 5IT9E 1RDPD 2KJXA 4AQYQ 1XNRQ 1HUNA 1STAA 2BH2A 1CTMA 3DHQA 4B3SL 1X56A 2BCOA 1F2MA 4JI8Q 3J7AV 1V1QA 4A3DB 4KHVA 4K2KA 1EWCA 4GNXC 1B7YB 1PYBA 2TMPA 4F7XA 1U4PA 1QZGA 4G7ZC 1WOCA 3O13A 3U9OA 3CHBD 3DWQA 4ZRZA 1ILPA 3MXNB 1X54A 4A3LH 1ESRA 3KF6B 3FVQA 1JORA 1WCMH 3CAMA 1SE8A 5EQ0A 3VA7A 5BN4A 4GNXA 2UUAQ 1VMPA 1AN8A 1HNXL 2I5LX 1NMGA 4A3KB 1W3SA 2F0PA 1HZAA 1PRTB 1V1OA 1IYUA 1GUNA 4G7HC 3HOXH 1EIFA 4O0AA 1EY4A 1YBYA 2IL8A 1V8QA 4HJ8A 3T53B 1WD0A 5JPMC 1JE5A 4RGTA 5I9OA 4R4CA 2K5DA 2RDHA 3IFTA 1AFPA 2MPMA 1A63A 4OIJA 3I73A 1UUPA 1CUKA 3W1GA 4AIMA 3KJPA 1IKLA 5JEAJ 5I4DA 2B2UC 5JPNC 1HNZL 4LW1A 1IBLQ 2C5CA 1XMOQ 4HJ5A 1SJHD 1UEAB 1KL9A 4NXMQ 3J81E 1JB7A 1M90C 1VQJA 2VXWA 1XTDA 4FF4A 4C2MH 2BH8A 3G48A 1AZPA 5AFWA 4IPCA 4X3TA 1ET6A 1BCPF 4CDFC 4A3FB 2E2IB 2YV5A 2WIIB 3MXNA 4ALPA 3S1MH 4NDXA 2KECA 2EYJA 5IYCG 1S40A 2HIVA 1TWFB 3BG3A 1ESFA 4P74A 4U68A 2EY5A 1SFOB 1HQMC 4B08A 4POFA 1XTCD 5J3BA 1WTWA 2CWAA 3OW7A 2EIFA 3SK8A 3I56A 4A3EG 3K80C 4DR7L 4IO9A 4CKCA 1XNQQ 2EYOA 1EY8A 1STNA 2KCNA 3GTJB 3P75A 4F88A 1CQFA 2K50A 1CZGA 3PQIA 4QJFA 3HOVB 1EL0A 5FOBB 3EROA 2BE5C 3WDNA 2F0DA 4IALA 3H3VH 1LM0A 1BCPC 3M4PA 3VR2A 1BUVT 3Q22A 4JI6Q 5EPKA 1ET9A 3TEHB 3A8JE 4UPAA 2GA4B 4BA2I 1ILQA 2B2UA 1L1OB 3I8ZA 3IRBA 1F2ZA 4YHHL 4K14A 3RNUA 4JOIA 1JOKA 1Y8OB 1LT5D 3MEFA 2D62A 3HOUH 3NQTA 3OPOA 3TP5A 3PO2G 1QE6A 4A3JG 4L8JA 1D8LA 1TWCH 3VR3A 1IBML 4PMCA 1OXXK 4IURA 3HRZC 3MXGA 4ME3A 3FPUB 3OTOQ 3S1QH 5C0XG 2K1BA 1PH4A 3MFYA 3UDIA 2WP8J 1ASZA 1VMCA 3BDOA 5C4XB 2B2VA 3PUZA 4KK7A 1GM5A 1EIYB 1PH3A 1QCBD 4FDBA 2L4NA 1TS5A 3FKIB 1KAAA 2UXCQ 1CKMA 1BVSA 1F77A 2OF1A 1SN8A 4OXPA 2F0JA 3H0GH 1G91A 3FPPA 4GN4B 3SEBA 1BBXC 3FEWX 1MJEA 5FO9B 1D5MC 1B50A 2KUMA 2ZTCA 3RMHA 3TS0A 1DZ1A 4HIMA 3H94A 3M9BA 3PUXA 2PO4A 4R1JA 4NXNL 3HOZG 3A5ZB 4L6TB 4X3SA 4J15A 4RGOS 3S16B 2ES2A 3PO3H 4ZUIA 4I7ZC 1T9HA 3KYHC 2C35B 1XPOA 2RF4A 5HGTA 1W6JA 2HCCA 2NVXB 3W5OA 2EZVA 1U4MA 2EYMA 1ENAA 5M3FH 2ALYB 4K8IA 2XRQD 3CRLC 2K7VA 2A6ED 2J0TD 5I9PA 2F0UA 4YWMA 4Q0FA 2G5DA 4FXKC 5IY0A 3S1MB 4KY6A 1PA6A 2HUGA 1I50B 3HFZB 1U4LA 2K03A 3L9AX 5EJWA 1JR0D 2DGYA 2B2YC 2FXQA 4LF7L 2Q2IA 3F1ZA 3L7ZC 1PH8A 3CPFA 4A3FH 1VQHA 4G7OC 4LMQD 1RODA 4JI0L 2EXZA 1N9WA 2EJMA 2YU9B 5ELBA 4EQ5A 3SK4A 4HIKA 2KVMA 2IJ0A 2QCPX 5CV5A 1VQ5A 4Y7NH 1S5CD 2IX0A 2RSNA 1DXMA 1A0IA 5I6YA 5IYBH 3D6CA 3M85A 2IWHA 2BA0A 2EPBA 5C4XG 4OWWB 1UNSA 2O5IC 1GXDC 3H3VC 3STBC 1PRTF 4JPBW 5NUCA 1S5DD 3GTKH 2K5WA 2QA4A 2N8NA 4BY1G 4JV5L 4ZCKA 1PTOF 3DM1A 1GUSA 3BYTB 4ZQ3A 1CHPD 4BY7H 3DLLA 1N36L 2ASBA 1Y1WG 1RIPA 1QOHA 3CC7A 2E76C 1EIHA 4ZK9B 3CF5A 1XMQQ 4KHZA 4A93H 2JA8H 5EAYA 3ND8A 3M4OB 1K9MC 2QILA 3KLSA 4RWSC 2A8VA 1FNUA 5IYDG 3TQYA 3IKJA 1PH6A 5K5PA 4HJ7A 3HOYB 1JMCA 3ONAB 4OO1H 1HJPA 3PGZA 1IZ6A 4M1UB 3I91A 5C5MA 3Q24A 2K6AA 4B3MQ 4QIWB 2VB2X 3R3OA 1VQ9A 2OTLA 2KEEA 3KJOA 4B3RQ 2F3VA 1A8VA 1D7QA 1ENFA 1EY5A 5EPJA 3A5UA 3I2ZA 2DY7A 2WAQE 1EU3A 2C9OA 1EEID 1OXUA 5GROA 4BBSB 5E7NA 2KCCA 4P2CB 4H0LC 1VQBA 5IP7G 3JAMc 3QG1A 4JG2A 1GHKA 1HA6A 2JA9A 3KDFB 3TREA 3CCVA 3CC4A 1T5EA 2O2LD 3SK5A 1KLGD 1GD7A 5CC4A 1SEBD 4X6AH 2NVYH 5A2QL 5EKLA 1CZWA 3A54A 3OSOA 5JAVA 2B2WC 1EZ8A 4UP8A 3HOVH 2UUBQ 5JJIA 2ZM6Q 4C1NI 3H6MA 1Y1VG 3PSIA 3GTOB 2FHTA 1LO5D 1IW7D 3T51B 1JJGA 5J39A 4HJ9A 1RJTA 1JICA 5L37A 3A0JA 1WTQA 2E2JH 3KFUA 4DV4Q 4DV5L 3LGJA 1PH7A 1QVGA 1X55A 2K32A 1SBBB 4YCVA 5ELOA 2K01A 2ICIA 4YY3Q 1N34Q 3MTSA 1N32Q 5E1FA 3K5NA 1B1ZA 1RL2A 1SE4A 2WKDA 2K5NA 2CFMA 2UXCL 4UP9A 4WORA 2KEDA 5FKAC 5C44H 2CQOA 2RKSA 5KNCA 1TWFH 4LF7Q 3U4ZA 1P8LA 3D6WA 1YITA 2HIXA 3AU7A 4J6HA 5FK9C 3NUCA 3X3MA 4LFCQ 4LF9Q 2Z8LA 1YI2A 2F0WA 2IX1A 1SNPA 5IGBA 2R92B 4J1MA 1TR5A 3VYRA 1PH2A 2VY3A 1SSOA 4GZYC 3J81j 1CHQD 4LUZA 5IP7H 3E5SA 3Q8DA 2OXPA 5KNBA 3HG9A 1YNND 1R4QB 2Y0SE 1TXYA 3J7ZC 1XPUA 4HAEA 1SR3A 5FJ8H 3J7A5 3M7GA 3BVMA 2QW7A 2HHHQ 1HXYD 4DAYA 2OTJA 1SMYC 1TS3A 1TWGH 3HOZB 3CCQA 1A15A 3NHHA 1YJNA 1CKNB 2PQAB 1KNAA 3A7AB 1LTLA 2AWOA 5K36H 1SMYD 2NYZD 3OMGA 1E2ZA 4H02A 3I4MH 3C1EA 1YVCA 1F2YA 5IYDH 1J6QA 2QKIC 3OHXC 4GOPC 2B63B 1U0LA 5M5WH 2R61A 4OHJA 4A93G 1RCVD 2QEJC 1Y69U 2L9HA 3NWSA 4JW0A 1B3QA 3Q6SA 1XPRA 5CORA 1BOSA 1Y1WH 4IUVA 3EA6A 1MD2D 5IP9H 5CV6A 5TSSA 3MFGA 5M9OA 1VQKA 4P71A 5CV4A 1Z47A 1ZEQX 4X62L 2I5MX 1LABA 4H7BA 3ITPA 4HIDA 5A2QE 1FVIA 3ERQA 2JA5B 3HGBA 5C3EB 4N9PA 5C44B 2Y0SG 2Q2UA 1Q81C 1YIJA 2A68D 1F9PA 3U58A 1LYLA 4FYDA 3I55A 1EQVA 1SYDA 2QDBA 4RG1A 5IYBG 4DR2L 2D5DA 3NE5B 4DR1Q 1N32L 2HD3A 3MAQA 3T4AC 3CCUA 2NVQH 4PMBA 3WOEA 1J8IA 1PZKD 4ABNA 4KJOA 3H0GB 1XJVA 2ICEC 2HQEA 3V96A 1Q3LA 1DJRD 1SAPA 5C4HA 4ZKBB 1WTHA 2JP1A 3GV3A 5M3MG 3VR5A 1FNWA 1A6XA 4K6DA 3BVZA 2WB1E 3TS2A 1PRTD 5IGCA 2DN8A 2LXKA 2KENA 1KTKA 2F0GA 2BOSA 2B8FA 2B29A 3CPWA 4PV1C 3VR6A 1EIGA 5T1GA 4JI7Q 4MHEA 3DEPA 1A3VA 3OWEB 2IT1A 4AH6A 2PI2A 3CCSA 1Q46A 3QOJA 4EVOA 4EQOA 2Q2TA 4LFCL 2F0EA 2IHEA 1EQRA 2PMZE 1BDOA 3PIO3 4XXEA 3OW2A 5IGEA 1WTRA 3D0FA 1BO0A 2WAQB 1S4ZA 2NN6I 1RTOA 4P75A 3RD4A 1HNZQ 3U50C 3QIAA 4I65A 3PIP3 5IE8A 2JA8B 3C1FA 2PW7A 3P20A 5DM73 1LTBD 2ZJRA 3PO3G 5IGDA 3FMCA 1LV9A 2AMCB 1MIUA 1AW7A 1H9JA 1E0BA 1FNVA 5DNFA 1D1IA 3NBIA 2J7ZA 1JB3A 4R8IA 5FO7B 1PHJA 4OX9Q 4OO1I 1QVFA 1B9MA 4XYQA 5ISRA 1S5BD 4V0BA 1DM0B 1Q12A 1DCZA 3C3LA 3K57A 1HCZA 3I4MG 3FHWA 4AYBG 4A3IG 3S1QB 2JEBI 3S1NH 3T16A 2JEAI 3LWUA 4R4TA 1K3BC 2OQKA 4V190 1LTTD 3KF6A 4KKSA 1QG7A 2BDOA 2EY6A 4FVMA 4IPDA 5C6AA 4A3KG 1GHJA 1VQ8A 4NPSA 3NELA 2MUYA 4JBKA 3VA5A 1N34L 1E2WA 4X3UA 4A3DG 4QUCA 4C3IH 1YJ9A 5DEHA 2OCEA 2VS1A 3UDFA 3M4OH 1O7LA 3S14B 4LF6Q 2NZHA 4DV5Q 4WJ4A 4K8JA 4LUVA 2NZ1D 4X64L 4IOAA 1NJIC 1STEA 1GUOA 3F8TA 1SXTA 1IL8A 3VYSA 5C44G 4HEDA 3JC66 4KN4C 4PZ7A 1OXVA 2A68C 3AFPA 1MSGA 2UUBL 5HY6A 1O78A 3CRKC 2VQFL 2Z6BA 2NTTA 1VQEA 1HZ9A 4KHPQ 2BE5D 2LY7A 1O7IA 2V1CC 1TY0A 2VNUD 1NSNS 2AUJD 4PMWA 5AJ3L 2V4DA 1NCVA 3OIPA 4BBSG 1V1PA 4KI0A 1TQOA 5CR3A 1JOQA 3GQBA 3V2TA 4A3CG 1D5ZC 2KA7A 1EUJA 1TWHH 1FL0A 2YTXA 5JVH3 1Y14B 3ICEA 2E2IH 4CJ1B 3W3AA 4JI3Q 1A3TA 1UAPA 5IT9c 5CV8A 4OWXB 2I07B 3E6ZX 1I50H 4A3BG 4DR3Q 1EYDA 5G3LD 4X65Q 1YHBA 3DUZA 3QB3A 1ENCA 1Y8PB 3CCRA 2CVRA 3GTOH 2IY5B 1II3A 2F4IA 3GTQB 2B2VC 4OWTB 2EOTA 4LUOA 5LL6X 1PZID 2GVAA 1CQVA 1I4PA 5F2DA 1B8AA 4KTAA 3PF4A 2F0QA 4CDCC 1N33Q 1AE2A 1KDBA 1S72A 3H91A 1SROA 1VQFA 2WFWA 2L12A 1FGBD 2XWBB 3TDQA 1BR9A 1OXTA 4QQBX 2KHSA 1VQDA 1RHPA 4LF8Q 5A35A 3UI2A 2QGQA 2M2LA 4DK0A 1I4RA 1XX8A 4S3SA 1B2TA 4F8MA 4DK1A 1X3PA 1P16A 2R7DA 4OO1G 3JAMi 2PMZB 1G291 1VQ6A 2DNEA 1EYAA 2F0SA 1I3QH 5JEAH 3S24A 1Q8IA 2M00A 1EWIA 3RZOB 1TWAB 3PIPA 4JC0A 4NW2A 3HS0C 1WVLA 1PFSA 4DXFA 1TWCB 2O4XA 4HSVA 3R2IA 2HDLA 2SNSA 1F2LA 4XIGS 2G9DA 2SEBD 4BY1H 2R3ZA 3DXJC 5GAGC 1X3QA 3E9IA 2ZM6L 1A62A 4CBVA 2NUCA 3NBHA 4CKEA 4QGUA 3MHBA 3AQQA 2YU9H 3S2DH 4WFN3 1DD2A 1HNWQ 1QNUA 2IPKD 1ML0D 2O5JC 5FLXc 2N3SA 4HIOA 3H15A 5DM63 4O42A 1I4QA 4DKAC 1CI3M 3HOWH 3VYTA 4RAUC 1GO3E 4C3JG 5FLXE 1O7YA 5M3MB 4DR3L 1A2UA 1B3AA 4JI2Q 1DYQA 1F9SA 1AE3A 2B2WA 2ZTDA 4MN3A 4LF5L 2QF7A 1Q86C 4IUTA 1B70B 4A3CH 3AFQA 3J80L 4ID6A 1KAWA 2R92G 4R9WA 1SYCA 1H9RA 3EVQA 3RN5A 1LACA 4BY7B 1IYJB 2A19A 2Y0SB 5D14A 2B2TC 4UY8C 5BN3A 2XWJB 5IWAL 4DAYB 2VQFQ 3J80c 3K5MA 1KABA 1LTGD 2F4VL 5LMNL 4OELB 1I5FA 1J9OA 2F0TA 3HOWG 2K28A 1ZXTA 1C7YA 1VQPA 3BU2A 3F2UA 4JK1C 3NWTA 2L5TA 1PXUA 4GN5A 3I3CA 4PZ8A 1NTGA 3QOLA 1DOMA 3HOYH 4Z9CB 4L5RC 1Y1WB 2N88A 1PYWD 1B53A 1EYCA 3CMEA 1PLFA 2FJ2A 4DAPA 1XMOL 4ZUJA 3MA2B 1PFMA 4BY1B 4LFBQ 2A74C 1WFQA 2JA5H 3WWVA 2ATWA 4RKLA 4C3IG 4DR7Q 1HZBA 4A3DH 1BXTA 3OTOL 2Q8RE 3LWEA 3GTGB 4DV6L 3PO2B 2E5LQ 2JK8A 2KHJA 1VQIA 4RKBA 1LTID 4B9XA 3S2HB 1TIID 1VQLA 2PZUA 3GV6A 4KLKA 4QL5A 5JEAG 1H9SA 3NTIA 4YCUA 1ASYA 1A3UA 4LF4L 3SVMA 1LT3D 1PTOC 4YHHQ 1BF4A 1BCPB 4ZKCB 4IFDI 1YEZA 4L5QA 4OONA 3CP0A 2UUAL 5LMNQ 4CDEC 2EE1A 3TN2A 2RBMA 4KN7C 4C56C 1E2VA 2VUMH 2AQ3B 4DR1L 1FD7D 1HR0L 2EVBA 2Z1CA 1PTOD 1E24A 5GADC 2Q8TA 2RSOA 1K3RA 1MBYA 3N6RA 3SGIA 4DA2A 4JYAL 3KLSX 3NK9A 3MC0B 3BS1A 4PQXA 2NVYB 1PV4A 1OXSC 4BXXH 4NB3A 4XQQA 1D6EC 3CQZH 4JI8L 3V05A 2B8GA 5C3EG 3CXCA 3SR1A 4LF5Q 4N9TA 1ICFB 2JA5G 4B3SQ 1PVOA 1O7ZA 1GKHA 2OEOA 1PMRA 3GTLB 3CU7A 5E4WC 4P72A 1TWAH 5CGKA 2FMMA 4ME5A 4K5XA 1EQQA 3DM3A 4QMGA 3U4VA 3HEJA 2NVTH 1E7ZA 4X62Q 4RCOA 2JA7G 2IHFA 4JI3L 3K58A 1TWHB 2PW5A 1CSPA 1FYCA 4X66L 4K0KL 3ZYYX 4DV0L 4IUPA 2JA7B 1H9SB 1W2BA 3AMUA 5G3LF 1NAPA 1SNCA 2VQEQ 2KBNA 2OT2A 3ULJA 1WYDA 1J5EL 3DWPA 4HTHA 4DV1Q 4B9WA 1HA5A 3T1HQ 2ZTEA 4JCVE 3PUYA 2WV6D 4BWGB 1EY6A 1Y1VH 1C48A 5M3MH 2NB0A 3VDYA 3HKSA 1E1TA 1FGUA 2FFKB 4FO2A 5EPLA 2RHSB 4C3JH 3A56A 4JI5L 4DV2L 3BJUA 1Q90A 5I2YA 1SNDA 4KY7A 3OMCA 3GTMH 4A3JB 4LWCA 1WD1A 1A2TA 3M7NA 3E9HA 1VQMA 1QJOA 2IX3A 1D1KA 4RH6A 4IJHA 3AB9A 3EFXD 4MNOA 2X6GA 1K83B 4H44C 2MJ8A 3K7UC 3J81i 2YYZA 4A3KH 2QDLA 4JI0Q 2L11A 3QWNA 2D0PA 3TP6A 2A6HD 2RHQB 3LX0A 3KLRA 4DV1L 1HR0W 5M5XB 2PPBC 5COYA 5IP9G 3K0YA 3NEMA 1U9RA 3EJIA 1Z6HA 4R4IA 2DJFC 1IHZA 4GNXB 1HHVA 4TRDA 1JJCB 1F9QA 1S5FD 1SRUA 4OEMB 2K5VA 5IIFA 2F03A 1KDAA 4ZLTF 2ZXOA 3M4YA 5IOCA 3I90A 1JT8A 1QNKA 2XNAC 4NMZA 3NP8A 4CDDC 2UXDL 1EQTA 4IUQA 1BBUA 2D0OA 4MTKA 2LXJA 4O1NA 5FLXL 3N52A 4AQYL 1XNRL 1C4QA 1HRJA 2R93B 1PTOB 1MGSA 4KJNA 1HFGA 1E22A 3HOWB 3RLOA 4CJ2C 3KBGA 4DAMA 1RKNA 5EKKA 3JAME 2CKZB 4A76A 4DF7A 2NWGA 2UXDQ 3GTPH 4OGQC 1YNJC 2TSSA 1VQ7A 3TRZA 3DEOA 3CC2A 1TS2A 1K8OA 1QB5D 3X3NA 2A6HC 3I4NH 1CA5A 2CQAA 4GLXA 3MXPA 3SE0A 3BZDB 4WRDA 2A73B 2F0HA 2MFIA 4XDXA 1VQOA 3I70A 1JOOA 1DOLA 1HUMA 2RDGA 4A3BH 3H3VI 5FLMG 4JV5Q 1HPCA 4UHVA 3L0OA 5H1SE 2VB3X 3EQLC 3A7LA 4ILWA 4IJLA 4A3EB 5GQOA 2UUCQ 1I3QB 2CH4W 4JI4Q 4RA8A 3D4WA 4B3ML 5LL6S 1I94L 2RVLA 4KKUA 4QUFA 2PZWA 5IT9L 3BVGA 1IW7C 2X6LA 4LF6L 1WTVA 1EFWA 1UE1A 1FJGL 2YTVA 2XIWA 5EBCA 4DFAA 4B3TL 4A3MH 2H4OA 1XMQL 1DGSA 3A55A 5DAUA 4C3HB 4IQZA 3TZUA 1SNOA 5M3FG 2UU9Q 1TY2A 4K5WA 3T1HL 4R4OA 2EY2A 3U9SA 4JI6L 3NTKA 2K04A 4K6LA 4KD3A 2B39A 1L1OA 1VQNA 1PH1A 3FP9A 1STGA 4A3GH 3HKZE 1WTPA 4L5SA 1HTPA 3GTQH 1VQAA 3K7AB 5I2XA 2PI2E 2ZJQA 1Q8KA 2RQXA 1E1OA 3BDLA 4IFDJ 1STHA 1Y8NB 4DUZQ 2WAQG 3M3YH 5HURA 1BKBA 2A69C 1GUGA 4FF2A 1H9MA 1ONLA 2XTIA 1KIXA 1L1OC 4JI7L 1I6HB 1SNQA 1YNNC 4DPGA 3C2PA 5E4XA 3Q23A 2EJFC 4GS3A 1VQGA 4XT3B 3GTMB 2VUMG 3E0EA 3SDZA 2F3IA 4JBWA 1NR4A 2A5HA 2D9UA 4EGVA 4P73A 2F1MA 1XXGA 2MP1A 3TBIB 4PNYA 4JBMA 5FJ8G 3HOUB 2ZJPA 4DR5L 2VW9A 2Q2HA 3RLFA 2AKWB 4JYAQ 1G51A 2Z6KA 4KHPL 4RGMA 3FDTA 4DU9A 2Z9HA 5LMNW 2DUDA 4R4QA 2L1BA 3L3OC 4FNFA 1MI2A 2JQOA 5LHY1 3C46A 1Q1BA 1HZCA 4WJWA 1G2TA 3GP7A 2JYOA 3MEHA 3J81c 1NY4A 4CHTB 4GKJQ 3S15B 1Q82C 1K8GA 3W1BA 2B2YA 3HP3A 5C4XH 4GKKQ 3WOFA 2WACA 1DONA 4HCEA 4GKKL 1I4HA 4A3GB 1B9NA 5CV9A 2E5LL 3ND9A 1GJXA 3G6JB 1NE3A 4POGA 2LKVA 4RMFA 3J80i 2K05A 1X3GA 5LMUQ 4A3BB 1K0RA 4RCNA 4XQJA 1GOZA 1KNEA 2K5QA 2Q8IB 4A3EH 4A3FG 4Q5VA 4HJAA 1QILA 4HSPA 3F2CA 4DR5Q 1WTOA 3PIOA 3S16H 4L63B 2SDFA 2G9HD 3HOXB 3S14H 3KF8B 2KHIA 3R2TA 1B44D 2M9VA 5KNDA 4DK3C 3GTJH 1S5ED 1EZ6A 5CYUA 2AHOB 2Z4HA 2VQEL 3RZDH 3RR5A 1AP0A 3NQIA 3MWYW 2RA4A 3E3XA 1U4RA 3TZDA 3EBEA 4YIJA 4CKBA 1D5XC 1SJED 1IKMA 2NN6H 1W6KA 1NMFA 5M5WB 1IYVA 1QVCA 1R4PB 4CJ0B 3CQZB 4X65L 4QB4A 5EKIA 4A75A 4AYBB 4A3IB 1DOKA 1NR2A 1ICWA 4FXGC 1TU2B 5IGFA 4GOPA 3M4QA 2D2CC 1H9KA 1EU4A 4NXNQ 2E2DC 4JI1L 2HQLA 4ULLA 1YNJD 3Q0AA 1KQSA 1HFNA 2LSSA 3LNNA 2I0QA 4MZ9A 3D4DA 3K8AA 4A4IA 4UAIA 5J22A 3UDXA 1NUCA 3BZKA 3NBHB 2NVTB 4DNIA 4C3JB 5C5LA 2CW0C 4LJZC 2HHHL 4QCLA 1TWGB 2RCNA 4FF3A 2GVBA 1CFMA 4APVA 1X32A 3NTHA 2A69D 4RHRA 2JA8G 1CT1D 2E75C 4ZAIA 2IW3A 5M5YH 3GTGH 1MKHA 5C0XH 2HCIA 3D31A 1PFNA 1K83H 5BR8L 1EYGA 2AWNA 1SFOH 3HZXA 5DLQE 2F0IA 4J8QA 1UE7A 1IBMQ 2KCMA 3UE0A 1EOVA 1Y1VB 3PV0A 4NXML 5KEEA 4DV6Q 4HMIA 4YWLA 1RF2D 1IBLL 4YWKA 1VCIA 1TS4A 3EIVA 2EYFA 4IUUA 1HNXQ 1B4OA 4IN3A 1KRTA 4QIWE 4GLAC 1STBA 1G6ZA 4MTNA 1K73C 1PH9A 3S17H 4DV3Q 5I6WA 3AEVA 5KYLA 1EY0A 2PCFB 1YHQA 2R93H 4IPGA 4DGZA 3CCMA 4HR7B 2NVQB 4IPHA 1QUQA 2NBFA 4DUZL 3GTLH 1MJCA 1FR3A 1TVXA 4BBSH 4TVAB 5GAEC 3MVVA 3T56B 4B3RL 2ZT9C 3BZCA 2HDMA 2QEXA 2Z0SA 1FJGQ 2X69A 2MNAA 1BCPD 2N78A 4GOPB 3R8BA 2JA6H 4OL7A 2FINB 4DNRB 4WJ3M 1CK1A 2JA7H 2I46A 4LAAA 1L0XB 1C9OA 1LTAD 3EN2A 5CBEE 2OWOA 3PMFA 5IODA 1IBKL 1RD9D 2L55A 2R6GA 1I4XA 3S2DB 4DR6L 3NXWA 4H13C 1PTOH 1VS0A 3DWAA 1SE2A 4KD4A 2BA1A 3L2PA 2CCZA 1L0WA 4DR4L 4JVZA 3K59A 4FF1A 2E2JB 1HNWL 3HOZH 5CBAE 1Z7TA 2B3GA 3K6OA 1L0YB 3GDEA 2UU9L 4BXXG 2PNRC 2LS01 3RZDB 3I7FA 2EYPA 3GTKB 2R7ZB 3H09A 4BS9A 1HTLD 1QUQB 2BDNA 4DV3L 2NZOA 1N36Q 4BBRH 1BBWA 1R9TB 2F0VA 2XGTA 1WI5A 4IFDH 4IFDG 4A3IH 4BA1I 4A93B 2ID0A 2DY8A 3B6YA 4JI4L 4BBRG 2LFNA 4RFBA 1PYSB 5KYIA 2MO0A 3CKIB 4LFAL 2JE6I 1RTNA 4IUNA 1GUWA 2UXBL 1AZQA 5GAHC 1K8MA 1WCMG 4DN4M 3PO2H 3RLNA 4BY7G 3HOUG 1UE5A 4C1NK 4MIUA 5BR8Q 4U673 1YNXA 3P7JA 1F9RA 3S2HH 1X3FA 2F0KA 1QZHA 2AQ1B 4HCSA 2F0LA 3OOCA 3K81C 3SXHA 5FO8B 3E0JA 2SOBA 5C4ZA 3K5LA 2WKCA 1WTXA 2E2HB 3UE1A 5M5YB 4XT1B 2SNMA 3M3YB 4ZYSA 2VUMB 4TSSA 3HKZB 5C0XJ 2KQ3A 4DR4Q 1CKOA 1SE3A 5HGQA 3CCEA 4PZ6A 3G6EA 4A3MG 2B63G 3K7AH 4HN7A 2PQEA 2JA6G 2WINB 4OIKA 2N49A 4TQUS 3NENA 4YCWA 1JC7A 4N8X1 3S9WA 3J7AF 3DMUA 2H5XA 3I4NB 2ZXPA 2KOLA 2R7ZH 5C3WA 4LF4Q 1U5KA 5ELCA 1QWYA 3SHLA 3FKIG 3PO3B 2Z4IA 1I6VC 3QO2A 3J80E 2ZXRA 3UDGA 5KRUA 1Q1EA 4Y52H 4F87A 5AJ3Q 1SYEA 5IYCH 5FLMH 3RN2A 2MHVA 3D3RA 3TSSA 1J5EQ 2A1AA 4DV2Q 1G8ZD 1M8AA
chains in the Genus database with same CATH topology
1ZKOA 2F0NA 4RGNA 2B2TA 3IL8A 3TP7A 2EDGA 3IAYA 2LMCB 1M4VA 2EJGC 3I4LA 4R8NA 1CA6A 1EY7A 3J81L 4A3MB 4Y7NB 3MZ5A 4E6IA 1SYGA 4UDUC 1JCKB 3R93A 3J7YW 1SYFA 3S1NB 4NP5A 2JXMB 1LT6D 1PDQA 3GO5A 4RHSA 1ZYRD 3SK6A 1V1PB 5K36G 5J1ZA 1WCMB 1VDZA 3D8GA 5D3DA 4ODGA 4C3IB 5D65A 2MGSA 1XWEA 2F3WA 5JVG3 3PUWA 1JWSD 1G2SA 5C4JB 3I72A 5CV7A 3KK7A 5KIXA 3D4RA 2NN6G 1EY9A 3BDCA 3OIQA 5EGTA 4LK1C 4DAVA 1LTSD 3JAML 1EEFD 1BQQT 1EWHA 1O80A 2JA6B 4M8AA 1JWMD 3NPPA 1V43A 3VR4A 4NKLA 2N55A 1SNMA 3IFDA 4XQNA 1LLRD 2F0MA 3NSWA 4KV6A 4TKOB 4G57A 3P1HA 3KBXA 1JE4A 3GTPB 2ENBA 2J4XA 2A6EC 2WB1B 1SYBA 4K2LA 5JOBA 3KUPA 1XYIA 1KLUD 2EYHA 3I4MB 3FRPB 3S1RB 4DNTB 5CMDA 2H1EA 4XTCS 3W2DA 3T13A 4BBRB 1KDCA 1LT4D 1VF7A 3PUVA 2CW0D 4KMUC 2DNCA 5ELDA 3MXUA 4FXDA 4FP5D 2F0FA 2NTSA 2K33A 1EOTA 2AQ2B 4HMJA 4EQPA 2AUKA 3VYUA 3S17B 2E74C 5ELFA 4DXGA 5M3FB 4KKTA 2XN9C 5D3IB 1D2BA 4C3HG 4C2MB 1CM9A 3KF8A 3TP8A 1LTRD 2JSOA 3QJYA 5C3XA 5JJZA 2L0CA 3G7LA 1SDFA 1JWUD 2FMCA 5BN5A 4G4KA 1PFBA 3BYYB 1JQYD 4QF4A 1TT2A 3A8IE 3RUZA 1OO9B 5C0XI 2XSCA 3A8KE 2CHBD 3OWFA 1GUTA 1C8CA 1T5XD 1HQRD 2PZTA 3URYA 1STYA 1AEXA 1PZJD 4KY5A 1MSHA 1PRTC 4EQNA 2XRSD 5EBDA 2EY1A 1ZYRC 5T1IA 1TKWB 2EYLA 5E3FA 1VF5C 2RDFA 1EFID 3TMEA 5IGGA 4X3KA 1I4GA 3K5OA 5ELEA 5KGUA 2XVSA 4K5VA 2F0OA 4XYOA 2PYKA 4IZ8A 1BNZA 3GD7A 4CGYB 5IT9E 1RDPD 2KJXA 1HUNA 1STAA 1CTMA 3DHQA 2BCOA 1F2MA 3J7AV 4A3DB 4KHVA 4K2KA 1EWCA 4F7XA 2TMPA 1U4PA 4G7ZC 3O13A 3U9OA 3CHBD 3DWQA 4ZRZA 1ILPA 1ESRA 3FVQA 1JORA 5EQ0A 3VA7A 5BN4A 1VMPA 1AN8A 4A3KB 2F0PA 1PRTB 1V1OA 1IYUA 4G7HC 1GUNA 1EY4A 2IL8A 1V8QA 3T53B 1WD0A 5JPMC 4RGTA 5I9OA 2K5DA 2RDHA 3IFTA 1AFPA 2MPMA 4OIJA 3I73A 1UUPA 1IKLA 5JEAJ 5I4DA 2B2UC 5JPNC 2C5CA 1SJHD 1UEAB 3J81E 2VXWA 4FF4A 1AZPA 5AFWA 4X3TA 1ET6A 1BCPF 4A3FB 2E2IB 2WIIB 3MXNA 4NDXA 2KECA 2EYJA 1TWFB 3BG3A 1ESFA 4U68A 2EY5A 1SFOB 1HQMC 4B08A 1XTCD 1WTWA 3OW7A 3SK8A 4CKCA 2EYOA 1EY8A 1STNA 2KCNA 3GTJB 3P75A 4F88A 1CQFA 1CZGA 1EL0A 3HOVB 5FOBB 3EROA 2BE5C 3WDNA 2F0DA 4IALA 1BCPC 3VR2A 1BUVT 3Q22A 5EPKA 1ET9A 3A8JE 2GA4B 4BA2I 1ILQA 2B2UA 3I8ZA 1F2ZA 4K14A 1JOKA 1Y8OB 1LT5D 2D62A 3NQTA 3OPOA 3TP5A 1QE6A 4L8JA 3VR3A 4PMCA 1OXXK 4IURA 3HRZC 3MXGA 3FPUB 5C0XG 2K1BA 3MFYA 2WP8J 1VMCA 3BDOA 5C4XB 2B2VA 3PUZA 4KK7A 1QCBD 2L4NA 1TS5A 3FKIB 1KAAA 1F77A 2OF1A 2F0JA 1G91A 3FPPA 3SEBA 1BBXC 3FEWX 5FO9B 1D5MC 1B50A 2KUMA 3RMHA 1DZ1A 3H94A 3PUXA 2PO4A 4L6TB 4X3SA 4RGOS 3S16B 4ZUIA 4I7ZC 5HGTA 1W6JA 2HCCA 2NVXB 2EZVA 1U4MA 2EYMA 1ENAA 4K8IA 2XRQD 3CRLC 2K7VA 2A6ED 2J0TD 5I9PA 2F0UA 4Q0FA 4FXKC 3S1MB 4KY6A 2HUGA 1I50B 1U4LA 2K03A 3L9AX 5EJWA 1JR0D 2B2YC 3L7ZC 4G7OC 4LMQD 1RODA 2EXZA 2EJMA 2YU9B 5ELBA 3SK4A 2KVMA 2IJ0A 2QCPX 5CV5A 1S5CD 2IX0A 2RSNA 1DXMA 5I6YA 3D6CA 3M85A 2IWHA 2BA0A 2EPBA 1UNSA 2O5IC 1GXDC 3H3VC 1PRTF 5NUCA 1S5DD 2K5WA 1PTOF 3DM1A 1GUSA 3BYTB 4ZQ3A 1CHPD 1QOHA 2E76C 1EIHA 4ZK9B 4KHZA 3ND8A 3M4OB 2QILA 3KLSA 4RWSC 1FNUA 3IKJA 5K5PA 3HOYB 3ONAB 4OO1H 4M1UB 3I91A 5C5MA 3Q24A 2K6AA 4QIWB 2VB2X 3R3OA 2KEEA 2F3VA 1ENFA 1EY5A 5EPJA 2DY7A 1EU3A 2C9OA 1EEID 1OXUA 4BBSB 2KCCA 4P2CB 4H0LC 3QG1A 1GHKA 1HA6A 1T5EA 2O2LD 3SK5A 1KLGD 5CC4A 1SEBD 5A2QL 5EKLA 5JAVA 1CZWA 3A54A 3OSOA 2B2WC 1EZ8A 4C1NI 3H6MA 3GTOB 2FHTA 1LO5D 1IW7D 3T51B 5J39A 1RJTA 1JICA 1WTQA 2K32A 1SBBB 2K01A 2ICIA 3MTSA 5E1FA 3K5NA 1B1ZA 1SE4A 2WKDA 4WORA 2KEDA 5FKAC 2RKSA 5KNCA 3D6WA 3AU7A 4J6HA 5FK9C 3NUCA 3X3MA 2Z8LA 2F0WA 2IX1A 1SNPA 5IGBA 2R92B 4J1MA 1TR5A 3VYRA 1SSOA 4GZYC 1CHQD 3E5SA 2OXPA 5KNBA 3HG9A 1YNND 1R4QB 4HAEA 3M7GA 3BVMA 1HXYD 4DAYA 1SMYC 1TS3A 3HOZB 1A15A 3NHHA 1KNAA 3A7AB 2AWOA 5K36H 1SMYD 2NYZD 3OMGA 1E2ZA 3C1EA 1F2YA 2QKIC 3OHXC 2B63B 2R61A 4OHJA 1RCVD 2QEJC 1Y69U 2L9HA 3NWSA 3Q6SA 5CORA 1BOSA 3EA6A 1MD2D 4IUVA 5CV6A 5TSSA 3MFGA 5M9OA 5CV4A 1Z47A 1ZEQX 1LABA 4H7BA 3ITPA 5A2QE 3ERQA 2JA5B 3HGBA 5C3EB 4N9PA 5C44B 2A68D 1F9PA 4FYDA 1EQVA 1SYDA 2QDBA 2D5DA 3NE5B 3MAQA 3T4AC 4PMBA 3WOEA 1J8IA 1PZKD 4ABNA 4KJOA 3H0GB 2ICEC 2HQEA 3V96A 1Q3LA 1DJRD 1SAPA 5C4HA 4ZKBB 2JP1A 3GV3A 3VR5A 1FNWA 1A6XA 4K6DA 3BVZA 1PRTD 5IGCA 2DN8A 1KTKA 2F0GA 2BOSA 2B8FA 4PV1C 3VR6A 1EIGA 5T1GA 4MHEA 3DEPA 1A3VA 3OWEB 2IT1A 3QOJA 4EVOA 4EQOA 2F0EA 1BDOA 3PIO3 4XXEA 5IGEA 1WTRA 1BO0A 1S4ZA 2WAQB 2NN6I 1RTOA 3RD4A 3QIAA 4I65A 3PIP3 2JA8B 3C1FA 2PW7A 3P20A 5DM73 1LTBD 5IGDA 3FMCA 1LV9A 1AW7A 1H9JA 1E0BA 1FNVA 5DNFA 1D1IA 3NBIA 2J7ZA 1JB3A 4R8IA 5FO7B 4OO1I 1B9MA 4XYQA 5ISRA 1S5BD 4V0BA 1DM0B 1Q12A 1DCZA 3C3LA 3K57A 1HCZA 3S1QB 2JEBI 3T16A 2JEAI 3LWUA 4V190 1LTTD 4KKSA 1QG7A 2BDOA 2EY6A 4FVMA 5C6AA 1GHJA 2MUYA 3VA5A 1E2WA 4X3UA 4QUCA 5DEHA 1O7LA 3S14B 4K8JA 2NZ1D 1STEA 1GUOA 1SXTA 1IL8A 3VYSA 4HEDA 4KN4C 1OXVA 2A68C 1MSGA 1O78A 3CRKC 2NTTA 2BE5D 2LY7A 1TY0A 2VNUD 1NSNS 2AUJD 4PMWA 2V4DA 1NCVA 3OIPA 1V1PA 4KI0A 1TQOA 5CR3A 1JOQA 3GQBA 3V2TA 1D5ZC 2KA7A 5JVH3 4CJ1B 3W3AA 1A3TA 1UAPA 5CV8A 2I07B 3E6ZX 1EYDA 5G3LD 3DUZA 3QB3A 1ENCA 1Y8PB 2CVRA 1II3A 2F4IA 3GTQB 2B2VC 2EOTA 5LL6X 1PZID 1CQVA 1I4PA 5F2DA 4KTAA 2F0QA 1KDBA 3H91A 2L12A 1FGBD 2XWBB 3TDQA 1BR9A 1OXTA 2KHSA 1RHPA 5A35A 4DK0A 3UI2A 2M2LA 1I4RA 1XX8A 4S3SA 1B2TA 4F8MA 4DK1A 1X3PA 4OO1G 2PMZB 1G291 2DNEA 1EYAA 2F0SA 5JEAH 1Q8IA 2M00A 3RZOB 1TWAB 4NW2A 3HS0C 1WVLA 4DXFA 1TWCB 2O4XA 4HSVA 3R2IA 2HDLA 2SNSA 1F2LA 4XIGS 2G9DA 2SEBD 2R3ZA 3DXJC 1X3QA 4CBVA 2NUCA 3NBHA 4CKEA 3MHBA 4WFN3 1DD2A 1QNUA 2IPKD 1ML0D 2O5JC 5DM63 4O42A 1I4QA 1CI3M 3VYTA 4RAUC 4C3JG 5FLXE 1O7YA 5M3MB 1A2UA 1B3AA 1DYQA 1F9SA 2B2WA 4MN3A 2QF7A 4IUTA 3J80L 4ID6A 4R9WA 1SYCA 1H9RA 3EVQA 1LACA 4BY7B 2Y0SB 5D14A 2B2TC 5BN3A 2XWJB 3K5MA 1KABA 1LTGD 1J9OA 2F0TA 2K28A 1ZXTA 3F2UA 3NWTA 4JK1C 2L5TA 1PXUA 3I3CA 3QOLA 1DOMA 4Z9CB 1Y1WB 2N88A 1PYWD 1B53A 1EYCA 1PLFA 2FJ2A 4DAPA 4ZUJA 3MA2B 1PFMA 4BY1B 2A74C 4RKLA 4C3IG 1BXTA 2Q8RE 3LWEA 3GTGB 3PO2B 4RKBA 1LTID 4B9XA 3S2HB 1TIID 2PZUA 3GV6A 5JEAG 1H9SA 3NTIA 1A3UA 1BF4A 1LT3D 1PTOC 3SVMA 1BCPB 4ZKCB 4IFDI 2EE1A 3TN2A 2RBMA 4KN7C 4C56C 1E2VA 2AQ3B 1FD7D 2EVBA 2Z1CA 1PTOD 2Q8TA 2RSOA 1MBYA 3N6RA 4DA2A 3KLSX 3NK9A 3MC0B 3BS1A 4PQXA 2NVYB 1OXSC 4XQQA 1D6EC 3V05A 2B8GA 3SR1A 4N9TA 1O7ZA 2OEOA 1PMRA 3GTLB 3CU7A 5E4WC 5CGKA 2FMMA 4ME5A 4K5XA 4QMGA 3HEJA 4RCOA 3K58A 1TWHB 2PW5A 1FYCA 3ZYYX 4IUPA 2JA7B 1H9SB 3AMUA 5G3LF 1NAPA 1SNCA 2OT2A 3DWPA 4HTHA 4B9WA 1HA5A 3PUYA 2WV6D 4BWGB 1EY6A 1C48A 2NB0A 2FFKB 4FO2A 5EPLA 3A56A 1Q90A 5I2YA 1SNDA 4KY7A 3OMCA 4A3JB 1WD1A 1A2TA 3M7NA 1QJOA 2IX3A 1D1KA 4RH6A 3AB9A 3EFXD 2X6GA 1K83B 2MJ8A 4H44C 2YYZA 2L11A 3QWNA 3TP6A 2A6HD 3LX0A 3KLRA 2PPBC 5M5XB 5COYA 3K0YA 1U9RA 3EJIA 1Z6HA 1IHZA 1HHVA 4TRDA 1F9QA 1S5FD 5IIFA 2F03A 1KDAA 4ZLTF 2ZXOA 5IOCA 3M4YA 3I90A 1QNKA 2XNAC 4NMZA 3NP8A 1EQTA 4IUQA 4O1NA 5FLXL 3N52A 1C4QA 1HRJA 2R93B 1PTOB 1MGSA 4KJNA 1HFGA 3HOWB 4CJ2C 3KBGA 1RKNA 5EKKA 3JAME 4DF7A 2NWGA 4OGQC 1YNJC 2TSSA 3DEOA 1TS2A 1K8OA 1QB5D 3X3NA 2A6HC 1CA5A 2CQAA 3MXPA 3SE0A 3BZDB 4WRDA 2A73B 2F0HA 4XDXA 3I70A 1JOOA 1DOLA 1HUMA 2RDGA 1HPCA 2VB3X 3EQLC 3A7LA 4ILWA 4A3EB 1I3QB 4RA8A 3D4WA 5LL6S 2RVLA 4KKUA 4QUFA 2PZWA 5IT9L 3BVGA 1IW7C 2X6LA 1WTVA 2XIWA 5EBCA 4DFAA 2H4OA 3A55A 5DAUA 4C3HB 4IQZA 3TZUA 1SNOA 1TY2A 4K5WA 2EY2A 3U9SA 3NTKA 2K04A 4K6LA 4KD3A 2B39A 1STGA 1WTPA 1HTPA 3K7AB 5I2XA 2RQXA 3BDLA 4IFDJ 1STHA 1Y8NB 5HURA 2A69C 1GUGA 4FF2A 1H9MA 1ONLA 1I6HB 1SNQA 1YNNC 3C2PA 5E4XA 3Q23A 2EJFC 4XT3B 3GTMB 3SDZA 4JBWA 1NR4A 2A5HA 2D9UA 4EGVA 2F1MA 1XXGA 2MP1A 3TBIB 4PNYA 3HOUB 3RLFA 4RGMA 3FDTA 4DU9A 3C46A 2L1BA 3L3OC 4FNFA 1MI2A 5LHY1 1Q1BA 4WJWA 1G2TA 3GP7A 2JYOA 3MEHA 4CHTB 3S15B 2B2YA 3HP3A 3WOFA 2WACA 1DONA 4HCEA 1I4HA 4A3GB 1B9NA 5CV9A 3ND9A 1GJXA 3G6JB 2LKVA 2K05A 4A3BB 4RCNA 4XQJA 1GOZA 1KNEA 2K5QA 2Q8IB 4Q5VA 1QILA 4HSPA 1WTOA 4L63B 2SDFA 2G9HD 3HOXB 3R2TA 1B44D 2M9VA 5KNDA 1S5ED 1EZ6A 5CYUA 2Z4HA 1AP0A 3NQIA 3MWYW 2RA4A 1U4RA 3TZDA 4YIJA 4CKBA 1D5XC 1SJED 1IKMA 2NN6H 1W6KA 5M5WB 1IYVA 1R4PB 4CJ0B 3CQZB 4QB4A 5EKIA 4AYBB 4A3IB 1DOKA 1NR2A 1ICWA 4FXGC 1TU2B 5IGFA 2D2CC 1H9KA 1EU4A 2E2DC 3Q0AA 4ULLA 1YNJD 1HFNA 3LNNA 3D4DA 4UAIA 5J22A 1NUCA 2NVTB 4C3JB 5C5LA 2CW0C 4LJZC 4QCLA 1TWGB 4FF3A 1CFMA 1X32A 3NTHA 2A69D 4RHRA 1CT1D 2E75C 4ZAIA 2IW3A 5C0XH 2HCIA 3D31A 1PFNA 2AWNA 3HZXA 2F0IA 4J8QA 1Y1VB 3PV0A 5KEEA 4HMIA 1RF2D 1VCIA 1TS4A 4IUUA 2EYFA 1B4OA 4IN3A 1STBA 1G6ZA 5I6WA 5KYLA 1EY0A 2PCFB 4DGZA 4HR7B 2NVQB 2NBFA 1FR3A 1TVXA 3MVVA 3T56B 2ZT9C 2HDMA 2X69A 1BCPD 3R8BA 4OL7A 2FINB 4DNRB 1CK1A 2I46A 4LAAA 1L0XB 1LTAD 5CBEE 3PMFA 5IODA 1RD9D 2L55A 2R6GA 1I4XA 3S2DB 3NXWA 4H13C 1PTOH 3DWAA 1SE2A 4KD4A 2BA1A 3K59A 4FF1A 2E2JB 5CBAE 1Z7TA 3K6OA 1L0YB 2PNRC 2LS01 3RZDB 2EYPA 3GTKB 2R7ZB 3H09A 4BS9A 1HTLD 2BDNA 1R9TB 2F0VA 4IFDH 4IFDG 4BA1I 4A93B 2ID0A 2DY8A 2LFNA 4RFBA 5KYIA 3CKIB 2JE6I 1RTNA 4IUNA 1GUWA 1AZQA 1K8MA 4DN4M 4C1NK 4MIUA 4U673 3P7JA 1F9RA 2F0KA 2AQ1B 4HCSA 2F0LA 3OOCA 3SXHA 5FO8B 3E0JA 2SOBA 5C4ZA 3K5LA 2WKCA 1WTXA 2E2HB 5M5YB 4XT1B 2SNMA 3M3YB 4ZYSA 2VUMB 4TSSA 3HKZB 5C0XJ 2KQ3A 1SE3A 4HN7A 2PQEA 2WINB 4OIKA 4TQUS 1JC7A 3S9WA 3J7AF 3DMUA 3I4NB 2ZXPA 2KOLA 5C3WA 5ELCA 1QWYA 3SHLA 3PO3B 2Z4IA 1I6VC 3QO2A 3J80E 2ZXRA 5KRUA 1Q1EA 4F87A 1SYEA 2MHVA 3D3RA 3TSSA 1G8ZD 1M8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J8I A;  1IKL A;  3FPU B;  2JYO A;  2K01 A;  4ZAI A;  2B2U C;  2N55 A;  4X3U A;  1Q3L A;  2B2T A;  2K1B A;  4QUC A;  1SAP A;  2HCI A;  3IL8 A;  4ZKB B;  2JP1 A;  1PFN A;  3MTS A;  2FFK B;  2Q8R E;  3GV3 A;  3IFD A;  5EPL A;  3LWE A;  1VMC A;  4RA8 A;  2BDN A;  2B2Y A;  3HP3 A;  2B2V A;  2RVL A;  2KED A;  4QUF A;  3DM1 A;  1DON A;  1MSH A;  2L4N A;  4NW2 A;  1WVL A;  2NZ1 D;  3D6W A;  3GV6 A;  2VXW A;  2X6L A;  3KBX A;  1CA6 A;  1WTV A;  1JE4 A;  1WD1 A;  1G91 A;  4HSV A;  1AZP A;  5AFW A;  4X3T A;  2DY8 A;  2HDL A;  1IL8 A;  1F2L A;  1EIH A;  1EIG A;  4ZK9 B;  3SVM A;  4HED A;  4IUU A;  5T1G A;  1BF4 A;  2XIW A;  1BBX C;  2R3Z A;  2K05 A;  1SSO A;  4MHE A;  5T1I A;  4ZKC B;  3DEP A;  1B50 A;  3KUP A;  1XYI A;  1B4O A;  1X3Q A;  2KUM A;  2MJ8 A;  2X6G A;  3R93 A;  1MSG A;  2EE1 A;  2KEC A;  3TN2 A;  1RTN A;  1DZ1 A;  4RWS C;  1GUW A;  5CMD A;  1KNE A;  2H1E A;  2L11 A;  4X3K A;  1AZQ A;  4X3S A;  4HAE A;  3ONA B;  2Q8T A;  4DN4 M;  1ML0 D;  5COY A;  1G6Z A;  4U68 A;  2RSO A;  1WTO A;  2SDF A;  2K04 A;  3I91 A;  1BNZ A;  1WTR A;  1PDQ A;  4O42 A;  1WTW A;  1NCV A;  1HHV A;  1BO0 A;  1F9Q A;  1S4Z A;  3P7J A;  1F9R A;  2HCC A;  1WTP A;  1M8A A;  1RTO A;  1U4M A;  4HCS A;  4RAU C;  1A15 A;  2KEE A;  1HUN A;  1O7Y A;  4ZLT F;  1EOT A;  1KNA A;  5EPJ A;  1B3A A;  1AP0 A;  3I90 A;  2NYZ D;  1F9S A;  4CJ1 B;  1QNK A;  2DY7 A;  1WTX A;  3MWY W;  2B2W A;  2RA4 A;  4MN3 A;  5D65 A;  1U4R A;  2MGS A;  1LV9 A;  1TVX A;  3TZD A;  1O7Z A;  1EQT A;  4IUQ A;  4XT1 B;  1EL0 A;  4IUT A;  1IKM A;  1U4P A;  1E0B A;  5E4W C;  3N52 A;  2HUG A;  5DNF A;  2HDM A;  1HRJ A;  2CVR A;  2FMM A;  1U4L A;  2K03 A;  5E4X A;  5EJW A;  4CJ0 B;  1MGS A;  2J7Z A;  1G2S A;  1HFG A;  2X69 A;  2L9H A;  4R9W A;  4R8I A;  1ILP A;  4XT3 B;  2B2V C;  2B2Y C;  2EOT A;  5EKI A;  1HA6 A;  1CM9 A;  1DOK A;  1NR2 A;  3Q6S A;  4OIK A;  1ICW A;  5COR A;  1ESR A;  2FIN B;  5EPK A;  4CJ2 C;  4IUV A;  5EQ0 A;  5D14 A;  2B2T C;  2NWG A;  4LMQ D;  1ILQ A;  1ROD A;  5JJZ A;  2B2U A;  4IUP A;  1VMP A;  3I8Z A;  1NR4 A;  5CBE E;  2D9U A;  3G7L A;  2KOL A;  1HFN A;  2B2W C;  1SDF A;  1J9O A;  3DEO A;  1NAP A;  2K28 A;  1ZXT A;  3F2U A;  1PFB A;  3H91 A;  1CA5 A;  3I3C A;  2MP1 A;  2KVM A;  2FHT A;  2IL8 A;  4UAI A;  3QO2 A;  2L12 A;  1F9P A;  1DOM A;  1QE6 A;  1WD0 A;  1RJT A;  1JIC A;  2N88 A;  1B53 A;  4XDX A;  1WTQ A;  1O80 A;  1QG7 A;  2RSN A;  1PLF A;  1RHP A;  2FJ2 A;  1DOL A;  1HUM A;  3FDT A;  5CBA E;  2MPM A;  1X32 A;  1PFM A;  2L1B A;  2M2L A;  4OIJ A;  1MI2 A;  1XX8 A;  3UI2 A;  1B2T A;  2EPB A;  4IUR A;  1X3P A;  1C8C A;  1G2T A; 
#chains in the Genus database with same CATH topology
 1ZKO A;  4GKJ L;  3ERS X;  2F0N A;  1X3E A;  4RGN A;  2B2T A;  1V9P A;  3IL8 A;  3TP7 A;  3I4N G;  2EDG A;  4X66 Q;  4K0K Q;  1IXR A;  3IAY A;  2WB1 G;  4X64 Q;  2LMC B;  3T1Y Q;  1IL2 A;  1M4V A;  4I7A A;  4OX9 L;  1Z9F A;  2EJG C;  3I4L A;  4R8N A;  1CA6 A;  1EY7 A;  2L15 A;  3J81 L;  4A3M B;  4Y7N B;  3MZ5 A;  4E6I A;  1SYG A;  4UDU C;  4JI1 Q;  3HKZ G;  1JCK B;  3R93 A;  1VQC A;  3J7Y W;  1SYF A;  3S1N B;  3ER0 A;  4NP5 A;  3H0G G;  2PNH A;  3PCO B;  1XNQ L;  1SMX A;  2JXM B;  1LT6 D;  1LUZ A;  2K75 A;  3G71 A;  1PDQ A;  2Z6K C;  3CMA A;  3GO5 A;  1X9N A;  1AH9 A;  4RHS A;  2CH4 A;  1R9T H;  1ZYR D;  3SK6 A;  4QY7 A;  1V1P B;  5K36 G;  5J1Z A;  1WCM B;  1VDZ A;  4LFB L;  3D8G A;  3KOJ A;  5D3D A;  4ODG A;  1JJ2 A;  1NNX A;  2EQS A;  2E8G A;  5D65 A;  4C3I B;  2MGS A;  4DV7 L;  1KD1 C;  3PF5 A;  1X6O A;  1XWE A;  4A3L G;  3S1R H;  2F3W A;  1GVP A;  1UE6 A;  2VZA A;  3G4S A;  1MHW C;  5JVG 3;  3RZO H;  3QR8 A;  4LNQ A;  3PUW A;  4A3J H;  1KC8 C;  1JWS D;  1G2S A;  5C4J B;  3I72 A;  2K52 A;  5CV7 A;  3KK7 A;  4DUY Q;  5KIX A;  3D4R A;  5IWA Q;  2NN6 G;  1EY9 A;  2UXB Q;  3BDC A;  3ZJY C;  1HR0 Q;  1UWV A;  3OIQ A;  2VL6 A;  4B3T Q;  2CWP A;  4AYB E;  5EGT A;  4LK1 C;  4DAV A;  1LTS D;  3JAM L;  5JJK A;  5JJL A;  1EEF D;  1BQQ T;  1EWH A;  1O80 A;  2JA6 B;  1CKN A;  2PQA A;  4M8A A;  1JWM D;  1OTC A;  3FKI H;  3NPP A;  1V43 A;  2UUC L;  2K4K A;  3VR4 A;  3ULP A;  1L2F A;  4NKL A;  2N55 A;  3S15 H;  1SNM A;  2E2H H;  2HT1 A;  3IFD A;  4XQN A;  1YHA A;  3ULL A;  1LLR D;  2F0M A;  2KCT A;  4IOC A;  3NSW A;  4KV6 A;  4TKO B;  4G57 A;  3T1Y L;  2B63 H;  2JJQ A;  1VQ4 A;  3P1H A;  2EXD A;  3KBX A;  3CD6 A;  3CCJ A;  3HOV G;  1K28 A;  4YY3 L;  1JE4 A;  3GTP B;  2ENB A;  2J4X A;  2A6E C;  2WB1 B;  1SYB A;  4O2D A;  4K2L A;  5JOB A;  3KUP A;  1XYI A;  1M1K C;  1KLU D;  1I6H H;  1E3P A;  1S3O A;  2EYH A;  1KRS A;  4EX5 A;  3I4M B;  3FRP B;  3S1R B;  4DNT B;  2F4V Q;  5CMD A;  2H1E A;  2OQ0 A;  4JI2 L;  4PG3 A;  4XTC S;  3CW2 C;  4JBJ A;  3W2D A;  3T13 A;  4BBR B;  2RCF A;  1KDC A;  4DR2 Q;  4DV4 L;  1LT4 D;  5C3E H;  1VF7 A;  4DUY L;  3PUV A;  5M5X H;  2CW0 D;  4KMU C;  2DNC A;  5ELD A;  3MXU A;  1UEB A;  4FXD A;  2NVX H;  1N8R C;  4FP5 D;  3K0X A;  2F0F A;  2NTS A;  2K33 A;  1EOT A;  2AQ2 B;  4HMJ A;  2JN4 A;  3F2B A;  4JOI C;  4EQP A;  3OYY A;  4DV7 Q;  2AUK A;  1X65 A;  1H95 A;  2I5H A;  3VYU A;  4C3H H;  3S17 B;  2K14 A;  2E74 C;  2MO1 A;  5ELF A;  4DXG A;  1PH5 A;  5M3F B;  4LF9 L;  4KKT A;  2XN9 C;  1C0A A;  1WJJ A;  5D3I B;  1D2B A;  4C3H G;  4C2M B;  1K8A C;  1CM9 A;  3HOX G;  4GLV B;  2GN5 A;  3KF8 A;  3TP8 A;  1LTR D;  2JSO A;  3QJY A;  5C3X A;  2P5Z X;  5JJZ A;  1CSQ A;  2L0C A;  3G7L A;  1SDF A;  1JWU D;  3CCL A;  2FMC A;  4G4K A;  5BN5 A;  1PFB A;  5LMU L;  3BYY B;  1SLJ A;  3A74 A;  3F2D A;  1KHI A;  5ELN A;  1JQY D;  4QF4 A;  1TT2 A;  3A8I E;  3RUZ A;  1OO9 B;  5C0X I;  1Q7Y C;  1G6P A;  2XSC A;  1I94 Q;  3A8K E;  2CHB D;  4A3G G;  1YJW A;  2F52 A;  3OWF A;  2MQH A;  3I4O A;  1GUT A;  1HH2 P;  1C8C A;  1T5X D;  1HQR D;  2PZT A;  3URY A;  3HOY G;  4GN3 B;  3KDF A;  1STY A;  2YTY A;  1AEX A;  1N33 L;  3AYH B;  4UP7 A;  1PZJ D;  4DK6 C;  1K0S A;  3STB D;  4KY5 A;  1MSH A;  4N8F A;  1PRT C;  4EQN A;  5C4J H;  1NBW A;  2XRS D;  5EBD A;  2EY1 A;  1KXL A;  4LFA Q;  1ZYR C;  1IBK Q;  5T1I A;  2R92 H;  1TKW B;  2EYL A;  5E3F A;  4DV0 Q;  4DR6 Q;  1VF5 C;  2R7Z G;  2RDF A;  1EFI D;  3TME A;  2K5H A;  4L5T A;  4X3K A;  1I4G A;  5IGG A;  3K5O A;  2R93 G;  5ELE A;  5KGU A;  3KLW A;  2XVS A;  4K5V A;  2F0O A;  4XYO A;  2DJG C;  4LF8 L;  2PYK A;  4IZ8 A;  1YZ6 A;  1BNZ A;  3GD7 A;  4JI5 Q;  2R7F A;  4CGY B;  5IT9 E;  1RDP D;  2KJX A;  4AQY Q;  1XNR Q;  1HUN A;  1STA A;  2BH2 A;  1CTM A;  3DHQ A;  4B3S L;  1X56 A;  2BCO A;  1F2M A;  4JI8 Q;  3J7A V;  1V1Q A;  4A3D B;  4KHV A;  4K2K A;  1EWC A;  4GNX C;  1B7Y B;  1PYB A;  2TMP A;  4F7X A;  1U4P A;  1QZG A;  4G7Z C;  1WOC A;  3O13 A;  3U9O A;  3CHB D;  3DWQ A;  4ZRZ A;  1ILP A;  3MXN B;  1X54 A;  4A3L H;  1ESR A;  3KF6 B;  3FVQ A;  1JOR A;  1WCM H;  3CAM A;  1SE8 A;  5EQ0 A;  3VA7 A;  5BN4 A;  4GNX A;  2UUA Q;  1VMP A;  1AN8 A;  1HNX L;  2I5L X;  1NMG A;  4A3K B;  1W3S A;  2F0P A;  1HZA A;  1PRT B;  1V1O A;  1IYU A;  1GUN A;  4G7H C;  3HOX H;  1EIF A;  4O0A A;  1EY4 A;  1YBY A;  2IL8 A;  1V8Q A;  4HJ8 A;  3T53 B;  1WD0 A;  5JPM C;  1JE5 A;  4RGT A;  5I9O A;  4R4C A;  2K5D A;  2RDH A;  3IFT A;  1AFP A;  2MPM A;  1A63 A;  4OIJ A;  3I73 A;  1UUP A;  1CUK A;  3W1G A;  4AIM A;  3KJP A;  1IKL A;  5JEA J;  5I4D A;  2B2U C;  5JPN C;  1HNZ L;  4LW1 A;  1IBL Q;  2C5C A;  1XMO Q;  4HJ5 A;  1SJH D;  1UEA B;  1KL9 A;  4NXM Q;  3J81 E;  1JB7 A;  1M90 C;  1VQJ A;  2VXW A;  1XTD A;  4FF4 A;  4C2M H;  2BH8 A;  3G48 A;  1AZP A;  5AFW A;  4IPC A;  4X3T A;  1ET6 A;  1BCP F;  4CDF C;  4A3F B;  2E2I B;  2YV5 A;  2WII B;  3MXN A;  4ALP A;  3S1M H;  4NDX A;  2KEC A;  2EYJ A;  5IYC G;  1S40 A;  2HIV A;  1TWF B;  3BG3 A;  1ESF A;  4P74 A;  4U68 A;  2EY5 A;  1SFO B;  1HQM C;  4B08 A;  4POF A;  1XTC D;  5J3B A;  1WTW A;  2CWA A;  3OW7 A;  2EIF A;  3SK8 A;  3I56 A;  4A3E G;  3K80 C;  4DR7 L;  4IO9 A;  4CKC A;  1XNQ Q;  2EYO A;  1EY8 A;  1STN A;  2KCN A;  3GTJ B;  3P75 A;  4F88 A;  1CQF A;  2K50 A;  1CZG A;  3PQI A;  4QJF A;  3HOV B;  1EL0 A;  5FOB B;  3ERO A;  2BE5 C;  3WDN A;  2F0D A;  4IAL A;  3H3V H;  1LM0 A;  1BCP C;  3M4P A;  3VR2 A;  1BUV T;  3Q22 A;  4JI6 Q;  5EPK A;  1ET9 A;  3TEH B;  3A8J E;  4UPA A;  2GA4 B;  4BA2 I;  1ILQ A;  2B2U A;  1L1O B;  3I8Z A;  3IRB A;  1F2Z A;  4YHH L;  4K14 A;  3RNU A;  4JOI A;  1JOK A;  1Y8O B;  1LT5 D;  3MEF A;  2D62 A;  3HOU H;  3NQT A;  3OPO A;  3TP5 A;  3PO2 G;  1QE6 A;  4A3J G;  4L8J A;  1D8L A;  1TWC H;  3VR3 A;  1IBM L;  4PMC A;  1OXX K;  4IUR A;  3HRZ C;  3MXG A;  4ME3 A;  3FPU B;  3OTO Q;  3S1Q H;  5C0X G;  2K1B A;  1PH4 A;  3MFY A;  3UDI A;  2WP8 J;  1ASZ A;  1VMC A;  3BDO A;  5C4X B;  2B2V A;  3PUZ A;  4KK7 A;  1GM5 A;  1EIY B;  1PH3 A;  1QCB D;  4FDB A;  2L4N A;  1TS5 A;  3FKI B;  1KAA A;  2UXC Q;  1CKM A;  1BVS A;  1F77 A;  2OF1 A;  1SN8 A;  4OXP A;  2F0J A;  3H0G H;  1G91 A;  3FPP A;  4GN4 B;  3SEB A;  1BBX C;  3FEW X;  1MJE A;  5FO9 B;  1D5M C;  1B50 A;  2KUM A;  2ZTC A;  3RMH A;  3TS0 A;  1DZ1 A;  4HIM A;  3H94 A;  3M9B A;  3PUX A;  2PO4 A;  4R1J A;  4NXN L;  3HOZ G;  3A5Z B;  4L6T B;  4X3S A;  4J15 A;  4RGO S;  3S16 B;  2ES2 A;  3PO3 H;  4ZUI A;  4I7Z C;  1T9H A;  3KYH C;  2C35 B;  1XPO A;  2RF4 A;  5HGT A;  1W6J A;  2HCC A;  2NVX B;  3W5O A;  2EZV A;  1U4M A;  2EYM A;  1ENA A;  5M3F H;  2ALY B;  4K8I A;  2XRQ D;  3CRL C;  2K7V A;  2A6E D;  2J0T D;  5I9P A;  2F0U A;  4YWM A;  4Q0F A;  2G5D A;  4FXK C;  5IY0 A;  3S1M B;  4KY6 A;  1PA6 A;  2HUG A;  1I50 B;  3HFZ B;  1U4L A;  2K03 A;  3L9A X;  5EJW A;  1JR0 D;  2DGY A;  2B2Y C;  2FXQ A;  4LF7 L;  2Q2I A;  3F1Z A;  3L7Z C;  1PH8 A;  3CPF A;  4A3F H;  1VQH A;  4G7O C;  4LMQ D;  1ROD A;  4JI0 L;  2EXZ A;  1N9W A;  2EJM A;  2YU9 B;  5ELB A;  4EQ5 A;  3SK4 A;  4HIK A;  2KVM A;  2IJ0 A;  2QCP X;  5CV5 A;  1VQ5 A;  4Y7N H;  1S5C D;  2IX0 A;  2RSN A;  1DXM A;  1A0I A;  5I6Y A;  5IYB H;  3D6C A;  3M85 A;  2IWH A;  2BA0 A;  2EPB A;  5C4X G;  4OWW B;  1UNS A;  2O5I C;  1GXD C;  3H3V C;  3STB C;  1PRT F;  4JPB W;  5NUC A;  1S5D D;  3GTK H;  2K5W A;  2QA4 A;  2N8N A;  4BY1 G;  4JV5 L;  4ZCK A;  1PTO F;  3DM1 A;  1GUS A;  3BYT B;  4ZQ3 A;  1CHP D;  4BY7 H;  3DLL A;  1N36 L;  2ASB A;  1Y1W G;  1RIP A;  1QOH A;  3CC7 A;  2E76 C;  1EIH A;  4ZK9 B;  3CF5 A;  1XMQ Q;  4KHZ A;  4A93 H;  2JA8 H;  5EAY A;  3ND8 A;  3M4O B;  1K9M C;  2QIL A;  3KLS A;  4RWS C;  2A8V A;  1FNU A;  5IYD G;  3TQY A;  3IKJ A;  1PH6 A;  5K5P A;  4HJ7 A;  3HOY B;  1JMC A;  3ONA B;  4OO1 H;  1HJP A;  3PGZ A;  1IZ6 A;  4M1U B;  3I91 A;  5C5M A;  3Q24 A;  2K6A A;  4B3M Q;  4QIW B;  2VB2 X;  3R3O A;  1VQ9 A;  2OTL A;  2KEE A;  3KJO A;  4B3R Q;  2F3V A;  1A8V A;  1D7Q A;  1ENF A;  1EY5 A;  5EPJ A;  3A5U A;  3I2Z A;  2DY7 A;  2WAQ E;  1EU3 A;  2C9O A;  1EEI D;  1OXU A;  5GRO A;  4BBS B;  5E7N A;  2KCC A;  4P2C B;  4H0L C;  1VQB A;  5IP7 G;  3JAM c;  3QG1 A;  4JG2 A;  1GHK A;  1HA6 A;  2JA9 A;  3KDF B;  3TRE A;  3CCV A;  3CC4 A;  1T5E A;  2O2L D;  3SK5 A;  1KLG D;  1GD7 A;  5CC4 A;  1SEB D;  4X6A H;  2NVY H;  5A2Q L;  5EKL A;  1CZW A;  3A54 A;  3OSO A;  5JAV A;  2B2W C;  1EZ8 A;  4UP8 A;  3HOV H;  2UUB Q;  5JJI A;  2ZM6 Q;  4C1N I;  3H6M A;  1Y1V G;  3PSI A;  3GTO B;  2FHT A;  1LO5 D;  1IW7 D;  3T51 B;  1JJG A;  5J39 A;  4HJ9 A;  1RJT A;  1JIC A;  5L37 A;  3A0J A;  1WTQ A;  2E2J H;  3KFU A;  4DV4 Q;  4DV5 L;  3LGJ A;  1PH7 A;  1QVG A;  1X55 A;  2K32 A;  1SBB B;  4YCV A;  5ELO A;  2K01 A;  2ICI A;  4YY3 Q;  1N34 Q;  3MTS A;  1N32 Q;  5E1F A;  3K5N A;  1B1Z A;  1RL2 A;  1SE4 A;  2WKD A;  2K5N A;  2CFM A;  2UXC L;  4UP9 A;  4WOR A;  2KED A;  5FKA C;  5C44 H;  2CQO A;  2RKS A;  5KNC A;  1TWF H;  4LF7 Q;  3U4Z A;  1P8L A;  3D6W A;  1YIT A;  2HIX A;  3AU7 A;  4J6H A;  5FK9 C;  3NUC A;  3X3M A;  4LFC Q;  4LF9 Q;  2Z8L A;  1YI2 A;  2F0W A;  2IX1 A;  1SNP A;  5IGB A;  2R92 B;  4J1M A;  1TR5 A;  3VYR A;  1PH2 A;  2VY3 A;  1SSO A;  4GZY C;  3J81 j;  1CHQ D;  4LUZ A;  5IP7 H;  3E5S A;  3Q8D A;  2OXP A;  5KNB A;  3HG9 A;  1YNN D;  1R4Q B;  2Y0S E;  1TXY A;  3J7Z C;  1XPU A;  4HAE A;  1SR3 A;  5FJ8 H;  3J7A 5;  3M7G A;  3BVM A;  2QW7 A;  2HHH Q;  1HXY D;  4DAY A;  2OTJ A;  1SMY C;  1TS3 A;  1TWG H;  3HOZ B;  3CCQ A;  1A15 A;  3NHH A;  1YJN A;  1CKN B;  2PQA B;  1KNA A;  3A7A B;  1LTL A;  2AWO A;  5K36 H;  1SMY D;  2NYZ D;  3OMG A;  1E2Z A;  4H02 A;  3I4M H;  3C1E A;  1YVC A;  1F2Y A;  5IYD H;  1J6Q A;  2QKI C;  3OHX C;  4GOP C;  2B63 B;  1U0L A;  5M5W H;  2R61 A;  4OHJ A;  4A93 G;  1RCV D;  2QEJ C;  1Y69 U;  2L9H A;  3NWS A;  4JW0 A;  1B3Q A;  3Q6S A;  1XPR A;  5COR A;  1BOS A;  1Y1W H;  4IUV A;  3EA6 A;  1MD2 D;  5IP9 H;  5CV6 A;  5TSS A;  3MFG A;  5M9O A;  1VQK A;  4P71 A;  5CV4 A;  1Z47 A;  1ZEQ X;  4X62 L;  2I5M X;  1LAB A;  4H7B A;  3ITP A;  4HID A;  5A2Q E;  1FVI A;  3ERQ A;  2JA5 B;  3HGB A;  5C3E B;  4N9P A;  5C44 B;  2Y0S G;  2Q2U A;  1Q81 C;  1YIJ A;  2A68 D;  1F9P A;  3U58 A;  1LYL A;  4FYD A;  3I55 A;  1EQV A;  1SYD A;  2QDB A;  4RG1 A;  5IYB G;  4DR2 L;  2D5D A;  3NE5 B;  4DR1 Q;  1N32 L;  2HD3 A;  3MAQ A;  3T4A C;  3CCU A;  2NVQ H;  4PMB A;  3WOE A;  1J8I A;  1PZK D;  4ABN A;  4KJO A;  3H0G B;  1XJV A;  2ICE C;  2HQE A;  3V96 A;  1Q3L A;  1DJR D;  1SAP A;  5C4H A;  4ZKB B;  1WTH A;  2JP1 A;  3GV3 A;  5M3M G;  3VR5 A;  1FNW A;  1A6X A;  4K6D A;  3BVZ A;  2WB1 E;  3TS2 A;  1PRT D;  5IGC A;  2DN8 A;  2LXK A;  2KEN A;  1KTK A;  2F0G A;  2BOS A;  2B8F A;  2B29 A;  3CPW A;  4PV1 C;  3VR6 A;  1EIG A;  5T1G A;  4JI7 Q;  4MHE A;  3DEP A;  1A3V A;  3OWE B;  2IT1 A;  4AH6 A;  2PI2 A;  3CCS A;  1Q46 A;  3QOJ A;  4EVO A;  4EQO A;  2Q2T A;  4LFC L;  2F0E A;  2IHE A;  1EQR A;  2PMZ E;  1BDO A;  3PIO 3;  4XXE A;  3OW2 A;  5IGE A;  1WTR A;  3D0F A;  1BO0 A;  2WAQ B;  1S4Z A;  2NN6 I;  1RTO A;  4P75 A;  3RD4 A;  1HNZ Q;  3U50 C;  3QIA A;  4I65 A;  3PIP 3;  5IE8 A;  2JA8 B;  3C1F A;  2PW7 A;  3P20 A;  5DM7 3;  1LTB D;  2ZJR A;  3PO3 G;  5IGD A;  3FMC A;  1LV9 A;  2AMC B;  1MIU A;  1AW7 A;  1H9J A;  1E0B A;  1FNV A;  5DNF A;  1D1I A;  3NBI A;  2J7Z A;  1JB3 A;  4R8I A;  5FO7 B;  1PHJ A;  4OX9 Q;  4OO1 I;  1QVF A;  1B9M A;  4XYQ A;  5ISR A;  1S5B D;  4V0B A;  1DM0 B;  1Q12 A;  1DCZ A;  3C3L A;  3K57 A;  1HCZ A;  3I4M G;  3FHW A;  4AYB G;  4A3I G;  3S1Q B;  2JEB I;  3S1N H;  3T16 A;  2JEA I;  3LWU A;  4R4T A;  1K3B C;  2OQK A;  4V19 0;  1LTT D;  3KF6 A;  4KKS A;  1QG7 A;  2BDO A;  2EY6 A;  4FVM A;  4IPD A;  5C6A A;  4A3K G;  1GHJ A;  1VQ8 A;  4NPS A;  3NEL A;  2MUY A;  4JBK A;  3VA5 A;  1N34 L;  1E2W A;  4X3U A;  4A3D G;  4QUC A;  4C3I H;  1YJ9 A;  5DEH A;  2OCE A;  2VS1 A;  3UDF A;  3M4O H;  1O7L A;  3S14 B;  4LF6 Q;  2NZH A;  4DV5 Q;  4WJ4 A;  4K8J A;  4LUV A;  2NZ1 D;  4X64 L;  4IOA A;  1NJI C;  1STE A;  1GUO A;  3F8T A;  1SXT A;  1IL8 A;  3VYS A;  5C44 G;  4HED A;  3JC6 6;  4KN4 C;  4PZ7 A;  1OXV A;  2A68 C;  3AFP A;  1MSG A;  2UUB L;  5HY6 A;  1O78 A;  3CRK C;  2VQF L;  2Z6B A;  2NTT A;  1VQE A;  1HZ9 A;  4KHP Q;  2BE5 D;  2LY7 A;  1O7I A;  2V1C C;  1TY0 A;  2VNU D;  1NSN S;  2AUJ D;  4PMW A;  5AJ3 L;  2V4D A;  1NCV A;  3OIP A;  4BBS G;  1V1P A;  4KI0 A;  1TQO A;  5CR3 A;  1JOQ A;  3GQB A;  3V2T A;  4A3C G;  1D5Z C;  2KA7 A;  1EUJ A;  1TWH H;  1FL0 A;  2YTX A;  5JVH 3;  1Y14 B;  3ICE A;  2E2I H;  4CJ1 B;  3W3A A;  4JI3 Q;  1A3T A;  1UAP A;  5IT9 c;  5CV8 A;  4OWX B;  2I07 B;  3E6Z X;  1I50 H;  4A3B G;  4DR3 Q;  1EYD A;  5G3L D;  4X65 Q;  1YHB A;  3DUZ A;  3QB3 A;  1ENC A;  1Y8P B;  3CCR A;  2CVR A;  3GTO H;  2IY5 B;  1II3 A;  2F4I A;  3GTQ B;  2B2V C;  4OWT B;  2EOT A;  4LUO A;  5LL6 X;  1PZI D;  2GVA A;  1CQV A;  1I4P A;  5F2D A;  1B8A A;  4KTA A;  3PF4 A;  2F0Q A;  4CDC C;  1N33 Q;  1AE2 A;  1KDB A;  1S72 A;  3H91 A;  1SRO A;  1VQF A;  2WFW A;  2L12 A;  1FGB D;  2XWB B;  3TDQ A;  1BR9 A;  1OXT A;  4QQB X;  2KHS A;  1VQD A;  1RHP A;  4LF8 Q;  5A35 A;  3UI2 A;  2QGQ A;  2M2L A;  4DK0 A;  1I4R A;  1XX8 A;  4S3S A;  1B2T A;  4F8M A;  4DK1 A;  1X3P A;  1P16 A;  2R7D A;  4OO1 G;  3JAM i;  2PMZ B;  1G29 1;  1VQ6 A;  2DNE A;  1EYA A;  2F0S A;  1I3Q H;  5JEA H;  3S24 A;  1Q8I A;  2M00 A;  1EWI A;  3RZO B;  1TWA B;  3PIP A;  4JC0 A;  4NW2 A;  3HS0 C;  1WVL A;  1PFS A;  4DXF A;  1TWC B;  2O4X A;  4HSV A;  3R2I A;  2HDL A;  2SNS A;  1F2L A;  4XIG S;  2G9D A;  2SEB D;  4BY1 H;  2R3Z A;  3DXJ C;  5GAG C;  1X3Q A;  3E9I A;  2ZM6 L;  1A62 A;  4CBV A;  2NUC A;  3NBH A;  4CKE A;  4QGU A;  3MHB A;  3AQQ A;  2YU9 H;  3S2D H;  4WFN 3;  1DD2 A;  1HNW Q;  1QNU A;  2IPK D;  1ML0 D;  2O5J C;  5FLX c;  2N3S A;  4HIO A;  3H15 A;  5DM6 3;  4O42 A;  1I4Q A;  4DKA C;  1CI3 M;  3HOW H;  3VYT A;  4RAU C;  1GO3 E;  4C3J G;  5FLX E;  1O7Y A;  5M3M B;  4DR3 L;  1A2U A;  1B3A A;  4JI2 Q;  1DYQ A;  1F9S A;  1AE3 A;  2B2W A;  2ZTD A;  4MN3 A;  4LF5 L;  2QF7 A;  1Q86 C;  4IUT A;  1B70 B;  4A3C H;  3AFQ A;  3J80 L;  4ID6 A;  1KAW A;  2R92 G;  4R9W A;  1SYC A;  1H9R A;  3EVQ A;  3RN5 A;  1LAC A;  4BY7 B;  1IYJ B;  2A19 A;  2Y0S B;  5D14 A;  2B2T C;  4UY8 C;  5BN3 A;  2XWJ B;  5IWA L;  4DAY B;  2VQF Q;  3J80 c;  3K5M A;  1KAB A;  1LTG D;  2F4V L;  5LMN L;  4OEL B;  1I5F A;  1J9O A;  2F0T A;  3HOW G;  2K28 A;  1ZXT A;  1C7Y A;  1VQP A;  3BU2 A;  3F2U A;  4JK1 C;  3NWT A;  2L5T A;  1PXU A;  4GN5 A;  3I3C A;  4PZ8 A;  1NTG A;  3QOL A;  1DOM A;  3HOY H;  4Z9C B;  4L5R C;  1Y1W B;  2N88 A;  1PYW D;  1B53 A;  1EYC A;  3CME A;  1PLF A;  2FJ2 A;  4DAP A;  1XMO L;  4ZUJ A;  3MA2 B;  1PFM A;  4BY1 B;  4LFB Q;  2A74 C;  1WFQ A;  2JA5 H;  3WWV A;  2ATW A;  4RKL A;  4C3I G;  4DR7 Q;  1HZB A;  4A3D H;  1BXT A;  3OTO L;  2Q8R E;  3LWE A;  3GTG B;  4DV6 L;  3PO2 B;  2E5L Q;  2JK8 A;  2KHJ A;  1VQI A;  4RKB A;  1LTI D;  4B9X A;  3S2H B;  1TII D;  1VQL A;  2PZU A;  3GV6 A;  4KLK A;  4QL5 A;  5JEA G;  1H9S A;  3NTI A;  4YCU A;  1ASY A;  1A3U A;  4LF4 L;  3SVM A;  1LT3 D;  1PTO C;  4YHH Q;  1BF4 A;  1BCP B;  4ZKC B;  4IFD I;  1YEZ A;  4L5Q A;  4OON A;  3CP0 A;  2UUA L;  5LMN Q;  4CDE C;  2EE1 A;  3TN2 A;  2RBM A;  4KN7 C;  4C56 C;  1E2V A;  2VUM H;  2AQ3 B;  4DR1 L;  1FD7 D;  1HR0 L;  2EVB A;  2Z1C A;  1PTO D;  1E24 A;  5GAD C;  2Q8T A;  2RSO A;  1K3R A;  1MBY A;  3N6R A;  3SGI A;  4DA2 A;  4JYA L;  3KLS X;  3NK9 A;  3MC0 B;  3BS1 A;  4PQX A;  2NVY B;  1PV4 A;  1OXS C;  4BXX H;  4NB3 A;  4XQQ A;  1D6E C;  3CQZ H;  4JI8 L;  3V05 A;  2B8G A;  5C3E G;  3CXC A;  3SR1 A;  4LF5 Q;  4N9T A;  1ICF B;  2JA5 G;  4B3S Q;  1PVO A;  1O7Z A;  1GKH A;  2OEO A;  1PMR A;  3GTL B;  3CU7 A;  5E4W C;  4P72 A;  1TWA H;  5CGK A;  2FMM A;  4ME5 A;  4K5X A;  1EQQ A;  3DM3 A;  4QMG A;  3U4V A;  3HEJ A;  2NVT H;  1E7Z A;  4X62 Q;  4RCO A;  2JA7 G;  2IHF A;  4JI3 L;  3K58 A;  1TWH B;  2PW5 A;  1CSP A;  1FYC A;  4X66 L;  4K0K L;  3ZYY X;  4DV0 L;  4IUP A;  2JA7 B;  1H9S B;  1W2B A;  3AMU A;  5G3L F;  1NAP A;  1SNC A;  2VQE Q;  2KBN A;  2OT2 A;  3ULJ A;  1WYD A;  1J5E L;  3DWP A;  4HTH A;  4DV1 Q;  4B9W A;  1HA5 A;  3T1H Q;  2ZTE A;  4JCV E;  3PUY A;  2WV6 D;  4BWG B;  1EY6 A;  1Y1V H;  1C48 A;  5M3M H;  2NB0 A;  3VDY A;  3HKS A;  1E1T A;  1FGU A;  2FFK B;  4FO2 A;  5EPL A;  2RHS B;  4C3J H;  3A56 A;  4JI5 L;  4DV2 L;  3BJU A;  1Q90 A;  5I2Y A;  1SND A;  4KY7 A;  3OMC A;  3GTM H;  4A3J B;  4LWC A;  1WD1 A;  1A2T A;  3M7N A;  3E9H A;  1VQM A;  1QJO A;  2IX3 A;  1D1K A;  4RH6 A;  4IJH A;  3AB9 A;  3EFX D;  4MNO A;  2X6G A;  1K83 B;  4H44 C;  2MJ8 A;  3K7U C;  3J81 i;  2YYZ A;  4A3K H;  2QDL A;  4JI0 Q;  2L11 A;  3QWN A;  2D0P A;  3TP6 A;  2A6H D;  2RHQ B;  3LX0 A;  3KLR A;  4DV1 L;  1HR0 W;  5M5X B;  2PPB C;  5COY A;  5IP9 G;  3K0Y A;  3NEM A;  1U9R A;  3EJI A;  1Z6H A;  4R4I A;  2DJF C;  1IHZ A;  4GNX B;  1HHV A;  4TRD A;  1JJC B;  1F9Q A;  1S5F D;  1SRU A;  4OEM B;  2K5V A;  5IIF A;  2F03 A;  1KDA A;  4ZLT F;  2ZXO A;  3M4Y A;  5IOC A;  3I90 A;  1JT8 A;  1QNK A;  2XNA C;  4NMZ A;  3NP8 A;  4CDD C;  2UXD L;  1EQT A;  4IUQ A;  1BBU A;  2D0O A;  4MTK A;  2LXJ A;  4O1N A;  5FLX L;  3N52 A;  4AQY L;  1XNR L;  1C4Q A;  1HRJ A;  2R93 B;  1PTO B;  1MGS A;  4KJN A;  1HFG A;  1E22 A;  3HOW B;  3RLO A;  4CJ2 C;  3KBG A;  4DAM A;  1RKN A;  5EKK A;  3JAM E;  2CKZ B;  4A76 A;  4DF7 A;  2NWG A;  2UXD Q;  3GTP H;  4OGQ C;  1YNJ C;  2TSS A;  1VQ7 A;  3TRZ A;  3DEO A;  3CC2 A;  1TS2 A;  1K8O A;  1QB5 D;  3X3N A;  2A6H C;  3I4N H;  1CA5 A;  2CQA A;  4GLX A;  3MXP A;  3SE0 A;  3BZD B;  4WRD A;  2A73 B;  2F0H A;  2MFI A;  4XDX A;  1VQO A;  3I70 A;  1JOO A;  1DOL A;  1HUM A;  2RDG A;  4A3B H;  3H3V I;  5FLM G;  4JV5 Q;  1HPC A;  4UHV A;  3L0O A;  5H1S E;  2VB3 X;  3EQL C;  3A7L A;  4ILW A;  4IJL A;  4A3E B;  5GQO A;  2UUC Q;  1I3Q B;  2CH4 W;  4JI4 Q;  4RA8 A;  3D4W A;  4B3M L;  5LL6 S;  1I94 L;  2RVL A;  4KKU A;  4QUF A;  2PZW A;  5IT9 L;  3BVG A;  1IW7 C;  2X6L A;  4LF6 L;  1WTV A;  1EFW A;  1UE1 A;  1FJG L;  2YTV A;  2XIW A;  5EBC A;  4DFA A;  4B3T L;  4A3M H;  2H4O A;  1XMQ L;  1DGS A;  3A55 A;  5DAU A;  4C3H B;  4IQZ A;  3TZU A;  1SNO A;  5M3F G;  2UU9 Q;  1TY2 A;  4K5W A;  3T1H L;  4R4O A;  2EY2 A;  3U9S A;  4JI6 L;  3NTK A;  2K04 A;  4K6L A;  4KD3 A;  2B39 A;  1L1O A;  1VQN A;  1PH1 A;  3FP9 A;  1STG A;  4A3G H;  3HKZ E;  1WTP A;  4L5S A;  1HTP A;  3GTQ H;  1VQA A;  3K7A B;  5I2X A;  2PI2 E;  2ZJQ A;  1Q8K A;  2RQX A;  1E1O A;  3BDL A;  4IFD J;  1STH A;  1Y8N B;  4DUZ Q;  2WAQ G;  3M3Y H;  5HUR A;  1BKB A;  2A69 C;  1GUG A;  4FF2 A;  1H9M A;  1ONL A;  2XTI A;  1KIX A;  1L1O C;  4JI7 L;  1I6H B;  1SNQ A;  1YNN C;  4DPG A;  3C2P A;  5E4X A;  3Q23 A;  2EJF C;  4GS3 A;  1VQG A;  4XT3 B;  3GTM B;  2VUM G;  3E0E A;  3SDZ A;  2F3I A;  4JBW A;  1NR4 A;  2A5H A;  2D9U A;  4EGV A;  4P73 A;  2F1M A;  1XXG A;  2MP1 A;  3TBI B;  4PNY A;  4JBM A;  5FJ8 G;  3HOU B;  2ZJP A;  4DR5 L;  2VW9 A;  2Q2H A;  3RLF A;  2AKW B;  4JYA Q;  1G51 A;  2Z6K A;  4KHP L;  4RGM A;  3FDT A;  4DU9 A;  2Z9H A;  5LMN W;  2DUD A;  4R4Q A;  2L1B A;  3L3O C;  4FNF A;  1MI2 A;  2JQO A;  5LHY 1;  3C46 A;  1Q1B A;  1HZC A;  4WJW A;  1G2T A;  3GP7 A;  2JYO A;  3MEH A;  3J81 c;  1NY4 A;  4CHT B;  4GKJ Q;  3S15 B;  1Q82 C;  1K8G A;  3W1B A;  2B2Y A;  3HP3 A;  5C4X H;  4GKK Q;  3WOF A;  2WAC A;  1DON A;  4HCE A;  4GKK L;  1I4H A;  4A3G B;  1B9N A;  5CV9 A;  2E5L L;  3ND9 A;  1GJX A;  3G6J B;  1NE3 A;  4POG A;  2LKV A;  4RMF A;  3J80 i;  2K05 A;  1X3G A;  5LMU Q;  4A3B B;  1K0R A;  4RCN A;  4XQJ A;  1GOZ A;  1KNE A;  2K5Q A;  2Q8I B;  4A3E H;  4A3F G;  4Q5V A;  4HJA A;  1QIL A;  4HSP A;  3F2C A;  4DR5 Q;  1WTO A;  3PIO A;  3S16 H;  4L63 B;  2SDF A;  2G9H D;  3HOX B;  3S14 H;  3KF8 B;  2KHI A;  3R2T A;  1B44 D;  2M9V A;  5KND A;  4DK3 C;  3GTJ H;  1S5E D;  1EZ6 A;  5CYU A;  2AHO B;  2Z4H A;  2VQE L;  3RZD H;  3RR5 A;  1AP0 A;  3NQI A;  3MWY W;  2RA4 A;  3E3X A;  1U4R A;  3TZD A;  3EBE A;  4YIJ A;  4CKB A;  1D5X C;  1SJE D;  1IKM A;  2NN6 H;  1W6K A;  1NMF A;  5M5W B;  1IYV A;  1QVC A;  1R4P B;  4CJ0 B;  3CQZ B;  4X65 L;  4QB4 A;  5EKI A;  4A75 A;  4AYB B;  4A3I B;  1DOK A;  1NR2 A;  1ICW A;  4FXG C;  1TU2 B;  5IGF A;  4GOP A;  3M4Q A;  2D2C C;  1H9K A;  1EU4 A;  4NXN Q;  2E2D C;  4JI1 L;  2HQL A;  4ULL A;  1YNJ D;  3Q0A A;  1KQS A;  1HFN A;  2LSS A;  3LNN A;  2I0Q A;  4MZ9 A;  3D4D A;  3K8A A;  4A4I A;  4UAI A;  5J22 A;  3UDX A;  1NUC A;  3BZK A;  3NBH B;  2NVT B;  4DNI A;  4C3J B;  5C5L A;  2CW0 C;  4LJZ C;  2HHH L;  4QCL A;  1TWG B;  2RCN A;  4FF3 A;  2GVB A;  1CFM A;  4APV A;  1X32 A;  3NTH A;  2A69 D;  4RHR A;  2JA8 G;  1CT1 D;  2E75 C;  4ZAI A;  2IW3 A;  5M5Y H;  3GTG H;  1MKH A;  5C0X H;  2HCI A;  3D31 A;  1PFN A;  1K83 H;  5BR8 L;  1EYG A;  2AWN A;  1SFO H;  3HZX A;  5DLQ E;  2F0I A;  4J8Q A;  1UE7 A;  1IBM Q;  2KCM A;  3UE0 A;  1EOV A;  1Y1V B;  3PV0 A;  4NXM L;  5KEE A;  4DV6 Q;  4HMI A;  4YWL A;  1RF2 D;  1IBL L;  4YWK A;  1VCI A;  1TS4 A;  3EIV A;  2EYF A;  4IUU A;  1HNX Q;  1B4O A;  4IN3 A;  1KRT A;  4QIW E;  4GLA C;  1STB A;  1G6Z A;  4MTN A;  1K73 C;  1PH9 A;  3S17 H;  4DV3 Q;  5I6W A;  3AEV A;  5KYL A;  1EY0 A;  2PCF B;  1YHQ A;  2R93 H;  4IPG A;  4DGZ A;  3CCM A;  4HR7 B;  2NVQ B;  4IPH A;  1QUQ A;  2NBF A;  4DUZ L;  3GTL H;  1MJC A;  1FR3 A;  1TVX A;  4BBS H;  4TVA B;  5GAE C;  3MVV A;  3T56 B;  4B3R L;  2ZT9 C;  3BZC A;  2HDM A;  2QEX A;  2Z0S A;  1FJG Q;  2X69 A;  2MNA A;  1BCP D;  2N78 A;  4GOP B;  3R8B A;  2JA6 H;  4OL7 A;  2FIN B;  4DNR B;  4WJ3 M;  1CK1 A;  2JA7 H;  2I46 A;  4LAA A;  1L0X B;  1C9O A;  1LTA D;  3EN2 A;  5CBE E;  2OWO A;  3PMF A;  5IOD A;  1IBK L;  1RD9 D;  2L55 A;  2R6G A;  1I4X A;  3S2D B;  4DR6 L;  3NXW A;  4H13 C;  1PTO H;  1VS0 A;  3DWA A;  1SE2 A;  4KD4 A;  2BA1 A;  3L2P A;  2CCZ A;  1L0W A;  4DR4 L;  4JVZ A;  3K59 A;  4FF1 A;  2E2J B;  1HNW L;  3HOZ H;  5CBA E;  1Z7T A;  2B3G A;  3K6O A;  1L0Y B;  3GDE A;  2UU9 L;  4BXX G;  2PNR C;  2LS0 1;  3RZD B;  3I7F A;  2EYP A;  3GTK B;  2R7Z B;  3H09 A;  4BS9 A;  1HTL D;  1QUQ B;  2BDN A;  4DV3 L;  2NZO A;  1N36 Q;  4BBR H;  1BBW A;  1R9T B;  2F0V A;  2XGT A;  1WI5 A;  4IFD H;  4IFD G;  4A3I H;  4BA1 I;  4A93 B;  2ID0 A;  2DY8 A;  3B6Y A;  4JI4 L;  4BBR G;  2LFN A;  4RFB A;  1PYS B;  5KYI A;  2MO0 A;  3CKI B;  4LFA L;  2JE6 I;  1RTN A;  4IUN A;  1GUW A;  2UXB L;  1AZQ A;  5GAH C;  1K8M A;  1WCM G;  4DN4 M;  3PO2 H;  3RLN A;  4BY7 G;  3HOU G;  1UE5 A;  4C1N K;  4MIU A;  5BR8 Q;  4U67 3;  1YNX A;  3P7J A;  1F9R A;  3S2H H;  1X3F A;  2F0K A;  1QZH A;  2AQ1 B;  4HCS A;  2F0L A;  3OOC A;  3K81 C;  3SXH A;  5FO8 B;  3E0J A;  2SOB A;  5C4Z A;  3K5L A;  2WKC A;  1WTX A;  2E2H B;  3UE1 A;  5M5Y B;  4XT1 B;  2SNM A;  3M3Y B;  4ZYS A;  2VUM B;  4TSS A;  3HKZ B;  5C0X J;  2KQ3 A;  4DR4 Q;  1CKO A;  1SE3 A;  5HGQ A;  3CCE A;  4PZ6 A;  3G6E A;  4A3M G;  2B63 G;  3K7A H;  4HN7 A;  2PQE A;  2JA6 G;  2WIN B;  4OIK A;  2N49 A;  4TQU S;  3NEN A;  4YCW A;  1JC7 A;  4N8X 1;  3S9W A;  3J7A F;  3DMU A;  2H5X A;  3I4N B;  2ZXP A;  2KOL A;  2R7Z H;  5C3W A;  4LF4 Q;  1U5K A;  5ELC A;  1QWY A;  3SHL A;  3FKI G;  3PO3 B;  2Z4I A;  1I6V C;  3QO2 A;  3J80 E;  2ZXR A;  3UDG A;  5KRU A;  1Q1E A;  4Y52 H;  4F87 A;  5AJ3 Q;  1SYE A;  5IYC H;  5FLM H;  3RN2 A;  2MHV A;  3D3R A;  3TSS A;  1J5E Q;  2A1A A;  4DV2 Q;  1G8Z D;  1M8A A; 
#chains in the Genus database with same CATH homology
 1ZKO A;  2F0N A;  4RGN A;  2B2T A;  3IL8 A;  3TP7 A;  2EDG A;  3IAY A;  2LMC B;  1M4V A;  2EJG C;  3I4L A;  4R8N A;  1CA6 A;  1EY7 A;  3J81 L;  4A3M B;  4Y7N B;  3MZ5 A;  4E6I A;  1SYG A;  4UDU C;  1JCK B;  3R93 A;  3J7Y W;  1SYF A;  3S1N B;  4NP5 A;  2JXM B;  1LT6 D;  1PDQ A;  3GO5 A;  4RHS A;  1ZYR D;  3SK6 A;  1V1P B;  5K36 G;  5J1Z A;  1WCM B;  1VDZ A;  3D8G A;  5D3D A;  4ODG A;  4C3I B;  5D65 A;  2MGS A;  1XWE A;  2F3W A;  5JVG 3;  3PUW A;  1JWS D;  1G2S A;  5C4J B;  3I72 A;  5CV7 A;  3KK7 A;  5KIX A;  3D4R A;  2NN6 G;  1EY9 A;  3BDC A;  3OIQ A;  5EGT A;  4LK1 C;  4DAV A;  1LTS D;  3JAM L;  1EEF D;  1BQQ T;  1EWH A;  1O80 A;  2JA6 B;  4M8A A;  1JWM D;  3NPP A;  1V43 A;  3VR4 A;  4NKL A;  2N55 A;  1SNM A;  3IFD A;  4XQN A;  1LLR D;  2F0M A;  3NSW A;  4KV6 A;  4TKO B;  4G57 A;  3P1H A;  3KBX A;  1JE4 A;  3GTP B;  2ENB A;  2J4X A;  2A6E C;  2WB1 B;  1SYB A;  4K2L A;  5JOB A;  3KUP A;  1XYI A;  1KLU D;  2EYH A;  3I4M B;  3FRP B;  3S1R B;  4DNT B;  5CMD A;  2H1E A;  4XTC S;  3W2D A;  3T13 A;  4BBR B;  1KDC A;  1LT4 D;  1VF7 A;  3PUV A;  2CW0 D;  4KMU C;  2DNC A;  5ELD A;  3MXU A;  4FXD A;  4FP5 D;  2F0F A;  2NTS A;  2K33 A;  1EOT A;  2AQ2 B;  4HMJ A;  4EQP A;  2AUK A;  3VYU A;  3S17 B;  2E74 C;  5ELF A;  4DXG A;  5M3F B;  4KKT A;  2XN9 C;  5D3I B;  1D2B A;  4C3H G;  4C2M B;  1CM9 A;  3KF8 A;  3TP8 A;  1LTR D;  2JSO A;  3QJY A;  5C3X A;  5JJZ A;  2L0C A;  3G7L A;  1SDF A;  1JWU D;  2FMC A;  5BN5 A;  4G4K A;  1PFB A;  3BYY B;  1JQY D;  4QF4 A;  1TT2 A;  3A8I E;  3RUZ A;  1OO9 B;  5C0X I;  2XSC A;  3A8K E;  2CHB D;  3OWF A;  1GUT A;  1C8C A;  1T5X D;  1HQR D;  2PZT A;  3URY A;  1STY A;  1AEX A;  1PZJ D;  4KY5 A;  1MSH A;  1PRT C;  4EQN A;  2XRS D;  5EBD A;  2EY1 A;  1ZYR C;  5T1I A;  1TKW B;  2EYL A;  5E3F A;  1VF5 C;  2RDF A;  1EFI D;  3TME A;  5IGG A;  4X3K A;  1I4G A;  3K5O A;  5ELE A;  5KGU A;  2XVS A;  4K5V A;  2F0O A;  4XYO A;  2PYK A;  4IZ8 A;  1BNZ A;  3GD7 A;  4CGY B;  5IT9 E;  1RDP D;  2KJX A;  1HUN A;  1STA A;  1CTM A;  3DHQ A;  2BCO A;  1F2M A;  3J7A V;  4A3D B;  4KHV A;  4K2K A;  1EWC A;  4F7X A;  2TMP A;  1U4P A;  4G7Z C;  3O13 A;  3U9O A;  3CHB D;  3DWQ A;  4ZRZ A;  1ILP A;  1ESR A;  3FVQ A;  1JOR A;  5EQ0 A;  3VA7 A;  5BN4 A;  1VMP A;  1AN8 A;  4A3K B;  2F0P A;  1PRT B;  1V1O A;  1IYU A;  4G7H C;  1GUN A;  1EY4 A;  2IL8 A;  1V8Q A;  3T53 B;  1WD0 A;  5JPM C;  4RGT A;  5I9O A;  2K5D A;  2RDH A;  3IFT A;  1AFP A;  2MPM A;  4OIJ A;  3I73 A;  1UUP A;  1IKL A;  5JEA J;  5I4D A;  2B2U C;  5JPN C;  2C5C A;  1SJH D;  1UEA B;  3J81 E;  2VXW A;  4FF4 A;  1AZP A;  5AFW A;  4X3T A;  1ET6 A;  1BCP F;  4A3F B;  2E2I B;  2WII B;  3MXN A;  4NDX A;  2KEC A;  2EYJ A;  1TWF B;  3BG3 A;  1ESF A;  4U68 A;  2EY5 A;  1SFO B;  1HQM C;  4B08 A;  1XTC D;  1WTW A;  3OW7 A;  3SK8 A;  4CKC A;  2EYO A;  1EY8 A;  1STN A;  2KCN A;  3GTJ B;  3P75 A;  4F88 A;  1CQF A;  1CZG A;  1EL0 A;  3HOV B;  5FOB B;  3ERO A;  2BE5 C;  3WDN A;  2F0D A;  4IAL A;  1BCP C;  3VR2 A;  1BUV T;  3Q22 A;  5EPK A;  1ET9 A;  3A8J E;  2GA4 B;  4BA2 I;  1ILQ A;  2B2U A;  3I8Z A;  1F2Z A;  4K14 A;  1JOK A;  1Y8O B;  1LT5 D;  2D62 A;  3NQT A;  3OPO A;  3TP5 A;  1QE6 A;  4L8J A;  3VR3 A;  4PMC A;  1OXX K;  4IUR A;  3HRZ C;  3MXG A;  3FPU B;  5C0X G;  2K1B A;  3MFY A;  2WP8 J;  1VMC A;  3BDO A;  5C4X B;  2B2V A;  3PUZ A;  4KK7 A;  1QCB D;  2L4N A;  1TS5 A;  3FKI B;  1KAA A;  1F77 A;  2OF1 A;  2F0J A;  1G91 A;  3FPP A;  3SEB A;  1BBX C;  3FEW X;  5FO9 B;  1D5M C;  1B50 A;  2KUM A;  3RMH A;  1DZ1 A;  3H94 A;  3PUX A;  2PO4 A;  4L6T B;  4X3S A;  4RGO S;  3S16 B;  4ZUI A;  4I7Z C;  5HGT A;  1W6J A;  2HCC A;  2NVX B;  2EZV A;  1U4M A;  2EYM A;  1ENA A;  4K8I A;  2XRQ D;  3CRL C;  2K7V A;  2A6E D;  2J0T D;  5I9P A;  2F0U A;  4Q0F A;  4FXK C;  3S1M B;  4KY6 A;  2HUG A;  1I50 B;  1U4L A;  2K03 A;  3L9A X;  5EJW A;  1JR0 D;  2B2Y C;  3L7Z C;  4G7O C;  4LMQ D;  1ROD A;  2EXZ A;  2EJM A;  2YU9 B;  5ELB A;  3SK4 A;  2KVM A;  2IJ0 A;  2QCP X;  5CV5 A;  1S5C D;  2IX0 A;  2RSN A;  1DXM A;  5I6Y A;  3D6C A;  3M85 A;  2IWH A;  2BA0 A;  2EPB A;  1UNS A;  2O5I C;  1GXD C;  3H3V C;  1PRT F;  5NUC A;  1S5D D;  2K5W A;  1PTO F;  3DM1 A;  1GUS A;  3BYT B;  4ZQ3 A;  1CHP D;  1QOH A;  2E76 C;  1EIH A;  4ZK9 B;  4KHZ A;  3ND8 A;  3M4O B;  2QIL A;  3KLS A;  4RWS C;  1FNU A;  3IKJ A;  5K5P A;  3HOY B;  3ONA B;  4OO1 H;  4M1U B;  3I91 A;  5C5M A;  3Q24 A;  2K6A A;  4QIW B;  2VB2 X;  3R3O A;  2KEE A;  2F3V A;  1ENF A;  1EY5 A;  5EPJ A;  2DY7 A;  1EU3 A;  2C9O A;  1EEI D;  1OXU A;  4BBS B;  2KCC A;  4P2C B;  4H0L C;  3QG1 A;  1GHK A;  1HA6 A;  1T5E A;  2O2L D;  3SK5 A;  1KLG D;  5CC4 A;  1SEB D;  5A2Q L;  5EKL A;  5JAV A;  1CZW A;  3A54 A;  3OSO A;  2B2W C;  1EZ8 A;  4C1N I;  3H6M A;  3GTO B;  2FHT A;  1LO5 D;  1IW7 D;  3T51 B;  5J39 A;  1RJT A;  1JIC A;  1WTQ A;  2K32 A;  1SBB B;  2K01 A;  2ICI A;  3MTS A;  5E1F A;  3K5N A;  1B1Z A;  1SE4 A;  2WKD A;  4WOR A;  2KED A;  5FKA C;  2RKS A;  5KNC A;  3D6W A;  3AU7 A;  4J6H A;  5FK9 C;  3NUC A;  3X3M A;  2Z8L A;  2F0W A;  2IX1 A;  1SNP A;  5IGB A;  2R92 B;  4J1M A;  1TR5 A;  3VYR A;  1SSO A;  4GZY C;  1CHQ D;  3E5S A;  2OXP A;  5KNB A;  3HG9 A;  1YNN D;  1R4Q B;  4HAE A;  3M7G A;  3BVM A;  1HXY D;  4DAY A;  1SMY C;  1TS3 A;  3HOZ B;  1A15 A;  3NHH A;  1KNA A;  3A7A B;  2AWO A;  5K36 H;  1SMY D;  2NYZ D;  3OMG A;  1E2Z A;  3C1E A;  1F2Y A;  2QKI C;  3OHX C;  2B63 B;  2R61 A;  4OHJ A;  1RCV D;  2QEJ C;  1Y69 U;  2L9H A;  3NWS A;  3Q6S A;  5COR A;  1BOS A;  3EA6 A;  1MD2 D;  4IUV A;  5CV6 A;  5TSS A;  3MFG A;  5M9O A;  5CV4 A;  1Z47 A;  1ZEQ X;  1LAB A;  4H7B A;  3ITP A;  5A2Q E;  3ERQ A;  2JA5 B;  3HGB A;  5C3E B;  4N9P A;  5C44 B;  2A68 D;  1F9P A;  4FYD A;  1EQV A;  1SYD A;  2QDB A;  2D5D A;  3NE5 B;  3MAQ A;  3T4A C;  4PMB A;  3WOE A;  1J8I A;  1PZK D;  4ABN A;  4KJO A;  3H0G B;  2ICE C;  2HQE A;  3V96 A;  1Q3L A;  1DJR D;  1SAP A;  5C4H A;  4ZKB B;  2JP1 A;  3GV3 A;  3VR5 A;  1FNW A;  1A6X A;  4K6D A;  3BVZ A;  1PRT D;  5IGC A;  2DN8 A;  1KTK A;  2F0G A;  2BOS A;  2B8F A;  4PV1 C;  3VR6 A;  1EIG A;  5T1G A;  4MHE A;  3DEP A;  1A3V A;  3OWE B;  2IT1 A;  3QOJ A;  4EVO A;  4EQO A;  2F0E A;  1BDO A;  3PIO 3;  4XXE A;  5IGE A;  1WTR A;  1BO0 A;  1S4Z A;  2WAQ B;  2NN6 I;  1RTO A;  3RD4 A;  3QIA A;  4I65 A;  3PIP 3;  2JA8 B;  3C1F A;  2PW7 A;  3P20 A;  5DM7 3;  1LTB D;  5IGD A;  3FMC A;  1LV9 A;  1AW7 A;  1H9J A;  1E0B A;  1FNV A;  5DNF A;  1D1I A;  3NBI A;  2J7Z A;  1JB3 A;  4R8I A;  5FO7 B;  4OO1 I;  1B9M A;  4XYQ A;  5ISR A;  1S5B D;  4V0B A;  1DM0 B;  1Q12 A;  1DCZ A;  3C3L A;  3K57 A;  1HCZ A;  3S1Q B;  2JEB I;  3T16 A;  2JEA I;  3LWU A;  4V19 0;  1LTT D;  4KKS A;  1QG7 A;  2BDO A;  2EY6 A;  4FVM A;  5C6A A;  1GHJ A;  2MUY A;  3VA5 A;  1E2W A;  4X3U A;  4QUC A;  5DEH A;  1O7L A;  3S14 B;  4K8J A;  2NZ1 D;  1STE A;  1GUO A;  1SXT A;  1IL8 A;  3VYS A;  4HED A;  4KN4 C;  1OXV A;  2A68 C;  1MSG A;  1O78 A;  3CRK C;  2NTT A;  2BE5 D;  2LY7 A;  1TY0 A;  2VNU D;  1NSN S;  2AUJ D;  4PMW A;  2V4D A;  1NCV A;  3OIP A;  1V1P A;  4KI0 A;  1TQO A;  5CR3 A;  1JOQ A;  3GQB A;  3V2T A;  1D5Z C;  2KA7 A;  5JVH 3;  4CJ1 B;  3W3A A;  1A3T A;  1UAP A;  5CV8 A;  2I07 B;  3E6Z X;  1EYD A;  5G3L D;  3DUZ A;  3QB3 A;  1ENC A;  1Y8P B;  2CVR A;  1II3 A;  2F4I A;  3GTQ B;  2B2V C;  2EOT A;  5LL6 X;  1PZI D;  1CQV A;  1I4P A;  5F2D A;  4KTA A;  2F0Q A;  1KDB A;  3H91 A;  2L12 A;  1FGB D;  2XWB B;  3TDQ A;  1BR9 A;  1OXT A;  2KHS A;  1RHP A;  5A35 A;  4DK0 A;  3UI2 A;  2M2L A;  1I4R A;  1XX8 A;  4S3S A;  1B2T A;  4F8M A;  4DK1 A;  1X3P A;  4OO1 G;  2PMZ B;  1G29 1;  2DNE A;  1EYA A;  2F0S A;  5JEA H;  1Q8I A;  2M00 A;  3RZO B;  1TWA B;  4NW2 A;  3HS0 C;  1WVL A;  4DXF A;  1TWC B;  2O4X A;  4HSV A;  3R2I A;  2HDL A;  2SNS A;  1F2L A;  4XIG S;  2G9D A;  2SEB D;  2R3Z A;  3DXJ C;  1X3Q A;  4CBV A;  2NUC A;  3NBH A;  4CKE A;  3MHB A;  4WFN 3;  1DD2 A;  1QNU A;  2IPK D;  1ML0 D;  2O5J C;  5DM6 3;  4O42 A;  1I4Q A;  1CI3 M;  3VYT A;  4RAU C;  4C3J G;  5FLX E;  1O7Y A;  5M3M B;  1A2U A;  1B3A A;  1DYQ A;  1F9S A;  2B2W A;  4MN3 A;  2QF7 A;  4IUT A;  3J80 L;  4ID6 A;  4R9W A;  1SYC A;  1H9R A;  3EVQ A;  1LAC A;  4BY7 B;  2Y0S B;  5D14 A;  2B2T C;  5BN3 A;  2XWJ B;  3K5M A;  1KAB A;  1LTG D;  1J9O A;  2F0T A;  2K28 A;  1ZXT A;  3F2U A;  3NWT A;  4JK1 C;  2L5T A;  1PXU A;  3I3C A;  3QOL A;  1DOM A;  4Z9C B;  1Y1W B;  2N88 A;  1PYW D;  1B53 A;  1EYC A;  1PLF A;  2FJ2 A;  4DAP A;  4ZUJ A;  3MA2 B;  1PFM A;  4BY1 B;  2A74 C;  4RKL A;  4C3I G;  1BXT A;  2Q8R E;  3LWE A;  3GTG B;  3PO2 B;  4RKB A;  1LTI D;  4B9X A;  3S2H B;  1TII D;  2PZU A;  3GV6 A;  5JEA G;  1H9S A;  3NTI A;  1A3U A;  1BF4 A;  1LT3 D;  1PTO C;  3SVM A;  1BCP B;  4ZKC B;  4IFD I;  2EE1 A;  3TN2 A;  2RBM A;  4KN7 C;  4C56 C;  1E2V A;  2AQ3 B;  1FD7 D;  2EVB A;  2Z1C A;  1PTO D;  2Q8T A;  2RSO A;  1MBY A;  3N6R A;  4DA2 A;  3KLS X;  3NK9 A;  3MC0 B;  3BS1 A;  4PQX A;  2NVY B;  1OXS C;  4XQQ A;  1D6E C;  3V05 A;  2B8G A;  3SR1 A;  4N9T A;  1O7Z A;  2OEO A;  1PMR A;  3GTL B;  3CU7 A;  5E4W C;  5CGK A;  2FMM A;  4ME5 A;  4K5X A;  4QMG A;  3HEJ A;  4RCO A;  3K58 A;  1TWH B;  2PW5 A;  1FYC A;  3ZYY X;  4IUP A;  2JA7 B;  1H9S B;  3AMU A;  5G3L F;  1NAP A;  1SNC A;  2OT2 A;  3DWP A;  4HTH A;  4B9W A;  1HA5 A;  3PUY A;  2WV6 D;  4BWG B;  1EY6 A;  1C48 A;  2NB0 A;  2FFK B;  4FO2 A;  5EPL A;  3A56 A;  1Q90 A;  5I2Y A;  1SND A;  4KY7 A;  3OMC A;  4A3J B;  1WD1 A;  1A2T A;  3M7N A;  1QJO A;  2IX3 A;  1D1K A;  4RH6 A;  3AB9 A;  3EFX D;  2X6G A;  1K83 B;  2MJ8 A;  4H44 C;  2YYZ A;  2L11 A;  3QWN A;  3TP6 A;  2A6H D;  3LX0 A;  3KLR A;  2PPB C;  5M5X B;  5COY A;  3K0Y A;  1U9R A;  3EJI A;  1Z6H A;  1IHZ A;  1HHV A;  4TRD A;  1F9Q A;  1S5F D;  5IIF A;  2F03 A;  1KDA A;  4ZLT F;  2ZXO A;  5IOC A;  3M4Y A;  3I90 A;  1QNK A;  2XNA C;  4NMZ A;  3NP8 A;  1EQT A;  4IUQ A;  4O1N A;  5FLX L;  3N52 A;  1C4Q A;  1HRJ A;  2R93 B;  1PTO B;  1MGS A;  4KJN A;  1HFG A;  3HOW B;  4CJ2 C;  3KBG A;  1RKN A;  5EKK A;  3JAM E;  4DF7 A;  2NWG A;  4OGQ C;  1YNJ C;  2TSS A;  3DEO A;  1TS2 A;  1K8O A;  1QB5 D;  3X3N A;  2A6H C;  1CA5 A;  2CQA A;  3MXP A;  3SE0 A;  3BZD B;  4WRD A;  2A73 B;  2F0H A;  4XDX A;  3I70 A;  1JOO A;  1DOL A;  1HUM A;  2RDG A;  1HPC A;  2VB3 X;  3EQL C;  3A7L A;  4ILW A;  4A3E B;  1I3Q B;  4RA8 A;  3D4W A;  5LL6 S;  2RVL A;  4KKU A;  4QUF A;  2PZW A;  5IT9 L;  3BVG A;  1IW7 C;  2X6L A;  1WTV A;  2XIW A;  5EBC A;  4DFA A;  2H4O A;  3A55 A;  5DAU A;  4C3H B;  4IQZ A;  3TZU A;  1SNO A;  1TY2 A;  4K5W A;  2EY2 A;  3U9S A;  3NTK A;  2K04 A;  4K6L A;  4KD3 A;  2B39 A;  1STG A;  1WTP A;  1HTP A;  3K7A B;  5I2X A;  2RQX A;  3BDL A;  4IFD J;  1STH A;  1Y8N B;  5HUR A;  2A69 C;  1GUG A;  4FF2 A;  1H9M A;  1ONL A;  1I6H B;  1SNQ A;  1YNN C;  3C2P A;  5E4X A;  3Q23 A;  2EJF C;  4XT3 B;  3GTM B;  3SDZ A;  4JBW A;  1NR4 A;  2A5H A;  2D9U A;  4EGV A;  2F1M A;  1XXG A;  2MP1 A;  3TBI B;  4PNY A;  3HOU B;  3RLF A;  4RGM A;  3FDT A;  4DU9 A;  3C46 A;  2L1B A;  3L3O C;  4FNF A;  1MI2 A;  5LHY 1;  1Q1B A;  4WJW A;  1G2T A;  3GP7 A;  2JYO A;  3MEH A;  4CHT B;  3S15 B;  2B2Y A;  3HP3 A;  3WOF A;  2WAC A;  1DON A;  4HCE A;  1I4H A;  4A3G B;  1B9N A;  5CV9 A;  3ND9 A;  1GJX A;  3G6J B;  2LKV A;  2K05 A;  4A3B B;  4RCN A;  4XQJ A;  1GOZ A;  1KNE A;  2K5Q A;  2Q8I B;  4Q5V A;  1QIL A;  4HSP A;  1WTO A;  4L63 B;  2SDF A;  2G9H D;  3HOX B;  3R2T A;  1B44 D;  2M9V A;  5KND A;  1S5E D;  1EZ6 A;  5CYU A;  2Z4H A;  1AP0 A;  3NQI A;  3MWY W;  2RA4 A;  1U4R A;  3TZD A;  4YIJ A;  4CKB A;  1D5X C;  1SJE D;  1IKM A;  2NN6 H;  1W6K A;  5M5W B;  1IYV A;  1R4P B;  4CJ0 B;  3CQZ B;  4QB4 A;  5EKI A;  4AYB B;  4A3I B;  1DOK A;  1NR2 A;  1ICW A;  4FXG C;  1TU2 B;  5IGF A;  2D2C C;  1H9K A;  1EU4 A;  2E2D C;  3Q0A A;  4ULL A;  1YNJ D;  1HFN A;  3LNN A;  3D4D A;  4UAI A;  5J22 A;  1NUC A;  2NVT B;  4C3J B;  5C5L A;  2CW0 C;  4LJZ C;  4QCL A;  1TWG B;  4FF3 A;  1CFM A;  1X32 A;  3NTH A;  2A69 D;  4RHR A;  1CT1 D;  2E75 C;  4ZAI A;  2IW3 A;  5C0X H;  2HCI A;  3D31 A;  1PFN A;  2AWN A;  3HZX A;  2F0I A;  4J8Q A;  1Y1V B;  3PV0 A;  5KEE A;  4HMI A;  1RF2 D;  1VCI A;  1TS4 A;  4IUU A;  2EYF A;  1B4O A;  4IN3 A;  1STB A;  1G6Z A;  5I6W A;  5KYL A;  1EY0 A;  2PCF B;  4DGZ A;  4HR7 B;  2NVQ B;  2NBF A;  1FR3 A;  1TVX A;  3MVV A;  3T56 B;  2ZT9 C;  2HDM A;  2X69 A;  1BCP D;  3R8B A;  4OL7 A;  2FIN B;  4DNR B;  1CK1 A;  2I46 A;  4LAA A;  1L0X B;  1LTA D;  5CBE E;  3PMF A;  5IOD A;  1RD9 D;  2L55 A;  2R6G A;  1I4X A;  3S2D B;  3NXW A;  4H13 C;  1PTO H;  3DWA A;  1SE2 A;  4KD4 A;  2BA1 A;  3K59 A;  4FF1 A;  2E2J B;  5CBA E;  1Z7T A;  3K6O A;  1L0Y B;  2PNR C;  2LS0 1;  3RZD B;  2EYP A;  3GTK B;  2R7Z B;  3H09 A;  4BS9 A;  1HTL D;  2BDN A;  1R9T B;  2F0V A;  4IFD H;  4IFD G;  4BA1 I;  4A93 B;  2ID0 A;  2DY8 A;  2LFN A;  4RFB A;  5KYI A;  3CKI B;  2JE6 I;  1RTN A;  4IUN A;  1GUW A;  1AZQ A;  1K8M A;  4DN4 M;  4C1N K;  4MIU A;  4U67 3;  3P7J A;  1F9R A;  2F0K A;  2AQ1 B;  4HCS A;  2F0L A;  3OOC A;  3SXH A;  5FO8 B;  3E0J A;  2SOB A;  5C4Z A;  3K5L A;  2WKC A;  1WTX A;  2E2H B;  5M5Y B;  4XT1 B;  2SNM A;  3M3Y B;  4ZYS A;  2VUM B;  4TSS A;  3HKZ B;  5C0X J;  2KQ3 A;  1SE3 A;  4HN7 A;  2PQE A;  2WIN B;  4OIK A;  4TQU S;  1JC7 A;  3S9W A;  3J7A F;  3DMU A;  3I4N B;  2ZXP A;  2KOL A;  5C3W A;  5ELC A;  1QWY A;  3SHL A;  3PO3 B;  2Z4I A;  1I6V C;  3QO2 A;  3J80 E;  2ZXR A;  5KRU A;  1Q1E A;  4F87 A;  1SYE A;  2MHV A;  3D3R A;  3TSS A;  1G8Z D;  1M8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...