2RA4A

Crystal structure of human monocyte chemoattractant protein 4 (mcp-4/ccl13)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
DALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Small-inducible cytokine A13
publication title Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ra4A00
3I90A 2L4NA 1O80A 2B2YA 1PFBA 4MHEA 1ICWA 1G2SA 4QUCA 2RA4A 3GV3A 4CJ2C 2X69A 4OIJA 1WTWA 1MI2A 1JE4A 2KVMA 2N55A 4ZLTF 2X6GA 1X3QA 4NW2A 4R8IA 1EQTA 1BO0A 1NCVA 2EPBA 1SDFA 3R93A 2RSNA 4LMQD 3MWYW 2VXWA 4ZK9B 1PFNA 1TVXA 2M2LA 2Q8TA 5CMDA 2RSOA 1CA6A 1WTXA 2HUGA 1Q3LA 3MTSA 1A15A 5EPLA 4IUPA 2RVLA 1EIHA 1MSGA 2HDLA 1B53A 4RAUC 2JP1A 2KEDA 4X3KA 2B2WA 2EOTA 2MJ8A 2JYOA 2SDFA 1F9RA 1ESRA 1WD1A 1RTOA 3P7JA 4QUFA 3D6WA 3IL8A 3KBXA 5E4WC 4IURA 1BBXC 3LWEA 5CBAE 2FMMA 1S4ZA 2FHTA 2K05A 2K04A 2KOLA 3F2UA 1WD0A 1B50A 3N52A 1PDQA 3I91A 4MN3A 1JICA 3UI2A 2NZ1D 1BNZA 1J9OA 1E0BA 5T1GA 2K03A 2MP1A 4RWSC 3Q6SA 1F9QA 1GUWA 2B2UA 4RA8A 2X6LA 1MSHA 5D14A 3DEPA 3IFDA 4U68A 1ZXTA 1X3PA 5EJWA 3QO2A 2B2YC 1SSOA 1NAPA 4XDXA 1C8CA 1IKLA 3DM1A 3FPUB 1J8IA 2BDNA 2Q8RE 4ZAIA 2K1BA 4HSVA 4ZKCB 2H1EA 1KNEA 1RHPA 1MGSA 4O42A 2B2UC 4OIKA 4X3TA 1ILPA 2DY7A 1QE6A 1IL8A 1VMCA 2K28A 2MPMA 1XYIA 1AP0A 2CVRA 2EE1A 1HUMA 1B3AA 1EOTA 2B2TA 1HFGA 2L1BA 1PFMA 5D65A 5T1IA 1WTOA 1AZPA 1WTQA 1F9SA 1XX8A 2FINB 1NR2A 4X3UA 1G2TA 3H91A 5AFWA 1B2TA 1CM9A 1RTNA 2NWGA 1HFNA 5EKIA 5COYA 1WTPA 2B2WC 2KECA 1U4MA 3G7LA 4IUTA 1VMPA 4IUQA 3HP3A 1IKMA 1U4RA 1RODA 1HUNA 1F9PA 3FDTA 3ONAB 1QG7A 2FJ2A 1HA6A 2HCCA 3I3CA 2HCIA 4IUVA 2HDMA 4CJ1B 2B2TC 5EQ0A 1QNKA 4DN4M 2K01A 1DOLA 1X32A 2L9HA 3TZDA 4IUUA 1ILQA 4R9WA 1F2LA 4HAEA 2KUMA 2B2VA 1O7ZA 2FFKB 2R3ZA 1U4PA 1LV9A 2DY8A 2J7ZA 5CORA 1WTVA 1BF4A 1DOMA 1DZ1A 1EL0A 1HRJA 1PLFA 3SVMA 3KUPA 3GV6A 1B4OA 5CBEE 1AZQA 1DONA 3TN2A 1G6ZA 1HHVA 4HCSA 2N88A 4ZKBB 4X3SA 5EPKA 1O7YA 5E4XA 4HEDA 2L11A 5DNFA 2MGSA 4CJ0B 1ML0D 5JJZA 4XT3B 1RJTA 1G91A 2B2VC 3DEOA 1SAPA 3I8ZA 1EIGA 1NR4A 2IL8A 1KNAA 1U4LA 2NYZD 1DOKA 4UAIA 1WVLA 1M8AA 2D9UA 4XT1B 1CA5A 5EPJA 1WTRA 2KEEA 2L12A 2XIWA
chains in the Genus database with same CATH superfamily
1EIFA 1SMXA 4ZLTF 2OXPA 2TSSA 2PQAA 1K0SA 3KF8A 2PI2A 2F4IA 4JBWA 2XSCA 3VDYA 1N34L 4JI3Q 1PA6A 1B9MA 4K8JA 1FJGL 3GTOH 4H13C 1I3QB 2RVLA 1HCZA 1MSGA 1QUQB 2JP1A 4XTCS 4DV3L 1OXUA 4K6DA 4HN7A 3KDFB 1ESRA 1WD1A 3S2HH 1RTOA 1LTBD 5GAEC 1AEXA 3HFZB 3Q23A 2EYPA 1SNOA 3A0JA 4PZ8A 4A3MB 4YCVA 5JJLA 4CDEC 3CMEA 1KDCA 2EYFA 3S16H 4RA8A 5D14A 1NE3A 3G4SA 4KY7A 3V05A 4DV1L 3ERSX 1PTOC 2KCTA 4GOPB 1IKLA 5M3FG 2VQFQ 4A3CG 4ZAIA 2K7VA 3GTLH 3CPFA 5IT9L 4EQNA 3CPWA 4KLKA 1WTQA 2EYHA 5C4XB 1SROA 1KIXA 5LHY1 3RD4A 4C3IB 4A3LG 1N34Q 4BBSB 4BY7H 1RODA 2O2LD 1CZGA 2LXJA 3J81j 1A3UA 1JMCA 2E8GA 4DNIA 1FL0A 3VYTA 4DV3Q 3PUZA 2PQEA 2F3WA 3RR5A 4EGVA 3GTMH 4GS3A 5HURA 5IT9c 1DOMA 4WRDA 5KNCA 1PLFA 4KN7C 4G7HC 4FF2A 1HHVA 3J81i 2AWNA 3CRLC 4XT3B 1YNJD 3S15B 1SE8A 2IHEA 4AYBE 2AHOB 2PW7A 4IPCA 1IW7C 1M8AA 3M4OH 3NBIA 2XIWA 1HZCA 4Q0FA 2NVQB 2IX3A 3CP0A 3HOXB 1KL9A 2X69A 4OIJA 1MI2A 2X6GA 3U4ZA 1XMQL 1EWHA 4LF8L 2UXCL 3F8TA 5ELFA 3EBEA 5JPMC 1DCZA 4IFDG 2JEAI 3T53B 4IALA 3X3MA 1Y1WH 3L3OC 3PQIA 4IUPA 1BKBA 4C3HH 1S72A 1E2WA 2KHSA 1PMRA 1TU2B 4LFBQ 1AW7A 1N36L 1DD2A 1DYQA 1V8QA 1FGBD 3HKSA 4J15A 4NMZA 3VR3A 4A3JB 4MN3A 5G3LF 4R4TA 2EXZA 3HKZG 4RWSC 1HPCA 4NXML 1FYCA 4B3RL 3MXNA 3GTPB 1PH1A 2J4XA 4L5SA 5C44G 5IIFA 2Y0SG 1PZID 5BR8Q 4A3GG 1RKNA 1VCIA 4RCNA 3DM1A 1NNXA 2F0FA 1EY7A 2QEJC 4I7AA 3K5OA 4RKBA 1SEBD 1YVCA 3MZ5A 1CI3M 3PUVA 2EIFA 1CTMA 3M9BA 1QE6A 5ELBA 1IL8A 1VMCA 2R6GA 1ENCA 3J80i 1HNXL 5AJ3L 2L55A 1CFMA 1I4RA 1VS0A 2L1BA 3BYTB 4F88A 4XYOA 4OONA 1JOQA 3VR6A 3H91A 4M8AA 4HIKA 3BVZA 1SYCA 2NVTH 2KECA 1HZAA 1YHBA 3HP3A 4XIGS 3FEWX 2E5LL 2MUYA 4LW1A 2EY2A 4U673 1UE5A 3PUYA 3K0YA 1BBWA 1EZ6A 4HAEA 4K5WA 2JJQA 1QVFA 5M9OA 1N36Q 4OHJA 2PW5A 3F1ZA 3T56B 1EL0A 3R2TA 2R93G 2UUCL 3CRKC 1Z47A 3D31A 3STBC 2K52A 3UDGA 5GQOA 1B3QA 1O7YA 4HEDA 2QCPX 2WV6D 4BY1G 5DNFA 4IJHA 4DV0L 4NXMQ 1PH2A 5H1SE 4JC0A 1ML0D 5KYLA 2R7FA 3TEHB 3I8ZA 1EIGA 2IL8A 4DFAA 1BUVT 1KNAA 3NBHB 3RZDH 3NHHA 2N8NA 1BR9A 2RF4A 2OTJA 5DAUA 1EY0A 4EQ5A 1O80A 4YCWA 1A2TA 4CKEA 3KOJA 1JE4A 5IP7G 4A3BG 4DR5L 5M5XB 1HNXQ 5AJ3Q 4LF9Q 4JYAL 1IBML 2R7ZB 5CMDA 3ITPA 5CV7A 3A5ZB 3NEMA 2VY3A 1LYLA 4JI5Q 1AE2A 2E5LQ 2A1AA 4RGNA 4CDCC 3D6WA 5I9PA 2JA8H 2K6AA 4LFCL 3GTQB 1G291 5FLMG 2KOLA 3L7ZC 1L1OC 1A3VA 5K36H 2B8GA 1KRTA 1N8RC 2MP1A 4H02A 5I6WA 1GUWA 1D1IA 4Q5VA 2UUCQ 3HOUG 1NJIC 1TWGB 1LTTD 3KK7A 5C4JB 3VR5A 1GO3E 2ASBA 4OWWB 3GTKH 1SYFA 1T9HA 2K33A 3ER0A 3I56A 1O7LA 4K8IA 4DK3C 4QF4A 3JAMc 2MNAA 2IPKD 4DV6Q 3A8KE 3S2DB 5IYDG 3CQZH 1KRSA 3I4MG 2BE5D 2Z0SA 3TP8A 5KYIA 1NTGA 2H1EA 2Q2UA 5ELNA 1B7YB 1KXLA 5A35A 3K7AB 5C44B 5M5WH 4PG3A 1Y8NB 4K5XA 3BZKA 1H9SB 1GUTA 4JI6L 2XN9C 3FKIG 3D6CA 4DAYA 1Y14B 2AKWB 3H0GB 2UUBQ 3OWEB 1U4MA 1VMPA 3CCMA 1EYGA 3J7A5 1FR3A 2VQEL 1D8LA 2PI2E 1QOHA 2WINB 2XWBB 4Z9CB 2R7DA 4ZQ3A 4K6LA 5LL6S 3KJPA 3JC66 2B2VA 1A0IA 2EZVA 4P74A 1V9PA 1EY9A 3IRBA 5IYBH 1WTVA 4LFCQ 4L5QA 3E0EA 1YHQA 4HJ5A 1BQQT 4B3ML 1CKNB 4LK1C 5DEHA 3OWFA 1ESFA 2Z8LA 3F2BA 4JI8Q 4R4QA 3BZCA 3SR1A 3HOVH 3TRZA 4GKJL 2BH8A 2E2HH 2MGSA 4QCLA 4F87A 4C1NI 1BVSA 4N9TA 1V1OA 3DEOA 5KIXA 5M3MB 1RCVD 3M85A 3P1HA 1CQVA 1UAPA 4DKAC 5ELCA 1GHKA 1TKWB 2R92B 1GUGA 4CJ2C 4KHPQ 2KVMA 4BWGB 4POGA 4NW2A 1NCVA 2IJ0A 2A6ED 4GN5A 3R93A 4CGYB 3MWYW 2KENA 4AYBG 1HA5A 3PO3H 1H95A 2KCCA 2IW3A 3BDLA 1CQFA 2HDLA 2K14A 3TDQA 2QDLA 3MAQA 4DR4Q 3MEHA 4DUYL 3GTOB 2VQEQ 2D62A 5IP9H 4IURA 3G6EA 1QWYA 4ME3A 3BU2A 1XNRL 1LACA 5JEAG 3S2HB 1JICA 2DN8A 4PV1C 1J9OA 5T1GA 1L1OB 3Q6SA 3CF5A 4RGTA 2E2IH 1BBUA 3JAME 3FMCA 4H44C 3QO2A 1NAPA 4LF5Q 4FO2A 3NSWA 3S16B 1JB7A 2AQ2B 2AUKA 1CK1A 3V96A 2F4VL 5GADC 2LFNA 1S5DD 1V1PB 2AWOA 5D65A 1PH9A 3GTLB 1HJPA 2FINB 1VQFA 4LF7L 3ULJA 4POFA 5FK9C 3CCVA 3HZXA 4RHSA 1CKOA 1VQPA 1AFPA 2B2TC 4BY7B 4L63B 2L9HA 3DHQA 5FO7B 5M3FH 1QB5D 4DUYQ 4OGQC 4A3CH 3OW2A 2DUDA 2FFKB 2K5DA 4LWCA 1U4PA 1EWCA 4WFN3 1L2FA 1Q81C 1DONA 1B4OA 4HR7B 1XNRQ 4DR7L 2JA9A 1QILA 2KQ3A 3GTMB 2AMCB 1E1OA 1GJXA 3KF6A 4A3LH 3GDEA 1U4LA 2I5LX 1FD7D 5JEAJ 3U9OA 2K50A 2L12A 3BVGA 2VUMG 1CZWA 4FF1A 1QNUA 3SDZA 1ASYA 1ICWA 4JV5Q 4K5VA 2RA4A 1K8OA 3OHXC 3NQIA 2B8FA 3M4OB 2NN6G 4TKOB 3UE0A 2JQOA 4B08A 2F4VQ 1VQGA 4BA1I 1EQTA 3W1GA 4EQPA 2Q8TA 3FP9A 2ES2A 1I50H 3WDNA 4F7XA 4GN3B 1EY4A 4DR6L 1RDPD 3G6JB 4A3FG 1KD1C 2DJGC 4ZCKA 3MFYA 3V2TA 3H6MA 1F9RA 2K4KA 3NTHA 1Y1WB 2O4XA 4YWMA 4C3HB 1XMOL 1PH6A 1RD9D 1WD0A 1IYVA 2GVBA 5EGTA 4JCVE 3EA6A 3GTJH 2I07B 1ET6A 2RCNA 3DEPA 3CU7A 2NZOA 3MXUA 1YEZA 4YWKA 4CDFC 3HKZE 1SSOA 2Z6BA 4A76A 3MHBA 3W3AA 1MJEA 3S14H 4RGOS 1JWSD 2Q8IB 4ZKCB 4IN3A 3EIVA 1VDZA 2Y0SE 1PVOA 1K83H 1AH9A 4EVOA 5ELDA 4NXNL 3KJOA 1HUMA 1V43A 3OMGA 2WB1B 2E75C 1XXGA 4HIDA 1I4PA 4PMWA 3PUWA 1FNVA 4DR3Q 3K0XA 3PF5A 3A74A 5GAHC 3RN5A 2C35B 1RF2D 2NVTB 4A3GH 3R2IA 4DK1A 2K01A 1X32A 1IYJB 1F2LA 4H7BA 1O7ZA 1UUPA 2CH4A 3BVMA 2DY8A 5CV8A 1K0RA 1X65A 2F03A 4C3JG 4ZKBB 3SE0A 4P75A 4N8X1 4C56C 4G57A 5JJZA 1YNJC 1C4QA 1HZ9A 1STHA 3KLSX 2JE6I 3EN2A 4KK7A 2LSSA 3R3OA 4AH6A 1QUQA 4APVA 4QIWB 3RZDB 1CHQD 3KDFA 4H0LC 4OWTB 2PCFB 1VQKA 2VW9A 4NXNQ 2RSNA 1Y8PB 1VQMA 2R93H 1PFNA 2FXQA 1YHAA 4R1JA 1Q3LA 3T16A 5A2QE 1EU4A 4BY1H 4NPSA 1GXDC 1R4PB 1SJHD 2RBMA 4X3KA 1VQJA 2D0OA 5C3EG 2A6HD 4JOIC 2HHHQ 1LT3D 4GOPA 5JVG3 4RH6A 5C6AA 2YTVA 1TWAH 3F2UA 2WKCA 3CAMA 3QOLA 2YU9H 1BNZA 5CC4A 4K2LA 1E0BA 1Y69U 2JA8B 4UHVA 1STGA 5IP7H 4A3BH 1L0YB 1JC7A 5E7NA 4UY8C 3ERQA 1WCMG 1VQHA 3W1BA 5EJWA 2EYJA 4DXFA 1UEAB 2BDOA 2MHVA 3GTKB 3L0OA 1JOOA 3HGBA 5CV9A 4FDBA 3J80E 2B2UC 3CQZB 1TWFH 3VR4A 3TSSA 1WTOA 5FLMH 2C9OA 2FMCA 3C1EA 5M5WB 3GO5A 4GN4B 3ZYYX 5COYA 1JCKB 2LKVA 4ODGA 1ZEQX 4GLAC 1IKMA 3HOUH 2XVSA 2CWAA 4XQNA 1HH2P 3U50C 1E22A 4MTNA 1BXTA 1QNKA 1BCPF 4DGZA 1VQAA 5IYDH 4O0AA 4KY5A 3I4MH 4A3KG 2JA7H 4I7ZC 5C4HA 4JBKA 2JK8A 3LX0A 5KGUA 1F77A 3HOYG 2NZHA 3Q8DA 5C4ZA 2QILA 2IT1A 4P71A 3FKIH 1XPRA 3LGJA 4HTHA 1PYWD 4IQZA 1GD7A 4UP9A 4S3SA 4LFBL 1AE3A 3EFXD 5L37A 3HOVB 2E2HB 2M2LA 1ENAA 2E76C 1SRUA 4QMGA 2Z1CA 1G2SA 2K5VA 4KKUA 2G5DA 3IKJA 2CKZB 1GOZA 1JORA 1FGUA 3WWVA 5JOBA 3L2PA 1D2BA 3CW2C 5BR8L 1OXTA 3NP8A 1RIPA 5HY6A 2JSOA 2EOTA 2QW7A 3PO3B 1QZGA 3P7JA 5I4DA 4EQOA 3KBXA 1T5XD 1SLJA 3K7UC 4KMUC 2ATWA 1STBA 5IGBA 3D4WA 2NZ1D 3RLNA 1OTCA 2OCEA 5CGKA 4X6AH 2Z6KC 5FLXc 2G9HD 3FHWA 1B70B 2SNMA 2F0NA 1J6QA 5FJ8G 1X3PA 3K81C 3TS0A 3Q22A 2E2IB 3OPOA 2BE5C 4K0KQ 2ID0A 2MQHA 4O42A 2A73B 1VQBA 3UDXA 1F9SA 2V4DA 5JEAH 2EY5A 1PYBA 1SBBB 1MIUA 4J8QA 5EKIA 1YI2A 3A56A 3G7LA 1SNQA 4JI0L 4OELB 1YJ9A 2KCNA 2RDFA 1HQMC 5LMUL 2ZJQA 1EIYB 3TQYA 3K5MA 1M4VA 3TP5A 1A3TA 5ELEA 1HR0W 1M90C 1D5MC 4UDUC 2IX1A 2KA7A 2F0QA 3NBHA 2OF1A 4PZ7A 3SK5A 2J7ZA 5C5MA 1JB3A 1ONLA 4LF9L 5M3FB 1LTLA 3HG9A 2CW0D 3PO2H 4BXXG 2A68D 1L0XB 1HXYD 1GUNA 4JI5L 3IAYA 1GKHA 1SYDA 1NR4A 2H4OA 4NKLA 2NYZD 1WVLA 3RN2A 2NVYH 3MXPA 3AB9A 4IFDI 5J1ZA 3D3RA 1CSQA 4E6IA 4XQJA 3GV3A 1QZHA 4GLVB 4HMJA 2N55A 3OSOA 4DV5L 3OW7A 2CQAA 3I7FA 2A6EC 1EWIA 1OO9B 1A6XA 2F0KA 1EEFD 4A3DG 1CT1D 4ZK9B 2EXDA 5CR3A 1SMYD 5BN3A 4DV6L 5IGCA 3MEFA 4FVMA 4JI0Q 2ZXPA 4ILWA 1I50B 2JYOA 5LMUQ 4X65L 2A69D 3MVVA 4CHTB 2MO1A 4DR2Q 2LMCB 4JBJA 1XPUA 2PMZB 1HA6A 4R4CA 2RHQB 2VUMH 5FLXE 3PGZA 2JN4A 2F0GA 2UUBL 3NELA 4X66L 1I4GA 2NN6H 4ALPA 1H9SA 1ZKOA 1IBKQ 1IHZA 2Z9HA 1SE4A 3S1NH 3JAML 4ME5A 3GTJB 4A3FH 2K1BA 3HOWG 1DM0B 4HSVA 3M4PA 3I4NG 4IPDA 3ND9A 4DAMA 1DXMA 1AZPA 5BN4A 3S14B 4JI8L 3H94A 4HJ7A 2ALYB 4DV5Q 1K83B 2B2WC 2D0PA 1T5EA 1D5XC 3CMAA 3PF4A 1QG7A 1CKNA 3S17H 5KEEA 3DWPA 2HD3A 3H09A 3KLSA 3HKZB 5EBCA 1UWVA 3CC7A 1GUSA 5D3IB 2JA7G 1DOLA 3TZDA 4KHPL 2EYMA 2OWOA 4R9WA 2K75A 4X65Q 2F3IA 2O5JC 2QEXA 1QCBD 2F0IA 4OO1I 2Y0SB 5CORA 1KHIA 2NTSA 4A3GB 1BCPB 2GN5A 3MA2B 4JK1C 4KJNA 1PH5A 5I9OA 3UDIA 4X66Q 1Y8OB 3VA5A 2B39A 4DR4L 3KYHC 5IODA 2F1MA 4A93G 4KKTA 3I90A 1GM5A 1PH8A 4RMFA 2SNSA 4TRDA 4ZRZA 1TT2A 2DNEA 4QGUA 1X3QA 1BCPD 3ULPA 1BO0A 4YIJA 4LMQD 1B44D 4IOCA 4LF6L 3E3XA 4TVAB 4UP7A 4C3JH 4LF5L 5DM63 2JA5G 5IGEA 1L1OA 2R93B 3RLFA 2B2WA 3MFGA 5TSSA 3CC4A 4B3TL 1EU3A 3VYRA 5CV5A 4BY1B 1K73C 1SYEA 1EUJA 1MBYA 3D0FA 3O13A 5CBAE 2NUCA 2GA4B 3HOZG 1D1KA 2CWPA 4LUOA 2IY5B 1TWAB 1Q8KA 3PV0A 3TREA 2JA6G 1NY4A 1PYSB 1V1PA 3AMUA 1E24A 5I6YA 2YU9B 4B3SL 1S3OA 3LWUA 2B2YC 1TXYA 4A3BB 1IL2A 2V1CC 1J8IA 1J5EL 4HJ9A 2F0JA 2ZJRA 3ICEA 3BS1A 2ZJPA 5C3EH 1C0AA 1JOKA 3KFUA 5IGGA 1PFMA 5T1IA 2B63G 1XX8A 1YNXA 1I4XA 2EYOA 5E1FA 1HFNA 1Q90A 3OYYA 4DA2A 1TWFB 1HUNA 4XXEA 3J7YW 4LF6Q 3M3YH 3QR8A 1WCMH 1TQOA 1Q7YC 2F0TA 3D4RA 2R61A 1I6HH 1C9OA 1FNUA 3HOUB 4DR1L 4JV5L 2YTXA 2C5CA 4A3IG 1EFWA 4B3TQ 1KC8C 4A3EG 1BF4A 1JJCB 3PO2G 1LUZA 4V190 1PH3A 1SXTA 3I4MB 4PZ6A 1PZJD 4HCSA 2JA7B 1ZYRD 4X3SA 5KNDA 3TZUA 3T1HL 5LMNW 2OQKA 3CC2A 3AEVA 2YYZA 4CJ0B 1LTID 2B3GA 5LL6X 3L9AX 1RJTA 1K8GA 1G6PA 2F0MA 3FKIB 4B3SQ 1VQOA 3I4OA 2L0CA 3SHLA 2EJMA 1HQRD 1SYGA 4PNYA 2CQOA 2B2YA 1J5EQ 4JI4L 3CCEA 1WTWA 2EJGC 4A3KH 2F0HA 3HEJA 3OTOL 4IOAA 1STAA 4LJZC 4YWLA 1R9TH 1PTOH 3HOYH 1TVXA 3C1FA 2PPBC 3DWAA 4J1MA 4DXGA 1VQ9A 1A15A 5EBDA 3J81c 5EPLA 4FYDA 4DU9A 1VQ5A 1FVIA 5J22A 2MJ8A 1SE2A 3A8JE 2A6HC 1PHJA 4X62L 3N6RA 3CCJA 4GNXC 1W6JA 1BBXC 4DR1Q 1S5ED 1IBLL 4P73A 5I2XA 2F0PA 3PSIA 5C0XG 3I2ZA 3UI2A 1STYA 1LLRD 4FXGC 4EX5A 5IGDA 4DR3L 2X6LA 4YCUA 3HS0C 1XNQQ 3PIOA 1D5ZC 3T1HQ 1F2ZA 1EEID 1PRTF 1EYDA 5ELOA 1L0WA 4AYBB 1EY5A 4G7OC 2F0SA 3A55A 1NMFA 1RHPA 4A4IA 4X3TA 2UUAL 2MPMA 2NVXH 2I5MX 4HIMA 4JI4Q 1IYUA 1WI5A 2B2TA 1MJCA 1X3FA 1SYBA 1W3SA 1WOCA 1B2TA 3OTOQ 5FKAC 2K5NA 3BJUA 2EJFC 4DV7Q 1X6OA 4IZ8A 1B1ZA 4DNRB 4DK0A 3S1RH 3K80C 2A5HA 2HCCA 4JVZA 5FJ8H 1GHJA 1TS4A 3MC0B 1KDAA 3WOEA 1ILQA 4X62Q 2ZM6L 2ZTDA 2XRQD 4YHHL 4LUVA 3J80c 4KY6A 3GTGH 1IBLQ 1A62A 1IZ6A 3I4LA 3E9HA 4ZYSA 1UE6A 1LT5D 1S5FD 5FO9B 1X55A 2F52A 4ZUIA 1A8VA 2PYKA 1YNND 1SFOH 2NN6I 2SOBA 4B9XA 4A3MG 2L5TA 3KLWA 2AUJD 2EYLA 2HHHL 4FXDA 1JWMD 2AQ3B 1KDBA 1O78A 4JPBW 4KD3A 5C0XJ 2NB0A 3EQLC 2KHIA 2F0WA 4MHEA 2WAQE 4R8NA 1LTRD 2NVYB 2UUAQ 3F2DA 1PTOF 1N32Q 1JR0D 4YY3Q 3J81E 3H3VH 5CV4A 3CD6A 2HQEA 3JAMi 3S1MH 2HUGA 4BXXH 1W2BA 1XJVA 3RNUA 3NWTA 5C4XG 1I4QA 3P75A 2PNHA 1GUOA 5HGTA 5I2YA 1X3EA 2RQXA 4WORA 4C3IG 4IPHA 4XYQA 1VQNA 4BBSG 4QB4A 4GNXB 3J7AV 3QJYA 3I91A 2WP8J 1E1TA 5JAVA 3Q24A 2ZM6Q 4LUZA 3I70A 4YHHQ 2WKDA 2VUMB 2XGTA 3TP7A 1STEA 3EJIA 3OIPA 4U68A 4DPGA 5IGFA 4A3DH 4A75A 2VS1A 1C8CA 2XRSD 2H5XA 4KTAA 5M5YH 4DAVA 2O5IC 3S1NB 4OIKA 2F0VA 1YZ6A 4L5TA 4A3FB 1TY2A 1DGSA 1HTLD 5GROA 3PIPA 3D4DA 3K8AA 1RL2A 4IUQA 4B9WA 3HOXG 2I46A 1VQEA 1SNDA 1KABA 2KHJA 3I3CA 3ND8A 4IUVA 1EQQA 4KKSA 3S9WA 3AFQA 2ZTEA 1I94Q 1O7IA 2I5HA 1JJ2A 3PMFA 2QA4A 4IUUA 3S17B 3HOWH 3CCQA 3TBIB 3RZOH 3M7NA 3VA7A 3I4NH 2Z4IA 2CW0C 3TN2A 3CXCA 1FNWA 1SN8A 2N88A 2A68C 1JJGA 1DJRD 1I6VC 1YIJA 3I72A 3QB3A 4LFAL 3W2DA 4A3JG 4RFBA 1VQDA 3U4VA 4PMBA 4QY7A 1AN8A 3U9SA 2LY7A 3E6ZX 3KBGA 1NUCA 4C2MH 2UXBL 1LO5D 4CKBA 4BBRH 5KNBA 1N9WA 4R8IA 4JOIA 1Q46A 3PCOB 3J7AF 5NUCA 5J3BA 1UNSA 2DNCA 1M1KC 1SMYC 1H9KA 2MO0A 3G71A 2QDBA 1EIHA 1TWCH 1B53A 4JI1L 2KEDA 4K0KL 4C3JB 2SDFA 3KLRA 3EVQA 3E9IA 2PQAB 2A69C 3NUCA 3ZJYC 3KF8B 5IYCG 4A93H 1WTHA 5IY0A 2JXMB 3ULLA 1MD2D 3N52A 3U58A 3G48A 5DM73 4FF4A 3R8BA 1F2YA 4K14A 1F9QA 1K3RA 2N49A 2B2UA 1V1QA 2B29A 5FLXL 3P20A 2N78A 1LT6D 2ZTCA 1FJGQ 3C2PA 5FOBB 3OIQA 2JA5H 4LFAQ 2Q8RE 1A63A 4G7ZC 4MZ9A 4Y7NH 2DY7A 4F8MA 1PRTB 2E2JH 1VQ8A 1B3AA 3RLOA 1Q82C 1HFGA 1SNCA 2XNAC 4I65A 5JJKA 2UXBQ 4X3UA 1E7ZA 5AFWA 4BS9A 5C3EB 2UU9L 1NMGA 2PZUA 3T4AC 3HOZH 5EKLA 1I5FA 2K5QA 2QGQA 1HR0L 1U4RA 1XPOA 2JA6H 3X3NA 1VQ4A 4IPGA 4DV1Q 4CJ1B 1CKMA 4DN4M 2R7ZG 4JI1Q 3M3YB 1SNMA 1TS2A 1WCMB 4GLXA 4JI7L 3GD7A 4C1NK 5ISRA 3F2CA 1PRTD 1I6HB 2N3SA 2CH4W 2D5DA 1EQRA 3M7GA 5EPKA 1STNA 4NB3A 3TS2A 2B63H 4FF3A 3PIO3 3QG1A 1SR3A 1TIID 4TQUS 1S5BD 1WFQA 4XT1B 1CA5A 3URYA 4QJFA 1WTRA 4DR2L 3QWNA 2PO4A 1VQ7A 5C5LA 2NTTA 1EOVA 2WB1E 4A3IH 1TWHH 1BCPC 2E74C 4QQBX 1Z6HA 2VL6A 3AU7A 4A3EH 1H9MA 1KAAA 4ID6A 3W5OA 5E3FA 1IBKL 1CA6A 4A3KB 2UU9Q 2GVAA 2J0TD 2CHBD 5JVH3 3H3VC 1R9TB 1PTOB 1Y1VH 2WAQG 1HR0Q 3HOYB 2Z6KA 3S24A 1IXRA 3M4YA 2OEOA 1YBYA 3D8GA 2BH2A 2KBNA 2F0EA 2K5HA 3H0GG 2I0QA 2PZTA 4L8JA 2K04A 2K05A 1CHPD 4JI7Q 4DV2L 3NENA 1CSPA 2F3VA 2K32A 1S40A 5CYUA 4QL5A 1XMQQ 4V0BA 4LNQA 2NBFA 2OQ0A 4LF8Q 4P2CB 2UXCQ 4CDDC 2BCOA 1PTOD 2YV5A 3NXWA 1PH7A 4XDXA 4OEMB 1PZKD 2JEBI 4QIWE 1UE7A 5IT9E 1II3A 4KHVA 2OTLA 1SE3A 2HQLA 2Q2IA 1VQ6A 4GZYC 4L6TB 1ILPA 3MXNB 4IFDJ 2CVRA 3H15A 5M3MG 2RCFA 2VB3X 4PQXA 1G2TA 3A5UA 5IE8A 5C0XH 2NWGA 4KI0A 3PUXA 2NVXB 3S1QH 2R92G 4IUTA 4B3RQ 4N9PA 2EDGA 1EY8A 2A19A 4OO1G 1OXVA 2WFWA 1F9PA 5EAYA 4XQQA 5HGQA 3SK6A 4P72A 2HCIA 2QF7A 3H3VI 3BDOA 1Q12A 4HMIA 4KHZA 1E2ZA 2K5WA 3S1RB 1GVPA 1Q1EA 2A8VA 1B9NA 1ICFB 3FPPA 2F0OA 3J7ZC 4LF4L 4G4KA 4WJ3M 4K2KA 2EVBA 1HRJA 2ENBA 1DZ1A 4CBVA 1LTAD 1G6ZA 1ZYRC 4DV2Q 3OMCA 5IWAL 3GP7A 3WOFA 2QKIC 3A54A 3TMEA 3GTGB 3K58A 1G91A 2B2VC 2KJXA 2M9VA 1YJNA 1IW7D 4AIMA 1OXSC 4ULLA 1VF5C 4MNOA 3NTIA 4UPAA 5F2DA 5BN5A 4NP5A 1SFOB 1Q86C 1PFBA 4ABNA 4BBRG 1HTPA 1MKHA 3FVQA 4UP8A 1I3QH 1SDFA 4KN4C 4OL7A 3DM3A 3PIP3 1ASZA 1TY0A 2RSOA 4HJ8A 1WTXA 1HNZL 4JW0A 2BA1A 3VR2A 4DV0Q 1E2VA 1VQIA 3CCLA 4RAUC 4IO9A 2AQ1B 3S1MB 2VZAA 4A3MH 4QUFA 3IL8A 2RDHA 1EYCA 5E4WC 1SJED 3LWEA 4OX9L 1S4ZA 1B50A 2WAQB 2DJFC 4LF4Q 3A7LA 2EY6A 4DNTB 2K03A 4DR5Q 4BY7G 3FRPB 3K59A 4JYAQ 1MSHA 1IBMQ 3DLLA 1ET9A 1A2UA 1NSNS 5IWAQ 4R4IA 4L5RC 4RKLA 3FPUB 1TR5A 2HIXA 2ICIA 3E0JA 4A3DB 1EFID 1D6EC 1JQYD 5C4XH 1KTKA 3T13A 4JG2A 1EYAA 1XWEA 2K28A 4X64L 4C3IH 2IHFA 2EE1A 4GKKL 3OOCA 2SEBD 4BBSH 5M5YB 4AQYL 1KLGD 4O1NA 3E5SA 1PFSA 4DAPA 3FDTA 2FJ2A 1HNZQ 1D7QA 2XTIA 1K8AC 5D3DA 1X9NA 5EQ0A 1H9JA 4IJLA 1U9RA 1UEBA 3NPPA 1Z7TA 4DAYB 2R3ZA 5LMNL 1CUKA 4R4OA 4OX9Q 3SVMA 3KUPA 3STBD 4JI6Q 1VF7A 3S15H 1G8ZD 3TP6A 1Q1BA 3C46A 2OT2A 1Y1WG 3HOWB 3RZOB 1QJOA 4C3HG 3CCSA 3M4QA 3I4NB 3SXHA 5C3XA 2KCMA 4M1UB 5FO8B 2HT1A 4NDXA 3C3LA 2NVQH 1YNNC 3NK9A 1N33L 1HNWL 3HOXH 4UAIA 3B6YA 1F2MA 3EROA 3K6OA 4ZUJA 3GQBA 2BOSA 3BDCA 4KV6A 5IOCA 1S5CD 2MFIA 2F0LA 4QUCA 1X3GA 2CCZA 2VB2X 3T51B 4X64Q 4DUZL 4GKKQ 4C2MB 1XNQL 4WJ4A 4B3MQ 4AQYQ 3CCUA 1P8LA 4BBRB 4HJAA 4GKJQ 1Y1VG 3NWSA 3J81L 3NE5B 2M00A 4KJOA 1K3BC 1I4HA 2WB1G 1K28A 4A3JH 3UE1A 2XWJB 1WYDA 1EY6A 3A8IE 1H9RA 5KRUA 3QOJA 5DLQE 1TWCB 4MIUA 3I73A 2FMMA 2FHTA 2ZXRA 3GTPH 3VYUA 1G51A 5LMNQ 2IX0A 2EQSA 3DXJC 3K5LA 1TS5A 4DV7L 4A93B 1HZBA 3RMHA 5G3LD 2BA0A 3IFDA 1U0LA 1PV4A 3K57A 1JE5A 3SGIA 2BDNA 4WJWA 1N33Q 1HNWQ 5A2QL 4BA2I 1Z9FA 3I55A 2YTYA 1MHWC 1MGSA 1XYIA 2JA5B 2E2DC 1EOTA 1XTDA 5IYCH 4RGMA 4Y7NB 2F0DA 4HCEA 1RTNA 1EQVA 4DUZQ 2E2JB 4OWXB 4FNFA 1X56A 5EKKA 3NTKA 2G9DA 2TMPA 2L15A 3ONAB 4LAAA 5CV6A 2HDMA 3HOZB 2UXDL 2Z4HA 1ENFA 1XTCD 2WIIB 4IUNA 4TSSA 1KLUD 2PMZE 2JA6B 4HIOA 4KD4A 2ZXOA 1LV9A 3AQQA 4JBMA 2PNRC 3J80L 1N32L 3IFTA 1TS3A 4YY3L 4RG1A 3T1YL 1YJWA 1AZQA 2D2CC 4LF7Q 1WJJA 3DMUA 3RUZA 1VQLA 2L11A 4JI2L 4CKCA 2ICEC 1K9MC 1P16A 1DOKA 2B63B 4PMCA 1LTGD 1PXUA 2WACA 2JA8G 4RCOA 2RKSA 1LM0A 5M5XH 2L4NA 3AFPA 2R7ZH 5K36G 1X54A 1SNPA 1LT4D 3NQTA 3KF6B 2EPBA 3UDFA 2VXWA 4GNXA 4DR7Q 4A3IB 3CKIB 1TWHB 2LXKA 2EY1A 3MTSA 4IFDH 3HRZC 4A3EB 2A74C 3PO2B 5C0XI 3GTQH 2F0UA 1B8AA 1E3PA 1W6KA 1R4QB 1Q8IA 2RDGA 2UXDQ 2VNUD 1Y1VB 1LABA 3QIAA 2DGYA 1BDOA 4J6HA 1TWGH 2ZT9C 5C4JH 1PDQA 3MXGA 1KAWA 3LNNA 5JPNC 3BZDB 3A7AB 1JT8A 3S2DH 5J39A 3T1YQ 3SEBA 1ZXTA 1C7YA 4DV4L 1NBWA 4GOPC 4JI2Q 4DR6Q 3K7AH 5C44H 1I94L 5JJIA 1K8MA 4MTKA 2IWHA 4HSPA 1LTSD 1KNEA 2Q2TA 5IYBG 1XMOQ 3BYYB 3H0GH 1AP0A 4FP5D 3VYSA 3CCRA 4JI3L 3HOVG 1NR2A 3SK4A 3DUZA 4OXPA 1CM9A 4O2DA 4N8FA 1WTPA 1PH4A 2HIVA 1QVGA 2Q2HA 5K5PA 1JWUD 4Y52H 1QVCA 3S1QB 4DF7A 5GAGC 1BOSA 2KUMA 2LS01 1PRTC 2CFMA 2PZWA 3K5NA 3CHBD 3BG3A 1KQSA 3GV6A 1OXXK 5CBEE 4DK6C 1YITA 3PO3G 5M3MH 3SK8A 1EZ8A 1U5KA 2P5ZX 5E4XA 3DWQA 5C3WA 2VQFL 2R92H 1SAPA 4FXKC 3AYHB 4OO1H 3Q0AA 1C48A 1UE1A 4DV4Q 2D9UA 2RHSB 5IP9G 5EPJA 1VQCA 2KEEA 4RHRA
chains in the Genus database with same CATH topology
4ZLTF 2OXPA 2TSSA 3KF8A 2F4IA 4JBWA 2XSCA 1B9MA 4K8JA 4H13C 1I3QB 2RVLA 1HCZA 1MSGA 2JP1A 4XTCS 1OXUA 4K6DA 4HN7A 1ESRA 1WD1A 1RTOA 1LTBD 1AEXA 3Q23A 2EYPA 1SNOA 4A3MB 1KDCA 2EYFA 4RA8A 5D14A 4KY7A 3V05A 1PTOC 1IKLA 4ZAIA 2K7VA 5IT9L 4EQNA 1WTQA 2EYHA 5C4XB 5LHY1 3RD4A 4C3IB 4BBSB 1RODA 2O2LD 1CZGA 1A3UA 3VYTA 3PUZA 2PQEA 2F3WA 4EGVA 5HURA 1DOMA 4WRDA 5KNCA 1PLFA 4KN7C 4G7HC 4FF2A 1HHVA 2AWNA 3CRLC 4XT3B 1YNJD 3S15B 2PW7A 1IW7C 1M8AA 3NBIA 2XIWA 4Q0FA 2NVQB 2IX3A 3HOXB 2X69A 4OIJA 1MI2A 2X6GA 1EWHA 5ELFA 5JPMC 1DCZA 4IFDG 2JEAI 3T53B 4IALA 3X3MA 3L3OC 4IUPA 1E2WA 2KHSA 1PMRA 1TU2B 1AW7A 1DD2A 1DYQA 1V8QA 1FGBD 4NMZA 3VR3A 4A3JB 4MN3A 5G3LF 2EXZA 4RWSC 1HPCA 1FYCA 3MXNA 3GTPB 2J4XA 5IIFA 1PZID 1RKNA 1VCIA 4RCNA 3DM1A 2F0FA 1EY7A 2QEJC 3K5OA 4RKBA 1SEBD 3MZ5A 1CI3M 3PUVA 1CTMA 1QE6A 5ELBA 1IL8A 1VMCA 2R6GA 1ENCA 2L55A 1CFMA 1I4RA 2L1BA 3BYTB 4F88A 4XYOA 1JOQA 3VR6A 3H91A 4M8AA 3BVZA 1SYCA 2KECA 3HP3A 4XIGS 3FEWX 2MUYA 2EY2A 4U673 3PUYA 3K0YA 1EZ6A 4HAEA 4K5WA 5M9OA 4OHJA 2PW5A 3T56B 1EL0A 3R2TA 3CRKC 1Z47A 3D31A 1O7YA 4HEDA 2QCPX 2WV6D 5DNFA 1ML0D 5KYLA 3I8ZA 1EIGA 2IL8A 4DFAA 1BUVT 1KNAA 3NHHA 1BR9A 5DAUA 1EY0A 1O80A 1A2TA 4CKEA 1JE4A 5M5XB 2R7ZB 5CMDA 3ITPA 5CV7A 4RGNA 3D6WA 5I9PA 2K6AA 3GTQB 1G291 2KOLA 3L7ZC 1A3VA 5K36H 2B8GA 2MP1A 5I6WA 1GUWA 1D1IA 4Q5VA 1TWGB 1LTTD 3KK7A 5C4JB 3VR5A 1SYFA 2K33A 1O7LA 4K8IA 4QF4A 2IPKD 3A8KE 3S2DB 2BE5D 3TP8A 5KYIA 2H1EA 5A35A 3K7AB 5C44B 1Y8NB 4K5XA 1H9SB 1GUTA 2XN9C 3D6CA 4DAYA 3H0GB 3OWEB 1U4MA 1VMPA 1FR3A 1QOHA 2WINB 2XWBB 4Z9CB 4ZQ3A 4K6LA 5LL6S 2B2VA 2EZVA 1EY9A 1WTVA 1BQQT 4LK1C 5DEHA 3OWFA 1ESFA 2Z8LA 3SR1A 2MGSA 4QCLA 4F87A 4C1NI 4N9TA 1V1OA 3DEOA 5KIXA 5M3MB 1RCVD 3M85A 3P1HA 1CQVA 1UAPA 5ELCA 1GHKA 1TKWB 2R92B 1GUGA 4CJ2C 2KVMA 4BWGB 4NW2A 1NCVA 2IJ0A 2A6ED 3R93A 4CGYB 3MWYW 1HA5A 2KCCA 2IW3A 3BDLA 1CQFA 2HDLA 3TDQA 3MAQA 3MEHA 3GTOB 2D62A 4IURA 1QWYA 1LACA 5JEAG 3S2HB 1JICA 2DN8A 4PV1C 1J9OA 5T1GA 3Q6SA 4RGTA 3JAME 3FMCA 4H44C 3QO2A 1NAPA 4FO2A 3NSWA 3S16B 2AQ2B 2AUKA 1CK1A 3V96A 2LFNA 1S5DD 1V1PB 2AWOA 5D65A 3GTLB 2FINB 5FK9C 3HZXA 4RHSA 1AFPA 2B2TC 4BY7B 4L63B 2L9HA 3DHQA 5FO7B 1QB5D 4OGQC 2FFKB 2K5DA 1U4PA 1EWCA 4WFN3 1DONA 1B4OA 4HR7B 1QILA 2KQ3A 3GTMB 1GJXA 1U4LA 1FD7D 5JEAJ 3U9OA 2L12A 3BVGA 1CZWA 4FF1A 1QNUA 3SDZA 1ICWA 4K5VA 2RA4A 1K8OA 3OHXC 3NQIA 2B8FA 3M4OB 2NN6G 4TKOB 4B08A 4BA1I 1EQTA 4EQPA 2Q8TA 3WDNA 4F7XA 1EY4A 1RDPD 3G6JB 3MFYA 3V2TA 3H6MA 1F9RA 3NTHA 1Y1WB 2O4XA 4C3HB 1RD9D 1WD0A 1IYVA 5EGTA 3EA6A 2I07B 1ET6A 3DEPA 3CU7A 3MXUA 1SSOA 3MHBA 3W3AA 4RGOS 1JWSD 2Q8IB 4ZKCB 4IN3A 1VDZA 4EVOA 5ELDA 1HUMA 1V43A 3OMGA 2WB1B 2E75C 1XXGA 1I4PA 4PMWA 3PUWA 1FNVA 1RF2D 2NVTB 3R2IA 4DK1A 2K01A 1X32A 1F2LA 4H7BA 1O7ZA 1UUPA 3BVMA 2DY8A 5CV8A 2F03A 4C3JG 4ZKBB 3SE0A 4C56C 4G57A 5JJZA 1YNJC 1C4QA 1STHA 3KLSX 2JE6I 4KK7A 3R3OA 4QIWB 3RZDB 1CHQD 4H0LC 2PCFB 2RSNA 1Y8PB 1PFNA 1Q3LA 3T16A 5A2QE 1EU4A 1GXDC 1R4PB 1SJHD 2RBMA 4X3KA 2A6HD 1LT3D 5JVG3 4RH6A 5C6AA 3F2UA 2WKCA 3QOLA 1BNZA 5CC4A 4K2LA 1E0BA 1Y69U 2JA8B 1STGA 1L0YB 1JC7A 3ERQA 5EJWA 2EYJA 4DXFA 1UEAB 2BDOA 2MHVA 3GTKB 3HGBA 1JOOA 5CV9A 3J80E 2B2UC 3CQZB 3VR4A 3TSSA 1WTOA 2C9OA 2FMCA 3C1EA 5M5WB 3GO5A 3ZYYX 5COYA 1JCKB 2LKVA 4ODGA 1ZEQX 1IKMA 2XVSA 4XQNA 1BXTA 1QNKA 1BCPF 4DGZA 4KY5A 4I7ZC 5C4HA 3LX0A 5KGUA 1F77A 5C4ZA 2QILA 2IT1A 4HTHA 1PYWD 4IQZA 4S3SA 3EFXD 3HOVB 2E2HB 2M2LA 1ENAA 2E76C 4QMGA 2Z1CA 1G2SA 4KKUA 3IKJA 1GOZA 1JORA 5JOBA 1D2BA 1OXTA 3NP8A 2JSOA 2EOTA 3PO3B 3P7JA 5I4DA 4EQOA 3KBXA 1T5XD 4KMUC 1STBA 5IGBA 3D4WA 2NZ1D 5CGKA 2G9HD 2SNMA 2F0NA 1X3PA 3Q22A 2E2IB 3OPOA 2BE5C 2ID0A 4O42A 2A73B 1F9SA 2V4DA 5JEAH 2EY5A 4J8QA 1SBBB 5EKIA 3A56A 3G7LA 1SNQA 2KCNA 2RDFA 1HQMC 3K5MA 1M4VA 3TP5A 1A3TA 5ELEA 1D5MC 4UDUC 2IX1A 2KA7A 2F0QA 3NBHA 2OF1A 3SK5A 2J7ZA 5C5MA 1JB3A 1ONLA 5M3FB 3HG9A 2CW0D 2A68D 1L0XB 1HXYD 1GUNA 3IAYA 1SYDA 1NR4A 2H4OA 4NKLA 2NYZD 1WVLA 3MXPA 3AB9A 4IFDI 5J1ZA 3D3RA 4E6IA 4XQJA 3GV3A 4HMJA 2N55A 3OSOA 3OW7A 2CQAA 2A6EC 1OO9B 1A6XA 2F0KA 1EEFD 1CT1D 4ZK9B 5CR3A 1SMYD 5BN3A 5IGCA 4FVMA 2ZXPA 4ILWA 1I50B 2JYOA 2A69D 3MVVA 4CHTB 2LMCB 2PMZB 1HA6A 5FLXE 2F0GA 1I4GA 2NN6H 1H9SA 1ZKOA 1IHZA 1SE4A 3JAML 4ME5A 3GTJB 2K1BA 1DM0B 4HSVA 3ND9A 1DXMA 1AZPA 5BN4A 3S14B 3H94A 1K83B 2B2WC 1T5EA 1D5XC 1QG7A 5KEEA 3DWPA 3H09A 3KLSA 3HKZB 5EBCA 1GUSA 5D3IB 1DOLA 3TZDA 2EYMA 4R9WA 2O5JC 1QCBD 2F0IA 4OO1I 2Y0SB 5CORA 2NTSA 4A3GB 1BCPB 3MA2B 4JK1C 4KJNA 5I9OA 1Y8OB 3VA5A 2B39A 5IODA 2F1MA 4KKTA 3I90A 2SNSA 4TRDA 4ZRZA 1TT2A 2DNEA 1X3QA 1BCPD 1BO0A 4YIJA 4LMQD 1B44D 5DM63 5IGEA 2R93B 3RLFA 2B2WA 3MFGA 5TSSA 1EU3A 3VYRA 5CV5A 4BY1B 1SYEA 1MBYA 3O13A 5CBAE 2NUCA 2GA4B 1D1KA 1TWAB 3PV0A 3AMUA 1V1PA 5I6YA 2YU9B 3LWUA 2B2YC 4A3BB 1J8IA 2F0JA 3BS1A 1JOKA 5IGGA 1PFMA 5T1IA 1XX8A 1I4XA 2EYOA 5E1FA 1HFNA 1Q90A 4DA2A 1TWFB 1HUNA 4XXEA 3J7YW 1TQOA 2F0TA 3D4RA 2R61A 1FNUA 3HOUB 2C5CA 1BF4A 4V190 1SXTA 3I4MB 1PZJD 4HCSA 2JA7B 1ZYRD 4X3SA 5KNDA 3TZUA 2YYZA 4CJ0B 1LTID 5LL6X 3L9AX 1RJTA 2F0MA 3FKIB 2L0CA 3SHLA 2EJMA 1HQRD 1SYGA 4PNYA 2B2YA 1WTWA 2EJGC 2F0HA 3HEJA 1STAA 4LJZC 1PTOH 1TVXA 3C1FA 2PPBC 3DWAA 4J1MA 4DXGA 1A15A 5EBDA 5EPLA 4FYDA 4DU9A 5J22A 2MJ8A 1SE2A 3A8JE 2A6HC 3N6RA 1W6JA 1BBXC 1S5ED 5I2XA 2F0PA 5C0XG 3UI2A 1STYA 1LLRD 4FXGC 5IGDA 2X6LA 3HS0C 1D5ZC 1F2ZA 1EEID 1PRTF 1EYDA 4AYBB 1EY5A 4G7OC 2F0SA 3A55A 1RHPA 4X3TA 2MPMA 1IYUA 2B2TA 1SYBA 1B2TA 5FKAC 2EJFC 4IZ8A 1B1ZA 4DNRB 4DK0A 2A5HA 2HCCA 1GHJA 1TS4A 3MC0B 1KDAA 3WOEA 1ILQA 2XRQD 4KY6A 3I4LA 4ZYSA 1LT5D 1S5FD 5FO9B 4ZUIA 2PYKA 1YNND 2NN6I 2SOBA 4B9XA 2L5TA 2AUJD 2EYLA 4FXDA 1JWMD 2AQ3B 1KDBA 1O78A 4KD3A 5C0XJ 2NB0A 3EQLC 2F0WA 4MHEA 4R8NA 1LTRD 2NVYB 1PTOF 1JR0D 3J81E 5CV4A 2HQEA 2HUGA 3NWTA 1I4QA 3P75A 5HGTA 1GUOA 5I2YA 2RQXA 4WORA 4C3IG 4XYQA 4QB4A 3J7AV 3QJYA 3I91A 2WP8J 5JAVA 3Q24A 3I70A 2WKDA 2VUMB 3TP7A 1STEA 3EJIA 3OIPA 4U68A 5IGFA 1C8CA 2XRSD 4KTAA 4DAVA 3S1NB 2O5IC 4OIKA 2F0VA 4A3FB 1TY2A 1HTLD 3D4DA 4IUQA 4B9WA 2I46A 1SNDA 1KABA 3ND8A 3I3CA 4IUVA 4KKSA 3S9WA 3PMFA 4IUUA 3S17B 3TBIB 3M7NA 3VA7A 2Z4IA 2CW0C 3TN2A 1FNWA 2N88A 2A68C 1DJRD 1I6VC 3I72A 3QB3A 3W2DA 4RFBA 4PMBA 1AN8A 3U9SA 2LY7A 3E6ZX 3KBGA 1NUCA 1LO5D 4CKBA 5KNBA 4R8IA 3J7AF 5NUCA 1UNSA 2DNCA 1SMYC 1H9KA 2QDBA 1EIHA 1B53A 2KEDA 4C3JB 2SDFA 3KLRA 3EVQA 2A69C 3NUCA 2JXMB 1MD2D 3N52A 4FF4A 5DM73 3R8BA 1F2YA 4K14A 1F9QA 5FLXL 2B2UA 3P20A 1LT6D 3C2PA 5FOBB 3OIQA 2Q8RE 4G7ZC 2DY7A 4F8MA 1PRTB 1B3AA 1HFGA 1SNCA 2XNAC 4I65A 4X3UA 4BS9A 5AFWA 5C3EB 2PZUA 3T4AC 5EKLA 2K5QA 1U4RA 3X3NA 4CJ1B 4DN4M 3M3YB 1SNMA 1TS2A 1WCMB 3GD7A 4C1NK 5ISRA 1PRTD 1I6HB 2D5DA 3M7GA 5EPKA 1STNA 4FF3A 3PIO3 3QG1A 1TIID 4TQUS 1S5BD 4XT1B 1CA5A 3URYA 1WTRA 3QWNA 2PO4A 5C5LA 2NTTA 1BCPC 2E74C 1Z6HA 3AU7A 1H9MA 1KAAA 4ID6A 5E3FA 1CA6A 4A3KB 2J0TD 2CHBD 5JVH3 3H3VC 1R9TB 1PTOB 3HOYB 3M4YA 2OEOA 3D8GA 2F0EA 2PZTA 4L8JA 2K04A 2K05A 1CHPD 2F3VA 2K32A 5CYUA 4V0BA 2NBFA 4P2CB 2BCOA 1PTOD 3NXWA 4XDXA 1PZKD 2JEBI 5IT9E 1II3A 4KHVA 1SE3A 4GZYC 4L6TB 1ILPA 4IFDJ 2CVRA 2VB3X 4PQXA 1G2TA 5C0XH 2NWGA 4KI0A 3PUXA 2NVXB 4IUTA 4N9PA 2EDGA 1EY8A 4OO1G 1OXVA 4XQQA 1F9PA 3SK6A 2HCIA 2QF7A 3BDOA 1Q12A 4HMIA 4KHZA 1E2ZA 2K5WA 3S1RB 1Q1EA 1B9NA 3FPPA 2F0OA 4G4KA 4K2KA 2EVBA 1HRJA 2ENBA 1DZ1A 4CBVA 1LTAD 1G6ZA 1ZYRC 3OMCA 3GP7A 3WOFA 2QKIC 3A54A 3TMEA 3GTGB 3K58A 1G91A 2B2VC 2KJXA 2M9VA 1IW7D 1OXSC 4ULLA 1VF5C 3NTIA 5F2DA 5BN5A 4NP5A 1SFOB 1PFBA 4ABNA 1HTPA 3FVQA 1SDFA 4KN4C 4OL7A 3PIP3 1TY0A 2RSOA 1WTXA 2BA1A 3VR2A 1E2VA 4RAUC 2AQ1B 3S1MB 4QUFA 3IL8A 2RDHA 1EYCA 5E4WC 1SJED 3LWEA 1S4ZA 1B50A 2WAQB 3A7LA 2EY6A 4DNTB 2K03A 3FRPB 3K59A 1MSHA 1ET9A 1A2UA 1NSNS 4RKLA 3FPUB 1TR5A 2ICIA 3E0JA 4A3DB 1EFID 1D6EC 1JQYD 1KTKA 3T13A 1EYAA 1XWEA 2K28A 2EE1A 3OOCA 2SEBD 5M5YB 1KLGD 4O1NA 3E5SA 4DAPA 3FDTA 2FJ2A 5D3DA 5EQ0A 1H9JA 1U9RA 3NPPA 1Z7TA 2R3ZA 3SVMA 3KUPA 1VF7A 1G8ZD 3TP6A 1Q1BA 3C46A 2OT2A 3HOWB 3RZOB 1QJOA 4C3HG 3I4NB 3SXHA 5C3XA 4M1UB 5FO8B 4NDXA 3C3LA 1YNNC 3NK9A 4UAIA 1F2MA 3EROA 3K6OA 4ZUJA 3GQBA 2BOSA 3BDCA 4KV6A 5IOCA 1S5CD 2F0LA 4QUCA 2VB2X 3T51B 4C2MB 4BBRB 3NWSA 3J81L 3NE5B 2M00A 4KJOA 1I4HA 2XWJB 1EY6A 3A8IE 1H9RA 5KRUA 3QOJA 1TWCB 4MIUA 3I73A 2FMMA 2FHTA 2ZXRA 3VYUA 2IX0A 3DXJC 3K5LA 1TS5A 4A93B 3RMHA 5G3LD 2BA0A 3IFDA 3K57A 2BDNA 4WJWA 5A2QL 4BA2I 1MGSA 1XYIA 2JA5B 2E2DC 1EOTA 4RGMA 4Y7NB 2F0DA 4HCEA 1RTNA 1EQVA 2E2JB 4FNFA 5EKKA 3NTKA 2G9DA 2TMPA 3ONAB 4LAAA 5CV6A 2HDMA 3HOZB 2Z4HA 1ENFA 1XTCD 2WIIB 4IUNA 4TSSA 1KLUD 2JA6B 4KD4A 2ZXOA 1LV9A 2PNRC 3J80L 3IFTA 1TS3A 1AZQA 2D2CC 3DMUA 3RUZA 2L11A 4CKCA 2ICEC 1DOKA 2B63B 4PMCA 1LTGD 1PXUA 2WACA 4RCOA 2RKSA 2L4NA 5K36G 1SNPA 1LT4D 3NQTA 2EPBA 2VXWA 4A3IB 3CKIB 1TWHB 2EY1A 3MTSA 4IFDH 3HRZC 4A3EB 2A74C 3PO2B 5C0XI 2F0UA 1W6KA 1R4QB 1Q8IA 2RDGA 2VNUD 1Y1VB 1LABA 3QIAA 1BDOA 4J6HA 2ZT9C 1PDQA 3MXGA 3LNNA 5JPNC 3BZDB 3A7AB 5J39A 3SEBA 1ZXTA 1K8MA 2IWHA 4HSPA 1LTSD 1KNEA 3BYYB 1AP0A 4FP5D 3VYSA 1NR2A 3SK4A 3DUZA 1CM9A 1WTPA 5K5PA 1JWUD 3S1QB 4DF7A 1BOSA 2KUMA 2LS01 1PRTC 3K5NA 2PZWA 3CHBD 3BG3A 3GV6A 1OXXK 5CBEE 3SK8A 1EZ8A 5E4XA 3DWQA 5C3WA 1SAPA 4FXKC 4OO1H 3Q0AA 1C48A 2D9UA 5EPJA 2KEEA 4RHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I90 A;  2L4N A;  1O80 A;  2B2Y A;  1PFB A;  4MHE A;  1ICW A;  1G2S A;  4QUC A;  2RA4 A;  3GV3 A;  4CJ2 C;  2X69 A;  4OIJ A;  1WTW A;  1MI2 A;  1JE4 A;  2KVM A;  2N55 A;  4ZLT F;  2X6G A;  1X3Q A;  4NW2 A;  4R8I A;  1EQT A;  1BO0 A;  1NCV A;  2EPB A;  1SDF A;  3R93 A;  2RSN A;  4LMQ D;  3MWY W;  2VXW A;  4ZK9 B;  1PFN A;  1TVX A;  2M2L A;  2Q8T A;  5CMD A;  2RSO A;  1CA6 A;  1WTX A;  2HUG A;  1Q3L A;  3MTS A;  1A15 A;  5EPL A;  4IUP A;  2RVL A;  1EIH A;  1MSG A;  2HDL A;  1B53 A;  4RAU C;  2JP1 A;  2KED A;  4X3K A;  2B2W A;  2EOT A;  2MJ8 A;  2JYO A;  2SDF A;  1F9R A;  1ESR A;  1WD1 A;  1RTO A;  3P7J A;  4QUF A;  3D6W A;  3IL8 A;  3KBX A;  5E4W C;  4IUR A;  1BBX C;  3LWE A;  5CBA E;  2FMM A;  1S4Z A;  2FHT A;  2K05 A;  2K04 A;  2KOL A;  3F2U A;  1WD0 A;  1B50 A;  3N52 A;  1PDQ A;  3I91 A;  4MN3 A;  1JIC A;  3UI2 A;  2NZ1 D;  1BNZ A;  1J9O A;  1E0B A;  5T1G A;  2K03 A;  2MP1 A;  4RWS C;  3Q6S A;  1F9Q A;  1GUW A;  2B2U A;  4RA8 A;  2X6L A;  1MSH A;  5D14 A;  3DEP A;  3IFD A;  4U68 A;  1ZXT A;  1X3P A;  5EJW A;  3QO2 A;  2B2Y C;  1SSO A;  1NAP A;  4XDX A;  1C8C A;  1IKL A;  3DM1 A;  3FPU B;  1J8I A;  2BDN A;  2Q8R E;  4ZAI A;  2K1B A;  4HSV A;  4ZKC B;  2H1E A;  1KNE A;  1RHP A;  1MGS A;  4O42 A;  2B2U C;  4OIK A;  4X3T A;  1ILP A;  2DY7 A;  1QE6 A;  1IL8 A;  1VMC A;  2K28 A;  2MPM A;  1XYI A;  1AP0 A;  2CVR A;  2EE1 A;  1HUM A;  1B3A A;  1EOT A;  2B2T A;  1HFG A;  2L1B A;  1PFM A;  5D65 A;  5T1I A;  1WTO A;  1AZP A;  1WTQ A;  1F9S A;  1XX8 A;  2FIN B;  1NR2 A;  4X3U A;  1G2T A;  3H91 A;  5AFW A;  1B2T A;  1CM9 A;  1RTN A;  2NWG A;  1HFN A;  5EKI A;  5COY A;  1WTP A;  2B2W C;  2KEC A;  1U4M A;  3G7L A;  4IUT A;  1VMP A;  4IUQ A;  3HP3 A;  1IKM A;  1U4R A;  1ROD A;  1HUN A;  1F9P A;  3FDT A;  3ONA B;  1QG7 A;  2FJ2 A;  1HA6 A;  2HCC A;  3I3C A;  2HCI A;  4IUV A;  2HDM A;  4CJ1 B;  2B2T C;  5EQ0 A;  1QNK A;  4DN4 M;  2K01 A;  1DOL A;  1X32 A;  2L9H A;  3TZD A;  4IUU A;  1ILQ A;  4R9W A;  1F2L A;  4HAE A;  2KUM A;  2B2V A;  1O7Z A;  2FFK B;  2R3Z A;  1U4P A;  1LV9 A;  2DY8 A;  2J7Z A;  5COR A;  1WTV A;  1BF4 A;  1DOM A;  1DZ1 A;  1EL0 A;  1HRJ A;  1PLF A;  3SVM A;  3KUP A;  3GV6 A;  1B4O A;  5CBE E;  1AZQ A;  1DON A;  3TN2 A;  1G6Z A;  1HHV A;  4HCS A;  2N88 A;  4ZKB B;  4X3S A;  5EPK A;  1O7Y A;  5E4X A;  4HED A;  2L11 A;  5DNF A;  2MGS A;  4CJ0 B;  1ML0 D;  5JJZ A;  4XT3 B;  1RJT A;  1G91 A;  2B2V C;  3DEO A;  1SAP A;  3I8Z A;  1EIG A;  1NR4 A;  2IL8 A;  1KNA A;  1U4L A;  2NYZ D;  1DOK A;  4UAI A;  1WVL A;  1M8A A;  2D9U A;  4XT1 B;  1CA5 A;  5EPJ A;  1WTR A;  2KEE A;  2L12 A;  2XIW A; 
#chains in the Genus database with same CATH topology
 1EIF A;  1SMX A;  4ZLT F;  2OXP A;  2TSS A;  2PQA A;  1K0S A;  3KF8 A;  2PI2 A;  2F4I A;  4JBW A;  2XSC A;  3VDY A;  1N34 L;  4JI3 Q;  1PA6 A;  1B9M A;  4K8J A;  1FJG L;  3GTO H;  4H13 C;  1I3Q B;  2RVL A;  1HCZ A;  1MSG A;  1QUQ B;  2JP1 A;  4XTC S;  4DV3 L;  1OXU A;  4K6D A;  4HN7 A;  3KDF B;  1ESR A;  1WD1 A;  3S2H H;  1RTO A;  1LTB D;  5GAE C;  1AEX A;  3HFZ B;  3Q23 A;  2EYP A;  1SNO A;  3A0J A;  4PZ8 A;  4A3M B;  4YCV A;  5JJL A;  4CDE C;  3CME A;  1KDC A;  2EYF A;  3S16 H;  4RA8 A;  5D14 A;  1NE3 A;  3G4S A;  4KY7 A;  3V05 A;  4DV1 L;  3ERS X;  1PTO C;  2KCT A;  4GOP B;  1IKL A;  5M3F G;  2VQF Q;  4A3C G;  4ZAI A;  2K7V A;  3GTL H;  3CPF A;  5IT9 L;  4EQN A;  3CPW A;  4KLK A;  1WTQ A;  2EYH A;  5C4X B;  1SRO A;  1KIX A;  5LHY 1;  3RD4 A;  4C3I B;  4A3L G;  1N34 Q;  4BBS B;  4BY7 H;  1ROD A;  2O2L D;  1CZG A;  2LXJ A;  3J81 j;  1A3U A;  1JMC A;  2E8G A;  4DNI A;  1FL0 A;  3VYT A;  4DV3 Q;  3PUZ A;  2PQE A;  2F3W A;  3RR5 A;  4EGV A;  3GTM H;  4GS3 A;  5HUR A;  5IT9 c;  1DOM A;  4WRD A;  5KNC A;  1PLF A;  4KN7 C;  4G7H C;  4FF2 A;  1HHV A;  3J81 i;  2AWN A;  3CRL C;  4XT3 B;  1YNJ D;  3S15 B;  1SE8 A;  2IHE A;  4AYB E;  2AHO B;  2PW7 A;  4IPC A;  1IW7 C;  1M8A A;  3M4O H;  3NBI A;  2XIW A;  1HZC A;  4Q0F A;  2NVQ B;  2IX3 A;  3CP0 A;  3HOX B;  1KL9 A;  2X69 A;  4OIJ A;  1MI2 A;  2X6G A;  3U4Z A;  1XMQ L;  1EWH A;  4LF8 L;  2UXC L;  3F8T A;  5ELF A;  3EBE A;  5JPM C;  1DCZ A;  4IFD G;  2JEA I;  3T53 B;  4IAL A;  3X3M A;  1Y1W H;  3L3O C;  3PQI A;  4IUP A;  1BKB A;  4C3H H;  1S72 A;  1E2W A;  2KHS A;  1PMR A;  1TU2 B;  4LFB Q;  1AW7 A;  1N36 L;  1DD2 A;  1DYQ A;  1V8Q A;  1FGB D;  3HKS A;  4J15 A;  4NMZ A;  3VR3 A;  4A3J B;  4MN3 A;  5G3L F;  4R4T A;  2EXZ A;  3HKZ G;  4RWS C;  1HPC A;  4NXM L;  1FYC A;  4B3R L;  3MXN A;  3GTP B;  1PH1 A;  2J4X A;  4L5S A;  5C44 G;  5IIF A;  2Y0S G;  1PZI D;  5BR8 Q;  4A3G G;  1RKN A;  1VCI A;  4RCN A;  3DM1 A;  1NNX A;  2F0F A;  1EY7 A;  2QEJ C;  4I7A A;  3K5O A;  4RKB A;  1SEB D;  1YVC A;  3MZ5 A;  1CI3 M;  3PUV A;  2EIF A;  1CTM A;  3M9B A;  1QE6 A;  5ELB A;  1IL8 A;  1VMC A;  2R6G A;  1ENC A;  3J80 i;  1HNX L;  5AJ3 L;  2L55 A;  1CFM A;  1I4R A;  1VS0 A;  2L1B A;  3BYT B;  4F88 A;  4XYO A;  4OON A;  1JOQ A;  3VR6 A;  3H91 A;  4M8A A;  4HIK A;  3BVZ A;  1SYC A;  2NVT H;  2KEC A;  1HZA A;  1YHB A;  3HP3 A;  4XIG S;  3FEW X;  2E5L L;  2MUY A;  4LW1 A;  2EY2 A;  4U67 3;  1UE5 A;  3PUY A;  3K0Y A;  1BBW A;  1EZ6 A;  4HAE A;  4K5W A;  2JJQ A;  1QVF A;  5M9O A;  1N36 Q;  4OHJ A;  2PW5 A;  3F1Z A;  3T56 B;  1EL0 A;  3R2T A;  2R93 G;  2UUC L;  3CRK C;  1Z47 A;  3D31 A;  3STB C;  2K52 A;  3UDG A;  5GQO A;  1B3Q A;  1O7Y A;  4HED A;  2QCP X;  2WV6 D;  4BY1 G;  5DNF A;  4IJH A;  4DV0 L;  4NXM Q;  1PH2 A;  5H1S E;  4JC0 A;  1ML0 D;  5KYL A;  2R7F A;  3TEH B;  3I8Z A;  1EIG A;  2IL8 A;  4DFA A;  1BUV T;  1KNA A;  3NBH B;  3RZD H;  3NHH A;  2N8N A;  1BR9 A;  2RF4 A;  2OTJ A;  5DAU A;  1EY0 A;  4EQ5 A;  1O80 A;  4YCW A;  1A2T A;  4CKE A;  3KOJ A;  1JE4 A;  5IP7 G;  4A3B G;  4DR5 L;  5M5X B;  1HNX Q;  5AJ3 Q;  4LF9 Q;  4JYA L;  1IBM L;  2R7Z B;  5CMD A;  3ITP A;  5CV7 A;  3A5Z B;  3NEM A;  2VY3 A;  1LYL A;  4JI5 Q;  1AE2 A;  2E5L Q;  2A1A A;  4RGN A;  4CDC C;  3D6W A;  5I9P A;  2JA8 H;  2K6A A;  4LFC L;  3GTQ B;  1G29 1;  5FLM G;  2KOL A;  3L7Z C;  1L1O C;  1A3V A;  5K36 H;  2B8G A;  1KRT A;  1N8R C;  2MP1 A;  4H02 A;  5I6W A;  1GUW A;  1D1I A;  4Q5V A;  2UUC Q;  3HOU G;  1NJI C;  1TWG B;  1LTT D;  3KK7 A;  5C4J B;  3VR5 A;  1GO3 E;  2ASB A;  4OWW B;  3GTK H;  1SYF A;  1T9H A;  2K33 A;  3ER0 A;  3I56 A;  1O7L A;  4K8I A;  4DK3 C;  4QF4 A;  3JAM c;  2MNA A;  2IPK D;  4DV6 Q;  3A8K E;  3S2D B;  5IYD G;  3CQZ H;  1KRS A;  3I4M G;  2BE5 D;  2Z0S A;  3TP8 A;  5KYI A;  1NTG A;  2H1E A;  2Q2U A;  5ELN A;  1B7Y B;  1KXL A;  5A35 A;  3K7A B;  5C44 B;  5M5W H;  4PG3 A;  1Y8N B;  4K5X A;  3BZK A;  1H9S B;  1GUT A;  4JI6 L;  2XN9 C;  3FKI G;  3D6C A;  4DAY A;  1Y14 B;  2AKW B;  3H0G B;  2UUB Q;  3OWE B;  1U4M A;  1VMP A;  3CCM A;  1EYG A;  3J7A 5;  1FR3 A;  2VQE L;  1D8L A;  2PI2 E;  1QOH A;  2WIN B;  2XWB B;  4Z9C B;  2R7D A;  4ZQ3 A;  4K6L A;  5LL6 S;  3KJP A;  3JC6 6;  2B2V A;  1A0I A;  2EZV A;  4P74 A;  1V9P A;  1EY9 A;  3IRB A;  5IYB H;  1WTV A;  4LFC Q;  4L5Q A;  3E0E A;  1YHQ A;  4HJ5 A;  1BQQ T;  4B3M L;  1CKN B;  4LK1 C;  5DEH A;  3OWF A;  1ESF A;  2Z8L A;  3F2B A;  4JI8 Q;  4R4Q A;  3BZC A;  3SR1 A;  3HOV H;  3TRZ A;  4GKJ L;  2BH8 A;  2E2H H;  2MGS A;  4QCL A;  4F87 A;  4C1N I;  1BVS A;  4N9T A;  1V1O A;  3DEO A;  5KIX A;  5M3M B;  1RCV D;  3M85 A;  3P1H A;  1CQV A;  1UAP A;  4DKA C;  5ELC A;  1GHK A;  1TKW B;  2R92 B;  1GUG A;  4CJ2 C;  4KHP Q;  2KVM A;  4BWG B;  4POG A;  4NW2 A;  1NCV A;  2IJ0 A;  2A6E D;  4GN5 A;  3R93 A;  4CGY B;  3MWY W;  2KEN A;  4AYB G;  1HA5 A;  3PO3 H;  1H95 A;  2KCC A;  2IW3 A;  3BDL A;  1CQF A;  2HDL A;  2K14 A;  3TDQ A;  2QDL A;  3MAQ A;  4DR4 Q;  3MEH A;  4DUY L;  3GTO B;  2VQE Q;  2D62 A;  5IP9 H;  4IUR A;  3G6E A;  1QWY A;  4ME3 A;  3BU2 A;  1XNR L;  1LAC A;  5JEA G;  3S2H B;  1JIC A;  2DN8 A;  4PV1 C;  1J9O A;  5T1G A;  1L1O B;  3Q6S A;  3CF5 A;  4RGT A;  2E2I H;  1BBU A;  3JAM E;  3FMC A;  4H44 C;  3QO2 A;  1NAP A;  4LF5 Q;  4FO2 A;  3NSW A;  3S16 B;  1JB7 A;  2AQ2 B;  2AUK A;  1CK1 A;  3V96 A;  2F4V L;  5GAD C;  2LFN A;  1S5D D;  1V1P B;  2AWO A;  5D65 A;  1PH9 A;  3GTL B;  1HJP A;  2FIN B;  1VQF A;  4LF7 L;  3ULJ A;  4POF A;  5FK9 C;  3CCV A;  3HZX A;  4RHS A;  1CKO A;  1VQP A;  1AFP A;  2B2T C;  4BY7 B;  4L63 B;  2L9H A;  3DHQ A;  5FO7 B;  5M3F H;  1QB5 D;  4DUY Q;  4OGQ C;  4A3C H;  3OW2 A;  2DUD A;  2FFK B;  2K5D A;  4LWC A;  1U4P A;  1EWC A;  4WFN 3;  1L2F A;  1Q81 C;  1DON A;  1B4O A;  4HR7 B;  1XNR Q;  4DR7 L;  2JA9 A;  1QIL A;  2KQ3 A;  3GTM B;  2AMC B;  1E1O A;  1GJX A;  3KF6 A;  4A3L H;  3GDE A;  1U4L A;  2I5L X;  1FD7 D;  5JEA J;  3U9O A;  2K50 A;  2L12 A;  3BVG A;  2VUM G;  1CZW A;  4FF1 A;  1QNU A;  3SDZ A;  1ASY A;  1ICW A;  4JV5 Q;  4K5V A;  2RA4 A;  1K8O A;  3OHX C;  3NQI A;  2B8F A;  3M4O B;  2NN6 G;  4TKO B;  3UE0 A;  2JQO A;  4B08 A;  2F4V Q;  1VQG A;  4BA1 I;  1EQT A;  3W1G A;  4EQP A;  2Q8T A;  3FP9 A;  2ES2 A;  1I50 H;  3WDN A;  4F7X A;  4GN3 B;  1EY4 A;  4DR6 L;  1RDP D;  3G6J B;  4A3F G;  1KD1 C;  2DJG C;  4ZCK A;  3MFY A;  3V2T A;  3H6M A;  1F9R A;  2K4K A;  3NTH A;  1Y1W B;  2O4X A;  4YWM A;  4C3H B;  1XMO L;  1PH6 A;  1RD9 D;  1WD0 A;  1IYV A;  2GVB A;  5EGT A;  4JCV E;  3EA6 A;  3GTJ H;  2I07 B;  1ET6 A;  2RCN A;  3DEP A;  3CU7 A;  2NZO A;  3MXU A;  1YEZ A;  4YWK A;  4CDF C;  3HKZ E;  1SSO A;  2Z6B A;  4A76 A;  3MHB A;  3W3A A;  1MJE A;  3S14 H;  4RGO S;  1JWS D;  2Q8I B;  4ZKC B;  4IN3 A;  3EIV A;  1VDZ A;  2Y0S E;  1PVO A;  1K83 H;  1AH9 A;  4EVO A;  5ELD A;  4NXN L;  3KJO A;  1HUM A;  1V43 A;  3OMG A;  2WB1 B;  2E75 C;  1XXG A;  4HID A;  1I4P A;  4PMW A;  3PUW A;  1FNV A;  4DR3 Q;  3K0X A;  3PF5 A;  3A74 A;  5GAH C;  3RN5 A;  2C35 B;  1RF2 D;  2NVT B;  4A3G H;  3R2I A;  4DK1 A;  2K01 A;  1X32 A;  1IYJ B;  1F2L A;  4H7B A;  1O7Z A;  1UUP A;  2CH4 A;  3BVM A;  2DY8 A;  5CV8 A;  1K0R A;  1X65 A;  2F03 A;  4C3J G;  4ZKB B;  3SE0 A;  4P75 A;  4N8X 1;  4C56 C;  4G57 A;  5JJZ A;  1YNJ C;  1C4Q A;  1HZ9 A;  1STH A;  3KLS X;  2JE6 I;  3EN2 A;  4KK7 A;  2LSS A;  3R3O A;  4AH6 A;  1QUQ A;  4APV A;  4QIW B;  3RZD B;  1CHQ D;  3KDF A;  4H0L C;  4OWT B;  2PCF B;  1VQK A;  2VW9 A;  4NXN Q;  2RSN A;  1Y8P B;  1VQM A;  2R93 H;  1PFN A;  2FXQ A;  1YHA A;  4R1J A;  1Q3L A;  3T16 A;  5A2Q E;  1EU4 A;  4BY1 H;  4NPS A;  1GXD C;  1R4P B;  1SJH D;  2RBM A;  4X3K A;  1VQJ A;  2D0O A;  5C3E G;  2A6H D;  4JOI C;  2HHH Q;  1LT3 D;  4GOP A;  5JVG 3;  4RH6 A;  5C6A A;  2YTV A;  1TWA H;  3F2U A;  2WKC A;  3CAM A;  3QOL A;  2YU9 H;  1BNZ A;  5CC4 A;  4K2L A;  1E0B A;  1Y69 U;  2JA8 B;  4UHV A;  1STG A;  5IP7 H;  4A3B H;  1L0Y B;  1JC7 A;  5E7N A;  4UY8 C;  3ERQ A;  1WCM G;  1VQH A;  3W1B A;  5EJW A;  2EYJ A;  4DXF A;  1UEA B;  2BDO A;  2MHV A;  3GTK B;  3L0O A;  1JOO A;  3HGB A;  5CV9 A;  4FDB A;  3J80 E;  2B2U C;  3CQZ B;  1TWF H;  3VR4 A;  3TSS A;  1WTO A;  5FLM H;  2C9O A;  2FMC A;  3C1E A;  5M5W B;  3GO5 A;  4GN4 B;  3ZYY X;  5COY A;  1JCK B;  2LKV A;  4ODG A;  1ZEQ X;  4GLA C;  1IKM A;  3HOU H;  2XVS A;  2CWA A;  4XQN A;  1HH2 P;  3U50 C;  1E22 A;  4MTN A;  1BXT A;  1QNK A;  1BCP F;  4DGZ A;  1VQA A;  5IYD H;  4O0A A;  4KY5 A;  3I4M H;  4A3K G;  2JA7 H;  4I7Z C;  5C4H A;  4JBK A;  2JK8 A;  3LX0 A;  5KGU A;  1F77 A;  3HOY G;  2NZH A;  3Q8D A;  5C4Z A;  2QIL A;  2IT1 A;  4P71 A;  3FKI H;  1XPR A;  3LGJ A;  4HTH A;  1PYW D;  4IQZ A;  1GD7 A;  4UP9 A;  4S3S A;  4LFB L;  1AE3 A;  3EFX D;  5L37 A;  3HOV B;  2E2H B;  2M2L A;  1ENA A;  2E76 C;  1SRU A;  4QMG A;  2Z1C A;  1G2S A;  2K5V A;  4KKU A;  2G5D A;  3IKJ A;  2CKZ B;  1GOZ A;  1JOR A;  1FGU A;  3WWV A;  5JOB A;  3L2P A;  1D2B A;  3CW2 C;  5BR8 L;  1OXT A;  3NP8 A;  1RIP A;  5HY6 A;  2JSO A;  2EOT A;  2QW7 A;  3PO3 B;  1QZG A;  3P7J A;  5I4D A;  4EQO A;  3KBX A;  1T5X D;  1SLJ A;  3K7U C;  4KMU C;  2ATW A;  1STB A;  5IGB A;  3D4W A;  2NZ1 D;  3RLN A;  1OTC A;  2OCE A;  5CGK A;  4X6A H;  2Z6K C;  5FLX c;  2G9H D;  3FHW A;  1B70 B;  2SNM A;  2F0N A;  1J6Q A;  5FJ8 G;  1X3P A;  3K81 C;  3TS0 A;  3Q22 A;  2E2I B;  3OPO A;  2BE5 C;  4K0K Q;  2ID0 A;  2MQH A;  4O42 A;  2A73 B;  1VQB A;  3UDX A;  1F9S A;  2V4D A;  5JEA H;  2EY5 A;  1PYB A;  1SBB B;  1MIU A;  4J8Q A;  5EKI A;  1YI2 A;  3A56 A;  3G7L A;  1SNQ A;  4JI0 L;  4OEL B;  1YJ9 A;  2KCN A;  2RDF A;  1HQM C;  5LMU L;  2ZJQ A;  1EIY B;  3TQY A;  3K5M A;  1M4V A;  3TP5 A;  1A3T A;  5ELE A;  1HR0 W;  1M90 C;  1D5M C;  4UDU C;  2IX1 A;  2KA7 A;  2F0Q A;  3NBH A;  2OF1 A;  4PZ7 A;  3SK5 A;  2J7Z A;  5C5M A;  1JB3 A;  1ONL A;  4LF9 L;  5M3F B;  1LTL A;  3HG9 A;  2CW0 D;  3PO2 H;  4BXX G;  2A68 D;  1L0X B;  1HXY D;  1GUN A;  4JI5 L;  3IAY A;  1GKH A;  1SYD A;  1NR4 A;  2H4O A;  4NKL A;  2NYZ D;  1WVL A;  3RN2 A;  2NVY H;  3MXP A;  3AB9 A;  4IFD I;  5J1Z A;  3D3R A;  1CSQ A;  4E6I A;  4XQJ A;  3GV3 A;  1QZH A;  4GLV B;  4HMJ A;  2N55 A;  3OSO A;  4DV5 L;  3OW7 A;  2CQA A;  3I7F A;  2A6E C;  1EWI A;  1OO9 B;  1A6X A;  2F0K A;  1EEF D;  4A3D G;  1CT1 D;  4ZK9 B;  2EXD A;  5CR3 A;  1SMY D;  5BN3 A;  4DV6 L;  5IGC A;  3MEF A;  4FVM A;  4JI0 Q;  2ZXP A;  4ILW A;  1I50 B;  2JYO A;  5LMU Q;  4X65 L;  2A69 D;  3MVV A;  4CHT B;  2MO1 A;  4DR2 Q;  2LMC B;  4JBJ A;  1XPU A;  2PMZ B;  1HA6 A;  4R4C A;  2RHQ B;  2VUM H;  5FLX E;  3PGZ A;  2JN4 A;  2F0G A;  2UUB L;  3NEL A;  4X66 L;  1I4G A;  2NN6 H;  4ALP A;  1H9S A;  1ZKO A;  1IBK Q;  1IHZ A;  2Z9H A;  1SE4 A;  3S1N H;  3JAM L;  4ME5 A;  3GTJ B;  4A3F H;  2K1B A;  3HOW G;  1DM0 B;  4HSV A;  3M4P A;  3I4N G;  4IPD A;  3ND9 A;  4DAM A;  1DXM A;  1AZP A;  5BN4 A;  3S14 B;  4JI8 L;  3H94 A;  4HJ7 A;  2ALY B;  4DV5 Q;  1K83 B;  2B2W C;  2D0P A;  1T5E A;  1D5X C;  3CMA A;  3PF4 A;  1QG7 A;  1CKN A;  3S17 H;  5KEE A;  3DWP A;  2HD3 A;  3H09 A;  3KLS A;  3HKZ B;  5EBC A;  1UWV A;  3CC7 A;  1GUS A;  5D3I B;  2JA7 G;  1DOL A;  3TZD A;  4KHP L;  2EYM A;  2OWO A;  4R9W A;  2K75 A;  4X65 Q;  2F3I A;  2O5J C;  2QEX A;  1QCB D;  2F0I A;  4OO1 I;  2Y0S B;  5COR A;  1KHI A;  2NTS A;  4A3G B;  1BCP B;  2GN5 A;  3MA2 B;  4JK1 C;  4KJN A;  1PH5 A;  5I9O A;  3UDI A;  4X66 Q;  1Y8O B;  3VA5 A;  2B39 A;  4DR4 L;  3KYH C;  5IOD A;  2F1M A;  4A93 G;  4KKT A;  3I90 A;  1GM5 A;  1PH8 A;  4RMF A;  2SNS A;  4TRD A;  4ZRZ A;  1TT2 A;  2DNE A;  4QGU A;  1X3Q A;  1BCP D;  3ULP A;  1BO0 A;  4YIJ A;  4LMQ D;  1B44 D;  4IOC A;  4LF6 L;  3E3X A;  4TVA B;  4UP7 A;  4C3J H;  4LF5 L;  5DM6 3;  2JA5 G;  5IGE A;  1L1O A;  2R93 B;  3RLF A;  2B2W A;  3MFG A;  5TSS A;  3CC4 A;  4B3T L;  1EU3 A;  3VYR A;  5CV5 A;  4BY1 B;  1K73 C;  1SYE A;  1EUJ A;  1MBY A;  3D0F A;  3O13 A;  5CBA E;  2NUC A;  2GA4 B;  3HOZ G;  1D1K A;  2CWP A;  4LUO A;  2IY5 B;  1TWA B;  1Q8K A;  3PV0 A;  3TRE A;  2JA6 G;  1NY4 A;  1PYS B;  1V1P A;  3AMU A;  1E24 A;  5I6Y A;  2YU9 B;  4B3S L;  1S3O A;  3LWU A;  2B2Y C;  1TXY A;  4A3B B;  1IL2 A;  2V1C C;  1J8I A;  1J5E L;  4HJ9 A;  2F0J A;  2ZJR A;  3ICE A;  3BS1 A;  2ZJP A;  5C3E H;  1C0A A;  1JOK A;  3KFU A;  5IGG A;  1PFM A;  5T1I A;  2B63 G;  1XX8 A;  1YNX A;  1I4X A;  2EYO A;  5E1F A;  1HFN A;  1Q90 A;  3OYY A;  4DA2 A;  1TWF B;  1HUN A;  4XXE A;  3J7Y W;  4LF6 Q;  3M3Y H;  3QR8 A;  1WCM H;  1TQO A;  1Q7Y C;  2F0T A;  3D4R A;  2R61 A;  1I6H H;  1C9O A;  1FNU A;  3HOU B;  4DR1 L;  4JV5 L;  2YTX A;  2C5C A;  4A3I G;  1EFW A;  4B3T Q;  1KC8 C;  4A3E G;  1BF4 A;  1JJC B;  3PO2 G;  1LUZ A;  4V19 0;  1PH3 A;  1SXT A;  3I4M B;  4PZ6 A;  1PZJ D;  4HCS A;  2JA7 B;  1ZYR D;  4X3S A;  5KND A;  3TZU A;  3T1H L;  5LMN W;  2OQK A;  3CC2 A;  3AEV A;  2YYZ A;  4CJ0 B;  1LTI D;  2B3G A;  5LL6 X;  3L9A X;  1RJT A;  1K8G A;  1G6P A;  2F0M A;  3FKI B;  4B3S Q;  1VQO A;  3I4O A;  2L0C A;  3SHL A;  2EJM A;  1HQR D;  1SYG A;  4PNY A;  2CQO A;  2B2Y A;  1J5E Q;  4JI4 L;  3CCE A;  1WTW A;  2EJG C;  4A3K H;  2F0H A;  3HEJ A;  3OTO L;  4IOA A;  1STA A;  4LJZ C;  4YWL A;  1R9T H;  1PTO H;  3HOY H;  1TVX A;  3C1F A;  2PPB C;  3DWA A;  4J1M A;  4DXG A;  1VQ9 A;  1A15 A;  5EBD A;  3J81 c;  5EPL A;  4FYD A;  4DU9 A;  1VQ5 A;  1FVI A;  5J22 A;  2MJ8 A;  1SE2 A;  3A8J E;  2A6H C;  1PHJ A;  4X62 L;  3N6R A;  3CCJ A;  4GNX C;  1W6J A;  1BBX C;  4DR1 Q;  1S5E D;  1IBL L;  4P73 A;  5I2X A;  2F0P A;  3PSI A;  5C0X G;  3I2Z A;  3UI2 A;  1STY A;  1LLR D;  4FXG C;  4EX5 A;  5IGD A;  4DR3 L;  2X6L A;  4YCU A;  3HS0 C;  1XNQ Q;  3PIO A;  1D5Z C;  3T1H Q;  1F2Z A;  1EEI D;  1PRT F;  1EYD A;  5ELO A;  1L0W A;  4AYB B;  1EY5 A;  4G7O C;  2F0S A;  3A55 A;  1NMF A;  1RHP A;  4A4I A;  4X3T A;  2UUA L;  2MPM A;  2NVX H;  2I5M X;  4HIM A;  4JI4 Q;  1IYU A;  1WI5 A;  2B2T A;  1MJC A;  1X3F A;  1SYB A;  1W3S A;  1WOC A;  1B2T A;  3OTO Q;  5FKA C;  2K5N A;  3BJU A;  2EJF C;  4DV7 Q;  1X6O A;  4IZ8 A;  1B1Z A;  4DNR B;  4DK0 A;  3S1R H;  3K80 C;  2A5H A;  2HCC A;  4JVZ A;  5FJ8 H;  1GHJ A;  1TS4 A;  3MC0 B;  1KDA A;  3WOE A;  1ILQ A;  4X62 Q;  2ZM6 L;  2ZTD A;  2XRQ D;  4YHH L;  4LUV A;  3J80 c;  4KY6 A;  3GTG H;  1IBL Q;  1A62 A;  1IZ6 A;  3I4L A;  3E9H A;  4ZYS A;  1UE6 A;  1LT5 D;  1S5F D;  5FO9 B;  1X55 A;  2F52 A;  4ZUI A;  1A8V A;  2PYK A;  1YNN D;  1SFO H;  2NN6 I;  2SOB A;  4B9X A;  4A3M G;  2L5T A;  3KLW A;  2AUJ D;  2EYL A;  2HHH L;  4FXD A;  1JWM D;  2AQ3 B;  1KDB A;  1O78 A;  4JPB W;  4KD3 A;  5C0X J;  2NB0 A;  3EQL C;  2KHI A;  2F0W A;  4MHE A;  2WAQ E;  4R8N A;  1LTR D;  2NVY B;  2UUA Q;  3F2D A;  1PTO F;  1N32 Q;  1JR0 D;  4YY3 Q;  3J81 E;  3H3V H;  5CV4 A;  3CD6 A;  2HQE A;  3JAM i;  3S1M H;  2HUG A;  4BXX H;  1W2B A;  1XJV A;  3RNU A;  3NWT A;  5C4X G;  1I4Q A;  3P75 A;  2PNH A;  1GUO A;  5HGT A;  5I2Y A;  1X3E A;  2RQX A;  4WOR A;  4C3I G;  4IPH A;  4XYQ A;  1VQN A;  4BBS G;  4QB4 A;  4GNX B;  3J7A V;  3QJY A;  3I91 A;  2WP8 J;  1E1T A;  5JAV A;  3Q24 A;  2ZM6 Q;  4LUZ A;  3I70 A;  4YHH Q;  2WKD A;  2VUM B;  2XGT A;  3TP7 A;  1STE A;  3EJI A;  3OIP A;  4U68 A;  4DPG A;  5IGF A;  4A3D H;  4A75 A;  2VS1 A;  1C8C A;  2XRS D;  2H5X A;  4KTA A;  5M5Y H;  4DAV A;  2O5I C;  3S1N B;  4OIK A;  2F0V A;  1YZ6 A;  4L5T A;  4A3F B;  1TY2 A;  1DGS A;  1HTL D;  5GRO A;  3PIP A;  3D4D A;  3K8A A;  1RL2 A;  4IUQ A;  4B9W A;  3HOX G;  2I46 A;  1VQE A;  1SND A;  1KAB A;  2KHJ A;  3I3C A;  3ND8 A;  4IUV A;  1EQQ A;  4KKS A;  3S9W A;  3AFQ A;  2ZTE A;  1I94 Q;  1O7I A;  2I5H A;  1JJ2 A;  3PMF A;  2QA4 A;  4IUU A;  3S17 B;  3HOW H;  3CCQ A;  3TBI B;  3RZO H;  3M7N A;  3VA7 A;  3I4N H;  2Z4I A;  2CW0 C;  3TN2 A;  3CXC A;  1FNW A;  1SN8 A;  2N88 A;  2A68 C;  1JJG A;  1DJR D;  1I6V C;  1YIJ A;  3I72 A;  3QB3 A;  4LFA L;  3W2D A;  4A3J G;  4RFB A;  1VQD A;  3U4V A;  4PMB A;  4QY7 A;  1AN8 A;  3U9S A;  2LY7 A;  3E6Z X;  3KBG A;  1NUC A;  4C2M H;  2UXB L;  1LO5 D;  4CKB A;  4BBR H;  5KNB A;  1N9W A;  4R8I A;  4JOI A;  1Q46 A;  3PCO B;  3J7A F;  5NUC A;  5J3B A;  1UNS A;  2DNC A;  1M1K C;  1SMY C;  1H9K A;  2MO0 A;  3G71 A;  2QDB A;  1EIH A;  1TWC H;  1B53 A;  4JI1 L;  2KED A;  4K0K L;  4C3J B;  2SDF A;  3KLR A;  3EVQ A;  3E9I A;  2PQA B;  2A69 C;  3NUC A;  3ZJY C;  3KF8 B;  5IYC G;  4A93 H;  1WTH A;  5IY0 A;  2JXM B;  3ULL A;  1MD2 D;  3N52 A;  3U58 A;  3G48 A;  5DM7 3;  4FF4 A;  3R8B A;  1F2Y A;  4K14 A;  1F9Q A;  1K3R A;  2N49 A;  2B2U A;  1V1Q A;  2B29 A;  5FLX L;  3P20 A;  2N78 A;  1LT6 D;  2ZTC A;  1FJG Q;  3C2P A;  5FOB B;  3OIQ A;  2JA5 H;  4LFA Q;  2Q8R E;  1A63 A;  4G7Z C;  4MZ9 A;  4Y7N H;  2DY7 A;  4F8M A;  1PRT B;  2E2J H;  1VQ8 A;  1B3A A;  3RLO A;  1Q82 C;  1HFG A;  1SNC A;  2XNA C;  4I65 A;  5JJK A;  2UXB Q;  4X3U A;  1E7Z A;  5AFW A;  4BS9 A;  5C3E B;  2UU9 L;  1NMG A;  2PZU A;  3T4A C;  3HOZ H;  5EKL A;  1I5F A;  2K5Q A;  2QGQ A;  1HR0 L;  1U4R A;  1XPO A;  2JA6 H;  3X3N A;  1VQ4 A;  4IPG A;  4DV1 Q;  4CJ1 B;  1CKM A;  4DN4 M;  2R7Z G;  4JI1 Q;  3M3Y B;  1SNM A;  1TS2 A;  1WCM B;  4GLX A;  4JI7 L;  3GD7 A;  4C1N K;  5ISR A;  3F2C A;  1PRT D;  1I6H B;  2N3S A;  2CH4 W;  2D5D A;  1EQR A;  3M7G A;  5EPK A;  1STN A;  4NB3 A;  3TS2 A;  2B63 H;  4FF3 A;  3PIO 3;  3QG1 A;  1SR3 A;  1TII D;  4TQU S;  1S5B D;  1WFQ A;  4XT1 B;  1CA5 A;  3URY A;  4QJF A;  1WTR A;  4DR2 L;  3QWN A;  2PO4 A;  1VQ7 A;  5C5L A;  2NTT A;  1EOV A;  2WB1 E;  4A3I H;  1TWH H;  1BCP C;  2E74 C;  4QQB X;  1Z6H A;  2VL6 A;  3AU7 A;  4A3E H;  1H9M A;  1KAA A;  4ID6 A;  3W5O A;  5E3F A;  1IBK L;  1CA6 A;  4A3K B;  2UU9 Q;  2GVA A;  2J0T D;  2CHB D;  5JVH 3;  3H3V C;  1R9T B;  1PTO B;  1Y1V H;  2WAQ G;  1HR0 Q;  3HOY B;  2Z6K A;  3S24 A;  1IXR A;  3M4Y A;  2OEO A;  1YBY A;  3D8G A;  2BH2 A;  2KBN A;  2F0E A;  2K5H A;  3H0G G;  2I0Q A;  2PZT A;  4L8J A;  2K04 A;  2K05 A;  1CHP D;  4JI7 Q;  4DV2 L;  3NEN A;  1CSP A;  2F3V A;  2K32 A;  1S40 A;  5CYU A;  4QL5 A;  1XMQ Q;  4V0B A;  4LNQ A;  2NBF A;  2OQ0 A;  4LF8 Q;  4P2C B;  2UXC Q;  4CDD C;  2BCO A;  1PTO D;  2YV5 A;  3NXW A;  1PH7 A;  4XDX A;  4OEM B;  1PZK D;  2JEB I;  4QIW E;  1UE7 A;  5IT9 E;  1II3 A;  4KHV A;  2OTL A;  1SE3 A;  2HQL A;  2Q2I A;  1VQ6 A;  4GZY C;  4L6T B;  1ILP A;  3MXN B;  4IFD J;  2CVR A;  3H15 A;  5M3M G;  2RCF A;  2VB3 X;  4PQX A;  1G2T A;  3A5U A;  5IE8 A;  5C0X H;  2NWG A;  4KI0 A;  3PUX A;  2NVX B;  3S1Q H;  2R92 G;  4IUT A;  4B3R Q;  4N9P A;  2EDG A;  1EY8 A;  2A19 A;  4OO1 G;  1OXV A;  2WFW A;  1F9P A;  5EAY A;  4XQQ A;  5HGQ A;  3SK6 A;  4P72 A;  2HCI A;  2QF7 A;  3H3V I;  3BDO A;  1Q12 A;  4HMI A;  4KHZ A;  1E2Z A;  2K5W A;  3S1R B;  1GVP A;  1Q1E A;  2A8V A;  1B9N A;  1ICF B;  3FPP A;  2F0O A;  3J7Z C;  4LF4 L;  4G4K A;  4WJ3 M;  4K2K A;  2EVB A;  1HRJ A;  2ENB A;  1DZ1 A;  4CBV A;  1LTA D;  1G6Z A;  1ZYR C;  4DV2 Q;  3OMC A;  5IWA L;  3GP7 A;  3WOF A;  2QKI C;  3A54 A;  3TME A;  3GTG B;  3K58 A;  1G91 A;  2B2V C;  2KJX A;  2M9V A;  1YJN A;  1IW7 D;  4AIM A;  1OXS C;  4ULL A;  1VF5 C;  4MNO A;  3NTI A;  4UPA A;  5F2D A;  5BN5 A;  4NP5 A;  1SFO B;  1Q86 C;  1PFB A;  4ABN A;  4BBR G;  1HTP A;  1MKH A;  3FVQ A;  4UP8 A;  1I3Q H;  1SDF A;  4KN4 C;  4OL7 A;  3DM3 A;  3PIP 3;  1ASZ A;  1TY0 A;  2RSO A;  4HJ8 A;  1WTX A;  1HNZ L;  4JW0 A;  2BA1 A;  3VR2 A;  4DV0 Q;  1E2V A;  1VQI A;  3CCL A;  4RAU C;  4IO9 A;  2AQ1 B;  3S1M B;  2VZA A;  4A3M H;  4QUF A;  3IL8 A;  2RDH A;  1EYC A;  5E4W C;  1SJE D;  3LWE A;  4OX9 L;  1S4Z A;  1B50 A;  2WAQ B;  2DJF C;  4LF4 Q;  3A7L A;  2EY6 A;  4DNT B;  2K03 A;  4DR5 Q;  4BY7 G;  3FRP B;  3K59 A;  4JYA Q;  1MSH A;  1IBM Q;  3DLL A;  1ET9 A;  1A2U A;  1NSN S;  5IWA Q;  4R4I A;  4L5R C;  4RKL A;  3FPU B;  1TR5 A;  2HIX A;  2ICI A;  3E0J A;  4A3D B;  1EFI D;  1D6E C;  1JQY D;  5C4X H;  1KTK A;  3T13 A;  4JG2 A;  1EYA A;  1XWE A;  2K28 A;  4X64 L;  4C3I H;  2IHF A;  2EE1 A;  4GKK L;  3OOC A;  2SEB D;  4BBS H;  5M5Y B;  4AQY L;  1KLG D;  4O1N A;  3E5S A;  1PFS A;  4DAP A;  3FDT A;  2FJ2 A;  1HNZ Q;  1D7Q A;  2XTI A;  1K8A C;  5D3D A;  1X9N A;  5EQ0 A;  1H9J A;  4IJL A;  1U9R A;  1UEB A;  3NPP A;  1Z7T A;  4DAY B;  2R3Z A;  5LMN L;  1CUK A;  4R4O A;  4OX9 Q;  3SVM A;  3KUP A;  3STB D;  4JI6 Q;  1VF7 A;  3S15 H;  1G8Z D;  3TP6 A;  1Q1B A;  3C46 A;  2OT2 A;  1Y1W G;  3HOW B;  3RZO B;  1QJO A;  4C3H G;  3CCS A;  3M4Q A;  3I4N B;  3SXH A;  5C3X A;  2KCM A;  4M1U B;  5FO8 B;  2HT1 A;  4NDX A;  3C3L A;  2NVQ H;  1YNN C;  3NK9 A;  1N33 L;  1HNW L;  3HOX H;  4UAI A;  3B6Y A;  1F2M A;  3ERO A;  3K6O A;  4ZUJ A;  3GQB A;  2BOS A;  3BDC A;  4KV6 A;  5IOC A;  1S5C D;  2MFI A;  2F0L A;  4QUC A;  1X3G A;  2CCZ A;  2VB2 X;  3T51 B;  4X64 Q;  4DUZ L;  4GKK Q;  4C2M B;  1XNQ L;  4WJ4 A;  4B3M Q;  4AQY Q;  3CCU A;  1P8L A;  4BBR B;  4HJA A;  4GKJ Q;  1Y1V G;  3NWS A;  3J81 L;  3NE5 B;  2M00 A;  4KJO A;  1K3B C;  1I4H A;  2WB1 G;  1K28 A;  4A3J H;  3UE1 A;  2XWJ B;  1WYD A;  1EY6 A;  3A8I E;  1H9R A;  5KRU A;  3QOJ A;  5DLQ E;  1TWC B;  4MIU A;  3I73 A;  2FMM A;  2FHT A;  2ZXR A;  3GTP H;  3VYU A;  1G51 A;  5LMN Q;  2IX0 A;  2EQS A;  3DXJ C;  3K5L A;  1TS5 A;  4DV7 L;  4A93 B;  1HZB A;  3RMH A;  5G3L D;  2BA0 A;  3IFD A;  1U0L A;  1PV4 A;  3K57 A;  1JE5 A;  3SGI A;  2BDN A;  4WJW A;  1N33 Q;  1HNW Q;  5A2Q L;  4BA2 I;  1Z9F A;  3I55 A;  2YTY A;  1MHW C;  1MGS A;  1XYI A;  2JA5 B;  2E2D C;  1EOT A;  1XTD A;  5IYC H;  4RGM A;  4Y7N B;  2F0D A;  4HCE A;  1RTN A;  1EQV A;  4DUZ Q;  2E2J B;  4OWX B;  4FNF A;  1X56 A;  5EKK A;  3NTK A;  2G9D A;  2TMP A;  2L15 A;  3ONA B;  4LAA A;  5CV6 A;  2HDM A;  3HOZ B;  2UXD L;  2Z4H A;  1ENF A;  1XTC D;  2WII B;  4IUN A;  4TSS A;  1KLU D;  2PMZ E;  2JA6 B;  4HIO A;  4KD4 A;  2ZXO A;  1LV9 A;  3AQQ A;  4JBM A;  2PNR C;  3J80 L;  1N32 L;  3IFT A;  1TS3 A;  4YY3 L;  4RG1 A;  3T1Y L;  1YJW A;  1AZQ A;  2D2C C;  4LF7 Q;  1WJJ A;  3DMU A;  3RUZ A;  1VQL A;  2L11 A;  4JI2 L;  4CKC A;  2ICE C;  1K9M C;  1P16 A;  1DOK A;  2B63 B;  4PMC A;  1LTG D;  1PXU A;  2WAC A;  2JA8 G;  4RCO A;  2RKS A;  1LM0 A;  5M5X H;  2L4N A;  3AFP A;  2R7Z H;  5K36 G;  1X54 A;  1SNP A;  1LT4 D;  3NQT A;  3KF6 B;  2EPB A;  3UDF A;  2VXW A;  4GNX A;  4DR7 Q;  4A3I B;  3CKI B;  1TWH B;  2LXK A;  2EY1 A;  3MTS A;  4IFD H;  3HRZ C;  4A3E B;  2A74 C;  3PO2 B;  5C0X I;  3GTQ H;  2F0U A;  1B8A A;  1E3P A;  1W6K A;  1R4Q B;  1Q8I A;  2RDG A;  2UXD Q;  2VNU D;  1Y1V B;  1LAB A;  3QIA A;  2DGY A;  1BDO A;  4J6H A;  1TWG H;  2ZT9 C;  5C4J H;  1PDQ A;  3MXG A;  1KAW A;  3LNN A;  5JPN C;  3BZD B;  3A7A B;  1JT8 A;  3S2D H;  5J39 A;  3T1Y Q;  3SEB A;  1ZXT A;  1C7Y A;  4DV4 L;  1NBW A;  4GOP C;  4JI2 Q;  4DR6 Q;  3K7A H;  5C44 H;  1I94 L;  5JJI A;  1K8M A;  4MTK A;  2IWH A;  4HSP A;  1LTS D;  1KNE A;  2Q2T A;  5IYB G;  1XMO Q;  3BYY B;  3H0G H;  1AP0 A;  4FP5 D;  3VYS A;  3CCR A;  4JI3 L;  3HOV G;  1NR2 A;  3SK4 A;  3DUZ A;  4OXP A;  1CM9 A;  4O2D A;  4N8F A;  1WTP A;  1PH4 A;  2HIV A;  1QVG A;  2Q2H A;  5K5P A;  1JWU D;  4Y52 H;  1QVC A;  3S1Q B;  4DF7 A;  5GAG C;  1BOS A;  2KUM A;  2LS0 1;  1PRT C;  2CFM A;  2PZW A;  3K5N A;  3CHB D;  3BG3 A;  1KQS A;  3GV6 A;  1OXX K;  5CBE E;  4DK6 C;  1YIT A;  3PO3 G;  5M3M H;  3SK8 A;  1EZ8 A;  1U5K A;  2P5Z X;  5E4X A;  3DWQ A;  5C3W A;  2VQF L;  2R92 H;  1SAP A;  4FXK C;  3AYH B;  4OO1 H;  3Q0A A;  1C48 A;  1UE1 A;  4DV4 Q;  2D9U A;  2RHS B;  5IP9 G;  5EPJ A;  1VQC A;  2KEE A;  4RHR A; 
#chains in the Genus database with same CATH homology
 4ZLT F;  2OXP A;  2TSS A;  3KF8 A;  2F4I A;  4JBW A;  2XSC A;  1B9M A;  4K8J A;  4H13 C;  1I3Q B;  2RVL A;  1HCZ A;  1MSG A;  2JP1 A;  4XTC S;  1OXU A;  4K6D A;  4HN7 A;  1ESR A;  1WD1 A;  1RTO A;  1LTB D;  1AEX A;  3Q23 A;  2EYP A;  1SNO A;  4A3M B;  1KDC A;  2EYF A;  4RA8 A;  5D14 A;  4KY7 A;  3V05 A;  1PTO C;  1IKL A;  4ZAI A;  2K7V A;  5IT9 L;  4EQN A;  1WTQ A;  2EYH A;  5C4X B;  5LHY 1;  3RD4 A;  4C3I B;  4BBS B;  1ROD A;  2O2L D;  1CZG A;  1A3U A;  3VYT A;  3PUZ A;  2PQE A;  2F3W A;  4EGV A;  5HUR A;  1DOM A;  4WRD A;  5KNC A;  1PLF A;  4KN7 C;  4G7H C;  4FF2 A;  1HHV A;  2AWN A;  3CRL C;  4XT3 B;  1YNJ D;  3S15 B;  2PW7 A;  1IW7 C;  1M8A A;  3NBI A;  2XIW A;  4Q0F A;  2NVQ B;  2IX3 A;  3HOX B;  2X69 A;  4OIJ A;  1MI2 A;  2X6G A;  1EWH A;  5ELF A;  5JPM C;  1DCZ A;  4IFD G;  2JEA I;  3T53 B;  4IAL A;  3X3M A;  3L3O C;  4IUP A;  1E2W A;  2KHS A;  1PMR A;  1TU2 B;  1AW7 A;  1DD2 A;  1DYQ A;  1V8Q A;  1FGB D;  4NMZ A;  3VR3 A;  4A3J B;  4MN3 A;  5G3L F;  2EXZ A;  4RWS C;  1HPC A;  1FYC A;  3MXN A;  3GTP B;  2J4X A;  5IIF A;  1PZI D;  1RKN A;  1VCI A;  4RCN A;  3DM1 A;  2F0F A;  1EY7 A;  2QEJ C;  3K5O A;  4RKB A;  1SEB D;  3MZ5 A;  1CI3 M;  3PUV A;  1CTM A;  1QE6 A;  5ELB A;  1IL8 A;  1VMC A;  2R6G A;  1ENC A;  2L55 A;  1CFM A;  1I4R A;  2L1B A;  3BYT B;  4F88 A;  4XYO A;  1JOQ A;  3VR6 A;  3H91 A;  4M8A A;  3BVZ A;  1SYC A;  2KEC A;  3HP3 A;  4XIG S;  3FEW X;  2MUY A;  2EY2 A;  4U67 3;  3PUY A;  3K0Y A;  1EZ6 A;  4HAE A;  4K5W A;  5M9O A;  4OHJ A;  2PW5 A;  3T56 B;  1EL0 A;  3R2T A;  3CRK C;  1Z47 A;  3D31 A;  1O7Y A;  4HED A;  2QCP X;  2WV6 D;  5DNF A;  1ML0 D;  5KYL A;  3I8Z A;  1EIG A;  2IL8 A;  4DFA A;  1BUV T;  1KNA A;  3NHH A;  1BR9 A;  5DAU A;  1EY0 A;  1O80 A;  1A2T A;  4CKE A;  1JE4 A;  5M5X B;  2R7Z B;  5CMD A;  3ITP A;  5CV7 A;  4RGN A;  3D6W A;  5I9P A;  2K6A A;  3GTQ B;  1G29 1;  2KOL A;  3L7Z C;  1A3V A;  5K36 H;  2B8G A;  2MP1 A;  5I6W A;  1GUW A;  1D1I A;  4Q5V A;  1TWG B;  1LTT D;  3KK7 A;  5C4J B;  3VR5 A;  1SYF A;  2K33 A;  1O7L A;  4K8I A;  4QF4 A;  2IPK D;  3A8K E;  3S2D B;  2BE5 D;  3TP8 A;  5KYI A;  2H1E A;  5A35 A;  3K7A B;  5C44 B;  1Y8N B;  4K5X A;  1H9S B;  1GUT A;  2XN9 C;  3D6C A;  4DAY A;  3H0G B;  3OWE B;  1U4M A;  1VMP A;  1FR3 A;  1QOH A;  2WIN B;  2XWB B;  4Z9C B;  4ZQ3 A;  4K6L A;  5LL6 S;  2B2V A;  2EZV A;  1EY9 A;  1WTV A;  1BQQ T;  4LK1 C;  5DEH A;  3OWF A;  1ESF A;  2Z8L A;  3SR1 A;  2MGS A;  4QCL A;  4F87 A;  4C1N I;  4N9T A;  1V1O A;  3DEO A;  5KIX A;  5M3M B;  1RCV D;  3M85 A;  3P1H A;  1CQV A;  1UAP A;  5ELC A;  1GHK A;  1TKW B;  2R92 B;  1GUG A;  4CJ2 C;  2KVM A;  4BWG B;  4NW2 A;  1NCV A;  2IJ0 A;  2A6E D;  3R93 A;  4CGY B;  3MWY W;  1HA5 A;  2KCC A;  2IW3 A;  3BDL A;  1CQF A;  2HDL A;  3TDQ A;  3MAQ A;  3MEH A;  3GTO B;  2D62 A;  4IUR A;  1QWY A;  1LAC A;  5JEA G;  3S2H B;  1JIC A;  2DN8 A;  4PV1 C;  1J9O A;  5T1G A;  3Q6S A;  4RGT A;  3JAM E;  3FMC A;  4H44 C;  3QO2 A;  1NAP A;  4FO2 A;  3NSW A;  3S16 B;  2AQ2 B;  2AUK A;  1CK1 A;  3V96 A;  2LFN A;  1S5D D;  1V1P B;  2AWO A;  5D65 A;  3GTL B;  2FIN B;  5FK9 C;  3HZX A;  4RHS A;  1AFP A;  2B2T C;  4BY7 B;  4L63 B;  2L9H A;  3DHQ A;  5FO7 B;  1QB5 D;  4OGQ C;  2FFK B;  2K5D A;  1U4P A;  1EWC A;  4WFN 3;  1DON A;  1B4O A;  4HR7 B;  1QIL A;  2KQ3 A;  3GTM B;  1GJX A;  1U4L A;  1FD7 D;  5JEA J;  3U9O A;  2L12 A;  3BVG A;  1CZW A;  4FF1 A;  1QNU A;  3SDZ A;  1ICW A;  4K5V A;  2RA4 A;  1K8O A;  3OHX C;  3NQI A;  2B8F A;  3M4O B;  2NN6 G;  4TKO B;  4B08 A;  4BA1 I;  1EQT A;  4EQP A;  2Q8T A;  3WDN A;  4F7X A;  1EY4 A;  1RDP D;  3G6J B;  3MFY A;  3V2T A;  3H6M A;  1F9R A;  3NTH A;  1Y1W B;  2O4X A;  4C3H B;  1RD9 D;  1WD0 A;  1IYV A;  5EGT A;  3EA6 A;  2I07 B;  1ET6 A;  3DEP A;  3CU7 A;  3MXU A;  1SSO A;  3MHB A;  3W3A A;  4RGO S;  1JWS D;  2Q8I B;  4ZKC B;  4IN3 A;  1VDZ A;  4EVO A;  5ELD A;  1HUM A;  1V43 A;  3OMG A;  2WB1 B;  2E75 C;  1XXG A;  1I4P A;  4PMW A;  3PUW A;  1FNV A;  1RF2 D;  2NVT B;  3R2I A;  4DK1 A;  2K01 A;  1X32 A;  1F2L A;  4H7B A;  1O7Z A;  1UUP A;  3BVM A;  2DY8 A;  5CV8 A;  2F03 A;  4C3J G;  4ZKB B;  3SE0 A;  4C56 C;  4G57 A;  5JJZ A;  1YNJ C;  1C4Q A;  1STH A;  3KLS X;  2JE6 I;  4KK7 A;  3R3O A;  4QIW B;  3RZD B;  1CHQ D;  4H0L C;  2PCF B;  2RSN A;  1Y8P B;  1PFN A;  1Q3L A;  3T16 A;  5A2Q E;  1EU4 A;  1GXD C;  1R4P B;  1SJH D;  2RBM A;  4X3K A;  2A6H D;  1LT3 D;  5JVG 3;  4RH6 A;  5C6A A;  3F2U A;  2WKC A;  3QOL A;  1BNZ A;  5CC4 A;  4K2L A;  1E0B A;  1Y69 U;  2JA8 B;  1STG A;  1L0Y B;  1JC7 A;  3ERQ A;  5EJW A;  2EYJ A;  4DXF A;  1UEA B;  2BDO A;  2MHV A;  3GTK B;  3HGB A;  1JOO A;  5CV9 A;  3J80 E;  2B2U C;  3CQZ B;  3VR4 A;  3TSS A;  1WTO A;  2C9O A;  2FMC A;  3C1E A;  5M5W B;  3GO5 A;  3ZYY X;  5COY A;  1JCK B;  2LKV A;  4ODG A;  1ZEQ X;  1IKM A;  2XVS A;  4XQN A;  1BXT A;  1QNK A;  1BCP F;  4DGZ A;  4KY5 A;  4I7Z C;  5C4H A;  3LX0 A;  5KGU A;  1F77 A;  5C4Z A;  2QIL A;  2IT1 A;  4HTH A;  1PYW D;  4IQZ A;  4S3S A;  3EFX D;  3HOV B;  2E2H B;  2M2L A;  1ENA A;  2E76 C;  4QMG A;  2Z1C A;  1G2S A;  4KKU A;  3IKJ A;  1GOZ A;  1JOR A;  5JOB A;  1D2B A;  1OXT A;  3NP8 A;  2JSO A;  2EOT A;  3PO3 B;  3P7J A;  5I4D A;  4EQO A;  3KBX A;  1T5X D;  4KMU C;  1STB A;  5IGB A;  3D4W A;  2NZ1 D;  5CGK A;  2G9H D;  2SNM A;  2F0N A;  1X3P A;  3Q22 A;  2E2I B;  3OPO A;  2BE5 C;  2ID0 A;  4O42 A;  2A73 B;  1F9S A;  2V4D A;  5JEA H;  2EY5 A;  4J8Q A;  1SBB B;  5EKI A;  3A56 A;  3G7L A;  1SNQ A;  2KCN A;  2RDF A;  1HQM C;  3K5M A;  1M4V A;  3TP5 A;  1A3T A;  5ELE A;  1D5M C;  4UDU C;  2IX1 A;  2KA7 A;  2F0Q A;  3NBH A;  2OF1 A;  3SK5 A;  2J7Z A;  5C5M A;  1JB3 A;  1ONL A;  5M3F B;  3HG9 A;  2CW0 D;  2A68 D;  1L0X B;  1HXY D;  1GUN A;  3IAY A;  1SYD A;  1NR4 A;  2H4O A;  4NKL A;  2NYZ D;  1WVL A;  3MXP A;  3AB9 A;  4IFD I;  5J1Z A;  3D3R A;  4E6I A;  4XQJ A;  3GV3 A;  4HMJ A;  2N55 A;  3OSO A;  3OW7 A;  2CQA A;  2A6E C;  1OO9 B;  1A6X A;  2F0K A;  1EEF D;  1CT1 D;  4ZK9 B;  5CR3 A;  1SMY D;  5BN3 A;  5IGC A;  4FVM A;  2ZXP A;  4ILW A;  1I50 B;  2JYO A;  2A69 D;  3MVV A;  4CHT B;  2LMC B;  2PMZ B;  1HA6 A;  5FLX E;  2F0G A;  1I4G A;  2NN6 H;  1H9S A;  1ZKO A;  1IHZ A;  1SE4 A;  3JAM L;  4ME5 A;  3GTJ B;  2K1B A;  1DM0 B;  4HSV A;  3ND9 A;  1DXM A;  1AZP A;  5BN4 A;  3S14 B;  3H94 A;  1K83 B;  2B2W C;  1T5E A;  1D5X C;  1QG7 A;  5KEE A;  3DWP A;  3H09 A;  3KLS A;  3HKZ B;  5EBC A;  1GUS A;  5D3I B;  1DOL A;  3TZD A;  2EYM A;  4R9W A;  2O5J C;  1QCB D;  2F0I A;  4OO1 I;  2Y0S B;  5COR A;  2NTS A;  4A3G B;  1BCP B;  3MA2 B;  4JK1 C;  4KJN A;  5I9O A;  1Y8O B;  3VA5 A;  2B39 A;  5IOD A;  2F1M A;  4KKT A;  3I90 A;  2SNS A;  4TRD A;  4ZRZ A;  1TT2 A;  2DNE A;  1X3Q A;  1BCP D;  1BO0 A;  4YIJ A;  4LMQ D;  1B44 D;  5DM6 3;  5IGE A;  2R93 B;  3RLF A;  2B2W A;  3MFG A;  5TSS A;  1EU3 A;  3VYR A;  5CV5 A;  4BY1 B;  1SYE A;  1MBY A;  3O13 A;  5CBA E;  2NUC A;  2GA4 B;  1D1K A;  1TWA B;  3PV0 A;  3AMU A;  1V1P A;  5I6Y A;  2YU9 B;  3LWU A;  2B2Y C;  4A3B B;  1J8I A;  2F0J A;  3BS1 A;  1JOK A;  5IGG A;  1PFM A;  5T1I A;  1XX8 A;  1I4X A;  2EYO A;  5E1F A;  1HFN A;  1Q90 A;  4DA2 A;  1TWF B;  1HUN A;  4XXE A;  3J7Y W;  1TQO A;  2F0T A;  3D4R A;  2R61 A;  1FNU A;  3HOU B;  2C5C A;  1BF4 A;  4V19 0;  1SXT A;  3I4M B;  1PZJ D;  4HCS A;  2JA7 B;  1ZYR D;  4X3S A;  5KND A;  3TZU A;  2YYZ A;  4CJ0 B;  1LTI D;  5LL6 X;  3L9A X;  1RJT A;  2F0M A;  3FKI B;  2L0C A;  3SHL A;  2EJM A;  1HQR D;  1SYG A;  4PNY A;  2B2Y A;  1WTW A;  2EJG C;  2F0H A;  3HEJ A;  1STA A;  4LJZ C;  1PTO H;  1TVX A;  3C1F A;  2PPB C;  3DWA A;  4J1M A;  4DXG A;  1A15 A;  5EBD A;  5EPL A;  4FYD A;  4DU9 A;  5J22 A;  2MJ8 A;  1SE2 A;  3A8J E;  2A6H C;  3N6R A;  1W6J A;  1BBX C;  1S5E D;  5I2X A;  2F0P A;  5C0X G;  3UI2 A;  1STY A;  1LLR D;  4FXG C;  5IGD A;  2X6L A;  3HS0 C;  1D5Z C;  1F2Z A;  1EEI D;  1PRT F;  1EYD A;  4AYB B;  1EY5 A;  4G7O C;  2F0S A;  3A55 A;  1RHP A;  4X3T A;  2MPM A;  1IYU A;  2B2T A;  1SYB A;  1B2T A;  5FKA C;  2EJF C;  4IZ8 A;  1B1Z A;  4DNR B;  4DK0 A;  2A5H A;  2HCC A;  1GHJ A;  1TS4 A;  3MC0 B;  1KDA A;  3WOE A;  1ILQ A;  2XRQ D;  4KY6 A;  3I4L A;  4ZYS A;  1LT5 D;  1S5F D;  5FO9 B;  4ZUI A;  2PYK A;  1YNN D;  2NN6 I;  2SOB A;  4B9X A;  2L5T A;  2AUJ D;  2EYL A;  4FXD A;  1JWM D;  2AQ3 B;  1KDB A;  1O78 A;  4KD3 A;  5C0X J;  2NB0 A;  3EQL C;  2F0W A;  4MHE A;  4R8N A;  1LTR D;  2NVY B;  1PTO F;  1JR0 D;  3J81 E;  5CV4 A;  2HQE A;  2HUG A;  3NWT A;  1I4Q A;  3P75 A;  5HGT A;  1GUO A;  5I2Y A;  2RQX A;  4WOR A;  4C3I G;  4XYQ A;  4QB4 A;  3J7A V;  3QJY A;  3I91 A;  2WP8 J;  5JAV A;  3Q24 A;  3I70 A;  2WKD A;  2VUM B;  3TP7 A;  1STE A;  3EJI A;  3OIP A;  4U68 A;  5IGF A;  1C8C A;  2XRS D;  4KTA A;  4DAV A;  3S1N B;  2O5I C;  4OIK A;  2F0V A;  4A3F B;  1TY2 A;  1HTL D;  3D4D A;  4IUQ A;  4B9W A;  2I46 A;  1SND A;  1KAB A;  3ND8 A;  3I3C A;  4IUV A;  4KKS A;  3S9W A;  3PMF A;  4IUU A;  3S17 B;  3TBI B;  3M7N A;  3VA7 A;  2Z4I A;  2CW0 C;  3TN2 A;  1FNW A;  2N88 A;  2A68 C;  1DJR D;  1I6V C;  3I72 A;  3QB3 A;  3W2D A;  4RFB A;  4PMB A;  1AN8 A;  3U9S A;  2LY7 A;  3E6Z X;  3KBG A;  1NUC A;  1LO5 D;  4CKB A;  5KNB A;  4R8I A;  3J7A F;  5NUC A;  1UNS A;  2DNC A;  1SMY C;  1H9K A;  2QDB A;  1EIH A;  1B53 A;  2KED A;  4C3J B;  2SDF A;  3KLR A;  3EVQ A;  2A69 C;  3NUC A;  2JXM B;  1MD2 D;  3N52 A;  4FF4 A;  5DM7 3;  3R8B A;  1F2Y A;  4K14 A;  1F9Q A;  5FLX L;  2B2U A;  3P20 A;  1LT6 D;  3C2P A;  5FOB B;  3OIQ A;  2Q8R E;  4G7Z C;  2DY7 A;  4F8M A;  1PRT B;  1B3A A;  1HFG A;  1SNC A;  2XNA C;  4I65 A;  4X3U A;  4BS9 A;  5AFW A;  5C3E B;  2PZU A;  3T4A C;  5EKL A;  2K5Q A;  1U4R A;  3X3N A;  4CJ1 B;  4DN4 M;  3M3Y B;  1SNM A;  1TS2 A;  1WCM B;  3GD7 A;  4C1N K;  5ISR A;  1PRT D;  1I6H B;  2D5D A;  3M7G A;  5EPK A;  1STN A;  4FF3 A;  3PIO 3;  3QG1 A;  1TII D;  4TQU S;  1S5B D;  4XT1 B;  1CA5 A;  3URY A;  1WTR A;  3QWN A;  2PO4 A;  5C5L A;  2NTT A;  1BCP C;  2E74 C;  1Z6H A;  3AU7 A;  1H9M A;  1KAA A;  4ID6 A;  5E3F A;  1CA6 A;  4A3K B;  2J0T D;  2CHB D;  5JVH 3;  3H3V C;  1R9T B;  1PTO B;  3HOY B;  3M4Y A;  2OEO A;  3D8G A;  2F0E A;  2PZT A;  4L8J A;  2K04 A;  2K05 A;  1CHP D;  2F3V A;  2K32 A;  5CYU A;  4V0B A;  2NBF A;  4P2C B;  2BCO A;  1PTO D;  3NXW A;  4XDX A;  1PZK D;  2JEB I;  5IT9 E;  1II3 A;  4KHV A;  1SE3 A;  4GZY C;  4L6T B;  1ILP A;  4IFD J;  2CVR A;  2VB3 X;  4PQX A;  1G2T A;  5C0X H;  2NWG A;  4KI0 A;  3PUX A;  2NVX B;  4IUT A;  4N9P A;  2EDG A;  1EY8 A;  4OO1 G;  1OXV A;  4XQQ A;  1F9P A;  3SK6 A;  2HCI A;  2QF7 A;  3BDO A;  1Q12 A;  4HMI A;  4KHZ A;  1E2Z A;  2K5W A;  3S1R B;  1Q1E A;  1B9N A;  3FPP A;  2F0O A;  4G4K A;  4K2K A;  2EVB A;  1HRJ A;  2ENB A;  1DZ1 A;  4CBV A;  1LTA D;  1G6Z A;  1ZYR C;  3OMC A;  3GP7 A;  3WOF A;  2QKI C;  3A54 A;  3TME A;  3GTG B;  3K58 A;  1G91 A;  2B2V C;  2KJX A;  2M9V A;  1IW7 D;  1OXS C;  4ULL A;  1VF5 C;  3NTI A;  5F2D A;  5BN5 A;  4NP5 A;  1SFO B;  1PFB A;  4ABN A;  1HTP A;  3FVQ A;  1SDF A;  4KN4 C;  4OL7 A;  3PIP 3;  1TY0 A;  2RSO A;  1WTX A;  2BA1 A;  3VR2 A;  1E2V A;  4RAU C;  2AQ1 B;  3S1M B;  4QUF A;  3IL8 A;  2RDH A;  1EYC A;  5E4W C;  1SJE D;  3LWE A;  1S4Z A;  1B50 A;  2WAQ B;  3A7L A;  2EY6 A;  4DNT B;  2K03 A;  3FRP B;  3K59 A;  1MSH A;  1ET9 A;  1A2U A;  1NSN S;  4RKL A;  3FPU B;  1TR5 A;  2ICI A;  3E0J A;  4A3D B;  1EFI D;  1D6E C;  1JQY D;  1KTK A;  3T13 A;  1EYA A;  1XWE A;  2K28 A;  2EE1 A;  3OOC A;  2SEB D;  5M5Y B;  1KLG D;  4O1N A;  3E5S A;  4DAP A;  3FDT A;  2FJ2 A;  5D3D A;  5EQ0 A;  1H9J A;  1U9R A;  3NPP A;  1Z7T A;  2R3Z A;  3SVM A;  3KUP A;  1VF7 A;  1G8Z D;  3TP6 A;  1Q1B A;  3C46 A;  2OT2 A;  3HOW B;  3RZO B;  1QJO A;  4C3H G;  3I4N B;  3SXH A;  5C3X A;  4M1U B;  5FO8 B;  4NDX A;  3C3L A;  1YNN C;  3NK9 A;  4UAI A;  1F2M A;  3ERO A;  3K6O A;  4ZUJ A;  3GQB A;  2BOS A;  3BDC A;  4KV6 A;  5IOC A;  1S5C D;  2F0L A;  4QUC A;  2VB2 X;  3T51 B;  4C2M B;  4BBR B;  3NWS A;  3J81 L;  3NE5 B;  2M00 A;  4KJO A;  1I4H A;  2XWJ B;  1EY6 A;  3A8I E;  1H9R A;  5KRU A;  3QOJ A;  1TWC B;  4MIU A;  3I73 A;  2FMM A;  2FHT A;  2ZXR A;  3VYU A;  2IX0 A;  3DXJ C;  3K5L A;  1TS5 A;  4A93 B;  3RMH A;  5G3L D;  2BA0 A;  3IFD A;  3K57 A;  2BDN A;  4WJW A;  5A2Q L;  4BA2 I;  1MGS A;  1XYI A;  2JA5 B;  2E2D C;  1EOT A;  4RGM A;  4Y7N B;  2F0D A;  4HCE A;  1RTN A;  1EQV A;  2E2J B;  4FNF A;  5EKK A;  3NTK A;  2G9D A;  2TMP A;  3ONA B;  4LAA A;  5CV6 A;  2HDM A;  3HOZ B;  2Z4H A;  1ENF A;  1XTC D;  2WII B;  4IUN A;  4TSS A;  1KLU D;  2JA6 B;  4KD4 A;  2ZXO A;  1LV9 A;  2PNR C;  3J80 L;  3IFT A;  1TS3 A;  1AZQ A;  2D2C C;  3DMU A;  3RUZ A;  2L11 A;  4CKC A;  2ICE C;  1DOK A;  2B63 B;  4PMC A;  1LTG D;  1PXU A;  2WAC A;  4RCO A;  2RKS A;  2L4N A;  5K36 G;  1SNP A;  1LT4 D;  3NQT A;  2EPB A;  2VXW A;  4A3I B;  3CKI B;  1TWH B;  2EY1 A;  3MTS A;  4IFD H;  3HRZ C;  4A3E B;  2A74 C;  3PO2 B;  5C0X I;  2F0U A;  1W6K A;  1R4Q B;  1Q8I A;  2RDG A;  2VNU D;  1Y1V B;  1LAB A;  3QIA A;  1BDO A;  4J6H A;  2ZT9 C;  1PDQ A;  3MXG A;  3LNN A;  5JPN C;  3BZD B;  3A7A B;  5J39 A;  3SEB A;  1ZXT A;  1K8M A;  2IWH A;  4HSP A;  1LTS D;  1KNE A;  3BYY B;  1AP0 A;  4FP5 D;  3VYS A;  1NR2 A;  3SK4 A;  3DUZ A;  1CM9 A;  1WTP A;  5K5P A;  1JWU D;  3S1Q B;  4DF7 A;  1BOS A;  2KUM A;  2LS0 1;  1PRT C;  3K5N A;  2PZW A;  3CHB D;  3BG3 A;  3GV6 A;  1OXX K;  5CBE E;  3SK8 A;  1EZ8 A;  5E4X A;  3DWQ A;  5C3W A;  1SAP A;  4FXK C;  4OO1 H;  3Q0A A;  1C48 A;  2D9U A;  5EPJ A;  2KEE A;  4RHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...