3PO2H

Arrested rna polymerase ii elongation complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3po2H00
1YHBA 1VS0A 4GKKL 2NVYH 2ATWA 1XPUA 1UE7A 4JYAL 4R4TA 3LGJA 5C0XJ 1WCMG 2WP8J 2N49A 5C44H 4GLAC 2WAQG 3TEHB 5GAHC 1LUZA 4JI8Q 1PFSA 1E7ZA 4R4OA 4HIKA 4JI5Q 2R7ZG 5C4XG 4JI8L 1QVFA 1Y1VG 4JBWA 1N8RC 1PH1A 2ZM6Q 3CCJA 4LFBL 4GNXC 3RZOH 4LF4L 4LF8L 2JEAI 3J80c 4DUYQ 1I94Q 4KI0A 4DKAC 3CCMA 1HNZL 2Q2IA 3MEFA 2RF4A 2N78A 2AWOA 2RHQB 4YCVA 1XNRQ 2Q2HA 4Y7NH 1B7YB 3H0GH 1IBMQ 4JI1Q 3M7NA 3E0EA 4DR5Q 3T1HQ 1HNWL 4A3LG 5ELOA 1K9MC 1HNWQ 3STBC 5M5WH 1G291 2YU9H 1SE8A 1EYGA 1IL2A 1WI5A 4A3FG 4LF7L 1NMFA 3G71A 4POFA 4DAYB 2HHHL 2UUCL 3T1YL 1UEBA 2ZTEA 4HJ5A 1K8AC 3W1BA 1E22A 5GROA 1Q86C 4A3KH 4O2DA 1YJNA 1HR0W 3HOXH 5IP9H 1TWAH 3F8TA 3PGZA 3PUWA 5HY6A 3CXCA 2EXDA 4DV3Q 2IX1A 4H02A 3CPWA 1XNQL 3S17H 4BBRH 1WJJA 1AE2A 3PUVA 3GDEA 1ASZA 3I4NH 1XMOQ 3PIPA 1KIXA 3GTLH 3EBEA 1C9OA 4R4QA 5IYBH 1VQ6A 3S2DH 3PIOA 1VQLA 4DV4Q 1PH5A 2R93H 1PHJA 4OWWB 3U4VA 4X62L 1V1QA 5FLXc 4LF4Q 4LF8Q 3K7AH 1QUQB 4A3GH 1PH2A 2GN5A 3CC7A 4A76A 3RZDH 1XMQL 3F2CA 3PV0A 5LMNW 4MTNA 4TVAB 5LMNQ 2E2IH 1K3RA 1HZBA 1KL9A 1E1TA 1G51A 2HQLA 2F52A 1QVGA 1FGUA 2ALYB 3OTOQ 3CCSA 4YY3Q 5K36G 1VQDA 2OCEA 3A0JA 4DR6L 1K83H 4DV5L 2UUAQ 3FKIH 2AMCB 3D31A 4LF6Q 4DPGA 3U4ZA 4TQUS 2FXQA 4DV6L 3CCUA 2I5MX 2K5HA 1SN8A 4AQYL 2OQ0A 3TS2A 3HFZB 3PF4A 3PUZA 4LFAL 2R7FA 3HKZE 2HIXA 3S1NH 4JI3L 5C3EG 2WB1E 3S2HH 3D0FA 3KDFB 5IYBG 1Q82C 1IBML 1Z9FA 2R92H 4BY1G 3EN2A 4EQ5A 2XGTA 2VQFQ 3HOVG 2R93G 2EQSA 3I56A 2E5LL 2JA5H 4GN3B 4JBMA 1C7YA 3TQYA 4C2MH 3TRZA 1RIPA 4JI0L 1YHQA 3RR5A 1XNQQ 2R7DA 2JA8G 1CKOA 4L5RC 3GTMH 2UXDL 1A0IA 2N8NA 2OWOA 4OONA 1FJGL 4QGUA 1VQNA 4LFBQ 3G4SA 4PMWA 4PZ8A 4DR2L 1QZGA 1GD7A 3ULPA 1EFWA 2IT1A 1KXLA 2Z6KC 2YTXA 1HR0Q 2BH2A 3AEVA 3JC66 4DV5Q 2UUAL 5JJLA 1YVCA 4ALPA 2JA9A 1YI2A 1KC8C 1IBLL 1AE3A 4KHZA 3KF8B 4PZ6A 1XJVA 3HOXG 4OXPA 4X66Q 4GNXB 4A3BG 5AJ3L 1G6PA 4LF5Q 1MJCA 3M4QA 1EQRA 1XMQQ 4GS3A 5LMUQ 4JBJA 4L5QA 4O0AA 1JJ2A 4A3LH 4Y52H 3I7FA 4BA1I 3K80C 4DK6C 3KFUA 3S1QH 2ZTCA 1W2BA 2IY5B 1X3EA 2F4VL 2QA4A 4JYAQ 3H15A 3A5ZB 1KRTA 4GN5A 4JI7Q 4IPCA 1X65A 3UDGA 1M1KC 1K73C 3RLFA 2YTYA 1HR0L 4LUOA 4GLVB 1HNZQ 2OTLA 1BBUA 4B3SQ 3M3YH 5C0XG 2LSSA 2IHEA 5M5XH 1IXRA 1B8AA 3PO2H 4HIMA 2K5NA 4NXMQ 4A3IH 3HOWG 4B3SL 2I0QA 5IP9G 3CCLA 1VQ5A 1IYJB 3JAMc 4DNIA 1BKBA 4A3BH 1R9TH 4QIWE 4R1JA 3HOVH 3E9HA 4LW1A 2F4VQ 2RCNA 3GTPH 4B3MQ 4JI2Q 5IWAQ 4JI4L 4GKKQ 4JV5Q 2D0OA 2PQAB 2YV5A 4IPGA 1N33L 1SLJA 3CW2C 1SRUA 4BY7H 2L15A 2AWNA 2A1AA 3WWVA 1O7IA 2UXCQ 4DV6Q 4B3ML 4JI4Q 3RN2A 1I50H 3AQQA 2VQEQ 2OQKA 4J15A 1T9HA 4R4IA 3KJOA 1J6QA 3IRBA 3PUXA 1A8VA 1IBLQ 1VQ8A 4BA2I 4X6AH 2XTIA 3F1ZA 3A5UA 1VQKA 3M9BA 2UXBQ 5FLMG 4BBSG 3HKZG 5M3FG 5GADC 2ZJQA 2KENA 4X64L 1EQQA 2CWPA 3BU2A 1UE6A 2IHFA 1TWCH 2K75A 3CD6A 4P72A 2E2HH 4JI5L 3HOYG 4JC0A 1N32L 4NPSA 5M3MH 4IOCA 1PH7A 4JBKA 3GTKH 4A3CH 1SFOH 2DGYA 1CSPA 4A93H 3OW2A 4IOAA 1GKHA 1VQ7A 2UXDQ 2E5LQ 3JAMi 3KDFA 1VQ4A 1E1OA 1VQFA 3H3VH 1U5KA 2JA7G 3PO3H 2VQFL 2Y0SG 2JA5G 1X3FA 2IX0A 4BY1H 1K0RA 3G48A 3I55A 4QY7A 4A3JG 2MO1A 4IPDA 3CCVA 1SMXA 2KCTA 1X56A 5BR8Q 4DR1Q 4PZ7A 4A3FH 5HGQA 1PA6A 2NVQH 1EOVA 1XPOA 1N34L 1L1OA 1LM0A 1WFQA 3CC4A 2MQHA 3F2DA 5GAEC 4LF6L 4R4CA 1WCMH 1NE3A 2JE6I 3HOWH 2PI2E 4OO1I 4P74A 4X65L 1Q7YC 4DR3Q 3SGIA 5GQOA 3F2BA 5ELNA 3HOZH 2EIFA 3K0XA 4BXXG 2GVAA 4DR3L 4GOPA 1VQOA 3K7UC 5LMNL 4A3CG 2K52A 2ID0A 2JQOA 1GM5A 4UP8A 2HT1A 4BXXH 1OXXK 1VQPA 4KHPQ 1Q8KA 1V43A 1SR3A 3T1HL 5FJ8G 2A19A 3TREA 1PYBA 2UU9Q 5JJIA 1PH3A 4PG3A 4JI6Q 4GKJL 3J80i 3J81i 2ZTDA 1C0AA 3S15H 4GKJQ 1Z47A 4YWLA 2K4KA 1J5EL 4K0KL 5C4JH 1X6OA 3B6YA 3A74A 3KYHC 3Q8DA 4UPAA 2VY3A 4LUVA 5M5YH 3KJPA 3FHWA 3FP9A 5EAYA 4DV2L 2B29A 4DV7Q 1KD1C 1YIJA 1PV4A 4JI6L 3S16H 2PQAA 3L7ZC 3CC2A 4LF9Q 3CQZH 4NXML 2JA8H 4B3RL 1L1OB 3VDYA 2R7ZH 1I5FA 1OXUA 1IBKL 4OX9Q 4UP7A 1U0LA 3GTJH 2PI2A 4B3TQ 3AFPA 4XTCS 2WB1G 2B63G 3EIVA 4DUZQ 4NB3A 4A3IG 1BVSA 1OXVA 4GOPB 1LYLA 4DR6Q 2I5LX 2V1CC 2KHIA 3BZKA 5JEAG 4YHHL 4DV1L 4DV0Q 1K8GA 4IFDJ 4JG2A 3T1YQ 1KHIA 4DK3C 4HIOA 1YJ9A 4LF7Q 3S1RH 1P8LA 2UXCL 1MKHA 1UE5A 4BY7G 1VQMA 1EIFA 3ER0A 3HKSA 4YCWA 1PH9A 4LF5L 4NXNQ 1PH6A 4X62Q 1B70B 1Q1BA 1X3GA 2KBNA 4LFCL 1VQBA 3CF5A 2CKZB 5IP7G 2ZM6L 1VQEA 4JCVE 3RLNA 2YYZA 2MNAA 2AKWB 4A3KG 1CSQA 1YBYA 5M3FH 1PH8A 1HNXL 3CCRA 1S72A 3PSIA 2VUMH 4A75A 1X54A 2R6GA 1ASYA 3J7A5 4A3DG 1NTGA 2NN6G 2Y0SE 1YJWA 5E7NA 2WAQE 1S40A 4JI0Q 2D0PA 4C3IH 1OTCA 3UE0A 4GLXA 5H1SE 1KRSA 2F3IA 1E24A 3UE1A 4DR4L 3CMEA 2BH8A 1VQCA 3L0OA 3GTOH 1JJCB 4IJLA 1D8LA 4YWKA 1VQHA 2Q2UA 2I5HA 3S24A 4LFCQ 4OO1G 1KQSA 3HOUG 3NENA 4QL5A 2JA6H 1EUJA 1TWHH 1V9PA 4HJ9A 1Q81C 4P73A 2ASBA 1FL0A 5GAGC 4WJ3M 2ZJPA 1NMGA 5C44G 3ZJYC 4HJ7A 4YHHQ 1Y14B 3CPFA 2VS1A 3PCOB 3PUYA 3M85A 3U58A 1VQ9A 3E9IA 1MIUA 2DUDA 3KF6A 3GTQH 4FDBA 3S14H 2JJQA 4QQBX 4DV0L 4MZ9A 3RLOA 3ULJA 1QZHA 1LTLA 2QEXA 4DUZL 3OYYA 2CQOA 4C3HH 1HNXQ 3GO5A 3J81j 1AH9A 1W3SA 2D62A 2UUBQ 2QGQA 2UXBL 4JOIA 3RNUA 1IBKQ 1OXSC 1JE5A 1Q1EA 4P75A 5JEAJ 4AYBE 5M3MG 5IYCG 3CMAA 4L5SA 5C0XI 4WJ4A 1JJGA 5J3BA 4A93G 1GO3E 5FJ8H 4GOPC 2CCZA 4DV7L 4IO9A 4NXNL 4IFDI 1L2FA 3M4PA 3PO3G 1J5EQ 4GNXA 1TWFH 4LFAQ 5IP7H 2JK8A 1QUQA 1WYDA 1CKMA 3TS0A 3L2PA 1YZ6A 1YITA 5IYDG 4KHPL 3CCEA 1L1OC 1XTDA 1TWGH 4DV1Q 2BA1A 2E8GA 3BZCA 1SROA 1RL2A 1A63A 5DLQE 4ME3A 5JJKA 3ERSX 2VUMG 4LUZA 4A3DH 3ULLA 1KAWA 1BBWA 2LXJA 4X66L 3I4MG 1H95A 2B3GA 3KF6B 1XPRA 3CP0A 4B3TL 2H5XA 2NZOA 3OTOL 2JEBI 1UE1A 1Y1VH 4XIGS 3ICEA 3HOYH 3FKIG 4X65Q 1Q12A 4C3JH 4LF9L 3J7ZC 1I3QH 3S1MH 1A62A 1WOCA 2CWAA 3GD7A 3I4OA 3UDIA 1Y1WG 1N36Q 4OX9L 4IFDG 1FJGQ 4A3EH 1X55A 1CKNA 3NEMA 3UDFA 4K0KQ 1OXTA 4RMFA 2VNUD 3PF5A 4A4IA 3K81C 4LWCA 5C3EH 2N3SA 4JI7L 1HZCA 1MJEA 1L0WA 4DR7L 2UU9L 3M4OH 4DUYL 1VCIA 1I94L 1UWVA 4JI3Q 5IE8A 4A3MG 2HIVA 2K5VA 1EIYB 2CFMA 3G6EA 1NBWA 4AQYQ 2JA6G 3DM3A 2NZHA 1YEZA 4OWXB 1XMOL 3PO2G 3KLWA 4KLKA 2K14A 1N36L 2YTVA 4DV3L 4POGA 4OWTB 2BA0A 1CKNB 4UP9A 1YHAA 3W5OA 3CAMA 5IYCH 3UDXA 4HIDA 4QJFA 4YWMA 4LNQA 2B63H 1Y1WH 4YY3L 5FLMH 1IZ6A 5C4XH 4DR2Q 1N34Q 1TXYA 4MNOA 4HJAA 4BBSH 2VL6A 3DLLA 5IT9c 1QVCA 4L5TA 1PYSB 2WFWA 2Q2TA 2R92G 4P71A 4B3RQ 3AFQA 3H3VI 3NELA 3MXNB 3KOJA 3U50C 5IWAL 4DV2Q 1YNXA 3W1GA 4AIMA 4JI2L 1DGSA 2VW9A 1XNRL 3STBD 1VQIA 2KHJA 1N33Q 4YCUA 4A3MH 4DV4L 1NY4A 4JI1L 3HOUH 4DR4Q 2NN6I 4A3GG 4DR7Q 4APVA 4RG1A 2KCMA 3H0GG 4AYBG 1VQGA 1PVOA 1GVPA 3BJUA 4A3JH 2NVTH 1JT8A 1N32Q 1HZ9A 2K50A 2C35B 2AHOB 2PNHA 5IYDH 3J81c 2UUBL 2ES2A 1HH2P 4HJ8A 4X64Q 2E2JH 1P16A 4AH6A 1JB7A 2PMZE 2MFIA 1PH4A 1D7QA 3I4MH 4BBRG 3CCQA 1HJPA 2HHHQ 3NBHB 2UUCQ 2Z0SA 3HOZG 1S3OA 2ZJRA 1FVIA 2LXKA 2JA7H 2NVXH 4DAMA 2RHSB 1E3PA 4IJHA 2VQEL 2GVBA 3AYHB 3RN5A 1VQJA 1N9WA 1CUKA 1HZAA 2MO0A 1Q46A 2Z6KA 4JOIC 3I2ZA 4EX5A 4DR5L 4A3EG 5LMUL 1M90C 5BR8L 4DR1L 1JMCA 3I4NG 4JV5L 4IPHA 1VQAA 1EWIA 3K8AA 1NJIC 4UY8C 2VZAA 5AJ3Q 2A8VA 3GTGH 1I6HH 4GN4B 5IY0A 1X9NA 2OTJA
chains in the Genus database with same CATH superfamily
1U9RA 4JYAL 3MWYW 1XPUA 1QG7A 5FKAC 1JOOA 2WAQG 2WB1B 2B63B 2Z4IA 3VR6A 5CYUA 3TEHB 1HCZA 1QOHA 3HRZC 5C4XG 4JI8L 5D14A 3AMUA 1EY6A 1N8RC 1CT1D 1MGSA 2ZM6Q 2WACA 3MFGA 1RHPA 4LF4L 1V1PB 3MA2B 1DOLA 4KI0A 1X3PA 2Q2IA 1I6VC 5C3XA 2AWOA 5KIXA 1B7YB 2B8FA 5NUCA 3TDQA 5C3EB 3J7YW 3T1HQ 4A3LG 1SE3A 2K7VA 5L37A 1HNWQ 1B53A 3QJYA 2SNMA 4A3BB 2G5DA 2UUCL 5KEEA 4HJ5A 1Y69U 3W1BA 4ZCKA 1Q86C 4A3KH 1YJNA 3PO2B 3HOXH 2EXDA 3KUPA 2RSNA 5ELFA 4EGVA 1XNQL 3OMGA 1GUGA 3I4NH 1XMOQ 3GTLH 1O7YA 1VQ6A 4ODGA 3KF8A 1PZJD 4DV4Q 1PHJA 3ZYYX 4LF8Q 1QUQB 1PH2A 3RZDH 1XMQL 3F2CA 3HGBA 1JICA 4M8AA 2L5TA 1EYAA 1FGUA 2EOTA 2F0JA 2J7ZA 3A0JA 4DR6L 4G7OC 4PNYA 3D31A 4DPGA 4DAVA 3U9OA 2FXQA 2F0DA 3CCUA 2I5MX 2K5HA 4RKLA 3R93A 3QO2A 3TS2A 4LFAL 2JA6B 1Q82C 1IBML 1GUTA 5IYBG 2R92H 1GHJA 4BY1G 4Z9CB 1IYVA 2EQSA 2E76C 3I56A 1C48A 2E5LL 1RDPD 1A15A 2LKVA 3TQYA 4C2MH 1XNQQ 1SE2A 2BE5C 2N8NA 4MIUA 2M9VA 3G4SA 4HCSA 4PMWA 1FYCA 1EFWA 2JXMB 5J39A 1K83B 1AZQA 4DV5Q 2MHVA 4ALPA 2JA9A 1YI2A 1KC8C 3HOXG 5JJZA 4GNXB 3GV3A 4FNFA 2J0TD 2KEEA 5LMUQ 1EYDA 4RGOS 1JJ2A 4O0AA 1TQOA 2ZTCA 1LTSD 3H15A 4GN5A 1X65A 2DJGC 2F0TA 2XRQD 2B2TC 4GLVB 4HR7B 1HNZQ 2OTLA 2LSSA 5M5XH 1IXRA 2EPBA 4KY5A 5IGFA 3I3CA 4EVOA 3GTJB 4A3KB 1ZYRD 1LTAD 2K5NA 4NXMQ 5KYLA 2I0QA 1R4PB 1BKBA 2XIWA 1DZ1A 4K6DA 2OXPA 5M5WB 4B3MQ 2G9DA 4JI4L 4GKKQ 2D0OA 5J22A 4FXDA 1A3TA 3Q24A 2A1AA 1B50A 1I50H 4R4IA 2HQEA 1IKLA 1J6QA 3PUXA 4YIJA 1A8VA 2ZXOA 4BA2I 3A5UA 4X64L 3NBIA 3HG9A 2IHFA 1RKNA 2K75A 1UAPA 4JI5L 4IOCA 5FLXL 3GTKH 2DGYA 4IOAA 2E5LQ 1VQ4A 2KCCA 4XDXA 1KLUD 3G48A 3TP5A 4IPDA 3MC0B 3G7LA 1HA6A 1PA6A 4A3FH 2NVQH 1EEFD 3GTKB 1LM0A 1TWCB 3F2DA 5GAEC 5EPJA 4E6IA 4P74A 2F0LA 1Q7YC 2RA4A 4DR3Q 3HOZH 3OSOA 1OO9B 5T1IA 2K52A 2ID0A 1TY2A 1I50B 4BXXH 1VQPA 3EFXD 4R9WA 4KHPQ 1V43A 3QIAA 1BOSA 2A19A 3TREA 1PYBA 3E5SA 3J81i 3SDZA 4YWLA 2K4KA 4K0KL 1G2TA 3Q8DA 1TKWB 4LUVA 2ICEC 2PQEA 2RDFA 3FP9A 3TZUA 3KJPA 3QB3A 1KD1C 4ZLTF 1YIJA 1EIGA 5C4XB 4BBSB 4OX9Q 1Y1WB 1U0LA 3GTJH 1LTBD 2EJMA 4B3TQ 2LY7A 3QOJA 2WB1G 2B63G 4DUZQ 4A3IG 1BVSA 1CZWA 2F0QA 4GOPB 1Y8PB 4YHHL 4DV0Q 2F0PA 4IFDJ 1KHIA 4DK3C 3E3XA 1YJ9A 3V05A 2MUYA 2Z1CA 1PH9A 1VF7A 5A2QL 3M4OB 3NXWA 3T16A 4X62Q 1Q1BA 4LFCL 1VQBA 2D2CC 3NQIA 4PQXA 3HEJA 2ZM6L 1PXUA 1VQEA 3D4WA 2JSOA 1HUMA 1HNXL 1HXYD 3HOYB 2B2TA 3J7A5 1Y1VB 2NN6G 4F87A 3T56B 4JI0Q 1BF4A 3GTMB 4WORA 2K03A 4GLXA 4KN7C 4C2MB 1SYBA 1LT3D 1VQCA 3GTOH 5FK9C 1Q90A 3VR4A 3PIO3 1TWFB 2R92B 2EYPA 4HJ9A 4WJ3M 3OMCA 2ZJPA 1K3BC 4ULLA 4CDFC 2QW7A 3LWEA 4YHHQ 3PCOB 5A2QE 3U58A 3E9IA 1E2VA 5CMDA 1F2LA 2QEXA 5EPLA 4DUZL 2CQOA 5IGBA 2G9HD 3MAQA 3IAYA 3J81j 4RWSC 2QGQA 1OXSC 1JE5A 5ELBA 4AYBE 1RF2D 5JEAJ 4L5SA 2WKCA 1FNVA 5C0XI 3K5NA 3QWNA 3T51B 1JJGA 1GO3E 5FJ8H 3MZ5A 1CQFA 3PO3G 4GNXA 4LFAQ 3TS0A 4HSPA 1CKMA 4KHPL 3GTLB 3CCEA 3I4NB 1L1OC 3VA5A 1PTOC 4OL7A 1BNZA 4DV1Q 1B1ZA 2DNEA 1SROA 1ESFA 1RL2A 5DLQE 4ME3A 5JJKA 4QCLA 1ICFB 3ERSX 4A3DH 3DM1A 3ULLA 3I4MG 2B3GA 3KF6B 3R8BA 2H5XA 3OTOL 2KOLA 2JP1A 2F3WA 2TSSA 1STHA 1MSGA 1I4GA 1Y1WG 1IL8A 1X55A 3NEMA 2WIIB 5CV5A 3LX0A 2B2VC 2VNUD 2FMMA 4LWCA 4RGMA 1DCZA 5C3EH 2AUJD 2N3SA 1L0WA 4DR7L 1S5BD 1IYUA 2UU9L 4DUYL 3AB9A 1UWVA 1EIYB 4AQYQ 3S1RB 1SEBD 4OWXB 1WTQA 3HKZB 4IUVA 2NZ1D 5TSSA 2EYJA 2DN8A 2YTVA 5IT9L 2RQXA 1CKNB 4UP9A 2QCPX 4X3UA 4HIDA 4IURA 4QJFA 1SYDA 1N34Q 4YY3L 1IZ6A 1H9SB 2VL6A 1AFPA 2NB0A 4B3RQ 1SYFA 3H3VI 3NELA 5M5YB 4DV2Q 3HP3A 1VMCA 1G91A 3STBD 1VQIA 2SEBD 2VXWA 3HOUH 1TU2B 4DR7Q 2KCMA 2LMCB 1VQGA 1ILPA 1PVOA 1GVPA 2NVTH 1HZ9A 2K50A 1EWHA 2C35B 2UUBL 2ES2A 3A8KE 4HJ8A 2L11A 1P16A 4R8NA 1EYCA 3CRKC 1GJXA 1M8AA 4BBRG 3CCQA 4IALA 1SYGA 2EYLA 2Z0SA 1WCMB 2JYOA 1U4RA 1H9JA 2M2LA 3I73A 5KYIA 2JN4A 1VQJA 2MO0A 1CUKA 2CH4W 4JYAQ 1Q46A 1PTOD 4A3EG 5LMUL 1JMCA 4IPHA 1ENAA 4JPBW 5KNCA 4XQJA 4UY8C 2VZAA 3VR5A 4XT1B 1X9NA 1VS0A 2BCOA 2NVYH 1LT4D 4R4TA 2WP8J 2N49A 4U673 3FPPA 5JPMC 2XVSA 1QNUA 4HMIA 1HA5A 5GAHC 3SVMA 3Q6SA 1V1PA 1AEXA 1X32A 4JI5Q 1QVFA 5I6YA 1PH1A 3UI2A 4K5WA 4RA8A 3RZOH 1EFID 4IFDH 3J80c 4DUYQ 2EXZA 3K6OA 1RD9D 2RF4A 2HD3A 3IKJA 2F0IA 1DM0B 4YCVA 2AQ2B 4Y7NH 3VA7A 1IBMQ 2NWGA 1K9MC 2RDHA 3STBC 2F03A 1DYQA 4DU9A 1WI5A 4A3FG 4L6TB 2HHHL 3T1YL 2ZTEA 1K8AC 2I07B 4HSVA 4JVZA 3PUWA 3F8TA 2IX1A 4DV3Q 1DD2A 2NN6H 1AE2A 3PUVA 1ASZA 3IFDA 1A3VA 1A2TA 1C9OA 1G2SA 3A8JE 1KNEA 1QE6A 2F0HA 3T4AC 2XRSD 4ABNA 1PH5A 1VQLA 2R93H 3U4VA 4X62L 4A3GH 4HAEA 1V1OA 3CC7A 3DUZA 5LMNQ 4TVAB 2E2IH 1KL9A 1E1TA 2HQLA 2F52A 2AUKA 4RH6A 2ALYB 4IZ8A 3CCSA 1VQDA 2OCEA 1TS5A 4DV5L 3FKIH 4LF6Q 5IGCA 5EKLA 3U4ZA 4TQUS 2ZXPA 3GTQB 1ZXTA 1SN8A 2IW3A 2EJGC 3PF4A 4DA2A 4KKTA 5I9PA 2HIXA 2K5DA 4P2CB 2SDFA 1SBBB 3ERQA 1W6KA 2Y0SB 2CVRA 1NCVA 1RIPA 4JI0L 1PFNA 4L5RC 2UXDL 2K1BA 2B2UA 1PTOB 3HS0C 2FHTA 1EEID 4OONA 5C4ZA 1SXTA 4PZ8A 3DEPA 1WTVA 3FKIB 5M3FB 2YTXA 3JC66 2E2DC 5JJLA 1AE3A 2EY1A 3KF8B 4OXPA 4G57A 3EVQA 3I90A 5CBEE 4A3BG 5AJ3L 4WJWA 4LF5Q 1MJCA 5I2YA 2B2UC 4JBJA 4KTAA 4ZYSA 3FVQA 1GOZA 4DK6C 3K58A 3KFUA 4UHVA 3SE0A 3S1QH 2IY5B 1X3QA 2QA4A 3A5ZB 4JI7Q 4IPCA 3UDGA 1I4HA 1HR0L 1PZID 4B3SQ 3M3YH 4BBRB 5C0XG 1II3A 3BVZA 4I7AA 1B8AA 1MHWC 5EPKA 4CDDC 4A3IH 3MVVA 4PMCA 3HOWG 5IP9G 1G8ZD 2JA8B 5G3LF 1IYJB 1SJHD 2NUCA 3BDOA 4RKBA 1R9TH 4OGQC 1U4PA 1PRTD 1F2YA 5C4JB 1EZ6A 3BVMA 4JI2Q 5IWAQ 3S15B 3MXUA 1WD0A 4G4KA 4HN7A 1QNKA 3CW2C 3D3RA 4EQOA 4Y7NB 1RTNA 3E6ZX 1O7IA 4DV6Q 4F7XA 2ZT9C 5HGTA 2VQEQ 2OQKA 4XT3B 1F9RA 3KJOA 1MD2D 3D8GA 3SHLA 1IBLQ 3HZXA 3F1ZA 5I6WA 1VQKA 2NTSA 1GXDC 3M9BA 3HKZG 2ZJQA 5GADC 1Z7TA 3CD6A 2E2HH 5FO8B 4JBKA 1RCVD 2D5DA 1CSPA 3OW2A 3NWSA 1GKHA 2Z9HA 2UXDQ 5COYA 1E1OA 1F2ZA 2JA7G 1XTCD 3IFTA 4BY1B 1I6HB 1ET6A 1UNSA 3I55A 4QY7A 4A3JG 1KDAA 4DR1Q 4I65A 2F0EA 1EOVA 1N34L 5BN3A 2RKSA 1WFQA 2MQHA 5AFWA 1WCMH 4OO1I 2JE6I 5BN5A 1JR0D 5GQOA 1D1KA 3A7AB 3I4MB 2A6HD 2RSOA 4N9TA 1LT5D 1DONA 2HT1A 1FR3A 1OXXK 5KNBA 1IKMA 1Q8KA 1BCPD 1SR3A 2NVTB 3URYA 5FJ8G 3BS1A 3I70A 5D65A 1XX8A 2E74C 3F2UA 4GKJL 3ND9A 3J80i 2DY8A 2ZTDA 2A6EC 3VR2A 1U4MA 3NBHA 3B6YA 3GQBA 3HOVB 4DV7Q 1R9TB 3G6JB 3VYUA 4NP5A 3A55A 1JWSD 3NPPA 4NXML 3CQZH 2JA8H 1L1OB 4ZUIA 3VDYA 2R7ZH 4NKLA 1SDFA 2PI2A 5D3IB 3AFPA 3MEHA 1EQTA 4NB3A 1OXVA 1LYLA 3VYSA 2I5LX 2KHIA 3BZKA 4OHJA 4DV1L 4IUQA 1LTGD 2OF1A 3T1YQ 2C5CA 4LF7Q 3OIPA 1SYEA 4ZK9B 1UE5A 4HEDA 5FO9B 1LTRD 3HKSA 4N8FA 1DJRD 4QIWB 4XQQA 2EJFC 4ZRZA 1EU4A 3CF5A 1F77A 4K6LA 1CTMA 5JOBA 5IP7G 1KLGD 3J80E 2K05A 4ZQ3A 1CSQA 1PH8A 4C3JB 3CCRA 1S72A 2VUMH 4A75A 2KEDA 1H9RA 2K32A 5E7NA 1YJWA 1PTOH 2D0PA 1OTCA 3L3OC 2F3IA 1WTPA 5KNDA 3AU7A 5G3LD 4TKOB 1D8LA 1EIHA 2I5HA 2L55A 3EROA 4QL5A 3HOUG 1LTTD 4K2LA 1EUJA 2CHBD 1KABA 1TWHH 1Q81C 4P73A 5GAGC 2QKIC 3ZJYC 1GHKA 4M1UB 1Y14B 3PUYA 4J6HA 5ISRA 1MIUA 4S3SA 2JJQA 2O4XA 2K5QA 2B39A 1A2UA 4LAAA 5CV4A 4Q0FA 1W3SA 1DOKA 5CORA 2QILA 4QMGA 3CMAA 5M3MG 2HCCA 4A3GB 5E3FA 3DWQA 1EQVA 4A93G 4K5VA 4EQPA 5ELDA 4DN4M 4DV7L 2R93B 4HCEA 3M4PA 2D9UA 2L4NA 5IP7H 3TN2A 3V96A 1WYDA 3MTSA 3FRPB 3S17B 5M9OA 5JVG3 2VUMG 3H91A 1KAWA 4X66L 1HTLD 2ENBA 1E0BA 2MJ8A 4B3TL 1SE4A 4C3IG 2JEBI 3ICEA 3FKIG 4KKUA 4ILWA 5IOCA 1H9SA 3J7ZC 5ELCA 2R3ZA 1KDBA 4J1MA 3I4OA 2DNCA 5JVH3 1FJGQ 3H6MA 4K0KQ 1OXTA 4RMFA 1T5EA 3P1HA 4A4IA 1B9MA 3H0GB 4JI7L 1HZCA 3OOCA 5DM73 1MJEA 5EKKA 3M4OH 1VCIA 2EYOA 3NSWA 2N88A 3NTKA 3H09A 5IE8A 4A3MG 3KLSA 2HIVA 3NHHA 3BG3A 3RZOB 1YEZA 5F2DA 1CQVA 2K14A 5C5MA 1B3QA 4C1NI 1YHAA 1IW7C 5IYCH 1WD1A 1YNNC 4LNQA 2K04A 5FLMH 5C4XH 3MHBA 5C44B 4BBSH 1TXYA 3RUZA 4CJ1B 3DLLA 1LLRD 2NVYB 4CKCA 5IT9c 3BYTB 2F0KA 1QVCA 1SNCA 3S16B 2Q2TA 5FLXE 4DXGA 1CFMA 5FOBB 3U50C 5IWAL 4JI2L 3SR1A 2KHJA 3GV6A 2AQ1B 1EY7A 1NY4A 1AZPA 4QUCA 4RG1A 2NVXB 4AYBG 5IODA 4A3JH 1STEA 1N32Q 1JOQA 2PNHA 5IYDH 1QWYA 1ZYRC 3JAME 1PRTB 2A6HC 4AH6A 3K5OA 3X3NA 3IL8A 3FPUB 1JWMD 2BDNA 1HJPA 3NWTA 3NBHB 2UUCQ 1HUNA 3KBGA 1FVIA 4RHSA 2LXKA 1STBA 2RHSB 1E3PA 3H94A 3AYHB 3S9WA 4A3FB 1N9WA 1HZAA 3CCLA 4DR5L 4DR1L 1QB5D 5IGEA 1NJIC 2A8VA 4GN4B 2KQ3A 1WTWA 5I9OA 4V190 4GKKL 2ATWA 4FXGC 1UE7A 4GLAC 4K2KA 3H3VC 4NMZA 4JI8Q 1EWCA 1E7ZA 4HIKA 2R7ZG 1KNAA 4CKBA 4JBWA 4H44C 1PFMA 4LFBL 4GNXC 4LF8L 4KMUC 4KN4C 1HNZL 3A54A 1TIID 4DKAC 3CCMA 1DXMA 3MEFA 3K5LA 2N78A 2F0GA 4IUPA 1XNRQ 4LJZC 2Q2HA 1HHVA 3M7NA 3DHQA 2QDLA 3E0EA 4DR5Q 4ME5A 5ELOA 1PFBA 4A3EB 5M5WH 1G291 2YU9H 1SE8A 1UEAB 1EYGA 4H7BA 1NMFA 3G71A 1V8QA 3O13A 3BYYB 4LK1C 5DNFA 1T5XD 5GROA 4O2DA 4QUFA 1HR0W 1I4XA 5IP9H 4H0LC 1TWAH 5HY6A 4A3DB 4H02A 5M5XB 3E0JA 4LMQD 1HTPA 2HDLA 3GDEA 4DNTB 3PIPA 4KD4A 1KIXA 5EBCA 1CI3M 2K5WA 4R4QA 3TP7A 3S2DH 5CV6A 3EJIA 1K0SA 1VDZA 2LS01 2I46A 5FLXc 4LF4Q 3K7AH 1EOTA 5K5PA 3CKIB 2GN5A 4FYDA 2EYMA 3PV0A 1K3RA 3TZDA 1QVGA 1JOKA 3OTOQ 4C3HB 1SNQA 3BVGA 1K83H 4Q5VA 4NDXA 1BCPF 1QJOA 2IJ0A 4DV6L 5DEHA 2HCIA 5ELEA 2SNSA 3PUZA 4K8JA 2R7FA 3HKZE 4JI3L 4DF7A 2WB1E 5C3EG 5A35A 4EQ5A 2VQFQ 2R93G 2VB2X 3A7LA 5CV8A 2DY7A 1S5CD 1WVLA 1J9OA 4GN3B 4JBMA 2WV6D 3TRZA 4O1NA 2XNAC 3GTMH 1TR5A 1A0IA 1FJGL 3EQLC 1VQNA 5C0XH 1RODA 3N6RA 5JPNC 3ULPA 2IT1A 2Z6KC 3TMEA 1HR0Q 2BH2A 2WAQB 1STNA 1PYWD 2UUAL 4ZAIA 1YVCA 2B2VA 1XJVA 4PZ6A 4OIKA 4X66Q 1LT6D 2DJFC 5I2XA 2GA4B 4L5QA 3TBIB 3I7FA 4CJ0B 4BA1I 2EVBA 1X3EA 3D4RA 2F4VL 1QCBD 3D6CA 2Q8IB 1BUVT 4KKSA 3D4DA 1KRTA 4FF4A 2WINB 2X69A 2YTYA 1BBUA 1LO5D 2IHEA 3P7JA 4MTKA 1VMPA 2IPKD 2SOBA 1BCPC 3PO2H 3RD4A 4HIMA 2Z4HA 2F4IA 2PW7A 1ENCA 1VQ5A 4EQNA 4DNIA 4A3BH 2O5IC 1GUSA 4R1JA 3E9HA 1JCKB 1JC7A 2B2WC 2RCNA 1EY9A 2V4DA 2YU9B 1CM9A 4X3TA 2F4VQ 1EY8A 1JWUD 2X6GA 4JV5Q 1GUWA 2PQAB 2YV5A 1SLJA 4KJOA 1SRUA 2AWNA 5IGGA 4CJ2C 2B2YC 2UXCQ 3R2TA 3RN2A 3M4YA 4J15A 3LNNA 2RVLA 1VQ8A 2FINB 3HOZB 4X6AH 5M3FG 2HUGA 1EQQA 1UE6A 1TWCH 4P72A 3HOYG 1N32L 4NPSA 1ML0D 1PH7A 4IUUA 4B9WA 3X3MA 3JAMi 4FF2A 3PO3H 2VQFL 2OEOA 2Y0SG 2JA5G 1X3FA 4CKEA 1K0RA 1DOMA 2FJ2A 1D5ZC 3W3AA 1SMXA 2KCTA 1X56A 4U68A 1XPOA 4BS9A 4CDCC 2BOSA 2RDGA 4R4CA 1G6ZA 2PI2E 1TS2A 1D5MC 1CA5A 3K0XA 4DR3L 4GOPA 4ZKBB 1NR2A 1S4ZA 1VQOA 4XYQA 4A3CG 2F0SA 2JQOA 3MXGA 4A3JB 2KA7A 2PMZB 2PZWA 4KV6A 1C0AA 4GKJQ 1Z47A 1HPCA 1HFNA 1X6OA 3RMHA 2VB3X 4H13C 1PH3A 3OW7A 2PNRC 2VY3A 4FP5D 4DV2L 3FHWA 1MSHA 4JI6L 2B29A 3S16H 5BN4A 1PV4A 4B3RL 3OHXC 1I5FA 1IBKL 2EY2A 1STAA 3BDLA 1D2BA 5JEAG 1E2WA 5LL6S 4JG2A 4HIOA 4ZUJA 1XWEA 5D3DA 2UXCL 3SK5A 4DK0A 4BY7G 2F0UA 4YCWA 4LF5L 1BXTA 1JORA 4RGNA 1PLFA 2F1MA 4JCVE 1LACA 1HQMC 1Y8OB 1YBYA 3S1MB 4X3KA 4A3DG 1ASYA 1FGBD 2R6GA 4C56C 3L9AX 2WAQE 1AP0A 1K8OA 1F9QA 3UE0A 5H1SE 3UE1A 1NUCA 4L8JA 1TWGB 3TP6A 3Q22A 4CBVA 4YWKA 1VQHA 2F0NA 3BDCA 4IUNA 3S24A 1BCPB 4LFCQ 5EQ0A 2EYFA 2JA6H 1W6JA 2H1EA 1CK1A 2ASBA 1EY4A 1SAPA 2KJXA 1NMGA 5C44G 4FF1A 1Q8IA 3CPFA 1KTKA 4MN3A 3TP8A 3M85A 1VQ9A 4QQBX 2DUDA 3KF6A 4FDBA 2QDBA 4DV0L 2MP1A 2B2YA 4MZ9A 3RLOA 2F0WA 3OYYA 4C3HH 2CW0D 3GO5A 2TMPA 2D62A 4DAYA 3J81E 4OIJA 1IBKQ 1U4LA 1Q1EA 4P75A 3RZDB 3PO3B 4PMBA 1LABA 2FFKB 4WJ4A 3K7AB 2PW5A 5EKIA 2CCZA 4IO9A 4NXNL 1BO0A 1TWHB 3S2DB 1D6EC 3ITPA 4KY6A 1YITA 3K59A 3FEWX 1XTDA 2E8GA 3BZCA 1BR9A 1EY0A 5LL6X 5IT9E 1H95A 4HMJA 1BBWA 1TWAB 1EZ8A 3HOXB 3SK4A 4C3IB 3BZDB 3CP0A 4J8QA 3C2PA 1UE1A 1LV9A 4XIGS 2VUMB 4UDUC 1NAPA 1Q12A 4C3JH 3KBXA 4UAIA 1I3QH 4LF9L 1C4QA 1A62A 3Q0AA 2CWAA 3GD7A 1ICWA 2A69C 2B8GA 3LWUA 3UDIA 5HURA 4A3EH 3UDFA 2KCNA 4QB4A 2F3VA 3J81L 3PF5A 2K6AA 5EJWA 4AYBB 1KAAA 2OT2A 1AN8A 1I94L 4XQNA 2CFMA 3G6EA 1NBWA 1NR4A 2BDOA 2A68D 2JA6G 3DM3A 2NZHA 4N9PA 1XMOL 4B9XA 3SEBA 3KLWA 1IW7D 1N36L 1HQRD 5I4DA 3NTHA 4OWTB 1PMRA 3WDNA 4NW2A 2PPBC 4JW0A 4YWMA 2B63H 3PIP3 2KECA 5C4HA 3CQZB 3NTIA 4L5TA 3TSSA 4V0BA 3P20A 2IL8A 3AFQA 4C1NK 1KDCA 1DGSA 1XNRL 4YCUA 4A3MH 4MHEA 2NN6I 4DK1A 3H0GG 3CRLC 1M4VA 1JT8A 2NBFA 1S5ED 3W2DA 1HH2P 1HRJA 2EY6A 3I4MH 2E2JB 2HHHQ 2KHSA 1CHPD 3HOZG 2ZJRA 2JA7H 2NVXH 4KJNA 4IJHA 2VQEL 2GVBA 3GTGH 2EDGA 4BXXG 4EX5A 4KD3A 5KGUA 1I6HH 1FNWA 2OTJA 1B4OA 1YHBA 3LGJA 5C0XJ 1WCMG 5C44H 4X3SA 4A93B 1SFOB 2NTTA 5M3MB 4XYOA 4DGZA 2E2HB 3CHBD 1LUZA 1PFSA 1TS4A 2A69D 1EL0A 1XYIA 1Z6HA 4R4OA 3DXJC 1Y1VG 1B9NA 1ESRA 1S5FD 2X6LA 2Z8LA 4QF4A 4CGYB 3CCJA 1CA6A 2JEAI 1I94Q 2A5HA 4KK7A 2PYKA 3VYTA 2RHQB 4OO1H 3H0GH 4BY7B 4JI1Q 4FXKC 3A56A 2PZTA 3GTPB 1IL2A 4LF7L 2WKDA 2AQ3B 4POFA 4DAYB 3CU7A 3ONAB 1ILQA 1UEBA 1E22A 3V2TA 3PQIA 4A3IB 4FF3A 1WTRA 5DAUA 3PGZA 3CXCA 4PV1C 5E1FA 3CPWA 2L12A 5CV7A 4C3JG 3S17H 4RHRA 4BBRH 1WJJA 4K8IA 3EBEA 1YNJC 3OIQA 1I4RA 5IYBH 4B08A 1VF5C 2F0FA 3PIOA 3S1QB 4OWWB 1EY5A 4G7HC 1V1QA 5EGTA 4A76A 1F9SA 4RCOA 5LMNW 4MTNA 1HZBA 1G51A 1SNPA 4YY3Q 5K36G 1E2ZA 2UUAQ 3C46A 5E4XA 1HFGA 2AMCB 2XWBB 1GUNA 3I91A 3S14B 1C8CA 3MXPA 4C3HG 2NYZD 2Q8TA 4AQYL 2OQ0A 3HFZB 1O78A 3S1NH 5JAVA 4FO2A 3D0FA 3KDFB 3S2HH 1Z9FA 1ONLA 2JA5B 4R8IA 3EN2A 3HOVG 2XGTA 3C1EA 3C3LA 2JA5H 3U9SA 4GZYC 4OELB 3S2HB 1SNDA 1C7YA 1LTID 1YHQA 3RR5A 2JA8G 2R7DA 2MPMA 1CKOA 4WFN3 2OWOA 4QGUA 4LFBQ 1SMYC 1QZGA 4DR2L 1GD7A 1KXLA 1CHQD 3AEVA 3QG1A 2LFNA 1IHZA 1ZKOA 4KHZA 1IBLL 2E2IB 5J1ZA 1G6PA 3Q23A 4JK1C 3M4QA 1EQRA 1FNUA 4GS3A 1XMQQ 4A3LH 4Y52H 1O7ZA 3K80C 1JB3A 2CH4A 1PZKD 1W2BA 1A3UA 2A68C 3KLSX 3I4LA 1M1KC 1K73C 3RLFA 4IN3A 3DWAA 4LUOA 4HTHA 4F88A 2O2LD 3DEOA 1NSNS 3NP8A 2Q8RE 4B3SL 2L9HA 2R7ZB 1B3AA 5JEAH 3JAMc 4K5XA 1B44D 1MBYA 1R4QB 5CR3A 4QIWE 3HOVH 4LW1A 5CBAE 3GTPH 1F2MA 2ICIA 1F9PA 1GUOA 4IPGA 1CZGA 1PTOF 1N33L 1SJED 3K0YA 4BY7H 2L15A 3J7AF 1PRTC 2L0CA 3WWVA 1ET9A 1D5XC 3OWFA 4F8MA 4B3ML 4JI4Q 3AQQA 2IWHA 3NQTA 4ZKCB 1T9HA 2EY5A 1D1IA 3IRBA 2XTIA 5LHY1 2UXBQ 1S5DD 5FLMG 4BBSG 3JAML 3HOWB 2H4OA 2KENA 2CWPA 3BU2A 1STYA 4DXFA 3R3OA 3R2IA 4JC0A 5M3MH 2PO4A 4A3CH 3A8IE 1SFOH 4A93H 1RJTA 1VQ7A 3KDFA 2P5ZX 1VQFA 3H3VH 1U5KA 4CDEC 3WOFA 4BY1H 2EYHA 2IX0A 1ENFA 5C5LA 2MO1A 3CCVA 1K28A 2A73B 5BR8Q 4PZ7A 5HGQA 3FDTA 1TVXA 1O7LA 1UUPA 1L1OA 3CC4A 4LF6L 1NE3A 3HOWH 4X65L 3NK9A 3SGIA 3F2BA 5ELNA 1FD7D 2J4XA 4TRDA 2EIFA 2GVAA 2F0OA 2M00A 3K7UC 4K14A 4O42A 5LMNL 1JE4A 1GM5A 4UP8A 4BWGB 1QILA 3T1HL 5T1GA 5JJIA 2UU9Q 4JI6Q 4PG3A 3WOEA 4A3MB 3S15H 5C6AA 1J5EL 2L1BA 5C4JH 3KYHC 3A74A 1H9KA 4UPAA 3M7GA 5M5YH 1JQYD 5EAYA 2K28A 3K57A 1PDQA 4RGTA 2PQAA 2A6ED 3L7ZC 3CC2A 4LF9Q 1OXUA 4UP7A 2KUMA 3MFYA 4XTCS 1L0YB 2HDMA 3EIVA 4DAPA 3M3YB 4DR6Q 2V1CC 1K8GA 3QR8A 3NE5B 5FO7B 3S1RH 1P8LA 1MKHA 2F0MA 1EIFA 1VQMA 3ER0A 4I7ZC 4NXNQ 5E4WC 1PH6A 3SXHA 1EU3A 1B70B 1X3GA 2KBNA 2CKZB 3K5MA 2A74C 2Z6BA 3RLNA 2YYZA 2MNAA 2AKWB 4A3KG 5M3FH 1I3QB 3MXNA 4WRDA 3PSIA 5EBDA 1X54A 1NTGA 2Y0SE 3FMCA 5K36H 4RFBA 1S40A 3SK6A 3NUCA 4C3IH 1KRSA 1E24A 4DR4L 4FVMA 3CMEA 2BH8A 3L0OA 1WTHA 1JJCB 4IJLA 1TS3A 2Q2UA 4OO1G 1KQSA 3NENA 1PRTF 1TT2A 3S1NB 4RAUC 1V9PA 1FL0A 2C9OA 4HJ7A 1SMYD 2VS1A 2E75C 3GTQH 3J7AV 3S14H 1SNOA 2PZUA 2CW0C 3J80L 3ULJA 1QZHA 1LTLA 1SNMA 1HNXQ 5IIFA 1SYCA 1AH9A 2UUBQ 1NNXA 2UXBL 1MI2A 4JOIA 3RNUA 4RCNA 5IYCG 5J3BA 4GOPC 3T53B 4IFDI 5CV9A 1L2FA 4L63B 4DFAA 1J5EQ 2F0VA 2MGSA 1TWFH 2JK8A 1QUQA 4IUTA 2XWJB 3L2PA 1YZ6A 4CHTB 5IYDG 3GTOB 4IQZA 1TWGH 1I4QA 3EA6A 2BA1A 3QOLA 1A63A 5CC4A 1B2TA 4LUZA 1L0XB 4N8X1 2LXJA 1XPRA 2NZOA 2BE5D 1K8MA 1WTXA 1Y1VH 3KLRA 3I8ZA 1Y8NB 3HOYH 3OPOA 4X65Q 3S1MH 1WOCA 1N36Q 1I4PA 3VR3A 4OX9L 4IFDG 3N52A 4DNRB 1CKNA 3T13A 2EE1A 4ID6A 2K01A 5IGDA 5KRUA 3K81C 2KVMA 3ND8A 2IX3A 4JI3Q 2QEJC 2K5VA 1J8IA 4OEMB 3KK7A 1YNND 2EZVA 3PO2G 4KY7A 4KLKA 2QF7A 4DV3L 4POGA 2BA0A 3W5OA 3CAMA 3PMFA 3UDXA 1TY0A 2ZXRA 2R61A 4TSSA 2B2WA 1STGA 3SK8A 1Y1WH 4DR2Q 2O5JC 4MNOA 4HJAA 1Q3LA 1WTOA 1PYSB 3I72A 2WFWA 2R92G 4P71A 3C1FA 2RBMA 3MXNB 5CGKA 3KOJA 5C3WA 1YNXA 3W1GA 4AIMA 2VW9A 2K33A 3DMUA 1N33Q 2FMCA 3GTGB 5DM63 1SSOA 4JI1L 4DV4L 2N55A 4A3GG 1RTOA 4DR4Q 4APVA 2RCFA 2JA7B 1A6XA 1O80A 3OWEB 3BJUA 2AHOB 1ZEQX 3J81c 1H9MA 4X64Q 2E2JH 3D6WA 3DWPA 1JB7A 1BQQT 2PMZE 2MFIA 1PH4A 4XXEA 1D7QA 2XSCA 3GP7A 1BDOA 1YNJD 4G7ZC 1S3OA 3P75A 4DAMA 4KHVA 2NVQB 1AW7A 3RN5A 3HOUB 4JOIC 2Z6KA 3VYRA 3I2ZA 1M90C 5BR8L 2XN9C 3I4NG 4JV5L 1XXGA 1BBXC 1HNWL 1VQAA 1EWIA 3K8AA 5AJ3Q 2CQAA 5IY0A 2PCFB
chains in the Genus database with same CATH topology
1YHBA 1VS0A 4GKKL 2NVYH 2ATWA 1XPUA 1UE7A 4JYAL 4R4TA 3LGJA 5C0XJ 1WCMG 2WP8J 2N49A 5C44H 4GLAC 2WAQG 3TEHB 5GAHC 1LUZA 4JI8Q 1PFSA 1E7ZA 4R4OA 4HIKA 4JI5Q 2R7ZG 5C4XG 4JI8L 1QVFA 1Y1VG 4JBWA 1N8RC 1PH1A 2ZM6Q 3CCJA 4LFBL 4GNXC 3RZOH 4LF4L 4LF8L 2JEAI 3J80c 4DUYQ 1I94Q 4KI0A 4DKAC 3CCMA 1HNZL 2Q2IA 3MEFA 2RF4A 2N78A 2AWOA 2RHQB 4YCVA 1XNRQ 2Q2HA 4Y7NH 1B7YB 3H0GH 1IBMQ 4JI1Q 3M7NA 3E0EA 4DR5Q 3T1HQ 1HNWL 4A3LG 5ELOA 1K9MC 1HNWQ 3STBC 5M5WH 1G291 2YU9H 1SE8A 1EYGA 1IL2A 1WI5A 4A3FG 4LF7L 1NMFA 3G71A 4POFA 4DAYB 2HHHL 2UUCL 3T1YL 1UEBA 2ZTEA 4HJ5A 1K8AC 3W1BA 1E22A 5GROA 1Q86C 4A3KH 4O2DA 1YJNA 1HR0W 3HOXH 5IP9H 1TWAH 3F8TA 3PGZA 3PUWA 5HY6A 3CXCA 2EXDA 4DV3Q 2IX1A 4H02A 3CPWA 1XNQL 3S17H 4BBRH 1WJJA 1AE2A 3PUVA 3GDEA 1ASZA 3I4NH 1XMOQ 3PIPA 1KIXA 3GTLH 3EBEA 1C9OA 4R4QA 5IYBH 1VQ6A 3S2DH 3PIOA 1VQLA 4DV4Q 1PH5A 2R93H 1PHJA 4OWWB 3U4VA 4X62L 1V1QA 5FLXc 4LF4Q 4LF8Q 3K7AH 1QUQB 4A3GH 1PH2A 2GN5A 3CC7A 4A76A 3RZDH 1XMQL 3F2CA 3PV0A 5LMNW 4MTNA 4TVAB 5LMNQ 2E2IH 1K3RA 1HZBA 1KL9A 1E1TA 1G51A 2HQLA 2F52A 1QVGA 1FGUA 2ALYB 3OTOQ 3CCSA 4YY3Q 5K36G 1VQDA 2OCEA 3A0JA 4DR6L 1K83H 4DV5L 2UUAQ 3FKIH 2AMCB 3D31A 4LF6Q 4DPGA 3U4ZA 4TQUS 2FXQA 4DV6L 3CCUA 2I5MX 2K5HA 1SN8A 4AQYL 2OQ0A 3TS2A 3HFZB 3PF4A 3PUZA 4LFAL 2R7FA 3HKZE 2HIXA 3S1NH 4JI3L 5C3EG 2WB1E 3S2HH 3D0FA 3KDFB 5IYBG 1Q82C 1IBML 1Z9FA 2R92H 4BY1G 3EN2A 4EQ5A 2XGTA 2VQFQ 3HOVG 2R93G 2EQSA 3I56A 2E5LL 2JA5H 4GN3B 4JBMA 1C7YA 3TQYA 4C2MH 3TRZA 1RIPA 4JI0L 1YHQA 3RR5A 1XNQQ 2R7DA 2JA8G 1CKOA 4L5RC 3GTMH 2UXDL 1A0IA 2N8NA 2OWOA 4OONA 1FJGL 4QGUA 1VQNA 4LFBQ 3G4SA 4PMWA 4PZ8A 4DR2L 1QZGA 1GD7A 3ULPA 1EFWA 2IT1A 1KXLA 2Z6KC 2YTXA 1HR0Q 2BH2A 3AEVA 3JC66 4DV5Q 2UUAL 5JJLA 1YVCA 4ALPA 2JA9A 1YI2A 1KC8C 1IBLL 1AE3A 4KHZA 3KF8B 4PZ6A 1XJVA 3HOXG 4OXPA 4X66Q 4GNXB 4A3BG 5AJ3L 1G6PA 4LF5Q 1MJCA 3M4QA 1EQRA 1XMQQ 4GS3A 5LMUQ 4JBJA 4L5QA 4O0AA 1JJ2A 4A3LH 4Y52H 3I7FA 4BA1I 3K80C 4DK6C 3KFUA 3S1QH 2ZTCA 1W2BA 2IY5B 1X3EA 2F4VL 2QA4A 4JYAQ 3H15A 3A5ZB 1KRTA 4GN5A 4JI7Q 4IPCA 1X65A 3UDGA 1M1KC 1K73C 3RLFA 2YTYA 1HR0L 4LUOA 4GLVB 1HNZQ 2OTLA 1BBUA 4B3SQ 3M3YH 5C0XG 2LSSA 2IHEA 5M5XH 1IXRA 1B8AA 3PO2H 4HIMA 2K5NA 4NXMQ 4A3IH 3HOWG 4B3SL 2I0QA 5IP9G 3CCLA 1VQ5A 1IYJB 3JAMc 4DNIA 1BKBA 4A3BH 1R9TH 4QIWE 4R1JA 3HOVH 3E9HA 4LW1A 2F4VQ 2RCNA 3GTPH 4B3MQ 4JI2Q 5IWAQ 4JI4L 4GKKQ 4JV5Q 2D0OA 2PQAB 2YV5A 4IPGA 1N33L 1SLJA 3CW2C 1SRUA 4BY7H 2L15A 2AWNA 2A1AA 3WWVA 1O7IA 2UXCQ 4DV6Q 4B3ML 4JI4Q 3RN2A 1I50H 3AQQA 2VQEQ 2OQKA 4J15A 1T9HA 4R4IA 3KJOA 1J6QA 3IRBA 3PUXA 1A8VA 1IBLQ 1VQ8A 4BA2I 4X6AH 2XTIA 3F1ZA 3A5UA 1VQKA 3M9BA 2UXBQ 5FLMG 4BBSG 3HKZG 5M3FG 5GADC 2ZJQA 2KENA 4X64L 1EQQA 2CWPA 3BU2A 1UE6A 2IHFA 1TWCH 2K75A 3CD6A 4P72A 2E2HH 4JI5L 3HOYG 4JC0A 1N32L 4NPSA 5M3MH 4IOCA 1PH7A 4JBKA 3GTKH 4A3CH 1SFOH 2DGYA 1CSPA 4A93H 3OW2A 4IOAA 1GKHA 1VQ7A 2UXDQ 2E5LQ 3JAMi 3KDFA 1VQ4A 1E1OA 1VQFA 3H3VH 1U5KA 2JA7G 3PO3H 2VQFL 2Y0SG 2JA5G 1X3FA 2IX0A 4BY1H 1K0RA 3G48A 3I55A 4QY7A 4A3JG 2MO1A 4IPDA 3CCVA 1SMXA 2KCTA 1X56A 5BR8Q 4DR1Q 4PZ7A 4A3FH 5HGQA 1PA6A 2NVQH 1EOVA 1XPOA 1N34L 1L1OA 1LM0A 1WFQA 3CC4A 2MQHA 3F2DA 5GAEC 4LF6L 4R4CA 1WCMH 1NE3A 2JE6I 3HOWH 2PI2E 4OO1I 4P74A 4X65L 1Q7YC 4DR3Q 3SGIA 5GQOA 3F2BA 5ELNA 3HOZH 2EIFA 3K0XA 4BXXG 2GVAA 4DR3L 4GOPA 1VQOA 3K7UC 5LMNL 4A3CG 2K52A 2ID0A 2JQOA 1GM5A 4UP8A 2HT1A 4BXXH 1OXXK 1VQPA 4KHPQ 1Q8KA 1V43A 1SR3A 3T1HL 5FJ8G 2A19A 3TREA 1PYBA 2UU9Q 5JJIA 1PH3A 4PG3A 4JI6Q 4GKJL 3J80i 3J81i 2ZTDA 1C0AA 3S15H 4GKJQ 1Z47A 4YWLA 2K4KA 1J5EL 4K0KL 5C4JH 1X6OA 3B6YA 3A74A 3KYHC 3Q8DA 4UPAA 2VY3A 4LUVA 5M5YH 3KJPA 3FHWA 3FP9A 5EAYA 4DV2L 2B29A 4DV7Q 1KD1C 1YIJA 1PV4A 4JI6L 3S16H 2PQAA 3L7ZC 3CC2A 4LF9Q 3CQZH 4NXML 2JA8H 4B3RL 1L1OB 3VDYA 2R7ZH 1I5FA 1OXUA 1IBKL 4OX9Q 4UP7A 1U0LA 3GTJH 2PI2A 4B3TQ 3AFPA 4XTCS 2WB1G 2B63G 3EIVA 4DUZQ 4NB3A 4A3IG 1BVSA 1OXVA 4GOPB 1LYLA 4DR6Q 2I5LX 2V1CC 2KHIA 3BZKA 5JEAG 4YHHL 4DV1L 4DV0Q 1K8GA 4IFDJ 4JG2A 3T1YQ 1KHIA 4DK3C 4HIOA 1YJ9A 4LF7Q 3S1RH 1P8LA 2UXCL 1MKHA 1UE5A 4BY7G 1VQMA 1EIFA 3ER0A 3HKSA 4YCWA 1PH9A 4LF5L 4NXNQ 1PH6A 4X62Q 1B70B 1Q1BA 1X3GA 2KBNA 4LFCL 1VQBA 3CF5A 2CKZB 5IP7G 2ZM6L 1VQEA 4JCVE 3RLNA 2YYZA 2MNAA 2AKWB 4A3KG 1CSQA 1YBYA 5M3FH 1PH8A 1HNXL 3CCRA 1S72A 3PSIA 2VUMH 4A75A 1X54A 2R6GA 1ASYA 3J7A5 4A3DG 1NTGA 2NN6G 2Y0SE 1YJWA 5E7NA 2WAQE 1S40A 4JI0Q 2D0PA 4C3IH 1OTCA 3UE0A 4GLXA 5H1SE 1KRSA 2F3IA 1E24A 3UE1A 4DR4L 3CMEA 2BH8A 1VQCA 3L0OA 3GTOH 1JJCB 4IJLA 1D8LA 4YWKA 1VQHA 2Q2UA 2I5HA 3S24A 4LFCQ 4OO1G 1KQSA 3HOUG 3NENA 4QL5A 2JA6H 1EUJA 1TWHH 1V9PA 4HJ9A 1Q81C 4P73A 2ASBA 1FL0A 5GAGC 4WJ3M 2ZJPA 1NMGA 5C44G 3ZJYC 4HJ7A 4YHHQ 1Y14B 3CPFA 2VS1A 3PCOB 3PUYA 3M85A 3U58A 1VQ9A 3E9IA 1MIUA 2DUDA 3KF6A 3GTQH 4FDBA 3S14H 2JJQA 4QQBX 4DV0L 4MZ9A 3RLOA 3ULJA 1QZHA 1LTLA 2QEXA 4DUZL 3OYYA 2CQOA 4C3HH 1HNXQ 3GO5A 3J81j 1AH9A 1W3SA 2D62A 2UUBQ 2QGQA 2UXBL 4JOIA 3RNUA 1IBKQ 1OXSC 1JE5A 1Q1EA 4P75A 5JEAJ 4AYBE 5M3MG 5IYCG 3CMAA 4L5SA 5C0XI 4WJ4A 1JJGA 5J3BA 4A93G 1GO3E 5FJ8H 4GOPC 2CCZA 4DV7L 4IO9A 4NXNL 4IFDI 1L2FA 3M4PA 3PO3G 1J5EQ 4GNXA 1TWFH 4LFAQ 5IP7H 2JK8A 1QUQA 1WYDA 1CKMA 3TS0A 3L2PA 1YZ6A 1YITA 5IYDG 4KHPL 3CCEA 1L1OC 1XTDA 1TWGH 4DV1Q 2BA1A 2E8GA 3BZCA 1SROA 1RL2A 1A63A 5DLQE 4ME3A 5JJKA 3ERSX 2VUMG 4LUZA 4A3DH 3ULLA 1KAWA 1BBWA 2LXJA 4X66L 3I4MG 1H95A 2B3GA 3KF6B 1XPRA 3CP0A 4B3TL 2H5XA 2NZOA 3OTOL 2JEBI 1UE1A 1Y1VH 4XIGS 3ICEA 3HOYH 3FKIG 4X65Q 1Q12A 4C3JH 4LF9L 3J7ZC 1I3QH 3S1MH 1A62A 1WOCA 2CWAA 3GD7A 3I4OA 3UDIA 1Y1WG 1N36Q 4OX9L 4IFDG 1FJGQ 4A3EH 1X55A 1CKNA 3NEMA 3UDFA 4K0KQ 1OXTA 4RMFA 2VNUD 3PF5A 4A4IA 3K81C 4LWCA 5C3EH 2N3SA 4JI7L 1HZCA 1MJEA 1L0WA 4DR7L 2UU9L 3M4OH 4DUYL 1VCIA 1I94L 1UWVA 4JI3Q 5IE8A 4A3MG 2HIVA 2K5VA 1EIYB 2CFMA 3G6EA 1NBWA 4AQYQ 2JA6G 3DM3A 2NZHA 1YEZA 4OWXB 1XMOL 3PO2G 3KLWA 4KLKA 2K14A 1N36L 2YTVA 4DV3L 4POGA 4OWTB 2BA0A 1CKNB 4UP9A 1YHAA 3W5OA 3CAMA 5IYCH 3UDXA 4HIDA 4QJFA 4YWMA 4LNQA 2B63H 1Y1WH 4YY3L 5FLMH 1IZ6A 5C4XH 4DR2Q 1N34Q 1TXYA 4MNOA 4HJAA 4BBSH 2VL6A 3DLLA 5IT9c 1QVCA 4L5TA 1PYSB 2WFWA 2Q2TA 2R92G 4P71A 4B3RQ 3AFQA 3H3VI 3NELA 3MXNB 3KOJA 3U50C 5IWAL 4DV2Q 1YNXA 3W1GA 4AIMA 4JI2L 1DGSA 2VW9A 1XNRL 3STBD 1VQIA 2KHJA 1N33Q 4YCUA 4A3MH 4DV4L 1NY4A 4JI1L 3HOUH 4DR4Q 2NN6I 4A3GG 4DR7Q 4APVA 4RG1A 2KCMA 3H0GG 4AYBG 1VQGA 1PVOA 1GVPA 3BJUA 4A3JH 2NVTH 1JT8A 1N32Q 1HZ9A 2K50A 2C35B 2AHOB 2PNHA 5IYDH 3J81c 2UUBL 2ES2A 1HH2P 4HJ8A 4X64Q 2E2JH 1P16A 4AH6A 1JB7A 2PMZE 2MFIA 1PH4A 1D7QA 3I4MH 4BBRG 3CCQA 1HJPA 2HHHQ 3NBHB 2UUCQ 2Z0SA 3HOZG 1S3OA 2ZJRA 1FVIA 2LXKA 2JA7H 2NVXH 4DAMA 2RHSB 1E3PA 4IJHA 2VQEL 2GVBA 3AYHB 3RN5A 1VQJA 1N9WA 1CUKA 1HZAA 2MO0A 1Q46A 2Z6KA 4JOIC 3I2ZA 4EX5A 4DR5L 4A3EG 5LMUL 1M90C 5BR8L 4DR1L 1JMCA 3I4NG 4JV5L 4IPHA 1VQAA 1EWIA 3K8AA 1NJIC 4UY8C 2VZAA 5AJ3Q 2A8VA 3GTGH 1I6HH 4GN4B 5IY0A 1X9NA 2OTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHB A;  1VS0 A;  4GKK L;  2NVY H;  2ATW A;  1XPU A;  1UE7 A;  4JYA L;  4R4T A;  3LGJ A;  5C0X J;  1WCM G;  2WP8 J;  2N49 A;  5C44 H;  4GLA C;  2WAQ G;  3TEH B;  5GAH C;  1LUZ A;  4JI8 Q;  1PFS A;  1E7Z A;  4R4O A;  4HIK A;  4JI5 Q;  2R7Z G;  5C4X G;  4JI8 L;  1QVF A;  1Y1V G;  4JBW A;  1N8R C;  1PH1 A;  2ZM6 Q;  3CCJ A;  4LFB L;  4GNX C;  3RZO H;  4LF4 L;  4LF8 L;  2JEA I;  3J80 c;  4DUY Q;  1I94 Q;  4KI0 A;  4DKA C;  3CCM A;  1HNZ L;  2Q2I A;  3MEF A;  2RF4 A;  2N78 A;  2AWO A;  2RHQ B;  4YCV A;  1XNR Q;  2Q2H A;  4Y7N H;  1B7Y B;  3H0G H;  1IBM Q;  4JI1 Q;  3M7N A;  3E0E A;  4DR5 Q;  3T1H Q;  1HNW L;  4A3L G;  5ELO A;  1K9M C;  1HNW Q;  3STB C;  5M5W H;  1G29 1;  2YU9 H;  1SE8 A;  1EYG A;  1IL2 A;  1WI5 A;  4A3F G;  4LF7 L;  1NMF A;  3G71 A;  4POF A;  4DAY B;  2HHH L;  2UUC L;  3T1Y L;  1UEB A;  2ZTE A;  4HJ5 A;  1K8A C;  3W1B A;  1E22 A;  5GRO A;  1Q86 C;  4A3K H;  4O2D A;  1YJN A;  1HR0 W;  3HOX H;  5IP9 H;  1TWA H;  3F8T A;  3PGZ A;  3PUW A;  5HY6 A;  3CXC A;  2EXD A;  4DV3 Q;  2IX1 A;  4H02 A;  3CPW A;  1XNQ L;  3S17 H;  4BBR H;  1WJJ A;  1AE2 A;  3PUV A;  3GDE A;  1ASZ A;  3I4N H;  1XMO Q;  3PIP A;  1KIX A;  3GTL H;  3EBE A;  1C9O A;  4R4Q A;  5IYB H;  1VQ6 A;  3S2D H;  3PIO A;  1VQL A;  4DV4 Q;  1PH5 A;  2R93 H;  1PHJ A;  4OWW B;  3U4V A;  4X62 L;  1V1Q A;  5FLX c;  4LF4 Q;  4LF8 Q;  3K7A H;  1QUQ B;  4A3G H;  1PH2 A;  2GN5 A;  3CC7 A;  4A76 A;  3RZD H;  1XMQ L;  3F2C A;  3PV0 A;  5LMN W;  4MTN A;  4TVA B;  5LMN Q;  2E2I H;  1K3R A;  1HZB A;  1KL9 A;  1E1T A;  1G51 A;  2HQL A;  2F52 A;  1QVG A;  1FGU A;  2ALY B;  3OTO Q;  3CCS A;  4YY3 Q;  5K36 G;  1VQD A;  2OCE A;  3A0J A;  4DR6 L;  1K83 H;  4DV5 L;  2UUA Q;  3FKI H;  2AMC B;  3D31 A;  4LF6 Q;  4DPG A;  3U4Z A;  4TQU S;  2FXQ A;  4DV6 L;  3CCU A;  2I5M X;  2K5H A;  1SN8 A;  4AQY L;  2OQ0 A;  3TS2 A;  3HFZ B;  3PF4 A;  3PUZ A;  4LFA L;  2R7F A;  3HKZ E;  2HIX A;  3S1N H;  4JI3 L;  5C3E G;  2WB1 E;  3S2H H;  3D0F A;  3KDF B;  5IYB G;  1Q82 C;  1IBM L;  1Z9F A;  2R92 H;  4BY1 G;  3EN2 A;  4EQ5 A;  2XGT A;  2VQF Q;  3HOV G;  2R93 G;  2EQS A;  3I56 A;  2E5L L;  2JA5 H;  4GN3 B;  4JBM A;  1C7Y A;  3TQY A;  4C2M H;  3TRZ A;  1RIP A;  4JI0 L;  1YHQ A;  3RR5 A;  1XNQ Q;  2R7D A;  2JA8 G;  1CKO A;  4L5R C;  3GTM H;  2UXD L;  1A0I A;  2N8N A;  2OWO A;  4OON A;  1FJG L;  4QGU A;  1VQN A;  4LFB Q;  3G4S A;  4PMW A;  4PZ8 A;  4DR2 L;  1QZG A;  1GD7 A;  3ULP A;  1EFW A;  2IT1 A;  1KXL A;  2Z6K C;  2YTX A;  1HR0 Q;  2BH2 A;  3AEV A;  3JC6 6;  4DV5 Q;  2UUA L;  5JJL A;  1YVC A;  4ALP A;  2JA9 A;  1YI2 A;  1KC8 C;  1IBL L;  1AE3 A;  4KHZ A;  3KF8 B;  4PZ6 A;  1XJV A;  3HOX G;  4OXP A;  4X66 Q;  4GNX B;  4A3B G;  5AJ3 L;  1G6P A;  4LF5 Q;  1MJC A;  3M4Q A;  1EQR A;  1XMQ Q;  4GS3 A;  5LMU Q;  4JBJ A;  4L5Q A;  4O0A A;  1JJ2 A;  4A3L H;  4Y52 H;  3I7F A;  4BA1 I;  3K80 C;  4DK6 C;  3KFU A;  3S1Q H;  2ZTC A;  1W2B A;  2IY5 B;  1X3E A;  2F4V L;  2QA4 A;  4JYA Q;  3H15 A;  3A5Z B;  1KRT A;  4GN5 A;  4JI7 Q;  4IPC A;  1X65 A;  3UDG A;  1M1K C;  1K73 C;  3RLF A;  2YTY A;  1HR0 L;  4LUO A;  4GLV B;  1HNZ Q;  2OTL A;  1BBU A;  4B3S Q;  3M3Y H;  5C0X G;  2LSS A;  2IHE A;  5M5X H;  1IXR A;  1B8A A;  3PO2 H;  4HIM A;  2K5N A;  4NXM Q;  4A3I H;  3HOW G;  4B3S L;  2I0Q A;  5IP9 G;  3CCL A;  1VQ5 A;  1IYJ B;  3JAM c;  4DNI A;  1BKB A;  4A3B H;  1R9T H;  4QIW E;  4R1J A;  3HOV H;  3E9H A;  4LW1 A;  2F4V Q;  2RCN A;  3GTP H;  4B3M Q;  4JI2 Q;  5IWA Q;  4JI4 L;  4GKK Q;  4JV5 Q;  2D0O A;  2PQA B;  2YV5 A;  4IPG A;  1N33 L;  1SLJ A;  3CW2 C;  1SRU A;  4BY7 H;  2L15 A;  2AWN A;  2A1A A;  3WWV A;  1O7I A;  2UXC Q;  4DV6 Q;  4B3M L;  4JI4 Q;  3RN2 A;  1I50 H;  3AQQ A;  2VQE Q;  2OQK A;  4J15 A;  1T9H A;  4R4I A;  3KJO A;  1J6Q A;  3IRB A;  3PUX A;  1A8V A;  1IBL Q;  1VQ8 A;  4BA2 I;  4X6A H;  2XTI A;  3F1Z A;  3A5U A;  1VQK A;  3M9B A;  2UXB Q;  5FLM G;  4BBS G;  3HKZ G;  5M3F G;  5GAD C;  2ZJQ A;  2KEN A;  4X64 L;  1EQQ A;  2CWP A;  3BU2 A;  1UE6 A;  2IHF A;  1TWC H;  2K75 A;  3CD6 A;  4P72 A;  2E2H H;  4JI5 L;  3HOY G;  4JC0 A;  1N32 L;  4NPS A;  5M3M H;  4IOC A;  1PH7 A;  4JBK A;  3GTK H;  4A3C H;  1SFO H;  2DGY A;  1CSP A;  4A93 H;  3OW2 A;  4IOA A;  1GKH A;  1VQ7 A;  2UXD Q;  2E5L Q;  3JAM i;  3KDF A;  1VQ4 A;  1E1O A;  1VQF A;  3H3V H;  1U5K A;  2JA7 G;  3PO3 H;  2VQF L;  2Y0S G;  2JA5 G;  1X3F A;  2IX0 A;  4BY1 H;  1K0R A;  3G48 A;  3I55 A;  4QY7 A;  4A3J G;  2MO1 A;  4IPD A;  3CCV A;  1SMX A;  2KCT A;  1X56 A;  5BR8 Q;  4DR1 Q;  4PZ7 A;  4A3F H;  5HGQ A;  1PA6 A;  2NVQ H;  1EOV A;  1XPO A;  1N34 L;  1L1O A;  1LM0 A;  1WFQ A;  3CC4 A;  2MQH A;  3F2D A;  5GAE C;  4LF6 L;  4R4C A;  1WCM H;  1NE3 A;  2JE6 I;  3HOW H;  2PI2 E;  4OO1 I;  4P74 A;  4X65 L;  1Q7Y C;  4DR3 Q;  3SGI A;  5GQO A;  3F2B A;  5ELN A;  3HOZ H;  2EIF A;  3K0X A;  4BXX G;  2GVA A;  4DR3 L;  4GOP A;  1VQO A;  3K7U C;  5LMN L;  4A3C G;  2K52 A;  2ID0 A;  2JQO A;  1GM5 A;  4UP8 A;  2HT1 A;  4BXX H;  1OXX K;  1VQP A;  4KHP Q;  1Q8K A;  1V43 A;  1SR3 A;  3T1H L;  5FJ8 G;  2A19 A;  3TRE A;  1PYB A;  2UU9 Q;  5JJI A;  1PH3 A;  4PG3 A;  4JI6 Q;  4GKJ L;  3J80 i;  3J81 i;  2ZTD A;  1C0A A;  3S15 H;  4GKJ Q;  1Z47 A;  4YWL A;  2K4K A;  1J5E L;  4K0K L;  5C4J H;  1X6O A;  3B6Y A;  3A74 A;  3KYH C;  3Q8D A;  4UPA A;  2VY3 A;  4LUV A;  5M5Y H;  3KJP A;  3FHW A;  3FP9 A;  5EAY A;  4DV2 L;  2B29 A;  4DV7 Q;  1KD1 C;  1YIJ A;  1PV4 A;  4JI6 L;  3S16 H;  2PQA A;  3L7Z C;  3CC2 A;  4LF9 Q;  3CQZ H;  4NXM L;  2JA8 H;  4B3R L;  1L1O B;  3VDY A;  2R7Z H;  1I5F A;  1OXU A;  1IBK L;  4OX9 Q;  4UP7 A;  1U0L A;  3GTJ H;  2PI2 A;  4B3T Q;  3AFP A;  4XTC S;  2WB1 G;  2B63 G;  3EIV A;  4DUZ Q;  4NB3 A;  4A3I G;  1BVS A;  1OXV A;  4GOP B;  1LYL A;  4DR6 Q;  2I5L X;  2V1C C;  2KHI A;  3BZK A;  5JEA G;  4YHH L;  4DV1 L;  4DV0 Q;  1K8G A;  4IFD J;  4JG2 A;  3T1Y Q;  1KHI A;  4DK3 C;  4HIO A;  1YJ9 A;  4LF7 Q;  3S1R H;  1P8L A;  2UXC L;  1MKH A;  1UE5 A;  4BY7 G;  1VQM A;  1EIF A;  3ER0 A;  3HKS A;  4YCW A;  1PH9 A;  4LF5 L;  4NXN Q;  1PH6 A;  4X62 Q;  1B70 B;  1Q1B A;  1X3G A;  2KBN A;  4LFC L;  1VQB A;  3CF5 A;  2CKZ B;  5IP7 G;  2ZM6 L;  1VQE A;  4JCV E;  3RLN A;  2YYZ A;  2MNA A;  2AKW B;  4A3K G;  1CSQ A;  1YBY A;  5M3F H;  1PH8 A;  1HNX L;  3CCR A;  1S72 A;  3PSI A;  2VUM H;  4A75 A;  1X54 A;  2R6G A;  1ASY A;  3J7A 5;  4A3D G;  1NTG A;  2NN6 G;  2Y0S E;  1YJW A;  5E7N A;  2WAQ E;  1S40 A;  4JI0 Q;  2D0P A;  4C3I H;  1OTC A;  3UE0 A;  4GLX A;  5H1S E;  1KRS A;  2F3I A;  1E24 A;  3UE1 A;  4DR4 L;  3CME A;  2BH8 A;  1VQC A;  3L0O A;  3GTO H;  1JJC B;  4IJL A;  1D8L A;  4YWK A;  1VQH A;  2Q2U A;  2I5H A;  3S24 A;  4LFC Q;  4OO1 G;  1KQS A;  3HOU G;  3NEN A;  4QL5 A;  2JA6 H;  1EUJ A;  1TWH H;  1V9P A;  4HJ9 A;  1Q81 C;  4P73 A;  2ASB A;  1FL0 A;  5GAG C;  4WJ3 M;  2ZJP A;  1NMG A;  5C44 G;  3ZJY C;  4HJ7 A;  4YHH Q;  1Y14 B;  3CPF A;  2VS1 A;  3PCO B;  3PUY A;  3M85 A;  3U58 A;  1VQ9 A;  3E9I A;  1MIU A;  2DUD A;  3KF6 A;  3GTQ H;  4FDB A;  3S14 H;  2JJQ A;  4QQB X;  4DV0 L;  4MZ9 A;  3RLO A;  3ULJ A;  1QZH A;  1LTL A;  2QEX A;  4DUZ L;  3OYY A;  2CQO A;  4C3H H;  1HNX Q;  3GO5 A;  3J81 j;  1AH9 A;  1W3S A;  2D62 A;  2UUB Q;  2QGQ A;  2UXB L;  4JOI A;  3RNU A;  1IBK Q;  1OXS C;  1JE5 A;  1Q1E A;  4P75 A;  5JEA J;  4AYB E;  5M3M G;  5IYC G;  3CMA A;  4L5S A;  5C0X I;  4WJ4 A;  1JJG A;  5J3B A;  4A93 G;  1GO3 E;  5FJ8 H;  4GOP C;  2CCZ A;  4DV7 L;  4IO9 A;  4NXN L;  4IFD I;  1L2F A;  3M4P A;  3PO3 G;  1J5E Q;  4GNX A;  1TWF H;  4LFA Q;  5IP7 H;  2JK8 A;  1QUQ A;  1WYD A;  1CKM A;  3TS0 A;  3L2P A;  1YZ6 A;  1YIT A;  5IYD G;  4KHP L;  3CCE A;  1L1O C;  1XTD A;  1TWG H;  4DV1 Q;  2BA1 A;  2E8G A;  3BZC A;  1SRO A;  1RL2 A;  1A63 A;  5DLQ E;  4ME3 A;  5JJK A;  3ERS X;  2VUM G;  4LUZ A;  4A3D H;  3ULL A;  1KAW A;  1BBW A;  2LXJ A;  4X66 L;  3I4M G;  1H95 A;  2B3G A;  3KF6 B;  1XPR A;  3CP0 A;  4B3T L;  2H5X A;  2NZO A;  3OTO L;  2JEB I;  1UE1 A;  1Y1V H;  4XIG S;  3ICE A;  3HOY H;  3FKI G;  4X65 Q;  1Q12 A;  4C3J H;  4LF9 L;  3J7Z C;  1I3Q H;  3S1M H;  1A62 A;  1WOC A;  2CWA A;  3GD7 A;  3I4O A;  3UDI A;  1Y1W G;  1N36 Q;  4OX9 L;  4IFD G;  1FJG Q;  4A3E H;  1X55 A;  1CKN A;  3NEM A;  3UDF A;  4K0K Q;  1OXT A;  4RMF A;  2VNU D;  3PF5 A;  4A4I A;  3K81 C;  4LWC A;  5C3E H;  2N3S A;  4JI7 L;  1HZC A;  1MJE A;  1L0W A;  4DR7 L;  2UU9 L;  3M4O H;  4DUY L;  1VCI A;  1I94 L;  1UWV A;  4JI3 Q;  5IE8 A;  4A3M G;  2HIV A;  2K5V A;  1EIY B;  2CFM A;  3G6E A;  1NBW A;  4AQY Q;  2JA6 G;  3DM3 A;  2NZH A;  1YEZ A;  4OWX B;  1XMO L;  3PO2 G;  3KLW A;  4KLK A;  2K14 A;  1N36 L;  2YTV A;  4DV3 L;  4POG A;  4OWT B;  2BA0 A;  1CKN B;  4UP9 A;  1YHA A;  3W5O A;  3CAM A;  5IYC H;  3UDX A;  4HID A;  4QJF A;  4YWM A;  4LNQ A;  2B63 H;  1Y1W H;  4YY3 L;  5FLM H;  1IZ6 A;  5C4X H;  4DR2 Q;  1N34 Q;  1TXY A;  4MNO A;  4HJA A;  4BBS H;  2VL6 A;  3DLL A;  5IT9 c;  1QVC A;  4L5T A;  1PYS B;  2WFW A;  2Q2T A;  2R92 G;  4P71 A;  4B3R Q;  3AFQ A;  3H3V I;  3NEL A;  3MXN B;  3KOJ A;  3U50 C;  5IWA L;  4DV2 Q;  1YNX A;  3W1G A;  4AIM A;  4JI2 L;  1DGS A;  2VW9 A;  1XNR L;  3STB D;  1VQI A;  2KHJ A;  1N33 Q;  4YCU A;  4A3M H;  4DV4 L;  1NY4 A;  4JI1 L;  3HOU H;  4DR4 Q;  2NN6 I;  4A3G G;  4DR7 Q;  4APV A;  4RG1 A;  2KCM A;  3H0G G;  4AYB G;  1VQG A;  1PVO A;  1GVP A;  3BJU A;  4A3J H;  2NVT H;  1JT8 A;  1N32 Q;  1HZ9 A;  2K50 A;  2C35 B;  2AHO B;  2PNH A;  5IYD H;  3J81 c;  2UUB L;  2ES2 A;  1HH2 P;  4HJ8 A;  4X64 Q;  2E2J H;  1P16 A;  4AH6 A;  1JB7 A;  2PMZ E;  2MFI A;  1PH4 A;  1D7Q A;  3I4M H;  4BBR G;  3CCQ A;  1HJP A;  2HHH Q;  3NBH B;  2UUC Q;  2Z0S A;  3HOZ G;  1S3O A;  2ZJR A;  1FVI A;  2LXK A;  2JA7 H;  2NVX H;  4DAM A;  2RHS B;  1E3P A;  4IJH A;  2VQE L;  2GVB A;  3AYH B;  3RN5 A;  1VQJ A;  1N9W A;  1CUK A;  1HZA A;  2MO0 A;  1Q46 A;  2Z6K A;  4JOI C;  3I2Z A;  4EX5 A;  4DR5 L;  4A3E G;  5LMU L;  1M90 C;  5BR8 L;  4DR1 L;  1JMC A;  3I4N G;  4JV5 L;  4IPH A;  1VQA A;  1EWI A;  3K8A A;  1NJI C;  4UY8 C;  2VZA A;  5AJ3 Q;  2A8V A;  3GTG H;  1I6H H;  4GN4 B;  5IY0 A;  1X9N A;  2OTJ A; 
#chains in the Genus database with same CATH topology
 1U9R A;  4JYA L;  3MWY W;  1XPU A;  1QG7 A;  5FKA C;  1JOO A;  2WAQ G;  2WB1 B;  2B63 B;  2Z4I A;  3VR6 A;  5CYU A;  3TEH B;  1HCZ A;  1QOH A;  3HRZ C;  5C4X G;  4JI8 L;  5D14 A;  3AMU A;  1EY6 A;  1N8R C;  1CT1 D;  1MGS A;  2ZM6 Q;  2WAC A;  3MFG A;  1RHP A;  4LF4 L;  1V1P B;  3MA2 B;  1DOL A;  4KI0 A;  1X3P A;  2Q2I A;  1I6V C;  5C3X A;  2AWO A;  5KIX A;  1B7Y B;  2B8F A;  5NUC A;  3TDQ A;  5C3E B;  3J7Y W;  3T1H Q;  4A3L G;  1SE3 A;  2K7V A;  5L37 A;  1HNW Q;  1B53 A;  3QJY A;  2SNM A;  4A3B B;  2G5D A;  2UUC L;  5KEE A;  4HJ5 A;  1Y69 U;  3W1B A;  4ZCK A;  1Q86 C;  4A3K H;  1YJN A;  3PO2 B;  3HOX H;  2EXD A;  3KUP A;  2RSN A;  5ELF A;  4EGV A;  1XNQ L;  3OMG A;  1GUG A;  3I4N H;  1XMO Q;  3GTL H;  1O7Y A;  1VQ6 A;  4ODG A;  3KF8 A;  1PZJ D;  4DV4 Q;  1PHJ A;  3ZYY X;  4LF8 Q;  1QUQ B;  1PH2 A;  3RZD H;  1XMQ L;  3F2C A;  3HGB A;  1JIC A;  4M8A A;  2L5T A;  1EYA A;  1FGU A;  2EOT A;  2F0J A;  2J7Z A;  3A0J A;  4DR6 L;  4G7O C;  4PNY A;  3D31 A;  4DPG A;  4DAV A;  3U9O A;  2FXQ A;  2F0D A;  3CCU A;  2I5M X;  2K5H A;  4RKL A;  3R93 A;  3QO2 A;  3TS2 A;  4LFA L;  2JA6 B;  1Q82 C;  1IBM L;  1GUT A;  5IYB G;  2R92 H;  1GHJ A;  4BY1 G;  4Z9C B;  1IYV A;  2EQS A;  2E76 C;  3I56 A;  1C48 A;  2E5L L;  1RDP D;  1A15 A;  2LKV A;  3TQY A;  4C2M H;  1XNQ Q;  1SE2 A;  2BE5 C;  2N8N A;  4MIU A;  2M9V A;  3G4S A;  4HCS A;  4PMW A;  1FYC A;  1EFW A;  2JXM B;  5J39 A;  1K83 B;  1AZQ A;  4DV5 Q;  2MHV A;  4ALP A;  2JA9 A;  1YI2 A;  1KC8 C;  3HOX G;  5JJZ A;  4GNX B;  3GV3 A;  4FNF A;  2J0T D;  2KEE A;  5LMU Q;  1EYD A;  4RGO S;  1JJ2 A;  4O0A A;  1TQO A;  2ZTC A;  1LTS D;  3H15 A;  4GN5 A;  1X65 A;  2DJG C;  2F0T A;  2XRQ D;  2B2T C;  4GLV B;  4HR7 B;  1HNZ Q;  2OTL A;  2LSS A;  5M5X H;  1IXR A;  2EPB A;  4KY5 A;  5IGF A;  3I3C A;  4EVO A;  3GTJ B;  4A3K B;  1ZYR D;  1LTA D;  2K5N A;  4NXM Q;  5KYL A;  2I0Q A;  1R4P B;  1BKB A;  2XIW A;  1DZ1 A;  4K6D A;  2OXP A;  5M5W B;  4B3M Q;  2G9D A;  4JI4 L;  4GKK Q;  2D0O A;  5J22 A;  4FXD A;  1A3T A;  3Q24 A;  2A1A A;  1B50 A;  1I50 H;  4R4I A;  2HQE A;  1IKL A;  1J6Q A;  3PUX A;  4YIJ A;  1A8V A;  2ZXO A;  4BA2 I;  3A5U A;  4X64 L;  3NBI A;  3HG9 A;  2IHF A;  1RKN A;  2K75 A;  1UAP A;  4JI5 L;  4IOC A;  5FLX L;  3GTK H;  2DGY A;  4IOA A;  2E5L Q;  1VQ4 A;  2KCC A;  4XDX A;  1KLU D;  3G48 A;  3TP5 A;  4IPD A;  3MC0 B;  3G7L A;  1HA6 A;  1PA6 A;  4A3F H;  2NVQ H;  1EEF D;  3GTK B;  1LM0 A;  1TWC B;  3F2D A;  5GAE C;  5EPJ A;  4E6I A;  4P74 A;  2F0L A;  1Q7Y C;  2RA4 A;  4DR3 Q;  3HOZ H;  3OSO A;  1OO9 B;  5T1I A;  2K52 A;  2ID0 A;  1TY2 A;  1I50 B;  4BXX H;  1VQP A;  3EFX D;  4R9W A;  4KHP Q;  1V43 A;  3QIA A;  1BOS A;  2A19 A;  3TRE A;  1PYB A;  3E5S A;  3J81 i;  3SDZ A;  4YWL A;  2K4K A;  4K0K L;  1G2T A;  3Q8D A;  1TKW B;  4LUV A;  2ICE C;  2PQE A;  2RDF A;  3FP9 A;  3TZU A;  3KJP A;  3QB3 A;  1KD1 C;  4ZLT F;  1YIJ A;  1EIG A;  5C4X B;  4BBS B;  4OX9 Q;  1Y1W B;  1U0L A;  3GTJ H;  1LTB D;  2EJM A;  4B3T Q;  2LY7 A;  3QOJ A;  2WB1 G;  2B63 G;  4DUZ Q;  4A3I G;  1BVS A;  1CZW A;  2F0Q A;  4GOP B;  1Y8P B;  4YHH L;  4DV0 Q;  2F0P A;  4IFD J;  1KHI A;  4DK3 C;  3E3X A;  1YJ9 A;  3V05 A;  2MUY A;  2Z1C A;  1PH9 A;  1VF7 A;  5A2Q L;  3M4O B;  3NXW A;  3T16 A;  4X62 Q;  1Q1B A;  4LFC L;  1VQB A;  2D2C C;  3NQI A;  4PQX A;  3HEJ A;  2ZM6 L;  1PXU A;  1VQE A;  3D4W A;  2JSO A;  1HUM A;  1HNX L;  1HXY D;  3HOY B;  2B2T A;  3J7A 5;  1Y1V B;  2NN6 G;  4F87 A;  3T56 B;  4JI0 Q;  1BF4 A;  3GTM B;  4WOR A;  2K03 A;  4GLX A;  4KN7 C;  4C2M B;  1SYB A;  1LT3 D;  1VQC A;  3GTO H;  5FK9 C;  1Q90 A;  3VR4 A;  3PIO 3;  1TWF B;  2R92 B;  2EYP A;  4HJ9 A;  4WJ3 M;  3OMC A;  2ZJP A;  1K3B C;  4ULL A;  4CDF C;  2QW7 A;  3LWE A;  4YHH Q;  3PCO B;  5A2Q E;  3U58 A;  3E9I A;  1E2V A;  5CMD A;  1F2L A;  2QEX A;  5EPL A;  4DUZ L;  2CQO A;  5IGB A;  2G9H D;  3MAQ A;  3IAY A;  3J81 j;  4RWS C;  2QGQ A;  1OXS C;  1JE5 A;  5ELB A;  4AYB E;  1RF2 D;  5JEA J;  4L5S A;  2WKC A;  1FNV A;  5C0X I;  3K5N A;  3QWN A;  3T51 B;  1JJG A;  1GO3 E;  5FJ8 H;  3MZ5 A;  1CQF A;  3PO3 G;  4GNX A;  4LFA Q;  3TS0 A;  4HSP A;  1CKM A;  4KHP L;  3GTL B;  3CCE A;  3I4N B;  1L1O C;  3VA5 A;  1PTO C;  4OL7 A;  1BNZ A;  4DV1 Q;  1B1Z A;  2DNE A;  1SRO A;  1ESF A;  1RL2 A;  5DLQ E;  4ME3 A;  5JJK A;  4QCL A;  1ICF B;  3ERS X;  4A3D H;  3DM1 A;  3ULL A;  3I4M G;  2B3G A;  3KF6 B;  3R8B A;  2H5X A;  3OTO L;  2KOL A;  2JP1 A;  2F3W A;  2TSS A;  1STH A;  1MSG A;  1I4G A;  1Y1W G;  1IL8 A;  1X55 A;  3NEM A;  2WII B;  5CV5 A;  3LX0 A;  2B2V C;  2VNU D;  2FMM A;  4LWC A;  4RGM A;  1DCZ A;  5C3E H;  2AUJ D;  2N3S A;  1L0W A;  4DR7 L;  1S5B D;  1IYU A;  2UU9 L;  4DUY L;  3AB9 A;  1UWV A;  1EIY B;  4AQY Q;  3S1R B;  1SEB D;  4OWX B;  1WTQ A;  3HKZ B;  4IUV A;  2NZ1 D;  5TSS A;  2EYJ A;  2DN8 A;  2YTV A;  5IT9 L;  2RQX A;  1CKN B;  4UP9 A;  2QCP X;  4X3U A;  4HID A;  4IUR A;  4QJF A;  1SYD A;  1N34 Q;  4YY3 L;  1IZ6 A;  1H9S B;  2VL6 A;  1AFP A;  2NB0 A;  4B3R Q;  1SYF A;  3H3V I;  3NEL A;  5M5Y B;  4DV2 Q;  3HP3 A;  1VMC A;  1G91 A;  3STB D;  1VQI A;  2SEB D;  2VXW A;  3HOU H;  1TU2 B;  4DR7 Q;  2KCM A;  2LMC B;  1VQG A;  1ILP A;  1PVO A;  1GVP A;  2NVT H;  1HZ9 A;  2K50 A;  1EWH A;  2C35 B;  2UUB L;  2ES2 A;  3A8K E;  4HJ8 A;  2L11 A;  1P16 A;  4R8N A;  1EYC A;  3CRK C;  1GJX A;  1M8A A;  4BBR G;  3CCQ A;  4IAL A;  1SYG A;  2EYL A;  2Z0S A;  1WCM B;  2JYO A;  1U4R A;  1H9J A;  2M2L A;  3I73 A;  5KYI A;  2JN4 A;  1VQJ A;  2MO0 A;  1CUK A;  2CH4 W;  4JYA Q;  1Q46 A;  1PTO D;  4A3E G;  5LMU L;  1JMC A;  4IPH A;  1ENA A;  4JPB W;  5KNC A;  4XQJ A;  4UY8 C;  2VZA A;  3VR5 A;  4XT1 B;  1X9N A;  1VS0 A;  2BCO A;  2NVY H;  1LT4 D;  4R4T A;  2WP8 J;  2N49 A;  4U67 3;  3FPP A;  5JPM C;  2XVS A;  1QNU A;  4HMI A;  1HA5 A;  5GAH C;  3SVM A;  3Q6S A;  1V1P A;  1AEX A;  1X32 A;  4JI5 Q;  1QVF A;  5I6Y A;  1PH1 A;  3UI2 A;  4K5W A;  4RA8 A;  3RZO H;  1EFI D;  4IFD H;  3J80 c;  4DUY Q;  2EXZ A;  3K6O A;  1RD9 D;  2RF4 A;  2HD3 A;  3IKJ A;  2F0I A;  1DM0 B;  4YCV A;  2AQ2 B;  4Y7N H;  3VA7 A;  1IBM Q;  2NWG A;  1K9M C;  2RDH A;  3STB C;  2F03 A;  1DYQ A;  4DU9 A;  1WI5 A;  4A3F G;  4L6T B;  2HHH L;  3T1Y L;  2ZTE A;  1K8A C;  2I07 B;  4HSV A;  4JVZ A;  3PUW A;  3F8T A;  2IX1 A;  4DV3 Q;  1DD2 A;  2NN6 H;  1AE2 A;  3PUV A;  1ASZ A;  3IFD A;  1A3V A;  1A2T A;  1C9O A;  1G2S A;  3A8J E;  1KNE A;  1QE6 A;  2F0H A;  3T4A C;  2XRS D;  4ABN A;  1PH5 A;  1VQL A;  2R93 H;  3U4V A;  4X62 L;  4A3G H;  4HAE A;  1V1O A;  3CC7 A;  3DUZ A;  5LMN Q;  4TVA B;  2E2I H;  1KL9 A;  1E1T A;  2HQL A;  2F52 A;  2AUK A;  4RH6 A;  2ALY B;  4IZ8 A;  3CCS A;  1VQD A;  2OCE A;  1TS5 A;  4DV5 L;  3FKI H;  4LF6 Q;  5IGC A;  5EKL A;  3U4Z A;  4TQU S;  2ZXP A;  3GTQ B;  1ZXT A;  1SN8 A;  2IW3 A;  2EJG C;  3PF4 A;  4DA2 A;  4KKT A;  5I9P A;  2HIX A;  2K5D A;  4P2C B;  2SDF A;  1SBB B;  3ERQ A;  1W6K A;  2Y0S B;  2CVR A;  1NCV A;  1RIP A;  4JI0 L;  1PFN A;  4L5R C;  2UXD L;  2K1B A;  2B2U A;  1PTO B;  3HS0 C;  2FHT A;  1EEI D;  4OON A;  5C4Z A;  1SXT A;  4PZ8 A;  3DEP A;  1WTV A;  3FKI B;  5M3F B;  2YTX A;  3JC6 6;  2E2D C;  5JJL A;  1AE3 A;  2EY1 A;  3KF8 B;  4OXP A;  4G57 A;  3EVQ A;  3I90 A;  5CBE E;  4A3B G;  5AJ3 L;  4WJW A;  4LF5 Q;  1MJC A;  5I2Y A;  2B2U C;  4JBJ A;  4KTA A;  4ZYS A;  3FVQ A;  1GOZ A;  4DK6 C;  3K58 A;  3KFU A;  4UHV A;  3SE0 A;  3S1Q H;  2IY5 B;  1X3Q A;  2QA4 A;  3A5Z B;  4JI7 Q;  4IPC A;  3UDG A;  1I4H A;  1HR0 L;  1PZI D;  4B3S Q;  3M3Y H;  4BBR B;  5C0X G;  1II3 A;  3BVZ A;  4I7A A;  1B8A A;  1MHW C;  5EPK A;  4CDD C;  4A3I H;  3MVV A;  4PMC A;  3HOW G;  5IP9 G;  1G8Z D;  2JA8 B;  5G3L F;  1IYJ B;  1SJH D;  2NUC A;  3BDO A;  4RKB A;  1R9T H;  4OGQ C;  1U4P A;  1PRT D;  1F2Y A;  5C4J B;  1EZ6 A;  3BVM A;  4JI2 Q;  5IWA Q;  3S15 B;  3MXU A;  1WD0 A;  4G4K A;  4HN7 A;  1QNK A;  3CW2 C;  3D3R A;  4EQO A;  4Y7N B;  1RTN A;  3E6Z X;  1O7I A;  4DV6 Q;  4F7X A;  2ZT9 C;  5HGT A;  2VQE Q;  2OQK A;  4XT3 B;  1F9R A;  3KJO A;  1MD2 D;  3D8G A;  3SHL A;  1IBL Q;  3HZX A;  3F1Z A;  5I6W A;  1VQK A;  2NTS A;  1GXD C;  3M9B A;  3HKZ G;  2ZJQ A;  5GAD C;  1Z7T A;  3CD6 A;  2E2H H;  5FO8 B;  4JBK A;  1RCV D;  2D5D A;  1CSP A;  3OW2 A;  3NWS A;  1GKH A;  2Z9H A;  2UXD Q;  5COY A;  1E1O A;  1F2Z A;  2JA7 G;  1XTC D;  3IFT A;  4BY1 B;  1I6H B;  1ET6 A;  1UNS A;  3I55 A;  4QY7 A;  4A3J G;  1KDA A;  4DR1 Q;  4I65 A;  2F0E A;  1EOV A;  1N34 L;  5BN3 A;  2RKS A;  1WFQ A;  2MQH A;  5AFW A;  1WCM H;  4OO1 I;  2JE6 I;  5BN5 A;  1JR0 D;  5GQO A;  1D1K A;  3A7A B;  3I4M B;  2A6H D;  2RSO A;  4N9T A;  1LT5 D;  1DON A;  2HT1 A;  1FR3 A;  1OXX K;  5KNB A;  1IKM A;  1Q8K A;  1BCP D;  1SR3 A;  2NVT B;  3URY A;  5FJ8 G;  3BS1 A;  3I70 A;  5D65 A;  1XX8 A;  2E74 C;  3F2U A;  4GKJ L;  3ND9 A;  3J80 i;  2DY8 A;  2ZTD A;  2A6E C;  3VR2 A;  1U4M A;  3NBH A;  3B6Y A;  3GQB A;  3HOV B;  4DV7 Q;  1R9T B;  3G6J B;  3VYU A;  4NP5 A;  3A55 A;  1JWS D;  3NPP A;  4NXM L;  3CQZ H;  2JA8 H;  1L1O B;  4ZUI A;  3VDY A;  2R7Z H;  4NKL A;  1SDF A;  2PI2 A;  5D3I B;  3AFP A;  3MEH A;  1EQT A;  4NB3 A;  1OXV A;  1LYL A;  3VYS A;  2I5L X;  2KHI A;  3BZK A;  4OHJ A;  4DV1 L;  4IUQ A;  1LTG D;  2OF1 A;  3T1Y Q;  2C5C A;  4LF7 Q;  3OIP A;  1SYE A;  4ZK9 B;  1UE5 A;  4HED A;  5FO9 B;  1LTR D;  3HKS A;  4N8F A;  1DJR D;  4QIW B;  4XQQ A;  2EJF C;  4ZRZ A;  1EU4 A;  3CF5 A;  1F77 A;  4K6L A;  1CTM A;  5JOB A;  5IP7 G;  1KLG D;  3J80 E;  2K05 A;  4ZQ3 A;  1CSQ A;  1PH8 A;  4C3J B;  3CCR A;  1S72 A;  2VUM H;  4A75 A;  2KED A;  1H9R A;  2K32 A;  5E7N A;  1YJW A;  1PTO H;  2D0P A;  1OTC A;  3L3O C;  2F3I A;  1WTP A;  5KND A;  3AU7 A;  5G3L D;  4TKO B;  1D8L A;  1EIH A;  2I5H A;  2L55 A;  3ERO A;  4QL5 A;  3HOU G;  1LTT D;  4K2L A;  1EUJ A;  2CHB D;  1KAB A;  1TWH H;  1Q81 C;  4P73 A;  5GAG C;  2QKI C;  3ZJY C;  1GHK A;  4M1U B;  1Y14 B;  3PUY A;  4J6H A;  5ISR A;  1MIU A;  4S3S A;  2JJQ A;  2O4X A;  2K5Q A;  2B39 A;  1A2U A;  4LAA A;  5CV4 A;  4Q0F A;  1W3S A;  1DOK A;  5COR A;  2QIL A;  4QMG A;  3CMA A;  5M3M G;  2HCC A;  4A3G B;  5E3F A;  3DWQ A;  1EQV A;  4A93 G;  4K5V A;  4EQP A;  5ELD A;  4DN4 M;  4DV7 L;  2R93 B;  4HCE A;  3M4P A;  2D9U A;  2L4N A;  5IP7 H;  3TN2 A;  3V96 A;  1WYD A;  3MTS A;  3FRP B;  3S17 B;  5M9O A;  5JVG 3;  2VUM G;  3H91 A;  1KAW A;  4X66 L;  1HTL D;  2ENB A;  1E0B A;  2MJ8 A;  4B3T L;  1SE4 A;  4C3I G;  2JEB I;  3ICE A;  3FKI G;  4KKU A;  4ILW A;  5IOC A;  1H9S A;  3J7Z C;  5ELC A;  2R3Z A;  1KDB A;  4J1M A;  3I4O A;  2DNC A;  5JVH 3;  1FJG Q;  3H6M A;  4K0K Q;  1OXT A;  4RMF A;  1T5E A;  3P1H A;  4A4I A;  1B9M A;  3H0G B;  4JI7 L;  1HZC A;  3OOC A;  5DM7 3;  1MJE A;  5EKK A;  3M4O H;  1VCI A;  2EYO A;  3NSW A;  2N88 A;  3NTK A;  3H09 A;  5IE8 A;  4A3M G;  3KLS A;  2HIV A;  3NHH A;  3BG3 A;  3RZO B;  1YEZ A;  5F2D A;  1CQV A;  2K14 A;  5C5M A;  1B3Q A;  4C1N I;  1YHA A;  1IW7 C;  5IYC H;  1WD1 A;  1YNN C;  4LNQ A;  2K04 A;  5FLM H;  5C4X H;  3MHB A;  5C44 B;  4BBS H;  1TXY A;  3RUZ A;  4CJ1 B;  3DLL A;  1LLR D;  2NVY B;  4CKC A;  5IT9 c;  3BYT B;  2F0K A;  1QVC A;  1SNC A;  3S16 B;  2Q2T A;  5FLX E;  4DXG A;  1CFM A;  5FOB B;  3U50 C;  5IWA L;  4JI2 L;  3SR1 A;  2KHJ A;  3GV6 A;  2AQ1 B;  1EY7 A;  1NY4 A;  1AZP A;  4QUC A;  4RG1 A;  2NVX B;  4AYB G;  5IOD A;  4A3J H;  1STE A;  1N32 Q;  1JOQ A;  2PNH A;  5IYD H;  1QWY A;  1ZYR C;  3JAM E;  1PRT B;  2A6H C;  4AH6 A;  3K5O A;  3X3N A;  3IL8 A;  3FPU B;  1JWM D;  2BDN A;  1HJP A;  3NWT A;  3NBH B;  2UUC Q;  1HUN A;  3KBG A;  1FVI A;  4RHS A;  2LXK A;  1STB A;  2RHS B;  1E3P A;  3H94 A;  3AYH B;  3S9W A;  4A3F B;  1N9W A;  1HZA A;  3CCL A;  4DR5 L;  4DR1 L;  1QB5 D;  5IGE A;  1NJI C;  2A8V A;  4GN4 B;  2KQ3 A;  1WTW A;  5I9O A;  4V19 0;  4GKK L;  2ATW A;  4FXG C;  1UE7 A;  4GLA C;  4K2K A;  3H3V C;  4NMZ A;  4JI8 Q;  1EWC A;  1E7Z A;  4HIK A;  2R7Z G;  1KNA A;  4CKB A;  4JBW A;  4H44 C;  1PFM A;  4LFB L;  4GNX C;  4LF8 L;  4KMU C;  4KN4 C;  1HNZ L;  3A54 A;  1TII D;  4DKA C;  3CCM A;  1DXM A;  3MEF A;  3K5L A;  2N78 A;  2F0G A;  4IUP A;  1XNR Q;  4LJZ C;  2Q2H A;  1HHV A;  3M7N A;  3DHQ A;  2QDL A;  3E0E A;  4DR5 Q;  4ME5 A;  5ELO A;  1PFB A;  4A3E B;  5M5W H;  1G29 1;  2YU9 H;  1SE8 A;  1UEA B;  1EYG A;  4H7B A;  1NMF A;  3G71 A;  1V8Q A;  3O13 A;  3BYY B;  4LK1 C;  5DNF A;  1T5X D;  5GRO A;  4O2D A;  4QUF A;  1HR0 W;  1I4X A;  5IP9 H;  4H0L C;  1TWA H;  5HY6 A;  4A3D B;  4H02 A;  5M5X B;  3E0J A;  4LMQ D;  1HTP A;  2HDL A;  3GDE A;  4DNT B;  3PIP A;  4KD4 A;  1KIX A;  5EBC A;  1CI3 M;  2K5W A;  4R4Q A;  3TP7 A;  3S2D H;  5CV6 A;  3EJI A;  1K0S A;  1VDZ A;  2LS0 1;  2I46 A;  5FLX c;  4LF4 Q;  3K7A H;  1EOT A;  5K5P A;  3CKI B;  2GN5 A;  4FYD A;  2EYM A;  3PV0 A;  1K3R A;  3TZD A;  1QVG A;  1JOK A;  3OTO Q;  4C3H B;  1SNQ A;  3BVG A;  1K83 H;  4Q5V A;  4NDX A;  1BCP F;  1QJO A;  2IJ0 A;  4DV6 L;  5DEH A;  2HCI A;  5ELE A;  2SNS A;  3PUZ A;  4K8J A;  2R7F A;  3HKZ E;  4JI3 L;  4DF7 A;  2WB1 E;  5C3E G;  5A35 A;  4EQ5 A;  2VQF Q;  2R93 G;  2VB2 X;  3A7L A;  5CV8 A;  2DY7 A;  1S5C D;  1WVL A;  1J9O A;  4GN3 B;  4JBM A;  2WV6 D;  3TRZ A;  4O1N A;  2XNA C;  3GTM H;  1TR5 A;  1A0I A;  1FJG L;  3EQL C;  1VQN A;  5C0X H;  1ROD A;  3N6R A;  5JPN C;  3ULP A;  2IT1 A;  2Z6K C;  3TME A;  1HR0 Q;  2BH2 A;  2WAQ B;  1STN A;  1PYW D;  2UUA L;  4ZAI A;  1YVC A;  2B2V A;  1XJV A;  4PZ6 A;  4OIK A;  4X66 Q;  1LT6 D;  2DJF C;  5I2X A;  2GA4 B;  4L5Q A;  3TBI B;  3I7F A;  4CJ0 B;  4BA1 I;  2EVB A;  1X3E A;  3D4R A;  2F4V L;  1QCB D;  3D6C A;  2Q8I B;  1BUV T;  4KKS A;  3D4D A;  1KRT A;  4FF4 A;  2WIN B;  2X69 A;  2YTY A;  1BBU A;  1LO5 D;  2IHE A;  3P7J A;  4MTK A;  1VMP A;  2IPK D;  2SOB A;  1BCP C;  3PO2 H;  3RD4 A;  4HIM A;  2Z4H A;  2F4I A;  2PW7 A;  1ENC A;  1VQ5 A;  4EQN A;  4DNI A;  4A3B H;  2O5I C;  1GUS A;  4R1J A;  3E9H A;  1JCK B;  1JC7 A;  2B2W C;  2RCN A;  1EY9 A;  2V4D A;  2YU9 B;  1CM9 A;  4X3T A;  2F4V Q;  1EY8 A;  1JWU D;  2X6G A;  4JV5 Q;  1GUW A;  2PQA B;  2YV5 A;  1SLJ A;  4KJO A;  1SRU A;  2AWN A;  5IGG A;  4CJ2 C;  2B2Y C;  2UXC Q;  3R2T A;  3RN2 A;  3M4Y A;  4J15 A;  3LNN A;  2RVL A;  1VQ8 A;  2FIN B;  3HOZ B;  4X6A H;  5M3F G;  2HUG A;  1EQQ A;  1UE6 A;  1TWC H;  4P72 A;  3HOY G;  1N32 L;  4NPS A;  1ML0 D;  1PH7 A;  4IUU A;  4B9W A;  3X3M A;  3JAM i;  4FF2 A;  3PO3 H;  2VQF L;  2OEO A;  2Y0S G;  2JA5 G;  1X3F A;  4CKE A;  1K0R A;  1DOM A;  2FJ2 A;  1D5Z C;  3W3A A;  1SMX A;  2KCT A;  1X56 A;  4U68 A;  1XPO A;  4BS9 A;  4CDC C;  2BOS A;  2RDG A;  4R4C A;  1G6Z A;  2PI2 E;  1TS2 A;  1D5M C;  1CA5 A;  3K0X A;  4DR3 L;  4GOP A;  4ZKB B;  1NR2 A;  1S4Z A;  1VQO A;  4XYQ A;  4A3C G;  2F0S A;  2JQO A;  3MXG A;  4A3J B;  2KA7 A;  2PMZ B;  2PZW A;  4KV6 A;  1C0A A;  4GKJ Q;  1Z47 A;  1HPC A;  1HFN A;  1X6O A;  3RMH A;  2VB3 X;  4H13 C;  1PH3 A;  3OW7 A;  2PNR C;  2VY3 A;  4FP5 D;  4DV2 L;  3FHW A;  1MSH A;  4JI6 L;  2B29 A;  3S16 H;  5BN4 A;  1PV4 A;  4B3R L;  3OHX C;  1I5F A;  1IBK L;  2EY2 A;  1STA A;  3BDL A;  1D2B A;  5JEA G;  1E2W A;  5LL6 S;  4JG2 A;  4HIO A;  4ZUJ A;  1XWE A;  5D3D A;  2UXC L;  3SK5 A;  4DK0 A;  4BY7 G;  2F0U A;  4YCW A;  4LF5 L;  1BXT A;  1JOR A;  4RGN A;  1PLF A;  2F1M A;  4JCV E;  1LAC A;  1HQM C;  1Y8O B;  1YBY A;  3S1M B;  4X3K A;  4A3D G;  1ASY A;  1FGB D;  2R6G A;  4C56 C;  3L9A X;  2WAQ E;  1AP0 A;  1K8O A;  1F9Q A;  3UE0 A;  5H1S E;  3UE1 A;  1NUC A;  4L8J A;  1TWG B;  3TP6 A;  3Q22 A;  4CBV A;  4YWK A;  1VQH A;  2F0N A;  3BDC A;  4IUN A;  3S24 A;  1BCP B;  4LFC Q;  5EQ0 A;  2EYF A;  2JA6 H;  1W6J A;  2H1E A;  1CK1 A;  2ASB A;  1EY4 A;  1SAP A;  2KJX A;  1NMG A;  5C44 G;  4FF1 A;  1Q8I A;  3CPF A;  1KTK A;  4MN3 A;  3TP8 A;  3M85 A;  1VQ9 A;  4QQB X;  2DUD A;  3KF6 A;  4FDB A;  2QDB A;  4DV0 L;  2MP1 A;  2B2Y A;  4MZ9 A;  3RLO A;  2F0W A;  3OYY A;  4C3H H;  2CW0 D;  3GO5 A;  2TMP A;  2D62 A;  4DAY A;  3J81 E;  4OIJ A;  1IBK Q;  1U4L A;  1Q1E A;  4P75 A;  3RZD B;  3PO3 B;  4PMB A;  1LAB A;  2FFK B;  4WJ4 A;  3K7A B;  2PW5 A;  5EKI A;  2CCZ A;  4IO9 A;  4NXN L;  1BO0 A;  1TWH B;  3S2D B;  1D6E C;  3ITP A;  4KY6 A;  1YIT A;  3K59 A;  3FEW X;  1XTD A;  2E8G A;  3BZC A;  1BR9 A;  1EY0 A;  5LL6 X;  5IT9 E;  1H95 A;  4HMJ A;  1BBW A;  1TWA B;  1EZ8 A;  3HOX B;  3SK4 A;  4C3I B;  3BZD B;  3CP0 A;  4J8Q A;  3C2P A;  1UE1 A;  1LV9 A;  4XIG S;  2VUM B;  4UDU C;  1NAP A;  1Q12 A;  4C3J H;  3KBX A;  4UAI A;  1I3Q H;  4LF9 L;  1C4Q A;  1A62 A;  3Q0A A;  2CWA A;  3GD7 A;  1ICW A;  2A69 C;  2B8G A;  3LWU A;  3UDI A;  5HUR A;  4A3E H;  3UDF A;  2KCN A;  4QB4 A;  2F3V A;  3J81 L;  3PF5 A;  2K6A A;  5EJW A;  4AYB B;  1KAA A;  2OT2 A;  1AN8 A;  1I94 L;  4XQN A;  2CFM A;  3G6E A;  1NBW A;  1NR4 A;  2BDO A;  2A68 D;  2JA6 G;  3DM3 A;  2NZH A;  4N9P A;  1XMO L;  4B9X A;  3SEB A;  3KLW A;  1IW7 D;  1N36 L;  1HQR D;  5I4D A;  3NTH A;  4OWT B;  1PMR A;  3WDN A;  4NW2 A;  2PPB C;  4JW0 A;  4YWM A;  2B63 H;  3PIP 3;  2KEC A;  5C4H A;  3CQZ B;  3NTI A;  4L5T A;  3TSS A;  4V0B A;  3P20 A;  2IL8 A;  3AFQ A;  4C1N K;  1KDC A;  1DGS A;  1XNR L;  4YCU A;  4A3M H;  4MHE A;  2NN6 I;  4DK1 A;  3H0G G;  3CRL C;  1M4V A;  1JT8 A;  2NBF A;  1S5E D;  3W2D A;  1HH2 P;  1HRJ A;  2EY6 A;  3I4M H;  2E2J B;  2HHH Q;  2KHS A;  1CHP D;  3HOZ G;  2ZJR A;  2JA7 H;  2NVX H;  4KJN A;  4IJH A;  2VQE L;  2GVB A;  3GTG H;  2EDG A;  4BXX G;  4EX5 A;  4KD3 A;  5KGU A;  1I6H H;  1FNW A;  2OTJ A;  1B4O A;  1YHB A;  3LGJ A;  5C0X J;  1WCM G;  5C44 H;  4X3S A;  4A93 B;  1SFO B;  2NTT A;  5M3M B;  4XYO A;  4DGZ A;  2E2H B;  3CHB D;  1LUZ A;  1PFS A;  1TS4 A;  2A69 D;  1EL0 A;  1XYI A;  1Z6H A;  4R4O A;  3DXJ C;  1Y1V G;  1B9N A;  1ESR A;  1S5F D;  2X6L A;  2Z8L A;  4QF4 A;  4CGY B;  3CCJ A;  1CA6 A;  2JEA I;  1I94 Q;  2A5H A;  4KK7 A;  2PYK A;  3VYT A;  2RHQ B;  4OO1 H;  3H0G H;  4BY7 B;  4JI1 Q;  4FXK C;  3A56 A;  2PZT A;  3GTP B;  1IL2 A;  4LF7 L;  2WKD A;  2AQ3 B;  4POF A;  4DAY B;  3CU7 A;  3ONA B;  1ILQ A;  1UEB A;  1E22 A;  3V2T A;  3PQI A;  4A3I B;  4FF3 A;  1WTR A;  5DAU A;  3PGZ A;  3CXC A;  4PV1 C;  5E1F A;  3CPW A;  2L12 A;  5CV7 A;  4C3J G;  3S17 H;  4RHR A;  4BBR H;  1WJJ A;  4K8I A;  3EBE A;  1YNJ C;  3OIQ A;  1I4R A;  5IYB H;  4B08 A;  1VF5 C;  2F0F A;  3PIO A;  3S1Q B;  4OWW B;  1EY5 A;  4G7H C;  1V1Q A;  5EGT A;  4A76 A;  1F9S A;  4RCO A;  5LMN W;  4MTN A;  1HZB A;  1G51 A;  1SNP A;  4YY3 Q;  5K36 G;  1E2Z A;  2UUA Q;  3C46 A;  5E4X A;  1HFG A;  2AMC B;  2XWB B;  1GUN A;  3I91 A;  3S14 B;  1C8C A;  3MXP A;  4C3H G;  2NYZ D;  2Q8T A;  4AQY L;  2OQ0 A;  3HFZ B;  1O78 A;  3S1N H;  5JAV A;  4FO2 A;  3D0F A;  3KDF B;  3S2H H;  1Z9F A;  1ONL A;  2JA5 B;  4R8I A;  3EN2 A;  3HOV G;  2XGT A;  3C1E A;  3C3L A;  2JA5 H;  3U9S A;  4GZY C;  4OEL B;  3S2H B;  1SND A;  1C7Y A;  1LTI D;  1YHQ A;  3RR5 A;  2JA8 G;  2R7D A;  2MPM A;  1CKO A;  4WFN 3;  2OWO A;  4QGU A;  4LFB Q;  1SMY C;  1QZG A;  4DR2 L;  1GD7 A;  1KXL A;  1CHQ D;  3AEV A;  3QG1 A;  2LFN A;  1IHZ A;  1ZKO A;  4KHZ A;  1IBL L;  2E2I B;  5J1Z A;  1G6P A;  3Q23 A;  4JK1 C;  3M4Q A;  1EQR A;  1FNU A;  4GS3 A;  1XMQ Q;  4A3L H;  4Y52 H;  1O7Z A;  3K80 C;  1JB3 A;  2CH4 A;  1PZK D;  1W2B A;  1A3U A;  2A68 C;  3KLS X;  3I4L A;  1M1K C;  1K73 C;  3RLF A;  4IN3 A;  3DWA A;  4LUO A;  4HTH A;  4F88 A;  2O2L D;  3DEO A;  1NSN S;  3NP8 A;  2Q8R E;  4B3S L;  2L9H A;  2R7Z B;  1B3A A;  5JEA H;  3JAM c;  4K5X A;  1B44 D;  1MBY A;  1R4Q B;  5CR3 A;  4QIW E;  3HOV H;  4LW1 A;  5CBA E;  3GTP H;  1F2M A;  2ICI A;  1F9P A;  1GUO A;  4IPG A;  1CZG A;  1PTO F;  1N33 L;  1SJE D;  3K0Y A;  4BY7 H;  2L15 A;  3J7A F;  1PRT C;  2L0C A;  3WWV A;  1ET9 A;  1D5X C;  3OWF A;  4F8M A;  4B3M L;  4JI4 Q;  3AQQ A;  2IWH A;  3NQT A;  4ZKC B;  1T9H A;  2EY5 A;  1D1I A;  3IRB A;  2XTI A;  5LHY 1;  2UXB Q;  1S5D D;  5FLM G;  4BBS G;  3JAM L;  3HOW B;  2H4O A;  2KEN A;  2CWP A;  3BU2 A;  1STY A;  4DXF A;  3R3O A;  3R2I A;  4JC0 A;  5M3M H;  2PO4 A;  4A3C H;  3A8I E;  1SFO H;  4A93 H;  1RJT A;  1VQ7 A;  3KDF A;  2P5Z X;  1VQF A;  3H3V H;  1U5K A;  4CDE C;  3WOF A;  4BY1 H;  2EYH A;  2IX0 A;  1ENF A;  5C5L A;  2MO1 A;  3CCV A;  1K28 A;  2A73 B;  5BR8 Q;  4PZ7 A;  5HGQ A;  3FDT A;  1TVX A;  1O7L A;  1UUP A;  1L1O A;  3CC4 A;  4LF6 L;  1NE3 A;  3HOW H;  4X65 L;  3NK9 A;  3SGI A;  3F2B A;  5ELN A;  1FD7 D;  2J4X A;  4TRD A;  2EIF A;  2GVA A;  2F0O A;  2M00 A;  3K7U C;  4K14 A;  4O42 A;  5LMN L;  1JE4 A;  1GM5 A;  4UP8 A;  4BWG B;  1QIL A;  3T1H L;  5T1G A;  5JJI A;  2UU9 Q;  4JI6 Q;  4PG3 A;  3WOE A;  4A3M B;  3S15 H;  5C6A A;  1J5E L;  2L1B A;  5C4J H;  3KYH C;  3A74 A;  1H9K A;  4UPA A;  3M7G A;  5M5Y H;  1JQY D;  5EAY A;  2K28 A;  3K57 A;  1PDQ A;  4RGT A;  2PQA A;  2A6E D;  3L7Z C;  3CC2 A;  4LF9 Q;  1OXU A;  4UP7 A;  2KUM A;  3MFY A;  4XTC S;  1L0Y B;  2HDM A;  3EIV A;  4DAP A;  3M3Y B;  4DR6 Q;  2V1C C;  1K8G A;  3QR8 A;  3NE5 B;  5FO7 B;  3S1R H;  1P8L A;  1MKH A;  2F0M A;  1EIF A;  1VQM A;  3ER0 A;  4I7Z C;  4NXN Q;  5E4W C;  1PH6 A;  3SXH A;  1EU3 A;  1B70 B;  1X3G A;  2KBN A;  2CKZ B;  3K5M A;  2A74 C;  2Z6B A;  3RLN A;  2YYZ A;  2MNA A;  2AKW B;  4A3K G;  5M3F H;  1I3Q B;  3MXN A;  4WRD A;  3PSI A;  5EBD A;  1X54 A;  1NTG A;  2Y0S E;  3FMC A;  5K36 H;  4RFB A;  1S40 A;  3SK6 A;  3NUC A;  4C3I H;  1KRS A;  1E24 A;  4DR4 L;  4FVM A;  3CME A;  2BH8 A;  3L0O A;  1WTH A;  1JJC B;  4IJL A;  1TS3 A;  2Q2U A;  4OO1 G;  1KQS A;  3NEN A;  1PRT F;  1TT2 A;  3S1N B;  4RAU C;  1V9P A;  1FL0 A;  2C9O A;  4HJ7 A;  1SMY D;  2VS1 A;  2E75 C;  3GTQ H;  3J7A V;  3S14 H;  1SNO A;  2PZU A;  2CW0 C;  3J80 L;  3ULJ A;  1QZH A;  1LTL A;  1SNM A;  1HNX Q;  5IIF A;  1SYC A;  1AH9 A;  2UUB Q;  1NNX A;  2UXB L;  1MI2 A;  4JOI A;  3RNU A;  4RCN A;  5IYC G;  5J3B A;  4GOP C;  3T53 B;  4IFD I;  5CV9 A;  1L2F A;  4L63 B;  4DFA A;  1J5E Q;  2F0V A;  2MGS A;  1TWF H;  2JK8 A;  1QUQ A;  4IUT A;  2XWJ B;  3L2P A;  1YZ6 A;  4CHT B;  5IYD G;  3GTO B;  4IQZ A;  1TWG H;  1I4Q A;  3EA6 A;  2BA1 A;  3QOL A;  1A63 A;  5CC4 A;  1B2T A;  4LUZ A;  1L0X B;  4N8X 1;  2LXJ A;  1XPR A;  2NZO A;  2BE5 D;  1K8M A;  1WTX A;  1Y1V H;  3KLR A;  3I8Z A;  1Y8N B;  3HOY H;  3OPO A;  4X65 Q;  3S1M H;  1WOC A;  1N36 Q;  1I4P A;  3VR3 A;  4OX9 L;  4IFD G;  3N52 A;  4DNR B;  1CKN A;  3T13 A;  2EE1 A;  4ID6 A;  2K01 A;  5IGD A;  5KRU A;  3K81 C;  2KVM A;  3ND8 A;  2IX3 A;  4JI3 Q;  2QEJ C;  2K5V A;  1J8I A;  4OEM B;  3KK7 A;  1YNN D;  2EZV A;  3PO2 G;  4KY7 A;  4KLK A;  2QF7 A;  4DV3 L;  4POG A;  2BA0 A;  3W5O A;  3CAM A;  3PMF A;  3UDX A;  1TY0 A;  2ZXR A;  2R61 A;  4TSS A;  2B2W A;  1STG A;  3SK8 A;  1Y1W H;  4DR2 Q;  2O5J C;  4MNO A;  4HJA A;  1Q3L A;  1WTO A;  1PYS B;  3I72 A;  2WFW A;  2R92 G;  4P71 A;  3C1F A;  2RBM A;  3MXN B;  5CGK A;  3KOJ A;  5C3W A;  1YNX A;  3W1G A;  4AIM A;  2VW9 A;  2K33 A;  3DMU A;  1N33 Q;  2FMC A;  3GTG B;  5DM6 3;  1SSO A;  4JI1 L;  4DV4 L;  2N55 A;  4A3G G;  1RTO A;  4DR4 Q;  4APV A;  2RCF A;  2JA7 B;  1A6X A;  1O80 A;  3OWE B;  3BJU A;  2AHO B;  1ZEQ X;  3J81 c;  1H9M A;  4X64 Q;  2E2J H;  3D6W A;  3DWP A;  1JB7 A;  1BQQ T;  2PMZ E;  2MFI A;  1PH4 A;  4XXE A;  1D7Q A;  2XSC A;  3GP7 A;  1BDO A;  1YNJ D;  4G7Z C;  1S3O A;  3P75 A;  4DAM A;  4KHV A;  2NVQ B;  1AW7 A;  3RN5 A;  3HOU B;  4JOI C;  2Z6K A;  3VYR A;  3I2Z A;  1M90 C;  5BR8 L;  2XN9 C;  3I4N G;  4JV5 L;  1XXG A;  1BBX C;  1HNW L;  1VQA A;  1EWI A;  3K8A A;  5AJ3 Q;  2CQA A;  5IY0 A;  2PCF B; 
#chains in the Genus database with same CATH homology
 1YHB A;  1VS0 A;  4GKK L;  2NVY H;  2ATW A;  1XPU A;  1UE7 A;  4JYA L;  4R4T A;  3LGJ A;  5C0X J;  1WCM G;  2WP8 J;  2N49 A;  5C44 H;  4GLA C;  2WAQ G;  3TEH B;  5GAH C;  1LUZ A;  4JI8 Q;  1PFS A;  1E7Z A;  4R4O A;  4HIK A;  4JI5 Q;  2R7Z G;  5C4X G;  4JI8 L;  1QVF A;  1Y1V G;  4JBW A;  1N8R C;  1PH1 A;  2ZM6 Q;  3CCJ A;  4LFB L;  4GNX C;  3RZO H;  4LF4 L;  4LF8 L;  2JEA I;  3J80 c;  4DUY Q;  1I94 Q;  4KI0 A;  4DKA C;  3CCM A;  1HNZ L;  2Q2I A;  3MEF A;  2RF4 A;  2N78 A;  2AWO A;  2RHQ B;  4YCV A;  1XNR Q;  2Q2H A;  4Y7N H;  1B7Y B;  3H0G H;  1IBM Q;  4JI1 Q;  3M7N A;  3E0E A;  4DR5 Q;  3T1H Q;  1HNW L;  4A3L G;  5ELO A;  1K9M C;  1HNW Q;  3STB C;  5M5W H;  1G29 1;  2YU9 H;  1SE8 A;  1EYG A;  1IL2 A;  1WI5 A;  4A3F G;  4LF7 L;  1NMF A;  3G71 A;  4POF A;  4DAY B;  2HHH L;  2UUC L;  3T1Y L;  1UEB A;  2ZTE A;  4HJ5 A;  1K8A C;  3W1B A;  1E22 A;  5GRO A;  1Q86 C;  4A3K H;  4O2D A;  1YJN A;  1HR0 W;  3HOX H;  5IP9 H;  1TWA H;  3F8T A;  3PGZ A;  3PUW A;  5HY6 A;  3CXC A;  2EXD A;  4DV3 Q;  2IX1 A;  4H02 A;  3CPW A;  1XNQ L;  3S17 H;  4BBR H;  1WJJ A;  1AE2 A;  3PUV A;  3GDE A;  1ASZ A;  3I4N H;  1XMO Q;  3PIP A;  1KIX A;  3GTL H;  3EBE A;  1C9O A;  4R4Q A;  5IYB H;  1VQ6 A;  3S2D H;  3PIO A;  1VQL A;  4DV4 Q;  1PH5 A;  2R93 H;  1PHJ A;  4OWW B;  3U4V A;  4X62 L;  1V1Q A;  5FLX c;  4LF4 Q;  4LF8 Q;  3K7A H;  1QUQ B;  4A3G H;  1PH2 A;  2GN5 A;  3CC7 A;  4A76 A;  3RZD H;  1XMQ L;  3F2C A;  3PV0 A;  5LMN W;  4MTN A;  4TVA B;  5LMN Q;  2E2I H;  1K3R A;  1HZB A;  1KL9 A;  1E1T A;  1G51 A;  2HQL A;  2F52 A;  1QVG A;  1FGU A;  2ALY B;  3OTO Q;  3CCS A;  4YY3 Q;  5K36 G;  1VQD A;  2OCE A;  3A0J A;  4DR6 L;  1K83 H;  4DV5 L;  2UUA Q;  3FKI H;  2AMC B;  3D31 A;  4LF6 Q;  4DPG A;  3U4Z A;  4TQU S;  2FXQ A;  4DV6 L;  3CCU A;  2I5M X;  2K5H A;  1SN8 A;  4AQY L;  2OQ0 A;  3TS2 A;  3HFZ B;  3PF4 A;  3PUZ A;  4LFA L;  2R7F A;  3HKZ E;  2HIX A;  3S1N H;  4JI3 L;  5C3E G;  2WB1 E;  3S2H H;  3D0F A;  3KDF B;  5IYB G;  1Q82 C;  1IBM L;  1Z9F A;  2R92 H;  4BY1 G;  3EN2 A;  4EQ5 A;  2XGT A;  2VQF Q;  3HOV G;  2R93 G;  2EQS A;  3I56 A;  2E5L L;  2JA5 H;  4GN3 B;  4JBM A;  1C7Y A;  3TQY A;  4C2M H;  3TRZ A;  1RIP A;  4JI0 L;  1YHQ A;  3RR5 A;  1XNQ Q;  2R7D A;  2JA8 G;  1CKO A;  4L5R C;  3GTM H;  2UXD L;  1A0I A;  2N8N A;  2OWO A;  4OON A;  1FJG L;  4QGU A;  1VQN A;  4LFB Q;  3G4S A;  4PMW A;  4PZ8 A;  4DR2 L;  1QZG A;  1GD7 A;  3ULP A;  1EFW A;  2IT1 A;  1KXL A;  2Z6K C;  2YTX A;  1HR0 Q;  2BH2 A;  3AEV A;  3JC6 6;  4DV5 Q;  2UUA L;  5JJL A;  1YVC A;  4ALP A;  2JA9 A;  1YI2 A;  1KC8 C;  1IBL L;  1AE3 A;  4KHZ A;  3KF8 B;  4PZ6 A;  1XJV A;  3HOX G;  4OXP A;  4X66 Q;  4GNX B;  4A3B G;  5AJ3 L;  1G6P A;  4LF5 Q;  1MJC A;  3M4Q A;  1EQR A;  1XMQ Q;  4GS3 A;  5LMU Q;  4JBJ A;  4L5Q A;  4O0A A;  1JJ2 A;  4A3L H;  4Y52 H;  3I7F A;  4BA1 I;  3K80 C;  4DK6 C;  3KFU A;  3S1Q H;  2ZTC A;  1W2B A;  2IY5 B;  1X3E A;  2F4V L;  2QA4 A;  4JYA Q;  3H15 A;  3A5Z B;  1KRT A;  4GN5 A;  4JI7 Q;  4IPC A;  1X65 A;  3UDG A;  1M1K C;  1K73 C;  3RLF A;  2YTY A;  1HR0 L;  4LUO A;  4GLV B;  1HNZ Q;  2OTL A;  1BBU A;  4B3S Q;  3M3Y H;  5C0X G;  2LSS A;  2IHE A;  5M5X H;  1IXR A;  1B8A A;  3PO2 H;  4HIM A;  2K5N A;  4NXM Q;  4A3I H;  3HOW G;  4B3S L;  2I0Q A;  5IP9 G;  3CCL A;  1VQ5 A;  1IYJ B;  3JAM c;  4DNI A;  1BKB A;  4A3B H;  1R9T H;  4QIW E;  4R1J A;  3HOV H;  3E9H A;  4LW1 A;  2F4V Q;  2RCN A;  3GTP H;  4B3M Q;  4JI2 Q;  5IWA Q;  4JI4 L;  4GKK Q;  4JV5 Q;  2D0O A;  2PQA B;  2YV5 A;  4IPG A;  1N33 L;  1SLJ A;  3CW2 C;  1SRU A;  4BY7 H;  2L15 A;  2AWN A;  2A1A A;  3WWV A;  1O7I A;  2UXC Q;  4DV6 Q;  4B3M L;  4JI4 Q;  3RN2 A;  1I50 H;  3AQQ A;  2VQE Q;  2OQK A;  4J15 A;  1T9H A;  4R4I A;  3KJO A;  1J6Q A;  3IRB A;  3PUX A;  1A8V A;  1IBL Q;  1VQ8 A;  4BA2 I;  4X6A H;  2XTI A;  3F1Z A;  3A5U A;  1VQK A;  3M9B A;  2UXB Q;  5FLM G;  4BBS G;  3HKZ G;  5M3F G;  5GAD C;  2ZJQ A;  2KEN A;  4X64 L;  1EQQ A;  2CWP A;  3BU2 A;  1UE6 A;  2IHF A;  1TWC H;  2K75 A;  3CD6 A;  4P72 A;  2E2H H;  4JI5 L;  3HOY G;  4JC0 A;  1N32 L;  4NPS A;  5M3M H;  4IOC A;  1PH7 A;  4JBK A;  3GTK H;  4A3C H;  1SFO H;  2DGY A;  1CSP A;  4A93 H;  3OW2 A;  4IOA A;  1GKH A;  1VQ7 A;  2UXD Q;  2E5L Q;  3JAM i;  3KDF A;  1VQ4 A;  1E1O A;  1VQF A;  3H3V H;  1U5K A;  2JA7 G;  3PO3 H;  2VQF L;  2Y0S G;  2JA5 G;  1X3F A;  2IX0 A;  4BY1 H;  1K0R A;  3G48 A;  3I55 A;  4QY7 A;  4A3J G;  2MO1 A;  4IPD A;  3CCV A;  1SMX A;  2KCT A;  1X56 A;  5BR8 Q;  4DR1 Q;  4PZ7 A;  4A3F H;  5HGQ A;  1PA6 A;  2NVQ H;  1EOV A;  1XPO A;  1N34 L;  1L1O A;  1LM0 A;  1WFQ A;  3CC4 A;  2MQH A;  3F2D A;  5GAE C;  4LF6 L;  4R4C A;  1WCM H;  1NE3 A;  2JE6 I;  3HOW H;  2PI2 E;  4OO1 I;  4P74 A;  4X65 L;  1Q7Y C;  4DR3 Q;  3SGI A;  5GQO A;  3F2B A;  5ELN A;  3HOZ H;  2EIF A;  3K0X A;  4BXX G;  2GVA A;  4DR3 L;  4GOP A;  1VQO A;  3K7U C;  5LMN L;  4A3C G;  2K52 A;  2ID0 A;  2JQO A;  1GM5 A;  4UP8 A;  2HT1 A;  4BXX H;  1OXX K;  1VQP A;  4KHP Q;  1Q8K A;  1V43 A;  1SR3 A;  3T1H L;  5FJ8 G;  2A19 A;  3TRE A;  1PYB A;  2UU9 Q;  5JJI A;  1PH3 A;  4PG3 A;  4JI6 Q;  4GKJ L;  3J80 i;  3J81 i;  2ZTD A;  1C0A A;  3S15 H;  4GKJ Q;  1Z47 A;  4YWL A;  2K4K A;  1J5E L;  4K0K L;  5C4J H;  1X6O A;  3B6Y A;  3A74 A;  3KYH C;  3Q8D A;  4UPA A;  2VY3 A;  4LUV A;  5M5Y H;  3KJP A;  3FHW A;  3FP9 A;  5EAY A;  4DV2 L;  2B29 A;  4DV7 Q;  1KD1 C;  1YIJ A;  1PV4 A;  4JI6 L;  3S16 H;  2PQA A;  3L7Z C;  3CC2 A;  4LF9 Q;  3CQZ H;  4NXM L;  2JA8 H;  4B3R L;  1L1O B;  3VDY A;  2R7Z H;  1I5F A;  1OXU A;  1IBK L;  4OX9 Q;  4UP7 A;  1U0L A;  3GTJ H;  2PI2 A;  4B3T Q;  3AFP A;  4XTC S;  2WB1 G;  2B63 G;  3EIV A;  4DUZ Q;  4NB3 A;  4A3I G;  1BVS A;  1OXV A;  4GOP B;  1LYL A;  4DR6 Q;  2I5L X;  2V1C C;  2KHI A;  3BZK A;  5JEA G;  4YHH L;  4DV1 L;  4DV0 Q;  1K8G A;  4IFD J;  4JG2 A;  3T1Y Q;  1KHI A;  4DK3 C;  4HIO A;  1YJ9 A;  4LF7 Q;  3S1R H;  1P8L A;  2UXC L;  1MKH A;  1UE5 A;  4BY7 G;  1VQM A;  1EIF A;  3ER0 A;  3HKS A;  4YCW A;  1PH9 A;  4LF5 L;  4NXN Q;  1PH6 A;  4X62 Q;  1B70 B;  1Q1B A;  1X3G A;  2KBN A;  4LFC L;  1VQB A;  3CF5 A;  2CKZ B;  5IP7 G;  2ZM6 L;  1VQE A;  4JCV E;  3RLN A;  2YYZ A;  2MNA A;  2AKW B;  4A3K G;  1CSQ A;  1YBY A;  5M3F H;  1PH8 A;  1HNX L;  3CCR A;  1S72 A;  3PSI A;  2VUM H;  4A75 A;  1X54 A;  2R6G A;  1ASY A;  3J7A 5;  4A3D G;  1NTG A;  2NN6 G;  2Y0S E;  1YJW A;  5E7N A;  2WAQ E;  1S40 A;  4JI0 Q;  2D0P A;  4C3I H;  1OTC A;  3UE0 A;  4GLX A;  5H1S E;  1KRS A;  2F3I A;  1E24 A;  3UE1 A;  4DR4 L;  3CME A;  2BH8 A;  1VQC A;  3L0O A;  3GTO H;  1JJC B;  4IJL A;  1D8L A;  4YWK A;  1VQH A;  2Q2U A;  2I5H A;  3S24 A;  4LFC Q;  4OO1 G;  1KQS A;  3HOU G;  3NEN A;  4QL5 A;  2JA6 H;  1EUJ A;  1TWH H;  1V9P A;  4HJ9 A;  1Q81 C;  4P73 A;  2ASB A;  1FL0 A;  5GAG C;  4WJ3 M;  2ZJP A;  1NMG A;  5C44 G;  3ZJY C;  4HJ7 A;  4YHH Q;  1Y14 B;  3CPF A;  2VS1 A;  3PCO B;  3PUY A;  3M85 A;  3U58 A;  1VQ9 A;  3E9I A;  1MIU A;  2DUD A;  3KF6 A;  3GTQ H;  4FDB A;  3S14 H;  2JJQ A;  4QQB X;  4DV0 L;  4MZ9 A;  3RLO A;  3ULJ A;  1QZH A;  1LTL A;  2QEX A;  4DUZ L;  3OYY A;  2CQO A;  4C3H H;  1HNX Q;  3GO5 A;  3J81 j;  1AH9 A;  1W3S A;  2D62 A;  2UUB Q;  2QGQ A;  2UXB L;  4JOI A;  3RNU A;  1IBK Q;  1OXS C;  1JE5 A;  1Q1E A;  4P75 A;  5JEA J;  4AYB E;  5M3M G;  5IYC G;  3CMA A;  4L5S A;  5C0X I;  4WJ4 A;  1JJG A;  5J3B A;  4A93 G;  1GO3 E;  5FJ8 H;  4GOP C;  2CCZ A;  4DV7 L;  4IO9 A;  4NXN L;  4IFD I;  1L2F A;  3M4P A;  3PO3 G;  1J5E Q;  4GNX A;  1TWF H;  4LFA Q;  5IP7 H;  2JK8 A;  1QUQ A;  1WYD A;  1CKM A;  3TS0 A;  3L2P A;  1YZ6 A;  1YIT A;  5IYD G;  4KHP L;  3CCE A;  1L1O C;  1XTD A;  1TWG H;  4DV1 Q;  2BA1 A;  2E8G A;  3BZC A;  1SRO A;  1RL2 A;  1A63 A;  5DLQ E;  4ME3 A;  5JJK A;  3ERS X;  2VUM G;  4LUZ A;  4A3D H;  3ULL A;  1KAW A;  1BBW A;  2LXJ A;  4X66 L;  3I4M G;  1H95 A;  2B3G A;  3KF6 B;  1XPR A;  3CP0 A;  4B3T L;  2H5X A;  2NZO A;  3OTO L;  2JEB I;  1UE1 A;  1Y1V H;  4XIG S;  3ICE A;  3HOY H;  3FKI G;  4X65 Q;  1Q12 A;  4C3J H;  4LF9 L;  3J7Z C;  1I3Q H;  3S1M H;  1A62 A;  1WOC A;  2CWA A;  3GD7 A;  3I4O A;  3UDI A;  1Y1W G;  1N36 Q;  4OX9 L;  4IFD G;  1FJG Q;  4A3E H;  1X55 A;  1CKN A;  3NEM A;  3UDF A;  4K0K Q;  1OXT A;  4RMF A;  2VNU D;  3PF5 A;  4A4I A;  3K81 C;  4LWC A;  5C3E H;  2N3S A;  4JI7 L;  1HZC A;  1MJE A;  1L0W A;  4DR7 L;  2UU9 L;  3M4O H;  4DUY L;  1VCI A;  1I94 L;  1UWV A;  4JI3 Q;  5IE8 A;  4A3M G;  2HIV A;  2K5V A;  1EIY B;  2CFM A;  3G6E A;  1NBW A;  4AQY Q;  2JA6 G;  3DM3 A;  2NZH A;  1YEZ A;  4OWX B;  1XMO L;  3PO2 G;  3KLW A;  4KLK A;  2K14 A;  1N36 L;  2YTV A;  4DV3 L;  4POG A;  4OWT B;  2BA0 A;  1CKN B;  4UP9 A;  1YHA A;  3W5O A;  3CAM A;  5IYC H;  3UDX A;  4HID A;  4QJF A;  4YWM A;  4LNQ A;  2B63 H;  1Y1W H;  4YY3 L;  5FLM H;  1IZ6 A;  5C4X H;  4DR2 Q;  1N34 Q;  1TXY A;  4MNO A;  4HJA A;  4BBS H;  2VL6 A;  3DLL A;  5IT9 c;  1QVC A;  4L5T A;  1PYS B;  2WFW A;  2Q2T A;  2R92 G;  4P71 A;  4B3R Q;  3AFQ A;  3H3V I;  3NEL A;  3MXN B;  3KOJ A;  3U50 C;  5IWA L;  4DV2 Q;  1YNX A;  3W1G A;  4AIM A;  4JI2 L;  1DGS A;  2VW9 A;  1XNR L;  3STB D;  1VQI A;  2KHJ A;  1N33 Q;  4YCU A;  4A3M H;  4DV4 L;  1NY4 A;  4JI1 L;  3HOU H;  4DR4 Q;  2NN6 I;  4A3G G;  4DR7 Q;  4APV A;  4RG1 A;  2KCM A;  3H0G G;  4AYB G;  1VQG A;  1PVO A;  1GVP A;  3BJU A;  4A3J H;  2NVT H;  1JT8 A;  1N32 Q;  1HZ9 A;  2K50 A;  2C35 B;  2AHO B;  2PNH A;  5IYD H;  3J81 c;  2UUB L;  2ES2 A;  1HH2 P;  4HJ8 A;  4X64 Q;  2E2J H;  1P16 A;  4AH6 A;  1JB7 A;  2PMZ E;  2MFI A;  1PH4 A;  1D7Q A;  3I4M H;  4BBR G;  3CCQ A;  1HJP A;  2HHH Q;  3NBH B;  2UUC Q;  2Z0S A;  3HOZ G;  1S3O A;  2ZJR A;  1FVI A;  2LXK A;  2JA7 H;  2NVX H;  4DAM A;  2RHS B;  1E3P A;  4IJH A;  2VQE L;  2GVB A;  3AYH B;  3RN5 A;  1VQJ A;  1N9W A;  1CUK A;  1HZA A;  2MO0 A;  1Q46 A;  2Z6K A;  4JOI C;  3I2Z A;  4EX5 A;  4DR5 L;  4A3E G;  5LMU L;  1M90 C;  5BR8 L;  4DR1 L;  1JMC A;  3I4N G;  4JV5 L;  4IPH A;  1VQA A;  1EWI A;  3K8A A;  1NJI C;  4UY8 C;  2VZA A;  5AJ3 Q;  2A8V A;  3GTG H;  1I6H H;  4GN4 B;  5IY0 A;  1X9N A;  2OTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...