3PO2H

Arrested rna polymerase ii elongation complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3po2H00
2R7FA 1T9HA 3Q8DA 3I4MG 2AWOA 2IY5B 4A3FG 2HT1A 4LF5Q 3AYHB 3HOWG 3GO5A 4LF4L 5FLXc 1WJJA 2V1CC 3BZCA 3KF8B 1CKOA 3J7ZC 4ALPA 1VQJA 1Q81C 2D62A 3S1RH 3BJUA 5JJIA 3CCJA 1U5KA 3EN2A 4JI3L 1M90C 2K5VA 1Y1VH 3J80c 2Q2HA 3M85A 5IWAL 4IOAA 2MQHA 3CMAA 2B29A 4L5SA 2UXCQ 3UE0A 3AFQA 2HQLA 3F2CA 1KL9A 4OWTB 3ICEA 3WWVA 3UDXA 2VUMH 5IP7H 3CMEA 1GVPA 1NJIC 2GN5A 3NENA 1EQQA 4BXXH 4JV5L 3OYYA 1X3EA 4DR4L 1K83H 3GTKH 1G291 3EBEA 4PZ7A 1SROA 4POGA 1Q12A 4DR1L 3KF6A 3TQYA 4DK3C 4YHHL 3TS0A 5FLMG 3CCMA 4BY1G 4DUYQ 4HIKA 3G4SA 4LUZA 4NPSA 3CCUA 4GNXB 4DR3L 3CCLA 2MO1A 4BBSH 4A3DH 1VQDA 2MO0A 1QZGA 2N3SA 3PCOB 4JBKA 2I5HA 4X66L 4JI0L 2WB1G 3M7NA 1YVCA 2ZTEA 4OWXB 5C4XH 4P73A 2E5LL 1N32Q 1VCIA 2JK8A 4DV0L 1PH7A 4X65Q 2AHOB 2K5NA 1K9MC 1VQLA 2R92H 2EQSA 3AFPA 3K7AH 4JI1L 5JEAG 5DLQE 5IT9c 1JJCB 5C4JH 2VQFL 4GOPA 3OW2A 3T1HQ 3TEHB 2CFMA 4TVAB 1HNZL 5IYCG 4PG3A 2LSSA 1TWFH 2JA8G 3TRZA 1J5EQ 4IFDG 2UUAQ 4UY8C 3SGIA 4UP8A 1HNXL 4O0AA 4X62Q 4R4QA 4R4OA 4A3JG 1P8LA 1QUQA 5IYBH 3TREA 3UDIA 1HR0Q 4HIDA 3KDFB 2IT1A 2KCMA 1U0LA 1YIJA 2ES2A 1PH2A 1N33Q 1L1OA 3I4NG 4QQBX 1PYBA 1PYSB 5FJ8G 4LF8L 2JA6G 1D7QA 1G51A 2VW9A 3RZOH 2HIXA 4RG1A 4C3HH 4DV6L 3MXNB 1SE8A 4DV7L 2I0QA 2PQAB 4JI2L 1VQ7A 4GLXA 3HOYH 4JI7L 2NVTH 2ZM6Q 2OTJA 5LMUL 4HIMA 4BY7G 3NBHB 1UE6A 4DR4Q 1SLJA 1RIPA 3CCEA 4A93G 3KFUA 3HOZG 3STBC 3S2DH 4B3TL 4B3SQ 1W2BA 4JBWA 4OX9L 4DV5Q 3GTPH 4LUVA 4AQYQ 1VQBA 1EQRA 1SR3A 4NXNL 5C3EH 4WJ3M 1EOVA 1VS0A 4LFCQ 2NVQH 1AE3A 2VZAA 3T1YL 1MJCA 1VQ9A 4IFDI 1XMQL 2H5XA 3J81i 4A3CH 4HJ7A 4JI8L 4P72A 1PFSA 2PMZE 3ERSX 2RCNA 3H0GG 4PZ6A 4AYBE 4DR5L 3HOUG 1KRTA 2JA7H 2WAQG 4DV3Q 1PH3A 4DV2Q 2JA5G 1CSQA 2OQ0A 5IYDG 3S1NH 1X9NA 2K5HA 3M4PA 4JCVE 1O7IA 3PUZA 4JOIC 1VQMA 2QGQA 1Q82C 4JBMA 4LF6L 1RL2A 3FKIG 3PV0A 4MNOA 3PO2G 4R1JA 4AIMA 1M1KC 1UE7A 4DV1Q 3GTOH 2E8GA 1KQSA 4LFAQ 1Z47A 1CUKA 4JI3Q 3NELA 4JBJA 1IBKQ 2ZJRA 3RN2A 1TWGH 4QJFA 1IBML 1Y14B 5GAEC 1NMGA 4A3IH 4H02A 4LF9L 1XNRL 3D31A 4KHPL 2ZJQA 1PVOA 4LNQA 2ID0A 1Q1EA 3PSIA 1VQNA 3RLNA 2UXBL 1BBWA 3A74A 5E7NA 1X65A 2LXJA 2IHEA 3RNUA 1QVGA 2UUCL 2B3GA 3S2HH 1WYDA 2R6GA 4LUOA 3PIPA 3HOXH 3K81C 2Q2UA 1HNWQ 4JI6L 1OXTA 1PH9A 1FVIA 2MFIA 4DR1Q 1OXSC 1WFQA 4YHHQ 4DR7L 4C2MH 1YITA 4L5QA 3FP9A 4P74A 2R7DA 1V43A 2BH2A 5JJLA 1DGSA 1K8AC 2ALYB 1VQGA 1EUJA 3M3YH 1JE5A 1V9PA 3K7UC 4C3JH 4X66Q 4X64L 2QEXA 4NXML 1GO3E 4B3RL 5IP9H 3I4OA 1JJGA 2AMCB 4LW1A 4YY3L 3KYHC 1WCMH 4ME3A 1MKHA 2UXDL 4JI1Q 1HZCA 2HHHQ 2VQFQ 1IL2A 2R93H 1HNZQ 3HOWH 2B63H 1H95A 2R7ZH 2Z6KA 3U4ZA 3I4MH 2UUBL 3CCSA 4X6AH 4A3FH 1FGUA 1S40A 2GVAA 3K8AA 4R4CA 3VDYA 1HNXQ 4RMFA 1CKMA 1WI5A 5LMNL 3CAMA 2JA9A 4L5RC 4MZ9A 2CWAA 4UP9A 2UU9L 1HZBA 1FJGQ 2NVYH 1S3OA 1X3GA 2KHIA 2N8NA 4GNXA 1Q7YC 1C9OA 4LFBQ 1VQHA 1Q8KA 1VQCA 2JE6I 1N34L 2RHQB 4LF8Q 2KHJA 3CP0A 4P75A 4DR6L 4EX5A 3K80C 4JYAQ 1YZ6A 4DV6Q 5M3FG 4A3BG 4DV7Q 4HJ8A 3U50C 1SFOH 4JI2Q 3H15A 1NE3A 3J81j 1I94Q 2A8VA 3PO3G 2YV5A 2C35B 5C0XG 2Y0SG 5LMUQ 1MJEA 4JI6Q 3OTOL 3K0XA 3PUXA 4GN4B 4LWCA 1IBLQ 2YTXA 1VQ6A 4B3TQ 3KJPA 4K0KQ 2E2IH 4IPDA 4DUZL 1W3SA 1IYJB 1B70B 1OTCA 5FLMH 4BY1H 4IPCA 3E9HA 3T1YQ 1N8RC 1KAWA 2NN6G 3A5ZB 1VQIA 4JI8Q 5IY0A 3IRBA 3KDFA 2Z6KC 1PH4A 1NY4A 1K8GA 1X55A 5GAGC 3UDGA 5GAHC 4YWKA 3M9BA 5ELNA 1YJWA 1C0AA 1P16A 1CSPA 2PQAA 4GN5A 5IYCH 4A76A 2YU9H 3KOJA 2JA8H 1FL0A 4A3GG 2ZJPA 3RZDH 4YWLA 3JAMi 5JJKA 3S15H 1L2FA 1E1OA 1X56A 2CQOA 4UPAA 1LYLA 2N78A 4DV4Q 3PIOA 1PHJA 1KIXA 3H3VI 3M4QA 5C0XJ 3L7ZC 2PI2A 1IBMQ 5AJ3Q 4GKJQ 2EIFA 2YYZA 1GKHA 2K14A 4A3JH 4LF9Q 1XNRQ 3DM3A 4R4TA 5GADC 2I5LX 4GN3B 2WB1E 3HOVG 2F52A 1I50H 2UXBQ 2VQEL 3I4NH 2WP8J 5FJ8H 1IZ6A 2JA6H 3FHWA 3I56A 1XJVA 4IPGA 3J7A5 2E2JH 2NN6I 4HJ5A 2FXQA 1JB7A 4IJHA 3A0JA 1TWHH 1EIYB 3J80i 1E7ZA 4DR7Q 2EXDA 2OTLA 3S14H 4BY7H 3CW2C 4GOPC 4JI5L 5GQOA 4A75A 3ULPA 4A93H 1LUZA 2N49A 3GTMH 3HOZH 5K36G 1K73C 1SMXA 2WFWA 2KCTA 4X64Q 1A0IA 2ZTCA 1QZHA 2OWOA 4A3EG 4NXMQ 4B3RQ 4DR2L 2OQKA 4JI4L 4LF4Q 1QVCA 2Z0SA 4A3KG 1EIFA 2UXDQ 1YI2A 1N32L 3PGZA 1CKNB 2BH8A 3H0GH 1JMCA 3HOUH 1R9TH 1EWIA 2JA5H 2UUBQ 2VS1A 3W5OA 5IYDH 1K3RA 3I7FA 4Y7NH 1L1OC 1A8VA 2K75A 4C3IH 2IX0A 4BBRG 3G71A 3T1HL 4A3MG 5IWAQ 3E0EA 3PUVA 1I5FA 3CXCA 5LMNQ 1S72A 1PH8A 1PH1A 3FKIH 3L0OA 2A19A 3U4VA 1X6OA 5C44G 2UUAL 1GD7A 3PO2H 1KRSA 1G6PA 4P71A 4X62L 1ASYA 1Q46A 1YNXA 5J3BA 4JV5Q 3LGJA 3W1BA 3L2PA 1TXYA 2D0PA 2LXKA 4A3LG 2CWPA 4DK6C 1Y1WG 3S16H 1N36L 1HZAA 2YTYA 5M3MG 1J6QA 4XIGS 4PZ8A 1VQFA 2JJQA 1YHBA 4DR3Q 3ZJYC 3CC7A 3G6EA 3OTOQ 1N9WA 4Y52H 4JI0Q 1NMFA 3HKZE 4PMWA 2E5LQ 2ZM6L 4DV0Q 3CC4A 1VQAA 4O2DA 1VQOA 1NTGA 4IO9A 1HZ9A 2JQOA 2K52A 3M4OH 2D0OA 4DV5L 4B3ML 4WJ4A 1Q1BA 1KXLA 1C7YA 1BVSA 3ER0A 4KHZA 2Q2TA 1MIUA 3BU2A 2DUDA 1UE5A 3GD7A 3JAMc 2MNAA 3HKSA 2YTVA 2AKWB 1PA6A 3S1QH 2VNUD 2BA1A 4DV3L 1XMOL 4DV2L 1HJPA 1UEBA 1Y1VG 3UE1A 2F4VL 4J15A 1VQ8A 2CCZA 3AEVA 5BR8L 4QGUA 2VUMG 2XGTA 5IP7G 3CF5A 4DV1L 1XNQL 1E3PA 1I6HH 4BXXG 3I55A 4LFAL 3DLLA 1HR0W 4JI7Q 4GLVB 3GTJH 1YJNA 2VQEQ 1IBKL 2I5MX 4GLAC 2F3IA 3NEMA 1NBWA 2K50A 3BZKA 4GS3A 1PH6A 3PF4A 3J81c 2OCEA 4OX9Q 5M3FH 4A3BH 1UE1A 4NXNQ 4A3DG 3H3VH 2IX1A 4BBSG 4IPHA 3PO3H 4OXPA 5M5XH 2K4KA 1XMQQ 1JJ2A 4OWWB 4GKKL 1HNWL 1XPOA 3CPWA 4JI5Q 2NZOA 3TS2A 5C4XG 4DR5Q 1YBYA 4LF7L 4OONA 1TWCH 5EAYA 4JC0A 4DKAC 2R92G 1XPRA 1Q86C 4DR2Q 5GROA 4JI4Q 2KBNA 3F2DA 1KD1C 1ASZA 4DAMA 3JC66 1A63A 2PNHA 2E2HH 4LF6Q 1X54A 4YCVA 1SN8A 4POFA 4LF5L 3PF5A 1AH9A 3KF6B 1GM5A 1X3FA 4GNXC 1TWAH 1OXUA 3RN5A 2HHHL 1KHIA 3RR5A 5C0XI 4A4IA 5IYBG 2Y0SE 4MTNA 3E9IA 4KHPQ 3CPFA 3RLFA 1D8LA 1LM0A 4AH6A 3U58A 1VQKA 1YJ9A 4OO1G 3ULLA 4A3GH 2XTIA 4DPGA 4YCUA 4BA1I 4QL5A 3S1MH 1OXVA 4JOIA 3CC2A 3GTLH 2UXCL 2BA0A 2UUCQ 4GOPB 4AYBG 1AE2A 1LTLA 1XPUA 3F1ZA 5M5WH 2HIVA 4EQ5A 5H1SE 2IHFA 2CKZB 1EFWA 1FJGL 3HOYG 1N36Q 4LFBL 5LMNW 2RF4A 4HIOA 2ASBA 3RLOA 3HOVH 1VQPA 3CQZH 1B8AA 2L15A 3KJOA 1E24A 4JYAL 1CKNA 2NZHA 4APVA 1XTDA 4DNIA 2QA4A 1QUQB 5C3EG 3D0FA 3PUWA 4DUYL 1I94L 1EYGA 1VQ5A 4A3CG 4YY3Q 1L1OB 1HH2P 5HY6A 1YHAA 1I3QH 5JEAJ 1IBLL 1SRUA 3EIVA 2JA7G 1KC8C 2ZTDA 2JEAI 3S24A 4B3MQ 4K0KL 4X65L 1OXXK 3CCQA 1K0RA 4A3EH 1WOCA 3I2ZA 3AQQA 4IFDJ 4OO1I 3GTGH 1E22A 4YWMA 3MEFA 4YCWA 3W1GA 4A3KH 2JEBI 5HGQA 4NB3A 2VY3A 1E1TA 3GTQH 1J5EL 1QVFA 1UWVA 4HJAA 3A5UA 1XMOQ 2UU9Q 4IJLA 3ULJA 3S17H 2Q2IA 1PV4A 1VQEA 2VL6A 1L0WA 1N34Q 2NVXH 1IXRA 2A1AA 2PI2E 2KENA 4QY7A 4BBRH 4HJ9A 4A3IG 4A3MH 2F4VQ 3PUYA 5IE8A 4DR6Q 3HKZG 1HR0L 3CCRA 5BR8Q 4JG2A 3F8TA 1N33L 4DAYB 1XNQQ 1YHQA 5C44H 2WAQE 1BBUA 3GDEA 4DV4L 1JT8A 1V1QA 2DGYA 3F2BA 4FDBA 5ELOA 3HOXG 5AJ3L 4GKJL 4UP7A 1YEZA 1B7YB 4IOCA 2AWNA 4A3LH 1A62A 4TQUS 1VQ4A 4DUZQ 1Y1WH 5M3MH 3STBD 4R4IA 3KLWA 3B6YA 3UDFA 2RHSB 1PH5A 4KLKA 4GKKQ 4BA2I 4B3SL 3G48A 4L5TA 3CD6A 2ATWA 4AQYL 5IP9G 4KI0A 4LFCL 4QIWE 3CCVA 2GVBA 4LF7Q 1WCMG 4XTCS 1Z9FA 1BKBA 2R93G 5M5YH 2B63G 3HFZB 2R7ZG
chains in the Genus database with same CATH superfamily
2R7FA 1T9HA 3I4MG 2MUYA 1S5DD 4A3FG 2XNAC 1PRTD 3KF8B 2DNEA 2FINB 4G4KA 5D65A 4ZK9B 1RF2D 2IJ0A 2L0CA 3S1RH 4H7BA 5JJIA 1O78A 3CCJA 1M90C 4NW2A 1Y1VH 4ME5A 5IWAL 3CMAA 3GTJB 1EY4A 1KL9A 4PNYA 1YNND 2J7ZA 2F0QA 3CMEA 1NJIC 1V1OA 2C5CA 3ONAB 3VA5A 3OYYA 3GTKH 1LV9A 4DR1L 3GQBA 4DK3C 4HR7B 3Q0AA 4HIKA 3CCLA 4GNXB 4HCSA 2N3SA 2X69A 1LTSD 1YVCA 4OWXB 1I4RA 3GV6A 2JK8A 3D6WA 3K5NA 2A6EC 1E2WA 4DR4Q 3AFPA 3K7AH 5CR3A 4JI1L 4POGA 1SJED 5C4HA 3D3RA 4PG3A 2F3VA 1CA5A 5T1IA 1KLUD 2UUAQ 3TP6A 2B8FA 1HNXL 4O0AA 4EQPA 2BOSA 4A3JG 3I4NB 1P8LA 2HDMA 2AQ3B 5K5PA 5CV7A 2KCMA 1U0LA 4OO1H 5M5WB 2FHTA 5C3WA 5IT9E 2HCCA 1A3UA 4DV6L 3MXNB 3CQZB 1IL8A 2PMZB 4JI2L 4GLXA 5E4XA 3HOYH 5C5LA 5LMUL 2EVBA 4BY7G 1UE6A 4N8FA 3NQIA 1ZYRD 2XN9C 4A93G 3HOZG 3S2DH 5IGGA 4B3TL 4JBWA 3O13A 4AQYQ 1SR3A 4NXNL 1NR4A 2A68C 3K5MA 1EOVA 1LABA 1VS0A 1VMPA 2VZAA 2WACA 3DWPA 1VQ9A 1TS3A 4IFDI 3J81i 1TY2A 5I6YA 4JI8L 2NYZD 1PFSA 4P72A 3RMHA 2DY8A 3K57A 4DAYA 2JA7H 4DV3Q 1PH3A 2XRQD 2LY7A 5IYDG 4C3IG 2TMPA 3K5OA 4DAPA 4K5XA 3FKIB 1OO9B 4FF2A 1CFMA 1O7IA 1C8CA 1B50A 2A5HA 4JBMA 1Y8NB 1ENCA 2AQ2B 2NVXB 1HFNA 1CM9A 2OT2A 1CUKA 3NELA 4JBJA 3HRZC 5C44B 3K59A 5GAEC 4H02A 1PVOA 2HCIA 4FXDA 2ID0A 3PSIA 5DEHA 3ND8A 3A74A 5E7NA 1KNAA 3OPOA 2LXJA 2IHEA 1VF7A 4G57A 4K8JA 2F0JA 3K81C 2Q2UA 1PH9A 4RGMA 1FVIA 4DR1Q 1FNVA 1CQFA 3PIO3 5EKLA 5C4ZA 4P74A 2BH2A 1K3BC 1TVXA 4DFAA 1VQGA 2RKSA 1JE5A 4NXML 1GO3E 4IUPA 2AMCB 2HDLA 3WOFA 4JI1Q 3H6MA 2R93H 2R7ZH 2Z6KA 1HRJA 3URYA 3T4AC 4H44C 4R4CA 3S1RB 4RWSC 5KYLA 2Z9HA 1HNXQ 4RMFA 5CGKA 4H13C 1S5BD 3CAMA 3X3NA 1Y1VB 4MZ9A 2CWAA 1MHWC 2F0IA 2UU9L 1ZXTA 1X3GA 1DZ1A 2N8NA 1C9OA 3MEHA 5JVH3 1N34L 1VQCA 5M3FB 3RUZA 3CP0A 1IKLA 3IKJA 4KY7A 4DV6Q 1A3VA 2F3WA 2BE5C 4N8X1 2A73B 4JI2Q 2K32A 3PO3G 3NPPA 1CI3M 3CRLC 1WTRA 5C0XG 5LMUQ 2L1BA 3A8KE 2XVSA 3VR2A 4LWCA 4B3TQ 4K6DA 4DXGA 4DUZL 3BZDB 4HTHA 2E2HB 3R93A 4BY1H 5E3FA 1U9RA 1B9NA 5I2XA 4JI8Q 3K7AB 1ENFA 3KDFA 1SE3A 3NE5B 3AMUA 5A2QE 4YWKA 3M9BA 2ZXOA 1YJWA 4OIKA 2PQAA 1C0AA 2Q8IB 4GN5A 2EYOA 3KOJA 2EYMA 4A3GG 3RZDH 3NBHA 3JAMi 5JJKA 1L2FA 1FR3A 1PHJA 2EYJA 4XT3B 2PI2A 1CZWA 1GKHA 4ZUIA 1EQTA 1UAPA 3DM3A 3I8ZA 1JC7A 2VQEL 3OSOA 3QOJA 5TSSA 3HOYB 2JA6H 3H09A 3QR8A 2RDGA 1I3QB 1HUMA 1E7ZA 2EXDA 3S14H 4GOPC 5E4WC 5GQOA 3ULPA 1AZPA 3ND9A 1K73C 4A3KB 2KCTA 4NXMQ 1STNA 5M9OA 1QVCA 1EIFA 3KLRA 1GUSA 5BN4A 1TR5A 1N32L 1CKNB 3FVQA 3H0GH 1JMCA 3HOUH 3R3OA 1EWIA 1U4MA 1I4HA 1A8VA 1TY0A 1F9SA 2E75C 5COYA 3MFGA 5ELDA 1JOQA 2PO4A 2IX3A 5IGCA 3QG1A 1KRSA 1FNUA 4J1MA 3TMEA 3S9WA 1TXYA 3J7YW 2VXWA 2CWPA 3M4YA 4K5WA 4EVOA 2YTYA 5M3MG 2ICIA 3E5SA 3C1FA 1DOMA 3VR5A 3CC7A 2K33A 2KOLA 2WINB 3G6EA 2XWJB 4KY5A 5M5YB 2E5LQ 4ZYSA 3EJIA 4JK1C 1B3AA 1LTBD 2BDOA 1KNEA 2K5DA 3QB3A 1NTGA 4XYOA 1LT5D 3M4OH 2K52A 1S5CD 1V8QA 2K01A 4IZ8A 2MGSA 2R93B 2R7ZB 3BU2A 2MNAA 2Z4HA 2LMCB 3HKSA 1SNDA 2AKWB 4Q0FA 1GOZA 2KQ3A 4DV2L 3MWYW 2VUMB 1Q3LA 1MD2D 2CCZA 5BN5A 3T51B 3I55A 3DLLA 5IIFA 2VQEQ 1IBKL 4IUVA 3NEMA 1NBWA 1DYQA 2OCEA 2O5JC 1EYCA 2K6AA 3BDLA 3HZXA 1D6EC 4HMIA 3J81L 4A3DG 1HCZA 4IPHA 4OXPA 1Q90A 2FFKB 4H0LC 4DR5Q 1HA5A 4CHTB 1YBYA 4JC0A 2ENBA 4G7ZC 1STGA 1ASZA 2PNHA 4LF6Q 2NN6H 1PFNA 3T13A 1SN8A 3FPPA 4POFA 3OHXC 1GM5A 1PZKD 3T53B 1TWAH 2HHHL 3RZDB 4A4IA 5D14A 1LM0A 3U58A 1A2TA 1KDAA 1M8AA 4YCUA 5FKAC 5CV5A 5EQ0A 2O2LD 2UUCQ 4GOPB 4AYBG 1WTOA 2NVTB 3DMUA 1JORA 2HIVA 1EFWA 2JA6B 4K2KA 5LMNW 2TSSA 2M2LA 1SNPA 1NUCA 4APVA 2NZHA 2DJFC 2B2VC 4UAIA 1I94L 4A3CG 3NTHA 4YY3Q 2L55A 3A8JE 5HY6A 3EIVA 3QOLA 5C3XA 5I2YA 5K36H 1ESFA 4K0KL 2OXPA 1PLFA 4X65L 4A3EH 3I2ZA 4OO1I 3H0GB 3OMCA 3HOUB 4YWMA 3W1GA 4YCWA 2OEOA 1B53A 1U4PA 5FO9B 1RJTA 2VY3A 1J5EL 4LK1C 4ID6A 4IUNA 4CKCA 4WFN3 3I70A 1L0WA 1VF5C 4QY7A 4BBRH 2KENA 4HJ9A 4A3IG 4A3MH 4DU9A 4JG2A 1N33L 1O7LA 1WD0A 2WAQE 4DV4L 2SEBD 2K1BA 1SNQA 5AJ3L 3OMGA 2A69D 3STBD 4R4IA 4KY6A 3B6YA 4KLKA 4B3SL 3G48A 1H9SB 4B9XA 3CD6A 3DM1A 1EEID 4LFCL 3M4OB 2WKCA 5KYIA 3V05A 3HOWG 3HFZB 1SJHD 3JAML 1D5MC 1RKNA 3SVMA 2G5DA 3MXUA 4LF4L 1WJJA 1ILPA 1CKOA 1H9RA 2HQEA 3OWFA 1Q81C 1QNKA 2A6HD 1U5KA 5EKKA 3J80c 3BVMA 2MQHA 1TS5A 4L5SA 3UE0A 3AFQA 2HQLA 5IP7H 4HMJA 3NENA 1EQQA 1HQMC 3PMFA 3E6ZX 4JV5L 2N88A 1SMYC 4HSPA 1K83H 4XXEA 3HEJA 3KF6A 4YHHL 2EY2A 5FLMG 2F0SA 3G4SA 1PZID 4LUZA 4NPSA 4DR3L 4FF4A 4BBSH 1ET6A 1VQDA 2MO0A 2KA7A 4X66L 2EY1A 4JI0L 2N55A 4FVMA 5C4XH 4P73A 3QJYA 4ODGA 1VCIA 4DV0L 4X65Q 3E0JA 2R92H 1VQLA 1ML0D 3A7LA 4RKLA 4V0BA 5DLQE 5JEAG 5IT9c 2VQFL 3T1HQ 4X6AH 1HNZL 5IYCG 3D4RA 1TWAB 1TWFH 2LSSA 3TRZA 1J5EQ 1KLGD 2B2YA 4CDFC 3CRKC 1CHPD 4IN3A 4KK7A 3QIAA 1EEFD 1QUQA 3RD4A 2NWGA 3UDIA 1MSGA 4DNRB 1N33Q 4ZLTF 3H94A 1L1OA 3I4NG 3V96A 1G51A 1H9JA 4DV7L 2B8GA 2EPBA 3GTMB 1I6VC 4JI7L 2RVLA 2EYPA 1RIPA 5KRUA 4B3SQ 1CZGA 5C3EH 4WJ3M 2MPMA 4LFCQ 2NVQH 4I7ZC 3SEBA 1R9TB 2WAQB 2ZXRA 4A3EB 2PMZE 5JPMC 4PZ6A 3QWNA 5CV8A 1NAPA 3KLSA 2JA5G 3LNNA 3MXGA 1CSQA 1JQYD 2K5HA 1LACA 3M4PA 4JPBW 1U4RA 1SYDA 1ZEQX 3FRPB 4JOIC 5FOBB 3FKIG 3PO2G 4A3MB 1M1KC 3GTOH 2E8GA 2K03A 4LFAQ 1TS4A 3RN2A 1EQVA 3TP8A 4KHPL 2Z4IA 2H4OA 3D31A 4LNQA 2NZ1D 1WD1A 3KBGA 4K14A 1EY0A 1J9OA 3R8BA 3HOXH 4RAUC 1HNWQ 4E6IA 2MFIA 2JXMB 3TDQA 4YHHQ 4LMQD 4DR7L 3KF8A 1Y8PB 1V43A 2EJFC 5EPKA 5EBCA 1I4PA 1VMCA 1F2YA 2ALYB 1EUJA 4DNTB 3GP7A 1GHJA 1Z7TA 1V9PA 3K7UC 3K58A 4X66Q 4B3RL 3S1QB 1PZJD 4LW1A 1WCMH 4ME3A 1ET9A 1MKHA 1DCZA 3DEOA 2VQFQ 1HNZQ 2B63H 5FLXL 2F0HA 3I4MH 1KABA 1V1PB 1QCBD 2PZTA 1JOKA 4RCNA 4A3FH 1FGUA 2PCFB 3SDZA 3K8AA 1WI5A 5ELEA 1ONLA 4L5RC 4RHSA 1JICA 4FXKC 1FJGQ 4LFBQ 2KHIA 4GNXA 2RHQB 4DR6L 4K5VA 4JYAQ 3I4LA 1YZ6A 4F87A 1YNJC 5M3FG 4A3BG 4DV7Q 2F03A 1K83B 3H15A 2A8VA 3EVQA 3J80E 2Y0SG 3AB9A 2K04A 3FEWX 1JWUD 2YTXA 3TP7A 1PMRA 1PTOD 1BBXC 4CKEA 4IPCA 5C4XB 1N8RC 2R92B 1IHZA 2KHSA 4KKTA 2Z6KC 5JPNC 1X3QA 5L37A 5NUCA 2GA4B 1K8GA 1TIID 3MXNA 5I9PA 1XYIA 1HQRD 1CSPA 4J8QA 2YU9H 3MC0B 4CKBA 3K5LA 4K8IA 2ZJPA 1Y69U 3OOCA 1E1OA 2CQOA 3S15H 2N78A 5IGFA 4DA2A 4GKJQ 4PMBA 2K7VA 2K14A 4A3JH 2I5LX 2KCCA 3HOVG 2F52A 1STAA 3I56A 4X3TA 2E2JH 2NN6I 4N9TA 2FXQA 1AZQA 1PRTF 1EIYB 4DR7Q 4BY7H 5C3EB 1XWEA 2NVQB 4A75A 1C4QA 1LUZA 3GTGB 2Q8RE 5CBAE 3HOZH 4A93H 1RHPA 4JVZA 1A0IA 3MXPA 4B3RQ 3HP3A 1RCVD 2OQKA 4DAVA 4A3KG 1TKWB 1YI2A 1LT6D 3PGZA 1II3A 2BH8A 3W5OA 5IYDH 4JI6L 4Y7NH 4C3IH 2DNCA 1EY7A 2M9VA 4QMGA 3GTOB 5IWAQ 3E0EA 3PUVA 4WRDA 3N52A 2A19A 1GD7A 1E2VA 1BDOA 4P71A 4X62L 2I46A 1YNXA 3L2PA 1G2TA 2D0PA 1TU2B 4DK6C 1FD7D 1Y1WG 1BO0A 1HZAA 3HOXB 1G91A 1RDPD 4XIGS 3DEPA 4V190 1HUNA 2OF1A 1LO5D 1YHBA 3C3LA 4PQXA 2NBFA 4Y52H 1ICFB 3HKZE 4PMWA 1QE6A 2ZM6L 1SBBB 3CC4A 4O2DA 5J1ZA 1HZ9A 2D0OA 1WCMB 1CK1A 4DV5L 4B3ML 4ZQ3A 1F2ZA 1KXLA 4FNFA 1C7YA 4J6HA 1BVSA 4KKUA 2B63B 4NKLA 1Y8OB 2F0OA 3ERQA 3TZUA 1MIUA 4DGZA 1WTHA 3JAMc 2Q2TA 1BCPC 2VNUD 4A3FB 1PA6A 1EU4A 2AQ1B 1JB3A 3VR3A 2F4VL 2G9HD 3AEVA 1RTNA 1X32A 2VUMG 4EGVA 4DV1L 1I6HH 1XNQL 4CGYB 4BXXG 3GTKB 1WTPA 1HR0W 1YJNA 3HGBA 3MAQA 1EIGA 2I5MX 4GS3A 2F3IA 4XT1B 5FK9C 1CA6A 3VA7A 2F0TA 3C46A 1D1KA 5IOCA 4ZUJA 5EPJA 1UE1A 4NXNQ 3H3VH 2IX1A 4S3SA 3PO3H 5M5XH 2K4KA 5C0XH 1XPOA 3CPWA 1UEAB 2NZOA 2FMMA 1CTMA 5CV4A 4R8NA 2VB2X 2PW5A 1TWCH 3CHBD 3Q22A 1F9QA 1XPRA 1KD1C 3H3VC 5D3DA 1A63A 1MSHA 3IFTA 3PF5A 2FJ2A 2AUJD 1GUGA 2YU9B 2K28A 3NUCA 2F4IA 1G8ZD 4M1UB 5IYBG 3E9IA 1VQKA 2SNSA 1RD9D 4B08A 4A3GH 2XTIA 4DPGA 4A3JB 4QL5A 3S1MH 3OWEB 1SSOA 2UXCL 1A6XA 4C3HG 1AE2A 1AFPA 4TRDA 1D1IA 3W3AA 1L0YB 4EQ5A 3M7GA 5H1SE 3S2DB 3IAYA 3F2UA 1STYA 4HIOA 2E2JB 1VQPA 1B8AA 4YIJA 1R4QB 3FMCA 1CKNA 1XTDA 3D0FA 3PUWA 4A93B 4TKOB 1EYGA 3HOZB 2CHBD 5D3IB 2JA7B 1HH2P 2A69C 3MZ5A 1IBLL 1SRUA 2A6ED 3S24A 4B3MQ 1OXXK 4ILWA 1K0RA 3NWSA 1E22A 5JAVA 1ZKOA 4C3IB 3NK9A 3GTQH 1W6JA 1QVFA 2UU9Q 4XDXA 3TBIB 3HKZB 2VL6A 5KNDA 1N34Q 1HPCA 2A1AA 2F4VQ 3KK7A 1HR0L 1VDZA 2F0UA 3F8TA 1XNQQ 3GDEA 1JT8A 4CDCC 4FDBA 1HFGA 4RHRA 4OL7A 1YEZA 2AWNA 1H9KA 3BYTB 4DUZQ 2KCNA 5M3MH 4KHVA 3EFXD 3KLWA 3SK4A 3UDFA 2RHSB 1BCPB 1PH5A 1SYBA 5I4DA 4C3JG 4MN3A 1SYCA 5IP9G 4QIWE 2GVBA 2D2CC 4KV6A 4XTCS 1Z9FA 1BKBA 3FDTA 5BN3A 3C2PA 2LKVA 1I4QA 5JOBA 2AWOA 1KDCA 3P1HA 1FYCA 3AYHB 3GO5A 4RH6A 2F0KA 3I73A 5FLXc 3BZCA 4RKBA 3VYUA 4IURA 1QWYA 4X3SA 1VQJA 1PYWD 2JN4A 4MIUA 2D62A 1BXTA 4RCOA 1TT2A 3WDNA 1I6HB 2K5VA 3JAME 4IOAA 2R3ZA 3SK6A 2UXCQ 3TZDA 3CKIB 4OWTB 3ICEA 1BQQT 4I7AA 1SNOA 3UDXA 1GVPA 2EXZA 2J4XA 2B2TA 2KECA 1IKMA 4OELB 4BY1B 1G291 1TQOA 3EBEA 1SROA 4PZ7A 1HA6A 5M5XB 3TQYA 5CV9A 3OIPA 3TS0A 3CCMA 1SAPA 3CCUA 4A3DH 1T5XD 3NXWA 4RGNA 3D4DA 3NTKA 2Q8TA 4JBKA 2WB1G 2ZTEA 1N32Q 4FYDA 1QOHA 1FGBD 2RCFA 4GOPA 1ILQA 1JJCB 1E0BA 4M8AA 1STHA 2JA8G 2RDHA 4K2LA 4IFDG 4UY8C 3IFDA 4UP8A 1A15A 3GV3A 4A3GB 3BYYB 4R4OA 3S1MB 1HR0Q 4QQBX 1PYBA 5FJ8G 1IW7D 1HTLD 2PPBC 1F2MA 2VW9A 2BE5D 4RG1A 5KIXA 3S14B 2OTJA 1SE2A 2B2UC 3T16A 2F0EA 2SDFA 3CCEA 3SXHA 3KFUA 2BCOA 4OX9L 4OEMB 4DN4M 2PZUA 3GTPH 1GUNA 1NR2A 2MHVA 2F0NA 4ZCKA 3T1YL 4A3CH 4TSSA 1XMQL 2H5XA 4HJ7A 4AYBE 1KRTA 4HCEA 2WAQG 4DV2Q 3S1NH 3DHQA 3GTQB 1CT1D 4JCVE 1VQMA 2B2YC 2QGQA 1PRTC 4ZAIA 1Q82C 4L8JA 4MNOA 4R1JA 2IW3A 2QF7A 4QIWB 1B4OA 2EJGC 1IBKQ 1TWGH 1H9SA 2WIIB 1IBML 4LF9L 1NMGA 4A3IH 2ZJQA 1BCPF 2VB3X 3KBXA 2UXBL 1BBWA 1UNSA 1YNNC 1X65A 3RNUA 3EA6A 3S2HH 2B3GA 2K5WA 4LUOA 4MHEA 2L9HA 3U9SA 2QDBA 3L9AX 1OXTA 2KEEA 1PTOH 1WFQA 1XTCD 4C2MH 4L5QA 5J39A 3FP9A 1YITA 2R7DA 4L63B 2LFNA 4LAAA 3MTSA 2DY7A 4X64L 3K6OA 3I4OA 5EKIA 4G7HC 3KYHC 1PTOC 2UXDL 2HHHQ 1S5ED 3HOWH 1H95A 1A2UA 4I65A 1F2LA 1U4LA 3CCSA 2EJMA 5KGUA 2GVAA 3I91A 3SK8A 3VDYA 5LHY1 3ZYYX 1CHQD 5LMNL 4O1NA 2NVYH 4FF3A 1S3OA 5E1FA 5FLXE 2JE6I 4P2CB 4P75A 3N6RA 2D9UA 1LTAD 3U50C 4XQQA 1NE3A 1I94Q 2YV5A 2RDFA 1MJEA 3K0XA 1ZYRC 2X6LA 4KMUC 4IPDA 1RTOA 2NTSA 2E2IH 4K0KQ 1W3SA 1IYJB 1HHVA 5FLMH 3T1YQ 3A5ZB 1VQIA 1SYEA 3Q24A 1PH4A 1NY4A 5GAGC 3UDGA 5JEAH 1JE4A 2AUKA 2EY6A 5ELNA 1D2BA 2QW7A 5IYCH 3K0YA 5G3LD 4UPAA 3SR1A 3H3VI 1LYLA 4DV4Q 1KIXA 3L7ZC 4U68A 1IBMQ 5AJ3Q 2EIFA 2YYZA 4LF9Q 1E2ZA 2MJ8A 4AYBB 2UXBQ 1J8IA 1SXTA 3I4NH 2O5IC 3VR4A 2JP1A 4IPGA 5C5MA 4IUUA 2F0PA 3R2IA 4F8MA 4IJHA 1TWHH 3J80i 1JWMD 1G2SA 5HURA 1K28A 1NCVA 1PRTB 3OIQA 1O7YA 1K0SA 1DOKA 1QZHA 4X64Q 2ZTCA 2OWOA 4L6TB 2HUGA 4LF4Q 2Z0SA 3S1NB 3MVVA 2UXDQ 2NB0A 1EY6A 2EYFA 4BBRB 1DM0B 2JA5H 3SK5A 4DR4L 3I7FA 3G71A 1XX8A 2K75A 1Z6HA 1AN8A 3DUZA 1I5FA 3CXCA 5LMNQ 3FKIH 3L0OA 5C44G 2UUAL 3PO2H 1G6PA 4A3IB 4WJWA 3VYSA 3I72A 2JYOA 4U673 2H1EA 4UHVA 4JV5Q 3W1BA 4A3LG 3S2HB 1N36L 4PZ8A 1VQFA 2JJQA 3DXJC 4DR3Q 3ZJYC 1N9WA 4JI0Q 1V1PA 2ICEC 4DV0Q 2F0GA 1EY5A 2EDGA 2X6GA 2JQOA 4WJ4A 1Q1BA 4KHZA 1SNMA 1AEXA 2YTVA 1W6KA 1DONA 2F1MA 2BA1A 4DV3L 1XMOL 1JOOA 3NP8A 1HJPA 1G6ZA 4PMCA 2IL8A 5IGDA 1Y1VG 1BUVT 3UE1A 1K8MA 4J15A 2NVYB 2C9OA 1EOTA 1O7ZA 4F7XA 1E3PA 4KJNA 3TP5A 1IYVA 4JI7Q 2EE1A 4GLVB 3KUPA 3A55A 4ABNA 2PW7A 3PF4A 2K50A 1PH6A 3P7JA 3J81c 4BBSB 2KVMA 5M3FH 4A3BH 1WTQA 4CJ1B 1B3QA 2E2IB 4UDUC 4XQNA 1JJ2A 4OWWB 2XIWA 1LTID 3TS2A 1C48A 3J7AV 4OONA 5EAYA 4DKAC 5KNCA 1TWFB 1Q86C 5CORA 2CH4A 5GROA 2KBNA 3I3CA 2EYLA 3F2DA 2E2HH 1GUTA 1X54A 4YCVA 4KN7C 4LF5L 1X3FA 1STBA 3PIP3 2RSNA 1B44D 1KHIA 3RR5A 1EYDA 2Y0SE 3VR6A 3OW7A 4KHPQ 3RLFA 1M4VA 1I4XA 1EZ6A 1YJ9A 4OO1G 4BA1I 4JOIA 1PXUA 2DN8A 3ITPA 3CC2A 2B2WA 2BA0A 3GTLH 2L11A 1LTLA 3HOYG 2CKZB 3PQIA 1N36Q 5IGEA 4HAEA 2ASBA 1SMYD 3HOVH 5KEEA 2L15A 1E24A 1TWHB 4DNIA 2L5TA 2F0DA 2CW0D 4BS9A 4DUYL 1VQ5A 1D5XC 1YHAA 1I3QH 5JEAJ 3DWQA 5ELCA 3Q6SA 2JA7G 1KC8C 3SE0A 2KUMA 3CCQA 1WOCA 3D4WA 2JA5B 4A3KH 5HGQA 5T1GA 1E1TA 1EY8A 4BWGB 1UWVA 3A5UA 1XMOQ 4IJLA 3S17H 2Q2IA 1PV4A 1VQEA 3PO2B 3X3MA 2PI2E 3MFYA 4NMZA 1DJRD 1QILA 4DR6Q 5IE8A 3HKZG 2HD3A 1PTOF 4O42A 4DAYB 1EWCA 4DK1A 1YHQA 2G9DA 1LT4D 1V1QA 2PZWA 5CC4A 4UP7A 4IOCA 1CQVA 1A62A 4TQUS 1Y1WH 1PDQA 2SOBA 1B9MA 3CCVA 3I4MB 2R93G 5M5YH 1W2BA 2R7ZG 3Q8DA 2IY5B 4HEDA 5CV6A 2HT1A 4LF5Q 4HN7A 2V1CC 3J7ZC 4ALPA 3HS0C 4OGQC 1DXMA 3BJUA 4XYQA 3EN2A 4JI3L 3M85A 2Q2HA 3J7AF 2B29A 3F2CA 1MI2A 2R61A 2J0TD 3WWVA 5FO8B 3J80L 2VUMH 2GN5A 4BXXH 1X3PA 4OIJA 5EJWA 4A3BB 1PFBA 1X3EA 1EIHA 4KD3A 3G6JB 1WTWA 1IW7C 1Q12A 2Y0SB 4BY1G 4DUYQ 3WOEA 2B39A 2MO1A 3SHLA 2MP1A 4GZYC 1QZGA 3J81E 3PCOB 2I5HA 4Q5VA 1AW7A 3M7NA 2E5LL 4K6LA 1KAAA 4EQOA 2AHOB 2K5NA 1PH7A 1K9MC 2EQSA 1F77A 5C4JH 4JI6Q 1WVLA 3OW2A 3NTIA 2CFMA 4TVAB 3TEHB 3S15B 4NP5A 5CMDA 2RSOA 5IT9L 4ZKCB 2QKIC 4C1NI 2FMCA 3SGIA 4KD4A 5IGBA 4X62Q 4R8IA 4R4QA 3U9OA 5IYBH 1EWHA 3TREA 3GTLB 1KDBA 4HIDA 3KDFB 2IT1A 1YIJA 2ES2A 1PH2A 1PYSB 4LF8L 1H9MA 2B2TC 1YNJD 2JA6G 1D7QA 3RZOH 1EZ8A 2HIXA 4C3HH 3HOVB 4BY7B 1SE8A 2I0QA 2PQAB 4JW0A 1VQ7A 5A35A 2NVTH 2ZM6Q 4HIMA 3NBHB 1D5ZC 1SLJA 4RGTA 1SYFA 4DF7A 3STBC 1AP0A 4DV5Q 5DM73 4LUVA 1VQBA 1EQRA 1Q8IA 3V2TA 4ZRZA 1AE3A 1MJCA 4Y7NB 3ERSX 2RCNA 3H0GG 3R2TA 4DR5L 3HOUG 2OQ0A 1X9NA 3PUZA 1ENAA 3S17B 4LF6L 1RL2A 1DOLA 3PV0A 4KKSA 2IWHA 4AIMA 4XQJA 1UE7A 4DV1Q 1SNCA 1BF4A 5HGTA 1KQSA 1SE4A 1Z47A 2L4NA 2A6HC 4JI3Q 3W2DA 5CBEE 2ZJRA 4QJFA 1BR9A 1Y14B 2QDLA 1XNRL 1T5EA 5LL6S 1Q1EA 1VQNA 3RLNA 3D8GA 1QVGA 2UUCL 1XXGA 1Y1WB 1WYDA 2R6GA 3PIPA 2A68D 3D6CA 3LWUA 3HG9A 3VYRA 1JR0D 4G7OC 1OXSC 2RQXA 1GUOA 2IPKD 4CJ0B 5JJLA 1DGSA 3BVGA 1K8AC 3M3YH 5ELFA 2QEXA 4C3JH 3P75A 3L3OC 5IP9H 5FO7B 2NTTA 1JJGA 4YY3L 2PNRC 2QEJC 1HZCA 2RBMA 1IL2A 2K05A 3U4ZA 2UUBL 2F0FA 1S40A 2F0WA 1CKMA 5KNBA 2JA9A 5EBDA 2I07B 3P20A 4UP9A 4OHJA 1HZBA 5J22A 2NUCA 1EY9A 1EYAA 1Q7YC 1TS2A 1BNZA 1VQHA 1Q8KA 3NHHA 1KTKA 4LF8Q 2KHJA 4EX5A 3K80C 3PO3B 3NSWA 4HJ8A 2D5DA 1SFOH 3J81j 3KLSX 2C35B 4CJ2C 1HXYD 1TWCB 1SDFA 4QUCA 3OTOL 3PUXA 4GN4B 5EPLA 1IBLQ 1VQ6A 3KJPA 4DK0A 1EL0A 2ZT9C 5A2QL 2F0LA 1B70B 2KJXA 1OTCA 3C1EA 3E9HA 3QO2A 1KAWA 5DM63 3BDCA 4IUQA 2NN6G 2Z1CA 5IY0A 3IRBA 5C4JB 4ULLA 1BCPD 3LX0A 3TN2A 1X55A 1GUWA 3E3XA 5GAHC 1A3TA 3FPUB 1P16A 3H91A 4A76A 2JA8H 1FL0A 4RGOS 4YWLA 2F0MA 4IFDH 1X56A 3PIOA 3M4QA 5C0XJ 2LS01 4RFBA 3VYTA 1XNRQ 4R4TA 5GADC 3RZOB 4GN3B 2WB1E 4C3HB 1I50H 4DXFA 2P5ZX 2WP8J 5FJ8H 1IZ6A 1STEA 2EZVA 3FHWA 4C1NK 4QB4A 1XJVA 3J7A5 1QJOA 4HJ5A 1JB7A 3A0JA 3A54A 2CVRA 2EY5A 3EQLC 3EROA 4FF1A 2OTLA 3CW2C 4JI5L 5K36G 1NNXA 3GTMH 2N49A 2SNMA 1SMXA 2WFWA 4PV1C 2Z6BA 2BDNA 1WTXA 4A3EG 4DR2L 4JI4L 5IODA 4R9WA 2M00A 4NDXA 1K8OA 1R9TH 3A8IE 2UUBQ 2VS1A 1K3RA 3CU7A 1L1OC 3T1HL 4A3MG 2IX0A 4BBRG 1LTRD 4X3KA 5LL6X 4QCLA 1PH8A 1S72A 1DD2A 1PH1A 4N9PA 3U4VA 1X6OA 1ASYA 1Q46A 1QNUA 5JVG3 5J3BA 5M3MB 4WORA 3LGJA 2LXKA 3S16H 1J6QA 5DAUA 4F88A 4IUTA 1B2TA 1R4PB 3OTOQ 1EFID 1NMFA 3M3YB 4C3JB 1ICWA 1VQAA 1VQOA 4IO9A 1EU3A 5DNFA 3MA2B 1SEBD 1FNWA 5JJZA 4B9WA 1LLRD 1HTPA 3DWAA 3ER0A 2WKDA 1F9RA 3GD7A 2DUDA 1UE5A 4RA8A 3S1QH 5I6WA 1WTVA 1LTTD 5ELBA 2K5QA 4IALA 1UEBA 1PFMA 5EGTA 4HSVA 1VQ8A 2QCPX 5C6AA 2V4DA 2CQAA 5BR8L 4QGUA 2XGTA 5IP7G 3CF5A 4LJZC 4LFAL 5CYUA 1NSNS 3GTJH 1LT3D 3G7LA 3TSSA 3BDOA 4GLAC 1SFOB 3BZKA 2PQEA 2O4XA 4A3DB 2L12A 2KEDA 4OX9Q 1L0XB 4BBSG 4EQNA 1XMQQ 3AU7A 1S4ZA 4GKKL 2JSOA 4Z9CB 1HNWL 1JWSD 1MBYA 4JI5Q 2F0VA 5C4XG 2B2VA 2DJGC 4LF7L 5ISRA 2R92G 2QILA 2B2UA 4DR2Q 1ESRA 2WB1B 4JI4Q 2CW0C 2Z8LA 2E76C 3I90A 4DAMA 3JC66 1UUPA 1I4GA 4QF4A 2RA4A 1RODA 1AH9A 3KF6B 1S5FD 2EYHA 4GNXC 2JA8B 3RN5A 1OXUA 3NWTA 1MGSA 3UI2A 2E74C 4MTKA 5C0XI 4MTNA 3CPFA 1D8LA 1O80A 4AH6A 3BS1A 3ULLA 3A7AB 1OXVA 2XRSD 1GJXA 3LWEA 3MHBA 1F9PA 4FO2A 1I50B 4FP5D 1XPUA 3F1ZA 5M5WH 2IHFA 1FJGL 4LFBL 2RF4A 3GTPB 3RLOA 4CBVA 3CQZH 2A74C 1B1ZA 3KJOA 4JYAL 3BVZA 2QA4A 1QUQB 5C3EG 4ZKBB 1GXDC 3NBIA 1L1OB 1LTGD 2ZTDA 2JEAI 2ZXPA 4IFDJ 3AQQA 1QB5D 4X3UA 3GTGH 3T56B 3BG3A 3MEFA 1QG7A 2JEBI 4IQZA 4NB3A 3IL8A 1TWGB 2XSCA 5F2DA 4HJAA 3ULJA 1JCKB 2NVXH 1IXRA 4KJOA 1IYUA 2B2WC 3PUYA 1GHKA 3CCRA 4KN4C 5BR8Q 3NQTA 4CDDC 2WV6D 3Q23A 5C44H 1BBUA 2E2DC 2DGYA 2PYKA 3F2BA 3S16B 1PTOB 5ELOA 3HOXG 4C2MB 4GKJL 1B7YB 4A3LH 4QUFA 2EOTA 1VQ4A 2CH4W 4CDEC 3A56A 5AFWA 1BOSA 4FXGC 4KTAA 5I9OA 2XWBB 4GKKQ 4C56C 4BA2I 4L5TA 1SYGA 2ATWA 5G3LF 4AQYL 4KI0A 3HOWB 4LF7Q 1WCMG 2B63G
chains in the Genus database with same CATH topology
2R7FA 1T9HA 3Q8DA 3I4MG 2AWOA 2IY5B 4A3FG 2HT1A 4LF5Q 3AYHB 3HOWG 3GO5A 4LF4L 5FLXc 1WJJA 2V1CC 3BZCA 3KF8B 1CKOA 3J7ZC 4ALPA 1VQJA 1Q81C 2D62A 3S1RH 3BJUA 5JJIA 3CCJA 1U5KA 3EN2A 4JI3L 1M90C 2K5VA 1Y1VH 3J80c 2Q2HA 3M85A 5IWAL 4IOAA 2MQHA 3CMAA 2B29A 4L5SA 2UXCQ 3UE0A 3AFQA 2HQLA 3F2CA 1KL9A 4OWTB 3ICEA 3WWVA 3UDXA 2VUMH 5IP7H 3CMEA 1GVPA 1NJIC 2GN5A 3NENA 1EQQA 4BXXH 4JV5L 3OYYA 1X3EA 4DR4L 1K83H 3GTKH 1G291 3EBEA 4PZ7A 1SROA 4POGA 1Q12A 4DR1L 3KF6A 3TQYA 4DK3C 4YHHL 3TS0A 5FLMG 3CCMA 4BY1G 4DUYQ 4HIKA 3G4SA 4LUZA 4NPSA 3CCUA 4GNXB 4DR3L 3CCLA 2MO1A 4BBSH 4A3DH 1VQDA 2MO0A 1QZGA 2N3SA 3PCOB 4JBKA 2I5HA 4X66L 4JI0L 2WB1G 3M7NA 1YVCA 2ZTEA 4OWXB 5C4XH 4P73A 2E5LL 1N32Q 1VCIA 2JK8A 4DV0L 1PH7A 4X65Q 2AHOB 2K5NA 1K9MC 1VQLA 2R92H 2EQSA 3AFPA 3K7AH 4JI1L 5JEAG 5DLQE 5IT9c 1JJCB 5C4JH 2VQFL 4GOPA 3OW2A 3T1HQ 3TEHB 2CFMA 4TVAB 1HNZL 5IYCG 4PG3A 2LSSA 1TWFH 2JA8G 3TRZA 1J5EQ 4IFDG 2UUAQ 4UY8C 3SGIA 4UP8A 1HNXL 4O0AA 4X62Q 4R4QA 4R4OA 4A3JG 1P8LA 1QUQA 5IYBH 3TREA 3UDIA 1HR0Q 4HIDA 3KDFB 2IT1A 2KCMA 1U0LA 1YIJA 2ES2A 1PH2A 1N33Q 1L1OA 3I4NG 4QQBX 1PYBA 1PYSB 5FJ8G 4LF8L 2JA6G 1D7QA 1G51A 2VW9A 3RZOH 2HIXA 4RG1A 4C3HH 4DV6L 3MXNB 1SE8A 4DV7L 2I0QA 2PQAB 4JI2L 1VQ7A 4GLXA 3HOYH 4JI7L 2NVTH 2ZM6Q 2OTJA 5LMUL 4HIMA 4BY7G 3NBHB 1UE6A 4DR4Q 1SLJA 1RIPA 3CCEA 4A93G 3KFUA 3HOZG 3STBC 3S2DH 4B3TL 4B3SQ 1W2BA 4JBWA 4OX9L 4DV5Q 3GTPH 4LUVA 4AQYQ 1VQBA 1EQRA 1SR3A 4NXNL 5C3EH 4WJ3M 1EOVA 1VS0A 4LFCQ 2NVQH 1AE3A 2VZAA 3T1YL 1MJCA 1VQ9A 4IFDI 1XMQL 2H5XA 3J81i 4A3CH 4HJ7A 4JI8L 4P72A 1PFSA 2PMZE 3ERSX 2RCNA 3H0GG 4PZ6A 4AYBE 4DR5L 3HOUG 1KRTA 2JA7H 2WAQG 4DV3Q 1PH3A 4DV2Q 2JA5G 1CSQA 2OQ0A 5IYDG 3S1NH 1X9NA 2K5HA 3M4PA 4JCVE 1O7IA 3PUZA 4JOIC 1VQMA 2QGQA 1Q82C 4JBMA 4LF6L 1RL2A 3FKIG 3PV0A 4MNOA 3PO2G 4R1JA 4AIMA 1M1KC 1UE7A 4DV1Q 3GTOH 2E8GA 1KQSA 4LFAQ 1Z47A 1CUKA 4JI3Q 3NELA 4JBJA 1IBKQ 2ZJRA 3RN2A 1TWGH 4QJFA 1IBML 1Y14B 5GAEC 1NMGA 4A3IH 4H02A 4LF9L 1XNRL 3D31A 4KHPL 2ZJQA 1PVOA 4LNQA 2ID0A 1Q1EA 3PSIA 1VQNA 3RLNA 2UXBL 1BBWA 3A74A 5E7NA 1X65A 2LXJA 2IHEA 3RNUA 1QVGA 2UUCL 2B3GA 3S2HH 1WYDA 2R6GA 4LUOA 3PIPA 3HOXH 3K81C 2Q2UA 1HNWQ 4JI6L 1OXTA 1PH9A 1FVIA 2MFIA 4DR1Q 1OXSC 1WFQA 4YHHQ 4DR7L 4C2MH 1YITA 4L5QA 3FP9A 4P74A 2R7DA 1V43A 2BH2A 5JJLA 1DGSA 1K8AC 2ALYB 1VQGA 1EUJA 3M3YH 1JE5A 1V9PA 3K7UC 4C3JH 4X66Q 4X64L 2QEXA 4NXML 1GO3E 4B3RL 5IP9H 3I4OA 1JJGA 2AMCB 4LW1A 4YY3L 3KYHC 1WCMH 4ME3A 1MKHA 2UXDL 4JI1Q 1HZCA 2HHHQ 2VQFQ 1IL2A 2R93H 1HNZQ 3HOWH 2B63H 1H95A 2R7ZH 2Z6KA 3U4ZA 3I4MH 2UUBL 3CCSA 4X6AH 4A3FH 1FGUA 1S40A 2GVAA 3K8AA 4R4CA 3VDYA 1HNXQ 4RMFA 1CKMA 1WI5A 5LMNL 3CAMA 2JA9A 4L5RC 4MZ9A 2CWAA 4UP9A 2UU9L 1HZBA 1FJGQ 2NVYH 1S3OA 1X3GA 2KHIA 2N8NA 4GNXA 1Q7YC 1C9OA 4LFBQ 1VQHA 1Q8KA 1VQCA 2JE6I 1N34L 2RHQB 4LF8Q 2KHJA 3CP0A 4P75A 4DR6L 4EX5A 3K80C 4JYAQ 1YZ6A 4DV6Q 5M3FG 4A3BG 4DV7Q 4HJ8A 3U50C 1SFOH 4JI2Q 3H15A 1NE3A 3J81j 1I94Q 2A8VA 3PO3G 2YV5A 2C35B 5C0XG 2Y0SG 5LMUQ 1MJEA 4JI6Q 3OTOL 3K0XA 3PUXA 4GN4B 4LWCA 1IBLQ 2YTXA 1VQ6A 4B3TQ 3KJPA 4K0KQ 2E2IH 4IPDA 4DUZL 1W3SA 1IYJB 1B70B 1OTCA 5FLMH 4BY1H 4IPCA 3E9HA 3T1YQ 1N8RC 1KAWA 2NN6G 3A5ZB 1VQIA 4JI8Q 5IY0A 3IRBA 3KDFA 2Z6KC 1PH4A 1NY4A 1K8GA 1X55A 5GAGC 3UDGA 5GAHC 4YWKA 3M9BA 5ELNA 1YJWA 1C0AA 1P16A 1CSPA 2PQAA 4GN5A 5IYCH 4A76A 2YU9H 3KOJA 2JA8H 1FL0A 4A3GG 2ZJPA 3RZDH 4YWLA 3JAMi 5JJKA 3S15H 1L2FA 1E1OA 1X56A 2CQOA 4UPAA 1LYLA 2N78A 4DV4Q 3PIOA 1PHJA 1KIXA 3H3VI 3M4QA 5C0XJ 3L7ZC 2PI2A 1IBMQ 5AJ3Q 4GKJQ 2EIFA 2YYZA 1GKHA 2K14A 4A3JH 4LF9Q 1XNRQ 3DM3A 4R4TA 5GADC 2I5LX 4GN3B 2WB1E 3HOVG 2F52A 1I50H 2UXBQ 2VQEL 3I4NH 2WP8J 5FJ8H 1IZ6A 2JA6H 3FHWA 3I56A 1XJVA 4IPGA 3J7A5 2E2JH 2NN6I 4HJ5A 2FXQA 1JB7A 4IJHA 3A0JA 1TWHH 1EIYB 3J80i 1E7ZA 4DR7Q 2EXDA 2OTLA 3S14H 4BY7H 3CW2C 4GOPC 4JI5L 5GQOA 4A75A 3ULPA 4A93H 1LUZA 2N49A 3GTMH 3HOZH 5K36G 1K73C 1SMXA 2WFWA 2KCTA 4X64Q 1A0IA 2ZTCA 1QZHA 2OWOA 4A3EG 4NXMQ 4B3RQ 4DR2L 2OQKA 4JI4L 4LF4Q 1QVCA 2Z0SA 4A3KG 1EIFA 2UXDQ 1YI2A 1N32L 3PGZA 1CKNB 2BH8A 3H0GH 1JMCA 3HOUH 1R9TH 1EWIA 2JA5H 2UUBQ 2VS1A 3W5OA 5IYDH 1K3RA 3I7FA 4Y7NH 1L1OC 1A8VA 2K75A 4C3IH 2IX0A 4BBRG 3G71A 3T1HL 4A3MG 5IWAQ 3E0EA 3PUVA 1I5FA 3CXCA 5LMNQ 1S72A 1PH8A 1PH1A 3FKIH 3L0OA 2A19A 3U4VA 1X6OA 5C44G 2UUAL 1GD7A 3PO2H 1KRSA 1G6PA 4P71A 4X62L 1ASYA 1Q46A 1YNXA 5J3BA 4JV5Q 3LGJA 3W1BA 3L2PA 1TXYA 2D0PA 2LXKA 4A3LG 2CWPA 4DK6C 1Y1WG 3S16H 1N36L 1HZAA 2YTYA 5M3MG 1J6QA 4XIGS 4PZ8A 1VQFA 2JJQA 1YHBA 4DR3Q 3ZJYC 3CC7A 3G6EA 3OTOQ 1N9WA 4Y52H 4JI0Q 1NMFA 3HKZE 4PMWA 2E5LQ 2ZM6L 4DV0Q 3CC4A 1VQAA 4O2DA 1VQOA 1NTGA 4IO9A 1HZ9A 2JQOA 2K52A 3M4OH 2D0OA 4DV5L 4B3ML 4WJ4A 1Q1BA 1KXLA 1C7YA 1BVSA 3ER0A 4KHZA 2Q2TA 1MIUA 3BU2A 2DUDA 1UE5A 3GD7A 3JAMc 2MNAA 3HKSA 2YTVA 2AKWB 1PA6A 3S1QH 2VNUD 2BA1A 4DV3L 1XMOL 4DV2L 1HJPA 1UEBA 1Y1VG 3UE1A 2F4VL 4J15A 1VQ8A 2CCZA 3AEVA 5BR8L 4QGUA 2VUMG 2XGTA 5IP7G 3CF5A 4DV1L 1XNQL 1E3PA 1I6HH 4BXXG 3I55A 4LFAL 3DLLA 1HR0W 4JI7Q 4GLVB 3GTJH 1YJNA 2VQEQ 1IBKL 2I5MX 4GLAC 2F3IA 3NEMA 1NBWA 2K50A 3BZKA 4GS3A 1PH6A 3PF4A 3J81c 2OCEA 4OX9Q 5M3FH 4A3BH 1UE1A 4NXNQ 4A3DG 3H3VH 2IX1A 4BBSG 4IPHA 3PO3H 4OXPA 5M5XH 2K4KA 1XMQQ 1JJ2A 4OWWB 4GKKL 1HNWL 1XPOA 3CPWA 4JI5Q 2NZOA 3TS2A 5C4XG 4DR5Q 1YBYA 4LF7L 4OONA 1TWCH 5EAYA 4JC0A 4DKAC 2R92G 1XPRA 1Q86C 4DR2Q 5GROA 4JI4Q 2KBNA 3F2DA 1KD1C 1ASZA 4DAMA 3JC66 1A63A 2PNHA 2E2HH 4LF6Q 1X54A 4YCVA 1SN8A 4POFA 4LF5L 3PF5A 1AH9A 3KF6B 1GM5A 1X3FA 4GNXC 1TWAH 1OXUA 3RN5A 2HHHL 1KHIA 3RR5A 5C0XI 4A4IA 5IYBG 2Y0SE 4MTNA 3E9IA 4KHPQ 3CPFA 3RLFA 1D8LA 1LM0A 4AH6A 3U58A 1VQKA 1YJ9A 4OO1G 3ULLA 4A3GH 2XTIA 4DPGA 4YCUA 4BA1I 4QL5A 3S1MH 1OXVA 4JOIA 3CC2A 3GTLH 2UXCL 2BA0A 2UUCQ 4GOPB 4AYBG 1AE2A 1LTLA 1XPUA 3F1ZA 5M5WH 2HIVA 4EQ5A 5H1SE 2IHFA 2CKZB 1EFWA 1FJGL 3HOYG 1N36Q 4LFBL 5LMNW 2RF4A 4HIOA 2ASBA 3RLOA 3HOVH 1VQPA 3CQZH 1B8AA 2L15A 3KJOA 1E24A 4JYAL 1CKNA 2NZHA 4APVA 1XTDA 4DNIA 2QA4A 1QUQB 5C3EG 3D0FA 3PUWA 4DUYL 1I94L 1EYGA 1VQ5A 4A3CG 4YY3Q 1L1OB 1HH2P 5HY6A 1YHAA 1I3QH 5JEAJ 1IBLL 1SRUA 3EIVA 2JA7G 1KC8C 2ZTDA 2JEAI 3S24A 4B3MQ 4K0KL 4X65L 1OXXK 3CCQA 1K0RA 4A3EH 1WOCA 3I2ZA 3AQQA 4IFDJ 4OO1I 3GTGH 1E22A 4YWMA 3MEFA 4YCWA 3W1GA 4A3KH 2JEBI 5HGQA 4NB3A 2VY3A 1E1TA 3GTQH 1J5EL 1QVFA 1UWVA 4HJAA 3A5UA 1XMOQ 2UU9Q 4IJLA 3ULJA 3S17H 2Q2IA 1PV4A 1VQEA 2VL6A 1L0WA 1N34Q 2NVXH 1IXRA 2A1AA 2PI2E 2KENA 4QY7A 4BBRH 4HJ9A 4A3IG 4A3MH 2F4VQ 3PUYA 5IE8A 4DR6Q 3HKZG 1HR0L 3CCRA 5BR8Q 4JG2A 3F8TA 1N33L 4DAYB 1XNQQ 1YHQA 5C44H 2WAQE 1BBUA 3GDEA 4DV4L 1JT8A 1V1QA 2DGYA 3F2BA 4FDBA 5ELOA 3HOXG 5AJ3L 4GKJL 4UP7A 1YEZA 1B7YB 4IOCA 2AWNA 4A3LH 1A62A 4TQUS 1VQ4A 4DUZQ 1Y1WH 5M3MH 3STBD 4R4IA 3KLWA 3B6YA 3UDFA 2RHSB 1PH5A 4KLKA 4GKKQ 4BA2I 4B3SL 3G48A 4L5TA 3CD6A 2ATWA 4AQYL 5IP9G 4KI0A 4LFCL 4QIWE 3CCVA 2GVBA 4LF7Q 1WCMG 4XTCS 1Z9FA 1BKBA 2R93G 5M5YH 2B63G 3HFZB 2R7ZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7F A;  1T9H A;  3Q8D A;  3I4M G;  2AWO A;  2IY5 B;  4A3F G;  2HT1 A;  4LF5 Q;  3AYH B;  3HOW G;  3GO5 A;  4LF4 L;  5FLX c;  1WJJ A;  2V1C C;  3BZC A;  3KF8 B;  1CKO A;  3J7Z C;  4ALP A;  1VQJ A;  1Q81 C;  2D62 A;  3S1R H;  3BJU A;  5JJI A;  3CCJ A;  1U5K A;  3EN2 A;  4JI3 L;  1M90 C;  2K5V A;  1Y1V H;  3J80 c;  2Q2H A;  3M85 A;  5IWA L;  4IOA A;  2MQH A;  3CMA A;  2B29 A;  4L5S A;  2UXC Q;  3UE0 A;  3AFQ A;  2HQL A;  3F2C A;  1KL9 A;  4OWT B;  3ICE A;  3WWV A;  3UDX A;  2VUM H;  5IP7 H;  3CME A;  1GVP A;  1NJI C;  2GN5 A;  3NEN A;  1EQQ A;  4BXX H;  4JV5 L;  3OYY A;  1X3E A;  4DR4 L;  1K83 H;  3GTK H;  1G29 1;  3EBE A;  4PZ7 A;  1SRO A;  4POG A;  1Q12 A;  4DR1 L;  3KF6 A;  3TQY A;  4DK3 C;  4YHH L;  3TS0 A;  5FLM G;  3CCM A;  4BY1 G;  4DUY Q;  4HIK A;  3G4S A;  4LUZ A;  4NPS A;  3CCU A;  4GNX B;  4DR3 L;  3CCL A;  2MO1 A;  4BBS H;  4A3D H;  1VQD A;  2MO0 A;  1QZG A;  2N3S A;  3PCO B;  4JBK A;  2I5H A;  4X66 L;  4JI0 L;  2WB1 G;  3M7N A;  1YVC A;  2ZTE A;  4OWX B;  5C4X H;  4P73 A;  2E5L L;  1N32 Q;  1VCI A;  2JK8 A;  4DV0 L;  1PH7 A;  4X65 Q;  2AHO B;  2K5N A;  1K9M C;  1VQL A;  2R92 H;  2EQS A;  3AFP A;  3K7A H;  4JI1 L;  5JEA G;  5DLQ E;  5IT9 c;  1JJC B;  5C4J H;  2VQF L;  4GOP A;  3OW2 A;  3T1H Q;  3TEH B;  2CFM A;  4TVA B;  1HNZ L;  5IYC G;  4PG3 A;  2LSS A;  1TWF H;  2JA8 G;  3TRZ A;  1J5E Q;  4IFD G;  2UUA Q;  4UY8 C;  3SGI A;  4UP8 A;  1HNX L;  4O0A A;  4X62 Q;  4R4Q A;  4R4O A;  4A3J G;  1P8L A;  1QUQ A;  5IYB H;  3TRE A;  3UDI A;  1HR0 Q;  4HID A;  3KDF B;  2IT1 A;  2KCM A;  1U0L A;  1YIJ A;  2ES2 A;  1PH2 A;  1N33 Q;  1L1O A;  3I4N G;  4QQB X;  1PYB A;  1PYS B;  5FJ8 G;  4LF8 L;  2JA6 G;  1D7Q A;  1G51 A;  2VW9 A;  3RZO H;  2HIX A;  4RG1 A;  4C3H H;  4DV6 L;  3MXN B;  1SE8 A;  4DV7 L;  2I0Q A;  2PQA B;  4JI2 L;  1VQ7 A;  4GLX A;  3HOY H;  4JI7 L;  2NVT H;  2ZM6 Q;  2OTJ A;  5LMU L;  4HIM A;  4BY7 G;  3NBH B;  1UE6 A;  4DR4 Q;  1SLJ A;  1RIP A;  3CCE A;  4A93 G;  3KFU A;  3HOZ G;  3STB C;  3S2D H;  4B3T L;  4B3S Q;  1W2B A;  4JBW A;  4OX9 L;  4DV5 Q;  3GTP H;  4LUV A;  4AQY Q;  1VQB A;  1EQR A;  1SR3 A;  4NXN L;  5C3E H;  4WJ3 M;  1EOV A;  1VS0 A;  4LFC Q;  2NVQ H;  1AE3 A;  2VZA A;  3T1Y L;  1MJC A;  1VQ9 A;  4IFD I;  1XMQ L;  2H5X A;  3J81 i;  4A3C H;  4HJ7 A;  4JI8 L;  4P72 A;  1PFS A;  2PMZ E;  3ERS X;  2RCN A;  3H0G G;  4PZ6 A;  4AYB E;  4DR5 L;  3HOU G;  1KRT A;  2JA7 H;  2WAQ G;  4DV3 Q;  1PH3 A;  4DV2 Q;  2JA5 G;  1CSQ A;  2OQ0 A;  5IYD G;  3S1N H;  1X9N A;  2K5H A;  3M4P A;  4JCV E;  1O7I A;  3PUZ A;  4JOI C;  1VQM A;  2QGQ A;  1Q82 C;  4JBM A;  4LF6 L;  1RL2 A;  3FKI G;  3PV0 A;  4MNO A;  3PO2 G;  4R1J A;  4AIM A;  1M1K C;  1UE7 A;  4DV1 Q;  3GTO H;  2E8G A;  1KQS A;  4LFA Q;  1Z47 A;  1CUK A;  4JI3 Q;  3NEL A;  4JBJ A;  1IBK Q;  2ZJR A;  3RN2 A;  1TWG H;  4QJF A;  1IBM L;  1Y14 B;  5GAE C;  1NMG A;  4A3I H;  4H02 A;  4LF9 L;  1XNR L;  3D31 A;  4KHP L;  2ZJQ A;  1PVO A;  4LNQ A;  2ID0 A;  1Q1E A;  3PSI A;  1VQN A;  3RLN A;  2UXB L;  1BBW A;  3A74 A;  5E7N A;  1X65 A;  2LXJ A;  2IHE A;  3RNU A;  1QVG A;  2UUC L;  2B3G A;  3S2H H;  1WYD A;  2R6G A;  4LUO A;  3PIP A;  3HOX H;  3K81 C;  2Q2U A;  1HNW Q;  4JI6 L;  1OXT A;  1PH9 A;  1FVI A;  2MFI A;  4DR1 Q;  1OXS C;  1WFQ A;  4YHH Q;  4DR7 L;  4C2M H;  1YIT A;  4L5Q A;  3FP9 A;  4P74 A;  2R7D A;  1V43 A;  2BH2 A;  5JJL A;  1DGS A;  1K8A C;  2ALY B;  1VQG A;  1EUJ A;  3M3Y H;  1JE5 A;  1V9P A;  3K7U C;  4C3J H;  4X66 Q;  4X64 L;  2QEX A;  4NXM L;  1GO3 E;  4B3R L;  5IP9 H;  3I4O A;  1JJG A;  2AMC B;  4LW1 A;  4YY3 L;  3KYH C;  1WCM H;  4ME3 A;  1MKH A;  2UXD L;  4JI1 Q;  1HZC A;  2HHH Q;  2VQF Q;  1IL2 A;  2R93 H;  1HNZ Q;  3HOW H;  2B63 H;  1H95 A;  2R7Z H;  2Z6K A;  3U4Z A;  3I4M H;  2UUB L;  3CCS A;  4X6A H;  4A3F H;  1FGU A;  1S40 A;  2GVA A;  3K8A A;  4R4C A;  3VDY A;  1HNX Q;  4RMF A;  1CKM A;  1WI5 A;  5LMN L;  3CAM A;  2JA9 A;  4L5R C;  4MZ9 A;  2CWA A;  4UP9 A;  2UU9 L;  1HZB A;  1FJG Q;  2NVY H;  1S3O A;  1X3G A;  2KHI A;  2N8N A;  4GNX A;  1Q7Y C;  1C9O A;  4LFB Q;  1VQH A;  1Q8K A;  1VQC A;  2JE6 I;  1N34 L;  2RHQ B;  4LF8 Q;  2KHJ A;  3CP0 A;  4P75 A;  4DR6 L;  4EX5 A;  3K80 C;  4JYA Q;  1YZ6 A;  4DV6 Q;  5M3F G;  4A3B G;  4DV7 Q;  4HJ8 A;  3U50 C;  1SFO H;  4JI2 Q;  3H15 A;  1NE3 A;  3J81 j;  1I94 Q;  2A8V A;  3PO3 G;  2YV5 A;  2C35 B;  5C0X G;  2Y0S G;  5LMU Q;  1MJE A;  4JI6 Q;  3OTO L;  3K0X A;  3PUX A;  4GN4 B;  4LWC A;  1IBL Q;  2YTX A;  1VQ6 A;  4B3T Q;  3KJP A;  4K0K Q;  2E2I H;  4IPD A;  4DUZ L;  1W3S A;  1IYJ B;  1B70 B;  1OTC A;  5FLM H;  4BY1 H;  4IPC A;  3E9H A;  3T1Y Q;  1N8R C;  1KAW A;  2NN6 G;  3A5Z B;  1VQI A;  4JI8 Q;  5IY0 A;  3IRB A;  3KDF A;  2Z6K C;  1PH4 A;  1NY4 A;  1K8G A;  1X55 A;  5GAG C;  3UDG A;  5GAH C;  4YWK A;  3M9B A;  5ELN A;  1YJW A;  1C0A A;  1P16 A;  1CSP A;  2PQA A;  4GN5 A;  5IYC H;  4A76 A;  2YU9 H;  3KOJ A;  2JA8 H;  1FL0 A;  4A3G G;  2ZJP A;  3RZD H;  4YWL A;  3JAM i;  5JJK A;  3S15 H;  1L2F A;  1E1O A;  1X56 A;  2CQO A;  4UPA A;  1LYL A;  2N78 A;  4DV4 Q;  3PIO A;  1PHJ A;  1KIX A;  3H3V I;  3M4Q A;  5C0X J;  3L7Z C;  2PI2 A;  1IBM Q;  5AJ3 Q;  4GKJ Q;  2EIF A;  2YYZ A;  1GKH A;  2K14 A;  4A3J H;  4LF9 Q;  1XNR Q;  3DM3 A;  4R4T A;  5GAD C;  2I5L X;  4GN3 B;  2WB1 E;  3HOV G;  2F52 A;  1I50 H;  2UXB Q;  2VQE L;  3I4N H;  2WP8 J;  5FJ8 H;  1IZ6 A;  2JA6 H;  3FHW A;  3I56 A;  1XJV A;  4IPG A;  3J7A 5;  2E2J H;  2NN6 I;  4HJ5 A;  2FXQ A;  1JB7 A;  4IJH A;  3A0J A;  1TWH H;  1EIY B;  3J80 i;  1E7Z A;  4DR7 Q;  2EXD A;  2OTL A;  3S14 H;  4BY7 H;  3CW2 C;  4GOP C;  4JI5 L;  5GQO A;  4A75 A;  3ULP A;  4A93 H;  1LUZ A;  2N49 A;  3GTM H;  3HOZ H;  5K36 G;  1K73 C;  1SMX A;  2WFW A;  2KCT A;  4X64 Q;  1A0I A;  2ZTC A;  1QZH A;  2OWO A;  4A3E G;  4NXM Q;  4B3R Q;  4DR2 L;  2OQK A;  4JI4 L;  4LF4 Q;  1QVC A;  2Z0S A;  4A3K G;  1EIF A;  2UXD Q;  1YI2 A;  1N32 L;  3PGZ A;  1CKN B;  2BH8 A;  3H0G H;  1JMC A;  3HOU H;  1R9T H;  1EWI A;  2JA5 H;  2UUB Q;  2VS1 A;  3W5O A;  5IYD H;  1K3R A;  3I7F A;  4Y7N H;  1L1O C;  1A8V A;  2K75 A;  4C3I H;  2IX0 A;  4BBR G;  3G71 A;  3T1H L;  4A3M G;  5IWA Q;  3E0E A;  3PUV A;  1I5F A;  3CXC A;  5LMN Q;  1S72 A;  1PH8 A;  1PH1 A;  3FKI H;  3L0O A;  2A19 A;  3U4V A;  1X6O A;  5C44 G;  2UUA L;  1GD7 A;  3PO2 H;  1KRS A;  1G6P A;  4P71 A;  4X62 L;  1ASY A;  1Q46 A;  1YNX A;  5J3B A;  4JV5 Q;  3LGJ A;  3W1B A;  3L2P A;  1TXY A;  2D0P A;  2LXK A;  4A3L G;  2CWP A;  4DK6 C;  1Y1W G;  3S16 H;  1N36 L;  1HZA A;  2YTY A;  5M3M G;  1J6Q A;  4XIG S;  4PZ8 A;  1VQF A;  2JJQ A;  1YHB A;  4DR3 Q;  3ZJY C;  3CC7 A;  3G6E A;  3OTO Q;  1N9W A;  4Y52 H;  4JI0 Q;  1NMF A;  3HKZ E;  4PMW A;  2E5L Q;  2ZM6 L;  4DV0 Q;  3CC4 A;  1VQA A;  4O2D A;  1VQO A;  1NTG A;  4IO9 A;  1HZ9 A;  2JQO A;  2K52 A;  3M4O H;  2D0O A;  4DV5 L;  4B3M L;  4WJ4 A;  1Q1B A;  1KXL A;  1C7Y A;  1BVS A;  3ER0 A;  4KHZ A;  2Q2T A;  1MIU A;  3BU2 A;  2DUD A;  1UE5 A;  3GD7 A;  3JAM c;  2MNA A;  3HKS A;  2YTV A;  2AKW B;  1PA6 A;  3S1Q H;  2VNU D;  2BA1 A;  4DV3 L;  1XMO L;  4DV2 L;  1HJP A;  1UEB A;  1Y1V G;  3UE1 A;  2F4V L;  4J15 A;  1VQ8 A;  2CCZ A;  3AEV A;  5BR8 L;  4QGU A;  2VUM G;  2XGT A;  5IP7 G;  3CF5 A;  4DV1 L;  1XNQ L;  1E3P A;  1I6H H;  4BXX G;  3I55 A;  4LFA L;  3DLL A;  1HR0 W;  4JI7 Q;  4GLV B;  3GTJ H;  1YJN A;  2VQE Q;  1IBK L;  2I5M X;  4GLA C;  2F3I A;  3NEM A;  1NBW A;  2K50 A;  3BZK A;  4GS3 A;  1PH6 A;  3PF4 A;  3J81 c;  2OCE A;  4OX9 Q;  5M3F H;  4A3B H;  1UE1 A;  4NXN Q;  4A3D G;  3H3V H;  2IX1 A;  4BBS G;  4IPH A;  3PO3 H;  4OXP A;  5M5X H;  2K4K A;  1XMQ Q;  1JJ2 A;  4OWW B;  4GKK L;  1HNW L;  1XPO A;  3CPW A;  4JI5 Q;  2NZO A;  3TS2 A;  5C4X G;  4DR5 Q;  1YBY A;  4LF7 L;  4OON A;  1TWC H;  5EAY A;  4JC0 A;  4DKA C;  2R92 G;  1XPR A;  1Q86 C;  4DR2 Q;  5GRO A;  4JI4 Q;  2KBN A;  3F2D A;  1KD1 C;  1ASZ A;  4DAM A;  3JC6 6;  1A63 A;  2PNH A;  2E2H H;  4LF6 Q;  1X54 A;  4YCV A;  1SN8 A;  4POF A;  4LF5 L;  3PF5 A;  1AH9 A;  3KF6 B;  1GM5 A;  1X3F A;  4GNX C;  1TWA H;  1OXU A;  3RN5 A;  2HHH L;  1KHI A;  3RR5 A;  5C0X I;  4A4I A;  5IYB G;  2Y0S E;  4MTN A;  3E9I A;  4KHP Q;  3CPF A;  3RLF A;  1D8L A;  1LM0 A;  4AH6 A;  3U58 A;  1VQK A;  1YJ9 A;  4OO1 G;  3ULL A;  4A3G H;  2XTI A;  4DPG A;  4YCU A;  4BA1 I;  4QL5 A;  3S1M H;  1OXV A;  4JOI A;  3CC2 A;  3GTL H;  2UXC L;  2BA0 A;  2UUC Q;  4GOP B;  4AYB G;  1AE2 A;  1LTL A;  1XPU A;  3F1Z A;  5M5W H;  2HIV A;  4EQ5 A;  5H1S E;  2IHF A;  2CKZ B;  1EFW A;  1FJG L;  3HOY G;  1N36 Q;  4LFB L;  5LMN W;  2RF4 A;  4HIO A;  2ASB A;  3RLO A;  3HOV H;  1VQP A;  3CQZ H;  1B8A A;  2L15 A;  3KJO A;  1E24 A;  4JYA L;  1CKN A;  2NZH A;  4APV A;  1XTD A;  4DNI A;  2QA4 A;  1QUQ B;  5C3E G;  3D0F A;  3PUW A;  4DUY L;  1I94 L;  1EYG A;  1VQ5 A;  4A3C G;  4YY3 Q;  1L1O B;  1HH2 P;  5HY6 A;  1YHA A;  1I3Q H;  5JEA J;  1IBL L;  1SRU A;  3EIV A;  2JA7 G;  1KC8 C;  2ZTD A;  2JEA I;  3S24 A;  4B3M Q;  4K0K L;  4X65 L;  1OXX K;  3CCQ A;  1K0R A;  4A3E H;  1WOC A;  3I2Z A;  3AQQ A;  4IFD J;  4OO1 I;  3GTG H;  1E22 A;  4YWM A;  3MEF A;  4YCW A;  3W1G A;  4A3K H;  2JEB I;  5HGQ A;  4NB3 A;  2VY3 A;  1E1T A;  3GTQ H;  1J5E L;  1QVF A;  1UWV A;  4HJA A;  3A5U A;  1XMO Q;  2UU9 Q;  4IJL A;  3ULJ A;  3S17 H;  2Q2I A;  1PV4 A;  1VQE A;  2VL6 A;  1L0W A;  1N34 Q;  2NVX H;  1IXR A;  2A1A A;  2PI2 E;  2KEN A;  4QY7 A;  4BBR H;  4HJ9 A;  4A3I G;  4A3M H;  2F4V Q;  3PUY A;  5IE8 A;  4DR6 Q;  3HKZ G;  1HR0 L;  3CCR A;  5BR8 Q;  4JG2 A;  3F8T A;  1N33 L;  4DAY B;  1XNQ Q;  1YHQ A;  5C44 H;  2WAQ E;  1BBU A;  3GDE A;  4DV4 L;  1JT8 A;  1V1Q A;  2DGY A;  3F2B A;  4FDB A;  5ELO A;  3HOX G;  5AJ3 L;  4GKJ L;  4UP7 A;  1YEZ A;  1B7Y B;  4IOC A;  2AWN A;  4A3L H;  1A62 A;  4TQU S;  1VQ4 A;  4DUZ Q;  1Y1W H;  5M3M H;  3STB D;  4R4I A;  3KLW A;  3B6Y A;  3UDF A;  2RHS B;  1PH5 A;  4KLK A;  4GKK Q;  4BA2 I;  4B3S L;  3G48 A;  4L5T A;  3CD6 A;  2ATW A;  4AQY L;  5IP9 G;  4KI0 A;  4LFC L;  4QIW E;  3CCV A;  2GVB A;  4LF7 Q;  1WCM G;  4XTC S;  1Z9F A;  1BKB A;  2R93 G;  5M5Y H;  2B63 G;  3HFZ B;  2R7Z G; 
#chains in the Genus database with same CATH topology
 2R7F A;  1T9H A;  3I4M G;  2MUY A;  1S5D D;  4A3F G;  2XNA C;  1PRT D;  3KF8 B;  2DNE A;  2FIN B;  4G4K A;  5D65 A;  4ZK9 B;  1RF2 D;  2IJ0 A;  2L0C A;  3S1R H;  4H7B A;  5JJI A;  1O78 A;  3CCJ A;  1M90 C;  4NW2 A;  1Y1V H;  4ME5 A;  5IWA L;  3CMA A;  3GTJ B;  1EY4 A;  1KL9 A;  4PNY A;  1YNN D;  2J7Z A;  2F0Q A;  3CME A;  1NJI C;  1V1O A;  2C5C A;  3ONA B;  3VA5 A;  3OYY A;  3GTK H;  1LV9 A;  4DR1 L;  3GQB A;  4DK3 C;  4HR7 B;  3Q0A A;  4HIK A;  3CCL A;  4GNX B;  4HCS A;  2N3S A;  2X69 A;  1LTS D;  1YVC A;  4OWX B;  1I4R A;  3GV6 A;  2JK8 A;  3D6W A;  3K5N A;  2A6E C;  1E2W A;  4DR4 Q;  3AFP A;  3K7A H;  5CR3 A;  4JI1 L;  4POG A;  1SJE D;  5C4H A;  3D3R A;  4PG3 A;  2F3V A;  1CA5 A;  5T1I A;  1KLU D;  2UUA Q;  3TP6 A;  2B8F A;  1HNX L;  4O0A A;  4EQP A;  2BOS A;  4A3J G;  3I4N B;  1P8L A;  2HDM A;  2AQ3 B;  5K5P A;  5CV7 A;  2KCM A;  1U0L A;  4OO1 H;  5M5W B;  2FHT A;  5C3W A;  5IT9 E;  2HCC A;  1A3U A;  4DV6 L;  3MXN B;  3CQZ B;  1IL8 A;  2PMZ B;  4JI2 L;  4GLX A;  5E4X A;  3HOY H;  5C5L A;  5LMU L;  2EVB A;  4BY7 G;  1UE6 A;  4N8F A;  3NQI A;  1ZYR D;  2XN9 C;  4A93 G;  3HOZ G;  3S2D H;  5IGG A;  4B3T L;  4JBW A;  3O13 A;  4AQY Q;  1SR3 A;  4NXN L;  1NR4 A;  2A68 C;  3K5M A;  1EOV A;  1LAB A;  1VS0 A;  1VMP A;  2VZA A;  2WAC A;  3DWP A;  1VQ9 A;  1TS3 A;  4IFD I;  3J81 i;  1TY2 A;  5I6Y A;  4JI8 L;  2NYZ D;  1PFS A;  4P72 A;  3RMH A;  2DY8 A;  3K57 A;  4DAY A;  2JA7 H;  4DV3 Q;  1PH3 A;  2XRQ D;  2LY7 A;  5IYD G;  4C3I G;  2TMP A;  3K5O A;  4DAP A;  4K5X A;  3FKI B;  1OO9 B;  4FF2 A;  1CFM A;  1O7I A;  1C8C A;  1B50 A;  2A5H A;  4JBM A;  1Y8N B;  1ENC A;  2AQ2 B;  2NVX B;  1HFN A;  1CM9 A;  2OT2 A;  1CUK A;  3NEL A;  4JBJ A;  3HRZ C;  5C44 B;  3K59 A;  5GAE C;  4H02 A;  1PVO A;  2HCI A;  4FXD A;  2ID0 A;  3PSI A;  5DEH A;  3ND8 A;  3A74 A;  5E7N A;  1KNA A;  3OPO A;  2LXJ A;  2IHE A;  1VF7 A;  4G57 A;  4K8J A;  2F0J A;  3K81 C;  2Q2U A;  1PH9 A;  4RGM A;  1FVI A;  4DR1 Q;  1FNV A;  1CQF A;  3PIO 3;  5EKL A;  5C4Z A;  4P74 A;  2BH2 A;  1K3B C;  1TVX A;  4DFA A;  1VQG A;  2RKS A;  1JE5 A;  4NXM L;  1GO3 E;  4IUP A;  2AMC B;  2HDL A;  3WOF A;  4JI1 Q;  3H6M A;  2R93 H;  2R7Z H;  2Z6K A;  1HRJ A;  3URY A;  3T4A C;  4H44 C;  4R4C A;  3S1R B;  4RWS C;  5KYL A;  2Z9H A;  1HNX Q;  4RMF A;  5CGK A;  4H13 C;  1S5B D;  3CAM A;  3X3N A;  1Y1V B;  4MZ9 A;  2CWA A;  1MHW C;  2F0I A;  2UU9 L;  1ZXT A;  1X3G A;  1DZ1 A;  2N8N A;  1C9O A;  3MEH A;  5JVH 3;  1N34 L;  1VQC A;  5M3F B;  3RUZ A;  3CP0 A;  1IKL A;  3IKJ A;  4KY7 A;  4DV6 Q;  1A3V A;  2F3W A;  2BE5 C;  4N8X 1;  2A73 B;  4JI2 Q;  2K32 A;  3PO3 G;  3NPP A;  1CI3 M;  3CRL C;  1WTR A;  5C0X G;  5LMU Q;  2L1B A;  3A8K E;  2XVS A;  3VR2 A;  4LWC A;  4B3T Q;  4K6D A;  4DXG A;  4DUZ L;  3BZD B;  4HTH A;  2E2H B;  3R93 A;  4BY1 H;  5E3F A;  1U9R A;  1B9N A;  5I2X A;  4JI8 Q;  3K7A B;  1ENF A;  3KDF A;  1SE3 A;  3NE5 B;  3AMU A;  5A2Q E;  4YWK A;  3M9B A;  2ZXO A;  1YJW A;  4OIK A;  2PQA A;  1C0A A;  2Q8I B;  4GN5 A;  2EYO A;  3KOJ A;  2EYM A;  4A3G G;  3RZD H;  3NBH A;  3JAM i;  5JJK A;  1L2F A;  1FR3 A;  1PHJ A;  2EYJ A;  4XT3 B;  2PI2 A;  1CZW A;  1GKH A;  4ZUI A;  1EQT A;  1UAP A;  3DM3 A;  3I8Z A;  1JC7 A;  2VQE L;  3OSO A;  3QOJ A;  5TSS A;  3HOY B;  2JA6 H;  3H09 A;  3QR8 A;  2RDG A;  1I3Q B;  1HUM A;  1E7Z A;  2EXD A;  3S14 H;  4GOP C;  5E4W C;  5GQO A;  3ULP A;  1AZP A;  3ND9 A;  1K73 C;  4A3K B;  2KCT A;  4NXM Q;  1STN A;  5M9O A;  1QVC A;  1EIF A;  3KLR A;  1GUS A;  5BN4 A;  1TR5 A;  1N32 L;  1CKN B;  3FVQ A;  3H0G H;  1JMC A;  3HOU H;  3R3O A;  1EWI A;  1U4M A;  1I4H A;  1A8V A;  1TY0 A;  1F9S A;  2E75 C;  5COY A;  3MFG A;  5ELD A;  1JOQ A;  2PO4 A;  2IX3 A;  5IGC A;  3QG1 A;  1KRS A;  1FNU A;  4J1M A;  3TME A;  3S9W A;  1TXY A;  3J7Y W;  2VXW A;  2CWP A;  3M4Y A;  4K5W A;  4EVO A;  2YTY A;  5M3M G;  2ICI A;  3E5S A;  3C1F A;  1DOM A;  3VR5 A;  3CC7 A;  2K33 A;  2KOL A;  2WIN B;  3G6E A;  2XWJ B;  4KY5 A;  5M5Y B;  2E5L Q;  4ZYS A;  3EJI A;  4JK1 C;  1B3A A;  1LTB D;  2BDO A;  1KNE A;  2K5D A;  3QB3 A;  1NTG A;  4XYO A;  1LT5 D;  3M4O H;  2K52 A;  1S5C D;  1V8Q A;  2K01 A;  4IZ8 A;  2MGS A;  2R93 B;  2R7Z B;  3BU2 A;  2MNA A;  2Z4H A;  2LMC B;  3HKS A;  1SND A;  2AKW B;  4Q0F A;  1GOZ A;  2KQ3 A;  4DV2 L;  3MWY W;  2VUM B;  1Q3L A;  1MD2 D;  2CCZ A;  5BN5 A;  3T51 B;  3I55 A;  3DLL A;  5IIF A;  2VQE Q;  1IBK L;  4IUV A;  3NEM A;  1NBW A;  1DYQ A;  2OCE A;  2O5J C;  1EYC A;  2K6A A;  3BDL A;  3HZX A;  1D6E C;  4HMI A;  3J81 L;  4A3D G;  1HCZ A;  4IPH A;  4OXP A;  1Q90 A;  2FFK B;  4H0L C;  4DR5 Q;  1HA5 A;  4CHT B;  1YBY A;  4JC0 A;  2ENB A;  4G7Z C;  1STG A;  1ASZ A;  2PNH A;  4LF6 Q;  2NN6 H;  1PFN A;  3T13 A;  1SN8 A;  3FPP A;  4POF A;  3OHX C;  1GM5 A;  1PZK D;  3T53 B;  1TWA H;  2HHH L;  3RZD B;  4A4I A;  5D14 A;  1LM0 A;  3U58 A;  1A2T A;  1KDA A;  1M8A A;  4YCU A;  5FKA C;  5CV5 A;  5EQ0 A;  2O2L D;  2UUC Q;  4GOP B;  4AYB G;  1WTO A;  2NVT B;  3DMU A;  1JOR A;  2HIV A;  1EFW A;  2JA6 B;  4K2K A;  5LMN W;  2TSS A;  2M2L A;  1SNP A;  1NUC A;  4APV A;  2NZH A;  2DJF C;  2B2V C;  4UAI A;  1I94 L;  4A3C G;  3NTH A;  4YY3 Q;  2L55 A;  3A8J E;  5HY6 A;  3EIV A;  3QOL A;  5C3X A;  5I2Y A;  5K36 H;  1ESF A;  4K0K L;  2OXP A;  1PLF A;  4X65 L;  4A3E H;  3I2Z A;  4OO1 I;  3H0G B;  3OMC A;  3HOU B;  4YWM A;  3W1G A;  4YCW A;  2OEO A;  1B53 A;  1U4P A;  5FO9 B;  1RJT A;  2VY3 A;  1J5E L;  4LK1 C;  4ID6 A;  4IUN A;  4CKC A;  4WFN 3;  3I70 A;  1L0W A;  1VF5 C;  4QY7 A;  4BBR H;  2KEN A;  4HJ9 A;  4A3I G;  4A3M H;  4DU9 A;  4JG2 A;  1N33 L;  1O7L A;  1WD0 A;  2WAQ E;  4DV4 L;  2SEB D;  2K1B A;  1SNQ A;  5AJ3 L;  3OMG A;  2A69 D;  3STB D;  4R4I A;  4KY6 A;  3B6Y A;  4KLK A;  4B3S L;  3G48 A;  1H9S B;  4B9X A;  3CD6 A;  3DM1 A;  1EEI D;  4LFC L;  3M4O B;  2WKC A;  5KYI A;  3V05 A;  3HOW G;  3HFZ B;  1SJH D;  3JAM L;  1D5M C;  1RKN A;  3SVM A;  2G5D A;  3MXU A;  4LF4 L;  1WJJ A;  1ILP A;  1CKO A;  1H9R A;  2HQE A;  3OWF A;  1Q81 C;  1QNK A;  2A6H D;  1U5K A;  5EKK A;  3J80 c;  3BVM A;  2MQH A;  1TS5 A;  4L5S A;  3UE0 A;  3AFQ A;  2HQL A;  5IP7 H;  4HMJ A;  3NEN A;  1EQQ A;  1HQM C;  3PMF A;  3E6Z X;  4JV5 L;  2N88 A;  1SMY C;  4HSP A;  1K83 H;  4XXE A;  3HEJ A;  3KF6 A;  4YHH L;  2EY2 A;  5FLM G;  2F0S A;  3G4S A;  1PZI D;  4LUZ A;  4NPS A;  4DR3 L;  4FF4 A;  4BBS H;  1ET6 A;  1VQD A;  2MO0 A;  2KA7 A;  4X66 L;  2EY1 A;  4JI0 L;  2N55 A;  4FVM A;  5C4X H;  4P73 A;  3QJY A;  4ODG A;  1VCI A;  4DV0 L;  4X65 Q;  3E0J A;  2R92 H;  1VQL A;  1ML0 D;  3A7L A;  4RKL A;  4V0B A;  5DLQ E;  5JEA G;  5IT9 c;  2VQF L;  3T1H Q;  4X6A H;  1HNZ L;  5IYC G;  3D4R A;  1TWA B;  1TWF H;  2LSS A;  3TRZ A;  1J5E Q;  1KLG D;  2B2Y A;  4CDF C;  3CRK C;  1CHP D;  4IN3 A;  4KK7 A;  3QIA A;  1EEF D;  1QUQ A;  3RD4 A;  2NWG A;  3UDI A;  1MSG A;  4DNR B;  1N33 Q;  4ZLT F;  3H94 A;  1L1O A;  3I4N G;  3V96 A;  1G51 A;  1H9J A;  4DV7 L;  2B8G A;  2EPB A;  3GTM B;  1I6V C;  4JI7 L;  2RVL A;  2EYP A;  1RIP A;  5KRU A;  4B3S Q;  1CZG A;  5C3E H;  4WJ3 M;  2MPM A;  4LFC Q;  2NVQ H;  4I7Z C;  3SEB A;  1R9T B;  2WAQ B;  2ZXR A;  4A3E B;  2PMZ E;  5JPM C;  4PZ6 A;  3QWN A;  5CV8 A;  1NAP A;  3KLS A;  2JA5 G;  3LNN A;  3MXG A;  1CSQ A;  1JQY D;  2K5H A;  1LAC A;  3M4P A;  4JPB W;  1U4R A;  1SYD A;  1ZEQ X;  3FRP B;  4JOI C;  5FOB B;  3FKI G;  3PO2 G;  4A3M B;  1M1K C;  3GTO H;  2E8G A;  2K03 A;  4LFA Q;  1TS4 A;  3RN2 A;  1EQV A;  3TP8 A;  4KHP L;  2Z4I A;  2H4O A;  3D31 A;  4LNQ A;  2NZ1 D;  1WD1 A;  3KBG A;  4K14 A;  1EY0 A;  1J9O A;  3R8B A;  3HOX H;  4RAU C;  1HNW Q;  4E6I A;  2MFI A;  2JXM B;  3TDQ A;  4YHH Q;  4LMQ D;  4DR7 L;  3KF8 A;  1Y8P B;  1V43 A;  2EJF C;  5EPK A;  5EBC A;  1I4P A;  1VMC A;  1F2Y A;  2ALY B;  1EUJ A;  4DNT B;  3GP7 A;  1GHJ A;  1Z7T A;  1V9P A;  3K7U C;  3K58 A;  4X66 Q;  4B3R L;  3S1Q B;  1PZJ D;  4LW1 A;  1WCM H;  4ME3 A;  1ET9 A;  1MKH A;  1DCZ A;  3DEO A;  2VQF Q;  1HNZ Q;  2B63 H;  5FLX L;  2F0H A;  3I4M H;  1KAB A;  1V1P B;  1QCB D;  2PZT A;  1JOK A;  4RCN A;  4A3F H;  1FGU A;  2PCF B;  3SDZ A;  3K8A A;  1WI5 A;  5ELE A;  1ONL A;  4L5R C;  4RHS A;  1JIC A;  4FXK C;  1FJG Q;  4LFB Q;  2KHI A;  4GNX A;  2RHQ B;  4DR6 L;  4K5V A;  4JYA Q;  3I4L A;  1YZ6 A;  4F87 A;  1YNJ C;  5M3F G;  4A3B G;  4DV7 Q;  2F03 A;  1K83 B;  3H15 A;  2A8V A;  3EVQ A;  3J80 E;  2Y0S G;  3AB9 A;  2K04 A;  3FEW X;  1JWU D;  2YTX A;  3TP7 A;  1PMR A;  1PTO D;  1BBX C;  4CKE A;  4IPC A;  5C4X B;  1N8R C;  2R92 B;  1IHZ A;  2KHS A;  4KKT A;  2Z6K C;  5JPN C;  1X3Q A;  5L37 A;  5NUC A;  2GA4 B;  1K8G A;  1TII D;  3MXN A;  5I9P A;  1XYI A;  1HQR D;  1CSP A;  4J8Q A;  2YU9 H;  3MC0 B;  4CKB A;  3K5L A;  4K8I A;  2ZJP A;  1Y69 U;  3OOC A;  1E1O A;  2CQO A;  3S15 H;  2N78 A;  5IGF A;  4DA2 A;  4GKJ Q;  4PMB A;  2K7V A;  2K14 A;  4A3J H;  2I5L X;  2KCC A;  3HOV G;  2F52 A;  1STA A;  3I56 A;  4X3T A;  2E2J H;  2NN6 I;  4N9T A;  2FXQ A;  1AZQ A;  1PRT F;  1EIY B;  4DR7 Q;  4BY7 H;  5C3E B;  1XWE A;  2NVQ B;  4A75 A;  1C4Q A;  1LUZ A;  3GTG B;  2Q8R E;  5CBA E;  3HOZ H;  4A93 H;  1RHP A;  4JVZ A;  1A0I A;  3MXP A;  4B3R Q;  3HP3 A;  1RCV D;  2OQK A;  4DAV A;  4A3K G;  1TKW B;  1YI2 A;  1LT6 D;  3PGZ A;  1II3 A;  2BH8 A;  3W5O A;  5IYD H;  4JI6 L;  4Y7N H;  4C3I H;  2DNC A;  1EY7 A;  2M9V A;  4QMG A;  3GTO B;  5IWA Q;  3E0E A;  3PUV A;  4WRD A;  3N52 A;  2A19 A;  1GD7 A;  1E2V A;  1BDO A;  4P71 A;  4X62 L;  2I46 A;  1YNX A;  3L2P A;  1G2T A;  2D0P A;  1TU2 B;  4DK6 C;  1FD7 D;  1Y1W G;  1BO0 A;  1HZA A;  3HOX B;  1G91 A;  1RDP D;  4XIG S;  3DEP A;  4V19 0;  1HUN A;  2OF1 A;  1LO5 D;  1YHB A;  3C3L A;  4PQX A;  2NBF A;  4Y52 H;  1ICF B;  3HKZ E;  4PMW A;  1QE6 A;  2ZM6 L;  1SBB B;  3CC4 A;  4O2D A;  5J1Z A;  1HZ9 A;  2D0O A;  1WCM B;  1CK1 A;  4DV5 L;  4B3M L;  4ZQ3 A;  1F2Z A;  1KXL A;  4FNF A;  1C7Y A;  4J6H A;  1BVS A;  4KKU A;  2B63 B;  4NKL A;  1Y8O B;  2F0O A;  3ERQ A;  3TZU A;  1MIU A;  4DGZ A;  1WTH A;  3JAM c;  2Q2T A;  1BCP C;  2VNU D;  4A3F B;  1PA6 A;  1EU4 A;  2AQ1 B;  1JB3 A;  3VR3 A;  2F4V L;  2G9H D;  3AEV A;  1RTN A;  1X32 A;  2VUM G;  4EGV A;  4DV1 L;  1I6H H;  1XNQ L;  4CGY B;  4BXX G;  3GTK B;  1WTP A;  1HR0 W;  1YJN A;  3HGB A;  3MAQ A;  1EIG A;  2I5M X;  4GS3 A;  2F3I A;  4XT1 B;  5FK9 C;  1CA6 A;  3VA7 A;  2F0T A;  3C46 A;  1D1K A;  5IOC A;  4ZUJ A;  5EPJ A;  1UE1 A;  4NXN Q;  3H3V H;  2IX1 A;  4S3S A;  3PO3 H;  5M5X H;  2K4K A;  5C0X H;  1XPO A;  3CPW A;  1UEA B;  2NZO A;  2FMM A;  1CTM A;  5CV4 A;  4R8N A;  2VB2 X;  2PW5 A;  1TWC H;  3CHB D;  3Q22 A;  1F9Q A;  1XPR A;  1KD1 C;  3H3V C;  5D3D A;  1A63 A;  1MSH A;  3IFT A;  3PF5 A;  2FJ2 A;  2AUJ D;  1GUG A;  2YU9 B;  2K28 A;  3NUC A;  2F4I A;  1G8Z D;  4M1U B;  5IYB G;  3E9I A;  1VQK A;  2SNS A;  1RD9 D;  4B08 A;  4A3G H;  2XTI A;  4DPG A;  4A3J B;  4QL5 A;  3S1M H;  3OWE B;  1SSO A;  2UXC L;  1A6X A;  4C3H G;  1AE2 A;  1AFP A;  4TRD A;  1D1I A;  3W3A A;  1L0Y B;  4EQ5 A;  3M7G A;  5H1S E;  3S2D B;  3IAY A;  3F2U A;  1STY A;  4HIO A;  2E2J B;  1VQP A;  1B8A A;  4YIJ A;  1R4Q B;  3FMC A;  1CKN A;  1XTD A;  3D0F A;  3PUW A;  4A93 B;  4TKO B;  1EYG A;  3HOZ B;  2CHB D;  5D3I B;  2JA7 B;  1HH2 P;  2A69 C;  3MZ5 A;  1IBL L;  1SRU A;  2A6E D;  3S24 A;  4B3M Q;  1OXX K;  4ILW A;  1K0R A;  3NWS A;  1E22 A;  5JAV A;  1ZKO A;  4C3I B;  3NK9 A;  3GTQ H;  1W6J A;  1QVF A;  2UU9 Q;  4XDX A;  3TBI B;  3HKZ B;  2VL6 A;  5KND A;  1N34 Q;  1HPC A;  2A1A A;  2F4V Q;  3KK7 A;  1HR0 L;  1VDZ A;  2F0U A;  3F8T A;  1XNQ Q;  3GDE A;  1JT8 A;  4CDC C;  4FDB A;  1HFG A;  4RHR A;  4OL7 A;  1YEZ A;  2AWN A;  1H9K A;  3BYT B;  4DUZ Q;  2KCN A;  5M3M H;  4KHV A;  3EFX D;  3KLW A;  3SK4 A;  3UDF A;  2RHS B;  1BCP B;  1PH5 A;  1SYB A;  5I4D A;  4C3J G;  4MN3 A;  1SYC A;  5IP9 G;  4QIW E;  2GVB A;  2D2C C;  4KV6 A;  4XTC S;  1Z9F A;  1BKB A;  3FDT A;  5BN3 A;  3C2P A;  2LKV A;  1I4Q A;  5JOB A;  2AWO A;  1KDC A;  3P1H A;  1FYC A;  3AYH B;  3GO5 A;  4RH6 A;  2F0K A;  3I73 A;  5FLX c;  3BZC A;  4RKB A;  3VYU A;  4IUR A;  1QWY A;  4X3S A;  1VQJ A;  1PYW D;  2JN4 A;  4MIU A;  2D62 A;  1BXT A;  4RCO A;  1TT2 A;  3WDN A;  1I6H B;  2K5V A;  3JAM E;  4IOA A;  2R3Z A;  3SK6 A;  2UXC Q;  3TZD A;  3CKI B;  4OWT B;  3ICE A;  1BQQ T;  4I7A A;  1SNO A;  3UDX A;  1GVP A;  2EXZ A;  2J4X A;  2B2T A;  2KEC A;  1IKM A;  4OEL B;  4BY1 B;  1G29 1;  1TQO A;  3EBE A;  1SRO A;  4PZ7 A;  1HA6 A;  5M5X B;  3TQY A;  5CV9 A;  3OIP A;  3TS0 A;  3CCM A;  1SAP A;  3CCU A;  4A3D H;  1T5X D;  3NXW A;  4RGN A;  3D4D A;  3NTK A;  2Q8T A;  4JBK A;  2WB1 G;  2ZTE A;  1N32 Q;  4FYD A;  1QOH A;  1FGB D;  2RCF A;  4GOP A;  1ILQ A;  1JJC B;  1E0B A;  4M8A A;  1STH A;  2JA8 G;  2RDH A;  4K2L A;  4IFD G;  4UY8 C;  3IFD A;  4UP8 A;  1A15 A;  3GV3 A;  4A3G B;  3BYY B;  4R4O A;  3S1M B;  1HR0 Q;  4QQB X;  1PYB A;  5FJ8 G;  1IW7 D;  1HTL D;  2PPB C;  1F2M A;  2VW9 A;  2BE5 D;  4RG1 A;  5KIX A;  3S14 B;  2OTJ A;  1SE2 A;  2B2U C;  3T16 A;  2F0E A;  2SDF A;  3CCE A;  3SXH A;  3KFU A;  2BCO A;  4OX9 L;  4OEM B;  4DN4 M;  2PZU A;  3GTP H;  1GUN A;  1NR2 A;  2MHV A;  2F0N A;  4ZCK A;  3T1Y L;  4A3C H;  4TSS A;  1XMQ L;  2H5X A;  4HJ7 A;  4AYB E;  1KRT A;  4HCE A;  2WAQ G;  4DV2 Q;  3S1N H;  3DHQ A;  3GTQ B;  1CT1 D;  4JCV E;  1VQM A;  2B2Y C;  2QGQ A;  1PRT C;  4ZAI A;  1Q82 C;  4L8J A;  4MNO A;  4R1J A;  2IW3 A;  2QF7 A;  4QIW B;  1B4O A;  2EJG C;  1IBK Q;  1TWG H;  1H9S A;  2WII B;  1IBM L;  4LF9 L;  1NMG A;  4A3I H;  2ZJQ A;  1BCP F;  2VB3 X;  3KBX A;  2UXB L;  1BBW A;  1UNS A;  1YNN C;  1X65 A;  3RNU A;  3EA6 A;  3S2H H;  2B3G A;  2K5W A;  4LUO A;  4MHE A;  2L9H A;  3U9S A;  2QDB A;  3L9A X;  1OXT A;  2KEE A;  1PTO H;  1WFQ A;  1XTC D;  4C2M H;  4L5Q A;  5J39 A;  3FP9 A;  1YIT A;  2R7D A;  4L63 B;  2LFN A;  4LAA A;  3MTS A;  2DY7 A;  4X64 L;  3K6O A;  3I4O A;  5EKI A;  4G7H C;  3KYH C;  1PTO C;  2UXD L;  2HHH Q;  1S5E D;  3HOW H;  1H95 A;  1A2U A;  4I65 A;  1F2L A;  1U4L A;  3CCS A;  2EJM A;  5KGU A;  2GVA A;  3I91 A;  3SK8 A;  3VDY A;  5LHY 1;  3ZYY X;  1CHQ D;  5LMN L;  4O1N A;  2NVY H;  4FF3 A;  1S3O A;  5E1F A;  5FLX E;  2JE6 I;  4P2C B;  4P75 A;  3N6R A;  2D9U A;  1LTA D;  3U50 C;  4XQQ A;  1NE3 A;  1I94 Q;  2YV5 A;  2RDF A;  1MJE A;  3K0X A;  1ZYR C;  2X6L A;  4KMU C;  4IPD A;  1RTO A;  2NTS A;  2E2I H;  4K0K Q;  1W3S A;  1IYJ B;  1HHV A;  5FLM H;  3T1Y Q;  3A5Z B;  1VQI A;  1SYE A;  3Q24 A;  1PH4 A;  1NY4 A;  5GAG C;  3UDG A;  5JEA H;  1JE4 A;  2AUK A;  2EY6 A;  5ELN A;  1D2B A;  2QW7 A;  5IYC H;  3K0Y A;  5G3L D;  4UPA A;  3SR1 A;  3H3V I;  1LYL A;  4DV4 Q;  1KIX A;  3L7Z C;  4U68 A;  1IBM Q;  5AJ3 Q;  2EIF A;  2YYZ A;  4LF9 Q;  1E2Z A;  2MJ8 A;  4AYB B;  2UXB Q;  1J8I A;  1SXT A;  3I4N H;  2O5I C;  3VR4 A;  2JP1 A;  4IPG A;  5C5M A;  4IUU A;  2F0P A;  3R2I A;  4F8M A;  4IJH A;  1TWH H;  3J80 i;  1JWM D;  1G2S A;  5HUR A;  1K28 A;  1NCV A;  1PRT B;  3OIQ A;  1O7Y A;  1K0S A;  1DOK A;  1QZH A;  4X64 Q;  2ZTC A;  2OWO A;  4L6T B;  2HUG A;  4LF4 Q;  2Z0S A;  3S1N B;  3MVV A;  2UXD Q;  2NB0 A;  1EY6 A;  2EYF A;  4BBR B;  1DM0 B;  2JA5 H;  3SK5 A;  4DR4 L;  3I7F A;  3G71 A;  1XX8 A;  2K75 A;  1Z6H A;  1AN8 A;  3DUZ A;  1I5F A;  3CXC A;  5LMN Q;  3FKI H;  3L0O A;  5C44 G;  2UUA L;  3PO2 H;  1G6P A;  4A3I B;  4WJW A;  3VYS A;  3I72 A;  2JYO A;  4U67 3;  2H1E A;  4UHV A;  4JV5 Q;  3W1B A;  4A3L G;  3S2H B;  1N36 L;  4PZ8 A;  1VQF A;  2JJQ A;  3DXJ C;  4DR3 Q;  3ZJY C;  1N9W A;  4JI0 Q;  1V1P A;  2ICE C;  4DV0 Q;  2F0G A;  1EY5 A;  2EDG A;  2X6G A;  2JQO A;  4WJ4 A;  1Q1B A;  4KHZ A;  1SNM A;  1AEX A;  2YTV A;  1W6K A;  1DON A;  2F1M A;  2BA1 A;  4DV3 L;  1XMO L;  1JOO A;  3NP8 A;  1HJP A;  1G6Z A;  4PMC A;  2IL8 A;  5IGD A;  1Y1V G;  1BUV T;  3UE1 A;  1K8M A;  4J15 A;  2NVY B;  2C9O A;  1EOT A;  1O7Z A;  4F7X A;  1E3P A;  4KJN A;  3TP5 A;  1IYV A;  4JI7 Q;  2EE1 A;  4GLV B;  3KUP A;  3A55 A;  4ABN A;  2PW7 A;  3PF4 A;  2K50 A;  1PH6 A;  3P7J A;  3J81 c;  4BBS B;  2KVM A;  5M3F H;  4A3B H;  1WTQ A;  4CJ1 B;  1B3Q A;  2E2I B;  4UDU C;  4XQN A;  1JJ2 A;  4OWW B;  2XIW A;  1LTI D;  3TS2 A;  1C48 A;  3J7A V;  4OON A;  5EAY A;  4DKA C;  5KNC A;  1TWF B;  1Q86 C;  5COR A;  2CH4 A;  5GRO A;  2KBN A;  3I3C A;  2EYL A;  3F2D A;  2E2H H;  1GUT A;  1X54 A;  4YCV A;  4KN7 C;  4LF5 L;  1X3F A;  1STB A;  3PIP 3;  2RSN A;  1B44 D;  1KHI A;  3RR5 A;  1EYD A;  2Y0S E;  3VR6 A;  3OW7 A;  4KHP Q;  3RLF A;  1M4V A;  1I4X A;  1EZ6 A;  1YJ9 A;  4OO1 G;  4BA1 I;  4JOI A;  1PXU A;  2DN8 A;  3ITP A;  3CC2 A;  2B2W A;  2BA0 A;  3GTL H;  2L11 A;  1LTL A;  3HOY G;  2CKZ B;  3PQI A;  1N36 Q;  5IGE A;  4HAE A;  2ASB A;  1SMY D;  3HOV H;  5KEE A;  2L15 A;  1E24 A;  1TWH B;  4DNI A;  2L5T A;  2F0D A;  2CW0 D;  4BS9 A;  4DUY L;  1VQ5 A;  1D5X C;  1YHA A;  1I3Q H;  5JEA J;  3DWQ A;  5ELC A;  3Q6S A;  2JA7 G;  1KC8 C;  3SE0 A;  2KUM A;  3CCQ A;  1WOC A;  3D4W A;  2JA5 B;  4A3K H;  5HGQ A;  5T1G A;  1E1T A;  1EY8 A;  4BWG B;  1UWV A;  3A5U A;  1XMO Q;  4IJL A;  3S17 H;  2Q2I A;  1PV4 A;  1VQE A;  3PO2 B;  3X3M A;  2PI2 E;  3MFY A;  4NMZ A;  1DJR D;  1QIL A;  4DR6 Q;  5IE8 A;  3HKZ G;  2HD3 A;  1PTO F;  4O42 A;  4DAY B;  1EWC A;  4DK1 A;  1YHQ A;  2G9D A;  1LT4 D;  1V1Q A;  2PZW A;  5CC4 A;  4UP7 A;  4IOC A;  1CQV A;  1A62 A;  4TQU S;  1Y1W H;  1PDQ A;  2SOB A;  1B9M A;  3CCV A;  3I4M B;  2R93 G;  5M5Y H;  1W2B A;  2R7Z G;  3Q8D A;  2IY5 B;  4HED A;  5CV6 A;  2HT1 A;  4LF5 Q;  4HN7 A;  2V1C C;  3J7Z C;  4ALP A;  3HS0 C;  4OGQ C;  1DXM A;  3BJU A;  4XYQ A;  3EN2 A;  4JI3 L;  3M85 A;  2Q2H A;  3J7A F;  2B29 A;  3F2C A;  1MI2 A;  2R61 A;  2J0T D;  3WWV A;  5FO8 B;  3J80 L;  2VUM H;  2GN5 A;  4BXX H;  1X3P A;  4OIJ A;  5EJW A;  4A3B B;  1PFB A;  1X3E A;  1EIH A;  4KD3 A;  3G6J B;  1WTW A;  1IW7 C;  1Q12 A;  2Y0S B;  4BY1 G;  4DUY Q;  3WOE A;  2B39 A;  2MO1 A;  3SHL A;  2MP1 A;  4GZY C;  1QZG A;  3J81 E;  3PCO B;  2I5H A;  4Q5V A;  1AW7 A;  3M7N A;  2E5L L;  4K6L A;  1KAA A;  4EQO A;  2AHO B;  2K5N A;  1PH7 A;  1K9M C;  2EQS A;  1F77 A;  5C4J H;  4JI6 Q;  1WVL A;  3OW2 A;  3NTI A;  2CFM A;  4TVA B;  3TEH B;  3S15 B;  4NP5 A;  5CMD A;  2RSO A;  5IT9 L;  4ZKC B;  2QKI C;  4C1N I;  2FMC A;  3SGI A;  4KD4 A;  5IGB A;  4X62 Q;  4R8I A;  4R4Q A;  3U9O A;  5IYB H;  1EWH A;  3TRE A;  3GTL B;  1KDB A;  4HID A;  3KDF B;  2IT1 A;  1YIJ A;  2ES2 A;  1PH2 A;  1PYS B;  4LF8 L;  1H9M A;  2B2T C;  1YNJ D;  2JA6 G;  1D7Q A;  3RZO H;  1EZ8 A;  2HIX A;  4C3H H;  3HOV B;  4BY7 B;  1SE8 A;  2I0Q A;  2PQA B;  4JW0 A;  1VQ7 A;  5A35 A;  2NVT H;  2ZM6 Q;  4HIM A;  3NBH B;  1D5Z C;  1SLJ A;  4RGT A;  1SYF A;  4DF7 A;  3STB C;  1AP0 A;  4DV5 Q;  5DM7 3;  4LUV A;  1VQB A;  1EQR A;  1Q8I A;  3V2T A;  4ZRZ A;  1AE3 A;  1MJC A;  4Y7N B;  3ERS X;  2RCN A;  3H0G G;  3R2T A;  4DR5 L;  3HOU G;  2OQ0 A;  1X9N A;  3PUZ A;  1ENA A;  3S17 B;  4LF6 L;  1RL2 A;  1DOL A;  3PV0 A;  4KKS A;  2IWH A;  4AIM A;  4XQJ A;  1UE7 A;  4DV1 Q;  1SNC A;  1BF4 A;  5HGT A;  1KQS A;  1SE4 A;  1Z47 A;  2L4N A;  2A6H C;  4JI3 Q;  3W2D A;  5CBE E;  2ZJR A;  4QJF A;  1BR9 A;  1Y14 B;  2QDL A;  1XNR L;  1T5E A;  5LL6 S;  1Q1E A;  1VQN A;  3RLN A;  3D8G A;  1QVG A;  2UUC L;  1XXG A;  1Y1W B;  1WYD A;  2R6G A;  3PIP A;  2A68 D;  3D6C A;  3LWU A;  3HG9 A;  3VYR A;  1JR0 D;  4G7O C;  1OXS C;  2RQX A;  1GUO A;  2IPK D;  4CJ0 B;  5JJL A;  1DGS A;  3BVG A;  1K8A C;  3M3Y H;  5ELF A;  2QEX A;  4C3J H;  3P75 A;  3L3O C;  5IP9 H;  5FO7 B;  2NTT A;  1JJG A;  4YY3 L;  2PNR C;  2QEJ C;  1HZC A;  2RBM A;  1IL2 A;  2K05 A;  3U4Z A;  2UUB L;  2F0F A;  1S40 A;  2F0W A;  1CKM A;  5KNB A;  2JA9 A;  5EBD A;  2I07 B;  3P20 A;  4UP9 A;  4OHJ A;  1HZB A;  5J22 A;  2NUC A;  1EY9 A;  1EYA A;  1Q7Y C;  1TS2 A;  1BNZ A;  1VQH A;  1Q8K A;  3NHH A;  1KTK A;  4LF8 Q;  2KHJ A;  4EX5 A;  3K80 C;  3PO3 B;  3NSW A;  4HJ8 A;  2D5D A;  1SFO H;  3J81 j;  3KLS X;  2C35 B;  4CJ2 C;  1HXY D;  1TWC B;  1SDF A;  4QUC A;  3OTO L;  3PUX A;  4GN4 B;  5EPL A;  1IBL Q;  1VQ6 A;  3KJP A;  4DK0 A;  1EL0 A;  2ZT9 C;  5A2Q L;  2F0L A;  1B70 B;  2KJX A;  1OTC A;  3C1E A;  3E9H A;  3QO2 A;  1KAW A;  5DM6 3;  3BDC A;  4IUQ A;  2NN6 G;  2Z1C A;  5IY0 A;  3IRB A;  5C4J B;  4ULL A;  1BCP D;  3LX0 A;  3TN2 A;  1X55 A;  1GUW A;  3E3X A;  5GAH C;  1A3T A;  3FPU B;  1P16 A;  3H91 A;  4A76 A;  2JA8 H;  1FL0 A;  4RGO S;  4YWL A;  2F0M A;  4IFD H;  1X56 A;  3PIO A;  3M4Q A;  5C0X J;  2LS0 1;  4RFB A;  3VYT A;  1XNR Q;  4R4T A;  5GAD C;  3RZO B;  4GN3 B;  2WB1 E;  4C3H B;  1I50 H;  4DXF A;  2P5Z X;  2WP8 J;  5FJ8 H;  1IZ6 A;  1STE A;  2EZV A;  3FHW A;  4C1N K;  4QB4 A;  1XJV A;  3J7A 5;  1QJO A;  4HJ5 A;  1JB7 A;  3A0J A;  3A54 A;  2CVR A;  2EY5 A;  3EQL C;  3ERO A;  4FF1 A;  2OTL A;  3CW2 C;  4JI5 L;  5K36 G;  1NNX A;  3GTM H;  2N49 A;  2SNM A;  1SMX A;  2WFW A;  4PV1 C;  2Z6B A;  2BDN A;  1WTX A;  4A3E G;  4DR2 L;  4JI4 L;  5IOD A;  4R9W A;  2M00 A;  4NDX A;  1K8O A;  1R9T H;  3A8I E;  2UUB Q;  2VS1 A;  1K3R A;  3CU7 A;  1L1O C;  3T1H L;  4A3M G;  2IX0 A;  4BBR G;  1LTR D;  4X3K A;  5LL6 X;  4QCL A;  1PH8 A;  1S72 A;  1DD2 A;  1PH1 A;  4N9P A;  3U4V A;  1X6O A;  1ASY A;  1Q46 A;  1QNU A;  5JVG 3;  5J3B A;  5M3M B;  4WOR A;  3LGJ A;  2LXK A;  3S16 H;  1J6Q A;  5DAU A;  4F88 A;  4IUT A;  1B2T A;  1R4P B;  3OTO Q;  1EFI D;  1NMF A;  3M3Y B;  4C3J B;  1ICW A;  1VQA A;  1VQO A;  4IO9 A;  1EU3 A;  5DNF A;  3MA2 B;  1SEB D;  1FNW A;  5JJZ A;  4B9W A;  1LLR D;  1HTP A;  3DWA A;  3ER0 A;  2WKD A;  1F9R A;  3GD7 A;  2DUD A;  1UE5 A;  4RA8 A;  3S1Q H;  5I6W A;  1WTV A;  1LTT D;  5ELB A;  2K5Q A;  4IAL A;  1UEB A;  1PFM A;  5EGT A;  4HSV A;  1VQ8 A;  2QCP X;  5C6A A;  2V4D A;  2CQA A;  5BR8 L;  4QGU A;  2XGT A;  5IP7 G;  3CF5 A;  4LJZ C;  4LFA L;  5CYU A;  1NSN S;  3GTJ H;  1LT3 D;  3G7L A;  3TSS A;  3BDO A;  4GLA C;  1SFO B;  3BZK A;  2PQE A;  2O4X A;  4A3D B;  2L12 A;  2KED A;  4OX9 Q;  1L0X B;  4BBS G;  4EQN A;  1XMQ Q;  3AU7 A;  1S4Z A;  4GKK L;  2JSO A;  4Z9C B;  1HNW L;  1JWS D;  1MBY A;  4JI5 Q;  2F0V A;  5C4X G;  2B2V A;  2DJG C;  4LF7 L;  5ISR A;  2R92 G;  2QIL A;  2B2U A;  4DR2 Q;  1ESR A;  2WB1 B;  4JI4 Q;  2CW0 C;  2Z8L A;  2E76 C;  3I90 A;  4DAM A;  3JC6 6;  1UUP A;  1I4G A;  4QF4 A;  2RA4 A;  1ROD A;  1AH9 A;  3KF6 B;  1S5F D;  2EYH A;  4GNX C;  2JA8 B;  3RN5 A;  1OXU A;  3NWT A;  1MGS A;  3UI2 A;  2E74 C;  4MTK A;  5C0X I;  4MTN A;  3CPF A;  1D8L A;  1O80 A;  4AH6 A;  3BS1 A;  3ULL A;  3A7A B;  1OXV A;  2XRS D;  1GJX A;  3LWE A;  3MHB A;  1F9P A;  4FO2 A;  1I50 B;  4FP5 D;  1XPU A;  3F1Z A;  5M5W H;  2IHF A;  1FJG L;  4LFB L;  2RF4 A;  3GTP B;  3RLO A;  4CBV A;  3CQZ H;  2A74 C;  1B1Z A;  3KJO A;  4JYA L;  3BVZ A;  2QA4 A;  1QUQ B;  5C3E G;  4ZKB B;  1GXD C;  3NBI A;  1L1O B;  1LTG D;  2ZTD A;  2JEA I;  2ZXP A;  4IFD J;  3AQQ A;  1QB5 D;  4X3U A;  3GTG H;  3T56 B;  3BG3 A;  3MEF A;  1QG7 A;  2JEB I;  4IQZ A;  4NB3 A;  3IL8 A;  1TWG B;  2XSC A;  5F2D A;  4HJA A;  3ULJ A;  1JCK B;  2NVX H;  1IXR A;  4KJO A;  1IYU A;  2B2W C;  3PUY A;  1GHK A;  3CCR A;  4KN4 C;  5BR8 Q;  3NQT A;  4CDD C;  2WV6 D;  3Q23 A;  5C44 H;  1BBU A;  2E2D C;  2DGY A;  2PYK A;  3F2B A;  3S16 B;  1PTO B;  5ELO A;  3HOX G;  4C2M B;  4GKJ L;  1B7Y B;  4A3L H;  4QUF A;  2EOT A;  1VQ4 A;  2CH4 W;  4CDE C;  3A56 A;  5AFW A;  1BOS A;  4FXG C;  4KTA A;  5I9O A;  2XWB B;  4GKK Q;  4C56 C;  4BA2 I;  4L5T A;  1SYG A;  2ATW A;  5G3L F;  4AQY L;  4KI0 A;  3HOW B;  4LF7 Q;  1WCM G;  2B63 G; 
#chains in the Genus database with same CATH homology
 2R7F A;  1T9H A;  3Q8D A;  3I4M G;  2AWO A;  2IY5 B;  4A3F G;  2HT1 A;  4LF5 Q;  3AYH B;  3HOW G;  3GO5 A;  4LF4 L;  5FLX c;  1WJJ A;  2V1C C;  3BZC A;  3KF8 B;  1CKO A;  3J7Z C;  4ALP A;  1VQJ A;  1Q81 C;  2D62 A;  3S1R H;  3BJU A;  5JJI A;  3CCJ A;  1U5K A;  3EN2 A;  4JI3 L;  1M90 C;  2K5V A;  1Y1V H;  3J80 c;  2Q2H A;  3M85 A;  5IWA L;  4IOA A;  2MQH A;  3CMA A;  2B29 A;  4L5S A;  2UXC Q;  3UE0 A;  3AFQ A;  2HQL A;  3F2C A;  1KL9 A;  4OWT B;  3ICE A;  3WWV A;  3UDX A;  2VUM H;  5IP7 H;  3CME A;  1GVP A;  1NJI C;  2GN5 A;  3NEN A;  1EQQ A;  4BXX H;  4JV5 L;  3OYY A;  1X3E A;  4DR4 L;  1K83 H;  3GTK H;  1G29 1;  3EBE A;  4PZ7 A;  1SRO A;  4POG A;  1Q12 A;  4DR1 L;  3KF6 A;  3TQY A;  4DK3 C;  4YHH L;  3TS0 A;  5FLM G;  3CCM A;  4BY1 G;  4DUY Q;  4HIK A;  3G4S A;  4LUZ A;  4NPS A;  3CCU A;  4GNX B;  4DR3 L;  3CCL A;  2MO1 A;  4BBS H;  4A3D H;  1VQD A;  2MO0 A;  1QZG A;  2N3S A;  3PCO B;  4JBK A;  2I5H A;  4X66 L;  4JI0 L;  2WB1 G;  3M7N A;  1YVC A;  2ZTE A;  4OWX B;  5C4X H;  4P73 A;  2E5L L;  1N32 Q;  1VCI A;  2JK8 A;  4DV0 L;  1PH7 A;  4X65 Q;  2AHO B;  2K5N A;  1K9M C;  1VQL A;  2R92 H;  2EQS A;  3AFP A;  3K7A H;  4JI1 L;  5JEA G;  5DLQ E;  5IT9 c;  1JJC B;  5C4J H;  2VQF L;  4GOP A;  3OW2 A;  3T1H Q;  3TEH B;  2CFM A;  4TVA B;  1HNZ L;  5IYC G;  4PG3 A;  2LSS A;  1TWF H;  2JA8 G;  3TRZ A;  1J5E Q;  4IFD G;  2UUA Q;  4UY8 C;  3SGI A;  4UP8 A;  1HNX L;  4O0A A;  4X62 Q;  4R4Q A;  4R4O A;  4A3J G;  1P8L A;  1QUQ A;  5IYB H;  3TRE A;  3UDI A;  1HR0 Q;  4HID A;  3KDF B;  2IT1 A;  2KCM A;  1U0L A;  1YIJ A;  2ES2 A;  1PH2 A;  1N33 Q;  1L1O A;  3I4N G;  4QQB X;  1PYB A;  1PYS B;  5FJ8 G;  4LF8 L;  2JA6 G;  1D7Q A;  1G51 A;  2VW9 A;  3RZO H;  2HIX A;  4RG1 A;  4C3H H;  4DV6 L;  3MXN B;  1SE8 A;  4DV7 L;  2I0Q A;  2PQA B;  4JI2 L;  1VQ7 A;  4GLX A;  3HOY H;  4JI7 L;  2NVT H;  2ZM6 Q;  2OTJ A;  5LMU L;  4HIM A;  4BY7 G;  3NBH B;  1UE6 A;  4DR4 Q;  1SLJ A;  1RIP A;  3CCE A;  4A93 G;  3KFU A;  3HOZ G;  3STB C;  3S2D H;  4B3T L;  4B3S Q;  1W2B A;  4JBW A;  4OX9 L;  4DV5 Q;  3GTP H;  4LUV A;  4AQY Q;  1VQB A;  1EQR A;  1SR3 A;  4NXN L;  5C3E H;  4WJ3 M;  1EOV A;  1VS0 A;  4LFC Q;  2NVQ H;  1AE3 A;  2VZA A;  3T1Y L;  1MJC A;  1VQ9 A;  4IFD I;  1XMQ L;  2H5X A;  3J81 i;  4A3C H;  4HJ7 A;  4JI8 L;  4P72 A;  1PFS A;  2PMZ E;  3ERS X;  2RCN A;  3H0G G;  4PZ6 A;  4AYB E;  4DR5 L;  3HOU G;  1KRT A;  2JA7 H;  2WAQ G;  4DV3 Q;  1PH3 A;  4DV2 Q;  2JA5 G;  1CSQ A;  2OQ0 A;  5IYD G;  3S1N H;  1X9N A;  2K5H A;  3M4P A;  4JCV E;  1O7I A;  3PUZ A;  4JOI C;  1VQM A;  2QGQ A;  1Q82 C;  4JBM A;  4LF6 L;  1RL2 A;  3FKI G;  3PV0 A;  4MNO A;  3PO2 G;  4R1J A;  4AIM A;  1M1K C;  1UE7 A;  4DV1 Q;  3GTO H;  2E8G A;  1KQS A;  4LFA Q;  1Z47 A;  1CUK A;  4JI3 Q;  3NEL A;  4JBJ A;  1IBK Q;  2ZJR A;  3RN2 A;  1TWG H;  4QJF A;  1IBM L;  1Y14 B;  5GAE C;  1NMG A;  4A3I H;  4H02 A;  4LF9 L;  1XNR L;  3D31 A;  4KHP L;  2ZJQ A;  1PVO A;  4LNQ A;  2ID0 A;  1Q1E A;  3PSI A;  1VQN A;  3RLN A;  2UXB L;  1BBW A;  3A74 A;  5E7N A;  1X65 A;  2LXJ A;  2IHE A;  3RNU A;  1QVG A;  2UUC L;  2B3G A;  3S2H H;  1WYD A;  2R6G A;  4LUO A;  3PIP A;  3HOX H;  3K81 C;  2Q2U A;  1HNW Q;  4JI6 L;  1OXT A;  1PH9 A;  1FVI A;  2MFI A;  4DR1 Q;  1OXS C;  1WFQ A;  4YHH Q;  4DR7 L;  4C2M H;  1YIT A;  4L5Q A;  3FP9 A;  4P74 A;  2R7D A;  1V43 A;  2BH2 A;  5JJL A;  1DGS A;  1K8A C;  2ALY B;  1VQG A;  1EUJ A;  3M3Y H;  1JE5 A;  1V9P A;  3K7U C;  4C3J H;  4X66 Q;  4X64 L;  2QEX A;  4NXM L;  1GO3 E;  4B3R L;  5IP9 H;  3I4O A;  1JJG A;  2AMC B;  4LW1 A;  4YY3 L;  3KYH C;  1WCM H;  4ME3 A;  1MKH A;  2UXD L;  4JI1 Q;  1HZC A;  2HHH Q;  2VQF Q;  1IL2 A;  2R93 H;  1HNZ Q;  3HOW H;  2B63 H;  1H95 A;  2R7Z H;  2Z6K A;  3U4Z A;  3I4M H;  2UUB L;  3CCS A;  4X6A H;  4A3F H;  1FGU A;  1S40 A;  2GVA A;  3K8A A;  4R4C A;  3VDY A;  1HNX Q;  4RMF A;  1CKM A;  1WI5 A;  5LMN L;  3CAM A;  2JA9 A;  4L5R C;  4MZ9 A;  2CWA A;  4UP9 A;  2UU9 L;  1HZB A;  1FJG Q;  2NVY H;  1S3O A;  1X3G A;  2KHI A;  2N8N A;  4GNX A;  1Q7Y C;  1C9O A;  4LFB Q;  1VQH A;  1Q8K A;  1VQC A;  2JE6 I;  1N34 L;  2RHQ B;  4LF8 Q;  2KHJ A;  3CP0 A;  4P75 A;  4DR6 L;  4EX5 A;  3K80 C;  4JYA Q;  1YZ6 A;  4DV6 Q;  5M3F G;  4A3B G;  4DV7 Q;  4HJ8 A;  3U50 C;  1SFO H;  4JI2 Q;  3H15 A;  1NE3 A;  3J81 j;  1I94 Q;  2A8V A;  3PO3 G;  2YV5 A;  2C35 B;  5C0X G;  2Y0S G;  5LMU Q;  1MJE A;  4JI6 Q;  3OTO L;  3K0X A;  3PUX A;  4GN4 B;  4LWC A;  1IBL Q;  2YTX A;  1VQ6 A;  4B3T Q;  3KJP A;  4K0K Q;  2E2I H;  4IPD A;  4DUZ L;  1W3S A;  1IYJ B;  1B70 B;  1OTC A;  5FLM H;  4BY1 H;  4IPC A;  3E9H A;  3T1Y Q;  1N8R C;  1KAW A;  2NN6 G;  3A5Z B;  1VQI A;  4JI8 Q;  5IY0 A;  3IRB A;  3KDF A;  2Z6K C;  1PH4 A;  1NY4 A;  1K8G A;  1X55 A;  5GAG C;  3UDG A;  5GAH C;  4YWK A;  3M9B A;  5ELN A;  1YJW A;  1C0A A;  1P16 A;  1CSP A;  2PQA A;  4GN5 A;  5IYC H;  4A76 A;  2YU9 H;  3KOJ A;  2JA8 H;  1FL0 A;  4A3G G;  2ZJP A;  3RZD H;  4YWL A;  3JAM i;  5JJK A;  3S15 H;  1L2F A;  1E1O A;  1X56 A;  2CQO A;  4UPA A;  1LYL A;  2N78 A;  4DV4 Q;  3PIO A;  1PHJ A;  1KIX A;  3H3V I;  3M4Q A;  5C0X J;  3L7Z C;  2PI2 A;  1IBM Q;  5AJ3 Q;  4GKJ Q;  2EIF A;  2YYZ A;  1GKH A;  2K14 A;  4A3J H;  4LF9 Q;  1XNR Q;  3DM3 A;  4R4T A;  5GAD C;  2I5L X;  4GN3 B;  2WB1 E;  3HOV G;  2F52 A;  1I50 H;  2UXB Q;  2VQE L;  3I4N H;  2WP8 J;  5FJ8 H;  1IZ6 A;  2JA6 H;  3FHW A;  3I56 A;  1XJV A;  4IPG A;  3J7A 5;  2E2J H;  2NN6 I;  4HJ5 A;  2FXQ A;  1JB7 A;  4IJH A;  3A0J A;  1TWH H;  1EIY B;  3J80 i;  1E7Z A;  4DR7 Q;  2EXD A;  2OTL A;  3S14 H;  4BY7 H;  3CW2 C;  4GOP C;  4JI5 L;  5GQO A;  4A75 A;  3ULP A;  4A93 H;  1LUZ A;  2N49 A;  3GTM H;  3HOZ H;  5K36 G;  1K73 C;  1SMX A;  2WFW A;  2KCT A;  4X64 Q;  1A0I A;  2ZTC A;  1QZH A;  2OWO A;  4A3E G;  4NXM Q;  4B3R Q;  4DR2 L;  2OQK A;  4JI4 L;  4LF4 Q;  1QVC A;  2Z0S A;  4A3K G;  1EIF A;  2UXD Q;  1YI2 A;  1N32 L;  3PGZ A;  1CKN B;  2BH8 A;  3H0G H;  1JMC A;  3HOU H;  1R9T H;  1EWI A;  2JA5 H;  2UUB Q;  2VS1 A;  3W5O A;  5IYD H;  1K3R A;  3I7F A;  4Y7N H;  1L1O C;  1A8V A;  2K75 A;  4C3I H;  2IX0 A;  4BBR G;  3G71 A;  3T1H L;  4A3M G;  5IWA Q;  3E0E A;  3PUV A;  1I5F A;  3CXC A;  5LMN Q;  1S72 A;  1PH8 A;  1PH1 A;  3FKI H;  3L0O A;  2A19 A;  3U4V A;  1X6O A;  5C44 G;  2UUA L;  1GD7 A;  3PO2 H;  1KRS A;  1G6P A;  4P71 A;  4X62 L;  1ASY A;  1Q46 A;  1YNX A;  5J3B A;  4JV5 Q;  3LGJ A;  3W1B A;  3L2P A;  1TXY A;  2D0P A;  2LXK A;  4A3L G;  2CWP A;  4DK6 C;  1Y1W G;  3S16 H;  1N36 L;  1HZA A;  2YTY A;  5M3M G;  1J6Q A;  4XIG S;  4PZ8 A;  1VQF A;  2JJQ A;  1YHB A;  4DR3 Q;  3ZJY C;  3CC7 A;  3G6E A;  3OTO Q;  1N9W A;  4Y52 H;  4JI0 Q;  1NMF A;  3HKZ E;  4PMW A;  2E5L Q;  2ZM6 L;  4DV0 Q;  3CC4 A;  1VQA A;  4O2D A;  1VQO A;  1NTG A;  4IO9 A;  1HZ9 A;  2JQO A;  2K52 A;  3M4O H;  2D0O A;  4DV5 L;  4B3M L;  4WJ4 A;  1Q1B A;  1KXL A;  1C7Y A;  1BVS A;  3ER0 A;  4KHZ A;  2Q2T A;  1MIU A;  3BU2 A;  2DUD A;  1UE5 A;  3GD7 A;  3JAM c;  2MNA A;  3HKS A;  2YTV A;  2AKW B;  1PA6 A;  3S1Q H;  2VNU D;  2BA1 A;  4DV3 L;  1XMO L;  4DV2 L;  1HJP A;  1UEB A;  1Y1V G;  3UE1 A;  2F4V L;  4J15 A;  1VQ8 A;  2CCZ A;  3AEV A;  5BR8 L;  4QGU A;  2VUM G;  2XGT A;  5IP7 G;  3CF5 A;  4DV1 L;  1XNQ L;  1E3P A;  1I6H H;  4BXX G;  3I55 A;  4LFA L;  3DLL A;  1HR0 W;  4JI7 Q;  4GLV B;  3GTJ H;  1YJN A;  2VQE Q;  1IBK L;  2I5M X;  4GLA C;  2F3I A;  3NEM A;  1NBW A;  2K50 A;  3BZK A;  4GS3 A;  1PH6 A;  3PF4 A;  3J81 c;  2OCE A;  4OX9 Q;  5M3F H;  4A3B H;  1UE1 A;  4NXN Q;  4A3D G;  3H3V H;  2IX1 A;  4BBS G;  4IPH A;  3PO3 H;  4OXP A;  5M5X H;  2K4K A;  1XMQ Q;  1JJ2 A;  4OWW B;  4GKK L;  1HNW L;  1XPO A;  3CPW A;  4JI5 Q;  2NZO A;  3TS2 A;  5C4X G;  4DR5 Q;  1YBY A;  4LF7 L;  4OON A;  1TWC H;  5EAY A;  4JC0 A;  4DKA C;  2R92 G;  1XPR A;  1Q86 C;  4DR2 Q;  5GRO A;  4JI4 Q;  2KBN A;  3F2D A;  1KD1 C;  1ASZ A;  4DAM A;  3JC6 6;  1A63 A;  2PNH A;  2E2H H;  4LF6 Q;  1X54 A;  4YCV A;  1SN8 A;  4POF A;  4LF5 L;  3PF5 A;  1AH9 A;  3KF6 B;  1GM5 A;  1X3F A;  4GNX C;  1TWA H;  1OXU A;  3RN5 A;  2HHH L;  1KHI A;  3RR5 A;  5C0X I;  4A4I A;  5IYB G;  2Y0S E;  4MTN A;  3E9I A;  4KHP Q;  3CPF A;  3RLF A;  1D8L A;  1LM0 A;  4AH6 A;  3U58 A;  1VQK A;  1YJ9 A;  4OO1 G;  3ULL A;  4A3G H;  2XTI A;  4DPG A;  4YCU A;  4BA1 I;  4QL5 A;  3S1M H;  1OXV A;  4JOI A;  3CC2 A;  3GTL H;  2UXC L;  2BA0 A;  2UUC Q;  4GOP B;  4AYB G;  1AE2 A;  1LTL A;  1XPU A;  3F1Z A;  5M5W H;  2HIV A;  4EQ5 A;  5H1S E;  2IHF A;  2CKZ B;  1EFW A;  1FJG L;  3HOY G;  1N36 Q;  4LFB L;  5LMN W;  2RF4 A;  4HIO A;  2ASB A;  3RLO A;  3HOV H;  1VQP A;  3CQZ H;  1B8A A;  2L15 A;  3KJO A;  1E24 A;  4JYA L;  1CKN A;  2NZH A;  4APV A;  1XTD A;  4DNI A;  2QA4 A;  1QUQ B;  5C3E G;  3D0F A;  3PUW A;  4DUY L;  1I94 L;  1EYG A;  1VQ5 A;  4A3C G;  4YY3 Q;  1L1O B;  1HH2 P;  5HY6 A;  1YHA A;  1I3Q H;  5JEA J;  1IBL L;  1SRU A;  3EIV A;  2JA7 G;  1KC8 C;  2ZTD A;  2JEA I;  3S24 A;  4B3M Q;  4K0K L;  4X65 L;  1OXX K;  3CCQ A;  1K0R A;  4A3E H;  1WOC A;  3I2Z A;  3AQQ A;  4IFD J;  4OO1 I;  3GTG H;  1E22 A;  4YWM A;  3MEF A;  4YCW A;  3W1G A;  4A3K H;  2JEB I;  5HGQ A;  4NB3 A;  2VY3 A;  1E1T A;  3GTQ H;  1J5E L;  1QVF A;  1UWV A;  4HJA A;  3A5U A;  1XMO Q;  2UU9 Q;  4IJL A;  3ULJ A;  3S17 H;  2Q2I A;  1PV4 A;  1VQE A;  2VL6 A;  1L0W A;  1N34 Q;  2NVX H;  1IXR A;  2A1A A;  2PI2 E;  2KEN A;  4QY7 A;  4BBR H;  4HJ9 A;  4A3I G;  4A3M H;  2F4V Q;  3PUY A;  5IE8 A;  4DR6 Q;  3HKZ G;  1HR0 L;  3CCR A;  5BR8 Q;  4JG2 A;  3F8T A;  1N33 L;  4DAY B;  1XNQ Q;  1YHQ A;  5C44 H;  2WAQ E;  1BBU A;  3GDE A;  4DV4 L;  1JT8 A;  1V1Q A;  2DGY A;  3F2B A;  4FDB A;  5ELO A;  3HOX G;  5AJ3 L;  4GKJ L;  4UP7 A;  1YEZ A;  1B7Y B;  4IOC A;  2AWN A;  4A3L H;  1A62 A;  4TQU S;  1VQ4 A;  4DUZ Q;  1Y1W H;  5M3M H;  3STB D;  4R4I A;  3KLW A;  3B6Y A;  3UDF A;  2RHS B;  1PH5 A;  4KLK A;  4GKK Q;  4BA2 I;  4B3S L;  3G48 A;  4L5T A;  3CD6 A;  2ATW A;  4AQY L;  5IP9 G;  4KI0 A;  4LFC L;  4QIW E;  3CCV A;  2GVB A;  4LF7 Q;  1WCM G;  4XTC S;  1Z9F A;  1BKB A;  2R93 G;  5M5Y H;  2B63 G;  3HFZ B;  2R7Z G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...