3PO2H

Arrested rna polymerase ii elongation complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3po2H00
1VQ4A 1VS0A 1IL2A 1M90C 4QQBX 1VQAA 3HKSA 3HOWH 4Y52H 1C9OA 3CC2A 4B3TQ 1TXYA 4P75A 3KF6A 2LXKA 5GQOA 2JA7H 1HNWQ 4K0KQ 1SLJA 1SN8A 1NJIC 3CCLA 1JB7A 4KHPL 1CSQA 4R4IA 3H15A 4OO1G 1CKNB 3CPWA 5GROA 4DUZL 4GNXA 3S2DH 2R93H 3J81c 3U4ZA 1IBML 4GLXA 4JI0Q 1FJGQ 1XNRL 1NMFA 5M5WH 1YHQA 3I4NG 4X6AH 1UEBA 1D7QA 4IOCA 4DR7L 1JT8A 1A63A 3HOVG 2N78A 1VQPA 1Y1WH 2PI2A 3GO5A 1YHBA 1A0IA 2R7DA 4LWCA 4A93H 5IP9G 3RN5A 4LFAQ 3CCRA 1NY4A 1GM5A 1OTCA 3PUYA 4JOIA 5BR8Q 4DV2L 2IT1A 3AEVA 5IYCH 1VQ5A 1W3SA 3K80C 2GVBA 5LMUL 1JJGA 1N34Q 5C0XJ 1KIXA 2VQFQ 4HIOA 1EIYB 4JBWA 2YU9H 4JI6L 3D0FA 4AYBG 2F3IA 1PH4A 1Q1EA 4BXXG 3T1YQ 1FVIA 2JA8G 5LMNQ 3NENA 3BZCA 5GAGC 4JV5Q 1Y1VH 1PH1A 1K9MC 4GKJQ 4JI5Q 2N8NA 1UE6A 4YCWA 4YY3Q 3RLOA 2HIXA 2VQEQ 4A3FG 4NXMQ 1OXXK 2BA0A 4GKKQ 4PMWA 3S14H 1C7YA 2ZTEA 1K73C 4HJAA 4DK6C 2NN6G 4A3IG 1HZ9A 2OCEA 3GTLH 3PV0A 4XTCS 4BBRH 1AE3A 2CKZB 2R7ZG 5JEAG 2VUMG 2K4KA 1SE8A 1HJPA 5AJ3L 4DV7Q 1OXVA 1H95A 3CF5A 3RR5A 4DR3Q 2CCZA 1X55A 2Q2HA 1PH9A 1IBLQ 4B3RL 3KDFB 2PQAB 3NBHB 5J3BA 2CFMA 3JC66 1G291 1N9WA 4DR1L 1LTLA 3FHWA 5FLMG 3KOJA 4P74A 1E24A 1QVCA 4R4CA 2NVYH 3J81i 2ZM6L 2I0QA 1Q12A 1LYLA 4GOPA 2JA5H 4OX9L 4BBSH 3STBC 2RHQB 3HOZG 5JJIA 4A3KH 3I4MH 1IBKL 4WJ4A 2KENA 1XMQL 1U5KA 3PUWA 2K5NA 4FDBA 5EAYA 1VQ7A 4DR2Q 2UU9Q 4LFBQ 2MO0A 1SMXA 4DV3Q 1OXSC 1LUZA 4OONA 3CCQA 4LF5L 4KLKA 4X65L 4APVA 1N33L 4JI8Q 1WI5A 4OO1I 3DM3A 5M3MH 1AE2A 2V1CC 4DV0L 1PHJA 1VQHA 4DR6Q 3J80i 3OW2A 1CSPA 4UP9A 2UXBQ 1NE3A 2K52A 3T1HL 4YHHL 1WJJA 1L0WA 4R4TA 2IX1A 1K83H 4EX5A 1WYDA 3TEHB 1KRTA 1A62A 1VQ9A 3I55A 3RZDH 1PA6A 4C3JH 3WWVA 4LF7L 2R92H 2UXDQ 2RCNA 4POFA 2UUCQ 3CCUA 3KJPA 2VW9A 2UUBL 4LF8L 4X66L 4DR5Q 4JI4L 4H02A 4PZ8A 1X3GA 3ERSX 1GVPA 1UE5A 2UXCL 2JA7G 4HIMA 1MJEA 2ES2A 3CCJA 5C4XH 3K0XA 3MEFA 3GTQH 2YTVA 4P71A 1XPOA 2ZTDA 2IHFA 3EN2A 4B3MQ 2R93G 1IXRA 5DLQE 1QUQA 4JI2Q 1TWGH 3J7ZC 5M3FH 1VQJA 2NN6I 2B3GA 3HFZB 4DV6L 1KC8C 1PH5A 1S72A 2QGQA 5ELNA 3TQYA 2Z0SA 3CQZH 5HGQA 1Y1WG 5IP7H 5GAHC 4DV2Q 4B3SQ 3H3VI 4ME3A 4A93G 1G6PA 5IWAQ 3AFPA 4JG2A 5LMUQ 1PYSB 4QL5A 4DV1L 2JQOA 3EIVA 2D62A 4A3LH 5IYCG 1A8VA 4IPCA 4NB3A 4LUOA 4A3DG 3UDFA 1N36L 4IFDG 4J15A 1PYBA 3OTOL 4IPDA 3PUVA 5C0XG 2E2IH 2Z6KA 2JA6H 1VQCA 1Y1VG 2QA4A 1VQOA 4QGUA 4R1JA 2QEXA 1TWCH 3BZKA 3PCOB 3TS2A 2Q2UA 3E9IA 4L5SA 4GNXC 2E2HH 4BY1G 2Y0SE 1QVGA 4O0AA 3ULPA 2JEAI 1NTGA 3PUZA 3F2BA 4AQYL 4X62Q 2F4VQ 4BBRG 2I5MX 2PMZE 3E0EA 3K7AH 4X64Q 3UE1A 1TWAH 4JBMA 3J7A5 1PVOA 4HJ5A 5C44H 1YJWA 3CD6A 2E5LL 3W1BA 3PO3H 4A3CH 1UE7A 3CP0A 1SR3A 4JI3L 1Q82C 2EQSA 2R7ZH 1IZ6A 4JOIC 5ELOA 2KHJA 4LF9L 3GTGH 2ZM6Q 1CKOA 3A5ZB 1N32Q 3J80c 1AH9A 1X56A 4LF4L 3ICEA 3FKIH 2VY3A 4IPGA 4LFCQ 3GTOH 3FP9A 1XMQQ 4JBKA 3B6YA 4JYAL 1P16A 2ZTCA 2JA5G 3HOUH 4BBSG 3GTMH 2DUDA 4DV5Q 4NXNQ 3RLFA 1Q7YC 1WCMG 2NZOA 1VQNA 4A3EG 2PI2E 1HR0L 2NVXH 3RZOH 3S2HH 1KL9A 1S3OA 4MZ9A 1XMOL 4C2MH 2BA1A 3Q8DA 1D8LA 5C3EH 2EXDA 4JI7Q 1GO3E 3AQQA 2NVTH 1L2FA 2Q2IA 4JI1Q 2MQHA 3H0GH 4C3IH 3CCEA 2BH8A 1JJCB 5IYBH 1UE1A 1G51A 4DNIA 3S1RH 1I94Q 1OXUA 1HNXL 4GN4B 4DR4L 2YTXA 2HHHQ 4LF7Q 1PFSA 4BY7H 4IPHA 1XNQQ 2AMCB 1IYJB 3PO2G 1Q81C 1VQIA 4AIMA 4DV4Q 1GD7A 2R92G 4B3TL 1P8LA 2KHIA 4UP7A 4A75A 1VQ8A 1BKBA 2KCMA 4IOAA 1I3QH 2NVQH 4YWMA 2ALYB 4K0KL 1HNWL 1PH7A 2UUAQ 1EIFA 1QZHA 3M3YH 2UXCQ 4DUYQ 3I7FA 1YEZA 1Q1BA 3E9HA 4XIGS 4IFDI 1ASZA 4GOPC 2PNHA 4DKAC 3L0OA 4RG1A 5M5XH 4JI0L 1FJGL 3S1MH 4GNXB 5C4XG 1HNZQ 2WFWA 3U58A 4P73A 2VNUD 2B29A 1JE5A 3KLWA 3GD7A 1VQ6A 2A8VA 5M3FG 2L15A 4KI0A 4LUZA 4LFAL 1CUKA 1YHAA 1L1OA 3F1ZA 4JC0A 4BA1I 2AWOA 3PF4A 1VCIA 1PH3A 2D0OA 3HKZG 5IP7G 1KXLA 1N34L 2OWOA 2K75A 1Q8KA 4LF6L 1YI2A 3PIOA 3T1YL 1RL2A 2B63H 2F52A 4A3LG 2OQKA 3I4OA 4R4OA 3OTOQ 5LMNL 4JV5L 3KFUA 2MNAA 4JI5L 1XPRA 4YY3L 1CKNA 1I5FA 2VQEL 2NZHA 4NXML 4GKKL 4RMFA 3HOWG 1JJ2A 3GTPH 3STBD 3CPFA 2JA6G 4KHPQ 1I50H 3HKZE 4PZ7A 4DUZQ 1HZBA 2K5VA 3CAMA 4A3GH 2N49A 1IBMQ 2OTJA 3NELA 1XNRQ 5M5YH 2C35B 5IE8A 1KAWA 1HR0W 4DR7Q 3OYYA 4C3HH 1NMGA 4AH6A 1YIJA 3I2ZA 4OWWB 4DR3L 4LNQA 1HZCA 1B70B 1E1TA 1X3FA 2A19A 3KF8B 1IBLL 1Y14B 4L5QA 3M9BA 4R4QA 4UPAA 1M1KC 1VQBA 1YNXA 3GDEA 1K8AC 2D0PA 5C44G 3W5OA 4IO9A 4DAYB 3CC7A 3PGZA 2HQLA 2GVAA 3PO3G 5IYDH 2CWPA 3KJOA 4JI6Q 4TVAB 2CQOA 1UWVA 3ER0A 5FJ8H 5GAEC 3D31A 4GN3B 4P72A 1TWHH 3MXNB 1VQKA 2Y0SG 2EIFA 1W2BA 2I5LX 2ZJRA 3FKIG 1LM0A 5JJKA 1FL0A 2WAQE 4GOPB 1O7IA 4YCUA 1EQQA 4DR2L 2UU9L 4LFBL 1EYGA 3G6EA 3HOUG 2Z6KC 3KYHC 1R9TH 2ASBA 3PUXA 4TQUS 3HOXH 1YITA 1Q86C 2ZJPA 4JI8L 1XMOQ 3DLLA 4QIWE 2R7FA 4PG3A 3CC4A 4DR6L 2UXBL 3RN2A 3HOYH 1KHIA 5JJLA 5C3EG 5AJ3Q 4JCVE 3KDFA 2PQAA 3ULJA 1N8RC 4DR4Q 1J6QA 4EQ5A 5E7NA 1VQLA 3H0GG 2VZAA 4B3RQ 5IYBG 2UXDL 4OXPA 2UUCL 4DR1Q 4BY7G 2AKWB 3S17H 4GLVB 4DAMA 3ULLA 4A3MH 1EQRA 1XJVA 3BJUA 1J5EL 4DR5L 3UDXA 5LMNW 1Q46A 3JAMi 4OX9Q 2E2JH 1IBKQ 2WB1E 1MIUA 1X6OA 1E1OA 1X3EA 1XTDA 4LW1A 4B3ML 1E22A 3UDGA 3CMAA 4A3KG 3I4MG 1Z9FA 1YBYA 3A0JA 1QVFA 1MKHA 1VQMA 1HH2P 4LF5Q 1V1QA 4JI2L 4X65Q 2JJQA 3G71A 2OTLA 1N33Q 1SROA 4A3BH 2AHOB 3U4VA 3S1QH 4WJ3M 4DV0Q 2H5XA 5FLXc 1QUQB 4A3JH 4B3SL 4GN5A 3T1HQ 3IRBA 3PF5A 3S15H 4YHHQ 1YVCA 2GN5A 5M3MG 4IFDJ 5IWAL 4YCVA 4A4IA 3F8TA 4IJHA 3RLNA 1T9HA 4LF6Q 1EFWA 1RIPA 4A3DH 2KCTA 1YJ9A 1U0LA 1PV4A 1EOVA 2AWNA 2A1AA 3AFQA 2DGYA 1X54A 4QY7A 3PIPA 2VS1A 1K8GA 2UUBQ 2B63G 4LF8Q 1WFQA 4X66Q 3K7UC 4JI4Q 1PH6A 1YJNA 2ATWA 2JK8A 2K5HA 1OXTA 3CCVA 4GLAC 2ID0A 2YV5A 4BY1H 3K8AA 3F2CA 1YZ6A 3I4NH 3J81j 4AYBE 3KF6B 3CCMA 3K81C 1B7YB 5GADC 4YWKA 5C4JH 3HOVH 5H1SE 4HIDA 1MJCA 3S24A 5C0XI 2HT1A 4A3GG 2JA9A 3CMEA 2HIVA 4X62L 1QZGA 5IY0A 4L5TA 2F4VL 5IP9H 1K3RA 4DV6Q 4X64L 3M85A 3L7ZC 2N3SA 2IHEA 2RHSB 3UDIA 1VQDA 2K14A 4HJ9A 1X9NA 1HZAA 3GTJH 3NEMA 3S16H 5BR8L 1I6HH 2XGTA 1L1OC 2KBNA 4DV1Q 4BXXH 1BVSA 4HJ7A 1N32L 2JA8H 1S40A 3TS0A 2VQFL 3RNUA 3A74A 4L5RC 1BBWA 5IYDG 3LGJA 3M7NA 3CCSA 4GS3A 3BU2A 4LFCL 4HJ8A 4A3FH 1N36Q 1X65A 4LUVA 5FJ8G 2RF4A 1WCMH 1VQEA 4NPSA 3M4OH 2JE6I 4IJLA 2CWAA 4A3EH 3TRZA 4GKJL 3VDYA 3F2DA 5JEAJ 4NXNL 4DV5L 4A3IH 3W1GA 4ALPA 3S1NH 1Z47A 2E8GA 3H3VH 1B8AA 3M4QA 2MFIA 2VL6A 1SRUA 2VUMH 3HOXG 1FGUA 4DPGA 4JI7L 3JAMc 4HIKA 4POGA 4AQYQ 2JEBI 4JI1L 2YYZA 3HOYG 2MO1A 3AYHB 4MNOA 4DV7L 3U50C 3PO2H 1I94L 4DK3C 2K50A 3M4PA 4PZ6A 2HHHL 2OQ0A 3ZJYC 5FLMH 1JMCA 1EUJA 2Q2TA 1XNQL 4QJFA 2WAQG 1E3PA 2E5LQ 3PSIA 1TWFH 3CXCA 4JI3Q 4DV4L 2FXQA 1V9PA 1NBWA 1J5EQ 3G48A 3TREA 1PH8A 1EWIA 3A5UA 1GKHA 4LF9Q 4OWTB 4UY8C 4O2DA 4OWXB 3HOZH 4LF4Q 4A3CG 5HY6A 4YWLA 5IT9c 4A3MG 2LSSA 2WP8J 4MTNA 4A76A 1ASYA 2UUAL 4DUYL 2BH2A 3CW2C 4KHZA 4JYAQ 1E7ZA 3G4SA 2R6GA 1PH2A 1VQGA 2IX0A 1BBUA 1HNZL 4DV3L 1KD1C 1HR0Q 4BA2I 4JBJA 1KQSA 2I5HA 2ZJQA 2XTIA 3SGIA 3UE0A 1V43A 3L2PA 3I56A 4A3BG 1KRSA 1C0AA 4UP8A 4Y7NH 1WOCA 1CKMA 2YTYA 4A3JG 1SFOH 3GTKH 1K0RA 2IY5B 2LXJA 1HNXQ 5K36G 1L1OB 1VQFA 2WB1G 1DGSA 3EBEA 1XPUA
chains in the Genus database with same CATH superfamily
1M90C 4QQBX 4Y52H 3HOWH 1C9OA 1TXYA 4MIUA 1UNSA 4BWGB 1CA5A 2JA7H 1CSQA 1F9SA 4OO1G 1SBBB 4DUZL 5FO9B 3S2DH 1EQTA 1AW7A 1XNRL 1YHQA 4IOCA 1SAPA 4DR7L 2M2LA 3MXUA 3GTKB 1GJXA 3I72A 1EY5A 1CHPD 3GO5A 4LWCA 5IP9G 4LFAQ 4K5VA 2HD3A 3PUYA 4JOIA 2IT1A 2J4XA 5IYCH 2B2VC 2IX3A 2Z4IA 3J80L 5C0XJ 3EVQA 2HCCA 4HIOA 1EIYB 1S5FD 2QF7A 3MFYA 2JSOA 3MZ5A 1LTGD 5LMNQ 3BZCA 5GAGC 1K9MC 4JI5Q 4YCWA 5KNBA 3M4YA 2HIXA 3FPUB 5DNFA 4G4KA 1H9JA 2VQEQ 2EZVA 3S14H 1EU3A 3R8BA 4WORA 3NP8A 1KAAA 2ZTEA 3V05A 1MBYA 1IW7C 4XTCS 1I4PA 4BBRH 2CKZB 5JEAG 2VUMG 1SE8A 1ICWA 1BCPF 4V190 1EY7A 1I4RA 4XDXA 2O2LD 2YU9B 2NBFA 4DAYA 3KK7A 4FP5D 5C4ZA 1PH9A 4RWSC 3KDFB 3NBHB 1BOSA 5EBCA 5J3BA 1N9WA 3MAQA 1LTLA 3MXNA 4B08A 4P74A 1E24A 1QVCA 5CV5A 4BBSH 4GOPA 1EZ6A 2JA5H 2LY7A 2HDMA 4IUVA 3GTLB 1EIGA 4JPBW 1U5KA 4FDBA 4O42A 1V1PB 3NHHA 3EROA 3NTHA 4ZKBB 4DV3Q 3T13A 3NUCA 4JI8Q 4OO1I 4WFN3 3MC0B 5M3MH 1PHJA 4DR6Q 3J80i 2K52A 3T1HL 1ILQA 1TT2A 3I70A 4KY7A 3PQIA 4R4TA 1JWUD 2CH4W 1VMPA 3R2IA 3K58A 3MEHA 3TEHB 2NVYB 3RZDH 3WWVA 4POFA 1SYEA 5EPJA 3KJPA 3OWFA 3TZUA 3KLRA 4RGMA 4R8IA 2R61A 2IWHA 4JI4L 1GVPA 2EY5A 1LTRD 1JR0D 1GUOA 1MJEA 2ES2A 1D6EC 2ZT9C 3K0XA 3JAML 4B3MQ 3EN2A 3WDNA 1B4OA 5FO7B 2P5ZX 5M3FH 2C5CA 3HZXA 2BCOA 4C3JB 5HGQA 5IP7H 4DV2Q 3UI2A 4O1NA 1SMYD 4DV1L 5IIFA 1Y8PB 2KUMA 4IPCA 3SK5A 4N9PA 4RGNA 1EY0A 2K5DA 2OXPA 4LUOA 2PO4A 5JPNC 3GTQB 5IGEA 5C0XG 3BS1A 3NTIA 1VQCA 3MWYW 2ENBA 3VR2A 2QEXA 1TWCH 5FLXE 2L0CA 1WTVA 1I4HA 5CV4A 1HUNA 2Y0SE 2JEAI 4ZRZA 3F2BA 1AZQA 1PVOA 2F03A 3A8IE 5A2QE 1YJWA 1QCBD 2B2UC 2F0QA 3CD6A 4B9WA 1F9PA 1UE7A 3FEWX 1SR3A 4JI3L 4DK0A 4DGZA 2KHJA 2ZM6Q 1I4QA 3FKIH 3HP3A 4IPGA 1Y8NB 4LFCQ 3FP9A 1XMQQ 3B6YA 1Q3LA 5LHY1 4RGOS 1ICFB 4DV5Q 4NXNQ 1L0XB 1STEA 3RLFA 1HR0L 1R4QB 1X32A 3BDLA 1H9SB 1K28A 1PTOD 4RA8A 3ZYYX 1XMOL 1IYVA 1ZEQX 4C3IH 2MQHA 3CCEA 2BH8A 5IYBH 1HNXL 1G51A 1OXUA 4ZKCB 4BY7H 4N8FA 2AMCB 3VYRA 4DXGA 1PRTD 4C56C 4C3JG 3HOUB 3GTMB 1GD7A 2FMCA 2KHIA 4I7ZC 2OEOA 4UP7A 1IHZA 4IOAA 2NVQH 1HNWL 4K0KL 3V96A 4DUYQ 3I7FA 4ABNA 5C5LA 5IGCA 1TIID 1FJGL 4M1UB 2XSCA 2K28A 5LL6S 3U58A 4JVZA 3TZDA 2A8VA 3VYUA 1Y69U 2EYJA 1UUPA 1YHAA 5ELEA 3F1ZA 2B39A 4BA1I 2M00A 4YIJA 2MHVA 5HURA 3M3YB 3T1YL 4R4OA 3OTOQ 3P75A 3KFUA 4EQNA 2E75C 3TSSA 4CKEA 2H4OA 4YY3L 2HUGA 1I5FA 3D3RA 4PMCA 4NXML 5G3LF 1A6XA 3CPFA 5EJWA 3I91A 3FRPB 4PZ7A 4DUZQ 2K5VA 3CAMA 1GUWA 1LABA 1XNRQ 3MVVA 4DAPA 2A6HD 3OOCA 4DR7Q 3OYYA 1K8MA 1SMYC 1NMGA 3M7GA 3W3AA 3I2ZA 3R2TA 4DR3L 4H13C 2A19A 3DXJC 4X3KA 1IBLL 5AFWA 2NZ1D 5IODA 1YNXA 2D0PA 2B2WC 2B8FA 2HQLA 2GVAA 1ZYRC 2C9OA 3ER0A 2CQOA 5GAEC 3D31A 3J81E 5J39A 1W2BA 2ZJRA 4A3GB 2O5IC 1FL0A 2WAQE 3A56A 4PQXA 3CKIB 4LFBL 1EEFD 4DR2L 1EYGA 2EDGA 3HOUG 2Z6KC 2F4IA 2A5HA 4TQUS 1YITA 3HOXH 1Q86C 2LKVA 3DLLA 1ENFA 3CC4A 4KN7C 3RN2A 3OWEB 2AQ1B 4WRDA 4XQQA 2G5DA 4X3UA 3KDFA 3NBHA 2A6ED 2F0TA 2IPKD 2VXWA 3MXPA 2UUCL 5ELDA 1TY0A 3HG9A 1LACA 1LTBD 1XJVA 1EQRA 1V1PA 1OO9B 2WB1E 2EOTA 1PTOC 4KJNA 4LW1A 1SNPA 1E22A 4V0BA 1Z9FA 4E6IA 1XTCD 1YBYA 3OPOA 5JVG3 5E4WC 3U4VA 1D1KA 5FLXc 2NYZD 3R93A 3T1HQ 3IRBA 4IUUA 4IFDJ 2B2VA 1YVCA 1MI2A 2GN5A 2HDLA 2Q8RE 4EGVA 3C2PA 3S17B 1HTPA 4IJHA 1JICA 4A3DH 1U0LA 1WVLA 2A1AA 1H9RA 4RHSA 2DGYA 1SE3A 1B9MA 3DUZA 3H91A 3NTKA 4JI4Q 1PH6A 3NWTA 2EYPA 4GLAC 2ID0A 4TSSA 3I4NH 3S1QB 4KD4A 3J81j 1NUCA 2F0WA 3K81C 4C2MB 1B53A 3S15B 4HIDA 1MJCA 4A3GG 4XT3B 4ZK9B 2XN9C 1CI3M 5EKIA 3M85A 1JWMD 2KQ3A 2NUCA 1HZAA 4HCSA 2ICIA 1CFMA 1SE4A 2KBNA 5T1GA 4DV1Q 4BXXH 4HJ7A 3QG1A 1S40A 4OHJA 3RNUA 3DWAA 4HTHA 3CCSA 4GS3A 3OSOA 4HJ8A 3KBGA 4J8QA 4F8MA 1WCMH 4K5XA 5C4JB 3HOVB 3TRZA 1HXYD 1PTOB 2A6HC 1DXMA 2WKDA 3VDYA 4A3IH 2BE5D 3S1NH 2EXZA 3S1MB 2DNCA 2E8GA 1GHJA 3X3NA 1JOOA 3NQIA 2HCIA 1D1IA 3OW7A 4JI7L 4HIKA 4M8AA 3I73A 4AYBB 5BN3A 4JI1L 5CBAE 3DWPA 2MO1A 2JA8B 4MNOA 4RKLA 4QUFA 3PO2H 1I94L 2K50A 4PZ6A 1SYCA 5FLMH 3I3CA 4A3FB 1JMCA 1XNQL 4CDFC 1TWFH 2AUJD 4JI3Q 3M4OB 1V9PA 4UY8C 1EWIA 3EJIA 5C6AA 4O2DA 1FR3A 1JORA 1ASYA 2BH2A 1TS4A 1E7ZA 4FXKC 2R6GA 1ENAA 4DNRB 1H9SA 2F0EA 1VQGA 1T5XD 1YNND 2XIWA 4DV3L 3TDQA 1HR0Q 1EYAA 5L37A 3P1HA 2A6EC 2PZUA 1NR2A 3F2UA 2KOLA 4KN4C 3U9SA 4Y7NH 2YTYA 1CKMA 3J80E 1K0RA 1HNXQ 5K36G 3HOZB 3EFXD 4K6DA 1RF2D 1IL2A 5CYUA 1TKWB 3BG3A 1HNWQ 4K0KQ 1NJIC 1JB7A 3CPWA 5GROA 3GV6A 2R93H 3J81c 4C1NK 4GLXA 1FJGQ 4KJOA 3V2TA 5M5WH 1D7QA 1GUGA 2F0SA 1AN8A 3HOVG 1Y1WH 2LS01 1YHBA 2B2UA 4A93H 1EIHA 4DV2L 3AEVA 4KKSA 4HSPA 5T1IA 1VQ5A 1W3SA 3D6CA 2GVBA 2E76C 1JJGA 1KIXA 2JA7B 4IFDH 1U4RA 4AYBG 2F3IA 1PH4A 3T1YQ 2JA8G 1E2VA 4KK7A 3S2DB 2BDOA 1KLUD 1PH1A 4GKJQ 2N8NA 4YY3Q 4A3FG 3LWEA 4NXMQ 1OXXK 2BA0A 4PMWA 5NUCA 1B1ZA 2DJGC 2NN6G 2A69D 1KLGD 2XRSD 2RA4A 4DV7Q 4DR3Q 1EY8A 1IBLQ 2PQAB 3IAYA 4DR1L 1G291 1EWCA 5D3DA 4DNTB 3S14B 3J81i 2ZM6L 1A3UA 5ELFA 2BE5C 3E0JA 2I0QA 4H0LC 3PMFA 5JJIA 3STBC 2RHQB 3HOZG 4A3KH 3MXGA 3JAME 3I4MH 4FF1A 1XMQL 2MUYA 4X3SA 4BBRB 5EAYA 4LFBQ 1VQ7A 4DR2Q 2MO0A 1OXSC 1LUZA 4X65L 3ITPA 1HRJA 1AE2A 3H09A 4DV0L 1BO0A 2EY6A 4HAEA 2IX1A 4LAAA 1K83H 4RKBA 1STAA 4EX5A 2Z4HA 2EY1A 1VQ9A 1A62A 3I55A 5FO8B 3T56B 1PA6A 3N52A 1KDAA 1TVXA 1XWEA 4LMQD 4BBSB 2JA5B 3G6JB 3GQBA 2UUCQ 3CU7A 4LF8L 2F0VA 4X66L 4A3EB 4H02A 4PZ8A 1UE5A 3MTSA 2JA7G 4IN3A 2I07B 1XXGA 5CV8A 1TWGH 2NN6I 4DV6L 3RZDB 3CQZH 1G6PA 2B2WA 5GAHC 1LTSD 1BBXC 5LMUQ 5KRUA 3SEBA 2ZXPA 5IYCG 3LNNA 3GP7A 2EJGC 3UDFA 1KNEA 5ELBA 3Q24A 2QW7A 3OTOL 4L8JA 2E2IH 2Z6KA 2JA6H 5M9OA 4QUCA 5M3FB 4QGUA 4R1JA 2RSNA 5IGBA 4KY6A 2EVBA 3TS2A 2A68C 2DNEA 2PNRC 3QWNA 2O4XA 2E2HH 1QVGA 1NTGA 2RBMA 4BBRG 2PMZE 3E0EA 3UE1A 3J7A5 2OF1A 1E2ZA 3KLSA 3PO3H 4A3CH 2EYHA 3GTGH 3OIPA 1H9KA 1F9QA 1CKOA 3A5ZB 4N9TA 3J80c 1AH9A 4B9XA 4LF4L 3ICEA 1CA6A 5EBDA 3GTOH 2A69C 4JBKA 4BBSG 2JA5G 1A3TA 3QJYA 5C3WA 4FO2A 2RDFA 3TP8A 1GUTA 2NZOA 1JC7A 4PNYA 4WJWA 4A3EG 2NVXH 3S2HH 2BA1A 4JI7Q 3AQQA 2NVTH 1NSNS 5JPMC 4NP5A 4JI1Q 1U9RA 1ZKOA 3H0GH 1AZPA 4X6AH 1I94Q 1I6VC 1PFNA 4EVOA 3FKIB 4GN4B 3SDZA 4IPHA 4FNFA 1XNQQ 1IYJB 1HHVA 1Q81C 1VQIA 2Z9HA 1QNUA 1P8LA 4B3TL 1BKBA 2KCMA 4YWMA 2ALYB 4BS9A 3QOLA 1F2YA 1YEZA 1ASZA 4DKAC 1PZID 1ESFA 1SJED 2MJ8A 4C3IB 2WFWA 3IKJA 3KLWA 3GD7A 4BY7B 5M3FG 3VR4A 4JW0A 4OEMB 4JC0A 5D65A 1F2MA 2D0OA 3SHLA 5IP7G 1KXLA 2KEDA 2NVQB 1Q8KA 4G7ZC 2G9HD 2F52A 1TU2B 3I4OA 1ONLA 1GUSA 4RCOA 4RMFA 1WD1A 3NSWA 1JJ2A 3HKZE 4NMZA 2N49A 1K3BC 3NELA 2C35B 4UAIA 5IE8A 1D5XC 3K57A 1LT6D 1YIJA 4LNQA 2WKCA 3KF8B 1Y14B 4L5QA 3GDEA 4IO9A 3CC7A 3N6RA 1STNA 2CWPA 5IT9L 3KJOA 1JCKB 1KDBA 1EFID 5FJ8H 2BOSA 2SDFA 5CBEE 2EIFA 3FKIG 2PW7A 1EOTA 1LM0A 2B2TC 2UU9L 4NW2A 1R9TH 2ASBA 3PUXA 1HPCA 1STHA 4QIWE 4J1MA 3TBIB 2R7FA 4PG3A 2UXBL 2F0DA 1KHIA 2E74C 4JCVE 2PQAA 3ULJA 2EJMA 1J6QA 4EQ5A 5E7NA 4C3IG 1VQLA 3E5SA 2L4NA 5EKLA 3DEOA 4Z9CB 5IYBG 3TP5A 4DR1Q 1JE4A 4BY7G 4TRDA 2AKWB 3ULLA 1LV9A 1I4GA 5LMNW 1Q46A 3JAMi 2E2JH 3HOXB 1DCZA 3K5MA 1KNAA 1E1OA 3FDTA 2X69A 4JI2L 4X65Q 2OTLA 1SROA 2R3ZA 4CKCA 4DV0Q 4B3SL 1PXUA 3BYTB 3H94A 1JOQA 4YCVA 3F8TA 4IUQA 3RLNA 1T9HA 2R7ZB 1LT4D 2KCTA 2J7ZA 1RDPD 1PV4A 2IL8A 1B44D 1D5MC 2AWNA 3AFQA 1A3VA 4LF8Q 1WFQA 2PCFB 4X66Q 2KEEA 2X6GA 1O80A 4DF7A 2PZTA 1YJNA 2ATWA 2K5HA 1OXTA 3CCVA 1HTLD 3K8AA 3F2CA 1YZ6A 3J7YW 3CCMA 4AYBE 1B7YB 2X6LA 1VDZA 4YWKA 4ODGA 5J22A 5H1SE 2HT1A 5C0XI 1NCVA 2IJ0A 3A7LA 2JA9A 2HIVA 4L5TA 1K3RA 3T4AC 4DV6Q 3L7ZC 1CM9A 3H6MA 1HQMC 1X9NA 1HUMA 1B2TA 2I46A 2XGTA 1HFNA 1QWYA 1D5ZC 4MN3A 3A74A 4CKBA 1BBWA 4L5RC 3LGJA 3BU2A 3I4NB 1X65A 4H7BA 2RF4A 3BVMA 1LTID 2JE6I 2CWAA 4GKJL 5C4HA 2F0UA 3W1GA 1Z47A 1BDOA 1SE2A 4KHVA 3H3VH 1E0BA 1SRUA 1SEBD 3HOXG 3KUPA 1XYIA 3AMUA 4POGA 5DM73 5DAUA 2JEBI 5IOCA 3O13A 4DV7L 3U50C 4DK3C 4IUNA 3BVGA 3QOJA 2QCPX 4QJFA 1J5EQ 1X3QA 3K5OA 2MGSA 4A3IB 3S1NB 4OWXB 3A54A 4LF4Q 2FJ2A 1YNJD 4YWLA 2R7ZG 2LSSA 3P20A 3HEJA 3GTPB 1G91A 3CW2C 1WTRA 1EEID 1Z7TA 3G4SA 4IURA 5I9OA 4XQNA 2Z6BA 5CC4A 2IX0A 5I6WA 1X3PA 1KD1C 2I5HA 2B8GA 2DY7A 1RTNA 4K5WA 3SGIA 1V43A 3L2PA 3EQLC 5IGDA 1C0AA 1TWFB 4UP8A 3T51B 1WOCA 5A35A 2A74C 2K5WA 1SFOH 5CR3A 1VS0A 1TWHB 1MD2D 1STYA 3HKSA 1WTHA 3CC2A 4B3TQ 3CRLC 3NXWA 4P75A 1PFBA 2NWGA 1SN8A 1O7YA 3CCLA 4KHPL 3H15A 4R4IA 1CKNB 4OIKA 1IBML 4XXEA 3I4NG 1NMFA 2ZXRA 4Y7NB 3BDCA 4FF2A 2F0GA 2D9UA 1JT8A 4ID6A 2N78A 1VQPA 1Y8OB 1MSHA 3G7LA 1A0IA 4RH6A 1JQYD 4PV1C 2WINB 1OTCA 5DM63 1BCPD 3K5NA 4OIJA 1PRTC 1WTPA 5LMUL 2HQEA 2VQFQ 2F0IA 4JBWA 1ET6A 4BXXG 1FVIA 3NENA 2KJXA 2R93B 1M8AA 1Y1VH 2TMPA 5M5WB 3HRZC 3VR3A 4HJAA 4DK6C 1K73C 1Y1WB 4A3IG 1HZ9A 2LFNA 4A93B 2OCEA 1STBA 2K4KA 3KF8A 1HJPA 5AJ3L 1OXVA 2G9DA 3RR5A 2QEJC 2F1MA 1X55A 3MA2B 4B3RL 3JC66 2F0LA 2EPBA 5FLMG 3FHWA 3KOJA 1LO5D 4KTAA 1U4PA 1Q12A 1LYLA 3CRKC 4BY1B 1PFMA 4XT1B 1IBKL 3PUWA 2UU9Q 5E3FA 2EYFA 1SMXA 3CCQA 4OONA 1LT5D 3DM3A 4G7HC 3QIAA 1VQHA 3OW2A 4UP9A 2UXBQ 1NE3A 4YHHL 2JN4A 4I7AA 4H44C 1L0WA 1WYDA 1GUNA 3IFDA 1KRTA 5KEEA 3C3LA 1PRTB 2PYKA 1YNJC 1PDQA 3QR8A 4S3SA 5FOBB 2R92H 4DK1A 2JXMB 2RDGA 2VW9A 1RKNA 1C48A 3K6OA 1HA6A 1SYBA 3ERSX 2PW5A 4HIMA 1TS3A 2K5QA 1RTOA 5C4XH 1XPOA 4P71A 1FGBD 2ZTDA 1C4QA 2R93G 1IXRA 5DLQE 1SNQA 1K83B 3I8ZA 4R9WA 4JI2Q 1A2TA 1VQJA 2B3GA 3D8GA 3HFZB 1KC8C 1PH5A 1S72A 2QGQA 4B3SQ 3TQYA 4ME5A 1Y1WG 3GV3A 3FVQA 3D4DA 4A93G 5D14A 2BDNA 4JG2A 3C46A 1S5ED 4QL5A 2PQEA 3SK4A 2D62A 4A3LH 2VB3X 2O5JC 4KV6A 1A8VA 4NB3A 4IFDG 4J15A 2B2TA 4IPDA 3PUVA 2F0KA 3BZKA 3PCOB 2Q2UA 3E9IA 4L5SA 3CQZB 4GNXC 1D2BA 4BY1G 4O0AA 4AQYL 3PUZA 2I5MX 3K7AH 4JBMA 1TWAH 4FXGC 1EU4A 5C44H 1C8CA 1NNXA 1ML0D 2E5LL 4LJZC 3W1BA 3HOWB 5ELOA 2E2IB 4IQZA 4LF9L 2JA6B 1IKMA 1X56A 1SNCA 2VY3A 3P7JA 1CQFA 1QB5D 4JYAL 1P16A 2ZTCA 3L3OC 1T5EA 4CDCC 5J1ZA 2JYOA 1M4VA 1VQNA 2EJFC 3BVZA 4CHTB 3RZOH 1KL9A 2D5DA 2N55A 4I65A 3TMEA 4C2MH 1A2UA 1SSOA 5C3EH 3PO3B 2EYLA 4EQOA 1L2FA 5KYIA 3GTGB 1UE1A 3S1RH 1GHKA 2AQ3B 2YTXA 4LF7Q 1PFSA 3RD4A 2D2CC 3GTOB 2Z8LA 1VQ8A 5KYLA 1I3QH 1PH7A 2UXCQ 1EIFA 1QZHA 2NVXB 1Q1BA 3E9HA 4IFDI 2PNHA 5FKAC 3L0OA 4RG1A 1PTOF 1FYCA 5M5XH 4K6LA 4JI0L 5G3LD 2NVTB 1FD7D 3S1MH 4GNXB 3H0GB 4TKOB 4P73A 1IW7D 4MTKA 1STGA 4KD3A 1CK1A 1VQ6A 3FMCA 5KNCA 4LUZA 1CUKA 3PF4A 2F3VA 1VCIA 1PRTF 5IT9E 1N34L 2KHSA 2K75A 1V1OA 1YI2A 3VR5A 2B63H 2OQKA 2XRQD 4JV5L 3OIQA 4HCEA 1WTXA 2MNAA 2AQ2B 1CKNA 2NZHA 5CV6A 4GKKL 4CJ1B 1LLRD 3HOWG 1B3QA 2JA6G 4KHPQ 1I50H 1YNNC 4OGQC 4IUPA 5M3MB 1CHQD 1IBMQ 5M5YH 3URYA 1W6JA 1KAWA 1HR0W 3C1FA 4C3HH 2CH4A 4HR7B 2F0JA 1DZ1A 1B70B 1X3FA 2Q8IB 4R4QA 4UPAA 3M9BA 1VQBA 3W5OA 2OT2A 2A73B 4DA2A 3PO3G 5BN5A 5IYDH 2DY8A 1UEAB 3ND9A 2F0MA 4GN3B 4P72A 1VQKA 1F2LA 5CV9A 2RKSA 5JJKA 1O7IA 1PLFA 3KYHC 1B3AA 2CHBD 2ZXOA 2ZJPA 1LTTD 4K8JA 1EZ8A 1F9RA 1SJHD 2F0NA 3R3OA 3HOYH 5AJ3Q 3SK8A 4DR4Q 4RCNA 3H0GG 2VZAA 4B3RQ 1PMRA 2UXDL 4CDEC 4KMUC 2Q8TA 4GLVB 4A3MH 3K0YA 1J5EL 4OELB 4DR5L 3UDXA 1SNDA 5IGFA 2L12A 1R9TB 1TWCB 4DN4M 1BR9A 1IBKQ 1MIUA 1X3EA 1XTDA 4IALA 3UDGA 3CMAA 3A0JA 1MKHA 4HN7A 1HH2P 1VQMA 1V1QA 4K2KA 4A3BH 2FFKB 2IW3A 4JK1C 2Z1CA 4FYDA 2H5XA 3AU7A 1QUQB 4A3JH 3RUZA 3PF5A 4YHHQ 5M3MG 5IWAL 1PZJD 4ZQ3A 4LF6Q 1RIPA 1YJ9A 3MHBA 1EOVA 4LK1C 2E2JB 1CZGA 2WACA 1X54A 1K8GA 1QE6A 4DFAA 3K7UC 5KIXA 3H3VC 4OO1H 2JK8A 3T53B 2B2YC 2NTSA 2N88A 1G8ZD 2KA7A 4F7XA 4HEDA 4X62L 1QZGA 5IY0A 2F4VL 3A8KE 1HQRD 5IP9H 4Q5VA 4X64L 1WD0A 2IHEA 3MFGA 3UDIA 2K14A 4HJ9A 3QB3A 1KDCA 2QILA 5COYA 3X3MA 3GTJH 2M9VA 3A7AB 3S9WA 3S16H 1I6HH 1V8QA 1L1OC 1N32L 1BVSA 1HFGA 2VQFL 1GXDC 3M7NA 4LUVA 5FJ8G 1VQEA 4NPSA 4IJLA 4A3EH 4P2CB 3F2DA 2F3WA 2KECA 1B8AA 1BXTA 1B9NA 3DM1A 1RODA 2CVRA 4KKTA 4CGYB 5JEAH 2VUMH 1EY6A 4DPGA 5CV7A 3JAMc 4X3TA 4AQYQ 2YYZA 3AYHB 1B50A 3M4PA 4KY5A 4RHRA 2OQ0A 5CORA 2HHHL 1EUJA 2PZWA 2E5LQ 3SR1A 4DV4L 1Q90A 5F2DA 4ULLA 3TREA 4LF9Q 2FINB 1O78A 3VA7A 4OWTB 3Q0AA 5HY6A 5IT9c 2UUAL 2WP8J 4PMBA 2SOBA 4KHZA 3ERQA 4JYAQ 2MP1A 2KCCA 1PH2A 1TY2A 4U673 2QDBA 5ISRA 5K5PA 1BBUA 1HNZL 2TSSA 4BA2I 3WOEA 2ZJQA 2XTIA 4R8NA 3I56A 3ND8A 4K8IA 1TS2A 1LT3D 3OMCA 2RSOA 5I6YA 2WV6D 3GTKH 1L1OB 1DGSA 3L9AX 3EBEA 1RHPA 3D4RA 1IKLA 1XPUA 1VQ4A 1VQAA 1R4PB 3BDOA 1ZYRD 4NDXA 3KF6A 2LXKA 5GQOA 1SLJA 3PIO3 3OMGA 3VYTA 1FNVA 1SDFA 2L55A 4GNXA 3U4ZA 4JI0Q 1UEBA 3BZDB 5KGUA 1SFOB 3NE5B 2PI2A 5JAVA 2R7DA 2J0TD 3RN5A 4ZCKA 3CCRA 1NY4A 1PYWD 1GM5A 5BR8Q 3Q23A 3K80C 1N34Q 2EYOA 4IZ8A 1WTOA 1S5BD 1UAPA 2DN8A 3D0FA 2YU9H 4JI6L 1HA5A 1Q1EA 1WTWA 2RDHA 5C0XH 3NBIA 1MSGA 4JV5Q 1UE6A 3RLOA 2XWBB 5C5MA 3K5LA 4GKKQ 3E6ZX 1ENCA 3TP6A 1ESRA 1O7ZA 1C7YA 2CW0D 4XYOA 1CTMA 3GTLH 1EY4A 3PV0A 1AE3A 2KCNA 4GZYC 1BF4A 2SEBD 1HCZA 1H95A 4A3DB 1IYUA 3CF5A 2CCZA 1F2ZA 2LMCB 2Q2HA 2PMZB 1TR5A 2CFMA 1Y1VB 4XQJA 3U9OA 5I2YA 4R4CA 2NVYH 1QILA 4OX9L 3SVMA 1GOZA 4WJ4A 2KENA 1JWSD 2NTTA 1A15A 2K5NA 3T16A 5EQ0A 1Q8IA 4RAUC 2RQXA 4LF5L 4KLKA 3A8JE 4APVA 1N33L 5E4XA 1WI5A 4NKLA 4ZAIA 2V1CC 2K05A 1CSPA 5CMDA 3DHQA 1WJJA 3NPPA 2QDLA 2L1BA 5JJZA 4C3JH 4LF7L 2UXDQ 2RCNA 4G57A 3CCUA 1WCMB 2XVSA 2UUBL 1II3A 4DR5Q 1JB3A 1X3GA 2K6AA 2UXCL 3QO2A 3BYYB 5DEHA 3PIP3 5LL6X 3CCJA 3MEFA 1NAPA 3GTQH 2YTVA 2IHFA 1QUQA 2K04A 3J7ZC 3PO2B 4CBVA 2F0HA 5ELNA 2Z0SA 2R92B 3H3VI 1A63A 4ME3A 5IWAQ 3AFPA 1AEXA 1PYSB 1EL0A 2JQOA 3EIVA 4CJ0B 4ZUJA 3J7AV 4QCLA 4KKUA 3HS0C 5JOBA 3VR6A 1N36L 4A3DG 5E1FA 1PYBA 5C4XB 2K33A 1PZKD 4FF3A 1Y1VG 2QA4A 1VQOA 4DXFA 1W6KA 2V4DA 2K01A 3SXHA 4CDDC 3HGBA 3HKZB 3WOFA 3ULPA 1QJOA 4X62Q 2F4VQ 2EY2A 4X64Q 4ZUIA 2KVMA 4HJ5A 1CZWA 4K14A 3CP0A 3TN2A 1Q82C 2EQSA 2R7ZH 1IZ6A 4JOIC 1N32Q 5IGGA 2JP1A 3IL8A 4HSVA 1LTAD 1SXTA 2CW0C 3HOUH 3GTMH 2DUDA 1S4ZA 4J6HA 4Q0FA 4HMJA 4QF4A 1Q7YC 1WCMG 3K7AB 1TWAB 2PI2E 1G6ZA 1AFPA 1S3OA 5FLXL 4MZ9A 4DAVA 5C44B 3Q8DA 1D8LA 2EXDA 3KBXA 4RFBA 1GO3E 3SK6A 4QIWB 2Q2IA 2DJFC 2K1BA 1JJCB 2Y0SB 4DNIA 3Q6SA 4DR4L 4ZYSA 2HHHQ 1EYDA 2E2DC 2FMMA 5A2QL 3PO2G 2EE1A 4AIMA 4DV4Q 2R92G 4A75A 2B2YA 2UUAQ 2F0OA 3M3YH 3RZOB 1S5DD 4XIGS 1DJRD 2L11A 2XNAC 3EA6A 4GOPC 1CT1D 5C3EB 5C4XG 1HNZQ 2VNUD 2B29A 1JE5A 3I90A 3S1RB 1DOLA 2L15A 4KI0A 4LFAL 1F77A 1L1OA 3FPPA 2AWOA 2K32A 2RVLA 1PH3A 1QOHA 3HKZG 5I2XA 3TP7A 3IFTA 2OWOA 1I3QB 4LF6L 1J9OA 3PIOA 4A3LG 1RL2A 5LMNL 1SNMA 4A3KB 3I4MB 1DOKA 4FF4A 3AB9A 5M5XB 4JI5L 1XPRA 2VQEL 3LWUA 1U4MA 5CGKA 3GTPH 3STBD 5I4DA 1HZBA 4A3GH 1O7LA 2OTJA 1BUVT 1I4XA 1ILPA 4G7OC 2RCFA 1FNUA 4AH6A 1XX8A 4OWWB 1HZCA 1E1TA 2F0PA 2B63B 1S5CD 1M1KC 3OHXC 4QB4A 1K8AC 5C44G 1BQQT 4DAYB 3PGZA 2AUKA 4JI6Q 4TVAB 5FK9C 1UWVA 1I50B 4F87A 1TWHH 3MXNB 1KTKA 3ONAB 2Y0SG 2I5LX 4U68A 2K7VA 5M5YB 4GOPB 4YCUA 1EQQA 2WIIB 3G6EA 4C3HB 1TWGB 4JI8L 4MHEA 1XMOQ 4DR6L 4RGTA 1J8IA 1BCPC 5C3EG 5JJLA 2F0FA 1N8RC 5I9PA 4EQPA 1DYQA 4OXPA 3S17H 4DAMA 1K0SA 3BJUA 4L6TB 5EGTA 4OX9Q 1SYGA 2L9HA 2PPBC 3J81L 4CJ2C 1X6OA 1DM0B 4B3ML 2E2HB 1L0YB 3HOYB 4A3KG 3I4MG 1QVFA 3SE0A 4LF5Q 1N33Q 3G71A 2JJQA 1SYDA 1QG7A 2WAQB 2AHOB 2A68D 1EQVA 4UDUC 2SNMA 3S1QH 4WJ3M 3D4WA 1G2SA 3VYSA 4GN5A 3S15H 5TSSA 5K36H 2XWJB 4A3MB 4A4IA 1G2TA 5HGTA 1EFWA 1VMCA 3D6WA 1E2WA 3VA5A 5C3XA 4ZLTF 3NQTA 3DEPA 5D3IB 4QY7A 3PIPA 2VS1A 2UUBQ 2B63G 4K2LA 1MHWC 1K8OA 1ET9A 1EY9A 2YV5A 4A3BB 4BY1H 3W2DA 3S2HB 2K03A 3KF6B 3KLSX 5GADC 4A3JB 5C4JH 3HOVH 3S24A 1PTOH 4ILWA 2WB1B 3CMEA 1FNWA 1WTQA 1BCPB 2N3SA 5EKKA 2RHSB 4F88A 1VQDA 4C3HG 3NEMA 4OL7A 5KNDA 1KABA 5BR8L 1AP0A 3LX0A 2JA8H 3TS0A 1NR4A 1QNKA 5IYDG 4A3FH 1N36Q 4LFCL 3M4OH 1RCVD 2NN6H 5JEAJ 5EPLA 4NXNL 4DV5L 4ALPA 3C1EA 3K59A 1VF5C 5EPKA 2QKIC 3M4QA 2MFIA 1TS5A 1JOKA 2VL6A 5JVH3 3E3XA 1DOMA 4HMIA 1FGUA 3GTJB 3S16B 1DONA 3J7AF 1I6HB 2GA4B 1TQOA 4C1NI 1SYFA 2L5TA 1EWHA 3HOYG 4DU9A 2NB0A 3ZJYC 1EYCA 2Q2TA 2WAQG 1E3PA 3PSIA 3CXCA 4IUTA 2FXQA 1NBWA 2H1EA 3G48A 3RMHA 1PH8A 1MGSA 1Z6HA 1GKHA 2ICEC 3A5UA 4FVMA 3HOZH 1H9MA 4A3CG 1RD9D 4L63B 1U4LA 4A3MG 3NWSA 4MTNA 4A76A 4DUYL 2EYMA 4FXDA 2CQAA 1IL8A 2FHTA 3DMUA 2VUMB 4QMGA 4XYQA 5BN4A 3NK9A 3CHBD 4JBJA 1KQSA 1CQVA 1ZXTA 1VF7A 4A3BG 3UE0A 4UHVA 1KRSA 2VB2X 3DWQA 4A3JG 1DD2A 2MPMA 2IY5B 1SNOA 2LXJA 2SNSA 5ELCA 3A55A 3Q22A 1RJTA 1VQFA 3I4LA 2WB1G 4N8X1 1BNZA
chains in the Genus database with same CATH topology
1VQ4A 1VS0A 1IL2A 1M90C 4QQBX 1VQAA 3HKSA 3HOWH 4Y52H 1C9OA 3CC2A 4B3TQ 1TXYA 4P75A 3KF6A 2LXKA 5GQOA 2JA7H 1HNWQ 4K0KQ 1SLJA 1SN8A 1NJIC 3CCLA 1JB7A 4KHPL 1CSQA 4R4IA 3H15A 4OO1G 1CKNB 3CPWA 5GROA 4DUZL 4GNXA 3S2DH 2R93H 3J81c 3U4ZA 1IBML 4GLXA 4JI0Q 1FJGQ 1XNRL 1NMFA 5M5WH 1YHQA 3I4NG 4X6AH 1UEBA 1D7QA 4IOCA 4DR7L 1JT8A 1A63A 3HOVG 2N78A 1VQPA 1Y1WH 2PI2A 3GO5A 1YHBA 1A0IA 2R7DA 4LWCA 4A93H 5IP9G 3RN5A 4LFAQ 3CCRA 1NY4A 1GM5A 1OTCA 3PUYA 4JOIA 5BR8Q 4DV2L 2IT1A 3AEVA 5IYCH 1VQ5A 1W3SA 3K80C 2GVBA 5LMUL 1JJGA 1N34Q 5C0XJ 1KIXA 2VQFQ 4HIOA 1EIYB 4JBWA 2YU9H 4JI6L 3D0FA 4AYBG 2F3IA 1PH4A 1Q1EA 4BXXG 3T1YQ 1FVIA 2JA8G 5LMNQ 3NENA 3BZCA 5GAGC 4JV5Q 1Y1VH 1PH1A 1K9MC 4GKJQ 4JI5Q 2N8NA 1UE6A 4YCWA 4YY3Q 3RLOA 2HIXA 2VQEQ 4A3FG 4NXMQ 1OXXK 2BA0A 4GKKQ 4PMWA 3S14H 1C7YA 2ZTEA 1K73C 4HJAA 4DK6C 2NN6G 4A3IG 1HZ9A 2OCEA 3GTLH 3PV0A 4XTCS 4BBRH 1AE3A 2CKZB 2R7ZG 5JEAG 2VUMG 2K4KA 1SE8A 1HJPA 5AJ3L 4DV7Q 1OXVA 1H95A 3CF5A 3RR5A 4DR3Q 2CCZA 1X55A 2Q2HA 1PH9A 1IBLQ 4B3RL 3KDFB 2PQAB 3NBHB 5J3BA 2CFMA 3JC66 1G291 1N9WA 4DR1L 1LTLA 3FHWA 5FLMG 3KOJA 4P74A 1E24A 1QVCA 4R4CA 2NVYH 3J81i 2ZM6L 2I0QA 1Q12A 1LYLA 4GOPA 2JA5H 4OX9L 4BBSH 3STBC 2RHQB 3HOZG 5JJIA 4A3KH 3I4MH 1IBKL 4WJ4A 2KENA 1XMQL 1U5KA 3PUWA 2K5NA 4FDBA 5EAYA 1VQ7A 4DR2Q 2UU9Q 4LFBQ 2MO0A 1SMXA 4DV3Q 1OXSC 1LUZA 4OONA 3CCQA 4LF5L 4KLKA 4X65L 4APVA 1N33L 4JI8Q 1WI5A 4OO1I 3DM3A 5M3MH 1AE2A 2V1CC 4DV0L 1PHJA 1VQHA 4DR6Q 3J80i 3OW2A 1CSPA 4UP9A 2UXBQ 1NE3A 2K52A 3T1HL 4YHHL 1WJJA 1L0WA 4R4TA 2IX1A 1K83H 4EX5A 1WYDA 3TEHB 1KRTA 1A62A 1VQ9A 3I55A 3RZDH 1PA6A 4C3JH 3WWVA 4LF7L 2R92H 2UXDQ 2RCNA 4POFA 2UUCQ 3CCUA 3KJPA 2VW9A 2UUBL 4LF8L 4X66L 4DR5Q 4JI4L 4H02A 4PZ8A 1X3GA 3ERSX 1GVPA 1UE5A 2UXCL 2JA7G 4HIMA 1MJEA 2ES2A 3CCJA 5C4XH 3K0XA 3MEFA 3GTQH 2YTVA 4P71A 1XPOA 2ZTDA 2IHFA 3EN2A 4B3MQ 2R93G 1IXRA 5DLQE 1QUQA 4JI2Q 1TWGH 3J7ZC 5M3FH 1VQJA 2NN6I 2B3GA 3HFZB 4DV6L 1KC8C 1PH5A 1S72A 2QGQA 5ELNA 3TQYA 2Z0SA 3CQZH 5HGQA 1Y1WG 5IP7H 5GAHC 4DV2Q 4B3SQ 3H3VI 4ME3A 4A93G 1G6PA 5IWAQ 3AFPA 4JG2A 5LMUQ 1PYSB 4QL5A 4DV1L 2JQOA 3EIVA 2D62A 4A3LH 5IYCG 1A8VA 4IPCA 4NB3A 4LUOA 4A3DG 3UDFA 1N36L 4IFDG 4J15A 1PYBA 3OTOL 4IPDA 3PUVA 5C0XG 2E2IH 2Z6KA 2JA6H 1VQCA 1Y1VG 2QA4A 1VQOA 4QGUA 4R1JA 2QEXA 1TWCH 3BZKA 3PCOB 3TS2A 2Q2UA 3E9IA 4L5SA 4GNXC 2E2HH 4BY1G 2Y0SE 1QVGA 4O0AA 3ULPA 2JEAI 1NTGA 3PUZA 3F2BA 4AQYL 4X62Q 2F4VQ 4BBRG 2I5MX 2PMZE 3E0EA 3K7AH 4X64Q 3UE1A 1TWAH 4JBMA 3J7A5 1PVOA 4HJ5A 5C44H 1YJWA 3CD6A 2E5LL 3W1BA 3PO3H 4A3CH 1UE7A 3CP0A 1SR3A 4JI3L 1Q82C 2EQSA 2R7ZH 1IZ6A 4JOIC 5ELOA 2KHJA 4LF9L 3GTGH 2ZM6Q 1CKOA 3A5ZB 1N32Q 3J80c 1AH9A 1X56A 4LF4L 3ICEA 3FKIH 2VY3A 4IPGA 4LFCQ 3GTOH 3FP9A 1XMQQ 4JBKA 3B6YA 4JYAL 1P16A 2ZTCA 2JA5G 3HOUH 4BBSG 3GTMH 2DUDA 4DV5Q 4NXNQ 3RLFA 1Q7YC 1WCMG 2NZOA 1VQNA 4A3EG 2PI2E 1HR0L 2NVXH 3RZOH 3S2HH 1KL9A 1S3OA 4MZ9A 1XMOL 4C2MH 2BA1A 3Q8DA 1D8LA 5C3EH 2EXDA 4JI7Q 1GO3E 3AQQA 2NVTH 1L2FA 2Q2IA 4JI1Q 2MQHA 3H0GH 4C3IH 3CCEA 2BH8A 1JJCB 5IYBH 1UE1A 1G51A 4DNIA 3S1RH 1I94Q 1OXUA 1HNXL 4GN4B 4DR4L 2YTXA 2HHHQ 4LF7Q 1PFSA 4BY7H 4IPHA 1XNQQ 2AMCB 1IYJB 3PO2G 1Q81C 1VQIA 4AIMA 4DV4Q 1GD7A 2R92G 4B3TL 1P8LA 2KHIA 4UP7A 4A75A 1VQ8A 1BKBA 2KCMA 4IOAA 1I3QH 2NVQH 4YWMA 2ALYB 4K0KL 1HNWL 1PH7A 2UUAQ 1EIFA 1QZHA 3M3YH 2UXCQ 4DUYQ 3I7FA 1YEZA 1Q1BA 3E9HA 4XIGS 4IFDI 1ASZA 4GOPC 2PNHA 4DKAC 3L0OA 4RG1A 5M5XH 4JI0L 1FJGL 3S1MH 4GNXB 5C4XG 1HNZQ 2WFWA 3U58A 4P73A 2VNUD 2B29A 1JE5A 3KLWA 3GD7A 1VQ6A 2A8VA 5M3FG 2L15A 4KI0A 4LUZA 4LFAL 1CUKA 1YHAA 1L1OA 3F1ZA 4JC0A 4BA1I 2AWOA 3PF4A 1VCIA 1PH3A 2D0OA 3HKZG 5IP7G 1KXLA 1N34L 2OWOA 2K75A 1Q8KA 4LF6L 1YI2A 3PIOA 3T1YL 1RL2A 2B63H 2F52A 4A3LG 2OQKA 3I4OA 4R4OA 3OTOQ 5LMNL 4JV5L 3KFUA 2MNAA 4JI5L 1XPRA 4YY3L 1CKNA 1I5FA 2VQEL 2NZHA 4NXML 4GKKL 4RMFA 3HOWG 1JJ2A 3GTPH 3STBD 3CPFA 2JA6G 4KHPQ 1I50H 3HKZE 4PZ7A 4DUZQ 1HZBA 2K5VA 3CAMA 4A3GH 2N49A 1IBMQ 2OTJA 3NELA 1XNRQ 5M5YH 2C35B 5IE8A 1KAWA 1HR0W 4DR7Q 3OYYA 4C3HH 1NMGA 4AH6A 1YIJA 3I2ZA 4OWWB 4DR3L 4LNQA 1HZCA 1B70B 1E1TA 1X3FA 2A19A 3KF8B 1IBLL 1Y14B 4L5QA 3M9BA 4R4QA 4UPAA 1M1KC 1VQBA 1YNXA 3GDEA 1K8AC 2D0PA 5C44G 3W5OA 4IO9A 4DAYB 3CC7A 3PGZA 2HQLA 2GVAA 3PO3G 5IYDH 2CWPA 3KJOA 4JI6Q 4TVAB 2CQOA 1UWVA 3ER0A 5FJ8H 5GAEC 3D31A 4GN3B 4P72A 1TWHH 3MXNB 1VQKA 2Y0SG 2EIFA 1W2BA 2I5LX 2ZJRA 3FKIG 1LM0A 5JJKA 1FL0A 2WAQE 4GOPB 1O7IA 4YCUA 1EQQA 4DR2L 2UU9L 4LFBL 1EYGA 3G6EA 3HOUG 2Z6KC 3KYHC 1R9TH 2ASBA 3PUXA 4TQUS 3HOXH 1YITA 1Q86C 2ZJPA 4JI8L 1XMOQ 3DLLA 4QIWE 2R7FA 4PG3A 3CC4A 4DR6L 2UXBL 3RN2A 3HOYH 1KHIA 5JJLA 5C3EG 5AJ3Q 4JCVE 3KDFA 2PQAA 3ULJA 1N8RC 4DR4Q 1J6QA 4EQ5A 5E7NA 1VQLA 3H0GG 2VZAA 4B3RQ 5IYBG 2UXDL 4OXPA 2UUCL 4DR1Q 4BY7G 2AKWB 3S17H 4GLVB 4DAMA 3ULLA 4A3MH 1EQRA 1XJVA 3BJUA 1J5EL 4DR5L 3UDXA 5LMNW 1Q46A 3JAMi 4OX9Q 2E2JH 1IBKQ 2WB1E 1MIUA 1X6OA 1E1OA 1X3EA 1XTDA 4LW1A 4B3ML 1E22A 3UDGA 3CMAA 4A3KG 3I4MG 1Z9FA 1YBYA 3A0JA 1QVFA 1MKHA 1VQMA 1HH2P 4LF5Q 1V1QA 4JI2L 4X65Q 2JJQA 3G71A 2OTLA 1N33Q 1SROA 4A3BH 2AHOB 3U4VA 3S1QH 4WJ3M 4DV0Q 2H5XA 5FLXc 1QUQB 4A3JH 4B3SL 4GN5A 3T1HQ 3IRBA 3PF5A 3S15H 4YHHQ 1YVCA 2GN5A 5M3MG 4IFDJ 5IWAL 4YCVA 4A4IA 3F8TA 4IJHA 3RLNA 1T9HA 4LF6Q 1EFWA 1RIPA 4A3DH 2KCTA 1YJ9A 1U0LA 1PV4A 1EOVA 2AWNA 2A1AA 3AFQA 2DGYA 1X54A 4QY7A 3PIPA 2VS1A 1K8GA 2UUBQ 2B63G 4LF8Q 1WFQA 4X66Q 3K7UC 4JI4Q 1PH6A 1YJNA 2ATWA 2JK8A 2K5HA 1OXTA 3CCVA 4GLAC 2ID0A 2YV5A 4BY1H 3K8AA 3F2CA 1YZ6A 3I4NH 3J81j 4AYBE 3KF6B 3CCMA 3K81C 1B7YB 5GADC 4YWKA 5C4JH 3HOVH 5H1SE 4HIDA 1MJCA 3S24A 5C0XI 2HT1A 4A3GG 2JA9A 3CMEA 2HIVA 4X62L 1QZGA 5IY0A 4L5TA 2F4VL 5IP9H 1K3RA 4DV6Q 4X64L 3M85A 3L7ZC 2N3SA 2IHEA 2RHSB 3UDIA 1VQDA 2K14A 4HJ9A 1X9NA 1HZAA 3GTJH 3NEMA 3S16H 5BR8L 1I6HH 2XGTA 1L1OC 2KBNA 4DV1Q 4BXXH 1BVSA 4HJ7A 1N32L 2JA8H 1S40A 3TS0A 2VQFL 3RNUA 3A74A 4L5RC 1BBWA 5IYDG 3LGJA 3M7NA 3CCSA 4GS3A 3BU2A 4LFCL 4HJ8A 4A3FH 1N36Q 1X65A 4LUVA 5FJ8G 2RF4A 1WCMH 1VQEA 4NPSA 3M4OH 2JE6I 4IJLA 2CWAA 4A3EH 3TRZA 4GKJL 3VDYA 3F2DA 5JEAJ 4NXNL 4DV5L 4A3IH 3W1GA 4ALPA 3S1NH 1Z47A 2E8GA 3H3VH 1B8AA 3M4QA 2MFIA 2VL6A 1SRUA 2VUMH 3HOXG 1FGUA 4DPGA 4JI7L 3JAMc 4HIKA 4POGA 4AQYQ 2JEBI 4JI1L 2YYZA 3HOYG 2MO1A 3AYHB 4MNOA 4DV7L 3U50C 3PO2H 1I94L 4DK3C 2K50A 3M4PA 4PZ6A 2HHHL 2OQ0A 3ZJYC 5FLMH 1JMCA 1EUJA 2Q2TA 1XNQL 4QJFA 2WAQG 1E3PA 2E5LQ 3PSIA 1TWFH 3CXCA 4JI3Q 4DV4L 2FXQA 1V9PA 1NBWA 1J5EQ 3G48A 3TREA 1PH8A 1EWIA 3A5UA 1GKHA 4LF9Q 4OWTB 4UY8C 4O2DA 4OWXB 3HOZH 4LF4Q 4A3CG 5HY6A 4YWLA 5IT9c 4A3MG 2LSSA 2WP8J 4MTNA 4A76A 1ASYA 2UUAL 4DUYL 2BH2A 3CW2C 4KHZA 4JYAQ 1E7ZA 3G4SA 2R6GA 1PH2A 1VQGA 2IX0A 1BBUA 1HNZL 4DV3L 1KD1C 1HR0Q 4BA2I 4JBJA 1KQSA 2I5HA 2ZJQA 2XTIA 3SGIA 3UE0A 1V43A 3L2PA 3I56A 4A3BG 1KRSA 1C0AA 4UP8A 4Y7NH 1WOCA 1CKMA 2YTYA 4A3JG 1SFOH 3GTKH 1K0RA 2IY5B 2LXJA 1HNXQ 5K36G 1L1OB 1VQFA 2WB1G 1DGSA 3EBEA 1XPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 A;  1VS0 A;  1IL2 A;  1M90 C;  4QQB X;  1VQA A;  3HKS A;  3HOW H;  4Y52 H;  1C9O A;  3CC2 A;  4B3T Q;  1TXY A;  4P75 A;  3KF6 A;  2LXK A;  5GQO A;  2JA7 H;  1HNW Q;  4K0K Q;  1SLJ A;  1SN8 A;  1NJI C;  3CCL A;  1JB7 A;  4KHP L;  1CSQ A;  4R4I A;  3H15 A;  4OO1 G;  1CKN B;  3CPW A;  5GRO A;  4DUZ L;  4GNX A;  3S2D H;  2R93 H;  3J81 c;  3U4Z A;  1IBM L;  4GLX A;  4JI0 Q;  1FJG Q;  1XNR L;  1NMF A;  5M5W H;  1YHQ A;  3I4N G;  4X6A H;  1UEB A;  1D7Q A;  4IOC A;  4DR7 L;  1JT8 A;  1A63 A;  3HOV G;  2N78 A;  1VQP A;  1Y1W H;  2PI2 A;  3GO5 A;  1YHB A;  1A0I A;  2R7D A;  4LWC A;  4A93 H;  5IP9 G;  3RN5 A;  4LFA Q;  3CCR A;  1NY4 A;  1GM5 A;  1OTC A;  3PUY A;  4JOI A;  5BR8 Q;  4DV2 L;  2IT1 A;  3AEV A;  5IYC H;  1VQ5 A;  1W3S A;  3K80 C;  2GVB A;  5LMU L;  1JJG A;  1N34 Q;  5C0X J;  1KIX A;  2VQF Q;  4HIO A;  1EIY B;  4JBW A;  2YU9 H;  4JI6 L;  3D0F A;  4AYB G;  2F3I A;  1PH4 A;  1Q1E A;  4BXX G;  3T1Y Q;  1FVI A;  2JA8 G;  5LMN Q;  3NEN A;  3BZC A;  5GAG C;  4JV5 Q;  1Y1V H;  1PH1 A;  1K9M C;  4GKJ Q;  4JI5 Q;  2N8N A;  1UE6 A;  4YCW A;  4YY3 Q;  3RLO A;  2HIX A;  2VQE Q;  4A3F G;  4NXM Q;  1OXX K;  2BA0 A;  4GKK Q;  4PMW A;  3S14 H;  1C7Y A;  2ZTE A;  1K73 C;  4HJA A;  4DK6 C;  2NN6 G;  4A3I G;  1HZ9 A;  2OCE A;  3GTL H;  3PV0 A;  4XTC S;  4BBR H;  1AE3 A;  2CKZ B;  2R7Z G;  5JEA G;  2VUM G;  2K4K A;  1SE8 A;  1HJP A;  5AJ3 L;  4DV7 Q;  1OXV A;  1H95 A;  3CF5 A;  3RR5 A;  4DR3 Q;  2CCZ A;  1X55 A;  2Q2H A;  1PH9 A;  1IBL Q;  4B3R L;  3KDF B;  2PQA B;  3NBH B;  5J3B A;  2CFM A;  3JC6 6;  1G29 1;  1N9W A;  4DR1 L;  1LTL A;  3FHW A;  5FLM G;  3KOJ A;  4P74 A;  1E24 A;  1QVC A;  4R4C A;  2NVY H;  3J81 i;  2ZM6 L;  2I0Q A;  1Q12 A;  1LYL A;  4GOP A;  2JA5 H;  4OX9 L;  4BBS H;  3STB C;  2RHQ B;  3HOZ G;  5JJI A;  4A3K H;  3I4M H;  1IBK L;  4WJ4 A;  2KEN A;  1XMQ L;  1U5K A;  3PUW A;  2K5N A;  4FDB A;  5EAY A;  1VQ7 A;  4DR2 Q;  2UU9 Q;  4LFB Q;  2MO0 A;  1SMX A;  4DV3 Q;  1OXS C;  1LUZ A;  4OON A;  3CCQ A;  4LF5 L;  4KLK A;  4X65 L;  4APV A;  1N33 L;  4JI8 Q;  1WI5 A;  4OO1 I;  3DM3 A;  5M3M H;  1AE2 A;  2V1C C;  4DV0 L;  1PHJ A;  1VQH A;  4DR6 Q;  3J80 i;  3OW2 A;  1CSP A;  4UP9 A;  2UXB Q;  1NE3 A;  2K52 A;  3T1H L;  4YHH L;  1WJJ A;  1L0W A;  4R4T A;  2IX1 A;  1K83 H;  4EX5 A;  1WYD A;  3TEH B;  1KRT A;  1A62 A;  1VQ9 A;  3I55 A;  3RZD H;  1PA6 A;  4C3J H;  3WWV A;  4LF7 L;  2R92 H;  2UXD Q;  2RCN A;  4POF A;  2UUC Q;  3CCU A;  3KJP A;  2VW9 A;  2UUB L;  4LF8 L;  4X66 L;  4DR5 Q;  4JI4 L;  4H02 A;  4PZ8 A;  1X3G A;  3ERS X;  1GVP A;  1UE5 A;  2UXC L;  2JA7 G;  4HIM A;  1MJE A;  2ES2 A;  3CCJ A;  5C4X H;  3K0X A;  3MEF A;  3GTQ H;  2YTV A;  4P71 A;  1XPO A;  2ZTD A;  2IHF A;  3EN2 A;  4B3M Q;  2R93 G;  1IXR A;  5DLQ E;  1QUQ A;  4JI2 Q;  1TWG H;  3J7Z C;  5M3F H;  1VQJ A;  2NN6 I;  2B3G A;  3HFZ B;  4DV6 L;  1KC8 C;  1PH5 A;  1S72 A;  2QGQ A;  5ELN A;  3TQY A;  2Z0S A;  3CQZ H;  5HGQ A;  1Y1W G;  5IP7 H;  5GAH C;  4DV2 Q;  4B3S Q;  3H3V I;  4ME3 A;  4A93 G;  1G6P A;  5IWA Q;  3AFP A;  4JG2 A;  5LMU Q;  1PYS B;  4QL5 A;  4DV1 L;  2JQO A;  3EIV A;  2D62 A;  4A3L H;  5IYC G;  1A8V A;  4IPC A;  4NB3 A;  4LUO A;  4A3D G;  3UDF A;  1N36 L;  4IFD G;  4J15 A;  1PYB A;  3OTO L;  4IPD A;  3PUV A;  5C0X G;  2E2I H;  2Z6K A;  2JA6 H;  1VQC A;  1Y1V G;  2QA4 A;  1VQO A;  4QGU A;  4R1J A;  2QEX A;  1TWC H;  3BZK A;  3PCO B;  3TS2 A;  2Q2U A;  3E9I A;  4L5S A;  4GNX C;  2E2H H;  4BY1 G;  2Y0S E;  1QVG A;  4O0A A;  3ULP A;  2JEA I;  1NTG A;  3PUZ A;  3F2B A;  4AQY L;  4X62 Q;  2F4V Q;  4BBR G;  2I5M X;  2PMZ E;  3E0E A;  3K7A H;  4X64 Q;  3UE1 A;  1TWA H;  4JBM A;  3J7A 5;  1PVO A;  4HJ5 A;  5C44 H;  1YJW A;  3CD6 A;  2E5L L;  3W1B A;  3PO3 H;  4A3C H;  1UE7 A;  3CP0 A;  1SR3 A;  4JI3 L;  1Q82 C;  2EQS A;  2R7Z H;  1IZ6 A;  4JOI C;  5ELO A;  2KHJ A;  4LF9 L;  3GTG H;  2ZM6 Q;  1CKO A;  3A5Z B;  1N32 Q;  3J80 c;  1AH9 A;  1X56 A;  4LF4 L;  3ICE A;  3FKI H;  2VY3 A;  4IPG A;  4LFC Q;  3GTO H;  3FP9 A;  1XMQ Q;  4JBK A;  3B6Y A;  4JYA L;  1P16 A;  2ZTC A;  2JA5 G;  3HOU H;  4BBS G;  3GTM H;  2DUD A;  4DV5 Q;  4NXN Q;  3RLF A;  1Q7Y C;  1WCM G;  2NZO A;  1VQN A;  4A3E G;  2PI2 E;  1HR0 L;  2NVX H;  3RZO H;  3S2H H;  1KL9 A;  1S3O A;  4MZ9 A;  1XMO L;  4C2M H;  2BA1 A;  3Q8D A;  1D8L A;  5C3E H;  2EXD A;  4JI7 Q;  1GO3 E;  3AQQ A;  2NVT H;  1L2F A;  2Q2I A;  4JI1 Q;  2MQH A;  3H0G H;  4C3I H;  3CCE A;  2BH8 A;  1JJC B;  5IYB H;  1UE1 A;  1G51 A;  4DNI A;  3S1R H;  1I94 Q;  1OXU A;  1HNX L;  4GN4 B;  4DR4 L;  2YTX A;  2HHH Q;  4LF7 Q;  1PFS A;  4BY7 H;  4IPH A;  1XNQ Q;  2AMC B;  1IYJ B;  3PO2 G;  1Q81 C;  1VQI A;  4AIM A;  4DV4 Q;  1GD7 A;  2R92 G;  4B3T L;  1P8L A;  2KHI A;  4UP7 A;  4A75 A;  1VQ8 A;  1BKB A;  2KCM A;  4IOA A;  1I3Q H;  2NVQ H;  4YWM A;  2ALY B;  4K0K L;  1HNW L;  1PH7 A;  2UUA Q;  1EIF A;  1QZH A;  3M3Y H;  2UXC Q;  4DUY Q;  3I7F A;  1YEZ A;  1Q1B A;  3E9H A;  4XIG S;  4IFD I;  1ASZ A;  4GOP C;  2PNH A;  4DKA C;  3L0O A;  4RG1 A;  5M5X H;  4JI0 L;  1FJG L;  3S1M H;  4GNX B;  5C4X G;  1HNZ Q;  2WFW A;  3U58 A;  4P73 A;  2VNU D;  2B29 A;  1JE5 A;  3KLW A;  3GD7 A;  1VQ6 A;  2A8V A;  5M3F G;  2L15 A;  4KI0 A;  4LUZ A;  4LFA L;  1CUK A;  1YHA A;  1L1O A;  3F1Z A;  4JC0 A;  4BA1 I;  2AWO A;  3PF4 A;  1VCI A;  1PH3 A;  2D0O A;  3HKZ G;  5IP7 G;  1KXL A;  1N34 L;  2OWO A;  2K75 A;  1Q8K A;  4LF6 L;  1YI2 A;  3PIO A;  3T1Y L;  1RL2 A;  2B63 H;  2F52 A;  4A3L G;  2OQK A;  3I4O A;  4R4O A;  3OTO Q;  5LMN L;  4JV5 L;  3KFU A;  2MNA A;  4JI5 L;  1XPR A;  4YY3 L;  1CKN A;  1I5F A;  2VQE L;  2NZH A;  4NXM L;  4GKK L;  4RMF A;  3HOW G;  1JJ2 A;  3GTP H;  3STB D;  3CPF A;  2JA6 G;  4KHP Q;  1I50 H;  3HKZ E;  4PZ7 A;  4DUZ Q;  1HZB A;  2K5V A;  3CAM A;  4A3G H;  2N49 A;  1IBM Q;  2OTJ A;  3NEL A;  1XNR Q;  5M5Y H;  2C35 B;  5IE8 A;  1KAW A;  1HR0 W;  4DR7 Q;  3OYY A;  4C3H H;  1NMG A;  4AH6 A;  1YIJ A;  3I2Z A;  4OWW B;  4DR3 L;  4LNQ A;  1HZC A;  1B70 B;  1E1T A;  1X3F A;  2A19 A;  3KF8 B;  1IBL L;  1Y14 B;  4L5Q A;  3M9B A;  4R4Q A;  4UPA A;  1M1K C;  1VQB A;  1YNX A;  3GDE A;  1K8A C;  2D0P A;  5C44 G;  3W5O A;  4IO9 A;  4DAY B;  3CC7 A;  3PGZ A;  2HQL A;  2GVA A;  3PO3 G;  5IYD H;  2CWP A;  3KJO A;  4JI6 Q;  4TVA B;  2CQO A;  1UWV A;  3ER0 A;  5FJ8 H;  5GAE C;  3D31 A;  4GN3 B;  4P72 A;  1TWH H;  3MXN B;  1VQK A;  2Y0S G;  2EIF A;  1W2B A;  2I5L X;  2ZJR A;  3FKI G;  1LM0 A;  5JJK A;  1FL0 A;  2WAQ E;  4GOP B;  1O7I A;  4YCU A;  1EQQ A;  4DR2 L;  2UU9 L;  4LFB L;  1EYG A;  3G6E A;  3HOU G;  2Z6K C;  3KYH C;  1R9T H;  2ASB A;  3PUX A;  4TQU S;  3HOX H;  1YIT A;  1Q86 C;  2ZJP A;  4JI8 L;  1XMO Q;  3DLL A;  4QIW E;  2R7F A;  4PG3 A;  3CC4 A;  4DR6 L;  2UXB L;  3RN2 A;  3HOY H;  1KHI A;  5JJL A;  5C3E G;  5AJ3 Q;  4JCV E;  3KDF A;  2PQA A;  3ULJ A;  1N8R C;  4DR4 Q;  1J6Q A;  4EQ5 A;  5E7N A;  1VQL A;  3H0G G;  2VZA A;  4B3R Q;  5IYB G;  2UXD L;  4OXP A;  2UUC L;  4DR1 Q;  4BY7 G;  2AKW B;  3S17 H;  4GLV B;  4DAM A;  3ULL A;  4A3M H;  1EQR A;  1XJV A;  3BJU A;  1J5E L;  4DR5 L;  3UDX A;  5LMN W;  1Q46 A;  3JAM i;  4OX9 Q;  2E2J H;  1IBK Q;  2WB1 E;  1MIU A;  1X6O A;  1E1O A;  1X3E A;  1XTD A;  4LW1 A;  4B3M L;  1E22 A;  3UDG A;  3CMA A;  4A3K G;  3I4M G;  1Z9F A;  1YBY A;  3A0J A;  1QVF A;  1MKH A;  1VQM A;  1HH2 P;  4LF5 Q;  1V1Q A;  4JI2 L;  4X65 Q;  2JJQ A;  3G71 A;  2OTL A;  1N33 Q;  1SRO A;  4A3B H;  2AHO B;  3U4V A;  3S1Q H;  4WJ3 M;  4DV0 Q;  2H5X A;  5FLX c;  1QUQ B;  4A3J H;  4B3S L;  4GN5 A;  3T1H Q;  3IRB A;  3PF5 A;  3S15 H;  4YHH Q;  1YVC A;  2GN5 A;  5M3M G;  4IFD J;  5IWA L;  4YCV A;  4A4I A;  3F8T A;  4IJH A;  3RLN A;  1T9H A;  4LF6 Q;  1EFW A;  1RIP A;  4A3D H;  2KCT A;  1YJ9 A;  1U0L A;  1PV4 A;  1EOV A;  2AWN A;  2A1A A;  3AFQ A;  2DGY A;  1X54 A;  4QY7 A;  3PIP A;  2VS1 A;  1K8G A;  2UUB Q;  2B63 G;  4LF8 Q;  1WFQ A;  4X66 Q;  3K7U C;  4JI4 Q;  1PH6 A;  1YJN A;  2ATW A;  2JK8 A;  2K5H A;  1OXT A;  3CCV A;  4GLA C;  2ID0 A;  2YV5 A;  4BY1 H;  3K8A A;  3F2C A;  1YZ6 A;  3I4N H;  3J81 j;  4AYB E;  3KF6 B;  3CCM A;  3K81 C;  1B7Y B;  5GAD C;  4YWK A;  5C4J H;  3HOV H;  5H1S E;  4HID A;  1MJC A;  3S24 A;  5C0X I;  2HT1 A;  4A3G G;  2JA9 A;  3CME A;  2HIV A;  4X62 L;  1QZG A;  5IY0 A;  4L5T A;  2F4V L;  5IP9 H;  1K3R A;  4DV6 Q;  4X64 L;  3M85 A;  3L7Z C;  2N3S A;  2IHE A;  2RHS B;  3UDI A;  1VQD A;  2K14 A;  4HJ9 A;  1X9N A;  1HZA A;  3GTJ H;  3NEM A;  3S16 H;  5BR8 L;  1I6H H;  2XGT A;  1L1O C;  2KBN A;  4DV1 Q;  4BXX H;  1BVS A;  4HJ7 A;  1N32 L;  2JA8 H;  1S40 A;  3TS0 A;  2VQF L;  3RNU A;  3A74 A;  4L5R C;  1BBW A;  5IYD G;  3LGJ A;  3M7N A;  3CCS A;  4GS3 A;  3BU2 A;  4LFC L;  4HJ8 A;  4A3F H;  1N36 Q;  1X65 A;  4LUV A;  5FJ8 G;  2RF4 A;  1WCM H;  1VQE A;  4NPS A;  3M4O H;  2JE6 I;  4IJL A;  2CWA A;  4A3E H;  3TRZ A;  4GKJ L;  3VDY A;  3F2D A;  5JEA J;  4NXN L;  4DV5 L;  4A3I H;  3W1G A;  4ALP A;  3S1N H;  1Z47 A;  2E8G A;  3H3V H;  1B8A A;  3M4Q A;  2MFI A;  2VL6 A;  1SRU A;  2VUM H;  3HOX G;  1FGU A;  4DPG A;  4JI7 L;  3JAM c;  4HIK A;  4POG A;  4AQY Q;  2JEB I;  4JI1 L;  2YYZ A;  3HOY G;  2MO1 A;  3AYH B;  4MNO A;  4DV7 L;  3U50 C;  3PO2 H;  1I94 L;  4DK3 C;  2K50 A;  3M4P A;  4PZ6 A;  2HHH L;  2OQ0 A;  3ZJY C;  5FLM H;  1JMC A;  1EUJ A;  2Q2T A;  1XNQ L;  4QJF A;  2WAQ G;  1E3P A;  2E5L Q;  3PSI A;  1TWF H;  3CXC A;  4JI3 Q;  4DV4 L;  2FXQ A;  1V9P A;  1NBW A;  1J5E Q;  3G48 A;  3TRE A;  1PH8 A;  1EWI A;  3A5U A;  1GKH A;  4LF9 Q;  4OWT B;  4UY8 C;  4O2D A;  4OWX B;  3HOZ H;  4LF4 Q;  4A3C G;  5HY6 A;  4YWL A;  5IT9 c;  4A3M G;  2LSS A;  2WP8 J;  4MTN A;  4A76 A;  1ASY A;  2UUA L;  4DUY L;  2BH2 A;  3CW2 C;  4KHZ A;  4JYA Q;  1E7Z A;  3G4S A;  2R6G A;  1PH2 A;  1VQG A;  2IX0 A;  1BBU A;  1HNZ L;  4DV3 L;  1KD1 C;  1HR0 Q;  4BA2 I;  4JBJ A;  1KQS A;  2I5H A;  2ZJQ A;  2XTI A;  3SGI A;  3UE0 A;  1V43 A;  3L2P A;  3I56 A;  4A3B G;  1KRS A;  1C0A A;  4UP8 A;  4Y7N H;  1WOC A;  1CKM A;  2YTY A;  4A3J G;  1SFO H;  3GTK H;  1K0R A;  2IY5 B;  2LXJ A;  1HNX Q;  5K36 G;  1L1O B;  1VQF A;  2WB1 G;  1DGS A;  3EBE A;  1XPU A; 
#chains in the Genus database with same CATH topology
 1M90 C;  4QQB X;  4Y52 H;  3HOW H;  1C9O A;  1TXY A;  4MIU A;  1UNS A;  4BWG B;  1CA5 A;  2JA7 H;  1CSQ A;  1F9S A;  4OO1 G;  1SBB B;  4DUZ L;  5FO9 B;  3S2D H;  1EQT A;  1AW7 A;  1XNR L;  1YHQ A;  4IOC A;  1SAP A;  4DR7 L;  2M2L A;  3MXU A;  3GTK B;  1GJX A;  3I72 A;  1EY5 A;  1CHP D;  3GO5 A;  4LWC A;  5IP9 G;  4LFA Q;  4K5V A;  2HD3 A;  3PUY A;  4JOI A;  2IT1 A;  2J4X A;  5IYC H;  2B2V C;  2IX3 A;  2Z4I A;  3J80 L;  5C0X J;  3EVQ A;  2HCC A;  4HIO A;  1EIY B;  1S5F D;  2QF7 A;  3MFY A;  2JSO A;  3MZ5 A;  1LTG D;  5LMN Q;  3BZC A;  5GAG C;  1K9M C;  4JI5 Q;  4YCW A;  5KNB A;  3M4Y A;  2HIX A;  3FPU B;  5DNF A;  4G4K A;  1H9J A;  2VQE Q;  2EZV A;  3S14 H;  1EU3 A;  3R8B A;  4WOR A;  3NP8 A;  1KAA A;  2ZTE A;  3V05 A;  1MBY A;  1IW7 C;  4XTC S;  1I4P A;  4BBR H;  2CKZ B;  5JEA G;  2VUM G;  1SE8 A;  1ICW A;  1BCP F;  4V19 0;  1EY7 A;  1I4R A;  4XDX A;  2O2L D;  2YU9 B;  2NBF A;  4DAY A;  3KK7 A;  4FP5 D;  5C4Z A;  1PH9 A;  4RWS C;  3KDF B;  3NBH B;  1BOS A;  5EBC A;  5J3B A;  1N9W A;  3MAQ A;  1LTL A;  3MXN A;  4B08 A;  4P74 A;  1E24 A;  1QVC A;  5CV5 A;  4BBS H;  4GOP A;  1EZ6 A;  2JA5 H;  2LY7 A;  2HDM A;  4IUV A;  3GTL B;  1EIG A;  4JPB W;  1U5K A;  4FDB A;  4O42 A;  1V1P B;  3NHH A;  3ERO A;  3NTH A;  4ZKB B;  4DV3 Q;  3T13 A;  3NUC A;  4JI8 Q;  4OO1 I;  4WFN 3;  3MC0 B;  5M3M H;  1PHJ A;  4DR6 Q;  3J80 i;  2K52 A;  3T1H L;  1ILQ A;  1TT2 A;  3I70 A;  4KY7 A;  3PQI A;  4R4T A;  1JWU D;  2CH4 W;  1VMP A;  3R2I A;  3K58 A;  3MEH A;  3TEH B;  2NVY B;  3RZD H;  3WWV A;  4POF A;  1SYE A;  5EPJ A;  3KJP A;  3OWF A;  3TZU A;  3KLR A;  4RGM A;  4R8I A;  2R61 A;  2IWH A;  4JI4 L;  1GVP A;  2EY5 A;  1LTR D;  1JR0 D;  1GUO A;  1MJE A;  2ES2 A;  1D6E C;  2ZT9 C;  3K0X A;  3JAM L;  4B3M Q;  3EN2 A;  3WDN A;  1B4O A;  5FO7 B;  2P5Z X;  5M3F H;  2C5C A;  3HZX A;  2BCO A;  4C3J B;  5HGQ A;  5IP7 H;  4DV2 Q;  3UI2 A;  4O1N A;  1SMY D;  4DV1 L;  5IIF A;  1Y8P B;  2KUM A;  4IPC A;  3SK5 A;  4N9P A;  4RGN A;  1EY0 A;  2K5D A;  2OXP A;  4LUO A;  2PO4 A;  5JPN C;  3GTQ B;  5IGE A;  5C0X G;  3BS1 A;  3NTI A;  1VQC A;  3MWY W;  2ENB A;  3VR2 A;  2QEX A;  1TWC H;  5FLX E;  2L0C A;  1WTV A;  1I4H A;  5CV4 A;  1HUN A;  2Y0S E;  2JEA I;  4ZRZ A;  3F2B A;  1AZQ A;  1PVO A;  2F03 A;  3A8I E;  5A2Q E;  1YJW A;  1QCB D;  2B2U C;  2F0Q A;  3CD6 A;  4B9W A;  1F9P A;  1UE7 A;  3FEW X;  1SR3 A;  4JI3 L;  4DK0 A;  4DGZ A;  2KHJ A;  2ZM6 Q;  1I4Q A;  3FKI H;  3HP3 A;  4IPG A;  1Y8N B;  4LFC Q;  3FP9 A;  1XMQ Q;  3B6Y A;  1Q3L A;  5LHY 1;  4RGO S;  1ICF B;  4DV5 Q;  4NXN Q;  1L0X B;  1STE A;  3RLF A;  1HR0 L;  1R4Q B;  1X32 A;  3BDL A;  1H9S B;  1K28 A;  1PTO D;  4RA8 A;  3ZYY X;  1XMO L;  1IYV A;  1ZEQ X;  4C3I H;  2MQH A;  3CCE A;  2BH8 A;  5IYB H;  1HNX L;  1G51 A;  1OXU A;  4ZKC B;  4BY7 H;  4N8F A;  2AMC B;  3VYR A;  4DXG A;  1PRT D;  4C56 C;  4C3J G;  3HOU B;  3GTM B;  1GD7 A;  2FMC A;  2KHI A;  4I7Z C;  2OEO A;  4UP7 A;  1IHZ A;  4IOA A;  2NVQ H;  1HNW L;  4K0K L;  3V96 A;  4DUY Q;  3I7F A;  4ABN A;  5C5L A;  5IGC A;  1TII D;  1FJG L;  4M1U B;  2XSC A;  2K28 A;  5LL6 S;  3U58 A;  4JVZ A;  3TZD A;  2A8V A;  3VYU A;  1Y69 U;  2EYJ A;  1UUP A;  1YHA A;  5ELE A;  3F1Z A;  2B39 A;  4BA1 I;  2M00 A;  4YIJ A;  2MHV A;  5HUR A;  3M3Y B;  3T1Y L;  4R4O A;  3OTO Q;  3P75 A;  3KFU A;  4EQN A;  2E75 C;  3TSS A;  4CKE A;  2H4O A;  4YY3 L;  2HUG A;  1I5F A;  3D3R A;  4PMC A;  4NXM L;  5G3L F;  1A6X A;  3CPF A;  5EJW A;  3I91 A;  3FRP B;  4PZ7 A;  4DUZ Q;  2K5V A;  3CAM A;  1GUW A;  1LAB A;  1XNR Q;  3MVV A;  4DAP A;  2A6H D;  3OOC A;  4DR7 Q;  3OYY A;  1K8M A;  1SMY C;  1NMG A;  3M7G A;  3W3A A;  3I2Z A;  3R2T A;  4DR3 L;  4H13 C;  2A19 A;  3DXJ C;  4X3K A;  1IBL L;  5AFW A;  2NZ1 D;  5IOD A;  1YNX A;  2D0P A;  2B2W C;  2B8F A;  2HQL A;  2GVA A;  1ZYR C;  2C9O A;  3ER0 A;  2CQO A;  5GAE C;  3D31 A;  3J81 E;  5J39 A;  1W2B A;  2ZJR A;  4A3G B;  2O5I C;  1FL0 A;  2WAQ E;  3A56 A;  4PQX A;  3CKI B;  4LFB L;  1EEF D;  4DR2 L;  1EYG A;  2EDG A;  3HOU G;  2Z6K C;  2F4I A;  2A5H A;  4TQU S;  1YIT A;  3HOX H;  1Q86 C;  2LKV A;  3DLL A;  1ENF A;  3CC4 A;  4KN7 C;  3RN2 A;  3OWE B;  2AQ1 B;  4WRD A;  4XQQ A;  2G5D A;  4X3U A;  3KDF A;  3NBH A;  2A6E D;  2F0T A;  2IPK D;  2VXW A;  3MXP A;  2UUC L;  5ELD A;  1TY0 A;  3HG9 A;  1LAC A;  1LTB D;  1XJV A;  1EQR A;  1V1P A;  1OO9 B;  2WB1 E;  2EOT A;  1PTO C;  4KJN A;  4LW1 A;  1SNP A;  1E22 A;  4V0B A;  1Z9F A;  4E6I A;  1XTC D;  1YBY A;  3OPO A;  5JVG 3;  5E4W C;  3U4V A;  1D1K A;  5FLX c;  2NYZ D;  3R93 A;  3T1H Q;  3IRB A;  4IUU A;  4IFD J;  2B2V A;  1YVC A;  1MI2 A;  2GN5 A;  2HDL A;  2Q8R E;  4EGV A;  3C2P A;  3S17 B;  1HTP A;  4IJH A;  1JIC A;  4A3D H;  1U0L A;  1WVL A;  2A1A A;  1H9R A;  4RHS A;  2DGY A;  1SE3 A;  1B9M A;  3DUZ A;  3H91 A;  3NTK A;  4JI4 Q;  1PH6 A;  3NWT A;  2EYP A;  4GLA C;  2ID0 A;  4TSS A;  3I4N H;  3S1Q B;  4KD4 A;  3J81 j;  1NUC A;  2F0W A;  3K81 C;  4C2M B;  1B53 A;  3S15 B;  4HID A;  1MJC A;  4A3G G;  4XT3 B;  4ZK9 B;  2XN9 C;  1CI3 M;  5EKI A;  3M85 A;  1JWM D;  2KQ3 A;  2NUC A;  1HZA A;  4HCS A;  2ICI A;  1CFM A;  1SE4 A;  2KBN A;  5T1G A;  4DV1 Q;  4BXX H;  4HJ7 A;  3QG1 A;  1S40 A;  4OHJ A;  3RNU A;  3DWA A;  4HTH A;  3CCS A;  4GS3 A;  3OSO A;  4HJ8 A;  3KBG A;  4J8Q A;  4F8M A;  1WCM H;  4K5X A;  5C4J B;  3HOV B;  3TRZ A;  1HXY D;  1PTO B;  2A6H C;  1DXM A;  2WKD A;  3VDY A;  4A3I H;  2BE5 D;  3S1N H;  2EXZ A;  3S1M B;  2DNC A;  2E8G A;  1GHJ A;  3X3N A;  1JOO A;  3NQI A;  2HCI A;  1D1I A;  3OW7 A;  4JI7 L;  4HIK A;  4M8A A;  3I73 A;  4AYB B;  5BN3 A;  4JI1 L;  5CBA E;  3DWP A;  2MO1 A;  2JA8 B;  4MNO A;  4RKL A;  4QUF A;  3PO2 H;  1I94 L;  2K50 A;  4PZ6 A;  1SYC A;  5FLM H;  3I3C A;  4A3F B;  1JMC A;  1XNQ L;  4CDF C;  1TWF H;  2AUJ D;  4JI3 Q;  3M4O B;  1V9P A;  4UY8 C;  1EWI A;  3EJI A;  5C6A A;  4O2D A;  1FR3 A;  1JOR A;  1ASY A;  2BH2 A;  1TS4 A;  1E7Z A;  4FXK C;  2R6G A;  1ENA A;  4DNR B;  1H9S A;  2F0E A;  1VQG A;  1T5X D;  1YNN D;  2XIW A;  4DV3 L;  3TDQ A;  1HR0 Q;  1EYA A;  5L37 A;  3P1H A;  2A6E C;  2PZU A;  1NR2 A;  3F2U A;  2KOL A;  4KN4 C;  3U9S A;  4Y7N H;  2YTY A;  1CKM A;  3J80 E;  1K0R A;  1HNX Q;  5K36 G;  3HOZ B;  3EFX D;  4K6D A;  1RF2 D;  1IL2 A;  5CYU A;  1TKW B;  3BG3 A;  1HNW Q;  4K0K Q;  1NJI C;  1JB7 A;  3CPW A;  5GRO A;  3GV6 A;  2R93 H;  3J81 c;  4C1N K;  4GLX A;  1FJG Q;  4KJO A;  3V2T A;  5M5W H;  1D7Q A;  1GUG A;  2F0S A;  1AN8 A;  3HOV G;  1Y1W H;  2LS0 1;  1YHB A;  2B2U A;  4A93 H;  1EIH A;  4DV2 L;  3AEV A;  4KKS A;  4HSP A;  5T1I A;  1VQ5 A;  1W3S A;  3D6C A;  2GVB A;  2E76 C;  1JJG A;  1KIX A;  2JA7 B;  4IFD H;  1U4R A;  4AYB G;  2F3I A;  1PH4 A;  3T1Y Q;  2JA8 G;  1E2V A;  4KK7 A;  3S2D B;  2BDO A;  1KLU D;  1PH1 A;  4GKJ Q;  2N8N A;  4YY3 Q;  4A3F G;  3LWE A;  4NXM Q;  1OXX K;  2BA0 A;  4PMW A;  5NUC A;  1B1Z A;  2DJG C;  2NN6 G;  2A69 D;  1KLG D;  2XRS D;  2RA4 A;  4DV7 Q;  4DR3 Q;  1EY8 A;  1IBL Q;  2PQA B;  3IAY A;  4DR1 L;  1G29 1;  1EWC A;  5D3D A;  4DNT B;  3S14 B;  3J81 i;  2ZM6 L;  1A3U A;  5ELF A;  2BE5 C;  3E0J A;  2I0Q A;  4H0L C;  3PMF A;  5JJI A;  3STB C;  2RHQ B;  3HOZ G;  4A3K H;  3MXG A;  3JAM E;  3I4M H;  4FF1 A;  1XMQ L;  2MUY A;  4X3S A;  4BBR B;  5EAY A;  4LFB Q;  1VQ7 A;  4DR2 Q;  2MO0 A;  1OXS C;  1LUZ A;  4X65 L;  3ITP A;  1HRJ A;  1AE2 A;  3H09 A;  4DV0 L;  1BO0 A;  2EY6 A;  4HAE A;  2IX1 A;  4LAA A;  1K83 H;  4RKB A;  1STA A;  4EX5 A;  2Z4H A;  2EY1 A;  1VQ9 A;  1A62 A;  3I55 A;  5FO8 B;  3T56 B;  1PA6 A;  3N52 A;  1KDA A;  1TVX A;  1XWE A;  4LMQ D;  4BBS B;  2JA5 B;  3G6J B;  3GQB A;  2UUC Q;  3CU7 A;  4LF8 L;  2F0V A;  4X66 L;  4A3E B;  4H02 A;  4PZ8 A;  1UE5 A;  3MTS A;  2JA7 G;  4IN3 A;  2I07 B;  1XXG A;  5CV8 A;  1TWG H;  2NN6 I;  4DV6 L;  3RZD B;  3CQZ H;  1G6P A;  2B2W A;  5GAH C;  1LTS D;  1BBX C;  5LMU Q;  5KRU A;  3SEB A;  2ZXP A;  5IYC G;  3LNN A;  3GP7 A;  2EJG C;  3UDF A;  1KNE A;  5ELB A;  3Q24 A;  2QW7 A;  3OTO L;  4L8J A;  2E2I H;  2Z6K A;  2JA6 H;  5M9O A;  4QUC A;  5M3F B;  4QGU A;  4R1J A;  2RSN A;  5IGB A;  4KY6 A;  2EVB A;  3TS2 A;  2A68 C;  2DNE A;  2PNR C;  3QWN A;  2O4X A;  2E2H H;  1QVG A;  1NTG A;  2RBM A;  4BBR G;  2PMZ E;  3E0E A;  3UE1 A;  3J7A 5;  2OF1 A;  1E2Z A;  3KLS A;  3PO3 H;  4A3C H;  2EYH A;  3GTG H;  3OIP A;  1H9K A;  1F9Q A;  1CKO A;  3A5Z B;  4N9T A;  3J80 c;  1AH9 A;  4B9X A;  4LF4 L;  3ICE A;  1CA6 A;  5EBD A;  3GTO H;  2A69 C;  4JBK A;  4BBS G;  2JA5 G;  1A3T A;  3QJY A;  5C3W A;  4FO2 A;  2RDF A;  3TP8 A;  1GUT A;  2NZO A;  1JC7 A;  4PNY A;  4WJW A;  4A3E G;  2NVX H;  3S2H H;  2BA1 A;  4JI7 Q;  3AQQ A;  2NVT H;  1NSN S;  5JPM C;  4NP5 A;  4JI1 Q;  1U9R A;  1ZKO A;  3H0G H;  1AZP A;  4X6A H;  1I94 Q;  1I6V C;  1PFN A;  4EVO A;  3FKI B;  4GN4 B;  3SDZ A;  4IPH A;  4FNF A;  1XNQ Q;  1IYJ B;  1HHV A;  1Q81 C;  1VQI A;  2Z9H A;  1QNU A;  1P8L A;  4B3T L;  1BKB A;  2KCM A;  4YWM A;  2ALY B;  4BS9 A;  3QOL A;  1F2Y A;  1YEZ A;  1ASZ A;  4DKA C;  1PZI D;  1ESF A;  1SJE D;  2MJ8 A;  4C3I B;  2WFW A;  3IKJ A;  3KLW A;  3GD7 A;  4BY7 B;  5M3F G;  3VR4 A;  4JW0 A;  4OEM B;  4JC0 A;  5D65 A;  1F2M A;  2D0O A;  3SHL A;  5IP7 G;  1KXL A;  2KED A;  2NVQ B;  1Q8K A;  4G7Z C;  2G9H D;  2F52 A;  1TU2 B;  3I4O A;  1ONL A;  1GUS A;  4RCO A;  4RMF A;  1WD1 A;  3NSW A;  1JJ2 A;  3HKZ E;  4NMZ A;  2N49 A;  1K3B C;  3NEL A;  2C35 B;  4UAI A;  5IE8 A;  1D5X C;  3K57 A;  1LT6 D;  1YIJ A;  4LNQ A;  2WKC A;  3KF8 B;  1Y14 B;  4L5Q A;  3GDE A;  4IO9 A;  3CC7 A;  3N6R A;  1STN A;  2CWP A;  5IT9 L;  3KJO A;  1JCK B;  1KDB A;  1EFI D;  5FJ8 H;  2BOS A;  2SDF A;  5CBE E;  2EIF A;  3FKI G;  2PW7 A;  1EOT A;  1LM0 A;  2B2T C;  2UU9 L;  4NW2 A;  1R9T H;  2ASB A;  3PUX A;  1HPC A;  1STH A;  4QIW E;  4J1M A;  3TBI B;  2R7F A;  4PG3 A;  2UXB L;  2F0D A;  1KHI A;  2E74 C;  4JCV E;  2PQA A;  3ULJ A;  2EJM A;  1J6Q A;  4EQ5 A;  5E7N A;  4C3I G;  1VQL A;  3E5S A;  2L4N A;  5EKL A;  3DEO A;  4Z9C B;  5IYB G;  3TP5 A;  4DR1 Q;  1JE4 A;  4BY7 G;  4TRD A;  2AKW B;  3ULL A;  1LV9 A;  1I4G A;  5LMN W;  1Q46 A;  3JAM i;  2E2J H;  3HOX B;  1DCZ A;  3K5M A;  1KNA A;  1E1O A;  3FDT A;  2X69 A;  4JI2 L;  4X65 Q;  2OTL A;  1SRO A;  2R3Z A;  4CKC A;  4DV0 Q;  4B3S L;  1PXU A;  3BYT B;  3H94 A;  1JOQ A;  4YCV A;  3F8T A;  4IUQ A;  3RLN A;  1T9H A;  2R7Z B;  1LT4 D;  2KCT A;  2J7Z A;  1RDP D;  1PV4 A;  2IL8 A;  1B44 D;  1D5M C;  2AWN A;  3AFQ A;  1A3V A;  4LF8 Q;  1WFQ A;  2PCF B;  4X66 Q;  2KEE A;  2X6G A;  1O80 A;  4DF7 A;  2PZT A;  1YJN A;  2ATW A;  2K5H A;  1OXT A;  3CCV A;  1HTL D;  3K8A A;  3F2C A;  1YZ6 A;  3J7Y W;  3CCM A;  4AYB E;  1B7Y B;  2X6L A;  1VDZ A;  4YWK A;  4ODG A;  5J22 A;  5H1S E;  2HT1 A;  5C0X I;  1NCV A;  2IJ0 A;  3A7L A;  2JA9 A;  2HIV A;  4L5T A;  1K3R A;  3T4A C;  4DV6 Q;  3L7Z C;  1CM9 A;  3H6M A;  1HQM C;  1X9N A;  1HUM A;  1B2T A;  2I46 A;  2XGT A;  1HFN A;  1QWY A;  1D5Z C;  4MN3 A;  3A74 A;  4CKB A;  1BBW A;  4L5R C;  3LGJ A;  3BU2 A;  3I4N B;  1X65 A;  4H7B A;  2RF4 A;  3BVM A;  1LTI D;  2JE6 I;  2CWA A;  4GKJ L;  5C4H A;  2F0U A;  3W1G A;  1Z47 A;  1BDO A;  1SE2 A;  4KHV A;  3H3V H;  1E0B A;  1SRU A;  1SEB D;  3HOX G;  3KUP A;  1XYI A;  3AMU A;  4POG A;  5DM7 3;  5DAU A;  2JEB I;  5IOC A;  3O13 A;  4DV7 L;  3U50 C;  4DK3 C;  4IUN A;  3BVG A;  3QOJ A;  2QCP X;  4QJF A;  1J5E Q;  1X3Q A;  3K5O A;  2MGS A;  4A3I B;  3S1N B;  4OWX B;  3A54 A;  4LF4 Q;  2FJ2 A;  1YNJ D;  4YWL A;  2R7Z G;  2LSS A;  3P20 A;  3HEJ A;  3GTP B;  1G91 A;  3CW2 C;  1WTR A;  1EEI D;  1Z7T A;  3G4S A;  4IUR A;  5I9O A;  4XQN A;  2Z6B A;  5CC4 A;  2IX0 A;  5I6W A;  1X3P A;  1KD1 C;  2I5H A;  2B8G A;  2DY7 A;  1RTN A;  4K5W A;  3SGI A;  1V43 A;  3L2P A;  3EQL C;  5IGD A;  1C0A A;  1TWF B;  4UP8 A;  3T51 B;  1WOC A;  5A35 A;  2A74 C;  2K5W A;  1SFO H;  5CR3 A;  1VS0 A;  1TWH B;  1MD2 D;  1STY A;  3HKS A;  1WTH A;  3CC2 A;  4B3T Q;  3CRL C;  3NXW A;  4P75 A;  1PFB A;  2NWG A;  1SN8 A;  1O7Y A;  3CCL A;  4KHP L;  3H15 A;  4R4I A;  1CKN B;  4OIK A;  1IBM L;  4XXE A;  3I4N G;  1NMF A;  2ZXR A;  4Y7N B;  3BDC A;  4FF2 A;  2F0G A;  2D9U A;  1JT8 A;  4ID6 A;  2N78 A;  1VQP A;  1Y8O B;  1MSH A;  3G7L A;  1A0I A;  4RH6 A;  1JQY D;  4PV1 C;  2WIN B;  1OTC A;  5DM6 3;  1BCP D;  3K5N A;  4OIJ A;  1PRT C;  1WTP A;  5LMU L;  2HQE A;  2VQF Q;  2F0I A;  4JBW A;  1ET6 A;  4BXX G;  1FVI A;  3NEN A;  2KJX A;  2R93 B;  1M8A A;  1Y1V H;  2TMP A;  5M5W B;  3HRZ C;  3VR3 A;  4HJA A;  4DK6 C;  1K73 C;  1Y1W B;  4A3I G;  1HZ9 A;  2LFN A;  4A93 B;  2OCE A;  1STB A;  2K4K A;  3KF8 A;  1HJP A;  5AJ3 L;  1OXV A;  2G9D A;  3RR5 A;  2QEJ C;  2F1M A;  1X55 A;  3MA2 B;  4B3R L;  3JC6 6;  2F0L A;  2EPB A;  5FLM G;  3FHW A;  3KOJ A;  1LO5 D;  4KTA A;  1U4P A;  1Q12 A;  1LYL A;  3CRK C;  4BY1 B;  1PFM A;  4XT1 B;  1IBK L;  3PUW A;  2UU9 Q;  5E3F A;  2EYF A;  1SMX A;  3CCQ A;  4OON A;  1LT5 D;  3DM3 A;  4G7H C;  3QIA A;  1VQH A;  3OW2 A;  4UP9 A;  2UXB Q;  1NE3 A;  4YHH L;  2JN4 A;  4I7A A;  4H44 C;  1L0W A;  1WYD A;  1GUN A;  3IFD A;  1KRT A;  5KEE A;  3C3L A;  1PRT B;  2PYK A;  1YNJ C;  1PDQ A;  3QR8 A;  4S3S A;  5FOB B;  2R92 H;  4DK1 A;  2JXM B;  2RDG A;  2VW9 A;  1RKN A;  1C48 A;  3K6O A;  1HA6 A;  1SYB A;  3ERS X;  2PW5 A;  4HIM A;  1TS3 A;  2K5Q A;  1RTO A;  5C4X H;  1XPO A;  4P71 A;  1FGB D;  2ZTD A;  1C4Q A;  2R93 G;  1IXR A;  5DLQ E;  1SNQ A;  1K83 B;  3I8Z A;  4R9W A;  4JI2 Q;  1A2T A;  1VQJ A;  2B3G A;  3D8G A;  3HFZ B;  1KC8 C;  1PH5 A;  1S72 A;  2QGQ A;  4B3S Q;  3TQY A;  4ME5 A;  1Y1W G;  3GV3 A;  3FVQ A;  3D4D A;  4A93 G;  5D14 A;  2BDN A;  4JG2 A;  3C46 A;  1S5E D;  4QL5 A;  2PQE A;  3SK4 A;  2D62 A;  4A3L H;  2VB3 X;  2O5J C;  4KV6 A;  1A8V A;  4NB3 A;  4IFD G;  4J15 A;  2B2T A;  4IPD A;  3PUV A;  2F0K A;  3BZK A;  3PCO B;  2Q2U A;  3E9I A;  4L5S A;  3CQZ B;  4GNX C;  1D2B A;  4BY1 G;  4O0A A;  4AQY L;  3PUZ A;  2I5M X;  3K7A H;  4JBM A;  1TWA H;  4FXG C;  1EU4 A;  5C44 H;  1C8C A;  1NNX A;  1ML0 D;  2E5L L;  4LJZ C;  3W1B A;  3HOW B;  5ELO A;  2E2I B;  4IQZ A;  4LF9 L;  2JA6 B;  1IKM A;  1X56 A;  1SNC A;  2VY3 A;  3P7J A;  1CQF A;  1QB5 D;  4JYA L;  1P16 A;  2ZTC A;  3L3O C;  1T5E A;  4CDC C;  5J1Z A;  2JYO A;  1M4V A;  1VQN A;  2EJF C;  3BVZ A;  4CHT B;  3RZO H;  1KL9 A;  2D5D A;  2N55 A;  4I65 A;  3TME A;  4C2M H;  1A2U A;  1SSO A;  5C3E H;  3PO3 B;  2EYL A;  4EQO A;  1L2F A;  5KYI A;  3GTG B;  1UE1 A;  3S1R H;  1GHK A;  2AQ3 B;  2YTX A;  4LF7 Q;  1PFS A;  3RD4 A;  2D2C C;  3GTO B;  2Z8L A;  1VQ8 A;  5KYL A;  1I3Q H;  1PH7 A;  2UXC Q;  1EIF A;  1QZH A;  2NVX B;  1Q1B A;  3E9H A;  4IFD I;  2PNH A;  5FKA C;  3L0O A;  4RG1 A;  1PTO F;  1FYC A;  5M5X H;  4K6L A;  4JI0 L;  5G3L D;  2NVT B;  1FD7 D;  3S1M H;  4GNX B;  3H0G B;  4TKO B;  4P73 A;  1IW7 D;  4MTK A;  1STG A;  4KD3 A;  1CK1 A;  1VQ6 A;  3FMC A;  5KNC A;  4LUZ A;  1CUK A;  3PF4 A;  2F3V A;  1VCI A;  1PRT F;  5IT9 E;  1N34 L;  2KHS A;  2K75 A;  1V1O A;  1YI2 A;  3VR5 A;  2B63 H;  2OQK A;  2XRQ D;  4JV5 L;  3OIQ A;  4HCE A;  1WTX A;  2MNA A;  2AQ2 B;  1CKN A;  2NZH A;  5CV6 A;  4GKK L;  4CJ1 B;  1LLR D;  3HOW G;  1B3Q A;  2JA6 G;  4KHP Q;  1I50 H;  1YNN C;  4OGQ C;  4IUP A;  5M3M B;  1CHQ D;  1IBM Q;  5M5Y H;  3URY A;  1W6J A;  1KAW A;  1HR0 W;  3C1F A;  4C3H H;  2CH4 A;  4HR7 B;  2F0J A;  1DZ1 A;  1B70 B;  1X3F A;  2Q8I B;  4R4Q A;  4UPA A;  3M9B A;  1VQB A;  3W5O A;  2OT2 A;  2A73 B;  4DA2 A;  3PO3 G;  5BN5 A;  5IYD H;  2DY8 A;  1UEA B;  3ND9 A;  2F0M A;  4GN3 B;  4P72 A;  1VQK A;  1F2L A;  5CV9 A;  2RKS A;  5JJK A;  1O7I A;  1PLF A;  3KYH C;  1B3A A;  2CHB D;  2ZXO A;  2ZJP A;  1LTT D;  4K8J A;  1EZ8 A;  1F9R A;  1SJH D;  2F0N A;  3R3O A;  3HOY H;  5AJ3 Q;  3SK8 A;  4DR4 Q;  4RCN A;  3H0G G;  2VZA A;  4B3R Q;  1PMR A;  2UXD L;  4CDE C;  4KMU C;  2Q8T A;  4GLV B;  4A3M H;  3K0Y A;  1J5E L;  4OEL B;  4DR5 L;  3UDX A;  1SND A;  5IGF A;  2L12 A;  1R9T B;  1TWC B;  4DN4 M;  1BR9 A;  1IBK Q;  1MIU A;  1X3E A;  1XTD A;  4IAL A;  3UDG A;  3CMA A;  3A0J A;  1MKH A;  4HN7 A;  1HH2 P;  1VQM A;  1V1Q A;  4K2K A;  4A3B H;  2FFK B;  2IW3 A;  4JK1 C;  2Z1C A;  4FYD A;  2H5X A;  3AU7 A;  1QUQ B;  4A3J H;  3RUZ A;  3PF5 A;  4YHH Q;  5M3M G;  5IWA L;  1PZJ D;  4ZQ3 A;  4LF6 Q;  1RIP A;  1YJ9 A;  3MHB A;  1EOV A;  4LK1 C;  2E2J B;  1CZG A;  2WAC A;  1X54 A;  1K8G A;  1QE6 A;  4DFA A;  3K7U C;  5KIX A;  3H3V C;  4OO1 H;  2JK8 A;  3T53 B;  2B2Y C;  2NTS A;  2N88 A;  1G8Z D;  2KA7 A;  4F7X A;  4HED A;  4X62 L;  1QZG A;  5IY0 A;  2F4V L;  3A8K E;  1HQR D;  5IP9 H;  4Q5V A;  4X64 L;  1WD0 A;  2IHE A;  3MFG A;  3UDI A;  2K14 A;  4HJ9 A;  3QB3 A;  1KDC A;  2QIL A;  5COY A;  3X3M A;  3GTJ H;  2M9V A;  3A7A B;  3S9W A;  3S16 H;  1I6H H;  1V8Q A;  1L1O C;  1N32 L;  1BVS A;  1HFG A;  2VQF L;  1GXD C;  3M7N A;  4LUV A;  5FJ8 G;  1VQE A;  4NPS A;  4IJL A;  4A3E H;  4P2C B;  3F2D A;  2F3W A;  2KEC A;  1B8A A;  1BXT A;  1B9N A;  3DM1 A;  1ROD A;  2CVR A;  4KKT A;  4CGY B;  5JEA H;  2VUM H;  1EY6 A;  4DPG A;  5CV7 A;  3JAM c;  4X3T A;  4AQY Q;  2YYZ A;  3AYH B;  1B50 A;  3M4P A;  4KY5 A;  4RHR A;  2OQ0 A;  5COR A;  2HHH L;  1EUJ A;  2PZW A;  2E5L Q;  3SR1 A;  4DV4 L;  1Q90 A;  5F2D A;  4ULL A;  3TRE A;  4LF9 Q;  2FIN B;  1O78 A;  3VA7 A;  4OWT B;  3Q0A A;  5HY6 A;  5IT9 c;  2UUA L;  2WP8 J;  4PMB A;  2SOB A;  4KHZ A;  3ERQ A;  4JYA Q;  2MP1 A;  2KCC A;  1PH2 A;  1TY2 A;  4U67 3;  2QDB A;  5ISR A;  5K5P A;  1BBU A;  1HNZ L;  2TSS A;  4BA2 I;  3WOE A;  2ZJQ A;  2XTI A;  4R8N A;  3I56 A;  3ND8 A;  4K8I A;  1TS2 A;  1LT3 D;  3OMC A;  2RSO A;  5I6Y A;  2WV6 D;  3GTK H;  1L1O B;  1DGS A;  3L9A X;  3EBE A;  1RHP A;  3D4R A;  1IKL A;  1XPU A;  1VQ4 A;  1VQA A;  1R4P B;  3BDO A;  1ZYR D;  4NDX A;  3KF6 A;  2LXK A;  5GQO A;  1SLJ A;  3PIO 3;  3OMG A;  3VYT A;  1FNV A;  1SDF A;  2L55 A;  4GNX A;  3U4Z A;  4JI0 Q;  1UEB A;  3BZD B;  5KGU A;  1SFO B;  3NE5 B;  2PI2 A;  5JAV A;  2R7D A;  2J0T D;  3RN5 A;  4ZCK A;  3CCR A;  1NY4 A;  1PYW D;  1GM5 A;  5BR8 Q;  3Q23 A;  3K80 C;  1N34 Q;  2EYO A;  4IZ8 A;  1WTO A;  1S5B D;  1UAP A;  2DN8 A;  3D0F A;  2YU9 H;  4JI6 L;  1HA5 A;  1Q1E A;  1WTW A;  2RDH A;  5C0X H;  3NBI A;  1MSG A;  4JV5 Q;  1UE6 A;  3RLO A;  2XWB B;  5C5M A;  3K5L A;  4GKK Q;  3E6Z X;  1ENC A;  3TP6 A;  1ESR A;  1O7Z A;  1C7Y A;  2CW0 D;  4XYO A;  1CTM A;  3GTL H;  1EY4 A;  3PV0 A;  1AE3 A;  2KCN A;  4GZY C;  1BF4 A;  2SEB D;  1HCZ A;  1H95 A;  4A3D B;  1IYU A;  3CF5 A;  2CCZ A;  1F2Z A;  2LMC B;  2Q2H A;  2PMZ B;  1TR5 A;  2CFM A;  1Y1V B;  4XQJ A;  3U9O A;  5I2Y A;  4R4C A;  2NVY H;  1QIL A;  4OX9 L;  3SVM A;  1GOZ A;  4WJ4 A;  2KEN A;  1JWS D;  2NTT A;  1A15 A;  2K5N A;  3T16 A;  5EQ0 A;  1Q8I A;  4RAU C;  2RQX A;  4LF5 L;  4KLK A;  3A8J E;  4APV A;  1N33 L;  5E4X A;  1WI5 A;  4NKL A;  4ZAI A;  2V1C C;  2K05 A;  1CSP A;  5CMD A;  3DHQ A;  1WJJ A;  3NPP A;  2QDL A;  2L1B A;  5JJZ A;  4C3J H;  4LF7 L;  2UXD Q;  2RCN A;  4G57 A;  3CCU A;  1WCM B;  2XVS A;  2UUB L;  1II3 A;  4DR5 Q;  1JB3 A;  1X3G A;  2K6A A;  2UXC L;  3QO2 A;  3BYY B;  5DEH A;  3PIP 3;  5LL6 X;  3CCJ A;  3MEF A;  1NAP A;  3GTQ H;  2YTV A;  2IHF A;  1QUQ A;  2K04 A;  3J7Z C;  3PO2 B;  4CBV A;  2F0H A;  5ELN A;  2Z0S A;  2R92 B;  3H3V I;  1A63 A;  4ME3 A;  5IWA Q;  3AFP A;  1AEX A;  1PYS B;  1EL0 A;  2JQO A;  3EIV A;  4CJ0 B;  4ZUJ A;  3J7A V;  4QCL A;  4KKU A;  3HS0 C;  5JOB A;  3VR6 A;  1N36 L;  4A3D G;  5E1F A;  1PYB A;  5C4X B;  2K33 A;  1PZK D;  4FF3 A;  1Y1V G;  2QA4 A;  1VQO A;  4DXF A;  1W6K A;  2V4D A;  2K01 A;  3SXH A;  4CDD C;  3HGB A;  3HKZ B;  3WOF A;  3ULP A;  1QJO A;  4X62 Q;  2F4V Q;  2EY2 A;  4X64 Q;  4ZUI A;  2KVM A;  4HJ5 A;  1CZW A;  4K14 A;  3CP0 A;  3TN2 A;  1Q82 C;  2EQS A;  2R7Z H;  1IZ6 A;  4JOI C;  1N32 Q;  5IGG A;  2JP1 A;  3IL8 A;  4HSV A;  1LTA D;  1SXT A;  2CW0 C;  3HOU H;  3GTM H;  2DUD A;  1S4Z A;  4J6H A;  4Q0F A;  4HMJ A;  4QF4 A;  1Q7Y C;  1WCM G;  3K7A B;  1TWA B;  2PI2 E;  1G6Z A;  1AFP A;  1S3O A;  5FLX L;  4MZ9 A;  4DAV A;  5C44 B;  3Q8D A;  1D8L A;  2EXD A;  3KBX A;  4RFB A;  1GO3 E;  3SK6 A;  4QIW B;  2Q2I A;  2DJF C;  2K1B A;  1JJC B;  2Y0S B;  4DNI A;  3Q6S A;  4DR4 L;  4ZYS A;  2HHH Q;  1EYD A;  2E2D C;  2FMM A;  5A2Q L;  3PO2 G;  2EE1 A;  4AIM A;  4DV4 Q;  2R92 G;  4A75 A;  2B2Y A;  2UUA Q;  2F0O A;  3M3Y H;  3RZO B;  1S5D D;  4XIG S;  1DJR D;  2L11 A;  2XNA C;  3EA6 A;  4GOP C;  1CT1 D;  5C3E B;  5C4X G;  1HNZ Q;  2VNU D;  2B29 A;  1JE5 A;  3I90 A;  3S1R B;  1DOL A;  2L15 A;  4KI0 A;  4LFA L;  1F77 A;  1L1O A;  3FPP A;  2AWO A;  2K32 A;  2RVL A;  1PH3 A;  1QOH A;  3HKZ G;  5I2X A;  3TP7 A;  3IFT A;  2OWO A;  1I3Q B;  4LF6 L;  1J9O A;  3PIO A;  4A3L G;  1RL2 A;  5LMN L;  1SNM A;  4A3K B;  3I4M B;  1DOK A;  4FF4 A;  3AB9 A;  5M5X B;  4JI5 L;  1XPR A;  2VQE L;  3LWU A;  1U4M A;  5CGK A;  3GTP H;  3STB D;  5I4D A;  1HZB A;  4A3G H;  1O7L A;  2OTJ A;  1BUV T;  1I4X A;  1ILP A;  4G7O C;  2RCF A;  1FNU A;  4AH6 A;  1XX8 A;  4OWW B;  1HZC A;  1E1T A;  2F0P A;  2B63 B;  1S5C D;  1M1K C;  3OHX C;  4QB4 A;  1K8A C;  5C44 G;  1BQQ T;  4DAY B;  3PGZ A;  2AUK A;  4JI6 Q;  4TVA B;  5FK9 C;  1UWV A;  1I50 B;  4F87 A;  1TWH H;  3MXN B;  1KTK A;  3ONA B;  2Y0S G;  2I5L X;  4U68 A;  2K7V A;  5M5Y B;  4GOP B;  4YCU A;  1EQQ A;  2WII B;  3G6E A;  4C3H B;  1TWG B;  4JI8 L;  4MHE A;  1XMO Q;  4DR6 L;  4RGT A;  1J8I A;  1BCP C;  5C3E G;  5JJL A;  2F0F A;  1N8R C;  5I9P A;  4EQP A;  1DYQ A;  4OXP A;  3S17 H;  4DAM A;  1K0S A;  3BJU A;  4L6T B;  5EGT A;  4OX9 Q;  1SYG A;  2L9H A;  2PPB C;  3J81 L;  4CJ2 C;  1X6O A;  1DM0 B;  4B3M L;  2E2H B;  1L0Y B;  3HOY B;  4A3K G;  3I4M G;  1QVF A;  3SE0 A;  4LF5 Q;  1N33 Q;  3G71 A;  2JJQ A;  1SYD A;  1QG7 A;  2WAQ B;  2AHO B;  2A68 D;  1EQV A;  4UDU C;  2SNM A;  3S1Q H;  4WJ3 M;  3D4W A;  1G2S A;  3VYS A;  4GN5 A;  3S15 H;  5TSS A;  5K36 H;  2XWJ B;  4A3M B;  4A4I A;  1G2T A;  5HGT A;  1EFW A;  1VMC A;  3D6W A;  1E2W A;  3VA5 A;  5C3X A;  4ZLT F;  3NQT A;  3DEP A;  5D3I B;  4QY7 A;  3PIP A;  2VS1 A;  2UUB Q;  2B63 G;  4K2L A;  1MHW C;  1K8O A;  1ET9 A;  1EY9 A;  2YV5 A;  4A3B B;  4BY1 H;  3W2D A;  3S2H B;  2K03 A;  3KF6 B;  3KLS X;  5GAD C;  4A3J B;  5C4J H;  3HOV H;  3S24 A;  1PTO H;  4ILW A;  2WB1 B;  3CME A;  1FNW A;  1WTQ A;  1BCP B;  2N3S A;  5EKK A;  2RHS B;  4F88 A;  1VQD A;  4C3H G;  3NEM A;  4OL7 A;  5KND A;  1KAB A;  5BR8 L;  1AP0 A;  3LX0 A;  2JA8 H;  3TS0 A;  1NR4 A;  1QNK A;  5IYD G;  4A3F H;  1N36 Q;  4LFC L;  3M4O H;  1RCV D;  2NN6 H;  5JEA J;  5EPL A;  4NXN L;  4DV5 L;  4ALP A;  3C1E A;  3K59 A;  1VF5 C;  5EPK A;  2QKI C;  3M4Q A;  2MFI A;  1TS5 A;  1JOK A;  2VL6 A;  5JVH 3;  3E3X A;  1DOM A;  4HMI A;  1FGU A;  3GTJ B;  3S16 B;  1DON A;  3J7A F;  1I6H B;  2GA4 B;  1TQO A;  4C1N I;  1SYF A;  2L5T A;  1EWH A;  3HOY G;  4DU9 A;  2NB0 A;  3ZJY C;  1EYC A;  2Q2T A;  2WAQ G;  1E3P A;  3PSI A;  3CXC A;  4IUT A;  2FXQ A;  1NBW A;  2H1E A;  3G48 A;  3RMH A;  1PH8 A;  1MGS A;  1Z6H A;  1GKH A;  2ICE C;  3A5U A;  4FVM A;  3HOZ H;  1H9M A;  4A3C G;  1RD9 D;  4L63 B;  1U4L A;  4A3M G;  3NWS A;  4MTN A;  4A76 A;  4DUY L;  2EYM A;  4FXD A;  2CQA A;  1IL8 A;  2FHT A;  3DMU A;  2VUM B;  4QMG A;  4XYQ A;  5BN4 A;  3NK9 A;  3CHB D;  4JBJ A;  1KQS A;  1CQV A;  1ZXT A;  1VF7 A;  4A3B G;  3UE0 A;  4UHV A;  1KRS A;  2VB2 X;  3DWQ A;  4A3J G;  1DD2 A;  2MPM A;  2IY5 B;  1SNO A;  2LXJ A;  2SNS A;  5ELC A;  3A55 A;  3Q22 A;  1RJT A;  1VQF A;  3I4L A;  2WB1 G;  4N8X 1;  1BNZ A; 
#chains in the Genus database with same CATH homology
 1VQ4 A;  1VS0 A;  1IL2 A;  1M90 C;  4QQB X;  1VQA A;  3HKS A;  3HOW H;  4Y52 H;  1C9O A;  3CC2 A;  4B3T Q;  1TXY A;  4P75 A;  3KF6 A;  2LXK A;  5GQO A;  2JA7 H;  1HNW Q;  4K0K Q;  1SLJ A;  1SN8 A;  1NJI C;  3CCL A;  1JB7 A;  4KHP L;  1CSQ A;  4R4I A;  3H15 A;  4OO1 G;  1CKN B;  3CPW A;  5GRO A;  4DUZ L;  4GNX A;  3S2D H;  2R93 H;  3J81 c;  3U4Z A;  1IBM L;  4GLX A;  4JI0 Q;  1FJG Q;  1XNR L;  1NMF A;  5M5W H;  1YHQ A;  3I4N G;  4X6A H;  1UEB A;  1D7Q A;  4IOC A;  4DR7 L;  1JT8 A;  1A63 A;  3HOV G;  2N78 A;  1VQP A;  1Y1W H;  2PI2 A;  3GO5 A;  1YHB A;  1A0I A;  2R7D A;  4LWC A;  4A93 H;  5IP9 G;  3RN5 A;  4LFA Q;  3CCR A;  1NY4 A;  1GM5 A;  1OTC A;  3PUY A;  4JOI A;  5BR8 Q;  4DV2 L;  2IT1 A;  3AEV A;  5IYC H;  1VQ5 A;  1W3S A;  3K80 C;  2GVB A;  5LMU L;  1JJG A;  1N34 Q;  5C0X J;  1KIX A;  2VQF Q;  4HIO A;  1EIY B;  4JBW A;  2YU9 H;  4JI6 L;  3D0F A;  4AYB G;  2F3I A;  1PH4 A;  1Q1E A;  4BXX G;  3T1Y Q;  1FVI A;  2JA8 G;  5LMN Q;  3NEN A;  3BZC A;  5GAG C;  4JV5 Q;  1Y1V H;  1PH1 A;  1K9M C;  4GKJ Q;  4JI5 Q;  2N8N A;  1UE6 A;  4YCW A;  4YY3 Q;  3RLO A;  2HIX A;  2VQE Q;  4A3F G;  4NXM Q;  1OXX K;  2BA0 A;  4GKK Q;  4PMW A;  3S14 H;  1C7Y A;  2ZTE A;  1K73 C;  4HJA A;  4DK6 C;  2NN6 G;  4A3I G;  1HZ9 A;  2OCE A;  3GTL H;  3PV0 A;  4XTC S;  4BBR H;  1AE3 A;  2CKZ B;  2R7Z G;  5JEA G;  2VUM G;  2K4K A;  1SE8 A;  1HJP A;  5AJ3 L;  4DV7 Q;  1OXV A;  1H95 A;  3CF5 A;  3RR5 A;  4DR3 Q;  2CCZ A;  1X55 A;  2Q2H A;  1PH9 A;  1IBL Q;  4B3R L;  3KDF B;  2PQA B;  3NBH B;  5J3B A;  2CFM A;  3JC6 6;  1G29 1;  1N9W A;  4DR1 L;  1LTL A;  3FHW A;  5FLM G;  3KOJ A;  4P74 A;  1E24 A;  1QVC A;  4R4C A;  2NVY H;  3J81 i;  2ZM6 L;  2I0Q A;  1Q12 A;  1LYL A;  4GOP A;  2JA5 H;  4OX9 L;  4BBS H;  3STB C;  2RHQ B;  3HOZ G;  5JJI A;  4A3K H;  3I4M H;  1IBK L;  4WJ4 A;  2KEN A;  1XMQ L;  1U5K A;  3PUW A;  2K5N A;  4FDB A;  5EAY A;  1VQ7 A;  4DR2 Q;  2UU9 Q;  4LFB Q;  2MO0 A;  1SMX A;  4DV3 Q;  1OXS C;  1LUZ A;  4OON A;  3CCQ A;  4LF5 L;  4KLK A;  4X65 L;  4APV A;  1N33 L;  4JI8 Q;  1WI5 A;  4OO1 I;  3DM3 A;  5M3M H;  1AE2 A;  2V1C C;  4DV0 L;  1PHJ A;  1VQH A;  4DR6 Q;  3J80 i;  3OW2 A;  1CSP A;  4UP9 A;  2UXB Q;  1NE3 A;  2K52 A;  3T1H L;  4YHH L;  1WJJ A;  1L0W A;  4R4T A;  2IX1 A;  1K83 H;  4EX5 A;  1WYD A;  3TEH B;  1KRT A;  1A62 A;  1VQ9 A;  3I55 A;  3RZD H;  1PA6 A;  4C3J H;  3WWV A;  4LF7 L;  2R92 H;  2UXD Q;  2RCN A;  4POF A;  2UUC Q;  3CCU A;  3KJP A;  2VW9 A;  2UUB L;  4LF8 L;  4X66 L;  4DR5 Q;  4JI4 L;  4H02 A;  4PZ8 A;  1X3G A;  3ERS X;  1GVP A;  1UE5 A;  2UXC L;  2JA7 G;  4HIM A;  1MJE A;  2ES2 A;  3CCJ A;  5C4X H;  3K0X A;  3MEF A;  3GTQ H;  2YTV A;  4P71 A;  1XPO A;  2ZTD A;  2IHF A;  3EN2 A;  4B3M Q;  2R93 G;  1IXR A;  5DLQ E;  1QUQ A;  4JI2 Q;  1TWG H;  3J7Z C;  5M3F H;  1VQJ A;  2NN6 I;  2B3G A;  3HFZ B;  4DV6 L;  1KC8 C;  1PH5 A;  1S72 A;  2QGQ A;  5ELN A;  3TQY A;  2Z0S A;  3CQZ H;  5HGQ A;  1Y1W G;  5IP7 H;  5GAH C;  4DV2 Q;  4B3S Q;  3H3V I;  4ME3 A;  4A93 G;  1G6P A;  5IWA Q;  3AFP A;  4JG2 A;  5LMU Q;  1PYS B;  4QL5 A;  4DV1 L;  2JQO A;  3EIV A;  2D62 A;  4A3L H;  5IYC G;  1A8V A;  4IPC A;  4NB3 A;  4LUO A;  4A3D G;  3UDF A;  1N36 L;  4IFD G;  4J15 A;  1PYB A;  3OTO L;  4IPD A;  3PUV A;  5C0X G;  2E2I H;  2Z6K A;  2JA6 H;  1VQC A;  1Y1V G;  2QA4 A;  1VQO A;  4QGU A;  4R1J A;  2QEX A;  1TWC H;  3BZK A;  3PCO B;  3TS2 A;  2Q2U A;  3E9I A;  4L5S A;  4GNX C;  2E2H H;  4BY1 G;  2Y0S E;  1QVG A;  4O0A A;  3ULP A;  2JEA I;  1NTG A;  3PUZ A;  3F2B A;  4AQY L;  4X62 Q;  2F4V Q;  4BBR G;  2I5M X;  2PMZ E;  3E0E A;  3K7A H;  4X64 Q;  3UE1 A;  1TWA H;  4JBM A;  3J7A 5;  1PVO A;  4HJ5 A;  5C44 H;  1YJW A;  3CD6 A;  2E5L L;  3W1B A;  3PO3 H;  4A3C H;  1UE7 A;  3CP0 A;  1SR3 A;  4JI3 L;  1Q82 C;  2EQS A;  2R7Z H;  1IZ6 A;  4JOI C;  5ELO A;  2KHJ A;  4LF9 L;  3GTG H;  2ZM6 Q;  1CKO A;  3A5Z B;  1N32 Q;  3J80 c;  1AH9 A;  1X56 A;  4LF4 L;  3ICE A;  3FKI H;  2VY3 A;  4IPG A;  4LFC Q;  3GTO H;  3FP9 A;  1XMQ Q;  4JBK A;  3B6Y A;  4JYA L;  1P16 A;  2ZTC A;  2JA5 G;  3HOU H;  4BBS G;  3GTM H;  2DUD A;  4DV5 Q;  4NXN Q;  3RLF A;  1Q7Y C;  1WCM G;  2NZO A;  1VQN A;  4A3E G;  2PI2 E;  1HR0 L;  2NVX H;  3RZO H;  3S2H H;  1KL9 A;  1S3O A;  4MZ9 A;  1XMO L;  4C2M H;  2BA1 A;  3Q8D A;  1D8L A;  5C3E H;  2EXD A;  4JI7 Q;  1GO3 E;  3AQQ A;  2NVT H;  1L2F A;  2Q2I A;  4JI1 Q;  2MQH A;  3H0G H;  4C3I H;  3CCE A;  2BH8 A;  1JJC B;  5IYB H;  1UE1 A;  1G51 A;  4DNI A;  3S1R H;  1I94 Q;  1OXU A;  1HNX L;  4GN4 B;  4DR4 L;  2YTX A;  2HHH Q;  4LF7 Q;  1PFS A;  4BY7 H;  4IPH A;  1XNQ Q;  2AMC B;  1IYJ B;  3PO2 G;  1Q81 C;  1VQI A;  4AIM A;  4DV4 Q;  1GD7 A;  2R92 G;  4B3T L;  1P8L A;  2KHI A;  4UP7 A;  4A75 A;  1VQ8 A;  1BKB A;  2KCM A;  4IOA A;  1I3Q H;  2NVQ H;  4YWM A;  2ALY B;  4K0K L;  1HNW L;  1PH7 A;  2UUA Q;  1EIF A;  1QZH A;  3M3Y H;  2UXC Q;  4DUY Q;  3I7F A;  1YEZ A;  1Q1B A;  3E9H A;  4XIG S;  4IFD I;  1ASZ A;  4GOP C;  2PNH A;  4DKA C;  3L0O A;  4RG1 A;  5M5X H;  4JI0 L;  1FJG L;  3S1M H;  4GNX B;  5C4X G;  1HNZ Q;  2WFW A;  3U58 A;  4P73 A;  2VNU D;  2B29 A;  1JE5 A;  3KLW A;  3GD7 A;  1VQ6 A;  2A8V A;  5M3F G;  2L15 A;  4KI0 A;  4LUZ A;  4LFA L;  1CUK A;  1YHA A;  1L1O A;  3F1Z A;  4JC0 A;  4BA1 I;  2AWO A;  3PF4 A;  1VCI A;  1PH3 A;  2D0O A;  3HKZ G;  5IP7 G;  1KXL A;  1N34 L;  2OWO A;  2K75 A;  1Q8K A;  4LF6 L;  1YI2 A;  3PIO A;  3T1Y L;  1RL2 A;  2B63 H;  2F52 A;  4A3L G;  2OQK A;  3I4O A;  4R4O A;  3OTO Q;  5LMN L;  4JV5 L;  3KFU A;  2MNA A;  4JI5 L;  1XPR A;  4YY3 L;  1CKN A;  1I5F A;  2VQE L;  2NZH A;  4NXM L;  4GKK L;  4RMF A;  3HOW G;  1JJ2 A;  3GTP H;  3STB D;  3CPF A;  2JA6 G;  4KHP Q;  1I50 H;  3HKZ E;  4PZ7 A;  4DUZ Q;  1HZB A;  2K5V A;  3CAM A;  4A3G H;  2N49 A;  1IBM Q;  2OTJ A;  3NEL A;  1XNR Q;  5M5Y H;  2C35 B;  5IE8 A;  1KAW A;  1HR0 W;  4DR7 Q;  3OYY A;  4C3H H;  1NMG A;  4AH6 A;  1YIJ A;  3I2Z A;  4OWW B;  4DR3 L;  4LNQ A;  1HZC A;  1B70 B;  1E1T A;  1X3F A;  2A19 A;  3KF8 B;  1IBL L;  1Y14 B;  4L5Q A;  3M9B A;  4R4Q A;  4UPA A;  1M1K C;  1VQB A;  1YNX A;  3GDE A;  1K8A C;  2D0P A;  5C44 G;  3W5O A;  4IO9 A;  4DAY B;  3CC7 A;  3PGZ A;  2HQL A;  2GVA A;  3PO3 G;  5IYD H;  2CWP A;  3KJO A;  4JI6 Q;  4TVA B;  2CQO A;  1UWV A;  3ER0 A;  5FJ8 H;  5GAE C;  3D31 A;  4GN3 B;  4P72 A;  1TWH H;  3MXN B;  1VQK A;  2Y0S G;  2EIF A;  1W2B A;  2I5L X;  2ZJR A;  3FKI G;  1LM0 A;  5JJK A;  1FL0 A;  2WAQ E;  4GOP B;  1O7I A;  4YCU A;  1EQQ A;  4DR2 L;  2UU9 L;  4LFB L;  1EYG A;  3G6E A;  3HOU G;  2Z6K C;  3KYH C;  1R9T H;  2ASB A;  3PUX A;  4TQU S;  3HOX H;  1YIT A;  1Q86 C;  2ZJP A;  4JI8 L;  1XMO Q;  3DLL A;  4QIW E;  2R7F A;  4PG3 A;  3CC4 A;  4DR6 L;  2UXB L;  3RN2 A;  3HOY H;  1KHI A;  5JJL A;  5C3E G;  5AJ3 Q;  4JCV E;  3KDF A;  2PQA A;  3ULJ A;  1N8R C;  4DR4 Q;  1J6Q A;  4EQ5 A;  5E7N A;  1VQL A;  3H0G G;  2VZA A;  4B3R Q;  5IYB G;  2UXD L;  4OXP A;  2UUC L;  4DR1 Q;  4BY7 G;  2AKW B;  3S17 H;  4GLV B;  4DAM A;  3ULL A;  4A3M H;  1EQR A;  1XJV A;  3BJU A;  1J5E L;  4DR5 L;  3UDX A;  5LMN W;  1Q46 A;  3JAM i;  4OX9 Q;  2E2J H;  1IBK Q;  2WB1 E;  1MIU A;  1X6O A;  1E1O A;  1X3E A;  1XTD A;  4LW1 A;  4B3M L;  1E22 A;  3UDG A;  3CMA A;  4A3K G;  3I4M G;  1Z9F A;  1YBY A;  3A0J A;  1QVF A;  1MKH A;  1VQM A;  1HH2 P;  4LF5 Q;  1V1Q A;  4JI2 L;  4X65 Q;  2JJQ A;  3G71 A;  2OTL A;  1N33 Q;  1SRO A;  4A3B H;  2AHO B;  3U4V A;  3S1Q H;  4WJ3 M;  4DV0 Q;  2H5X A;  5FLX c;  1QUQ B;  4A3J H;  4B3S L;  4GN5 A;  3T1H Q;  3IRB A;  3PF5 A;  3S15 H;  4YHH Q;  1YVC A;  2GN5 A;  5M3M G;  4IFD J;  5IWA L;  4YCV A;  4A4I A;  3F8T A;  4IJH A;  3RLN A;  1T9H A;  4LF6 Q;  1EFW A;  1RIP A;  4A3D H;  2KCT A;  1YJ9 A;  1U0L A;  1PV4 A;  1EOV A;  2AWN A;  2A1A A;  3AFQ A;  2DGY A;  1X54 A;  4QY7 A;  3PIP A;  2VS1 A;  1K8G A;  2UUB Q;  2B63 G;  4LF8 Q;  1WFQ A;  4X66 Q;  3K7U C;  4JI4 Q;  1PH6 A;  1YJN A;  2ATW A;  2JK8 A;  2K5H A;  1OXT A;  3CCV A;  4GLA C;  2ID0 A;  2YV5 A;  4BY1 H;  3K8A A;  3F2C A;  1YZ6 A;  3I4N H;  3J81 j;  4AYB E;  3KF6 B;  3CCM A;  3K81 C;  1B7Y B;  5GAD C;  4YWK A;  5C4J H;  3HOV H;  5H1S E;  4HID A;  1MJC A;  3S24 A;  5C0X I;  2HT1 A;  4A3G G;  2JA9 A;  3CME A;  2HIV A;  4X62 L;  1QZG A;  5IY0 A;  4L5T A;  2F4V L;  5IP9 H;  1K3R A;  4DV6 Q;  4X64 L;  3M85 A;  3L7Z C;  2N3S A;  2IHE A;  2RHS B;  3UDI A;  1VQD A;  2K14 A;  4HJ9 A;  1X9N A;  1HZA A;  3GTJ H;  3NEM A;  3S16 H;  5BR8 L;  1I6H H;  2XGT A;  1L1O C;  2KBN A;  4DV1 Q;  4BXX H;  1BVS A;  4HJ7 A;  1N32 L;  2JA8 H;  1S40 A;  3TS0 A;  2VQF L;  3RNU A;  3A74 A;  4L5R C;  1BBW A;  5IYD G;  3LGJ A;  3M7N A;  3CCS A;  4GS3 A;  3BU2 A;  4LFC L;  4HJ8 A;  4A3F H;  1N36 Q;  1X65 A;  4LUV A;  5FJ8 G;  2RF4 A;  1WCM H;  1VQE A;  4NPS A;  3M4O H;  2JE6 I;  4IJL A;  2CWA A;  4A3E H;  3TRZ A;  4GKJ L;  3VDY A;  3F2D A;  5JEA J;  4NXN L;  4DV5 L;  4A3I H;  3W1G A;  4ALP A;  3S1N H;  1Z47 A;  2E8G A;  3H3V H;  1B8A A;  3M4Q A;  2MFI A;  2VL6 A;  1SRU A;  2VUM H;  3HOX G;  1FGU A;  4DPG A;  4JI7 L;  3JAM c;  4HIK A;  4POG A;  4AQY Q;  2JEB I;  4JI1 L;  2YYZ A;  3HOY G;  2MO1 A;  3AYH B;  4MNO A;  4DV7 L;  3U50 C;  3PO2 H;  1I94 L;  4DK3 C;  2K50 A;  3M4P A;  4PZ6 A;  2HHH L;  2OQ0 A;  3ZJY C;  5FLM H;  1JMC A;  1EUJ A;  2Q2T A;  1XNQ L;  4QJF A;  2WAQ G;  1E3P A;  2E5L Q;  3PSI A;  1TWF H;  3CXC A;  4JI3 Q;  4DV4 L;  2FXQ A;  1V9P A;  1NBW A;  1J5E Q;  3G48 A;  3TRE A;  1PH8 A;  1EWI A;  3A5U A;  1GKH A;  4LF9 Q;  4OWT B;  4UY8 C;  4O2D A;  4OWX B;  3HOZ H;  4LF4 Q;  4A3C G;  5HY6 A;  4YWL A;  5IT9 c;  4A3M G;  2LSS A;  2WP8 J;  4MTN A;  4A76 A;  1ASY A;  2UUA L;  4DUY L;  2BH2 A;  3CW2 C;  4KHZ A;  4JYA Q;  1E7Z A;  3G4S A;  2R6G A;  1PH2 A;  1VQG A;  2IX0 A;  1BBU A;  1HNZ L;  4DV3 L;  1KD1 C;  1HR0 Q;  4BA2 I;  4JBJ A;  1KQS A;  2I5H A;  2ZJQ A;  2XTI A;  3SGI A;  3UE0 A;  1V43 A;  3L2P A;  3I56 A;  4A3B G;  1KRS A;  1C0A A;  4UP8 A;  4Y7N H;  1WOC A;  1CKM A;  2YTY A;  4A3J G;  1SFO H;  3GTK H;  1K0R A;  2IY5 B;  2LXJ A;  1HNX Q;  5K36 G;  1L1O B;  1VQF A;  2WB1 G;  1DGS A;  3EBE A;  1XPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...