3PO2H

Arrested rna polymerase ii elongation complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3po2H00
4BXXG 1HR0L 4A3KG 1EWIA 3PGZA 2QA4A 3H0GG 3I4OA 2DUDA 2NN6I 4PZ7A 3OYYA 3HOVG 1PH9A 2YYZA 2NVXH 3PV0A 4NPSA 2VS1A 3MEFA 3OTOQ 3J81j 2ZM6Q 4HJ5A 1IBKL 2VNUD 1H95A 2BA1A 4JCVE 4POGA 3HOZH 4A3DG 2R93H 1E1TA 4GN4B 4JBKA 3E9IA 1PHJA 1HNZQ 4KI0A 2I5LX 3ERSX 3HKZE 3EN2A 4X66L 2A19A 4JI6L 3PCOB 4JI3L 4C3HH 5IYDG 1QZGA 4GS3A 1X6OA 2JEBI 4PG3A 4JI7L 4B3RQ 3E9HA 4P71A 3CC2A 2NZHA 4LUVA 1PH2A 1Q46A 1CUKA 1PYSB 1X3EA 1P8LA 2JJQA 3G4SA 4GNXC 2E8GA 3BJUA 3HOYG 2AWOA 1WCMH 3ICEA 5C4XH 2ASBA 3M4PA 3KF6A 3CXCA 2VUMG 1EUJA 4YY3L 5M5WH 2YTXA 4AYBE 4Y7NH 1UE7A 2QGQA 4YHHL 2OCEA 1YHBA 3AFQA 5C44G 4DR1Q 1IBLQ 5IWAL 3PO2H 1VQDA 3T1YQ 1SR3A 2KHJA 2HHHQ 1I94L 1NMGA 1N33L 1NE3A 2LSSA 4JI2L 3CCJA 3UE0A 1PH6A 3DLLA 4DV5L 4OO1I 3GTLH 4JG2A 4ALPA 3E0EA 3M3YH 4DV4Q 5FLMG 5C3EH 4L5TA 1GD7A 2KCTA 4DUZL 3W1BA 4JI4L 1I6HH 3GTJH 3GTOH 1VQBA 1K8GA 5M5YH 4JYAQ 5LMUQ 4LF5Q 4A93G 2D0OA 3I4MH 3PO3G 3CCVA 1CKOA 3CCMA 3TS2A 2B3GA 3JC66 4QY7A 4APVA 4B3ML 3H3VH 4K0KQ 2K52A 2XTIA 4IJHA 1KIXA 5EAYA 2KCMA 2IHEA 1U0LA 1MKHA 1EQQA 1VQMA 1VQGA 1KAWA 1V43A 1X55A 4IPHA 4QJFA 4A3MG 2MO1A 5GAEC 1K9MC 4DUYL 2UUBL 3HOXG 4B3SQ 2VQFQ 3ZJYC 3F2DA 3S1RH 1PA6A 3S1MH 4R4OA 4JI8L 1KL9A 3MXNB 3RZOH 1VQ8A 1A63A 3U50C 2A1AA 1EFWA 4A76A 1VQCA 2YTYA 4RMFA 1GKHA 3T1HQ 1XMOQ 5LMNL 4A3JG 2QEXA 2JA8G 3KLWA 4X65L 1V1QA 4DV6Q 4BY7H 1YJ9A 3KDFA 4LF9L 2ID0A 1OXSC 2HQLA 2N78A 4YWMA 3HOUG 4A3IH 4UP8A 3J81c 1HR0W 5BR8L 3F2CA 4DAMA 2IX1A 1BVSA 1T9HA 2N3SA 3KDFB 4HIMA 1XTDA 3CMEA 1S72A 1XNRL 4DV1L 3STBD 5AJ3Q 2JQOA 4A3GG 1YEZA 3L2PA 4A3BG 1IXRA 4DAYB 1Y1WG 2LXJA 2B63H 5IYBG 1OTCA 2ZJRA 2PMZE 3B6YA 3KF8B 3FP9A 4IPCA 5DLQE 4AYBG 4DV2L 1R9TH 1HNXQ 1SRUA 1SE8A 4HJ9A 4BY1H 2HIXA 2Y0SE 1PYBA 2IY5B 2KENA 3ULLA 2AMCB 3RLNA 1CKMA 1B70B 2K5NA 2GN5A 1CSQA 3K81C 2A8VA 1Q82C 1E1OA 4KHPQ 1XJVA 2EXDA 4JOIA 3S15H 1AH9A 1J5EL 2OQ0A 3Q8DA 2PQAA 3S16H 4DV7L 1X56A 4GOPA 4OX9Q 2UXBL 1ASZA 4GN3B 4MNOA 4RG1A 2PNHA 4B3TQ 2VL6A 2PQAB 4BBSH 4A3LG 1JT8A 3KOJA 5E7NA 1Q8KA 4GOPB 1PH4A 2F4VL 3FHWA 2R92H 2JA7G 1JMCA 1TWGH 1EIFA 1SLJA 2NVYH 4LF4Q 4HJ7A 3PUYA 4LF8Q 1B7YB 4JI1Q 3KJOA 3SGIA 5FJ8H 1VQ9A 3PUXA 2KHIA 1HNWQ 2I5HA 1VS0A 1WJJA 3FKIG 4TQUS 4XTCS 4A3EG 3M7NA 2F52A 2ALYB 1VQPA 2JK8A 2V1CC 4A4IA 3OTOL 2ZM6L 3J7ZC 2K5VA 3F1ZA 2JA6G 1XMQQ 2I0QA 5ELOA 4GLXA 3S2HH 4NXMQ 2Q2HA 5JJLA 3U4VA 1S40A 1HNZL 5M5XH 1SROA 4YWLA 1E24A 4HIOA 4AQYQ 3K0XA 2R7DA 2IX0A 2HIVA 1Z9FA 1LM0A 4GKJQ 2UXCQ 1UE6A 2UU9Q 1D8LA 1Q12A 4OWXB 4JI3Q 5IP9H 2R7ZH 2R7FA 4DR6Q 3I4NG 2R6GA 3HOWH 3PF4A 1YBYA 1BBWA 1N9WA 3L7ZC 1DGSA 1Z47A 1YJWA 4O2DA 4QIWE 1M90C 4BXXH 4A3KH 4QGUA 3GO5A 3WWVA 1NJIC 2VY3A 3H0GH 3KF6B 4OO1G 3TRZA 2BH8A 3HOVH 1CKNA 2I5MX 2N8NA 5J3BA 1Y1VG 4DKAC 3STBC 1YIJA 3HFZB 4DR1L 1P16A 3I56A 1IBLL 4HIKA 1PH7A 4JI5Q 5LMNW 1XNQQ 3T1YL 4A3DH 3J7A5 4X6AH 2HHHL 1C9OA 4JC0A 4KHZA 1L0WA 3TREA 1CKNB 3GTPH 1VQEA 3H3VI 4DR7Q 2E2IH 4UPAA 5IYCG 2CFMA 4R4CA 3TS0A 1IBMQ 4L5SA 2Y0SG 4X62Q 1FJGQ 2FXQA 1KHIA 4NXNQ 5IYDH 2IT1A 1N36Q 1OXVA 1K73C 1G6PA 1HH2P 1UEBA 5FLXc 1HZCA 2K14A 3RN2A 1QVCA 4DV4L 3GTKH 2JA9A 1PH8A 3RZDH 1XPRA 4JBMA 1UE5A 1VQ7A 3GTGH 4JYAL 3M4QA 4LUOA 1K0RA 5LMUL 4DR3Q 1A62A 4LFAQ 4LF5L 1VQ6A 4BA2I 4GLAC 3U4ZA 3HOYH 4H02A 4DR2Q 1OXTA 3K80C 3A5UA 3PF5A 4IJLA 1HZBA 2MNAA 4LFCQ 4K0KL 2Z0SA 1BBUA 1HZAA 1JB7A 2UUAQ 1PV4A 4A3FH 4JBJA 4UY8C 1KRTA 2ES2A 4DR4Q 4GKKQ 1OXXK 3CCLA 4IOAA 4JV5Q 5C0XG 3CPWA 1Q7YC 1QVGA 1B8AA 3J80i 1YITA 3EIVA 1MJCA 4B3SL 2BA0A 3JAMi 4LF7Q 4DV3L 3ER0A 4BBRG 2VQFL 1MJEA 3RR5A 2UUCQ 2UXDQ 4LF6Q 5C0XI 3D0FA 4YCVA 3EBEA 2CCZA 3M4OH 1N34Q 1WYDA 2YTVA 4LW1A 4A3CG 2IHFA 2D0PA 1TXYA 3I7FA 5JEAG 2ZJQA 3A74A 5FLMH 3T1HL 1XMOL 4LFBQ 3OW2A 1YNXA 4KLKA 1EQRA 4OWTB 2E2HH 1Q86C 4YCUA 3CCSA 3NEMA 4DNIA 4POFA 1PH5A 3M85A 3BU2A 4DV6L 1TWAH 1WFQA 5M3MG 4DR5Q 1VQFA 4A93H 4C3JH 4OWWB 3PO3H 1VQJA 3LGJA 4GOPC 5M3FG 5HGQA 1W2BA 1MIUA 2MQHA 3HKSA 4IPDA 2RHQB 2D62A 4UP9A 4IFDG 4MZ9A 5AJ3L 2GVAA 4A3MH 1JJCB 3L0OA 2PI2A 2ZTDA 4PZ8A 3HOXH 4IFDI 4DV1Q 2WB1G 3J80c 5GADC 1N32Q 1HNXL 2RHSB 2Z6KA 2JA5H 4DV0Q 2Q2IA 2H5XA 3A0JA 4R4TA 2ATWA 2OWOA 3KFUA 2WFWA 3NENA 3F2BA 4DV2Q 1UWVA 3IRBA 3PSIA 1I3QH 4QL5A 4P74A 4JI0Q 3HOZG 1QUQA 2R93G 4HJ8A 4KHPL 4OONA 1AE3A 1RIPA 1KQSA 2JA8H 3NBHB 3AFPA 2NVQH 2RCNA 4R1JA 2EQSA 3S1QH 1TWCH 4OX9L 1QVFA 1VQKA 1WOCA 3HOUH 1A0IA 2VQEQ 4ME3A 2E5LQ 1VQIA 3S2DH 3W1GA 1YI2A 2L15A 4B3TL 5HY6A 1HJPA 3UDIA 1N8RC 4C2MH 1SN8A 2RF4A 2BH2A 3ULPA 4HJAA 1C0AA 3A5ZB 3GTMH 5IP7H 1VCIA 2AHOB 4A3GH 4X64Q 1PFSA 4LF4L 4LF8L 4A3BH 3PUWA 4JI1L 1Y1WH 1WCMG 3M9BA 4R4IA 5IYBH 1HR0Q 2EIFA 1TWFH 1A8VA 1Q81C 2YU9H 5C4XG 1L1OA 3G48A 3UDFA 1FVIA 4L5RC 1VQOA 4QQBX 3K7AH 1NMFA 3ULJA 1IBKQ 4DPGA 5ELNA 2E2JH 1L1OB 3S24A 3RN5A 4LWCA 2CKZB 3K8AA 4O0AA 5GQOA 3RLOA 3KJPA 3PO2G 1Y14B 3I55A 1XMQL 2OTJA 3VDYA 4NXML 3UDXA 4B3RL 1VQHA 4X66Q 1K83H 1YJNA 4JI6Q 1Q1EA 1X3FA 3PUVA 1X9NA 1W3SA 3CPFA 1NBWA 1VQ5A 4JI7Q 3TQYA 1K3RA 2PI2E 4HIDA 4AQYL 1U5KA 4GKJL 2UXCL 5C3EG 3RNUA 2B29A 2N49A 4A3LH 2UU9L 1EIYB 1XPOA 2JA7H 4DR6L 1EOVA 1EYGA 4J15A 5GAHC 5JJIA 2VW9A 1RL2A 2CWAA 2WB1E 2C35B 2NZOA 5IE8A 4IOCA 4EX5A 4A75A 2OTLA 3I4MG 1JJGA 1K8AC 3S17H 4L5QA 4JBWA 1PH1A 3FKIH 5GROA 1E7ZA 4YY3Q 4A3EH 1G51A 1YHAA 4BA1I 1S3OA 2KBNA 4YHHQ 1LUZA 3CC7A 1CSPA 5IWAQ 2JEAI 2JA6H 4JI5L 4DK6C 1XNQL 4A3FG 1I94Q 4Y52H 4TVAB 1NTGA 3RLFA 1N33Q 4JI2Q 4YWKA 5C0XJ 4DR7L 1X65A 3NELA 2VZAA 4DV5Q 1FL0A 1IBML 4FDBA 4X62L 1FJGL 1LYLA 4NXNL 2Q2TA 4NB3A 1KXLA 1N36L 3CMAA 3D31A 1NY4A 1AE2A 1D7QA 3GTQH 4DUZQ 5K36G 4EQ5A 4GNXA 4JI4Q 3G6EA 1WI5A 3CQZH 1JE5A 5JEAJ 3I4NH 2WAQG 4IO9A 1OXUA 2VUMH 4BY7G 2MO0A 4DR3L 2CQOA 4LFAL 4C3IH 2HT1A 3S14H 3CW2C 2F3IA 4A3IG 4GNXB 3CCQA 4DR2L 4P73A 4B3MQ 4PMWA 5C44H 3KYHC 1VQ4A 1J6QA 4LFCL 1IZ6A 3J81i 1YVCA 2UUAL 4DR4L 4LNQA 4GKKL 2Q2UA 1O7IA 3BZCA 4IPGA 3CD6A 2MFIA 4JV5L 1Y1VH 4AH6A 2UUBQ 1Q1BA 3PUZA 1I50H 4DUYQ 4R4QA 2GVBA 2WP8J 4AIMA 2B63G 2K50A 2XGTA 4LF7L 4OXPA 5IT9c 2UUCL 4IFDJ 4P75A 2UXDL 4GN5A 1PH3A 4JI8Q 4LF6L 1V9PA 5JJKA 5IYCH 1N34L 2K75A 3F8TA 4BY1G 2K5HA 4DK3C 4DV3Q 5H1SE 1GVPA 2Z6KC 2OQKA 1I5FA 1IYJB 3CCUA 4JOIC 5LMNQ 4LFBL 1VQNA 3AEVA 3GDEA 2ZTEA 3PIPA 2JA5G 1C7YA 4X65Q 1BKBA 2CWPA 3I2ZA 1M1KC 2JE6I 3CC4A 1IL2A 4WJ4A 4LF9Q 3GD7A 3CCRA 2K4KA 4DR5L 1YZ6A 4LUZA 3TEHB 5BR8Q 1XPUA 3HKZG 4P72A 2ZTCA 3PIOA 4BBSG 4PZ6A 1E22A 1X3GA 5IY0A 4XIGS 3AQQA 1ASYA 1XNRQ 2AWNA 1SFOH 3DM3A 1SMXA 2R92G 3W5OA 1L2FA 1VQAA 3JAMc 1JJ2A 1QZHA 5FJ8G 4BBRH 1VQLA 5IP7G 2DGYA 5C4JH 1N32L 1TWHH 3UE1A 4A3JH 4A3CH 1E3PA 1G291 1L1OC 2AKWB 4DV0L 3CAMA 3G71A 4JI0L 2WAQE 3AYHB 1QUQB 2YV5A 1PVOA 4GLVB 1LTLA 1UE1A 1HZ9A 4YCWA 1YHQA 1J5EQ 3BZKA 1KC8C 1X54A 4DV7Q 1GM5A 1KRSA 1KD1C 2NVTH 2UXBQ 5M3MH 3S1NH 4WJ3M 3UDGA 1GO3E 2ZJPA 2VQEL 5M3FH 2E5LL 1FGUA 3H15A 2F4VQ 2LXKA 4MTNA 5IP9G 5GAGC 3U58A 2R7ZG 1HNWL 3HOWG 3CP0A 3CF5A 4UP7A 3CCEA 4X64L 2NN6G 3K7UC
chains in the Genus database with same CATH superfamily
4IZ8A 2QA4A 1MBYA 3OYYA 4EGVA 3OMGA 3C1EA 2K5DA 2VS1A 2RDFA 3P7JA 5CGKA 2BA1A 4OGQC 3HOZH 5DM73 4GN4B 1EOTA 1SNDA 4DK0A 3T4AC 3HKZE 4JI6L 2HCCA 4C3HH 1PRTB 4TKOB 3S17B 5KNBA 1SE4A 4HEDA 2VXWA 3BVZA 1TY0A 2E2IB 1X3EA 1P8LA 2FFKB 2E8GA 3HOYG 2HDMA 5TSSA 2K32A 3QWNA 5C4XH 3CXCA 3KF6A 2NWGA 1EUJA 5BN3A 5M5WH 2YTXA 1FNUA 4Y7NH 2QGQA 1CT1D 1TR5A 3DM1A 5C44G 3PO2H 1VQDA 1DZ1A 3CQZB 1N33L 1WTWA 1T5EA 3GV3A 2F0PA 3DLLA 4OO1I 1B44D 2B2TC 4ALPA 4I7AA 5C44B 5FLMG 4L5TA 2AQ2B 2KCTA 3A7AB 1Y8NB 4F7XA 2B2YC 3GTJH 3GTOH 5M5YH 2NZ1D 4LF5Q 2PMZB 2XNAC 3AB9A 3TS2A 5LL6X 4XDXA 3TP5A 5IGCA 3EJIA 1JCKB 2E2HB 1VQGA 1WTXA 4QJFA 1X55A 1K9MC 2B2VC 5GAEC 4DUYL 1R4QB 2EYLA 3NWSA 1B3QA 2SNSA 3S1MH 1JR0D 5D65A 1VF5C 2LY7A 2YTYA 4RMFA 3T1HQ 4A3JG 4HMJA 3MAQA 4FF2A 3OMCA 1ICWA 4X65L 1KDCA 3KDFA 4FNFA 5CV7A 4ZQ3A 4BBRB 1HR0W 3M7GA 2IX1A 1SNCA 1XXGA 4A3JB 2PZWA 1XTDA 1UEAB 4DV1L 4A3GG 3L2PA 1WTOA 2I07B 1AW7A 1A2TA 4DAYB 2B63H 1E2ZA 2PMZE 4IPCA 1RTOA 1SRUA 4DK1A 5M3MB 4R8IA 4HJ9A 2L55A 2A69C 2IY5B 3ULLA 2F0HA 2K5NA 3K81C 1SE2A 5JPMC 1EYAA 2OQ0A 5DAUA 1PRTC 4DV7L 1IW7D 1ZYRC 4N8FA 4GN3B 4ZK9B 4MNOA 3NUCA 4LK1C 1SYEA 4K8JA 4F87A 4A3LG 3KLSX 5E7NA 1Q8KA 2F4VL 1Y69U 2R92H 2JA7G 2F3VA 2J7ZA 3OWFA 4LF8Q 3KJOA 1H9KA 1VQ9A 1A3VA 1VS0A 4XTCS 1LACA 2JA7B 4C3HB 1YNNC 2BE5D 2EJFC 4DNTB 1XMQQ 5ELOA 2Q2HA 2Z1CA 5KNDA 2RSOA 2P5ZX 3LX0A 1KDAA 2A68C 2L0CA 2R7DA 1TS2A 1E2VA 1FD7D 1D8LA 5M5WB 4K2LA 3QOJA 4Y7NB 4NKLA 3PF4A 2Q8RE 3PO2B 1TVXA 4O2DA 3ZYYX 3VR6A 1M90C 4BXXH 4A3KH 1A6XA 2VY3A 1EL0A 4OO1G 5ELDA 3SK6A 2MP1A 2I5MX 5I9PA 5IOCA 3I56A 3J7AF 1XNQQ 5LMNW 4A3DH 3FPPA 3J7A5 1C9OA 4JC0A 1L0WA 3GTJB 3GTPH 1CKNB 4DR7Q 3H3VI 4GZYC 4RCNA 5IYCG 2CFMA 5FLXE 3C46A 1FJGQ 3X3NA 1F9PA 5IYDH 2IT1A 2PCFB 1N36Q 5DNFA 1OXVA 2KEEA 3DEOA 1VQ7A 1O7YA 4LF5L 3GP7A 4BA2I 2L4NA 1F2MA 1O7ZA 3S1MB 3D4DA 3PF5A 4IJLA 2MNAA 1I4HA 2Z0SA 1HZAA 1BBUA 2AQ1B 1VMCA 4JBJA 4JV5Q 2PPBC 1LABA 4JPBW 3CPWA 1WTVA 3EIVA 3JAMi 4DV3L 3ER0A 2UUCQ 5IT9L 3MC0B 3RR5A 3HZXA 1ENCA 3K57A 3D4RA 1I4RA 1WYDA 5K36H 1Z7TA 1TXYA 5JEAG 2ZJQA 3T1HL 1YNXA 2G9DA 5JJZA 3M85A 1TWAH 1TWHB 2B2YA 4G4KA 2LMCB 1MSHA 4KV6A 3LGJA 5HGQA 1W2BA 4RFBA 1FR3A 3PMFA 4IPDA 5I9OA 4ZKCB 3J80L 1SJHD 4IFDG 4MZ9A 3EA6A 1HTLD 1GXDC 1TQOA 2PI2A 4PZ8A 4HTHA 3HOXH 5LHY1 1TKWB 4IUPA 4KKUA 3Q22A 5DM63 2Q2IA 3NBHA 2ATWA 2WFWA 3F2BA 2J4XA 4L8JA 5C3XA 3ITPA 4HJ8A 3NBIA 1HXYD 1BOSA 3AFPA 3K5MA 2NVQH 2XWJB 2RCNA 3S1QH 1A0IA 4ME3A 2LS01 5A35A 4RKBA 2RF4A 2BH2A 2QILA 1EU3A 3A5ZB 4MTKA 1VCIA 3NWTA 4LF8L 3M9BA 4R4IA 1HR0Q 5IYBH 2YU9H 1CFMA 1Q81C 2XRQD 4N9PA 4L5RC 4QQBX 1NMFA 4I65A 1IBKQ 5ELNA 2E2JH 3RN5A 4O0AA 4DXGA 3I55A 1XMQL 2OTJA 3VDYA 2NBFA 4RGTA 1TS5A 3UDXA 1K83H 3K59A 4ID6A 1PRTF 1X9NA 1W3SA 4CBVA 4A3KB 1NR2A 5C3EG 1I4XA 3RNUA 5BN4A 1C8CA 5EQ0A 3NQIA 1EOVA 3I4LA 2C35B 5IE8A 4A75A 4EX5A 1EEID 4A3DB 5ELBA 2E75C 5T1GA 2A5HA 2CH4W 3FKIH 1G51A 1BCPF 3NSWA 3A8KE 4ZCKA 2SNMA 2JA6H 5FO8B 1XNQL 4TSSA 2EY6A 1NTGA 3RLFA 2K01A 4DR7L 5I6YA 1FJGL 1LYLA 4WORA 4DNRB 3WDNA 1N36L 1NY4A 3GTQH 5K36G 4EQ5A 3VYRA 3G6EA 2F0WA 1WI5A 2E76C 1JE5A 3I4NH 2WAQG 1OXUA 1AEXA 2MO0A 3TZDA 4C3IH 1HA5A 1B9NA 4A3IG 4GNXB 4PMWA 3J81i 1IZ6A 1PZJD 1M4VA 2Q2UA 1O7IA 4JV5L 1VDZA 1Y1VH 4KN4C 2K50A 2XGTA 4OXPA 5IT9c 1STBA 3H91A 4A3IB 2UUCL 3ND9A 5FKAC 1D1IA 1GUGA 3CCUA 5LMNQ 1JQYD 3AEVA 1WD0A 3BVMA 1C7YA 1GOZA 4WJ4A 4XQJA 1CQVA 3HOXB 1QJOA 1B1ZA 1G91A 4P72A 1SNOA 2L12A 4BBSG 4PZ6A 4PNYA 1ASYA 5IY0A 1XNRQ 3W2DA 2DNEA 5C0XH 2ZXOA 4MN3A 1PTOD 2OF1A 4ZUJA 2Z9HA 2NVQB 2DGYA 3UE1A 3S1QB 3OWEB 4A3CH 1TT2A 1DOMA 2WAQE 1QUQB 2YV5A 1PVOA 1YHQA 1HZ9A 3SK4A 1KRSA 3H94A 1O7LA 2B2WC 2KECA 3UDGA 1GO3E 1LTBD 1F9SA 4QB4A 1FGUA 4AYBB 4MTNA 5IP9G 3I90A 2R7ZG 3HOWG 1S5FD 2BDNA 2NN6G 1MJEA 3MXUA 3OSOA 3VYUA 2EJMA 1HR0L 5JVG3 3PGZA 4TRDA 3I4OA 4PZ7A 1GHJA 2K1BA 3HOVG 2NVXH 3HOWB 3MEFA 4DAPA 1IBKL 3K5NA 3E9IA 4J6HA 1PHJA 1HNZQ 5KGUA 4Q5VA 3CRLC 3EN2A 2NUCA 2WINB 1QZGA 4RCOA 4GS3A 2JEBI 1IYVA 2M2LA 3E9HA 2NTTA 3K58A 3CC2A 3G7LA 4G7OC 2NZHA 1SBBB 1PYSB 2JJQA 1FNWA 4GNXC 2DY8A 3QOLA 2AWOA 1WCMH 3ICEA 2F0QA 1JB3A 3M4PA 1CA6A 1DONA 4AYBE 3R93A 1UE7A 2OCEA 1H9RA 5CV8A 2BDOA 4DN4M 4JK1C 4DR1Q 4CDEC 1PDQA 3GTQB 2A6ED 1NMGA 3I4NB 2LSSA 2KOLA 1EIHA 3GTLH 4YIJA 4G57A 1D5MC 4WFN3 2F0EA 4CKBA 3SK5A 1GD7A 3T53B 5KIXA 4EQNA 4JYAQ 1Y1VB 4B9XA 5LMUQ 4C3JG 2CQAA 3I4MH 3PO3G 3CCVA 1CKOA 3CCMA 2FJ2A 3I70A 3JC66 4QY7A 4CDCC 4K0KQ 4PV1C 2E74C 2AUKA 1RTNA 2QDLA 5EAYA 1KIXA 1DD2A 3R8BA 4RH6A 1MKHA 3MA2B 1VQMA 1V43A 3MXNA 4IPHA 4B3SQ 1S5BD 3ZJYC 1AZQA 4HAEA 4R4OA 5C3WA 1XX8A 1ET9A 2EVBA 1KL9A 1VQ8A 1BDOA 3HGBA 1I6VC 3MFGA 5LMNL 3VR3A 2BE5C 4BY7H 1SYCA 1OXSC 3HOUG 1O78A 1WTRA 2B2UC 3V2TA 3Q0AA 4DAMA 1PTOH 1BVSA 1T9HA 3K5OA 3NTHA 2O5IC 3CMEA 1XNRL 3KF8A 3TMEA 1PZID 1L0YB 2IWHA 4A3BG 3K0YA 1IXRA 1Y1WG 3HOUB 3E0JA 5L37A 2MUYA 4BS9A 4DV2L 2F1MA 1HNXQ 4BY1H 2TSSA 2EY2A 3HEJA 1B70B 2QW7A 2Q8TA 1Q82C 3X3MA 5EBDA 3Q8DA 2PQAA 1X56A 2RDHA 4GOPA 3MXGA 5T1IA 1ASZA 1G2SA 2N88A 2RVLA 1U4RA 3CKIB 4I7ZC 1CM9A 3LWUA 3MHBA 1JMCA 2NVXB 2NVYH 4OELB 4CJ0B 3DEPA 1B7YB 4JI1Q 5KNCA 3SGIA 4ABNA 5FJ8H 2KHIA 1HNWQ 4OEMB 3OOCA 2K05A 1WJJA 3IAYA 1LTSD 2F52A 2JK8A 1SMYD 3J7ZC 3F1ZA 1RHPA 3FEWX 4K6LA 1ENAA 5DEHA 3U4VA 1KNEA 5I4DA 1S40A 1HNZL 3Q23A 4YWLA 3L9AX 1WCMB 5JVH3 3P1HA 4IUVA 2HIVA 4CKCA 4GKJQ 2JSOA 2UU9Q 1Q12A 5IGEA 5J39A 4JI3Q 2R7FA 1CHQD 1BBWA 3L7ZC 1Z47A 2CHBD 1H9SB 4IUUA 3TP6A 4K5VA 3GO5A 3H0GH 3S9WA 2BH8A 2N8NA 5ISRA 3STBC 4DR1L 2MHVA 1PH7A 4X6AH 3DWAA 1HFGA 3TREA 1VQEA 4M1UB 3TS0A 3I4MB 1KHIA 1K73C 1G6PA 2K14A 1PMRA 3E6ZX 1XPRA 3KBGA 1LTGD 3KUPA 1EY5A 3VA7A 1EZ8A 4DR3Q 5LMUL 4JYAL 1VQ6A 1PFBA 4IN3A 4K14A 4K2KA 3K80C 1A3UA 5ELFA 1PZKD 4NW2A 4K0KL 4LFCQ 4OHJA 3KK7A 3PQIA 1OXXK 4V0BA 1QILA 4R9WA 1B8AA 4B3SL 2BA0A 4LF7Q 4MHEA 4RAUC 4BBRG 3MZ5A 2H4OA 5IT9E 4YCVA 1WTQA 3EBEA 4KHVA 4BY7B 1EQTA 2YTVA 4DGZA 3R2TA 1PTOB 3A74A 2EPBA 2B39A 4ZKBB 4OWTB 3CCSA 1PH5A 3BU2A 4A93H 5M3MG 4DR5Q 5ELEA 3DXJC 3A8JE 4KY6A 1NR4A 1M8AA 4U673 4BY1B 2D62A 4UP9A 2XSCA 3J80E 1WVLA 2C5CA 2DY7A 4A3MH 3L0OA 2PYKA 4IFDI 2EYFA 4RGMA 1HNXL 2LFNA 4DV0Q 1STHA 4JVZA 3A55A 2OWOA 1JOQA 1MD2D 3PSIA 3HOZG 1ZXTA 1QUQA 4XQQA 2IJ0A 1VF7A 2ZT9C 2JA8H 1SNMA 2RQXA 1QG7A 2EQSA 4R1JA 4FXKC 1TWCH 1VMPA 4C3HG 1WOCA 2E5LQ 3W1GA 3HOZB 2D9UA 3ULPA 2EYPA 1EIGA 1QE6A 5G3LF 3PUWA 4JI1L 1K0SA 2QKIC 4C1NI 1A8VA 3FRPB 5C4XG 3UDFA 3G6JB 1FVIA 4IALA 1RODA 1AFPA 2FMMA 1L1OB 3N52A 3KJPA 3K8AA 5GQOA 2WACA 3PO2G 1Y14B 1ILPA 5C4XB 2PZUA 4CHTB 3PUVA 3CPFA 1NBWA 4HIDA 1K3RA 2V4DA 1U5KA 4GKJL 1BO0A 2N49A 3H0GB 2UU9L 1EYGA 3SDZA 1RL2A 2CWAA 4FF3A 1K8AC 4L5QA 5GROA 2F0LA 4A3EH 3OIPA 2KUMA 1II3A 1QNKA 1YHAA 2KCCA 4BA1I 5E4WC 1S3OA 3GTOB 5M5YB 1LUZA 5IWAQ 4DK6C 5JOBA 4TVAB 1TS4A 4JI2Q 5C0XJ 3NELA 2O4XA 1FL0A 1ONLA 1PTOC 1Y8PB 4NB3A 4K8IA 3D31A 4HSVA 3U9OA 1AE2A 4CJ1B 3PIO3 4XYQA 1D5ZC 4DU9A 2VUMH 4DR3L 2C9OA 2HT1A 1LTID 2EY5A 3CW2C 5HURA 2F3IA 3O13A 1TU2B 4B3MQ 2PQEA 1I4QA 4DF7A 1VQ4A 1J6QA 1FYCA 4LFCL 1HCZA 1YVCA 4LNQA 5IGBA 4NMZA 2J0TD 3BZCA 3CD6A 4MIUA 4AH6A 2SDFA 1Q1BA 1I50H 2B63G 3VYTA 4LF7L 3T51B 4P75A 1W6KA 4JI8Q 1YNJC 2B2TA 4O42A 2DJFC 2F0OA 2K75A 3F8TA 2AQ3B 1SYFA 2Z6KC 5C4HA 3QR8A 1IYJB 4JOIC 2B63B 1VQNA 2XVSA 3HG9A 1BKBA 1PFNA 1TS3A 3I2ZA 1CK1A 2JE6I 1M1KC 3CC4A 4LF9Q 4A3MB 4DR5L 3BS1A 4IQZA 5EKLA 4KD3A 4LUZA 2EYHA 5BR8Q 3J81L 3N6RA 4L63B 1NAPA 3TBIB 1X3GA 2R92G 2B2VA 1SFOH 3TN2A 1JJ2A 3JAMc 2PO4A 3ERQA 2M9VA 3A7LA 4QUFA 1TWCB 3D4WA 2R92B 1E3PA 1L1OC 1G291 4DV0L 1A3TA 4N9TA 2KVMA 1UE1A 3BZKA 1KC8C 1X54A 3EQLC 4V190 2UXBQ 1SXTA 4WJ3M 1KDBA 1STAA 2A6EC 5M3FH 2E5LL 2HQEA 4J8QA 3U58A 3CP0A 1HUNA 5NUCA 3CCEA 2OEOA 3K7UC 1LV9A 4BXXG 1D5XC 2F3WA 4A3KG 1EWIA 1KTKA 2DUDA 2GA4B 2NN6I 3TSSA 2YYZA 2K6AA 3PV0A 3OIQA 4JCVE 4POGA 4A3DG 2R93H 2DJGC 1NCVA 2I5LX 3ERSX 4X3TA 2A19A 4C1NK 5J22A 5IYDG 4X3SA 4PG3A 1X6OA 3VYSA 4B3RQ 4A3EB 4P71A 3C1FA 3SHLA 3GTPB 5KEEA 1PH2A 1EY0A 1Q46A 3HP3A 4ZAIA 1H9MA 5FO9B 1EYCA 3NE5B 2VUMG 4UAIA 2A69D 1YHBA 3NK9A 1IBLQ 5IWAL 2IX3A 3T1YQ 2DN8A 1SR3A 2KHJA 2IW3A 2HHHQ 4ZUIA 4JI2L 2VUMB 1JWSD 3V96A 1ZYRD 1DYQA 4ZYSA 4EQOA 5IIFA 4DV4Q 1NSNS 3W1BA 1I6HH 2R61A 3SVMA 1K8GA 4HMIA 1I50B 2HCIA 1CI3M 2B3GA 4B3ML 1BCPD 2K52A 1ILQA 4IJHA 2Y0SB 2IHEA 2QF7A 1TWAB 2MO1A 4IUNA 3K6OA 3D3RA 5D14A 3HOXG 2VQFQ 3S1RH 3MTSA 1MHWC 1IHZA 2QDBA 4JI8L 1CHPD 2JXMB 2A68D 3VR5A 1A63A 1LLRD 3U50C 2A1AA 4A76A 1XMOQ 2K28A 4NP5A 1SFOB 3KLWA 1V1QA 1GHKA 1YJ9A 4LF9L 2ID0A 1SMYC 2HQLA 4YWMA 5A2QE 1ESRA 4UP8A 3J81c 5BR8L 3F2CA 1CTMA 4FXGC 3SR1A 4DAYA 1BR9A 2M00A 4HIMA 3KDFB 1S72A 2E2DC 2JQOA 1YEZA 4F88A 2LXJA 1SSOA 5IYBG 5IODA 3B6YA 3FP9A 4AYBG 3DHQA 3TP7A 1SE8A 2F0TA 2Z8LA 2HIXA 2Y0SE 1PYBA 5M3FB 2KENA 5KRUA 1Z6HA 2A8VA 2GN5A 2YU9B 1AH9A 3S15H 4JOIA 3SE0A 4C56C 3H6MA 4XXEA 2NYZD 3S16H 2RCFA 4OX9Q 2UXBL 4RG1A 2EZVA 2E2JB 3QG1A 1GJXA 1EIFA 1F2LA 4IUQA 1K83B 1G6ZA 2PW5A 3FKIG 3M7NA 2X6LA 4FP5D 2ALYB 2RBMA 2BOSA 3T56B 2V1CC 4A4IA 3W3AA 2K5VA 4E6IA 2JA6G 2I0QA 4QF4A 1U4MA 4GLXA 3S2HH 4NXMQ 3FKIB 5M5XH 1SROA 3TP8A 3D8GA 4Q0FA 3QIAA 4AQYQ 1HA6A 2IX0A 4F8MA 1Z9FA 5E4XA 2UXCQ 5JPNC 2JA6B 1HQMC 4OWXB 2G5DA 4DR6Q 3I4NG 1PYWD 3F2UA 4DA2A 2ZXRA 1N9WA 4C3IG 1YJWA 1TY2A 2A6HD 1E2WA 4QGUA 3WWVA 3ONAB 3R3OA 1CKNA 1BXTA 1Y1VG 5CV4A 3IL8A 4DKAC 5K5PA 5CV6A 1YIJA 1L0XB 1IBLL 4C3IB 4HIKA 1JE4A 4H13C 1QWYA 1ET6A 3T1YL 2HHHL 1DM0B 1SYGA 2ICIA 4KHZA 3TDQA 2E2IH 4UPAA 3KLSA 5C4ZA 1IBMQ 1UAPA 1IL8A 4ULLA 2FXQA 4NXNQ 2PW7A 1HH2P 1UEBA 5FLXc 1HZCA 3RN2A 4DV4L 1LT3D 2JA9A 1PH8A 4BWGB 5IGDA 4JBMA 1UE5A 3GTGH 3M4QA 4LUOA 5EKIA 3BG3A 1A62A 4LFAQ 3RMHA 1GUWA 4GLAC 3U4ZA 1IW7C 4H02A 3HOYH 4DR2Q 1EWCA 1OXTA 3M4YA 3A5UA 1HZBA 5C5MA 2MJ8A 4DR4Q 1I4PA 1PV4A 4GKKQ 1KRTA 2ES2A 2O5JC 3WOFA 5C0XG 1QVGA 1Q7YC 1SEBD 2RSNA 1YITA 2L11A 2K5WA 2JEAI 2VQFL 4PQXA 4S3SA 4LF6Q 2B8FA 3D0FA 3HS0C 2CCZA 1K8OA 1NNXA 4LW1A 1JICA 4A3CG 2IHFA 3I7FA 5F2DA 5AFWA 2R3ZA 3HRZC 5A2QL 5FLMH 1XMOL 3OW2A 4KLKA 4KKTA 1Q86C 2E2HH 4YCUA 3NEMA 4DNIA 4POFA 1VQFA 4HR7B 4KJOA 1I4GA 4ILWA 3CHBD 5CORA 1MIUA 1KLGD 1XTCD 2GVAA 4K6DA 2ZTDA 4KD4A 2F0IA 4DV1Q 2WB1G 1N32Q 3S16B 2RHSB 2FINB 4N8X1 3A0JA 1HQRD 4R4TA 1AN8A 3NENA 4JI0Q 3C3LA 1EY4A 1RIPA 2WB1B 3NBHB 1UNSA 1DJRD 2X69A 2FMCA 4OX9L 1QVFA 1VQKA 2VQEQ 3SXHA 1VQIA 1YI2A 2L15A 3ND8A 5HY6A 3UDIA 1N8RC 1EY9A 2EJGC 4HJAA 1C0AA 3FDTA 2AHOB 1V1PB 4A3GH 1QNUA 1WCMG 2EIFA 1TWFH 3S2HB 1SE3A 3AU7A 5M5XB 1RDPD 1AP0A 1ICFB 1EYDA 2ZXPA 3I91A 3ULJA 3DWQA 4DPGA 4LWCA 2EE1A 2TMPA 2B2WA 4NXML 1K3BC 2K7VA 4PMCA 4QCLA 1VQHA 4X66Q 4CKEA 1YJNA 1CA5A 1V8QA 1X3FA 3T13A 1D1KA 1H9JA 4JI7Q 3TQYA 4AQYL 2PI2E 2PNRC 2UXCL 2HUGA 4O1NA 2B29A 5JAVA 4A3LH 1EIYB 3OW7A 1XPOA 2JA7H 4DR6L 1STYA 1Q90A 1OO9B 4IOCA 2WB1E 3TZUA 2NZOA 3I4MG 3GTLB 4G7HC 2EYMA 4ZLTF 2OTLA 2L1BA 5I2XA 1ML0D 2F0KA 4UHVA 4JBWA 4UDUC 1E7ZA 4YY3Q 1CZWA 5D3IB 2KBNA 4YHHQ 3UI2A 3CC7A 5J1ZA 1J8IA 1EWHA 1Q3LA 1I94Q 4YWKA 3GTGB 1BCPB 1X65A 2H1EA 4DV5Q 3PIP3 1HFNA 1IBML 2F0SA 5CMDA 3HOYB 2D5DA 3E5SA 4NXNL 3EROA 1RF2D 1D7QA 4DUZQ 4GNXA 4JI4Q 1S5DD 2HDLA 1QCBD 4IO9A 4BY7G 1SNPA 5I6WA 2CQOA 4LFAL 2HD3A 3S14H 4NDXA 4DR2L 1WTHA 4P73A 4HCEA 3KYHC 4OO1H 1F9RA 3D6CA 4FO2A 4DR4L 4GKKL 1HHVA 4IPGA 3J7AV 1STEA 2UUBQ 2ENBA 2OXPA 4HN7A 3E3XA 2VB3X 3A8IE 3A56A 1LO5D 4LF6L 5JJKA 5IYCH 4BY1G 4DK3C 4DV3Q 4LAAA 1E0BA 1GVPA 2X6GA 3BVGA 2JP1A 1BF4A 3AMUA 1HUMA 4PMBA 4HSPA 1F9QA 1XWEA 2CWPA 3GD7A 1EU4A 3CCRA 1XPUA 3TEHB 3JAML 1IYUA 3PIOA 2MPMA 3J81E 1B50A 4WJWA 4XIGS 1PLFA 3CRKC 1SMXA 3DM3A 3EVQA 1VQAA 2CW0D 4RHRA 2KCNA 3BDOA 1QZHA 5FJ8G 4IUTA 2L9HA 1VQLA 1SJED 5M9OA 5C4JH 1N32L 1TWHH 1ESFA 2NVYB 4HCSA 5JEAH 1DXMA 4JI0L 1GUSA 4GLVB 4YCWA 1J5EQ 2LKVA 4A3GB 1GM5A 2NVTH 2B2UA 3S1NH 1S5CD 2ZJPA 1TWFB 2VQEL 5EPLA 2XN9C 2Z4IA 4DAVA 5GAGC 1G8ZD 5COYA 1HNWL 2A73B 3D6WA 4IFDH 2JYOA 4UP7A 2DNCA 1KNAA 3H0GG 2EDGA 1PH9A 3V05A 4DFAA 3FPUB 4NPSA 3OTOQ 2ZM6Q 3J81j 4HJ5A 2VNUD 1IKMA 1LT4D 1H95A 1BCPC 1E1TA 4JBKA 5CV9A 1U4LA 4KI0A 4X66L 3PCOB 4JI3L 2K03A 4JI7L 1EY8A 1RJTA 3DMUA 4LUVA 5G3LD 4K5XA 1CUKA 1V1OA 3G4SA 3FVQA 1SYDA 3BJUA 5KYLA 4H44C 2CH4A 2ASBA 2SOBA 4YY3L 5KYIA 4YHHL 3AFQA 2NTSA 1I94L 1NE3A 3CCJA 3IFDA 3UE0A 1PH6A 4DV5L 3QO2A 1EQVA 1KABA 3OHXC 2PZTA 4JG2A 3S14B 3E0EA 5CC4A 5IGFA 3M3YH 1J9OA 1DCZA 5C3EH 4DUZL 1LTRD 4JI4L 1BUVT 1VQBA 4A93G 4B9WA 2D0OA 3T16A 3WOEA 2KA7A 1EY7A 3H3VH 4APVA 1PXUA 2XTIA 2KCMA 1U0LA 1EQQA 1KAWA 4A93B 1QOHA 2EYOA 4A3MG 2UUBL 3F2DA 1BQQT 2F0DA 1PA6A 5C6AA 1KAAA 2I46A 3MXNB 3RZOH 2WKDA 2RKSA 4WRDA 2NB0A 2G9HD 4FF1A 1EFWA 1VQCA 5EGTA 1T5XD 1GKHA 4Z9CB 4CGYB 5ELCA 1SAPA 2QEXA 2JA8G 1EFID 1Q8IA 4DV6Q 3FMCA 2XRSD 1C4QA 5HGTA 2K5QA 2N78A 1EEFD 3NPPA 5CYUA 2XWBB 4A3IH 4OIJA 1C48A 3VA5A 1CZGA 5C4JB 2N3SA 4RWSC 4OL7A 2JA8B 3STBD 5AJ3Q 4X3UA 1U4PA 5FK9C 2KEDA 1OTCA 2ZJRA 3DUZA 3KF8B 3NXWA 5DLQE 2QEJC 1R9TH 2NVTB 3S1NB 1STGA 1AZPA 1HPCA 2A6HC 3C2PA 2AMCB 3RLNA 1CKMA 1CSQA 4LMQD 4KHPQ 1E1OA 1XJVA 2EXDA 1A15A 1J5EL 2L5TA 4QIWB 2K04A 2PNHA 4B3TQ 2IPKD 2VL6A 2PQAB 4BBSH 1Y8OB 1JT8A 3KOJA 4GOPB 1PH4A 3FHWA 4JW0A 1TWGH 1SLJA 1X3QA 1GUTA 4G7ZC 1V1PA 4LF4Q 4HJ7A 1F2ZA 1EY6A 3PUYA 2Z6BA 4FF4A 3PUXA 5BN5A 2I5HA 3NQTA 4TQUS 5EPJA 4A3EG 4FYDA 4X3KA 1VQPA 4KMUC 3OTOL 2ZM6L 2SEBD 1LTTD 5JJLA 1WTPA 1K28A 4CDFC 1E24A 4HIOA 1B4OA 3K0XA 1LM0A 1UE6A 1H9SA 3CU7A 2WV6D 5IP9H 2R7ZH 1HRJA 2R6GA 3HOWH 1CQFA 4RGOS 1R4PB 1YBYA 1DGSA 2OT2A 2NN6H 1F77A 3OPOA 4QIWE 2QCPX 1NJIC 3KF6B 3TRZA 3HOVH 1PRTD 5LL6S 5J3BA 3SEBA 3M3YB 3HFZB 1P16A 1ZEQX 5C3EB 2K33A 4JI5Q 2A74C 4KK7A 5FOBB 5FLXL 4R4CA 2O2LD 4L5SA 1U9RA 2Y0SG 4X62Q 3IKJA 3NHHA 3GTKH 1QVCA 3P75A 2F4IA 3BZDB 3RZDH 1K0RA 1JWUD 1YNND 3I3CA 1WD1A 4H0LC 1JOKA 3BYTB 1JB7A 3RZOB 3H09A 2UUAQ 4UY8C 4A3FH 4IOAA 3Q6SA 3RUZA 3CCLA 5D3DA 4IURA 3J80i 1MJCA 1PTOF 2UXDQ 1EZ6A 1X32A 5C0XI 4FXDA 2WAQB 4OIKA 3M4OH 1N34Q 4RKLA 1LT5D 1GUOA 2B8GA 2D0PA 5EKKA 3K5LA 1IKLA 1K8MA 4LFBQ 3A54A 4L6TB 1EQRA 4XQNA 3I72A 2F0JA 3IFTA 2EXZA 4DV6L 3L3OC 1WFQA 4C3JH 4OWWB 4KTAA 3PO3H 1VQJA 4GOPC 5M3FG 3NP8A 3EFXD 2KHSA 1R9TB 1MSGA 1S5ED 2MQHA 2XIWA 3HKSA 1QB5D 4KJNA 1X3PA 2RHQB 3KBXA 3J7YW 4XT1B 1B53A 5AJ3L 1BNZA 5EPKA 1JJCB 2KQ3A 3MWYW 3J80c 5GADC 4CJ2C 2F0NA 2Z6KA 5EJWA 2JA5H 2H5XA 2D2CC 3KFUA 3U9SA 4DV2Q 1UWVA 3IRBA 1I3QH 4QL5A 4P74A 4BBSB 2R93G 2Q8IB 4KHPL 1GUNA 3GQBA 1AE3A 4OONA 1KQSA 1TWGB 5CR3A 2CVRA 3BYYB 3MXPA 1F2YA 2F0FA 4QMGA 3HOUH 3S2DH 5CBAE 4B3TL 1HJPA 2R93B 4C2MH 1SN8A 4KKSA 1JOOA 3GTMH 4H7BA 5IP7H 1JC7A 4XYOA 4X64Q 1PFSA 4LF4L 3VR2A 4A3BH 1Y1WH 5CV5A 1TIID 1YNJD 1DOKA 1L1OA 1MGSA 3G48A 3VR4A 2WIIB 1VQOA 3RD4A 3K7AH 2EYJA 1S4ZA 4EQPA 3S24A 1G2TA 2CKZB 2Z4HA 3NTIA 3RLOA 1XYIA 2R7ZB 3I8ZA 3SK8A 1JWMD 2RA4A 4B3RL 4KY5A 3BDLA 2IL8A 3R2IA 4JI6Q 1Q1EA 3H3VC 1VQ5A 2RDGA 1SYBA 1STNA 3HOVB 4LJZC 3P20A 4ME5A 4J15A 5GAHC 5JJIA 4ODGA 2VW9A 3I73A 1JJGA 1B9MA 3S17H 3NTKA 2EY1A 5EBCA 1B2TA 1PH1A 1NUCA 3LWEA 2F0GA 4K5WA 1RCVD 1SNQA 1I6HB 1RKNA 4R8NA 3QB3A 1ZKOA 1CSPA 3GTKB 3LNNA 1FNVA 4JI5L 4RHSA 4Y52H 4A3FG 3RZDB 1N33Q 2EOTA 1DOLA 2VZAA 2CW0C 4FDBA 4X62L 4KN7C 4ZRZA 2Q2TA 1KXLA 2F0VA 3CMAA 1SDFA 5E1FA 1LTAD 3S1RB 4A3FB 3CQZH 5JEAJ 2KJXA 4B08A 3CCQA 2ICEC 5C44H 3M4OB 1HTPA 2UUAL 3QJYA 4M8AA 2MFIA 4P2CB 5E3FA 1LT6D 3PUZA 4DUYQ 4R4QA 2GVBA 2WP8J 4AIMA 2FHTA 4IFDJ 2UXDL 4GN5A 1PH3A 3MEHA 1V9PA 2BCOA 3URYA 1N34L 4C3JB 1A2UA 4FVMA 2K5HA 3KLRA 1B3AA 5H1SE 3PO3B 5C5LA 2OQKA 1I5FA 2N55A 4LFBL 1JORA 3GDEA 2ZTEA 4RGNA 3PIPA 2VB2X 4EVOA 2JA5G 3DWPA 4X65Q 1IL2A 2WKCA 2K4KA 1YZ6A 1ENFA 3HKZG 2ZTCA 3JAME 4QUCA 1E22A 2JA5B 3AQQA 3S15B 2AWNA 3W5OA 1L2FA 3GV6A 1BBXC 1I3QB 3MFYA 4BBRH 4XT3B 1RD9D 3HKZB 5IP7G 3MVVA 1MI2A 2F0UA 3Q24A 4A3JH 4DXFA 1D6EC 2F0MA 3BDCA 2AKWB 1PFMA 5CBEE 3CAMA 3S2DB 3G71A 5FO7B 5IGGA 3AYHB 4C2MB 1KLUD 1UUPA 1W6JA 1LTLA 3GTMB 1D2BA 4DV7Q 4CDDC 1KD1C 4KY7A 5M3MH 2JN4A 4A3BB 5I2YA 1Y1WB 2MGSA 4U68A 4J1MA 4RA8A 3H15A 2F4VQ 1O80A 2AUJD 2LXKA 3K7AB 2F03A 3CF5A 4X64L 1FGBD
chains in the Genus database with same CATH topology
4BXXG 1HR0L 4A3KG 1EWIA 3PGZA 2QA4A 3H0GG 3I4OA 2DUDA 2NN6I 4PZ7A 3OYYA 3HOVG 1PH9A 2YYZA 2NVXH 3PV0A 4NPSA 2VS1A 3MEFA 3OTOQ 3J81j 2ZM6Q 4HJ5A 1IBKL 2VNUD 1H95A 2BA1A 4JCVE 4POGA 3HOZH 4A3DG 2R93H 1E1TA 4GN4B 4JBKA 3E9IA 1PHJA 1HNZQ 4KI0A 2I5LX 3ERSX 3HKZE 3EN2A 4X66L 2A19A 4JI6L 3PCOB 4JI3L 4C3HH 5IYDG 1QZGA 4GS3A 1X6OA 2JEBI 4PG3A 4JI7L 4B3RQ 3E9HA 4P71A 3CC2A 2NZHA 4LUVA 1PH2A 1Q46A 1CUKA 1PYSB 1X3EA 1P8LA 2JJQA 3G4SA 4GNXC 2E8GA 3BJUA 3HOYG 2AWOA 1WCMH 3ICEA 5C4XH 2ASBA 3M4PA 3KF6A 3CXCA 2VUMG 1EUJA 4YY3L 5M5WH 2YTXA 4AYBE 4Y7NH 1UE7A 2QGQA 4YHHL 2OCEA 1YHBA 3AFQA 5C44G 4DR1Q 1IBLQ 5IWAL 3PO2H 1VQDA 3T1YQ 1SR3A 2KHJA 2HHHQ 1I94L 1NMGA 1N33L 1NE3A 2LSSA 4JI2L 3CCJA 3UE0A 1PH6A 3DLLA 4DV5L 4OO1I 3GTLH 4JG2A 4ALPA 3E0EA 3M3YH 4DV4Q 5FLMG 5C3EH 4L5TA 1GD7A 2KCTA 4DUZL 3W1BA 4JI4L 1I6HH 3GTJH 3GTOH 1VQBA 1K8GA 5M5YH 4JYAQ 5LMUQ 4LF5Q 4A93G 2D0OA 3I4MH 3PO3G 3CCVA 1CKOA 3CCMA 3TS2A 2B3GA 3JC66 4QY7A 4APVA 4B3ML 3H3VH 4K0KQ 2K52A 2XTIA 4IJHA 1KIXA 5EAYA 2KCMA 2IHEA 1U0LA 1MKHA 1EQQA 1VQMA 1VQGA 1KAWA 1V43A 1X55A 4IPHA 4QJFA 4A3MG 2MO1A 5GAEC 1K9MC 4DUYL 2UUBL 3HOXG 4B3SQ 2VQFQ 3ZJYC 3F2DA 3S1RH 1PA6A 3S1MH 4R4OA 4JI8L 1KL9A 3MXNB 3RZOH 1VQ8A 1A63A 3U50C 2A1AA 1EFWA 4A76A 1VQCA 2YTYA 4RMFA 1GKHA 3T1HQ 1XMOQ 5LMNL 4A3JG 2QEXA 2JA8G 3KLWA 4X65L 1V1QA 4DV6Q 4BY7H 1YJ9A 3KDFA 4LF9L 2ID0A 1OXSC 2HQLA 2N78A 4YWMA 3HOUG 4A3IH 4UP8A 3J81c 1HR0W 5BR8L 3F2CA 4DAMA 2IX1A 1BVSA 1T9HA 2N3SA 3KDFB 4HIMA 1XTDA 3CMEA 1S72A 1XNRL 4DV1L 3STBD 5AJ3Q 2JQOA 4A3GG 1YEZA 3L2PA 4A3BG 1IXRA 4DAYB 1Y1WG 2LXJA 2B63H 5IYBG 1OTCA 2ZJRA 2PMZE 3B6YA 3KF8B 3FP9A 4IPCA 5DLQE 4AYBG 4DV2L 1R9TH 1HNXQ 1SRUA 1SE8A 4HJ9A 4BY1H 2HIXA 2Y0SE 1PYBA 2IY5B 2KENA 3ULLA 2AMCB 3RLNA 1CKMA 1B70B 2K5NA 2GN5A 1CSQA 3K81C 2A8VA 1Q82C 1E1OA 4KHPQ 1XJVA 2EXDA 4JOIA 3S15H 1AH9A 1J5EL 2OQ0A 3Q8DA 2PQAA 3S16H 4DV7L 1X56A 4GOPA 4OX9Q 2UXBL 1ASZA 4GN3B 4MNOA 4RG1A 2PNHA 4B3TQ 2VL6A 2PQAB 4BBSH 4A3LG 1JT8A 3KOJA 5E7NA 1Q8KA 4GOPB 1PH4A 2F4VL 3FHWA 2R92H 2JA7G 1JMCA 1TWGH 1EIFA 1SLJA 2NVYH 4LF4Q 4HJ7A 3PUYA 4LF8Q 1B7YB 4JI1Q 3KJOA 3SGIA 5FJ8H 1VQ9A 3PUXA 2KHIA 1HNWQ 2I5HA 1VS0A 1WJJA 3FKIG 4TQUS 4XTCS 4A3EG 3M7NA 2F52A 2ALYB 1VQPA 2JK8A 2V1CC 4A4IA 3OTOL 2ZM6L 3J7ZC 2K5VA 3F1ZA 2JA6G 1XMQQ 2I0QA 5ELOA 4GLXA 3S2HH 4NXMQ 2Q2HA 5JJLA 3U4VA 1S40A 1HNZL 5M5XH 1SROA 4YWLA 1E24A 4HIOA 4AQYQ 3K0XA 2R7DA 2IX0A 2HIVA 1Z9FA 1LM0A 4GKJQ 2UXCQ 1UE6A 2UU9Q 1D8LA 1Q12A 4OWXB 4JI3Q 5IP9H 2R7ZH 2R7FA 4DR6Q 3I4NG 2R6GA 3HOWH 3PF4A 1YBYA 1BBWA 1N9WA 3L7ZC 1DGSA 1Z47A 1YJWA 4O2DA 4QIWE 1M90C 4BXXH 4A3KH 4QGUA 3GO5A 3WWVA 1NJIC 2VY3A 3H0GH 3KF6B 4OO1G 3TRZA 2BH8A 3HOVH 1CKNA 2I5MX 2N8NA 5J3BA 1Y1VG 4DKAC 3STBC 1YIJA 3HFZB 4DR1L 1P16A 3I56A 1IBLL 4HIKA 1PH7A 4JI5Q 5LMNW 1XNQQ 3T1YL 4A3DH 3J7A5 4X6AH 2HHHL 1C9OA 4JC0A 4KHZA 1L0WA 3TREA 1CKNB 3GTPH 1VQEA 3H3VI 4DR7Q 2E2IH 4UPAA 5IYCG 2CFMA 4R4CA 3TS0A 1IBMQ 4L5SA 2Y0SG 4X62Q 1FJGQ 2FXQA 1KHIA 4NXNQ 5IYDH 2IT1A 1N36Q 1OXVA 1K73C 1G6PA 1HH2P 1UEBA 5FLXc 1HZCA 2K14A 3RN2A 1QVCA 4DV4L 3GTKH 2JA9A 1PH8A 3RZDH 1XPRA 4JBMA 1UE5A 1VQ7A 3GTGH 4JYAL 3M4QA 4LUOA 1K0RA 5LMUL 4DR3Q 1A62A 4LFAQ 4LF5L 1VQ6A 4BA2I 4GLAC 3U4ZA 3HOYH 4H02A 4DR2Q 1OXTA 3K80C 3A5UA 3PF5A 4IJLA 1HZBA 2MNAA 4LFCQ 4K0KL 2Z0SA 1BBUA 1HZAA 1JB7A 2UUAQ 1PV4A 4A3FH 4JBJA 4UY8C 1KRTA 2ES2A 4DR4Q 4GKKQ 1OXXK 3CCLA 4IOAA 4JV5Q 5C0XG 3CPWA 1Q7YC 1QVGA 1B8AA 3J80i 1YITA 3EIVA 1MJCA 4B3SL 2BA0A 3JAMi 4LF7Q 4DV3L 3ER0A 4BBRG 2VQFL 1MJEA 3RR5A 2UUCQ 2UXDQ 4LF6Q 5C0XI 3D0FA 4YCVA 3EBEA 2CCZA 3M4OH 1N34Q 1WYDA 2YTVA 4LW1A 4A3CG 2IHFA 2D0PA 1TXYA 3I7FA 5JEAG 2ZJQA 3A74A 5FLMH 3T1HL 1XMOL 4LFBQ 3OW2A 1YNXA 4KLKA 1EQRA 4OWTB 2E2HH 1Q86C 4YCUA 3CCSA 3NEMA 4DNIA 4POFA 1PH5A 3M85A 3BU2A 4DV6L 1TWAH 1WFQA 5M3MG 4DR5Q 1VQFA 4A93H 4C3JH 4OWWB 3PO3H 1VQJA 3LGJA 4GOPC 5M3FG 5HGQA 1W2BA 1MIUA 2MQHA 3HKSA 4IPDA 2RHQB 2D62A 4UP9A 4IFDG 4MZ9A 5AJ3L 2GVAA 4A3MH 1JJCB 3L0OA 2PI2A 2ZTDA 4PZ8A 3HOXH 4IFDI 4DV1Q 2WB1G 3J80c 5GADC 1N32Q 1HNXL 2RHSB 2Z6KA 2JA5H 4DV0Q 2Q2IA 2H5XA 3A0JA 4R4TA 2ATWA 2OWOA 3KFUA 2WFWA 3NENA 3F2BA 4DV2Q 1UWVA 3IRBA 3PSIA 1I3QH 4QL5A 4P74A 4JI0Q 3HOZG 1QUQA 2R93G 4HJ8A 4KHPL 4OONA 1AE3A 1RIPA 1KQSA 2JA8H 3NBHB 3AFPA 2NVQH 2RCNA 4R1JA 2EQSA 3S1QH 1TWCH 4OX9L 1QVFA 1VQKA 1WOCA 3HOUH 1A0IA 2VQEQ 4ME3A 2E5LQ 1VQIA 3S2DH 3W1GA 1YI2A 2L15A 4B3TL 5HY6A 1HJPA 3UDIA 1N8RC 4C2MH 1SN8A 2RF4A 2BH2A 3ULPA 4HJAA 1C0AA 3A5ZB 3GTMH 5IP7H 1VCIA 2AHOB 4A3GH 4X64Q 1PFSA 4LF4L 4LF8L 4A3BH 3PUWA 4JI1L 1Y1WH 1WCMG 3M9BA 4R4IA 5IYBH 1HR0Q 2EIFA 1TWFH 1A8VA 1Q81C 2YU9H 5C4XG 1L1OA 3G48A 3UDFA 1FVIA 4L5RC 1VQOA 4QQBX 3K7AH 1NMFA 3ULJA 1IBKQ 4DPGA 5ELNA 2E2JH 1L1OB 3S24A 3RN5A 4LWCA 2CKZB 3K8AA 4O0AA 5GQOA 3RLOA 3KJPA 3PO2G 1Y14B 3I55A 1XMQL 2OTJA 3VDYA 4NXML 3UDXA 4B3RL 1VQHA 4X66Q 1K83H 1YJNA 4JI6Q 1Q1EA 1X3FA 3PUVA 1X9NA 1W3SA 3CPFA 1NBWA 1VQ5A 4JI7Q 3TQYA 1K3RA 2PI2E 4HIDA 4AQYL 1U5KA 4GKJL 2UXCL 5C3EG 3RNUA 2B29A 2N49A 4A3LH 2UU9L 1EIYB 1XPOA 2JA7H 4DR6L 1EOVA 1EYGA 4J15A 5GAHC 5JJIA 2VW9A 1RL2A 2CWAA 2WB1E 2C35B 2NZOA 5IE8A 4IOCA 4EX5A 4A75A 2OTLA 3I4MG 1JJGA 1K8AC 3S17H 4L5QA 4JBWA 1PH1A 3FKIH 5GROA 1E7ZA 4YY3Q 4A3EH 1G51A 1YHAA 4BA1I 1S3OA 2KBNA 4YHHQ 1LUZA 3CC7A 1CSPA 5IWAQ 2JEAI 2JA6H 4JI5L 4DK6C 1XNQL 4A3FG 1I94Q 4Y52H 4TVAB 1NTGA 3RLFA 1N33Q 4JI2Q 4YWKA 5C0XJ 4DR7L 1X65A 3NELA 2VZAA 4DV5Q 1FL0A 1IBML 4FDBA 4X62L 1FJGL 1LYLA 4NXNL 2Q2TA 4NB3A 1KXLA 1N36L 3CMAA 3D31A 1NY4A 1AE2A 1D7QA 3GTQH 4DUZQ 5K36G 4EQ5A 4GNXA 4JI4Q 3G6EA 1WI5A 3CQZH 1JE5A 5JEAJ 3I4NH 2WAQG 4IO9A 1OXUA 2VUMH 4BY7G 2MO0A 4DR3L 2CQOA 4LFAL 4C3IH 2HT1A 3S14H 3CW2C 2F3IA 4A3IG 4GNXB 3CCQA 4DR2L 4P73A 4B3MQ 4PMWA 5C44H 3KYHC 1VQ4A 1J6QA 4LFCL 1IZ6A 3J81i 1YVCA 2UUAL 4DR4L 4LNQA 4GKKL 2Q2UA 1O7IA 3BZCA 4IPGA 3CD6A 2MFIA 4JV5L 1Y1VH 4AH6A 2UUBQ 1Q1BA 3PUZA 1I50H 4DUYQ 4R4QA 2GVBA 2WP8J 4AIMA 2B63G 2K50A 2XGTA 4LF7L 4OXPA 5IT9c 2UUCL 4IFDJ 4P75A 2UXDL 4GN5A 1PH3A 4JI8Q 4LF6L 1V9PA 5JJKA 5IYCH 1N34L 2K75A 3F8TA 4BY1G 2K5HA 4DK3C 4DV3Q 5H1SE 1GVPA 2Z6KC 2OQKA 1I5FA 1IYJB 3CCUA 4JOIC 5LMNQ 4LFBL 1VQNA 3AEVA 3GDEA 2ZTEA 3PIPA 2JA5G 1C7YA 4X65Q 1BKBA 2CWPA 3I2ZA 1M1KC 2JE6I 3CC4A 1IL2A 4WJ4A 4LF9Q 3GD7A 3CCRA 2K4KA 4DR5L 1YZ6A 4LUZA 3TEHB 5BR8Q 1XPUA 3HKZG 4P72A 2ZTCA 3PIOA 4BBSG 4PZ6A 1E22A 1X3GA 5IY0A 4XIGS 3AQQA 1ASYA 1XNRQ 2AWNA 1SFOH 3DM3A 1SMXA 2R92G 3W5OA 1L2FA 1VQAA 3JAMc 1JJ2A 1QZHA 5FJ8G 4BBRH 1VQLA 5IP7G 2DGYA 5C4JH 1N32L 1TWHH 3UE1A 4A3JH 4A3CH 1E3PA 1G291 1L1OC 2AKWB 4DV0L 3CAMA 3G71A 4JI0L 2WAQE 3AYHB 1QUQB 2YV5A 1PVOA 4GLVB 1LTLA 1UE1A 1HZ9A 4YCWA 1YHQA 1J5EQ 3BZKA 1KC8C 1X54A 4DV7Q 1GM5A 1KRSA 1KD1C 2NVTH 2UXBQ 5M3MH 3S1NH 4WJ3M 3UDGA 1GO3E 2ZJPA 2VQEL 5M3FH 2E5LL 1FGUA 3H15A 2F4VQ 2LXKA 4MTNA 5IP9G 5GAGC 3U58A 2R7ZG 1HNWL 3HOWG 3CP0A 3CF5A 4UP7A 3CCEA 4X64L 2NN6G 3K7UC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX G;  1HR0 L;  4A3K G;  1EWI A;  3PGZ A;  2QA4 A;  3H0G G;  3I4O A;  2DUD A;  2NN6 I;  4PZ7 A;  3OYY A;  3HOV G;  1PH9 A;  2YYZ A;  2NVX H;  3PV0 A;  4NPS A;  2VS1 A;  3MEF A;  3OTO Q;  3J81 j;  2ZM6 Q;  4HJ5 A;  1IBK L;  2VNU D;  1H95 A;  2BA1 A;  4JCV E;  4POG A;  3HOZ H;  4A3D G;  2R93 H;  1E1T A;  4GN4 B;  4JBK A;  3E9I A;  1PHJ A;  1HNZ Q;  4KI0 A;  2I5L X;  3ERS X;  3HKZ E;  3EN2 A;  4X66 L;  2A19 A;  4JI6 L;  3PCO B;  4JI3 L;  4C3H H;  5IYD G;  1QZG A;  4GS3 A;  1X6O A;  2JEB I;  4PG3 A;  4JI7 L;  4B3R Q;  3E9H A;  4P71 A;  3CC2 A;  2NZH A;  4LUV A;  1PH2 A;  1Q46 A;  1CUK A;  1PYS B;  1X3E A;  1P8L A;  2JJQ A;  3G4S A;  4GNX C;  2E8G A;  3BJU A;  3HOY G;  2AWO A;  1WCM H;  3ICE A;  5C4X H;  2ASB A;  3M4P A;  3KF6 A;  3CXC A;  2VUM G;  1EUJ A;  4YY3 L;  5M5W H;  2YTX A;  4AYB E;  4Y7N H;  1UE7 A;  2QGQ A;  4YHH L;  2OCE A;  1YHB A;  3AFQ A;  5C44 G;  4DR1 Q;  1IBL Q;  5IWA L;  3PO2 H;  1VQD A;  3T1Y Q;  1SR3 A;  2KHJ A;  2HHH Q;  1I94 L;  1NMG A;  1N33 L;  1NE3 A;  2LSS A;  4JI2 L;  3CCJ A;  3UE0 A;  1PH6 A;  3DLL A;  4DV5 L;  4OO1 I;  3GTL H;  4JG2 A;  4ALP A;  3E0E A;  3M3Y H;  4DV4 Q;  5FLM G;  5C3E H;  4L5T A;  1GD7 A;  2KCT A;  4DUZ L;  3W1B A;  4JI4 L;  1I6H H;  3GTJ H;  3GTO H;  1VQB A;  1K8G A;  5M5Y H;  4JYA Q;  5LMU Q;  4LF5 Q;  4A93 G;  2D0O A;  3I4M H;  3PO3 G;  3CCV A;  1CKO A;  3CCM A;  3TS2 A;  2B3G A;  3JC6 6;  4QY7 A;  4APV A;  4B3M L;  3H3V H;  4K0K Q;  2K52 A;  2XTI A;  4IJH A;  1KIX A;  5EAY A;  2KCM A;  2IHE A;  1U0L A;  1MKH A;  1EQQ A;  1VQM A;  1VQG A;  1KAW A;  1V43 A;  1X55 A;  4IPH A;  4QJF A;  4A3M G;  2MO1 A;  5GAE C;  1K9M C;  4DUY L;  2UUB L;  3HOX G;  4B3S Q;  2VQF Q;  3ZJY C;  3F2D A;  3S1R H;  1PA6 A;  3S1M H;  4R4O A;  4JI8 L;  1KL9 A;  3MXN B;  3RZO H;  1VQ8 A;  1A63 A;  3U50 C;  2A1A A;  1EFW A;  4A76 A;  1VQC A;  2YTY A;  4RMF A;  1GKH A;  3T1H Q;  1XMO Q;  5LMN L;  4A3J G;  2QEX A;  2JA8 G;  3KLW A;  4X65 L;  1V1Q A;  4DV6 Q;  4BY7 H;  1YJ9 A;  3KDF A;  4LF9 L;  2ID0 A;  1OXS C;  2HQL A;  2N78 A;  4YWM A;  3HOU G;  4A3I H;  4UP8 A;  3J81 c;  1HR0 W;  5BR8 L;  3F2C A;  4DAM A;  2IX1 A;  1BVS A;  1T9H A;  2N3S A;  3KDF B;  4HIM A;  1XTD A;  3CME A;  1S72 A;  1XNR L;  4DV1 L;  3STB D;  5AJ3 Q;  2JQO A;  4A3G G;  1YEZ A;  3L2P A;  4A3B G;  1IXR A;  4DAY B;  1Y1W G;  2LXJ A;  2B63 H;  5IYB G;  1OTC A;  2ZJR A;  2PMZ E;  3B6Y A;  3KF8 B;  3FP9 A;  4IPC A;  5DLQ E;  4AYB G;  4DV2 L;  1R9T H;  1HNX Q;  1SRU A;  1SE8 A;  4HJ9 A;  4BY1 H;  2HIX A;  2Y0S E;  1PYB A;  2IY5 B;  2KEN A;  3ULL A;  2AMC B;  3RLN A;  1CKM A;  1B70 B;  2K5N A;  2GN5 A;  1CSQ A;  3K81 C;  2A8V A;  1Q82 C;  1E1O A;  4KHP Q;  1XJV A;  2EXD A;  4JOI A;  3S15 H;  1AH9 A;  1J5E L;  2OQ0 A;  3Q8D A;  2PQA A;  3S16 H;  4DV7 L;  1X56 A;  4GOP A;  4OX9 Q;  2UXB L;  1ASZ A;  4GN3 B;  4MNO A;  4RG1 A;  2PNH A;  4B3T Q;  2VL6 A;  2PQA B;  4BBS H;  4A3L G;  1JT8 A;  3KOJ A;  5E7N A;  1Q8K A;  4GOP B;  1PH4 A;  2F4V L;  3FHW A;  2R92 H;  2JA7 G;  1JMC A;  1TWG H;  1EIF A;  1SLJ A;  2NVY H;  4LF4 Q;  4HJ7 A;  3PUY A;  4LF8 Q;  1B7Y B;  4JI1 Q;  3KJO A;  3SGI A;  5FJ8 H;  1VQ9 A;  3PUX A;  2KHI A;  1HNW Q;  2I5H A;  1VS0 A;  1WJJ A;  3FKI G;  4TQU S;  4XTC S;  4A3E G;  3M7N A;  2F52 A;  2ALY B;  1VQP A;  2JK8 A;  2V1C C;  4A4I A;  3OTO L;  2ZM6 L;  3J7Z C;  2K5V A;  3F1Z A;  2JA6 G;  1XMQ Q;  2I0Q A;  5ELO A;  4GLX A;  3S2H H;  4NXM Q;  2Q2H A;  5JJL A;  3U4V A;  1S40 A;  1HNZ L;  5M5X H;  1SRO A;  4YWL A;  1E24 A;  4HIO A;  4AQY Q;  3K0X A;  2R7D A;  2IX0 A;  2HIV A;  1Z9F A;  1LM0 A;  4GKJ Q;  2UXC Q;  1UE6 A;  2UU9 Q;  1D8L A;  1Q12 A;  4OWX B;  4JI3 Q;  5IP9 H;  2R7Z H;  2R7F A;  4DR6 Q;  3I4N G;  2R6G A;  3HOW H;  3PF4 A;  1YBY A;  1BBW A;  1N9W A;  3L7Z C;  1DGS A;  1Z47 A;  1YJW A;  4O2D A;  4QIW E;  1M90 C;  4BXX H;  4A3K H;  4QGU A;  3GO5 A;  3WWV A;  1NJI C;  2VY3 A;  3H0G H;  3KF6 B;  4OO1 G;  3TRZ A;  2BH8 A;  3HOV H;  1CKN A;  2I5M X;  2N8N A;  5J3B A;  1Y1V G;  4DKA C;  3STB C;  1YIJ A;  3HFZ B;  4DR1 L;  1P16 A;  3I56 A;  1IBL L;  4HIK A;  1PH7 A;  4JI5 Q;  5LMN W;  1XNQ Q;  3T1Y L;  4A3D H;  3J7A 5;  4X6A H;  2HHH L;  1C9O A;  4JC0 A;  4KHZ A;  1L0W A;  3TRE A;  1CKN B;  3GTP H;  1VQE A;  3H3V I;  4DR7 Q;  2E2I H;  4UPA A;  5IYC G;  2CFM A;  4R4C A;  3TS0 A;  1IBM Q;  4L5S A;  2Y0S G;  4X62 Q;  1FJG Q;  2FXQ A;  1KHI A;  4NXN Q;  5IYD H;  2IT1 A;  1N36 Q;  1OXV A;  1K73 C;  1G6P A;  1HH2 P;  1UEB A;  5FLX c;  1HZC A;  2K14 A;  3RN2 A;  1QVC A;  4DV4 L;  3GTK H;  2JA9 A;  1PH8 A;  3RZD H;  1XPR A;  4JBM A;  1UE5 A;  1VQ7 A;  3GTG H;  4JYA L;  3M4Q A;  4LUO A;  1K0R A;  5LMU L;  4DR3 Q;  1A62 A;  4LFA Q;  4LF5 L;  1VQ6 A;  4BA2 I;  4GLA C;  3U4Z A;  3HOY H;  4H02 A;  4DR2 Q;  1OXT A;  3K80 C;  3A5U A;  3PF5 A;  4IJL A;  1HZB A;  2MNA A;  4LFC Q;  4K0K L;  2Z0S A;  1BBU A;  1HZA A;  1JB7 A;  2UUA Q;  1PV4 A;  4A3F H;  4JBJ A;  4UY8 C;  1KRT A;  2ES2 A;  4DR4 Q;  4GKK Q;  1OXX K;  3CCL A;  4IOA A;  4JV5 Q;  5C0X G;  3CPW A;  1Q7Y C;  1QVG A;  1B8A A;  3J80 i;  1YIT A;  3EIV A;  1MJC A;  4B3S L;  2BA0 A;  3JAM i;  4LF7 Q;  4DV3 L;  3ER0 A;  4BBR G;  2VQF L;  1MJE A;  3RR5 A;  2UUC Q;  2UXD Q;  4LF6 Q;  5C0X I;  3D0F A;  4YCV A;  3EBE A;  2CCZ A;  3M4O H;  1N34 Q;  1WYD A;  2YTV A;  4LW1 A;  4A3C G;  2IHF A;  2D0P A;  1TXY A;  3I7F A;  5JEA G;  2ZJQ A;  3A74 A;  5FLM H;  3T1H L;  1XMO L;  4LFB Q;  3OW2 A;  1YNX A;  4KLK A;  1EQR A;  4OWT B;  2E2H H;  1Q86 C;  4YCU A;  3CCS A;  3NEM A;  4DNI A;  4POF A;  1PH5 A;  3M85 A;  3BU2 A;  4DV6 L;  1TWA H;  1WFQ A;  5M3M G;  4DR5 Q;  1VQF A;  4A93 H;  4C3J H;  4OWW B;  3PO3 H;  1VQJ A;  3LGJ A;  4GOP C;  5M3F G;  5HGQ A;  1W2B A;  1MIU A;  2MQH A;  3HKS A;  4IPD A;  2RHQ B;  2D62 A;  4UP9 A;  4IFD G;  4MZ9 A;  5AJ3 L;  2GVA A;  4A3M H;  1JJC B;  3L0O A;  2PI2 A;  2ZTD A;  4PZ8 A;  3HOX H;  4IFD I;  4DV1 Q;  2WB1 G;  3J80 c;  5GAD C;  1N32 Q;  1HNX L;  2RHS B;  2Z6K A;  2JA5 H;  4DV0 Q;  2Q2I A;  2H5X A;  3A0J A;  4R4T A;  2ATW A;  2OWO A;  3KFU A;  2WFW A;  3NEN A;  3F2B A;  4DV2 Q;  1UWV A;  3IRB A;  3PSI A;  1I3Q H;  4QL5 A;  4P74 A;  4JI0 Q;  3HOZ G;  1QUQ A;  2R93 G;  4HJ8 A;  4KHP L;  4OON A;  1AE3 A;  1RIP A;  1KQS A;  2JA8 H;  3NBH B;  3AFP A;  2NVQ H;  2RCN A;  4R1J A;  2EQS A;  3S1Q H;  1TWC H;  4OX9 L;  1QVF A;  1VQK A;  1WOC A;  3HOU H;  1A0I A;  2VQE Q;  4ME3 A;  2E5L Q;  1VQI A;  3S2D H;  3W1G A;  1YI2 A;  2L15 A;  4B3T L;  5HY6 A;  1HJP A;  3UDI A;  1N8R C;  4C2M H;  1SN8 A;  2RF4 A;  2BH2 A;  3ULP A;  4HJA A;  1C0A A;  3A5Z B;  3GTM H;  5IP7 H;  1VCI A;  2AHO B;  4A3G H;  4X64 Q;  1PFS A;  4LF4 L;  4LF8 L;  4A3B H;  3PUW A;  4JI1 L;  1Y1W H;  1WCM G;  3M9B A;  4R4I A;  5IYB H;  1HR0 Q;  2EIF A;  1TWF H;  1A8V A;  1Q81 C;  2YU9 H;  5C4X G;  1L1O A;  3G48 A;  3UDF A;  1FVI A;  4L5R C;  1VQO A;  4QQB X;  3K7A H;  1NMF A;  3ULJ A;  1IBK Q;  4DPG A;  5ELN A;  2E2J H;  1L1O B;  3S24 A;  3RN5 A;  4LWC A;  2CKZ B;  3K8A A;  4O0A A;  5GQO A;  3RLO A;  3KJP A;  3PO2 G;  1Y14 B;  3I55 A;  1XMQ L;  2OTJ A;  3VDY A;  4NXM L;  3UDX A;  4B3R L;  1VQH A;  4X66 Q;  1K83 H;  1YJN A;  4JI6 Q;  1Q1E A;  1X3F A;  3PUV A;  1X9N A;  1W3S A;  3CPF A;  1NBW A;  1VQ5 A;  4JI7 Q;  3TQY A;  1K3R A;  2PI2 E;  4HID A;  4AQY L;  1U5K A;  4GKJ L;  2UXC L;  5C3E G;  3RNU A;  2B29 A;  2N49 A;  4A3L H;  2UU9 L;  1EIY B;  1XPO A;  2JA7 H;  4DR6 L;  1EOV A;  1EYG A;  4J15 A;  5GAH C;  5JJI A;  2VW9 A;  1RL2 A;  2CWA A;  2WB1 E;  2C35 B;  2NZO A;  5IE8 A;  4IOC A;  4EX5 A;  4A75 A;  2OTL A;  3I4M G;  1JJG A;  1K8A C;  3S17 H;  4L5Q A;  4JBW A;  1PH1 A;  3FKI H;  5GRO A;  1E7Z A;  4YY3 Q;  4A3E H;  1G51 A;  1YHA A;  4BA1 I;  1S3O A;  2KBN A;  4YHH Q;  1LUZ A;  3CC7 A;  1CSP A;  5IWA Q;  2JEA I;  2JA6 H;  4JI5 L;  4DK6 C;  1XNQ L;  4A3F G;  1I94 Q;  4Y52 H;  4TVA B;  1NTG A;  3RLF A;  1N33 Q;  4JI2 Q;  4YWK A;  5C0X J;  4DR7 L;  1X65 A;  3NEL A;  2VZA A;  4DV5 Q;  1FL0 A;  1IBM L;  4FDB A;  4X62 L;  1FJG L;  1LYL A;  4NXN L;  2Q2T A;  4NB3 A;  1KXL A;  1N36 L;  3CMA A;  3D31 A;  1NY4 A;  1AE2 A;  1D7Q A;  3GTQ H;  4DUZ Q;  5K36 G;  4EQ5 A;  4GNX A;  4JI4 Q;  3G6E A;  1WI5 A;  3CQZ H;  1JE5 A;  5JEA J;  3I4N H;  2WAQ G;  4IO9 A;  1OXU A;  2VUM H;  4BY7 G;  2MO0 A;  4DR3 L;  2CQO A;  4LFA L;  4C3I H;  2HT1 A;  3S14 H;  3CW2 C;  2F3I A;  4A3I G;  4GNX B;  3CCQ A;  4DR2 L;  4P73 A;  4B3M Q;  4PMW A;  5C44 H;  3KYH C;  1VQ4 A;  1J6Q A;  4LFC L;  1IZ6 A;  3J81 i;  1YVC A;  2UUA L;  4DR4 L;  4LNQ A;  4GKK L;  2Q2U A;  1O7I A;  3BZC A;  4IPG A;  3CD6 A;  2MFI A;  4JV5 L;  1Y1V H;  4AH6 A;  2UUB Q;  1Q1B A;  3PUZ A;  1I50 H;  4DUY Q;  4R4Q A;  2GVB A;  2WP8 J;  4AIM A;  2B63 G;  2K50 A;  2XGT A;  4LF7 L;  4OXP A;  5IT9 c;  2UUC L;  4IFD J;  4P75 A;  2UXD L;  4GN5 A;  1PH3 A;  4JI8 Q;  4LF6 L;  1V9P A;  5JJK A;  5IYC H;  1N34 L;  2K75 A;  3F8T A;  4BY1 G;  2K5H A;  4DK3 C;  4DV3 Q;  5H1S E;  1GVP A;  2Z6K C;  2OQK A;  1I5F A;  1IYJ B;  3CCU A;  4JOI C;  5LMN Q;  4LFB L;  1VQN A;  3AEV A;  3GDE A;  2ZTE A;  3PIP A;  2JA5 G;  1C7Y A;  4X65 Q;  1BKB A;  2CWP A;  3I2Z A;  1M1K C;  2JE6 I;  3CC4 A;  1IL2 A;  4WJ4 A;  4LF9 Q;  3GD7 A;  3CCR A;  2K4K A;  4DR5 L;  1YZ6 A;  4LUZ A;  3TEH B;  5BR8 Q;  1XPU A;  3HKZ G;  4P72 A;  2ZTC A;  3PIO A;  4BBS G;  4PZ6 A;  1E22 A;  1X3G A;  5IY0 A;  4XIG S;  3AQQ A;  1ASY A;  1XNR Q;  2AWN A;  1SFO H;  3DM3 A;  1SMX A;  2R92 G;  3W5O A;  1L2F A;  1VQA A;  3JAM c;  1JJ2 A;  1QZH A;  5FJ8 G;  4BBR H;  1VQL A;  5IP7 G;  2DGY A;  5C4J H;  1N32 L;  1TWH H;  3UE1 A;  4A3J H;  4A3C H;  1E3P A;  1G29 1;  1L1O C;  2AKW B;  4DV0 L;  3CAM A;  3G71 A;  4JI0 L;  2WAQ E;  3AYH B;  1QUQ B;  2YV5 A;  1PVO A;  4GLV B;  1LTL A;  1UE1 A;  1HZ9 A;  4YCW A;  1YHQ A;  1J5E Q;  3BZK A;  1KC8 C;  1X54 A;  4DV7 Q;  1GM5 A;  1KRS A;  1KD1 C;  2NVT H;  2UXB Q;  5M3M H;  3S1N H;  4WJ3 M;  3UDG A;  1GO3 E;  2ZJP A;  2VQE L;  5M3F H;  2E5L L;  1FGU A;  3H15 A;  2F4V Q;  2LXK A;  4MTN A;  5IP9 G;  5GAG C;  3U58 A;  2R7Z G;  1HNW L;  3HOW G;  3CP0 A;  3CF5 A;  4UP7 A;  3CCE A;  4X64 L;  2NN6 G;  3K7U C; 
#chains in the Genus database with same CATH topology
 4IZ8 A;  2QA4 A;  1MBY A;  3OYY A;  4EGV A;  3OMG A;  3C1E A;  2K5D A;  2VS1 A;  2RDF A;  3P7J A;  5CGK A;  2BA1 A;  4OGQ C;  3HOZ H;  5DM7 3;  4GN4 B;  1EOT A;  1SND A;  4DK0 A;  3T4A C;  3HKZ E;  4JI6 L;  2HCC A;  4C3H H;  1PRT B;  4TKO B;  3S17 B;  5KNB A;  1SE4 A;  4HED A;  2VXW A;  3BVZ A;  1TY0 A;  2E2I B;  1X3E A;  1P8L A;  2FFK B;  2E8G A;  3HOY G;  2HDM A;  5TSS A;  2K32 A;  3QWN A;  5C4X H;  3CXC A;  3KF6 A;  2NWG A;  1EUJ A;  5BN3 A;  5M5W H;  2YTX A;  1FNU A;  4Y7N H;  2QGQ A;  1CT1 D;  1TR5 A;  3DM1 A;  5C44 G;  3PO2 H;  1VQD A;  1DZ1 A;  3CQZ B;  1N33 L;  1WTW A;  1T5E A;  3GV3 A;  2F0P A;  3DLL A;  4OO1 I;  1B44 D;  2B2T C;  4ALP A;  4I7A A;  5C44 B;  5FLM G;  4L5T A;  2AQ2 B;  2KCT A;  3A7A B;  1Y8N B;  4F7X A;  2B2Y C;  3GTJ H;  3GTO H;  5M5Y H;  2NZ1 D;  4LF5 Q;  2PMZ B;  2XNA C;  3AB9 A;  3TS2 A;  5LL6 X;  4XDX A;  3TP5 A;  5IGC A;  3EJI A;  1JCK B;  2E2H B;  1VQG A;  1WTX A;  4QJF A;  1X55 A;  1K9M C;  2B2V C;  5GAE C;  4DUY L;  1R4Q B;  2EYL A;  3NWS A;  1B3Q A;  2SNS A;  3S1M H;  1JR0 D;  5D65 A;  1VF5 C;  2LY7 A;  2YTY A;  4RMF A;  3T1H Q;  4A3J G;  4HMJ A;  3MAQ A;  4FF2 A;  3OMC A;  1ICW A;  4X65 L;  1KDC A;  3KDF A;  4FNF A;  5CV7 A;  4ZQ3 A;  4BBR B;  1HR0 W;  3M7G A;  2IX1 A;  1SNC A;  1XXG A;  4A3J B;  2PZW A;  1XTD A;  1UEA B;  4DV1 L;  4A3G G;  3L2P A;  1WTO A;  2I07 B;  1AW7 A;  1A2T A;  4DAY B;  2B63 H;  1E2Z A;  2PMZ E;  4IPC A;  1RTO A;  1SRU A;  4DK1 A;  5M3M B;  4R8I A;  4HJ9 A;  2L55 A;  2A69 C;  2IY5 B;  3ULL A;  2F0H A;  2K5N A;  3K81 C;  1SE2 A;  5JPM C;  1EYA A;  2OQ0 A;  5DAU A;  1PRT C;  4DV7 L;  1IW7 D;  1ZYR C;  4N8F A;  4GN3 B;  4ZK9 B;  4MNO A;  3NUC A;  4LK1 C;  1SYE A;  4K8J A;  4F87 A;  4A3L G;  3KLS X;  5E7N A;  1Q8K A;  2F4V L;  1Y69 U;  2R92 H;  2JA7 G;  2F3V A;  2J7Z A;  3OWF A;  4LF8 Q;  3KJO A;  1H9K A;  1VQ9 A;  1A3V A;  1VS0 A;  4XTC S;  1LAC A;  2JA7 B;  4C3H B;  1YNN C;  2BE5 D;  2EJF C;  4DNT B;  1XMQ Q;  5ELO A;  2Q2H A;  2Z1C A;  5KND A;  2RSO A;  2P5Z X;  3LX0 A;  1KDA A;  2A68 C;  2L0C A;  2R7D A;  1TS2 A;  1E2V A;  1FD7 D;  1D8L A;  5M5W B;  4K2L A;  3QOJ A;  4Y7N B;  4NKL A;  3PF4 A;  2Q8R E;  3PO2 B;  1TVX A;  4O2D A;  3ZYY X;  3VR6 A;  1M90 C;  4BXX H;  4A3K H;  1A6X A;  2VY3 A;  1EL0 A;  4OO1 G;  5ELD A;  3SK6 A;  2MP1 A;  2I5M X;  5I9P A;  5IOC A;  3I56 A;  3J7A F;  1XNQ Q;  5LMN W;  4A3D H;  3FPP A;  3J7A 5;  1C9O A;  4JC0 A;  1L0W A;  3GTJ B;  3GTP H;  1CKN B;  4DR7 Q;  3H3V I;  4GZY C;  4RCN A;  5IYC G;  2CFM A;  5FLX E;  3C46 A;  1FJG Q;  3X3N A;  1F9P A;  5IYD H;  2IT1 A;  2PCF B;  1N36 Q;  5DNF A;  1OXV A;  2KEE A;  3DEO A;  1VQ7 A;  1O7Y A;  4LF5 L;  3GP7 A;  4BA2 I;  2L4N A;  1F2M A;  1O7Z A;  3S1M B;  3D4D A;  3PF5 A;  4IJL A;  2MNA A;  1I4H A;  2Z0S A;  1HZA A;  1BBU A;  2AQ1 B;  1VMC A;  4JBJ A;  4JV5 Q;  2PPB C;  1LAB A;  4JPB W;  3CPW A;  1WTV A;  3EIV A;  3JAM i;  4DV3 L;  3ER0 A;  2UUC Q;  5IT9 L;  3MC0 B;  3RR5 A;  3HZX A;  1ENC A;  3K57 A;  3D4R A;  1I4R A;  1WYD A;  5K36 H;  1Z7T A;  1TXY A;  5JEA G;  2ZJQ A;  3T1H L;  1YNX A;  2G9D A;  5JJZ A;  3M85 A;  1TWA H;  1TWH B;  2B2Y A;  4G4K A;  2LMC B;  1MSH A;  4KV6 A;  3LGJ A;  5HGQ A;  1W2B A;  4RFB A;  1FR3 A;  3PMF A;  4IPD A;  5I9O A;  4ZKC B;  3J80 L;  1SJH D;  4IFD G;  4MZ9 A;  3EA6 A;  1HTL D;  1GXD C;  1TQO A;  2PI2 A;  4PZ8 A;  4HTH A;  3HOX H;  5LHY 1;  1TKW B;  4IUP A;  4KKU A;  3Q22 A;  5DM6 3;  2Q2I A;  3NBH A;  2ATW A;  2WFW A;  3F2B A;  2J4X A;  4L8J A;  5C3X A;  3ITP A;  4HJ8 A;  3NBI A;  1HXY D;  1BOS A;  3AFP A;  3K5M A;  2NVQ H;  2XWJ B;  2RCN A;  3S1Q H;  1A0I A;  4ME3 A;  2LS0 1;  5A35 A;  4RKB A;  2RF4 A;  2BH2 A;  2QIL A;  1EU3 A;  3A5Z B;  4MTK A;  1VCI A;  3NWT A;  4LF8 L;  3M9B A;  4R4I A;  1HR0 Q;  5IYB H;  2YU9 H;  1CFM A;  1Q81 C;  2XRQ D;  4N9P A;  4L5R C;  4QQB X;  1NMF A;  4I65 A;  1IBK Q;  5ELN A;  2E2J H;  3RN5 A;  4O0A A;  4DXG A;  3I55 A;  1XMQ L;  2OTJ A;  3VDY A;  2NBF A;  4RGT A;  1TS5 A;  3UDX A;  1K83 H;  3K59 A;  4ID6 A;  1PRT F;  1X9N A;  1W3S A;  4CBV A;  4A3K B;  1NR2 A;  5C3E G;  1I4X A;  3RNU A;  5BN4 A;  1C8C A;  5EQ0 A;  3NQI A;  1EOV A;  3I4L A;  2C35 B;  5IE8 A;  4A75 A;  4EX5 A;  1EEI D;  4A3D B;  5ELB A;  2E75 C;  5T1G A;  2A5H A;  2CH4 W;  3FKI H;  1G51 A;  1BCP F;  3NSW A;  3A8K E;  4ZCK A;  2SNM A;  2JA6 H;  5FO8 B;  1XNQ L;  4TSS A;  2EY6 A;  1NTG A;  3RLF A;  2K01 A;  4DR7 L;  5I6Y A;  1FJG L;  1LYL A;  4WOR A;  4DNR B;  3WDN A;  1N36 L;  1NY4 A;  3GTQ H;  5K36 G;  4EQ5 A;  3VYR A;  3G6E A;  2F0W A;  1WI5 A;  2E76 C;  1JE5 A;  3I4N H;  2WAQ G;  1OXU A;  1AEX A;  2MO0 A;  3TZD A;  4C3I H;  1HA5 A;  1B9N A;  4A3I G;  4GNX B;  4PMW A;  3J81 i;  1IZ6 A;  1PZJ D;  1M4V A;  2Q2U A;  1O7I A;  4JV5 L;  1VDZ A;  1Y1V H;  4KN4 C;  2K50 A;  2XGT A;  4OXP A;  5IT9 c;  1STB A;  3H91 A;  4A3I B;  2UUC L;  3ND9 A;  5FKA C;  1D1I A;  1GUG A;  3CCU A;  5LMN Q;  1JQY D;  3AEV A;  1WD0 A;  3BVM A;  1C7Y A;  1GOZ A;  4WJ4 A;  4XQJ A;  1CQV A;  3HOX B;  1QJO A;  1B1Z A;  1G91 A;  4P72 A;  1SNO A;  2L12 A;  4BBS G;  4PZ6 A;  4PNY A;  1ASY A;  5IY0 A;  1XNR Q;  3W2D A;  2DNE A;  5C0X H;  2ZXO A;  4MN3 A;  1PTO D;  2OF1 A;  4ZUJ A;  2Z9H A;  2NVQ B;  2DGY A;  3UE1 A;  3S1Q B;  3OWE B;  4A3C H;  1TT2 A;  1DOM A;  2WAQ E;  1QUQ B;  2YV5 A;  1PVO A;  1YHQ A;  1HZ9 A;  3SK4 A;  1KRS A;  3H94 A;  1O7L A;  2B2W C;  2KEC A;  3UDG A;  1GO3 E;  1LTB D;  1F9S A;  4QB4 A;  1FGU A;  4AYB B;  4MTN A;  5IP9 G;  3I90 A;  2R7Z G;  3HOW G;  1S5F D;  2BDN A;  2NN6 G;  1MJE A;  3MXU A;  3OSO A;  3VYU A;  2EJM A;  1HR0 L;  5JVG 3;  3PGZ A;  4TRD A;  3I4O A;  4PZ7 A;  1GHJ A;  2K1B A;  3HOV G;  2NVX H;  3HOW B;  3MEF A;  4DAP A;  1IBK L;  3K5N A;  3E9I A;  4J6H A;  1PHJ A;  1HNZ Q;  5KGU A;  4Q5V A;  3CRL C;  3EN2 A;  2NUC A;  2WIN B;  1QZG A;  4RCO A;  4GS3 A;  2JEB I;  1IYV A;  2M2L A;  3E9H A;  2NTT A;  3K58 A;  3CC2 A;  3G7L A;  4G7O C;  2NZH A;  1SBB B;  1PYS B;  2JJQ A;  1FNW A;  4GNX C;  2DY8 A;  3QOL A;  2AWO A;  1WCM H;  3ICE A;  2F0Q A;  1JB3 A;  3M4P A;  1CA6 A;  1DON A;  4AYB E;  3R93 A;  1UE7 A;  2OCE A;  1H9R A;  5CV8 A;  2BDO A;  4DN4 M;  4JK1 C;  4DR1 Q;  4CDE C;  1PDQ A;  3GTQ B;  2A6E D;  1NMG A;  3I4N B;  2LSS A;  2KOL A;  1EIH A;  3GTL H;  4YIJ A;  4G57 A;  1D5M C;  4WFN 3;  2F0E A;  4CKB A;  3SK5 A;  1GD7 A;  3T53 B;  5KIX A;  4EQN A;  4JYA Q;  1Y1V B;  4B9X A;  5LMU Q;  4C3J G;  2CQA A;  3I4M H;  3PO3 G;  3CCV A;  1CKO A;  3CCM A;  2FJ2 A;  3I70 A;  3JC6 6;  4QY7 A;  4CDC C;  4K0K Q;  4PV1 C;  2E74 C;  2AUK A;  1RTN A;  2QDL A;  5EAY A;  1KIX A;  1DD2 A;  3R8B A;  4RH6 A;  1MKH A;  3MA2 B;  1VQM A;  1V43 A;  3MXN A;  4IPH A;  4B3S Q;  1S5B D;  3ZJY C;  1AZQ A;  4HAE A;  4R4O A;  5C3W A;  1XX8 A;  1ET9 A;  2EVB A;  1KL9 A;  1VQ8 A;  1BDO A;  3HGB A;  1I6V C;  3MFG A;  5LMN L;  3VR3 A;  2BE5 C;  4BY7 H;  1SYC A;  1OXS C;  3HOU G;  1O78 A;  1WTR A;  2B2U C;  3V2T A;  3Q0A A;  4DAM A;  1PTO H;  1BVS A;  1T9H A;  3K5O A;  3NTH A;  2O5I C;  3CME A;  1XNR L;  3KF8 A;  3TME A;  1PZI D;  1L0Y B;  2IWH A;  4A3B G;  3K0Y A;  1IXR A;  1Y1W G;  3HOU B;  3E0J A;  5L37 A;  2MUY A;  4BS9 A;  4DV2 L;  2F1M A;  1HNX Q;  4BY1 H;  2TSS A;  2EY2 A;  3HEJ A;  1B70 B;  2QW7 A;  2Q8T A;  1Q82 C;  3X3M A;  5EBD A;  3Q8D A;  2PQA A;  1X56 A;  2RDH A;  4GOP A;  3MXG A;  5T1I A;  1ASZ A;  1G2S A;  2N88 A;  2RVL A;  1U4R A;  3CKI B;  4I7Z C;  1CM9 A;  3LWU A;  3MHB A;  1JMC A;  2NVX B;  2NVY H;  4OEL B;  4CJ0 B;  3DEP A;  1B7Y B;  4JI1 Q;  5KNC A;  3SGI A;  4ABN A;  5FJ8 H;  2KHI A;  1HNW Q;  4OEM B;  3OOC A;  2K05 A;  1WJJ A;  3IAY A;  1LTS D;  2F52 A;  2JK8 A;  1SMY D;  3J7Z C;  3F1Z A;  1RHP A;  3FEW X;  4K6L A;  1ENA A;  5DEH A;  3U4V A;  1KNE A;  5I4D A;  1S40 A;  1HNZ L;  3Q23 A;  4YWL A;  3L9A X;  1WCM B;  5JVH 3;  3P1H A;  4IUV A;  2HIV A;  4CKC A;  4GKJ Q;  2JSO A;  2UU9 Q;  1Q12 A;  5IGE A;  5J39 A;  4JI3 Q;  2R7F A;  1CHQ D;  1BBW A;  3L7Z C;  1Z47 A;  2CHB D;  1H9S B;  4IUU A;  3TP6 A;  4K5V A;  3GO5 A;  3H0G H;  3S9W A;  2BH8 A;  2N8N A;  5ISR A;  3STB C;  4DR1 L;  2MHV A;  1PH7 A;  4X6A H;  3DWA A;  1HFG A;  3TRE A;  1VQE A;  4M1U B;  3TS0 A;  3I4M B;  1KHI A;  1K73 C;  1G6P A;  2K14 A;  1PMR A;  3E6Z X;  1XPR A;  3KBG A;  1LTG D;  3KUP A;  1EY5 A;  3VA7 A;  1EZ8 A;  4DR3 Q;  5LMU L;  4JYA L;  1VQ6 A;  1PFB A;  4IN3 A;  4K14 A;  4K2K A;  3K80 C;  1A3U A;  5ELF A;  1PZK D;  4NW2 A;  4K0K L;  4LFC Q;  4OHJ A;  3KK7 A;  3PQI A;  1OXX K;  4V0B A;  1QIL A;  4R9W A;  1B8A A;  4B3S L;  2BA0 A;  4LF7 Q;  4MHE A;  4RAU C;  4BBR G;  3MZ5 A;  2H4O A;  5IT9 E;  4YCV A;  1WTQ A;  3EBE A;  4KHV A;  4BY7 B;  1EQT A;  2YTV A;  4DGZ A;  3R2T A;  1PTO B;  3A74 A;  2EPB A;  2B39 A;  4ZKB B;  4OWT B;  3CCS A;  1PH5 A;  3BU2 A;  4A93 H;  5M3M G;  4DR5 Q;  5ELE A;  3DXJ C;  3A8J E;  4KY6 A;  1NR4 A;  1M8A A;  4U67 3;  4BY1 B;  2D62 A;  4UP9 A;  2XSC A;  3J80 E;  1WVL A;  2C5C A;  2DY7 A;  4A3M H;  3L0O A;  2PYK A;  4IFD I;  2EYF A;  4RGM A;  1HNX L;  2LFN A;  4DV0 Q;  1STH A;  4JVZ A;  3A55 A;  2OWO A;  1JOQ A;  1MD2 D;  3PSI A;  3HOZ G;  1ZXT A;  1QUQ A;  4XQQ A;  2IJ0 A;  1VF7 A;  2ZT9 C;  2JA8 H;  1SNM A;  2RQX A;  1QG7 A;  2EQS A;  4R1J A;  4FXK C;  1TWC H;  1VMP A;  4C3H G;  1WOC A;  2E5L Q;  3W1G A;  3HOZ B;  2D9U A;  3ULP A;  2EYP A;  1EIG A;  1QE6 A;  5G3L F;  3PUW A;  4JI1 L;  1K0S A;  2QKI C;  4C1N I;  1A8V A;  3FRP B;  5C4X G;  3UDF A;  3G6J B;  1FVI A;  4IAL A;  1ROD A;  1AFP A;  2FMM A;  1L1O B;  3N52 A;  3KJP A;  3K8A A;  5GQO A;  2WAC A;  3PO2 G;  1Y14 B;  1ILP A;  5C4X B;  2PZU A;  4CHT B;  3PUV A;  3CPF A;  1NBW A;  4HID A;  1K3R A;  2V4D A;  1U5K A;  4GKJ L;  1BO0 A;  2N49 A;  3H0G B;  2UU9 L;  1EYG A;  3SDZ A;  1RL2 A;  2CWA A;  4FF3 A;  1K8A C;  4L5Q A;  5GRO A;  2F0L A;  4A3E H;  3OIP A;  2KUM A;  1II3 A;  1QNK A;  1YHA A;  2KCC A;  4BA1 I;  5E4W C;  1S3O A;  3GTO B;  5M5Y B;  1LUZ A;  5IWA Q;  4DK6 C;  5JOB A;  4TVA B;  1TS4 A;  4JI2 Q;  5C0X J;  3NEL A;  2O4X A;  1FL0 A;  1ONL A;  1PTO C;  1Y8P B;  4NB3 A;  4K8I A;  3D31 A;  4HSV A;  3U9O A;  1AE2 A;  4CJ1 B;  3PIO 3;  4XYQ A;  1D5Z C;  4DU9 A;  2VUM H;  4DR3 L;  2C9O A;  2HT1 A;  1LTI D;  2EY5 A;  3CW2 C;  5HUR A;  2F3I A;  3O13 A;  1TU2 B;  4B3M Q;  2PQE A;  1I4Q A;  4DF7 A;  1VQ4 A;  1J6Q A;  1FYC A;  4LFC L;  1HCZ A;  1YVC A;  4LNQ A;  5IGB A;  4NMZ A;  2J0T D;  3BZC A;  3CD6 A;  4MIU A;  4AH6 A;  2SDF A;  1Q1B A;  1I50 H;  2B63 G;  3VYT A;  4LF7 L;  3T51 B;  4P75 A;  1W6K A;  4JI8 Q;  1YNJ C;  2B2T A;  4O42 A;  2DJF C;  2F0O A;  2K75 A;  3F8T A;  2AQ3 B;  1SYF A;  2Z6K C;  5C4H A;  3QR8 A;  1IYJ B;  4JOI C;  2B63 B;  1VQN A;  2XVS A;  3HG9 A;  1BKB A;  1PFN A;  1TS3 A;  3I2Z A;  1CK1 A;  2JE6 I;  1M1K C;  3CC4 A;  4LF9 Q;  4A3M B;  4DR5 L;  3BS1 A;  4IQZ A;  5EKL A;  4KD3 A;  4LUZ A;  2EYH A;  5BR8 Q;  3J81 L;  3N6R A;  4L63 B;  1NAP A;  3TBI B;  1X3G A;  2R92 G;  2B2V A;  1SFO H;  3TN2 A;  1JJ2 A;  3JAM c;  2PO4 A;  3ERQ A;  2M9V A;  3A7L A;  4QUF A;  1TWC B;  3D4W A;  2R92 B;  1E3P A;  1L1O C;  1G29 1;  4DV0 L;  1A3T A;  4N9T A;  2KVM A;  1UE1 A;  3BZK A;  1KC8 C;  1X54 A;  3EQL C;  4V19 0;  2UXB Q;  1SXT A;  4WJ3 M;  1KDB A;  1STA A;  2A6E C;  5M3F H;  2E5L L;  2HQE A;  4J8Q A;  3U58 A;  3CP0 A;  1HUN A;  5NUC A;  3CCE A;  2OEO A;  3K7U C;  1LV9 A;  4BXX G;  1D5X C;  2F3W A;  4A3K G;  1EWI A;  1KTK A;  2DUD A;  2GA4 B;  2NN6 I;  3TSS A;  2YYZ A;  2K6A A;  3PV0 A;  3OIQ A;  4JCV E;  4POG A;  4A3D G;  2R93 H;  2DJG C;  1NCV A;  2I5L X;  3ERS X;  4X3T A;  2A19 A;  4C1N K;  5J22 A;  5IYD G;  4X3S A;  4PG3 A;  1X6O A;  3VYS A;  4B3R Q;  4A3E B;  4P71 A;  3C1F A;  3SHL A;  3GTP B;  5KEE A;  1PH2 A;  1EY0 A;  1Q46 A;  3HP3 A;  4ZAI A;  1H9M A;  5FO9 B;  1EYC A;  3NE5 B;  2VUM G;  4UAI A;  2A69 D;  1YHB A;  3NK9 A;  1IBL Q;  5IWA L;  2IX3 A;  3T1Y Q;  2DN8 A;  1SR3 A;  2KHJ A;  2IW3 A;  2HHH Q;  4ZUI A;  4JI2 L;  2VUM B;  1JWS D;  3V96 A;  1ZYR D;  1DYQ A;  4ZYS A;  4EQO A;  5IIF A;  4DV4 Q;  1NSN S;  3W1B A;  1I6H H;  2R61 A;  3SVM A;  1K8G A;  4HMI A;  1I50 B;  2HCI A;  1CI3 M;  2B3G A;  4B3M L;  1BCP D;  2K52 A;  1ILQ A;  4IJH A;  2Y0S B;  2IHE A;  2QF7 A;  1TWA B;  2MO1 A;  4IUN A;  3K6O A;  3D3R A;  5D14 A;  3HOX G;  2VQF Q;  3S1R H;  3MTS A;  1MHW C;  1IHZ A;  2QDB A;  4JI8 L;  1CHP D;  2JXM B;  2A68 D;  3VR5 A;  1A63 A;  1LLR D;  3U50 C;  2A1A A;  4A76 A;  1XMO Q;  2K28 A;  4NP5 A;  1SFO B;  3KLW A;  1V1Q A;  1GHK A;  1YJ9 A;  4LF9 L;  2ID0 A;  1SMY C;  2HQL A;  4YWM A;  5A2Q E;  1ESR A;  4UP8 A;  3J81 c;  5BR8 L;  3F2C A;  1CTM A;  4FXG C;  3SR1 A;  4DAY A;  1BR9 A;  2M00 A;  4HIM A;  3KDF B;  1S72 A;  2E2D C;  2JQO A;  1YEZ A;  4F88 A;  2LXJ A;  1SSO A;  5IYB G;  5IOD A;  3B6Y A;  3FP9 A;  4AYB G;  3DHQ A;  3TP7 A;  1SE8 A;  2F0T A;  2Z8L A;  2HIX A;  2Y0S E;  1PYB A;  5M3F B;  2KEN A;  5KRU A;  1Z6H A;  2A8V A;  2GN5 A;  2YU9 B;  1AH9 A;  3S15 H;  4JOI A;  3SE0 A;  4C56 C;  3H6M A;  4XXE A;  2NYZ D;  3S16 H;  2RCF A;  4OX9 Q;  2UXB L;  4RG1 A;  2EZV A;  2E2J B;  3QG1 A;  1GJX A;  1EIF A;  1F2L A;  4IUQ A;  1K83 B;  1G6Z A;  2PW5 A;  3FKI G;  3M7N A;  2X6L A;  4FP5 D;  2ALY B;  2RBM A;  2BOS A;  3T56 B;  2V1C C;  4A4I A;  3W3A A;  2K5V A;  4E6I A;  2JA6 G;  2I0Q A;  4QF4 A;  1U4M A;  4GLX A;  3S2H H;  4NXM Q;  3FKI B;  5M5X H;  1SRO A;  3TP8 A;  3D8G A;  4Q0F A;  3QIA A;  4AQY Q;  1HA6 A;  2IX0 A;  4F8M A;  1Z9F A;  5E4X A;  2UXC Q;  5JPN C;  2JA6 B;  1HQM C;  4OWX B;  2G5D A;  4DR6 Q;  3I4N G;  1PYW D;  3F2U A;  4DA2 A;  2ZXR A;  1N9W A;  4C3I G;  1YJW A;  1TY2 A;  2A6H D;  1E2W A;  4QGU A;  3WWV A;  3ONA B;  3R3O A;  1CKN A;  1BXT A;  1Y1V G;  5CV4 A;  3IL8 A;  4DKA C;  5K5P A;  5CV6 A;  1YIJ A;  1L0X B;  1IBL L;  4C3I B;  4HIK A;  1JE4 A;  4H13 C;  1QWY A;  1ET6 A;  3T1Y L;  2HHH L;  1DM0 B;  1SYG A;  2ICI A;  4KHZ A;  3TDQ A;  2E2I H;  4UPA A;  3KLS A;  5C4Z A;  1IBM Q;  1UAP A;  1IL8 A;  4ULL A;  2FXQ A;  4NXN Q;  2PW7 A;  1HH2 P;  1UEB A;  5FLX c;  1HZC A;  3RN2 A;  4DV4 L;  1LT3 D;  2JA9 A;  1PH8 A;  4BWG B;  5IGD A;  4JBM A;  1UE5 A;  3GTG H;  3M4Q A;  4LUO A;  5EKI A;  3BG3 A;  1A62 A;  4LFA Q;  3RMH A;  1GUW A;  4GLA C;  3U4Z A;  1IW7 C;  4H02 A;  3HOY H;  4DR2 Q;  1EWC A;  1OXT A;  3M4Y A;  3A5U A;  1HZB A;  5C5M A;  2MJ8 A;  4DR4 Q;  1I4P A;  1PV4 A;  4GKK Q;  1KRT A;  2ES2 A;  2O5J C;  3WOF A;  5C0X G;  1QVG A;  1Q7Y C;  1SEB D;  2RSN A;  1YIT A;  2L11 A;  2K5W A;  2JEA I;  2VQF L;  4PQX A;  4S3S A;  4LF6 Q;  2B8F A;  3D0F A;  3HS0 C;  2CCZ A;  1K8O A;  1NNX A;  4LW1 A;  1JIC A;  4A3C G;  2IHF A;  3I7F A;  5F2D A;  5AFW A;  2R3Z A;  3HRZ C;  5A2Q L;  5FLM H;  1XMO L;  3OW2 A;  4KLK A;  4KKT A;  1Q86 C;  2E2H H;  4YCU A;  3NEM A;  4DNI A;  4POF A;  1VQF A;  4HR7 B;  4KJO A;  1I4G A;  4ILW A;  3CHB D;  5COR A;  1MIU A;  1KLG D;  1XTC D;  2GVA A;  4K6D A;  2ZTD A;  4KD4 A;  2F0I A;  4DV1 Q;  2WB1 G;  1N32 Q;  3S16 B;  2RHS B;  2FIN B;  4N8X 1;  3A0J A;  1HQR D;  4R4T A;  1AN8 A;  3NEN A;  4JI0 Q;  3C3L A;  1EY4 A;  1RIP A;  2WB1 B;  3NBH B;  1UNS A;  1DJR D;  2X69 A;  2FMC A;  4OX9 L;  1QVF A;  1VQK A;  2VQE Q;  3SXH A;  1VQI A;  1YI2 A;  2L15 A;  3ND8 A;  5HY6 A;  3UDI A;  1N8R C;  1EY9 A;  2EJG C;  4HJA A;  1C0A A;  3FDT A;  2AHO B;  1V1P B;  4A3G H;  1QNU A;  1WCM G;  2EIF A;  1TWF H;  3S2H B;  1SE3 A;  3AU7 A;  5M5X B;  1RDP D;  1AP0 A;  1ICF B;  1EYD A;  2ZXP A;  3I91 A;  3ULJ A;  3DWQ A;  4DPG A;  4LWC A;  2EE1 A;  2TMP A;  2B2W A;  4NXM L;  1K3B C;  2K7V A;  4PMC A;  4QCL A;  1VQH A;  4X66 Q;  4CKE A;  1YJN A;  1CA5 A;  1V8Q A;  1X3F A;  3T13 A;  1D1K A;  1H9J A;  4JI7 Q;  3TQY A;  4AQY L;  2PI2 E;  2PNR C;  2UXC L;  2HUG A;  4O1N A;  2B29 A;  5JAV A;  4A3L H;  1EIY B;  3OW7 A;  1XPO A;  2JA7 H;  4DR6 L;  1STY A;  1Q90 A;  1OO9 B;  4IOC A;  2WB1 E;  3TZU A;  2NZO A;  3I4M G;  3GTL B;  4G7H C;  2EYM A;  4ZLT F;  2OTL A;  2L1B A;  5I2X A;  1ML0 D;  2F0K A;  4UHV A;  4JBW A;  4UDU C;  1E7Z A;  4YY3 Q;  1CZW A;  5D3I B;  2KBN A;  4YHH Q;  3UI2 A;  3CC7 A;  5J1Z A;  1J8I A;  1EWH A;  1Q3L A;  1I94 Q;  4YWK A;  3GTG B;  1BCP B;  1X65 A;  2H1E A;  4DV5 Q;  3PIP 3;  1HFN A;  1IBM L;  2F0S A;  5CMD A;  3HOY B;  2D5D A;  3E5S A;  4NXN L;  3ERO A;  1RF2 D;  1D7Q A;  4DUZ Q;  4GNX A;  4JI4 Q;  1S5D D;  2HDL A;  1QCB D;  4IO9 A;  4BY7 G;  1SNP A;  5I6W A;  2CQO A;  4LFA L;  2HD3 A;  3S14 H;  4NDX A;  4DR2 L;  1WTH A;  4P73 A;  4HCE A;  3KYH C;  4OO1 H;  1F9R A;  3D6C A;  4FO2 A;  4DR4 L;  4GKK L;  1HHV A;  4IPG A;  3J7A V;  1STE A;  2UUB Q;  2ENB A;  2OXP A;  4HN7 A;  3E3X A;  2VB3 X;  3A8I E;  3A56 A;  1LO5 D;  4LF6 L;  5JJK A;  5IYC H;  4BY1 G;  4DK3 C;  4DV3 Q;  4LAA A;  1E0B A;  1GVP A;  2X6G A;  3BVG A;  2JP1 A;  1BF4 A;  3AMU A;  1HUM A;  4PMB A;  4HSP A;  1F9Q A;  1XWE A;  2CWP A;  3GD7 A;  1EU4 A;  3CCR A;  1XPU A;  3TEH B;  3JAM L;  1IYU A;  3PIO A;  2MPM A;  3J81 E;  1B50 A;  4WJW A;  4XIG S;  1PLF A;  3CRK C;  1SMX A;  3DM3 A;  3EVQ A;  1VQA A;  2CW0 D;  4RHR A;  2KCN A;  3BDO A;  1QZH A;  5FJ8 G;  4IUT A;  2L9H A;  1VQL A;  1SJE D;  5M9O A;  5C4J H;  1N32 L;  1TWH H;  1ESF A;  2NVY B;  4HCS A;  5JEA H;  1DXM A;  4JI0 L;  1GUS A;  4GLV B;  4YCW A;  1J5E Q;  2LKV A;  4A3G B;  1GM5 A;  2NVT H;  2B2U A;  3S1N H;  1S5C D;  2ZJP A;  1TWF B;  2VQE L;  5EPL A;  2XN9 C;  2Z4I A;  4DAV A;  5GAG C;  1G8Z D;  5COY A;  1HNW L;  2A73 B;  3D6W A;  4IFD H;  2JYO A;  4UP7 A;  2DNC A;  1KNA A;  3H0G G;  2EDG A;  1PH9 A;  3V05 A;  4DFA A;  3FPU B;  4NPS A;  3OTO Q;  2ZM6 Q;  3J81 j;  4HJ5 A;  2VNU D;  1IKM A;  1LT4 D;  1H95 A;  1BCP C;  1E1T A;  4JBK A;  5CV9 A;  1U4L A;  4KI0 A;  4X66 L;  3PCO B;  4JI3 L;  2K03 A;  4JI7 L;  1EY8 A;  1RJT A;  3DMU A;  4LUV A;  5G3L D;  4K5X A;  1CUK A;  1V1O A;  3G4S A;  3FVQ A;  1SYD A;  3BJU A;  5KYL A;  4H44 C;  2CH4 A;  2ASB A;  2SOB A;  4YY3 L;  5KYI A;  4YHH L;  3AFQ A;  2NTS A;  1I94 L;  1NE3 A;  3CCJ A;  3IFD A;  3UE0 A;  1PH6 A;  4DV5 L;  3QO2 A;  1EQV A;  1KAB A;  3OHX C;  2PZT A;  4JG2 A;  3S14 B;  3E0E A;  5CC4 A;  5IGF A;  3M3Y H;  1J9O A;  1DCZ A;  5C3E H;  4DUZ L;  1LTR D;  4JI4 L;  1BUV T;  1VQB A;  4A93 G;  4B9W A;  2D0O A;  3T16 A;  3WOE A;  2KA7 A;  1EY7 A;  3H3V H;  4APV A;  1PXU A;  2XTI A;  2KCM A;  1U0L A;  1EQQ A;  1KAW A;  4A93 B;  1QOH A;  2EYO A;  4A3M G;  2UUB L;  3F2D A;  1BQQ T;  2F0D A;  1PA6 A;  5C6A A;  1KAA A;  2I46 A;  3MXN B;  3RZO H;  2WKD A;  2RKS A;  4WRD A;  2NB0 A;  2G9H D;  4FF1 A;  1EFW A;  1VQC A;  5EGT A;  1T5X D;  1GKH A;  4Z9C B;  4CGY B;  5ELC A;  1SAP A;  2QEX A;  2JA8 G;  1EFI D;  1Q8I A;  4DV6 Q;  3FMC A;  2XRS D;  1C4Q A;  5HGT A;  2K5Q A;  2N78 A;  1EEF D;  3NPP A;  5CYU A;  2XWB B;  4A3I H;  4OIJ A;  1C48 A;  3VA5 A;  1CZG A;  5C4J B;  2N3S A;  4RWS C;  4OL7 A;  2JA8 B;  3STB D;  5AJ3 Q;  4X3U A;  1U4P A;  5FK9 C;  2KED A;  1OTC A;  2ZJR A;  3DUZ A;  3KF8 B;  3NXW A;  5DLQ E;  2QEJ C;  1R9T H;  2NVT B;  3S1N B;  1STG A;  1AZP A;  1HPC A;  2A6H C;  3C2P A;  2AMC B;  3RLN A;  1CKM A;  1CSQ A;  4LMQ D;  4KHP Q;  1E1O A;  1XJV A;  2EXD A;  1A15 A;  1J5E L;  2L5T A;  4QIW B;  2K04 A;  2PNH A;  4B3T Q;  2IPK D;  2VL6 A;  2PQA B;  4BBS H;  1Y8O B;  1JT8 A;  3KOJ A;  4GOP B;  1PH4 A;  3FHW A;  4JW0 A;  1TWG H;  1SLJ A;  1X3Q A;  1GUT A;  4G7Z C;  1V1P A;  4LF4 Q;  4HJ7 A;  1F2Z A;  1EY6 A;  3PUY A;  2Z6B A;  4FF4 A;  3PUX A;  5BN5 A;  2I5H A;  3NQT A;  4TQU S;  5EPJ A;  4A3E G;  4FYD A;  4X3K A;  1VQP A;  4KMU C;  3OTO L;  2ZM6 L;  2SEB D;  1LTT D;  5JJL A;  1WTP A;  1K28 A;  4CDF C;  1E24 A;  4HIO A;  1B4O A;  3K0X A;  1LM0 A;  1UE6 A;  1H9S A;  3CU7 A;  2WV6 D;  5IP9 H;  2R7Z H;  1HRJ A;  2R6G A;  3HOW H;  1CQF A;  4RGO S;  1R4P B;  1YBY A;  1DGS A;  2OT2 A;  2NN6 H;  1F77 A;  3OPO A;  4QIW E;  2QCP X;  1NJI C;  3KF6 B;  3TRZ A;  3HOV H;  1PRT D;  5LL6 S;  5J3B A;  3SEB A;  3M3Y B;  3HFZ B;  1P16 A;  1ZEQ X;  5C3E B;  2K33 A;  4JI5 Q;  2A74 C;  4KK7 A;  5FOB B;  5FLX L;  4R4C A;  2O2L D;  4L5S A;  1U9R A;  2Y0S G;  4X62 Q;  3IKJ A;  3NHH A;  3GTK H;  1QVC A;  3P75 A;  2F4I A;  3BZD B;  3RZD H;  1K0R A;  1JWU D;  1YNN D;  3I3C A;  1WD1 A;  4H0L C;  1JOK A;  3BYT B;  1JB7 A;  3RZO B;  3H09 A;  2UUA Q;  4UY8 C;  4A3F H;  4IOA A;  3Q6S A;  3RUZ A;  3CCL A;  5D3D A;  4IUR A;  3J80 i;  1MJC A;  1PTO F;  2UXD Q;  1EZ6 A;  1X32 A;  5C0X I;  4FXD A;  2WAQ B;  4OIK A;  3M4O H;  1N34 Q;  4RKL A;  1LT5 D;  1GUO A;  2B8G A;  2D0P A;  5EKK A;  3K5L A;  1IKL A;  1K8M A;  4LFB Q;  3A54 A;  4L6T B;  1EQR A;  4XQN A;  3I72 A;  2F0J A;  3IFT A;  2EXZ A;  4DV6 L;  3L3O C;  1WFQ A;  4C3J H;  4OWW B;  4KTA A;  3PO3 H;  1VQJ A;  4GOP C;  5M3F G;  3NP8 A;  3EFX D;  2KHS A;  1R9T B;  1MSG A;  1S5E D;  2MQH A;  2XIW A;  3HKS A;  1QB5 D;  4KJN A;  1X3P A;  2RHQ B;  3KBX A;  3J7Y W;  4XT1 B;  1B53 A;  5AJ3 L;  1BNZ A;  5EPK A;  1JJC B;  2KQ3 A;  3MWY W;  3J80 c;  5GAD C;  4CJ2 C;  2F0N A;  2Z6K A;  5EJW A;  2JA5 H;  2H5X A;  2D2C C;  3KFU A;  3U9S A;  4DV2 Q;  1UWV A;  3IRB A;  1I3Q H;  4QL5 A;  4P74 A;  4BBS B;  2R93 G;  2Q8I B;  4KHP L;  1GUN A;  3GQB A;  1AE3 A;  4OON A;  1KQS A;  1TWG B;  5CR3 A;  2CVR A;  3BYY B;  3MXP A;  1F2Y A;  2F0F A;  4QMG A;  3HOU H;  3S2D H;  5CBA E;  4B3T L;  1HJP A;  2R93 B;  4C2M H;  1SN8 A;  4KKS A;  1JOO A;  3GTM H;  4H7B A;  5IP7 H;  1JC7 A;  4XYO A;  4X64 Q;  1PFS A;  4LF4 L;  3VR2 A;  4A3B H;  1Y1W H;  5CV5 A;  1TII D;  1YNJ D;  1DOK A;  1L1O A;  1MGS A;  3G48 A;  3VR4 A;  2WII B;  1VQO A;  3RD4 A;  3K7A H;  2EYJ A;  1S4Z A;  4EQP A;  3S24 A;  1G2T A;  2CKZ B;  2Z4H A;  3NTI A;  3RLO A;  1XYI A;  2R7Z B;  3I8Z A;  3SK8 A;  1JWM D;  2RA4 A;  4B3R L;  4KY5 A;  3BDL A;  2IL8 A;  3R2I A;  4JI6 Q;  1Q1E A;  3H3V C;  1VQ5 A;  2RDG A;  1SYB A;  1STN A;  3HOV B;  4LJZ C;  3P20 A;  4ME5 A;  4J15 A;  5GAH C;  5JJI A;  4ODG A;  2VW9 A;  3I73 A;  1JJG A;  1B9M A;  3S17 H;  3NTK A;  2EY1 A;  5EBC A;  1B2T A;  1PH1 A;  1NUC A;  3LWE A;  2F0G A;  4K5W A;  1RCV D;  1SNQ A;  1I6H B;  1RKN A;  4R8N A;  3QB3 A;  1ZKO A;  1CSP A;  3GTK B;  3LNN A;  1FNV A;  4JI5 L;  4RHS A;  4Y52 H;  4A3F G;  3RZD B;  1N33 Q;  2EOT A;  1DOL A;  2VZA A;  2CW0 C;  4FDB A;  4X62 L;  4KN7 C;  4ZRZ A;  2Q2T A;  1KXL A;  2F0V A;  3CMA A;  1SDF A;  5E1F A;  1LTA D;  3S1R B;  4A3F B;  3CQZ H;  5JEA J;  2KJX A;  4B08 A;  3CCQ A;  2ICE C;  5C44 H;  3M4O B;  1HTP A;  2UUA L;  3QJY A;  4M8A A;  2MFI A;  4P2C B;  5E3F A;  1LT6 D;  3PUZ A;  4DUY Q;  4R4Q A;  2GVB A;  2WP8 J;  4AIM A;  2FHT A;  4IFD J;  2UXD L;  4GN5 A;  1PH3 A;  3MEH A;  1V9P A;  2BCO A;  3URY A;  1N34 L;  4C3J B;  1A2U A;  4FVM A;  2K5H A;  3KLR A;  1B3A A;  5H1S E;  3PO3 B;  5C5L A;  2OQK A;  1I5F A;  2N55 A;  4LFB L;  1JOR A;  3GDE A;  2ZTE A;  4RGN A;  3PIP A;  2VB2 X;  4EVO A;  2JA5 G;  3DWP A;  4X65 Q;  1IL2 A;  2WKC A;  2K4K A;  1YZ6 A;  1ENF A;  3HKZ G;  2ZTC A;  3JAM E;  4QUC A;  1E22 A;  2JA5 B;  3AQQ A;  3S15 B;  2AWN A;  3W5O A;  1L2F A;  3GV6 A;  1BBX C;  1I3Q B;  3MFY A;  4BBR H;  4XT3 B;  1RD9 D;  3HKZ B;  5IP7 G;  3MVV A;  1MI2 A;  2F0U A;  3Q24 A;  4A3J H;  4DXF A;  1D6E C;  2F0M A;  3BDC A;  2AKW B;  1PFM A;  5CBE E;  3CAM A;  3S2D B;  3G71 A;  5FO7 B;  5IGG A;  3AYH B;  4C2M B;  1KLU D;  1UUP A;  1W6J A;  1LTL A;  3GTM B;  1D2B A;  4DV7 Q;  4CDD C;  1KD1 C;  4KY7 A;  5M3M H;  2JN4 A;  4A3B B;  5I2Y A;  1Y1W B;  2MGS A;  4U68 A;  4J1M A;  4RA8 A;  3H15 A;  2F4V Q;  1O80 A;  2AUJ D;  2LXK A;  3K7A B;  2F03 A;  3CF5 A;  4X64 L;  1FGB D; 
#chains in the Genus database with same CATH homology
 4BXX G;  1HR0 L;  4A3K G;  1EWI A;  3PGZ A;  2QA4 A;  3H0G G;  3I4O A;  2DUD A;  2NN6 I;  4PZ7 A;  3OYY A;  3HOV G;  1PH9 A;  2YYZ A;  2NVX H;  3PV0 A;  4NPS A;  2VS1 A;  3MEF A;  3OTO Q;  3J81 j;  2ZM6 Q;  4HJ5 A;  1IBK L;  2VNU D;  1H95 A;  2BA1 A;  4JCV E;  4POG A;  3HOZ H;  4A3D G;  2R93 H;  1E1T A;  4GN4 B;  4JBK A;  3E9I A;  1PHJ A;  1HNZ Q;  4KI0 A;  2I5L X;  3ERS X;  3HKZ E;  3EN2 A;  4X66 L;  2A19 A;  4JI6 L;  3PCO B;  4JI3 L;  4C3H H;  5IYD G;  1QZG A;  4GS3 A;  1X6O A;  2JEB I;  4PG3 A;  4JI7 L;  4B3R Q;  3E9H A;  4P71 A;  3CC2 A;  2NZH A;  4LUV A;  1PH2 A;  1Q46 A;  1CUK A;  1PYS B;  1X3E A;  1P8L A;  2JJQ A;  3G4S A;  4GNX C;  2E8G A;  3BJU A;  3HOY G;  2AWO A;  1WCM H;  3ICE A;  5C4X H;  2ASB A;  3M4P A;  3KF6 A;  3CXC A;  2VUM G;  1EUJ A;  4YY3 L;  5M5W H;  2YTX A;  4AYB E;  4Y7N H;  1UE7 A;  2QGQ A;  4YHH L;  2OCE A;  1YHB A;  3AFQ A;  5C44 G;  4DR1 Q;  1IBL Q;  5IWA L;  3PO2 H;  1VQD A;  3T1Y Q;  1SR3 A;  2KHJ A;  2HHH Q;  1I94 L;  1NMG A;  1N33 L;  1NE3 A;  2LSS A;  4JI2 L;  3CCJ A;  3UE0 A;  1PH6 A;  3DLL A;  4DV5 L;  4OO1 I;  3GTL H;  4JG2 A;  4ALP A;  3E0E A;  3M3Y H;  4DV4 Q;  5FLM G;  5C3E H;  4L5T A;  1GD7 A;  2KCT A;  4DUZ L;  3W1B A;  4JI4 L;  1I6H H;  3GTJ H;  3GTO H;  1VQB A;  1K8G A;  5M5Y H;  4JYA Q;  5LMU Q;  4LF5 Q;  4A93 G;  2D0O A;  3I4M H;  3PO3 G;  3CCV A;  1CKO A;  3CCM A;  3TS2 A;  2B3G A;  3JC6 6;  4QY7 A;  4APV A;  4B3M L;  3H3V H;  4K0K Q;  2K52 A;  2XTI A;  4IJH A;  1KIX A;  5EAY A;  2KCM A;  2IHE A;  1U0L A;  1MKH A;  1EQQ A;  1VQM A;  1VQG A;  1KAW A;  1V43 A;  1X55 A;  4IPH A;  4QJF A;  4A3M G;  2MO1 A;  5GAE C;  1K9M C;  4DUY L;  2UUB L;  3HOX G;  4B3S Q;  2VQF Q;  3ZJY C;  3F2D A;  3S1R H;  1PA6 A;  3S1M H;  4R4O A;  4JI8 L;  1KL9 A;  3MXN B;  3RZO H;  1VQ8 A;  1A63 A;  3U50 C;  2A1A A;  1EFW A;  4A76 A;  1VQC A;  2YTY A;  4RMF A;  1GKH A;  3T1H Q;  1XMO Q;  5LMN L;  4A3J G;  2QEX A;  2JA8 G;  3KLW A;  4X65 L;  1V1Q A;  4DV6 Q;  4BY7 H;  1YJ9 A;  3KDF A;  4LF9 L;  2ID0 A;  1OXS C;  2HQL A;  2N78 A;  4YWM A;  3HOU G;  4A3I H;  4UP8 A;  3J81 c;  1HR0 W;  5BR8 L;  3F2C A;  4DAM A;  2IX1 A;  1BVS A;  1T9H A;  2N3S A;  3KDF B;  4HIM A;  1XTD A;  3CME A;  1S72 A;  1XNR L;  4DV1 L;  3STB D;  5AJ3 Q;  2JQO A;  4A3G G;  1YEZ A;  3L2P A;  4A3B G;  1IXR A;  4DAY B;  1Y1W G;  2LXJ A;  2B63 H;  5IYB G;  1OTC A;  2ZJR A;  2PMZ E;  3B6Y A;  3KF8 B;  3FP9 A;  4IPC A;  5DLQ E;  4AYB G;  4DV2 L;  1R9T H;  1HNX Q;  1SRU A;  1SE8 A;  4HJ9 A;  4BY1 H;  2HIX A;  2Y0S E;  1PYB A;  2IY5 B;  2KEN A;  3ULL A;  2AMC B;  3RLN A;  1CKM A;  1B70 B;  2K5N A;  2GN5 A;  1CSQ A;  3K81 C;  2A8V A;  1Q82 C;  1E1O A;  4KHP Q;  1XJV A;  2EXD A;  4JOI A;  3S15 H;  1AH9 A;  1J5E L;  2OQ0 A;  3Q8D A;  2PQA A;  3S16 H;  4DV7 L;  1X56 A;  4GOP A;  4OX9 Q;  2UXB L;  1ASZ A;  4GN3 B;  4MNO A;  4RG1 A;  2PNH A;  4B3T Q;  2VL6 A;  2PQA B;  4BBS H;  4A3L G;  1JT8 A;  3KOJ A;  5E7N A;  1Q8K A;  4GOP B;  1PH4 A;  2F4V L;  3FHW A;  2R92 H;  2JA7 G;  1JMC A;  1TWG H;  1EIF A;  1SLJ A;  2NVY H;  4LF4 Q;  4HJ7 A;  3PUY A;  4LF8 Q;  1B7Y B;  4JI1 Q;  3KJO A;  3SGI A;  5FJ8 H;  1VQ9 A;  3PUX A;  2KHI A;  1HNW Q;  2I5H A;  1VS0 A;  1WJJ A;  3FKI G;  4TQU S;  4XTC S;  4A3E G;  3M7N A;  2F52 A;  2ALY B;  1VQP A;  2JK8 A;  2V1C C;  4A4I A;  3OTO L;  2ZM6 L;  3J7Z C;  2K5V A;  3F1Z A;  2JA6 G;  1XMQ Q;  2I0Q A;  5ELO A;  4GLX A;  3S2H H;  4NXM Q;  2Q2H A;  5JJL A;  3U4V A;  1S40 A;  1HNZ L;  5M5X H;  1SRO A;  4YWL A;  1E24 A;  4HIO A;  4AQY Q;  3K0X A;  2R7D A;  2IX0 A;  2HIV A;  1Z9F A;  1LM0 A;  4GKJ Q;  2UXC Q;  1UE6 A;  2UU9 Q;  1D8L A;  1Q12 A;  4OWX B;  4JI3 Q;  5IP9 H;  2R7Z H;  2R7F A;  4DR6 Q;  3I4N G;  2R6G A;  3HOW H;  3PF4 A;  1YBY A;  1BBW A;  1N9W A;  3L7Z C;  1DGS A;  1Z47 A;  1YJW A;  4O2D A;  4QIW E;  1M90 C;  4BXX H;  4A3K H;  4QGU A;  3GO5 A;  3WWV A;  1NJI C;  2VY3 A;  3H0G H;  3KF6 B;  4OO1 G;  3TRZ A;  2BH8 A;  3HOV H;  1CKN A;  2I5M X;  2N8N A;  5J3B A;  1Y1V G;  4DKA C;  3STB C;  1YIJ A;  3HFZ B;  4DR1 L;  1P16 A;  3I56 A;  1IBL L;  4HIK A;  1PH7 A;  4JI5 Q;  5LMN W;  1XNQ Q;  3T1Y L;  4A3D H;  3J7A 5;  4X6A H;  2HHH L;  1C9O A;  4JC0 A;  4KHZ A;  1L0W A;  3TRE A;  1CKN B;  3GTP H;  1VQE A;  3H3V I;  4DR7 Q;  2E2I H;  4UPA A;  5IYC G;  2CFM A;  4R4C A;  3TS0 A;  1IBM Q;  4L5S A;  2Y0S G;  4X62 Q;  1FJG Q;  2FXQ A;  1KHI A;  4NXN Q;  5IYD H;  2IT1 A;  1N36 Q;  1OXV A;  1K73 C;  1G6P A;  1HH2 P;  1UEB A;  5FLX c;  1HZC A;  2K14 A;  3RN2 A;  1QVC A;  4DV4 L;  3GTK H;  2JA9 A;  1PH8 A;  3RZD H;  1XPR A;  4JBM A;  1UE5 A;  1VQ7 A;  3GTG H;  4JYA L;  3M4Q A;  4LUO A;  1K0R A;  5LMU L;  4DR3 Q;  1A62 A;  4LFA Q;  4LF5 L;  1VQ6 A;  4BA2 I;  4GLA C;  3U4Z A;  3HOY H;  4H02 A;  4DR2 Q;  1OXT A;  3K80 C;  3A5U A;  3PF5 A;  4IJL A;  1HZB A;  2MNA A;  4LFC Q;  4K0K L;  2Z0S A;  1BBU A;  1HZA A;  1JB7 A;  2UUA Q;  1PV4 A;  4A3F H;  4JBJ A;  4UY8 C;  1KRT A;  2ES2 A;  4DR4 Q;  4GKK Q;  1OXX K;  3CCL A;  4IOA A;  4JV5 Q;  5C0X G;  3CPW A;  1Q7Y C;  1QVG A;  1B8A A;  3J80 i;  1YIT A;  3EIV A;  1MJC A;  4B3S L;  2BA0 A;  3JAM i;  4LF7 Q;  4DV3 L;  3ER0 A;  4BBR G;  2VQF L;  1MJE A;  3RR5 A;  2UUC Q;  2UXD Q;  4LF6 Q;  5C0X I;  3D0F A;  4YCV A;  3EBE A;  2CCZ A;  3M4O H;  1N34 Q;  1WYD A;  2YTV A;  4LW1 A;  4A3C G;  2IHF A;  2D0P A;  1TXY A;  3I7F A;  5JEA G;  2ZJQ A;  3A74 A;  5FLM H;  3T1H L;  1XMO L;  4LFB Q;  3OW2 A;  1YNX A;  4KLK A;  1EQR A;  4OWT B;  2E2H H;  1Q86 C;  4YCU A;  3CCS A;  3NEM A;  4DNI A;  4POF A;  1PH5 A;  3M85 A;  3BU2 A;  4DV6 L;  1TWA H;  1WFQ A;  5M3M G;  4DR5 Q;  1VQF A;  4A93 H;  4C3J H;  4OWW B;  3PO3 H;  1VQJ A;  3LGJ A;  4GOP C;  5M3F G;  5HGQ A;  1W2B A;  1MIU A;  2MQH A;  3HKS A;  4IPD A;  2RHQ B;  2D62 A;  4UP9 A;  4IFD G;  4MZ9 A;  5AJ3 L;  2GVA A;  4A3M H;  1JJC B;  3L0O A;  2PI2 A;  2ZTD A;  4PZ8 A;  3HOX H;  4IFD I;  4DV1 Q;  2WB1 G;  3J80 c;  5GAD C;  1N32 Q;  1HNX L;  2RHS B;  2Z6K A;  2JA5 H;  4DV0 Q;  2Q2I A;  2H5X A;  3A0J A;  4R4T A;  2ATW A;  2OWO A;  3KFU A;  2WFW A;  3NEN A;  3F2B A;  4DV2 Q;  1UWV A;  3IRB A;  3PSI A;  1I3Q H;  4QL5 A;  4P74 A;  4JI0 Q;  3HOZ G;  1QUQ A;  2R93 G;  4HJ8 A;  4KHP L;  4OON A;  1AE3 A;  1RIP A;  1KQS A;  2JA8 H;  3NBH B;  3AFP A;  2NVQ H;  2RCN A;  4R1J A;  2EQS A;  3S1Q H;  1TWC H;  4OX9 L;  1QVF A;  1VQK A;  1WOC A;  3HOU H;  1A0I A;  2VQE Q;  4ME3 A;  2E5L Q;  1VQI A;  3S2D H;  3W1G A;  1YI2 A;  2L15 A;  4B3T L;  5HY6 A;  1HJP A;  3UDI A;  1N8R C;  4C2M H;  1SN8 A;  2RF4 A;  2BH2 A;  3ULP A;  4HJA A;  1C0A A;  3A5Z B;  3GTM H;  5IP7 H;  1VCI A;  2AHO B;  4A3G H;  4X64 Q;  1PFS A;  4LF4 L;  4LF8 L;  4A3B H;  3PUW A;  4JI1 L;  1Y1W H;  1WCM G;  3M9B A;  4R4I A;  5IYB H;  1HR0 Q;  2EIF A;  1TWF H;  1A8V A;  1Q81 C;  2YU9 H;  5C4X G;  1L1O A;  3G48 A;  3UDF A;  1FVI A;  4L5R C;  1VQO A;  4QQB X;  3K7A H;  1NMF A;  3ULJ A;  1IBK Q;  4DPG A;  5ELN A;  2E2J H;  1L1O B;  3S24 A;  3RN5 A;  4LWC A;  2CKZ B;  3K8A A;  4O0A A;  5GQO A;  3RLO A;  3KJP A;  3PO2 G;  1Y14 B;  3I55 A;  1XMQ L;  2OTJ A;  3VDY A;  4NXM L;  3UDX A;  4B3R L;  1VQH A;  4X66 Q;  1K83 H;  1YJN A;  4JI6 Q;  1Q1E A;  1X3F A;  3PUV A;  1X9N A;  1W3S A;  3CPF A;  1NBW A;  1VQ5 A;  4JI7 Q;  3TQY A;  1K3R A;  2PI2 E;  4HID A;  4AQY L;  1U5K A;  4GKJ L;  2UXC L;  5C3E G;  3RNU A;  2B29 A;  2N49 A;  4A3L H;  2UU9 L;  1EIY B;  1XPO A;  2JA7 H;  4DR6 L;  1EOV A;  1EYG A;  4J15 A;  5GAH C;  5JJI A;  2VW9 A;  1RL2 A;  2CWA A;  2WB1 E;  2C35 B;  2NZO A;  5IE8 A;  4IOC A;  4EX5 A;  4A75 A;  2OTL A;  3I4M G;  1JJG A;  1K8A C;  3S17 H;  4L5Q A;  4JBW A;  1PH1 A;  3FKI H;  5GRO A;  1E7Z A;  4YY3 Q;  4A3E H;  1G51 A;  1YHA A;  4BA1 I;  1S3O A;  2KBN A;  4YHH Q;  1LUZ A;  3CC7 A;  1CSP A;  5IWA Q;  2JEA I;  2JA6 H;  4JI5 L;  4DK6 C;  1XNQ L;  4A3F G;  1I94 Q;  4Y52 H;  4TVA B;  1NTG A;  3RLF A;  1N33 Q;  4JI2 Q;  4YWK A;  5C0X J;  4DR7 L;  1X65 A;  3NEL A;  2VZA A;  4DV5 Q;  1FL0 A;  1IBM L;  4FDB A;  4X62 L;  1FJG L;  1LYL A;  4NXN L;  2Q2T A;  4NB3 A;  1KXL A;  1N36 L;  3CMA A;  3D31 A;  1NY4 A;  1AE2 A;  1D7Q A;  3GTQ H;  4DUZ Q;  5K36 G;  4EQ5 A;  4GNX A;  4JI4 Q;  3G6E A;  1WI5 A;  3CQZ H;  1JE5 A;  5JEA J;  3I4N H;  2WAQ G;  4IO9 A;  1OXU A;  2VUM H;  4BY7 G;  2MO0 A;  4DR3 L;  2CQO A;  4LFA L;  4C3I H;  2HT1 A;  3S14 H;  3CW2 C;  2F3I A;  4A3I G;  4GNX B;  3CCQ A;  4DR2 L;  4P73 A;  4B3M Q;  4PMW A;  5C44 H;  3KYH C;  1VQ4 A;  1J6Q A;  4LFC L;  1IZ6 A;  3J81 i;  1YVC A;  2UUA L;  4DR4 L;  4LNQ A;  4GKK L;  2Q2U A;  1O7I A;  3BZC A;  4IPG A;  3CD6 A;  2MFI A;  4JV5 L;  1Y1V H;  4AH6 A;  2UUB Q;  1Q1B A;  3PUZ A;  1I50 H;  4DUY Q;  4R4Q A;  2GVB A;  2WP8 J;  4AIM A;  2B63 G;  2K50 A;  2XGT A;  4LF7 L;  4OXP A;  5IT9 c;  2UUC L;  4IFD J;  4P75 A;  2UXD L;  4GN5 A;  1PH3 A;  4JI8 Q;  4LF6 L;  1V9P A;  5JJK A;  5IYC H;  1N34 L;  2K75 A;  3F8T A;  4BY1 G;  2K5H A;  4DK3 C;  4DV3 Q;  5H1S E;  1GVP A;  2Z6K C;  2OQK A;  1I5F A;  1IYJ B;  3CCU A;  4JOI C;  5LMN Q;  4LFB L;  1VQN A;  3AEV A;  3GDE A;  2ZTE A;  3PIP A;  2JA5 G;  1C7Y A;  4X65 Q;  1BKB A;  2CWP A;  3I2Z A;  1M1K C;  2JE6 I;  3CC4 A;  1IL2 A;  4WJ4 A;  4LF9 Q;  3GD7 A;  3CCR A;  2K4K A;  4DR5 L;  1YZ6 A;  4LUZ A;  3TEH B;  5BR8 Q;  1XPU A;  3HKZ G;  4P72 A;  2ZTC A;  3PIO A;  4BBS G;  4PZ6 A;  1E22 A;  1X3G A;  5IY0 A;  4XIG S;  3AQQ A;  1ASY A;  1XNR Q;  2AWN A;  1SFO H;  3DM3 A;  1SMX A;  2R92 G;  3W5O A;  1L2F A;  1VQA A;  3JAM c;  1JJ2 A;  1QZH A;  5FJ8 G;  4BBR H;  1VQL A;  5IP7 G;  2DGY A;  5C4J H;  1N32 L;  1TWH H;  3UE1 A;  4A3J H;  4A3C H;  1E3P A;  1G29 1;  1L1O C;  2AKW B;  4DV0 L;  3CAM A;  3G71 A;  4JI0 L;  2WAQ E;  3AYH B;  1QUQ B;  2YV5 A;  1PVO A;  4GLV B;  1LTL A;  1UE1 A;  1HZ9 A;  4YCW A;  1YHQ A;  1J5E Q;  3BZK A;  1KC8 C;  1X54 A;  4DV7 Q;  1GM5 A;  1KRS A;  1KD1 C;  2NVT H;  2UXB Q;  5M3M H;  3S1N H;  4WJ3 M;  3UDG A;  1GO3 E;  2ZJP A;  2VQE L;  5M3F H;  2E5L L;  1FGU A;  3H15 A;  2F4V Q;  2LXK A;  4MTN A;  5IP9 G;  5GAG C;  3U58 A;  2R7Z G;  1HNW L;  3HOW G;  3CP0 A;  3CF5 A;  4UP7 A;  3CCE A;  4X64 L;  2NN6 G;  3K7U C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...