1CA5A

Intercalation site of hyperthermophile chromosomal protein sso7d/sac7d bound to dna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
VKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*GP*AP*TP*CP*AP*C)-3'
publication title Crystal structures of the chromosomal proteins Sso7d/Sac7d bound to DNA containing T-G mismatched base-pairs
pubmed doi rcsb
molecule tags Structural protein/dna
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1999-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ca5A00
2B2VA 4ZLTF 5EPLA 2K1BA 2SDFA 4X3TA 4OIKA 5EPJA 1BBXC 2XIWA 1U4MA 2MGSA 1MGSA 1QNKA 2B2WA 4IUTA 1U4RA 2L9HA 1IKMA 1G2SA 1GUWA 1NR2A 1HUNA 1ML0D 4ZKBB 2KEEA 2FJ2A 2CVRA 1WTQA 1PFBA 1EOTA 1J9OA 3GV6A 3FDTA 4X3KA 4IUQA 5T1IA 1F9SA 1AP0A 4CJ0B 1AZPA 3MWYW 3TN2A 1NCVA 2KOLA 4HSVA 1A15A 3I90A 4HEDA 2NYZD 2B2UA 1VMCA 2RSOA 3HP3A 5EPKA 2KUMA 4ZAIA 4CJ2C 2IL8A 5DNFA 1G2TA 4XDXA 5AFWA 2EPBA 2EE1A 1JE4A 1HHVA 2R3ZA 1B53A 2HCIA 4DN4M 2N88A 1WTWA 1BF4A 1KNEA 4UAIA 3UI2A 1CA5A 2DY8A 5EJWA 5CMDA 5E4XA 1WD0A 1MSHA 3FPUB 4RAUC 1QG7A 1B50A 1HFNA 3IFDA 5D65A 2FHTA 3D6WA 1E0BA 2FINB 2K01A 5D14A 1DZ1A 1O7YA 3DM1A 1IL8A 2HUGA 1EIGA 1XX8A 2L11A 3TZDA 1EIHA 5CBAE 1C8CA 1QE6A 1B4OA 2N55A 3H91A 2B2YC 2HCCA 4HCSA 4NW2A 1JICA 1ILQA 2BDNA 3MTSA 1B3AA 3IL8A 3Q6SA 1NR4A 2X69A 4X3UA 4IUPA 1EL0A 5CBEE 1G91A 1RHPA 2NZ1D 4MN3A 2KVMA 4IUUA 1SAPA 2B2TC 2MJ8A 2D9UA 1HUMA 1O7ZA 2KEDA 2MP1A 2KECA 1AZQA 1O80A 1WD1A 5JJZA 1DOKA 3I91A 3KUPA 2VXWA 1PLFA 1HA6A 4XT1B 3I3CA 2JP1A 3ONAB 1VMPA 4ZKCB 1X3PA 2B2VC 3DEOA 1RTOA 1X32A 2L4NA 4U68A 1SDFA 1WTXA 2B2WC 5EQ0A 1M8AA 1U4LA 1RJTA 2M2LA 1RTNA 3GV3A 4QUCA 4OIJA 1WTPA 1CM9A 2HDLA 4HAEA 1BO0A 1CA6A 2HDMA 1RODA 1Q3LA 1PFNA 2J7ZA 2K05A 2FMMA 5COYA 1XYIA 5E4WC 1G6ZA 2K04A 2K28A 1SSOA 3DEPA 1X3QA 3F2UA 2H1EA 4MHEA 2NWGA 4IURA 1F9PA 4QUFA 1ILPA 1NAPA 1U4PA 1DONA 1F9RA 4R8IA 1WTVA 2B2UC 5EKIA 1J8IA 1BNZA 2EOTA 2Q8RE 1WVLA 1PFMA 1S4ZA 2L12A 4X3SA 1MI2A 1MSGA 3LWEA 2RSNA 4IUVA 3KBXA 3N52A 5T1GA 2B2YA 2L1BA 2X6GA 1WTOA 1WTRA 1LV9A 4RWSC 3G7LA 1HRJA 2X6LA 4LMQD 4R9WA 4ZK9B 3SVMA 2K03A 3I8ZA 3QO2A 1ESRA 4O42A 4XT3B 2RA4A 1EQTA 2B2TA 5CORA 2RVLA 4RA8A 1DOLA 1ICWA 2Q8TA 3P7JA 1TVXA 1IKLA 1F2LA 1F9QA 1PDQA 1KNAA 2JYOA 2DY7A 1B2TA 2FFKB 2MPMA 1DOMA 1ZXTA 4CJ1B 1HFGA 3R93A
chains in the Genus database with same CATH superfamily
2NVQB 4MIUA 1HNXQ 5ELEA 3BYYB 2Z6BA 4Z9CB 5FLMG 2XNAC 4IUNA 1TWCH 2PNRC 4NPSA 4H7BA 4A3KH 1SYEA 2IX0A 2NZOA 2CW0C 4A93B 1TS2A 3Q0AA 4KV6A 4YCWA 1F9SA 4CJ0B 2F0NA 3ERSX 5BR8L 1HNWQ 5IGFA 2NYZD 2VW9A 2RSOA 4A3EH 4EX5A 4L6TB 1L1OA 3SK4A 4DN4M 4HJ8A 1PRTF 2KHIA 4DV3Q 4IJHA 4KHZA 1BCPC 4PMBA 5GAHC 5E4XA 3VR4A 1FGBD 2F0IA 3D4RA 3DM1A 1PH3A 1TY0A 3HKZG 1LT4D 4KK7A 1SNOA 1B9NA 1ILQA 1HQMC 3QR8A 1NR4A 5FLXL 1V1PA 1JOQA 4FDBA 1PTOB 3S1NH 4O0AA 1QVGA 3K7UC 4A3DG 5JJZA 1PMRA 1YNJD 2EDGA 4JI2L 4JI6Q 3H3VI 1VQKA 2QGQA 4A3CH 1EY8A 1TWGH 5FLXE 1QUQB 4QUCA 3BZCA 1JB7A 1R9TB 3MFGA 4YY3Q 3HOVB 3JAMc 1N36Q 2JA6B 3OHXC 4DAPA 4JOIC 1QILA 5J22A 3GD7A 4IURA 4C3HG 4BY1H 4X62Q 5M3FB 3J7AF 1TKWB 3ITPA 1LABA 2RDGA 2Z1CA 4IUVA 1BVSA 2B2YA 1LM0A 2AHOB 5IYDG 4DV7L 4Y52H 4R4QA 3E0JA 2JJQA 4ZKBB 5C4XH 4RA8A 5CV4A 4DV2Q 4LAAA 5IGBA 2Z0SA 3NWTA 3MEHA 5EPLA 4AYBG 4OIKA 4K0KQ 3HOWG 3ND8A 4IUTA 4ZRZA 2PZWA 4KKTA 1GUWA 2FMCA 3R2IA 4IFDJ 5E7NA 1F2YA 4DXGA 1SJED 2IWHA 5EBCA 2R93G 2J0TD 4N8X1 1YHAA 3GTQB 1RL2A 3A54A 2GN5A 3K80C 4OWWB 1EY9A 3VR6A 1BQQT 4X64Q 2HHHQ 1N9WA 1JE5A 4IQZA 1TS5A 4M8AA 2FHTA 3J80c 5C3EH 3FP9A 1H9SB 1FNUA 3K57A 1PXUA 1CI3M 5I9OA 3VR3A 1XXGA 1X9NA 1EYAA 1SXTA 4RCOA 1N34Q 2WB1G 4IUUA 2F1MA 2D9UA 4IPHA 5LMNW 1KLUD 2WAQG 3ER0A 4UPAA 3A8JE 2BH8A 2YTYA 4GKKQ 3RR5A 4OO1I 2VB2X 3ONAB 4DR7Q 2A74C 3J7A5 4LUVA 4DR4L 4KY7A 1X3EA 4ZYSA 1EFID 5EQ0A 5LHY1 5C6AA 1RTNA 5CV7A 1O7LA 1HR0W 1VQNA 4G57A 1EQVA 5IE8A 1UE1A 1GUOA 3E3XA 2JN4A 3NPPA 1JWUD 2JXMB 1GD7A 1PRTC 1BBUA 3MAQA 3PO3H 3CC2A 4YHHQ 1Y1WB 1AFPA 1Y1VG 4NXML 2ZJRA 4JI8Q 1L1OC 2AUKA 1QZHA 1FJGQ 4AQYQ 3LWEA 4GLAC 1SMYD 4RGNA 3H0GG 3CU7A 2VB3X 3OW7A 5GQOA 2C35B 3UDGA 4DV1L 1B44D 1KNAA 1UEAB 2JYOA 3L3OC 1SEBD 4RKLA 3S16B 1ZKOA 2O4XA 4X66Q 2Z8LA 3RLFA 4KY6A 2O2LD 4X3TA 5IP7G 1BUVT 2MGSA 3CPFA 4A3BG 1Q90A 2B2WA 1EIYB 4OX9L 3AU7A 2AQ1B 5IP9H 1SYDA 3OWEB 3I4MB 2JA7B 2R7ZB 4P75A 1FL0A 3PIO3 1PYWD 4GKJL 1D2BA 1J9OA 2G9DA 2NVYB 3KYHC 3GTJH 2Z4HA 4H44C 3BS1A 3HOUB 2OQKA 1G2TA 4XDXA 1NMFA 5A35A 1GHKA 1XNRQ 1V8QA 1K73C 2SEBD 3P75A 1GUSA 4UP8A 4DGZA 4A3FH 4RAUC 1QG7A 3IFDA 4UHVA 4KHVA 3X3NA 4WJ3M 3PUYA 4A3KG 1IL8A 4QL5A 1VQ7A 1QWYA 1EQQA 4CDEC 4DUZQ 3H91A 2B2YC 4HCSA 3VA7A 1B8AA 4B3RL 5IT9c 2UXDL 3I4NB 1Y14B 5FO7B 1E1TA 1SYGA 5C5LA 1SAPA 2XGTA 4CKCA 4A3EG 4FF1A 4OHJA 3TBIB 3AFPA 1QJOA 1Z47A 4R4OA 3GTKH 3HOZH 3I4OA 2SNMA 5FOBB 2VL6A 5KEEA 3JAME 4N9TA 4R1JA 2L4NA 2RBMA 2QEJC 2LFNA 5F2DA 3L2PA 3RNUA 1KAWA 1VQBA 4LFCL 1CM9A 2PW7A 2A69D 4K14A 4JC0A 2J7ZA 2K05A 2FMMA 1XYIA 4BBRB 2K33A 2HIXA 4P2CB 2B8FA 2VS1A 3ND9A 1LT3D 1EU3A 4K6DA 1OXTA 2V1CC 4LWCA 1J8IA 2UXBL 3HOXH 1I6HH 4LK1C 4C56C 4KKUA 4LF7L 3MZ5A 2HIVA 4PZ8A 1ESFA 3BDCA 2X6LA 3IRBA 4A3CG 1K28A 4DV5L 2B2TA 3I4LA 2D0OA 1SMYC 3FEWX 3AMUA 1PDQA 4C3IH 1X6OA 1E22A 1XJVA 1N32L 1OXUA 2A68D 3BVZA 2Z6KA 3I55A 1XPOA 5FLMH 4DR6L 1UNSA 1DYQA 1G51A 3J80L 1KXLA 1Z9FA 5FO8B 2BA1A 3KLSX 2DJFC 2BDOA 1AW7A 4A3JB 3NBHB 3RZDH 4LF4L 3QB3A 4O1NA 3TDQA 2E2HB 5C4XG 5C5MA 1NCVA 4ME5A 5H1SE 5EPKA 1WCMH 2WIIB 4POFA 4LFAL 3J80E 1JCKB 1I3QH 1RD9D 2YYZA 2PQEA 4L5SA 1HZ9A 4NDXA 5DLQE 2K5QA 1IYVA 2ZM6L 1OO9B 2DUDA 5FJ8G 1PZJD 2A6HD 2MHVA 3TZDA 5CBAE 4LF5Q 2BCOA 2HCCA 3ZYYX 1PH7A 2X69A 1J6QA 3QOLA 1C0AA 3J81L 4DK1A 2KHJA 1GKHA 2A1AA 4A93G 3T1HL 2UU9L 3M3YB 3I3CA 5M3MB 2ES2A 1ZEQX 1FD7D 3EBEA 2XWBB 1FYCA 5AJ3Q 5C3EG 2C9OA 4JV5Q 1HXYD 2B2WC 2ALYB 1SN8A 4YCVA 4DNTB 5M5YB 4XYOA 3KF8A 1Q3LA 4JI2Q 1OXVA 3PIP3 3RLOA 3S14H 3S9WA 2A69C 1M1KC 2H1EA 3ULLA 4RGMA 4QUFA 1U4PA 1E2WA 1KAAA 1I4XA 2A73B 4S3SA 2CH4A 4DAVA 3CCMA 3TREA 4R4IA 5EKLA 2CCZA 4DV0L 1PYSB 1LV9A 4RWSC 3G7LA 5I4DA 2JA5B 1HRJA 2O5IC 4HMJA 3I8ZA 3AEVA 3H3VH 4XT3B 1K8GA 2YU9H 2ZT9C 3EQLC 3LNNA 4L63B 4CGYB 2UUBQ 4H13C 5FLXc 1ZXTA 2RCFA 1WTXA 3R93A 2XRQD 2QF7A 2ZTCA 4ZUIA 1K8OA 5EPJA 1D5MC 2YV5A 4DV7Q 2VUMG 1YZ6A 3NTHA 4ILWA 2A68C 3AFQA 4HJ5A 3G6EA 4DNIA 2KEEA 3NXWA 4CDDC 1J5EL 3ICEA 1BKBA 1Y69U 3U50C 3N6RA 3CCJA 5KIXA 1PH8A 4LFBQ 3LGJA 3BVMA 3QWNA 4JBJA 2PQAB 4JI4Q 5DEHA 3F8TA 1MIUA 4RCNA 2I5MX 1YIJA 3EN2A 2R92H 2F0GA 4P72A 4QMGA 1D5XC 2A6EC 5IP9G 3CAMA 3GQBA 4PMCA 1SE4A 2FINB 2K01A 1EEID 5IT9E 1TWHB 2E8GA 2L11A 1KC8C 1V1QA 1JICA 1MJCA 3V96A 2ATWA 2A6HC 2LXKA 2PNHA 3M4YA 2E75C 1EOVA 4DV6Q 2F4VL 2DJGC 2MO1A 3U4ZA 2B2TC 4A75A 2VQEL 4NXNL 3S17H 1SYFA 3HEJA 1QUQA 1E2ZA 4A3FG 5ELCA 4U68A 2Z6KC 1GUTA 1XWEA 3EIVA 4OIJA 3NHHA 4OELB 3BU2A 1VQ6A 4OWTB 3RZOH 3K0YA 1SNQA 4WORA 4DR4Q 3D31A 1IHZA 1A2TA 1R4PB 4A3GH 4IJLA 1F9RA 1DONA 2Z9HA 4A3MH 2K7VA 1I5FA 5EKIA 3HOZG 2CKZB 2CWAA 1RDPD 1STAA 4B3TQ 4X3SA 4P71A 3KF6B 1WTHA 1W3SA 1K3BC 1TWAH 3NELA 2XSCA 1ICFB 2QEXA 1PH1A 3S1NB 2PI2E 3TP5A 5LL6X 2NVTH 3PO2B 1PTOD 2KQ3A 3CQZH 4LF9Q 5IIFA 4O42A 1LTLA 4OO1H 1EY5A 2JA8H 5IWAQ 1NUCA 1IKLA 3GTGB 4J15A 1N33L 4WJ4A 3S24A 3D8GA 4JBMA 1TWGB 2AWNA 3CCQA 4OWXB 1IYUA 5E3FA 1X3FA 1L0YB 3HOXG 4A3IB 4L5RC 3W1GA 5J39A 2BE5D 3SGIA 1YI2A 1CHPD 3S1QB 5ELDA 2N8NA 2AUJD 5T1IA 1EUJA 2KBNA 3MWYW 4TSSA 1UEBA 4C3IG 1F2MA 1D1IA 1X3GA 1CQFA 4GNXB 2R3ZA 2F52A 1I4RA 4P74A 1E7ZA 1D7QA 1X56A 1MSHA 1EWCA 2KENA 2UUAL 4M1UB 5D65A 2XTIA 2Q2TA 4R8NA 4RFBA 3PV0A 3CCRA 3VYSA 4JK1C 3KJOA 4DR2Q 1PA6A 4DFAA 4DK6C 2UUCL 3DWQA 1ENAA 3NEMA 4X65L 2YTVA 2IW3A 4Y7NB 4RGOS 2K32A 1WCMG 5JVH3 3GTOH 4GS3A 1O80A 2EY5A 4IPDA 4UDUC 3GTLB 1BCPB 3A5UA 4ZKCB 4DV4L 4C3JB 3DEOA 3OTOL 1K83B 2RF4A 2WKCA 2IHEA 5M5XH 5G3LD 3KDFA 3K81C 1V9PA 3M4PA 1QOHA 2F0QA 2VZAA 2Y0SB 5E1FA 3C1EA 1C4QA 1TU2B 4YWLA 4Q0FA 1JB3A 5C44H 3S1RB 3S2HH 5A2QL 4C2MB 5JEAH 5BN3A 3QG1A 3IAYA 1A3TA 3W3AA 1XNQQ 2EOTA 1T5EA 3J80i 4DAYB 1RKNA 2IX1A 3PUZA 5JPNC 5A2QE 3TP6A 2RA4A 1DXMA 3H09A 4UY8C 3JC66 1CZWA 2LXJA 3TS0A 2FFKB 2MPMA 2QW7A 2K5DA 4N8FA 3S1MH 2K1BA 3CMEA 4EQOA 3OWFA 4DV5Q 1B9MA 3A7AB 1GHJA 3G71A 1YJNA 3K0XA 3R2TA 1STNA 1I4HA 1S5CD 3SXHA 1VQFA 5IYBG 3UDIA 1AZPA 2JEBI 1CKNA 4DR6Q 5IGGA 5IGCA 1VMCA 1SMXA 3M4OH 4DR5L 2UXCL 4AH6A 3EA6A 4K8JA 4BY7H 1LTTD 1Z6HA 4LF4Q 5FJ8H 4JYAQ 1DM0B 2NVQH 3H6MA 2N55A 1A63A 3RN5A 2F4IA 4G4KA 4JI5L 5ELFA 3S2DB 4XQJA 4B3MQ 3F2DA 3E5SA 1IBKQ 4FF3A 3MFYA 3NSWA 1HUMA 1PZID 2RDHA 2ZM6Q 3HOYB 4A93H 2KCTA 4NKLA 2PYKA 2E5LQ 3AQQA 2ZJPA 1PH6A 4I65A 2R92G 4RHSA 3P1HA 4HMIA 2VY3A 4IOAA 2N49A 1H9RA 5JPMC 2HD3A 3OIPA 4JI1L 1SFOB 2I0QA 5KNBA 1CQVA 2LSSA 3CW2C 1H9JA 3A7LA 4H02A 1NAPA 3SHLA 3TRZA 1SNDA 2QCPX 4WJWA 4DK0A 1PH9A 1NJIC 4JI3L 1MI2A 2CHBD 1PTOH 1LTID 1FNVA 2F0DA 3R3OA 1Z7TA 1YNJC 3U58A 1EZ8A 2K03A 4JBWA 4CBVA 2MNAA 3GTKB 1ESRA 1ET6A 1CA5A 2RVLA 1IW7D 1ICWA 3BDLA 4LUZA 1HZBA 3GTPB 1VQ9A 1PRTB 1VQMA 1R9TH 2B2VA 2EYHA 4DV0Q 3HOVH 2B63B 3J81c 3CD6A 1LT5D 1BBXC 4A3GG 1BXTA 2DGYA 4A3MG 2ZJQA 2JA6H 1E2VA 2VUMH 3TS2A 4BBSB 1L1OB 4EGVA 3CRLC 1G6PA 5M5WB 2A19A 3DXJC 1NR2A 2Q2UA 3TP8A 4G7ZC 3J81j 4K5VA 1Q81C 4ZQ3A 1VQDA 4OO1G 4OGQC 3TN2A 2JA8G 4G7HC 5ELOA 4JI7L 1A15A 5LMUQ 2PZUA 2VNUD 2IL8A 4DR3Q 1QZGA 4J6HA 1B53A 1WTWA 1V1PB 2MO0A 3K5MA 4UAIA 3J7ZC 3UI2A 4A76A 2E2JH 1P16A 1STBA 2M00A 5JJKA 2JK8A 2J4XA 4IPCA 2AKWB 1EY4A 4HSPA 1NSNS 3DHQA 4X3UA 1T9HA 2O5JC 1G8ZD 1YVCA 4MN3A 4DR1Q 1XMOL 1IBLL 2OWOA 4RG1A 1EY6A 1TS4A 2QA4A 1VMPA 1X3PA 2B3GA 4J8QA 3TP7A 1VQCA 1OXXK 4TKOB 4FXKC 1JOOA 4NMZA 1SNMA 3RN2A 2F4VQ 4C1NK 1M8AA 2CFMA 2VQEQ 3CRKC 4NXNQ 2HDLA 1I4GA 5LMNQ 2XWJB 5COYA 2EXDA 5C0XI 3KLSA 4GLVB 1X65A 3M85A 2Q2IA 2NWGA 5D3DA 3D0FA 1I94L 1NY4A 3I70A 2E74C 2L15A 4YIJA 3D3RA 3HKZB 2F0WA 3BG3A 4PZ7A 5K36H 3CP0A 1WVLA 2DN8A 1MSGA 3L7ZC 1GVPA 3E9IA 2PPBC 1GJXA 3N52A 1HR0Q 5BN4A 1YHBA 4DV3L 3SVMA 4A3DB 4HN7A 4NB3A 1IZ6A 3STBD 3K59A 1HNZL 1VQPA 2IJ0A 1TT2A 5JAVA 5C44G 1FNWA 3L9AX 2QDBA 5JEAG 3MXNA 3VR5A 1JR0D 2NVXB 5ELBA 3SK5A 4GN3B 4RMFA 1QNKA 5FKAC 3TSSA 2WINB 4EQPA 4PMWA 2QKIC 5DM73 5GROA 2HQEA 1VQHA 2BOSA 1Y1WH 4C3HB 5IODA 1PFBA 3FDTA 3TZUA 1DD2A 4KTAA 1PHJA 2KOLA 1V1OA 1SJHD 4K6LA 4HCEA 1N36L 1I4PA 2EVBA 2E2IB 3UE1A 2L0CA 2P5ZX 1IL2A 2WFWA 2HCIA 1CUKA 1KIXA 1N8RC 2VQFL 3T1YQ 4DK3C 1SE8A 5JOBA 1DCZA 3H3VC 1BBWA 4HIMA 4LNQA 1HCZA 2EZVA 2XN9C 1A3VA 3S16H 1ONLA 1HA5A 3DUZA 3BYTB 1KDBA 1BDOA 4AYBB 4JI0Q 3HOWB 3RUZA 1TWFB 5ISRA 3Q6SA 4IUPA 2JA7H 3I4MH 1UUPA 3PGZA 4PG3A 2KVMA 1D5ZC 1O7ZA 1QVCA 2KEDA 5C3XA 2JA9A 4DV2L 1E3PA 1STHA 4F7XA 3I56A 3I2ZA 2NVYH 3PUVA 1UE6A 2R93B 3A56A 4N9PA 4BY7G 3K7AB 2B2VC 2D62A 3SK6A 2UUCQ 4X65Q 4K0KL 1ASZA 5BR8Q 1RJTA 3CPWA 1E24A 4F8MA 5GAGC 2LS01 3TMEA 1HTPA 1G6ZA 2F0TA 3SEBA 3KLRA 1CT1D 2Y0SE 1SSOA 4DU9A 4DPGA 4FVMA 4XTCS 3NTKA 1VF7A 3UDFA 1ILPA 1B70B 5CV6A 1YNND 1KL9A 3E0EA 2WB1B 4GOPA 1LTBD 2L1BA 5JJIA 5CYUA 4H0LC 1JQYD 2KHSA 2GVAA 4R9WA 3S17B 2WAQB 3IFTA 3D4WA 2CQOA 1LTRD 2KCMA 4FNFA 3J81E 1K0SA 1M90C 3P7JA 1KRTA 5CC4A 4KY5A 2DY7A 4OEMB 3RD4A 1HQRD 2NBFA 5IYCH 1F77A 3KFUA 3VYUA 1N34L 3CC4A 3ZJYC 1V43A 2RDFA 1JWMD 4BBRH 1PV4A 3D6CA 2CQAA 3K6OA 1VF5C 2E76C 2FJ2A 4DR7L 4HIOA 3Q8DA 2QILA 5IYBH 1Y1VB 4IUQA 4GNXA 3Q22A 3W2DA 5CV9A 1I50B 1AE3A 3F2CA 1X55A 3H0GB 4EVOA 3MVVA 5C4JB 3PIOA 3CQZB 3NENA 3BJUA 3HOVG 1NBWA 2JA6G 2OCEA 2AQ3B 1II3A 4HJ7A 2PMZB 4A3LH 1DZ1A 5D14A 3T13A 1ENCA 5I6WA 1XX8A 4JI8L 3DM3A 3DWAA 5M3FG 4AQYL 3KBGA 4A3BB 4PQXA 4DA2A 1EYDA 1CHQD 1EL0A 4KN7C 1EEFD 4UP7A 1DGSA 2EYOA 4CKEA 4A3JH 1C48A 1DOKA 3KUPA 1QVFA 1CK1A 2E2HH 3EVQA 1LYLA 4AIMA 3V05A 3D4DA 4X66L 1JOKA 4JI5Q 2DNEA 2EYJA 3FKIB 2MFIA 1EY7A 2R7FA 1YNXA 2M2LA 2PW5A 2OTLA 3HKSA 3HGBA 2EJFC 5BN5A 1WTPA 3G6JB 3HS0C 3MEFA 1UE5A 1PH5A 1KDCA 4KHPL 1GOZA 4A4IA 1KDAA 1RODA 1PFNA 4IO9A 1KABA 1PYBA 1TWCB 1YJ9A 2C5CA 4L8JA 4A3KB 4IALA 4DAMA 1PTOF 4DNRB 1U5KA 1X54A 1S4ZA 2L12A 1NMGA 1TR5A 3B6YA 1AE2A 3CCSA 1YNNC 5KNCA 1XNRL 4A3EB 4LMQD 1HZAA 4ZK9B 3AYHB 3M3YH 2EJGC 4APVA 1MD2D 1SR3A 2PCFB 4LJZC 1DOLA 4WRDA 5D3IB 1SYCA 2B8GA 2NTSA 1F9QA 2ICEC 3VYRA 3CKIB 5KGUA 1BCPD 5M5XB 4DUZL 1HFGA 1FVIA 3T51B 5M5YH 1GM5A 1UWVA 1D8LA 1FGUA 2OQ0A 2PZTA 2F0KA 4IN3A 5K36G 5I6YA 3MC0B 2IY5B 2PO4A 1YEZA 3U9OA 3PF5A 1LO5D 3GTMH 2ZXPA 2CVRA 4V190 4WFN3 3J7AV 3SR1A 1EOTA 3BZDB 2F0JA 4ABNA 4FP5D 3VR2A 4XQQA 1VDZA 3CCEA 4HEDA 4K2LA 2JA5H 4NXMQ 1Q82C 1PFSA 3SDZA 1HZCA 4GLXA 3C46A 2SNSA 3BDOA 1CTMA 1EY0A 1NNXA 3W5OA 1JJ2A 3CMAA 5EJWA 4F88A 2F3VA 4KLKA 1Q86C 4DV1Q 1JJGA 3NUCA 1Y1WG 4GOPC 4BY1B 2F03A 1KHIA 1B3AA 1JMCA 1NE3A 3ERQA 1TY2A 5TSSA 1Q7YC 2D2CC 3AB9A 4BS9A 3FMCA 5G3LF 4OX9Q 1JC7A 4TQUS 4LF6L 3EROA 2CH4W 2MJ8A 2MP1A 3KF8B 3CCUA 4JCVE 4JW0A 2R6GA 5EAYA 3CCVA 1WD1A 2F0EA 2A5HA 1H9SA 2D5DA 3ULPA 3WOFA 2LKVA 5C4XB 4GKJQ 1SNPA 3PCOB 1YJWA 1Y8OB 2IT1A 2DNCA 3BVGA 3K5OA 3M4QA 1IBML 3G4SA 1IBLQ 2HDMA 5JVG3 1U9RA 3CXCA 3RLNA 3E6ZX 2JA7G 3I4MG 2R7ZG 4PV1C 1TWHH 4MHEA 4GNXC 2HQLA 1I4QA 3P20A 1CKMA 2EYPA 1SNCA 4R8IA 5HY6A 1RCVD 2NN6H 4HIKA 1YBYA 3HOUG 3PIPA 2X6GA 2G9HD 3U9SA 2IPKD 3HKZE 4B3RQ 2UXDQ 1K8MA 4K5WA 2LY7A 3ULJA 1B3QA 1I94Q 2Q8TA 3H94A 4HJAA 4LF5L 5C3EB 4CJ1B 2PI2A 4G7OC 4ZLTF 2F0VA 2SDFA 4B3SL 1W2BA 5C4HA 4ZCKA 1MGSA 5KRUA 4QIWB 4Q5VA 1ENFA 1VQJA 3GP7A 2XRSD 1S5BD 5C0XH 4LFCQ 3I4NG 1G2SA 1HNZQ 2IHFA 3QIAA 2F3WA 5JEAJ 5AJ3L 2NZHA 4JV5L 4J1MA 5C0XJ 4HSVA 4FYDA 1EYCA 4CJ2C 2UXBQ 1A62A 1PTOC 5I2YA 3PO2H 4IZ8A 3FHWA 5AFWA 1JE4A 3OPOA 5IYCG 4LF7Q 4TVAB 1EIFA 2BA0A 3S15H 2KA7A 3GTGH 2FXQA 4I7ZC 2SOBA 4BBRG 1GO3E 1A2UA 2F0MA 5KYIA 4JBKA 2CWPA 1SROA 2HUGA 3CF5A 1JWSD 2QDLA 1C8CA 3M7NA 1PRTD 3PO3B 3SE0A 4XQNA 4DUYL 2VUMB 2BE5C 1N32Q 1EU4A 3IL8A 2WP8J 1Q8IA 2VQFQ 4A3IH 1LT6D 2LMCB 4C1NI 1STYA 1CSPA 1VQ4A 4AYBE 3PSIA 1PVOA 3S1QH 2UUBL 1XPRA 1SE2A 3J81i 4PNYA 4LF8L 2OF1A 3UDXA 1A6XA 3H15A 1U0LA 1F2ZA 1MHWC 3C1FA 4A3LG 2L5TA 1VQIA 3M7GA 3A5ZB 1H9KA 1VCIA 1GUNA 2XVSA 4HAEA 4LFAQ 4U673 4ID6A 4FXDA 1LTSD 1JORA 4IFDH 2E2JB 1EWHA 2Q2HA 5EKKA 1W6JA 2I46A 1EZ6A 3L0OA 2M9VA 1S40A 4ODGA 1K9MC 1XTCD 4A3JG 3VDYA 4LFBL 2A8VA 1WTVA 4Y7NH 2ID0A 4JI4L 3KJPA 3GTJB 5T1GA 1LLRD 3WOEA 3HZXA 1CSQA 4QB4A 5C4ZA 2K4KA 3MXUA 3GTLH 3QO2A 2GVBA 2WB1E 5EBDA 4C3JH 3J7YW 3LWUA 1K83H 3T1HQ 2I5LX 1MKHA 4A3FB 2UU9Q 4KKSA 4ALPA 2WAQE 2L55A 2BH2A 2E2DC 3TEHB 2JEAI 1XTDA 4DV6L 3OSOA 3NBIA 2RKSA 3S1RH 4C2MH 1LUZA 1ML0D 1SBBB 3EJIA 1SYBA 1UE7A 5IGDA 1VS0A 3PUXA 3HOZB 5M3MG 1O78A 2TSSA 1AP0A 4MTKA 3M9BA 4YCUA 4K8IA 3BZKA 2KUMA 4CDFC 1CKOA 1HHVA 3T56B 3GO5A 2N88A 3C3LA 4QQBX 1WD0A 3FPUB 4HTHA 1HFNA 3OOCA 3NBHA 2F3IA 2K14A 2EYFA 4B3TL 3FRPB 3OMGA 5M3FH 1A8VA 1XMQL 4NW2A 3KDFB 2PMZE 4MNOA 1LTGD 4XXEA 4LW1A 3HOXB 2EXZA 3K8AA 2JA5G 1I6HB 4LF9L 3URYA 2EYLA 1AZQA 3WWVA 3CCLA 5IWAL 1B7YB 1BOSA 3I91A 5J1ZA 3GDEA 1J5EQ 3SK8A 2WACA 1H9MA 1LTAD 4EQNA 3MHBA 4E6IA 3RMHA 4C3IB 4DKAC 1CA6A 2TMPA 2NTTA 3T4AC 5E4WC 5CV8A 5KNDA 2K04A 2K28A 5DM63 3DEPA 2NN6I 1X3QA 5I9PA 3F2UA 5IY0A 1TS3A 4I7AA 3Q24A 2K5VA 3FPPA 1PZKD 4KD3A 3S2DH 3RZDB 4BXXH 3NP8A 4KHPQ 3GTQH 3KBXA 4FXGC 4IPGA 1MBYA 5K5PA 3HOYH 2R61A 1WCMB 1HNXL 5HGQA 1I3QB 1GUGA 1W6KA 1HPCA 2B39A 1GXDC 2V4DA 1B1ZA 1TVXA 3FKIG 3NK9A 3OYYA 4DR2L 3PF4A 1K0RA 3QOJA 1KRSA 1CKNB 3A8IE 4IOCA 2XIWA 1U4MA 3A0JA 1HNWL 1U4RA 1SFOH 1IKMA 4DXFA 2F0OA 2NN6G 1L2FA 3F2BA 4GZYC 1Y8NB 4K2KA 4CDCC 3JAML 2EY2A 4MZ9A 1KTKA 1FR3A 1WTQA 3LX0A 2OT2A 2KCCA 2RQXA 2B29A 2AQ2B 2K6AA 2EPBA 5IGEA 1IW7C 5C3WA 1D6EC 3K58A 4CHTB 4YWKA 1S72A 4FF2A 2K52A 3MA2B 3GTPH 1B50A 5C0XG 3DMUA 4NP5A 5JJLA 1Q12A 1E0BA 3S14B 1UAPA 5NUCA 2H4OA 1XNQL 2B63H 1EIGA 1WJJA 1K8AC 2H5XA 4JI6L 1N33Q 2I07B 4BBSH 1S5ED 2BDNA 3MTSA 2PQAA 5M5WH 2OXPA 4JVZA 4JPBW 5J3BA 1RHPA 5CBEE 4KJNA 1WOCA 3C2PA 4YY3L 4GN5A 3PO2G 2KECA 4R4TA 1PH4A 4B9WA 1PLFA 1Q8KA 1P8LA 2JP1A 2YU9B 4B9XA 2R7DA 4BWGB 1SDFA 3Q23A 1TIID 4X62L 4IFDI 3I72A 4KJOA 1C9OA 3NWSA 1VQ8A 2NB0A 3KOJA 4LF6Q 4BA2I 3FVQA 1JJCB 3I7FA 1IYJB 4A3IG 2IX3A 2R7ZH 1PH2A 1OTCA 2UUAQ 3VYTA 4HIDA 5LL6S 4BY1G 4RKBA 1KD1C 3KK7A 1AEXA 1BNZA 2Q8RE 2AWOA 1AH9A 1IBMQ 4P73A 2RSNA 4ULLA 3HOUH 1STGA 3IKJA 1WTOA 1WTRA 2WV6D 2K50A 3VA5A 1CFMA 5CGKA 1DJRD 1YHQA 3V2TA 1EQTA 1WFQA 3QJYA 4JYAL 1HTLD 4OL7A 1BR9A 1HH2P 1C7YA 3NE5B 4IFDG 2R92B 1B2TA 2EIFA 5CV5A 4DV4Q 2EJMA 1G291 3OTOQ 4POGA 1TXYA 2A6ED 3KF6A 1KLGD 4B3ML 2MUYA 2ZXRA 1IBKL 1EFWA 1VQOA 2L9HA 2ICIA 3I4NH 5HURA 4RH6A 1HUNA 4X64L 4QIWE 2E5LL 2HHHL 1QB5D 2JQOA 3GV6A 4X3KA 3HRZC 4C3JG 4B3SQ 2Q8IB 4O2DA 2MQHA 4ME3A 3X3MA 3I90A 1ET9A 2B2UA 4ZAIA 2OEOA 5DNFA 4A3DH 3STBC 2EE1A 2Y0SG 2K75A 2F0PA 1KNEA 1Q1EA 1BF4A 1H95A 5CMDA 2EQSA 4CKBA 3U4VA 3D6WA 3RZOB 4FF4A 4GKKL 1VQAA 2NVXH 1EIHA 1QE6A 4A3GB 3PQIA 4A3MB 3NTIA 3HFZB 4HJ9A 3KLWA 1HJPA 1G91A 1LACA 4R4CA 5CR3A 4DF7A 1O7IA 4LUOA 1RIPA 1TWAB 3GTMB 1VQ5A 4C3HH 1E1OA 2NVTB 1HA6A 2VXWA 4XT1B 2AMCB 2I5HA 2F0UA 3NQTA 2K5NA 1RTOA 3A55A 4DUYQ 2ASBA 2JA8B 2E2IH 1A0IA 3I73A 4XIGS 1L0WA 5IYDH 4YHHL 1U4LA 2KCNA 3GV3A 2ZXOA 1M4VA 3T16A 2K5HA 1QNUA 1FJGL 3OIQA 3HG9A 4QJFA 4KI0A 1RF2D 5KYLA 1SLJA 4DR5Q 2UXCQ 2EY6A 1XPUA 2Z4IA 4LF8Q 5M9OA 2NUCA 2RHSB 2OTJA 2JSOA 1ZYRD 2RCNA 1R4QB 3PO3G 3HOWH 1TWFH 3OMCA 4QY7A 5LMUL 1Y8PB 1PFMA 2HT1A 3CHBD 3MXNB 1EQRA 4DR3L 1EYGA 1BCPF 4YWMA 1Q46A 1Q1BA 4L5TA 3NQIA 4K5XA 5EGTA 4X6AH 4RHRA 2R93H 5CORA 1WI5A 3K7AH 5IT9L 1JT8A 1S5DD 1F2LA 4BA1I 3A74A 1DOMA 4ZUJA 3TQYA 5FO9B 1SRUA 5FK9C 1NTGA 4DAYA 1S3OA 3WDNA 2D0PA 4DR1L 3PMFA 4BXXG 1WYDA 2CW0D 2F0SA 1VQEA 1YITA 3HOYG 2EY1A 4JI1Q 2F0HA 3W1BA 3GTOB 2RHQB 4JOIA 5GADC 4HR7B 3E9HA 5M3MH 3CC7A 3A8KE 1STEA 5HGTA 1OXSC 3HP3A 4JI3Q 1KQSA 5LMNL 2GA4B 2JE6I 5GAEC 2DY8A 3DWPA 2ZTEA 1I6VC 3PUWA 3EFXD 5C44B 2N78A 1VQLA 1CZGA 1O7YA 4KN4C 3S2HB 1ASYA 4KMUC 3K5LA 1B4OA 1D1KA 1HR0L 4GN4B 4V0BA 2WKDA 4F87A 5DAUA 3MXGA 2NZ1D 3MXPA 4QCLA 1Y1VH 2EYMA 3T53B 4XYQA 3F1ZA 2YTXA 1XMQQ 3DLLA 5IOCA 1X32A 1A3UA 4PZ6A 1I50H 1EWIA 4FO2A 3H0GH 1T5XD 5C4JH 4JI7Q 2B63G 3UE0A 4GOPB 1SE3A 3S1MB 1K3RA 1BO0A 3S15B 4TRDA 4BBSG 4QGUA 1MJEA 2ZTDA 2K5WA 4B08A 4QF4A 3K5NA 4KD4A 4RGTA 1IXRA 2KJXA 1F9PA 5I2XA 5L37A 2N3SA 5IP7H 4L5QA 1L0XB 4EQ5A 4A3BH 2B2UC 3OW2A 1VQGA 2F0FA 3G48A 1ZYRC 1TQOA 1S5FD 4UP9A 3T1YL 4OXPA 3O13A 2F0LA 4OONA 3M4OB 3JAMi 2G5DA 1AN8A 1XMOQ 4BY7B 3FKIH 5ELNA 3R8BA 4JG2A 2ENBA 1QCBD 4JI0L 4MTNA
chains in the Genus database with same CATH topology
2NVQB 4MIUA 5ELEA 3BYYB 4Z9CB 2XNAC 4IUNA 2PNRC 4H7BA 1SYEA 2IX0A 2CW0C 4A93B 1TS2A 3Q0AA 4KV6A 1F9SA 4CJ0B 2F0NA 5IGFA 2NYZD 2RSOA 4L6TB 3SK4A 4DN4M 1PRTF 4KHZA 1BCPC 4PMBA 5E4XA 3VR4A 1FGBD 2F0IA 3D4RA 3DM1A 1TY0A 1LT4D 4KK7A 1SNOA 1B9NA 1ILQA 1HQMC 1NR4A 5FLXL 1V1PA 1JOQA 1PTOB 5JJZA 1PMRA 1YNJD 2EDGA 1EY8A 5FLXE 4QUCA 1R9TB 3MFGA 3HOVB 2JA6B 3OHXC 4DAPA 1QILA 5J22A 3GD7A 4IURA 4C3HG 5M3FB 3J7AF 1TKWB 3ITPA 1LABA 2RDGA 2Z1CA 4IUVA 2B2YA 3E0JA 4ZKBB 4RA8A 5CV4A 4LAAA 5IGBA 3NWTA 3MEHA 5EPLA 4OIKA 3ND8A 4IUTA 4ZRZA 2PZWA 4KKTA 1GUWA 2FMCA 3R2IA 4IFDJ 1F2YA 4DXGA 1SJED 2IWHA 5EBCA 2J0TD 3GTQB 3A54A 1EY9A 3VR6A 1BQQT 4IQZA 1TS5A 4M8AA 2FHTA 1H9SB 1FNUA 3K57A 1PXUA 1CI3M 5I9OA 3VR3A 1XXGA 1EYAA 1SXTA 4RCOA 4IUUA 2F1MA 2D9UA 1KLUD 3A8JE 4OO1I 2VB2X 3ONAB 2A74C 4KY7A 4ZYSA 1EFID 5EQ0A 5LHY1 5C6AA 1RTNA 5CV7A 1O7LA 4G57A 1EQVA 1GUOA 3NPPA 1JWUD 2JXMB 1PRTC 3MAQA 1Y1WB 1AFPA 2AUKA 3LWEA 1SMYD 4RGNA 3CU7A 2VB3X 3OW7A 1B44D 1KNAA 1UEAB 2JYOA 3L3OC 1SEBD 4RKLA 3S16B 1ZKOA 2O4XA 2Z8LA 3RLFA 4KY6A 2O2LD 4X3TA 1BUVT 2MGSA 1Q90A 2B2WA 3AU7A 2AQ1B 1SYDA 3OWEB 3I4MB 2JA7B 2R7ZB 3PIO3 1PYWD 1D2BA 1J9OA 2G9DA 2NVYB 2Z4HA 4H44C 3BS1A 3HOUB 1G2TA 4XDXA 5A35A 1GHKA 1V8QA 2SEBD 3P75A 1GUSA 4DGZA 4RAUC 1QG7A 3IFDA 4KHVA 3X3NA 3PUYA 1IL8A 1QWYA 3H91A 2B2YC 4HCSA 3VA7A 3I4NB 5FO7B 1SYGA 5C5LA 1SAPA 4CKCA 4FF1A 4OHJA 3TBIB 1QJOA 1Z47A 2SNMA 5FOBB 5KEEA 3JAME 4N9TA 2L4NA 2RBMA 2QEJC 2LFNA 5F2DA 1CM9A 2PW7A 2A69D 4K14A 2J7ZA 2K05A 2FMMA 1XYIA 4BBRB 2K33A 4P2CB 2B8FA 3ND9A 1LT3D 1EU3A 4K6DA 1OXTA 1J8IA 4LK1C 4C56C 4KKUA 3MZ5A 1ESFA 3BDCA 2X6LA 2B2TA 3I4LA 1SMYC 3FEWX 3AMUA 1PDQA 1OXUA 2A68D 3BVZA 1UNSA 1DYQA 3J80L 5FO8B 2BA1A 3KLSX 2BDOA 1AW7A 4A3JB 3QB3A 4O1NA 3TDQA 2E2HB 5C5MA 1NCVA 4ME5A 5EPKA 2WIIB 3J80E 1JCKB 1RD9D 2YYZA 2PQEA 4NDXA 2K5QA 1IYVA 1OO9B 1PZJD 2A6HD 2MHVA 3TZDA 5CBAE 2BCOA 2HCCA 3ZYYX 2X69A 3QOLA 3J81L 4DK1A 3M3YB 3I3CA 5M3MB 1ZEQX 1FD7D 2XWBB 1FYCA 2C9OA 1HXYD 2B2WC 4DNTB 5M5YB 4XYOA 3KF8A 1Q3LA 1OXVA 3PIP3 3S9WA 2A69C 2H1EA 4QUFA 4RGMA 1U4PA 1E2WA 1KAAA 1I4XA 2A73B 4S3SA 4DAVA 5EKLA 1LV9A 4RWSC 3G7LA 5I4DA 2JA5B 1HRJA 2O5IC 4HMJA 3I8ZA 4XT3B 2ZT9C 3EQLC 3LNNA 4L63B 4CGYB 4H13C 1ZXTA 1WTXA 3R93A 2XRQD 2QF7A 4ZUIA 1K8OA 5EPJA 1D5MC 3NTHA 4ILWA 2A68C 2KEEA 3NXWA 1Y69U 3N6RA 5KIXA 3BVMA 3QWNA 5DEHA 4RCNA 2F0GA 4QMGA 1D5XC 2A6EC 3GQBA 4PMCA 1SE4A 2FINB 2K01A 1EEID 5IT9E 1TWHB 2L11A 1JICA 3V96A 2A6HC 3M4YA 2E75C 2B2TC 1SYFA 3HEJA 1E2ZA 5ELCA 4U68A 1GUTA 1XWEA 4OIJA 3NHHA 3K0YA 1SNQA 4WORA 3D31A 1IHZA 1A2TA 1R4PB 1DONA 1F9RA 2K7VA 5EKIA 1RDPD 1STAA 4X3SA 2XSCA 3S1NB 3TP5A 5LL6X 3PO2B 1PTOD 2KQ3A 5IIFA 4O42A 4OO1H 1EY5A 1NUCA 1IKLA 3GTGB 3D8GA 1TWGB 2AWNA 1IYUA 5E3FA 1L0YB 4A3IB 5J39A 2BE5D 1CHPD 3S1QB 5ELDA 2AUJD 5T1IA 3MWYW 4TSSA 4C3IG 1F2MA 1D1IA 1CQFA 2R3ZA 1I4RA 1MSHA 1EWCA 4M1UB 5D65A 4R8NA 4RFBA 3PV0A 3VYSA 4JK1C 4DFAA 3DWQA 1ENAA 2IW3A 4Y7NB 4RGOS 2K32A 5JVH3 1O80A 2EY5A 4UDUC 3GTLB 1BCPB 4ZKCB 4C3JB 3DEOA 1K83B 2WKCA 5G3LD 1QOHA 2F0QA 2Y0SB 5E1FA 3C1EA 1C4QA 1TU2B 4Q0FA 1JB3A 3S1RB 5A2QL 4C2MB 5JEAH 5BN3A 3QG1A 3IAYA 1A3TA 3W3AA 2EOTA 1T5EA 1RKNA 2IX1A 3PUZA 5JPNC 5A2QE 3TP6A 2RA4A 1DXMA 3H09A 1CZWA 2FFKB 2MPMA 2K5DA 2K1BA 4EQOA 3OWFA 1B9MA 3A7AB 1GHJA 3R2TA 1STNA 1I4HA 1S5CD 3SXHA 1AZPA 2JEBI 5IGGA 5IGCA 1VMCA 3EA6A 4K8JA 1LTTD 1Z6HA 1DM0B 3H6MA 2N55A 2F4IA 4G4KA 5ELFA 3S2DB 4XQJA 3E5SA 4FF3A 3MFYA 3NSWA 1HUMA 1PZID 2RDHA 3HOYB 4NKLA 2PYKA 4I65A 4RHSA 3P1HA 4HMIA 1H9RA 5JPMC 3OIPA 1SFOB 5KNBA 1CQVA 1H9JA 3A7LA 1NAPA 3SHLA 1SNDA 2QCPX 4WJWA 4DK0A 1MI2A 2CHBD 1PTOH 1LTID 1FNVA 2F0DA 3R3OA 1Z7TA 1YNJC 1EZ8A 2K03A 4JBWA 4CBVA 3GTKB 1ESRA 1ET6A 1CA5A 2RVLA 1IW7D 1ICWA 3BDLA 3GTPB 1PRTB 2B2VA 2EYHA 2B63B 1LT5D 1BBXC 1BXTA 1E2VA 4BBSB 4EGVA 3CRLC 5M5WB 3DXJC 1NR2A 3TP8A 4G7ZC 4K5VA 4ZQ3A 4OO1G 4OGQC 3TN2A 4G7HC 1A15A 2PZUA 2VNUD 2IL8A 4J6HA 1B53A 1WTWA 1V1PB 3K5MA 4UAIA 3UI2A 1STBA 2M00A 2J4XA 1EY4A 4HSPA 1NSNS 3DHQA 4X3UA 2O5JC 1G8ZD 4MN3A 1EY6A 1TS4A 1VMPA 1X3PA 4J8QA 3TP7A 1OXXK 4TKOB 4FXKC 1JOOA 4NMZA 1SNMA 4C1NK 1M8AA 3CRKC 2HDLA 1I4GA 2XWJB 5COYA 5C0XI 3KLSA 3M85A 2NWGA 5D3DA 3I70A 2E74C 4YIJA 3D3RA 2F0WA 3HKZB 3BG3A 5K36H 1WVLA 2DN8A 1MSGA 3L7ZC 2PPBC 1GJXA 3N52A 5BN4A 3SVMA 4A3DB 4HN7A 3K59A 2IJ0A 1TT2A 5JAVA 1FNWA 3L9AX 2QDBA 5JEAG 3MXNA 3VR5A 1JR0D 2NVXB 5ELBA 3SK5A 5FKAC 1QNKA 3TSSA 2WINB 4EQPA 4PMWA 2QKIC 5DM73 2HQEA 2BOSA 4C3HB 5IODA 1PFBA 3FDTA 3TZUA 1DD2A 4KTAA 2KOLA 1V1OA 1SJHD 4K6LA 4HCEA 1I4PA 2EVBA 2E2IB 2L0CA 2HCIA 5JOBA 1DCZA 3H3VC 1HCZA 2EZVA 2XN9C 1A3VA 1ONLA 1HA5A 3DUZA 3BYTB 1KDBA 1BDOA 4AYBB 3HOWB 3RUZA 1TWFB 5ISRA 3Q6SA 4IUPA 1UUPA 2KVMA 1D5ZC 1O7ZA 2KEDA 5C3XA 1STHA 4F7XA 3PUVA 2R93B 3A56A 4N9PA 3K7AB 2B2VC 2D62A 3SK6A 1RJTA 4F8MA 2LS01 3TMEA 1HTPA 1G6ZA 2F0TA 3SEBA 3KLRA 1CT1D 1SSOA 4DU9A 4FVMA 4XTCS 3NTKA 1VF7A 1ILPA 5CV6A 1YNND 2WB1B 1LTBD 2L1BA 5CYUA 4H0LC 1JQYD 2KHSA 4R9WA 3S17B 2WAQB 3IFTA 3D4WA 1LTRD 4FNFA 3J81E 3P7JA 5CC4A 4KY5A 2DY7A 3RD4A 1HQRD 2NBFA 1F77A 3VYUA 1V43A 2RDFA 1JWMD 3D6CA 2CQAA 3K6OA 1VF5C 2E76C 2FJ2A 2QILA 1Y1VB 4IUQA 3Q22A 3W2DA 5CV9A 1I50B 3H0GB 4EVOA 3MVVA 5C4JB 3CQZB 2AQ3B 1II3A 2PMZB 1DZ1A 5D14A 3T13A 1ENCA 5I6WA 1XX8A 3DWAA 3KBGA 4A3BB 4PQXA 4DA2A 1EYDA 1CHQD 1EL0A 4KN7C 1EEFD 2EYOA 4CKEA 1C48A 1DOKA 3KUPA 1CK1A 3EVQA 3V05A 3D4DA 1JOKA 2DNEA 2EYJA 3FKIB 1EY7A 2M2LA 2PW5A 3HGBA 2EJFC 5BN5A 1WTPA 3G6JB 3HS0C 1KDCA 1GOZA 1KDAA 1RODA 1PFNA 1KABA 1TWCB 2C5CA 4L8JA 4A3KB 4IALA 1PTOF 4DNRB 1S4ZA 2L12A 1TR5A 1YNNC 5KNCA 4A3EB 4LMQD 4ZK9B 2EJGC 1MD2D 2PCFB 4LJZC 1DOLA 4WRDA 5D3IB 1SYCA 2B8GA 2NTSA 1F9QA 2ICEC 3VYRA 3CKIB 5KGUA 1BCPD 5M5XB 1HFGA 3T51B 2PZTA 2F0KA 4IN3A 5K36G 5I6YA 3MC0B 2PO4A 3U9OA 1LO5D 2ZXPA 2CVRA 4V190 4WFN3 3J7AV 3SR1A 1EOTA 3BZDB 2F0JA 4ABNA 4FP5D 3VR2A 4XQQA 1VDZA 4HEDA 4K2LA 3SDZA 3C46A 2SNSA 3BDOA 1CTMA 1EY0A 5EJWA 4F88A 2F3VA 3NUCA 4BY1B 2F03A 1B3AA 3ERQA 1TY2A 5TSSA 2D2CC 3AB9A 4BS9A 3FMCA 5G3LF 1JC7A 4TQUS 3EROA 2MP1A 2MJ8A 2R6GA 1WD1A 2F0EA 2A5HA 1H9SA 2D5DA 3WOFA 2LKVA 5C4XB 1SNPA 1Y8OB 2IT1A 2DNCA 3BVGA 3K5OA 2HDMA 5JVG3 1U9RA 3E6ZX 4PV1C 4MHEA 1I4QA 3P20A 2EYPA 1SNCA 4R8IA 1RCVD 2NN6H 2X6GA 2G9HD 3U9SA 2IPKD 1K8MA 4K5WA 2LY7A 2Q8TA 3H94A 5C3EB 4CJ1B 4G7OC 4ZLTF 2F0VA 2SDFA 5C4HA 1MGSA 5KRUA 4QIWB 4Q5VA 1ENFA 3GP7A 2XRSD 1S5BD 5C0XH 1G2SA 3QIAA 2F3WA 5JEAJ 4J1MA 5C0XJ 4HSVA 4FYDA 1EYCA 4CJ2C 1PTOC 5I2YA 4IZ8A 5AFWA 1JE4A 3OPOA 2BA0A 2KA7A 4I7ZC 2SOBA 1A2UA 2F0MA 5KYIA 2HUGA 1JWSD 1C8CA 3M7NA 1PRTD 3PO3B 3SE0A 4XQNA 2VUMB 2BE5C 1EU4A 3IL8A 2WP8J 1Q8IA 1LT6D 2LMCB 4C1NI 1STYA 1SE2A 4PNYA 2OF1A 1A6XA 1F2ZA 3C1FA 2L5TA 3M7GA 1H9KA 1VCIA 1GUNA 2XVSA 4HAEA 4U673 4ID6A 4FXDA 1LTSD 1JORA 4IFDH 2E2JB 1EWHA 5EKKA 1W6JA 2I46A 1EZ6A 2M9VA 4ODGA 1XTCD 1WTVA 2ID0A 3GTJB 5T1GA 1LLRD 3WOEA 3HZXA 4QB4A 5C4ZA 3MXUA 3QO2A 5EBDA 3J7YW 3LWUA 4A3FB 4KKSA 2L55A 2E2DC 2JEAI 3OSOA 3NBIA 2RKSA 1ML0D 1SBBB 3EJIA 1SYBA 5IGDA 3PUXA 3HOZB 1O78A 2TSSA 1AP0A 4K8IA 2KUMA 1HHVA 3T56B 3GO5A 2N88A 3C3LA 1WD0A 3FPUB 4HTHA 1HFNA 3OOCA 3NBHA 2EYFA 3FRPB 3OMGA 4NW2A 1LTGD 4XXEA 3HOXB 2EXZA 1I6HB 3URYA 2EYLA 1AZQA 1BOSA 3I91A 5J1ZA 3SK8A 2WACA 1H9MA 1LTAD 4EQNA 3MHBA 4E6IA 3RMHA 4C3IB 1CA6A 2TMPA 2NTTA 3T4AC 5E4WC 5CV8A 5KNDA 2K04A 2K28A 5DM63 3DEPA 2NN6I 1X3QA 5I9PA 3F2UA 1TS3A 3Q24A 3FPPA 1PZKD 4KD3A 3RZDB 3NP8A 3KBXA 4FXGC 1MBYA 5K5PA 2R61A 1WCMB 1I3QB 1GUGA 1W6KA 1HPCA 2B39A 1GXDC 2V4DA 1B1ZA 1TVXA 3NK9A 3QOJA 3A8IE 2XIWA 1U4MA 1U4RA 1IKMA 4DXFA 2F0OA 2NN6G 4GZYC 1Y8NB 4K2KA 3JAML 2EY2A 1KTKA 1FR3A 1WTQA 3LX0A 2OT2A 2KCCA 2RQXA 2AQ2B 2K6AA 2EPBA 5IGEA 1IW7C 5C3WA 1D6EC 3K58A 4CHTB 4FF2A 3MA2B 1B50A 5C0XG 3DMUA 4NP5A 1Q12A 1E0BA 3S14B 1UAPA 5NUCA 2H4OA 1EIGA 2I07B 1S5ED 2BDNA 3MTSA 2OXPA 5CBEE 1RHPA 4KJNA 3C2PA 2KECA 4B9WA 1PLFA 2JP1A 2YU9B 4B9XA 4BWGB 1SDFA 3Q23A 1TIID 4IFDI 3I72A 4KJOA 3NWSA 2NB0A 4BA2I 3FVQA 2IX3A 3VYTA 5LL6S 4RKBA 3KK7A 1AEXA 1BNZA 2Q8RE 2AWOA 2RSNA 4ULLA 1STGA 3IKJA 1WTOA 1WTRA 2WV6D 3VA5A 1CFMA 5CGKA 1DJRD 3V2TA 1EQTA 3QJYA 1HTLD 4OL7A 1BR9A 3NE5B 4IFDG 2R92B 1B2TA 5CV5A 2EJMA 1G291 2A6ED 1KLGD 2MUYA 2ZXRA 2L9HA 2ICIA 5HURA 4RH6A 1HUNA 1QB5D 3GV6A 4X3KA 3HRZC 4C3JG 2Q8IB 3X3MA 3I90A 1ET9A 2B2UA 4ZAIA 2OEOA 5DNFA 2EE1A 2F0PA 1KNEA 1Q1EA 1BF4A 5CMDA 4CKBA 3D6WA 3RZOB 4FF4A 1EIHA 1QE6A 4A3GB 4A3MB 3NTIA 1G91A 1LACA 5CR3A 4DF7A 1TWAB 3GTMB 2NVTB 1HA6A 2VXWA 4XT1B 2F0UA 3NQTA 1RTOA 3A55A 2JA8B 3I73A 4XIGS 1U4LA 2KCNA 3GV3A 2ZXOA 1M4VA 3T16A 1QNUA 3OIQA 3HG9A 4KI0A 1RF2D 5KYLA 2EY6A 2Z4IA 5M9OA 2NUCA 2JSOA 1ZYRD 1R4QB 3OMCA 1Y8PB 1PFMA 3CHBD 1BCPF 1Q1BA 3NQIA 4K5XA 5EGTA 4RHRA 5CORA 5IT9L 1S5DD 1F2LA 4BA1I 1DOMA 4ZUJA 5FO9B 5FK9C 4DAYA 3WDNA 3PMFA 2CW0D 2F0SA 2EY1A 2F0HA 3GTOB 4HR7B 3A8KE 1STEA 5HGTA 1OXSC 3HP3A 2GA4B 2JE6I 2DY8A 3DWPA 3PUWA 1I6VC 3EFXD 5C44B 1CZGA 1O7YA 4KN4C 3S2HB 4KMUC 3K5LA 1B4OA 1D1KA 4V0BA 2WKDA 4F87A 5DAUA 3MXGA 2NZ1D 3MXPA 4QCLA 2EYMA 3T53B 4XYQA 5IOCA 1X32A 1A3UA 4FO2A 1T5XD 1SE3A 3S1MB 1BO0A 3S15B 4TRDA 2K5WA 4B08A 4QF4A 3K5NA 4KD4A 4RGTA 2KJXA 5I2XA 1F9PA 1L0XB 2B2UC 2F0FA 1ZYRC 1TQOA 1S5FD 3O13A 2F0LA 3M4OB 1AN8A 4BY7B 3R8BA 2ENBA 1QCBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2V A;  4ZLT F;  5EPL A;  2K1B A;  2SDF A;  4X3T A;  4OIK A;  5EPJ A;  1BBX C;  2XIW A;  1U4M A;  2MGS A;  1MGS A;  1QNK A;  2B2W A;  4IUT A;  1U4R A;  2L9H A;  1IKM A;  1G2S A;  1GUW A;  1NR2 A;  1HUN A;  1ML0 D;  4ZKB B;  2KEE A;  2FJ2 A;  2CVR A;  1WTQ A;  1PFB A;  1EOT A;  1J9O A;  3GV6 A;  3FDT A;  4X3K A;  4IUQ A;  5T1I A;  1F9S A;  1AP0 A;  4CJ0 B;  1AZP A;  3MWY W;  3TN2 A;  1NCV A;  2KOL A;  4HSV A;  1A15 A;  3I90 A;  4HED A;  2NYZ D;  2B2U A;  1VMC A;  2RSO A;  3HP3 A;  5EPK A;  2KUM A;  4ZAI A;  4CJ2 C;  2IL8 A;  5DNF A;  1G2T A;  4XDX A;  5AFW A;  2EPB A;  2EE1 A;  1JE4 A;  1HHV A;  2R3Z A;  1B53 A;  2HCI A;  4DN4 M;  2N88 A;  1WTW A;  1BF4 A;  1KNE A;  4UAI A;  3UI2 A;  1CA5 A;  2DY8 A;  5EJW A;  5CMD A;  5E4X A;  1WD0 A;  1MSH A;  3FPU B;  4RAU C;  1QG7 A;  1B50 A;  1HFN A;  3IFD A;  5D65 A;  2FHT A;  3D6W A;  1E0B A;  2FIN B;  2K01 A;  5D14 A;  1DZ1 A;  1O7Y A;  3DM1 A;  1IL8 A;  2HUG A;  1EIG A;  1XX8 A;  2L11 A;  3TZD A;  1EIH A;  5CBA E;  1C8C A;  1QE6 A;  1B4O A;  2N55 A;  3H91 A;  2B2Y C;  2HCC A;  4HCS A;  4NW2 A;  1JIC A;  1ILQ A;  2BDN A;  3MTS A;  1B3A A;  3IL8 A;  3Q6S A;  1NR4 A;  2X69 A;  4X3U A;  4IUP A;  1EL0 A;  5CBE E;  1G91 A;  1RHP A;  2NZ1 D;  4MN3 A;  2KVM A;  4IUU A;  1SAP A;  2B2T C;  2MJ8 A;  2D9U A;  1HUM A;  1O7Z A;  2KED A;  2MP1 A;  2KEC A;  1AZQ A;  1O80 A;  1WD1 A;  5JJZ A;  1DOK A;  3I91 A;  3KUP A;  2VXW A;  1PLF A;  1HA6 A;  4XT1 B;  3I3C A;  2JP1 A;  3ONA B;  1VMP A;  4ZKC B;  1X3P A;  2B2V C;  3DEO A;  1RTO A;  1X32 A;  2L4N A;  4U68 A;  1SDF A;  1WTX A;  2B2W C;  5EQ0 A;  1M8A A;  1U4L A;  1RJT A;  2M2L A;  1RTN A;  3GV3 A;  4QUC A;  4OIJ A;  1WTP A;  1CM9 A;  2HDL A;  4HAE A;  1BO0 A;  1CA6 A;  2HDM A;  1ROD A;  1Q3L A;  1PFN A;  2J7Z A;  2K05 A;  2FMM A;  5COY A;  1XYI A;  5E4W C;  1G6Z A;  2K04 A;  2K28 A;  1SSO A;  3DEP A;  1X3Q A;  3F2U A;  2H1E A;  4MHE A;  2NWG A;  4IUR A;  1F9P A;  4QUF A;  1ILP A;  1NAP A;  1U4P A;  1DON A;  1F9R A;  4R8I A;  1WTV A;  2B2U C;  5EKI A;  1J8I A;  1BNZ A;  2EOT A;  2Q8R E;  1WVL A;  1PFM A;  1S4Z A;  2L12 A;  4X3S A;  1MI2 A;  1MSG A;  3LWE A;  2RSN A;  4IUV A;  3KBX A;  3N52 A;  5T1G A;  2B2Y A;  2L1B A;  2X6G A;  1WTO A;  1WTR A;  1LV9 A;  4RWS C;  3G7L A;  1HRJ A;  2X6L A;  4LMQ D;  4R9W A;  4ZK9 B;  3SVM A;  2K03 A;  3I8Z A;  3QO2 A;  1ESR A;  4O42 A;  4XT3 B;  2RA4 A;  1EQT A;  2B2T A;  5COR A;  2RVL A;  4RA8 A;  1DOL A;  1ICW A;  2Q8T A;  3P7J A;  1TVX A;  1IKL A;  1F2L A;  1F9Q A;  1PDQ A;  1KNA A;  2JYO A;  2DY7 A;  1B2T A;  2FFK B;  2MPM A;  1DOM A;  1ZXT A;  4CJ1 B;  1HFG A;  3R93 A; 
#chains in the Genus database with same CATH topology
 2NVQ B;  4MIU A;  1HNX Q;  5ELE A;  3BYY B;  2Z6B A;  4Z9C B;  5FLM G;  2XNA C;  4IUN A;  1TWC H;  2PNR C;  4NPS A;  4H7B A;  4A3K H;  1SYE A;  2IX0 A;  2NZO A;  2CW0 C;  4A93 B;  1TS2 A;  3Q0A A;  4KV6 A;  4YCW A;  1F9S A;  4CJ0 B;  2F0N A;  3ERS X;  5BR8 L;  1HNW Q;  5IGF A;  2NYZ D;  2VW9 A;  2RSO A;  4A3E H;  4EX5 A;  4L6T B;  1L1O A;  3SK4 A;  4DN4 M;  4HJ8 A;  1PRT F;  2KHI A;  4DV3 Q;  4IJH A;  4KHZ A;  1BCP C;  4PMB A;  5GAH C;  5E4X A;  3VR4 A;  1FGB D;  2F0I A;  3D4R A;  3DM1 A;  1PH3 A;  1TY0 A;  3HKZ G;  1LT4 D;  4KK7 A;  1SNO A;  1B9N A;  1ILQ A;  1HQM C;  3QR8 A;  1NR4 A;  5FLX L;  1V1P A;  1JOQ A;  4FDB A;  1PTO B;  3S1N H;  4O0A A;  1QVG A;  3K7U C;  4A3D G;  5JJZ A;  1PMR A;  1YNJ D;  2EDG A;  4JI2 L;  4JI6 Q;  3H3V I;  1VQK A;  2QGQ A;  4A3C H;  1EY8 A;  1TWG H;  5FLX E;  1QUQ B;  4QUC A;  3BZC A;  1JB7 A;  1R9T B;  3MFG A;  4YY3 Q;  3HOV B;  3JAM c;  1N36 Q;  2JA6 B;  3OHX C;  4DAP A;  4JOI C;  1QIL A;  5J22 A;  3GD7 A;  4IUR A;  4C3H G;  4BY1 H;  4X62 Q;  5M3F B;  3J7A F;  1TKW B;  3ITP A;  1LAB A;  2RDG A;  2Z1C A;  4IUV A;  1BVS A;  2B2Y A;  1LM0 A;  2AHO B;  5IYD G;  4DV7 L;  4Y52 H;  4R4Q A;  3E0J A;  2JJQ A;  4ZKB B;  5C4X H;  4RA8 A;  5CV4 A;  4DV2 Q;  4LAA A;  5IGB A;  2Z0S A;  3NWT A;  3MEH A;  5EPL A;  4AYB G;  4OIK A;  4K0K Q;  3HOW G;  3ND8 A;  4IUT A;  4ZRZ A;  2PZW A;  4KKT A;  1GUW A;  2FMC A;  3R2I A;  4IFD J;  5E7N A;  1F2Y A;  4DXG A;  1SJE D;  2IWH A;  5EBC A;  2R93 G;  2J0T D;  4N8X 1;  1YHA A;  3GTQ B;  1RL2 A;  3A54 A;  2GN5 A;  3K80 C;  4OWW B;  1EY9 A;  3VR6 A;  1BQQ T;  4X64 Q;  2HHH Q;  1N9W A;  1JE5 A;  4IQZ A;  1TS5 A;  4M8A A;  2FHT A;  3J80 c;  5C3E H;  3FP9 A;  1H9S B;  1FNU A;  3K57 A;  1PXU A;  1CI3 M;  5I9O A;  3VR3 A;  1XXG A;  1X9N A;  1EYA A;  1SXT A;  4RCO A;  1N34 Q;  2WB1 G;  4IUU A;  2F1M A;  2D9U A;  4IPH A;  5LMN W;  1KLU D;  2WAQ G;  3ER0 A;  4UPA A;  3A8J E;  2BH8 A;  2YTY A;  4GKK Q;  3RR5 A;  4OO1 I;  2VB2 X;  3ONA B;  4DR7 Q;  2A74 C;  3J7A 5;  4LUV A;  4DR4 L;  4KY7 A;  1X3E A;  4ZYS A;  1EFI D;  5EQ0 A;  5LHY 1;  5C6A A;  1RTN A;  5CV7 A;  1O7L A;  1HR0 W;  1VQN A;  4G57 A;  1EQV A;  5IE8 A;  1UE1 A;  1GUO A;  3E3X A;  2JN4 A;  3NPP A;  1JWU D;  2JXM B;  1GD7 A;  1PRT C;  1BBU A;  3MAQ A;  3PO3 H;  3CC2 A;  4YHH Q;  1Y1W B;  1AFP A;  1Y1V G;  4NXM L;  2ZJR A;  4JI8 Q;  1L1O C;  2AUK A;  1QZH A;  1FJG Q;  4AQY Q;  3LWE A;  4GLA C;  1SMY D;  4RGN A;  3H0G G;  3CU7 A;  2VB3 X;  3OW7 A;  5GQO A;  2C35 B;  3UDG A;  4DV1 L;  1B44 D;  1KNA A;  1UEA B;  2JYO A;  3L3O C;  1SEB D;  4RKL A;  3S16 B;  1ZKO A;  2O4X A;  4X66 Q;  2Z8L A;  3RLF A;  4KY6 A;  2O2L D;  4X3T A;  5IP7 G;  1BUV T;  2MGS A;  3CPF A;  4A3B G;  1Q90 A;  2B2W A;  1EIY B;  4OX9 L;  3AU7 A;  2AQ1 B;  5IP9 H;  1SYD A;  3OWE B;  3I4M B;  2JA7 B;  2R7Z B;  4P75 A;  1FL0 A;  3PIO 3;  1PYW D;  4GKJ L;  1D2B A;  1J9O A;  2G9D A;  2NVY B;  3KYH C;  3GTJ H;  2Z4H A;  4H44 C;  3BS1 A;  3HOU B;  2OQK A;  1G2T A;  4XDX A;  1NMF A;  5A35 A;  1GHK A;  1XNR Q;  1V8Q A;  1K73 C;  2SEB D;  3P75 A;  1GUS A;  4UP8 A;  4DGZ A;  4A3F H;  4RAU C;  1QG7 A;  3IFD A;  4UHV A;  4KHV A;  3X3N A;  4WJ3 M;  3PUY A;  4A3K G;  1IL8 A;  4QL5 A;  1VQ7 A;  1QWY A;  1EQQ A;  4CDE C;  4DUZ Q;  3H91 A;  2B2Y C;  4HCS A;  3VA7 A;  1B8A A;  4B3R L;  5IT9 c;  2UXD L;  3I4N B;  1Y14 B;  5FO7 B;  1E1T A;  1SYG A;  5C5L A;  1SAP A;  2XGT A;  4CKC A;  4A3E G;  4FF1 A;  4OHJ A;  3TBI B;  3AFP A;  1QJO A;  1Z47 A;  4R4O A;  3GTK H;  3HOZ H;  3I4O A;  2SNM A;  5FOB B;  2VL6 A;  5KEE A;  3JAM E;  4N9T A;  4R1J A;  2L4N A;  2RBM A;  2QEJ C;  2LFN A;  5F2D A;  3L2P A;  3RNU A;  1KAW A;  1VQB A;  4LFC L;  1CM9 A;  2PW7 A;  2A69 D;  4K14 A;  4JC0 A;  2J7Z A;  2K05 A;  2FMM A;  1XYI A;  4BBR B;  2K33 A;  2HIX A;  4P2C B;  2B8F A;  2VS1 A;  3ND9 A;  1LT3 D;  1EU3 A;  4K6D A;  1OXT A;  2V1C C;  4LWC A;  1J8I A;  2UXB L;  3HOX H;  1I6H H;  4LK1 C;  4C56 C;  4KKU A;  4LF7 L;  3MZ5 A;  2HIV A;  4PZ8 A;  1ESF A;  3BDC A;  2X6L A;  3IRB A;  4A3C G;  1K28 A;  4DV5 L;  2B2T A;  3I4L A;  2D0O A;  1SMY C;  3FEW X;  3AMU A;  1PDQ A;  4C3I H;  1X6O A;  1E22 A;  1XJV A;  1N32 L;  1OXU A;  2A68 D;  3BVZ A;  2Z6K A;  3I55 A;  1XPO A;  5FLM H;  4DR6 L;  1UNS A;  1DYQ A;  1G51 A;  3J80 L;  1KXL A;  1Z9F A;  5FO8 B;  2BA1 A;  3KLS X;  2DJF C;  2BDO A;  1AW7 A;  4A3J B;  3NBH B;  3RZD H;  4LF4 L;  3QB3 A;  4O1N A;  3TDQ A;  2E2H B;  5C4X G;  5C5M A;  1NCV A;  4ME5 A;  5H1S E;  5EPK A;  1WCM H;  2WII B;  4POF A;  4LFA L;  3J80 E;  1JCK B;  1I3Q H;  1RD9 D;  2YYZ A;  2PQE A;  4L5S A;  1HZ9 A;  4NDX A;  5DLQ E;  2K5Q A;  1IYV A;  2ZM6 L;  1OO9 B;  2DUD A;  5FJ8 G;  1PZJ D;  2A6H D;  2MHV A;  3TZD A;  5CBA E;  4LF5 Q;  2BCO A;  2HCC A;  3ZYY X;  1PH7 A;  2X69 A;  1J6Q A;  3QOL A;  1C0A A;  3J81 L;  4DK1 A;  2KHJ A;  1GKH A;  2A1A A;  4A93 G;  3T1H L;  2UU9 L;  3M3Y B;  3I3C A;  5M3M B;  2ES2 A;  1ZEQ X;  1FD7 D;  3EBE A;  2XWB B;  1FYC A;  5AJ3 Q;  5C3E G;  2C9O A;  4JV5 Q;  1HXY D;  2B2W C;  2ALY B;  1SN8 A;  4YCV A;  4DNT B;  5M5Y B;  4XYO A;  3KF8 A;  1Q3L A;  4JI2 Q;  1OXV A;  3PIP 3;  3RLO A;  3S14 H;  3S9W A;  2A69 C;  1M1K C;  2H1E A;  3ULL A;  4RGM A;  4QUF A;  1U4P A;  1E2W A;  1KAA A;  1I4X A;  2A73 B;  4S3S A;  2CH4 A;  4DAV A;  3CCM A;  3TRE A;  4R4I A;  5EKL A;  2CCZ A;  4DV0 L;  1PYS B;  1LV9 A;  4RWS C;  3G7L A;  5I4D A;  2JA5 B;  1HRJ A;  2O5I C;  4HMJ A;  3I8Z A;  3AEV A;  3H3V H;  4XT3 B;  1K8G A;  2YU9 H;  2ZT9 C;  3EQL C;  3LNN A;  4L63 B;  4CGY B;  2UUB Q;  4H13 C;  5FLX c;  1ZXT A;  2RCF A;  1WTX A;  3R93 A;  2XRQ D;  2QF7 A;  2ZTC A;  4ZUI A;  1K8O A;  5EPJ A;  1D5M C;  2YV5 A;  4DV7 Q;  2VUM G;  1YZ6 A;  3NTH A;  4ILW A;  2A68 C;  3AFQ A;  4HJ5 A;  3G6E A;  4DNI A;  2KEE A;  3NXW A;  4CDD C;  1J5E L;  3ICE A;  1BKB A;  1Y69 U;  3U50 C;  3N6R A;  3CCJ A;  5KIX A;  1PH8 A;  4LFB Q;  3LGJ A;  3BVM A;  3QWN A;  4JBJ A;  2PQA B;  4JI4 Q;  5DEH A;  3F8T A;  1MIU A;  4RCN A;  2I5M X;  1YIJ A;  3EN2 A;  2R92 H;  2F0G A;  4P72 A;  4QMG A;  1D5X C;  2A6E C;  5IP9 G;  3CAM A;  3GQB A;  4PMC A;  1SE4 A;  2FIN B;  2K01 A;  1EEI D;  5IT9 E;  1TWH B;  2E8G A;  2L11 A;  1KC8 C;  1V1Q A;  1JIC A;  1MJC A;  3V96 A;  2ATW A;  2A6H C;  2LXK A;  2PNH A;  3M4Y A;  2E75 C;  1EOV A;  4DV6 Q;  2F4V L;  2DJG C;  2MO1 A;  3U4Z A;  2B2T C;  4A75 A;  2VQE L;  4NXN L;  3S17 H;  1SYF A;  3HEJ A;  1QUQ A;  1E2Z A;  4A3F G;  5ELC A;  4U68 A;  2Z6K C;  1GUT A;  1XWE A;  3EIV A;  4OIJ A;  3NHH A;  4OEL B;  3BU2 A;  1VQ6 A;  4OWT B;  3RZO H;  3K0Y A;  1SNQ A;  4WOR A;  4DR4 Q;  3D31 A;  1IHZ A;  1A2T A;  1R4P B;  4A3G H;  4IJL A;  1F9R A;  1DON A;  2Z9H A;  4A3M H;  2K7V A;  1I5F A;  5EKI A;  3HOZ G;  2CKZ B;  2CWA A;  1RDP D;  1STA A;  4B3T Q;  4X3S A;  4P71 A;  3KF6 B;  1WTH A;  1W3S A;  1K3B C;  1TWA H;  3NEL A;  2XSC A;  1ICF B;  2QEX A;  1PH1 A;  3S1N B;  2PI2 E;  3TP5 A;  5LL6 X;  2NVT H;  3PO2 B;  1PTO D;  2KQ3 A;  3CQZ H;  4LF9 Q;  5IIF A;  4O42 A;  1LTL A;  4OO1 H;  1EY5 A;  2JA8 H;  5IWA Q;  1NUC A;  1IKL A;  3GTG B;  4J15 A;  1N33 L;  4WJ4 A;  3S24 A;  3D8G A;  4JBM A;  1TWG B;  2AWN A;  3CCQ A;  4OWX B;  1IYU A;  5E3F A;  1X3F A;  1L0Y B;  3HOX G;  4A3I B;  4L5R C;  3W1G A;  5J39 A;  2BE5 D;  3SGI A;  1YI2 A;  1CHP D;  3S1Q B;  5ELD A;  2N8N A;  2AUJ D;  5T1I A;  1EUJ A;  2KBN A;  3MWY W;  4TSS A;  1UEB A;  4C3I G;  1F2M A;  1D1I A;  1X3G A;  1CQF A;  4GNX B;  2R3Z A;  2F52 A;  1I4R A;  4P74 A;  1E7Z A;  1D7Q A;  1X56 A;  1MSH A;  1EWC A;  2KEN A;  2UUA L;  4M1U B;  5D65 A;  2XTI A;  2Q2T A;  4R8N A;  4RFB A;  3PV0 A;  3CCR A;  3VYS A;  4JK1 C;  3KJO A;  4DR2 Q;  1PA6 A;  4DFA A;  4DK6 C;  2UUC L;  3DWQ A;  1ENA A;  3NEM A;  4X65 L;  2YTV A;  2IW3 A;  4Y7N B;  4RGO S;  2K32 A;  1WCM G;  5JVH 3;  3GTO H;  4GS3 A;  1O80 A;  2EY5 A;  4IPD A;  4UDU C;  3GTL B;  1BCP B;  3A5U A;  4ZKC B;  4DV4 L;  4C3J B;  3DEO A;  3OTO L;  1K83 B;  2RF4 A;  2WKC A;  2IHE A;  5M5X H;  5G3L D;  3KDF A;  3K81 C;  1V9P A;  3M4P A;  1QOH A;  2F0Q A;  2VZA A;  2Y0S B;  5E1F A;  3C1E A;  1C4Q A;  1TU2 B;  4YWL A;  4Q0F A;  1JB3 A;  5C44 H;  3S1R B;  3S2H H;  5A2Q L;  4C2M B;  5JEA H;  5BN3 A;  3QG1 A;  3IAY A;  1A3T A;  3W3A A;  1XNQ Q;  2EOT A;  1T5E A;  3J80 i;  4DAY B;  1RKN A;  2IX1 A;  3PUZ A;  5JPN C;  5A2Q E;  3TP6 A;  2RA4 A;  1DXM A;  3H09 A;  4UY8 C;  3JC6 6;  1CZW A;  2LXJ A;  3TS0 A;  2FFK B;  2MPM A;  2QW7 A;  2K5D A;  4N8F A;  3S1M H;  2K1B A;  3CME A;  4EQO A;  3OWF A;  4DV5 Q;  1B9M A;  3A7A B;  1GHJ A;  3G71 A;  1YJN A;  3K0X A;  3R2T A;  1STN A;  1I4H A;  1S5C D;  3SXH A;  1VQF A;  5IYB G;  3UDI A;  1AZP A;  2JEB I;  1CKN A;  4DR6 Q;  5IGG A;  5IGC A;  1VMC A;  1SMX A;  3M4O H;  4DR5 L;  2UXC L;  4AH6 A;  3EA6 A;  4K8J A;  4BY7 H;  1LTT D;  1Z6H A;  4LF4 Q;  5FJ8 H;  4JYA Q;  1DM0 B;  2NVQ H;  3H6M A;  2N55 A;  1A63 A;  3RN5 A;  2F4I A;  4G4K A;  4JI5 L;  5ELF A;  3S2D B;  4XQJ A;  4B3M Q;  3F2D A;  3E5S A;  1IBK Q;  4FF3 A;  3MFY A;  3NSW A;  1HUM A;  1PZI D;  2RDH A;  2ZM6 Q;  3HOY B;  4A93 H;  2KCT A;  4NKL A;  2PYK A;  2E5L Q;  3AQQ A;  2ZJP A;  1PH6 A;  4I65 A;  2R92 G;  4RHS A;  3P1H A;  4HMI A;  2VY3 A;  4IOA A;  2N49 A;  1H9R A;  5JPM C;  2HD3 A;  3OIP A;  4JI1 L;  1SFO B;  2I0Q A;  5KNB A;  1CQV A;  2LSS A;  3CW2 C;  1H9J A;  3A7L A;  4H02 A;  1NAP A;  3SHL A;  3TRZ A;  1SND A;  2QCP X;  4WJW A;  4DK0 A;  1PH9 A;  1NJI C;  4JI3 L;  1MI2 A;  2CHB D;  1PTO H;  1LTI D;  1FNV A;  2F0D A;  3R3O A;  1Z7T A;  1YNJ C;  3U58 A;  1EZ8 A;  2K03 A;  4JBW A;  4CBV A;  2MNA A;  3GTK B;  1ESR A;  1ET6 A;  1CA5 A;  2RVL A;  1IW7 D;  1ICW A;  3BDL A;  4LUZ A;  1HZB A;  3GTP B;  1VQ9 A;  1PRT B;  1VQM A;  1R9T H;  2B2V A;  2EYH A;  4DV0 Q;  3HOV H;  2B63 B;  3J81 c;  3CD6 A;  1LT5 D;  1BBX C;  4A3G G;  1BXT A;  2DGY A;  4A3M G;  2ZJQ A;  2JA6 H;  1E2V A;  2VUM H;  3TS2 A;  4BBS B;  1L1O B;  4EGV A;  3CRL C;  1G6P A;  5M5W B;  2A19 A;  3DXJ C;  1NR2 A;  2Q2U A;  3TP8 A;  4G7Z C;  3J81 j;  4K5V A;  1Q81 C;  4ZQ3 A;  1VQD A;  4OO1 G;  4OGQ C;  3TN2 A;  2JA8 G;  4G7H C;  5ELO A;  4JI7 L;  1A15 A;  5LMU Q;  2PZU A;  2VNU D;  2IL8 A;  4DR3 Q;  1QZG A;  4J6H A;  1B53 A;  1WTW A;  1V1P B;  2MO0 A;  3K5M A;  4UAI A;  3J7Z C;  3UI2 A;  4A76 A;  2E2J H;  1P16 A;  1STB A;  2M00 A;  5JJK A;  2JK8 A;  2J4X A;  4IPC A;  2AKW B;  1EY4 A;  4HSP A;  1NSN S;  3DHQ A;  4X3U A;  1T9H A;  2O5J C;  1G8Z D;  1YVC A;  4MN3 A;  4DR1 Q;  1XMO L;  1IBL L;  2OWO A;  4RG1 A;  1EY6 A;  1TS4 A;  2QA4 A;  1VMP A;  1X3P A;  2B3G A;  4J8Q A;  3TP7 A;  1VQC A;  1OXX K;  4TKO B;  4FXK C;  1JOO A;  4NMZ A;  1SNM A;  3RN2 A;  2F4V Q;  4C1N K;  1M8A A;  2CFM A;  2VQE Q;  3CRK C;  4NXN Q;  2HDL A;  1I4G A;  5LMN Q;  2XWJ B;  5COY A;  2EXD A;  5C0X I;  3KLS A;  4GLV B;  1X65 A;  3M85 A;  2Q2I A;  2NWG A;  5D3D A;  3D0F A;  1I94 L;  1NY4 A;  3I70 A;  2E74 C;  2L15 A;  4YIJ A;  3D3R A;  3HKZ B;  2F0W A;  3BG3 A;  4PZ7 A;  5K36 H;  3CP0 A;  1WVL A;  2DN8 A;  1MSG A;  3L7Z C;  1GVP A;  3E9I A;  2PPB C;  1GJX A;  3N52 A;  1HR0 Q;  5BN4 A;  1YHB A;  4DV3 L;  3SVM A;  4A3D B;  4HN7 A;  4NB3 A;  1IZ6 A;  3STB D;  3K59 A;  1HNZ L;  1VQP A;  2IJ0 A;  1TT2 A;  5JAV A;  5C44 G;  1FNW A;  3L9A X;  2QDB A;  5JEA G;  3MXN A;  3VR5 A;  1JR0 D;  2NVX B;  5ELB A;  3SK5 A;  4GN3 B;  4RMF A;  1QNK A;  5FKA C;  3TSS A;  2WIN B;  4EQP A;  4PMW A;  2QKI C;  5DM7 3;  5GRO A;  2HQE A;  1VQH A;  2BOS A;  1Y1W H;  4C3H B;  5IOD A;  1PFB A;  3FDT A;  3TZU A;  1DD2 A;  4KTA A;  1PHJ A;  2KOL A;  1V1O A;  1SJH D;  4K6L A;  4HCE A;  1N36 L;  1I4P A;  2EVB A;  2E2I B;  3UE1 A;  2L0C A;  2P5Z X;  1IL2 A;  2WFW A;  2HCI A;  1CUK A;  1KIX A;  1N8R C;  2VQF L;  3T1Y Q;  4DK3 C;  1SE8 A;  5JOB A;  1DCZ A;  3H3V C;  1BBW A;  4HIM A;  4LNQ A;  1HCZ A;  2EZV A;  2XN9 C;  1A3V A;  3S16 H;  1ONL A;  1HA5 A;  3DUZ A;  3BYT B;  1KDB A;  1BDO A;  4AYB B;  4JI0 Q;  3HOW B;  3RUZ A;  1TWF B;  5ISR A;  3Q6S A;  4IUP A;  2JA7 H;  3I4M H;  1UUP A;  3PGZ A;  4PG3 A;  2KVM A;  1D5Z C;  1O7Z A;  1QVC A;  2KED A;  5C3X A;  2JA9 A;  4DV2 L;  1E3P A;  1STH A;  4F7X A;  3I56 A;  3I2Z A;  2NVY H;  3PUV A;  1UE6 A;  2R93 B;  3A56 A;  4N9P A;  4BY7 G;  3K7A B;  2B2V C;  2D62 A;  3SK6 A;  2UUC Q;  4X65 Q;  4K0K L;  1ASZ A;  5BR8 Q;  1RJT A;  3CPW A;  1E24 A;  4F8M A;  5GAG C;  2LS0 1;  3TME A;  1HTP A;  1G6Z A;  2F0T A;  3SEB A;  3KLR A;  1CT1 D;  2Y0S E;  1SSO A;  4DU9 A;  4DPG A;  4FVM A;  4XTC S;  3NTK A;  1VF7 A;  3UDF A;  1ILP A;  1B70 B;  5CV6 A;  1YNN D;  1KL9 A;  3E0E A;  2WB1 B;  4GOP A;  1LTB D;  2L1B A;  5JJI A;  5CYU A;  4H0L C;  1JQY D;  2KHS A;  2GVA A;  4R9W A;  3S17 B;  2WAQ B;  3IFT A;  3D4W A;  2CQO A;  1LTR D;  2KCM A;  4FNF A;  3J81 E;  1K0S A;  1M90 C;  3P7J A;  1KRT A;  5CC4 A;  4KY5 A;  2DY7 A;  4OEM B;  3RD4 A;  1HQR D;  2NBF A;  5IYC H;  1F77 A;  3KFU A;  3VYU A;  1N34 L;  3CC4 A;  3ZJY C;  1V43 A;  2RDF A;  1JWM D;  4BBR H;  1PV4 A;  3D6C A;  2CQA A;  3K6O A;  1VF5 C;  2E76 C;  2FJ2 A;  4DR7 L;  4HIO A;  3Q8D A;  2QIL A;  5IYB H;  1Y1V B;  4IUQ A;  4GNX A;  3Q22 A;  3W2D A;  5CV9 A;  1I50 B;  1AE3 A;  3F2C A;  1X55 A;  3H0G B;  4EVO A;  3MVV A;  5C4J B;  3PIO A;  3CQZ B;  3NEN A;  3BJU A;  3HOV G;  1NBW A;  2JA6 G;  2OCE A;  2AQ3 B;  1II3 A;  4HJ7 A;  2PMZ B;  4A3L H;  1DZ1 A;  5D14 A;  3T13 A;  1ENC A;  5I6W A;  1XX8 A;  4JI8 L;  3DM3 A;  3DWA A;  5M3F G;  4AQY L;  3KBG A;  4A3B B;  4PQX A;  4DA2 A;  1EYD A;  1CHQ D;  1EL0 A;  4KN7 C;  1EEF D;  4UP7 A;  1DGS A;  2EYO A;  4CKE A;  4A3J H;  1C48 A;  1DOK A;  3KUP A;  1QVF A;  1CK1 A;  2E2H H;  3EVQ A;  1LYL A;  4AIM A;  3V05 A;  3D4D A;  4X66 L;  1JOK A;  4JI5 Q;  2DNE A;  2EYJ A;  3FKI B;  2MFI A;  1EY7 A;  2R7F A;  1YNX A;  2M2L A;  2PW5 A;  2OTL A;  3HKS A;  3HGB A;  2EJF C;  5BN5 A;  1WTP A;  3G6J B;  3HS0 C;  3MEF A;  1UE5 A;  1PH5 A;  1KDC A;  4KHP L;  1GOZ A;  4A4I A;  1KDA A;  1ROD A;  1PFN A;  4IO9 A;  1KAB A;  1PYB A;  1TWC B;  1YJ9 A;  2C5C A;  4L8J A;  4A3K B;  4IAL A;  4DAM A;  1PTO F;  4DNR B;  1U5K A;  1X54 A;  1S4Z A;  2L12 A;  1NMG A;  1TR5 A;  3B6Y A;  1AE2 A;  3CCS A;  1YNN C;  5KNC A;  1XNR L;  4A3E B;  4LMQ D;  1HZA A;  4ZK9 B;  3AYH B;  3M3Y H;  2EJG C;  4APV A;  1MD2 D;  1SR3 A;  2PCF B;  4LJZ C;  1DOL A;  4WRD A;  5D3I B;  1SYC A;  2B8G A;  2NTS A;  1F9Q A;  2ICE C;  3VYR A;  3CKI B;  5KGU A;  1BCP D;  5M5X B;  4DUZ L;  1HFG A;  1FVI A;  3T51 B;  5M5Y H;  1GM5 A;  1UWV A;  1D8L A;  1FGU A;  2OQ0 A;  2PZT A;  2F0K A;  4IN3 A;  5K36 G;  5I6Y A;  3MC0 B;  2IY5 B;  2PO4 A;  1YEZ A;  3U9O A;  3PF5 A;  1LO5 D;  3GTM H;  2ZXP A;  2CVR A;  4V19 0;  4WFN 3;  3J7A V;  3SR1 A;  1EOT A;  3BZD B;  2F0J A;  4ABN A;  4FP5 D;  3VR2 A;  4XQQ A;  1VDZ A;  3CCE A;  4HED A;  4K2L A;  2JA5 H;  4NXM Q;  1Q82 C;  1PFS A;  3SDZ A;  1HZC A;  4GLX A;  3C46 A;  2SNS A;  3BDO A;  1CTM A;  1EY0 A;  1NNX A;  3W5O A;  1JJ2 A;  3CMA A;  5EJW A;  4F88 A;  2F3V A;  4KLK A;  1Q86 C;  4DV1 Q;  1JJG A;  3NUC A;  1Y1W G;  4GOP C;  4BY1 B;  2F03 A;  1KHI A;  1B3A A;  1JMC A;  1NE3 A;  3ERQ A;  1TY2 A;  5TSS A;  1Q7Y C;  2D2C C;  3AB9 A;  4BS9 A;  3FMC A;  5G3L F;  4OX9 Q;  1JC7 A;  4TQU S;  4LF6 L;  3ERO A;  2CH4 W;  2MJ8 A;  2MP1 A;  3KF8 B;  3CCU A;  4JCV E;  4JW0 A;  2R6G A;  5EAY A;  3CCV A;  1WD1 A;  2F0E A;  2A5H A;  1H9S A;  2D5D A;  3ULP A;  3WOF A;  2LKV A;  5C4X B;  4GKJ Q;  1SNP A;  3PCO B;  1YJW A;  1Y8O B;  2IT1 A;  2DNC A;  3BVG A;  3K5O A;  3M4Q A;  1IBM L;  3G4S A;  1IBL Q;  2HDM A;  5JVG 3;  1U9R A;  3CXC A;  3RLN A;  3E6Z X;  2JA7 G;  3I4M G;  2R7Z G;  4PV1 C;  1TWH H;  4MHE A;  4GNX C;  2HQL A;  1I4Q A;  3P20 A;  1CKM A;  2EYP A;  1SNC A;  4R8I A;  5HY6 A;  1RCV D;  2NN6 H;  4HIK A;  1YBY A;  3HOU G;  3PIP A;  2X6G A;  2G9H D;  3U9S A;  2IPK D;  3HKZ E;  4B3R Q;  2UXD Q;  1K8M A;  4K5W A;  2LY7 A;  3ULJ A;  1B3Q A;  1I94 Q;  2Q8T A;  3H94 A;  4HJA A;  4LF5 L;  5C3E B;  4CJ1 B;  2PI2 A;  4G7O C;  4ZLT F;  2F0V A;  2SDF A;  4B3S L;  1W2B A;  5C4H A;  4ZCK A;  1MGS A;  5KRU A;  4QIW B;  4Q5V A;  1ENF A;  1VQJ A;  3GP7 A;  2XRS D;  1S5B D;  5C0X H;  4LFC Q;  3I4N G;  1G2S A;  1HNZ Q;  2IHF A;  3QIA A;  2F3W A;  5JEA J;  5AJ3 L;  2NZH A;  4JV5 L;  4J1M A;  5C0X J;  4HSV A;  4FYD A;  1EYC A;  4CJ2 C;  2UXB Q;  1A62 A;  1PTO C;  5I2Y A;  3PO2 H;  4IZ8 A;  3FHW A;  5AFW A;  1JE4 A;  3OPO A;  5IYC G;  4LF7 Q;  4TVA B;  1EIF A;  2BA0 A;  3S15 H;  2KA7 A;  3GTG H;  2FXQ A;  4I7Z C;  2SOB A;  4BBR G;  1GO3 E;  1A2U A;  2F0M A;  5KYI A;  4JBK A;  2CWP A;  1SRO A;  2HUG A;  3CF5 A;  1JWS D;  2QDL A;  1C8C A;  3M7N A;  1PRT D;  3PO3 B;  3SE0 A;  4XQN A;  4DUY L;  2VUM B;  2BE5 C;  1N32 Q;  1EU4 A;  3IL8 A;  2WP8 J;  1Q8I A;  2VQF Q;  4A3I H;  1LT6 D;  2LMC B;  4C1N I;  1STY A;  1CSP A;  1VQ4 A;  4AYB E;  3PSI A;  1PVO A;  3S1Q H;  2UUB L;  1XPR A;  1SE2 A;  3J81 i;  4PNY A;  4LF8 L;  2OF1 A;  3UDX A;  1A6X A;  3H15 A;  1U0L A;  1F2Z A;  1MHW C;  3C1F A;  4A3L G;  2L5T A;  1VQI A;  3M7G A;  3A5Z B;  1H9K A;  1VCI A;  1GUN A;  2XVS A;  4HAE A;  4LFA Q;  4U67 3;  4ID6 A;  4FXD A;  1LTS D;  1JOR A;  4IFD H;  2E2J B;  1EWH A;  2Q2H A;  5EKK A;  1W6J A;  2I46 A;  1EZ6 A;  3L0O A;  2M9V A;  1S40 A;  4ODG A;  1K9M C;  1XTC D;  4A3J G;  3VDY A;  4LFB L;  2A8V A;  1WTV A;  4Y7N H;  2ID0 A;  4JI4 L;  3KJP A;  3GTJ B;  5T1G A;  1LLR D;  3WOE A;  3HZX A;  1CSQ A;  4QB4 A;  5C4Z A;  2K4K A;  3MXU A;  3GTL H;  3QO2 A;  2GVB A;  2WB1 E;  5EBD A;  4C3J H;  3J7Y W;  3LWU A;  1K83 H;  3T1H Q;  2I5L X;  1MKH A;  4A3F B;  2UU9 Q;  4KKS A;  4ALP A;  2WAQ E;  2L55 A;  2BH2 A;  2E2D C;  3TEH B;  2JEA I;  1XTD A;  4DV6 L;  3OSO A;  3NBI A;  2RKS A;  3S1R H;  4C2M H;  1LUZ A;  1ML0 D;  1SBB B;  3EJI A;  1SYB A;  1UE7 A;  5IGD A;  1VS0 A;  3PUX A;  3HOZ B;  5M3M G;  1O78 A;  2TSS A;  1AP0 A;  4MTK A;  3M9B A;  4YCU A;  4K8I A;  3BZK A;  2KUM A;  4CDF C;  1CKO A;  1HHV A;  3T56 B;  3GO5 A;  2N88 A;  3C3L A;  4QQB X;  1WD0 A;  3FPU B;  4HTH A;  1HFN A;  3OOC A;  3NBH A;  2F3I A;  2K14 A;  2EYF A;  4B3T L;  3FRP B;  3OMG A;  5M3F H;  1A8V A;  1XMQ L;  4NW2 A;  3KDF B;  2PMZ E;  4MNO A;  1LTG D;  4XXE A;  4LW1 A;  3HOX B;  2EXZ A;  3K8A A;  2JA5 G;  1I6H B;  4LF9 L;  3URY A;  2EYL A;  1AZQ A;  3WWV A;  3CCL A;  5IWA L;  1B7Y B;  1BOS A;  3I91 A;  5J1Z A;  3GDE A;  1J5E Q;  3SK8 A;  2WAC A;  1H9M A;  1LTA D;  4EQN A;  3MHB A;  4E6I A;  3RMH A;  4C3I B;  4DKA C;  1CA6 A;  2TMP A;  2NTT A;  3T4A C;  5E4W C;  5CV8 A;  5KND A;  2K04 A;  2K28 A;  5DM6 3;  3DEP A;  2NN6 I;  1X3Q A;  5I9P A;  3F2U A;  5IY0 A;  1TS3 A;  4I7A A;  3Q24 A;  2K5V A;  3FPP A;  1PZK D;  4KD3 A;  3S2D H;  3RZD B;  4BXX H;  3NP8 A;  4KHP Q;  3GTQ H;  3KBX A;  4FXG C;  4IPG A;  1MBY A;  5K5P A;  3HOY H;  2R61 A;  1WCM B;  1HNX L;  5HGQ A;  1I3Q B;  1GUG A;  1W6K A;  1HPC A;  2B39 A;  1GXD C;  2V4D A;  1B1Z A;  1TVX A;  3FKI G;  3NK9 A;  3OYY A;  4DR2 L;  3PF4 A;  1K0R A;  3QOJ A;  1KRS A;  1CKN B;  3A8I E;  4IOC A;  2XIW A;  1U4M A;  3A0J A;  1HNW L;  1U4R A;  1SFO H;  1IKM A;  4DXF A;  2F0O A;  2NN6 G;  1L2F A;  3F2B A;  4GZY C;  1Y8N B;  4K2K A;  4CDC C;  3JAM L;  2EY2 A;  4MZ9 A;  1KTK A;  1FR3 A;  1WTQ A;  3LX0 A;  2OT2 A;  2KCC A;  2RQX A;  2B29 A;  2AQ2 B;  2K6A A;  2EPB A;  5IGE A;  1IW7 C;  5C3W A;  1D6E C;  3K58 A;  4CHT B;  4YWK A;  1S72 A;  4FF2 A;  2K52 A;  3MA2 B;  3GTP H;  1B50 A;  5C0X G;  3DMU A;  4NP5 A;  5JJL A;  1Q12 A;  1E0B A;  3S14 B;  1UAP A;  5NUC A;  2H4O A;  1XNQ L;  2B63 H;  1EIG A;  1WJJ A;  1K8A C;  2H5X A;  4JI6 L;  1N33 Q;  2I07 B;  4BBS H;  1S5E D;  2BDN A;  3MTS A;  2PQA A;  5M5W H;  2OXP A;  4JVZ A;  4JPB W;  5J3B A;  1RHP A;  5CBE E;  4KJN A;  1WOC A;  3C2P A;  4YY3 L;  4GN5 A;  3PO2 G;  2KEC A;  4R4T A;  1PH4 A;  4B9W A;  1PLF A;  1Q8K A;  1P8L A;  2JP1 A;  2YU9 B;  4B9X A;  2R7D A;  4BWG B;  1SDF A;  3Q23 A;  1TII D;  4X62 L;  4IFD I;  3I72 A;  4KJO A;  1C9O A;  3NWS A;  1VQ8 A;  2NB0 A;  3KOJ A;  4LF6 Q;  4BA2 I;  3FVQ A;  1JJC B;  3I7F A;  1IYJ B;  4A3I G;  2IX3 A;  2R7Z H;  1PH2 A;  1OTC A;  2UUA Q;  3VYT A;  4HID A;  5LL6 S;  4BY1 G;  4RKB A;  1KD1 C;  3KK7 A;  1AEX A;  1BNZ A;  2Q8R E;  2AWO A;  1AH9 A;  1IBM Q;  4P73 A;  2RSN A;  4ULL A;  3HOU H;  1STG A;  3IKJ A;  1WTO A;  1WTR A;  2WV6 D;  2K50 A;  3VA5 A;  1CFM A;  5CGK A;  1DJR D;  1YHQ A;  3V2T A;  1EQT A;  1WFQ A;  3QJY A;  4JYA L;  1HTL D;  4OL7 A;  1BR9 A;  1HH2 P;  1C7Y A;  3NE5 B;  4IFD G;  2R92 B;  1B2T A;  2EIF A;  5CV5 A;  4DV4 Q;  2EJM A;  1G29 1;  3OTO Q;  4POG A;  1TXY A;  2A6E D;  3KF6 A;  1KLG D;  4B3M L;  2MUY A;  2ZXR A;  1IBK L;  1EFW A;  1VQO A;  2L9H A;  2ICI A;  3I4N H;  5HUR A;  4RH6 A;  1HUN A;  4X64 L;  4QIW E;  2E5L L;  2HHH L;  1QB5 D;  2JQO A;  3GV6 A;  4X3K A;  3HRZ C;  4C3J G;  4B3S Q;  2Q8I B;  4O2D A;  2MQH A;  4ME3 A;  3X3M A;  3I90 A;  1ET9 A;  2B2U A;  4ZAI A;  2OEO A;  5DNF A;  4A3D H;  3STB C;  2EE1 A;  2Y0S G;  2K75 A;  2F0P A;  1KNE A;  1Q1E A;  1BF4 A;  1H95 A;  5CMD A;  2EQS A;  4CKB A;  3U4V A;  3D6W A;  3RZO B;  4FF4 A;  4GKK L;  1VQA A;  2NVX H;  1EIH A;  1QE6 A;  4A3G B;  3PQI A;  4A3M B;  3NTI A;  3HFZ B;  4HJ9 A;  3KLW A;  1HJP A;  1G91 A;  1LAC A;  4R4C A;  5CR3 A;  4DF7 A;  1O7I A;  4LUO A;  1RIP A;  1TWA B;  3GTM B;  1VQ5 A;  4C3H H;  1E1O A;  2NVT B;  1HA6 A;  2VXW A;  4XT1 B;  2AMC B;  2I5H A;  2F0U A;  3NQT A;  2K5N A;  1RTO A;  3A55 A;  4DUY Q;  2ASB A;  2JA8 B;  2E2I H;  1A0I A;  3I73 A;  4XIG S;  1L0W A;  5IYD H;  4YHH L;  1U4L A;  2KCN A;  3GV3 A;  2ZXO A;  1M4V A;  3T16 A;  2K5H A;  1QNU A;  1FJG L;  3OIQ A;  3HG9 A;  4QJF A;  4KI0 A;  1RF2 D;  5KYL A;  1SLJ A;  4DR5 Q;  2UXC Q;  2EY6 A;  1XPU A;  2Z4I A;  4LF8 Q;  5M9O A;  2NUC A;  2RHS B;  2OTJ A;  2JSO A;  1ZYR D;  2RCN A;  1R4Q B;  3PO3 G;  3HOW H;  1TWF H;  3OMC A;  4QY7 A;  5LMU L;  1Y8P B;  1PFM A;  2HT1 A;  3CHB D;  3MXN B;  1EQR A;  4DR3 L;  1EYG A;  1BCP F;  4YWM A;  1Q46 A;  1Q1B A;  4L5T A;  3NQI A;  4K5X A;  5EGT A;  4X6A H;  4RHR A;  2R93 H;  5COR A;  1WI5 A;  3K7A H;  5IT9 L;  1JT8 A;  1S5D D;  1F2L A;  4BA1 I;  3A74 A;  1DOM A;  4ZUJ A;  3TQY A;  5FO9 B;  1SRU A;  5FK9 C;  1NTG A;  4DAY A;  1S3O A;  3WDN A;  2D0P A;  4DR1 L;  3PMF A;  4BXX G;  1WYD A;  2CW0 D;  2F0S A;  1VQE A;  1YIT A;  3HOY G;  2EY1 A;  4JI1 Q;  2F0H A;  3W1B A;  3GTO B;  2RHQ B;  4JOI A;  5GAD C;  4HR7 B;  3E9H A;  5M3M H;  3CC7 A;  3A8K E;  1STE A;  5HGT A;  1OXS C;  3HP3 A;  4JI3 Q;  1KQS A;  5LMN L;  2GA4 B;  2JE6 I;  5GAE C;  2DY8 A;  3DWP A;  2ZTE A;  1I6V C;  3PUW A;  3EFX D;  5C44 B;  2N78 A;  1VQL A;  1CZG A;  1O7Y A;  4KN4 C;  3S2H B;  1ASY A;  4KMU C;  3K5L A;  1B4O A;  1D1K A;  1HR0 L;  4GN4 B;  4V0B A;  2WKD A;  4F87 A;  5DAU A;  3MXG A;  2NZ1 D;  3MXP A;  4QCL A;  1Y1V H;  2EYM A;  3T53 B;  4XYQ A;  3F1Z A;  2YTX A;  1XMQ Q;  3DLL A;  5IOC A;  1X32 A;  1A3U A;  4PZ6 A;  1I50 H;  1EWI A;  4FO2 A;  3H0G H;  1T5X D;  5C4J H;  4JI7 Q;  2B63 G;  3UE0 A;  4GOP B;  1SE3 A;  3S1M B;  1K3R A;  1BO0 A;  3S15 B;  4TRD A;  4BBS G;  4QGU A;  1MJE A;  2ZTD A;  2K5W A;  4B08 A;  4QF4 A;  3K5N A;  4KD4 A;  4RGT A;  1IXR A;  2KJX A;  1F9P A;  5I2X A;  5L37 A;  2N3S A;  5IP7 H;  4L5Q A;  1L0X B;  4EQ5 A;  4A3B H;  2B2U C;  3OW2 A;  1VQG A;  2F0F A;  3G48 A;  1ZYR C;  1TQO A;  1S5F D;  4UP9 A;  3T1Y L;  4OXP A;  3O13 A;  2F0L A;  4OON A;  3M4O B;  3JAM i;  2G5D A;  1AN8 A;  1XMO Q;  4BY7 B;  3FKI H;  5ELN A;  3R8B A;  4JG2 A;  2ENB A;  1QCB D;  4JI0 L;  4MTN A; 
#chains in the Genus database with same CATH homology
 2NVQ B;  4MIU A;  5ELE A;  3BYY B;  4Z9C B;  2XNA C;  4IUN A;  2PNR C;  4H7B A;  1SYE A;  2IX0 A;  2CW0 C;  4A93 B;  1TS2 A;  3Q0A A;  4KV6 A;  1F9S A;  4CJ0 B;  2F0N A;  5IGF A;  2NYZ D;  2RSO A;  4L6T B;  3SK4 A;  4DN4 M;  1PRT F;  4KHZ A;  1BCP C;  4PMB A;  5E4X A;  3VR4 A;  1FGB D;  2F0I A;  3D4R A;  3DM1 A;  1TY0 A;  1LT4 D;  4KK7 A;  1SNO A;  1B9N A;  1ILQ A;  1HQM C;  1NR4 A;  5FLX L;  1V1P A;  1JOQ A;  1PTO B;  5JJZ A;  1PMR A;  1YNJ D;  2EDG A;  1EY8 A;  5FLX E;  4QUC A;  1R9T B;  3MFG A;  3HOV B;  2JA6 B;  3OHX C;  4DAP A;  1QIL A;  5J22 A;  3GD7 A;  4IUR A;  4C3H G;  5M3F B;  3J7A F;  1TKW B;  3ITP A;  1LAB A;  2RDG A;  2Z1C A;  4IUV A;  2B2Y A;  3E0J A;  4ZKB B;  4RA8 A;  5CV4 A;  4LAA A;  5IGB A;  3NWT A;  3MEH A;  5EPL A;  4OIK A;  3ND8 A;  4IUT A;  4ZRZ A;  2PZW A;  4KKT A;  1GUW A;  2FMC A;  3R2I A;  4IFD J;  1F2Y A;  4DXG A;  1SJE D;  2IWH A;  5EBC A;  2J0T D;  3GTQ B;  3A54 A;  1EY9 A;  3VR6 A;  1BQQ T;  4IQZ A;  1TS5 A;  4M8A A;  2FHT A;  1H9S B;  1FNU A;  3K57 A;  1PXU A;  1CI3 M;  5I9O A;  3VR3 A;  1XXG A;  1EYA A;  1SXT A;  4RCO A;  4IUU A;  2F1M A;  2D9U A;  1KLU D;  3A8J E;  4OO1 I;  2VB2 X;  3ONA B;  2A74 C;  4KY7 A;  4ZYS A;  1EFI D;  5EQ0 A;  5LHY 1;  5C6A A;  1RTN A;  5CV7 A;  1O7L A;  4G57 A;  1EQV A;  1GUO A;  3NPP A;  1JWU D;  2JXM B;  1PRT C;  3MAQ A;  1Y1W B;  1AFP A;  2AUK A;  3LWE A;  1SMY D;  4RGN A;  3CU7 A;  2VB3 X;  3OW7 A;  1B44 D;  1KNA A;  1UEA B;  2JYO A;  3L3O C;  1SEB D;  4RKL A;  3S16 B;  1ZKO A;  2O4X A;  2Z8L A;  3RLF A;  4KY6 A;  2O2L D;  4X3T A;  1BUV T;  2MGS A;  1Q90 A;  2B2W A;  3AU7 A;  2AQ1 B;  1SYD A;  3OWE B;  3I4M B;  2JA7 B;  2R7Z B;  3PIO 3;  1PYW D;  1D2B A;  1J9O A;  2G9D A;  2NVY B;  2Z4H A;  4H44 C;  3BS1 A;  3HOU B;  1G2T A;  4XDX A;  5A35 A;  1GHK A;  1V8Q A;  2SEB D;  3P75 A;  1GUS A;  4DGZ A;  4RAU C;  1QG7 A;  3IFD A;  4KHV A;  3X3N A;  3PUY A;  1IL8 A;  1QWY A;  3H91 A;  2B2Y C;  4HCS A;  3VA7 A;  3I4N B;  5FO7 B;  1SYG A;  5C5L A;  1SAP A;  4CKC A;  4FF1 A;  4OHJ A;  3TBI B;  1QJO A;  1Z47 A;  2SNM A;  5FOB B;  5KEE A;  3JAM E;  4N9T A;  2L4N A;  2RBM A;  2QEJ C;  2LFN A;  5F2D A;  1CM9 A;  2PW7 A;  2A69 D;  4K14 A;  2J7Z A;  2K05 A;  2FMM A;  1XYI A;  4BBR B;  2K33 A;  4P2C B;  2B8F A;  3ND9 A;  1LT3 D;  1EU3 A;  4K6D A;  1OXT A;  1J8I A;  4LK1 C;  4C56 C;  4KKU A;  3MZ5 A;  1ESF A;  3BDC A;  2X6L A;  2B2T A;  3I4L A;  1SMY C;  3FEW X;  3AMU A;  1PDQ A;  1OXU A;  2A68 D;  3BVZ A;  1UNS A;  1DYQ A;  3J80 L;  5FO8 B;  2BA1 A;  3KLS X;  2BDO A;  1AW7 A;  4A3J B;  3QB3 A;  4O1N A;  3TDQ A;  2E2H B;  5C5M A;  1NCV A;  4ME5 A;  5EPK A;  2WII B;  3J80 E;  1JCK B;  1RD9 D;  2YYZ A;  2PQE A;  4NDX A;  2K5Q A;  1IYV A;  1OO9 B;  1PZJ D;  2A6H D;  2MHV A;  3TZD A;  5CBA E;  2BCO A;  2HCC A;  3ZYY X;  2X69 A;  3QOL A;  3J81 L;  4DK1 A;  3M3Y B;  3I3C A;  5M3M B;  1ZEQ X;  1FD7 D;  2XWB B;  1FYC A;  2C9O A;  1HXY D;  2B2W C;  4DNT B;  5M5Y B;  4XYO A;  3KF8 A;  1Q3L A;  1OXV A;  3PIP 3;  3S9W A;  2A69 C;  2H1E A;  4QUF A;  4RGM A;  1U4P A;  1E2W A;  1KAA A;  1I4X A;  2A73 B;  4S3S A;  4DAV A;  5EKL A;  1LV9 A;  4RWS C;  3G7L A;  5I4D A;  2JA5 B;  1HRJ A;  2O5I C;  4HMJ A;  3I8Z A;  4XT3 B;  2ZT9 C;  3EQL C;  3LNN A;  4L63 B;  4CGY B;  4H13 C;  1ZXT A;  1WTX A;  3R93 A;  2XRQ D;  2QF7 A;  4ZUI A;  1K8O A;  5EPJ A;  1D5M C;  3NTH A;  4ILW A;  2A68 C;  2KEE A;  3NXW A;  1Y69 U;  3N6R A;  5KIX A;  3BVM A;  3QWN A;  5DEH A;  4RCN A;  2F0G A;  4QMG A;  1D5X C;  2A6E C;  3GQB A;  4PMC A;  1SE4 A;  2FIN B;  2K01 A;  1EEI D;  5IT9 E;  1TWH B;  2L11 A;  1JIC A;  3V96 A;  2A6H C;  3M4Y A;  2E75 C;  2B2T C;  1SYF A;  3HEJ A;  1E2Z A;  5ELC A;  4U68 A;  1GUT A;  1XWE A;  4OIJ A;  3NHH A;  3K0Y A;  1SNQ A;  4WOR A;  3D31 A;  1IHZ A;  1A2T A;  1R4P B;  1DON A;  1F9R A;  2K7V A;  5EKI A;  1RDP D;  1STA A;  4X3S A;  2XSC A;  3S1N B;  3TP5 A;  5LL6 X;  3PO2 B;  1PTO D;  2KQ3 A;  5IIF A;  4O42 A;  4OO1 H;  1EY5 A;  1NUC A;  1IKL A;  3GTG B;  3D8G A;  1TWG B;  2AWN A;  1IYU A;  5E3F A;  1L0Y B;  4A3I B;  5J39 A;  2BE5 D;  1CHP D;  3S1Q B;  5ELD A;  2AUJ D;  5T1I A;  3MWY W;  4TSS A;  4C3I G;  1F2M A;  1D1I A;  1CQF A;  2R3Z A;  1I4R A;  1MSH A;  1EWC A;  4M1U B;  5D65 A;  4R8N A;  4RFB A;  3PV0 A;  3VYS A;  4JK1 C;  4DFA A;  3DWQ A;  1ENA A;  2IW3 A;  4Y7N B;  4RGO S;  2K32 A;  5JVH 3;  1O80 A;  2EY5 A;  4UDU C;  3GTL B;  1BCP B;  4ZKC B;  4C3J B;  3DEO A;  1K83 B;  2WKC A;  5G3L D;  1QOH A;  2F0Q A;  2Y0S B;  5E1F A;  3C1E A;  1C4Q A;  1TU2 B;  4Q0F A;  1JB3 A;  3S1R B;  5A2Q L;  4C2M B;  5JEA H;  5BN3 A;  3QG1 A;  3IAY A;  1A3T A;  3W3A A;  2EOT A;  1T5E A;  1RKN A;  2IX1 A;  3PUZ A;  5JPN C;  5A2Q E;  3TP6 A;  2RA4 A;  1DXM A;  3H09 A;  1CZW A;  2FFK B;  2MPM A;  2K5D A;  2K1B A;  4EQO A;  3OWF A;  1B9M A;  3A7A B;  1GHJ A;  3R2T A;  1STN A;  1I4H A;  1S5C D;  3SXH A;  1AZP A;  2JEB I;  5IGG A;  5IGC A;  1VMC A;  3EA6 A;  4K8J A;  1LTT D;  1Z6H A;  1DM0 B;  3H6M A;  2N55 A;  2F4I A;  4G4K A;  5ELF A;  3S2D B;  4XQJ A;  3E5S A;  4FF3 A;  3MFY A;  3NSW A;  1HUM A;  1PZI D;  2RDH A;  3HOY B;  4NKL A;  2PYK A;  4I65 A;  4RHS A;  3P1H A;  4HMI A;  1H9R A;  5JPM C;  3OIP A;  1SFO B;  5KNB A;  1CQV A;  1H9J A;  3A7L A;  1NAP A;  3SHL A;  1SND A;  2QCP X;  4WJW A;  4DK0 A;  1MI2 A;  2CHB D;  1PTO H;  1LTI D;  1FNV A;  2F0D A;  3R3O A;  1Z7T A;  1YNJ C;  1EZ8 A;  2K03 A;  4JBW A;  4CBV A;  3GTK B;  1ESR A;  1ET6 A;  1CA5 A;  2RVL A;  1IW7 D;  1ICW A;  3BDL A;  3GTP B;  1PRT B;  2B2V A;  2EYH A;  2B63 B;  1LT5 D;  1BBX C;  1BXT A;  1E2V A;  4BBS B;  4EGV A;  3CRL C;  5M5W B;  3DXJ C;  1NR2 A;  3TP8 A;  4G7Z C;  4K5V A;  4ZQ3 A;  4OO1 G;  4OGQ C;  3TN2 A;  4G7H C;  1A15 A;  2PZU A;  2VNU D;  2IL8 A;  4J6H A;  1B53 A;  1WTW A;  1V1P B;  3K5M A;  4UAI A;  3UI2 A;  1STB A;  2M00 A;  2J4X A;  1EY4 A;  4HSP A;  1NSN S;  3DHQ A;  4X3U A;  2O5J C;  1G8Z D;  4MN3 A;  1EY6 A;  1TS4 A;  1VMP A;  1X3P A;  4J8Q A;  3TP7 A;  1OXX K;  4TKO B;  4FXK C;  1JOO A;  4NMZ A;  1SNM A;  4C1N K;  1M8A A;  3CRK C;  2HDL A;  1I4G A;  2XWJ B;  5COY A;  5C0X I;  3KLS A;  3M85 A;  2NWG A;  5D3D A;  3I70 A;  2E74 C;  4YIJ A;  3D3R A;  2F0W A;  3HKZ B;  3BG3 A;  5K36 H;  1WVL A;  2DN8 A;  1MSG A;  3L7Z C;  2PPB C;  1GJX A;  3N52 A;  5BN4 A;  3SVM A;  4A3D B;  4HN7 A;  3K59 A;  2IJ0 A;  1TT2 A;  5JAV A;  1FNW A;  3L9A X;  2QDB A;  5JEA G;  3MXN A;  3VR5 A;  1JR0 D;  2NVX B;  5ELB A;  3SK5 A;  5FKA C;  1QNK A;  3TSS A;  2WIN B;  4EQP A;  4PMW A;  2QKI C;  5DM7 3;  2HQE A;  2BOS A;  4C3H B;  5IOD A;  1PFB A;  3FDT A;  3TZU A;  1DD2 A;  4KTA A;  2KOL A;  1V1O A;  1SJH D;  4K6L A;  4HCE A;  1I4P A;  2EVB A;  2E2I B;  2L0C A;  2HCI A;  5JOB A;  1DCZ A;  3H3V C;  1HCZ A;  2EZV A;  2XN9 C;  1A3V A;  1ONL A;  1HA5 A;  3DUZ A;  3BYT B;  1KDB A;  1BDO A;  4AYB B;  3HOW B;  3RUZ A;  1TWF B;  5ISR A;  3Q6S A;  4IUP A;  1UUP A;  2KVM A;  1D5Z C;  1O7Z A;  2KED A;  5C3X A;  1STH A;  4F7X A;  3PUV A;  2R93 B;  3A56 A;  4N9P A;  3K7A B;  2B2V C;  2D62 A;  3SK6 A;  1RJT A;  4F8M A;  2LS0 1;  3TME A;  1HTP A;  1G6Z A;  2F0T A;  3SEB A;  3KLR A;  1CT1 D;  1SSO A;  4DU9 A;  4FVM A;  4XTC S;  3NTK A;  1VF7 A;  1ILP A;  5CV6 A;  1YNN D;  2WB1 B;  1LTB D;  2L1B A;  5CYU A;  4H0L C;  1JQY D;  2KHS A;  4R9W A;  3S17 B;  2WAQ B;  3IFT A;  3D4W A;  1LTR D;  4FNF A;  3J81 E;  3P7J A;  5CC4 A;  4KY5 A;  2DY7 A;  3RD4 A;  1HQR D;  2NBF A;  1F77 A;  3VYU A;  1V43 A;  2RDF A;  1JWM D;  3D6C A;  2CQA A;  3K6O A;  1VF5 C;  2E76 C;  2FJ2 A;  2QIL A;  1Y1V B;  4IUQ A;  3Q22 A;  3W2D A;  5CV9 A;  1I50 B;  3H0G B;  4EVO A;  3MVV A;  5C4J B;  3CQZ B;  2AQ3 B;  1II3 A;  2PMZ B;  1DZ1 A;  5D14 A;  3T13 A;  1ENC A;  5I6W A;  1XX8 A;  3DWA A;  3KBG A;  4A3B B;  4PQX A;  4DA2 A;  1EYD A;  1CHQ D;  1EL0 A;  4KN7 C;  1EEF D;  2EYO A;  4CKE A;  1C48 A;  1DOK A;  3KUP A;  1CK1 A;  3EVQ A;  3V05 A;  3D4D A;  1JOK A;  2DNE A;  2EYJ A;  3FKI B;  1EY7 A;  2M2L A;  2PW5 A;  3HGB A;  2EJF C;  5BN5 A;  1WTP A;  3G6J B;  3HS0 C;  1KDC A;  1GOZ A;  1KDA A;  1ROD A;  1PFN A;  1KAB A;  1TWC B;  2C5C A;  4L8J A;  4A3K B;  4IAL A;  1PTO F;  4DNR B;  1S4Z A;  2L12 A;  1TR5 A;  1YNN C;  5KNC A;  4A3E B;  4LMQ D;  4ZK9 B;  2EJG C;  1MD2 D;  2PCF B;  4LJZ C;  1DOL A;  4WRD A;  5D3I B;  1SYC A;  2B8G A;  2NTS A;  1F9Q A;  2ICE C;  3VYR A;  3CKI B;  5KGU A;  1BCP D;  5M5X B;  1HFG A;  3T51 B;  2PZT A;  2F0K A;  4IN3 A;  5K36 G;  5I6Y A;  3MC0 B;  2PO4 A;  3U9O A;  1LO5 D;  2ZXP A;  2CVR A;  4V19 0;  4WFN 3;  3J7A V;  3SR1 A;  1EOT A;  3BZD B;  2F0J A;  4ABN A;  4FP5 D;  3VR2 A;  4XQQ A;  1VDZ A;  4HED A;  4K2L A;  3SDZ A;  3C46 A;  2SNS A;  3BDO A;  1CTM A;  1EY0 A;  5EJW A;  4F88 A;  2F3V A;  3NUC A;  4BY1 B;  2F03 A;  1B3A A;  3ERQ A;  1TY2 A;  5TSS A;  2D2C C;  3AB9 A;  4BS9 A;  3FMC A;  5G3L F;  1JC7 A;  4TQU S;  3ERO A;  2MP1 A;  2MJ8 A;  2R6G A;  1WD1 A;  2F0E A;  2A5H A;  1H9S A;  2D5D A;  3WOF A;  2LKV A;  5C4X B;  1SNP A;  1Y8O B;  2IT1 A;  2DNC A;  3BVG A;  3K5O A;  2HDM A;  5JVG 3;  1U9R A;  3E6Z X;  4PV1 C;  4MHE A;  1I4Q A;  3P20 A;  2EYP A;  1SNC A;  4R8I A;  1RCV D;  2NN6 H;  2X6G A;  2G9H D;  3U9S A;  2IPK D;  1K8M A;  4K5W A;  2LY7 A;  2Q8T A;  3H94 A;  5C3E B;  4CJ1 B;  4G7O C;  4ZLT F;  2F0V A;  2SDF A;  5C4H A;  1MGS A;  5KRU A;  4QIW B;  4Q5V A;  1ENF A;  3GP7 A;  2XRS D;  1S5B D;  5C0X H;  1G2S A;  3QIA A;  2F3W A;  5JEA J;  4J1M A;  5C0X J;  4HSV A;  4FYD A;  1EYC A;  4CJ2 C;  1PTO C;  5I2Y A;  4IZ8 A;  5AFW A;  1JE4 A;  3OPO A;  2BA0 A;  2KA7 A;  4I7Z C;  2SOB A;  1A2U A;  2F0M A;  5KYI A;  2HUG A;  1JWS D;  1C8C A;  3M7N A;  1PRT D;  3PO3 B;  3SE0 A;  4XQN A;  2VUM B;  2BE5 C;  1EU4 A;  3IL8 A;  2WP8 J;  1Q8I A;  1LT6 D;  2LMC B;  4C1N I;  1STY A;  1SE2 A;  4PNY A;  2OF1 A;  1A6X A;  1F2Z A;  3C1F A;  2L5T A;  3M7G A;  1H9K A;  1VCI A;  1GUN A;  2XVS A;  4HAE A;  4U67 3;  4ID6 A;  4FXD A;  1LTS D;  1JOR A;  4IFD H;  2E2J B;  1EWH A;  5EKK A;  1W6J A;  2I46 A;  1EZ6 A;  2M9V A;  4ODG A;  1XTC D;  1WTV A;  2ID0 A;  3GTJ B;  5T1G A;  1LLR D;  3WOE A;  3HZX A;  4QB4 A;  5C4Z A;  3MXU A;  3QO2 A;  5EBD A;  3J7Y W;  3LWU A;  4A3F B;  4KKS A;  2L55 A;  2E2D C;  2JEA I;  3OSO A;  3NBI A;  2RKS A;  1ML0 D;  1SBB B;  3EJI A;  1SYB A;  5IGD A;  3PUX A;  3HOZ B;  1O78 A;  2TSS A;  1AP0 A;  4K8I A;  2KUM A;  1HHV A;  3T56 B;  3GO5 A;  2N88 A;  3C3L A;  1WD0 A;  3FPU B;  4HTH A;  1HFN A;  3OOC A;  3NBH A;  2EYF A;  3FRP B;  3OMG A;  4NW2 A;  1LTG D;  4XXE A;  3HOX B;  2EXZ A;  1I6H B;  3URY A;  2EYL A;  1AZQ A;  1BOS A;  3I91 A;  5J1Z A;  3SK8 A;  2WAC A;  1H9M A;  1LTA D;  4EQN A;  3MHB A;  4E6I A;  3RMH A;  4C3I B;  1CA6 A;  2TMP A;  2NTT A;  3T4A C;  5E4W C;  5CV8 A;  5KND A;  2K04 A;  2K28 A;  5DM6 3;  3DEP A;  2NN6 I;  1X3Q A;  5I9P A;  3F2U A;  1TS3 A;  3Q24 A;  3FPP A;  1PZK D;  4KD3 A;  3RZD B;  3NP8 A;  3KBX A;  4FXG C;  1MBY A;  5K5P A;  2R61 A;  1WCM B;  1I3Q B;  1GUG A;  1W6K A;  1HPC A;  2B39 A;  1GXD C;  2V4D A;  1B1Z A;  1TVX A;  3NK9 A;  3QOJ A;  3A8I E;  2XIW A;  1U4M A;  1U4R A;  1IKM A;  4DXF A;  2F0O A;  2NN6 G;  4GZY C;  1Y8N B;  4K2K A;  3JAM L;  2EY2 A;  1KTK A;  1FR3 A;  1WTQ A;  3LX0 A;  2OT2 A;  2KCC A;  2RQX A;  2AQ2 B;  2K6A A;  2EPB A;  5IGE A;  1IW7 C;  5C3W A;  1D6E C;  3K58 A;  4CHT B;  4FF2 A;  3MA2 B;  1B50 A;  5C0X G;  3DMU A;  4NP5 A;  1Q12 A;  1E0B A;  3S14 B;  1UAP A;  5NUC A;  2H4O A;  1EIG A;  2I07 B;  1S5E D;  2BDN A;  3MTS A;  2OXP A;  5CBE E;  1RHP A;  4KJN A;  3C2P A;  2KEC A;  4B9W A;  1PLF A;  2JP1 A;  2YU9 B;  4B9X A;  4BWG B;  1SDF A;  3Q23 A;  1TII D;  4IFD I;  3I72 A;  4KJO A;  3NWS A;  2NB0 A;  4BA2 I;  3FVQ A;  2IX3 A;  3VYT A;  5LL6 S;  4RKB A;  3KK7 A;  1AEX A;  1BNZ A;  2Q8R E;  2AWO A;  2RSN A;  4ULL A;  1STG A;  3IKJ A;  1WTO A;  1WTR A;  2WV6 D;  3VA5 A;  1CFM A;  5CGK A;  1DJR D;  3V2T A;  1EQT A;  3QJY A;  1HTL D;  4OL7 A;  1BR9 A;  3NE5 B;  4IFD G;  2R92 B;  1B2T A;  5CV5 A;  2EJM A;  1G29 1;  2A6E D;  1KLG D;  2MUY A;  2ZXR A;  2L9H A;  2ICI A;  5HUR A;  4RH6 A;  1HUN A;  1QB5 D;  3GV6 A;  4X3K A;  3HRZ C;  4C3J G;  2Q8I B;  3X3M A;  3I90 A;  1ET9 A;  2B2U A;  4ZAI A;  2OEO A;  5DNF A;  2EE1 A;  2F0P A;  1KNE A;  1Q1E A;  1BF4 A;  5CMD A;  4CKB A;  3D6W A;  3RZO B;  4FF4 A;  1EIH A;  1QE6 A;  4A3G B;  4A3M B;  3NTI A;  1G91 A;  1LAC A;  5CR3 A;  4DF7 A;  1TWA B;  3GTM B;  2NVT B;  1HA6 A;  2VXW A;  4XT1 B;  2F0U A;  3NQT A;  1RTO A;  3A55 A;  2JA8 B;  3I73 A;  4XIG S;  1U4L A;  2KCN A;  3GV3 A;  2ZXO A;  1M4V A;  3T16 A;  1QNU A;  3OIQ A;  3HG9 A;  4KI0 A;  1RF2 D;  5KYL A;  2EY6 A;  2Z4I A;  5M9O A;  2NUC A;  2JSO A;  1ZYR D;  1R4Q B;  3OMC A;  1Y8P B;  1PFM A;  3CHB D;  1BCP F;  1Q1B A;  3NQI A;  4K5X A;  5EGT A;  4RHR A;  5COR A;  5IT9 L;  1S5D D;  1F2L A;  4BA1 I;  1DOM A;  4ZUJ A;  5FO9 B;  5FK9 C;  4DAY A;  3WDN A;  3PMF A;  2CW0 D;  2F0S A;  2EY1 A;  2F0H A;  3GTO B;  4HR7 B;  3A8K E;  1STE A;  5HGT A;  1OXS C;  3HP3 A;  2GA4 B;  2JE6 I;  2DY8 A;  3DWP A;  3PUW A;  1I6V C;  3EFX D;  5C44 B;  1CZG A;  1O7Y A;  4KN4 C;  3S2H B;  4KMU C;  3K5L A;  1B4O A;  1D1K A;  4V0B A;  2WKD A;  4F87 A;  5DAU A;  3MXG A;  2NZ1 D;  3MXP A;  4QCL A;  2EYM A;  3T53 B;  4XYQ A;  5IOC A;  1X32 A;  1A3U A;  4FO2 A;  1T5X D;  1SE3 A;  3S1M B;  1BO0 A;  3S15 B;  4TRD A;  2K5W A;  4B08 A;  4QF4 A;  3K5N A;  4KD4 A;  4RGT A;  2KJX A;  5I2X A;  1F9P A;  1L0X B;  2B2U C;  2F0F A;  1ZYR C;  1TQO A;  1S5F D;  3O13 A;  2F0L A;  3M4O B;  1AN8 A;  4BY7 B;  3R8B A;  2ENB A;  1QCB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...