1SNCA

The crystal structure of the ternary complex of staphylococcal nuclease, ca2+, and the inhibitor pd*tp, refined at 1.65 angstroms
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THERMONUCLEASE PRECURSOR
publication title The crystal structure of the ternary complex of staphylococcal nuclease, Ca2+, and the inhibitor pdTp, refined at 1.65 A.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 35
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1989-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sncA00
5JAVA 1A3VA 3NP8A 5EGTA 3VA5A 5KYIA 3TP8A 5C3WA 1TT2A 1STHA 2O4XA 5C6AA 2EYLA 3DHQA 1RKNA 4J1MA 3T13A 4IUNA 3BDLA 3QOLA 4IALA 5KEEA 4K14A 5J22A 4NKLA 4DF7A 4PMBA 1SNDA 2KQ3A 3C1FA 1NSNS 3P1HA 1STGA 4YIJA 5CR3A 1JORA 1SNQA 2ENBA 4K8JA 1SNOA 3D4WA 4K5WA 5CV9A 5DEHA 4B9WA 4F8MA 5I9PA 5K5PA 2EYMA 2F0TA 1SNPA 1ENAA 1KDCA 4ZUJA 2WACA 4N9TA 4KD3A 4NMZA 4NP5A 2QDBA 1SNMA 4RKBA 2F0KA 3T16A 5C4ZA 1A3TA 2PW5A 2HQEA 4PNYA 4K2LA 3C1EA 4QB4A 3TP5A 3D8GA 3DMUA 5I9OA 4R8NA 4ZUIA 5M9OA 5KRUA 2EY6A 1AEXA 4H7BA 5ISRA 3QB3A 1EZ8A 2F0SA 3NHHA 3OMCA 1IHZA 2OF1A 2RBMA 1SYEA 4IZ8A 3TP7A 5CV7A 4DU9A 5KIXA 1NUCA 1KAAA 2F0QA 2F3VA 5I6WA 4HTHA 4I65A 3P75A 2EYFA 5DAUA 1EQVA 1II3A 3HEJA 4G57A 5J1ZA 2SNMA 4KJNA 4LAAA 5KYLA 1EY7A 3H6MA 2F0UA 4EQPA 2EXZA 2F0OA 3MZ5A 3ERQA 4K5XA 5IGCA 2F0VA 3EVQA 3EJIA 3SXHA 5C5LA 5C3XA 4EQOA 2PQEA 3MXPA 1A2UA 2PZTA 4KY7A 2F0MA 2F0IA 4K2KA 4ME5A 3TP6A 3PMFA 4KD4A 4NDXA 3NXWA 4QMGA 5IGFA 3S9WA 5IGEA 5HURA 1TQOA 1SNCA 5IOCA 3SK4A 2F0EA 5CC4A 1STNA 2F0LA 4ID6A 5IIFA 1SYFA 2KHSA 4WRDA 5CGKA 2PZUA 1F2YA 1A3UA 4EQNA 2EYPA 2M00A 3HZXA 1EY5A 5CV5A 1STYA 3NK9A 4MIUA 2RKSA 3MVVA 5F2DA 4HMJA 1KDAA 2NUCA 3SK6A 2SOBA 2EYJA 4KTAA 3OWFA 2F0WA 4PMCA 5C4HA 1EY9A 3D6CA 4E6IA 2F0DA 2EYOA 2F0NA 2PZWA 2RDFA 3OMGA 4ODGA 2EY1A 5CV8A 5EKLA 3MHBA 5IGDA 3MEHA 2EY2A 3R3OA 3EROA 2EYHA 5NUCA 2F0PA 5E3FA 1JOOA 3NUCA 4K6DA 5E1FA 3SR1A 4B9XA 4RKLA 1EY4A 3SK8A 4K5VA 3ITPA 1EY6A 5IGGA 2PW7A 1A2TA 1STBA 5CV4A 5JOBA 1EYDA 5C5MA 5HGTA 4K8IA 3LX0A 3TMEA 2OEOA 3OSOA 5KGUA 4KY5A 4QF4A 3E5SA 4KY6A 1TR5A 5CV6A 3SK5A 5J39A 1EY0A 1SYDA 2SNSA 5IODA 2OXPA 5I6YA 4DFAA 4ZQ3A 4J6HA 3RUZA 4EVOA 4DGZA 4KHVA 1F2MA 1EZ6A 1EY8A 2F0HA 1SYBA 1KDBA 2F0JA 4N9PA 3NQTA 1EYCA 2PYKA 3BDCA 3QOJA 4HMIA 4KV6A 5EKKA 1JOQA 4OL7A 1EYAA 1ENCA 1KABA 1STAA 1JOKA 4KJOA 2LKVA 5IGBA 4TRDA 1SYGA 4S3SA 2F3WA 2F0FA 3SHLA 2EY5A 2F0GA 3D4DA 4WORA 1SYCA 3V2TA 1F2ZA 4F7XA 1U9RA 3U9OA
chains in the Genus database with same CATH superfamily
3FVQA 3J81c 4RGTA 3JC66 3KBGA 1CHQD 1CQFA 4DV0Q 2WFWA 4NW2A 5E4WC 2EYLA 3NTKA 4J1MA 3NBHB 2HDMA 4FF4A 1L0XB 1JCKB 4MTKA 3C46A 4OX9L 5IYDH 1HR0Q 1E1TA 5DEHA 5CORA 4FNFA 4B08A 2EYMA 4ZUJA 2WACA 4C3HG 4YCUA 4RAUC 5JJLA 4IPDA 5K36H 2M2LA 4K2LA 4LFAQ 5CMDA 3TP5A 5M5WH 3J81j 5I9OA 3EFXD 1CKNA 3I4OA 4PZ6A 1N9WA 2KCNA 2F0QA 2FFKB 5FK9C 4OEMB 1QVGA 1TWHB 4CHTB 2MFIA 1QNUA 4KI0A 3GTOB 4HJ5A 4GOPA 4JBWA 2B2WA 1XNRL 3ND8A 1OXTA 3EJIA 3SXHA 4EX5A 4YHHL 1ILPA 1PTOD 2F0MA 3MXNB 4R1JA 1JOQA 5IGFA 5C0XG 1QVCA 1TQOA 4PZ7A 1JE5A 2B63B 2Q2IA 5M3MH 1BNZA 1D7QA 2WAQB 4RH6A 2KCCA 1DM0B 3M85A 1WTRA 1TXYA 1D5MC 1KDAA 1K3RA 3UE0A 2A6EC 4OO1G 2EYJA 3GTJH 2ES2A 2A68D 3S15B 1RIPA 2F0DA 1QUQA 3BVGA 3K80C 1IBML 1MIUA 5HY6A 2EYHA 3KF8B 2Q2HA 2LMCB 2A73B 2AHOB 1VCIA 2JJQA 5CV4A 5JOBA 1RCVD 4K8IA 3K59A 3AEVA 2PMZB 2NZ1D 3A8KE 1YHQA 1EY8A 3K7UC 3I4MH 1WTHA 1OTCA 2B63G 2Q8TA 2NVXB 1CKOA 1MI2A 3U9SA 2BDNA 2R61A 3GTLB 1NMGA 2WAQG 3J80E 2F0FA 2A19A 3D4RA 1RTOA 1X56A 1QZHA 2E2DC 4GN5A 4F7XA 4DR4L 1H9SB 1J5EL 5KYIA 5FKAC 3HG9A 3I72A 3IFTA 4AQYQ 2O4XA 2RHQB 4UP7A 5ELNA 3DHQA 3G71A 4IURA 1UWVA 2KVMA 2XTIA 5J22A 4DF7A 1R4QB 4OHJA 5C4XH 3KOJA 2O5JC 2NVQH 1TWGB 4YIJA 3TQYA 4K8JA 4C1NK 4JI0Q 2I5LX 1TIID 2G9HD 3GTMB 4JI7L 1PH2A 3G6JB 3S16B 2I07B 1U4MA 2RSNA 2NB0A 1VQPA 2K5VA 2IPKD 2N3SA 2NZOA 4JG2A 1SRUA 3NQIA 4PG3A 4DR3Q 2R7ZB 3PSIA 2F3VA 4HTHA 1CKNB 2A69C 4KKUA 3UE1A 2EXDA 3K5MA 1VQLA 5C0XJ 4O2DA 1ET6A 3HFZB 4X62L 4C3JB 4K5XA 5D65A 1YITA 5JPMC 3URYA 2Z8LA 2JQOA 2SEBD 4QMGA 2F4VQ 1GHJA 5HURA 1BR9A 4V0BA 1WD1A 4OO1H 4GOPB 1CZGA 4LWCA 3I55A 2AQ3B 2H4OA 4RFBA 4A3GB 2HIVA 4O0AA 1STYA 1H9JA 2AQ1B 4JPBW 2F4IA 3AMUA 3CC4A 3SK6A 2SOBA 3VYRA 4YY3L 3A8IE 1FNUA 2R7ZG 1H9MA 2K5QA 3VDYA 3GTOH 1Q7YC 1KLGD 3K0YA 3HOYB 4J8QA 4JOIC 1N32L 4L8JA 3G6EA 1QUQB 1PH7A 2E74C 1SE2A 2B63H 4C3JG 2EZVA 1NMFA 1S5ED 2IX1A 3VR2A 3TREA 1SJHD 5ELCA 1TS3A 5JVG3 4B3RL 3VR3A 3FPPA 3DUZA 4F87A 4QY7A 3BDCA 1EIFA 2JA6B 3S15H 2CW0D 1PTOC 1WYDA 1NAPA 1PH6A 4Y7NB 4A3GG 3V96A 2E5LL 1YHAA 2F0GA 4WORA 1SYCA 2WKCA 1EEFD 1U9RA 4IPGA 1ZYRD 3M9BA 4LF4L 1AE2A 3HOYG 1PYBA 1RKNA 4OXPA 1JJCB 3UDIA 1G2TA 1BOSA 1VQ6A 1QVFA 3WOEA 2ICIA 3GTKH 4ZKCB 1G91A 4K5WA 1SNOA 3E6ZX 1HFGA 4DV1Q 1SNPA 3GTLH 4C3IB 5BN5A 2L0CA 2M9VA 1SR3A 1Z7TA 3OTOQ 5IP9G 1GM5A 4ME3A 3PO2B 2JA6G 4GN3B 2B2UC 1TKWB 2EY6A 3OWEB 5ISRA 2F0SA 5CV7A 3HOXB 4FP5D 1PYWD 1F9QA 4LK1C 1D1KA 4BS9A 4M1UB 1LABA 2N88A 2EXZA 1F9SA 2LSSA 1L1OB 1IYVA 3VYTA 1PRTB 4DR5L 3GTMH 3OHXC 5C3XA 2PZTA 1SE4A 2LXJA 2AUKA 1EYGA 5IT9E 2IX3A 4JI4Q 3VR4A 1JC7A 4C3IG 2B2VC 2KEDA 3WWVA 2R7ZH 3ZYYX 3NPPA 3PO2G 1D2BA 4JI2L 1STEA 2UU9L 2Z6KC 4B3MQ 4QQBX 4PMCA 4BXXH 3AB9A 1I4HA 2EYOA 3HOXG 4C3JH 5A35A 3L2PA 1GKHA 4ULLA 1X6OA 5TSSA 2RDGA 4DR1Q 3A7AB 1EY6A 2K52A 5HGQA 3E3XA 3PIOA 3LX0A 5IWAL 1K8AC 1V43A 2MUYA 2DN8A 5I6YA 2L5TA 4IUTA 1IBLQ 4A3GH 2HD3A 5GADC 3I2ZA 5ELEA 3HGBA 4X3SA 4X3UA 3OIPA 4Z9CB 3DXJC 5JEAJ 2EE1A 1E1OA 5GAHC 3HOYH 2EY5A 4HCEA 1C8CA 2Z4HA 1PV4A 4J15A 2K01A 1B3QA 1IW7D 1UEAB 2I5HA 1O7LA 2CFMA 3PUWA 4AYBB 1STHA 4I7AA 2IJ0A 3T13A 4RMFA 4IOAA 3H09A 1QNKA 1MKHA 1RHPA 3T53B 3S14B 4RGNA 1SNQA 1K8GA 3MXGA 1SBBB 4Y7NH 2MO0A 2L15A 3PF4A 2VQEQ 5LMNW 1KIXA 4DAVA 1KD1C 4L5RC 4X66L 4YCWA 4FYDA 1EOVA 4AIMA 4QJFA 5IY0A 1X65A 4LUVA 1I50B 2I0QA 3K5OA 2CW0C 1KAAA 3GTPB 2MGSA 4UP8A 5I6WA 1JE4A 4DV2L 3GDEA 3J80L 1L0YB 4AYBG 2QGQA 1GUWA 1VQNA 4DV7L 3I70A 2WKDA 3BVZA 2P5ZX 2F0UA 2VZAA 4EQPA 5JPNC 2H5XA 4C3IH 2CWAA 3LNNA 4CDFC 1S72A 2K75A 1UEBA 4LNQA 3PO2H 1SROA 3S9WA 3EN2A 1CK1A 1S4ZA 4P74A 3C3LA 1QB5D 4JYAQ 4A93B 1S5BD 2BE5D 3KLWA 2JA7B 4EGVA 3HOXH 1VQBA 2EYPA 1WVLA 3E0EA 4X6AH 1RTNA 3MVVA 1BBWA 1BCPB 4JI8Q 2JEAI 1CQVA 3M4PA 2AKWB 3MHBA 4RGMA 4A3MB 3NEMA 3HOUH 1EY4A 1LTGD 3T56B 1SMYD 4G7OC 4HN7A 1NR4A 4UPAA 4UHVA 1EWIA 1HR0W 4OIJA 1C48A 3KJPA 3KYHC 5JVH3 4LF8Q 1NE3A 4DR7L 1UUPA 4HIKA 3I91A 3IAYA 4A93G 4H0LC 1SSOA 2EPBA 3J81L 4OX9Q 2K04A 4A3IB 2JA7G 2B2YA 2VB2X 2JA9A 3SEBA 2K5WA 2BDOA 4B3TL 1B9NA 2VNUD 3SHLA 2IX0A 5D3IB 1WTWA 5IE8A 2Q8RE 3I4NB 3TSSA 1SLJA 5T1GA 3O13A 1GJXA 1VQJA 1MD2D 3S2DB 3I8ZA 4A3MG 1O7ZA 1Q8KA 3Q22A 5KEEA 5GQOA 1LT3D 1YBYA 1VQ8A 2DY8A 5FLMG 3STBD 1X3GA 1K83H 3RNUA 1TY2A 3LGJA 1Z9FA 1XNRQ 4QCLA 3P20A 3Q8DA 3NBHA 4A3IG 1AN8A 5GAGC 2L12A 3TS2A 1UE1A 3UDFA 4YHHQ 2KHIA 1A0IA 1DZ1A 2IHFA 2HCIA 3KF6A 1HQMC 2WINB 1L2FA 4X3TA 3I4NG 1VQIA 4XDXA 5DAUA 1JWSD 3ULLA 4U68A 1HA6A 4IFDJ 4JBMA 2K33A 5GROA 2K4KA 1IW7C 2KUMA 3T51B 1IBMQ 1FJGL 3QG1A 4DPGA 4YWKA 3CCMA 5EKIA 1EQRA 4JVZA 1F2LA 1SYFA 1CKMA 4FDBA 1RL2A 3HZXA 1EY5A 3I7FA 3AYHB 4BY7B 2RDHA 2NUCA 3I3CA 2HUGA 2X6LA 3M7GA 2F0PA 1LTRD 3RZDH 5C44B 1CT1D 4ZAIA 4GNXA 3W2DA 1YIJA 4YWLA 4A93H 1FD7D 3J80c 4EQ5A 3E5SA 2JA7H 5CV6A 5CBAE 3KJOA 2MO1A 1SYDA 2UUAQ 1ZXTA 1SJED 2CHBD 4U673 1D8LA 1YEZA 5FLXE 1MHWC 1F9PA 1QILA 4KHVA 3BYYB 3CAMA 3FHWA 2OTLA 1GUGA 2EJFC 4LF9L 1FYCA 2WAQE 5AJ3Q 4BA2I 4BY7G 1M4VA 2F3WA 3DWQA 2BE5C 1PRTF 1F2ZA 4A3EB 1VQ4A 1TY0A 2NN6I 2N49A 1Y8NB 4FXGC 1T9HA 2ZT9C 3CD6A 4IPHA 2ALYB 5FLMH 2YU9B 3VR5A 3DWAA 4IALA 1GUNA 4LW1A 5C44G 2B3GA 3H3VI 3CCVA 3DEPA 1NSNS 1XX8A 4A3IH 3K0XA 1OXXK 2PMZE 2JE6I 3D31A 3A7LA 1RF2D 1SMYC 1ENAA 1X55A 1TWCB 4X62Q 3VYUA 3I4NH 5EBDA 3B6YA 4QB4A 4RG1A 3DMUA 4A3FB 2GA4B 4FXDA 4WJ3M 1K0RA 4NXNL 3S2DH 5G3LF 4JV5Q 2PI2A 1HHVA 3U4ZA 4CJ1B 1EZ8A 3CCRA 3FP9A 3T1YL 3M4YA 4DU9A 4ZLTF 4A3EG 1BF4A 4UDUC 1XNQL 2K14A 2ATWA 1KNAA 4G57A 1LT5D 3KF6B 2OQKA 4RA8A 2VL6A 1DCZA 1DONA 4YY3Q 1Q81C 4RHRA 5IGCA 4JCVE 4DKAC 3OYYA 1PH1A 2Y0SB 2ICEC 4GKKL 1N32Q 5IOCA 2F0EA 4ID6A 5IIFA 3S2HB 2NTSA 4PMWA 4A3FG 3STBC 2CCZA 4R8IA 1ASZA 4B3RQ 2O5IC 4APVA 3RLFA 3I56A 1E0BA 5EQ0A 2PZWA 3HKZB 5IGDA 1Y1WB 3CCLA 1Y8PB 3MEHA 2LFNA 3MEFA 2IT1A 5E3FA 3X3NA 5E1FA 1I6HB 3I73A 4RKLA 4DV5Q 3ITPA 4CGYB 1B1ZA 4X64Q 4OIKA 4LMQD 1KXLA 1Q3LA 1YJNA 2R93B 4R4CA 2OXPA 2NVYB 4JI5L 2Y0SG 1BUVT 1A8VA 1LTLA 4GNXB 1Q90A 1EZ6A 2KENA 1IL2A 1SYBA 1RJTA 4N9PA 1TWAB 1SN8A 3ULPA 1N33L 2XWBB 4LF7Q 2XRSD 3H15A 3K7AB 4QUCA 3H0GB 1HZCA 4BBRG 4XYQA 4TRDA 3GV3A 4DK3C 3UI2A 3PIP3 2DNEA 2IW3A 3HKZG 1Y1WG 2TSSA 3GTGB 3K57A 2VQFL 3BZDB 3A5ZB 5CBEE 4X65L 4NKLA 1CUKA 1HZAA 2WB1B 3LWUA 3C1FA 1X3PA 2R93G 2OT2A 3U4VA 5CR3A 1LT6D 1JORA 1BCPF 4JI1L 2VUMB 2F0TA 2RSOA 1KLUD 4DAYA 4N9TA 3K5LA 1VQOA 2QDBA 2F0KA 2ZM6L 1J8IA 4G4KA 4A3EH 1HUNA 4F88A 3CHBD 1MSGA 3AFQA 3M4QA 3H0GG 1ENFA 1GO3E 2YU9H 3DM1A 5IT9c 2NYZD 1JMCA 4I65A 1DJRD 4C3HH 2EYFA 1II3A 3HEJA 4JI2Q 4DNTB 3CPFA 3KLRA 5A2QE 4LAAA 4UAIA 2UU9Q 1U4LA 1IKMA 4A4IA 1E24A 2WB1G 3T1HL 1TWCH 1IYJB 4L63B 2GN5A 3PCOB 4A3BB 3JAME 4ALPA 4A3FH 5LMNL 2VUMG 2HDLA 1M8AA 3F1ZA 4DV6L 1EQQA 5IWAQ 2HT1A 2KCTA 4JI3L 1N34L 1O78A 1DYQA 3TZUA 4A3CG 4GKJL 3RZOB 1L1OA 3NK9A 2JEBI 4N8X1 1P8LA 3OOCA 3D6CA 5C0XH 2NVTB 1IZ6A 1QE6A 3A8JE 3J7YW 4H02A 1VQ7A 1JICA 2NN6G 1A62A 2WP8J 3E0JA 4POGA 5NUCA 1B4OA 4B9XA 4C1NI 1G51A 1K73C 2UXCL 2IY5B 3HRZC 1STBA 3NSWA 2JA8B 1AE3A 3UDGA 3G48A 4KY6A 3A74A 3MTSA 1PH9A 3R2TA 4A3BG 4IN3A 1EWHA 4GLAC 4HR7B 4LF5Q 3KK7A 1L0WA 1PH3A 4IJLA 1EYCA 1TWHH 3D3RA 1LTID 4KV6A 4ZYSA 2OWOA 1ML0D 2X6GA 1ENCA 1PH4A 1Y1WH 4XIGS 3KFUA 4UP9A 4WJ4A 1I6HH 3GTQB 3N52A 1SYGA 2R92B 1QZGA 3V2TA 2Q2UA 1VQ9A 2QW7A 3QR8A 4JBKA 2R93H 1V1OA 3S1MB 4X66Q 2YTYA 2NVYH 1WTPA 1HR0L 4IUNA 1FNWA 2N78A 4ZRZA 5L37A 1K28A 2JA8G 4IFDI 3P1HA 1TWAH 2VY3A 4TKOB 4K0KL 3BS1A 1C9OA 4A3JB 4DV2Q 4KKSA 1A6XA 2R6GA 3H0GH 1T5XD 2K7VA 4LFAL 4R4IA 4NP5A 4RKBA 2RVLA 4RCNA 5C4ZA 1HZ9A 1GVPA 4IUQA 5EBCA 4XQNA 1SAPA 1U4PA 4DAYB 5JEAG 2B2TC 2E8GA 3GTGH 4H7BA 2Z6BA 3P7JA 5I4DA 2F52A 2Q2TA 2R92G 2DY7A 2ZTCA 3PF5A 2CQAA 5AFWA 5M3FB 4L6TB 1C7YA 1AW7A 3DM3A 1EQVA 1X3FA 2AUJD 2L1BA 4AYBE 3BU2A 2NVXH 2VUMH 2F0OA 1QJOA 2L11A 2EIFA 1NTGA 3CF5A 4JOIA 1EOTA 2MP1A 3F2CA 1A2UA 1BDOA 3CPWA 4A3JG 4A3CH 3NXWA 1HNZL 4P75A 1H9KA 4KN4C 1UE5A 2V1CC 4WRDA 1HQRD 4R4TA 2CKZB 4DR7Q 4C2MB 5LL6S 2NN6H 5FOBB 4HMJA 5BR8L 1BBXC 1TWGH 2F0WA 3OWFA 3H3VH 2F0NA 5M3FG 3NELA 1V8QA 2B29A 4A76A 4A3BH 1MBYA 4B3TQ 1H95A 2KCMA 4OWXB 3S16H 2PW7A 4A75A 1IBKL 3TS0A 2C9OA 1NR2A 3CP0A 1M90C 2R3ZA 4EVOA 4ZK9B 5DM73 4CDCC 2AWNA 3FKIB 1DD2A 5JJIA 4UY8C 1ICWA 2HCCA 2NVTH 4DR2Q 3TZDA 1GUSA 2EJGC 3Q23A 1KAWA 2D9UA 3D4DA 4R9WA 3AU7A 1KRTA 1I94Q 1S5FD 4HAEA 2JA8H 3J7ZC 2B2UA 4N8FA 2BH2A 4XT1B 5KNBA 3QOLA 2Z1CA 4HIMA 1Y1VB 4LF6Q 1PXUA 4JI0L 4DAMA 1CA6A 1HTLD 1Q1BA 2AQ2B 4OGQC 2O2LD 2QDLA 3D4WA 4NB3A 2AMCB 5JEAH 2R92H 3FKIG 3OIQA 4DUYQ 2A6HD 1EQTA 2FMMA 1FJGQ 4DR3L 4IUPA 5COYA 2J7ZA 2LXKA 1AEXA 3MAQA 1B9MA 3R93A 3S1MH 2L4NA 2B2VA 1Q1EA 2RBMA 1SYEA 2IL8A 1JT8A 1EU4A 1KQSA 5IP9H 4IO9A 2Z6KA 2CQOA 2UXBQ 2JA6H 1EY7A 1HNXL 1U5KA 2R7DA 3JAMi 1Y1VG 1LTBD 2PQAA 2PQEA 2Z4IA 3MXPA 4ME5A 4LFBL 4Y52H 4WFN3 1LLRD 1Q46A 1V9PA 3ZJYC 4KK7A 1I5FA 2JK8A 1FVIA 2PZUA 4EQNA 1I4RA 3LWEA 3FPUB 4XTCS 4MIUA 5FLXc 3TEHB 5CV8A 5KNCA 3Q6SA 2UUBL 1VQCA 4LF9Q 1ONLA 2XVSA 1HNWL 3PUVA 1VQAA 2DJFC 1PTOB 5HGTA 4IJHA 2RA4A 4IFDG 3W5OA 4BA1I 2IWHA 1PLFA 1XJVA 1E22A 1DXMA 1E2WA 2XWJB 5IYBG 2B2YC 4L5TA 1Y8OB 1N8RC 3J81i 2K28A 1MJEA 1TU2B 1WD0A 3T4AC 1STAA 4DUZQ 1VQHA 4RCOA 2WIIB 3BJUA 4JK1C 2RHSB 3RLOA 4DK1A 2VB3X 3L7ZC 1CTMA 5EJWA 3H91A 3TP8A 4NXNQ 2E75C 1OXVA 1I3QB 3RMHA 4DNRB 3KLSX 3I4LA 4DV1L 1KC8C 4Q0FA 3FDTA 3PUYA 1XNQQ 1F9RA 5CV9A 3OTOL 4KD3A 1SE3A 1ZEQX 1XMOL 1I4XA 1VF7A 2HQEA 1YNXA 3C1EA 3MFGA 5J3BA 2OQ0A 3CC2A 4A3DB 4H44C 1B7YB 2PNRC 4GKKQ 4HCSA 1B2TA 1PA6A 4QIWB 1VQ5A 4DR6L 1NUCA 1Y1VH 3QIAA 3D6WA 3S24A 4DK0A 1K3BC 4PQXA 1JWUD 5J1ZA 1HFNA 1TS5A 4G7ZC 3KDFA 2MPMA 1IKLA 1CFMA 4LFCL 5C5LA 4JI4L 3A0JA 1IYUA 2SDFA 1NCVA 2JXMB 1A63A 3MXUA 1EU3A 4DNIA 1F77A 4FXKC 2K50A 1DGSA 1X9NA 2PQAB 3CRLC 1YZ6A 2F3IA 4B3ML 5CV5A 4A3DG 2L9HA 2RKSA 3W1BA 4DXFA 1PH5A 2HHHL 4B3SL 3S14H 2RDFA 4IFDH 2A6HC 3OMGA 3FRPB 2CH4A 1O7IA 2UXDL 4OELB 1XPRA 1AFPA 3ICEA 1UNSA 5IYBH 1G2SA 1KTKA 4QF4A 1IBLL 4HIDA 1G6PA 2K5HA 2Y0SE 1I50H 3QJYA 2IHEA 2VQFQ 3GTPH 1KDBA 2BH8A 4GN4B 4X65Q 3A54A 1XYIA 1RDPD 4XQQA 1GUOA 2KOLA 1SEBD 5EKKA 5M5XB 1ZKOA 2BOSA 4BWGB 2E76C 2QEXA 4JI1Q 5IYDG 3WOFA 4S3SA 1HTPA 2ZM6Q 1PTOH 3HKZE 5EGTA 4PZ8A 3D0FA 2DJGC 1J9OA 4DV3L 4DR4Q 3EQLC 1BXTA 5K36G 2F1MA 1J5EQ 3SE0A 2JYOA 3HOZB 5M3MB 4C56C 4K14A 2I46A 3N6RA 3IL8A 4PMBA 3AFPA 1SNDA 2KQ3A 1GD7A 1UE6A 4V190 3PIPA 2YTXA 3J7AF 1PRTD 5IT9L 4ABNA 1VQKA 4A3MH 1CA5A 3QWNA 4BY1B 3MFYA 2I5MX 2J0TD 1G8ZD 4KHPL 1Y14B 3R2IA 4QL5A 4JI7Q 3RD4A 1OXSC 2ZJQA 5LMNQ 3JAMc 2FXQA 1I3QH 2DNCA 4JI3Q 3I4MB 1N34Q 4POFA 1PFMA 4GKJQ 3S1QB 3E9HA 3BZCA 3HOZG 5M3MG 4DV4L 2WB1E 5I2YA 1V1PB 5G3LD 1HXYD 3VA7A 2F0IA 4TQUS 4A3DH 1BBUA 1CHPD 2X69A 3AQQA 2G5DA 1SE8A 3KDFB 4JBJA 4RGOS 3SK4A 2VXWA 5BN4A 2EQSA 1LT4D 4BY1G 5JJKA 1VS0A 5C4XB 2V4DA 2NVQB 1PZID 1BQQT 5C4HA 1N36L 3VYSA 3L9AX 4ODGA 4GOPC 2EY1A 2B2WC 4BBSB 4I7ZC 4P71A 1B70B 2K03A 3V05A 1JOOA 3NUCA 3I4MG 2PI2E 4IOCA 4K5VA 4LF8L 1T5EA 1ASYA 1YVCA 3TDQA 3PQIA 1UE7A 4IQZA 1XPOA 3A55A 2RF4A 2ID0A 5CYUA 1WTOA 1LUZA 4Q5VA 1ESRA 1GUTA 3BZKA 4BBRB 4RWSC 1Q82C 1P16A 3CCSA 3CMAA 1FR3A 1DOKA 5LMUL 2HQLA 4K0KQ 1EIYB 1K8MA 1B8AA 1CZWA 5C4XG 5FO9B 4M8AA 1I6VC 1JJ2A 4K6LA 2A5HA 4G7HC 1JR0D 2E5LQ 3NP8A 3VA5A 4BBSG 1PHJA 1H9RA 1MJCA 3ERSX 2CWPA 1TT2A 4NXML 1E2ZA 1SDFA 4XQJA 1U0LA 3F2DA 3BDLA 3BVMA 4LF4Q 4KLKA 1LTAD 1VQEA 1A15A 4TVAB 2KHJA 4BY7H 1OXUA 5M5XH 2ZTDA 1FNVA 1PVOA 2XRQD 3T16A 3TRZA 1BVSA 3C2PA 5C44H 2XNAC 4ZUIA 2NWGA 1PTOF 4HJ8A 3NHHA 4HJAA 1HNZQ 3EA6A 3HOZH 4AH6A 1LYLA 1BCPD 3L0OA 4L5QA 3P75A 3F2UA 4KJNA 2XSCA 5KYLA 3S1NB 2E2IB 5BR8Q 3ND9A 2XGTA 5ELDA 1WI5A 4QGUA 2ZJPA 1C4QA 4O1NA 3R8BA 3F2BA 3ERQA 1I4QA 3CC7A 2F0VA 4GLVB 5D3DA 3HP3A 3TP6A 4BY1H 2QEJC 3PMFA 4NDXA 1D6EC 3GP7A 5IGEA 3PV0A 4DR5Q 1I4GA 5EAYA 1QWYA 1STNA 1IBKQ 1L1OC 4CKCA 1KHIA 4FVMA 4OWWB 1UAPA 1PRTC 3GTKB 1LTTD 3FEWX 3S1QH 4XXEA 3CU7A 3TN2A 1S3OA 3SGIA 3R3OA 1VQMA 1YNND 3SR1A 1NNXA 4OWTB 1HJPA 2DUDA 3NENA 4DAPA 3PGZA 2UUAL 2VW9A 2OEOA 2FINB 2BCOA 3SK5A 4DXGA 3IRBA 3M4OB 3NWTA 3IKJA 3OW2A 1F2MA 5D14A 2ZJRA 1BKBA 2EVBA 1HCZA 3QOJA 2J4XA 4O42A 3HOWB 3NWSA 5AJ3L 2G9DA 1KABA 4BBSH 2KECA 1SMXA 5IGBA 2OCEA 4JI6L 3OPOA 1WJJA 2L55A 3K5NA 1NY4A 1U4RA 1XMQL 4KMUC 2UUCL 2RCFA 3S2HH 5GAEC 4CJ2C 4BBRH 2EJMA 2E2JB 3CQZB 1XPUA 3TBIB 2A1AA 5FO8B 4F8MA 5I9PA 1HNXQ 3J81E 4CKEA 1EIHA 1SNMA 2B8GA 2PW5A 4JV5L 1G6ZA 1IXRA 4CDDC 3HOWG 1DOLA 3GV6A 5M9OA 4DV0L 4LFBQ 3BG3A 2FHTA 3OMCA 1IHZA 4HJ7A 3A56A 2QA4A 3I90A 2H1EA 2K1BA 1JWMD 2A8VA 3K7AH 3F8TA 3DWPA 4DV7Q 4ZKBB 1Q12A 4RHSA 2UUBQ 4BXXG 3W3AA 1HNWQ 5FLXL 1SNCA 2DGYA 2B39A 2XN9C 1YI2A 3HOVB 4LUZA 5EPJA 2PPBC 3E9IA 5IYCG 4KTAA 2E2IH 3S1NH 1WTXA 4GZYC 4DV5L 3EROA 1X3EA 4X64L 3U58A 2ZXOA 5C3EB 1TVXA 1CSQA 1JQYD 4MHEA 1PFSA 1TS2A 4CBVA 4GLXA 5C5MA 5C4JB 1BCPC 3OSOA 2CVRA 5J39A 5IODA 2A68C 1HPCA 1CSPA 3L3OC 4J6HA 2K05A 2MJ8A 4LF7L 3HOVG 3KBXA 5JJZA 1XWEA 4HMIA 1TS4A 3K8AA 4P73A 3VR6A 3NTHA 1EYAA 3H94A 4FF3A 4LJZC 2HIXA 3NE5B 2JP1A 1XMOQ 3U9OA 2D5DA 1Y69U 3PO3B 3CW2C 1FGUA 1XTDA 2B2TA 1GHKA 3M4OH 1EWCA 1D5ZC 5C3EG 3MC0B 1Z6HA 2VS1A 1K0SA 1X3QA 1KL9A 1D5XC 1VQFA 4MNOA 3RZOH 4HEDA 4A3LG 3BYTB 4DR6Q 2K32A 4KHZA 1WFQA 1YNNC 2TMPA 2B8FA 3HOWH 4B9WA 5K5PA 1EL0A 5IP7G 2PNHA 4H13C 2Z9HA 2F03A 3HOUB 1PZKD 2NTTA 4P72A 5I2XA 1JB7A 2C5CA 4CJ0B 4LFCQ 1PH8A 4AQYL 3QB3A 4FF1A 3K81C 3CCJA 2MQHA 1VMCA 2PCFB 1FL0A 1WCMB 2BA0A 1ILQA 2K5NA 1AZQA 3PO3G 2E2JH 3CQZH 1C0AA 2YV5A 1YJ9A 3NBIA 1TWFB 2HHHQ 1AZPA 4B3SQ 4R4QA 1EFWA 2EDGA 3GTQH 4EQOA 3S1RB 1Z47A 3ER0A 5IYCH 1R4PB 2UXDQ 3X3MA 1VQGA 1QOHA 3HOUG 1G291 5CGKA 1F2YA 1DOMA 4L5SA 1X32A 1K8OA 3KUPA 1J6QA 5E7NA 3DLLA 2GVBA 1OO9B 4A3JH 3J80i 4E6IA 4QIWE 3CRKC 1WCMG 1S5DD 3SDZA 2QF7A 1K83B 2EY2A 2FMCA 2F4VL 5BN3A 2NZHA 1PFBA 1V1QA 2PO4A 2GVAA 2D2CC 1A2TA 3HOVH 4HSVA 5KGUA 3S17B 3TMEA 4KY5A 4IUVA 1TR5A 1HH2P 4LF5L 2Q8IB 1EY0A 2SNSA 4KN7C 4ILWA 4DFAA 2LY7A 2JN4A 4DV3Q 4A3KB 3HKSA 4DGZA 5M3FH 3CCEA 2F0HA 2C35B 1B3AA 4OL7A 2D0PA 2NBFA 3RR5A 4JC0A 4KJOA 2YYZA 4R4OA 3CXCA 1R9TB 1Q8IA 5C3EH 1BO0A 3G4SA 5EPLA 5JAVA 1A3VA 3HS0C 2KBNA 4YWMA 5C4JH 3CCQA 4A3LH 2JA5B 4KHPQ 5C3WA 4CKBA 3J7A5 5C6AA 1W2BA 2EOTA 1E7ZA 1KRSA 5IP7H 3A5UA 3QO2A 5A2QL 4C2MH 1O7YA 2JSOA 4PV1C 2N8NA 2QKIC 2D0OA 4CDEC 1GOZA 3UDXA 2RCNA 3JAML 4A3KG 1X54A 2K6AA 4LUOA 1ZYRC 3WDNA 1ET9A 1S40A 3RZDB 4DV4Q 4PNYA 4HIOA 2CH4W 4OONA 3M3YB 1HA5A 3PUZA 4P2CB 3PO3H 5KRUA 4IUUA 1AP0A 5DM63 1YNJD 1PZJD 3EIVA 3M7NA 1ICFB 3RLNA 3U50C 4IZ8A 5DLQE 3IFDA 5KIXA 2JA5G 3T1YQ 5ELBA 1K9MC 3FKIH 2E2HB 1SFOB 1YJWA 1GXDC 3Q24A 1N36Q 1W6KA 3EVQA 1M1KC 3OW7A 3EBEA 2ASBA 1LO5D 5CC4A 2MNAA 3CKIB 4JW0A 2K5DA 2KHSA 4MN3A 5DNFA 3MA2B 5FJ8G 1WCMH 2N55A 4QUFA 1HUMA 1E3PA 3PIO3 5M5YB 1QCBD 5F2DA 1V1PA 4XYOA 1TWFH 1XTCD 5EKLA 5LMUQ 1IL8A 1JJGA 3GQBA 1HRJA 3S1RH 1PYSB 3SK8A 5T1IA 1B44D 5IGGA 1WTVA 3FMCA 3GD7A 1MSHA 2ZXPA 1JB3A 2YTVA 1Q86C 4DA2A 4TSSA 1KNEA 1MGSA 5EPKA 4NXMQ 4ZQ3A 4XT3B 5C0XI 4NPSA 4DR2L 1VQDA 4JI5Q 3NQTA 2ZXRA 1W3SA 3DEOA 4YCVA 1NBWA 1I94L 1N33Q 2Z0SA 2D62A 4DR1L 4OO1I 1WTQA 4GNXC 1VMPA 1LM0A 4WJWA 5M5WB 3S17H 1O80A 3CMEA 4ZCKA 3W1GA 2BA1A 1LV9A 3G7LA 4LF6L 1LACA 4HJ9A 4A3KH 4FO2A 5ELFA 3MWYW 2AWOA 2LS01 1PFNA 3K58A 1STGA 2ENBA 2KEEA 1B50A 1KDCA 2FJ2A 1R9TH 4DUYL 2MHVA 1EUJA 5E4XA 4NMZA 1RD9D 2A6ED 1A3TA 1PDQA 1I4PA 2QILA 3RN2A 3D8GA 2JA5H 1YHBA 2R7FA 3BDOA 4R8NA 4FF2A 2KA7A 5KNDA 3NTIA 2KJXA 1VF5C 1FGBD 3Q0AA 2OF1A 2RQXA 3TP7A 1PMRA 2UXBL 4KKTA 5LL6X 4MTNA 3MXNA 2SNMA 3GTJB 2A74C 3H6MA 2QCPX 1ESFA 2VQEL 3MZ5A 3K6OA 4X3KA 4KY7A 5FJ8H 4K2KA 5H1SE 3KLSA 4KD4A 1NJIC 3M3YH 3T1HQ 1EEID 1QG7A 4GS3A 1WOCA 2XIWA 1CI3M 2F0LA 4IPCA 3H3VC 1A3UA 1S5CD 2M00A 1AH9A 2OTJA 4DK6C 4DV6Q 4HSPA 1LTSD 3KF8A 3PUXA 5FO7B 2E2HH 1SFOH 1EY9A 3SVMA 1B53A 3ONAB 1SXTA 3CCUA 3J7AV 4K6DA 4DN4M 1YNJC 3GO5A 1E2VA 4JI6Q 4JYAL 1EYDA 2UXCQ 3ULJA 1XXGA 1EIGA 1XMQQ 2WV6D 3RUZA 2UUCQ 4JI8L 5M5YH 4C3HB 5LHY1 2ZTEA 1W6JA 2F0JA 2PYKA 4DUZL 1CM9A 3RN5A 1RODA 1H9SA 1HZBA 5ELOA 2A69D 1JOKA 2LKVA 1D1IA 4MZ9A 1VDZA 1EFID
chains in the Genus database with same CATH topology
3FVQA 4RGTA 3KBGA 1CHQD 1CQFA 4NW2A 5E4WC 2EYLA 3NTKA 4J1MA 2HDMA 4FF4A 1L0XB 1JCKB 3C46A 5DEHA 5CORA 4FNFA 4B08A 2EYMA 4ZUJA 2WACA 4C3HG 4RAUC 5K36H 2M2LA 4K2LA 5CMDA 3TP5A 5I9OA 3EFXD 2KCNA 2F0QA 2FFKB 5FK9C 1TWHB 4CHTB 1QNUA 4KI0A 3GTOB 4JBWA 2B2WA 3ND8A 1OXTA 3EJIA 3SXHA 1ILPA 1PTOD 2F0MA 1JOQA 5IGFA 5C0XG 1TQOA 2B63B 1BNZA 2WAQB 4RH6A 2KCCA 1DM0B 3M85A 1WTRA 4OO1G 1D5MC 1KDAA 2A6EC 2EYJA 2A68D 3S15B 2F0DA 3BVGA 2EYHA 2LMCB 2A73B 1VCIA 5CV4A 5JOBA 1RCVD 4K8IA 3K59A 2PMZB 2NZ1D 3A8KE 1EY8A 2Q8TA 2NVXB 1MI2A 3U9SA 2BDNA 2R61A 3GTLB 3J80E 2F0FA 3D4RA 1RTOA 2E2DC 4F7XA 1H9SB 5KYIA 5FKAC 3HG9A 3I72A 3IFTA 2O4XA 3DHQA 4IURA 2KVMA 5J22A 4DF7A 1R4QB 4OHJA 2O5JC 1TWGB 4YIJA 4K8JA 4C1NK 1TIID 2G9HD 3GTMB 3G6JB 3S16B 2I07B 1U4MA 2RSNA 2NB0A 2IPKD 3NQIA 2R7ZB 2F3VA 4HTHA 2A69C 4KKUA 3K5MA 5C0XJ 1ET6A 4C3JB 4K5XA 5D65A 5JPMC 3URYA 2Z8LA 2SEBD 4QMGA 1GHJA 5HURA 1BR9A 4V0BA 1WD1A 4OO1H 1CZGA 2AQ3B 2H4OA 4RFBA 4A3GB 1STYA 1H9JA 2AQ1B 2F4IA 3AMUA 3SK6A 2SOBA 3VYRA 3A8IE 1FNUA 1H9MA 2K5QA 1KLGD 3K0YA 3HOYB 4J8QA 4L8JA 2E74C 1SE2A 4C3JG 2EZVA 1S5ED 2IX1A 3VR2A 1SJHD 5ELCA 1TS3A 5JVG3 3VR3A 3FPPA 3DUZA 4F87A 3BDCA 2JA6B 2CW0D 1PTOC 1NAPA 4Y7NB 3V96A 2F0GA 4WORA 1SYCA 2WKCA 1EEFD 1U9RA 1ZYRD 1RKNA 1G2TA 1BOSA 3WOEA 2ICIA 4ZKCB 1G91A 4K5WA 1SNOA 3E6ZX 1HFGA 1SNPA 4C3IB 5BN5A 2L0CA 2M9VA 1Z7TA 3PO2B 2B2UC 1TKWB 2EY6A 3OWEB 5ISRA 2F0SA 5CV7A 3HOXB 4FP5D 1PYWD 1F9QA 4LK1C 1D1KA 4BS9A 4M1UB 1LABA 2N88A 2EXZA 1F9SA 1IYVA 3VYTA 1PRTB 3OHXC 5C3XA 2PZTA 1SE4A 2AUKA 5IT9E 2IX3A 3VR4A 1JC7A 4C3IG 2B2VC 2KEDA 3ZYYX 3NPPA 1D2BA 1STEA 4PMCA 3AB9A 1I4HA 2EYOA 5A35A 4ULLA 5TSSA 2RDGA 3A7AB 1EY6A 3LX0A 1V43A 2MUYA 2DN8A 5I6YA 2L5TA 4IUTA 5ELEA 3HGBA 4X3UA 4X3SA 3OIPA 4Z9CB 3DXJC 5JEAJ 2EE1A 2EY5A 4HCEA 1C8CA 2Z4HA 2K01A 1IW7D 1UEAB 1O7LA 3PUWA 4AYBB 1STHA 2IJ0A 3T13A 3H09A 1QNKA 1RHPA 3T53B 3S14B 4RGNA 1SNQA 3MXGA 1SBBB 4DAVA 4FYDA 1I50B 3K5OA 2CW0C 1KAAA 3GTPB 2MGSA 5I6WA 1JE4A 3J80L 1L0YB 1GUWA 3I70A 2WKDA 3BVZA 5JPNC 2F0UA 4EQPA 3LNNA 3S9WA 1CK1A 1S4ZA 3C3LA 4A93B 1QB5D 1S5BD 2BE5D 2JA7B 4EGVA 1WVLA 2EYPA 1RTNA 3MVVA 1BCPB 2JEAI 1CQVA 4RGMA 3MHBA 4A3MB 1EY4A 1LTGD 3T56B 1SMYD 4G7OC 4HN7A 1NR4A 4OIJA 1C48A 5JVH3 1UUPA 3I91A 3IAYA 4H0LC 1SSOA 2EPBA 3J81L 2K04A 4A3IB 2B2YA 2VB2X 3SEBA 2K5WA 2BDOA 1B9NA 2VNUD 3SHLA 2IX0A 5D3IB 1WTWA 2Q8RE 3I4NB 3TSSA 5T1GA 3O13A 1GJXA 1MD2D 3S2DB 3I8ZA 1O7ZA 3Q22A 5KEEA 1LT3D 2DY8A 1TY2A 4QCLA 3P20A 3NBHA 1AN8A 2L12A 1DZ1A 2HCIA 1HQMC 2WINB 4X3TA 4XDXA 5DAUA 1JWSD 4U68A 1HA6A 4IFDJ 2K33A 1IW7C 2KUMA 3T51B 3QG1A 5EKIA 1F2LA 1SYFA 3HZXA 1EY5A 4BY7B 2RDHA 2NUCA 3I3CA 2HUGA 2X6LA 3M7GA 2F0PA 1LTRD 5C44B 1CT1D 4ZAIA 3W2DA 1FD7D 3E5SA 5CV6A 5CBAE 1SYDA 1ZXTA 1SJED 2CHBD 4U673 5FLXE 1F9PA 1QILA 4KHVA 3BYYB 1GUGA 2EJFC 1FYCA 4BA2I 1M4VA 2F3WA 3DWQA 2BE5C 1PRTF 1F2ZA 4A3EB 1TY0A 2NN6I 1Y8NB 4FXGC 2ZT9C 2YU9B 3VR5A 3DWAA 4IALA 1GUNA 3DEPA 1NSNS 1XX8A 1OXXK 2JE6I 3D31A 3A7LA 1RF2D 1SMYC 1ENAA 1TWCB 3VYUA 5EBDA 4QB4A 3DMUA 4A3FB 2GA4B 4FXDA 1HHVA 5G3LF 4CJ1B 1EZ8A 3M4YA 4DU9A 4ZLTF 1BF4A 4UDUC 1KNAA 4G57A 1LT5D 4RA8A 1DCZA 1DONA 4RHRA 5IGCA 2Y0SB 2ICEC 5IOCA 2F0EA 4ID6A 5IIFA 3S2HB 2NTSA 4PMWA 4R8IA 2O5IC 3RLFA 1E0BA 5EQ0A 2PZWA 3HKZB 5IGDA 1Y1WB 1Y8PB 3MEHA 2LFNA 2IT1A 5E3FA 3X3NA 5E1FA 1I6HB 3I73A 4RKLA 3ITPA 4CGYB 1B1ZA 4OIKA 4LMQD 1Q3LA 2R93B 2OXPA 2NVYB 1BUVT 1Q90A 1EZ6A 1SYBA 1RJTA 4N9PA 1TWAB 2XWBB 2XRSD 3K7AB 4QUCA 3H0GB 4XYQA 4TRDA 3GV3A 3UI2A 3PIP3 2DNEA 2IW3A 2TSSA 3GTGB 3K57A 3BZDB 5CBEE 4NKLA 2WB1B 3LWUA 3C1FA 1X3PA 2OT2A 5CR3A 1LT6D 1JORA 1BCPF 2VUMB 2F0TA 2RSOA 1KLUD 4DAYA 4N9TA 3K5LA 2QDBA 2F0KA 1J8IA 4G4KA 1HUNA 4F88A 3CHBD 1MSGA 1ENFA 3DM1A 2NYZD 4I65A 1DJRD 2EYFA 1II3A 3HEJA 4DNTB 3KLRA 5A2QE 4LAAA 4UAIA 1U4LA 1IKMA 4L63B 4A3BB 3JAME 2HDLA 1M8AA 1O78A 1DYQA 3TZUA 3RZOB 3NK9A 2JEBI 3OOCA 3D6CA 5C0XH 2NVTB 1QE6A 3A8JE 3J7YW 1JICA 2NN6G 2WP8J 3E0JA 5NUCA 1B4OA 4B9XA 4C1NI 3HRZC 1STBA 3NSWA 2JA8B 4KY6A 3MTSA 3R2TA 4IN3A 1EWHA 4HR7B 3KK7A 1EYCA 3D3RA 4ZYSA 1LTID 4KV6A 1ML0D 2X6GA 1ENCA 4XIGS 3GTQB 3N52A 1SYGA 2R92B 3V2TA 1V1OA 3S1MB 1WTPA 4IUNA 1FNWA 4ZRZA 4IFDI 3P1HA 4TKOB 3BS1A 4A3JB 4KKSA 1A6XA 2R6GA 1T5XD 2K7VA 4NP5A 4RKBA 2RVLA 4RCNA 5C4ZA 4IUQA 5EBCA 4XQNA 1SAPA 1U4PA 5JEAG 2B2TC 4H7BA 3P7JA 5I4DA 2DY7A 2CQAA 5AFWA 5M3FB 4L6TB 1AW7A 1EQVA 2AUJD 2L1BA 2F0OA 1QJOA 2L11A 1EOTA 2MP1A 1A2UA 1BDOA 3NXWA 1H9KA 4KN4C 4WRDA 1HQRD 4C2MB 5LL6S 2NN6H 5FOBB 4HMJA 1BBXC 3OWFA 2F0WA 2F0NA 1V8QA 1MBYA 2PW7A 2C9OA 1NR2A 2R3ZA 4EVOA 4ZK9B 5DM73 2AWNA 3FKIB 1DD2A 1ICWA 2HCCA 3TZDA 1GUSA 2EJGC 3Q23A 2D9UA 3D4DA 4R9WA 3AU7A 1S5FD 4HAEA 2B2UA 4XT1B 5KNBA 3QOLA 2Z1CA 1Y1VB 1PXUA 1CA6A 1HTLD 1Q1BA 2AQ2B 4OGQC 2O2LD 3D4WA 5JEAH 3OIQA 2A6HD 1EQTA 2FMMA 4IUPA 5COYA 2J7ZA 3MAQA 1AEXA 1B9MA 3R93A 2L4NA 2B2VA 1Q1EA 2RBMA 1SYEA 2IL8A 1EU4A 1EY7A 1LTBD 2Z4IA 2PQEA 3MXPA 4ME5A 4WFN3 1LLRD 4KK7A 2PZUA 4EQNA 1I4RA 3LWEA 3FPUB 4XTCS 4MIUA 5CV8A 5KNCA 3Q6SA 1ONLA 2XVSA 3PUVA 1PTOB 5HGTA 2RA4A 4IFDG 4BA1I 2IWHA 1PLFA 1DXMA 1E2WA 2XWJB 2B2YC 1Y8OB 2K28A 1TU2B 1WD0A 3T4AC 1STAA 4RCOA 2WIIB 4JK1C 4DK1A 2VB3X 3L7ZC 1CTMA 5EJWA 3H91A 3TP8A 2E75C 1OXVA 1I3QB 3RMHA 4DNRB 3KLSX 3I4LA 4Q0FA 3FDTA 3PUYA 1F9RA 5CV9A 4KD3A 1SE3A 1ZEQX 1I4XA 1VF7A 2HQEA 3C1EA 3MFGA 4A3DB 4H44C 2PNRC 4HCSA 1B2TA 4QIWB 1NUCA 3QIAA 3D6WA 4DK0A 4PQXA 1JWUD 5J1ZA 1HFNA 1TS5A 4G7ZC 2MPMA 1IKLA 1CFMA 5C5LA 1IYUA 2SDFA 1NCVA 2JXMB 3MXUA 1EU3A 1F77A 4FXKC 3CRLC 5CV5A 2L9HA 2RKSA 4DXFA 2RDFA 4IFDH 2A6HC 3OMGA 3FRPB 1AFPA 1UNSA 1G2SA 1KTKA 4QF4A 3QJYA 1KDBA 3A54A 1XYIA 1RDPD 4XQQA 1GUOA 2KOLA 1SEBD 5EKKA 5M5XB 1ZKOA 2BOSA 4BWGB 2E76C 3WOFA 4S3SA 1HTPA 1PTOH 5EGTA 1J9OA 3EQLC 1BXTA 5K36G 2F1MA 3SE0A 2JYOA 3HOZB 5M3MB 4C56C 4K14A 2I46A 3N6RA 3IL8A 4PMBA 1SNDA 2KQ3A 4V190 3J7AF 1PRTD 5IT9L 4ABNA 1CA5A 3QWNA 4BY1B 3MFYA 2J0TD 1G8ZD 3R2IA 3RD4A 1OXSC 2DNCA 3I4MB 1PFMA 3S1QB 5I2YA 1V1PB 5G3LD 1HXYD 3VA7A 2F0IA 4TQUS 2X69A 1CHPD 3SK4A 4RGOS 2VXWA 5BN4A 1LT4D 5C4XB 2V4DA 2NVQB 1PZID 1BQQT 5C4HA 3VYSA 3L9AX 4ODGA 2EY1A 2B2WC 4BBSB 4I7ZC 2K03A 3V05A 1JOOA 3NUCA 4K5VA 1T5EA 3TDQA 4IQZA 3A55A 2ID0A 5CYUA 1WTOA 4Q5VA 1ESRA 1GUTA 4BBRB 4RWSC 1FR3A 1DOKA 1K8MA 1CZWA 5FO9B 4M8AA 1I6VC 4K6LA 2A5HA 4G7HC 1JR0D 3NP8A 3VA5A 1H9RA 1TT2A 1E2ZA 1SDFA 4XQJA 3BDLA 3BVMA 1LTAD 1A15A 1OXUA 1FNVA 2XRQD 3T16A 3C2PA 2XNAC 4ZUIA 2NWGA 1PTOF 3NHHA 3EA6A 1BCPD 3P75A 3F2UA 4KJNA 2XSCA 5KYLA 3S1NB 2E2IB 3ND9A 5ELDA 1C4QA 4O1NA 3R8BA 3ERQA 1I4QA 2F0VA 5D3DA 3HP3A 3TP6A 2QEJC 3PMFA 4NDXA 1D6EC 3GP7A 5IGEA 3PV0A 1I4GA 1QWYA 1STNA 4CKCA 4FVMA 1UAPA 1PRTC 3GTKB 1LTTD 3FEWX 4XXEA 3CU7A 3TN2A 3R3OA 1YNND 3SR1A 4DAPA 2OEOA 2FINB 2BCOA 3SK5A 4DXGA 3M4OB 3NWTA 3IKJA 1F2MA 5D14A 2EVBA 1HCZA 3QOJA 2J4XA 4O42A 3HOWB 3NWSA 2G9DA 1KABA 2KECA 5IGBA 3OPOA 2L55A 3K5NA 1U4RA 4KMUC 4CJ2C 2EJMA 2E2JB 3CQZB 3TBIB 5FO8B 4F8MA 5I9PA 3J81E 4CKEA 1EIHA 1SNMA 2B8GA 2PW5A 1G6ZA 1DOLA 3GV6A 5M9OA 3BG3A 2FHTA 3OMCA 1IHZA 3A56A 3I90A 2H1EA 2K1BA 1JWMD 3DWPA 4ZKBB 1Q12A 4RHSA 3W3AA 5FLXL 1SNCA 2XN9C 2B39A 3HOVB 5EPJA 2PPBC 4KTAA 1WTXA 4GZYC 3EROA 2ZXOA 5C3EB 1TVXA 1JQYD 4MHEA 1TS2A 4CBVA 5C5MA 5C4JB 1BCPC 3OSOA 2CVRA 5J39A 5IODA 2A68C 1HPCA 3L3OC 4J6HA 2K05A 2MJ8A 3KBXA 5JJZA 1XWEA 4HMIA 1TS4A 3VR6A 3NTHA 1EYAA 3H94A 4FF3A 4LJZC 3NE5B 2JP1A 3U9OA 2D5DA 1Y69U 3PO3B 2B2TA 1GHKA 1EWCA 1D5ZC 3MC0B 1Z6HA 1X3QA 1D5XC 4HEDA 3BYTB 2K32A 4KHZA 1YNNC 2TMPA 2B8FA 4B9WA 5K5PA 1EL0A 4H13C 2F03A 3HOUB 1PZKD 2NTTA 5I2XA 2C5CA 4CJ0B 3QB3A 4FF1A 1VMCA 2PCFB 1WCMB 2BA0A 1ILQA 1AZQA 3NBIA 1TWFB 1AZPA 2EDGA 4EQOA 3S1RB 1Z47A 1R4PB 3X3MA 1QOHA 1G291 5CGKA 1F2YA 1DOMA 1X32A 1K8OA 3KUPA 1OO9B 4E6IA 3CRKC 1S5DD 3SDZA 2QF7A 1K83B 2EY2A 2FMCA 5BN3A 1PFBA 2PO4A 2D2CC 1A2TA 4HSVA 5KGUA 3S17B 3TMEA 4KY5A 4IUVA 1TR5A 2Q8IB 1EY0A 2SNSA 4KN7C 4ILWA 4DFAA 2LY7A 4A3KB 4DGZA 2F0HA 1B3AA 4OL7A 2NBFA 4KJOA 2YYZA 1R9TB 1Q8IA 1BO0A 5EPLA 5JAVA 1A3VA 3HS0C 2JA5B 5C3WA 4CKBA 5C6AA 2EOTA 3QO2A 5A2QL 1O7YA 2JSOA 4PV1C 2QKIC 1GOZA 3JAML 2K6AA 3WDNA 1ZYRC 1ET9A 3RZDB 4PNYA 3M3YB 1HA5A 3PUZA 4P2CB 5KRUA 4IUUA 1AP0A 5DM63 1YNJD 1PZJD 3M7NA 4IZ8A 3IFDA 5KIXA 5ELBA 2E2HB 1SFOB 1GXDC 3Q24A 1W6KA 3EVQA 3OW7A 1LO5D 5CC4A 3CKIB 2K5DA 2KHSA 4MN3A 5DNFA 3MA2B 2N55A 4QUFA 1HUMA 3PIO3 5M5YB 1QCBD 5F2DA 1V1PA 4XYOA 1XTCD 5EKLA 1IL8A 3GQBA 1HRJA 3SK8A 5T1IA 1B44D 5IGGA 1WTVA 3FMCA 3GD7A 1MSHA 2ZXPA 1JB3A 4DA2A 4TSSA 1KNEA 1MGSA 5EPKA 4ZQ3A 4XT3B 5C0XI 3NQTA 2ZXRA 3DEOA 2D62A 4OO1I 1WTQA 1VMPA 4WJWA 5M5WB 1O80A 2BA1A 1LV9A 3G7LA 1LACA 4FO2A 5ELFA 3MWYW 2AWOA 2LS01 1PFNA 3K58A 1STGA 2ENBA 2KEEA 1B50A 1KDCA 2FJ2A 2MHVA 5E4XA 4NMZA 1RD9D 2A6ED 1A3TA 1PDQA 1I4PA 2QILA 3D8GA 3BDOA 4R8NA 4FF2A 2KA7A 5KNDA 3NTIA 2KJXA 1VF5C 1FGBD 3Q0AA 2OF1A 2RQXA 3TP7A 1PMRA 4KKTA 5LL6X 3MXNA 2SNMA 3GTJB 2A74C 3H6MA 2QCPX 1ESFA 3MZ5A 3K6OA 4X3KA 4KY7A 4K2KA 3KLSA 4KD4A 1EEID 1QG7A 2XIWA 1CI3M 2F0LA 3H3VC 1A3UA 1S5CD 2M00A 4HSPA 1LTSD 3KF8A 3PUXA 5FO7B 1EY9A 3SVMA 1B53A 3ONAB 1SXTA 3J7AV 4K6DA 4DN4M 1YNJC 3GO5A 1E2VA 1EYDA 1XXGA 1EIGA 2WV6D 3RUZA 4C3HB 5LHY1 1W6JA 2F0JA 2PYKA 1CM9A 1RODA 1H9SA 2A69D 1JOKA 2LKVA 1D1IA 1VDZA 1EFID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JAV A;  1A3V A;  3NP8 A;  5EGT A;  3VA5 A;  5KYI A;  3TP8 A;  5C3W A;  1TT2 A;  1STH A;  2O4X A;  5C6A A;  2EYL A;  3DHQ A;  1RKN A;  4J1M A;  3T13 A;  4IUN A;  3BDL A;  3QOL A;  4IAL A;  5KEE A;  4K14 A;  5J22 A;  4NKL A;  4DF7 A;  4PMB A;  1SND A;  2KQ3 A;  3C1F A;  1NSN S;  3P1H A;  1STG A;  4YIJ A;  5CR3 A;  1JOR A;  1SNQ A;  2ENB A;  4K8J A;  1SNO A;  3D4W A;  4K5W A;  5CV9 A;  5DEH A;  4B9W A;  4F8M A;  5I9P A;  5K5P A;  2EYM A;  2F0T A;  1SNP A;  1ENA A;  1KDC A;  4ZUJ A;  2WAC A;  4N9T A;  4KD3 A;  4NMZ A;  4NP5 A;  2QDB A;  1SNM A;  4RKB A;  2F0K A;  3T16 A;  5C4Z A;  1A3T A;  2PW5 A;  2HQE A;  4PNY A;  4K2L A;  3C1E A;  4QB4 A;  3TP5 A;  3D8G A;  3DMU A;  5I9O A;  4R8N A;  4ZUI A;  5M9O A;  5KRU A;  2EY6 A;  1AEX A;  4H7B A;  5ISR A;  3QB3 A;  1EZ8 A;  2F0S A;  3NHH A;  3OMC A;  1IHZ A;  2OF1 A;  2RBM A;  1SYE A;  4IZ8 A;  3TP7 A;  5CV7 A;  4DU9 A;  5KIX A;  1NUC A;  1KAA A;  2F0Q A;  2F3V A;  5I6W A;  4HTH A;  4I65 A;  3P75 A;  2EYF A;  5DAU A;  1EQV A;  1II3 A;  3HEJ A;  4G57 A;  5J1Z A;  2SNM A;  4KJN A;  4LAA A;  5KYL A;  1EY7 A;  3H6M A;  2F0U A;  4EQP A;  2EXZ A;  2F0O A;  3MZ5 A;  3ERQ A;  4K5X A;  5IGC A;  2F0V A;  3EVQ A;  3EJI A;  3SXH A;  5C5L A;  5C3X A;  4EQO A;  2PQE A;  3MXP A;  1A2U A;  2PZT A;  4KY7 A;  2F0M A;  2F0I A;  4K2K A;  4ME5 A;  3TP6 A;  3PMF A;  4KD4 A;  4NDX A;  3NXW A;  4QMG A;  5IGF A;  3S9W A;  5IGE A;  5HUR A;  1TQO A;  1SNC A;  5IOC A;  3SK4 A;  2F0E A;  5CC4 A;  1STN A;  2F0L A;  4ID6 A;  5IIF A;  1SYF A;  2KHS A;  4WRD A;  5CGK A;  2PZU A;  1F2Y A;  1A3U A;  4EQN A;  2EYP A;  2M00 A;  3HZX A;  1EY5 A;  5CV5 A;  1STY A;  3NK9 A;  4MIU A;  2RKS A;  3MVV A;  5F2D A;  4HMJ A;  1KDA A;  2NUC A;  3SK6 A;  2SOB A;  2EYJ A;  4KTA A;  3OWF A;  2F0W A;  4PMC A;  5C4H A;  1EY9 A;  3D6C A;  4E6I A;  2F0D A;  2EYO A;  2F0N A;  2PZW A;  2RDF A;  3OMG A;  4ODG A;  2EY1 A;  5CV8 A;  5EKL A;  3MHB A;  5IGD A;  3MEH A;  2EY2 A;  3R3O A;  3ERO A;  2EYH A;  5NUC A;  2F0P A;  5E3F A;  1JOO A;  3NUC A;  4K6D A;  5E1F A;  3SR1 A;  4B9X A;  4RKL A;  1EY4 A;  3SK8 A;  4K5V A;  3ITP A;  1EY6 A;  5IGG A;  2PW7 A;  1A2T A;  1STB A;  5CV4 A;  5JOB A;  1EYD A;  5C5M A;  5HGT A;  4K8I A;  3LX0 A;  3TME A;  2OEO A;  3OSO A;  5KGU A;  4KY5 A;  4QF4 A;  3E5S A;  4KY6 A;  1TR5 A;  5CV6 A;  3SK5 A;  5J39 A;  1EY0 A;  1SYD A;  2SNS A;  5IOD A;  2OXP A;  5I6Y A;  4DFA A;  4ZQ3 A;  4J6H A;  3RUZ A;  4EVO A;  4DGZ A;  4KHV A;  1F2M A;  1EZ6 A;  1EY8 A;  2F0H A;  1SYB A;  1KDB A;  2F0J A;  4N9P A;  3NQT A;  1EYC A;  2PYK A;  3BDC A;  3QOJ A;  4HMI A;  4KV6 A;  5EKK A;  1JOQ A;  4OL7 A;  1EYA A;  1ENC A;  1KAB A;  1STA A;  1JOK A;  4KJO A;  2LKV A;  5IGB A;  4TRD A;  1SYG A;  4S3S A;  2F3W A;  2F0F A;  3SHL A;  2EY5 A;  2F0G A;  3D4D A;  4WOR A;  1SYC A;  3V2T A;  1F2Z A;  4F7X A;  1U9R A;  3U9O A; 
#chains in the Genus database with same CATH topology
 3FVQ A;  3J81 c;  4RGT A;  3JC6 6;  3KBG A;  1CHQ D;  1CQF A;  4DV0 Q;  2WFW A;  4NW2 A;  5E4W C;  2EYL A;  3NTK A;  4J1M A;  3NBH B;  2HDM A;  4FF4 A;  1L0X B;  1JCK B;  4MTK A;  3C46 A;  4OX9 L;  5IYD H;  1HR0 Q;  1E1T A;  5DEH A;  5COR A;  4FNF A;  4B08 A;  2EYM A;  4ZUJ A;  2WAC A;  4C3H G;  4YCU A;  4RAU C;  5JJL A;  4IPD A;  5K36 H;  2M2L A;  4K2L A;  4LFA Q;  5CMD A;  3TP5 A;  5M5W H;  3J81 j;  5I9O A;  3EFX D;  1CKN A;  3I4O A;  4PZ6 A;  1N9W A;  2KCN A;  2F0Q A;  2FFK B;  5FK9 C;  4OEM B;  1QVG A;  1TWH B;  4CHT B;  2MFI A;  1QNU A;  4KI0 A;  3GTO B;  4HJ5 A;  4GOP A;  4JBW A;  2B2W A;  1XNR L;  3ND8 A;  1OXT A;  3EJI A;  3SXH A;  4EX5 A;  4YHH L;  1ILP A;  1PTO D;  2F0M A;  3MXN B;  4R1J A;  1JOQ A;  5IGF A;  5C0X G;  1QVC A;  1TQO A;  4PZ7 A;  1JE5 A;  2B63 B;  2Q2I A;  5M3M H;  1BNZ A;  1D7Q A;  2WAQ B;  4RH6 A;  2KCC A;  1DM0 B;  3M85 A;  1WTR A;  1TXY A;  1D5M C;  1KDA A;  1K3R A;  3UE0 A;  2A6E C;  4OO1 G;  2EYJ A;  3GTJ H;  2ES2 A;  2A68 D;  3S15 B;  1RIP A;  2F0D A;  1QUQ A;  3BVG A;  3K80 C;  1IBM L;  1MIU A;  5HY6 A;  2EYH A;  3KF8 B;  2Q2H A;  2LMC B;  2A73 B;  2AHO B;  1VCI A;  2JJQ A;  5CV4 A;  5JOB A;  1RCV D;  4K8I A;  3K59 A;  3AEV A;  2PMZ B;  2NZ1 D;  3A8K E;  1YHQ A;  1EY8 A;  3K7U C;  3I4M H;  1WTH A;  1OTC A;  2B63 G;  2Q8T A;  2NVX B;  1CKO A;  1MI2 A;  3U9S A;  2BDN A;  2R61 A;  3GTL B;  1NMG A;  2WAQ G;  3J80 E;  2F0F A;  2A19 A;  3D4R A;  1RTO A;  1X56 A;  1QZH A;  2E2D C;  4GN5 A;  4F7X A;  4DR4 L;  1H9S B;  1J5E L;  5KYI A;  5FKA C;  3HG9 A;  3I72 A;  3IFT A;  4AQY Q;  2O4X A;  2RHQ B;  4UP7 A;  5ELN A;  3DHQ A;  3G71 A;  4IUR A;  1UWV A;  2KVM A;  2XTI A;  5J22 A;  4DF7 A;  1R4Q B;  4OHJ A;  5C4X H;  3KOJ A;  2O5J C;  2NVQ H;  1TWG B;  4YIJ A;  3TQY A;  4K8J A;  4C1N K;  4JI0 Q;  2I5L X;  1TII D;  2G9H D;  3GTM B;  4JI7 L;  1PH2 A;  3G6J B;  3S16 B;  2I07 B;  1U4M A;  2RSN A;  2NB0 A;  1VQP A;  2K5V A;  2IPK D;  2N3S A;  2NZO A;  4JG2 A;  1SRU A;  3NQI A;  4PG3 A;  4DR3 Q;  2R7Z B;  3PSI A;  2F3V A;  4HTH A;  1CKN B;  2A69 C;  4KKU A;  3UE1 A;  2EXD A;  3K5M A;  1VQL A;  5C0X J;  4O2D A;  1ET6 A;  3HFZ B;  4X62 L;  4C3J B;  4K5X A;  5D65 A;  1YIT A;  5JPM C;  3URY A;  2Z8L A;  2JQO A;  2SEB D;  4QMG A;  2F4V Q;  1GHJ A;  5HUR A;  1BR9 A;  4V0B A;  1WD1 A;  4OO1 H;  4GOP B;  1CZG A;  4LWC A;  3I55 A;  2AQ3 B;  2H4O A;  4RFB A;  4A3G B;  2HIV A;  4O0A A;  1STY A;  1H9J A;  2AQ1 B;  4JPB W;  2F4I A;  3AMU A;  3CC4 A;  3SK6 A;  2SOB A;  3VYR A;  4YY3 L;  3A8I E;  1FNU A;  2R7Z G;  1H9M A;  2K5Q A;  3VDY A;  3GTO H;  1Q7Y C;  1KLG D;  3K0Y A;  3HOY B;  4J8Q A;  4JOI C;  1N32 L;  4L8J A;  3G6E A;  1QUQ B;  1PH7 A;  2E74 C;  1SE2 A;  2B63 H;  4C3J G;  2EZV A;  1NMF A;  1S5E D;  2IX1 A;  3VR2 A;  3TRE A;  1SJH D;  5ELC A;  1TS3 A;  5JVG 3;  4B3R L;  3VR3 A;  3FPP A;  3DUZ A;  4F87 A;  4QY7 A;  3BDC A;  1EIF A;  2JA6 B;  3S15 H;  2CW0 D;  1PTO C;  1WYD A;  1NAP A;  1PH6 A;  4Y7N B;  4A3G G;  3V96 A;  2E5L L;  1YHA A;  2F0G A;  4WOR A;  1SYC A;  2WKC A;  1EEF D;  1U9R A;  4IPG A;  1ZYR D;  3M9B A;  4LF4 L;  1AE2 A;  3HOY G;  1PYB A;  1RKN A;  4OXP A;  1JJC B;  3UDI A;  1G2T A;  1BOS A;  1VQ6 A;  1QVF A;  3WOE A;  2ICI A;  3GTK H;  4ZKC B;  1G91 A;  4K5W A;  1SNO A;  3E6Z X;  1HFG A;  4DV1 Q;  1SNP A;  3GTL H;  4C3I B;  5BN5 A;  2L0C A;  2M9V A;  1SR3 A;  1Z7T A;  3OTO Q;  5IP9 G;  1GM5 A;  4ME3 A;  3PO2 B;  2JA6 G;  4GN3 B;  2B2U C;  1TKW B;  2EY6 A;  3OWE B;  5ISR A;  2F0S A;  5CV7 A;  3HOX B;  4FP5 D;  1PYW D;  1F9Q A;  4LK1 C;  1D1K A;  4BS9 A;  4M1U B;  1LAB A;  2N88 A;  2EXZ A;  1F9S A;  2LSS A;  1L1O B;  1IYV A;  3VYT A;  1PRT B;  4DR5 L;  3GTM H;  3OHX C;  5C3X A;  2PZT A;  1SE4 A;  2LXJ A;  2AUK A;  1EYG A;  5IT9 E;  2IX3 A;  4JI4 Q;  3VR4 A;  1JC7 A;  4C3I G;  2B2V C;  2KED A;  3WWV A;  2R7Z H;  3ZYY X;  3NPP A;  3PO2 G;  1D2B A;  4JI2 L;  1STE A;  2UU9 L;  2Z6K C;  4B3M Q;  4QQB X;  4PMC A;  4BXX H;  3AB9 A;  1I4H A;  2EYO A;  3HOX G;  4C3J H;  5A35 A;  3L2P A;  1GKH A;  4ULL A;  1X6O A;  5TSS A;  2RDG A;  4DR1 Q;  3A7A B;  1EY6 A;  2K52 A;  5HGQ A;  3E3X A;  3PIO A;  3LX0 A;  5IWA L;  1K8A C;  1V43 A;  2MUY A;  2DN8 A;  5I6Y A;  2L5T A;  4IUT A;  1IBL Q;  4A3G H;  2HD3 A;  5GAD C;  3I2Z A;  5ELE A;  3HGB A;  4X3S A;  4X3U A;  3OIP A;  4Z9C B;  3DXJ C;  5JEA J;  2EE1 A;  1E1O A;  5GAH C;  3HOY H;  2EY5 A;  4HCE A;  1C8C A;  2Z4H A;  1PV4 A;  4J15 A;  2K01 A;  1B3Q A;  1IW7 D;  1UEA B;  2I5H A;  1O7L A;  2CFM A;  3PUW A;  4AYB B;  1STH A;  4I7A A;  2IJ0 A;  3T13 A;  4RMF A;  4IOA A;  3H09 A;  1QNK A;  1MKH A;  1RHP A;  3T53 B;  3S14 B;  4RGN A;  1SNQ A;  1K8G A;  3MXG A;  1SBB B;  4Y7N H;  2MO0 A;  2L15 A;  3PF4 A;  2VQE Q;  5LMN W;  1KIX A;  4DAV A;  1KD1 C;  4L5R C;  4X66 L;  4YCW A;  4FYD A;  1EOV A;  4AIM A;  4QJF A;  5IY0 A;  1X65 A;  4LUV A;  1I50 B;  2I0Q A;  3K5O A;  2CW0 C;  1KAA A;  3GTP B;  2MGS A;  4UP8 A;  5I6W A;  1JE4 A;  4DV2 L;  3GDE A;  3J80 L;  1L0Y B;  4AYB G;  2QGQ A;  1GUW A;  1VQN A;  4DV7 L;  3I70 A;  2WKD A;  3BVZ A;  2P5Z X;  2F0U A;  2VZA A;  4EQP A;  5JPN C;  2H5X A;  4C3I H;  2CWA A;  3LNN A;  4CDF C;  1S72 A;  2K75 A;  1UEB A;  4LNQ A;  3PO2 H;  1SRO A;  3S9W A;  3EN2 A;  1CK1 A;  1S4Z A;  4P74 A;  3C3L A;  1QB5 D;  4JYA Q;  4A93 B;  1S5B D;  2BE5 D;  3KLW A;  2JA7 B;  4EGV A;  3HOX H;  1VQB A;  2EYP A;  1WVL A;  3E0E A;  4X6A H;  1RTN A;  3MVV A;  1BBW A;  1BCP B;  4JI8 Q;  2JEA I;  1CQV A;  3M4P A;  2AKW B;  3MHB A;  4RGM A;  4A3M B;  3NEM A;  3HOU H;  1EY4 A;  1LTG D;  3T56 B;  1SMY D;  4G7O C;  4HN7 A;  1NR4 A;  4UPA A;  4UHV A;  1EWI A;  1HR0 W;  4OIJ A;  1C48 A;  3KJP A;  3KYH C;  5JVH 3;  4LF8 Q;  1NE3 A;  4DR7 L;  1UUP A;  4HIK A;  3I91 A;  3IAY A;  4A93 G;  4H0L C;  1SSO A;  2EPB A;  3J81 L;  4OX9 Q;  2K04 A;  4A3I B;  2JA7 G;  2B2Y A;  2VB2 X;  2JA9 A;  3SEB A;  2K5W A;  2BDO A;  4B3T L;  1B9N A;  2VNU D;  3SHL A;  2IX0 A;  5D3I B;  1WTW A;  5IE8 A;  2Q8R E;  3I4N B;  3TSS A;  1SLJ A;  5T1G A;  3O13 A;  1GJX A;  1VQJ A;  1MD2 D;  3S2D B;  3I8Z A;  4A3M G;  1O7Z A;  1Q8K A;  3Q22 A;  5KEE A;  5GQO A;  1LT3 D;  1YBY A;  1VQ8 A;  2DY8 A;  5FLM G;  3STB D;  1X3G A;  1K83 H;  3RNU A;  1TY2 A;  3LGJ A;  1Z9F A;  1XNR Q;  4QCL A;  3P20 A;  3Q8D A;  3NBH A;  4A3I G;  1AN8 A;  5GAG C;  2L12 A;  3TS2 A;  1UE1 A;  3UDF A;  4YHH Q;  2KHI A;  1A0I A;  1DZ1 A;  2IHF A;  2HCI A;  3KF6 A;  1HQM C;  2WIN B;  1L2F A;  4X3T A;  3I4N G;  1VQI A;  4XDX A;  5DAU A;  1JWS D;  3ULL A;  4U68 A;  1HA6 A;  4IFD J;  4JBM A;  2K33 A;  5GRO A;  2K4K A;  1IW7 C;  2KUM A;  3T51 B;  1IBM Q;  1FJG L;  3QG1 A;  4DPG A;  4YWK A;  3CCM A;  5EKI A;  1EQR A;  4JVZ A;  1F2L A;  1SYF A;  1CKM A;  4FDB A;  1RL2 A;  3HZX A;  1EY5 A;  3I7F A;  3AYH B;  4BY7 B;  2RDH A;  2NUC A;  3I3C A;  2HUG A;  2X6L A;  3M7G A;  2F0P A;  1LTR D;  3RZD H;  5C44 B;  1CT1 D;  4ZAI A;  4GNX A;  3W2D A;  1YIJ A;  4YWL A;  4A93 H;  1FD7 D;  3J80 c;  4EQ5 A;  3E5S A;  2JA7 H;  5CV6 A;  5CBA E;  3KJO A;  2MO1 A;  1SYD A;  2UUA Q;  1ZXT A;  1SJE D;  2CHB D;  4U67 3;  1D8L A;  1YEZ A;  5FLX E;  1MHW C;  1F9P A;  1QIL A;  4KHV A;  3BYY B;  3CAM A;  3FHW A;  2OTL A;  1GUG A;  2EJF C;  4LF9 L;  1FYC A;  2WAQ E;  5AJ3 Q;  4BA2 I;  4BY7 G;  1M4V A;  2F3W A;  3DWQ A;  2BE5 C;  1PRT F;  1F2Z A;  4A3E B;  1VQ4 A;  1TY0 A;  2NN6 I;  2N49 A;  1Y8N B;  4FXG C;  1T9H A;  2ZT9 C;  3CD6 A;  4IPH A;  2ALY B;  5FLM H;  2YU9 B;  3VR5 A;  3DWA A;  4IAL A;  1GUN A;  4LW1 A;  5C44 G;  2B3G A;  3H3V I;  3CCV A;  3DEP A;  1NSN S;  1XX8 A;  4A3I H;  3K0X A;  1OXX K;  2PMZ E;  2JE6 I;  3D31 A;  3A7L A;  1RF2 D;  1SMY C;  1ENA A;  1X55 A;  1TWC B;  4X62 Q;  3VYU A;  3I4N H;  5EBD A;  3B6Y A;  4QB4 A;  4RG1 A;  3DMU A;  4A3F B;  2GA4 B;  4FXD A;  4WJ3 M;  1K0R A;  4NXN L;  3S2D H;  5G3L F;  4JV5 Q;  2PI2 A;  1HHV A;  3U4Z A;  4CJ1 B;  1EZ8 A;  3CCR A;  3FP9 A;  3T1Y L;  3M4Y A;  4DU9 A;  4ZLT F;  4A3E G;  1BF4 A;  4UDU C;  1XNQ L;  2K14 A;  2ATW A;  1KNA A;  4G57 A;  1LT5 D;  3KF6 B;  2OQK A;  4RA8 A;  2VL6 A;  1DCZ A;  1DON A;  4YY3 Q;  1Q81 C;  4RHR A;  5IGC A;  4JCV E;  4DKA C;  3OYY A;  1PH1 A;  2Y0S B;  2ICE C;  4GKK L;  1N32 Q;  5IOC A;  2F0E A;  4ID6 A;  5IIF A;  3S2H B;  2NTS A;  4PMW A;  4A3F G;  3STB C;  2CCZ A;  4R8I A;  1ASZ A;  4B3R Q;  2O5I C;  4APV A;  3RLF A;  3I56 A;  1E0B A;  5EQ0 A;  2PZW A;  3HKZ B;  5IGD A;  1Y1W B;  3CCL A;  1Y8P B;  3MEH A;  2LFN A;  3MEF A;  2IT1 A;  5E3F A;  3X3N A;  5E1F A;  1I6H B;  3I73 A;  4RKL A;  4DV5 Q;  3ITP A;  4CGY B;  1B1Z A;  4X64 Q;  4OIK A;  4LMQ D;  1KXL A;  1Q3L A;  1YJN A;  2R93 B;  4R4C A;  2OXP A;  2NVY B;  4JI5 L;  2Y0S G;  1BUV T;  1A8V A;  1LTL A;  4GNX B;  1Q90 A;  1EZ6 A;  2KEN A;  1IL2 A;  1SYB A;  1RJT A;  4N9P A;  1TWA B;  1SN8 A;  3ULP A;  1N33 L;  2XWB B;  4LF7 Q;  2XRS D;  3H15 A;  3K7A B;  4QUC A;  3H0G B;  1HZC A;  4BBR G;  4XYQ A;  4TRD A;  3GV3 A;  4DK3 C;  3UI2 A;  3PIP 3;  2DNE A;  2IW3 A;  3HKZ G;  1Y1W G;  2TSS A;  3GTG B;  3K57 A;  2VQF L;  3BZD B;  3A5Z B;  5CBE E;  4X65 L;  4NKL A;  1CUK A;  1HZA A;  2WB1 B;  3LWU A;  3C1F A;  1X3P A;  2R93 G;  2OT2 A;  3U4V A;  5CR3 A;  1LT6 D;  1JOR A;  1BCP F;  4JI1 L;  2VUM B;  2F0T A;  2RSO A;  1KLU D;  4DAY A;  4N9T A;  3K5L A;  1VQO A;  2QDB A;  2F0K A;  2ZM6 L;  1J8I A;  4G4K A;  4A3E H;  1HUN A;  4F88 A;  3CHB D;  1MSG A;  3AFQ A;  3M4Q A;  3H0G G;  1ENF A;  1GO3 E;  2YU9 H;  3DM1 A;  5IT9 c;  2NYZ D;  1JMC A;  4I65 A;  1DJR D;  4C3H H;  2EYF A;  1II3 A;  3HEJ A;  4JI2 Q;  4DNT B;  3CPF A;  3KLR A;  5A2Q E;  4LAA A;  4UAI A;  2UU9 Q;  1U4L A;  1IKM A;  4A4I A;  1E24 A;  2WB1 G;  3T1H L;  1TWC H;  1IYJ B;  4L63 B;  2GN5 A;  3PCO B;  4A3B B;  3JAM E;  4ALP A;  4A3F H;  5LMN L;  2VUM G;  2HDL A;  1M8A A;  3F1Z A;  4DV6 L;  1EQQ A;  5IWA Q;  2HT1 A;  2KCT A;  4JI3 L;  1N34 L;  1O78 A;  1DYQ A;  3TZU A;  4A3C G;  4GKJ L;  3RZO B;  1L1O A;  3NK9 A;  2JEB I;  4N8X 1;  1P8L A;  3OOC A;  3D6C A;  5C0X H;  2NVT B;  1IZ6 A;  1QE6 A;  3A8J E;  3J7Y W;  4H02 A;  1VQ7 A;  1JIC A;  2NN6 G;  1A62 A;  2WP8 J;  3E0J A;  4POG A;  5NUC A;  1B4O A;  4B9X A;  4C1N I;  1G51 A;  1K73 C;  2UXC L;  2IY5 B;  3HRZ C;  1STB A;  3NSW A;  2JA8 B;  1AE3 A;  3UDG A;  3G48 A;  4KY6 A;  3A74 A;  3MTS A;  1PH9 A;  3R2T A;  4A3B G;  4IN3 A;  1EWH A;  4GLA C;  4HR7 B;  4LF5 Q;  3KK7 A;  1L0W A;  1PH3 A;  4IJL A;  1EYC A;  1TWH H;  3D3R A;  1LTI D;  4KV6 A;  4ZYS A;  2OWO A;  1ML0 D;  2X6G A;  1ENC A;  1PH4 A;  1Y1W H;  4XIG S;  3KFU A;  4UP9 A;  4WJ4 A;  1I6H H;  3GTQ B;  3N52 A;  1SYG A;  2R92 B;  1QZG A;  3V2T A;  2Q2U A;  1VQ9 A;  2QW7 A;  3QR8 A;  4JBK A;  2R93 H;  1V1O A;  3S1M B;  4X66 Q;  2YTY A;  2NVY H;  1WTP A;  1HR0 L;  4IUN A;  1FNW A;  2N78 A;  4ZRZ A;  5L37 A;  1K28 A;  2JA8 G;  4IFD I;  3P1H A;  1TWA H;  2VY3 A;  4TKO B;  4K0K L;  3BS1 A;  1C9O A;  4A3J B;  4DV2 Q;  4KKS A;  1A6X A;  2R6G A;  3H0G H;  1T5X D;  2K7V A;  4LFA L;  4R4I A;  4NP5 A;  4RKB A;  2RVL A;  4RCN A;  5C4Z A;  1HZ9 A;  1GVP A;  4IUQ A;  5EBC A;  4XQN A;  1SAP A;  1U4P A;  4DAY B;  5JEA G;  2B2T C;  2E8G A;  3GTG H;  4H7B A;  2Z6B A;  3P7J A;  5I4D A;  2F52 A;  2Q2T A;  2R92 G;  2DY7 A;  2ZTC A;  3PF5 A;  2CQA A;  5AFW A;  5M3F B;  4L6T B;  1C7Y A;  1AW7 A;  3DM3 A;  1EQV A;  1X3F A;  2AUJ D;  2L1B A;  4AYB E;  3BU2 A;  2NVX H;  2VUM H;  2F0O A;  1QJO A;  2L11 A;  2EIF A;  1NTG A;  3CF5 A;  4JOI A;  1EOT A;  2MP1 A;  3F2C A;  1A2U A;  1BDO A;  3CPW A;  4A3J G;  4A3C H;  3NXW A;  1HNZ L;  4P75 A;  1H9K A;  4KN4 C;  1UE5 A;  2V1C C;  4WRD A;  1HQR D;  4R4T A;  2CKZ B;  4DR7 Q;  4C2M B;  5LL6 S;  2NN6 H;  5FOB B;  4HMJ A;  5BR8 L;  1BBX C;  1TWG H;  2F0W A;  3OWF A;  3H3V H;  2F0N A;  5M3F G;  3NEL A;  1V8Q A;  2B29 A;  4A76 A;  4A3B H;  1MBY A;  4B3T Q;  1H95 A;  2KCM A;  4OWX B;  3S16 H;  2PW7 A;  4A75 A;  1IBK L;  3TS0 A;  2C9O A;  1NR2 A;  3CP0 A;  1M90 C;  2R3Z A;  4EVO A;  4ZK9 B;  5DM7 3;  4CDC C;  2AWN A;  3FKI B;  1DD2 A;  5JJI A;  4UY8 C;  1ICW A;  2HCC A;  2NVT H;  4DR2 Q;  3TZD A;  1GUS A;  2EJG C;  3Q23 A;  1KAW A;  2D9U A;  3D4D A;  4R9W A;  3AU7 A;  1KRT A;  1I94 Q;  1S5F D;  4HAE A;  2JA8 H;  3J7Z C;  2B2U A;  4N8F A;  2BH2 A;  4XT1 B;  5KNB A;  3QOL A;  2Z1C A;  4HIM A;  1Y1V B;  4LF6 Q;  1PXU A;  4JI0 L;  4DAM A;  1CA6 A;  1HTL D;  1Q1B A;  2AQ2 B;  4OGQ C;  2O2L D;  2QDL A;  3D4W A;  4NB3 A;  2AMC B;  5JEA H;  2R92 H;  3FKI G;  3OIQ A;  4DUY Q;  2A6H D;  1EQT A;  2FMM A;  1FJG Q;  4DR3 L;  4IUP A;  5COY A;  2J7Z A;  2LXK A;  1AEX A;  3MAQ A;  1B9M A;  3R93 A;  3S1M H;  2L4N A;  2B2V A;  1Q1E A;  2RBM A;  1SYE A;  2IL8 A;  1JT8 A;  1EU4 A;  1KQS A;  5IP9 H;  4IO9 A;  2Z6K A;  2CQO A;  2UXB Q;  2JA6 H;  1EY7 A;  1HNX L;  1U5K A;  2R7D A;  3JAM i;  1Y1V G;  1LTB D;  2PQA A;  2PQE A;  2Z4I A;  3MXP A;  4ME5 A;  4LFB L;  4Y52 H;  4WFN 3;  1LLR D;  1Q46 A;  1V9P A;  3ZJY C;  4KK7 A;  1I5F A;  2JK8 A;  1FVI A;  2PZU A;  4EQN A;  1I4R A;  3LWE A;  3FPU B;  4XTC S;  4MIU A;  5FLX c;  3TEH B;  5CV8 A;  5KNC A;  3Q6S A;  2UUB L;  1VQC A;  4LF9 Q;  1ONL A;  2XVS A;  1HNW L;  3PUV A;  1VQA A;  2DJF C;  1PTO B;  5HGT A;  4IJH A;  2RA4 A;  4IFD G;  3W5O A;  4BA1 I;  2IWH A;  1PLF A;  1XJV A;  1E22 A;  1DXM A;  1E2W A;  2XWJ B;  5IYB G;  2B2Y C;  4L5T A;  1Y8O B;  1N8R C;  3J81 i;  2K28 A;  1MJE A;  1TU2 B;  1WD0 A;  3T4A C;  1STA A;  4DUZ Q;  1VQH A;  4RCO A;  2WII B;  3BJU A;  4JK1 C;  2RHS B;  3RLO A;  4DK1 A;  2VB3 X;  3L7Z C;  1CTM A;  5EJW A;  3H91 A;  3TP8 A;  4NXN Q;  2E75 C;  1OXV A;  1I3Q B;  3RMH A;  4DNR B;  3KLS X;  3I4L A;  4DV1 L;  1KC8 C;  4Q0F A;  3FDT A;  3PUY A;  1XNQ Q;  1F9R A;  5CV9 A;  3OTO L;  4KD3 A;  1SE3 A;  1ZEQ X;  1XMO L;  1I4X A;  1VF7 A;  2HQE A;  1YNX A;  3C1E A;  3MFG A;  5J3B A;  2OQ0 A;  3CC2 A;  4A3D B;  4H44 C;  1B7Y B;  2PNR C;  4GKK Q;  4HCS A;  1B2T A;  1PA6 A;  4QIW B;  1VQ5 A;  4DR6 L;  1NUC A;  1Y1V H;  3QIA A;  3D6W A;  3S24 A;  4DK0 A;  1K3B C;  4PQX A;  1JWU D;  5J1Z A;  1HFN A;  1TS5 A;  4G7Z C;  3KDF A;  2MPM A;  1IKL A;  1CFM A;  4LFC L;  5C5L A;  4JI4 L;  3A0J A;  1IYU A;  2SDF A;  1NCV A;  2JXM B;  1A63 A;  3MXU A;  1EU3 A;  4DNI A;  1F77 A;  4FXK C;  2K50 A;  1DGS A;  1X9N A;  2PQA B;  3CRL C;  1YZ6 A;  2F3I A;  4B3M L;  5CV5 A;  4A3D G;  2L9H A;  2RKS A;  3W1B A;  4DXF A;  1PH5 A;  2HHH L;  4B3S L;  3S14 H;  2RDF A;  4IFD H;  2A6H C;  3OMG A;  3FRP B;  2CH4 A;  1O7I A;  2UXD L;  4OEL B;  1XPR A;  1AFP A;  3ICE A;  1UNS A;  5IYB H;  1G2S A;  1KTK A;  4QF4 A;  1IBL L;  4HID A;  1G6P A;  2K5H A;  2Y0S E;  1I50 H;  3QJY A;  2IHE A;  2VQF Q;  3GTP H;  1KDB A;  2BH8 A;  4GN4 B;  4X65 Q;  3A54 A;  1XYI A;  1RDP D;  4XQQ A;  1GUO A;  2KOL A;  1SEB D;  5EKK A;  5M5X B;  1ZKO A;  2BOS A;  4BWG B;  2E76 C;  2QEX A;  4JI1 Q;  5IYD G;  3WOF A;  4S3S A;  1HTP A;  2ZM6 Q;  1PTO H;  3HKZ E;  5EGT A;  4PZ8 A;  3D0F A;  2DJG C;  1J9O A;  4DV3 L;  4DR4 Q;  3EQL C;  1BXT A;  5K36 G;  2F1M A;  1J5E Q;  3SE0 A;  2JYO A;  3HOZ B;  5M3M B;  4C56 C;  4K14 A;  2I46 A;  3N6R A;  3IL8 A;  4PMB A;  3AFP A;  1SND A;  2KQ3 A;  1GD7 A;  1UE6 A;  4V19 0;  3PIP A;  2YTX A;  3J7A F;  1PRT D;  5IT9 L;  4ABN A;  1VQK A;  4A3M H;  1CA5 A;  3QWN A;  4BY1 B;  3MFY A;  2I5M X;  2J0T D;  1G8Z D;  4KHP L;  1Y14 B;  3R2I A;  4QL5 A;  4JI7 Q;  3RD4 A;  1OXS C;  2ZJQ A;  5LMN Q;  3JAM c;  2FXQ A;  1I3Q H;  2DNC A;  4JI3 Q;  3I4M B;  1N34 Q;  4POF A;  1PFM A;  4GKJ Q;  3S1Q B;  3E9H A;  3BZC A;  3HOZ G;  5M3M G;  4DV4 L;  2WB1 E;  5I2Y A;  1V1P B;  5G3L D;  1HXY D;  3VA7 A;  2F0I A;  4TQU S;  4A3D H;  1BBU A;  1CHP D;  2X69 A;  3AQQ A;  2G5D A;  1SE8 A;  3KDF B;  4JBJ A;  4RGO S;  3SK4 A;  2VXW A;  5BN4 A;  2EQS A;  1LT4 D;  4BY1 G;  5JJK A;  1VS0 A;  5C4X B;  2V4D A;  2NVQ B;  1PZI D;  1BQQ T;  5C4H A;  1N36 L;  3VYS A;  3L9A X;  4ODG A;  4GOP C;  2EY1 A;  2B2W C;  4BBS B;  4I7Z C;  4P71 A;  1B70 B;  2K03 A;  3V05 A;  1JOO A;  3NUC A;  3I4M G;  2PI2 E;  4IOC A;  4K5V A;  4LF8 L;  1T5E A;  1ASY A;  1YVC A;  3TDQ A;  3PQI A;  1UE7 A;  4IQZ A;  1XPO A;  3A55 A;  2RF4 A;  2ID0 A;  5CYU A;  1WTO A;  1LUZ A;  4Q5V A;  1ESR A;  1GUT A;  3BZK A;  4BBR B;  4RWS C;  1Q82 C;  1P16 A;  3CCS A;  3CMA A;  1FR3 A;  1DOK A;  5LMU L;  2HQL A;  4K0K Q;  1EIY B;  1K8M A;  1B8A A;  1CZW A;  5C4X G;  5FO9 B;  4M8A A;  1I6V C;  1JJ2 A;  4K6L A;  2A5H A;  4G7H C;  1JR0 D;  2E5L Q;  3NP8 A;  3VA5 A;  4BBS G;  1PHJ A;  1H9R A;  1MJC A;  3ERS X;  2CWP A;  1TT2 A;  4NXM L;  1E2Z A;  1SDF A;  4XQJ A;  1U0L A;  3F2D A;  3BDL A;  3BVM A;  4LF4 Q;  4KLK A;  1LTA D;  1VQE A;  1A15 A;  4TVA B;  2KHJ A;  4BY7 H;  1OXU A;  5M5X H;  2ZTD A;  1FNV A;  1PVO A;  2XRQ D;  3T16 A;  3TRZ A;  1BVS A;  3C2P A;  5C44 H;  2XNA C;  4ZUI A;  2NWG A;  1PTO F;  4HJ8 A;  3NHH A;  4HJA A;  1HNZ Q;  3EA6 A;  3HOZ H;  4AH6 A;  1LYL A;  1BCP D;  3L0O A;  4L5Q A;  3P75 A;  3F2U A;  4KJN A;  2XSC A;  5KYL A;  3S1N B;  2E2I B;  5BR8 Q;  3ND9 A;  2XGT A;  5ELD A;  1WI5 A;  4QGU A;  2ZJP A;  1C4Q A;  4O1N A;  3R8B A;  3F2B A;  3ERQ A;  1I4Q A;  3CC7 A;  2F0V A;  4GLV B;  5D3D A;  3HP3 A;  3TP6 A;  4BY1 H;  2QEJ C;  3PMF A;  4NDX A;  1D6E C;  3GP7 A;  5IGE A;  3PV0 A;  4DR5 Q;  1I4G A;  5EAY A;  1QWY A;  1STN A;  1IBK Q;  1L1O C;  4CKC A;  1KHI A;  4FVM A;  4OWW B;  1UAP A;  1PRT C;  3GTK B;  1LTT D;  3FEW X;  3S1Q H;  4XXE A;  3CU7 A;  3TN2 A;  1S3O A;  3SGI A;  3R3O A;  1VQM A;  1YNN D;  3SR1 A;  1NNX A;  4OWT B;  1HJP A;  2DUD A;  3NEN A;  4DAP A;  3PGZ A;  2UUA L;  2VW9 A;  2OEO A;  2FIN B;  2BCO A;  3SK5 A;  4DXG A;  3IRB A;  3M4O B;  3NWT A;  3IKJ A;  3OW2 A;  1F2M A;  5D14 A;  2ZJR A;  1BKB A;  2EVB A;  1HCZ A;  3QOJ A;  2J4X A;  4O42 A;  3HOW B;  3NWS A;  5AJ3 L;  2G9D A;  1KAB A;  4BBS H;  2KEC A;  1SMX A;  5IGB A;  2OCE A;  4JI6 L;  3OPO A;  1WJJ A;  2L55 A;  3K5N A;  1NY4 A;  1U4R A;  1XMQ L;  4KMU C;  2UUC L;  2RCF A;  3S2H H;  5GAE C;  4CJ2 C;  4BBR H;  2EJM A;  2E2J B;  3CQZ B;  1XPU A;  3TBI B;  2A1A A;  5FO8 B;  4F8M A;  5I9P A;  1HNX Q;  3J81 E;  4CKE A;  1EIH A;  1SNM A;  2B8G A;  2PW5 A;  4JV5 L;  1G6Z A;  1IXR A;  4CDD C;  3HOW G;  1DOL A;  3GV6 A;  5M9O A;  4DV0 L;  4LFB Q;  3BG3 A;  2FHT A;  3OMC A;  1IHZ A;  4HJ7 A;  3A56 A;  2QA4 A;  3I90 A;  2H1E A;  2K1B A;  1JWM D;  2A8V A;  3K7A H;  3F8T A;  3DWP A;  4DV7 Q;  4ZKB B;  1Q12 A;  4RHS A;  2UUB Q;  4BXX G;  3W3A A;  1HNW Q;  5FLX L;  1SNC A;  2DGY A;  2B39 A;  2XN9 C;  1YI2 A;  3HOV B;  4LUZ A;  5EPJ A;  2PPB C;  3E9I A;  5IYC G;  4KTA A;  2E2I H;  3S1N H;  1WTX A;  4GZY C;  4DV5 L;  3ERO A;  1X3E A;  4X64 L;  3U58 A;  2ZXO A;  5C3E B;  1TVX A;  1CSQ A;  1JQY D;  4MHE A;  1PFS A;  1TS2 A;  4CBV A;  4GLX A;  5C5M A;  5C4J B;  1BCP C;  3OSO A;  2CVR A;  5J39 A;  5IOD A;  2A68 C;  1HPC A;  1CSP A;  3L3O C;  4J6H A;  2K05 A;  2MJ8 A;  4LF7 L;  3HOV G;  3KBX A;  5JJZ A;  1XWE A;  4HMI A;  1TS4 A;  3K8A A;  4P73 A;  3VR6 A;  3NTH A;  1EYA A;  3H94 A;  4FF3 A;  4LJZ C;  2HIX A;  3NE5 B;  2JP1 A;  1XMO Q;  3U9O A;  2D5D A;  1Y69 U;  3PO3 B;  3CW2 C;  1FGU A;  1XTD A;  2B2T A;  1GHK A;  3M4O H;  1EWC A;  1D5Z C;  5C3E G;  3MC0 B;  1Z6H A;  2VS1 A;  1K0S A;  1X3Q A;  1KL9 A;  1D5X C;  1VQF A;  4MNO A;  3RZO H;  4HED A;  4A3L G;  3BYT B;  4DR6 Q;  2K32 A;  4KHZ A;  1WFQ A;  1YNN C;  2TMP A;  2B8F A;  3HOW H;  4B9W A;  5K5P A;  1EL0 A;  5IP7 G;  2PNH A;  4H13 C;  2Z9H A;  2F03 A;  3HOU B;  1PZK D;  2NTT A;  4P72 A;  5I2X A;  1JB7 A;  2C5C A;  4CJ0 B;  4LFC Q;  1PH8 A;  4AQY L;  3QB3 A;  4FF1 A;  3K81 C;  3CCJ A;  2MQH A;  1VMC A;  2PCF B;  1FL0 A;  1WCM B;  2BA0 A;  1ILQ A;  2K5N A;  1AZQ A;  3PO3 G;  2E2J H;  3CQZ H;  1C0A A;  2YV5 A;  1YJ9 A;  3NBI A;  1TWF B;  2HHH Q;  1AZP A;  4B3S Q;  4R4Q A;  1EFW A;  2EDG A;  3GTQ H;  4EQO A;  3S1R B;  1Z47 A;  3ER0 A;  5IYC H;  1R4P B;  2UXD Q;  3X3M A;  1VQG A;  1QOH A;  3HOU G;  1G29 1;  5CGK A;  1F2Y A;  1DOM A;  4L5S A;  1X32 A;  1K8O A;  3KUP A;  1J6Q A;  5E7N A;  3DLL A;  2GVB A;  1OO9 B;  4A3J H;  3J80 i;  4E6I A;  4QIW E;  3CRK C;  1WCM G;  1S5D D;  3SDZ A;  2QF7 A;  1K83 B;  2EY2 A;  2FMC A;  2F4V L;  5BN3 A;  2NZH A;  1PFB A;  1V1Q A;  2PO4 A;  2GVA A;  2D2C C;  1A2T A;  3HOV H;  4HSV A;  5KGU A;  3S17 B;  3TME A;  4KY5 A;  4IUV A;  1TR5 A;  1HH2 P;  4LF5 L;  2Q8I B;  1EY0 A;  2SNS A;  4KN7 C;  4ILW A;  4DFA A;  2LY7 A;  2JN4 A;  4DV3 Q;  4A3K B;  3HKS A;  4DGZ A;  5M3F H;  3CCE A;  2F0H A;  2C35 B;  1B3A A;  4OL7 A;  2D0P A;  2NBF A;  3RR5 A;  4JC0 A;  4KJO A;  2YYZ A;  4R4O A;  3CXC A;  1R9T B;  1Q8I A;  5C3E H;  1BO0 A;  3G4S A;  5EPL A;  5JAV A;  1A3V A;  3HS0 C;  2KBN A;  4YWM A;  5C4J H;  3CCQ A;  4A3L H;  2JA5 B;  4KHP Q;  5C3W A;  4CKB A;  3J7A 5;  5C6A A;  1W2B A;  2EOT A;  1E7Z A;  1KRS A;  5IP7 H;  3A5U A;  3QO2 A;  5A2Q L;  4C2M H;  1O7Y A;  2JSO A;  4PV1 C;  2N8N A;  2QKI C;  2D0O A;  4CDE C;  1GOZ A;  3UDX A;  2RCN A;  3JAM L;  4A3K G;  1X54 A;  2K6A A;  4LUO A;  1ZYR C;  3WDN A;  1ET9 A;  1S40 A;  3RZD B;  4DV4 Q;  4PNY A;  4HIO A;  2CH4 W;  4OON A;  3M3Y B;  1HA5 A;  3PUZ A;  4P2C B;  3PO3 H;  5KRU A;  4IUU A;  1AP0 A;  5DM6 3;  1YNJ D;  1PZJ D;  3EIV A;  3M7N A;  1ICF B;  3RLN A;  3U50 C;  4IZ8 A;  5DLQ E;  3IFD A;  5KIX A;  2JA5 G;  3T1Y Q;  5ELB A;  1K9M C;  3FKI H;  2E2H B;  1SFO B;  1YJW A;  1GXD C;  3Q24 A;  1N36 Q;  1W6K A;  3EVQ A;  1M1K C;  3OW7 A;  3EBE A;  2ASB A;  1LO5 D;  5CC4 A;  2MNA A;  3CKI B;  4JW0 A;  2K5D A;  2KHS A;  4MN3 A;  5DNF A;  3MA2 B;  5FJ8 G;  1WCM H;  2N55 A;  4QUF A;  1HUM A;  1E3P A;  3PIO 3;  5M5Y B;  1QCB D;  5F2D A;  1V1P A;  4XYO A;  1TWF H;  1XTC D;  5EKL A;  5LMU Q;  1IL8 A;  1JJG A;  3GQB A;  1HRJ A;  3S1R H;  1PYS B;  3SK8 A;  5T1I A;  1B44 D;  5IGG A;  1WTV A;  3FMC A;  3GD7 A;  1MSH A;  2ZXP A;  1JB3 A;  2YTV A;  1Q86 C;  4DA2 A;  4TSS A;  1KNE A;  1MGS A;  5EPK A;  4NXM Q;  4ZQ3 A;  4XT3 B;  5C0X I;  4NPS A;  4DR2 L;  1VQD A;  4JI5 Q;  3NQT A;  2ZXR A;  1W3S A;  3DEO A;  4YCV A;  1NBW A;  1I94 L;  1N33 Q;  2Z0S A;  2D62 A;  4DR1 L;  4OO1 I;  1WTQ A;  4GNX C;  1VMP A;  1LM0 A;  4WJW A;  5M5W B;  3S17 H;  1O80 A;  3CME A;  4ZCK A;  3W1G A;  2BA1 A;  1LV9 A;  3G7L A;  4LF6 L;  1LAC A;  4HJ9 A;  4A3K H;  4FO2 A;  5ELF A;  3MWY W;  2AWO A;  2LS0 1;  1PFN A;  3K58 A;  1STG A;  2ENB A;  2KEE A;  1B50 A;  1KDC A;  2FJ2 A;  1R9T H;  4DUY L;  2MHV A;  1EUJ A;  5E4X A;  4NMZ A;  1RD9 D;  2A6E D;  1A3T A;  1PDQ A;  1I4P A;  2QIL A;  3RN2 A;  3D8G A;  2JA5 H;  1YHB A;  2R7F A;  3BDO A;  4R8N A;  4FF2 A;  2KA7 A;  5KND A;  3NTI A;  2KJX A;  1VF5 C;  1FGB D;  3Q0A A;  2OF1 A;  2RQX A;  3TP7 A;  1PMR A;  2UXB L;  4KKT A;  5LL6 X;  4MTN A;  3MXN A;  2SNM A;  3GTJ B;  2A74 C;  3H6M A;  2QCP X;  1ESF A;  2VQE L;  3MZ5 A;  3K6O A;  4X3K A;  4KY7 A;  5FJ8 H;  4K2K A;  5H1S E;  3KLS A;  4KD4 A;  1NJI C;  3M3Y H;  3T1H Q;  1EEI D;  1QG7 A;  4GS3 A;  1WOC A;  2XIW A;  1CI3 M;  2F0L A;  4IPC A;  3H3V C;  1A3U A;  1S5C D;  2M00 A;  1AH9 A;  2OTJ A;  4DK6 C;  4DV6 Q;  4HSP A;  1LTS D;  3KF8 A;  3PUX A;  5FO7 B;  2E2H H;  1SFO H;  1EY9 A;  3SVM A;  1B53 A;  3ONA B;  1SXT A;  3CCU A;  3J7A V;  4K6D A;  4DN4 M;  1YNJ C;  3GO5 A;  1E2V A;  4JI6 Q;  4JYA L;  1EYD A;  2UXC Q;  3ULJ A;  1XXG A;  1EIG A;  1XMQ Q;  2WV6 D;  3RUZ A;  2UUC Q;  4JI8 L;  5M5Y H;  4C3H B;  5LHY 1;  2ZTE A;  1W6J A;  2F0J A;  2PYK A;  4DUZ L;  1CM9 A;  3RN5 A;  1ROD A;  1H9S A;  1HZB A;  5ELO A;  2A69 D;  1JOK A;  2LKV A;  1D1I A;  4MZ9 A;  1VDZ A;  1EFI D; 
#chains in the Genus database with same CATH homology
 3FVQ A;  4RGT A;  3KBG A;  1CHQ D;  1CQF A;  4NW2 A;  5E4W C;  2EYL A;  3NTK A;  4J1M A;  2HDM A;  4FF4 A;  1L0X B;  1JCK B;  3C46 A;  5DEH A;  5COR A;  4FNF A;  4B08 A;  2EYM A;  4ZUJ A;  2WAC A;  4C3H G;  4RAU C;  5K36 H;  2M2L A;  4K2L A;  5CMD A;  3TP5 A;  5I9O A;  3EFX D;  2KCN A;  2F0Q A;  2FFK B;  5FK9 C;  1TWH B;  4CHT B;  1QNU A;  4KI0 A;  3GTO B;  4JBW A;  2B2W A;  3ND8 A;  1OXT A;  3EJI A;  3SXH A;  1ILP A;  1PTO D;  2F0M A;  1JOQ A;  5IGF A;  5C0X G;  1TQO A;  2B63 B;  1BNZ A;  2WAQ B;  4RH6 A;  2KCC A;  1DM0 B;  3M85 A;  1WTR A;  4OO1 G;  1D5M C;  1KDA A;  2A6E C;  2EYJ A;  2A68 D;  3S15 B;  2F0D A;  3BVG A;  2EYH A;  2LMC B;  2A73 B;  1VCI A;  5CV4 A;  5JOB A;  1RCV D;  4K8I A;  3K59 A;  2PMZ B;  2NZ1 D;  3A8K E;  1EY8 A;  2Q8T A;  2NVX B;  1MI2 A;  3U9S A;  2BDN A;  2R61 A;  3GTL B;  3J80 E;  2F0F A;  3D4R A;  1RTO A;  2E2D C;  4F7X A;  1H9S B;  5KYI A;  5FKA C;  3HG9 A;  3I72 A;  3IFT A;  2O4X A;  3DHQ A;  4IUR A;  2KVM A;  5J22 A;  4DF7 A;  1R4Q B;  4OHJ A;  2O5J C;  1TWG B;  4YIJ A;  4K8J A;  4C1N K;  1TII D;  2G9H D;  3GTM B;  3G6J B;  3S16 B;  2I07 B;  1U4M A;  2RSN A;  2NB0 A;  2IPK D;  3NQI A;  2R7Z B;  2F3V A;  4HTH A;  2A69 C;  4KKU A;  3K5M A;  5C0X J;  1ET6 A;  4C3J B;  4K5X A;  5D65 A;  5JPM C;  3URY A;  2Z8L A;  2SEB D;  4QMG A;  1GHJ A;  5HUR A;  1BR9 A;  4V0B A;  1WD1 A;  4OO1 H;  1CZG A;  2AQ3 B;  2H4O A;  4RFB A;  4A3G B;  1STY A;  1H9J A;  2AQ1 B;  2F4I A;  3AMU A;  3SK6 A;  2SOB A;  3VYR A;  3A8I E;  1FNU A;  1H9M A;  2K5Q A;  1KLG D;  3K0Y A;  3HOY B;  4J8Q A;  4L8J A;  2E74 C;  1SE2 A;  4C3J G;  2EZV A;  1S5E D;  2IX1 A;  3VR2 A;  1SJH D;  5ELC A;  1TS3 A;  5JVG 3;  3VR3 A;  3FPP A;  3DUZ A;  4F87 A;  3BDC A;  2JA6 B;  2CW0 D;  1PTO C;  1NAP A;  4Y7N B;  3V96 A;  2F0G A;  4WOR A;  1SYC A;  2WKC A;  1EEF D;  1U9R A;  1ZYR D;  1RKN A;  1G2T A;  1BOS A;  3WOE A;  2ICI A;  4ZKC B;  1G91 A;  4K5W A;  1SNO A;  3E6Z X;  1HFG A;  1SNP A;  4C3I B;  5BN5 A;  2L0C A;  2M9V A;  1Z7T A;  3PO2 B;  2B2U C;  1TKW B;  2EY6 A;  3OWE B;  5ISR A;  2F0S A;  5CV7 A;  3HOX B;  4FP5 D;  1PYW D;  1F9Q A;  4LK1 C;  1D1K A;  4BS9 A;  4M1U B;  1LAB A;  2N88 A;  2EXZ A;  1F9S A;  1IYV A;  3VYT A;  1PRT B;  3OHX C;  5C3X A;  2PZT A;  1SE4 A;  2AUK A;  5IT9 E;  2IX3 A;  3VR4 A;  1JC7 A;  4C3I G;  2B2V C;  2KED A;  3ZYY X;  3NPP A;  1D2B A;  1STE A;  4PMC A;  3AB9 A;  1I4H A;  2EYO A;  5A35 A;  4ULL A;  5TSS A;  2RDG A;  3A7A B;  1EY6 A;  3LX0 A;  1V43 A;  2MUY A;  2DN8 A;  5I6Y A;  2L5T A;  4IUT A;  5ELE A;  3HGB A;  4X3U A;  4X3S A;  3OIP A;  4Z9C B;  3DXJ C;  5JEA J;  2EE1 A;  2EY5 A;  4HCE A;  1C8C A;  2Z4H A;  2K01 A;  1IW7 D;  1UEA B;  1O7L A;  3PUW A;  4AYB B;  1STH A;  2IJ0 A;  3T13 A;  3H09 A;  1QNK A;  1RHP A;  3T53 B;  3S14 B;  4RGN A;  1SNQ A;  3MXG A;  1SBB B;  4DAV A;  4FYD A;  1I50 B;  3K5O A;  2CW0 C;  1KAA A;  3GTP B;  2MGS A;  5I6W A;  1JE4 A;  3J80 L;  1L0Y B;  1GUW A;  3I70 A;  2WKD A;  3BVZ A;  5JPN C;  2F0U A;  4EQP A;  3LNN A;  3S9W A;  1CK1 A;  1S4Z A;  3C3L A;  4A93 B;  1QB5 D;  1S5B D;  2BE5 D;  2JA7 B;  4EGV A;  1WVL A;  2EYP A;  1RTN A;  3MVV A;  1BCP B;  2JEA I;  1CQV A;  4RGM A;  3MHB A;  4A3M B;  1EY4 A;  1LTG D;  3T56 B;  1SMY D;  4G7O C;  4HN7 A;  1NR4 A;  4OIJ A;  1C48 A;  5JVH 3;  1UUP A;  3I91 A;  3IAY A;  4H0L C;  1SSO A;  2EPB A;  3J81 L;  2K04 A;  4A3I B;  2B2Y A;  2VB2 X;  3SEB A;  2K5W A;  2BDO A;  1B9N A;  2VNU D;  3SHL A;  2IX0 A;  5D3I B;  1WTW A;  2Q8R E;  3I4N B;  3TSS A;  5T1G A;  3O13 A;  1GJX A;  1MD2 D;  3S2D B;  3I8Z A;  1O7Z A;  3Q22 A;  5KEE A;  1LT3 D;  2DY8 A;  1TY2 A;  4QCL A;  3P20 A;  3NBH A;  1AN8 A;  2L12 A;  1DZ1 A;  2HCI A;  1HQM C;  2WIN B;  4X3T A;  4XDX A;  5DAU A;  1JWS D;  4U68 A;  1HA6 A;  4IFD J;  2K33 A;  1IW7 C;  2KUM A;  3T51 B;  3QG1 A;  5EKI A;  1F2L A;  1SYF A;  3HZX A;  1EY5 A;  4BY7 B;  2RDH A;  2NUC A;  3I3C A;  2HUG A;  2X6L A;  3M7G A;  2F0P A;  1LTR D;  5C44 B;  1CT1 D;  4ZAI A;  3W2D A;  1FD7 D;  3E5S A;  5CV6 A;  5CBA E;  1SYD A;  1ZXT A;  1SJE D;  2CHB D;  4U67 3;  5FLX E;  1F9P A;  1QIL A;  4KHV A;  3BYY B;  1GUG A;  2EJF C;  1FYC A;  4BA2 I;  1M4V A;  2F3W A;  3DWQ A;  2BE5 C;  1PRT F;  1F2Z A;  4A3E B;  1TY0 A;  2NN6 I;  1Y8N B;  4FXG C;  2ZT9 C;  2YU9 B;  3VR5 A;  3DWA A;  4IAL A;  1GUN A;  3DEP A;  1NSN S;  1XX8 A;  1OXX K;  2JE6 I;  3D31 A;  3A7L A;  1RF2 D;  1SMY C;  1ENA A;  1TWC B;  3VYU A;  5EBD A;  4QB4 A;  3DMU A;  4A3F B;  2GA4 B;  4FXD A;  1HHV A;  5G3L F;  4CJ1 B;  1EZ8 A;  3M4Y A;  4DU9 A;  4ZLT F;  1BF4 A;  4UDU C;  1KNA A;  4G57 A;  1LT5 D;  4RA8 A;  1DCZ A;  1DON A;  4RHR A;  5IGC A;  2Y0S B;  2ICE C;  5IOC A;  2F0E A;  4ID6 A;  5IIF A;  3S2H B;  2NTS A;  4PMW A;  4R8I A;  2O5I C;  3RLF A;  1E0B A;  5EQ0 A;  2PZW A;  3HKZ B;  5IGD A;  1Y1W B;  1Y8P B;  3MEH A;  2LFN A;  2IT1 A;  5E3F A;  3X3N A;  5E1F A;  1I6H B;  3I73 A;  4RKL A;  3ITP A;  4CGY B;  1B1Z A;  4OIK A;  4LMQ D;  1Q3L A;  2R93 B;  2OXP A;  2NVY B;  1BUV T;  1Q90 A;  1EZ6 A;  1SYB A;  1RJT A;  4N9P A;  1TWA B;  2XWB B;  2XRS D;  3K7A B;  4QUC A;  3H0G B;  4XYQ A;  4TRD A;  3GV3 A;  3UI2 A;  3PIP 3;  2DNE A;  2IW3 A;  2TSS A;  3GTG B;  3K57 A;  3BZD B;  5CBE E;  4NKL A;  2WB1 B;  3LWU A;  3C1F A;  1X3P A;  2OT2 A;  5CR3 A;  1LT6 D;  1JOR A;  1BCP F;  2VUM B;  2F0T A;  2RSO A;  1KLU D;  4DAY A;  4N9T A;  3K5L A;  2QDB A;  2F0K A;  1J8I A;  4G4K A;  1HUN A;  4F88 A;  3CHB D;  1MSG A;  1ENF A;  3DM1 A;  2NYZ D;  4I65 A;  1DJR D;  2EYF A;  1II3 A;  3HEJ A;  4DNT B;  3KLR A;  5A2Q E;  4LAA A;  4UAI A;  1U4L A;  1IKM A;  4L63 B;  4A3B B;  3JAM E;  2HDL A;  1M8A A;  1O78 A;  1DYQ A;  3TZU A;  3RZO B;  3NK9 A;  2JEB I;  3OOC A;  3D6C A;  5C0X H;  2NVT B;  1QE6 A;  3A8J E;  3J7Y W;  1JIC A;  2NN6 G;  2WP8 J;  3E0J A;  5NUC A;  1B4O A;  4B9X A;  4C1N I;  3HRZ C;  1STB A;  3NSW A;  2JA8 B;  4KY6 A;  3MTS A;  3R2T A;  4IN3 A;  1EWH A;  4HR7 B;  3KK7 A;  1EYC A;  3D3R A;  4ZYS A;  1LTI D;  4KV6 A;  1ML0 D;  2X6G A;  1ENC A;  4XIG S;  3GTQ B;  3N52 A;  1SYG A;  2R92 B;  3V2T A;  1V1O A;  3S1M B;  1WTP A;  4IUN A;  1FNW A;  4ZRZ A;  4IFD I;  3P1H A;  4TKO B;  3BS1 A;  4A3J B;  4KKS A;  1A6X A;  2R6G A;  1T5X D;  2K7V A;  4NP5 A;  4RKB A;  2RVL A;  4RCN A;  5C4Z A;  4IUQ A;  5EBC A;  4XQN A;  1SAP A;  1U4P A;  5JEA G;  2B2T C;  4H7B A;  3P7J A;  5I4D A;  2DY7 A;  2CQA A;  5AFW A;  5M3F B;  4L6T B;  1AW7 A;  1EQV A;  2AUJ D;  2L1B A;  2F0O A;  1QJO A;  2L11 A;  1EOT A;  2MP1 A;  1A2U A;  1BDO A;  3NXW A;  1H9K A;  4KN4 C;  4WRD A;  1HQR D;  4C2M B;  5LL6 S;  2NN6 H;  5FOB B;  4HMJ A;  1BBX C;  3OWF A;  2F0W A;  2F0N A;  1V8Q A;  1MBY A;  2PW7 A;  2C9O A;  1NR2 A;  2R3Z A;  4EVO A;  4ZK9 B;  5DM7 3;  2AWN A;  3FKI B;  1DD2 A;  1ICW A;  2HCC A;  3TZD A;  1GUS A;  2EJG C;  3Q23 A;  2D9U A;  3D4D A;  4R9W A;  3AU7 A;  1S5F D;  4HAE A;  2B2U A;  4XT1 B;  5KNB A;  3QOL A;  2Z1C A;  1Y1V B;  1PXU A;  1CA6 A;  1HTL D;  1Q1B A;  2AQ2 B;  4OGQ C;  2O2L D;  3D4W A;  5JEA H;  3OIQ A;  2A6H D;  1EQT A;  2FMM A;  4IUP A;  5COY A;  2J7Z A;  3MAQ A;  1AEX A;  1B9M A;  3R93 A;  2L4N A;  2B2V A;  1Q1E A;  2RBM A;  1SYE A;  2IL8 A;  1EU4 A;  1EY7 A;  1LTB D;  2Z4I A;  2PQE A;  3MXP A;  4ME5 A;  4WFN 3;  1LLR D;  4KK7 A;  2PZU A;  4EQN A;  1I4R A;  3LWE A;  3FPU B;  4XTC S;  4MIU A;  5CV8 A;  5KNC A;  3Q6S A;  1ONL A;  2XVS A;  3PUV A;  1PTO B;  5HGT A;  2RA4 A;  4IFD G;  4BA1 I;  2IWH A;  1PLF A;  1DXM A;  1E2W A;  2XWJ B;  2B2Y C;  1Y8O B;  2K28 A;  1TU2 B;  1WD0 A;  3T4A C;  1STA A;  4RCO A;  2WII B;  4JK1 C;  4DK1 A;  2VB3 X;  3L7Z C;  1CTM A;  5EJW A;  3H91 A;  3TP8 A;  2E75 C;  1OXV A;  1I3Q B;  3RMH A;  4DNR B;  3KLS X;  3I4L A;  4Q0F A;  3FDT A;  3PUY A;  1F9R A;  5CV9 A;  4KD3 A;  1SE3 A;  1ZEQ X;  1I4X A;  1VF7 A;  2HQE A;  3C1E A;  3MFG A;  4A3D B;  4H44 C;  2PNR C;  4HCS A;  1B2T A;  4QIW B;  1NUC A;  3QIA A;  3D6W A;  4DK0 A;  4PQX A;  1JWU D;  5J1Z A;  1HFN A;  1TS5 A;  4G7Z C;  2MPM A;  1IKL A;  1CFM A;  5C5L A;  1IYU A;  2SDF A;  1NCV A;  2JXM B;  3MXU A;  1EU3 A;  1F77 A;  4FXK C;  3CRL C;  5CV5 A;  2L9H A;  2RKS A;  4DXF A;  2RDF A;  4IFD H;  2A6H C;  3OMG A;  3FRP B;  1AFP A;  1UNS A;  1G2S A;  1KTK A;  4QF4 A;  3QJY A;  1KDB A;  3A54 A;  1XYI A;  1RDP D;  4XQQ A;  1GUO A;  2KOL A;  1SEB D;  5EKK A;  5M5X B;  1ZKO A;  2BOS A;  4BWG B;  2E76 C;  3WOF A;  4S3S A;  1HTP A;  1PTO H;  5EGT A;  1J9O A;  3EQL C;  1BXT A;  5K36 G;  2F1M A;  3SE0 A;  2JYO A;  3HOZ B;  5M3M B;  4C56 C;  4K14 A;  2I46 A;  3N6R A;  3IL8 A;  4PMB A;  1SND A;  2KQ3 A;  4V19 0;  3J7A F;  1PRT D;  5IT9 L;  4ABN A;  1CA5 A;  3QWN A;  4BY1 B;  3MFY A;  2J0T D;  1G8Z D;  3R2I A;  3RD4 A;  1OXS C;  2DNC A;  3I4M B;  1PFM A;  3S1Q B;  5I2Y A;  1V1P B;  5G3L D;  1HXY D;  3VA7 A;  2F0I A;  4TQU S;  2X69 A;  1CHP D;  3SK4 A;  4RGO S;  2VXW A;  5BN4 A;  1LT4 D;  5C4X B;  2V4D A;  2NVQ B;  1PZI D;  1BQQ T;  5C4H A;  3VYS A;  3L9A X;  4ODG A;  2EY1 A;  2B2W C;  4BBS B;  4I7Z C;  2K03 A;  3V05 A;  1JOO A;  3NUC A;  4K5V A;  1T5E A;  3TDQ A;  4IQZ A;  3A55 A;  2ID0 A;  5CYU A;  1WTO A;  4Q5V A;  1ESR A;  1GUT A;  4BBR B;  4RWS C;  1FR3 A;  1DOK A;  1K8M A;  1CZW A;  5FO9 B;  4M8A A;  1I6V C;  4K6L A;  2A5H A;  4G7H C;  1JR0 D;  3NP8 A;  3VA5 A;  1H9R A;  1TT2 A;  1E2Z A;  1SDF A;  4XQJ A;  3BDL A;  3BVM A;  1LTA D;  1A15 A;  1OXU A;  1FNV A;  2XRQ D;  3T16 A;  3C2P A;  2XNA C;  4ZUI A;  2NWG A;  1PTO F;  3NHH A;  3EA6 A;  1BCP D;  3P75 A;  3F2U A;  4KJN A;  2XSC A;  5KYL A;  3S1N B;  2E2I B;  3ND9 A;  5ELD A;  1C4Q A;  4O1N A;  3R8B A;  3ERQ A;  1I4Q A;  2F0V A;  5D3D A;  3HP3 A;  3TP6 A;  2QEJ C;  3PMF A;  4NDX A;  1D6E C;  3GP7 A;  5IGE A;  3PV0 A;  1I4G A;  1QWY A;  1STN A;  4CKC A;  4FVM A;  1UAP A;  1PRT C;  3GTK B;  1LTT D;  3FEW X;  4XXE A;  3CU7 A;  3TN2 A;  3R3O A;  1YNN D;  3SR1 A;  4DAP A;  2OEO A;  2FIN B;  2BCO A;  3SK5 A;  4DXG A;  3M4O B;  3NWT A;  3IKJ A;  1F2M A;  5D14 A;  2EVB A;  1HCZ A;  3QOJ A;  2J4X A;  4O42 A;  3HOW B;  3NWS A;  2G9D A;  1KAB A;  2KEC A;  5IGB A;  3OPO A;  2L55 A;  3K5N A;  1U4R A;  4KMU C;  4CJ2 C;  2EJM A;  2E2J B;  3CQZ B;  3TBI B;  5FO8 B;  4F8M A;  5I9P A;  3J81 E;  4CKE A;  1EIH A;  1SNM A;  2B8G A;  2PW5 A;  1G6Z A;  1DOL A;  3GV6 A;  5M9O A;  3BG3 A;  2FHT A;  3OMC A;  1IHZ A;  3A56 A;  3I90 A;  2H1E A;  2K1B A;  1JWM D;  3DWP A;  4ZKB B;  1Q12 A;  4RHS A;  3W3A A;  5FLX L;  1SNC A;  2XN9 C;  2B39 A;  3HOV B;  5EPJ A;  2PPB C;  4KTA A;  1WTX A;  4GZY C;  3ERO A;  2ZXO A;  5C3E B;  1TVX A;  1JQY D;  4MHE A;  1TS2 A;  4CBV A;  5C5M A;  5C4J B;  1BCP C;  3OSO A;  2CVR A;  5J39 A;  5IOD A;  2A68 C;  1HPC A;  3L3O C;  4J6H A;  2K05 A;  2MJ8 A;  3KBX A;  5JJZ A;  1XWE A;  4HMI A;  1TS4 A;  3VR6 A;  3NTH A;  1EYA A;  3H94 A;  4FF3 A;  4LJZ C;  3NE5 B;  2JP1 A;  3U9O A;  2D5D A;  1Y69 U;  3PO3 B;  2B2T A;  1GHK A;  1EWC A;  1D5Z C;  3MC0 B;  1Z6H A;  1X3Q A;  1D5X C;  4HED A;  3BYT B;  2K32 A;  4KHZ A;  1YNN C;  2TMP A;  2B8F A;  4B9W A;  5K5P A;  1EL0 A;  4H13 C;  2F03 A;  3HOU B;  1PZK D;  2NTT A;  5I2X A;  2C5C A;  4CJ0 B;  3QB3 A;  4FF1 A;  1VMC A;  2PCF B;  1WCM B;  2BA0 A;  1ILQ A;  1AZQ A;  3NBI A;  1TWF B;  1AZP A;  2EDG A;  4EQO A;  3S1R B;  1Z47 A;  1R4P B;  3X3M A;  1QOH A;  1G29 1;  5CGK A;  1F2Y A;  1DOM A;  1X32 A;  1K8O A;  3KUP A;  1OO9 B;  4E6I A;  3CRK C;  1S5D D;  3SDZ A;  2QF7 A;  1K83 B;  2EY2 A;  2FMC A;  5BN3 A;  1PFB A;  2PO4 A;  2D2C C;  1A2T A;  4HSV A;  5KGU A;  3S17 B;  3TME A;  4KY5 A;  4IUV A;  1TR5 A;  2Q8I B;  1EY0 A;  2SNS A;  4KN7 C;  4ILW A;  4DFA A;  2LY7 A;  4A3K B;  4DGZ A;  2F0H A;  1B3A A;  4OL7 A;  2NBF A;  4KJO A;  2YYZ A;  1R9T B;  1Q8I A;  1BO0 A;  5EPL A;  5JAV A;  1A3V A;  3HS0 C;  2JA5 B;  5C3W A;  4CKB A;  5C6A A;  2EOT A;  3QO2 A;  5A2Q L;  1O7Y A;  2JSO A;  4PV1 C;  2QKI C;  1GOZ A;  3JAM L;  2K6A A;  3WDN A;  1ZYR C;  1ET9 A;  3RZD B;  4PNY A;  3M3Y B;  1HA5 A;  3PUZ A;  4P2C B;  5KRU A;  4IUU A;  1AP0 A;  5DM6 3;  1YNJ D;  1PZJ D;  3M7N A;  4IZ8 A;  3IFD A;  5KIX A;  5ELB A;  2E2H B;  1SFO B;  1GXD C;  3Q24 A;  1W6K A;  3EVQ A;  3OW7 A;  1LO5 D;  5CC4 A;  3CKI B;  2K5D A;  2KHS A;  4MN3 A;  5DNF A;  3MA2 B;  2N55 A;  4QUF A;  1HUM A;  3PIO 3;  5M5Y B;  1QCB D;  5F2D A;  1V1P A;  4XYO A;  1XTC D;  5EKL A;  1IL8 A;  3GQB A;  1HRJ A;  3SK8 A;  5T1I A;  1B44 D;  5IGG A;  1WTV A;  3FMC A;  3GD7 A;  1MSH A;  2ZXP A;  1JB3 A;  4DA2 A;  4TSS A;  1KNE A;  1MGS A;  5EPK A;  4ZQ3 A;  4XT3 B;  5C0X I;  3NQT A;  2ZXR A;  3DEO A;  2D62 A;  4OO1 I;  1WTQ A;  1VMP A;  4WJW A;  5M5W B;  1O80 A;  2BA1 A;  1LV9 A;  3G7L A;  1LAC A;  4FO2 A;  5ELF A;  3MWY W;  2AWO A;  2LS0 1;  1PFN A;  3K58 A;  1STG A;  2ENB A;  2KEE A;  1B50 A;  1KDC A;  2FJ2 A;  2MHV A;  5E4X A;  4NMZ A;  1RD9 D;  2A6E D;  1A3T A;  1PDQ A;  1I4P A;  2QIL A;  3D8G A;  3BDO A;  4R8N A;  4FF2 A;  2KA7 A;  5KND A;  3NTI A;  2KJX A;  1VF5 C;  1FGB D;  3Q0A A;  2OF1 A;  2RQX A;  3TP7 A;  1PMR A;  4KKT A;  5LL6 X;  3MXN A;  2SNM A;  3GTJ B;  2A74 C;  3H6M A;  2QCP X;  1ESF A;  3MZ5 A;  3K6O A;  4X3K A;  4KY7 A;  4K2K A;  3KLS A;  4KD4 A;  1EEI D;  1QG7 A;  2XIW A;  1CI3 M;  2F0L A;  3H3V C;  1A3U A;  1S5C D;  2M00 A;  4HSP A;  1LTS D;  3KF8 A;  3PUX A;  5FO7 B;  1EY9 A;  3SVM A;  1B53 A;  3ONA B;  1SXT A;  3J7A V;  4K6D A;  4DN4 M;  1YNJ C;  3GO5 A;  1E2V A;  1EYD A;  1XXG A;  1EIG A;  2WV6 D;  3RUZ A;  4C3H B;  5LHY 1;  1W6J A;  2F0J A;  2PYK A;  1CM9 A;  1ROD A;  1H9S A;  2A69 D;  1JOK A;  2LKV A;  1D1I A;  1VDZ A;  1EFI D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...