1SNCA

The crystal structure of the ternary complex of staphylococcal nuclease, ca2+, and the inhibitor pd*tp, refined at 1.65 angstroms
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (phosphoric diester)
molecule keywords THERMONUCLEASE PRECURSOR
publication title The crystal structure of the ternary complex of staphylococcal nuclease, Ca2+, and the inhibitor pdTp, refined at 1.65 A.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1989-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sncA00
1ENCA 3T13A 1F2YA 2EYOA 3NHHA 4K8JA 4KY5A 4ODGA 2KHSA 2F0IA 2EYHA 2F0EA 5CV7A 5JOBA 1TQOA 3D8GA 4DFAA 4RKLA 1NSNS 3DHQA 4DF7A 3E5SA 5J22A 3SK8A 2F0TA 5CC4A 4ZQ3A 1SNMA 2F0FA 2HQEA 3P1HA 5EGTA 5KEEA 1EY0A 1EY8A 3S9WA 1SYCA 1AEXA 5IOCA 4LAAA 4S3SA 5JAVA 2ENBA 4K5VA 5HURA 2RDFA 1JOQA 4B9XA 5DAUA 3TP7A 5KYLA 1KDCA 3SK5A 1A3VA 4PMCA 5I9OA 1IHZA 2KQ3A 3SK4A 2O4XA 4KV6A 1JOOA 3C1EA 2F0WA 5IGEA 3EROA 1A3UA 4K8IA 2EY1A 4IALA 1EYAA 4KJNA 3NK9A 4PMBA 1NUCA 3BDCA 3TMEA 3EVQA 3HEJA 1A2TA 3ITPA 4ID6A 4KD3A 4B9WA 3NUCA 2F0LA 3DMUA 4K5WA 3QOLA 2SOBA 1KABA 5I6WA 5J39A 5CV8A 5E1FA 5CR3A 2F0NA 3EJIA 3MXPA 3T16A 4KY6A 4IZ8A 1TT2A 3U9OA 2SNMA 4DGZA 5CGKA 5C6AA 1EY7A 2F0UA 4TRDA 5CV5A 4F8MA 4QF4A 3RUZA 5KRUA 2F0VA 1JORA 4WORA 4N9TA 5IGFA 3SR1A 2F0SA 3SK6A 5I6YA 5K5PA 5ISRA 1EY4A 2EYPA 4K14A 5EKLA 2EXZA 4WRDA 1F2MA 5EKKA 5C4ZA 2F0JA 1SNOA 2F0DA 4KD4A 1SYGA 1EY9A 4OL7A 1STAA 1JOKA 4KJOA 1SNDA 4H7BA 5KIXA 4K6DA 3SXHA 4F7XA 1STBA 2F0PA 1STYA 5C5MA 4MIUA 2RBMA 3LX0A 3NP8A 4IUNA 2PZTA 3HZXA 1A2UA 2F3VA 4EVOA 2EYFA 2PW7A 1A3TA 1SYDA 4K2KA 2EY2A 3OMGA 4N9PA 2PZUA 2OF1A 4QB4A 4ME5A 3SHLA 5M9OA 4PNYA 3OSOA 1EQVA 1STNA 2EYJA 1EYCA 1SNQA 2RKSA 5HGTA 5I9PA 5C3XA 2EYLA 3D4DA 3H6MA 3P75A 4HMJA 3TP8A 3NXWA 4NP5A 2F0QA 1EY6A 4R8NA 1F2ZA 1KDAA 1SYEA 4K5XA 1SNPA 3NQTA 1SYFA 5IGBA 3ERQA 5J1ZA 5NUCA 1SYBA 4ZUIA 5C5LA 5DEHA 2EY5A 4NDXA 4NMZA 3D6CA 2F0GA 2WACA 3OMCA 4G57A 1ENAA 4K2LA 2EY6A 1EZ8A 2QDBA 2OXPA 5IIFA 1EY5A 4I65A 1TR5A 1EZ6A 4ZUJA 4YIJA 5CV6A 5CV9A 5E3FA 3V2TA 2PZWA 3C1FA 3MVVA 4KHVA 4EQPA 2M00A 3PMFA 4J1MA 2F0OA 4RKBA 4EQNA 4QMGA 3BDLA 5F2DA 5IGGA 1U9RA 4KY7A 3OWFA 3QB3A 4KTAA 3TP5A 4E6IA 3MZ5A 5C3WA 1RKNA 1KAAA 3R3OA 1KDBA 2F3WA 2F0KA 1STGA 2F0HA 3VA5A 4EQOA 3TP6A 5IGDA 5IODA 5KYIA 2PYKA 2EYMA 2NUCA 2SNSA 2LKVA 1II3A 2PQEA 1STHA 3D4WA 2F0MA 4DU9A 5CV4A 4HTHA 2PW5A 1SNCA 3MEHA 3QOJA 4NKLA 5C4HA 5KGUA 2OEOA 3MHBA 4J6HA 5IGCA 4HMIA 1EYDA
chains in the Genus database with same CATH superfamily
4OHJA 4A3KG 3PQIA 5ELBA 4Q0FA 2A8VA 1SAPA 1DD2A 1EU4A 1K3BC 1BR9A 3CPFA 4AQYL 1PH3A 4B3MQ 2ZJPA 2G9DA 2BA1A 1Y1VB 2L55A 1JOQA 1ASYA 3U4VA 5KYLA 1Q82C 2CW0C 3AEVA 1NAPA 2K01A 1LT5D 2FJ2A 2JE6I 4DNIA 2YTVA 3NK9A 3JAMc 1DOKA 1EQQA 3PO3H 5D3DA 2B2TC 5BN4A 1EOVA 2F0LA 3HOWG 2SOBA 1VQMA 3EJIA 2WP8J 5K36H 2EOTA 5BR8L 3RD4A 2RDGA 1SNOA 3EA6A 3VYTA 3A55A 3KBXA 3OIQA 2K5HA 4FNFA 1Q1EA 3MAQA 2NVTB 1STBA 3NP8A 1PLFA 5C3EH 2WKDA 3CP0A 1GKHA 2EYFA 4DR3L 2OQ0A 4JC0A 3SHLA 1IBKQ 1LLRD 4J15A 3STBD 1ET6A 1GUOA 1V1PB 4G7OC 3QO2A 1OXSC 1F2ZA 1SSOA 1E24A 3NQTA 1WCMH 4ZAIA 2IPKD 3Q22A 1HR0Q 4ZUIA 4NDXA 4GKKQ 2BH8A 2G5DA 1KC8C 2R6GA 1ENAA 3KOJA 5EBCA 1EQRA 2O5IC 4H13C 4JI1Q 3S14H 5FLMH 1B1ZA 1FNWA 3MC0B 5LMNL 1PH5A 4LF8Q 1WD1A 3AQQA 4RKBA 3QB3A 5C3WA 3S15H 2AWNA 1ICWA 5KYIA 2NUCA 1DONA 5HGQA 1EWHA 2QILA 5C4HA 2NN6I 4GKJQ 4DU9A 1K28A 2ZM6L 4DF7A 3QR8A 3GP7A 1VQCA 1TY2A 2HQEA 4LF5L 2R7DA 1BKBA 1UE5A 5HURA 5KNCA 2L9HA 2K75A 1KNAA 2JA6G 1KDCA 5GQOA 1C4QA 4PMCA 3OHXC 3VR5A 1LTID 2N78A 4L8JA 1F9RA 3S17H 4JI3L 3SDZA 1WTWA 1NUCA 3T1HQ 1Q7YC 2A74C 2RDHA 1LTSD 1J6QA 1K3RA 2K04A 2PQAB 3KF6A 1LUZA 4A3MG 4IPHA 4JI4Q 1HHVA 4U68A 3H0GB 2A6EC 5I6YA 2EYPA 3CXCA 2DGYA 5EKKA 1GUWA 4C3JB 4KKTA 2O2LD 3CQZH 4A3BH 4LWCA 1WTPA 1QNKA 4OIJA 1SJED 2FFKB 5C4JH 3HOYH 1FGUA 2PZTA 3LNNA 1A2UA 3ONAB 4EVOA 1FL0A 4A4IA 5BN3A 3RNUA 3OIPA 2JA5G 1MHWC 4N8X1 3M4OB 5CBEE 4RGOS 2EYJA 1EYCA 2RKSA 2DJFC 3D4DA 1CK1A 3NE5B 1BOSA 4HMJA 1XYIA 3H91A 3I72A 5ELFA 4F88A 1SNPA 1TWGH 3UDIA 4B3TL 3ZYYX 4CKBA 3VDYA 4C3IB 1YJWA 3T53B 4A3DB 1XNQQ 3KDFA 3S1QB 2B2VA 3MEFA 3TZUA 1EFWA 1Z7TA 4MNOA 4I65A 3E9IA 3HKZB 1YHBA 2ZTCA 5AFWA 3VR2A 2E2JH 3PMFA 2L1BA 4P72A 3TS0A 3BZCA 3W3AA 4IURA 3G6EA 2F3WA 4IFDH 2RHQB 2IW3A 1D5MC 5EKIA 2B2YC 2LKVA 5M3MB 1NR4A 4HEDA 2OEOA 4J6HA 4BBRG 4BY7B 3I3CA 4RKLA 4IUUA 2UXBQ 1X54A 4FF3A 3E3XA 5CV7A 3CCLA 4R4CA 1F2LA 4A3FB 5CORA 1A8VA 1EY0A 2VQFQ 1I4RA 3S9WA 2K5QA 3M4QA 2A68D 2QGQA 2ENBA 3R2TA 4LFCQ 2D62A 2Q2IA 1E2WA 5I9OA 2O4XA 4YWKA 3URYA 4X6AH 3P20A 4P75A 1OXTA 4DAMA 1BQQT 5IY0A 4A76A 3I4LA 4RG1A 5IE8A 1Y1WB 3W2DA 4JBMA 5FK9C 1LTTD 1CFMA 4QIWB 1A63A 5CR3A 3T56B 4IUQA 4IZ8A 5FLXE 1LT3D 4ABNA 3S1MB 3FRPB 2NVTH 4BXXG 3PUYA 4UY8C 5K5PA 2AMCB 2LXJA 3DM1A 3ND9A 4P73A 4PZ6A 4DR4L 1SDFA 1HNZL 2F0DA 3FMCA 4LUVA 3TSSA 4DV4Q 1A0IA 3EBEA 4O2DA 4LF7L 3S16B 3L9AX 1IBMQ 1HA5A 4DV3L 2JA7G 1SYDA 1N33Q 3GQBA 4C2MB 3DXJC 2PZUA 4JI6L 2PI2A 1RIPA 3QIAA 4ULLA 2FHTA 1KXLA 5JJKA 3C3LA 4NP5A 4NXML 1SYFA 2B2VC 3VR3A 3NEMA 4JBKA 1T5EA 2RQXA 1YNJC 2LXKA 1IXRA 3PUWA 5BN5A 4WJ3M 2UXCL 1HFNA 2QDBA 2K28A 1FVIA 5FOBB 4YIJA 5CV9A 5E7NA 2E2IB 2IWHA 3F2BA 3KYHC 4DV7Q 3BDLA 3DUZA 1QB5D 5G3LD 1I4PA 5JEAH 3TP6A 3VYUA 2NZHA 1FR3A 2BCOA 3T1YQ 1Q8KA 2HHHL 3QOJA 1J8IA 1MGSA 4OEMB 3GTQB 2XRQD 3T13A 2NN6G 3PO2G 1TWAB 4K8JA 4X62Q 4X64Q 4NXNL 2EYHA 2NB0A 4X3SA 3H09A 5CC4A 1TXYA 5ELOA 1G6ZA 1EY8A 1HTLD 3ND8A 1Y8PB 2QEXA 5IOCA 4LAAA 3KDFB 1GJXA 2XGTA 4RHRA 4CDFC 1RL2A 1I5FA 3G48A 1U4RA 1Z9FA 3DWAA 4LF6L 1GXDC 1JOOA 4AIMA 4IFDI 3CCEA 4R9WA 5G3LF 4KJNA 5FKAC 4JI5Q 3MXNB 4XYOA 3H0GH 1N34Q 2ES2A 2AWOA 3EVQA 2I5LX 2JK8A 3ITPA 1LO5D 2IX0A 1Q12A 4C3JH 4FO2A 3CU7A 4FYDA 2JA8B 2J7ZA 3H3VH 4DR6Q 2F0VA 5JPNC 1WTOA 4YWMA 1AZQA 3I2ZA 5DM63 1YHAA 4KHPQ 2VNUD 3TDQA 1VQKA 1EU3A 2PMZB 4JBWA 3GTPB 5GADC 1SR3A 5KNBA 1OXUA 1RHPA 1WYDA 4DV6L 2EXDA 2I46A 1RJTA 4RCNA 3M4YA 2WAQB 2AHOB 2KBNA 3U50C 5C44B 2OF1A 4FP5D 3PO3G 2RSNA 4C3IH 4DK0A 1S5BD 4A3DH 2OT2A 3S1QH 3T4AC 4AYBG 3TP8A 3J7A5 1VQBA 4LK1C 4K0KL 5K36G 4LF9L 2OTJA 2KJXA 3UDXA 2E74C 3A5UA 2DNEA 1WOCA 3CKIB 5AJ3Q 1EY5A 4ZUJA 5IT9L 1VQ9A 5M3MH 1IW7D 3X3MA 4XDXA 1RTOA 3JAMi 4YCVA 4BY7H 2XVSA 5C3EG 1VQPA 2F0KA 3CPWA 1PYSB 5IODA 2YU9B 1BNZA 4JYAQ 1JWMD 1II3A 4DUZQ 3N52A 4B3SQ 1TS2A 4NB3A 4OX9L 2Z4HA 5KGUA 3Q0AA 4L6TB 1JJCB 5ELCA 4AYBE 1KHIA 1WCMG 3RLNA 4DFAA 2NBFA 3OTOQ 3EIVA 4HAEA 1B9NA 5J22A 4BA2I 2K03A 3P1HA 3D3RA 2NWGA 4Q5VA 1VQ4A 3PV0A 3E0EA 5JAVA 4JI7Q 5FLMG 3HOZB 2BOSA 5DAUA 3TP7A 3A56A 1Y1WH 3CHBD 3DWPA 4XYQA 1S5CD 1IHZA 2FXQA 1YNND 2R92H 4CJ2C 1V1OA 1XPRA 2V1CC 1BXTA 1O7IA 1SJHD 3EROA 2VUMB 2HDMA 4IOCA 3S1MH 4YY3Q 1X3EA 1PFNA 4KD3A 4X66L 2ZTDA 1K9MC 2F0NA 1K0RA 2HIVA 4ZK9B 1X3GA 2SNMA 3KLRA 2GVAA 4IQZA 1TVXA 1GM5A 4GKKL 3SK6A 2BA0A 3S16H 2DJGC 3K59A 4B3RL 2MHVA 4IPDA 5EPLA 2AKWB 4C2MH 3BYTB 1NBWA 4YCUA 4L5SA 4F7XA 1RTNA 2ICIA 3HOXB 2R93B 1QOHA 2PW7A 2H4OA 5FJ8H 4ZLTF 5IYBH 2ZTEA 2TMPA 1K83B 1D5XC 1FJGQ 2I5HA 4GKJL 1CKNA 2Z4IA 1DOLA 3H3VI 3NTKA 1H9JA 2A69C 4R8NA 3TEHB 1Y8NB 1AW7A 4BY1B 2EJGC 2K32A 1QILA 1MKHA 1I6HB 2E2IH 5C5LA 1B3QA 4TSSA 1HNXL 1B4OA 3M9BA 3PUVA 1I4XA 2OXPA 1CKOA 3V2TA 4A3BG 5TSSA 2CW0D 4KY7A 1LTLA 4QGUA 4E6IA 3TP5A 3CD6A 3HOYG 3GTQH 5C0XH 3CMEA 1TWAH 3KJPA 3K0XA 3TS2A 3I8ZA 2PYKA 2N8NA 3CCUA 5JJIA 2EZVA 1PXUA 1TWHB 5DM73 1HJPA 1STEA 1HH2P 5DNFA 4ME3A 2XWBB 4DR5L 2E8GA 4DK3C 4TQUS 1TKWB 4CBVA 3AB9A 4A3EB 4XQNA 4S3SA 2B29A 4EGVA 1NMFA 4MTNA 3SK5A 1SBBB 3RR5A 3X3NA 3E9HA 2JA8H 4IFDG 1JMCA 1MSGA 5I4DA 1EL0A 5I6WA 5E1FA 1XPOA 1B44D 4UP7A 2KENA 1NE3A 4HIMA 5T1GA 1BCPC 4I7ZC 1E0BA 2F0UA 1PZKD 1CA5A 2LY7A 3G71A 3GTPH 4LFBL 4G7ZC 1XNQL 4A3JG 1SEBD 2EXZA 2F1MA 1PHJA 3A74A 4PMWA 2RHSB 4DR7Q 1VS0A 3I4MB 1G6PA 1RDPD 5C44H 1SNDA 1RCVD 3SXHA 1BBWA 5JEAJ 4MIUA 2RBMA 2B39A 2K50A 2JEAI 2EY2A 3A0JA 4PNYA 3PIO3 2KECA 1SNQA 5GAGC 3M7GA 4DV0L 2MNAA 3G4SA 1D1IA 3GTMB 4JI8L 3NXWA 1XNRQ 4Y7NB 4LMQD 4ZYSA 4GNXA 4YHHL 3JAME 2EY5A 2VY3A 2VQFL 1VF5C 2D0PA 1Z6HA 3S24A 5IYCH 2EY6A 1EIYB 3VR4A 1BCPB 1TR5A 4V190 4RAUC 2B8GA 3MXUA 1MJEA 4IOAA 4EQPA 1CSQA 1VQJA 1N32Q 1VQLA 4GN4B 2KCNA 2F4VQ 3HP3A 2PQEA 1W6KA 4C1NK 4HR7B 4HMIA 2QCPX 3DEOA 1WI5A 3G6JB 5A2QL 1KRSA 3WDNA 3BVGA 1CKNB 1TY0A 5T1IA 3LWUA 4QY7A 1C7YA 5ELEA 2CWPA 4KI0A 3I4NB 2A6ED 3L3OC 3I90A 4OGQC 1ZXTA 2KEDA 3GV6A 2B8FA 3OW7A 1P8LA 3LWEA 1JR0D 1PVOA 4RA8A 1N36Q 5C0XI 2CQAA 2F0WA 2OTLA 2N88A 1PMRA 1EYAA 5JEAG 3NWSA 4PMBA 2B2YA 1JE5A 4BA1I 3A7AB 4KN7C 3HOVG 3QOLA 4JVZA 2UUCL 2AUKA 1DJRD 3T16A 1FNUA 3MA2B 1B53A 4TRDA 3EN2A 2A6HC 2NVYB 4X65Q 4DR1Q 4JI2L 1A15A 1CUKA 3HOXH 2R93H 1L0WA 4DV2L 4PZ8A 1B50A 1K83H 2F0PA 2VB3X 2Q8RE 3W5OA 3HZXA 4DAPA 2VQEQ 2E5LQ 4BY1H 1D2BA 1GHKA 2CH4A 3S2HB 3NBHA 3T1YL 3RN2A 1I6HH 4M1UB 4N9PA 4GNXC 5M9OA 1U4MA 1XX8A 1EIFA 4DKAC 2EYLA 4BWGB 3I7FA 4C3JG 1IBLQ 3RLOA 1EY6A 3W1BA 2AUJD 1ILQA 1PYWD 2C9OA 1SN8A 3NBIA 3M4PA 1WVLA 1SLJA 3CCSA 2JP1A 1B7YB 1I4HA 3BZKA 4HSVA 1GD7A 2L4NA 1QZHA 4P74A 1JC7A 1NR2A 3V96A 1RKNA 2E2DC 4EQOA 1VQIA 3AMUA 1VQ7A 5M5WB 2JYOA 3S1RB 4RH6A 4C3IG 4A3DG 2UXDQ 3C2PA 2R7ZB 4CDCC 2BDOA 2KCCA 4A3EH 4XIGS 5COYA 1EYDA 4DAVA 1YITA 3FEWX 4FXKC 4LFAQ 4KN4C 1Z47A 4GN5A 5LMUL 4HIDA 4XXEA 4GNXB 4H44C 3J7AF 4KHPL 2J0TD 3FPPA 4L5QA 1ILPA 3GTKB 1SMYD 4DN4M 4C1NI 1ICFB 1WJJA 1HQMC 1XMQL 5M3MG 2UUBL 4AQYQ 3S1NB 2CWAA 2KQ3A 4TKOB 4BY7G 3P7JA 2NYZD 2ID0A 1R4QB 1Y1VH 1O7YA 1O78A 3SVMA 3I4MH 3J80L 1N8RC 1LM0A 4I7AA 4F8MA 3OYYA 1C9OA 4UP9A 2MQHA 3OWEB 1CHQD 2B2WA 1RD9D 4A3GG 3A8KE 3UE1A 5AJ3L 2CFMA 1YNJD 3LGJA 2ICEC 1J5EL 5BR8Q 4RCOA 1PDQA 1Y1WG 2A5HA 5KIXA 1QUQA 1KD1C 3K81C 5H1SE 3GTMH 2R92G 2EJMA 4JYAL 3M3YB 2QEJC 2I5MX 4DUZL 2Z6BA 3BVMA 1ESFA 1E2ZA 4HCEA 1EQVA 3I4OA 5HGTA 2NVQB 1G2TA 5C3XA 1YEZA 1NY4A 1QVFA 3PF5A 1K0SA 4DR3Q 1D5ZC 2FMCA 4RGNA 4LF4L 5ELNA 4DV1Q 3FPUB 4A93B 4QCLA 1AE2A 3K5NA 1AH9A 5C4XB 4CDEC 3NENA 3OMCA 3JC66 1FNVA 2GVBA 2ZXRA 3UDFA 4EX5A 1EOTA 5IT9c 4DR2Q 3U58A 1X65A 2AQ2B 3BJUA 4KHZA 2A19A 4X3UA 3K5OA 4BBSG 3D0FA 4QIWE 2WIIB 3KLWA 2NVXB 1STGA 2JEBI 3E0JA 1S5ED 2ZXOA 3HG9A 5FJ8G 4GOPA 5IYBG 1I4GA 4JBJA 3D4WA 1ZYRC 5CV4A 3I4NH 2C35B 2D2CC 3NBHB 1Y69U 3KF6B 3ULPA 1X6OA 2L15A 3D6WA 3K6OA 2MO0A 5IT9E 5EAYA 4ODGA 4CHTB 4IUTA 5M3FB 4TVAB 4PG3A 2PO4A 3J7AV 2QA4A 4R4IA 3I73A 1V1QA 2JA7B 3PIOA 1B8AA 4JV5Q 2ZM6Q 1CQVA 2FINB 2L11A 4K5VA 3GTJB 1T9HA 4B9XA 3KFUA 4LUZA 1R4PB 4CJ0B 3J81L 1S40A 2K4KA 2K7VA 4LF5Q 1Q1BA 5C0XG 3C1EA 1G91A 1CKMA 1GUNA 3HOUB 1LV9A 4XT1B 3TMEA 2NVYH 5FO9B 3ULJA 3F2CA 1UEBA 1HZCA 3DWQA 2B2WC 1PFMA 5CGKA 3U9OA 4JI3Q 5C6AA 2K5VA 5LL6S 1ZEQX 2Q8IB 1AZPA 3PUZA 3RUZA 1MJCA 2UUAL 1HFGA 1C0AA 4DUYL 4U673 3K57A 2EE1A 2B63B 3S2HH 4MHEA 1VQOA 2VZAA 3GTOB 1JOKA 1CZGA 4H7BA 3M7NA 3I91A 3PO2B 3K58A 2JA8G 2JJQA 3OMGA 2BE5C 1MD2D 1XPUA 1CQFA 1U5KA 1GO3E 4OO1H 4BS9A 2K1BA 4MN3A 2RVLA 1O7ZA 4NMZA 1JB7A 3M4OH 1I94L 2KCMA 3CMAA 4B3TQ 2B2UA 5M5WH 3S1RH 2WAQG 2MO1A 2JXMB 1HNWL 5IP9H 1HZBA 2R7ZH 1VCIA 4GOPC 2HIXA 1PRTC 4DK6C 1QUQB 3GTLB 5FLXL 2XTIA 3R3OA 2RCFA 1G51A 2KEEA 2PCFB 2SNSA 4OWTB 3R2IA 1CTMA 3G7LA 1BBXC 3GTKH 5IGCA 2WB1B 4DV5Q 4B3ML 4DXGA 3NHHA 1P16A 4A3IB 4J8QA 2PMZE 1D8LA 4FF4A 3HRZC 3S1NH 2F0TA 1HUMA 2F52A 2K14A 2WV6D 3QWNA 1VMPA 2KCTA 4CDDC 2D9UA 4O1NA 3RZOB 2N55A 2EIFA 1DCZA 4AYBB 3L7ZC 2WAQE 4IJHA 4QQBX 2QF7A 1CSPA 2UU9Q 2DN8A 4A3FH 1GHJA 2Y0SG 4K8IA 3GD7A 4OELB 1J9OA 1DXMA 5D65A 3ULLA 1C48A 1TU2B 2BH2A 4IN3A 1L2FA 2X6LA 5EPJA 4GOPB 2F4IA 1PRTB 5CV8A 2JQOA 4KY6A 4PQXA 1YI2A 4QF4A 2L5TA 3CCRA 2H1EA 4WORA 3GO5A 4M8AA 2DY8A 5EKLA 2ATWA 2F0JA 1CT1D 3M3YH 1EY9A 4R4OA 1VQAA 3PUXA 4KJOA 2E2HB 2NVQH 1IBKL 1HNZQ 5LL6X 1SXTA 5I2XA 1LTBD 1VDZA 4P2CB 2N3SA 4A93H 2Y0SE 4HJ5A 5C4XH 1NNXA 2ZJQA 2Z6KA 4LF7Q 2KOLA 1STNA 1HR0L 1VQ6A 2VXWA 1IYVA 3J80i 4CKCA 1MIUA 4DV3Q 1D6EC 2F0QA 1KDAA 4JI1L 2E75C 4JI6Q 4XQJA 1ZKOA 4F87A 2B2UC 3O13A 3S15B 4LF8L 1VQ8A 2F0GA 2PPBC 3S2DB 3CF5A 4HJ8A 1DM0B 1K8AC 4FF1A 2R93G 5FO8B 4NXMQ 3T51B 1PH2A 2NVXH 4IFDJ 3DM3A 4DA2A 3RZDB 3KLSA 3D31A 5CV6A 1LABA 3R8BA 3E6ZX 5E4WC 4DNRB 3J81j 1U9RA 2UXCQ 4X3KA 1R9TB 3BYYB 4APVA 3BS1A 4L5RC 1SROA 3Q6SA 1YJ9A 4BY1G 1S5FD 4RGTA 5M3FH 3HS0C 2EPBA 1SNCA 4JI0Q 3MHBA 1D7QA 4OO1I 1VQNA 1ENCA 1JCKB 1TS3A 1NJIC 2F03A 1I3QB 3GTJH 4LUOA 3CAMA 5IYDH 1BCPD 4DR1L 1TQOA 1ET9A 4A3LH 2EQSA 5KEEA 3MFGA 3L2PA 3HOUH 1I4QA 3FKIB 1HA6A 1SFOB 3T1HL 2R61A 4ALPA 5J3BA 4H0LC 3SK4A 5A2QE 4V0BA 1WTXA 2VQEL 2ALYB 1A3UA 4LW1A 1TS4A 4C3HB 4JI4L 4IPCA 4ID6A 1B3AA 2QKIC 3DMUA 4K5WA 3A7LA 1PA6A 4MZ9A 3VYRA 2Z9HA 1I6VC 1B9MA 2B63H 3FHWA 4Z9CB 3GTOH 1DZ1A 1PV4A 4L63B 5C4JB 1WTHA 3HOYB 1HQRD 2F0SA 4HJ7A 4QUFA 1B2TA 4FDBA 5IWAQ 1JJGA 2ASBA 3H15A 3UE0A 1PTOC 1CM9A 1HUNA 1SYGA 1QNUA 1VQDA 2ZT9C 3J81i 2Z6KC 2L0CA 1AE3A 1UAPA 3Q24A 2EVBA 3CC7A 1KQSA 3GV3A 3K8AA 3GTGB 3PIP3 4ME5A 4ZRZA 1Y1VG 4DV6Q 2XNAC 1O80A 1I50B 1SE3A 1LT4D 3P75A 1TIID 1MI2A 1E3PA 3UDGA 3I4MG 4DPGA 5IGBA 3ERQA 2IHFA 2EDGA 2YTYA 1X56A 4B08A 1XJVA 4POGA 1EFID 1EWCA 4FVMA 2HT1A 3GTLH 4K0KQ 4LF9Q 5HY6A 2CKZB 5D14A 4A3KB 1UEAB 3KK7A 1V43A 2RF4A 1MSHA 4RWSC 2DNCA 3SGIA 2I0QA 1X9NA 4O42A 1PTOB 4A3IH 4A3JB 2UXBL 1YBYA 2H5XA 4FXDA 3ERSX 1A62A 4CJ1B 1L1OA 2K5NA 1H9SA 4JW0A 3RZOH 5JOBA 1HTPA 3D8GA 2DY7A 4LFCL 4OX9Q 3RMHA 2YU9H 3J7YW 3E5SA 2A6HD 3NTIA 3HOWB 3CCMA 5EGTA 3K80C 4PV1C 1O7LA 2X69A 1BDOA 2IX3A 3IKJA 4NPSA 5LMNW 5EBDA 3RN5A 3J7ZC 1KL9A 4HJ9A 1RF2D 1HZAA 2XRSD 1FD7D 4HN7A 3K5LA 3CRLC 1SRUA 2KHIA 3BDCA 3TN2A 1Q90A 3HOZH 3I4NG 4QJFA 3CRKC 5M5YB 3J80c 4FF2A 1OTCA 4DV1L 5JJZA 4DGZA 2CCZA 1A6XA 3MTSA 1UE7A 2E2HH 4DV4L 1Q81C 3SR1A 2VUMH 4WFN3 1LTAD 4X66Q 1F2MA 1XTCD 3FVQA 4LJZC 4XTCS 4AH6A 4DR2L 1IBML 5LHY1 4OL7A 2MGSA 1DYQA 1W6JA 4NW2A 1M4VA 1N33L 1XTDA 2VL6A 4UHVA 3MFYA 4B3RQ 3F1ZA 3J80E 2F3IA 2F3VA 1E1TA 2M2LA 1VQEA 2IHEA 1IZ6A 1PH7A 4N8FA 2K33A 3WOEA 2B3GA 3S2DH 3QG1A 1E1OA 3HGBA 4WJWA 3WWVA 3GDEA 2RSOA 2NTSA 4K5XA 3RZDH 1XMOQ 1PZID 5NUCA 1RODA 1E7ZA 4JV5L 2WACA 1VMCA 4DV7L 1R9TH 3H3VC 3R93A 1EIHA 2RA4A 2V4DA 2OQKA 3KF8A 3HOVB 1V9PA 1CI3M 1ESRA 1HNXQ 5CMDA 2J4XA 3H0GG 5IGGA 5GAHC 3I56A 1L1OC 1I3QH 1G291 2HCIA 4X62L 3STBC 1LACA 1F9SA 2R3ZA 4GN3B 4X64L 2JA6B 2SDFA 4NKLA 2ZJRA 2EJFC 3CCVA 2VW9A 1M8AA 3FKIH 4OO1G 5JVH3 5CBAE 5I2YA 1SFOH 1EYGA 1NSNS 4HIKA 4IJLA 3TRZA 5DLQE 3F2DA 2F0FA 3NQIA 4A3CH 1TWHH 4A3MB 4OWXB 4C3HH 4QUCA 4DR5Q 3J81c 4JI5L 4GLVB 1N34L 4KK7A 5IP9G 1LT6D 2CVRA 2R7ZG 4KV6A 2IX1A 4IALA 1PZJD 2CHBD 1ONLA 2IY5B 1X55A 1ENFA 3JAML 4DR6L 4B9WA 3NUCA 3Q8DA 2D5DA 3HKZG 1KABA 1CA6A 1WFQA 1K8GA 2A73B 1L1OB 1SE2A 1UE1A 1EY7A 1H9SB 1SMXA 1YVCA 3J81E 2JA5B 1JORA 2HUGA 1M1KC 1OO9B 4N9TA 5IGFA 1K8OA 2PNHA 3IFDA 1IYJB 1UUPA 4K6LA 1QZGA 3PCOB 1C8CA 3GTGH 1BF4A 4LFBQ 1VQ5A 3BG3A 1I50H 3ER0A 2K05A 3I55A 1IKMA 4HIOA 4IUNA 3TBIB 4A3FG 1PH4A 5IP7H 4QB4A 3MXNA 5CYUA 1AN8A 4X3TA 4DV5L 1ZYRD 3H6MA 3HKZE 2KA7A 4GLAC 4A3KH 1VQGA 4DXFA 3EFXD 4DV0Q 1SE4A 4JI8Q 1NCVA 5C0XJ 4BBRB 1VQHA 1IL2A 4G4KA 1PTOH 1YJNA 1TWCB 4A3JH 4YHHQ 1EZ6A 2Q2TA 4Y7NH 2K5WA 3C1FA 2VB2X 4WJ4A 1HXYD 4KKSA 4EQNA 4B3SL 2UU9L 1G8ZD 5F2DA 4IUPA 1KLUD 3BDOA 5FLXc 1TWFB 2Q2UA 1KAAA 3KBGA 4L5TA 4YWLA 1KDBA 3EQLC 4A3GB 2F0HA 2FMMA 4ZCKA 4A93G 2EYMA 5GROA 3H94A 5C4XG 2F0MA 1TS5A 3FP9A 3OTOL 2PW5A 3HOWH 1U0LA 4JCVE 2EYOA 1ML0D 4R4QA 2F0IA 3A54A 2AQ1B 4O0AA 4JI7L 1DGSA 3F8TA 3DHQA 2IL8A 2QW7A 4IUVA 2R92B 1X3QA 2YV5A 3PIPA 1BO0A 4ZQ3A 4JPBW 1HPCA 4UDUC 3V05A 4KKUA 2XIWA 1SYCA 1H9RA 1AEXA 4HCSA 2BDNA 4MTKA 1V8QA 4RGMA 1CZWA 3ZJYC 1SMYC 2K6AA 4YY3L 3Q23A 1UNSA 1IL8A 3KF8B 5LMNQ 3CCJA 5M5YH 1GUSA 4HJAA 2JN4A 1PH9A 5IGEA 3DLLA 3NELA 4HSPA 1PH6A 5EJWA 4ZKBB 2JSOA 3K0YA 4DAYA 5M3FG 1YZ6A 3PGZA 2BE5D 5J39A 3RLFA 1JWSD 1F77A 1LYLA 1TT2A 1YHQA 3AU7A 3SEBA 3MXGA 2NTTA 5IYDG 4LNQA 2OWOA 4BBSB 2Q8TA 3VR6A 3U4ZA 4A3LG 5ISRA 2UUCQ 4JG2A 4WRDA 1SE8A 3OW2A 4EQ5A 2A68C 4KD4A 3M85A 3HOUG 2YYZA 1STAA 1BUVT 4JI2Q 5E4XA 4K6DA 5L37A 1QCBD 1FJGL 3HFZB 1Q46A 4DV2Q 1PH8A 1PRTD 1EUJA 2YTXA 5JVG3 2P5ZX 4H02A 4JI0L 2Q2HA 3VYSA 5I9PA 3AFQA 3F2UA 1S72A 3WOFA 1NTGA 2Z8LA 3NWTA 2KUMA 2B63G 3HOVH 1K73C 1ASZA 4UPAA 1GUGA 2A1AA 2CQOA 3K7UC 5DEHA 3D6CA 4G57A 5M5XB 3K7AB 1EZ8A 4JK1C 5IIFA 1WTRA 1QE6A 2PZWA 2JA6H 2NZOA 4J1MA 2F0OA 3IL8A 4QMGA 3MZ5A 3TREA 2XN9C 1PRTF 2PNRC 2I07B 1QVGA 3PSIA 4Y52H 3TZDA 1S4ZA 3BVZA 3D4RA 2LMCB 3AYHB 1KTKA 2D0OA 1QJOA 2HCCA 2K5DA 2IJ0A 1VQFA 4R8IA 2LSSA 4A3MH 3A5ZB 1D1KA 4KY5A 1Y8OB 2KHSA 2F0EA 4IO9A 3DEPA 5IWAL 5C44G 1PFBA 2SEBD 1NMGA 1KRTA 3HKSA 1F9QA 1VF7A 3BU2A 4JOIA 5LMUQ 4XT3B 4GZYC 3A8JE 3NTHA 4C56C 1F9PA 2WB1G 2MPMA 3U9SA 2NZ1D 3TQYA 2JA5H 4A3IG 2R7FA 1CHPD 1X3PA 2GN5A 1XMQQ 2UUBQ 4P71A 1JT8A 4PZ7A 2XSCA 4OWWB 1U4PA 5D3IB 3I70A 3MXPA 1QG7A 4DR7L 3MWYW 5CV5A 2WKCA 1H9KA 5IYCG 2TSSA 2CH4W 3PO3B 5C4ZA 1S5DD 4KLKA 1B70B 2DUDA 4QL5A 4XQQA 1WTQA 2RCNA 2MP1A 1Q8IA 1H9MA 1J5EQ 1XNRL 3A8IE 1A3TA 2WB1E 4RFBA 4K2KA 1JWUD 4ZKCB 1LTRD 3OSOA 3HOZG 1HRJA 2A69D 1JB3A 1QVCA 4BBRH 4RMFA 4DAYB 1MBYA 3OOCA 5C3EB 1WD0A 1HR0W 1TWCH 4G7HC 1BVSA 1JQYD 1SYEA 1UWVA 5J1ZA 1L0XB 2VUMG 1T5XD 1IKLA 2WFWA 4DK1A 2Y0SB 2MUYA 2MJ8A 1OXXK 1TWFH 4FXGC 5A35A 1GOZA 4DR4Q 2MFIA 1M90C 4LF4Q 2KVMA 4A3GH 1N32L 1HCZA 2F4VL 1AP0A 1WCMB 1FYCA 2K52A 2O5JC 4KHVA 1EIGA 1XXGA 2PI2E 4KTAA 2GA4B 3FDTA 1QWYA 3UI2A 1JJ2A 3S14B 3VA5A 5IGDA 5KNDA 1W3SA 4YCWA 3NPPA 3CCQA 1N9WA 1DOMA 4DNTB 3CC4A 4K14A 1EEFD 1F2YA 3HOXG 2LS01 4BXXH 4JOIC 3SK8A 4ILWA 5ELDA 1U4LA 1YNXA 1SNMA 1X3FA 1N36L 1WTVA 1E2VA 2M9VA 4UAIA 2RDFA 1IW7C 1PTOD 3QJYA 2LFNA 1BBUA 3W1GA 4CKEA 1A3VA 3CW2C 3K5MA 1S3OA 2QDLA 2Z1CA 3CC2A 2JA7H 2EY1A 2C5CA 4BBSH 3HEJA 1A2TA 2X6GA 1V1PA 2Z0SA 4X65L 3IRBA 1Q86C 1E22A 2HHHQ 2KHJA 1XMOL 4OONA 1HZ9A 3S17B 3FKIG 2B2TA 5KRUA 3PF4A 5JPMC 4NXNQ 4POFA 1EY4A 1XWEA 1EQTA 3OPOA 4R1JA 4KMUC 5GAEC 1KLGD 2HQLA 3B6YA 4A3CG 1LTGD 2OCEA 3NSWA 2E5LL 1PTOF 4C3HG 3VA7A 2UUAQ 2XWJB 4OIKA 1JICA 4DUYQ 1YNNC 4OXPA 1IYUA 1STYA 5C5MA 1OXVA 3LX0A 2ZXPA 1GVPA 3L0OA 2E76C 3ICEA 5EPKA 1AFPA 1K8MA 4A75A 1IBLL 4IPGA 4LF6Q 3CQZB 2IT1A 1GUTA 1YIJA 4A3EG 4A3BB 5JJLA 4GS3A 4R4TA 1BCPF 5EQ0A 1H95A 5M5XH 3K7AH 2NN6H 3PO2H 5FO7B 2JA9A 3C46A 1PH1A 1SYBA 1KAWA 3KUPA 1W2BA 1Y14B 1PYBA 4K2LA 3KLSX 2VS1A 3KJOA 2HD3A 3AFPA 2G9HD 4CGYB 1UE6A 3SE0A 1X32A 4GLXA 1TWGB 1JE4A 5E3FA 2WINB 2HDLA 3MVVA 1PFSA 1EWIA 2M00A 3BZDB 1Q3LA 1I94Q 3OWFA 2UXDL 3IFTA 2N49A 4RHSA 2L12A 3IAYA 2AQ3B 5IP7G 3N6RA 4UP8A 1G2SA 4LFAL 1HNWQ 1STHA 2PQAA 4HTHA 2E2JB 3MEHA 1KIXA 1FGBD 1EEID 1L0YB 1KNEA
chains in the Genus database with same CATH topology
4OHJA 5ELBA 4Q0FA 1SAPA 1DD2A 1EU4A 1BR9A 2G9DA 2BA1A 1Y1VB 2L55A 1JOQA 5KYLA 2CW0C 1NAPA 2K01A 1LT5D 2FJ2A 2JE6I 3NK9A 1DOKA 5D3DA 2B2TC 5BN4A 2F0LA 2SOBA 3EJIA 2WP8J 5K36H 2EOTA 3RD4A 2RDGA 1SNOA 3EA6A 3VYTA 3A55A 3KBXA 3OIQA 4FNFA 1Q1EA 3MAQA 2NVTB 1STBA 3NP8A 1PLFA 2WKDA 2EYFA 3SHLA 1LLRD 1ET6A 1GUOA 1V1PB 4G7OC 3QO2A 1OXSC 1F2ZA 1SSOA 3NQTA 4ZAIA 2IPKD 3Q22A 4ZUIA 4NDXA 2R6GA 1ENAA 5EBCA 2O5IC 4H13C 1B1ZA 1FNWA 3MC0B 1WD1A 4RKBA 3QB3A 5C3WA 2AWNA 1ICWA 5KYIA 2NUCA 1DONA 1EWHA 2QILA 5C4HA 2NN6I 4DU9A 4DF7A 3GP7A 1TY2A 2HQEA 5HURA 5KNCA 2L9HA 1KNAA 1KDCA 1C4QA 4PMCA 3OHXC 3VR5A 1LTID 4L8JA 1F9RA 3SDZA 1WTWA 1NUCA 2A74C 2RDHA 1LTSD 2K04A 1HHVA 4U68A 3H0GB 2A6EC 5I6YA 2EYPA 5EKKA 1GUWA 4C3JB 4KKTA 2O2LD 1WTPA 1QNKA 4OIJA 1SJED 2FFKB 2PZTA 3LNNA 1A2UA 3ONAB 4EVOA 5BN3A 3OIPA 3M4OB 5CBEE 4RGOS 2EYJA 1EYCA 2RKSA 3NE5B 3D4DA 1CK1A 1BOSA 4HMJA 1XYIA 3H91A 3I72A 5ELFA 4F88A 1SNPA 3ZYYX 4CKBA 4C3IB 4A3DB 3T53B 3S1QB 2B2VA 3TZUA 1Z7TA 4I65A 3HKZB 5AFWA 3VR2A 3PMFA 2L1BA 3W3AA 4IURA 2F3WA 4IFDH 2IW3A 1D5MC 5EKIA 2B2YC 2LKVA 5M3MB 1NR4A 4HEDA 2OEOA 4J6HA 4BY7B 3I3CA 4RKLA 4IUUA 4FF3A 5CV7A 1F2LA 4A3FB 5CORA 1EY0A 1I4RA 3S9WA 2K5QA 2A68D 2ENBA 3R2TA 2D62A 1E2WA 5I9OA 2O4XA 3URYA 3P20A 1OXTA 1BQQT 3I4LA 1Y1WB 3W2DA 5FK9C 1LTTD 1CFMA 4QIWB 5CR3A 3T56B 4IUQA 4IZ8A 5FLXE 1LT3D 4ABNA 3S1MB 3FRPB 3PUYA 5K5PA 3DM1A 3ND9A 1SDFA 2F0DA 3FMCA 3TSSA 3S16B 3L9AX 1HA5A 1SYDA 3GQBA 4C2MB 3DXJC 2PZUA 3QIAA 4ULLA 2FHTA 3C3LA 4NP5A 1SYFA 2B2VC 3VR3A 1T5EA 2RQXA 1YNJC 5BN5A 3PUWA 1HFNA 2QDBA 2K28A 5FOBB 4YIJA 5CV9A 2E2IB 2IWHA 3BDLA 3DUZA 1QB5D 5G3LD 1I4PA 5JEAH 3TP6A 3VYUA 1FR3A 2BCOA 3QOJA 1J8IA 1MGSA 3GTQB 2XRQD 3T13A 2NN6G 1TWAB 4K8JA 2EYHA 2NB0A 4X3SA 3H09A 5CC4A 1G6ZA 1EY8A 1HTLD 3ND8A 1Y8PB 5IOCA 4LAAA 1GJXA 4RHRA 1U4RA 3DWAA 1GXDC 1JOOA 4IFDI 4R9WA 5G3LF 4KJNA 5FKAC 4XYOA 2AWOA 3EVQA 3ITPA 1LO5D 2IX0A 1Q12A 4FO2A 3CU7A 4FYDA 2JA8B 2J7ZA 2F0VA 5JPNC 1WTOA 1AZQA 5DM63 2VNUD 3TDQA 1EU3A 2PMZB 4JBWA 3GTPB 5KNBA 1OXUA 1RHPA 2I46A 1RJTA 4RCNA 3M4YA 2WAQB 5C44B 2OF1A 4FP5D 2RSNA 4DK0A 1S5BD 2OT2A 3T4AC 3TP8A 4LK1C 5K36G 2KJXA 2E74C 2DNEA 3CKIB 1EY5A 4ZUJA 5IT9L 1IW7D 3X3MA 4XDXA 1RTOA 2XVSA 2F0KA 5IODA 2YU9B 1BNZA 1JWMD 1II3A 3N52A 1TS2A 2Z4HA 5KGUA 3Q0AA 4L6TB 5ELCA 4DFAA 2NBFA 4HAEA 1B9NA 5J22A 4BA2I 2K03A 3P1HA 3D3RA 2NWGA 4Q5VA 3PV0A 5JAVA 3HOZB 2BOSA 5DAUA 3TP7A 3A56A 3CHBD 3DWPA 4XYQA 1S5CD 1IHZA 1YNND 4CJ2C 1V1OA 1BXTA 1SJHD 3EROA 2VUMB 2HDMA 1PFNA 4KD3A 2F0NA 4ZK9B 2SNMA 3KLRA 4IQZA 1TVXA 3SK6A 2BA0A 3K59A 2MHVA 5EPLA 3BYTB 4F7XA 1RTNA 2ICIA 3HOXB 2R93B 1QOHA 2PW7A 2H4OA 4ZLTF 2TMPA 1K83B 1D5XC 2Z4IA 1DOLA 3NTKA 1H9JA 2A69C 4R8NA 1Y8NB 1AW7A 4BY1B 2EJGC 2K32A 1QILA 1I6HB 5C5LA 4TSSA 1B4OA 3PUVA 1I4XA 2OXPA 3V2TA 5TSSA 2CW0D 4KY7A 4E6IA 3TP5A 5C0XH 3I8ZA 2PYKA 2EZVA 1PXUA 1TWHB 5DM73 1STEA 5DNFA 2XWBB 4TQUS 1TKWB 4CBVA 3AB9A 4A3EB 4XQNA 4S3SA 4EGVA 3SK5A 1SBBB 3X3NA 4IFDG 1MSGA 5I4DA 1EL0A 5I6WA 5E1FA 1B44D 5T1GA 1BCPC 4I7ZC 1E0BA 2F0UA 1PZKD 1CA5A 2LY7A 4G7ZC 1SEBD 2EXZA 2F1MA 4PMWA 3I4MB 1RDPD 1SNDA 1RCVD 3SXHA 5JEAJ 4MIUA 2RBMA 2B39A 2JEAI 2EY2A 4PNYA 3PIO3 2KECA 1SNQA 3M7GA 1D1IA 3GTMB 3NXWA 4Y7NB 4LMQD 4ZYSA 3JAME 2EY5A 1VF5C 1Z6HA 2EY6A 3VR4A 1BCPB 1TR5A 4V190 4RAUC 2B8GA 3MXUA 4EQPA 2KCNA 3HP3A 2PQEA 1W6KA 4C1NK 4HR7B 4HMIA 2QCPX 3DEOA 3G6JB 5A2QL 3WDNA 3BVGA 1TY0A 5T1IA 3LWUA 5ELEA 4KI0A 3I4NB 2A6ED 3L3OC 3I90A 4OGQC 1ZXTA 2KEDA 3GV6A 2B8FA 3OW7A 3LWEA 1JR0D 4RA8A 5C0XI 2CQAA 2F0WA 2N88A 1PMRA 1EYAA 5JEAG 3NWSA 4PMBA 2B2YA 4BA1I 3A7AB 4KN7C 3QOLA 2AUKA 1DJRD 3T16A 1FNUA 3MA2B 1B53A 4TRDA 2A6HC 2NVYB 1A15A 1B50A 2F0PA 2VB3X 2Q8RE 3HZXA 4DAPA 1GHKA 1D2BA 3S2HB 3NBHA 4M1UB 4N9PA 5M9OA 1U4MA 1XX8A 2EYLA 4BWGB 4C3JG 1EY6A 2AUJD 1ILQA 1PYWD 2C9OA 3NBIA 1WVLA 2JP1A 1I4HA 4HSVA 2L4NA 1JC7A 3V96A 1NR2A 1RKNA 2E2DC 4EQOA 3AMUA 5M5WB 2JYOA 3S1RB 4RH6A 4C3IG 3C2PA 2R7ZB 2BDOA 2KCCA 4XIGS 5COYA 1EYDA 4DAVA 3FEWX 4FXKC 4KN4C 1Z47A 4XXEA 4H44C 3J7AF 2J0TD 3FPPA 1ILPA 3GTKB 1SMYD 4DN4M 4C1NI 1HQMC 3S1NB 2KQ3A 4TKOB 3P7JA 2NYZD 2ID0A 1R4QB 1O7YA 1O78A 3SVMA 3J80L 4F8MA 3OWEB 1CHQD 2B2WA 1RD9D 3A8KE 1YNJD 2ICEC 4RCOA 1PDQA 2A5HA 5KIXA 2EJMA 3M3YB 2QEJC 3BVMA 1ESFA 1E2ZA 4HCEA 1EQVA 5HGTA 2NVQB 1G2TA 5C3XA 1D5ZC 2FMCA 4RGNA 3FPUB 4A93B 4QCLA 3K5NA 5C4XB 3OMCA 1FNVA 2ZXRA 1EOTA 2AQ2B 4KHZA 4X3UA 3K5OA 2WIIB 2NVXB 1STGA 2JEBI 3E0JA 1S5ED 2ZXOA 3HG9A 1I4GA 3D4WA 1ZYRC 5CV4A 2D2CC 1Y69U 3D6WA 3K6OA 5IT9E 4ODGA 4CHTB 4IUTA 5M3FB 2PO4A 3J7AV 3I73A 2JA7B 1CQVA 2FINB 2L11A 4K5VA 3GTJB 4B9XA 1R4PB 4CJ0B 3J81L 2K7VA 1Q1BA 5C0XG 3C1EA 1G91A 1GUNA 3HOUB 1LV9A 4XT1B 3TMEA 5FO9B 3DWQA 2B2WC 1PFMA 5CGKA 3U9OA 5C6AA 5LL6S 1ZEQX 2Q8IB 1AZPA 3PUZA 3RUZA 1HFGA 4U673 3K57A 2EE1A 2B63B 4MHEA 3GTOB 1JOKA 1CZGA 4H7BA 3M7NA 3I91A 3PO2B 3K58A 3OMGA 2BE5C 1MD2D 1CQFA 4OO1H 4BS9A 2K1BA 4MN3A 2RVLA 1O7ZA 4NMZA 2B2UA 2JXMB 1VCIA 1PRTC 3GTLB 5FLXL 3R3OA 2KEEA 2PCFB 2SNSA 3R2IA 1CTMA 3G7LA 1BBXC 5IGCA 2WB1B 4DXGA 3NHHA 4A3IB 4J8QA 4FF4A 3HRZC 2F0TA 1HUMA 2WV6D 3QWNA 1VMPA 2D9UA 4O1NA 3RZOB 2N55A 1DCZA 4AYBB 3L7ZC 2QF7A 2DN8A 1GHJA 4K8IA 3GD7A 1J9OA 1DXMA 5D65A 1C48A 1TU2B 4IN3A 2X6LA 5EPJA 2F4IA 1PRTB 5CV8A 4KY6A 4PQXA 4QF4A 2L5TA 2H1EA 4WORA 3GO5A 4M8AA 2DY8A 5EKLA 2F0JA 1CT1D 1EY9A 3PUXA 4KJOA 2E2HB 5LL6X 1SXTA 5I2XA 1LTBD 1VDZA 4P2CB 2KOLA 1STNA 2VXWA 1IYVA 4CKCA 1D6EC 2F0QA 1KDAA 2E75C 4XQJA 1ZKOA 4F87A 2B2UC 3O13A 3S15B 2F0GA 2PPBC 3S2DB 1DM0B 4FF1A 5FO8B 3T51B 4IFDJ 4DA2A 3RZDB 3KLSA 3D31A 5CV6A 1LABA 3R8BA 3E6ZX 5E4WC 4DNRB 1U9RA 4X3KA 1R9TB 3BYYB 3BS1A 3Q6SA 1S5FD 4RGTA 3HS0C 2EPBA 1SNCA 3MHBA 4OO1I 1ENCA 1JCKB 1TS3A 2F03A 1I3QB 1BCPD 1TQOA 1ET9A 5KEEA 3MFGA 1I4QA 3FKIB 1HA6A 1SFOB 2R61A 4H0LC 3SK4A 5A2QE 4V0BA 1WTXA 1A3UA 1TS4A 4C3HB 4ID6A 1B3AA 2QKIC 3DMUA 4K5WA 3A7LA 3VYRA 1I6VC 1B9MA 4Z9CB 1DZ1A 4L63B 5C4JB 3HOYB 1HQRD 2F0SA 4QUFA 1B2TA 1PTOC 1CM9A 1HUNA 1SYGA 1QNUA 2ZT9C 2L0CA 1UAPA 3Q24A 2EVBA 3GV3A 3GTGB 3PIP3 4ME5A 4ZRZA 2XNAC 1I50B 1O80A 1SE3A 1LT4D 3P75A 1TIID 1MI2A 5IGBA 3ERQA 2EDGA 4B08A 1EFID 1EWCA 4FVMA 4A3KB 5D14A 1UEAB 3KK7A 1V43A 1MSHA 4RWSC 2DNCA 4O42A 1PTOB 4A3JB 4FXDA 4CJ1B 1H9SA 5JOBA 1HTPA 3D8GA 2DY7A 3RMHA 3J7YW 3E5SA 2A6HD 3NTIA 3HOWB 5EGTA 4PV1C 1O7LA 2X69A 1BDOA 2IX3A 3IKJA 5EBDA 1RF2D 2XRSD 1FD7D 4HN7A 3K5LA 3CRLC 3BDCA 3TN2A 1Q90A 3CRKC 5M5YB 4FF2A 5JJZA 4DGZA 1A6XA 3MTSA 3SR1A 4WFN3 1LTAD 1F2MA 1XTCD 3FVQA 4LJZC 4XTCS 5LHY1 4OL7A 2MGSA 1DYQA 1W6JA 4NW2A 1M4VA 3MFYA 3J80E 2F3VA 2M2LA 2K33A 3WOEA 3QG1A 3HGBA 4WJWA 2RSOA 2NTSA 4K5XA 1PZID 5NUCA 1RODA 2WACA 1VMCA 3H3VC 3R93A 1EIHA 2RA4A 2V4DA 3KF8A 3HOVB 1CI3M 1ESRA 5CMDA 2J4XA 5IGGA 1G291 2HCIA 1LACA 1F9SA 2R3ZA 2JA6B 2SDFA 4NKLA 2EJFC 1M8AA 4OO1G 5JVH3 5CBAE 5I2YA 1NSNS 2F0FA 3NQIA 4A3MB 4QUCA 4KK7A 1LT6D 2CVRA 4KV6A 2IX1A 4IALA 1PZJD 2CHBD 1ONLA 1ENFA 3JAML 4B9WA 3NUCA 2D5DA 1KABA 1CA6A 2A73B 1SE2A 1EY7A 1H9SB 3J81E 2JA5B 1JORA 2HUGA 1OO9B 4N9TA 5IGFA 1K8OA 3IFDA 1UUPA 4K6LA 1C8CA 1BF4A 3BG3A 2K05A 1IKMA 4IUNA 3TBIB 4QB4A 3MXNA 5CYUA 1AN8A 4X3TA 1ZYRD 3H6MA 2KA7A 4DXFA 3EFXD 1SE4A 1NCVA 5C0XJ 4BBRB 4G4KA 1PTOH 1TWCB 1EZ6A 2K5WA 3C1FA 2VB2X 1HXYD 4KKSA 4EQNA 1G8ZD 5F2DA 4IUPA 1KLUD 3BDOA 1TWFB 1KAAA 3KBGA 1KDBA 3EQLC 4A3GB 2F0HA 2FMMA 2EYMA 3H94A 2F0MA 1TS5A 2PW5A 2EYOA 1ML0D 2F0IA 3A54A 2AQ1B 3DHQA 2IL8A 4IUVA 2R92B 1X3QA 1BO0A 4ZQ3A 4UDUC 1HPCA 3V05A 4KKUA 2XIWA 1SYCA 1H9RA 1AEXA 4HCSA 2BDNA 4RGMA 1V8QA 1CZWA 1SMYC 2K6AA 3Q23A 1UNSA 1IL8A 1GUSA 5IGEA 4HSPA 5EJWA 4ZKBB 2JSOA 3K0YA 4DAYA 2BE5D 5J39A 3RLFA 1JWSD 1F77A 1TT2A 3AU7A 3SEBA 3MXGA 2NTTA 4BBSB 2Q8TA 3VR6A 5ISRA 4WRDA 2A68C 4KD4A 3M85A 2YYZA 1STAA 1BUVT 5E4XA 4K6DA 1QCBD 1PRTD 5JVG3 3VYSA 5I9PA 3F2UA 3WOFA 3NWTA 2Z8LA 2KUMA 1GUGA 5DEHA 3D6CA 4G57A 5M5XB 3K7AB 1EZ8A 4JK1C 5IIFA 1WTRA 1QE6A 2PZWA 4J1MA 2F0OA 3IL8A 4QMGA 3MZ5A 2XN9C 1PRTF 2PNRC 2I07B 3TZDA 1S4ZA 3BVZA 3D4RA 2LMCB 1KTKA 1QJOA 2HCCA 2K5DA 2IJ0A 4R8IA 1D1KA 4KY5A 1Y8OB 2KHSA 2F0EA 3DEPA 1PFBA 2SEBD 1F9QA 1VF7A 4XT3B 4GZYC 3A8JE 3NTHA 4C56C 1F9PA 2MPMA 3U9SA 2NZ1D 1CHPD 1X3PA 2XSCA 1U4PA 5D3IB 3I70A 3MXPA 1QG7A 3MWYW 5CV5A 2WKCA 1H9KA 2TSSA 3PO3B 5C4ZA 1S5DD 4XQQA 1WTQA 2MP1A 1Q8IA 1H9MA 3A8IE 1A3TA 4RFBA 4K2KA 1JWUD 4ZKCB 1LTRD 3OSOA 1HRJA 2A69D 1JB3A 1MBYA 3OOCA 5C3EB 1WD0A 4G7HC 1JQYD 1SYEA 5J1ZA 1L0XB 1T5XD 1IKLA 4DK1A 2Y0SB 2MUYA 2MJ8A 1OXXK 4FXGC 5A35A 1GOZA 2KVMA 1HCZA 1AP0A 1WCMB 1FYCA 2O5JC 4KHVA 1EIGA 1XXGA 4KTAA 2GA4B 3FDTA 1QWYA 3UI2A 3S14B 3VA5A 5IGDA 5KNDA 3NPPA 1DOMA 4DNTB 4K14A 1EEFD 1F2YA 2LS01 3SK8A 4ILWA 5ELDA 1U4LA 1SNMA 1WTVA 1E2VA 2M9VA 4UAIA 2RDFA 1IW7C 1PTOD 3QJYA 2LFNA 4CKEA 1A3VA 3K5MA 2Z1CA 2EY1A 2C5CA 3HEJA 1A2TA 2X6GA 1V1PA 3S17B 2B2TA 5KRUA 5JPMC 1EY4A 1XWEA 1EQTA 3OPOA 4KMUC 1KLGD 1LTGD 3NSWA 1PTOF 4C3HG 3VA7A 2XWJB 4OIKA 1JICA 1YNNC 1IYUA 1STYA 5C5MA 1OXVA 3LX0A 2ZXPA 2E76C 5EPKA 1AFPA 1K8MA 2IT1A 3CQZB 1GUTA 4A3BB 1BCPF 5EQ0A 2NN6H 5FO7B 3C46A 1SYBA 3KUPA 4K2LA 3KLSX 4CGYB 2G9HD 3SE0A 1X32A 1TWGB 1JE4A 5E3FA 2WINB 2HDLA 3MVVA 2M00A 3BZDB 1Q3LA 3OWFA 3IFTA 4RHSA 2L12A 3IAYA 2AQ3B 3N6RA 1G2SA 1STHA 4HTHA 2E2JB 3MEHA 1FGBD 1EEID 1L0YB 1KNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ENC A;  3T13 A;  1F2Y A;  2EYO A;  3NHH A;  4K8J A;  4KY5 A;  4ODG A;  2KHS A;  2F0I A;  2EYH A;  2F0E A;  5CV7 A;  5JOB A;  1TQO A;  3D8G A;  4DFA A;  4RKL A;  1NSN S;  3DHQ A;  4DF7 A;  3E5S A;  5J22 A;  3SK8 A;  2F0T A;  5CC4 A;  4ZQ3 A;  1SNM A;  2F0F A;  2HQE A;  3P1H A;  5EGT A;  5KEE A;  1EY0 A;  1EY8 A;  3S9W A;  1SYC A;  1AEX A;  5IOC A;  4LAA A;  4S3S A;  5JAV A;  2ENB A;  4K5V A;  5HUR A;  2RDF A;  1JOQ A;  4B9X A;  5DAU A;  3TP7 A;  5KYL A;  1KDC A;  3SK5 A;  1A3V A;  4PMC A;  5I9O A;  1IHZ A;  2KQ3 A;  3SK4 A;  2O4X A;  4KV6 A;  1JOO A;  3C1E A;  2F0W A;  5IGE A;  3ERO A;  1A3U A;  4K8I A;  2EY1 A;  4IAL A;  1EYA A;  4KJN A;  3NK9 A;  4PMB A;  1NUC A;  3BDC A;  3TME A;  3EVQ A;  3HEJ A;  1A2T A;  3ITP A;  4ID6 A;  4KD3 A;  4B9W A;  3NUC A;  2F0L A;  3DMU A;  4K5W A;  3QOL A;  2SOB A;  1KAB A;  5I6W A;  5J39 A;  5CV8 A;  5E1F A;  5CR3 A;  2F0N A;  3EJI A;  3MXP A;  3T16 A;  4KY6 A;  4IZ8 A;  1TT2 A;  3U9O A;  2SNM A;  4DGZ A;  5CGK A;  5C6A A;  1EY7 A;  2F0U A;  4TRD A;  5CV5 A;  4F8M A;  4QF4 A;  3RUZ A;  5KRU A;  2F0V A;  1JOR A;  4WOR A;  4N9T A;  5IGF A;  3SR1 A;  2F0S A;  3SK6 A;  5I6Y A;  5K5P A;  5ISR A;  1EY4 A;  2EYP A;  4K14 A;  5EKL A;  2EXZ A;  4WRD A;  1F2M A;  5EKK A;  5C4Z A;  2F0J A;  1SNO A;  2F0D A;  4KD4 A;  1SYG A;  1EY9 A;  4OL7 A;  1STA A;  1JOK A;  4KJO A;  1SND A;  4H7B A;  5KIX A;  4K6D A;  3SXH A;  4F7X A;  1STB A;  2F0P A;  1STY A;  5C5M A;  4MIU A;  2RBM A;  3LX0 A;  3NP8 A;  4IUN A;  2PZT A;  3HZX A;  1A2U A;  2F3V A;  4EVO A;  2EYF A;  2PW7 A;  1A3T A;  1SYD A;  4K2K A;  2EY2 A;  3OMG A;  4N9P A;  2PZU A;  2OF1 A;  4QB4 A;  4ME5 A;  3SHL A;  5M9O A;  4PNY A;  3OSO A;  1EQV A;  1STN A;  2EYJ A;  1EYC A;  1SNQ A;  2RKS A;  5HGT A;  5I9P A;  5C3X A;  2EYL A;  3D4D A;  3H6M A;  3P75 A;  4HMJ A;  3TP8 A;  3NXW A;  4NP5 A;  2F0Q A;  1EY6 A;  4R8N A;  1F2Z A;  1KDA A;  1SYE A;  4K5X A;  1SNP A;  3NQT A;  1SYF A;  5IGB A;  3ERQ A;  5J1Z A;  5NUC A;  1SYB A;  4ZUI A;  5C5L A;  5DEH A;  2EY5 A;  4NDX A;  4NMZ A;  3D6C A;  2F0G A;  2WAC A;  3OMC A;  4G57 A;  1ENA A;  4K2L A;  2EY6 A;  1EZ8 A;  2QDB A;  2OXP A;  5IIF A;  1EY5 A;  4I65 A;  1TR5 A;  1EZ6 A;  4ZUJ A;  4YIJ A;  5CV6 A;  5CV9 A;  5E3F A;  3V2T A;  2PZW A;  3C1F A;  3MVV A;  4KHV A;  4EQP A;  2M00 A;  3PMF A;  4J1M A;  2F0O A;  4RKB A;  4EQN A;  4QMG A;  3BDL A;  5F2D A;  5IGG A;  1U9R A;  4KY7 A;  3OWF A;  3QB3 A;  4KTA A;  3TP5 A;  4E6I A;  3MZ5 A;  5C3W A;  1RKN A;  1KAA A;  3R3O A;  1KDB A;  2F3W A;  2F0K A;  1STG A;  2F0H A;  3VA5 A;  4EQO A;  3TP6 A;  5IGD A;  5IOD A;  5KYI A;  2PYK A;  2EYM A;  2NUC A;  2SNS A;  2LKV A;  1II3 A;  2PQE A;  1STH A;  3D4W A;  2F0M A;  4DU9 A;  5CV4 A;  4HTH A;  2PW5 A;  1SNC A;  3MEH A;  3QOJ A;  4NKL A;  5C4H A;  5KGU A;  2OEO A;  3MHB A;  4J6H A;  5IGC A;  4HMI A;  1EYD A; 
#chains in the Genus database with same CATH topology
 4OHJ A;  4A3K G;  3PQI A;  5ELB A;  4Q0F A;  2A8V A;  1SAP A;  1DD2 A;  1EU4 A;  1K3B C;  1BR9 A;  3CPF A;  4AQY L;  1PH3 A;  4B3M Q;  2ZJP A;  2G9D A;  2BA1 A;  1Y1V B;  2L55 A;  1JOQ A;  1ASY A;  3U4V A;  5KYL A;  1Q82 C;  2CW0 C;  3AEV A;  1NAP A;  2K01 A;  1LT5 D;  2FJ2 A;  2JE6 I;  4DNI A;  2YTV A;  3NK9 A;  3JAM c;  1DOK A;  1EQQ A;  3PO3 H;  5D3D A;  2B2T C;  5BN4 A;  1EOV A;  2F0L A;  3HOW G;  2SOB A;  1VQM A;  3EJI A;  2WP8 J;  5K36 H;  2EOT A;  5BR8 L;  3RD4 A;  2RDG A;  1SNO A;  3EA6 A;  3VYT A;  3A55 A;  3KBX A;  3OIQ A;  2K5H A;  4FNF A;  1Q1E A;  3MAQ A;  2NVT B;  1STB A;  3NP8 A;  1PLF A;  5C3E H;  2WKD A;  3CP0 A;  1GKH A;  2EYF A;  4DR3 L;  2OQ0 A;  4JC0 A;  3SHL A;  1IBK Q;  1LLR D;  4J15 A;  3STB D;  1ET6 A;  1GUO A;  1V1P B;  4G7O C;  3QO2 A;  1OXS C;  1F2Z A;  1SSO A;  1E24 A;  3NQT A;  1WCM H;  4ZAI A;  2IPK D;  3Q22 A;  1HR0 Q;  4ZUI A;  4NDX A;  4GKK Q;  2BH8 A;  2G5D A;  1KC8 C;  2R6G A;  1ENA A;  3KOJ A;  5EBC A;  1EQR A;  2O5I C;  4H13 C;  4JI1 Q;  3S14 H;  5FLM H;  1B1Z A;  1FNW A;  3MC0 B;  5LMN L;  1PH5 A;  4LF8 Q;  1WD1 A;  3AQQ A;  4RKB A;  3QB3 A;  5C3W A;  3S15 H;  2AWN A;  1ICW A;  5KYI A;  2NUC A;  1DON A;  5HGQ A;  1EWH A;  2QIL A;  5C4H A;  2NN6 I;  4GKJ Q;  4DU9 A;  1K28 A;  2ZM6 L;  4DF7 A;  3QR8 A;  3GP7 A;  1VQC A;  1TY2 A;  2HQE A;  4LF5 L;  2R7D A;  1BKB A;  1UE5 A;  5HUR A;  5KNC A;  2L9H A;  2K75 A;  1KNA A;  2JA6 G;  1KDC A;  5GQO A;  1C4Q A;  4PMC A;  3OHX C;  3VR5 A;  1LTI D;  2N78 A;  4L8J A;  1F9R A;  3S17 H;  4JI3 L;  3SDZ A;  1WTW A;  1NUC A;  3T1H Q;  1Q7Y C;  2A74 C;  2RDH A;  1LTS D;  1J6Q A;  1K3R A;  2K04 A;  2PQA B;  3KF6 A;  1LUZ A;  4A3M G;  4IPH A;  4JI4 Q;  1HHV A;  4U68 A;  3H0G B;  2A6E C;  5I6Y A;  2EYP A;  3CXC A;  2DGY A;  5EKK A;  1GUW A;  4C3J B;  4KKT A;  2O2L D;  3CQZ H;  4A3B H;  4LWC A;  1WTP A;  1QNK A;  4OIJ A;  1SJE D;  2FFK B;  5C4J H;  3HOY H;  1FGU A;  2PZT A;  3LNN A;  1A2U A;  3ONA B;  4EVO A;  1FL0 A;  4A4I A;  5BN3 A;  3RNU A;  3OIP A;  2JA5 G;  1MHW C;  4N8X 1;  3M4O B;  5CBE E;  4RGO S;  2EYJ A;  1EYC A;  2RKS A;  2DJF C;  3D4D A;  1CK1 A;  3NE5 B;  1BOS A;  4HMJ A;  1XYI A;  3H91 A;  3I72 A;  5ELF A;  4F88 A;  1SNP A;  1TWG H;  3UDI A;  4B3T L;  3ZYY X;  4CKB A;  3VDY A;  4C3I B;  1YJW A;  3T53 B;  4A3D B;  1XNQ Q;  3KDF A;  3S1Q B;  2B2V A;  3MEF A;  3TZU A;  1EFW A;  1Z7T A;  4MNO A;  4I65 A;  3E9I A;  3HKZ B;  1YHB A;  2ZTC A;  5AFW A;  3VR2 A;  2E2J H;  3PMF A;  2L1B A;  4P72 A;  3TS0 A;  3BZC A;  3W3A A;  4IUR A;  3G6E A;  2F3W A;  4IFD H;  2RHQ B;  2IW3 A;  1D5M C;  5EKI A;  2B2Y C;  2LKV A;  5M3M B;  1NR4 A;  4HED A;  2OEO A;  4J6H A;  4BBR G;  4BY7 B;  3I3C A;  4RKL A;  4IUU A;  2UXB Q;  1X54 A;  4FF3 A;  3E3X A;  5CV7 A;  3CCL A;  4R4C A;  1F2L A;  4A3F B;  5COR A;  1A8V A;  1EY0 A;  2VQF Q;  1I4R A;  3S9W A;  2K5Q A;  3M4Q A;  2A68 D;  2QGQ A;  2ENB A;  3R2T A;  4LFC Q;  2D62 A;  2Q2I A;  1E2W A;  5I9O A;  2O4X A;  4YWK A;  3URY A;  4X6A H;  3P20 A;  4P75 A;  1OXT A;  4DAM A;  1BQQ T;  5IY0 A;  4A76 A;  3I4L A;  4RG1 A;  5IE8 A;  1Y1W B;  3W2D A;  4JBM A;  5FK9 C;  1LTT D;  1CFM A;  4QIW B;  1A63 A;  5CR3 A;  3T56 B;  4IUQ A;  4IZ8 A;  5FLX E;  1LT3 D;  4ABN A;  3S1M B;  3FRP B;  2NVT H;  4BXX G;  3PUY A;  4UY8 C;  5K5P A;  2AMC B;  2LXJ A;  3DM1 A;  3ND9 A;  4P73 A;  4PZ6 A;  4DR4 L;  1SDF A;  1HNZ L;  2F0D A;  3FMC A;  4LUV A;  3TSS A;  4DV4 Q;  1A0I A;  3EBE A;  4O2D A;  4LF7 L;  3S16 B;  3L9A X;  1IBM Q;  1HA5 A;  4DV3 L;  2JA7 G;  1SYD A;  1N33 Q;  3GQB A;  4C2M B;  3DXJ C;  2PZU A;  4JI6 L;  2PI2 A;  1RIP A;  3QIA A;  4ULL A;  2FHT A;  1KXL A;  5JJK A;  3C3L A;  4NP5 A;  4NXM L;  1SYF A;  2B2V C;  3VR3 A;  3NEM A;  4JBK A;  1T5E A;  2RQX A;  1YNJ C;  2LXK A;  1IXR A;  3PUW A;  5BN5 A;  4WJ3 M;  2UXC L;  1HFN A;  2QDB A;  2K28 A;  1FVI A;  5FOB B;  4YIJ A;  5CV9 A;  5E7N A;  2E2I B;  2IWH A;  3F2B A;  3KYH C;  4DV7 Q;  3BDL A;  3DUZ A;  1QB5 D;  5G3L D;  1I4P A;  5JEA H;  3TP6 A;  3VYU A;  2NZH A;  1FR3 A;  2BCO A;  3T1Y Q;  1Q8K A;  2HHH L;  3QOJ A;  1J8I A;  1MGS A;  4OEM B;  3GTQ B;  2XRQ D;  3T13 A;  2NN6 G;  3PO2 G;  1TWA B;  4K8J A;  4X62 Q;  4X64 Q;  4NXN L;  2EYH A;  2NB0 A;  4X3S A;  3H09 A;  5CC4 A;  1TXY A;  5ELO A;  1G6Z A;  1EY8 A;  1HTL D;  3ND8 A;  1Y8P B;  2QEX A;  5IOC A;  4LAA A;  3KDF B;  1GJX A;  2XGT A;  4RHR A;  4CDF C;  1RL2 A;  1I5F A;  3G48 A;  1U4R A;  1Z9F A;  3DWA A;  4LF6 L;  1GXD C;  1JOO A;  4AIM A;  4IFD I;  3CCE A;  4R9W A;  5G3L F;  4KJN A;  5FKA C;  4JI5 Q;  3MXN B;  4XYO A;  3H0G H;  1N34 Q;  2ES2 A;  2AWO A;  3EVQ A;  2I5L X;  2JK8 A;  3ITP A;  1LO5 D;  2IX0 A;  1Q12 A;  4C3J H;  4FO2 A;  3CU7 A;  4FYD A;  2JA8 B;  2J7Z A;  3H3V H;  4DR6 Q;  2F0V A;  5JPN C;  1WTO A;  4YWM A;  1AZQ A;  3I2Z A;  5DM6 3;  1YHA A;  4KHP Q;  2VNU D;  3TDQ A;  1VQK A;  1EU3 A;  2PMZ B;  4JBW A;  3GTP B;  5GAD C;  1SR3 A;  5KNB A;  1OXU A;  1RHP A;  1WYD A;  4DV6 L;  2EXD A;  2I46 A;  1RJT A;  4RCN A;  3M4Y A;  2WAQ B;  2AHO B;  2KBN A;  3U50 C;  5C44 B;  2OF1 A;  4FP5 D;  3PO3 G;  2RSN A;  4C3I H;  4DK0 A;  1S5B D;  4A3D H;  2OT2 A;  3S1Q H;  3T4A C;  4AYB G;  3TP8 A;  3J7A 5;  1VQB A;  4LK1 C;  4K0K L;  5K36 G;  4LF9 L;  2OTJ A;  2KJX A;  3UDX A;  2E74 C;  3A5U A;  2DNE A;  1WOC A;  3CKI B;  5AJ3 Q;  1EY5 A;  4ZUJ A;  5IT9 L;  1VQ9 A;  5M3M H;  1IW7 D;  3X3M A;  4XDX A;  1RTO A;  3JAM i;  4YCV A;  4BY7 H;  2XVS A;  5C3E G;  1VQP A;  2F0K A;  3CPW A;  1PYS B;  5IOD A;  2YU9 B;  1BNZ A;  4JYA Q;  1JWM D;  1II3 A;  4DUZ Q;  3N52 A;  4B3S Q;  1TS2 A;  4NB3 A;  4OX9 L;  2Z4H A;  5KGU A;  3Q0A A;  4L6T B;  1JJC B;  5ELC A;  4AYB E;  1KHI A;  1WCM G;  3RLN A;  4DFA A;  2NBF A;  3OTO Q;  3EIV A;  4HAE A;  1B9N A;  5J22 A;  4BA2 I;  2K03 A;  3P1H A;  3D3R A;  2NWG A;  4Q5V A;  1VQ4 A;  3PV0 A;  3E0E A;  5JAV A;  4JI7 Q;  5FLM G;  3HOZ B;  2BOS A;  5DAU A;  3TP7 A;  3A56 A;  1Y1W H;  3CHB D;  3DWP A;  4XYQ A;  1S5C D;  1IHZ A;  2FXQ A;  1YNN D;  2R92 H;  4CJ2 C;  1V1O A;  1XPR A;  2V1C C;  1BXT A;  1O7I A;  1SJH D;  3ERO A;  2VUM B;  2HDM A;  4IOC A;  3S1M H;  4YY3 Q;  1X3E A;  1PFN A;  4KD3 A;  4X66 L;  2ZTD A;  1K9M C;  2F0N A;  1K0R A;  2HIV A;  4ZK9 B;  1X3G A;  2SNM A;  3KLR A;  2GVA A;  4IQZ A;  1TVX A;  1GM5 A;  4GKK L;  3SK6 A;  2BA0 A;  3S16 H;  2DJG C;  3K59 A;  4B3R L;  2MHV A;  4IPD A;  5EPL A;  2AKW B;  4C2M H;  3BYT B;  1NBW A;  4YCU A;  4L5S A;  4F7X A;  1RTN A;  2ICI A;  3HOX B;  2R93 B;  1QOH A;  2PW7 A;  2H4O A;  5FJ8 H;  4ZLT F;  5IYB H;  2ZTE A;  2TMP A;  1K83 B;  1D5X C;  1FJG Q;  2I5H A;  4GKJ L;  1CKN A;  2Z4I A;  1DOL A;  3H3V I;  3NTK A;  1H9J A;  2A69 C;  4R8N A;  3TEH B;  1Y8N B;  1AW7 A;  4BY1 B;  2EJG C;  2K32 A;  1QIL A;  1MKH A;  1I6H B;  2E2I H;  5C5L A;  1B3Q A;  4TSS A;  1HNX L;  1B4O A;  3M9B A;  3PUV A;  1I4X A;  2OXP A;  1CKO A;  3V2T A;  4A3B G;  5TSS A;  2CW0 D;  4KY7 A;  1LTL A;  4QGU A;  4E6I A;  3TP5 A;  3CD6 A;  3HOY G;  3GTQ H;  5C0X H;  3CME A;  1TWA H;  3KJP A;  3K0X A;  3TS2 A;  3I8Z A;  2PYK A;  2N8N A;  3CCU A;  5JJI A;  2EZV A;  1PXU A;  1TWH B;  5DM7 3;  1HJP A;  1STE A;  1HH2 P;  5DNF A;  4ME3 A;  2XWB B;  4DR5 L;  2E8G A;  4DK3 C;  4TQU S;  1TKW B;  4CBV A;  3AB9 A;  4A3E B;  4XQN A;  4S3S A;  2B29 A;  4EGV A;  1NMF A;  4MTN A;  3SK5 A;  1SBB B;  3RR5 A;  3X3N A;  3E9H A;  2JA8 H;  4IFD G;  1JMC A;  1MSG A;  5I4D A;  1EL0 A;  5I6W A;  5E1F A;  1XPO A;  1B44 D;  4UP7 A;  2KEN A;  1NE3 A;  4HIM A;  5T1G A;  1BCP C;  4I7Z C;  1E0B A;  2F0U A;  1PZK D;  1CA5 A;  2LY7 A;  3G71 A;  3GTP H;  4LFB L;  4G7Z C;  1XNQ L;  4A3J G;  1SEB D;  2EXZ A;  2F1M A;  1PHJ A;  3A74 A;  4PMW A;  2RHS B;  4DR7 Q;  1VS0 A;  3I4M B;  1G6P A;  1RDP D;  5C44 H;  1SND A;  1RCV D;  3SXH A;  1BBW A;  5JEA J;  4MIU A;  2RBM A;  2B39 A;  2K50 A;  2JEA I;  2EY2 A;  3A0J A;  4PNY A;  3PIO 3;  2KEC A;  1SNQ A;  5GAG C;  3M7G A;  4DV0 L;  2MNA A;  3G4S A;  1D1I A;  3GTM B;  4JI8 L;  3NXW A;  1XNR Q;  4Y7N B;  4LMQ D;  4ZYS A;  4GNX A;  4YHH L;  3JAM E;  2EY5 A;  2VY3 A;  2VQF L;  1VF5 C;  2D0P A;  1Z6H A;  3S24 A;  5IYC H;  2EY6 A;  1EIY B;  3VR4 A;  1BCP B;  1TR5 A;  4V19 0;  4RAU C;  2B8G A;  3MXU A;  1MJE A;  4IOA A;  4EQP A;  1CSQ A;  1VQJ A;  1N32 Q;  1VQL A;  4GN4 B;  2KCN A;  2F4V Q;  3HP3 A;  2PQE A;  1W6K A;  4C1N K;  4HR7 B;  4HMI A;  2QCP X;  3DEO A;  1WI5 A;  3G6J B;  5A2Q L;  1KRS A;  3WDN A;  3BVG A;  1CKN B;  1TY0 A;  5T1I A;  3LWU A;  4QY7 A;  1C7Y A;  5ELE A;  2CWP A;  4KI0 A;  3I4N B;  2A6E D;  3L3O C;  3I90 A;  4OGQ C;  1ZXT A;  2KED A;  3GV6 A;  2B8F A;  3OW7 A;  1P8L A;  3LWE A;  1JR0 D;  1PVO A;  4RA8 A;  1N36 Q;  5C0X I;  2CQA A;  2F0W A;  2OTL A;  2N88 A;  1PMR A;  1EYA A;  5JEA G;  3NWS A;  4PMB A;  2B2Y A;  1JE5 A;  4BA1 I;  3A7A B;  4KN7 C;  3HOV G;  3QOL A;  4JVZ A;  2UUC L;  2AUK A;  1DJR D;  3T16 A;  1FNU A;  3MA2 B;  1B53 A;  4TRD A;  3EN2 A;  2A6H C;  2NVY B;  4X65 Q;  4DR1 Q;  4JI2 L;  1A15 A;  1CUK A;  3HOX H;  2R93 H;  1L0W A;  4DV2 L;  4PZ8 A;  1B50 A;  1K83 H;  2F0P A;  2VB3 X;  2Q8R E;  3W5O A;  3HZX A;  4DAP A;  2VQE Q;  2E5L Q;  4BY1 H;  1D2B A;  1GHK A;  2CH4 A;  3S2H B;  3NBH A;  3T1Y L;  3RN2 A;  1I6H H;  4M1U B;  4N9P A;  4GNX C;  5M9O A;  1U4M A;  1XX8 A;  1EIF A;  4DKA C;  2EYL A;  4BWG B;  3I7F A;  4C3J G;  1IBL Q;  3RLO A;  1EY6 A;  3W1B A;  2AUJ D;  1ILQ A;  1PYW D;  2C9O A;  1SN8 A;  3NBI A;  3M4P A;  1WVL A;  1SLJ A;  3CCS A;  2JP1 A;  1B7Y B;  1I4H A;  3BZK A;  4HSV A;  1GD7 A;  2L4N A;  1QZH A;  4P74 A;  1JC7 A;  1NR2 A;  3V96 A;  1RKN A;  2E2D C;  4EQO A;  1VQI A;  3AMU A;  1VQ7 A;  5M5W B;  2JYO A;  3S1R B;  4RH6 A;  4C3I G;  4A3D G;  2UXD Q;  3C2P A;  2R7Z B;  4CDC C;  2BDO A;  2KCC A;  4A3E H;  4XIG S;  5COY A;  1EYD A;  4DAV A;  1YIT A;  3FEW X;  4FXK C;  4LFA Q;  4KN4 C;  1Z47 A;  4GN5 A;  5LMU L;  4HID A;  4XXE A;  4GNX B;  4H44 C;  3J7A F;  4KHP L;  2J0T D;  3FPP A;  4L5Q A;  1ILP A;  3GTK B;  1SMY D;  4DN4 M;  4C1N I;  1ICF B;  1WJJ A;  1HQM C;  1XMQ L;  5M3M G;  2UUB L;  4AQY Q;  3S1N B;  2CWA A;  2KQ3 A;  4TKO B;  4BY7 G;  3P7J A;  2NYZ D;  2ID0 A;  1R4Q B;  1Y1V H;  1O7Y A;  1O78 A;  3SVM A;  3I4M H;  3J80 L;  1N8R C;  1LM0 A;  4I7A A;  4F8M A;  3OYY A;  1C9O A;  4UP9 A;  2MQH A;  3OWE B;  1CHQ D;  2B2W A;  1RD9 D;  4A3G G;  3A8K E;  3UE1 A;  5AJ3 L;  2CFM A;  1YNJ D;  3LGJ A;  2ICE C;  1J5E L;  5BR8 Q;  4RCO A;  1PDQ A;  1Y1W G;  2A5H A;  5KIX A;  1QUQ A;  1KD1 C;  3K81 C;  5H1S E;  3GTM H;  2R92 G;  2EJM A;  4JYA L;  3M3Y B;  2QEJ C;  2I5M X;  4DUZ L;  2Z6B A;  3BVM A;  1ESF A;  1E2Z A;  4HCE A;  1EQV A;  3I4O A;  5HGT A;  2NVQ B;  1G2T A;  5C3X A;  1YEZ A;  1NY4 A;  1QVF A;  3PF5 A;  1K0S A;  4DR3 Q;  1D5Z C;  2FMC A;  4RGN A;  4LF4 L;  5ELN A;  4DV1 Q;  3FPU B;  4A93 B;  4QCL A;  1AE2 A;  3K5N A;  1AH9 A;  5C4X B;  4CDE C;  3NEN A;  3OMC A;  3JC6 6;  1FNV A;  2GVB A;  2ZXR A;  3UDF A;  4EX5 A;  1EOT A;  5IT9 c;  4DR2 Q;  3U58 A;  1X65 A;  2AQ2 B;  3BJU A;  4KHZ A;  2A19 A;  4X3U A;  3K5O A;  4BBS G;  3D0F A;  4QIW E;  2WII B;  3KLW A;  2NVX B;  1STG A;  2JEB I;  3E0J A;  1S5E D;  2ZXO A;  3HG9 A;  5FJ8 G;  4GOP A;  5IYB G;  1I4G A;  4JBJ A;  3D4W A;  1ZYR C;  5CV4 A;  3I4N H;  2C35 B;  2D2C C;  3NBH B;  1Y69 U;  3KF6 B;  3ULP A;  1X6O A;  2L15 A;  3D6W A;  3K6O A;  2MO0 A;  5IT9 E;  5EAY A;  4ODG A;  4CHT B;  4IUT A;  5M3F B;  4TVA B;  4PG3 A;  2PO4 A;  3J7A V;  2QA4 A;  4R4I A;  3I73 A;  1V1Q A;  2JA7 B;  3PIO A;  1B8A A;  4JV5 Q;  2ZM6 Q;  1CQV A;  2FIN B;  2L11 A;  4K5V A;  3GTJ B;  1T9H A;  4B9X A;  3KFU A;  4LUZ A;  1R4P B;  4CJ0 B;  3J81 L;  1S40 A;  2K4K A;  2K7V A;  4LF5 Q;  1Q1B A;  5C0X G;  3C1E A;  1G91 A;  1CKM A;  1GUN A;  3HOU B;  1LV9 A;  4XT1 B;  3TME A;  2NVY H;  5FO9 B;  3ULJ A;  3F2C A;  1UEB A;  1HZC A;  3DWQ A;  2B2W C;  1PFM A;  5CGK A;  3U9O A;  4JI3 Q;  5C6A A;  2K5V A;  5LL6 S;  1ZEQ X;  2Q8I B;  1AZP A;  3PUZ A;  3RUZ A;  1MJC A;  2UUA L;  1HFG A;  1C0A A;  4DUY L;  4U67 3;  3K57 A;  2EE1 A;  2B63 B;  3S2H H;  4MHE A;  1VQO A;  2VZA A;  3GTO B;  1JOK A;  1CZG A;  4H7B A;  3M7N A;  3I91 A;  3PO2 B;  3K58 A;  2JA8 G;  2JJQ A;  3OMG A;  2BE5 C;  1MD2 D;  1XPU A;  1CQF A;  1U5K A;  1GO3 E;  4OO1 H;  4BS9 A;  2K1B A;  4MN3 A;  2RVL A;  1O7Z A;  4NMZ A;  1JB7 A;  3M4O H;  1I94 L;  2KCM A;  3CMA A;  4B3T Q;  2B2U A;  5M5W H;  3S1R H;  2WAQ G;  2MO1 A;  2JXM B;  1HNW L;  5IP9 H;  1HZB A;  2R7Z H;  1VCI A;  4GOP C;  2HIX A;  1PRT C;  4DK6 C;  1QUQ B;  3GTL B;  5FLX L;  2XTI A;  3R3O A;  2RCF A;  1G51 A;  2KEE A;  2PCF B;  2SNS A;  4OWT B;  3R2I A;  1CTM A;  3G7L A;  1BBX C;  3GTK H;  5IGC A;  2WB1 B;  4DV5 Q;  4B3M L;  4DXG A;  3NHH A;  1P16 A;  4A3I B;  4J8Q A;  2PMZ E;  1D8L A;  4FF4 A;  3HRZ C;  3S1N H;  2F0T A;  1HUM A;  2F52 A;  2K14 A;  2WV6 D;  3QWN A;  1VMP A;  2KCT A;  4CDD C;  2D9U A;  4O1N A;  3RZO B;  2N55 A;  2EIF A;  1DCZ A;  4AYB B;  3L7Z C;  2WAQ E;  4IJH A;  4QQB X;  2QF7 A;  1CSP A;  2UU9 Q;  2DN8 A;  4A3F H;  1GHJ A;  2Y0S G;  4K8I A;  3GD7 A;  4OEL B;  1J9O A;  1DXM A;  5D65 A;  3ULL A;  1C48 A;  1TU2 B;  2BH2 A;  4IN3 A;  1L2F A;  2X6L A;  5EPJ A;  4GOP B;  2F4I A;  1PRT B;  5CV8 A;  2JQO A;  4KY6 A;  4PQX A;  1YI2 A;  4QF4 A;  2L5T A;  3CCR A;  2H1E A;  4WOR A;  3GO5 A;  4M8A A;  2DY8 A;  5EKL A;  2ATW A;  2F0J A;  1CT1 D;  3M3Y H;  1EY9 A;  4R4O A;  1VQA A;  3PUX A;  4KJO A;  2E2H B;  2NVQ H;  1IBK L;  1HNZ Q;  5LL6 X;  1SXT A;  5I2X A;  1LTB D;  1VDZ A;  4P2C B;  2N3S A;  4A93 H;  2Y0S E;  4HJ5 A;  5C4X H;  1NNX A;  2ZJQ A;  2Z6K A;  4LF7 Q;  2KOL A;  1STN A;  1HR0 L;  1VQ6 A;  2VXW A;  1IYV A;  3J80 i;  4CKC A;  1MIU A;  4DV3 Q;  1D6E C;  2F0Q A;  1KDA A;  4JI1 L;  2E75 C;  4JI6 Q;  4XQJ A;  1ZKO A;  4F87 A;  2B2U C;  3O13 A;  3S15 B;  4LF8 L;  1VQ8 A;  2F0G A;  2PPB C;  3S2D B;  3CF5 A;  4HJ8 A;  1DM0 B;  1K8A C;  4FF1 A;  2R93 G;  5FO8 B;  4NXM Q;  3T51 B;  1PH2 A;  2NVX H;  4IFD J;  3DM3 A;  4DA2 A;  3RZD B;  3KLS A;  3D31 A;  5CV6 A;  1LAB A;  3R8B A;  3E6Z X;  5E4W C;  4DNR B;  3J81 j;  1U9R A;  2UXC Q;  4X3K A;  1R9T B;  3BYY B;  4APV A;  3BS1 A;  4L5R C;  1SRO A;  3Q6S A;  1YJ9 A;  4BY1 G;  1S5F D;  4RGT A;  5M3F H;  3HS0 C;  2EPB A;  1SNC A;  4JI0 Q;  3MHB A;  1D7Q A;  4OO1 I;  1VQN A;  1ENC A;  1JCK B;  1TS3 A;  1NJI C;  2F03 A;  1I3Q B;  3GTJ H;  4LUO A;  3CAM A;  5IYD H;  1BCP D;  4DR1 L;  1TQO A;  1ET9 A;  4A3L H;  2EQS A;  5KEE A;  3MFG A;  3L2P A;  3HOU H;  1I4Q A;  3FKI B;  1HA6 A;  1SFO B;  3T1H L;  2R61 A;  4ALP A;  5J3B A;  4H0L C;  3SK4 A;  5A2Q E;  4V0B A;  1WTX A;  2VQE L;  2ALY B;  1A3U A;  4LW1 A;  1TS4 A;  4C3H B;  4JI4 L;  4IPC A;  4ID6 A;  1B3A A;  2QKI C;  3DMU A;  4K5W A;  3A7L A;  1PA6 A;  4MZ9 A;  3VYR A;  2Z9H A;  1I6V C;  1B9M A;  2B63 H;  3FHW A;  4Z9C B;  3GTO H;  1DZ1 A;  1PV4 A;  4L63 B;  5C4J B;  1WTH A;  3HOY B;  1HQR D;  2F0S A;  4HJ7 A;  4QUF A;  1B2T A;  4FDB A;  5IWA Q;  1JJG A;  2ASB A;  3H15 A;  3UE0 A;  1PTO C;  1CM9 A;  1HUN A;  1SYG A;  1QNU A;  1VQD A;  2ZT9 C;  3J81 i;  2Z6K C;  2L0C A;  1AE3 A;  1UAP A;  3Q24 A;  2EVB A;  3CC7 A;  1KQS A;  3GV3 A;  3K8A A;  3GTG B;  3PIP 3;  4ME5 A;  4ZRZ A;  1Y1V G;  4DV6 Q;  2XNA C;  1O80 A;  1I50 B;  1SE3 A;  1LT4 D;  3P75 A;  1TII D;  1MI2 A;  1E3P A;  3UDG A;  3I4M G;  4DPG A;  5IGB A;  3ERQ A;  2IHF A;  2EDG A;  2YTY A;  1X56 A;  4B08 A;  1XJV A;  4POG A;  1EFI D;  1EWC A;  4FVM A;  2HT1 A;  3GTL H;  4K0K Q;  4LF9 Q;  5HY6 A;  2CKZ B;  5D14 A;  4A3K B;  1UEA B;  3KK7 A;  1V43 A;  2RF4 A;  1MSH A;  4RWS C;  2DNC A;  3SGI A;  2I0Q A;  1X9N A;  4O42 A;  1PTO B;  4A3I H;  4A3J B;  2UXB L;  1YBY A;  2H5X A;  4FXD A;  3ERS X;  1A62 A;  4CJ1 B;  1L1O A;  2K5N A;  1H9S A;  4JW0 A;  3RZO H;  5JOB A;  1HTP A;  3D8G A;  2DY7 A;  4LFC L;  4OX9 Q;  3RMH A;  2YU9 H;  3J7Y W;  3E5S A;  2A6H D;  3NTI A;  3HOW B;  3CCM A;  5EGT A;  3K80 C;  4PV1 C;  1O7L A;  2X69 A;  1BDO A;  2IX3 A;  3IKJ A;  4NPS A;  5LMN W;  5EBD A;  3RN5 A;  3J7Z C;  1KL9 A;  4HJ9 A;  1RF2 D;  1HZA A;  2XRS D;  1FD7 D;  4HN7 A;  3K5L A;  3CRL C;  1SRU A;  2KHI A;  3BDC A;  3TN2 A;  1Q90 A;  3HOZ H;  3I4N G;  4QJF A;  3CRK C;  5M5Y B;  3J80 c;  4FF2 A;  1OTC A;  4DV1 L;  5JJZ A;  4DGZ A;  2CCZ A;  1A6X A;  3MTS A;  1UE7 A;  2E2H H;  4DV4 L;  1Q81 C;  3SR1 A;  2VUM H;  4WFN 3;  1LTA D;  4X66 Q;  1F2M A;  1XTC D;  3FVQ A;  4LJZ C;  4XTC S;  4AH6 A;  4DR2 L;  1IBM L;  5LHY 1;  4OL7 A;  2MGS A;  1DYQ A;  1W6J A;  4NW2 A;  1M4V A;  1N33 L;  1XTD A;  2VL6 A;  4UHV A;  3MFY A;  4B3R Q;  3F1Z A;  3J80 E;  2F3I A;  2F3V A;  1E1T A;  2M2L A;  1VQE A;  2IHE A;  1IZ6 A;  1PH7 A;  4N8F A;  2K33 A;  3WOE A;  2B3G A;  3S2D H;  3QG1 A;  1E1O A;  3HGB A;  4WJW A;  3WWV A;  3GDE A;  2RSO A;  2NTS A;  4K5X A;  3RZD H;  1XMO Q;  1PZI D;  5NUC A;  1ROD A;  1E7Z A;  4JV5 L;  2WAC A;  1VMC A;  4DV7 L;  1R9T H;  3H3V C;  3R93 A;  1EIH A;  2RA4 A;  2V4D A;  2OQK A;  3KF8 A;  3HOV B;  1V9P A;  1CI3 M;  1ESR A;  1HNX Q;  5CMD A;  2J4X A;  3H0G G;  5IGG A;  5GAH C;  3I56 A;  1L1O C;  1I3Q H;  1G29 1;  2HCI A;  4X62 L;  3STB C;  1LAC A;  1F9S A;  2R3Z A;  4GN3 B;  4X64 L;  2JA6 B;  2SDF A;  4NKL A;  2ZJR A;  2EJF C;  3CCV A;  2VW9 A;  1M8A A;  3FKI H;  4OO1 G;  5JVH 3;  5CBA E;  5I2Y A;  1SFO H;  1EYG A;  1NSN S;  4HIK A;  4IJL A;  3TRZ A;  5DLQ E;  3F2D A;  2F0F A;  3NQI A;  4A3C H;  1TWH H;  4A3M B;  4OWX B;  4C3H H;  4QUC A;  4DR5 Q;  3J81 c;  4JI5 L;  4GLV B;  1N34 L;  4KK7 A;  5IP9 G;  1LT6 D;  2CVR A;  2R7Z G;  4KV6 A;  2IX1 A;  4IAL A;  1PZJ D;  2CHB D;  1ONL A;  2IY5 B;  1X55 A;  1ENF A;  3JAM L;  4DR6 L;  4B9W A;  3NUC A;  3Q8D A;  2D5D A;  3HKZ G;  1KAB A;  1CA6 A;  1WFQ A;  1K8G A;  2A73 B;  1L1O B;  1SE2 A;  1UE1 A;  1EY7 A;  1H9S B;  1SMX A;  1YVC A;  3J81 E;  2JA5 B;  1JOR A;  2HUG A;  1M1K C;  1OO9 B;  4N9T A;  5IGF A;  1K8O A;  2PNH A;  3IFD A;  1IYJ B;  1UUP A;  4K6L A;  1QZG A;  3PCO B;  1C8C A;  3GTG H;  1BF4 A;  4LFB Q;  1VQ5 A;  3BG3 A;  1I50 H;  3ER0 A;  2K05 A;  3I55 A;  1IKM A;  4HIO A;  4IUN A;  3TBI B;  4A3F G;  1PH4 A;  5IP7 H;  4QB4 A;  3MXN A;  5CYU A;  1AN8 A;  4X3T A;  4DV5 L;  1ZYR D;  3H6M A;  3HKZ E;  2KA7 A;  4GLA C;  4A3K H;  1VQG A;  4DXF A;  3EFX D;  4DV0 Q;  1SE4 A;  4JI8 Q;  1NCV A;  5C0X J;  4BBR B;  1VQH A;  1IL2 A;  4G4K A;  1PTO H;  1YJN A;  1TWC B;  4A3J H;  4YHH Q;  1EZ6 A;  2Q2T A;  4Y7N H;  2K5W A;  3C1F A;  2VB2 X;  4WJ4 A;  1HXY D;  4KKS A;  4EQN A;  4B3S L;  2UU9 L;  1G8Z D;  5F2D A;  4IUP A;  1KLU D;  3BDO A;  5FLX c;  1TWF B;  2Q2U A;  1KAA A;  3KBG A;  4L5T A;  4YWL A;  1KDB A;  3EQL C;  4A3G B;  2F0H A;  2FMM A;  4ZCK A;  4A93 G;  2EYM A;  5GRO A;  3H94 A;  5C4X G;  2F0M A;  1TS5 A;  3FP9 A;  3OTO L;  2PW5 A;  3HOW H;  1U0L A;  4JCV E;  2EYO A;  1ML0 D;  4R4Q A;  2F0I A;  3A54 A;  2AQ1 B;  4O0A A;  4JI7 L;  1DGS A;  3F8T A;  3DHQ A;  2IL8 A;  2QW7 A;  4IUV A;  2R92 B;  1X3Q A;  2YV5 A;  3PIP A;  1BO0 A;  4ZQ3 A;  4JPB W;  1HPC A;  4UDU C;  3V05 A;  4KKU A;  2XIW A;  1SYC A;  1H9R A;  1AEX A;  4HCS A;  2BDN A;  4MTK A;  1V8Q A;  4RGM A;  1CZW A;  3ZJY C;  1SMY C;  2K6A A;  4YY3 L;  3Q23 A;  1UNS A;  1IL8 A;  3KF8 B;  5LMN Q;  3CCJ A;  5M5Y H;  1GUS A;  4HJA A;  2JN4 A;  1PH9 A;  5IGE A;  3DLL A;  3NEL A;  4HSP A;  1PH6 A;  5EJW A;  4ZKB B;  2JSO A;  3K0Y A;  4DAY A;  5M3F G;  1YZ6 A;  3PGZ A;  2BE5 D;  5J39 A;  3RLF A;  1JWS D;  1F77 A;  1LYL A;  1TT2 A;  1YHQ A;  3AU7 A;  3SEB A;  3MXG A;  2NTT A;  5IYD G;  4LNQ A;  2OWO A;  4BBS B;  2Q8T A;  3VR6 A;  3U4Z A;  4A3L G;  5ISR A;  2UUC Q;  4JG2 A;  4WRD A;  1SE8 A;  3OW2 A;  4EQ5 A;  2A68 C;  4KD4 A;  3M85 A;  3HOU G;  2YYZ A;  1STA A;  1BUV T;  4JI2 Q;  5E4X A;  4K6D A;  5L37 A;  1QCB D;  1FJG L;  3HFZ B;  1Q46 A;  4DV2 Q;  1PH8 A;  1PRT D;  1EUJ A;  2YTX A;  5JVG 3;  2P5Z X;  4H02 A;  4JI0 L;  2Q2H A;  3VYS A;  5I9P A;  3AFQ A;  3F2U A;  1S72 A;  3WOF A;  1NTG A;  2Z8L A;  3NWT A;  2KUM A;  2B63 G;  3HOV H;  1K73 C;  1ASZ A;  4UPA A;  1GUG A;  2A1A A;  2CQO A;  3K7U C;  5DEH A;  3D6C A;  4G57 A;  5M5X B;  3K7A B;  1EZ8 A;  4JK1 C;  5IIF A;  1WTR A;  1QE6 A;  2PZW A;  2JA6 H;  2NZO A;  4J1M A;  2F0O A;  3IL8 A;  4QMG A;  3MZ5 A;  3TRE A;  2XN9 C;  1PRT F;  2PNR C;  2I07 B;  1QVG A;  3PSI A;  4Y52 H;  3TZD A;  1S4Z A;  3BVZ A;  3D4R A;  2LMC B;  3AYH B;  1KTK A;  2D0O A;  1QJO A;  2HCC A;  2K5D A;  2IJ0 A;  1VQF A;  4R8I A;  2LSS A;  4A3M H;  3A5Z B;  1D1K A;  4KY5 A;  1Y8O B;  2KHS A;  2F0E A;  4IO9 A;  3DEP A;  5IWA L;  5C44 G;  1PFB A;  2SEB D;  1NMG A;  1KRT A;  3HKS A;  1F9Q A;  1VF7 A;  3BU2 A;  4JOI A;  5LMU Q;  4XT3 B;  4GZY C;  3A8J E;  3NTH A;  4C56 C;  1F9P A;  2WB1 G;  2MPM A;  3U9S A;  2NZ1 D;  3TQY A;  2JA5 H;  4A3I G;  2R7F A;  1CHP D;  1X3P A;  2GN5 A;  1XMQ Q;  2UUB Q;  4P71 A;  1JT8 A;  4PZ7 A;  2XSC A;  4OWW B;  1U4P A;  5D3I B;  3I70 A;  3MXP A;  1QG7 A;  4DR7 L;  3MWY W;  5CV5 A;  2WKC A;  1H9K A;  5IYC G;  2TSS A;  2CH4 W;  3PO3 B;  5C4Z A;  1S5D D;  4KLK A;  1B70 B;  2DUD A;  4QL5 A;  4XQQ A;  1WTQ A;  2RCN A;  2MP1 A;  1Q8I A;  1H9M A;  1J5E Q;  1XNR L;  3A8I E;  1A3T A;  2WB1 E;  4RFB A;  4K2K A;  1JWU D;  4ZKC B;  1LTR D;  3OSO A;  3HOZ G;  1HRJ A;  2A69 D;  1JB3 A;  1QVC A;  4BBR H;  4RMF A;  4DAY B;  1MBY A;  3OOC A;  5C3E B;  1WD0 A;  1HR0 W;  1TWC H;  4G7H C;  1BVS A;  1JQY D;  1SYE A;  1UWV A;  5J1Z A;  1L0X B;  2VUM G;  1T5X D;  1IKL A;  2WFW A;  4DK1 A;  2Y0S B;  2MUY A;  2MJ8 A;  1OXX K;  1TWF H;  4FXG C;  5A35 A;  1GOZ A;  4DR4 Q;  2MFI A;  1M90 C;  4LF4 Q;  2KVM A;  4A3G H;  1N32 L;  1HCZ A;  2F4V L;  1AP0 A;  1WCM B;  1FYC A;  2K52 A;  2O5J C;  4KHV A;  1EIG A;  1XXG A;  2PI2 E;  4KTA A;  2GA4 B;  3FDT A;  1QWY A;  3UI2 A;  1JJ2 A;  3S14 B;  3VA5 A;  5IGD A;  5KND A;  1W3S A;  4YCW A;  3NPP A;  3CCQ A;  1N9W A;  1DOM A;  4DNT B;  3CC4 A;  4K14 A;  1EEF D;  1F2Y A;  3HOX G;  2LS0 1;  4BXX H;  4JOI C;  3SK8 A;  4ILW A;  5ELD A;  1U4L A;  1YNX A;  1SNM A;  1X3F A;  1N36 L;  1WTV A;  1E2V A;  2M9V A;  4UAI A;  2RDF A;  1IW7 C;  1PTO D;  3QJY A;  2LFN A;  1BBU A;  3W1G A;  4CKE A;  1A3V A;  3CW2 C;  3K5M A;  1S3O A;  2QDL A;  2Z1C A;  3CC2 A;  2JA7 H;  2EY1 A;  2C5C A;  4BBS H;  3HEJ A;  1A2T A;  2X6G A;  1V1P A;  2Z0S A;  4X65 L;  3IRB A;  1Q86 C;  1E22 A;  2HHH Q;  2KHJ A;  1XMO L;  4OON A;  1HZ9 A;  3S17 B;  3FKI G;  2B2T A;  5KRU A;  3PF4 A;  5JPM C;  4NXN Q;  4POF A;  1EY4 A;  1XWE A;  1EQT A;  3OPO A;  4R1J A;  4KMU C;  5GAE C;  1KLG D;  2HQL A;  3B6Y A;  4A3C G;  1LTG D;  2OCE A;  3NSW A;  2E5L L;  1PTO F;  4C3H G;  3VA7 A;  2UUA Q;  2XWJ B;  4OIK A;  1JIC A;  4DUY Q;  1YNN C;  4OXP A;  1IYU A;  1STY A;  5C5M A;  1OXV A;  3LX0 A;  2ZXP A;  1GVP A;  3L0O A;  2E76 C;  3ICE A;  5EPK A;  1AFP A;  1K8M A;  4A75 A;  1IBL L;  4IPG A;  4LF6 Q;  3CQZ B;  2IT1 A;  1GUT A;  1YIJ A;  4A3E G;  4A3B B;  5JJL A;  4GS3 A;  4R4T A;  1BCP F;  5EQ0 A;  1H95 A;  5M5X H;  3K7A H;  2NN6 H;  3PO2 H;  5FO7 B;  2JA9 A;  3C46 A;  1PH1 A;  1SYB A;  1KAW A;  3KUP A;  1W2B A;  1Y14 B;  1PYB A;  4K2L A;  3KLS X;  2VS1 A;  3KJO A;  2HD3 A;  3AFP A;  2G9H D;  4CGY B;  1UE6 A;  3SE0 A;  1X32 A;  4GLX A;  1TWG B;  1JE4 A;  5E3F A;  2WIN B;  2HDL A;  3MVV A;  1PFS A;  1EWI A;  2M00 A;  3BZD B;  1Q3L A;  1I94 Q;  3OWF A;  2UXD L;  3IFT A;  2N49 A;  4RHS A;  2L12 A;  3IAY A;  2AQ3 B;  5IP7 G;  3N6R A;  4UP8 A;  1G2S A;  4LFA L;  1HNW Q;  1STH A;  2PQA A;  4HTH A;  2E2J B;  3MEH A;  1KIX A;  1FGB D;  1EEI D;  1L0Y B;  1KNE A; 
#chains in the Genus database with same CATH homology
 4OHJ A;  5ELB A;  4Q0F A;  1SAP A;  1DD2 A;  1EU4 A;  1BR9 A;  2G9D A;  2BA1 A;  1Y1V B;  2L55 A;  1JOQ A;  5KYL A;  2CW0 C;  1NAP A;  2K01 A;  1LT5 D;  2FJ2 A;  2JE6 I;  3NK9 A;  1DOK A;  5D3D A;  2B2T C;  5BN4 A;  2F0L A;  2SOB A;  3EJI A;  2WP8 J;  5K36 H;  2EOT A;  3RD4 A;  2RDG A;  1SNO A;  3EA6 A;  3VYT A;  3A55 A;  3KBX A;  3OIQ A;  4FNF A;  1Q1E A;  3MAQ A;  2NVT B;  1STB A;  3NP8 A;  1PLF A;  2WKD A;  2EYF A;  3SHL A;  1LLR D;  1ET6 A;  1GUO A;  1V1P B;  4G7O C;  3QO2 A;  1OXS C;  1F2Z A;  1SSO A;  3NQT A;  4ZAI A;  2IPK D;  3Q22 A;  4ZUI A;  4NDX A;  2R6G A;  1ENA A;  5EBC A;  2O5I C;  4H13 C;  1B1Z A;  1FNW A;  3MC0 B;  1WD1 A;  4RKB A;  3QB3 A;  5C3W A;  2AWN A;  1ICW A;  5KYI A;  2NUC A;  1DON A;  1EWH A;  2QIL A;  5C4H A;  2NN6 I;  4DU9 A;  4DF7 A;  3GP7 A;  1TY2 A;  2HQE A;  5HUR A;  5KNC A;  2L9H A;  1KNA A;  1KDC A;  1C4Q A;  4PMC A;  3OHX C;  3VR5 A;  1LTI D;  4L8J A;  1F9R A;  3SDZ A;  1WTW A;  1NUC A;  2A74 C;  2RDH A;  1LTS D;  2K04 A;  1HHV A;  4U68 A;  3H0G B;  2A6E C;  5I6Y A;  2EYP A;  5EKK A;  1GUW A;  4C3J B;  4KKT A;  2O2L D;  1WTP A;  1QNK A;  4OIJ A;  1SJE D;  2FFK B;  2PZT A;  3LNN A;  1A2U A;  3ONA B;  4EVO A;  5BN3 A;  3OIP A;  3M4O B;  5CBE E;  4RGO S;  2EYJ A;  1EYC A;  2RKS A;  3NE5 B;  3D4D A;  1CK1 A;  1BOS A;  4HMJ A;  1XYI A;  3H91 A;  3I72 A;  5ELF A;  4F88 A;  1SNP A;  3ZYY X;  4CKB A;  4C3I B;  4A3D B;  3T53 B;  3S1Q B;  2B2V A;  3TZU A;  1Z7T A;  4I65 A;  3HKZ B;  5AFW A;  3VR2 A;  3PMF A;  2L1B A;  3W3A A;  4IUR A;  2F3W A;  4IFD H;  2IW3 A;  1D5M C;  5EKI A;  2B2Y C;  2LKV A;  5M3M B;  1NR4 A;  4HED A;  2OEO A;  4J6H A;  4BY7 B;  3I3C A;  4RKL A;  4IUU A;  4FF3 A;  5CV7 A;  1F2L A;  4A3F B;  5COR A;  1EY0 A;  1I4R A;  3S9W A;  2K5Q A;  2A68 D;  2ENB A;  3R2T A;  2D62 A;  1E2W A;  5I9O A;  2O4X A;  3URY A;  3P20 A;  1OXT A;  1BQQ T;  3I4L A;  1Y1W B;  3W2D A;  5FK9 C;  1LTT D;  1CFM A;  4QIW B;  5CR3 A;  3T56 B;  4IUQ A;  4IZ8 A;  5FLX E;  1LT3 D;  4ABN A;  3S1M B;  3FRP B;  3PUY A;  5K5P A;  3DM1 A;  3ND9 A;  1SDF A;  2F0D A;  3FMC A;  3TSS A;  3S16 B;  3L9A X;  1HA5 A;  1SYD A;  3GQB A;  4C2M B;  3DXJ C;  2PZU A;  3QIA A;  4ULL A;  2FHT A;  3C3L A;  4NP5 A;  1SYF A;  2B2V C;  3VR3 A;  1T5E A;  2RQX A;  1YNJ C;  5BN5 A;  3PUW A;  1HFN A;  2QDB A;  2K28 A;  5FOB B;  4YIJ A;  5CV9 A;  2E2I B;  2IWH A;  3BDL A;  3DUZ A;  1QB5 D;  5G3L D;  1I4P A;  5JEA H;  3TP6 A;  3VYU A;  1FR3 A;  2BCO A;  3QOJ A;  1J8I A;  1MGS A;  3GTQ B;  2XRQ D;  3T13 A;  2NN6 G;  1TWA B;  4K8J A;  2EYH A;  2NB0 A;  4X3S A;  3H09 A;  5CC4 A;  1G6Z A;  1EY8 A;  1HTL D;  3ND8 A;  1Y8P B;  5IOC A;  4LAA A;  1GJX A;  4RHR A;  1U4R A;  3DWA A;  1GXD C;  1JOO A;  4IFD I;  4R9W A;  5G3L F;  4KJN A;  5FKA C;  4XYO A;  2AWO A;  3EVQ A;  3ITP A;  1LO5 D;  2IX0 A;  1Q12 A;  4FO2 A;  3CU7 A;  4FYD A;  2JA8 B;  2J7Z A;  2F0V A;  5JPN C;  1WTO A;  1AZQ A;  5DM6 3;  2VNU D;  3TDQ A;  1EU3 A;  2PMZ B;  4JBW A;  3GTP B;  5KNB A;  1OXU A;  1RHP A;  2I46 A;  1RJT A;  4RCN A;  3M4Y A;  2WAQ B;  5C44 B;  2OF1 A;  4FP5 D;  2RSN A;  4DK0 A;  1S5B D;  2OT2 A;  3T4A C;  3TP8 A;  4LK1 C;  5K36 G;  2KJX A;  2E74 C;  2DNE A;  3CKI B;  1EY5 A;  4ZUJ A;  5IT9 L;  1IW7 D;  3X3M A;  4XDX A;  1RTO A;  2XVS A;  2F0K A;  5IOD A;  2YU9 B;  1BNZ A;  1JWM D;  1II3 A;  3N52 A;  1TS2 A;  2Z4H A;  5KGU A;  3Q0A A;  4L6T B;  5ELC A;  4DFA A;  2NBF A;  4HAE A;  1B9N A;  5J22 A;  4BA2 I;  2K03 A;  3P1H A;  3D3R A;  2NWG A;  4Q5V A;  3PV0 A;  5JAV A;  3HOZ B;  2BOS A;  5DAU A;  3TP7 A;  3A56 A;  3CHB D;  3DWP A;  4XYQ A;  1S5C D;  1IHZ A;  1YNN D;  4CJ2 C;  1V1O A;  1BXT A;  1SJH D;  3ERO A;  2VUM B;  2HDM A;  1PFN A;  4KD3 A;  2F0N A;  4ZK9 B;  2SNM A;  3KLR A;  4IQZ A;  1TVX A;  3SK6 A;  2BA0 A;  3K59 A;  2MHV A;  5EPL A;  3BYT B;  4F7X A;  1RTN A;  2ICI A;  3HOX B;  2R93 B;  1QOH A;  2PW7 A;  2H4O A;  4ZLT F;  2TMP A;  1K83 B;  1D5X C;  2Z4I A;  1DOL A;  3NTK A;  1H9J A;  2A69 C;  4R8N A;  1Y8N B;  1AW7 A;  4BY1 B;  2EJG C;  2K32 A;  1QIL A;  1I6H B;  5C5L A;  4TSS A;  1B4O A;  3PUV A;  1I4X A;  2OXP A;  3V2T A;  5TSS A;  2CW0 D;  4KY7 A;  4E6I A;  3TP5 A;  5C0X H;  3I8Z A;  2PYK A;  2EZV A;  1PXU A;  1TWH B;  5DM7 3;  1STE A;  5DNF A;  2XWB B;  4TQU S;  1TKW B;  4CBV A;  3AB9 A;  4A3E B;  4XQN A;  4S3S A;  4EGV A;  3SK5 A;  1SBB B;  3X3N A;  4IFD G;  1MSG A;  5I4D A;  1EL0 A;  5I6W A;  5E1F A;  1B44 D;  5T1G A;  1BCP C;  4I7Z C;  1E0B A;  2F0U A;  1PZK D;  1CA5 A;  2LY7 A;  4G7Z C;  1SEB D;  2EXZ A;  2F1M A;  4PMW A;  3I4M B;  1RDP D;  1SND A;  1RCV D;  3SXH A;  5JEA J;  4MIU A;  2RBM A;  2B39 A;  2JEA I;  2EY2 A;  4PNY A;  3PIO 3;  2KEC A;  1SNQ A;  3M7G A;  1D1I A;  3GTM B;  3NXW A;  4Y7N B;  4LMQ D;  4ZYS A;  3JAM E;  2EY5 A;  1VF5 C;  1Z6H A;  2EY6 A;  3VR4 A;  1BCP B;  1TR5 A;  4V19 0;  4RAU C;  2B8G A;  3MXU A;  4EQP A;  2KCN A;  3HP3 A;  2PQE A;  1W6K A;  4C1N K;  4HR7 B;  4HMI A;  2QCP X;  3DEO A;  3G6J B;  5A2Q L;  3WDN A;  3BVG A;  1TY0 A;  5T1I A;  3LWU A;  5ELE A;  4KI0 A;  3I4N B;  2A6E D;  3L3O C;  3I90 A;  4OGQ C;  1ZXT A;  2KED A;  3GV6 A;  2B8F A;  3OW7 A;  3LWE A;  1JR0 D;  4RA8 A;  5C0X I;  2CQA A;  2F0W A;  2N88 A;  1PMR A;  1EYA A;  5JEA G;  3NWS A;  4PMB A;  2B2Y A;  4BA1 I;  3A7A B;  4KN7 C;  3QOL A;  2AUK A;  1DJR D;  3T16 A;  1FNU A;  3MA2 B;  1B53 A;  4TRD A;  2A6H C;  2NVY B;  1A15 A;  1B50 A;  2F0P A;  2VB3 X;  2Q8R E;  3HZX A;  4DAP A;  1GHK A;  1D2B A;  3S2H B;  3NBH A;  4M1U B;  4N9P A;  5M9O A;  1U4M A;  1XX8 A;  2EYL A;  4BWG B;  4C3J G;  1EY6 A;  2AUJ D;  1ILQ A;  1PYW D;  2C9O A;  3NBI A;  1WVL A;  2JP1 A;  1I4H A;  4HSV A;  2L4N A;  1JC7 A;  3V96 A;  1NR2 A;  1RKN A;  2E2D C;  4EQO A;  3AMU A;  5M5W B;  2JYO A;  3S1R B;  4RH6 A;  4C3I G;  3C2P A;  2R7Z B;  2BDO A;  2KCC A;  4XIG S;  5COY A;  1EYD A;  4DAV A;  3FEW X;  4FXK C;  4KN4 C;  1Z47 A;  4XXE A;  4H44 C;  3J7A F;  2J0T D;  3FPP A;  1ILP A;  3GTK B;  1SMY D;  4DN4 M;  4C1N I;  1HQM C;  3S1N B;  2KQ3 A;  4TKO B;  3P7J A;  2NYZ D;  2ID0 A;  1R4Q B;  1O7Y A;  1O78 A;  3SVM A;  3J80 L;  4F8M A;  3OWE B;  1CHQ D;  2B2W A;  1RD9 D;  3A8K E;  1YNJ D;  2ICE C;  4RCO A;  1PDQ A;  2A5H A;  5KIX A;  2EJM A;  3M3Y B;  2QEJ C;  3BVM A;  1ESF A;  1E2Z A;  4HCE A;  1EQV A;  5HGT A;  2NVQ B;  1G2T A;  5C3X A;  1D5Z C;  2FMC A;  4RGN A;  3FPU B;  4A93 B;  4QCL A;  3K5N A;  5C4X B;  3OMC A;  1FNV A;  2ZXR A;  1EOT A;  2AQ2 B;  4KHZ A;  4X3U A;  3K5O A;  2WII B;  2NVX B;  1STG A;  2JEB I;  3E0J A;  1S5E D;  2ZXO A;  3HG9 A;  1I4G A;  3D4W A;  1ZYR C;  5CV4 A;  2D2C C;  1Y69 U;  3D6W A;  3K6O A;  5IT9 E;  4ODG A;  4CHT B;  4IUT A;  5M3F B;  2PO4 A;  3J7A V;  3I73 A;  2JA7 B;  1CQV A;  2FIN B;  2L11 A;  4K5V A;  3GTJ B;  4B9X A;  1R4P B;  4CJ0 B;  3J81 L;  2K7V A;  1Q1B A;  5C0X G;  3C1E A;  1G91 A;  1GUN A;  3HOU B;  1LV9 A;  4XT1 B;  3TME A;  5FO9 B;  3DWQ A;  2B2W C;  1PFM A;  5CGK A;  3U9O A;  5C6A A;  5LL6 S;  1ZEQ X;  2Q8I B;  1AZP A;  3PUZ A;  3RUZ A;  1HFG A;  4U67 3;  3K57 A;  2EE1 A;  2B63 B;  4MHE A;  3GTO B;  1JOK A;  1CZG A;  4H7B A;  3M7N A;  3I91 A;  3PO2 B;  3K58 A;  3OMG A;  2BE5 C;  1MD2 D;  1CQF A;  4OO1 H;  4BS9 A;  2K1B A;  4MN3 A;  2RVL A;  1O7Z A;  4NMZ A;  2B2U A;  2JXM B;  1VCI A;  1PRT C;  3GTL B;  5FLX L;  3R3O A;  2KEE A;  2PCF B;  2SNS A;  3R2I A;  1CTM A;  3G7L A;  1BBX C;  5IGC A;  2WB1 B;  4DXG A;  3NHH A;  4A3I B;  4J8Q A;  4FF4 A;  3HRZ C;  2F0T A;  1HUM A;  2WV6 D;  3QWN A;  1VMP A;  2D9U A;  4O1N A;  3RZO B;  2N55 A;  1DCZ A;  4AYB B;  3L7Z C;  2QF7 A;  2DN8 A;  1GHJ A;  4K8I A;  3GD7 A;  1J9O A;  1DXM A;  5D65 A;  1C48 A;  1TU2 B;  4IN3 A;  2X6L A;  5EPJ A;  2F4I A;  1PRT B;  5CV8 A;  4KY6 A;  4PQX A;  4QF4 A;  2L5T A;  2H1E A;  4WOR A;  3GO5 A;  4M8A A;  2DY8 A;  5EKL A;  2F0J A;  1CT1 D;  1EY9 A;  3PUX A;  4KJO A;  2E2H B;  5LL6 X;  1SXT A;  5I2X A;  1LTB D;  1VDZ A;  4P2C B;  2KOL A;  1STN A;  2VXW A;  1IYV A;  4CKC A;  1D6E C;  2F0Q A;  1KDA A;  2E75 C;  4XQJ A;  1ZKO A;  4F87 A;  2B2U C;  3O13 A;  3S15 B;  2F0G A;  2PPB C;  3S2D B;  1DM0 B;  4FF1 A;  5FO8 B;  3T51 B;  4IFD J;  4DA2 A;  3RZD B;  3KLS A;  3D31 A;  5CV6 A;  1LAB A;  3R8B A;  3E6Z X;  5E4W C;  4DNR B;  1U9R A;  4X3K A;  1R9T B;  3BYY B;  3BS1 A;  3Q6S A;  1S5F D;  4RGT A;  3HS0 C;  2EPB A;  1SNC A;  3MHB A;  4OO1 I;  1ENC A;  1JCK B;  1TS3 A;  2F03 A;  1I3Q B;  1BCP D;  1TQO A;  1ET9 A;  5KEE A;  3MFG A;  1I4Q A;  3FKI B;  1HA6 A;  1SFO B;  2R61 A;  4H0L C;  3SK4 A;  5A2Q E;  4V0B A;  1WTX A;  1A3U A;  1TS4 A;  4C3H B;  4ID6 A;  1B3A A;  2QKI C;  3DMU A;  4K5W A;  3A7L A;  3VYR A;  1I6V C;  1B9M A;  4Z9C B;  1DZ1 A;  4L63 B;  5C4J B;  3HOY B;  1HQR D;  2F0S A;  4QUF A;  1B2T A;  1PTO C;  1CM9 A;  1HUN A;  1SYG A;  1QNU A;  2ZT9 C;  2L0C A;  1UAP A;  3Q24 A;  2EVB A;  3GV3 A;  3GTG B;  3PIP 3;  4ME5 A;  4ZRZ A;  2XNA C;  1I50 B;  1O80 A;  1SE3 A;  1LT4 D;  3P75 A;  1TII D;  1MI2 A;  5IGB A;  3ERQ A;  2EDG A;  4B08 A;  1EFI D;  1EWC A;  4FVM A;  4A3K B;  5D14 A;  1UEA B;  3KK7 A;  1V43 A;  1MSH A;  4RWS C;  2DNC A;  4O42 A;  1PTO B;  4A3J B;  4FXD A;  4CJ1 B;  1H9S A;  5JOB A;  1HTP A;  3D8G A;  2DY7 A;  3RMH A;  3J7Y W;  3E5S A;  2A6H D;  3NTI A;  3HOW B;  5EGT A;  4PV1 C;  1O7L A;  2X69 A;  1BDO A;  2IX3 A;  3IKJ A;  5EBD A;  1RF2 D;  2XRS D;  1FD7 D;  4HN7 A;  3K5L A;  3CRL C;  3BDC A;  3TN2 A;  1Q90 A;  3CRK C;  5M5Y B;  4FF2 A;  5JJZ A;  4DGZ A;  1A6X A;  3MTS A;  3SR1 A;  4WFN 3;  1LTA D;  1F2M A;  1XTC D;  3FVQ A;  4LJZ C;  4XTC S;  5LHY 1;  4OL7 A;  2MGS A;  1DYQ A;  1W6J A;  4NW2 A;  1M4V A;  3MFY A;  3J80 E;  2F3V A;  2M2L A;  2K33 A;  3WOE A;  3QG1 A;  3HGB A;  4WJW A;  2RSO A;  2NTS A;  4K5X A;  1PZI D;  5NUC A;  1ROD A;  2WAC A;  1VMC A;  3H3V C;  3R93 A;  1EIH A;  2RA4 A;  2V4D A;  3KF8 A;  3HOV B;  1CI3 M;  1ESR A;  5CMD A;  2J4X A;  5IGG A;  1G29 1;  2HCI A;  1LAC A;  1F9S A;  2R3Z A;  2JA6 B;  2SDF A;  4NKL A;  2EJF C;  1M8A A;  4OO1 G;  5JVH 3;  5CBA E;  5I2Y A;  1NSN S;  2F0F A;  3NQI A;  4A3M B;  4QUC A;  4KK7 A;  1LT6 D;  2CVR A;  4KV6 A;  2IX1 A;  4IAL A;  1PZJ D;  2CHB D;  1ONL A;  1ENF A;  3JAM L;  4B9W A;  3NUC A;  2D5D A;  1KAB A;  1CA6 A;  2A73 B;  1SE2 A;  1EY7 A;  1H9S B;  3J81 E;  2JA5 B;  1JOR A;  2HUG A;  1OO9 B;  4N9T A;  5IGF A;  1K8O A;  3IFD A;  1UUP A;  4K6L A;  1C8C A;  1BF4 A;  3BG3 A;  2K05 A;  1IKM A;  4IUN A;  3TBI B;  4QB4 A;  3MXN A;  5CYU A;  1AN8 A;  4X3T A;  1ZYR D;  3H6M A;  2KA7 A;  4DXF A;  3EFX D;  1SE4 A;  1NCV A;  5C0X J;  4BBR B;  4G4K A;  1PTO H;  1TWC B;  1EZ6 A;  2K5W A;  3C1F A;  2VB2 X;  1HXY D;  4KKS A;  4EQN A;  1G8Z D;  5F2D A;  4IUP A;  1KLU D;  3BDO A;  1TWF B;  1KAA A;  3KBG A;  1KDB A;  3EQL C;  4A3G B;  2F0H A;  2FMM A;  2EYM A;  3H94 A;  2F0M A;  1TS5 A;  2PW5 A;  2EYO A;  1ML0 D;  2F0I A;  3A54 A;  2AQ1 B;  3DHQ A;  2IL8 A;  4IUV A;  2R92 B;  1X3Q A;  1BO0 A;  4ZQ3 A;  4UDU C;  1HPC A;  3V05 A;  4KKU A;  2XIW A;  1SYC A;  1H9R A;  1AEX A;  4HCS A;  2BDN A;  4RGM A;  1V8Q A;  1CZW A;  1SMY C;  2K6A A;  3Q23 A;  1UNS A;  1IL8 A;  1GUS A;  5IGE A;  4HSP A;  5EJW A;  4ZKB B;  2JSO A;  3K0Y A;  4DAY A;  2BE5 D;  5J39 A;  3RLF A;  1JWS D;  1F77 A;  1TT2 A;  3AU7 A;  3SEB A;  3MXG A;  2NTT A;  4BBS B;  2Q8T A;  3VR6 A;  5ISR A;  4WRD A;  2A68 C;  4KD4 A;  3M85 A;  2YYZ A;  1STA A;  1BUV T;  5E4X A;  4K6D A;  1QCB D;  1PRT D;  5JVG 3;  3VYS A;  5I9P A;  3F2U A;  3WOF A;  3NWT A;  2Z8L A;  2KUM A;  1GUG A;  5DEH A;  3D6C A;  4G57 A;  5M5X B;  3K7A B;  1EZ8 A;  4JK1 C;  5IIF A;  1WTR A;  1QE6 A;  2PZW A;  4J1M A;  2F0O A;  3IL8 A;  4QMG A;  3MZ5 A;  2XN9 C;  1PRT F;  2PNR C;  2I07 B;  3TZD A;  1S4Z A;  3BVZ A;  3D4R A;  2LMC B;  1KTK A;  1QJO A;  2HCC A;  2K5D A;  2IJ0 A;  4R8I A;  1D1K A;  4KY5 A;  1Y8O B;  2KHS A;  2F0E A;  3DEP A;  1PFB A;  2SEB D;  1F9Q A;  1VF7 A;  4XT3 B;  4GZY C;  3A8J E;  3NTH A;  4C56 C;  1F9P A;  2MPM A;  3U9S A;  2NZ1 D;  1CHP D;  1X3P A;  2XSC A;  1U4P A;  5D3I B;  3I70 A;  3MXP A;  1QG7 A;  3MWY W;  5CV5 A;  2WKC A;  1H9K A;  2TSS A;  3PO3 B;  5C4Z A;  1S5D D;  4XQQ A;  1WTQ A;  2MP1 A;  1Q8I A;  1H9M A;  3A8I E;  1A3T A;  4RFB A;  4K2K A;  1JWU D;  4ZKC B;  1LTR D;  3OSO A;  1HRJ A;  2A69 D;  1JB3 A;  1MBY A;  3OOC A;  5C3E B;  1WD0 A;  4G7H C;  1JQY D;  1SYE A;  5J1Z A;  1L0X B;  1T5X D;  1IKL A;  4DK1 A;  2Y0S B;  2MUY A;  2MJ8 A;  1OXX K;  4FXG C;  5A35 A;  1GOZ A;  2KVM A;  1HCZ A;  1AP0 A;  1WCM B;  1FYC A;  2O5J C;  4KHV A;  1EIG A;  1XXG A;  4KTA A;  2GA4 B;  3FDT A;  1QWY A;  3UI2 A;  3S14 B;  3VA5 A;  5IGD A;  5KND A;  3NPP A;  1DOM A;  4DNT B;  4K14 A;  1EEF D;  1F2Y A;  2LS0 1;  3SK8 A;  4ILW A;  5ELD A;  1U4L A;  1SNM A;  1WTV A;  1E2V A;  2M9V A;  4UAI A;  2RDF A;  1IW7 C;  1PTO D;  3QJY A;  2LFN A;  4CKE A;  1A3V A;  3K5M A;  2Z1C A;  2EY1 A;  2C5C A;  3HEJ A;  1A2T A;  2X6G A;  1V1P A;  3S17 B;  2B2T A;  5KRU A;  5JPM C;  1EY4 A;  1XWE A;  1EQT A;  3OPO A;  4KMU C;  1KLG D;  1LTG D;  3NSW A;  1PTO F;  4C3H G;  3VA7 A;  2XWJ B;  4OIK A;  1JIC A;  1YNN C;  1IYU A;  1STY A;  5C5M A;  1OXV A;  3LX0 A;  2ZXP A;  2E76 C;  5EPK A;  1AFP A;  1K8M A;  2IT1 A;  3CQZ B;  1GUT A;  4A3B B;  1BCP F;  5EQ0 A;  2NN6 H;  5FO7 B;  3C46 A;  1SYB A;  3KUP A;  4K2L A;  3KLS X;  4CGY B;  2G9H D;  3SE0 A;  1X32 A;  1TWG B;  1JE4 A;  5E3F A;  2WIN B;  2HDL A;  3MVV A;  2M00 A;  3BZD B;  1Q3L A;  3OWF A;  3IFT A;  4RHS A;  2L12 A;  3IAY A;  2AQ3 B;  3N6R A;  1G2S A;  1STH A;  4HTH A;  2E2J B;  3MEH A;  1FGB D;  1EEI D;  1L0Y B;  1KNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...