1PZKD

Cholera toxin b-pentamer complexed with n-acyl phenyl galactoside 9h
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cholera Toxin B Subunit
publication title 3,5-Substituted phenyl galactosides as leads in designing effective cholera toxin antagonists; synthesis and crystallographic studies
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 25
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pzkD00
1CHPD 1T5XD 1FGBD 3EFXD 2NTSA 1M4VA 1I4HA 1L0YB 2J4XA 3BVGA 4K6LA 2XN9C 3DWAA 1SJED 2NTTA 1CQVA 5D3IB 1JR0D 1I4PA 2SEBD 4RGNA 1QILA 1LTAD 1SBBB 3DWQA 2AQ1B 1ET9A 1PZJD 1MD2D 4RGMA 1CK1A 1L0XB 1TY2A 3EA6A 1LLRD 3R8BA 2ICIA 1I4XA 1LTSD 3URYA 1SE2A 1I4QA 3KLSX 3R2TA 1LT3D 1LTTD 1PTOD 1AW7A 1FNWA 1PZID 1D5MC 4RHRA 1I4GA 1V1PA 2IPKD 1KLGD 1CT1D 1BCPD 1S5BD 1SEBD 2QEJC 2R61A 1PRTD 4L6TB 2CHBD 5D3DA 1V1PB 1S5FD 1RCVD 2O2LD 1B44D 1V1OA 3V05A 1EU4A 1ENFA 1LT5D 1F77A 1TY0A 1PTOC 1RDPD 1EU3A 4DXFA 2WV6D 1KTKA 2AQ2B 3MFGA 4RGOS 1EEFD 1XTCD 4RFBA 1HA5A 2QILA 1XXGA 1JWUD 1ESFA 1BCPC 3CHBD 1PRTC 4O1NA 1FNVA 1GOZA 4L63B 4C56C 4DXGA 3BYYB 5TSSA 2XRSD 1DYQA 1HTLD 4RCOA 1JWMD 5ELDA 4Z9CB 2XRQD 1HXYD 1ET6A 1TS2A 3BVZA 2G9HD 1RF2D 1S5DD 5ELCA 3TSSA 1SE4A 1CHQD 1SJHD 1EFID 1EEID 1I4RA 3R2IA 1TS4A 1SE3A 1PTOH 1PTOB 2TSSA 1D5ZC 1EWCA 4UDUC 2RDHA 1BXTA 1RD9D 1KLUD 1BCPF 1JQYD 3SEBA 1PYWD 5I4DA 1PRTF 5ELFA 5FK9C 1SXTA 3O13A 2AQ3B 2RDGA 1LTBD 1G8ZD 1LO5D 1STEA 1D5XC 3MC0B 1BCPB 4RGTA 2XNAC 4RH6A 1PRTB 1TS3A 4BWGB 5FKAC 1JCKB 3BVMA 1DJRD 3W2DA 2IJ0A 4TSSA 3BZDB 4ZYSA 1S5CD 1FNUA 1HQRD 1FD7D 4OHJA 1LT4D 5ELEA 2Z8LA 4RHSA 1JWSD 1TS5A 1S5ED 1UNSA 1PZKD 1D6EC 3DWPA 1PTOF 1LTID 5ELBA 1LT6D 3BYTB 3OWEB 1UUPA 1LTGD 1B1ZA 1AN8A 3GP7A 1LTRD
chains in the Genus database with same CATH superfamily
1SNDA 3SGIA 3QB3A 5M3MB 1P16A 4A93G 4X3KA 1I4HA 2K5HA 4LF5L 4NW2A 1EZ8A 2VB3X 4KV6A 3J7AF 1RTOA 2B2WC 2XWBB 5D3IB 5JJZA 4ME3A 4JI0L 2NYZD 3T4AC 2UU9L 3V96A 1ET9A 1PZJD 4MNOA 5AJ3L 1CKMA 4HMIA 1FYCA 1L1OB 1YHBA 5DEHA 5EBCA 4OO1H 4IPGA 4QL5A 2UXBQ 3KLWA 3E9HA 1JOOA 3NSWA 2VB2X 4NXML 1WTOA 1SFOB 1MJCA 1FNWA 4IPHA 5LL6X 1D5MC 4XIGS 2MP1A 4KY6A 2EQSA 3N6RA 3QO2A 1II3A 2A74C 2C9OA 2EJMA 1T5EA 3KLRA 3VR2A 1SEBD 5G3LD 1E3PA 3PMFA 4JVZA 3SK4A 3HKZB 3ZJYC 2ZTDA 4LFBQ 4K5WA 1JC7A 1QVCA 3I56A 2CW0D 4KJNA 5C4HA 4X3SA 3ICEA 4JOIC 2AQ2B 4H44C 1HR0L 3OOCA 3MEHA 2BH2A 1QVGA 2N78A 4JG2A 1I50B 2QILA 3BG3A 4A3EB 4DU9A 2F0UA 1N34Q 4L63B 4QIWB 2B2UC 3NWTA 1X55A 4JI3Q 3HOYB 3D4WA 4DNTB 1IXRA 2GN5A 5JJKA 4OO1I 4H7BA 2KHIA 3J7YW 3R2IA 1O7IA 4A4IA 2GVAA 4CDFC 1X65A 1RJTA 5DM63 1ZYRC 4DFAA 1G8ZD 4APVA 2YU9B 4A3GH 1SNOA 3H0GB 3S1RH 4X3UA 4J6HA 4JW0A 4JCVE 4PV1C 3NWSA 2EOTA 3TDQA 4OX9Q 2N49A 1W6KA 2EJGC 1Y69U 2Z8LA 1KDCA 5CMDA 1TS5A 3HOZB 1NY4A 1J5EQ 1PZKD 1D6EC 5ELBA 4LJZC 2K32A 2Z9HA 4HIOA 4BBSG 1PH7A 3CAMA 3A56A 4DV0Q 1TWFH 3LGJA 3E3XA 3I90A 4JBJA 1GUWA 5IYDG 1L0YB 2A6EC 4C2MB 1WYDA 1MIUA 3GQBA 4J15A 1I4PA 3LWEA 1O80A 3A0JA 1SMYD 2NVXH 4RKBA 2UUBL 1H9SB 3A74A 5M5WH 3K81C 1VS0A 4DK6C 1L0XB 2JA5H 4LFAQ 2JA7B 1F9PA 1X3GA 1CI3M 1JB3A 1V8QA 3R2TA 4DR7L 1WCMH 1ZKOA 2KQ3A 3K80C 3JAME 4E6IA 4DNIA 4DV3L 1Y8OB 2H5XA 4XXEA 4OXPA 2B8GA 4ZCKA 2F4VL 4OWTB 1Q81C 4RCNA 1QB5D 2KEEA 3T1HL 1WTRA 3HOVG 2KEDA 3S9WA 1TY0A 2F0GA 3HOXB 3KBXA 3PF5A 5FJ8H 4POGA 4PZ8A 2VQFQ 5IYDH 5CC4A 2B2UA 3AFQA 3RN2A 1HNXL 1HA5A 1WI5A 3I4MG 4DK0A 4KY7A 1BCPC 1A2UA 2MO0A 2L1BA 1B7YB 5TSSA 4KD4A 3SK8A 4RKLA 4OONA 1ET6A 5FLMG 2EXDA 2MPMA 2V1CC 4A3IH 4NMZA 1A2TA 1CHQD 3GV6A 1I4RA 2LS01 4FO2A 4IPCA 5KRUA 3RMHA 3HZXA 1RD9D 3S2HH 5M3FB 5H1SE 1BCPF 5I4DA 1K83B 3ND9A 4L5QA 2IW3A 4PMBA 3S15B 2HHHQ 1BCPB 3S2DB 1V43A 3PO3H 2PCFB 2ZTEA 3G4SA 1X54A 2A73B 3I8ZA 5C4XG 3A54A 1PXUA 2FMMA 2ASBA 1N9WA 1PMRA 1C0AA 2OTLA 1GO3E 4JPBW 3BYTB 3NBHB 3I70A 1KRSA 4DAMA 2MFIA 3TP8A 1I94Q 1X9NA 1SNQA 5EBDA 3NQTA 4ILWA 1A15A 1BOSA 3BVGA 4K6LA 5M5YB 1A6XA 5DM73 3TN2A 1GUGA 1KNAA 4PQXA 2JA8H 3X3NA 1HA6A 1OXSC 3T1YL 4RAUC 2AQ1B 2XTIA 1KABA 3MVVA 3HGBA 3EA6A 1LLRD 2JEBI 5CBAE 3P1HA 4U673 1RIPA 4A3KG 1SN8A 1VQDA 2F4IA 4B3ML 4IN3A 3KLSX 4Y7NH 3C1EA 3ULPA 4N9TA 3F2CA 4HAEA 1PTOD 2K5WA 3CCRA 4A3FB 1F9SA 1TU2B 1V1PA 2EE1A 1VQIA 3DXJC 1HNZQ 4FF4A 5EKIA 4A3MH 3K8AA 2R92G 3I7FA 5CYUA 3AU7A 5D3DA 1E2VA 2OCEA 4JI8L 1QG7A 3V05A 1HJPA 4LF8L 2D9UA 4JI5Q 1G6ZA 4DF7A 4TRDA 4BS9A 3IFTA 4FF1A 1ICFB 3I72A 2EXZA 4OGQC 3OYYA 4JI6Q 4XQQA 1ESFA 2UXCL 1PRTC 1KAAA 2XSCA 1EYAA 3M4OH 4JBMA 3ULLA 2G5DA 3JAMc 3X3MA 4X64L 4L5RC 1TWGB 4LFCL 1LACA 4CDEC 3DHQA 3WOEA 4Q5VA 5CV6A 3PSIA 2CWPA 5EPLA 1PVOA 4PMWA 1SE3A 2Z6KC 1NMFA 2B2VC 4AIMA 1TR5A 3R3OA 1PRTF 4A76A 3L9AX 2UUAQ 5C0XG 4LF9Q 1JE4A 1PRTB 1WTXA 4FYDA 1TWHB 1E1TA 5L37A 3TQYA 1H95A 2R92H 5E4XA 1FVIA 5EPKA 1HQRD 1QVFA 3KF6B 3DEPA 4LF4Q 1VQMA 4KY5A 4G7OC 1A62A 1UUPA 2H4OA 3D0FA 1EIFA 3S16B 2EY5A 5HURA 3GO5A 3CQZB 4TQUS 3NBIA 1VQBA 4HIDA 1EL0A 4HSVA 5JJIA 1VQ4A 3Q24A 1HPCA 3FHWA 1GUOA 1YNJD 3ER0A 3NP8A 4LWCA 3S1MB 4NP5A 4R8NA 2YTXA 1PV4A 1OTCA 3R8BA 1BBUA 1QUQB 2PMZE 3CRLC 1Q1BA 1W3SA 4V190 5M3MG 4AYBG 3F8TA 3IRBA 5C0XH 2J7ZA 4A3LH 1FJGL 1U4RA 3KF8B 2Q2TA 1CT1D 2QEJC 3C46A 4BY1G 2OXPA 1PYSB 4DR4Q 3CMAA 4UP7A 2O2LD 3W5OA 4C1NK 3HOWH 3D4RA 5CV8A 4G7HC 4DR6L 4LFBL 4MHEA 2RQXA 2A8VA 2YTVA 4P75A 1XNQQ 1JT8A 4GZYC 4HTHA 3CHBD 2D0OA 3ND8A 2L4NA 3OSOA 3J81E 2F0LA 1GHJA 1VQ5A 4QMGA 5T1GA 3VYSA 2B39A 5FO9B 4HR7B 2OF1A 3CPWA 3KYHC 4MN3A 4A3CG 2RCNA 1VQJA 4EQ5A 1EOVA 1YIJA 2D5DA 4K8IA 1D2BA 3HP3A 2AWNA 5BN3A 5GAHC 4FF2A 1XNRL 1EWCA 4NB3A 4UAIA 5G3LF 3FP9A 5ELFA 4LUZA 3O13A 2AQ3B 2JJQA 2Q2HA 4JV5Q 4A3EG 2B2TA 2AWOA 4RH6A 3HEJA 1Z6HA 4DGZA 1UEBA 5FKAC 3I4LA 3MXGA 4BY1H 5JJLA 2G9DA 2NZOA 3UDXA 2F0PA 4RMFA 3HOYG 3SK5A 3UE0A 1TVXA 2JYOA 3HKZE 2YYZA 4DV1L 4RHSA 4KI0A 5KYLA 1NUCA 1B3QA 3IKJA 2F1MA 2L55A 4A3DH 2IY5B 3G6JB 5FOBB 2AMCB 1KNEA 2A1AA 5E1FA 3I2ZA 4KK7A 3M85A 4QB4A 2KCTA 3BZKA 1JJGA 3SHLA 3H0GG 5KIXA 4K0KL 3HOUG 2BCOA 1YZ6A 4YIJA 1EZ6A 1VQGA 3C2PA 1BVSA 2I46A 1OO9B 5IE8A 3NXWA 2MQHA 2IX3A 4RGMA 2F0TA 1K3RA 4KTAA 1ASZA 4XT3B 3A7AB 2HUGA 3VA5A 1RODA 3D4DA 1VQFA 1E0BA 3RLNA 2QCPX 4YCWA 1JB7A 3BU2A 3M3YB 1LTTD 1IBMQ 1SMYC 3OIPA 1HNWQ 1V9PA 2PZTA 1K0RA 4N8FA 2IPKD 4C3IB 5IWAL 1YNXA 4UHVA 2K5NA 2RCFA 2WB1B 5ELNA 2LMCB 2O5JC 2Z4HA 5A2QE 4JBWA 2JA7G 1EQQA 4HJ9A 1N33L 3RZOB 3UDFA 3PIO3 2NVTH 3IAYA 3KFUA 1O7ZA 5A35A 2VQFL 2JA6H 3HOUH 2K28A 5KNDA 1BNZA 1IL2A 1NSNS 4X66L 3L3OC 1EYGA 2K04A 1AE3A 2YTYA 2WFWA 3OWFA 1JOKA 3GTOB 4P72A 2B63B 1S3OA 1HQMC 1SJHD 5T1IA 2JP1A 1WD1A 5BR8Q 2D2CC 2K14A 2TSSA 1IBKL 4PG3A 3DMUA 5K5PA 1PYWD 1DGSA 1SYEA 2Z4IA 1G2SA 3FEWX 1YJNA 5D14A 1B50A 2KHSA 2CH4A 4IFDH 4RGTA 4DR2Q 2DNCA 3GTGH 1B8AA 1C8CA 2FJ2A 3NK9A 1FNUA 3IFDA 2C5CA 2L12A 2Z0SA 3BZCA 3AEVA 5I6WA 3M4YA 4KHVA 5LL6S 1VQ9A 2WKCA 4P74A 3I4NB 1SRUA 2PMZB 5KNCA 2NN6I 4ZRZA 3TZDA 1CHPD 2HCCA 2K1BA 1VQOA 5M3FG 1EY8A 1X32A 4C1NI 4UPAA 3DM3A 4BY7B 2I07B 2NTTA 5IP9H 2Q2UA 2XWJB 3PO2H 1PDQA 3D6CA 2NB0A 2RKSA 3EIVA 3DWQA 3ZYYX 1WJJA 3L0OA 4GOPA 1H9JA 1CFMA 4DV5L 2N8NA 1PH3A 1VQAA 4A3BB 2M00A 2ICIA 1STYA 2L0CA 5C3EG 4B3SQ 2SNMA 3GTMH 1XMOL 2BE5C 3FRPB 1CKNB 1SYFA 3CW2C 2CH4W 2E2HB 1GVPA 4MTNA 4DN4M 1CZWA 3S14B 1R9TB 4PZ7A 5IYCH 5J3BA 1S5FD 1Y1VH 3NELA 3NEMA 5I2YA 5C44B 4GLAC 3BDOA 1CSQA 4X65Q 2E5LQ 1PTOC 2UUCL 4G7ZC 4RFBA 3VYUA 1ENCA 4DR1Q 4A3FG 4B3RQ 2PZWA 4DUZL 1BR9A 2I5MX 1Q8IA 4H02A 2R93H 2EYFA 1YJ9A 2VUMH 4DUYL 1X3PA 3KDFA 1NR2A 1L2FA 1MSHA 4L5SA 1E24A 5JEAG 1E1OA 1TS2A 5I9OA 2G9HD 5HY6A 5CV9A 2A68D 5ELCA 5C3EH 4CJ0B 5HGQA 1HUMA 4GN4B 1A63A 1SNCA 1Z7TA 3SE0A 2KHJA 1PTOB 3CRKC 4GNXA 1VQKA 2RF4A 4A93H 1JQYD 3GD7A 4KHPL 5LMUQ 3SR1A 3ITPA 1QCBD 1N32L 2LFNA 5EPJA 1S40A 1I3QH 1A3VA 1PH4A 1IBLQ 1KXLA 1AP0A 1X3EA 1NR4A 2XNAC 2R7FA 5E4WC 3B6YA 3F2DA 1WVLA 4A3JB 4KHZA 2IJ0A 1K0SA 4TVAB 1EYDA 2QW7A 5IP7G 4IO9A 1RL2A 1S5ED 4HEDA 1VQEA 1LTID 1CM9A 1AZQA 4DV7Q 5FO7B 1STHA 4R4CA 5FLXL 3GP7A 3CD6A 1Y1WB 1FGBD 1SNPA 5M5XH 1M4VA 3A8JE 2L11A 3S17B 3I4OA 2K52A 1PFBA 2K01A 4QY7A 1BQQT 1L1OA 1VCIA 3V2TA 1H9KA 1TWAH 1EWHA 3MHBA 2B3GA 4N8X1 1SAPA 3SDZA 2EDGA 2R7ZB 2AHOB 4IALA 1B9MA 1MHWC 3DLLA 2PW5A 3LWUA 2P5ZX 4LUOA 4JYAQ 2B2WA 5LMNQ 4Y52H 4X3TA 4DV2L 1EIHA 2F0FA 3H15A 2A69D 1G51A 1VQHA 1YNJC 4H0LC 1Z47A 3CCVA 2TMPA 2A6HD 2LXJA 2ZJQA 4XDXA 3W1BA 1KC8C 1IHZA 2HT1A 1RCVD 1KHIA 1W6JA 4J1MA 3RD4A 3K7AB 4XQJA 1S4ZA 1B3AA 1DONA 3Q23A 2PO4A 4KD3A 1EEFD 3RUZA 5BN4A 3OPOA 4YY3Q 5ELOA 4C3HB 1DOKA 2ZXRA 1XXGA 4QJFA 3GTPB 3GTKB 4GKJL 1EY0A 3EVQA 3S1NH 4LK1C 3T56B 4C3JB 2FINB 3A7LA 4K5VA 4F8MA 3H3VH 1F2ZA 3T51B 2ZJPA 1PH1A 3AYHB 4RCOA 5IGFA 1DOLA 3CC2A 2NUCA 2EY6A 3W1GA 2WP8J 4JOIA 1UE6A 4MIUA 1SNMA 3CPFA 1EFID 1N36Q 2JE6I 4BBSH 4DPGA 1EY4A 4BBRG 4K6DA 3U4ZA 1KLUD 1SYBA 3D8GA 5C3XA 2D62A 1XMQQ 1B70B 3PO2B 2KCCA 3QOLA 2K75A 2LKVA 4BWGB 2F0HA 4XQNA 3NENA 4R4TA 1K8MA 1EQTA 2NWGA 1LYLA 4DR5Q 2IWHA 1Q7YC 1IYUA 4FNFA 4TKOB 4CKEA 3RZDH 2Q8IB 1Q3LA 2F0DA 2DY8A 2E2IH 5M9OA 3H09A 3KK7A 4ULLA 1YHQA 3RNUA 3G7LA 4HIMA 1H9SA 3FKIG 1HFGA 3S1QH 1I6HH 3HRZC 1LTAD 5IGEA 1QNUA 1DD2A 2PI2E 5GROA 2NVQH 2PQAB 1HZBA 1MD2D 2E76C 4AQYL 1STAA 1R4QB 1TY2A 1WOCA 2QF7A 4I65A 3HOVH 1X56A 4V0BA 4X62Q 4BBRH 3MZ5A 3NTHA 5J1ZA 2R7DA 1U5KA 4IUTA 1JJCB 1LTLA 5EKLA 3GTLH 3I4MH 1PHJA 4P2CB 1U4MA 4GKKQ 3P75A 4ZUJA 1Q90A 1IBML 4IUVA 4CKBA 2VXWA 1A8VA 2H1EA 1TXYA 4EQPA 1OXVA 1SSOA 1KDBA 3QR8A 5FLMH 4FDBA 1GM5A 4B3TQ 2NVYH 1J6QA 3LX0A 1WTVA 1KTKA 1Q8KA 2E2JH 4IOAA 1YJWA 2RHSB 3FKIH 1HRJA 3OTOQ 1JWUD 1A3TA 1YNND 3GTJH 1FNVA 1DOMA 1GOZA 3PIOA 4IOCA 1XPRA 1KIXA 2UXDQ 2EY1A 3CCLA 4DK1A 5C4ZA 5C4XH 3HFZB 1KDAA 4FXKC 4CJ2C 4YHHL 1IYVA 3E5SA 4DAVA 1NJIC 4ZK9B 4IZ8A 3MXNB 4WORA 1PH9A 1EEID 4I7ZC 4LF5Q 2CVRA 1VF7A 4JI2L 3EROA 1WTQA 1D5ZC 2JN4A 3MXUA 5IOCA 4QCLA 1R4PB 2MHVA 5C5LA 2UU9Q 3I55A 2FHTA 2ES2A 4LF6L 1D5XC 1U4PA 4A3GB 3A5ZB 3S1RB 1ESRA 4HCEA 3P7JA 4BA2I 5LMNW 5AJ3Q 4JI7L 1WFQA 3S24A 3NBHA 2B2YC 4ZYSA 4DR2L 1S5CD 1XPOA 2WB1E 4R4QA 2EY2A 3J80L 1NE3A 5GAGC 2B63G 4IJLA 3GTQH 1PFMA 3VR3A 4NXNL 1TWFB 1B1ZA 4A3KH 1S72A 1A3UA 3EFXD 1C4QA 1ENAA 2JSOA 2XN9C 3EJIA 3M4QA 2SEBD 1STBA 2ZXOA 4GLVB 3AFPA 1G6PA 4JI4Q 2NVXB 1VQNA 5M5WB 5DNFA 4Q0FA 1CK1A 2JA5B 2DGYA 3DM1A 3I4NG 3AMUA 1CKOA 1I4XA 3OW7A 4LNQA 1O78A 4LAAA 1EY9A 1LT3D 1WCMB 3SXHA 3VYTA 2F3VA 2F0KA 4RHRA 2CKZB 3G71A 4KMUC 2E2DC 1LM0A 3PV0A 4YWLA 3NE5B 2O4XA 5CV7A 5CORA 2ENBA 4A3BG 3K57A 4S3SA 2BDOA 1EU4A 2SDFA 4FP5D 1EIGA 1PH6A 2DUDA 1OXUA 3UDGA 1PLFA 2E74C 2PQEA 4X65L 3Q22A 3PUXA 2UXBL 1M90C 3M7NA 4YCUA 3QWNA 5C3WA 1OXTA 3FDTA 2X6GA 5CGKA 4Z9CB 4A3IB 4J8QA 5EAYA 5C44G 2A19A 2I5LX 3T16A 4M8AA 4UDUC 2ZM6Q 2F03A 3S2HB 1WTPA 3SEBA 2JXMB 1YEZA 3Q6SA 3K5OA 2AUKA 2K5QA 3HS0C 3KF6A 3J80i 3L7ZC 1ZXTA 3PO3B 5GADC 2Y0SB 3BVMA 2A68C 1F9QA 4LMQD 5HGTA 1N34L 3HKZG 2CW0C 4DAYB 2Z6KA 3D31A 4DAPA 2B2VA 1AH9A 4JI3L 1F2YA 4A75A 4BA1I 5JPMC 3PF4A 2WAQE 1AN8A 4PNYA 4IURA 2RSOA 5C0XI 1SR3A 1CA6A 5M3MH 1YI2A 4DV3Q 3VYRA 3GV3A 5E7NA 1CQVA 4NDXA 2OT2A 2F4VQ 2JA8B 1SE8A 1HZCA 2HIVA 1QILA 3E6ZX 3A8IE 1QUQA 1HTPA 1VMPA 5LHY1 4A3JG 1SBBB 3T1HQ 1SMXA 2QEXA 1PFNA 1JORA 1HCZA 5C6AA 1ASYA 4P73A 4ZKBB 4EX5A 3KJPA 4OX9L 2QDLA 1HNXQ 1D1KA 2IL8A 3KF8A 1Y1WG 1J5EL 4Y7NB 2CFMA 5JVG3 4DV0L 1SFOH 5LMNL 2KCNA 1TWCH 2XVSA 1CA5A 4WFN3 2Q8RE 1BO0A 3LNNA 4U68A 1S5BD 4L8JA 3CCQA 1XX8A 4A3MB 2B29A 3AQQA 3KUPA 1IW7D 4IFDJ 2J0TD 1NNXA 1UE5A 4R8IA 4A3CH 1CTMA 4GS3A 2R7ZG 2PYKA 1G2TA 3HOZG 3DEOA 2A69C 4IPDA 1EU3A 1EY7A 1W2BA 4LFAL 4RGOS 4HJ7A 1XTCD 5JAVA 1VQLA 2PI2A 3NTIA 1I50H 2A6HC 3CXCA 4I7AA 3A8KE 3OW2A 4A3EH 1M8AA 2LY7A 5IT9L 3M4OB 2VY3A 3SK6A 3HOYH 2XRSD 4H13C 5ELDA 4IUNA 4DV6Q 3TSSA 2CQAA 2M9VA 3VR5A 2PPBC 1G91A 4JK1C 1PH5A 1HH2P 1K9MC 5DLQE 1RTNA 1I6VC 4ZAIA 3CP0A 3G6EA 1BXTA 3U9OA 2KOLA 4OWWB 3NQIA 2V4DA 3D3RA 4C3HG 1JICA 4QUCA 3TS2A 3NHHA 5IGDA 1NMGA 3T1YQ 2YU9H 4MZ9A 3MC0B 3H0GH 4JI1Q 4C3JG 4OELB 4CDDC 1TS3A 2F0QA 1Z9FA 5CV5A 4WJWA 2R92B 4IJHA 2XGTA 5J22A 3K0XA 4B3MQ 1Y8PB 3HOZH 1GHKA 2F52A 3UE1A 2VS1A 3PQIA 4IQZA 5COYA 5D65A 4B08A 3HOXG 2RDGA 3HKSA 1T5XD 5JOBA 3K0YA 4ABNA 4C2MH 2J4XA 2EYLA 2BA1A 3UI2A 4YWMA 2OTJA 2F0SA 2Q8TA 2R6GA 3RR5A 3STBD 2L5TA 4JI8Q 2HHHL 4LF8Q 1LUZA 1MGSA 2GVBA 2VW9A 2JA7H 3TP7A 1UWVA 3E9IA 1MKHA 4HJ5A 2OQ0A 2UXCQ 2IX1A 1IYJB 2EYHA 1I94L 4HSPA 3J80c 3C3LA 1VQ6A 1EOTA 2K5VA 3MAQA 3MTSA 2CHBD 5IGCA 1VF5C 1DZ1A 1SYDA 3W3AA 4DNRB 3HOWB 1JMCA 2BDNA 2E75C 4NPSA 4OO1G 3HOXH 4R1JA 5EQ0A 1GKHA 4B3TL 3CU7A 4IFDI 1IKLA 4HN7A 1MBYA 3PUVA 4O1NA 5EJWA 1VQPA 4C56C 4GN5A 3F2UA 4F87A 2N55A 4LF7Q 1HNZL 4QGUA 1S5DD 1E2ZA 4KKTA 3I73A 1QOHA 2RVLA 3ERQA 2WAQB 4ZKCB 1TS4A 3VA7A 2RDHA 1HZAA 4AYBB 5M3FH 2EZVA 1YNNC 1K83H 1EY5A 3I3CA 4JI5L 5FK9C 1BKBA 3HG9A 3S15H 1STEA 2K4KA 3S2DH 3G48A 1T9HA 4JI6L 1EWIA 1GUSA 1JCKB 1AZPA 1DJRD 1U0LA 1DM0B 3K6OA 4BY1B 2R3ZA 5BN5A 3K5NA 2F0OA 3U50C 3JAML 1PTOF 4F88A 1C48A 4A3DB 2FMCA 2EYMA 1BUVT 1FJGQ 3BS1A 2MNAA 5M5YH 5IYBG 1TWCB 3M4PA 1B9NA 4A3GG 1IKMA 1EIYB 2OEOA 2UUAL 3F2BA 4LF9L 1K8OA 1GJXA 3TMEA 4JI4L 2KVMA 4DR6Q 1GUNA 4UY8C 2NZ1D 2XIWA 4R9WA 1F2LA 1CKNA 4DV4Q 2ATWA 2QGQA 2VZAA 4DA2A 4IUUA 1ILQA 3FMCA 3URYA 3CCUA 3WOFA 1RKNA 4LF4L 2HDMA 1KD1C 4B9WA 3BDLA 1PZID 4KKUA 4A3FH 2ZXPA 3CCEA 2K05A 4CKCA 2ZT9C 1TT2A 2R61A 5J39A 4KN7C 5JEAH 2D0PA 4HIKA 2VNUD 5IGGA 1XNRQ 2JA5G 1EY6A 2K03A 1UE7A 1AE2A 1LT5D 2E8GA 1RDPD 3K58A 1U4LA 3TP6A 2NVTB 3MFGA 2F0NA 2F0VA 1WCMG 4AH6A 5IYBH 2HDLA 2JA6B 1RHPA 2A5HA 4ZQ3A 3HOUB 5IODA 3TBIB 2I0QA 3FPPA 4DV1Q 2X6LA 1F2MA 1TWGH 4ZUIA 1HTLD 3MA2B 1YBYA 4L5TA 1HXYD 5IP7H 3U4VA 3QG1A 1BF4A 3TREA 1E22A 1Q86C 1D8LA 1VMCA 1PA6A 4DR4L 3TP5A 1G291 4QF4A 5FJ8G 1TQOA 2VQEQ 1IZ6A 4K0KQ 2PZUA 5KEEA 1EUJA 3QJYA 1FR3A 2ZM6L 2K7VA 1GXDC 3EQLC 5KGUA 1P8LA 1GUTA 3E0JA 4WJ4A 1XNQL 3GTGB 1WTWA 1QZHA 3JAMi 1TWHH 1XYIA 3W2DA 1KRTA 2GA4B 1JOQA 2NZHA 4A3IG 1H9RA 4CGYB 1J8IA 2DY7A 4GLXA 4XYQA 4EQOA 5CBEE 2AUJD 3DUZA 1WTHA 3S16H 2C35B 4OEMB 1LV9A 1NBWA 3CQZH 1O7YA 5IT9c 5IWAQ 2O5IC 1SJED 4K14A 1K73C 1KAWA 3R93A 4RGNA 3PO3G 2Y0SG 1HZ9A 4JV5L 1UE1A 3S1MH 2HCIA 3ULJA 3UDIA 1N33Q 4NKLA 1FGUA 1STNA 3MXPA 3TZUA 4ID6A 4EGVA 3K59A 3KBGA 2KBNA 3GTMB 3Q0AA 2RBMA 3TS0A 1YITA 1Q46A 3PIP3 1SDFA 3KJOA 3OIQA 1AW7A 4X66Q 1X3QA 2WIIB 4FXDA 3H3VI 4CBVA 1NTGA 1BBXC 1QNKA 2JA8G 3L2PA 2EJFC 3M9BA 4FVMA 1NAPA 3A55A 2JQOA 3BDCA 4LW1A 4WJ3M 2Y0SE 4L6TB 5FLXE 3OHXC 3RLOA 4K8JA 1V1PB 2M2LA 1Y1VB 2WINB 5EGTA 1MI2A 1IBKQ 1TKWB 2IHEA 1SLJA 3QOJA 4DXFA 1TIID 3CMEA 3VR6A 3EBEA 5FO8B 5IIFA 4M1UB 3CCMA 2HD3A 5C4JH 1IW7C 2R93B 2JA9A 3T53B 2VUMB 3KOJA 1MSGA 4A3MG 1HNWL 2JEAI 1PYBA 1X6OA 1AEXA 1VDZA 1RF2D 5C3EB 1B53A 5GQOA 2MO1A 4DV6L 4DR3Q 5K36G 1YHAA 3CCSA 3FVQA 4A93B 1YVCA 1LTBD 1I3QB 1LO5D 5AFWA 1UEAB 2BE5D 3OMGA 2YV5A 2EYPA 4DV5Q 5E3FA 4C3IG 5IGBA 4JI1L 1STGA 3ERSX 4TSSA 4UP9A 3U58A 2PNHA 2WB1G 2K6AA 1XJVA 1XPUA 1HFNA 4OHJA 2ICEC 1QE6A 1XMOQ 1LT6D 3RN5A 2K33A 2EVBA 4RWSC 3P20A 2NTSA 5M5XB 4OIJA 1C7YA 5BR8L 4IUQA 1EQVA 4JI0Q 2PQAA 1SYGA 1QWYA 1Q1EA 2ID0A 3SVMA 1M1KC 4HCSA 1BDOA 1TWAB 5C0XJ 3CCJA 4YCVA 2UUCQ 3J81L 4DK3C 4NXMQ 5K36H 1LTSD 2F0WA 4DUZQ 3M3YH 2L15A 4EQNA 4BXXG 1CSPA 4DUYQ 3STBC 3K5LA 3J7AV 4GN3B 1LABA 1UAPA 4FF3A 3H3VC 2Z6BA 4C3IH 4WRDA 3ONAB 2ZJRA 3TRZA 2KECA 1Q82C 3I91A 1HHVA 4PMCA 5GAEC 1V1OA 3GDEA 1F9RA 1F77A 1EFWA 1HR0Q 4KHPQ 4KLKA 1N32Q 3PGZA 2VL6A 2HIXA 3M7GA 2CWAA 3RZOH 2WKDA 2EIFA 4XT1B 4B3SL 4O2DA 4A3LG 3H91A 1FL0A 4BY7G 3S1NB 4RG1A 1ZYRD 3MXNA 4DXGA 1ICWA 1K8GA 3BYYB 2B2TC 2N3SA 3KLSA 3GTOH 3U9SA 2B63H 4ZLTF 5FLXc 3HOWG 1SE4A 4P71A 3N52A 4LF7L 4BBSB 4G4KA 1K8AC 1K28A 2DNEA 4KKSA 4BXXH 2E5LL 4K5XA 1SXTA 1QJOA 4CDCC 2F0EA 5I6YA 2A6ED 2KUMA 4IUPA 5I2XA 4B3RL 2K50A 4DR1L 1E7ZA 2LXKA 1ILPA 1ZEQX 1SROA 1H9MA 1XTDA 3RZDB 2Q2IA 5ELEA 2CCZA 1JWSD 1UNSA 2N88A 3I4NH 1PH8A 4DV2Q 4FXGC 3K7UC 1U9RA 2E2IB 4X6AH 1LTGD 2HQEA 2WAQG 4XYOA 1MJEA 2OQKA 3AB9A 1C9OA 2QKIC 1B4OA 3MWYW 4ALPA 5KNBA 5A2QL 4JBKA 4BY7H 4ODGA 2B2YA 5NUCA 3S1QB 1I6HB 3MEFA 2UUBQ 5LMUL 3J81i 2RSNA 2FFKB 3EN2A 1IBLL 3CC4A 2OWOA 2NVQB 3MFYA 4KJOA 2AKWB 1SYCA 4A3BH 4O0AA 5CV4A 5JPNC 4HJAA 2MGSA 1DXMA 3HOVB 4DR7Q 4F7XA 3K5MA 4A3DG 2EPBA 4N9PA 1SE2A 4BBRB 4DV4L 3NUCA 4ME5A 4OWXB 4GKJQ 1I4QA 5ISRA 5KYIA 5C5MA 1XWEA 4HMJA 4AYBE 2BOSA 4DV7L 3J80E 3GTLB 3I4MB 5C4JB 3VDYA 2E2HH 3H94A 3PCOB 3TEHB 2RA4A 2DJFC 3PUYA 2KA7A 1BCPD 2I5HA 2IT1A 3S14H 1R9TH 1ML0D 2JK8A 2KENA 1CQFA 1B2TA 2PNRC 5C44H 1KL9A 3PUZA 1VQCA 3CKIB 2NBFA 4UP8A 1ONLA 2NVYB 2B8FA 3JC66 2E2JB 1AFPA 1E2WA 3FKIB 4JYAL 5DAUA 3VR4A 2DJGC 3GTJB 2LSSA 4CJ1B 2F0MA 5C4XB 5CR3A 1DYQA 1JWMD 4CHTB 2XRQD 5EKKA 2IHFA 2QA4A 4RA8A 3CF5A 3WDNA 2F0IA 1GD7A 1PTOH 3Q8DA 4G57A 3C1FA 4QQBX 2NN6G 3J7A5 4JC0A 2VQEL 3QIAA 4K2LA 2JA6G 4DAYA 4YY3L 4QIWE 4AQYQ 4A3JH 1Y8NB 4EVOA 4POFA 3BZDB 1Y14B 3F1ZA 3J81j 3RLFA 1LT4D 3GTQB 2RHQB 3NTKA 2ALYB 4O42A 4GOPC 1QZGA 4K2KA 4OL7A 4A3KB 1LTRD 1Y1WH 5IY0A 1N36L 1EYCA 1HUNA 1D1IA 3S17H 2IX0A 1JE5A 1D7QA 1A0IA 3DWAA 1EQRA 1HR0W 4IFDG 1WD0A 1JR0D 1XMQL 1I5FA 5I9PA 4LUVA 2CQOA 1V1QA 5JVH3 2F3IA 2RDFA 2R7ZH 3H6MA 4DR5L 2F0JA 2EYOA 4GOPB 1NCVA 4KN4C 3A5UA 3T13A 2NN6H 5F2DA 5IP9G 2MUYA 4DKAC 1I4GA 3PO2G 4YHHQ 2HQLA 2QDBA 3PIPA 1O7LA 1KLGD 2BA0A 1N8RC 2BH8A 1PRTD 1KQSA 4QUFA 3J7ZC 2KCMA 3D6WA 4YWKA 1B44D 4JI2Q 2ZTCA 4MTKA 1ENFA 2MJ8A 3K7AH 1PH2A 1DCZA 2WV6D 4LF6Q 3NPPA 1JJ2A 2WACA 4X62L 4HJ8A 4JI7Q 2Z1CA 4C3HH 3GTPH 3GTKH 3OMCA 3WWVA 2PW7A 4GNXC 2L9HA 1PFSA 4C3JH 2X69A 4X64Q 4LFCQ 2SOBA 4OIKA 3J81c 4GKKL 3FPUB 1CUKA 2KJXA 5IYCG 4NXNQ 4B9XA 1K3BC 3BVZA 1Y1VG 1Q12A 3BJUA 3CC7A 3KDFB 1L0WA 4R4OA 2K5DA 4DR3L 1CZGA 4R4IA 2EYJA 1BBWA 4PZ6A 2FXQA 2R93G 4XTCS 4GNXB 3OTOL 2VUMG 2F3WA 3IL8A 3PUWA 2SNSA 2UXDL 1FD7D 1VQ7A 1X3FA 1L1OC 1IL8A 3E0EA 3DWPA 1OXXK 2DN8A 3OWEB 5JEAJ 1J9OA 1VQ8A 5IT9E
chains in the Genus database with same CATH topology
1SNDA 3QB3A 5M3MB 4X3KA 1I4HA 4NW2A 1EZ8A 2VB3X 4KV6A 3J7AF 1RTOA 2B2WC 2XWBB 5D3IB 5JJZA 2NYZD 3T4AC 3V96A 1ET9A 1PZJD 4HMIA 1FYCA 5EBCA 5DEHA 4OO1H 1JOOA 3NSWA 2VB2X 1WTOA 1SFOB 1FNWA 5LL6X 1D5MC 4XIGS 2MP1A 4KY6A 3N6RA 3QO2A 1II3A 2A74C 2C9OA 2EJMA 1T5EA 3KLRA 3VR2A 1SEBD 5G3LD 3PMFA 3SK4A 3HKZB 4K5WA 1JC7A 2CW0D 4KJNA 5C4HA 4X3SA 2AQ2B 4H44C 3OOCA 3MEHA 1I50B 2QILA 3BG3A 4A3EB 4DU9A 2F0UA 4L63B 4QIWB 2B2UC 3NWTA 3HOYB 3D4WA 4DNTB 4OO1I 4H7BA 3J7YW 3R2IA 1RJTA 5DM63 1ZYRC 4DFAA 1G8ZD 2YU9B 1SNOA 3H0GB 4X3UA 4J6HA 4PV1C 3NWSA 2EOTA 3TDQA 1W6KA 2EJGC 1Y69U 2Z8LA 1KDCA 5CMDA 1TS5A 3HOZB 1PZKD 1D6EC 5ELBA 4LJZC 2K32A 3A56A 3I90A 1GUWA 1L0YB 2A6EC 4C2MB 3GQBA 1I4PA 3LWEA 1O80A 1SMYD 4RKBA 1H9SB 1L0XB 2JA7B 1F9PA 1CI3M 1JB3A 1V8QA 3R2TA 1ZKOA 2KQ3A 3JAME 4E6IA 1Y8OB 4XXEA 2B8GA 4RCNA 1QB5D 2KEEA 1WTRA 2KEDA 3S9WA 1TY0A 2F0GA 3HOXB 3KBXA 5CC4A 2B2UA 1HA5A 4DK0A 4KY7A 1BCPC 1A2UA 2L1BA 5TSSA 4KD4A 3SK8A 4RKLA 1ET6A 2MPMA 4NMZA 1A2TA 1CHQD 3GV6A 1I4RA 2LS01 4FO2A 5KRUA 3RMHA 3HZXA 1RD9D 5M3FB 1BCPF 5I4DA 1K83B 3ND9A 2IW3A 4PMBA 3S15B 1BCPB 3S2DB 1V43A 2PCFB 2A73B 3I8ZA 3A54A 1PXUA 2FMMA 1PMRA 3BYTB 3I70A 3TP8A 1SNQA 5EBDA 3NQTA 4ILWA 1A15A 1BOSA 3BVGA 4K6LA 5M5YB 1A6XA 5DM73 3TN2A 1GUGA 1KNAA 4PQXA 3X3NA 1HA6A 1OXSC 4RAUC 2AQ1B 1KABA 3MVVA 3HGBA 3EA6A 1LLRD 2JEBI 5CBAE 3P1HA 4U673 2F4IA 4IN3A 3KLSX 3C1EA 4N9TA 4HAEA 1PTOD 2K5WA 4A3FB 1F9SA 1TU2B 1V1PA 2EE1A 3DXJC 4FF4A 5EKIA 5CYUA 3AU7A 5D3DA 1E2VA 1QG7A 3V05A 2D9UA 1G6ZA 4DF7A 4TRDA 4BS9A 3IFTA 4FF1A 3I72A 2EXZA 4OGQC 4XQQA 1ESFA 1PRTC 1KAAA 2XSCA 1EYAA 3X3MA 1TWGB 1LACA 3DHQA 3WOEA 4Q5VA 5CV6A 5EPLA 4PMWA 1SE3A 2B2VC 1TR5A 3R3OA 1PRTF 3L9AX 5C0XG 1JE4A 1PRTB 1WTXA 4FYDA 1TWHB 5E4XA 5EPKA 1HQRD 3DEPA 4KY5A 4G7OC 1UUPA 2H4OA 3S16B 2EY5A 5HURA 3GO5A 3CQZB 4TQUS 3NBIA 1EL0A 4HSVA 3Q24A 1HPCA 1GUOA 1YNJD 3NP8A 3S1MB 4NP5A 4R8NA 3R8BA 3CRLC 1Q1BA 4V190 5C0XH 2J7ZA 1U4RA 1CT1D 2QEJC 3C46A 2OXPA 2O2LD 4C1NK 3D4RA 5CV8A 4G7HC 4MHEA 2RQXA 4GZYC 4HTHA 3CHBD 3ND8A 2L4NA 3OSOA 3J81E 2F0LA 1GHJA 3VYSA 4QMGA 5T1GA 2B39A 5FO9B 4HR7B 2OF1A 4MN3A 2D5DA 4K8IA 1D2BA 3HP3A 2AWNA 5BN3A 4FF2A 1EWCA 4UAIA 5G3LF 5ELFA 3O13A 2AQ3B 2B2TA 2AWOA 4RH6A 3HEJA 1Z6HA 4DGZA 5FKAC 3I4LA 3MXGA 2G9DA 2F0PA 3SK5A 1TVXA 2JYOA 2YYZA 4RHSA 4KI0A 5KYLA 1NUCA 3IKJA 2F1MA 2L55A 3G6JB 5FOBB 1KNEA 5E1FA 4KK7A 3M85A 4QB4A 3SHLA 5KIXA 2BCOA 4YIJA 1EZ6A 3C2PA 2I46A 1OO9B 3NXWA 2IX3A 4RGMA 2F0TA 4KTAA 4XT3B 3A7AB 2HUGA 3VA5A 1RODA 3D4DA 1E0BA 2QCPX 3M3YB 1LTTD 1SMYC 3OIPA 2PZTA 2IPKD 4C3IB 2WB1B 2LMCB 2O5JC 2Z4HA 5A2QE 4JBWA 3RZOB 3PIO3 3IAYA 1O7ZA 5A35A 2K28A 5KNDA 1BNZA 1NSNS 3L3OC 2K04A 3OWFA 1JOKA 3GTOB 2B63B 1HQMC 1SJHD 5T1IA 2JP1A 1WD1A 2D2CC 2TSSA 3DMUA 5K5PA 1SYEA 1PYWD 2Z4IA 3FEWX 1G2SA 5D14A 1B50A 2KHSA 4IFDH 4RGTA 2DNCA 1C8CA 2FJ2A 3NK9A 1FNUA 3IFDA 2C5CA 2L12A 5I6WA 3M4YA 4KHVA 5LL6S 2WKCA 3I4NB 2PMZB 5KNCA 2NN6I 4ZRZA 3TZDA 1CHPD 2HCCA 2K1BA 1EY8A 1X32A 4C1NI 4BY7B 2I07B 2NTTA 2XWJB 1PDQA 3D6CA 2NB0A 2RKSA 3DWQA 3ZYYX 1H9JA 1CFMA 4A3BB 2M00A 2ICIA 1STYA 2L0CA 2SNMA 2BE5C 3FRPB 1SYFA 2E2HB 4DN4M 1CZWA 3S14B 1R9TB 1S5FD 5I2YA 5C44B 3BDOA 1PTOC 4G7ZC 4RFBA 3VYUA 1ENCA 2PZWA 1BR9A 1Q8IA 2EYFA 1X3PA 1NR2A 1MSHA 5JEAG 1TS2A 5I9OA 2G9HD 5CV9A 2A68D 5ELCA 4CJ0B 1HUMA 1SNCA 1Z7TA 3SE0A 1PTOB 3CRKC 1JQYD 3GD7A 3SR1A 3ITPA 1QCBD 2LFNA 5EPJA 1A3VA 1AP0A 1NR4A 2XNAC 5E4WC 1WVLA 4A3JB 4KHZA 2IJ0A 1EYDA 1S5ED 4HEDA 1LTID 1CM9A 1AZQA 5FO7B 1STHA 5FLXL 3GP7A 1Y1WB 1FGBD 1SNPA 1M4VA 3A8JE 2L11A 3S17B 1PFBA 2K01A 1BQQT 1VCIA 3V2TA 1H9KA 1EWHA 3MHBA 1SAPA 3SDZA 2EDGA 2R7ZB 4IALA 1B9MA 2PW5A 3LWUA 2B2WA 4X3TA 1EIHA 2F0FA 2A69D 1YNJC 4H0LC 1Z47A 2TMPA 2A6HD 4XDXA 1IHZA 1RCVD 1W6JA 4J1MA 3RD4A 3K7AB 4XQJA 1S4ZA 1B3AA 1DONA 3Q23A 2PO4A 4KD3A 1EEFD 3RUZA 5BN4A 3OPOA 4C3HB 1DOKA 2ZXRA 1XXGA 3GTPB 3GTKB 1EY0A 3EVQA 4LK1C 3T56B 4C3JB 2FINB 3A7LA 4K5VA 4F8MA 1F2ZA 3T51B 4RCOA 5IGFA 1DOLA 2NUCA 2EY6A 2WP8J 4MIUA 1SNMA 1EFID 2JE6I 1EY4A 4K6DA 1KLUD 1SYBA 3D8GA 5C3XA 2D62A 3PO2B 2KCCA 3QOLA 2LKVA 4BWGB 2F0HA 4XQNA 1K8MA 1EQTA 2NWGA 2IWHA 1IYUA 4FNFA 4TKOB 4CKEA 2Q8IB 1Q3LA 2F0DA 2DY8A 5M9OA 3H09A 3KK7A 4ULLA 3G7LA 1H9SA 1HFGA 3HRZC 1LTAD 5IGEA 1QNUA 1DD2A 1MD2D 2E76C 1STAA 1R4QB 1TY2A 2QF7A 4I65A 4V0BA 3MZ5A 3NTHA 5J1ZA 4IUTA 5EKLA 4P2CB 1U4MA 3P75A 4ZUJA 1Q90A 4IUVA 4CKBA 2VXWA 2H1EA 4EQPA 1OXVA 1SSOA 1KDBA 3LX0A 1WTVA 1KTKA 1HRJA 1JWUD 1A3TA 1YNND 1FNVA 1DOMA 1GOZA 2EY1A 4DK1A 5C4ZA 1KDAA 4FXKC 4CJ2C 1IYVA 3E5SA 4DAVA 4ZK9B 4IZ8A 4WORA 1EEID 4I7ZC 2CVRA 1VF7A 3EROA 1WTQA 1D5ZC 3MXUA 5IOCA 4QCLA 1R4PB 2MHVA 5C5LA 2FHTA 1D5XC 1U4PA 4A3GB 3S1RB 1ESRA 4HCEA 3P7JA 4BA2I 3NBHA 2B2YC 4ZYSA 1S5CD 2EY2A 3J80L 1PFMA 3VR3A 1TWFB 1B1ZA 1A3UA 3EFXD 1C4QA 1ENAA 2JSOA 2XN9C 3EJIA 2SEBD 1STBA 2ZXOA 2NVXB 5M5WB 5DNFA 4Q0FA 1CK1A 2JA5B 3DM1A 3AMUA 1I4XA 3OW7A 1O78A 4LAAA 1EY9A 1LT3D 1WCMB 3SXHA 3VYTA 2F3VA 2F0KA 4RHRA 4KMUC 2E2DC 3PV0A 3NE5B 2O4XA 5CV7A 5CORA 2ENBA 3K57A 4S3SA 2BDOA 1EU4A 2SDFA 4FP5D 1EIGA 1OXUA 1PLFA 2E74C 2PQEA 3Q22A 3PUXA 3M7NA 3QWNA 5C3WA 1OXTA 3FDTA 2X6GA 5CGKA 4Z9CB 4A3IB 4J8QA 3T16A 4M8AA 4UDUC 2F03A 3S2HB 1WTPA 3SEBA 2JXMB 3Q6SA 3K5OA 2AUKA 2K5QA 3HS0C 3L7ZC 1ZXTA 3PO3B 2Y0SB 3BVMA 2A68C 1F9QA 4LMQD 5HGTA 2CW0C 4DAPA 3D31A 2B2VA 1F2YA 4BA1I 5JPMC 1AN8A 4PNYA 4IURA 2RSOA 5C0XI 1CA6A 3VYRA 3GV3A 1CQVA 4NDXA 2OT2A 2JA8B 5LHY1 1QILA 3E6ZX 3A8IE 1HTPA 1VMPA 1SBBB 1PFNA 1JORA 1HCZA 5C6AA 4ZKBB 1D1KA 2IL8A 3KF8A 4Y7NB 5JVG3 2KCNA 2XVSA 1CA5A 4WFN3 2Q8RE 1BO0A 3LNNA 4U68A 1S5BD 4L8JA 4A3MB 1XX8A 3KUPA 1IW7D 4IFDJ 2J0TD 4R8IA 1CTMA 2PYKA 1G2TA 3DEOA 2A69C 1EU3A 1EY7A 4RGOS 1XTCD 5JAVA 3NTIA 2A6HC 3A8KE 1M8AA 2LY7A 5IT9L 3M4OB 3SK6A 2XRSD 4H13C 5ELDA 4IUNA 3TSSA 2CQAA 2M9VA 3VR5A 2PPBC 1G91A 4JK1C 1RTNA 1I6VC 4ZAIA 1BXTA 3U9OA 2KOLA 3NQIA 2V4DA 3D3RA 4C3HG 1JICA 4QUCA 3NHHA 5IGDA 3MC0B 4C3JG 1TS3A 2F0QA 5CV5A 4WJWA 2R92B 5J22A 1Y8PB 1GHKA 4IQZA 4B08A 5COYA 5D65A 2RDGA 5JOBA 1T5XD 3K0YA 4ABNA 2J4XA 2EYLA 2BA1A 3UI2A 2F0SA 2Q8TA 2R6GA 2L5TA 1MGSA 3TP7A 2IX1A 2EYHA 4HSPA 3C3LA 1EOTA 3MAQA 3MTSA 2CHBD 5IGCA 1VF5C 1DZ1A 1SYDA 3W3AA 4DNRB 3HOWB 2BDNA 2E75C 4OO1G 5EQ0A 3CU7A 4IFDI 1IKLA 4HN7A 1MBYA 3PUVA 4O1NA 5EJWA 4C56C 3F2UA 4F87A 2N55A 1S5DD 1E2ZA 4KKTA 3I73A 1QOHA 2RVLA 3ERQA 2WAQB 4ZKCB 1TS4A 3VA7A 2RDHA 2EZVA 4AYBB 1YNNC 3I3CA 1EY5A 5FK9C 3HG9A 1STEA 1GUSA 1JCKB 1AZPA 1DJRD 1DM0B 3K6OA 4BY1B 2R3ZA 5BN5A 3K5NA 2F0OA 3JAML 1PTOF 4F88A 1C48A 4A3DB 2FMCA 2EYMA 1BUVT 3BS1A 1TWCB 1B9NA 1IKMA 2OEOA 1K8OA 1GJXA 3TMEA 2KVMA 1GUNA 2NZ1D 2XIWA 4R9WA 1F2LA 4DA2A 4IUUA 1ILQA 3FMCA 3URYA 3WOFA 1RKNA 2HDMA 4B9WA 3BDLA 1PZID 4KKUA 2ZXPA 2K05A 4CKCA 2ZT9C 1TT2A 2R61A 5J39A 4KN7C 5JEAH 2VNUD 5IGGA 1EY6A 2K03A 1LT5D 1RDPD 3K58A 1U4LA 3TP6A 2NVTB 3MFGA 2F0NA 2F0VA 2HDLA 2JA6B 1RHPA 2A5HA 4ZQ3A 3HOUB 5IODA 3TBIB 3FPPA 2X6LA 1F2MA 4ZUIA 1HTLD 3MA2B 1HXYD 3QG1A 1BF4A 1VMCA 3TP5A 1G291 4QF4A 1TQOA 2PZUA 5KEEA 3QJYA 1FR3A 2K7VA 1GXDC 3EQLC 5KGUA 3E0JA 1GUTA 3GTGB 1WTWA 1XYIA 3W2DA 2GA4B 1JOQA 1H9RA 4CGYB 1J8IA 2DY7A 4XYQA 4EQOA 5CBEE 2AUJD 3DUZA 1LV9A 1O7YA 2O5IC 1SJED 4K14A 3R93A 4RGNA 2HCIA 4NKLA 1STNA 3MXPA 3TZUA 4ID6A 4EGVA 3K59A 3KBGA 3GTMB 3Q0AA 2RBMA 3PIP3 1SDFA 3OIQA 1AW7A 1X3QA 2WIIB 4FXDA 4CBVA 1BBXC 1QNKA 2EJFC 4FVMA 1NAPA 3A55A 3BDCA 5FLXE 4L6TB 3OHXC 4K8JA 1V1PB 2M2LA 1Y1VB 2WINB 5EGTA 1MI2A 1TKWB 3QOJA 4DXFA 1TIID 3VR6A 5FO8B 5IIFA 4M1UB 1IW7C 2R93B 3T53B 2VUMB 1MSGA 2JEAI 1AEXA 1VDZA 1RF2D 5C3EB 1B53A 5K36G 3FVQA 4A93B 1LTBD 1I3QB 1LO5D 5AFWA 1UEAB 2BE5D 3OMGA 2EYPA 5E3FA 4C3IG 5IGBA 1STGA 4TSSA 2K6AA 1HFNA 4OHJA 2ICEC 1QE6A 1LT6D 2K33A 2EVBA 4RWSC 3P20A 2NTSA 5M5XB 4OIJA 4IUQA 1EQVA 1SYGA 1QWYA 1Q1EA 2ID0A 3SVMA 4HCSA 1BDOA 1TWAB 5C0XJ 3J81L 5K36H 1LTSD 2F0WA 4EQNA 3K5LA 3J7AV 1LABA 1UAPA 4FF3A 3H3VC 4WRDA 3ONAB 2KECA 3I91A 1HHVA 4PMCA 1V1OA 1F9RA 1F77A 3M7GA 2WKDA 4XT1B 3H91A 3S1NB 1ZYRD 3MXNA 4DXGA 1ICWA 3BYYB 2B2TC 3KLSA 3U9SA 4ZLTF 1SE4A 3N52A 4BBSB 4G4KA 2DNEA 4KKSA 4K5XA 1SXTA 1QJOA 2F0EA 5I6YA 2A6ED 2KUMA 4IUPA 5I2XA 1ILPA 1ZEQX 1H9MA 3RZDB 5ELEA 1JWSD 1UNSA 2N88A 4FXGC 1U9RA 2E2IB 1LTGD 2HQEA 4XYOA 3AB9A 2QKIC 1B4OA 3MWYW 5KNBA 5A2QL 4ODGA 2B2YA 5NUCA 3S1QB 1I6HB 2RSNA 2FFKB 2NVQB 3MFYA 4KJOA 1SYCA 5CV4A 5JPNC 2MGSA 1DXMA 3HOVB 4F7XA 3K5MA 2EPBA 4N9PA 1SE2A 4BBRB 3NUCA 4ME5A 1I4QA 5ISRA 5KYIA 5C5MA 1XWEA 4HMJA 2BOSA 3GTLB 3J80E 3I4MB 5C4JB 3H94A 2RA4A 3PUYA 2KA7A 1BCPD 2IT1A 1ML0D 1CQFA 1B2TA 2PNRC 3PUZA 3CKIB 2NBFA 1ONLA 2NVYB 2B8FA 2E2JB 1AFPA 1E2WA 3FKIB 5DAUA 3VR4A 3GTJB 4CJ1B 2F0MA 5C4XB 5CR3A 1DYQA 1JWMD 4CHTB 2XRQD 5EKKA 4RA8A 3WDNA 2F0IA 1PTOH 4G57A 3C1FA 2NN6G 3QIAA 4K2LA 4DAYA 1Y8NB 4EVOA 3BZDB 3RLFA 1LT4D 3GTQB 3NTKA 4O42A 4K2KA 4OL7A 4A3KB 1LTRD 1EYCA 1HUNA 1D1IA 2IX0A 3DWAA 4IFDG 1WD0A 1JR0D 5I9PA 5JVH3 2RDFA 3H6MA 2F0JA 2EYOA 1NCVA 4KN4C 3T13A 2NN6H 5F2DA 2MUYA 1I4GA 2QDBA 1O7LA 1KLGD 2BA0A 1PRTD 4QUFA 3D6WA 1B44D 1ENFA 2MJ8A 1DCZA 2WV6D 3NPPA 2WACA 2Z1CA 3OMCA 2PW7A 2L9HA 2X69A 2SOBA 4OIKA 3FPUB 2KJXA 4B9XA 3BVZA 1Q12A 2K5DA 1CZGA 2EYJA 4XTCS 2F3WA 3IL8A 3PUWA 2SNSA 1FD7D 1IL8A 3DWPA 1OXXK 2DN8A 3OWEB 5JEAJ 1J9OA 5IT9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHP D;  1T5X D;  1FGB D;  3EFX D;  2NTS A;  1M4V A;  1I4H A;  1L0Y B;  2J4X A;  3BVG A;  4K6L A;  2XN9 C;  3DWA A;  1SJE D;  2NTT A;  1CQV A;  5D3I B;  1JR0 D;  1I4P A;  2SEB D;  4RGN A;  1QIL A;  1LTA D;  1SBB B;  3DWQ A;  2AQ1 B;  1ET9 A;  1PZJ D;  1MD2 D;  4RGM A;  1CK1 A;  1L0X B;  1TY2 A;  3EA6 A;  1LLR D;  3R8B A;  2ICI A;  1I4X A;  1LTS D;  3URY A;  1SE2 A;  1I4Q A;  3KLS X;  3R2T A;  1LT3 D;  1LTT D;  1PTO D;  1AW7 A;  1FNW A;  1PZI D;  1D5M C;  4RHR A;  1I4G A;  1V1P A;  2IPK D;  1KLG D;  1CT1 D;  1BCP D;  1S5B D;  1SEB D;  2QEJ C;  2R61 A;  1PRT D;  4L6T B;  2CHB D;  5D3D A;  1V1P B;  1S5F D;  1RCV D;  2O2L D;  1B44 D;  1V1O A;  3V05 A;  1EU4 A;  1ENF A;  1LT5 D;  1F77 A;  1TY0 A;  1PTO C;  1RDP D;  1EU3 A;  4DXF A;  2WV6 D;  1KTK A;  2AQ2 B;  3MFG A;  4RGO S;  1EEF D;  1XTC D;  4RFB A;  1HA5 A;  2QIL A;  1XXG A;  1JWU D;  1ESF A;  1BCP C;  3CHB D;  1PRT C;  4O1N A;  1FNV A;  1GOZ A;  4L63 B;  4C56 C;  4DXG A;  3BYY B;  5TSS A;  2XRS D;  1DYQ A;  1HTL D;  4RCO A;  1JWM D;  5ELD A;  4Z9C B;  2XRQ D;  1HXY D;  1ET6 A;  1TS2 A;  3BVZ A;  2G9H D;  1RF2 D;  1S5D D;  5ELC A;  3TSS A;  1SE4 A;  1CHQ D;  1SJH D;  1EFI D;  1EEI D;  1I4R A;  3R2I A;  1TS4 A;  1SE3 A;  1PTO H;  1PTO B;  2TSS A;  1D5Z C;  1EWC A;  4UDU C;  2RDH A;  1BXT A;  1RD9 D;  1KLU D;  1BCP F;  1JQY D;  3SEB A;  1PYW D;  5I4D A;  1PRT F;  5ELF A;  5FK9 C;  1SXT A;  3O13 A;  2AQ3 B;  2RDG A;  1LTB D;  1G8Z D;  1LO5 D;  1STE A;  1D5X C;  3MC0 B;  1BCP B;  4RGT A;  2XNA C;  4RH6 A;  1PRT B;  1TS3 A;  4BWG B;  5FKA C;  1JCK B;  3BVM A;  1DJR D;  3W2D A;  2IJ0 A;  4TSS A;  3BZD B;  4ZYS A;  1S5C D;  1FNU A;  1HQR D;  1FD7 D;  4OHJ A;  1LT4 D;  5ELE A;  2Z8L A;  4RHS A;  1JWS D;  1TS5 A;  1S5E D;  1UNS A;  1PZK D;  1D6E C;  3DWP A;  1PTO F;  1LTI D;  5ELB A;  1LT6 D;  3BYT B;  3OWE B;  1UUP A;  1LTG D;  1B1Z A;  1AN8 A;  3GP7 A;  1LTR D; 
#chains in the Genus database with same CATH topology
 1SND A;  3SGI A;  3QB3 A;  5M3M B;  1P16 A;  4A93 G;  4X3K A;  1I4H A;  2K5H A;  4LF5 L;  4NW2 A;  1EZ8 A;  2VB3 X;  4KV6 A;  3J7A F;  1RTO A;  2B2W C;  2XWB B;  5D3I B;  5JJZ A;  4ME3 A;  4JI0 L;  2NYZ D;  3T4A C;  2UU9 L;  3V96 A;  1ET9 A;  1PZJ D;  4MNO A;  5AJ3 L;  1CKM A;  4HMI A;  1FYC A;  1L1O B;  1YHB A;  5DEH A;  5EBC A;  4OO1 H;  4IPG A;  4QL5 A;  2UXB Q;  3KLW A;  3E9H A;  1JOO A;  3NSW A;  2VB2 X;  4NXM L;  1WTO A;  1SFO B;  1MJC A;  1FNW A;  4IPH A;  5LL6 X;  1D5M C;  4XIG S;  2MP1 A;  4KY6 A;  2EQS A;  3N6R A;  3QO2 A;  1II3 A;  2A74 C;  2C9O A;  2EJM A;  1T5E A;  3KLR A;  3VR2 A;  1SEB D;  5G3L D;  1E3P A;  3PMF A;  4JVZ A;  3SK4 A;  3HKZ B;  3ZJY C;  2ZTD A;  4LFB Q;  4K5W A;  1JC7 A;  1QVC A;  3I56 A;  2CW0 D;  4KJN A;  5C4H A;  4X3S A;  3ICE A;  4JOI C;  2AQ2 B;  4H44 C;  1HR0 L;  3OOC A;  3MEH A;  2BH2 A;  1QVG A;  2N78 A;  4JG2 A;  1I50 B;  2QIL A;  3BG3 A;  4A3E B;  4DU9 A;  2F0U A;  1N34 Q;  4L63 B;  4QIW B;  2B2U C;  3NWT A;  1X55 A;  4JI3 Q;  3HOY B;  3D4W A;  4DNT B;  1IXR A;  2GN5 A;  5JJK A;  4OO1 I;  4H7B A;  2KHI A;  3J7Y W;  3R2I A;  1O7I A;  4A4I A;  2GVA A;  4CDF C;  1X65 A;  1RJT A;  5DM6 3;  1ZYR C;  4DFA A;  1G8Z D;  4APV A;  2YU9 B;  4A3G H;  1SNO A;  3H0G B;  3S1R H;  4X3U A;  4J6H A;  4JW0 A;  4JCV E;  4PV1 C;  3NWS A;  2EOT A;  3TDQ A;  4OX9 Q;  2N49 A;  1W6K A;  2EJG C;  1Y69 U;  2Z8L A;  1KDC A;  5CMD A;  1TS5 A;  3HOZ B;  1NY4 A;  1J5E Q;  1PZK D;  1D6E C;  5ELB A;  4LJZ C;  2K32 A;  2Z9H A;  4HIO A;  4BBS G;  1PH7 A;  3CAM A;  3A56 A;  4DV0 Q;  1TWF H;  3LGJ A;  3E3X A;  3I90 A;  4JBJ A;  1GUW A;  5IYD G;  1L0Y B;  2A6E C;  4C2M B;  1WYD A;  1MIU A;  3GQB A;  4J15 A;  1I4P A;  3LWE A;  1O80 A;  3A0J A;  1SMY D;  2NVX H;  4RKB A;  2UUB L;  1H9S B;  3A74 A;  5M5W H;  3K81 C;  1VS0 A;  4DK6 C;  1L0X B;  2JA5 H;  4LFA Q;  2JA7 B;  1F9P A;  1X3G A;  1CI3 M;  1JB3 A;  1V8Q A;  3R2T A;  4DR7 L;  1WCM H;  1ZKO A;  2KQ3 A;  3K80 C;  3JAM E;  4E6I A;  4DNI A;  4DV3 L;  1Y8O B;  2H5X A;  4XXE A;  4OXP A;  2B8G A;  4ZCK A;  2F4V L;  4OWT B;  1Q81 C;  4RCN A;  1QB5 D;  2KEE A;  3T1H L;  1WTR A;  3HOV G;  2KED A;  3S9W A;  1TY0 A;  2F0G A;  3HOX B;  3KBX A;  3PF5 A;  5FJ8 H;  4POG A;  4PZ8 A;  2VQF Q;  5IYD H;  5CC4 A;  2B2U A;  3AFQ A;  3RN2 A;  1HNX L;  1HA5 A;  1WI5 A;  3I4M G;  4DK0 A;  4KY7 A;  1BCP C;  1A2U A;  2MO0 A;  2L1B A;  1B7Y B;  5TSS A;  4KD4 A;  3SK8 A;  4RKL A;  4OON A;  1ET6 A;  5FLM G;  2EXD A;  2MPM A;  2V1C C;  4A3I H;  4NMZ A;  1A2T A;  1CHQ D;  3GV6 A;  1I4R A;  2LS0 1;  4FO2 A;  4IPC A;  5KRU A;  3RMH A;  3HZX A;  1RD9 D;  3S2H H;  5M3F B;  5H1S E;  1BCP F;  5I4D A;  1K83 B;  3ND9 A;  4L5Q A;  2IW3 A;  4PMB A;  3S15 B;  2HHH Q;  1BCP B;  3S2D B;  1V43 A;  3PO3 H;  2PCF B;  2ZTE A;  3G4S A;  1X54 A;  2A73 B;  3I8Z A;  5C4X G;  3A54 A;  1PXU A;  2FMM A;  2ASB A;  1N9W A;  1PMR A;  1C0A A;  2OTL A;  1GO3 E;  4JPB W;  3BYT B;  3NBH B;  3I70 A;  1KRS A;  4DAM A;  2MFI A;  3TP8 A;  1I94 Q;  1X9N A;  1SNQ A;  5EBD A;  3NQT A;  4ILW A;  1A15 A;  1BOS A;  3BVG A;  4K6L A;  5M5Y B;  1A6X A;  5DM7 3;  3TN2 A;  1GUG A;  1KNA A;  4PQX A;  2JA8 H;  3X3N A;  1HA6 A;  1OXS C;  3T1Y L;  4RAU C;  2AQ1 B;  2XTI A;  1KAB A;  3MVV A;  3HGB A;  3EA6 A;  1LLR D;  2JEB I;  5CBA E;  3P1H A;  4U67 3;  1RIP A;  4A3K G;  1SN8 A;  1VQD A;  2F4I A;  4B3M L;  4IN3 A;  3KLS X;  4Y7N H;  3C1E A;  3ULP A;  4N9T A;  3F2C A;  4HAE A;  1PTO D;  2K5W A;  3CCR A;  4A3F B;  1F9S A;  1TU2 B;  1V1P A;  2EE1 A;  1VQI A;  3DXJ C;  1HNZ Q;  4FF4 A;  5EKI A;  4A3M H;  3K8A A;  2R92 G;  3I7F A;  5CYU A;  3AU7 A;  5D3D A;  1E2V A;  2OCE A;  4JI8 L;  1QG7 A;  3V05 A;  1HJP A;  4LF8 L;  2D9U A;  4JI5 Q;  1G6Z A;  4DF7 A;  4TRD A;  4BS9 A;  3IFT A;  4FF1 A;  1ICF B;  3I72 A;  2EXZ A;  4OGQ C;  3OYY A;  4JI6 Q;  4XQQ A;  1ESF A;  2UXC L;  1PRT C;  1KAA A;  2XSC A;  1EYA A;  3M4O H;  4JBM A;  3ULL A;  2G5D A;  3JAM c;  3X3M A;  4X64 L;  4L5R C;  1TWG B;  4LFC L;  1LAC A;  4CDE C;  3DHQ A;  3WOE A;  4Q5V A;  5CV6 A;  3PSI A;  2CWP A;  5EPL A;  1PVO A;  4PMW A;  1SE3 A;  2Z6K C;  1NMF A;  2B2V C;  4AIM A;  1TR5 A;  3R3O A;  1PRT F;  4A76 A;  3L9A X;  2UUA Q;  5C0X G;  4LF9 Q;  1JE4 A;  1PRT B;  1WTX A;  4FYD A;  1TWH B;  1E1T A;  5L37 A;  3TQY A;  1H95 A;  2R92 H;  5E4X A;  1FVI A;  5EPK A;  1HQR D;  1QVF A;  3KF6 B;  3DEP A;  4LF4 Q;  1VQM A;  4KY5 A;  4G7O C;  1A62 A;  1UUP A;  2H4O A;  3D0F A;  1EIF A;  3S16 B;  2EY5 A;  5HUR A;  3GO5 A;  3CQZ B;  4TQU S;  3NBI A;  1VQB A;  4HID A;  1EL0 A;  4HSV A;  5JJI A;  1VQ4 A;  3Q24 A;  1HPC A;  3FHW A;  1GUO A;  1YNJ D;  3ER0 A;  3NP8 A;  4LWC A;  3S1M B;  4NP5 A;  4R8N A;  2YTX A;  1PV4 A;  1OTC A;  3R8B A;  1BBU A;  1QUQ B;  2PMZ E;  3CRL C;  1Q1B A;  1W3S A;  4V19 0;  5M3M G;  4AYB G;  3F8T A;  3IRB A;  5C0X H;  2J7Z A;  4A3L H;  1FJG L;  1U4R A;  3KF8 B;  2Q2T A;  1CT1 D;  2QEJ C;  3C46 A;  4BY1 G;  2OXP A;  1PYS B;  4DR4 Q;  3CMA A;  4UP7 A;  2O2L D;  3W5O A;  4C1N K;  3HOW H;  3D4R A;  5CV8 A;  4G7H C;  4DR6 L;  4LFB L;  4MHE A;  2RQX A;  2A8V A;  2YTV A;  4P75 A;  1XNQ Q;  1JT8 A;  4GZY C;  4HTH A;  3CHB D;  2D0O A;  3ND8 A;  2L4N A;  3OSO A;  3J81 E;  2F0L A;  1GHJ A;  1VQ5 A;  4QMG A;  5T1G A;  3VYS A;  2B39 A;  5FO9 B;  4HR7 B;  2OF1 A;  3CPW A;  3KYH C;  4MN3 A;  4A3C G;  2RCN A;  1VQJ A;  4EQ5 A;  1EOV A;  1YIJ A;  2D5D A;  4K8I A;  1D2B A;  3HP3 A;  2AWN A;  5BN3 A;  5GAH C;  4FF2 A;  1XNR L;  1EWC A;  4NB3 A;  4UAI A;  5G3L F;  3FP9 A;  5ELF A;  4LUZ A;  3O13 A;  2AQ3 B;  2JJQ A;  2Q2H A;  4JV5 Q;  4A3E G;  2B2T A;  2AWO A;  4RH6 A;  3HEJ A;  1Z6H A;  4DGZ A;  1UEB A;  5FKA C;  3I4L A;  3MXG A;  4BY1 H;  5JJL A;  2G9D A;  2NZO A;  3UDX A;  2F0P A;  4RMF A;  3HOY G;  3SK5 A;  3UE0 A;  1TVX A;  2JYO A;  3HKZ E;  2YYZ A;  4DV1 L;  4RHS A;  4KI0 A;  5KYL A;  1NUC A;  1B3Q A;  3IKJ A;  2F1M A;  2L55 A;  4A3D H;  2IY5 B;  3G6J B;  5FOB B;  2AMC B;  1KNE A;  2A1A A;  5E1F A;  3I2Z A;  4KK7 A;  3M85 A;  4QB4 A;  2KCT A;  3BZK A;  1JJG A;  3SHL A;  3H0G G;  5KIX A;  4K0K L;  3HOU G;  2BCO A;  1YZ6 A;  4YIJ A;  1EZ6 A;  1VQG A;  3C2P A;  1BVS A;  2I46 A;  1OO9 B;  5IE8 A;  3NXW A;  2MQH A;  2IX3 A;  4RGM A;  2F0T A;  1K3R A;  4KTA A;  1ASZ A;  4XT3 B;  3A7A B;  2HUG A;  3VA5 A;  1ROD A;  3D4D A;  1VQF A;  1E0B A;  3RLN A;  2QCP X;  4YCW A;  1JB7 A;  3BU2 A;  3M3Y B;  1LTT D;  1IBM Q;  1SMY C;  3OIP A;  1HNW Q;  1V9P A;  2PZT A;  1K0R A;  4N8F A;  2IPK D;  4C3I B;  5IWA L;  1YNX A;  4UHV A;  2K5N A;  2RCF A;  2WB1 B;  5ELN A;  2LMC B;  2O5J C;  2Z4H A;  5A2Q E;  4JBW A;  2JA7 G;  1EQQ A;  4HJ9 A;  1N33 L;  3RZO B;  3UDF A;  3PIO 3;  2NVT H;  3IAY A;  3KFU A;  1O7Z A;  5A35 A;  2VQF L;  2JA6 H;  3HOU H;  2K28 A;  5KND A;  1BNZ A;  1IL2 A;  1NSN S;  4X66 L;  3L3O C;  1EYG A;  2K04 A;  1AE3 A;  2YTY A;  2WFW A;  3OWF A;  1JOK A;  3GTO B;  4P72 A;  2B63 B;  1S3O A;  1HQM C;  1SJH D;  5T1I A;  2JP1 A;  1WD1 A;  5BR8 Q;  2D2C C;  2K14 A;  2TSS A;  1IBK L;  4PG3 A;  3DMU A;  5K5P A;  1PYW D;  1DGS A;  1SYE A;  2Z4I A;  1G2S A;  3FEW X;  1YJN A;  5D14 A;  1B50 A;  2KHS A;  2CH4 A;  4IFD H;  4RGT A;  4DR2 Q;  2DNC A;  3GTG H;  1B8A A;  1C8C A;  2FJ2 A;  3NK9 A;  1FNU A;  3IFD A;  2C5C A;  2L12 A;  2Z0S A;  3BZC A;  3AEV A;  5I6W A;  3M4Y A;  4KHV A;  5LL6 S;  1VQ9 A;  2WKC A;  4P74 A;  3I4N B;  1SRU A;  2PMZ B;  5KNC A;  2NN6 I;  4ZRZ A;  3TZD A;  1CHP D;  2HCC A;  2K1B A;  1VQO A;  5M3F G;  1EY8 A;  1X32 A;  4C1N I;  4UPA A;  3DM3 A;  4BY7 B;  2I07 B;  2NTT A;  5IP9 H;  2Q2U A;  2XWJ B;  3PO2 H;  1PDQ A;  3D6C A;  2NB0 A;  2RKS A;  3EIV A;  3DWQ A;  3ZYY X;  1WJJ A;  3L0O A;  4GOP A;  1H9J A;  1CFM A;  4DV5 L;  2N8N A;  1PH3 A;  1VQA A;  4A3B B;  2M00 A;  2ICI A;  1STY A;  2L0C A;  5C3E G;  4B3S Q;  2SNM A;  3GTM H;  1XMO L;  2BE5 C;  3FRP B;  1CKN B;  1SYF A;  3CW2 C;  2CH4 W;  2E2H B;  1GVP A;  4MTN A;  4DN4 M;  1CZW A;  3S14 B;  1R9T B;  4PZ7 A;  5IYC H;  5J3B A;  1S5F D;  1Y1V H;  3NEL A;  3NEM A;  5I2Y A;  5C44 B;  4GLA C;  3BDO A;  1CSQ A;  4X65 Q;  2E5L Q;  1PTO C;  2UUC L;  4G7Z C;  4RFB A;  3VYU A;  1ENC A;  4DR1 Q;  4A3F G;  4B3R Q;  2PZW A;  4DUZ L;  1BR9 A;  2I5M X;  1Q8I A;  4H02 A;  2R93 H;  2EYF A;  1YJ9 A;  2VUM H;  4DUY L;  1X3P A;  3KDF A;  1NR2 A;  1L2F A;  1MSH A;  4L5S A;  1E24 A;  5JEA G;  1E1O A;  1TS2 A;  5I9O A;  2G9H D;  5HY6 A;  5CV9 A;  2A68 D;  5ELC A;  5C3E H;  4CJ0 B;  5HGQ A;  1HUM A;  4GN4 B;  1A63 A;  1SNC A;  1Z7T A;  3SE0 A;  2KHJ A;  1PTO B;  3CRK C;  4GNX A;  1VQK A;  2RF4 A;  4A93 H;  1JQY D;  3GD7 A;  4KHP L;  5LMU Q;  3SR1 A;  3ITP A;  1QCB D;  1N32 L;  2LFN A;  5EPJ A;  1S40 A;  1I3Q H;  1A3V A;  1PH4 A;  1IBL Q;  1KXL A;  1AP0 A;  1X3E A;  1NR4 A;  2XNA C;  2R7F A;  5E4W C;  3B6Y A;  3F2D A;  1WVL A;  4A3J B;  4KHZ A;  2IJ0 A;  1K0S A;  4TVA B;  1EYD A;  2QW7 A;  5IP7 G;  4IO9 A;  1RL2 A;  1S5E D;  4HED A;  1VQE A;  1LTI D;  1CM9 A;  1AZQ A;  4DV7 Q;  5FO7 B;  1STH A;  4R4C A;  5FLX L;  3GP7 A;  3CD6 A;  1Y1W B;  1FGB D;  1SNP A;  5M5X H;  1M4V A;  3A8J E;  2L11 A;  3S17 B;  3I4O A;  2K52 A;  1PFB A;  2K01 A;  4QY7 A;  1BQQ T;  1L1O A;  1VCI A;  3V2T A;  1H9K A;  1TWA H;  1EWH A;  3MHB A;  2B3G A;  4N8X 1;  1SAP A;  3SDZ A;  2EDG A;  2R7Z B;  2AHO B;  4IAL A;  1B9M A;  1MHW C;  3DLL A;  2PW5 A;  3LWU A;  2P5Z X;  4LUO A;  4JYA Q;  2B2W A;  5LMN Q;  4Y52 H;  4X3T A;  4DV2 L;  1EIH A;  2F0F A;  3H15 A;  2A69 D;  1G51 A;  1VQH A;  1YNJ C;  4H0L C;  1Z47 A;  3CCV A;  2TMP A;  2A6H D;  2LXJ A;  2ZJQ A;  4XDX A;  3W1B A;  1KC8 C;  1IHZ A;  2HT1 A;  1RCV D;  1KHI A;  1W6J A;  4J1M A;  3RD4 A;  3K7A B;  4XQJ A;  1S4Z A;  1B3A A;  1DON A;  3Q23 A;  2PO4 A;  4KD3 A;  1EEF D;  3RUZ A;  5BN4 A;  3OPO A;  4YY3 Q;  5ELO A;  4C3H B;  1DOK A;  2ZXR A;  1XXG A;  4QJF A;  3GTP B;  3GTK B;  4GKJ L;  1EY0 A;  3EVQ A;  3S1N H;  4LK1 C;  3T56 B;  4C3J B;  2FIN B;  3A7L A;  4K5V A;  4F8M A;  3H3V H;  1F2Z A;  3T51 B;  2ZJP A;  1PH1 A;  3AYH B;  4RCO A;  5IGF A;  1DOL A;  3CC2 A;  2NUC A;  2EY6 A;  3W1G A;  2WP8 J;  4JOI A;  1UE6 A;  4MIU A;  1SNM A;  3CPF A;  1EFI D;  1N36 Q;  2JE6 I;  4BBS H;  4DPG A;  1EY4 A;  4BBR G;  4K6D A;  3U4Z A;  1KLU D;  1SYB A;  3D8G A;  5C3X A;  2D62 A;  1XMQ Q;  1B70 B;  3PO2 B;  2KCC A;  3QOL A;  2K75 A;  2LKV A;  4BWG B;  2F0H A;  4XQN A;  3NEN A;  4R4T A;  1K8M A;  1EQT A;  2NWG A;  1LYL A;  4DR5 Q;  2IWH A;  1Q7Y C;  1IYU A;  4FNF A;  4TKO B;  4CKE A;  3RZD H;  2Q8I B;  1Q3L A;  2F0D A;  2DY8 A;  2E2I H;  5M9O A;  3H09 A;  3KK7 A;  4ULL A;  1YHQ A;  3RNU A;  3G7L A;  4HIM A;  1H9S A;  3FKI G;  1HFG A;  3S1Q H;  1I6H H;  3HRZ C;  1LTA D;  5IGE A;  1QNU A;  1DD2 A;  2PI2 E;  5GRO A;  2NVQ H;  2PQA B;  1HZB A;  1MD2 D;  2E76 C;  4AQY L;  1STA A;  1R4Q B;  1TY2 A;  1WOC A;  2QF7 A;  4I65 A;  3HOV H;  1X56 A;  4V0B A;  4X62 Q;  4BBR H;  3MZ5 A;  3NTH A;  5J1Z A;  2R7D A;  1U5K A;  4IUT A;  1JJC B;  1LTL A;  5EKL A;  3GTL H;  3I4M H;  1PHJ A;  4P2C B;  1U4M A;  4GKK Q;  3P75 A;  4ZUJ A;  1Q90 A;  1IBM L;  4IUV A;  4CKB A;  2VXW A;  1A8V A;  2H1E A;  1TXY A;  4EQP A;  1OXV A;  1SSO A;  1KDB A;  3QR8 A;  5FLM H;  4FDB A;  1GM5 A;  4B3T Q;  2NVY H;  1J6Q A;  3LX0 A;  1WTV A;  1KTK A;  1Q8K A;  2E2J H;  4IOA A;  1YJW A;  2RHS B;  3FKI H;  1HRJ A;  3OTO Q;  1JWU D;  1A3T A;  1YNN D;  3GTJ H;  1FNV A;  1DOM A;  1GOZ A;  3PIO A;  4IOC A;  1XPR A;  1KIX A;  2UXD Q;  2EY1 A;  3CCL A;  4DK1 A;  5C4Z A;  5C4X H;  3HFZ B;  1KDA A;  4FXK C;  4CJ2 C;  4YHH L;  1IYV A;  3E5S A;  4DAV A;  1NJI C;  4ZK9 B;  4IZ8 A;  3MXN B;  4WOR A;  1PH9 A;  1EEI D;  4I7Z C;  4LF5 Q;  2CVR A;  1VF7 A;  4JI2 L;  3ERO A;  1WTQ A;  1D5Z C;  2JN4 A;  3MXU A;  5IOC A;  4QCL A;  1R4P B;  2MHV A;  5C5L A;  2UU9 Q;  3I55 A;  2FHT A;  2ES2 A;  4LF6 L;  1D5X C;  1U4P A;  4A3G B;  3A5Z B;  3S1R B;  1ESR A;  4HCE A;  3P7J A;  4BA2 I;  5LMN W;  5AJ3 Q;  4JI7 L;  1WFQ A;  3S24 A;  3NBH A;  2B2Y C;  4ZYS A;  4DR2 L;  1S5C D;  1XPO A;  2WB1 E;  4R4Q A;  2EY2 A;  3J80 L;  1NE3 A;  5GAG C;  2B63 G;  4IJL A;  3GTQ H;  1PFM A;  3VR3 A;  4NXN L;  1TWF B;  1B1Z A;  4A3K H;  1S72 A;  1A3U A;  3EFX D;  1C4Q A;  1ENA A;  2JSO A;  2XN9 C;  3EJI A;  3M4Q A;  2SEB D;  1STB A;  2ZXO A;  4GLV B;  3AFP A;  1G6P A;  4JI4 Q;  2NVX B;  1VQN A;  5M5W B;  5DNF A;  4Q0F A;  1CK1 A;  2JA5 B;  2DGY A;  3DM1 A;  3I4N G;  3AMU A;  1CKO A;  1I4X A;  3OW7 A;  4LNQ A;  1O78 A;  4LAA A;  1EY9 A;  1LT3 D;  1WCM B;  3SXH A;  3VYT A;  2F3V A;  2F0K A;  4RHR A;  2CKZ B;  3G71 A;  4KMU C;  2E2D C;  1LM0 A;  3PV0 A;  4YWL A;  3NE5 B;  2O4X A;  5CV7 A;  5COR A;  2ENB A;  4A3B G;  3K57 A;  4S3S A;  2BDO A;  1EU4 A;  2SDF A;  4FP5 D;  1EIG A;  1PH6 A;  2DUD A;  1OXU A;  3UDG A;  1PLF A;  2E74 C;  2PQE A;  4X65 L;  3Q22 A;  3PUX A;  2UXB L;  1M90 C;  3M7N A;  4YCU A;  3QWN A;  5C3W A;  1OXT A;  3FDT A;  2X6G A;  5CGK A;  4Z9C B;  4A3I B;  4J8Q A;  5EAY A;  5C44 G;  2A19 A;  2I5L X;  3T16 A;  4M8A A;  4UDU C;  2ZM6 Q;  2F03 A;  3S2H B;  1WTP A;  3SEB A;  2JXM B;  1YEZ A;  3Q6S A;  3K5O A;  2AUK A;  2K5Q A;  3HS0 C;  3KF6 A;  3J80 i;  3L7Z C;  1ZXT A;  3PO3 B;  5GAD C;  2Y0S B;  3BVM A;  2A68 C;  1F9Q A;  4LMQ D;  5HGT A;  1N34 L;  3HKZ G;  2CW0 C;  4DAY B;  2Z6K A;  3D31 A;  4DAP A;  2B2V A;  1AH9 A;  4JI3 L;  1F2Y A;  4A75 A;  4BA1 I;  5JPM C;  3PF4 A;  2WAQ E;  1AN8 A;  4PNY A;  4IUR A;  2RSO A;  5C0X I;  1SR3 A;  1CA6 A;  5M3M H;  1YI2 A;  4DV3 Q;  3VYR A;  3GV3 A;  5E7N A;  1CQV A;  4NDX A;  2OT2 A;  2F4V Q;  2JA8 B;  1SE8 A;  1HZC A;  2HIV A;  1QIL A;  3E6Z X;  3A8I E;  1QUQ A;  1HTP A;  1VMP A;  5LHY 1;  4A3J G;  1SBB B;  3T1H Q;  1SMX A;  2QEX A;  1PFN A;  1JOR A;  1HCZ A;  5C6A A;  1ASY A;  4P73 A;  4ZKB B;  4EX5 A;  3KJP A;  4OX9 L;  2QDL A;  1HNX Q;  1D1K A;  2IL8 A;  3KF8 A;  1Y1W G;  1J5E L;  4Y7N B;  2CFM A;  5JVG 3;  4DV0 L;  1SFO H;  5LMN L;  2KCN A;  1TWC H;  2XVS A;  1CA5 A;  4WFN 3;  2Q8R E;  1BO0 A;  3LNN A;  4U68 A;  1S5B D;  4L8J A;  3CCQ A;  1XX8 A;  4A3M B;  2B29 A;  3AQQ A;  3KUP A;  1IW7 D;  4IFD J;  2J0T D;  1NNX A;  1UE5 A;  4R8I A;  4A3C H;  1CTM A;  4GS3 A;  2R7Z G;  2PYK A;  1G2T A;  3HOZ G;  3DEO A;  2A69 C;  4IPD A;  1EU3 A;  1EY7 A;  1W2B A;  4LFA L;  4RGO S;  4HJ7 A;  1XTC D;  5JAV A;  1VQL A;  2PI2 A;  3NTI A;  1I50 H;  2A6H C;  3CXC A;  4I7A A;  3A8K E;  3OW2 A;  4A3E H;  1M8A A;  2LY7 A;  5IT9 L;  3M4O B;  2VY3 A;  3SK6 A;  3HOY H;  2XRS D;  4H13 C;  5ELD A;  4IUN A;  4DV6 Q;  3TSS A;  2CQA A;  2M9V A;  3VR5 A;  2PPB C;  1G91 A;  4JK1 C;  1PH5 A;  1HH2 P;  1K9M C;  5DLQ E;  1RTN A;  1I6V C;  4ZAI A;  3CP0 A;  3G6E A;  1BXT A;  3U9O A;  2KOL A;  4OWW B;  3NQI A;  2V4D A;  3D3R A;  4C3H G;  1JIC A;  4QUC A;  3TS2 A;  3NHH A;  5IGD A;  1NMG A;  3T1Y Q;  2YU9 H;  4MZ9 A;  3MC0 B;  3H0G H;  4JI1 Q;  4C3J G;  4OEL B;  4CDD C;  1TS3 A;  2F0Q A;  1Z9F A;  5CV5 A;  4WJW A;  2R92 B;  4IJH A;  2XGT A;  5J22 A;  3K0X A;  4B3M Q;  1Y8P B;  3HOZ H;  1GHK A;  2F52 A;  3UE1 A;  2VS1 A;  3PQI A;  4IQZ A;  5COY A;  5D65 A;  4B08 A;  3HOX G;  2RDG A;  3HKS A;  1T5X D;  5JOB A;  3K0Y A;  4ABN A;  4C2M H;  2J4X A;  2EYL A;  2BA1 A;  3UI2 A;  4YWM A;  2OTJ A;  2F0S A;  2Q8T A;  2R6G A;  3RR5 A;  3STB D;  2L5T A;  4JI8 Q;  2HHH L;  4LF8 Q;  1LUZ A;  1MGS A;  2GVB A;  2VW9 A;  2JA7 H;  3TP7 A;  1UWV A;  3E9I A;  1MKH A;  4HJ5 A;  2OQ0 A;  2UXC Q;  2IX1 A;  1IYJ B;  2EYH A;  1I94 L;  4HSP A;  3J80 c;  3C3L A;  1VQ6 A;  1EOT A;  2K5V A;  3MAQ A;  3MTS A;  2CHB D;  5IGC A;  1VF5 C;  1DZ1 A;  1SYD A;  3W3A A;  4DNR B;  3HOW B;  1JMC A;  2BDN A;  2E75 C;  4NPS A;  4OO1 G;  3HOX H;  4R1J A;  5EQ0 A;  1GKH A;  4B3T L;  3CU7 A;  4IFD I;  1IKL A;  4HN7 A;  1MBY A;  3PUV A;  4O1N A;  5EJW A;  1VQP A;  4C56 C;  4GN5 A;  3F2U A;  4F87 A;  2N55 A;  4LF7 Q;  1HNZ L;  4QGU A;  1S5D D;  1E2Z A;  4KKT A;  3I73 A;  1QOH A;  2RVL A;  3ERQ A;  2WAQ B;  4ZKC B;  1TS4 A;  3VA7 A;  2RDH A;  1HZA A;  4AYB B;  5M3F H;  2EZV A;  1YNN C;  1K83 H;  1EY5 A;  3I3C A;  4JI5 L;  5FK9 C;  1BKB A;  3HG9 A;  3S15 H;  1STE A;  2K4K A;  3S2D H;  3G48 A;  1T9H A;  4JI6 L;  1EWI A;  1GUS A;  1JCK B;  1AZP A;  1DJR D;  1U0L A;  1DM0 B;  3K6O A;  4BY1 B;  2R3Z A;  5BN5 A;  3K5N A;  2F0O A;  3U50 C;  3JAM L;  1PTO F;  4F88 A;  1C48 A;  4A3D B;  2FMC A;  2EYM A;  1BUV T;  1FJG Q;  3BS1 A;  2MNA A;  5M5Y H;  5IYB G;  1TWC B;  3M4P A;  1B9N A;  4A3G G;  1IKM A;  1EIY B;  2OEO A;  2UUA L;  3F2B A;  4LF9 L;  1K8O A;  1GJX A;  3TME A;  4JI4 L;  2KVM A;  4DR6 Q;  1GUN A;  4UY8 C;  2NZ1 D;  2XIW A;  4R9W A;  1F2L A;  1CKN A;  4DV4 Q;  2ATW A;  2QGQ A;  2VZA A;  4DA2 A;  4IUU A;  1ILQ A;  3FMC A;  3URY A;  3CCU A;  3WOF A;  1RKN A;  4LF4 L;  2HDM A;  1KD1 C;  4B9W A;  3BDL A;  1PZI D;  4KKU A;  4A3F H;  2ZXP A;  3CCE A;  2K05 A;  4CKC A;  2ZT9 C;  1TT2 A;  2R61 A;  5J39 A;  4KN7 C;  5JEA H;  2D0P A;  4HIK A;  2VNU D;  5IGG A;  1XNR Q;  2JA5 G;  1EY6 A;  2K03 A;  1UE7 A;  1AE2 A;  1LT5 D;  2E8G A;  1RDP D;  3K58 A;  1U4L A;  3TP6 A;  2NVT B;  3MFG A;  2F0N A;  2F0V A;  1WCM G;  4AH6 A;  5IYB H;  2HDL A;  2JA6 B;  1RHP A;  2A5H A;  4ZQ3 A;  3HOU B;  5IOD A;  3TBI B;  2I0Q A;  3FPP A;  4DV1 Q;  2X6L A;  1F2M A;  1TWG H;  4ZUI A;  1HTL D;  3MA2 B;  1YBY A;  4L5T A;  1HXY D;  5IP7 H;  3U4V A;  3QG1 A;  1BF4 A;  3TRE A;  1E22 A;  1Q86 C;  1D8L A;  1VMC A;  1PA6 A;  4DR4 L;  3TP5 A;  1G29 1;  4QF4 A;  5FJ8 G;  1TQO A;  2VQE Q;  1IZ6 A;  4K0K Q;  2PZU A;  5KEE A;  1EUJ A;  3QJY A;  1FR3 A;  2ZM6 L;  2K7V A;  1GXD C;  3EQL C;  5KGU A;  1P8L A;  1GUT A;  3E0J A;  4WJ4 A;  1XNQ L;  3GTG B;  1WTW A;  1QZH A;  3JAM i;  1TWH H;  1XYI A;  3W2D A;  1KRT A;  2GA4 B;  1JOQ A;  2NZH A;  4A3I G;  1H9R A;  4CGY B;  1J8I A;  2DY7 A;  4GLX A;  4XYQ A;  4EQO A;  5CBE E;  2AUJ D;  3DUZ A;  1WTH A;  3S16 H;  2C35 B;  4OEM B;  1LV9 A;  1NBW A;  3CQZ H;  1O7Y A;  5IT9 c;  5IWA Q;  2O5I C;  1SJE D;  4K14 A;  1K73 C;  1KAW A;  3R93 A;  4RGN A;  3PO3 G;  2Y0S G;  1HZ9 A;  4JV5 L;  1UE1 A;  3S1M H;  2HCI A;  3ULJ A;  3UDI A;  1N33 Q;  4NKL A;  1FGU A;  1STN A;  3MXP A;  3TZU A;  4ID6 A;  4EGV A;  3K59 A;  3KBG A;  2KBN A;  3GTM B;  3Q0A A;  2RBM A;  3TS0 A;  1YIT A;  1Q46 A;  3PIP 3;  1SDF A;  3KJO A;  3OIQ A;  1AW7 A;  4X66 Q;  1X3Q A;  2WII B;  4FXD A;  3H3V I;  4CBV A;  1NTG A;  1BBX C;  1QNK A;  2JA8 G;  3L2P A;  2EJF C;  3M9B A;  4FVM A;  1NAP A;  3A55 A;  2JQO A;  3BDC A;  4LW1 A;  4WJ3 M;  2Y0S E;  4L6T B;  5FLX E;  3OHX C;  3RLO A;  4K8J A;  1V1P B;  2M2L A;  1Y1V B;  2WIN B;  5EGT A;  1MI2 A;  1IBK Q;  1TKW B;  2IHE A;  1SLJ A;  3QOJ A;  4DXF A;  1TII D;  3CME A;  3VR6 A;  3EBE A;  5FO8 B;  5IIF A;  4M1U B;  3CCM A;  2HD3 A;  5C4J H;  1IW7 C;  2R93 B;  2JA9 A;  3T53 B;  2VUM B;  3KOJ A;  1MSG A;  4A3M G;  1HNW L;  2JEA I;  1PYB A;  1X6O A;  1AEX A;  1VDZ A;  1RF2 D;  5C3E B;  1B53 A;  5GQO A;  2MO1 A;  4DV6 L;  4DR3 Q;  5K36 G;  1YHA A;  3CCS A;  3FVQ A;  4A93 B;  1YVC A;  1LTB D;  1I3Q B;  1LO5 D;  5AFW A;  1UEA B;  2BE5 D;  3OMG A;  2YV5 A;  2EYP A;  4DV5 Q;  5E3F A;  4C3I G;  5IGB A;  4JI1 L;  1STG A;  3ERS X;  4TSS A;  4UP9 A;  3U58 A;  2PNH A;  2WB1 G;  2K6A A;  1XJV A;  1XPU A;  1HFN A;  4OHJ A;  2ICE C;  1QE6 A;  1XMO Q;  1LT6 D;  3RN5 A;  2K33 A;  2EVB A;  4RWS C;  3P20 A;  2NTS A;  5M5X B;  4OIJ A;  1C7Y A;  5BR8 L;  4IUQ A;  1EQV A;  4JI0 Q;  2PQA A;  1SYG A;  1QWY A;  1Q1E A;  2ID0 A;  3SVM A;  1M1K C;  4HCS A;  1BDO A;  1TWA B;  5C0X J;  3CCJ A;  4YCV A;  2UUC Q;  3J81 L;  4DK3 C;  4NXM Q;  5K36 H;  1LTS D;  2F0W A;  4DUZ Q;  3M3Y H;  2L15 A;  4EQN A;  4BXX G;  1CSP A;  4DUY Q;  3STB C;  3K5L A;  3J7A V;  4GN3 B;  1LAB A;  1UAP A;  4FF3 A;  3H3V C;  2Z6B A;  4C3I H;  4WRD A;  3ONA B;  2ZJR A;  3TRZ A;  2KEC A;  1Q82 C;  3I91 A;  1HHV A;  4PMC A;  5GAE C;  1V1O A;  3GDE A;  1F9R A;  1F77 A;  1EFW A;  1HR0 Q;  4KHP Q;  4KLK A;  1N32 Q;  3PGZ A;  2VL6 A;  2HIX A;  3M7G A;  2CWA A;  3RZO H;  2WKD A;  2EIF A;  4XT1 B;  4B3S L;  4O2D A;  4A3L G;  3H91 A;  1FL0 A;  4BY7 G;  3S1N B;  4RG1 A;  1ZYR D;  3MXN A;  4DXG A;  1ICW A;  1K8G A;  3BYY B;  2B2T C;  2N3S A;  3KLS A;  3GTO H;  3U9S A;  2B63 H;  4ZLT F;  5FLX c;  3HOW G;  1SE4 A;  4P71 A;  3N52 A;  4LF7 L;  4BBS B;  4G4K A;  1K8A C;  1K28 A;  2DNE A;  4KKS A;  4BXX H;  2E5L L;  4K5X A;  1SXT A;  1QJO A;  4CDC C;  2F0E A;  5I6Y A;  2A6E D;  2KUM A;  4IUP A;  5I2X A;  4B3R L;  2K50 A;  4DR1 L;  1E7Z A;  2LXK A;  1ILP A;  1ZEQ X;  1SRO A;  1H9M A;  1XTD A;  3RZD B;  2Q2I A;  5ELE A;  2CCZ A;  1JWS D;  1UNS A;  2N88 A;  3I4N H;  1PH8 A;  4DV2 Q;  4FXG C;  3K7U C;  1U9R A;  2E2I B;  4X6A H;  1LTG D;  2HQE A;  2WAQ G;  4XYO A;  1MJE A;  2OQK A;  3AB9 A;  1C9O A;  2QKI C;  1B4O A;  3MWY W;  4ALP A;  5KNB A;  5A2Q L;  4JBK A;  4BY7 H;  4ODG A;  2B2Y A;  5NUC A;  3S1Q B;  1I6H B;  3MEF A;  2UUB Q;  5LMU L;  3J81 i;  2RSN A;  2FFK B;  3EN2 A;  1IBL L;  3CC4 A;  2OWO A;  2NVQ B;  3MFY A;  4KJO A;  2AKW B;  1SYC A;  4A3B H;  4O0A A;  5CV4 A;  5JPN C;  4HJA A;  2MGS A;  1DXM A;  3HOV B;  4DR7 Q;  4F7X A;  3K5M A;  4A3D G;  2EPB A;  4N9P A;  1SE2 A;  4BBR B;  4DV4 L;  3NUC A;  4ME5 A;  4OWX B;  4GKJ Q;  1I4Q A;  5ISR A;  5KYI A;  5C5M A;  1XWE A;  4HMJ A;  4AYB E;  2BOS A;  4DV7 L;  3J80 E;  3GTL B;  3I4M B;  5C4J B;  3VDY A;  2E2H H;  3H94 A;  3PCO B;  3TEH B;  2RA4 A;  2DJF C;  3PUY A;  2KA7 A;  1BCP D;  2I5H A;  2IT1 A;  3S14 H;  1R9T H;  1ML0 D;  2JK8 A;  2KEN A;  1CQF A;  1B2T A;  2PNR C;  5C44 H;  1KL9 A;  3PUZ A;  1VQC A;  3CKI B;  2NBF A;  4UP8 A;  1ONL A;  2NVY B;  2B8F A;  3JC6 6;  2E2J B;  1AFP A;  1E2W A;  3FKI B;  4JYA L;  5DAU A;  3VR4 A;  2DJG C;  3GTJ B;  2LSS A;  4CJ1 B;  2F0M A;  5C4X B;  5CR3 A;  1DYQ A;  1JWM D;  4CHT B;  2XRQ D;  5EKK A;  2IHF A;  2QA4 A;  4RA8 A;  3CF5 A;  3WDN A;  2F0I A;  1GD7 A;  1PTO H;  3Q8D A;  4G57 A;  3C1F A;  4QQB X;  2NN6 G;  3J7A 5;  4JC0 A;  2VQE L;  3QIA A;  4K2L A;  2JA6 G;  4DAY A;  4YY3 L;  4QIW E;  4AQY Q;  4A3J H;  1Y8N B;  4EVO A;  4POF A;  3BZD B;  1Y14 B;  3F1Z A;  3J81 j;  3RLF A;  1LT4 D;  3GTQ B;  2RHQ B;  3NTK A;  2ALY B;  4O42 A;  4GOP C;  1QZG A;  4K2K A;  4OL7 A;  4A3K B;  1LTR D;  1Y1W H;  5IY0 A;  1N36 L;  1EYC A;  1HUN A;  1D1I A;  3S17 H;  2IX0 A;  1JE5 A;  1D7Q A;  1A0I A;  3DWA A;  1EQR A;  1HR0 W;  4IFD G;  1WD0 A;  1JR0 D;  1XMQ L;  1I5F A;  5I9P A;  4LUV A;  2CQO A;  1V1Q A;  5JVH 3;  2F3I A;  2RDF A;  2R7Z H;  3H6M A;  4DR5 L;  2F0J A;  2EYO A;  4GOP B;  1NCV A;  4KN4 C;  3A5U A;  3T13 A;  2NN6 H;  5F2D A;  5IP9 G;  2MUY A;  4DKA C;  1I4G A;  3PO2 G;  4YHH Q;  2HQL A;  2QDB A;  3PIP A;  1O7L A;  1KLG D;  2BA0 A;  1N8R C;  2BH8 A;  1PRT D;  1KQS A;  4QUF A;  3J7Z C;  2KCM A;  3D6W A;  4YWK A;  1B44 D;  4JI2 Q;  2ZTC A;  4MTK A;  1ENF A;  2MJ8 A;  3K7A H;  1PH2 A;  1DCZ A;  2WV6 D;  4LF6 Q;  3NPP A;  1JJ2 A;  2WAC A;  4X62 L;  4HJ8 A;  4JI7 Q;  2Z1C A;  4C3H H;  3GTP H;  3GTK H;  3OMC A;  3WWV A;  2PW7 A;  4GNX C;  2L9H A;  1PFS A;  4C3J H;  2X69 A;  4X64 Q;  4LFC Q;  2SOB A;  4OIK A;  3J81 c;  4GKK L;  3FPU B;  1CUK A;  2KJX A;  5IYC G;  4NXN Q;  4B9X A;  1K3B C;  3BVZ A;  1Y1V G;  1Q12 A;  3BJU A;  3CC7 A;  3KDF B;  1L0W A;  4R4O A;  2K5D A;  4DR3 L;  1CZG A;  4R4I A;  2EYJ A;  1BBW A;  4PZ6 A;  2FXQ A;  2R93 G;  4XTC S;  4GNX B;  3OTO L;  2VUM G;  2F3W A;  3IL8 A;  3PUW A;  2SNS A;  2UXD L;  1FD7 D;  1VQ7 A;  1X3F A;  1L1O C;  1IL8 A;  3E0E A;  3DWP A;  1OXX K;  2DN8 A;  3OWE B;  5JEA J;  1J9O A;  1VQ8 A;  5IT9 E; 
#chains in the Genus database with same CATH homology
 1SND A;  3QB3 A;  5M3M B;  4X3K A;  1I4H A;  4NW2 A;  1EZ8 A;  2VB3 X;  4KV6 A;  3J7A F;  1RTO A;  2B2W C;  2XWB B;  5D3I B;  5JJZ A;  2NYZ D;  3T4A C;  3V96 A;  1ET9 A;  1PZJ D;  4HMI A;  1FYC A;  5EBC A;  5DEH A;  4OO1 H;  1JOO A;  3NSW A;  2VB2 X;  1WTO A;  1SFO B;  1FNW A;  5LL6 X;  1D5M C;  4XIG S;  2MP1 A;  4KY6 A;  3N6R A;  3QO2 A;  1II3 A;  2A74 C;  2C9O A;  2EJM A;  1T5E A;  3KLR A;  3VR2 A;  1SEB D;  5G3L D;  3PMF A;  3SK4 A;  3HKZ B;  4K5W A;  1JC7 A;  2CW0 D;  4KJN A;  5C4H A;  4X3S A;  2AQ2 B;  4H44 C;  3OOC A;  3MEH A;  1I50 B;  2QIL A;  3BG3 A;  4A3E B;  4DU9 A;  2F0U A;  4L63 B;  4QIW B;  2B2U C;  3NWT A;  3HOY B;  3D4W A;  4DNT B;  4OO1 I;  4H7B A;  3J7Y W;  3R2I A;  1RJT A;  5DM6 3;  1ZYR C;  4DFA A;  1G8Z D;  2YU9 B;  1SNO A;  3H0G B;  4X3U A;  4J6H A;  4PV1 C;  3NWS A;  2EOT A;  3TDQ A;  1W6K A;  2EJG C;  1Y69 U;  2Z8L A;  1KDC A;  5CMD A;  1TS5 A;  3HOZ B;  1PZK D;  1D6E C;  5ELB A;  4LJZ C;  2K32 A;  3A56 A;  3I90 A;  1GUW A;  1L0Y B;  2A6E C;  4C2M B;  3GQB A;  1I4P A;  3LWE A;  1O80 A;  1SMY D;  4RKB A;  1H9S B;  1L0X B;  2JA7 B;  1F9P A;  1CI3 M;  1JB3 A;  1V8Q A;  3R2T A;  1ZKO A;  2KQ3 A;  3JAM E;  4E6I A;  1Y8O B;  4XXE A;  2B8G A;  4RCN A;  1QB5 D;  2KEE A;  1WTR A;  2KED A;  3S9W A;  1TY0 A;  2F0G A;  3HOX B;  3KBX A;  5CC4 A;  2B2U A;  1HA5 A;  4DK0 A;  4KY7 A;  1BCP C;  1A2U A;  2L1B A;  5TSS A;  4KD4 A;  3SK8 A;  4RKL A;  1ET6 A;  2MPM A;  4NMZ A;  1A2T A;  1CHQ D;  3GV6 A;  1I4R A;  2LS0 1;  4FO2 A;  5KRU A;  3RMH A;  3HZX A;  1RD9 D;  5M3F B;  1BCP F;  5I4D A;  1K83 B;  3ND9 A;  2IW3 A;  4PMB A;  3S15 B;  1BCP B;  3S2D B;  1V43 A;  2PCF B;  2A73 B;  3I8Z A;  3A54 A;  1PXU A;  2FMM A;  1PMR A;  3BYT B;  3I70 A;  3TP8 A;  1SNQ A;  5EBD A;  3NQT A;  4ILW A;  1A15 A;  1BOS A;  3BVG A;  4K6L A;  5M5Y B;  1A6X A;  5DM7 3;  3TN2 A;  1GUG A;  1KNA A;  4PQX A;  3X3N A;  1HA6 A;  1OXS C;  4RAU C;  2AQ1 B;  1KAB A;  3MVV A;  3HGB A;  3EA6 A;  1LLR D;  2JEB I;  5CBA E;  3P1H A;  4U67 3;  2F4I A;  4IN3 A;  3KLS X;  3C1E A;  4N9T A;  4HAE A;  1PTO D;  2K5W A;  4A3F B;  1F9S A;  1TU2 B;  1V1P A;  2EE1 A;  3DXJ C;  4FF4 A;  5EKI A;  5CYU A;  3AU7 A;  5D3D A;  1E2V A;  1QG7 A;  3V05 A;  2D9U A;  1G6Z A;  4DF7 A;  4TRD A;  4BS9 A;  3IFT A;  4FF1 A;  3I72 A;  2EXZ A;  4OGQ C;  4XQQ A;  1ESF A;  1PRT C;  1KAA A;  2XSC A;  1EYA A;  3X3M A;  1TWG B;  1LAC A;  3DHQ A;  3WOE A;  4Q5V A;  5CV6 A;  5EPL A;  4PMW A;  1SE3 A;  2B2V C;  1TR5 A;  3R3O A;  1PRT F;  3L9A X;  5C0X G;  1JE4 A;  1PRT B;  1WTX A;  4FYD A;  1TWH B;  5E4X A;  5EPK A;  1HQR D;  3DEP A;  4KY5 A;  4G7O C;  1UUP A;  2H4O A;  3S16 B;  2EY5 A;  5HUR A;  3GO5 A;  3CQZ B;  4TQU S;  3NBI A;  1EL0 A;  4HSV A;  3Q24 A;  1HPC A;  1GUO A;  1YNJ D;  3NP8 A;  3S1M B;  4NP5 A;  4R8N A;  3R8B A;  3CRL C;  1Q1B A;  4V19 0;  5C0X H;  2J7Z A;  1U4R A;  1CT1 D;  2QEJ C;  3C46 A;  2OXP A;  2O2L D;  4C1N K;  3D4R A;  5CV8 A;  4G7H C;  4MHE A;  2RQX A;  4GZY C;  4HTH A;  3CHB D;  3ND8 A;  2L4N A;  3OSO A;  3J81 E;  2F0L A;  1GHJ A;  3VYS A;  4QMG A;  5T1G A;  2B39 A;  5FO9 B;  4HR7 B;  2OF1 A;  4MN3 A;  2D5D A;  4K8I A;  1D2B A;  3HP3 A;  2AWN A;  5BN3 A;  4FF2 A;  1EWC A;  4UAI A;  5G3L F;  5ELF A;  3O13 A;  2AQ3 B;  2B2T A;  2AWO A;  4RH6 A;  3HEJ A;  1Z6H A;  4DGZ A;  5FKA C;  3I4L A;  3MXG A;  2G9D A;  2F0P A;  3SK5 A;  1TVX A;  2JYO A;  2YYZ A;  4RHS A;  4KI0 A;  5KYL A;  1NUC A;  3IKJ A;  2F1M A;  2L55 A;  3G6J B;  5FOB B;  1KNE A;  5E1F A;  4KK7 A;  3M85 A;  4QB4 A;  3SHL A;  5KIX A;  2BCO A;  4YIJ A;  1EZ6 A;  3C2P A;  2I46 A;  1OO9 B;  3NXW A;  2IX3 A;  4RGM A;  2F0T A;  4KTA A;  4XT3 B;  3A7A B;  2HUG A;  3VA5 A;  1ROD A;  3D4D A;  1E0B A;  2QCP X;  3M3Y B;  1LTT D;  1SMY C;  3OIP A;  2PZT A;  2IPK D;  4C3I B;  2WB1 B;  2LMC B;  2O5J C;  2Z4H A;  5A2Q E;  4JBW A;  3RZO B;  3PIO 3;  3IAY A;  1O7Z A;  5A35 A;  2K28 A;  5KND A;  1BNZ A;  1NSN S;  3L3O C;  2K04 A;  3OWF A;  1JOK A;  3GTO B;  2B63 B;  1HQM C;  1SJH D;  5T1I A;  2JP1 A;  1WD1 A;  2D2C C;  2TSS A;  3DMU A;  5K5P A;  1SYE A;  1PYW D;  2Z4I A;  3FEW X;  1G2S A;  5D14 A;  1B50 A;  2KHS A;  4IFD H;  4RGT A;  2DNC A;  1C8C A;  2FJ2 A;  3NK9 A;  1FNU A;  3IFD A;  2C5C A;  2L12 A;  5I6W A;  3M4Y A;  4KHV A;  5LL6 S;  2WKC A;  3I4N B;  2PMZ B;  5KNC A;  2NN6 I;  4ZRZ A;  3TZD A;  1CHP D;  2HCC A;  2K1B A;  1EY8 A;  1X32 A;  4C1N I;  4BY7 B;  2I07 B;  2NTT A;  2XWJ B;  1PDQ A;  3D6C A;  2NB0 A;  2RKS A;  3DWQ A;  3ZYY X;  1H9J A;  1CFM A;  4A3B B;  2M00 A;  2ICI A;  1STY A;  2L0C A;  2SNM A;  2BE5 C;  3FRP B;  1SYF A;  2E2H B;  4DN4 M;  1CZW A;  3S14 B;  1R9T B;  1S5F D;  5I2Y A;  5C44 B;  3BDO A;  1PTO C;  4G7Z C;  4RFB A;  3VYU A;  1ENC A;  2PZW A;  1BR9 A;  1Q8I A;  2EYF A;  1X3P A;  1NR2 A;  1MSH A;  5JEA G;  1TS2 A;  5I9O A;  2G9H D;  5CV9 A;  2A68 D;  5ELC A;  4CJ0 B;  1HUM A;  1SNC A;  1Z7T A;  3SE0 A;  1PTO B;  3CRK C;  1JQY D;  3GD7 A;  3SR1 A;  3ITP A;  1QCB D;  2LFN A;  5EPJ A;  1A3V A;  1AP0 A;  1NR4 A;  2XNA C;  5E4W C;  1WVL A;  4A3J B;  4KHZ A;  2IJ0 A;  1EYD A;  1S5E D;  4HED A;  1LTI D;  1CM9 A;  1AZQ A;  5FO7 B;  1STH A;  5FLX L;  3GP7 A;  1Y1W B;  1FGB D;  1SNP A;  1M4V A;  3A8J E;  2L11 A;  3S17 B;  1PFB A;  2K01 A;  1BQQ T;  1VCI A;  3V2T A;  1H9K A;  1EWH A;  3MHB A;  1SAP A;  3SDZ A;  2EDG A;  2R7Z B;  4IAL A;  1B9M A;  2PW5 A;  3LWU A;  2B2W A;  4X3T A;  1EIH A;  2F0F A;  2A69 D;  1YNJ C;  4H0L C;  1Z47 A;  2TMP A;  2A6H D;  4XDX A;  1IHZ A;  1RCV D;  1W6J A;  4J1M A;  3RD4 A;  3K7A B;  4XQJ A;  1S4Z A;  1B3A A;  1DON A;  3Q23 A;  2PO4 A;  4KD3 A;  1EEF D;  3RUZ A;  5BN4 A;  3OPO A;  4C3H B;  1DOK A;  2ZXR A;  1XXG A;  3GTP B;  3GTK B;  1EY0 A;  3EVQ A;  4LK1 C;  3T56 B;  4C3J B;  2FIN B;  3A7L A;  4K5V A;  4F8M A;  1F2Z A;  3T51 B;  4RCO A;  5IGF A;  1DOL A;  2NUC A;  2EY6 A;  2WP8 J;  4MIU A;  1SNM A;  1EFI D;  2JE6 I;  1EY4 A;  4K6D A;  1KLU D;  1SYB A;  3D8G A;  5C3X A;  2D62 A;  3PO2 B;  2KCC A;  3QOL A;  2LKV A;  4BWG B;  2F0H A;  4XQN A;  1K8M A;  1EQT A;  2NWG A;  2IWH A;  1IYU A;  4FNF A;  4TKO B;  4CKE A;  2Q8I B;  1Q3L A;  2F0D A;  2DY8 A;  5M9O A;  3H09 A;  3KK7 A;  4ULL A;  3G7L A;  1H9S A;  1HFG A;  3HRZ C;  1LTA D;  5IGE A;  1QNU A;  1DD2 A;  1MD2 D;  2E76 C;  1STA A;  1R4Q B;  1TY2 A;  2QF7 A;  4I65 A;  4V0B A;  3MZ5 A;  3NTH A;  5J1Z A;  4IUT A;  5EKL A;  4P2C B;  1U4M A;  3P75 A;  4ZUJ A;  1Q90 A;  4IUV A;  4CKB A;  2VXW A;  2H1E A;  4EQP A;  1OXV A;  1SSO A;  1KDB A;  3LX0 A;  1WTV A;  1KTK A;  1HRJ A;  1JWU D;  1A3T A;  1YNN D;  1FNV A;  1DOM A;  1GOZ A;  2EY1 A;  4DK1 A;  5C4Z A;  1KDA A;  4FXK C;  4CJ2 C;  1IYV A;  3E5S A;  4DAV A;  4ZK9 B;  4IZ8 A;  4WOR A;  1EEI D;  4I7Z C;  2CVR A;  1VF7 A;  3ERO A;  1WTQ A;  1D5Z C;  3MXU A;  5IOC A;  4QCL A;  1R4P B;  2MHV A;  5C5L A;  2FHT A;  1D5X C;  1U4P A;  4A3G B;  3S1R B;  1ESR A;  4HCE A;  3P7J A;  4BA2 I;  3NBH A;  2B2Y C;  4ZYS A;  1S5C D;  2EY2 A;  3J80 L;  1PFM A;  3VR3 A;  1TWF B;  1B1Z A;  1A3U A;  3EFX D;  1C4Q A;  1ENA A;  2JSO A;  2XN9 C;  3EJI A;  2SEB D;  1STB A;  2ZXO A;  2NVX B;  5M5W B;  5DNF A;  4Q0F A;  1CK1 A;  2JA5 B;  3DM1 A;  3AMU A;  1I4X A;  3OW7 A;  1O78 A;  4LAA A;  1EY9 A;  1LT3 D;  1WCM B;  3SXH A;  3VYT A;  2F3V A;  2F0K A;  4RHR A;  4KMU C;  2E2D C;  3PV0 A;  3NE5 B;  2O4X A;  5CV7 A;  5COR A;  2ENB A;  3K57 A;  4S3S A;  2BDO A;  1EU4 A;  2SDF A;  4FP5 D;  1EIG A;  1OXU A;  1PLF A;  2E74 C;  2PQE A;  3Q22 A;  3PUX A;  3M7N A;  3QWN A;  5C3W A;  1OXT A;  3FDT A;  2X6G A;  5CGK A;  4Z9C B;  4A3I B;  4J8Q A;  3T16 A;  4M8A A;  4UDU C;  2F03 A;  3S2H B;  1WTP A;  3SEB A;  2JXM B;  3Q6S A;  3K5O A;  2AUK A;  2K5Q A;  3HS0 C;  3L7Z C;  1ZXT A;  3PO3 B;  2Y0S B;  3BVM A;  2A68 C;  1F9Q A;  4LMQ D;  5HGT A;  2CW0 C;  4DAP A;  3D31 A;  2B2V A;  1F2Y A;  4BA1 I;  5JPM C;  1AN8 A;  4PNY A;  4IUR A;  2RSO A;  5C0X I;  1CA6 A;  3VYR A;  3GV3 A;  1CQV A;  4NDX A;  2OT2 A;  2JA8 B;  5LHY 1;  1QIL A;  3E6Z X;  3A8I E;  1HTP A;  1VMP A;  1SBB B;  1PFN A;  1JOR A;  1HCZ A;  5C6A A;  4ZKB B;  1D1K A;  2IL8 A;  3KF8 A;  4Y7N B;  5JVG 3;  2KCN A;  2XVS A;  1CA5 A;  4WFN 3;  2Q8R E;  1BO0 A;  3LNN A;  4U68 A;  1S5B D;  4L8J A;  4A3M B;  1XX8 A;  3KUP A;  1IW7 D;  4IFD J;  2J0T D;  4R8I A;  1CTM A;  2PYK A;  1G2T A;  3DEO A;  2A69 C;  1EU3 A;  1EY7 A;  4RGO S;  1XTC D;  5JAV A;  3NTI A;  2A6H C;  3A8K E;  1M8A A;  2LY7 A;  5IT9 L;  3M4O B;  3SK6 A;  2XRS D;  4H13 C;  5ELD A;  4IUN A;  3TSS A;  2CQA A;  2M9V A;  3VR5 A;  2PPB C;  1G91 A;  4JK1 C;  1RTN A;  1I6V C;  4ZAI A;  1BXT A;  3U9O A;  2KOL A;  3NQI A;  2V4D A;  3D3R A;  4C3H G;  1JIC A;  4QUC A;  3NHH A;  5IGD A;  3MC0 B;  4C3J G;  1TS3 A;  2F0Q A;  5CV5 A;  4WJW A;  2R92 B;  5J22 A;  1Y8P B;  1GHK A;  4IQZ A;  4B08 A;  5COY A;  5D65 A;  2RDG A;  5JOB A;  1T5X D;  3K0Y A;  4ABN A;  2J4X A;  2EYL A;  2BA1 A;  3UI2 A;  2F0S A;  2Q8T A;  2R6G A;  2L5T A;  1MGS A;  3TP7 A;  2IX1 A;  2EYH A;  4HSP A;  3C3L A;  1EOT A;  3MAQ A;  3MTS A;  2CHB D;  5IGC A;  1VF5 C;  1DZ1 A;  1SYD A;  3W3A A;  4DNR B;  3HOW B;  2BDN A;  2E75 C;  4OO1 G;  5EQ0 A;  3CU7 A;  4IFD I;  1IKL A;  4HN7 A;  1MBY A;  3PUV A;  4O1N A;  5EJW A;  4C56 C;  3F2U A;  4F87 A;  2N55 A;  1S5D D;  1E2Z A;  4KKT A;  3I73 A;  1QOH A;  2RVL A;  3ERQ A;  2WAQ B;  4ZKC B;  1TS4 A;  3VA7 A;  2RDH A;  2EZV A;  4AYB B;  1YNN C;  3I3C A;  1EY5 A;  5FK9 C;  3HG9 A;  1STE A;  1GUS A;  1JCK B;  1AZP A;  1DJR D;  1DM0 B;  3K6O A;  4BY1 B;  2R3Z A;  5BN5 A;  3K5N A;  2F0O A;  3JAM L;  1PTO F;  4F88 A;  1C48 A;  4A3D B;  2FMC A;  2EYM A;  1BUV T;  3BS1 A;  1TWC B;  1B9N A;  1IKM A;  2OEO A;  1K8O A;  1GJX A;  3TME A;  2KVM A;  1GUN A;  2NZ1 D;  2XIW A;  4R9W A;  1F2L A;  4DA2 A;  4IUU A;  1ILQ A;  3FMC A;  3URY A;  3WOF A;  1RKN A;  2HDM A;  4B9W A;  3BDL A;  1PZI D;  4KKU A;  2ZXP A;  2K05 A;  4CKC A;  2ZT9 C;  1TT2 A;  2R61 A;  5J39 A;  4KN7 C;  5JEA H;  2VNU D;  5IGG A;  1EY6 A;  2K03 A;  1LT5 D;  1RDP D;  3K58 A;  1U4L A;  3TP6 A;  2NVT B;  3MFG A;  2F0N A;  2F0V A;  2HDL A;  2JA6 B;  1RHP A;  2A5H A;  4ZQ3 A;  3HOU B;  5IOD A;  3TBI B;  3FPP A;  2X6L A;  1F2M A;  4ZUI A;  1HTL D;  3MA2 B;  1HXY D;  3QG1 A;  1BF4 A;  1VMC A;  3TP5 A;  1G29 1;  4QF4 A;  1TQO A;  2PZU A;  5KEE A;  3QJY A;  1FR3 A;  2K7V A;  1GXD C;  3EQL C;  5KGU A;  3E0J A;  1GUT A;  3GTG B;  1WTW A;  1XYI A;  3W2D A;  2GA4 B;  1JOQ A;  1H9R A;  4CGY B;  1J8I A;  2DY7 A;  4XYQ A;  4EQO A;  5CBE E;  2AUJ D;  3DUZ A;  1LV9 A;  1O7Y A;  2O5I C;  1SJE D;  4K14 A;  3R93 A;  4RGN A;  2HCI A;  4NKL A;  1STN A;  3MXP A;  3TZU A;  4ID6 A;  4EGV A;  3K59 A;  3KBG A;  3GTM B;  3Q0A A;  2RBM A;  3PIP 3;  1SDF A;  3OIQ A;  1AW7 A;  1X3Q A;  2WII B;  4FXD A;  4CBV A;  1BBX C;  1QNK A;  2EJF C;  4FVM A;  1NAP A;  3A55 A;  3BDC A;  5FLX E;  4L6T B;  3OHX C;  4K8J A;  1V1P B;  2M2L A;  1Y1V B;  2WIN B;  5EGT A;  1MI2 A;  1TKW B;  3QOJ A;  4DXF A;  1TII D;  3VR6 A;  5FO8 B;  5IIF A;  4M1U B;  1IW7 C;  2R93 B;  3T53 B;  2VUM B;  1MSG A;  2JEA I;  1AEX A;  1VDZ A;  1RF2 D;  5C3E B;  1B53 A;  5K36 G;  3FVQ A;  4A93 B;  1LTB D;  1I3Q B;  1LO5 D;  5AFW A;  1UEA B;  2BE5 D;  3OMG A;  2EYP A;  5E3F A;  4C3I G;  5IGB A;  1STG A;  4TSS A;  2K6A A;  1HFN A;  4OHJ A;  2ICE C;  1QE6 A;  1LT6 D;  2K33 A;  2EVB A;  4RWS C;  3P20 A;  2NTS A;  5M5X B;  4OIJ A;  4IUQ A;  1EQV A;  1SYG A;  1QWY A;  1Q1E A;  2ID0 A;  3SVM A;  4HCS A;  1BDO A;  1TWA B;  5C0X J;  3J81 L;  5K36 H;  1LTS D;  2F0W A;  4EQN A;  3K5L A;  3J7A V;  1LAB A;  1UAP A;  4FF3 A;  3H3V C;  4WRD A;  3ONA B;  2KEC A;  3I91 A;  1HHV A;  4PMC A;  1V1O A;  1F9R A;  1F77 A;  3M7G A;  2WKD A;  4XT1 B;  3H91 A;  3S1N B;  1ZYR D;  3MXN A;  4DXG A;  1ICW A;  3BYY B;  2B2T C;  3KLS A;  3U9S A;  4ZLT F;  1SE4 A;  3N52 A;  4BBS B;  4G4K A;  2DNE A;  4KKS A;  4K5X A;  1SXT A;  1QJO A;  2F0E A;  5I6Y A;  2A6E D;  2KUM A;  4IUP A;  5I2X A;  1ILP A;  1ZEQ X;  1H9M A;  3RZD B;  5ELE A;  1JWS D;  1UNS A;  2N88 A;  4FXG C;  1U9R A;  2E2I B;  1LTG D;  2HQE A;  4XYO A;  3AB9 A;  2QKI C;  1B4O A;  3MWY W;  5KNB A;  5A2Q L;  4ODG A;  2B2Y A;  5NUC A;  3S1Q B;  1I6H B;  2RSN A;  2FFK B;  2NVQ B;  3MFY A;  4KJO A;  1SYC A;  5CV4 A;  5JPN C;  2MGS A;  1DXM A;  3HOV B;  4F7X A;  3K5M A;  2EPB A;  4N9P A;  1SE2 A;  4BBR B;  3NUC A;  4ME5 A;  1I4Q A;  5ISR A;  5KYI A;  5C5M A;  1XWE A;  4HMJ A;  2BOS A;  3GTL B;  3J80 E;  3I4M B;  5C4J B;  3H94 A;  2RA4 A;  3PUY A;  2KA7 A;  1BCP D;  2IT1 A;  1ML0 D;  1CQF A;  1B2T A;  2PNR C;  3PUZ A;  3CKI B;  2NBF A;  1ONL A;  2NVY B;  2B8F A;  2E2J B;  1AFP A;  1E2W A;  3FKI B;  5DAU A;  3VR4 A;  3GTJ B;  4CJ1 B;  2F0M A;  5C4X B;  5CR3 A;  1DYQ A;  1JWM D;  4CHT B;  2XRQ D;  5EKK A;  4RA8 A;  3WDN A;  2F0I A;  1PTO H;  4G57 A;  3C1F A;  2NN6 G;  3QIA A;  4K2L A;  4DAY A;  1Y8N B;  4EVO A;  3BZD B;  3RLF A;  1LT4 D;  3GTQ B;  3NTK A;  4O42 A;  4K2K A;  4OL7 A;  4A3K B;  1LTR D;  1EYC A;  1HUN A;  1D1I A;  2IX0 A;  3DWA A;  4IFD G;  1WD0 A;  1JR0 D;  5I9P A;  5JVH 3;  2RDF A;  3H6M A;  2F0J A;  2EYO A;  1NCV A;  4KN4 C;  3T13 A;  2NN6 H;  5F2D A;  2MUY A;  1I4G A;  2QDB A;  1O7L A;  1KLG D;  2BA0 A;  1PRT D;  4QUF A;  3D6W A;  1B44 D;  1ENF A;  2MJ8 A;  1DCZ A;  2WV6 D;  3NPP A;  2WAC A;  2Z1C A;  3OMC A;  2PW7 A;  2L9H A;  2X69 A;  2SOB A;  4OIK A;  3FPU B;  2KJX A;  4B9X A;  3BVZ A;  1Q12 A;  2K5D A;  1CZG A;  2EYJ A;  4XTC S;  2F3W A;  3IL8 A;  3PUW A;  2SNS A;  1FD7 D;  1IL8 A;  3DWP A;  1OXX K;  2DN8 A;  3OWE B;  5JEA J;  1J9O A;  5IT9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...