1ZKOA

Crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
b'HHHHHLKMKKYTKTHEWVSIEDKVATVGITNHAQEQLGDVVYVDLPEVGREVKKGEVVASIESVKAAADVYAPLSGKIVEVNEKLDTEPELINKDPEGEGWLFKMEISDEGELEDLLDEQAYQEFCAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine cleavage system H protein
publication title Crystal structure of Glycine cleavage system H protein (tm0212) from Thermotoga maritima at 1.65 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Glycine cleavage h-protein
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1zkoA00
2NN6H 1DCZA 3BG3A 2CW0C 3MXUA 3DXJC 4G7ZC 4G7HC 2B8GA 1SMYC 5K36H 1OXSC 3CRKC 3N6RA 4LJZC 3PUYA 1Q90A 3WDNA 3M7NA 2O5JC 1YNNC 1TU2B 4KKSA 5C0XH 1T5EA 2NN6I 3PUXA 4KMUC 1GHJA 3KLRA 1VDZA 4XIGS 4JK1C 4LK1C 4RCNA 5BN5A 3GQBA 3QG1A 3SE0A 1H9MA 5KNCA 1TKWB 3A7AB 4KHZA 4DNTB 5BN3A 3HGBA 2A6HD 3VR2A 3PUWA 1Y8NB 1HTPA 1GJXA 4IFDH 4H13C 2DNCA 1Y8OB 2E74C 1IW7D 3W3AA 3IKJA 1EWHA 4BA1I 4OO1G 2A69D 4XTCS 2BA0A 3EQLC 2K7VA 2D2CC 2AUKA 3OPOA 1H9JA 1OXXK 1Z7TA 3QJYA 2QF7A 2LMCB 4I7ZC 4PV1C 3D4RA 1DD2A 1K8OA 2E75C 3VR6A 1DXMA 2A68C 4H44C 4TQUS 2NN6G 2PPBC 1CTMA 2D62A 2V4DA 5K36G 2KA7A 1BDOA 2F1MA 3FPPA 1CI3M 2DNEA 3ND9A 3VR4A 5KNBA 2DN8A 3A7LA 4JBWA 5C0XG 4KN7C 4KN4C 1V43A 1HQMC 2JXMB 2BE5C 3T51B 3A8KE 3TZUA 4GZYC 2A6EC 3I4LA 1ONLA 2YYZA 1GUTA 3LWUA 2JEAI 1Y8PB 3GD7A 3T56B 3AB9A 2D5DA 4IFDG 3P20A 3CRLC 2A6HC 4BA2I 1H9RA 2EDGA 3H94A 1IYVA 3VR3A 1K8MA 2AWOA 1GUNA 1OXVA 5BN4A 3LNNA 2A69C 1Z6HA 2B8FA 4L8JA 3A8IE 1ZKOA 3IFTA 3NE5B 2E76C 3PUVA 3PUZA 1FYCA 4KI0A 2AUJD 3FMCA 4HR7B 2O5IC 1O7LA 4OGQC 5JEAH 1GUOA 3VA7A 3VR5A 1CFMA 1E2VA 1Q1EA 1I6VC 2PCFB 1VF5C 2A68D 1E2WA 2PNRC 5KNDA 1HPCA 1HCZA 1GHKA 2EJGC 4IQZA 1H9SB 4KKUA 3QIAA 1H9KA 1VF7A 4KKTA 1Y69U 1A6XA 1VCIA 1PMRA 1IYUA 3T53B 1E2ZA 2JE6I 2BE5D 1OXTA 2JEBI 1O78A 1OXUA 2A6ED 2K32A 3U9SA 1B9MA 1IW7C 3I72A 1QJOA 1G291 2EJMA 2BA1A 3MFYA 3RLFA 3M85A 2BDOA 2IT1A 1H9SA 5A35A 1Q12A 2K33A 4G7OC 3ND8A 3PV0A 2EVBA 4H0LC 2L5TA 3SDZA 4OO1H 1B9NA 1FR3A 2KCCA 3M4YA 4TKOB 2EJFC 1LABA 3BDOA 3OOCA 3A8JE 2R6GA 1GUGA 1GUSA 2Q8IB 3L7ZC 1YNJC 1ZYRC 4DK1A 1Q1BA 3I73A 4DK0A 1V8QA 4DNRB 3OW7A 1LACA 5JEAG 3D31A 2ZT9C
chains in the Genus database with same CATH superfamily
1XMQQ 4DXGA 3E9IA 3HOWH 3CC4A 1BQQT 3AEVA 2B8GA 4JI0Q 1SYEA 2KEEA 3N6RA 1PA6A 3EJIA 5C3EH 3M4PA 5LMNQ 2EXDA 4M8AA 3PUXA 4IOAA 2KCMA 2MGSA 4CJ0B 2NTSA 4RHRA 1PH4A 4JI8L 3C1FA 1HTPA 1MJEA 5FLXE 4RGTA 4F87A 1CA6A 5FKAC 1IKMA 1JT8A 5JAVA 1CKNB 1L0WA 5IP7H 2EYOA 3K59A 3T1YQ 1W6KA 2VQEQ 3NELA 3OMGA 3I3CA 2XNAC 1WOCA 1I94Q 2PPBC 1RIPA 4IUUA 4OWWB 4BY7G 3RZDB 5I9OA 2VUMG 3P7JA 3VR4A 2JA7H 1SNQA 1WCMB 4HSVA 3MFGA 3BVZA 2KOLA 3KK7A 4LW1A 1KNAA 1HQRD 4IPCA 4I65A 4J6HA 1BCPD 3LWEA 2VW9A 3GTOB 1BR9A 1EZ6A 1Q3LA 1ZXTA 1I50B 3GD7A 4JI2L 2R7ZG 2RDFA 4FXDA 3H94A 4X3KA 3VYTA 1OXVA 3BDLA 2L15A 4B3SL 3NK9A 1EWCA 1ML0D 1GUOA 1ICWA 4C1NK 1D8LA 4LF5Q 4K2LA 4IQZA 1L1OB 3S16B 2Z6KC 4CDDC 2MO0A 2XGTA 1KTKA 1YNXA 3G71A 5KYIA 1SNPA 1V1QA 2EE1A 4FP5D 4A3JH 2L0CA 3CCVA 4R4IA 4LF6Q 5FK9C 4N8FA 2OEOA 1QVCA 5ELEA 3M3YB 1I3QH 1M8AA 2LXKA 3I90A 5CV4A 1O7YA 4DAYA 2RBMA 3PO2B 2SEBD 1X9NA 2IX3A 2F0JA 3J81E 3S14H 4B9XA 2CH4W 3MXNA 5JEAG 3AU7A 3KJOA 4BWGB 1UAPA 1PH1A 3M4OB 1SMYC 4AH6A 4R9WA 4KY5A 2M2LA 1VQ8A 5F2DA 3PF4A 3PSIA 1K3RA 1T5EA 2AWNA 2K5WA 4C2MH 2RHQB 2F3IA 3TBIB 4A75A 2RCFA 2RVLA 4ZQ3A 3VYRA 3DLLA 1XPRA 1XNRL 1NJIC 2RSNA 4CHTB 3HKZE 2A1AA 2C9OA 2PZTA 1NSNS 1WTPA 4JI7L 2RDHA 3GTGH 2XTIA 4ILWA 1I4HA 4A3BG 5DEHA 1G2TA 1ICFB 1W6JA 3Q23A 1EQRA 1KDBA 3S2HB 1F77A 1DXMA 5NUCA 2ASBA 3CP0A 1SJHD 2JYOA 5E7NA 1D1IA 2DNEA 5ELBA 3M9BA 3T4AC 1NY4A 2ID0A 4P71A 1EIFA 3PQIA 4QUFA 5G3LD 1V43A 4H7BA 2JXMB 4A3MH 3K5LA 4KHPL 4IJHA 4TSSA 1J6QA 3ICEA 3LWUA 1TT2A 4DR7L 1VQMA 1SNOA 1B2TA 5JPNC 1AZPA 2I5HA 3L0OA 3K5NA 4DR3Q 5C4XB 2PZUA 1GUNA 2LKVA 5ISRA 1K0SA 1B70B 5C5MA 1TIID 1FGBD 2F0LA 1EIYB 3HKZG 1K83H 4OELB 3I91A 2F0SA 4LFAL 1XNRQ 1MD2D 3CCLA 3DUZA 2EJGC 5FO9B 2FXQA 3HOUB 3U4VA 2HQLA 4JI7Q 1L0YB 1H9KA 2WACA 4GLVB 1JJCB 4DAMA 4LFCQ 3F1ZA 1VQ5A 3A5UA 1YITA 3NTIA 3GO5A 5CV6A 1Y1VB 3I4MG 4QJFA 1X3GA 2VQFL 1TY0A 1DONA 4TKOB 1WTRA 3BDOA 3MWYW 4S3SA 3A8JE 1GUGA 4IPDA 4K8JA 1KDCA 2L4NA 1ZYRC 4KJOA 2UUBL 1LT5D 3A0JA 4KHPQ 1G6ZA 1Y14B 3JAMi 1N32L 1BBUA 2N3SA 3DMUA 3GTKB 2PNHA 4DR7Q 2OF1A 4OEMB 3OW2A 1EQTA 1VQDA 2J0TD 1Q82C 1YNNC 2QCPX 1EY6A 4JK1C 2YTXA 3BDCA 3HOVG 1CHQD 1G8ZD 5KYLA 2FJ2A 1NR4A 1SBBB 1MGSA 1KRTA 1JE4A 4DNTB 5BN3A 4LUVA 4NMZA 5EPKA 3W2DA 1HZCA 2DUDA 2CWPA 2Z6KA 1Y8OB 2OCEA 1I4RA 3IKJA 3KDFB 3I7FA 4LFAQ 4XTCS 5IGEA 2K7VA 1WCMH 2FMCA 4QY7A 4C3HH 2F0QA 3QWNA 5JEAJ 4PV1C 3D4RA 1I4PA 4X66Q 3GTOH 4P75A 2UU9L 1TWGB 4CDCC 1I50H 4DK6C 5C44G 3JC66 1HQMC 5ELDA 2ATWA 3C2PA 1FNWA 3NQIA 2D9UA 2UUBQ 4MZ9A 1TWHB 3MHBA 1Q7YC 4BBSG 2H5XA 4ZYSA 3IL8A 2NYZD 1A63A 4K14A 3OWEB 2F0GA 1QE6A 2E5LQ 4TVAB 1CK1A 3LNNA 3SVMA 2WP8J 5EJWA 4DK3C 3IFTA 3PUVA 1D2BA 1KD1C 3NTKA 2BH8A 1IYJB 5FLXc 3T1HL 3HOZB 1VQFA 3VA7A 3VR5A 1PRTD 2EY6A 1E2VA 4WORA 5CMDA 4X6AH 4IOCA 4DFAA 1F2MA 1H9SB 1JE5A 5FJ8H 2ZXOA 2B63B 1KRSA 1S40A 1TVXA 3P75A 1HHVA 4A4IA 2K6AA 3E5SA 3PO2G 2NWGA 1G91A 2EYJA 2IT1A 2UU9Q 1PLFA 3OIQA 5M5YH 1CKOA 1LLRD 1EYCA 3RMHA 1CQVA 3SDZA 3M4YA 4ZK9B 3OWFA 3OOCA 2R6GA 1Z47A 1EEID 3I73A 3MVVA 2VL6A 3BZCA 5IT9E 3HOYH 1LACA 2PI2E 1QG7A 3CU7A 2EYMA 1EQVA 1N34L 1S5FD 2F0NA 1MBYA 4V0BA 3CRKC 5CV5A 1VS0A 3NEMA 3M7NA 5EBCA 1B3QA 3OHXC 1QWYA 3H3VI 1TQOA 2XWBB 3MXNB 5EGTA 3QG1A 1EU4A 2EPBA 5C0XI 3S2HH 4PMCA 4B3TQ 1VQNA 1Y8NB 1IHZA 3U4ZA 2OQKA 4DAPA 1K0RA 3E6ZX 1FGUA 5GQOA 1SE8A 2F0MA 3BU2A 4DV1L 1H9JA 4ZRZA 4GN3B 1Q46A 1WD0A 5M3MB 1ZYRD 1WTVA 5BR8L 4GNXC 2D62A 2F52A 4HMIA 2H1EA 3A54A 1CKNA 3J81c 1UWVA 1YI2A 5IYDH 5C0XG 5C4XH 1SR3A 4L5RC 3HOXG 4HCSA 2HIVA 1B8AA 1VQ9A 3NQTA 3BYTB 1EYGA 1C0AA 2GA4B 1ESFA 1HUMA 1YNND 3B6YA 3SR1A 4RMFA 3RNUA 4HJ7A 4QUCA 5GAEC 1D5ZC 4NW2A 4FVMA 4IFDI 1Z6HA 3HOUH 2Z6BA 4K5WA 3D3RA 3W1BA 3HRZC 1ZKOA 2HCIA 3FVQA 4KI0A 2AUJD 3HOUG 2R92H 3R2TA 2RSOA 1ILQA 4CKEA 1TWAH 1PH9A 4DKAC 4RCOA 4JW0A 4C3JB 3WOFA 4XDXA 4HAEA 3QIAA 4LFBQ 3KLWA 1Y1VG 4OWXB 2B2YA 4YCUA 1PVOA 4DV1Q 3H15A 1CUKA 3I72A 4QMGA 1E3PA 3NPPA 4UP9A 4BS9A 1LTAD 4X64L 3GTKH 1I6HH 1L1OA 2QW7A 5BR8Q 4O1NA 5I6WA 3M4QA 1A0IA 2EJFC 2BOSA 3CPFA 1JICA 3L7ZC 1MSGA 1N36L 1J9OA 4FF2A 4OO1I 3A5ZB 3TQYA 2ZJPA 5JJIA 3KBGA 5DLQE 3FKIG 2EIFA 4WRDA 3KBXA 5CR3A 2L1BA 4N9PA 3S24A 3STBD 2XN9C 4JI1L 5H1SE 1FJGL 2RQXA 1HJPA 2ZM6L 2HCCA 1XPUA 2WKCA 3MEFA 1PFBA 1TWGH 2PO4A 3VR2A 1TWFB 1BBXC 1BNZA 4JI3Q 3SGIA 2HDMA 4OO1G 4A3JB 3EN2A 4DV2L 4K6LA 2KENA 1I3QB 3H0GG 4FYDA 2OWOA 4BXXG 3VR6A 1F2LA 2HHHL 5K36G 1TWHH 1NMFA 1BDOA 1LYLA 2HD3A 4X64Q 4OONA 4JBWA 3BYYB 4B3ML 3RLNA 2RCNA 2YYZA 4A3LH 1KNEA 1T5XD 1QVFA 1TS5A 3HOZH 3EFXD 1IYVA 2X6LA 3H6MA 2A69C 4FDBA 4A93G 4DR6Q 3AFPA 1HFGA 2B63H 3A8IE 3KJPA 4JI1Q 1N33Q 2K04A 1FJGQ 1EYAA 1MJCA 3K81C 2PI2A 2YU9B 1Q1EA 4X65L 3KLSX 4RHSA 1LTID 5T1IA 5C0XJ 5KNDA 2K52A 4RG1A 1U4PA 3MXGA 5JJKA 4GNXA 1VCIA 2JA6G 1U4LA 3LGJA 3T53B 4DV2Q 4AYBG 1AE2A 2EYPA 2FFKB 1GO3E 4ULLA 3NENA 2BA1A 3OIPA 3KF6B 4DV7Q 2EY1A 4DNIA 1KAAA 1EY7A 2N8NA 2JA8H 3I4NB 2QEJC 5CBAE 4IPGA 5IP9H 3I55A 4A3KB 4CKCA 2JSOA 5IYCH 1TWCB 2R61A 4POFA 1YHAA 2K01A 1K83B 1TR5A 4IFDJ 1BXTA 1GHJA 1EIGA 4ZAIA 3TMEA 2UXBL 1Y1WG 4NP5A 3ER0A 1VMPA 5M3MH 1LTBD 5CV7A 5GAGC 4J1MA 1RTOA 2E74C 1HA5A 3W3AA 5M3MG 3F2CA 4X65Q 3S1NH 2AUKA 4DV5Q 5LHY1 2QGQA 4EQ5A 3TP6A 4I7ZC 3EIVA 3TP8A 1XYIA 4RWSC 3NBIA 1VQ6A 3HOWG 3KDFA 1DM0B 1EEFD 2V4DA 1J5EL 3BS1A 4QF4A 2MO1A 1NTGA 2QKIC 5C3EG 1E1TA 5IT9c 3ONAB 4HJ5A 4KN7C 4GOPB 1AZQA 3IRBA 2X69A 3UDGA 5E3FA 1A3VA 2K5QA 3AFQA 1ENFA 3S15B 4YWMA 2B39A 2XVSA 2HQEA 4LMQD 3N52A 2K50A 3AQQA 1PDQA 3CRLC 4UY8C 2C35B 2AKWB 2J4XA 1EY0A 5IP7G 4C3JH 1V1PB 2WAQG 4J15A 3T13A 1I5FA 3PUZA 5C4JB 4DR5L 5IIFA 4C3HB 2CHBD 3C1EA 1LTLA 3CD6A 5TSSA 2JA7G 2Y0SG 5IOCA 3K7UC 3WOEA 1PZJD 1GKHA 2F3WA 3CHBD 1KAWA 1OTCA 1CKMA 1OO9B 4U673 2KUMA 4GLXA 3TS0A 2AMCB 1F9PA 2K32A 2WB1B 2QDLA 5FLMH 3U9SA 4J8QA 1E24A 4LUOA 1H9SA 5A35A 4HIOA 1SSOA 2EVBA 1WD1A 5LMUL 1L0XB 1KL9A 1C48A 4DR2L 2ZTCA 1VQLA 4WJ4A 1LTGD 2ICEC 4JBKA 4CJ2C 4JI8Q 2E2IH 2E2DC 3D4DA 3MTSA 2IJ0A 1PYSB 2NVTH 1TWFH 3DWQA 4IALA 1SJED 2DY7A 2N88A 1R4PB 2VNUD 3OMCA 4OX9L 2K03A 2K28A 4A3FB 5HY6A 1YJ9A 4NXML 2QDBA 3NUCA 1SRUA 4A3JG 3A7AB 1S5ED 3MXPA 3S17H 4CDEC 2GN5A 5A2QE 3PO3H 3L9AX 4NPSA 1UUPA 3J81j 1YBYA 2WFWA 4R1JA 5M5YB 2QF7A 2AQ3B 3NTHA 2IHFA 4JI2Q 3BVMA 5J39A 2LS01 1QUQA 4JV5L 3HOYB 3J80L 3GTLB 2CQOA 4UAIA 1I4XA 2D0PA 4OL7A 3JAME 2NZOA 5M9OA 4H02A 4B3SQ 4DR2Q 1M1KC 2KCNA 5C3WA 1RODA 4JI6L 2JEAI 1GUWA 1U9RA 4HSPA 2UUAL 3Q22A 4CBVA 1EWIA 2RF4A 2VB3X 4JG2A 1NE3A 2YU9H 1B44D 3K8AA 2A6HC 2F0FA 5E4WC 3D8GA 2IWHA 3V2TA 2Z4HA 4L63B 5DAUA 3EBEA 5HURA 1VQBA 3X3MA 1SEBD 4NXMQ 1EL0A 4DF7A 1A3UA 1IL2A 2ZTDA 1FD7D 1VF5C 4XYOA 5CGKA 1SMXA 1X56A 4KKUA 4A3MG 5EKKA 1MI2A 4FXGC 3I4NH 1KHIA 1U0LA 1A15A 3CMAA 4A3KH 1LV9A 1IW7C 2BCOA 1QJOA 2IHEA 4MTNA 1GM5A 1PYBA 1TWCH 4A3DB 2KCCA 4GNXB 4JV5Q 1XWEA 4RFBA 2NZ1D 4P72A 3TN2A 1B4OA 4DK0A 2MUYA 1PFSA 2ZT9C 2A8VA 4XXEA 3CF5A 1HA6A 4JI6Q 2CW0C 1E22A 2UUAQ 1DOMA 2R92B 3HKSA 1JORA 4ODGA 2O5JC 4A3IH 1KLGD 3J81L 4KMUC 1TWAB 4GOPC 5BN5A 4XIGS 3F2BA 1V9PA 2N78A 4XQJA 5KNCA 1TKWB 4R8IA 1N9WA 1FVIA 1HNZL 1K73C 2K5NA 2Z0SA 3K0YA 2KBNA 2G5DA 4B3RL 2ZJRA 2WB1E 3SHLA 5KGUA 1I6HB 3W1GA 4H44C 2A68C 5M3FB 2BH2A 3S15H 1PZID 1UE5A 2MPMA 3S9WA 1IXRA 4XQNA 1P16A 1I4GA 5FO7B 3BJUA 2KHJA 5C5LA 1SNDA 1PH8A 3H91A 1PXUA 5C4JH 1JB3A 3O13A 1C8CA 1X3QA 1EZ8A 3P20A 4BA2I 1WCMG 4C1NI 4C3HG 3K0XA 5EPJA 2F0IA 2LSSA 4A76A 1DOKA 2PZWA 2EQSA 2MJ8A 4KTAA 3A55A 3D4WA 4B9WA 1SMYD 1S5CD 2VQFQ 1CZGA 1EYDA 2F0WA 2K5VA 2I5MX 2WB1G 1WTOA 2K5HA 1JWSD 1HNZQ 1PMRA 1IYUA 4BBRB 2JE6I 1N32Q 3FDTA 4JYAL 2HDLA 4LF7L 1LO5D 1ILPA 1A2TA 3DWPA 1DJRD 2CVRA 4G7OC 1M90C 1N8RC 2Z1CA 3TP7A 1GUSA 3SXHA 4A3FH 2SNSA 3PMFA 1SYDA 3KF6A 3J7A5 1BF4A 3BVGA 2LXJA 1B7YB 5JVG3 4AIMA 1DCZA 4IO9A 3GDEA 2FHTA 4ID6A 1S3OA 3SK6A 3TDQA 5FJ8G 3X3NA 2O2LD 4ALPA 1VDZA 3SK4A 1A2UA 1IBKL 3UDFA 4APVA 4NKLA 4WFN3 1SDFA 3CCUA 5C4ZA 1GXDC 3VDYA 3I70A 1IW7D 4BA1I 1SFOH 2B2WC 2UXCL 1EFID 3GTLH 5IE8A 1PH3A 4WJ3M 3HOYG 3PGZA 1DGSA 1IL8A 1K8AC 2NVXH 4A3EB 4KHVA 2JA8B 3F2DA 2M00A 5E1FA 4JYAQ 2OTLA 1JR0D 3I8ZA 1IKLA 3S1RB 4P2CB 5EQ0A 5KNBA 5FOBB 2CW0D 3U58A 4KN4C 5IODA 2IY5B 5JJLA 2XRSD 3G48A 3QOJA 1VQCA 3T1HQ 2A6EC 3S1QB 4YCVA 1MIUA 1PFNA 4YHHL 4A3CH 1STAA 4UP8A 1LTRD 4AQYL 2PW7A 1QUQB 1Z9FA 3CAMA 3S1MB 4QIWB 3AB9A 2KHSA 1WI5A 2VZAA 3ITPA 2K14A 4GOPA 2Q8RE 2F4IA 2VS1A 2OTJA 1PH2A 2UUCL 4M1UB 2E2HH 4QQBX 4UP7A 2B3GA 3S1NB 3C46A 1EOVA 1IBKQ 2NZHA 2A73B 4DR1L 2GVBA 2A68D 5IYDG 1BVSA 3DWAA 1V1PA 4A3DH 5C4XG 1RD9D 3K80C 4DV4L 3L3OC 3PF5A 4IURA 2R93H 5CC4A 2EYLA 1N34Q 3Q24A 1FNVA 3RLFA 4IUVA 2YTYA 3JAMc 1YJNA 3S2DB 4YWLA 4PQXA 1Q12A 1P8LA 3A74A 4MNOA 1AP0A 3V96A 4A3GH 5K5PA 5AFWA 1YNJC 2R92G 1X6OA 2MNAA 4L5SA 4YHHQ 2NN6H 4G7ZC 3DXJC 4G7HC 4AQYQ 1V1OA 1SYBA 1JOQA 3W5OA 2Q2IA 4UDUC 4GS3A 1TU2B 4KKSA 1II3A 4XYQA 4OIKA 3VYUA 5IT9L 3KLRA 2UUCQ 2UXDL 4LK1C 5EAYA 3J7AV 1D1KA 4BY7B 1QB5D 5M3FH 3OTOL 1A3TA 3CC2A 4IFDH 1L2FA 1MHWC 1EWHA 1VMCA 3FP9A 1DYQA 4DU9A 4DR1Q 1SAPA 4CGYB 2AQ1B 2N49A 1ASYA 1Z7TA 5GROA 2JK8A 3UDXA 2ZXPA 1S72A 4IPHA 2L55A 1HRJA 2XSCA 4JBMA 2KA7A 5IYBH 2I0QA 1KIXA 3ND9A 1RDPD 1X3PA 2DN8A 1X32A 2L12A 1JMCA 2E2IB 2DJFC 5HGQA 2RKSA 4R4QA 1D5MC 2NVTB 4K0KL 1G6PA 3UE1A 1VQEA 4HIMA 2C5CA 5KIXA 2A5HA 1JOOA 3BZDB 3G4SA 1EU3A 4EGVA 4JVZA 2CH4A 1GD7A 1PTOF 3S17B 1VQGA 3GV3A 5IGBA 4KK7A 3HP3A 1B3AA 4HR7B 3NBHB 4BBRH 3PO3B 1XMOL 4EQNA 1O7LA 4QB4A 3K5MA 1VQHA 2B2WA 3CCEA 2K75A 5D3DA 3HG9A 4PMWA 1STNA 4Y52H 3OTOQ 1WJJA 1Y69U 4OIJA 1XNQL 1N36Q 3C3LA 1B53A 1HXYD 4A3LG 5DM63 1F2YA 5COYA 2M9VA 1OXTA 4U68A 2NTTA 3HOZG 2A6ED 2Z4IA 2Q2UA 2WV6D 2EJMA 2PQAA 2F0VA 2BDOA 3TZDA 3H09A 2R7FA 4H0LC 1B1ZA 5C6AA 1BBWA 3TRZA 1FL0A 1FR3A 2R3ZA 4KY6A 2B63G 1XXGA 4QIWE 1S5DD 1X55A 2ZM6Q 2JA5H 1Q1BA 3KF8B 4K0KQ 4HIKA 4KY7A 4C56C 3BG3A 4PZ6A 4LF4L 2IW3A 3L2PA 2B29A 4A3BB 2ALYB 1NUCA 4DUYL 3PIOA 1HZBA 1QCBD 4GKJL 2HHHQ 4B08A 2EYHA 4A3EH 1X3FA 1CSQA 3MEHA 1XMOQ 3NWSA 1XMQL 4B3MQ 3S1RH 4EQOA 2Q2HA 4JI0L 4GN5A 2JA8G 1D5XC 1SN8A 2WINB 5IP9G 1KLUD 1E7ZA 3FHWA 1XNQQ 5IYCG 3S1QH 1NR2A 4C3IH 1YNJD 3MZ5A 1CSPA 4RGOS 3RZOH 3S1MH 1RHPA 3FPPA 3NHHA 4ZUJA 1JOKA 3G6JB 4BY1H 4ZKCB 2BE5C 3I4LA 4ABNA 3T1YL 1GUTA 1PH5A 1YHQA 5CBEE 4DUZL 4K6DA 2RHSB 4A3IB 1XX8A 1O7IA 4MN3A 1I94L 2VXWA 4I7AA 2IX0A 5I9PA 2CWAA 2KQ3A 2EY2A 3QOLA 3ULPA 2JP1A 3FMCA 3Q8DA 3CKIB 3MA2B 1YEZA 5M5WB 4GKJQ 3I4MB 4FXKC 2A74C 1E2WA 1LTTD 1SE4A 1STBA 2PNRC 4DA2A 1XPOA 1HPCA 4IJLA 3S2DH 2K4KA 3J7AF 2PW5A 5ELNA 1A6XA 3J7YW 5J22A 4LUZA 1TY2A 4F8MA 4K5XA 3FPUB 3HEJA 2MHVA 1B9MA 2EZVA 3GTPB 2I5LX 1EY9A 2E2JB 2RA4A 2Q2TA 1BCPF 4C3JG 4LF5L 5EKLA 5HGTA 4Q0FA 1LABA 2DGYA 3K5OA 3E3XA 2XWJB 3J7ZC 2Q8IB 5EBDA 2UXBQ 3HOVB 4DK1A 3CCJA 1KXLA 2F0UA 4DNRB 1WFQA 2F4VL 5J3BA 3J80E 1EQQA 4ME3A 1KC8C 1I4QA 3QB3A 1TS4A 3NSWA 4UPAA 4BY7H 1SYGA 2KECA 4DUZQ 4FF4A 1HZAA 1SLJA 4LF6L 4RKBA 1UE7A 4X3UA 2VUMH 4JI5L 4DGZA 3R2IA 1UNSA 3CCMA 1ET9A 1VQPA 1PH7A 1K8GA 3RN2A 1NNXA 3RR5A 2CFMA 3DM3A 5JJZA 3DEOA 3V05A 3IAYA 5FLMG 5M5XB 1J5EQ 5I4DA 5I2YA 1MSHA 2ENBA 1W3SA 5C44B 2R7ZH 4Z9CB 4XT3B 2ZXRA 2Q8TA 1DOLA 4Q5VA 2A69D 3PIO3 1M4VA 3EQLC 4HTHA 1PV4A 3OPOA 1CA5A 1HR0W 1DD2A 4ME5A 1F9RA 4HJ9A 5D65A 3NP8A 1TXYA 1HNWL 4BBSB 2OT2A 2F1MA 1CI3M 3DHQA 1BO0A 4TRDA 4N8X1 1WVLA 1C7YA 1SE3A 3KOJA 3T16A 2PMZB 3GTJB 1HUNA 3TZUA 1SROA 4DR5Q 4GZYC 1ONLA 2Z9HA 4G57A 2NUCA 2F4VQ 5IGGA 3CXCA 5DNFA 1YJWA 1WYDA 2ZTEA 3NWTA 3PO3G 1H9RA 2EDGA 1NBWA 3VR3A 2Z8LA 1ENAA 4P73A 1ASZA 2B8FA 4L8JA 5FLXL 4JI5Q 5EKIA 1LT6D 1EY5A 1SFOB 1U4MA 4O42A 2O5IC 1UE1A 1J8IA 5JEAH 5LMUQ 2PCFB 2F0OA 4IUNA 2NVXB 4FF1A 4DR3L 2SOBA 3CW2C 4MIUA 1JWUD 2MP1A 1QOHA 1STGA 1TS2A 2BE5D 3J80i 4HMJA 3VA5A 2WIIB 4L5QA 1G291 1VQ4A 2F0DA 1EFWA 2PQEA 5G3LF 4IZ8A 1Q81C 2DJGC 3PV0A 1HNWQ 4OHJA 1F9QA 5T1GA 4OX9Q 2G9HD 1NAPA 3CQZB 4A3BH 4ZUIA 4G4KA 2JA9A 5IY0A 4X62L 3CC7A 1JJGA 1V8QA 3GTMH 2NVYB 2CCZA 4CJ1B 2PQAB 2E2HB 4HCEA 4LFCL 3GTQB 3MXUA 4KLKA 1JCKB 1PRTC 3OSOA 1PFMA 1PTOB 3I4NG 4YCWA 2KVMA 1LM0A 3GQBA 4A3KG 4NDXA 4FF3A 1H9MA 2B2UC 1NCVA 1Q86C 1UE6A 4PZ7A 4GN4B 4YIJA 2R93B 3DM1A 3OYYA 1WTXA 1O80A 2DNCA 1HFNA 2O4XA 2D2CC 3HOXB 1RTNA 4YY3L 2TSSA 1ZEQX 3QR8A 4A3GB 1VQAA 4TQUS 4FO2A 1QNUA 1CTMA 1R9TB 3KYHC 4YWKA 5A2QL 2KJXA 3GP7A 3A7LA 3FRPB 4RH6A 4A3IG 2F0HA 4GKKL 4O2DA 4Y7NB 4HEDA 4DV6L 4X62Q 1AEXA 4X66L 2JQOA 4MHEA 3J81i 2L9HA 5M5WH 4ZKBB 3I4MH 3RUZA 3JAML 4LF8L 5FO8B 5BN4A 1H95A 1QILA 4OWTB 4HJ8A 1SNCA 1CHPD 2E76C 1LT3D 3TS2A 4IN3A 4R4TA 2LFNA 3CPWA 1I6VC 5AJ3L 1UEBA 3SK5A 3G7LA 3GTPH 1RCVD 2E2JH 4PMBA 1R4QB 5GADC 4NXNL 5ELFA 1WTQA 2TMPA 3NBHA 2E5LL 2XRQD 1E2ZA 4IUQA 3PIPA 2BDNA 5IGFA 4YY3Q 3HOVH 2NVQB 1C9OA 4FNFA 1AW7A 3MFYA 3M85A 4QGUA 3FKIB 4E6IA 1X54A 4KJNA 2PMZE 1CM9A 2X6GA 1C4QA 1LUZA 2L11A 3RZDH 2A19A 2RDGA 1ET6A 3EVQA 2VB2X 3D31A 4GKKQ 4XQQA 5M5XH 4DV6Q 3LX0A 4B3RQ 5C44H 4IUTA 4LJZC 3PUYA 1Q90A 1SYFA 1RF2D 1STHA 2B2YC 3KF8A 5LL6S 4LF8Q 5KEEA 1PRTF 3H0GB 1SXTA 2ES2A 2PYKA 3ZJYC 4KV6A 4K2KA 3R8BA 3E0JA 3K7AB 1PH6A 1L1OC 1QNKA 2A6HD 2IL8A 3PUWA 2MFIA 4PNYA 1GJXA 4JPBW 4BBSH 1PYWD 3TSSA 5JVH3 3M7GA 5AJ3Q 5LMNW 1BUVT 1EUJA 4R4CA 4L6TB 1BKBA 5D3IB 1HNXL 4L5TA 1CZWA 1LTSD 1VQJA 1OXXK 4A3FG 3QJYA 4OXPA 4P74A 2LMCB 4K5VA 3GTJH 4NXNQ 1MKHA 2E75C 2EXZA 4DV0L 4X3TA 2D0OA 2IX1A 3S16H 2JA5B 2JN4A 4B3TL 5LL6X 1BCPB 2ICIA 3J80c 1STEA 1GVPA 3K57A 4A93B 1LT4D 3T51B 3STBC 3A8KE 4DN4M 3R93A 1E1OA 3M3YH 4NB3A 4KD3A 2IPKD 3CMEA 5D14A 3PO2H 3CCQA 5C3XA 1O7ZA 3UE0A 3ULLA 1U5KA 5CORA 2B2UA 3EA6A 4RAUC 1HR0L 4JOIC 1F9SA 3I2ZA 2JA6B 1K3BC 4LF7Q 3M4OH 4DV3L 4AYBB 2V1CC 4KD4A 1QZHA 2GVAA 2EYFA 2NBFA 5KRUA 2F0TA 5IWAL 1PZKD 2F0PA 2I46A 3MAQA 5I6YA 1VQ7A 1GHKA 1F2ZA 4C3IB 1WTHA 2CQAA 2YTVA 3RZOB 4ZCKA 3K58A 1PTOC 3CQZH 3E0EA 4DAYB 4A3CG 1HNXQ 4BY1B 3F8TA 4RA8A 1OXUA 2NVYH 1IZ6A 1YHBA 3H3VC 4EQPA 3FEWX 5E4XA 3GTQH 4DV0Q 1UEAB 4X3SA 4PZ8A 5ELOA 2B2TC 3PIP3 4HJAA 2EOTA 5IGDA 1PTOH 1X65A 3UDIA 2LY7A 4LFBL 1Q8KA 2YV5A 1Y1WB 5IGCA 3H3VH 4EX5A 2F0KA 1VQKA 4A3DG 1RL2A 2B2VC 2UXCQ 1WTWA 2KCTA 5C0XH 2NN6I 2R93G 3HOXH 1B50A 1HR0Q 4DR4L 1JC7A 4KHZA 3URYA 4QL5A 3HOWB 4DV3Q 4EVOA 1R9TH 2F03A 1STYA 4F88A 5C3EB 1IBML 4H13C 3RD4A 5IWAQ 1JWMD 1T9HA 4A3GG 5EPLA 1AN8A 3DEPA 1FNUA 3ERQA 3HFZB 3I56A 4QCLA 1K8OA 1K9MC 4Y7NH 2NN6G 3TP5A 1DZ1A 1PHJA 4CDFC 3UI2A 4JI3L 2ZJQA 3ULJA 3K6OA 2N55A 4F7XA 2WAQB 2J7ZA 2VY3A 3D6CA 1Y1VH 4LWCA 3TEHB 3SEBA 2VUMB 1Y8PB 1KDAA 1SNMA 2KEDA 5M3FG 1RJTA 1D6EC 4IFDG 2JA7B 1D7QA 2Y0SB 5CV8A 1A8VA 4CKBA 1VQIA 4DV4Q 2DY8A 2R7ZB 5ELCA 5GAHC 1GOZA 2AQ2B 1A62A 1EY8A 5DM73 4DR4Q 2NVQH 1NMGA 5IYBG 3Q0AA 4ZLTF 3FKIH 3KFUA 1EOTA 1IBMQ 1HH2P 1S5BD 4KKTA 1G2SA 1YZ6A 4O0AA 3U9OA 1SYCA 2SNMA 4DR6L 4DAVA 3D0FA 3AYHB 2JEBI 1TS3A 1N33L 4LF9L 2AHOB 3Q6SA 3ERSX 4IUPA 3ND8A 1CQFA 2CKZB 4POGA 4GLAC 2R7DA 4OO1H 3HS0C 2UXDQ 5CV9A 4RGNA 4HIDA 3P1HA 2P5ZX 2SDFA 3RLOA 4BBRG 1RKNA 3H0GH 1XTDA 2K5DA 4BXXH 3SK8A 4JOIA 3K7AH 4RKLA 4XT1B 4DV7L 3AMUA 1OXSC 5CYUA 5K36H 2QILA 3WDNA 3D6WA 4AYBE 1BCPC 1QVGA 3S14B 4RCNA 3R3OA 3SE0A 3PCOB 1XJVA 1PTOD 3HGBA 3CCRA 1JJ2A 1EIHA 1BOSA 1KQSA 1IBLL 1G51A 4V190 2KHIA 5L37A 1ENCA 2BA0A 3RN5A 4C2MB 3A56A 2JA5G 4A93H 1E0BA 3F2UA 4UHVA 3U50C 1HZ9A 1ESRA 2FINB 3NXWA 1S4ZA 3BZKA 1XTCD 1SE2A 1EY4A 2B2TA 2HT1A 5I2XA 2XIWA 4JI4L 1AE3A 1JB7A 2HIXA 4DXFA 3GTMB 4LF9Q 3GTGB 3QO2A 1JQYD 4R4OA 5JPMC 3CCSA 1YVCA 4DPGA 4N9TA 4DV5L 2HUGA 3EROA 3GV6A 2JA6H 2B2VA 4LAAA 1X3EA 4HN7A 5C4HA 4A3EG 3T56B 1Q8IA 2D5DA 1VQOA 2K1BA 5LMNL 1AFPA 1W2BA 1K8MA 2AWOA 3ZYYX 4A3MB 3I4OA 1HTLD 5J1ZA 1PRTB 2E8GA 4JCVE 3NE5B 1AH9A 4JC0A 1FYCA 2QA4A 4C3IG 4OGQC 2JJQA 2F0EA 1CFMA 2F3VA 2MQHA 2NB0A 2WKDA 4LNQA 4RGMA 4BY1G 1HCZA 2VQEL 3HKZB 1IBLQ 1VF7A 3G6EA 2OXPA 4R8NA 2EY5A 1YIJA 2G9DA 2I07B 1KABA 4MTKA 2QEXA 3TREA 3IFDA 5JOBA 1O78A 3E9HA 4LF4Q 1Y1WH 1QZGA 1K28A 2WAQE 3VYSA 3KLSA 3KUPA 2K33A 3WWVA 4JI4Q 1U4RA 2H4OA 1CT1D 2L5TA 3MC0B 1B9NA 4K8IA 4DUYQ 3HZXA 2FMMA 4PG3A 2Y0SE 3OW7A 4JBJA 4WJWA 2K05A 2OQ0A
chains in the Genus database with same CATH topology
4DXGA 1BQQT 2B8GA 1SYEA 2KEEA 3N6RA 3EJIA 4M8AA 3PUXA 2MGSA 4CJ0B 2NTSA 4RHRA 3C1FA 1HTPA 5FLXE 4RGTA 4F87A 1CA6A 5FKAC 1IKMA 5JAVA 2EYOA 3K59A 1W6KA 3OMGA 3I3CA 2XNAC 2PPBC 4IUUA 3RZDB 5I9OA 3P7JA 3VR4A 1SNQA 1WCMB 4HSVA 3MFGA 3BVZA 2KOLA 3KK7A 1KNAA 1HQRD 4I65A 4J6HA 1BCPD 3LWEA 3GTOB 1BR9A 1EZ6A 1Q3LA 1ZXTA 1I50B 3GD7A 2RDFA 4FXDA 3H94A 4X3KA 3VYTA 1OXVA 3BDLA 3NK9A 1EWCA 1ML0D 1GUOA 1ICWA 4C1NK 4K2LA 4IQZA 3S16B 1KTKA 5KYIA 1SNPA 2EE1A 4FP5D 2L0CA 5FK9C 2OEOA 5ELEA 3M3YB 1M8AA 3I90A 5CV4A 1O7YA 4DAYA 2RBMA 3PO2B 2SEBD 2IX3A 2F0JA 3J81E 4B9XA 3MXNA 5JEAG 3AU7A 4BWGB 1UAPA 3M4OB 1SMYC 4R9WA 4KY5A 2M2LA 5F2DA 1T5EA 2AWNA 2K5WA 3TBIB 3VYRA 2RVLA 4ZQ3A 2RSNA 4CHTB 2C9OA 2PZTA 1NSNS 1WTPA 2RDHA 4ILWA 1I4HA 5DEHA 1G2TA 1W6JA 3Q23A 1KDBA 3S2HB 1F77A 1DXMA 5NUCA 1SJHD 2JYOA 1D1IA 2DNEA 5ELBA 3T4AC 2ID0A 4QUFA 5G3LD 1V43A 4H7BA 2JXMB 3K5LA 4TSSA 3LWUA 1TT2A 1SNOA 1B2TA 5JPNC 1AZPA 3K5NA 5C4XB 2PZUA 1GUNA 2LKVA 5ISRA 5C5MA 1TIID 1FGBD 2F0LA 3I91A 2F0SA 1MD2D 3DUZA 2EJGC 5FO9B 3HOUB 1L0YB 1H9KA 2WACA 3NTIA 3GO5A 5CV6A 1Y1VB 1TY0A 1DONA 4TKOB 1WTRA 3BDOA 3MWYW 4S3SA 3A8JE 1GUGA 4K8JA 1KDCA 2L4NA 1ZYRC 4KJOA 1LT5D 1G6ZA 3DMUA 3GTKB 2OF1A 1EQTA 2J0TD 1YNNC 2QCPX 1EY6A 4JK1C 3BDCA 1CHQD 1G8ZD 5KYLA 2FJ2A 1NR4A 1SBBB 1MGSA 1JE4A 4DNTB 5BN3A 4NMZA 5EPKA 3W2DA 1Y8OB 1I4RA 3IKJA 4XTCS 5IGEA 2K7VA 2FMCA 2F0QA 3QWNA 5JEAJ 4PV1C 3D4RA 1I4PA 1TWGB 1HQMC 5ELDA 3C2PA 1FNWA 3NQIA 2D9UA 1TWHB 3MHBA 4ZYSA 3IL8A 2NYZD 4K14A 3OWEB 2F0GA 1QE6A 1CK1A 3LNNA 3SVMA 2WP8J 5EJWA 3IFTA 3PUVA 1D2BA 3NTKA 3HOZB 3VA7A 3VR5A 1PRTD 2EY6A 1E2VA 4WORA 5CMDA 4DFAA 1F2MA 1H9SB 2ZXOA 2B63B 1TVXA 3P75A 1HHVA 2K6AA 3E5SA 2NWGA 1G91A 2EYJA 2IT1A 1PLFA 3OIQA 1LLRD 1EYCA 3RMHA 1CQVA 3SDZA 3M4YA 4ZK9B 3OWFA 3OOCA 2R6GA 1Z47A 1EEID 3I73A 3MVVA 5IT9E 1LACA 1QG7A 3CU7A 2EYMA 1EQVA 1S5FD 2F0NA 1MBYA 4V0BA 3CRKC 5CV5A 3M7NA 5EBCA 3OHXC 1QWYA 1TQOA 2XWBB 5EGTA 3QG1A 1EU4A 2EPBA 5C0XI 4PMCA 1Y8NB 1IHZA 4DAPA 3E6ZX 2F0MA 1H9JA 4ZRZA 1WD0A 5M3MB 1ZYRD 1WTVA 2D62A 4HMIA 2H1EA 3A54A 5C0XG 4HCSA 3NQTA 3BYTB 2GA4B 1ESFA 1HUMA 1YNND 3SR1A 4QUCA 1D5ZC 4NW2A 4FVMA 4IFDI 1Z6HA 4K5WA 3D3RA 1ZKOA 2HCIA 3FVQA 3HRZC 4KI0A 2AUJD 3R2TA 2RSOA 1ILQA 4CKEA 4RCOA 4C3JB 3WOFA 4XDXA 4HAEA 3QIAA 2B2YA 3I72A 4QMGA 3NPPA 4BS9A 1LTAD 4O1NA 5I6WA 2EJFC 2BOSA 1JICA 3L7ZC 1MSGA 1J9OA 4FF2A 4OO1I 3KBGA 4WRDA 3KBXA 5CR3A 2L1BA 4N9PA 2XN9C 2RQXA 2HCCA 2WKCA 1BNZA 1PFBA 2PO4A 3VR2A 1BBXC 1TWFB 2HDMA 4OO1G 4A3JB 4K6LA 1I3QB 4FYDA 3VR6A 1F2LA 5K36G 1BDOA 4JBWA 3BYYB 2YYZA 1KNEA 1T5XD 1TS5A 3EFXD 1IYVA 2X6LA 3H6MA 2A69C 1HFGA 3A8IE 2K04A 1EYAA 2YU9B 1Q1EA 3KLSX 4RHSA 1LTID 5T1IA 5C0XJ 5KNDA 1U4PA 3MXGA 1VCIA 1U4LA 3T53B 2EYPA 2FFKB 4ULLA 2BA1A 3OIPA 2EY1A 1KAAA 1EY7A 3I4NB 2QEJC 5CBAE 4A3KB 4CKCA 2JSOA 1TWCB 2R61A 2K01A 1K83B 1TR5A 4IFDJ 1BXTA 1GHJA 1EIGA 4ZAIA 3TMEA 4NP5A 1VMPA 1LTBD 5CV7A 4J1MA 1RTOA 2E74C 1HA5A 3W3AA 2AUKA 5LHY1 3TP6A 4I7ZC 3TP8A 1XYIA 4RWSC 3NBIA 1DM0B 1EEFD 2V4DA 3BS1A 4QF4A 2QKIC 3ONAB 4KN7C 1AZQA 2X69A 5E3FA 1A3VA 2K5QA 1ENFA 3S15B 2B39A 2XVSA 2HQEA 4LMQD 3N52A 1PDQA 3CRLC 2J4XA 1EY0A 1V1PB 3T13A 3PUZA 5C4JB 5IIFA 4C3HB 2CHBD 3C1EA 5TSSA 5IOCA 3WOEA 1PZJD 2F3WA 3CHBD 1OO9B 4U673 2KUMA 1F9PA 2K32A 2WB1B 3U9SA 4J8QA 1H9SA 5A35A 1SSOA 2EVBA 1WD1A 1L0XB 1C48A 1LTGD 2ICEC 4CJ2C 2E2DC 3D4DA 3MTSA 2IJ0A 3DWQA 4IALA 1SJED 2DY7A 2N88A 1R4PB 2VNUD 3OMCA 2K03A 2K28A 4A3FB 2QDBA 3NUCA 3A7AB 1S5ED 3MXPA 5A2QE 3L9AX 1UUPA 5M5YB 2QF7A 2AQ3B 3NTHA 3BVMA 5J39A 2LS01 3HOYB 3J80L 3GTLB 4UAIA 1I4XA 4OL7A 3JAME 5M9OA 2KCNA 5C3WA 1RODA 2JEAI 1GUWA 1U9RA 4HSPA 3Q22A 4CBVA 2VB3X 1B44D 2A6HC 2F0FA 5E4WC 3D8GA 2IWHA 3V2TA 2Z4HA 4L63B 5DAUA 5HURA 3X3MA 1SEBD 1EL0A 4DF7A 1A3UA 1FD7D 1VF5C 5CGKA 4XYOA 4KKUA 5EKKA 1MI2A 4FXGC 1A15A 1LV9A 1IW7C 2BCOA 1QJOA 4A3DB 2KCCA 1XWEA 4RFBA 2NZ1D 3TN2A 1B4OA 4DK0A 2MUYA 2ZT9C 4XXEA 1HA6A 2CW0C 1DOMA 2R92B 1JORA 4ODGA 2O5JC 1KLGD 3J81L 4KMUC 1TWAB 5BN5A 4XIGS 4XQJA 5KNCA 1TKWB 4R8IA 3K0YA 3SHLA 5KGUA 1I6HB 4H44C 2A68C 5M3FB 1PZID 2MPMA 3S9WA 4XQNA 1I4GA 5FO7B 5C5LA 1SNDA 3H91A 1PXUA 1JB3A 3O13A 1C8CA 1X3QA 1EZ8A 3P20A 4BA2I 4C1NI 4C3HG 5EPJA 2F0IA 1DOKA 2PZWA 2MJ8A 4KTAA 3A55A 3D4WA 4B9WA 1SMYD 1S5CD 1CZGA 1EYDA 2F0WA 1WTOA 1JWSD 1PMRA 1IYUA 4BBRB 2JE6I 3FDTA 2HDLA 1LO5D 1ILPA 1A2TA 3DWPA 1DJRD 2CVRA 4G7OC 2Z1CA 3TP7A 1GUSA 3SXHA 2SNSA 3PMFA 1SYDA 1BF4A 3BVGA 5JVG3 1DCZA 2FHTA 4ID6A 3SK6A 3TDQA 3X3NA 2O2LD 1VDZA 3SK4A 1A2UA 4NKLA 4WFN3 1SDFA 5C4ZA 1GXDC 3I70A 1IW7D 4BA1I 2B2WC 1EFID 1IL8A 4A3EB 4KHVA 2JA8B 2M00A 5E1FA 1JR0D 3I8ZA 1IKLA 3S1RB 4P2CB 5EQ0A 5KNBA 5FOBB 2CW0D 4KN4C 5IODA 2XRSD 3QOJA 2A6EC 3S1QB 1PFNA 1STAA 1LTRD 2PW7A 3S1MB 4QIWB 3AB9A 2KHSA 3ITPA 2Q8RE 2F4IA 4M1UB 3S1NB 3C46A 2A73B 2A68D 3DWAA 1V1PA 1RD9D 3L3OC 4IURA 5CC4A 2EYLA 3Q24A 1FNVA 3RLFA 4IUVA 3S2DB 4PQXA 1Q12A 1AP0A 3V96A 5K5PA 5AFWA 1YNJC 2NN6H 4G7ZC 3DXJC 4G7HC 1V1OA 1SYBA 1JOQA 4UDUC 1TU2B 4KKSA 1II3A 4XYQA 4OIKA 3VYUA 5IT9L 3KLRA 4LK1C 3J7AV 1D1KA 4BY7B 1QB5D 1A3TA 4IFDH 1VMCA 1EWHA 1DYQA 4DU9A 1SAPA 4CGYB 2AQ1B 1Z7TA 2ZXPA 2L55A 1HRJA 2XSCA 2KA7A 1RDPD 1X3PA 3ND9A 2DN8A 1X32A 2L12A 2E2IB 2RKSA 1D5MC 2NVTB 2C5CA 5KIXA 2A5HA 1JOOA 3BZDB 1EU3A 4EGVA 1PTOF 3S17B 3GV3A 5IGBA 4KK7A 3HP3A 1B3AA 4HR7B 3PO3B 4EQNA 1O7LA 4QB4A 3K5MA 2B2WA 5D3DA 3HG9A 4PMWA 1STNA 1Y69U 4OIJA 3C3LA 1B53A 1HXYD 5DM63 1F2YA 5COYA 2M9VA 1OXTA 4U68A 2NTTA 2A6ED 2Z4IA 2WV6D 2EJMA 2F0VA 2BDOA 3TZDA 3H09A 4H0LC 1B1ZA 5C6AA 1FR3A 2R3ZA 4KY6A 1XXGA 1S5DD 1Q1BA 4KY7A 4C56C 3BG3A 2IW3A 4A3BB 1NUCA 1QCBD 4B08A 2EYHA 3MEHA 3NWSA 4EQOA 1D5XC 2WINB 1KLUD 1NR2A 1YNJD 3MZ5A 4RGOS 1RHPA 3FPPA 3NHHA 4ZUJA 1JOKA 3G6JB 4ZKCB 2BE5C 3I4LA 4ABNA 1GUTA 5CBEE 4K6DA 4A3IB 1XX8A 4MN3A 2VXWA 2IX0A 5I9PA 2KQ3A 2EY2A 3QOLA 2JP1A 3FMCA 3CKIB 3MA2B 5M5WB 3I4MB 4FXKC 2A74C 1E2WA 1LTTD 1SE4A 1STBA 2PNRC 4DA2A 1HPCA 3J7AF 2PW5A 1A6XA 3J7YW 5J22A 1TY2A 4F8MA 4K5XA 3FPUB 3HEJA 2MHVA 1B9MA 2EZVA 3GTPB 1EY9A 2E2JB 2RA4A 1BCPF 4C3JG 5HGTA 5EKLA 4Q0FA 1LABA 3K5OA 2XWJB 2Q8IB 5EBDA 3HOVB 4DK1A 2F0UA 4DNRB 3J80E 1I4QA 3QB3A 1TS4A 3NSWA 1SYGA 2KECA 4FF4A 4RKBA 4X3UA 4DGZA 3R2IA 1UNSA 1ET9A 5JJZA 3DEOA 3V05A 3IAYA 5M5XB 5I4DA 5I2YA 1MSHA 2ENBA 5C44B 4Z9CB 4XT3B 2ZXRA 2Q8TA 1DOLA 4Q5VA 2A69D 3PIO3 1M4VA 3EQLC 4HTHA 3OPOA 1CA5A 1DD2A 4ME5A 1F9RA 5D65A 3NP8A 4BBSB 2OT2A 2F1MA 1CI3M 3DHQA 1BO0A 4TRDA 1WVLA 1SE3A 3T16A 2PMZB 3GTJB 1HUNA 3TZUA 4GZYC 1ONLA 4G57A 2NUCA 5IGGA 5DNFA 3NWTA 1H9RA 2EDGA 3VR3A 2Z8LA 1ENAA 2B8FA 4L8JA 5FLXL 5EKIA 1LT6D 1EY5A 1SFOB 1U4MA 4O42A 2O5IC 1J8IA 5JEAH 2PCFB 2F0OA 4IUNA 2NVXB 4FF1A 2SOBA 4MIUA 1JWUD 2MP1A 1QOHA 1STGA 1TS2A 2BE5D 4HMJA 3VA5A 2WIIB 1G291 2F0DA 2PQEA 5G3LF 4IZ8A 3PV0A 4OHJA 1F9QA 5T1GA 2G9HD 1NAPA 3CQZB 4ZUIA 4G4KA 1V8QA 2NVYB 4CJ1B 2E2HB 4HCEA 3GTQB 3MXUA 1JCKB 1PRTC 3OSOA 1PFMA 1PTOB 2KVMA 3GQBA 4NDXA 4FF3A 1H9MA 2B2UC 1NCVA 4YIJA 2R93B 3DM1A 1WTXA 1O80A 2DNCA 1HFNA 2O4XA 2D2CC 3HOXB 1RTNA 2TSSA 1ZEQX 4A3GB 4TQUS 4FO2A 1QNUA 1CTMA 1R9TB 5A2QL 2KJXA 3GP7A 3A7LA 3FRPB 4RH6A 2F0HA 4Y7NB 4HEDA 1AEXA 4MHEA 2L9HA 4ZKBB 3RUZA 3JAML 5FO8B 5BN4A 1QILA 1SNCA 1CHPD 2E76C 1LT3D 4IN3A 2LFNA 1I6VC 3SK5A 3G7LA 1RCVD 4PMBA 1R4QB 5ELFA 1WTQA 2TMPA 3NBHA 2XRQD 1E2ZA 4IUQA 2BDNA 5IGFA 2NVQB 4FNFA 1AW7A 3MFYA 3M85A 3FKIB 4E6IA 4KJNA 1CM9A 2X6GA 1C4QA 2L11A 2RDGA 1ET6A 3EVQA 2VB2X 3D31A 4XQQA 3LX0A 4IUTA 4LJZC 3PUYA 1Q90A 1SYFA 1RF2D 1STHA 2B2YC 3KF8A 5LL6S 5KEEA 1PRTF 3H0GB 1SXTA 2PYKA 4KV6A 4K2KA 3R8BA 3E0JA 3K7AB 1QNKA 2A6HD 2IL8A 3PUWA 4PNYA 1GJXA 1PYWD 3TSSA 5JVH3 3M7GA 1BUVT 4L6TB 5D3IB 1CZWA 1LTSD 1OXXK 3QJYA 2LMCB 4K5VA 2E75C 2EXZA 4X3TA 2IX1A 2JA5B 5LL6X 1BCPB 2ICIA 1STEA 3K57A 4A93B 1LT4D 3T51B 4DN4M 3A8KE 3R93A 4KD3A 2IPKD 5D14A 5C3XA 1O7ZA 5CORA 2B2UA 3EA6A 4RAUC 1F9SA 2JA6B 4AYBB 4KD4A 5KRUA 2EYFA 2NBFA 2F0TA 1PZKD 2F0PA 2I46A 3MAQA 5I6YA 1GHKA 1F2ZA 4C3IB 2CQAA 3RZOB 3K58A 1PTOC 4BY1B 4RA8A 1OXUA 3H3VC 4EQPA 3FEWX 5E4XA 1UEAB 4X3SA 3PIP3 2B2TC 2EOTA 5IGDA 1PTOH 2LY7A 1Y1WB 5IGCA 2F0KA 2B2VC 1WTWA 5C0XH 2NN6I 1B50A 1JC7A 4KHZA 3URYA 3HOWB 4EVOA 2F03A 1STYA 4F88A 5C3EB 4H13C 3RD4A 1JWMD 5EPLA 1AN8A 3DEPA 1FNUA 3ERQA 4QCLA 1K8OA 2NN6G 3TP5A 1DZ1A 3UI2A 3K6OA 2N55A 4F7XA 2WAQB 2J7ZA 3D6CA 3SEBA 2VUMB 1Y8PB 1KDAA 1SNMA 2KEDA 1RJTA 1D6EC 4IFDG 2JA7B 2Y0SB 5CV8A 4CKBA 2DY8A 2R7ZB 5ELCA 1GOZA 2AQ2B 1EY8A 5DM73 3Q0AA 4ZLTF 1EOTA 1S5BD 4KKTA 1G2SA 3U9OA 1SYCA 2SNMA 4DAVA 2JEBI 1TS3A 3Q6SA 4IUPA 3ND8A 1CQFA 4OO1H 3HS0C 5CV9A 4RGNA 3P1HA 2SDFA 1RKNA 2K5DA 3SK8A 4RKLA 4XT1B 3AMUA 5K36H 1OXSC 5CYUA 2QILA 3WDNA 3D6WA 1BCPC 3S14B 4RCNA 3R3OA 3SE0A 1PTOD 3HGBA 1EIHA 1BOSA 4V190 1ENCA 2BA0A 4C2MB 3A56A 1E0BA 3F2UA 2FINB 1ESRA 3NXWA 1S4ZA 1XTCD 1SE2A 1EY4A 2B2TA 5I2XA 2XIWA 4DXFA 3GTMB 3GTGB 3QO2A 1JQYD 5JPMC 4N9TA 2HUGA 3EROA 3GV6A 2B2VA 4LAAA 4HN7A 5C4HA 3T56B 1Q8IA 2D5DA 2K1BA 1AFPA 1K8MA 2AWOA 3ZYYX 4A3MB 1HTLD 5J1ZA 1PRTB 3NE5B 1FYCA 4C3IG 4OGQC 2F0EA 1CFMA 2F3VA 2NB0A 2WKDA 4RGMA 1HCZA 3HKZB 1VF7A 2OXPA 4R8NA 2EY5A 2G9DA 2I07B 1KABA 3IFDA 5JOBA 1O78A 3VYSA 3KLSA 3KUPA 2K33A 1U4RA 2H4OA 1CT1D 2L5TA 3MC0B 1B9NA 3HZXA 2FMMA 3OW7A 4WJWA 2K05A 4K8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 H;  1DCZ A;  3BG3 A;  2CW0 C;  3MXU A;  3DXJ C;  4G7Z C;  4G7H C;  2B8G A;  1SMY C;  5K36 H;  1OXS C;  3CRK C;  3N6R A;  4LJZ C;  3PUY A;  1Q90 A;  3WDN A;  3M7N A;  2O5J C;  1YNN C;  1TU2 B;  4KKS A;  5C0X H;  1T5E A;  2NN6 I;  3PUX A;  4KMU C;  1GHJ A;  3KLR A;  1VDZ A;  4XIG S;  4JK1 C;  4LK1 C;  4RCN A;  5BN5 A;  3GQB A;  3QG1 A;  3SE0 A;  1H9M A;  5KNC A;  1TKW B;  3A7A B;  4KHZ A;  4DNT B;  5BN3 A;  3HGB A;  2A6H D;  3VR2 A;  3PUW A;  1Y8N B;  1HTP A;  1GJX A;  4IFD H;  4H13 C;  2DNC A;  1Y8O B;  2E74 C;  1IW7 D;  3W3A A;  3IKJ A;  1EWH A;  4BA1 I;  4OO1 G;  2A69 D;  4XTC S;  2BA0 A;  3EQL C;  2K7V A;  2D2C C;  2AUK A;  3OPO A;  1H9J A;  1OXX K;  1Z7T A;  3QJY A;  2QF7 A;  2LMC B;  4I7Z C;  4PV1 C;  3D4R A;  1DD2 A;  1K8O A;  2E75 C;  3VR6 A;  1DXM A;  2A68 C;  4H44 C;  4TQU S;  2NN6 G;  2PPB C;  1CTM A;  2D62 A;  2V4D A;  5K36 G;  2KA7 A;  1BDO A;  2F1M A;  3FPP A;  1CI3 M;  2DNE A;  3ND9 A;  3VR4 A;  5KNB A;  2DN8 A;  3A7L A;  4JBW A;  5C0X G;  4KN7 C;  4KN4 C;  1V43 A;  1HQM C;  2JXM B;  2BE5 C;  3T51 B;  3A8K E;  3TZU A;  4GZY C;  2A6E C;  3I4L A;  1ONL A;  2YYZ A;  1GUT A;  3LWU A;  2JEA I;  1Y8P B;  3GD7 A;  3T56 B;  3AB9 A;  2D5D A;  4IFD G;  3P20 A;  3CRL C;  2A6H C;  4BA2 I;  1H9R A;  2EDG A;  3H94 A;  1IYV A;  3VR3 A;  1K8M A;  2AWO A;  1GUN A;  1OXV A;  5BN4 A;  3LNN A;  2A69 C;  1Z6H A;  2B8F A;  4L8J A;  3A8I E;  1ZKO A;  3IFT A;  3NE5 B;  2E76 C;  3PUV A;  3PUZ A;  1FYC A;  4KI0 A;  2AUJ D;  3FMC A;  4HR7 B;  2O5I C;  1O7L A;  4OGQ C;  5JEA H;  1GUO A;  3VA7 A;  3VR5 A;  1CFM A;  1E2V A;  1Q1E A;  1I6V C;  2PCF B;  1VF5 C;  2A68 D;  1E2W A;  2PNR C;  5KND A;  1HPC A;  1HCZ A;  1GHK A;  2EJG C;  4IQZ A;  1H9S B;  4KKU A;  3QIA A;  1H9K A;  1VF7 A;  4KKT A;  1Y69 U;  1A6X A;  1VCI A;  1PMR A;  1IYU A;  3T53 B;  1E2Z A;  2JE6 I;  2BE5 D;  1OXT A;  2JEB I;  1O78 A;  1OXU A;  2A6E D;  2K32 A;  3U9S A;  1B9M A;  1IW7 C;  3I72 A;  1QJO A;  1G29 1;  2EJM A;  2BA1 A;  3MFY A;  3RLF A;  3M85 A;  2BDO A;  2IT1 A;  1H9S A;  5A35 A;  1Q12 A;  2K33 A;  4G7O C;  3ND8 A;  3PV0 A;  2EVB A;  4H0L C;  2L5T A;  3SDZ A;  4OO1 H;  1B9N A;  1FR3 A;  2KCC A;  3M4Y A;  4TKO B;  2EJF C;  1LAB A;  3BDO A;  3OOC A;  3A8J E;  2R6G A;  1GUG A;  1GUS A;  2Q8I B;  3L7Z C;  1YNJ C;  1ZYR C;  4DK1 A;  1Q1B A;  3I73 A;  4DK0 A;  1V8Q A;  4DNR B;  3OW7 A;  1LAC A;  5JEA G;  3D31 A;  2ZT9 C; 
#chains in the Genus database with same CATH topology
 1XMQ Q;  4DXG A;  3E9I A;  3HOW H;  3CC4 A;  1BQQ T;  3AEV A;  2B8G A;  4JI0 Q;  1SYE A;  2KEE A;  3N6R A;  1PA6 A;  3EJI A;  5C3E H;  3M4P A;  5LMN Q;  2EXD A;  4M8A A;  3PUX A;  4IOA A;  2KCM A;  2MGS A;  4CJ0 B;  2NTS A;  4RHR A;  1PH4 A;  4JI8 L;  3C1F A;  1HTP A;  1MJE A;  5FLX E;  4RGT A;  4F87 A;  1CA6 A;  5FKA C;  1IKM A;  1JT8 A;  5JAV A;  1CKN B;  1L0W A;  5IP7 H;  2EYO A;  3K59 A;  3T1Y Q;  1W6K A;  2VQE Q;  3NEL A;  3OMG A;  3I3C A;  2XNA C;  1WOC A;  1I94 Q;  2PPB C;  1RIP A;  4IUU A;  4OWW B;  4BY7 G;  3RZD B;  5I9O A;  2VUM G;  3P7J A;  3VR4 A;  2JA7 H;  1SNQ A;  1WCM B;  4HSV A;  3MFG A;  3BVZ A;  2KOL A;  3KK7 A;  4LW1 A;  1KNA A;  1HQR D;  4IPC A;  4I65 A;  4J6H A;  1BCP D;  3LWE A;  2VW9 A;  3GTO B;  1BR9 A;  1EZ6 A;  1Q3L A;  1ZXT A;  1I50 B;  3GD7 A;  4JI2 L;  2R7Z G;  2RDF A;  4FXD A;  3H94 A;  4X3K A;  3VYT A;  1OXV A;  3BDL A;  2L15 A;  4B3S L;  3NK9 A;  1EWC A;  1ML0 D;  1GUO A;  1ICW A;  4C1N K;  1D8L A;  4LF5 Q;  4K2L A;  4IQZ A;  1L1O B;  3S16 B;  2Z6K C;  4CDD C;  2MO0 A;  2XGT A;  1KTK A;  1YNX A;  3G71 A;  5KYI A;  1SNP A;  1V1Q A;  2EE1 A;  4FP5 D;  4A3J H;  2L0C A;  3CCV A;  4R4I A;  4LF6 Q;  5FK9 C;  4N8F A;  2OEO A;  1QVC A;  5ELE A;  3M3Y B;  1I3Q H;  1M8A A;  2LXK A;  3I90 A;  5CV4 A;  1O7Y A;  4DAY A;  2RBM A;  3PO2 B;  2SEB D;  1X9N A;  2IX3 A;  2F0J A;  3J81 E;  3S14 H;  4B9X A;  2CH4 W;  3MXN A;  5JEA G;  3AU7 A;  3KJO A;  4BWG B;  1UAP A;  1PH1 A;  3M4O B;  1SMY C;  4AH6 A;  4R9W A;  4KY5 A;  2M2L A;  1VQ8 A;  5F2D A;  3PF4 A;  3PSI A;  1K3R A;  1T5E A;  2AWN A;  2K5W A;  4C2M H;  2RHQ B;  2F3I A;  3TBI B;  4A75 A;  2RCF A;  2RVL A;  4ZQ3 A;  3VYR A;  3DLL A;  1XPR A;  1XNR L;  1NJI C;  2RSN A;  4CHT B;  3HKZ E;  2A1A A;  2C9O A;  2PZT A;  1NSN S;  1WTP A;  4JI7 L;  2RDH A;  3GTG H;  2XTI A;  4ILW A;  1I4H A;  4A3B G;  5DEH A;  1G2T A;  1ICF B;  1W6J A;  3Q23 A;  1EQR A;  1KDB A;  3S2H B;  1F77 A;  1DXM A;  5NUC A;  2ASB A;  3CP0 A;  1SJH D;  2JYO A;  5E7N A;  1D1I A;  2DNE A;  5ELB A;  3M9B A;  3T4A C;  1NY4 A;  2ID0 A;  4P71 A;  1EIF A;  3PQI A;  4QUF A;  5G3L D;  1V43 A;  4H7B A;  2JXM B;  4A3M H;  3K5L A;  4KHP L;  4IJH A;  4TSS A;  1J6Q A;  3ICE A;  3LWU A;  1TT2 A;  4DR7 L;  1VQM A;  1SNO A;  1B2T A;  5JPN C;  1AZP A;  2I5H A;  3L0O A;  3K5N A;  4DR3 Q;  5C4X B;  2PZU A;  1GUN A;  2LKV A;  5ISR A;  1K0S A;  1B70 B;  5C5M A;  1TII D;  1FGB D;  2F0L A;  1EIY B;  3HKZ G;  1K83 H;  4OEL B;  3I91 A;  2F0S A;  4LFA L;  1XNR Q;  1MD2 D;  3CCL A;  3DUZ A;  2EJG C;  5FO9 B;  2FXQ A;  3HOU B;  3U4V A;  2HQL A;  4JI7 Q;  1L0Y B;  1H9K A;  2WAC A;  4GLV B;  1JJC B;  4DAM A;  4LFC Q;  3F1Z A;  1VQ5 A;  3A5U A;  1YIT A;  3NTI A;  3GO5 A;  5CV6 A;  1Y1V B;  3I4M G;  4QJF A;  1X3G A;  2VQF L;  1TY0 A;  1DON A;  4TKO B;  1WTR A;  3BDO A;  3MWY W;  4S3S A;  3A8J E;  1GUG A;  4IPD A;  4K8J A;  1KDC A;  2L4N A;  1ZYR C;  4KJO A;  2UUB L;  1LT5 D;  3A0J A;  4KHP Q;  1G6Z A;  1Y14 B;  3JAM i;  1N32 L;  1BBU A;  2N3S A;  3DMU A;  3GTK B;  2PNH A;  4DR7 Q;  2OF1 A;  4OEM B;  3OW2 A;  1EQT A;  1VQD A;  2J0T D;  1Q82 C;  1YNN C;  2QCP X;  1EY6 A;  4JK1 C;  2YTX A;  3BDC A;  3HOV G;  1CHQ D;  1G8Z D;  5KYL A;  2FJ2 A;  1NR4 A;  1SBB B;  1MGS A;  1KRT A;  1JE4 A;  4DNT B;  5BN3 A;  4LUV A;  4NMZ A;  5EPK A;  3W2D A;  1HZC A;  2DUD A;  2CWP A;  2Z6K A;  1Y8O B;  2OCE A;  1I4R A;  3IKJ A;  3KDF B;  3I7F A;  4LFA Q;  4XTC S;  5IGE A;  2K7V A;  1WCM H;  2FMC A;  4QY7 A;  4C3H H;  2F0Q A;  3QWN A;  5JEA J;  4PV1 C;  3D4R A;  1I4P A;  4X66 Q;  3GTO H;  4P75 A;  2UU9 L;  1TWG B;  4CDC C;  1I50 H;  4DK6 C;  5C44 G;  3JC6 6;  1HQM C;  5ELD A;  2ATW A;  3C2P A;  1FNW A;  3NQI A;  2D9U A;  2UUB Q;  4MZ9 A;  1TWH B;  3MHB A;  1Q7Y C;  4BBS G;  2H5X A;  4ZYS A;  3IL8 A;  2NYZ D;  1A63 A;  4K14 A;  3OWE B;  2F0G A;  1QE6 A;  2E5L Q;  4TVA B;  1CK1 A;  3LNN A;  3SVM A;  2WP8 J;  5EJW A;  4DK3 C;  3IFT A;  3PUV A;  1D2B A;  1KD1 C;  3NTK A;  2BH8 A;  1IYJ B;  5FLX c;  3T1H L;  3HOZ B;  1VQF A;  3VA7 A;  3VR5 A;  1PRT D;  2EY6 A;  1E2V A;  4WOR A;  5CMD A;  4X6A H;  4IOC A;  4DFA A;  1F2M A;  1H9S B;  1JE5 A;  5FJ8 H;  2ZXO A;  2B63 B;  1KRS A;  1S40 A;  1TVX A;  3P75 A;  1HHV A;  4A4I A;  2K6A A;  3E5S A;  3PO2 G;  2NWG A;  1G91 A;  2EYJ A;  2IT1 A;  2UU9 Q;  1PLF A;  3OIQ A;  5M5Y H;  1CKO A;  1LLR D;  1EYC A;  3RMH A;  1CQV A;  3SDZ A;  3M4Y A;  4ZK9 B;  3OWF A;  3OOC A;  2R6G A;  1Z47 A;  1EEI D;  3I73 A;  3MVV A;  2VL6 A;  3BZC A;  5IT9 E;  3HOY H;  1LAC A;  2PI2 E;  1QG7 A;  3CU7 A;  2EYM A;  1EQV A;  1N34 L;  1S5F D;  2F0N A;  1MBY A;  4V0B A;  3CRK C;  5CV5 A;  1VS0 A;  3NEM A;  3M7N A;  5EBC A;  1B3Q A;  3OHX C;  1QWY A;  3H3V I;  1TQO A;  2XWB B;  3MXN B;  5EGT A;  3QG1 A;  1EU4 A;  2EPB A;  5C0X I;  3S2H H;  4PMC A;  4B3T Q;  1VQN A;  1Y8N B;  1IHZ A;  3U4Z A;  2OQK A;  4DAP A;  1K0R A;  3E6Z X;  1FGU A;  5GQO A;  1SE8 A;  2F0M A;  3BU2 A;  4DV1 L;  1H9J A;  4ZRZ A;  4GN3 B;  1Q46 A;  1WD0 A;  5M3M B;  1ZYR D;  1WTV A;  5BR8 L;  4GNX C;  2D62 A;  2F52 A;  4HMI A;  2H1E A;  3A54 A;  1CKN A;  3J81 c;  1UWV A;  1YI2 A;  5IYD H;  5C0X G;  5C4X H;  1SR3 A;  4L5R C;  3HOX G;  4HCS A;  2HIV A;  1B8A A;  1VQ9 A;  3NQT A;  3BYT B;  1EYG A;  1C0A A;  2GA4 B;  1ESF A;  1HUM A;  1YNN D;  3B6Y A;  3SR1 A;  4RMF A;  3RNU A;  4HJ7 A;  4QUC A;  5GAE C;  1D5Z C;  4NW2 A;  4FVM A;  4IFD I;  1Z6H A;  3HOU H;  2Z6B A;  4K5W A;  3D3R A;  3W1B A;  3HRZ C;  1ZKO A;  2HCI A;  3FVQ A;  4KI0 A;  2AUJ D;  3HOU G;  2R92 H;  3R2T A;  2RSO A;  1ILQ A;  4CKE A;  1TWA H;  1PH9 A;  4DKA C;  4RCO A;  4JW0 A;  4C3J B;  3WOF A;  4XDX A;  4HAE A;  3QIA A;  4LFB Q;  3KLW A;  1Y1V G;  4OWX B;  2B2Y A;  4YCU A;  1PVO A;  4DV1 Q;  3H15 A;  1CUK A;  3I72 A;  4QMG A;  1E3P A;  3NPP A;  4UP9 A;  4BS9 A;  1LTA D;  4X64 L;  3GTK H;  1I6H H;  1L1O A;  2QW7 A;  5BR8 Q;  4O1N A;  5I6W A;  3M4Q A;  1A0I A;  2EJF C;  2BOS A;  3CPF A;  1JIC A;  3L7Z C;  1MSG A;  1N36 L;  1J9O A;  4FF2 A;  4OO1 I;  3A5Z B;  3TQY A;  2ZJP A;  5JJI A;  3KBG A;  5DLQ E;  3FKI G;  2EIF A;  4WRD A;  3KBX A;  5CR3 A;  2L1B A;  4N9P A;  3S24 A;  3STB D;  2XN9 C;  4JI1 L;  5H1S E;  1FJG L;  2RQX A;  1HJP A;  2ZM6 L;  2HCC A;  1XPU A;  2WKC A;  3MEF A;  1PFB A;  1TWG H;  2PO4 A;  3VR2 A;  1TWF B;  1BBX C;  1BNZ A;  4JI3 Q;  3SGI A;  2HDM A;  4OO1 G;  4A3J B;  3EN2 A;  4DV2 L;  4K6L A;  2KEN A;  1I3Q B;  3H0G G;  4FYD A;  2OWO A;  4BXX G;  3VR6 A;  1F2L A;  2HHH L;  5K36 G;  1TWH H;  1NMF A;  1BDO A;  1LYL A;  2HD3 A;  4X64 Q;  4OON A;  4JBW A;  3BYY B;  4B3M L;  3RLN A;  2RCN A;  2YYZ A;  4A3L H;  1KNE A;  1T5X D;  1QVF A;  1TS5 A;  3HOZ H;  3EFX D;  1IYV A;  2X6L A;  3H6M A;  2A69 C;  4FDB A;  4A93 G;  4DR6 Q;  3AFP A;  1HFG A;  2B63 H;  3A8I E;  3KJP A;  4JI1 Q;  1N33 Q;  2K04 A;  1FJG Q;  1EYA A;  1MJC A;  3K81 C;  2PI2 A;  2YU9 B;  1Q1E A;  4X65 L;  3KLS X;  4RHS A;  1LTI D;  5T1I A;  5C0X J;  5KND A;  2K52 A;  4RG1 A;  1U4P A;  3MXG A;  5JJK A;  4GNX A;  1VCI A;  2JA6 G;  1U4L A;  3LGJ A;  3T53 B;  4DV2 Q;  4AYB G;  1AE2 A;  2EYP A;  2FFK B;  1GO3 E;  4ULL A;  3NEN A;  2BA1 A;  3OIP A;  3KF6 B;  4DV7 Q;  2EY1 A;  4DNI A;  1KAA A;  1EY7 A;  2N8N A;  2JA8 H;  3I4N B;  2QEJ C;  5CBA E;  4IPG A;  5IP9 H;  3I55 A;  4A3K B;  4CKC A;  2JSO A;  5IYC H;  1TWC B;  2R61 A;  4POF A;  1YHA A;  2K01 A;  1K83 B;  1TR5 A;  4IFD J;  1BXT A;  1GHJ A;  1EIG A;  4ZAI A;  3TME A;  2UXB L;  1Y1W G;  4NP5 A;  3ER0 A;  1VMP A;  5M3M H;  1LTB D;  5CV7 A;  5GAG C;  4J1M A;  1RTO A;  2E74 C;  1HA5 A;  3W3A A;  5M3M G;  3F2C A;  4X65 Q;  3S1N H;  2AUK A;  4DV5 Q;  5LHY 1;  2QGQ A;  4EQ5 A;  3TP6 A;  4I7Z C;  3EIV A;  3TP8 A;  1XYI A;  4RWS C;  3NBI A;  1VQ6 A;  3HOW G;  3KDF A;  1DM0 B;  1EEF D;  2V4D A;  1J5E L;  3BS1 A;  4QF4 A;  2MO1 A;  1NTG A;  2QKI C;  5C3E G;  1E1T A;  5IT9 c;  3ONA B;  4HJ5 A;  4KN7 C;  4GOP B;  1AZQ A;  3IRB A;  2X69 A;  3UDG A;  5E3F A;  1A3V A;  2K5Q A;  3AFQ A;  1ENF A;  3S15 B;  4YWM A;  2B39 A;  2XVS A;  2HQE A;  4LMQ D;  3N52 A;  2K50 A;  3AQQ A;  1PDQ A;  3CRL C;  4UY8 C;  2C35 B;  2AKW B;  2J4X A;  1EY0 A;  5IP7 G;  4C3J H;  1V1P B;  2WAQ G;  4J15 A;  3T13 A;  1I5F A;  3PUZ A;  5C4J B;  4DR5 L;  5IIF A;  4C3H B;  2CHB D;  3C1E A;  1LTL A;  3CD6 A;  5TSS A;  2JA7 G;  2Y0S G;  5IOC A;  3K7U C;  3WOE A;  1PZJ D;  1GKH A;  2F3W A;  3CHB D;  1KAW A;  1OTC A;  1CKM A;  1OO9 B;  4U67 3;  2KUM A;  4GLX A;  3TS0 A;  2AMC B;  1F9P A;  2K32 A;  2WB1 B;  2QDL A;  5FLM H;  3U9S A;  4J8Q A;  1E24 A;  4LUO A;  1H9S A;  5A35 A;  4HIO A;  1SSO A;  2EVB A;  1WD1 A;  5LMU L;  1L0X B;  1KL9 A;  1C48 A;  4DR2 L;  2ZTC A;  1VQL A;  4WJ4 A;  1LTG D;  2ICE C;  4JBK A;  4CJ2 C;  4JI8 Q;  2E2I H;  2E2D C;  3D4D A;  3MTS A;  2IJ0 A;  1PYS B;  2NVT H;  1TWF H;  3DWQ A;  4IAL A;  1SJE D;  2DY7 A;  2N88 A;  1R4P B;  2VNU D;  3OMC A;  4OX9 L;  2K03 A;  2K28 A;  4A3F B;  5HY6 A;  1YJ9 A;  4NXM L;  2QDB A;  3NUC A;  1SRU A;  4A3J G;  3A7A B;  1S5E D;  3MXP A;  3S17 H;  4CDE C;  2GN5 A;  5A2Q E;  3PO3 H;  3L9A X;  4NPS A;  1UUP A;  3J81 j;  1YBY A;  2WFW A;  4R1J A;  5M5Y B;  2QF7 A;  2AQ3 B;  3NTH A;  2IHF A;  4JI2 Q;  3BVM A;  5J39 A;  2LS0 1;  1QUQ A;  4JV5 L;  3HOY B;  3J80 L;  3GTL B;  2CQO A;  4UAI A;  1I4X A;  2D0P A;  4OL7 A;  3JAM E;  2NZO A;  5M9O A;  4H02 A;  4B3S Q;  4DR2 Q;  1M1K C;  2KCN A;  5C3W A;  1ROD A;  4JI6 L;  2JEA I;  1GUW A;  1U9R A;  4HSP A;  2UUA L;  3Q22 A;  4CBV A;  1EWI A;  2RF4 A;  2VB3 X;  4JG2 A;  1NE3 A;  2YU9 H;  1B44 D;  3K8A A;  2A6H C;  2F0F A;  5E4W C;  3D8G A;  2IWH A;  3V2T A;  2Z4H A;  4L63 B;  5DAU A;  3EBE A;  5HUR A;  1VQB A;  3X3M A;  1SEB D;  4NXM Q;  1EL0 A;  4DF7 A;  1A3U A;  1IL2 A;  2ZTD A;  1FD7 D;  1VF5 C;  4XYO A;  5CGK A;  1SMX A;  1X56 A;  4KKU A;  4A3M G;  5EKK A;  1MI2 A;  4FXG C;  3I4N H;  1KHI A;  1U0L A;  1A15 A;  3CMA A;  4A3K H;  1LV9 A;  1IW7 C;  2BCO A;  1QJO A;  2IHE A;  4MTN A;  1GM5 A;  1PYB A;  1TWC H;  4A3D B;  2KCC A;  4GNX B;  4JV5 Q;  1XWE A;  4RFB A;  2NZ1 D;  4P72 A;  3TN2 A;  1B4O A;  4DK0 A;  2MUY A;  1PFS A;  2ZT9 C;  2A8V A;  4XXE A;  3CF5 A;  1HA6 A;  4JI6 Q;  2CW0 C;  1E22 A;  2UUA Q;  1DOM A;  2R92 B;  3HKS A;  1JOR A;  4ODG A;  2O5J C;  4A3I H;  1KLG D;  3J81 L;  4KMU C;  1TWA B;  4GOP C;  5BN5 A;  4XIG S;  3F2B A;  1V9P A;  2N78 A;  4XQJ A;  5KNC A;  1TKW B;  4R8I A;  1N9W A;  1FVI A;  1HNZ L;  1K73 C;  2K5N A;  2Z0S A;  3K0Y A;  2KBN A;  2G5D A;  4B3R L;  2ZJR A;  2WB1 E;  3SHL A;  5KGU A;  1I6H B;  3W1G A;  4H44 C;  2A68 C;  5M3F B;  2BH2 A;  3S15 H;  1PZI D;  1UE5 A;  2MPM A;  3S9W A;  1IXR A;  4XQN A;  1P16 A;  1I4G A;  5FO7 B;  3BJU A;  2KHJ A;  5C5L A;  1SND A;  1PH8 A;  3H91 A;  1PXU A;  5C4J H;  1JB3 A;  3O13 A;  1C8C A;  1X3Q A;  1EZ8 A;  3P20 A;  4BA2 I;  1WCM G;  4C1N I;  4C3H G;  3K0X A;  5EPJ A;  2F0I A;  2LSS A;  4A76 A;  1DOK A;  2PZW A;  2EQS A;  2MJ8 A;  4KTA A;  3A55 A;  3D4W A;  4B9W A;  1SMY D;  1S5C D;  2VQF Q;  1CZG A;  1EYD A;  2F0W A;  2K5V A;  2I5M X;  2WB1 G;  1WTO A;  2K5H A;  1JWS D;  1HNZ Q;  1PMR A;  1IYU A;  4BBR B;  2JE6 I;  1N32 Q;  3FDT A;  4JYA L;  2HDL A;  4LF7 L;  1LO5 D;  1ILP A;  1A2T A;  3DWP A;  1DJR D;  2CVR A;  4G7O C;  1M90 C;  1N8R C;  2Z1C A;  3TP7 A;  1GUS A;  3SXH A;  4A3F H;  2SNS A;  3PMF A;  1SYD A;  3KF6 A;  3J7A 5;  1BF4 A;  3BVG A;  2LXJ A;  1B7Y B;  5JVG 3;  4AIM A;  1DCZ A;  4IO9 A;  3GDE A;  2FHT A;  4ID6 A;  1S3O A;  3SK6 A;  3TDQ A;  5FJ8 G;  3X3N A;  2O2L D;  4ALP A;  1VDZ A;  3SK4 A;  1A2U A;  1IBK L;  3UDF A;  4APV A;  4NKL A;  4WFN 3;  1SDF A;  3CCU A;  5C4Z A;  1GXD C;  3VDY A;  3I70 A;  1IW7 D;  4BA1 I;  1SFO H;  2B2W C;  2UXC L;  1EFI D;  3GTL H;  5IE8 A;  1PH3 A;  4WJ3 M;  3HOY G;  3PGZ A;  1DGS A;  1IL8 A;  1K8A C;  2NVX H;  4A3E B;  4KHV A;  2JA8 B;  3F2D A;  2M00 A;  5E1F A;  4JYA Q;  2OTL A;  1JR0 D;  3I8Z A;  1IKL A;  3S1R B;  4P2C B;  5EQ0 A;  5KNB A;  5FOB B;  2CW0 D;  3U58 A;  4KN4 C;  5IOD A;  2IY5 B;  5JJL A;  2XRS D;  3G48 A;  3QOJ A;  1VQC A;  3T1H Q;  2A6E C;  3S1Q B;  4YCV A;  1MIU A;  1PFN A;  4YHH L;  4A3C H;  1STA A;  4UP8 A;  1LTR D;  4AQY L;  2PW7 A;  1QUQ B;  1Z9F A;  3CAM A;  3S1M B;  4QIW B;  3AB9 A;  2KHS A;  1WI5 A;  2VZA A;  3ITP A;  2K14 A;  4GOP A;  2Q8R E;  2F4I A;  2VS1 A;  2OTJ A;  1PH2 A;  2UUC L;  4M1U B;  2E2H H;  4QQB X;  4UP7 A;  2B3G A;  3S1N B;  3C46 A;  1EOV A;  1IBK Q;  2NZH A;  2A73 B;  4DR1 L;  2GVB A;  2A68 D;  5IYD G;  1BVS A;  3DWA A;  1V1P A;  4A3D H;  5C4X G;  1RD9 D;  3K80 C;  4DV4 L;  3L3O C;  3PF5 A;  4IUR A;  2R93 H;  5CC4 A;  2EYL A;  1N34 Q;  3Q24 A;  1FNV A;  3RLF A;  4IUV A;  2YTY A;  3JAM c;  1YJN A;  3S2D B;  4YWL A;  4PQX A;  1Q12 A;  1P8L A;  3A74 A;  4MNO A;  1AP0 A;  3V96 A;  4A3G H;  5K5P A;  5AFW A;  1YNJ C;  2R92 G;  1X6O A;  2MNA A;  4L5S A;  4YHH Q;  2NN6 H;  4G7Z C;  3DXJ C;  4G7H C;  4AQY Q;  1V1O A;  1SYB A;  1JOQ A;  3W5O A;  2Q2I A;  4UDU C;  4GS3 A;  1TU2 B;  4KKS A;  1II3 A;  4XYQ A;  4OIK A;  3VYU A;  5IT9 L;  3KLR A;  2UUC Q;  2UXD L;  4LK1 C;  5EAY A;  3J7A V;  1D1K A;  4BY7 B;  1QB5 D;  5M3F H;  3OTO L;  1A3T A;  3CC2 A;  4IFD H;  1L2F A;  1MHW C;  1EWH A;  1VMC A;  3FP9 A;  1DYQ A;  4DU9 A;  4DR1 Q;  1SAP A;  4CGY B;  2AQ1 B;  2N49 A;  1ASY A;  1Z7T A;  5GRO A;  2JK8 A;  3UDX A;  2ZXP A;  1S72 A;  4IPH A;  2L55 A;  1HRJ A;  2XSC A;  4JBM A;  2KA7 A;  5IYB H;  2I0Q A;  1KIX A;  3ND9 A;  1RDP D;  1X3P A;  2DN8 A;  1X32 A;  2L12 A;  1JMC A;  2E2I B;  2DJF C;  5HGQ A;  2RKS A;  4R4Q A;  1D5M C;  2NVT B;  4K0K L;  1G6P A;  3UE1 A;  1VQE A;  4HIM A;  2C5C A;  5KIX A;  2A5H A;  1JOO A;  3BZD B;  3G4S A;  1EU3 A;  4EGV A;  4JVZ A;  2CH4 A;  1GD7 A;  1PTO F;  3S17 B;  1VQG A;  3GV3 A;  5IGB A;  4KK7 A;  3HP3 A;  1B3A A;  4HR7 B;  3NBH B;  4BBR H;  3PO3 B;  1XMO L;  4EQN A;  1O7L A;  4QB4 A;  3K5M A;  1VQH A;  2B2W A;  3CCE A;  2K75 A;  5D3D A;  3HG9 A;  4PMW A;  1STN A;  4Y52 H;  3OTO Q;  1WJJ A;  1Y69 U;  4OIJ A;  1XNQ L;  1N36 Q;  3C3L A;  1B53 A;  1HXY D;  4A3L G;  5DM6 3;  1F2Y A;  5COY A;  2M9V A;  1OXT A;  4U68 A;  2NTT A;  3HOZ G;  2A6E D;  2Z4I A;  2Q2U A;  2WV6 D;  2EJM A;  2PQA A;  2F0V A;  2BDO A;  3TZD A;  3H09 A;  2R7F A;  4H0L C;  1B1Z A;  5C6A A;  1BBW A;  3TRZ A;  1FL0 A;  1FR3 A;  2R3Z A;  4KY6 A;  2B63 G;  1XXG A;  4QIW E;  1S5D D;  1X55 A;  2ZM6 Q;  2JA5 H;  1Q1B A;  3KF8 B;  4K0K Q;  4HIK A;  4KY7 A;  4C56 C;  3BG3 A;  4PZ6 A;  4LF4 L;  2IW3 A;  3L2P A;  2B29 A;  4A3B B;  2ALY B;  1NUC A;  4DUY L;  3PIO A;  1HZB A;  1QCB D;  4GKJ L;  2HHH Q;  4B08 A;  2EYH A;  4A3E H;  1X3F A;  1CSQ A;  3MEH A;  1XMO Q;  3NWS A;  1XMQ L;  4B3M Q;  3S1R H;  4EQO A;  2Q2H A;  4JI0 L;  4GN5 A;  2JA8 G;  1D5X C;  1SN8 A;  2WIN B;  5IP9 G;  1KLU D;  1E7Z A;  3FHW A;  1XNQ Q;  5IYC G;  3S1Q H;  1NR2 A;  4C3I H;  1YNJ D;  3MZ5 A;  1CSP A;  4RGO S;  3RZO H;  3S1M H;  1RHP A;  3FPP A;  3NHH A;  4ZUJ A;  1JOK A;  3G6J B;  4BY1 H;  4ZKC B;  2BE5 C;  3I4L A;  4ABN A;  3T1Y L;  1GUT A;  1PH5 A;  1YHQ A;  5CBE E;  4DUZ L;  4K6D A;  2RHS B;  4A3I B;  1XX8 A;  1O7I A;  4MN3 A;  1I94 L;  2VXW A;  4I7A A;  2IX0 A;  5I9P A;  2CWA A;  2KQ3 A;  2EY2 A;  3QOL A;  3ULP A;  2JP1 A;  3FMC A;  3Q8D A;  3CKI B;  3MA2 B;  1YEZ A;  5M5W B;  4GKJ Q;  3I4M B;  4FXK C;  2A74 C;  1E2W A;  1LTT D;  1SE4 A;  1STB A;  2PNR C;  4DA2 A;  1XPO A;  1HPC A;  4IJL A;  3S2D H;  2K4K A;  3J7A F;  2PW5 A;  5ELN A;  1A6X A;  3J7Y W;  5J22 A;  4LUZ A;  1TY2 A;  4F8M A;  4K5X A;  3FPU B;  3HEJ A;  2MHV A;  1B9M A;  2EZV A;  3GTP B;  2I5L X;  1EY9 A;  2E2J B;  2RA4 A;  2Q2T A;  1BCP F;  4C3J G;  4LF5 L;  5EKL A;  5HGT A;  4Q0F A;  1LAB A;  2DGY A;  3K5O A;  3E3X A;  2XWJ B;  3J7Z C;  2Q8I B;  5EBD A;  2UXB Q;  3HOV B;  4DK1 A;  3CCJ A;  1KXL A;  2F0U A;  4DNR B;  1WFQ A;  2F4V L;  5J3B A;  3J80 E;  1EQQ A;  4ME3 A;  1KC8 C;  1I4Q A;  3QB3 A;  1TS4 A;  3NSW A;  4UPA A;  4BY7 H;  1SYG A;  2KEC A;  4DUZ Q;  4FF4 A;  1HZA A;  1SLJ A;  4LF6 L;  4RKB A;  1UE7 A;  4X3U A;  2VUM H;  4JI5 L;  4DGZ A;  3R2I A;  1UNS A;  3CCM A;  1ET9 A;  1VQP A;  1PH7 A;  1K8G A;  3RN2 A;  1NNX A;  3RR5 A;  2CFM A;  3DM3 A;  5JJZ A;  3DEO A;  3V05 A;  3IAY A;  5FLM G;  5M5X B;  1J5E Q;  5I4D A;  5I2Y A;  1MSH A;  2ENB A;  1W3S A;  5C44 B;  2R7Z H;  4Z9C B;  4XT3 B;  2ZXR A;  2Q8T A;  1DOL A;  4Q5V A;  2A69 D;  3PIO 3;  1M4V A;  3EQL C;  4HTH A;  1PV4 A;  3OPO A;  1CA5 A;  1HR0 W;  1DD2 A;  4ME5 A;  1F9R A;  4HJ9 A;  5D65 A;  3NP8 A;  1TXY A;  1HNW L;  4BBS B;  2OT2 A;  2F1M A;  1CI3 M;  3DHQ A;  1BO0 A;  4TRD A;  4N8X 1;  1WVL A;  1C7Y A;  1SE3 A;  3KOJ A;  3T16 A;  2PMZ B;  3GTJ B;  1HUN A;  3TZU A;  1SRO A;  4DR5 Q;  4GZY C;  1ONL A;  2Z9H A;  4G57 A;  2NUC A;  2F4V Q;  5IGG A;  3CXC A;  5DNF A;  1YJW A;  1WYD A;  2ZTE A;  3NWT A;  3PO3 G;  1H9R A;  2EDG A;  1NBW A;  3VR3 A;  2Z8L A;  1ENA A;  4P73 A;  1ASZ A;  2B8F A;  4L8J A;  5FLX L;  4JI5 Q;  5EKI A;  1LT6 D;  1EY5 A;  1SFO B;  1U4M A;  4O42 A;  2O5I C;  1UE1 A;  1J8I A;  5JEA H;  5LMU Q;  2PCF B;  2F0O A;  4IUN A;  2NVX B;  4FF1 A;  4DR3 L;  2SOB A;  3CW2 C;  4MIU A;  1JWU D;  2MP1 A;  1QOH A;  1STG A;  1TS2 A;  2BE5 D;  3J80 i;  4HMJ A;  3VA5 A;  2WII B;  4L5Q A;  1G29 1;  1VQ4 A;  2F0D A;  1EFW A;  2PQE A;  5G3L F;  4IZ8 A;  1Q81 C;  2DJG C;  3PV0 A;  1HNW Q;  4OHJ A;  1F9Q A;  5T1G A;  4OX9 Q;  2G9H D;  1NAP A;  3CQZ B;  4A3B H;  4ZUI A;  4G4K A;  2JA9 A;  5IY0 A;  4X62 L;  3CC7 A;  1JJG A;  1V8Q A;  3GTM H;  2NVY B;  2CCZ A;  4CJ1 B;  2PQA B;  2E2H B;  4HCE A;  4LFC L;  3GTQ B;  3MXU A;  4KLK A;  1JCK B;  1PRT C;  3OSO A;  1PFM A;  1PTO B;  3I4N G;  4YCW A;  2KVM A;  1LM0 A;  3GQB A;  4A3K G;  4NDX A;  4FF3 A;  1H9M A;  2B2U C;  1NCV A;  1Q86 C;  1UE6 A;  4PZ7 A;  4GN4 B;  4YIJ A;  2R93 B;  3DM1 A;  3OYY A;  1WTX A;  1O80 A;  2DNC A;  1HFN A;  2O4X A;  2D2C C;  3HOX B;  1RTN A;  4YY3 L;  2TSS A;  1ZEQ X;  3QR8 A;  4A3G B;  1VQA A;  4TQU S;  4FO2 A;  1QNU A;  1CTM A;  1R9T B;  3KYH C;  4YWK A;  5A2Q L;  2KJX A;  3GP7 A;  3A7L A;  3FRP B;  4RH6 A;  4A3I G;  2F0H A;  4GKK L;  4O2D A;  4Y7N B;  4HED A;  4DV6 L;  4X62 Q;  1AEX A;  4X66 L;  2JQO A;  4MHE A;  3J81 i;  2L9H A;  5M5W H;  4ZKB B;  3I4M H;  3RUZ A;  3JAM L;  4LF8 L;  5FO8 B;  5BN4 A;  1H95 A;  1QIL A;  4OWT B;  4HJ8 A;  1SNC A;  1CHP D;  2E76 C;  1LT3 D;  3TS2 A;  4IN3 A;  4R4T A;  2LFN A;  3CPW A;  1I6V C;  5AJ3 L;  1UEB A;  3SK5 A;  3G7L A;  3GTP H;  1RCV D;  2E2J H;  4PMB A;  1R4Q B;  5GAD C;  4NXN L;  5ELF A;  1WTQ A;  2TMP A;  3NBH A;  2E5L L;  2XRQ D;  1E2Z A;  4IUQ A;  3PIP A;  2BDN A;  5IGF A;  4YY3 Q;  3HOV H;  2NVQ B;  1C9O A;  4FNF A;  1AW7 A;  3MFY A;  3M85 A;  4QGU A;  3FKI B;  4E6I A;  1X54 A;  4KJN A;  2PMZ E;  1CM9 A;  2X6G A;  1C4Q A;  1LUZ A;  2L11 A;  3RZD H;  2A19 A;  2RDG A;  1ET6 A;  3EVQ A;  2VB2 X;  3D31 A;  4GKK Q;  4XQQ A;  5M5X H;  4DV6 Q;  3LX0 A;  4B3R Q;  5C44 H;  4IUT A;  4LJZ C;  3PUY A;  1Q90 A;  1SYF A;  1RF2 D;  1STH A;  2B2Y C;  3KF8 A;  5LL6 S;  4LF8 Q;  5KEE A;  1PRT F;  3H0G B;  1SXT A;  2ES2 A;  2PYK A;  3ZJY C;  4KV6 A;  4K2K A;  3R8B A;  3E0J A;  3K7A B;  1PH6 A;  1L1O C;  1QNK A;  2A6H D;  2IL8 A;  3PUW A;  2MFI A;  4PNY A;  1GJX A;  4JPB W;  4BBS H;  1PYW D;  3TSS A;  5JVH 3;  3M7G A;  5AJ3 Q;  5LMN W;  1BUV T;  1EUJ A;  4R4C A;  4L6T B;  1BKB A;  5D3I B;  1HNX L;  4L5T A;  1CZW A;  1LTS D;  1VQJ A;  1OXX K;  4A3F G;  3QJY A;  4OXP A;  4P74 A;  2LMC B;  4K5V A;  3GTJ H;  4NXN Q;  1MKH A;  2E75 C;  2EXZ A;  4DV0 L;  4X3T A;  2D0O A;  2IX1 A;  3S16 H;  2JA5 B;  2JN4 A;  4B3T L;  5LL6 X;  1BCP B;  2ICI A;  3J80 c;  1STE A;  1GVP A;  3K57 A;  4A93 B;  1LT4 D;  3T51 B;  3STB C;  3A8K E;  4DN4 M;  3R93 A;  1E1O A;  3M3Y H;  4NB3 A;  4KD3 A;  2IPK D;  3CME A;  5D14 A;  3PO2 H;  3CCQ A;  5C3X A;  1O7Z A;  3UE0 A;  3ULL A;  1U5K A;  5COR A;  2B2U A;  3EA6 A;  4RAU C;  1HR0 L;  4JOI C;  1F9S A;  3I2Z A;  2JA6 B;  1K3B C;  4LF7 Q;  3M4O H;  4DV3 L;  4AYB B;  2V1C C;  4KD4 A;  1QZH A;  2GVA A;  2EYF A;  2NBF A;  5KRU A;  2F0T A;  5IWA L;  1PZK D;  2F0P A;  2I46 A;  3MAQ A;  5I6Y A;  1VQ7 A;  1GHK A;  1F2Z A;  4C3I B;  1WTH A;  2CQA A;  2YTV A;  3RZO B;  4ZCK A;  3K58 A;  1PTO C;  3CQZ H;  3E0E A;  4DAY B;  4A3C G;  1HNX Q;  4BY1 B;  3F8T A;  4RA8 A;  1OXU A;  2NVY H;  1IZ6 A;  1YHB A;  3H3V C;  4EQP A;  3FEW X;  5E4X A;  3GTQ H;  4DV0 Q;  1UEA B;  4X3S A;  4PZ8 A;  5ELO A;  2B2T C;  3PIP 3;  4HJA A;  2EOT A;  5IGD A;  1PTO H;  1X65 A;  3UDI A;  2LY7 A;  4LFB L;  1Q8K A;  2YV5 A;  1Y1W B;  5IGC A;  3H3V H;  4EX5 A;  2F0K A;  1VQK A;  4A3D G;  1RL2 A;  2B2V C;  2UXC Q;  1WTW A;  2KCT A;  5C0X H;  2NN6 I;  2R93 G;  3HOX H;  1B50 A;  1HR0 Q;  4DR4 L;  1JC7 A;  4KHZ A;  3URY A;  4QL5 A;  3HOW B;  4DV3 Q;  4EVO A;  1R9T H;  2F03 A;  1STY A;  4F88 A;  5C3E B;  1IBM L;  4H13 C;  3RD4 A;  5IWA Q;  1JWM D;  1T9H A;  4A3G G;  5EPL A;  1AN8 A;  3DEP A;  1FNU A;  3ERQ A;  3HFZ B;  3I56 A;  4QCL A;  1K8O A;  1K9M C;  4Y7N H;  2NN6 G;  3TP5 A;  1DZ1 A;  1PHJ A;  4CDF C;  3UI2 A;  4JI3 L;  2ZJQ A;  3ULJ A;  3K6O A;  2N55 A;  4F7X A;  2WAQ B;  2J7Z A;  2VY3 A;  3D6C A;  1Y1V H;  4LWC A;  3TEH B;  3SEB A;  2VUM B;  1Y8P B;  1KDA A;  1SNM A;  2KED A;  5M3F G;  1RJT A;  1D6E C;  4IFD G;  2JA7 B;  1D7Q A;  2Y0S B;  5CV8 A;  1A8V A;  4CKB A;  1VQI A;  4DV4 Q;  2DY8 A;  2R7Z B;  5ELC A;  5GAH C;  1GOZ A;  2AQ2 B;  1A62 A;  1EY8 A;  5DM7 3;  4DR4 Q;  2NVQ H;  1NMG A;  5IYB G;  3Q0A A;  4ZLT F;  3FKI H;  3KFU A;  1EOT A;  1IBM Q;  1HH2 P;  1S5B D;  4KKT A;  1G2S A;  1YZ6 A;  4O0A A;  3U9O A;  1SYC A;  2SNM A;  4DR6 L;  4DAV A;  3D0F A;  3AYH B;  2JEB I;  1TS3 A;  1N33 L;  4LF9 L;  2AHO B;  3Q6S A;  3ERS X;  4IUP A;  3ND8 A;  1CQF A;  2CKZ B;  4POG A;  4GLA C;  2R7D A;  4OO1 H;  3HS0 C;  2UXD Q;  5CV9 A;  4RGN A;  4HID A;  3P1H A;  2P5Z X;  2SDF A;  3RLO A;  4BBR G;  1RKN A;  3H0G H;  1XTD A;  2K5D A;  4BXX H;  3SK8 A;  4JOI A;  3K7A H;  4RKL A;  4XT1 B;  4DV7 L;  3AMU A;  1OXS C;  5CYU A;  5K36 H;  2QIL A;  3WDN A;  3D6W A;  4AYB E;  1BCP C;  1QVG A;  3S14 B;  4RCN A;  3R3O A;  3SE0 A;  3PCO B;  1XJV A;  1PTO D;  3HGB A;  3CCR A;  1JJ2 A;  1EIH A;  1BOS A;  1KQS A;  1IBL L;  1G51 A;  4V19 0;  2KHI A;  5L37 A;  1ENC A;  2BA0 A;  3RN5 A;  4C2M B;  3A56 A;  2JA5 G;  4A93 H;  1E0B A;  3F2U A;  4UHV A;  3U50 C;  1HZ9 A;  1ESR A;  2FIN B;  3NXW A;  1S4Z A;  3BZK A;  1XTC D;  1SE2 A;  1EY4 A;  2B2T A;  2HT1 A;  5I2X A;  2XIW A;  4JI4 L;  1AE3 A;  1JB7 A;  2HIX A;  4DXF A;  3GTM B;  4LF9 Q;  3GTG B;  3QO2 A;  1JQY D;  4R4O A;  5JPM C;  3CCS A;  1YVC A;  4DPG A;  4N9T A;  4DV5 L;  2HUG A;  3ERO A;  3GV6 A;  2JA6 H;  2B2V A;  4LAA A;  1X3E A;  4HN7 A;  5C4H A;  4A3E G;  3T56 B;  1Q8I A;  2D5D A;  1VQO A;  2K1B A;  5LMN L;  1AFP A;  1W2B A;  1K8M A;  2AWO A;  3ZYY X;  4A3M B;  3I4O A;  1HTL D;  5J1Z A;  1PRT B;  2E8G A;  4JCV E;  3NE5 B;  1AH9 A;  4JC0 A;  1FYC A;  2QA4 A;  4C3I G;  4OGQ C;  2JJQ A;  2F0E A;  1CFM A;  2F3V A;  2MQH A;  2NB0 A;  2WKD A;  4LNQ A;  4RGM A;  4BY1 G;  1HCZ A;  2VQE L;  3HKZ B;  1IBL Q;  1VF7 A;  3G6E A;  2OXP A;  4R8N A;  2EY5 A;  1YIJ A;  2G9D A;  2I07 B;  1KAB A;  4MTK A;  2QEX A;  3TRE A;  3IFD A;  5JOB A;  1O78 A;  3E9H A;  4LF4 Q;  1Y1W H;  1QZG A;  1K28 A;  2WAQ E;  3VYS A;  3KLS A;  3KUP A;  2K33 A;  3WWV A;  4JI4 Q;  1U4R A;  2H4O A;  1CT1 D;  2L5T A;  3MC0 B;  1B9N A;  4K8I A;  4DUY Q;  3HZX A;  2FMM A;  4PG3 A;  2Y0S E;  3OW7 A;  4JBJ A;  4WJW A;  2K05 A;  2OQ0 A; 
#chains in the Genus database with same CATH homology
 4DXG A;  1BQQ T;  2B8G A;  1SYE A;  2KEE A;  3N6R A;  3EJI A;  4M8A A;  3PUX A;  2MGS A;  4CJ0 B;  2NTS A;  4RHR A;  3C1F A;  1HTP A;  5FLX E;  4RGT A;  4F87 A;  1CA6 A;  5FKA C;  1IKM A;  5JAV A;  2EYO A;  3K59 A;  1W6K A;  3OMG A;  3I3C A;  2XNA C;  2PPB C;  4IUU A;  3RZD B;  5I9O A;  3P7J A;  3VR4 A;  1SNQ A;  1WCM B;  4HSV A;  3MFG A;  3BVZ A;  2KOL A;  3KK7 A;  1KNA A;  1HQR D;  4I65 A;  4J6H A;  1BCP D;  3LWE A;  3GTO B;  1BR9 A;  1EZ6 A;  1Q3L A;  1ZXT A;  1I50 B;  3GD7 A;  2RDF A;  4FXD A;  3H94 A;  4X3K A;  3VYT A;  1OXV A;  3BDL A;  3NK9 A;  1EWC A;  1ML0 D;  1GUO A;  1ICW A;  4C1N K;  4K2L A;  4IQZ A;  3S16 B;  1KTK A;  5KYI A;  1SNP A;  2EE1 A;  4FP5 D;  2L0C A;  5FK9 C;  2OEO A;  5ELE A;  3M3Y B;  1M8A A;  3I90 A;  5CV4 A;  1O7Y A;  4DAY A;  2RBM A;  3PO2 B;  2SEB D;  2IX3 A;  2F0J A;  3J81 E;  4B9X A;  3MXN A;  5JEA G;  3AU7 A;  4BWG B;  1UAP A;  3M4O B;  1SMY C;  4R9W A;  4KY5 A;  2M2L A;  5F2D A;  1T5E A;  2AWN A;  2K5W A;  3TBI B;  3VYR A;  2RVL A;  4ZQ3 A;  2RSN A;  4CHT B;  2C9O A;  2PZT A;  1NSN S;  1WTP A;  2RDH A;  4ILW A;  1I4H A;  5DEH A;  1G2T A;  1W6J A;  3Q23 A;  1KDB A;  3S2H B;  1F77 A;  1DXM A;  5NUC A;  1SJH D;  2JYO A;  1D1I A;  2DNE A;  5ELB A;  3T4A C;  2ID0 A;  4QUF A;  5G3L D;  1V43 A;  4H7B A;  2JXM B;  3K5L A;  4TSS A;  3LWU A;  1TT2 A;  1SNO A;  1B2T A;  5JPN C;  1AZP A;  3K5N A;  5C4X B;  2PZU A;  1GUN A;  2LKV A;  5ISR A;  5C5M A;  1TII D;  1FGB D;  2F0L A;  3I91 A;  2F0S A;  1MD2 D;  3DUZ A;  2EJG C;  5FO9 B;  3HOU B;  1L0Y B;  1H9K A;  2WAC A;  3NTI A;  3GO5 A;  5CV6 A;  1Y1V B;  1TY0 A;  1DON A;  4TKO B;  1WTR A;  3BDO A;  3MWY W;  4S3S A;  3A8J E;  1GUG A;  4K8J A;  1KDC A;  2L4N A;  1ZYR C;  4KJO A;  1LT5 D;  1G6Z A;  3DMU A;  3GTK B;  2OF1 A;  1EQT A;  2J0T D;  1YNN C;  2QCP X;  1EY6 A;  4JK1 C;  3BDC A;  1CHQ D;  1G8Z D;  5KYL A;  2FJ2 A;  1NR4 A;  1SBB B;  1MGS A;  1JE4 A;  4DNT B;  5BN3 A;  4NMZ A;  5EPK A;  3W2D A;  1Y8O B;  1I4R A;  3IKJ A;  4XTC S;  5IGE A;  2K7V A;  2FMC A;  2F0Q A;  3QWN A;  5JEA J;  4PV1 C;  3D4R A;  1I4P A;  1TWG B;  1HQM C;  5ELD A;  3C2P A;  1FNW A;  3NQI A;  2D9U A;  1TWH B;  3MHB A;  4ZYS A;  3IL8 A;  2NYZ D;  4K14 A;  3OWE B;  2F0G A;  1QE6 A;  1CK1 A;  3LNN A;  3SVM A;  2WP8 J;  5EJW A;  3IFT A;  3PUV A;  1D2B A;  3NTK A;  3HOZ B;  3VA7 A;  3VR5 A;  1PRT D;  2EY6 A;  1E2V A;  4WOR A;  5CMD A;  4DFA A;  1F2M A;  1H9S B;  2ZXO A;  2B63 B;  1TVX A;  3P75 A;  1HHV A;  2K6A A;  3E5S A;  2NWG A;  1G91 A;  2EYJ A;  2IT1 A;  1PLF A;  3OIQ A;  1LLR D;  1EYC A;  3RMH A;  1CQV A;  3SDZ A;  3M4Y A;  4ZK9 B;  3OWF A;  3OOC A;  2R6G A;  1Z47 A;  1EEI D;  3I73 A;  3MVV A;  5IT9 E;  1LAC A;  1QG7 A;  3CU7 A;  2EYM A;  1EQV A;  1S5F D;  2F0N A;  1MBY A;  4V0B A;  3CRK C;  5CV5 A;  3M7N A;  5EBC A;  3OHX C;  1QWY A;  1TQO A;  2XWB B;  5EGT A;  3QG1 A;  1EU4 A;  2EPB A;  5C0X I;  4PMC A;  1Y8N B;  1IHZ A;  4DAP A;  3E6Z X;  2F0M A;  1H9J A;  4ZRZ A;  1WD0 A;  5M3M B;  1ZYR D;  1WTV A;  2D62 A;  4HMI A;  2H1E A;  3A54 A;  5C0X G;  4HCS A;  3NQT A;  3BYT B;  2GA4 B;  1ESF A;  1HUM A;  1YNN D;  3SR1 A;  4QUC A;  1D5Z C;  4NW2 A;  4FVM A;  4IFD I;  1Z6H A;  4K5W A;  3D3R A;  1ZKO A;  2HCI A;  3FVQ A;  3HRZ C;  4KI0 A;  2AUJ D;  3R2T A;  2RSO A;  1ILQ A;  4CKE A;  4RCO A;  4C3J B;  3WOF A;  4XDX A;  4HAE A;  3QIA A;  2B2Y A;  3I72 A;  4QMG A;  3NPP A;  4BS9 A;  1LTA D;  4O1N A;  5I6W A;  2EJF C;  2BOS A;  1JIC A;  3L7Z C;  1MSG A;  1J9O A;  4FF2 A;  4OO1 I;  3KBG A;  4WRD A;  3KBX A;  5CR3 A;  2L1B A;  4N9P A;  2XN9 C;  2RQX A;  2HCC A;  2WKC A;  1BNZ A;  1PFB A;  2PO4 A;  3VR2 A;  1BBX C;  1TWF B;  2HDM A;  4OO1 G;  4A3J B;  4K6L A;  1I3Q B;  4FYD A;  3VR6 A;  1F2L A;  5K36 G;  1BDO A;  4JBW A;  3BYY B;  2YYZ A;  1KNE A;  1T5X D;  1TS5 A;  3EFX D;  1IYV A;  2X6L A;  3H6M A;  2A69 C;  1HFG A;  3A8I E;  2K04 A;  1EYA A;  2YU9 B;  1Q1E A;  3KLS X;  4RHS A;  1LTI D;  5T1I A;  5C0X J;  5KND A;  1U4P A;  3MXG A;  1VCI A;  1U4L A;  3T53 B;  2EYP A;  2FFK B;  4ULL A;  2BA1 A;  3OIP A;  2EY1 A;  1KAA A;  1EY7 A;  3I4N B;  2QEJ C;  5CBA E;  4A3K B;  4CKC A;  2JSO A;  1TWC B;  2R61 A;  2K01 A;  1K83 B;  1TR5 A;  4IFD J;  1BXT A;  1GHJ A;  1EIG A;  4ZAI A;  3TME A;  4NP5 A;  1VMP A;  1LTB D;  5CV7 A;  4J1M A;  1RTO A;  2E74 C;  1HA5 A;  3W3A A;  2AUK A;  5LHY 1;  3TP6 A;  4I7Z C;  3TP8 A;  1XYI A;  4RWS C;  3NBI A;  1DM0 B;  1EEF D;  2V4D A;  3BS1 A;  4QF4 A;  2QKI C;  3ONA B;  4KN7 C;  1AZQ A;  2X69 A;  5E3F A;  1A3V A;  2K5Q A;  1ENF A;  3S15 B;  2B39 A;  2XVS A;  2HQE A;  4LMQ D;  3N52 A;  1PDQ A;  3CRL C;  2J4X A;  1EY0 A;  1V1P B;  3T13 A;  3PUZ A;  5C4J B;  5IIF A;  4C3H B;  2CHB D;  3C1E A;  5TSS A;  5IOC A;  3WOE A;  1PZJ D;  2F3W A;  3CHB D;  1OO9 B;  4U67 3;  2KUM A;  1F9P A;  2K32 A;  2WB1 B;  3U9S A;  4J8Q A;  1H9S A;  5A35 A;  1SSO A;  2EVB A;  1WD1 A;  1L0X B;  1C48 A;  1LTG D;  2ICE C;  4CJ2 C;  2E2D C;  3D4D A;  3MTS A;  2IJ0 A;  3DWQ A;  4IAL A;  1SJE D;  2DY7 A;  2N88 A;  1R4P B;  2VNU D;  3OMC A;  2K03 A;  2K28 A;  4A3F B;  2QDB A;  3NUC A;  3A7A B;  1S5E D;  3MXP A;  5A2Q E;  3L9A X;  1UUP A;  5M5Y B;  2QF7 A;  2AQ3 B;  3NTH A;  3BVM A;  5J39 A;  2LS0 1;  3HOY B;  3J80 L;  3GTL B;  4UAI A;  1I4X A;  4OL7 A;  3JAM E;  5M9O A;  2KCN A;  5C3W A;  1ROD A;  2JEA I;  1GUW A;  1U9R A;  4HSP A;  3Q22 A;  4CBV A;  2VB3 X;  1B44 D;  2A6H C;  2F0F A;  5E4W C;  3D8G A;  2IWH A;  3V2T A;  2Z4H A;  4L63 B;  5DAU A;  5HUR A;  3X3M A;  1SEB D;  1EL0 A;  4DF7 A;  1A3U A;  1FD7 D;  1VF5 C;  5CGK A;  4XYO A;  4KKU A;  5EKK A;  1MI2 A;  4FXG C;  1A15 A;  1LV9 A;  1IW7 C;  2BCO A;  1QJO A;  4A3D B;  2KCC A;  1XWE A;  4RFB A;  2NZ1 D;  3TN2 A;  1B4O A;  4DK0 A;  2MUY A;  2ZT9 C;  4XXE A;  1HA6 A;  2CW0 C;  1DOM A;  2R92 B;  1JOR A;  4ODG A;  2O5J C;  1KLG D;  3J81 L;  4KMU C;  1TWA B;  5BN5 A;  4XIG S;  4XQJ A;  5KNC A;  1TKW B;  4R8I A;  3K0Y A;  3SHL A;  5KGU A;  1I6H B;  4H44 C;  2A68 C;  5M3F B;  1PZI D;  2MPM A;  3S9W A;  4XQN A;  1I4G A;  5FO7 B;  5C5L A;  1SND A;  3H91 A;  1PXU A;  1JB3 A;  3O13 A;  1C8C A;  1X3Q A;  1EZ8 A;  3P20 A;  4BA2 I;  4C1N I;  4C3H G;  5EPJ A;  2F0I A;  1DOK A;  2PZW A;  2MJ8 A;  4KTA A;  3A55 A;  3D4W A;  4B9W A;  1SMY D;  1S5C D;  1CZG A;  1EYD A;  2F0W A;  1WTO A;  1JWS D;  1PMR A;  1IYU A;  4BBR B;  2JE6 I;  3FDT A;  2HDL A;  1LO5 D;  1ILP A;  1A2T A;  3DWP A;  1DJR D;  2CVR A;  4G7O C;  2Z1C A;  3TP7 A;  1GUS A;  3SXH A;  2SNS A;  3PMF A;  1SYD A;  1BF4 A;  3BVG A;  5JVG 3;  1DCZ A;  2FHT A;  4ID6 A;  3SK6 A;  3TDQ A;  3X3N A;  2O2L D;  1VDZ A;  3SK4 A;  1A2U A;  4NKL A;  4WFN 3;  1SDF A;  5C4Z A;  1GXD C;  3I70 A;  1IW7 D;  4BA1 I;  2B2W C;  1EFI D;  1IL8 A;  4A3E B;  4KHV A;  2JA8 B;  2M00 A;  5E1F A;  1JR0 D;  3I8Z A;  1IKL A;  3S1R B;  4P2C B;  5EQ0 A;  5KNB A;  5FOB B;  2CW0 D;  4KN4 C;  5IOD A;  2XRS D;  3QOJ A;  2A6E C;  3S1Q B;  1PFN A;  1STA A;  1LTR D;  2PW7 A;  3S1M B;  4QIW B;  3AB9 A;  2KHS A;  3ITP A;  2Q8R E;  2F4I A;  4M1U B;  3S1N B;  3C46 A;  2A73 B;  2A68 D;  3DWA A;  1V1P A;  1RD9 D;  3L3O C;  4IUR A;  5CC4 A;  2EYL A;  3Q24 A;  1FNV A;  3RLF A;  4IUV A;  3S2D B;  4PQX A;  1Q12 A;  1AP0 A;  3V96 A;  5K5P A;  5AFW A;  1YNJ C;  2NN6 H;  4G7Z C;  3DXJ C;  4G7H C;  1V1O A;  1SYB A;  1JOQ A;  4UDU C;  1TU2 B;  4KKS A;  1II3 A;  4XYQ A;  4OIK A;  3VYU A;  5IT9 L;  3KLR A;  4LK1 C;  3J7A V;  1D1K A;  4BY7 B;  1QB5 D;  1A3T A;  4IFD H;  1VMC A;  1EWH A;  1DYQ A;  4DU9 A;  1SAP A;  4CGY B;  2AQ1 B;  1Z7T A;  2ZXP A;  2L55 A;  1HRJ A;  2XSC A;  2KA7 A;  1RDP D;  1X3P A;  3ND9 A;  2DN8 A;  1X32 A;  2L12 A;  2E2I B;  2RKS A;  1D5M C;  2NVT B;  2C5C A;  5KIX A;  2A5H A;  1JOO A;  3BZD B;  1EU3 A;  4EGV A;  1PTO F;  3S17 B;  3GV3 A;  5IGB A;  4KK7 A;  3HP3 A;  1B3A A;  4HR7 B;  3PO3 B;  4EQN A;  1O7L A;  4QB4 A;  3K5M A;  2B2W A;  5D3D A;  3HG9 A;  4PMW A;  1STN A;  1Y69 U;  4OIJ A;  3C3L A;  1B53 A;  1HXY D;  5DM6 3;  1F2Y A;  5COY A;  2M9V A;  1OXT A;  4U68 A;  2NTT A;  2A6E D;  2Z4I A;  2WV6 D;  2EJM A;  2F0V A;  2BDO A;  3TZD A;  3H09 A;  4H0L C;  1B1Z A;  5C6A A;  1FR3 A;  2R3Z A;  4KY6 A;  1XXG A;  1S5D D;  1Q1B A;  4KY7 A;  4C56 C;  3BG3 A;  2IW3 A;  4A3B B;  1NUC A;  1QCB D;  4B08 A;  2EYH A;  3MEH A;  3NWS A;  4EQO A;  1D5X C;  2WIN B;  1KLU D;  1NR2 A;  1YNJ D;  3MZ5 A;  4RGO S;  1RHP A;  3FPP A;  3NHH A;  4ZUJ A;  1JOK A;  3G6J B;  4ZKC B;  2BE5 C;  3I4L A;  4ABN A;  1GUT A;  5CBE E;  4K6D A;  4A3I B;  1XX8 A;  4MN3 A;  2VXW A;  2IX0 A;  5I9P A;  2KQ3 A;  2EY2 A;  3QOL A;  2JP1 A;  3FMC A;  3CKI B;  3MA2 B;  5M5W B;  3I4M B;  4FXK C;  2A74 C;  1E2W A;  1LTT D;  1SE4 A;  1STB A;  2PNR C;  4DA2 A;  1HPC A;  3J7A F;  2PW5 A;  1A6X A;  3J7Y W;  5J22 A;  1TY2 A;  4F8M A;  4K5X A;  3FPU B;  3HEJ A;  2MHV A;  1B9M A;  2EZV A;  3GTP B;  1EY9 A;  2E2J B;  2RA4 A;  1BCP F;  4C3J G;  5HGT A;  5EKL A;  4Q0F A;  1LAB A;  3K5O A;  2XWJ B;  2Q8I B;  5EBD A;  3HOV B;  4DK1 A;  2F0U A;  4DNR B;  3J80 E;  1I4Q A;  3QB3 A;  1TS4 A;  3NSW A;  1SYG A;  2KEC A;  4FF4 A;  4RKB A;  4X3U A;  4DGZ A;  3R2I A;  1UNS A;  1ET9 A;  5JJZ A;  3DEO A;  3V05 A;  3IAY A;  5M5X B;  5I4D A;  5I2Y A;  1MSH A;  2ENB A;  5C44 B;  4Z9C B;  4XT3 B;  2ZXR A;  2Q8T A;  1DOL A;  4Q5V A;  2A69 D;  3PIO 3;  1M4V A;  3EQL C;  4HTH A;  3OPO A;  1CA5 A;  1DD2 A;  4ME5 A;  1F9R A;  5D65 A;  3NP8 A;  4BBS B;  2OT2 A;  2F1M A;  1CI3 M;  3DHQ A;  1BO0 A;  4TRD A;  1WVL A;  1SE3 A;  3T16 A;  2PMZ B;  3GTJ B;  1HUN A;  3TZU A;  4GZY C;  1ONL A;  4G57 A;  2NUC A;  5IGG A;  5DNF A;  3NWT A;  1H9R A;  2EDG A;  3VR3 A;  2Z8L A;  1ENA A;  2B8F A;  4L8J A;  5FLX L;  5EKI A;  1LT6 D;  1EY5 A;  1SFO B;  1U4M A;  4O42 A;  2O5I C;  1J8I A;  5JEA H;  2PCF B;  2F0O A;  4IUN A;  2NVX B;  4FF1 A;  2SOB A;  4MIU A;  1JWU D;  2MP1 A;  1QOH A;  1STG A;  1TS2 A;  2BE5 D;  4HMJ A;  3VA5 A;  2WII B;  1G29 1;  2F0D A;  2PQE A;  5G3L F;  4IZ8 A;  3PV0 A;  4OHJ A;  1F9Q A;  5T1G A;  2G9H D;  1NAP A;  3CQZ B;  4ZUI A;  4G4K A;  1V8Q A;  2NVY B;  4CJ1 B;  2E2H B;  4HCE A;  3GTQ B;  3MXU A;  1JCK B;  1PRT C;  3OSO A;  1PFM A;  1PTO B;  2KVM A;  3GQB A;  4NDX A;  4FF3 A;  1H9M A;  2B2U C;  1NCV A;  4YIJ A;  2R93 B;  3DM1 A;  1WTX A;  1O80 A;  2DNC A;  1HFN A;  2O4X A;  2D2C C;  3HOX B;  1RTN A;  2TSS A;  1ZEQ X;  4A3G B;  4TQU S;  4FO2 A;  1QNU A;  1CTM A;  1R9T B;  5A2Q L;  2KJX A;  3GP7 A;  3A7L A;  3FRP B;  4RH6 A;  2F0H A;  4Y7N B;  4HED A;  1AEX A;  4MHE A;  2L9H A;  4ZKB B;  3RUZ A;  3JAM L;  5FO8 B;  5BN4 A;  1QIL A;  1SNC A;  1CHP D;  2E76 C;  1LT3 D;  4IN3 A;  2LFN A;  1I6V C;  3SK5 A;  3G7L A;  1RCV D;  4PMB A;  1R4Q B;  5ELF A;  1WTQ A;  2TMP A;  3NBH A;  2XRQ D;  1E2Z A;  4IUQ A;  2BDN A;  5IGF A;  2NVQ B;  4FNF A;  1AW7 A;  3MFY A;  3M85 A;  3FKI B;  4E6I A;  4KJN A;  1CM9 A;  2X6G A;  1C4Q A;  2L11 A;  2RDG A;  1ET6 A;  3EVQ A;  2VB2 X;  3D31 A;  4XQQ A;  3LX0 A;  4IUT A;  4LJZ C;  3PUY A;  1Q90 A;  1SYF A;  1RF2 D;  1STH A;  2B2Y C;  3KF8 A;  5LL6 S;  5KEE A;  1PRT F;  3H0G B;  1SXT A;  2PYK A;  4KV6 A;  4K2K A;  3R8B A;  3E0J A;  3K7A B;  1QNK A;  2A6H D;  2IL8 A;  3PUW A;  4PNY A;  1GJX A;  1PYW D;  3TSS A;  5JVH 3;  3M7G A;  1BUV T;  4L6T B;  5D3I B;  1CZW A;  1LTS D;  1OXX K;  3QJY A;  2LMC B;  4K5V A;  2E75 C;  2EXZ A;  4X3T A;  2IX1 A;  2JA5 B;  5LL6 X;  1BCP B;  2ICI A;  1STE A;  3K57 A;  4A93 B;  1LT4 D;  3T51 B;  4DN4 M;  3A8K E;  3R93 A;  4KD3 A;  2IPK D;  5D14 A;  5C3X A;  1O7Z A;  5COR A;  2B2U A;  3EA6 A;  4RAU C;  1F9S A;  2JA6 B;  4AYB B;  4KD4 A;  5KRU A;  2EYF A;  2NBF A;  2F0T A;  1PZK D;  2F0P A;  2I46 A;  3MAQ A;  5I6Y A;  1GHK A;  1F2Z A;  4C3I B;  2CQA A;  3RZO B;  3K58 A;  1PTO C;  4BY1 B;  4RA8 A;  1OXU A;  3H3V C;  4EQP A;  3FEW X;  5E4X A;  1UEA B;  4X3S A;  3PIP 3;  2B2T C;  2EOT A;  5IGD A;  1PTO H;  2LY7 A;  1Y1W B;  5IGC A;  2F0K A;  2B2V C;  1WTW A;  5C0X H;  2NN6 I;  1B50 A;  1JC7 A;  4KHZ A;  3URY A;  3HOW B;  4EVO A;  2F03 A;  1STY A;  4F88 A;  5C3E B;  4H13 C;  3RD4 A;  1JWM D;  5EPL A;  1AN8 A;  3DEP A;  1FNU A;  3ERQ A;  4QCL A;  1K8O A;  2NN6 G;  3TP5 A;  1DZ1 A;  3UI2 A;  3K6O A;  2N55 A;  4F7X A;  2WAQ B;  2J7Z A;  3D6C A;  3SEB A;  2VUM B;  1Y8P B;  1KDA A;  1SNM A;  2KED A;  1RJT A;  1D6E C;  4IFD G;  2JA7 B;  2Y0S B;  5CV8 A;  4CKB A;  2DY8 A;  2R7Z B;  5ELC A;  1GOZ A;  2AQ2 B;  1EY8 A;  5DM7 3;  3Q0A A;  4ZLT F;  1EOT A;  1S5B D;  4KKT A;  1G2S A;  3U9O A;  1SYC A;  2SNM A;  4DAV A;  2JEB I;  1TS3 A;  3Q6S A;  4IUP A;  3ND8 A;  1CQF A;  4OO1 H;  3HS0 C;  5CV9 A;  4RGN A;  3P1H A;  2SDF A;  1RKN A;  2K5D A;  3SK8 A;  4RKL A;  4XT1 B;  3AMU A;  5K36 H;  1OXS C;  5CYU A;  2QIL A;  3WDN A;  3D6W A;  1BCP C;  3S14 B;  4RCN A;  3R3O A;  3SE0 A;  1PTO D;  3HGB A;  1EIH A;  1BOS A;  4V19 0;  1ENC A;  2BA0 A;  4C2M B;  3A56 A;  1E0B A;  3F2U A;  2FIN B;  1ESR A;  3NXW A;  1S4Z A;  1XTC D;  1SE2 A;  1EY4 A;  2B2T A;  5I2X A;  2XIW A;  4DXF A;  3GTM B;  3GTG B;  3QO2 A;  1JQY D;  5JPM C;  4N9T A;  2HUG A;  3ERO A;  3GV6 A;  2B2V A;  4LAA A;  4HN7 A;  5C4H A;  3T56 B;  1Q8I A;  2D5D A;  2K1B A;  1AFP A;  1K8M A;  2AWO A;  3ZYY X;  4A3M B;  1HTL D;  5J1Z A;  1PRT B;  3NE5 B;  1FYC A;  4C3I G;  4OGQ C;  2F0E A;  1CFM A;  2F3V A;  2NB0 A;  2WKD A;  4RGM A;  1HCZ A;  3HKZ B;  1VF7 A;  2OXP A;  4R8N A;  2EY5 A;  2G9D A;  2I07 B;  1KAB A;  3IFD A;  5JOB A;  1O78 A;  3VYS A;  3KLS A;  3KUP A;  2K33 A;  1U4R A;  2H4O A;  1CT1 D;  2L5T A;  3MC0 B;  1B9N A;  3HZX A;  2FMM A;  3OW7 A;  4WJW A;  2K05 A;  4K8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...