1ZKOA

Crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
HHHHHLKMKKYTKTHEWVSIEDKVATVGITNHAQEQLGDVVYVDLPEVGREVKKGEVVASIESVKAAADVYAPLSGKIVEVNEKLDTEPELINKDPEGEGWLFKMEISDEGELEDLLDEQAYQEFCAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine cleavage system H protein
publication title Crystal structure of Glycine cleavage system H protein (tm0212) from Thermotoga maritima at 1.65 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Glycine cleavage h-protein
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1zkoA00
3BDOA 1CFMA 4DNRB 4JBWA 1GUOA 1GJXA 2A69D 1OXVA 4LK1C 2E74C 1GHJA 1Q1BA 3M7NA 2DNEA 3TZUA 2EDGA 3PUYA 4KKSA 3CRKC 1GUNA 1GHKA 4BA2I 1K8OA 4PV1C 2EJGC 1O7LA 3CRLC 1Y69U 4OGQC 2JE6I 3A7LA 4DK0A 2F1MA 5KNDA 3A8IE 2A68D 2IT1A 4XIGS 1T5EA 1IW7D 3LNNA 4I7ZC 1OXXK 4KHZA 4G7HC 2QF7A 1H9SB 4OO1H 1TKWB 4TKOB 4OO1G 1HQMC 3KLRA 2BA0A 1TU2B 2D62A 1Y8OB 2NN6H 3PV0A 4IFDH 4KN4C 3BG3A 2DN8A 4IFDG 2DNCA 3I4LA 1OXTA 4LJZC 4G7ZC 1FR3A 3PUXA 3PUZA 4DNTB 2AUKA 1B9NA 1Q12A 1Z6HA 2EJFC 2EVBA 3LWUA 1Q90A 4XTCS 5BN3A 3PUWA 2PNRC 4BA1I 3T53B 1GUGA 1HPCA 3FPPA 3ND8A 3PUVA 3QG1A 3VR5A 2YYZA 3EQLC 3WDNA 5BN5A 1H9JA 2BE5D 2K33A 2V4DA 1V8QA 3GD7A 4TQUS 2ZT9C 1B9MA 1YNNC 1H9SA 5JEAH 4HR7B 1VDZA 3HGBA 2A69C 3T51B 2K7VA 5KNBA 5JEAG 2JEAI 4G7OC 2R6GA 2JXMB 1VF7A 4KKUA 3M4YA 1H9KA 1DCZA 2AWOA 5K36H 1BDOA 2L5TA 1OXUA 1Q1EA 2A6HD 3SE0A 1ONLA 1ZKOA 2A6ED 2BDOA 2CW0C 2LMCB 4H0LC 3L7ZC 3VA7A 2AUJD 3MFYA 5K36G 1A6XA 3P20A 2B8GA 1VF5C 1K8MA 1SMYC 1HTPA 1IYUA 2KCCA 3D31A 5KNCA 4H13C 1G291 2A68C 3OOCA 1VCIA 1Z7TA 3OPOA 1IW7C 3N6RA 2K32A 3A8KE 2E75C 1HCZA 3W3AA 5C0XH 3IKJA 2KA7A 5C0XG 5BN4A 3M85A 3DXJC 1CI3M 3T56B 1DXMA 1H9RA 1H9MA 1EWHA 1ZYRC 5A35A 4H44C 3ND9A 1Y8NB 4GZYC 1V43A 1LABA 1O78A 1LACA 1E2ZA 4DK1A 4L8JA 2PCFB 3QJYA 4JK1C 3AB9A 3A8JE 4KMUC 4RCNA 2D5DA 3VR4A 1E2WA 3D4RA 2B8FA 3SDZA 3MXUA 1CTMA 3VR6A 1IYVA 4KKTA 3VR2A 1PMRA 2PPBC 2O5IC 1OXSC 4KI0A 3FMCA 3H94A 1GUTA 2BE5C 2BA1A 1I6VC 1FYCA 3U9SA 4IQZA 3A7AB 2O5JC 2NN6I 1YNJC 3I73A 3GQBA 2E76C 1GUSA 3I72A 1QJOA 2Q8IB 2D2CC 3NE5B 3RLFA 2A6HC 1E2VA 2JEBI 2EJMA 2NN6G 1Y8PB 2A6EC 3IFTA 3OW7A 4KN7C 3VR3A 1DD2A 3QIAA
chains in the Genus database with same CATH superfamily
1L1OA 1GUOA 1NR4A 1I94L 1PVOA 2Z4IA 1YHBA 3J7YW 3BZDB 2MHVA 4QCLA 2EDGA 2F3WA 4DGZA 3CRLC 2FFKB 2UXCL 3RLOA 4QUCA 1PFNA 1MJEA 1AFPA 4G7HC 2QF7A 1H9SB 2XVSA 3TMEA 4A3FH 3O13A 2ZTEA 4RCOA 2PZTA 2NN6H 2KJXA 3QO2A 2NBFA 4AYBB 3R3OA 5AJ3Q 3ULPA 1TS5A 1QE6A 1B7YB 1DOMA 1VQ5A 4XDXA 3DWQA 4C2MH 1PFMA 3S2DB 2WP8J 3T53B 3I4MG 4PNYA 4CJ1B 1SN8A 3D6CA 3GTQB 1HH2P 4WFN3 5JEAJ 2UUBQ 1NCVA 1X54A 1B44D 3CQZB 1ENFA 2F0VA 1F9RA 1W3SA 1GUWA 1PH5A 4CBVA 1RHPA 5EAYA 1XNQL 4DXGA 4HTHA 1MJCA 2EIFA 3CKIB 4YWKA 3JAME 2F52A 1VF5C 1HNZQ 3J80L 2K5DA 5C5LA 4L63B 1A2TA 1PTOC 1TWAH 3A8KE 2JA5B 5C3EG 2CKZB 3HKZB 2D0OA 1X3GA 5IGFA 4NPSA 2H5XA 3KUPA 2OT2A 1K3BC 4LMQD 3BS1A 3JC66 1Y8NB 2E5LQ 4BY7B 1LABA 2UUCL 3HOYG 5C44H 3H09A 3VYSA 4DA2A 4RKLA 3QWNA 4X64L 3GTOH 3H3VH 2FMCA 5IYBG 1RODA 2WACA 2F0HA 4FXGC 5LL6X 1NE3A 1SR3A 3I4NB 3MEFA 5EBDA 1E1OA 4B08A 1A15A 3RZOB 5E7NA 3GTPB 2F0SA 3RLFA 1F2LA 3R8BA 2NVTB 1A62A 4KY6A 4HMJA 1GJXA 2A69D 4LWCA 3M9BA 1SROA 1TQOA 3BYTB 1NSNS 1TS3A 4PMBA 4DFAA 1R9TB 3GTMB 1AH9A 1GHKA 1M8AA 2R3ZA 1U4MA 1RIPA 2JE6I 4GLAC 4LUZA 3RN5A 4O0AA 2Q2UA 1S5CD 3J81i 2SOBA 4DF7A 3NXWA 4OL7A 1PA6A 3KBXA 2CFMA 5C4JH 2B2WC 3CCRA 1PYWD 1SYFA 4FF2A 3DEPA 4AQYQ 4LJZC 1JB7A 4WJ4A 2WV6D 4KJOA 1L0YB 3RUZA 2F0FA 1XPRA 4BBRH 3AEVA 1HPCA 1ML0D 3EA6A 5E4WC 4A3IB 1PTOF 5LMUL 1PYSB 5GAGC 1IBKQ 1ESFA 1DONA 4XQJA 1TT2A 1EUJA 2BE5D 1ILQA 3HOVB 1AE2A 2KECA 1IKMA 1Q8KA 2NVYB 2UU9L 4B3RQ 1G8ZD 2R6GA 3KF8A 5K36H 4C3JG 3K59A 2M9VA 3SE0A 1ONLA 2RF4A 2LMCB 2BDOA 4POGA 4K2KA 3P20A 2VS1A 4BWGB 1PXUA 1RJTA 4DV1Q 3CCEA 2K32A 2E75C 4PZ8A 4JC0A 4GNXC 2L15A 4U68A 4X65Q 5C4HA 3E9IA 3S2DH 4X3KA 4YIJA 1SJHD 4YCWA 1H9RA 1CQFA 2IX1A 1JJCB 3ND9A 1MSHA 3FVQA 3OHXC 3EROA 2NVXH 3GTQH 4R4QA 1T5XD 3I90A 3A56A 2JA8B 3CQZH 2M2LA 3VR4A 3R2IA 4OWTB 1WFQA 3W1BA 4RGMA 3H15A 1ESRA 1SYEA 1ENAA 3FMCA 4RH6A 1FYCA 1BF4A 4DR5L 4IJHA 4XQNA 2NN6I 5IGDA 1DOLA 4OX9L 3HOWH 1EFWA 1CKOA 4DR1L 4RFBA 1O7ZA 4LFAL 1EYAA 2NN6G 4AIMA 1UEBA 1HFNA 5G3LD 1SDFA 3LX0A 1EYDA 4JBWA 1ENCA 3TQYA 2HHHQ 4OEMB 1U0LA 2CW0D 1K9MC 3Q24A 1NNXA 1SFOB 3A7LA 1VQ9A 5ELOA 3S1MB 4CKCA 5T1GA 2E2JH 3CCQA 1X56A 1JC7A 4IFDH 1CT1D 2WKCA 5IYDH 2MGSA 2DNCA 2G9DA 3RZOH 4I65A 3J80c 1FVIA 3GTPH 4PZ6A 1LUZA 2KBNA 5DM73 3S1QB 4KJNA 2NVTH 4ZKCB 1UE7A 5IP9H 3G6JB 2K6AA 1VQFA 3IL8A 1X9NA 4JI7L 3L3OC 5EPJA 1QCBD 2YU9B 3PSIA 3GTMH 4A93B 1P8LA 2J4XA 2L1BA 4DR2L 1V1PB 3UE0A 3W5OA 2UXCQ 3H3VI 2F0WA 1DCZA 3PIP3 4DPGA 2L5TA 4GKJL 4A3GH 3D8GA 1LTID 1K8MA 1X6OA 4K0KL 2ZTDA 2A68C 1IW7C 3KJPA 4KLKA 1BVSA 4FF4A 3STBC 1A0IA 1TWGB 5E4XA 1P16A 3MZ5A 2HT1A 1H9MA 5HGTA 1N36L 4A3IH 1HNXL 3L2PA 3P75A 1JE5A 2C5CA 4JPBW 4KY7A 5I2XA 2R92H 1I4HA 2R61A 1DYQA 2EE1A 3QJYA 2HCCA 3T13A 2M00A 1YJWA 1LTGD 4A3LH 3M4PA 3D4RA 4APVA 1PH4A 2NVYH 3BU2A 3I56A 3SK4A 4KHPL 1EY5A 2PPBC 1BXTA 3C2PA 1XNQQ 2VNUD 4JI8Q 2ASBA 3CXCA 4A3JB 1D6EC 1BNZA 3AMUA 4Q5VA 4YWMA 2PI2E 4KY5A 3KLSA 4UP7A 1VQBA 2JEBI 1U5KA 3H6MA 1YHQA 1HQRD 3NK9A 1V1PA 4HSPA 5CMDA 5JJLA 3SEBA 4BY1B 3MA2B 2VUMB 1TIID 2WB1G 3I7FA 2G9HD 1GUNA 2UUCQ 5JJIA 1O7LA 1YHAA 2HCIA 1EYGA 2AKWB 3QOLA 2F0GA 1VQAA 5T1IA 1VQOA 4NXNL 4X64Q 4R8NA 3S16B 4XIGS 4ME3A 3J7ZC 3U50C 4TKOB 3KOJA 3C1FA 2KOLA 1E3PA 2LY7A 5KYLA 3SK8A 4DR6L 1EY8A 1SLJA 3TP8A 1WD1A 1D5XC 1G2TA 3URYA 1JT8A 1ZYRD 3TN2A 5J3BA 4JI2L 1OTCA 4DNTB 4N8X1 1PRTC 3BVMA 1WTOA 4C1NK 2MPMA 4N9TA 4CGYB 3M7GA 1C9OA 1EIGA 2RDHA 2J0TD 2R7ZB 1B3QA 2V4DA 2OWOA 1YNNC 1DM0B 1SFOH 1VQDA 3S1NB 2NZHA 2ALYB 5M5YH 2JA7B 4GNXB 3M4YA 2E2IH 2AWOA 2HIXA 4K5XA 3HOXB 4FXDA 4A75A 3I55A 4HJ8A 5IWAL 5D14A 3V96A 5GROA 1BKBA 3OOCA 2TSSA 1SYGA 3PGZA 1TWFH 4DAYB 2B2WA 4S3SA 2KA7A 4J6HA 1UE1A 3QB3A 4A4IA 3DXJC 3HOWG 2HDLA 3DWPA 4LF8L 2FXQA 4RG1A 5LMUQ 1E2ZA 1BBUA 1PLFA 2YU9H 2I5LX 2MJ8A 4A3EG 3HFZB 2IL8A 5M3MB 2UU9Q 3MXUA 5IY0A 3OIPA 3H0GB 4F87A 1FNWA 4IQZA 2Q2TA 2WAQE 4K5WA 4GLXA 3K5LA 1E1TA 3J81L 2F0NA 1KXLA 2PQAA 4YHHQ 1MIUA 1ICWA 3T1YL 1EZ6A 2A6HC 1HUMA 3MFYA 1TWGH 4FNFA 4MHEA 2PMZE 3CCJA 2EZVA 3U9OA 3BZCA 2NUCA 3NSWA 4GNXA 3MXPA 4K5VA 1PRTF 1NBWA 4DR4L 4BA2I 1K8OA 2DGYA 1B3AA 2RKSA 4OGQC 3UE1A 3A54A 2QKIC 3A8IE 2Y0SB 3NENA 1I5FA 4RA8A 2Q8RE 1HRJA 3J80E 1X3EA 2QA4A 1BCPD 1EQRA 4DR5Q 4A3JH 4ALPA 3I4LA 2ATWA 3HKZE 4WORA 4OX9Q 4A3GG 4GOPC 4DR1Q 4HIOA 4LFAQ 4HAEA 3PUVA 4K6DA 3M3YB 1D5ZC 3DHQA 5ELCA 3F1ZA 2K33A 4QB4A 3NTIA 5KNBA 2R92G 4OWWB 5A2QE 3S16H 2C35B 3A55A 2EOTA 3HZXA 4A3LG 5ELBA 2WFWA 1SMYC 5GQOA 4YY3L 5IGGA 1JWSD 1MHWC 1WTQA 1STAA 1ET9A 3F8TA 4HJ5A 5C0XH 1XXGA 4C3HB 5KGUA 4A3CH 1O7YA 1DXMA 2F0UA 5LMNL 4XT1B 1AZPA 3NUCA 4RHRA 4IURA 2A73B 4JI7Q 2PCFB 2R7ZH 1I4RA 3A0JA 2D5DA 4L5QA 2G5DA 4B3SL 4DR2Q 3SDZA 3Q23A 3S1NH 2JA7H 4JI0L 4P75A 1XTCD 3G7LA 3HOXH 2PYKA 3NTHA 4GKJQ 3VYRA 3JAMi 2EYMA 2FJ2A 4IFDJ 4K0KQ 5ISRA 4A3DB 4JI3L 1FNUA 1ASYA 3K0YA 5CYUA 1Y8PB 2XRSD 1QVCA 3G6EA 2PW5A 4LK1C 1Q1BA 3G48A 1N36Q 4RGNA 1R4QB 2B2UC 1HNXQ 4PV1C 5LMNW 4R9WA 3GO5A 2KHSA 4O1NA 2IW3A 5JVG3 2IT1A 1PRTB 4MTKA 3R93A 3E0EA 1SE8A 5FJ8H 4FYDA 5M3MH 3TREA 4KHPQ 5ELEA 3I8ZA 1DJRD 1S5FD 2JN4A 1N34Q 5FLMH 2LS01 2K05A 3PQIA 1X3FA 2PW7A 1XMQL 1D2BA 3PUZA 4FXKC 4POFA 1NMGA 2I0QA 2JA9A 1X55A 4MNOA 3J7A5 3OYYA 3NHHA 4V0BA 3J81j 3FPPA 2CCZA 5EKLA 4CDEC 2UUAL 1QVGA 2KHJA 3UDGA 1EIFA 2Q2IA 4JI1L 5I2YA 1K83B 1B1ZA 4X66L 4UDUC 4C1NI 4L5RC 5C4XB 4JBKA 3TSSA 2R93B 2K5VA 5M3FB 2IY5B 4ZKBB 4A3MH 3NP8A 1G2SA 1UNSA 4NXNQ 1EY0A 4JOIC 2LSSA 1BDOA 1Q1EA 4H0LC 1SNCA 2WAQB 3ER0A 3L7ZC 3L9AX 1WTPA 2Z0SA 2B8GA 4DR6Q 3PIOA 3ITPA 4DR7L 4YWLA 4JI2Q 1HCZA 3J81c 4WJWA 1TWCB 4L5TA 2PMZB 1XYIA 1FJGL 2Z6KC 3GV3A 4BBSG 3M3YH 3PO2G 2JSOA 1K3RA 3TS2A 4JK1C 4OIJA 1A2UA 4KMUC 4DK3C 4A3KB 5CV9A 1E2WA 1Q46A 4JI8L 2JA6G 4BXXH 1BCPB 2PNHA 1RKNA 3CCVA 4GN5A 1SNDA 5EPKA 1XTDA 1S5DD 3K7AB 3NWTA 5IWAQ 5CR3A 3PMFA 1JWUD 1LTAD 2F4IA 5I6WA 1T9HA 3NE5B 2EJMA 1N33L 4C3HH 4RKBA 2SNSA 2VQEL 4DV5L 3HOZG 4WJ3M 1AW7A 4DAPA 4LF8Q 1HTLD 4ZAIA 4J8QA 3SVMA 3PUYA 4JI6L 1KAAA 4C3IG 1WI5A 2EJGC 2SDFA 2X6LA 5CC4A 3FKIH 1PTOD 1Z9FA 4P71A 4DV3L 3KLRA 1KDBA 4JCVE 4N8FA 4NKLA 4LW1A 3KF8B 4Y52H 4X3UA 3BG3A 1KNEA 3FPUB 4MN3A 4PG3A 4A3DH 4Q0FA 1PV4A 1Q12A 4ZYSA 1IXRA 4LF6L 2PNRC 3T1YQ 1WTHA 5FKAC 1I4GA 4DV6L 5I9PA 3HOUH 1HZAA 1WYDA 2EPBA 2EYFA 3PO3B 4RGOS 1EY7A 3MHBA 1JWMD 4DR4Q 5BR8L 4DV4L 2RHSB 4H7BA 2L0CA 2CH4A 3SK5A 2JEAI 3F2UA 3S1RB 3DUZA 2OXPA 2EYLA 1IZ6A 1YZ6A 3D4DA 1AZQA 1WCMH 1D1IA 1Y1VG 2JJQA 3OWFA 2IWHA 4X62L 3OW2A 2KCCA 5CBAE 1D7QA 5JJZA 3OPOA 5D3DA 2L12A 1F9SA 1RCVD 5IGEA 3HRZC 5FLXL 4DAVA 1JJGA 2RDFA 2RHQB 2Z6BA 2K4KA 1WTXA 1Y1WB 1EL0A 4GOPA 2GVAA 4GZYC 1EOTA 2L55A 1UUPA 3NEMA 5I9OA 1O78A 2VB3X 1K83H 1PZKD 5C4XH 1SYCA 3IAYA 3G71A 1A3TA 4UPAA 3CCLA 2R93H 3TP6A 1FGUA 5IGBA 1KQSA 4G57A 2VZAA 3AQQA 3NBHB 3VR2A 1PMRA 2FMMA 4YHHL 1PH6A 2DJGC 3ZYYX 4YY3Q 1A8VA 2ES2A 1VQGA 5LL6S 3CP0A 1TWCH 3QIAA 5ELNA 3K5NA 2NWGA 1EQQA 2QDLA 5LMNQ 1L0XB 4IPHA 2NYZD 1C48A 3GTJB 1PH7A 5H1SE 2K04A 4A3KH 4B3SQ 3CAMA 4OO1H 4MIUA 2BH2A 2ZM6L 2NZ1D 3TP5A 4DKAC 4A3FG 4JI0Q 4FP5D 2CVRA 1GKHA 4ZK9B 4GLVB 4R8IA 1Q82C 4A3MG 3PV0A 2K01A 1EEFD 2JA5H 3VYUA 3K7AH 4JI3Q 1SMXA 4XTCS 2B39A 2EYPA 5BN3A 3PUWA 1LTTD 1Q7YC 1E7ZA 5C0XJ 3CF5A 2NTSA 3CC2A 4BY7H 2N55A 4IUNA 4DAMA 2AHOB 3NBHA 3OMCA 3OIQA 3K81C 4NB3A 1H9JA 4LNQA 4JI5L 2EY6A 5JPMC 1IL2A 1B9MA 1DOKA 4HR7B 1CKMA 4R1JA 2B2UA 5KYIA 1HFGA 1EY9A 2JXMB 2I46A 2PZWA 1H9KA 3I4NH 1MGSA 2B63B 4IALA 3AYHB 1A6XA 1QUQA 4BXXG 2K5HA 3CCSA 1EQTA 3K57A 4A3BB 2B2TA 3RZDB 1EWIA 1XMQQ 1LTBD 4DV7L 3W3AA 4WRDA 3IKJA 3UI2A 4Y7NB 3JAML 5IT9L 4JYAL 3W2DA 1VQHA 1R9TH 5CBEE 1CHPD 1RF2D 1TVXA 1HR0L 4IUPA 2UUAQ 1PTOB 1QOHA 2HQLA 5HY6A 2CQOA 4DK6C 4JI1Q 4L8JA 3M4OB 2KEEA 4X66Q 5C44G 3BVGA 2Y0SE 3NWSA 5E3FA 4B9WA 1JORA 1XWEA 1CZGA 2HQEA 2F0KA 2VY3A 1YJNA 4LFCL 1V9PA 2O5IC 3H94A 5J22A 1GUTA 5CV5A 2I07B 3RR5A 3FDTA 4XT3B 1O80A 2FHTA 4JOIA 3ULJA 3OMGA 3I72A 1RD9D 1CM9A 3A5ZB 4LF4L 4DR7Q 2PZUA 1VQ6A 1E2VA 3I4MB 3X3NA 1V1OA 5IP7H 1MSGA 1FJGQ 2XN9C 4LUVA 2QEJC 1Y1WH 3HOVH 1LTSD 2OF1A 3M7NA 2DNEA 4HIDA 1WJJA 4Z9CB 2UXBL 2Z6KA 4ZCKA 3HOUG 2AQ2B 1HR0W 2CQAA 3E0JA 1PZID 4FF3A 1DGSA 1N34L 2KEDA 1VQNA 2A68D 2VB2X 1IW7D 3LNNA 2E2HB 2QEXA 2JQOA 3STBD 2BA0A 3CMEA 1YIJA 1BUVT 1V1QA 4FVMA 2Q8TA 1Z47A 2BDNA 3NELA 1KIXA 4L6TB 2K5NA 5C3EB 1IBLL 4HCEA 5IGCA 4XXEA 3MC0B 1EOVA 4NXMQ 4GS3A 1WCMG 4H02A 3H3VC 3ZJYC 1N33Q 4BBRG 1KNAA 1TS2A 1K8GA 3Q6SA 4QY7A 2VQEQ 3HOYB 1PH8A 3CU7A 4DV5Q 3CD6A 2JA8H 4HJ9A 1SBBB 4JI6Q 5KRUA 3CHBD 5JEAH 3HGBA 5I6YA 3T51B 3FHWA 2LKVA 4ZUIA 1OXUA 4DV3Q 5K36G 3J80i 2AUJD 1ET6A 1C4QA 1F77A 1J5EL 1NAPA 4FDBA 1A3VA 2IJ0A 4H13C 5JVH3 3TDQA 4AYBG 3GTGB 1N8RC 4R4IA 4LF6Q 3T1HL 2PQAB 4DV6Q 2F0OA 2AQ1B 2KUMA 5GADC 3PCOB 1EWHA 3ERQA 5A35A 1F9PA 1SE4A 3I70A 4PMWA 4O42A 2K5QA 2JK8A 3GDEA 3RMHA 4XYQA 1RL2A 4ABNA 1I4QA 1GVPA 5BR8Q 2PO4A 4DV4Q 3S1MH 2FINB 1I50B 1PRTD 2GN5A 4LAAA 4HJAA 4F88A 4OONA 1G51A 2B63H 1PH9A 2O5JC 4X62Q 2L4NA 3U4VA 4DV0L 4A3BH 3S1QH 3VDYA 1WVLA 3DM3A 1B4OA 1KRSA 3R2TA 3D4WA 2Q8IB 2F03A 2A6EC 2JA5G 4Y7NH 1YNND 3HKZG 5IOCA 2F0IA 4FF1A 1K0SA 4QL5A 4A93H 2L9HA 2A19A 4P2CB 1M4VA 4TRDA 3TZUA 1PTOH 3S2HB 2OTJA 4NP5A 1J9OA 1HA5A 1NTGA 1YEZA 2MFIA 2BCOA 1EIYB 5M9OA 5KNDA 2F0DA 3S9WA 4C3JB 2KCMA 1J8IA 1RDPD 2LXKA 4IFDI 1B70B 4HCSA 3F2DA 2RVLA 2JYOA 2DN8A 5CV8A 4IFDG 1SE2A 5IYDG 1BOSA 1FR3A 2NVQB 1KLGD 3NBIA 2VW9A 3PIO3 2WIIB 3EVQA 1BO0A 2ENBA 1PYBA 4FO2A 3H91A 5IT9c 5NUCA 3JAMc 5IP9G 3WDNA 2R7FA 1PDQA 2ZT9C 4DUZL 1J6QA 2LFNA 1L2FA 2A5HA 1HJPA 1CSQA 3W1GA 3A5UA 4KKUA 4AH6A 4F8MA 3I2ZA 1HNWL 1LLRD 2E2HH 2HIVA 2A6HD 2ZM6Q 1QWYA 1PH2A 2N49A 5KNCA 4R4OA 5C3EH 1KTKA 4X3SA 4BY1H 4PZ7A 4KK7A 2VUMH 1NUCA 5BN4A 4IUTA 4CKBA 3HOYH 1V43A 4A3IG 2ZXOA 1EFID 3KFUA 1UE6A 1D5MC 1X32A 1B53A 4JG2A 4JI5Q 5IYBH 3HOVG 5COYA 2XTIA 2F0TA 5IIFA 4XYOA 5FO9B 4KKTA 3MXNA 5DAUA 4MTNA 1CA6A 1BBXC 1VQKA 1YNJC 1STBA 3KLWA 2GVBA 5M5XB 3SK6A 4J1MA 3M4QA 1XNRQ 1BBWA 2YTXA 3GTGH 4DV7Q 3B6YA 3F2BA 3VR3A 3FEWX 4LUOA 1TWAB 4NW2A 3GTLB 3BDOA 2MUYA 4JYAQ 3K8AA 4RWSC 1VS0A 5CORA 4MZ9A 3RLNA 2E74C 1TY2A 1HR0Q 3G4SA 4C56C 4DR3L 1XMOL 2F0JA 4HMIA 3GTKB 3VYTA 2N88A 3LGJA 3C1EA 1SMYD 1QILA 1NMFA 2HDMA 2KVMA 4I7ZC 1I50H 2O4XA 4LFCQ 3MAQA 1TS4A 2PQEA 3BVZA 1EY6A 2D62A 1JCKB 2DY8A 1K28A 4RGTA 4F7XA 1Y14B 1B9NA 1BR9A 1Z6HA 4B3TL 4LF4Q 2VXWA 1K73C 1AP0A 2V1CC 5HURA 1S3OA 2YTYA 2K03A 2XIWA 2R7DA 3ONAB 5BN5A 2ZXRA 3DWAA 1PHJA 4LF9L 2E2DC 3S2HH 3EN2A 2UXBQ 2J7ZA 2B2TC 3ICEA 1XPOA 1I4XA 3QOJA 1CA5A 3NQIA 1TR5A 1LTLA 3H0GH 4G7OC 1KAWA 1QNKA 4GN4B 4ZUJA 1TWHB 5J39A 4IN3A 4IUUA 3S15B 1EEID 4IUVA 5I4DA 1G291 4YCVA 1IBLQ 2IHEA 4DNIA 4KV6A 3NTKA 5DLQE 2NVQH 4ULLA 2KENA 4V190 2B2YC 1XX8A 3FP9A 3DEOA 3SHLA 3VA5A 1PH1A 1JOOA 2WB1B 2IX3A 4BBRB 4DK1A 4EX5A 1RTOA 5K5PA 3AB9A 1VQIA 3TS0A 3HEJA 1K8AC 4A93G 2RQXA 2NB0A 3GV6A 3F2CA 3N52A 3U4ZA 2IX0A 1KLUD 1TY0A 2BA1A 4OXPA 4QIWE 1B2TA 1U9RA 1Q8IA 2A8VA 2DUDA 1J5EQ 4YCUA 2A74C 3Q8DA 2RSOA 2D2CC 4BS9A 2RCFA 4K2LA 2TMPA 2F4VL 3FRPB 1KDAA 4KHVA 1GO3E 3T1HQ 3C46A 2O2LD 3BZKA 3E3XA 1FNVA 1GHJA 1YNXA 4OIKA 1C0AA 5ELFA 3K7UC 1STYA 4HJ7A 1CKNB 3SR1A 3UDIA 3SGIA 4JW0A 4TSSA 2NVXB 1W2BA 2B3GA 1FL0A 1OXXK 4IJLA 1HA6A 1QB5D 3K6OA 1PFSA 3TBIB 1TU2B 4NXML 1X3QA 1F2ZA 4A3JG 4DV0Q 4GKKQ 1CSPA 5C6AA 5M5XH 5IT9E 2F0MA 3LWUA 3BYYB 3BDCA 1HZ9A 3HOWB 3D3RA 3GTLH 4K8IA 1G6ZA 2ID0A 2F0EA 2XNAC 1C7YA 1N32L 3EQLC 4BY1G 1S5BD 2VUMG 2K52A 4ID6A 4A3EB 2XRQD 3V05A 4GOPB 4CJ2C 3GTKH 1H9SA 3DMUA 4ILWA 1WOCA 2A69C 1VF7A 2K1BA 1STEA 1II3A 1SXTA 2F0PA 2YTVA 1D8LA 1IYUA 4LFBL 4HIKA 5C0XI 3NPPA 2E2JB 1U4LA 5A2QL 1CKNA 5IODA 3I3CA 1IL8A 3WWVA 5C0XG 3M85A 1HZCA 3K5OA 4A3CG 5D3IB 5EPLA 4EQOA 4HEDA 4UHVA 1SNMA 2QGQA 1NJIC 2B2VC 1HXYD 4JI4L 3A8JE 4K8JA 2R7ZG 3CPFA 4DUZQ 3EJIA 2B8FA 2CH4W 2E8GA 1CTMA 2K28A 5ELDA 1I3QB 1OXSC 1TWHH 2JA7G 1HNWQ 2BE5C 2X6GA 2OTLA 3NQTA 5JJKA 1FGBD 2EY5A 1I6VC 1EQVA 2HD3A 3HOXG 3MWYW 5EQ0A 5F2DA 3S15H 4A3GB 1MBYA 4RAUC 5IYCH 1QJOA 5C3WA 3IFTA 4HN7A 2JP1A 2H4OA 1VQMA 1CFMA 4DV2L 3P1HA 2MP1A 1LT4D 1EY4A 1KL9A 4NDXA 3RNUA 5C3XA 5M3FH 5C5MA 2VQFL 3CRKC 2SEBD 1Y69U 5GAEC 1I6HB 2R92B 4DK0A 2F1MA 4LF5L 3WOFA 1MKHA 4DUYL 4P73A 3HP3A 5FJ8G 1TKWB 5E1FA 5M3MG 3KK7A 2NTTA 1QVFA 1STHA 3H0GG 4KN4C 4OELB 5FLMG 4J15A 2EXDA 1QUQB 1IYJB 1QG7A 3PUXA 1UE5A 2I5MX 3J7AV 1MD2D 1LT6D 1JJ2A 5IE8A 3QG1A 2N8NA 2YYZA 2N78A 1EZ8A 3K0XA 2F0LA 3DM1A 4DR3Q 5FO8B 1XMOQ 1G91A 4XQQA 2F0QA 1HZBA 2D0PA 2Z1CA 3RD4A 1ZEQX 1KRTA 4X3TA 3EIVA 4G4KA 2Y0SG 4QIWB 2HUGA 4CKEA 1CUKA 1ICFB 2CHBD 2CW0C 1SRUA 1A63A 3D31A 1HTPA 4KD3A 1F9QA 1KD1C 2B29A 1VCIA 1VMPA 5CV4A 2EY1A 3CCUA 4RMFA 1SEBD 5DNFA 4JBMA 1VQLA 2UXDL 1CHQD 4B3TQ 2RBMA 2XWBB 1JOQA 1Q86C 4N9PA 3OSOA 4HSVA 4LF9Q 4A3EH 5FOBB 4DXFA 3MVVA 1VQJA 4LF7L 2AWNA 3J81E 2KQ3A 2X69A 1IYVA 1SAPA 4JVZA 1AN8A 4IPDA 1XNRL 1WTRA 3TZDA 5M5YB 4A76A 2AQ3B 2F3VA 4IOAA 2E2IB 1UEAB 1SSOA 1S72A 2IHFA 1WD0A 1IHZA 4TVAB 1EYCA 4KN7C 1RTNA 4EQNA 3VR5A 3PO3H 4CJ0B 1TWFB 4CHTB 2BH8A 4C3HG 4B3ML 2RA4A 1HHVA 1FD7D 2XSCA 3HG9A 1IBMQ 2B2YA 1B8AA 2OCEA 3GP7A 1JMCA 3S1RH 3I4OA 1WTWA 4IZ8A 4QUFA 2KCNA 1ZXTA 2CWAA 5EKKA 1I94Q 2BOSA 1YBYA 3V2TA 3FKIG 1JQYD 1WTVA 2ZTCA 4CDCC 3T4AC 1HQMC 4UP8A 1I3QH 4QGUA 1M90C 1E24A 1Y8OB 3I91A 1SYDA 5G3LF 2N3SA 2QILA 1O7IA 1OXTA 2Z9HA 2P5ZX 2XGTA 2EJFC 4A3DG 3UDXA 1EIHA 1UAPA 2RCNA 1IKLA 2OEOA 4BBSB 2F4VQ 1B50A 1LTRD 5DEHA 3PO2B 1M1KC 1F2YA 2ZJQA 3E9HA 1GXDC 2C9OA 1OO9B 3GD7A 2JA6B 3PF5A 3CCMA 5D65A 3TEHB 1I6HH 3KYHC 1LV9A 2K7VA 3C3LA 4PQXA 5J1ZA 3KDFB 1Q3LA 1CQVA 3OTOL 3E5SA 2D9UA 5GAHC 3QR8A 4IPGA 1I4PA 4ME5A 1W6JA 4O2DA 1Z7TA 1L1OC 3N6RA 4L5SA 2GA4B 1ASZA 1S5ED 5FLXc 4QQBX 5EJWA 4JV5L 2MO0A 4KD4A 1AE3A 3HOZB 3T56B 1G6PA 1SE3A 1SJED 2A1AA 3AFQA 1ZYRC 5IYCG 3GTJH 4C3IB 1LT3D 1N32Q 3T16A 4DN4M 4OHJA 2H1EA 2OQ0A 1YJ9A 4OWXB 1VQCA 5C4XG 2R93G 5M3FG 3D0FA 4I7AA 2EYHA 5LHY1 4K6LA 4IUQA 3HKSA 5M5WB 1YITA 1KC8C 1JR0D 5AJ3L 1S40A 2WAQG 3CMAA 4LFBQ 3I73A 1X3PA 3S14B 1KDCA 2DY7A 2MQHA 1LT5D 3OW7A 1XJVA 3D6WA 3P7JA 4EGVA 3K80C 3KJOA 1F2MA 2RDGA 3HS0C 1OXVA 1LM0A 1STGA 2I5HA 3KDFA 3TP7A 3Q0AA 2UUBL 2NZOA 5KEEA 2IPKD 1YVCA 3KLSX 3AU7A 4OO1I 4JI4Q 4A3KG 3K58A 2B2VA 3CW2C 4GKKL 4OO1G 1R4PB 2ZJPA 1Y1VB 1JICA 4P72A 1NR2A 3RZDH 1HNZL 2VL6A 3CPWA 1VQ7A 5FK9C 4RHSA 1U4PA 1LO5D 4CDDC 4G7ZC 2AUKA 1X65A 1PZJD 3TRZA 4IO9A 4BA1I 1PFBA 3BDLA 2WB1E 2F3IA 1TXYA 4BY7G 4DV2Q 1SNPA 3M4OH 4GN3B 2E5LL 3AFPA 4E6IA 2VQFQ 1ILPA 3S17B 5EKIA 1VDZA 4IPCA 5EGTA 1QNUA 4LF5Q 4DUYQ 3L0OA 4ZLTF 3I4NG 1ZKOA 1UWVA 2A6ED 2KHIA 4R4CA 3MXNB 5C4ZA 5CV6A 2RSNA 3S24A 4CDFC 2EYOA 3I4MH 1SYBA 1EU4A 4AYBE 4U673 1MI2A 3MXGA 4B9XA 1QZGA 3E6ZX 2L11A 4UY8C 3IRBA 1BCPC 5TSSA 4BBSH 1VQ8A 3PO2H 2SNMA 4H44C 4EQ5A 1STNA 1LACA 3EBEA 4QMGA 1VQPA 3PO3G 2EQSA 1N9WA 4DU9A 1CZWA 4RCNA 2JA6H 3PF4A 4EVOA 3PIPA 3X3MA 1LYLA 1SNQA 1HUNA 3VR6A 1NY4A 4A3FB 2EY2A 4KTAA 1Q81C 4A3MB 1K0RA 4KI0A 5JAVA 2K75A 5JOBA 1XPUA 5CV7A 1JE4A 3U9SA 1A3UA 4DAYA 1CK1A 2Z8LA 3A7AB 4QF4A 2MNAA 4AQYL 2XWJB 3MFGA 3GQBA 4UAIA 2E76C 1E22A 1GUSA 3ERSX 3CC4A 4PMCA 4C2MB 2UXDQ 5FO7B 4M8AA 1JB3A 4DNRB 5IP7G 3HOZH 4X6AH 2Q2HA 1IBKL 3RN2A 3UDFA 3J7AF 1Y1WG 3WOEA 2EXZA 4C3IH 3KBGA 2QDBA 4KKSA 1U4RA 1SNOA 4K14A 1GM5A 1AEXA 2QW7A 4B3RL 1T5EA 4LF7Q 2YV5A 2OQKA 4KHZA 2Z4HA 4ZRZA 3KF6B 1D1KA 1JOKA 5M5WH 2K5WA 4DV1L 1S4ZA 1GD7A 2EVBA 3MTSA 3S14H 1Q90A 4X65L 5JPNC 4IOCA 3LWEA 5CGKA 1GUGA 2MO1A 3BJUA 4M1UB 3ND8A 4NMZA 4B3MQ 1C8CA 1KABA 5C44B 4ODGA 2JA8G 2ICEC 2LXJA 2WKDA 1V8QA 4TQUS 1EU3A 4EQPA 3EFXD 3ULLA 1GOZA 2EYJA 5EBCA 3GTOB 1DZ1A 4JBJA 5L37A 1YNJD 1BCPF 1L1OB 5JEAG 1VQEA 1L0WA 1W6KA 2K14A 3DLLA 3FKIB 1H95A 2WINB 4QJFA 5FLXE 1Y1VH 2ZXPA 3VA7A 1VMCA 1VQ4A 2CWPA 1PH3A 5KIXA 3A74A 4P74A 2DJFC 2ICIA 2AMCB 1CI3M 3Q22A 2HHHL 3CC7A 4ZQ3A 3KF6A 3HOUB 2K50A 4HIMA 4C3JH 1E0BA 2QCPX 3U58A 4R4TA 5HGQA 3S17H 3IFDA 1EWCA 2PI2A 2KCTA 5C4JB 5DM63 3SXHA 3OTOQ 4UP9A 3K5MA 2B63G 5AFWA 1QZHA 1BQQT 1YI2A 1WCMB 1KHIA 3OWEB 4A3BG 2ZJRA 1IBML 4JV5Q 3MEHA 1DD2A
chains in the Genus database with same CATH topology
1GUOA 1NR4A 2Z4IA 3J7YW 3BZDB 2MHVA 4QCLA 2EDGA 2F3WA 4DGZA 3CRLC 2FFKB 4QUCA 1PFNA 1AFPA 4G7HC 2QF7A 1H9SB 2XVSA 3TMEA 3O13A 4RCOA 2PZTA 2NN6H 2KJXA 3QO2A 2NBFA 4AYBB 3R3OA 1TS5A 1QE6A 1DOMA 4XDXA 3DWQA 1PFMA 3S2DB 2WP8J 3T53B 4PNYA 4CJ1B 3D6CA 3GTQB 4WFN3 5JEAJ 1NCVA 1B44D 3CQZB 1ENFA 2F0VA 1F9RA 1GUWA 4CBVA 1RHPA 4DXGA 4HTHA 3CKIB 3JAME 1VF5C 3J80L 2K5DA 5C5LA 4L63B 1A2TA 1PTOC 3A8KE 2JA5B 3HKZB 5IGFA 3KUPA 2OT2A 4LMQD 3BS1A 1Y8NB 4BY7B 1LABA 3H09A 3VYSA 4DA2A 4RKLA 3QWNA 2FMCA 1RODA 2WACA 2F0HA 4FXGC 5LL6X 3I4NB 5EBDA 4B08A 3RZOB 1A15A 3GTPB 2F0SA 3RLFA 1F2LA 3R8BA 2NVTB 4KY6A 4HMJA 1GJXA 2A69D 1TQOA 3BYTB 1NSNS 4PMBA 1TS3A 4DFAA 1R9TB 3GTMB 1GHKA 1M8AA 2R3ZA 1U4MA 2JE6I 1S5CD 2SOBA 4DF7A 3NXWA 4OL7A 3KBXA 2B2WC 1PYWD 1SYFA 4FF2A 3DEPA 4LJZC 2WV6D 4KJOA 1L0YB 3RUZA 2F0FA 1HPCA 1ML0D 3EA6A 5E4WC 4A3IB 1PTOF 1ESFA 1DONA 4XQJA 1TT2A 2BE5D 1ILQA 3HOVB 2KECA 1IKMA 2NVYB 1G8ZD 2R6GA 3KF8A 5K36H 4C3JG 3K59A 2M9VA 3SE0A 1ONLA 2LMCB 2BDOA 4K2KA 3P20A 4BWGB 1PXUA 1RJTA 2K32A 2E75C 4U68A 5C4HA 4X3KA 4YIJA 1SJHD 1H9RA 1CQFA 2IX1A 3ND9A 1MSHA 3FVQA 3OHXC 3EROA 1T5XD 3I90A 3A56A 2JA8B 2M2LA 3VR4A 3R2IA 4RGMA 1ESRA 1SYEA 1ENAA 3FMCA 4RH6A 1FYCA 1BF4A 4XQNA 2NN6I 5IGDA 1DOLA 4RFBA 1O7ZA 1EYAA 2NN6G 1HFNA 5G3LD 1SDFA 3LX0A 1EYDA 4JBWA 1ENCA 2CW0D 3Q24A 1SFOB 3A7LA 3S1MB 4CKCA 5T1GA 1JC7A 4IFDH 1CT1D 2WKCA 2MGSA 2DNCA 2G9DA 4I65A 5DM73 3S1QB 4KJNA 4ZKCB 3G6JB 2K6AA 3IL8A 3L3OC 5EPJA 1QCBD 2YU9B 4A93B 2J4XA 2L1BA 1V1PB 2F0WA 1DCZA 3PIP3 2L5TA 3D8GA 1LTID 1K8MA 2A68C 1IW7C 4FF4A 1TWGB 5E4XA 3MZ5A 1H9MA 5HGTA 3P75A 2C5CA 4KY7A 5I2XA 1I4HA 3T13A 1DYQA 2EE1A 2R61A 2HCCA 3QJYA 2M00A 1LTGD 3D4RA 3SK4A 1EY5A 2PPBC 1BXTA 3C2PA 2VNUD 4A3JB 1D6EC 1BNZA 3AMUA 4Q5VA 4KY5A 3KLSA 2JEBI 3H6MA 1HQRD 3NK9A 1V1PA 4HSPA 5CMDA 3SEBA 4BY1B 3MA2B 2VUMB 1TIID 2G9HD 1GUNA 1O7LA 2HCIA 3QOLA 2F0GA 5T1IA 4R8NA 3S16B 4XIGS 4TKOB 3C1FA 2KOLA 2LY7A 5KYLA 3SK8A 1EY8A 3TP8A 1WD1A 1D5XC 1G2TA 3URYA 1ZYRD 3TN2A 4DNTB 1PRTC 3BVMA 1WTOA 4C1NK 2MPMA 4N9TA 4CGYB 3M7GA 1EIGA 2RDHA 2J0TD 2R7ZB 2V4DA 1YNNC 1DM0B 3S1NB 2JA7B 3M4YA 2AWOA 4K5XA 3HOXB 4FXDA 5D14A 3V96A 3OOCA 2TSSA 1SYGA 2B2WA 4S3SA 2KA7A 4J6HA 3QB3A 3DXJC 2HDLA 3DWPA 1E2ZA 1PLFA 2MJ8A 2IL8A 5M3MB 3MXUA 3OIPA 3H0GB 4F87A 1FNWA 4IQZA 4K5WA 3K5LA 3J81L 2F0NA 1ICWA 1EZ6A 2A6HC 1HUMA 3MFYA 4FNFA 4MHEA 2EZVA 3U9OA 2NUCA 3NSWA 3MXPA 4K5VA 1PRTF 4BA2I 1K8OA 1B3AA 2RKSA 4OGQC 3A54A 2QKIC 3A8IE 2Y0SB 4RA8A 2Q8RE 1HRJA 3J80E 1BCPD 3I4LA 4WORA 4HAEA 3PUVA 4K6DA 3M3YB 1D5ZC 3DHQA 5ELCA 2K33A 4QB4A 3NTIA 5KNBA 5A2QE 3A55A 2EOTA 3HZXA 5ELBA 1SMYC 5IGGA 1JWSD 1WTQA 1STAA 1ET9A 5C0XH 1XXGA 4C3HB 5KGUA 1O7YA 1DXMA 2F0UA 4XT1B 1AZPA 3NUCA 4RHRA 4IURA 2A73B 2PCFB 1I4RA 2D5DA 3SDZA 3Q23A 1XTCD 3G7LA 2PYKA 3NTHA 3VYRA 2EYMA 2FJ2A 4IFDJ 5ISRA 4A3DB 1FNUA 3K0YA 5CYUA 1Y8PB 2XRSD 2PW5A 4LK1C 1Q1BA 4RGNA 1R4QB 2B2UC 4PV1C 4R9WA 3GO5A 2KHSA 4O1NA 2IW3A 5JVG3 2IT1A 1PRTB 3R93A 4FYDA 5ELEA 3I8ZA 1DJRD 1S5FD 2LS01 2K05A 2PW7A 1D2BA 3PUZA 4FXKC 3NHHA 4V0BA 3FPPA 5EKLA 5I2YA 1K83B 1B1ZA 4C1NI 4UDUC 5C4XB 3TSSA 2R93B 5M3FB 4ZKBB 3NP8A 1G2SA 1UNSA 1EY0A 1BDOA 1Q1EA 4H0LC 1SNCA 2WAQB 3L7ZC 3L9AX 1WTPA 2B8GA 3ITPA 1HCZA 4WJWA 1TWCB 2PMZB 1XYIA 3GV3A 2JSOA 4JK1C 4OIJA 1A2UA 4KMUC 4A3KB 5CV9A 1E2WA 1BCPB 1RKNA 1SNDA 5EPKA 1S5DD 3K7AB 3NWTA 5CR3A 3PMFA 1JWUD 1LTAD 2F4IA 5I6WA 3NE5B 2EJMA 4RKBA 2SNSA 1AW7A 4DAPA 1HTLD 4ZAIA 4J8QA 3SVMA 3PUYA 1KAAA 4C3IG 2EJGC 2X6LA 2SDFA 5CC4A 1PTOD 3KLRA 1KDBA 4NKLA 4X3UA 3BG3A 1KNEA 3FPUB 4MN3A 4Q0FA 1Q12A 4ZYSA 2PNRC 5FKAC 1I4GA 5I9PA 2EPBA 2EYFA 3PO3B 4RGOS 1EY7A 3MHBA 1JWMD 4H7BA 2L0CA 3SK5A 2JEAI 3F2UA 3S1RB 3DUZA 2OXPA 2EYLA 3D4DA 1AZQA 3OWFA 1D1IA 2IWHA 2KCCA 5CBAE 5JJZA 3OPOA 5D3DA 2L12A 1F9SA 1RCVD 5IGEA 3HRZC 5FLXL 4DAVA 2RDFA 1WTXA 1EL0A 1Y1WB 4GZYC 1EOTA 2L55A 1UUPA 5I9OA 1O78A 2VB3X 1PZKD 3IAYA 1SYCA 1A3TA 3TP6A 5IGBA 4G57A 3VR2A 1PMRA 2FMMA 3ZYYX 5LL6S 3QIAA 3K5NA 2NWGA 1L0XB 2NYZD 1C48A 3GTJB 2K04A 4OO1H 4MIUA 2NZ1D 3TP5A 4FP5D 2CVRA 4ZK9B 4R8IA 3PV0A 2K01A 1EEFD 3VYUA 4XTCS 2B39A 2EYPA 5BN3A 3PUWA 1LTTD 5C0XJ 2NTSA 2N55A 4IUNA 3NBHA 3OMCA 3OIQA 1H9JA 5JPMC 2EY6A 1B9MA 1DOKA 4HR7B 2B2UA 5KYIA 1HFGA 1EY9A 2JXMB 2I46A 2PZWA 1H9KA 1MGSA 2B63B 4IALA 1A6XA 1EQTA 3K57A 4A3BB 2B2TA 3RZDB 1LTBD 3W3AA 4WRDA 3IKJA 3UI2A 4Y7NB 3JAML 5IT9L 3W2DA 5CBEE 1CHPD 1RF2D 1TVXA 4IUPA 1PTOB 1QOHA 4L8JA 3M4OB 2KEEA 3BVGA 3NWSA 5E3FA 4B9WA 1JORA 1XWEA 1CZGA 2HQEA 2F0KA 2O5IC 3H94A 5J22A 1GUTA 5CV5A 2I07B 3FDTA 4XT3B 1O80A 2FHTA 3OMGA 3I72A 1RD9D 1CM9A 2PZUA 1E2VA 3I4MB 3X3NA 1V1OA 1MSGA 2XN9C 2QEJC 1LTSD 2OF1A 3M7NA 2DNEA 4Z9CB 2AQ2B 2CQAA 3E0JA 1PZID 4FF3A 2KEDA 2A68D 2VB2X 1IW7D 3LNNA 2E2HB 2BA0A 1BUVT 4FVMA 2Q8TA 1Z47A 2BDNA 4L6TB 5C3EB 4HCEA 5IGCA 4XXEA 3MC0B 3H3VC 1KNAA 1TS2A 3Q6SA 3HOYB 3CU7A 1SBBB 5KRUA 3CHBD 5JEAH 3HGBA 5I6YA 3T51B 2LKVA 4ZUIA 1OXUA 5K36G 2AUJD 1ET6A 1C4QA 1F77A 1NAPA 1A3VA 2IJ0A 4H13C 5JVH3 3TDQA 3GTGB 2F0OA 2AQ1B 2KUMA 1EWHA 3ERQA 5A35A 1F9PA 1SE4A 3I70A 4PMWA 4O42A 2K5QA 3RMHA 4XYQA 4ABNA 1I4QA 2PO4A 2FINB 1I50B 1PRTD 4LAAA 4F88A 2O5JC 2L4NA 1WVLA 1B4OA 3R2TA 2Q8IB 3D4WA 2F03A 2A6EC 1YNND 5IOCA 2F0IA 4FF1A 2L9HA 4TRDA 4P2CB 1M4VA 3TZUA 1PTOH 3S2HB 4NP5A 1J9OA 1HA5A 2BCOA 5M9OA 5KNDA 2F0DA 3S9WA 4C3JB 1J8IA 1RDPD 4IFDI 4HCSA 2RVLA 2JYOA 2DN8A 5CV8A 4IFDG 1SE2A 1BOSA 1FR3A 2NVQB 1KLGD 3NBIA 3PIO3 2WIIB 3EVQA 1BO0A 2ENBA 4FO2A 3H91A 5NUCA 3WDNA 1PDQA 2ZT9C 2LFNA 2A5HA 4KKUA 4F8MA 1LLRD 2A6HD 1QWYA 5KNCA 1KTKA 4X3SA 4KK7A 1NUCA 5BN4A 4IUTA 4CKBA 1V43A 2ZXOA 1EFID 1D5MC 1X32A 1B53A 5COYA 2F0TA 5IIFA 4XYOA 5FO9B 4KKTA 3MXNA 5DAUA 1CA6A 1BBXC 1YNJC 1STBA 5M5XB 3SK6A 4J1MA 3VR3A 3FEWX 1TWAB 4NW2A 3GTLB 3BDOA 2MUYA 4RWSC 5CORA 2E74C 1TY2A 4C56C 2F0JA 4HMIA 3GTKB 3VYTA 2N88A 3C1EA 1SMYD 1QILA 2HDMA 2KVMA 4I7ZC 2O4XA 3MAQA 1TS4A 2PQEA 3BVZA 1EY6A 2D62A 1JCKB 2DY8A 4RGTA 4F7XA 1B9NA 1BR9A 1Z6HA 2VXWA 1AP0A 5HURA 2K03A 2XIWA 3ONAB 5BN5A 2ZXRA 3DWAA 2E2DC 2J7ZA 2B2TC 1I4XA 3QOJA 1CA5A 3NQIA 1TR5A 4G7OC 1QNKA 4ZUJA 1TWHB 5J39A 4IN3A 4IUUA 3S15B 1EEID 4IUVA 5I4DA 1G291 4KV6A 3NTKA 4ULLA 4V190 2B2YC 1XX8A 3DEOA 3SHLA 3VA5A 1JOOA 2WB1B 2IX3A 4BBRB 4DK1A 5K5PA 1RTOA 3AB9A 3HEJA 2RQXA 2NB0A 3GV6A 3N52A 2IX0A 1KLUD 1TY0A 2BA1A 1B2TA 1U9RA 1Q8IA 2A74C 2RSOA 2D2CC 4BS9A 4K2LA 2TMPA 3FRPB 1KDAA 4KHVA 3C46A 2O2LD 1FNVA 1GHJA 4OIKA 5ELFA 1STYA 3SR1A 4TSSA 2NVXB 1OXXK 1HA6A 1QB5D 3K6OA 3TBIB 1TU2B 1X3QA 1F2ZA 5C6AA 5IT9E 2F0MA 3LWUA 3BYYB 3BDCA 3HOWB 3D3RA 4K8IA 1G6ZA 2ID0A 2F0EA 2XNAC 3EQLC 1S5BD 4ID6A 4A3EB 2XRQD 3V05A 4CJ2C 1H9SA 3DMUA 4ILWA 2A69C 1VF7A 2K1BA 1STEA 1II3A 1SXTA 2F0PA 1IYUA 5C0XI 3NPPA 2E2JB 1U4LA 5A2QL 5IODA 3I3CA 1IL8A 5C0XG 3M85A 3K5OA 5D3IB 5EPLA 4EQOA 4HEDA 1SNMA 2B2VC 1HXYD 3A8JE 4K8JA 3EJIA 2B8FA 1CTMA 2K28A 5ELDA 1I3QB 1OXSC 2BE5C 2X6GA 3NQTA 1FGBD 2EY5A 1I6VC 1EQVA 3MWYW 5EQ0A 5F2DA 4A3GB 1MBYA 4RAUC 1QJOA 5C3WA 3IFTA 4HN7A 2JP1A 2H4OA 1CFMA 3P1HA 2MP1A 1LT4D 1EY4A 4NDXA 5C3XA 5C5MA 3CRKC 2SEBD 1Y69U 1I6HB 2R92B 4DK0A 2F1MA 3WOFA 3HP3A 1TKWB 5E1FA 3KK7A 2NTTA 1STHA 4KN4C 1QG7A 3PUXA 3J7AV 1MD2D 1LT6D 3QG1A 2YYZA 1EZ8A 2F0LA 3DM1A 5FO8B 1G91A 4XQQA 2F0QA 2Z1CA 3RD4A 1ZEQX 4X3TA 4G4KA 4QIWB 2HUGA 4CKEA 2CHBD 2CW0C 3D31A 1HTPA 4KD3A 1F9QA 1VCIA 1VMPA 5CV4A 2EY1A 1SEBD 5DNFA 1CHQD 2RBMA 2XWBB 1JOQA 4N9PA 3OSOA 4HSVA 5FOBB 4DXFA 3MVVA 2AWNA 3J81E 2KQ3A 2X69A 1IYVA 1SAPA 1AN8A 1WTRA 3TZDA 5M5YB 2AQ3B 2F3VA 2E2IB 1UEAB 1SSOA 1WD0A 1IHZA 1EYCA 4KN7C 1RTNA 4EQNA 3VR5A 4CJ0B 1TWFB 4CHTB 4C3HG 2RA4A 1HHVA 1FD7D 2XSCA 3HG9A 2B2YA 3GP7A 1WTWA 4IZ8A 4QUFA 2KCNA 1ZXTA 5EKKA 2BOSA 3V2TA 1JQYD 1WTVA 3T4AC 1HQMC 1Y8OB 3I91A 1SYDA 5G3LF 2QILA 1OXTA 2EJFC 1EIHA 1UAPA 1IKLA 2OEOA 4BBSB 1B50A 1LTRD 5DEHA 3PO2B 1F2YA 1GXDC 2C9OA 1OO9B 3GD7A 2JA6B 5D65A 1LV9A 2K7VA 3C3LA 4PQXA 5J1ZA 1Q3LA 1CQVA 3E5SA 2D9UA 1I4PA 4ME5A 1W6JA 1Z7TA 3N6RA 2GA4B 1S5ED 5EJWA 4KD4A 3HOZB 3T56B 1SE3A 1SJED 1ZYRC 4C3IB 1LT3D 3T16A 4DN4M 4OHJA 2H1EA 2EYHA 5LHY1 4K6LA 4IUQA 5M5WB 1JR0D 3I73A 1X3PA 3S14B 1KDCA 2DY7A 1LT5D 3OW7A 3D6WA 3P7JA 4EGVA 1F2MA 2RDGA 3HS0C 1OXVA 1STGA 3TP7A 3Q0AA 5KEEA 2IPKD 3KLSX 3AU7A 4OO1I 3K58A 2B2VA 4OO1G 1R4PB 1Y1VB 1JICA 1NR2A 5FK9C 4RHSA 1U4PA 1LO5D 4G7ZC 2AUKA 1PZJD 4BA1I 1PFBA 3BDLA 1SNPA 4E6IA 1ILPA 3S17B 5EKIA 1VDZA 5EGTA 1QNUA 4ZLTF 1ZKOA 2A6ED 5C4ZA 5CV6A 2RSNA 2EYOA 1SYBA 1EU4A 4U673 1MI2A 3MXGA 4B9XA 3E6ZX 2L11A 1BCPC 5TSSA 2SNMA 4H44C 1STNA 1LACA 4QMGA 4DU9A 1CZWA 4RCNA 4EVOA 3X3MA 1SNQA 1HUNA 3VR6A 4A3FB 2EY2A 4KTAA 4A3MB 4KI0A 5JAVA 5JOBA 5CV7A 1JE4A 3U9SA 1A3UA 4DAYA 1CK1A 2Z8LA 3A7AB 4QF4A 2XWJB 3MFGA 3GQBA 4UAIA 2E76C 1GUSA 4PMCA 4C2MB 5FO7B 4M8AA 1JB3A 4DNRB 3J7AF 3WOEA 2EXZA 3KBGA 2QDBA 4KKSA 1U4RA 1SNOA 4K14A 1AEXA 1T5EA 4KHZA 2Z4HA 4ZRZA 1D1KA 1JOKA 2K5WA 1S4ZA 2EVBA 3MTSA 1Q90A 5JPNC 3LWEA 5CGKA 1GUGA 4M1UB 3ND8A 4NMZA 1C8CA 1KABA 5C44B 4ODGA 2ICEC 2WKDA 1V8QA 4TQUS 1EU3A 4EQPA 3EFXD 1DZ1A 5EBCA 1GOZA 2EYJA 3GTOB 1YNJD 1BCPF 5JEAG 1W6KA 3FKIB 2WINB 5FLXE 3VA7A 2ZXPA 1VMCA 5KIXA 2ICIA 1CI3M 3Q22A 4ZQ3A 3HOUB 1E0BA 2QCPX 3IFDA 1EWCA 5C4JB 5DM63 3SXHA 3K5MA 5AFWA 1BQQT 1WCMB 3OWEB 3MEHA 1DD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BDO A;  1CFM A;  4DNR B;  4JBW A;  1GUO A;  1GJX A;  2A69 D;  1OXV A;  4LK1 C;  2E74 C;  1GHJ A;  1Q1B A;  3M7N A;  2DNE A;  3TZU A;  2EDG A;  3PUY A;  4KKS A;  3CRK C;  1GUN A;  1GHK A;  4BA2 I;  1K8O A;  4PV1 C;  2EJG C;  1O7L A;  3CRL C;  1Y69 U;  4OGQ C;  2JE6 I;  3A7L A;  4DK0 A;  2F1M A;  5KND A;  3A8I E;  2A68 D;  2IT1 A;  4XIG S;  1T5E A;  1IW7 D;  3LNN A;  4I7Z C;  1OXX K;  4KHZ A;  4G7H C;  2QF7 A;  1H9S B;  4OO1 H;  1TKW B;  4TKO B;  4OO1 G;  1HQM C;  3KLR A;  2BA0 A;  1TU2 B;  2D62 A;  1Y8O B;  2NN6 H;  3PV0 A;  4IFD H;  4KN4 C;  3BG3 A;  2DN8 A;  4IFD G;  2DNC A;  3I4L A;  1OXT A;  4LJZ C;  4G7Z C;  1FR3 A;  3PUX A;  3PUZ A;  4DNT B;  2AUK A;  1B9N A;  1Q12 A;  1Z6H A;  2EJF C;  2EVB A;  3LWU A;  1Q90 A;  4XTC S;  5BN3 A;  3PUW A;  2PNR C;  4BA1 I;  3T53 B;  1GUG A;  1HPC A;  3FPP A;  3ND8 A;  3PUV A;  3QG1 A;  3VR5 A;  2YYZ A;  3EQL C;  3WDN A;  5BN5 A;  1H9J A;  2BE5 D;  2K33 A;  2V4D A;  1V8Q A;  3GD7 A;  4TQU S;  2ZT9 C;  1B9M A;  1YNN C;  1H9S A;  5JEA H;  4HR7 B;  1VDZ A;  3HGB A;  2A69 C;  3T51 B;  2K7V A;  5KNB A;  5JEA G;  2JEA I;  4G7O C;  2R6G A;  2JXM B;  1VF7 A;  4KKU A;  3M4Y A;  1H9K A;  1DCZ A;  2AWO A;  5K36 H;  1BDO A;  2L5T A;  1OXU A;  1Q1E A;  2A6H D;  3SE0 A;  1ONL A;  1ZKO A;  2A6E D;  2BDO A;  2CW0 C;  2LMC B;  4H0L C;  3L7Z C;  3VA7 A;  2AUJ D;  3MFY A;  5K36 G;  1A6X A;  3P20 A;  2B8G A;  1VF5 C;  1K8M A;  1SMY C;  1HTP A;  1IYU A;  2KCC A;  3D31 A;  5KNC A;  4H13 C;  1G29 1;  2A68 C;  3OOC A;  1VCI A;  1Z7T A;  3OPO A;  1IW7 C;  3N6R A;  2K32 A;  3A8K E;  2E75 C;  1HCZ A;  3W3A A;  5C0X H;  3IKJ A;  2KA7 A;  5C0X G;  5BN4 A;  3M85 A;  3DXJ C;  1CI3 M;  3T56 B;  1DXM A;  1H9R A;  1H9M A;  1EWH A;  1ZYR C;  5A35 A;  4H44 C;  3ND9 A;  1Y8N B;  4GZY C;  1V43 A;  1LAB A;  1O78 A;  1LAC A;  1E2Z A;  4DK1 A;  4L8J A;  2PCF B;  3QJY A;  4JK1 C;  3AB9 A;  3A8J E;  4KMU C;  4RCN A;  2D5D A;  3VR4 A;  1E2W A;  3D4R A;  2B8F A;  3SDZ A;  3MXU A;  1CTM A;  3VR6 A;  1IYV A;  4KKT A;  3VR2 A;  1PMR A;  2PPB C;  2O5I C;  1OXS C;  4KI0 A;  3FMC A;  3H94 A;  1GUT A;  2BE5 C;  2BA1 A;  1I6V C;  1FYC A;  3U9S A;  4IQZ A;  3A7A B;  2O5J C;  2NN6 I;  1YNJ C;  3I73 A;  3GQB A;  2E76 C;  1GUS A;  3I72 A;  1QJO A;  2Q8I B;  2D2C C;  3NE5 B;  3RLF A;  2A6H C;  1E2V A;  2JEB I;  2EJM A;  2NN6 G;  1Y8P B;  2A6E C;  3IFT A;  3OW7 A;  4KN7 C;  3VR3 A;  1DD2 A;  3QIA A; 
#chains in the Genus database with same CATH topology
 1L1O A;  1GUO A;  1NR4 A;  1I94 L;  1PVO A;  2Z4I A;  1YHB A;  3J7Y W;  3BZD B;  2MHV A;  4QCL A;  2EDG A;  2F3W A;  4DGZ A;  3CRL C;  2FFK B;  2UXC L;  3RLO A;  4QUC A;  1PFN A;  1MJE A;  1AFP A;  4G7H C;  2QF7 A;  1H9S B;  2XVS A;  3TME A;  4A3F H;  3O13 A;  2ZTE A;  4RCO A;  2PZT A;  2NN6 H;  2KJX A;  3QO2 A;  2NBF A;  4AYB B;  3R3O A;  5AJ3 Q;  3ULP A;  1TS5 A;  1QE6 A;  1B7Y B;  1DOM A;  1VQ5 A;  4XDX A;  3DWQ A;  4C2M H;  1PFM A;  3S2D B;  2WP8 J;  3T53 B;  3I4M G;  4PNY A;  4CJ1 B;  1SN8 A;  3D6C A;  3GTQ B;  1HH2 P;  4WFN 3;  5JEA J;  2UUB Q;  1NCV A;  1X54 A;  1B44 D;  3CQZ B;  1ENF A;  2F0V A;  1F9R A;  1W3S A;  1GUW A;  1PH5 A;  4CBV A;  1RHP A;  5EAY A;  1XNQ L;  4DXG A;  4HTH A;  1MJC A;  2EIF A;  3CKI B;  4YWK A;  3JAM E;  2F52 A;  1VF5 C;  1HNZ Q;  3J80 L;  2K5D A;  5C5L A;  4L63 B;  1A2T A;  1PTO C;  1TWA H;  3A8K E;  2JA5 B;  5C3E G;  2CKZ B;  3HKZ B;  2D0O A;  1X3G A;  5IGF A;  4NPS A;  2H5X A;  3KUP A;  2OT2 A;  1K3B C;  4LMQ D;  3BS1 A;  3JC6 6;  1Y8N B;  2E5L Q;  4BY7 B;  1LAB A;  2UUC L;  3HOY G;  5C44 H;  3H09 A;  3VYS A;  4DA2 A;  4RKL A;  3QWN A;  4X64 L;  3GTO H;  3H3V H;  2FMC A;  5IYB G;  1ROD A;  2WAC A;  2F0H A;  4FXG C;  5LL6 X;  1NE3 A;  1SR3 A;  3I4N B;  3MEF A;  5EBD A;  1E1O A;  4B08 A;  1A15 A;  3RZO B;  5E7N A;  3GTP B;  2F0S A;  3RLF A;  1F2L A;  3R8B A;  2NVT B;  1A62 A;  4KY6 A;  4HMJ A;  1GJX A;  2A69 D;  4LWC A;  3M9B A;  1SRO A;  1TQO A;  3BYT B;  1NSN S;  1TS3 A;  4PMB A;  4DFA A;  1R9T B;  3GTM B;  1AH9 A;  1GHK A;  1M8A A;  2R3Z A;  1U4M A;  1RIP A;  2JE6 I;  4GLA C;  4LUZ A;  3RN5 A;  4O0A A;  2Q2U A;  1S5C D;  3J81 i;  2SOB A;  4DF7 A;  3NXW A;  4OL7 A;  1PA6 A;  3KBX A;  2CFM A;  5C4J H;  2B2W C;  3CCR A;  1PYW D;  1SYF A;  4FF2 A;  3DEP A;  4AQY Q;  4LJZ C;  1JB7 A;  4WJ4 A;  2WV6 D;  4KJO A;  1L0Y B;  3RUZ A;  2F0F A;  1XPR A;  4BBR H;  3AEV A;  1HPC A;  1ML0 D;  3EA6 A;  5E4W C;  4A3I B;  1PTO F;  5LMU L;  1PYS B;  5GAG C;  1IBK Q;  1ESF A;  1DON A;  4XQJ A;  1TT2 A;  1EUJ A;  2BE5 D;  1ILQ A;  3HOV B;  1AE2 A;  2KEC A;  1IKM A;  1Q8K A;  2NVY B;  2UU9 L;  4B3R Q;  1G8Z D;  2R6G A;  3KF8 A;  5K36 H;  4C3J G;  3K59 A;  2M9V A;  3SE0 A;  1ONL A;  2RF4 A;  2LMC B;  2BDO A;  4POG A;  4K2K A;  3P20 A;  2VS1 A;  4BWG B;  1PXU A;  1RJT A;  4DV1 Q;  3CCE A;  2K32 A;  2E75 C;  4PZ8 A;  4JC0 A;  4GNX C;  2L15 A;  4U68 A;  4X65 Q;  5C4H A;  3E9I A;  3S2D H;  4X3K A;  4YIJ A;  1SJH D;  4YCW A;  1H9R A;  1CQF A;  2IX1 A;  1JJC B;  3ND9 A;  1MSH A;  3FVQ A;  3OHX C;  3ERO A;  2NVX H;  3GTQ H;  4R4Q A;  1T5X D;  3I90 A;  3A56 A;  2JA8 B;  3CQZ H;  2M2L A;  3VR4 A;  3R2I A;  4OWT B;  1WFQ A;  3W1B A;  4RGM A;  3H15 A;  1ESR A;  1SYE A;  1ENA A;  3FMC A;  4RH6 A;  1FYC A;  1BF4 A;  4DR5 L;  4IJH A;  4XQN A;  2NN6 I;  5IGD A;  1DOL A;  4OX9 L;  3HOW H;  1EFW A;  1CKO A;  4DR1 L;  4RFB A;  1O7Z A;  4LFA L;  1EYA A;  2NN6 G;  4AIM A;  1UEB A;  1HFN A;  5G3L D;  1SDF A;  3LX0 A;  1EYD A;  4JBW A;  1ENC A;  3TQY A;  2HHH Q;  4OEM B;  1U0L A;  2CW0 D;  1K9M C;  3Q24 A;  1NNX A;  1SFO B;  3A7L A;  1VQ9 A;  5ELO A;  3S1M B;  4CKC A;  5T1G A;  2E2J H;  3CCQ A;  1X56 A;  1JC7 A;  4IFD H;  1CT1 D;  2WKC A;  5IYD H;  2MGS A;  2DNC A;  2G9D A;  3RZO H;  4I65 A;  3J80 c;  1FVI A;  3GTP H;  4PZ6 A;  1LUZ A;  2KBN A;  5DM7 3;  3S1Q B;  4KJN A;  2NVT H;  4ZKC B;  1UE7 A;  5IP9 H;  3G6J B;  2K6A A;  1VQF A;  3IL8 A;  1X9N A;  4JI7 L;  3L3O C;  5EPJ A;  1QCB D;  2YU9 B;  3PSI A;  3GTM H;  4A93 B;  1P8L A;  2J4X A;  2L1B A;  4DR2 L;  1V1P B;  3UE0 A;  3W5O A;  2UXC Q;  3H3V I;  2F0W A;  1DCZ A;  3PIP 3;  4DPG A;  2L5T A;  4GKJ L;  4A3G H;  3D8G A;  1LTI D;  1K8M A;  1X6O A;  4K0K L;  2ZTD A;  2A68 C;  1IW7 C;  3KJP A;  4KLK A;  1BVS A;  4FF4 A;  3STB C;  1A0I A;  1TWG B;  5E4X A;  1P16 A;  3MZ5 A;  2HT1 A;  1H9M A;  5HGT A;  1N36 L;  4A3I H;  1HNX L;  3L2P A;  3P75 A;  1JE5 A;  2C5C A;  4JPB W;  4KY7 A;  5I2X A;  2R92 H;  1I4H A;  2R61 A;  1DYQ A;  2EE1 A;  3QJY A;  2HCC A;  3T13 A;  2M00 A;  1YJW A;  1LTG D;  4A3L H;  3M4P A;  3D4R A;  4APV A;  1PH4 A;  2NVY H;  3BU2 A;  3I56 A;  3SK4 A;  4KHP L;  1EY5 A;  2PPB C;  1BXT A;  3C2P A;  1XNQ Q;  2VNU D;  4JI8 Q;  2ASB A;  3CXC A;  4A3J B;  1D6E C;  1BNZ A;  3AMU A;  4Q5V A;  4YWM A;  2PI2 E;  4KY5 A;  3KLS A;  4UP7 A;  1VQB A;  2JEB I;  1U5K A;  3H6M A;  1YHQ A;  1HQR D;  3NK9 A;  1V1P A;  4HSP A;  5CMD A;  5JJL A;  3SEB A;  4BY1 B;  3MA2 B;  2VUM B;  1TII D;  2WB1 G;  3I7F A;  2G9H D;  1GUN A;  2UUC Q;  5JJI A;  1O7L A;  1YHA A;  2HCI A;  1EYG A;  2AKW B;  3QOL A;  2F0G A;  1VQA A;  5T1I A;  1VQO A;  4NXN L;  4X64 Q;  4R8N A;  3S16 B;  4XIG S;  4ME3 A;  3J7Z C;  3U50 C;  4TKO B;  3KOJ A;  3C1F A;  2KOL A;  1E3P A;  2LY7 A;  5KYL A;  3SK8 A;  4DR6 L;  1EY8 A;  1SLJ A;  3TP8 A;  1WD1 A;  1D5X C;  1G2T A;  3URY A;  1JT8 A;  1ZYR D;  3TN2 A;  5J3B A;  4JI2 L;  1OTC A;  4DNT B;  4N8X 1;  1PRT C;  3BVM A;  1WTO A;  4C1N K;  2MPM A;  4N9T A;  4CGY B;  3M7G A;  1C9O A;  1EIG A;  2RDH A;  2J0T D;  2R7Z B;  1B3Q A;  2V4D A;  2OWO A;  1YNN C;  1DM0 B;  1SFO H;  1VQD A;  3S1N B;  2NZH A;  2ALY B;  5M5Y H;  2JA7 B;  4GNX B;  3M4Y A;  2E2I H;  2AWO A;  2HIX A;  4K5X A;  3HOX B;  4FXD A;  4A75 A;  3I55 A;  4HJ8 A;  5IWA L;  5D14 A;  3V96 A;  5GRO A;  1BKB A;  3OOC A;  2TSS A;  1SYG A;  3PGZ A;  1TWF H;  4DAY B;  2B2W A;  4S3S A;  2KA7 A;  4J6H A;  1UE1 A;  3QB3 A;  4A4I A;  3DXJ C;  3HOW G;  2HDL A;  3DWP A;  4LF8 L;  2FXQ A;  4RG1 A;  5LMU Q;  1E2Z A;  1BBU A;  1PLF A;  2YU9 H;  2I5L X;  2MJ8 A;  4A3E G;  3HFZ B;  2IL8 A;  5M3M B;  2UU9 Q;  3MXU A;  5IY0 A;  3OIP A;  3H0G B;  4F87 A;  1FNW A;  4IQZ A;  2Q2T A;  2WAQ E;  4K5W A;  4GLX A;  3K5L A;  1E1T A;  3J81 L;  2F0N A;  1KXL A;  2PQA A;  4YHH Q;  1MIU A;  1ICW A;  3T1Y L;  1EZ6 A;  2A6H C;  1HUM A;  3MFY A;  1TWG H;  4FNF A;  4MHE A;  2PMZ E;  3CCJ A;  2EZV A;  3U9O A;  3BZC A;  2NUC A;  3NSW A;  4GNX A;  3MXP A;  4K5V A;  1PRT F;  1NBW A;  4DR4 L;  4BA2 I;  1K8O A;  2DGY A;  1B3A A;  2RKS A;  4OGQ C;  3UE1 A;  3A54 A;  2QKI C;  3A8I E;  2Y0S B;  3NEN A;  1I5F A;  4RA8 A;  2Q8R E;  1HRJ A;  3J80 E;  1X3E A;  2QA4 A;  1BCP D;  1EQR A;  4DR5 Q;  4A3J H;  4ALP A;  3I4L A;  2ATW A;  3HKZ E;  4WOR A;  4OX9 Q;  4A3G G;  4GOP C;  4DR1 Q;  4HIO A;  4LFA Q;  4HAE A;  3PUV A;  4K6D A;  3M3Y B;  1D5Z C;  3DHQ A;  5ELC A;  3F1Z A;  2K33 A;  4QB4 A;  3NTI A;  5KNB A;  2R92 G;  4OWW B;  5A2Q E;  3S16 H;  2C35 B;  3A55 A;  2EOT A;  3HZX A;  4A3L G;  5ELB A;  2WFW A;  1SMY C;  5GQO A;  4YY3 L;  5IGG A;  1JWS D;  1MHW C;  1WTQ A;  1STA A;  1ET9 A;  3F8T A;  4HJ5 A;  5C0X H;  1XXG A;  4C3H B;  5KGU A;  4A3C H;  1O7Y A;  1DXM A;  2F0U A;  5LMN L;  4XT1 B;  1AZP A;  3NUC A;  4RHR A;  4IUR A;  2A73 B;  4JI7 Q;  2PCF B;  2R7Z H;  1I4R A;  3A0J A;  2D5D A;  4L5Q A;  2G5D A;  4B3S L;  4DR2 Q;  3SDZ A;  3Q23 A;  3S1N H;  2JA7 H;  4JI0 L;  4P75 A;  1XTC D;  3G7L A;  3HOX H;  2PYK A;  3NTH A;  4GKJ Q;  3VYR A;  3JAM i;  2EYM A;  2FJ2 A;  4IFD J;  4K0K Q;  5ISR A;  4A3D B;  4JI3 L;  1FNU A;  1ASY A;  3K0Y A;  5CYU A;  1Y8P B;  2XRS D;  1QVC A;  3G6E A;  2PW5 A;  4LK1 C;  1Q1B A;  3G48 A;  1N36 Q;  4RGN A;  1R4Q B;  2B2U C;  1HNX Q;  4PV1 C;  5LMN W;  4R9W A;  3GO5 A;  2KHS A;  4O1N A;  2IW3 A;  5JVG 3;  2IT1 A;  1PRT B;  4MTK A;  3R93 A;  3E0E A;  1SE8 A;  5FJ8 H;  4FYD A;  5M3M H;  3TRE A;  4KHP Q;  5ELE A;  3I8Z A;  1DJR D;  1S5F D;  2JN4 A;  1N34 Q;  5FLM H;  2LS0 1;  2K05 A;  3PQI A;  1X3F A;  2PW7 A;  1XMQ L;  1D2B A;  3PUZ A;  4FXK C;  4POF A;  1NMG A;  2I0Q A;  2JA9 A;  1X55 A;  4MNO A;  3J7A 5;  3OYY A;  3NHH A;  4V0B A;  3J81 j;  3FPP A;  2CCZ A;  5EKL A;  4CDE C;  2UUA L;  1QVG A;  2KHJ A;  3UDG A;  1EIF A;  2Q2I A;  4JI1 L;  5I2Y A;  1K83 B;  1B1Z A;  4X66 L;  4UDU C;  4C1N I;  4L5R C;  5C4X B;  4JBK A;  3TSS A;  2R93 B;  2K5V A;  5M3F B;  2IY5 B;  4ZKB B;  4A3M H;  3NP8 A;  1G2S A;  1UNS A;  4NXN Q;  1EY0 A;  4JOI C;  2LSS A;  1BDO A;  1Q1E A;  4H0L C;  1SNC A;  2WAQ B;  3ER0 A;  3L7Z C;  3L9A X;  1WTP A;  2Z0S A;  2B8G A;  4DR6 Q;  3PIO A;  3ITP A;  4DR7 L;  4YWL A;  4JI2 Q;  1HCZ A;  3J81 c;  4WJW A;  1TWC B;  4L5T A;  2PMZ B;  1XYI A;  1FJG L;  2Z6K C;  3GV3 A;  4BBS G;  3M3Y H;  3PO2 G;  2JSO A;  1K3R A;  3TS2 A;  4JK1 C;  4OIJ A;  1A2U A;  4KMU C;  4DK3 C;  4A3K B;  5CV9 A;  1E2W A;  1Q46 A;  4JI8 L;  2JA6 G;  4BXX H;  1BCP B;  2PNH A;  1RKN A;  3CCV A;  4GN5 A;  1SND A;  5EPK A;  1XTD A;  1S5D D;  3K7A B;  3NWT A;  5IWA Q;  5CR3 A;  3PMF A;  1JWU D;  1LTA D;  2F4I A;  5I6W A;  1T9H A;  3NE5 B;  2EJM A;  1N33 L;  4C3H H;  4RKB A;  2SNS A;  2VQE L;  4DV5 L;  3HOZ G;  4WJ3 M;  1AW7 A;  4DAP A;  4LF8 Q;  1HTL D;  4ZAI A;  4J8Q A;  3SVM A;  3PUY A;  4JI6 L;  1KAA A;  4C3I G;  1WI5 A;  2EJG C;  2SDF A;  2X6L A;  5CC4 A;  3FKI H;  1PTO D;  1Z9F A;  4P71 A;  4DV3 L;  3KLR A;  1KDB A;  4JCV E;  4N8F A;  4NKL A;  4LW1 A;  3KF8 B;  4Y52 H;  4X3U A;  3BG3 A;  1KNE A;  3FPU B;  4MN3 A;  4PG3 A;  4A3D H;  4Q0F A;  1PV4 A;  1Q12 A;  4ZYS A;  1IXR A;  4LF6 L;  2PNR C;  3T1Y Q;  1WTH A;  5FKA C;  1I4G A;  4DV6 L;  5I9P A;  3HOU H;  1HZA A;  1WYD A;  2EPB A;  2EYF A;  3PO3 B;  4RGO S;  1EY7 A;  3MHB A;  1JWM D;  4DR4 Q;  5BR8 L;  4DV4 L;  2RHS B;  4H7B A;  2L0C A;  2CH4 A;  3SK5 A;  2JEA I;  3F2U A;  3S1R B;  3DUZ A;  2OXP A;  2EYL A;  1IZ6 A;  1YZ6 A;  3D4D A;  1AZQ A;  1WCM H;  1D1I A;  1Y1V G;  2JJQ A;  3OWF A;  2IWH A;  4X62 L;  3OW2 A;  2KCC A;  5CBA E;  1D7Q A;  5JJZ A;  3OPO A;  5D3D A;  2L12 A;  1F9S A;  1RCV D;  5IGE A;  3HRZ C;  5FLX L;  4DAV A;  1JJG A;  2RDF A;  2RHQ B;  2Z6B A;  2K4K A;  1WTX A;  1Y1W B;  1EL0 A;  4GOP A;  2GVA A;  4GZY C;  1EOT A;  2L55 A;  1UUP A;  3NEM A;  5I9O A;  1O78 A;  2VB3 X;  1K83 H;  1PZK D;  5C4X H;  1SYC A;  3IAY A;  3G71 A;  1A3T A;  4UPA A;  3CCL A;  2R93 H;  3TP6 A;  1FGU A;  5IGB A;  1KQS A;  4G57 A;  2VZA A;  3AQQ A;  3NBH B;  3VR2 A;  1PMR A;  2FMM A;  4YHH L;  1PH6 A;  2DJG C;  3ZYY X;  4YY3 Q;  1A8V A;  2ES2 A;  1VQG A;  5LL6 S;  3CP0 A;  1TWC H;  3QIA A;  5ELN A;  3K5N A;  2NWG A;  1EQQ A;  2QDL A;  5LMN Q;  1L0X B;  4IPH A;  2NYZ D;  1C48 A;  3GTJ B;  1PH7 A;  5H1S E;  2K04 A;  4A3K H;  4B3S Q;  3CAM A;  4OO1 H;  4MIU A;  2BH2 A;  2ZM6 L;  2NZ1 D;  3TP5 A;  4DKA C;  4A3F G;  4JI0 Q;  4FP5 D;  2CVR A;  1GKH A;  4ZK9 B;  4GLV B;  4R8I A;  1Q82 C;  4A3M G;  3PV0 A;  2K01 A;  1EEF D;  2JA5 H;  3VYU A;  3K7A H;  4JI3 Q;  1SMX A;  4XTC S;  2B39 A;  2EYP A;  5BN3 A;  3PUW A;  1LTT D;  1Q7Y C;  1E7Z A;  5C0X J;  3CF5 A;  2NTS A;  3CC2 A;  4BY7 H;  2N55 A;  4IUN A;  4DAM A;  2AHO B;  3NBH A;  3OMC A;  3OIQ A;  3K81 C;  4NB3 A;  1H9J A;  4LNQ A;  4JI5 L;  2EY6 A;  5JPM C;  1IL2 A;  1B9M A;  1DOK A;  4HR7 B;  1CKM A;  4R1J A;  2B2U A;  5KYI A;  1HFG A;  1EY9 A;  2JXM B;  2I46 A;  2PZW A;  1H9K A;  3I4N H;  1MGS A;  2B63 B;  4IAL A;  3AYH B;  1A6X A;  1QUQ A;  4BXX G;  2K5H A;  3CCS A;  1EQT A;  3K57 A;  4A3B B;  2B2T A;  3RZD B;  1EWI A;  1XMQ Q;  1LTB D;  4DV7 L;  3W3A A;  4WRD A;  3IKJ A;  3UI2 A;  4Y7N B;  3JAM L;  5IT9 L;  4JYA L;  3W2D A;  1VQH A;  1R9T H;  5CBE E;  1CHP D;  1RF2 D;  1TVX A;  1HR0 L;  4IUP A;  2UUA Q;  1PTO B;  1QOH A;  2HQL A;  5HY6 A;  2CQO A;  4DK6 C;  4JI1 Q;  4L8J A;  3M4O B;  2KEE A;  4X66 Q;  5C44 G;  3BVG A;  2Y0S E;  3NWS A;  5E3F A;  4B9W A;  1JOR A;  1XWE A;  1CZG A;  2HQE A;  2F0K A;  2VY3 A;  1YJN A;  4LFC L;  1V9P A;  2O5I C;  3H94 A;  5J22 A;  1GUT A;  5CV5 A;  2I07 B;  3RR5 A;  3FDT A;  4XT3 B;  1O80 A;  2FHT A;  4JOI A;  3ULJ A;  3OMG A;  3I72 A;  1RD9 D;  1CM9 A;  3A5Z B;  4LF4 L;  4DR7 Q;  2PZU A;  1VQ6 A;  1E2V A;  3I4M B;  3X3N A;  1V1O A;  5IP7 H;  1MSG A;  1FJG Q;  2XN9 C;  4LUV A;  2QEJ C;  1Y1W H;  3HOV H;  1LTS D;  2OF1 A;  3M7N A;  2DNE A;  4HID A;  1WJJ A;  4Z9C B;  2UXB L;  2Z6K A;  4ZCK A;  3HOU G;  2AQ2 B;  1HR0 W;  2CQA A;  3E0J A;  1PZI D;  4FF3 A;  1DGS A;  1N34 L;  2KED A;  1VQN A;  2A68 D;  2VB2 X;  1IW7 D;  3LNN A;  2E2H B;  2QEX A;  2JQO A;  3STB D;  2BA0 A;  3CME A;  1YIJ A;  1BUV T;  1V1Q A;  4FVM A;  2Q8T A;  1Z47 A;  2BDN A;  3NEL A;  1KIX A;  4L6T B;  2K5N A;  5C3E B;  1IBL L;  4HCE A;  5IGC A;  4XXE A;  3MC0 B;  1EOV A;  4NXM Q;  4GS3 A;  1WCM G;  4H02 A;  3H3V C;  3ZJY C;  1N33 Q;  4BBR G;  1KNA A;  1TS2 A;  1K8G A;  3Q6S A;  4QY7 A;  2VQE Q;  3HOY B;  1PH8 A;  3CU7 A;  4DV5 Q;  3CD6 A;  2JA8 H;  4HJ9 A;  1SBB B;  4JI6 Q;  5KRU A;  3CHB D;  5JEA H;  3HGB A;  5I6Y A;  3T51 B;  3FHW A;  2LKV A;  4ZUI A;  1OXU A;  4DV3 Q;  5K36 G;  3J80 i;  2AUJ D;  1ET6 A;  1C4Q A;  1F77 A;  1J5E L;  1NAP A;  4FDB A;  1A3V A;  2IJ0 A;  4H13 C;  5JVH 3;  3TDQ A;  4AYB G;  3GTG B;  1N8R C;  4R4I A;  4LF6 Q;  3T1H L;  2PQA B;  4DV6 Q;  2F0O A;  2AQ1 B;  2KUM A;  5GAD C;  3PCO B;  1EWH A;  3ERQ A;  5A35 A;  1F9P A;  1SE4 A;  3I70 A;  4PMW A;  4O42 A;  2K5Q A;  2JK8 A;  3GDE A;  3RMH A;  4XYQ A;  1RL2 A;  4ABN A;  1I4Q A;  1GVP A;  5BR8 Q;  2PO4 A;  4DV4 Q;  3S1M H;  2FIN B;  1I50 B;  1PRT D;  2GN5 A;  4LAA A;  4HJA A;  4F88 A;  4OON A;  1G51 A;  2B63 H;  1PH9 A;  2O5J C;  4X62 Q;  2L4N A;  3U4V A;  4DV0 L;  4A3B H;  3S1Q H;  3VDY A;  1WVL A;  3DM3 A;  1B4O A;  1KRS A;  3R2T A;  3D4W A;  2Q8I B;  2F03 A;  2A6E C;  2JA5 G;  4Y7N H;  1YNN D;  3HKZ G;  5IOC A;  2F0I A;  4FF1 A;  1K0S A;  4QL5 A;  4A93 H;  2L9H A;  2A19 A;  4P2C B;  1M4V A;  4TRD A;  3TZU A;  1PTO H;  3S2H B;  2OTJ A;  4NP5 A;  1J9O A;  1HA5 A;  1NTG A;  1YEZ A;  2MFI A;  2BCO A;  1EIY B;  5M9O A;  5KND A;  2F0D A;  3S9W A;  4C3J B;  2KCM A;  1J8I A;  1RDP D;  2LXK A;  4IFD I;  1B70 B;  4HCS A;  3F2D A;  2RVL A;  2JYO A;  2DN8 A;  5CV8 A;  4IFD G;  1SE2 A;  5IYD G;  1BOS A;  1FR3 A;  2NVQ B;  1KLG D;  3NBI A;  2VW9 A;  3PIO 3;  2WII B;  3EVQ A;  1BO0 A;  2ENB A;  1PYB A;  4FO2 A;  3H91 A;  5IT9 c;  5NUC A;  3JAM c;  5IP9 G;  3WDN A;  2R7F A;  1PDQ A;  2ZT9 C;  4DUZ L;  1J6Q A;  2LFN A;  1L2F A;  2A5H A;  1HJP A;  1CSQ A;  3W1G A;  3A5U A;  4KKU A;  4AH6 A;  4F8M A;  3I2Z A;  1HNW L;  1LLR D;  2E2H H;  2HIV A;  2A6H D;  2ZM6 Q;  1QWY A;  1PH2 A;  2N49 A;  5KNC A;  4R4O A;  5C3E H;  1KTK A;  4X3S A;  4BY1 H;  4PZ7 A;  4KK7 A;  2VUM H;  1NUC A;  5BN4 A;  4IUT A;  4CKB A;  3HOY H;  1V43 A;  4A3I G;  2ZXO A;  1EFI D;  3KFU A;  1UE6 A;  1D5M C;  1X32 A;  1B53 A;  4JG2 A;  4JI5 Q;  5IYB H;  3HOV G;  5COY A;  2XTI A;  2F0T A;  5IIF A;  4XYO A;  5FO9 B;  4KKT A;  3MXN A;  5DAU A;  4MTN A;  1CA6 A;  1BBX C;  1VQK A;  1YNJ C;  1STB A;  3KLW A;  2GVB A;  5M5X B;  3SK6 A;  4J1M A;  3M4Q A;  1XNR Q;  1BBW A;  2YTX A;  3GTG H;  4DV7 Q;  3B6Y A;  3F2B A;  3VR3 A;  3FEW X;  4LUO A;  1TWA B;  4NW2 A;  3GTL B;  3BDO A;  2MUY A;  4JYA Q;  3K8A A;  4RWS C;  1VS0 A;  5COR A;  4MZ9 A;  3RLN A;  2E74 C;  1TY2 A;  1HR0 Q;  3G4S A;  4C56 C;  4DR3 L;  1XMO L;  2F0J A;  4HMI A;  3GTK B;  3VYT A;  2N88 A;  3LGJ A;  3C1E A;  1SMY D;  1QIL A;  1NMF A;  2HDM A;  2KVM A;  4I7Z C;  1I50 H;  2O4X A;  4LFC Q;  3MAQ A;  1TS4 A;  2PQE A;  3BVZ A;  1EY6 A;  2D62 A;  1JCK B;  2DY8 A;  1K28 A;  4RGT A;  4F7X A;  1Y14 B;  1B9N A;  1BR9 A;  1Z6H A;  4B3T L;  4LF4 Q;  2VXW A;  1K73 C;  1AP0 A;  2V1C C;  5HUR A;  1S3O A;  2YTY A;  2K03 A;  2XIW A;  2R7D A;  3ONA B;  5BN5 A;  2ZXR A;  3DWA A;  1PHJ A;  4LF9 L;  2E2D C;  3S2H H;  3EN2 A;  2UXB Q;  2J7Z A;  2B2T C;  3ICE A;  1XPO A;  1I4X A;  3QOJ A;  1CA5 A;  3NQI A;  1TR5 A;  1LTL A;  3H0G H;  4G7O C;  1KAW A;  1QNK A;  4GN4 B;  4ZUJ A;  1TWH B;  5J39 A;  4IN3 A;  4IUU A;  3S15 B;  1EEI D;  4IUV A;  5I4D A;  1G29 1;  4YCV A;  1IBL Q;  2IHE A;  4DNI A;  4KV6 A;  3NTK A;  5DLQ E;  2NVQ H;  4ULL A;  2KEN A;  4V19 0;  2B2Y C;  1XX8 A;  3FP9 A;  3DEO A;  3SHL A;  3VA5 A;  1PH1 A;  1JOO A;  2WB1 B;  2IX3 A;  4BBR B;  4DK1 A;  4EX5 A;  1RTO A;  5K5P A;  3AB9 A;  1VQI A;  3TS0 A;  3HEJ A;  1K8A C;  4A93 G;  2RQX A;  2NB0 A;  3GV6 A;  3F2C A;  3N52 A;  3U4Z A;  2IX0 A;  1KLU D;  1TY0 A;  2BA1 A;  4OXP A;  4QIW E;  1B2T A;  1U9R A;  1Q8I A;  2A8V A;  2DUD A;  1J5E Q;  4YCU A;  2A74 C;  3Q8D A;  2RSO A;  2D2C C;  4BS9 A;  2RCF A;  4K2L A;  2TMP A;  2F4V L;  3FRP B;  1KDA A;  4KHV A;  1GO3 E;  3T1H Q;  3C46 A;  2O2L D;  3BZK A;  3E3X A;  1FNV A;  1GHJ A;  1YNX A;  4OIK A;  1C0A A;  5ELF A;  3K7U C;  1STY A;  4HJ7 A;  1CKN B;  3SR1 A;  3UDI A;  3SGI A;  4JW0 A;  4TSS A;  2NVX B;  1W2B A;  2B3G A;  1FL0 A;  1OXX K;  4IJL A;  1HA6 A;  1QB5 D;  3K6O A;  1PFS A;  3TBI B;  1TU2 B;  4NXM L;  1X3Q A;  1F2Z A;  4A3J G;  4DV0 Q;  4GKK Q;  1CSP A;  5C6A A;  5M5X H;  5IT9 E;  2F0M A;  3LWU A;  3BYY B;  3BDC A;  1HZ9 A;  3HOW B;  3D3R A;  3GTL H;  4K8I A;  1G6Z A;  2ID0 A;  2F0E A;  2XNA C;  1C7Y A;  1N32 L;  3EQL C;  4BY1 G;  1S5B D;  2VUM G;  2K52 A;  4ID6 A;  4A3E B;  2XRQ D;  3V05 A;  4GOP B;  4CJ2 C;  3GTK H;  1H9S A;  3DMU A;  4ILW A;  1WOC A;  2A69 C;  1VF7 A;  2K1B A;  1STE A;  1II3 A;  1SXT A;  2F0P A;  2YTV A;  1D8L A;  1IYU A;  4LFB L;  4HIK A;  5C0X I;  3NPP A;  2E2J B;  1U4L A;  5A2Q L;  1CKN A;  5IOD A;  3I3C A;  1IL8 A;  3WWV A;  5C0X G;  3M85 A;  1HZC A;  3K5O A;  4A3C G;  5D3I B;  5EPL A;  4EQO A;  4HED A;  4UHV A;  1SNM A;  2QGQ A;  1NJI C;  2B2V C;  1HXY D;  4JI4 L;  3A8J E;  4K8J A;  2R7Z G;  3CPF A;  4DUZ Q;  3EJI A;  2B8F A;  2CH4 W;  2E8G A;  1CTM A;  2K28 A;  5ELD A;  1I3Q B;  1OXS C;  1TWH H;  2JA7 G;  1HNW Q;  2BE5 C;  2X6G A;  2OTL A;  3NQT A;  5JJK A;  1FGB D;  2EY5 A;  1I6V C;  1EQV A;  2HD3 A;  3HOX G;  3MWY W;  5EQ0 A;  5F2D A;  3S15 H;  4A3G B;  1MBY A;  4RAU C;  5IYC H;  1QJO A;  5C3W A;  3IFT A;  4HN7 A;  2JP1 A;  2H4O A;  1VQM A;  1CFM A;  4DV2 L;  3P1H A;  2MP1 A;  1LT4 D;  1EY4 A;  1KL9 A;  4NDX A;  3RNU A;  5C3X A;  5M3F H;  5C5M A;  2VQF L;  3CRK C;  2SEB D;  1Y69 U;  5GAE C;  1I6H B;  2R92 B;  4DK0 A;  2F1M A;  4LF5 L;  3WOF A;  1MKH A;  4DUY L;  4P73 A;  3HP3 A;  5FJ8 G;  1TKW B;  5E1F A;  5M3M G;  3KK7 A;  2NTT A;  1QVF A;  1STH A;  3H0G G;  4KN4 C;  4OEL B;  5FLM G;  4J15 A;  2EXD A;  1QUQ B;  1IYJ B;  1QG7 A;  3PUX A;  1UE5 A;  2I5M X;  3J7A V;  1MD2 D;  1LT6 D;  1JJ2 A;  5IE8 A;  3QG1 A;  2N8N A;  2YYZ A;  2N78 A;  1EZ8 A;  3K0X A;  2F0L A;  3DM1 A;  4DR3 Q;  5FO8 B;  1XMO Q;  1G91 A;  4XQQ A;  2F0Q A;  1HZB A;  2D0P A;  2Z1C A;  3RD4 A;  1ZEQ X;  1KRT A;  4X3T A;  3EIV A;  4G4K A;  2Y0S G;  4QIW B;  2HUG A;  4CKE A;  1CUK A;  1ICF B;  2CHB D;  2CW0 C;  1SRU A;  1A63 A;  3D31 A;  1HTP A;  4KD3 A;  1F9Q A;  1KD1 C;  2B29 A;  1VCI A;  1VMP A;  5CV4 A;  2EY1 A;  3CCU A;  4RMF A;  1SEB D;  5DNF A;  4JBM A;  1VQL A;  2UXD L;  1CHQ D;  4B3T Q;  2RBM A;  2XWB B;  1JOQ A;  1Q86 C;  4N9P A;  3OSO A;  4HSV A;  4LF9 Q;  4A3E H;  5FOB B;  4DXF A;  3MVV A;  1VQJ A;  4LF7 L;  2AWN A;  3J81 E;  2KQ3 A;  2X69 A;  1IYV A;  1SAP A;  4JVZ A;  1AN8 A;  4IPD A;  1XNR L;  1WTR A;  3TZD A;  5M5Y B;  4A76 A;  2AQ3 B;  2F3V A;  4IOA A;  2E2I B;  1UEA B;  1SSO A;  1S72 A;  2IHF A;  1WD0 A;  1IHZ A;  4TVA B;  1EYC A;  4KN7 C;  1RTN A;  4EQN A;  3VR5 A;  3PO3 H;  4CJ0 B;  1TWF B;  4CHT B;  2BH8 A;  4C3H G;  4B3M L;  2RA4 A;  1HHV A;  1FD7 D;  2XSC A;  3HG9 A;  1IBM Q;  2B2Y A;  1B8A A;  2OCE A;  3GP7 A;  1JMC A;  3S1R H;  3I4O A;  1WTW A;  4IZ8 A;  4QUF A;  2KCN A;  1ZXT A;  2CWA A;  5EKK A;  1I94 Q;  2BOS A;  1YBY A;  3V2T A;  3FKI G;  1JQY D;  1WTV A;  2ZTC A;  4CDC C;  3T4A C;  1HQM C;  4UP8 A;  1I3Q H;  4QGU A;  1M90 C;  1E24 A;  1Y8O B;  3I91 A;  1SYD A;  5G3L F;  2N3S A;  2QIL A;  1O7I A;  1OXT A;  2Z9H A;  2P5Z X;  2XGT A;  2EJF C;  4A3D G;  3UDX A;  1EIH A;  1UAP A;  2RCN A;  1IKL A;  2OEO A;  4BBS B;  2F4V Q;  1B50 A;  1LTR D;  5DEH A;  3PO2 B;  1M1K C;  1F2Y A;  2ZJQ A;  3E9H A;  1GXD C;  2C9O A;  1OO9 B;  3GD7 A;  2JA6 B;  3PF5 A;  3CCM A;  5D65 A;  3TEH B;  1I6H H;  3KYH C;  1LV9 A;  2K7V A;  3C3L A;  4PQX A;  5J1Z A;  3KDF B;  1Q3L A;  1CQV A;  3OTO L;  3E5S A;  2D9U A;  5GAH C;  3QR8 A;  4IPG A;  1I4P A;  4ME5 A;  1W6J A;  4O2D A;  1Z7T A;  1L1O C;  3N6R A;  4L5S A;  2GA4 B;  1ASZ A;  1S5E D;  5FLX c;  4QQB X;  5EJW A;  4JV5 L;  2MO0 A;  4KD4 A;  1AE3 A;  3HOZ B;  3T56 B;  1G6P A;  1SE3 A;  1SJE D;  2A1A A;  3AFQ A;  1ZYR C;  5IYC G;  3GTJ H;  4C3I B;  1LT3 D;  1N32 Q;  3T16 A;  4DN4 M;  4OHJ A;  2H1E A;  2OQ0 A;  1YJ9 A;  4OWX B;  1VQC A;  5C4X G;  2R93 G;  5M3F G;  3D0F A;  4I7A A;  2EYH A;  5LHY 1;  4K6L A;  4IUQ A;  3HKS A;  5M5W B;  1YIT A;  1KC8 C;  1JR0 D;  5AJ3 L;  1S40 A;  2WAQ G;  3CMA A;  4LFB Q;  3I73 A;  1X3P A;  3S14 B;  1KDC A;  2DY7 A;  2MQH A;  1LT5 D;  3OW7 A;  1XJV A;  3D6W A;  3P7J A;  4EGV A;  3K80 C;  3KJO A;  1F2M A;  2RDG A;  3HS0 C;  1OXV A;  1LM0 A;  1STG A;  2I5H A;  3KDF A;  3TP7 A;  3Q0A A;  2UUB L;  2NZO A;  5KEE A;  2IPK D;  1YVC A;  3KLS X;  3AU7 A;  4OO1 I;  4JI4 Q;  4A3K G;  3K58 A;  2B2V A;  3CW2 C;  4GKK L;  4OO1 G;  1R4P B;  2ZJP A;  1Y1V B;  1JIC A;  4P72 A;  1NR2 A;  3RZD H;  1HNZ L;  2VL6 A;  3CPW A;  1VQ7 A;  5FK9 C;  4RHS A;  1U4P A;  1LO5 D;  4CDD C;  4G7Z C;  2AUK A;  1X65 A;  1PZJ D;  3TRZ A;  4IO9 A;  4BA1 I;  1PFB A;  3BDL A;  2WB1 E;  2F3I A;  1TXY A;  4BY7 G;  4DV2 Q;  1SNP A;  3M4O H;  4GN3 B;  2E5L L;  3AFP A;  4E6I A;  2VQF Q;  1ILP A;  3S17 B;  5EKI A;  1VDZ A;  4IPC A;  5EGT A;  1QNU A;  4LF5 Q;  4DUY Q;  3L0O A;  4ZLT F;  3I4N G;  1ZKO A;  1UWV A;  2A6E D;  2KHI A;  4R4C A;  3MXN B;  5C4Z A;  5CV6 A;  2RSN A;  3S24 A;  4CDF C;  2EYO A;  3I4M H;  1SYB A;  1EU4 A;  4AYB E;  4U67 3;  1MI2 A;  3MXG A;  4B9X A;  1QZG A;  3E6Z X;  2L11 A;  4UY8 C;  3IRB A;  1BCP C;  5TSS A;  4BBS H;  1VQ8 A;  3PO2 H;  2SNM A;  4H44 C;  4EQ5 A;  1STN A;  1LAC A;  3EBE A;  4QMG A;  1VQP A;  3PO3 G;  2EQS A;  1N9W A;  4DU9 A;  1CZW A;  4RCN A;  2JA6 H;  3PF4 A;  4EVO A;  3PIP A;  3X3M A;  1LYL A;  1SNQ A;  1HUN A;  3VR6 A;  1NY4 A;  4A3F B;  2EY2 A;  4KTA A;  1Q81 C;  4A3M B;  1K0R A;  4KI0 A;  5JAV A;  2K75 A;  5JOB A;  1XPU A;  5CV7 A;  1JE4 A;  3U9S A;  1A3U A;  4DAY A;  1CK1 A;  2Z8L A;  3A7A B;  4QF4 A;  2MNA A;  4AQY L;  2XWJ B;  3MFG A;  3GQB A;  4UAI A;  2E76 C;  1E22 A;  1GUS A;  3ERS X;  3CC4 A;  4PMC A;  4C2M B;  2UXD Q;  5FO7 B;  4M8A A;  1JB3 A;  4DNR B;  5IP7 G;  3HOZ H;  4X6A H;  2Q2H A;  1IBK L;  3RN2 A;  3UDF A;  3J7A F;  1Y1W G;  3WOE A;  2EXZ A;  4C3I H;  3KBG A;  2QDB A;  4KKS A;  1U4R A;  1SNO A;  4K14 A;  1GM5 A;  1AEX A;  2QW7 A;  4B3R L;  1T5E A;  4LF7 Q;  2YV5 A;  2OQK A;  4KHZ A;  2Z4H A;  4ZRZ A;  3KF6 B;  1D1K A;  1JOK A;  5M5W H;  2K5W A;  4DV1 L;  1S4Z A;  1GD7 A;  2EVB A;  3MTS A;  3S14 H;  1Q90 A;  4X65 L;  5JPN C;  4IOC A;  3LWE A;  5CGK A;  1GUG A;  2MO1 A;  3BJU A;  4M1U B;  3ND8 A;  4NMZ A;  4B3M Q;  1C8C A;  1KAB A;  5C44 B;  4ODG A;  2JA8 G;  2ICE C;  2LXJ A;  2WKD A;  1V8Q A;  4TQU S;  1EU3 A;  4EQP A;  3EFX D;  3ULL A;  1GOZ A;  2EYJ A;  5EBC A;  3GTO B;  1DZ1 A;  4JBJ A;  5L37 A;  1YNJ D;  1BCP F;  1L1O B;  5JEA G;  1VQE A;  1L0W A;  1W6K A;  2K14 A;  3DLL A;  3FKI B;  1H95 A;  2WIN B;  4QJF A;  5FLX E;  1Y1V H;  2ZXP A;  3VA7 A;  1VMC A;  1VQ4 A;  2CWP A;  1PH3 A;  5KIX A;  3A74 A;  4P74 A;  2DJF C;  2ICI A;  2AMC B;  1CI3 M;  3Q22 A;  2HHH L;  3CC7 A;  4ZQ3 A;  3KF6 A;  3HOU B;  2K50 A;  4HIM A;  4C3J H;  1E0B A;  2QCP X;  3U58 A;  4R4T A;  5HGQ A;  3S17 H;  3IFD A;  1EWC A;  2PI2 A;  2KCT A;  5C4J B;  5DM6 3;  3SXH A;  3OTO Q;  4UP9 A;  3K5M A;  2B63 G;  5AFW A;  1QZH A;  1BQQ T;  1YI2 A;  1WCM B;  1KHI A;  3OWE B;  4A3B G;  2ZJR A;  1IBM L;  4JV5 Q;  3MEH A;  1DD2 A; 
#chains in the Genus database with same CATH homology
 1GUO A;  1NR4 A;  2Z4I A;  3J7Y W;  3BZD B;  2MHV A;  4QCL A;  2EDG A;  2F3W A;  4DGZ A;  3CRL C;  2FFK B;  4QUC A;  1PFN A;  1AFP A;  4G7H C;  2QF7 A;  1H9S B;  2XVS A;  3TME A;  3O13 A;  4RCO A;  2PZT A;  2NN6 H;  2KJX A;  3QO2 A;  2NBF A;  4AYB B;  3R3O A;  1TS5 A;  1QE6 A;  1DOM A;  4XDX A;  3DWQ A;  1PFM A;  3S2D B;  2WP8 J;  3T53 B;  4PNY A;  4CJ1 B;  3D6C A;  3GTQ B;  4WFN 3;  5JEA J;  1NCV A;  1B44 D;  3CQZ B;  1ENF A;  2F0V A;  1F9R A;  1GUW A;  4CBV A;  1RHP A;  4DXG A;  4HTH A;  3CKI B;  3JAM E;  1VF5 C;  3J80 L;  2K5D A;  5C5L A;  4L63 B;  1A2T A;  1PTO C;  3A8K E;  2JA5 B;  3HKZ B;  5IGF A;  3KUP A;  2OT2 A;  4LMQ D;  3BS1 A;  1Y8N B;  4BY7 B;  1LAB A;  3H09 A;  3VYS A;  4DA2 A;  4RKL A;  3QWN A;  2FMC A;  1ROD A;  2WAC A;  2F0H A;  4FXG C;  5LL6 X;  3I4N B;  5EBD A;  4B08 A;  3RZO B;  1A15 A;  3GTP B;  2F0S A;  3RLF A;  1F2L A;  3R8B A;  2NVT B;  4KY6 A;  4HMJ A;  1GJX A;  2A69 D;  1TQO A;  3BYT B;  1NSN S;  4PMB A;  1TS3 A;  4DFA A;  1R9T B;  3GTM B;  1GHK A;  1M8A A;  2R3Z A;  1U4M A;  2JE6 I;  1S5C D;  2SOB A;  4DF7 A;  3NXW A;  4OL7 A;  3KBX A;  2B2W C;  1PYW D;  1SYF A;  4FF2 A;  3DEP A;  4LJZ C;  2WV6 D;  4KJO A;  1L0Y B;  3RUZ A;  2F0F A;  1HPC A;  1ML0 D;  3EA6 A;  5E4W C;  4A3I B;  1PTO F;  1ESF A;  1DON A;  4XQJ A;  1TT2 A;  2BE5 D;  1ILQ A;  3HOV B;  2KEC A;  1IKM A;  2NVY B;  1G8Z D;  2R6G A;  3KF8 A;  5K36 H;  4C3J G;  3K59 A;  2M9V A;  3SE0 A;  1ONL A;  2LMC B;  2BDO A;  4K2K A;  3P20 A;  4BWG B;  1PXU A;  1RJT A;  2K32 A;  2E75 C;  4U68 A;  5C4H A;  4X3K A;  4YIJ A;  1SJH D;  1H9R A;  1CQF A;  2IX1 A;  3ND9 A;  1MSH A;  3FVQ A;  3OHX C;  3ERO A;  1T5X D;  3I90 A;  3A56 A;  2JA8 B;  2M2L A;  3VR4 A;  3R2I A;  4RGM A;  1ESR A;  1SYE A;  1ENA A;  3FMC A;  4RH6 A;  1FYC A;  1BF4 A;  4XQN A;  2NN6 I;  5IGD A;  1DOL A;  4RFB A;  1O7Z A;  1EYA A;  2NN6 G;  1HFN A;  5G3L D;  1SDF A;  3LX0 A;  1EYD A;  4JBW A;  1ENC A;  2CW0 D;  3Q24 A;  1SFO B;  3A7L A;  3S1M B;  4CKC A;  5T1G A;  1JC7 A;  4IFD H;  1CT1 D;  2WKC A;  2MGS A;  2DNC A;  2G9D A;  4I65 A;  5DM7 3;  3S1Q B;  4KJN A;  4ZKC B;  3G6J B;  2K6A A;  3IL8 A;  3L3O C;  5EPJ A;  1QCB D;  2YU9 B;  4A93 B;  2J4X A;  2L1B A;  1V1P B;  2F0W A;  1DCZ A;  3PIP 3;  2L5T A;  3D8G A;  1LTI D;  1K8M A;  2A68 C;  1IW7 C;  4FF4 A;  1TWG B;  5E4X A;  3MZ5 A;  1H9M A;  5HGT A;  3P75 A;  2C5C A;  4KY7 A;  5I2X A;  1I4H A;  3T13 A;  1DYQ A;  2EE1 A;  2R61 A;  2HCC A;  3QJY A;  2M00 A;  1LTG D;  3D4R A;  3SK4 A;  1EY5 A;  2PPB C;  1BXT A;  3C2P A;  2VNU D;  4A3J B;  1D6E C;  1BNZ A;  3AMU A;  4Q5V A;  4KY5 A;  3KLS A;  2JEB I;  3H6M A;  1HQR D;  3NK9 A;  1V1P A;  4HSP A;  5CMD A;  3SEB A;  4BY1 B;  3MA2 B;  2VUM B;  1TII D;  2G9H D;  1GUN A;  1O7L A;  2HCI A;  3QOL A;  2F0G A;  5T1I A;  4R8N A;  3S16 B;  4XIG S;  4TKO B;  3C1F A;  2KOL A;  2LY7 A;  5KYL A;  3SK8 A;  1EY8 A;  3TP8 A;  1WD1 A;  1D5X C;  1G2T A;  3URY A;  1ZYR D;  3TN2 A;  4DNT B;  1PRT C;  3BVM A;  1WTO A;  4C1N K;  2MPM A;  4N9T A;  4CGY B;  3M7G A;  1EIG A;  2RDH A;  2J0T D;  2R7Z B;  2V4D A;  1YNN C;  1DM0 B;  3S1N B;  2JA7 B;  3M4Y A;  2AWO A;  4K5X A;  3HOX B;  4FXD A;  5D14 A;  3V96 A;  3OOC A;  2TSS A;  1SYG A;  2B2W A;  4S3S A;  2KA7 A;  4J6H A;  3QB3 A;  3DXJ C;  2HDL A;  3DWP A;  1E2Z A;  1PLF A;  2MJ8 A;  2IL8 A;  5M3M B;  3MXU A;  3OIP A;  3H0G B;  4F87 A;  1FNW A;  4IQZ A;  4K5W A;  3K5L A;  3J81 L;  2F0N A;  1ICW A;  1EZ6 A;  2A6H C;  1HUM A;  3MFY A;  4FNF A;  4MHE A;  2EZV A;  3U9O A;  2NUC A;  3NSW A;  3MXP A;  4K5V A;  1PRT F;  4BA2 I;  1K8O A;  1B3A A;  2RKS A;  4OGQ C;  3A54 A;  2QKI C;  3A8I E;  2Y0S B;  4RA8 A;  2Q8R E;  1HRJ A;  3J80 E;  1BCP D;  3I4L A;  4WOR A;  4HAE A;  3PUV A;  4K6D A;  3M3Y B;  1D5Z C;  3DHQ A;  5ELC A;  2K33 A;  4QB4 A;  3NTI A;  5KNB A;  5A2Q E;  3A55 A;  2EOT A;  3HZX A;  5ELB A;  1SMY C;  5IGG A;  1JWS D;  1WTQ A;  1STA A;  1ET9 A;  5C0X H;  1XXG A;  4C3H B;  5KGU A;  1O7Y A;  1DXM A;  2F0U A;  4XT1 B;  1AZP A;  3NUC A;  4RHR A;  4IUR A;  2A73 B;  2PCF B;  1I4R A;  2D5D A;  3SDZ A;  3Q23 A;  1XTC D;  3G7L A;  2PYK A;  3NTH A;  3VYR A;  2EYM A;  2FJ2 A;  4IFD J;  5ISR A;  4A3D B;  1FNU A;  3K0Y A;  5CYU A;  1Y8P B;  2XRS D;  2PW5 A;  4LK1 C;  1Q1B A;  4RGN A;  1R4Q B;  2B2U C;  4PV1 C;  4R9W A;  3GO5 A;  2KHS A;  4O1N A;  2IW3 A;  5JVG 3;  2IT1 A;  1PRT B;  3R93 A;  4FYD A;  5ELE A;  3I8Z A;  1DJR D;  1S5F D;  2LS0 1;  2K05 A;  2PW7 A;  1D2B A;  3PUZ A;  4FXK C;  3NHH A;  4V0B A;  3FPP A;  5EKL A;  5I2Y A;  1K83 B;  1B1Z A;  4C1N I;  4UDU C;  5C4X B;  3TSS A;  2R93 B;  5M3F B;  4ZKB B;  3NP8 A;  1G2S A;  1UNS A;  1EY0 A;  1BDO A;  1Q1E A;  4H0L C;  1SNC A;  2WAQ B;  3L7Z C;  3L9A X;  1WTP A;  2B8G A;  3ITP A;  1HCZ A;  4WJW A;  1TWC B;  2PMZ B;  1XYI A;  3GV3 A;  2JSO A;  4JK1 C;  4OIJ A;  1A2U A;  4KMU C;  4A3K B;  5CV9 A;  1E2W A;  1BCP B;  1RKN A;  1SND A;  5EPK A;  1S5D D;  3K7A B;  3NWT A;  5CR3 A;  3PMF A;  1JWU D;  1LTA D;  2F4I A;  5I6W A;  3NE5 B;  2EJM A;  4RKB A;  2SNS A;  1AW7 A;  4DAP A;  1HTL D;  4ZAI A;  4J8Q A;  3SVM A;  3PUY A;  1KAA A;  4C3I G;  2EJG C;  2X6L A;  2SDF A;  5CC4 A;  1PTO D;  3KLR A;  1KDB A;  4NKL A;  4X3U A;  3BG3 A;  1KNE A;  3FPU B;  4MN3 A;  4Q0F A;  1Q12 A;  4ZYS A;  2PNR C;  5FKA C;  1I4G A;  5I9P A;  2EPB A;  2EYF A;  3PO3 B;  4RGO S;  1EY7 A;  3MHB A;  1JWM D;  4H7B A;  2L0C A;  3SK5 A;  2JEA I;  3F2U A;  3S1R B;  3DUZ A;  2OXP A;  2EYL A;  3D4D A;  1AZQ A;  3OWF A;  1D1I A;  2IWH A;  2KCC A;  5CBA E;  5JJZ A;  3OPO A;  5D3D A;  2L12 A;  1F9S A;  1RCV D;  5IGE A;  3HRZ C;  5FLX L;  4DAV A;  2RDF A;  1WTX A;  1EL0 A;  1Y1W B;  4GZY C;  1EOT A;  2L55 A;  1UUP A;  5I9O A;  1O78 A;  2VB3 X;  1PZK D;  3IAY A;  1SYC A;  1A3T A;  3TP6 A;  5IGB A;  4G57 A;  3VR2 A;  1PMR A;  2FMM A;  3ZYY X;  5LL6 S;  3QIA A;  3K5N A;  2NWG A;  1L0X B;  2NYZ D;  1C48 A;  3GTJ B;  2K04 A;  4OO1 H;  4MIU A;  2NZ1 D;  3TP5 A;  4FP5 D;  2CVR A;  4ZK9 B;  4R8I A;  3PV0 A;  2K01 A;  1EEF D;  3VYU A;  4XTC S;  2B39 A;  2EYP A;  5BN3 A;  3PUW A;  1LTT D;  5C0X J;  2NTS A;  2N55 A;  4IUN A;  3NBH A;  3OMC A;  3OIQ A;  1H9J A;  5JPM C;  2EY6 A;  1B9M A;  1DOK A;  4HR7 B;  2B2U A;  5KYI A;  1HFG A;  1EY9 A;  2JXM B;  2I46 A;  2PZW A;  1H9K A;  1MGS A;  2B63 B;  4IAL A;  1A6X A;  1EQT A;  3K57 A;  4A3B B;  2B2T A;  3RZD B;  1LTB D;  3W3A A;  4WRD A;  3IKJ A;  3UI2 A;  4Y7N B;  3JAM L;  5IT9 L;  3W2D A;  5CBE E;  1CHP D;  1RF2 D;  1TVX A;  4IUP A;  1PTO B;  1QOH A;  4L8J A;  3M4O B;  2KEE A;  3BVG A;  3NWS A;  5E3F A;  4B9W A;  1JOR A;  1XWE A;  1CZG A;  2HQE A;  2F0K A;  2O5I C;  3H94 A;  5J22 A;  1GUT A;  5CV5 A;  2I07 B;  3FDT A;  4XT3 B;  1O80 A;  2FHT A;  3OMG A;  3I72 A;  1RD9 D;  1CM9 A;  2PZU A;  1E2V A;  3I4M B;  3X3N A;  1V1O A;  1MSG A;  2XN9 C;  2QEJ C;  1LTS D;  2OF1 A;  3M7N A;  2DNE A;  4Z9C B;  2AQ2 B;  2CQA A;  3E0J A;  1PZI D;  4FF3 A;  2KED A;  2A68 D;  2VB2 X;  1IW7 D;  3LNN A;  2E2H B;  2BA0 A;  1BUV T;  4FVM A;  2Q8T A;  1Z47 A;  2BDN A;  4L6T B;  5C3E B;  4HCE A;  5IGC A;  4XXE A;  3MC0 B;  3H3V C;  1KNA A;  1TS2 A;  3Q6S A;  3HOY B;  3CU7 A;  1SBB B;  5KRU A;  3CHB D;  5JEA H;  3HGB A;  5I6Y A;  3T51 B;  2LKV A;  4ZUI A;  1OXU A;  5K36 G;  2AUJ D;  1ET6 A;  1C4Q A;  1F77 A;  1NAP A;  1A3V A;  2IJ0 A;  4H13 C;  5JVH 3;  3TDQ A;  3GTG B;  2F0O A;  2AQ1 B;  2KUM A;  1EWH A;  3ERQ A;  5A35 A;  1F9P A;  1SE4 A;  3I70 A;  4PMW A;  4O42 A;  2K5Q A;  3RMH A;  4XYQ A;  4ABN A;  1I4Q A;  2PO4 A;  2FIN B;  1I50 B;  1PRT D;  4LAA A;  4F88 A;  2O5J C;  2L4N A;  1WVL A;  1B4O A;  3R2T A;  2Q8I B;  3D4W A;  2F03 A;  2A6E C;  1YNN D;  5IOC A;  2F0I A;  4FF1 A;  2L9H A;  4TRD A;  4P2C B;  1M4V A;  3TZU A;  1PTO H;  3S2H B;  4NP5 A;  1J9O A;  1HA5 A;  2BCO A;  5M9O A;  5KND A;  2F0D A;  3S9W A;  4C3J B;  1J8I A;  1RDP D;  4IFD I;  4HCS A;  2RVL A;  2JYO A;  2DN8 A;  5CV8 A;  4IFD G;  1SE2 A;  1BOS A;  1FR3 A;  2NVQ B;  1KLG D;  3NBI A;  3PIO 3;  2WII B;  3EVQ A;  1BO0 A;  2ENB A;  4FO2 A;  3H91 A;  5NUC A;  3WDN A;  1PDQ A;  2ZT9 C;  2LFN A;  2A5H A;  4KKU A;  4F8M A;  1LLR D;  2A6H D;  1QWY A;  5KNC A;  1KTK A;  4X3S A;  4KK7 A;  1NUC A;  5BN4 A;  4IUT A;  4CKB A;  1V43 A;  2ZXO A;  1EFI D;  1D5M C;  1X32 A;  1B53 A;  5COY A;  2F0T A;  5IIF A;  4XYO A;  5FO9 B;  4KKT A;  3MXN A;  5DAU A;  1CA6 A;  1BBX C;  1YNJ C;  1STB A;  5M5X B;  3SK6 A;  4J1M A;  3VR3 A;  3FEW X;  1TWA B;  4NW2 A;  3GTL B;  3BDO A;  2MUY A;  4RWS C;  5COR A;  2E74 C;  1TY2 A;  4C56 C;  2F0J A;  4HMI A;  3GTK B;  3VYT A;  2N88 A;  3C1E A;  1SMY D;  1QIL A;  2HDM A;  2KVM A;  4I7Z C;  2O4X A;  3MAQ A;  1TS4 A;  2PQE A;  3BVZ A;  1EY6 A;  2D62 A;  1JCK B;  2DY8 A;  4RGT A;  4F7X A;  1B9N A;  1BR9 A;  1Z6H A;  2VXW A;  1AP0 A;  5HUR A;  2K03 A;  2XIW A;  3ONA B;  5BN5 A;  2ZXR A;  3DWA A;  2E2D C;  2J7Z A;  2B2T C;  1I4X A;  3QOJ A;  1CA5 A;  3NQI A;  1TR5 A;  4G7O C;  1QNK A;  4ZUJ A;  1TWH B;  5J39 A;  4IN3 A;  4IUU A;  3S15 B;  1EEI D;  4IUV A;  5I4D A;  1G29 1;  4KV6 A;  3NTK A;  4ULL A;  4V19 0;  2B2Y C;  1XX8 A;  3DEO A;  3SHL A;  3VA5 A;  1JOO A;  2WB1 B;  2IX3 A;  4BBR B;  4DK1 A;  5K5P A;  1RTO A;  3AB9 A;  3HEJ A;  2RQX A;  2NB0 A;  3GV6 A;  3N52 A;  2IX0 A;  1KLU D;  1TY0 A;  2BA1 A;  1B2T A;  1U9R A;  1Q8I A;  2A74 C;  2RSO A;  2D2C C;  4BS9 A;  4K2L A;  2TMP A;  3FRP B;  1KDA A;  4KHV A;  3C46 A;  2O2L D;  1FNV A;  1GHJ A;  4OIK A;  5ELF A;  1STY A;  3SR1 A;  4TSS A;  2NVX B;  1OXX K;  1HA6 A;  1QB5 D;  3K6O A;  3TBI B;  1TU2 B;  1X3Q A;  1F2Z A;  5C6A A;  5IT9 E;  2F0M A;  3LWU A;  3BYY B;  3BDC A;  3HOW B;  3D3R A;  4K8I A;  1G6Z A;  2ID0 A;  2F0E A;  2XNA C;  3EQL C;  1S5B D;  4ID6 A;  4A3E B;  2XRQ D;  3V05 A;  4CJ2 C;  1H9S A;  3DMU A;  4ILW A;  2A69 C;  1VF7 A;  2K1B A;  1STE A;  1II3 A;  1SXT A;  2F0P A;  1IYU A;  5C0X I;  3NPP A;  2E2J B;  1U4L A;  5A2Q L;  5IOD A;  3I3C A;  1IL8 A;  5C0X G;  3M85 A;  3K5O A;  5D3I B;  5EPL A;  4EQO A;  4HED A;  1SNM A;  2B2V C;  1HXY D;  3A8J E;  4K8J A;  3EJI A;  2B8F A;  1CTM A;  2K28 A;  5ELD A;  1I3Q B;  1OXS C;  2BE5 C;  2X6G A;  3NQT A;  1FGB D;  2EY5 A;  1I6V C;  1EQV A;  3MWY W;  5EQ0 A;  5F2D A;  4A3G B;  1MBY A;  4RAU C;  1QJO A;  5C3W A;  3IFT A;  4HN7 A;  2JP1 A;  2H4O A;  1CFM A;  3P1H A;  2MP1 A;  1LT4 D;  1EY4 A;  4NDX A;  5C3X A;  5C5M A;  3CRK C;  2SEB D;  1Y69 U;  1I6H B;  2R92 B;  4DK0 A;  2F1M A;  3WOF A;  3HP3 A;  1TKW B;  5E1F A;  3KK7 A;  2NTT A;  1STH A;  4KN4 C;  1QG7 A;  3PUX A;  3J7A V;  1MD2 D;  1LT6 D;  3QG1 A;  2YYZ A;  1EZ8 A;  2F0L A;  3DM1 A;  5FO8 B;  1G91 A;  4XQQ A;  2F0Q A;  2Z1C A;  3RD4 A;  1ZEQ X;  4X3T A;  4G4K A;  4QIW B;  2HUG A;  4CKE A;  2CHB D;  2CW0 C;  3D31 A;  1HTP A;  4KD3 A;  1F9Q A;  1VCI A;  1VMP A;  5CV4 A;  2EY1 A;  1SEB D;  5DNF A;  1CHQ D;  2RBM A;  2XWB B;  1JOQ A;  4N9P A;  3OSO A;  4HSV A;  5FOB B;  4DXF A;  3MVV A;  2AWN A;  3J81 E;  2KQ3 A;  2X69 A;  1IYV A;  1SAP A;  1AN8 A;  1WTR A;  3TZD A;  5M5Y B;  2AQ3 B;  2F3V A;  2E2I B;  1UEA B;  1SSO A;  1WD0 A;  1IHZ A;  1EYC A;  4KN7 C;  1RTN A;  4EQN A;  3VR5 A;  4CJ0 B;  1TWF B;  4CHT B;  4C3H G;  2RA4 A;  1HHV A;  1FD7 D;  2XSC A;  3HG9 A;  2B2Y A;  3GP7 A;  1WTW A;  4IZ8 A;  4QUF A;  2KCN A;  1ZXT A;  5EKK A;  2BOS A;  3V2T A;  1JQY D;  1WTV A;  3T4A C;  1HQM C;  1Y8O B;  3I91 A;  1SYD A;  5G3L F;  2QIL A;  1OXT A;  2EJF C;  1EIH A;  1UAP A;  1IKL A;  2OEO A;  4BBS B;  1B50 A;  1LTR D;  5DEH A;  3PO2 B;  1F2Y A;  1GXD C;  2C9O A;  1OO9 B;  3GD7 A;  2JA6 B;  5D65 A;  1LV9 A;  2K7V A;  3C3L A;  4PQX A;  5J1Z A;  1Q3L A;  1CQV A;  3E5S A;  2D9U A;  1I4P A;  4ME5 A;  1W6J A;  1Z7T A;  3N6R A;  2GA4 B;  1S5E D;  5EJW A;  4KD4 A;  3HOZ B;  3T56 B;  1SE3 A;  1SJE D;  1ZYR C;  4C3I B;  1LT3 D;  3T16 A;  4DN4 M;  4OHJ A;  2H1E A;  2EYH A;  5LHY 1;  4K6L A;  4IUQ A;  5M5W B;  1JR0 D;  3I73 A;  1X3P A;  3S14 B;  1KDC A;  2DY7 A;  1LT5 D;  3OW7 A;  3D6W A;  3P7J A;  4EGV A;  1F2M A;  2RDG A;  3HS0 C;  1OXV A;  1STG A;  3TP7 A;  3Q0A A;  5KEE A;  2IPK D;  3KLS X;  3AU7 A;  4OO1 I;  3K58 A;  2B2V A;  4OO1 G;  1R4P B;  1Y1V B;  1JIC A;  1NR2 A;  5FK9 C;  4RHS A;  1U4P A;  1LO5 D;  4G7Z C;  2AUK A;  1PZJ D;  4BA1 I;  1PFB A;  3BDL A;  1SNP A;  4E6I A;  1ILP A;  3S17 B;  5EKI A;  1VDZ A;  5EGT A;  1QNU A;  4ZLT F;  1ZKO A;  2A6E D;  5C4Z A;  5CV6 A;  2RSN A;  2EYO A;  1SYB A;  1EU4 A;  4U67 3;  1MI2 A;  3MXG A;  4B9X A;  3E6Z X;  2L11 A;  1BCP C;  5TSS A;  2SNM A;  4H44 C;  1STN A;  1LAC A;  4QMG A;  4DU9 A;  1CZW A;  4RCN A;  4EVO A;  3X3M A;  1SNQ A;  1HUN A;  3VR6 A;  4A3F B;  2EY2 A;  4KTA A;  4A3M B;  4KI0 A;  5JAV A;  5JOB A;  5CV7 A;  1JE4 A;  3U9S A;  1A3U A;  4DAY A;  1CK1 A;  2Z8L A;  3A7A B;  4QF4 A;  2XWJ B;  3MFG A;  3GQB A;  4UAI A;  2E76 C;  1GUS A;  4PMC A;  4C2M B;  5FO7 B;  4M8A A;  1JB3 A;  4DNR B;  3J7A F;  3WOE A;  2EXZ A;  3KBG A;  2QDB A;  4KKS A;  1U4R A;  1SNO A;  4K14 A;  1AEX A;  1T5E A;  4KHZ A;  2Z4H A;  4ZRZ A;  1D1K A;  1JOK A;  2K5W A;  1S4Z A;  2EVB A;  3MTS A;  1Q90 A;  5JPN C;  3LWE A;  5CGK A;  1GUG A;  4M1U B;  3ND8 A;  4NMZ A;  1C8C A;  1KAB A;  5C44 B;  4ODG A;  2ICE C;  2WKD A;  1V8Q A;  4TQU S;  1EU3 A;  4EQP A;  3EFX D;  1DZ1 A;  5EBC A;  1GOZ A;  2EYJ A;  3GTO B;  1YNJ D;  1BCP F;  5JEA G;  1W6K A;  3FKI B;  2WIN B;  5FLX E;  3VA7 A;  2ZXP A;  1VMC A;  5KIX A;  2ICI A;  1CI3 M;  3Q22 A;  4ZQ3 A;  3HOU B;  1E0B A;  2QCP X;  3IFD A;  1EWC A;  5C4J B;  5DM6 3;  3SXH A;  3K5M A;  5AFW A;  1BQQ T;  1WCM B;  3OWE B;  3MEH A;  1DD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...