1ZKOA

Crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
HHHHHLKMKKYTKTHEWVSIEDKVATVGITNHAQEQLGDVVYVDLPEVGREVKKGEVVASIESVKAAADVYAPLSGKIVEVNEKLDTEPELINKDPEGEGWLFKMEISDEGELEDLLDEQAYQEFCAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Glycine cleavage system H protein (tm0212) from Thermotoga maritima at 1.65 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Glycine cleavage h-protein
molecule keywords Glycine cleavage system H protein
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1zkoA00
1H9JA 3A8JE 2EJGC 3RLFA 3T56B 1Q90A 1LACA 4OO1H 1DXMA 4TQUS 1H9SA 2E74C 1GJXA 2E76C 1Y69U 3DXJC 1DCZA 5KNBA 1IYUA 1I6VC 3CRLC 1Z7TA 3VA7A 4KKUA 4IQZA 4DK1A 4KKTA 2Q8IB 1Y8PB 2B8FA 2YYZA 4XTCS 4IFDG 2EJFC 1E2WA 2ZT9C 2D5DA 3I4LA 1K8OA 1A6XA 2EDGA 1HPCA 4L8JA 1OXUA 4I7ZC 2R6GA 2A6ED 3PUZA 3D31A 3OPOA 2A69C 5JEAH 1O78A 4KN4C 1IW7D 3MFYA 5K36H 1H9RA 3L7ZC 2K32A 4H44C 3EQLC 4TKOB 3PV0A 2DNEA 3SDZA 1VDZA 2KCCA 4DNTB 2D62A 2JE6I 3LWUA 1DD2A 2PNRC 3ND9A 3VR5A 3A8KE 1Y8NB 2LMCB 4LJZC 3QIAA 2NN6H 1OXXK 3OOCA 1H9MA 3NE5B 4G7OC 5C0XH 1BDOA 1G291 1V43A 2JXMB 1PMRA 1T5EA 2AUKA 3QJYA 3T51B 3T53B 4OO1G 2B8GA 5KNDA 4G7ZC 2K7VA 3D4RA 3A8IE 3M7NA 4BA2I 5KNCA 3SE0A 2O5IC 4JK1C 2L5TA 1VCIA 4H0LC 5K36G 4KKSA 1EWHA 3W3AA 3VR6A 1K8MA 1SMYC 2DN8A 2D2CC 4H13C 3P20A 4KI0A 4JBWA 2A68C 4KN7C 4BA1I 3H94A 1E2VA 1CI3M 2NN6I 1Q12A 3KLRA 1O7LA 2A6HC 3M85A 5BN5A 1Y8OB 5JEAG 1TU2B 1ZKOA 1B9NA 1ZYRC 2F1MA 2DNCA 2KA7A 5C0XG 1GUGA 3VR2A 2JEAI 4XIGS 2NN6G 2EVBA 3TZUA 1OXTA 1GHJA 2AWOA 1VF7A 3WDNA 3ND8A 2A6EC 3MXUA 2CW0C 1OXSC 2JEBI 4RCNA 3VR4A 4DK0A 2IT1A 1Z6HA 4GZYC 3FMCA 1CTMA 1FR3A 2BE5D 3PUWA 3AB9A 5BN4A 1GUSA 1VF5C 1GUOA 1TKWB 2A69D 3IKJA 3I73A 1Q1BA 2PPBC 1YNJC 1E2ZA 3N6RA 4LK1C 2AUJD 3QG1A 2BE5C 1B9MA 3LNNA 1ONLA 1HCZA 2QF7A 3IFTA 3PUXA 3VR3A 4HR7B 4G7HC 4IFDH 3BG3A 2A68D 2A6HD 1GUTA 1H9SB 3HGBA 3A7AB 4KMUC 1FYCA 1GUNA 1LABA 2BA1A 2PCFB 2BA0A 1Q1EA 3GD7A 3PUVA 1QJOA 3GQBA 1IW7C 4PV1C 5BN3A 1H9KA 3A7LA 2E75C 2V4DA 1HTPA 1HQMC 3M4YA 3OW7A 1CFMA 3PUYA 3U9SA 1IYVA 4KHZA 3I72A 3BDOA 3CRKC 2EJMA 1V8QA 1YNNC 2K33A 1OXVA 5A35A 4DNRB 4OGQC 2O5JC 1GHKA 2BDOA 3FPPA
chains in the Genus database with same CATH superfamily
3DUZA 3H0GB 1I3QB 4CHTB 1M4VA 4EQPA 3AQQA 3HG9A 5CV8A 4N9PA 3PO3G 3D4DA 3MVVA 1IL2A 2K1BA 3M4QA 2MNAA 1EFWA 3KF6B 3H3VC 4JI7L 1H95A 2B2YC 2NTSA 1JE4A 2LY7A 1RCVD 1SJHD 2UXBQ 5D14A 2UUAQ 2IL8A 2EY5A 4HEDA 2NVTH 3R8BA 3OIQA 3PCOB 1S5DD 1KAWA 2YU9H 2D62A 2QW7A 1FNWA 2ALYB 4GOPB 1WTVA 1DONA 4UPAA 1XMOQ 3TS0A 3DEPA 1RODA 2E2IB 1UUPA 2M00A 4RWSC 4ZKBB 2QKIC 2F0PA 3DMUA 4IPGA 1A63A 2UUCL 2JYOA 4G4KA 1EOTA 2XRQD 2F0QA 5JVG3 4KKSA 4Y7NB 4DV6Q 2F4VL 2WAQE 4A3JB 1IBML 4H13C 1V9PA 4DA2A 2K52A 4KN7C 4DV1Q 3JAME 5C4XH 1CKOA 1G8ZD 4GNXA 2ATWA 2NN6I 1UE7A 2MHVA 3V96A 4X62L 2K5HA 1HA5A 3NTKA 5JPNC 2UXCL 3OHXC 1NTGA 1GHJA 3KLWA 1GVPA 1II3A 3S1NH 1PYSB 3FDTA 3K81C 4LFCL 4BXXG 3CD6A 4DK0A 1JOOA 2R7ZB 5IYCG 4GKKQ 4GOPA 4J15A 1EQRA 5BN4A 1BCPC 3IL8A 3NBHA 4L5RC 2DY8A 3N6RA 1VQGA 1XMQQ 2E5LQ 1B50A 1SEBD 4Q5VA 1STYA 1S72A 4OXPA 3H3VI 1GKHA 3NXWA 4KV6A 2AQ2B 2N88A 1HTPA 4ZAIA 5IYBH 4C3JG 3I72A 4Z9CB 4A3DH 2R93G 3ER0A 1WTHA 3CU7A 3KUPA 5I9PA 2JN4A 4DR2Q 3A56A 2Y0SB 4JBJA 1B44D 3RZOB 2J4XA 2VUMH 2OQ0A 4DR2L 2NVXH 2JA8G 1DCZA 2NVYB 5FOBB 4JBKA 3E3XA 3QOLA 2DJFC 4C1NK 4LF7Q 3GTPH 2R6GA 4DU9A 1VQ4A 4QUCA 2I0QA 3NWTA 2D0OA 4A93G 2KCNA 3NP8A 4RGTA 1STAA 1CKMA 3J81L 4BY1B 5IGDA 3SGIA 1PFSA 3OOCA 1BDOA 1V43A 5J39A 2NVTB 4DKAC 1HZAA 2HQLA 4QIWE 3CQZB 3NELA 2Z9HA 1E7ZA 1VCIA 2ZTEA 3PGZA 3C2PA 5C4HA 4NXMQ 1VQJA 3V05A 3HS0C 1JJGA 1Q81C 3CMAA 4A3DG 3NQTA 1PH1A 2E2IH 3RR5A 1P16A 1SNPA 4GLVB 3R2TA 1E1TA 2A6HC 4DV1L 2XWBB 4C56C 5J22A 5LMUQ 1VQHA 1DM0B 3VR2A 1EIGA 4DV6L 1CT1D 1PH6A 1OXTA 1PFNA 4DR7Q 1TWHH 1SROA 4GN3B 2RVLA 3I4MB 4AIMA 2UUCQ 1DOMA 1PRTD 2DY7A 2JA8B 4IALA 1VS0A 3TRZA 1DJRD 5LMUL 1XMOL 3T13A 4FF1A 4BXXH 1HZ9A 3QG1A 1ONLA 3LX0A 2Z1CA 3X3NA 1HNWQ 1J8IA 4BY7H 3TP7A 1F2LA 2A6HD 1GUTA 1EU3A 1SE2A 4K2LA 4KMUC 3PO2G 4MTNA 4NXML 3FVQA 1Q8KA 2I5HA 1JORA 4DAPA 1YHAA 4KHVA 1V1PA 4JI7Q 2XN9C 3QWNA 2L9HA 1NCVA 1SNCA 1U5KA 3Q6SA 5J1ZA 2CKZB 3H91A 2NTTA 1KAAA 4DAVA 1BBWA 3M7GA 4JC0A 3MA2B 4PZ6A 1U9RA 1YITA 1ZEQX 1M90C 4JOIA 2HQEA 1LT5D 4RKBA 1F9PA 4XTCS 3F2BA 4IPDA 2SDFA 1CM9A 5FLXE 4KHPQ 2A74C 1FNVA 5FO7B 1QUQA 1D2BA 1NUCA 1XYIA 5IOCA 5DM63 3J81i 5ISRA 5GAHC 3KJPA 4A3KB 1VDZA 3LWEA 3KDFB 3LWUA 1HNZQ 5CV5A 1SE8A 2WIIB 3KBGA 2HHHQ 2BH8A 3NE5B 3NENA 1STGA 1B1ZA 1XXGA 3STBC 1LT4D 4UDUC 5CV6A 3K59A 3CCJA 5FLMG 2UU9Q 3S17H 5IP7H 3S1RB 2C9OA 4ME5A 3T1HQ 3SK8A 3HOXB 3HKZB 4R8IA 1PH5A 4ODGA 1BBXC 2AKWB 1I4XA 1EWCA 2QCPX 1E0BA 1TWFB 1CI3M 1XMQL 2E5LL 4LUZA 1SMYD 3TZDA 3QR8A 3CCRA 4JW0A 1I4PA 1IBKQ 5IYBG 5E3FA 5KIXA 3MWYW 3UE0A 2NN6G 2BCOA 1YJWA 3DWQA 1PRTC 1LT6D 5JAVA 4DV0Q 5A2QE 3GTQH 1TWFH 3HKSA 4MHEA 1A15A 4LFBQ 4LFCQ 4HSPA 4LW1A 4P72A 3TN2A 4CKBA 1LTBD 1Z6HA 4YWLA 2J0TD 1KRTA 4X62Q 1C8CA 2SNSA 4JI6L 2BE5D 2RCFA 1V1PB 4B3SQ 5IY0A 5C44H 1KABA 2MFIA 1G2SA 2E2JH 3S1RH 1B9MA 4X66L 2F0GA 4OEMB 1HCZA 3ERQA 1X32A 4HCEA 1IBMQ 4KTAA 2JA5G 4A93B 2F4VQ 1ESFA 4L5SA 1IXRA 5FO9B 2F0FA 1QJOA 4DPGA 5BN3A 3HOUG 3CCVA 1W2BA 2L0CA 1KLGD 1R9TB 4OHJA 5M5WH 4CDEC 1EY5A 1KQSA 3TS2A 2E74C 1AE3A 1K83B 1Q90A 4MNOA 1DXMA 1BF4A 2K5NA 1GJXA 4GN5A 2EYPA 3S2HB 5M5WB 2K05A 4LUVA 2B63H 2WAQG 3E0EA 3K8AA 3GTGB 3NUCA 3JAMc 1AP0A 2UUAL 1QNUA 4C3JB 5IE8A 2L1BA 2UXBL 4DV3L 3S1MH 1VMCA 2KCMA 1IHZA 3GTPB 1Y1VG 2A6ED 3OPOA 2NVQH 4KN4C 2L15A 1Y1VB 1O80A 1HA6A 4H44C 1RD9D 4OX9Q 2DNEA 1STHA 3S24A 3K5NA 4A76A 5D65A 5AJ3L 4UHVA 1MBYA 5IT9L 2B2UC 4O2DA 3FP9A 2HDMA 1I4HA 2AUKA 2F0NA 2JQOA 3WOFA 3PIO3 1CSQA 1RJTA 1UE5A 4BA2I 2WB1G 4XYOA 1PVOA 3S16H 3KFUA 1A8VA 5M5XB 1NJIC 1X3QA 3K58A 5FK9C 1TWCH 5LL6S 4PNYA 3VYRA 3SVMA 2F0TA 4IPHA 1I4RA 3H94A 2KHSA 5DEHA 1CA6A 1O7LA 4HIMA 4JV5L 5HGTA 1VQBA 4X65Q 2PZWA 5C0XG 4PQXA 3HOWB 1MGSA 1O7ZA 3V2TA 4C3HG 3MXUA 3HZXA 4DV2L 1NBWA 1JICA 2B2WA 4FXGC 5T1IA 4LAAA 1GUOA 1TKWB 2EY6A 1V1QA 4UP8A 1HFNA 5M5XH 2L11A 3I55A 4K5VA 4IFDH 4B9WA 2EYLA 4HR7B 4JI1L 3AEVA 4DUZL 3J80L 3D6CA 5M3FG 3C46A 5ELBA 1M1KC 1WCMG 4DAYB 2ZXRA 2NUCA 4DR4Q 1EYAA 4N8X1 2LS01 4RG1A 4JYAQ 4LFAL 1H9KA 1DZ1A 1L2FA 2E75C 5CC4A 3S1QB 1E24A 3PUYA 5ELDA 1FNUA 4EQ5A 1UE6A 4ZYSA 2F0VA 3CC7A 1WD1A 1D7QA 2K01A 5CORA 1WTWA 1Q86C 1TY0A 2Z4IA 1S5FD 2KQ3A 2XIWA 1EY0A 5C0XI 5EKLA 4JI3L 1K9MC 4IOAA 2QA4A 2IWHA 4LF8Q 4ME3A 1SYDA 5K5PA 4RKLA 3TP6A 1N34L 1QILA 3UDXA 3A5UA 2CH4W 1BQQT 5F2DA 1O78A 1K0SA 1LTAD 4LF9L 2L12A 2OT2A 1HXYD 1GOZA 3P75A 1VQIA 3S1QH 1ZYRD 2Q2TA 3A8KE 2RSOA 4FXDA 4CDCC 4NMZA 2WACA 1Y1WB 4XYQA 3SHLA 3CMEA 4DR1L 3P7JA 3AFQA 2R93B 3HOYH 4X3UA 4BBSG 1LLRD 2NZOA 1QB5D 5C5MA 3G6EA 2R7ZG 4MN3A 2B2TA 1YEZA 2H5XA 2D2CC 5C4XB 2B2VA 3P20A 1RIPA 3E5SA 2ICEC 4BA1I 2UXDQ 1GUWA 3JAMi 4GS3A 1PZID 2NVXB 3FKIG 1BCPF 5CBAE 2HIVA 3KBXA 5EKKA 5EJWA 1VQKA 5E4XA 4C3IG 3RLOA 3MAQA 3OTOL 2PW7A 4PMCA 1EY8A 3J80c 4A3MB 2IY5B 2A19A 1CHPD 4L5QA 3KDFA 1MSGA 1X3FA 5LMNQ 1NR2A 1D1IA 3U4VA 2B2YA 1YNJC 3CCLA 3Q24A 2R3ZA 2K5QA 3EN2A 4DK3C 3IFTA 3VR3A 4IUQA 5M3FH 3HOUB 1N33Q 1NAPA 3H09A 4HIOA 3L2PA 4MTKA 1JT8A 5EPLA 1FGBD 4X3KA 2EXDA 1HTLD 1Q1EA 2YTXA 1AZPA 3AYHB 5ELCA 3U9OA 2TMPA 3HOUH 4A3IB 1IZ6A 2BOSA 4DNRB 3RZOH 3J81E 1H9JA 4FDBA 4A3KG 2EJGC 3I2ZA 1QVFA 1VQ7A 1CKNB 1EWIA 2QEXA 1EIFA 1ICWA 3SEBA 1IYUA 5KYLA 4C3IH 3E9IA 3PIOA 4LF9Q 4DK1A 3KK7A 2CQAA 4C2MH 3U4ZA 3CQZH 1ILPA 1HRJA 5IIFA 3HOWG 2Z0SA 1SBBB 2WKDA 4BBRG 4LF8L 4OL7A 5K36H 1LV9A 1X54A 3HKZG 1AW7A 2VB2X 2MGSA 1B53A 4B9XA 1OTCA 2JA6G 2R7DA 3BVGA 1YNND 1CA5A 1KNEA 3VR5A 1IBLL 2E2HH 1OXXK 1ET6A 4A3MG 1AFPA 2MQHA 3L9AX 5IYDH 3GTLH 3HRZC 2XTIA 2QDLA 3LGJA 1HUMA 2OF1A 4DAYA 3MEHA 4JG2A 4B3TQ 4A3EG 4LF4Q 5IP7G 1F9SA 3PF5A 4CKEA 1WTQA 1GXDC 4K8JA 5IODA 1B4OA 3O13A 2FJ2A 1PTOD 4YCVA 3BDCA 1SYFA 4IUTA 1M8AA 2I46A 1SN8A 1T9HA 2DUDA 3E6ZX 1HNXL 2KA7A 2DNCA 3AMUA 4K6DA 2CVRA 2KVMA 3PO2B 2EVBA 1K3RA 3DHQA 4R4QA 4DN4M 4DV2Q 4IFDJ 4KY5A 1A3VA 4CDFC 1HZCA 4HIKA 2K5DA 1CTMA 2F0JA 5E7NA 2M9VA 2MJ8A 1GUSA 2RF4A 1WOCA 4LK1C 1JWSD 3LNNA 4ZQ3A 2LXJA 3OWFA 1AEXA 1EYGA 1EQTA 2RDHA 3F2CA 1PFMA 1LTID 3AU7A 5NUCA 1I4QA 3TMEA 5I2XA 1WVLA 5C44G 3NK9A 3I4OA 1Q7YC 4A3FG 1B70B 2HD3A 2V4DA 1HH2P 3D8GA 1CFMA 5C6AA 4NPSA 2NBFA 3S14H 1NMFA 3CRKC 2K5WA 3K6OA 2AQ1B 3K80C 3VYTA 1K8OA 1RHPA 2E8GA 2WV6D 4QL5A 2EE1A 4A3CH 4DK6C 3ICEA 4HMIA 2G5DA 1PYBA 2KJXA 3VA7A 2KHJA 1AZQA 4G57A 5C5LA 5EAYA 3MXNA 1W6KA 3CC4A 3G48A 2J7ZA 4ZKCB 2PI2E 3EQLC 2Y0SE 4TKOB 3PV0A 4ID6A 2Y0SG 1B2TA 2RKSA 1XPUA 1YNJD 1BOSA 4A3MH 3X3MA 2VXWA 5A2QL 4PMWA 5C3EB 3ULJA 3K0YA 3T51B 1C4QA 2M2LA 2B8GA 1G51A 1SYCA 5C4ZA 4G7ZC 1PH3A 1PV4A 4L6TB 4FYDA 4X6AH 2PYKA 3GTOH 1R9TH 5K36G 1TWAB 1BKBA 4HN7A 4HJ9A 1KL9A 4JPBW 1DYQA 3U50C 5KEEA 1J5EL 4KI0A 3OW2A 2VUMB 4FXKC 5GAGC 4IUUA 1U4PA 1PH4A 3K5MA 4Q0FA 4X3TA 1HR0W 1ZYRC 3HP3A 2Q8RE 3UE1A 3OSOA 5H1SE 1WI5A 4JI6Q 3J7ZC 1ET9A 2F0MA 1D5MC 2IX0A 1EQVA 5AFWA 3S1MB 2WB1E 2DGYA 1GO3E 1CZGA 3PO3H 2IT1A 1JB7A 3RZDH 3GV3A 3OYYA 2NVYH 1I5FA 4C3IB 1I6HB 1L0YB 1A62A 1VF5C 1YIJA 3IKJA 3I73A 3PO2H 3S2DH 3RLNA 2AWNA 4OIJA 1W3SA 3J7AV 3S15H 4BY7G 1YHBA 4G7HC 3RD4A 4FF3A 3I4NB 2JSOA 1N32Q 2FINB 4M1UB 4NW2A 3E0JA 2Z6KC 3PUVA 4HAEA 2UU9L 3BS1A 1LTRD 5FKAC 3CC2A 2QEJC 4L5TA 3BDOA 1W6JA 3SK4A 5CBEE 2NVQB 5ELOA 4A3JG 2K33A 3PF4A 3HOZH 4FNFA 4YWMA 2PMZE 1A3UA 4OGQC 1HR0L 3GTLB 4K2KA 4LWCA 3NTIA 3EROA 1HNZL 2NZHA 1JR0D 3D0FA 2XGTA 2B29A 3GV6A 2YTYA 3GTGH 1I6HH 1XJVA 2VQEQ 4KKUA 1AE2A 2Z6BA 3ITPA 4POGA 1PH8A 2B8FA 2YYZA 3URYA 2WKCA 5I9OA 1X9NA 1I3QH 2YV5A 4L8JA 1PHJA 2A69C 1YVCA 1SYBA 5CR3A 3GTKH 4M8AA 5EQ0A 2VB3X 4AYBB 4PZ7A 4DR5Q 3CCSA 1UAPA 3ND9A 4CJ2C 5LMNL 1H9MA 1WTOA 1GD7A 2JA7H 3NPPA 3QJYA 2VUMG 3S16B 1KIXA 3GP7A 1PLFA 2L5TA 3M4OB 1VQLA 1EWHA 4DV7L 1LYLA 1Q46A 3A55A 1IKMA 3NBIA 5FLXc 1HNWL 3J80E 1FL0A 1E2VA 1Z9FA 3K5LA 3IAYA 3HOWH 3TQYA 3MEFA 1KRSA 1R4QB 4LF6Q 1GUGA 4QGUA 5M3MG 5IGCA 3CHBD 4O1NA 3ERSX 4N8FA 4PZ8A 2RDFA 4PMBA 3ND8A 5IT9E 1RDPD 5M9OA 4DR7L 3N52A 4PG3A 4KD4A 1G6PA 2FMCA 4DR6L 3M3YH 2N8NA 3Q8DA 3HOXH 2ZM6L 4A3KH 1C9OA 1HFGA 1TR5A 3KLSX 4P73A 2AUJD 2EYHA 4P2CB 1G2TA 2K75A 1UEAB 2RQXA 1VQDA 3MC0B 2Z8LA 1RTOA 5L37A 1CKNA 3T16A 3M3YB 1B3QA 3A7AB 3RZDB 3T1YL 2BA1A 2PCFB 1BVSA 4QB4A 3I3CA 4APVA 1KC8C 4PV1C 5C4XG 3A7LA 4WORA 2RCNA 3BZCA 5CV9A 1B3AA 4KHZA 3S15B 4OIKA 4JI3Q 4NDXA 1N36L 2EYMA 1QVGA 2KECA 1MJEA 4MIUA 2I5MX 3I56A 1KTKA 2IX1A 4JI8L 3RNUA 2CFMA 1IYJB 2EQSA 4KKTA 1UNSA 4LF7L 1EYCA 1Y8PB 1HPCA 1TQOA 3KOJA 1CHQD 1SNMA 5EPJA 3NQIA 3JAML 1IW7D 4CJ0B 4A3IH 3NSWA 1NNXA 1WYDA 4DUZQ 4JI1Q 4I65A 4RHSA 2WFWA 1DD2A 1BCPD 4X3SA 4C1NI 2MP1A 1QOHA 2R7ZH 5DAUA 1Q8IA 2LMCB 1VQOA 1EIYB 1G291 4H02A 3HOYB 4FVMA 4IO9A 4K8IA 4AYBE 3K7UC 1PMRA 3T53B 2WP8J 1IL8A 4ZUIA 1QUQB 4QMGA 2RHSB 4JK1C 3J81c 3W3AA 2IPKD 2JJQA 1JWUD 3EVQA 1JWMD 4BBSH 4N9TA 1PTOC 1TU2B 1B9NA 2G9DA 3RN5A 2JEAI 3A0JA 1TT2A 3DEOA 1MHWC 5JPMC 2FMMA 2FFKB 1Q3LA 1G91A 3QOJA 1YJNA 4RH6A 3QB3A 1S40A 1DOLA 1XTCD 4DR3L 1I94Q 2IW3A 2TSSA 4ZK9B 3AB9A 1K0RA 5AJ3Q 3W5OA 1MD2D 4A3LH 3AFPA 2RA4A 2R61A 2SNMA 2QF7A 2A68D 4ZRZA 1HJPA 5EBCA 4J1MA 2F0LA 3VYSA 2CHBD 2BA0A 5I2YA 2DJGC 4DV3Q 4ZCKA 1WJJA 2X69A 4K5WA 4DV4L 1IYVA 2R7FA 3H0GG 5IP9H 4ULLA 1L1OC 1L0XB 4QIWB 4FF2A 3BZDB 1YNNC 4KY6A 2WB1B 2JA7B 5I4DA 1ASYA 1RTNA 2B2TC 1C0AA 1Z7TA 4ILWA 1WCMH 1KD1C 4FO2A 1BCPB 4TSSA 3FRPB 5LHY1 2CCZA 1QE6A 4DV4Q 4JI2Q 3I4LA 2ZJQA 4KJOA 4A3EH 3EBEA 2Z4HA 1S4ZA 2K32A 3KF8A 2VY3A 2OQKA 5IYDG 4MZ9A 4XDXA 1F2YA 3I7FA 5IWAQ 4QCLA 4C3HH 4RGOS 1MSHA 3QIAA 4OWTB 4B3SL 3D6WA 5IT9c 5FJ8G 1PH2A 2JXMB 4LUOA 1PFBA 1B8AA 1SR3A 4F8MA 4ZUJA 1CQVA 1F2MA 5DM73 5C4JB 3M7NA 2SOBA 4LF5Q 1PTOH 2JA9A 3UI2A 4K6LA 4BBRH 4H0LC 2MO1A 4EX5A 1E22A 4GN4B 1SMYC 1IBKL 1TVXA 3OMCA 1F9RA 4RGMA 4NKLA 4OWWB 3FKIB 1ENCA 1WFQA 3ONAB 1Q12A 4JVZA 2N55A 3GTQB 4DXFA 3VA5A 1CSPA 3F1ZA 1C48A 1YNXA 1DOKA 2F1MA 5COYA 3MXNB 2K6AA 3M4PA 3TZUA 1XPOA 1VQ5A 3SK5A 1LUZA 3CPFA 4A3LG 2B63G 4IJLA 3BU2A 2EXZA 3IFDA 2CWPA 4BBRB 1U4MA 1PRTB 2KUMA 3BG3A 1T5XD 3I90A 1LTSD 3PMFA 1Z47A 1MI2A 1STBA 2L55A 1SFOH 4KHPL 4LF5L 4R1JA 1HQMC 3PQIA 1VMPA 1QG7A 4IJHA 2QDBA 3PO3B 4RMFA 1PYWD 2BDOA 1R4PB 5ELNA 1RL2A 5IWAL 3WWVA 1X3GA 3A5ZB 2Q2HA 2VS1A 3F8TA 1JMCA 1EZ8A 4A3DB 4IUVA 4BWGB 3I4MH 1KHIA 5BR8Q 2P5ZX 2NWGA 4IOCA 1NE3A 4AH6A 5M3MB 3HOXG 1YJ9A 3BVZA 3U58A 1P8LA 1K83H 1KXLA 4XT3B 4JI2L 4A4IA 1O7IA 2XNAC 3PUZA 3T1YQ 4RGNA 5JEAH 4WJ3M 4A3IG 2PNHA 4S3SA 1PTOF 2VL6A 1RF2D 2PMZB 3HOYG 3I91A 5M3MH 3J80i 1WCMB 3CAMA 2F0SA 1A2UA 1JC7A 2KBNA 2ZM6Q 2NN6H 1YHQA 3RN2A 1Y1VH 2KCTA 4DR6Q 1FVIA 3NEMA 4F88A 1SDFA 3MFGA 4YCUA 2PZUA 4ABNA 2HT1A 2NZ1D 2LKVA 2K5VA 1KDCA 3IRBA 4LF6L 4OO1I 3CXCA 1PXUA 2VW9A 3KJOA 3Q23A 4A3BB 3NHHA 1ZKOA 2OCEA 1EY6A 1LTGD 1SJED 2F0HA 1PDQA 5D3IB 4DR3Q 1I94L 2RHQB 1LM0A 4R8NA 4OWXB 5EGTA 3BVMA 2JEBI 4YIJA 4RAUC 3J7YW 2JA5H 4V190 3ZYYX 4OELB 4EQNA 4HMJA 2K50A 3BYYB 3H6MA 2PPBC 4HTHA 2OWOA 4XT1B 2JA6B 3CCEA 3H0GH 2EZVA 4DR5L 4A3BG 1JOQA 3OIPA 1VQPA 3EA6A 4EGVA 3CPWA 4JCVE 3HGBA 3TP8A 3MXGA 2BH2A 4A3JH 5J3BA 3DM1A 5I6WA 3NWSA 3M4OH 3C3LA 4HJAA 2YTVA 4FP5D 5IGFA 2F0IA 1XX8A 3BZKA 4CKCA 1OXVA 3ULLA 3TBIB 4AQYL 2OTJA 4GKJQ 1QWYA 2H1EA 3E9HA 1HZBA 1E3PA 5LMNW 3T56B 1J9OA 2QILA 4UAIA 4OO1H 3GO5A 3J7AF 1HR0Q 5KNBA 1QCBD 4GNXB 4IQZA 2PQAA 1L0WA 4OONA 5HURA 3K5OA 1QZHA 2ZT9C 2LFNA 1A6XA 3S1NB 1OXUA 1PZJD 2F3WA 4JI8Q 4CJ1B 4XQNA 1TIID 4JI5Q 1C7YA 1EIHA 1S5CD 1UEBA 1X65A 2KCCA 2PI2A 2C5CA 3S9WA 2F0EA 4A3GH 1D5ZC 1N36Q 1SSOA 2HDLA 2A5HA 5CYUA 1KNAA 4GKKL 1VQNA 1IKLA 1AN8A 1MKHA 5KNDA 2HUGA 2G9HD 4P71A 5G3LD 3DWPA 5CV4A 1JJCB 1TS2A 2UXCQ 2F0UA 3HOZG 3TP5A 2DN8A 1UWVA 4DUYL 2Z6KA 1FJGQ 2B63B 2EY1A 3CCMA 3C1FA 1OO9B 5KRUA 4ALPA 2V1CC 5BN5A 2A8VA 4NB3A 1J5EQ 1WD0A 2FXQA 4K5XA 4K14A 1YZ6A 5JOBA 1GM5A 4XIGS 2QGQA 3HKZE 1K28A 1XTDA 2AWOA 1VF7A 2OEOA 3H3VH 2K28A 2EYOA 2ZTCA 5C0XJ 1XNRL 4GZYC 4KJNA 4JI4Q 5GADC 2AMCB 1AH9A 4P75A 3DM3A 2ZJPA 5ELEA 2K4KA 2F0DA 3I4NG 3EIVA 5IGBA 2IHFA 1A2TA 2B39A 1ENFA 1VQFA 4A3FB 4BBSB 4UP9A 1STEA 2PQEA 1FYCA 1GUNA 4DV7Q 2A73B 1I50H 2K03A 2HCCA 1IW7C 1WTRA 1TWAH 1MJCA 4XXEA 4GNXC 3U9SA 2F3IA 4A3FH 2FHTA 1XNQQ 2O4XA 1V8QA 2R93H 1X55A 3FPPA 1SXTA 3VDYA 2F0WA 1LACA 4TQUS 2WAQB 1QVCA 2MO0A 2E2DC 3OMGA 4U673 3DLLA 4FF4A 5JJLA 3EJIA 1KDAA 1E2WA 2D5DA 1FGUA 4Y52H 1TWHB 1RKNA 1BXTA 4DNIA 5I6YA 3K7AB 4TVAB 3D31A 4RHRA 2VQEL 1SNOA 1JQYD 3L3OC 1H9RA 3S2DB 2ZTDA 2N49A 2PNRC 1K8GA 2BDNA 4NXNL 4X64Q 1SNQA 1KLUD 2JA5B 4UY8C 4BY1G 5CGKA 2JA7G 4G7OC 3BDLA 1S5ED 2ZXPA 5M3FB 3D4RA 3A8IE 2JA6H 4YHHQ 1PZKD 3SE0A 1JB3A 1U0LA 1K73C 2MUYA 1XWEA 2JA8H 1N32L 1LO5D 3DWAA 1FD7D 1HNXQ 5M5YB 4R4CA 1STNA 3P1HA 3R93A 5JEAG 4IN3A 3SK6A 2RDGA 1SAPA 1E1OA 1MIUA 4POFA 1F2ZA 1SE3A 2F52A 1X56A 4B3TL 3A54A 2N78A 3CCUA 1J6QA 5GROA 1SYEA 3C1EA 1PH9A 1VQ6A 4H7BA 2GN5A 5E1FA 2KENA 1JJ2A 1Q1BA 1E2ZA 2XRSD 2CH4A 1I4GA 2X6GA 1VQ9A 3W2DA 4V0BA 1BUVT 5IYCH 4IUPA 4EQOA 3JC66 1ML0D 4B3MQ 3S14B 1EL0A 4YCWA 1VQEA 4YHHL 4U68A 4JI0Q 4A3CG 3OWEB 3J81j 2KEDA 1YI2A 4NP5A 2RSNA 2XVSA 1PRTF 2EJMA 2O5JC 2R92B 5GQOA 4X64L 2ID0A 4NXNQ 4WJ4A 2F0KA 1JCKB 2E76C 1Y69U 4IPCA 1I6VC 3HOVG 2SEBD 3NTHA 3GTMB 1CK1A 3G4SA 1SMXA 3QO2A 1BNZA 4A3GG 3S17B 3A74A 4A3EB 5JJKA 4Y7NH 3K0XA 3KYHC 5T1GA 2ES2A 3G71A 2I07B 1B7YB 3MFYA 4WRDA 5KYIA 2EPBA 5HY6A 3CCQA 4DNTB 3FKIH 2JK8A 2I5LX 1Y8NB 2F03A 3T4AC 2K14A 3GTOB 1CZWA 3CP0A 1XNQL 1NSNS 2HIXA 2D9UA 2OXPA 4A93H 3I8ZA 1HHVA 1F9QA 1PTOB 1ILQA 2VQFQ 2KOLA 4OO1G 2LXKA 3OTOQ 2O5IC 3Q22A 1X3PA 2EYJA 2MPMA 1N8RC 2GA4B 1SYGA 1SE4A 3ULPA 5C3EG 1A3TA 2PW5A 1EYDA 2F3VA 4JOIC 4JBWA 1YBYA 2UXDL 1CQFA 2PZTA 3KLRA 1L1OA 2NB0A 4J8QA 1PH7A 5C3WA 3G6JB 1X3EA 2GVBA 2AHOB 4JI4L 4K0KQ 5DLQE 2Q8TA 1QZGA 2IX3A 1XNRQ 1JOKA 3Q0AA 1VQ8A 4DV5L 4DFAA 1OXSC 1VQAA 3VR4A 4C3JH 4WJWA 4DR1Q 1FR3A 2E2HB 4O42A 3G7LA 2RBMA 3UDIA 4YWKA 4YY3Q 2BE5C 1O7YA 1K8AC 4KY7A 4QJFA 3GDEA 2ZXOA 4A3BH 3K7AH 4RCOA 4DUYQ 2WINB 4R4OA 3TEHB 1FJGL 1H9SB 1NR4A 5JEAJ 1SFOB 1LABA 1I50B 1N9WA 4DAMA 4LF4L 1ENAA 3GD7A 3GQBA 4B3RL 5IGGA 3M4YA 1XPRA 2UUBL 3I4NH 4HJ8A 2IJ0A 4QF4A 1EU4A 4HIDA 2LSSA 3D4WA 2E2JB 5A35A 5LL6X 4E6IA 1PA6A 2JP1A 3A8JE 2XSCA 3L0OA 5EBDA 3RLFA 1A0IA 2IHEA 1IBLQ 2B3GA 2N3SA 3H15A 2O2LD 1H9SA 4R4IA 5KGUA 3DXJC 4C3HB 2F0OA 3CRLC 2NYZD 5E4WC 4JI5L 2EIFA 3R2IA 2Q2IA 2UUBQ 2VNUD 2PQAB 1JE5A 1WTXA 4I7AA 3D3RA 4GLAC 5C4JH 4B3RQ 1BBUA 4I7ZC 5C3XA 1EZ6A 1TS4A 5HGQA 4CGYB 3SDZA 5TSSA 2JE6I 4WFN3 4YY3L 3CW2C 4GKJL 4R9WA 1D8LA 4AQYQ 1G6ZA 3GTKB 3MXPA 1LTLA 1TS5A 3W1BA 1ASZA 1SNDA 5D3DA 2K7VA 5KNCA 4DV5Q 4JBMA 3B6YA 3ZJYC 1ESRA 3VR6A 1Q82C 1K8MA 4K0KL 5FLXL 2KEEA 5FO8B 4LNQA 1VQCA 3SXHA 4X65L 1N33L 1V1OA 3W1GA 5M5YH 2GVAA 2A68C 2R92G 4XQQA 4BY7B 3I4MG 3HEJA 2PO4A 1Y8OB 1U4LA 4RA8A 5JJIA 1L1OB 2ASBA 3HOZB 2CW0D 4KLKA 4HCSA 4CDDC 4IFDI 4O0AA 3UDGA 4EVOA 4RCNA 2VQFL 4F87A 5CV7A 1ICFB 3CKIB 1TY2A 4IUNA 3PUWA 3GTJB 2A69D 1EQQA 2OTLA 3UDFA 2B2UA 3K57A 4CBVA 4OX9L 3PUXA 1EEFD 1EY9A 1TWGB 2KHIA 3F2UA 1F77A 2H4OA 1CUKA 1Y1WH 3TSSA 2D0PA 3FPUB 3VYUA 3OW7A 4L63B 4QUFA 3M9BA 4F7XA 2EYFA 4QY7A 4AYBG 1D6EC 1NY4A 3I70A 4UP7A 3FEWX 1EUJA 2R92H 1Y14B 3KF8B 3WOEA 4DXGA 2K04A 2XWJB 2HCIA 5FJ8H 4QQBX 4ZLTF 3GTMH 5IGEA 3KF6A 1SRUA 1S3OA 1UE1A 2B2WC 2Q8IB 2A1AA 4GOPC 2CWAA 4JI0L 4IFDG 1X6OA 2EJFC 2EOTA 1N34Q 2EDGA 5EKIA 1EFID 1TWGH 4B3ML 4TRDA 1QNKA 3RMHA 4HSVA 3R3OA 5BR8L 3L7ZC 5GAEC 5ELFA 1NMGA 3RUZA 5FLMH 4KD3A 4A3GB 5DNFA 1ZXTA 4IZ8A 4X66Q 3STBD 3PIPA 1S5BD 1LTTD 4BY1H 3MTSA 4LJZC 2VZAA 3PSIA 3BJUA 1LT3D 5C0XH 3MHBA 1EOVA 1K3BC 1T5EA 3PIP3 1TS3A 2AQ3B 2ENBA 4LFAQ 4LFBL 4DV0L 4JYAL 4DR4L 5C3EH 5C44B 4IURA 4GLXA 2CQOA 1D1KA 1KDBA 2EY2A 3HOVB 3SR1A 4DF7A 5CMDA 3M85A 4P74A 1VQMA 3S2HH 3TDQA 3T1HL 2X6LA 4A75A 4HJ7A 1HUNA 4LMQD 1EY7A 2Q2UA 3WDNA 2A6EC 2F4IA 2CW0C 4RFBA 4C2MB 4HJ5A 5IP9G 2ICIA 4DGZA 3FMCA 1TWCB 1BO0A 2HHHL 2C35B 1Y1WG 1DGSA 1EY4A 3NBHB 4B08A 1D5XC 1SLJA 4JV5Q 4R4TA 1WTPA 4J6HA 3KLSA 3EFXD 5JVH3 3HOVH 3MZ5A 3BYTB 1EEID 1U4RA 3J7A5 4BS9A 3GTJH 2B2VC 5G3LF 2L4NA 3FHWA 3HFZB 5JJZA 2YU9B 1BR9A 5EPKA 4KK7A 4XQJA 1HQRD 3F2DA 3CF5A 3TREA 1GHKA 1TXYA 2ZJRA
chains in the Genus database with same CATH topology
3DUZA 3H0GB 1I3QB 4CHTB 1M4VA 4EQPA 3HG9A 5CV8A 4N9PA 3D4DA 3MVVA 2K1BA 3H3VC 2B2YC 2NTSA 1JE4A 2LY7A 1RCVD 1SJHD 5D14A 2IL8A 2EY5A 4HEDA 3R8BA 3OIQA 1S5DD 2D62A 1FNWA 1WTVA 1DONA 3DEPA 1RODA 2E2IB 1UUPA 2M00A 4RWSC 4ZKBB 2QKIC 2F0PA 3DMUA 2JYOA 4G4KA 1EOTA 2XRQD 2F0QA 5JVG3 4KKSA 4Y7NB 4A3JB 4H13C 4DA2A 4KN7C 3JAME 1G8ZD 2NN6I 2MHVA 3V96A 3NTKA 1HA5A 5JPNC 3OHXC 1GHJA 1II3A 3FDTA 4DK0A 1JOOA 2R7ZB 5BN4A 1BCPC 3IL8A 3NBHA 2DY8A 3N6RA 1B50A 1SEBD 4Q5VA 1STYA 3NXWA 4KV6A 2AQ2B 2N88A 1HTPA 4ZAIA 4C3JG 3I72A 4Z9CB 3CU7A 3KUPA 5I9PA 3A56A 2Y0SB 1B44D 3RZOB 2J4XA 1DCZA 2NVYB 5FOBB 3QOLA 4C1NK 2R6GA 4DU9A 4QUCA 3NWTA 2KCNA 3NP8A 4RGTA 1STAA 3J81L 4BY1B 5IGDA 3OOCA 1BDOA 1V43A 5J39A 2NVTB 3CQZB 1VCIA 3C2PA 5C4HA 3V05A 3HS0C 3NQTA 1SNPA 3R2TA 2A6HC 2XWBB 4C56C 5J22A 1DM0B 3VR2A 1EIGA 1CT1D 1OXTA 1PFNA 2RVLA 3I4MB 1DOMA 1PRTD 2DY7A 2JA8B 4IALA 1DJRD 3T13A 4FF1A 3QG1A 1ONLA 3LX0A 2Z1CA 3X3NA 1J8IA 3TP7A 1F2LA 2A6HD 1GUTA 1EU3A 1SE2A 4K2LA 4KMUC 3FVQA 1JORA 4DAPA 4KHVA 1V1PA 2XN9C 3QWNA 2L9HA 1NCVA 1SNCA 3Q6SA 5J1ZA 3H91A 2NTTA 1KAAA 4DAVA 3M7GA 3MA2B 1U9RA 1ZEQX 2HQEA 1LT5D 4RKBA 1F9PA 4XTCS 2SDFA 1CM9A 5FLXE 2A74C 1FNVA 5FO7B 1D2BA 1NUCA 1XYIA 5IOCA 5DM63 5ISRA 4A3KB 1VDZA 3LWEA 3LWUA 5CV5A 2WIIB 3KBGA 3NE5B 1STGA 1B1ZA 1XXGA 1LT4D 4UDUC 5CV6A 3K59A 3S1RB 2C9OA 4ME5A 3SK8A 3HOXB 3HKZB 4R8IA 4ODGA 1BBXC 1I4XA 1EWCA 2QCPX 1E0BA 1TWFB 1CI3M 1SMYD 3TZDA 1I4PA 5E3FA 5KIXA 3MWYW 2NN6G 2BCOA 3DWQA 1PRTC 1LT6D 5JAVA 5A2QE 4MHEA 1A15A 4HSPA 3TN2A 4CKBA 1LTBD 1Z6HA 2J0TD 1C8CA 2SNSA 2BE5D 1V1PB 1KABA 1G2SA 1B9MA 2F0GA 1HCZA 3ERQA 1X32A 4HCEA 4KTAA 4A93B 1ESFA 5FO9B 2F0FA 1QJOA 5BN3A 2L0CA 1KLGD 1R9TB 4OHJA 1EY5A 2E74C 1K83B 1Q90A 1DXMA 1BF4A 1GJXA 2EYPA 3S2HB 5M5WB 2K05A 3GTGB 3NUCA 1AP0A 1QNUA 4C3JB 2L1BA 1VMCA 1IHZA 3GTPB 2A6ED 3OPOA 4KN4C 1Y1VB 1O80A 1HA6A 4H44C 1RD9D 2DNEA 1STHA 3K5NA 5D65A 1MBYA 5IT9L 2B2UC 2HDMA 1I4HA 2AUKA 2F0NA 3WOFA 3PIO3 1RJTA 4BA2I 4XYOA 5M5XB 1X3QA 3K58A 5FK9C 5LL6S 4PNYA 3VYRA 3SVMA 2F0TA 1I4RA 3H94A 2KHSA 5DEHA 1CA6A 1O7LA 5HGTA 2PZWA 5C0XG 4PQXA 3HOWB 1MGSA 1O7ZA 3V2TA 4C3HG 3MXUA 3HZXA 1JICA 2B2WA 4FXGC 5T1IA 4LAAA 1GUOA 1TKWB 2EY6A 1HFNA 2L11A 4K5VA 4IFDH 4B9WA 2EYLA 4HR7B 3J80L 3D6CA 3C46A 5ELBA 2ZXRA 2NUCA 1EYAA 2LS01 1H9KA 1DZ1A 2E75C 5CC4A 3S1QB 3PUYA 5ELDA 1FNUA 4ZYSA 2F0VA 1WD1A 2K01A 5CORA 1WTWA 1TY0A 2Z4IA 1S5FD 2KQ3A 2XIWA 1EY0A 5C0XI 5EKLA 2IWHA 1SYDA 5K5PA 4RKLA 3TP6A 1QILA 5F2DA 1BQQT 1O78A 1LTAD 2L12A 2OT2A 1HXYD 1GOZA 3P75A 1ZYRD 3A8KE 2RSOA 4FXDA 4NMZA 2WACA 1Y1WB 4XYQA 3SHLA 3P7JA 2R93B 4X3UA 1LLRD 1QB5D 5C5MA 4MN3A 2B2TA 2D2CC 5C4XB 2B2VA 3P20A 3E5SA 2ICEC 4BA1I 1GUWA 1PZID 2NVXB 1BCPF 5CBAE 3KBXA 5EKKA 5EJWA 5E4XA 4C3IG 3MAQA 2PW7A 4PMCA 1EY8A 4A3MB 1CHPD 1MSGA 1NR2A 1D1IA 2B2YA 1YNJC 3Q24A 2R3ZA 2K5QA 3IFTA 3VR3A 4IUQA 3HOUB 1NAPA 3H09A 5EPLA 1FGBD 4X3KA 1HTLD 1Q1EA 1AZPA 5ELCA 3U9OA 2TMPA 4A3IB 2BOSA 4DNRB 3J81E 1H9JA 2EJGC 1ICWA 3SEBA 1IYUA 5KYLA 4DK1A 3KK7A 2CQAA 1ILPA 1HRJA 5IIFA 1SBBB 2WKDA 4OL7A 5K36H 1LV9A 1AW7A 2VB2X 2MGSA 1B53A 4B9XA 3BVGA 1YNND 1CA5A 1KNEA 3VR5A 1OXXK 1ET6A 1AFPA 3L9AX 3HRZC 1HUMA 2OF1A 4DAYA 3MEHA 1F9SA 4CKEA 1WTQA 1GXDC 4K8JA 5IODA 1B4OA 3O13A 2FJ2A 1PTOD 3BDCA 1SYFA 4IUTA 1M8AA 2I46A 3E6ZX 2KA7A 2DNCA 3AMUA 4K6DA 2CVRA 2KVMA 3PO2B 2EVBA 3DHQA 4DN4M 4IFDJ 4KY5A 1A3VA 2K5DA 1CTMA 2F0JA 2M9VA 2MJ8A 1GUSA 4LK1C 1JWSD 3LNNA 4ZQ3A 3OWFA 1AEXA 1EQTA 2RDHA 1LTID 1PFMA 3AU7A 5NUCA 1I4QA 3TMEA 5I2XA 1WVLA 3NK9A 2V4DA 3D8GA 1CFMA 5C6AA 2NBFA 3CRKC 2K5WA 3K6OA 2AQ1B 3VYTA 1K8OA 1RHPA 2WV6D 2EE1A 4HMIA 2KJXA 3VA7A 1AZQA 4G57A 5C5LA 3MXNA 1W6KA 2J7ZA 4ZKCB 3EQLC 4TKOB 3PV0A 4ID6A 1B2TA 2RKSA 1YNJD 1BOSA 3X3MA 2VXWA 5A2QL 4PMWA 5C3EB 3K0YA 3T51B 1C4QA 2M2LA 2B8GA 1SYCA 4G7ZC 5C4ZA 4FYDA 4L6TB 2PYKA 5K36G 1TWAB 4HN7A 1DYQA 5KEEA 4KI0A 2VUMB 4FXKC 4IUUA 1U4PA 3K5MA 4Q0FA 4X3TA 1ZYRC 3HP3A 2Q8RE 3OSOA 1ET9A 2F0MA 1D5MC 2IX0A 1EQVA 5AFWA 3S1MB 1CZGA 2IT1A 3GV3A 4C3IB 1I6HB 1L0YB 1VF5C 3IKJA 3I73A 2AWNA 4OIJA 3J7AV 4G7HC 3RD4A 4FF3A 3I4NB 2JSOA 2FINB 4M1UB 4NW2A 3E0JA 3PUVA 4HAEA 3BS1A 1LTRD 5FKAC 2QEJC 3BDOA 1W6JA 3SK4A 5CBEE 2NVQB 2K33A 4FNFA 4OGQC 1A3UA 3GTLB 4K2KA 3NTIA 3EROA 1JR0D 3GV6A 4KKUA 3ITPA 2B8FA 2YYZA 3URYA 2WKCA 5I9OA 4L8JA 2A69C 1SYBA 5CR3A 4M8AA 5EQ0A 2VB3X 4AYBB 1UAPA 3ND9A 4CJ2C 1WTOA 1H9MA 3NPPA 3QJYA 3S16B 3GP7A 1PLFA 2L5TA 3M4OB 1EWHA 3A55A 1IKMA 3NBIA 3J80E 1E2VA 3K5LA 3IAYA 1R4QB 1GUGA 5IGCA 3CHBD 4O1NA 2RDFA 4PMBA 3ND8A 5IT9E 1RDPD 5M9OA 3N52A 4KD4A 2FMCA 3KLSX 1HFGA 1TR5A 2AUJD 2EYHA 4P2CB 1G2TA 2RQXA 1UEAB 3MC0B 2Z8LA 1RTOA 3T16A 3M3YB 3A7AB 3RZDB 2BA1A 2PCFB 4QB4A 3I3CA 4PV1C 3A7LA 4WORA 5CV9A 1B3AA 4KHZA 3S15B 4OIKA 4NDXA 2EYMA 2KECA 4MIUA 1KTKA 2IX1A 4KKTA 1UNSA 1EYCA 1Y8PB 1HPCA 1TQOA 1CHQD 1SNMA 5EPJA 3NQIA 3JAML 1IW7D 4CJ0B 3NSWA 4I65A 4RHSA 1DD2A 1BCPD 4X3SA 4C1NI 2MP1A 1QOHA 5DAUA 1Q8IA 2LMCB 1G291 3HOYB 4FVMA 4K8IA 1PMRA 3T53B 2WP8J 1IL8A 4ZUIA 4QMGA 4JK1C 3W3AA 2IPKD 1JWUD 3EVQA 1JWMD 4N9TA 1PTOC 1TU2B 1B9NA 2G9DA 2JEAI 1TT2A 3DEOA 5JPMC 2FMMA 2FFKB 1Q3LA 1G91A 3QOJA 4RH6A 3QB3A 1DOLA 1XTCD 2IW3A 2TSSA 4ZK9B 3AB9A 1MD2D 2RA4A 2R61A 2SNMA 2QF7A 2A68D 4ZRZA 5EBCA 4J1MA 2F0LA 3VYSA 2CHBD 2BA0A 5I2YA 2X69A 4K5WA 1IYVA 4ULLA 1L0XB 4QIWB 4FF2A 3BZDB 1YNNC 4KY6A 2WB1B 2JA7B 5I4DA 1RTNA 2B2TC 1Z7TA 4ILWA 4FO2A 1BCPB 4TSSA 3FRPB 5LHY1 1QE6A 3I4LA 4KJOA 2Z4HA 1S4ZA 2K32A 3KF8A 4XDXA 1F2YA 4QCLA 4RGOS 1MSHA 3QIAA 3D6WA 2JXMB 1PFBA 4F8MA 4ZUJA 1CQVA 1F2MA 5DM73 5C4JB 3M7NA 2SOBA 1PTOH 3UI2A 4K6LA 4H0LC 1SMYC 1TVXA 3OMCA 1F9RA 4RGMA 4NKLA 3FKIB 1ENCA 3ONAB 1Q12A 2N55A 3GTQB 4DXFA 3VA5A 5COYA 1C48A 2F1MA 1DOKA 2K6AA 3TZUA 3SK5A 2EXZA 3IFDA 4BBRB 1U4MA 1PRTB 2KUMA 3BG3A 1T5XD 3I90A 1LTSD 3PMFA 1Z47A 1MI2A 1STBA 2L55A 1HQMC 1VMPA 1QG7A 2QDBA 3PO3B 1PYWD 2BDOA 1R4PB 1EZ8A 4A3DB 4IUVA 4BWGB 2NWGA 5M3MB 3BVZA 4XT3B 2XNAC 3PUZA 4RGNA 5JEAH 4S3SA 1PTOF 1RF2D 2PMZB 3I91A 1WCMB 2F0SA 1A2UA 1JC7A 2NN6H 4F88A 1SDFA 3MFGA 4ABNA 2PZUA 2NZ1D 2LKVA 1KDCA 4OO1I 1PXUA 3Q23A 4A3BB 3NHHA 1ZKOA 1EY6A 1LTGD 1SJED 2F0HA 1PDQA 5D3IB 4R8NA 5EGTA 3BVMA 2JEBI 4YIJA 4RAUC 3J7YW 4V190 3ZYYX 4EQNA 4HMJA 3BYYB 3H6MA 2PPBC 4HTHA 4XT1B 2JA6B 2EZVA 1JOQA 3OIPA 3EA6A 4EGVA 3HGBA 3TP8A 3MXGA 3DM1A 5I6WA 3NWSA 3C3LA 4FP5D 5IGFA 2F0IA 1XX8A 4CKCA 1OXVA 3TBIB 1QWYA 2H1EA 3T56B 1J9OA 2QILA 4UAIA 4OO1H 3GO5A 3J7AF 5KNBA 1QCBD 4IQZA 5HURA 3K5OA 2ZT9C 2LFNA 1A6XA 3S1NB 1OXUA 1PZJD 2F3WA 4CJ1B 4XQNA 1TIID 1EIHA 1S5CD 2KCCA 2C5CA 3S9WA 2F0EA 1D5ZC 1SSOA 2HDLA 2A5HA 5CYUA 1KNAA 1IKLA 1AN8A 5KNDA 2HUGA 2G9HD 5G3LD 3DWPA 5CV4A 1TS2A 2F0UA 3TP5A 2DN8A 2B63B 2EY1A 3C1FA 1OO9B 5KRUA 5BN5A 1WD0A 4K5XA 4K14A 5JOBA 4XIGS 2AWOA 1VF7A 2OEOA 2K28A 2EYOA 5C0XJ 4GZYC 4KJNA 5ELEA 2F0DA 5IGBA 1A2TA 4A3FB 2B39A 1ENFA 4BBSB 1STEA 2PQEA 1FYCA 1GUNA 2A73B 2K03A 2HCCA 1IW7C 1WTRA 4XXEA 3U9SA 2FHTA 2O4XA 1V8QA 3FPPA 1SXTA 2F0WA 1LACA 4TQUS 2WAQB 2E2DC 3OMGA 4U673 4FF4A 3EJIA 1KDAA 1E2WA 2D5DA 1TWHB 1RKNA 1BXTA 5I6YA 3K7AB 3D31A 4RHRA 1SNOA 1JQYD 3L3OC 1H9RA 3S2DB 2PNRC 2BDNA 1SNQA 1KLUD 2JA5B 5CGKA 4G7OC 3BDLA 1S5ED 2ZXPA 5M3FB 3D4RA 3A8IE 1PZKD 3SE0A 1JB3A 2MUYA 1XWEA 1LO5D 3DWAA 1FD7D 5M5YB 1STNA 3P1HA 3R93A 5JEAG 4IN3A 3SK6A 2RDGA 1SAPA 1F2ZA 1SE3A 3A54A 1SYEA 3C1EA 4H7BA 5E1FA 1Q1BA 1E2ZA 2XRSD 1I4GA 2X6GA 3W2DA 4V0BA 1BUVT 4IUPA 4EQOA 1ML0D 3S14B 1EL0A 4U68A 3OWEB 2KEDA 4NP5A 2RSNA 2XVSA 1PRTF 2EJMA 2O5JC 2R92B 2ID0A 2F0KA 1JCKB 2E76C 1Y69U 1I6VC 2SEBD 3NTHA 3GTMB 1CK1A 3QO2A 1BNZA 3S17B 4A3EB 5T1GA 2I07B 3MFYA 4WRDA 5KYIA 2EPBA 4DNTB 1Y8NB 2F03A 3T4AC 3GTOB 1CZWA 1NSNS 2D9UA 2OXPA 3I8ZA 1HHVA 1F9QA 1PTOB 1ILQA 4OO1G 2KOLA 2O5IC 3Q22A 1X3PA 2EYJA 2MPMA 2GA4B 1SYGA 1SE4A 1A3TA 2PW5A 1EYDA 2F3VA 4JBWA 1CQFA 2PZTA 3KLRA 2NB0A 4J8QA 5C3WA 3G6JB 2Q8TA 2IX3A 1JOKA 3Q0AA 4DFAA 1OXSC 3VR4A 4WJWA 1FR3A 2E2HB 4O42A 3G7LA 2RBMA 2BE5C 1O7YA 4KY7A 2ZXOA 4RCOA 2WINB 1H9SB 1NR4A 5JEAJ 1SFOB 1LABA 1I50B 1ENAA 3GD7A 3GQBA 5IGGA 3M4YA 2IJ0A 4QF4A 1EU4A 3D4WA 2E2JB 5A35A 5LL6X 4E6IA 2JP1A 3A8JE 2XSCA 3RLFA 5EBDA 2O2LD 1H9SA 5KGUA 3DXJC 4C3HB 2F0OA 3CRLC 2NYZD 5E4WC 3R2IA 2VNUD 1WTXA 3D3RA 4I7ZC 5C3XA 1EZ6A 1TS4A 4CGYB 3SDZA 5TSSA 2JE6I 4WFN3 4R9WA 1G6ZA 3GTKB 3MXPA 1TS5A 1SNDA 5D3DA 2K7VA 5KNCA 1ESRA 3VR6A 1K8MA 5FLXL 2KEEA 5FO8B 3SXHA 1V1OA 2A68C 4XQQA 4BY7B 3HEJA 2PO4A 1Y8OB 1U4LA 4RA8A 3HOZB 2CW0D 4HCSA 4IFDI 4EVOA 4RCNA 4F87A 5CV7A 3CKIB 1TY2A 4IUNA 3PUWA 3GTJB 2A69D 2B2UA 3K57A 4CBVA 3PUXA 1EEFD 1TWGB 1EY9A 3F2UA 1F77A 2H4OA 3TSSA 3FPUB 3VYUA 3OW7A 4L63B 4QUFA 4F7XA 2EYFA 1D6EC 3I70A 3FEWX 3WOEA 4DXGA 2K04A 2XWJB 2HCIA 4ZLTF 5IGEA 2B2WC 2Q8IB 4IFDG 2EJFC 2EOTA 2EDGA 5EKIA 1EFID 4TRDA 1QNKA 3RMHA 4HSVA 3R3OA 3L7ZC 5ELFA 3RUZA 4KD3A 4A3GB 5DNFA 1ZXTA 4IZ8A 1S5BD 1LTTD 3MTSA 4LJZC 1LT3D 5C0XH 3MHBA 1T5EA 3PIP3 1TS3A 2AQ3B 2ENBA 5C44B 4IURA 1D1KA 1KDBA 2EY2A 3HOVB 3SR1A 4DF7A 5CMDA 3M85A 3TDQA 2X6LA 1HUNA 4LMQD 1EY7A 3WDNA 2A6EC 2F4IA 2CW0C 4RFBA 4C2MB 2ICIA 4DGZA 3FMCA 1TWCB 1BO0A 1EY4A 4B08A 1D5XC 1WTPA 4J6HA 3KLSA 3EFXD 5JVH3 3MZ5A 3BYTB 1EEID 1U4RA 4BS9A 2B2VC 5G3LF 2L4NA 5JJZA 2YU9B 1BR9A 5EPKA 4KK7A 4XQJA 1HQRD 1GHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9J A;  3A8J E;  2EJG C;  3RLF A;  3T56 B;  1Q90 A;  1LAC A;  4OO1 H;  1DXM A;  4TQU S;  1H9S A;  2E74 C;  1GJX A;  2E76 C;  1Y69 U;  3DXJ C;  1DCZ A;  5KNB A;  1IYU A;  1I6V C;  3CRL C;  1Z7T A;  3VA7 A;  4KKU A;  4IQZ A;  4DK1 A;  4KKT A;  2Q8I B;  1Y8P B;  2B8F A;  2YYZ A;  4XTC S;  4IFD G;  2EJF C;  1E2W A;  2ZT9 C;  2D5D A;  3I4L A;  1K8O A;  1A6X A;  2EDG A;  1HPC A;  4L8J A;  1OXU A;  4I7Z C;  2R6G A;  2A6E D;  3PUZ A;  3D31 A;  3OPO A;  2A69 C;  5JEA H;  1O78 A;  4KN4 C;  1IW7 D;  3MFY A;  5K36 H;  1H9R A;  3L7Z C;  2K32 A;  4H44 C;  3EQL C;  4TKO B;  3PV0 A;  2DNE A;  3SDZ A;  1VDZ A;  2KCC A;  4DNT B;  2D62 A;  2JE6 I;  3LWU A;  1DD2 A;  2PNR C;  3ND9 A;  3VR5 A;  3A8K E;  1Y8N B;  2LMC B;  4LJZ C;  3QIA A;  2NN6 H;  1OXX K;  3OOC A;  1H9M A;  3NE5 B;  4G7O C;  5C0X H;  1BDO A;  1G29 1;  1V43 A;  2JXM B;  1PMR A;  1T5E A;  2AUK A;  3QJY A;  3T51 B;  3T53 B;  4OO1 G;  2B8G A;  5KND A;  4G7Z C;  2K7V A;  3D4R A;  3A8I E;  3M7N A;  4BA2 I;  5KNC A;  3SE0 A;  2O5I C;  4JK1 C;  2L5T A;  1VCI A;  4H0L C;  5K36 G;  4KKS A;  1EWH A;  3W3A A;  3VR6 A;  1K8M A;  1SMY C;  2DN8 A;  2D2C C;  4H13 C;  3P20 A;  4KI0 A;  4JBW A;  2A68 C;  4KN7 C;  4BA1 I;  3H94 A;  1E2V A;  1CI3 M;  2NN6 I;  1Q12 A;  3KLR A;  1O7L A;  2A6H C;  3M85 A;  5BN5 A;  1Y8O B;  5JEA G;  1TU2 B;  1ZKO A;  1B9N A;  1ZYR C;  2F1M A;  2DNC A;  2KA7 A;  5C0X G;  1GUG A;  3VR2 A;  2JEA I;  4XIG S;  2NN6 G;  2EVB A;  3TZU A;  1OXT A;  1GHJ A;  2AWO A;  1VF7 A;  3WDN A;  3ND8 A;  2A6E C;  3MXU A;  2CW0 C;  1OXS C;  2JEB I;  4RCN A;  3VR4 A;  4DK0 A;  2IT1 A;  1Z6H A;  4GZY C;  3FMC A;  1CTM A;  1FR3 A;  2BE5 D;  3PUW A;  3AB9 A;  5BN4 A;  1GUS A;  1VF5 C;  1GUO A;  1TKW B;  2A69 D;  3IKJ A;  3I73 A;  1Q1B A;  2PPB C;  1YNJ C;  1E2Z A;  3N6R A;  4LK1 C;  2AUJ D;  3QG1 A;  2BE5 C;  1B9M A;  3LNN A;  1ONL A;  1HCZ A;  2QF7 A;  3IFT A;  3PUX A;  3VR3 A;  4HR7 B;  4G7H C;  4IFD H;  3BG3 A;  2A68 D;  2A6H D;  1GUT A;  1H9S B;  3HGB A;  3A7A B;  4KMU C;  1FYC A;  1GUN A;  1LAB A;  2BA1 A;  2PCF B;  2BA0 A;  1Q1E A;  3GD7 A;  3PUV A;  1QJO A;  3GQB A;  1IW7 C;  4PV1 C;  5BN3 A;  1H9K A;  3A7L A;  2E75 C;  2V4D A;  1HTP A;  1HQM C;  3M4Y A;  3OW7 A;  1CFM A;  3PUY A;  3U9S A;  1IYV A;  4KHZ A;  3I72 A;  3BDO A;  3CRK C;  2EJM A;  1V8Q A;  1YNN C;  2K33 A;  1OXV A;  5A35 A;  4DNR B;  4OGQ C;  2O5J C;  1GHK A;  2BDO A;  3FPP A; 
#chains in the Genus database with same CATH topology
 3DUZ A;  3H0G B;  1I3Q B;  4CHT B;  1M4V A;  4EQP A;  3AQQ A;  3HG9 A;  5CV8 A;  4N9P A;  3PO3 G;  3D4D A;  3MVV A;  1IL2 A;  2K1B A;  3M4Q A;  2MNA A;  1EFW A;  3KF6 B;  3H3V C;  4JI7 L;  1H95 A;  2B2Y C;  2NTS A;  1JE4 A;  2LY7 A;  1RCV D;  1SJH D;  2UXB Q;  5D14 A;  2UUA Q;  2IL8 A;  2EY5 A;  4HED A;  2NVT H;  3R8B A;  3OIQ A;  3PCO B;  1S5D D;  1KAW A;  2YU9 H;  2D62 A;  2QW7 A;  1FNW A;  2ALY B;  4GOP B;  1WTV A;  1DON A;  4UPA A;  1XMO Q;  3TS0 A;  3DEP A;  1ROD A;  2E2I B;  1UUP A;  2M00 A;  4RWS C;  4ZKB B;  2QKI C;  2F0P A;  3DMU A;  4IPG A;  1A63 A;  2UUC L;  2JYO A;  4G4K A;  1EOT A;  2XRQ D;  2F0Q A;  5JVG 3;  4KKS A;  4Y7N B;  4DV6 Q;  2F4V L;  2WAQ E;  4A3J B;  1IBM L;  4H13 C;  1V9P A;  4DA2 A;  2K52 A;  4KN7 C;  4DV1 Q;  3JAM E;  5C4X H;  1CKO A;  1G8Z D;  4GNX A;  2ATW A;  2NN6 I;  1UE7 A;  2MHV A;  3V96 A;  4X62 L;  2K5H A;  1HA5 A;  3NTK A;  5JPN C;  2UXC L;  3OHX C;  1NTG A;  1GHJ A;  3KLW A;  1GVP A;  1II3 A;  3S1N H;  1PYS B;  3FDT A;  3K81 C;  4LFC L;  4BXX G;  3CD6 A;  4DK0 A;  1JOO A;  2R7Z B;  5IYC G;  4GKK Q;  4GOP A;  4J15 A;  1EQR A;  5BN4 A;  1BCP C;  3IL8 A;  3NBH A;  4L5R C;  2DY8 A;  3N6R A;  1VQG A;  1XMQ Q;  2E5L Q;  1B50 A;  1SEB D;  4Q5V A;  1STY A;  1S72 A;  4OXP A;  3H3V I;  1GKH A;  3NXW A;  4KV6 A;  2AQ2 B;  2N88 A;  1HTP A;  4ZAI A;  5IYB H;  4C3J G;  3I72 A;  4Z9C B;  4A3D H;  2R93 G;  3ER0 A;  1WTH A;  3CU7 A;  3KUP A;  5I9P A;  2JN4 A;  4DR2 Q;  3A56 A;  2Y0S B;  4JBJ A;  1B44 D;  3RZO B;  2J4X A;  2VUM H;  2OQ0 A;  4DR2 L;  2NVX H;  2JA8 G;  1DCZ A;  2NVY B;  5FOB B;  4JBK A;  3E3X A;  3QOL A;  2DJF C;  4C1N K;  4LF7 Q;  3GTP H;  2R6G A;  4DU9 A;  1VQ4 A;  4QUC A;  2I0Q A;  3NWT A;  2D0O A;  4A93 G;  2KCN A;  3NP8 A;  4RGT A;  1STA A;  1CKM A;  3J81 L;  4BY1 B;  5IGD A;  3SGI A;  1PFS A;  3OOC A;  1BDO A;  1V43 A;  5J39 A;  2NVT B;  4DKA C;  1HZA A;  2HQL A;  4QIW E;  3CQZ B;  3NEL A;  2Z9H A;  1E7Z A;  1VCI A;  2ZTE A;  3PGZ A;  3C2P A;  5C4H A;  4NXM Q;  1VQJ A;  3V05 A;  3HS0 C;  1JJG A;  1Q81 C;  3CMA A;  4A3D G;  3NQT A;  1PH1 A;  2E2I H;  3RR5 A;  1P16 A;  1SNP A;  4GLV B;  3R2T A;  1E1T A;  2A6H C;  4DV1 L;  2XWB B;  4C56 C;  5J22 A;  5LMU Q;  1VQH A;  1DM0 B;  3VR2 A;  1EIG A;  4DV6 L;  1CT1 D;  1PH6 A;  1OXT A;  1PFN A;  4DR7 Q;  1TWH H;  1SRO A;  4GN3 B;  2RVL A;  3I4M B;  4AIM A;  2UUC Q;  1DOM A;  1PRT D;  2DY7 A;  2JA8 B;  4IAL A;  1VS0 A;  3TRZ A;  1DJR D;  5LMU L;  1XMO L;  3T13 A;  4FF1 A;  4BXX H;  1HZ9 A;  3QG1 A;  1ONL A;  3LX0 A;  2Z1C A;  3X3N A;  1HNW Q;  1J8I A;  4BY7 H;  3TP7 A;  1F2L A;  2A6H D;  1GUT A;  1EU3 A;  1SE2 A;  4K2L A;  4KMU C;  3PO2 G;  4MTN A;  4NXM L;  3FVQ A;  1Q8K A;  2I5H A;  1JOR A;  4DAP A;  1YHA A;  4KHV A;  1V1P A;  4JI7 Q;  2XN9 C;  3QWN A;  2L9H A;  1NCV A;  1SNC A;  1U5K A;  3Q6S A;  5J1Z A;  2CKZ B;  3H91 A;  2NTT A;  1KAA A;  4DAV A;  1BBW A;  3M7G A;  4JC0 A;  3MA2 B;  4PZ6 A;  1U9R A;  1YIT A;  1ZEQ X;  1M90 C;  4JOI A;  2HQE A;  1LT5 D;  4RKB A;  1F9P A;  4XTC S;  3F2B A;  4IPD A;  2SDF A;  1CM9 A;  5FLX E;  4KHP Q;  2A74 C;  1FNV A;  5FO7 B;  1QUQ A;  1D2B A;  1NUC A;  1XYI A;  5IOC A;  5DM6 3;  3J81 i;  5ISR A;  5GAH C;  3KJP A;  4A3K B;  1VDZ A;  3LWE A;  3KDF B;  3LWU A;  1HNZ Q;  5CV5 A;  1SE8 A;  2WII B;  3KBG A;  2HHH Q;  2BH8 A;  3NE5 B;  3NEN A;  1STG A;  1B1Z A;  1XXG A;  3STB C;  1LT4 D;  4UDU C;  5CV6 A;  3K59 A;  3CCJ A;  5FLM G;  2UU9 Q;  3S17 H;  5IP7 H;  3S1R B;  2C9O A;  4ME5 A;  3T1H Q;  3SK8 A;  3HOX B;  3HKZ B;  4R8I A;  1PH5 A;  4ODG A;  1BBX C;  2AKW B;  1I4X A;  1EWC A;  2QCP X;  1E0B A;  1TWF B;  1CI3 M;  1XMQ L;  2E5L L;  4LUZ A;  1SMY D;  3TZD A;  3QR8 A;  3CCR A;  4JW0 A;  1I4P A;  1IBK Q;  5IYB G;  5E3F A;  5KIX A;  3MWY W;  3UE0 A;  2NN6 G;  2BCO A;  1YJW A;  3DWQ A;  1PRT C;  1LT6 D;  5JAV A;  4DV0 Q;  5A2Q E;  3GTQ H;  1TWF H;  3HKS A;  4MHE A;  1A15 A;  4LFB Q;  4LFC Q;  4HSP A;  4LW1 A;  4P72 A;  3TN2 A;  4CKB A;  1LTB D;  1Z6H A;  4YWL A;  2J0T D;  1KRT A;  4X62 Q;  1C8C A;  2SNS A;  4JI6 L;  2BE5 D;  2RCF A;  1V1P B;  4B3S Q;  5IY0 A;  5C44 H;  1KAB A;  2MFI A;  1G2S A;  2E2J H;  3S1R H;  1B9M A;  4X66 L;  2F0G A;  4OEM B;  1HCZ A;  3ERQ A;  1X32 A;  4HCE A;  1IBM Q;  4KTA A;  2JA5 G;  4A93 B;  2F4V Q;  1ESF A;  4L5S A;  1IXR A;  5FO9 B;  2F0F A;  1QJO A;  4DPG A;  5BN3 A;  3HOU G;  3CCV A;  1W2B A;  2L0C A;  1KLG D;  1R9T B;  4OHJ A;  5M5W H;  4CDE C;  1EY5 A;  1KQS A;  3TS2 A;  2E74 C;  1AE3 A;  1K83 B;  1Q90 A;  4MNO A;  1DXM A;  1BF4 A;  2K5N A;  1GJX A;  4GN5 A;  2EYP A;  3S2H B;  5M5W B;  2K05 A;  4LUV A;  2B63 H;  2WAQ G;  3E0E A;  3K8A A;  3GTG B;  3NUC A;  3JAM c;  1AP0 A;  2UUA L;  1QNU A;  4C3J B;  5IE8 A;  2L1B A;  2UXB L;  4DV3 L;  3S1M H;  1VMC A;  2KCM A;  1IHZ A;  3GTP B;  1Y1V G;  2A6E D;  3OPO A;  2NVQ H;  4KN4 C;  2L15 A;  1Y1V B;  1O80 A;  1HA6 A;  4H44 C;  1RD9 D;  4OX9 Q;  2DNE A;  1STH A;  3S24 A;  3K5N A;  4A76 A;  5D65 A;  5AJ3 L;  4UHV A;  1MBY A;  5IT9 L;  2B2U C;  4O2D A;  3FP9 A;  2HDM A;  1I4H A;  2AUK A;  2F0N A;  2JQO A;  3WOF A;  3PIO 3;  1CSQ A;  1RJT A;  1UE5 A;  4BA2 I;  2WB1 G;  4XYO A;  1PVO A;  3S16 H;  3KFU A;  1A8V A;  5M5X B;  1NJI C;  1X3Q A;  3K58 A;  5FK9 C;  1TWC H;  5LL6 S;  4PNY A;  3VYR A;  3SVM A;  2F0T A;  4IPH A;  1I4R A;  3H94 A;  2KHS A;  5DEH A;  1CA6 A;  1O7L A;  4HIM A;  4JV5 L;  5HGT A;  1VQB A;  4X65 Q;  2PZW A;  5C0X G;  4PQX A;  3HOW B;  1MGS A;  1O7Z A;  3V2T A;  4C3H G;  3MXU A;  3HZX A;  4DV2 L;  1NBW A;  1JIC A;  2B2W A;  4FXG C;  5T1I A;  4LAA A;  1GUO A;  1TKW B;  2EY6 A;  1V1Q A;  4UP8 A;  1HFN A;  5M5X H;  2L11 A;  3I55 A;  4K5V A;  4IFD H;  4B9W A;  2EYL A;  4HR7 B;  4JI1 L;  3AEV A;  4DUZ L;  3J80 L;  3D6C A;  5M3F G;  3C46 A;  5ELB A;  1M1K C;  1WCM G;  4DAY B;  2ZXR A;  2NUC A;  4DR4 Q;  1EYA A;  4N8X 1;  2LS0 1;  4RG1 A;  4JYA Q;  4LFA L;  1H9K A;  1DZ1 A;  1L2F A;  2E75 C;  5CC4 A;  3S1Q B;  1E24 A;  3PUY A;  5ELD A;  1FNU A;  4EQ5 A;  1UE6 A;  4ZYS A;  2F0V A;  3CC7 A;  1WD1 A;  1D7Q A;  2K01 A;  5COR A;  1WTW A;  1Q86 C;  1TY0 A;  2Z4I A;  1S5F D;  2KQ3 A;  2XIW A;  1EY0 A;  5C0X I;  5EKL A;  4JI3 L;  1K9M C;  4IOA A;  2QA4 A;  2IWH A;  4LF8 Q;  4ME3 A;  1SYD A;  5K5P A;  4RKL A;  3TP6 A;  1N34 L;  1QIL A;  3UDX A;  3A5U A;  2CH4 W;  1BQQ T;  5F2D A;  1O78 A;  1K0S A;  1LTA D;  4LF9 L;  2L12 A;  2OT2 A;  1HXY D;  1GOZ A;  3P75 A;  1VQI A;  3S1Q H;  1ZYR D;  2Q2T A;  3A8K E;  2RSO A;  4FXD A;  4CDC C;  4NMZ A;  2WAC A;  1Y1W B;  4XYQ A;  3SHL A;  3CME A;  4DR1 L;  3P7J A;  3AFQ A;  2R93 B;  3HOY H;  4X3U A;  4BBS G;  1LLR D;  2NZO A;  1QB5 D;  5C5M A;  3G6E A;  2R7Z G;  4MN3 A;  2B2T A;  1YEZ A;  2H5X A;  2D2C C;  5C4X B;  2B2V A;  3P20 A;  1RIP A;  3E5S A;  2ICE C;  4BA1 I;  2UXD Q;  1GUW A;  3JAM i;  4GS3 A;  1PZI D;  2NVX B;  3FKI G;  1BCP F;  5CBA E;  2HIV A;  3KBX A;  5EKK A;  5EJW A;  1VQK A;  5E4X A;  4C3I G;  3RLO A;  3MAQ A;  3OTO L;  2PW7 A;  4PMC A;  1EY8 A;  3J80 c;  4A3M B;  2IY5 B;  2A19 A;  1CHP D;  4L5Q A;  3KDF A;  1MSG A;  1X3F A;  5LMN Q;  1NR2 A;  1D1I A;  3U4V A;  2B2Y A;  1YNJ C;  3CCL A;  3Q24 A;  2R3Z A;  2K5Q A;  3EN2 A;  4DK3 C;  3IFT A;  3VR3 A;  4IUQ A;  5M3F H;  3HOU B;  1N33 Q;  1NAP A;  3H09 A;  4HIO A;  3L2P A;  4MTK A;  1JT8 A;  5EPL A;  1FGB D;  4X3K A;  2EXD A;  1HTL D;  1Q1E A;  2YTX A;  1AZP A;  3AYH B;  5ELC A;  3U9O A;  2TMP A;  3HOU H;  4A3I B;  1IZ6 A;  2BOS A;  4DNR B;  3RZO H;  3J81 E;  1H9J A;  4FDB A;  4A3K G;  2EJG C;  3I2Z A;  1QVF A;  1VQ7 A;  1CKN B;  1EWI A;  2QEX A;  1EIF A;  1ICW A;  3SEB A;  1IYU A;  5KYL A;  4C3I H;  3E9I A;  3PIO A;  4LF9 Q;  4DK1 A;  3KK7 A;  2CQA A;  4C2M H;  3U4Z A;  3CQZ H;  1ILP A;  1HRJ A;  5IIF A;  3HOW G;  2Z0S A;  1SBB B;  2WKD A;  4BBR G;  4LF8 L;  4OL7 A;  5K36 H;  1LV9 A;  1X54 A;  3HKZ G;  1AW7 A;  2VB2 X;  2MGS A;  1B53 A;  4B9X A;  1OTC A;  2JA6 G;  2R7D A;  3BVG A;  1YNN D;  1CA5 A;  1KNE A;  3VR5 A;  1IBL L;  2E2H H;  1OXX K;  1ET6 A;  4A3M G;  1AFP A;  2MQH A;  3L9A X;  5IYD H;  3GTL H;  3HRZ C;  2XTI A;  2QDL A;  3LGJ A;  1HUM A;  2OF1 A;  4DAY A;  3MEH A;  4JG2 A;  4B3T Q;  4A3E G;  4LF4 Q;  5IP7 G;  1F9S A;  3PF5 A;  4CKE A;  1WTQ A;  1GXD C;  4K8J A;  5IOD A;  1B4O A;  3O13 A;  2FJ2 A;  1PTO D;  4YCV A;  3BDC A;  1SYF A;  4IUT A;  1M8A A;  2I46 A;  1SN8 A;  1T9H A;  2DUD A;  3E6Z X;  1HNX L;  2KA7 A;  2DNC A;  3AMU A;  4K6D A;  2CVR A;  2KVM A;  3PO2 B;  2EVB A;  1K3R A;  3DHQ A;  4R4Q A;  4DN4 M;  4DV2 Q;  4IFD J;  4KY5 A;  1A3V A;  4CDF C;  1HZC A;  4HIK A;  2K5D A;  1CTM A;  2F0J A;  5E7N A;  2M9V A;  2MJ8 A;  1GUS A;  2RF4 A;  1WOC A;  4LK1 C;  1JWS D;  3LNN A;  4ZQ3 A;  2LXJ A;  3OWF A;  1AEX A;  1EYG A;  1EQT A;  2RDH A;  3F2C A;  1PFM A;  1LTI D;  3AU7 A;  5NUC A;  1I4Q A;  3TME A;  5I2X A;  1WVL A;  5C44 G;  3NK9 A;  3I4O A;  1Q7Y C;  4A3F G;  1B70 B;  2HD3 A;  2V4D A;  1HH2 P;  3D8G A;  1CFM A;  5C6A A;  4NPS A;  2NBF A;  3S14 H;  1NMF A;  3CRK C;  2K5W A;  3K6O A;  2AQ1 B;  3K80 C;  3VYT A;  1K8O A;  1RHP A;  2E8G A;  2WV6 D;  4QL5 A;  2EE1 A;  4A3C H;  4DK6 C;  3ICE A;  4HMI A;  2G5D A;  1PYB A;  2KJX A;  3VA7 A;  2KHJ A;  1AZQ A;  4G57 A;  5C5L A;  5EAY A;  3MXN A;  1W6K A;  3CC4 A;  3G48 A;  2J7Z A;  4ZKC B;  2PI2 E;  3EQL C;  2Y0S E;  4TKO B;  3PV0 A;  4ID6 A;  2Y0S G;  1B2T A;  2RKS A;  1XPU A;  1YNJ D;  1BOS A;  4A3M H;  3X3M A;  2VXW A;  5A2Q L;  4PMW A;  5C3E B;  3ULJ A;  3K0Y A;  3T51 B;  1C4Q A;  2M2L A;  2B8G A;  1G51 A;  1SYC A;  5C4Z A;  4G7Z C;  1PH3 A;  1PV4 A;  4L6T B;  4FYD A;  4X6A H;  2PYK A;  3GTO H;  1R9T H;  5K36 G;  1TWA B;  1BKB A;  4HN7 A;  4HJ9 A;  1KL9 A;  4JPB W;  1DYQ A;  3U50 C;  5KEE A;  1J5E L;  4KI0 A;  3OW2 A;  2VUM B;  4FXK C;  5GAG C;  4IUU A;  1U4P A;  1PH4 A;  3K5M A;  4Q0F A;  4X3T A;  1HR0 W;  1ZYR C;  3HP3 A;  2Q8R E;  3UE1 A;  3OSO A;  5H1S E;  1WI5 A;  4JI6 Q;  3J7Z C;  1ET9 A;  2F0M A;  1D5M C;  2IX0 A;  1EQV A;  5AFW A;  3S1M B;  2WB1 E;  2DGY A;  1GO3 E;  1CZG A;  3PO3 H;  2IT1 A;  1JB7 A;  3RZD H;  3GV3 A;  3OYY A;  2NVY H;  1I5F A;  4C3I B;  1I6H B;  1L0Y B;  1A62 A;  1VF5 C;  1YIJ A;  3IKJ A;  3I73 A;  3PO2 H;  3S2D H;  3RLN A;  2AWN A;  4OIJ A;  1W3S A;  3J7A V;  3S15 H;  4BY7 G;  1YHB A;  4G7H C;  3RD4 A;  4FF3 A;  3I4N B;  2JSO A;  1N32 Q;  2FIN B;  4M1U B;  4NW2 A;  3E0J A;  2Z6K C;  3PUV A;  4HAE A;  2UU9 L;  3BS1 A;  1LTR D;  5FKA C;  3CC2 A;  2QEJ C;  4L5T A;  3BDO A;  1W6J A;  3SK4 A;  5CBE E;  2NVQ B;  5ELO A;  4A3J G;  2K33 A;  3PF4 A;  3HOZ H;  4FNF A;  4YWM A;  2PMZ E;  1A3U A;  4OGQ C;  1HR0 L;  3GTL B;  4K2K A;  4LWC A;  3NTI A;  3ERO A;  1HNZ L;  2NZH A;  1JR0 D;  3D0F A;  2XGT A;  2B29 A;  3GV6 A;  2YTY A;  3GTG H;  1I6H H;  1XJV A;  2VQE Q;  4KKU A;  1AE2 A;  2Z6B A;  3ITP A;  4POG A;  1PH8 A;  2B8F A;  2YYZ A;  3URY A;  2WKC A;  5I9O A;  1X9N A;  1I3Q H;  2YV5 A;  4L8J A;  1PHJ A;  2A69 C;  1YVC A;  1SYB A;  5CR3 A;  3GTK H;  4M8A A;  5EQ0 A;  2VB3 X;  4AYB B;  4PZ7 A;  4DR5 Q;  3CCS A;  1UAP A;  3ND9 A;  4CJ2 C;  5LMN L;  1H9M A;  1WTO A;  1GD7 A;  2JA7 H;  3NPP A;  3QJY A;  2VUM G;  3S16 B;  1KIX A;  3GP7 A;  1PLF A;  2L5T A;  3M4O B;  1VQL A;  1EWH A;  4DV7 L;  1LYL A;  1Q46 A;  3A55 A;  1IKM A;  3NBI A;  5FLX c;  1HNW L;  3J80 E;  1FL0 A;  1E2V A;  1Z9F A;  3K5L A;  3IAY A;  3HOW H;  3TQY A;  3MEF A;  1KRS A;  1R4Q B;  4LF6 Q;  1GUG A;  4QGU A;  5M3M G;  5IGC A;  3CHB D;  4O1N A;  3ERS X;  4N8F A;  4PZ8 A;  2RDF A;  4PMB A;  3ND8 A;  5IT9 E;  1RDP D;  5M9O A;  4DR7 L;  3N52 A;  4PG3 A;  4KD4 A;  1G6P A;  2FMC A;  4DR6 L;  3M3Y H;  2N8N A;  3Q8D A;  3HOX H;  2ZM6 L;  4A3K H;  1C9O A;  1HFG A;  1TR5 A;  3KLS X;  4P73 A;  2AUJ D;  2EYH A;  4P2C B;  1G2T A;  2K75 A;  1UEA B;  2RQX A;  1VQD A;  3MC0 B;  2Z8L A;  1RTO A;  5L37 A;  1CKN A;  3T16 A;  3M3Y B;  1B3Q A;  3A7A B;  3RZD B;  3T1Y L;  2BA1 A;  2PCF B;  1BVS A;  4QB4 A;  3I3C A;  4APV A;  1KC8 C;  4PV1 C;  5C4X G;  3A7L A;  4WOR A;  2RCN A;  3BZC A;  5CV9 A;  1B3A A;  4KHZ A;  3S15 B;  4OIK A;  4JI3 Q;  4NDX A;  1N36 L;  2EYM A;  1QVG A;  2KEC A;  1MJE A;  4MIU A;  2I5M X;  3I56 A;  1KTK A;  2IX1 A;  4JI8 L;  3RNU A;  2CFM A;  1IYJ B;  2EQS A;  4KKT A;  1UNS A;  4LF7 L;  1EYC A;  1Y8P B;  1HPC A;  1TQO A;  3KOJ A;  1CHQ D;  1SNM A;  5EPJ A;  3NQI A;  3JAM L;  1IW7 D;  4CJ0 B;  4A3I H;  3NSW A;  1NNX A;  1WYD A;  4DUZ Q;  4JI1 Q;  4I65 A;  4RHS A;  2WFW A;  1DD2 A;  1BCP D;  4X3S A;  4C1N I;  2MP1 A;  1QOH A;  2R7Z H;  5DAU A;  1Q8I A;  2LMC B;  1VQO A;  1EIY B;  1G29 1;  4H02 A;  3HOY B;  4FVM A;  4IO9 A;  4K8I A;  4AYB E;  3K7U C;  1PMR A;  3T53 B;  2WP8 J;  1IL8 A;  4ZUI A;  1QUQ B;  4QMG A;  2RHS B;  4JK1 C;  3J81 c;  3W3A A;  2IPK D;  2JJQ A;  1JWU D;  3EVQ A;  1JWM D;  4BBS H;  4N9T A;  1PTO C;  1TU2 B;  1B9N A;  2G9D A;  3RN5 A;  2JEA I;  3A0J A;  1TT2 A;  3DEO A;  1MHW C;  5JPM C;  2FMM A;  2FFK B;  1Q3L A;  1G91 A;  3QOJ A;  1YJN A;  4RH6 A;  3QB3 A;  1S40 A;  1DOL A;  1XTC D;  4DR3 L;  1I94 Q;  2IW3 A;  2TSS A;  4ZK9 B;  3AB9 A;  1K0R A;  5AJ3 Q;  3W5O A;  1MD2 D;  4A3L H;  3AFP A;  2RA4 A;  2R61 A;  2SNM A;  2QF7 A;  2A68 D;  4ZRZ A;  1HJP A;  5EBC A;  4J1M A;  2F0L A;  3VYS A;  2CHB D;  2BA0 A;  5I2Y A;  2DJG C;  4DV3 Q;  4ZCK A;  1WJJ A;  2X69 A;  4K5W A;  4DV4 L;  1IYV A;  2R7F A;  3H0G G;  5IP9 H;  4ULL A;  1L1O C;  1L0X B;  4QIW B;  4FF2 A;  3BZD B;  1YNN C;  4KY6 A;  2WB1 B;  2JA7 B;  5I4D A;  1ASY A;  1RTN A;  2B2T C;  1C0A A;  1Z7T A;  4ILW A;  1WCM H;  1KD1 C;  4FO2 A;  1BCP B;  4TSS A;  3FRP B;  5LHY 1;  2CCZ A;  1QE6 A;  4DV4 Q;  4JI2 Q;  3I4L A;  2ZJQ A;  4KJO A;  4A3E H;  3EBE A;  2Z4H A;  1S4Z A;  2K32 A;  3KF8 A;  2VY3 A;  2OQK A;  5IYD G;  4MZ9 A;  4XDX A;  1F2Y A;  3I7F A;  5IWA Q;  4QCL A;  4C3H H;  4RGO S;  1MSH A;  3QIA A;  4OWT B;  4B3S L;  3D6W A;  5IT9 c;  5FJ8 G;  1PH2 A;  2JXM B;  4LUO A;  1PFB A;  1B8A A;  1SR3 A;  4F8M A;  4ZUJ A;  1CQV A;  1F2M A;  5DM7 3;  5C4J B;  3M7N A;  2SOB A;  4LF5 Q;  1PTO H;  2JA9 A;  3UI2 A;  4K6L A;  4BBR H;  4H0L C;  2MO1 A;  4EX5 A;  1E22 A;  4GN4 B;  1SMY C;  1IBK L;  1TVX A;  3OMC A;  1F9R A;  4RGM A;  4NKL A;  4OWW B;  3FKI B;  1ENC A;  1WFQ A;  3ONA B;  1Q12 A;  4JVZ A;  2N55 A;  3GTQ B;  4DXF A;  3VA5 A;  1CSP A;  3F1Z A;  1C48 A;  1YNX A;  1DOK A;  2F1M A;  5COY A;  3MXN B;  2K6A A;  3M4P A;  3TZU A;  1XPO A;  1VQ5 A;  3SK5 A;  1LUZ A;  3CPF A;  4A3L G;  2B63 G;  4IJL A;  3BU2 A;  2EXZ A;  3IFD A;  2CWP A;  4BBR B;  1U4M A;  1PRT B;  2KUM A;  3BG3 A;  1T5X D;  3I90 A;  1LTS D;  3PMF A;  1Z47 A;  1MI2 A;  1STB A;  2L55 A;  1SFO H;  4KHP L;  4LF5 L;  4R1J A;  1HQM C;  3PQI A;  1VMP A;  1QG7 A;  4IJH A;  2QDB A;  3PO3 B;  4RMF A;  1PYW D;  2BDO A;  1R4P B;  5ELN A;  1RL2 A;  5IWA L;  3WWV A;  1X3G A;  3A5Z B;  2Q2H A;  2VS1 A;  3F8T A;  1JMC A;  1EZ8 A;  4A3D B;  4IUV A;  4BWG B;  3I4M H;  1KHI A;  5BR8 Q;  2P5Z X;  2NWG A;  4IOC A;  1NE3 A;  4AH6 A;  5M3M B;  3HOX G;  1YJ9 A;  3BVZ A;  3U58 A;  1P8L A;  1K83 H;  1KXL A;  4XT3 B;  4JI2 L;  4A4I A;  1O7I A;  2XNA C;  3PUZ A;  3T1Y Q;  4RGN A;  5JEA H;  4WJ3 M;  4A3I G;  2PNH A;  4S3S A;  1PTO F;  2VL6 A;  1RF2 D;  2PMZ B;  3HOY G;  3I91 A;  5M3M H;  3J80 i;  1WCM B;  3CAM A;  2F0S A;  1A2U A;  1JC7 A;  2KBN A;  2ZM6 Q;  2NN6 H;  1YHQ A;  3RN2 A;  1Y1V H;  2KCT A;  4DR6 Q;  1FVI A;  3NEM A;  4F88 A;  1SDF A;  3MFG A;  4YCU A;  2PZU A;  4ABN A;  2HT1 A;  2NZ1 D;  2LKV A;  2K5V A;  1KDC A;  3IRB A;  4LF6 L;  4OO1 I;  3CXC A;  1PXU A;  2VW9 A;  3KJO A;  3Q23 A;  4A3B B;  3NHH A;  1ZKO A;  2OCE A;  1EY6 A;  1LTG D;  1SJE D;  2F0H A;  1PDQ A;  5D3I B;  4DR3 Q;  1I94 L;  2RHQ B;  1LM0 A;  4R8N A;  4OWX B;  5EGT A;  3BVM A;  2JEB I;  4YIJ A;  4RAU C;  3J7Y W;  2JA5 H;  4V19 0;  3ZYY X;  4OEL B;  4EQN A;  4HMJ A;  2K50 A;  3BYY B;  3H6M A;  2PPB C;  4HTH A;  2OWO A;  4XT1 B;  2JA6 B;  3CCE A;  3H0G H;  2EZV A;  4DR5 L;  4A3B G;  1JOQ A;  3OIP A;  1VQP A;  3EA6 A;  4EGV A;  3CPW A;  4JCV E;  3HGB A;  3TP8 A;  3MXG A;  2BH2 A;  4A3J H;  5J3B A;  3DM1 A;  5I6W A;  3NWS A;  3M4O H;  3C3L A;  4HJA A;  2YTV A;  4FP5 D;  5IGF A;  2F0I A;  1XX8 A;  3BZK A;  4CKC A;  1OXV A;  3ULL A;  3TBI B;  4AQY L;  2OTJ A;  4GKJ Q;  1QWY A;  2H1E A;  3E9H A;  1HZB A;  1E3P A;  5LMN W;  3T56 B;  1J9O A;  2QIL A;  4UAI A;  4OO1 H;  3GO5 A;  3J7A F;  1HR0 Q;  5KNB A;  1QCB D;  4GNX B;  4IQZ A;  2PQA A;  1L0W A;  4OON A;  5HUR A;  3K5O A;  1QZH A;  2ZT9 C;  2LFN A;  1A6X A;  3S1N B;  1OXU A;  1PZJ D;  2F3W A;  4JI8 Q;  4CJ1 B;  4XQN A;  1TII D;  4JI5 Q;  1C7Y A;  1EIH A;  1S5C D;  1UEB A;  1X65 A;  2KCC A;  2PI2 A;  2C5C A;  3S9W A;  2F0E A;  4A3G H;  1D5Z C;  1N36 Q;  1SSO A;  2HDL A;  2A5H A;  5CYU A;  1KNA A;  4GKK L;  1VQN A;  1IKL A;  1AN8 A;  1MKH A;  5KND A;  2HUG A;  2G9H D;  4P71 A;  5G3L D;  3DWP A;  5CV4 A;  1JJC B;  1TS2 A;  2UXC Q;  2F0U A;  3HOZ G;  3TP5 A;  2DN8 A;  1UWV A;  4DUY L;  2Z6K A;  1FJG Q;  2B63 B;  2EY1 A;  3CCM A;  3C1F A;  1OO9 B;  5KRU A;  4ALP A;  2V1C C;  5BN5 A;  2A8V A;  4NB3 A;  1J5E Q;  1WD0 A;  2FXQ A;  4K5X A;  4K14 A;  1YZ6 A;  5JOB A;  1GM5 A;  4XIG S;  2QGQ A;  3HKZ E;  1K28 A;  1XTD A;  2AWO A;  1VF7 A;  2OEO A;  3H3V H;  2K28 A;  2EYO A;  2ZTC A;  5C0X J;  1XNR L;  4GZY C;  4KJN A;  4JI4 Q;  5GAD C;  2AMC B;  1AH9 A;  4P75 A;  3DM3 A;  2ZJP A;  5ELE A;  2K4K A;  2F0D A;  3I4N G;  3EIV A;  5IGB A;  2IHF A;  1A2T A;  2B39 A;  1ENF A;  1VQF A;  4A3F B;  4BBS B;  4UP9 A;  1STE A;  2PQE A;  1FYC A;  1GUN A;  4DV7 Q;  2A73 B;  1I50 H;  2K03 A;  2HCC A;  1IW7 C;  1WTR A;  1TWA H;  1MJC A;  4XXE A;  4GNX C;  3U9S A;  2F3I A;  4A3F H;  2FHT A;  1XNQ Q;  2O4X A;  1V8Q A;  2R93 H;  1X55 A;  3FPP A;  1SXT A;  3VDY A;  2F0W A;  1LAC A;  4TQU S;  2WAQ B;  1QVC A;  2MO0 A;  2E2D C;  3OMG A;  4U67 3;  3DLL A;  4FF4 A;  5JJL A;  3EJI A;  1KDA A;  1E2W A;  2D5D A;  1FGU A;  4Y52 H;  1TWH B;  1RKN A;  1BXT A;  4DNI A;  5I6Y A;  3K7A B;  4TVA B;  3D31 A;  4RHR A;  2VQE L;  1SNO A;  1JQY D;  3L3O C;  1H9R A;  3S2D B;  2ZTD A;  2N49 A;  2PNR C;  1K8G A;  2BDN A;  4NXN L;  4X64 Q;  1SNQ A;  1KLU D;  2JA5 B;  4UY8 C;  4BY1 G;  5CGK A;  2JA7 G;  4G7O C;  3BDL A;  1S5E D;  2ZXP A;  5M3F B;  3D4R A;  3A8I E;  2JA6 H;  4YHH Q;  1PZK D;  3SE0 A;  1JB3 A;  1U0L A;  1K73 C;  2MUY A;  1XWE A;  2JA8 H;  1N32 L;  1LO5 D;  3DWA A;  1FD7 D;  1HNX Q;  5M5Y B;  4R4C A;  1STN A;  3P1H A;  3R93 A;  5JEA G;  4IN3 A;  3SK6 A;  2RDG A;  1SAP A;  1E1O A;  1MIU A;  4POF A;  1F2Z A;  1SE3 A;  2F52 A;  1X56 A;  4B3T L;  3A54 A;  2N78 A;  3CCU A;  1J6Q A;  5GRO A;  1SYE A;  3C1E A;  1PH9 A;  1VQ6 A;  4H7B A;  2GN5 A;  5E1F A;  2KEN A;  1JJ2 A;  1Q1B A;  1E2Z A;  2XRS D;  2CH4 A;  1I4G A;  2X6G A;  1VQ9 A;  3W2D A;  4V0B A;  1BUV T;  5IYC H;  4IUP A;  4EQO A;  3JC6 6;  1ML0 D;  4B3M Q;  3S14 B;  1EL0 A;  4YCW A;  1VQE A;  4YHH L;  4U68 A;  4JI0 Q;  4A3C G;  3OWE B;  3J81 j;  2KED A;  1YI2 A;  4NP5 A;  2RSN A;  2XVS A;  1PRT F;  2EJM A;  2O5J C;  2R92 B;  5GQO A;  4X64 L;  2ID0 A;  4NXN Q;  4WJ4 A;  2F0K A;  1JCK B;  2E76 C;  1Y69 U;  4IPC A;  1I6V C;  3HOV G;  2SEB D;  3NTH A;  3GTM B;  1CK1 A;  3G4S A;  1SMX A;  3QO2 A;  1BNZ A;  4A3G G;  3S17 B;  3A74 A;  4A3E B;  5JJK A;  4Y7N H;  3K0X A;  3KYH C;  5T1G A;  2ES2 A;  3G71 A;  2I07 B;  1B7Y B;  3MFY A;  4WRD A;  5KYI A;  2EPB A;  5HY6 A;  3CCQ A;  4DNT B;  3FKI H;  2JK8 A;  2I5L X;  1Y8N B;  2F03 A;  3T4A C;  2K14 A;  3GTO B;  1CZW A;  3CP0 A;  1XNQ L;  1NSN S;  2HIX A;  2D9U A;  2OXP A;  4A93 H;  3I8Z A;  1HHV A;  1F9Q A;  1PTO B;  1ILQ A;  2VQF Q;  2KOL A;  4OO1 G;  2LXK A;  3OTO Q;  2O5I C;  3Q22 A;  1X3P A;  2EYJ A;  2MPM A;  1N8R C;  2GA4 B;  1SYG A;  1SE4 A;  3ULP A;  5C3E G;  1A3T A;  2PW5 A;  1EYD A;  2F3V A;  4JOI C;  4JBW A;  1YBY A;  2UXD L;  1CQF A;  2PZT A;  3KLR A;  1L1O A;  2NB0 A;  4J8Q A;  1PH7 A;  5C3W A;  3G6J B;  1X3E A;  2GVB A;  2AHO B;  4JI4 L;  4K0K Q;  5DLQ E;  2Q8T A;  1QZG A;  2IX3 A;  1XNR Q;  1JOK A;  3Q0A A;  1VQ8 A;  4DV5 L;  4DFA A;  1OXS C;  1VQA A;  3VR4 A;  4C3J H;  4WJW A;  4DR1 Q;  1FR3 A;  2E2H B;  4O42 A;  3G7L A;  2RBM A;  3UDI A;  4YWK A;  4YY3 Q;  2BE5 C;  1O7Y A;  1K8A C;  4KY7 A;  4QJF A;  3GDE A;  2ZXO A;  4A3B H;  3K7A H;  4RCO A;  4DUY Q;  2WIN B;  4R4O A;  3TEH B;  1FJG L;  1H9S B;  1NR4 A;  5JEA J;  1SFO B;  1LAB A;  1I50 B;  1N9W A;  4DAM A;  4LF4 L;  1ENA A;  3GD7 A;  3GQB A;  4B3R L;  5IGG A;  3M4Y A;  1XPR A;  2UUB L;  3I4N H;  4HJ8 A;  2IJ0 A;  4QF4 A;  1EU4 A;  4HID A;  2LSS A;  3D4W A;  2E2J B;  5A35 A;  5LL6 X;  4E6I A;  1PA6 A;  2JP1 A;  3A8J E;  2XSC A;  3L0O A;  5EBD A;  3RLF A;  1A0I A;  2IHE A;  1IBL Q;  2B3G A;  2N3S A;  3H15 A;  2O2L D;  1H9S A;  4R4I A;  5KGU A;  3DXJ C;  4C3H B;  2F0O A;  3CRL C;  2NYZ D;  5E4W C;  4JI5 L;  2EIF A;  3R2I A;  2Q2I A;  2UUB Q;  2VNU D;  2PQA B;  1JE5 A;  1WTX A;  4I7A A;  3D3R A;  4GLA C;  5C4J H;  4B3R Q;  1BBU A;  4I7Z C;  5C3X A;  1EZ6 A;  1TS4 A;  5HGQ A;  4CGY B;  3SDZ A;  5TSS A;  2JE6 I;  4WFN 3;  4YY3 L;  3CW2 C;  4GKJ L;  4R9W A;  1D8L A;  4AQY Q;  1G6Z A;  3GTK B;  3MXP A;  1LTL A;  1TS5 A;  3W1B A;  1ASZ A;  1SND A;  5D3D A;  2K7V A;  5KNC A;  4DV5 Q;  4JBM A;  3B6Y A;  3ZJY C;  1ESR A;  3VR6 A;  1Q82 C;  1K8M A;  4K0K L;  5FLX L;  2KEE A;  5FO8 B;  4LNQ A;  1VQC A;  3SXH A;  4X65 L;  1N33 L;  1V1O A;  3W1G A;  5M5Y H;  2GVA A;  2A68 C;  2R92 G;  4XQQ A;  4BY7 B;  3I4M G;  3HEJ A;  2PO4 A;  1Y8O B;  1U4L A;  4RA8 A;  5JJI A;  1L1O B;  2ASB A;  3HOZ B;  2CW0 D;  4KLK A;  4HCS A;  4CDD C;  4IFD I;  4O0A A;  3UDG A;  4EVO A;  4RCN A;  2VQF L;  4F87 A;  5CV7 A;  1ICF B;  3CKI B;  1TY2 A;  4IUN A;  3PUW A;  3GTJ B;  2A69 D;  1EQQ A;  2OTL A;  3UDF A;  2B2U A;  3K57 A;  4CBV A;  4OX9 L;  3PUX A;  1EEF D;  1EY9 A;  1TWG B;  2KHI A;  3F2U A;  1F77 A;  2H4O A;  1CUK A;  1Y1W H;  3TSS A;  2D0P A;  3FPU B;  3VYU A;  3OW7 A;  4L63 B;  4QUF A;  3M9B A;  4F7X A;  2EYF A;  4QY7 A;  4AYB G;  1D6E C;  1NY4 A;  3I70 A;  4UP7 A;  3FEW X;  1EUJ A;  2R92 H;  1Y14 B;  3KF8 B;  3WOE A;  4DXG A;  2K04 A;  2XWJ B;  2HCI A;  5FJ8 H;  4QQB X;  4ZLT F;  3GTM H;  5IGE A;  3KF6 A;  1SRU A;  1S3O A;  1UE1 A;  2B2W C;  2Q8I B;  2A1A A;  4GOP C;  2CWA A;  4JI0 L;  4IFD G;  1X6O A;  2EJF C;  2EOT A;  1N34 Q;  2EDG A;  5EKI A;  1EFI D;  1TWG H;  4B3M L;  4TRD A;  1QNK A;  3RMH A;  4HSV A;  3R3O A;  5BR8 L;  3L7Z C;  5GAE C;  5ELF A;  1NMG A;  3RUZ A;  5FLM H;  4KD3 A;  4A3G B;  5DNF A;  1ZXT A;  4IZ8 A;  4X66 Q;  3STB D;  3PIP A;  1S5B D;  1LTT D;  4BY1 H;  3MTS A;  4LJZ C;  2VZA A;  3PSI A;  3BJU A;  1LT3 D;  5C0X H;  3MHB A;  1EOV A;  1K3B C;  1T5E A;  3PIP 3;  1TS3 A;  2AQ3 B;  2ENB A;  4LFA Q;  4LFB L;  4DV0 L;  4JYA L;  4DR4 L;  5C3E H;  5C44 B;  4IUR A;  4GLX A;  2CQO A;  1D1K A;  1KDB A;  2EY2 A;  3HOV B;  3SR1 A;  4DF7 A;  5CMD A;  3M85 A;  4P74 A;  1VQM A;  3S2H H;  3TDQ A;  3T1H L;  2X6L A;  4A75 A;  4HJ7 A;  1HUN A;  4LMQ D;  1EY7 A;  2Q2U A;  3WDN A;  2A6E C;  2F4I A;  2CW0 C;  4RFB A;  4C2M B;  4HJ5 A;  5IP9 G;  2ICI A;  4DGZ A;  3FMC A;  1TWC B;  1BO0 A;  2HHH L;  2C35 B;  1Y1W G;  1DGS A;  1EY4 A;  3NBH B;  4B08 A;  1D5X C;  1SLJ A;  4JV5 Q;  4R4T A;  1WTP A;  4J6H A;  3KLS A;  3EFX D;  5JVH 3;  3HOV H;  3MZ5 A;  3BYT B;  1EEI D;  1U4R A;  3J7A 5;  4BS9 A;  3GTJ H;  2B2V C;  5G3L F;  2L4N A;  3FHW A;  3HFZ B;  5JJZ A;  2YU9 B;  1BR9 A;  5EPK A;  4KK7 A;  4XQJ A;  1HQR D;  3F2D A;  3CF5 A;  3TRE A;  1GHK A;  1TXY A;  2ZJR A; 
#chains in the Genus database with same CATH homology
 3DUZ A;  3H0G B;  1I3Q B;  4CHT B;  1M4V A;  4EQP A;  3HG9 A;  5CV8 A;  4N9P A;  3D4D A;  3MVV A;  2K1B A;  3H3V C;  2B2Y C;  2NTS A;  1JE4 A;  2LY7 A;  1RCV D;  1SJH D;  5D14 A;  2IL8 A;  2EY5 A;  4HED A;  3R8B A;  3OIQ A;  1S5D D;  2D62 A;  1FNW A;  1WTV A;  1DON A;  3DEP A;  1ROD A;  2E2I B;  1UUP A;  2M00 A;  4RWS C;  4ZKB B;  2QKI C;  2F0P A;  3DMU A;  2JYO A;  4G4K A;  1EOT A;  2XRQ D;  2F0Q A;  5JVG 3;  4KKS A;  4Y7N B;  4A3J B;  4H13 C;  4DA2 A;  4KN7 C;  3JAM E;  1G8Z D;  2NN6 I;  2MHV A;  3V96 A;  3NTK A;  1HA5 A;  5JPN C;  3OHX C;  1GHJ A;  1II3 A;  3FDT A;  4DK0 A;  1JOO A;  2R7Z B;  5BN4 A;  1BCP C;  3IL8 A;  3NBH A;  2DY8 A;  3N6R A;  1B50 A;  1SEB D;  4Q5V A;  1STY A;  3NXW A;  4KV6 A;  2AQ2 B;  2N88 A;  1HTP A;  4ZAI A;  4C3J G;  3I72 A;  4Z9C B;  3CU7 A;  3KUP A;  5I9P A;  3A56 A;  2Y0S B;  1B44 D;  3RZO B;  2J4X A;  1DCZ A;  2NVY B;  5FOB B;  3QOL A;  4C1N K;  2R6G A;  4DU9 A;  4QUC A;  3NWT A;  2KCN A;  3NP8 A;  4RGT A;  1STA A;  3J81 L;  4BY1 B;  5IGD A;  3OOC A;  1BDO A;  1V43 A;  5J39 A;  2NVT B;  3CQZ B;  1VCI A;  3C2P A;  5C4H A;  3V05 A;  3HS0 C;  3NQT A;  1SNP A;  3R2T A;  2A6H C;  2XWB B;  4C56 C;  5J22 A;  1DM0 B;  3VR2 A;  1EIG A;  1CT1 D;  1OXT A;  1PFN A;  2RVL A;  3I4M B;  1DOM A;  1PRT D;  2DY7 A;  2JA8 B;  4IAL A;  1DJR D;  3T13 A;  4FF1 A;  3QG1 A;  1ONL A;  3LX0 A;  2Z1C A;  3X3N A;  1J8I A;  3TP7 A;  1F2L A;  2A6H D;  1GUT A;  1EU3 A;  1SE2 A;  4K2L A;  4KMU C;  3FVQ A;  1JOR A;  4DAP A;  4KHV A;  1V1P A;  2XN9 C;  3QWN A;  2L9H A;  1NCV A;  1SNC A;  3Q6S A;  5J1Z A;  3H91 A;  2NTT A;  1KAA A;  4DAV A;  3M7G A;  3MA2 B;  1U9R A;  1ZEQ X;  2HQE A;  1LT5 D;  4RKB A;  1F9P A;  4XTC S;  2SDF A;  1CM9 A;  5FLX E;  2A74 C;  1FNV A;  5FO7 B;  1D2B A;  1NUC A;  1XYI A;  5IOC A;  5DM6 3;  5ISR A;  4A3K B;  1VDZ A;  3LWE A;  3LWU A;  5CV5 A;  2WII B;  3KBG A;  3NE5 B;  1STG A;  1B1Z A;  1XXG A;  1LT4 D;  4UDU C;  5CV6 A;  3K59 A;  3S1R B;  2C9O A;  4ME5 A;  3SK8 A;  3HOX B;  3HKZ B;  4R8I A;  4ODG A;  1BBX C;  1I4X A;  1EWC A;  2QCP X;  1E0B A;  1TWF B;  1CI3 M;  1SMY D;  3TZD A;  1I4P A;  5E3F A;  5KIX A;  3MWY W;  2NN6 G;  2BCO A;  3DWQ A;  1PRT C;  1LT6 D;  5JAV A;  5A2Q E;  4MHE A;  1A15 A;  4HSP A;  3TN2 A;  4CKB A;  1LTB D;  1Z6H A;  2J0T D;  1C8C A;  2SNS A;  2BE5 D;  1V1P B;  1KAB A;  1G2S A;  1B9M A;  2F0G A;  1HCZ A;  3ERQ A;  1X32 A;  4HCE A;  4KTA A;  4A93 B;  1ESF A;  5FO9 B;  2F0F A;  1QJO A;  5BN3 A;  2L0C A;  1KLG D;  1R9T B;  4OHJ A;  1EY5 A;  2E74 C;  1K83 B;  1Q90 A;  1DXM A;  1BF4 A;  1GJX A;  2EYP A;  3S2H B;  5M5W B;  2K05 A;  3GTG B;  3NUC A;  1AP0 A;  1QNU A;  4C3J B;  2L1B A;  1VMC A;  1IHZ A;  3GTP B;  2A6E D;  3OPO A;  4KN4 C;  1Y1V B;  1O80 A;  1HA6 A;  4H44 C;  1RD9 D;  2DNE A;  1STH A;  3K5N A;  5D65 A;  1MBY A;  5IT9 L;  2B2U C;  2HDM A;  1I4H A;  2AUK A;  2F0N A;  3WOF A;  3PIO 3;  1RJT A;  4BA2 I;  4XYO A;  5M5X B;  1X3Q A;  3K58 A;  5FK9 C;  5LL6 S;  4PNY A;  3VYR A;  3SVM A;  2F0T A;  1I4R A;  3H94 A;  2KHS A;  5DEH A;  1CA6 A;  1O7L A;  5HGT A;  2PZW A;  5C0X G;  4PQX A;  3HOW B;  1MGS A;  1O7Z A;  3V2T A;  4C3H G;  3MXU A;  3HZX A;  1JIC A;  2B2W A;  4FXG C;  5T1I A;  4LAA A;  1GUO A;  1TKW B;  2EY6 A;  1HFN A;  2L11 A;  4K5V A;  4IFD H;  4B9W A;  2EYL A;  4HR7 B;  3J80 L;  3D6C A;  3C46 A;  5ELB A;  2ZXR A;  2NUC A;  1EYA A;  2LS0 1;  1H9K A;  1DZ1 A;  2E75 C;  5CC4 A;  3S1Q B;  3PUY A;  5ELD A;  1FNU A;  4ZYS A;  2F0V A;  1WD1 A;  2K01 A;  5COR A;  1WTW A;  1TY0 A;  2Z4I A;  1S5F D;  2KQ3 A;  2XIW A;  1EY0 A;  5C0X I;  5EKL A;  2IWH A;  1SYD A;  5K5P A;  4RKL A;  3TP6 A;  1QIL A;  5F2D A;  1BQQ T;  1O78 A;  1LTA D;  2L12 A;  2OT2 A;  1HXY D;  1GOZ A;  3P75 A;  1ZYR D;  3A8K E;  2RSO A;  4FXD A;  4NMZ A;  2WAC A;  1Y1W B;  4XYQ A;  3SHL A;  3P7J A;  2R93 B;  4X3U A;  1LLR D;  1QB5 D;  5C5M A;  4MN3 A;  2B2T A;  2D2C C;  5C4X B;  2B2V A;  3P20 A;  3E5S A;  2ICE C;  4BA1 I;  1GUW A;  1PZI D;  2NVX B;  1BCP F;  5CBA E;  3KBX A;  5EKK A;  5EJW A;  5E4X A;  4C3I G;  3MAQ A;  2PW7 A;  4PMC A;  1EY8 A;  4A3M B;  1CHP D;  1MSG A;  1NR2 A;  1D1I A;  2B2Y A;  1YNJ C;  3Q24 A;  2R3Z A;  2K5Q A;  3IFT A;  3VR3 A;  4IUQ A;  3HOU B;  1NAP A;  3H09 A;  5EPL A;  1FGB D;  4X3K A;  1HTL D;  1Q1E A;  1AZP A;  5ELC A;  3U9O A;  2TMP A;  4A3I B;  2BOS A;  4DNR B;  3J81 E;  1H9J A;  2EJG C;  1ICW A;  3SEB A;  1IYU A;  5KYL A;  4DK1 A;  3KK7 A;  2CQA A;  1ILP A;  1HRJ A;  5IIF A;  1SBB B;  2WKD A;  4OL7 A;  5K36 H;  1LV9 A;  1AW7 A;  2VB2 X;  2MGS A;  1B53 A;  4B9X A;  3BVG A;  1YNN D;  1CA5 A;  1KNE A;  3VR5 A;  1OXX K;  1ET6 A;  1AFP A;  3L9A X;  3HRZ C;  1HUM A;  2OF1 A;  4DAY A;  3MEH A;  1F9S A;  4CKE A;  1WTQ A;  1GXD C;  4K8J A;  5IOD A;  1B4O A;  3O13 A;  2FJ2 A;  1PTO D;  3BDC A;  1SYF A;  4IUT A;  1M8A A;  2I46 A;  3E6Z X;  2KA7 A;  2DNC A;  3AMU A;  4K6D A;  2CVR A;  2KVM A;  3PO2 B;  2EVB A;  3DHQ A;  4DN4 M;  4IFD J;  4KY5 A;  1A3V A;  2K5D A;  1CTM A;  2F0J A;  2M9V A;  2MJ8 A;  1GUS A;  4LK1 C;  1JWS D;  3LNN A;  4ZQ3 A;  3OWF A;  1AEX A;  1EQT A;  2RDH A;  1LTI D;  1PFM A;  3AU7 A;  5NUC A;  1I4Q A;  3TME A;  5I2X A;  1WVL A;  3NK9 A;  2V4D A;  3D8G A;  1CFM A;  5C6A A;  2NBF A;  3CRK C;  2K5W A;  3K6O A;  2AQ1 B;  3VYT A;  1K8O A;  1RHP A;  2WV6 D;  2EE1 A;  4HMI A;  2KJX A;  3VA7 A;  1AZQ A;  4G57 A;  5C5L A;  3MXN A;  1W6K A;  2J7Z A;  4ZKC B;  3EQL C;  4TKO B;  3PV0 A;  4ID6 A;  1B2T A;  2RKS A;  1YNJ D;  1BOS A;  3X3M A;  2VXW A;  5A2Q L;  4PMW A;  5C3E B;  3K0Y A;  3T51 B;  1C4Q A;  2M2L A;  2B8G A;  1SYC A;  4G7Z C;  5C4Z A;  4FYD A;  4L6T B;  2PYK A;  5K36 G;  1TWA B;  4HN7 A;  1DYQ A;  5KEE A;  4KI0 A;  2VUM B;  4FXK C;  4IUU A;  1U4P A;  3K5M A;  4Q0F A;  4X3T A;  1ZYR C;  3HP3 A;  2Q8R E;  3OSO A;  1ET9 A;  2F0M A;  1D5M C;  2IX0 A;  1EQV A;  5AFW A;  3S1M B;  1CZG A;  2IT1 A;  3GV3 A;  4C3I B;  1I6H B;  1L0Y B;  1VF5 C;  3IKJ A;  3I73 A;  2AWN A;  4OIJ A;  3J7A V;  4G7H C;  3RD4 A;  4FF3 A;  3I4N B;  2JSO A;  2FIN B;  4M1U B;  4NW2 A;  3E0J A;  3PUV A;  4HAE A;  3BS1 A;  1LTR D;  5FKA C;  2QEJ C;  3BDO A;  1W6J A;  3SK4 A;  5CBE E;  2NVQ B;  2K33 A;  4FNF A;  4OGQ C;  1A3U A;  3GTL B;  4K2K A;  3NTI A;  3ERO A;  1JR0 D;  3GV6 A;  4KKU A;  3ITP A;  2B8F A;  2YYZ A;  3URY A;  2WKC A;  5I9O A;  4L8J A;  2A69 C;  1SYB A;  5CR3 A;  4M8A A;  5EQ0 A;  2VB3 X;  4AYB B;  1UAP A;  3ND9 A;  4CJ2 C;  1WTO A;  1H9M A;  3NPP A;  3QJY A;  3S16 B;  3GP7 A;  1PLF A;  2L5T A;  3M4O B;  1EWH A;  3A55 A;  1IKM A;  3NBI A;  3J80 E;  1E2V A;  3K5L A;  3IAY A;  1R4Q B;  1GUG A;  5IGC A;  3CHB D;  4O1N A;  2RDF A;  4PMB A;  3ND8 A;  5IT9 E;  1RDP D;  5M9O A;  3N52 A;  4KD4 A;  2FMC A;  3KLS X;  1HFG A;  1TR5 A;  2AUJ D;  2EYH A;  4P2C B;  1G2T A;  2RQX A;  1UEA B;  3MC0 B;  2Z8L A;  1RTO A;  3T16 A;  3M3Y B;  3A7A B;  3RZD B;  2BA1 A;  2PCF B;  4QB4 A;  3I3C A;  4PV1 C;  3A7L A;  4WOR A;  5CV9 A;  1B3A A;  4KHZ A;  3S15 B;  4OIK A;  4NDX A;  2EYM A;  2KEC A;  4MIU A;  1KTK A;  2IX1 A;  4KKT A;  1UNS A;  1EYC A;  1Y8P B;  1HPC A;  1TQO A;  1CHQ D;  1SNM A;  5EPJ A;  3NQI A;  3JAM L;  1IW7 D;  4CJ0 B;  3NSW A;  4I65 A;  4RHS A;  1DD2 A;  1BCP D;  4X3S A;  4C1N I;  2MP1 A;  1QOH A;  5DAU A;  1Q8I A;  2LMC B;  1G29 1;  3HOY B;  4FVM A;  4K8I A;  1PMR A;  3T53 B;  2WP8 J;  1IL8 A;  4ZUI A;  4QMG A;  4JK1 C;  3W3A A;  2IPK D;  1JWU D;  3EVQ A;  1JWM D;  4N9T A;  1PTO C;  1TU2 B;  1B9N A;  2G9D A;  2JEA I;  1TT2 A;  3DEO A;  5JPM C;  2FMM A;  2FFK B;  1Q3L A;  1G91 A;  3QOJ A;  4RH6 A;  3QB3 A;  1DOL A;  1XTC D;  2IW3 A;  2TSS A;  4ZK9 B;  3AB9 A;  1MD2 D;  2RA4 A;  2R61 A;  2SNM A;  2QF7 A;  2A68 D;  4ZRZ A;  5EBC A;  4J1M A;  2F0L A;  3VYS A;  2CHB D;  2BA0 A;  5I2Y A;  2X69 A;  4K5W A;  1IYV A;  4ULL A;  1L0X B;  4QIW B;  4FF2 A;  3BZD B;  1YNN C;  4KY6 A;  2WB1 B;  2JA7 B;  5I4D A;  1RTN A;  2B2T C;  1Z7T A;  4ILW A;  4FO2 A;  1BCP B;  4TSS A;  3FRP B;  5LHY 1;  1QE6 A;  3I4L A;  4KJO A;  2Z4H A;  1S4Z A;  2K32 A;  3KF8 A;  4XDX A;  1F2Y A;  4QCL A;  4RGO S;  1MSH A;  3QIA A;  3D6W A;  2JXM B;  1PFB A;  4F8M A;  4ZUJ A;  1CQV A;  1F2M A;  5DM7 3;  5C4J B;  3M7N A;  2SOB A;  1PTO H;  3UI2 A;  4K6L A;  4H0L C;  1SMY C;  1TVX A;  3OMC A;  1F9R A;  4RGM A;  4NKL A;  3FKI B;  1ENC A;  3ONA B;  1Q12 A;  2N55 A;  3GTQ B;  4DXF A;  3VA5 A;  5COY A;  1C48 A;  2F1M A;  1DOK A;  2K6A A;  3TZU A;  3SK5 A;  2EXZ A;  3IFD A;  4BBR B;  1U4M A;  1PRT B;  2KUM A;  3BG3 A;  1T5X D;  3I90 A;  1LTS D;  3PMF A;  1Z47 A;  1MI2 A;  1STB A;  2L55 A;  1HQM C;  1VMP A;  1QG7 A;  2QDB A;  3PO3 B;  1PYW D;  2BDO A;  1R4P B;  1EZ8 A;  4A3D B;  4IUV A;  4BWG B;  2NWG A;  5M3M B;  3BVZ A;  4XT3 B;  2XNA C;  3PUZ A;  4RGN A;  5JEA H;  4S3S A;  1PTO F;  1RF2 D;  2PMZ B;  3I91 A;  1WCM B;  2F0S A;  1A2U A;  1JC7 A;  2NN6 H;  4F88 A;  1SDF A;  3MFG A;  4ABN A;  2PZU A;  2NZ1 D;  2LKV A;  1KDC A;  4OO1 I;  1PXU A;  3Q23 A;  4A3B B;  3NHH A;  1ZKO A;  1EY6 A;  1LTG D;  1SJE D;  2F0H A;  1PDQ A;  5D3I B;  4R8N A;  5EGT A;  3BVM A;  2JEB I;  4YIJ A;  4RAU C;  3J7Y W;  4V19 0;  3ZYY X;  4EQN A;  4HMJ A;  3BYY B;  3H6M A;  2PPB C;  4HTH A;  4XT1 B;  2JA6 B;  2EZV A;  1JOQ A;  3OIP A;  3EA6 A;  4EGV A;  3HGB A;  3TP8 A;  3MXG A;  3DM1 A;  5I6W A;  3NWS A;  3C3L A;  4FP5 D;  5IGF A;  2F0I A;  1XX8 A;  4CKC A;  1OXV A;  3TBI B;  1QWY A;  2H1E A;  3T56 B;  1J9O A;  2QIL A;  4UAI A;  4OO1 H;  3GO5 A;  3J7A F;  5KNB A;  1QCB D;  4IQZ A;  5HUR A;  3K5O A;  2ZT9 C;  2LFN A;  1A6X A;  3S1N B;  1OXU A;  1PZJ D;  2F3W A;  4CJ1 B;  4XQN A;  1TII D;  1EIH A;  1S5C D;  2KCC A;  2C5C A;  3S9W A;  2F0E A;  1D5Z C;  1SSO A;  2HDL A;  2A5H A;  5CYU A;  1KNA A;  1IKL A;  1AN8 A;  5KND A;  2HUG A;  2G9H D;  5G3L D;  3DWP A;  5CV4 A;  1TS2 A;  2F0U A;  3TP5 A;  2DN8 A;  2B63 B;  2EY1 A;  3C1F A;  1OO9 B;  5KRU A;  5BN5 A;  1WD0 A;  4K5X A;  4K14 A;  5JOB A;  4XIG S;  2AWO A;  1VF7 A;  2OEO A;  2K28 A;  2EYO A;  5C0X J;  4GZY C;  4KJN A;  5ELE A;  2F0D A;  5IGB A;  1A2T A;  4A3F B;  2B39 A;  1ENF A;  4BBS B;  1STE A;  2PQE A;  1FYC A;  1GUN A;  2A73 B;  2K03 A;  2HCC A;  1IW7 C;  1WTR A;  4XXE A;  3U9S A;  2FHT A;  2O4X A;  1V8Q A;  3FPP A;  1SXT A;  2F0W A;  1LAC A;  4TQU S;  2WAQ B;  2E2D C;  3OMG A;  4U67 3;  4FF4 A;  3EJI A;  1KDA A;  1E2W A;  2D5D A;  1TWH B;  1RKN A;  1BXT A;  5I6Y A;  3K7A B;  3D31 A;  4RHR A;  1SNO A;  1JQY D;  3L3O C;  1H9R A;  3S2D B;  2PNR C;  2BDN A;  1SNQ A;  1KLU D;  2JA5 B;  5CGK A;  4G7O C;  3BDL A;  1S5E D;  2ZXP A;  5M3F B;  3D4R A;  3A8I E;  1PZK D;  3SE0 A;  1JB3 A;  2MUY A;  1XWE A;  1LO5 D;  3DWA A;  1FD7 D;  5M5Y B;  1STN A;  3P1H A;  3R93 A;  5JEA G;  4IN3 A;  3SK6 A;  2RDG A;  1SAP A;  1F2Z A;  1SE3 A;  3A54 A;  1SYE A;  3C1E A;  4H7B A;  5E1F A;  1Q1B A;  1E2Z A;  2XRS D;  1I4G A;  2X6G A;  3W2D A;  4V0B A;  1BUV T;  4IUP A;  4EQO A;  1ML0 D;  3S14 B;  1EL0 A;  4U68 A;  3OWE B;  2KED A;  4NP5 A;  2RSN A;  2XVS A;  1PRT F;  2EJM A;  2O5J C;  2R92 B;  2ID0 A;  2F0K A;  1JCK B;  2E76 C;  1Y69 U;  1I6V C;  2SEB D;  3NTH A;  3GTM B;  1CK1 A;  3QO2 A;  1BNZ A;  3S17 B;  4A3E B;  5T1G A;  2I07 B;  3MFY A;  4WRD A;  5KYI A;  2EPB A;  4DNT B;  1Y8N B;  2F03 A;  3T4A C;  3GTO B;  1CZW A;  1NSN S;  2D9U A;  2OXP A;  3I8Z A;  1HHV A;  1F9Q A;  1PTO B;  1ILQ A;  4OO1 G;  2KOL A;  2O5I C;  3Q22 A;  1X3P A;  2EYJ A;  2MPM A;  2GA4 B;  1SYG A;  1SE4 A;  1A3T A;  2PW5 A;  1EYD A;  2F3V A;  4JBW A;  1CQF A;  2PZT A;  3KLR A;  2NB0 A;  4J8Q A;  5C3W A;  3G6J B;  2Q8T A;  2IX3 A;  1JOK A;  3Q0A A;  4DFA A;  1OXS C;  3VR4 A;  4WJW A;  1FR3 A;  2E2H B;  4O42 A;  3G7L A;  2RBM A;  2BE5 C;  1O7Y A;  4KY7 A;  2ZXO A;  4RCO A;  2WIN B;  1H9S B;  1NR4 A;  5JEA J;  1SFO B;  1LAB A;  1I50 B;  1ENA A;  3GD7 A;  3GQB A;  5IGG A;  3M4Y A;  2IJ0 A;  4QF4 A;  1EU4 A;  3D4W A;  2E2J B;  5A35 A;  5LL6 X;  4E6I A;  2JP1 A;  3A8J E;  2XSC A;  3RLF A;  5EBD A;  2O2L D;  1H9S A;  5KGU A;  3DXJ C;  4C3H B;  2F0O A;  3CRL C;  2NYZ D;  5E4W C;  3R2I A;  2VNU D;  1WTX A;  3D3R A;  4I7Z C;  5C3X A;  1EZ6 A;  1TS4 A;  4CGY B;  3SDZ A;  5TSS A;  2JE6 I;  4WFN 3;  4R9W A;  1G6Z A;  3GTK B;  3MXP A;  1TS5 A;  1SND A;  5D3D A;  2K7V A;  5KNC A;  1ESR A;  3VR6 A;  1K8M A;  5FLX L;  2KEE A;  5FO8 B;  3SXH A;  1V1O A;  2A68 C;  4XQQ A;  4BY7 B;  3HEJ A;  2PO4 A;  1Y8O B;  1U4L A;  4RA8 A;  3HOZ B;  2CW0 D;  4HCS A;  4IFD I;  4EVO A;  4RCN A;  4F87 A;  5CV7 A;  3CKI B;  1TY2 A;  4IUN A;  3PUW A;  3GTJ B;  2A69 D;  2B2U A;  3K57 A;  4CBV A;  3PUX A;  1EEF D;  1TWG B;  1EY9 A;  3F2U A;  1F77 A;  2H4O A;  3TSS A;  3FPU B;  3VYU A;  3OW7 A;  4L63 B;  4QUF A;  4F7X A;  2EYF A;  1D6E C;  3I70 A;  3FEW X;  3WOE A;  4DXG A;  2K04 A;  2XWJ B;  2HCI A;  4ZLT F;  5IGE A;  2B2W C;  2Q8I B;  4IFD G;  2EJF C;  2EOT A;  2EDG A;  5EKI A;  1EFI D;  4TRD A;  1QNK A;  3RMH A;  4HSV A;  3R3O A;  3L7Z C;  5ELF A;  3RUZ A;  4KD3 A;  4A3G B;  5DNF A;  1ZXT A;  4IZ8 A;  1S5B D;  1LTT D;  3MTS A;  4LJZ C;  1LT3 D;  5C0X H;  3MHB A;  1T5E A;  3PIP 3;  1TS3 A;  2AQ3 B;  2ENB A;  5C44 B;  4IUR A;  1D1K A;  1KDB A;  2EY2 A;  3HOV B;  3SR1 A;  4DF7 A;  5CMD A;  3M85 A;  3TDQ A;  2X6L A;  1HUN A;  4LMQ D;  1EY7 A;  3WDN A;  2A6E C;  2F4I A;  2CW0 C;  4RFB A;  4C2M B;  2ICI A;  4DGZ A;  3FMC A;  1TWC B;  1BO0 A;  1EY4 A;  4B08 A;  1D5X C;  1WTP A;  4J6H A;  3KLS A;  3EFX D;  5JVH 3;  3MZ5 A;  3BYT B;  1EEI D;  1U4R A;  4BS9 A;  2B2V C;  5G3L F;  2L4N A;  5JJZ A;  2YU9 B;  1BR9 A;  5EPK A;  4KK7 A;  4XQJ A;  1HQR D;  1GHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...