1ZKOA

Crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
HHHHHLKMKKYTKTHEWVSIEDKVATVGITNHAQEQLGDVVYVDLPEVGREVKKGEVVASIESVKAAADVYAPLSGKIVEVNEKLDTEPELINKDPEGEGWLFKMEISDEGELEDLLDEQAYQEFCAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glycine cleavage h-protein
molecule keywords Glycine cleavage system H protein
publication title Crystal structure of Glycine cleavage system H protein (tm0212) from Thermotoga maritima at 1.65 A resolution
rcsb
source organism Thermotoga maritima
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1zkoA00
3GQBA 1ZYRC 1G291 2EJMA 4H0LC 1Y69U 3FMCA 4IFDG 4KKTA 3IKJA 1EWHA 3EQLC 3P20A 4RCNA 2A69C 4KI0A 1Q90A 2A6EC 3OW7A 3A7AB 1T5EA 4DNTB 1VCIA 2AUJD 5KNBA 2A6HC 1HPCA 1E2ZA 1OXUA 3GD7A 2AUKA 3VA7A 4GZYC 4BA2I 4TKOB 4BA1I 2E76C 2QF7A 3N6RA 4KKUA 1O7LA 1GHJA 2D62A 5BN5A 2L5TA 4H44C 1Z6HA 1OXXK 3FPPA 3U9SA 2A68D 4I7ZC 1SMYC 1Q12A 3BG3A 3LWUA 4LK1C 4DNRB 3T56B 4OO1G 3I72A 3RLFA 3VR2A 3T51B 2DNEA 1IYUA 2DNCA 2EDGA 3IFTA 3WDNA 2EVBA 1GUGA 2O5JC 1V8QA 2LMCB 2YYZA 3KLRA 1CTMA 1OXVA 3ND9A 1K8OA 3T53B 2BA0A 1HCZA 4JBWA 4L8JA 5C0XH 1Q1BA 2DN8A 1VDZA 2K7VA 2R6GA 3NE5B 4DK1A 2NN6G 1PMRA 1YNJC 5KNCA 2PCFB 3M7NA 3PUVA 1TU2B 5K36G 1GUTA 3DXJC 2BE5C 3SDZA 3SE0A 5KNDA 3PUZA 4OO1H 2JEAI 1I6VC 3M4YA 1Q1EA 2B8FA 1FYCA 4KKSA 1FR3A 1K8MA 3TZUA 2CW0C 3CRKC 1B9MA 3A8KE 2V4DA 3LNNA 4LJZC 2A68C 2K32A 3HGBA 3QG1A 2A6ED 1GUOA 4KMUC 3VR6A 4IFDH 2D2CC 2K33A 3A7LA 3VR3A 4G7OC 1YNNC 2A6HD 4HR7B 1OXSC 2NN6I 4KHZA 1QJOA 4H13C 3PUYA 5BN4A 4G7ZC 2NN6H 2KCCA 2PNRC 3CRLC 2EJFC 1GJXA 1Y8PB 5A35A 4KN7C 1IW7D 2BA1A 1H9JA 2F1MA 3H94A 4JK1C 3QJYA 4XTCS 5K36H 1HQMC 1E2WA 2JEBI 1DCZA 2B8GA 3A8IE 3I73A 2KA7A 3ND8A 1BDOA 1Z7TA 1E2VA 4DK0A 1VF7A 1GHKA 1O78A 2ZT9C 1B9NA 1CFMA 2O5IC 2JE6I 1CI3M 5BN3A 3A8JE 2E75C 3L7ZC 1A6XA 3VR5A 1IYVA 1GUNA 1H9RA 1V43A 3OOCA 5JEAG 1OXTA 2EJGC 1Y8NB 2A69D 4IQZA 2PPBC 1GUSA 3AB9A 3PV0A 2JXMB 4PV1C 4OGQC 1H9SA 2Q8IB 3D31A 3QIAA 1H9KA 1LABA 2IT1A 4KN4C 3PUXA 2E74C 1Y8OB 3W3AA 2BE5D 5C0XG 1H9MA 1DXMA 3OPOA 1H9SB 3VR4A 1DD2A 1IW7C 4G7HC 4XIGS 4TQUS 1VF5C 3MFYA 5JEAH 3BDOA 2AWOA 3PUWA 1LACA 1ONLA 2BDOA 1ZKOA 2D5DA 3M85A 1HTPA 3MXUA 1TKWB 3D4RA 3I4LA
chains in the Genus database with same CATH superfamily
4ZRZA 3H0GB 2EOTA 5EKKA 4DXFA 4DV7Q 1SR3A 3HEJA 3NK9A 5C3EB 4A3DG 4A3GG 2NZ1D 3EJIA 4JBMA 1AN8A 2HIXA 3VA7A 5T1IA 5KEEA 4J6HA 1N33Q 1HTLD 2PZUA 1I3QB 5I9PA 1UEAB 2F0SA 1SNDA 3BG3A 4CDCC 4OO1G 2IWHA 3I72A 1ML0D 3KBGA 2DNEA 1K3BC 4HIKA 2K05A 1SSOA 3GTKB 1Q3LA 1SROA 3T1HQ 2CQAA 3CPFA 1G2SA 3KLSA 2XVSA 1SRUA 2JA8G 2C9OA 1S5BD 4RHSA 1UE5A 4IPCA 4F88A 1X32A 5CBAE 1RHPA 5KNDA 3M4YA 3CC2A 2V1CC 1BNZA 3D0FA 5IE8A 1ASZA 3A8KE 1B53A 4CDDC 1QZHA 5M5WB 2K32A 4BBRH 4YHHL 2F4VL 3HOVH 3VR3A 3ZYYX 1MIUA 1PH8A 4A3BB 5CGKA 2VS1A 2PYKA 1PH4A 5JJIA 3K59A 1KL9A 1VQGA 1NBWA 4DPGA 5IYCG 1BCPD 1H9JA 4A3EH 3PIP3 1LLRD 1NMFA 1N34L 4C3JB 1AE3A 3T1YQ 2NVYB 1Z7TA 4RCOA 1BUVT 4OO1I 2EQSA 3DM1A 2ZTCA 4IUUA 5E7NA 2F03A 1Q7YC 1E24A 1XTDA 4UPAA 1I4GA 2Y0SG 4IUVA 3OW2A 1GUSA 4DAYA 2F0DA 4DR2Q 1L1OB 3PUXA 3UDIA 4FDBA 1TXYA 4R8IA 1LYLA 4K0KQ 4DR4L 1FNVA 1H9SB 3NSWA 5E4XA 1X55A 3K81C 2VUMB 4RH6A 5D65A 1VQMA 3J7AF 4K2LA 3EFXD 1GXDC 3T16A 5I4DA 4R4CA 4N9PA 4XQJA 2EXZA 2K50A 4AYBG 3M85A 4OIJA 4A3IG 2UUAQ 1D5ZC 3TS0A 2CVRA 1JORA 1BR9A 1RCVD 4JI5L 4A3LG 2XRSD 1EYCA 4QY7A 3IL8A 1TS2A 4DV3L 1YI2A 5KNBA 2A6HC 1GUWA 5ELNA 2GA4B 3M9BA 1D7QA 1AZQA 3M3YH 2VL6A 4X3TA 4L6TB 3CQZH 4X65Q 4F7XA 1B4OA 1JICA 3DHQA 1I4PA 1SE8A 4DV7L 1DOKA 2LMCB 2F0JA 3P7JA 4JOIC 4CDEC 3K5LA 4CJ0B 4JI6L 1N33L 2I5MX 5KYLA 4Y7NB 2IY5B 3L2PA 1EYDA 4Z9CB 3CXCA 2EXDA 1CT1D 3VYSA 1E1TA 1U4LA 3KBXA 3SE0A 3I56A 1C9OA 2D0PA 5ELBA 4DV2Q 3S1MB 2FMMA 4FXKC 4KKSA 1FR3A 2CHBD 4JI3Q 4ZK9B 4A3CG 3T1HL 2A6ED 3IFDA 5IP9H 1EQVA 2JQOA 3CCEA 2WAQB 3K7AH 2RQXA 3GTOB 4AQYQ 4HIDA 1HXYD 3HKZE 5IY0A 5M3MB 4GOPB 1JC7A 2I07B 3MXNB 2MGSA 1Y8PB 1LM0A 5G3LD 2F1MA 4FO2A 4FVMA 3F2CA 2N49A 1LTBD 2B2YC 2FHTA 3KUPA 2UUCL 2F0NA 5BN3A 3KJPA 2E75C 4NB3A 2QA4A 1PFSA 2JK8A 1Y1WH 3VR5A 4GNXA 5H1SE 2EYLA 3J80E 1TWFB 1SN8A 1OXTA 4EX5A 4YY3Q 2E2HB 4PV1C 3AMUA 2PQAB 1O80A 3M4PA 2LXJA 1YNJD 2F0QA 2IT1A 1G2TA 3T1YL 1EZ8A 2MO1A 3SK4A 1W3SA 1UEBA 1WYDA 1C8CA 5IT9E 4HAEA 4OL7A 3R3OA 3CCLA 1ENAA 4IOAA 1ZKOA 5CV6A 5EBCA 1KDBA 2CWPA 3I4LA 4FNFA 4DR2L 5HGTA 5G3LF 2N78A 2ZXPA 2ID0A 2PO4A 4IUTA 4K0KL 1CA6A 1Q90A 2E2DC 2UXDL 5DEHA 3CCSA 3GD7A 2B2VA 2WKCA 1EEFD 3H3VC 4OELB 4DV1Q 2Z9HA 3HOXH 3EN2A 1WI5A 1JB7A 2ZXRA 3R8BA 2UUAL 2EYHA 4A3JG 1CSQA 3WOFA 1ASYA 1SYDA 3GTQB 2F0TA 4R9WA 3UI2A 4IALA 4B3SQ 1X6OA 3E0EA 4IO9A 1VQ9A 2WINB 3CC7A 3KLRA 4QB4A 1SDFA 4UHVA 2O5JC 3R2TA 4IJHA 1HZCA 4PNYA 2E2JB 4JBWA 1VQAA 4DR3Q 3MC0B 4R4QA 5C0XH 4JG2A 3A5ZB 3ULJA 1N32L 1D5MC 1MI2A 4PZ8A 2PCFB 2K5QA 3KLWA 3TRZA 3MZ5A 4JC0A 4DAPA 5C3WA 4X65L 1LO5D 1U4MA 1I6VC 3C46A 3TZUA 2B2WA 4J8QA 4LJZC 2J0TD 3PO2H 2R7DA 2A68C 2N88A 4CDFC 1QE6A 4GLAC 2D2CC 3OWEB 3S1RB 1STNA 3I8ZA 4A3MG 3MVVA 5A35A 4KN7C 1IL8A 3E9IA 2L0CA 3QJYA 1QUQA 3W1GA 1U5KA 2JEBI 1IBKQ 3CD6A 4DV2L 1QB5D 3SR1A 5LMUQ 2OF1A 4CKEA 3GTJH 4NMZA 2VY3A 4ALPA 1I94Q 4JI4Q 3NTKA 1B9NA 3BVMA 4JI3L 1S5DD 3PO3H 3NBHB 4ZAIA 2H5XA 1ESFA 1Q8KA 3GV3A 3OOCA 3CAMA 5TSSA 1YJWA 1VQKA 2F0PA 1PDQA 4AQYL 1YJNA 2NZOA 2OXPA 3ONAB 4B9WA 3EBEA 2I0QA 1PLFA 3HOWG 1ILPA 1CKNB 4KN4C 1YIJA 2O4XA 3RLOA 2K52A 2BE5D 1B1ZA 4DAMA 3E5SA 2JJQA 3RZOB 4I65A 2JA5H 2YTXA 3TP8A 2DUDA 2XRQD 1IL2A 1LACA 1QUQB 4BY7B 1L1OC 1AE2A 4OIKA 4YY3L 5ISRA 1SXTA 2I5HA 4RG1A 3NWSA 3EA6A 3MFGA 2VXWA 1Q81C 1EIHA 2XWBB 1KAAA 4PMBA 4IFDG 1K0RA 1PH1A 2RCNA 5IT9L 4XT3B 1KLGD 3Q24A 5L37A 4GZYC 3V2TA 3PF5A 2JA7B 1F2ZA 1E0BA 3JAMc 2PI2E 1PXUA 1RJTA 2B2UC 5BN5A 2L5TA 1XYIA 5IP7H 4XQNA 1HZAA 3UE1A 3K0YA 2R93G 3TS2A 4A93G 1NY4A 4A3DH 4A3GH 2VZAA 1QG7A 2RHQB 2ZJQA 4OWWB 1K83H 3D4WA 4RA8A 4L8JA 2NB0A 4DV1L 3RR5A 1MJEA 1D1KA 1BVSA 3ICEA 1UUPA 1QVFA 3W2DA 3GTMH 5C6AA 3J7AV 4OO1H 4IPHA 4EQOA 1M90C 4C3HH 2NVQB 2RDHA 5DM73 1D8LA 5FJ8G 3GTGH 4IFDI 4Q0FA 1EY5A 3H0GG 4CKCA 3KF8B 4KMUC 4DR3L 1PFMA 5C3EG 1II3A 2NN6I 2EYPA 2Z8LA 3CRLC 2JA8H 2PNRC 1V9PA 1TWAH 2EJFC 2B63B 1RKNA 2QW7A 4ILWA 4K5VA 1SMYD 2Q2TA 1K8AC 1VF7A 1HNXQ 5GAGC 2F3VA 2KHIA 2B2TC 1PYBA 1J5EL 1O7IA 3NP8A 1W2BA 3KYHC 4FF4A 5EAYA 5I9OA 1I4HA 2ICIA 5IYCH 1N9WA 3S24A 4R4IA 2Y0SE 1IBKL 3IRBA 1VS0A 4F8MA 4JI4L 1I94L 3TSSA 4X6AH 4L5TA 3VR4A 4BBSG 2CW0D 1KIXA 1PTOH 2EYFA 3TZDA 2LFNA 2OQ0A 1DONA 2F0VA 1W6JA 4YWLA 1Q82C 5CMDA 2K5WA 3A54A 3RD4A 3RN5A 3I91A 4A3BG 1PRTC 4AYBE 3OIPA 2NZHA 3DLLA 2KCTA 4JOIA 1EQRA 5C5MA 5EKIA 1EY8A 2AUKA 4ZYSA 4JCVE 2Q2IA 2IX1A 4ZLTF 1QNKA 4PG3A 3KF6A 1LTAD 1O7YA 4A3IH 3FPPA 3H09A 4KD3A 4I7ZC 5ELFA 1WTWA 4DXGA 4A3LH 2HD3A 5LL6S 1D5XC 1FNUA 2NBFA 2Q2HA 1LT4D 4FP5D 4ZUJA 5FLXE 1I4QA 1EYGA 4IPDA 2CWAA 3A74A 2OT2A 4PQXA 3I4MB 5C4XB 1R4PB 2K7VA 5T1GA 1HFGA 1WTXA 3FHWA 4P74A 1NMGA 3RZDH 2VUMG 1PA6A 2AQ2B 4HTHA 1EZ6A 3CPWA 1IBLQ 1K8MA 5EPJA 2NVXB 2RVLA 1VQEA 2IW3A 2RDFA 5CV9A 1MSGA 3BYYB 3MEFA 3AQQA 5FLMH 4BBRB 1IW7D 4MN3A 2WFWA 2FFKB 1A2UA 3FDTA 5LMNQ 1NE3A 4EGVA 4RAUC 2CH4A 2QDBA 2VW9A 1Z9FA 1LTRD 5C4ZA 1TIID 4DR7Q 4M8AA 1XPRA 3E3XA 3L7ZC 4A3CH 1PH6A 2XNAC 1AP0A 1A6XA 4ZKCB 1HA6A 1ZYRD 1PVOA 4HJ8A 2FJ2A 1A62A 2KOLA 1QOHA 4IUNA 3Q8DA 2Q8IB 1EQTA 1UE6A 2G5DA 1K28A 1Z47A 2G9HD 5JPMC 2K14A 1PTOC 1HNXL 4OONA 4KY5A 1D6EC 4XIGS 5EPKA 4X3UA 1NR2A 4NDXA 1CHPD 2HIVA 3SEBA 4L5QA 3OYYA 4HCSA 2WAQG 2JN4A 3SK5A 3Q0AA 1PH9A 1EWHA 4JI0L 3ITPA 2MHVA 1TWGH 1TWHH 4OEMB 5DM63 4HIMA 2HHHQ 1VCIA 2AUJD 3U50C 3G6EA 4DR6Q 4TKOB 3BZCA 5GQOA 4DAVA 5J1ZA 3S1NH 4A3FB 1Z6HA 1ILQA 1OXXK 1HNWQ 2F0FA 3NENA 3M3YB 3AU7A 4LUOA 5DLQE 2YU9H 3KK7A 4B3TQ 2GVBA 2I46A 2DNCA 3HKSA 4UP9A 1BBUA 2YTVA 1X9NA 2QDLA 3JAML 1I5FA 3E6ZX 2WP8J 4POFA 5M9OA 3G6JB 1EIGA 1ET6A 2R6GA 2RF4A 1PH5A 5K5PA 1K9MC 3VA5A 2PZTA 3GP7A 2OQKA 5IGFA 4JI6Q 4GLXA 3DWPA 1GUTA 2TSSA 3DXJC 1FGBD 4A3JH 3SDZA 4K14A 3BDLA 4RGMA 5FLXL 1XWEA 2PNHA 3KLSX 4PZ7A 4DR5Q 5JPNC 3D3RA 3QG1A 1WVLA 3TMEA 1KHIA 1RIPA 3PUYA 3CMEA 2KCCA 4FF1A 1HUMA 4IPGA 1JT8A 2BA1A 4OXPA 1XPOA 1SE2A 4ME5A 3F2UA 1IBLL 3E0JA 1E2VA 2SNSA 3NPPA 1O78A 2DY8A 2L55A 2UXCQ 3DMUA 4KK7A 4QCLA 3C3LA 2UUCQ 1H9RA 1VQJA 4HN7A 1K73C 5JEAG 1L1OA 1B3AA 4CHTB 1Y1WB 1C7YA 2Z4IA 2MNAA 3HKZB 3UDGA 1H9SA 1DJRD 5IWAQ 3D31A 1XNQQ 5LMNL 1SFOH 4FXDA 1R9TH 3CCJA 2HT1A 4H7BA 4N8X1 1H9MA 3DUZA 1SYEA 4DR7L 1BCPC 1LTGD 1S40A 2HDMA 4G7HC 5NUCA 4TQUS 2B2UA 4LF4Q 3BDOA 3M7GA 3CF5A 4KJNA 1NTGA 4L5SA 1TQOA 1CK1A 3J80c 1GHKA 3HOWH 1ICFB 2R3ZA 5JEAJ 4H0LC 1E7ZA 4UP7A 4XYQA 3URYA 4AH6A 2UXDQ 1AH9A 5IGGA 3K5OA 5IT9c 1BO0A 3JAMi 1XNRQ 1P16A 3S2DH 3LWEA 1AFPA 1Q12A 1WCMB 2MUYA 4LFBQ 3RLFA 3I55A 3S17H 1EY9A 3O13A 2HHHL 1K8OA 4OX9Q 1LTTD 1XTCD 4LF6Q 1Y1VB 4DR6L 2ASBA 1EEID 2K5NA 4MTNA 4X62Q 1HNWL 5FO9B 1N32Q 2VNUD 4K6DA 4JI8Q 1TWCH 1M4VA 4B3TL 2K5VA 2EY1A 2R93H 4A93H 4GOPA 3MXNA 5JJZA 4G4KA 3BS1A 3HOZB 5C4JH 4B08A 1TY0A 1XXGA 4BS9A 1YNNC 2A6HD 5FO8B 4KHZA 1F2MA 1ZEQX 2YTYA 3OHXC 5KGUA 1MKHA 2EYMA 2VQFQ 2JA7G 1M8AA 3WOEA 5M5YH 3B6YA 3MHBA 3WWVA 3MAQA 2F0WA 2Z1CA 2F3IA 4DR5L 2L9HA 1CFMA 5FJ8H 2JE6I 4K8JA 1FJGL 3H0GH 3AEVA 2PQAA 3GTJB 1GVPA 5C3EH 4LNQA 2HCIA 3PO3B 4C2MH 2PPBC 4JW0A 2R7ZB 5KYIA 4P73A 1LABA 2WV6D 1SYBA 1K3RA 1STYA 4A3KB 1I3QH 1JE4A 3STBC 2UXCL 3FEWX 1SE4A 1WTRA 4QL5A 5IOCA 1YBYA 1UWVA 5FO7B 3TREA 3MFYA 5CR3A 2K6AA 2D9UA 2OWOA 2F0IA 2WB1B 1N36L 2CQOA 5IWAL 1TKWB 4POGA 1JWMD 3D4RA 3F8TA 1XNQL 2KUMA 1HNZQ 1KLUD 3CP0A 2B63G 4RCNA 3S1QB 3R93A 3FKIB 4Y52H 4BBSH 1E2ZA 1SJHD 1PRTB 2QEXA 4LF4L 1U4PA 3NXWA 5IYBG 4J15A 1XMQQ 3S14H 4A3BH 2AWNA 1HFNA 4KY7A 1N8RC 2L12A 1HQRD 2EDGA 3WDNA 3FPUB 1GUGA 4BWGB 1VQBA 5LMNW 2PW7A 1CZWA 1NCVA 2LXKA 4GN5A 3J7ZC 1PH7A 4A3DB 1Q46A 2JA6G 4DK1A 2L15A 1GO3E 1A8VA 4YIJA 5C44B 1XNRL 3HOUB 2E8GA 4O1NA 1EQQA 2E5LQ 4TSSA 4LFBL 2B8FA 5M3FH 2B29A 1PV4A 4I7AA 2V4DA 1RODA 3AFQA 3GTMB 1JOKA 3J81j 4OX9L 2X69A 4LF6L 4C3HB 4N8FA 2ZXOA 1B3QA 2VB2X 3K58A 4R4TA 4L5RC 4LUVA 4G7ZC 4ZQ3A 2KENA 2R92G 4X62L 1CZGA 1EY7A 3NBHA 4JI8L 2JA8B 3D6WA 1TWAB 3VYRA 3D4DA 3L3OC 2QCPX 1CI3M 4WJ3M 5KRUA 1GUNA 3CCUA 1CKNA 1J5EQ 2BCOA 4K2KA 1PZID 1FD7D 2VQFL 3I4MG 2UUBQ 5C4XG 3SVMA 2K03A 2IHFA 3D8GA 3KDFB 2IX3A 5IGCA 5ELEA 3RN2A 1HUNA 4C3IG 4K8IA 1BKBA 4QIWB 5A2QE 3OWFA 3CCVA 1PTOB 2ZJPA 1YHAA 3HRZC 4KTAA 3HFZB 3TP7A 2PQEA 2Y0SB 4WRDA 3E9HA 2WAQE 1STHA 2EY5A 2R61A 2NYZD 2AHOB 1B7YB 3S1MH 1SLJA 3A55A 3N6RA 1LT3D 4JV5Q 1VMCA 3U58A 5CC4A 1WTOA 3H91A 3J80L 4RGTA 4DU9A 4H44C 4MTKA 4XQQA 3U9SA 1X3PA 4M1UB 5IGEA 1ESRA 1TR5A 2JYOA 2KVMA 4AYBB 1HNZL 1BF4A 2N55A 2PMZB 1B44D 3H15A 1JR0D 3I4NB 3I4OA 1F77A 1CTMA 2WACA 2XSCA 4QUFA 2AMCB 4JI2Q 3HZXA 3I70A 1SNMA 3OTOQ 1WJJA 1YITA 2K4KA 2HCCA 2M00A 1SJED 2A19A 2NN6G 2NVTB 1XMQL 4WJ4A 2Z6BA 3MWYW 1V1QA 4C1NK 5AJ3Q 3KF8A 1HH2P 2JEAI 1GM5A 1X3GA 2RHSB 1S3OA 2QGQA 2PZWA 2EY6A 1FGUA 1I6HB 5FLXc 2J7ZA 1YEZA 1IXRA 5GADC 4ZCKA 3GTPH 2X6GA 4IFDJ 2E5LL 4A3FG 1SNPA 1KNAA 1H95A 1CQVA 4DUZQ 1SNQA 1D1IA 1O7ZA 1VQLA 1KDCA 5GROA 1A15A 4ID6A 2F3WA 4OGQC 1X54A 5I2YA 2EPBA 2FXQA 4FF2A 2K1BA 3PCOB 1F2YA 1EY4A 3HOYB 4FXGC 2F0GA 1DOLA 5JJKA 2NUCA 4BY1B 3GTQH 5JEAH 1HHVA 1VQNA 1MSHA 4KHPQ 4TVAB 1HR0Q 1SNCA 1NJIC 4X66Q 2G9DA 3G7LA 2UUBL 1BCPB 1U4RA 2VQEQ 1MHWC 3GQBA 4A76A 4HJAA 1EOVA 3J80i 5IP9G 1WTQA 1SMXA 4GKJL 3A7AB 1BBXC 2F0KA 3K8AA 2RA4A 4RHRA 4DV4Q 1VQ7A 3NBIA 1RDPD 4JI0Q 2L4NA 4PZ6A 3S16H 1TWGB 5J3BA 1TWHB 5IYDG 1M1KC 4CJ2C 3U4ZA 3H3VI 3ULPA 3P75A 1XX8A 3KFUA 4FYDA 1K0SA 3PF4A 1RF2D 3LWUA 1XMOQ 3S1NB 1CQFA 1KRSA 1PHJA 4RGOS 2EYOA 1OXVA 4DUYL 2YU9B 1HCZA 5CV8A 1IBMQ 3LX0A 1BBWA 2J4XA 5E4WC 4JV5L 3M4QA 2YV5A 1KQSA 4C3JG 1XJVA 3TEHB 4NXNQ 2F0OA 2HQLA 3KJOA 4LF5Q 4C1NI 1PRTD 1YZ6A 3RUZA 5AFWA 3OSOA 5M5XH 3SK8A 3BDCA 3HGBA 3VR6A 4JI2L 2IL8A 2CCZA 2K33A 4QJFA 3TDQA 3OTOL 1QJOA 3SXHA 3RZOH 2MPMA 1BXTA 2Q8TA 4R1JA 5AJ3L 4BXXG 1EFID 1E2WA 3QOLA 5ELCA 3NQIA 1JJGA 2B2YA 3S2HH 4GNXC 3A8JE 2KEDA 1WCMG 1V1PB 1SEBD 3X3MA 4JI1Q 3VDYA 1K8GA 3VYUA 2A69D 1KC8C 3PV0A 1Y1VG 1A3VA 2JA7H 3CHBD 3NHHA 1VQFA 3HOVB 3S9WA 1MD2D 5C0XG 4KJOA 4J1MA 4IZ8A 1FVIA 1IW7C 1PRTF 4X3SA 1R9TB 3K5MA 4DUZL 1QVCA 3W5OA 3GTLH 1Y14B 4DA2A 4A3EB 3I90A 5EGTA 1B70B 4KY6A 2BDOA 3HOZG 2KECA 3MXUA 3PIOA 1FL0A 3MXPA 2O2LD 4GS3A 1A3UA 1IHZA 1ZYRC 1G291 2EJMA 2Q2UA 4GKKQ 4KI0A 4CGYB 2B2VC 2RBMA 2XWJB 3HOWB 4HJ5A 5CV7A 1YVCA 1S5ED 5EBDA 4K5XA 2E76C 2QF7A 2K01A 4PMCA 1A3TA 1IYJB 2NVQH 2OEOA 2F0MA 4NW2A 4U673 4KHPL 1HR0L 4JBJA 4X66L 4DR1Q 4IUPA 1IKLA 2KBNA 4DKAC 1QCBD 2VQEL 1BOSA 1V1OA 1I50H 4DV5Q 1WOCA 1QZGA 2IPKD 2DJGC 2B63H 1S4ZA 3S2DB 2R7ZG 1HZ9A 1NNXA 1R4QB 3IFTA 1IKMA 2VB3X 2KCNA 1HJPA 5M3MG 4DV4L 5ELOA 1T5XD 1T9HA 2FINB 3V05A 1CUKA 2QILA 1ZXTA 2F0LA 5C0XI 4A3KG 3S17B 3TN2A 1DM0B 4H02A 1B2TA 3W1BA 5IYBH 3S15H 1EOTA 1JJCB 2B2WC 1EY6A 1IZ6A 1XMOL 5JVG3 4UY8C 1Q1EA 1FYCA 2WB1G 4GLVB 3G48A 2XTIA 4KV6A 1TWCB 1EIFA 1GUOA 1OO9B 4NKLA 1IBML 3CQZB 2EZVA 4A93B 4MIUA 2JA6H 3FKIG 3NQTA 5BN4A 5C4JB 4O2DA 2F0HA 4NXNL 3U9OA 4JK1C 1JE5A 1GKHA 5D14A 1PZJD 2MO0A 4L63B 4LF5L 3ULLA 4F87A 2QKIC 4LF8Q 2KQ3A 4YWKA 1EU3A 1X3EA 1PYSB 1Y8NB 2GN5A 2K04A 1FJGQ 1DZ1A 2F4IA 4EQPA 2R92H 4C2MB 1EIYB 1X56A 5CBEE 1OTCA 2B3GA 5C44G 3K7AB 3HOUG 4K6LA 1DD2A 1WD0A 4XYOA 1PFBA 1PYWD 1LV9A 4JI1L 1B50A 3BYTB 2Z6KC 1VQDA 4C3HG 3RLNA 2K5HA 1HTPA 5I6YA 3I4MH 1LTSD 4LMQD 4HJ9A 5C4XH 3N52A 1Y69U 4A3MH 4KKTA 3EQLC 1N36Q 2P5ZX 2K28A 5FK9C 1PFNA 2OTJA 4C3IH 1A2TA 1J6QA 4BA1I 1F9SA 2NVXH 4BBSB 5I2XA 3M4OH 2D62A 3CCQA 2F0EA 2RDGA 1UNSA 4QQBX 3BU2A 3X3NA 2OCEA 3T51B 4GKKL 2UU9Q 3EROA 3S14B 4EVOA 2EVBA 3CCMA 2A74C 1DOMA 1U0LA 3NELA 3T53B 2BA0A 1EWCA 4LF7Q 1VQCA 2NTTA 1G6ZA 1SE3A 3Q22A 1A63A 2N8NA 3M7NA 4DR1L 3KOJA 1C48A 3PUZA 4ZUIA 4DV5L 3UE0A 3CRKC 4LWCA 4DGZA 3HOXB 4NPSA 3L9AX 1L2FA 4WFN3 2E2IH 2CFMA 3PQIA 4IFDH 5M3FB 4OWTB 1JCKB 4DF7A 3JC66 4UDUC 4HEDA 2LY7A 2NN6H 5IIFA 3QR8A 3NEMA 3SGIA 3G4SA 1TS3A 3CCRA 3PSIA 3A8IE 2RSNA 1HR0W 2C5CA 1SYCA 3RNUA 4BY7G 1IYVA 2L11A 3J81E 2EY2A 2B2TA 4S3SA 2QEJC 3I4NG 4DN4M 1BCPF 4IQZA 1WTHA 4YCVA 2ZTEA 3U4VA 3PO2B 3TP5A 5EQ0A 3SK6A 4A3FH 3W3AA 3HP3A 5EKLA 1RTNA 3OPOA 1AW7A 4DAYB 4LF8L 5CORA 2ZM6Q 3H3VH 3K80C 4RWSC 2PW5A 3MA2B 2JSOA 2RCFA 2OTLA 3PUWA 4OWXB 1YNXA 1YNND 3FRPB 3ERQA 2BH2A 3RMHA 2WKDA 4KLKA 4RKLA 2I5LX 1JQYD 4JI7Q 3IKJA 3BVGA 3P20A 1W6KA 2A6EC 3OW7A 4ME3A 5FLMG 1F9RA 5KIXA 5CV5A 5HURA 3UDXA 2GVAA 1O7LA 1WFQA 1WTVA 4FF3A 4LK1C 3GTKH 4IOCA 3QO2A 1U9RA 2BH8A 1NSNS 4DNIA 4YCUA 1PH2A 2JA5B 4JVZA 2PI2A 2YYZA 3MXGA 3ND9A 3STBD 2SDFA 2ALYB 2DN8A 5IYDH 1VDZA 5IODA 3NE5B 2AQ1B 2ICEC 3HOYG 1L0XB 1NAPA 2HQEA 2NTSA 1Q86C 1YNJC 5KNCA 5HY6A 4BY1G 5K36G 3OMCA 3G71A 3AYHB 5M5WH 1VQ8A 5HGQA 2UU9L 1B9MA 4B3RQ 4CKBA 4X64Q 3PIO3 2K5DA 4LF7L 4HCEA 3A7LA 1KAWA 4RMFA 1FNWA 4ULLA 3BZKA 4H13C 1JOQA 3OMGA 1VQ5A 4C3JH 1HA5A 2NVYH 4XTCS 5C5LA 3Q6SA 4A3GB 1X65A 2UXBQ 1K83B 2B8GA 1KDAA 2KA7A 3ND8A 1BDOA 3GTPB 4MNOA 4C56C 2DY7A 3OIQA 5JAVA 1UE7A 1RL2A 4JYAQ 5I6WA 4WORA 3IAYA 1E1OA 5IGDA 2ZTDA 3KDFA 3NWTA 1EUJA 4HSPA 2JXMB 1KTKA 4GNXB 4EQ5A 3GTGB 4BXXH 1H9KA 2A1AA 3NTHA 1Y8OB 2VUMH 5COYA 1TT2A 2AKWB 2BDNA 3J81L 2IHEA 4UAIA 3QOJA 1WCMH 4P71A 3DEPA 2CKZB 4U68A 1VF5C 4LFCQ 1HZBA 1ONLA 3VYTA 4NP5A 2D5DA 1Y1VH 2ENBA 4K5WA 1STEA 1AZPA 1MBYA 3K6OA 4YWMA 1SYFA 4IURA 4DNTB 2HUGA 4JBKA 2ZM6L 4BA2I 1JOOA 3Q23A 4GKJQ 4KKUA 1QNUA 4MZ9A 1LT5D 4IN3A 4APVA 3I3CA 4QUCA 3S16B 5LL6X 3HOZH 2A68D 4P2CB 4LF9Q 1J8IA 4HMIA 5CV4A 1CKOA 4JI7L 5BR8Q 1JWUD 3QB3A 4Y7NH 4ABNA 2BOSA 4BBRG 4CBVA 1SNOA 3HOVG 1G8ZD 1GOZA 3ZJYC 1TVXA 4DUYQ 1SAPA 1L0WA 5JJLA 4A3EG 2D0OA 3DEOA 3C1EA 2BE5C 4LAAA 2DGYA 1SBBB 4RKBA 4DV6Q 1X3QA 3DM3A 5J39A 1JMCA 2R7ZH 2LKVA 3GTOH 1E22A 1VQOA 2WB1E 5M3MH 4A3KH 5JOBA 4A3IB 2WIIB 1OXSC 5J22A 2ZJRA 2L1BA 5M5XB 1QILA 1ENFA 1F9QA 3T4AC 5C3XA 5GAHC 1HQMC 3FP9A 3I73A 3UDFA 1DCZA 2AQ3B 1D2BA 4ZKBB 1STAA 3CU7A 4LFAQ 2O5IC 3PGZA 4B3RL 1TWFH 3CC4A 4X64L 2FMCA 3RZDB 2LSSA 4WJWA 2E2HH 1VQPA 3S1QH 1V43A 3FVQA 5D3DA 3AFPA 3S2HB 2Z6KA 1CKMA 1EY0A 2M2LA 3FKIH 4V0BA 3J81i 1G6PA 3AB9A 4XDXA 1TS5A 3GO5A 2XIWA 4HSVA 2UXBL 2E74C 5EJWA 1UAPA 1STBA 4QF4A 1AEXA 2A8VA 1DXMA 1RTOA 1EWIA 1KD1C 3GDEA 4JYAL 3EVQA 1S5CD 4MHEA 2H1EA 4CJ1B 3C1FA 1Q8IA 4O0AA 5CYUA 1KXLA 4HMJA 3GTLB 1ICWA 5C4HA 3H6MA 5F2DA 5FOBB 3FMCA 1VQHA 1PH3A 2SOBA 4NXMQ 5C44H 4R4OA 3HOUH 1T5EA 5GAEC 2KEEA 1WD1A 2Z0SA 1F2LA 1HPCA 1OXUA 3PIPA 3J7A5 4O42A 5ELDA 3T13A 2CH4W 4LFCL 2KCMA 4A4IA 1JB3A 4IJLA 4OHJA 4B3SL 3NTIA 3K5NA 4B3MQ 1SMYC 4DV0Q 5D3IB 2SEBD 4DNRB 3T56B 4E6IA 2E2JH 3VR2A 2A73B 1MGSA 1IYUA 5EPLA 4DFAA 3J7YW 4N9TA 1V8QA 5E1FA 1LTLA 1I50B 3EIVA 4EQNA 1S5FD 1NR4A 1Q1BA 2MJ8A 5DNFA 2EYJA 2KJXA 1VQIA 5A2QL 5FKAC 3PUVA 1TU2B 4LF9L 4GN4B 4QIWE 5BR8L 3S15B 2A5HA 5IGBA 4GOPC 1G51A 2CW0C 1NUCA 3LNNA 1G91A 3MEHA 2MP1A 4KD4A 1Y1WG 4DK3C 3V96A 1CHQD 3S1RH 1VMPA 3HKZG 2F0UA 1F9PA 1X3FA 4RFBA 4HR7B 2KHSA 3A5UA 1RD9D 4HIOA 4Q5VA 3GV6A 3F1ZA 4XT1B 1GJXA 1UE1A 2C35B 5LMUL 1YJ9A 3H94A 2JA6B 1P8LA 1V1PA 1CA5A 3TP6A 1HRJA 4DV6L 2LS01 3I2ZA 1B8AA 4DK0A 1QVGA 2ZT9C 1VQ6A 4A3JB 3A56A 2NWGA 4RGNA 4IUQA 4R8NA 1YHBA 3I7FA 1E3PA 2PMZE 1JJ2A 2KHJA 3NUCA 3K57A 4G57A 4AIMA 2R7FA 1JWSD 2R92B 3JAME 4P75A 3HS0C 4LFAL 2MQHA 5JVH3 4BY7H 4KHVA 3TQYA 3ER0A 3DWAA 2M9VA 3R2IA 4YCWA 3HOXG 3F2BA 4PMWA 4TRDA 1TS4A 3I4NH 1C0AA 1KNEA 5M3FG 1LUZA 1PZKD 4QMGA 5DAUA 2NVTH 2A69C 4P72A 2IX0A 3LGJA 4QGUA 4A3MB 3BZDB 3SHLA 3K7UC 1EL0A 3PMFA 1DGSA 1CSPA 1GHJA 2XN9C 1SFOB 4C3IB 1QWYA 3QWNA 2XGTA 3CW2C 2X6LA 4X3KA 1WTPA 3P1HA 2F52A 1I6HH 3F2DA 1GD7A 3M4OB 2RKSA 4GN3B 3KF6B 4NXML 4HJ7A 2JA9A 2K75A 3PO2G 1BQQT 4YHHQ 1L0YB 3CMAA 2F4VQ 1ENCA 1MJCA 3DWQA 1YHQA 2HDLA 3ERSX 4V190 4LUZA 1EYAA 1PMRA 1STGA 2TMPA 1KRTA 1A0IA 4XXEA 3D6CA 4B3ML 5C0XJ 4DV0L 1N34Q 2MFIA 4DK6C 2Q8RE 5E3FA 3PO3G 2Z4HA 1EFWA 4G7OC 1I4XA 3BVZA 3A0JA 2E2IB 3HOYH 1PTOD 4B9XA 2ES2A 3HG9A 4BY1H 5K36H 3L0OA 2H4OA 1I4RA 1C4QA 2SNMA 3MTSA 4DR4Q 5LHY1 1J9OA 1ET9A 2JP1A 1S72A 2JA5G 3TBIB 2B39A 2EJGC 1CM9A 2ATWA 3C2PA 2R93B 4JPBW 3BJUA 1LTID 3CKIB 3QIAA 4A75A 4JI5Q 2DJFC 4LW1A 4DV3Q 1LT6D 4UP8A 1XPUA 2EE1A 1VQ4A 1EU4A 1SYGA 5M5YB 2AWOA 2EIFA 2N3SA 1DYQA 3J81c 2RSOA 1TY2A 1KABA 2IJ0A 5IP7G 1PTOF 4ODGA 3K0XA
chains in the Genus database with same CATH topology
4ZRZA 3H0GB 2EOTA 5EKKA 4DXFA 3HEJA 3NK9A 5C3EB 2NZ1D 3EJIA 1AN8A 3VA7A 5T1IA 5KEEA 4J6HA 1HTLD 2PZUA 1I3QB 5I9PA 1UEAB 2F0SA 1SNDA 3BG3A 4OO1G 2IWHA 3I72A 1ML0D 3KBGA 2DNEA 2K05A 1SSOA 3GTKB 1Q3LA 2CQAA 1G2SA 3KLSA 2XVSA 2C9OA 1S5BD 4RHSA 4F88A 1X32A 5CBAE 1RHPA 5KNDA 3M4YA 1BNZA 3A8KE 1B53A 5M5WB 2K32A 3VR3A 3ZYYX 4A3BB 5CGKA 2PYKA 3K59A 1BCPD 1H9JA 3PIP3 1LLRD 4C3JB 2NVYB 1Z7TA 4RCOA 1BUVT 4OO1I 3DM1A 4IUUA 2F03A 1I4GA 4IUVA 1GUSA 4DAYA 2F0DA 3PUXA 4R8IA 1FNVA 1H9SB 3NSWA 5E4XA 2VUMB 4RH6A 5D65A 3J7AF 4K2LA 3EFXD 1GXDC 3T16A 5I4DA 4N9PA 4XQJA 2EXZA 3M85A 4OIJA 1D5ZC 1JORA 2CVRA 1BR9A 1RCVD 2XRSD 1EYCA 3IL8A 1TS2A 5KNBA 2A6HC 1GUWA 2GA4B 1AZQA 4X3TA 4L6TB 4F7XA 1B4OA 1JICA 3DHQA 1I4PA 1DOKA 2LMCB 2F0JA 3P7JA 3K5LA 4CJ0B 5KYLA 4Y7NB 1EYDA 4Z9CB 1CT1D 3VYSA 1U4LA 3KBXA 3SE0A 5ELBA 3S1MB 2FMMA 4FXKC 4KKSA 1FR3A 2CHBD 4ZK9B 2A6ED 3IFDA 1EQVA 2WAQB 3GTOB 2RQXA 1HXYD 5M3MB 1JC7A 2I07B 2MGSA 1Y8PB 5G3LD 2F1MA 4FO2A 4FVMA 1LTBD 2B2YC 2FHTA 3KUPA 2F0NA 5BN3A 2E75C 3VR5A 2EYLA 3J80E 1TWFB 1OXTA 2E2HB 4PV1C 3AMUA 1O80A 1YNJD 2F0QA 2IT1A 1G2TA 1EZ8A 3SK4A 1C8CA 5IT9E 4HAEA 4OL7A 3R3OA 1ENAA 1ZKOA 5CV6A 5EBCA 1KDBA 3I4LA 4FNFA 5HGTA 5G3LF 2ZXPA 2ID0A 2PO4A 4IUTA 1CA6A 1Q90A 2E2DC 5DEHA 3GD7A 2B2VA 2WKCA 1EEFD 3H3VC 2ZXRA 3R8BA 2EYHA 3WOFA 1SYDA 3GTQB 2F0TA 4R9WA 3UI2A 4IALA 2WINB 2O5JC 3KLRA 4QB4A 1SDFA 3R2TA 2E2JB 4PNYA 4JBWA 3MC0B 5C0XH 1D5MC 1MI2A 2PCFB 2K5QA 3MZ5A 4DAPA 5C3WA 1LO5D 1U4MA 1I6VC 3C46A 3TZUA 2B2WA 4J8QA 4LJZC 2J0TD 2A68C 2N88A 1QE6A 2D2CC 3OWEB 3S1RB 1STNA 3I8ZA 3MVVA 5A35A 4KN7C 1IL8A 2L0CA 3QJYA 2JEBI 1QB5D 3SR1A 2OF1A 4CKEA 4NMZA 3NTKA 1B9NA 3BVMA 1S5DD 4ZAIA 1ESFA 3GV3A 5TSSA 3OOCA 2F0PA 1PDQA 2OXPA 3ONAB 4B9WA 1PLFA 1ILPA 4KN4C 2O4XA 2BE5D 1B1ZA 3E5SA 3RZOB 4I65A 3TP8A 2XRQD 1LACA 4BY7B 4OIKA 5ISRA 1SXTA 3NWSA 3EA6A 3MFGA 2VXWA 1EIHA 2XWBB 1KAAA 4PMBA 4IFDG 5IT9L 4XT3B 1KLGD 3Q24A 4GZYC 3V2TA 2JA7B 1F2ZA 1E0BA 1PXUA 1RJTA 2B2UC 5BN5A 2L5TA 1XYIA 4XQNA 3K0YA 1QG7A 3D4WA 4RA8A 4L8JA 2NB0A 1D1KA 1UUPA 3W2DA 3J7AV 5C6AA 4OO1H 4EQOA 2NVQB 2RDHA 5DM73 4IFDI 4Q0FA 1EY5A 4CKCA 4KMUC 1PFMA 1II3A 2NN6I 2EYPA 2Z8LA 3CRLC 2PNRC 2EJFC 2B63B 1RKNA 4ILWA 4K5VA 1SMYD 1VF7A 2F3VA 2B2TC 3NP8A 4FF4A 5I9OA 1I4HA 2ICIA 4F8MA 3TSSA 3VR4A 2CW0D 1PTOH 2EYFA 3TZDA 2LFNA 1DONA 2F0VA 1W6JA 5CMDA 2K5WA 3RD4A 3A54A 3I91A 1PRTC 3OIPA 5C5MA 5EKIA 1EY8A 2AUKA 4ZYSA 2IX1A 4ZLTF 1QNKA 1LTAD 1O7YA 3FPPA 3H09A 4KD3A 4I7ZC 5ELFA 1WTWA 4DXGA 5LL6S 1D5XC 1FNUA 2NBFA 1LT4D 4FP5D 4ZUJA 5FLXE 1I4QA 2OT2A 4PQXA 3I4MB 5C4XB 1R4PB 2K7VA 5T1GA 1HFGA 1WTXA 2AQ2B 4HTHA 1EZ6A 1K8MA 5EPJA 2NVXB 2RVLA 2IW3A 2RDFA 5CV9A 1MSGA 3BYYB 4BBRB 1IW7D 4MN3A 2FFKB 1A2UA 3FDTA 4EGVA 4RAUC 2QDBA 1LTRD 5C4ZA 1TIID 4M8AA 3L7ZC 1AP0A 2XNAC 1A6XA 4ZKCB 1HA6A 1ZYRD 2FJ2A 2KOLA 1QOHA 4IUNA 2Q8IB 1EQTA 2G9HD 1Z47A 5JPMC 1PTOC 4KY5A 1D6EC 4XIGS 5EPKA 4X3UA 1NR2A 4NDXA 1CHPD 3SEBA 4HCSA 3SK5A 3Q0AA 1EWHA 3ITPA 2MHVA 5DM63 1VCIA 2AUJD 4TKOB 4DAVA 5J1ZA 4A3FB 1Z6HA 1ILQA 1OXXK 2F0FA 3M3YB 3AU7A 3KK7A 2I46A 2DNCA 3JAML 3E6ZX 2WP8J 5M9OA 3G6JB 1EIGA 1ET6A 2R6GA 5K5PA 3VA5A 2PZTA 3GP7A 5IGFA 3DWPA 1GUTA 2TSSA 3DXJC 1FGBD 3SDZA 4K14A 3BDLA 4RGMA 5FLXL 1XWEA 3KLSX 5JPNC 3D3RA 3QG1A 1WVLA 3TMEA 3PUYA 2KCCA 4FF1A 1HUMA 2BA1A 1SE2A 4ME5A 3F2UA 3E0JA 1E2VA 2SNSA 3NPPA 1O78A 2DY8A 2L55A 3DMUA 4KK7A 4QCLA 3C3LA 1H9RA 4HN7A 5JEAG 1B3AA 4CHTB 1Y1WB 2Z4IA 3HKZB 1H9SA 1DJRD 3D31A 4FXDA 4H7BA 1H9MA 3DUZA 1SYEA 1BCPC 1LTGD 2HDMA 4G7HC 5NUCA 4TQUS 2B2UA 3BDOA 3M7GA 4KJNA 1TQOA 1CK1A 1GHKA 2R3ZA 5JEAJ 4H0LC 4XYQA 3URYA 5IGGA 3K5OA 1BO0A 3LWEA 1AFPA 1Q12A 1WCMB 2MUYA 3RLFA 1EY9A 3O13A 1K8OA 1LTTD 1XTCD 1Y1VB 1EEID 5FO9B 2VNUD 4K6DA 1M4VA 2EY1A 3MXNA 5JJZA 4G4KA 3BS1A 3HOZB 4B08A 1TY0A 1XXGA 4BS9A 1YNNC 2A6HD 5FO8B 4KHZA 1F2MA 1ZEQX 3OHXC 5KGUA 2EYMA 1M8AA 3WOEA 3MHBA 3MAQA 2F0WA 2Z1CA 2L9HA 1CFMA 2JE6I 4K8JA 3GTJB 2HCIA 3PO3B 2PPBC 2R7ZB 5KYIA 1LABA 2WV6D 1SYBA 4A3KB 1STYA 1JE4A 3FEWX 1SE4A 1WTRA 5IOCA 5FO7B 3MFYA 5CR3A 2K6AA 2D9UA 2F0IA 2WB1B 1TKWB 1JWMD 3D4RA 2KUMA 1KLUD 4RCNA 3S1QB 3R93A 3FKIB 1E2ZA 1SJHD 1PRTB 1U4PA 3NXWA 2AWNA 1HFNA 4KY7A 2L12A 1HQRD 2EDGA 3WDNA 3FPUB 1GUGA 4BWGB 2PW7A 1CZWA 1NCVA 4A3DB 4DK1A 4YIJA 5C44B 3HOUB 4O1NA 4TSSA 2B8FA 2V4DA 1RODA 3GTMB 1JOKA 2X69A 4C3HB 2ZXOA 3K58A 2VB2X 4G7ZC 4ZQ3A 1CZGA 1EY7A 3NBHA 2JA8B 3D6WA 1TWAB 3VYRA 3D4DA 3L3OC 2QCPX 1CI3M 5KRUA 1GUNA 2BCOA 4K2KA 1PZID 1FD7D 3SVMA 2K03A 3D8GA 2IX3A 5IGCA 5ELEA 1HUNA 4C3IG 4K8IA 4QIWB 5A2QE 3OWFA 1PTOB 3HRZC 4KTAA 3TP7A 2PQEA 2Y0SB 4WRDA 1STHA 2EY5A 2R61A 2NYZD 3A55A 3N6RA 1LT3D 1VMCA 5CC4A 1WTOA 3H91A 3J80L 4RGTA 4DU9A 4H44C 4XQQA 3U9SA 1X3PA 4M1UB 5IGEA 1ESRA 1TR5A 2JYOA 2KVMA 4AYBB 1BF4A 2N55A 2PMZB 1B44D 1JR0D 3I4NB 1F77A 1CTMA 2WACA 2XSCA 4QUFA 3HZXA 3I70A 1SNMA 2HCCA 2M00A 1SJED 2NN6G 2NVTB 3MWYW 4C1NK 3KF8A 2JEAI 2PZWA 2EY6A 1I6HB 2J7ZA 2X6GA 4IFDJ 1SNPA 1KNAA 1CQVA 1SNQA 1D1IA 1O7ZA 1KDCA 1A15A 4ID6A 2F3WA 4OGQC 5I2YA 2EPBA 4FF2A 2K1BA 1F2YA 1EY4A 3HOYB 4FXGC 2F0GA 1DOLA 2NUCA 4BY1B 5JEAH 1HHVA 1MSHA 1SNCA 2G9DA 3G7LA 1BCPB 1U4RA 3GQBA 1WTQA 3A7AB 1BBXC 2F0KA 4RHRA 2RA4A 3NBIA 1RDPD 2L4NA 1TWGB 1TWHB 4CJ2C 3P75A 1XX8A 4FYDA 1RF2D 3LWUA 3S1NB 1CQFA 4RGOS 2EYOA 1OXVA 2YU9B 1HCZA 5CV8A 3LX0A 2J4XA 5E4WC 4C3JG 2F0OA 4C1NI 1PRTD 3RUZA 5AFWA 3OSOA 3SK8A 3BDCA 3HGBA 3VR6A 2IL8A 2K33A 3TDQA 1QJOA 3SXHA 2MPMA 1BXTA 2Q8TA 1EFID 1E2WA 3QOLA 5ELCA 3NQIA 2B2YA 3A8JE 2KEDA 1V1PB 1SEBD 3X3MA 3VYUA 2A69D 3PV0A 1A3VA 3CHBD 3NHHA 3HOVB 3S9WA 1MD2D 5C0XG 4KJOA 4J1MA 4IZ8A 1IW7C 1PRTF 4X3SA 1R9TB 3K5MA 4DA2A 4A3EB 3I90A 5EGTA 4KY6A 2BDOA 2KECA 3MXUA 3MXPA 2O2LD 1A3UA 1IHZA 1ZYRC 1G291 2EJMA 4KI0A 4CGYB 2B2VC 2RBMA 2XWJB 3HOWB 5CV7A 1S5ED 5EBDA 4K5XA 2E76C 2QF7A 2K01A 4PMCA 1A3TA 2OEOA 2F0MA 4NW2A 4U673 4IUPA 1IKLA 1QCBD 1BOSA 1V1OA 2IPKD 3S2DB 1S4ZA 1R4QB 3IFTA 1IKMA 2VB3X 2KCNA 1T5XD 3V05A 2FINB 5C0XI 2QILA 1ZXTA 2F0LA 3S17B 3TN2A 1DM0B 1B2TA 1EOTA 2B2WC 1EY6A 5JVG3 1Q1EA 1FYCA 4KV6A 1TWCB 1GUOA 1OO9B 4NKLA 3CQZB 2EZVA 4A93B 4MIUA 3NQTA 5BN4A 5C4JB 2F0HA 3U9OA 4JK1C 5D14A 1PZJD 4L63B 4F87A 2QKIC 2KQ3A 1EU3A 1Y8NB 1DZ1A 2K04A 2F4IA 4EQPA 4C2MB 5CBEE 3K7AB 4K6LA 1DD2A 1WD0A 4XYOA 1PFBA 1PYWD 1LV9A 1B50A 3BYTB 4C3HG 1HTPA 5I6YA 1LTSD 4LMQD 3N52A 1Y69U 4KKTA 3EQLC 2K28A 5FK9C 1PFNA 1A2TA 4BA1I 1F9SA 4BBSB 5I2XA 2D62A 2F0EA 2RDGA 1UNSA 3X3NA 3T51B 3EROA 3S14B 4EVOA 2EVBA 2A74C 1DOMA 3T53B 2BA0A 1EWCA 2NTTA 1G6ZA 1SE3A 3Q22A 3M7NA 1C48A 3PUZA 4ZUIA 3CRKC 4DGZA 3HOXB 3L9AX 4WFN3 4IFDH 5M3FB 1JCKB 4DF7A 4UDUC 4HEDA 2LY7A 2NN6H 5IIFA 1TS3A 3A8IE 2RSNA 2C5CA 1SYCA 1IYVA 2L11A 3J81E 2EY2A 2B2TA 4S3SA 2QEJC 4DN4M 1BCPF 4IQZA 3PO2B 3TP5A 5EQ0A 3SK6A 3W3AA 3HP3A 5EKLA 1RTNA 3OPOA 1AW7A 5CORA 4RWSC 2PW5A 3MA2B 2JSOA 3PUWA 1YNND 3FRPB 3ERQA 3RMHA 2WKDA 4RKLA 1JQYD 3IKJA 3BVGA 3P20A 1W6KA 2A6EC 3OW7A 1F9RA 5KIXA 5CV5A 5HURA 1O7LA 1WTVA 4FF3A 4LK1C 3QO2A 1U9RA 1NSNS 2JA5B 2YYZA 3MXGA 3ND9A 2SDFA 2DN8A 1VDZA 5IODA 3NE5B 2AQ1B 2ICEC 1L0XB 1NAPA 2HQEA 2NTSA 1YNJC 5KNCA 5K36G 3OMCA 1B9MA 4CKBA 3PIO3 2K5DA 4HCEA 3A7LA 1FNWA 4ULLA 4H13C 1JOQA 3OMGA 1HA5A 4XTCS 5C5LA 3Q6SA 4A3GB 1K83B 2B8GA 1KDAA 2KA7A 3ND8A 1BDOA 3GTPB 4C56C 2DY7A 3OIQA 5JAVA 5I6WA 4WORA 3IAYA 5IGDA 3NWTA 4HSPA 2JXMB 1KTKA 3GTGB 1H9KA 3NTHA 1Y8OB 5COYA 1TT2A 3J81L 2BDNA 4UAIA 3QOJA 3DEPA 4U68A 1VF5C 1ONLA 3VYTA 4NP5A 2D5DA 2ENBA 4K5WA 1STEA 1AZPA 1MBYA 3K6OA 1SYFA 4IURA 4DNTB 2HUGA 4BA2I 1JOOA 3Q23A 4KKUA 1QNUA 1LT5D 4IN3A 3I3CA 4QUCA 3S16B 5LL6X 2A68D 4P2CB 1J8IA 4HMIA 5CV4A 1JWUD 3QB3A 4ABNA 2BOSA 4CBVA 1SNOA 1G8ZD 1GOZA 1TVXA 1SAPA 3DEOA 3C1EA 2BE5C 4LAAA 1SBBB 4RKBA 1X3QA 5J39A 2LKVA 4A3IB 5JOBA 2WIIB 1OXSC 5J22A 2L1BA 5M5XB 1QILA 1ENFA 1F9QA 3T4AC 5C3XA 1HQMC 1D2BA 3I73A 1DCZA 2AQ3B 4ZKBB 1STAA 3CU7A 2O5IC 2FMCA 3RZDB 4WJWA 1V43A 3FVQA 5D3DA 3S2HB 1EY0A 2M2LA 4V0BA 3AB9A 4XDXA 1TS5A 3GO5A 2XIWA 4HSVA 2E74C 5EJWA 1UAPA 1STBA 4QF4A 1AEXA 1DXMA 1RTOA 3EVQA 1S5CD 4MHEA 2H1EA 4CJ1B 3C1FA 1Q8IA 5CYUA 4HMJA 3GTLB 1ICWA 5C4HA 3H6MA 5F2DA 5FOBB 3FMCA 2SOBA 1T5EA 2KEEA 1WD1A 1F2LA 1HPCA 1OXUA 4O42A 5ELDA 3T13A 1JB3A 4OHJA 3NTIA 3K5NA 1SMYC 5D3IB 2SEBD 4DNRB 3T56B 4E6IA 3VR2A 5EPLA 4DFAA 2A73B 1IYUA 1MGSA 3J7YW 4N9TA 1V8QA 5E1FA 1I50B 4EQNA 1S5FD 1NR4A 1Q1BA 2MJ8A 5DNFA 2EYJA 2KJXA 5A2QL 5FKAC 3PUVA 1TU2B 3S15B 2A5HA 5IGBA 2CW0C 1NUCA 3LNNA 1G91A 3MEHA 2MP1A 4KD4A 3V96A 1CHQD 1VMPA 2F0UA 4RFBA 1F9PA 4HR7B 2KHSA 1RD9D 4Q5VA 3GV6A 1GJXA 4XT1B 3H94A 2JA6B 1V1PA 1CA5A 3TP6A 1HRJA 2LS01 4DK0A 2ZT9C 4A3JB 3A56A 2NWGA 4RGNA 4IUQA 4R8NA 3NUCA 3K57A 4G57A 1JWSD 2R92B 3JAME 3HS0C 5JVH3 4KHVA 3DWAA 2M9VA 3R2IA 4PMWA 4TRDA 1TS4A 1KNEA 1PZKD 4QMGA 5DAUA 2A69C 2IX0A 4A3MB 3BZDB 3SHLA 1EL0A 3PMFA 1GHJA 2XN9C 1SFOB 4C3IB 1QWYA 3QWNA 2X6LA 4X3KA 1WTPA 3P1HA 3M4OB 2RKSA 1BQQT 1L0YB 1ENCA 3DWQA 2HDLA 4V190 1EYAA 1PMRA 1STGA 2TMPA 4XXEA 3D6CA 5C0XJ 2Q8RE 5E3FA 2Z4HA 4G7OC 1I4XA 3BVZA 2E2IB 1PTOD 4B9XA 3HG9A 5K36H 2H4OA 1I4RA 1C4QA 2SNMA 3MTSA 5LHY1 1J9OA 1ET9A 2JP1A 3TBIB 2B39A 2EJGC 1CM9A 3C2PA 2R93B 1LTID 3CKIB 3QIAA 1LT6D 2EE1A 1EU4A 1SYGA 5M5YB 2AWOA 1DYQA 2RSOA 1TY2A 1KABA 2IJ0A 1PTOF 4ODGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQB A;  1ZYR C;  1G29 1;  2EJM A;  4H0L C;  1Y69 U;  3FMC A;  4IFD G;  4KKT A;  3IKJ A;  1EWH A;  3EQL C;  3P20 A;  4RCN A;  2A69 C;  4KI0 A;  1Q90 A;  2A6E C;  3OW7 A;  3A7A B;  1T5E A;  4DNT B;  1VCI A;  2AUJ D;  5KNB A;  2A6H C;  1HPC A;  1E2Z A;  1OXU A;  3GD7 A;  2AUK A;  3VA7 A;  4GZY C;  4BA2 I;  4TKO B;  4BA1 I;  2E76 C;  2QF7 A;  3N6R A;  4KKU A;  1O7L A;  1GHJ A;  2D62 A;  5BN5 A;  2L5T A;  4H44 C;  1Z6H A;  1OXX K;  3FPP A;  3U9S A;  2A68 D;  4I7Z C;  1SMY C;  1Q12 A;  3BG3 A;  3LWU A;  4LK1 C;  4DNR B;  3T56 B;  4OO1 G;  3I72 A;  3RLF A;  3VR2 A;  3T51 B;  2DNE A;  1IYU A;  2DNC A;  2EDG A;  3IFT A;  3WDN A;  2EVB A;  1GUG A;  2O5J C;  1V8Q A;  2LMC B;  2YYZ A;  3KLR A;  1CTM A;  1OXV A;  3ND9 A;  1K8O A;  3T53 B;  2BA0 A;  1HCZ A;  4JBW A;  4L8J A;  5C0X H;  1Q1B A;  2DN8 A;  1VDZ A;  2K7V A;  2R6G A;  3NE5 B;  4DK1 A;  2NN6 G;  1PMR A;  1YNJ C;  5KNC A;  2PCF B;  3M7N A;  3PUV A;  1TU2 B;  5K36 G;  1GUT A;  3DXJ C;  2BE5 C;  3SDZ A;  3SE0 A;  5KND A;  3PUZ A;  4OO1 H;  2JEA I;  1I6V C;  3M4Y A;  1Q1E A;  2B8F A;  1FYC A;  4KKS A;  1FR3 A;  1K8M A;  3TZU A;  2CW0 C;  3CRK C;  1B9M A;  3A8K E;  2V4D A;  3LNN A;  4LJZ C;  2A68 C;  2K32 A;  3HGB A;  3QG1 A;  2A6E D;  1GUO A;  4KMU C;  3VR6 A;  4IFD H;  2D2C C;  2K33 A;  3A7L A;  3VR3 A;  4G7O C;  1YNN C;  2A6H D;  4HR7 B;  1OXS C;  2NN6 I;  4KHZ A;  1QJO A;  4H13 C;  3PUY A;  5BN4 A;  4G7Z C;  2NN6 H;  2KCC A;  2PNR C;  3CRL C;  2EJF C;  1GJX A;  1Y8P B;  5A35 A;  4KN7 C;  1IW7 D;  2BA1 A;  1H9J A;  2F1M A;  3H94 A;  4JK1 C;  3QJY A;  4XTC S;  5K36 H;  1HQM C;  1E2W A;  2JEB I;  1DCZ A;  2B8G A;  3A8I E;  3I73 A;  2KA7 A;  3ND8 A;  1BDO A;  1Z7T A;  1E2V A;  4DK0 A;  1VF7 A;  1GHK A;  1O78 A;  2ZT9 C;  1B9N A;  1CFM A;  2O5I C;  2JE6 I;  1CI3 M;  5BN3 A;  3A8J E;  2E75 C;  3L7Z C;  1A6X A;  3VR5 A;  1IYV A;  1GUN A;  1H9R A;  1V43 A;  3OOC A;  5JEA G;  1OXT A;  2EJG C;  1Y8N B;  2A69 D;  4IQZ A;  2PPB C;  1GUS A;  3AB9 A;  3PV0 A;  2JXM B;  4PV1 C;  4OGQ C;  1H9S A;  2Q8I B;  3D31 A;  3QIA A;  1H9K A;  1LAB A;  2IT1 A;  4KN4 C;  3PUX A;  2E74 C;  1Y8O B;  3W3A A;  2BE5 D;  5C0X G;  1H9M A;  1DXM A;  3OPO A;  1H9S B;  3VR4 A;  1DD2 A;  1IW7 C;  4G7H C;  4XIG S;  4TQU S;  1VF5 C;  3MFY A;  5JEA H;  3BDO A;  2AWO A;  3PUW A;  1LAC A;  1ONL A;  2BDO A;  1ZKO A;  2D5D A;  3M85 A;  1HTP A;  3MXU A;  1TKW B;  3D4R A;  3I4L A; 
#chains in the Genus database with same CATH topology
 4ZRZ A;  3H0G B;  2EOT A;  5EKK A;  4DXF A;  4DV7 Q;  1SR3 A;  3HEJ A;  3NK9 A;  5C3E B;  4A3D G;  4A3G G;  2NZ1 D;  3EJI A;  4JBM A;  1AN8 A;  2HIX A;  3VA7 A;  5T1I A;  5KEE A;  4J6H A;  1N33 Q;  1HTL D;  2PZU A;  1I3Q B;  5I9P A;  1UEA B;  2F0S A;  1SND A;  3BG3 A;  4CDC C;  4OO1 G;  2IWH A;  3I72 A;  1ML0 D;  3KBG A;  2DNE A;  1K3B C;  4HIK A;  2K05 A;  1SSO A;  3GTK B;  1Q3L A;  1SRO A;  3T1H Q;  2CQA A;  3CPF A;  1G2S A;  3KLS A;  2XVS A;  1SRU A;  2JA8 G;  2C9O A;  1S5B D;  4RHS A;  1UE5 A;  4IPC A;  4F88 A;  1X32 A;  5CBA E;  1RHP A;  5KND A;  3M4Y A;  3CC2 A;  2V1C C;  1BNZ A;  3D0F A;  5IE8 A;  1ASZ A;  3A8K E;  1B53 A;  4CDD C;  1QZH A;  5M5W B;  2K32 A;  4BBR H;  4YHH L;  2F4V L;  3HOV H;  3VR3 A;  3ZYY X;  1MIU A;  1PH8 A;  4A3B B;  5CGK A;  2VS1 A;  2PYK A;  1PH4 A;  5JJI A;  3K59 A;  1KL9 A;  1VQG A;  1NBW A;  4DPG A;  5IYC G;  1BCP D;  1H9J A;  4A3E H;  3PIP 3;  1LLR D;  1NMF A;  1N34 L;  4C3J B;  1AE3 A;  3T1Y Q;  2NVY B;  1Z7T A;  4RCO A;  1BUV T;  4OO1 I;  2EQS A;  3DM1 A;  2ZTC A;  4IUU A;  5E7N A;  2F03 A;  1Q7Y C;  1E24 A;  1XTD A;  4UPA A;  1I4G A;  2Y0S G;  4IUV A;  3OW2 A;  1GUS A;  4DAY A;  2F0D A;  4DR2 Q;  1L1O B;  3PUX A;  3UDI A;  4FDB A;  1TXY A;  4R8I A;  1LYL A;  4K0K Q;  4DR4 L;  1FNV A;  1H9S B;  3NSW A;  5E4X A;  1X55 A;  3K81 C;  2VUM B;  4RH6 A;  5D65 A;  1VQM A;  3J7A F;  4K2L A;  3EFX D;  1GXD C;  3T16 A;  5I4D A;  4R4C A;  4N9P A;  4XQJ A;  2EXZ A;  2K50 A;  4AYB G;  3M85 A;  4OIJ A;  4A3I G;  2UUA Q;  1D5Z C;  3TS0 A;  2CVR A;  1JOR A;  1BR9 A;  1RCV D;  4JI5 L;  4A3L G;  2XRS D;  1EYC A;  4QY7 A;  3IL8 A;  1TS2 A;  4DV3 L;  1YI2 A;  5KNB A;  2A6H C;  1GUW A;  5ELN A;  2GA4 B;  3M9B A;  1D7Q A;  1AZQ A;  3M3Y H;  2VL6 A;  4X3T A;  4L6T B;  3CQZ H;  4X65 Q;  4F7X A;  1B4O A;  1JIC A;  3DHQ A;  1I4P A;  1SE8 A;  4DV7 L;  1DOK A;  2LMC B;  2F0J A;  3P7J A;  4JOI C;  4CDE C;  3K5L A;  4CJ0 B;  4JI6 L;  1N33 L;  2I5M X;  5KYL A;  4Y7N B;  2IY5 B;  3L2P A;  1EYD A;  4Z9C B;  3CXC A;  2EXD A;  1CT1 D;  3VYS A;  1E1T A;  1U4L A;  3KBX A;  3SE0 A;  3I56 A;  1C9O A;  2D0P A;  5ELB A;  4DV2 Q;  3S1M B;  2FMM A;  4FXK C;  4KKS A;  1FR3 A;  2CHB D;  4JI3 Q;  4ZK9 B;  4A3C G;  3T1H L;  2A6E D;  3IFD A;  5IP9 H;  1EQV A;  2JQO A;  3CCE A;  2WAQ B;  3K7A H;  2RQX A;  3GTO B;  4AQY Q;  4HID A;  1HXY D;  3HKZ E;  5IY0 A;  5M3M B;  4GOP B;  1JC7 A;  2I07 B;  3MXN B;  2MGS A;  1Y8P B;  1LM0 A;  5G3L D;  2F1M A;  4FO2 A;  4FVM A;  3F2C A;  2N49 A;  1LTB D;  2B2Y C;  2FHT A;  3KUP A;  2UUC L;  2F0N A;  5BN3 A;  3KJP A;  2E75 C;  4NB3 A;  2QA4 A;  1PFS A;  2JK8 A;  1Y1W H;  3VR5 A;  4GNX A;  5H1S E;  2EYL A;  3J80 E;  1TWF B;  1SN8 A;  1OXT A;  4EX5 A;  4YY3 Q;  2E2H B;  4PV1 C;  3AMU A;  2PQA B;  1O80 A;  3M4P A;  2LXJ A;  1YNJ D;  2F0Q A;  2IT1 A;  1G2T A;  3T1Y L;  1EZ8 A;  2MO1 A;  3SK4 A;  1W3S A;  1UEB A;  1WYD A;  1C8C A;  5IT9 E;  4HAE A;  4OL7 A;  3R3O A;  3CCL A;  1ENA A;  4IOA A;  1ZKO A;  5CV6 A;  5EBC A;  1KDB A;  2CWP A;  3I4L A;  4FNF A;  4DR2 L;  5HGT A;  5G3L F;  2N78 A;  2ZXP A;  2ID0 A;  2PO4 A;  4IUT A;  4K0K L;  1CA6 A;  1Q90 A;  2E2D C;  2UXD L;  5DEH A;  3CCS A;  3GD7 A;  2B2V A;  2WKC A;  1EEF D;  3H3V C;  4OEL B;  4DV1 Q;  2Z9H A;  3HOX H;  3EN2 A;  1WI5 A;  1JB7 A;  2ZXR A;  3R8B A;  2UUA L;  2EYH A;  4A3J G;  1CSQ A;  3WOF A;  1ASY A;  1SYD A;  3GTQ B;  2F0T A;  4R9W A;  3UI2 A;  4IAL A;  4B3S Q;  1X6O A;  3E0E A;  4IO9 A;  1VQ9 A;  2WIN B;  3CC7 A;  3KLR A;  4QB4 A;  1SDF A;  4UHV A;  2O5J C;  3R2T A;  4IJH A;  1HZC A;  4PNY A;  2E2J B;  4JBW A;  1VQA A;  4DR3 Q;  3MC0 B;  4R4Q A;  5C0X H;  4JG2 A;  3A5Z B;  3ULJ A;  1N32 L;  1D5M C;  1MI2 A;  4PZ8 A;  2PCF B;  2K5Q A;  3KLW A;  3TRZ A;  3MZ5 A;  4JC0 A;  4DAP A;  5C3W A;  4X65 L;  1LO5 D;  1U4M A;  1I6V C;  3C46 A;  3TZU A;  2B2W A;  4J8Q A;  4LJZ C;  2J0T D;  3PO2 H;  2R7D A;  2A68 C;  2N88 A;  4CDF C;  1QE6 A;  4GLA C;  2D2C C;  3OWE B;  3S1R B;  1STN A;  3I8Z A;  4A3M G;  3MVV A;  5A35 A;  4KN7 C;  1IL8 A;  3E9I A;  2L0C A;  3QJY A;  1QUQ A;  3W1G A;  1U5K A;  2JEB I;  1IBK Q;  3CD6 A;  4DV2 L;  1QB5 D;  3SR1 A;  5LMU Q;  2OF1 A;  4CKE A;  3GTJ H;  4NMZ A;  2VY3 A;  4ALP A;  1I94 Q;  4JI4 Q;  3NTK A;  1B9N A;  3BVM A;  4JI3 L;  1S5D D;  3PO3 H;  3NBH B;  4ZAI A;  2H5X A;  1ESF A;  1Q8K A;  3GV3 A;  3OOC A;  3CAM A;  5TSS A;  1YJW A;  1VQK A;  2F0P A;  1PDQ A;  4AQY L;  1YJN A;  2NZO A;  2OXP A;  3ONA B;  4B9W A;  3EBE A;  2I0Q A;  1PLF A;  3HOW G;  1ILP A;  1CKN B;  4KN4 C;  1YIJ A;  2O4X A;  3RLO A;  2K52 A;  2BE5 D;  1B1Z A;  4DAM A;  3E5S A;  2JJQ A;  3RZO B;  4I65 A;  2JA5 H;  2YTX A;  3TP8 A;  2DUD A;  2XRQ D;  1IL2 A;  1LAC A;  1QUQ B;  4BY7 B;  1L1O C;  1AE2 A;  4OIK A;  4YY3 L;  5ISR A;  1SXT A;  2I5H A;  4RG1 A;  3NWS A;  3EA6 A;  3MFG A;  2VXW A;  1Q81 C;  1EIH A;  2XWB B;  1KAA A;  4PMB A;  4IFD G;  1K0R A;  1PH1 A;  2RCN A;  5IT9 L;  4XT3 B;  1KLG D;  3Q24 A;  5L37 A;  4GZY C;  3V2T A;  3PF5 A;  2JA7 B;  1F2Z A;  1E0B A;  3JAM c;  2PI2 E;  1PXU A;  1RJT A;  2B2U C;  5BN5 A;  2L5T A;  1XYI A;  5IP7 H;  4XQN A;  1HZA A;  3UE1 A;  3K0Y A;  2R93 G;  3TS2 A;  4A93 G;  1NY4 A;  4A3D H;  4A3G H;  2VZA A;  1QG7 A;  2RHQ B;  2ZJQ A;  4OWW B;  1K83 H;  3D4W A;  4RA8 A;  4L8J A;  2NB0 A;  4DV1 L;  3RR5 A;  1MJE A;  1D1K A;  1BVS A;  3ICE A;  1UUP A;  1QVF A;  3W2D A;  3GTM H;  5C6A A;  3J7A V;  4OO1 H;  4IPH A;  4EQO A;  1M90 C;  4C3H H;  2NVQ B;  2RDH A;  5DM7 3;  1D8L A;  5FJ8 G;  3GTG H;  4IFD I;  4Q0F A;  1EY5 A;  3H0G G;  4CKC A;  3KF8 B;  4KMU C;  4DR3 L;  1PFM A;  5C3E G;  1II3 A;  2NN6 I;  2EYP A;  2Z8L A;  3CRL C;  2JA8 H;  2PNR C;  1V9P A;  1TWA H;  2EJF C;  2B63 B;  1RKN A;  2QW7 A;  4ILW A;  4K5V A;  1SMY D;  2Q2T A;  1K8A C;  1VF7 A;  1HNX Q;  5GAG C;  2F3V A;  2KHI A;  2B2T C;  1PYB A;  1J5E L;  1O7I A;  3NP8 A;  1W2B A;  3KYH C;  4FF4 A;  5EAY A;  5I9O A;  1I4H A;  2ICI A;  5IYC H;  1N9W A;  3S24 A;  4R4I A;  2Y0S E;  1IBK L;  3IRB A;  1VS0 A;  4F8M A;  4JI4 L;  1I94 L;  3TSS A;  4X6A H;  4L5T A;  3VR4 A;  4BBS G;  2CW0 D;  1KIX A;  1PTO H;  2EYF A;  3TZD A;  2LFN A;  2OQ0 A;  1DON A;  2F0V A;  1W6J A;  4YWL A;  1Q82 C;  5CMD A;  2K5W A;  3A54 A;  3RD4 A;  3RN5 A;  3I91 A;  4A3B G;  1PRT C;  4AYB E;  3OIP A;  2NZH A;  3DLL A;  2KCT A;  4JOI A;  1EQR A;  5C5M A;  5EKI A;  1EY8 A;  2AUK A;  4ZYS A;  4JCV E;  2Q2I A;  2IX1 A;  4ZLT F;  1QNK A;  4PG3 A;  3KF6 A;  1LTA D;  1O7Y A;  4A3I H;  3FPP A;  3H09 A;  4KD3 A;  4I7Z C;  5ELF A;  1WTW A;  4DXG A;  4A3L H;  2HD3 A;  5LL6 S;  1D5X C;  1FNU A;  2NBF A;  2Q2H A;  1LT4 D;  4FP5 D;  4ZUJ A;  5FLX E;  1I4Q A;  1EYG A;  4IPD A;  2CWA A;  3A74 A;  2OT2 A;  4PQX A;  3I4M B;  5C4X B;  1R4P B;  2K7V A;  5T1G A;  1HFG A;  1WTX A;  3FHW A;  4P74 A;  1NMG A;  3RZD H;  2VUM G;  1PA6 A;  2AQ2 B;  4HTH A;  1EZ6 A;  3CPW A;  1IBL Q;  1K8M A;  5EPJ A;  2NVX B;  2RVL A;  1VQE A;  2IW3 A;  2RDF A;  5CV9 A;  1MSG A;  3BYY B;  3MEF A;  3AQQ A;  5FLM H;  4BBR B;  1IW7 D;  4MN3 A;  2WFW A;  2FFK B;  1A2U A;  3FDT A;  5LMN Q;  1NE3 A;  4EGV A;  4RAU C;  2CH4 A;  2QDB A;  2VW9 A;  1Z9F A;  1LTR D;  5C4Z A;  1TII D;  4DR7 Q;  4M8A A;  1XPR A;  3E3X A;  3L7Z C;  4A3C H;  1PH6 A;  2XNA C;  1AP0 A;  1A6X A;  4ZKC B;  1HA6 A;  1ZYR D;  1PVO A;  4HJ8 A;  2FJ2 A;  1A62 A;  2KOL A;  1QOH A;  4IUN A;  3Q8D A;  2Q8I B;  1EQT A;  1UE6 A;  2G5D A;  1K28 A;  1Z47 A;  2G9H D;  5JPM C;  2K14 A;  1PTO C;  1HNX L;  4OON A;  4KY5 A;  1D6E C;  4XIG S;  5EPK A;  4X3U A;  1NR2 A;  4NDX A;  1CHP D;  2HIV A;  3SEB A;  4L5Q A;  3OYY A;  4HCS A;  2WAQ G;  2JN4 A;  3SK5 A;  3Q0A A;  1PH9 A;  1EWH A;  4JI0 L;  3ITP A;  2MHV A;  1TWG H;  1TWH H;  4OEM B;  5DM6 3;  4HIM A;  2HHH Q;  1VCI A;  2AUJ D;  3U50 C;  3G6E A;  4DR6 Q;  4TKO B;  3BZC A;  5GQO A;  4DAV A;  5J1Z A;  3S1N H;  4A3F B;  1Z6H A;  1ILQ A;  1OXX K;  1HNW Q;  2F0F A;  3NEN A;  3M3Y B;  3AU7 A;  4LUO A;  5DLQ E;  2YU9 H;  3KK7 A;  4B3T Q;  2GVB A;  2I46 A;  2DNC A;  3HKS A;  4UP9 A;  1BBU A;  2YTV A;  1X9N A;  2QDL A;  3JAM L;  1I5F A;  3E6Z X;  2WP8 J;  4POF A;  5M9O A;  3G6J B;  1EIG A;  1ET6 A;  2R6G A;  2RF4 A;  1PH5 A;  5K5P A;  1K9M C;  3VA5 A;  2PZT A;  3GP7 A;  2OQK A;  5IGF A;  4JI6 Q;  4GLX A;  3DWP A;  1GUT A;  2TSS A;  3DXJ C;  1FGB D;  4A3J H;  3SDZ A;  4K14 A;  3BDL A;  4RGM A;  5FLX L;  1XWE A;  2PNH A;  3KLS X;  4PZ7 A;  4DR5 Q;  5JPN C;  3D3R A;  3QG1 A;  1WVL A;  3TME A;  1KHI A;  1RIP A;  3PUY A;  3CME A;  2KCC A;  4FF1 A;  1HUM A;  4IPG A;  1JT8 A;  2BA1 A;  4OXP A;  1XPO A;  1SE2 A;  4ME5 A;  3F2U A;  1IBL L;  3E0J A;  1E2V A;  2SNS A;  3NPP A;  1O78 A;  2DY8 A;  2L55 A;  2UXC Q;  3DMU A;  4KK7 A;  4QCL A;  3C3L A;  2UUC Q;  1H9R A;  1VQJ A;  4HN7 A;  1K73 C;  5JEA G;  1L1O A;  1B3A A;  4CHT B;  1Y1W B;  1C7Y A;  2Z4I A;  2MNA A;  3HKZ B;  3UDG A;  1H9S A;  1DJR D;  5IWA Q;  3D31 A;  1XNQ Q;  5LMN L;  1SFO H;  4FXD A;  1R9T H;  3CCJ A;  2HT1 A;  4H7B A;  4N8X 1;  1H9M A;  3DUZ A;  1SYE A;  4DR7 L;  1BCP C;  1LTG D;  1S40 A;  2HDM A;  4G7H C;  5NUC A;  4TQU S;  2B2U A;  4LF4 Q;  3BDO A;  3M7G A;  3CF5 A;  4KJN A;  1NTG A;  4L5S A;  1TQO A;  1CK1 A;  3J80 c;  1GHK A;  3HOW H;  1ICF B;  2R3Z A;  5JEA J;  4H0L C;  1E7Z A;  4UP7 A;  4XYQ A;  3URY A;  4AH6 A;  2UXD Q;  1AH9 A;  5IGG A;  3K5O A;  5IT9 c;  1BO0 A;  3JAM i;  1XNR Q;  1P16 A;  3S2D H;  3LWE A;  1AFP A;  1Q12 A;  1WCM B;  2MUY A;  4LFB Q;  3RLF A;  3I55 A;  3S17 H;  1EY9 A;  3O13 A;  2HHH L;  1K8O A;  4OX9 Q;  1LTT D;  1XTC D;  4LF6 Q;  1Y1V B;  4DR6 L;  2ASB A;  1EEI D;  2K5N A;  4MTN A;  4X62 Q;  1HNW L;  5FO9 B;  1N32 Q;  2VNU D;  4K6D A;  4JI8 Q;  1TWC H;  1M4V A;  4B3T L;  2K5V A;  2EY1 A;  2R93 H;  4A93 H;  4GOP A;  3MXN A;  5JJZ A;  4G4K A;  3BS1 A;  3HOZ B;  5C4J H;  4B08 A;  1TY0 A;  1XXG A;  4BS9 A;  1YNN C;  2A6H D;  5FO8 B;  4KHZ A;  1F2M A;  1ZEQ X;  2YTY A;  3OHX C;  5KGU A;  1MKH A;  2EYM A;  2VQF Q;  2JA7 G;  1M8A A;  3WOE A;  5M5Y H;  3B6Y A;  3MHB A;  3WWV A;  3MAQ A;  2F0W A;  2Z1C A;  2F3I A;  4DR5 L;  2L9H A;  1CFM A;  5FJ8 H;  2JE6 I;  4K8J A;  1FJG L;  3H0G H;  3AEV A;  2PQA A;  3GTJ B;  1GVP A;  5C3E H;  4LNQ A;  2HCI A;  3PO3 B;  4C2M H;  2PPB C;  4JW0 A;  2R7Z B;  5KYI A;  4P73 A;  1LAB A;  2WV6 D;  1SYB A;  1K3R A;  1STY A;  4A3K B;  1I3Q H;  1JE4 A;  3STB C;  2UXC L;  3FEW X;  1SE4 A;  1WTR A;  4QL5 A;  5IOC A;  1YBY A;  1UWV A;  5FO7 B;  3TRE A;  3MFY A;  5CR3 A;  2K6A A;  2D9U A;  2OWO A;  2F0I A;  2WB1 B;  1N36 L;  2CQO A;  5IWA L;  1TKW B;  4POG A;  1JWM D;  3D4R A;  3F8T A;  1XNQ L;  2KUM A;  1HNZ Q;  1KLU D;  3CP0 A;  2B63 G;  4RCN A;  3S1Q B;  3R93 A;  3FKI B;  4Y52 H;  4BBS H;  1E2Z A;  1SJH D;  1PRT B;  2QEX A;  4LF4 L;  1U4P A;  3NXW A;  5IYB G;  4J15 A;  1XMQ Q;  3S14 H;  4A3B H;  2AWN A;  1HFN A;  4KY7 A;  1N8R C;  2L12 A;  1HQR D;  2EDG A;  3WDN A;  3FPU B;  1GUG A;  4BWG B;  1VQB A;  5LMN W;  2PW7 A;  1CZW A;  1NCV A;  2LXK A;  4GN5 A;  3J7Z C;  1PH7 A;  4A3D B;  1Q46 A;  2JA6 G;  4DK1 A;  2L15 A;  1GO3 E;  1A8V A;  4YIJ A;  5C44 B;  1XNR L;  3HOU B;  2E8G A;  4O1N A;  1EQQ A;  2E5L Q;  4TSS A;  4LFB L;  2B8F A;  5M3F H;  2B29 A;  1PV4 A;  4I7A A;  2V4D A;  1ROD A;  3AFQ A;  3GTM B;  1JOK A;  3J81 j;  4OX9 L;  2X69 A;  4LF6 L;  4C3H B;  4N8F A;  2ZXO A;  1B3Q A;  2VB2 X;  3K58 A;  4R4T A;  4L5R C;  4LUV A;  4G7Z C;  4ZQ3 A;  2KEN A;  2R92 G;  4X62 L;  1CZG A;  1EY7 A;  3NBH A;  4JI8 L;  2JA8 B;  3D6W A;  1TWA B;  3VYR A;  3D4D A;  3L3O C;  2QCP X;  1CI3 M;  4WJ3 M;  5KRU A;  1GUN A;  3CCU A;  1CKN A;  1J5E Q;  2BCO A;  4K2K A;  1PZI D;  1FD7 D;  2VQF L;  3I4M G;  2UUB Q;  5C4X G;  3SVM A;  2K03 A;  2IHF A;  3D8G A;  3KDF B;  2IX3 A;  5IGC A;  5ELE A;  3RN2 A;  1HUN A;  4C3I G;  4K8I A;  1BKB A;  4QIW B;  5A2Q E;  3OWF A;  3CCV A;  1PTO B;  2ZJP A;  1YHA A;  3HRZ C;  4KTA A;  3HFZ B;  3TP7 A;  2PQE A;  2Y0S B;  4WRD A;  3E9H A;  2WAQ E;  1STH A;  2EY5 A;  2R61 A;  2NYZ D;  2AHO B;  1B7Y B;  3S1M H;  1SLJ A;  3A55 A;  3N6R A;  1LT3 D;  4JV5 Q;  1VMC A;  3U58 A;  5CC4 A;  1WTO A;  3H91 A;  3J80 L;  4RGT A;  4DU9 A;  4H44 C;  4MTK A;  4XQQ A;  3U9S A;  1X3P A;  4M1U B;  5IGE A;  1ESR A;  1TR5 A;  2JYO A;  2KVM A;  4AYB B;  1HNZ L;  1BF4 A;  2N55 A;  2PMZ B;  1B44 D;  3H15 A;  1JR0 D;  3I4N B;  3I4O A;  1F77 A;  1CTM A;  2WAC A;  2XSC A;  4QUF A;  2AMC B;  4JI2 Q;  3HZX A;  3I70 A;  1SNM A;  3OTO Q;  1WJJ A;  1YIT A;  2K4K A;  2HCC A;  2M00 A;  1SJE D;  2A19 A;  2NN6 G;  2NVT B;  1XMQ L;  4WJ4 A;  2Z6B A;  3MWY W;  1V1Q A;  4C1N K;  5AJ3 Q;  3KF8 A;  1HH2 P;  2JEA I;  1GM5 A;  1X3G A;  2RHS B;  1S3O A;  2QGQ A;  2PZW A;  2EY6 A;  1FGU A;  1I6H B;  5FLX c;  2J7Z A;  1YEZ A;  1IXR A;  5GAD C;  4ZCK A;  3GTP H;  2X6G A;  4IFD J;  2E5L L;  4A3F G;  1SNP A;  1KNA A;  1H95 A;  1CQV A;  4DUZ Q;  1SNQ A;  1D1I A;  1O7Z A;  1VQL A;  1KDC A;  5GRO A;  1A15 A;  4ID6 A;  2F3W A;  4OGQ C;  1X54 A;  5I2Y A;  2EPB A;  2FXQ A;  4FF2 A;  2K1B A;  3PCO B;  1F2Y A;  1EY4 A;  3HOY B;  4FXG C;  2F0G A;  1DOL A;  5JJK A;  2NUC A;  4BY1 B;  3GTQ H;  5JEA H;  1HHV A;  1VQN A;  1MSH A;  4KHP Q;  4TVA B;  1HR0 Q;  1SNC A;  1NJI C;  4X66 Q;  2G9D A;  3G7L A;  2UUB L;  1BCP B;  1U4R A;  2VQE Q;  1MHW C;  3GQB A;  4A76 A;  4HJA A;  1EOV A;  3J80 i;  5IP9 G;  1WTQ A;  1SMX A;  4GKJ L;  3A7A B;  1BBX C;  2F0K A;  3K8A A;  2RA4 A;  4RHR A;  4DV4 Q;  1VQ7 A;  3NBI A;  1RDP D;  4JI0 Q;  2L4N A;  4PZ6 A;  3S16 H;  1TWG B;  5J3B A;  1TWH B;  5IYD G;  1M1K C;  4CJ2 C;  3U4Z A;  3H3V I;  3ULP A;  3P75 A;  1XX8 A;  3KFU A;  4FYD A;  1K0S A;  3PF4 A;  1RF2 D;  3LWU A;  1XMO Q;  3S1N B;  1CQF A;  1KRS A;  1PHJ A;  4RGO S;  2EYO A;  1OXV A;  4DUY L;  2YU9 B;  1HCZ A;  5CV8 A;  1IBM Q;  3LX0 A;  1BBW A;  2J4X A;  5E4W C;  4JV5 L;  3M4Q A;  2YV5 A;  1KQS A;  4C3J G;  1XJV A;  3TEH B;  4NXN Q;  2F0O A;  2HQL A;  3KJO A;  4LF5 Q;  4C1N I;  1PRT D;  1YZ6 A;  3RUZ A;  5AFW A;  3OSO A;  5M5X H;  3SK8 A;  3BDC A;  3HGB A;  3VR6 A;  4JI2 L;  2IL8 A;  2CCZ A;  2K33 A;  4QJF A;  3TDQ A;  3OTO L;  1QJO A;  3SXH A;  3RZO H;  2MPM A;  1BXT A;  2Q8T A;  4R1J A;  5AJ3 L;  4BXX G;  1EFI D;  1E2W A;  3QOL A;  5ELC A;  3NQI A;  1JJG A;  2B2Y A;  3S2H H;  4GNX C;  3A8J E;  2KED A;  1WCM G;  1V1P B;  1SEB D;  3X3M A;  4JI1 Q;  3VDY A;  1K8G A;  3VYU A;  2A69 D;  1KC8 C;  3PV0 A;  1Y1V G;  1A3V A;  2JA7 H;  3CHB D;  3NHH A;  1VQF A;  3HOV B;  3S9W A;  1MD2 D;  5C0X G;  4KJO A;  4J1M A;  4IZ8 A;  1FVI A;  1IW7 C;  1PRT F;  4X3S A;  1R9T B;  3K5M A;  4DUZ L;  1QVC A;  3W5O A;  3GTL H;  1Y14 B;  4DA2 A;  4A3E B;  3I90 A;  5EGT A;  1B70 B;  4KY6 A;  2BDO A;  3HOZ G;  2KEC A;  3MXU A;  3PIO A;  1FL0 A;  3MXP A;  2O2L D;  4GS3 A;  1A3U A;  1IHZ A;  1ZYR C;  1G29 1;  2EJM A;  2Q2U A;  4GKK Q;  4KI0 A;  4CGY B;  2B2V C;  2RBM A;  2XWJ B;  3HOW B;  4HJ5 A;  5CV7 A;  1YVC A;  1S5E D;  5EBD A;  4K5X A;  2E76 C;  2QF7 A;  2K01 A;  4PMC A;  1A3T A;  1IYJ B;  2NVQ H;  2OEO A;  2F0M A;  4NW2 A;  4U67 3;  4KHP L;  1HR0 L;  4JBJ A;  4X66 L;  4DR1 Q;  4IUP A;  1IKL A;  2KBN A;  4DKA C;  1QCB D;  2VQE L;  1BOS A;  1V1O A;  1I50 H;  4DV5 Q;  1WOC A;  1QZG A;  2IPK D;  2DJG C;  2B63 H;  1S4Z A;  3S2D B;  2R7Z G;  1HZ9 A;  1NNX A;  1R4Q B;  3IFT A;  1IKM A;  2VB3 X;  2KCN A;  1HJP A;  5M3M G;  4DV4 L;  5ELO A;  1T5X D;  1T9H A;  2FIN B;  3V05 A;  1CUK A;  2QIL A;  1ZXT A;  2F0L A;  5C0X I;  4A3K G;  3S17 B;  3TN2 A;  1DM0 B;  4H02 A;  1B2T A;  3W1B A;  5IYB H;  3S15 H;  1EOT A;  1JJC B;  2B2W C;  1EY6 A;  1IZ6 A;  1XMO L;  5JVG 3;  4UY8 C;  1Q1E A;  1FYC A;  2WB1 G;  4GLV B;  3G48 A;  2XTI A;  4KV6 A;  1TWC B;  1EIF A;  1GUO A;  1OO9 B;  4NKL A;  1IBM L;  3CQZ B;  2EZV A;  4A93 B;  4MIU A;  2JA6 H;  3FKI G;  3NQT A;  5BN4 A;  5C4J B;  4O2D A;  2F0H A;  4NXN L;  3U9O A;  4JK1 C;  1JE5 A;  1GKH A;  5D14 A;  1PZJ D;  2MO0 A;  4L63 B;  4LF5 L;  3ULL A;  4F87 A;  2QKI C;  4LF8 Q;  2KQ3 A;  4YWK A;  1EU3 A;  1X3E A;  1PYS B;  1Y8N B;  2GN5 A;  2K04 A;  1FJG Q;  1DZ1 A;  2F4I A;  4EQP A;  2R92 H;  4C2M B;  1EIY B;  1X56 A;  5CBE E;  1OTC A;  2B3G A;  5C44 G;  3K7A B;  3HOU G;  4K6L A;  1DD2 A;  1WD0 A;  4XYO A;  1PFB A;  1PYW D;  1LV9 A;  4JI1 L;  1B50 A;  3BYT B;  2Z6K C;  1VQD A;  4C3H G;  3RLN A;  2K5H A;  1HTP A;  5I6Y A;  3I4M H;  1LTS D;  4LMQ D;  4HJ9 A;  5C4X H;  3N52 A;  1Y69 U;  4A3M H;  4KKT A;  3EQL C;  1N36 Q;  2P5Z X;  2K28 A;  5FK9 C;  1PFN A;  2OTJ A;  4C3I H;  1A2T A;  1J6Q A;  4BA1 I;  1F9S A;  2NVX H;  4BBS B;  5I2X A;  3M4O H;  2D62 A;  3CCQ A;  2F0E A;  2RDG A;  1UNS A;  4QQB X;  3BU2 A;  3X3N A;  2OCE A;  3T51 B;  4GKK L;  2UU9 Q;  3ERO A;  3S14 B;  4EVO A;  2EVB A;  3CCM A;  2A74 C;  1DOM A;  1U0L A;  3NEL A;  3T53 B;  2BA0 A;  1EWC A;  4LF7 Q;  1VQC A;  2NTT A;  1G6Z A;  1SE3 A;  3Q22 A;  1A63 A;  2N8N A;  3M7N A;  4DR1 L;  3KOJ A;  1C48 A;  3PUZ A;  4ZUI A;  4DV5 L;  3UE0 A;  3CRK C;  4LWC A;  4DGZ A;  3HOX B;  4NPS A;  3L9A X;  1L2F A;  4WFN 3;  2E2I H;  2CFM A;  3PQI A;  4IFD H;  5M3F B;  4OWT B;  1JCK B;  4DF7 A;  3JC6 6;  4UDU C;  4HED A;  2LY7 A;  2NN6 H;  5IIF A;  3QR8 A;  3NEM A;  3SGI A;  3G4S A;  1TS3 A;  3CCR A;  3PSI A;  3A8I E;  2RSN A;  1HR0 W;  2C5C A;  1SYC A;  3RNU A;  4BY7 G;  1IYV A;  2L11 A;  3J81 E;  2EY2 A;  2B2T A;  4S3S A;  2QEJ C;  3I4N G;  4DN4 M;  1BCP F;  4IQZ A;  1WTH A;  4YCV A;  2ZTE A;  3U4V A;  3PO2 B;  3TP5 A;  5EQ0 A;  3SK6 A;  4A3F H;  3W3A A;  3HP3 A;  5EKL A;  1RTN A;  3OPO A;  1AW7 A;  4DAY B;  4LF8 L;  5COR A;  2ZM6 Q;  3H3V H;  3K80 C;  4RWS C;  2PW5 A;  3MA2 B;  2JSO A;  2RCF A;  2OTL A;  3PUW A;  4OWX B;  1YNX A;  1YNN D;  3FRP B;  3ERQ A;  2BH2 A;  3RMH A;  2WKD A;  4KLK A;  4RKL A;  2I5L X;  1JQY D;  4JI7 Q;  3IKJ A;  3BVG A;  3P20 A;  1W6K A;  2A6E C;  3OW7 A;  4ME3 A;  5FLM G;  1F9R A;  5KIX A;  5CV5 A;  5HUR A;  3UDX A;  2GVA A;  1O7L A;  1WFQ A;  1WTV A;  4FF3 A;  4LK1 C;  3GTK H;  4IOC A;  3QO2 A;  1U9R A;  2BH8 A;  1NSN S;  4DNI A;  4YCU A;  1PH2 A;  2JA5 B;  4JVZ A;  2PI2 A;  2YYZ A;  3MXG A;  3ND9 A;  3STB D;  2SDF A;  2ALY B;  2DN8 A;  5IYD H;  1VDZ A;  5IOD A;  3NE5 B;  2AQ1 B;  2ICE C;  3HOY G;  1L0X B;  1NAP A;  2HQE A;  2NTS A;  1Q86 C;  1YNJ C;  5KNC A;  5HY6 A;  4BY1 G;  5K36 G;  3OMC A;  3G71 A;  3AYH B;  5M5W H;  1VQ8 A;  5HGQ A;  2UU9 L;  1B9M A;  4B3R Q;  4CKB A;  4X64 Q;  3PIO 3;  2K5D A;  4LF7 L;  4HCE A;  3A7L A;  1KAW A;  4RMF A;  1FNW A;  4ULL A;  3BZK A;  4H13 C;  1JOQ A;  3OMG A;  1VQ5 A;  4C3J H;  1HA5 A;  2NVY H;  4XTC S;  5C5L A;  3Q6S A;  4A3G B;  1X65 A;  2UXB Q;  1K83 B;  2B8G A;  1KDA A;  2KA7 A;  3ND8 A;  1BDO A;  3GTP B;  4MNO A;  4C56 C;  2DY7 A;  3OIQ A;  5JAV A;  1UE7 A;  1RL2 A;  4JYA Q;  5I6W A;  4WOR A;  3IAY A;  1E1O A;  5IGD A;  2ZTD A;  3KDF A;  3NWT A;  1EUJ A;  4HSP A;  2JXM B;  1KTK A;  4GNX B;  4EQ5 A;  3GTG B;  4BXX H;  1H9K A;  2A1A A;  3NTH A;  1Y8O B;  2VUM H;  5COY A;  1TT2 A;  2AKW B;  2BDN A;  3J81 L;  2IHE A;  4UAI A;  3QOJ A;  1WCM H;  4P71 A;  3DEP A;  2CKZ B;  4U68 A;  1VF5 C;  4LFC Q;  1HZB A;  1ONL A;  3VYT A;  4NP5 A;  2D5D A;  1Y1V H;  2ENB A;  4K5W A;  1STE A;  1AZP A;  1MBY A;  3K6O A;  4YWM A;  1SYF A;  4IUR A;  4DNT B;  2HUG A;  4JBK A;  2ZM6 L;  4BA2 I;  1JOO A;  3Q23 A;  4GKJ Q;  4KKU A;  1QNU A;  4MZ9 A;  1LT5 D;  4IN3 A;  4APV A;  3I3C A;  4QUC A;  3S16 B;  5LL6 X;  3HOZ H;  2A68 D;  4P2C B;  4LF9 Q;  1J8I A;  4HMI A;  5CV4 A;  1CKO A;  4JI7 L;  5BR8 Q;  1JWU D;  3QB3 A;  4Y7N H;  4ABN A;  2BOS A;  4BBR G;  4CBV A;  1SNO A;  3HOV G;  1G8Z D;  1GOZ A;  3ZJY C;  1TVX A;  4DUY Q;  1SAP A;  1L0W A;  5JJL A;  4A3E G;  2D0O A;  3DEO A;  3C1E A;  2BE5 C;  4LAA A;  2DGY A;  1SBB B;  4RKB A;  4DV6 Q;  1X3Q A;  3DM3 A;  5J39 A;  1JMC A;  2R7Z H;  2LKV A;  3GTO H;  1E22 A;  1VQO A;  2WB1 E;  5M3M H;  4A3K H;  5JOB A;  4A3I B;  2WII B;  1OXS C;  5J22 A;  2ZJR A;  2L1B A;  5M5X B;  1QIL A;  1ENF A;  1F9Q A;  3T4A C;  5C3X A;  5GAH C;  1HQM C;  3FP9 A;  3I73 A;  3UDF A;  1DCZ A;  2AQ3 B;  1D2B A;  4ZKB B;  1STA A;  3CU7 A;  4LFA Q;  2O5I C;  3PGZ A;  4B3R L;  1TWF H;  3CC4 A;  4X64 L;  2FMC A;  3RZD B;  2LSS A;  4WJW A;  2E2H H;  1VQP A;  3S1Q H;  1V43 A;  3FVQ A;  5D3D A;  3AFP A;  3S2H B;  2Z6K A;  1CKM A;  1EY0 A;  2M2L A;  3FKI H;  4V0B A;  3J81 i;  1G6P A;  3AB9 A;  4XDX A;  1TS5 A;  3GO5 A;  2XIW A;  4HSV A;  2UXB L;  2E74 C;  5EJW A;  1UAP A;  1STB A;  4QF4 A;  1AEX A;  2A8V A;  1DXM A;  1RTO A;  1EWI A;  1KD1 C;  3GDE A;  4JYA L;  3EVQ A;  1S5C D;  4MHE A;  2H1E A;  4CJ1 B;  3C1F A;  1Q8I A;  4O0A A;  5CYU A;  1KXL A;  4HMJ A;  3GTL B;  1ICW A;  5C4H A;  3H6M A;  5F2D A;  5FOB B;  3FMC A;  1VQH A;  1PH3 A;  2SOB A;  4NXM Q;  5C44 H;  4R4O A;  3HOU H;  1T5E A;  5GAE C;  2KEE A;  1WD1 A;  2Z0S A;  1F2L A;  1HPC A;  1OXU A;  3PIP A;  3J7A 5;  4O42 A;  5ELD A;  3T13 A;  2CH4 W;  4LFC L;  2KCM A;  4A4I A;  1JB3 A;  4IJL A;  4OHJ A;  4B3S L;  3NTI A;  3K5N A;  4B3M Q;  1SMY C;  4DV0 Q;  5D3I B;  2SEB D;  4DNR B;  3T56 B;  4E6I A;  2E2J H;  3VR2 A;  2A73 B;  1MGS A;  1IYU A;  5EPL A;  4DFA A;  3J7Y W;  4N9T A;  1V8Q A;  5E1F A;  1LTL A;  1I50 B;  3EIV A;  4EQN A;  1S5F D;  1NR4 A;  1Q1B A;  2MJ8 A;  5DNF A;  2EYJ A;  2KJX A;  1VQI A;  5A2Q L;  5FKA C;  3PUV A;  1TU2 B;  4LF9 L;  4GN4 B;  4QIW E;  5BR8 L;  3S15 B;  2A5H A;  5IGB A;  4GOP C;  1G51 A;  2CW0 C;  1NUC A;  3LNN A;  1G91 A;  3MEH A;  2MP1 A;  4KD4 A;  1Y1W G;  4DK3 C;  3V96 A;  1CHQ D;  3S1R H;  1VMP A;  3HKZ G;  2F0U A;  1F9P A;  1X3F A;  4RFB A;  4HR7 B;  2KHS A;  3A5U A;  1RD9 D;  4HIO A;  4Q5V A;  3GV6 A;  3F1Z A;  4XT1 B;  1GJX A;  1UE1 A;  2C35 B;  5LMU L;  1YJ9 A;  3H94 A;  2JA6 B;  1P8L A;  1V1P A;  1CA5 A;  3TP6 A;  1HRJ A;  4DV6 L;  2LS0 1;  3I2Z A;  1B8A A;  4DK0 A;  1QVG A;  2ZT9 C;  1VQ6 A;  4A3J B;  3A56 A;  2NWG A;  4RGN A;  4IUQ A;  4R8N A;  1YHB A;  3I7F A;  1E3P A;  2PMZ E;  1JJ2 A;  2KHJ A;  3NUC A;  3K57 A;  4G57 A;  4AIM A;  2R7F A;  1JWS D;  2R92 B;  3JAM E;  4P75 A;  3HS0 C;  4LFA L;  2MQH A;  5JVH 3;  4BY7 H;  4KHV A;  3TQY A;  3ER0 A;  3DWA A;  2M9V A;  3R2I A;  4YCW A;  3HOX G;  3F2B A;  4PMW A;  4TRD A;  1TS4 A;  3I4N H;  1C0A A;  1KNE A;  5M3F G;  1LUZ A;  1PZK D;  4QMG A;  5DAU A;  2NVT H;  2A69 C;  4P72 A;  2IX0 A;  3LGJ A;  4QGU A;  4A3M B;  3BZD B;  3SHL A;  3K7U C;  1EL0 A;  3PMF A;  1DGS A;  1CSP A;  1GHJ A;  2XN9 C;  1SFO B;  4C3I B;  1QWY A;  3QWN A;  2XGT A;  3CW2 C;  2X6L A;  4X3K A;  1WTP A;  3P1H A;  2F52 A;  1I6H H;  3F2D A;  1GD7 A;  3M4O B;  2RKS A;  4GN3 B;  3KF6 B;  4NXM L;  4HJ7 A;  2JA9 A;  2K75 A;  3PO2 G;  1BQQ T;  4YHH Q;  1L0Y B;  3CMA A;  2F4V Q;  1ENC A;  1MJC A;  3DWQ A;  1YHQ A;  2HDL A;  3ERS X;  4V19 0;  4LUZ A;  1EYA A;  1PMR A;  1STG A;  2TMP A;  1KRT A;  1A0I A;  4XXE A;  3D6C A;  4B3M L;  5C0X J;  4DV0 L;  1N34 Q;  2MFI A;  4DK6 C;  2Q8R E;  5E3F A;  3PO3 G;  2Z4H A;  1EFW A;  4G7O C;  1I4X A;  3BVZ A;  3A0J A;  2E2I B;  3HOY H;  1PTO D;  4B9X A;  2ES2 A;  3HG9 A;  4BY1 H;  5K36 H;  3L0O A;  2H4O A;  1I4R A;  1C4Q A;  2SNM A;  3MTS A;  4DR4 Q;  5LHY 1;  1J9O A;  1ET9 A;  2JP1 A;  1S72 A;  2JA5 G;  3TBI B;  2B39 A;  2EJG C;  1CM9 A;  2ATW A;  3C2P A;  2R93 B;  4JPB W;  3BJU A;  1LTI D;  3CKI B;  3QIA A;  4A75 A;  4JI5 Q;  2DJF C;  4LW1 A;  4DV3 Q;  1LT6 D;  4UP8 A;  1XPU A;  2EE1 A;  1VQ4 A;  1EU4 A;  1SYG A;  5M5Y B;  2AWO A;  2EIF A;  2N3S A;  1DYQ A;  3J81 c;  2RSO A;  1TY2 A;  1KAB A;  2IJ0 A;  5IP7 G;  1PTO F;  4ODG A;  3K0X A; 
#chains in the Genus database with same CATH homology
 4ZRZ A;  3H0G B;  2EOT A;  5EKK A;  4DXF A;  3HEJ A;  3NK9 A;  5C3E B;  2NZ1 D;  3EJI A;  1AN8 A;  3VA7 A;  5T1I A;  5KEE A;  4J6H A;  1HTL D;  2PZU A;  1I3Q B;  5I9P A;  1UEA B;  2F0S A;  1SND A;  3BG3 A;  4OO1 G;  2IWH A;  3I72 A;  1ML0 D;  3KBG A;  2DNE A;  2K05 A;  1SSO A;  3GTK B;  1Q3L A;  2CQA A;  1G2S A;  3KLS A;  2XVS A;  2C9O A;  1S5B D;  4RHS A;  4F88 A;  1X32 A;  5CBA E;  1RHP A;  5KND A;  3M4Y A;  1BNZ A;  3A8K E;  1B53 A;  5M5W B;  2K32 A;  3VR3 A;  3ZYY X;  4A3B B;  5CGK A;  2PYK A;  3K59 A;  1BCP D;  1H9J A;  3PIP 3;  1LLR D;  4C3J B;  2NVY B;  1Z7T A;  4RCO A;  1BUV T;  4OO1 I;  3DM1 A;  4IUU A;  2F03 A;  1I4G A;  4IUV A;  1GUS A;  4DAY A;  2F0D A;  3PUX A;  4R8I A;  1FNV A;  1H9S B;  3NSW A;  5E4X A;  2VUM B;  4RH6 A;  5D65 A;  3J7A F;  4K2L A;  3EFX D;  1GXD C;  3T16 A;  5I4D A;  4N9P A;  4XQJ A;  2EXZ A;  3M85 A;  4OIJ A;  1D5Z C;  1JOR A;  2CVR A;  1BR9 A;  1RCV D;  2XRS D;  1EYC A;  3IL8 A;  1TS2 A;  5KNB A;  2A6H C;  1GUW A;  2GA4 B;  1AZQ A;  4X3T A;  4L6T B;  4F7X A;  1B4O A;  1JIC A;  3DHQ A;  1I4P A;  1DOK A;  2LMC B;  2F0J A;  3P7J A;  3K5L A;  4CJ0 B;  5KYL A;  4Y7N B;  1EYD A;  4Z9C B;  1CT1 D;  3VYS A;  1U4L A;  3KBX A;  3SE0 A;  5ELB A;  3S1M B;  2FMM A;  4FXK C;  4KKS A;  1FR3 A;  2CHB D;  4ZK9 B;  2A6E D;  3IFD A;  1EQV A;  2WAQ B;  3GTO B;  2RQX A;  1HXY D;  5M3M B;  1JC7 A;  2I07 B;  2MGS A;  1Y8P B;  5G3L D;  2F1M A;  4FO2 A;  4FVM A;  1LTB D;  2B2Y C;  2FHT A;  3KUP A;  2F0N A;  5BN3 A;  2E75 C;  3VR5 A;  2EYL A;  3J80 E;  1TWF B;  1OXT A;  2E2H B;  4PV1 C;  3AMU A;  1O80 A;  1YNJ D;  2F0Q A;  2IT1 A;  1G2T A;  1EZ8 A;  3SK4 A;  1C8C A;  5IT9 E;  4HAE A;  4OL7 A;  3R3O A;  1ENA A;  1ZKO A;  5CV6 A;  5EBC A;  1KDB A;  3I4L A;  4FNF A;  5HGT A;  5G3L F;  2ZXP A;  2ID0 A;  2PO4 A;  4IUT A;  1CA6 A;  1Q90 A;  2E2D C;  5DEH A;  3GD7 A;  2B2V A;  2WKC A;  1EEF D;  3H3V C;  2ZXR A;  3R8B A;  2EYH A;  3WOF A;  1SYD A;  3GTQ B;  2F0T A;  4R9W A;  3UI2 A;  4IAL A;  2WIN B;  2O5J C;  3KLR A;  4QB4 A;  1SDF A;  3R2T A;  2E2J B;  4PNY A;  4JBW A;  3MC0 B;  5C0X H;  1D5M C;  1MI2 A;  2PCF B;  2K5Q A;  3MZ5 A;  4DAP A;  5C3W A;  1LO5 D;  1U4M A;  1I6V C;  3C46 A;  3TZU A;  2B2W A;  4J8Q A;  4LJZ C;  2J0T D;  2A68 C;  2N88 A;  1QE6 A;  2D2C C;  3OWE B;  3S1R B;  1STN A;  3I8Z A;  3MVV A;  5A35 A;  4KN7 C;  1IL8 A;  2L0C A;  3QJY A;  2JEB I;  1QB5 D;  3SR1 A;  2OF1 A;  4CKE A;  4NMZ A;  3NTK A;  1B9N A;  3BVM A;  1S5D D;  4ZAI A;  1ESF A;  3GV3 A;  5TSS A;  3OOC A;  2F0P A;  1PDQ A;  2OXP A;  3ONA B;  4B9W A;  1PLF A;  1ILP A;  4KN4 C;  2O4X A;  2BE5 D;  1B1Z A;  3E5S A;  3RZO B;  4I65 A;  3TP8 A;  2XRQ D;  1LAC A;  4BY7 B;  4OIK A;  5ISR A;  1SXT A;  3NWS A;  3EA6 A;  3MFG A;  2VXW A;  1EIH A;  2XWB B;  1KAA A;  4PMB A;  4IFD G;  5IT9 L;  4XT3 B;  1KLG D;  3Q24 A;  4GZY C;  3V2T A;  2JA7 B;  1F2Z A;  1E0B A;  1PXU A;  1RJT A;  2B2U C;  5BN5 A;  2L5T A;  1XYI A;  4XQN A;  3K0Y A;  1QG7 A;  3D4W A;  4RA8 A;  4L8J A;  2NB0 A;  1D1K A;  1UUP A;  3W2D A;  3J7A V;  5C6A A;  4OO1 H;  4EQO A;  2NVQ B;  2RDH A;  5DM7 3;  4IFD I;  4Q0F A;  1EY5 A;  4CKC A;  4KMU C;  1PFM A;  1II3 A;  2NN6 I;  2EYP A;  2Z8L A;  3CRL C;  2PNR C;  2EJF C;  2B63 B;  1RKN A;  4ILW A;  4K5V A;  1SMY D;  1VF7 A;  2F3V A;  2B2T C;  3NP8 A;  4FF4 A;  5I9O A;  1I4H A;  2ICI A;  4F8M A;  3TSS A;  3VR4 A;  2CW0 D;  1PTO H;  2EYF A;  3TZD A;  2LFN A;  1DON A;  2F0V A;  1W6J A;  5CMD A;  2K5W A;  3RD4 A;  3A54 A;  3I91 A;  1PRT C;  3OIP A;  5C5M A;  5EKI A;  1EY8 A;  2AUK A;  4ZYS A;  2IX1 A;  4ZLT F;  1QNK A;  1LTA D;  1O7Y A;  3FPP A;  3H09 A;  4KD3 A;  4I7Z C;  5ELF A;  1WTW A;  4DXG A;  5LL6 S;  1D5X C;  1FNU A;  2NBF A;  1LT4 D;  4FP5 D;  4ZUJ A;  5FLX E;  1I4Q A;  2OT2 A;  4PQX A;  3I4M B;  5C4X B;  1R4P B;  2K7V A;  5T1G A;  1HFG A;  1WTX A;  2AQ2 B;  4HTH A;  1EZ6 A;  1K8M A;  5EPJ A;  2NVX B;  2RVL A;  2IW3 A;  2RDF A;  5CV9 A;  1MSG A;  3BYY B;  4BBR B;  1IW7 D;  4MN3 A;  2FFK B;  1A2U A;  3FDT A;  4EGV A;  4RAU C;  2QDB A;  1LTR D;  5C4Z A;  1TII D;  4M8A A;  3L7Z C;  1AP0 A;  2XNA C;  1A6X A;  4ZKC B;  1HA6 A;  1ZYR D;  2FJ2 A;  2KOL A;  1QOH A;  4IUN A;  2Q8I B;  1EQT A;  2G9H D;  1Z47 A;  5JPM C;  1PTO C;  4KY5 A;  1D6E C;  4XIG S;  5EPK A;  4X3U A;  1NR2 A;  4NDX A;  1CHP D;  3SEB A;  4HCS A;  3SK5 A;  3Q0A A;  1EWH A;  3ITP A;  2MHV A;  5DM6 3;  1VCI A;  2AUJ D;  4TKO B;  4DAV A;  5J1Z A;  4A3F B;  1Z6H A;  1ILQ A;  1OXX K;  2F0F A;  3M3Y B;  3AU7 A;  3KK7 A;  2I46 A;  2DNC A;  3JAM L;  3E6Z X;  2WP8 J;  5M9O A;  3G6J B;  1EIG A;  1ET6 A;  2R6G A;  5K5P A;  3VA5 A;  2PZT A;  3GP7 A;  5IGF A;  3DWP A;  1GUT A;  2TSS A;  3DXJ C;  1FGB D;  3SDZ A;  4K14 A;  3BDL A;  4RGM A;  5FLX L;  1XWE A;  3KLS X;  5JPN C;  3D3R A;  3QG1 A;  1WVL A;  3TME A;  3PUY A;  2KCC A;  4FF1 A;  1HUM A;  2BA1 A;  1SE2 A;  4ME5 A;  3F2U A;  3E0J A;  1E2V A;  2SNS A;  3NPP A;  1O78 A;  2DY8 A;  2L55 A;  3DMU A;  4KK7 A;  4QCL A;  3C3L A;  1H9R A;  4HN7 A;  5JEA G;  1B3A A;  4CHT B;  1Y1W B;  2Z4I A;  3HKZ B;  1H9S A;  1DJR D;  3D31 A;  4FXD A;  4H7B A;  1H9M A;  3DUZ A;  1SYE A;  1BCP C;  1LTG D;  2HDM A;  4G7H C;  5NUC A;  4TQU S;  2B2U A;  3BDO A;  3M7G A;  4KJN A;  1TQO A;  1CK1 A;  1GHK A;  2R3Z A;  5JEA J;  4H0L C;  4XYQ A;  3URY A;  5IGG A;  3K5O A;  1BO0 A;  3LWE A;  1AFP A;  1Q12 A;  1WCM B;  2MUY A;  3RLF A;  1EY9 A;  3O13 A;  1K8O A;  1LTT D;  1XTC D;  1Y1V B;  1EEI D;  5FO9 B;  2VNU D;  4K6D A;  1M4V A;  2EY1 A;  3MXN A;  5JJZ A;  4G4K A;  3BS1 A;  3HOZ B;  4B08 A;  1TY0 A;  1XXG A;  4BS9 A;  1YNN C;  2A6H D;  5FO8 B;  4KHZ A;  1F2M A;  1ZEQ X;  3OHX C;  5KGU A;  2EYM A;  1M8A A;  3WOE A;  3MHB A;  3MAQ A;  2F0W A;  2Z1C A;  2L9H A;  1CFM A;  2JE6 I;  4K8J A;  3GTJ B;  2HCI A;  3PO3 B;  2PPB C;  2R7Z B;  5KYI A;  1LAB A;  2WV6 D;  1SYB A;  4A3K B;  1STY A;  1JE4 A;  3FEW X;  1SE4 A;  1WTR A;  5IOC A;  5FO7 B;  3MFY A;  5CR3 A;  2K6A A;  2D9U A;  2F0I A;  2WB1 B;  1TKW B;  1JWM D;  3D4R A;  2KUM A;  1KLU D;  4RCN A;  3S1Q B;  3R93 A;  3FKI B;  1E2Z A;  1SJH D;  1PRT B;  1U4P A;  3NXW A;  2AWN A;  1HFN A;  4KY7 A;  2L12 A;  1HQR D;  2EDG A;  3WDN A;  3FPU B;  1GUG A;  4BWG B;  2PW7 A;  1CZW A;  1NCV A;  4A3D B;  4DK1 A;  4YIJ A;  5C44 B;  3HOU B;  4O1N A;  4TSS A;  2B8F A;  2V4D A;  1ROD A;  3GTM B;  1JOK A;  2X69 A;  4C3H B;  2ZXO A;  3K58 A;  2VB2 X;  4G7Z C;  4ZQ3 A;  1CZG A;  1EY7 A;  3NBH A;  2JA8 B;  3D6W A;  1TWA B;  3VYR A;  3D4D A;  3L3O C;  2QCP X;  1CI3 M;  5KRU A;  1GUN A;  2BCO A;  4K2K A;  1PZI D;  1FD7 D;  3SVM A;  2K03 A;  3D8G A;  2IX3 A;  5IGC A;  5ELE A;  1HUN A;  4C3I G;  4K8I A;  4QIW B;  5A2Q E;  3OWF A;  1PTO B;  3HRZ C;  4KTA A;  3TP7 A;  2PQE A;  2Y0S B;  4WRD A;  1STH A;  2EY5 A;  2R61 A;  2NYZ D;  3A55 A;  3N6R A;  1LT3 D;  1VMC A;  5CC4 A;  1WTO A;  3H91 A;  3J80 L;  4RGT A;  4DU9 A;  4H44 C;  4XQQ A;  3U9S A;  1X3P A;  4M1U B;  5IGE A;  1ESR A;  1TR5 A;  2JYO A;  2KVM A;  4AYB B;  1BF4 A;  2N55 A;  2PMZ B;  1B44 D;  1JR0 D;  3I4N B;  1F77 A;  1CTM A;  2WAC A;  2XSC A;  4QUF A;  3HZX A;  3I70 A;  1SNM A;  2HCC A;  2M00 A;  1SJE D;  2NN6 G;  2NVT B;  3MWY W;  4C1N K;  3KF8 A;  2JEA I;  2PZW A;  2EY6 A;  1I6H B;  2J7Z A;  2X6G A;  4IFD J;  1SNP A;  1KNA A;  1CQV A;  1SNQ A;  1D1I A;  1O7Z A;  1KDC A;  1A15 A;  4ID6 A;  2F3W A;  4OGQ C;  5I2Y A;  2EPB A;  4FF2 A;  2K1B A;  1F2Y A;  1EY4 A;  3HOY B;  4FXG C;  2F0G A;  1DOL A;  2NUC A;  4BY1 B;  5JEA H;  1HHV A;  1MSH A;  1SNC A;  2G9D A;  3G7L A;  1BCP B;  1U4R A;  3GQB A;  1WTQ A;  3A7A B;  1BBX C;  2F0K A;  4RHR A;  2RA4 A;  3NBI A;  1RDP D;  2L4N A;  1TWG B;  1TWH B;  4CJ2 C;  3P75 A;  1XX8 A;  4FYD A;  1RF2 D;  3LWU A;  3S1N B;  1CQF A;  4RGO S;  2EYO A;  1OXV A;  2YU9 B;  1HCZ A;  5CV8 A;  3LX0 A;  2J4X A;  5E4W C;  4C3J G;  2F0O A;  4C1N I;  1PRT D;  3RUZ A;  5AFW A;  3OSO A;  3SK8 A;  3BDC A;  3HGB A;  3VR6 A;  2IL8 A;  2K33 A;  3TDQ A;  1QJO A;  3SXH A;  2MPM A;  1BXT A;  2Q8T A;  1EFI D;  1E2W A;  3QOL A;  5ELC A;  3NQI A;  2B2Y A;  3A8J E;  2KED A;  1V1P B;  1SEB D;  3X3M A;  3VYU A;  2A69 D;  3PV0 A;  1A3V A;  3CHB D;  3NHH A;  3HOV B;  3S9W A;  1MD2 D;  5C0X G;  4KJO A;  4J1M A;  4IZ8 A;  1IW7 C;  1PRT F;  4X3S A;  1R9T B;  3K5M A;  4DA2 A;  4A3E B;  3I90 A;  5EGT A;  4KY6 A;  2BDO A;  2KEC A;  3MXU A;  3MXP A;  2O2L D;  1A3U A;  1IHZ A;  1ZYR C;  1G29 1;  2EJM A;  4KI0 A;  4CGY B;  2B2V C;  2RBM A;  2XWJ B;  3HOW B;  5CV7 A;  1S5E D;  5EBD A;  4K5X A;  2E76 C;  2QF7 A;  2K01 A;  4PMC A;  1A3T A;  2OEO A;  2F0M A;  4NW2 A;  4U67 3;  4IUP A;  1IKL A;  1QCB D;  1BOS A;  1V1O A;  2IPK D;  3S2D B;  1S4Z A;  1R4Q B;  3IFT A;  1IKM A;  2VB3 X;  2KCN A;  1T5X D;  3V05 A;  2FIN B;  5C0X I;  2QIL A;  1ZXT A;  2F0L A;  3S17 B;  3TN2 A;  1DM0 B;  1B2T A;  1EOT A;  2B2W C;  1EY6 A;  5JVG 3;  1Q1E A;  1FYC A;  4KV6 A;  1TWC B;  1GUO A;  1OO9 B;  4NKL A;  3CQZ B;  2EZV A;  4A93 B;  4MIU A;  3NQT A;  5BN4 A;  5C4J B;  2F0H A;  3U9O A;  4JK1 C;  5D14 A;  1PZJ D;  4L63 B;  4F87 A;  2QKI C;  2KQ3 A;  1EU3 A;  1Y8N B;  1DZ1 A;  2K04 A;  2F4I A;  4EQP A;  4C2M B;  5CBE E;  3K7A B;  4K6L A;  1DD2 A;  1WD0 A;  4XYO A;  1PFB A;  1PYW D;  1LV9 A;  1B50 A;  3BYT B;  4C3H G;  1HTP A;  5I6Y A;  1LTS D;  4LMQ D;  3N52 A;  1Y69 U;  4KKT A;  3EQL C;  2K28 A;  5FK9 C;  1PFN A;  1A2T A;  4BA1 I;  1F9S A;  4BBS B;  5I2X A;  2D62 A;  2F0E A;  2RDG A;  1UNS A;  3X3N A;  3T51 B;  3ERO A;  3S14 B;  4EVO A;  2EVB A;  2A74 C;  1DOM A;  3T53 B;  2BA0 A;  1EWC A;  2NTT A;  1G6Z A;  1SE3 A;  3Q22 A;  3M7N A;  1C48 A;  3PUZ A;  4ZUI A;  3CRK C;  4DGZ A;  3HOX B;  3L9A X;  4WFN 3;  4IFD H;  5M3F B;  1JCK B;  4DF7 A;  4UDU C;  4HED A;  2LY7 A;  2NN6 H;  5IIF A;  1TS3 A;  3A8I E;  2RSN A;  2C5C A;  1SYC A;  1IYV A;  2L11 A;  3J81 E;  2EY2 A;  2B2T A;  4S3S A;  2QEJ C;  4DN4 M;  1BCP F;  4IQZ A;  3PO2 B;  3TP5 A;  5EQ0 A;  3SK6 A;  3W3A A;  3HP3 A;  5EKL A;  1RTN A;  3OPO A;  1AW7 A;  5COR A;  4RWS C;  2PW5 A;  3MA2 B;  2JSO A;  3PUW A;  1YNN D;  3FRP B;  3ERQ A;  3RMH A;  2WKD A;  4RKL A;  1JQY D;  3IKJ A;  3BVG A;  3P20 A;  1W6K A;  2A6E C;  3OW7 A;  1F9R A;  5KIX A;  5CV5 A;  5HUR A;  1O7L A;  1WTV A;  4FF3 A;  4LK1 C;  3QO2 A;  1U9R A;  1NSN S;  2JA5 B;  2YYZ A;  3MXG A;  3ND9 A;  2SDF A;  2DN8 A;  1VDZ A;  5IOD A;  3NE5 B;  2AQ1 B;  2ICE C;  1L0X B;  1NAP A;  2HQE A;  2NTS A;  1YNJ C;  5KNC A;  5K36 G;  3OMC A;  1B9M A;  4CKB A;  3PIO 3;  2K5D A;  4HCE A;  3A7L A;  1FNW A;  4ULL A;  4H13 C;  1JOQ A;  3OMG A;  1HA5 A;  4XTC S;  5C5L A;  3Q6S A;  4A3G B;  1K83 B;  2B8G A;  1KDA A;  2KA7 A;  3ND8 A;  1BDO A;  3GTP B;  4C56 C;  2DY7 A;  3OIQ A;  5JAV A;  5I6W A;  4WOR A;  3IAY A;  5IGD A;  3NWT A;  4HSP A;  2JXM B;  1KTK A;  3GTG B;  1H9K A;  3NTH A;  1Y8O B;  5COY A;  1TT2 A;  3J81 L;  2BDN A;  4UAI A;  3QOJ A;  3DEP A;  4U68 A;  1VF5 C;  1ONL A;  3VYT A;  4NP5 A;  2D5D A;  2ENB A;  4K5W A;  1STE A;  1AZP A;  1MBY A;  3K6O A;  1SYF A;  4IUR A;  4DNT B;  2HUG A;  4BA2 I;  1JOO A;  3Q23 A;  4KKU A;  1QNU A;  1LT5 D;  4IN3 A;  3I3C A;  4QUC A;  3S16 B;  5LL6 X;  2A68 D;  4P2C B;  1J8I A;  4HMI A;  5CV4 A;  1JWU D;  3QB3 A;  4ABN A;  2BOS A;  4CBV A;  1SNO A;  1G8Z D;  1GOZ A;  1TVX A;  1SAP A;  3DEO A;  3C1E A;  2BE5 C;  4LAA A;  1SBB B;  4RKB A;  1X3Q A;  5J39 A;  2LKV A;  4A3I B;  5JOB A;  2WII B;  1OXS C;  5J22 A;  2L1B A;  5M5X B;  1QIL A;  1ENF A;  1F9Q A;  3T4A C;  5C3X A;  1HQM C;  1D2B A;  3I73 A;  1DCZ A;  2AQ3 B;  4ZKB B;  1STA A;  3CU7 A;  2O5I C;  2FMC A;  3RZD B;  4WJW A;  1V43 A;  3FVQ A;  5D3D A;  3S2H B;  1EY0 A;  2M2L A;  4V0B A;  3AB9 A;  4XDX A;  1TS5 A;  3GO5 A;  2XIW A;  4HSV A;  2E74 C;  5EJW A;  1UAP A;  1STB A;  4QF4 A;  1AEX A;  1DXM A;  1RTO A;  3EVQ A;  1S5C D;  4MHE A;  2H1E A;  4CJ1 B;  3C1F A;  1Q8I A;  5CYU A;  4HMJ A;  3GTL B;  1ICW A;  5C4H A;  3H6M A;  5F2D A;  5FOB B;  3FMC A;  2SOB A;  1T5E A;  2KEE A;  1WD1 A;  1F2L A;  1HPC A;  1OXU A;  4O42 A;  5ELD A;  3T13 A;  1JB3 A;  4OHJ A;  3NTI A;  3K5N A;  1SMY C;  5D3I B;  2SEB D;  4DNR B;  3T56 B;  4E6I A;  3VR2 A;  5EPL A;  4DFA A;  2A73 B;  1IYU A;  1MGS A;  3J7Y W;  4N9T A;  1V8Q A;  5E1F A;  1I50 B;  4EQN A;  1S5F D;  1NR4 A;  1Q1B A;  2MJ8 A;  5DNF A;  2EYJ A;  2KJX A;  5A2Q L;  5FKA C;  3PUV A;  1TU2 B;  3S15 B;  2A5H A;  5IGB A;  2CW0 C;  1NUC A;  3LNN A;  1G91 A;  3MEH A;  2MP1 A;  4KD4 A;  3V96 A;  1CHQ D;  1VMP A;  2F0U A;  4RFB A;  1F9P A;  4HR7 B;  2KHS A;  1RD9 D;  4Q5V A;  3GV6 A;  1GJX A;  4XT1 B;  3H94 A;  2JA6 B;  1V1P A;  1CA5 A;  3TP6 A;  1HRJ A;  2LS0 1;  4DK0 A;  2ZT9 C;  4A3J B;  3A56 A;  2NWG A;  4RGN A;  4IUQ A;  4R8N A;  3NUC A;  3K57 A;  4G57 A;  1JWS D;  2R92 B;  3JAM E;  3HS0 C;  5JVH 3;  4KHV A;  3DWA A;  2M9V A;  3R2I A;  4PMW A;  4TRD A;  1TS4 A;  1KNE A;  1PZK D;  4QMG A;  5DAU A;  2A69 C;  2IX0 A;  4A3M B;  3BZD B;  3SHL A;  1EL0 A;  3PMF A;  1GHJ A;  2XN9 C;  1SFO B;  4C3I B;  1QWY A;  3QWN A;  2X6L A;  4X3K A;  1WTP A;  3P1H A;  3M4O B;  2RKS A;  1BQQ T;  1L0Y B;  1ENC A;  3DWQ A;  2HDL A;  4V19 0;  1EYA A;  1PMR A;  1STG A;  2TMP A;  4XXE A;  3D6C A;  5C0X J;  2Q8R E;  5E3F A;  2Z4H A;  4G7O C;  1I4X A;  3BVZ A;  2E2I B;  1PTO D;  4B9X A;  3HG9 A;  5K36 H;  2H4O A;  1I4R A;  1C4Q A;  2SNM A;  3MTS A;  5LHY 1;  1J9O A;  1ET9 A;  2JP1 A;  3TBI B;  2B39 A;  2EJG C;  1CM9 A;  3C2P A;  2R93 B;  1LTI D;  3CKI B;  3QIA A;  1LT6 D;  2EE1 A;  1EU4 A;  1SYG A;  5M5Y B;  2AWO A;  1DYQ A;  2RSO A;  1TY2 A;  1KAB A;  2IJ0 A;  1PTO F;  4ODG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...