5M3MH

Free monomeric rna polymerase i at 4.0a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
144
structure length
131
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
total genus 20
structure length 131
sequence length 144
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m3mH00
1IXRA 2K50A 1X55A 3CCJA 2R7ZH 4IFDG 4DKAC 2UU9Q 4DV3Q 4HIDA 5AJ3Q 1CSPA 3BU2A 4DUYL 4JI7L 1YITA 2VQFL 3KOJA 2NN6I 1AE2A 2HIVA 2RF4A 3KDFB 1VQIA 3STBC 2D62A 3H15A 3PO3G 4A3GH 4GLAC 1E3PA 3G6EA 1VQNA 1MKHA 1OXSC 2NN6G 4LW1A 5GAGC 4DV4L 5IWAQ 4DV4Q 1PV4A 1VQ9A 3GTPH 2AKWB 1HZ9A 1Q12A 3PIPA 1GM5A 1PVOA 1A8VA 2CFMA 3TRZA 2MQHA 4C2MH 1XJVA 4B3RL 4A3GG 4LF6Q 1K83H 1Q1BA 5IY0A 2QEXA 3FHWA 5FLMH 1EQRA 4YY3Q 4DV1Q 1VQ8A 4O0AA 2UU9L 2JQOA 2NVYH 1C7YA 2AWOA 1L1OC 1J5EQ 4B3SQ 2UXDQ 4BBSG 4DR5L 2JA5H 5M3MG 4MTNA 4UPAA 4A3IH 3HKZE 5EAYA 3L7ZC 4JI8L 1E1TA 1PYBA 1CUKA 3CCEA 4DUZL 2VW9A 4JI2L 1L1OA 1KHIA 2WFWA 2MFIA 3LGJA 1FVIA 4KLKA 5DLQE 1P16A 2WB1E 2EXDA 1HNXQ 2K75A 4A3EG 1HR0Q 4QJFA 1S40A 5IYDH 2UUCL 1PFSA 1QVFA 1KQSA 1SRUA 2UUBQ 2R6GA 4HIMA 1YIJA 1EOVA 3FP9A 3DM3A 1OXUA 4KHPQ 2NZHA 1XMOQ 1XMOL 3GTGH 1JT8A 1TXYA 3HKSA 3J7ZC 3GTLH 4BA1I 4EQ5A 2KCMA 3S15H 1BBWA 4JI0Q 4X62L 3KJPA 1YBYA 4GKJQ 1H95A 5GAHC 1P8LA 4JI1L 2B63G 1KAWA 4GKKQ 4A3LH 2JA8H 3CW2C 3RLFA 1YJWA 1TWHH 1T9HA 5GROA 3H3VH 5C44H 3TS0A 1L0WA 3KJOA 3CCSA 2OTJA 3AQQA 3T1HQ 2PI2A 4DR7L 4K0KQ 1PH1A 1Y14B 3PUZA 3M4QA 4UP9A 1N36L 2YYZA 2ES2A 4B3SL 4LF5Q 3OTOQ 5M3FG 1SLJA 2OWOA 1VQ5A 2UXCL 3GTKH 4MNOA 3ICEA 1PH4A 1G51A 2DUDA 2IX0A 1YI2A 3AFQA 4DV5Q 1KXLA 3JAMi 5JEAJ 5C3EH 1VQGA 3PCOB 4J15A 4C3IH 2L15A 5ELNA 4A93G 1SROA 1YJ9A 3PUWA 1E22A 1Q1EA 1GKHA 1YHBA 3L2PA 3G4SA 4A3LG 1X54A 3M9BA 4NB3A 4DR1Q 4X64L 4LF4Q 1LM0A 2CWPA 5GADC 1Q82C 4OWTB 2BH2A 3ULPA 2VS1A 4OXPA 3K8AA 3DLLA 2BA0A 3CMAA 1Q81C 1G6PA 3CPFA 3TS2A 1PH8A 4DAYB 4IFDJ 1Y1VG 1XTDA 4DUYQ 1BVSA 4JI7Q 2JJQA 1E7ZA 1EWIA 5GAEC 3NELA 1X3GA 2R93H 2AWNA 3UE0A 4DV5L 3I56A 5C4XH 2YTXA 4L5QA 4O2DA 3M85A 2ZJQA 1YZ6A 2N49A 1I3QH 1V1QA 1NBWA 4JC0A 1PH5A 4DPGA 4GOPC 1UE1A 2ZTCA 3PUVA 3A0JA 1K8AC 4UY8C 1NMFA 1L1OB 4NXMQ 2LXJA 1J6QA 1FJGQ 1X3FA 3CC2A 1LTLA 2RCNA 5IP7H 4BY7H 1SFOH 4BBRH 1XNQQ 3TQYA 4JBMA 2JA5G 1Q8KA 3I55A 1PH6A 2E5LL 1I6HH 5JJLA 1VQ6A 5LMNW 3FKIH 4X66L 3KFUA 2AHOB 4P71A 4DR2L 4A3KH 1E24A 3PGZA 4A3MH 1MIUA 2K14A 4MZ9A 4EX5A 2YTVA 3CXCA 4X65Q 4P74A 5H1SE 2I5MX 2PI2E 4JYAL 2KHJA 1GVPA 4IO9A 1EIYB 1A0IA 5BR8L 2OTLA 1UE5A 3J81i 1I50H 1VQBA 3K0XA 4R4OA 3A5UA 2Q2TA 2F52A 4JI4Q 4LF5L 5C0XG 1KRTA 3ZJYC 5HY6A 1ASYA 3HOVG 2ASBA 1K0RA 3JC66 4LWCA 4POGA 3W5OA 3AEVA 4A3CH 1EIFA 1HH2P 1IBMQ 3CP0A 4JG2A 1X6OA 3GO5A 2YV5A 2A8VA 1UE6A 1K9MC 1Q46A 5HGQA 3KDFA 1Y1VH 4A3MG 4JI1Q 1LUZA 4GN3B 3GTJH 4A3BH 3GTQH 1Z47A 3PIOA 5IE8A 2JA9A 5IYBG 4LFBQ 1RIPA 4LF7Q 1UEBA 2CQOA 4YCUA 4YWKA 4NXML 4B3TQ 3M4PA 1OTCA 1S72A 1A62A 5IP9G 1CKMA 3GDEA 1JMCA 3I7FA 4B3RQ 4A3DG 4GNXC 4PG3A 1QVCA 1NMGA 2YTYA 2ZJRA 3SGIA 4IPCA 4AYBE 3ULLA 1WCMG 3JAMc 2RHSB 2JK8A 4GLXA 1BKBA 3PF5A 4AH6A 4OONA 3HOXH 2D0PA 4JV5Q 4DR3L 4LF8Q 2HQLA 4TVAB 2RHQB 3F2BA 1VQCA 3PUYA 4A3JH 4DR3Q 3CC7A 4LF8L 4R4IA 4POFA 1KC8C 1IZ6A 4ME3A 3S24A 1VQHA 2UXDL 2JA6H 3UDGA 4DR4Q 1EQQA 2ATWA 3RR5A 1LYLA 1S3OA 3TEHB 5FJ8G 4IOAA 2ZM6L 1HNWQ 1TWFH 2KHIA 2GVAA 2Z6KC 4L5SA 1U0LA 4BXXG 3NBHB 1SR3A 4A3EH 1XMQL 2HHHQ 5C3EG 4BBSH 4IPDA 1W3SA 3E9HA 4B3TL 5C0XJ 1HJPA 4DR4L 3OTOL 5IT9c 2IHFA 4BY7G 4P75A 2K4KA 1HNZL 3S17H 3PV0A 3T1HL 2NVTH 1AE3A 2NZOA 4DR7Q 1VQMA 4DV0Q 3PO2H 2XGTA 3RLNA 3J81c 4DV7L 1QZHA 1NJIC 4A3DH 4GKKL 3HOZH 4OO1G 4JV5L 1IBML 3CF5A 4JI5Q 2K5HA 4RG1A 1XNRQ 5IP9H 4NPSA 3EN2A 4GKJL 1N32L 4DK3C 2N78A 2R7FA 4IPHA 2R93G 2I5HA 2B63H 1NTGA 3ULJA 1N34Q 3F2CA 3RLOA 2GVBA 1QVGA 4OO1I 4FDBA 3U58A 2WB1G 2KENA 2UXBL 2N8NA 3BZKA 3CAMA 4L5TA 1JE5A 3T1YQ 2VL6A 3I4NG 4K0KL 3NENA 3RNUA 4IFDI 1IL2A 1OXXK 2EQSA 2JE6I 1NY4A 2ZTEA 3D31A 3KLWA 2UUCQ 4B3MQ 3PO3H 3A74A 4YCWA 3F1ZA 4LF9L 2WP8J 1IBKL 4DV6Q 2C35B 4PZ6A 2JA6G 3HOYG 2BA1A 3H3VI 1PH7A 1VQDA 5LMNQ 1D8LA 1IBKQ 4JI2Q 1VS0A 1AH9A 2Q2UA 4JI0L 2V1CC 4LUVA 4QIWE 4B3ML 1WI5A 2R7DA 3EBEA 5E7NA 2E2IH 1FJGL 1IBLL 4DR5Q 3RZDH 1XPRA 3CCMA 4HJ8A 1PH2A 1I94Q 3KF6A 3J81j 4BY1G 3M7NA 1V9PA 1HZCA 1HZAA 3EIVA 5BR8Q 4PMWA 3I4OA 1QUQB 1FGUA 3W1GA 4DV1L 4A3FG 4KHPL 3CCVA 4YWMA 4X65L 2PMZE 1HR0W 2LSSA 5FLMG 4GOPB 3S2HH 3Q8DA 3CQZH 4APVA 4YWLA 4JI5L 5JEAG 1R9TH 1VQ7A 3RN2A 4X66Q 1OXVA 4LUZA 5M3FH 3CC4A 4A3IG 4WJ3M 1N33Q 1VQEA 2MNAA 4H02A 5M5YH 4AIMA 3S14H 2MO0A 1PYSB 3NEMA 4A3BG 2I5LX 3PO2G 1XNQL 2JA7H 3I4MG 4A93H 4GNXB 1HNZQ 4A76A 1Y1WG 2K52A 4IOCA 3IRBA 3WWVA 2VQEQ 1QZGA 1PA6A 2Q2HA 4YY3L 1YVCA 4TQUS 3K81C 1XMQQ 4HJ5A 2HHHL 3L0OA 3I4NH 3U50C 1GO3E 1N9WA 3J80c 4DV3L 2JA7G 4X6AH 4BXXH 2DGYA 3MXNB 1B7YB 4C3JH 1JJGA 1E1OA 1CKOA 3CD6A 2R7ZG 2JEAI 1YHAA 2AMCB 5M5WH 1JJCB 1KIXA 1O7IA 4R1JA 4JI6Q 1B70B 4LFAQ 2UUAQ 1IYJB 4A3KG 3S1RH 4DAMA 2N3SA 5K36G 2LXKA 3ERSX 2R92G 3PF4A 4A3JG 5FLXc 4DR1L 3HKZG 4GN5A 1I5FA 1VQ4A 1KD1C 4BY1H 4JI3Q 1WFQA 2F4VQ 3D0FA 5GQOA 3UE1A 5AJ3L 4P72A 1K73C 1YHQA 3HOWG 1I94L 2ZTDA 3GTOH 2PNHA 1TWGH 1YEZA 4RMFA 5IYBH 4HJ9A 1VQPA 4BA2I 1IBLQ 3CCLA 3STBD 3S1MH 3GD7A 1WYDA 3UDXA 1OXTA 4L5RC 3U4VA 2K5VA 1SMXA 2CKZB 1HZBA 2FXQA 1BBUA 4HJ7A 2E2HH 2OCEA 3M3YH 2UXCQ 2B3GA 2VUMG 1K3RA 4A4IA 2UUBL 1SN8A 4AYBG 4JOIA 3B6YA 2CWAA 4HIKA 1Q86C 1HR0L 5C0XI 5JJIA 1WOCA 2Z6KA 1X65A 3U4ZA 4P73A 3HOYH 4DUZQ 4JCVE 3HOUG 2OQKA 3T1YL 4QL5A 1X3EA 3W1BA 4JI8Q 2QA4A 4X62Q 1KRSA 4AQYQ 2QGQA 1WCMH 1PH3A 1J5EL 4QQBX 4NXNL 4NXNQ 2MO1A 2PQAB 4JI4L 2OQ0A 4AQYL 3AFPA 3CPWA 4GS3A 4YHHL 4LNQA 3HOZG 5IYCH 3RZOH 1NE3A 1Z9FA 3CCQA 3VDYA 1XNRL 1YJNA 3OW2A 1CKNB 1FL0A 3E9IA 3H0GH 3UDFA 3K7AH 3ER0A 4GN4B 4R4QA 4XTCS 1TWCH 4OWWB 4DV0L 1W2BA 5IP7G 1YNXA 2D0OA 3KF6B 4DNIA 2ALYB 1GD7A 4HIOA 2CCZA 4JI6L 5IWAL 2IX1A 4WJ4A 3BJUA 1VCIA 3FKIG 2H5XA 3UDIA 2BH8A 2Y0SG 1XPUA 4OX9Q 2R92H 1PH9A 3S1NH 3MEFA 4R4CA 1TWAH 4DK6C 4UP8A 5ELOA 1X9NA 1VQKA 5LMUQ 3PUXA 2VQFQ 3KF8B 4C3HH 2ZM6Q 1HNWL 5J3BA 2XTIA 1CSQA 3I2ZA 2VQEL 2E2JH 4LFCQ 3F2DA 4JI3L 2NVQH 4ALPA 4LF6L 1B8AA 1KL9A 1VQAA 3PSIA 1C0AA 3HOXG 3J80i 4HJAA 1Q7YC 4JBKA 3CMEA 2HT1A 1N33L 4UP7A 2WAQE 1N8RC 1D7QA 3HOVH 3AYHB 2NVXH 2VNUD 4QGUA 1QUQA 5IYDG 4JBWA 3S1QH 3M4OH 4IJHA 4IPGA 2A19A 4X64Q 3OYYA 4LF4L 4Y52H 1WJJA 4IJLA 2KCTA 1ASZA 2EIFA 4A75A 4GLVB 4LFCL 4BBRG 1M1KC 3RN5A 2GN5A 3BZCA 5JJKA 2HIXA 2VY3A 4R4TA 2Z0SA 5LMUL 4Y7NH 3HFZB 2VZAA 4YHHQ 4LF7L 5IYCG 1X56A 4LFBL 5C44G 2JEBI 1G291 3E0EA 3J7A5 4DR6L 4OX9L 3GTMH 2JA8G 5LMNL 1N36Q 1V43A 2F3IA 2ID0A 4QY7A 1MJCA 4LF9Q 4JOIC 2IT1A 4GOPA 3G71A 1JJ2A 2YU9H 1UE7A 2WAQG 4DV2Q 3K7UC 1VQJA 2IHEA 2KBNA 2I0QA 2Y0SE 3CCRA 1VQOA 2PQAA 3TREA 4XIGS 2UXBQ 1K8GA 5FJ8H 4OWXB 1CKNA 4LUOA 4KI0A 1DGSA 4JYAQ 3F8TA 3K80C 4GNXA 1EUJA 4YCVA 3G48A 1EYGA 3HOUH 1RL2A 1N32Q 3I4MH 3KYHC 1XPOA 1VQFA 4PZ8A 4DR2Q 1VQLA 4KHZA 2F4VL 4DV7Q 1PHJA 2B29A 3HOWH 2E5LQ 2A1AA 1EFWA 1C9OA 4DV6L 2VUMH 1SE8A 5M3MH 4DV2L 1UWVA 1JB7A 1Y1WH 3H0GG 1HNXL 2ZJPA 2IY5B 1MJEA 2K5NA 2E8GA 2UUAL 4LFAL 4JBJA 1L2FA 2Q2IA 4PZ7A 4A3FH 4A3CG 3A5ZB 5M5XH 3CCUA 3S16H 1U5KA 3S2DH 1M90C 5C4JH 5C4XG 4DR6Q 1A63A 1N34L
chains in the Genus database with same CATH superfamily
1IXRA 2K50A 3I70A 4FVMA 1UEAB 3SR1A 1ESRA 3VR4A 3GV3A 3KOJA 2K32A 1AE2A 1T5XD 2C9OA 3A7AB 3IKJA 1BOSA 5ISRA 1E3PA 3G6EA 4KK7A 1VQNA 1O7LA 2KUMA 1KDAA 1PRTF 1A6XA 2RA4A 4LW1A 4DV4Q 4A93G 1C0AA 3PIPA 2H1EA 1Q8IA 2B8GA 2CFMA 3GQBA 2PNRC 3TRZA 4XYOA 1EOTA 4CHTB 2L1BA 2DY7A 5FLMH 1D1KA 2RSNA 1C7YA 2AWOA 1L1OC 1FNWA 1XXGA 4RKBA 3MHBA 4IUVA 2JA5H 4UPAA 1HQMC 3C1EA 2B2WC 3GTGB 4JI2L 1L1OA 3LWUA 2JA6B 3LGJA 2EVBA 5DLQE 2F03A 2Z4IA 2EXDA 2E2JB 4QJFA 5IYDH 4NDXA 4F88A 1QVFA 4DNTB 2UUBQ 2R6GA 1I6HB 1OXUA 3VA7A 3P1HA 1CZGA 4LMQD 2QF7A 1TXYA 4KKTA 1IHZA 4C3JG 4EQ5A 2KCMA 3M3YB 3NPPA 1F9RA 4JI0Q 3KJPA 1IW7C 1L0YB 2PMZB 1KNAA 1BCPB 3SEBA 3RLFA 3H3VH 3CCSA 3AQQA 3URYA 1Y14B 4UP9A 1N36L 2ES2A 2R7ZB 5M3FG 1SLJA 4MNOA 1G51A 4UHVA 2E74C 3OPOA 1BCPF 2AUKA 5I9OA 5ELNA 5IT9L 1MSGA 3MZ5A 2KECA 1Q1EA 1GKHA 1YHBA 5HURA 2R61A 1R4PB 2HCIA 3ULPA 4A3KB 4OXPA 3BYYB 1Z6HA 1O7ZA 2LFNA 4XQJA 4IFDJ 1XTDA 4DUYQ 4JI7Q 3VR6A 3LWEA 5GAEC 5ELFA 2ZT9C 3M85A 3T53B 2N49A 3RMHA 3DHQA 4GOPC 1EQTA 1UE1A 2Y0SB 2ZTCA 5CC4A 1L1OB 3EFXD 2LXJA 1J6QA 3MTSA 1K0SA 2FHTA 3NE5B 1SFOH 2F0KA 1XNQQ 1PXUA 2IPKD 3VYUA 3I55A 3TP8A 1FYCA 5FO9B 4A3MH 3GV6A 4A3FB 2I5MX 2PI2E 2KHJA 4DAPA 4IO9A 1GUNA 4R4OA 4LF5L 4RGTA 3V2TA 2XWJB 4PNYA 3BDCA 5HY6A 1WTVA 3TN2A 1ASYA 4XYQA 3HOVG 2ASBA 1K0RA 4POGA 4YIJA 1X6OA 3GO5A 3NP8A 1Y1VH 1RHPA 1LUZA 3CKIB 1F9PA 2MUYA 5IYBG 3BDOA 3TZUA 1AN8A 1YNND 2B2TA 1CKMA 3GDEA 1JMCA 4CDCC 4OO1H 1EWHA 4KMUC 4GNXC 4PG3A 3C46A 3S14B 1QVCA 3SGIA 4IPCA 1CHPD 4AYBE 2TMPA 4ZLTF 5C4ZA 4GLXA 4AH6A 3S9WA 2F0WA 1SYCA 4DR3L 4LF8Q 1ENCA 1PTOD 1VQCA 3PMFA 2M9VA 1RODA 3MXNA 3S24A 5KYIA 4MHEA 4K6DA 3HP3A 3RR5A 3TEHB 4LK1C 2TSSA 3PO2B 4ZKBB 1BO0A 1CHQD 3NBHB 4DAYA 4A3EH 3M4YA 1W3SA 5IT9c 1F77A 2K4KA 4P75A 4RHRA 3S17H 3T1HL 2NZOA 1VQMA 5M9OA 2XGTA 1A2UA 4FO2A 4C3IG 4A3DH 2A73B 4GKKL 2XRSD 4M1UB 4JI5Q 2K5HA 4F8MA 4NPSA 2Z4HA 3EN2A 4GKJL 2R7FA 4IPHA 2B63H 4BY1B 2SEBD 3RLOA 4QUFA 1QVGA 2EY2A 1MHWC 2WB1G 5G3LF 4K0KL 5COYA 1OXXK 4BWGB 4B3MQ 2JE6I 2UUCQ 3KLWA 1A2TA 5I6WA 1DOMA 3PIO3 1PH7A 3P20A 5KYLA 1HUMA 1AH9A 1PFMA 2D5DA 3DWPA 4G57A 2R7DA 3EBEA 1FJGL 1IBLL 2F0DA 4DR5Q 3MVVA 3UI2A 1CT1D 4BY1G 4FXKC 1HZCA 1AFPA 4DV1L 1FGUA 2N55A 2KCNA 2L55A 3P7JA 1HR0W 1SJHD 4YWLA 3RN2A 3Q0AA 1N33Q 1M4VA 4AIMA 1PYSB 4IN3A 5D3DA 2I5LX 1XNQL 2JA7H 3DXJC 4A93H 1KAAA 2EYFA 2K01A 2VQEQ 4YY3L 4TQUS 3K81C 3E0JA 2KA7A 3FKIB 2HHHL 5IODA 1GO3E 4BXXH 4A3BB 3BDLA 1E1OA 4HAEA 3CD6A 1RTOA 1JCKB 1W6JA 2AMCB 2O5JC 4R1JA 3OIPA 1PTOC 5EBDA 3S1RH 1CQFA 3NQTA 2R92G 3S1QB 4ULLA 3JAML 5FLXc 5I6YA 1VQ4A 3GTJB 1JOQA 5AJ3L 1E2VA 3UE1A 1YHQA 1SYEA 3LX0A 1I94L 4BA2I 4HJ9A 2EYPA 1OXTA 3M3YH 1HZBA 2OCEA 3T4AC 1BR9A 2X6GA 2B3GA 3C3LA 2VUMG 4AYBG 1U9RA 2CWAA 1TS5A 3X3MA 4HIKA 1HUNA 4PMBA 2Z6KA 2Z8LA 1J8IA 4JCVE 3HOUG 1JWSD 4FF2A 5CV7A 4JI8Q 2QA4A 4AYBB 4X3KA 3SVMA 1WCMH 2VB2X 4DA2A 1J5EL 4QQBX 2MO1A 2PQAB 3D4RA 5KGUA 3CPWA 4QCLA 1II3A 3PQIA 4L6TB 2MHVA 5IYCH 3HOZG 3VDYA 3RZOH 1XNRL 1YJNA 3H0GH 3E9IA 3N52A 3ER0A 4IUQA 5JPMC 3EVQA 4DV0L 3E6ZX 1DYQA 1M8AA 2ALYB 2E2HB 1EL0A 4HIOA 4JI6L 4WJ4A 5IWAL 3FKIG 1VCIA 1LTBD 1U4LA 3MFYA 3NTHA 3GTQB 1PH9A 5CGKA 4DK6C 4UP8A 2ZXPA 1S5FD 1VQKA 5LMUQ 1HNWL 3N6RA 2XTIA 1AZQA 5IIFA 1B8AA 3PSIA 3R3OA 4KJOA 1GHKA 3TSSA 4IUPA 4HMIA 3HOXG 1A3UA 5KNCA 3E3XA 1Q7YC 4IUTA 5EPKA 1D7QA 3F2UA 2PQEA 4ZYSA 4A3DB 3AMUA 1B3QA 2A19A 1WJJA 3BVMA 4LFCL 4KKSA 1M1KC 4ZCKA 3MEHA 2KQ3A 1EYAA 2X6LA 5JJKA 2HIXA 4RHSA 3HFZB 4QIWB 3NWTA 4OX9L 4BY7B 3RD4A 2F3IA 2ID0A 4QY7A 4LF9Q 3WOEA 3U9SA 2YU9H 1UE7A 4H44C 2IHEA 3HOZB 2Y0SE 4FXGC 4XIGS 2UXBQ 1CKNA 3TP7A 2OF1A 4F87A 1N32Q 2WB1B 4PMCA 4PV1C 1LT4D 2NTSA 3OW7A 2KEDA 1H9RA 2B29A 2VXWA 2E5LQ 3HOWH 1WCMB 2A5HA 3W2DA 5C3WA 4DV2L 1UWVA 1KDCA 1JOOA 2A74C 5CBAE 3CRKC 2Z1CA 3KLSA 5C4XG 3KBXA 4MTKA 2FINB 3PO3B 1A63A 1ONLA 1WTQA 1ICFB 2UU9Q 5CV5A 3K5MA 3NSWA 1NNXA 3VA5A 4JW0A 5IGBA 1YITA 1RTNA 1J9OA 2BOSA 1PZKD 1ILPA 1JWMD 1PLFA 4KY6A 4A3GH 3KF8A 1C48A 1I4GA 1VMPA 2WKDA 1KLGD 5GAGC 3GTPH 3DWQA 2AKWB 4XQNA 1PVOA 2CH4W 1A8VA 2MQHA 4C2MH 1XJVA 4B3RL 4V0BA 4A3GG 1Q1BA 5IY0A 4DV1Q 1G2TA 3ND9A 4FP5D 3MA2B 4BBSG 1BUVT 4DR5L 1E1TA 1GUGA 5JEAH 1CUKA 4DUZL 1KHIA 1EQVA 2MFIA 1FVIA 4KLKA 2B2UA 1P16A 4IUUA 1HNXQ 1HR0Q 3H09A 2UUCL 1PFSA 1KQSA 1SRUA 1SSOA 1YIJA 3OHXC 3FP9A 1XMOQ 1XMOL 5IT9E 3GTGH 2CQAA 3J7ZC 3GTLH 1CQVA 4BA1I 5C44B 5D14A 2KJXA 3S15H 2JA8B 1BBWA 4GKJQ 5JOBA 4C3HG 1P8LA 3HZXA 2DY8A 1WD1A 1KLUD 4GKKQ 2JA8H 3CW2C 1YJWA 1T9HA 3ND8A 5C44H 3TS0A 2OTJA 3T1HQ 1EY0A 2L12A 4LF5Q 2NVXB 2F0HA 5BN5A 3C1FA 2A68C 3ICEA 4F7XA 3ITPA 4ZKCB 3AFQA 3JAMi 2K1BA 3PCOB 4J15A 4C3IH 2L15A 3HRZC 3J81E 3PUWA 1E22A 2CVRA 3G4SA 5C3EB 4HN7A 4A3LG 2B63B 4OHJA 4X64L 3HGBA 1EY8A 2BH2A 2IWHA 3K8AA 5JVG3 2F0TA 3CMAA 2ZXRA 3CPFA 1PH8A 2BE5D 1BVSA 1E7ZA 3TZDA 4TRDA 4DV5L 4RCNA 3R2IA 4O2DA 2JA5B 1B9MA 1V1QA 1NBWA 1PH5A 3I4MB 3CC2A 4BY7H 4BBRH 3TQYA 1GUTA 2JYOA 5D3IB 1PH6A 5ELBA 2E5LL 1PFNA 5JJLA 1VQ6A 4NMZA 3FKIH 4P71A 1CA5A 3PGZA 1MIUA 5T1GA 2IX3A 4MZ9A 2PW7A 1S5BD 2YTVA 2M2LA 3CXCA 1JWUD 3HG9A 2SNMA 2EYLA 1SAPA 3HOYG 1UE5A 1JORA 1I50H 2A69C 2B2YA 2A69D 2HD3A 2N88A 4DAVA 3A5UA 4LAAA 1YNJD 3ZJYC 3I8ZA 3AEVA 1HH2P 2HDMA 1EU4A 3CP0A 4JG2A 4UAIA 1UE6A 4I7AA 5HGQA 4RWSC 4A3MG 4N9TA 4RGOS 5IE8A 1A3TA 1RIPA 3I4LA 4YCUA 4YWKA 3T56B 1OTCA 5IP9G 2EY5A 4A3DG 2LKVA 1KTKA 1NMGA 2AQ1B 2YTYA 3JAMc 4C56C 5AFWA 3HOXH 4JV5Q 4TVAB 2CHBD 3AB9A 3S2DB 1SMYD 1JC7A 1LO5D 1KC8C 4QF4A 2PZTA 2A6HD 1GUOA 1LTGD 3UDGA 4DR4Q 2ATWA 1EEID 1LYLA 1S3OA 1STBA 2F0VA 3J80L 1HNWQ 1TWFH 2GVAA 5F2DA 2PYKA 1U0LA 4MIUA 3E9HA 4B3TL 5C0XJ 1TY2A 1K8MA 4DK0A 3I3CA 5FO8B 1TR5A 2XVSA 3J7AV 3PV0A 1EZ6A 1AE3A 3T16A 1GOZA 1WVLA 2NZ1D 4DV0Q 1IYUA 2PZWA 4DGZA 4DV7L 1QZHA 3PO2H 2A6HC 4DXFA 1CFMA 1IBML 4RG1A 1XNRQ 4RA8A 2EOTA 2N78A 1NTGA 3OSOA 1DONA 1SNMA 4B9XA 2N8NA 1JE5A 2VL6A 5M3FB 3NENA 1IL2A 3OOCA 2IJ0A 3J81L 2EQSA 1B9NA 1NY4A 4YCWA 2WP8J 2Q8IB 3H91A 3H3VI 5NUCA 2NVYB 4JI2Q 1VS0A 4LUVA 4QIWE 2EYOA 2OEOA 5M3MB 1X32A 1LABA 4ZUIA 1I94Q 3KF6A 1V9PA 3P75A 2CW0C 5I2YA 1QUQB 4KHPL 4OIKA 3W1GA 2K03A 4YWMA 5FLMG 1WTPA 3S2HH 3Q8DA 4K14A 5JEAG 1VQ7A 1OXVA 1DJRD 4WJ3M 2FJ2A 1VQEA 1MI2A 2MNAA 4H02A 2NTTA 5I2XA 3I4MG 2NYZD 4I7ZC 4A76A 2F0UA 3D6CA 3WWVA 1QZGA 2Q2HA 1YVCA 1I4QA 1V8QA 1N9WA 1EWCA 2KEEA 1CA6A 3MXNB 1MD2D 3SXHA 4LFAQ 2UUAQ 3R8BA 1IYJB 1RF2D 1B2TA 5K36G 3SK6A 1HXYD 1UNSA 1L0XB 3BYTB 1I5FA 3IL8A 4BY1H 1WFQA 4P72A 2PNHA 1YEZA 2IL8A 2CW0D 4RMFA 5IYBH 1IBLQ 5LL6X 3STBD 3S1MH 2NVQB 1WYDA 4C3JB 1SMXA 2CKZB 4G4KA 3D4DA 2UXCQ 1K3RA 1LTID 4OL7A 1NR4A 3OIQA 3B6YA 2L9HA 3Q22A 1HQRD 1Q86C 1I6VC 3U4ZA 2RBMA 2OQKA 1Y8PB 1PZJD 3R93A 3A7LA 4AQYQ 1TT2A 3I91A 5IGCA 2J7ZA 4GS3A 3NHHA 4K2KA 1HA5A 4YHHL 4A3IB 4LNQA 1Y69U 3OW2A 1FL0A 4J8QA 1H9JA 5CORA 4FF4A 3HOVB 1TQOA 1F9QA 1TWCH 2F0EA 5IGDA 1F2MA 4CJ0B 3BJUA 2BH8A 2Y0SG 4K5XA 1K3BC 3MEFA 1TVXA 2JXMB 3OWFA 2IW3A 1X9NA 4QUCA 3C2PA 3PUXA 2VQFQ 1CSQA 3I2ZA 5EGTA 2E2JH 1IKLA 2NVQH 2J0TD 3BG3A 2HT1A 3CMEA 2K33A 4UP7A 1STNA 2EYHA 4X3UA 3HOVH 2NVXH 1DZ1A 3I90A 4JBWA 1SNDA 4Z9CB 4X64Q 3OYYA 4QB4A 5A2QE 4A75A 3RN5A 1KDBA 1I4XA 4A3MB 2VY3A 4OELB 1STYA 2WAQB 4HSVA 5JPNC 1X56A 2G9DA 3E0EA 3I73A 3GTMH 3SK4A 5LMNL 4FNFA 1PTOF 3LNNA 3K5NA 1D6EC 2ENBA 1TIID 1RJTA 2F0PA 5C6AA 4I65A 3K7UC 1SXTA 3MC0B 1IW7D 2KBNA 2I0QA 3CCRA 2NUCA 2PQAA 1VQOA 4S3SA 1K8GA 4ME5A 5BN4A 1TKWB 4OWXB 1QILA 4KI0A 3F8TA 3G6JB 3K80C 3KK7A 4GNXA 1RL2A 5ELEA 1D5MC 4XDXA 1XPOA 3EJIA 1VQFA 3NUCA 1VQLA 3IAYA 1PMRA 4Y7NB 1PHJA 2A1AA 1JB3A 2DN8A 5EQ0A 5KEEA 4B08A 2VUMH 4OEMB 1HHVA 5M3MH 4FYDA 1JE4A 1HNXL 2ZJPA 2IY5B 1A15A 3HOUB 1MJEA 5C5MA 1L2FA 2Q2IA 4A3FH 3S16H 4TKOB 4EGVA 3S2DH 1ZXTA 4DR6Q 2L11A 1X55A 3CCJA 2R7ZH 4FF1A 4DKAC 4N8X1 4ILWA 4DV3Q 1LV9A 4KD3A 2RDFA 3S1NB 3BU2A 5EKKA 4DUYL 4JI7L 2VQFL 3OMCA 3STBC 3Q23A 2HIVA 1VQIA 5DM73 2D62A 4L8JA 2F0IA 4GLAC 2F0FA 1VQ9A 5CYUA 1Q12A 1GM5A 4MN3A 1I4PA 1Y8OB 2A6ED 3EQLC 5HGTA 4LF6Q 1K83H 2F0SA 2F0JA 3FHWA 1XWEA 1VQ8A 2UU9L 1EFID 2NVYH 4KY7A 3D3RA 1I3QB 1LACA 1QB5D 5FLXE 1PYBA 5G3LD 2VW9A 1RKNA 2I46A 2WB1E 4A3EG 1HFNA 5J22A 1B50A 2HQEA 1SMYC 4ZAIA 1HCZA 3GTOB 3L9AX 4KHPQ 4CDFC 2NZHA 1TWAB 5I9PA 1JT8A 3HKSA 4DFAA 4GZYC 4U68A 1KABA 1H9SA 4IUNA 5EKLA 5DEHA 4X62L 4BBSB 1H95A 5GAHC 4L63B 2B63G 1KAWA 3VYSA 1TWHH 3BVZA 5K5PA 5L37A 1O80A 1L0WA 3KJOA 1F2ZA 3A8KE 1PH1A 1TWFB 2YYZA 2EDGA 3OTOQ 2L4NA 2OWOA 1VQ5A 3GTKH 3SDZA 1WTHA 1EYCA 2IX0A 3HS0C 1YI2A 1KXLA 5JEAJ 5C3EH 4WRDA 1SYFA 4DU9A 1I50B 1HRJA 5DM63 1SROA 1ICWA 3L2PA 4KV6A 3M9BA 4NB3A 2KCCA 4DR1Q 1LM0A 5GADC 3QO2A 4KY5A 1Q82C 1JOKA 1NSNS 4J1MA 1G6PA 3D8GA 1WTWA 2O2LD 5C4XB 1BQQT 2R93H 2AWNA 3UE0A 2AUJD 5C4XH 3U9OA 3CQZB 4JC0A 4DPGA 3QOJA 3QOLA 2F0LA 1K8AC 4UY8C 1NMFA 4X3SA 1BBXC 4NXMQ 4P2CB 2SNSA 5EPLA 5E4XA 1X3FA 1HTLD 5IP7H 4NW2A 5ELDA 2BDNA 2JA5G 1Q8KA 1S4ZA 2QDBA 4X66L 3KFUA 2AHOB 4DR2L 1CK1A 3H6MA 2B8FA 2K14A 5C4JB 4X65Q 1JR0D 1EIYB 1HPCA 1A0IA 3DM1A 3M7GA 5BR8L 2PZUA 3J81i 3K0XA 3M7NA 2F52A 5IGFA 4JVZA 5CBEE 4LWCA 3W5OA 1PRTC 1EIFA 1DOLA 1IBMQ 1GXDC 2MPMA 1G2SA 5TSSA 2A8VA 1HFGA 2K5QA 3TDQA 1Q46A 2E75C 4JI1Q 4GN3B 4RCOA 5C0XH 3GTJH 3GTQH 5LHY1 3PIOA 3O13A 3MAQA 4LF7Q 4IZ8A 4B3TQ 1A62A 4K8JA 3NXWA 4OIJA 1SNPA 3RZOB 3NQIA 3ULLA 1WCMG 1SYGA 2JK8A 3PF5A 1O7YA 4OONA 1NAPA 2D0PA 4FXDA 2RHQB 1BCPD 4C1NI 4A3JH 3J7AF 3S1MB 1Z7TA 5CV4A 4C3IB 3CC7A 2Z9HA 1IZ6A 1B44D 1CI3M 2LS01 2UXDL 2R92B 1FNVA 2K5WA 2QW7A 4A3JB 4LJZC 1EQQA 1VDZA 4KJNA 4IOAA 4OGQC 3M4OB 2KHIA 2Z6KC 1U4RA 1XTCD 2HHHQ 4IPDA 2DNEA 2B2VA 4R9WA 3K6OA 2XWBB 5FK9C 4BY7G 1QCBD 1OO9B 4DR7Q 3FDTA 1WTRA 2WACA 3RLNA 3PIP3 1EY9A 3HOZH 3FPPA 2EJGC 3CF5A 3S1RB 3A55A 5IP9H 2YU9B 4DK3C 3QIAA 2R93G 2I5HA 1X3PA 4XT1B 5ELCA 1N34Q 3F2CA 1STEA 2GA4B 5CV9A 4OO1I 4FDBA 3U58A 2KENA 3BZKA 3CAMA 4L5TA 3J7YW 3T1YQ 3K58A 4XXEA 3I4NG 2XNAC 5DNFA 3RNUA 5E3FA 4H0LC 3PO3H 2ZTEA 1FR3A 3F1ZA 3ZYYX 2C35B 4PZ6A 4DV6Q 5D65A 4K2LA 5LMNQ 1D8LA 1EY4A 1LTSD 1PTOH 3FEWX 2Q2UA 4B3ML 3I4NB 5C3XA 4K6LA 3BS1A 1XPRA 3CCMA 3HOYB 2AQ3B 1HZAA 3EIVA 5BR8Q 4A3FG 3I4OA 2F0NA 2FFKB 4X65L 2PMZE 2LSSA 2AQ2B 3VR3A 2XN9C 4GOPB 3CQZH 3QB3A 5IGGA 4JI5L 4A3GB 2SOBA 1R9TH 3CC4A 4X66Q 4LUZA 5M3FH 1DXMA 1EY6A 5M5YH 3NEMA 5J1ZA 2K52A 5CV6A 4IOCA 3IRBA 5M5YB 3IFTA 4R8IA 2EY1A 4Q5VA 1F9SA 4HJ5A 4ZQ3A 3U50C 2RQXA 3MXGA 1NUCA 1WTXA 4X6AH 2DGYA 3H0GB 3SHLA 1JJGA 1K28A 2E76C 1ZEQX 1MGSA 2R7ZG 1AZPA 5M5WH 1JJCB 1KIXA 1B70B 3K57A 5CV8A 5J39A 1LLRD 2PO4A 4DAMA 4G7ZC 2LXKA 3ERSX 2XSCA 1SEBD 4DR1L 4KKUA 3HKZG 3GP7A 1KD1C 3EA6A 4JI3Q 2F4VQ 4JK1C 3VR5A 2EPBA 4HCSA 3HOWG 1BCPC 4K5WA 2ZTDA 3MFGA 1TWGH 2D9UA 1VQPA 4NKLA 1BNZA 3CCLA 4HCEA 3KLSX 4CJ1B 1TWCB 2NWGA 4RAUC 1S5ED 4G7OC 1HR0L 5JJIA 1IKMA 2KVMA 1WOCA 4HMJA 1X65A 2L0CA 1DCZA 4P73A 4DUZQ 2BCOA 2XIWA 4QL5A 3HKZB 3W1BA 4X62Q 1KRSA 2QGQA 1EYDA 3K0YA 1PH3A 1C8CA 4NXNL 1EY7A 4NXNQ 1G91A 2OQ0A 3AFPA 1FNUA 4N9PA 4Q0FA 1NE3A 1Z9FA 3CCQA 1CKNB 3UDFA 1HTPA 3K7AH 4GN4B 4XTCS 2RVLA 4OWWB 1W2BA 5IP7G 1YNXA 2D0OA 2Q8TA 1K83B 3KF6B 4DNIA 1GD7A 2IX1A 2EXZA 3QWNA 3UDIA 1H9KA 4OX9Q 2R92H 1UAPA 4R4CA 2JA7B 1QE6A 5A35A 2PPBC 4FF3A 3OMGA 1XX8A 4C3HH 2ZM6Q 5J3BA 4ODGA 5M5XB 2QILA 3D4WA 2RDHA 4LFCQ 3F2DA 4JI3L 1S5CD 1B53A 4ALPA 4DF7A 1F2LA 4LF6L 1LT5D 3H94A 3V96A 4NP5A 4BS9A 4HJAA 2M00A 2WAQE 2OT2A 2EJMA 3AYHB 5KRUA 2VNUD 3A8IE 2WKCA 3S1QH 4IPGA 1O78A 5E1FA 4IJLA 2KCTA 1ASZA 2EIFA 3FPUB 4GLVB 4BBRG 2ICIA 1V1PB 2EY6A 3BZCA 5I4DA 3NBIA 1NR2A 3A54A 4R4TA 3NWSA 5LMUL 4Y7NH 2VZAA 5IYCG 4LFBL 5C44G 1BDOA 1SJED 2JEBI 1G291 2EYJA 3J7A5 4DR6L 2F3WA 1GJXA 2V4DA 1N36Q 1MJCA 1ET6A 4JOIC 2WAQG 5KNBA 5FO7B 4H7BA 4HSPA 2B39A 3QR8A 2PW5A 5C4HA 4LUOA 1DGSA 4JYAQ 2K7VA 2KHSA 1EYGA 2D2CC 3KYHC 2MGSA 4WJWA 4KHZA 3K5LA 4DV7Q 2F4VL 5JVH3 4DV6L 1SE8A 1JB7A 4ZUJA 1AW7A 1S5DD 2F0GA 2K5NA 2E8GA 2X69A 4PZ7A 1LTAD 4A3CG 2BE5C 5M5XH 2NBFA 1M90C 1PRTB 1PYWD 1N34L 1RDPD 4RH6A 4IFDG 4HIDA 5EJWA 4IQZA 5AJ3Q 1CSPA 1MBYA 2NN6I 2RF4A 3KDFB 4IURA 2VB3X 3H15A 3PO3G 2ZXOA 1FD7D 5T1IA 3TP5A 1MKHA 1OXSC 2MP1A 3K7AB 2NN6G 4DV4L 1PV4A 5IWAQ 1FGBD 1HZ9A 2CH4A 2MJ8A 1TS4A 3X3NA 4CDEC 4N8FA 4CKCA 1T5EA 5LL6S 2QEXA 3SE0A 1EQRA 4H13C 4YY3Q 3WOFA 3GTPB 4O0AA 4A3EB 4TSSA 2FMCA 2JQOA 4EQNA 1J5EQ 4B3SQ 2UXDQ 3HOXB 5M3MG 4MTNA 4A3IH 3HKZE 5EAYA 3L7ZC 1G8ZD 4JI8L 3CCEA 1ET9A 2WFWA 1SNCA 3DEPA 3TMEA 4CBVA 2K75A 4RKLA 1S40A 4PQXA 1TWGB 2OXPA 4KN4C 4RGMA 4HIMA 1EOVA 3DM3A 1R9TB 1QNKA 1MSHA 3VR2A 1F2YA 4B9WA 4E6IA 5EKIA 3K59A 2NN6H 4HEDA 3DEOA 1YBYA 2QDLA 4JI1L 4EVOA 1VF7A 3S17B 3GTKB 2R3ZA 4ABNA 4A3LH 2F1MA 5GROA 4O42A 1PTOB 2PI2A 3K5OA 4DR7L 4K0KQ 3PUZA 3M4QA 2EE1A 4B3SL 1TWHB 4WFN3 2UXCL 2HUGA 1PH4A 3VYTA 2DUDA 1CTMA 1PRTD 2C5CA 4IALA 4DV5Q 1U4PA 1VQGA 2K5DA 2QEJC 3OWEB 1YJ9A 4BBRB 1TY0A 1ENFA 3KLRA 1X54A 1PDQA 1B3AA 4X3TA 4LF4Q 2O5IC 2CWPA 1SE2A 1ENAA 4OWTB 4DXGA 2F4IA 4ZRZA 1EY5A 2VS1A 1B1ZA 3DLLA 2BA0A 1Q81C 1ZYRC 3TS2A 3NBHA 4DAYB 1Y1VG 5FLXL 2JJQA 3FMCA 1EWIA 3H3VC 1DM0B 2B2VC 1X3GA 3A8JE 3NELA 1SFOB 3I56A 1A3VA 2YTXA 4L5QA 2FMMA 1YZ6A 2ZJQA 3T51B 1I3QH 1GUWA 3S2HB 1R4QB 1DOKA 3PUVA 3A0JA 1STHA 1Y1VB 3Q24A 3T13A 1FJGQ 1E2ZA 1LTLA 2RCNA 4JBMA 3FRPB 4RGNA 1I6HH 3CU7A 2DJGC 5LMNW 1QOHA 1D2BA 2F3VA 4A3KH 1E24A 4CKEA 5FOBB 4EX5A 1EIHA 2L5TA 4P74A 5H1SE 4JYAL 2NB0A 3BZDB 1GVPA 2ICEC 4JPBW 4EQPA 3SK5A 2OTLA 4JI4Q 3GTMB 1VQBA 2Q2TA 5C0XG 1KRTA 2SDFA 1JQYD 5CR3A 3JC66 2P5ZX 1YNNC 2BDOA 3MXPA 2YV5A 1QNUA 1TS2A 1K9MC 3KDFA 1BXTA 1EZ8A 4G7HC 1U4MA 4A3BH 2F0QA 1Z47A 1H9SB 2XRQD 2JA9A 4ID6A 1ESFA 2PCFB 4LFBQ 3ERQA 1UEBA 2CQOA 4NXML 3M4PA 1S72A 3D6WA 5JJZA 3KBGA 1LTTD 3I7FA 4B3RQ 5K36H 1JICA 1RD9D 2ZJRA 1ILQA 3Q6SA 2RHSB 1BKBA 2WINB 5KNDA 2QCPX 3RUZA 2HQLA 3F2BA 3PUYA 1ZKOA 4DR3Q 4LF8L 4R4IA 1PZID 4POFA 1SE3A 4ME3A 1VQHA 1LT3D 3BVGA 2JA6H 5FJ8G 3W3AA 2ZM6L 4KTAA 3TBIB 3V05A 3G7LA 4L5SA 1ZYRD 4KHVA 1XMQL 1SR3A 4BXXG 5C3EG 1UUPA 2B2YC 1HJPA 4DR4L 2B2WA 3OTOL 5IOCA 5A2QL 2IHFA 2DNCA 1HNZL 2NVTH 4R8NA 3NTIA 1SYBA 1NJIC 3J81c 4JV5L 4OO1G 3NK9A 4C3HB 2HCCA 1N32L 4U673 2K05A 4C1NK 2EZVA 2G5DA 3DWAA 1GUSA 1EU3A 3ULJA 2F0MA 2GVBA 3R2TA 2UXBL 1AEXA 1SBBB 1QJOA 3MXUA 4IFDI 3HOWB 2B2UC 1E2WA 1VMCA 3CRLC 2RCFA 3D31A 5M5WB 3A74A 4LF9L 2JA6G 1IBKL 1G6ZA 2BA1A 1VQDA 1IBKQ 2JSOA 4J6HA 4JI0L 2V1CC 5EBCA 2J4XA 1WI5A 3QJYA 2E2IH 5E7NA 4HR7B 2WIIB 3RZDH 4HJ8A 4DK1A 1PH2A 3DUZA 3J81j 4BBSH 2K04A 4A3CH 4PMWA 1I4RA 3CCVA 1DD2A 4EQOA 1AP0A 1V1PA 4APVA 3RZDB 1STGA 4A3IG 2JP1A 2EJFC 3S14H 2MO0A 4A3BG 3PO2G 2RSOA 5IGEA 4GNXB 1HNZQ 1Y1WG 4UDUC 5BN3A 1X3QA 1PA6A 3JAME 1XMQQ 3L0OA 3I4NH 1STAA 3J80c 3DMUA 4DV3L 1HA6A 2JA7G 1GHJA 1B7YB 4C3JH 1Y1WB 1CKOA 5EPJA 4XT3B 4IFDH 2JEAI 1YHAA 1LT6D 4M8AA 1O7IA 4JI6Q 1VF5C 1SDFA 4ZK9B 2A6EC 4CKBA 4A3KG 2N3SA 3MWYW 4DN4M 3PF4A 4A3JG 4XQQA 2KOLA 4GN5A 1XYIA 4V190 3D0FA 5GQOA 2H4OA 1SE4A 2A68D 1H9MA 2RKSA 1K73C 1EIGA 3GTOH 3FVQA 3GD7A 3UDXA 4L5RC 3U4VA 2K5VA 4HJ7A 3S15B 3QG1A 2FXQA 1BBUA 2E2HH 2HDLA 1TS3A 3GTLB 4A4IA 2UUBL 1SN8A 1SYDA 3J80E 4JOIA 3WDNA 2O4XA 2K6AA 4CDDC 4WORA 5C0XI 3HOYH 3E5SA 3T1YL 1X3EA 4QMGA 5JAVA 4K8IA 4CJ2C 4RFBA 1I4HA 4JI4L 4AQYL 1Q3LA 3KUPA 3A56A 4CGYB 2WV6D 1D5XC 2LY7A 1CM9A 4R4QA 2QKIC 1YNJC 2Z6BA 3AU7A 2B2TC 5KIXA 1K8OA 5CMDA 2CCZA 2LMCB 4C2MB 2H5XA 5DAUA 5E4WC 1BF4A 1XPUA 3S1NH 3SK8A 1TWAH 1RCVD 5ELOA 1IL8A 1PFBA 3KF8B 3S16B 1SNOA 3HEJA 3I72A 2DJFC 2VQEL 1QG7A 1WD0A 2I07B 1KL9A 1C4QA 1VQAA 2JN4A 1ML0D 3J80i 1Y8NB 2E2DC 3CHBD 3TP6A 4JBKA 1N33L 3EROA 2G9HD 5FKAC 1N8RC 1LTRD 1E0BA 4QGUA 1QUQA 5IYDG 3NTKA 3M4OH 4HTHA 4IJHA 4LF4L 1QWYA 4Y52H 1TU2B 4KN7C 2EYMA 2GN5A 4A93B 2Z0SA 4YHHQ 4O1NA 1WTOA 4LF7L 1B4OA 4DNRB 2Q8RE 1NCVA 2JA8G 1V43A 3IFDA 2IT1A 1V1OA 4GOPA 3G71A 3VYRA 1JJ2A 1KNEA 4DV2Q 3ONAB 1VQJA 3L3OC 3TREA 2K28A 1D1IA 5FJ8H 2R93B 2NVTB 1EUJA 4YCVA 3G48A 3HOUH 3I4MH 5C5LA 4PZ8A 4DR2Q 2VUMB 1IYVA 2F0OA 1EFWA 1CZWA 1C9OA 1SNQA 2E2IB 4KD4A 4K5VA 1Y1WH 3H0GG 2RDGA 2UUAL 4LFAL 1W6KA 4JBJA 3A5ZB 3CCUA 1D5ZC 1U5KA 5C4JH 1Q90A 1EEFD
chains in the Genus database with same CATH topology
1IXRA 2K50A 1X55A 3CCJA 2R7ZH 4IFDG 4DKAC 2UU9Q 4DV3Q 4HIDA 5AJ3Q 1CSPA 3BU2A 4DUYL 4JI7L 1YITA 2VQFL 3KOJA 2NN6I 1AE2A 2HIVA 2RF4A 3KDFB 1VQIA 3STBC 2D62A 3H15A 3PO3G 4A3GH 4GLAC 1E3PA 3G6EA 1VQNA 1MKHA 1OXSC 2NN6G 4LW1A 5GAGC 4DV4L 5IWAQ 4DV4Q 1PV4A 1VQ9A 3GTPH 2AKWB 1HZ9A 1Q12A 3PIPA 1GM5A 1PVOA 1A8VA 2CFMA 3TRZA 2MQHA 4C2MH 1XJVA 4B3RL 4A3GG 4LF6Q 1K83H 1Q1BA 5IY0A 2QEXA 3FHWA 5FLMH 1EQRA 4YY3Q 4DV1Q 1VQ8A 4O0AA 2UU9L 2JQOA 2NVYH 1C7YA 2AWOA 1L1OC 1J5EQ 4B3SQ 2UXDQ 4BBSG 4DR5L 2JA5H 5M3MG 4MTNA 4UPAA 4A3IH 3HKZE 5EAYA 3L7ZC 4JI8L 1E1TA 1PYBA 1CUKA 3CCEA 4DUZL 2VW9A 4JI2L 1L1OA 1KHIA 2WFWA 2MFIA 3LGJA 1FVIA 4KLKA 5DLQE 1P16A 2WB1E 2EXDA 1HNXQ 2K75A 4A3EG 1HR0Q 4QJFA 1S40A 5IYDH 2UUCL 1PFSA 1QVFA 1KQSA 1SRUA 2UUBQ 2R6GA 4HIMA 1YIJA 1EOVA 3FP9A 3DM3A 1OXUA 4KHPQ 2NZHA 1XMOQ 1XMOL 3GTGH 1JT8A 1TXYA 3HKSA 3J7ZC 3GTLH 4BA1I 4EQ5A 2KCMA 3S15H 1BBWA 4JI0Q 4X62L 3KJPA 1YBYA 4GKJQ 1H95A 5GAHC 1P8LA 4JI1L 2B63G 1KAWA 4GKKQ 4A3LH 2JA8H 3CW2C 3RLFA 1YJWA 1TWHH 1T9HA 5GROA 3H3VH 5C44H 3TS0A 1L0WA 3KJOA 3CCSA 2OTJA 3AQQA 3T1HQ 2PI2A 4DR7L 4K0KQ 1PH1A 1Y14B 3PUZA 3M4QA 4UP9A 1N36L 2YYZA 2ES2A 4B3SL 4LF5Q 3OTOQ 5M3FG 1SLJA 2OWOA 1VQ5A 2UXCL 3GTKH 4MNOA 3ICEA 1PH4A 1G51A 2DUDA 2IX0A 1YI2A 3AFQA 4DV5Q 1KXLA 3JAMi 5JEAJ 5C3EH 1VQGA 3PCOB 4J15A 4C3IH 2L15A 5ELNA 4A93G 1SROA 1YJ9A 3PUWA 1E22A 1Q1EA 1GKHA 1YHBA 3L2PA 3G4SA 4A3LG 1X54A 3M9BA 4NB3A 4DR1Q 4X64L 4LF4Q 1LM0A 2CWPA 5GADC 1Q82C 4OWTB 2BH2A 3ULPA 2VS1A 4OXPA 3K8AA 3DLLA 2BA0A 3CMAA 1Q81C 1G6PA 3CPFA 3TS2A 1PH8A 4DAYB 4IFDJ 1Y1VG 1XTDA 4DUYQ 1BVSA 4JI7Q 2JJQA 1E7ZA 1EWIA 5GAEC 3NELA 1X3GA 2R93H 2AWNA 3UE0A 4DV5L 3I56A 5C4XH 2YTXA 4L5QA 4O2DA 3M85A 2ZJQA 1YZ6A 2N49A 1I3QH 1V1QA 1NBWA 4JC0A 1PH5A 4DPGA 4GOPC 1UE1A 2ZTCA 3PUVA 3A0JA 1K8AC 4UY8C 1NMFA 1L1OB 4NXMQ 2LXJA 1J6QA 1FJGQ 1X3FA 3CC2A 1LTLA 2RCNA 5IP7H 4BY7H 1SFOH 4BBRH 1XNQQ 3TQYA 4JBMA 2JA5G 1Q8KA 3I55A 1PH6A 2E5LL 1I6HH 5JJLA 1VQ6A 5LMNW 3FKIH 4X66L 3KFUA 2AHOB 4P71A 4DR2L 4A3KH 1E24A 3PGZA 4A3MH 1MIUA 2K14A 4MZ9A 4EX5A 2YTVA 3CXCA 4X65Q 4P74A 5H1SE 2I5MX 2PI2E 4JYAL 2KHJA 1GVPA 4IO9A 1EIYB 1A0IA 5BR8L 2OTLA 1UE5A 3J81i 1I50H 1VQBA 3K0XA 4R4OA 3A5UA 2Q2TA 2F52A 4JI4Q 4LF5L 5C0XG 1KRTA 3ZJYC 5HY6A 1ASYA 3HOVG 2ASBA 1K0RA 3JC66 4LWCA 4POGA 3W5OA 3AEVA 4A3CH 1EIFA 1HH2P 1IBMQ 3CP0A 4JG2A 1X6OA 3GO5A 2YV5A 2A8VA 1UE6A 1K9MC 1Q46A 5HGQA 3KDFA 1Y1VH 4A3MG 4JI1Q 1LUZA 4GN3B 3GTJH 4A3BH 3GTQH 1Z47A 3PIOA 5IE8A 2JA9A 5IYBG 4LFBQ 1RIPA 4LF7Q 1UEBA 2CQOA 4YCUA 4YWKA 4NXML 4B3TQ 3M4PA 1OTCA 1S72A 1A62A 5IP9G 1CKMA 3GDEA 1JMCA 3I7FA 4B3RQ 4A3DG 4GNXC 4PG3A 1QVCA 1NMGA 2YTYA 2ZJRA 3SGIA 4IPCA 4AYBE 3ULLA 1WCMG 3JAMc 2RHSB 2JK8A 4GLXA 1BKBA 3PF5A 4AH6A 4OONA 3HOXH 2D0PA 4JV5Q 4DR3L 4LF8Q 2HQLA 4TVAB 2RHQB 3F2BA 1VQCA 3PUYA 4A3JH 4DR3Q 3CC7A 4LF8L 4R4IA 4POFA 1KC8C 1IZ6A 4ME3A 3S24A 1VQHA 2UXDL 2JA6H 3UDGA 4DR4Q 1EQQA 2ATWA 3RR5A 1LYLA 1S3OA 3TEHB 5FJ8G 4IOAA 2ZM6L 1HNWQ 1TWFH 2KHIA 2GVAA 2Z6KC 4L5SA 1U0LA 4BXXG 3NBHB 1SR3A 4A3EH 1XMQL 2HHHQ 5C3EG 4BBSH 4IPDA 1W3SA 3E9HA 4B3TL 5C0XJ 1HJPA 4DR4L 3OTOL 5IT9c 2IHFA 4BY7G 4P75A 2K4KA 1HNZL 3S17H 3PV0A 3T1HL 2NVTH 1AE3A 2NZOA 4DR7Q 1VQMA 4DV0Q 3PO2H 2XGTA 3RLNA 3J81c 4DV7L 1QZHA 1NJIC 4A3DH 4GKKL 3HOZH 4OO1G 4JV5L 1IBML 3CF5A 4JI5Q 2K5HA 4RG1A 1XNRQ 5IP9H 4NPSA 3EN2A 4GKJL 1N32L 4DK3C 2N78A 2R7FA 4IPHA 2R93G 2I5HA 2B63H 1NTGA 3ULJA 1N34Q 3F2CA 3RLOA 2GVBA 1QVGA 4OO1I 4FDBA 3U58A 2WB1G 2KENA 2UXBL 2N8NA 3BZKA 3CAMA 4L5TA 1JE5A 3T1YQ 2VL6A 3I4NG 4K0KL 3NENA 3RNUA 4IFDI 1IL2A 1OXXK 2EQSA 2JE6I 1NY4A 2ZTEA 3D31A 3KLWA 2UUCQ 4B3MQ 3PO3H 3A74A 4YCWA 3F1ZA 4LF9L 2WP8J 1IBKL 4DV6Q 2C35B 4PZ6A 2JA6G 3HOYG 2BA1A 3H3VI 1PH7A 1VQDA 5LMNQ 1D8LA 1IBKQ 4JI2Q 1VS0A 1AH9A 2Q2UA 4JI0L 2V1CC 4LUVA 4QIWE 4B3ML 1WI5A 2R7DA 3EBEA 5E7NA 2E2IH 1FJGL 1IBLL 4DR5Q 3RZDH 1XPRA 3CCMA 4HJ8A 1PH2A 1I94Q 3KF6A 3J81j 4BY1G 3M7NA 1V9PA 1HZCA 1HZAA 3EIVA 5BR8Q 4PMWA 3I4OA 1QUQB 1FGUA 3W1GA 4DV1L 4A3FG 4KHPL 3CCVA 4YWMA 4X65L 2PMZE 1HR0W 2LSSA 5FLMG 4GOPB 3S2HH 3Q8DA 3CQZH 4APVA 4YWLA 4JI5L 5JEAG 1R9TH 1VQ7A 3RN2A 4X66Q 1OXVA 4LUZA 5M3FH 3CC4A 4A3IG 4WJ3M 1N33Q 1VQEA 2MNAA 4H02A 5M5YH 4AIMA 3S14H 2MO0A 1PYSB 3NEMA 4A3BG 2I5LX 3PO2G 1XNQL 2JA7H 3I4MG 4A93H 4GNXB 1HNZQ 4A76A 1Y1WG 2K52A 4IOCA 3IRBA 3WWVA 2VQEQ 1QZGA 1PA6A 2Q2HA 4YY3L 1YVCA 4TQUS 3K81C 1XMQQ 4HJ5A 2HHHL 3L0OA 3I4NH 3U50C 1GO3E 1N9WA 3J80c 4DV3L 2JA7G 4X6AH 4BXXH 2DGYA 3MXNB 1B7YB 4C3JH 1JJGA 1E1OA 1CKOA 3CD6A 2R7ZG 2JEAI 1YHAA 2AMCB 5M5WH 1JJCB 1KIXA 1O7IA 4R1JA 4JI6Q 1B70B 4LFAQ 2UUAQ 1IYJB 4A3KG 3S1RH 4DAMA 2N3SA 5K36G 2LXKA 3ERSX 2R92G 3PF4A 4A3JG 5FLXc 4DR1L 3HKZG 4GN5A 1I5FA 1VQ4A 1KD1C 4BY1H 4JI3Q 1WFQA 2F4VQ 3D0FA 5GQOA 3UE1A 5AJ3L 4P72A 1K73C 1YHQA 3HOWG 1I94L 2ZTDA 3GTOH 2PNHA 1TWGH 1YEZA 4RMFA 5IYBH 4HJ9A 1VQPA 4BA2I 1IBLQ 3CCLA 3STBD 3S1MH 3GD7A 1WYDA 3UDXA 1OXTA 4L5RC 3U4VA 2K5VA 1SMXA 2CKZB 1HZBA 2FXQA 1BBUA 4HJ7A 2E2HH 2OCEA 3M3YH 2UXCQ 2B3GA 2VUMG 1K3RA 4A4IA 2UUBL 1SN8A 4AYBG 4JOIA 3B6YA 2CWAA 4HIKA 1Q86C 1HR0L 5C0XI 5JJIA 1WOCA 2Z6KA 1X65A 3U4ZA 4P73A 3HOYH 4DUZQ 4JCVE 3HOUG 2OQKA 3T1YL 4QL5A 1X3EA 3W1BA 4JI8Q 2QA4A 4X62Q 1KRSA 4AQYQ 2QGQA 1WCMH 1PH3A 1J5EL 4QQBX 4NXNL 4NXNQ 2MO1A 2PQAB 4JI4L 2OQ0A 4AQYL 3AFPA 3CPWA 4GS3A 4YHHL 4LNQA 3HOZG 5IYCH 3RZOH 1NE3A 1Z9FA 3CCQA 3VDYA 1XNRL 1YJNA 3OW2A 1CKNB 1FL0A 3E9IA 3H0GH 3UDFA 3K7AH 3ER0A 4GN4B 4R4QA 4XTCS 1TWCH 4OWWB 4DV0L 1W2BA 5IP7G 1YNXA 2D0OA 3KF6B 4DNIA 2ALYB 1GD7A 4HIOA 2CCZA 4JI6L 5IWAL 2IX1A 4WJ4A 3BJUA 1VCIA 3FKIG 2H5XA 3UDIA 2BH8A 2Y0SG 1XPUA 4OX9Q 2R92H 1PH9A 3S1NH 3MEFA 4R4CA 1TWAH 4DK6C 4UP8A 5ELOA 1X9NA 1VQKA 5LMUQ 3PUXA 2VQFQ 3KF8B 4C3HH 2ZM6Q 1HNWL 5J3BA 2XTIA 1CSQA 3I2ZA 2VQEL 2E2JH 4LFCQ 3F2DA 4JI3L 2NVQH 4ALPA 4LF6L 1B8AA 1KL9A 1VQAA 3PSIA 1C0AA 3HOXG 3J80i 4HJAA 1Q7YC 4JBKA 3CMEA 2HT1A 1N33L 4UP7A 2WAQE 1N8RC 1D7QA 3HOVH 3AYHB 2NVXH 2VNUD 4QGUA 1QUQA 5IYDG 4JBWA 3S1QH 3M4OH 4IJHA 4IPGA 2A19A 4X64Q 3OYYA 4LF4L 4Y52H 1WJJA 4IJLA 2KCTA 1ASZA 2EIFA 4A75A 4GLVB 4LFCL 4BBRG 1M1KC 3RN5A 2GN5A 3BZCA 5JJKA 2HIXA 2VY3A 4R4TA 2Z0SA 5LMUL 4Y7NH 3HFZB 2VZAA 4YHHQ 4LF7L 5IYCG 1X56A 4LFBL 5C44G 2JEBI 1G291 3E0EA 3J7A5 4DR6L 4OX9L 3GTMH 2JA8G 5LMNL 1N36Q 1V43A 2F3IA 2ID0A 4QY7A 1MJCA 4LF9Q 4JOIC 2IT1A 4GOPA 3G71A 1JJ2A 2YU9H 1UE7A 2WAQG 4DV2Q 3K7UC 1VQJA 2IHEA 2KBNA 2I0QA 2Y0SE 3CCRA 1VQOA 2PQAA 3TREA 4XIGS 2UXBQ 1K8GA 5FJ8H 4OWXB 1CKNA 4LUOA 4KI0A 1DGSA 4JYAQ 3F8TA 3K80C 4GNXA 1EUJA 4YCVA 3G48A 1EYGA 3HOUH 1RL2A 1N32Q 3I4MH 3KYHC 1XPOA 1VQFA 4PZ8A 4DR2Q 1VQLA 4KHZA 2F4VL 4DV7Q 1PHJA 2B29A 3HOWH 2E5LQ 2A1AA 1EFWA 1C9OA 4DV6L 2VUMH 1SE8A 5M3MH 4DV2L 1UWVA 1JB7A 1Y1WH 3H0GG 1HNXL 2ZJPA 2IY5B 1MJEA 2K5NA 2E8GA 2UUAL 4LFAL 4JBJA 1L2FA 2Q2IA 4PZ7A 4A3FH 4A3CG 3A5ZB 5M5XH 3CCUA 3S16H 1U5KA 3S2DH 1M90C 5C4JH 5C4XG 4DR6Q 1A63A 1N34L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXR A;  2K50 A;  1X55 A;  3CCJ A;  2R7Z H;  4IFD G;  4DKA C;  2UU9 Q;  4DV3 Q;  4HID A;  5AJ3 Q;  1CSP A;  3BU2 A;  4DUY L;  4JI7 L;  1YIT A;  2VQF L;  3KOJ A;  2NN6 I;  1AE2 A;  2HIV A;  2RF4 A;  3KDF B;  1VQI A;  3STB C;  2D62 A;  3H15 A;  3PO3 G;  4A3G H;  4GLA C;  1E3P A;  3G6E A;  1VQN A;  1MKH A;  1OXS C;  2NN6 G;  4LW1 A;  5GAG C;  4DV4 L;  5IWA Q;  4DV4 Q;  1PV4 A;  1VQ9 A;  3GTP H;  2AKW B;  1HZ9 A;  1Q12 A;  3PIP A;  1GM5 A;  1PVO A;  1A8V A;  2CFM A;  3TRZ A;  2MQH A;  4C2M H;  1XJV A;  4B3R L;  4A3G G;  4LF6 Q;  1K83 H;  1Q1B A;  5IY0 A;  2QEX A;  3FHW A;  5FLM H;  1EQR A;  4YY3 Q;  4DV1 Q;  1VQ8 A;  4O0A A;  2UU9 L;  2JQO A;  2NVY H;  1C7Y A;  2AWO A;  1L1O C;  1J5E Q;  4B3S Q;  2UXD Q;  4BBS G;  4DR5 L;  2JA5 H;  5M3M G;  4MTN A;  4UPA A;  4A3I H;  3HKZ E;  5EAY A;  3L7Z C;  4JI8 L;  1E1T A;  1PYB A;  1CUK A;  3CCE A;  4DUZ L;  2VW9 A;  4JI2 L;  1L1O A;  1KHI A;  2WFW A;  2MFI A;  3LGJ A;  1FVI A;  4KLK A;  5DLQ E;  1P16 A;  2WB1 E;  2EXD A;  1HNX Q;  2K75 A;  4A3E G;  1HR0 Q;  4QJF A;  1S40 A;  5IYD H;  2UUC L;  1PFS A;  1QVF A;  1KQS A;  1SRU A;  2UUB Q;  2R6G A;  4HIM A;  1YIJ A;  1EOV A;  3FP9 A;  3DM3 A;  1OXU A;  4KHP Q;  2NZH A;  1XMO Q;  1XMO L;  3GTG H;  1JT8 A;  1TXY A;  3HKS A;  3J7Z C;  3GTL H;  4BA1 I;  4EQ5 A;  2KCM A;  3S15 H;  1BBW A;  4JI0 Q;  4X62 L;  3KJP A;  1YBY A;  4GKJ Q;  1H95 A;  5GAH C;  1P8L A;  4JI1 L;  2B63 G;  1KAW A;  4GKK Q;  4A3L H;  2JA8 H;  3CW2 C;  3RLF A;  1YJW A;  1TWH H;  1T9H A;  5GRO A;  3H3V H;  5C44 H;  3TS0 A;  1L0W A;  3KJO A;  3CCS A;  2OTJ A;  3AQQ A;  3T1H Q;  2PI2 A;  4DR7 L;  4K0K Q;  1PH1 A;  1Y14 B;  3PUZ A;  3M4Q A;  4UP9 A;  1N36 L;  2YYZ A;  2ES2 A;  4B3S L;  4LF5 Q;  3OTO Q;  5M3F G;  1SLJ A;  2OWO A;  1VQ5 A;  2UXC L;  3GTK H;  4MNO A;  3ICE A;  1PH4 A;  1G51 A;  2DUD A;  2IX0 A;  1YI2 A;  3AFQ A;  4DV5 Q;  1KXL A;  3JAM i;  5JEA J;  5C3E H;  1VQG A;  3PCO B;  4J15 A;  4C3I H;  2L15 A;  5ELN A;  4A93 G;  1SRO A;  1YJ9 A;  3PUW A;  1E22 A;  1Q1E A;  1GKH A;  1YHB A;  3L2P A;  3G4S A;  4A3L G;  1X54 A;  3M9B A;  4NB3 A;  4DR1 Q;  4X64 L;  4LF4 Q;  1LM0 A;  2CWP A;  5GAD C;  1Q82 C;  4OWT B;  2BH2 A;  3ULP A;  2VS1 A;  4OXP A;  3K8A A;  3DLL A;  2BA0 A;  3CMA A;  1Q81 C;  1G6P A;  3CPF A;  3TS2 A;  1PH8 A;  4DAY B;  4IFD J;  1Y1V G;  1XTD A;  4DUY Q;  1BVS A;  4JI7 Q;  2JJQ A;  1E7Z A;  1EWI A;  5GAE C;  3NEL A;  1X3G A;  2R93 H;  2AWN A;  3UE0 A;  4DV5 L;  3I56 A;  5C4X H;  2YTX A;  4L5Q A;  4O2D A;  3M85 A;  2ZJQ A;  1YZ6 A;  2N49 A;  1I3Q H;  1V1Q A;  1NBW A;  4JC0 A;  1PH5 A;  4DPG A;  4GOP C;  1UE1 A;  2ZTC A;  3PUV A;  3A0J A;  1K8A C;  4UY8 C;  1NMF A;  1L1O B;  4NXM Q;  2LXJ A;  1J6Q A;  1FJG Q;  1X3F A;  3CC2 A;  1LTL A;  2RCN A;  5IP7 H;  4BY7 H;  1SFO H;  4BBR H;  1XNQ Q;  3TQY A;  4JBM A;  2JA5 G;  1Q8K A;  3I55 A;  1PH6 A;  2E5L L;  1I6H H;  5JJL A;  1VQ6 A;  5LMN W;  3FKI H;  4X66 L;  3KFU A;  2AHO B;  4P71 A;  4DR2 L;  4A3K H;  1E24 A;  3PGZ A;  4A3M H;  1MIU A;  2K14 A;  4MZ9 A;  4EX5 A;  2YTV A;  3CXC A;  4X65 Q;  4P74 A;  5H1S E;  2I5M X;  2PI2 E;  4JYA L;  2KHJ A;  1GVP A;  4IO9 A;  1EIY B;  1A0I A;  5BR8 L;  2OTL A;  1UE5 A;  3J81 i;  1I50 H;  1VQB A;  3K0X A;  4R4O A;  3A5U A;  2Q2T A;  2F52 A;  4JI4 Q;  4LF5 L;  5C0X G;  1KRT A;  3ZJY C;  5HY6 A;  1ASY A;  3HOV G;  2ASB A;  1K0R A;  3JC6 6;  4LWC A;  4POG A;  3W5O A;  3AEV A;  4A3C H;  1EIF A;  1HH2 P;  1IBM Q;  3CP0 A;  4JG2 A;  1X6O A;  3GO5 A;  2YV5 A;  2A8V A;  1UE6 A;  1K9M C;  1Q46 A;  5HGQ A;  3KDF A;  1Y1V H;  4A3M G;  4JI1 Q;  1LUZ A;  4GN3 B;  3GTJ H;  4A3B H;  3GTQ H;  1Z47 A;  3PIO A;  5IE8 A;  2JA9 A;  5IYB G;  4LFB Q;  1RIP A;  4LF7 Q;  1UEB A;  2CQO A;  4YCU A;  4YWK A;  4NXM L;  4B3T Q;  3M4P A;  1OTC A;  1S72 A;  1A62 A;  5IP9 G;  1CKM A;  3GDE A;  1JMC A;  3I7F A;  4B3R Q;  4A3D G;  4GNX C;  4PG3 A;  1QVC A;  1NMG A;  2YTY A;  2ZJR A;  3SGI A;  4IPC A;  4AYB E;  3ULL A;  1WCM G;  3JAM c;  2RHS B;  2JK8 A;  4GLX A;  1BKB A;  3PF5 A;  4AH6 A;  4OON A;  3HOX H;  2D0P A;  4JV5 Q;  4DR3 L;  4LF8 Q;  2HQL A;  4TVA B;  2RHQ B;  3F2B A;  1VQC A;  3PUY A;  4A3J H;  4DR3 Q;  3CC7 A;  4LF8 L;  4R4I A;  4POF A;  1KC8 C;  1IZ6 A;  4ME3 A;  3S24 A;  1VQH A;  2UXD L;  2JA6 H;  3UDG A;  4DR4 Q;  1EQQ A;  2ATW A;  3RR5 A;  1LYL A;  1S3O A;  3TEH B;  5FJ8 G;  4IOA A;  2ZM6 L;  1HNW Q;  1TWF H;  2KHI A;  2GVA A;  2Z6K C;  4L5S A;  1U0L A;  4BXX G;  3NBH B;  1SR3 A;  4A3E H;  1XMQ L;  2HHH Q;  5C3E G;  4BBS H;  4IPD A;  1W3S A;  3E9H A;  4B3T L;  5C0X J;  1HJP A;  4DR4 L;  3OTO L;  5IT9 c;  2IHF A;  4BY7 G;  4P75 A;  2K4K A;  1HNZ L;  3S17 H;  3PV0 A;  3T1H L;  2NVT H;  1AE3 A;  2NZO A;  4DR7 Q;  1VQM A;  4DV0 Q;  3PO2 H;  2XGT A;  3RLN A;  3J81 c;  4DV7 L;  1QZH A;  1NJI C;  4A3D H;  4GKK L;  3HOZ H;  4OO1 G;  4JV5 L;  1IBM L;  3CF5 A;  4JI5 Q;  2K5H A;  4RG1 A;  1XNR Q;  5IP9 H;  4NPS A;  3EN2 A;  4GKJ L;  1N32 L;  4DK3 C;  2N78 A;  2R7F A;  4IPH A;  2R93 G;  2I5H A;  2B63 H;  1NTG A;  3ULJ A;  1N34 Q;  3F2C A;  3RLO A;  2GVB A;  1QVG A;  4OO1 I;  4FDB A;  3U58 A;  2WB1 G;  2KEN A;  2UXB L;  2N8N A;  3BZK A;  3CAM A;  4L5T A;  1JE5 A;  3T1Y Q;  2VL6 A;  3I4N G;  4K0K L;  3NEN A;  3RNU A;  4IFD I;  1IL2 A;  1OXX K;  2EQS A;  2JE6 I;  1NY4 A;  2ZTE A;  3D31 A;  3KLW A;  2UUC Q;  4B3M Q;  3PO3 H;  3A74 A;  4YCW A;  3F1Z A;  4LF9 L;  2WP8 J;  1IBK L;  4DV6 Q;  2C35 B;  4PZ6 A;  2JA6 G;  3HOY G;  2BA1 A;  3H3V I;  1PH7 A;  1VQD A;  5LMN Q;  1D8L A;  1IBK Q;  4JI2 Q;  1VS0 A;  1AH9 A;  2Q2U A;  4JI0 L;  2V1C C;  4LUV A;  4QIW E;  4B3M L;  1WI5 A;  2R7D A;  3EBE A;  5E7N A;  2E2I H;  1FJG L;  1IBL L;  4DR5 Q;  3RZD H;  1XPR A;  3CCM A;  4HJ8 A;  1PH2 A;  1I94 Q;  3KF6 A;  3J81 j;  4BY1 G;  3M7N A;  1V9P A;  1HZC A;  1HZA A;  3EIV A;  5BR8 Q;  4PMW A;  3I4O A;  1QUQ B;  1FGU A;  3W1G A;  4DV1 L;  4A3F G;  4KHP L;  3CCV A;  4YWM A;  4X65 L;  2PMZ E;  1HR0 W;  2LSS A;  5FLM G;  4GOP B;  3S2H H;  3Q8D A;  3CQZ H;  4APV A;  4YWL A;  4JI5 L;  5JEA G;  1R9T H;  1VQ7 A;  3RN2 A;  4X66 Q;  1OXV A;  4LUZ A;  5M3F H;  3CC4 A;  4A3I G;  4WJ3 M;  1N33 Q;  1VQE A;  2MNA A;  4H02 A;  5M5Y H;  4AIM A;  3S14 H;  2MO0 A;  1PYS B;  3NEM A;  4A3B G;  2I5L X;  3PO2 G;  1XNQ L;  2JA7 H;  3I4M G;  4A93 H;  4GNX B;  1HNZ Q;  4A76 A;  1Y1W G;  2K52 A;  4IOC A;  3IRB A;  3WWV A;  2VQE Q;  1QZG A;  1PA6 A;  2Q2H A;  4YY3 L;  1YVC A;  4TQU S;  3K81 C;  1XMQ Q;  4HJ5 A;  2HHH L;  3L0O A;  3I4N H;  3U50 C;  1GO3 E;  1N9W A;  3J80 c;  4DV3 L;  2JA7 G;  4X6A H;  4BXX H;  2DGY A;  3MXN B;  1B7Y B;  4C3J H;  1JJG A;  1E1O A;  1CKO A;  3CD6 A;  2R7Z G;  2JEA I;  1YHA A;  2AMC B;  5M5W H;  1JJC B;  1KIX A;  1O7I A;  4R1J A;  4JI6 Q;  1B70 B;  4LFA Q;  2UUA Q;  1IYJ B;  4A3K G;  3S1R H;  4DAM A;  2N3S A;  5K36 G;  2LXK A;  3ERS X;  2R92 G;  3PF4 A;  4A3J G;  5FLX c;  4DR1 L;  3HKZ G;  4GN5 A;  1I5F A;  1VQ4 A;  1KD1 C;  4BY1 H;  4JI3 Q;  1WFQ A;  2F4V Q;  3D0F A;  5GQO A;  3UE1 A;  5AJ3 L;  4P72 A;  1K73 C;  1YHQ A;  3HOW G;  1I94 L;  2ZTD A;  3GTO H;  2PNH A;  1TWG H;  1YEZ A;  4RMF A;  5IYB H;  4HJ9 A;  1VQP A;  4BA2 I;  1IBL Q;  3CCL A;  3STB D;  3S1M H;  3GD7 A;  1WYD A;  3UDX A;  1OXT A;  4L5R C;  3U4V A;  2K5V A;  1SMX A;  2CKZ B;  1HZB A;  2FXQ A;  1BBU A;  4HJ7 A;  2E2H H;  2OCE A;  3M3Y H;  2UXC Q;  2B3G A;  2VUM G;  1K3R A;  4A4I A;  2UUB L;  1SN8 A;  4AYB G;  4JOI A;  3B6Y A;  2CWA A;  4HIK A;  1Q86 C;  1HR0 L;  5C0X I;  5JJI A;  1WOC A;  2Z6K A;  1X65 A;  3U4Z A;  4P73 A;  3HOY H;  4DUZ Q;  4JCV E;  3HOU G;  2OQK A;  3T1Y L;  4QL5 A;  1X3E A;  3W1B A;  4JI8 Q;  2QA4 A;  4X62 Q;  1KRS A;  4AQY Q;  2QGQ A;  1WCM H;  1PH3 A;  1J5E L;  4QQB X;  4NXN L;  4NXN Q;  2MO1 A;  2PQA B;  4JI4 L;  2OQ0 A;  4AQY L;  3AFP A;  3CPW A;  4GS3 A;  4YHH L;  4LNQ A;  3HOZ G;  5IYC H;  3RZO H;  1NE3 A;  1Z9F A;  3CCQ A;  3VDY A;  1XNR L;  1YJN A;  3OW2 A;  1CKN B;  1FL0 A;  3E9I A;  3H0G H;  3UDF A;  3K7A H;  3ER0 A;  4GN4 B;  4R4Q A;  4XTC S;  1TWC H;  4OWW B;  4DV0 L;  1W2B A;  5IP7 G;  1YNX A;  2D0O A;  3KF6 B;  4DNI A;  2ALY B;  1GD7 A;  4HIO A;  2CCZ A;  4JI6 L;  5IWA L;  2IX1 A;  4WJ4 A;  3BJU A;  1VCI A;  3FKI G;  2H5X A;  3UDI A;  2BH8 A;  2Y0S G;  1XPU A;  4OX9 Q;  2R92 H;  1PH9 A;  3S1N H;  3MEF A;  4R4C A;  1TWA H;  4DK6 C;  4UP8 A;  5ELO A;  1X9N A;  1VQK A;  5LMU Q;  3PUX A;  2VQF Q;  3KF8 B;  4C3H H;  2ZM6 Q;  1HNW L;  5J3B A;  2XTI A;  1CSQ A;  3I2Z A;  2VQE L;  2E2J H;  4LFC Q;  3F2D A;  4JI3 L;  2NVQ H;  4ALP A;  4LF6 L;  1B8A A;  1KL9 A;  1VQA A;  3PSI A;  1C0A A;  3HOX G;  3J80 i;  4HJA A;  1Q7Y C;  4JBK A;  3CME A;  2HT1 A;  1N33 L;  4UP7 A;  2WAQ E;  1N8R C;  1D7Q A;  3HOV H;  3AYH B;  2NVX H;  2VNU D;  4QGU A;  1QUQ A;  5IYD G;  4JBW A;  3S1Q H;  3M4O H;  4IJH A;  4IPG A;  2A19 A;  4X64 Q;  3OYY A;  4LF4 L;  4Y52 H;  1WJJ A;  4IJL A;  2KCT A;  1ASZ A;  2EIF A;  4A75 A;  4GLV B;  4LFC L;  4BBR G;  1M1K C;  3RN5 A;  2GN5 A;  3BZC A;  5JJK A;  2HIX A;  2VY3 A;  4R4T A;  2Z0S A;  5LMU L;  4Y7N H;  3HFZ B;  2VZA A;  4YHH Q;  4LF7 L;  5IYC G;  1X56 A;  4LFB L;  5C44 G;  2JEB I;  1G29 1;  3E0E A;  3J7A 5;  4DR6 L;  4OX9 L;  3GTM H;  2JA8 G;  5LMN L;  1N36 Q;  1V43 A;  2F3I A;  2ID0 A;  4QY7 A;  1MJC A;  4LF9 Q;  4JOI C;  2IT1 A;  4GOP A;  3G71 A;  1JJ2 A;  2YU9 H;  1UE7 A;  2WAQ G;  4DV2 Q;  3K7U C;  1VQJ A;  2IHE A;  2KBN A;  2I0Q A;  2Y0S E;  3CCR A;  1VQO A;  2PQA A;  3TRE A;  4XIG S;  2UXB Q;  1K8G A;  5FJ8 H;  4OWX B;  1CKN A;  4LUO A;  4KI0 A;  1DGS A;  4JYA Q;  3F8T A;  3K80 C;  4GNX A;  1EUJ A;  4YCV A;  3G48 A;  1EYG A;  3HOU H;  1RL2 A;  1N32 Q;  3I4M H;  3KYH C;  1XPO A;  1VQF A;  4PZ8 A;  4DR2 Q;  1VQL A;  4KHZ A;  2F4V L;  4DV7 Q;  1PHJ A;  2B29 A;  3HOW H;  2E5L Q;  2A1A A;  1EFW A;  1C9O A;  4DV6 L;  2VUM H;  1SE8 A;  5M3M H;  4DV2 L;  1UWV A;  1JB7 A;  1Y1W H;  3H0G G;  1HNX L;  2ZJP A;  2IY5 B;  1MJE A;  2K5N A;  2E8G A;  2UUA L;  4LFA L;  4JBJ A;  1L2F A;  2Q2I A;  4PZ7 A;  4A3F H;  4A3C G;  3A5Z B;  5M5X H;  3CCU A;  3S16 H;  1U5K A;  3S2D H;  1M90 C;  5C4J H;  5C4X G;  4DR6 Q;  1A63 A;  1N34 L; 
#chains in the Genus database with same CATH topology
 1IXR A;  2K50 A;  3I70 A;  4FVM A;  1UEA B;  3SR1 A;  1ESR A;  3VR4 A;  3GV3 A;  3KOJ A;  2K32 A;  1AE2 A;  1T5X D;  2C9O A;  3A7A B;  3IKJ A;  1BOS A;  5ISR A;  1E3P A;  3G6E A;  4KK7 A;  1VQN A;  1O7L A;  2KUM A;  1KDA A;  1PRT F;  1A6X A;  2RA4 A;  4LW1 A;  4DV4 Q;  4A93 G;  1C0A A;  3PIP A;  2H1E A;  1Q8I A;  2B8G A;  2CFM A;  3GQB A;  2PNR C;  3TRZ A;  4XYO A;  1EOT A;  4CHT B;  2L1B A;  2DY7 A;  5FLM H;  1D1K A;  2RSN A;  1C7Y A;  2AWO A;  1L1O C;  1FNW A;  1XXG A;  4RKB A;  3MHB A;  4IUV A;  2JA5 H;  4UPA A;  1HQM C;  3C1E A;  2B2W C;  3GTG B;  4JI2 L;  1L1O A;  3LWU A;  2JA6 B;  3LGJ A;  2EVB A;  5DLQ E;  2F03 A;  2Z4I A;  2EXD A;  2E2J B;  4QJF A;  5IYD H;  4NDX A;  4F88 A;  1QVF A;  4DNT B;  2UUB Q;  2R6G A;  1I6H B;  1OXU A;  3VA7 A;  3P1H A;  1CZG A;  4LMQ D;  2QF7 A;  1TXY A;  4KKT A;  1IHZ A;  4C3J G;  4EQ5 A;  2KCM A;  3M3Y B;  3NPP A;  1F9R A;  4JI0 Q;  3KJP A;  1IW7 C;  1L0Y B;  2PMZ B;  1KNA A;  1BCP B;  3SEB A;  3RLF A;  3H3V H;  3CCS A;  3AQQ A;  3URY A;  1Y14 B;  4UP9 A;  1N36 L;  2ES2 A;  2R7Z B;  5M3F G;  1SLJ A;  4MNO A;  1G51 A;  4UHV A;  2E74 C;  3OPO A;  1BCP F;  2AUK A;  5I9O A;  5ELN A;  5IT9 L;  1MSG A;  3MZ5 A;  2KEC A;  1Q1E A;  1GKH A;  1YHB A;  5HUR A;  2R61 A;  1R4P B;  2HCI A;  3ULP A;  4A3K B;  4OXP A;  3BYY B;  1Z6H A;  1O7Z A;  2LFN A;  4XQJ A;  4IFD J;  1XTD A;  4DUY Q;  4JI7 Q;  3VR6 A;  3LWE A;  5GAE C;  5ELF A;  2ZT9 C;  3M85 A;  3T53 B;  2N49 A;  3RMH A;  3DHQ A;  4GOP C;  1EQT A;  1UE1 A;  2Y0S B;  2ZTC A;  5CC4 A;  1L1O B;  3EFX D;  2LXJ A;  1J6Q A;  3MTS A;  1K0S A;  2FHT A;  3NE5 B;  1SFO H;  2F0K A;  1XNQ Q;  1PXU A;  2IPK D;  3VYU A;  3I55 A;  3TP8 A;  1FYC A;  5FO9 B;  4A3M H;  3GV6 A;  4A3F B;  2I5M X;  2PI2 E;  2KHJ A;  4DAP A;  4IO9 A;  1GUN A;  4R4O A;  4LF5 L;  4RGT A;  3V2T A;  2XWJ B;  4PNY A;  3BDC A;  5HY6 A;  1WTV A;  3TN2 A;  1ASY A;  4XYQ A;  3HOV G;  2ASB A;  1K0R A;  4POG A;  4YIJ A;  1X6O A;  3GO5 A;  3NP8 A;  1Y1V H;  1RHP A;  1LUZ A;  3CKI B;  1F9P A;  2MUY A;  5IYB G;  3BDO A;  3TZU A;  1AN8 A;  1YNN D;  2B2T A;  1CKM A;  3GDE A;  1JMC A;  4CDC C;  4OO1 H;  1EWH A;  4KMU C;  4GNX C;  4PG3 A;  3C46 A;  3S14 B;  1QVC A;  3SGI A;  4IPC A;  1CHP D;  4AYB E;  2TMP A;  4ZLT F;  5C4Z A;  4GLX A;  4AH6 A;  3S9W A;  2F0W A;  1SYC A;  4DR3 L;  4LF8 Q;  1ENC A;  1PTO D;  1VQC A;  3PMF A;  2M9V A;  1ROD A;  3MXN A;  3S24 A;  5KYI A;  4MHE A;  4K6D A;  3HP3 A;  3RR5 A;  3TEH B;  4LK1 C;  2TSS A;  3PO2 B;  4ZKB B;  1BO0 A;  1CHQ D;  3NBH B;  4DAY A;  4A3E H;  3M4Y A;  1W3S A;  5IT9 c;  1F77 A;  2K4K A;  4P75 A;  4RHR A;  3S17 H;  3T1H L;  2NZO A;  1VQM A;  5M9O A;  2XGT A;  1A2U A;  4FO2 A;  4C3I G;  4A3D H;  2A73 B;  4GKK L;  2XRS D;  4M1U B;  4JI5 Q;  2K5H A;  4F8M A;  4NPS A;  2Z4H A;  3EN2 A;  4GKJ L;  2R7F A;  4IPH A;  2B63 H;  4BY1 B;  2SEB D;  3RLO A;  4QUF A;  1QVG A;  2EY2 A;  1MHW C;  2WB1 G;  5G3L F;  4K0K L;  5COY A;  1OXX K;  4BWG B;  4B3M Q;  2JE6 I;  2UUC Q;  3KLW A;  1A2T A;  5I6W A;  1DOM A;  3PIO 3;  1PH7 A;  3P20 A;  5KYL A;  1HUM A;  1AH9 A;  1PFM A;  2D5D A;  3DWP A;  4G57 A;  2R7D A;  3EBE A;  1FJG L;  1IBL L;  2F0D A;  4DR5 Q;  3MVV A;  3UI2 A;  1CT1 D;  4BY1 G;  4FXK C;  1HZC A;  1AFP A;  4DV1 L;  1FGU A;  2N55 A;  2KCN A;  2L55 A;  3P7J A;  1HR0 W;  1SJH D;  4YWL A;  3RN2 A;  3Q0A A;  1N33 Q;  1M4V A;  4AIM A;  1PYS B;  4IN3 A;  5D3D A;  2I5L X;  1XNQ L;  2JA7 H;  3DXJ C;  4A93 H;  1KAA A;  2EYF A;  2K01 A;  2VQE Q;  4YY3 L;  4TQU S;  3K81 C;  3E0J A;  2KA7 A;  3FKI B;  2HHH L;  5IOD A;  1GO3 E;  4BXX H;  4A3B B;  3BDL A;  1E1O A;  4HAE A;  3CD6 A;  1RTO A;  1JCK B;  1W6J A;  2AMC B;  2O5J C;  4R1J A;  3OIP A;  1PTO C;  5EBD A;  3S1R H;  1CQF A;  3NQT A;  2R92 G;  3S1Q B;  4ULL A;  3JAM L;  5FLX c;  5I6Y A;  1VQ4 A;  3GTJ B;  1JOQ A;  5AJ3 L;  1E2V A;  3UE1 A;  1YHQ A;  1SYE A;  3LX0 A;  1I94 L;  4BA2 I;  4HJ9 A;  2EYP A;  1OXT A;  3M3Y H;  1HZB A;  2OCE A;  3T4A C;  1BR9 A;  2X6G A;  2B3G A;  3C3L A;  2VUM G;  4AYB G;  1U9R A;  2CWA A;  1TS5 A;  3X3M A;  4HIK A;  1HUN A;  4PMB A;  2Z6K A;  2Z8L A;  1J8I A;  4JCV E;  3HOU G;  1JWS D;  4FF2 A;  5CV7 A;  4JI8 Q;  2QA4 A;  4AYB B;  4X3K A;  3SVM A;  1WCM H;  2VB2 X;  4DA2 A;  1J5E L;  4QQB X;  2MO1 A;  2PQA B;  3D4R A;  5KGU A;  3CPW A;  4QCL A;  1II3 A;  3PQI A;  4L6T B;  2MHV A;  5IYC H;  3HOZ G;  3VDY A;  3RZO H;  1XNR L;  1YJN A;  3H0G H;  3E9I A;  3N52 A;  3ER0 A;  4IUQ A;  5JPM C;  3EVQ A;  4DV0 L;  3E6Z X;  1DYQ A;  1M8A A;  2ALY B;  2E2H B;  1EL0 A;  4HIO A;  4JI6 L;  4WJ4 A;  5IWA L;  3FKI G;  1VCI A;  1LTB D;  1U4L A;  3MFY A;  3NTH A;  3GTQ B;  1PH9 A;  5CGK A;  4DK6 C;  4UP8 A;  2ZXP A;  1S5F D;  1VQK A;  5LMU Q;  1HNW L;  3N6R A;  2XTI A;  1AZQ A;  5IIF A;  1B8A A;  3PSI A;  3R3O A;  4KJO A;  1GHK A;  3TSS A;  4IUP A;  4HMI A;  3HOX G;  1A3U A;  5KNC A;  3E3X A;  1Q7Y C;  4IUT A;  5EPK A;  1D7Q A;  3F2U A;  2PQE A;  4ZYS A;  4A3D B;  3AMU A;  1B3Q A;  2A19 A;  1WJJ A;  3BVM A;  4LFC L;  4KKS A;  1M1K C;  4ZCK A;  3MEH A;  2KQ3 A;  1EYA A;  2X6L A;  5JJK A;  2HIX A;  4RHS A;  3HFZ B;  4QIW B;  3NWT A;  4OX9 L;  4BY7 B;  3RD4 A;  2F3I A;  2ID0 A;  4QY7 A;  4LF9 Q;  3WOE A;  3U9S A;  2YU9 H;  1UE7 A;  4H44 C;  2IHE A;  3HOZ B;  2Y0S E;  4FXG C;  4XIG S;  2UXB Q;  1CKN A;  3TP7 A;  2OF1 A;  4F87 A;  1N32 Q;  2WB1 B;  4PMC A;  4PV1 C;  1LT4 D;  2NTS A;  3OW7 A;  2KED A;  1H9R A;  2B29 A;  2VXW A;  2E5L Q;  3HOW H;  1WCM B;  2A5H A;  3W2D A;  5C3W A;  4DV2 L;  1UWV A;  1KDC A;  1JOO A;  2A74 C;  5CBA E;  3CRK C;  2Z1C A;  3KLS A;  5C4X G;  3KBX A;  4MTK A;  2FIN B;  3PO3 B;  1A63 A;  1ONL A;  1WTQ A;  1ICF B;  2UU9 Q;  5CV5 A;  3K5M A;  3NSW A;  1NNX A;  3VA5 A;  4JW0 A;  5IGB A;  1YIT A;  1RTN A;  1J9O A;  2BOS A;  1PZK D;  1ILP A;  1JWM D;  1PLF A;  4KY6 A;  4A3G H;  3KF8 A;  1C48 A;  1I4G A;  1VMP A;  2WKD A;  1KLG D;  5GAG C;  3GTP H;  3DWQ A;  2AKW B;  4XQN A;  1PVO A;  2CH4 W;  1A8V A;  2MQH A;  4C2M H;  1XJV A;  4B3R L;  4V0B A;  4A3G G;  1Q1B A;  5IY0 A;  4DV1 Q;  1G2T A;  3ND9 A;  4FP5 D;  3MA2 B;  4BBS G;  1BUV T;  4DR5 L;  1E1T A;  1GUG A;  5JEA H;  1CUK A;  4DUZ L;  1KHI A;  1EQV A;  2MFI A;  1FVI A;  4KLK A;  2B2U A;  1P16 A;  4IUU A;  1HNX Q;  1HR0 Q;  3H09 A;  2UUC L;  1PFS A;  1KQS A;  1SRU A;  1SSO A;  1YIJ A;  3OHX C;  3FP9 A;  1XMO Q;  1XMO L;  5IT9 E;  3GTG H;  2CQA A;  3J7Z C;  3GTL H;  1CQV A;  4BA1 I;  5C44 B;  5D14 A;  2KJX A;  3S15 H;  2JA8 B;  1BBW A;  4GKJ Q;  5JOB A;  4C3H G;  1P8L A;  3HZX A;  2DY8 A;  1WD1 A;  1KLU D;  4GKK Q;  2JA8 H;  3CW2 C;  1YJW A;  1T9H A;  3ND8 A;  5C44 H;  3TS0 A;  2OTJ A;  3T1H Q;  1EY0 A;  2L12 A;  4LF5 Q;  2NVX B;  2F0H A;  5BN5 A;  3C1F A;  2A68 C;  3ICE A;  4F7X A;  3ITP A;  4ZKC B;  3AFQ A;  3JAM i;  2K1B A;  3PCO B;  4J15 A;  4C3I H;  2L15 A;  3HRZ C;  3J81 E;  3PUW A;  1E22 A;  2CVR A;  3G4S A;  5C3E B;  4HN7 A;  4A3L G;  2B63 B;  4OHJ A;  4X64 L;  3HGB A;  1EY8 A;  2BH2 A;  2IWH A;  3K8A A;  5JVG 3;  2F0T A;  3CMA A;  2ZXR A;  3CPF A;  1PH8 A;  2BE5 D;  1BVS A;  1E7Z A;  3TZD A;  4TRD A;  4DV5 L;  4RCN A;  3R2I A;  4O2D A;  2JA5 B;  1B9M A;  1V1Q A;  1NBW A;  1PH5 A;  3I4M B;  3CC2 A;  4BY7 H;  4BBR H;  3TQY A;  1GUT A;  2JYO A;  5D3I B;  1PH6 A;  5ELB A;  2E5L L;  1PFN A;  5JJL A;  1VQ6 A;  4NMZ A;  3FKI H;  4P71 A;  1CA5 A;  3PGZ A;  1MIU A;  5T1G A;  2IX3 A;  4MZ9 A;  2PW7 A;  1S5B D;  2YTV A;  2M2L A;  3CXC A;  1JWU D;  3HG9 A;  2SNM A;  2EYL A;  1SAP A;  3HOY G;  1UE5 A;  1JOR A;  1I50 H;  2A69 C;  2B2Y A;  2A69 D;  2HD3 A;  2N88 A;  4DAV A;  3A5U A;  4LAA A;  1YNJ D;  3ZJY C;  3I8Z A;  3AEV A;  1HH2 P;  2HDM A;  1EU4 A;  3CP0 A;  4JG2 A;  4UAI A;  1UE6 A;  4I7A A;  5HGQ A;  4RWS C;  4A3M G;  4N9T A;  4RGO S;  5IE8 A;  1A3T A;  1RIP A;  3I4L A;  4YCU A;  4YWK A;  3T56 B;  1OTC A;  5IP9 G;  2EY5 A;  4A3D G;  2LKV A;  1KTK A;  1NMG A;  2AQ1 B;  2YTY A;  3JAM c;  4C56 C;  5AFW A;  3HOX H;  4JV5 Q;  4TVA B;  2CHB D;  3AB9 A;  3S2D B;  1SMY D;  1JC7 A;  1LO5 D;  1KC8 C;  4QF4 A;  2PZT A;  2A6H D;  1GUO A;  1LTG D;  3UDG A;  4DR4 Q;  2ATW A;  1EEI D;  1LYL A;  1S3O A;  1STB A;  2F0V A;  3J80 L;  1HNW Q;  1TWF H;  2GVA A;  5F2D A;  2PYK A;  1U0L A;  4MIU A;  3E9H A;  4B3T L;  5C0X J;  1TY2 A;  1K8M A;  4DK0 A;  3I3C A;  5FO8 B;  1TR5 A;  2XVS A;  3J7A V;  3PV0 A;  1EZ6 A;  1AE3 A;  3T16 A;  1GOZ A;  1WVL A;  2NZ1 D;  4DV0 Q;  1IYU A;  2PZW A;  4DGZ A;  4DV7 L;  1QZH A;  3PO2 H;  2A6H C;  4DXF A;  1CFM A;  1IBM L;  4RG1 A;  1XNR Q;  4RA8 A;  2EOT A;  2N78 A;  1NTG A;  3OSO A;  1DON A;  1SNM A;  4B9X A;  2N8N A;  1JE5 A;  2VL6 A;  5M3F B;  3NEN A;  1IL2 A;  3OOC A;  2IJ0 A;  3J81 L;  2EQS A;  1B9N A;  1NY4 A;  4YCW A;  2WP8 J;  2Q8I B;  3H91 A;  3H3V I;  5NUC A;  2NVY B;  4JI2 Q;  1VS0 A;  4LUV A;  4QIW E;  2EYO A;  2OEO A;  5M3M B;  1X32 A;  1LAB A;  4ZUI A;  1I94 Q;  3KF6 A;  1V9P A;  3P75 A;  2CW0 C;  5I2Y A;  1QUQ B;  4KHP L;  4OIK A;  3W1G A;  2K03 A;  4YWM A;  5FLM G;  1WTP A;  3S2H H;  3Q8D A;  4K14 A;  5JEA G;  1VQ7 A;  1OXV A;  1DJR D;  4WJ3 M;  2FJ2 A;  1VQE A;  1MI2 A;  2MNA A;  4H02 A;  2NTT A;  5I2X A;  3I4M G;  2NYZ D;  4I7Z C;  4A76 A;  2F0U A;  3D6C A;  3WWV A;  1QZG A;  2Q2H A;  1YVC A;  1I4Q A;  1V8Q A;  1N9W A;  1EWC A;  2KEE A;  1CA6 A;  3MXN B;  1MD2 D;  3SXH A;  4LFA Q;  2UUA Q;  3R8B A;  1IYJ B;  1RF2 D;  1B2T A;  5K36 G;  3SK6 A;  1HXY D;  1UNS A;  1L0X B;  3BYT B;  1I5F A;  3IL8 A;  4BY1 H;  1WFQ A;  4P72 A;  2PNH A;  1YEZ A;  2IL8 A;  2CW0 D;  4RMF A;  5IYB H;  1IBL Q;  5LL6 X;  3STB D;  3S1M H;  2NVQ B;  1WYD A;  4C3J B;  1SMX A;  2CKZ B;  4G4K A;  3D4D A;  2UXC Q;  1K3R A;  1LTI D;  4OL7 A;  1NR4 A;  3OIQ A;  3B6Y A;  2L9H A;  3Q22 A;  1HQR D;  1Q86 C;  1I6V C;  3U4Z A;  2RBM A;  2OQK A;  1Y8P B;  1PZJ D;  3R93 A;  3A7L A;  4AQY Q;  1TT2 A;  3I91 A;  5IGC A;  2J7Z A;  4GS3 A;  3NHH A;  4K2K A;  1HA5 A;  4YHH L;  4A3I B;  4LNQ A;  1Y69 U;  3OW2 A;  1FL0 A;  4J8Q A;  1H9J A;  5COR A;  4FF4 A;  3HOV B;  1TQO A;  1F9Q A;  1TWC H;  2F0E A;  5IGD A;  1F2M A;  4CJ0 B;  3BJU A;  2BH8 A;  2Y0S G;  4K5X A;  1K3B C;  3MEF A;  1TVX A;  2JXM B;  3OWF A;  2IW3 A;  1X9N A;  4QUC A;  3C2P A;  3PUX A;  2VQF Q;  1CSQ A;  3I2Z A;  5EGT A;  2E2J H;  1IKL A;  2NVQ H;  2J0T D;  3BG3 A;  2HT1 A;  3CME A;  2K33 A;  4UP7 A;  1STN A;  2EYH A;  4X3U A;  3HOV H;  2NVX H;  1DZ1 A;  3I90 A;  4JBW A;  1SND A;  4Z9C B;  4X64 Q;  3OYY A;  4QB4 A;  5A2Q E;  4A75 A;  3RN5 A;  1KDB A;  1I4X A;  4A3M B;  2VY3 A;  4OEL B;  1STY A;  2WAQ B;  4HSV A;  5JPN C;  1X56 A;  2G9D A;  3E0E A;  3I73 A;  3GTM H;  3SK4 A;  5LMN L;  4FNF A;  1PTO F;  3LNN A;  3K5N A;  1D6E C;  2ENB A;  1TII D;  1RJT A;  2F0P A;  5C6A A;  4I65 A;  3K7U C;  1SXT A;  3MC0 B;  1IW7 D;  2KBN A;  2I0Q A;  3CCR A;  2NUC A;  2PQA A;  1VQO A;  4S3S A;  1K8G A;  4ME5 A;  5BN4 A;  1TKW B;  4OWX B;  1QIL A;  4KI0 A;  3F8T A;  3G6J B;  3K80 C;  3KK7 A;  4GNX A;  1RL2 A;  5ELE A;  1D5M C;  4XDX A;  1XPO A;  3EJI A;  1VQF A;  3NUC A;  1VQL A;  3IAY A;  1PMR A;  4Y7N B;  1PHJ A;  2A1A A;  1JB3 A;  2DN8 A;  5EQ0 A;  5KEE A;  4B08 A;  2VUM H;  4OEM B;  1HHV A;  5M3M H;  4FYD A;  1JE4 A;  1HNX L;  2ZJP A;  2IY5 B;  1A15 A;  3HOU B;  1MJE A;  5C5M A;  1L2F A;  2Q2I A;  4A3F H;  3S16 H;  4TKO B;  4EGV A;  3S2D H;  1ZXT A;  4DR6 Q;  2L11 A;  1X55 A;  3CCJ A;  2R7Z H;  4FF1 A;  4DKA C;  4N8X 1;  4ILW A;  4DV3 Q;  1LV9 A;  4KD3 A;  2RDF A;  3S1N B;  3BU2 A;  5EKK A;  4DUY L;  4JI7 L;  2VQF L;  3OMC A;  3STB C;  3Q23 A;  2HIV A;  1VQI A;  5DM7 3;  2D62 A;  4L8J A;  2F0I A;  4GLA C;  2F0F A;  1VQ9 A;  5CYU A;  1Q12 A;  1GM5 A;  4MN3 A;  1I4P A;  1Y8O B;  2A6E D;  3EQL C;  5HGT A;  4LF6 Q;  1K83 H;  2F0S A;  2F0J A;  3FHW A;  1XWE A;  1VQ8 A;  2UU9 L;  1EFI D;  2NVY H;  4KY7 A;  3D3R A;  1I3Q B;  1LAC A;  1QB5 D;  5FLX E;  1PYB A;  5G3L D;  2VW9 A;  1RKN A;  2I46 A;  2WB1 E;  4A3E G;  1HFN A;  5J22 A;  1B50 A;  2HQE A;  1SMY C;  4ZAI A;  1HCZ A;  3GTO B;  3L9A X;  4KHP Q;  4CDF C;  2NZH A;  1TWA B;  5I9P A;  1JT8 A;  3HKS A;  4DFA A;  4GZY C;  4U68 A;  1KAB A;  1H9S A;  4IUN A;  5EKL A;  5DEH A;  4X62 L;  4BBS B;  1H95 A;  5GAH C;  4L63 B;  2B63 G;  1KAW A;  3VYS A;  1TWH H;  3BVZ A;  5K5P A;  5L37 A;  1O80 A;  1L0W A;  3KJO A;  1F2Z A;  3A8K E;  1PH1 A;  1TWF B;  2YYZ A;  2EDG A;  3OTO Q;  2L4N A;  2OWO A;  1VQ5 A;  3GTK H;  3SDZ A;  1WTH A;  1EYC A;  2IX0 A;  3HS0 C;  1YI2 A;  1KXL A;  5JEA J;  5C3E H;  4WRD A;  1SYF A;  4DU9 A;  1I50 B;  1HRJ A;  5DM6 3;  1SRO A;  1ICW A;  3L2P A;  4KV6 A;  3M9B A;  4NB3 A;  2KCC A;  4DR1 Q;  1LM0 A;  5GAD C;  3QO2 A;  4KY5 A;  1Q82 C;  1JOK A;  1NSN S;  4J1M A;  1G6P A;  3D8G A;  1WTW A;  2O2L D;  5C4X B;  1BQQ T;  2R93 H;  2AWN A;  3UE0 A;  2AUJ D;  5C4X H;  3U9O A;  3CQZ B;  4JC0 A;  4DPG A;  3QOJ A;  3QOL A;  2F0L A;  1K8A C;  4UY8 C;  1NMF A;  4X3S A;  1BBX C;  4NXM Q;  4P2C B;  2SNS A;  5EPL A;  5E4X A;  1X3F A;  1HTL D;  5IP7 H;  4NW2 A;  5ELD A;  2BDN A;  2JA5 G;  1Q8K A;  1S4Z A;  2QDB A;  4X66 L;  3KFU A;  2AHO B;  4DR2 L;  1CK1 A;  3H6M A;  2B8F A;  2K14 A;  5C4J B;  4X65 Q;  1JR0 D;  1EIY B;  1HPC A;  1A0I A;  3DM1 A;  3M7G A;  5BR8 L;  2PZU A;  3J81 i;  3K0X A;  3M7N A;  2F52 A;  5IGF A;  4JVZ A;  5CBE E;  4LWC A;  3W5O A;  1PRT C;  1EIF A;  1DOL A;  1IBM Q;  1GXD C;  2MPM A;  1G2S A;  5TSS A;  2A8V A;  1HFG A;  2K5Q A;  3TDQ A;  1Q46 A;  2E75 C;  4JI1 Q;  4GN3 B;  4RCO A;  5C0X H;  3GTJ H;  3GTQ H;  5LHY 1;  3PIO A;  3O13 A;  3MAQ A;  4LF7 Q;  4IZ8 A;  4B3T Q;  1A62 A;  4K8J A;  3NXW A;  4OIJ A;  1SNP A;  3RZO B;  3NQI A;  3ULL A;  1WCM G;  1SYG A;  2JK8 A;  3PF5 A;  1O7Y A;  4OON A;  1NAP A;  2D0P A;  4FXD A;  2RHQ B;  1BCP D;  4C1N I;  4A3J H;  3J7A F;  3S1M B;  1Z7T A;  5CV4 A;  4C3I B;  3CC7 A;  2Z9H A;  1IZ6 A;  1B44 D;  1CI3 M;  2LS0 1;  2UXD L;  2R92 B;  1FNV A;  2K5W A;  2QW7 A;  4A3J B;  4LJZ C;  1EQQ A;  1VDZ A;  4KJN A;  4IOA A;  4OGQ C;  3M4O B;  2KHI A;  2Z6K C;  1U4R A;  1XTC D;  2HHH Q;  4IPD A;  2DNE A;  2B2V A;  4R9W A;  3K6O A;  2XWB B;  5FK9 C;  4BY7 G;  1QCB D;  1OO9 B;  4DR7 Q;  3FDT A;  1WTR A;  2WAC A;  3RLN A;  3PIP 3;  1EY9 A;  3HOZ H;  3FPP A;  2EJG C;  3CF5 A;  3S1R B;  3A55 A;  5IP9 H;  2YU9 B;  4DK3 C;  3QIA A;  2R93 G;  2I5H A;  1X3P A;  4XT1 B;  5ELC A;  1N34 Q;  3F2C A;  1STE A;  2GA4 B;  5CV9 A;  4OO1 I;  4FDB A;  3U58 A;  2KEN A;  3BZK A;  3CAM A;  4L5T A;  3J7Y W;  3T1Y Q;  3K58 A;  4XXE A;  3I4N G;  2XNA C;  5DNF A;  3RNU A;  5E3F A;  4H0L C;  3PO3 H;  2ZTE A;  1FR3 A;  3F1Z A;  3ZYY X;  2C35 B;  4PZ6 A;  4DV6 Q;  5D65 A;  4K2L A;  5LMN Q;  1D8L A;  1EY4 A;  1LTS D;  1PTO H;  3FEW X;  2Q2U A;  4B3M L;  3I4N B;  5C3X A;  4K6L A;  3BS1 A;  1XPR A;  3CCM A;  3HOY B;  2AQ3 B;  1HZA A;  3EIV A;  5BR8 Q;  4A3F G;  3I4O A;  2F0N A;  2FFK B;  4X65 L;  2PMZ E;  2LSS A;  2AQ2 B;  3VR3 A;  2XN9 C;  4GOP B;  3CQZ H;  3QB3 A;  5IGG A;  4JI5 L;  4A3G B;  2SOB A;  1R9T H;  3CC4 A;  4X66 Q;  4LUZ A;  5M3F H;  1DXM A;  1EY6 A;  5M5Y H;  3NEM A;  5J1Z A;  2K52 A;  5CV6 A;  4IOC A;  3IRB A;  5M5Y B;  3IFT A;  4R8I A;  2EY1 A;  4Q5V A;  1F9S A;  4HJ5 A;  4ZQ3 A;  3U50 C;  2RQX A;  3MXG A;  1NUC A;  1WTX A;  4X6A H;  2DGY A;  3H0G B;  3SHL A;  1JJG A;  1K28 A;  2E76 C;  1ZEQ X;  1MGS A;  2R7Z G;  1AZP A;  5M5W H;  1JJC B;  1KIX A;  1B70 B;  3K57 A;  5CV8 A;  5J39 A;  1LLR D;  2PO4 A;  4DAM A;  4G7Z C;  2LXK A;  3ERS X;  2XSC A;  1SEB D;  4DR1 L;  4KKU A;  3HKZ G;  3GP7 A;  1KD1 C;  3EA6 A;  4JI3 Q;  2F4V Q;  4JK1 C;  3VR5 A;  2EPB A;  4HCS A;  3HOW G;  1BCP C;  4K5W A;  2ZTD A;  3MFG A;  1TWG H;  2D9U A;  1VQP A;  4NKL A;  1BNZ A;  3CCL A;  4HCE A;  3KLS X;  4CJ1 B;  1TWC B;  2NWG A;  4RAU C;  1S5E D;  4G7O C;  1HR0 L;  5JJI A;  1IKM A;  2KVM A;  1WOC A;  4HMJ A;  1X65 A;  2L0C A;  1DCZ A;  4P73 A;  4DUZ Q;  2BCO A;  2XIW A;  4QL5 A;  3HKZ B;  3W1B A;  4X62 Q;  1KRS A;  2QGQ A;  1EYD A;  3K0Y A;  1PH3 A;  1C8C A;  4NXN L;  1EY7 A;  4NXN Q;  1G91 A;  2OQ0 A;  3AFP A;  1FNU A;  4N9P A;  4Q0F A;  1NE3 A;  1Z9F A;  3CCQ A;  1CKN B;  3UDF A;  1HTP A;  3K7A H;  4GN4 B;  4XTC S;  2RVL A;  4OWW B;  1W2B A;  5IP7 G;  1YNX A;  2D0O A;  2Q8T A;  1K83 B;  3KF6 B;  4DNI A;  1GD7 A;  2IX1 A;  2EXZ A;  3QWN A;  3UDI A;  1H9K A;  4OX9 Q;  2R92 H;  1UAP A;  4R4C A;  2JA7 B;  1QE6 A;  5A35 A;  2PPB C;  4FF3 A;  3OMG A;  1XX8 A;  4C3H H;  2ZM6 Q;  5J3B A;  4ODG A;  5M5X B;  2QIL A;  3D4W A;  2RDH A;  4LFC Q;  3F2D A;  4JI3 L;  1S5C D;  1B53 A;  4ALP A;  4DF7 A;  1F2L A;  4LF6 L;  1LT5 D;  3H94 A;  3V96 A;  4NP5 A;  4BS9 A;  4HJA A;  2M00 A;  2WAQ E;  2OT2 A;  2EJM A;  3AYH B;  5KRU A;  2VNU D;  3A8I E;  2WKC A;  3S1Q H;  4IPG A;  1O78 A;  5E1F A;  4IJL A;  2KCT A;  1ASZ A;  2EIF A;  3FPU B;  4GLV B;  4BBR G;  2ICI A;  1V1P B;  2EY6 A;  3BZC A;  5I4D A;  3NBI A;  1NR2 A;  3A54 A;  4R4T A;  3NWS A;  5LMU L;  4Y7N H;  2VZA A;  5IYC G;  4LFB L;  5C44 G;  1BDO A;  1SJE D;  2JEB I;  1G29 1;  2EYJ A;  3J7A 5;  4DR6 L;  2F3W A;  1GJX A;  2V4D A;  1N36 Q;  1MJC A;  1ET6 A;  4JOI C;  2WAQ G;  5KNB A;  5FO7 B;  4H7B A;  4HSP A;  2B39 A;  3QR8 A;  2PW5 A;  5C4H A;  4LUO A;  1DGS A;  4JYA Q;  2K7V A;  2KHS A;  1EYG A;  2D2C C;  3KYH C;  2MGS A;  4WJW A;  4KHZ A;  3K5L A;  4DV7 Q;  2F4V L;  5JVH 3;  4DV6 L;  1SE8 A;  1JB7 A;  4ZUJ A;  1AW7 A;  1S5D D;  2F0G A;  2K5N A;  2E8G A;  2X69 A;  4PZ7 A;  1LTA D;  4A3C G;  2BE5 C;  5M5X H;  2NBF A;  1M90 C;  1PRT B;  1PYW D;  1N34 L;  1RDP D;  4RH6 A;  4IFD G;  4HID A;  5EJW A;  4IQZ A;  5AJ3 Q;  1CSP A;  1MBY A;  2NN6 I;  2RF4 A;  3KDF B;  4IUR A;  2VB3 X;  3H15 A;  3PO3 G;  2ZXO A;  1FD7 D;  5T1I A;  3TP5 A;  1MKH A;  1OXS C;  2MP1 A;  3K7A B;  2NN6 G;  4DV4 L;  1PV4 A;  5IWA Q;  1FGB D;  1HZ9 A;  2CH4 A;  2MJ8 A;  1TS4 A;  3X3N A;  4CDE C;  4N8F A;  4CKC A;  1T5E A;  5LL6 S;  2QEX A;  3SE0 A;  1EQR A;  4H13 C;  4YY3 Q;  3WOF A;  3GTP B;  4O0A A;  4A3E B;  4TSS A;  2FMC A;  2JQO A;  4EQN A;  1J5E Q;  4B3S Q;  2UXD Q;  3HOX B;  5M3M G;  4MTN A;  4A3I H;  3HKZ E;  5EAY A;  3L7Z C;  1G8Z D;  4JI8 L;  3CCE A;  1ET9 A;  2WFW A;  1SNC A;  3DEP A;  3TME A;  4CBV A;  2K75 A;  4RKL A;  1S40 A;  4PQX A;  1TWG B;  2OXP A;  4KN4 C;  4RGM A;  4HIM A;  1EOV A;  3DM3 A;  1R9T B;  1QNK A;  1MSH A;  3VR2 A;  1F2Y A;  4B9W A;  4E6I A;  5EKI A;  3K59 A;  2NN6 H;  4HED A;  3DEO A;  1YBY A;  2QDL A;  4JI1 L;  4EVO A;  1VF7 A;  3S17 B;  3GTK B;  2R3Z A;  4ABN A;  4A3L H;  2F1M A;  5GRO A;  4O42 A;  1PTO B;  2PI2 A;  3K5O A;  4DR7 L;  4K0K Q;  3PUZ A;  3M4Q A;  2EE1 A;  4B3S L;  1TWH B;  4WFN 3;  2UXC L;  2HUG A;  1PH4 A;  3VYT A;  2DUD A;  1CTM A;  1PRT D;  2C5C A;  4IAL A;  4DV5 Q;  1U4P A;  1VQG A;  2K5D A;  2QEJ C;  3OWE B;  1YJ9 A;  4BBR B;  1TY0 A;  1ENF A;  3KLR A;  1X54 A;  1PDQ A;  1B3A A;  4X3T A;  4LF4 Q;  2O5I C;  2CWP A;  1SE2 A;  1ENA A;  4OWT B;  4DXG A;  2F4I A;  4ZRZ A;  1EY5 A;  2VS1 A;  1B1Z A;  3DLL A;  2BA0 A;  1Q81 C;  1ZYR C;  3TS2 A;  3NBH A;  4DAY B;  1Y1V G;  5FLX L;  2JJQ A;  3FMC A;  1EWI A;  3H3V C;  1DM0 B;  2B2V C;  1X3G A;  3A8J E;  3NEL A;  1SFO B;  3I56 A;  1A3V A;  2YTX A;  4L5Q A;  2FMM A;  1YZ6 A;  2ZJQ A;  3T51 B;  1I3Q H;  1GUW A;  3S2H B;  1R4Q B;  1DOK A;  3PUV A;  3A0J A;  1STH A;  1Y1V B;  3Q24 A;  3T13 A;  1FJG Q;  1E2Z A;  1LTL A;  2RCN A;  4JBM A;  3FRP B;  4RGN A;  1I6H H;  3CU7 A;  2DJG C;  5LMN W;  1QOH A;  1D2B A;  2F3V A;  4A3K H;  1E24 A;  4CKE A;  5FOB B;  4EX5 A;  1EIH A;  2L5T A;  4P74 A;  5H1S E;  4JYA L;  2NB0 A;  3BZD B;  1GVP A;  2ICE C;  4JPB W;  4EQP A;  3SK5 A;  2OTL A;  4JI4 Q;  3GTM B;  1VQB A;  2Q2T A;  5C0X G;  1KRT A;  2SDF A;  1JQY D;  5CR3 A;  3JC6 6;  2P5Z X;  1YNN C;  2BDO A;  3MXP A;  2YV5 A;  1QNU A;  1TS2 A;  1K9M C;  3KDF A;  1BXT A;  1EZ8 A;  4G7H C;  1U4M A;  4A3B H;  2F0Q A;  1Z47 A;  1H9S B;  2XRQ D;  2JA9 A;  4ID6 A;  1ESF A;  2PCF B;  4LFB Q;  3ERQ A;  1UEB A;  2CQO A;  4NXM L;  3M4P A;  1S72 A;  3D6W A;  5JJZ A;  3KBG A;  1LTT D;  3I7F A;  4B3R Q;  5K36 H;  1JIC A;  1RD9 D;  2ZJR A;  1ILQ A;  3Q6S A;  2RHS B;  1BKB A;  2WIN B;  5KND A;  2QCP X;  3RUZ A;  2HQL A;  3F2B A;  3PUY A;  1ZKO A;  4DR3 Q;  4LF8 L;  4R4I A;  1PZI D;  4POF A;  1SE3 A;  4ME3 A;  1VQH A;  1LT3 D;  3BVG A;  2JA6 H;  5FJ8 G;  3W3A A;  2ZM6 L;  4KTA A;  3TBI B;  3V05 A;  3G7L A;  4L5S A;  1ZYR D;  4KHV A;  1XMQ L;  1SR3 A;  4BXX G;  5C3E G;  1UUP A;  2B2Y C;  1HJP A;  4DR4 L;  2B2W A;  3OTO L;  5IOC A;  5A2Q L;  2IHF A;  2DNC A;  1HNZ L;  2NVT H;  4R8N A;  3NTI A;  1SYB A;  1NJI C;  3J81 c;  4JV5 L;  4OO1 G;  3NK9 A;  4C3H B;  2HCC A;  1N32 L;  4U67 3;  2K05 A;  4C1N K;  2EZV A;  2G5D A;  3DWA A;  1GUS A;  1EU3 A;  3ULJ A;  2F0M A;  2GVB A;  3R2T A;  2UXB L;  1AEX A;  1SBB B;  1QJO A;  3MXU A;  4IFD I;  3HOW B;  2B2U C;  1E2W A;  1VMC A;  3CRL C;  2RCF A;  3D31 A;  5M5W B;  3A74 A;  4LF9 L;  2JA6 G;  1IBK L;  1G6Z A;  2BA1 A;  1VQD A;  1IBK Q;  2JSO A;  4J6H A;  4JI0 L;  2V1C C;  5EBC A;  2J4X A;  1WI5 A;  3QJY A;  2E2I H;  5E7N A;  4HR7 B;  2WII B;  3RZD H;  4HJ8 A;  4DK1 A;  1PH2 A;  3DUZ A;  3J81 j;  4BBS H;  2K04 A;  4A3C H;  4PMW A;  1I4R A;  3CCV A;  1DD2 A;  4EQO A;  1AP0 A;  1V1P A;  4APV A;  3RZD B;  1STG A;  4A3I G;  2JP1 A;  2EJF C;  3S14 H;  2MO0 A;  4A3B G;  3PO2 G;  2RSO A;  5IGE A;  4GNX B;  1HNZ Q;  1Y1W G;  4UDU C;  5BN3 A;  1X3Q A;  1PA6 A;  3JAM E;  1XMQ Q;  3L0O A;  3I4N H;  1STA A;  3J80 c;  3DMU A;  4DV3 L;  1HA6 A;  2JA7 G;  1GHJ A;  1B7Y B;  4C3J H;  1Y1W B;  1CKO A;  5EPJ A;  4XT3 B;  4IFD H;  2JEA I;  1YHA A;  1LT6 D;  4M8A A;  1O7I A;  4JI6 Q;  1VF5 C;  1SDF A;  4ZK9 B;  2A6E C;  4CKB A;  4A3K G;  2N3S A;  3MWY W;  4DN4 M;  3PF4 A;  4A3J G;  4XQQ A;  2KOL A;  4GN5 A;  1XYI A;  4V19 0;  3D0F A;  5GQO A;  2H4O A;  1SE4 A;  2A68 D;  1H9M A;  2RKS A;  1K73 C;  1EIG A;  3GTO H;  3FVQ A;  3GD7 A;  3UDX A;  4L5R C;  3U4V A;  2K5V A;  4HJ7 A;  3S15 B;  3QG1 A;  2FXQ A;  1BBU A;  2E2H H;  2HDL A;  1TS3 A;  3GTL B;  4A4I A;  2UUB L;  1SN8 A;  1SYD A;  3J80 E;  4JOI A;  3WDN A;  2O4X A;  2K6A A;  4CDD C;  4WOR A;  5C0X I;  3HOY H;  3E5S A;  3T1Y L;  1X3E A;  4QMG A;  5JAV A;  4K8I A;  4CJ2 C;  4RFB A;  1I4H A;  4JI4 L;  4AQY L;  1Q3L A;  3KUP A;  3A56 A;  4CGY B;  2WV6 D;  1D5X C;  2LY7 A;  1CM9 A;  4R4Q A;  2QKI C;  1YNJ C;  2Z6B A;  3AU7 A;  2B2T C;  5KIX A;  1K8O A;  5CMD A;  2CCZ A;  2LMC B;  4C2M B;  2H5X A;  5DAU A;  5E4W C;  1BF4 A;  1XPU A;  3S1N H;  3SK8 A;  1TWA H;  1RCV D;  5ELO A;  1IL8 A;  1PFB A;  3KF8 B;  3S16 B;  1SNO A;  3HEJ A;  3I72 A;  2DJF C;  2VQE L;  1QG7 A;  1WD0 A;  2I07 B;  1KL9 A;  1C4Q A;  1VQA A;  2JN4 A;  1ML0 D;  3J80 i;  1Y8N B;  2E2D C;  3CHB D;  3TP6 A;  4JBK A;  1N33 L;  3ERO A;  2G9H D;  5FKA C;  1N8R C;  1LTR D;  1E0B A;  4QGU A;  1QUQ A;  5IYD G;  3NTK A;  3M4O H;  4HTH A;  4IJH A;  4LF4 L;  1QWY A;  4Y52 H;  1TU2 B;  4KN7 C;  2EYM A;  2GN5 A;  4A93 B;  2Z0S A;  4YHH Q;  4O1N A;  1WTO A;  4LF7 L;  1B4O A;  4DNR B;  2Q8R E;  1NCV A;  2JA8 G;  1V43 A;  3IFD A;  2IT1 A;  1V1O A;  4GOP A;  3G71 A;  3VYR A;  1JJ2 A;  1KNE A;  4DV2 Q;  3ONA B;  1VQJ A;  3L3O C;  3TRE A;  2K28 A;  1D1I A;  5FJ8 H;  2R93 B;  2NVT B;  1EUJ A;  4YCV A;  3G48 A;  3HOU H;  3I4M H;  5C5L A;  4PZ8 A;  4DR2 Q;  2VUM B;  1IYV A;  2F0O A;  1EFW A;  1CZW A;  1C9O A;  1SNQ A;  2E2I B;  4KD4 A;  4K5V A;  1Y1W H;  3H0G G;  2RDG A;  2UUA L;  4LFA L;  1W6K A;  4JBJ A;  3A5Z B;  3CCU A;  1D5Z C;  1U5K A;  5C4J H;  1Q90 A;  1EEF D; 
#chains in the Genus database with same CATH homology
 1IXR A;  2K50 A;  1X55 A;  3CCJ A;  2R7Z H;  4IFD G;  4DKA C;  2UU9 Q;  4DV3 Q;  4HID A;  5AJ3 Q;  1CSP A;  3BU2 A;  4DUY L;  4JI7 L;  1YIT A;  2VQF L;  3KOJ A;  2NN6 I;  1AE2 A;  2HIV A;  2RF4 A;  3KDF B;  1VQI A;  3STB C;  2D62 A;  3H15 A;  3PO3 G;  4A3G H;  4GLA C;  1E3P A;  3G6E A;  1VQN A;  1MKH A;  1OXS C;  2NN6 G;  4LW1 A;  5GAG C;  4DV4 L;  5IWA Q;  4DV4 Q;  1PV4 A;  1VQ9 A;  3GTP H;  2AKW B;  1HZ9 A;  1Q12 A;  3PIP A;  1GM5 A;  1PVO A;  1A8V A;  2CFM A;  3TRZ A;  2MQH A;  4C2M H;  1XJV A;  4B3R L;  4A3G G;  4LF6 Q;  1K83 H;  1Q1B A;  5IY0 A;  2QEX A;  3FHW A;  5FLM H;  1EQR A;  4YY3 Q;  4DV1 Q;  1VQ8 A;  4O0A A;  2UU9 L;  2JQO A;  2NVY H;  1C7Y A;  2AWO A;  1L1O C;  1J5E Q;  4B3S Q;  2UXD Q;  4BBS G;  4DR5 L;  2JA5 H;  5M3M G;  4MTN A;  4UPA A;  4A3I H;  3HKZ E;  5EAY A;  3L7Z C;  4JI8 L;  1E1T A;  1PYB A;  1CUK A;  3CCE A;  4DUZ L;  2VW9 A;  4JI2 L;  1L1O A;  1KHI A;  2WFW A;  2MFI A;  3LGJ A;  1FVI A;  4KLK A;  5DLQ E;  1P16 A;  2WB1 E;  2EXD A;  1HNX Q;  2K75 A;  4A3E G;  1HR0 Q;  4QJF A;  1S40 A;  5IYD H;  2UUC L;  1PFS A;  1QVF A;  1KQS A;  1SRU A;  2UUB Q;  2R6G A;  4HIM A;  1YIJ A;  1EOV A;  3FP9 A;  3DM3 A;  1OXU A;  4KHP Q;  2NZH A;  1XMO Q;  1XMO L;  3GTG H;  1JT8 A;  1TXY A;  3HKS A;  3J7Z C;  3GTL H;  4BA1 I;  4EQ5 A;  2KCM A;  3S15 H;  1BBW A;  4JI0 Q;  4X62 L;  3KJP A;  1YBY A;  4GKJ Q;  1H95 A;  5GAH C;  1P8L A;  4JI1 L;  2B63 G;  1KAW A;  4GKK Q;  4A3L H;  2JA8 H;  3CW2 C;  3RLF A;  1YJW A;  1TWH H;  1T9H A;  5GRO A;  3H3V H;  5C44 H;  3TS0 A;  1L0W A;  3KJO A;  3CCS A;  2OTJ A;  3AQQ A;  3T1H Q;  2PI2 A;  4DR7 L;  4K0K Q;  1PH1 A;  1Y14 B;  3PUZ A;  3M4Q A;  4UP9 A;  1N36 L;  2YYZ A;  2ES2 A;  4B3S L;  4LF5 Q;  3OTO Q;  5M3F G;  1SLJ A;  2OWO A;  1VQ5 A;  2UXC L;  3GTK H;  4MNO A;  3ICE A;  1PH4 A;  1G51 A;  2DUD A;  2IX0 A;  1YI2 A;  3AFQ A;  4DV5 Q;  1KXL A;  3JAM i;  5JEA J;  5C3E H;  1VQG A;  3PCO B;  4J15 A;  4C3I H;  2L15 A;  5ELN A;  4A93 G;  1SRO A;  1YJ9 A;  3PUW A;  1E22 A;  1Q1E A;  1GKH A;  1YHB A;  3L2P A;  3G4S A;  4A3L G;  1X54 A;  3M9B A;  4NB3 A;  4DR1 Q;  4X64 L;  4LF4 Q;  1LM0 A;  2CWP A;  5GAD C;  1Q82 C;  4OWT B;  2BH2 A;  3ULP A;  2VS1 A;  4OXP A;  3K8A A;  3DLL A;  2BA0 A;  3CMA A;  1Q81 C;  1G6P A;  3CPF A;  3TS2 A;  1PH8 A;  4DAY B;  4IFD J;  1Y1V G;  1XTD A;  4DUY Q;  1BVS A;  4JI7 Q;  2JJQ A;  1E7Z A;  1EWI A;  5GAE C;  3NEL A;  1X3G A;  2R93 H;  2AWN A;  3UE0 A;  4DV5 L;  3I56 A;  5C4X H;  2YTX A;  4L5Q A;  4O2D A;  3M85 A;  2ZJQ A;  1YZ6 A;  2N49 A;  1I3Q H;  1V1Q A;  1NBW A;  4JC0 A;  1PH5 A;  4DPG A;  4GOP C;  1UE1 A;  2ZTC A;  3PUV A;  3A0J A;  1K8A C;  4UY8 C;  1NMF A;  1L1O B;  4NXM Q;  2LXJ A;  1J6Q A;  1FJG Q;  1X3F A;  3CC2 A;  1LTL A;  2RCN A;  5IP7 H;  4BY7 H;  1SFO H;  4BBR H;  1XNQ Q;  3TQY A;  4JBM A;  2JA5 G;  1Q8K A;  3I55 A;  1PH6 A;  2E5L L;  1I6H H;  5JJL A;  1VQ6 A;  5LMN W;  3FKI H;  4X66 L;  3KFU A;  2AHO B;  4P71 A;  4DR2 L;  4A3K H;  1E24 A;  3PGZ A;  4A3M H;  1MIU A;  2K14 A;  4MZ9 A;  4EX5 A;  2YTV A;  3CXC A;  4X65 Q;  4P74 A;  5H1S E;  2I5M X;  2PI2 E;  4JYA L;  2KHJ A;  1GVP A;  4IO9 A;  1EIY B;  1A0I A;  5BR8 L;  2OTL A;  1UE5 A;  3J81 i;  1I50 H;  1VQB A;  3K0X A;  4R4O A;  3A5U A;  2Q2T A;  2F52 A;  4JI4 Q;  4LF5 L;  5C0X G;  1KRT A;  3ZJY C;  5HY6 A;  1ASY A;  3HOV G;  2ASB A;  1K0R A;  3JC6 6;  4LWC A;  4POG A;  3W5O A;  3AEV A;  4A3C H;  1EIF A;  1HH2 P;  1IBM Q;  3CP0 A;  4JG2 A;  1X6O A;  3GO5 A;  2YV5 A;  2A8V A;  1UE6 A;  1K9M C;  1Q46 A;  5HGQ A;  3KDF A;  1Y1V H;  4A3M G;  4JI1 Q;  1LUZ A;  4GN3 B;  3GTJ H;  4A3B H;  3GTQ H;  1Z47 A;  3PIO A;  5IE8 A;  2JA9 A;  5IYB G;  4LFB Q;  1RIP A;  4LF7 Q;  1UEB A;  2CQO A;  4YCU A;  4YWK A;  4NXM L;  4B3T Q;  3M4P A;  1OTC A;  1S72 A;  1A62 A;  5IP9 G;  1CKM A;  3GDE A;  1JMC A;  3I7F A;  4B3R Q;  4A3D G;  4GNX C;  4PG3 A;  1QVC A;  1NMG A;  2YTY A;  2ZJR A;  3SGI A;  4IPC A;  4AYB E;  3ULL A;  1WCM G;  3JAM c;  2RHS B;  2JK8 A;  4GLX A;  1BKB A;  3PF5 A;  4AH6 A;  4OON A;  3HOX H;  2D0P A;  4JV5 Q;  4DR3 L;  4LF8 Q;  2HQL A;  4TVA B;  2RHQ B;  3F2B A;  1VQC A;  3PUY A;  4A3J H;  4DR3 Q;  3CC7 A;  4LF8 L;  4R4I A;  4POF A;  1KC8 C;  1IZ6 A;  4ME3 A;  3S24 A;  1VQH A;  2UXD L;  2JA6 H;  3UDG A;  4DR4 Q;  1EQQ A;  2ATW A;  3RR5 A;  1LYL A;  1S3O A;  3TEH B;  5FJ8 G;  4IOA A;  2ZM6 L;  1HNW Q;  1TWF H;  2KHI A;  2GVA A;  2Z6K C;  4L5S A;  1U0L A;  4BXX G;  3NBH B;  1SR3 A;  4A3E H;  1XMQ L;  2HHH Q;  5C3E G;  4BBS H;  4IPD A;  1W3S A;  3E9H A;  4B3T L;  5C0X J;  1HJP A;  4DR4 L;  3OTO L;  5IT9 c;  2IHF A;  4BY7 G;  4P75 A;  2K4K A;  1HNZ L;  3S17 H;  3PV0 A;  3T1H L;  2NVT H;  1AE3 A;  2NZO A;  4DR7 Q;  1VQM A;  4DV0 Q;  3PO2 H;  2XGT A;  3RLN A;  3J81 c;  4DV7 L;  1QZH A;  1NJI C;  4A3D H;  4GKK L;  3HOZ H;  4OO1 G;  4JV5 L;  1IBM L;  3CF5 A;  4JI5 Q;  2K5H A;  4RG1 A;  1XNR Q;  5IP9 H;  4NPS A;  3EN2 A;  4GKJ L;  1N32 L;  4DK3 C;  2N78 A;  2R7F A;  4IPH A;  2R93 G;  2I5H A;  2B63 H;  1NTG A;  3ULJ A;  1N34 Q;  3F2C A;  3RLO A;  2GVB A;  1QVG A;  4OO1 I;  4FDB A;  3U58 A;  2WB1 G;  2KEN A;  2UXB L;  2N8N A;  3BZK A;  3CAM A;  4L5T A;  1JE5 A;  3T1Y Q;  2VL6 A;  3I4N G;  4K0K L;  3NEN A;  3RNU A;  4IFD I;  1IL2 A;  1OXX K;  2EQS A;  2JE6 I;  1NY4 A;  2ZTE A;  3D31 A;  3KLW A;  2UUC Q;  4B3M Q;  3PO3 H;  3A74 A;  4YCW A;  3F1Z A;  4LF9 L;  2WP8 J;  1IBK L;  4DV6 Q;  2C35 B;  4PZ6 A;  2JA6 G;  3HOY G;  2BA1 A;  3H3V I;  1PH7 A;  1VQD A;  5LMN Q;  1D8L A;  1IBK Q;  4JI2 Q;  1VS0 A;  1AH9 A;  2Q2U A;  4JI0 L;  2V1C C;  4LUV A;  4QIW E;  4B3M L;  1WI5 A;  2R7D A;  3EBE A;  5E7N A;  2E2I H;  1FJG L;  1IBL L;  4DR5 Q;  3RZD H;  1XPR A;  3CCM A;  4HJ8 A;  1PH2 A;  1I94 Q;  3KF6 A;  3J81 j;  4BY1 G;  3M7N A;  1V9P A;  1HZC A;  1HZA A;  3EIV A;  5BR8 Q;  4PMW A;  3I4O A;  1QUQ B;  1FGU A;  3W1G A;  4DV1 L;  4A3F G;  4KHP L;  3CCV A;  4YWM A;  4X65 L;  2PMZ E;  1HR0 W;  2LSS A;  5FLM G;  4GOP B;  3S2H H;  3Q8D A;  3CQZ H;  4APV A;  4YWL A;  4JI5 L;  5JEA G;  1R9T H;  1VQ7 A;  3RN2 A;  4X66 Q;  1OXV A;  4LUZ A;  5M3F H;  3CC4 A;  4A3I G;  4WJ3 M;  1N33 Q;  1VQE A;  2MNA A;  4H02 A;  5M5Y H;  4AIM A;  3S14 H;  2MO0 A;  1PYS B;  3NEM A;  4A3B G;  2I5L X;  3PO2 G;  1XNQ L;  2JA7 H;  3I4M G;  4A93 H;  4GNX B;  1HNZ Q;  4A76 A;  1Y1W G;  2K52 A;  4IOC A;  3IRB A;  3WWV A;  2VQE Q;  1QZG A;  1PA6 A;  2Q2H A;  4YY3 L;  1YVC A;  4TQU S;  3K81 C;  1XMQ Q;  4HJ5 A;  2HHH L;  3L0O A;  3I4N H;  3U50 C;  1GO3 E;  1N9W A;  3J80 c;  4DV3 L;  2JA7 G;  4X6A H;  4BXX H;  2DGY A;  3MXN B;  1B7Y B;  4C3J H;  1JJG A;  1E1O A;  1CKO A;  3CD6 A;  2R7Z G;  2JEA I;  1YHA A;  2AMC B;  5M5W H;  1JJC B;  1KIX A;  1O7I A;  4R1J A;  4JI6 Q;  1B70 B;  4LFA Q;  2UUA Q;  1IYJ B;  4A3K G;  3S1R H;  4DAM A;  2N3S A;  5K36 G;  2LXK A;  3ERS X;  2R92 G;  3PF4 A;  4A3J G;  5FLX c;  4DR1 L;  3HKZ G;  4GN5 A;  1I5F A;  1VQ4 A;  1KD1 C;  4BY1 H;  4JI3 Q;  1WFQ A;  2F4V Q;  3D0F A;  5GQO A;  3UE1 A;  5AJ3 L;  4P72 A;  1K73 C;  1YHQ A;  3HOW G;  1I94 L;  2ZTD A;  3GTO H;  2PNH A;  1TWG H;  1YEZ A;  4RMF A;  5IYB H;  4HJ9 A;  1VQP A;  4BA2 I;  1IBL Q;  3CCL A;  3STB D;  3S1M H;  3GD7 A;  1WYD A;  3UDX A;  1OXT A;  4L5R C;  3U4V A;  2K5V A;  1SMX A;  2CKZ B;  1HZB A;  2FXQ A;  1BBU A;  4HJ7 A;  2E2H H;  2OCE A;  3M3Y H;  2UXC Q;  2B3G A;  2VUM G;  1K3R A;  4A4I A;  2UUB L;  1SN8 A;  4AYB G;  4JOI A;  3B6Y A;  2CWA A;  4HIK A;  1Q86 C;  1HR0 L;  5C0X I;  5JJI A;  1WOC A;  2Z6K A;  1X65 A;  3U4Z A;  4P73 A;  3HOY H;  4DUZ Q;  4JCV E;  3HOU G;  2OQK A;  3T1Y L;  4QL5 A;  1X3E A;  3W1B A;  4JI8 Q;  2QA4 A;  4X62 Q;  1KRS A;  4AQY Q;  2QGQ A;  1WCM H;  1PH3 A;  1J5E L;  4QQB X;  4NXN L;  4NXN Q;  2MO1 A;  2PQA B;  4JI4 L;  2OQ0 A;  4AQY L;  3AFP A;  3CPW A;  4GS3 A;  4YHH L;  4LNQ A;  3HOZ G;  5IYC H;  3RZO H;  1NE3 A;  1Z9F A;  3CCQ A;  3VDY A;  1XNR L;  1YJN A;  3OW2 A;  1CKN B;  1FL0 A;  3E9I A;  3H0G H;  3UDF A;  3K7A H;  3ER0 A;  4GN4 B;  4R4Q A;  4XTC S;  1TWC H;  4OWW B;  4DV0 L;  1W2B A;  5IP7 G;  1YNX A;  2D0O A;  3KF6 B;  4DNI A;  2ALY B;  1GD7 A;  4HIO A;  2CCZ A;  4JI6 L;  5IWA L;  2IX1 A;  4WJ4 A;  3BJU A;  1VCI A;  3FKI G;  2H5X A;  3UDI A;  2BH8 A;  2Y0S G;  1XPU A;  4OX9 Q;  2R92 H;  1PH9 A;  3S1N H;  3MEF A;  4R4C A;  1TWA H;  4DK6 C;  4UP8 A;  5ELO A;  1X9N A;  1VQK A;  5LMU Q;  3PUX A;  2VQF Q;  3KF8 B;  4C3H H;  2ZM6 Q;  1HNW L;  5J3B A;  2XTI A;  1CSQ A;  3I2Z A;  2VQE L;  2E2J H;  4LFC Q;  3F2D A;  4JI3 L;  2NVQ H;  4ALP A;  4LF6 L;  1B8A A;  1KL9 A;  1VQA A;  3PSI A;  1C0A A;  3HOX G;  3J80 i;  4HJA A;  1Q7Y C;  4JBK A;  3CME A;  2HT1 A;  1N33 L;  4UP7 A;  2WAQ E;  1N8R C;  1D7Q A;  3HOV H;  3AYH B;  2NVX H;  2VNU D;  4QGU A;  1QUQ A;  5IYD G;  4JBW A;  3S1Q H;  3M4O H;  4IJH A;  4IPG A;  2A19 A;  4X64 Q;  3OYY A;  4LF4 L;  4Y52 H;  1WJJ A;  4IJL A;  2KCT A;  1ASZ A;  2EIF A;  4A75 A;  4GLV B;  4LFC L;  4BBR G;  1M1K C;  3RN5 A;  2GN5 A;  3BZC A;  5JJK A;  2HIX A;  2VY3 A;  4R4T A;  2Z0S A;  5LMU L;  4Y7N H;  3HFZ B;  2VZA A;  4YHH Q;  4LF7 L;  5IYC G;  1X56 A;  4LFB L;  5C44 G;  2JEB I;  1G29 1;  3E0E A;  3J7A 5;  4DR6 L;  4OX9 L;  3GTM H;  2JA8 G;  5LMN L;  1N36 Q;  1V43 A;  2F3I A;  2ID0 A;  4QY7 A;  1MJC A;  4LF9 Q;  4JOI C;  2IT1 A;  4GOP A;  3G71 A;  1JJ2 A;  2YU9 H;  1UE7 A;  2WAQ G;  4DV2 Q;  3K7U C;  1VQJ A;  2IHE A;  2KBN A;  2I0Q A;  2Y0S E;  3CCR A;  1VQO A;  2PQA A;  3TRE A;  4XIG S;  2UXB Q;  1K8G A;  5FJ8 H;  4OWX B;  1CKN A;  4LUO A;  4KI0 A;  1DGS A;  4JYA Q;  3F8T A;  3K80 C;  4GNX A;  1EUJ A;  4YCV A;  3G48 A;  1EYG A;  3HOU H;  1RL2 A;  1N32 Q;  3I4M H;  3KYH C;  1XPO A;  1VQF A;  4PZ8 A;  4DR2 Q;  1VQL A;  4KHZ A;  2F4V L;  4DV7 Q;  1PHJ A;  2B29 A;  3HOW H;  2E5L Q;  2A1A A;  1EFW A;  1C9O A;  4DV6 L;  2VUM H;  1SE8 A;  5M3M H;  4DV2 L;  1UWV A;  1JB7 A;  1Y1W H;  3H0G G;  1HNX L;  2ZJP A;  2IY5 B;  1MJE A;  2K5N A;  2E8G A;  2UUA L;  4LFA L;  4JBJ A;  1L2F A;  2Q2I A;  4PZ7 A;  4A3F H;  4A3C G;  3A5Z B;  5M5X H;  3CCU A;  3S16 H;  1U5K A;  3S2D H;  1M90 C;  5C4J H;  5C4X G;  4DR6 Q;  1A63 A;  1N34 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...