5M3MH

Free monomeric rna polymerase i at 4.0a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
144
structure length
131
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
total genus 20
structure length 131
sequence length 144
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m3mH00
1Y1WG 2NVTH 4BBRH 5M5XH 1K9MC 3S14H 1PVOA 4P71A 4WJ4A 2AWNA 3M9BA 2YYZA 3T1HL 4UP7A 2ZM6Q 1WCMH 1K83H 2VL6A 2OCEA 3CMAA 3U58A 1YHQA 4JBKA 1HZBA 5H1SE 3HOXG 2UU9L 3PIOA 2JA5H 3M3YH 2V1CC 4TVAB 2F4VL 1T9HA 2JA7H 4DR3L 1YNXA 4JOIA 3GTGH 3G48A 3PF5A 2F3IA 3HKZE 3GD7A 3U4ZA 4DR1L 1YHAA 2ZTCA 3I4OA 4B3TL 4OX9L 1C0AA 1J5EQ 1SLJA 2VW9A 3PO3H 1JT8A 4BBSH 4DUZQ 4AQYQ 1HNWQ 1I6HH 4J15A 4BA1I 4OXPA 1VQLA 4QQBX 4DV0L 4AYBE 2KCMA 3GTJH 1YEZA 1EFWA 3KF6A 2B63H 3ER0A 3TS2A 4L5QA 3GTQH 4A3DH 4BBRG 5HGQA 1WFQA 3HKSA 3SGIA 1YITA 3STBC 1X3FA 1N36L 1Q86C 1PA6A 3K8AA 3OTOQ 1KRSA 2CCZA 1WCMG 1I94Q 2IX0A 4HJ8A 4GN3B 4IPDA 1GM5A 2JA5G 2Z6KC 1CKNB 5IYCH 1PYBA 2Q2UA 1Q12A 5C4XH 1GVPA 4H02A 1X3GA 3PUYA 1EQQA 4LNQA 1HZ9A 4POFA 1QUQA 3F2BA 2R6GA 4BY7G 2E2JH 1LYLA 4O0AA 2DUDA 2Q2HA 3U50C 2B29A 3RN2A 1P16A 1QZGA 5M3MH 3UDXA 3K7AH 2BH2A 4BBSG 1B8AA 2OTLA 5JJIA 1VQKA 1MIUA 4DR6L 1AE2A 4X62Q 1S72A 1A63A 1VS0A 5GAEC 3FKIH 1HNXL 5HY6A 5C4JH 2HHHQ 2B63G 3CD6A 4A3DG 2DGYA 3K81C 4IPGA 2WB1E 4LUZA 3J81i 5IE8A 3CP0A 2JA6H 4A3BH 4IO9A 4B3RL 2UXDL 3EN2A 5IY0A 2K5HA 4GOPB 2ZJQA 4R4QA 2OWOA 2ASBA 4R4OA 4A3KG 2FXQA 4DV2L 3GTOH 2JK8A 2PI2A 3CAMA 3J81j 2JA9A 2Z0SA 5IYCG 4LFAQ 2HIVA 4B3MQ 2JA8H 2ES2A 4WJ3M 1XMOQ 1L1OB 3CCUA 4R1JA 3HOVH 4NB3A 1HNZQ 4LFBQ 3B6YA 3E9IA 4HIKA 4JCVE 3ULLA 1NJIC 1D8LA 4JG2A 1XPUA 4DAMA 1PH7A 1IL2A 2JJQA 3CQZH 3FP9A 3U4VA 4JI2L 5LMNQ 2KHJA 4MTNA 3S24A 1IZ6A 3L7ZC 3FKIG 2AHOB 2OQ0A 2CWPA 1YIJA 2RCNA 1QZHA 4A3BG 3TREA 1PH4A 3A5ZB 3KF8B 4QIWE 3VDYA 1HR0L 1OXVA 2YTYA 2HT1A 1E22A 2PQAB 1X9NA 4LF5L 1SROA 1SE8A 5JEAG 1KHIA 5IP9H 2JA8G 3M7NA 3I4NH 5IT9c 1IBLQ 2R7ZH 4QL5A 4IFDI 4B3SQ 5LMNW 3HOVG 4O2DA 4JYAL 1PH6A 1BVSA 4A3LG 2UUAQ 4DUYL 4JI5L 1XMQL 1YZ6A 1VQHA 1B7YB 1HZAA 3CC4A 3J80c 4RG1A 5M5YH 4C3HH 1IBKL 1Z9FA 2NVYH 4X64Q 4DR5Q 2IHFA 4XIGS 3S15H 4BY7H 3M4OH 3AEVA 1QVCA 2K50A 2VS1A 4YCWA 4DV3Q 2Z6KA 1EOVA 1SR3A 4R4CA 1VQAA 2KBNA 4L5TA 4X66L 1YJWA 4A93H 2JQOA 1A8VA 1L2FA 4JC0A 2MO1A 3KJPA 3CXCA 1S40A 4LF7L 3PF4A 4JI4Q 4DV5L 2BA1A 3CCQA 1S3OA 5IP9G 5LMUQ 5FLMH 3I4NG 4JI3L 1K3RA 3RZOH 4DV1Q 1VQFA 2UUCQ 1P8LA 3I7FA 4R4TA 4A3GH 4KHPQ 4A3MG 1HH2P 2QEXA 5GADC 5C0XI 1N8RC 2KHIA 4GKKQ 1RIPA 1C9OA 4BXXG 1G51A 1I50H 4LF9Q 1XJVA 1AH9A 2MO0A 3Q8DA 1XNQL 1OXUA 4FDBA 4JBMA 4DK6C 4GKJQ 1BBUA 5C3EG 2ZM6L 4A93G 4LF4Q 3HOZH 1QUQB 1VQIA 1NMFA 2HIXA 3ERSX 2VUMH 1VQNA 4DR2Q 2CFMA 3E9HA 3HOYG 2LSSA 1JB7A 1X56A 3KLWA 2H5XA 3RLNA 2QA4A 1Y1VH 5C44H 1WI5A 3BZCA 1NY4A 3TS0A 2E5LL 3CCVA 3PUWA 5DLQE 1J5EL 4A3GG 5IWAQ 2BA0A 4PZ6A 4OO1I 3UE0A 3ULPA 2VY3A 4DUZL 3EIVA 1OXXK 4AQYL 1HNWL 4DNIA 1UEBA 3UE1A 3H3VH 3S16H 4A3EH 2UU9Q 3W1GA 1VQMA 4HJ5A 3GTMH 3OW2A 1KAWA 3F1ZA 1WJJA 4A4IA 1SMXA 1N9WA 1X6OA 4K0KQ 4PZ7A 1E7ZA 3S1QH 5GQOA 4IJLA 1OXSC 2GVBA 1VQ8A 3OTOL 1CSQA 3NENA 1EIFA 1EUJA 4PMWA 1UE5A 1I94L 2VQEL 1CSPA 2E2HH 2JA7G 4IJHA 3RNUA 1LUZA 1LM0A 1BBWA 4NXNQ 4Y52H 2NN6G 1Y1VG 5JEAJ 1M1KC 3PO3G 3F2DA 2RHQB 4KLKA 3HFZB 2Q2TA 3KFUA 3PCOB 1G291 3F2CA 3D31A 4GS3A 5M5WH 1FVIA 1AE3A 2LXJA 4A3EG 4YCUA 4X62L 1UWVA 3W1BA 4LF8L 2K52A 4YHHQ 4HIOA 3RLOA 4LF6Q 1X65A 4DV4L 2K5VA 3KDFB 1G6PA 2XGTA 1V43A 3CC7A 1U0LA 4QY7A 3S1RH 4HIMA 1JMCA 3TEHB 3NBHB 1D7QA 5GAGC 4JV5Q 2L15A 1XPOA 3CC2A 2Q2IA 1ASZA 3TRZA 4OWXB 5C4XG 2YV5A 3PUZA 2K4KA 4OWTB 2WP8J 1A0IA 4ME3A 3K0XA 4DV6L 4LFAL 5IP7H 4DAYB 4B3ML 2OTJA 1VQOA 1XNRQ 3CPWA 1XMOL 2R7DA 1K8GA 4UY8C 5M3MG 1HNZL 1KC8C 1WOCA 4LFBL 4GLXA 4LFCQ 1N34Q 1JJGA 3LGJA 1VQ7A 5LMNL 4DV7Q 1EIYB 2NVXH 4DR7Q 1V1QA 4X65Q 2VZAA 4DR4L 2B3GA 1E1TA 1R9TH 3J80i 2JA6G 3K80C 2E8GA 1YJNA 1XTDA 2C35B 1YVCA 3AYHB 4A3CH 4AH6A 1C7YA 3PO2H 3UDGA 1N33Q 1Q7YC 2I5LX 2KCTA 3KYHC 1X54A 1KRTA 2VQFQ 1ASYA 3UDFA 2I5HA 3TQYA 1FL0A 1DGSA 3IRBA 1QVFA 2R93H 4JI0L 1Y14B 2NZHA 4JI8Q 1IBMQ 1BKBA 3I2ZA 2UUBL 2ATWA 4MZ9A 4UP9A 5IP7G 1FJGQ 5ELNA 1VQ6A 1TWHH 1IBLL 1YBYA 4B3SL 2YU9H 3ICEA 3I4MH 4YY3Q 1PH1A 3PUVA 4R4IA 2ID0A 3D0FA 5BR8Q 2UUAL 4P73A 1SN8A 3CCMA 2R92H 2JE6I 2MFIA 2I0QA 4YWMA 3KOJA 5AJ3L 4GNXC 2PMZE 4YWKA 4IPCA 4JI6Q 4X64L 4DR5L 1KD1C 4GOPA 1W2BA 2Y0SG 3I55A 3CCRA 2N78A 4DKAC 3GDEA 4DV3L 4A3CG 4KI0A 4JI7Q 2AWOA 4C3IH 2XTIA 1WYDA 3AQQA 3FHWA 1VQCA 4C3JH 3H0GH 4NPSA 2MNAA 1UE1A 5GAHC 3G71A 4JI5Q 2F52A 2R93G 3A74A 4RMFA 1L1OA 3UDIA 2R7ZG 5LMUL 1PYSB 2N49A 1K0RA 2AKWB 2GN5A 3KF6B 3T1YQ 3S1NH 2ZJRA 3S2DH 3I4MG 1PH5A 4DV1L 4BY1H 2A8VA 2UUCL 4BA2I 2IY5B 3OYYA 4KHPL 1V9PA 2QGQA 3J7ZC 1E3PA 2D0OA 2NZOA 2R92G 1IXRA 1VCIA 4NXMQ 2AMCB 1RL2A 1JJCB 3JAMc 1J6QA 5IYDH 4X6AH 1KQSA 1Q46A 2UXCQ 4LF9L 2YTVA 2RF4A 1PH3A 3S1MH 5J3BA 4GKJL 1Q1BA 1EYGA 2A19A 5M3FH 1Z47A 3A0JA 4JI1Q 4AIMA 4LF4L 3GTKH 4PZ8A 3PUXA 2NVQH 1MKHA 5IYBH 3HOUH 1N32Q 5FLMG 2K14A 4DR2L 4IOCA 5K36G 5JJKA 1YJ9A 3PIPA 4LWCA 1XPRA 1FGUA 1CUKA 2IT1A 3S17H 1E24A 3E0EA 1EWIA 4C2MH 3T1HQ 1XNQQ 4BY1G 5FJ8H 1K8AC 1B70B 5IWAL 4Y7NH 2CKZB 1Q82C 1TWCH 4P74A 3RZDH 3W5OA 3CCEA 4EQ5A 1HZCA 3STBD 4A3LH 5IYDG 1PV4A 2F4VQ 4QGUA 1JJ2A 1TWGH 4A3IH 1Q1EA 1X55A 4DR3Q 1KL9A 2I5MX 4POGA 4DR1Q 3MEFA 4K0KL 4IFDJ 4B3TQ 2ALYB 4HJAA 3BU2A 4OX9Q 3HOZG 1E1OA 1VQGA 1UE6A 3ZJYC 1VQBA 4GOPC 2E5LQ 5M3FG 2VUMG 4JBWA 2ZTEA 4UPAA 3PSIA 1A62A 3ULJA 2EQSA 5IYBG 4DV0Q 3HOUG 1JE5A 4HJ7A 2VNUD 5C44G 1U5KA 1GO3E 2PNHA 1VQ9A 4NXNL 3I56A 2ZTDA 4TQUS 1CKOA 2Y0SE 1L1OC 3K7UC 1N36Q 1MJEA 1IYJB 1TWAH 2EIFA 3CCJA 4GNXA 5FJ8G 4ALPA 2CQOA 1H95A 4GN5A 3G6EA 1TWFH 4LUOA 1HJPA 3DM3A 1VQJA 1M90C 1W3SA 3CW2C 5GROA 4A3JH 2VQEQ 4A3KH 2HHHL 5FLXc 4A3IG 1PFSA 2K5NA 4YHHL 1K73C 4LF6L 2GVAA 3S2HH 3WWVA 1NTGA 3EBEA 2D0PA 5JJLA 1OXTA 4JV5L 5C0XJ 2N3SA 4DR6Q 4A3FH 2MQHA 3GO5A 2WAQG 1HNXQ 4JBJA 5ELOA 3RN5A 1VQDA 5E7NA 1SRUA 4LF8Q 1XNRL 4B3RQ 2UXDQ 4GLAC 4LW1A 4DV4Q 4MNOA 3CF5A 2YTXA 1EQRA 1VQ5A 4OONA 3KJOA 1I5FA 4LFCL 2NN6I 1Q81C 4DV2Q 1N34L 2LXKA 4KHZA 4IFDG 3CPFA 4A3JG 4DV7L 4L5RC 3GTPH 3DLLA 4DR7L 1YI2A 4X65L 1GD7A 1NMGA 4DV6Q 2OQKA 3H3VI 3L0OA 4A75A 1CKNA 4APVA 1N33L 2KENA 4A76A 1PH8A 4IPHA 1O7IA 4JOIC 4JI2Q 3RR5A 2VQFL 2K75A 4OWWB 2IX1A 4A3FG 1Q8KA 3J7A5 3HOWH 4JI8L 1IBML 1SFOH 2ZJPA 3J81c 3G4SA 1FJGL 1KXLA 2WFWA 4YWLA 4DPGA 2CWAA 3HKZG 4GLVB 4XTCS 4DR4Q 3PV0A 2BH8A 1HR0Q 4YY3L 4PG3A 3M4PA 1X3EA 3A5UA 3BJUA 5BR8L 3NELA 4LF5Q 1UE7A 1LTLA 2JEAI 4P75A 4AYBG 3MXNB 3KDFA 3CCLA 4JI0Q 3JAMi 4HIDA 2UUBQ 4JI6L 5C0XG 3AFPA 1VQ4A 3PO2G 1I3QH 4GN4B 4JYAQ 1PH2A 3GTLH 4P72A 4QJFA 4JI7L 2UXBL 4DUYQ 1XMQQ 4JI4L 1TXYA 3BZKA 3JC66 4HJ9A 3CCSA 4A3MH 4YCVA 2HQLA 1HR0W 1IBKQ 3HOWG 1GKHA 1QVGA 1CKMA 1L0WA 3CMEA 2UXBQ 5AJ3Q 1Y1WH 3H15A 1MJCA 4BXXH 1KIXA 3F8TA 3T1YL 1PHJA 4IOAA 4X66Q 2E2IH 1NE3A 3AFQA 1VQPA 1NBWA 3M4QA 5C3EH 3HOXH 4DK3C 4L5SA 4LF7Q 4GKKL 2N8NA 3RLFA 1VQEA 4LUVA 4DV5Q 5EAYA 4NXML 2WAQE 4JI3Q 1YHBA 2UXCL 3HOYH 1OTCA 4OO1G 3L2PA 2JEBI 2WB1G 2PQAA 2R7FA 3NEMA 4UP8A 2RHSB 3H0GG 1PH9A 4JI1L 2PI2E 2A1AA 3PGZA 4GNXB 1N32L 4EX5A 3M85A 2D62A 2EXDA 2IHEA
chains in the Genus database with same CATH superfamily
1HUMA 4NMZA 3GTJB 2EYHA 2AWNA 3T1HL 2B63B 1PTOB 4A3DB 3U58A 1YHQA 1VF7A 1S5CD 1WTPA 4JBKA 5H1SE 4OGQC 3HP3A 2PW5A 1DYQA 2F4VL 5HGTA 1GHJA 1JE4A 1YNXA 1FD7D 4JOIA 5EBCA 2CH4A 2F3IA 3HKZE 4DR1L 1EY5A 2ZTCA 4JPBW 1K3BC 1SLJA 2VW9A 1B53A 4BBSH 3NTHA 1EU3A 4OXPA 4NP5A 3IL8A 3MXUA 1BOSA 5CV7A 3HKSA 3SGIA 1YITA 1X3FA 3K8AA 2QDBA 4HJ8A 3TZUA 2JA6B 3PIO3 2Z6KC 2Q2UA 1Q12A 3GTOB 4DAVA 3S1RB 1XXGA 4B08A 2O4XA 1HZ9A 1XYIA 3F2BA 1B1ZA 1LYLA 4O0AA 1Q3LA 2DUDA 2JA8B 2B29A 1G6ZA 4BBSG 3UDXA 4XT3B 1VQKA 1AE2A 4K14A 1S72A 3CQZB 3FKIH 5HY6A 5C4JH 3AMUA 1I4XA 4LUZA 4A3BH 2C5CA 4B3RL 5COYA 2UXDL 4GOPB 2B2TA 5A2QL 1RJTA 3GQBA 4R4OA 1G2SA 5FO8B 2XRSD 1L1OB 5C5LA 3D3RA 4JCVE 1NJIC 5EBDA 1VMPA 2JJQA 4JI2L 2A6EC 1CFMA 5LMNQ 4G7OC 3L7ZC 4KY6A 2YU9B 3I4MB 3FKIG 1D5XC 2EY1A 1QZHA 3D6WA 4A3BG 5IIFA 2B8FA 4K5XA 4K5WA 4QUCA 2YTYA 2HT1A 1JQYD 2RA4A 4NKLA 1E22A 2PQAB 1X9NA 2M00A 1CA6A 4LF5L 1PFBA 1EY7A 1SE8A 2QW7A 1BNZA 3I4NH 1AFPA 5LMNW 2Z4IA 3E0JA 4JYAL 4V190 1BVSA 5CR3A 2UUAQ 4DUYL 3RZOB 1V1PB 3WOEA 4X64Q 2UXBL 2IHFA 3S15H 3AEVA 1QVCA 2K50A 3HS0C 1PRTB 2EYMA 3AU7A 3ZYYX 3ERQA 2BCOA 1SE4A 3T53B 4JI4Q 1SE3A 4ZRZA 5G3LD 4HCSA 3I4NG 1J9OA 3KLSX 4DV1Q 4A3GH 3J80L 3SXHA 4K2KA 5GADC 1N8RC 3TN2A 2AUJD 2SEBD 5DAUA 3Q8DA 3DWAA 3URYA 1OXUA 3S16B 4DK6C 3GTMB 1ONLA 5C3EG 5BN5A 4LF4Q 1QUQB 1VQIA 1H9SB 4DFAA 3ERSX 4DR2Q 2PNRC 3E9HA 2LSSA 4J6HA 3KLWA 3RLNA 4DK0A 3BZCA 1NY4A 3TS0A 3T51B 4A3GG 3R93A 3EIVA 3MEHA 3OIPA 4IALA 3T56B 5C4ZA 3JAML 2UU9Q 4FO2A 5C5MA 3W1GA 1TVXA 4HJ5A 4G7HC 3F1ZA 1WJJA 2DNCA 1BF4A 3MXGA 1N9WA 1X6OA 4K0KQ 3S1QH 1A6XA 1EIFA 1ICWA 1RF2D 4PMWA 2PZUA 2VQEL 3CRLC 2AQ3B 1CSPA 2JA7G 4IJHA 2F0GA 1EYDA 4KY7A 1LUZA 5BN3A 1LM0A 1PLFA 2BOSA 3PO3G 1IKLA 2RHQB 3C46A 3TBIB 1B44D 1G291 1BCPC 2PZWA 2X6LA 5M5WH 3CRKC 5CV5A 2LXJA 1UWVA 3W1BA 3K58A 4DXFA 4LF6Q 4DV4L 2NVXB 4PNYA 1U4PA 1D7QA 1VDZA 2L15A 4XQJA 1WTWA 1CI3M 4OWXB 3PO2B 3Q22A 4DV6L 2OTJA 4DAYB 5HURA 5A2QE 2R7DA 1K8GA 1KC8C 2F0JA 1WOCA 3R3OA 1SFOB 5IGFA 5ELEA 5LMNL 4DV7Q 1EIYB 1B9NA 4ZCKA 4DR7Q 2EOTA 2B3GA 3J80i 3SEBA 1Y69U 2C35B 3AYHB 1C7YA 1Q7YC 1TS2A 1LTAD 1ZYRC 2KCTA 1ASYA 1X54A 1KDAA 4CDDC 3TQYA 5E4WC 1DGSA 4JI0L 1VQ6A 4UP9A 3H0GB 1TWHH 3DWQA 2KEEA 5CV4A 1E2WA 1GJXA 3D0FA 2JXMB 2EDGA 5BR8Q 5CYUA 1Y1WB 2UUAL 2R92H 2F0KA 1L0XB 2JE6I 2MFIA 4YWMA 2I0QA 3BVGA 4X64L 1HCZA 2Y0SG 5I9OA 3I55A 2K5WA 3Q6SA 3IFTA 1PTOC 4C3IH 1WYDA 2F0EA 3FHWA 2WIIB 1UE1A 3G71A 3A74A 2N49A 1O78A 2AKWB 1SSOA 3T1YQ 3S1NH 4DV1L 4BY1H 4BA2I 2IY5B 2CVRA 3J7ZC 2R92G 1IXRA 1VCIA 4NXMQ 1JWUD 1RL2A 3S14B 5G3LF 3RZDB 3KF8A 1K83B 3J80E 4O42A 1Q1BA 1DOMA 4C3IG 4AIMA 4JI1Q 4LF4L 5AFWA 4PZ8A 4DU9A 1SJED 3HOUH 1N32Q 2OEOA 1RHPA 4DR2L 5JJKA 3D4DA 1YJ9A 4S3SA 3PIPA 1EEID 1FGUA 1CUKA 3S17H 1E24A 2Z1CA 4C2MH 1K28A 3NTIA 3Q24A 3X3NA 1XNQQ 4BY1G 2O5JC 2F0NA 3VYSA 1B70B 1MSGA 3W5OA 3GTQB 2Z4HA 3KLRA 3NWSA 1PV4A 1X55A 4FP5D 4POGA 2NTSA 4HEDA 4K0KL 4IFDJ 4B3TQ 2EPBA 4QF4A 3ZJYC 1VQBA 4GOPC 4I65A 3FPPA 1WD0A 4JBWA 4BS9A 5C3WA 1HUNA 1A62A 3ULJA 2NUCA 3HOUG 4HJ7A 1SXTA 5J1ZA 1EQTA 2VNUD 3GP7A 3WOFA 4DF7A 1U5KA 1CKOA 1L1OC 3CCJA 4HR7B 4XT1B 2KCCA 3G6EA 1TWFH 4XQNA 3HKZB 1M90C 4IFDH 4A3KH 4G7ZC 3J7YW 4LF6L 1C48A 1LT3D 1F9RA 1F2ZA 5CBAE 5JJLA 4CBVA 1BDOA 2KUMA 1GHKA 4ZYSA 1SYEA 5C0XJ 4A3FH 2MQHA 3HOVB 2BE5C 1SBBB 3X3MA 1YNJC 3RN5A 2A6ED 3HOWB 1HPCA 4LW1A 1V8QA 5KYIA 1BO0A 1LTGD 4OONA 1BUVT 2ICIA 2NN6I 4DV2Q 4FXGC 4FF3A 4IFDG 2IWHA 1KTKA 4DV7L 4DR7L 3BZDB 1TY2A 5C0XH 3QR8A 1TS3A 1PZID 1PRTC 2PYKA 1O7IA 2EYFA 2KECA 3RR5A 4A3FG 3J81c 4A3MB 3OPOA 4RKBA 1EWHA 4DPGA 2CWAA 4XTCS 5EQ0A 1HR0Q 1KAAA 2JSOA 3A5UA 5BR8L 1T5XD 2CW0C 2G9HD 1RODA 2E2IB 2IL8A 1VMCA 3MXNB 3N6RA 3HOXB 2F0HA 1H9JA 4PV1C 3SK8A 5C0XG 1VQ4A 1GUSA 1CHPD 4JW0A 3EA6A 3OWEB 3HOYB 2F4IA 3JC66 3P75A 1DXMA 4RGTA 5JPMC 1HR0W 2RQXA 1E2VA 2P5ZX 4BXXH 3F8TA 3T1YL 5C3XA 4K6LA 5ELBA 1NE3A 3AFQA 4QCLA 2B2YC 1QJOA 4GKKL 4NDXA 4L5SA 4LF7Q 4IUNA 1BXTA 3EVQA 3RLFA 4DV5Q 4NXML 3LX0A 1CK1A 1LABA 1XWEA 3FVQA 2B2UC 5DNFA 5I2YA 1ICFB 3G7LA 3M3YB 1B3QA 2WB1G 3KK7A 4UP8A 2B2WA 4JI1L 4BY7B 2E75C 3D4RA 4GNXB 1N32L 1R9TH 2D62A 2EXDA 2IHEA 2NVTH 4BBRH 1K9MC 1PVOA 1F2LA 3T13A 3M9BA 5F2DA 3VYUA 2ZM6Q 1WCMH 1SAPA 5KNDA 3VR6A 1CT1D 2N55A 2JA5H 1IKMA 1KLGD 3H6MA 2F0TA 4TVAB 1LTID 4ZAIA 2XIWA 4K8IA 4C1NI 3GTGH 4KJOA 4B3TL 2E2HB 5C4XB 1JT8A 1J5EQ 2XWJB 2LFNA 5IODA 4AYBE 1NR4A 2KCMA 4X3KA 3K7AB 5M3MB 3GTJH 2B63H 4A3DH 3TS2A 1BCPD 3HG9A 4BBRG 2FMCA 2G5DA 1WFQA 3A56A 3NE5B 1KRSA 1WCMG 2HUGA 4IPDA 2Z9HA 4WFN3 1GM5A 2JA5G 2K5QA 2DY8A 1GVPA 2ENBA 2JN4A 3PUYA 4LNQA 2R6GA 2E2JH 3C1FA 2F0OA 2Q2HA 1QZGA 1DCZA 1STHA 2EE1A 5JJIA 2A6HD 5GAEC 2B63G 4KN4C 4A3DG 3CD6A 1QB5D 4KMUC 4LAAA 3H09A 4CKEA 3SK4A 2JA6H 2K5HA 2ZJQA 4OHJA 3GTOH 1BR9A 4DV2L 2JK8A 2PI2A 3CAMA 1SEBD 2JA9A 2Z0SA 2HIVA 3W2DA 1ZYRD 4TRDA 4B3MQ 2EYLA 2JA8H 2ES2A 1XMOQ 3I4LA 3E9IA 2R7ZB 3CQZH 5KRUA 1LT4D 3OWFA 5FK9C 2AHOB 2OQ0A 2CWPA 2RCNA 3VYTA 3A5ZB 4C3HB 2NVYB 1HR0L 3CHBD 4CKBA 3M4OB 1OXVA 5E1FA 2RSOA 2G9DA 2PQEA 3ONAB 1KHIA 1GXDC 1PTOD 1SNQA 2JA8G 3M7NA 2CHBD 5IT9c 4XQQA 4QL5A 1G8ZD 4B3SQ 3DWPA 1JB3A 1PH6A 1F2YA 5TSSA 4JI5L 1YZ6A 1K8MA 4RG1A 3HZXA 2X6GA 3VR3A 2VS1A 3DMUA 1EOVA 1MBYA 1I50B 2HCCA 2AQ1B 1NAPA 3EROA 1A8VA 4JC0A 4J8QA 1D1KA 2MO1A 4LF7L 3PF4A 4DV5L 2RVLA 1LTSD 3HOZB 3K5LA 4RGOS 1WTXA 2VUMB 2NVQB 1WD1A 3RZOH 1SNMA 3U9OA 2UUCQ 2DJFC 3D4WA 4R4TA 5D3IB 5C44B 1I4HA 2KHIA 4KD3A 4RA8A 4LF9Q 4A3EB 1MHWC 4FDBA 5C4HA 2ZM6L 3A7AB 4A3IB 1D1IA 2HIXA 3V96A 2CFMA 2L0CA 1Y1VH 2E5LL 1DOKA 3K57A 1J5EL 2BA0A 1B2TA 3UE0A 3ULPA 2VY3A 1OXXK 4DNIA 1UEBA 3P1HA 3EFXD 3H3VH 3FEWX 3S16H 3GTMH 4A4IA 5GQOA 1LT6D 4A3JB 5CGKA 1CSQA 1UE5A 3SDZA 5IOCA 4PQXA 3S2HB 2CQAA 5K5PA 1BCPF 4NXNQ 4Y52H 2M9VA 1Y1VG 4KTAA 5EKLA 4RHRA 1V1OA 2BE5D 2Q2TA 1WTVA 1YNJD 3I72A 3F2CA 4CKCA 2RSNA 1GUOA 2D2CC 3P20A 1X65A 2K5VA 2XGTA 5I4DA 5NUCA 4QY7A 1SMYC 1A2TA 1QNUA 3EQLC 1JMCA 5GAGC 2PCFB 2Q2IA 2R61A 3O13A 4C1NK 1ASZA 1PRTD 2MHVA 2WP8J 4ME3A 5IP7H 4B3ML 4OEMB 1DJRD 3CPWA 1XMOL 2R93B 4UY8C 1I4GA 4GLXA 3LGJA 2NVXH 1V1QA 1SNDA 1HA5A 1XTDA 4A3CH 1GUTA 1LT5D 3PO2H 1A3VA 1UUPA 3RMHA 5IGCA 3KYHC 1KRTA 2VQFQ 3UDFA 2MGSA 1Y14B 1WVLA 4QMGA 5IP7G 4C3JB 4B3SL 3ICEA 3PUVA 4R4IA 1PYWD 5BN4A 3NQTA 2QILA 1SN8A 4DA2A 1IYVA 4EQPA 3KOJA 4GNXC 4YWKA 3SK5A 1PTOF 4IPCA 1JCKB 1WTHA 3MFGA 1A3UA 4GOPA 4IN3A 1B3AA 4I7AA 3CCRA 3SR1A 2N78A 1NNXA 4A3CG 4KI0A 2XTIA 3HRZC 3NPPA 3I3CA 5FKAC 2PZTA 5C6AA 1VQCA 1EYCA 3H0GH 3M4YA 4E6IA 2SDFA 3C3LA 5K36H 3J81L 2WV6D 1L1OA 3GTKB 1PYSB 3KF6B 2ZJRA 1DD2A 1TIID 2UUCL 4X3SA 1V9PA 1SYCA 5IYDH 1J6QA 1X32A 3HEJA 4X6AH 1HHVA 4LF9L 3S1MH 3QJYA 4ZLTF 1TWGB 1STBA 3NHHA 1EYGA 1S5ED 5M3FH 1Z47A 3S9WA 1STNA 1EY4A 3H94A 3BYYB 5K36G 4MHEA 3PMFA 1KABA 2CKZB 1V1PA 1SDFA 3RZDH 2F0QA 1STAA 5IYDG 1JJ2A 1D5MC 4R8IA 1KL9A 2I5MX 3QO2A 1EIGA 1EWCA 5JAVA 3DEOA 2ALYB 2SNMA 1VQGA 1JR0D 5M3FG 1RTOA 4G4KA 4UPAA 5T1IA 1SYDA 4DV0Q 3A55A 4Z9CB 2A69C 3TP5A 1RD9D 2PNHA 1VQ9A 4NXNL 2ZTDA 4TQUS 1HRJA 1ET6A 1N36Q 1MJEA 1H95A 2EIFA 3KBGA 4ALPA 4GN5A 4QB4A 3FKIB 1VQJA 3CW2C 5M9OA 4A3BB 1PXUA 1UNSA 2M2LA 2K5NA 4BWGB 1YNNC 4AYBB 3GTPB 1OO9B 3EBEA 4HMJA 2TSSA 4M8AA 3Q0AA 4DR6Q 4FXKC 1KLUD 2NYZD 2WAQG 2SNSA 4JBJA 2XSCA 4RAUC 5E7NA 1SRUA 2B2YA 4HSPA 4Q5VA 4K2LA 4LF8Q 4GLAC 4MNOA 4HCEA 3CF5A 2YTXA 1VQ5A 3KJOA 2F0LA 1U4LA 1GUNA 2LXKA 4KHZA 2B2UA 4EGVA 1JOQA 3DM1A 1PRTF 4L5RC 1YI2A 1A2UA 1GD7A 3BDCA 1O7YA 4GZYC 4F8MA 3L0OA 2B2VA 4A75A 1CKNA 1KDBA 3KBXA 3MC0B 1O7ZA 2QF7A 4JOIC 2VQFL 1U9RA 4HAEA 4OWWB 3I4NB 2IX1A 3HOWH 2EJGC 4FXDA 4DR4Q 3HKZG 3OIQA 2O5IC 4PG3A 4J1MA 3D8GA 4P75A 4B9XA 3GV6A 5C3EB 5A35A 3JAMi 2UUBQ 2EY5A 4OO1H 3AFPA 1I3QH 3BDLA 4QJFA 2F0VA 4JI4L 2DJGC 3BZKA 4HJ9A 4A3MH 3CCSA 2HQLA 3E3XA 1IBKQ 3HOWG 1CKMA 3TSSA 5AJ3Q 1MJCA 1KIXA 2N88A 3GV3A 4IOAA 1EU4A 1X3PA 2E2IH 1TT2A 1VQPA 5M5XB 3M4QA 4IUPA 2F0IA 3HOXH 4ME5A 4DK3C 2N8NA 2B2TC 5IT9L 1CTMA 3I8ZA 3HOYH 3NUCA 1OTCA 4OO1G 1D5ZC 2FJ2A 3BVMA 2JA7B 3A8KE 5CBEE 1RDPD 1NR2A 4RH6A 4MN3A 1ESRA 4M1UB 3PO3B 1Q8IA 4H44C 2Q8TA 1I6HB 4CDEC 4P71A 3OSOA 2OCEA 3HOXG 2UU9L 3PIOA 3M3YH 1HQRD 2HCIA 2VB3X 1T9HA 5KNBA 4HN7A 3DUZA 2XWBB 3JAME 3G48A 3PF5A 4BY7H 3GD7A 1JICA 1SJHD 1C0AA 3I70A 4DUZQ 1EFID 3MAQA 2EJMA 4ZQ3A 2F3VA 4DV0L 5J39A 1YEZA 4ZKBB 1EFWA 3ER0A 1UAPA 4L5QA 3K59A 5HGQA 3VA5A 4LMQD 3STBC 1N36L 1PA6A 2L4NA 2IX0A 4GN3B 4CJ0B 5IYCH 1PYBA 4IUTA 2PW7A 1CHQD 1SMYD 5C4XH 4H02A 3TP8A 4BY7G 1NUCA 3U50C 3A8IE 3V05A 3RN2A 1P16A 5M3MH 3K7AH 2OTLA 1MIUA 4DR6L 4MIUA 1VS0A 2HHHQ 3R2IA 4IPGA 3K81C 3RD4A 4U68A 3CP0A 4IO9A 3EN2A 4HTHA 3MA2B 4A3KG 2FXQA 3J81j 2Y0SB 5IYCG 1QOHA 5JEAH 2H4OA 2K1BA 2C9OA 1HNZQ 1G91A 3B6YA 4HIKA 2NWGA 4JG2A 4A3LH 4DAMA 1PH7A 1IL2A 3FP9A 3U4VA 2I07B 2KHJA 4MTNA 3S24A 1UEAB 1YIJA 4ZK9B 3TREA 5M5YB 1CM9A 3VDYA 2KVMA 2MUYA 3QG1A 4A93B 5JEAG 4PMBA 5IP9H 1LACA 3NBHA 4C3IB 2R7ZH 4IFDI 3C2PA 4O2DA 3VR4A 5JOBA 3LNNA 1LTRD 4A3LG 1VQHA 1HZAA 3J80c 1IBKL 4C3HH 2NVYH 5EPJA 3M4OH 2Z6KA 4DN4M 1VQAA 2KBNA 1A3TA 3CXCA 1S40A 2LS01 1S3OA 5IP9G 5FLMH 4N9PA 1VQFA 3I7FA 4KHPQ 1TS5A 5IT9E 5C0XI 2F0DA 2FHTA 1JORA 1RIPA 2F0UA 1E0BA 1C9OA 4C3HG 4BXXG 1I50H 1XNQL 1IYUA 2EY6A 4B9WA 4JBMA 2HDMA 3HOZH 3IFDA 1NMFA 2AQ2B 2VUMH 2KJXA 2IW3A 1X56A 2H5XA 2QA4A 4N8FA 1EY8A 5C44H 1WI5A 5IWAQ 1S5BD 4PZ6A 1HXYD 4DUZL 3UE1A 1PTOH 4A3EH 2AUKA 1KAWA 3OW2A 1HA6A 3NTKA 1FGBD 1AP0A 3I91A 4H7BA 4PZ7A 5KGUA 1E7ZA 1CA5A 1VQ8A 1NCVA 2L12A 3TZDA 1YNND 4XXEA 1Z6HA 2WINB 3CKIB 3RNUA 2NB0A 3FRPB 1BBWA 1IHZA 2WACA 3VR5A 2EXZA 4L63B 4KLKA 4DK1A 3HFZB 3BYTB 3E5SA 2K28A 3LWEA 3W3AA 1QE6A 2DY7A 4GS3A 1AE3A 2OXPA 4A3EG 4YCUA 1CZGA 3WDNA 4YHHQ 3VA7A 1KNEA 3RLOA 4HIOA 2EYOA 3KDFB 3CC7A 2D9UA 1SYGA 1Y8NB 3S1RH 1ZXTA 2KEDA 4R8NA 5IGEA 3TRZA 3PUZA 2K4KA 1A0IA 3A54A 3K0XA 3SVMA 1X3QA 1A15A 3HGBA 1HNZL 3G6JB 3MVVA 5E3FA 1JJGA 1PZJD 2EY2A 2VZAA 1E1TA 2JA6G 3K80C 1LTTD 4KKUA 2SOBA 3EJIA 3T4AC 4XYQA 3UDGA 1N33Q 2I5LX 5J22A 4X3TA 1I6VC 4KHVA 2R93H 4RKLA 4JI8Q 2NZHA 1BKBA 2JYOA 2F3WA 2EYJA 3LWUA 3NSWA 2YU9H 3I4MH 1I4PA 4YY3Q 2LMCB 1PFMA 1EY6A 2R3ZA 3CU7A 3S2DB 1EEFD 4CJ1B 4JI6Q 1KD1C 4O1NA 4UDUC 3M7GA 2H1EA 1HTPA 2WKDA 4DKAC 1EZ8A 3GDEA 4JI7Q 1EIHA 2L5TA 3AQQA 4V0BA 5ELFA 4C3JH 4NPSA 2R93G 1LLRD 2F52A 2X69A 4QIWB 5CMDA 3UDIA 4K5VA 2JP1A 4RGMA 1Q90A 2GN5A 3I4MG 4KY5A 4ULLA 2A68C 4KHPL 2PPBC 1E3PA 2F0SA 2NZOA 2XN9C 1HFGA 4Y7NB 1KQSA 1TWCB 5KYLA 2UXCQ 1TKWB 1ILQA 3TDQA 1F2MA 2YTVA 1TS4A 1XX8A 2GA4B 2A19A 2DN8A 3A0JA 3GTKH 3PUXA 4C3JG 3GTGB 1MKHA 4UAIA 2K14A 2MP1A 4LWCA 5DM63 1LV9A 4DXGA 1FNWA 2ZXRA 1K8AC 2IX3A 5IWAL 4P74A 4EQ5A 1TWAB 3STBD 3ITPA 1ILPA 3UI2A 4QGUA 1TWGH 3DHQA 3NQIA 1ENFA 1Q1EA 1EZ6A 4DR3Q 4RCOA 3MXPA 1TQOA 2K7VA 4HJAA 3BU2A 4OX9Q 2HD3A 1MSHA 3TP6A 4FF1A 2E2JB 3BG3A 1GO3E 3PIP3 3I56A 4R9WA 1GOZA 2Y0SE 4HSVA 4DNRB 1IYJB 1RKNA 1HFNA 2CQOA 4C56C 3OMCA 3OOCA 1W3SA 5GROA 2VQEQ 4UHVA 5FLXc 4L6TB 1R4QB 4YHHL 1K73C 2ZT9C 4MTKA 1QG7A 3I90A 1QWYA 1WTOA 1OXTA 5D3DA 4L8JA 3FPUB 2A73B 4QUFA 3GO5A 1J8IA 4F88A 5I6YA 1PZKD 1HNXQ 2FMMA 1C4QA 3BVZA 2B2WC 5ELOA 4IURA 2TMPA 4DV4Q 1EQRA 2J0TD 2F0FA 3GTPH 2CW0D 2L11A 2QKIC 2OQKA 4RWSC 4DV6Q 3H3VI 4RGNA 1QCBD 1N33L 3TMEA 2K75A 1F9SA 3IAYA 3GTLB 4FNFA 3J7A5 4JI8L 1KNAA 1SFOH 2ZJPA 3G4SA 1H9RA 2WFWA 5LL6X 4GLVB 3KUPA 3PV0A 2BH8A 4YY3L 3M4PA 1U4MA 1X3EA 3BJUA 5JJZA 3FMCA 3MWYW 1LTLA 4AYBG 1O80A 1TR5A 5CV9A 2NTTA 3CCLA 4JI0Q 4HIDA 4JI6L 2ZXPA 3KLSA 3PO2G 4GN4B 1BBXC 1D6EC 4WORA 1PH2A 4P72A 1CQFA 4JI7L 1SNOA 3DEPA 5I2XA 1JOKA 4P2CB 1XMQQ 1TXYA 5FOBB 4YCVA 1GKHA 1QVGA 1L0WA 4XYOA 3CMEA 1K8OA 1Y1WH 3H15A 1PHJA 1CZWA 4X66Q 2KCNA 2KHSA 3MTSA 5C3EH 1ENCA 2ICEC 3QWNA 4DAPA 4JI3Q 1YHBA 2E76C 4FF4A 2UXCL 2JEBI 3ND9A 2PQAA 4ZKCB 2R7FA 2PMZB 3H0GG 2PI2E 2A1AA 1Y1VB 5LL6S 4BBSB 3RUZA 2F0WA 3M85A 1Y1WG 3PQIA 5M5XH 3K0YA 2BDOA 3S14H 3V2TA 3K5MA 4WJ4A 2YYZA 2KOLA 4UP7A 2K32A 1K83H 1ML0D 2VL6A 4EQOA 3CMAA 5I6WA 1HZBA 1QNKA 2V1CC 2JA7H 1I4QA 5KEEA 1CQVA 4DR3L 2V4DA 3U4ZA 1YHAA 2ZXOA 3I4OA 2K5DA 4OX9L 4RHSA 3PO3H 4IUQA 4FF2A 3K6OA 3QOJA 1HNWQ 4AQYQ 1I6HH 4J15A 1B9MA 4BA1I 1VQLA 4QQBX 1SE2A 2A5HA 3KF6A 3GTQH 5E4XA 1SYFA 1Q86C 2MPMA 1F9QA 1SNCA 5C4JB 5ELDA 3OTOQ 2CCZA 1I94Q 1MD2D 2Z6BA 1Y8OB 1CKNB 1X3GA 4F87A 5DEHA 1EQQA 4POFA 1QUQA 1H9SA 2BH2A 1RCVD 1B8AA 4LK1C 5FO7B 4X62Q 1A63A 1EL0A 1HNXL 1FNUA 4JVZA 2DGYA 2L1BA 2WB1E 3J81i 5IE8A 4ID6A 5IY0A 4R4QA 5I9PA 2RDHA 2OWOA 2ASBA 1H9KA 2IPKD 4TSSA 4KJNA 4CJ2C 4LFAQ 4JK1C 4WJ3M 3I73A 4KKSA 3CCUA 4R1JA 3HOVH 4NB3A 4LFBQ 1ZEQX 3ULLA 1D8LA 1XPUA 2A6HC 1W6KA 2D5DA 1EYAA 1IZ6A 4IUVA 3TP7A 3OW7A 1PH4A 3KF8B 4QIWE 5ISRA 3S15B 4F7XA 3E6ZX 3SE0A 1SROA 2RCFA 2J7ZA 1IBLQ 5IGBA 2FFKB 3HOVG 3K5OA 2I46A 1K0SA 3SHLA 1KDCA 4DAYA 1XMQL 4KK7A 1B7YB 3MHBA 3T16A 4A3GB 3CC4A 5M5YH 2A68D 1Z9FA 1AEXA 4DR5Q 1HQMC 4XIGS 2F1MA 3R2TA 4YCWA 4DV3Q 1SR3A 3J81E 2F03A 4R4CA 1YJWA 4L5TA 4X66L 4A93H 4ZUJA 2JQOA 1L2FA 5EGTA 3KJPA 3S1MB 1WTQA 2BA1A 2L55A 4IQZA 3CCQA 4K8JA 5LMUQ 2RDGA 2XRQD 4JI3L 5M3FB 5D65A 1K3RA 1B4OA 4CDFC 1P8LA 2EJFC 4A3MG 1HH2P 2LKVA 2QEXA 2F0MA 4OL7A 1F77A 4GKKQ 1G2TA 4OIJA 5KNCA 1G51A 1VF5C 1XJVA 2K03A 2MO0A 1AH9A 2PO4A 4GKJQ 1BBUA 3F2UA 1SNPA 5EPKA 4A93G 3D6CA 3S1QB 1LTBD 4X3UA 1STGA 1VQNA 3HOYG 2EZVA 1JB7A 1IW7C 2NN6H 3CCVA 3PUWA 5DLQE 2WAQB 2HDLA 4OO1I 1HNWL 3QOLA 4AQYL 3NBIA 1PFNA 1VQMA 4U673 1SMXA 5M5WB 1LO5D 4IJLA 1OXSC 2GVBA 5FO9B 1F9PA 3MZ5A 3OTOL 3NENA 1EUJA 1I94L 5CV8A 2Q8IB 2E2HH 4FVMA 2KA7A 1AZQA 2K04A 2NN6G 2OT2A 1EY9A 5JEAJ 3VYRA 1M1KC 3F2DA 4ABNA 3KFUA 5JPNC 3PCOB 2E74C 3D31A 1MI2A 2QCPX 1II3A 1JWMD 5JVG3 1FVIA 5EJWA 4X62L 4LF8L 2K52A 1G6PA 1V43A 1U0LA 4WJWA 4HIMA 3TEHB 3NBHB 1GUGA 4JV5Q 2RBMA 1XPOA 4Q0FA 3CC2A 5C4XG 2YV5A 4OWTB 4LFAL 1FNVA 1M8AA 1VQOA 1XNRQ 5M3MG 4NW2A 4LFBL 3N52A 1TWHB 4LFCQ 2Z8LA 1N34Q 1VQ7A 1I4RA 5FLXL 4X65Q 4DR4L 2R92B 1DONA 2E8GA 1YJNA 1YVCA 1BQQT 4AH6A 2VB2X 1FR3A 1EOTA 5IGDA 2BDNA 2FINB 2I5HA 1FL0A 3NP8A 2RKSA 3BDOA 3IRBA 2QDLA 1I3QB 1QVFA 1IBMQ 2UUBL 2ATWA 3I2ZA 1IL8A 3L9AX 4MZ9A 1FJGQ 5ELNA 2VXWA 1D2BA 1ET9A 1IBLL 1YBYA 1PH1A 2EVBA 2E2DC 2ID0A 1STYA 2B39A 2B8GA 3S1NB 4P73A 3CCMA 4BY1B 5ELCA 5AJ3L 2PMZE 1DOLA 4DNTB 4DR5L 1W2BA 4RCNA 1M4VA 1L0YB 2HQEA 4DV3L 4IZ8A 3H3VC 2IJ0A 2AWOA 4WRDA 2MNAA 5GAHC 4JI5Q 3H91A 4RMFA 3L3OC 4H0LC 4ZUIA 2R7ZG 5LMUL 1K0RA 3HOUB 3S2DH 1AZPA 1PH5A 2A8VA 3OYYA 4CHTB 3NK9A 3S17B 2XVSA 1EQVA 2QGQA 2MJ8A 2D0OA 4KD4A 4C2MB 4KN7C 2AMCB 1JJCB 3JAMc 4RFBA 1Q46A 1W6JA 1PH3A 2RF4A 5D14A 2QEJC 5EPLA 5J3BA 4GKJL 2WKCA 3VR2A 2EYPA 3IKJA 3MXNA 3SK6A 4K6DA 2NBFA 2NVQH 1E2ZA 5IYBH 1ENAA 5FLMG 2B2VC 4IOCA 1C8CA 1XPRA 1XTCD 1ZKOA 2IT1A 3E0EA 1EWIA 4N9TA 2A69D 3T1HQ 3A7LA 5FJ8H 2OF1A 1Q82C 4Y7NH 4YIJA 1TWCH 2O2LD 3CCEA 1TY0A 1HZCA 2F4VQ 4KKTA 1TWFB 3J7AV 4A3IH 1DZ1A 3J7AF 1AW7A 4DR1Q 3MEFA 4A3KB 1S5DD 3HOZG 1E1OA 1UE6A 2E5LQ 2VUMG 2ZTEA 1H9MA 1PDQA 3PSIA 2J4XA 1STEA 2EQSA 5IYBG 2F0PA 1JE5A 2L9HA 5C44G 1T5EA 1ESFA 5CC4A 4A3FB 4EVOA 3K7UC 1TWAH 1Y8PB 2DNEA 3C1EA 5DM73 4TKOB 5FJ8G 4GNXA 4LUOA 3QB3A 1HJPA 3DM3A 5KIXA 4A3JH 2HHHL 4A3IG 1PFSA 4FYDA 3AB9A 1Z7TA 2GVAA 3OHXC 3S2HH 3WWVA 1JOOA 1NTGA 2D0PA 1EY0A 4CGYB 1NSNS 1S5FD 1QILA 4JV5L 2Q8RE 2N3SA 5JVH3 3OMGA 4ILWA 1R4PB 4G57A 1SYBA 3NXWA 1VQDA 1XNRL 4B3RQ 2UXDQ 1AN8A 1PMRA 4OELB 1I5FA 4LFCL 3U9SA 1Q81C 1N34L 2K05A 3CPFA 4A3JG 3DLLA 4X65L 1NMGA 4I7ZC 4N8X1 4CDCC 1WTRA 5FLXE 4APVA 2KENA 1BCPB 1U4RA 4IPHA 2WB1B 1O7LA 4A76A 1RTNA 1PH8A 4JI2Q 4OIKA 4IUUA 1Q8KA 2A74C 1IBML 4PMCA 1FJGL 1KXLA 2K33A 4YWLA 2KQ3A 5LHY1 1FYCA 5CORA 3R8BA 3NELA 4LF5Q 5EKKA 1UE7A 5T1GA 3NWTA 2JEAI 1MGSA 1B50A 3KDFA 1JC7A 3MFYA 4HMIA 5L37A 3Q23A 4JYAQ 3GTLH 2K01A 4KV6A 1HTLD 4DUYQ 3K5NA 3BS1A 4DGZA 3A8JE 4ODGA 2NZ1D 2UXBQ 2CH4W 2XNAC 1JWSD 1R9TB 3QIAA 1TU2B 4H13C 3DXJC 4EQNA 2NVTB 3FDTA 4BBRB 3ND8A 1GUWA 1NBWA 3P7JA 1DM0B 2LY7A 4XDXA 1VQEA 4LUVA 1WCMB 5CV6A 5EAYA 2WAQE 1S4ZA 2JA5B 3L2PA 3NEMA 2RHSB 4LJZC 1PH9A 1IW7D 5IGGA 3PGZA 4EX5A 5EKIA 2K6AA 2RDFA
chains in the Genus database with same CATH topology
1Y1WG 2NVTH 4BBRH 5M5XH 1K9MC 3S14H 1PVOA 4P71A 4WJ4A 2AWNA 3M9BA 2YYZA 3T1HL 4UP7A 2ZM6Q 1WCMH 1K83H 2VL6A 2OCEA 3CMAA 3U58A 1YHQA 4JBKA 1HZBA 5H1SE 3HOXG 2UU9L 3PIOA 2JA5H 3M3YH 2V1CC 4TVAB 2F4VL 1T9HA 2JA7H 4DR3L 1YNXA 4JOIA 3GTGH 3G48A 3PF5A 2F3IA 3HKZE 3GD7A 3U4ZA 4DR1L 1YHAA 2ZTCA 3I4OA 4B3TL 4OX9L 1C0AA 1J5EQ 1SLJA 2VW9A 3PO3H 1JT8A 4BBSH 4DUZQ 4AQYQ 1HNWQ 1I6HH 4J15A 4BA1I 4OXPA 1VQLA 4QQBX 4DV0L 4AYBE 2KCMA 3GTJH 1YEZA 1EFWA 3KF6A 2B63H 3ER0A 3TS2A 4L5QA 3GTQH 4A3DH 4BBRG 5HGQA 1WFQA 3HKSA 3SGIA 1YITA 3STBC 1X3FA 1N36L 1Q86C 1PA6A 3K8AA 3OTOQ 1KRSA 2CCZA 1WCMG 1I94Q 2IX0A 4HJ8A 4GN3B 4IPDA 1GM5A 2JA5G 2Z6KC 1CKNB 5IYCH 1PYBA 2Q2UA 1Q12A 5C4XH 1GVPA 4H02A 1X3GA 3PUYA 1EQQA 4LNQA 1HZ9A 4POFA 1QUQA 3F2BA 2R6GA 4BY7G 2E2JH 1LYLA 4O0AA 2DUDA 2Q2HA 3U50C 2B29A 3RN2A 1P16A 1QZGA 5M3MH 3UDXA 3K7AH 2BH2A 4BBSG 1B8AA 2OTLA 5JJIA 1VQKA 1MIUA 4DR6L 1AE2A 4X62Q 1S72A 1A63A 1VS0A 5GAEC 3FKIH 1HNXL 5HY6A 5C4JH 2HHHQ 2B63G 3CD6A 4A3DG 2DGYA 3K81C 4IPGA 2WB1E 4LUZA 3J81i 5IE8A 3CP0A 2JA6H 4A3BH 4IO9A 4B3RL 2UXDL 3EN2A 5IY0A 2K5HA 4GOPB 2ZJQA 4R4QA 2OWOA 2ASBA 4R4OA 4A3KG 2FXQA 4DV2L 3GTOH 2JK8A 2PI2A 3CAMA 3J81j 2JA9A 2Z0SA 5IYCG 4LFAQ 2HIVA 4B3MQ 2JA8H 2ES2A 4WJ3M 1XMOQ 1L1OB 3CCUA 4R1JA 3HOVH 4NB3A 1HNZQ 4LFBQ 3B6YA 3E9IA 4HIKA 4JCVE 3ULLA 1NJIC 1D8LA 4JG2A 1XPUA 4DAMA 1PH7A 1IL2A 2JJQA 3CQZH 3FP9A 3U4VA 4JI2L 5LMNQ 2KHJA 4MTNA 3S24A 1IZ6A 3L7ZC 3FKIG 2AHOB 2OQ0A 2CWPA 1YIJA 2RCNA 1QZHA 4A3BG 3TREA 1PH4A 3A5ZB 3KF8B 4QIWE 3VDYA 1HR0L 1OXVA 2YTYA 2HT1A 1E22A 2PQAB 1X9NA 4LF5L 1SROA 1SE8A 5JEAG 1KHIA 5IP9H 2JA8G 3M7NA 3I4NH 5IT9c 1IBLQ 2R7ZH 4QL5A 4IFDI 4B3SQ 5LMNW 3HOVG 4O2DA 4JYAL 1PH6A 1BVSA 4A3LG 2UUAQ 4DUYL 4JI5L 1XMQL 1YZ6A 1VQHA 1B7YB 1HZAA 3CC4A 3J80c 4RG1A 5M5YH 4C3HH 1IBKL 1Z9FA 2NVYH 4X64Q 4DR5Q 2IHFA 4XIGS 3S15H 4BY7H 3M4OH 3AEVA 1QVCA 2K50A 2VS1A 4YCWA 4DV3Q 2Z6KA 1EOVA 1SR3A 4R4CA 1VQAA 2KBNA 4L5TA 4X66L 1YJWA 4A93H 2JQOA 1A8VA 1L2FA 4JC0A 2MO1A 3KJPA 3CXCA 1S40A 4LF7L 3PF4A 4JI4Q 4DV5L 2BA1A 3CCQA 1S3OA 5IP9G 5LMUQ 5FLMH 3I4NG 4JI3L 1K3RA 3RZOH 4DV1Q 1VQFA 2UUCQ 1P8LA 3I7FA 4R4TA 4A3GH 4KHPQ 4A3MG 1HH2P 2QEXA 5GADC 5C0XI 1N8RC 2KHIA 4GKKQ 1RIPA 1C9OA 4BXXG 1G51A 1I50H 4LF9Q 1XJVA 1AH9A 2MO0A 3Q8DA 1XNQL 1OXUA 4FDBA 4JBMA 4DK6C 4GKJQ 1BBUA 5C3EG 2ZM6L 4A93G 4LF4Q 3HOZH 1QUQB 1VQIA 1NMFA 2HIXA 3ERSX 2VUMH 1VQNA 4DR2Q 2CFMA 3E9HA 3HOYG 2LSSA 1JB7A 1X56A 3KLWA 2H5XA 3RLNA 2QA4A 1Y1VH 5C44H 1WI5A 3BZCA 1NY4A 3TS0A 2E5LL 3CCVA 3PUWA 5DLQE 1J5EL 4A3GG 5IWAQ 2BA0A 4PZ6A 4OO1I 3UE0A 3ULPA 2VY3A 4DUZL 3EIVA 1OXXK 4AQYL 1HNWL 4DNIA 1UEBA 3UE1A 3H3VH 3S16H 4A3EH 2UU9Q 3W1GA 1VQMA 4HJ5A 3GTMH 3OW2A 1KAWA 3F1ZA 1WJJA 4A4IA 1SMXA 1N9WA 1X6OA 4K0KQ 4PZ7A 1E7ZA 3S1QH 5GQOA 4IJLA 1OXSC 2GVBA 1VQ8A 3OTOL 1CSQA 3NENA 1EIFA 1EUJA 4PMWA 1UE5A 1I94L 2VQEL 1CSPA 2E2HH 2JA7G 4IJHA 3RNUA 1LUZA 1LM0A 1BBWA 4NXNQ 4Y52H 2NN6G 1Y1VG 5JEAJ 1M1KC 3PO3G 3F2DA 2RHQB 4KLKA 3HFZB 2Q2TA 3KFUA 3PCOB 1G291 3F2CA 3D31A 4GS3A 5M5WH 1FVIA 1AE3A 2LXJA 4A3EG 4YCUA 4X62L 1UWVA 3W1BA 4LF8L 2K52A 4YHHQ 4HIOA 3RLOA 4LF6Q 1X65A 4DV4L 2K5VA 3KDFB 1G6PA 2XGTA 1V43A 3CC7A 1U0LA 4QY7A 3S1RH 4HIMA 1JMCA 3TEHB 3NBHB 1D7QA 5GAGC 4JV5Q 2L15A 1XPOA 3CC2A 2Q2IA 1ASZA 3TRZA 4OWXB 5C4XG 2YV5A 3PUZA 2K4KA 4OWTB 2WP8J 1A0IA 4ME3A 3K0XA 4DV6L 4LFAL 5IP7H 4DAYB 4B3ML 2OTJA 1VQOA 1XNRQ 3CPWA 1XMOL 2R7DA 1K8GA 4UY8C 5M3MG 1HNZL 1KC8C 1WOCA 4LFBL 4GLXA 4LFCQ 1N34Q 1JJGA 3LGJA 1VQ7A 5LMNL 4DV7Q 1EIYB 2NVXH 4DR7Q 1V1QA 4X65Q 2VZAA 4DR4L 2B3GA 1E1TA 1R9TH 3J80i 2JA6G 3K80C 2E8GA 1YJNA 1XTDA 2C35B 1YVCA 3AYHB 4A3CH 4AH6A 1C7YA 3PO2H 3UDGA 1N33Q 1Q7YC 2I5LX 2KCTA 3KYHC 1X54A 1KRTA 2VQFQ 1ASYA 3UDFA 2I5HA 3TQYA 1FL0A 1DGSA 3IRBA 1QVFA 2R93H 4JI0L 1Y14B 2NZHA 4JI8Q 1IBMQ 1BKBA 3I2ZA 2UUBL 2ATWA 4MZ9A 4UP9A 5IP7G 1FJGQ 5ELNA 1VQ6A 1TWHH 1IBLL 1YBYA 4B3SL 2YU9H 3ICEA 3I4MH 4YY3Q 1PH1A 3PUVA 4R4IA 2ID0A 3D0FA 5BR8Q 2UUAL 4P73A 1SN8A 3CCMA 2R92H 2JE6I 2MFIA 2I0QA 4YWMA 3KOJA 5AJ3L 4GNXC 2PMZE 4YWKA 4IPCA 4JI6Q 4X64L 4DR5L 1KD1C 4GOPA 1W2BA 2Y0SG 3I55A 3CCRA 2N78A 4DKAC 3GDEA 4DV3L 4A3CG 4KI0A 4JI7Q 2AWOA 4C3IH 2XTIA 1WYDA 3AQQA 3FHWA 1VQCA 4C3JH 3H0GH 4NPSA 2MNAA 1UE1A 5GAHC 3G71A 4JI5Q 2F52A 2R93G 3A74A 4RMFA 1L1OA 3UDIA 2R7ZG 5LMUL 1PYSB 2N49A 1K0RA 2AKWB 2GN5A 3KF6B 3T1YQ 3S1NH 2ZJRA 3S2DH 3I4MG 1PH5A 4DV1L 4BY1H 2A8VA 2UUCL 4BA2I 2IY5B 3OYYA 4KHPL 1V9PA 2QGQA 3J7ZC 1E3PA 2D0OA 2NZOA 2R92G 1IXRA 1VCIA 4NXMQ 2AMCB 1RL2A 1JJCB 3JAMc 1J6QA 5IYDH 4X6AH 1KQSA 1Q46A 2UXCQ 4LF9L 2YTVA 2RF4A 1PH3A 3S1MH 5J3BA 4GKJL 1Q1BA 1EYGA 2A19A 5M3FH 1Z47A 3A0JA 4JI1Q 4AIMA 4LF4L 3GTKH 4PZ8A 3PUXA 2NVQH 1MKHA 5IYBH 3HOUH 1N32Q 5FLMG 2K14A 4DR2L 4IOCA 5K36G 5JJKA 1YJ9A 3PIPA 4LWCA 1XPRA 1FGUA 1CUKA 2IT1A 3S17H 1E24A 3E0EA 1EWIA 4C2MH 3T1HQ 1XNQQ 4BY1G 5FJ8H 1K8AC 1B70B 5IWAL 4Y7NH 2CKZB 1Q82C 1TWCH 4P74A 3RZDH 3W5OA 3CCEA 4EQ5A 1HZCA 3STBD 4A3LH 5IYDG 1PV4A 2F4VQ 4QGUA 1JJ2A 1TWGH 4A3IH 1Q1EA 1X55A 4DR3Q 1KL9A 2I5MX 4POGA 4DR1Q 3MEFA 4K0KL 4IFDJ 4B3TQ 2ALYB 4HJAA 3BU2A 4OX9Q 3HOZG 1E1OA 1VQGA 1UE6A 3ZJYC 1VQBA 4GOPC 2E5LQ 5M3FG 2VUMG 4JBWA 2ZTEA 4UPAA 3PSIA 1A62A 3ULJA 2EQSA 5IYBG 4DV0Q 3HOUG 1JE5A 4HJ7A 2VNUD 5C44G 1U5KA 1GO3E 2PNHA 1VQ9A 4NXNL 3I56A 2ZTDA 4TQUS 1CKOA 2Y0SE 1L1OC 3K7UC 1N36Q 1MJEA 1IYJB 1TWAH 2EIFA 3CCJA 4GNXA 5FJ8G 4ALPA 2CQOA 1H95A 4GN5A 3G6EA 1TWFH 4LUOA 1HJPA 3DM3A 1VQJA 1M90C 1W3SA 3CW2C 5GROA 4A3JH 2VQEQ 4A3KH 2HHHL 5FLXc 4A3IG 1PFSA 2K5NA 4YHHL 1K73C 4LF6L 2GVAA 3S2HH 3WWVA 1NTGA 3EBEA 2D0PA 5JJLA 1OXTA 4JV5L 5C0XJ 2N3SA 4DR6Q 4A3FH 2MQHA 3GO5A 2WAQG 1HNXQ 4JBJA 5ELOA 3RN5A 1VQDA 5E7NA 1SRUA 4LF8Q 1XNRL 4B3RQ 2UXDQ 4GLAC 4LW1A 4DV4Q 4MNOA 3CF5A 2YTXA 1EQRA 1VQ5A 4OONA 3KJOA 1I5FA 4LFCL 2NN6I 1Q81C 4DV2Q 1N34L 2LXKA 4KHZA 4IFDG 3CPFA 4A3JG 4DV7L 4L5RC 3GTPH 3DLLA 4DR7L 1YI2A 4X65L 1GD7A 1NMGA 4DV6Q 2OQKA 3H3VI 3L0OA 4A75A 1CKNA 4APVA 1N33L 2KENA 4A76A 1PH8A 4IPHA 1O7IA 4JOIC 4JI2Q 3RR5A 2VQFL 2K75A 4OWWB 2IX1A 4A3FG 1Q8KA 3J7A5 3HOWH 4JI8L 1IBML 1SFOH 2ZJPA 3J81c 3G4SA 1FJGL 1KXLA 2WFWA 4YWLA 4DPGA 2CWAA 3HKZG 4GLVB 4XTCS 4DR4Q 3PV0A 2BH8A 1HR0Q 4YY3L 4PG3A 3M4PA 1X3EA 3A5UA 3BJUA 5BR8L 3NELA 4LF5Q 1UE7A 1LTLA 2JEAI 4P75A 4AYBG 3MXNB 3KDFA 3CCLA 4JI0Q 3JAMi 4HIDA 2UUBQ 4JI6L 5C0XG 3AFPA 1VQ4A 3PO2G 1I3QH 4GN4B 4JYAQ 1PH2A 3GTLH 4P72A 4QJFA 4JI7L 2UXBL 4DUYQ 1XMQQ 4JI4L 1TXYA 3BZKA 3JC66 4HJ9A 3CCSA 4A3MH 4YCVA 2HQLA 1HR0W 1IBKQ 3HOWG 1GKHA 1QVGA 1CKMA 1L0WA 3CMEA 2UXBQ 5AJ3Q 1Y1WH 3H15A 1MJCA 4BXXH 1KIXA 3F8TA 3T1YL 1PHJA 4IOAA 4X66Q 2E2IH 1NE3A 3AFQA 1VQPA 1NBWA 3M4QA 5C3EH 3HOXH 4DK3C 4L5SA 4LF7Q 4GKKL 2N8NA 3RLFA 1VQEA 4LUVA 4DV5Q 5EAYA 4NXML 2WAQE 4JI3Q 1YHBA 2UXCL 3HOYH 1OTCA 4OO1G 3L2PA 2JEBI 2WB1G 2PQAA 2R7FA 3NEMA 4UP8A 2RHSB 3H0GG 1PH9A 4JI1L 2PI2E 2A1AA 3PGZA 4GNXB 1N32L 4EX5A 3M85A 2D62A 2EXDA 2IHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1W G;  2NVT H;  4BBR H;  5M5X H;  1K9M C;  3S14 H;  1PVO A;  4P71 A;  4WJ4 A;  2AWN A;  3M9B A;  2YYZ A;  3T1H L;  4UP7 A;  2ZM6 Q;  1WCM H;  1K83 H;  2VL6 A;  2OCE A;  3CMA A;  3U58 A;  1YHQ A;  4JBK A;  1HZB A;  5H1S E;  3HOX G;  2UU9 L;  3PIO A;  2JA5 H;  3M3Y H;  2V1C C;  4TVA B;  2F4V L;  1T9H A;  2JA7 H;  4DR3 L;  1YNX A;  4JOI A;  3GTG H;  3G48 A;  3PF5 A;  2F3I A;  3HKZ E;  3GD7 A;  3U4Z A;  4DR1 L;  1YHA A;  2ZTC A;  3I4O A;  4B3T L;  4OX9 L;  1C0A A;  1J5E Q;  1SLJ A;  2VW9 A;  3PO3 H;  1JT8 A;  4BBS H;  4DUZ Q;  4AQY Q;  1HNW Q;  1I6H H;  4J15 A;  4BA1 I;  4OXP A;  1VQL A;  4QQB X;  4DV0 L;  4AYB E;  2KCM A;  3GTJ H;  1YEZ A;  1EFW A;  3KF6 A;  2B63 H;  3ER0 A;  3TS2 A;  4L5Q A;  3GTQ H;  4A3D H;  4BBR G;  5HGQ A;  1WFQ A;  3HKS A;  3SGI A;  1YIT A;  3STB C;  1X3F A;  1N36 L;  1Q86 C;  1PA6 A;  3K8A A;  3OTO Q;  1KRS A;  2CCZ A;  1WCM G;  1I94 Q;  2IX0 A;  4HJ8 A;  4GN3 B;  4IPD A;  1GM5 A;  2JA5 G;  2Z6K C;  1CKN B;  5IYC H;  1PYB A;  2Q2U A;  1Q12 A;  5C4X H;  1GVP A;  4H02 A;  1X3G A;  3PUY A;  1EQQ A;  4LNQ A;  1HZ9 A;  4POF A;  1QUQ A;  3F2B A;  2R6G A;  4BY7 G;  2E2J H;  1LYL A;  4O0A A;  2DUD A;  2Q2H A;  3U50 C;  2B29 A;  3RN2 A;  1P16 A;  1QZG A;  5M3M H;  3UDX A;  3K7A H;  2BH2 A;  4BBS G;  1B8A A;  2OTL A;  5JJI A;  1VQK A;  1MIU A;  4DR6 L;  1AE2 A;  4X62 Q;  1S72 A;  1A63 A;  1VS0 A;  5GAE C;  3FKI H;  1HNX L;  5HY6 A;  5C4J H;  2HHH Q;  2B63 G;  3CD6 A;  4A3D G;  2DGY A;  3K81 C;  4IPG A;  2WB1 E;  4LUZ A;  3J81 i;  5IE8 A;  3CP0 A;  2JA6 H;  4A3B H;  4IO9 A;  4B3R L;  2UXD L;  3EN2 A;  5IY0 A;  2K5H A;  4GOP B;  2ZJQ A;  4R4Q A;  2OWO A;  2ASB A;  4R4O A;  4A3K G;  2FXQ A;  4DV2 L;  3GTO H;  2JK8 A;  2PI2 A;  3CAM A;  3J81 j;  2JA9 A;  2Z0S A;  5IYC G;  4LFA Q;  2HIV A;  4B3M Q;  2JA8 H;  2ES2 A;  4WJ3 M;  1XMO Q;  1L1O B;  3CCU A;  4R1J A;  3HOV H;  4NB3 A;  1HNZ Q;  4LFB Q;  3B6Y A;  3E9I A;  4HIK A;  4JCV E;  3ULL A;  1NJI C;  1D8L A;  4JG2 A;  1XPU A;  4DAM A;  1PH7 A;  1IL2 A;  2JJQ A;  3CQZ H;  3FP9 A;  3U4V A;  4JI2 L;  5LMN Q;  2KHJ A;  4MTN A;  3S24 A;  1IZ6 A;  3L7Z C;  3FKI G;  2AHO B;  2OQ0 A;  2CWP A;  1YIJ A;  2RCN A;  1QZH A;  4A3B G;  3TRE A;  1PH4 A;  3A5Z B;  3KF8 B;  4QIW E;  3VDY A;  1HR0 L;  1OXV A;  2YTY A;  2HT1 A;  1E22 A;  2PQA B;  1X9N A;  4LF5 L;  1SRO A;  1SE8 A;  5JEA G;  1KHI A;  5IP9 H;  2JA8 G;  3M7N A;  3I4N H;  5IT9 c;  1IBL Q;  2R7Z H;  4QL5 A;  4IFD I;  4B3S Q;  5LMN W;  3HOV G;  4O2D A;  4JYA L;  1PH6 A;  1BVS A;  4A3L G;  2UUA Q;  4DUY L;  4JI5 L;  1XMQ L;  1YZ6 A;  1VQH A;  1B7Y B;  1HZA A;  3CC4 A;  3J80 c;  4RG1 A;  5M5Y H;  4C3H H;  1IBK L;  1Z9F A;  2NVY H;  4X64 Q;  4DR5 Q;  2IHF A;  4XIG S;  3S15 H;  4BY7 H;  3M4O H;  3AEV A;  1QVC A;  2K50 A;  2VS1 A;  4YCW A;  4DV3 Q;  2Z6K A;  1EOV A;  1SR3 A;  4R4C A;  1VQA A;  2KBN A;  4L5T A;  4X66 L;  1YJW A;  4A93 H;  2JQO A;  1A8V A;  1L2F A;  4JC0 A;  2MO1 A;  3KJP A;  3CXC A;  1S40 A;  4LF7 L;  3PF4 A;  4JI4 Q;  4DV5 L;  2BA1 A;  3CCQ A;  1S3O A;  5IP9 G;  5LMU Q;  5FLM H;  3I4N G;  4JI3 L;  1K3R A;  3RZO H;  4DV1 Q;  1VQF A;  2UUC Q;  1P8L A;  3I7F A;  4R4T A;  4A3G H;  4KHP Q;  4A3M G;  1HH2 P;  2QEX A;  5GAD C;  5C0X I;  1N8R C;  2KHI A;  4GKK Q;  1RIP A;  1C9O A;  4BXX G;  1G51 A;  1I50 H;  4LF9 Q;  1XJV A;  1AH9 A;  2MO0 A;  3Q8D A;  1XNQ L;  1OXU A;  4FDB A;  4JBM A;  4DK6 C;  4GKJ Q;  1BBU A;  5C3E G;  2ZM6 L;  4A93 G;  4LF4 Q;  3HOZ H;  1QUQ B;  1VQI A;  1NMF A;  2HIX A;  3ERS X;  2VUM H;  1VQN A;  4DR2 Q;  2CFM A;  3E9H A;  3HOY G;  2LSS A;  1JB7 A;  1X56 A;  3KLW A;  2H5X A;  3RLN A;  2QA4 A;  1Y1V H;  5C44 H;  1WI5 A;  3BZC A;  1NY4 A;  3TS0 A;  2E5L L;  3CCV A;  3PUW A;  5DLQ E;  1J5E L;  4A3G G;  5IWA Q;  2BA0 A;  4PZ6 A;  4OO1 I;  3UE0 A;  3ULP A;  2VY3 A;  4DUZ L;  3EIV A;  1OXX K;  4AQY L;  1HNW L;  4DNI A;  1UEB A;  3UE1 A;  3H3V H;  3S16 H;  4A3E H;  2UU9 Q;  3W1G A;  1VQM A;  4HJ5 A;  3GTM H;  3OW2 A;  1KAW A;  3F1Z A;  1WJJ A;  4A4I A;  1SMX A;  1N9W A;  1X6O A;  4K0K Q;  4PZ7 A;  1E7Z A;  3S1Q H;  5GQO A;  4IJL A;  1OXS C;  2GVB A;  1VQ8 A;  3OTO L;  1CSQ A;  3NEN A;  1EIF A;  1EUJ A;  4PMW A;  1UE5 A;  1I94 L;  2VQE L;  1CSP A;  2E2H H;  2JA7 G;  4IJH A;  3RNU A;  1LUZ A;  1LM0 A;  1BBW A;  4NXN Q;  4Y52 H;  2NN6 G;  1Y1V G;  5JEA J;  1M1K C;  3PO3 G;  3F2D A;  2RHQ B;  4KLK A;  3HFZ B;  2Q2T A;  3KFU A;  3PCO B;  1G29 1;  3F2C A;  3D31 A;  4GS3 A;  5M5W H;  1FVI A;  1AE3 A;  2LXJ A;  4A3E G;  4YCU A;  4X62 L;  1UWV A;  3W1B A;  4LF8 L;  2K52 A;  4YHH Q;  4HIO A;  3RLO A;  4LF6 Q;  1X65 A;  4DV4 L;  2K5V A;  3KDF B;  1G6P A;  2XGT A;  1V43 A;  3CC7 A;  1U0L A;  4QY7 A;  3S1R H;  4HIM A;  1JMC A;  3TEH B;  3NBH B;  1D7Q A;  5GAG C;  4JV5 Q;  2L15 A;  1XPO A;  3CC2 A;  2Q2I A;  1ASZ A;  3TRZ A;  4OWX B;  5C4X G;  2YV5 A;  3PUZ A;  2K4K A;  4OWT B;  2WP8 J;  1A0I A;  4ME3 A;  3K0X A;  4DV6 L;  4LFA L;  5IP7 H;  4DAY B;  4B3M L;  2OTJ A;  1VQO A;  1XNR Q;  3CPW A;  1XMO L;  2R7D A;  1K8G A;  4UY8 C;  5M3M G;  1HNZ L;  1KC8 C;  1WOC A;  4LFB L;  4GLX A;  4LFC Q;  1N34 Q;  1JJG A;  3LGJ A;  1VQ7 A;  5LMN L;  4DV7 Q;  1EIY B;  2NVX H;  4DR7 Q;  1V1Q A;  4X65 Q;  2VZA A;  4DR4 L;  2B3G A;  1E1T A;  1R9T H;  3J80 i;  2JA6 G;  3K80 C;  2E8G A;  1YJN A;  1XTD A;  2C35 B;  1YVC A;  3AYH B;  4A3C H;  4AH6 A;  1C7Y A;  3PO2 H;  3UDG A;  1N33 Q;  1Q7Y C;  2I5L X;  2KCT A;  3KYH C;  1X54 A;  1KRT A;  2VQF Q;  1ASY A;  3UDF A;  2I5H A;  3TQY A;  1FL0 A;  1DGS A;  3IRB A;  1QVF A;  2R93 H;  4JI0 L;  1Y14 B;  2NZH A;  4JI8 Q;  1IBM Q;  1BKB A;  3I2Z A;  2UUB L;  2ATW A;  4MZ9 A;  4UP9 A;  5IP7 G;  1FJG Q;  5ELN A;  1VQ6 A;  1TWH H;  1IBL L;  1YBY A;  4B3S L;  2YU9 H;  3ICE A;  3I4M H;  4YY3 Q;  1PH1 A;  3PUV A;  4R4I A;  2ID0 A;  3D0F A;  5BR8 Q;  2UUA L;  4P73 A;  1SN8 A;  3CCM A;  2R92 H;  2JE6 I;  2MFI A;  2I0Q A;  4YWM A;  3KOJ A;  5AJ3 L;  4GNX C;  2PMZ E;  4YWK A;  4IPC A;  4JI6 Q;  4X64 L;  4DR5 L;  1KD1 C;  4GOP A;  1W2B A;  2Y0S G;  3I55 A;  3CCR A;  2N78 A;  4DKA C;  3GDE A;  4DV3 L;  4A3C G;  4KI0 A;  4JI7 Q;  2AWO A;  4C3I H;  2XTI A;  1WYD A;  3AQQ A;  3FHW A;  1VQC A;  4C3J H;  3H0G H;  4NPS A;  2MNA A;  1UE1 A;  5GAH C;  3G71 A;  4JI5 Q;  2F52 A;  2R93 G;  3A74 A;  4RMF A;  1L1O A;  3UDI A;  2R7Z G;  5LMU L;  1PYS B;  2N49 A;  1K0R A;  2AKW B;  2GN5 A;  3KF6 B;  3T1Y Q;  3S1N H;  2ZJR A;  3S2D H;  3I4M G;  1PH5 A;  4DV1 L;  4BY1 H;  2A8V A;  2UUC L;  4BA2 I;  2IY5 B;  3OYY A;  4KHP L;  1V9P A;  2QGQ A;  3J7Z C;  1E3P A;  2D0O A;  2NZO A;  2R92 G;  1IXR A;  1VCI A;  4NXM Q;  2AMC B;  1RL2 A;  1JJC B;  3JAM c;  1J6Q A;  5IYD H;  4X6A H;  1KQS A;  1Q46 A;  2UXC Q;  4LF9 L;  2YTV A;  2RF4 A;  1PH3 A;  3S1M H;  5J3B A;  4GKJ L;  1Q1B A;  1EYG A;  2A19 A;  5M3F H;  1Z47 A;  3A0J A;  4JI1 Q;  4AIM A;  4LF4 L;  3GTK H;  4PZ8 A;  3PUX A;  2NVQ H;  1MKH A;  5IYB H;  3HOU H;  1N32 Q;  5FLM G;  2K14 A;  4DR2 L;  4IOC A;  5K36 G;  5JJK A;  1YJ9 A;  3PIP A;  4LWC A;  1XPR A;  1FGU A;  1CUK A;  2IT1 A;  3S17 H;  1E24 A;  3E0E A;  1EWI A;  4C2M H;  3T1H Q;  1XNQ Q;  4BY1 G;  5FJ8 H;  1K8A C;  1B70 B;  5IWA L;  4Y7N H;  2CKZ B;  1Q82 C;  1TWC H;  4P74 A;  3RZD H;  3W5O A;  3CCE A;  4EQ5 A;  1HZC A;  3STB D;  4A3L H;  5IYD G;  1PV4 A;  2F4V Q;  4QGU A;  1JJ2 A;  1TWG H;  4A3I H;  1Q1E A;  1X55 A;  4DR3 Q;  1KL9 A;  2I5M X;  4POG A;  4DR1 Q;  3MEF A;  4K0K L;  4IFD J;  4B3T Q;  2ALY B;  4HJA A;  3BU2 A;  4OX9 Q;  3HOZ G;  1E1O A;  1VQG A;  1UE6 A;  3ZJY C;  1VQB A;  4GOP C;  2E5L Q;  5M3F G;  2VUM G;  4JBW A;  2ZTE A;  4UPA A;  3PSI A;  1A62 A;  3ULJ A;  2EQS A;  5IYB G;  4DV0 Q;  3HOU G;  1JE5 A;  4HJ7 A;  2VNU D;  5C44 G;  1U5K A;  1GO3 E;  2PNH A;  1VQ9 A;  4NXN L;  3I56 A;  2ZTD A;  4TQU S;  1CKO A;  2Y0S E;  1L1O C;  3K7U C;  1N36 Q;  1MJE A;  1IYJ B;  1TWA H;  2EIF A;  3CCJ A;  4GNX A;  5FJ8 G;  4ALP A;  2CQO A;  1H95 A;  4GN5 A;  3G6E A;  1TWF H;  4LUO A;  1HJP A;  3DM3 A;  1VQJ A;  1M90 C;  1W3S A;  3CW2 C;  5GRO A;  4A3J H;  2VQE Q;  4A3K H;  2HHH L;  5FLX c;  4A3I G;  1PFS A;  2K5N A;  4YHH L;  1K73 C;  4LF6 L;  2GVA A;  3S2H H;  3WWV A;  1NTG A;  3EBE A;  2D0P A;  5JJL A;  1OXT A;  4JV5 L;  5C0X J;  2N3S A;  4DR6 Q;  4A3F H;  2MQH A;  3GO5 A;  2WAQ G;  1HNX Q;  4JBJ A;  5ELO A;  3RN5 A;  1VQD A;  5E7N A;  1SRU A;  4LF8 Q;  1XNR L;  4B3R Q;  2UXD Q;  4GLA C;  4LW1 A;  4DV4 Q;  4MNO A;  3CF5 A;  2YTX A;  1EQR A;  1VQ5 A;  4OON A;  3KJO A;  1I5F A;  4LFC L;  2NN6 I;  1Q81 C;  4DV2 Q;  1N34 L;  2LXK A;  4KHZ A;  4IFD G;  3CPF A;  4A3J G;  4DV7 L;  4L5R C;  3GTP H;  3DLL A;  4DR7 L;  1YI2 A;  4X65 L;  1GD7 A;  1NMG A;  4DV6 Q;  2OQK A;  3H3V I;  3L0O A;  4A75 A;  1CKN A;  4APV A;  1N33 L;  2KEN A;  4A76 A;  1PH8 A;  4IPH A;  1O7I A;  4JOI C;  4JI2 Q;  3RR5 A;  2VQF L;  2K75 A;  4OWW B;  2IX1 A;  4A3F G;  1Q8K A;  3J7A 5;  3HOW H;  4JI8 L;  1IBM L;  1SFO H;  2ZJP A;  3J81 c;  3G4S A;  1FJG L;  1KXL A;  2WFW A;  4YWL A;  4DPG A;  2CWA A;  3HKZ G;  4GLV B;  4XTC S;  4DR4 Q;  3PV0 A;  2BH8 A;  1HR0 Q;  4YY3 L;  4PG3 A;  3M4P A;  1X3E A;  3A5U A;  3BJU A;  5BR8 L;  3NEL A;  4LF5 Q;  1UE7 A;  1LTL A;  2JEA I;  4P75 A;  4AYB G;  3MXN B;  3KDF A;  3CCL A;  4JI0 Q;  3JAM i;  4HID A;  2UUB Q;  4JI6 L;  5C0X G;  3AFP A;  1VQ4 A;  3PO2 G;  1I3Q H;  4GN4 B;  4JYA Q;  1PH2 A;  3GTL H;  4P72 A;  4QJF A;  4JI7 L;  2UXB L;  4DUY Q;  1XMQ Q;  4JI4 L;  1TXY A;  3BZK A;  3JC6 6;  4HJ9 A;  3CCS A;  4A3M H;  4YCV A;  2HQL A;  1HR0 W;  1IBK Q;  3HOW G;  1GKH A;  1QVG A;  1CKM A;  1L0W A;  3CME A;  2UXB Q;  5AJ3 Q;  1Y1W H;  3H15 A;  1MJC A;  4BXX H;  1KIX A;  3F8T A;  3T1Y L;  1PHJ A;  4IOA A;  4X66 Q;  2E2I H;  1NE3 A;  3AFQ A;  1VQP A;  1NBW A;  3M4Q A;  5C3E H;  3HOX H;  4DK3 C;  4L5S A;  4LF7 Q;  4GKK L;  2N8N A;  3RLF A;  1VQE A;  4LUV A;  4DV5 Q;  5EAY A;  4NXM L;  2WAQ E;  4JI3 Q;  1YHB A;  2UXC L;  3HOY H;  1OTC A;  4OO1 G;  3L2P A;  2JEB I;  2WB1 G;  2PQA A;  2R7F A;  3NEM A;  4UP8 A;  2RHS B;  3H0G G;  1PH9 A;  4JI1 L;  2PI2 E;  2A1A A;  3PGZ A;  4GNX B;  1N32 L;  4EX5 A;  3M85 A;  2D62 A;  2EXD A;  2IHE A; 
#chains in the Genus database with same CATH topology
 1HUM A;  4NMZ A;  3GTJ B;  2EYH A;  2AWN A;  3T1H L;  2B63 B;  1PTO B;  4A3D B;  3U58 A;  1YHQ A;  1VF7 A;  1S5C D;  1WTP A;  4JBK A;  5H1S E;  4OGQ C;  3HP3 A;  2PW5 A;  1DYQ A;  2F4V L;  5HGT A;  1GHJ A;  1JE4 A;  1YNX A;  1FD7 D;  4JOI A;  5EBC A;  2CH4 A;  2F3I A;  3HKZ E;  4DR1 L;  1EY5 A;  2ZTC A;  4JPB W;  1K3B C;  1SLJ A;  2VW9 A;  1B53 A;  4BBS H;  3NTH A;  1EU3 A;  4OXP A;  4NP5 A;  3IL8 A;  3MXU A;  1BOS A;  5CV7 A;  3HKS A;  3SGI A;  1YIT A;  1X3F A;  3K8A A;  2QDB A;  4HJ8 A;  3TZU A;  2JA6 B;  3PIO 3;  2Z6K C;  2Q2U A;  1Q12 A;  3GTO B;  4DAV A;  3S1R B;  1XXG A;  4B08 A;  2O4X A;  1HZ9 A;  1XYI A;  3F2B A;  1B1Z A;  1LYL A;  4O0A A;  1Q3L A;  2DUD A;  2JA8 B;  2B29 A;  1G6Z A;  4BBS G;  3UDX A;  4XT3 B;  1VQK A;  1AE2 A;  4K14 A;  1S72 A;  3CQZ B;  3FKI H;  5HY6 A;  5C4J H;  3AMU A;  1I4X A;  4LUZ A;  4A3B H;  2C5C A;  4B3R L;  5COY A;  2UXD L;  4GOP B;  2B2T A;  5A2Q L;  1RJT A;  3GQB A;  4R4O A;  1G2S A;  5FO8 B;  2XRS D;  1L1O B;  5C5L A;  3D3R A;  4JCV E;  1NJI C;  5EBD A;  1VMP A;  2JJQ A;  4JI2 L;  2A6E C;  1CFM A;  5LMN Q;  4G7O C;  3L7Z C;  4KY6 A;  2YU9 B;  3I4M B;  3FKI G;  1D5X C;  2EY1 A;  1QZH A;  3D6W A;  4A3B G;  5IIF A;  2B8F A;  4K5X A;  4K5W A;  4QUC A;  2YTY A;  2HT1 A;  1JQY D;  2RA4 A;  4NKL A;  1E22 A;  2PQA B;  1X9N A;  2M00 A;  1CA6 A;  4LF5 L;  1PFB A;  1EY7 A;  1SE8 A;  2QW7 A;  1BNZ A;  3I4N H;  1AFP A;  5LMN W;  2Z4I A;  3E0J A;  4JYA L;  4V19 0;  1BVS A;  5CR3 A;  2UUA Q;  4DUY L;  3RZO B;  1V1P B;  3WOE A;  4X64 Q;  2UXB L;  2IHF A;  3S15 H;  3AEV A;  1QVC A;  2K50 A;  3HS0 C;  1PRT B;  2EYM A;  3AU7 A;  3ZYY X;  3ERQ A;  2BCO A;  1SE4 A;  3T53 B;  4JI4 Q;  1SE3 A;  4ZRZ A;  5G3L D;  4HCS A;  3I4N G;  1J9O A;  3KLS X;  4DV1 Q;  4A3G H;  3J80 L;  3SXH A;  4K2K A;  5GAD C;  1N8R C;  3TN2 A;  2AUJ D;  2SEB D;  5DAU A;  3Q8D A;  3DWA A;  3URY A;  1OXU A;  3S16 B;  4DK6 C;  3GTM B;  1ONL A;  5C3E G;  5BN5 A;  4LF4 Q;  1QUQ B;  1VQI A;  1H9S B;  4DFA A;  3ERS X;  4DR2 Q;  2PNR C;  3E9H A;  2LSS A;  4J6H A;  3KLW A;  3RLN A;  4DK0 A;  3BZC A;  1NY4 A;  3TS0 A;  3T51 B;  4A3G G;  3R93 A;  3EIV A;  3MEH A;  3OIP A;  4IAL A;  3T56 B;  5C4Z A;  3JAM L;  2UU9 Q;  4FO2 A;  5C5M A;  3W1G A;  1TVX A;  4HJ5 A;  4G7H C;  3F1Z A;  1WJJ A;  2DNC A;  1BF4 A;  3MXG A;  1N9W A;  1X6O A;  4K0K Q;  3S1Q H;  1A6X A;  1EIF A;  1ICW A;  1RF2 D;  4PMW A;  2PZU A;  2VQE L;  3CRL C;  2AQ3 B;  1CSP A;  2JA7 G;  4IJH A;  2F0G A;  1EYD A;  4KY7 A;  1LUZ A;  5BN3 A;  1LM0 A;  1PLF A;  2BOS A;  3PO3 G;  1IKL A;  2RHQ B;  3C46 A;  3TBI B;  1B44 D;  1G29 1;  1BCP C;  2PZW A;  2X6L A;  5M5W H;  3CRK C;  5CV5 A;  2LXJ A;  1UWV A;  3W1B A;  3K58 A;  4DXF A;  4LF6 Q;  4DV4 L;  2NVX B;  4PNY A;  1U4P A;  1D7Q A;  1VDZ A;  2L15 A;  4XQJ A;  1WTW A;  1CI3 M;  4OWX B;  3PO2 B;  3Q22 A;  4DV6 L;  2OTJ A;  4DAY B;  5HUR A;  5A2Q E;  2R7D A;  1K8G A;  1KC8 C;  2F0J A;  1WOC A;  3R3O A;  1SFO B;  5IGF A;  5ELE A;  5LMN L;  4DV7 Q;  1EIY B;  1B9N A;  4ZCK A;  4DR7 Q;  2EOT A;  2B3G A;  3J80 i;  3SEB A;  1Y69 U;  2C35 B;  3AYH B;  1C7Y A;  1Q7Y C;  1TS2 A;  1LTA D;  1ZYR C;  2KCT A;  1ASY A;  1X54 A;  1KDA A;  4CDD C;  3TQY A;  5E4W C;  1DGS A;  4JI0 L;  1VQ6 A;  4UP9 A;  3H0G B;  1TWH H;  3DWQ A;  2KEE A;  5CV4 A;  1E2W A;  1GJX A;  3D0F A;  2JXM B;  2EDG A;  5BR8 Q;  5CYU A;  1Y1W B;  2UUA L;  2R92 H;  2F0K A;  1L0X B;  2JE6 I;  2MFI A;  4YWM A;  2I0Q A;  3BVG A;  4X64 L;  1HCZ A;  2Y0S G;  5I9O A;  3I55 A;  2K5W A;  3Q6S A;  3IFT A;  1PTO C;  4C3I H;  1WYD A;  2F0E A;  3FHW A;  2WII B;  1UE1 A;  3G71 A;  3A74 A;  2N49 A;  1O78 A;  2AKW B;  1SSO A;  3T1Y Q;  3S1N H;  4DV1 L;  4BY1 H;  4BA2 I;  2IY5 B;  2CVR A;  3J7Z C;  2R92 G;  1IXR A;  1VCI A;  4NXM Q;  1JWU D;  1RL2 A;  3S14 B;  5G3L F;  3RZD B;  3KF8 A;  1K83 B;  3J80 E;  4O42 A;  1Q1B A;  1DOM A;  4C3I G;  4AIM A;  4JI1 Q;  4LF4 L;  5AFW A;  4PZ8 A;  4DU9 A;  1SJE D;  3HOU H;  1N32 Q;  2OEO A;  1RHP A;  4DR2 L;  5JJK A;  3D4D A;  1YJ9 A;  4S3S A;  3PIP A;  1EEI D;  1FGU A;  1CUK A;  3S17 H;  1E24 A;  2Z1C A;  4C2M H;  1K28 A;  3NTI A;  3Q24 A;  3X3N A;  1XNQ Q;  4BY1 G;  2O5J C;  2F0N A;  3VYS A;  1B70 B;  1MSG A;  3W5O A;  3GTQ B;  2Z4H A;  3KLR A;  3NWS A;  1PV4 A;  1X55 A;  4FP5 D;  4POG A;  2NTS A;  4HED A;  4K0K L;  4IFD J;  4B3T Q;  2EPB A;  4QF4 A;  3ZJY C;  1VQB A;  4GOP C;  4I65 A;  3FPP A;  1WD0 A;  4JBW A;  4BS9 A;  5C3W A;  1HUN A;  1A62 A;  3ULJ A;  2NUC A;  3HOU G;  4HJ7 A;  1SXT A;  5J1Z A;  1EQT A;  2VNU D;  3GP7 A;  3WOF A;  4DF7 A;  1U5K A;  1CKO A;  1L1O C;  3CCJ A;  4HR7 B;  4XT1 B;  2KCC A;  3G6E A;  1TWF H;  4XQN A;  3HKZ B;  1M90 C;  4IFD H;  4A3K H;  4G7Z C;  3J7Y W;  4LF6 L;  1C48 A;  1LT3 D;  1F9R A;  1F2Z A;  5CBA E;  5JJL A;  4CBV A;  1BDO A;  2KUM A;  1GHK A;  4ZYS A;  1SYE A;  5C0X J;  4A3F H;  2MQH A;  3HOV B;  2BE5 C;  1SBB B;  3X3M A;  1YNJ C;  3RN5 A;  2A6E D;  3HOW B;  1HPC A;  4LW1 A;  1V8Q A;  5KYI A;  1BO0 A;  1LTG D;  4OON A;  1BUV T;  2ICI A;  2NN6 I;  4DV2 Q;  4FXG C;  4FF3 A;  4IFD G;  2IWH A;  1KTK A;  4DV7 L;  4DR7 L;  3BZD B;  1TY2 A;  5C0X H;  3QR8 A;  1TS3 A;  1PZI D;  1PRT C;  2PYK A;  1O7I A;  2EYF A;  2KEC A;  3RR5 A;  4A3F G;  3J81 c;  4A3M B;  3OPO A;  4RKB A;  1EWH A;  4DPG A;  2CWA A;  4XTC S;  5EQ0 A;  1HR0 Q;  1KAA A;  2JSO A;  3A5U A;  5BR8 L;  1T5X D;  2CW0 C;  2G9H D;  1ROD A;  2E2I B;  2IL8 A;  1VMC A;  3MXN B;  3N6R A;  3HOX B;  2F0H A;  1H9J A;  4PV1 C;  3SK8 A;  5C0X G;  1VQ4 A;  1GUS A;  1CHP D;  4JW0 A;  3EA6 A;  3OWE B;  3HOY B;  2F4I A;  3JC6 6;  3P75 A;  1DXM A;  4RGT A;  5JPM C;  1HR0 W;  2RQX A;  1E2V A;  2P5Z X;  4BXX H;  3F8T A;  3T1Y L;  5C3X A;  4K6L A;  5ELB A;  1NE3 A;  3AFQ A;  4QCL A;  2B2Y C;  1QJO A;  4GKK L;  4NDX A;  4L5S A;  4LF7 Q;  4IUN A;  1BXT A;  3EVQ A;  3RLF A;  4DV5 Q;  4NXM L;  3LX0 A;  1CK1 A;  1LAB A;  1XWE A;  3FVQ A;  2B2U C;  5DNF A;  5I2Y A;  1ICF B;  3G7L A;  3M3Y B;  1B3Q A;  2WB1 G;  3KK7 A;  4UP8 A;  2B2W A;  4JI1 L;  4BY7 B;  2E75 C;  3D4R A;  4GNX B;  1N32 L;  1R9T H;  2D62 A;  2EXD A;  2IHE A;  2NVT H;  4BBR H;  1K9M C;  1PVO A;  1F2L A;  3T13 A;  3M9B A;  5F2D A;  3VYU A;  2ZM6 Q;  1WCM H;  1SAP A;  5KND A;  3VR6 A;  1CT1 D;  2N55 A;  2JA5 H;  1IKM A;  1KLG D;  3H6M A;  2F0T A;  4TVA B;  1LTI D;  4ZAI A;  2XIW A;  4K8I A;  4C1N I;  3GTG H;  4KJO A;  4B3T L;  2E2H B;  5C4X B;  1JT8 A;  1J5E Q;  2XWJ B;  2LFN A;  5IOD A;  4AYB E;  1NR4 A;  2KCM A;  4X3K A;  3K7A B;  5M3M B;  3GTJ H;  2B63 H;  4A3D H;  3TS2 A;  1BCP D;  3HG9 A;  4BBR G;  2FMC A;  2G5D A;  1WFQ A;  3A56 A;  3NE5 B;  1KRS A;  1WCM G;  2HUG A;  4IPD A;  2Z9H A;  4WFN 3;  1GM5 A;  2JA5 G;  2K5Q A;  2DY8 A;  1GVP A;  2ENB A;  2JN4 A;  3PUY A;  4LNQ A;  2R6G A;  2E2J H;  3C1F A;  2F0O A;  2Q2H A;  1QZG A;  1DCZ A;  1STH A;  2EE1 A;  5JJI A;  2A6H D;  5GAE C;  2B63 G;  4KN4 C;  4A3D G;  3CD6 A;  1QB5 D;  4KMU C;  4LAA A;  3H09 A;  4CKE A;  3SK4 A;  2JA6 H;  2K5H A;  2ZJQ A;  4OHJ A;  3GTO H;  1BR9 A;  4DV2 L;  2JK8 A;  2PI2 A;  3CAM A;  1SEB D;  2JA9 A;  2Z0S A;  2HIV A;  3W2D A;  1ZYR D;  4TRD A;  4B3M Q;  2EYL A;  2JA8 H;  2ES2 A;  1XMO Q;  3I4L A;  3E9I A;  2R7Z B;  3CQZ H;  5KRU A;  1LT4 D;  3OWF A;  5FK9 C;  2AHO B;  2OQ0 A;  2CWP A;  2RCN A;  3VYT A;  3A5Z B;  4C3H B;  2NVY B;  1HR0 L;  3CHB D;  4CKB A;  3M4O B;  1OXV A;  5E1F A;  2RSO A;  2G9D A;  2PQE A;  3ONA B;  1KHI A;  1GXD C;  1PTO D;  1SNQ A;  2JA8 G;  3M7N A;  2CHB D;  5IT9 c;  4XQQ A;  4QL5 A;  1G8Z D;  4B3S Q;  3DWP A;  1JB3 A;  1PH6 A;  1F2Y A;  5TSS A;  4JI5 L;  1YZ6 A;  1K8M A;  4RG1 A;  3HZX A;  2X6G A;  3VR3 A;  2VS1 A;  3DMU A;  1EOV A;  1MBY A;  1I50 B;  2HCC A;  2AQ1 B;  1NAP A;  3ERO A;  1A8V A;  4JC0 A;  4J8Q A;  1D1K A;  2MO1 A;  4LF7 L;  3PF4 A;  4DV5 L;  2RVL A;  1LTS D;  3HOZ B;  3K5L A;  4RGO S;  1WTX A;  2VUM B;  2NVQ B;  1WD1 A;  3RZO H;  1SNM A;  3U9O A;  2UUC Q;  2DJF C;  3D4W A;  4R4T A;  5D3I B;  5C44 B;  1I4H A;  2KHI A;  4KD3 A;  4RA8 A;  4LF9 Q;  4A3E B;  1MHW C;  4FDB A;  5C4H A;  2ZM6 L;  3A7A B;  4A3I B;  1D1I A;  2HIX A;  3V96 A;  2CFM A;  2L0C A;  1Y1V H;  2E5L L;  1DOK A;  3K57 A;  1J5E L;  2BA0 A;  1B2T A;  3UE0 A;  3ULP A;  2VY3 A;  1OXX K;  4DNI A;  1UEB A;  3P1H A;  3EFX D;  3H3V H;  3FEW X;  3S16 H;  3GTM H;  4A4I A;  5GQO A;  1LT6 D;  4A3J B;  5CGK A;  1CSQ A;  1UE5 A;  3SDZ A;  5IOC A;  4PQX A;  3S2H B;  2CQA A;  5K5P A;  1BCP F;  4NXN Q;  4Y52 H;  2M9V A;  1Y1V G;  4KTA A;  5EKL A;  4RHR A;  1V1O A;  2BE5 D;  2Q2T A;  1WTV A;  1YNJ D;  3I72 A;  3F2C A;  4CKC A;  2RSN A;  1GUO A;  2D2C C;  3P20 A;  1X65 A;  2K5V A;  2XGT A;  5I4D A;  5NUC A;  4QY7 A;  1SMY C;  1A2T A;  1QNU A;  3EQL C;  1JMC A;  5GAG C;  2PCF B;  2Q2I A;  2R61 A;  3O13 A;  4C1N K;  1ASZ A;  1PRT D;  2MHV A;  2WP8 J;  4ME3 A;  5IP7 H;  4B3M L;  4OEM B;  1DJR D;  3CPW A;  1XMO L;  2R93 B;  4UY8 C;  1I4G A;  4GLX A;  3LGJ A;  2NVX H;  1V1Q A;  1SND A;  1HA5 A;  1XTD A;  4A3C H;  1GUT A;  1LT5 D;  3PO2 H;  1A3V A;  1UUP A;  3RMH A;  5IGC A;  3KYH C;  1KRT A;  2VQF Q;  3UDF A;  2MGS A;  1Y14 B;  1WVL A;  4QMG A;  5IP7 G;  4C3J B;  4B3S L;  3ICE A;  3PUV A;  4R4I A;  1PYW D;  5BN4 A;  3NQT A;  2QIL A;  1SN8 A;  4DA2 A;  1IYV A;  4EQP A;  3KOJ A;  4GNX C;  4YWK A;  3SK5 A;  1PTO F;  4IPC A;  1JCK B;  1WTH A;  3MFG A;  1A3U A;  4GOP A;  4IN3 A;  1B3A A;  4I7A A;  3CCR A;  3SR1 A;  2N78 A;  1NNX A;  4A3C G;  4KI0 A;  2XTI A;  3HRZ C;  3NPP A;  3I3C A;  5FKA C;  2PZT A;  5C6A A;  1VQC A;  1EYC A;  3H0G H;  3M4Y A;  4E6I A;  2SDF A;  3C3L A;  5K36 H;  3J81 L;  2WV6 D;  1L1O A;  3GTK B;  1PYS B;  3KF6 B;  2ZJR A;  1DD2 A;  1TII D;  2UUC L;  4X3S A;  1V9P A;  1SYC A;  5IYD H;  1J6Q A;  1X32 A;  3HEJ A;  4X6A H;  1HHV A;  4LF9 L;  3S1M H;  3QJY A;  4ZLT F;  1TWG B;  1STB A;  3NHH A;  1EYG A;  1S5E D;  5M3F H;  1Z47 A;  3S9W A;  1STN A;  1EY4 A;  3H94 A;  3BYY B;  5K36 G;  4MHE A;  3PMF A;  1KAB A;  2CKZ B;  1V1P A;  1SDF A;  3RZD H;  2F0Q A;  1STA A;  5IYD G;  1JJ2 A;  1D5M C;  4R8I A;  1KL9 A;  2I5M X;  3QO2 A;  1EIG A;  1EWC A;  5JAV A;  3DEO A;  2ALY B;  2SNM A;  1VQG A;  1JR0 D;  5M3F G;  1RTO A;  4G4K A;  4UPA A;  5T1I A;  1SYD A;  4DV0 Q;  3A55 A;  4Z9C B;  2A69 C;  3TP5 A;  1RD9 D;  2PNH A;  1VQ9 A;  4NXN L;  2ZTD A;  4TQU S;  1HRJ A;  1ET6 A;  1N36 Q;  1MJE A;  1H95 A;  2EIF A;  3KBG A;  4ALP A;  4GN5 A;  4QB4 A;  3FKI B;  1VQJ A;  3CW2 C;  5M9O A;  4A3B B;  1PXU A;  1UNS A;  2M2L A;  2K5N A;  4BWG B;  1YNN C;  4AYB B;  3GTP B;  1OO9 B;  3EBE A;  4HMJ A;  2TSS A;  4M8A A;  3Q0A A;  4DR6 Q;  4FXK C;  1KLU D;  2NYZ D;  2WAQ G;  2SNS A;  4JBJ A;  2XSC A;  4RAU C;  5E7N A;  1SRU A;  2B2Y A;  4HSP A;  4Q5V A;  4K2L A;  4LF8 Q;  4GLA C;  4MNO A;  4HCE A;  3CF5 A;  2YTX A;  1VQ5 A;  3KJO A;  2F0L A;  1U4L A;  1GUN A;  2LXK A;  4KHZ A;  2B2U A;  4EGV A;  1JOQ A;  3DM1 A;  1PRT F;  4L5R C;  1YI2 A;  1A2U A;  1GD7 A;  3BDC A;  1O7Y A;  4GZY C;  4F8M A;  3L0O A;  2B2V A;  4A75 A;  1CKN A;  1KDB A;  3KBX A;  3MC0 B;  1O7Z A;  2QF7 A;  4JOI C;  2VQF L;  1U9R A;  4HAE A;  4OWW B;  3I4N B;  2IX1 A;  3HOW H;  2EJG C;  4FXD A;  4DR4 Q;  3HKZ G;  3OIQ A;  2O5I C;  4PG3 A;  4J1M A;  3D8G A;  4P75 A;  4B9X A;  3GV6 A;  5C3E B;  5A35 A;  3JAM i;  2UUB Q;  2EY5 A;  4OO1 H;  3AFP A;  1I3Q H;  3BDL A;  4QJF A;  2F0V A;  4JI4 L;  2DJG C;  3BZK A;  4HJ9 A;  4A3M H;  3CCS A;  2HQL A;  3E3X A;  1IBK Q;  3HOW G;  1CKM A;  3TSS A;  5AJ3 Q;  1MJC A;  1KIX A;  2N88 A;  3GV3 A;  4IOA A;  1EU4 A;  1X3P A;  2E2I H;  1TT2 A;  1VQP A;  5M5X B;  3M4Q A;  4IUP A;  2F0I A;  3HOX H;  4ME5 A;  4DK3 C;  2N8N A;  2B2T C;  5IT9 L;  1CTM A;  3I8Z A;  3HOY H;  3NUC A;  1OTC A;  4OO1 G;  1D5Z C;  2FJ2 A;  3BVM A;  2JA7 B;  3A8K E;  5CBE E;  1RDP D;  1NR2 A;  4RH6 A;  4MN3 A;  1ESR A;  4M1U B;  3PO3 B;  1Q8I A;  4H44 C;  2Q8T A;  1I6H B;  4CDE C;  4P71 A;  3OSO A;  2OCE A;  3HOX G;  2UU9 L;  3PIO A;  3M3Y H;  1HQR D;  2HCI A;  2VB3 X;  1T9H A;  5KNB A;  4HN7 A;  3DUZ A;  2XWB B;  3JAM E;  3G48 A;  3PF5 A;  4BY7 H;  3GD7 A;  1JIC A;  1SJH D;  1C0A A;  3I70 A;  4DUZ Q;  1EFI D;  3MAQ A;  2EJM A;  4ZQ3 A;  2F3V A;  4DV0 L;  5J39 A;  1YEZ A;  4ZKB B;  1EFW A;  3ER0 A;  1UAP A;  4L5Q A;  3K59 A;  5HGQ A;  3VA5 A;  4LMQ D;  3STB C;  1N36 L;  1PA6 A;  2L4N A;  2IX0 A;  4GN3 B;  4CJ0 B;  5IYC H;  1PYB A;  4IUT A;  2PW7 A;  1CHQ D;  1SMY D;  5C4X H;  4H02 A;  3TP8 A;  4BY7 G;  1NUC A;  3U50 C;  3A8I E;  3V05 A;  3RN2 A;  1P16 A;  5M3M H;  3K7A H;  2OTL A;  1MIU A;  4DR6 L;  4MIU A;  1VS0 A;  2HHH Q;  3R2I A;  4IPG A;  3K81 C;  3RD4 A;  4U68 A;  3CP0 A;  4IO9 A;  3EN2 A;  4HTH A;  3MA2 B;  4A3K G;  2FXQ A;  3J81 j;  2Y0S B;  5IYC G;  1QOH A;  5JEA H;  2H4O A;  2K1B A;  2C9O A;  1HNZ Q;  1G91 A;  3B6Y A;  4HIK A;  2NWG A;  4JG2 A;  4A3L H;  4DAM A;  1PH7 A;  1IL2 A;  3FP9 A;  3U4V A;  2I07 B;  2KHJ A;  4MTN A;  3S24 A;  1UEA B;  1YIJ A;  4ZK9 B;  3TRE A;  5M5Y B;  1CM9 A;  3VDY A;  2KVM A;  2MUY A;  3QG1 A;  4A93 B;  5JEA G;  4PMB A;  5IP9 H;  1LAC A;  3NBH A;  4C3I B;  2R7Z H;  4IFD I;  3C2P A;  4O2D A;  3VR4 A;  5JOB A;  3LNN A;  1LTR D;  4A3L G;  1VQH A;  1HZA A;  3J80 c;  1IBK L;  4C3H H;  2NVY H;  5EPJ A;  3M4O H;  2Z6K A;  4DN4 M;  1VQA A;  2KBN A;  1A3T A;  3CXC A;  1S40 A;  2LS0 1;  1S3O A;  5IP9 G;  5FLM H;  4N9P A;  1VQF A;  3I7F A;  4KHP Q;  1TS5 A;  5IT9 E;  5C0X I;  2F0D A;  2FHT A;  1JOR A;  1RIP A;  2F0U A;  1E0B A;  1C9O A;  4C3H G;  4BXX G;  1I50 H;  1XNQ L;  1IYU A;  2EY6 A;  4B9W A;  4JBM A;  2HDM A;  3HOZ H;  3IFD A;  1NMF A;  2AQ2 B;  2VUM H;  2KJX A;  2IW3 A;  1X56 A;  2H5X A;  2QA4 A;  4N8F A;  1EY8 A;  5C44 H;  1WI5 A;  5IWA Q;  1S5B D;  4PZ6 A;  1HXY D;  4DUZ L;  3UE1 A;  1PTO H;  4A3E H;  2AUK A;  1KAW A;  3OW2 A;  1HA6 A;  3NTK A;  1FGB D;  1AP0 A;  3I91 A;  4H7B A;  4PZ7 A;  5KGU A;  1E7Z A;  1CA5 A;  1VQ8 A;  1NCV A;  2L12 A;  3TZD A;  1YNN D;  4XXE A;  1Z6H A;  2WIN B;  3CKI B;  3RNU A;  2NB0 A;  3FRP B;  1BBW A;  1IHZ A;  2WAC A;  3VR5 A;  2EXZ A;  4L63 B;  4KLK A;  4DK1 A;  3HFZ B;  3BYT B;  3E5S A;  2K28 A;  3LWE A;  3W3A A;  1QE6 A;  2DY7 A;  4GS3 A;  1AE3 A;  2OXP A;  4A3E G;  4YCU A;  1CZG A;  3WDN A;  4YHH Q;  3VA7 A;  1KNE A;  3RLO A;  4HIO A;  2EYO A;  3KDF B;  3CC7 A;  2D9U A;  1SYG A;  1Y8N B;  3S1R H;  1ZXT A;  2KED A;  4R8N A;  5IGE A;  3TRZ A;  3PUZ A;  2K4K A;  1A0I A;  3A54 A;  3K0X A;  3SVM A;  1X3Q A;  1A15 A;  3HGB A;  1HNZ L;  3G6J B;  3MVV A;  5E3F A;  1JJG A;  1PZJ D;  2EY2 A;  2VZA A;  1E1T A;  2JA6 G;  3K80 C;  1LTT D;  4KKU A;  2SOB A;  3EJI A;  3T4A C;  4XYQ A;  3UDG A;  1N33 Q;  2I5L X;  5J22 A;  4X3T A;  1I6V C;  4KHV A;  2R93 H;  4RKL A;  4JI8 Q;  2NZH A;  1BKB A;  2JYO A;  2F3W A;  2EYJ A;  3LWU A;  3NSW A;  2YU9 H;  3I4M H;  1I4P A;  4YY3 Q;  2LMC B;  1PFM A;  1EY6 A;  2R3Z A;  3CU7 A;  3S2D B;  1EEF D;  4CJ1 B;  4JI6 Q;  1KD1 C;  4O1N A;  4UDU C;  3M7G A;  2H1E A;  1HTP A;  2WKD A;  4DKA C;  1EZ8 A;  3GDE A;  4JI7 Q;  1EIH A;  2L5T A;  3AQQ A;  4V0B A;  5ELF A;  4C3J H;  4NPS A;  2R93 G;  1LLR D;  2F52 A;  2X69 A;  4QIW B;  5CMD A;  3UDI A;  4K5V A;  2JP1 A;  4RGM A;  1Q90 A;  2GN5 A;  3I4M G;  4KY5 A;  4ULL A;  2A68 C;  4KHP L;  2PPB C;  1E3P A;  2F0S A;  2NZO A;  2XN9 C;  1HFG A;  4Y7N B;  1KQS A;  1TWC B;  5KYL A;  2UXC Q;  1TKW B;  1ILQ A;  3TDQ A;  1F2M A;  2YTV A;  1TS4 A;  1XX8 A;  2GA4 B;  2A19 A;  2DN8 A;  3A0J A;  3GTK H;  3PUX A;  4C3J G;  3GTG B;  1MKH A;  4UAI A;  2K14 A;  2MP1 A;  4LWC A;  5DM6 3;  1LV9 A;  4DXG A;  1FNW A;  2ZXR A;  1K8A C;  2IX3 A;  5IWA L;  4P74 A;  4EQ5 A;  1TWA B;  3STB D;  3ITP A;  1ILP A;  3UI2 A;  4QGU A;  1TWG H;  3DHQ A;  3NQI A;  1ENF A;  1Q1E A;  1EZ6 A;  4DR3 Q;  4RCO A;  3MXP A;  1TQO A;  2K7V A;  4HJA A;  3BU2 A;  4OX9 Q;  2HD3 A;  1MSH A;  3TP6 A;  4FF1 A;  2E2J B;  3BG3 A;  1GO3 E;  3PIP 3;  3I56 A;  4R9W A;  1GOZ A;  2Y0S E;  4HSV A;  4DNR B;  1IYJ B;  1RKN A;  1HFN A;  2CQO A;  4C56 C;  3OMC A;  3OOC A;  1W3S A;  5GRO A;  2VQE Q;  4UHV A;  5FLX c;  4L6T B;  1R4Q B;  4YHH L;  1K73 C;  2ZT9 C;  4MTK A;  1QG7 A;  3I90 A;  1QWY A;  1WTO A;  1OXT A;  5D3D A;  4L8J A;  3FPU B;  2A73 B;  4QUF A;  3GO5 A;  1J8I A;  4F88 A;  5I6Y A;  1PZK D;  1HNX Q;  2FMM A;  1C4Q A;  3BVZ A;  2B2W C;  5ELO A;  4IUR A;  2TMP A;  4DV4 Q;  1EQR A;  2J0T D;  2F0F A;  3GTP H;  2CW0 D;  2L11 A;  2QKI C;  2OQK A;  4RWS C;  4DV6 Q;  3H3V I;  4RGN A;  1QCB D;  1N33 L;  3TME A;  2K75 A;  1F9S A;  3IAY A;  3GTL B;  4FNF A;  3J7A 5;  4JI8 L;  1KNA A;  1SFO H;  2ZJP A;  3G4S A;  1H9R A;  2WFW A;  5LL6 X;  4GLV B;  3KUP A;  3PV0 A;  2BH8 A;  4YY3 L;  3M4P A;  1U4M A;  1X3E A;  3BJU A;  5JJZ A;  3FMC A;  3MWY W;  1LTL A;  4AYB G;  1O80 A;  1TR5 A;  5CV9 A;  2NTT A;  3CCL A;  4JI0 Q;  4HID A;  4JI6 L;  2ZXP A;  3KLS A;  3PO2 G;  4GN4 B;  1BBX C;  1D6E C;  4WOR A;  1PH2 A;  4P72 A;  1CQF A;  4JI7 L;  1SNO A;  3DEP A;  5I2X A;  1JOK A;  4P2C B;  1XMQ Q;  1TXY A;  5FOB B;  4YCV A;  1GKH A;  1QVG A;  1L0W A;  4XYO A;  3CME A;  1K8O A;  1Y1W H;  3H15 A;  1PHJ A;  1CZW A;  4X66 Q;  2KCN A;  2KHS A;  3MTS A;  5C3E H;  1ENC A;  2ICE C;  3QWN A;  4DAP A;  4JI3 Q;  1YHB A;  2E76 C;  4FF4 A;  2UXC L;  2JEB I;  3ND9 A;  2PQA A;  4ZKC B;  2R7F A;  2PMZ B;  3H0G G;  2PI2 E;  2A1A A;  1Y1V B;  5LL6 S;  4BBS B;  3RUZ A;  2F0W A;  3M85 A;  1Y1W G;  3PQI A;  5M5X H;  3K0Y A;  2BDO A;  3S14 H;  3V2T A;  3K5M A;  4WJ4 A;  2YYZ A;  2KOL A;  4UP7 A;  2K32 A;  1K83 H;  1ML0 D;  2VL6 A;  4EQO A;  3CMA A;  5I6W A;  1HZB A;  1QNK A;  2V1C C;  2JA7 H;  1I4Q A;  5KEE A;  1CQV A;  4DR3 L;  2V4D A;  3U4Z A;  1YHA A;  2ZXO A;  3I4O A;  2K5D A;  4OX9 L;  4RHS A;  3PO3 H;  4IUQ A;  4FF2 A;  3K6O A;  3QOJ A;  1HNW Q;  4AQY Q;  1I6H H;  4J15 A;  1B9M A;  4BA1 I;  1VQL A;  4QQB X;  1SE2 A;  2A5H A;  3KF6 A;  3GTQ H;  5E4X A;  1SYF A;  1Q86 C;  2MPM A;  1F9Q A;  1SNC A;  5C4J B;  5ELD A;  3OTO Q;  2CCZ A;  1I94 Q;  1MD2 D;  2Z6B A;  1Y8O B;  1CKN B;  1X3G A;  4F87 A;  5DEH A;  1EQQ A;  4POF A;  1QUQ A;  1H9S A;  2BH2 A;  1RCV D;  1B8A A;  4LK1 C;  5FO7 B;  4X62 Q;  1A63 A;  1EL0 A;  1HNX L;  1FNU A;  4JVZ A;  2DGY A;  2L1B A;  2WB1 E;  3J81 i;  5IE8 A;  4ID6 A;  5IY0 A;  4R4Q A;  5I9P A;  2RDH A;  2OWO A;  2ASB A;  1H9K A;  2IPK D;  4TSS A;  4KJN A;  4CJ2 C;  4LFA Q;  4JK1 C;  4WJ3 M;  3I73 A;  4KKS A;  3CCU A;  4R1J A;  3HOV H;  4NB3 A;  4LFB Q;  1ZEQ X;  3ULL A;  1D8L A;  1XPU A;  2A6H C;  1W6K A;  2D5D A;  1EYA A;  1IZ6 A;  4IUV A;  3TP7 A;  3OW7 A;  1PH4 A;  3KF8 B;  4QIW E;  5ISR A;  3S15 B;  4F7X A;  3E6Z X;  3SE0 A;  1SRO A;  2RCF A;  2J7Z A;  1IBL Q;  5IGB A;  2FFK B;  3HOV G;  3K5O A;  2I46 A;  1K0S A;  3SHL A;  1KDC A;  4DAY A;  1XMQ L;  4KK7 A;  1B7Y B;  3MHB A;  3T16 A;  4A3G B;  3CC4 A;  5M5Y H;  2A68 D;  1Z9F A;  1AEX A;  4DR5 Q;  1HQM C;  4XIG S;  2F1M A;  3R2T A;  4YCW A;  4DV3 Q;  1SR3 A;  3J81 E;  2F03 A;  4R4C A;  1YJW A;  4L5T A;  4X66 L;  4A93 H;  4ZUJ A;  2JQO A;  1L2F A;  5EGT A;  3KJP A;  3S1M B;  1WTQ A;  2BA1 A;  2L55 A;  4IQZ A;  3CCQ A;  4K8J A;  5LMU Q;  2RDG A;  2XRQ D;  4JI3 L;  5M3F B;  5D65 A;  1K3R A;  1B4O A;  4CDF C;  1P8L A;  2EJF C;  4A3M G;  1HH2 P;  2LKV A;  2QEX A;  2F0M A;  4OL7 A;  1F77 A;  4GKK Q;  1G2T A;  4OIJ A;  5KNC A;  1G51 A;  1VF5 C;  1XJV A;  2K03 A;  2MO0 A;  1AH9 A;  2PO4 A;  4GKJ Q;  1BBU A;  3F2U A;  1SNP A;  5EPK A;  4A93 G;  3D6C A;  3S1Q B;  1LTB D;  4X3U A;  1STG A;  1VQN A;  3HOY G;  2EZV A;  1JB7 A;  1IW7 C;  2NN6 H;  3CCV A;  3PUW A;  5DLQ E;  2WAQ B;  2HDL A;  4OO1 I;  1HNW L;  3QOL A;  4AQY L;  3NBI A;  1PFN A;  1VQM A;  4U67 3;  1SMX A;  5M5W B;  1LO5 D;  4IJL A;  1OXS C;  2GVB A;  5FO9 B;  1F9P A;  3MZ5 A;  3OTO L;  3NEN A;  1EUJ A;  1I94 L;  5CV8 A;  2Q8I B;  2E2H H;  4FVM A;  2KA7 A;  1AZQ A;  2K04 A;  2NN6 G;  2OT2 A;  1EY9 A;  5JEA J;  3VYR A;  1M1K C;  3F2D A;  4ABN A;  3KFU A;  5JPN C;  3PCO B;  2E74 C;  3D31 A;  1MI2 A;  2QCP X;  1II3 A;  1JWM D;  5JVG 3;  1FVI A;  5EJW A;  4X62 L;  4LF8 L;  2K52 A;  1G6P A;  1V43 A;  1U0L A;  4WJW A;  4HIM A;  3TEH B;  3NBH B;  1GUG A;  4JV5 Q;  2RBM A;  1XPO A;  4Q0F A;  3CC2 A;  5C4X G;  2YV5 A;  4OWT B;  4LFA L;  1FNV A;  1M8A A;  1VQO A;  1XNR Q;  5M3M G;  4NW2 A;  4LFB L;  3N52 A;  1TWH B;  4LFC Q;  2Z8L A;  1N34 Q;  1VQ7 A;  1I4R A;  5FLX L;  4X65 Q;  4DR4 L;  2R92 B;  1DON A;  2E8G A;  1YJN A;  1YVC A;  1BQQ T;  4AH6 A;  2VB2 X;  1FR3 A;  1EOT A;  5IGD A;  2BDN A;  2FIN B;  2I5H A;  1FL0 A;  3NP8 A;  2RKS A;  3BDO A;  3IRB A;  2QDL A;  1I3Q B;  1QVF A;  1IBM Q;  2UUB L;  2ATW A;  3I2Z A;  1IL8 A;  3L9A X;  4MZ9 A;  1FJG Q;  5ELN A;  2VXW A;  1D2B A;  1ET9 A;  1IBL L;  1YBY A;  1PH1 A;  2EVB A;  2E2D C;  2ID0 A;  1STY A;  2B39 A;  2B8G A;  3S1N B;  4P73 A;  3CCM A;  4BY1 B;  5ELC A;  5AJ3 L;  2PMZ E;  1DOL A;  4DNT B;  4DR5 L;  1W2B A;  4RCN A;  1M4V A;  1L0Y B;  2HQE A;  4DV3 L;  4IZ8 A;  3H3V C;  2IJ0 A;  2AWO A;  4WRD A;  2MNA A;  5GAH C;  4JI5 Q;  3H91 A;  4RMF A;  3L3O C;  4H0L C;  4ZUI A;  2R7Z G;  5LMU L;  1K0R A;  3HOU B;  3S2D H;  1AZP A;  1PH5 A;  2A8V A;  3OYY A;  4CHT B;  3NK9 A;  3S17 B;  2XVS A;  1EQV A;  2QGQ A;  2MJ8 A;  2D0O A;  4KD4 A;  4C2M B;  4KN7 C;  2AMC B;  1JJC B;  3JAM c;  4RFB A;  1Q46 A;  1W6J A;  1PH3 A;  2RF4 A;  5D14 A;  2QEJ C;  5EPL A;  5J3B A;  4GKJ L;  2WKC A;  3VR2 A;  2EYP A;  3IKJ A;  3MXN A;  3SK6 A;  4K6D A;  2NBF A;  2NVQ H;  1E2Z A;  5IYB H;  1ENA A;  5FLM G;  2B2V C;  4IOC A;  1C8C A;  1XPR A;  1XTC D;  1ZKO A;  2IT1 A;  3E0E A;  1EWI A;  4N9T A;  2A69 D;  3T1H Q;  3A7L A;  5FJ8 H;  2OF1 A;  1Q82 C;  4Y7N H;  4YIJ A;  1TWC H;  2O2L D;  3CCE A;  1TY0 A;  1HZC A;  2F4V Q;  4KKT A;  1TWF B;  3J7A V;  4A3I H;  1DZ1 A;  3J7A F;  1AW7 A;  4DR1 Q;  3MEF A;  4A3K B;  1S5D D;  3HOZ G;  1E1O A;  1UE6 A;  2E5L Q;  2VUM G;  2ZTE A;  1H9M A;  1PDQ A;  3PSI A;  2J4X A;  1STE A;  2EQS A;  5IYB G;  2F0P A;  1JE5 A;  2L9H A;  5C44 G;  1T5E A;  1ESF A;  5CC4 A;  4A3F B;  4EVO A;  3K7U C;  1TWA H;  1Y8P B;  2DNE A;  3C1E A;  5DM7 3;  4TKO B;  5FJ8 G;  4GNX A;  4LUO A;  3QB3 A;  1HJP A;  3DM3 A;  5KIX A;  4A3J H;  2HHH L;  4A3I G;  1PFS A;  4FYD A;  3AB9 A;  1Z7T A;  2GVA A;  3OHX C;  3S2H H;  3WWV A;  1JOO A;  1NTG A;  2D0P A;  1EY0 A;  4CGY B;  1NSN S;  1S5F D;  1QIL A;  4JV5 L;  2Q8R E;  2N3S A;  5JVH 3;  3OMG A;  4ILW A;  1R4P B;  4G57 A;  1SYB A;  3NXW A;  1VQD A;  1XNR L;  4B3R Q;  2UXD Q;  1AN8 A;  1PMR A;  4OEL B;  1I5F A;  4LFC L;  3U9S A;  1Q81 C;  1N34 L;  2K05 A;  3CPF A;  4A3J G;  3DLL A;  4X65 L;  1NMG A;  4I7Z C;  4N8X 1;  4CDC C;  1WTR A;  5FLX E;  4APV A;  2KEN A;  1BCP B;  1U4R A;  4IPH A;  2WB1 B;  1O7L A;  4A76 A;  1RTN A;  1PH8 A;  4JI2 Q;  4OIK A;  4IUU A;  1Q8K A;  2A74 C;  1IBM L;  4PMC A;  1FJG L;  1KXL A;  2K33 A;  4YWL A;  2KQ3 A;  5LHY 1;  1FYC A;  5COR A;  3R8B A;  3NEL A;  4LF5 Q;  5EKK A;  1UE7 A;  5T1G A;  3NWT A;  2JEA I;  1MGS A;  1B50 A;  3KDF A;  1JC7 A;  3MFY A;  4HMI A;  5L37 A;  3Q23 A;  4JYA Q;  3GTL H;  2K01 A;  4KV6 A;  1HTL D;  4DUY Q;  3K5N A;  3BS1 A;  4DGZ A;  3A8J E;  4ODG A;  2NZ1 D;  2UXB Q;  2CH4 W;  2XNA C;  1JWS D;  1R9T B;  3QIA A;  1TU2 B;  4H13 C;  3DXJ C;  4EQN A;  2NVT B;  3FDT A;  4BBR B;  3ND8 A;  1GUW A;  1NBW A;  3P7J A;  1DM0 B;  2LY7 A;  4XDX A;  1VQE A;  4LUV A;  1WCM B;  5CV6 A;  5EAY A;  2WAQ E;  1S4Z A;  2JA5 B;  3L2P A;  3NEM A;  2RHS B;  4LJZ C;  1PH9 A;  1IW7 D;  5IGG A;  3PGZ A;  4EX5 A;  5EKI A;  2K6A A;  2RDF A; 
#chains in the Genus database with same CATH homology
 1Y1W G;  2NVT H;  4BBR H;  5M5X H;  1K9M C;  3S14 H;  1PVO A;  4P71 A;  4WJ4 A;  2AWN A;  3M9B A;  2YYZ A;  3T1H L;  4UP7 A;  2ZM6 Q;  1WCM H;  1K83 H;  2VL6 A;  2OCE A;  3CMA A;  3U58 A;  1YHQ A;  4JBK A;  1HZB A;  5H1S E;  3HOX G;  2UU9 L;  3PIO A;  2JA5 H;  3M3Y H;  2V1C C;  4TVA B;  2F4V L;  1T9H A;  2JA7 H;  4DR3 L;  1YNX A;  4JOI A;  3GTG H;  3G48 A;  3PF5 A;  2F3I A;  3HKZ E;  3GD7 A;  3U4Z A;  4DR1 L;  1YHA A;  2ZTC A;  3I4O A;  4B3T L;  4OX9 L;  1C0A A;  1J5E Q;  1SLJ A;  2VW9 A;  3PO3 H;  1JT8 A;  4BBS H;  4DUZ Q;  4AQY Q;  1HNW Q;  1I6H H;  4J15 A;  4BA1 I;  4OXP A;  1VQL A;  4QQB X;  4DV0 L;  4AYB E;  2KCM A;  3GTJ H;  1YEZ A;  1EFW A;  3KF6 A;  2B63 H;  3ER0 A;  3TS2 A;  4L5Q A;  3GTQ H;  4A3D H;  4BBR G;  5HGQ A;  1WFQ A;  3HKS A;  3SGI A;  1YIT A;  3STB C;  1X3F A;  1N36 L;  1Q86 C;  1PA6 A;  3K8A A;  3OTO Q;  1KRS A;  2CCZ A;  1WCM G;  1I94 Q;  2IX0 A;  4HJ8 A;  4GN3 B;  4IPD A;  1GM5 A;  2JA5 G;  2Z6K C;  1CKN B;  5IYC H;  1PYB A;  2Q2U A;  1Q12 A;  5C4X H;  1GVP A;  4H02 A;  1X3G A;  3PUY A;  1EQQ A;  4LNQ A;  1HZ9 A;  4POF A;  1QUQ A;  3F2B A;  2R6G A;  4BY7 G;  2E2J H;  1LYL A;  4O0A A;  2DUD A;  2Q2H A;  3U50 C;  2B29 A;  3RN2 A;  1P16 A;  1QZG A;  5M3M H;  3UDX A;  3K7A H;  2BH2 A;  4BBS G;  1B8A A;  2OTL A;  5JJI A;  1VQK A;  1MIU A;  4DR6 L;  1AE2 A;  4X62 Q;  1S72 A;  1A63 A;  1VS0 A;  5GAE C;  3FKI H;  1HNX L;  5HY6 A;  5C4J H;  2HHH Q;  2B63 G;  3CD6 A;  4A3D G;  2DGY A;  3K81 C;  4IPG A;  2WB1 E;  4LUZ A;  3J81 i;  5IE8 A;  3CP0 A;  2JA6 H;  4A3B H;  4IO9 A;  4B3R L;  2UXD L;  3EN2 A;  5IY0 A;  2K5H A;  4GOP B;  2ZJQ A;  4R4Q A;  2OWO A;  2ASB A;  4R4O A;  4A3K G;  2FXQ A;  4DV2 L;  3GTO H;  2JK8 A;  2PI2 A;  3CAM A;  3J81 j;  2JA9 A;  2Z0S A;  5IYC G;  4LFA Q;  2HIV A;  4B3M Q;  2JA8 H;  2ES2 A;  4WJ3 M;  1XMO Q;  1L1O B;  3CCU A;  4R1J A;  3HOV H;  4NB3 A;  1HNZ Q;  4LFB Q;  3B6Y A;  3E9I A;  4HIK A;  4JCV E;  3ULL A;  1NJI C;  1D8L A;  4JG2 A;  1XPU A;  4DAM A;  1PH7 A;  1IL2 A;  2JJQ A;  3CQZ H;  3FP9 A;  3U4V A;  4JI2 L;  5LMN Q;  2KHJ A;  4MTN A;  3S24 A;  1IZ6 A;  3L7Z C;  3FKI G;  2AHO B;  2OQ0 A;  2CWP A;  1YIJ A;  2RCN A;  1QZH A;  4A3B G;  3TRE A;  1PH4 A;  3A5Z B;  3KF8 B;  4QIW E;  3VDY A;  1HR0 L;  1OXV A;  2YTY A;  2HT1 A;  1E22 A;  2PQA B;  1X9N A;  4LF5 L;  1SRO A;  1SE8 A;  5JEA G;  1KHI A;  5IP9 H;  2JA8 G;  3M7N A;  3I4N H;  5IT9 c;  1IBL Q;  2R7Z H;  4QL5 A;  4IFD I;  4B3S Q;  5LMN W;  3HOV G;  4O2D A;  4JYA L;  1PH6 A;  1BVS A;  4A3L G;  2UUA Q;  4DUY L;  4JI5 L;  1XMQ L;  1YZ6 A;  1VQH A;  1B7Y B;  1HZA A;  3CC4 A;  3J80 c;  4RG1 A;  5M5Y H;  4C3H H;  1IBK L;  1Z9F A;  2NVY H;  4X64 Q;  4DR5 Q;  2IHF A;  4XIG S;  3S15 H;  4BY7 H;  3M4O H;  3AEV A;  1QVC A;  2K50 A;  2VS1 A;  4YCW A;  4DV3 Q;  2Z6K A;  1EOV A;  1SR3 A;  4R4C A;  1VQA A;  2KBN A;  4L5T A;  4X66 L;  1YJW A;  4A93 H;  2JQO A;  1A8V A;  1L2F A;  4JC0 A;  2MO1 A;  3KJP A;  3CXC A;  1S40 A;  4LF7 L;  3PF4 A;  4JI4 Q;  4DV5 L;  2BA1 A;  3CCQ A;  1S3O A;  5IP9 G;  5LMU Q;  5FLM H;  3I4N G;  4JI3 L;  1K3R A;  3RZO H;  4DV1 Q;  1VQF A;  2UUC Q;  1P8L A;  3I7F A;  4R4T A;  4A3G H;  4KHP Q;  4A3M G;  1HH2 P;  2QEX A;  5GAD C;  5C0X I;  1N8R C;  2KHI A;  4GKK Q;  1RIP A;  1C9O A;  4BXX G;  1G51 A;  1I50 H;  4LF9 Q;  1XJV A;  1AH9 A;  2MO0 A;  3Q8D A;  1XNQ L;  1OXU A;  4FDB A;  4JBM A;  4DK6 C;  4GKJ Q;  1BBU A;  5C3E G;  2ZM6 L;  4A93 G;  4LF4 Q;  3HOZ H;  1QUQ B;  1VQI A;  1NMF A;  2HIX A;  3ERS X;  2VUM H;  1VQN A;  4DR2 Q;  2CFM A;  3E9H A;  3HOY G;  2LSS A;  1JB7 A;  1X56 A;  3KLW A;  2H5X A;  3RLN A;  2QA4 A;  1Y1V H;  5C44 H;  1WI5 A;  3BZC A;  1NY4 A;  3TS0 A;  2E5L L;  3CCV A;  3PUW A;  5DLQ E;  1J5E L;  4A3G G;  5IWA Q;  2BA0 A;  4PZ6 A;  4OO1 I;  3UE0 A;  3ULP A;  2VY3 A;  4DUZ L;  3EIV A;  1OXX K;  4AQY L;  1HNW L;  4DNI A;  1UEB A;  3UE1 A;  3H3V H;  3S16 H;  4A3E H;  2UU9 Q;  3W1G A;  1VQM A;  4HJ5 A;  3GTM H;  3OW2 A;  1KAW A;  3F1Z A;  1WJJ A;  4A4I A;  1SMX A;  1N9W A;  1X6O A;  4K0K Q;  4PZ7 A;  1E7Z A;  3S1Q H;  5GQO A;  4IJL A;  1OXS C;  2GVB A;  1VQ8 A;  3OTO L;  1CSQ A;  3NEN A;  1EIF A;  1EUJ A;  4PMW A;  1UE5 A;  1I94 L;  2VQE L;  1CSP A;  2E2H H;  2JA7 G;  4IJH A;  3RNU A;  1LUZ A;  1LM0 A;  1BBW A;  4NXN Q;  4Y52 H;  2NN6 G;  1Y1V G;  5JEA J;  1M1K C;  3PO3 G;  3F2D A;  2RHQ B;  4KLK A;  3HFZ B;  2Q2T A;  3KFU A;  3PCO B;  1G29 1;  3F2C A;  3D31 A;  4GS3 A;  5M5W H;  1FVI A;  1AE3 A;  2LXJ A;  4A3E G;  4YCU A;  4X62 L;  1UWV A;  3W1B A;  4LF8 L;  2K52 A;  4YHH Q;  4HIO A;  3RLO A;  4LF6 Q;  1X65 A;  4DV4 L;  2K5V A;  3KDF B;  1G6P A;  2XGT A;  1V43 A;  3CC7 A;  1U0L A;  4QY7 A;  3S1R H;  4HIM A;  1JMC A;  3TEH B;  3NBH B;  1D7Q A;  5GAG C;  4JV5 Q;  2L15 A;  1XPO A;  3CC2 A;  2Q2I A;  1ASZ A;  3TRZ A;  4OWX B;  5C4X G;  2YV5 A;  3PUZ A;  2K4K A;  4OWT B;  2WP8 J;  1A0I A;  4ME3 A;  3K0X A;  4DV6 L;  4LFA L;  5IP7 H;  4DAY B;  4B3M L;  2OTJ A;  1VQO A;  1XNR Q;  3CPW A;  1XMO L;  2R7D A;  1K8G A;  4UY8 C;  5M3M G;  1HNZ L;  1KC8 C;  1WOC A;  4LFB L;  4GLX A;  4LFC Q;  1N34 Q;  1JJG A;  3LGJ A;  1VQ7 A;  5LMN L;  4DV7 Q;  1EIY B;  2NVX H;  4DR7 Q;  1V1Q A;  4X65 Q;  2VZA A;  4DR4 L;  2B3G A;  1E1T A;  1R9T H;  3J80 i;  2JA6 G;  3K80 C;  2E8G A;  1YJN A;  1XTD A;  2C35 B;  1YVC A;  3AYH B;  4A3C H;  4AH6 A;  1C7Y A;  3PO2 H;  3UDG A;  1N33 Q;  1Q7Y C;  2I5L X;  2KCT A;  3KYH C;  1X54 A;  1KRT A;  2VQF Q;  1ASY A;  3UDF A;  2I5H A;  3TQY A;  1FL0 A;  1DGS A;  3IRB A;  1QVF A;  2R93 H;  4JI0 L;  1Y14 B;  2NZH A;  4JI8 Q;  1IBM Q;  1BKB A;  3I2Z A;  2UUB L;  2ATW A;  4MZ9 A;  4UP9 A;  5IP7 G;  1FJG Q;  5ELN A;  1VQ6 A;  1TWH H;  1IBL L;  1YBY A;  4B3S L;  2YU9 H;  3ICE A;  3I4M H;  4YY3 Q;  1PH1 A;  3PUV A;  4R4I A;  2ID0 A;  3D0F A;  5BR8 Q;  2UUA L;  4P73 A;  1SN8 A;  3CCM A;  2R92 H;  2JE6 I;  2MFI A;  2I0Q A;  4YWM A;  3KOJ A;  5AJ3 L;  4GNX C;  2PMZ E;  4YWK A;  4IPC A;  4JI6 Q;  4X64 L;  4DR5 L;  1KD1 C;  4GOP A;  1W2B A;  2Y0S G;  3I55 A;  3CCR A;  2N78 A;  4DKA C;  3GDE A;  4DV3 L;  4A3C G;  4KI0 A;  4JI7 Q;  2AWO A;  4C3I H;  2XTI A;  1WYD A;  3AQQ A;  3FHW A;  1VQC A;  4C3J H;  3H0G H;  4NPS A;  2MNA A;  1UE1 A;  5GAH C;  3G71 A;  4JI5 Q;  2F52 A;  2R93 G;  3A74 A;  4RMF A;  1L1O A;  3UDI A;  2R7Z G;  5LMU L;  1PYS B;  2N49 A;  1K0R A;  2AKW B;  2GN5 A;  3KF6 B;  3T1Y Q;  3S1N H;  2ZJR A;  3S2D H;  3I4M G;  1PH5 A;  4DV1 L;  4BY1 H;  2A8V A;  2UUC L;  4BA2 I;  2IY5 B;  3OYY A;  4KHP L;  1V9P A;  2QGQ A;  3J7Z C;  1E3P A;  2D0O A;  2NZO A;  2R92 G;  1IXR A;  1VCI A;  4NXM Q;  2AMC B;  1RL2 A;  1JJC B;  3JAM c;  1J6Q A;  5IYD H;  4X6A H;  1KQS A;  1Q46 A;  2UXC Q;  4LF9 L;  2YTV A;  2RF4 A;  1PH3 A;  3S1M H;  5J3B A;  4GKJ L;  1Q1B A;  1EYG A;  2A19 A;  5M3F H;  1Z47 A;  3A0J A;  4JI1 Q;  4AIM A;  4LF4 L;  3GTK H;  4PZ8 A;  3PUX A;  2NVQ H;  1MKH A;  5IYB H;  3HOU H;  1N32 Q;  5FLM G;  2K14 A;  4DR2 L;  4IOC A;  5K36 G;  5JJK A;  1YJ9 A;  3PIP A;  4LWC A;  1XPR A;  1FGU A;  1CUK A;  2IT1 A;  3S17 H;  1E24 A;  3E0E A;  1EWI A;  4C2M H;  3T1H Q;  1XNQ Q;  4BY1 G;  5FJ8 H;  1K8A C;  1B70 B;  5IWA L;  4Y7N H;  2CKZ B;  1Q82 C;  1TWC H;  4P74 A;  3RZD H;  3W5O A;  3CCE A;  4EQ5 A;  1HZC A;  3STB D;  4A3L H;  5IYD G;  1PV4 A;  2F4V Q;  4QGU A;  1JJ2 A;  1TWG H;  4A3I H;  1Q1E A;  1X55 A;  4DR3 Q;  1KL9 A;  2I5M X;  4POG A;  4DR1 Q;  3MEF A;  4K0K L;  4IFD J;  4B3T Q;  2ALY B;  4HJA A;  3BU2 A;  4OX9 Q;  3HOZ G;  1E1O A;  1VQG A;  1UE6 A;  3ZJY C;  1VQB A;  4GOP C;  2E5L Q;  5M3F G;  2VUM G;  4JBW A;  2ZTE A;  4UPA A;  3PSI A;  1A62 A;  3ULJ A;  2EQS A;  5IYB G;  4DV0 Q;  3HOU G;  1JE5 A;  4HJ7 A;  2VNU D;  5C44 G;  1U5K A;  1GO3 E;  2PNH A;  1VQ9 A;  4NXN L;  3I56 A;  2ZTD A;  4TQU S;  1CKO A;  2Y0S E;  1L1O C;  3K7U C;  1N36 Q;  1MJE A;  1IYJ B;  1TWA H;  2EIF A;  3CCJ A;  4GNX A;  5FJ8 G;  4ALP A;  2CQO A;  1H95 A;  4GN5 A;  3G6E A;  1TWF H;  4LUO A;  1HJP A;  3DM3 A;  1VQJ A;  1M90 C;  1W3S A;  3CW2 C;  5GRO A;  4A3J H;  2VQE Q;  4A3K H;  2HHH L;  5FLX c;  4A3I G;  1PFS A;  2K5N A;  4YHH L;  1K73 C;  4LF6 L;  2GVA A;  3S2H H;  3WWV A;  1NTG A;  3EBE A;  2D0P A;  5JJL A;  1OXT A;  4JV5 L;  5C0X J;  2N3S A;  4DR6 Q;  4A3F H;  2MQH A;  3GO5 A;  2WAQ G;  1HNX Q;  4JBJ A;  5ELO A;  3RN5 A;  1VQD A;  5E7N A;  1SRU A;  4LF8 Q;  1XNR L;  4B3R Q;  2UXD Q;  4GLA C;  4LW1 A;  4DV4 Q;  4MNO A;  3CF5 A;  2YTX A;  1EQR A;  1VQ5 A;  4OON A;  3KJO A;  1I5F A;  4LFC L;  2NN6 I;  1Q81 C;  4DV2 Q;  1N34 L;  2LXK A;  4KHZ A;  4IFD G;  3CPF A;  4A3J G;  4DV7 L;  4L5R C;  3GTP H;  3DLL A;  4DR7 L;  1YI2 A;  4X65 L;  1GD7 A;  1NMG A;  4DV6 Q;  2OQK A;  3H3V I;  3L0O A;  4A75 A;  1CKN A;  4APV A;  1N33 L;  2KEN A;  4A76 A;  1PH8 A;  4IPH A;  1O7I A;  4JOI C;  4JI2 Q;  3RR5 A;  2VQF L;  2K75 A;  4OWW B;  2IX1 A;  4A3F G;  1Q8K A;  3J7A 5;  3HOW H;  4JI8 L;  1IBM L;  1SFO H;  2ZJP A;  3J81 c;  3G4S A;  1FJG L;  1KXL A;  2WFW A;  4YWL A;  4DPG A;  2CWA A;  3HKZ G;  4GLV B;  4XTC S;  4DR4 Q;  3PV0 A;  2BH8 A;  1HR0 Q;  4YY3 L;  4PG3 A;  3M4P A;  1X3E A;  3A5U A;  3BJU A;  5BR8 L;  3NEL A;  4LF5 Q;  1UE7 A;  1LTL A;  2JEA I;  4P75 A;  4AYB G;  3MXN B;  3KDF A;  3CCL A;  4JI0 Q;  3JAM i;  4HID A;  2UUB Q;  4JI6 L;  5C0X G;  3AFP A;  1VQ4 A;  3PO2 G;  1I3Q H;  4GN4 B;  4JYA Q;  1PH2 A;  3GTL H;  4P72 A;  4QJF A;  4JI7 L;  2UXB L;  4DUY Q;  1XMQ Q;  4JI4 L;  1TXY A;  3BZK A;  3JC6 6;  4HJ9 A;  3CCS A;  4A3M H;  4YCV A;  2HQL A;  1HR0 W;  1IBK Q;  3HOW G;  1GKH A;  1QVG A;  1CKM A;  1L0W A;  3CME A;  2UXB Q;  5AJ3 Q;  1Y1W H;  3H15 A;  1MJC A;  4BXX H;  1KIX A;  3F8T A;  3T1Y L;  1PHJ A;  4IOA A;  4X66 Q;  2E2I H;  1NE3 A;  3AFQ A;  1VQP A;  1NBW A;  3M4Q A;  5C3E H;  3HOX H;  4DK3 C;  4L5S A;  4LF7 Q;  4GKK L;  2N8N A;  3RLF A;  1VQE A;  4LUV A;  4DV5 Q;  5EAY A;  4NXM L;  2WAQ E;  4JI3 Q;  1YHB A;  2UXC L;  3HOY H;  1OTC A;  4OO1 G;  3L2P A;  2JEB I;  2WB1 G;  2PQA A;  2R7F A;  3NEM A;  4UP8 A;  2RHS B;  3H0G G;  1PH9 A;  4JI1 L;  2PI2 E;  2A1A A;  3PGZ A;  4GNX B;  1N32 L;  4EX5 A;  3M85 A;  2D62 A;  2EXD A;  2IHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...