2OF1A

Cryogenic crystal structure of the staphylococcal nuclease variant truncated delta+phs i92w
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKAMVENAKKIEVEFDKGQRTDKYGRGLAYWYADGAMVNEALVRQGLAAVAYVYKGNNTHEQLLRAAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal thermonuclease
publication title On the presence of water molecules in the protein hydrophobic core
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2of1A00
1EYCA 3D8GA 4MIUA 3T16A 1IHZA 2F0PA 1EYDA 2F0IA 3QOLA 2M00A 5C3WA 5HURA 5I6YA 2PQEA 4R8NA 3SHLA 4EQOA 1EZ8A 5JAVA 4IUNA 3ITPA 3SR1A 2F0SA 1EY8A 1U9RA 2EY6A 1STGA 4ZQ3A 4K14A 4DF7A 2F0NA 4J6HA 5C5LA 3RUZA 4H7BA 1SNDA 2PW5A 1SYFA 5IGCA 4KY5A 1A2UA 3SK8A 1KDCA 1EY4A 2ENBA 2SNSA 4F7XA 1SNOA 5CV6A 5KEEA 5I9OA 5C4HA 2HQEA 2PZWA 1JOKA 1JORA 3EROA 2OEOA 2WACA 3NP8A 4KJOA 4KV6A 4OL7A 5JOBA 3SXHA 5IGGA 4NP5A 4G57A 5DEHA 4NDXA 4QB4A 5J22A 3E5SA 1STHA 2F0GA 2RKSA 5KYLA 2EY5A 4RKBA 5M9OA 1F2MA 2EYHA 3C1FA 4NKLA 3S9WA 5I6WA 3NQTA 4I65A 5EKKA 3SK5A 2F0MA 2SNMA 4PNYA 5CV4A 5IIFA 2F0WA 2RDFA 1STBA 1II3A 4HTHA 1STAA 4B9XA 3NHHA 4PMBA 1F2ZA 2EXZA 1KABA 2RBMA 1KDBA 5CV7A 2O4XA 1SNPA 2EYJA 2F0FA 2F0LA 2PW7A 4RKLA 5CV8A 1EY0A 4QMGA 5E1FA 1STYA 5CGKA 4KY7A 2KQ3A 5C5MA 1EY5A 3TP6A 3PMFA 4IALA 4KY6A 4WORA 1KAAA 4YIJA 4TRDA 5IOCA 3BDCA 5HGTA 3H6MA 5KYIA 4KD3A 2F0JA 3OWFA 2EYOA 4QF4A 1NUCA 4IZ8A 5IODA 1SNQA 5E3FA 1EY9A 1STNA 3QOJA 4DU9A 5IGBA 3HZXA 4NMZA 3BDLA 1SYDA 4K8JA 2QDBA 4K5XA 5J1ZA 1TT2A 1SNCA 3TP7A 1JOOA 1EYAA 4ZUJA 2EYPA 1TR5A 2F3WA 2F0OA 3R3OA 4B9WA 3EVQA 2OF1A 3NXWA 2LKVA 4E6IA 4F8MA 5IGEA 3QB3A 3OMCA 4N9PA 2NUCA 3EJIA 5F2DA 1EY6A 4N9TA 4ODGA 4ZUIA 4ME5A 1A3TA 4KTAA 1SNMA 1SYGA 5CV9A 4K5VA 1SYEA 4K2KA 3ERQA 4DGZA 1EQVA 5CR3A 3MVVA 1A3UA 2PZTA 2F3VA 3DMUA 5IGDA 3U9OA 3D4DA 3MXPA 4J1MA 3T13A 5K5PA 4K5WA 1AEXA 2PZUA 4S3SA 5EKLA 5IGFA 4ID6A 1ENCA 4DFAA 2SOBA 4HMIA 2F0HA 1RKNA 2EY2A 5C3XA 5I9PA 4KD4A 2PYKA 3TMEA 3MEHA 4KJNA 2EYFA 3SK6A 4KHVA 3SK4A 1ENAA 1F2YA 3OMGA 3P1HA 4HMJA 1A3VA 3NK9A 5NUCA 1SYCA 3V2TA 5J39A 1KDAA 1TQOA 2EYLA 3LX0A 3MZ5A 3D4WA 3MHBA 4K8IA 2F0QA 5CV5A 5KIXA 1JOQA 4LAAA 5DAUA 1EY7A 4K6DA 3HEJA 5KRUA 1A2TA 1EZ6A 2EYMA 4EQPA 5EGTA 4WRDA 2F0TA 2F0KA 2EY1A 4EVOA 3D6CA 2F0VA 1NSNS 5CC4A 5KGUA 5ISRA 2F0UA 2KHSA 4K2LA 5C4ZA 4PMCA 3C1EA 2F0EA 3P75A 1SYBA 3TP5A 2OXPA 3NUCA 3DHQA 3VA5A 5C6AA 3TP8A 4EQNA 2F0DA 3OSOA
chains in the Genus database with same CATH superfamily
3D8GA 1C48A 3CCSA 3GTPH 1IKMA 3A56A 2PQEA 2K32A 2J7ZA 2AMCB 2EY6A 3RLOA 4UPAA 1S5BD 2PMZE 4QIWE 5C5LA 2L15A 1SNDA 3I55A 3GTMB 2SNSA 1KRTA 2Z8LA 1PH3A 1CQVA 3CCJA 3HOZB 1RDPD 3DLLA 4MTKA 1QB5D 5TSSA 3QJYA 5C0XH 1N34L 3E5SA 3RLFA 2A8VA 1EEFD 1STHA 2F0GA 3KLSX 2K05A 4P74A 3P7JA 2A6EC 3WOFA 1K8OA 4HCSA 5C3EB 3I4NG 3HOUB 4K0KQ 4ZK9B 3L0OA 3E0EA 2RCNA 5ELCA 2HQLA 4HTHA 2DUDA 4HJ5A 4PMBA 4BY1G 4DAPA 3FKIG 4FP5D 1JB3A 3NTHA 4JI2L 4H13C 5EBDA 1S40A 3CQZB 3BYTB 2KQ3A 1TU2B 5IWAL 3PUWA 4DR5Q 4R1JA 2Z9HA 1RJTA 2BDOA 5M3FG 4HSVA 3MC0B 1EY9A 1M1KC 3QOJA 4K5XA 5IYBH 4C1NI 4C3IH 2E2IH 3N6RA 2F3WA 2L12A 2Z4IA 2B63B 1PZID 4YWMA 4DA2A 2VZAA 3C3LA 1BBXC 1TWFB 3J81j 4LFBQ 1QOHA 4HEDA 2WKDA 5IP7H 2PZTA 4IFDG 1UEBA 1PYBA 1HR0L 1PMRA 4ZKBB 2JEAI 1E1OA 3AMUA 2A69D 1UE1A 2JA6G 3HFZB 4A76A 1YHAA 4LF4Q 4C1NK 1JB7A 2N3SA 4DR6L 5BN4A 3TZDA 2NVTH 1LT4D 1V9PA 1I6VC 5KGUA 5ELDA 1TWGH 4Z9CB 2B2TA 4C3JG 3S1RB 3SEBA 4YWKA 2PI2A 4GLXA 3KBGA 3UI2A 3HOWH 4KHPL 3NENA 1EYCA 3FRPB 4A3GH 1LT6D 5FJ8H 3QOLA 3WDNA 4R4TA 4GOPC 3PUXA 3ZJYC 4QUFA 5FLXc 4FF3A 1EZ8A 1BVSA 1WTXA 2QEXA 2O2LD 1SAPA 4DV0L 1JWSD 5EPJA 2PW5A 1XNQQ 1KDCA 1J9OA 1BBWA 2HDLA 5CYUA 1CI3M 4DR4L 4WJ3M 4KV6A 1Y1WH 1X3EA 1K28A 3H0GG 1W6JA 4QB4A 1GO3E 2R93G 1VQBA 1VF7A 2RKSA 5A35A 1X6OA 1VQFA 3M4OH 1YEZA 4YHHL 4J15A 1JMCA 1HPCA 1IBLL 3MXUA 2I0QA 1SE4A 3PQIA 4AIMA 2NTSA 4PNYA 1V43A 4HR7B 1ET9A 1D7QA 1STAA 1U5KA 1W6KA 2E74C 4XXEA 1I5FA 5M5YB 4DR1Q 3I70A 5E1FA 1LUZA 1R4PB 1PH8A 1N32Q 5ELBA 4LF7L 2CWAA 4R4IA 3I8ZA 2F0JA 1G6ZA 5BN5A 1STNA 1TS5A 2B8FA 2Y0SG 4A3IB 1CUKA 1ZEQX 2ATWA 4LNQA 3QB3A 4ZUIA 1L1OC 3I7FA 1LO5D 4HJ9A 4ME3A 3K5MA 1KLGD 5C44H 1SBBB 4LFCL 4HIMA 4OX9Q 4MNOA 2QCPX 1TWAB 2MUYA 3S1NH 2SDFA 3CCEA 2SOBA 2N78A 4JI5Q 1A8VA 2K5NA 4A3BH 5ELEA 1M90C 1LACA 1SE8A 2ZXPA 3MHBA 1I3QH 3S16H 1JJGA 1OXVA 4A3KG 1JE5A 5K36G 1JJ2A 1STEA 4JCVE 2TSSA 2I5LX 1KNEA 4IPCA 2E2JH 3HOYG 5LMNW 2XGTA 2F4VL 2D9UA 4L63B 3F2DA 1PYSB 5D3DA 1VQLA 3HKZG 1EOTA 5LL6S 3HS0C 1BCPD 3KF8B 1BDOA 4LK1C 1CHQD 3GD7A 1W3SA 1JORA 4OL7A 1E2ZA 3A8IE 4PV1C 4UAIA 1OTCA 1PFMA 3CW2C 2ID0A 2KCCA 3C46A 1KD1C 3VR5A 1E1TA 4O2DA 1I6HB 2KEDA 3NEMA 3PO3G 3W2DA 2BE5D 2B2VC 3IRBA 4JV5L 4YY3L 3UE1A 4DV4L 1EQQA 1EQTA 1BCPF 4A3FG 3K0YA 3OIQA 3C2PA 1KABA 1F77A 1QWYA 2KEEA 2JE6I 4FYDA 5CBEE 4LF6Q 3RMHA 3BVMA 2JA5B 2C35B 3KDFB 3TP6A 4UHVA 4X64Q 2FJ2A 3H6MA 2WV6D 5KNDA 1VS0A 3F2CA 3KFUA 1V1QA 3T1YL 3TP7A 3HOXH 4DV6L 2OQKA 1EIFA 2N88A 4FXGC 2YU9B 3I4MH 3PUVA 4A3DH 2Q8IB 5BR8Q 1A3TA 1SYGA 2R7ZH 4FVMA 1NMFA 5DLQE 3U58A 3MVVA 4L6TB 1MJCA 1AEXA 5IT9c 1CFMA 3J80i 2EY2A 4OIJA 5HY6A 4KD4A 1FJGL 2A6ED 2VUMH 1B2TA 1DJRD 1VQHA 1RIPA 2CH4W 1N33L 5E4XA 4A93G 1TQOA 3VYRA 4DV1Q 2N55A 3GTPB 1VQEA 4H0LC 1SJED 1GUOA 4JI1Q 1LTSD 1CKOA 4HN7A 2AHOB 4OWXB 2F0KA 2KBNA 2QILA 1SROA 3K8AA 3JC66 1LABA 4CKEA 2UUCQ 2VB3X 2CW0C 3R2IA 3C1EA 1R4QB 2M2LA 4CDDC 5KNBA 3DHQA 5LMNL 1F2LA 1AW7A 2B63H 4GKJQ 1P8LA 1U4RA 5G3LD 3PO2G 1EY8A 4A3LH 4ZQ3A 4LFAQ 1FVIA 1AH9A 4H7BA 3I91A 1PTOC 2UU9Q 1SNOA 1I94Q 4B3RQ 1C4QA 4FXDA 1DONA 3M7NA 2Z1CA 1VQIA 4DV5L 4B3SQ 4ZAIA 3A8KE 2AWNA 5CORA 2XWBB 5JJZA 4IOCA 1QNUA 5G3LF 1FNUA 4KKTA 2F0WA 4C3IB 1QE6A 2VY3A 1PH2A 2FFKB 3TZUA 2NZHA 1O7YA 4AYBG 5H1SE 4RKLA 5CV8A 2FHTA 3PUZA 3S17H 2K28A 1Z47A 3K7AB 1KHIA 5C4XG 2JA7B 2JK8A 3RR5A 5C0XJ 1EYAA 1EWCA 3EQLC 2RA4A 5I4DA 2R7FA 3RD4A 4N9PA 1V1OA 3RN5A 2K52A 4LF9Q 4R4CA 3ULPA 1ZYRC 1WTPA 5CV9A 1SYEA 3E6ZX 2K04A 1IBKQ 1A3UA 2NVTB 2F3VA 2EDGA 4DAYA 3BJUA 1EWHA 4ID6A 4HMIA 3I73A 1TWGB 2UUBL 2AQ3B 4APVA 4BBSH 1ESFA 1VQ4A 1GKHA 2PYKA 4JOIC 5A2QE 3HOWB 3RN2A 1F2YA 3P1HA 3V2TA 5J39A 3NK9A 2ASBA 1UNSA 1K3BC 1XNRL 2EYLA 2KCMA 4LAAA 4CDFC 3HEJA 4NXMQ 2EYMA 2M9VA 1E3PA 2EY1A 4DV3Q 2Q2UA 2F0VA 4POGA 1XMQL 1D8LA 3SVMA 4X66Q 2HCCA 4EQNA 1UEAB 4C2MH 1Y1WB 1QVGA 4A3JG 1GUGA 1SEBD 4B3MQ 3TS2A 2IW3A 1AN8A 2RDGA 2MNAA 1YIJA 4KHZA 1QILA 1Y1VB 5GAHC 1JQYD 1TWAH 4X3KA 2V4DA 4FNFA 3K0XA 1Z9FA 3F2UA 4RCNA 2R92H 1EOVA 3HOVG 1PZJD 2E76C 2K7VA 2GVAA 3J7A5 5DEHA 2FMCA 3AQQA 3U4ZA 1DCZA 3I90A 4JI4L 4I65A 2F0MA 1G8ZD 2OT2A 1BOSA 2AWOA 3ER0A 2VQEQ 1STBA 4YCVA 1HQMC 1RODA 5FKAC 3MTSA 3HP3A 1NR2A 1S72A 4ILWA 2EQSA 2AQ1B 3M4QA 4XT3B 4JI0L 4KY6A 1YNNC 1OXSC 4TRDA 1XMOL 3KJOA 2XRSD 5KYIA 1WFQA 2Y0SE 1NUCA 1WD1A 4JVZA 1IBML 4DV2Q 5EBCA 3J80L 1BNZA 3S1NB 1UE7A 3S2DH 1JOOA 5AJ3Q 3GQBA 2LKVA 5IGEA 4B3TL 3SGIA 4A3BB 1GUSA 4AQYQ 1SSOA 3JAML 1CZGA 1MD2D 2RQXA 1I3QB 2BOSA 3J81E 1TS4A 1CKNA 3PV0A 1D5XC 1Q1EA 1HNXQ 3ONAB 4RHRA 2WAQG 4Y52H 3GTKH 2PQAA 2NBFA 3M4PA 2E2JB 4WJ4A 3Q22A 3TMEA 2K5DA 1CA6A 2IX0A 1HZCA 1S5CD 3K7UC 1WTOA 3ND8A 2UUAQ 4DV7Q 1CHPD 1JOQA 3KF6B 2B39A 3CC7A 1WI5A 2WB1G 3S15H 3K5NA 1SMYC 1VQKA 4A3MH 2HIXA 3FPPA 5CC4A 5JEAH 2UXCL 2E8GA 1KQSA 4C3HG 4A3EH 3VR4A 5EJWA 2HHHL 3TSSA 1DXMA 2F0DA 2H1EA 1B3QA 3EIVA 4JI8L 1EEID 2WIIB 3V05A 1IYVA 3HKZE 1QVFA 2M00A 1K83H 3K80C 3J7ZC 4XQNA 4DUYQ 4LUZA 1U9RA 2N8NA 4J6HA 2MO0A 1BBUA 1EY4A 2D5DA 2K14A 4R4OA 1QJOA 1WCMH 3PUYA 5BN3A 4QL5A 1PH5A 4RG1A 3U9SA 2L55A 4RKBA 1B3AA 1RHPA 1HCZA 1ILQA 3DM1A 2F52A 4BY7H 2CCZA 4IFDI 1VMPA 1X32A 2ZXOA 3HOXB 1GD7A 2KENA 5IYCG 2LS01 2RBMA 2IX1A 2EYJA 2K03A 2PMZB 4QIWB 2L4NA 3I2ZA 3I4MB 4A3DB 1BO0A 3PF5A 1HNZQ 2I46A 3KK7A 2R7ZB 4ZYSA 2CW0D 4DR7Q 1HFGA 1TY0A 5C4JH 2N49A 3IFDA 1PV4A 4P71A 2ALYB 1VQ5A 3NXWA 4QUCA 3A7LA 2VUMB 1GHKA 4ZCKA 2A73B 3M3YH 1H9SA 1VF5C 2A68C 1PTOD 1E24A 1P16A 4K5VA 4RA8A 5I2YA 1XPOA 1EQVA 2X69A 3MXPA 3G71A 1I4XA 4C56C 1HA5A 2JN4A 3KLSA 3HRZC 5T1IA 3I4NH 3K57A 3BYYB 2K50A 3T51B 1N34Q 4JI6L 3OW7A 5JVG3 4Q5VA 3SK6A 4BY1H 2K5VA 5DM73 3FKIH 4TSSA 1H9KA 5GAGC 1A3VA 3NELA 1XWEA 2V1CC 1HNWQ 2BA0A 1LT3D 4LFBL 3ERSX 2MHVA 1PTOF 5KRUA 2L11A 2YTYA 2AKWB 1VMCA 5M3FH 3K7AH 2Q2TA 4MTNA 4JI2Q 4K2LA 2L0CA 2TMPA 3NTIA 5LL6X 5D65A 5IWAQ 3TP5A 2JA7H 3IKJA 3NUCA 3M4YA 2D0PA 4IN3A 2VW9A 1RTNA 2X6GA 1ENFA 4NXNL 1PH9A 1JCKB 1A6XA 2ZTCA 3SR1A 1F9SA 1TIID 4XTCS 1BF4A 4OWWB 2EIFA 2GN5A 2Q2HA 1JT8A 3W1GA 2MJ8A 2YTVA 1HRJA 3CD6A 2RSNA 1B8AA 4BBRG 4FDBA 4DK3C 1V8QA 1PFSA 4IFDH 1ZYRD 2VQFQ 4O0AA 5KEEA 5FLXL 2HQEA 2VNUD 2EVBA 5IY0A 1JWUD 2NVQH 1PRTC 2DJGC 1G2TA 4RWSC 2JA6H 5EKIA 1H9JA 2RVLA 1FR3A 1OO9B 3S17B 5M9OA 2ES2A 2HT1A 3CC4A 1CKMA 2QA4A 3NQTA 3KDFA 1B4OA 1SMXA 2SNMA 4LUVA 4AYBE 4A3GG 4JK1C 3NBHB 2KA7A 4RHSA 1F2ZA 1J8IA 2ZJQA 2WKCA 4C3JH 1VQDA 1LV9A 1SNPA 2CQOA 4X62L 2ZM6L 4KY7A 1MSGA 3FEWX 3CCQA 2VS1A 3VA7A 4HCEA 1AZPA 1L0YB 3GP7A 4M8AA 4BWGB 2PPBC 3UE0A 2O5IC 1SNCA 2WFWA 4KHPQ 3S14H 4OXPA 1Y1VH 4BBSB 3LWEA 4DR1L 3OMCA 4BS9A 3MXNB 5F2DA 4N9TA 2JA9A 3D6WA 3DM3A 1VQGA 2RDHA 4KTAA 4LMQD 4DV0Q 3LWUA 2E5LQ 4G4KA 2MO1A 1WYDA 5CR3A 4FXKC 5T1GA 5IGDA 1K73C 1AP0A 1B1ZA 4IUUA 1XXGA 3Q8DA 2HDMA 1MKHA 2OTLA 5M3MB 3CMAA 2L9HA 3MEHA 2MP1A 5ELNA 4JI7L 4C2MB 2ZJRA 4YHHQ 2R6GA 1IBLQ 1YITA 4GNXC 1EFID 3MFYA 3K6OA 3CCUA 4OX9L 4EQPA 3K59A 4QCLA 5JJLA 4UP8A 4GOPA 1YNND 5C44G 2R92B 3P75A 1FGBD 2CWPA 3CPWA 1IYJB 4LF7Q 1IL8A 2B2YC 3O13A 2UXBQ 5C3WA 3H94A 5JPNC 4PMWA 3Q23A 2QW7A 2JA8G 2AUJD 4MHEA 1QNKA 2JSOA 1Q81C 1XYIA 3I72A 1S3OA 4UDUC 5CV6A 4G7OC 5FO8B 4POFA 2B8GA 1H9MA 2E2DC 4BXXG 4NDXA 5J3BA 1XTCD 1B50A 4DKAC 2XRQD 1X3QA 4LF8L 4CJ2C 3I4OA 1OXXK 1UE5A 2G5DA 4A3KH 2CFMA 5K36H 3GTQH 2DNEA 2LSSA 3S2DB 1TKWB 3BVGA 1Y14B 3HG9A 3D0FA 1HQRD 1SMYD 1Q8KA 5COYA 3ZYYX 3A0JA 3HOYH 3T4AC 4DAMA 2EZVA 5DM63 2F4IA 4GNXA 1W2BA 1C0AA 4KD3A 4JBMA 1L1OA 2F1MA 2NZ1D 1VQAA 4ALPA 3GTKB 4IPDA 1YJWA 3Q0AA 2F4VQ 1TR5A 1H95A 2D0OA 1MIUA 3QR8A 4E6IA 1MHWC 3EVQA 3RZOH 1KNAA 1MBYA 2NUCA 5KNCA 2ZTEA 2UXDL 4ME5A 1G291 1S4ZA 1ASYA 2B2YA 3PCOB 4X64L 3ERQA 1ILPA 1EU4A 2DN8A 4GZYC 1FNVA 1WVLA 1TY2A 1RL2A 3S15B 4J1MA 4YWLA 4A3MB 3NPPA 3K5LA 1V1PA 1SRUA 1Q8IA 3BU2A 3UDFA 2F0HA 2RSOA 1WTVA 4A3EB 2NVYH 4A3FH 1RF2D 4OIKA 4P75A 3BVZA 1CZWA 3X3MA 1WTRA 2PI2E 4G7HC 1KDAA 3E3XA 4XYOA 3LX0A 5IT9L 3R8BA 2WB1E 1K83B 1XTDA 4K8IA 3T56B 4JV5Q 4YY3Q 4ZLTF 1EY7A 1KXLA 1EZ6A 4A3CG 3S24A 4IURA 2QDLA 3CCLA 4A75A 2L5TA 2F0UA 3S1QH 2D62A 2XIWA 3HOZG 2J0TD 3TQYA 3UDIA 3IL8A 2OXPA 1A15A 4MZ9A 3FVQA 1QUQA 2K33A 3EFXD 2E2HH 1EYDA 4P73A 1WCMB 1X3GA 1JC7A 2NVXH 5C3EG 3HOUG 3CPFA 1U0LA 1GHJA 4BY7B 1X65A 2A68D 1A2UA 2UUCL 4DPGA 5I9OA 5C4HA 1PXUA 2B2VA 5IGGA 5JOBA 2KHJA 3SXHA 3RNUA 1FL0A 4JYAQ 5JPMC 2JYOA 5J22A 4DNIA 1HTLD 5JEAJ 4GKJL 2VL6A 4A93H 3A55A 3MWYW 2EYHA 1GUTA 3NQIA 4FF4A 4DAVA 3GTOH 5EAYA 5C4JB 1FJGQ 3OOCA 1N33Q 1QCBD 5FLMG 2B63G 2B29A 1II3A 4HIOA 3NHHA 4DR3L 3I3CA 3KOJA 3DEPA 1KDBA 2J4XA 1NR4A 5E4WC 1I4HA 1BKBA 4JBJA 3H09A 3OTOL 4A3LG 3NTKA 3M3YB 1PH4A 1EIYB 3CC2A 5IE8A 3UDGA 3GTLB 4KK7A 1JR0D 5E3FA 3DWQA 3H3VI 3EBEA 2QKIC 4PQXA 4LJZC 1EIHA 2EYPA 3I4NB 3PSIA 2OCEA 3PIO3 3S2HH 2KCNA 2MPMA 3QWNA 4BY1B 1EY6A 3FKIB 5IP9G 2EJGC 1IL2A 2JQOA 4KLKA 2LXKA 1PDQA 1KL9A 1NBWA 1YBYA 3U9OA 1PRTD 5M3FB 2C9OA 3D31A 3QG1A 4R4QA 3A7AB 4DV5Q 1PH6A 1CK1A 2K6AA 4H44C 3J81c 4KHVA 3A74A 4A4IA 1GVPA 3FHWA 2FMMA 2I07B 4UP7A 1UWVA 1Q12A 5DAUA 4QY7A 2F0TA 2BCOA 4GN4B 3KYHC 1PRTF 4DK6C 3CCMA 2CH4A 1OXUA 4XT1B 4NPSA 5IGFA 3BZCA 2NVQB 5LMUL 4LF5L 4HAEA 3J7AF 1HFNA 3SHLA 4EQOA 2JA6B 1E2VA 3IAYA 3FDTA 1LTAD 2LMCB 3CAMA 4DV3L 4UY8C 2B2UC 4KY5A 3SK8A 1KAWA 4U68A 1WD0A 4C3JB 4NP5A 3DWPA 3QIAA 5M3MH 4NB3A 4K6LA 3B6YA 2O5JC 4NW2A 1J5EL 1HH2P 1EU3A 2UUBQ 3LNNA 1Q46A 4DUZL 4A3IG 3H3VH 2YYZA 1CSPA 3OWEB 1F9QA 1Y69U 1CT1D 3S14B 3M85A 1XNRQ 4QGUA 4JG2A 2D2CC 4H02A 4O1NA 5CGKA 5GAEC 1DD2A 4N8FA 4IFDJ 4LW1A 3H0GB 3BZKA 1SLJA 2R93B 3DXJC 4IUQA 1L0XB 1XMQQ 4FF1A 4DU9A 1DM0B 2NN6I 1D1IA 3URYA 1SYDA 3MAQA 2VQEL 1NCVA 1I50B 4J8QA 2G9HD 2R3ZA 3H15A 1N8RC 3HOVH 2K5WA 3TBIB 3N52A 1ICWA 1S5FD 5L37A 3MFGA 3M9BA 4JOIA 1S5DD 1O7LA 4V190 1TWCH 3D3RA 1MJEA 4DR2L 1WJJA 4IJHA 2B2UA 3F2BA 2ZXRA 2Y0SB 5C3XA 1A63A 2GA4B 4F88A 1TVXA 2I5MX 3OMGA 1VCIA 2Z0SA 3T1HL 4JI4Q 3A5ZB 4IUVA 4X65L 2HIVA 2PNRC 5CV5A 1HHVA 1WTWA 3PF4A 1B44D 4WFN3 1HNXL 2EPBA 1HZ9A 2K5HA 1NSNS 5JVH3 3BZDB 1CM9A 3GV6A 4FF2A 4JI0Q 4JI3Q 1XMOQ 4U673 3CF5A 3CP0A 1IHZA 2JEBI 1NTGA 3NWSA 5I6YA 1IBMQ 1OXTA 1RD9D 4L5TA 1QZGA 1HXYD 5ELOA 2K1BA 3HKSA 4TVAB 4A3KB 1TS3A 3GTQB 3G7LA 1I4PA 1FYCA 4LWCA 4L5RC 5M5XH 4ZRZA 1XPUA 4KMUC 1JOKA 1K8AC 2PCFB 3EROA 2JA5G 1SJHD 3GO5A 4P72A 1IZ6A 3I56A 3JAMc 3HOYB 4JBWA 1KC8C 3WOEA 5KYLA 1WTQA 2L1BA 4RGOS 3C1FA 4B08A 2EJMA 1SR3A 5EKKA 2EE1A 1Q7YC 3HKZB 2NN6H 3FMCA 4R9WA 2RDFA 1HTPA 4B9XA 1QZHA 5CV7A 4C3HH 1NMGA 3RZOB 4KN4C 4GLAC 1X56A 1X54A 2IPKD 4GKKL 4WORA 3OYYA 5IOCA 1DOLA 3MXNA 3I4LA 1Q3LA 4FO2A 4IZ8A 3DWAA 4IUPA 4OO1G 3OHXC 3KJPA 1AE3A 1EUJA 3BDLA 5FOBB 2QDBA 2HHHQ 1SXTA 3EN2A 3PO3B 2HD3A 4JI8Q 2F0OA 4F8MA 4B9WA 1WOCA 2NVYB 4A3FB 3CMEA 4DAYB 1N36Q 5IYDH 3EJIA 1SNMA 1HNZL 1N9WA 3E9HA 3TDQA 1ZXTA 4DGZA 4X6AH 3ND9A 3W3AA 1VQ9A 3D4DA 5AFWA 5EKLA 3R2TA 2A1AA 4DFAA 3CRKC 3IFTA 2FINB 1D1KA 2XVSA 3QO2A 4G7ZC 3S1QB 2KJXA 1D5ZC 1WTHA 4K0KL 5FK9C 5IYCH 5C0XG 1CTMA 4X3UA 2E2HB 3D4WA 2NVXB 3R93A 2KECA 3K81C 4DR5L 4IPGA 4EVOA 3GTLH 3BG3A 4BA1I 3D6CA 2P5ZX 5ISRA 1VQ7A 2MQHA 2IT1A 2EXDA 2IWHA 1IYUA 3OSOA 1QG7A 1PVOA 4BA2I 1M4VA 1TS2A 3TREA 3LGJA 1HNWL 1D2BA 2CVRA 4A93B 1IW7C 2B2TC 2RF4A 1ASZA 3ITPA 1G6PA 1G91A 2F0SA 5IYBG 4C3IG 2RCFA 3Q24A 3GTOB 4TQUS 3RUZA 1Q1BA 1K9MC 4KN7C 1IKLA 4LUOA 3NP8A 1XX8A 1PH1A 4V0BA 2PNHA 3STBC 1C7YA 1T5EA 3KF8A 4PZ7A 3E9IA 3GTGH 5IP7G 3AYHB 1LYLA 1AFPA 1EL0A 3J80E 2JA7G 4LF4L 1DOKA 2XN9C 3PO2B 3SK5A 2BA1A 4JI6Q 1YJ9A 3TEHB 4JBKA 1T5XD 2VQFL 1GJXA 4RGNA 1B53A 2BDNA 3JAME 3S2HB 4ULLA 5I2XA 4RH6A 3U50C 2PW7A 4OHJA 2DY8A 2MGSA 1Y8NB 4YIJA 1JE4A 1SFOB 2NYZD 5IGBA 3HZXA 1HR0Q 5D14A 3KUPA 1SN8A 3J7YW 3SE0A 1CKNB 2IHEA 2JP1A 4BBRH 4CHTB 1K8GA 3HOWG 3R3OA 5GQOA 3FPUB 4NXNQ 3HGBA 3L2PA 4DK0A 1XNQL 5FJ8G 2PQAB 4AYBB 1PH7A 1JICA 3CHBD 4ZKCB 4K2KA 4DR6Q 1SE3A 3T53B 1C9OA 3DEOA 2NTTA 4L5SA 2A6HC 4RGMA 4XIGS 3PIPA 1M8AA 4GN3B 3CKIB 5C4XB 1Y1WG 5I9PA 4GS3A 1LT5D 2EYFA 3OIPA 3SK4A 1Q90A 3GDEA 3K5OA 4CJ0B 4CGYB 2R7DA 2F0QA 4HJAA 2E5LL 3PGZA 5E7NA 1DOMA 1Y1VG 1U4PA 3H0GH 1MI2A 2Z6BA 1N32L 3G6EA 2R93H 1A62A 4IUTA 4X62Q 4PMCA 4Y7NH 2ZM6Q 3MA2B 1A0IA 4DR4Q 4KKUA 3OW2A 3VA5A 1I50H 2ZT9C 3T16A 1QVCA 3VYUA 1GOZA 1UUPA 4M1UB 1HZAA 4R8NA 1E0BA 4DNTB 3GTJH 1Y8OB 3TN2A 1ML0D 2KVMA 1E22A 1SE2A 5IGCA 5CMDA 3J81i 4GN5A 2F3IA 1YI2A 2OEOA 2WACA 1X3PA 1R9TH 2ZJPA 2UXBL 4JI5L 3BS1A 5CBAE 5JJIA 2LY7A 4XQQA 4A3JB 4X3TA 1YHQA 1F2MA 3H91A 4DK1A 2E75C 4QJFA 5EQ0A 5I6WA 1VQPA 1HJPA 3AB9A 2KUMA 4JI7Q 2BH8A 4A3BG 3V96A 1PA6A 1BCPB 2EXZA 2ICIA 3SDZA 3ICEA 4RGTA 1S5ED 2F0FA 4QMGA 2Z6KC 3HOVB 5C5MA 1EY5A 3A54A 1ESRA 4DXGA 3TS0A 1HUNA 4LFCQ 4QF4A 5IODA 1XJVA 1EWIA 1H9SB 1TWCB 1TT2A 2VB2X 2JA8H 4CDCC 1FNWA 3MEFA 2OF1A 5DNFA 4RMFA 4HIDA 4CKBA 5JJKA 3RZDH 4CKCA 1SDFA 1X55A 1ONLA 4BXXH 1O80A 3W1BA 3CXCA 2QGQA 2Q2IA 4PZ6A 2PZUA 2RHQB 1NE3A 1VQOA 1ENCA 1LTBD 4DN4M 1DGSA 3KLWA 2XSCA 1ENAA 5M5WB 1B70B 1LTLA 5ELFA 4LF8Q 2FXQA 1ZKOA 3P20A 4RFBA 3KBXA 2B3GA 4LF6L 4X3SA 1A2TA 4AH6A 5EGTA 4PG3A 2IX3A 1E7ZA 1PZKD 3NE5B 5FLXE 2QF7A 2WAQE 5C4ZA 1ICFB 2WAQB 2EOTA 1SYBA 3PO3H 5M5XB 1I4RA 3NWTA 1T9HA 5LHY1 4EGVA 2A74C 4CBVA 4MIUA 2F0PA 2DGYA 5A2QL 2F0IA 4OGQC 2Z6KA 5EPKA 3S1MH 4HIKA 4IOAA 1YNJC 1O78A 1PTOH 2DJFC 3L9AX 5BR8L 1EFWA 2BH2A 2A5HA 3HOXG 2F0NA 3A8JE 4DV4Q 1NAPA 2WB1B 3KLRA 2UXDQ 1BR9A 1U4MA 4DXFA 1D5MC 3I4MG 1JWMD 4XQJA 4A3DG 4C3HB 2LFNA 1PFBA 2R7ZG 1YVCA 2CQAA 3J7AV 1UE6A 3W5OA 3DUZA 4DV1L 3S9WA 4QQBX 3GV3A 3T1YQ 4A3CH 3GTMH 4JI1L 1EQRA 2K5QA 2VUMG 4DV6Q 2ZTDA 4GLVB 3F8TA 4JC0A 2CKZB 2F0LA 2Z4HA 2MFIA 3HOZH 4WJWA 4JYAL 3AEVA 4IALA 3MXGA 1JJCB 5HGTA 1TWHB 4F87A 2EYOA 2XWJB 1AZQA 5C3EH 2OWOA 3HOUH 4NMZA 4R8IA 4K8JA 1VQMA 4ABNA 1IW7D 2DY7A 4LFAL 2B2WC 3JAMi 4XDXA 3AU7A 2PO4A 2UU9L 3CQZH 2NB0A 1I94L 4B3RL 1LTRD 1AE2A 2JJQA 3CRLC 4B3SL 3WWVA 1PRTB 3T13A 4K5WA 3STBD 4JPBW 1MSHA 5FO7B 1GUWA 3PO2H 4N8X1 5FLMH 3ULLA 2A19A 5LMNQ 1BUVT 4GOPB 1MGSA 4CJ1B 1SYCA 3G48A 3MZ5A 1TWFH 1EYGA 4KKSA 2AQ2B 2GVBA 4DR3Q 1VDZA 4WRDA 3J81L 3CU7A 1IXRA 1I4QA 2I5HA 3OTOQ 2C5CA 1SFOH 1F9PA 1YHBA 5EPLA 3VYSA 1Y8PB 5C6AA 5FO9B 3TP8A 3KF6A 1U4LA 2OQ0A 3ULJA 5HURA 5IP9H 1B9MA 5JAVA 3GTGB 2NZOA 4IUNA 1GM5A 2WINB 4LF9L 2E2IB 4TKOB 3EA6A 2XNAC 1STGA 1PYWD 4RAUC 4HJ8A 1O7ZA 2YTXA 4UP9A 1IBKL 3S1RH 2IY5B 2RHSB 1FGUA 2PZWA 3K58A 2B2WA 2IJ0A 2A6HD 5C4XH 2KHIA 4CDEC 1K8MA 2F03A 4P2CB 2A69C 2KCTA 3L3OC 3VR6A 1DZ1A 2EJFC 4GNXB 4O42A 4NXML 4BBSG 1Z6HA 3BDOA 4BBRB 1L1OB 1B9NA 1KIXA 1LM0A 1VQJA 4HSPA 4IQZA 1YZ6A 2LXJA 1HUMA 1H9RA 1STYA 2AUKA 4X66L 4OEMB 1K0SA 1KAAA 2H4OA 3UDXA 3OWFA 4B3ML 1SNQA 1YJNA 1X9NA 4YCUA 2Q8RE 5M3MG 1PFNA 4YCWA 3G4SA 4IO9A 4ZUJA 5LMUQ 2K75A 4LF5Q 3M7GA 4A3GB 1LTGD 2QEJC 5M5YH 1RCVD 1Q82C 3D4RA 1V1PB 5IT9E 1F9RA 4ODGA 1LTID 1HA6A 1G51A 2DNCA 1Z7TA 4EQ5A 3VR2A 5K5PA 3X3NA 4A3JH 2R92G 4A3IH 2HCIA 4Y7NB 1PHJA 1J5EQ 4KJNA 1HZBA 4HMJA 1UAPA 3OPOA 5D3IB 1NJIC 3M4OB 4DUZQ 3A5UA 1QUQB 2CHBD 1B7YB 4K6DA 3GTJB 1J6QA 1FD7D 1VQCA 2IHFA 4IJLA 3NBIA 4OELB 1X3FA 2F0EA 1KTKA 4DV2L 1GXDC 2YV5A 1NNXA 2H5XA 5AJ3L 2XTIA 1R9TB 4OWTB 1KLUD 4I7ZC 4IPHA 1BQQT 4AQYL 3VR3A 2OTJA 2K01A 1ET6A 1G2SA 4K14A 3U4VA 4DF7A 1DYQA 4OO1I 1SYFA 1GUNA 2ENBA 4L5QA 4F7XA 3VYTA 1BXTA 3VDYA 2JXMB 1C8CA 3Q6SA 4KJOA 4JI3L 5C44B 4G57A 1CA5A 3G6JB 2WP8J 2Q8TA 5M5WH 2EY5A 4JW0A 4OONA 3PIP3 4DR2Q 1CQFA 4NKLA 5HGQA 1XPRA 2UUAL 5CV4A 5IIFA 4MN3A 4DV7L 4DNRB 2X6LA 2JA8B 3T1HQ 4L8JA 4X65Q 3H3VC 4B3TQ 2O4XA 3AFPA 3J80c 1EY0A 3S16B 5C0XI 3RZDB 3F1ZA 3PMFA 2HUGA 4HJ7A 1VQNA 1NY4A 1I6HH 3BDCA 3NBHA 1TXYA 4PZ8A 1VQ8A 1EIGA 2SEBD 4A3MG 5JEAG 1L2FA 1CSQA 5J1ZA 4A3EG 4RCOA 4DUYL 1E2WA 1K0RA 4Q0FA 1YNJD 3L7ZC 1VQ6A 1BCPC 2JA5H 2NN6G 3E0JA 2ICEC 3AFQA 2VXWA 3NSWA 5GADC 2IL8A 3DMUA 1KRSA 2G9DA 1HR0W 2KOLA 3TRZA 4S3SA 2R61A 3PIOA 2UXCQ 4EX5A 1Q86C 1RKNA 1O7IA 1K3RA 1L0WA 2YU9H 2BE5C 1N36L 4I7AA 1WCMG 4XYQA 1LTTD 5NUCA 1I4GA 1PLFA 3S1MB 5KIXA 4KI0A 1RTOA 1D6EC 4BY7G 1PTOB 3FP9A 3CCRA 5IYDG 2NWGA 4DR7L 4OO1H 2K4KA 1TWHH 2KHSA 5GROA 3CCVA 1LLRD 1YNXA 4GKKQ 3RLNA
chains in the Genus database with same CATH topology
3D8GA 1C48A 1IKMA 3A56A 2PQEA 2K32A 2J7ZA 2EY6A 1S5BD 5C5LA 1SNDA 3GTMB 2SNSA 2Z8LA 1CQVA 3HOZB 1RDPD 1QB5D 5TSSA 3QJYA 5C0XH 3E5SA 3RLFA 1EEFD 1STHA 2F0GA 3KLSX 2K05A 3P7JA 2A6EC 3WOFA 1K8OA 4HCSA 5C3EB 3HOUB 4ZK9B 5ELCA 4HTHA 4PMBA 4DAPA 4FP5D 1JB3A 3NTHA 4H13C 5EBDA 3CQZB 3BYTB 2KQ3A 1TU2B 3PUWA 1RJTA 2BDOA 4HSVA 3MC0B 1EY9A 3QOJA 4K5XA 4C1NI 3N6RA 2F3WA 2L12A 2Z4IA 2B63B 1PZID 4DA2A 3C3LA 1BBXC 1TWFB 1QOHA 4HEDA 2WKDA 2PZTA 4IFDG 1PMRA 4ZKBB 2JEAI 3AMUA 2A69D 4C1NK 5BN4A 3TZDA 1LT4D 1I6VC 5KGUA 5ELDA 4Z9CB 2B2TA 4C3JG 3S1RB 3SEBA 3KBGA 3UI2A 1EYCA 3FRPB 1LT6D 3QOLA 3WDNA 3PUXA 4QUFA 4FF3A 1EZ8A 1WTXA 2O2LD 1SAPA 1JWSD 5EPJA 2PW5A 1KDCA 1J9OA 2HDLA 5CYUA 1CI3M 4KV6A 1W6JA 4QB4A 1VF7A 2RKSA 5A35A 1HPCA 3MXUA 1SE4A 2NTSA 4PNYA 1V43A 4HR7B 1ET9A 1STAA 2E74C 1W6KA 4XXEA 5M5YB 3I70A 5E1FA 1R4PB 5ELBA 3I8ZA 2F0JA 1G6ZA 5BN5A 1STNA 1TS5A 2B8FA 4A3IB 1ZEQX 3QB3A 4ZUIA 1LO5D 3K5MA 1KLGD 1SBBB 2QCPX 1TWAB 2MUYA 2SDFA 2SOBA 5ELEA 1LACA 2ZXPA 3MHBA 1OXVA 5K36G 1STEA 2TSSA 1KNEA 2D9UA 4L63B 5D3DA 1EOTA 5LL6S 3HS0C 1BCPD 1BDOA 4LK1C 1CHQD 3GD7A 1JORA 4OL7A 1E2ZA 3A8IE 4PV1C 4UAIA 1PFMA 2ID0A 2KCCA 3C46A 3VR5A 1I6HB 2KEDA 3W2DA 2BE5D 2B2VC 1EQTA 1BCPF 3K0YA 3OIQA 3C2PA 1KABA 1F77A 1QWYA 2KEEA 2JE6I 4FYDA 5CBEE 3RMHA 3BVMA 2JA5B 3TP6A 2FJ2A 3H6MA 2WV6D 5KNDA 3TP7A 2N88A 4FXGC 2YU9B 3PUVA 2Q8IB 1A3TA 1SYGA 4FVMA 3MVVA 4L6TB 1AEXA 1CFMA 2EY2A 4OIJA 4KD4A 2A6ED 1B2TA 1DJRD 5E4XA 1TQOA 3VYRA 2N55A 3GTPB 4H0LC 1SJED 1GUOA 1LTSD 4HN7A 2F0KA 2QILA 4CKEA 1LABA 2VB3X 2CW0C 3R2IA 3C1EA 1R4QB 2M2LA 5KNBA 3DHQA 1F2LA 1AW7A 1U4RA 5G3LD 1EY8A 4ZQ3A 4H7BA 3I91A 1PTOC 1SNOA 1C4QA 4FXDA 1DONA 3M7NA 2Z1CA 4ZAIA 3A8KE 2AWNA 5CORA 2XWBB 5JJZA 1QNUA 5G3LF 1FNUA 4KKTA 2F0WA 4C3IB 1QE6A 2FFKB 3TZUA 1O7YA 4RKLA 5CV8A 2FHTA 3PUZA 2K28A 1Z47A 3K7AB 2JA7B 5C0XJ 1EYAA 1EWCA 3EQLC 2RA4A 5I4DA 3RD4A 4N9PA 1V1OA 1ZYRC 1WTPA 5CV9A 1SYEA 3E6ZX 2K04A 1A3UA 2NVTB 2F3VA 2EDGA 4DAYA 1EWHA 4ID6A 4HMIA 3I73A 1TWGB 2AQ3B 1ESFA 2PYKA 5A2QE 3HOWB 3V2TA 1F2YA 3P1HA 5J39A 3NK9A 1UNSA 2EYLA 4LAAA 3HEJA 2EYMA 2M9VA 2EY1A 2F0VA 3SVMA 2HCCA 4EQNA 1UEAB 1Y1WB 1GUGA 1SEBD 2IW3A 1AN8A 2RDGA 4KHZA 1QILA 1Y1VB 1JQYD 4X3KA 2V4DA 4FNFA 3F2UA 4RCNA 1PZJD 2E76C 2K7VA 5DEHA 2FMCA 1DCZA 3I90A 4I65A 2F0MA 1G8ZD 2OT2A 1BOSA 2AWOA 1STBA 1HQMC 1RODA 5FKAC 3MTSA 3HP3A 1NR2A 4ILWA 2AQ1B 4XT3B 4KY6A 1YNNC 1OXSC 4TRDA 2XRSD 5KYIA 1NUCA 1WD1A 5EBCA 3J80L 1BNZA 3S1NB 1JOOA 3GQBA 2LKVA 5IGEA 4A3BB 1GUSA 1SSOA 3JAML 1CZGA 1MD2D 2RQXA 1I3QB 2BOSA 3J81E 1TS4A 3PV0A 1D5XC 1Q1EA 3ONAB 4RHRA 2NBFA 2E2JB 3Q22A 3TMEA 2K5DA 1CA6A 2IX0A 1S5CD 1WTOA 3ND8A 1CHPD 1JOQA 2B39A 3K5NA 1SMYC 3FPPA 5CC4A 5JEAH 4C3HG 3VR4A 5EJWA 3TSSA 1DXMA 2F0DA 2H1EA 1EEID 2WIIB 3V05A 1IYVA 2M00A 4XQNA 1U9RA 4J6HA 1EY4A 2D5DA 1QJOA 3PUYA 5BN3A 3U9SA 2L55A 4RKBA 1B3AA 1RHPA 1HCZA 1ILQA 3DM1A 4IFDI 1VMPA 1X32A 2ZXOA 3HOXB 2LS01 2RBMA 2IX1A 2EYJA 2K03A 2PMZB 4QIWB 2L4NA 3I4MB 4A3DB 1BO0A 2I46A 3KK7A 2R7ZB 4ZYSA 2CW0D 1HFGA 1TY0A 3IFDA 3NXWA 4QUCA 3A7LA 2VUMB 1GHKA 2A73B 1H9SA 1VF5C 2A68C 1PTOD 4K5VA 4RA8A 5I2YA 1EQVA 2X69A 3MXPA 1I4XA 4C56C 1HA5A 3KLSA 3HRZC 5T1IA 3K57A 3BYYB 3T51B 3OW7A 5JVG3 4Q5VA 3SK6A 5DM73 4TSSA 1H9KA 1A3VA 1XWEA 2BA0A 1LT3D 2MHVA 1PTOF 5KRUA 2L11A 1VMCA 4K2LA 2L0CA 2TMPA 3NTIA 5LL6X 5D65A 3TP5A 3IKJA 3NUCA 3M4YA 4IN3A 1RTNA 2X6GA 1ENFA 1JCKB 1A6XA 3SR1A 1F9SA 1TIID 4XTCS 1BF4A 2MJ8A 1HRJA 2RSNA 1V8QA 4IFDH 1ZYRD 5KEEA 5FLXL 2HQEA 2VNUD 2EVBA 1JWUD 1PRTC 1G2TA 4RWSC 5EKIA 1H9JA 2RVLA 1FR3A 1OO9B 3S17B 5M9OA 3NQTA 1B4OA 2SNMA 4JK1C 2KA7A 4RHSA 1F2ZA 1J8IA 2WKCA 1LV9A 1SNPA 4KY7A 1MSGA 3FEWX 3VA7A 4HCEA 1AZPA 1L0YB 3GP7A 4M8AA 4BWGB 2PPBC 2O5IC 1SNCA 4BBSB 3LWEA 3OMCA 4BS9A 5F2DA 4N9TA 3D6WA 2RDHA 4KTAA 4LMQD 3LWUA 4G4KA 5CR3A 4FXKC 5T1GA 5IGDA 1AP0A 1B1ZA 4IUUA 1XXGA 2HDMA 5M3MB 2L9HA 3MEHA 2MP1A 4C2MB 2R6GA 1EFID 3MFYA 3K6OA 4EQPA 3K59A 4QCLA 1YNND 2R92B 3P75A 1FGBD 1IL8A 2B2YC 3O13A 5C3WA 3H94A 5JPNC 4PMWA 3Q23A 2AUJD 4MHEA 1QNKA 2JSOA 1XYIA 3I72A 4UDUC 5CV6A 4G7OC 5FO8B 2B8GA 1H9MA 2E2DC 4NDXA 1XTCD 1B50A 2XRQD 1X3QA 4CJ2C 1OXXK 5K36H 2DNEA 3S2DB 1TKWB 3BVGA 3HG9A 1HQRD 1SMYD 5COYA 3ZYYX 3T4AC 2EZVA 5DM63 2F4IA 4KD3A 2F1MA 2NZ1D 3GTKB 3Q0AA 1TR5A 4E6IA 3EVQA 1KNAA 1MBYA 2NUCA 5KNCA 4ME5A 1G291 1S4ZA 2B2YA 3ERQA 1ILPA 1EU4A 2DN8A 4GZYC 1FNVA 1WVLA 1TY2A 3S15B 4J1MA 4A3MB 3NPPA 3K5LA 1V1PA 1Q8IA 2F0HA 2RSOA 1WTVA 4A3EB 1RF2D 4OIKA 3BVZA 1CZWA 3X3MA 1WTRA 4G7HC 1KDAA 4XYOA 3LX0A 5IT9L 3R8BA 4K8IA 1K83B 3T56B 4ZLTF 1EY7A 1EZ6A 4IURA 2L5TA 2F0UA 2D62A 2XIWA 2J0TD 3IL8A 2OXPA 1A15A 3FVQA 2K33A 3EFXD 1EYDA 1WCMB 1JC7A 1GHJA 4BY7B 2A68D 1A2UA 5I9OA 5C4HA 1PXUA 2B2VA 5IGGA 5JOBA 3SXHA 5JPMC 2JYOA 5J22A 1HTLD 5JEAJ 3A55A 3MWYW 2EYHA 1GUTA 3NQIA 4FF4A 4DAVA 5C4JB 3OOCA 1QCBD 1II3A 3NHHA 3I3CA 5E4WC 3DEPA 1KDBA 2J4XA 1NR4A 1I4HA 3H09A 3NTKA 3M3YB 3GTLB 4KK7A 1JR0D 5E3FA 3DWQA 2QKIC 4PQXA 4LJZC 1EIHA 2EYPA 3I4NB 3PIO3 2KCNA 2MPMA 3QWNA 4BY1B 1EY6A 3FKIB 2EJGC 1PDQA 3U9OA 1PRTD 5M3FB 2C9OA 3D31A 3QG1A 3A7AB 1CK1A 2K6AA 4H44C 4KHVA 2FMMA 2I07B 1Q12A 5DAUA 2F0TA 2BCOA 1PRTF 1OXUA 4XT1B 5IGFA 2NVQB 4HAEA 3J7AF 1HFNA 3SHLA 4EQOA 2JA6B 1E2VA 3IAYA 3FDTA 1LTAD 2LMCB 2B2UC 4KY5A 3SK8A 4U68A 1WD0A 4C3JB 4NP5A 3DWPA 3QIAA 4K6LA 2O5JC 4NW2A 1EU3A 3LNNA 2YYZA 3OWEB 1F9QA 1Y69U 1CT1D 3S14B 3M85A 2D2CC 4O1NA 5CGKA 1DD2A 4IFDJ 3H0GB 2R93B 3DXJC 4IUQA 1L0XB 4FF1A 4DU9A 1DM0B 2NN6I 1D1IA 3URYA 1SYDA 3MAQA 1NCVA 1I50B 4J8QA 2G9HD 2R3ZA 2K5WA 3TBIB 3N52A 1ICWA 1S5FD 3MFGA 1S5DD 1O7LA 4V190 3D3RA 2B2UA 2ZXRA 2Y0SB 5C3XA 2GA4B 4F88A 1TVXA 1VCIA 3OMGA 4IUVA 2PNRC 5CV5A 1HHVA 1WTWA 1B44D 4WFN3 2EPBA 1NSNS 5JVH3 3BZDB 1CM9A 3GV6A 4FF2A 4U673 1IHZA 2JEBI 3NWSA 5I6YA 1OXTA 1RD9D 1HXYD 2K1BA 4A3KB 1TS3A 3GTQB 3G7LA 1I4PA 1FYCA 4ZRZA 4KMUC 1JOKA 2PCFB 3EROA 1SJHD 3GO5A 3HOYB 4JBWA 3WOEA 5KYLA 1WTQA 2L1BA 4RGOS 3C1FA 4B08A 2EJMA 5EKKA 2EE1A 3HKZB 2NN6H 3FMCA 4R9WA 2RDFA 1HTPA 4B9XA 5CV7A 3RZOB 4KN4C 2IPKD 4WORA 5IOCA 1DOLA 3MXNA 3I4LA 1Q3LA 4FO2A 4IZ8A 3DWAA 4IUPA 4OO1G 3OHXC 3BDLA 5FOBB 3PO3B 2QDBA 1SXTA 2F0OA 4F8MA 4B9WA 2NVYB 4A3FB 3EJIA 1SNMA 3TDQA 1ZXTA 4DGZA 3ND9A 3W3AA 3D4DA 5AFWA 5EKLA 3R2TA 4DFAA 3CRKC 3IFTA 2FINB 1D1KA 2XVSA 3QO2A 4G7ZC 3S1QB 2KJXA 1D5ZC 5FK9C 5C0XG 1CTMA 4X3UA 2E2HB 3D4WA 2NVXB 3R93A 2KECA 4EVOA 3BG3A 4BA1I 3D6CA 5ISRA 2IT1A 2IWHA 1IYUA 3OSOA 1QG7A 4BA2I 1M4VA 1TS2A 1D2BA 2CVRA 4A93B 1IW7C 2B2TC 3ITPA 1G91A 2F0SA 4C3IG 3Q24A 3GTOB 4TQUS 3RUZA 1Q1BA 4KN7C 1IKLA 3NP8A 1XX8A 4V0BA 1T5EA 3KF8A 1AFPA 1EL0A 3J80E 1DOKA 2XN9C 3PO2B 3SK5A 2BA1A 1T5XD 1GJXA 4RGNA 1B53A 2BDNA 3JAME 3S2HB 4ULLA 5I2XA 4RH6A 2PW7A 4OHJA 2DY8A 2MGSA 1Y8NB 4YIJA 1JE4A 1SFOB 2NYZD 5IGBA 3HZXA 5D14A 3KUPA 3J7YW 3SE0A 2JP1A 4CHTB 3R3OA 3FPUB 3HGBA 4DK0A 4AYBB 1JICA 3CHBD 4ZKCB 4K2KA 1SE3A 3T53B 3DEOA 2NTTA 2A6HC 4RGMA 4XIGS 1M8AA 3CKIB 5C4XB 5I9PA 1LT5D 2EYFA 3OIPA 3SK4A 1Q90A 3K5OA 4CJ0B 4CGYB 2F0QA 1DOMA 1U4PA 1MI2A 4IUTA 4PMCA 3MA2B 4KKUA 3VA5A 2ZT9C 3T16A 3VYUA 1GOZA 1UUPA 4M1UB 4R8NA 1E0BA 4DNTB 1Y8OB 3TN2A 1ML0D 2KVMA 1SE2A 5IGCA 5CMDA 2OEOA 2WACA 1X3PA 3BS1A 5CBAE 2LY7A 4XQQA 4A3JB 4X3TA 1F2MA 3H91A 4DK1A 2E75C 5EQ0A 5I6WA 3AB9A 2KUMA 3V96A 1BCPB 2EXZA 2ICIA 3SDZA 4RGTA 1S5ED 2F0FA 4QMGA 3HOVB 5C5MA 1EY5A 3A54A 1ESRA 4DXGA 1HUNA 4QF4A 5IODA 1H9SB 1TWCB 1TT2A 2VB2X 1FNWA 2OF1A 5DNFA 4CKBA 4CKCA 1SDFA 1ONLA 1O80A 2PZUA 1ENCA 1LTBD 4DN4M 2XSCA 1ENAA 5M5WB 5ELFA 1ZKOA 3P20A 4RFBA 3KBXA 4X3SA 1A2TA 5EGTA 2IX3A 1PZKD 3NE5B 5FLXE 2QF7A 5C4ZA 2WAQB 2EOTA 1SYBA 5M5XB 1I4RA 3NWTA 5LHY1 4EGVA 2A74C 4CBVA 4MIUA 2F0PA 5A2QL 2F0IA 4OGQC 5EPKA 1YNJC 1O78A 1PTOH 3L9AX 2A5HA 2F0NA 3A8JE 1NAPA 2WB1B 3KLRA 1BR9A 1U4MA 4DXFA 1D5MC 1JWMD 4XQJA 4C3HB 2LFNA 1PFBA 2CQAA 3J7AV 3DUZA 3S9WA 3GV3A 2K5QA 2F0LA 2Z4HA 4WJWA 4IALA 3MXGA 5HGTA 1TWHB 4F87A 2EYOA 2XWJB 1AZQA 4NMZA 4R8IA 4K8JA 4ABNA 1IW7D 2DY7A 2B2WC 4XDXA 3AU7A 2PO4A 2NB0A 1LTRD 3CRLC 1PRTB 3T13A 4K5WA 1MSHA 5FO7B 1GUWA 1BUVT 1MGSA 4CJ1B 1SYCA 3MZ5A 4KKSA 2AQ2B 1VDZA 4WRDA 3J81L 3CU7A 1I4QA 2C5CA 1F9PA 5EPLA 3VYSA 1Y8PB 5C6AA 5FO9B 3TP8A 1U4LA 5HURA 1B9MA 5JAVA 3GTGB 4IUNA 2WINB 2E2IB 4TKOB 3EA6A 2XNAC 1STGA 1PYWD 4RAUC 1O7ZA 3K58A 2PZWA 2B2WA 2IJ0A 2A6HD 1K8MA 2F03A 4P2CB 2A69C 3L3OC 3VR6A 1DZ1A 2EJFC 4O42A 1Z6HA 3BDOA 4BBRB 1B9NA 4HSPA 4IQZA 1HUMA 1H9RA 1STYA 2AUKA 1KAAA 2H4OA 3OWFA 1SNQA 2Q8RE 1PFNA 4ZUJA 3M7GA 4A3GB 1LTGD 2QEJC 1RCVD 3D4RA 1V1PB 5IT9E 1F9RA 4ODGA 1LTID 1HA6A 2DNCA 1Z7TA 3VR2A 5K5PA 3X3NA 2HCIA 4Y7NB 4KJNA 4HMJA 1UAPA 3OPOA 5D3IB 3M4OB 2CHBD 4K6DA 3GTJB 1FD7D 3NBIA 2F0EA 1KTKA 1GXDC 1R9TB 1KLUD 4I7ZC 1BQQT 3VR3A 2K01A 1ET6A 1G2SA 4K14A 4DF7A 1DYQA 4OO1I 1SYFA 1GUNA 2ENBA 4F7XA 3VYTA 1BXTA 2JXMB 1C8CA 3Q6SA 4KJOA 5C44B 4G57A 1CA5A 3G6JB 2WP8J 2Q8TA 2EY5A 3PIP3 1CQFA 4NKLA 5CV4A 5IIFA 4MN3A 4DNRB 2X6LA 2JA8B 4L8JA 3H3VC 2O4XA 1EY0A 3S16B 5C0XI 3RZDB 3PMFA 2HUGA 3BDCA 3NBHA 1EIGA 2SEBD 5JEAG 5J1ZA 4RCOA 1E2WA 4Q0FA 1YNJD 3L7ZC 1BCPC 2NN6G 3E0JA 2ICEC 2VXWA 3NSWA 2IL8A 3DMUA 2G9DA 2KOLA 4S3SA 2R61A 1RKNA 2BE5C 4XYQA 1LTTD 5NUCA 1I4GA 1PLFA 3S1MB 5KIXA 4KI0A 1RTOA 1D6EC 1PTOB 2NWGA 4OO1H 2KHSA 1LLRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYC A;  3D8G A;  4MIU A;  3T16 A;  1IHZ A;  2F0P A;  1EYD A;  2F0I A;  3QOL A;  2M00 A;  5C3W A;  5HUR A;  5I6Y A;  2PQE A;  4R8N A;  3SHL A;  4EQO A;  1EZ8 A;  5JAV A;  4IUN A;  3ITP A;  3SR1 A;  2F0S A;  1EY8 A;  1U9R A;  2EY6 A;  1STG A;  4ZQ3 A;  4K14 A;  4DF7 A;  2F0N A;  4J6H A;  5C5L A;  3RUZ A;  4H7B A;  1SND A;  2PW5 A;  1SYF A;  5IGC A;  4KY5 A;  1A2U A;  3SK8 A;  1KDC A;  1EY4 A;  2ENB A;  2SNS A;  4F7X A;  1SNO A;  5CV6 A;  5KEE A;  5I9O A;  5C4H A;  2HQE A;  2PZW A;  1JOK A;  1JOR A;  3ERO A;  2OEO A;  2WAC A;  3NP8 A;  4KJO A;  4KV6 A;  4OL7 A;  5JOB A;  3SXH A;  5IGG A;  4NP5 A;  4G57 A;  5DEH A;  4NDX A;  4QB4 A;  5J22 A;  3E5S A;  1STH A;  2F0G A;  2RKS A;  5KYL A;  2EY5 A;  4RKB A;  5M9O A;  1F2M A;  2EYH A;  3C1F A;  4NKL A;  3S9W A;  5I6W A;  3NQT A;  4I65 A;  5EKK A;  3SK5 A;  2F0M A;  2SNM A;  4PNY A;  5CV4 A;  5IIF A;  2F0W A;  2RDF A;  1STB A;  1II3 A;  4HTH A;  1STA A;  4B9X A;  3NHH A;  4PMB A;  1F2Z A;  2EXZ A;  1KAB A;  2RBM A;  1KDB A;  5CV7 A;  2O4X A;  1SNP A;  2EYJ A;  2F0F A;  2F0L A;  2PW7 A;  4RKL A;  5CV8 A;  1EY0 A;  4QMG A;  5E1F A;  1STY A;  5CGK A;  4KY7 A;  2KQ3 A;  5C5M A;  1EY5 A;  3TP6 A;  3PMF A;  4IAL A;  4KY6 A;  4WOR A;  1KAA A;  4YIJ A;  4TRD A;  5IOC A;  3BDC A;  5HGT A;  3H6M A;  5KYI A;  4KD3 A;  2F0J A;  3OWF A;  2EYO A;  4QF4 A;  1NUC A;  4IZ8 A;  5IOD A;  1SNQ A;  5E3F A;  1EY9 A;  1STN A;  3QOJ A;  4DU9 A;  5IGB A;  3HZX A;  4NMZ A;  3BDL A;  1SYD A;  4K8J A;  2QDB A;  4K5X A;  5J1Z A;  1TT2 A;  1SNC A;  3TP7 A;  1JOO A;  1EYA A;  4ZUJ A;  2EYP A;  1TR5 A;  2F3W A;  2F0O A;  3R3O A;  4B9W A;  3EVQ A;  2OF1 A;  3NXW A;  2LKV A;  4E6I A;  4F8M A;  5IGE A;  3QB3 A;  3OMC A;  4N9P A;  2NUC A;  3EJI A;  5F2D A;  1EY6 A;  4N9T A;  4ODG A;  4ZUI A;  4ME5 A;  1A3T A;  4KTA A;  1SNM A;  1SYG A;  5CV9 A;  4K5V A;  1SYE A;  4K2K A;  3ERQ A;  4DGZ A;  1EQV A;  5CR3 A;  3MVV A;  1A3U A;  2PZT A;  2F3V A;  3DMU A;  5IGD A;  3U9O A;  3D4D A;  3MXP A;  4J1M A;  3T13 A;  5K5P A;  4K5W A;  1AEX A;  2PZU A;  4S3S A;  5EKL A;  5IGF A;  4ID6 A;  1ENC A;  4DFA A;  2SOB A;  4HMI A;  2F0H A;  1RKN A;  2EY2 A;  5C3X A;  5I9P A;  4KD4 A;  2PYK A;  3TME A;  3MEH A;  4KJN A;  2EYF A;  3SK6 A;  4KHV A;  3SK4 A;  1ENA A;  1F2Y A;  3OMG A;  3P1H A;  4HMJ A;  1A3V A;  3NK9 A;  5NUC A;  1SYC A;  3V2T A;  5J39 A;  1KDA A;  1TQO A;  2EYL A;  3LX0 A;  3MZ5 A;  3D4W A;  3MHB A;  4K8I A;  2F0Q A;  5CV5 A;  5KIX A;  1JOQ A;  4LAA A;  5DAU A;  1EY7 A;  4K6D A;  3HEJ A;  5KRU A;  1A2T A;  1EZ6 A;  2EYM A;  4EQP A;  5EGT A;  4WRD A;  2F0T A;  2F0K A;  2EY1 A;  4EVO A;  3D6C A;  2F0V A;  1NSN S;  5CC4 A;  5KGU A;  5ISR A;  2F0U A;  2KHS A;  4K2L A;  5C4Z A;  4PMC A;  3C1E A;  2F0E A;  3P75 A;  1SYB A;  3TP5 A;  2OXP A;  3NUC A;  3DHQ A;  3VA5 A;  5C6A A;  3TP8 A;  4EQN A;  2F0D A;  3OSO A; 
#chains in the Genus database with same CATH topology
 3D8G A;  1C48 A;  3CCS A;  3GTP H;  1IKM A;  3A56 A;  2PQE A;  2K32 A;  2J7Z A;  2AMC B;  2EY6 A;  3RLO A;  4UPA A;  1S5B D;  2PMZ E;  4QIW E;  5C5L A;  2L15 A;  1SND A;  3I55 A;  3GTM B;  2SNS A;  1KRT A;  2Z8L A;  1PH3 A;  1CQV A;  3CCJ A;  3HOZ B;  1RDP D;  3DLL A;  4MTK A;  1QB5 D;  5TSS A;  3QJY A;  5C0X H;  1N34 L;  3E5S A;  3RLF A;  2A8V A;  1EEF D;  1STH A;  2F0G A;  3KLS X;  2K05 A;  4P74 A;  3P7J A;  2A6E C;  3WOF A;  1K8O A;  4HCS A;  5C3E B;  3I4N G;  3HOU B;  4K0K Q;  4ZK9 B;  3L0O A;  3E0E A;  2RCN A;  5ELC A;  2HQL A;  4HTH A;  2DUD A;  4HJ5 A;  4PMB A;  4BY1 G;  4DAP A;  3FKI G;  4FP5 D;  1JB3 A;  3NTH A;  4JI2 L;  4H13 C;  5EBD A;  1S40 A;  3CQZ B;  3BYT B;  2KQ3 A;  1TU2 B;  5IWA L;  3PUW A;  4DR5 Q;  4R1J A;  2Z9H A;  1RJT A;  2BDO A;  5M3F G;  4HSV A;  3MC0 B;  1EY9 A;  1M1K C;  3QOJ A;  4K5X A;  5IYB H;  4C1N I;  4C3I H;  2E2I H;  3N6R A;  2F3W A;  2L12 A;  2Z4I A;  2B63 B;  1PZI D;  4YWM A;  4DA2 A;  2VZA A;  3C3L A;  1BBX C;  1TWF B;  3J81 j;  4LFB Q;  1QOH A;  4HED A;  2WKD A;  5IP7 H;  2PZT A;  4IFD G;  1UEB A;  1PYB A;  1HR0 L;  1PMR A;  4ZKB B;  2JEA I;  1E1O A;  3AMU A;  2A69 D;  1UE1 A;  2JA6 G;  3HFZ B;  4A76 A;  1YHA A;  4LF4 Q;  4C1N K;  1JB7 A;  2N3S A;  4DR6 L;  5BN4 A;  3TZD A;  2NVT H;  1LT4 D;  1V9P A;  1I6V C;  5KGU A;  5ELD A;  1TWG H;  4Z9C B;  2B2T A;  4C3J G;  3S1R B;  3SEB A;  4YWK A;  2PI2 A;  4GLX A;  3KBG A;  3UI2 A;  3HOW H;  4KHP L;  3NEN A;  1EYC A;  3FRP B;  4A3G H;  1LT6 D;  5FJ8 H;  3QOL A;  3WDN A;  4R4T A;  4GOP C;  3PUX A;  3ZJY C;  4QUF A;  5FLX c;  4FF3 A;  1EZ8 A;  1BVS A;  1WTX A;  2QEX A;  2O2L D;  1SAP A;  4DV0 L;  1JWS D;  5EPJ A;  2PW5 A;  1XNQ Q;  1KDC A;  1J9O A;  1BBW A;  2HDL A;  5CYU A;  1CI3 M;  4DR4 L;  4WJ3 M;  4KV6 A;  1Y1W H;  1X3E A;  1K28 A;  3H0G G;  1W6J A;  4QB4 A;  1GO3 E;  2R93 G;  1VQB A;  1VF7 A;  2RKS A;  5A35 A;  1X6O A;  1VQF A;  3M4O H;  1YEZ A;  4YHH L;  4J15 A;  1JMC A;  1HPC A;  1IBL L;  3MXU A;  2I0Q A;  1SE4 A;  3PQI A;  4AIM A;  2NTS A;  4PNY A;  1V43 A;  4HR7 B;  1ET9 A;  1D7Q A;  1STA A;  1U5K A;  1W6K A;  2E74 C;  4XXE A;  1I5F A;  5M5Y B;  4DR1 Q;  3I70 A;  5E1F A;  1LUZ A;  1R4P B;  1PH8 A;  1N32 Q;  5ELB A;  4LF7 L;  2CWA A;  4R4I A;  3I8Z A;  2F0J A;  1G6Z A;  5BN5 A;  1STN A;  1TS5 A;  2B8F A;  2Y0S G;  4A3I B;  1CUK A;  1ZEQ X;  2ATW A;  4LNQ A;  3QB3 A;  4ZUI A;  1L1O C;  3I7F A;  1LO5 D;  4HJ9 A;  4ME3 A;  3K5M A;  1KLG D;  5C44 H;  1SBB B;  4LFC L;  4HIM A;  4OX9 Q;  4MNO A;  2QCP X;  1TWA B;  2MUY A;  3S1N H;  2SDF A;  3CCE A;  2SOB A;  2N78 A;  4JI5 Q;  1A8V A;  2K5N A;  4A3B H;  5ELE A;  1M90 C;  1LAC A;  1SE8 A;  2ZXP A;  3MHB A;  1I3Q H;  3S16 H;  1JJG A;  1OXV A;  4A3K G;  1JE5 A;  5K36 G;  1JJ2 A;  1STE A;  4JCV E;  2TSS A;  2I5L X;  1KNE A;  4IPC A;  2E2J H;  3HOY G;  5LMN W;  2XGT A;  2F4V L;  2D9U A;  4L63 B;  3F2D A;  1PYS B;  5D3D A;  1VQL A;  3HKZ G;  1EOT A;  5LL6 S;  3HS0 C;  1BCP D;  3KF8 B;  1BDO A;  4LK1 C;  1CHQ D;  3GD7 A;  1W3S A;  1JOR A;  4OL7 A;  1E2Z A;  3A8I E;  4PV1 C;  4UAI A;  1OTC A;  1PFM A;  3CW2 C;  2ID0 A;  2KCC A;  3C46 A;  1KD1 C;  3VR5 A;  1E1T A;  4O2D A;  1I6H B;  2KED A;  3NEM A;  3PO3 G;  3W2D A;  2BE5 D;  2B2V C;  3IRB A;  4JV5 L;  4YY3 L;  3UE1 A;  4DV4 L;  1EQQ A;  1EQT A;  1BCP F;  4A3F G;  3K0Y A;  3OIQ A;  3C2P A;  1KAB A;  1F77 A;  1QWY A;  2KEE A;  2JE6 I;  4FYD A;  5CBE E;  4LF6 Q;  3RMH A;  3BVM A;  2JA5 B;  2C35 B;  3KDF B;  3TP6 A;  4UHV A;  4X64 Q;  2FJ2 A;  3H6M A;  2WV6 D;  5KND A;  1VS0 A;  3F2C A;  3KFU A;  1V1Q A;  3T1Y L;  3TP7 A;  3HOX H;  4DV6 L;  2OQK A;  1EIF A;  2N88 A;  4FXG C;  2YU9 B;  3I4M H;  3PUV A;  4A3D H;  2Q8I B;  5BR8 Q;  1A3T A;  1SYG A;  2R7Z H;  4FVM A;  1NMF A;  5DLQ E;  3U58 A;  3MVV A;  4L6T B;  1MJC A;  1AEX A;  5IT9 c;  1CFM A;  3J80 i;  2EY2 A;  4OIJ A;  5HY6 A;  4KD4 A;  1FJG L;  2A6E D;  2VUM H;  1B2T A;  1DJR D;  1VQH A;  1RIP A;  2CH4 W;  1N33 L;  5E4X A;  4A93 G;  1TQO A;  3VYR A;  4DV1 Q;  2N55 A;  3GTP B;  1VQE A;  4H0L C;  1SJE D;  1GUO A;  4JI1 Q;  1LTS D;  1CKO A;  4HN7 A;  2AHO B;  4OWX B;  2F0K A;  2KBN A;  2QIL A;  1SRO A;  3K8A A;  3JC6 6;  1LAB A;  4CKE A;  2UUC Q;  2VB3 X;  2CW0 C;  3R2I A;  3C1E A;  1R4Q B;  2M2L A;  4CDD C;  5KNB A;  3DHQ A;  5LMN L;  1F2L A;  1AW7 A;  2B63 H;  4GKJ Q;  1P8L A;  1U4R A;  5G3L D;  3PO2 G;  1EY8 A;  4A3L H;  4ZQ3 A;  4LFA Q;  1FVI A;  1AH9 A;  4H7B A;  3I91 A;  1PTO C;  2UU9 Q;  1SNO A;  1I94 Q;  4B3R Q;  1C4Q A;  4FXD A;  1DON A;  3M7N A;  2Z1C A;  1VQI A;  4DV5 L;  4B3S Q;  4ZAI A;  3A8K E;  2AWN A;  5COR A;  2XWB B;  5JJZ A;  4IOC A;  1QNU A;  5G3L F;  1FNU A;  4KKT A;  2F0W A;  4C3I B;  1QE6 A;  2VY3 A;  1PH2 A;  2FFK B;  3TZU A;  2NZH A;  1O7Y A;  4AYB G;  5H1S E;  4RKL A;  5CV8 A;  2FHT A;  3PUZ A;  3S17 H;  2K28 A;  1Z47 A;  3K7A B;  1KHI A;  5C4X G;  2JA7 B;  2JK8 A;  3RR5 A;  5C0X J;  1EYA A;  1EWC A;  3EQL C;  2RA4 A;  5I4D A;  2R7F A;  3RD4 A;  4N9P A;  1V1O A;  3RN5 A;  2K52 A;  4LF9 Q;  4R4C A;  3ULP A;  1ZYR C;  1WTP A;  5CV9 A;  1SYE A;  3E6Z X;  2K04 A;  1IBK Q;  1A3U A;  2NVT B;  2F3V A;  2EDG A;  4DAY A;  3BJU A;  1EWH A;  4ID6 A;  4HMI A;  3I73 A;  1TWG B;  2UUB L;  2AQ3 B;  4APV A;  4BBS H;  1ESF A;  1VQ4 A;  1GKH A;  2PYK A;  4JOI C;  5A2Q E;  3HOW B;  3RN2 A;  1F2Y A;  3P1H A;  3V2T A;  5J39 A;  3NK9 A;  2ASB A;  1UNS A;  1K3B C;  1XNR L;  2EYL A;  2KCM A;  4LAA A;  4CDF C;  3HEJ A;  4NXM Q;  2EYM A;  2M9V A;  1E3P A;  2EY1 A;  4DV3 Q;  2Q2U A;  2F0V A;  4POG A;  1XMQ L;  1D8L A;  3SVM A;  4X66 Q;  2HCC A;  4EQN A;  1UEA B;  4C2M H;  1Y1W B;  1QVG A;  4A3J G;  1GUG A;  1SEB D;  4B3M Q;  3TS2 A;  2IW3 A;  1AN8 A;  2RDG A;  2MNA A;  1YIJ A;  4KHZ A;  1QIL A;  1Y1V B;  5GAH C;  1JQY D;  1TWA H;  4X3K A;  2V4D A;  4FNF A;  3K0X A;  1Z9F A;  3F2U A;  4RCN A;  2R92 H;  1EOV A;  3HOV G;  1PZJ D;  2E76 C;  2K7V A;  2GVA A;  3J7A 5;  5DEH A;  2FMC A;  3AQQ A;  3U4Z A;  1DCZ A;  3I90 A;  4JI4 L;  4I65 A;  2F0M A;  1G8Z D;  2OT2 A;  1BOS A;  2AWO A;  3ER0 A;  2VQE Q;  1STB A;  4YCV A;  1HQM C;  1ROD A;  5FKA C;  3MTS A;  3HP3 A;  1NR2 A;  1S72 A;  4ILW A;  2EQS A;  2AQ1 B;  3M4Q A;  4XT3 B;  4JI0 L;  4KY6 A;  1YNN C;  1OXS C;  4TRD A;  1XMO L;  3KJO A;  2XRS D;  5KYI A;  1WFQ A;  2Y0S E;  1NUC A;  1WD1 A;  4JVZ A;  1IBM L;  4DV2 Q;  5EBC A;  3J80 L;  1BNZ A;  3S1N B;  1UE7 A;  3S2D H;  1JOO A;  5AJ3 Q;  3GQB A;  2LKV A;  5IGE A;  4B3T L;  3SGI A;  4A3B B;  1GUS A;  4AQY Q;  1SSO A;  3JAM L;  1CZG A;  1MD2 D;  2RQX A;  1I3Q B;  2BOS A;  3J81 E;  1TS4 A;  1CKN A;  3PV0 A;  1D5X C;  1Q1E A;  1HNX Q;  3ONA B;  4RHR A;  2WAQ G;  4Y52 H;  3GTK H;  2PQA A;  2NBF A;  3M4P A;  2E2J B;  4WJ4 A;  3Q22 A;  3TME A;  2K5D A;  1CA6 A;  2IX0 A;  1HZC A;  1S5C D;  3K7U C;  1WTO A;  3ND8 A;  2UUA Q;  4DV7 Q;  1CHP D;  1JOQ A;  3KF6 B;  2B39 A;  3CC7 A;  1WI5 A;  2WB1 G;  3S15 H;  3K5N A;  1SMY C;  1VQK A;  4A3M H;  2HIX A;  3FPP A;  5CC4 A;  5JEA H;  2UXC L;  2E8G A;  1KQS A;  4C3H G;  4A3E H;  3VR4 A;  5EJW A;  2HHH L;  3TSS A;  1DXM A;  2F0D A;  2H1E A;  1B3Q A;  3EIV A;  4JI8 L;  1EEI D;  2WII B;  3V05 A;  1IYV A;  3HKZ E;  1QVF A;  2M00 A;  1K83 H;  3K80 C;  3J7Z C;  4XQN A;  4DUY Q;  4LUZ A;  1U9R A;  2N8N A;  4J6H A;  2MO0 A;  1BBU A;  1EY4 A;  2D5D A;  2K14 A;  4R4O A;  1QJO A;  1WCM H;  3PUY A;  5BN3 A;  4QL5 A;  1PH5 A;  4RG1 A;  3U9S A;  2L55 A;  4RKB A;  1B3A A;  1RHP A;  1HCZ A;  1ILQ A;  3DM1 A;  2F52 A;  4BY7 H;  2CCZ A;  4IFD I;  1VMP A;  1X32 A;  2ZXO A;  3HOX B;  1GD7 A;  2KEN A;  5IYC G;  2LS0 1;  2RBM A;  2IX1 A;  2EYJ A;  2K03 A;  2PMZ B;  4QIW B;  2L4N A;  3I2Z A;  3I4M B;  4A3D B;  1BO0 A;  3PF5 A;  1HNZ Q;  2I46 A;  3KK7 A;  2R7Z B;  4ZYS A;  2CW0 D;  4DR7 Q;  1HFG A;  1TY0 A;  5C4J H;  2N49 A;  3IFD A;  1PV4 A;  4P71 A;  2ALY B;  1VQ5 A;  3NXW A;  4QUC A;  3A7L A;  2VUM B;  1GHK A;  4ZCK A;  2A73 B;  3M3Y H;  1H9S A;  1VF5 C;  2A68 C;  1PTO D;  1E24 A;  1P16 A;  4K5V A;  4RA8 A;  5I2Y A;  1XPO A;  1EQV A;  2X69 A;  3MXP A;  3G71 A;  1I4X A;  4C56 C;  1HA5 A;  2JN4 A;  3KLS A;  3HRZ C;  5T1I A;  3I4N H;  3K57 A;  3BYY B;  2K50 A;  3T51 B;  1N34 Q;  4JI6 L;  3OW7 A;  5JVG 3;  4Q5V A;  3SK6 A;  4BY1 H;  2K5V A;  5DM7 3;  3FKI H;  4TSS A;  1H9K A;  5GAG C;  1A3V A;  3NEL A;  1XWE A;  2V1C C;  1HNW Q;  2BA0 A;  1LT3 D;  4LFB L;  3ERS X;  2MHV A;  1PTO F;  5KRU A;  2L11 A;  2YTY A;  2AKW B;  1VMC A;  5M3F H;  3K7A H;  2Q2T A;  4MTN A;  4JI2 Q;  4K2L A;  2L0C A;  2TMP A;  3NTI A;  5LL6 X;  5D65 A;  5IWA Q;  3TP5 A;  2JA7 H;  3IKJ A;  3NUC A;  3M4Y A;  2D0P A;  4IN3 A;  2VW9 A;  1RTN A;  2X6G A;  1ENF A;  4NXN L;  1PH9 A;  1JCK B;  1A6X A;  2ZTC A;  3SR1 A;  1F9S A;  1TII D;  4XTC S;  1BF4 A;  4OWW B;  2EIF A;  2GN5 A;  2Q2H A;  1JT8 A;  3W1G A;  2MJ8 A;  2YTV A;  1HRJ A;  3CD6 A;  2RSN A;  1B8A A;  4BBR G;  4FDB A;  4DK3 C;  1V8Q A;  1PFS A;  4IFD H;  1ZYR D;  2VQF Q;  4O0A A;  5KEE A;  5FLX L;  2HQE A;  2VNU D;  2EVB A;  5IY0 A;  1JWU D;  2NVQ H;  1PRT C;  2DJG C;  1G2T A;  4RWS C;  2JA6 H;  5EKI A;  1H9J A;  2RVL A;  1FR3 A;  1OO9 B;  3S17 B;  5M9O A;  2ES2 A;  2HT1 A;  3CC4 A;  1CKM A;  2QA4 A;  3NQT A;  3KDF A;  1B4O A;  1SMX A;  2SNM A;  4LUV A;  4AYB E;  4A3G G;  4JK1 C;  3NBH B;  2KA7 A;  4RHS A;  1F2Z A;  1J8I A;  2ZJQ A;  2WKC A;  4C3J H;  1VQD A;  1LV9 A;  1SNP A;  2CQO A;  4X62 L;  2ZM6 L;  4KY7 A;  1MSG A;  3FEW X;  3CCQ A;  2VS1 A;  3VA7 A;  4HCE A;  1AZP A;  1L0Y B;  3GP7 A;  4M8A A;  4BWG B;  2PPB C;  3UE0 A;  2O5I C;  1SNC A;  2WFW A;  4KHP Q;  3S14 H;  4OXP A;  1Y1V H;  4BBS B;  3LWE A;  4DR1 L;  3OMC A;  4BS9 A;  3MXN B;  5F2D A;  4N9T A;  2JA9 A;  3D6W A;  3DM3 A;  1VQG A;  2RDH A;  4KTA A;  4LMQ D;  4DV0 Q;  3LWU A;  2E5L Q;  4G4K A;  2MO1 A;  1WYD A;  5CR3 A;  4FXK C;  5T1G A;  5IGD A;  1K73 C;  1AP0 A;  1B1Z A;  4IUU A;  1XXG A;  3Q8D A;  2HDM A;  1MKH A;  2OTL A;  5M3M B;  3CMA A;  2L9H A;  3MEH A;  2MP1 A;  5ELN A;  4JI7 L;  4C2M B;  2ZJR A;  4YHH Q;  2R6G A;  1IBL Q;  1YIT A;  4GNX C;  1EFI D;  3MFY A;  3K6O A;  3CCU A;  4OX9 L;  4EQP A;  3K59 A;  4QCL A;  5JJL A;  4UP8 A;  4GOP A;  1YNN D;  5C44 G;  2R92 B;  3P75 A;  1FGB D;  2CWP A;  3CPW A;  1IYJ B;  4LF7 Q;  1IL8 A;  2B2Y C;  3O13 A;  2UXB Q;  5C3W A;  3H94 A;  5JPN C;  4PMW A;  3Q23 A;  2QW7 A;  2JA8 G;  2AUJ D;  4MHE A;  1QNK A;  2JSO A;  1Q81 C;  1XYI A;  3I72 A;  1S3O A;  4UDU C;  5CV6 A;  4G7O C;  5FO8 B;  4POF A;  2B8G A;  1H9M A;  2E2D C;  4BXX G;  4NDX A;  5J3B A;  1XTC D;  1B50 A;  4DKA C;  2XRQ D;  1X3Q A;  4LF8 L;  4CJ2 C;  3I4O A;  1OXX K;  1UE5 A;  2G5D A;  4A3K H;  2CFM A;  5K36 H;  3GTQ H;  2DNE A;  2LSS A;  3S2D B;  1TKW B;  3BVG A;  1Y14 B;  3HG9 A;  3D0F A;  1HQR D;  1SMY D;  1Q8K A;  5COY A;  3ZYY X;  3A0J A;  3HOY H;  3T4A C;  4DAM A;  2EZV A;  5DM6 3;  2F4I A;  4GNX A;  1W2B A;  1C0A A;  4KD3 A;  4JBM A;  1L1O A;  2F1M A;  2NZ1 D;  1VQA A;  4ALP A;  3GTK B;  4IPD A;  1YJW A;  3Q0A A;  2F4V Q;  1TR5 A;  1H95 A;  2D0O A;  1MIU A;  3QR8 A;  4E6I A;  1MHW C;  3EVQ A;  3RZO H;  1KNA A;  1MBY A;  2NUC A;  5KNC A;  2ZTE A;  2UXD L;  4ME5 A;  1G29 1;  1S4Z A;  1ASY A;  2B2Y A;  3PCO B;  4X64 L;  3ERQ A;  1ILP A;  1EU4 A;  2DN8 A;  4GZY C;  1FNV A;  1WVL A;  1TY2 A;  1RL2 A;  3S15 B;  4J1M A;  4YWL A;  4A3M B;  3NPP A;  3K5L A;  1V1P A;  1SRU A;  1Q8I A;  3BU2 A;  3UDF A;  2F0H A;  2RSO A;  1WTV A;  4A3E B;  2NVY H;  4A3F H;  1RF2 D;  4OIK A;  4P75 A;  3BVZ A;  1CZW A;  3X3M A;  1WTR A;  2PI2 E;  4G7H C;  1KDA A;  3E3X A;  4XYO A;  3LX0 A;  5IT9 L;  3R8B A;  2WB1 E;  1K83 B;  1XTD A;  4K8I A;  3T56 B;  4JV5 Q;  4YY3 Q;  4ZLT F;  1EY7 A;  1KXL A;  1EZ6 A;  4A3C G;  3S24 A;  4IUR A;  2QDL A;  3CCL A;  4A75 A;  2L5T A;  2F0U A;  3S1Q H;  2D62 A;  2XIW A;  3HOZ G;  2J0T D;  3TQY A;  3UDI A;  3IL8 A;  2OXP A;  1A15 A;  4MZ9 A;  3FVQ A;  1QUQ A;  2K33 A;  3EFX D;  2E2H H;  1EYD A;  4P73 A;  1WCM B;  1X3G A;  1JC7 A;  2NVX H;  5C3E G;  3HOU G;  3CPF A;  1U0L A;  1GHJ A;  4BY7 B;  1X65 A;  2A68 D;  1A2U A;  2UUC L;  4DPG A;  5I9O A;  5C4H A;  1PXU A;  2B2V A;  5IGG A;  5JOB A;  2KHJ A;  3SXH A;  3RNU A;  1FL0 A;  4JYA Q;  5JPM C;  2JYO A;  5J22 A;  4DNI A;  1HTL D;  5JEA J;  4GKJ L;  2VL6 A;  4A93 H;  3A55 A;  3MWY W;  2EYH A;  1GUT A;  3NQI A;  4FF4 A;  4DAV A;  3GTO H;  5EAY A;  5C4J B;  1FJG Q;  3OOC A;  1N33 Q;  1QCB D;  5FLM G;  2B63 G;  2B29 A;  1II3 A;  4HIO A;  3NHH A;  4DR3 L;  3I3C A;  3KOJ A;  3DEP A;  1KDB A;  2J4X A;  1NR4 A;  5E4W C;  1I4H A;  1BKB A;  4JBJ A;  3H09 A;  3OTO L;  4A3L G;  3NTK A;  3M3Y B;  1PH4 A;  1EIY B;  3CC2 A;  5IE8 A;  3UDG A;  3GTL B;  4KK7 A;  1JR0 D;  5E3F A;  3DWQ A;  3H3V I;  3EBE A;  2QKI C;  4PQX A;  4LJZ C;  1EIH A;  2EYP A;  3I4N B;  3PSI A;  2OCE A;  3PIO 3;  3S2H H;  2KCN A;  2MPM A;  3QWN A;  4BY1 B;  1EY6 A;  3FKI B;  5IP9 G;  2EJG C;  1IL2 A;  2JQO A;  4KLK A;  2LXK A;  1PDQ A;  1KL9 A;  1NBW A;  1YBY A;  3U9O A;  1PRT D;  5M3F B;  2C9O A;  3D31 A;  3QG1 A;  4R4Q A;  3A7A B;  4DV5 Q;  1PH6 A;  1CK1 A;  2K6A A;  4H44 C;  3J81 c;  4KHV A;  3A74 A;  4A4I A;  1GVP A;  3FHW A;  2FMM A;  2I07 B;  4UP7 A;  1UWV A;  1Q12 A;  5DAU A;  4QY7 A;  2F0T A;  2BCO A;  4GN4 B;  3KYH C;  1PRT F;  4DK6 C;  3CCM A;  2CH4 A;  1OXU A;  4XT1 B;  4NPS A;  5IGF A;  3BZC A;  2NVQ B;  5LMU L;  4LF5 L;  4HAE A;  3J7A F;  1HFN A;  3SHL A;  4EQO A;  2JA6 B;  1E2V A;  3IAY A;  3FDT A;  1LTA D;  2LMC B;  3CAM A;  4DV3 L;  4UY8 C;  2B2U C;  4KY5 A;  3SK8 A;  1KAW A;  4U68 A;  1WD0 A;  4C3J B;  4NP5 A;  3DWP A;  3QIA A;  5M3M H;  4NB3 A;  4K6L A;  3B6Y A;  2O5J C;  4NW2 A;  1J5E L;  1HH2 P;  1EU3 A;  2UUB Q;  3LNN A;  1Q46 A;  4DUZ L;  4A3I G;  3H3V H;  2YYZ A;  1CSP A;  3OWE B;  1F9Q A;  1Y69 U;  1CT1 D;  3S14 B;  3M85 A;  1XNR Q;  4QGU A;  4JG2 A;  2D2C C;  4H02 A;  4O1N A;  5CGK A;  5GAE C;  1DD2 A;  4N8F A;  4IFD J;  4LW1 A;  3H0G B;  3BZK A;  1SLJ A;  2R93 B;  3DXJ C;  4IUQ A;  1L0X B;  1XMQ Q;  4FF1 A;  4DU9 A;  1DM0 B;  2NN6 I;  1D1I A;  3URY A;  1SYD A;  3MAQ A;  2VQE L;  1NCV A;  1I50 B;  4J8Q A;  2G9H D;  2R3Z A;  3H15 A;  1N8R C;  3HOV H;  2K5W A;  3TBI B;  3N52 A;  1ICW A;  1S5F D;  5L37 A;  3MFG A;  3M9B A;  4JOI A;  1S5D D;  1O7L A;  4V19 0;  1TWC H;  3D3R A;  1MJE A;  4DR2 L;  1WJJ A;  4IJH A;  2B2U A;  3F2B A;  2ZXR A;  2Y0S B;  5C3X A;  1A63 A;  2GA4 B;  4F88 A;  1TVX A;  2I5M X;  3OMG A;  1VCI A;  2Z0S A;  3T1H L;  4JI4 Q;  3A5Z B;  4IUV A;  4X65 L;  2HIV A;  2PNR C;  5CV5 A;  1HHV A;  1WTW A;  3PF4 A;  1B44 D;  4WFN 3;  1HNX L;  2EPB A;  1HZ9 A;  2K5H A;  1NSN S;  5JVH 3;  3BZD B;  1CM9 A;  3GV6 A;  4FF2 A;  4JI0 Q;  4JI3 Q;  1XMO Q;  4U67 3;  3CF5 A;  3CP0 A;  1IHZ A;  2JEB I;  1NTG A;  3NWS A;  5I6Y A;  1IBM Q;  1OXT A;  1RD9 D;  4L5T A;  1QZG A;  1HXY D;  5ELO A;  2K1B A;  3HKS A;  4TVA B;  4A3K B;  1TS3 A;  3GTQ B;  3G7L A;  1I4P A;  1FYC A;  4LWC A;  4L5R C;  5M5X H;  4ZRZ A;  1XPU A;  4KMU C;  1JOK A;  1K8A C;  2PCF B;  3ERO A;  2JA5 G;  1SJH D;  3GO5 A;  4P72 A;  1IZ6 A;  3I56 A;  3JAM c;  3HOY B;  4JBW A;  1KC8 C;  3WOE A;  5KYL A;  1WTQ A;  2L1B A;  4RGO S;  3C1F A;  4B08 A;  2EJM A;  1SR3 A;  5EKK A;  2EE1 A;  1Q7Y C;  3HKZ B;  2NN6 H;  3FMC A;  4R9W A;  2RDF A;  1HTP A;  4B9X A;  1QZH A;  5CV7 A;  4C3H H;  1NMG A;  3RZO B;  4KN4 C;  4GLA C;  1X56 A;  1X54 A;  2IPK D;  4GKK L;  4WOR A;  3OYY A;  5IOC A;  1DOL A;  3MXN A;  3I4L A;  1Q3L A;  4FO2 A;  4IZ8 A;  3DWA A;  4IUP A;  4OO1 G;  3OHX C;  3KJP A;  1AE3 A;  1EUJ A;  3BDL A;  5FOB B;  2QDB A;  2HHH Q;  1SXT A;  3EN2 A;  3PO3 B;  2HD3 A;  4JI8 Q;  2F0O A;  4F8M A;  4B9W A;  1WOC A;  2NVY B;  4A3F B;  3CME A;  4DAY B;  1N36 Q;  5IYD H;  3EJI A;  1SNM A;  1HNZ L;  1N9W A;  3E9H A;  3TDQ A;  1ZXT A;  4DGZ A;  4X6A H;  3ND9 A;  3W3A A;  1VQ9 A;  3D4D A;  5AFW A;  5EKL A;  3R2T A;  2A1A A;  4DFA A;  3CRK C;  3IFT A;  2FIN B;  1D1K A;  2XVS A;  3QO2 A;  4G7Z C;  3S1Q B;  2KJX A;  1D5Z C;  1WTH A;  4K0K L;  5FK9 C;  5IYC H;  5C0X G;  1CTM A;  4X3U A;  2E2H B;  3D4W A;  2NVX B;  3R93 A;  2KEC A;  3K81 C;  4DR5 L;  4IPG A;  4EVO A;  3GTL H;  3BG3 A;  4BA1 I;  3D6C A;  2P5Z X;  5ISR A;  1VQ7 A;  2MQH A;  2IT1 A;  2EXD A;  2IWH A;  1IYU A;  3OSO A;  1QG7 A;  1PVO A;  4BA2 I;  1M4V A;  1TS2 A;  3TRE A;  3LGJ A;  1HNW L;  1D2B A;  2CVR A;  4A93 B;  1IW7 C;  2B2T C;  2RF4 A;  1ASZ A;  3ITP A;  1G6P A;  1G91 A;  2F0S A;  5IYB G;  4C3I G;  2RCF A;  3Q24 A;  3GTO B;  4TQU S;  3RUZ A;  1Q1B A;  1K9M C;  4KN7 C;  1IKL A;  4LUO A;  3NP8 A;  1XX8 A;  1PH1 A;  4V0B A;  2PNH A;  3STB C;  1C7Y A;  1T5E A;  3KF8 A;  4PZ7 A;  3E9I A;  3GTG H;  5IP7 G;  3AYH B;  1LYL A;  1AFP A;  1EL0 A;  3J80 E;  2JA7 G;  4LF4 L;  1DOK A;  2XN9 C;  3PO2 B;  3SK5 A;  2BA1 A;  4JI6 Q;  1YJ9 A;  3TEH B;  4JBK A;  1T5X D;  2VQF L;  1GJX A;  4RGN A;  1B53 A;  2BDN A;  3JAM E;  3S2H B;  4ULL A;  5I2X A;  4RH6 A;  3U50 C;  2PW7 A;  4OHJ A;  2DY8 A;  2MGS A;  1Y8N B;  4YIJ A;  1JE4 A;  1SFO B;  2NYZ D;  5IGB A;  3HZX A;  1HR0 Q;  5D14 A;  3KUP A;  1SN8 A;  3J7Y W;  3SE0 A;  1CKN B;  2IHE A;  2JP1 A;  4BBR H;  4CHT B;  1K8G A;  3HOW G;  3R3O A;  5GQO A;  3FPU B;  4NXN Q;  3HGB A;  3L2P A;  4DK0 A;  1XNQ L;  5FJ8 G;  2PQA B;  4AYB B;  1PH7 A;  1JIC A;  3CHB D;  4ZKC B;  4K2K A;  4DR6 Q;  1SE3 A;  3T53 B;  1C9O A;  3DEO A;  2NTT A;  4L5S A;  2A6H C;  4RGM A;  4XIG S;  3PIP A;  1M8A A;  4GN3 B;  3CKI B;  5C4X B;  1Y1W G;  5I9P A;  4GS3 A;  1LT5 D;  2EYF A;  3OIP A;  3SK4 A;  1Q90 A;  3GDE A;  3K5O A;  4CJ0 B;  4CGY B;  2R7D A;  2F0Q A;  4HJA A;  2E5L L;  3PGZ A;  5E7N A;  1DOM A;  1Y1V G;  1U4P A;  3H0G H;  1MI2 A;  2Z6B A;  1N32 L;  3G6E A;  2R93 H;  1A62 A;  4IUT A;  4X62 Q;  4PMC A;  4Y7N H;  2ZM6 Q;  3MA2 B;  1A0I A;  4DR4 Q;  4KKU A;  3OW2 A;  3VA5 A;  1I50 H;  2ZT9 C;  3T16 A;  1QVC A;  3VYU A;  1GOZ A;  1UUP A;  4M1U B;  1HZA A;  4R8N A;  1E0B A;  4DNT B;  3GTJ H;  1Y8O B;  3TN2 A;  1ML0 D;  2KVM A;  1E22 A;  1SE2 A;  5IGC A;  5CMD A;  3J81 i;  4GN5 A;  2F3I A;  1YI2 A;  2OEO A;  2WAC A;  1X3P A;  1R9T H;  2ZJP A;  2UXB L;  4JI5 L;  3BS1 A;  5CBA E;  5JJI A;  2LY7 A;  4XQQ A;  4A3J B;  4X3T A;  1YHQ A;  1F2M A;  3H91 A;  4DK1 A;  2E75 C;  4QJF A;  5EQ0 A;  5I6W A;  1VQP A;  1HJP A;  3AB9 A;  2KUM A;  4JI7 Q;  2BH8 A;  4A3B G;  3V96 A;  1PA6 A;  1BCP B;  2EXZ A;  2ICI A;  3SDZ A;  3ICE A;  4RGT A;  1S5E D;  2F0F A;  4QMG A;  2Z6K C;  3HOV B;  5C5M A;  1EY5 A;  3A54 A;  1ESR A;  4DXG A;  3TS0 A;  1HUN A;  4LFC Q;  4QF4 A;  5IOD A;  1XJV A;  1EWI A;  1H9S B;  1TWC B;  1TT2 A;  2VB2 X;  2JA8 H;  4CDC C;  1FNW A;  3MEF A;  2OF1 A;  5DNF A;  4RMF A;  4HID A;  4CKB A;  5JJK A;  3RZD H;  4CKC A;  1SDF A;  1X55 A;  1ONL A;  4BXX H;  1O80 A;  3W1B A;  3CXC A;  2QGQ A;  2Q2I A;  4PZ6 A;  2PZU A;  2RHQ B;  1NE3 A;  1VQO A;  1ENC A;  1LTB D;  4DN4 M;  1DGS A;  3KLW A;  2XSC A;  1ENA A;  5M5W B;  1B70 B;  1LTL A;  5ELF A;  4LF8 Q;  2FXQ A;  1ZKO A;  3P20 A;  4RFB A;  3KBX A;  2B3G A;  4LF6 L;  4X3S A;  1A2T A;  4AH6 A;  5EGT A;  4PG3 A;  2IX3 A;  1E7Z A;  1PZK D;  3NE5 B;  5FLX E;  2QF7 A;  2WAQ E;  5C4Z A;  1ICF B;  2WAQ B;  2EOT A;  1SYB A;  3PO3 H;  5M5X B;  1I4R A;  3NWT A;  1T9H A;  5LHY 1;  4EGV A;  2A74 C;  4CBV A;  4MIU A;  2F0P A;  2DGY A;  5A2Q L;  2F0I A;  4OGQ C;  2Z6K A;  5EPK A;  3S1M H;  4HIK A;  4IOA A;  1YNJ C;  1O78 A;  1PTO H;  2DJF C;  3L9A X;  5BR8 L;  1EFW A;  2BH2 A;  2A5H A;  3HOX G;  2F0N A;  3A8J E;  4DV4 Q;  1NAP A;  2WB1 B;  3KLR A;  2UXD Q;  1BR9 A;  1U4M A;  4DXF A;  1D5M C;  3I4M G;  1JWM D;  4XQJ A;  4A3D G;  4C3H B;  2LFN A;  1PFB A;  2R7Z G;  1YVC A;  2CQA A;  3J7A V;  1UE6 A;  3W5O A;  3DUZ A;  4DV1 L;  3S9W A;  4QQB X;  3GV3 A;  3T1Y Q;  4A3C H;  3GTM H;  4JI1 L;  1EQR A;  2K5Q A;  2VUM G;  4DV6 Q;  2ZTD A;  4GLV B;  3F8T A;  4JC0 A;  2CKZ B;  2F0L A;  2Z4H A;  2MFI A;  3HOZ H;  4WJW A;  4JYA L;  3AEV A;  4IAL A;  3MXG A;  1JJC B;  5HGT A;  1TWH B;  4F87 A;  2EYO A;  2XWJ B;  1AZQ A;  5C3E H;  2OWO A;  3HOU H;  4NMZ A;  4R8I A;  4K8J A;  1VQM A;  4ABN A;  1IW7 D;  2DY7 A;  4LFA L;  2B2W C;  3JAM i;  4XDX A;  3AU7 A;  2PO4 A;  2UU9 L;  3CQZ H;  2NB0 A;  1I94 L;  4B3R L;  1LTR D;  1AE2 A;  2JJQ A;  3CRL C;  4B3S L;  3WWV A;  1PRT B;  3T13 A;  4K5W A;  3STB D;  4JPB W;  1MSH A;  5FO7 B;  1GUW A;  3PO2 H;  4N8X 1;  5FLM H;  3ULL A;  2A19 A;  5LMN Q;  1BUV T;  4GOP B;  1MGS A;  4CJ1 B;  1SYC A;  3G48 A;  3MZ5 A;  1TWF H;  1EYG A;  4KKS A;  2AQ2 B;  2GVB A;  4DR3 Q;  1VDZ A;  4WRD A;  3J81 L;  3CU7 A;  1IXR A;  1I4Q A;  2I5H A;  3OTO Q;  2C5C A;  1SFO H;  1F9P A;  1YHB A;  5EPL A;  3VYS A;  1Y8P B;  5C6A A;  5FO9 B;  3TP8 A;  3KF6 A;  1U4L A;  2OQ0 A;  3ULJ A;  5HUR A;  5IP9 H;  1B9M A;  5JAV A;  3GTG B;  2NZO A;  4IUN A;  1GM5 A;  2WIN B;  4LF9 L;  2E2I B;  4TKO B;  3EA6 A;  2XNA C;  1STG A;  1PYW D;  4RAU C;  4HJ8 A;  1O7Z A;  2YTX A;  4UP9 A;  1IBK L;  3S1R H;  2IY5 B;  2RHS B;  1FGU A;  2PZW A;  3K58 A;  2B2W A;  2IJ0 A;  2A6H D;  5C4X H;  2KHI A;  4CDE C;  1K8M A;  2F03 A;  4P2C B;  2A69 C;  2KCT A;  3L3O C;  3VR6 A;  1DZ1 A;  2EJF C;  4GNX B;  4O42 A;  4NXM L;  4BBS G;  1Z6H A;  3BDO A;  4BBR B;  1L1O B;  1B9N A;  1KIX A;  1LM0 A;  1VQJ A;  4HSP A;  4IQZ A;  1YZ6 A;  2LXJ A;  1HUM A;  1H9R A;  1STY A;  2AUK A;  4X66 L;  4OEM B;  1K0S A;  1KAA A;  2H4O A;  3UDX A;  3OWF A;  4B3M L;  1SNQ A;  1YJN A;  1X9N A;  4YCU A;  2Q8R E;  5M3M G;  1PFN A;  4YCW A;  3G4S A;  4IO9 A;  4ZUJ A;  5LMU Q;  2K75 A;  4LF5 Q;  3M7G A;  4A3G B;  1LTG D;  2QEJ C;  5M5Y H;  1RCV D;  1Q82 C;  3D4R A;  1V1P B;  5IT9 E;  1F9R A;  4ODG A;  1LTI D;  1HA6 A;  1G51 A;  2DNC A;  1Z7T A;  4EQ5 A;  3VR2 A;  5K5P A;  3X3N A;  4A3J H;  2R92 G;  4A3I H;  2HCI A;  4Y7N B;  1PHJ A;  1J5E Q;  4KJN A;  1HZB A;  4HMJ A;  1UAP A;  3OPO A;  5D3I B;  1NJI C;  3M4O B;  4DUZ Q;  3A5U A;  1QUQ B;  2CHB D;  1B7Y B;  4K6D A;  3GTJ B;  1J6Q A;  1FD7 D;  1VQC A;  2IHF A;  4IJL A;  3NBI A;  4OEL B;  1X3F A;  2F0E A;  1KTK A;  4DV2 L;  1GXD C;  2YV5 A;  1NNX A;  2H5X A;  5AJ3 L;  2XTI A;  1R9T B;  4OWT B;  1KLU D;  4I7Z C;  4IPH A;  1BQQ T;  4AQY L;  3VR3 A;  2OTJ A;  2K01 A;  1ET6 A;  1G2S A;  4K14 A;  3U4V A;  4DF7 A;  1DYQ A;  4OO1 I;  1SYF A;  1GUN A;  2ENB A;  4L5Q A;  4F7X A;  3VYT A;  1BXT A;  3VDY A;  2JXM B;  1C8C A;  3Q6S A;  4KJO A;  4JI3 L;  5C44 B;  4G57 A;  1CA5 A;  3G6J B;  2WP8 J;  2Q8T A;  5M5W H;  2EY5 A;  4JW0 A;  4OON A;  3PIP 3;  4DR2 Q;  1CQF A;  4NKL A;  5HGQ A;  1XPR A;  2UUA L;  5CV4 A;  5IIF A;  4MN3 A;  4DV7 L;  4DNR B;  2X6L A;  2JA8 B;  3T1H Q;  4L8J A;  4X65 Q;  3H3V C;  4B3T Q;  2O4X A;  3AFP A;  3J80 c;  1EY0 A;  3S16 B;  5C0X I;  3RZD B;  3F1Z A;  3PMF A;  2HUG A;  4HJ7 A;  1VQN A;  1NY4 A;  1I6H H;  3BDC A;  3NBH A;  1TXY A;  4PZ8 A;  1VQ8 A;  1EIG A;  2SEB D;  4A3M G;  5JEA G;  1L2F A;  1CSQ A;  5J1Z A;  4A3E G;  4RCO A;  4DUY L;  1E2W A;  1K0R A;  4Q0F A;  1YNJ D;  3L7Z C;  1VQ6 A;  1BCP C;  2JA5 H;  2NN6 G;  3E0J A;  2ICE C;  3AFQ A;  2VXW A;  3NSW A;  5GAD C;  2IL8 A;  3DMU A;  1KRS A;  2G9D A;  1HR0 W;  2KOL A;  3TRZ A;  4S3S A;  2R61 A;  3PIO A;  2UXC Q;  4EX5 A;  1Q86 C;  1RKN A;  1O7I A;  1K3R A;  1L0W A;  2YU9 H;  2BE5 C;  1N36 L;  4I7A A;  1WCM G;  4XYQ A;  1LTT D;  5NUC A;  1I4G A;  1PLF A;  3S1M B;  5KIX A;  4KI0 A;  1RTO A;  1D6E C;  4BY7 G;  1PTO B;  3FP9 A;  3CCR A;  5IYD G;  2NWG A;  4DR7 L;  4OO1 H;  2K4K A;  1TWH H;  2KHS A;  5GRO A;  3CCV A;  1LLR D;  1YNX A;  4GKK Q;  3RLN A; 
#chains in the Genus database with same CATH homology
 3D8G A;  1C48 A;  1IKM A;  3A56 A;  2PQE A;  2K32 A;  2J7Z A;  2EY6 A;  1S5B D;  5C5L A;  1SND A;  3GTM B;  2SNS A;  2Z8L A;  1CQV A;  3HOZ B;  1RDP D;  1QB5 D;  5TSS A;  3QJY A;  5C0X H;  3E5S A;  3RLF A;  1EEF D;  1STH A;  2F0G A;  3KLS X;  2K05 A;  3P7J A;  2A6E C;  3WOF A;  1K8O A;  4HCS A;  5C3E B;  3HOU B;  4ZK9 B;  5ELC A;  4HTH A;  4PMB A;  4DAP A;  4FP5 D;  1JB3 A;  3NTH A;  4H13 C;  5EBD A;  3CQZ B;  3BYT B;  2KQ3 A;  1TU2 B;  3PUW A;  1RJT A;  2BDO A;  4HSV A;  3MC0 B;  1EY9 A;  3QOJ A;  4K5X A;  4C1N I;  3N6R A;  2F3W A;  2L12 A;  2Z4I A;  2B63 B;  1PZI D;  4DA2 A;  3C3L A;  1BBX C;  1TWF B;  1QOH A;  4HED A;  2WKD A;  2PZT A;  4IFD G;  1PMR A;  4ZKB B;  2JEA I;  3AMU A;  2A69 D;  4C1N K;  5BN4 A;  3TZD A;  1LT4 D;  1I6V C;  5KGU A;  5ELD A;  4Z9C B;  2B2T A;  4C3J G;  3S1R B;  3SEB A;  3KBG A;  3UI2 A;  1EYC A;  3FRP B;  1LT6 D;  3QOL A;  3WDN A;  3PUX A;  4QUF A;  4FF3 A;  1EZ8 A;  1WTX A;  2O2L D;  1SAP A;  1JWS D;  5EPJ A;  2PW5 A;  1KDC A;  1J9O A;  2HDL A;  5CYU A;  1CI3 M;  4KV6 A;  1W6J A;  4QB4 A;  1VF7 A;  2RKS A;  5A35 A;  1HPC A;  3MXU A;  1SE4 A;  2NTS A;  4PNY A;  1V43 A;  4HR7 B;  1ET9 A;  1STA A;  2E74 C;  1W6K A;  4XXE A;  5M5Y B;  3I70 A;  5E1F A;  1R4P B;  5ELB A;  3I8Z A;  2F0J A;  1G6Z A;  5BN5 A;  1STN A;  1TS5 A;  2B8F A;  4A3I B;  1ZEQ X;  3QB3 A;  4ZUI A;  1LO5 D;  3K5M A;  1KLG D;  1SBB B;  2QCP X;  1TWA B;  2MUY A;  2SDF A;  2SOB A;  5ELE A;  1LAC A;  2ZXP A;  3MHB A;  1OXV A;  5K36 G;  1STE A;  2TSS A;  1KNE A;  2D9U A;  4L63 B;  5D3D A;  1EOT A;  5LL6 S;  3HS0 C;  1BCP D;  1BDO A;  4LK1 C;  1CHQ D;  3GD7 A;  1JOR A;  4OL7 A;  1E2Z A;  3A8I E;  4PV1 C;  4UAI A;  1PFM A;  2ID0 A;  2KCC A;  3C46 A;  3VR5 A;  1I6H B;  2KED A;  3W2D A;  2BE5 D;  2B2V C;  1EQT A;  1BCP F;  3K0Y A;  3OIQ A;  3C2P A;  1KAB A;  1F77 A;  1QWY A;  2KEE A;  2JE6 I;  4FYD A;  5CBE E;  3RMH A;  3BVM A;  2JA5 B;  3TP6 A;  2FJ2 A;  3H6M A;  2WV6 D;  5KND A;  3TP7 A;  2N88 A;  4FXG C;  2YU9 B;  3PUV A;  2Q8I B;  1A3T A;  1SYG A;  4FVM A;  3MVV A;  4L6T B;  1AEX A;  1CFM A;  2EY2 A;  4OIJ A;  4KD4 A;  2A6E D;  1B2T A;  1DJR D;  5E4X A;  1TQO A;  3VYR A;  2N55 A;  3GTP B;  4H0L C;  1SJE D;  1GUO A;  1LTS D;  4HN7 A;  2F0K A;  2QIL A;  4CKE A;  1LAB A;  2VB3 X;  2CW0 C;  3R2I A;  3C1E A;  1R4Q B;  2M2L A;  5KNB A;  3DHQ A;  1F2L A;  1AW7 A;  1U4R A;  5G3L D;  1EY8 A;  4ZQ3 A;  4H7B A;  3I91 A;  1PTO C;  1SNO A;  1C4Q A;  4FXD A;  1DON A;  3M7N A;  2Z1C A;  4ZAI A;  3A8K E;  2AWN A;  5COR A;  2XWB B;  5JJZ A;  1QNU A;  5G3L F;  1FNU A;  4KKT A;  2F0W A;  4C3I B;  1QE6 A;  2FFK B;  3TZU A;  1O7Y A;  4RKL A;  5CV8 A;  2FHT A;  3PUZ A;  2K28 A;  1Z47 A;  3K7A B;  2JA7 B;  5C0X J;  1EYA A;  1EWC A;  3EQL C;  2RA4 A;  5I4D A;  3RD4 A;  4N9P A;  1V1O A;  1ZYR C;  1WTP A;  5CV9 A;  1SYE A;  3E6Z X;  2K04 A;  1A3U A;  2NVT B;  2F3V A;  2EDG A;  4DAY A;  1EWH A;  4ID6 A;  4HMI A;  3I73 A;  1TWG B;  2AQ3 B;  1ESF A;  2PYK A;  5A2Q E;  3HOW B;  3V2T A;  1F2Y A;  3P1H A;  5J39 A;  3NK9 A;  1UNS A;  2EYL A;  4LAA A;  3HEJ A;  2EYM A;  2M9V A;  2EY1 A;  2F0V A;  3SVM A;  2HCC A;  4EQN A;  1UEA B;  1Y1W B;  1GUG A;  1SEB D;  2IW3 A;  1AN8 A;  2RDG A;  4KHZ A;  1QIL A;  1Y1V B;  1JQY D;  4X3K A;  2V4D A;  4FNF A;  3F2U A;  4RCN A;  1PZJ D;  2E76 C;  2K7V A;  5DEH A;  2FMC A;  1DCZ A;  3I90 A;  4I65 A;  2F0M A;  1G8Z D;  2OT2 A;  1BOS A;  2AWO A;  1STB A;  1HQM C;  1ROD A;  5FKA C;  3MTS A;  3HP3 A;  1NR2 A;  4ILW A;  2AQ1 B;  4XT3 B;  4KY6 A;  1YNN C;  1OXS C;  4TRD A;  2XRS D;  5KYI A;  1NUC A;  1WD1 A;  5EBC A;  3J80 L;  1BNZ A;  3S1N B;  1JOO A;  3GQB A;  2LKV A;  5IGE A;  4A3B B;  1GUS A;  1SSO A;  3JAM L;  1CZG A;  1MD2 D;  2RQX A;  1I3Q B;  2BOS A;  3J81 E;  1TS4 A;  3PV0 A;  1D5X C;  1Q1E A;  3ONA B;  4RHR A;  2NBF A;  2E2J B;  3Q22 A;  3TME A;  2K5D A;  1CA6 A;  2IX0 A;  1S5C D;  1WTO A;  3ND8 A;  1CHP D;  1JOQ A;  2B39 A;  3K5N A;  1SMY C;  3FPP A;  5CC4 A;  5JEA H;  4C3H G;  3VR4 A;  5EJW A;  3TSS A;  1DXM A;  2F0D A;  2H1E A;  1EEI D;  2WII B;  3V05 A;  1IYV A;  2M00 A;  4XQN A;  1U9R A;  4J6H A;  1EY4 A;  2D5D A;  1QJO A;  3PUY A;  5BN3 A;  3U9S A;  2L55 A;  4RKB A;  1B3A A;  1RHP A;  1HCZ A;  1ILQ A;  3DM1 A;  4IFD I;  1VMP A;  1X32 A;  2ZXO A;  3HOX B;  2LS0 1;  2RBM A;  2IX1 A;  2EYJ A;  2K03 A;  2PMZ B;  4QIW B;  2L4N A;  3I4M B;  4A3D B;  1BO0 A;  2I46 A;  3KK7 A;  2R7Z B;  4ZYS A;  2CW0 D;  1HFG A;  1TY0 A;  3IFD A;  3NXW A;  4QUC A;  3A7L A;  2VUM B;  1GHK A;  2A73 B;  1H9S A;  1VF5 C;  2A68 C;  1PTO D;  4K5V A;  4RA8 A;  5I2Y A;  1EQV A;  2X69 A;  3MXP A;  1I4X A;  4C56 C;  1HA5 A;  3KLS A;  3HRZ C;  5T1I A;  3K57 A;  3BYY B;  3T51 B;  3OW7 A;  5JVG 3;  4Q5V A;  3SK6 A;  5DM7 3;  4TSS A;  1H9K A;  1A3V A;  1XWE A;  2BA0 A;  1LT3 D;  2MHV A;  1PTO F;  5KRU A;  2L11 A;  1VMC A;  4K2L A;  2L0C A;  2TMP A;  3NTI A;  5LL6 X;  5D65 A;  3TP5 A;  3IKJ A;  3NUC A;  3M4Y A;  4IN3 A;  1RTN A;  2X6G A;  1ENF A;  1JCK B;  1A6X A;  3SR1 A;  1F9S A;  1TII D;  4XTC S;  1BF4 A;  2MJ8 A;  1HRJ A;  2RSN A;  1V8Q A;  4IFD H;  1ZYR D;  5KEE A;  5FLX L;  2HQE A;  2VNU D;  2EVB A;  1JWU D;  1PRT C;  1G2T A;  4RWS C;  5EKI A;  1H9J A;  2RVL A;  1FR3 A;  1OO9 B;  3S17 B;  5M9O A;  3NQT A;  1B4O A;  2SNM A;  4JK1 C;  2KA7 A;  4RHS A;  1F2Z A;  1J8I A;  2WKC A;  1LV9 A;  1SNP A;  4KY7 A;  1MSG A;  3FEW X;  3VA7 A;  4HCE A;  1AZP A;  1L0Y B;  3GP7 A;  4M8A A;  4BWG B;  2PPB C;  2O5I C;  1SNC A;  4BBS B;  3LWE A;  3OMC A;  4BS9 A;  5F2D A;  4N9T A;  3D6W A;  2RDH A;  4KTA A;  4LMQ D;  3LWU A;  4G4K A;  5CR3 A;  4FXK C;  5T1G A;  5IGD A;  1AP0 A;  1B1Z A;  4IUU A;  1XXG A;  2HDM A;  5M3M B;  2L9H A;  3MEH A;  2MP1 A;  4C2M B;  2R6G A;  1EFI D;  3MFY A;  3K6O A;  4EQP A;  3K59 A;  4QCL A;  1YNN D;  2R92 B;  3P75 A;  1FGB D;  1IL8 A;  2B2Y C;  3O13 A;  5C3W A;  3H94 A;  5JPN C;  4PMW A;  3Q23 A;  2AUJ D;  4MHE A;  1QNK A;  2JSO A;  1XYI A;  3I72 A;  4UDU C;  5CV6 A;  4G7O C;  5FO8 B;  2B8G A;  1H9M A;  2E2D C;  4NDX A;  1XTC D;  1B50 A;  2XRQ D;  1X3Q A;  4CJ2 C;  1OXX K;  5K36 H;  2DNE A;  3S2D B;  1TKW B;  3BVG A;  3HG9 A;  1HQR D;  1SMY D;  5COY A;  3ZYY X;  3T4A C;  2EZV A;  5DM6 3;  2F4I A;  4KD3 A;  2F1M A;  2NZ1 D;  3GTK B;  3Q0A A;  1TR5 A;  4E6I A;  3EVQ A;  1KNA A;  1MBY A;  2NUC A;  5KNC A;  4ME5 A;  1G29 1;  1S4Z A;  2B2Y A;  3ERQ A;  1ILP A;  1EU4 A;  2DN8 A;  4GZY C;  1FNV A;  1WVL A;  1TY2 A;  3S15 B;  4J1M A;  4A3M B;  3NPP A;  3K5L A;  1V1P A;  1Q8I A;  2F0H A;  2RSO A;  1WTV A;  4A3E B;  1RF2 D;  4OIK A;  3BVZ A;  1CZW A;  3X3M A;  1WTR A;  4G7H C;  1KDA A;  4XYO A;  3LX0 A;  5IT9 L;  3R8B A;  4K8I A;  1K83 B;  3T56 B;  4ZLT F;  1EY7 A;  1EZ6 A;  4IUR A;  2L5T A;  2F0U A;  2D62 A;  2XIW A;  2J0T D;  3IL8 A;  2OXP A;  1A15 A;  3FVQ A;  2K33 A;  3EFX D;  1EYD A;  1WCM B;  1JC7 A;  1GHJ A;  4BY7 B;  2A68 D;  1A2U A;  5I9O A;  5C4H A;  1PXU A;  2B2V A;  5IGG A;  5JOB A;  3SXH A;  5JPM C;  2JYO A;  5J22 A;  1HTL D;  5JEA J;  3A55 A;  3MWY W;  2EYH A;  1GUT A;  3NQI A;  4FF4 A;  4DAV A;  5C4J B;  3OOC A;  1QCB D;  1II3 A;  3NHH A;  3I3C A;  5E4W C;  3DEP A;  1KDB A;  2J4X A;  1NR4 A;  1I4H A;  3H09 A;  3NTK A;  3M3Y B;  3GTL B;  4KK7 A;  1JR0 D;  5E3F A;  3DWQ A;  2QKI C;  4PQX A;  4LJZ C;  1EIH A;  2EYP A;  3I4N B;  3PIO 3;  2KCN A;  2MPM A;  3QWN A;  4BY1 B;  1EY6 A;  3FKI B;  2EJG C;  1PDQ A;  3U9O A;  1PRT D;  5M3F B;  2C9O A;  3D31 A;  3QG1 A;  3A7A B;  1CK1 A;  2K6A A;  4H44 C;  4KHV A;  2FMM A;  2I07 B;  1Q12 A;  5DAU A;  2F0T A;  2BCO A;  1PRT F;  1OXU A;  4XT1 B;  5IGF A;  2NVQ B;  4HAE A;  3J7A F;  1HFN A;  3SHL A;  4EQO A;  2JA6 B;  1E2V A;  3IAY A;  3FDT A;  1LTA D;  2LMC B;  2B2U C;  4KY5 A;  3SK8 A;  4U68 A;  1WD0 A;  4C3J B;  4NP5 A;  3DWP A;  3QIA A;  4K6L A;  2O5J C;  4NW2 A;  1EU3 A;  3LNN A;  2YYZ A;  3OWE B;  1F9Q A;  1Y69 U;  1CT1 D;  3S14 B;  3M85 A;  2D2C C;  4O1N A;  5CGK A;  1DD2 A;  4IFD J;  3H0G B;  2R93 B;  3DXJ C;  4IUQ A;  1L0X B;  4FF1 A;  4DU9 A;  1DM0 B;  2NN6 I;  1D1I A;  3URY A;  1SYD A;  3MAQ A;  1NCV A;  1I50 B;  4J8Q A;  2G9H D;  2R3Z A;  2K5W A;  3TBI B;  3N52 A;  1ICW A;  1S5F D;  3MFG A;  1S5D D;  1O7L A;  4V19 0;  3D3R A;  2B2U A;  2ZXR A;  2Y0S B;  5C3X A;  2GA4 B;  4F88 A;  1TVX A;  1VCI A;  3OMG A;  4IUV A;  2PNR C;  5CV5 A;  1HHV A;  1WTW A;  1B44 D;  4WFN 3;  2EPB A;  1NSN S;  5JVH 3;  3BZD B;  1CM9 A;  3GV6 A;  4FF2 A;  4U67 3;  1IHZ A;  2JEB I;  3NWS A;  5I6Y A;  1OXT A;  1RD9 D;  1HXY D;  2K1B A;  4A3K B;  1TS3 A;  3GTQ B;  3G7L A;  1I4P A;  1FYC A;  4ZRZ A;  4KMU C;  1JOK A;  2PCF B;  3ERO A;  1SJH D;  3GO5 A;  3HOY B;  4JBW A;  3WOE A;  5KYL A;  1WTQ A;  2L1B A;  4RGO S;  3C1F A;  4B08 A;  2EJM A;  5EKK A;  2EE1 A;  3HKZ B;  2NN6 H;  3FMC A;  4R9W A;  2RDF A;  1HTP A;  4B9X A;  5CV7 A;  3RZO B;  4KN4 C;  2IPK D;  4WOR A;  5IOC A;  1DOL A;  3MXN A;  3I4L A;  1Q3L A;  4FO2 A;  4IZ8 A;  3DWA A;  4IUP A;  4OO1 G;  3OHX C;  3BDL A;  5FOB B;  3PO3 B;  2QDB A;  1SXT A;  2F0O A;  4F8M A;  4B9W A;  2NVY B;  4A3F B;  3EJI A;  1SNM A;  3TDQ A;  1ZXT A;  4DGZ A;  3ND9 A;  3W3A A;  3D4D A;  5AFW A;  5EKL A;  3R2T A;  4DFA A;  3CRK C;  3IFT A;  2FIN B;  1D1K A;  2XVS A;  3QO2 A;  4G7Z C;  3S1Q B;  2KJX A;  1D5Z C;  5FK9 C;  5C0X G;  1CTM A;  4X3U A;  2E2H B;  3D4W A;  2NVX B;  3R93 A;  2KEC A;  4EVO A;  3BG3 A;  4BA1 I;  3D6C A;  5ISR A;  2IT1 A;  2IWH A;  1IYU A;  3OSO A;  1QG7 A;  4BA2 I;  1M4V A;  1TS2 A;  1D2B A;  2CVR A;  4A93 B;  1IW7 C;  2B2T C;  3ITP A;  1G91 A;  2F0S A;  4C3I G;  3Q24 A;  3GTO B;  4TQU S;  3RUZ A;  1Q1B A;  4KN7 C;  1IKL A;  3NP8 A;  1XX8 A;  4V0B A;  1T5E A;  3KF8 A;  1AFP A;  1EL0 A;  3J80 E;  1DOK A;  2XN9 C;  3PO2 B;  3SK5 A;  2BA1 A;  1T5X D;  1GJX A;  4RGN A;  1B53 A;  2BDN A;  3JAM E;  3S2H B;  4ULL A;  5I2X A;  4RH6 A;  2PW7 A;  4OHJ A;  2DY8 A;  2MGS A;  1Y8N B;  4YIJ A;  1JE4 A;  1SFO B;  2NYZ D;  5IGB A;  3HZX A;  5D14 A;  3KUP A;  3J7Y W;  3SE0 A;  2JP1 A;  4CHT B;  3R3O A;  3FPU B;  3HGB A;  4DK0 A;  4AYB B;  1JIC A;  3CHB D;  4ZKC B;  4K2K A;  1SE3 A;  3T53 B;  3DEO A;  2NTT A;  2A6H C;  4RGM A;  4XIG S;  1M8A A;  3CKI B;  5C4X B;  5I9P A;  1LT5 D;  2EYF A;  3OIP A;  3SK4 A;  1Q90 A;  3K5O A;  4CJ0 B;  4CGY B;  2F0Q A;  1DOM A;  1U4P A;  1MI2 A;  4IUT A;  4PMC A;  3MA2 B;  4KKU A;  3VA5 A;  2ZT9 C;  3T16 A;  3VYU A;  1GOZ A;  1UUP A;  4M1U B;  4R8N A;  1E0B A;  4DNT B;  1Y8O B;  3TN2 A;  1ML0 D;  2KVM A;  1SE2 A;  5IGC A;  5CMD A;  2OEO A;  2WAC A;  1X3P A;  3BS1 A;  5CBA E;  2LY7 A;  4XQQ A;  4A3J B;  4X3T A;  1F2M A;  3H91 A;  4DK1 A;  2E75 C;  5EQ0 A;  5I6W A;  3AB9 A;  2KUM A;  3V96 A;  1BCP B;  2EXZ A;  2ICI A;  3SDZ A;  4RGT A;  1S5E D;  2F0F A;  4QMG A;  3HOV B;  5C5M A;  1EY5 A;  3A54 A;  1ESR A;  4DXG A;  1HUN A;  4QF4 A;  5IOD A;  1H9S B;  1TWC B;  1TT2 A;  2VB2 X;  1FNW A;  2OF1 A;  5DNF A;  4CKB A;  4CKC A;  1SDF A;  1ONL A;  1O80 A;  2PZU A;  1ENC A;  1LTB D;  4DN4 M;  2XSC A;  1ENA A;  5M5W B;  5ELF A;  1ZKO A;  3P20 A;  4RFB A;  3KBX A;  4X3S A;  1A2T A;  5EGT A;  2IX3 A;  1PZK D;  3NE5 B;  5FLX E;  2QF7 A;  5C4Z A;  2WAQ B;  2EOT A;  1SYB A;  5M5X B;  1I4R A;  3NWT A;  5LHY 1;  4EGV A;  2A74 C;  4CBV A;  4MIU A;  2F0P A;  5A2Q L;  2F0I A;  4OGQ C;  5EPK A;  1YNJ C;  1O78 A;  1PTO H;  3L9A X;  2A5H A;  2F0N A;  3A8J E;  1NAP A;  2WB1 B;  3KLR A;  1BR9 A;  1U4M A;  4DXF A;  1D5M C;  1JWM D;  4XQJ A;  4C3H B;  2LFN A;  1PFB A;  2CQA A;  3J7A V;  3DUZ A;  3S9W A;  3GV3 A;  2K5Q A;  2F0L A;  2Z4H A;  4WJW A;  4IAL A;  3MXG A;  5HGT A;  1TWH B;  4F87 A;  2EYO A;  2XWJ B;  1AZQ A;  4NMZ A;  4R8I A;  4K8J A;  4ABN A;  1IW7 D;  2DY7 A;  2B2W C;  4XDX A;  3AU7 A;  2PO4 A;  2NB0 A;  1LTR D;  3CRL C;  1PRT B;  3T13 A;  4K5W A;  1MSH A;  5FO7 B;  1GUW A;  1BUV T;  1MGS A;  4CJ1 B;  1SYC A;  3MZ5 A;  4KKS A;  2AQ2 B;  1VDZ A;  4WRD A;  3J81 L;  3CU7 A;  1I4Q A;  2C5C A;  1F9P A;  5EPL A;  3VYS A;  1Y8P B;  5C6A A;  5FO9 B;  3TP8 A;  1U4L A;  5HUR A;  1B9M A;  5JAV A;  3GTG B;  4IUN A;  2WIN B;  2E2I B;  4TKO B;  3EA6 A;  2XNA C;  1STG A;  1PYW D;  4RAU C;  1O7Z A;  3K58 A;  2PZW A;  2B2W A;  2IJ0 A;  2A6H D;  1K8M A;  2F03 A;  4P2C B;  2A69 C;  3L3O C;  3VR6 A;  1DZ1 A;  2EJF C;  4O42 A;  1Z6H A;  3BDO A;  4BBR B;  1B9N A;  4HSP A;  4IQZ A;  1HUM A;  1H9R A;  1STY A;  2AUK A;  1KAA A;  2H4O A;  3OWF A;  1SNQ A;  2Q8R E;  1PFN A;  4ZUJ A;  3M7G A;  4A3G B;  1LTG D;  2QEJ C;  1RCV D;  3D4R A;  1V1P B;  5IT9 E;  1F9R A;  4ODG A;  1LTI D;  1HA6 A;  2DNC A;  1Z7T A;  3VR2 A;  5K5P A;  3X3N A;  2HCI A;  4Y7N B;  4KJN A;  4HMJ A;  1UAP A;  3OPO A;  5D3I B;  3M4O B;  2CHB D;  4K6D A;  3GTJ B;  1FD7 D;  3NBI A;  2F0E A;  1KTK A;  1GXD C;  1R9T B;  1KLU D;  4I7Z C;  1BQQ T;  3VR3 A;  2K01 A;  1ET6 A;  1G2S A;  4K14 A;  4DF7 A;  1DYQ A;  4OO1 I;  1SYF A;  1GUN A;  2ENB A;  4F7X A;  3VYT A;  1BXT A;  2JXM B;  1C8C A;  3Q6S A;  4KJO A;  5C44 B;  4G57 A;  1CA5 A;  3G6J B;  2WP8 J;  2Q8T A;  2EY5 A;  3PIP 3;  1CQF A;  4NKL A;  5CV4 A;  5IIF A;  4MN3 A;  4DNR B;  2X6L A;  2JA8 B;  4L8J A;  3H3V C;  2O4X A;  1EY0 A;  3S16 B;  5C0X I;  3RZD B;  3PMF A;  2HUG A;  3BDC A;  3NBH A;  1EIG A;  2SEB D;  5JEA G;  5J1Z A;  4RCO A;  1E2W A;  4Q0F A;  1YNJ D;  3L7Z C;  1BCP C;  2NN6 G;  3E0J A;  2ICE C;  2VXW A;  3NSW A;  2IL8 A;  3DMU A;  2G9D A;  2KOL A;  4S3S A;  2R61 A;  1RKN A;  2BE5 C;  4XYQ A;  1LTT D;  5NUC A;  1I4G A;  1PLF A;  3S1M B;  5KIX A;  4KI0 A;  1RTO A;  1D6E C;  1PTO B;  2NWG A;  4OO1 H;  2KHS A;  1LLR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...