3PUZA

Crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
370
structure length
370
Chain Sequence
b'ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
total genus 88
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puzA01
5FJ8G 3CNOA 3GJXC 3S2HH 3UANA 1RC8A 3CX8A 2JEOA 1NMFA 2ZITA 3IO5A 1VMAA 3AM1A 1JJVA 4ZCLA 3KL4A 2A19A 1WP9A 1ZRHA 3BAFA 3KQNA 3EIVA 1W36B 3OAAD 1ZC3A 4GP7A 2ZUCA 1G4AE 2QGZA 4Q4AA 4Q9LA 3SYKA 3R8CA 1BDOA 3UE1A 5IK2D 4X62Q 2DN8A 2H5XA 3SQXA 3AB9A 5JWOA 2V8OA 2LKCA 3KUDA 2K33A 2R7FA 3Q5EA 4QC2A 3I5XA 4TZ0A 4A3KG 4EQ6A 4FI3C 1AE3A 4IEEA 4JI3Q 4DEXA 2IXFA 1H9SA 3K81C 3GEEA 1NLYA 2A6ED 2G77B 3WHLA 1KDOA 2I4IA 1KO7A 2J7KA 2R6CA 5AUQA 4AYWA 1WFQA 3L0OA 3A1SA 3LW7A 2OCBA 1F48A 2D7CA 3HJNA 2IS4A 3VFDA 1LF0A 1EYGA 3HOXH 2XB2A 3HDTA 4WW0A 5FOWA 3H2YA 1XU4A 2ZI4A 2OFOA 3U50C 3KKMA 2C95A 1FQJA 4MYHA 3SS8A 2NIPA 1KRSA 1S0UA 3NKVA 2B63G 1HR0L 3UDFA 2DWPA 1KKMA 5J4LA 4ERNA 2UXBQ 5FLMG 2QM7A 4Q1AA 3RDPA 4A6XA 4DC9A 4KODA 3SFZA 2FEMA 5SZJA 4GKJL 4XSHA 1E2GA 1YZUA 3U4QA 2ZIAA 3K70C 4PZZA 2OBNA 2WIBA 4C0SA 1ZAKA 2VS1A 2N49A 3A5UA 1N6KA 2CXXA 2GCPA 4AYBG 1Z29A 2W2VA 1E9FA 2WPDD 4OBEA 3ZQJA 2IX3A 1T0JB 3S1MH 4BFYA 3GLIB 4DXAA 2K4KA 4RD3A 2IX0A 3A7LA 2ZTEA 1A2KC 4DV1Q 2VA8A 2XXAA 4KBFA 2HT1A 4DR4L 4UJ5A 3QG5A 3BU2A 4IFEA 4JZKA 1E1OA 4Q9KA 3UK6A 2J5XA 1R5NA 1NMYA 4HDQB 4M1KA 2L15A 1OJLA 4A15A 1FUUA 2YWHA 2RHSB 4URWR 5AJYA 2VUMH 5EZ6B 2IYQA 3UXMA 1KAOA 4L5TA 3BGWA 1ZIOA 4K81B 2GF0A 4PAOA 1V9PA 1CJVC 1U99A 2Q2HA 2QAJA 1E2VA 4P3YA 3MJHA 3GJ8A 2WKQA 5HCNA 2ONJA 3UE0A 4HAUA 4A92A 2A6HD 2GXAA 1SKYB 2P3SA 5AR1A 3ZYCA 1ZM2A 1IBMQ 4URVR 4RD4A 2GDJA 4D4MA 4GOXA 3STBD 1HH2P 1C0AA 2QAGC 4P32A 2N42A 3A8KE 1XTDA 1BMFD 1XJCA 4QRHA 1J7KA 4W5JA 5K8IA 2J7PA 3IDQA 4O2LA 4LHZA 1GAJA 2EYQA 2IA5A 3SC3A 4BFVA 1QUQA 1SXJD 2QTFA 2F3IA 2F4VQ 3TH5A 4JBXA 3N6RA 1ONBA 2ZI5A 5CM8B 1S4QA 3A58B 3QXCA 4TTPA 2CL7X 2PCFB 4TN1A 4P31A 2B6HA 4LF9Q 3RWOA 3CPFA 3I73A 3BG3A 4A0HA 2Y0SE 2J46A 3A1UA 4JYCA 5IP7H 1KI2A 2JA6G 3CMAA 3ECCA 3QKRA 1W36D 1PZNA 1Y14B 4CGZA 1G9XA 1W4RA 3DZ8A 1DVRA 3QUSA 1ZKOA 1Q1QA 2REXB 5EP1A 5GVRA 4B6EA 1W2BA 4FMCF 3W9YA 4PTLA 3KQUA 3CC2A 4AIIA 2JLZA 4OHWA 1BBWA 4Q7KA 5L3SB 4UKDA 4LF8L 1X56A 1OIWA 2RGDA 3JAMc 1RYHA 3HOVH 3CH4B 4YHHQ 1CSQA 4MRRA 2ZE7A 3JVVA 2CWAA 2I3BA 2ZJ8A 4Q48A 4B3RQ 4NCHA 3VTKA 4PC7A 3CW2A 4Q9IA 4NPHA 2A9KA 4A2WA 5IYDG 1S3OA 3UMRA 1JJGA 3CRVA 4K0KL 4ILEA 1M7BA 5L3QB 4JV5Q 5KPDA 2IS2A 1DADA 3P32A 4D0GA 1E32A 1YITA 2J7PD 1FP7A 2ZT9C 5JHGB 2BE5C 2NO9A 2P5TB 3K70B 5H68A 3CCEA 1XMSA 3BH0A 3KTAA 1E69A 2FE4A 5EE0A 4Z51A 4GOKA 1VG9B 4CEIA 3MLEA 3NTUA 1G17A 5DYGA 4V03A 4L5SA 5G3YA 4B44A 3UIEA 5SZHB 4A3KH 1VG1A 1R0ZA 4NXML 1A62A 1FPMA 5FBVB 4JBYA 1WBDA 1TWHH 1GUNA 3OF5A 2ANCA 2PQAB 1W48A 4UPAA 1QG4A 2UVQA 4BY7H 1Q46A 1H8HD 1VQ4A 1KYIA 5FOXA 1IN8A 2O8CB 4NZYA 3NH6A 4YWMA 4CEHA 5J4HA 4OHZA 4Q1DA 1B9NA 5LDDC 4W5HA 4C0KA 3EZ6A 2VP2A 1P60A 2B63H 2QBYB 1GOTA 3MRSA 4FWIB 4DT1B 3RZOH 1TQ6A 4ZCMA 2Y8EA 4KKUA 1BYUA 1KOFA 1R5OA 4M4SA 5FLMH 3W5IA 4B3ML 3GTGH 1R0YA 3RHFA 2V1UA 4YDHB 221PA 1Z5ZA 4TZ6A 2NGRA 4U02A 2B7BA 2QAGB 4IVPA 5KSZA 4AY2A 2G1JA 4ZCIA 3R8FA 2I1VB 4Y7NH 3B1ZA 1NSTA 1E2IA 3I72A 2E5LQ 2YWGA 4RD6A 2ZI9A 4F7WA 4IO9A 4URZR 1LB1B 1GIAA 5JZVA 1WB9A 3CPJB 1Q3TA 1DELA 4KU4A 2A5FA 4QHTA 4NYJQ 3U2QA 3BFXA 4DLRA 1IY1A 2H57A 2Z83A 1XTKA 2GEUA 4BFSA 1KY3A 3MJRA 4A3LG 2PLRA 4OQLA 2UU9L 4D6PA 1H8EA 5JBQA 4RY2A 1R9TH 3JC66 4A3IH 5FOSA 1RE0A 5CITA 3RC3A 1JALA 2YZ2A 1ZD9A 1RRPA 4GN5A 2ZJBA 4ZO4A 1R4AA 4HJ5A 2IXGA 1WJJA 4A8JA 1E1RD 4QBGB 1D9XA 3SR0A 2A8VA 1HNXQ 2GAOA 3U4VA 2V54A 2ANBA 1UF9A 1XDBA 3LVQE 2F6RA 3GFOA 4DUZQ 5G41A 5HZKA 4AI6A 3HOYG 2PI2A 4YMTA 1II8A 2C9OA 1FMJA 3VNVA 4GZMA 4Q7MB 1JR3A 4KSCA 4AKIA 2R6FA 1R8SA 1CBUA 1PLJA 2D5DA 1Z6GA 4NCJA 1KI4A 3EQLC 1MJCA 2C5LA 1W2GA 3TVTA 1N5JA 1XB2A 2HXYA 4A3FG 1UADA 3KZ1E 3ADBA 1QHNA 3C8UA 5EUQB 3BZKA 1WCV1 4HLUC 3W8RA 4IOAA 1IYJB 4IOJA 2ORIA 4DDWA 3FKQA 1CKOA 5CB8A 2KHJA 4KHZA 3CC4A 4OHXA 1WOCA 2J3EA 2XJ4A 2JA8H 5EAYA 2H1LA 2ZS8A 4HB3A 4LHXA 3I7FA 2EWWA 4PHFA 3QF7A 3BWDD 1WDTA 4JSYA 4LWZA 3ZGXA 2JA6H 4BFWA 5KTYA 4JI2Q 4IFDI 2GJSA 1NIPA 4WXRA 2EFGA 3TQYA 5DGXA 2CL6X 4D26A 5K8LA 4EQ5A 3K70D 4C7OA 3TAUA 2XGJA 3HOWH 2HEIA 1TWGH 2VZAA 1QVAA 4WJ4A 3MWYW 4X8OA 5EUMA 1R10A 4DLSA 1QF9A 3T61A 2HT6A 1KI7A 3EAQA 4PO8A 3WMFA 1CXZA 2Q2UA 3HYRA 2QEQA 3KF6A 4DV5Q 1VDZA 3T1YL 4OKSA 1Z08A 1RW4A 1ANKA 1KMQA 1A63A 5BW8A 3NDBB 1GUAA 1C9KA 1XD8A 1P7CA 1UWVA 4H9GA 2XJ9A 2HLDA 4BLQA 4EFNA 2ZJAA 4WAUA 2PJRA 2ODBA 2R44A 5BQ5A 2IYTA 1C1YA 1XD2B 3CZPA 2PZEA 4LFAQ 4G0NA 2YYZA 3OW2A 1BYIA 2IUSA 5EP2A 4FN5A 3OZXA 4S35A 3OE7D 4G7OC 3K7AH 4PMWA 4A76A 4QBFA 4ZKEA 3NENA 2HCJB 3HPRA 1KL9A 4NTZA 1X1SA 2GVAA 1Y63A 4ME3A 1VQ6A 3J80c 1OIXA 2BBWA 1M1YE 1VF5C 3ICEA 1PYBA 1VQFA 1ONLA 1OFHA 2ZTSA 3F8TA 1NY5A 1MIUA 3O8CA 3W90A 1E0KA 4R9UC 1GRRA 2NZOA 4M1YA 5JSZB 4EPTA 1Q86C 4DNRB 4HR7B 1CP2A 4KO8A 4OK6A 4TQ9A 5GJWC 3D4RA 1FMLA 1MH1A 1PLKA 2QNRA 4LBWA 3M4PA 3U7EB 2H16A 3NG1A 3GTPH 1PJRA 1J99A 4BWYA 1JR6A 2QPOA 4E09A 3IEVA 2VQSA 4Q4JB 4B34A 3M7NA 2C35B 4QY7A 3DMDA 1XZPA 3B6EA 1BO6A 1K6MA 1KMHB 2KBFA 1EG7A 1US8B 3HKSA 2WJIA 1EFRA 2HCBA 1SFOH 3IO3A 3ONWA 1CKNB 1BKDR 3QEJA 1Q3HA 4JLDA 4DEYA 3KJEA 4PPQA 2BEKA 3DOFA 4DKXA 2GF9A 2ZRPA 2OHFA 3H84A 1ZM7A 5B2ZA 1HPCA 2QE7A 2ZSFA 3WNBA 2GESA 1D8LA 1E1TA 4ZI2A 1R2QA 5JS8A 3AQ4A 3HR7A 2XITA 3GDEA 2VEDA 3DMNA 4ASUD 2D4HA 2W58A 4Q9HA 1HNWQ 4B75A 2AUKA 2ZR0A 1G8GA 4U00A 1HQYE 4LV5B 1JJ2A 2UKDA 4B3TQ 3BK7A 3SJAA 4BUJA 1EOVA 3BDOA 1Z8FA 1KSGA 4A3LH 2QUZA 2D7DA 4PC1A 3T51B 4PZYA 4D2IA 3AVTA 2GEDA 5GAHC 1KO5A 1A82A 1P72A 1YE8A 2ZYVX 4K8OA 2H8KA 4TSFD 4XTCS 5HE9A 1E0SA 3AVOA 3H15A 1DAHA 3PCRB 1L0WA 2YV5A 1GL6A 2QPTA 4BGDA 3LNCA 3PUVA 1M1KC 2RGBA 2BE5D 2EVBA 4Q5IA 3HOYH 4GI7A 3OW7A 4B74A 2ZETA 2C8VA 2Q8IB 3K09C 4M9XA 2MQHA 1N2CE 1KKLA 3J81j 4GLAC 4DR7L 4NKRA 4OHVA 4LFCL 3A1WA 3T1HQ 1E24A 3X1ZA 5EE1A 4AG6A 1W5TA 3PITA 2HUPA 3I4NG 1OXVA 1RJ9B 2ZRFA 1EFRD 2ASEA 3FWYA 4MKHA 2BBOA 1OKKA 1VKJA 2BJVA 1I3QH 2FMXA 3K0EA 4A3FH 4URXR 5JEDA 2FH5B 4UXIA 5AUOB 2AR7A 4M1MA 1TQ4A 4YY3Q 4CVNA 1G5RA 1VYUA 4OGQC 121PA 5GADl 1E9AA 4IPHA 1ODFA 2E1RA 3BD9A 3SFVA 3R7WA 1MO6A 1GUTA 4WZ6A 1BS1A 1KK0A 5BYJA 1YZTA 2KHIA 3CBQA 5FPHA 2VPPA 1WCMG 1E99A 5HGQA 2PL3A 4I1UA 4L4UA 1S3GA 4ABYA 4M1OA 1LABA 1U0HC 3UDIA 4LF6L 3G6EA 4I4LA 1DG3A 1VQ5A 2VP5A 3HR8A 3EZFA 2BMDA 3PJRA 3QEOA 3CIOA 3NHAA 1BBUA 1NBMA 3K8YA 1R0WA 4JOIC 3H3VI 1O7LA 4GNXC 1VQLA 1U81A 1VG8A 2XSZD 3IQWA 3TRFA 1T5IA 1AA9A 4FDBA 3CF0A 2MSDB 2K5VA 5A0FA 4A3EH 1PH4A 3QOFA 3DXJC 3LO5A 3T5DA 2NMVA 5KNDA 3AEVA 1LS1A 3B85A 4B3FX 1NN3A 5LB2A 3TR0A 4JVLA 4RCZA 3UMFA 3FHCB 3FYHA 4TMTA 2RF4A 5DO9A 2WFWA 1KIXA 2FGKA 3EZ2A 1Y3AA 1Q8KA 4DCVA 4LF7L 1RFLA 4QGUA 2W2TA 2ATVA 2X2EA 3TVDA 5F98A 1NVUQ 1XTRA 5FBQB 4EFLA 2XAUA 5C4XH 1TNDA 4ZDJA 1EX6A 1QVFA 4IFDG 4EPWA 2JDIA 1VQOA 2G6BA 5C0XJ 3D8BA 4MH0R 4CYMA 3TRZA 3ETLA 3RNLA 1JB7A 4X65Q 2QEXA 1MT0A 4C3HH 3GTQH 1OHHD 2PPBC 4OONA 1G3QA 2Q6TA 1N32Q 1ZINA 3JZAA 4LDJA 3QXHA 4LBYA 4YCVA 3KQKA 2IHEA 4AIMA 4DR5Q 1U8AA 3CCQA 5B58C 3TBKA 4DV1L 2CCKA 2ZQ5A 3W6NA 4UQOA 2ZM6L 3BH6A 5DI3B 1GM5A 4LFBQ 5C2JB 4HUQA 4G3XA 4AYXA 2GZDA 3FKSA 1ZYRC 4DR2Q 2VQEL 1YR9A 2CBZA 2AHOB 3FGNA 2A30A 4PSAA 1NJIC 3CF6R 4DV7Q 4A9AA 3K0SA 1G51A 2C04A 2V1CC 2BJWA 3ZLJA 5KNBA 2CLDX 4LYJA 4LK1C 1ZNXA 2PLFA 2AKAB 2EDGA 3VHLB 2G1KA 4MYTA 1EIYB 2P6NA 4JI0L 2OBLA 1NBMD 1N6PA 3KDSE 4B43A 4KKTA 1SMYC 2P0EA 1TWAH 3RSLA 4MDEA 2YTVA 1IBML 2D62A 2PNRC 1G1MA 1HUQA 2HIXA 3NC1C 1V43A 1KD1C 3VR4A 2XNSA 1ZVQA 1L8QA 2O8EB 5LMNQ 1HY3A 2YINC 3CF5A 1Q12A 3CCSA 1KO1A 2CNWD 4V0MA 1HT1E 1S72A 1UFQA 3LLUA 3P1JA 4GL2A 2HHHQ 4P0TA 5H70A 2B3GA 1TU2B 1KAGA 4AKEA 3GFPA 4JYAL 2K32A 3K0XA 1NTGA 1VCNA 1YR7A 3F2DA 2F4VL 4NPSA 1E2HA 3CO5A 4MUBA 2HQLA 3H94A 2QG6A 2VL6A 3CRLC 2QP9X 3HYTA 1XXHA 1G3IA 3VA7A 2WB1E 1IN4A 1AQUA 4PO1A 4DDVA 4LF9L 3A8TA 3ZZTA 2NVTH 1VQJA 2VY3A 1KO4A 2KSQA 3C4JA 4IDOA 3FMFA 3RS2A 4XVUA 2P65A 2GNOA 2BMJA 2ONKA 1VQEA 3ZJYC 1TAGA 4BEJA 4AWXA 2WIAA 3AF1A 4JI5Q 3EG5A 5EP4A 3T12A 4NYIR 1XX6A 2XNDA 2ZSEA 1NI3A 4A3GG 3RS4A 1FNNA 1SXJC 2HIVA 4JBKA 4Q66C 4GT1A 5HKKD 1DXMA 1GITA 3Q5DA 5AJWA 4YC7A 4LV6A 3U6KA 1DOAA 1ZUHA 1D8TA 4R2IA 2ORWA 4RD1A 3T1VA 2FZ4A 4KFRA 3TAHA 4GFDA 4B3DA 1S3SA 5DHAA 3V4FA 2V7QD 3QJYA 2QZ4A 1E2EA 1UE5A 4NCNA 3U60B 1WI5A 1N25A 1VIYA 1W4AA 3MSXA 4R71A 3CUEF 2WOOA 4QM6A 3NEYA 2XGTA 1LY1A 3B9PA 2RH5A 3QSYA 4JV5L 5KSPA 1OFIA 4HZUA 3EW9A 2DNCA 4LUOA 4OQXA 3WYFA 4UP8A 1KI6B 4Y52H 3WRXC 3AUXA 1EUJA 2QGNA 2V9PA 1B23P 3Q9LA 4QXAA 2QSZA 3CPEA 4AC9A 1HQCA 3KXLA 5B30A 2ZJPA 1PYSB 5GVSA 3U7HB 4OI2A 4BXXG 4DR3Q 4PR0A 3ZD7A 5IT5A 2Z43A 4B3SQ 5FI1B 1SKQA 1ASZA 1E2WA 1Q57A 3K9NA 4N3NA 4PSKA 1YZKA 3ZS8A 3BE4A 2XEXA 2CL0X 3NHBA 3BIFA 1IBLQ 1XMQL 3BJIC 4X64L 2ZJYA 4JVSB 4QFMA 5CDFE 3IBYA 3EPJA 2QY9A 4M9SA 5E7NA 1TXYA 4DB2A 3PSIA 3GCGA 2R62A 3IFTA 4GNXA 2XNDD 2IF0A 1OB2A 4MYCA 1S96A 1U2RA 3OIWA 2VF7A 2ZUBA 4LUCA 1E2ZA 3VNUA 2D3WA 1YBYA 2BBSA 4A3BH 2PMZE 1N6NA 4JVMA 1IBRA 2C99A 3SBDA 4JLMA 4RKFA 2A5JA 4JKYA 3G5UA 3MXNB 4GS3A 1G8PA 2F1MA 2R7ZG 3Q85A 4HLQB 5IDVA 3T06B 2XTZA 4B47A 4DHEA 2CHVA 4DSOA 4Q1FA 4B2LA 4IFDH 3OAAA 1OXSC 4RVCA 4TWZA 3CX7A 3TQCA 2ECKA 3A4LA 4E22A 4U7DA 3NBZC 1VYVA 1TEVA 3I62A 2B21A 1OH8A 5IK2A 3LH5A 3CWQA 4DK0A 4PG3A 2E5LL 2W83A 4JLNA 4HEJA 1F2UA 2C96A 2FPMA 2NPIA 2XB4A 3UDXA 1QG2A 2UUBQ 2GA8A 2ZVQX 4HLCA 3WXMA 1OPXA 4YONB 4DR1L 8OHMA 4A82A 4RZ3A 2PEZA 4LJ4A 3RAPR 1E2JA 2V1XA 2UXCL 4JK1C 1OH5A 5FPYA 1Q7YC 1FX0B 5AWFC 3SOPA 3X2SA 2IYVA 2WKRA 1NJFA 4KVAA 1DE0A 2OCYC 2OM2A 2ZJQA 2IYLD 4LHVA 3U6BA 1TEXA 4LNQA 2JLQA 4YXWD 2D06A 4ZIRA 1QRAA 4C30A 3CCMA 1ESMA 2FSIA 3IHLA 2VP0A 3P4YA 4POFA 1SROA 4MGZR 5CLLA 2ZE8A 2ZROA 4DUZL 4GLVB 4WOPA 4KN7C 1I5FA 3VR6A 2RHQB 1E2LA 1EX7A 2QRNA 1SR3A 4G5RA 2CJWB 2Q0HA 2NG1A 3M6AA 1NVXQ 1T9HA 1FL9A 3AB3A 3KJPA 4HATA 3PO2G 4TYWA 4C0LA 1Q81C 2WHXA 1ZCAA 2GZHA 3KB2A 2F52A 2VLIA 1P16A 4MDFA 1X9NA 1F5NA 3O8RA 5HR5A 4XWOA 1X8KA 1GRQA 4FW9A 5JEEA 3HOUG 2OTJA 3BXZA 3L0IB 5LBIA 2JJ8A 1ZP6A 4A0RA 3IIMA 1JMCA 4DVGA 1ESNA 4BBSH 1WA5A 4OI1A 1NLZA 2JA1A 2RKOA 4KVGA 4L9SA 3AF4A 4IFBA 4Q4HB 1M7HA 1S1MA 3GLFE 5FUWA 4JI2L 1KI1A 4KLNA 4RZXA 1D9ZA 2N46A 3LWNA 3OHMA 1FX0A 2FSGA 5M5XH 2AXNA 4GOPC 3NBHB 1EWRA 3ZVMA 2HJGA 3AVPA 1QHSA 5FUVA 1K8GA 1HH4A 4YCUA 1F2TB 5E3HA 1HV8A 1XEXB 2OFXA 3CNNA 2DGYA 3D6TB 5JEAG 1BMFA 4RSGA 5UKDA 5ELOA 3LX5A 1OSNA 1N6HA 2ZAMA 3NEMA 3HU3A 2A5GA 3I8XA 3DPUA 2JLRA 4GNKA 1EXMA 4LHYA 4DRZA 1JXOA 4MRNA 1R0XA 1SXJA 2CKZB 3KFVA 2BA0A 5AJ3Q 4LX0A 1L1OC 1H9JA 4A3JG 4LF4L 4EPXA 5JCPA 3G0HA 3IQXA 3KX2A 3EA5A 3TLXA 1G7RA 3J7A5 1OFUX 2GWHA 3S15H 3L43A 1I6HH 4JL6A 4LJ6A 1K0RA 1QVGA 2BM1A 5DN6D 5IYCG 1ZYUA 1YZGA 4J0QA 2G88A 3ULLA 1G291 2BEJA 1V8QA 2K5UA 3K0CA 4PPGA 1VS0A 1PH5A 3GEHA 2PX0A 2QMEA 1N36Q 1JAHA 5L3VA 4JI6L 2IEZA 1OXXK 1JECA 2RHMA 1E9EA 3X1YA 3B82A 2NO6A 1MABB 4UXHA 4BRUA 1K8MA 1KIMA 3LGJA 4L15A 5JRJA 3FKIG 2A3RA 4N0DA 4CRWB 2W6JA 1P5ZB 4ON9A 2IY5B 3AVYA 5E7MA 1EWQA 3Q7QA 2I5LX 2KWIA 3AF2A 4B3CA 2GN5A 2XZLA 2PH1A 5K36G 4Q1BA 5FL3A 3A5ZB 3T15A 1NY4A 2CHGA 4Z8YA 2RGNC 2HF8A 2MMGA 5ANRB 4XWKA 4GBMA 2AK2A 2DWOA 5F3WB 3UPUA 2XTNA 2NVXH 3AF3A 3TK1A 3QNUA 3AH8A 3HPQA 4LRWA 3DM9B 4C0HA 1BOFA 5FH9A 3VQTA 2JLSA 1PFSA 5A5GA 5HY6A 2UZIR 1E6CA 3CPHA 1Y1WG 1XRJA 3WNDA 2NO7A 4O0MA 2ZU0C 3MWLA 2ZE6A 4FWTA 2GBLC 4JYBA 3W5OA 5KSYA 4EFMA 1W0KD 3CF2A 1GKHA 2Q9AA 5BYKA 4LI0A 2FFAA 2LWIA 3MMPA 3QXSA 5EP3A 2OLJA 1T3SA 3GLIA 3CR7A 4TYPA 1VHLA 1Z2AA 4H44C 4B3TL 2R8RA 4P4SB 3THOA 4X6AH 2IL1A 1ZU5A 3GTMH 4IDQA 2F1RA 1PH8A 1HZAA 1P2VA 3KJOA 1MABA 3L0SA 1H8HA 3CRRA 4NU0A 4V0KA 2BMEA 1JQLB 3K9LA 2K52A 4CT5A 2AXPA 2B8WA 4UP7A 4DSNA 4C9BA 2J9RA 4IPCA 1G8YA 1WQ1R 4BFTA 2TMKA 2CCZA 2W6JD 2MSCB 1Z0DA 1PA6A 4GOPB 3TS2A 2F1JA 5JWHA 1E1QD 621PA 4OK5A 4JI7Q 5JECA 1Y1VG 5LD2C 5D3MB 3GLGE 1XTSA 2MNAA 3HKZE 3RR5A 3T1HL 2I5HA 1LVGA 3ASYA 3UWKA 1HTPA 1XNRQ 4URUR 2CE7A 5FJ8H 1SULA 1AIPA 1T6NA 4HLDA 3ADDA 3F1ZA 3Q7PA 1ZUIA 3BERA 4GKKQ 2GAAA 1T8UA 4DCTA 1E3MA 3B9QA 3RN5A 1KJZA 1RYFA 1L1OB 3D31A 3I4OA 2WJJA 4OI4A 3LD9A 4YCWA 2WSSA 4JI1L 5EXPA 4A2PA 2WJYA 1X8JA 3LY5A 1G7TA 4LYHA 1QZXA 1CJUC 3IHWA 2OQKA 3MGCA 5P21A 1QVRA 3FHOA 3RS3A 2Q3MA 1DS6A 4BZXA 3VKGA 4BBRG 3PG5A 3A7AB 2CK3D 3HOZG 3AKYA 2BH2A 1M90C 4I99A 2QI9C 1Z07A 4JLVA 2QT0A 4DV2Q 4Q00A 4HIMA 5JJKA 2WAQG 4BFZA 4H13C 1E1RA 1Z3IX 3B7GA 3HP1A 2Z5FA 4QBIA 1EGAA 1DBSA 3VR2A 3WY9A 4B32A 3FMCA 3RABA 1LYLA 5L3RA 3D3QA 4MZ9A 4B73A 3NBFA 4MYUA 4DR6Q 2V6JA 3SEAA 1I50H 1VQMA 1TU4A 1Z6TA 3QXXA 4GMDA 5JEAH 1HTWA 5LMNW 1KSFX 2Z4SA 3EA0A 4C3IH 3MWJA 3FVQA 4GOPA 2OZEA 5HTKA 4DUGD 1WBBA 4LCBA 5L3SA 1QHYA 4OWWB 1E96A 3R20A 4KAXA 4IVQA 5CK4A 1AK2A 1C9OA 2LMCB 4A3JH 4L9WA 1UBEA 4AQYQ 5TV2A 1KXLA 1L4YA 4BEBA 1SVMA 2JA7G 4KKSA 1J6QA 2JLYA 3VDYA 4UY8C 4DLVA 5IYCH 1BKBA 1GZSA 4MRVA 2BMFA 5L3QA 2ZRGA 2BKUA 1YIJA 1P6XA 2GVDC 1MO4A 2UXDQ 2IC5A 2BM0A 3IGFA 5FOTA 4DK6C 1NVVR 4X65L 1IY2A 1G6HA 1TKWB 4KSBA 4TKOB 4DV6L 2WSSD 3LLMA 4TTRA 1RL2A 1W47A 5IRCD 1GL7A 2Z0MA 1PHJA 3LRPA 3FKIH 1E2MA 4WJ3M 3SU8A 3WYGA 1XZQA 2ATXA 3QPWA 3RC8A 3KKOA 3TSOA 4LFBL 4GZLA 4XD7A 2YNMA 1AS0A 1EWIA 4DR2L 3GFTA 1GG2A 1OYWA 1NNEA 2R65A 5K36H 4ESHA 1PV4A 4DV7L 2P67A 4LPSA 1DGSA 4JMPA 5DISB 4LJZC 3PQCA 2PQAA 5BN5A 5C4JH 2J45A 2AX4A 3S1AB 2J0SA 1FJGL 4M1WA 4PHTA 3C41J 2O8CA 1L7VC 3QQ5A 1AS3A 2ZYUX 1NN5A 1JJ7A 1G3UA 4LUVA 2A7QA 3IUYA 1CR1A 3CCLA 1VQIA 2EJMA 4LJ7A 4LZZA 1J90A 2ZAOA 1Y1WH 4IRUB 1UPTA 1H65A 2DB3A 2O52A 3MD0A 4DT1A 3OE7A 1CIPA 4EPRA 5LD2B 3ZDQA 1EIFA 2QQEA 5G3ZA 3X1DA 3ZVLA 4OQFA 1P9NA 5JJIA 1VG0B 3Q72A 4LYAA 1R5BA 2QAGA 1CU1A 2HHHL 4IOMA 3EPLA 4RZUA 4DV0Q 4XIGS 1W49A 4NCIA 3QKSB 3W3ZB 4US2R 2UUCL 2OG2A 1B8AA 1G8FA 1SZPA 2GBLA 2H18A 4MKIA 1Q0UA 2ORVA 4HI0E 4R4OA 5CIWA 3ZVNA 1OH7A 2QMUA 4R4IA 4JI8L 4GP6A 1CRPA 2ODEA 4HDCA 3CLVA 3QG1A 1N6RA 4JLKA 1FYCA 2NN6I 1KJWA 4R4CA 3DL0A 1KQSA 3EXAA 5ELXA 4IPGA 1OYYA 4HJAA 1UEIA 2WMNB 4BASA 1Q90A 3DDCA 3PCOB 4AKGA 3SN6A 2GCNA 3KQHA 2WWHA 4XD7D 3SI7A 5M5YH 2C77A 1N0UA 3S1RH 2BA1A 3PEYA 2X2FA 2Q3HA 1IXSB 4PZ8A 3WP0A 1KK3A 4C2UA 4G5QA 2R6DA 3SHWA 1ZUNB 2IYUA 4TL8A 2OQ0A 1NF3A 4KFSA 4JG2A 1ZM3A 1SVOA 2GILA 4NBSA 5J40A 4ASUA 2EQSA 3LFUA 4WZBE 3TGPA 1W5SA 1I94L 5IYDH 3KFXA 4EIWA 4AYBE 3QXJA 4LGMA 2OXCA 1JI0A 1P62B 3AF0A 4L8GA 2MO0A 2PX3A 3OIYA 3A0JA 1F6BA 4QGHA 4B3GA 1SHZA 1X6OA 3OTOL 5HE8A 1B0UA 3H86A 3L82B 1YJWA 4DLWA 5LPNA 1JB1A 1HT2E 1P4SA 2NPFA 4TSFA 4NYIQ 1W0JD 2IHFA 2Q9CA 5FL7A 4P33A 2VP4A 3FMPB 4PC2A 3H4MA 3AKEA 1M8PA 3THXB 2OFWA 3J81k 4OHYA 1U8YA 4IQZA 2IWRA 2FG5A 3Q8DA 2NZJA 2E9SA 2QN6A 3VMFA 4JIMA 2GEVA 2ID0A 4C0BA 4CEJB 4GKJQ 4PPFA 3CP0A 4KN4C 3J7ZC 4OWXB 4F91B 4I1VA 2PCLA 3IIJA 1W4CA 4JL5A 4LJ5A 5CJPA 1IBLL 1PUIA 3DVLA 4Y0VA 2DCUA 1RKBA 1XNQL 3PR1A 4B33A 2YWEA 2J41A 2RMKA 1FQKA 1MO5A 1XBTA 1E4VA 4Q7JB 4C3ZA 3EPHA 1TU3A 4DCUA 5EXSA 3QVUA 1DEKA 3R9WA 4NONA 4QNRA 1Z6HA 4R4TA 1SQ5A 1HNZQ 4OI0A 2V4DA 5GJVC 1CKMA 2UUAL 1B7YB 4TL7A 4JS0A 2YVUA 1YHBA 2IX1A 3S14H 2R7DA 1CR2A 2KJQA 4RFVA 4D4JA 5AUPB 1G7CA 3FFAA 3PF5A 1XD2A 1Z0KA 3MFYA 5FLXc 1IQPA 3AFQA 2WKPA 3RWMB 1K73C 3SJBA 2CQOA 4LJ9A 3KJHA 1YI2A 4G5GA 1JXMA 3GLHB 3K7UC 2G0TA 1BVSA 2C2HA 2PMKA 2JEAI 1TQ2A 1SKYE 3JVUA 3LXRA 2BHRA 3GPLA 1XWIA 4A0FA 2NVYH 3SQWA 2IF2A 5DLQE 3F2BA 4GMXA 2VIIA 3GJ3A 3TSZA 2XSZA 1IOZA 3MCAA 3UATA 3NBYC 4RKEA 5IP9G 3DKPA 5JSZA 4ARZB 4JCVE 1D2EA 1KNQA 5FL7D 2FV8A 4KV9A 2ZRHA 3C16C 2WWIA 3REFA 3WMGA 4DWJA 1AN0A 2EIFA 3TREA 4QKQA 1GL9B 1KC8C 3ERSX 4EX5A 2HJVA 4LJYA 4Q4JA 4QGGA 1MRNA 4G01B 3VU9B 1IJFA 4Z1MD 3DO6A 1RIFA 1YHNA 2ZR9A 2QA4A 4DV3Q 1KMHA 1O87A 4AURA 1IHUA 4URYR 1U5KA 4XH9B 1AGRA 1F60A 1QHHB 1US8A 3U3MA 4D0LB 4QJ3A 3AGQA 1XD9A 1CKNA 3M4YA 4DAMA 4RCNA 2FN4A 2JLUA 2JASA 2YOFA 1OTCA 1P3JA 2J0UB 1TF5A 3PUWA 1IY0A 1OF1A 4X8MA 3S24A 1YU9A 4RCYA 1QHIA 1TQDA 1OHHA 1VCOA 1PH6A 3E70C 1G5PA 4GOJA 1XJ0A 2OILA 3GMTA 4DLUA 3EN2A 3C14C 3M4QA 1UBCA 2HXSA 3L2OB 3SDZA 2ZJOA 3BFKA 4UXJA 2JE6I 5FTKA 3SYLA 5M3FG 2RAPA 2BDTA 2WBLC 3B5JA 1LW7A 2FSFA 4ALPA 3CM0A 1N33Q 1NN0A 3K0AB 3L0PA 4G1UC 4NYMQ 5FTMA 4HLUA 3AUYA 1T5LA 2VO1A 3GLFB 1AE2A 4X62L 2IYXA 4KFTA 4II7A 2ODNA 3PGZA 2IXEA 2JIZD 5JLJA 1XMIA 1N8RC 1DAMA 1FVIA 3UG7A 4JBMA 4JI3L 2FGJA 4LC0A 1QZHA 3VX3A 4DSUA 2VNUD 3KJIA 2C78A 3VAAA 4C4PA 3MAAC 3U44B 4DKAC 1TX4B 2A1AA 3EZ7A 5DI9A 1WF3A 2FPLA 4HAWA 1W1WA 4TL9A 4B3BA 2J0QA 3BB4A 2O8BB 5C46F 2ZU6A 3QBVA 3QI2A 1PUJA 4QJFA 1T0HB 2CNWA 3K0FB 4Z1MA 3KKNA 3B1WA 1LTQA 3E1SA 1IN6A 2PBRA 4L5RC 4O0AA 5AJ3L 2BWJA 2ZJ5A 4EPYA 4ZDKA 4HIOA 1RJ9A 1FUKA 2CVHA 3OEEA 2UXBL 3SHFA 3THWB 2QQ0A 1W3SA 2V3CC 1DAFA 5EZ5A 3KF8B 2JEBI 3B78A 2NN6G 4A93G 1G18A 3BZCA 2O8DB 3RN2A 4EJSB 3UMSA 4EPVA 3CRW1 2D0PA 1HA3A 2XTIA 3E9IA 4PPNA 4DLXA 2IT1A 2E75C 3CRQA 2PI2E 1GHJA 2AUJD 4IXNA 2ZRIA 4JI4Q 1NMXA 2QORA 2RHDA 1VQBA 3HGBA 1JR3E 4LBZA 1E2DA 1Q82C 4FMBB 1DO0A 3FPPA 1P75A 2GCOB 2VBCA 1W36C 1GNPA 1JBKA 2RGCA 1N6OA 2YOHA 1WYDA 1TUIA 4NHOA 2D2CC 5IE8A 1IBKQ 3PIOA 4B3MQ 1IL2A 1GDDA 2XZPA 3U3RA 1IYUA 4FD2A 5HKKA 1EFCA 1U0JA 3DOEA 1Z06A 2XOKD 3THYB 4PANA 3FPAA 3IPYA 3RRMA 2H92A 4BY1G 1DPFA 1AKEA 4GN4B 2D2FA 2REBA 3QF4B 1RIPA 2VYFA 2QMHA 2ZI7A 1N9WA 1JQJC 4C2TA 4PC6A 4AG5A 2FA9A 4OYHA 2V7QA 3WP1B 4X66Q 3FHWA 1R6BX 2IYYA 4QIWE 2ZVPX 5KDOA 5DNYB 1WE2A 4M8NE 4O3MA 3CPWA 3BB3A 5TVKA 4OO1G 1G7SA 2ZRDA 3NE5B 3RS5A 2BH8A 3WBKA 4QOSA 4CZ2A 4N0EA 1OV4A 1KSJA 2F43B 2QU8A 3LBNA 5J5CA 3QVVA 4DB4A 2ZI6A 3C5CA 2ZANA 1FZQA 1NKTA 1O78A 2QM8A 2I0QA 3J81i 2DFLA 1SGWA 3OEED 1S40A 5CB6A 3RLFA 4PQYA 1OE0A 3HFZB 1LNZA 3OPOA 1VCIA 2A5YB 1CSPA 1H9MA 2QMOA 2VHTA 4RFSB 1MO3A 3QIAA 2EFCB 4JC0A 1DG1G 1Q22A 2P2LA 4NE2A 5IP9H 5SZIA 1E7ZA 5DI3A 1LACA 1PH1A 1NIJA 2KCCA 2JLVA 2XTMA 2ZXUA 3SJZA 3K53A 3FHTA 1Z83A 2AHOA 4RD2A 4BRWA 5J4VA 3WRYC 1N5KA 4Q01A 5ELNA 1U94A 1E2QA 5JI3E 3GTJH 5TXGA 3LX8A 5AJXA 4DBLC 4KJZA 2KENA 3CCUA 5GADC 4TT3D 3GLGB 3IPXA 5FBLB 4MRPA 1KAWA 4D4LA 2MMCA 4JI7L 2IUTA 1UBGA 3MG9A 3I4NH 4YHHL 2NVQH 4JLPA 4PX9A 3GJ5A 3GD7A 3OOCA 3K09A 2JLWA 4B3RL 4G7HC 3DLLA 4Q4LA 5DSZA 3TMKA 3LV8A 1QDEA 2EYUA 3TUZC 5BN3A 4A36A 3CQZH 1I4LD 2Y0SG 1GFIA 3N5CA 4MNOA 1UJ2A 2A5DA 3RLNA 4LPKA 3RS7A 2ATWA 3OEHA 4IOCA 2FFHA 2DNEA 1K8RA 1LFDB 1S8FA 1WCMH 2L0XA 2DFNA 1KNXA 2ZREA 4TTQA 3M0EA 4RZ2A 1UKEA 4C3JH 3HOXG 1GRNA 1P9WA 1WRBA 4QHYA 4B6FA 3LNNA 3K80C 3AP2A 4FXPA 3PEUA 4YMVA 4YXWA 2JJ2D 5JI2E 4H0LC 1E9RA 3OIUA 4F4IA 1K3RA 2ZS9A 3OFNA 1G64A 1JPJA 4YLGA 5J4YA 3VR3A 2QT1A 2SHKA 3B13B 4IXMA 1B70B 5CJ2A 1OXTA 1M6NA 5F9FA 1HQMC 5FUYA 2I5MX 4Q9JA 5KUTA 4GLXA 3A8IE 3LVRE 2AD5A 4F38A 1GUGA 4DR6L 3X1WA 3RRZA 4POAA 4M9QA 3A6PC 1X65A 3KDFB 1IXRC 2W00A 2QROA 3P27A 1G19A 5LMUQ 1YQTA 2F55A 4LBVA 4JOIA 4GN3B 3G71A 2PT5A 1XEFA 4BQSA 2R92G 4H1UA 2O0JA 3NXSA 3LQRA 5FBRB 3BJUA 2N1BA 2DPXA 5B57C 4A4DA 2NO0A 5H1SE 1SRUA 4IOKA 4KXFB 1D7QA 1OT3A 1U8ZA 3M85A 4IVRA 2JJ1D 2ZUDA 2K7VA 2NN6H 3KYHC 2ZPTX 2G9NA 4Q02A 2W6ID 4B76A 3PUYA 2YWFA 3GQBA 2ZE5A 2ZRAA 3RANA 2ZYTX 3W34A 2RGXA 2VUMG 2FPKA 4I1SA 4EAQA 5BWMA 1KDPA 2OAP1 2VH5R 4IOLA 5KDDA 2UXDL 5EJEA 1KI6A 4B71A 3A4MA 3CCRA 4ZKDA 1GJXA 4A3CG 1YKSA 4HJ8A 3TR5A 4IDHA 1NBWA 3P4XA 3OEHD 3ND9A 2FX3A 2OEPA 4ZPXA 2FOLA 1CTQA 4AKHA 4CDGA 2A68C 2IYZA 2ZSAA 2FSHA 4HYYA 2L5TA 2WJVA 1G3MA 1GKIA 3BB1A 5CK5A 2FZLA 1KY2A 2OCEA 2F3TA 1GO3E 2DR3A 2ODWA 3EC2A 1RRCA 2R93G 2NTYC 1ZC4A 3SYNA 4IJMA 1ZD1A 3CCJA 4NYMR 1G41A 1Y69U 3HWSA 3OFND 1HNXL 4WIAA 2B8GA 1XJVA 3RNUA 4NMMA 1VQPA 3EBEA 2CLCX 2B8FA 2OBMA 1HEIA 1YJNA 4Q4AB 4IPDA 5C0XI 5JRZA 2IEYA 4QL5A 1F3OA 1NVVQ 5DN6A 3U4ZA 2G83A 2VL7A 5FOVA 2YC2C 3T1TA 3PEVA 4EQ6B 4Z54A 5IP7G 5KDLA 4H1VA 3M4OH 2NZ8A 1H9SB 5K8TA 1NBME 2ZRCA 2VRWA 5HZHA 1YZLA 5EXXA 3ZIAD 3I5YA 3QENA 2QBYA 1HZCA 3LW8A 1NG1A 3F3YA 4V02A 5EXTA 1A6XA 1KJYA 4MA4A 1Q1BA 5TB5A 5KPJA 4DV0L 1VQCA 5FR1A 3U3OA 1TWCH 1JNYA 4LOAA 4WXPA 3TIFA 2QGQA 2V55B 4JLBA 3CW2C 1Z0IA 1IAQA 2VTKA 4LFCQ 2OUKA 3F2CA 2ES2A 3HOVG 1N5LA 1KTVA 3PV0A 2W0MA 3AVQA 2XZOA 2K75A 1KRTA 2WMOB 3ND8A 4GRAA 1E94E 1VECA 5KO2A 2DUDA 2WJGA 4MUAA 2ZS7A 3U4QB 2OE2A 3FMIA 4Y0AA 2OWOA 4A3GH 2HF9A 2GETA 2Q3FA 5JJLA 4HB4A 4OK3A 1JAIA 4Q47A 3QPUA 1FW6A 1NE3A 1DO2A 4V0OA 1COWD 3PF4A 4DUYQ 1I4DD 1T4GA 2CDNA 2YHSA 3ZJYA 3A8JE 1GUSA 1A8VA 3ICQB 2NOAA 2PMDA 3W6OA 2WWYA 3O8BA 2XXAB 4TLCA 3EIEA 3S16H 1OXUA 1XMOQ 4PHGA 1XNJA 4DV5L 4TMXA 5KNCA 1GSIA 1W0KA 4R7ZA 2GVBA 1QZGA 4FIDA 4LF6Q 4B2IA 5F9HA 2CJWA 2OTLA 1OFTA 2DYKA 3WYAA 1AJEA 5J47A 1N5IA 1KI9A 4YMWA 1W2HA 4BZPA 1Z7TA 1A5TA 4FMCB 4BPBA 3KLWA 2Z6VA 4IHQA 2HDNB 1IW7C 2CFMA 1YRAA 2Q2TA 2V4ZA 4LFAL 2FFBA 2FNAA 2WAYA 1GKUB 1T3HA 4LY6A 4DIDA 4IJLA 4A75A 4BY7G 2B92A 2QL6A 1OIVA 1E22A 1VCMA 3HU1A 4JLJA 3SZRA 3AV0B 5TY0A 3WHKA 3T53B 1P8LA 1UE1A 2AFIE 3OYYA 3GJ0A 5H1YA 3TEHB 1Q1ZA 2GRJA 1N3BA 1P61B 1WXQA 2GK6A 3DKVA 4MGKR 3C7KA 5DYIA 4PFSA 3AKDA 4QNMA 1E2FA 3TW4A 1CI3M 4BXXH 1O3YA 2GKSA 1CULC 4CIDA 3E0EA 1XPOA 1N0WA 4Q4HA 4QJ5A 1UDWA 2O0HA 3PENA 3TJZA 3G4SA 4LF7Q 2C9CA 2NQ2C 1CTMA 4DK3C 3EARA 2Z6KC 1KK2A 4ZDWA 5FR2A 1QUQB 3CC7A 2X1VA 2OO7A 4KBGA 1E1QA 2CCGA 4L16A 4V0ME 4D0NA 4ESVA 2DBYA 3PO3G 2ZYWX 1XF9A 1LM0A 1NVWQ 2CMKA 5EE3A 4UNRA 2YTYA 1F2TA 1XEXA 1Z2CA 2CHQA 4LF5Q 4HSEA 2KBNA 1CR4A 4TMVA 3SNHA 2ZTDA 2ZRNA 4LW1A 3ZH9B 4BECA 2R92H 3WMEA 2BCJQ 1XXHE 3U3JA 5JFGA 4QQBX 1DTSA 2IYSA 3LA6A 2DHRA 5JS7A 821PA 2ZM6Q 3PFIA 4A8JC 4KLKA 1G3RA 2CW0C 1HJPA 1IXRA 1VQ7A 1GVNB 2EVWX 1HNZL 1KZ7B 1P2SA 2PZFA 2R7ZH 3KB1A 3QKRB 4EKDA 2VP9A 2VQEQ 2ZTCA 3LXXA 3BBPA 2WP8J 4JBWA 4OJQA 3L2PA 4ZV4A 4A3IG 3PEWA 1NG9A 5EE5B 2R9VA 4JL8A 2CK3A 4LJAA 1IM2A 3KKPA 1HNWL 3I3SR 1GTVA 4R98A 3TW8B 2BVNA 1MJEA 4JI0Q 2FU5C 4RMFA 3I55A 1K8AC 3H3VH 4A3CH 1GKYA 4IFDJ 2J0VA 3E2IA 1VQAA 5FPSA 1X6VA 1MRSA 4W5WA 4TQUS 2VQFQ 3KXIA 4DCNA 1KGDA 4DK1A 3L8YA 4N1AA 4TLBA 5AK0A 5A35A 3CNLA 5FI0B 4F4CA 4PXAA 2IS6A 4F4JA 1P2TA 2A2ZA 3UKDA 3CR8A 3G48A 1FR3A 2K5HA 1HE8B 4KHPQ 1LTLA 2R93H 1AKYA 1WMSA 4QGAA 4DNIA 4PZ6A 3DEFA 3MUFA 4JYAQ 1YNXA 2DWQA 1M74A 2IYRA 1Z63A 1T5EA 1QJOA 2JA5G 3S17H 2JXMB 1TADA 3KTAB 5KHOC 4C0QC 3ADKA 3WWVA 4CF7A 3L7ZC 1RRFA 4DV3L 2D2EA 2P6RA 2G3YA 4XTRA 4CEIB 4RG1A 1G20E 3AP3A 3B60A 1E98A 4OX9Q 2JA8G 1CJTC 2JAQA 1DD2A 3PO2H 2JK8A 2GXUA 4F93B 2ZRMA 4HIDA 4IJHA 2O0KA 3OESA 1HZ9A 3BH7A 1KI8A 4HAZA 5KOYA 3EASA 1KZGB 1CKEA 4E5UA 1U0LA 4KYUA 4BLPA 1TWFH 1Z47A 4YY3L 1VQNA 3HOUH 3HOWG 4ITRC 2P5SA 3NIBA 2A78A 4DJTA 1YVDA 4TMZA 4CEHB 1TTTA 3RS0A 4O2RA 2EJFC 1DAEA 5BXQC 1SVSA 3FOZA 3QY0A 1AM4D 4JJZA 1N33L 3TS0A 4P4SA 2R2AA 1EFUA 1M34E 4US1R 5FTLA 1M2OB 1JPNA 3GEIA 2WM9B 4TMWA 3U3KA 2A69C 5A4JA 2IWHA 3GTOH 5C0XG 1XEWY 4IEIA 1PMRA 1XFAA 2CLSA 1SVLA 2F7SA 2G0NA 1Q21A 4TMKA 1X1RA 2Q2IA 1ETUA 3QBTA 3ZS9A 4NCKA 4P72A 3KXKA 1DCZA 1KK1A 1D2NA 4S2EA 4TVAB 3A37A 4KFUA 4F92B 2GJ9A 5KU1A 5E4FA 3ZD6A 3ZZUA 2A68D 5D3MA 1HYQA 1U9IC 4M1SA 2GVZC 3C15C 3PIPA 3NH9A 4MKFA 3VX4A 3RVBA 5IF9A 2CCJA 5DE3A 4D25A 3B1YA 1J5EQ 1YZQA 4ACBA 4ZDIA 1VF7A 2LXJA 3I92A 5EE9A 5J4KA 1CF4A 1ZMXA 4A8JB 1XPUA 1E2NA 3T35A 4B3XA 3PXGA 3A4NA 3NDPA 3AVXA 1L1OA 4PAQA 1XP8A 1XMQQ 4PZLA 3F0TA 3ZZ0A 4KITB 1UEBA 4X64Q 2PJZA 2OT3B 3R9IA 4DV4Q 1FFHA 3AFPA 1II8B 4XVRA 4PO9A 4JI4L 3V9PA 1N32L 3I4MG 4PQRA 4UNSA 4DR5L 1JEDA 4XOIA 1TF7A 3AVUA 2JGNA 2RB4A 4G5OA 3I1FA 5J3BA 1IBKL 3S1NH 1GWNA 1XMVA 1ZNYA 4WA7A 1HE1C 1I2DA 2BC9A 1E0AA 4HAXA 3PO3H 2YJTD 3KUCA 2JA9A 1RZ3A 2EU8A 3QKUA 5E95A 1CEEA 1CFMA 2OAQ1 4M22A 3D0FA 4DLYA 1V5WA 1VTKA 5D3QA 2Z6KA 2IHYA 2VHQA 4W9MC 1E0JA 1YR8A 4NXNQ 4X66L 1PVOA 1E9BA 2X8AA 4G5SA 5CYPA 2HYIC 5B64A 4I7ZC 4DR1Q 5LB4A 3B8HA 1UEJA 4QL3A 1NY6A 1GVPA 2DY1A 1H95A 2RGNA 2UXCQ 1XCPA 3VR1A 4BZQA 1Y8OB 3CRMA 1E2PA 4L5BA 2MO1A 3Q3JB 4FCWA 5JCZA 1MKHA 3KQLA 1EFTA 3LQQA 4C7OB 1AQYA 3LBHA 2K14A 1A4RA 1G6OA 3D7MA 4QG7A 1OW3B 3H0KA 5LMNL 2KE5A 4AYTA 2VSOA 1W0JA 1SVKA 2BDOA 1IZ6A 3EX7C 5IWAQ 3CCVA 1G16A 3N2IA 1SN8A 1RVDA 5BR8Q 2H7VA 2QPAA 3UWOA 4TYYA 1S1CA 3E9HA 2B7CA 1N34Q 3MEFA 3KF6B 3SGIA 2E87A 4IDNA 3T1QA 2BOVA 1DAGA 1OLOA 4OQMA 4DPGA 1SXJE 3CX6A 1UE6A 5FPKA 2OCAA 3NEJA 1KDRA 4P71A 1G4UR 2EW1A 2GHIA 4M0LA 3W8NA 3WBJA 5JWRA 3FMOB 2P6UA 1IW7D 3J81c 5AJVB 1YZ6A 3FDIA 4GSYA 1G6PA 3W6PA 1TMKA 4FMDB 2C9YA 4JI5L 3M3YH 1YJ9A 3A36A 2VF8A 3M9BA 2JA5H 2AKYA 4XJXA 5BN4A 2ERYA 1NKSA 5G53C 4LYFA 2CEAA 4ACAA 3MXUA 5H8WA 3IEUA 1LV7A 3AYHB 2QENA 2EFEB 3S1AA 1Y1VH 3QPVA 2BCGY 3CD6A 3UG6A 3ASZA 4X8HA 1IN5A 2E74C 2GXSA 3M1IA 1E9CA 3ADCA 2PZGA 5AJZA 1DAIA 1DARA 4XWAA 3FP9A 1Z0FA 2N8NA 3CXCA 2C03A 3GO5A 3ZQ6A 2VHJA 3WNCA 2WB1G 1E9SA 2X19A 4BA1I 1I6VC 4JSTA 3PVSA 2WJHA 1T91A 2UZ3A 4OO1I 1GNQA 1H8ED 3AEZA 5M3MG 2J59A 1A1VA 1XEWX 4BBRH 2E2HH 3QKSA 3HOZH 2JJQA 3PIRA 3A1TA 1BIFA 1FTNA 4IDPA 4A3EG 5GROA 2ZRLA 3SE0A 2O5IC 5IYBG 1D5CA 4OQNA 1S9DA 1SVIA 2AD1A 3W1BA 1GILA 4YWKA 3HU2A 4OL0A 1HR0Q 2AFHE 4DNTB 1A2BA 4JKIA 5TARA 5C1BA 4LF4Q 4PSVA 4APVA 2GXQA 1TUEA 4DR3L 1W4BA 4JT4A 5C0XH 3V00A 4GDFA 2JQOA 4B3SL 3BOSA 1JR3D 1UBFA 4KYIB 4V0LA 5CIQA 2IK8A 1PH9A 4M9ZA 1UAAA 1B9MA 4JJKA 4GZYC 1YR6A 1IN7A 4Q18A 1YRBA 1JJCB 4LSGA 3VR5A 1ZM4A 5C4XG 4Q19A 1VPLA 2AKWB 2MFIA 4D82A 3H0GG 2Z4RA 2BIFA 4JI6Q 4UJ3A 3GLIE 1J2JA 1C7YA 1H9RA 5LMUL 1ZCBA 4WVFA 4ZI3A 2BBTA 4HDOB 2FWRA 4DR4Q 5SZKB 1VQHA 5JEAJ 4JBJA 5CM9C 1BH2A 3VKHA 2YOGA 2E8GA 1W7AA 2CWPA 4TL6A 2JA7H 3G82C 1I4TD 1NJGA 5JMTA 4HJ9A 4EJSC 4C0AC 5CLQA 4A3MG 2VHUA 4PHHA 4JVNA 1U9IA 2RGAA 1ZU4A 2W2XA 2F1IA 3RSOA 1OB5A 2CE2X 4C2MH 3LWUA 3WDNA 1X55A 1E4YA 1FOEB 1XTQA 2ZJ2A 4HB0A 2PEYA 1GD7A 1V1QA 1YHAA 1AGPA 1P73A 2FJUA 3NELA 3UDGA 1R7RA 1S9HA 1XCGB 2ZSBA 2JIZA 2Q21A 4EUNA 4QGFA 3I4MH 2ASBA 2KCMA 2B29A 5M5WH 2UUBL 1I2MA 2R6GA 1MV5A 1N6IA 5GQOA 1NSFA 1CUKA 1YNNC 3BFVA 4TYNA 3A1VA 2VW9A 4M21A 3S2DH 3BORA 4NP6A 4XVQA 4Q21A 4OWTB 2DFKB 3KKQA 3DM5A 4JLAA 5E7IA 3THXA 4BLRA 2LSSA 2BV3A 4TYQA 5TDHA 5GAGC 3VKWA 3AKCA 4WBSA 3Q8XB 4DCSA 2CVFA 4CEJA 1Z6YA 1NMZA 4FMDF 1J8MF 2JLXA 2HLDD 1X3EA 3R7WB 3SJCA 3N70A 2PCJA 3QE0A 1XJQA 3RRYA 4AK9A 2N3SA 1CJKC 4TQAA 1EQQA 2IHBA 1VQ9A 5CDFA 4P74A 2XX3A 4Z8XA 1G21E 3JZMA 5F2EA 5GJBA 2AL7A 2J87A 4P73A 3GJ4A 3T5GA 4D80A 4TLEA 5EQTA 4DZZA 1H9KA 2A69D 1D2MA 1ZW6A 3I8SA 4JT2A 3DHWC 3EPKA 1ZJ6A 2QSYA 4G7ZC 3JAMi 1VQDA 4DLZA 4H02A 2ZM5A 2O8FA 2ERXA 3K9GA 4J15A 1YVCA 3IIKA 4D81A 2ZJRA 4PAMA 2WAXA 6Q21A 1L2TA 2YKGA 1U98A 3PUXA 2WAQE 4DDUA 1Y8PB 4NDZA 1KSHA 1PLLA 2QRZA 4LF8Q 3GLHA 5TMPA 1E9DA 2H5EA 2C98A 3P26A 5C3EG 2KI5A 2LXKA 1Z0JA 2BKEA 2E76C 1EFHA 1MKYA 2XOKA 5C4GB 2YU9H 4DAYB 4HB2A 4DSTA 3F5FA 3CAMA 2NO1A 1ZD8A 3B1XA 1J8YF 1LS6A 1P2UA 4ARZA 4UNNA 1CLUA 1KHIA 4K0KQ 3NC0C 2K50A 2H17A 1NLFA 1VQGA 2OESA 3B2EA 4JI1Q 3R9XA 4MKGA 4WZAE 1VHTA 1K83H 5C44G 2QE7D 3VU9A 3QKTA 2AN9A 4DUYL 2GJKA 4PQFA 4MQBA 3EIHA 3DZDA 4YMSA 1II9A 5GJCA 5K8UA 1X54A 4A3DG 3NVAA 2D0OA 1QHHA 1ZBDA 4NL4H 1X3FA 1Z9FA 1XMOL 3CH5A 4HUQB 2WV9A 1JT8A 1AS2A 1YEZA 2X77A 3C5HA 2WSMA 1A0IA 2QP4A 2O8FB 4NXMQ 4QHSA 2OLKA 2V6IA 2J0UA 2EJGC 2KA7A 4DDTA 4FCVA 4C0JA 4YWLA 1T8TA 4YMUA 1ASYA 3EIQA 5M3MH 4IW3B 2ZEJA 4LV8B 4R2HA 4HJ7A 3T34A 5FPTA 4NYJR 2N78A 2DFTA 4FINA 3U7GA 2LCFA 5L8VA 3LDAA 1N36L 2WOJA 5IYBH 1T3LA 2LKDA 2WWFA 5FTNA 2RGEA 4R1JA 3K0AA 3GTKH 5IT9c 2HV8A 4EDHA 3GLFA 1IONA 1K5GA 4A3BG 4B2PA 2JATA 5KSOA 1W46A 4UNPA 1C4OA 1UKZA 2GJ8A 3A74A 4V0NA 4TT3A 3KOJA 4A4IA 2D74A 3H0GH 521PA 1OKKD 3KFUA 1Z0AA 2A6EC 1LF5A 4IKEA 3U44A 2EQBA 4LF5L 1L2FA 1XXHB 1NP6A 4DV6Q 2I1QA 2WVJA 4QJ4A 3TKLA 1AZSC 1Z6XA 2OSBA 2VP6A 4US0R 2O8BA 4U5XA 1Z22A 3EWAA 3K0FA 2UU9Q 2JCSA 4Q03A 1Y8NB 2KB0A 4LUZA 4A3MH 1QHXA 4KLZA 1OH6A 4AD8A 4M53A 1QHGA 4A1FA 4QM7A 3THWA 4LK2A 3FTQA 1R8QA 4MRSA 3REGA 3CRKC 2IBMA 1U90A 5DHFA 4A0GA 2O8DA 1X3GA 4KCGA 5FUXA 4HIKA 1FJGQ 2JJ2A 4EJSA 3EC1A 2ZRKA 1A7JA 3S1QH 1SMXA 1GP2A 2QP3A 1VQ8A 2O5JC 5C4MA 2QA5A 2VQFL 3ULPA 2GCOA 3TNFA 2OV2A 1YHQA 1J70A 1E2KA 1K9MC 1TPZA 1MOZA 3GTLH 4PV1C 1FNMA 1QBKC 3U5ZB 4E07A 4KHPL 4A2QA 1PH2A 2QF7A 1PH7A 3LAWA 4HZUB 3THYA 3RYTC 4MGYR 4L8JA 3ER0A 2UUCQ 3CB4A 3BS4A 3QF4A 5CYOA 4JLOA 1IJEA 1ZM9A 3E5HA 1ELOA 421PA 2KCTA 4KI0A 3DM3A 1XTIA 4JI8Q 1NL3A 3AQQA 2R6AA 2VHCA 3B6YA 1GHKA 1AH9A 2WZQA 2JJ1A 1G8HA 2A6HC 1QVCA 4BBSG 1Q1EA 3KLRA 1CRQA 1YZNA 2YTXA 1Z28A 2JDID 4OX9L 2MSEB 2VSFA 2W6IA 4LC1A 2E2JH 3TE6A 4B35A 5AUNB 5FBWB 1DAKA 1UKVY 3SBEA 1Q20A 1JEEA 3STBC 1XNRL 3KJGA 2PNHA 1K5DA 5FOUA 3BC1A 1E79A 1FP6A 1HURA 3O8DA 4K46A 4W7SA 4GKKL 2F43A 4X8LA 4Q7LA 1JE5A 3TUJC 3CZQA 4E03A 4HUTA 3RRNA 1EQRA 2J1LA 2ZRJA 4O25A 3FKSD 5M3FH 4UP9A 4P4TA 3CMEA 1PH3A 3N2EA 1FGUA 2FEOA 4HAYA 4GNXB 5C3EH 3O47A 2EFHB 3U58A 1EK0A 1K8OA 4FCTA 3T1YQ 3AGPA 2YC4C 1FL0A 2B8TA 5G40A 3TSWA 3AVWA 2QTVB 2ALYB 4DV2L 1CS4C 2NZHA 4RFSA 3I61A 4O2DA 3J80i 4M2LA 1I94Q 4HAVA 3K0CC 2EWVA 4BE7B 3GP8A 1UKYA 4MGIR 4POGA 2E2IH 1KHTA 2HYDA 3K1JA 1E3PA 3U9SA 1ZNZA 3HKZG 3IBGA 1KDTA 3NBXX 4LHWA 2IW3A 2VSXA 4MITA 3B1VA 1S2MA 2ZR7A 1Z6AA 3I4LA 2RGGA 5C44H 4B48A 4BLOA 3OTOQ 3TZUA 4AH6A 3RZDH 1AZTA 5JHHB 5FTJA 1HCZA 3K8AA 2ZI3A 1F2UB 3LBIA 4A6PA 3T1OA 1N0VC 2WWGA 5DIFA 5C18A 1L4UA 3U7FB 4A3DH 4HZIA 1HZBA 4KMUC 1ZNWA 2AWNA 1FTSA 2WWXA 1KO8A 3GLGA 2QTHA 1SLJA 3GJ7A 1IXZA 1O7IA 1G5TA 1CR0A 3OIVA 4YDSA 1XCMA 3ZIAA 3FFBA 2F1HA 2GJAA 4OXPA 4AQYL 3K9HA 1J5EL 3IRBA 2EFDB 2ZJZA 4A93H 1YNJC 4ZIRB 1X3SA 3I2ZA 1KI3A 4RJLA 4TLAA 3PUZA 2O8EA 4NB3A 1VQKA 4Q1EA 2ZRBA 4M1TA 1XNQQ 1GNRA 1E79D 4DV4L 2AK3A 1W44A 5GAEC 3AP1A 3CONA 2REOA 1VIAA 3BRWD 4I1OA 721PA 3GJ6A 4QBHA 2EXDA 1X86B 2Q9BA 1IYVA 1Q44A 2WICA 3L8ZA 2F9MA 3W3AA 4YQFA 5HPYB 4BA2I 1XPRA 4P4UA 1XTJA 2UUAQ 1COWA 1P9RA 4XSGA 4DUGA 3NWJA 2GTPA 2PT7A 3ZVRA 3RLOA 4LJ8A 3VHXA 5KYKA 5M04A 4BY1H 4CW7A 4CT4B 1NRJB 2FFQA 2O5VA 4I81A 1RPZA 4BLSA 2OXRA 4RD0A 1II0A 2F9LA 5HCIA 2ZSDA 1NMGA 1UM8A 4Q1CA 4BFUA 4PZ7A 2FXQA 4OJKA 3EZ9A 3FE2A 2WWWA 3KDFA 3ULJA 4P75A 2IYWA 3W1GA 3GLHE 2RCNA 4NXNL 4R4QA 4D4KA 1MR3F 1M7GA 1TL7C 3H1TA 3U61B 3P20A 4OO1H 2FF7A 1SE8A 1YJ5A 2K5NA 1EFWA 4NH0A 1SVWA 4BLTA 3TQFA 2GZAA 3CWZA 1GUOA 4LWCA 1UDXA 1X8LA 2AMCB 2Z0SA 2F3RA 3FB4A 3IILA 2GK7A 4MTNA 1CJMA 3V4RA 1LUZA 3AVVA 2KBEA 1HR0W 4GPTA 1N6LA 4DIEA 5IWAL 5DH9A 3EWSA 2OCPA 3T56B 1SHKA 3CKLA 5DLQC 5BR8L 1VYTA 3MWKA 4PC3A 5E7JA 4DLTA 1N34L 4L5QA 4DR7Q 5IHPA 1XMJA 1EESA 5IY0A 1SXJB 5FFMA 3TUIC 4TLDA 1NN1A 2W0SA 3W5JA 2IUUA 2AWOA 3IKJA 1RRGA 3I32A 3X1XA 1UE7A 1TF2A 1ZIPA 3I56A 4UNQA 2WTUA 4BFXA 1D6JA 1EWHA 2FDCA 2IS1A 2WPDA
chains in the Genus database with same CATH superfamily
3GJXC 1G5QA 3RTEA 1VMAA 1BS2A 3PBKA 3MJCA 1ZC3A 3WRYA 2I2WA 3T5AA 2R7FA 3OTIA 2AZ4A 5IG2A 3W5SA 4LCEA 5T8KA 4CGYA 2NIPA 4P6VF 5JDCA 5SZJA 1DC5A 2WW8A 5E4JA 2HO4A 4ZYXA 2Z5VA 3U19A 2L15A 4J07A 3T9BA 2IYQA 4HQKA 3UXMA 2OV6A 3F6YA 4OGGA 4YTEA 3MINB 1STYA 1N2EA 2PWAA 1AQ6A 5TPZA 1ZM2A 1EVYA 4C5AA 1QE6A 2VBFA 4QRHA 4BFVA 1U80A 4LTMA 4AUNA 1Z5OA 2F4VQ 3TH5A 4U7HA 1ULTA 4ZZ2A 4WFKA 3U56A 3IBCA 1QYXA 2B6HA 2MGSA 3SVLA 3FDFA 3QKRA 1PNQA 3I0NA 4KKXB 4MYSA 3GNQA 3LX4A 4E4RA 4GW3A 1DJNA 2WB2A 3RI3A 5ECYA 3DVAB 2A9KA 3ZGZA 2PO4A 1IHYA 4FM9A 4YDQA 2P5TB 1WB6A 3RROA 2JA7B 4RHYA 4XQCA 5H4GA 5EE0A 3EWNA 3JRXA 2P3QA 1V71A 3TWOA 1GUNA 4MEAA 1HQDA 2PL1A 1IN8A 3I9LA 3KYDA 4INPA 4K5QA 5MGBA 4OHZA 1BEEA 1XL0A 4F45A 3HDHA 3T7IA 2MIIA 3RZOH 2JCYA 3OOHA 1X19A 3W5IA 3GTGH 2DT5A 3F4BA 3TB4A 4U1RA 2O6HA 4FJ0A 4X3UA 2ZJ6A 3LKZA 2YZKA 3PDJA 2ATIA 3ZBTA 3CGGA 4CBVA 3T13A 2QKIC 2O2YA 4WINA 3RBAA 4CKEB 3UJ6A 2QYOA 3GLVA 4A3IH 1TMYA 2C2XA 4HJ5A 2IXGA 1NWHA 3B1KA 1OBVA 2A8VA 2ANBA 1TU0A 3D4LA 3MJ4A 1S8OA 3WQBA 1N75A 4NCJA 4QD3A 2BMVA 4DZRA 1N5JA 2CJXA 3DE5X 3DB1A 2HK6A 3D0KA 3PHBE 4KK3A 4B4UA 4BNIA 4P5EA 3IUNA 2EFGA 4O3FA 1AUOA 3V55A 3NZEA 4C7OA 2PS9A 3TP8A 1TWGH 2VZAA 4WJ4A 3M6XA 1H2YA 1XIVA 3KBBA 1U7PA 1L8OA 4PO3X 5B3JC 2NADA 3ULKA 1QHEA 2AJLI 3GFVA 4ND1A 1U2EA 3H5TA 3LQ1A 1IJKA 3F67A 4G0NA 2W90A 5JXJA 3NENA 1WKCA 3LCRA 4MVJM 4NTZA 3S44A 2GVAA 1ZMOA 2BBWA 1J8QA 5GOZA 1VQFA 4EPTA 4HR7B 1Z45A 1KFKB 4LBWA 3NG1A 3EIXA 5E2BA 1J99A 2B1JA 2X2OA 3QLUC 3VHRA 5CB4A 4GHWA 1PR2A 4YRKA 1EZ1A 1Q3HA 2X5JO 3KJEA 4IDFA 2Y66A 4ENQA 1NT4A 13PKA 4K6KA 5JR3A 1D8LA 3WGGA 4U5QA 1QANA 1ODKA 2VEDA 5J58A 4UDNA 1BA3A 4GGOA 4HTFA 3W9BA 5HNKA 2CMHA 3TSYA 4RWZA 4U8GA 3IC5A 1ZJYA 3AVTA 4G0WA 3BD6A 1DJLA 4HMPA 1J0DA 5C81A 4YEDA 5G1OA 1E2BA 5GONB 3I9OA 1EFRD 4EB0A 4URXR 4JQYA 3WX0A 4RPCA 5GM1A 5GADl 2JGMA 1B44D 4C3JG 1KY4A 2DWCA 3NWOA 1WCXA 2QX6A 3KQQA 1YNOA 2Q5EA 2ZW9A 1FSSA 4PYNA 3LO5A 2PU5A 3LT2A 1TE2A 4AB1A 1NXSA 4DFDA 2FKNA 4QU5A 1TTPB 5C4XH 1M5TA 3PXUA 4N7RA 5MHTA 4DGQA 5C0XJ 1JB7A 2N9UA 2QSUA 2PPBC 5CCEA 4ZFNA 1TCUA 3QB3A 4DR2Q 1FNCA 4A9AA 2V1CC 4TTJA 4WNAA 2HBZA 3DEIA 1EIYB 4J76A 5TQ2A 2PZWA 3IEIA 3I70A 1HUQA 2HIXA 3E22B 1CFJA 4EGSA 3MCWA 3O91A 2K32A 4ITUA 2EP7A 3UOWA 1C30A 4PO1A 4YYEA 5E38A 2LKVA 3DAOA 4UM9B 2PD4A 2IP2A 4BLVA 3CT4A 1DOAA 2I8AA 4JHXA 3TYXA 4RD1A 4NJMA 2I34A 5F7ZA 2AF4C 4RK7A 1LLCA 2QZ4A 4CFZA 1E3TA 1E2EA 1MD2D 2M9VA 5EZYA 3NOXA 3NEYA 2JFZA 4IUCS 4IINA 2H7CA 1B8OA 4EG5A 1SQSA 1G20A 1R9JA 2PYDA 1E59A 4LMQD 3U7HB 1B1ZA 1OAOA 1U7DA 3K9WA 4BV3A 3GDFA 2COKA 4PSKA 4CMAA 5HRCA 3L8FA 5DRTA 1EIGA 2D9UA 5DXAA 4JVSB 4HPJB 4M9SA 3HSKA 2R85A 2WWVD 2XNDD 1PJ4A 3CA8A 1YBYA 3JR3A 2QTVA 3QUQA 4FGSA 1EU1A 1JG3A 3ISJA 3OEWA 1WHSA 4TWZA 2AR9A 4AP6A 2A7XA 2NPIA 3H8JA 4OA5A 8OHMA 3RIYA 1IE3A 1GTJ1 1JKJB 2Y1GA 1B73A 3OCVA 3NGLA 2VDKB 1Q7YC 4TUYA 1O57A 1QIMA 1Y8AA 1KBZA 2OM2A 4ZZ0A 2C59A 1UFVA 4N01A 2VYQA 1E2LA 2VJOA 5DM1A 1X14A 3KB2A 4G1CA 1JMCA 1ESNA 1Y1TA 3PXDA 1AQLA 1NP3A 2Q99A 3SDBA 4POOA 1FX0A 5NULA 4CMGA 4QWMA 4JEHA 4YLYA 5KIAA 1T8RA 4EHKA 5CXQA 3HU3A 2FW8A 4GNKA 2E4YA 1R0XA 1A4IA 1YL6A 1S5BD 3L43A 5B58T 1SMYD 2E21A 5LP6A 3X1YA 1HC7A 3JTEA 4L15A 4N0DA 4ZAFA 2IY5B 2B2VA 2IPNA 1M2VB 5A5EA 4XQ0A 1KXZA 4HEA1 5FH9A 3WK9A 5I4IA 2XW6A 1PFSA 5HY6A 2UZIR 1Y1WG 1AGXA 4XYMA 4UFOA 1SUBA 4ZGGA 1G9SA 2EW2A 2FFAA 2VPQA 4IFIA 4TKUA 3GLIA 2YASA 1Z2AA 1ZU5A 4KY7A 1PH8A 3KJOA 4HC4A 3J80A 1XZLA 2P2ZA 5C3UA 2CCZA 5T3YA 1CQPA 2AMJA 1CNMA 3GLGE 2MNAA 1QK4A 1YASA 3DMGA 3T1HL 2CE7A 1AIPA 3I64A 1BOSA 3FDXA 4WOCA 3LY5A 3DUFB 1QM5A 1DS6A 4JUCA 1IRIA 1QH8A 1ESDA 3CH6A 1DM0B 1PJ8A 3UC9A 2FUG6 1LV9A 2WYWA 4GGPA 5JEAH 2ENUA 1AK2A 4B1FA 5DEHA 5LZ5A 1L4YA 1SVMA 3JWEA 4DLVA 3N6VA 3DLTA 2PGXA 2F3UA 3IGFA 2QXUA 3GAMA 2EDAA 2F59A 2FZCA 5K3AA 1PYOA 5JZMA 3DFFA 4R8MA 3IPLA 4JEIA 4ESHA 4LQDA 3DDSA 1MJ5A 3U9LA 1Z4MA 1DOLA 1I3KA 4R01A 4BTVA 3PNSA 4ZOLB 1KZ4A 3ZHUA 3L77A 4NZNA 5IGFA 5DASA 1BXRB 3LCMA 1QP4A 4RZUA 5D3KA 2ILTA 2OG2A 5D00A 2GCIA 2WTMA 4ZVTA 3D8UA 3R5FA 4R4CA 4RJIA 4RKYA 4HRAA 4XPIB 3T4AC 2W2LA 2GX6A 4QGSA 3HEJA 1UXHA 5BMVB 1F9AA 3TQSA 2Z58A 3A6ZA 1FRNA 2O3UA 1F1JA 3ZHSA 2EHDA 3P9ZA 2IYUA 2C9ZA 4GI2A 3NSWA 1C8LA 2AZXA 4C5CA 2C0QA 1A3CA 4W9RA 3PDCA 3FGZA 5LPNA 2XE4A 2VP4A 4CQMD 2EYFA 2FG5A 4GIBA 3L0YA 1N2OA 3NPPA 2K5DA 3DVLA 4ECAA 1DGQA 1EY9A 1TU3A 1JHZA 1ZQ1A 5KVQA 1QAOA 1N7JA 4QNRA 1HNZQ 1CKMA 3EGDB 2HMAA 5DVZA 1R6AA 4YAFA 1CR2A 3PF5A 4TN5A 3AFQA 2D0DA 3IAAA 3G8CA 1QZ3A 2REQB 3Q3EA 2OHHA 1BVSA 5DLQE 5IP9G 1SG6A 5FL7D 4MUYA 4DWJA 1U02A 1PDVA 4FYXA 1YHNA 3LP6A 5CFRA 4URYR 4D0LB 1AGRA 2QL7A 3AX6A 3DBVO 1WSDA 3RFUA 2OP0A 4RM3A 4M36A 2ZWVA 3OPYB 5BOSB 1LNSA 3HKBB 1JKMA 4ND2A 3ZEIA 4BXOA 3HN7A 3SYLA 1MAUA 4ALPA 2WWTA 4BN5A 3BVPA 3DLPX 4LZOA 2WIGA 1VM6A 1XMIA 4CL3A 1D6NA 5ABPA 1KS2A 4CR7A 1X2BA 1K7EB 1W1WA 2EC5A 3N9IA 3QI2A 1F9PA 2Q8RE 3OFJA 2RC5A 2YQ4A 4ER7A 2Z9BA 3Q2IA 3UMSA 1Q91A 1TC2A 4KACA 5FA5A 1E2DA 1AKRA 2GCOB 2VBCA 1QJ4A 5BN1A 3OETA 2W6QA 3R1IA 4C04A 1V8ZA 3H1BA 1QV6A 2XOKD 2MHCA 3RRMA 5C8VA 2BM9A 2A8YA 3QWAA 5K2MA 1IYZA 2RI6A 3PWZA 1ISGA 2FA9A 3VC3A 2BKVA 2J32A 4AULA 1SY7A 4N3GA 1KSJA 5J5CA 3ZU6A 1S40A 2IYOA 4PN3A 1CSPA 1YQ9A 4X1IA 4PYMA 3OQIB 2ZXUA 1U8CB 3SJZA 1TM4E 2GI4A 3K0KA 2KENA 2FQWA 1JVSA 5K3BA 4YQYA 4BMNA 1Z37A 2ZB7A 2ZDQA 3PFFA 3CW8X 4IS3A 3TECE 5JCOA 3LV8A 4H3HB 2IIPA 2ATWA 5LBUA 4LRXA 1WCMH 1D2GA 1NSYA 3HOXG 1CE8B 5KNDH 4F4IA 4NMHA 3I23A 2FW6A 4KG7A 3X1WA 1T10A 3L4BC 2J3LA 3PF8A 5HGXA 2C2ZA 1XU7A 4GWLA 2AF3C 5EMHA 3DTTA 5DCUA 2ZUDA 4YCJA 2Q4DA 2VQFB 2O2IA 3ZWMA 3V4ZA 1VP9A 4HJ8A 3O75A 3P4XA 2FX3A 4BRZA 5JVDF 2A68C 4G5XA 3WGYA 4HMJA 1RQRA 2V7GA 3GPDG 1KY2A 2O57A 3EC2A 4XXEA 3MPOA 2F9FA 3Q24A 3NK9A 4ZD6A 2GEFA 2ZYDA 3FSRA 5C0XI 2C4WA 3R5XA 4OHCA 4QXRA 3H8WA 1RHMA 4L4YA 4O2AF 3MPUA 1B42A 4H1VA 1ESZA 3H2BA 5K6AC 2ZRCA 4JGGA 5ED0A 3PGVA 5EXTA 5F1OA 3AR6A 1TGYA 2QGQA 3MGBA 1QLJA 1C1DB 2CXOA 2J3JA 1MNQA 4U8HA 3HOVG 5B4VA 2JFFA 1KRHA 3OUZA 4L4SA 3OUUA 5HF9A 1NI4B 1K7YA 5JZ9A 1W581 4ZGWA 3EIEA 4FD3A 4DW8A 4G56A 4TMXA 4CHTB 3S1LA 3TINA 2O06A 3HQ4O 2DPHA 4X64B 5AM4A 1USUA 4M0DA 2QL6A 3HU1A 1VCMA 3ZHVA 2JIPA 3W2HA 3DKVA 1WXQA 5DYIA 4HNVA 2IL8A 2E18A 4CMIA 4L0CA 1JHPA 2MSWA 1N0WA 2HK9A 4TMVA 4F46A 4Q3AA 3F46A 2YL2A 3LA6A 4A8JC 1JTFA 3OE4A 5I7HA 4ETWA 2TMPA 1Q7TA 1B8UA 2JLCA 4OJQA 3L2PA 1WKBA 1NG9A 4E5PA 1P1BA 4EK9A 3NHMA 1NVGA 4ZEMA 2LGJA 2ZB2A 2IS6A 2PL9A 2G76A 3CB2A 3E5NA 1YNXA 2ZJ0A 1XOIA 3NHFA 3W1WA 5J1ZA 3FX2A 3GLUA 2LP4Y 2GN4A 4NFHA 1FFXA 2HJ9A 2ZSHA 5BWLA 1Z36A 5ALYA 4F87A 3WHPA 4RJJA 1W52X 1YS4A 2BSQA 1NR4A 1O08A 2Y4OA 3N2GA 5L51A 3GEIA 3IALA 1YNJD 4PX5A 1PTOH 2YZMA 3MGGA 1FD7D 4OXQA 2FPPB 5KYVA 3ZS9A 2BDNA 5IVKA 3ZD6A 2FQ1A 3NH9A 2JFQA 3DV0A 1E2NA 1XP8A 2RHJA 4WESA 5AXBA 4OXKA 1KPIA 4FFBA 3AVUA 4K88A 1DJQA 2NZXA 1RZ3A 1EEHA 4AF6A 4Z3KA 3QU4A 1P33A 4EYGA 4EUSA 2F0OA 4NDXA 3MMZA 2UXCQ 3B12A 2DJ5A 5HBGA 4FFWA 4DLBA 3K57A 3OPYI 3I1IA 1ZGBA 4E7PA 3WB0A 4I2VA 4HX5A 1N34Q 3K7EA 3TL3A 4RZQA 1VE9A 1UE6A 4NABA 4ZTBA 4U9IS 2O14A 1E4OA 4JB0A 5LIRA 2BHSA 2VF8A 3EFHA 5JASA 1V1RB 4OUDB 3LL7A 1VXOA 5F52A 2DUUA 3CD6A 3N3AC 1E9CA 3S8EA 1YDMA 3ZQ6A 1FYVA 4FFSA 2WJHA 3KOXA 4BO3A 2H1VA 1A1VA 3HOZH 4JGBA 1D5CA 4PSVA 4JT4A 3WQHA 1BN7A 3MTBA 3E23A 2P4EA 1GDHA 4HXEB 1M4VA 5F12A 1U4PA 4C7VA 2PZBA 1I4TD 2IYEA 2QTNA 1MB4A 1KAAA 4D3DA 3SIWA 1S5ED 1M1UA 5AXAA 3V3KA 4IDEA 4RZIA 5EJWA 2ZDGA 3PCXA 3R41A 2WVGA 4TYQA 1PFNA 4FMDF 2VXWA 2V9ZA 1FFDA 4HRXA 3JZMA 3HH8A 4EEKA 1D2MA 3OKAA 3T95A 1I24A 4YJ3F 2NUBA 4QLAA 3ANTA 5IXYA 1TM7E 4M8KA 5LDGA 5JNSA 1FYXA 5BSTA 1D1TA 1J8YF 3NC0C 4MKGA 2B2XA 1X3FA 1EL0A 1RWPA 4MVJF 1A0IA 4MPDA 1WDLA 4R8NA 4MIEA 2QQGA 5EL0A 2ZEJA 4O4HB 2Z6BA 4W5QA 2A58A 2RGEA 4MB2A 3QPAA 1A8IA 3QU7A 3ZXUB 1L5HB 1I4RA 4A3BG 4HWGA 4V0NA 4INJA 2JARA 3ASUA 2W6OA 3TKLA 2DCMA 3EWAA 4NPAA 4KLZA 4K14A 2ZBQA 4AF8A 2O8DA 3FD8A 3D43A 8ADHA 2ZRKA 1RI3A 3S1QH 4ZZ1A 2WAOA 5HWSA 1VQ8A 2O5JC 1AF4A 4R1LA 1EB8A 2OV2A 1IVNA 2OM6A 1MOZA 3U5ZB 4KHPL 3NOQA 1PH2A 2YN0A 6AT1A 3S7TA 5E8JA 1SYFA 2PZJA 3HBFA 4GM0A 4RK4A 5CYOA 4IJKA 1EKXA 1ELOA 3B6YA 1AH9A 2JDID 2B2WA 1TW3A 3WLKX 1QG0A 1GN8A 3PXEA 1V0JA 1EQRA 1RLIA 5F2OA 3FWHA 3SEQA 2VOJA 2ALYB 4GM4A 4P5DA 3BF7A 1S2IA 3K1JA 5BSFA 2RGGA 1RZRA 1BROA 5JHHB 4D7AA 4JP8A 2AWNA 4OIFA 3W5HA 1VHJA 3ZIAA 1ORRA 1YKGA 2IP4A 4MJ7A 2ALJA 3QM1A 3VV2A 4BKRA 3O95A 2C2OA 2EXDA 3RC2A 2RONA 2YZ7A 4WORA 4CW7A 1VGQA 3DM1A 2VK4A 2O5VA 2AXQA 2D5BA 1KHHA 3RADC 4RM2A 4OO3A 1MR3F 3STXA 3CLSC 1C7FA 5IYZA 3ANMA 1CQZA 3MQ4A 1LDYA 1ECLA 3LE8A 3OTQA 1YE5A 1Z34A 1SBTA 5KYLA 5BQPA 1XVUA 4FC6A 4JT8A 4IIFA 2AWOA 2GAFA 1QF7A 1BJRE 2IS1A 4PYOA 3UANA 3VR0A 4ZUJA 3NI2A 4A73A 4Y6GB 3G2KA 3K81C 2QD4A 4DMKA 2R6CA 2Y0DA 3L0OA 3A1SA 5FOWA 2K04A 1EVJA 1T1GA 1FQJA 4MYHA 2FK8A 1OFUA 4R8IA 2PN1A 4XSHA 2OBNA 3PD0A 2V96A 1HFKA 3HBMA 2OPBA 3A7LA 3R0QA 3Q10A 3MB8A 3GV3A 4UJ5A 1H4VB 5I7VA 4D42A 5LQCA 4IO1A 1S4ZA 4L3VA 4PAOA 1IVYA 6ABPA 2J7ZA 3GJ8A 2IH4A 1AZLA 2A6HD 1IBMQ 1C8VB 2BKLA 1BMFD 1EX1A 2J7PA 3SC3A 1LBQA 1Z12A 2B2CA 3NUQA 3BYTB 3OM9A 4KWHA 3AUAA 3AESB 3SMVA 1FFEA 2QLBA 1XQXA 3R6DA 4P31A 1XQVA 3AZQA 2Y0SE 4PCUA 2PGOA 4G8DA 1PD0A 3CMAA 4YUYA 3VNBA 1G9XA 3ENVA 5HM6A 3OBBA 1PKXA 1PJCA 3EDYA 3R24A 3KUKA 4H27A 5L3SB 3TGLA 2R0QC 1QAQA 2DKFA 1X56A 5IS2A 3OQBA 4KQFA 2CGEA 3C3KA 1RWWA 4I0WB 1ACJA 3L7YA 1UZMA 4ES6A 1H1TA 4NI5A 4JX9A 2PTGA 3FNHA 3GJZA 5JHGB 2BE5C 4KO4S 3CCEA 3KTAA 4CU5A 3VO8A 3M1YA 1GXSB 2EL7A 2QRVA 1R0ZA 3UMBA 3UC5A 1STBA 3DMFA 1QK5A 1W48A 4HH3C 2RSNA 2NU6B 2FP3A 3QVXA 4QQ8A 4DT1B 1CY7A 2NGRA 2QRJA 4JWKA 4B31A 3SXHA 4R1NA 5AKZA 3L9WA 2E5LQ 1LK5A 3CPJB 4QHTA 3NWEA 2H57A 2PLRA 2BGTA 2ADOA 3AR2A 4J1MA 4PM4A 1U5BB 3AJ9A 3GFOA 3T1HB 4CKBB 3A26A 4LE2A 3QPDA 2DY0A 1TKBA 3LPCA 4BO8A 2ZUSA 1QHNA 2GERA 3ZV6A 4E2XA 4ARVA 5K7SA 5IGBA 2L17A 3SQLA 1TGVA 3UYKA 3HRZC 4Z3DA 4U673 4HB3A 5IF3A 5A6SB 2EWWA 3ZGXA 3AW8A 1T3TA 5DGXA 1ADYA 2X9VA 3VSDA 5FK9C 2Y1WA 2RHTA 1R10A 2HT6A 3EAQA 1MB2A 2X9GA 4XM1A 2LDXA 3L06A 1GUAA 1UWVA 4S2UA 4WAUA 3N1UA 3BSFA 3PE6A 3CLHA