3PUZA

Crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
total genus 88
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puzA01
5DISB 1NI3A 2OXRA 1GAJA 3RC3A 5GROA 5A4JA 4Q1CA 4A2WA 1QG4A 1FTNA 4P33A 1KI2A 2D06A 1HNWL 3BZKA 4A93G 2UUCQ 1E4VA 4DNRB 3TREA 3U50C 1G3RA 1SKQA 2ZJBA 4LJAA 1CJUC 2RH5A 3DPUA 3IEVA 4HDCA 4XIGS 2XSZA 1IL2A 3SJBA 2RHSB 1KI1A 4AY2A 4QL5A 4DR2L 3ZS8A 3S2HH 2OTLA 2UXCL 1BIFA 4QG7A 4R98A 2ATWA 1J5EL 3CRKC 3HOZH 2B6HA 2ZREA 3CRVA 3HYRA 3MWLA 1G5RA 3OE7A 5JFGA 3PGZA 3BS4A 1F6BA 4MDEA 3C4JA 4A3LH 2CCZA 4A3JH 2NN6H 4IJMA 2G0TA 1KOFA 4XWAA 5IYCG 3TMKA 3K9HA 3ZJYA 1ZBDA 4EPXA 5M3FH 4DC9A 1E94E 3EA0A 1E3MA 1GNQA 1TWFH 1LF5A 1W44A 2CBZA 5A5GA 4B3RL 3FHCB 1JI0A 5DI9A 1XTKA 1GRQA 3P20A 1MJEA 5C18A 1YZ6A 5FBWB 4F4CA 3ND9A 1U0JA 3CMAA 1KI8A 2YWFA 4EQ6A 1PA6A 3MJRA 4MTNA 4HDOB 1ZIPA 2IS1A 4GMXA 4UNRA 2JEBI 5M3MG 4DWJA 2MO0A 1YJ9A 2XGJA 4MITA 1P2SA 3OEEA 1EIFA 2IWHA 3C8UA 3LLUA 1IN6A 1XPOA 1G17A 3GLHE 3GLHB 4BFVA 1KD1C 1N0WA 4CW7A 4DK3C 2QBYB 3REFA 2JLWA 1V5WA 4TQUS 2C77A 1FUUA 4LBVA 5EE3A 3X1DA 4R1JA 4KV9A 5KNDA 4MZ9A 4D0NA 1WQ1R 2NVTH 2V54A 4MH0R 5B30A 1W7AA 1LTQA 2BA0A 2IXGA 2PLFA 3JAMc 1AKYA 3VKWA 1BDOA 4YCVA 4DV7Q 3MWYW 3NWJA 1YZNA 4BFZA 4KU4A 4HAUA 3WMGA 2QTVB 3A37A 4M1YA 5FLMG 1XJVA 2WWGA 4DV6L 3AH8A 2WZQA 4GN5A 4TLDA 4FINA 3HKSA 1IBRA 1MOZA 3R7WA 1W46A 1UEBA 3TQYA 3OFND 1NBWA 3BC1A 2DNEA 2A68D 4IPDA 5FLXc 1KK2A 2Q6TA 3QVVA 2WOJA 4LF9L 2FA9A 4O25A 4PZ6A 3N6RA 1I6VC 2W00A 1FJGQ 3KLWA 1OKKD 1CKOA 1T3LA 3EIQA 4P31A 4LYJA 1ELOA 2WWHA 1XNRL 2XZLA 1XF9A 1SXJD 2GK6A 1DS6A 3I4LA 4BBSH 2GAOA 3KJPA 3CH5A 3M4YA 3L0IB 4JYBA 1K73C 1PUJA 3CR7A 3OEHA 4TSFA 3RS2A 4JG2A 2G1JA 1HT2E 3IHLA 4BBRG 3DM3A 3AVUA 4JC0A 5IYDG 1II9A 1YVDA 2HT6A 4NDZA 4LWCA 2QMHA 4HAYA 1QVAA 1EX6A 4URWR 3LVQE 4B6EA 4YHHQ 1VQIA 1AE2A 1ZM2A 1N6PA 2WWFA 2WM9B 2QBYA 2XTNA 3NEJA 4LHWA 2GXQA 3FYHA 5JBQA 5HCIA 3BFVA 3SJCA 3T1VA 3Q7PA 2WV9A 3M9BA 2PBRA 5HZKA 5TXGA 3I62A 2CLSA 4DLVA 2JA5H 1II0A 1JECA 4XSHA 1AS2A 3AKDA 1ZUHA 2IYRA 1ZYUA 1QVCA 3CNOA 4CEHB 4QIWE 4DCTA 1OJLA 5AJ3Q 2I4IA 4M1KA 1D8LA 3I56A 1VG8A 2C95A 4KJZA 4ZI2A 5F98A 4V0OA 1O7LA 3PUZA 2JJ2A 4HDQB 2IHEA 4TSFD 5KNCA 4URZR 3WNCA 1KDOA 1MO6A 3DM5A 2JATA 4D25A 5IT9c 4JI5L 3K0AB 3M85A 4KFRA 3MXNB 4AH6A 3M4QA 1IXZA 5D3MA 2IUUA 3TE6A 2R7FA 4IW3B 4Q02A 2J87A 5AJZA 2NTYC 2P6UA 4DT1A 3RWMB 4B3FX 2GN5A 3CC7A 3GJ8A 821PA 4O0AA 2CE7A 5LPNA 1QZGA 4NONA 4KI0A 1KI6B 4RD2A 2RGCA 3TVDA 4JK1C 1JPJA 2AWNA 4CRWB 3NTUA 4OHXA 3K0EA 3H84A 1QUQB 5AUPB 2SHKA 1TF2A 3CR8A 3CD6A 1X65A 4LF6Q 1XFAA 2BOVA 2J5XA 2VYFA 3EIEA 3NBHB 4IKEA 5KSOA 1E32A 1DXMA 4Q01A 2A2ZA 3PO3H 5FLMH 5JS7A 3VNUA 3MSXA 2BCGY 4LGMA 2ONJA 3BH0A 3F8TA 1S2MA 3BJUA 3A5ZB 2Q3MA 1N36L 3NXSA 4CDGA 3DXJC 4HAZA 4OO1G 2Q9CA 4HB4A 4QNRA 3G82C 4LBZA 2JA7H 3GD7A 1DVRA 1Z0KA 3TEHB 3QG1A 1RW4A 4A0FA 2HIXA 2GVBA 3GTKH 3GQBA 3OIUA 3UDFA 1XBTA 2FU5C 1DCZA 2ZSFA 4LUZA 1P75A 2W6JA 3QNUA 2KCCA 1G16A 3QKUA 3QKRA 3U3KA 3GTLH 3EZFA 4DUZQ 1VCOA 5CIWA 2Z4SA 4D4JA 2WIAA 5FL7A 3RLOA 4DEYA 1M2OB 1XTSA 3RNLA 1UAAA 4KAXA 1YU9A 5BR8L 4NCNA 1YZLA 3CPEA 4M1MA 1XWIA 3LXRA 3ZYCA 2AXNA 1GUTA 4RCYA 5AUOB 4B76A 3BERA 3LXXA 3I8XA 2ZAOA 1Z47A 3MLEA 4DCNA 3QOFA 4KO8A 3S1RH 3GJ5A 4D81A 1KKLA 4DV4Q 2K14A 4R71A 3GLFA 3EX7C 4NXNQ 1I6HH 1IOZA 5J47A 4C7OB 3LW8A 4CT5A 1CFMA 3W6PA 2JLUA 3THWB 2BM0A 4DLTA 1MO4A 3WWVA 4TYQA 1R10A 1S9DA 2ZRFA 1Z0IA 1W47A 4GN4B 4BRUA 3IBYA 1RC8A 1L2TA 4ZI3A 4OHYA 3RR5A 1YJNA 3CRQA 5EE1A 2JA6G 5BN4A 4OX9L 4L8JA 4TMKA 1OFTA 1SGWA 2GJKA 1HY3A 2ODWA 5FL7D 1ZKOA 221PA 5E7NA 4LF4Q 1E9CA 4Q47A 3G4SA 1FUKA 3U3RA 4YWMA 3QKRB 4TZ6A 2ZJ5A 3NEMA 1U9IA 3KDSE 4A8JB 1EESA 3HU3A 4A2QA 1KAGA 3LBHA 5DHAA 2XB4A 4MYTA 4QBIA 4IDOA 3ZVMA 2W2TA 2F1JA 2RHMA 2BEJA 5E7IA 4PMWA 3I55A 1NY4A 1QHHA 1VPLA 1UKEA 2NO7A 4PC6A 5A0FA 5FFMA 3ZZUA 2BE5D 3IIKA 1VECA 2L0XA 4LY6A 4DXAA 3Q5EA 1T0HB 3DDCA 2DGYA 3S16H 4PQFA 2XX3A 4E09A 1K5DA 2IF0A 4PTLA 4DUGD 4A3MH 3FFBA 4I1SA 3GEIA 5CK5A 2VPPA 3U44B 1SR3A 4ZDKA 2BEKA 3KKQA 1KSFX 3THXB 2AWOA 4C3JH 3FP9A 1P8LA 2UUAL 3S17H 1LF0A 1YR8A 2VP0A 3IO5A 5H8WA 2PPBC 1FQJA 5K8TA 4L16A 2WICA 3MAAC 2A7QA 1VHTA 1IN5A 1YITA 3H4MA 4GDFA 4C3HH 4JV5L 2VLIA 4XD7A 1KIMA 1YE8A 3K9NA 3HR8A 4EPVA 1GIAA 1BO6A 4FMDB 4DNTB 1VHLA 5B58C 5J40A 2FE4A 3A1UA 1RRCA 2RHQB 3FPAA 2ZRPA 1JXMA 2QAGA 1H95A 4AQYL 2D7CA 2YYZA 3EW9A 4R7ZA 3J81k 1L1OB 3KDFA 1E2ZA 3CIOA 4JT4A 4JI7Q 3TAUA 4N0DA 4PC3A 2XXAA 3A4MA 4Q48A 5IHPA 4KFTA 3AGQA 1RFLA 3F5FA 3IIJA 4V0NA 1R0WA 1S0UA 3ZIAA 2J9RA 2ZQ5A 4TTRA 2BCJQ 5JSZA 2BMEA 1N5KA 1XZQA 2EFCB 4LHZA 1XNQQ 2ASBA 4A3LG 4WXRA 4A3KH 1G64A 3D7MA 1Z0DA 4QHSA 1UKVY 1V9PA 1NJIC 4YQFA 3TK1A 4JI8L 1Z6XA 1YJ5A 3GJ4A 1NVWQ 1E2NA 1E2WA 4Q4HA 4QGFA 2JJ8A 3I32A 3HOUG 1M8PA 3LD9A 4LV8B 5TVKA 4DSTA 5FUWA 2F7SA 2HHHL 4PX9A 3UATA 3CCQA 1Q1QA 2VL7A 3LLMA 4OI0A 4Y52H 3PUYA 4DR4Q 3AVOA 4M1OA 1R2QA 4DR4L 2G3YA 4DKAC 2QT1A 1J8YF 1NY5A 5CLLA 3E2IA 1Z28A 3T1YL 3BGWA 3WRYC 1UBEA 1HZBA 3KJOA 4JI0Q 4FMCB 4KYUA 1TX4B 2JIZA 1KQSA 5EZ5A 1X8KA 4L5BA 2EYUA 2QQEA 3I4OA 4LF4L 2KE5A 3LBIA 1I94L 1XPUA 1XEXB 3HR7A 3QBVA 4LHXA 3I61A 2JXMB 2WJVA 3EZ2A 2NOAA 4UP9A 3DLLA 4HZUA 1OPXA 2VO1A 2VS1A 1XMIA 4DPGA 2AKYA 4L5SA 1US8A 1FX0B 4L15A 5H1SE 1Y8PB 2EIFA 4Q7JB 1L1OA 3KDFB 2IYTA 1OFHA 1U5KA 1N33Q 1MRSA 1OSNA 2D2FA 2GVAA 5M3FG 2EJFC 2GRJA 4GMDA 4PPQA 4RJLA 1U98A 4IVRA 3H0GG 5HCNA 5L3SA 1BYIA 3ER0A 4IEIA 5KO2A 3ECCA 2KSQA 1NVUQ 1YZGA 2W83A 5BYJA 2KB0A 3ZS9A 4EJSA 3FKSA 4OJQA 3OW7A 3F2DA 3CF0A 3WXMA 3G6EA 2FSGA 4APVA 2OCBA 4YWLA 4RSGA 3RRZA 1RPZA 6Q21A 4OBEA 5J4HA 1ZU4A 1L4UA 1R8QA 1XCMA 1VQ8A 2RGGA 1Y69U 2YC2C 4QQBX 3TVTA 1CJKC 1EK0A 3PFIA 4R4TA 3NG1A 3G0HA 1QHHB 3TUIC 4C0HA 1NMGA 3W5OA 2VA8A 3U44A 4LSGA 3NE5B 2WJHA 2PCFB 1TPZA 1VQGA 3EIHA 4US1R 3K7AH 5UKDA 3TNFA 2EWWA 4A36A 4BA2I 4POGA 2VL6A 4W5WA 1S40A 2Q2HA 3A1SA 5KPJA 4C2TA 2BKEA 2H5XA 2CDNA 1GL6A 2PT7A 2B8FA 1K8GA 1GWNA 1NVVQ 1ZC4A 2C9CA 3FMFA 3LV8A 1T6NA 4GOXA 1EQRA 2FFAA 2BA1A 3E5HA 4P73A 5LMUQ 3LRPA 5EP3A 4KFSA 5FOTA 1IJEA 3ZVLA 4Y7NH 1OH6A 2BVNA 4Q19A 3QI2A 3MWKA 2ZVQX 1A1VA 4OO1I 3WBKA 4BBRH 2ZI9A 4RKEA 1ZIOA 4CZ2A 1IQPA 4PQRA 3KB1A 4TMZA 2PCLA 5TV2A 2VSFA 3FKSD 3BB3A 1NY6A 4L5RC 1VCNA 4I99A 1E0JA 4M21A 1YHBA 4MA4A 4ME3A 1WRBA 2DWOA 5DYGA 2YTXA 1ZYRC 4GSYA 1Z8FA 2H5EA 2XGTA 1KMHA 2W0MA 3SC3A 4BY7H 4LUCA 4QGUA 2ZI6A 5LBIA 1N6OA 5JHGB 3M0EA 4A2PA 3K7UC 4C0BA 1IY2A 2LKCA 1P62B 4H02A 4TLCA 5DN6D 5GADl 3P32A 2GILA 1VCIA 1N32Q 4NU0A 1W4RA 4C0SA 3MEFA 3Q3JB 3TQCA 2QM8A 4M53A 5GVSA 4PPFA 2FDCA 2J3EA 2FGJA 2N46A 1AS0A 2D7DA 2FFBA 5JEDA 2I5MX 4X8LA 1UDXA 3VDYA 1XU4A 1YJWA 3TZUA 2R6FA 4JLDA 5G40A 5EXTA 3WRXC 1DD2A 3F1ZA 1ZNZA 2X19A 5DLQC 4AURA 4GP6A 1XD9A 5C0XH 1OH7A 3HOWG 4XD7D 2VBCA 5DI3B 4M9SA 1VQDA 3PXGA 1NG1A 3BFXA 5J4LA 2IXEA 1QHXA 3FWYA 1Y8OB 1I2DA 1P9RA 2W6IA 4HZUB 4PAMA 5FBRB 2H7VA 3KJHA 4EKDA 1TEXA 1G8YA 1H9SA 1PH5A 1OXVA 1DOAA 1JPNA 1ZP6A 4AG6A 1G9XA 1HA3A 3I73A 1E69A 3T1OA 5TARA 2AUJD 3WNBA 3TRZA 2EQBA 2PX0A 4A75A 2WSSA 5DN6A 2CWPA 5FPSA 4QGHA 4DUYQ 4AC9A 3H0GH 3NDBB 5FBLB 4ZDIA 4B35A 2V8OA 3KTAA 3OIVA 2O8BA 4NXML 1W48A 3KJIA 3LO5A 5JMTA 3S14H 2Z5FA 4Q00A 5FR2A 4LW1A 3L2PA 4IFDH 3I5YA 2PCJA 4QOSA 2GJSA 3B13B 3STBD 4IXNA 4TL7A 1E9SA 1EFHA 3GTQH 1A2KC 2IUSA 3BK7A 1EWHA 4G7OC 3HKZG 1SKYE 1C9KA 3I4NH 2R2AA 3AF4A 1GZSA 2ZTCA 1XNRQ 2OILA 2WKQA 4QC2A 3U3OA 3UG7A 4AG5A 2HXSA 1I4DD 4M9XA 4N1AA 1KYIA 3B6EA 4QJ4A 5FPHA 2R7DA 1DAKA 4QJFA 3NHAA 4MRNA 4B2PA 1KL9A 1KJWA 1JR3E 1JAHA 2FPKA 3HU2A 5JI3E 5P21A 4PPNA 1RYFA 2ALYB 4JVSB 3CX7A 5A35A 5L3RA 5BR8Q 2ORVA 2JLXA 1QHSA 1ZW6A 4XTCS 1VQEA 4JOIA 2YNMA 3A36A 2G0NA 3VR4A 2J0UB 1ZM9A 2WKPA 2F1IA 4WAUA 2CK3A 4GLAC 1XPRA 3U2QA 1DGSA 4DV0Q 1COWA 5JCZA 4G01B 4C2MH 1IYVA 1CKEA 4JI1L 3B85A 4PQYA 4Q1FA 2QL6A 1X3EA 2ZJRA 2PMKA 5IYBG 3F0TA 4JLMA 3FTQA 1JR6A 2WB1G 2G83A 1X56A 2I5HA 2AFIE 3RS5A 4FMCF 2A30A 1XB2A 1Z3IX 3J80c 1KY3A 3H3VH 2R6GA 3AFPA 2HT1A 2JLSA 1P16A 5EP4A 1L2FA 1GUGA 4PSVA 4B32A 5HKKA 4LFCL 5IE8A 3A5UA 2GEDA 1R6BX 1OXXK 2RGEA 2N42A 4PR0A 1FMLA 2YJTD 1ZC3A 3TSWA 3V4FA 5J4YA 1D2MA 1G18A 2VQFL 2R7ZH 1E79A 2DFNA 2F3IA 3E1SA 1XJ0A 2QNRA 4LZZA 3BRWD 4HLDA 2V6IA 3QPUA 4JI7L 1SQ5A 3WYGA 4NH0A 4JVLA 2WTUA 1V8QA 4IPHA 3CCUA 1K8RA 1MH1A 1NVXQ 4A76A 2O5VA 421PA 4F4JA 1OIXA 3RNUA 5AJ3L 1W0JD 4NTZA 1W3SA 5L3VA 4P3YA 1E7ZA 3U7GA 5KNBA 1WBDA 3KKPA 4JLPA 1D7QA 1PJRA 1DAGA 4HLQB 1IXRC 2FZLA 3OTOL 4QJ5A 4UNPA 1AIPA 1KRTA 3NBYC 4KKTA 2D3WA 3B1XA 1NIJA 3CUEF 4Q1EA 4LUVA 1VQFA 2Q9BA 3LFUA 5BW8A 2ZRJA 2CQOA 3BAFA 3RS7A 2QP9X 4IEEA 3RSLA 5JWRA 4DV2L 4OHZA 4XOIA 4L4UA 3ICQB 4EQ6B 1G1MA 1RRPA 3A7AB 3GLGE 3GJ7A 4JLJA 2LXJA 1DARA 2W58A 3F3YA 4S35A 1CKMA 4KYIB 5FOUA 3K70D 2RGNA 1FNMA 3C14C 2R92G 4FCVA 4Q4LA 1T5EA 2JA6H 4QBGB 2GCOA 3GJ3A 2UUCL 2BIFA 1TU4A 2ZJQA 3KTAB 2QP3A 4RD0A 4A15A 3R9WA 4DV6Q 3CCMA 4DV5Q 4KODA 1DAHA 2H57A 4BFTA 1IXRA 3JAMi 3CP0A 2WVJA 4RZ3A 1EFUA 2C9YA 2J41A 3P26A 2AFHE 1M7HA 2R62A 3R9IA 2PI2A 1GNPA 4ACBA 2B92A 4A3BH 4NYIR 1Q1EA 1PUIA 1E24A 1U0HC 3R8FA 3UDXA 4DSNA 1LFDB 1JQJC 1QHIA 2B63G 2DY1A 3QPVA 1OYWA 3U4QA 2WJJA 2OSBA 3G5UA 5AR1A 5IYDH 3QJYA 4DIDA 2Q3FA 4D82A 4HUTA 2AD5A 5FTMA 4OGQC 2A6EC 3T1HL 1G8FA 4DV4L 1ZNYA 3B78A 3Q8XB 2WWIA 4LF7L 1HH2P 1A2BA 4JJZA 3PG5A 4IFDJ 4GNXA 1S9HA 2NZOA 1IBKQ 3AV0B 3K81C 3KKNA 1HNXQ 2UUBQ 2XAUA 2ZRBA 1LB1B 4YMTA 621PA 3I3SR 5GQOA 1HPCA 1G5PA 3B5JA 1XD2B 4DV3L 4CYMA 4GKJL 3GMTA 2X77A 1H8HD 3QXSA 1IW7D 3MMPA 2ZTEA 1KTVA 1H8ED 5JEEA 3BH6A 1JB1A 2WAYA 4PC1A 3OAAD 1WFQA 2N3SA 4G5QA 3EC2A 4DCUA 1HQYE 3MUFA 4BFXA 3VMFA 1DEKA 1G8HA 2ZI3A 1VS0A 2JE6I 5KTYA 5C44G 2DNCA 3U7HB 1JMCA 4ZCLA 2FX3A 3FB4A 2NPIA 5G3YA 1Q0UA 5FI1B 1TUIA 1IAQA 2R6AA 4C7OA 3E0EA 3B2EA 1BOFA 2QPAA 2UZIR 1KI9A 3PF4A 1KHTA 4A3GG 2WHXA 3B60A 4LJ5A 5FOWA 4DR2Q 1Y1WH 4YLGA 2XJ9A 1TUEA 2O8EA 1RE0A 2DFLA 3ADKA 4ZDWA 3OOCA 2NQ2C 5C46F 4B3XA 1FYCA 1YHAA 2YHSA 3VQTA 1UE7A 1COWD 1X54A 1N6LA 4P4SB 5FI0B 4D6PA 3GO5A 3VKGA 2YV5A 3AVVA 2CCKA 1SROA 2IYZA 3U4ZA 1JJCB 2C8VA 5TDHA 2JLVA 3TGPA 4XVUA 2ZUDA 3CX8A 4LF9Q 4GKKL 3OEED 5IWAQ 2EFGA 2QY9A 1CKNB 4KLKA 4OONA 2CMKA 2ORIA 4BY1H 3DOFA 3I1FA 3QKTA 3T5DA 3IQXA 1MIUA 1Y1VG 5AJYA 5K36H 4HJAA 1RKBA 2DFTA 5M5XH 2CCJA 4LDJA 4A92A 1ZNXA 4HR7B 1GHJA 5JS8A 2AUKA 1MO5A 4P0TA 4LNQA 1IY1A 1R5NA 1SHKA 3D4RA 2HJGA 2RMKA 3T61A 4CEJB 1L0WA 4UJ3A 4XWKA 3AVPA 5D3QA 1Z63A 2XNDA 2KBEA 1YNXA 4LC1A 2VF7A 1SRUA 1CR2A 1FMJA 1IONA 4QL3A 4X62Q 2QG6A 1VYVA 4P75A 3W6NA 3E9HA 1FZQA 2WMNB 3CX6A 4OWXB 1KC8C 2ZYTX 3BIFA 2ZJ8A 3B9QA 4TMWA 5KOYA 4DV2Q 1PLKA 2N1BA 3B7GA 3QXHA 4GRAA 1F2TB 4IFEA 2HQLA 3V9PA 1MRNA 2IYWA 1J70A 4A4IA 3IPXA 3MWJA 1QJOA 1XX6A 2OWOA 4A4DA 4NXNL 1Y63A 3A58B 3W9YA 4Q1DA 4FIDA 4QNMA 4Q1AA 2PQAA 2EW1A 4D0GA 1J6QA 1JJ2A 1T8UA 3C16C 3T1TA 2HCJB 2OCEA 4EJSB 4DR3L 3M1IA 1A5TA 1PHJA 1DAMA 2BE5C 3HYTA 1X3FA 1VKJA 2PZEA 2VEDA 1TU2B 3SJZA 4B2IA 2A5FA 2J1LA 4LX0A 4A3EG 3UMSA 3DM9B 4A0GA 1VQBA 2BM1A 1RL2A 4Y0VA 2HXYA 1HR0W 1GITA 1GKYA 4Q9LA 2NIPA 4FI3C 1I94Q 2ZUCA 1CEEA 3UE0A 1NLFA 2RF4A 4DR6L 4Z51A 1ONBA 3KKOA 5B64A 1HR0Q 2VW9A 1HV8A 2QORA 5CYOA 1G41A 1KAWA 1PZNA 3NH6A 2BV3A 3B1ZA 4NCJA 4MNOA 4ZCMA 2GESA 4DDVA 3EQLC 3MJHA 1GUSA 1TKWB 3KL4A 3PEUA 4LRWA 1N32L 2EXDA 2REBA 3FMPB 4XWOA 1N6NA 2IW3A 1S72A 1E2IA 3LW7A 4LYFA 2ZE5A 3QF4B 2JJ1D 3FPPA 2F1MA 2QROA 4XTRA 1JR3D 1FOEB 1GL7A 8OHMA 3OHMA 1MO3A 3S15H 4X64L 3QENA 3T06B 2UUAQ 3JC66 4R4CA 5FJ8H 4Q7LA 4ZO4A 1R5OA 5LD2C 4FWIB 2NPFA 1E1QD 1T5LA 3KZ1E 2WSSD 3FMOB 3GLGA 5HE8A 1NMFA 2ES2A 4Q4JB 2YTYA 1KZGB 2CVHA 4EJSC 1IN4A 4BZPA 5FOSA 2QQ0A 4LPSA 2H17A 2ZRNA 5EUMA 4LBWA 1NN0A 4CEJA 3GEEA 2V55B 2C96A 3QXCA 1G3QA 4QHTA 3K70C 4AKIA 1JXOA 1YRBA 4JZKA 4JI0L 2FSIA 2BH2A 4GOKA 4M8NE 3SJAA 121PA 3MCAA 4BBSG 3KXIA 5AK0A 3TLXA 3B6YA 4OQXA 5DNYB 1LNZA 1NP6A 3ASZA 4HUQB 3ZDQA 3BZCA 3AUXA 1BMFD 1X1RA 1KO1A 1Z6TA 4PZYA 3C5HA 1X8JA 1CTMA 4G3XA 5C2JB 2B3GA 2IYQA 2NGRA 1NBMA 2IS4A 3RABA 3KXLA 5KHOC 3GLFE 1FL0A 3R7WB 4H44C 3QPWA 3HGBA 2LXKA 2C9OA 2DWQA 3RN2A 1HZCA 4K81B 4L5TA 3PEWA 3I4NG 4DLRA 4ON9A 2C99A 2V7QA 4G1UC 4UP8A 4JBKA 4IJHA 4MGYR 1IN8A 2FPMA 2Y8EA 5CB6A 5KDOA 2YWHA 1F48A 3VR2A 1SULA 2H16A 4R2HA 3W6OA 1HEIA 1DADA 2HF9A 2PZGA 4X65L 1N0UA 3CNNA 2J0VA 3NC1C 4JT2A 3SI7A 4BLRA 2ZRKA 3PJRA 2P65A 5DIFA 1KGDA 3CM0A 3UXMA 3M4PA 1EG7A 1WYDA 3D6TB 4PO8A 3HOXH 2AHOB 2TMKA 3P1JA 5HKKD 2VTKA 3AP1A 3UWKA 3PO2G 3H15A 3A1WA 2DBYA 1IYJB 2QAGC 2ZU6A 1OB2A 1GUNA 3G71A 1VIYA 1YNJC 5C4XH 3GJXC 1ZJ6A 3VX3A 1MJCA 3CLVA 3TW4A 3O8DA 5CDFA 2ZITA 1JJVA 2IX0A 3MXUA 4MYCA 2C5LA 2GK7A 2BBSA 5JJLA 1P61B 4M1TA 2GETA 2XOKA 1DELA 5H1YA 4RMFA 3HJNA 3VHLB 3L43A 3CCEA 3QEJA 1TADA 4NBSA 2WB1E 3TRFA 1EFCA 3DZ8A 2P5TB 2L15A 1GRNA 1O7IA 4BFUA 2Q2UA 1UE1A 3RZOH 2H8KA 3A1VA 1WI5A 5CM9C 1I4TD 1VF5C 5ELXA 3SOPA 1YNNC 4NE2A 1YZUA 2V1XA 2X2EA 2Q3HA 2VQEQ 1CTQA 2KHIA 1P5ZB 3KQUA 1SVMA 4CT4B 3CBQA 2IT1A 4LC0A 4Q21A 2IBMA 5B2ZA 3PEVA 4NYJQ 2GZHA 1WMSA 4X66Q 1WXQA 2I3BA 3SYNA 4CF7A 5L3SB 1W0KD 1W5SA 1QG2A 3AQ4A 5FL3A 2J7PA 3DEFA 1P60A 2F4VQ 1U9IC 1NMYA 1NRJB 3UMFA 1KJYA 2G9NA 1SMXA 1S3GA 4NYMQ 5IF9A 4BFSA 1TNDA 3CW2A 4UXIA 2VZAA 1EWRA 3SFZA 2XOKD 3M6AA 3T12A 3UDIA 5IT5A 4P4UA 1KDPA 2KA7A 3TIFA 2QU8A 2CXXA 5FR1A 1FVIA 2IUTA 3P4YA 2CE2X 2VUMH 1L7VC 2ORWA 3KUDA 4MGIR 4LFCQ 1P2VA 1T5IA 1O87A 2QAJA 1DTSA 5GAHC 2UUBL 1KSJA 2UZ3A 1OV4A 3JZMA 4IVQA 1GDDA 4R2IA 4TKOB 4B3SQ 5EXPA 1VG9B 2OLKA 1OHHA 2G88A 2VP6A 4V02A 4F93B 4DK1A 1Y14B 2MSDB 5EJEA 1G6OA 1OF1A 3OZXA 4RCZA 4OQNA 4PC2A 2VRWA 4JI1Q 4KLNA 5M04A 5E7JA 1HUQA 2J0SA 3O47A 2OBMA 5DLQE 2WPDD 3TKLA 5EZ6B 3ZIAD 1MR3F 1TWHH 4N0EA 4LF7Q 4GOPA 1R5BA 2V6JA 1AS3A 1VG0B 5CJPA 5IY0A 4KVGA 2PEYA 3S1AB 3T15A 1EFRD 1OT3A 3T5GA 4Q7KA 4RFSA 3HOYH 3L2OB 2V3CC 2A1AA 5F2EA 1K5GA 3HOXG 1DG1G 1XEWY 2GA8A 3TSZA 2Q2TA 5IDVA 1XMOL 3AF2A 3K09A 4ASUA 2IX3A 1Q81C 3CCJA 5ELOA 2O52A 2WJIA 4QHYA 3CPWA 3VR6A 4OX9Q 4I1OA 2NN6G 4AIMA 2ZSBA 1K8MA 2L5TA 4Z8XA 3GLIB 1QVRA 3KLRA 4HJ5A 4WJ3M 3TQFA 4O2LA 4TTQA 4HEJA 1GG2A 1BMFA 4DSUA 4RY2A 1E0KA 4Z8YA 4F38A 1RIPA 3T1YQ 1A7JA 2FNAA 4DLXA 4JVMA 4DHEA 1XNQL 4LFBQ 4IJLA 1OHHD 3WNDA 1NBMD 4TYPA 1Z6AA 1N6KA 1CS4C 4X8OA 1W1WA 3V00A 4LFAL 4MKIA 3UPUA 3QKSA 5CLQA 3ULLA 1J8MF 1SVSA 4GN3B 1Z07A 1TF7A 4FD2A 4C0LA 1F2TA 4JI6Q 3DMNA 4IOKA 3JVVA 1VCMA 4JLVA 1E0SA 2XTMA 4I81A 4YXWD 1EFRA 2JA8H 3BB1A 2XZOA 4TL9A 4B43A 1TTTA 2E8GA 1G7RA 4KFUA 4B74A 2QP4A 4DR7L 1S1CA 1TF5A 4DR7Q 3VA7A 4UNNA 3KUCA 3Q8DA 1E6CA 2VIIA 3GCGA 5HR5A 1PMRA 1W2HA 2NO1A 1ASYA 2WBLC 2ZPTX 2ZYVX 4A8JA 4BLOA 1UDWA 1GUOA 2QTFA 2FSHA 3J81j 4UPAA 3H86A 3IPYA 5AJWA 1ZM7A 4HJ9A 5AUNB 2X8AA 2ZANA 4Q66C 2UXBL 3RLFA 2IYUA 4J0QA 1E2MA 3QF7A 3QXXA 4HI0E 1Q8KA 4H0LC 2F52A 1NE3A 1G8PA 3M3YH 2ZR9A 4J15A 1GILA 1X1SA 5TMPA 5LMNW 5FOXA 3L0SA 5EE0A 5IP9H 2BDTA 3I92A 2RGNC 4LK1C 2NO0A 4IO9A 3EPHA 1Q12A 3PSIA 2AXPA 3LY5A 4DKXA 1F5NA 1XXHB 2O8FA 3A1TA 2VQEL 2XEXA 3AQQA 4DV5L 2DPXA 1JALA 4IFBA 1Y1VH 5LMNQ 1XMQQ 1G8GA 1W4CA 1IBLQ 4IOCA 2W6JD 3QY0A 3UIEA 4YXWA 4AQYQ 2JLQA 4M2LA 4P4SA 2HYIC 1K0RA 2C2HA 1NJGA 2OV2A 2VHJA 3U7FB 2Z0SA 2ZR7A 1SVKA 3HDTA 3R20A 4II7A 4A3EH 4M22A 4V0MA 4F7WA 5C4MA 1LS1A 2XXAB 1OLOA 3RAPR 5JWHA 4A3FH 3P27A 2ZRGA 4B75A 2GKSA 3W1BA 1G4AE 3A8JE 3X1YA 1W36B 4NPSA 2BDOA 3I4MH 5JWOA 3BORA 3ASYA 2VF8A 3ICEA 2WAQG 4L9SA 521PA 1DE0A 4AYWA 1E1RD 3WY9A 4HJ7A 4AKGA 4TMTA 4IHQA 4JI5Q 1VQCA 5BQ5A 2V9PA 1R0ZA 2VH5R 3EXAA 4FN5A 5FTJA 4F4IA 1FW6A 2GTPA 3EBEA 1XD2A 2YOFA 3IGFA 3KJGA 5AJVB 4US2R 2PNRC 4A3KG 1RZ3A 2VHQA 3WHKA 4W5JA 4B3SL 5ANRB 4HB2A 5EXXA 2QA5A 1GOTA 2FMXA 3LQQA 4Q18A 1EOVA 4A9AA 2OBNA 4EFLA 1G7CA 4NYMR 4PG3A 4JI2L 4LUOA 3IRBA 2PLRA 1PV4A 2GAAA 3EPKA 2EVBA 4OK3A 3CCLA 5CB8A 1HTPA 1VQMA 2O8EB 3AYHB 3STBC 2JDID 5FJ8G 3AP2A 3RRMA 4NL4H 1O78A 1OIVA 1LABA 1PH6A 3CAMA 4C0JA 4DK0A 1UE5A 2D0OA 5CK4A 4D2IA 4JKYA 1NSTA 4L9WA 3CCRA 2VY3A 3B9PA 1XXHA 3FFAA 1OIWA 4WZ6A 4QKQA 4C2UA 1GNRA 1XTJA 2AL7A 3KJEA 3A6PC 3O8CA 4YMSA 2G77B 2RAPA 4ZKEA 3VTKA 3CWZA 4LPKA 1E9EA 4KHPQ 4ZKDA 2ZT9C 3AF1A 2ZM6Q 1Z5ZA 2WMOB 4JL8A 4PZLA 4R4QA 4UKDA 2BH8A 1FX0A 4X6AH 1IXSB 5KSYA 3FOZA 1B23P 4FDBA 4HLUC 2DB3A 1KMQA 3GDEA 4URYR 4E5UA 3BDOA 1NG9A 4UY8C 3NDPA 1Q82C 2CFMA 5KUTA 3NBZC 1BS1A 2MSEB 3PVSA 2FEOA 5ELNA 2FFQA 3MRSA 1A63A 5GADC 2YC4C 1GKIA 1KDTA 4DZZA 2CHVA 1XMJA 4A3BG 4BLTA 2HYDA 2GCOB 2Q2IA 5AJXA 1U0LA 1VQ6A 1E2EA 1NLZA 1Q22A 2JDIA 2UXDQ 1E99A 3D8BA 4MGZR 4A6PA 2B29A 3EASA 4ESVA 3I7FA 3PO3G 1IBML 4D4MA 4GL2A 4A3IG 2MQHA 2I0QA 3W3AA 1GUAA 5LDDC 1XTRA 2NVYH 3A0JA 3CH4B 4QRHA 1D2NA 2EYQA 1K6MA 4IOLA 3HU1A 4ESHA 2OESA 4JI8Q 3BOSA 1ZUNB 1AH9A 2ASEA 1F60A 4X65Q 2KBFA 2Z4RA 1D9XA 4KBGA 3R8CA 4I7ZC 4G7ZC 1K8OA 2HLDD 2ZVPX 5HGQA 1I4LD 2YWGA 1QZXA 2E5LL 1WDTA 3SBEA 2KCMA 3D31A 4QY7A 1AGPA 2QSYA 4WOPA 5AUQA 1A4RA 4EFNA 4MKHA 4BPBA 4BGDA 1AZTA 4A3FG 1HNWQ 3CO5A 3CRRA 1VYTA 4IPCA 4AYBE 1BBWA 3DL0A 1KO4A 1GFIA 1RRGA 2V7QD 2EVWX 4R4IA 4LV6A 5H70A 5JEAJ 1Z6YA 3C41J 3VAAA 2V1CC 2ECKA 2ZUBA 2D62A 5DHFA 5C4GB 2OCAA 5GJBA 1ZNWA 3EARA 2G6BA 3RSOA 3ZH9B 2J45A 2V4DA 2OCPA 3OIYA 1ESNA 2HV8A 2GWHA 2ZETA 4OQFA 4V0ME 1YR9A 1HYQA 3CQZH 4UJ5A 4ARZA 3ULPA 1HQMC 4GKKQ 3GTGH 5IYCH 4GZYC 3I2ZA 3F2CA 4LHVA 5JRJA 4QGAA 2D5DA 2ZRLA 1Y1WG 2R44A 4DR5Q 3SN6A 3FHTA 4V03A 2NZJA 5IK2D 5CIQA 1GM5A 1WF3A 4URVR 4KN7C 3CNLA 2ZTDA 2LCFA 4JI3L 3CXCA 3L8YA 3DOEA 1W0JA 4JL6A 3THXA 1P7CA 2P2LA 4E22A 1XTQA 2DHRA 3FKIG 2QAGB 3GTOH 2C35B 1AQYA 4EIWA 2I1QA 2C04A 4LYHA 4CEHA 4BY1G 4Q9HA 1YI2A 2ZTSA 1XCGB 5GJCA 1YIJA 1J5EQ 3HOWH 1W49A 4A3DH 2ANBA 2OUKA 2RGDA 2ZR0A 3QQ5A 4QBHA 4RFSB 1Z0FA 4DV1Q 4MRSA 3BG3A 2OQKA 1E22A 2FSFA 4Z1MD 3CRLC 1H9SB 4GOPB 1T3SA 4IDNA 1NL3A 2KJQA 4PAOA 4Q4AB 3LNCA 4A8JC 1VQJA 4M1WA 4MGKR 1QVGA 1XCPA 1TQ6A 4WW0A 2XB2A 5FUXA 4OL0A 3U58A 1D5CA 1KO5A 3RVBA 1PVOA 3CWQA 5HE9A 3QSYA 1HNXL 1IBMQ 3ND8A 1W2GA 4DJTA 2K5HA 2F4VL 5BYKA 2NZHA 1NBME 4EQ5A 3PUVA 3VR3A 3DKPA 5FTKA 4Q03A 2IYLD 1PLLA 3TS2A 1W5TA 5E4FA 5KDDA 3NBFA 3IFTA 4A3IH 4TQ9A 4RG1A 2W2XA 1C7YA 1VTKA 4BFYA 1BYUA 1PFSA 5LB2A 2MO1A 4B47A 3NELA 4ALPA 4LF8Q 3CZQA 3FKQA 4PAQA 3WP1B 4BQSA 2K5VA 1FQKA 2DYKA 4LV5B 4TTPA 4ZDJA 3DZDA 4PHFA 1LTLA 3CPFA 4JVNA 4G5RA 4C30A 3L8ZA 4FWTA 2MFIA 2CNWA 2BMDA 1NMXA 3DO6A 3SQXA 3FGNA 2O8FB 3CONA 1Z06A 4TYYA 4NCKA 4A3CG 3GTPH 1GD7A 4HB3A 2R65A 1G291 1W4AA 1VQAA 3S24A 3G48A 1VQNA 4WBSA 1K3RA 1UE6A 4HAXA 4DB2A 1KK0A 1M6NA 1U8YA 1CSQA 1PH9A 1XMVA 1A62A 1UKZA 2QGZA 3S1NH 1NSFA 1M34E 1PH4A 1A0IA 1B0UA 4DR3Q 4GOPC 1PH3A 1F2UB 2CL7X 5JECA 4OWTB 1XJQA 4DEXA 4AYXA 1B70B 4URXR 1TQ2A 3THWA 4D80A 4M0LA 3EIVA 1SXJB 3KXKA 1CKNA 1FP6A 3VR5A 3S1MH 1RIFA 1LYLA 4G5OA 5SZJA 4AIIA 1W4BA 1XXHE 2UU9Q 4ASUD 1VQOA 1G7TA 1KDRA 4BEBA 2IC5A 1YKSA 2CL0X 3GJ6A 3T51B 1V1QA 2WP8J 2UXCQ 4IDHA 2VNUD 2E2IH 2QM7A 3OE7D 4JLBA 4DLWA 2K75A 5JRZA 2Z6VA 5EE9A 1PH7A 1HT1E 1SKYB 2R7ZG 2HJVA 5J4KA 2X1VA 3LA6A 4EX5A 2JJ1A 1EWIA 5IP7G 1JR3A 4WJ4A 3H94A 2F55A 1NF3A 4XVRA 2B7CA 2R92H 1N6RA 3NHBA 3FKIH 2QA4A 1OFUX 1HTWA 4RZXA 4W7SA 2HLDA 2F6RA 3NEYA 1TWCH 1S4QA 1VYUA 1P4SA 3EWAA 2VSXA 1KK3A 2FWRA 2WIBA 3CW2C 4JI4Q 4A3DG 4Q4AA 4OI2A 3HFZB 4PSAA 2IHBA 1ODFA 3U7EB 1E0AA 2CK3D 3NC0C 5G53C 2QUZA 1E96A 5FUYA 2QF7A 4BXXH 3MG9A 4C0AC 2NVQH 1NKSA 5C1BA 2JEOA 3LDAA 4TWZA 3K8AA 4DK6C 1HH4A 4Q4JA 3W5IA 3KF6A 1FP7A 5LB4A 2WAXA 2K50A 2WJGA 1YRAA 2O8CB 1Q3TA 4GLVB 1UBFA 2I1VB 2PEZA 2RGAA 4KCGA 4X66L 1GRRA 3N5CA 3ERSX 1E2GA 5CYPA 3CC4A 2ZRHA 4HJ8A 1NMZA 5J4VA 5F9HA 1XZPA 1ESMA 2GCNA 1YBYA 4K0KQ 3IHWA 3LBNA 1PYSB 4JBJA 3PF5A 4RD6A 2JQOA 4W5HA 3AVYA 4MUAA 3GP8A 4B3GA 2J0QA 2IS2A 1BKBA 4GLXA 2PNHA 1E4YA 2R6CA 2JA7G 2UKDA 1E2KA 3EN2A 4JL5A 3GFPA 1E2PA 1X86B 1X9NA 4GPTA 1XMOQ 3H1TA 2AR7A 4YMVA 2DCUA 2G1KA 4DUZL 2EDGA 3HWSA 2Z6KC 4O2RA 3X2SA 1JAIA 4TYNA 1JB7A 1Q21A 4HLCA 4G7HC 4ZIRB 2ODBA 2ZYUX 4NCHA 4IOJA 3U4VA 4YONB 3RWOA 3UWOA 3K0CA 1G4UR 5IP9G 2O5IC 1E98A 1Q90A 3CF2A 3ETLA 2AN9A 1QVFA 3SU8A 2ZEJA 1OKKA 3A8KE 2OXCA 2IX1A 4A3JG 2PMDA 4TLBA 4R4OA 1KK1A 1Z6HA 3CMEA 1T8TA 4NZYA 3CZPA 1CULC 2K5NA 1N36Q 1CF4A 2XITA 3CCSA 1Q86C 1S3OA 1HE8B 3QE0A 4DVGA 2LMCB 4Q4HB 5CM8B 2O8CA 4CGZA 1X3SA 1YR6A 1VQPA 1HZAA 1N0VC 2GJ9A 2KI5A 2O0KA 4P32A 1IW7C 4JBWA 2CJWB 2D0PA 3J7ZC 3LNNA 4YCUA 4YY3L 3VHXA 1WB9A 4GZLA 1VIAA 2OHFA 2QMEA 3GLIA 1DAIA 3UANA 1E2HA 2A69D 1T91A 1G21E 3ZQ6A 1X6OA 2NZ8A 3OTOQ 2ZRDA 4B3DA 3BE4A 3PEYA 3E9IA 1TXYA 1B8AA 4HIMA 2OAQ1 4HAVA 3GEHA 4LK2A 3PO2H 4YDSA 5IP7H 4GKJQ 4ABYA 2H1LA 1GP2A 2ZU0C 3EAQA 3W3ZB 3K0AA 1AN0A 3LH5A 4TQAA 1IYUA 1EIYB 3UDGA 5C44H 1CRPA 4JI4L 1G3MA 1YEZA 1AA9A 4ZCIA 3HOZG 1OH8A 4EPRA 4AYBG 5E95A 2R93G 1CI3M 3O8BA 1YZTA 1K8AC 2IHFA 2CHGA 2EFEB 3GLHA 3FHWA 4C3ZA 2J7KA 1QZHA 2WWWA 2F1HA 1T9HA 4H1VA 3C7KA 4B3RQ 1TMKA 1BKDR 2MMCA 3PIRA 3RS4A 4EAQA 2FG5A 4IOMA 4IFDI 1Z7TA 1W0KA 5GJWC 3WBJA 2J7PD 1CJTC 3LWUA 3ZQJA 1XP8A 4EUNA 2AHOA 2LSSA 1GL9B 4LJZC 2KENA 2CCGA 2NO9A 3GPLA 1Z83A 2AKAB 1Z6GA 1VQ5A 1A82A 4NMMA 1Q1BA 4DDUA 1IN7A 3T53B 1SHZA 3WMFA 1E3PA 3AP3A 5F9FA 3OPOA 2VUMG 2E76C 3AVQA 4KHZA 3KF6B 1ZD1A 4IQZA 1IM2A 4DV1L 1CU1A 4M4SA 1XTIA 1AM4D 4ACAA 2QGNA 4DAYB 1VQKA 2LWIA 3Q9LA 4B3CA 1M74A 2GXSA 5KYKA 5L3QB 4LF6L 2IF2A 2GZDA 3IUYA 2ZRAA 1E9RA 2EFDB 2B7BA 2R6DA 2W6ID 3GJ0A 3AB9A 3LWNA 4P4TA 2PMZE 1M90C 1G7SA 2OZEA 4KMUC 4FMBB 4BECA 2FEMA 4CEIB 5AWFC 4JYCA 2BBOA 4DAMA 1AKEA 4DB4A 1I2MA 3N2EA 1DAEA 3CF5A 2KBNA 1GKUB 2LKDA 4ILEA 5B57C 1R0YA 1XEWX 2FGKA 1FPMA 2NO6A 2ZRIA 3Q85A 5FTNA 4JJKA 3K0XA 1YZQA 3WDNA 5IYBH 4H1UA 1WE2A 1VQHA 3VKHA 4Q1BA 1H8EA 2RGBA 4Q9JA 3SR0A 4BWYA 1LVGA 3OAAA 3LGJA 3T1HQ 2NMVA 4AKHA 2WFWA 3GLFB 4DR6Q 2ZIAA 1FJGL 5E7MA 1KY2A 4B3ML 3HOUH 4GOJA 1UF9A 1Z29A 2QT0A 1JJGA 3KF8B 1VQ4A 1U8ZA 2QENA 5G3ZA 3UG6A 4B3BA 1CJMA 3J81c 1P2UA 3K8YA 5IRCD 5GAGC 5FPYA 3CB4A 3W8NA 3HPRA 3CRMA 4JLOA 2GBLC 3CKLA 2A3RA 1IBLL 4DRZA 5FUVA 1N6IA 1P6XA 3HOYG 1KI6A 1XDBA 2B8TA 2EFHB 4AD8A 5HPYB 4HUQA 1TU3A 1K9MC 1PH8A 1YQTA 2Z83A 2O8DA 1KI7A 4BLQA 3KX2A 4WIAA 3THYB 1ZU5A 1CR1A 2V4ZA 1Q20A 3U4QB 2CW0C 2YOGA 2WAQE 1JNYA 1E9DA 2NN6I 1Q1ZA 2PX3A 4QBFA 5CITA 2AX4A 4XVQA 4O3MA 4IRUB 3AFQA 2AK2A 4HIDA 2ZS9A 4M9ZA 2OT3B 4DR5L 5C3EH 1LW7A 2XNSA 2ANCA 2JASA 3L0PA 2K32A 1IY0A 4K46A 4BEJA 2IS6A 1AE3A 2CKZB 1UBCA 2GEUA 4B2LA 2GEVA 1CXZA 1M7BA 3CF6R 4F92B 3TH5A 1WOCA 2I5LX 2QZ4A 2XNDD 1U81A 1ANKA 2QTHA 4G0NA 1XJCA 3BXZA 1HZ9A 2F3RA 2ZRCA 3CCVA 3BJIC 3VFDA 5JHHB 1II8A 1GTVA 1Z0JA 3HP1A 5IWAL 2OO7A 2D74A 3L7ZC 1EX7A 4OO1H 2VSOA 1G3IA 4PO1A 2MNAA 3A8IE 3FE2A 2VP5A 3NVAA 3ADBA 2A5GA 3AVWA 1M1YE 1Z2CA 4P71A 3SYLA 2OFOA 4BZQA 4URUR 1QF9A 4RFVA 4A3CH 1QRAA 2E87A 4B48A 3LAWA 3OFNA 2C98A 1XEXA 4HLUA 5LMUL 4EFMA 4GP7A 5JEAH 4DV7L 2BBWA 3TJZA 3NENA 4P72A 4B34A 1SXJE 1QHYA 5DYIA 1MABB 1US8B 2OAP1 4QXAA 2P5SA 1KRSA 1RRFA 3GLGB 5HZHA 2VHTA 2IY5B 2CEAA 2HF8A 2RHDA 3AEZA 3PCRB 2FFHA 4TLEA 2ONKA 3AKYA 4LJYA 4JIMA 1Q7YC 4DBLC 1DO0A 2ATXA 1KSHA 4DV0L 1CLUA 3AF0A 5TY0A 2GJAA 3WP0A 3THOA 4RD4A 3KQLA 2JEAI 3W5JA 1E1RA 1GVPA 4O2DA 2F9LA 2JLRA 3SNHA 3Q7QA 4JI6L 2XZPA 5FBQB 4BA1I 3U3MA 2IK8A 1S8FA 4QM6A 4AK9A 1SN8A 4LF5L 2GVDC 3K1JA 3OESA 3BH7A 4POAA 1WCMG 3RC8A 1U2RA 2ERXA 2O5JC 3B1VA 4H9GA 4NKRA 4JMPA 4LI0A 3A7LA 4NB3A 2IWRA 5C0XI 3TUZC 1YVCA 3ZJYC 2XSZD 3GFOA 1B9NA 4DV3Q 4QGGA 2W0SA 3M7NA 3AEVA 2OG2A 2X2FA 1OXTA 3MFYA 2DR3A 3CC2A 5JJIA 4JSYA 4ARZB 1CP2A 4U5XA 1KO7A 3SGIA 3SZRA 4D4LA 5KPDA 4OI4A 1XD8A 5HTKA 3T34A 4DLZA 4C4PA 4KKSA 4KN4C 5C0XG 2D2CC 2ZJZA 1AJEA 1W2BA 5M3MH 4KSBA 4ZIRA 3GLIE 1N8RC 2GZAA 3FVQA 3RRYA 3AVTA 1V43A 2P6NA 5SZIA 2VQSA 3IBGA 2IEZA 4R9UC 1KKMA 2F1RA 2EJGC 1G3UA 3K0FB 2IYYA 3UE1A 2A6HC 1KO8A 1D2EA 1DPFA 3Q5DA 2B21A 1OXUA 1DBSA 2BWJA 2QMOA 2Z43A 1X6VA 3NKVA 1HCZA 1RJ9A 2JGNA 5FOVA 3U3JA 2ZJAA 2CLDX 2BMJA 3M4OH 1PH1A 3EPJA 3PUXA 1MT0A 4PV1C 4YHHL 4BE7B 4EPWA 5CJ2A 1C1YA 1P2TA 2FJUA 4JI2Q 2AMCB 4JYAQ 1ZUIA 2GF9A 2Q9AA 1II8B 1P9WA 2QPTA 4UQOA 4DCSA 3W8RA 3HOVG 1N33L 1CIPA 1P73A 3FHOA 2BKUA 4HIOA 3ZVNA 3W1GA 2PJZA 4C3IH 4QFMA 1EXMA 1OE0A 2ZROA 3RRNA 4TN1A 1YHQA 4RD3A 4BASA 4IVPA 2XTZA 4MKGA 1ZM4A 3AF3A 3B8HA 5K8IA 4L8GA 3P4XA 1YR7A 4H13C 1HQCA 1NIPA 1E79D 2F43B 4HSEA 4Q7MB 5DI3A 2Q8IB 2H92A 1X55A 2FXQA 3QBTA 4U02A 1Q44A 4WZAE 2EJMA 4OI1A 1FTSA 2FV8A 2QRZA 4A0HA 5G41A 1OW3B 4D4KA 1MABA 2GVZC 1FL9A 1SVOA 4V0KA 5JEAG 2ZI4A 4AWXA 2ZS8A 5LMNL 3PUWA 3H3VI 3PR1A 1UFQA 1CR0A 2HEIA 2BJVA 3ADDA 1E9BA 3T1QA 1LUZA 2VP2A 1PH2A 1N34Q 2ZJPA 1VG1A 3A4LA 2QE7D 4KXFB 3A4NA 3SYKA 4B6FA 1H9JA 1XRJA 4E03A 3SHFA 4CEIA 2ZE6A 3SEAA 5K8UA 3REGA 3PCOB 4LJ9A 2OQ0A 1MKHA 3MGCA 2O8BB 5SZKB 4TL8A 1KSGA 5C4JH 3S1QH 4OKSA 3WMEA 1IBKL 1F3OA 2N49A 3L0OA 2GHIA 3DMDA 1A8VA 3TBKA 3IO3A 5E3HA 1SXJA 1UBGA 2PI2E 2OM2A 2YVUA 3N2IA 3KQKA 5C0XJ 1UKYA 3EZ9A 4WA7A 2EQSA 1U8AA 2IYXA 3SE0A 1CUKA 3K80C 1EYGA 1ONLA 2K52A 4B3TQ 2N78A 1F2UA 1TQ4A 2IYVA 2VHUA 1AK2A 4LJ4A 4RVCA 4HZIA 2RCNA 4GNXB 4O0MA 4KVAA 1KI3A 3KKMA 4BRWA 1L4YA 3K09C 3TR5A 2YKGA 4TT3A 2E74C 1QBKC 5KSZA 4JOIC 1KHIA 4KLZA 4Q9KA 2PL3A 5L3QA 3W90A 1JJ7A 1HR0L 4G5GA 4LOAA 4NYJR 4B73A 5JI2E 1SVIA 2HUPA 1KAOA 2OFWA 3VR1A 3C5CA 1NJFA 4IXMA 4LFAQ 4P74A 1C0AA 3A8TA 4JLAA 4M1SA 2UXDL 5FPTA 1KJZA 3OF5A 2ERYA 2KCTA 4CVNA 2O8DB 3N70A 2QRNA 2J59A 3IDQA 3U9SA 4B3MQ 1J7KA 4DLUA 5EE5B 4A1FA 4FCWA 4FCTA 2OFXA 1E2FA 4PZ7A 1FNNA 1O3YA 2OEPA 3ONWA 4DNIA 4JLKA 1RYHA 1R7RA 4LCBA 1E2QA 4Q9IA 2MSCB 5D3MB 4DDTA 4IPGA 1NNEA 3QKSB 1ETUA 1FFHA 1Z22A 2W2VA 2VQFQ 1GVNB 2IEYA 1SLJA 3OYYA 3J81i 3PIOA 4LFBL 2RB4A 3I8SA 4OHVA 4RKFA 5DGXA 1VQ9A 1R9TH 1S96A 1Q3HA 1U90A 2BHRA 2JA1A 2ZJ2A 3GFTA 2A5DA 4GT1A 4RD1A 3I72A 1LS6A 1RJ9B 2REXB 3D3QA 4S2EA 4US0R 5LD2B 2REOA 2UU9L 3HOVH 1U99A 1SMYC 3I5XA 1JE5A 3HPQA 5L8VA 3KFXA 4LYAA 4AKEA 1QUQA 1CSPA 4KKUA 1B9MA 5CDFE 4GI7A 3FDIA 1Z2AA 4DUGA 5JLJA 3EA5A 2F43A 4Q5IA 1ZCAA 1LV7A 1AZSC 4NPHA 3I4MG 2QGQA 3IQWA 4GBMA 1JEDA 2CNWD 4Y0AA 4OQMA 4RZUA 1WA5A 1N34L 4MQBA 4IDPA 5FTLA 3C15C 1BVSA 3H0KA 2QSZA 3AVXA 2PJRA 1DG3A 4F91B 1HNZL 1ZCBA 2P67A 2ZE8A 1HNZQ 2WPDA 4V0LA 1ZM3A 2GBLA 4Z54A 1FGUA 1ZD9A 1G51A 3NIBA 4QJ3A 3RDPA 1WBBA 2E75C 3U5ZB 1E1QA 1Z0AA 2ZRMA 1R4AA 4YMUA 3ADCA 4MRVA 4DSOA 2AKWB 1DAFA 4PC7A 3SS8A 4B44A 4MRPA 3SFVA 3L82B 4MRRA 1DO2A 3WYFA 4DCVA 4EPTA 4D26A 4JLNA 2WWXA 1H65A 2PQAB 1HE1C 1TL7C 4XJXA 3VU9B 1S1MA 1GHKA 2CVFA 1Y8NB 3BWDD 1TWAH 1J2JA 2RKOA 2XTIA 1G20E 4A93H 1CJVC 1NN3A 4YWKA 3A74A 3S1AA 5KU1A 2YWEA 2OLJA 4GFDA 5C4XG 1UPTA 4C0KA 2E9SA 2NG1A 2A8VA 1D6JA 1ZAKA 1UEIA 1X8LA 3QXJA 4LJ7A 1X3GA 4LBYA 1EGAA 2ZYWX 3QUSA 2K4KA 4C0QC 3FMCA 1A6XA 2OBLA 2WKRA 5HY6A 4PHHA 4PXAA 2WSMA 2A69C 1E1OA 4OHWA 3RHFA 1SVLA 5FBVB 1N9WA 1WP9A 3LX8A 2FOLA 2R9VA 5FH9A 1PYBA 4UXJA 3J7A5 3EWSA 3GTMH 1HURA 3EPLA 4HIKA 4DR1L 2GNOA 2P3SA 2ZS7A 4DR1Q 3B82A 3AGPA 1Y3AA 3IKJA 2A9KA 5DH9A 3SBDA 2HCBA 2BJWA 2A5YB 3TW8B 1XNJA 4TVAB 1N2CE 2IA5A 1J99A 4Z1MA 4ERNA 1IJFA 4QM7A 2ZE7A 2FZ4A 1L8QA 3AKCA 3KQNA 4E07A 3LQRA 2FF7A 4A3MG 1BH2A 2D4HA 2OE2A 4UNQA 5EP1A 3SDZA 1H9RA 1LY1A 5K36G 1Z9FA 1EQQA 4OXPA 1T3HA 3E70C 3QVUA 2V1UA 3KFVA 1G6PA 3IEUA 4WXPA 4ZV4A 3AKEA 2OTJA 4LHYA 4RCNA 1NLYA 2NVXH 1AQUA 2GXUA 3QIAA 1L1OC 3CRW1 3OIWA 1OXSC 1P9NA 4X8HA 1UM8A 4X8MA 3KQHA 2O0JA 5F3WB 4KHPL 4X62L 2ZJYA 1SZPA 1XEFA 1LACA 1M1KC 4JBYA 4TT3D 3U60B 4K0KL 3RN5A 3CPJB 2R8RA 1NVVR 3F2BA 5DSZA 1J90A 1E2JA 2BMFA 1D8TA 4C9BA 2UXBQ 2ZXUA 5M5WH 5FPKA 1S3SA 2UVQA 4GZMA 3NBXX 1VQ7A 2ZI7A 4BUJA 4DLYA 1UJ2A 2QI9C 2P6RA 1VQLA 1CRQA 1UADA 2VP4A 4HB0A 2Z0MA 3WHLA 1EFWA 4IFDG 3THYA 3SQWA 1E2VA 5EXSA 3U6KA 2CHQA 2WJYA 2AD1A 4LJ8A 5DO9A 2MMGA 2VHCA 3DHWC 1Z08A 1I50H 1XMQL 1EFTA 1T0JB 1ZINA 1OH5A 2B8WA 2FH5B 721PA 2A5JA 2A78A 2EWVA 5J3BA 2WOOA 1TAGA 5KDLA 2ZSAA 4JS0A 4D0LB 1GJXA 1H9MA 2E2JH 1NKTA 4DLSA 3OW2A 3PENA 1SVWA 1W36D 2HHHQ 1HJPA 3RS0A 3V4RA 3K0CC 1E2DA 2ZJOA 1ZMXA 2Y0SG 3RYTC 1MKYA 1C4OA 4TMXA 1B7YB 3QEOA 2JLZA 1ASZA 1NTGA 1MV5A 2Z6KA 4FMDF 2YU9H 2ZSDA 4OK6A 4JCVE 1H8HA 2CLCX 3BFKA 3S2DH 4LF5Q 3TAHA 3RS3A 2GCPA 3U61B 2CL6X 4UXHA 4BZXA 4KSCA 3PIPA 1I3QH 1QHNA 4PSKA 4TYWA 1Q57A 3ZGXA 4PFSA 1T4GA 3RZDH 1GSIA 4OK5A 1WCMH 2JJ2D 1EWQA 2FPLA 1YZKA 5TB5A 2JA5G 1YHNA 4MYHA 1M7GA 4JYAL 2JK8A 4X64Q 1WCV1 3IIMA 4I4LA 3K9LA 4IDQA 2QEXA 4NP6A 2JIZD 5GAEC 1FR3A 4YCWA 4NHOA 3U6BA 3J80i 1KZ7B 2VP9A 3B1WA 3BB4A 3VX4A 2C78A 1BBUA 2ID0A 2BBTA 1OB5A 4JV5Q 4A0RA 3ZD7A 4OJKA 2JAQA 2PT5A 5EP2A 3ZZ0A 2YINC 2JA8G 4DUYL 3ZLJA 4AYTA 2YTVA 5EAYA 1CR4A 2ATVA 4GS3A 1N5LA 2R93H 4PZ8A 3PQCA 1GKHA 1PLJA 4YC7A 2ODEA 3PV0A 3JZAA 1VDZA 1NN5A 4JBMA 1KNXA 3K70B 3FMIA 4EDHA 1RVDA 2QN6A 2QPOA 4PZZA 2ZM6L 1XMSA 4PHGA 3X1ZA 3ULJA 1AGRA 1U94A 1ZD8A 2E1RA 4ITRC 4UP7A 3TS0A 1JEEA 4OYHA 3K0SA 1OTCA 1TEVA 3IILA 5EQTA 1ZRHA 4LF8L 2H18A 4TLAA 4M9QA 4B71A 1XTDA 4YMWA 2A6HD 4HAWA 5K8LA 5BN3A 2JA9A 2HDNB 2YOHA 3MD0A 3H2YA 2A68C 1SFOH 2HIVA 2ODNA 4TL6A 2JCSA 1I5FA 1E9FA 4B33A 3AM1A 2CJWA 2ZSEA 4OQLA 3ZD6A 4HATA 5IK2A 4TZ0A 3BBPA 3W34A 1E1TA 4N3NA 3T56B 2ZAMA 3GTJH 1KMHB 1G19A 2GF0A 4RZ2A 1K83H 4BY7G 3TR0A 2C03A 4B3TL 3JVUA 3WYAA 3QF4A 2JLYA 5BXQC 1SE8A 2QE7A 1JT8A 1R0XA 4WVFA 1IHUA 1KXLA 3CPHA 5DE3A 3HKZE 4DIEA 2DFKB 3KOJA 3EZ6A 3EG5A 3K0FA 1KI4A 2KWIA 2IXFA 3AUYA 2ZI5A 3ZZTA 2DUDA 1E2LA 4BFWA 1W36C 3RANA 2XJ4A 4DDWA 3D0FA 4FXPA 4W9MC 4KBFA 5H68A 5JSZB 2GXAA 1LM0A 4DT1B 2WWYA 3X1XA 3KFUA 2Q0HA 2GJ8A 2B63H 2RGXA 1WJJA 2JJQA 4G5SA 1EUJA 2N8NA 3RLNA 2IL1A 2J46A 2A6ED 4U00A 3UMRA 2IYSA 3K53A 3DKVA 4MYUA 5M5YH 1JBKA 1OYYA 2IHYA 4JI3Q 3VNVA 3VU9A 4WZBE 1IZ6A 4A3GH 3EZ7A 4LJ6A 4TMVA 4BLPA 5BN5A 2FN4A 1R8SA 2K7VA 1KIXA 2F9MA 5BWMA 1UEJA 2YZ2A 4JBXA 1G6HA 1H9KA 1P72A 1QHGA 5C3EG 1QDEA 1SXJC 4JKIA 4UNSA 2K5UA 1P3JA 3EC1A 3UK6A 4PPGA 3ZVRA 1OFIA 4GNXC 2A19A 2BC9A 1Q46A 4XH9B 4CIDA 1GO3E 4OWWB 4MUBA 2PZFA 3KB2A 3BU2A 3QG5A 2K33A 5JCPA 3TUJC 2GDJA 1N5JA 5SZHB 1G5TA 3LVRE 4EPYA 3LX5A 3BD9A 5JZVA 2B8GA 2CWAA 2DN8A 4POFA 4LWZA 2PH1A 4A6XA 4YY3Q 2D2EA 2J0UA 5KSPA 2ZM5A 3NH9A 2OCYC 4NXMQ 2DWPA 2P0EA 3OEHD 4GNKA 1VMAA 3X1WA 4U7DA 4KITB 3TSOA 4HYYA 5JJKA 1N3BA 1VF7A 3PITA 1E9AA 3UKDA 4NCIA 2E5LQ 2KHJA 4PANA 2Y0SE 4I1VA 5J5CA 1D9ZA 1TQDA 3T35A 4MDFA 3Q72A 3AB3A 4BXXG 1TWGH 4A82A 4FW9A 3B1YA 2EU8A 3KYHC 2QMUA 5GVRA 1JQLB 2F3TA 4ZPXA 3K9GA 2Q21A 1N25A 3R9XA 4BLSA 4JSTA 4PHTA 3O8RA 1NN1A 1N6HA 4XSGA 3DVLA 4I1UA 4YDHB 4K8OA 1KNQA 1C9OA 5EUQB 3SHWA 2AK3A 1UWVA 1CBUA 1ZVQA 4L5QA 2QEQA 4PO9A 4NYIQ 5GJVC 2O0HA 4IOAA 4AI6A 2E2HH 1N5IA 4MKFA
chains in the Genus database with same CATH superfamily
3LBFA 4JJ4A 8AT1A 1A77A 1Q19A 1NI3A 3QTTA 1AFPA 1EL0A 1MFZA 2OXRA 1WAMA 5TQ0A 3UUEA 4DLYA 4O5AA 3CLTD 4Q1CA 1QG4A 1FTNA 1U0RA 1HNWL 3VI3B 3LFTA 4FJ1A 4EI9A 1E4VA 3VJMA 1G3RA 2EAUA 4LJAA 4MSUA 5ENDA 1A9PA 3CUYA 4LECA 3K16A 3SF8B 4NAUA 4JBGA 3WE7A 1ENPA 2RHSB 1Y98A 1QO7A 3SPXA 5EMHA 1NLUA 2RHBA 4WX2B 4V2IA 3K9FC 2EX1A 3HOZH 1E92A 1QH1B 2G9VA 3ACBA 3IJ5A 4NV1A 4PAGA 3F3SA 1F0KA 4QU9A 3VOBA 3WBFA 1KERA 3COPA 4MDEA 2O2LD 4A3LH 1Q6YA 2DTEA 4PRLA 1U63A 3HVUA 2NN6H 2WHRA 2G0TA 4XWAA 4FEEA 5IYCG 5LP6A 1DJNA 3ZJYA 1GUDA 5M3FH 1O6GA 2UXDB 1E94E 2PX4A 3D8SA 4IQ4A 4ZVUA 1E3MA 1U0GA 2HMTA 2JGFA 2WYHA 3KXDA 2CBZA 4I65A 3GRYA 3F5SA 1Y8QB 3H18A 4N3BA 2FSVA 5DI9A 4E5DA 5JCXA 3P20A 3ZDZB 1J97A 5AKGA 2FXVA 2R25B 4WESA 5LBTA 5JAOA 4DJAA 4MVXA 3OKAA 3RVMA 1YTLA 1EWCA 5CFPA 1U0JA 1KI8A 1PRTC 3MJRA 3HYLA 1ENFA 4MTNA 1IM5A 1MMFB 4HDOB 4RIFA 3UFXA 4BAUA 1R1DA 1O5IA 1YE5A 3NNSA 4PS0A 3AOGA 2QG4A 3N2LA 3CISA 2JKYA 3QU5A 4MK4A 4MITA 5EJ2A 2RQXA 1PNRA 3OEEA 2XGJA 1H0RA 1Z68A 1FXWF 1QF6A 1G17A 3CSSA 4RY0A 1E4EB 2C2BA 2VNKA 3OA2A 4DK3C 3FCXA 2QBYB 4TQUS 4F04A 1L7EA 1KH1A 3CLKA 1EAYA 4M0UA 3WMRA 2XQJA 2WIGA 4EMTA 2DBRA 1E77A 3QLJA 1LPBB 2HIGA 1IBSA 2IPMA 4R1JA 5B3KA 4KR7A 1UOPA 4MZ9A 3EDQA 2V54A 4GP9A 3IOBA 4LDPA 4D0NA 5KTRA 1LTQA 3JAMc 3MGAA 1WCIA 3LT0A 2Q6LA 3MD9A 3MWYW 1SC1A 3DHYA 2WLTA 4KU4A 3H42B 2Z95A 4R84A 3WMGA 2FMMA 5CBPA 2QTVB 3PDIA 4M1YA 3L46A 4Z9CB 2WWGA 4DV6L 4K6DA 1DJPA 3KALA 4GN5A 4GYKA 2J9FB 5JPIA 2PUFA 4J1MA 4MI3A 3KBXA 1ISJA 4RKYA 3WDSA 2ZB3A 5JIBA 3R7WA 2PZLA 1W46A 4BX3A 1PV2A 1NVMB 3OFND 2Z6AA 3B2NA 4K9PA 4QLBA 3BEOA 4RVDA 5LP6F 2Z9CA 2A68D 2POCA 3HACA 3TOZA 1I0ZA 3QVVA 4BLUA 2WOJA 3UOGA 4ZKBB 3S5JA 1LGYA 1EM8B 4UEWA 5KJCA 4JOQA 4ZGWA 1I6VC 4IIJB 1FJGQ 3KLWA 1OKKD 1Q92A 3FKJA 5D6OA 4ND3A 3WQSB 4MJXA 2CMHA 4LYJA 4S1PA 2WWHA 3AL2A 1NBAA 2XZLA 5CV9A 3PYMA 1IBCA 1DOHA 4UC0A 4YDRA 3T7AA 2Z5LA 3M4YA 1K73C 3CR7A 5H3HA 5IARA 4D4GA 2G1JA 1GT6A 2VDLB 4BBRG 3DM3A 3H2KA 3AVUA 1OAAA 1MH9A 1II9A 2GK3A 1FYXA 3FF1A 3PUJA 4H7HA 3RHZA 2XTJA 5A02A 4DA4A 4HAYA 4OVKA 1L5SA 1IVSA 2XKKA 3NIFB 1EX6A 2EFJA 3NYIA 4B6EA 4H27A 4NMZA 5BQ3A 4B3RB 1A97A 1ID8A 1NQAO 3Q6MA 2WM9B 1WXHA 1R3UA 3N5KA 2QBYA 2BZ1A 2GXQA 2O3RA 3AUTA 1WNFA 3FYHA 1AHHA 4V3CA 1M2KA 3AESA 3BFVA 1O97C 3DF9A 3GIWA 3M9BA 2PBRA 1DG9A 3BCHA 2MCFA 1J8QA 3IP7A 4ZALA 5FBKA 3QOJA 3KYCB 4WNAA 1FUIA 2G72A 3OPYI 2FWPA 4MICA 1PJ4A 4BY1B 4QIWE 3F6EX 3M6XA 4R8MA 3LX6A 3O4IA 2FSPA 1DI0A 4C1NK 2VPWA 5D3ZA 5ESDA 3EEIA 3W3AD 5ICMA 4KJZA 2D8MA 4K2HA 4KE8A 1NQVA 2IHTA 3PDIB 3ZCVA 1QPBA 2Q0SA 3RVQA 1ZGJA 2JJ2A 2B82A 5K09A 4URZR 1VPTA 2CW0D 4AF7A 1KDOA 4P4GA 1QGDA 3DM5A 3PIDA 1UJ4A 3KR0A 3DHEA 3HGMA 5B4TA 3K0AB 2WE7A 1Y6QA 1HUMA 4F88A 2DHQA 2BGMA 1DLIA 3HGTA 3KSRA 4AH6A 3M4QA 4P3NA 3TOXA 2R7FA 3G0GA 4HGOA 3ETEA 4J0HA 3JQ7A 2QI9F 1KJNA 2ZSJA 4C2AA 4MUHA 821PA 1UMBA 4O0AA 3HB1A 1P2BA 1X7HA 3MERA 1QKKA 4KI0A 2IKSA 2RHCA 4UOQA 3ENWA 4XIIA 2ZDHA 1E59A 1JPJA 5JS2A 3P9QA 2DQ4A 2RI0A 2C4TA 3LYUA 3NTUA 4KQ6A 4R8SA 1OD6A 3GROA 2J31A 4MW5A 4YI5A 5GOZA 5AUPB 5JPCA 1AN9A 2XRZA 1TF2A 5ADUS 1X65A 2BOVA 1XFAA 4IKEA 1E32A 1RKXA 2EP5A 2A2ZA 3PO3H 5FQNA 1QRRA 1POXA 1NUSA 2Z1CA 1OI2A 2H0RA 1JWSD 2ZIXB 1EJ0A 3BH0A 3M6LA 4GAEA 3A5ZB 4D8YA 5KNCD 5LA6F 4XYBA 3ZX5A 1QG7A 1CY2A 4ZGGA 3G82C 4GMGA 4LBZA 4KOAA 5EY5B 5AM2A 4L3WA 3QG1A 1RI2A 3N7UA 3PJGA 4A0FA 1FP1D 4CIBA 3DFUA 1TCCA 2CJXA 1NDQA 1Y34E 3FH0A 4LUZA 3OG9A 2CFTA 3OD5A 3B7PA 3NBKA 1K97A 1C0PA 2PANA 3FETA 3EZFA 4OHPA 1SUIA 1VCOA 1XQ6A 2WTAA 3ABQB 3IOYA 4OH7A 4R2LA 4UULA 4D4JA 5KJFA 1AQLA 2I3ZA 1W9MA 2PS1A 2ZBVA 3SF8A 4DEYA 2R4QA 4ZODA 4C6SA 1WU7A 5BR8L 1MXFA 1VE7A 1YU9A 3P2OA 3TOVA 3W05A 2IHVA 1XWIA 2HHLA 1XAHA 2XUOA 3C7CB 3DHVA 4DY6A 4NJEB 4XI9A 3F6BX 1GUTA 5KYWA 2Q4RA 1SPBS 4X20A 5JC8A 2OY0A 1NASA 3BERA 1JFTA 4IJ5A 4MROA 1XLTC 2NUBA 3QOFA 3ZY4A 2HL6A 1X70A 3INYA 1N9ZA 1WULS 1YV9A 1V1MA 1IE3A 3IUPA 4KO8A 4NATA 3EX7C 1BQQT 5J47A 3K0KA 1PO7A 2PZKA 1EZ1A 5ALHA 3KF8A 3OECA 1ZA1A 3AR2A 4NMHA 5K3SA 4UNIA 3V55A 2MHCA 3L1KA 2G06A 1A04A 5T67A 1IHPA 1TO6A 1W47A 3IBYA 2JCXA 1AV7A 1RC8A 5IP5A 3WVNA 4ZI3A 3NMUF 1YJNA 2Z30A 2W42A 2BSXA 3GT4A 1K3UB 3HXTA 4RUKA 4UD2A 4UHJA 1J5PA 5ERYA 1U2DA 3S17B 4XWTA 2D1SA 1Z36A 3IULA 1SGWA 4WJKB 5FL7D 1GL3A 2CXQA 4LF4Q 1E9CA 4CMIA 4IQ0A 4Q47A 4YWMA 4MAMA 4N8EA 2ZJ5A 1NPDA 2HK7A 3E48A 4FCCA 5CV6A 1TEHA 3L7CA 3ZVMA 4OGGA 1BCRA 2BFEA 4LQCA 4MYTA 4P3PA 5AKEA 4LJRA 2XNKA 1KL7A 3HKEA 3I0ZA 4J0EA 4UUPA 3UXEA 4PMWA 3I55A 1NY4A 1QHHA 3HB0A 3L8HA 5F77A 3B38A 2DGYA 1DBQA 1RHQA 1ENCA 4R16A 2XX3A 1K5DA 4I55B 2YW9A 2ZIFA 4MV6A 4PE5B 2FSUA 2WDPA 4PTLA 5HBGA 1L4FA 1U7DA 4F1KA 3OQPA 4FP9A 4ZDKA 1N3YA 1HETA 4CF5A 5GY7A 4AUNA 1C2YA 4QTYA 1PS9A 3S17H 2UUAL 1XRPA 4IS2A 4HYEA 2PLWA 5K8TA 3I4MB 4JCCA 1K9SA 2XWQA 4L16A 3Q0AA 4JV5L 2KX7A 3OIQA 2VLIA 1SYCA 1KIMA 2W8BA 3C3WA 2VYQA 1YJXA 2QDBA 2VXYA 3HR8A 1UBLS 1BO6A 4PNZA 3ER8A 3IQGX 5J40A 5HP4A 2FE4A 2VKQA 3A1UA 4AZVA 3ZEAA 2RHQB 4JWTA 1X0VA 2ZRPA 2QAGA 1H95A 4AQYL 2JFXA 3EW9A 3IAFA 4R7ZA 3RK4A 3SJUA 3TEJA 1E2ZA 3CVUA 4JI7Q 1H6BA 5GINE 1RF2D 4UCXA 5KOJA 1J5XA 1K4KA 5JARA 4UEJA 4GMKA 1BDIA 4H1TA 1KIAA 2EFCB 4A3IB 1LDEA 3E27A 1G64A 4QUFA 1GPMA 1PGPA 1Z0DA 2NT3A 2WJAA 3ANMA 2XR1A 1FF9A 1T25A 1UKVY 3FUUA 2Q8PA 4WGFA 4JI8L 2VJDA 3DZHA 3RF7A 4K8RB 1VJ5A 2JJ8A 1M8PA 1TIBA 5TVKA 4H3VA 4YNBA 2F7SA 2QPLA 1FLVA 3CCQA 1IHZA 1Q1QA 1KETA 4TS9A 1HK7A 4OI0A 4Y52H 1M8GA 2ICAA 3AVOA 5EKTA 4DR4L 2NVYB 3N0TA 1QFXA 4DKAC 4O4LB 4J7AA 5CLLA 3WSWA 3E2IA 4CKXA 3WRYC 4M37A 3HN2A 1N2JA 4BNWA 2Z4TA 4FMCB 4IV5A 1P7ZA 4C4TA 3GLIB 1UT6A 1OWPA 1NVTA 5EZ5A 3RRJA 3ZBPA 4EYOA 4KE7A 2GHTA 3I4OA 2P1RA 5JATA 4ZT6A 1YL7A 4GC9A 2GTHA 3A6GA 2O3SA 1NU8A 1EWTA 1NBHA 2WJVA 3QBVA 1V1OA 2NOAA 4HZUA 4IYRA 2HMVA 1OPXA 4A23A 2AKYA 1MXHA 1US8A 5JDIA 3T5AA 1R18A 4HEA1 3ECAA 4FOOA 3KDFB 1HZJA 3HRZC 1OFHA 2IYTA 3GEEA 1MRSA 2OYCA 3S81A 1T13A 2EJFC 4DL9A 4BTLA 2UV8A 1AUOA 5KCZA 5KO2A 3VV3A 2CDRA 2NVOA 3HU5A 3ECCA 1Q84A 4K2KA 1H0SA 3TWOA 4EK9A 1B50A 1JKMA 1ZRSA 2ZAYA 3HCOA 4HDMA 3SYRA 2QZZA 2FSGA 4APVA 2OCBA 4HNRA 3DLTA 4LVOA 4PXYA 1TYEB 3MIZA 1DKQA 4C1NI 3GUVA 1ZU4A 4QUHA 5J4HA 5MDHA 3P2KA 2KOLA 1LPNA 3SWWA 4QQBX 3LUHA 1CJKC 3KVNA 1RDFA 3PFIA 3ZTYA 3KEQA 2JCGA 3TUIC 5A2QA 5TLSA 3EN0A 4GWKA 1VJGA 3FTDA 3HBFA 1M2VB 3IOEA 3TTVA 1XZCA 3U44A 1YR2A 4Y2SA 4XR4A 3CLRC 4PIVA 3HL0A 5DM1A 1FFCA 2ZQZA 3AY3A 4POGA 4ZAWA 4BO7A 1AQNA 1UBTS 1WPQA 1S40A 1DKMA 1JJAA 5KPJA 1MBZA 1CE8B 4LV5B 4C2TA 2P6PA 2VCEA 3LV8A 1NVVQ 4GOXA 5LR6A 3VU1A 1ZVMA 5AESA 1TGYA 4OX9Y 1DOZA 2BA1A 1OU0A 1DUIA 1XZLA 3E5HA 3LRPA 1UPCA 2BGNA 4U2FA 5FOTA 4MEJA 4Q19A 2IP1A 3MWKA 3S9WA 2VHEA 4BO5A 2Y27A 1V8DA 4RKEA 1QO0A 1IQPA 1E1LA 3KB1A 4W1RA 3L04A 2BMWA 5JAIA 3AVVA 2VSFA 3F4KA 2QWXA 3BB3A 4RK6A 4DCGA 1J8VA 4PR3A 1VCNA 2M6RA 1E0JA 3E2MA 3JARB 3OJXA 3AEKB 3O92A 4I99A 4MA4A 4WKOA 4D8VA 3UTDA 4M1UB 1V8BA 5FO0A 5TPWB 4IIJF 5D7BA 3NHWA 3PX3A 4EVSA 2FOXA 4J4BA 4QXPA 4IHAA 4UTPA 4TLCA 6CHYA 5HSGA 4RHFA 1OXMA 2GILA 1N32Q 2D00A 2CQAA 1W4RA 5DK6A 4D9BA 1JYFA 1PD0A 4M53A 4PPFA 5GVSA 2FDCA 2Q29A 5MFZA 2FGJA 1DC7A 4Y2JA 2D7DA 2IE0A 2BW0A 1P6QA 5EJ4A 2HBYA 2HLHA 4X8LA 1UDXA 4NZPA 4RCOA 3PEEA 4NBKA 4PRYA 5B2EA 1YJWA 1U4RA 1DJMA 3LT2A 3C48A 1DD2A 3F1ZA 2QTAA 2H2AA 1KYYA 4AQDA 1O7YA 4Z2YA 4MVJP 5DI3B 5FORA 4OJNA 1N7GA 3RROA 3I64A 1CY6A 4GECA 2C5FA 2YCBA 2JIQA 3MRVA 1EBUA 1QHXA 2CSUA 2PGXA 5FBRB 1NCVA 2XVXA 3DWIA 3H5RA 3MTAA 1UBHS 2H7VA 5G0VA 3KJHA 3RJ5A 1VB3A 1DOAA 3QVMA 3LIIA 4Y7CA 2ODTX 3NNDA 1HA3A 4BV3A 2YIDA 3Q88A 3GLQA 4B8YA 3TRZA 1VM6A 5FFNA 2YZKA 2CWPA 5D5QA 5CB4B 4KJOA 3PXUA 3T4UA 1K75A 3SJ7A 5FBLB 4I6GA 1LTKA 2BFMA 5DLYA 3PGJA 3H1EA 4HH0A 1DZIA 2YDXA 3RGGA 3W2DA 2O8BA 2WTBA 3LO5A 2ZAGA 8ATCA 2PZAA 3ISJA 3EROA 2B9EA 2PWYA 5TSSA 2ECPA 4YHBA 3NWSA 3B13B 3GPIA 4BNNA 1F2VA 2BGWA 3TBHA 2IUSA 3BK7A 2Z9DA 2R2AA 3AF4A 4QYIA 3U3OA 1GY8A 1SURA 4IIUA 5F9MA 4I8IA 1MJ5A 5CGQB 5JNRA 3CGGA 2D0PB 3FSGA 1I4DD 4M9XA 1IQRA 3O8OB 9GPBA 1CS0B 4QJFA 1XZMA 1J8FA 5ENVA 5KIXA 3LL7A 4B2PA 2VF4X 3G2MA 1JAHA 1TA0A 3DYIA 1MC8A 2FPKA 2ZDGA 2JIPA 5JI3E 2H51A 4B6QA 3PIO3 2SEBD 2JFFA 5P21A 4EL5A 1VMCA 5A35A 5L3RA 1SXPA 5BR8Q 3IKTA 2JLXA 3PQ8A 1CE8A 4I08A 3ZDFA 3A36A 1L8OA 4AJ1A 2J0UB 1ZN7A 1ZM9A 2CVPA 4BS9A 2GN1A 3T3DA 4EITA 2PLAA 3TQRA 3OPQA 1C4KA 4QTXA 4KD4A 3OIPA 4DV0Q 2EKLA 4JT8A 3TD6A 4J8QA 4NBLA 3KWFA 1CKEA 3WWPA 1CHDA 1PJAA 5F73A 2ZJRA 1ZK0A 3OX2A 5FADA 1DBIA 1KPHA 1SHTX 4JLMA 3JQCA 4DPMA 1IMOA 2P6MA 4G8JA 1N2CA 2AOTB 2O4UX 2AQHA 1I80A 3EQ6A 1VKNA 1KY3A 1JZQA 3OPXA 4MCIA 2OZPA 5EL0A 4D46A 3COJA 1MPXA 3NWBA 4L3OA 3R76A 2GEDA 3KQYA 1FMLA 3C45A 5J4YA 3ROKA 4P0QB 2XB9A 2XUDA 4AMUA 2XE7A 2R7ZH 5DM60 1CY4A 1E79A 1Q6ZA 2J30A 3E1SA 4EGVA 1XJ0A 1XELA 3SDSA 1M75A 4GLFA 1BS9A 3IV6A 1SQ5A 3WYGA 3SKYA 3EXHA 3CA8A 5DTJA 4JVLA 2W4IA 5CR3A 1U1CA 1C2TA 3UK2A 5FLXE 1NVXQ 4A76A 2ILTA 2UZ1A 3BIJA 3ZHTA 4COKA 3RNUA 5AJ3L 3BMCA 4LAFA 4WQMA 2Y1OA 1EDBA 2ZTHA 1W0JD 4BNGA 1C14A 1DFHA 2GM5A 2ZBGA 3H9JA 3IB3A 4J0GA 2A35A 2P78A 4L85A 3EC7A 1XXLA 4OQ4A 3S55A 3OTOL 5I3ZA 1EYZA 4QJ5A 4CLOB 1KRTA 1F9AA 4QZVA 1WUHS 3LUPA 4IWYA 4UUNA 4X54A 5H83A 3B1XA 1BKYA 5ABPA 3Q8MA 2ZGVA 4PZ0A 3CVYA 2CNLA 4IO0A 3QY9A 3RSLA 2PRYA 5AKYA 3EAGA 2WAAA 4KR0A 1SA0B 5IULC 3HL4A 4ECEA 4CT4B 1R6TA 5FEUA 5I4IA 2Z8YM 3A7AB 3VYSA 1WEKA 3GI1A 3WYEA 5J58A 2CH4W 1DARA 4R1QA 3K70D 4ZT3A 2V1UA 5FOUA 4UFPA 2AI3A 4FR2A 4UBLA 2R92G 2FX2A 2Z3ZA 1Y8RB 3Q10A 4IICA 4UEOA 3QUTA 3ACCA 1JKJB 5K0GA 3GJ3A 1Q0RA 1PZJD 1TU4A 2BIFA 3QBDA 2VTBB 3ODGA 4ID3A 2JA6B 5KVSA 2O3QA 2YWBA 2ZUTA 3CCMA 4DV5Q 2OQ2A 4KODA 1FLNA 4TV9A 3ICWA 3NWPA 2HPHA 3WJ2A 3MCWA 4BFTA 1OCEA 3TMYA 1IXRA 3JAMi 1H9AA 2YVKA 3NUZA 4HZGA 3DV0A 2J41A 4B4KA 1H3NA 1HMYA 3EXIB 3FIUA 3X3HA 1VPWA 2Q8RE 4XLZA 2X3FA 3RMHA 1VJ0A 5E9QA 2JHPA 1YA4A 1Q1EA 1J0EA 1XVAA 3JYOA 4B3TB 3UDXA 4DSNA 1LFDB 2AMVA 3W6ZA 4TKUA 5BMVB 2FY8A 3G23A 2DY1A 4FIZA 3VPGA 1GTZA 1OYWA 4C6TA 1FW8A 3DEPA 1U5BB 2IXDA 4Y18A 2H48A 2SCUB 4IAOA 5AR1A 3TN7A 2BN4A 5KX5F 2O5RA 2GO7A 8GPBA 4GH5A 4C3UA 5IT0A 1O0CA 1ZSVA 4D0SA 4E11A 4OGQC