3PUZA

Crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
total genus 88
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puzA01
4BBRG 3I4LA 2FU5C 5EXTA 3VU9A 4DSUA 1HPCA 2FZ4A 4X8MA 4JI8L 4R9UC 4DR5L 3PO2H 1R0YA 2KI5A 5AUOB 2LXJA 2VUMH 4IEIA 3K70D 2OQ0A 1C9OA 3PGZA 1NMFA 4JG2A 2OEPA 2HJVA 2Q9CA 4RZ3A 3RNUA 3V4RA 5AWFC 5DHFA 1IAQA 3GO5A 1VQEA 1LACA 2H1LA 3SDZA 1XEWY 4KCGA 4DLZA 2UZIR 1W36B 2HF8A 4MKHA 2IUUA 4II7A 2ORVA 2BH2A 2PEZA 1JAHA 4JVSB 2CJWA 4QGGA 4C0LA 3ADKA 1J70A 4IPHA 5FJ8H 5G3YA 1JXOA 2FA9A 4O25A 4RD2A 2VH5R 1GKIA 1ZUNB 2CCKA 2GK7A 1GKUB 1G3UA 4QM7A 621PA 2ASEA 2VRWA 3P1JA 4YCVA 1P3JA 1G16A 2GJ9A 2GXAA 5AJ3Q 2UXCL 3F8TA 2RF4A 2VTKA 4PZLA 2C35B 1NL3A 5IP9H 1CJUC 2ZSEA 4I1UA 1DADA 1ZIOA 2OSBA 5IRCD 5JEAG 5LD2C 3GP8A 2FSFA 3U7HB 1YRAA 2GZHA 4UNPA 5KO2A 1FJGQ 4PTLA 1EX7A 3THXB 3FKSA 4M2LA 4M1WA 4AKIA 4BLQA 1G1MA 1O78A 3QPWA 1V9PA 1PH7A 2IS4A 4PV1C 4DK0A 2ODEA 4OYHA 4Q4HB 3CQZH 1N5KA 4HIMA 4HDCA 1CBUA 1DS6A 1NY6A 2N42A 4DAMA 3UG6A 4BFUA 5GADl 3UWOA 3KFVA 1J5EL 2X77A 4A8JB 2ANBA 4NCIA 4JI4Q 4ZCLA 5EAYA 2BWJA 2PMKA 2WV9A 2WZQA 2ZEJA 3LA6A 3SHFA 3TMKA 4KITB 3GLIA 1NY4A 1TTTA 2BJVA 3I2ZA 4LCBA 1VQ5A 4ZDJA 1AE3A 3F2DA 2E1RA 3TJZA 1PVOA 4AYTA 4FCWA 2CNWA 1E2ZA 3NENA 4Q18A 3ULPA 2P2LA 1HZBA 1LF5A 3SGIA 3U9SA 5EUMA 5CITA 3ZQ6A 3T56B 3KKPA 3QENA 4BWYA 1XTDA 5EXSA 4E22A 4DNIA 2J9RA 1FX0B 3AF2A 1A4RA 5UKDA 1K8RA 3F2CA 3I8XA 2HF9A 1LS1A 1KHIA 2B63G 4JOIA 4LFBL 2ZSDA 1GDDA 4M21A 5FBQB 2VP5A 4FMDF 2IXEA 1SXJB 1K8AC 1DXMA 1ESMA 2ZANA 3BS4A 1UDXA 1OKKA 4DWJA 5C2JB 2CL7X 3EIEA 5TV2A 4JL6A 5CM8B 1T5LA 3W1GA 1BOFA 4XTRA 4TMTA 3VA7A 1IYVA 2IX1A 2R93H 1PZNA 1IXRC 2IYVA 2LMCB 1II8B 3EQLC 1YZUA 3OYYA 2LSSA 1E94E 1PMRA 4R7ZA 4MYTA 1VYTA 1X1RA 3P26A 2XGJA 2WIAA 5JLJA 4A76A 5C18A 3OTOL 4FXPA 3CNNA 1XCPA 3P4XA 4M1TA 4A2QA 4BY7H 1VQ6A 1EFCA 1K6MA 1NSTA 2EXDA 4B3ML 1QHHB 2C99A 4A4DA 1Z7TA 5JHHB 1A2BA 3MWLA 2KSQA 2WICA 3OIYA 4DR3L 4GKKL 1WE2A 2RGNA 2GNOA 3TZUA 2D2FA 3QXCA 4MYUA 5FR1A 2QUZA 3KQKA 2W2VA 5FPSA 3THXA 3ZZUA 1G291 2A69D 2XXAB 2WB1E 1XMQQ 1HJPA 2K33A 1MO5A 3R9XA 2ERYA 4OBEA 1Z07A 2Q3HA 1XFAA 4LV5B 5EZ5A 1TQ4A 3TRFA 3CBQA 2NN6G 1UADA 4HJ7A 3LLUA 4URZR 2BE5C 3L2PA 1UM8A 1XB2A 3RN2A 1GNRA 3CB4A 2E74C 1OPXA 3AP2A 2EJFC 1EQQA 1RRFA 1ZC3A 2WKQA 1T6NA 3LWNA 3PCRB 2IWRA 2HHHQ 1NNEA 3MSXA 3J81k 3T1HL 4KYIB 1PLJA 4A15A 3LXRA 4XOIA 1E0KA 5DISB 2VP6A 1D2MA 1ODFA 2ZI7A 4GDFA 4TYWA 4C0JA 2JJ1A 4BEJA 1I94Q 3T51B 1N8RC 1BKDR 2WKRA 4RFSB 5HE8A 3QUSA 1YU9A 6Q21A 4R98A 4RZUA 3H0GG 4Y52H 4ZI3A 3BGWA 2JA6H 1DCZA 4JCVE 4LK2A 1S72A 1XD9A 1W0KD 4GOPC 4ZIRA 2ONKA 1FP7A 5CIQA 1N0WA 5GJWC 4Z51A 4N0EA 4B3RQ 5DN6A 2C96A 3KJOA 2BV3A 3CCLA 1EFRA 3NWJA 1WCMG 2ATVA 4GNKA 2YTXA 4JZKA 5TMPA 5LB2A 3I61A 1CXZA 2EYUA 3MWYW 4ARZB 4KMUC 2NN6I 4OONA 1L0WA 5AJWA 3IPXA 1FL9A 2VF7A 4G7ZC 2EW1A 4U7DA 2ZYTX 4D4KA 2XTIA 2DWPA 1OJLA 2VBCA 3QEOA 1ZD1A 4D0NA 1Q1QA 2J5XA 4KLZA 4DR6Q 3TVTA 5TVKA 1K8GA 4P3YA 2GVBA 4A4IA 4DV7Q 3FE2A 3H1TA 3KXLA 2Z4SA 4V02A 4WAUA 3H3VH 2OM2A 3W8RA 2Z83A 1RYHA 4G5QA 2GEDA 1Y69U 4UJ5A 4PO1A 4IJHA 1KKMA 4JIMA 1HZAA 1E2FA 1UWVA 1JJGA 2R6GA 4A3MG 4CVNA 4F93B 3DM3A 3RS0A 1UE6A 3HU3A 2JA7G 5FLMG 3QKRB 2DR3A 4LHZA 4Q7KA 3C5HA 3KQHA 1MO6A 1P75A 3UWKA 3VKGA 4DUYQ 1E7ZA 4BZXA 2EJMA 1O7IA 4GLXA 1P9NA 3U50C 1SROA 2ZRLA 1ZYUA 2WAYA 3AGPA 1SVSA 5CYOA 5HPYB 3FTQA 3SYNA 3I73A 1BO6A 4HJ9A 4PPNA 3ZGXA 2VLIA 2UXBQ 1AH9A 3U3MA 4TTRA 5J4KA 1GUGA 3PV0A 1D8TA 1ZC4A 3QPVA 2EYQA 3O8CA 2MO0A 4LF6Q 1YNXA 4B3SL 2O8BB 3W3AA 1Z6TA 3ONWA 2BMEA 5AR1A 3SOPA 2BKEA 1DAEA 2REOA 1SHKA 1LM0A 4V03A 4YY3Q 3K8YA 3KTAB 3TRZA 1XPOA 3RHFA 3CPWA 3WXMA 3HGBA 3MAAC 4BRWA 2XNSA 5JWRA 4JV5Q 3A8TA 2RGGA 5CB8A 2IX0A 2IYLD 2F6RA 1VQPA 4Z1MA 2RAPA 4AG5A 1EWRA 4DNTB 1CSQA 3G71A 1M7HA 2Z4RA 1ETUA 5F3WB 1NJFA 1T5IA 4JLAA 2ZTDA 2IBMA 1G7SA 1G9XA 3SE0A 1TF7A 1OFIA 1VECA 1U8AA 3A7LA 3KJPA 1E9FA 2G88A 2G83A 2Q3MA 2QAGC 3BK7A 3DEFA 4FMBB 5H70A 4ARZA 1KSHA 1UFQA 4F4IA 2IHEA 2F52A 2BBTA 2BIFA 4JVNA 1FR3A 3FKIH 3TQCA 4DB4A 1X56A 4UJ3A 1P62B 4AY2A 2WKPA 1PLLA 4PPGA 2BMFA 1E9RA 4CT5A 4QKQA 1GHJA 5GADC 1KJWA 3PF4A 4A3BH 1KI1A 2FE4A 5EP4A 4NYMQ 1GP2A 1CR1A 3A5UA 3RWOA 1HUQA 1ZD9A 3T1OA 1K5DA 3TLXA 5L3VA 2CWAA 1X8JA 3FKSD 4JVMA 3A5ZB 2C78A 1AKYA 4CEHB 1Q82C 4GLVB 2WWWA 4HLQB 2P6NA 1XXHE 2WB1G 1F2UB 1XMVA 4S35A 4YWKA 2J87A 5EZ6B 3VTKA 4RD1A 1E1QA 1E24A 3I4OA 2D4HA 4IXNA 4NMMA 4Q02A 4OI1A 3U6KA 1ZW6A 2R7FA 2R62A 3U4QB 4AG6A 4RSGA 5AUNB 3T5GA 1Q7YC 2NZHA 5C4JH 4FMCF 4IFDG 5JMTA 5KSYA 1B7YB 4DKAC 1KK2A 1M8PA 4G01B 2CNWD 3L82B 4G5OA 4L4UA 3U3OA 4C0KA 1J6QA 1AS3A 2D0PA 3NBHB 4AH6A 2J1LA 3AFPA 2O8BA 4PC7A 2IXGA 1UEIA 2D7CA 1QVGA 5L3QA 1DD2A 2WMNB 2YC2C 1YZGA 5C0XH 1G5TA 3KL4A 1UE1A 1SMYC 4JT4A 3PO2G 3KTAA 1B23P 4QC2A 1VQIA 4B71A 3X1YA 2VUMG 1KSJA 1T8TA 2BC9A 2LKDA 3AQ4A 2I5HA 3BXZA 5CM9C 3PO3H 4MRNA 2R2AA 3SYKA 1N36L 2ZR7A 3QVUA 2DNEA 1OKKD 3REFA 3SC3A 4FMCB 4LJ7A 4IFBA 4KI0A 4POAA 5EUQB 4G5RA 5FJ8G 3HOUH 5JSZB 1CKOA 2EVWX 3TSOA 4QBGB 1P2UA 3V00A 3ZJYA 4IFDI 2XZPA 2XZOA 2KWIA 1B9NA 1IM2A 1Y8OB 2YU9H 1H95A 4G1UC 1A0IA 1Q12A 3JAMc 1SQ5A 3UMFA 1A82A 1E3PA 3PF5A 1JR6A 3ZS8A 1HTPA 3T53B 2VL7A 4HZUA 3HU2A 4WXRA 4JS0A 4KSBA 3U2QA 3AVUA 3GLGE 3LX8A 1X3SA 4OQLA 4JK1C 1QZHA 2QTHA 4B3TQ 4DUZL 3I4NH 3A1TA 4LJ8A 2A5GA 5L8VA 5IY0A 5KUTA 3IKJA 1W4BA 2B21A 1YIJA 1VQNA 1XXHA 3VAAA 4FIDA 2WJHA 2HXSA 2F1JA 3PQCA 4RD3A 5GVRA 3QNUA 1I50H 1RIPA 4MNOA 2IYUA 1FTNA 2OCBA 2AWNA 3ICEA 4IJLA 1L8QA 2LXKA 4A3LH 1Z6YA 2PL3A 2QL6A 1TF5A 2YOGA 1P73A 3LW8A 1RC8A 3GTQH 2HIVA 2ZI4A 2A7QA 1IYJB 4H0LC 1N5IA 4U00A 5FPTA 1W36C 4DDTA 1OH8A 1PH1A 4XH9B 3WRXC 5L3SB 4C3HH 4A93H 2D3WA 1NBWA 3HOYH 4OI0A 3MGCA 3GTLH 3FHOA 3AVXA 3U4QA 1L1OA 3LGJA 1UDWA 2EU8A 1WXQA 2V9PA 3CR8A 1Z83A 4MGKR 4ALPA 1DO0A 1QBKC 3CP0A 2GVZC 2ZSAA 2FV8A 3FMOB 2JJ1D 1P60A 2AK2A 2ZRDA 2ZYWX 3PEVA 3QI2A 3W6PA 4UP7A 4X62L 1FPMA 2X2EA 1C0AA 2XOKA 1KI3A 3IDQA 4OXPA 3GJ5A 4UXJA 1P72A 2V4DA 4P4TA 3K53A 1Z0AA 4OX9L 3FVQA 2JLQA 1DTSA 1X8LA 2PEYA 3PUZA 1UJ2A 2X1VA 1PH3A 3K70B 1EQRA 4O0MA 2F9LA 1XEXB 4KV9A 5DN6D 1ZRHA 4Q03A 1E2JA 1EFRD 1HNXL 1A6XA 4RFVA 2JIZA 3QKUA 1XNJA 4JI7L 2PQAB 4EUNA 3T1YQ 4ESVA 1HTWA 3LXXA 1ZKOA 1E9SA 1XTQA 3C4JA 5DE3A 2R44A 3EC2A 2AHOB 2ZE7A 4NB3A 3RN5A 1KQSA 2OAP1 4A8JC 2R93G 3RANA 3WHKA 5JSZA 1MH1A 1DAKA 3I72A 3IGFA 5J40A 4G7HC 1LFDB 4C30A 1R5OA 4CW7A 4LHXA 2XAUA 2IYWA 2G77B 2E5LQ 5CLQA 1EWIA 1XD2B 1HE1C 1E2LA 3GLGA 3AVYA 4DJTA 4BY7G 1IY1A 2XTZA 1SKYB 3NBYC 4S2EA 3T61A 4ASUA 4LF8Q 4DR1L 5AUPB 4F91B 1Q0UA 5TB5A 2LKCA 4A3KH 4JYBA 4TYNA 3DZ8A 2WBLC 3HOXH 4W9MC 1BDOA 4Q48A 1JR3A 4UNQA 1H65A 3OIVA 2NTYC 1TEVA 4D6PA 2B29A 4JLVA 1PH6A 3SR0A 4NYJR 5FOVA 3B9PA 2AR7A 3TGPA 3DXJC 2BJWA 1SXJC 1KOFA 2WWGA 4HB0A 3MRSA 4JLPA 3NHAA 4X64L 1KRTA 4UQOA 3AKDA 4YMSA 5DLQC 4Q1CA 4B3GA 2A3RA 2B7CA 3I5XA 1WJJA 4QFMA 3K0CC 4FWIB 2JGNA 5BR8L 1NVXQ 2R65A 2E75C 1R2QA 2JAQA 2ZJYA 2ZRPA 3BFVA 2IY5B 3GJ8A 5EXPA 4B48A 2W83A 1YRBA 2IK8A 3BRWD 3U61B 4PX9A 4TLAA 2ZI3A 4CEJA 2JA6G 2NO6A 2VP0A 3QY0A 5CYPA 1Z5ZA 3SHWA 1S3OA 3IO5A 3W5OA 1NN0A 2GKSA 3TSZA 2VO1A 3L8YA 5H1YA 4MYHA 2Q9BA 3AVOA 4HB2A 1X3FA 4DV2L 1P9WA 4Z1MD 2WTUA 1JJCB 1SR3A 3M0EA 4B2PA 1UKYA 1XEXA 4G0NA 3VX4A 2J0QA 4YQFA 1C7YA 5A0FA 2O8CB 3K7AH 2YWFA 3R7WA 2OV2A 2PQAA 4LF5Q 1RKBA 1T0HB 2CK3A 3HDTA 1KAOA 4GKJL 3LW7A 4CYMA 3JVUA 2D74A 1XEFA 4P4SB 5E7MA 2GF9A 2ZJBA 1UBCA 2F3IA 3E9HA 1ZM9A 4AIMA 2AHOA 2IYYA 3AUXA 4TLCA 1S1MA 2PLFA 2ZREA 5JWHA 4DV1Q 3K0XA 5FTLA 2WMOB 2A68D 2ALYB 5JECA 1W47A 3GQBA 4DV3Q 4X65Q 1N6PA 3BERA 5AJZA 5JCZA 1EOVA 1HQCA 2BKUA 5SZHB 3KLWA 1IBML 3S2DH 5DHAA 1XD2A 1U8ZA 3QKSB 4GOXA 5CK4A 2D0OA 1GSIA 4E03A 2OTJA 1NG1A 3TAHA 1RW4A 1MR3F 1E2IA 3IILA 4HAZA 4B2LA 4C0QC 4QGUA 1N34Q 3K0SA 4M0LA 3M4QA 2Z43A 4J0QA 4LJ9A 3CO5A 4RZXA 1E1QD 1BBWA 3Q7QA 1N6IA 4GOJA 4TLDA 1KJYA 2I5MX 4MQBA 3NDPA 4EQ6B 5AK0A 1MABA 1E2EA 3S15H 1E0SA 2NQ2C 4A3EH 1SMXA 3B85A 2Z5FA 1G3MA 4JLKA 4PHHA 2ZTEA 1B9MA 4YMTA 1OT3A 2O5VA 3OZXA 2YINC 1Z2AA 4BZPA 1JNYA 3TREA 1OXSC 3H3VI 2GCOA 2Q0HA 3M4PA 3I8SA 1UF9A 4B3XA 2VS1A 4AWXA 5JWOA 1I5FA 2FZLA 5IDVA 3U3KA 4B33A 5KSZA 3THYB 2A6HD 2FDCA 5AJYA 3GTMH 1QVAA 4L8GA 3CCQA 4HIDA 3DO6A 4B34A 3EX7C 3GTGH 4A3DH 4QBHA 1KO1A 5D3MB 1M1YE 1NIPA 2A5JA 2AD1A 3GFPA 2N46A 4HLUA 4KJZA 4W5JA 3C8UA 3TNFA 3RS7A 1KK0A 4PZYA 1GG2A 3TVDA 3OHMA 4ZPXA 4R4QA 2ZI6A 1KIMA 4FW9A 3ZVNA 2O8CA 2K4KA 4JC0A 1NSFA 1CRPA 3STBC 3ZIAD 3W1BA 1G64A 4U02A 1GJXA 5GVSA 1X54A 2PLRA 3HFZB 2XSZD 4RKEA 4GNXB 3PUVA 5KHOC 3FKIG 2RHDA 1FGUA 1KO4A 3GEEA 3KXIA 2ONJA 1PUJA 3K0FB 1X65A 4D4JA 4POGA 4C0BA 1YZLA 3ZVLA 4A3BG 1IN5A 2Z6KC 1KRSA 4DV5Q 1FUKA 2J45A 2DB3A 1UEJA 5KNCA 1Z8FA 1CKMA 3KDFA 3BJUA 2NOAA 2SHKA 3A37A 4YXWA 2IC5A 4A2WA 1LS6A 3QKSA 2J7PD 2WIBA 2A19A 4QIWE 2ZM6L 4JYAQ 4DDWA 1HH4A 4TYPA 1T5EA 2EFDB 4V0KA 1OV4A 4W7SA 2EWVA 2ZE5A 3LY5A 2JEBI 1YNNC 1R5BA 4BPBA 4M1MA 2KBEA 4MH0R 3AQQA 1XNRQ 1RYFA 1YHNA 1BH2A 5DSZA 4H1UA 2UXDQ 4IO9A 3F3YA 1CR4A 1PJRA 1J90A 3LH5A 5FOTA 4PAOA 1SVMA 4NU0A 3ZDQA 1KXLA 1HQMC 1YJ9A 1S0UA 1VMAA 3T5DA 4NXNQ 4O2LA 4QY7A 5GAGC 1KNXA 4IOJA 1IOZA 1ZU4A 2BM1A 4JI5L 1IY0A 2OT3B 3PIPA 1N6NA 2ZRGA 4H9GA 4DNRB 3CX6A 4DIEA 4YMUA 2MSCB 2XOKD 4BZQA 4AKEA 3CM0A 3CR7A 3X1DA 1SVOA 2D06A 5C0XG 1N0VC 1JMCA 2PT7A 4QGFA 2P5SA 3THYA 3GD7A 4N0DA 2CVHA 1VQFA 5JZVA 4GMXA 3CRKC 3TH5A 5CK5A 1WYDA 1IXZA 4KVAA 3RWMB 1ZINA 3KJEA 4WIAA 5D3MA 3K0AB 4PHGA 5LMUL 4JI3Q 1J7KA 1O87A 2JIZD 1NRJB 2FF7A 3EWSA 2CJWB 1E2NA 2H17A 3GLFE 2E2HH 2IYQA 1QHGA 1TWGH 2V1XA 2X2FA 1S8FA 3H0KA 1XCMA 2CEAA 3HOUG 4M1YA 4P74A 2RGCA 4YHHL 1Q21A 5DO9A 1YQTA 1CFMA 3I32A 1MKHA 2A6EC 4QHYA 2K5NA 5FTJA 4JI0L 1JI0A 1IL2A 1DO2A 1NG9A 3DMDA 1H9MA 1E2HA 5CB6A 1KIXA 3N6RA 5F98A 1I6HH 2RCNA 4ASUD 2OWOA 2QROA 2F1HA 2C5LA 1E96A 4JLJA 4KLNA 1LV7A 1JR3D 5KSOA 1R5NA 2XEXA 1HNZL 4BGDA 1GNQA 2QMEA 3P32A 1W0JD 3BDOA 2E76C 3GTKH 3ERSX 2YV5A 1KZ7B 1TXYA 4PZZA 2CVFA 2W0MA 4M1SA 4R4OA 3GLIB 2IS2A 4Q5IA 2CLDX 4A36A 3CW2C 1TWFH 2UZ3A 1ZCAA 8OHMA 1MT0A 4A93G 3IRBA 1GKYA 3HOYG 1YNJC 2NIPA 2NO9A 2FWRA 1GUAA 3FB4A 4KKTA 4KXFB 4I7ZC 4L15A 1UE5A 4A3JH 1ASZA 2V6JA 4JVLA 2NVQH 3CMAA 3QSYA 3H4MA 4BFZA 4GN5A 2ATWA 1GILA 3FWYA 2ODWA 3NBXX 2A9KA 1JT8A 4PC3A 1G7RA 3WNCA 2KA7A 2YNMA 2GTPA 5E7JA 2ZRHA 3ZZTA 4IVQA 2XJ4A 3PUWA 2DN8A 2Q3FA 2WPDD 4LPKA 2PH1A 1RFLA 4IDPA 4OQXA 4LYJA 2MNAA 2GJKA 4ZDIA 5IK2A 4MGYR 2BDOA 1XTIA 1WF3A 1WI5A 2OQKA 5GROA 2OTLA 1KY3A 2IW3A 4TL9A 3DOFA 4EDHA 2K5UA 3K0AA 3GLFA 1HZCA 4Q9LA 1OLOA 4X66Q 3K9HA 1D9XA 2XX3A 2GAOA 3PSIA 4V0LA 2CK3D 2YC4C 3AVTA 4JI8Q 1G5PA 1FL0A 4DR5Q 1KMQA 1U9IA 2IXFA 3LNNA 1KAGA 3IBYA 2YWGA 2FMXA 4Q01A 1TADA 1VYUA 4R2HA 3EIVA 3U44B 2J0SA 2L15A 3VHLB 4XWAA 3W3ZB 5K8LA 1NMZA 3AP3A 2RKOA 4QXAA 5FH9A 3ICQB 1N0UA 2QMOA 3UMSA 4A3KG 3KOJA 3TS2A 1M74A 2PCJA 2QM7A 5KYKA 3LQQA 4WW0A 5E7NA 2VIIA 1JECA 3EXAA 3RABA 3IEUA 5FI0B 4KVGA 2VP2A 3I1FA 4US1R 2UXCQ 2VQEL 1A2KC 3K70C 2J46A 3CONA 5EE3A 1IBKL 2QG6A 3W6NA 1M6NA 4DLSA 5DI9A 1TQ6A 2JLRA 4EPVA 4GP7A 3CX7A 4RD0A 1UKVY 2P5TB 2Q21A 2ZI5A 4DLVA 1GUOA 4LNQA 1JXMA 2W2TA 1HCZA 2QGNA 4HZIA 3RC3A 4DLRA 3CRLC 2QE7D 4HYYA 5KPDA 2PCLA 3U5ZB 3A8KE 1S4QA 5IYBH 3O8DA 5C4MA 2E2JH 5IP7H 1Z22A 4H44C 2R92H 4C9BA 1GIAA 2A30A 2QTVB 3L0IB 3K09A 4LSGA 1J5EQ 4Q47A 4WVFA 2PX3A 1GRQA 4IKEA 2YWEA 1GD7A 1OYYA 1Z6GA 4IOLA 1IQPA 2VQFL 3I7FA 1ONLA 5HTKA 1RRPA 3GLHE 3KX2A 4ZIRB 3C41J 4DBLC 3GJ6A 4RG1A 4BQSA 1P4SA 3CPFA 2ZJQA 3DM5A 3LVRE 3CRRA 3L2OB 3LDAA 5FBWB 5C4XH 1Q3HA 1U2RA 1QVRA 4Q21A 4EFLA 1P9RA 2FJUA 2XTMA 4DK3C 2FPLA 4MTNA 3IPYA 3H84A 3FGNA 4LGMA 4TN1A 4RCNA 5G53C 1GVNB 2JEOA 5EE5B 4DLTA 4LW1A 1C9KA 1G6HA 3L0PA 5FTNA 2QBYB 5L3RA 5G41A 3ULJA 3HOZH 1XF9A 4LFBQ 1PH5A 3MEFA 2BBWA 2C2HA 3FFAA 3RLFA 3AF4A 3KB2A 3LO5A 4QL3A 4A92A 4KN4C 3EPLA 4GZYC 1AN0A 1ZM4A 4TTPA 3NE5B 1RE0A 5JBQA 2Q2HA 3IQWA 3U44A 1M1KC 2EQBA 5HGQA 2JLWA 2CE7A 1ELOA 2B8TA 2ODBA 1F60A 4K0KL 1Z0KA 2C98A 2FSHA 2VA8A 3U7EB 3NIBA 4YXWD 3G82C 4R1JA 1PFSA 3A1VA 1OH5A 3KKNA 2QNRA 4FMDB 4DT1A 2WP8J 1HR0L 5KNDA 1BS1A 3EBEA 4BFYA 1EUJA 4XVRA 3WRYC 3DHWC 5SZKB 3ECCA 3JZAA 4NDZA 2EIFA 1P61B 2ORWA 3X1WA 3RSOA 3OTOQ 1VQ4A 2QRZA 4ME3A 1VCOA 4JI6L 4AC9A 1R0XA 4B3MQ 4MRVA 3Q72A 2AD5A 4PSKA 4QRHA 3ZZ0A 4A3EG 1EFWA 3LRPA 2YJTD 3FHWA 1IHUA 2CLSA 2GZDA 3WBJA 4DR3Q 4GKKQ 4AI6A 1W5SA 1OXTA 4D2IA 1WRBA 1EYGA 2GN5A 4KFRA 2AX4A 2FH5B 1TQ2A 4TQUS 2DCUA 3H2YA 3M6AA 4MITA 3X1XA 3QF4A 4HEJA 4XWKA 4CEIA 3I62A 2CFMA 3TS0A 1G3IA 2ZE6A 5J4HA 3EC1A 2IUSA 2OG2A 2VP4A 3GLHA 2PPBC 2CWPA 2XB4A 1KI2A 3JVVA 2ZVPX 3AP1A 4HLDA 1CSPA 1Z6AA 5BN4A 1WDTA 1ZAKA 4A3DG 4GT1A 1JJVA 3T1HQ 3NELA 5DGXA 2PI2E 4KU4A 4LFCL 3GJ7A 2F3RA 4CZ2A 2ZIAA 4TQAA 5C1BA 1Q57A 3CKLA 2X19A 3GMTA 1IBLL 3KLRA 2A69C 4OQNA 4WA7A 3QIAA 5C44H 3MXNB 3UMRA 2CL0X 2G9NA 3OOCA 2I1VB 3PJRA 1XJQA 1HA3A 1ZNXA 1E1TA 3K0EA 1TQDA 4Q1AA 4LHVA 4ESHA 4JYCA 4NYJQ 3H86A 5CIWA 2QBYA 2RHQB 4P73A 4KKSA 2AKYA 4PC1A 5B30A 2ZRMA 3ZD7A 2KE5A 2B6HA 2IHFA 4QQBX 4QNRA 3GEHA 4WBSA 2OFOA 2RH5A 5FL7A 2R6DA 4HB4A 4B3DA 2F43B 4WZ6A 1DAMA 1NJIC 2QT0A 4URYR 2VSXA 4LHWA 5HZHA 5J4VA 3M1IA 2IF0A 2L0XA 3K8AA 3AFQA 1CKNA 4NP6A 2ZS7A 2ZR9A 5GJBA 3CC4A 2B8FA 2JLUA 1CR0A 1QZXA 5K36H 4EPRA 1CF4A 1ZJ6A 3DL0A 4MYCA 5JEEA 2BCJQ 2AKAB 3PR1A 1N33L 4IW3B 1ZUIA 1D9ZA 2BEKA 1V8QA 5FBVB 2FFHA 1P2SA 4I4LA 1QJOA 2UUBL 4NBSA 3GJXC 1J8MF 4PSVA 3MFYA 3QF7A 2QPTA 5JCPA 2H18A 2N8NA 1G8PA 1R8SA 1Q8KA 3U6BA 2IUTA 1GITA 2ZYUX 1XTSA 4WZBE 1A1VA 1JALA 3NEYA 3MCAA 3TUIC 3AVQA 4HAUA 2BEJA 1TX4B 4GNXC 4A1FA 4BFSA 4HAYA 1FP6A 4HSEA 1OB5A 4UNRA 5L3QB 2Q6TA 4LK1C 1G8GA 2LWIA 2JA8H 2VHUA 1HQYE 4A6XA 3E5HA 4QOSA 2Z0MA 4RD6A 421PA 1YZQA 4AD8A 4LZZA 3T34A 4ERNA 4HUTA 2MMCA 5FPHA 3EPKA 2IX3A 2OCAA 2W6JA 4LYFA 2PI2A 1Z0FA 3HOVH 5IK2D 4B3SQ 4LY6A 2NO0A 5IYDG 4NZYA 4X8OA 3RVBA 3SBDA 3SJZA 1AS2A 4C0SA 4L5SA 4BUJA 3FMFA 4KKUA 3BFKA 4PO9A 3KDSE 3G6EA 2WSSA 4I1OA 3LFUA 1M2OB 4GLAC 4UP9A 4AYXA 2Q2UA 1G20E 2BOVA 5H8WA 1NBME 4BBSH 1Z6XA 2MMGA 1OYWA 2NO1A 4HATA 1N2CE 2W58A 1PH9A 2ZJ8A 3CNLA 2WAQE 1OTCA 2ZS8A 3QJYA 1II0A 2AUKA 5DI3A 1AGPA 1Y8NB 1L2FA 1VQAA 4IPDA 3QG1A 4HZUB 2JLYA 2ASBA 1U5KA 1P6XA 1DARA 3KKMA 4MRSA 3VR5A 2O5JC 1JQLB 2F43A 1KI8A 4KHPL 3K9GA 2VL6A 1XXHB 2I4IA 3Q5EA 4O3MA 2XGTA 2BCGY 2A78A 2GA8A 2RGXA 3PFIA 3QOFA 4B76A 1S3SA 1G6OA 2C03A 4TZ6A 4PHFA 1S9DA 3DKVA 1XBTA 3KFXA 1U8YA 3ZVRA 1OHHD 2OLKA 3Q9LA 4K8OA 3VX3A 4ZKEA 4BLRA 2K5HA 2IYXA 1QZGA 5FBLB 3UANA 3ULLA 4TT3A 2GVAA 5G40A 3CZQA 1HURA 1DOAA 1CIPA 1NJGA 2CHGA 2LCFA 1L1OB 5J5CA 4EIWA 3A7AB 3G4SA 2C77A 5CJ2A 3C16C 3IFTA 1NMGA 1WFQA 3TR5A 3FHCB 2E8GA 1QHYA 3P20A 2J3EA 3VU9B 3ZH9B 4P32A 1PH4A 5DIFA 1Y63A 1S3GA 4JL5A 3W5IA 4D4LA 3A74A 3T1TA 1X6VA 3EIHA 3FMCA 5IWAL 3CC7A 1ANKA 2V7QA 1XDBA 2QQEA 2QTFA 1FFHA 5TDHA 3OW2A 4BLPA 2A8VA 4JLDA 4TZ0A 3TW8B 1YJWA 3EZFA 5KDDA 2BH8A 3AV0B 2VPPA 4UNNA 1I4TD 3NBZC 1R4AA 2EVBA 5BWMA 3BG3A 4Z8YA 1X3EA 3A36A 2GF0A 4JMPA 1NBMA 3TUJC 5JS8A 4URXR 1GM5A 4ZCIA 2JJ8A 3ZIAA 1YHBA 2VSOA 1HNWL 2W6IA 2AK3A 2Z6KA 2XSZA 1ESNA 2JJ2A 4TWZA 3RDPA 3SQXA 3VR6A 1N36Q 2OESA 1YZKA 2B3GA 3CCEA 2ZAOA 3GLGB 4LPSA 4LF7L 2QF7A 4OO1H 5ELOA 2FNAA 3TE6A 5E3HA 3KQUA 2WWYA 1TUIA 3PVSA 3QE0A 5IP9G 3CCJA 1XMOL 1XTJA 1CLUA 4Y0VA 5DH9A 2JE6I 3UG7A 1R9TH 4Z54A 2QGZA 3EPHA 4YLGA 1BBUA 2QSYA 3ASYA 2QA5A 5FOXA 3M9BA 1O3YA 1XPUA 3CMEA 2J7PA 3WP1B 3EN2A 1COWA 3PEWA 1OF1A 2O0JA 4WJ3M 1Z0DA 4D82A 1CRQA 1NY5A 3JAMi 3HKSA 4JOIC 1EX6A 1ZBDA 2HLDA 3QKTA 1U99A 5AJVB 3ZS9A 2OFWA 2ZE8A 1I4LD 1JAIA 3B13B 4MGIR 1XTKA 4IDOA 3TIFA 1WQ1R 1GUNA 1F6BA 4DUZQ 2GWHA 2GEVA 2OCPA 2F3TA 1JEEA 3EAQA 4BFVA 2AWOA 3UK6A 5LMNL 2ZRCA 821PA 5B64A 1D8LA 4JLNA 4BY1H 1Y8PB 3ND9A 5IYBG 1KO5A 4C7OB 3W5JA 4ACAA 5ELXA 4CIDA 2HT6A 3ZD6A 2R92G 1E2MA 1M7BA 1X86B 1GL6A 1VQGA 4I1VA 4CEJB 3AVVA 2OXRA 1HEIA 4D81A 1RZ3A 1E79A 4A0RA 1SVKA 4KBGA 4EJSB 2ZTCA 4Q19A 2DFTA 3DZDA 3DVLA 2F4VL 1Z0JA 2AXPA 1VDZA 1B0UA 4RCZA 2FG5A 3FFBA 4OHWA 1WBBA 4FCTA 1VG9B 4LFAL 2VHTA 4R4IA 3IO3A 1GFIA 2RGNC 5C4XG 3WP0A 4LJ5A 5JS7A 2K32A 1CULC 1W5TA 4X62Q 1E1OA 4DV4L 3L43A 4G5GA 3R7WB 1GUTA 3AM1A 4OX9Q 3HYTA 3VR3A 4LJ6A 4EPYA 4ZV4A 3HOZG 2WAQG 1SGWA 1PUIA 2WWIA 2HQLA 3AGQA 2OHFA 4B6FA 3LLMA 2OO7A 1HNXQ 2H7VA 2HXYA 3OFNA 4JT2A 1E2VA 1EFUA 1XCGB 4QJ5A 1N32L 4JI7Q 5FL7D 4OKSA 2E87A 1Q46A 1LB1B 4EKDA 2ID0A 3HPQA 2DUDA 1E32A 3MWKA 4LWCA 1XPRA 4A9AA 3B6YA 2YWHA 2JLVA 4ILEA 1HT2E 1N6OA 4NPHA 5A35A 1Q20A 3WNBA 3PG5A 3BU2A 2ZJRA 3S2HH 1C1YA 1W3SA 3TUZC 1JB1A 4TLEA 2ZETA 1ZNWA 2G3YA 2IS6A 1ZP6A 1HYQA 2PCFB 1OSNA 3KJHA 2J0UB 2ZYVX 4NONA 1Z47A 3WBKA 2FFAA 2EFCB 2MO1A 4LF9L 4OK5A 4IRUB 3QPUA 1VG8A 1W0JA 3CLVA 3BZCA 1N9WA 1MABB 3CRW1 1DAIA 3BFXA 3C5CA 3RS2A 2JLXA 1VG1A 2V4ZA 1D6JA 4DR1Q 2QMUA 2ZJZA 3G48A 3K1JA 4YMVA 2GBLA 2QAJA 4JBYA 4Q4LA 3BD9A 2QA4A 4JBXA 4B47A 4B43A 1AM4D 2V55B 3E2IA 1S9HA 2O8EB 3W8NA 3BORA 4IEEA 2GCOB 2F55A 1QVFA 2HJGA 2UUCL 1ZIPA 2R6FA 4ON9A 1GVPA 4UXHA 5KTYA 4C7OA 4DIDA 2ZRAA 4LBWA 2KCCA 3QG5A 4X64Q 4NPSA 1SRUA 1N3BA 4RY2A 4AKGA 2WPDA 3AF3A 2FSIA 3BIFA 2W6JD 3LBIA 4MKGA 2FFBA 2HDNB 4NHOA 2Q2IA 4UKDA 3KFUA 5BR8Q 4DEXA 1SN8A 4LRWA 4POFA 3SU8A 4ITRC 1KMHA 2WSSD 1SKQA 3BH7A 3CNOA 4P31A 5C4GB 4B3CA 2RHSB 5BXQC 5C44G 2FN4A 1KC8C 1L2TA 4LDJA 4OK6A 4MRRA 1UKEA 2ORIA 4AYBE 1IN4A 1G7CA 2R9VA 4QJ3A 4YDHB 5HKKA 2KBFA 1NVWQ 4DV2Q 2NVXH 1HE8B 1I6VC 3IIKA 1OFHA 3C15C 3LNCA 5FOSA 2CQOA 2HIXA 2WAXA 3LX5A 4Q7LA 2ZSFA 4QL5A 2NMVA 3Q8XB 1TMKA 1Y3AA 2EFGA 1H8HA 4NCJA 3TEHB 4V0NA 4I99A 2QP3A 5FUYA 3E9IA 1FZQA 4HIOA 1P2VA 4YCUA 3KDFB 2BMDA 2ZSBA 2IYRA 4GKJQ 3CUEF 3LBHA 4XVQA 5E4FA 5FUXA 1WA5A 3AB3A 1ZYRC 4DV6L 4Q7MB 5FOUA 1GKHA 2KHIA 2QMHA 1JEDA 1ZVQA 2WVJA 4M9ZA 4XIGS 1Y14B 3HYRA 3NTUA 4URUR 4DC9A 1OH7A 4O2DA 1QUQA 1DEKA 1E9CA 2DFKB 3E70C 1P5ZB 2GDJA 4QHSA 4H1VA 3RLNA 2V54A 2ZJAA 2J0UA 4K81B 1E2WA 2QT1A 2DNCA 2V1CC 1IBMQ 1NN5A 1VHLA 2GJAA 5EE0A 2NZ8A 3RS5A 4Q7JB 4TT3D 4CT4B 4YONB 3CIOA 4PQFA 5M5XH 1BYIA 2V6IA 3BOSA 1E9AA 5EE1A 3WMFA 2IT1A 3RZOH 1W4RA 2PZFA 2QE7A 3UPUA 4C0HA 5JI3E 3WHLA 4GOPB 1KZGB 2ZRJA 2ZM5A 1GRNA 2VP9A 4BA2I 2O8EA 4PG3A 4LUOA 5M3FH 5SZIA 4OHZA 3D4RA 1VQHA 1I2DA 2A68C 3RLOA 4OWWB 1E3MA 3SNHA 2KJQA 2D5DA 1FMJA 1FNNA 1A8VA 2OFXA 4ACBA 1W49A 3ADDA 4E07A 4A3CH 4GRAA 4DR4L 2V7QD 3EZ7A 1OIVA 3KQLA 1ZNYA 3SFZA 3EG5A 1Z63A 3KF6A 3HOVG 2FEMA 4I81A 4CDGA 1KL9A 1DG3A 3OIWA 4GZLA 3GJ0A 4U5XA 4M9SA 4HAVA 2ZT9C 1NN1A 1XD8A 3KUCA 2QEXA 1IXRA 3HKZE 3S1QH 4QHTA 1NBMD 1CP2A 4BBSG 2WJVA 3FDIA 4HUQB 3VKHA 2W6ID 3IHWA 4G7OC 2ZPTX 4TMWA 2I0QA 3M4YA 3MMPA 2JJ2D 2J0VA 1IJFA 3J7A5 1DAFA 1TEXA 2HYDA 2ZUBA 1CJVC 3OW7A 2WWXA 1NMYA 3EA0A 3SQWA 4JKIA 1HV8A 1CKEA 1EIYB 3FMIA 1Y1VH 1NVVR 1G8YA 5IHPA 4IVRA 4UY8C 2D62A 3HOWH 2FX3A 2YTVA 3NEMA 1UKZA 1X6OA 3BB4A 2A6HC 3R9IA 2O8FB 1Q90A 2CKZB 1COWD 2PZEA 1BIFA 1Z3IX 3BB3A 4EJSA 3TSWA 4JI2L 2CCJA 2HLDD 3GEIA 1AIPA 1MOZA 4L5QA 1Z28A 2B92A 2N1BA 5HZKA 5EP1A 4KLKA 4PHTA 1RRCA 4C2TA 5TY0A 3G5UA 1IW7D 1UBFA 2PX0A 1QG4A 3FP9A 5HE9A 3I55A 4B35A 3SJBA 2RHMA 2ZM6Q 4A3GH 2EWWA 3ZJYC 2AFIE 4D0LB 1TAGA 1U81A 1E9DA 4GSYA 5EE9A 4UNSA 2ZJ5A 4IOCA 1T3LA 2YTYA 5FLXc 4GOPA 4PMWA 1XJVA 121PA 1IN6A 1K5GA 1KTVA 1K73C 1TPZA 4LYAA 1IXSB 3CCUA 4A3MH 3B1VA 1E79D 1A62A 3K9NA 1VQBA 3BWDD 4TL7A 2G6BA 2MSEB 2CLCX 4MUBA 4D0GA 2IYTA 2QAGB 5A4JA 1Y1WH 2OCYC 4DSTA 4JI5Q 3PO3G 3CRVA 4BFTA 4DLXA 4M1OA 5FPKA 1XZPA 2IA5A 1X3GA 2JCSA 1K9MC 4IVPA 4DR2L 2AFHE 4JJKA 4RZ2A 2REBA 3UATA 3GLFB 4F38A 1W7AA 1DPFA 1NP6A 4DV0L 1W46A 3BZKA 3IBGA 2ZUDA 4BLSA 3THOA 5ELNA 2H5XA 1DAGA 2P65A 3W34A 2DY1A 1MJCA 1VPLA 3MUFA 3OEHA 4LJYA 3WYGA 4HUQA 2QGQA 3NKVA 1P2TA 3NC0C 5LMUQ 4LF4L 3OFND 3A0JA 1L1OC 4TLBA 2QQ0A 4PAQA 4PC6A 4OO1G 4TQ9A 4MA4A 2ZTSA 1E4YA 1GL7A 1KSGA 5J4LA 3QVVA 1FNMA 3B5JA 4YHHQ 4XJXA 1FYCA 3TQFA 4D25A 5LB4A 3I4NG 3F2BA 1KDPA 2Q9AA 2XZLA 1V43A 3MJRA 2BBSA 3R8CA 4LBZA 4JI0Q 5JEDA 1RPZA 2O8FA 3J81c 2WJYA 1T3HA 3GCGA 4DEYA 1YKSA 4RD4A 5D3QA 4A3LG 4L9WA 4LBVA 1UPTA 3O47A 3FPPA 4LC1A 4PANA 3S17H 2KB0A 3KXKA 4TKOB 3T12A 1XNQL 1I3QH 4IOAA 2UU9L 5CJPA 2REXB 4GMDA 5P21A 2KCTA 5FFMA 3A4NA 1U0LA 4G5SA 3CCMA 1OIWA 1H8EA 1XEWX 3KB1A 1HNZQ 2Y8EA 5DNYB 2VHCA 1CJKC 1N6HA 2I3BA 4OO1I 1ASYA 3SN6A 3O8RA 1GOTA 3ETLA 4AQYL 1VG0B 4HDOB 1F3OA 2CCGA 2B8WA 2JJQA 4O2RA 5FL3A 4R2IA 1OIXA 4GS3A 3PIRA 4JL8A 4OHVA 5FTMA 1RJ9A 2QM8A 2VHJA 4GBMA 4YDSA 2EQSA 3UKDA 1G5RA 1C4OA 3UE0A 2OXCA 4NCKA 4Q4AA 3AVWA 1XRJA 1US8A 2QAGA 1U94A 3IQXA 3PXGA 5FR2A 1UAAA 3J80c 2B8GA 3WNDA 1M34E 3HKZG 1E2GA 3B7GA 3CPEA 3AKEA 3S1AA 4LYHA 1AK2A 3L7ZC 2QN6A 3DM9B 1F2TA 3PITA 4IDQA 1FW6A 1R8QA 4LJAA 5EXXA 1F48A 1VCNA 2A1AA 1ZM7A 5HKKD 1NTGA 4MGZR 4P72A 2PBRA 3AB9A 2JASA 2VEDA 3X1ZA 3QXSA 5SZJA 1A5TA 3W90A 1NIJA 1H8HD 2D2CC 2BA1A 2ES2A 4PZ7A 1W4CA 1T3SA 2J41A 2P0EA 3GFOA 4WOPA 2DGYA 1P16A 3P4YA 3U3JA 1IJEA 5J3BA 2GCNA 4LUZA 3NG1A 4DT1B 2FXQA 1A7JA 2DFLA 1QHSA 1XP8A 1YHQA 5JJKA 2DPXA 2DYKA 2E9SA 2PMDA 3GJ4A 3L0SA 4A0FA 4G3XA 3HOXG 5AJ3L 1KGDA 1H9JA 4C3JH 1W44A 2G0NA 1PV4A 4ZDKA 4TVAB 1PLKA 1EESA 4B3BA 4OJKA 2O8DA 1IZ6A 1OHHA 2DWQA 4FN5A 4XWOA 3ADCA 3A6PC 4IQZA 3HR7A 5BYJA 1TL7C 4KO8A 2FGJA 2VQSA 4MDFA 1FJGL 1LW7A 3LV8A 4OHXA 1VYVA 2W2XA 1VTKA 2R7DA 4EX5A 3FOZA 1NI3A 3S24A 1DG1G 1SULA 4HAWA 5KU1A 3QF4B 4P4UA 2ODNA 2VQEQ 3AKCA 2ZROA 4CEIB 1TWCH 2O52A 2WJGA 1IBKQ 4JI4L 3D31A 2QPOA 2AMCB 3F5FA 2QEQA 4A0GA 2AKWB 3GLHB 2FGKA 4Q1EA 1GZSA 1HY3A 1YR6A 3VMFA 3LVQE 2GCPA 1EWHA 1YJ5A 3CZPA 1AQYA 5LDDC 5C3EH 1SLJA 5HR5A 5K8IA 2GXSA 2C9OA 2DBYA 1GRRA 2NO7A 4PO8A 1YZNA 4IOKA 1KDOA 4P75A 5KOYA 4V0ME 2MQHA 3CCVA 1BKBA 2GRJA 1OXXK 3T35A 4UPAA 2WOOA 3P27A 5B2ZA 4B32A 1VQOA 4EFNA 1ZUHA 2L5TA 2VQFQ 3VDYA 1IYUA 1Z06A 4DK1A 1YI2A 2ZVQX 1KO8A 3CRQA 1WB9A 5BN3A 4FINA 3KKOA 1T91A 3VNUA 1HR0W 4BASA 3IHLA 1EFTA 5M3MH 1E9EA 3GTPH 2HT1A 2IHBA 3S1MH 1G41A 1N6KA 1AQUA 3B1WA 3GFTA 2PT5A 4KFTA 5FUVA 4PPQA 5F9HA 1MRSA 2ZR0A 2VHQA 1KI6B 2RB4A 4K46A 2R6CA 1CKNB 4EFMA 1G3QA 1JJ7A 3SFVA 4OHYA 4Q9JA 3CWQA 2EDGA 1ZD8A 2JATA 5HCIA 4D4MA 3SZRA 5E7IA 1IBRA 2BE5D 1VQLA 1I2MA 3CRMA 4JSYA 4HLUC 2BA0A 1SXJE 2XNDA 3UDFA 1TWHH 4C2MH 1CTQA 4LI0A 3WMEA 5JEAJ 5DLQE 1L4UA 2HUPA 1BVSA 2CW0C 4B73A 4A3FH 3S14H 4K0KQ 4I1SA 3BB1A 1GHKA 3S1RH 2GETA 2JA5H 1HR0Q 3A1SA 4BLOA 1G4AE 1MV5A 3PEUA 1YE8A 4M9XA 5EQTA 3K81C 4DVGA 1XMQL 3OAAA 4A0HA 4OK3A 4C3IH 1K0RA 4RCYA 2XJ9A 5KPJA 1SE8A 5M3FG 4JI6Q 1R6BX 1EXMA 4B6EA 4GZMA 3THWB 3RZDH 3H94A 2F9MA 1EG7A 1TWAH 3CWZA 2HHHL 4A3CG 4TYQA 5IYCH 2JLSA 1T9HA 1W2BA 5JI2E 1W48A 3VQTA 4Q4HA 1CTMA 4Z8XA 4V0MA 4JLMA 1I94L 2O5IC 3B1ZA 3KJGA 3KUDA 1EFHA 3T1VA 1G18A 4A8JA 3U4ZA 3VKWA 4DSOA 4AKHA 2QRNA 1NLFA 1XZQA 4OI2A 3C7KA 1TU2B 4JBWA 1H9KA 4EAQA 3AH8A 3UE1A 3A4MA 3MXUA 4NXML 2WJJA 2YOHA 3CPJB 3KKQA 2ANCA 2FEOA 2N78A 3S1NH 4B3RL 3B8HA 4GFDA 3OEHD 1LTQA 2XTNA 5DI3B 5BW8A 4H02A 3UDIA 1R7RA 3DMNA 2EFEB 1I4DD 4LFCQ 2F7SA 1JE5A 5BQ5A 2XITA 2HV8A 3CF2A 4LJ4A 3EPJA 1DBSA 2K52A 1IBLQ 1RRGA 2P3SA 1Y1VG 4QGHA 1LTLA 4UP8A 1D5CA 1FX0A 1Q22A 2V8OA 3AYHB 4NXMQ 3HOWG 2R7ZH 5GJCA 4C4PA 3JZMA 3U7GA 2FFQA 2D7DA 1E99A 1EIFA 1YR8A 4YMWA 4BECA 4Q4JB 3D7MA 5EP3A 1PH8A 1KI6A 2QU8A 4Y0AA 1FQKA 3J81j 3CD6A 3V4FA 4DR6L 4LJZC 1RIFA 1ZM2A 4OL0A 2IWHA 4RJLA 1SXJA 4DV7L 5KNBA 1PYSB 1G19A 2YZ2A 3Q5DA 1NLYA 3A58B 3MJHA 3AF0A 3L8ZA 4LHYA 4Q00A 4M4SA 3D8BA 2N3SA 2BBOA 1KHTA 3K0CA 3OEEA 4QGAA 4M8NE 4D80A 4MDEA 2J7KA 3PUYA 4L8JA 2A5FA 3DPUA 3F0TA 1LVGA 3EIQA 4OQFA 5H68A 1II8A 1YEZA 3I92A 2JDIA 4D26A 4A3GG 3LBNA 2C8VA 2JA9A 4IPGA 1H8ED 5H1SE 4IHQA 2Q8IB 1UBGA 4L5TA 1TKWB 4DUYL 1KY2A 3OESA 3BBPA 4HR7B 1B70B 1N33Q 5KDOA 3WDNA 3TQYA 1QHHA 3CXCA 4MKFA 2UUBQ 3PCOB 5TARA 3SI7A 2UXBL 3THWA 1VHTA 1KKLA 4LF6L 1M90C 1Y1WG 1ZMXA 4DR7L 1WBDA 1JPJA 4XSGA 3VNVA 1PH2A 3Q85A 4HLCA 2HYIC 2XXAA 1G17A 2GXUA 1KYIA 4PSAA 4HJAA 4OJQA 4YY3L 1AZSC 1OXVA 1GUSA 3E0EA 4H13C 2WWHA 4IPCA 2JK8A 4JV5L 3QBVA 2ATXA 4KBFA 1SZPA 1X1SA 4DR7Q 3A8IE 2YKGA 1TF2A 4RMFA 2JXMB 3B6EA 1QDEA 4RFSA 2P67A 2ZRFA 1W2GA 2UVQA 5FI1B 2KBNA 5KDLA 3RRNA 4BFWA 5HCNA 3RS3A 4AURA 1W1WA 1S40A 1VIAA 2NGRA 2ZITA 4NYIR 1WMSA 2RMKA 4TL8A 4TSFA 4EPWA 3EZ9A 3O8BA 4QM6A 2CMKA 1XJ0A 3QXHA 3B82A 4IJMA 3BJIC 4NCHA 2PMZE 1KSFX 4NL4H 4Q4JA 2DHRA 1RL2A 1L4YA 4WJ4A 4DLUA 3VR2A 2IHYA 4GPTA 3G0HA 5AUQA 1XTRA 3PUXA 2F1RA 1D2EA 1YR7A 3KF8B 3U4VA 4KHPQ 1LY1A 1AKEA 1T8UA 2GEUA 3HP1A 3NEJA 1WP9A 1VF7A 1NF3A 1VQ9A 1U9IC 1M7GA 2W0SA 4A3JG 3ND8A 2QORA 3OE7A 1N25A 4NTZA 1E2KA 4BXXH 1TU3A 2GJ8A 4F4JA 4RKFA 4E09A 5JFGA 2RGBA 4KFSA 5DYGA 1E0AA 4JBKA 3CH5A 1YJNA 1N6LA 1QVCA 1VQKA 4Y7NH 4DDVA 2F1IA 1EWQA 4LUCA 2VF8A 3QKRA 4A3IH 3EARA 4NE2A 3BE4A 2IF2A 2K50A 2FPKA 1NMXA 1NVVQ 2FOLA 2RGEA 5BYKA 1V5WA 5K8UA 2EFHB 2K7VA 2WJIA 3SJCA 4DUGA 1CEEA 4DZZA 3Q3JB 1Z08A 1IN8A 1P7CA 4JKYA 5IWAQ 1X55A 1CJTC 4XVUA 2A2ZA 1H9SB 3PEYA 1QHXA 1O7LA 1YVDA 2YVUA 1K8OA 4Q1BA 3U3RA 4XD7A 3GPLA 3U60B 4YCWA 3LQRA 5A5GA 2WSMA 3VHXA 5B58C 3CCRA 1FTSA 2MFIA 3UXMA 2QPAA 3I3SR 1NE3A 3M4OH 1ZCBA 1RVDA 1XMSA 4B2IA 4YC7A 1PYBA 4EJSC 4F4CA 3K09C 4B75A 4F7WA 3NDBB 1R0WA 3R8FA 2K75A 1NLZA 2JEAI 4O0AA 5LMNW 1HNWQ 1E0JA 4Q1FA 2ZU6A 5IF9A 3V9PA 3TBKA 3M3YH 4L5RC 2QI9C 4PPFA 3H15A 1W36D 2CXXA 2GXQA 2VY3A 4A2PA 2XNDD 4LF7Q 3AVPA 4LWZA 2HCJB 4DCUA 5DYIA 2X8AA 4B3TL 3BH6A 1XMOQ 3AKYA 4PR0A 1VQJA 2AXNA 2UUAL 1DELA 4HDQB 4MUAA 1PA6A 1VQ8A 1G4UR 1NN3A 2UKDA 4M9QA 1VCIA 3IUYA 3B78A 3ZLJA 3KZ1E 3KYHC 3K80C 3OAAD 1GTVA 1PHJA 3OPOA 1E2DA 4A75A 1NKSA 5EP2A 2AN9A 3RRMA 4DSNA 4DDUA 5IP7G 1QRAA 1SVWA 3AUYA 3N70A 4N1AA 3TW4A 221PA 1GL9B 3ZVMA 1ONBA 5BN5A 4PZ6A 1VQDA 1KO7A 4HIKA 4R4CA 2UUAQ 2DWOA 3A4LA 4JSTA 3SYLA 5K8TA 5LPNA 4CGZA 3CC2A 4TMKA 2ERXA 4FDBA 3GTJH 3RC8A 5C3EG 5LMNQ 4HJ5A 4IFDJ 2NZOA 1JR3E 4PFSA 4CEHA 1W2HA 3B1YA 1KI9A 1H9RA 3D3QA 4AK9A 3BC1A 4GI7A 1F2UA 3T1QA 1BYUA 3WWVA 1GWNA 1KMHB 4HI0E 3SBEA 521PA 3T06B 2BVNA 5F9FA 2IEZA 2A5YB 4LOAA 1TUEA 4QBFA 4DCVA 721PA 2F1MA 1E4VA 2ZJPA 1YHAA 2J59A 1GO3E 1J99A 4QJFA 1YITA 2F4VQ 2E2IH 3W6OA 4B3FX 1CS4C 1E9BA 2I5LX 3CCSA 3R20A 4Q1DA 4AYWA 4B74A 5M5WH 2KCMA 5M3MG 1G8HA 1K3RA 4LFAQ 3I4MH 1H9SA 3F1ZA 5M5YH 4BA1I 1J2JA 1FOEB 3NXSA 4KAXA 5TXGA 4X6AH 2ZI9A 4ZO4A 1OB2A 3T1YL 3EASA 2WHXA 2FPMA 4DV4Q 3NH9A 3QEJA 3M7NA 4BBRH 1G6PA 1AA9A 1Z6HA 5AJXA 3RNLA 3EZ6A 2NVYH 5JHGB 4KSCA 1U0HC 4KFUA 4LV8B 4OQMA 1J8YF 2ZQ5A 1W4AA 4Q9KA 4EPXA 3FHTA 1DVRA 1G8FA 3QXXA 1QUQB 2H8KA 3SEAA 4JBMA 4DLWA 2E5LL 1EGAA 1SXJD 3EZ2A 4ZI2A 2O0KA 2N49A 1QHIA 1E1RA 3CW2A 3LAWA 2PNRC 3AEVA 1N32Q 1S96A 1T0JB 2OE2A 2ZJ2A 2G0TA 4WXPA 1XU4A 3EA5A 4DPGA 4A3FG 1SHZA 3OEED 4LF8L 2QP9X 4QG7A 1FUUA 2CL6X 1CR2A 4YWLA 1II9A 1JB7A 3QBTA 2JA5G 1OXUA 4P71A 1Z29A 2JDID 3RAPR 4FWTA 4URVR 2IL1A 1P8LA 5FOWA 2OCEA 1JBKA 2Y0SE 1FQJA 1QHNA 3HWSA 4W5WA 2GJSA 4GOKA 4TMVA 4LF9Q 5JJLA 1E6CA 4JLBA 1JPNA 4IDNA 2H57A 3ER0A 2OBLA 5JEAH 3TR0A 3RSLA 4BRUA 1SKYE 1BMFA 3KJIA 4KN7C 3IIMA 4C3ZA 1YZ6A 3SS8A 2ZUCA 1LNZA 5IYCG 1IY2A 3BH0A 3KF6B 4W5HA 3N2IA 4XSHA 4PAMA 2K14A 2OBMA 3NC1C 1Q86C 1ZU5A 2UUCQ 2AUJD 3BAFA 4BEBA 4YWMA 3LWUA 2GESA 4J15A 5J47A 1V1QA 3A1WA 1VS0A 4BLTA 1IN7A 5L3SA 4PXAA 1KDTA 3DDCA 3UIEA 4BE7B 1VF5C 1KI7A 1SFOH 1X8KA 1F5NA 1Z2CA 2ZRKA 5CLLA 2ZS9A 4V0OA 2PJRA 4L16A 1GNPA 2ZRBA 4C0AC 1T4GA 3U7FB 4JBJA 2H92A 2ZJOA 2R6AA 4QBIA 2JLZA 4DB2A 2R8RA 3NBFA 1N5JA 4LF5L 4Q9IA 4IOMA 3NHBA 5M04A 4TSFD 3WY9A 2R7ZG 3JC66 4CRWB 5GAEC 3OIUA 3IEVA 1DE0A 2B63H 4PC2A 4TL6A 4DV1L 2GAAA 1CJMA 1TU4A 4DLYA 4DV3L 4X65L 4LC0A 5K36G 3PIOA 3B1XA 1AS0A 1E69A 1FVIA 2K5VA 1QF9A 4HAXA 3ADBA 1HT1E 4C2UA 3AF1A 1G51A 1VIYA 3Q8DA 5HY6A 3CH4B 1KD1C 2BM0A 1MKYA 5JJIA 4DV6Q 2TMKA 4N3NA 1N34L 3K9LA 4NCNA 1Z0IA 1L7VC 2NG1A 3DLLA 3E1SA 3K7UC 4US2R 3OE7D 1EK0A 2OAQ1 1MIUA 3DKPA 4MRPA 1U90A 4OI4A 1YZTA 1K83H 2ZU0C 4LX0A 1AGRA 1KI4A 2JA8G 1Q44A 1OW3B 3MWJA 1S2MA 2Z0SA 1OFUX 2CCZA 4QJ4A 4GL2A 1D7QA 1ZNZA 4NKRA 2GZAA 1G3RA 1HH2P 2WWFA 4FD2A 5C46F 1OH6A 1YR9A 3M85A 2WM9B 3C14C 3STBD 3EWAA 4X8HA 4ZDWA 3WYFA 4DKXA 3I5YA 3CF5A 2NN6H 4JI1L 1CUKA 4DUGD 2C9YA 4X8LA 2KENA 1MRNA 2FSGA 1A63A 3N2EA 4NYMR 3NH6A 4DK6C 1N5LA 1E22A 2NPFA 2VW9A 4DR4Q 2QP4A 2CDNA 1UBEA 2MSDB 5GJVC 3DOEA 4TTQA 2WFWA 3VR1A 1CU1A 4XD7D 1UE7A 2CHVA 2D2EA 2ECKA 2GHIA 3PENA 2QZ4A 4P0TA 5ANRB 4DCSA 5J4YA 1KAWA 1VCMA 4JI1Q 3CX8A 4HB3A 1AE2A 2H16A 4DAYB 3H0GH 1TNDA 1K8MA 2ZRIA 3QQ5A 2H5EA 1XMIA 3A8JE 2QSZA 4LV6A 1KK1A 4F92B 2VZAA 4HJ8A 2OUKA 2EJGC 3UDXA 1OE0A 3MG9A 1WOCA 4DXAA 1NVUQ 4GP6A 4PZ8A 4L9SA 1WCMH 3MLEA 4BFXA 2Z6VA 4B44A 3U58A 2KHJA 2IYSA 3B9QA 4DCTA 2VNUD 1Q1EA 3HJNA 3FPAA 4DV5L 1LABA 1VQ7A 3CAMA 1MJEA 4DCNA 3T15A 1X9NA 2WOJA 4IXMA 5CDFE 2VSFA 3R9WA 4FI3C 4P4SA 1LF0A 4M22A 4JYAL 1S1CA 3HPRA 4PQRA 3OF5A 5EJEA 1G21E 1XJCA 2Y0SG 4KYUA 1N6RA 1OFTA 3UDGA 1JJ2A 3A1UA 3HU1A 4AIIA 4JI2Q 4BXXG 2NZJA 1XNRL 2P6UA 1UEBA 3Q7PA 2YYZA 2UXDL 1U0JA 2BHRA 2W00A 5GAHC 3LD9A 1R10A 2OBNA 1RJ9B 2C95A 4R4TA 2Q2TA 1G7TA 4DHEA 4GN3B 5KSPA 4NXNL 4MZ9A 4R71A 2PJZA 5G3ZA 2JA7H 5FLMH 4Q4AB 5F2EA 4ZKDA 4A3IG 1US8B 2YOFA 1Q81C 4TMXA 5JRJA 4URWR 2RGAA 1DAHA 3GJ3A 3N5CA 3RS4A 4IDHA 1HZ9A 3S1AB 3REGA 1VQCA 4EQ6A 2JQOA 1YBYA 2OLJA 2A6ED 5FTKA 1F2TB 5LBIA 4PQYA 1Z9FA 3D0FA 3ZYCA 2NVTH 3FMPB 2P6RA 4AYBG 2O0HA 2G1JA 3B60A 2JA1A 1B8AA 2QENA 1XX6A 3CPHA 4JJZA 5IE8A 1CI3M 1IW7C 1GAJA 2GILA 4DRZA 4JI3L 3WMGA 1MO4A 3KQNA 4FCVA 5E95A 1LUZA 4DR2Q 1Q1BA 4P33A 1QG2A 1R0ZA 1E2PA 3GDEA 2ZXUA 2V3CC 3RYTC 4QNMA 1Q1ZA 4DV0Q 4KHZA 1U98A 1XMJA 2A5DA 3TK1A 2YHSA 3WYAA 4LBYA 3ZQJA 1DGSA 3CF0A 5JRZA 1W0KA 2PZGA 5FPYA 5LD2B 1FMLA 3TKLA 3HR8A 4ABYA 1Q3TA 3TAUA 5IYDH 2IEYA 3VR4A 2GVDC 2CE2X 4OGQC 4A6PA 1KNQA 3NVAA 2XB2A 4LF4Q 4TMZA 3I56A 1E1RD 2ZRNA 2OZEA 2O8DB 4UXIA 5FBRB 1ZM3A 5B57C 4E5UA 1XWIA 5CDFA 2CHQA 4A82A 1KDRA 2GK6A 1KK3A 4WZAE 2AL7A 4M1KA 3RRYA 1SVIA 3CF6R 4GNXA 2C04A 1NKTA 4IFEA 2RGDA 1SVLA 5GQOA 4L5BA 3X2SA 1E2QA 3K0FA 4US0R 2QY9A 4BY1G 3RRZA 4ZCMA 5C0XI 4OWTB 5IT9c 3J81i 2DFNA 2NPIA 3D6TB 4RVCA 1AJEA 4EQ5A 3J7ZC 4EPTA 1VQMA 3W9YA 2V1UA 3L0OA 2BMJA 1WCV1 2IYZA 1IONA 1BMFD 2IS1A 1XNQQ 4XTCS 2UU9Q 2BDTA 4Q66C 3RR5A 1E98A 2VYFA 2HEIA 3QXJA 3AEZA 3S16H 4MKIA 2PNHA 3IIJA 3B2EA 1AZTA 1D2NA 2B7BA 3EW9A 2I1QA 1LYLA 3FYHA 3GTOH 4NYIQ 4OWXB 4AQYQ 4GN4B 4JLOA 2HCBA 5IT5A 1MO3A 5C0XJ 4TYYA 3VFDA 3GLIE 1YVCA 5FUWA 4Q9HA 4CF7A 3FKQA 2G1KA 1JQJC 4M53A 4IFDH 3SJAA 3MD0A 4APVA 3I4MG 2CBZA 2GBLC 2C9CA 2ZAMA 3ASZA 1VKJA 1KJZA 2OILA 4NH0A 4KODA 4LUVA 4X66L 3J80i
chains in the Genus database with same CATH superfamily
2FZ4A 3IS3A 4A23A 1T4CB 3GARA 4IEIA 4HNAA 3IB3A 1AHIA 1VQEA 1LACA 3MQ4A 4QM7A 1GKUB 5JDIA 4N9WA 2AUTA 4RABA 3QEAZ 3PHHA 3CINA 4CDCC 3DXFA 1DS6A 2R97A 2J9ZB 4PV7A 1EXVA 4A8JB 4ZCLA 2R1TA 3HKEA 1D8AA 4AYTA 1OWPA 4BWYA 1D2CA 2Z04A 5JJBA 3O3OB 1Z2PX 1AN9A 4P34A 4B9WA 3RB8A 3J80L 3GLKA 2R93H 2GZSA 3G9XA 5REQA 1YZUA 3E03A 1RKNA 4KR0A 4CQMA 2B5WA 4D98A 4FXPA 3A70A 3LKZA 1NSTA 2P8JA 5KX5A 3THXA 3ZZUA 1GGKA 2WB4A 1VPWA 5TSDA 4UOZA 4EJSC 4HJ7A 1JX6A 1G4HA 4PW0A 4HAIA 4MARA 1PLJA 1R12A 3FNEA 3QHPA 4PBTA 1D2MA 4QUAA 2C3PA 5HE8A 4ZQFA 1DUIA 2EGHA 2EWMA 4KE7A 4ZIRA 2ONKA 1EFRA 5TMPA 3CS3A 3M9LA 5LQCA 2JIRA 4G7ZC 4HX2A 1OJLA 3V96A 4FN4A 3E18A 2D5CA 4J91A 4MV4A 3DCYA 1NFRA 4FYXA 3DEZA 1KKMA 1JJGA 2R6GA 3Q3HA 3NU1A 3M33A 4DAVA 4GC9A 1O7IA 3LG2A 1KQPA 1UMDA 2LCIA 3I73A 2NYRA 3A10A 3CLRC 4TTVA 3ONWA 1T25A 3IURA 4MROA 2R11A 4CQLB 3A9TA 3CPWA 4ZHQB 3MAAC 1NU6A 4CM9D 5JWRA 2CXUA 4AG5A 1PGNA 3KBBA 1LJUA 1TF7A 1WXWA 1CJBA 2GPTA 3VKHA 4M86A 1V26A 2BBTA 3I2IA 4JVNA 3H5LA 1DC8A 1FDVA 1CDZA 3PF4A 4NYMQ 1P1KA 1KYYA 1YNOA 4HLQB 2I2CA 2WB1G 3CSSA 3INYA 1PUXA 3U6KA 3WWPA 4E3ZA 4J0KA 3VPFA 1I94B 2CNWD 1G59A 1KOGA 2HPVA 1X9IA 3IFSA 1K4YA 1SMYC 3PO2G 4I4NA 4QC2A 1VQIA 3X1YA 3PO3H 1N36L 2O14A 2XBLA 3QVUA 1UKAA 1NNXA 3SIRA 1SEVA 4P7KA 1P2UA 4OIKA 1B9NA 3HXQA 2O2JA 5K0NA 3UMFA 1C1DA 4K5VA 1BTOA 4FNMA 4LJ8A 3P0HA 1HE4A 4E7PA 3INNA 2GF2A 2WJHA 3TFQA 1XT6A 3GTQH 2RGRA 3PE3A 1AO0A 2XMCA 1L1OA 3V1UA 2GVZC 3LT4A 1XR3A 5SYNA 2X1VA 1NURA 4N0QA 4Q03A 4ZJUA 1A6XA 4JI7L 4UDYX 1PNOA 3C4JA 4KQ1A 1POXA 3FBGA 1H0SA 4AJOA 1LFDB 3W05A 3GOHA 1OI7A 2BD0A 4OHOA 3O13A 1SKYB 1F9RA 3BZUA 4JYBA 1IWOA 4CI0B 3T7AA 1SCBA 2F8MA 1XP5A 2DT8A 1SXJC 2BGMA 2WWGA 3MRSA 1OC4A 4UQOA 4QFMA 2ZB8A 1TAHA 4M9RA 3GAMA 2TMGA 3FW1A 1H3EA 1YRBA 3G8DA 4QNNA 1AOXA 2VP0A 1KVTA 4K5WA 1PI3A 1QO0A 1LTSD 2VZ8A 2OV6A 2YWFA 3K1TA 2Z58A 1E61A 1K06A 4P4SB 2GF9A 2IYYA 5JNLA 4RY0A 4DV3Q 3Q8MA 4EI7A 3ZJTA 1SIUA 3TAHA 1RW4A 3PWSA 1E3TA 1MR3F 2EPBA 3IILA 4C5BA 3LYLA 3K0SA 1SG6A 4G97A 1DQSA 3M3PA 5JMWA 5E4WC 4MPJA 4YLEA 4O2BB 1SNPA 3MTIA 4KWHA 3JD4A 4XM0A 4A5SA 1JQ3A 2VS1A 5ENVA 1GCOA 2FP3A 3FRJA 4N3AA 5E2IA 5THQA 4F6LA 1RQPA 1KK0A 4PZYA 4I36A 3MFQA 1GD1O 1V48A 4YJGA 2O59A 3ECSA 3GRUA 4HNUA 1YBFA 1PTOF 2C5SA 5KWIA 5L6LB 4A3BG 3BMQB 4OFZA 1NASA 2ZM6L 1QZUA 1OAOC 1R5BA 2QJWA 1YJXA 5AK6A 1C4WA 3OCZA 4NU0A 4NXNQ 5P8WA 3U31A 4RCVA 1IOZA 2HREA 1C5KA 1XZAA 5C0XG 4GBED 4BZWA 3N0XA 1M1YA 4HNAB 3VU3A 1HTLD 2QX9A 2E0IA 4X7RA 4AJHA 4P74A 3T5BA 4DV6B 5EJMA 1IEVA 5F5NA 1O97C 2VHXA 4ZAYA 4JQOA 5T8KA 2FSPA 4JLJA 3QOXA 4BGDA 4Z4FA 2QMEA 3SR4A 2YV5A 1THZA 3HUDA 1TWFH 1NVKA 3CCCA 3HKEB 1I6LA 5FNVB 1ML4A 4L15A 4RMJA 3CMAA 4YCNA 4TXJA 1JT8A 4BNKA 3CUUA 4RL6A 3DT8A 4WNAB 3RBZA 3I9JA 4Q9NA 1M8AA 1T2DA 2OD7A 3AVTA 5REQB 1KAGA 4R2HA 3SHOA 1SCJA 3VHLB 5AVQA 1NMZA 1MVLA 2YN2A 4RMHA 2GD2A 2PGIA 1SPBS 1DCMA 4LQLA 5E38A 5FI0B 3L7BA 4HQFA 7MHTA 2R5FA 3BHIA 3CLHA 4LNQA 4HZIA 4ND5A 2WT8A 2R48A 4HH1A 2PTHA 3O8DA 1CERA 4UE6A 2R92H 4NE9A 3WICA 1SOUA 5I7FA 2VJKA 4ZIRB 4HWTA 3TL3A 4H7HA 3ANSA 2FPWA 1PFQA 3IMKA 1K6XA 4S1TA 4M87A 1N8KA 3W7BA 3AF4A 3LO5A 1WSBA 1M1KC 2C98A 4FIZA 2XUDA 3KKNA 4LRQA 1T9GS 4MVCA 2X1LA 4IMRA 2ORWA 2EXZA 2UYQA 3GTOB 3EZNA 4MRVA 4QRHA 1AKUA 3PGKA 1T29A 2GZDA 1YONA 5CGZA 3RU2A 4ZAWA 3ILVA 5B3LA 4DTCA 4A3DG 4Y1FA 3ILHA 2O48X 4A73A 2G08A 1Q57A 5D7NA 4TSKA 3CHYA 2ZJ4A 1TQDA 4JYCA 4E51A 4QXQA 2IHFA 2B2NA 2OCIA 4BBJA 2FZGA 3OE5A 5JVDF 1NJIC 2L0XA 2JI9A 3AFQA 1Q17A 3FPHA 2JLUA 1CUXA 1CF4A 1IB6A 4FEGA 2AKAB 1N33L 4MW7A 2FFHA 2QN3A 3QF7A 4ZKCB 1WIWA 1R8SA 2NXWA 4MI6A 1V3VA 4Y2RA 4G65A 3ESQA 3FSGA 4JGIA 5FPHA 3UWSA 2OCAA 4ONEA 1A04A 4PN7A 3ZDBA 5IK2D 5IYDG 4BUJA 2EIHA 3ZUGA 4LYDA 4D9CA 1F8XA 4GLAC 4KXYA 1ONSA 3ELBA 2JI7A 2HQEA 2PSHA 1L4BA 1C1DB 4BJ6A 1N2OA 4BXOB 1P6XA 2FAXA 3SSAA 4RWEA 3O90A 3NHPA 4MIYA 2HLNA 1YFJA 3AL0C 3PFIA 1K88A 4DQDA 2ZOSA 3UTDA 5HUHA 2B8JA 1QQAA 1PR4A 1KU6A 3WZ2A 2RCFA 4YT2A 3CZQA 1GN8A 1L1OB 2E4VA 3VV2A 2I29A 2Z8XA 2I0FA 5LP1A 4YP6A 1F5SA 4WFN3 5DIFA 1EQVA 2CXHA 1O7JA 4BJHB 3S81A 4XA8A 4DA4A 1LPMA 1EP2B 3K8OE 4B3RB 2W48A 2ZJFA 3OW2A 2A8VA 3RSCA 1R4AA 1F12A 2J3QA 3H99A 3SEZA 3A4TA 3ZIAA 3UJ3X 3SF8B 2JJ2A 1WLSA 2FNAA 3X3MA 2RGYA 5E9JA 2JE6I 3R4CA 1FP4A 4V3CA 4WK0B 1SD5A 4ZO7A 1F6BA 4PINA 2Y3IA 3Q11A 1Z7WA 1Y8PB 4YYZA 4ACAA 5E4TA 1CRZA 4YRPA 3RFCA 2F0GA 4D81A 4RF5A 3I90A 3TMEA 1BWPA 1QHFA 2Y2VA 3DMFA 1PWZA 1CW2B 3FFBA 1LEHA 2J3JA 4WMLA 2Y6UA 1GFIA 3B89A 1CULC 5TGDA 1JHQA 3S2IA 3OE1A 3N6XA 4JB3A 2NUTA 2P9YA 1XRNA 2PJDA 3N0VA 4C0KA 4ROTA 4IX1A 4ND7A 3QFCA 4KIJA 4G0QA 5AVSA 1J9GA 1XDZA 3N8NA 1WTAA 1BGWA 4J3NA 2JKVA 1GLGA 3RC7A 3QFTA 4L22A 4BYGA 3W8NA 3ZHCA 1G98A 4Q1VA 3DD5A 1AC5A 2DKFA 4ON9A 3AWIA 4K9DA 4PMBA 3K2IA 5CX1A 5CBAE 1FS5A 3RT9A 1E64A 5IWCA 3ABQB 1SUIA 1C8VB 4JAVC 3LY9A 1RS0A 2NZXA 4OYLA 3H5AA 1N1MA 5HKLA 3Q8XB 5CTAA 2WU3A 4GF5A 4NCJA 2J9GA 4F7DA 2L11A 2Z6BA 4M7PA 3INTA 1E9CA 1FYWA 1VL5A 4MUEA 2Y66A 3Q9SA 1F4LA 2NZ8A 5IG2A 4EL5A 4IWXA 4S12A 1JICA 2LNDA 3GEMA 5A9SB 1GZDA 4OHZA 1I2DA 4NMWA 2HK8A 1AW7A 3G89A 3VOSA 1M1YB 3TQOA 4K2AA 4XUEA 3PQ2A 1BBXC 4EECA 4DMRA 2B4KA 3ZWAA 1QRRA 4AO8A 3IHWA 2TSSA 2F0IA 4XQCA 3FKJA 1UC5B 4O6VA 1SA0A 5AW5A 3SQWA 3FMIA 1CKEA 1EIYB 3R7NA 4OQQA 2AJLI 1X6OA 4UFNA 3UMCA 4C7XA 4G89A 4WSOA 4WLOA 4FR5A 2HHJA 5LLTA 3I2JA 5HZKA 4QTYA 5EP1A 1G5HA 1RRCA 4FE4A 1SBTA 4RHTA 5CXXA 1IW7D 4EYSA 3D43A 2ZJ5A 2G5GX 1IEQA 4ZEOA 1IN6A 1KDVA 3BWDD 2VPZA 2ECFA 5I9IA 5A02A 2BKAA 3UT0A 4NPCA 2X2OA 1KQFA 4JJKA 1RQRA 3BZBA 3BZKA 1JGTA 4E2YA 3AC0A 3OZGA 1SE4A 4RA9A 1ISFA 3NKVA 4PZDA 4BATA 3I28A 1JIJA 3H1AA 3I4NG 5AOAA 3G5LA 4PLYA 4HEA1 4LBVA 1UPTA 1SNYA 4UFPA 3O82A 2XCUA 2KCTA 2RJOA 1H8EA 3CLUD 5CDUA 3CN7A 4G84A 4OHVA 1JA1A 3ZWNA 4MLDA 2W2OA 4PHCA 1LTGD 4PAGA 2YHBA 2QN6A 1O6FA 4LJAA 1F48A 2PRSA 3NGMA 4HQ0A 5D51S 4WXYB 4AUNA 1P16A 3NG1A 4W1SA 1QHSA 3HOXG 2VAWA 4Q5VA 4ENVA 5HOEA 2UXDB 4OHMA 4IN3A 1QP7A 1T6BY 5K20A 2F17A 4IUTA 5JCJA 5D8DA 3I58A 1FXWF 4Q1EA 2VDWB 4BOYA 1LVHA 2DBRA 2RARA 3ZJVA 2MQHA 3VH4A 1JLMA 3HI4A 3PNYA 3NR2A 2GLTA 4ZYZA 2GARA 5J59A 2L1BA 2IHZA 3TNYA 2YWXA 3F47A 2DY7A 1SK9A 2OMKA 2Y1WA 3H91A 4CLEA 1IBRA 3CRMA 1NAPA 3S17B 3UDFA 3AESA 1UBNA 4W4TA 4U63A 3ER8A 3PS9A 5ADUS 3AU8A 3Q3EA 4RCYA 2X2PA 4JI6Q 2ZTHA 5BV0A 5I4BA 3RZDH 2C9ZA 4JB0A 3FPKA 1RLMA 1VL2A 2JLSA 2VTVA 1T9HA 3U9OA 4RAUC 1G18A 3U4ZA 4AKHA 4AMGA 5JE8A 1NLFA 3TP8A 2Q0XA 5BW8A 4QOHA 3KLSX 1KVSA 1QGZA 2H4JA 1HKUA 1ODKA 1EUQA 4OJTA 4NXMQ 4IJKA 3TGWA 1B6SA 4G8JA 5EP3A 1PH8A 1KI6A 4NWIA 1AMNA 3D8BA 4JJGA 4NMZA 1XCOA 1QJ4A 2JDIA 1TGYA 1OI4A 1O6CA 5H1SE 5D1HA 2R7NA 4XQEA 4DUYL 4FGLA 3AI1A 4ZHQF 2RHHA 1KKUA 3S4YA 4N40A 3OKCA 3Q0AA 1G17A 3Q88A 1QRTA 4RGOS 5I3ZA 3QBVA 1HXHA 4UM7A 2DF8A 3B6EA 2AB0A 3WLKX 4BCCA 4M36A 4QU0A 1ESEA 5LQRA 1FP4B 3VU0A 3DZCA 1M6YA 1DAOA 4WJ4A 3AFHA 4ZXFA 1NF3A 4LYEA 4CETA 1VKOA 4RTJA 4NFSA 2O6LA 3FPGA 3P9RA 4TS9A 1QVCA 1E1KA 2VF8A 4CE6A 2KHSA 5BYKA 1DWPA 3ENZA 4P3XA 4ZCSA 2LS01 2VHZA 2NUTB 4LFCB 4RXUA 3NPAA 3DOUA 3ENVA 1K97A 4E5YA 3CMCO 4ALJA 4F9TA 3I3SR 3NQTA 1NLZA 4UM9B 2E4WA 2FPSA 3RLIA 4HYTA 1EWTA 4PQXA 5C3XA 2NTEA 4D7AA 4HDQB 3BGDA 1V1RB 3IUYA 1EK5A 4H7EA 2CY0A 4G57A 3RRMA 1SVWA 2FZVA 4BX0A 3SYLA 3VZRA 3JV7A 3ZCRA 2F00A 4PFSA 4AK9A 4LHSA 1GWNA 3JQBA 4RJJA 2F0OA 2F1MA 4CDNA 4UHBA 3NK9A 1EEHA 1ICFB 4QJFA 3UWPA 3E2PA 1ZH8A 1AGYA 1CS4C 3CCSA 4BA1I 1XTPA 5C5MA 4JNKA 3MA2B 4JB8A 2JAWA 4HRVA 4PBRA 3U26A 5JHGB 3OQOA 3S55A 3LC1O 4MCIA 4XM2A 2H2DA 1T0JB 1Q1NA 2XOEA 1AGNA 4JXKA 4C7JA 4RIEA 2PKEA 5IF3A 2WE7A 1SOVA 4O4IA 1BMFA 1QZTA 3IIMA 1L0YB 2PGAA 2RHLA 1B0ZA 3WZMA 1L5WA 4NOMA 3SSMA 1DUVG 4ER7A 1FDIA 2OR3A 5LL6S 1BU8A 4PXAA 3DZJA 5DHUA 4ZFNA 1A98A 1O9HA 3WQBA 3NORA 4L16A 4MI3A 5GAEC 3ACBA 1GOZA 1FVIA 2IY9A 5EHGA 1VIYA 3JQCA 3VR2D 3HY3A 3HJFA 5LU9A 1QK4A 4HWPA 4DCCA 3C3EA 4BY1B 4NCNA 3OE7D 2Q99A 3MTSA 1TJ4A 1VBKA 3DOIA 2B6NA 3MWJA 1ZXBA 4NKRA 1G3RA 3G7UA 4O29A 3WYFA 1QK3A 2OOSA 3NH6A 3OJXA 4G4JA 2YVQA 3VR1A 1QV6A 5A03A 4IUDS 1N7JA 1VCMA 2E3JA 1T0IA 1I4XA 1TNDA 3D7RA 5LQAA 1KRXA 2QSJA 5BMOA 1WOCA 1KRWA 5CNIA 2HA2A 3AOGA 1LRJA 3DZKA 1IOLA 1Z4JA 3PHBE 1Z5UA 2XA9A 1KEWA 3PNBA 1EY5A 1IATA 5DLDA 1LF0A 3A1FA 3RTCA 3MOSA 1STNA 4J1TC 3PJEA 4LGCA 1JUDA 1XNRL 1PO7A 3WLTA 5AKLA 3EXIA 3ITNA 1EK1A 2FFKB 4F87A 1B1CA 3IP1A 4DS3A 2X9VA 1J0EA 4O8CA 3D0FA 1V96A 2F2TA 3IAYA 1IW7C 2GILA 3KQNA 2QDKA 1BCPB 1WD5A 4IDEA 1KPHA 3RKSA 2D8MA 4YP0A 4A6PA 1VP3A 3ZY5A 1KNEA 4MGHA 3O83A 2XECA 2VOEA 1NJSA 2BFEA 4K6KA 1DC6A 2AL7A 1H5NA 1E2QA 2C5BA 1GPBA 3C39A 3L0OA 1VE7A 3RIEA 2VYFA 4I6GA 4BNNA 1RQNA 1LV9A 4Q82A 2Q46A 2HJHA 4QG3A 4P08A 1SKAA 5IT5A 4DR4B 3GLIE 2I6XA 2CFCA 1EWKA 2V45A 2GBLC 3D2CA 4NH0A 5EXTA 1HPCA 3CLUC 4R9UC 4Y7DA 2KI5A 1VI5A 3CLSD 4HLNA 3O8NA 1U2DA 1W36B 5KX5F 1SOMA 4K9SA 2C4HA 4BBZA 1WVIA 3E6ZX 1WVGA 1RACA 2VH5R 3F4BA 2ID8A 1G16A 1P4HA 1AZLA 4FX5A 3T94A 3PIO3 2FSFA 5E1DA 2B2YC 4IGEA 1Y5LA 1N5KA 1EFID 1XZFA 5GADl 1V9CA 2IGTA 4JI4Q 2WZQA 2ZYIA 3AUJB 3TMKA 3H5RA 3ZDEA 3I2ZA 1AE3A 1QP0A 2BR5A 3IAXA 5DRTA 1KEKA 1FTQA 1ZI6A 5FJIA 3ZQ6A 2PD3A 1GGEA 4QCLA 2QTTA 3AF2A 2C92A 1JTVA 3L0ZA 2IXEA 4Q16A 4ER3A 1O7YA 3GVHA 2ZCJA 1IYVA 2IX1A 4DTIA 4EG7A 2ESRA 4LWQA 4MYTA 1EJ6A 3U4HA 2J33A 4DYHA 3EVGA 3L46A 1ZN2A 1DKNA 3ILYA 1JDNA 4YTEA 3R44A 2IXDA 4DR3L 3HSSA 1FJ2A 3TZUA 1NM5A 3LLUA 4CM8A 2GN9A 1ZC3A 3IQZA 3C7TA 2OC4A 1K0UA 3KZVA 4R1MA 5ALIA 3T1HL 2RBEA 4EG8A 5DISB 3P9PA 2Y1EA 2EARA 3V7FA 5TMDA 1FDWA 5DN6A 1LI5A 2FKNA 1WCMG 3LIIA 5LB2A 5CCEA 3ZBUA 3OOHA 1EQ2A 1JF8A 2XKBA 3QEOA 5H5JA 3ROFA 3JQ9C 4NSNA 4Y18A 2Y1KA 1RD9D 4DR6Q 3RUPA 4DMKA 4IJHA 4CMCA 4CVNA 1YUNA 3MJVA 1B73A 2DR3A 4ZRMA 1CC1S 1LPNA 4HJ9A 1AKWA 1RMQA 2ZAIA 2PIAA 1YNXA 5KCMA 1XV5A 4RH3A 1L3BA 3KTAB 1SEBD 4MWCA 4IALA 1G60A 1EWRA 3W5UA 1WCXA 3PNQA 4HWKA 4WL0A 5K0EA 1KSHA 3HEMA 2X5KO 4RGMA 2DP4E 4UJ3A 2KQUA 4C3IB 1MF7A 1GP2A 2OP0A 1DPGA 2YIMA 1T34A 2P6NA 1R6AA 3HS0C 2AJCA 4M0FA 3BG5A 3T5AA 1Q0RA 2D0DA 5JMTA 5B3KA 4IHAA 3TEFA 1AQIA 3R7FA 1AS3A 2D0PA 2J1LA 1IBLB 3JS5A 1UBRS 1PL6A 2YC2C 2CXSA 2X14A 4DAOA 2WD9A 5FP0A