3PUZA

Crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
total genus 88
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puzA01
3C5CA 2NZ8A 2RGDA 3HOYG 4DK0A 4R4QA 1DTSA 1SR3A 1R0WA 2ORIA 1VQLA 1H9JA 2L0XA 3QOFA 4OI2A 1MO4A 1CR0A 3KF6A 1YIJA 4Q5IA 3IDQA 2CJWA 2KCTA 2L15A 4I4LA 1UFQA 3IO3A 3DPUA 3VQTA 4AKIA 2H1LA 1MRSA 4ALPA 1UDWA 1PFSA 3A36A 3KZ1E 1FP7A 3U9SA 2A5DA 3RSOA 3CRRA 1ZINA 4LOAA 5EP4A 1OIVA 5E7NA 3OZXA 3UDIA 3WNBA 3CONA 4KAXA 5C0XH 4I1SA 4F93B 2QAJA 1E1QA 1YR8A 3RLOA 4DK3C 1LTQA 1GAJA 3HPRA 2WV9A 1IAQA 2KE5A 3OHMA 2FEOA 3MUFA 5FL3A 3V4RA 5C46F 1ETUA 4BLRA 4D80A 1E6CA 2EVWX 4M4SA 5CM9C 4LFAQ 2IX3A 1E7ZA 1VCOA 2YJTD 3G6EA 2WWXA 2BEKA 1PLLA 2DCUA 1G7TA 4MRPA 4Q02A 4PPGA 4HLDA 1TMKA 2J0UA 2DWPA 2XZLA 1ZNXA 3FKIG 1NMYA 1IW7D 1J6QA 4FINA 5FUWA 4AYXA 4I7ZC 4X62L 3HOWG 3RS3A 2ATVA 4D4KA 3OTOL 1DAFA 2DUDA 4X64L 4QGGA 3FYHA 4C3IH 4FWIB 1V5WA 3KL4A 2OFOA 2RAPA 2JA7G 1P4SA 1XEXB 3WRYC 3O8RA 5EUMA 2G0NA 1G64A 5F98A 3GCGA 1Y14B 3T56B 1EG7A 1CJTC 1ESNA 3DM5A 1G3RA 3CLVA 1KOFA 3L8ZA 4F92B 3JZAA 5FJ8G 4LF7L 5CIQA 4V0OA 2J7PD 2R65A 2Q3MA 4PZLA 3X1WA 3C14C 1M34E 3TAHA 4POGA 5A0FA 4C2MH 2F3IA 3GLFE 3IPXA 4FMCB 3Q72A 1HNWQ 4QOSA 5IP9H 5EE9A 4KFSA 5C4GB 1G51A 2KBFA 1O7IA 4MH0R 4O2LA 2BH2A 1QG4A 2JJQA 1TAGA 2C77A 2CJWB 3QBTA 3PF4A 4TMXA 2A5YB 4CEJB 4FN5A 1QZGA 3GTKH 1XJ0A 4B48A 3HOXH 2CCZA 2PT5A 2Q3FA 2IHBA 2QAGA 1KO8A 1PH1A 1TNDA 2XSZA 4IRUB 5DSZA 1SKYE 4DJTA 1XX6A 1IY0A 2CCKA 3U3KA 5KSYA 2R93H 5LD2B 3A74A 2MMCA 5FBWB 4FDBA 2ZRGA 1W46A 1F3OA 4CT4B 2RF4A 3I72A 2B63G 3EQLC 2E1RA 2OCYC 2PCLA 3I8XA 2O8DB 5IP9G 5D3MA 4HEJA 1F48A 5EUQB 3K70B 4MNOA 3TMKA 4H1UA 2QBYA 1BDOA 2JE6I 1IZ6A 3KJGA 3LH5A 2V1UA 1EIFA 2OTLA 2P65A 621PA 4JLBA 3D6TB 1A6XA 4A93G 2JEOA 4LCBA 4AQYL 4QGFA 2ZVPX 3K7AH 2B8GA 2BVNA 3MWJA 4IVPA 3U2QA 1YHNA 5H1YA 4E09A 1W2GA 5K8UA 2Q9AA 4PSVA 5A4JA 4DV6L 3BJIC 2FSFA 3RHFA 2QMEA 2R62A 1KTVA 4IW3B 3TGPA 2CW0C 3IBYA 1H9RA 4U00A 1GNQA 2YWFA 3I4OA 1NF3A 3IHWA 1JXMA 2PQAB 1YZNA 4RZ2A 4L5RC 1XEWY 2F9LA 3SU8A 1KKLA 4L8GA 2FSIA 2DR3A 1VPLA 3TZUA 3BORA 3MWKA 4TMZA 2BM1A 3AF3A 1E0KA 3NELA 3TW4A 1CJMA 1YR6A 4V03A 3EWSA 4TKOB 2F1IA 1G41A 4OO1H 1QVRA 3Q7PA 1TU2B 3B6YA 3TRFA 4B3DA 4EAQA 3PQCA 3SBDA 4DUZQ 1Z6YA 1UPTA 1KYIA 1GFIA 2AN9A 3CX8A 1IOZA 4X66Q 1XXHE 4A1FA 2JJ1D 1J7KA 5CDFA 1WBBA 3I5XA 1Z08A 4LJ6A 3CR8A 4UNNA 2FDCA 4QFMA 3VFDA 2GWHA 3BGWA 2J7KA 3LVQE 3PUZA 3FKQA 3ZIAD 3FFAA 3CX6A 1VQNA 3BFXA 1VQBA 1DELA 4DLXA 3CNOA 1XU4A 3NE5B 4YMTA 2JJ2D 1L4UA 2AKAB 2PLRA 3BERA 3T15A 5M3MG 4PC3A 2JATA 2DNCA 3ADCA 4QBHA 5FR2A 2VW9A 2E2HH 1R10A 2EW1A 521PA 3THWB 1P6XA 2PZGA 3ZYCA 4JLOA 1WOCA 2A30A 2RGGA 3UMSA 1GKHA 1X3SA 4EKDA 5BWMA 2V4DA 1F5NA 2ALYB 4KYUA 3G71A 2HQLA 2ZR0A 4TLDA 1GRQA 4DDTA 1HH2P 2Q8IB 1SXJB 4B44A 5F9HA 3WNDA 2NO6A 5EE5B 4JK1C 4BEBA 2JA9A 3N6RA 2GZHA 3D8BA 2Q9CA 4FW9A 1TTTA 5JHGB 5BXQC 1Z47A 4DCVA 2VO1A 2C03A 2YWGA 2VQFL 2P6UA 3MRSA 2V6JA 1KKMA 4W5HA 1XMQQ 1N33Q 2YINC 1AE3A 4NP6A 5JS7A 1PH8A 2G88A 2GEDA 3TEHB 3SYLA 4JLDA 3W3AA 4DV2L 4DR3L 4KLZA 2C78A 4GL2A 3A8IE 1IW7C 1FVIA 1BBWA 2K5VA 4LF9Q 2FFHA 2I1QA 1I2MA 2XAUA 4LHZA 4R4IA 1G4UR 3T53B 2ZE6A 4HATA 4NKRA 4GZMA 5HPYB 1BS1A 5KSPA 4NZYA 2NN6G 4LJ9A 3P20A 1E2FA 4ZDIA 8OHMA 3KB2A 2QTVB 5JRZA 1XMQL 2GJ8A 3LRPA 3RANA 4M1MA 2LWIA 2DFKB 2W6JA 2EWVA 5DISB 1L1OA 5FUYA 5K8TA 1PH7A 4KBFA 3MG9A 4WXRA 2IYRA 1ANKA 1RZ3A 1Z0AA 2V8OA 2VEDA 4Y0AA 1W36C 4DR5Q 1JB1A 5AJWA 3ZLJA 4EQ6B 3LNNA 2IF0A 1II0A 5HKKA 1A8VA 4JBMA 3CP0A 1A82A 1P9WA 1R7RA 3I4LA 3MAAC 2OXCA 3VU9B 3F1ZA 2P67A 5KDOA 4PSAA 1SULA 2PNHA 2DB3A 4P32A 2XTNA 3WXMA 2EXDA 1Q3HA 2KI5A 5FI1B 2XGJA 4UXHA 3ADKA 4M53A 1X6VA 1IN5A 3W3ZB 4IKEA 4JVSB 4TSFD 1M7GA 5C0XI 1VQ4A 2BMJA 2F9MA 1KSHA 2ZETA 3KDSE 4AYBG 4BFVA 1M6NA 2ZTDA 3R20A 4N0DA 1ZUIA 4MGKR 1GUAA 3SZRA 2CFMA 1RJ9B 2WBLC 1FNNA 1K3RA 2OAQ1 2P2LA 4HDOB 4OQXA 3V4FA 3VAAA 5B30A 3IEUA 3K80C 3MXNB 4PG3A 5BN3A 1E24A 5C4XG 3LWNA 5IHPA 2GZDA 3CXCA 5E7MA 3GLGA 3F8TA 1E9AA 2A5GA 4TQAA 1T91A 3IPYA 2JA8G 4JV5L 4A3FH 3JVVA 1FR3A 4BECA 4DAYB 3VHXA 2XB2A 1G3QA 2A6ED 3QKRA 3KJPA 4B33A 3V00A 3QXXA 3A1UA 2FEMA 2UUCL 1ONBA 5K8IA 1H8EA 2BMEA 1GUTA 1I4DD 3WNCA 4X8MA 2K5NA 1QZXA 1VIYA 1NVXQ 2QP3A 3ETLA 5JECA 4DSOA 2CCJA 2D0PA 3ULLA 1OH5A 2BA0A 2NGRA 3F3YA 1KDRA 4M8NE 1P62B 2EWWA 4QRHA 1NLYA 1E4VA 2VHUA 2EJMA 3IEVA 1VQMA 4UP9A 4JLJA 3A7LA 1J70A 3NDPA 2NN6I 4EQ5A 1B70B 4DK1A 2IS2A 3RR5A 2BC9A 4GT1A 2ONJA 1VQDA 2WB1E 5L3RA 2HF9A 4AIMA 4WZ6A 1XTDA 1VQ7A 4B43A 3EPHA 1UF9A 2WJYA 3CCSA 3HKZE 2IW3A 3QG5A 2YU9H 1CR2A 3S1AA 2VL6A 5GAEC 2PMKA 3NC1C 1JXOA 3TSOA 5E4FA 4AG5A 5JCPA 3I92A 4GN3B 1N32Q 1DADA 1E0AA 2PMZE 1N0UA 3B1WA 2R7ZH 3TKLA 1E1RA 4AG6A 2PNRC 1N34Q 4HB2A 1E2IA 5J4HA 2GHIA 4NCKA 3L0SA 1HTWA 3THXB 3VTKA 4A2QA 1KD1C 3VR6A 2QGQA 1DG3A 1E69A 1MJCA 4JYAL 4CDGA 2QRNA 4KO8A 3JVUA 3ZVNA 1UE7A 3RLFA 5JJKA 3AQ4A 2JLRA 2FE4A 4Z8XA 4QJ3A 3DOFA 5DHFA 3KF8B 1GHJA 1U9IA 4IOMA 4GLXA 2FH5B 3Q3JB 3EIHA 2IYXA 1Y1WH 2OTJA 3E2IA 2HF8A 3EAQA 4PPFA 1LUZA 3CCLA 4HYYA 2FX3A 4A4DA 2Y0SG 2B21A 2VP0A 2Q3HA 4NH0A 5J47A 3VR1A 4YXWD 5HE9A 1Z0JA 2EFHB 2GILA 2J41A 2ZYTX 1MO3A 5B64A 2N3SA 3AF4A 3I55A 4DKAC 2IF2A 2R6CA 4KCGA 5GJCA 3IIMA 1WCV1 5LDDC 3AVTA 4ZCIA 1E2WA 1HE8B 2ZRNA 1LY1A 2H17A 3WMEA 5L3QB 3AVWA 1D8TA 1OYWA 3AVXA 2BJVA 4AKEA 4C7OB 1C0AA 4HLUA 3CRQA 2ASEA 1T8TA 1I2DA 1H9KA 5GAGC 1R5BA 3BS4A 1T0HB 4IPDA 4A3JH 2J7PA 5FPKA 3PIPA 4D4LA 1WE2A 3FOZA 3I73A 1D7QA 1L8QA 3QKSB 1YZTA 1W4AA 5GADl 2WJJA 3BRWD 3DHWC 1GTVA 4XVRA 1IYUA 1M74A 3AEZA 1V8QA 3PSIA 2A1AA 3CB4A 1N0WA 3PFIA 3QXCA 4IDPA 3BE4A 3NVAA 1CJUC 3L0IB 4IXNA 4MRNA 4TZ0A 1AS2A 1SE8A 1T0JB 1ZM9A 3WWVA 3Q8XB 4DT1A 3UPUA 4YC7A 2QNRA 1XZPA 4Q03A 4GMDA 4D4MA 1QVGA 3HOYH 2OBMA 4A3DG 1U9IC 5K8LA 3SFZA 3VR4A 1S3GA 2ODEA 2WOJA 4A3JG 5KDLA 1QUQB 1HR0W 1F2UA 4RZ3A 3I2ZA 1KK2A 2R44A 4U7DA 4OJQA 2ODBA 1UM8A 3I4MH 1T8UA 1G7CA 1MT0A 3NXSA 4DNRB 2QEXA 1CI3M 1E9FA 3FTQA 4FMCF 2N1BA 1RRCA 1WQ1R 3B9QA 2QA4A 1UBEA 2B8FA 4EPVA 1LVGA 1QRAA 2D06A 4NMMA 2OLJA 2ZM5A 2IUSA 3K0CC 4BFUA 1E1QD 4KFUA 3TAUA 3A5UA 1RRPA 3I1FA 1UBGA 1UEIA 2DFNA 3KXLA 3PO2G 2XNDA 4BBSG 4DRZA 1PH4A 1NBME 2IY5B 4O3MA 2QT0A 1Z9FA 4UPAA 1US8B 4B6EA 1AKEA 2ZYUX 3SDZA 1YHAA 1A4RA 2AKWB 1W2BA 3I56A 3DVLA 5TMPA 2GZAA 2O8CB 4LJ4A 3A8JE 3FFBA 4OHVA 5LBIA 2GDJA 4N3NA 1GO3E 4R7ZA 2NO0A 3CPFA 1X1RA 2FFQA 4P33A 4YDHB 3BZKA 1WRBA 1EFRD 1L2TA 3J80i 1PLJA 1T6NA 2O8CA 2PJZA 1O78A 3T51B 3ZJYA 4HDCA 2ZSEA 4XD7D 1QUQA 1F2UB 1SROA 2OCAA 2ZSBA 3G4SA 3FPAA 1JEDA 4LUVA 4A3BG 4BXXH 2KBNA 4K0KQ 4LF9L 2OV2A 2RB4A 5KNDA 5EAYA 1G3UA 3U7EB 5GROA 3ZZTA 4DV3Q 4B3TL 3BBPA 1LF0A 1W49A 2P5SA 2XZPA 3BIFA 2FMXA 1FZQA 5ANRB 4IFEA 4PPNA 5BR8L 5F2EA 1YHBA 5CK5A 2FWRA 1QHYA 2IT1A 2OQ0A 2FU5C 4YDSA 4X66L 3UWKA 4MDFA 4B34A 1WYDA 1K8AC 4DV1Q 5DH9A 1GIAA 1FTSA 4NCIA 4JYCA 1FX0A 1OV4A 1FX0B 4ON9A 5AK0A 1OH7A 4TT3A 5D3MB 4RY2A 4ACBA 1SKYB 2B63H 1HZBA 1G7RA 4LJ8A 1W36B 2ORVA 2XXAB 1W44A 3FHWA 4C7OA 4Q4JB 1COWA 1CKNB 4JOIC 2FSHA 1XF9A 5JLJA 2OBLA 5M3FH 1X55A 1P16A 1KJWA 1YZLA 2OEPA 2RGEA 2WICA 4Z8YA 4B32A 5EXTA 3FGNA 5GJVC 5FI0B 4JVLA 4A93H 5IYDH 1HQCA 4DR4L 2RHQB 3CCRA 4DR1Q 3CQZH 2CNWA 4PR0A 1EX7A 2TMKA 5J40A 2AK2A 2AWOA 1Q1ZA 3EW9A 3H84A 3NBZC 2WAQG 3HOUH 4N0EA 2OXRA 1XD9A 3TE6A 5K36G 1HR0Q 3THWA 1EIYB 3HOZG 3BFVA 1XTIA 1OH6A 2WM9B 1HZ9A 4M9XA 1NL3A 4RCYA 1KAOA 4ZDWA 4C0AC 721PA 1YJ5A 1BMFA 1GD7A 2OSBA 2ZS8A 1WFQA 4GOPB 4M9ZA 3WP0A 4NPSA 2IYSA 5F3WB 5CK4A 4KITB 2J0SA 3RZOH 3H3VI 1VQ8A 3U4QB 4WZAE 2UXBQ 2VHCA 1S40A 4H9GA 2V3CC 2UZIR 4IOLA 1PYSB 1QHIA 1TWAH 4GN5A 1XNQQ 2HJVA 3NKVA 4GOJA 4YY3Q 2W6JD 1B23P 2QMUA 2Q21A 1FP6A 3QIAA 2OM2A 3S1AB 3K9NA 4C2TA 3AKDA 3U61B 4G0NA 3PF5A 1UE6A 1VDZA 3I4NH 4OXPA 5JJLA 1Z0IA 1NMGA 1N36L 3K0AB 1Z2CA 4BBSH 3PCRB 4TQ9A 1S3OA 3RN5A 3FHOA 4OYHA 2H92A 2UU9L 5JEAH 1HH4A 3HOVH 3CCUA 2FGKA 5DYGA 2NN6H 2I5HA 2QGZA 5LB2A 4P4UA 3U7FB 3R9WA 3IRBA 3UDGA 4C0KA 4DIDA 2YWEA 4M9QA 1CR4A 2Q2UA 1OHHA 2PLFA 3RC8A 4QJFA 1KDPA 1AQUA 1VCMA 4TWZA 4PZ6A 2HHHQ 1CULC 3SJZA 4BRUA 5FTLA 3LQQA 3FMFA 5FLXc 2UZ3A 4LF4Q 1G16A 1TPZA 2HUPA 3RZDH 1W2HA 3B1YA 1QHNA 2JQOA 4XSGA 5SZHB 4OI1A 4BZPA 3I4MG 2GKSA 3CRVA 1SFOH 3QKRB 4L5BA 3V9PA 4Z51A 4JJZA 1L2FA 4G7ZC 2QE7D 2XXAA 5IWAQ 1P8LA 2D3WA 5JZVA 1NIJA 1A62A 4NPHA 3GLGB 4YCUA 1S4QA 2PL3A 2CCGA 2GJSA 3L0PA 4TMWA 4UNPA 4WAUA 5EZ6B 3SYKA 3VX4A 3F2BA 3I61A 4BY7H 2FFAA 5AJYA 1A0IA 1P3JA 4LF4L 3IUYA 3GDEA 2RHDA 2C35B 3EZ6A 2QF7A 4KJZA 1JE5A 5DE3A 5JSZB 3CWQA 2UXDL 3D7MA 4PANA 4Q9LA 4OX9Q 1YZQA 4IVRA 1SXJC 2ZJQA 3STBC 1PH5A 1T4GA 1ODFA 4OWWB 2D74A 4WBSA 3IILA 4I1VA 2JDID 2QN6A 1FL9A 5KDDA 3U60B 4YONB 1E79D 4BFSA 5AJ3L 1KIXA 2X19A 1UBCA 4JI8Q 4UP8A 3ZJYC 4TLAA 1P5ZB 4QC2A 2QZ4A 3K0XA 3MLEA 4HAZA 3HKZG 2YHSA 3M1IA 3KKNA 1Z0FA 1I94L 1E4YA 1OB2A 2JLWA 4GLVB 3H4MA 1QDEA 4BY1H 4YWKA 1T3SA 2WAXA 4JSYA 2A78A 2KJQA 3K0CA 2A6HD 4WJ3M 1V9PA 1HEIA 421PA 2IL1A 4F91B 4X8HA 3W8RA 3OIWA 3K70D 1KI1A 2AFIE 3K09C 1W47A 2ZJOA 1PH3A 2KCCA 4M22A 4MRVA 1IJEA 1HE1C 4X62Q 2ZT9C 4IQZA 4OWXB 2BH8A 4JI5Q 1NIPA 1P61B 2J87A 4DLWA 2V7QA 3A1WA 3K8YA 5KO2A 2PEYA 2WSSD 2P6RA 1BYIA 3TQYA 5IYBH 2OILA 3OW7A 3QPWA 4Q4HA 1L1OC 4G7OC 3RDPA 2KB0A 1OXUA 4LPSA 1U81A 3VMFA 5FH9A 4JLKA 5IRCD 3BWDD 2CL0X 2WKPA 5GVRA 5BN4A 2PPBC 1YNNC 1U94A 1Z22A 2CHVA 4BY1G 2Y0SE 2NQ2C 4IJMA 2JA7H 5HTKA 2WHXA 2AWNA 3CNLA 1CTQA 2O5VA 3K70C 3CAMA 2QL6A 2A68C 4XSHA 4CZ2A 2AUJD 2QQ0A 4B76A 1MKYA 1KC8C 1D2EA 1RE0A 1W0KA 4KXFB 1KK1A 2CMKA 3K09A 4C4PA 5G40A 4Q1BA 1QG2A 1GL9B 1ZD1A 1GUSA 1JR6A 2GCNA 4HI0E 4H02A 2WIAA 2F55A 1OFHA 5E7JA 3FMIA 1KO4A 3CW2A 3CZQA 2NVTH 1S1CA 2QSYA 4C3HH 3QENA 2G3YA 3NBYC 3OEHA 4KHPQ 2EFEB 4LGMA 3OAAD 2ZJRA 4URVR 5JEEA 3FPPA 3ZS9A 4D25A 4V0KA 1MOZA 2FV8A 2K4KA 4G5SA 2JDIA 3HP1A 3IQXA 1NG9A 2F52A 3EARA 4JL5A 1ZM7A 4IOCA 2QENA 3GQBA 2ZRIA 4LW1A 4GP7A 2IXEA 3RLNA 1OFUX 4O2RA 3RC3A 4B75A 2NZOA 4BFZA 1E2ZA 3GP8A 3KXIA 5M3MH 5EQTA 3R9IA 5JBQA 1Y1VG 1XNRL 1NNEA 3TVTA 1IJFA 3KF6B 4YWMA 5IE8A 1VQPA 1BYUA 2IYLD 2UKDA 4B3BA 4BY7G 4OQFA 2ZUCA 1P2UA 1WXQA 3FDIA 3BJUA 1CUKA 1P2TA 3CPHA 3PUXA 3L43A 2B8TA 4BZXA 1AGRA 4AYBE 2LSSA 5E95A 2XTMA 1HQMC 2WMOB 3DZ8A 4OONA 4YMWA 3OEED 1VMAA 2FSGA 3QKUA 1GL7A 2PT7A 3TJZA 2MO0A 3L82B 3X2SA 1RYHA 1G6PA 4M0LA 2OBNA 2QGNA 3B60A 4MKFA 2JLVA 3AB3A 2K5HA 3AKCA 4KFTA 4KN7C 2J59A 4D26A 4IXMA 1G5PA 1IXZA 3E9IA 1DEKA 2C8VA 3FHTA 4KVAA 1SVKA 2AFHE 4A3GH 1C7YA 1H8ED 3C16C 3CF2A 4IDQA 4LJYA 2PJRA 2PQAA 1S9HA 3HOUG 1YQTA 4IFDI 3LXXA 4HB0A 4NCJA 1VQJA 3G5UA 4LRWA 6Q21A 1DCZA 3KQNA 4JI1L 2VSFA 1G8FA 4B74A 4OHZA 1JJGA 1YRAA 2UUAQ 1GITA 2QORA 3K9GA 4RD0A 3W6PA 2XTIA 1KGDA 1S96A 3UG7A 2JLZA 2V54A 5BN5A 3KOJA 3KX2A 3S2DH 2RKOA 2VF8A 1TWGH 5KNCA 5CIWA 4LK1C 1BKDR 4IHQA 3MEFA 3W5OA 1Z29A 3PEWA 3BG3A 1JECA 4II7A 4O0MA 4DV0Q 4I1OA 2CWAA 1AZTA 4JLAA 4JS0A 1X65A 4LBYA 4DC9A 4Q48A 4ZI2A 4RZXA 2BHRA 2EQBA 2O0HA 5HZHA 1OXVA 2F1JA 4TT3D 1CFMA 4QHYA 2O8DA 2QY9A 4A3CH 1KAGA 2NPIA 3VNUA 3VA7A 3LA6A 1AE2A 1G8YA 5AUQA 3EASA 4LYHA 1OKKD 3GMTA 2OO7A 1LS6A 2PX3A 4QJ4A 1SLJA 1DGSA 3GTJH 3VDYA 1N5JA 1ZNZA 1MV5A 1VCNA 5FUXA 3VR2A 3U3OA 2OHFA 1SXJA 2Y8EA 3AB9A 1N34L 1KK3A 1NKSA 3DKVA 2W0MA 2C96A 2NZHA 1HZAA 1VQOA 2VQSA 3RS2A 3A5ZB 2ZEJA 2DWQA 4KMUC 4Z54A 4ZCMA 3G48A 2GXUA 2SHKA 2DNEA 3T1TA 3P27A 2J3EA 4S35A 5FTKA 1CR1A 1JJ2A 2JCSA 2REXB 1DBSA 3RSLA 1E9SA 2O0JA 2N49A 1IBKL 2DGYA 4GLAC 4A3FG 4BZQA 2JA5H 1NTGA 4ASUD 3FKSD 2VUMG 2RGNA 3REFA 4EJSA 4HJ9A 1CJVC 1HPCA 2XX3A 2HYIC 5AUPB 2YWHA 4HIDA 2GXQA 3RYTC 3EC1A 4A75A 5JRJA 4YMUA 2IYWA 2VQEL 4TLEA 1J2JA 4NXNL 4TTPA 4IO9A 4M1WA 1FNMA 2ZJ5A 4B3ML 4KI0A 1WCMH 1KO5A 2Q9BA 4FXPA 4Q9IA 2VHQA 3S1QH 2IXFA 2ZXUA 5KNBA 2ZROA 3HU1A 2E76C 2ZVQX 2FXQA 3MD0A 4LJ7A 4QHTA 3FE2A 3K0FB 4D82A 5M5YH 1W4BA 1ZMXA 2B7CA 4POFA 1K9MC 4X6AH 1KMQA 5IYCG 2GJAA 2IUTA 4HB3A 2WSMA 1QZHA 4M2LA 1MJEA 121PA 1IN6A 1IYVA 2WAYA 4PTLA 2BBSA 4R1JA 1QHHA 2VIIA 1VG9B 5C4JH 2W58A 1R0ZA 4DV5L 2HT1A 4HDQB 2LCFA 2J0QA 4TMVA 1RRGA 3U6KA 3CF5A 5GQOA 2UU9Q 5C44H 4BBRG 1XWIA 1KSGA 2ZI3A 1VF7A 1EX6A 4CW7A 5DN6D 3GTQH 3M3YH 1WF3A 3T5DA 4B3SQ 1JR3A 3GLHB 3TQFA 1XJVA 2JLQA 3A7AB 3BOSA 3CC2A 5GJBA 4A8JC 5AUOB 2ZS9A 3G0HA 2V1CC 1H9SB 5JWRA 4JC0A 1HNZQ 1W0JA 1CSQA 3AV0B 1GILA 3CRMA 1OIWA 2IYUA 4BQSA 4LYJA 4G01B 2NOAA 1N5IA 1VG0B 4JYBA 4OI4A 4JV5Q 3B13B 4ZV4A 3L2PA 3THYB 2R7DA 1YNJC 2AD5A 4DPGA 4A3LG 1ZM3A 4PXAA 5FTMA 5C2JB 4BA1I 4XIGS 1Q46A 2UXCL 3J7ZC 4JLPA 2NO9A 1UBFA 1NVUQ 2H57A 5FOVA 4NHOA 2ZAMA 3TUJC 2WFWA 2F4VL 4L4UA 4BA2I 1G5RA 2C95A 1YBYA 2RMKA 4Q1CA 4X8LA 3UDFA 1XTSA 3A1TA 3QE0A 4AY2A 1TL7C 5EXXA 2ZRFA 1OYYA 1N2CE 5BQ5A 3LXRA 3QG1A 1JT8A 2BA1A 1KI4A 1XEFA 3IGFA 2NVQH 1ZU4A 1V43A 5IWAL 3QQ5A 1E2LA 4HIKA 5JWOA 4BFXA 1EOVA 1MABB 4DR2L 1S1MA 4OK5A 4A9AA 4RZUA 1QVFA 5FPTA 3RRYA 1AN0A 3REGA 5M3FG 4RCNA 4PQRA 3THYA 4D81A 2GK7A 3PVSA 4CYMA 5J4VA 2ZR9A 4JBWA 2VL7A 4DV3L 4MGZR 2UXDQ 2HEIA 3CMEA 1T3LA 1X8JA 4LBWA 4M1YA 5P21A 1Z07A 2PH1A 3AF0A 2C5LA 3ONWA 4NYJR 4UXIA 4DUGA 3Q7QA 4DV1L 4AKGA 1FYCA 2K7VA 1N6OA 1ZD9A 2ZSAA 3NG1A 3QEJA 3PUYA 4FMDF 3TNFA 3TUZC 5A5GA 2AKYA 2BEJA 5FBRB 4Q19A 1CKMA 4QY7A 3TS2A 1GP2A 3GJ5A 5DI3A 4MKIA 3JAMc 1W0JD 2EFGA 4B3CA 4L8JA 1HNXQ 2FG5A 3NHBA 2K50A 5DN6A 3KDFB 1GZSA 1KMHB 4C0QC 2ZITA 3T1HL 1Z63A 3PIRA 4GKJQ 1X6OA 3DDCA 2F3RA 3LBHA 1L1OB 3GLFA 2W6ID 2YNMA 3RVBA 3UIEA 1BIFA 2CDNA 3LVRE 4TSFA 2IYZA 4OK3A 2RHSB 2CK3A 5FBLB 3LDAA 3M0EA 3MWYW 1HA3A 4MDEA 4O0AA 3R7WB 3U50C 5DHAA 5HY6A 3W1BA 1AS0A 3W6NA 1T9HA 1GVPA 3NH9A 5C18A 2BCGY 1GSIA 3B7GA 1YJNA 4P0TA 5FPHA 2V55B 4CEIA 1M7HA 2ZANA 3HJNA 2YTXA 2ZI5A 2WAQE 4NU0A 5A35A 1LFDB 1YHQA 4R4TA 1N8RC 3PXGA 4BPBA 4DUYQ 1PH6A 2BBOA 4IEEA 3RNUA 1HR0L 2QMHA 4A76A 1EYGA 4R2HA 5KPJA 4O2DA 1KNQA 4DEYA 4LJZC 1XRJA 4NCHA 3ADBA 3TRZA 1LYLA 4Q4AB 4LFBQ 4A4IA 4KKTA 1II9A 4TYYA 2GK6A 1W5TA 2O8FB 2QG6A 1Q3TA 4RKEA 2PI2A 3EN2A 4JI2Q 2BIFA 4PC7A 4Q01A 4ASUA 2G77B 1UKEA 1I6VC 1E1TA 2N8NA 3U4VA 3QF4A 4XWKA 3F2DA 1DARA 3IHLA 2ZUBA 1ZCBA 4YHHQ 4DV7L 2R6DA 4W9MC 3WP1B 1ZC3A 3D3QA 1C4OA 1OSNA 2QE7A 2CQOA 1Z6TA 2JJ2A 1NMZA 3A8KE 1GG2A 4LZZA 1MIUA 2GJ9A 2RHMA 2NMVA 3HOWH 5DLQE 1FL0A 4AH6A 1YNXA 1NI3A 1Z6HA 2Q0HA 3EIEA 4NYIQ 3K8AA 4PHTA 2KHJA 4QBIA 1XXHA 1J8MF 5B58C 4DWJA 3AVUA 1WBDA 1YI2A 1SVLA 3UATA 2B7BA 1BOFA 3B1VA 2FZLA 4JCVE 3S15H 3LX5A 2HIVA 1VYTA 3B6EA 3FVQA 4GPTA 4GSYA 1JJVA 1LNZA 3BB4A 3CNNA 4TTRA 1G3IA 1ZYUA 1P2VA 2OWOA 2WJIA 3DOEA 3LFUA 3S24A 4OJKA 1NY5A 1HJPA 2GA8A 3KFXA 4R4OA 3H0GG 4JL8A 4DV4L 1TWCH 2B3GA 1NG1A 2GAOA 2XSZD 1CTMA 4PAOA 1RVDA 4F38A 4DSTA 3AVOA 2JLXA 3LWUA 1PZNA 2IWHA 4LJ5A 1H9SA 3GJ3A 1TEXA 5C1BA 3GTOH 4DDUA 1E94E 3SEAA 2WZQA 5AUNB 4DXAA 2FOLA 1YZGA 5HE8A 4XWOA 1JAHA 1G21E 1OIXA 4CGZA 1G8GA 1N6NA 1NKTA 2C98A 1XZQA 3Q9LA 5BW8A 2WPDD 4AI6A 4LC1A 4DLVA 4KFRA 2IEYA 2F3TA 4HAUA 4ABYA 5FPYA 1Y8PB 1Y69U 2X77A 1KI3A 1ZW6A 3BB3A 1Z7TA 3RAPR 3ZH9B 4US1R 4MYUA 2AL7A 4OQMA 4JI6L 1QHHB 2FPKA 1M8PA 4LF8Q 5IYBG 3BB1A 4EQ6A 5J4YA 3DEFA 2O5JC 4JI7Q 4R2IA 2ASBA 4A3GG 5CJPA 4AK9A 2MMGA 4RD6A 2AUKA 4RD2A 3GLHE 4OHWA 1C9KA 3KDFA 5H70A 3T1YL 3I32A 3ZS8A 3HYTA 4DDVA 1BO6A 1Z0KA 4GKKL 5DIFA 3I7FA 3NBXX 1E22A 4G5GA 1HUQA 4POAA 1Z8FA 2A69D 1BBUA 3O8DA 3P4XA 1YKSA 4UY8C 1CRPA 2CLDX 3FKIH 3TH5A 1E32A 2ZE7A 1SKQA 2MNAA 4QHSA 2VRWA 1OB5A 2CHGA 1X9NA 3S1NH 2HJGA 4P3YA 4CEJA 2O8FA 1CSPA 3ND9A 2F1HA 3CX7A 3AFQA 1HTPA 1XPUA 3PCOB 1IONA 2JJ1A 4B2IA 1LABA 1ZVQA 1B0UA 1VYVA 2BV3A 4K81B 2A3RA 1HY3A 4TL9A 3ZQ6A 4EUNA 3CPEA 5FOSA 3WHKA 2J1LA 4AD8A 3A4MA 1SMYC 2GVZC 4P4SA 3U44B 4KODA 4EDHA 1TF5A 4BFWA 1CP2A 4I81A 2ZJAA 4LX0A 3ZZ0A 2IK8A 3ZVMA 4Q4LA 3GLFB 3FWYA 5F9FA 1H65A 1YZKA 4B3TQ 1VG8A 1KK0A 4LBZA 4PC6A 4G5RA 3U7HB 1NJGA 2BJWA 1Z83A 3K53A 2QMOA 1H8HA 4A3BH 1MO6A 2NZJA 5B2ZA 1HT2E 4A6PA 4Q7JB 3SE0A 3AEVA 4FMDB 2H5EA 4HIMA 3F5FA 4W5WA 3T12A 4OO1G 2OCEA 1NVWQ 1KJYA 1Q90A 4JI4L 3H3VH 1P75A 4ZCLA 2ZRJA 1JR3D 2UUBL 2G9NA 1E2KA 1DE0A 2NVYH 2J0UB 3BAFA 1X54A 3UXMA 2ANCA 5M04A 1KHIA 4GI7A 4NYIR 2VS1A 4MRSA 3SC3A 5UKDA 4DDWA 2WVJA 3AFPA 1NN1A 1FOEB 2ATXA 2XNSA 5HZKA 1IQPA 4YCVA 4MGYR 3CM0A 3D0FA 2C9YA 2YC2C 4IPCA 4DK6C 4LHXA 4LYFA 4ZDKA 5CJ2A 3EC2A 3ICQB 4IPGA 2QTFA 3A37A 5G3YA 3HOXG 4FCWA 4WZBE 3U4QA 4LI0A 1WB9A 1XMOL 2HXYA 5C4MA 3RABA 4OQNA 1KRSA 3KTAB 3ER0A 2CWPA 2CLSA 4PSKA 5HR5A 3NEMA 1EXMA 1QBKC 1WDTA 3I62A 4GZLA 1GUGA 3DM9B 3X1YA 2KHIA 2FF7A 4PO8A 4D6PA 4Z1MD 3PUWA 4F4JA 4MZ9A 1WI5A 2ZPTX 5FBVB 4Q9KA 2GJKA 1WP9A 4OK6A 4V0NA 2KA7A 3AF2A 3GJ4A 2Q2TA 5B57C 2A68D 3ULPA 1KSFX 3Q5EA 5EZ5A 1G9XA 3P26A 1WJJA 1HYQA 2FJUA 3NIBA 1A1VA 2F4VQ 1TQDA 2PCJA 2A2ZA 4OBEA 4W7SA 2W6IA 3SI7A 2ECKA 1FJGL 2QROA 3KJEA 4A3KG 2FA9A 1J90A 4HAWA 3KFUA 4WA7A 2K5UA 5DLQC 5TXGA 2PI2E 1XNJA 5LMUL 1J5EL 4DLUA 1FMLA 5TB5A 2I4IA 1ELOA 4JI0L 1R5NA 3CZPA 2GF0A 4QBGB 2WB1G 4Q4AA 5CB6A 3GLIE 1U5KA 3LBNA 2VP5A 2O8BB 4DCUA 4LWZA 3SNHA 4GNXB 1NP6A 4XD7A 2IS1A 1TX4B 3Q8DA 4LF5Q 4JOIA 3AUYA 4LUZA 1TEVA 2ZJPA 1DVRA 3EA5A 2I5LX 2UVQA 2JASA 4WW0A 1K6MA 1LV7A 2E9SA 1E2HA 1JI0A 2GVBA 1N3BA 1TWHH 5FJ8H 3CRLC 2G1JA 3OIVA 4L15A 4B6FA 4NYMQ 5JCZA 4HAVA 1NJIC 1ZIPA 1Y63A 2DHRA 2JEAI 3KQLA 3T35A 4DR5L 4DSUA 2ANBA 5FBQB 1U99A 2ES2A 1XTRA 3RRZA 3HOZH 1XDBA 2GNOA 3S16H 3R9XA 1QHSA 3G82C 4HLQB 4JT4A 1SVOA 1H9MA 1Y8OB 3PEVA 2EQSA 2HDNB 2W83A 1NBMD 1E2NA 4XVQA 4C0SA 1NBMA 3I3SR 1OFIA 1F6BA 4K0KL 2ZTCA 2RGXA 3CR7A 2K75A 3CCEA 4QGUA 4GOKA 1OLOA 4PO9A 1RRFA 2JA6G 1SQ5A 1AA9A 4NONA 4NYJQ 3U3JA 3MFYA 1EQRA 3PEUA 3KKOA 4A8JA 3KKQA 1G291 2WOOA 2XEXA 2ZTEA 2BWJA 4EFLA 4Q47A 1AK2A 4R98A 5DNYB 3CW2C 2CL6X 3QXJA 3BDOA 4NXML 2IS4A 3CO5A 1Q86C 4BBRH 4IFDJ 2E87A 3IIJA 2ZSFA 3OFND 3HU3A 1Q1EA 1P60A 2ZRKA 4LSGA 1P9RA 4DZZA 3J81j 1NVVQ 3LD9A 1W7AA 1N6HA 2FZ4A 4JYAQ 5FTJA 3THOA 3ADDA 1IM2A 1MR3F 2ZM6Q 3GLIB 1RC8A 3J81i 3QVUA 3ZQJA 5AJXA 3WDNA 5HGQA 4Q1FA 1XB2A 5CYPA 3X1DA 3J81k 4DR2Q 4KKUA 1GUOA 2YVUA 4HUTA 4NE2A 3OOCA 2VYFA 3S1MH 4A6XA 2ZI7A 4MA4A 4DKXA 1N9WA 3AKEA 3C8UA 2QU8A 4D0NA 5KPDA 2RGBA 3PIOA 1G20E 2F1MA 4DR6L 2AR7A 3QF4B 1JNYA 1Q21A 2NG1A 3LAWA 4TL8A 1AGPA 1DAIA 4A0GA 5JHHB 4TTQA 2YTYA 3K0SA 3FMPB 1ASZA 4RJLA 1ASYA 1L7VC 4HZUA 4U5XA 2GXAA 5IY0A 1DPFA 3A58B 3NEYA 5JS8A 1VYUA 4C9BA 3OPOA 3IO5A 4HJAA 2WWHA 2VHJA 2IS6A 3QPUA 2VUMH 1PUJA 1KO1A 2HV8A 1RIFA 2YYZA 4DEXA 2VNUD 1XPRA 3NH6A 3VX3A 4Q1DA 1S3SA 4GOXA 4JI0Q 2R2AA 1H95A 1KO7A 4LV8B 4DCNA 2W2TA 4HJ7A 1NMXA 3MSXA 4IFDH 2ZIAA 4QQBX 4BXXG 1I4LD 1XBTA 3BFKA 3C4JA 4UXJA 3EPKA 1E3PA 4Y52H 3ULJA 4LNQA 1DD2A 3IFTA 2HXSA 3GD7A 4JLNA 2QP4A 4OHXA 1K83H 3SHFA 1DAHA 3ZGXA 4B3XA 4DIEA 3MXUA 3OFNA 3B1ZA 1K5DA 2K52A 5KSZA 3OE7D 3EZ2A 3NWJA 1TF7A 1IYJB 1I3QH 2V9PA 4B2LA 2C99A 1TUEA 4AC9A 1KRTA 1D2MA 2ZSDA 2WP8J 4PMWA 3TREA 1CKEA 1U8AA 2UUAL 1ZC4A 2NO7A 4XOIA 4DV6Q 4KYIB 1YZUA 4QM7A 1XNQL 1VQ5A 3K9HA 4I1UA 4JBYA 4LK2A 5EE1A 2F7SA 1XTQA 3GTPH 3TIFA 4EFMA 1VKJA 5IT5A 2IA5A 4LPKA 1MO5A 3GTGH 3J80c 2NO1A 2ZJBA 1BMFD 1W4CA 3E0EA 1G17A 3K0AA 4WOPA 3EPJA 4L9WA 4MRRA 1TXYA 1RL2A 3FB4A 5JWHA 2J0VA 4L16A 4KSBA 4OO1I 3OE7A 1Q1BA 1JPNA 4PHHA 1S0UA 2GVDC 2CHQA 2OZEA 2ODNA 2ZQ5A 2NPFA 1P73A 2OFXA 2BBWA 4A2PA 5C3EH 2REBA 2ZU6A 4EJSB 2GAAA 1ZUHA 4DUZL 4FCTA 3OEHD 5L3SB 5ELXA 1VECA 2IX1A 2LKCA 4GFDA 1MABA 4Q18A 3QVVA 2X8AA 1GKUB 4AYTA 2HT6A 4P73A 1KNXA 4LF8L 1N5KA 3ASYA 1YEZA 4TYWA 3K7UC 2QTHA 1XEWX 4MITA 3TR0A 3TSWA 4LUCA 3SGIA 4AURA 4QM6A 2EVBA 3T61A 1E9DA 3CF6R 4QL5A 3T1HQ 4TL6A 5GJWC 3AP2A 1OH8A 3LW8A 2ZRAA 1CS4C 3ND8A 1E2EA 3A4LA 3CD6A 2P6NA 3EIQA 2FN4A 3IBGA 1II8B 3Q85A 1U0JA 4US2R 4ESHA 2WJGA 4E03A 4L5SA 5CLLA 5LMNQ 4HAXA 5JEAJ 4NCNA 2VBCA 3NEJA 1Q44A 4IOKA 4LDJA 5AJVB 4W5JA 1UKVY 4PQFA 4YXWA 4BE7B 4DBLC 1OF1A 1XMSA 2BKEA 4DT1B 4JI8L 1G3MA 1PLKA 1E2GA 1ZM4A 2ERXA 2VHTA 5FL7A 1IXRA 5H1SE 4DV0L 1KI6B 1W5SA 5JSZA 3WY9A 1Z2AA 221PA 1OXTA 3U58A 2BOVA 4M21A 5IK2A 1TU4A 4A92A 4DR7L 3T34A 5EJEA 1XMJA 2ZS7A 2IBMA 3ZD6A 5HCIA 2QUZA 4U02A 3UANA 1ZJ6A 3DL0A 3TLXA 4C0HA 1VQHA 4TQUS 1JAIA 3C7KA 2RGNC 1YVDA 3W9YA 5E3HA 2OESA 4EJSC 1KHTA 1PUIA 1Z6AA 2E5LL 1EWHA 3M9BA 3BXZA 5H68A 5L3VA 1CU1A 2Z4SA 3UKDA 3VR3A 4OL0A 1EWQA 1G6OA 4JBJA 2Z0SA 1A2KC 3LLUA 4JLMA 4NXMQ 4RFSB 5CM8B 5L3QA 3PUVA 1TF2A 5BYJA 1KDTA 3VR5A 1ZD8A 2Q2HA 1W4RA 2D4HA 1OXXK 3NENA 1R2QA 1Y3AA 1H8HD 2EDGA 1VQKA 1GHKA 2LXJA 1KI7A 2XJ4A 1K8MA 3OTOQ 2IEZA 4GKJL 2ZE8A 1NJFA 4Q1AA 3SS8A 1S9DA 2BMFA 4KHZA 2A5FA 3UMFA 4ZIRB 1Q57A 1FUUA 3HU2A 4EX5A 2BMDA 5FPSA 2K33A 4Y7NH 1IBKQ 1VCIA 4JJKA 1IN7A 3S2HH 1RKBA 2VSXA 4PC1A 3STBD 1D9ZA 2Z5FA 4P4TA 4RKFA 2E5LQ 3H0GH 2GCOA 2XTZA 3DO6A 3PEYA 2KSQA 2H5XA 5JFGA 1TADA 1TQ6A 5AJ3Q 4LHYA 1VQCA 3GTLH 3E70C 3K9LA 3S1RH 3CPJB 4IFBA 3N2EA 3AVVA 1KAWA 4TYNA 1K8OA 2H18A 1OXSC 2E8GA 4MKHA 1FQJA 2D7DA 3VNVA 1K5GA 1PHJA 4KHPL 4NDZA 4ZDJA 5JI2E 5KTYA 1E2DA 2B8WA 2QM8A 1G8PA 1XD2B 2GRJA 4C3JH 3CC4A 2ZRCA 3E5HA 3UDXA 1YRBA 4MQBA 4MUAA 5KSOA 1DO2A 1VHTA 4G3XA 4CIDA 3SQXA 1TU3A 2C2HA 4DLRA 3EIVA 2QEQA 1ZNYA 3W1GA 1XPOA 1ZIOA 5IYDG 1JJCB 5FLMG 1CLUA 1E96A 1VQ6A 2H16A 3CH5A 3KKMA 1I5FA 1E0JA 4FI3C 1PJRA 4JT2A 2L5TA 4Q66C 1ZAKA 5SZJA 1AH9A 4DR7Q 4UNRA 4MUBA 1W1WA 2XOKA 4QNMA 4HR7B 2FGJA 1J8YF 4IVQA 5EE0A 2QRZA 4Z1MA 1XJCA 4LJAA 4ZPXA 2GESA 3SFVA 2CVFA 2XB4A 5CITA 4D0LB 1ZYRC 1SHKA 3UK6A 3AQQA 2RH5A 5JEAG 4B47A 1Z06A 3BK7A 3TVDA 4BGDA 1KQSA 4AYWA 4A82A 4ZO4A 2QP9X 4A0HA 3IQWA 2J5XA 4Q4HB 1E9EA 1JJ7A 2HLDA 5C0XG 3KXKA 1EFWA 4URYR 4EPXA 3HPQA 2YZ2A 4YMVA 3SQWA 3HYRA 2KWIA 1UWVA 4URXR 1AQYA 1FMJA 5EXSA 3J7A5 2CLCX 4X64Q 1F60A 2GXSA 2RGCA 2D2FA 3QJYA 2GETA 2OAP1 2OUKA 3X1ZA 5KHOC 3AUXA 3ERSX 3M85A 1AKYA 1D2NA 2CBZA 1V1QA 1LTLA 2ZI4A 3BH6A 4BASA 4HJ5A 4GOPA 1N6LA 3WYGA 1G1MA 1I50H 1UKYA 1R8QA 2JAQA 5FTNA 5G53C 1VQEA 1A7JA 2JK8A 4JZKA 4PZ7A 1K8RA 2A7QA 1FW6A 4APVA 1EFRA 1ZCAA 2A6EC 1DAEA 3GEEA 4UNSA 1XJQA 5JJIA 3TW8B 4WIAA 3SHWA 2BDOA 3B2EA 5EP2A 4C0JA 4I99A 4WJ4A 3WHLA 3O8CA 2GBLA 3PV0A 4IEIA 5L8VA 3BH0A 4XVUA 2XZOA 1DAMA 2VY3A 1A63A 1GNRA 1VQFA 3QF7A 1GM5A 4GBMA 4QGAA 4QNRA 3A6PC 4M1TA 4B3SL 3TS0A 2PZFA 2BM0A 4IDHA 2HHHL 1LACA 4H0LC 4B3FX 3DLLA 1JQJC 2XGTA 1RIPA 4A3EG 3M4OH 1XTKA 3EZFA 2EIFA 2PEZA 5DO9A 4R71A 1U0LA 3CCMA 1JQLB 2F43A 4KU4A 5IP7G 2ZTSA 4KV9A 4UJ3A 5SZIA 1KSJA 2ZRHA 5EP1A 3NHAA 1OJLA 2DPXA 2W0SA 3PITA 4ACAA 3DZDA 1T5EA 4CRWB 1J5EQ 3CH4B 2B29A 3PO3G 2O8BA 2RGAA 2AHOB 3OESA 2F43B 1VIAA 4LWCA 1QVCA 2N42A 2W00A 4CT5A 2EJFC 3SOPA 3EPLA 1NY6A 2ZYWX 1UADA 1YR7A 3L0OA 1I6HH 1RW4A 2H7VA 5KOYA 1XMIA 2WTUA 3PENA 2O0KA 1SXJD 4MTNA 4P72A 1CRQA 3KUCA 1G19A 3PR1A 1N32L 1KZ7B 3QNUA 1NY4A 5IP7H 1VQGA 2QI9C 1K73C 2LMCB 4DLYA 3AM1A 5H8WA 4OGQC 2XNDD 1SVSA 1U90A 3LGJA 1Z5ZA 4RVCA 4V02A 4XWAA 3FP9A 4DVGA 3VKHA 1U2RA 2ATWA 3MWLA 2HCBA 3T1OA 1B9MA 1RYFA 1EFUA 4E5UA 4HUQB 1YJWA 1SZPA 2N78A 2YOFA 1RJ9A 2Z0MA 1VQ9A 2MSCB 1NRJB 4DR4Q 1I94Q 3F0TA 3N70A 5J4KA 3C41J 3S17H 3E1SA 2DYKA 2ZAOA 3M6AA 2LXKA 1S72A 1MRNA 4JL6A 3AF1A 3LNCA 3N5CA 4LV5B 1X1SA 2IHYA 1FPMA 1W36D 4A3DH 1N25A 2BBTA 2DFLA 2OCPA 3AP1A 3QPVA 5JEDA 1FJGQ 3B78A 4A3IH 1M7BA 4LBVA 3A1VA 2QT1A 5HCNA 4A3MG 1E2JA 1OPXA 4EPTA 1FQKA 4C2UA 2BDTA 1IXRC 1UKZA 2ZI9A 1Q20A 4N1AA 2IYQA 3TUIC 2IC5A 4BLPA 4LF5L 2AXPA 5D3QA 3NBHB 1O3YA 1PYBA 3MJRA 5M5WH 2ZJZA 5LB4A 4Q00A 4A0FA 1JBKA 1N6KA 1L0WA 1X3FA 4V0ME 2ZU0C 1YVCA 4LV6A 2IHEA 2I5MX 3RS0A 1Q82C 4QXAA 4JLVA 2BE5D 3GJ7A 5AR1A 2A5JA 2AXNA 2OG2A 2VH5R 1N6IA 1Z28A 2OCBA 4AQYQ 2VA8A 4LY6A 4URUR 4TMKA 2IHFA 3LO5A 4JI3Q 1MKHA 1TUIA 2BCJQ 4M1KA 1U98A 2R7ZG 1HV8A 4B71A 2ERYA 2A19A 4Q9JA 3WBKA 4RFSA 2WWYA 3OIUA 2Z4RA 1CKNA 2GCPA 3EG5A 2XOKD 3GJXC 4Q4JA 3ZIAA 4A15A 3NBFA 4LFCL 1HT1E 2DBYA 2Z43A 4AKHA 2EFCB 5TARA 1EWRA 2AX4A 4B35A 2AHOA 1X86B 4LF6L 4YQFA 1S8FA 3UE0A 3HR8A 1XD2A 4HIOA 1Z6XA 3Q5DA 1OHHD 2B92A 1P9NA 4PV1C 2FFBA 3QKSA 1DS6A 3ZD7A 4EIWA 1IBMQ 4K8OA 3AKYA 5SZKB 4F7WA 5CDFE 1N33L 3TK1A 3M7NA 3VKWA 1U8ZA 3W5JA 3ASZA 4RMFA 1JPJA 5IT9c 2ZE5A 3K0EA 4PHGA 2WMNB 1G8HA 1U0HC 4JI2L 5C4XH 1GKYA 3TR5A 5LD2C 4LHVA 1GKIA 1M2OB 2GCOB 4UKDA 2D2CC 3CCJA 2VZAA 1XCMA 4HLCA 5FL7D 4JIMA 4AIIA 3U6BA 2WJHA 4A3KH 1J99A 3GFTA 1QHGA 1E2VA 3QXSA 4DLSA 1O7LA 1DAGA 2H8KA 3CUEF 5ELNA 4B2PA 2ID0A 4MKGA 3KLRA 3M4PA 1X56A 4QIWE 2Z6KC 4DR1L 1PVOA 1P2SA 1CBUA 2V6IA 2Z6VA 3AGQA 2YC4C 3DXJC 5DI9A 1G6HA 4TLCA 4JI4Q 1KZGB 5K36H 1NSTA 2D5DA 1SN8A 3C15C 1TKWB 1Q8KA 3CBQA 4BFTA 3RS5A 4H13C 1IN8A 3THXA 3B1XA 2JLUA 3FKSA 4OX9L 1EK0A 4US0R 1Q0UA 3RWMB 3GO5A 3X1XA 2WIBA 3H0KA 4TMTA 2WSSA 1VS0A 3SBEA 2V7QD 1XEXA 4HSEA 3CF0A 4UQOA 4GDFA 4DHEA 1P7CA 2E2IH 1Y8NB 4JBKA 5C3EG 2OFWA 4KSCA 4HUQA 4IFDG 2ZRDA 1QF9A 3ECCA 2LKDA 2ZJ2A 1G4AE 1Q1QA 5J4LA 3OEEA 4GNXC 4PO1A 1AM4D 2NIPA 1UAAA 3KLWA 4DV5Q 3QXHA 1UE5A 1GNPA 1N36Q 2PZEA 2UUCQ 1Q7YC 1OTCA 1JEEA 3A8TA 3FMOB 4OKSA 5TVKA 2J45A 2A6HC 2IYVA 1D9XA 5TV2A 4YMSA 4J0QA 1X8KA 3U3MA 2Z6KA 3IIKA 3W8NA 2Z83A 821PA 2Q6TA 3I8SA 5IYCH 1E2PA 4TLBA 4LFBL 4ILEA 4PZYA 3SJBA 4BLSA 2ZM6L 3O8BA 1W3SA 4D0GA 4G5QA 2MFIA 3CMAA 1FUKA 5FFMA 4G1UC 2R6AA 5KU1A 3FMCA 2PCFB 1G7SA 4C30A 4M1OA 1JB7A 3KJIA 4E07A 2QBYB 1D5CA 3EZ7A 2GF9A 4R4CA 1KI9A 2GVAA 1UEJA 2JEBI 3TSZA 1IHUA 4GNXA 2W2XA 1M90C 4JKYA 3M4YA 1XP8A 1G5TA 1LB1B 1N6PA 1BH2A 2C04A 2P3SA 1XTJA 3P1JA 3P32A 1YU9A 4WVFA 1HZCA 1P72A 3U3RA 4H44C 3T1QA 5BYKA 4Q1EA 2R8RA 4GMXA 2JXMB 2YOGA 2A69C 4DCSA 3KYHC 2ZRPA 5TY0A 4DV4Q 3W5IA 2QPTA 4BFYA 2FPLA 1UE1A 4DB4A 1ZNWA 3GPLA 1EQQA 1E79A 4ZKEA 2ZUDA 2QA5A 1PV4A 4PPQA 4JI1Q 1KXLA 1GL6A 4K46A 3EZ9A 3RRNA 4P71A 3UE1A 4X65L 3CIOA 1FGUA 4DAMA 1A2BA 3RNLA 5IK2D 2JIZA 3VU9A 1OFTA 4JKIA 2D2EA 3UMRA 1B7YB 1GVNB 2VSOA 3HKSA 3WMGA 1T5LA 2ZYVX 2HCJB 3GLIA 1EFHA 3D4RA 1O87A 2KENA 1VTKA 2G6BA 3GJ0A 4ZIRA 4V0LA 1PH2A 1JR3E 4IOAA 3DMDA 3KB1A 4MGIR 1Z6GA 1VG1A 3CRKC 2VP2A 3WBJA 1D8LA 1KY3A 2NVXH 1US8A 3W90A 3LBIA 1SHZA 3L8YA 2R6FA 3U5ZB 1TQ2A 1VHLA 3TBKA 1NLZA 1ZM2A 3HGBA 1KJZA 1R9TH 2A9KA 3K81C 1NSFA 2WWGA 4GRAA 3HDTA 3OAAA 3QKTA 3R7WA 4ZKDA 2RCNA 2DY1A 4YHHL 4DV7Q 1COWD 4RG1A 2WWWA 3GEHA 4URZR 2ZJ8A 4AWXA 1QHXA 3AGPA 2F1RA 2R92G 1HQYE 2IYTA 3LX8A 2MQHA 1IL2A 4GKKQ 1LW7A 4DLZA 1KMHA 3H1TA 3KFVA 2D62A 3QY0A 3B8HA 3KQKA 4BLTA 1G18A 1R0YA 5DI3B 1E3MA 3O47A 1E9BA 1NN3A 4BWYA 2KCMA 5GAHC 1N5LA 4QBFA 1ZUNB 4LF6Q 4GZYC 3GTMH 1YE8A 4B3RL 1KI6A 2C9CA 2DWOA 3GJ6A 3SJAA 1OKKA 3HWSA 4BUJA 4EFNA 1CEEA 1R8SA 2ONKA 1TWFH 2AD1A 4FMBB 3FHCB 2E75C 3W34A 5GADC 5DYIA 5FOTA 1YZ6A 1XCPA 1E2MA 5J5CA 3MJHA 4IDNA 5AWFC 3ZZUA 3EBEA 2AMCB 4G7HC 1E99A 2IX0A 4IJLA 2VP6A 1TQ4A 4B73A 4BRWA 1LM0A 3BH7A 1KDOA 2G1KA 4OWTB 3RN2A 4XTCS 4V0MA 4MYCA 4FD2A 2IXGA 3PO3H 3MMPA 2R6GA 1KL9A 3JC66 1ONLA 5JMTA 2VF7A 3HOVG 5GVSA 1GOTA 3EWAA 4HAYA 1M1KC 1R0XA 4KKSA 1B8AA 4GP6A 1GRNA 4ME3A 3AVQA 2HIXA 3WMFA 2DN8A 1F2TA 2QAGB 1BVSA 4X65Q 2JA6H 3PG5A 4PX9A 4RCZA 2VP9A 3B9PA 1VF5C 1WMSA 5CYOA 3OYYA 4UJ5A 4A8JB 4ZI3A 2E74C 3H86A 4YWLA 3U4ZA 2WKQA 4NYMR 4ARZB 3GLGE 4CEHB 4IPHA 4A3CG 4IOJA 4TL7A 5C44G 2MSDB 2JIZD 3QBVA 3SYNA 2XITA 3U7GA 1NLFA 2C9OA 1XD8A 1W0KD 1JALA 4P74A 4ESVA 1Q81C 4D2IA 5C0XJ 1K8GA 1I4TD 3L7ZC 1IBLL 2CVHA 1DOAA 3B85A 4IJHA 1OT3A 3KTAA 2CE7A 3ZVLA 2JLYA 2WJVA 1ESMA 4LC0A 2JA5G 4PAMA 4DSNA 4Q9HA 3KJHA 3NTUA 4DR6Q 3UWOA 5LPNA 2CE2X 1HCZA 3LV8A 3CC7A 1XMOQ 2ZJYA 3OIYA 1NE3A 3S14H 1ZP6A 1ZRHA 4FCVA 4RD4A 4TN1A 2D7CA 2VPPA 5FOWA 4CF7A 3KQUA 3JAMi 4URWR 5EXPA 1E9RA 4M9SA 4UNQA 4GOPC 2OE2A 3KUDA 4JVNA 1YJ9A 3RRMA 4Q7MB 1DO0A 4Q21A 5FUVA 1IY1A 3VKGA 3H2YA 2XJ9A 4PZZA 4TYQA 4JMPA 4DNTB 5IDVA 4QKQA 1SGWA 1Y1VH 2P5TB 3N2IA 3J81c 2VQEQ 2ORWA 4BLOA 1EFTA 4P4SB 2V1XA 4L5TA 3EXAA 2HYDA 2R92H 2QPAA 1CJKC 4RSGA 4LHWA 3H94A 5EE3A 2X2EA 2A8VA 1LF5A 3M4QA 4NBSA 2J46A 5TDHA 5KYKA 4ARZA 3PO2H 4CEHA 4RD1A 4HZUB 5M5XH 3H15A 2WPDA 4YCWA 4XH9B 3B82A 1CF4A 2W2VA 2VTKA 3GEIA 2EYUA 2BKUA 1F2TB 4FIDA 1YR9A 3C5HA 4Q7KA 4C0BA 1RPZA 3RS4A 5J3BA 3T1YQ 1Q22A 4JG2A 4NTZA 3P4YA 4JVMA 4A3EH 1PA6A 2R93G 1II8A 1XXHB 1IBML 2FNAA 3B5JA 3RS7A 1EESA 1FFHA 4JI7L 1R6BX 1L4YA 2ZRMA 3LW7A 3CPWA 2K14A 1X8LA 4GN4B 3TQCA 4DB2A 2NTYC 1KY2A 1IY2A 4A2WA 1IN4A 5HKKD 4IDOA 3KJOA 4DNIA 3T5GA 4PHFA 1HNZL 1N6RA 1QVAA 5IF9A 2WWFA 4HB4A 5L3SA 1E1RD 1T5IA 2QM7A 1EFCA 4B3GA 2GN5A 2EU8A 2WWIA 2PX0A 3DMNA 3A1SA 3BC1A 4CVNA 4NL4H 1R5OA 4XJXA 3ICEA 4O25A 4A0RA 1IBLQ 3GFOA 3F2CA 4GS3A 2PBRA 2ZRBA 2O8EB 2AK3A 2PMDA 1Y1WG 4FWTA 2QAGC 2VQFQ 1NN5A 3LQRA 1XFAA 1Z3IX 1NMFA 2QSZA 1OW3B 4DLTA 2O52A 5G41A 3SN6A 4J15A 4R9UC 2ZR7A 4B3RQ 3I4NG 1JMCA 4QGHA 4F4IA 2YTVA 5LMNL 3AP3A 4B3MQ 1KI8A 3BD9A 3WYAA 1XMVA 4DV2Q 2B6HA 2JJ8A 2HLDD 1NVVR 4DUYL 1D6JA 3AVPA 4JI3L 2E2JH 1E2QA 2MSEB 4ITRC 4H1VA 3JZMA 4QJ5A 1E98A 3K1JA 4C0LA 2CNWD 2MO1A 4BLQA 4JI5L 1CXZA 3HFZB 5FOXA 4X8OA 1E1OA 2Q2IA 1EWIA 1GWNA 4A3MH 1HNXL 5KUTA 1VQAA 4A3IG 2I3BA 3EA0A 4Q7LA 5G3ZA 3K0FA 1UDXA 1GDDA 4OQLA 4DCTA 4L5QA 2O5IC 5DGXA 3T1VA 4KVGA 3DM3A 3U44A 3OW2A 1GJXA 2O8EA 4ERNA 2X1VA 3NC0C 4EPRA 2VLIA 5FLMH 2IWRA 3QSYA 1N0VC 2EYQA 1SVIA 2UXBL 1WA5A 2OT3B 3KKPA 4KBGA 4OI0A 1SVWA 4G5OA 4HLUC 4NB3A 1AIPA 4P31A 4LUOA 2CKZB 4P75A 1FTNA 3MCAA 2JA1A 1UJ2A 4L9SA 4F4CA 1PMRA 1GRRA 4GNKA 2IYYA 1AS3A 2REOA 2GTPA 3KQHA 3QEOA 1A5TA 3QUSA 3ZVRA 4JBXA 2F6RA 1NBWA 4S2EA 4WXPA 1IXSB 1DG1G 3CKLA 3I5YA 3R8FA 4PQYA 1K0RA 1RFLA 3AH8A 2K32A 4EPWA 1Z0DA 4YY3L 1U8YA 1BKBA 2JA8H 1R4AA 2J9RA 4LYAA 3DKPA 3BU2A 4LF7Q 1SXJE 4OHYA 1EGAA 2G83A 4DUGD 3IKJA 3BZCA 1ZBDA 2QQEA 4DR3Q 3UG6A 3CRW1 3A0JA 2X2FA 3WYFA 3PJRA 2CL7X 3GJ8A 3AVYA 3T06B 2BE5C 4NXNQ 2ZREA 3HR7A 2R7FA 2FPMA 4EPYA 1CIPA 2DFTA 4KLKA 2WKRA 3W6OA 1EUJA 5CLQA 4UP7A 1XNRQ 3WRXC 5LMUQ 4MYTA 3PGZA 1M1YE 1AZSC 5ELOA 3CCQA 2JGNA 3D31A 3A4NA 2I1VB 4HJ8A 4Y0VA 1X3EA 1S2MA 2CK3D 2ZRLA 3E9HA 1QJOA 2YV5A 2QPOA 3AYHB 3OF5A 3L2OB 2P0EA 1DXMA 3MGCA 4LFCQ 4YLGA 4TYPA 1XCGB 4JI6Q 5JI3E 3GFPA 4PC2A 4TZ6A 2VP4A 4LFAL 4RFVA 5EP3A 1T3HA 3GLHA 1W48A 2R9VA 4XTRA 1HURA 4RD3A 4JSTA 4CEIB 1UEBA 2IUUA 2OLKA 3RWOA 1YITA 2G0TA 2N46A 1B9NA 4A3LH 2UUBQ 2GEVA 4PZ8A 1PH9A 4D4JA 4TVAB 1ZKOA 1ZU5A 3EX7C 4QG7A 3NDBB 1C1YA 5AJZA 5FOUA 5LMNW 1MH1A 1OE0A 1LS1A 1VQIA 2I0QA 2GBLC 2YOHA 3SJCA 1C9OA 5FR1A 4KN4C 1E0SA 4HZIA 3CCVA 4KLNA 4C3ZA 1AJEA 1HNWL 2D0OA 1SVMA 2YKGA 1DAKA 2CXXA 4MYHA 2EJGC 2ODWA 5E7IA 3CWZA 5BR8Q 1KIMA 3LY5A 3QI2A 3SR0A 1CKOA 2UXCQ 4PFSA 5CB8A 1X3GA 1WCMG 1IBRA 1NN0A 2CEAA 3VHLB 3ZDQA 1E9CA 2JLSA 1Q12A 2GEUA 3R8CA 4BEJA 1SMXA 1KI2A 4E22A 3LLMA 2V4ZA 1GUNA 2OQKA 2ZI6A 2KBEA 4M1SA 4PAQA 4QL3A 2EFDB 1SRUA 4A36A
chains in the Genus database with same CATH superfamily
4BMPB 4KR6A 1B2RA 2NZ8A 3OP1A 3HOYG 4PZDA 5KJ6A 2NAPA 4LGYA 1J2UA 2R6HA 4RW0A 2AE2A 5GM1A 3ZQKA 2ORIA 1VQLA 1H9JA 2QRVA 1LPOA 3N6XA 1EP2B 2FPSA 3QOFA 3UAGA 1K83B 1JSCA 2ACEA 2Q5JA 1TWHB 2W9XA 3IDQA 2L15A 4I4LA 1UFQA 3IO3A 3DPUA 2RSOA 4DCCA 1NR2A 1XC7A 1UDWA 3MAQA 1PFSA 1GU0A 1PWHA 3Q3IA 1QP7A 2JFPA 2AMVA 3CRRA 3HWWA 2BP7B 1YB5A 4E7PA 1EAYA 4XFKA 2J6BA 3N2KA 1STHA 3C45A 3G2JA 2X9NA 3IV9A 4A3IB 3MTJA 3S40A 4CQMA 1C3OA 1L7XA 4E46A 9LDTA 1ADCA 1NULA 4C4AA 1EHYA 1YR8A 1P31A 3NRBA 3EGDA 1EL0A 1SBHA 1EG2A 4L8VA 5KOIA 1SUSA 4G89A 5J2TF 4EG7A 5JNUA 4CDCC 4WUTA 1BQ4A 1R6DA 1ZDMA 3H17A 1UEXC 5JXWA 2V0GA 1FFGA 3G6EA 5SY9A 4EA9A 1PLLA 4WOKA 1J20A 1N2ZA 3SSMA 1QUFA 4O4LB 2C00A 2YN4A 1DJRD 3D3NA 2XZLA 4P1ZA 2QE6A 1IW7D 1J6QA 1ENCA 4RWSC 2QX8A 1B8NA 3KB6A 3CH7A 3Q8WA 1BRTA 4KNVA 4NZOA 2F0PA 5BVHA 1TA4A 3OA0A 2PV7A 3R3ZA 4I1IA 3OTOL 4P3PA 1R00A 1VIDA 4D4KA 4E21A 3KU4A 2WD7A 4GPAA 2CVQA 4KO4S 4C3IH 3WL5A 2IH2A 1SYBA 5BSGA 2HSEA 3K15A 2JA7G 3L02A 4MR9B 5BWNA 2G0NA 1WZEA 2ODQA 4PIMA 1EG7A 4DY4A 2R86A 1ESNA 4C0WA 3CLVA 1TS4A 3L8ZA 4DAOA 3RYIB 2VB2X 1AUVA 1D6SA 2FRVA 4CETA 5KHLB 1F06A 1AH2A 5BORA 2C92A 1CUHA 1M34E 4LCEA 4O59O 4RHCA 4YREA 3MS4A 5TLSA 1IL0A 2F3IA 4JUDX 4FMCB 3NBIA 4QOSA 1QB7A 5EE9A 4JZYA 4L4XA 4ZQIA 3F5SA 4JFRA 2KBFA 4AJ4A 4LQCA 4MH0R 4UBLA 3I90A 4O2LA 1QG4A 4ZT5A 5K51A 5LP6F 1GPJA 2CJWB 5G1PA 2IHJA 1WW2A 3UZUA 2A5YB 5K9ZA 2BFCB 5GY7A 3BWVA 3HJTA 5J2UA 1EGHA 4UBOA 3UFBA 4FN5A 1QZGA 3GTKH 2AFIB 1P2GA 2XNJA 3B2NA 2PT5A 1PLFA 2QAGA 4ZC8A 1REQA 1Z38A 3PKJA 1IY0A 3RT9A 1HDEA 2MMCA 3UJ7A 2EYMA 5GV8A 1UM9A 3VZDA 4Q05A 5AO9A 1XQ6A 1W46A 2ZRGA 5TS2A 4BNVA 3JWIA 2OCYC 5F76A 3EQLC 2O4CA 1U3WA 3I8XA 3ZDRA 5E7QA 5IP9G 3I0NA 1T5OA 1F48A 1U8TA 1YVUA 2DQ4A 5DV9A 5A7HA 3ROXA 2AYYA 4RHRA 4KYVA 1IH8A 4QOEA 5JPCA 1JPVA 3MC1A 3N6VA 4OHMA 3KJGA 4W8GA 3D8HA 1STEA 1UBUS 1EIFA 1G42A 1P0PA 4J16A 2O2DA 1Z37A 1C14A 3O82A 4KXLA 4F97A 3OTHA 3MWJA 4HMJA 4Z7QB 5K8UA 4YJFA 1KWGA 4P7JA 3UUFA 4B8ZA 2JIQA 1CUEA 4QQNA 4PSVA 1JHUA 3A05A 1XLUA 3RVPA 1E66A 5A4JA 4YRIA 2QMEA 2AFRA 3WYCA 4F96A 2CW0C 1T1GA 3IBYA 3U49A 4HNGA 4XWYA 4IGFA 3CIFA 13PKA 3FOWA 3T1NA 5I7RA 1AKVA 3W0LB 3JQGB 4DDKA 1EJBA 4PX2A 1KKLA 5EMHA 5A4IS 3AT1A 3V8NA 2ZIGA 3MWKA 5J43A 4AECA 4OELB 1DGQA 3K72B 1CUXA 2BI4A 1Z33A 2UUPA 3PFGA 4LF4B 1T34A 1G41A 3OPYB 1C7IA 5IVKA 1CE8A 3Q7PA 1TU2B 3B6YA 1I0IA 4EAQA 4F88A 3PQCA 3NP9A 2PUHA 2H06A 1UPTA 2Q1UA 4IZHA 2B9EA 4J7AA 1TIBA 3I6BA 1E7YA 4NF2A 4EF5A 4F2PA 2XHZA 4YDQA 2LVBA 4LJ6A 2QN1A 2DY0A 5KYYB 3VFDA 2FDCA 4BP8A 3BGWA 2R60A 3ER6A 3KP1A 1B1ZA 1WXGA 3ZIAD 3T3EA 5DBIA 3BFXA 1C29B 5KVCA 1VQBA 1Y33E 4MP6A 3MFGA 1D0IA 2EZ9A 3CNOA 2QOEA 3VPHA 2GYWA 2B82A 4NP5A 1PQ4A 2AKAB 4HXYA 4QU5A 4R1MA 2DNCA 1VSUA 4BJ5A 1XVVA 2NTSA 5FK9C 3DEHA 1P6XA 2PZGA 3U4IA 4N3AA 3GBVA 3ZYCA 2C3MA 2A30A 2RGGA 1RR6A 3A1NA 3RKUA 4EWLA 3I3CA 3OVMA 1LPMA 4TLDA 5IZCC 4KDCA 3HFRA 1DX6A 2X3FA 1HH2P 3WX0A 5IM4F 3JAME 3DEAA 4RS4A 1T36A 4B44A 5CYUA 2XCOA 4Z2YA 4JK1C 2V74B 4DG8A 2JA9A 4NPAA 1Y7LA 5AI6A 2GZHA 4UOZA 2CBGA 1PHPA 3ZH2A 5JHGB 5BXQC 2BRUA 4V38A 3U9OA 3ZE8A 5IVIA 1MQAA 1Y9EA 1VL8A 3SC2B 4D44A 4X3TA 3ANTA 1V3QE 2Q5IA 3U9TA 5JS7A 2EGHA 1YB1A 5FLXL 1PJ2A 1PH8A 3HUUA 3K05A 3OZGA 4NRDA 4W8HA 5DSXA 4B2IA 1NUQA 3JSXA 4X95A 4UDUC 3UKOA 6REQB 1A8PA 1OYOA 3A8IE 3DUWA 4U9UA 4R1NA 1WBJB 5HF5A 1EY7A 1I2MA 2C57A 4LHZA 3K58A 1DMSA 4ZT3A 1L5FA 3HEAA 2EBUA 4OOFA 4MVJG 4X7MA 1QP4A 1BS1A 4IV8A 2JFFA 4LEIA 4LJ9A 5ALNA 1HX7A 1GGKA 4FI3F 2W71A 3MOGA 4NMHA 3LRPA 3UOGA 5JRZA 2PUDA 4XVHA 2FWBA 2DFKB 2LWIA 1MF7A 3G0OA 3RRXA 2KW5A 2EARA 3CVJA 4EGVA 5K8TA 2ABWA 5C8YF 1W36C 3DT6A 4BMNA 1UIMA 4K1LA 1C3LA 3ZLJA 4WT7A 1II0A 3OJOA 1IBSA 4R1LA 4Y2GA 5HKKA 2VUMB 3QLVC 1A82A 3I4LA 4JV5B 1EX9A 3FCEA 2KVMA 2GN6A 2P67A 3T3DA 3TP5A 1SULA 4PSAA 1DWQA 1A3VA 1WX1A 4XARA 3UXHA 4BVKA 3L6BA 1W9HA 3SS9X 2XE6A 5IZCA 5GGYA 1GNVA 2XGJA 1RKNA 2HTEA 2J9GA 1X6VA 1IN5A 1FDTA 4TSFD 3F4LA 3LYUA 4Q16A 2BMJA 4L07A 2R8BA 1M5UA 5IMBA 1QJCA 5LC1A 3N53A 5ALEA 1STOA 2UYGA 5JZOA 3S8YA 4DA4A 4TRNA 1TM7E 2ZTDA 2WAOA 2WG1A 1QPGA 1E5XA 2JFWA 3FWPA 4ER0A 5AW0A 3SZRA 2CFMA 2P8JA 4Y9TA 4CLRB 2OAQ1 3K7EA 5ALRA 3WIDA 4PLHA 1F0YA 4RGNA 1PNTA 5TF0A 5IHPA 1N7IA 1A9QA 4IIJB 4XWKA 2VB3X 5E7MA 2B30A 3C3XA 3D02A 4UUQA 2BUBA 3IPYA 1X13A 4MQFB 4XPZA 3JVVA 3RJMA 4DAYB 1OQAA 1SEVA 3JQAB 3VHXA 4B6PA 2OD2A 3U31A 3QKRA 2XB2A 4KQ2A 3AYXB 3A1UA 1STYA 4PINA 5K8IA 2WJ4A 4U7TB 1U9JA 1HDXA 5F2NA 3INYA 4QUEA 1PJZA 4NAVA 1QNFA 4P53A 1NVXQ 1JEQA 5CXXA 1MGSA 3RYHB 5B3JC 5JECA 4P9NA 2BSQA 2D0PA 3ULLA 1OH5A 3WRVA 2NGRA 2VXOA 4COOA 3HCNA 4M8NE 4XUEA 1Z7YA 3H2BA 3WOFA 5KVQA 4MDHA 4Y8VA 1BMTA 4K3VA 1G0NA 3P97A 2CQAA 4YMTA 4EQ5A 4XVCA 1B70B 2O2EA 4DK1A 4GICA 5D5PA 2Z2ZA 4GT1A 4PRYA 5DM4A 3SQOA 3HOWB 1X7XB 5FHQA 4Y18A 4AIMA 1Y5NA 2R25B 4LVNA 1UF9A 2YU9H 1U4LA 1CR2A 5GAEC 1GU7A 2PGDA 1JXOA 3TSOA 1QC5B 3Q8KA 4O1HA 3VNRA 2H5LA 1E1RA 1KAMA 2X5OA 3L79A 5T3YA 4YJKA 2PNRC 1NPDA 1SD2A 2DAPA 3BIOA 4HB2A 1KMIY 4PZAA 5J4HA 2GZ1A 2HMSA 2RVLA 3K7AB 1TDJA 5C7LO 2AOVA 3ZKAA 5JQWA 2QGQA 2GN2A 1E69A 2LY7A 4JYAL 4BCBA 4P86A 3DYIA 1P2BA 4KO8A 3U4DA 5D65A 1UE7A 1RXWA 4KJOA 3ROZA 4BO5A 2FE4A 5GGXA 1NONA 4E1VA 4JI7B 5IUNC 5LUAA 3C3BA 1JBEA 3LLCA 2PKEA 1L4KA 1WCWA 3IIIA 5J5AA 2FR8C 4HYYA 3HGTA 4HC4A 2VP0A 2ZW9A 4D9IA 2O3TA 3URMA 2M1XA 2X9QA 2EFHB 1M6HA 4MX8A 4OLAA 3IVRA 3EPRA 3OEWA 2VPYA 5B64A 3BSSA 4EW3A 2Y76A 3I55A 4DKAC 4IH9A 5FO1A 2IF2A 3A28A 5SV2A 1WCV1 3WOVA 2KJXA 4ZCIA 5HM8A 1E2WA 1HE8B 2Q1TA 4DU9A 2ZRNA 3VVBA 3AVTA 3K16A 1CQZA 5EJWA 1CZOA 2OGSA 2HHCA 2XNHA 4O2AA 3ZUPA 2IZZA 2QMYA 3CRQA 1H05A 2FKNA 3AIMA 4HLUA 4D6YA 4CDDC 1I2DA 3VBCA 4FFNA 2PVCA 3BS4A 5BURA 5FPKA 2QSJA 2J7PA 1M6WA 3FOZA 1MPTA 3QKSB 4MXDA 1YZTA 3IVMA 1W4AA 1UMCA 1W85A 3LGXA 3WB1A 4I66A 5EAIA 1L5QA 1RI1A 2LGJA 2WJJA 4MTCA 4J03A 1GTVA 1HG0A 1P77A 3AEZA 3JD0A 3PFIA 3X1XA 2A1AA 4EHLA 1N0WA 4IXNA 4QGBA 2BGUA 2HDMA 3NVAA 4MRNA 2P0YA 3OMGA 1E5QA 1NW5A 2K7ZA 2MSWA 4RZQA 3UK0A 2BR5A 2E5WA 1KIAA 1XZPA 4R2KA 4DT1A 2I1WA 1QQ6A 4YASA 4H6XA 4EEKA 2OBMA 4HGYA 1PF7E 3UAZA 5CDTA 1O97D 4J9UE 2H1OA 1BJTA 3HXPA 2AVDA 2GSDA 2V65A 4GEKA 4NBVA 4KZPA 3QZUA 2ODEA 1MQ8B 2M00A 3NEPX 1HR0W 4NESA 2Q6VA 5E3JA 3KOOA 2ZSHA 2EP7A 3GAMA 4ILKA 1RF2D 4MQFA 4UAGA 4EHNA 5KOJB 1DYQA 5BT9A 3GI1A 4DPKA 1T2NA 3HKDB 4M9CA 2WTMA 2N1BA 3GEPA 2ZIUB 3B6ZA 1RWXA 3C85A 1DSSG 1QANA 2YL2A 3RD5A 4EPVA 3S16B 2C3YA 2QPLA 3R6GA 4CM8A 4CLEA 2ZM5A 3CHBD 4F9TA 2HDLA 3LDHA 4G0YA 4WCFB 2VBFA 3VUEA 1SG0A 1SUFA 4KFUA 4XLTA 4U0KA 3LM8A 4PQXA 4B4KA 1EZ6A 1T8RA 1PEAA 1UBGA 1DEOA 3NOVA 3PQ5A 1PH4A 4LZAA 1SNQA 2QRHA 1NBME 4GLJA 4RPKA 5M3BA 4KRXA 2IIVA 1US8B 3T9EA 5IEBA 4B6EA 5K6AA 2F0VA 1L4FA 1O95D 2OGWA 4ADSG 2VH2A 3I56A 3GTMB 1YUBA 2GZAA 4W5NA 5E9QA 2YXDA 1P1RA 4Y2UA 4OHVA 1JA9A 1KU0A 5C5MA 2GDJA 3HCDA 5LBIA 4JYMA 3X2FA 2NO0A 2EW8A 1F8YA 3TXAA 4GLBA 4EGQA 3WOEA 1SBYA 1P1FA 5JZSA 2O8CA 2PJZA 3IEIA 3T51B 1GXSB 2HJWA 3JQGA 4XD7D 2A58A 3TEMA 1QUQA 3AFOA 5AW3A 4CKWA 5MHTA 4JCCA 3UJ9A 2IDZA 3I4CA 3U0VA 2RJOA 4JFAA 5BP7A 3U7RA 1R4MA 3ZDEA 1LF0A 2XZPA 4BKQA 4GQAA 1DX4A 3TI9A 1Y6GA 2ZQZA 1DZ3A 1YHBA 1ZN7A 2D54A 1QHYA 2VXWA 2FWRA 3EVGA 5DEIA 2FU5C 3IQZA 3F71A 3P1HA 3CLKA 2UU9B 2GF2A 6REQA 1WYDA 1K8AC 4DV1Q 1PZHA 4J4TA 1FTSA 1SBNE 1MXFA 4X90A 4IUTA 4DA0A 1U2PA 2X22A 4IICA 3IP9A 2NYUA 2QLLA 4ACBA 5DAUA 3JQ9A 4M0MA 3NV7A 3CY6A 1T8PA 4BEWA 2O07A 4LIPD 4L8WB 3FTEA 3HZOA 4S12A 5D7BA 5JLJA 2I6UA 1X55A 1P16A 1P5RA 3KAQA 4TYNA 3V4OA 5JNRA 3R6WA 2YZKA 3WLIA 2C4UA 2Q4TA 4A93H 1ZH0A 3GHHA 1HQCA 4DR4L 1RHMA 2GYVA 2RHQB 4UHVA 2JA5B 1UC5B 3Q6IA 4CN8A 4UVGA 2XCRB 4CLDA 4ESHA 5EHNA 3VU1A 4UPDA 1CUSA 3H84A 3EW9A 3GDHA 3UJBA 5K0SA 4N0EA 2Z1DA 3L1HA 3BVZA 3K9QO 4FHEA 1RCUA 4YXFA 3BAZA 3EE6A 3EFBA 4C4YA 1NL3A 3KSAC 3T5AA 1BCRA 3H1FA 3WP0A 4O1NA 1GD7A 1ZXTA 1BMFA 1WFQA 4GOPB 1VCHA 2GBCA 2PFGA 3PDWA 3TSCA 5CK4A 3FUVA 1U1CA 1XQ1A 4NH4A 3RZOH 4A3BB 3NHWA 1JIIA 4LXQA 4ENSA 1TEHA 4RVHA 4WZAE 4ZOBA 5LIRA 2Z6UA 4L0QA 3J81L 2O3UA 1B16A 2PMWB 4L9AA 2V3CC 2C5GA 1QHIA 1DRKA 4GN5A 4FQ7A 3T3PB 3NKVA 4ZJUA 5ITZB 4NOLA 3GTJB 2NACA 2QVBA 3E6AA 2OCDA 3HZZA 4YY3Q 3OWXA 4QE3A 2HW8A 1B23P 1BE1A 1ISSA 2NQTA 4D97A 1AKRA 1ZI8A 3QJ5A 1WTAA 3AKDA 3CZMA 3EFEA 3O3NB 1VDZA 5JJLA 4PLTA 8ABPA 3WLKX 3PCRB 5BVHB 1Z2EA 3FHOA 2FRDA 5JEAH 3HOVH 4IFTA 3S2FA 5ECGC 2HRQA 3ZV7A 2NN6H 2JA8B 4KJNA 1NDUA 4P4UA 4N9WA 3R9WA 3DDZX 2CL5A 4B9WA 2A84A 3C8MA 1G8AA 4BVBA 4C0KA 1WETA 3HYNA 3NDJA 3SQLA 2Q2UA 3M6FA 3RQSA 4E51A 5KTSA 1KFKB 3KYCA 1BXZA 1AQUA 3LC7O 4JBLA 4PZ6A 1U3CA 4HR7A 5H0IA 4RGBA 2A94A 3TTSA 4BRUA 3R3HA 5CYFA 2FWJA 2G06A 2QTVA 2XCIA 2DHCA 4HS4A 3RZDH 2GRUA 3F5MA 3FKIB 3B1YA 3I9FA 3OLQA 3LMKA 4W4TA 5SZHB 3VR3D 4BZPA 4R8MA 3OCCA 4AZ0A 2VH1A 1NI4B 1O0SA 2YY7A 2P40A 2ZIWB 3KSZO 3V9PA 1VE6A 1STBA 2H3HA 4Z51A 1L2FA 4G7ZC 3TBKA 5FUMA 2FPPB 5IARA 2WAQB 1T0BA 2D3WA 3BJMA 5CH5A 4EHHA 2XXAA 1NIJA 1A62A 1B3QA 4QYIA 1ATIA 2FWAA 4TMWA 2GJSA 3ASVA 4UNPA 4WAUA 3TIVA 3WTBA 3VJRA 3AZPA 4UVDA 3I61A 2O2SA 4BY7H 1WZCA 3ROMA 5AJYA 5FOBB 2B39A 1L1RA 2OO5A 4RMJA 4A23A 1LKZA 1KEUA 3QNWA 3URKA 1JE5A 2OG1A 3A6HA 3D7MA 3IAXA 1OAOC 3KFLA 4N18A 3SC6A 5JSZB 1SH7A 1YZQA 1U0OC 2I2AA 4FSXA 4IVRA 4ZREA 4YWJA 2OWEA 3KQQA 1PH5A 4WBSA 1ODFA 1WU7A 4V2UA 2I54A 4MQEB 3FZYA 4N5IX 4NICA 3VV3A 1FL9A 2YVAA 4BV2A 4OGFA 3QVXA 2ZCVA 5C4ZA 3BULA 4ZZIA 1KIXA 2VWPA 4F2HA 4DV6B 1XTVA 1MC1A 1A8SA 2I5PO 2AIRA 3HXQA 4QODA 3HN6A 3D8NA 4P3OA 5EGTA 3NQIA 2QZ4A 1YRYE 4QC2A 3AONB 5B4TA 5MN6A 5E4WC 1Z5PA 4P5EA 4HAZA 5DWQA 4KQFA 1DU4A 2YHSA 3CUUA 3SX2A 1YAJA 1Y7PA 1Z0FA 1I94L 3TXYA 4E7OA 5DTQA 1QDEA 2ZSIA 4BNMA 5ANRB 1T3SA 3BXEA 3E9DA 3K0CA 4J0GA 4TN5A 421PA 4F5EA 5CYGA 1JKXA 4ETWA 1GQSA 2ZB2A 1YASA 4X8HA 5DGTA 3K70D 1U0FA 4A8HA 3L8HA 2ZXRA 4MRVA 4HXFB 4IQZA 4OWXB 1FFBA 3GHYA 3QLVA 4N9QA 2IYFA 2O6HA 2NVUB 5LQDA 3ZWBA 4Y0AA 4EW2A 2P6RA 4MR9A 1BYIA 3TQYA 3WWCA 1UJMA 3NIWA 2R85A 5BXYA 3OW7A 1W94A 5IAGA 3PZBA 5FJIA 4ZQCB 4AL4A 4G7OC 1OXUA 4DBLE 4V190 2X0NA 4JLKA 4M8LA 1BCRB 1U94A 4CTMA 2CNOA 4IJMA 4YV1A 2NQ2C 2Y0SE 4E15A 2WHXA 1Y4ZA 4ZHQB