3PUZA

Crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puzA01
2ZJQA 2ZTSA 3FKSA 5C18A 2K75A 2FSHA 5BWMA 4A3FG 3GLHB 2NVXH 4UQOA 3T15A 5KNDA 2AWOA 1IJEA 2BJVA 4LCBA 1G4AE 1P9NA 2JATA 2ZEJA 4NMMA 1M7HA 5IK2A 4BUJA 1E2MA 1QRAA 3QEOA 4NH0A 2KBEA 4RD0A 1E22A 3A74A 3M4PA 5IYBH 1J90A 4HDCA 1HQMC 4R98A 1XZQA 3RS2A 4X65L 2IS6A 3W1BA 3LWUA 2A5JA 3WBKA 1HT1E 1VHTA 3NEMA 1R0WA 4C0AC 1QDEA 3SYKA 4JLDA 4RFVA 1RL2A 2GHIA 3DZDA 4S2EA 5EZ6B 4U7DA 2ZRBA 4C0HA 1XEXA 2WIBA 4LPKA 4TVAB 2UZIR 4OQXA 1SXJD 1JPJA 5LMNL 5EE1A 3B9QA 4JL8A 1UE6A 2Q9BA 3EAQA 4GOPA 1OIXA 1GUOA 3DM9B 1A82A 1S1CA 5ANRB 2ONJA 2FV8A 3AUXA 1TU3A 3QXXA 1E0JA 1Z83A 5M5YH 1YVDA 2OBMA 3I92A 3RWOA 4B6FA 3CF5A 4B3MQ 1SZPA 1MH1A 3DHWC 1DADA 1M1KC 4URUR 5E4FA 3RHFA 4LSGA 3V00A 2KBFA 4ZPXA 3S1AB 4BASA 5CB8A 4A3LG 4TMTA 2JEOA 5HZKA 3GJ8A 4TZ0A 1CUKA 3DO6A 1SMYC 4GNXA 2V6JA 1XNJA 2CCJA 4OHXA 4JLAA 3NENA 2ZS9A 4M21A 2PNHA 1JAHA 1OT3A 1QUQB 1ZM3A 4M2LA 4C0LA 3D6TB 4LYJA 3SYLA 4D4JA 3KLRA 1K3RA 4DPGA 1II8B 3E5HA 3AVOA 1G20E 1QG2A 3SFVA 4B48A 4DLZA 4EPXA 4DV7L 3DL0A 1D7QA 1HNZL 3SJBA 2VYFA 2HYDA 2XZOA 4DV3L 1E2KA 2ZUDA 4AKGA 3E70C 2OLJA 4BRUA 1BMFA 2GXQA 4A8JA 1CTQA 1Z29A 1L1OB 5BR8L 1E9EA 1NBMD 1NN0A 2IF0A 3CM0A 2OFOA 2EFHB 4Q9IA 3RDPA 2V54A 1Y8PB 2G77B 5HZHA 3FFAA 4JI5L 3RABA 2O5JC 3AVVA 1U0LA 4D2IA 1GHJA 4PHHA 4JBYA 4KV9A 1Q20A 2BMEA 4JKIA 1TAGA 2IS4A 2C35B 3UDIA 1J8MF 2JIZD 1GUTA 3KFUA 1MABB 5FJ8G 2ZRHA 3N2EA 3OEED 1XF9A 4NP6A 2A5FA 4EIWA 1XMQQ 4Q21A 1IQPA 221PA 1Q90A 2NGRA 3KKNA 5JMTA 721PA 4GZYC 4C0BA 1VCIA 2JJ1A 3KF6B 3Q3JB 2OV2A 1VQ8A 3TS2A 2ZI3A 2JLYA 4A3FH 4ZCIA 4O25A 3GFTA 2PQAB 1GL9B 4GMDA 3WHKA 3VKWA 2B8TA 4DUYQ 1X56A 4TKOB 1JE5A 1D2EA 3CX8A 4GOPC 3S16H 1RRPA 4ITRC 4BZXA 4CYMA 5KUTA 1FW6A 1U9IA 3GLIA 4YHHQ 4WJ4A 1Z22A 2E9SA 4GP7A 4HLCA 4WXPA 2IS1A 3WXMA 5IDVA 2DGYA 2PJRA 1HUQA 1JPNA 2UUCL 1S2MA 2H57A 1R9TH 4JVLA 2C2HA 4LJ7A 4F93B 4TYYA 2AKYA 3NDPA 3OAAA 4KN4C 4JJZA 1DBSA 2ZRFA 4GNXC 3AP2A 4JC0A 1G18A 1CTMA 1H8HA 3OW2A 1Z0KA 3WHLA 4RG1A 3MSXA 4DZZA 2O8FB 4LBYA 3K0EA 4IEEA 4JI1L 4KCGA 1E2QA 4LJ6A 4RY2A 4EKDA 2I5MX 2HLDA 4W5WA 3T61A 5C2JB 1NL3A 2A1AA 2JDIA 5GAHC 2GVAA 4NU0A 4LBZA 5FFMA 5FI1B 1WF3A 3AH8A 1VG1A 1LFDB 4LX0A 3HYRA 4ACAA 5HKKD 1GUSA 2RCNA 2DBYA 3H0GG 2YNMA 3TQCA 3EPKA 3KF8B 2ZRIA 2RB4A 4A8JC 5E7JA 5JHHB 4NYIQ 1P75A 4A3LH 4KMUC 4Z1MA 5DGXA 1SXJA 4YXWD 4A92A 1T0HB 4YC7A 4CEIB 2IT1A 3T56B 1EWRA 2D3WA 2GZAA 1W1WA 4PXAA 4A0FA 2EQBA 1WYDA 4TQAA 3TR0A 4YQFA 1LV7A 3UMSA 4RCNA 2A5YB 3I73A 2E75C 1JAIA 2MQHA 5C44G 4QBGB 4P71A 1XMIA 1NG1A 2CLCX 2QENA 3CR7A 5JHGB 4PSAA 3K9HA 2J0UA 4LFBQ 3BOSA 4DLYA 3N6RA 4G7HC 5BN5A 1EXMA 1UE5A 2BWJA 1QF9A 2IUSA 3OE7D 2CW0C 2BDOA 4LF5Q 1LYLA 5M5XH 2RMKA 1KO8A 1OB2A 2O8DA 4KI0A 1IXSB 2F9LA 4D0LB 3BC1A 2CMKA 5DE3A 4A75A 4XWKA 1WXQA 1XCGB 3GMTA 1FUKA 1SRUA 2G1JA 3ADBA 1W2GA 5JECA 5FJ8H 4H1VA 1IY1A 4K8OA 3JVVA 2UXCL 1VG8A 1SMXA 2E2HH 1YZKA 4E22A 2ALYB 1AJEA 1C9OA 1U9IC 5A0FA 4DB4A 1YHAA 3EN2A 2WMNB 4PZYA 1YHQA 4EQ6B 4EUNA 3AVTA 2OQKA 2OCEA 1YITA 2F1IA 4PV1C 1W0JD 4DLSA 2EWVA 5HE9A 521PA 3PQCA 2BEKA 3VKHA 1E9CA 3M4QA 4JBJA 3TREA 1MO5A 2XNSA 3W6NA 2BBTA 4QGAA 5GAGC 3CRKC 2VHUA 5EE5B 3NE5B 1FP6A 1T0JB 2H7VA 4D4KA 3X1WA 1E2GA 4HAYA 4IVPA 1MT0A 1TNDA 3GJ3A 4YMTA 2W6JD 4L9WA 3QPVA 1CRQA 2IYXA 2UUBL 1EK0A 3IHWA 1VTKA 1I4LD 2B63G 4HZIA 3ZD6A 4NB3A 4XIGS 5LMUQ 4BBSG 1GUAA 2BH2A 5CDFE 4F4CA 3QXJA 4Q1AA 4CEJB 1KDRA 4X64Q 1SXJC 1G1MA 5EZ5A 4O0AA 2GDJA 3THOA 2F1RA 1Y3AA 2N78A 8OHMA 2Q2HA 3I5YA 2JA8G 5DLQC 1CJTC 5GQOA 2VP5A 3IGFA 1N33Q 2F6RA 3QF7A 3PIPA 4XJXA 5D3QA 5EXXA 1L8QA 5FTMA 3GLGE 2GVZC 3R7WB 3ULLA 2BJWA 4DSUA 4LV5B 2W0MA 4U00A 3VTKA 2QSZA 1X1SA 4GBMA 2CWAA 2ZYWX 3LY5A 3H0GH 4I1VA 1VPLA 3N5CA 4X8MA 1VQOA 4MYUA 4ZIRA 4DR1Q 4ERNA 1W36B 2N49A 4DWJA 1G7RA 5IT5A 4OX9Q 1FJGQ 3QENA 3B7GA 2QI9C 3K09A 4MQBA 4DR7L 1UKYA 3FWYA 3SBDA 4HAVA 1TF2A 4OONA 2IYWA 4WZ6A 4B2IA 3GJ7A 2CXXA 1LUZA 2KI5A 1VDZA 2IHBA 3LBHA 2JEBI 2R6DA 1RJ9A 5C44H 5DH9A 4A0GA 2VHJA 1F5NA 3QVVA 3KL4A 4BY7G 3CPFA 1UDWA 3VNVA 2GJKA 3EA5A 4A6PA 1Z0IA 1VQGA 2GAAA 2VPPA 2JLSA 2TMKA 1MO4A 4EPRA 3U4ZA 3L0OA 2F3RA 4PANA 1YNNC 3FKIG 3GEIA 4TMXA 4PC1A 1QHSA 4IFDI 1DS6A 2YC4C 5J4YA 3ZS9A 4EPWA 1GKUB 2DFKB 1R5NA 1G7SA 1YZUA 2ZVQX 1AM4D 2KWIA 1U90A 1XTDA 1S1MA 2UZ3A 1XD2A 3HU1A 1M7GA 2Q3MA 2ZQ5A 3T51B 3ND8A 3CP0A 1XMSA 3QE0A 3UK6A 2MSDB 2P2LA 3TE6A 4C4PA 5KTYA 4DVGA 3UKDA 1W7AA 2NO0A 5L3RA 2ZJZA 2NG1A 2GVBA 1VQ5A 4LC1A 2GESA 4CVNA 3WNCA 3QKTA 2K4KA 4TLBA 1FYCA 2OLKA 5C4XG 4GT1A 4I99A 1NKTA 2RKOA 3KJHA 1RFLA 2R6CA 1NMFA 2REBA 2QEQA 4OWWB 2XAUA 1PJRA 2ZRKA 2OXCA 3SZRA 2PCLA 4AD8A 1YNJC 4L5QA 3GTQH 4B6EA 4FIDA 3T35A 4MKIA 3BFVA 4WJ3M 2CJWA 1MJEA 3QF4B 4RD1A 3T34A 5FOWA 4IOJA 2ZJPA 5M3FG 4BBSH 4A3DG 1UADA 4XWOA 1HE8B 2A8VA 3E9IA 1W3SA 1U2RA 2CL0X 2GBLA 2I4IA 2WWIA 1E79A 1NNEA 1GO3E 4IQZA 3K09C 4DR6L 1XTJA 1Q1ZA 4LUZA 4UXIA 5EP1A 2HT6A 3ZQ6A 3ZZ0A 4E07A 2JA8H 4UPAA 3PF5A 2CNWD 1X1RA 2YJTD 2G1KA 3K7AH 1H9SA 1XU4A 4YWKA 4JI3Q 1E9FA 3FHOA 2AWNA 4QBHA 3CH4B 1EGAA 1MRNA 1TUEA 2GILA 4B47A 1VIAA 1KI6B 4UNSA 3FP9A 1TWCH 4Q5IA 1YR6A 1E9BA 4ZI3A 3HOZG 1G8YA 4Q4JB 4XD7D 2N8NA 4OK5A 1HE1C 1X3EA 4XTCS 2FJUA 5KU1A 1KK2A 2V9PA 2QP9X 4LY6A 1GHKA 1UE1A 1AS3A 1UBEA 1XTQA 5AJ3Q 4IVQA 5CM8B 3UMRA 3G5UA 4K81B 2WSMA 5CM9C 4LF6L 3PG5A 5FTKA 5JFGA 4F4IA 2GVDC 5AWFC 4KKSA 4BY7H 3WYGA 3QQ5A 4DLVA 3VR4A 3EIVA 3S1NH 1NMZA 2GCPA 1LTLA 3AFQA 4TYPA 4FMCF 2EWWA 4UXHA 3TMKA 4OKSA 3THYA 1Z6GA 3UIEA 1X9NA 1MR3F 2Q9CA 1GUNA 3FKIH 1G8GA 4W7SA 4A3CG 4WVFA 5BQ5A 3HWSA 2ZTDA 3GLHA 3RS7A 2DNEA 5GAEC 1M74A 3EW9A 4DV1L 4EJSA 5C4MA 1GITA 1S0UA 2ZREA 2O8EA 4C0SA 1KHTA 1N5LA 2R65A 4IOMA 4ASUA 1HZBA 4FMCB 2A69C 2RF4A 3CD6A 1PLJA 2FZ4A 2PMDA 4TL9A 4ARZB 4NXNQ 4OQMA 1G64A 4A3GG 4JI0Q 4ALPA 1FFHA 4DUZL 3EZ9A 1E4YA 3LRPA 5FUXA 1S4QA 1XTKA 3WDNA 4TL8A 2E76C 5G40A 2FPMA 4ESVA 1RYFA 2BCJQ 2A6EC 4B71A 1J8YF 4AYBG 2GBLC 5BN4A 3W90A 2D7DA 1KY2A 5AR1A 3GP8A 3GDEA 2FEOA 1DO0A 5ELXA 4KSCA 1AE3A 4UNRA 5C4XH 3OFNA 3DLLA 3A8JE 2NPFA 1CULC 2XB4A 4LGMA 2WP8J 3LVQE 1T91A 3GTGH 2Q2TA 1PH6A 1CSQA 1MIUA 2PH1A 2ANCA 1HZ9A 1E2FA 4JSTA 5M3FH 2IX3A 3NBHB 1ZYRC 1BKBA 2R93G 5CYPA 5H1SE 5HR5A 1JJGA 3UMFA 3JC66 4G3XA 1KMHB 3U44A 3AKDA 3DOFA 3D8BA 4ON9A 3S2HH 2N42A 5F2EA 3EZFA 3P1JA 1U99A 1E0AA 3S2DH 4B74A 3SI7A 1QUQA 3SGIA 4DR2Q 1J5EQ 3RS5A 4GKKQ 1IN7A 3C41J 1II8A 3RLFA 5TY0A 3IO5A 3U3RA 3BH0A 5DN6A 1VF5C 4H0LC 4EQ5A 1IN8A 1FQJA 2C03A 2LSSA 1JB7A 3OESA 2CDNA 4QGFA 5CDFA 3K80C 1DO2A 1E9SA 3B9PA 4C2TA 4V0ME 1SVIA 3HOZH 2VQFL 4JV5L 5FLXc 3OPOA 2PZGA 2QBYB 2H5XA 4BPBA 1TU2B 3PF4A 2FWRA 2H17A 1L4YA 1W2BA 4I81A 3VR6A 2R7DA 2BBWA 2J1LA 4RSGA 3LX8A 3MG9A 4UY8C 1K83H 4EJSC 1CRPA 4FINA 3GLGA 4TYWA 1XEFA 3HKZE 5L3SA 1Q82C 3P27A 4NTZA 2EYQA 5EP2A 1E1QD 1ZYUA 1MRSA 2GXUA 2IYRA 1XPRA 1VS0A 3L8YA 2B21A 1L2FA 4YDHB 3BZKA 1SGWA 4O0MA 4FWIB 4YCUA 2Z83A 5FL7A 2WWWA 4TSFA 4FN5A 1NP6A 3WMGA 1JNYA 2QE7D 3O47A 1A7JA 4DR4Q 4MRNA 4MRRA 4EAQA 1KJYA 3TIFA 3A8IE 2YTYA 4BFUA 1E2JA 3KKMA 4X8HA 1PH9A 4DKAC 4D25A 1IBLL 4UP9A 1CJUC 4QJ4A 1KO4A 4J0QA 3HOUH 1I6VC 4A3GH 1XCPA 3HPRA 2A2ZA 1VYVA 1Q46A 2IBMA 3EIHA 3TVDA 1KZ7B 4H13C 1H8ED 2ZJOA 1XTIA 3BZCA 2OXRA 3PIRA 3PO3G 4LBWA 4PC2A 4PHGA 4P4UA 1FGUA 4QXAA 1GIAA 4ME3A 1IBMQ 3I4LA 4R4TA 3CPWA 4DJTA 3KQHA 1W36D 1G5RA 3LBNA 2LMCB 4JL6A 3T12A 4DV0Q 4LFCL 2FU5C 5DO9A 4UJ3A 2ZI7A 3W5JA 4KVAA 4KFUA 1C1YA 5TARA 3CH5A 2HDNB 3CC4A 4IFDJ 4YWMA 2UXBL 4JLPA 4PPGA 4WA7A 5DI3B 4GRAA 3X1ZA 2VRWA 1UKEA 1ZNWA 2JQOA 2N3SA 1P61B 2XITA 5E95A 2VY3A 3I8SA 2R93H 1EUJA 1U8ZA 3AB3A 1NSTA 4LJ5A 1G8HA 2R6GA 3EIQA 3J81c 2Z0SA 1J7KA 4DC9A 1Z3IX 1NVVR 4DR5L 3GJ4A 5BYJA 2QG6A 5C0XJ 2K14A 4X62Q 3F2DA 3OW7A 4OXPA 1Q3HA 2P6UA 1C9KA 4GZLA 4YWLA 5BW8A 5L3QB 3U3KA 1E6CA 1N36L 2V1CC 3NHBA 1TQDA 1YQTA 5K8UA 4TYQA 1KRSA 1ASZA 1YRBA 2J7PD 4HAWA 1XNQQ 1A63A 3A4LA 2ZSBA 4TQUS 4POGA 1ZW6A 4JMPA 1G5TA 2WSSA 2NZHA 4DR3L 4BXXG 3THWA 5HGQA 2E8GA 1OFIA 1N34Q 4IKEA 5JS8A 4YCWA 1VQMA 3NEJA 3U58A 4RZ3A 2B8WA 2KB0A 5KDLA 1FOEB 2FFHA 2L0XA 1BBWA 4MNOA 2NO6A 4DXAA 5HPYB 3U6BA 4DV4Q 5SZHB 4US2R 3U7HB 1G6OA 1NI3A 2OBNA 3KYHC 2Q3FA 5AUQA 4A6XA 3TSWA 1B9MA 1IY2A 2BKUA 1OE0A 3L0IB 5FPSA 4BA2I 2NZ8A 3ONWA 2JLVA 1E2PA 3LGJA 4NDZA 3L0SA 4MGIR 4DCVA 3NVAA 3CMEA 1DXMA 4A3KH 4MH0R 3KLWA 4XVUA 3U5ZB 2ZJ8A 2ZPTX 2OO7A 2H16A 4DKXA 1JJVA 1ZD1A 4LF7Q 3EARA 4PMWA 3CCQA 2VHCA 4XSGA 4G1UC 2FGJA 3W9YA 5AUNB 3CZPA 3LD9A 1FUUA 3LV8A 2RGNC 2XOKA 2H5EA 3IQXA 4JYAL 5IY0A 1AN0A 1D5CA 3EPHA 1P4SA 5G41A 3PIOA 4QL5A 3KXKA 4F7WA 5B30A 3T5DA 3GLIE 4C7OA 1PYBA 1D8LA 1BKDR 2ECKA 2ZJYA 3PEUA 1E1RD 4D6PA 1HA3A 2CL7X 2F3TA 3CLVA 4JLKA 4D4MA 3AVPA 1GNRA 3J7A5 2QAJA 2ZS7A 2O8CA 3PO3H 2BMJA 1F2UB 1NTGA 1GM5A 3KFXA 2NMVA 2ZVPX 3GFOA 4ZDKA 1XXHB 4XOIA 3SEAA 4BLQA 3K70C 1C0AA 2R7FA 2VZAA 2A7QA 3BD9A 1D8TA 3UG7A 4RD3A 5K8LA 4TMKA 4DBLC 5TVKA 4AYTA 3CRVA 3TJZA 5K8IA 1F60A 2ZE5A 3CCJA 4HR7B 5JCZA 3AVWA 4AKHA 1IY0A 2HJVA 4LHYA 2BA1A 3GJXC 1GP2A 1W48A 3IEVA 4PSVA 4HDQB 1F6BA 4FD2A 3HFZB 2VHTA 1OHHD 1TQ2A 1H9KA 1NIPA 4JYBA 1WP9A 5C4GB 1T3HA 4AC9A 4ZV4A 4ZKEA 4MZ9A 5IWAL 3HOXG 3B60A 2KCTA 4LJAA 1SXJE 4QJ5A 4R2HA 3N2IA 3P4XA 1OXSC 1QJOA 1T8TA 4B3TL 2IXEA 5L3VA 3EC1A 1N32L 4IOCA 3TGPA 1GILA 1W5SA 5DLQE 1M2OB 1TWFH 1GNQA 2BHRA 2XTZA 1HYQA 1OB5A 3AGQA 3CPHA 5M3MG 4LV8B 5AJWA 1YVCA 1L0WA 1DARA 1VQAA 4LF9L 1SHKA 1QHHB 2J45A 3MCAA 4B3DA 4A3IH 4TTQA 1MJCA 2O0KA 1YHBA 2J7KA 1E0SA 4TMVA 1VKJA 1VYUA 3Q72A 3TSOA 4BXXH 4D80A 3U2QA 2I3BA 4M1TA 3C15C 1ZC4A 4OI4A 5EXSA 3RSOA 3SQWA 4QBFA 2IK8A 1WBDA 5M04A 4IOLA 5EP4A 3S1QH 4P74A 2XNDD 4YMSA 4URYR 3MMPA 2UVQA 2BEJA 3W6OA 3U61B 3DMDA 2O0JA 4JLJA 4KFSA 1P72A 1YZTA 1PFSA 4M22A 1ZUHA 5FR1A 4TT3A 1XX6A 3VDYA 3G4SA 2FPLA 4JLVA 1E2VA 1US8A 3ZIAD 1QHXA 2J59A 1WQ1R 3A7AB 4B3RL 4P31A 4WOPA 4MYTA 4P4SA 3M9BA 4V0MA 4YMUA 5F3WB 4BQSA 3CMAA 2CK3A 1UEJA 4BLOA 1X54A 3R8CA 2IEZA 4HIKA 3H86A 3QEJA 2IYYA 2XJ9A 1OH5A 5IYDG 3STBD 3KXLA 2F43B 2WKPA 2QM8A 5IT9c 2D06A 4LPSA 2YTXA 1N6RA 1ZUIA 2OESA 3KKPA 4HSEA 1K8MA 2QEXA 4HYYA 5CK4A 4ABYA 2FFBA 4X65Q 3BERA 3B85A 3SJAA 4OI1A 4W5HA 2IXGA 1JJ7A 3WMFA 3GLFE 1GL6A 3R9IA 3W8NA 3DMNA 3CNNA 1E2DA 1G41A 2MMGA 1DAEA 3D0FA 1XFAA 2DWQA 1W36C 3PJRA 5LMNQ 1MO3A 1CJKC 3TUZC 3U60B 1XTRA 2ATWA 2JAQA 2GZHA 2YOHA 1OF1A 4GSYA 4A0RA 4A3BH 4QY7A 3I8XA 2QY9A 3C5HA 4PHFA 3MJHA 4KFRA 5G53C 2BA0A 2D0OA 2ZM6L 2JJ2A 5JS7A 2ZSEA 1IAQA 3OEHD 3I61A 1AZSC 5D3MB 4C2UA 1K0RA 2NN6I 4TMZA 4D82A 3FVQA 1UWVA 1XNRL 4IHQA 1E7ZA 3ULPA 2ODEA 4LRWA 3TAHA 3LH5A 4DDTA 3K0FA 4PQFA 4IPGA 4QIWE 1K8RA 2UUAL 4RZXA 2B8FA 3VX4A 3IPYA 3W6PA 1G16A 3HOXH 5LBIA 4IPDA 3NXSA 2VIIA 4B3BA 1G3UA 5A35A 1KGDA 4AIIA 4DIDA 3WYFA 1W0KA 5EE0A 3MXNB 1JALA 4U02A 4LYFA 3K0AA 4TN1A 5M3MH 1HNZQ 2W6IA 2WMOB 4DV3Q 1Z0JA 1VQEA 4NHOA 3KB2A 1ONBA 4KLKA 2NQ2C 3EQLC 2GK7A 1UM8A 2GA8A 4TTRA 1XD9A 3CW2A 3GJ6A 5BR8Q 2V7QD 4LHZA 3CF6R 4PZZA 1NVUQ 4E09A 5FI0B 4JG2A 2A68D 1GRRA 1UPTA 2E2IH 4JI5Q 3DKVA 1NBWA 1YR9A 2OAP1 3MWJA 4Q02A 2B7CA 3NDBB 3KJPA 4YLGA 5IF9A 1EQQA 3ASZA 5BXQC 4QGGA 3QPWA 2I5HA 2EDGA 4MITA 1R0XA 3WP0A 4P3YA 2QP4A 4CDGA 4TLDA 1H9RA 2PNRC 1WJJA 2DR3A 4X8OA 2ZETA 1D2NA 1HZCA 3QVUA 4IFEA 1Y1WG 2D0PA 1N6IA 5IP7G 5FBQB 1QG4A 4RFSA 3VR1A 4ZO4A 1YZQA 1LNZA 4UP8A 2EVWX 1KI8A 2QGZA 2QSYA 3AF4A 1B9NA 2G6BA 2GEUA 2JGNA 4Q47A 2ZYTX 3MD0A 1E0KA 1T3SA 4NONA 1Z08A 2JASA 4XVQA 2ODWA 4DLXA 4GS3A 3ZH9B 5IYDH 5FL3A 5FTJA 1YJNA 1WRBA 2IEYA 1LY1A 3BH7A 1ZMXA 2WPDD 4PSKA 2HV8A 4RCYA 1VQKA 4MGKR 3ZVNA 4PO1A 3ERSX 2YWHA 4C0JA 2DCUA 1UE7A 2JLWA 5KPJA 4X6AH 4L9SA 3GJ0A 4LC0A 2XEXA 3C8UA 3PV0A 1TX4B 3LQQA 3GCGA 3RNLA 4OO1I 1AZTA 3ZQJA 3ZZTA 4QJFA 4N0EA 2YOFA 3AP1A 3OIYA 4BFVA 2K5NA 4HAZA 2UUCQ 2BCGY 4WBSA 4NYMQ 3DKPA 4EPYA 2ZJRA 3RANA 1ZC3A 2G88A 3RAPR 2XSZD 2XTIA 2EJFC 2XXAB 1M8PA 4JI1Q 3THXB 2C9YA 2RGEA 2CKZB 3J81j 3KTAA 1VCNA 2A5GA 3KDFB 4FW9A 3E1SA 1T4GA 3CCRA 4DB2A 3D31A 1P8LA 2PLRA 3AKEA 1UBGA 3BB4A 1Z5ZA 4H9GA 1E4VA 4CGZA 3CW2C 1B0UA 2FXQA 4XSHA 5J4HA 1G21E 1KYIA 2JA5H 1ESNA 3ICEA 1N5IA 2G0TA 4B3CA 1NY4A 3A1TA 1NG9A 3DXJC 3QJYA 1A6XA 2RHSB 1S96A 5H8WA 2ZE8A 4IJMA 5J4LA 4AKIA 4A2QA 2Y0SE 2AUJD 4OK3A 3ZVMA 2EFGA 2ZROA 3U4QB 3HR8A 4DNIA 2OCAA 4DV5L 3S17H 5FBLB 3LO5A 1S3OA 3FPAA 3VMFA 2AD5A 2ZSDA 4JI8L 1SKYB 4B3XA 2H1LA 2HQLA 2KCMA 1E2LA 1AQUA 1U8AA 2OCYC 4PC6A 4KSBA 4NKRA 3TW8B 1Q3TA 1OYYA 4FMBB 2C5LA 4DSOA 2GZDA 2QROA 4QHYA 3KJIA 4MA4A 5DHFA 4MYHA 3GLHE 4JBKA 1WCMG 1YBYA 5LB4A 2OCPA 2CCGA 5JWHA 3A5UA 2NTYC 5AJVB 4AQYL 2UXCQ 4KFTA 4B33A 3SYNA 2QL6A 4LNQA 1Y1WH 2JK8A 4IDPA 1EWHA 2BE5D 3MJRA 1LABA 2GETA 5IP7H 4R7ZA 1G3QA 1Q1BA 2WAQE 1JBKA 1OLOA 4TL7A 3SBEA 3B6YA 4OHWA 4KN7C 4L16A 2ZXUA 3PCOB 1NVWQ 2ZRAA 4PPFA 2FMXA 1E2HA 4QOSA 4PZ8A 4HDOB 4KYIB 2DNCA 2DY1A 4A2WA 1E9RA 2GCNA 4GN3B 1NN1A 2OE2A 4N0DA 4HUQB 1H9JA 3K0XA 5DISB 1GZSA 3VU9A 2GCOB 4BLPA 4DT1A 3WP1B 3ADDA 4F91B 3VA7A 4KLNA 4C30A 1K5DA 1W5TA 1TL7C 1KTVA 2UUBQ 1NBMA 1FR3A 5DYIA 1TKWB 2OT3B 5TB5A 3RRZA 1G3MA 2DB3A 4Q01A 5FBVB 4AY2A 1PUJA 2QAGB 5HCIA 1Y8OB 2VA8A 1NN5A 4K0KL 3L2OB 2P6NA 4NCNA 2O8BB 3W3AA 2KJQA 4NXML 4JLMA 1ETUA 3C7KA 3M4YA 3FYHA 2F52A 2B8GA 3S24A 2JIZA 3QSYA 3OYYA 1E2EA 3OEEA 3P32A 3VFDA 1R8QA 2IWRA 1SROA 4QM7A 1PV4A 2V4DA 1DTSA 2EQSA 3U3OA 3FDIA 2VF7A 1CSPA 4L15A 3U9SA 2FFAA 4QL3A 3HU3A 5FLMG 1FX0B 4Q1BA 5AK0A 2YWFA 1A4RA 3GEHA 1E1TA 1XEWY 1TEVA 2CHGA 5E7IA 3GLFA 2Q8IB 3EG5A 4QHSA 2G9NA 1KJWA 1G19A 3G82C 4EX5A 4IVRA 1P16A 1OH8A 1G4UR 1EOVA 3BS4A 5CLQA 1CI3M 2NN6G 1OSNA 2KHIA 1XWIA 4PAMA 1A2BA 2B6HA 2LKDA 4HATA 1OXVA 2BOVA 2XTMA 1HH2P 5CIWA 3EWSA 4Q9JA 1F2TA 3QOFA 3EX7C 4PQRA 2MSCB 4NYJR 4OQNA 4BFYA 1NLYA 4DCUA 3WMEA 1QHGA 1ZIPA 4X66L 3GJ5A 4MRSA 4RVCA 4PC3A 4JI6L 3RRYA 1DD2A 3UE0A 1E24A 3NELA 4YCVA 1J2JA 2R6FA 3LW7A 1DAKA 1KO1A 1RIFA 4PX9A 5P21A 1EG7A 2A68C 4Q4AB 1CKNB 1IYUA 1GWNA 1S40A 5SZKB 1VQBA 4IOAA 4KBFA 5EUMA 3D7MA 4OK6A 4PO8A 2HYIC 1WCMH 3PFIA 3KKOA 1BOFA 1QVCA 2IX1A 4Z8XA 5HKKA 1NLFA 4RD6A 4BLTA 1N5KA 3BJIC 1ZJ6A 2C95A 3HKZG 3HR7A 1IL2A 4KJZA 4HLQB 5EE9A 4APVA 1A2KC 3UATA 2JLXA 1RRCA 4NYIR 5CJPA 1P9WA 2IUTA 2W0SA 2FFQA 3RSLA 3MUFA 4PR0A 4ZCLA 3CRQA 4Q7KA 1D2MA 2AKWB 2FE4A 1KIXA 2WB1E 1F2UA 3PEYA 3CKLA 1E98A 2VQEL 2FZLA 1XXHA 3CZQA 3AF2A 4Q4HB 2DFTA 3K1JA 3HOYG 2AHOB 3BE4A 3DZ8A 3R20A 1JB1A 1WMSA 5TV2A 2PCJA 3NHAA 3ZDQA 1ASYA 5LD2C 2WWHA 2RGBA 3OE7A 3GO5A 1A8VA 3U4VA 3RRMA 1M1YE 4LF4L 1II9A 3BORA 1X3GA 3QXCA 2ERYA 2CCZA 4M1MA 3T53B 3CCVA 1CS4C 4HZUB 4YMVA 2GJ9A 1E3PA 1KO5A 2F7SA 4JSYA 4MGYR 4RCZA 4CRWB 5F9HA 4DR6Q 1QVFA 2DN8A 4OO1G 2ZT9C 2NIPA 2QT1A 1IW7D 4G7ZC 1Z6TA 3AEZA 4FMDF 4M1YA 2HCBA 4EFNA 3C4JA 2Q2UA 2AN9A 2ZI5A 2E74C 1ZIOA 5CLLA 5J47A 1ZRHA 4DUGD 5FLMH 5C4JH 4A3JG 2UXDL 3EZ2A 4C9BA 4A76A 1W0JA 5FOXA 1CIPA 1PUIA 1FQKA 1OIWA 1TF5A 1HY3A 5TXGA 2Q0HA 4FMDB 3X1DA 3L8ZA 1R10A 4Q00A 1HQCA 2NN6H 3SS8A 4OQFA 4UNPA 4L5RC 1BS1A 5FUVA 3QIAA 4UXJA 4PZ7A 1VQNA 3TLXA 4CF7A 3A5ZB 1XPOA 2DWOA 4URXR 1JR3D 3PVSA 1UF9A 2FOLA 1PH7A 4UP7A 2UU9L 2W6JA 4HIDA 3HOVG 2ZJAA 2ORIA 4M1SA 1Q21A 4LF6Q 1KSFX 4LI0A 1QBKC 5FOTA 3R8FA 1TXYA 1SVLA 2E5LL 1VIYA 3QKSB 2YU9H 1Q44A 2WZQA 2QGQA 2K32A 3E2IA 1KNXA 3TSZA 4A2PA 5JSZA 4CEHA 4L8GA 1UBFA 1I94L 1VQPA 2XGJA 4MKHA 1N6HA 4US1R 1MKYA 1YZLA 3H3VI 2GAOA 1J70A 1XMOL 4DV1Q 4KKUA 1KAGA 1ZM7A 4Q03A 4MKGA 4B35A 2I5LX 4HJ7A 1NSFA 1RYHA 4OQLA 1ZINA 4QJ3A 1Z07A 2F43A 4LF8L 1G8PA 2VBCA 4KLZA 2BE5C 5JZVA 1E32A 1WI5A 1NF3A 3T1OA 2HIVA 4A3EG 4Q66C 2IXFA 4DUZQ 1ZVQA 5KHOC 3VR3A 2FSFA 4FWTA 1E3MA 1Q57A 3BAFA 2HEIA 5H68A 1SE8A 3P20A 4JLOA 3Q8XB 4Y7NH 4DV2L 4LYAA 5JJLA 2KE5A 4LJZC 2OTJA 2CHQA 2Q9AA 1JJ2A 1XEXB 3H1TA 1G9XA 4D0NA 3BJUA 2WJGA 3B1XA 4I7ZC 1NN3A 3T1YL 3CRMA 4GOPB 1I6HH 1GL7A 5DHAA 4NPHA 2K50A 3NH6A 4GNKA 3HOYH 3WRXC 1OXXK 3VQTA 2W00A 2YV5A 2BIFA 4PZ6A 2DHRA 3HOUG 2RH5A 5D3MA 5HE8A 2PT7A 1DG3A 2RGCA 5KO2A 3CPJB 2OHFA 2C96A 2GRJA 2YWGA 5JRJA 2JJ8A 3A1SA 4POAA 2LXJA 1P6XA 3E9HA 4TLAA 4GNXB 1YE8A 4LFAL 1OYWA 4OO1H 2WWGA 1N0WA 2E87A 3A8TA 4N1AA 5IHPA 4E03A 4V0NA 4YONB 1G6HA 1CF4A 2O8DB 3AF1A 2B29A 3RNUA 4B43A 5FPTA 1EFRD 1DE0A 4PC7A 1Q86C 3AUYA 4U5XA 3QBTA 4LJYA 4A3JH 1E2WA 1KO7A 1P73A 3OHMA 1H9MA 3RZOH 2CEAA 2Y8EA 4A8JB 5GVSA 1K73C 1E9DA 3HU2A 5LPNA 1LACA 4PPQA 4QQBX 3LLUA 4KYUA 3VR2A 2JLUA 4A36A 2VQFQ 4JV5Q 2C99A 4FCTA 1CJVC 3WNDA 3F3YA 1U5KA 4JVNA 3S1AA 2R92G 3BDOA 3KQLA 1B23P 1AH9A 3QKRB 2ES2A 3I4OA 1FNMA 5UKDA 4R4QA 3I1FA 4CZ2A 3PUVA 1L7VC 1JQLB 4IDNA 4P4TA 3KUCA 3KJOA 1DEKA 3M85A 3HOVH 2D7CA 3FFBA 2QF7A 4P0TA 4Y0VA 4DNTB 3TS0A 1KL9A 3J81i 3BRWD 5C46F 1YJ5A 2H92A 4LOAA 1A0IA 3CC2A 2P65A 3FMIA 2OAQ1 3H0KA 621PA 4ACBA 821PA 4BRWA 1KSGA 2GF9A 3ZGXA 3A8KE 4LBVA 4NE2A 1L1OA 4DEYA 4G5GA 4OJQA 3UPUA 2XZLA 2YVUA 4A9AA 3ECCA 2CNWA 3CAMA 1VG9B 2QMEA 3AF3A 1TPZA 4M9SA 5FUWA 1IBLQ 1X3SA 2BMDA 2BVNA 1KDTA 1OJLA 1MABA 4Q9KA 1AE2A 1O7LA 1Q1EA 3O8RA 3CCEA 1YIJA 4A3EH 2GEVA 4QM6A 3A1WA 1BH2A 3B1WA 2I1VB 3U3MA 4XD7A 3ASYA 1VQ6A 4RD2A 5JWRA 3PEVA 4GDFA 4A3KG 1S8FA 3KF6A 2HXYA 4KVGA 1BYIA 4Y52H 1K9MC 1RKBA 4JVSB 3PUWA 4BFZA 1NMGA 1EIFA 5GADC 4LFCQ 4LYHA 3OOCA 2KHJA 4LHVA 2PQAA 1TEXA 2IYQA 4EFLA 4GN4B 3WBJA 4KHPL 3THXA 1U8YA 4IDOA 2VSOA 2UXBQ 2K33A 4O3MA 2GWHA 3T1HL 3CBQA 1AA9A 2QORA 5FBRB 4R71A 4Z8YA 2Z6VA 4GL2A 2OWOA 2PEYA 3I4NG 1E69A 1JJCB 1KI7A 3VX3A 1A1VA 4AYXA 4DNRB 4LW1A 2X1VA 3FMFA 3D3QA 1U94A 3BG3A 2Q21A 1VQJA 2WFWA 1KOFA 4DR5Q 1N6OA 5GVRA 1Z63A 4KITB 5B64A 1NRJB 2RGNA 1IN5A 5HY6A 2ZR9A 4TQ9A 4D0GA 2O8FA 3PEWA 1N36Q 1HNWL 2MFIA 1W4CA 2J0UB 3IDQA 2O5IC 3OIUA 1G7TA 2EJMA 3DM3A 2NVQH 3GTKH 1UEBA 1P3JA 2JCSA 2ZRLA 3H4MA 3LFUA 3QXHA 4K46A 4NBSA 1Q22A 4D4LA 4DR3Q 4DV6L 4QGHA 4EPVA 4JI7L 2IY5B 1GAJA 3AQQA 3GTPH 1OXTA 3NWJA 3QUSA 4HJ9A 4LV6A 1L1OC 1Q81C 1AS0A 3RZDH 2R92H 3CO5A 4RKEA 4BLSA 2BMFA 3DOEA 4OWTB 2VSFA 1R2QA 4I4LA 4CEIA 3PITA 2ZSAA 3CRW1 3TEHB 3OTOL 3GQBA 1KD1C 3NBFA 2PMKA 2XZPA 4URZR 2PMZE 4MRVA 1JXMA 3K9LA 4XTRA 1FNNA 4IW3B 3R9WA 3L43A 3CXCA 4A3IG 1HNXL 3IHLA 1HR0Q 4DEXA 3RS3A 3A36A 2ZTEA 1NJIC 2QUZA 2RGGA 2V4ZA 1PYSB 2XX3A 1GJXA 4Q9HA 4R9UC 1N25A 3U7GA 3KDSE 4GI7A 1ZUNB 4MYCA 3TW4A 2HXSA 3EXAA 4LHWA 3A58B 4ZDWA 3TH5A 4TZ6A 3CX6A 4IOKA 4JYAQ 3PCRB 4RKFA 5J5CA 2IA5A 1Y8NB 4YDSA 2ASBA 2BKEA 2ZJBA 1BVSA 3UE1A 4HJAA 2F1MA 2ZAMA 1Z06A 3JVUA 4IXNA 4Q1EA 3QPUA 2FDCA 2J41A 2BM0A 2VEDA 5IYCG 3AF0A 4EQ6A 1WDTA 2ZRCA 3J80c 4X8LA 5FPYA 3M3YH 2QQEA 5FOUA 4DCSA 2ZRMA 5JEAG 3TUJC 4YY3L 1L2TA 3I55A 3O8BA 1E1QA 1X3FA 2FN4A 2A78A 3L82B 4TLCA 4M9QA 1I2DA 4JI2L 2V8OA 3A4MA 4V0LA 1IXZA 4ZIRB 2ZI6A 3I4NH 2CCKA 3ADCA 3F2CA 4G0NA 2Q6TA 2KSQA 2UKDA 2QE7A 3K0CC 4XVRA 5IWAQ 4B3SL 1DELA 3RC8A 3K9GA 4GKJL 4B3TQ 2QU8A 1VQFA 4CEJA 1N32Q 1C4OA 3IUYA 1Z9FA 1VQ4A 3MEFA 1NVXQ 2HUPA 5K36G 1DAFA 1PH8A 1OV4A 3FKSD 4A3BG 1OW3B 1ZD9A 3V4RA 1RJ9B 1Z8FA 4TL6A 4LF9Q 1CP2A 2QPAA 1IM2A 2ZRJA 3FPPA 4Q7JB 3BK7A 4J15A 4HI0E 3OF5A 2YYZA 4MUAA 1XTSA 4JI4L 1Q12A 3G48A 2IYSA 3R7WA 4NCHA 1H8EA 1EYGA 1NY6A 1OPXA 1TUIA 4G7OC 3AYHB 1KMQA 2R44A 1II0A 3JZAA 4PAQA 4JLNA 3V9PA 5JBQA 4OI0A 1E99A 4KAXA 2ZU0C 4B3FX 4OHZA 1Z0FA 4IEIA 1Q7YC 1TU4A 2AFIE 2KA7A 2X19A 2WTUA 1OH6A 2VS1A 3G71A 2RHDA 1XD2B 1FL9A 1HURA 2WWFA 5KDOA 5HTKA 2J0VA 4UJ5A 2Y0SG 1VF7A 2A5DA 2ATXA 1Z6HA 1HPCA 4GLVB 1ZU5A 2R62A 2VL7A 4B3RQ 2VP9A 3JAMc 2X2FA 5G3ZA 2QRZA 4UNNA 4XWAA 1Z6XA 3CNLA 3B2EA 3EPJA 3RC3A 4PO9A 3ND9A 1V5WA 4GOJA 2B7BA 4Q7MB 4R4CA 1CR1A 2OQ0A 3F8TA 1A5TA 2Z0MA 5DI9A 2O0HA 2W2VA 1YRAA 1RPZA 2QMUA 1AQYA 2ONKA 1OKKD 2J7PA 3SDZA 3H3VH 1IBKL 1IYVA 1XPUA 1NBME 2CJWB 3CCMA 3LDAA 1CR2A 1GSIA 1HV8A 1LB1B 4HLUA 5KPDA 2WAQG 3BFXA 4QGUA 5IYCH 1P7CA 2JA6G 1KNQA 3WWVA 2ZE6A 1DG1G 1SULA 2DWPA 1BMFD 4HZUA 2P5SA 5CYOA 2LCFA 2VSXA 3ZZUA 1O87A 2ERXA 5JEAH 2C04A 4KO8A 2ZSFA 2PEZA 1T6NA 4JT4A 2NO9A 2ZM6Q 1H9SB 1Z28A 2V6IA 3NKVA 5E7MA 5SZIA 3TKLA 1U0HC 5EJEA 1H95A 3KQKA 5KSPA 4Q4LA 4TWZA 1XNRQ 3K81C 1XJ0A 3P4YA 5LDDC 1TTTA 2F4VL 2KBNA 1GOTA 1KI2A 1UAAA 3LQRA 3W3ZB 1KK1A 4GN5A 1PHJA 2UUAQ 1G5PA 3PENA 4JS0A 3QF4A 1P2TA 2OG2A 1P62B 1SVOA 1W4AA 1T5EA 4V03A 5TDHA 2GJSA 2JJ1D 1KI3A 3ZYCA 2BH8A 1QVGA 2WM9B 5K36H 3SN6A 2EJGC 2K7VA 3CB4A 4HB3A 2XTNA 2QP3A 4US0R 1WB9A 1R8SA 3NC0C 5FTLA 3I7FA 4GPTA 4H44C 2PT5A 4HUTA 3FGNA 1E1RA 5AUPB 3B1YA 3SHFA 2G0NA 2P6RA 1DOAA 4F4JA 1ZP6A 3QKSA 2AD1A 3THYB 2PJZA 2HHHL 3K8YA 1KI6A 3JZMA 2O52A 3RVBA 4NL4H 2JA5G 1EFCA 2BBOA 2QMHA 2H18A 3TNFA 4HAXA 4QHTA 3AVUA 4JBXA 1LW7A 2J46A 4Q4JA 4EJSB 1EFWA 2O8EB 1UFQA 3M1IA 4DLUA 4BWYA 4A15A 1UDXA 3OAAD 1VHLA 2IYTA 1I4TD 3KX2A 4DV7Q 1JEDA 1UKVY 4AURA 1E2ZA 1H8HD 3BXZA 4OL0A 3MWYW 3VNUA 1JT8A 1OHHA 1U0JA 1F48A 2HLDD 2QN6A 1H65A 5GJWC 2JDID 4BFWA 3U6KA 1FVIA 4GMXA 4II7A 4YMWA 4HLUC 5GJBA 3DEFA 4NZYA 2IHEA 3LA6A 2WKRA 3SNHA 2AL7A 3NBYC 4PZLA 3NEYA 4Z54A 1VG0B 1KHIA 4Z1MD 3RLNA 4YXWA 1XXHE 2GK6A 4DLWA 5CK5A 1R5BA 1BYUA 4DK1A 1FL0A 2BM1A 2CL6X 2VUMG 4BFSA 1ZCBA 3LX5A 3IEUA 3K7UC 2D4HA 2VHQA 1AS2A 2J87A 1PVOA 2XGTA 5IP9H 1T3LA 1W2HA 3SR0A 1GG2A 4ARZA 3FOZA 3OIVA 4JT2A 2JA6H 2ZTCA 2CE7A 2DFLA 3BWDD 1XD8A 4H1UA 5EE3A 5FR2A 3EBEA 3VAAA 3U44B 3HGBA 1CKMA 4JZKA 2XNDA 3HOWG 2FA9A 3HDTA 3I56A 1YNXA 3ZJYA 1P5ZB 2WB1G 2ZIAA 2HF9A 3ZVRA 1OKKA 1AKYA 4F38A 1HZAA 3A4NA 1RC8A 1WBBA 1W4BA 3VHXA 3CQZH 3ZIAA 3BFKA 1AK2A 4QG7A 3GTJH 5FTNA 3MXUA 1WE2A 4DK3C 2EVBA 3AP3A 4MDEA 2RGAA 4O2RA 2Z4RA 1Z47A 1RZ3A 1W44A 3EWAA 1D9ZA 3FE2A 3L2PA 4B3ML 3ZLJA 1JXOA 4L5SA 2PX0A 2PLFA 3Q85A 2I0QA 1F3OA 1P9RA 1X8JA 2IYUA 2VNUD 4BY1G 3LNNA 1GNPA 2IYLD 4TTPA 1JI0A 3M7NA 2C9CA 3LWNA 1V8QA 4IRUB 1G7CA 1KMHA 3GFPA 4CT4B 4M4SA 5JRZA 3K0SA 2D5DA 3QKRA 4WAUA 2Z43A 1GRNA 2GXSA 5JEDA 3GLGB 3NC1C 2X2EA 1I50H 1VQCA 1P60A 2V1UA 1CLUA 2OCBA 2YZ2A 4QFMA 4DV5Q 4MKFA 3H94A 4B73A 4S35A 3FMCA 2YC2C 1IN6A 3G0HA 1G51A 3BGWA 3B1VA 4KODA 2V3CC 4JI8Q 4M8NE 3VKGA 1LF5A 2NO1A 3W1GA 1S9HA 1UKZA 3QG5A 3U3JA 2W2TA 3TUIC 4PQYA 2AXPA 2QBYA 5F9FA 2V1XA 4DAMA 3A7LA 1I4DD 4JOIA 3OEHA 1GVPA 3IQWA 3SJZA 4AQYQ 4GP6A 4BFTA 4IJHA 2FG5A 4Q18A 2E1RA 4HJ5A 2NO7A 4JVMA 3B6EA 4NYJQ 4FI3C 1XMQL 1E9AA 1IHUA 4GOKA 4FCVA 1A62A 1MV5A 5A4JA 4OJKA 2QA4A 1XDBA 5FOVA 5GJCA 2JA7G 1Y69U 1K8AC 3NBXX 2AFHE 3LBIA 4RMFA 4WW0A 4C0QC 1YI2A 1COWD 3KJEA 4R2IA 1DVRA 3ZJYC 4G5OA 1S3SA 1O7IA 4I1UA 2DPXA 2VUMH 2MSEB 4N3NA 4DUYL 1LVGA 2BC9A 3IPXA 3X2SA 2V7QA 2GXAA 4DK0A 4JCVE 4IPCA 4YHHL 3IBGA 4GZMA 2Z6KA 2QTFA 4K0KQ 4M9ZA 1YZNA 4OI2A 4Q1DA 3W8RA 3AQ4A 2NZOA 4NXMQ 1JECA 2CVFA 1CJMA 4DSNA 2GF0A 1FTNA 3DDCA 3NTUA 1N9WA 3K70B 3STBC 3HOWH 2W58A 1L4UA 2PZEA 3K9NA 1QHIA 3SE0A 2P3SA 1XEWX 2WWXA 2OEPA 5FPHA 2A6HD 1ZCAA 5H70A 2EFCB 5CB6A 1GUGA 1E2NA 4ESHA 1XJCA 5B58C 1Z7TA 3CONA 4NCIA 3UDXA 1ZNZA 1X8LA 4NCKA 2FSGA 5DI3A 4LJ4A 2OSBA 3TRZA 2PL3A 2JA1A 4B32A 5FH9A 2K52A 3U50C 4KU4A 1O3YA 1IXRA 4EDHA 4ZDJA 3THWB 5JCPA 5JJKA 2IX0A 3IRBA 4JBWA 2K5UA 4BY1H 1EWQA 4I1SA 1VCMA 2WPDA 3MFYA 2YHSA 1YZGA 3HJNA 1ZM2A 1U98A 1TWAH 1M7BA 4R1JA 1TADA 2R8RA 4FDBA 4JOIC 3FMPB 1E1OA 2WBLC 4RJLA 1I2MA 3AM1A 4X66Q 4ZDIA 4JI6Q 3AB9A 1KRTA 1SVMA 1TQ4A 3EC2A 4DLTA 1Z0DA 5L3QA 3HP1A 4NYMR 1V43A 2A69D 1PH1A 4LFBL 1OIVA 2D2FA 3LVRE 1PH3A 2CWPA 3NIBA 1ZNXA 4HB2A 3FKQA 3TZUA 2VF8A 2Z5FA 2CVHA 1HQYE 4LF5L 2XSZA 4DR7Q 3WRYC 2OTLA 4UNQA 5FBWB 4C3JH 4CIDA 3J7ZC 1JR3E 1N2CE 4QBIA 3RS0A 2BV3A 2E2JH 1NLZA 4HIMA 2A6ED 2F9MA 3BB3A 3ETLA 3M4OH 1E79D 1G17A 5JI2E 4BZPA 2ORWA 2H8KA 2WVJA 3A37A 3TQFA 4Q1FA 3WYAA 4JBMA 1UBCA 1VCOA 4A1FA 4C7OB 2ZANA 2R7ZG 1RE0A 4MTNA 2WJJA 2A19A 1GFIA 2EYUA 3EA0A 2O8CB 1NY5A 1SR3A 2Z6KC 3QY0A 2JA7H 1NMYA 2CLDX 3DPUA 2VQEQ 3I72A 4BGDA 3ZVLA 2WHXA 3CF2A 2R2AA 5GJVC 3TVTA 2J0QA 1W49A 3FHWA 1SHZA 4OHYA 3X1YA 1EFUA 3F1ZA 4L5TA 1Q0UA 1T5LA 2B3GA 1KKMA 1B70B 1YR8A 3Q8DA 3RN2A 3E0EA 1Y1VG 1XBTA 2F55A 2ZRDA 3K8AA 3UDGA 4LF4Q 2A30A 3EIEA 4HB4A 2WJIA 3J81k 2ZR0A 2BDTA 1IXRC 5LMUL 1FMLA 1QZGA 1COWA 1G8FA 3A1VA 1CEEA 4AI6A 1ZKOA 2J9RA 4LHXA 3CCUA 4AKEA 2ATVA 3IO3A 3LLMA 2IWHA 3TAUA 4X64L 3REGA 3UG6A 2RGDA 4LDJA 2ZITA 2FEMA 2EXDA 3KXIA 5EXPA 1YEZA 3IIMA 3NG1A 4IO9A 1ZBDA 4QNMA 2NPIA 3SU8A 4DDUA 1N33L 2YOGA 1FPMA 2UXDQ 1MO6A 1UEIA 2C8VA 2ZI4A 3QNUA 4M9XA 4B2LA 1XP8A 5KYKA 2IC5A 4AIMA 1Z6AA 1Y63A 1DAMA 4O2LA 4ASUD 2L15A 2JLZA 1B8AA 2ZYUX 1X6VA 2ZR7A 3B1ZA 4DR1L 1CU1A 4GFDA 4AYWA 2IF2A 2AX4A 1SKYE 4OX9L 1FJGL 1P2VA 1N6PA 2QM7A 3UWKA 2UU9Q 1HT2E 2WOJA 2MO1A 3ER0A 3PO2G 4TMWA 2CE2X 3MAAC 4OYHA 3W5OA 1XJQA 2OZEA 4JYCA 2E5LQ 4BBRG 3I4MG 1R0YA 3B82A 4P72A 1YJ9A 1AIPA 1OFHA 1US8B 1W4RA 3MWKA 3OFND 1GDDA 1QHHA 2PCFB 2NVYH 1S3GA 1SVWA 2LKCA 1M90C 1GVNB 2J3EA 3AV0B 3QXSA 4P4SB 4PFSA 3GTOH 3GTLH 1OFUX 1I94Q 1X55A 4Q19A 1N0VC 1WOCA 5C0XI 3S1RH 4HEJA 1KDPA 1IN4A 4M1OA 4JJKA 3CF0A 1XMOQ 4A4IA 4DDVA 1X6OA 3BU2A 4IDHA 4LK2A 1E94E 5JEEA 5L8VA 3MGCA 3T06B 3PUZA 1T8UA 1S9DA 4LF8Q 1RIPA 5CJ2A 1Q1QA 2YINC 2C9OA 1G3RA 3CPEA 3S14H 1TF7A 2OFWA 1P2SA 3BB1A 2R7ZH 4TLEA 4WZAE 4A3MG 5KOYA 4Q1CA 5IRCD 4BA1I 1ODFA 2Q3HA 4DRZA 4DV2Q 2G83A 4PPNA 1ZM4A 5DN6D 4JK1C 2B63H 5L3SB 1YKSA 3T1TA 2WIAA 4V0KA 2A9KA 2IYVA 1KQSA 1R7RA 2P0EA 1DPFA 2C98A 1MKHA 1D6JA 4LUOA 2FGKA 1BIFA 3T1YQ 3SQXA 3W5IA 1XJVA 2R6AA 1MOZA 2PI2E 2F1JA 4GLXA 4C0KA 5G3YA 5C1BA 1Y1VH 2JJQA 2W83A 1YHNA 4G01B 1Z2AA 3TR5A 4A82A 5F98A 4L8JA 2PX3A 2GTPA 2QA5A 1QVRA 3ZS8A 3K0FB 1HH4A 5C3EG 3V4FA 4E5UA 1EX6A 2OFXA 3FTQA 1JR6A 4XH9B 1D9XA 4KHZA 2LXKA 1KI1A 4LFAQ 4AH6A 1PLKA 1E2IA 2ZRPA 1R4AA 2VTKA 4P73A 1C7YA 1FMJA 1VMAA 2IS2A 5FL7D 1KJZA 2DUDA 4TSFD 3WNBA 4PHTA 2A6HC 2D74A 5EP3A 5E3HA 3HPQA 3K0AB 1K5GA 1R6BX 1T5IA 3AKCA 3L0PA 1S72A 3LAWA 3GD7A 2R9VA 4JI3L 3QI2A 1K6MA 3D4RA 4A93G 2WICA 3RN5A 5CIQA 2AXNA 4HB0A 1VQDA 1GD7A 1EX7A 1HEIA 1TMKA 2GJAA 5B2ZA 1GTVA 1IZ6A 3BIFA 1SN8A 5KSYA 2FF7A 3PUYA 1JQJC 1JMCA 5JI3E 3UWOA 3U7EB 1B7YB 1YZ6A 2LWIA 3AGPA 4A0HA 1PA6A 1SVKA 4JIMA 1NJGA 3EASA 3AVYA 4BZQA 3PO2H 5K8TA 3M6AA 5FUYA 2C77A 4TYNA 3AFPA 3RLOA 4BBRH 2D2CC 5AJ3L 3I4MH 1CR4A 3I5XA 4QKQA 2QTVB 1J99A 4RFSB 3G6EA 1VYTA 2FH5B 1SFOH 1AGPA 3IBYA 4LK1C 4POFA 2Z4SA 3VHLB 1OFTA 3WY9A 4B76A 1EQRA 1SKQA 2VP2A 1RVDA 2WAYA 2K5HA 3IKJA 1BO6A 1GKIA 3M0EA 4PAOA 1X86B 1NJFA 2NVTH 4BFXA 1RRFA 2ZRGA 2QPTA 1PLLA 4DUGA 2AMCB 1NVVQ 3IFTA 5AUOB 3K70D 5JLJA 5J40A 1NE3A 4W5JA 5J4KA 2ZYVX 4KKTA 3VR5A 2D2EA 3Q7PA 4A3MH 4DSTA 3C5CA 4NXNL 2MMCA 3GPLA 5AJXA 4JI0L 2QMOA 4DHEA 4PG3A 3SOPA 1CKOA 1KSJA 4A3DH 4DLRA 2BBSA 1JR3A 5BN3A 3H84A 2WSSD 1N5JA 1HR0W 3A0JA 1ZAKA 3KQUA 4HIOA 5ELNA 5A5GA 3KTAB 2WAXA 1VQ9A 3H15A 4KHPQ 2QZ4A 3LXRA 3KKQA 2GEDA 4KBGA 4BE7B 5FPKA 1QHYA 4G5QA 4B75A 3T1HQ 3GLIB 3LW8A 1K8GA 2DYKA 1PH2A 2DFNA 4CT5A 1KIMA 3PSIA 1P2UA 3K53A 2IHFA 3KJGA 1JEEA 3I2ZA 3CC7A 5C3EH 2RAPA 3CX7A 3U7FB 3I3SR 1OTCA 2JE6I 5JJIA 1QZXA 4M1WA 3RRNA 4BEBA 3ADKA 1LM0A 4G5SA 4RZ2A 3PUXA 4IJLA 3MWLA 2D62A 1DAGA 4QNRA 2AK3A 4WZBE 4G5RA 2QPOA 3BBPA 3O8CA 1DAHA 4V0OA 2XXAA 4C3IH 1HNWQ 4B2PA 2ASEA 3J80i 4AG6A 1DCZA 1CXZA 1TQ6A 2J5XA 1HJPA 4DR2L 1EWIA 1J5EL 2QRNA 3LXXA 2WJHA 2QTHA 5GADl 2XOKD 3KDFA 4GKKL 3REFA 4A93H 3KQNA 3R9XA 5B57C 1RRGA 5KNBA 3FHCB 1QHNA 3CRRA 4DV6Q 2AKAB 4JI7Q 1Y14B 3KB1A 1SXJB 2N1BA 2IW3A 2GN5A 1KXLA 1IW7C 1HTPA 2CFMA 1SQ5A 1U81A 2GKSA 4GLAC 4JLBA 1PZNA 2QGNA 1YR7A 2XB2A 1XMVA 5KNCA 3OTOQ 3SC3A 5DSZA 3FMOB 4A3CH 4B44A 3AEVA 4P75A 2J0SA 3UDFA 1GKYA 4M0LA 4OWXB 2ZJ5A 3C16C 4UKDA 4I1OA 2L5TA 1QVAA 3F5FA 4OHVA 2C78A 1HNXQ 4JKYA 1KAWA 1KAOA 4LWZA 3U4QA 4IFDG 3PXGA 4D26A 2FSIA 4LZZA 3ZD7A 1V9PA 1ELOA 2OM2A 3K0CA 2EU8A 2WWYA 5SZJA 1YJWA 3IILA 3KZ1E 4D81A 2IL1A 4L5BA 2PBRA 2GNOA 4BEJA 3AVQA 1M34E 2SHKA 1NKSA 1I3QH 3HKSA 4QC2A 3CIOA 3L7ZC 3B78A 5EXTA 3VU9B 5E7NA 4DR4L 1EFRA 1LF0A 1W46A 4DT1B 1KK0A 5KSOA 5C0XG 4AK9A 4EPTA 2MO0A 4CW7A 4R4IA 2ORVA 3TBKA 4RZUA 3Q7QA 3CRLC 2F3IA 2RHQB 3QKUA 4QRHA 3TK1A 6Q21A 1TWGH 1O78A 5EUQB 1VQIA 4ZCMA 3CNOA 2CLSA 4BECA 3EPLA 2WJYA 2WOOA 3HYTA 2REOA 2XJ4A 2X77A 4M53A 3I62A 3Q5EA 421PA 1N6KA 3JAMi 4YY3Q 3Q9LA 2VW9A 1IBML 2FX3A 2IYZA 3P26A 1OH7A 3A6PC 1EIYB 2F1HA 1Q8KA 4HUQA 5HCNA 2VP0A 4DV0L 2GCOA 4LJ8A 3UANA 5LD2B 1GKHA 4JI2Q 4NPSA 4RD4A 2N46A 3NBZC 2VP6A 3CWQA 3GLFB 1ANKA 1G6PA 3SFZA 5GROA 1IONA 2G3YA 2ZE7A 4TT3D 4B3SQ 2QAGA 3QG1A 2YWEA 4URWR 2ZUCA 1KC8C 4ILEA 1BBUA 4GKJQ 4MGZR 4LWCA 5IE8A 1N8RC 3IIKA 4HJ8A 4HLDA 2O8BA 3EZ6A 4HAUA 1F2TB 1N3BA 5CITA 5J3BA 2CK3D 1FTSA 1CFMA 1IBRA 2PI2A 4DCNA 1EFHA 2GJ8A 4X62L 2FNAA 3SHWA 2O5VA 1K8OA 2EIFA 3TQYA 3BH6A 4JI4Q 1HTWA 3CR8A 1KY3A 1G291 1IOZA 2OUKA 5DNYB 4MRPA 1FP7A 3N70A 1KKLA 1V1QA 1FX0A 2JLRA 1XRJA 5LB2A 1HR0L 1CBUA 4IPHA 1SLJA 1R5OA 3DM5A 5EAYA 1XCMA 1XNQL 2AUKA 4IXMA 2VP4A 1IJFA 2A3RA 3Q5DA 5ELOA 1I5FA 2ODNA 2Q2IA 1N0UA 1N34L 5JEAJ 3CCSA 4Q7LA 2B92A 3T1QA 3FHTA 1RW4A 2MNAA 2REXB 4IFBA 4AWXA 3I32A 1HCZA 4WIAA 2EFEB 2CBZA 4DIEA 2P67A 1IYJB 2KCCA 5IK2D 3H2YA 5M5WH 4DK6C 1XB2A 4OBEA 4DV4L 3LNCA 4B3GA 2OBLA 1PH4A 5LMNW 4IFDH 2JJ2D 4M1KA 1VQHA 2NOAA 1ONLA 3CCLA 2HF8A 3GTMH 1OXUA 3EZ7A 2VO1A 2IHYA 3ULJA 1AGRA 4PTLA 4AYBE 1KZGB 4Q4AA 3SJCA 4B34A 1CKNA 3RWMB 1X65A 1ZD8A 2I1QA 4C3HH 2JLQA 3B5JA 3MRSA 1FZQA 2HJGA 4MDFA 4Z51A 4LF7L 2K5VA 3GEEA 1GRQA 4W9MC 1KI9A 3F0TA 5C0XH 3OZXA 1EESA 2AK2A 1W0KD 4P32A 1ZU4A 4R4OA 1IBKQ 4BLRA 1DGSA 2AR7A 1CR0A 4L4UA 5IYBG 5DYGA 1ESMA 3UXMA 2X8AA 2ZRNA 3OIWA 2W6ID 2ZS8A 3T1VA 4LUVA 3X1XA 2JXMB 1KDOA 2CQOA 3PGZA 3A1UA 1J6QA 1TWHH 2QAGC 2ZUBA 3O8DA 5KDDA 1YU9A 4JL5A 4MUBA 5EQTA 1XMJA 3FB4A 3PR1A 4C2MH 2HT1A 3RR5A 1LS1A 1PMRA 5TMPA 3RS4A 2ZI9A 2QQ0A 4V02A 4EFMA 1DAIA 2EFDB 4Q4HA 2F4VQ 2AHOA 2YKGA 1AKEA 1VQLA 5IP9G 3IIJA 3KOJA 2WJVA 1EFTA 2FPKA 4FXPA 2CHVA 1N6LA 1ZM9A 3MLEA 2HCJB 3NH9A 5AJZA 3TRFA 3QBVA 3AKYA 1N6NA 2PPBC 1PH5A 1NIJA 4Q9LA 4C3ZA 1CKEA 1Z0AA 5AJYA 2IUUA 3B8HA 1QZHA 2QNRA 2VLIA 4Y0AA 4ZI2A 2ZM5A 1WCV1 2HIXA 2YTVA 1ZNYA 3C14C 4NCJA 5H1YA 2VQSA 1G3IA 1W47A 4GOXA 3RYTC 3CWZA 5J4VA 5DIFA 4OGQC 2HHHQ 2V55B 4LJ9A 4WXRA 2P5TB 1WA5A 5JWOA 1KSHA 2OILA 5JSZB 2NZJA 5KSZA 4CEHB 2JEAI 1T9HA 1Z6YA 2PZFA 4H02A 2RGXA 3ICQB 2JA9A 3F2BA 4P33A 3DVLA 3AVXA 3B13B 1LS6A 2ID0A 2ANBA 3KFVA 2VH5R 1WFQA 4O2DA 4Q48A 3CUEF 1R0ZA 1NMXA 1UJ2A 2ZJ2A 2WV9A 3KUDA 4KXFB 3W34A 4A4DA 2EW1A 2KENA 121PA 4DAYB 4LUCA 1X8KA 4DCTA 3S15H 1XZPA 1Z2CA 4URVR 4IDQA 4ZKDA 2RHMA 1SVSA 2WKQA 5FOSA 2ZU6A 4DDWA 2ZAOA 1KI4A 2ODBA 2W2XA 1E96A 1M6NA 1VECA 1VQ7A 5BYKA 1BDOA 4FCWA 1KK3A 2VL6A 4AG5A 3S1MH 1LTQA 3T5GA 2QT0A 4F92B
chains in the Genus database with same CATH superfamily
2AQ8A 3GJTA 4MXDA 3ESZA 3ZH2A 4BUJA 1P9NA 2FP3A 1Y9EA 3NEMA 2W8BB 1ESEA 3QE4A 4JLDA 2OORA 4L8YA 4P22A 1JPJA 2HTFA 1SUSA 4G0ZA 2PS9A 4ND4A 3QXXA 4X97A 5E1MA 2VDKB 4B3MQ 1FSFA 1H85A 4OHFA 4ZPXA 2QSJA 4RGYA 2JEOA 2V6JA 4AUKA 1JAHA 1QUQB 1ZM3A 3D6TB 3NLLA 2ZUDA 1E3JA 2P9CA 2HUNA 2PFKA 1BMFA 1NBMD 4GKVA 5BQ3A 3RABA 1Z7EA 2EJVA 3UDIA 2A1UA 1R0BA 1KYYA 4IUBS 3RV3A 2Y0BA 1Z6ZA 3VI4B 1NHWA 1R6UA 1FSSA 2ZI3A 1IKMA 4QPNA 3U5TA 5DM63 3JSXA 5BO5A 5KUTA 5DBEX 4L50A 3AIMA 1U9IA 1GRCA 3LLCA 2E9SA 3A2NA 4FFLA 4KLRA 1JPNA 2HQ1A 5CV4A 6NULA 3OAAA 5HFJA 1Z0KA 1ZD4A 4LBYA 1K6IA 2I5MX 3W2TA 3ROTA 2VWPA 2A1AA 1U3CA 4LX0A 4ACAA 3HYRA 4HS9A 3TI9A 4A3LH 3OCCA 3QOXA 5LC1A 1WYDA 4DL9A 5DDIP 4TTVA 4YFYA 4JNCA 3KJXA 4OA5A 1F2DA 2MUYA 1RACA 1X0XA 3IJEB 1GPDG 3COPA 3ADBA 4YRNA 5BYBA 1IY1A 3H9BA 1ORHA 5BR4A 1YHAA 3P7JA 3BXEA 1SCUB 1T1RA 4JCOA 1MV8A 5DJ5A 1WU7A 4BJ3A 3GGOA 2NU9B 4RTQA 1VJDA 3ZD6A 3WVNA 5CDFE 5E2IA 3WGZA 2RDHA 3QEBZ 1XYGA 2BJWA 4I1YA 1KAEA 4A0FA 4GBMA 3LY5A 3N5CA 3L8GA 4WJZA 1CUSA 2PIAA 1LVHA 2W6ZA 3OM9A 3AJDA 1G7RA 4OX9Q 1FJGQ 2QI9C 4G25A 1TF2A 4B0PA 2DEUA 3NNSA 1VHJA 2ZRQA 3QOJA 4RVUA 3RGWS 4KKVA 3EA5A 1PFBA 3MCTA 5CFQA 4TMXA 3RVSA 1DS6A 4EECA 2R7ZB 2DFKB 1R5NA 2RAVA 1D2BA 1FSZA 3QE0A 2X9GA 1YMVA 2NO0A 2JIDA 4LGYA 3U37A 2NG1A 5FV4A 4TLBA 4NJOA 2REBA 3DWPA 3OCVA 2FOXA 5DBOA 3GTQH 1U0GA 2CNKA 3I1YA 4A3DG 1UADA 2O4UX 3E9IA 5IFKA 1YAJA 2P2DA 1U2DA 2EGGA 1N9GB 1YMQA 1E9BA 1VZ3A 2EPBA 1HE1C 2R1TA 1UE1A 1EY7A 1D5ZC 3AFNA 1NMZA 4WHMA 4Z49A 1JG6A 3RS7A 4GQAA 3NYIA 5KNDH 3HKBA 1FFHA 4FZ3A 5C34B 1SELA 3RARA 3NHKA 2GBLC 4JI1B 3OTIA 2RGUA 4R3NA 5ELXA 2FEOA 3QBEA 1ZIYA 3VHXB 1KQFA 3DLLA 1M0WA 3G1WA 1M1XB 1HZ9A 1E2FA 1OY1A 1LSSA 1ZN7A 2O4XA 3ITEA 1X1TA 1U99A 3WB9A 1TT5A 1V9LA 5C1OA 3C41J 2W11A 4AWBA 2C03A 2LSSA 3FNEA 1CVLA 4ENVA 1E1NA 1K83H 1IULA 3HKZE 2F0IA 1ZYUA 4KQIA 3BZKA 4X1YB 4TSFA 3ELWA 3UUWA 3O47A 4M0MA 1KJYA 1PH9A 1KDAA 5HW0A 1HXHA 4D25A 1ZOSA 1KO4A 4BBZA 4FOTA 4L9RA 1GV0A 4F87A 2GRUA 2OXRA 4B3HA 1W88A 4HMPA 5AVZA 3C4QA 3I6MA 1XAHA 2UUOA 4JL6A 1PHPA 1XRMA 4XIIA 3CC4A 1JKJA 2EZ8A 5IM4A 1NXWA 2VRWA 4C21A 2SNSA 2RJOA 1AT1A 3J81c 2P2CA 4WUVA 4XYGA 4HN7A 4OREX 3IFDA 4YWLA 4XA8A 4B6RA 5L3QB 4ALJA 3FCXA 4BXXG 1OFIA 4IKEA 1QIKA 1EY0A 1P7WA 3Q22A 2OBNA 4J4TA 4A6XA 2WSYB 5EKLA 3TSWA 4D9GA 2K6AA 3ONWA 3X44A 1KC1A 1EP3B 3LV8A 1P4SA 5B30A 2ECKA 3ZE6A 3PEUA 4LXHA 3ADOA 2I4NA 1W4LA 1GNRA 3J7A5 2QAJA 4K9SA 3OTHA 1NTGA 3KFXA 3DKRA 2PH7A 4UUAA 4LHYA 3CSUA 1K75A 3R5SA 4XR4A 4ZV4A 2DT5A 1QJOA 1L0XB 4R1SA 1ML0D 4PX5A 4TTQA 3P5SA 2YWRA 1XQVA 3INGA 3VHQA 4IOLA 2O5EA 3FEWX 1U3GA 3LKBA 3G4SA 2PXHA 5KS2A 4MYTA 5A03A 2I4RA 3KIPA 1X54A 4HIKA 1KFCB 1OH5A 1XDUA 4ABYA 1K8MA 1G5FA 3KEQA 3GLFE 1UDBA 3DUFB 1U5CA 1G41A 4JUBA 4F9GA 1DAEA 3D0FA 4H16A 3U60B 4GOND 4GWKA 4FGKA 1OF1A 4A0RA 4QY7A 1T9GR 1SCKA 3DL4A 1ML3A 2X1HA 3X2EA 3OT1A 2VT6A 2CUNA 1IBSA 3JU3A 4U673 3HB4X 4I65A 4GI2A 5C8YB 1EY8A 1O94D 4NG5A 4LWQA 4ZGGA 5AESA 4IDEA 3UJHA 4U4AA 4DPMA 2WA1A 1ETHA 4PZZA 1H6DA 3DWQA 5FI0B 2A68D 3FNHA 1IQUA 1XNHA 4MV4A 1R0XA 2YVKA 1C4KA 1PSWA 4ZEOA 1Z8NA 3I2FA 3PKZA 3UHOA 3VR1A 4A3FB 1QWSA 5C4IA 1ZG3A 1MENA 4OB8A 1QCDA 4LYDA 1TKBA 4M37A 5CPFA 2PWZA 4ZT2A 1KFKB 2DHCA 3PXAA 3OD1A 1O57A 4NW2A 3KD2A 3HCBA 3A6JA 4AN4A 2QUJA 5E4WC 2FX5A 4Q15A 3EGVA 5KC9A 4F4FA 1CUVA 4HHEA 3J81j 3D5TA 3ADPA 1DIBA 3SY8A 2XYGA 1GGKA 5EIAA 1WEKA 4INPA 4Q3NA 3IBCA 1SJ9A 1HFJA 3MGKA 1QE0A 3F5MA 3JALA 3UXHA 2X4GA 3CB2A 3NW9A 1OD6A 2JHAA 2VJBA 3ME5A 3LO5A 3IAYA 1HEYA 3VMFA 2JGFA 2AD5A 1A95A 5AKZA 2H1LA 2HQLA 1E2LA 2MYUA 1U8AA 1JJIA 2FUG1 3OTQA 1TC2A 4JN6B 2NTYC 4KFTA 3OZRA 3MJRA 3JQGB 3HEMA 2B82A 4HG2A 4PZ8A 2QV7A 4LXIA 3UJ7A 1NJ1A 4GLOA 4HEA6 1RMQA 1SJED 4CF4A 1EA5A 1QZ3A 3BZUA 4FC6A 1C9MA 3HHEA 2O8BB 4JLMA 4NXML 4L8VA 4HL6A 1UBJS 4BOYA 3RM3A 1U7PA 4KN8A 3U3DA 1P3DA 4O1MA 3KTDA 2V97A 2VNIA 2NN6G 5CIWA 4FE3A 3ESAA 3I8OA 4YCVA 2X1LA 5SZKB 1B15A 1GA1A 3L01A 3O1HB 4PSDA 4YRJA 2JLXA 3EJWA 5CV8A 4C2BA 5AI4A 2JFXA 4RYDA 1VC2A 1F2UA 2C3OA 4UE2A 1Y80A 1O97C 3DDHA 4CETA 1ILQA 2OWEA 3OD5A 3S2IA 2DN8A 2YZGA 4G7ZC 4UM9B 4HJRA 4UTXA 2Q2UA 2K7ZA 1WZ2A 2YJ6A 3EZXA 3TZHA 1CUZA 4MJ7A 1SC3A 2AR9A 1AUXA 2OVBA 2P0AA 3A5ZB 1WXGA 2UU9L 3R8FA 1Q3LA 3T16A 2QYTA 1CP3A 3QKSB 2K32A 3FKIB 3TSZA 1CD5A 2CDBA 3W78A 4DV1Q 3WSTA 6YASA 5LOVF 3ZHBA 1ZINA 4KLZA 2VB3X 1G2PA 5EIOA 1NI5A 3BIWA 1AB6A 3ULKA 4W5RA 2CNLA 1XEXB 4LWPA 3FOEC 4W9NC 5EGSA 3SXHA 1NN3A 1YTLA 4MRAA 1MSGA 3T0FA 3TSSA 2OBFA 5IHPA 2ZCJA 1XU9A 5FP0A 3S99A 2GEJA 5JSHA 4MUFA 1E7WA 1K73C 1BCSB 4JV5Q 2NZYA 1JEOA 3IAHA 4R4QA 1QANA 3PUVA 2D7CA 3KJQA 3P75A 5C46F 3WLIA 5DXFA 1ATIA 1XDSA 4I6JA 4NE2A 4D9JA 3D4PA 4QX6A 3A2LA 2BP7B 1GO2A 4G4KA 5JU6A 3E48A 2PM8A 3WXBA 3ORSA 4YPFA 1HOXA 3D0OA 4GN4B 5HIAA 2R93B 4GL2A 5F3DA 1ZOOA 3KFLA 5AOCA 3V8VA 4E13A 1EIGA 2JGLA 2CB9A 3BSWA 3PX2A 5BN5B 1GU7A 1W6KA 1G7TA 4M1WA 3ANMA 2QSUA 4M83A 3FH0A 1AS0A 3FUCA 1ECFA 1B42A 3HH8A 4RPCA 4NZPA 1L5OA 1Z8HA 1ZH2A 3J7AC 1SIUA 1Y3CE 3K9LA 2QXYA 4J0KA 4FQ5A 1HR0Q 4IUDS 4UMEA 2RGGA 1NJIC 2QL5A 1V8DA 1DUSA 4CR7A 2WV6D 1UPAA 1KH2A 2Z09A 5E0OA 5CFPA 1X15A 1O5OA 3DAFA 5I7VA 2H3EA 3IAM1 4J8PA 4BX3A 4DR1B 3T3PB 2EP5A 3KD3A 3PICA 5FPYA 4A26A 1GZVA 3SVLA 1YK1A 4EO9A 2FN4A 4PNHA 1T1EA 3DHQA 1GNVA 4JI2L 4U39A 1NR2A 4O8CA 5I9PA 4WASA 3T38A 2QU8A 1N32Q 4K9KA 3DV2A 1VQ4A 3MEFA 3H1BA 4I50F 4L8LA 5J9FA 4KUGA 1EYGA 1XVLA 4ZJUA 1XMOB 4KAXA 1GA6A 2B39A 2PTHA 3EGDB 5KDOA 1VF7A 2UV8A 2OZLA 1JR4A 4BMPB 2L82A 1Y89A 4OKNA 2DG2A 1T9GS 5A62A 4JIGA 2OQ0A 1VCHA 2Z0MA 1RPZA 4M36A 1QF7A 2JFZA 1OKKD 3IDFA 4LVNA 2YBDA 3VPBA 1AUQA 1O8BA 1P7CA 3RKRA 3WJ1A 1AHPA 3PHHA 3G17A 4OXYA 1FS6A 3IP8A 3AM5A 1TTTA 3WNQA 1PHJA 2V8BA 3QF4A 5BT8A 1P2TA 3M3HA 4M7RA 3ZYCA 3JV7A 4US0R 4QJIA 2PUGA 5DASA 1U2GA 5EKSA 3KJFA 4ND7A 1J42A 1SNDA 1ZS9A 2GVNA 4NZ9A 2PJZA 4RGVA 3DE5X 2VPWA 4LQDA 2H18A 4D98A 1H8HD 3UPTA 3PUJA 3DVQX 1F48A 1JGTA 3OLZA 2GT1A 2ZWMA 1O1YA 3LA6A 2WKRA 2NV0A 1D1TA 2R8ZA 1M2KA 3V4ZA 3QRWA 4Z54A 3A28A 3CFYA 3DWFA 1HG0A 2PNFA 1T3LA 2HXGA 1XZLA 3UJ9A 2WUFA 2MDTA 3DNMA 1WW3A 3DV0B 3UW3A 1WBBA 4OJYA 1MOPA 2C88A 3GG9A 1BEEA 1GZHB 1DJPA 1SCAA 4YA6A 2AG6A 1NYQA 2B4TO 2HX1A 3U49A 5IH7A 2OBXA 1CLUA 4DV5Q 5GGXA 3E9EA 2EP8A 3S8MA 1V8ZA 5HA5A 4C3JG 2AXPA 2JIBA 2QBYA 2YRXA 1EXNA 2X4DA 1WB6A 2WMDA 4JVMA 2B2YA 5ADHA 1XMQL 4UVGA 3G5AA 1K88A 2IIBA 2WYVA 5FOVA 4KDFA 1S3SA 4CPDA 1O7IA 3P0EA 4A27A 1V47A 4MULA 1HT0A 1ZK0A 3K5HA 4DGSA 4FX2A 2V4MA 2BFAA 5JJ5A 1JECA 4RVDA 3EXG1 4ZAIA 3NRJA 4RQAA 1JBQA 3V1YA 4ESHA 1XJCA 4ZVRA 1ZNZA 2C4NA 4AMGA 5D14A 3TRZA 4K6FA 3R76A 1HWYA 4KU4A 4V1CA 2J3LA 4JBWA 4I1SA 3X2FA 2YHSA 4H7JA 3D0QA 2PKCA 4GYJA 1V2GA 2CUZA 2H1CA 4X41A 3AB9A 1AHIA 4I0WB 3GLQA 2J33A 3TZUA 1GUBA 4GL4A 5J5VA 3RS0A 1RE1A 2EW8A 4FJ1A 2VKTA 4BZPA 3P2OA 2LDXA 3W2GA 5K0TA 3IQGX 3V4LA 1BA2A 1SUCA 1EUDB 3NJRA 4M54A 1SHZA 3MA0A 3F1ZA 1ZA1A 3JQAD 4TX1A 2B35A 5EKXA 4E7PA 2YUTA 4HB4A 3J81k 3BGIA 2ZR0A 5KJEA 2ZWOA 3ZJ4A 2J9RA 3RU9A 1F7UA 3KXIA 1YEZA 4O2BA 4GC9A 1LPNA 2IC5A 1Z6AA 1B8AA 2RBMA 4RTRA 2XYQA 3U7RA 3ER0A 1UEAB 4OYHA 3GL9A 1AIPA 4I2NA 4D9IA 2PCFB 1Y1TA 2Z6QA 1X7XA 1WOCA 2EXZA 1G42A 1FUEA 4DDVA 3OIFA 1OWMA 2CT8A 1E94E 2VHVA 3T06B 1T8UA 1Z4IA 1W85B 3AEUB 3VSBA 3EFOB 3G8AA 4AM8A 3SK6A 4JK1C 4MUIA 1YKSA 2IYVA 1R7RA 3AOEA 2H29A 3UKJA 4P92A 1MH9A 4PIVA 4GLXA 1V4NA 3N74A 1W9MA 3V46A 4PHTA 1K5GA 1JOKA 1U0SY 4WXMA 2OXIA 3C4VA 3C1AA 1RAEA 3RN5A 3TLGA 1VQDA 1TMKA 2GJAA 2LTAA 2FF7A 3NQTA 4G4SO 4EHFA 4BZQA 2FSUA 5AJ3L 1AG9A 1T0IA 3WKBA 5KTOA 3VHLB 3TYXA 2PS3A 2NZXA 1XN1A 1YUMA 4HGNA 5D8DA 3N2LA 3PGA1 4DSTA 2QMOA 4DHEA 3RIYA 1CKOA 4A3DH 3MC0B 1UOQA 2A1IA 4CMEA 3UWSA 4KD3A 1Y6ZA 4QQKA 1QHYA 5LP6A 3HZHA 1KP2A 3I3SR 2JE6I 2LD4A 3KPVA 1L3CA 4C6SA 4GECA 1I5RA 2W2QA 3R6GA 1EY4A 4MUGA 4PLZA 1KPIA 4CCWA 1SWWA 2PL9A 1TQ6A 2QRNA 5IASA 3QLVA 3W6ZA 4A93H 3Q6NA 3FHCB 5ICSA 3X0DA 5KNCA 2A86A 2C97A 4UKDA 4WACA 4ZQCB 4KNYA 3TXYA 1NUAA 1QJCA 1K27A 1UBHS 5IG2A 5EXTA 1I3QH 2PNJA 3PDCA 3SK8A 2VF4X 3D4DA 1GEGA 4K0RA 4C78A 2WJYA 2IRWA 2REOA 4G1CA 1RP7A 1XZBA 2C4KA 2IYZA 5BWLA 3AUKA 2GCOA 3KHSA 2P11A 4NOJA 3SHQA 2C2MA 3B53X 3MTSA 2IBTA 3ZJVA 1B4OA 4XVHA 3R5TA 5JY1A 3Q2OA 4D8WA 3BH6A 1HTWA 4RHCA 1KU0A 3WGLA 4KO4S 4OIFA 1LTID 1NULA 2A3RA 3MS7A 2REXB 4IFBA 3TEJA 3EF1A 5B3AA 1A96A 5M5WH 4JB0A 5L6MB 3WIDA 3TKYA 4R8SA 1JKFA 4AYBE 1ZD8A 4TM7A 3MRSA 1JS1X 2F4IA 4MOWA 1JMVA 4O5AA 4YJGA 4JH0A 1NNXA 4LSMA 1ZJYA 4A7PA 1KDOA 3ZOKA 4P98A 2ZJ0A 2ZUBA 5I5GA 4M7PA 5JZ9A 1FNWA 4KRGA 4NJMA 4CNBA 2ZUTA 2WVGA 2PK3A 4XGNA 1S7GA 2ZGVA 2VNJA 4EX7A 3CX4A 1ZSYA 5AI6A 1B3AA 1DO8A 5J2UF 1NIJA 1COZA 2IXBA 2WUVA 1IJKA 1VRCA 4ZI2A 4QZVA 2UDPA 3HUFA 5JSUA 6REQB 2HHHQ 4WDRA 1D1QA 4I5DA 1C41A 2CMHA 4DCTA 1Z2CA 2HPZA 2RHMA 2WKQA 3EYAA 2F64A 3S1MH 3RZOH 4AY4A 2QT0A 4KRYA 4YCBA 1ZGJA 4AMVA 1ZXXA 2ZB2A 4RH0A 1YZYA 4JOQA 2I7CA 2HRCA 1GKKA 2GHIA 3C1EA 4DR2B 5LMNL 1QH1A 4P0PB 4EUEA 1QV9A 1XRQA 1RC1A 4A3LG 5KOHA 3GJ8A 1JXAA 4YJ2F 1XNJA 2CCJA 5E6SA 4UPVA 1YS2X 1IBLB 1H2RS 1YQDA 3DL0A 5CVJA 2FMKA 3MLBA 2HQBA 2GXQA 3ESRA 3TTSA 1K4KA 1KYVA 3C8MA 2EFHB 3RDPA 5CV5A 1K3TA 3EXHB 4JB8A 1JI3A 1N7IA 4JBYA 4L95C 1TAGA 4UQPA 3TLKA 5AVVA 3N2EA 4WNAA 2O59A 2Y1XA 3KKNA 2JJ1A 3SVZA 1MN6A 4E5MA 5GV8A 1UP7A 4BMSA 2PQAB 1X56A 3DLIA 4BIIA 2BEVB 1PZID 2CMFA 4P2CB 2A88A 2C2HA 4EEXA 3WNBA 3LTEA 3AP2A 4WEQA 1E2QA 3G2KA 3M4XA 3UMYA 5BW6B 2RCNA 1ODLA 5E7JA 2R6R1 3TVYA 2N0SA 4K5XA 3T56B 1VL5A 5T8KA 1LV7A 1NVAA 2PKQO 3I73A 2P1RA 2E75C 1RXSA 4QBGB 4WA8A 3PHBE 3K9HA 3IQEA 4OGKA 3IALA 5FO8B 2EJBA 4AVYA 4TSKA 4GI3A 4EUKA 2D0IA 2YFHA 3SMVA 2LVBA 4MPPA 1VMCA 2ALYB 3G1UA 4DB4A 2R8XA 4EQ6B 4EUNA 3WOEA 5P8WA 4DLSA 4BN5A 3B12A 2VI5A 1BGWA 1B74A 2Q5CA 4ROSA 3ROQA 1K7CA 3EDOA 3CW9A 4X64Q 5EZ5A 1T9CA 1RODA 1R6TA 3OIQA 2F1RA 2GDJA 3THOA 4YJFB 5EJAA 5FTMA 5JZOA 1B1AA 1L8QA 4B0OA 1G2QA 3GGJA 3D4IA 1YR3A 4S1VA 3F9CA 4AU1A 4B40A 4HTFA 2F62A 2P4UA 3DAGA 1EXDA 3LQ1A 5F7JA 4B2YA 1CZLA 4BRSA 1TQ8A 1TZKA 1Z26A 4G6ZA 2CFIA 2EC5A 4QEZA 3RC1A 4EYGA 2I67A 3CURA 4IDBA 3R8XA 3AHJA 3RMHA 1SRRA 4DVGA 3KSMA 2VYNA 3BREA 2ZJZA