3PUZA

Crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
total genus 88
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puzA01
2IYYA 4XWKA 3SDZA 721PA 2FGJA 4NB3A 5EAYA 4KYIB 4MH0R 3ADDA 1NIPA 4LYHA 2HYIC 3FYHA 1L4UA 1YQTA 2A6HC 5IYDG 3ONWA 2R9VA 3CRVA 4RCZA 4LF8Q 3SYKA 5FR1A 3KDFB 1NVXQ 2PMDA 5KNCA 1KAOA 4OQMA 5JHGB 3NH6A 1K9MC 4BY7H 3MUFA 2Q0HA 2VHTA 1CF4A 4F4CA 2B63G 4GNXC 4K81B 5SZKB 4H9GA 3ZS9A 1NMZA 2CVHA 1QUQA 2PH1A 2REOA 4N3NA 3DM9B 5F2EA 4DKXA 3D0FA 1FX0A 1CXZA 3FTQA 4DV4Q 1N0UA 1Y8PB 4GKJL 3G71A 3UDGA 4GOPC 3L8ZA 4ZCLA 3G48A 2QTHA 4A3IG 5CK4A 2CDNA 3LXRA 2CK3D 4P3YA 5FL7D 5FUVA 3PO3G 2WBLC 1FUUA 2DFNA 2F1JA 4DEYA 3GLFE 3DPUA 1JB1A 4Q4HB 3LV8A 2VP2A 3CPWA 4A93H 3A5ZB 1G8HA 1KI6A 1KI3A 3ZQ6A 1RRCA 1OH6A 1J8YF 4A0FA 1DG1G 5HR5A 5IYCG 2V8OA 2K50A 3A0JA 4MITA 1BMFA 4B75A 3T53B 4L8GA 2QMOA 3WBKA 3U7HB 1JR6A 3SEAA 2F55A 2YNMA 3AVXA 2BCJQ 2F9MA 3DKVA 4LV8B 4V0MA 5DO9A 2CCZA 2QTFA 4PSKA 3WNCA 3LAWA 1Y1WG 1TF2A 5FOXA 4BZQA 4GZYC 4D4LA 4IDPA 2A5GA 2F1IA 1M7GA 2J0SA 1US8B 3DMNA 3X1WA 3LW7A 4GMDA 4JMPA 4JLNA 4GKKL 2OCYC 1ETUA 4PHGA 1TU2B 3QXSA 3W3ZB 1Q81C 5EP1A 5EXPA 3DVLA 3SOPA 4KV9A 4C7OA 3RS0A 2IYZA 3Q3JB 4C0LA 1UAAA 1TADA 3A1TA 4OJKA 2P65A 1EX6A 3IHLA 2ZETA 3AVQA 5TVKA 4LC0A 4O3MA 3TSZA 1VECA 3HOZG 1J2JA 4GBMA 1E1TA 2O0KA 4Q1BA 1N32Q 1DXMA 4A0RA 1OF1A 1SGWA 3OW2A 1Z2AA 4PO9A 1P7CA 1BBWA 1IY2A 2WPDA 1UE1A 4RFSB 2IS6A 5BW8A 1E99A 1LTLA 1XMVA 4NPSA 2JJ2D 3M9BA 1MR3F 1XTJA 2D2FA 2D0PA 5AR1A 3CC7A 2KHIA 4B6FA 5FPKA 2JA6G 3KF6B 2GVDC 4EJSA 5J4KA 5GAGC 1BMFD 2NVXH 3DMDA 2AFHE 4FMDB 4LCBA 4O2LA 5JRZA 1CKNA 1JAHA 2H57A 4KCGA 3T1YL 4GLAC 1Y1VG 1CBUA 1HE8B 3CMAA 4ZDJA 4GNXB 1RL2A 1YKSA 2RHQB 4IDOA 1V1QA 2E5LL 1YVDA 4QL3A 3AVWA 2E75C 3W8NA 3AUYA 1A4RA 3LGJA 3H15A 4XD7D 1R5NA 2FA9A 4JYBA 2RGBA 4PC6A 2CFMA 3H3VH 5BN3A 3S16H 4GOPB 1SVKA 2ZI6A 1DEKA 3CX6A 3EARA 1DVRA 4BFTA 1R2QA 4KFRA 2JK8A 3PENA 4Q00A 4GOJA 3JAMc 1VQHA 4JS0A 5L3RA 1KI8A 1W1WA 2PL3A 1WYDA 4GZMA 4HLUC 3RS7A 4AWXA 1W36D 4EFNA 3IIKA 4DV1Q 2EU8A 4GRAA 2CQOA 2IK8A 2ES2A 3K0EA 2PNRC 1XTRA 2XEXA 1T3LA 5EJEA 1VQOA 2ZR7A 4AKHA 3IFTA 4LF6Q 1R8QA 1XD2B 4M4SA 4QJ3A 2QMHA 3CF0A 3MAAC 3FP9A 1XMOQ 5B58C 2GCOA 3GLHA 5EUQB 4PG3A 1N33L 1IXRC 2VP6A 1DCZA 1X3SA 2C8VA 4MDEA 2GCPA 2EDGA 1VQ7A 4H0LC 5EXXA 4NCHA 1YNNC 2E2JH 1T5IA 5GVRA 2QQEA 2V1XA 1I2DA 4FXPA 3PJRA 3FPAA 4B76A 1KHIA 3CPFA 2RB4A 4GI7A 4TT3A 3P20A 4LDJA 1UWVA 4V0ME 4B33A 3F5FA 2NO1A 3A4LA 2CLSA 2I4IA 5JFGA 1WBDA 1FJGQ 4JZKA 1HNWQ 2GN5A 2VPPA 4JVSB 4LJYA 3F8TA 4M1MA 3T06B 4URVR 4G5SA 4LFBL 4CIDA 1Z6YA 1QVAA 1AQYA 1I6HH 1G7CA 3GLIE 1E3MA 1Q90A 1IN4A 1GNQA 1P2VA 1R6BX 2WWWA 3T1TA 5BYKA 1LNZA 1TQ6A 2XOKA 4TL6A 4R98A 4LUCA 1ZU4A 2UUBL 1YRBA 5IK2D 4X66L 1QHXA 3AGQA 4NXNQ 2JLSA 2NZJA 4KI0A 1GL9B 1U0HC 2Q9BA 2C98A 1UF9A 3CCLA 2OBLA 4IJLA 1LM0A 2HCBA 2N42A 4TMKA 1TKWB 2R6AA 3DHWC 5HKKD 1X9NA 1Z6TA 4QGFA 4NKRA 2LKCA 5LB4A 1GVNB 1XXHB 3WNDA 4KODA 2WSSA 5CIQA 1E1OA 5M5XH 1R9TH 2D7CA 2VP0A 3QPUA 3NTUA 2O8DB 2HIXA 2ZUDA 1TMKA 3RR5A 2H18A 1IONA 2OCPA 1RVDA 2FXQA 3EA5A 3I5XA 1VQFA 2XTIA 5C44G 3PO3H 1WE2A 2QTVB 2VHJA 1L1OA 2C9YA 4E07A 2HEIA 3K70C 1CTQA 1O87A 3AF3A 3MD0A 4UP7A 1A1VA 2GJ8A 3FGNA 1JBKA 3K81C 4TLAA 3EZ6A 3UATA 3U44A 1YHQA 3GTPH 3BERA 1CIPA 3GJ5A 3OEEA 3O8RA 3HKSA 1YR9A 5C4MA 4LF6L 3WRXC 1HNZQ 4MA4A 4Q47A 2H92A 4AK9A 3W90A 2K75A 3AFPA 1NMXA 1P9RA 3T1YQ 2NOAA 2X77A 2J0VA 1NVVQ 3U9SA 2XZPA 3H84A 4TSFD 3HKZE 1IJEA 2ODEA 1W5TA 4HJ5A 2A69C 4RSGA 4B3DA 1RPZA 1SXJB 2A30A 4OWTB 2R6FA 1JR3D 1Y1VH 1P2UA 2Q6TA 4KKTA 2QPOA 2ZYUX 4YHHL 4X64Q 1Q82C 2UUCQ 1P9NA 3HKZG 5IP7G 3D3QA 2IS2A 2OCEA 2GXQA 1D2EA 4KLZA 4OKSA 4Q1AA 3U5ZB 3C4JA 2D2EA 421PA 1OFHA 5CITA 4ESVA 5J4HA 4QNRA 4GFDA 1RIFA 4E03A 2RH5A 2JXMB 2ZITA 4NYMQ 4TQAA 1XP8A 2JJ1A 4Q4JB 4DCUA 1DAMA 1M8PA 3QJYA 2AMCB 5IWAQ 4RKFA 4R4IA 1WQ1R 2PI2E 4QY7A 1JEDA 1VQPA 2RAPA 4M0LA 4EPWA 1Q1EA 5SZHB 4CYMA 1WB9A 2IWRA 1FFHA 3TW8B 3ZVLA 2GZHA 1BBUA 4AKGA 2ONKA 1FL0A 4MRVA 5J5CA 1UKEA 3I4MH 4YY3Q 1HZCA 2R7ZG 1MH1A 3FHWA 2XB4A 1P72A 3OHMA 4UNNA 1SRUA 3AEZA 4DB2A 4DUZL 3T51B 2Y8EA 1AGPA 1ZNYA 1OTCA 3KFXA 3E70C 5JWRA 4IFDG 1ZUNB 5JS8A 2B8WA 2FFHA 1X1SA 2QQ0A 4RFSA 3PF4A 1JXOA 2HV8A 5AUQA 1GNRA 2G77B 1Q3HA 3WWVA 3PUVA 2WSSD 1Z28A 3PG5A 3QEOA 3RS3A 2BC9A 3FMOB 5JSZB 4H02A 4H1VA 1WA5A 1VIAA 2R8RA 2G1JA 3I56A 2IC5A 2R92H 4KSCA 2LXKA 2OFOA 1UE6A 5E7MA 6Q21A 5JLJA 2VO1A 1KSGA 1M7BA 4IOCA 2D74A 2JQOA 4A4IA 2QBYA 4D25A 1LW7A 1BO6A 5JI2E 2O8FA 1AE2A 1VQ9A 2AWOA 3M4QA 1ANKA 1OIXA 1NN5A 4PMWA 4ZDIA 4POFA 3QKSB 5FPTA 3W9YA 2BA1A 4DV4L 2OG2A 4GKJQ 2VQFQ 1EGAA 2XNDD 2O8CB 4S2EA 2VIIA 521PA 2LXJA 4BXXG 1FTSA 3T34A 4JYAQ 1QVGA 1OT3A 1BH2A 3OPOA 1G3IA 1H9JA 3GDEA 1KK1A 1HNXQ 1YR6A 3HU1A 3MWYW 3EQLC 2YWHA 3NHBA 5HE8A 3VTKA 5GVSA 4B3FX 1RYFA 2ZE5A 3TAHA 1MV5A 3IDQA 4IKEA 4Q7MB 1KI9A 1W5SA 2NO7A 3AF1A 4JCVE 4LFAQ 4PZ7A 4P0TA 1VYVA 4OHYA 4LV5B 2OBMA 2D06A 5F9HA 3SGIA 3PO2H 5JWOA 3AVYA 1SVIA 4LFCL 2E1RA 4G7OC 5CM9C 2R6CA 3GD7A 4D0NA 3J80c 5IT5A 4Q9HA 2JLQA 4UPAA 2H5XA 1TU3A 1QHSA 3QKUA 4A3KH 2DFTA 1KMQA 2HJVA 4JT2A 3CCUA 1D8LA 1D5CA 2DCUA 3TJZA 3MGCA 4UQOA 4CEJB 1BKDR 3PCOB 1ZP6A 4YHHQ 2UUCL 2N46A 1Q1QA 2R93H 3EZ7A 2Z6KC 3IQXA 3CRRA 3HOWH 4BY1H 2HHHL 2KA7A 1QHHB 3Q5EA 4O2DA 2ZR9A 4A1FA 1K8GA 2GK6A 2MMGA 2REXB 4QOSA 4JVMA 4JBWA 4W7SA 5KTYA 5KYKA 2E8GA 1RIPA 4C0QC 3VNUA 1E2EA 3RLFA 1DD2A 3IHWA 4ZCIA 4Q9IA 1U9IC 1M90C 3TSOA 1MIUA 1NVWQ 1F2TB 2H5EA 3FWYA 4EJSC 1HH2P 4J15A 3ND9A 2IYWA 1XJQA 621PA 5LDDC 1GFIA 4LJZC 4IPGA 4HAZA 4D6PA 3GLIA 1P61B 4DSOA 4JLPA 4ABYA 4IOJA 3BJUA 1PVOA 4KJZA 4Q4HA 3U3JA 3RC8A 1X3EA 1K0RA 5AJ3Q 1KI6B 1O7LA 1LS6A 4Z1MA 4GT1A 1OE0A 1W4CA 1N8RC 2FGKA 5SZIA 4I7ZC 2CNWD 1Z0AA 4JL8A 1ELOA 1G51A 5FLMG 1M1YE 2AX4A 4C2UA 4A3DH 1C7YA 2WP8J 2AUKA 1E2MA 1FZQA 1FUKA 1XXHE 2GF0A 4NU0A 4AC9A 5JRJA 4JI8Q 2IS1A 1H8EA 3BH0A 3QPWA 1CU1A 5A35A 4DB4A 4AYBG 3QIAA 1VMAA 4OHXA 2IYLD 3MJRA 3ZVNA 4MQBA 3WMFA 3U4QB 3HOZH 2VQEL 2BMJA 3VKWA 1JEEA 5HY6A 2CE7A 5FTLA 4NP6A 3S1MH 5FOWA 2J7PD 4DR7L 2A8VA 3I7FA 1WI5A 2EYUA 3G82C 3VU9A 3NBHB 3GTGH 5JJIA 4I1SA 5K8LA 1PUIA 3BC1A 4RG1A 4DR1Q 4JC0A 1MABB 3FOZA 2W58A 4JSYA 1E2GA 2DPXA 5GROA 3ECCA 4NL4H 3AVTA 5AUNB 2XTNA 5FPYA 1QRAA 1NBWA 4ZDKA 1QVFA 1OXXK 3UMRA 4D4JA 3RAPR 1T5EA 3NDPA 5CJ2A 4NDZA 5JJKA 1IXRA 2BM0A 3L7ZC 4RJLA 3CRLC 1NY5A 3B1YA 2D0OA 4B3XA 2KSQA 3PIPA 1FQKA 1P60A 1AK2A 2FMXA 2A5YB 1XEWX 3BS4A 4JLBA 1GUGA 5FL3A 4A3BG 3M1IA 3QVVA 2DWOA 4D82A 1IW7D 1R0XA 1J99A 4DIDA 1Z0IA 3IBGA 2BKUA 3TRFA 1XNRL 1N6KA 4CF7A 2PEZA 3EZFA 3WBJA 3I61A 3AKEA 2KCMA 2OWOA 1U94A 2UVQA 1VCNA 5BN4A 3G6EA 2FOLA 2GRJA 4OI4A 1SVWA 2WMNB 3CO5A 4AKEA 1BOFA 5FTKA 5FLXc 2J1LA 3CRMA 5CDFA 1L1OB 2ZTSA 1ZAKA 5IWAL 1Z0FA 1E4YA 1X1RA 5KHOC 4U7DA 4PZ6A 3EC2A 4C0BA 1XJ0A 2QA5A 1VF5C 3AP2A 3RC3A 2VNUD 1BYIA 2QUZA 2PT7A 2IXEA 2JASA 4MRRA 4PO8A 1E6CA 1LUZA 1E79D 2R65A 1KDRA 4S35A 4PV1C 1VTKA 2CL0X 2JAQA 1AKEA 1KQSA 3OAAA 3X1YA 4B44A 4B3SL 3CB4A 4GOKA 4K0KL 1FP6A 3B1XA 4WJ4A 4JI2L 2QF7A 3F2CA 4EFMA 3MLEA 3BBPA 4LPSA 1HA3A 2O52A 5KSOA 4JVNA 2BM1A 1IBKQ 1JXMA 2ZJYA 1YJ9A 5C18A 4ARZA 1ZC4A 1JJVA 4A3GH 2UXDQ 1X6OA 4A6XA 4LI0A 2VP4A 4BA1I 2PMZE 4TL8A 5GADC 1SXJA 1AA9A 3LXXA 2WWGA 1GKYA 1OXSC 3QVUA 2PZEA 3LLMA 3K8YA 1NTGA 3EIEA 1K8OA 2VTKA 1Q20A 2ZSBA 4MKFA 4LBVA 1EIFA 1JJCB 2GCOB 3E1SA 5ANRB 8OHMA 1IOZA 1W4AA 2ZJBA 4E09A 2JLYA 1N6PA 1U9IA 3QKSA 3I8SA 4KU4A 4D0LB 2QM8A 4NCJA 3I1FA 2GEVA 3AF0A 1ZBDA 3K7UC 4LUVA 4O0AA 1MRNA 1ZM3A 2EFGA 3B8HA 4AKIA 4QC2A 1I2MA 3LBHA 3DDCA 1Z5ZA 1TEVA 3K09C 5L3VA 5FOSA 1K5GA 1IN7A 2V7QD 1JJ2A 1ZUHA 1K8RA 2QMEA 2J0UA 1GZSA 3JZAA 1EIYB 4Q7LA 1V43A 4URWR 3CBQA 3S1NH 4RZ2A 1F6BA 1G6PA 1II8A 4PQRA 3DOEA 2ZRKA 3C7KA 3UPUA 3FB4A 5JEDA 2QP3A 2JA5H 4PQYA 4D80A 2LCFA 1XMIA 2CLCX 4WBSA 4QJFA 4C3HH 2FFAA 3KOJA 2WHXA 1SKQA 1E1RA 5A4JA 2G1KA 2A19A 4X8LA 2Q21A 2P3SA 2IEYA 3M0EA 2WOOA 2UKDA 1HEIA 1EFWA 4IVRA 2E74C 2GJ9A 2ZS7A 4NXMQ 5M5WH 4LBYA 4RD2A 3N2IA 2FG5A 4GLVB 2WWFA 2AKWB 1QG2A 1QHNA 1RRGA 5JSZA 5H8WA 2AHOB 5B57C 3VR4A 1IBLQ 1ZM9A 4B2IA 1VIYA 1O7IA 2BBTA 3ZIAA 4M1SA 3ZZTA 4Q4LA 1G3RA 4F92B 2VHCA 4A3MG 2VF8A 2J45A 2ZR0A 1SZPA 4GOXA 1F48A 5BR8L 3LX8A 3VAAA 1GOTA 4OX9L 1UJ2A 3HOYG 4LUOA 2YWEA 4YY3L 1TEXA 2WWXA 4L16A 4TMXA 2QENA 2EFDB 1XEXA 3ASYA 4LF7Q 3EIQA 1SN8A 1XPRA 3U3KA 4OX9Q 2IL1A 3TQYA 1KJWA 2ZAOA 4QG7A 3OFND 3NDBB 3DL0A 1AM4D 4QBHA 1HR0W 1E69A 1DG3A 4JI6L 4BFVA 1XB2A 2ODNA 2OAQ1 4BFYA 1A63A 2PT5A 4URZR 4IPCA 1RRFA 3GLIB 4KVAA 4L9SA 5TARA 3TK1A 1J8MF 1ZINA 5HTKA 3THWB 1CLUA 3SYNA 2R62A 3WP1B 3LBNA 1NVVR 1VG1A 2XJ9A 4RD1A 4TL9A 3HWSA 3KDSE 1E1RD 1NP6A 1E2NA 5IF9A 2F3IA 4DLRA 1E0JA 1AS2A 4HYYA 3TH5A 3K0FB 3AKCA 3GP8A 4DV7Q 2ZRNA 2OLJA 1EFRD 3KJHA 3I2ZA 1U8YA 3ZJYC 1QZXA 1ZNWA 3BFKA 2ANBA 2EVWX 3B13B 1CR0A 3U4QA 1DPFA 2K5VA 1V8QA 4DK0A 2H1LA 2JJ1D 2ZVPX 4ALPA 3QBVA 2O8BB 2C96A 2J0UB 4LJAA 1CJVC 4W5JA 3CKLA 3DLLA 4PPFA 1E98A 2B8GA 4TMVA 4O2RA 2UXBL 3BZKA 3CCVA 3UANA 4A3LG 4A6PA 1UBEA 2V7QA 3AKDA 1IYVA 1UFQA 3KTAB 1DBSA 1PH9A 3M6AA 4B48A 4KXFB 1KRTA 2K33A 4FI3C 1HYQA 1KO5A 4G5OA 4I81A 2ZTEA 4M1KA 4LFAL 2DYKA 3W34A 2MFIA 4OGQC 4U5XA 1CKEA 1Z0DA 2D7DA 4FCWA 2C04A 4URUR 1T3HA 3UIEA 3HOVG 3A6PC 5FOVA 3RYTC 3GLGB 4JKYA 2ASBA 2PJZA 4IXNA 2ZT9C 4Q18A 2O5JC 4RD3A 5D3MB 1E24A 3K0XA 2ZSEA 4Y0VA 3ADKA 3W1BA 2HHHQ 2AHOA 1VQIA 2JDIA 2CHGA 5GADl 2KBNA 2ID0A 5IYBH 2A6HD 3CC2A 2LWIA 1EXMA 3B9PA 4QL5A 2HT6A 2QGQA 4KVGA 2J0QA 5H70A 5TV2A 5M5YH 4OONA 2BWJA 2Z6VA 3T1HQ 3B9QA 1KO1A 1AE3A 2CCGA 1VCMA 2BJWA 4LHZA 4OBEA 4P4SB 5FBRB 4CEIA 1XNJA 4EKDA 3PIOA 4JVLA 1UBGA 1XMJA 4X8OA 2YOHA 1GAJA 4BRUA 2ZJQA 1F5NA 3BZCA 1IN6A 1KYIA 3I4MG 2GWHA 3B2EA 4P72A 4MGZR 1T3SA 4Q1CA 1E79A 3GFTA 1GTVA 3AUXA 1FR3A 4YWMA 3W3AA 2VHQA 2ZRLA 4CZ2A 5CB6A 5J3BA 4M53A 4A0GA 4DDUA 3PQCA 5E7IA 4L4UA 3FHCB 1WBBA 1SQ5A 1E4VA 4IQZA 2ERYA 3K0AB 3P4XA 2Z4SA 2C03A 4XVUA 1QF9A 2G9NA 4CW7A 3VU9B 1UEBA 1R8SA 4JI0L 3L2PA 2MO0A 3CD6A 1ZIPA 2ZJ8A 2K5NA 4L8JA 2BCGY 1G7RA 4ARZB 2GESA 3SE0A 1E2KA 1D2NA 2A1AA 1KTVA 4HB2A 4HDOB 4NCKA 2WAYA 4R7ZA 2JLZA 2Q3FA 3D31A 5C3EH 1P9WA 2F1RA 3AGPA 2XX3A 3HU2A 5KSYA 4TYPA 3SQWA 4DV2L 1K83H 2DGYA 1B70B 2ZTCA 2GAAA 2MSCB 1L2TA 3GJ0A 1R5OA 2F1HA 3PEUA 1CJTC 3THXA 4LK2A 2VQEQ 2R7DA 3Q9LA 3U3OA 4ON9A 4A8JA 1EFUA 2BDOA 2PI2A 3GTJH 3GQBA 4JI3Q 4IDNA 1XTSA 4JI8L 1G4AE 2BBWA 2WAQG 3OE7A 2V9PA 1Q44A 2GILA 1TF7A 1YHNA 1IY1A 2JJ2A 1IAQA 1XNQQ 3CNNA 4PZYA 4DUGA 1ZJ6A 5HZHA 3KQNA 1OH5A 3OIVA 1UE5A 4BA2I 3STBC 4FIDA 2ZPTX 4MRSA 3F2BA 4W9MC 2QG6A 2RGXA 2ODBA 2KI5A 4HB4A 2BMFA 4JLDA 1HNZL 1KDTA 2QEXA 4NONA 2O8EB 3U6BA 4A92A 3G4SA 1NN0A 2P0EA 3KYHC 2FH5B 3G0HA 1JECA 5L3QB 3KX2A 2JA8H 2CMKA 4TYQA 1ZM2A 1XPOA 5LBIA 1IJFA 1Y3AA 1VQ5A 2QAJA 5EZ6B 3W6OA 5GQOA 1WRBA 2E87A 4C30A 1FQJA 5JS7A 1IXZA 1PLKA 4FWTA 4HAXA 3E5HA 1QHYA 3HDTA 3Q7QA 1LABA 1G8PA 1UE7A 4A3DG 4UNSA 1XF9A 3ZVRA 1H9SA 1F2TA 4BECA 2N1BA 2F7SA 1L0WA 4NH0A 1XCMA 4XTCS 1S40A 1LTQA 2J59A 2Q3HA 3K9HA 3SS8A 1D9XA 4Y0AA 1KIXA 2FFBA 3A4NA 2YTVA 4Q4AB 3PEWA 2ZYWX 1YNXA 4RMFA 1VQ4A 3O8BA 4RZUA 4C0JA 3FHOA 1DAEA 4NE2A 3QOFA 1CR2A 3OIWA 1AGRA 2BMEA 4DV5Q 5FBLB 1TQ2A 2WB1E 1XMSA 4DNRB 2YC2C 4DV1L 3AB3A 2NVTH 4GP6A 4QFMA 3CH5A 2W83A 2ZQ5A 2NTYC 5CYPA 4A82A 1N34Q 1BIFA 5F98A 5HCNA 1BVSA 4DUGD 3KB1A 5UKDA 4KBGA 2BE5D 3HOVH 2CHVA 4ITRC 1ZNZA 3H0GH 4P32A 4Q21A 1P3JA 2ZI3A 3K0AA 4PPGA 1ZVQA 3LA6A 2BH8A 3S17H 4FW9A 1XZPA 4YWKA 4BY1G 4DDTA 4G5QA 3JZMA 2WAQE 2IXGA 2O0HA 4LJ8A 2F3RA 2OHFA 1KGDA 4JI2Q 1ZD8A 5E4FA 3CNOA 4BZPA 3B1WA 2JLXA 3PFIA 5G53C 3THWA 2QE7D 4G1UC 3A7LA 2W2XA 2FJUA 5DNYB 1VQDA 5BYJA 5FPHA 1VQNA 3LY5A 1YHAA 3R8FA 4TYWA 2VY3A 1SXJC 2UUAL 2A3RA 2VA8A 2FDCA 1TL7C 3BH6A 3PUWA 3W5IA 1XEWY 1Q86C 4TZ6A 4UXJA 2C5LA 3ZZUA 2AL7A 2V3CC 4GDFA 4MDFA 4K0KQ 1G1MA 2IW3A 5FI0B 4PC1A 1FGUA 2WWHA 3KQHA 2H7VA 5C3EG 3S1QH 3A8JE 1JPJA 2IYVA 3CWZA 2P5TB 3G5UA 1X86B 1Q7YC 4LHYA 1ONLA 3AV0B 2B7CA 2BOVA 1E2DA 1OXUA 1W4RA 2ZRFA 3LDAA 3J81c 3KDFA 3LNNA 4DLUA 2I5HA 4PXAA 4B74A 2G88A 1NLFA 3FVQA 2Z83A 5EP3A 1NLYA 2ZAMA 5EE9A 1JPNA 5JZVA 2VBCA 4DIEA 1YZ6A 2JCSA 1TUIA 4HIOA 5FUWA 2CLDX 4XSGA 3BFVA 5KDLA 4B73A 2NO9A 1VS0A 3T12A 1RZ3A 3AVPA 1JE5A 4BPBA 1C9KA 3VR1A 2FF7A 3PXGA 5C44H 4U00A 4JI7Q 4PHFA 2G3YA 4H13C 4US2R 1TTTA 1VHLA 3GCGA 3OIYA 1X56A 2W0MA 1L7VC 2AKYA 4JI7L 4Q02A 2VUMH 1U2RA 2WAXA 4FCVA 2OTLA 3A8TA 1VG0B 1N33Q 4L5BA 3ZH9B 3U3MA 1N6RA 2PCFB 1U8AA 4RD0A 4A36A 3DOFA 3H1TA 5BWMA 5CM8B 3K53A 2OT3B 1YJ5A 3HPQA 1KAWA 1WCV1 2ATXA 3ZDQA 1E2JA 4BWYA 2WVJA 1LYLA 4LF4Q 3WXMA 4DLTA 4F4JA 1KHTA 3K70D 4QQBX 4FWIB 2LMCB 3ICEA 3PSIA 2A7QA 1YBYA 4KYUA 4GPTA 1U99A 2ECKA 1K6MA 2XTZA 3NG1A 1SHKA 3RRZA 3TQCA 3AQQA 1Z6GA 4G0NA 3TUZC 4QBIA 3RS5A 3GTLH 4C0HA 3SN6A 2IEZA 3NENA 4GN5A 1RJ9B 2VSXA 3E2IA 4NYIR 1NY6A 4POGA 1CR4A 3AM1A 2QROA 2VEDA 1E22A 2XNDA 2ZROA 1UEIA 4UXHA 5B64A 3KJEA 2QAGC 2V6JA 3KJIA 1KDOA 3TNFA 5CB8A 2NVQH 2UUBQ 4X62Q 2P67A 3IBYA 1N34L 2A68D 3CMEA 2YHSA 2XXAA 4B47A 1S3OA 1ESNA 2Y0SG 2QN6A 4M21A 1E2QA 3HFZB 1DO0A 4A3CH 2EW1A 3VKHA 2F3TA 1Z0KA 4N0EA 4NYJR 5DI9A 4O25A 2PX3A 2VLIA 2C2HA 3S1AB 4LF5Q 2N49A 1IYJB 3IUYA 3GFOA 2XGJA 3QKTA 1CRPA 4IPDA 2QL6A 2WJJA 3BORA 1N6NA 5AK0A 1CSPA 3CRQA 3AQ4A 4ZO4A 2ZREA 4G5RA 3U2QA 5JCZA 5LD2C 4G01B 3VNVA 4KHZA 3A36A 3U4VA 2FNAA 3OE7D 1V9PA 4RZXA 1G8GA 2PZFA 3SJZA 4JYCA 4ACBA 1MKHA 3ZIAD 4ZI3A 1X54A 2W00A 2O8EA 4XJXA 1XNQL 5BXQC 1CI3M 3KQKA 4CT4B 2GVAA 2Q3MA 1TU4A 2RMKA 1T8UA 1VQAA 5C2JB 4II7A 3FKSD 1QZGA 1W7AA 2JA5G 1G6OA 2ERXA 1Q12A 4QRHA 5KSZA 2HLDD 1OB2A 2KCCA 2OE2A 3X1DA 4A0HA 1NF3A 4G5GA 1EK0A 1PLLA 1EWRA 4B3CA 3HOXG 2A6ED 3K80C 4HAUA 3CZQA 2A5DA 4V02A 1NSTA 1GUTA 4MUBA 3R9WA 3TE6A 2D62A 1COWA 2GVZC 1PYSB 1S4QA 1YZKA 2VS1A 3CPHA 4JOIC 4RZ3A 2HQLA 5EQTA 2CCJA 1Z0JA 1DTSA 4ZPXA 1TAGA 1S9DA 5TXGA 3A7AB 2B8FA 2PLFA 2QGZA 3DEFA 2B7BA 4QHSA 1AIPA 1G20E 2W6JA 4A3MH 1HY3A 5GJWC 4BBRG 3L0IB 3WYAA 3GLHB 4V0LA 3MWJA 2REBA 5IK2A 2YOFA 1ZM7A 4OI0A 4Z54A 4HATA 3LQRA 4NCIA 1BYUA 3GEIA 3STBD 2OESA 4ASUD 1II9A 3L82B 3GJ6A 4C0SA 1A6XA 3GJXC 3QXXA 5EZ5A 2JA9A 1EX7A 4IFDH 4JKIA 4BXXH 2YJTD 1Z9FA 4DEXA 3A5UA 2G83A 3RLOA 1Z6AA 2ZU0C 2BE5C 4QGGA 1TPZA 2ZJ2A 4PTLA 3QG1A 3GO5A 3LO5A 2RGDA 2DHRA 3EA0A 1DOAA 1N25A 4R9UC 3LQQA 4A3LH 4TLCA 1G8YA 3GTQH 3KTAA 1CTMA 4FDBA 5FBQB 1JJGA 3BE4A 2N78A 1U90A 3M4YA 3CUEF 2UXDL 1AZTA 3HOWG 1VQJA 1CJKC 1WCMG 3UKDA 4LFBQ 1N3BA 4HDQB 3R7WA 2BHRA 2NQ2C 3H4MA 3PEYA 1WFQA 1SHZA 5HE9A 4TLBA 4Q9LA 3CRKC 1N5JA 2KJQA 4Y52H 4KMUC 4B3BA 2GJKA 5CIWA 1P62B 1W36C 1SXJD 1DO2A 2EQSA 3EC1A 4EQ5A 3I5YA 2NN6H 2R6GA 1EUJA 3S24A 1IBMQ 1IBRA 3TIFA 5LD2B 3TQFA 1QZHA 1S3GA 3R8CA 3TKLA 1ZRHA 2UZIR 3MFYA 1EFRA 4P74A 2VQFL 1VCOA 1XD2A 2NZOA 1XTIA 2AXNA 5EP2A 4A3CG 1ZYRC 4KN4C 1S8FA 4BEBA 4L5RC 2HLDA 5LMUQ 1WP9A 3CH4B 2D5DA 4B43A 1G41A 1W4BA 3VR6A 4C3JH 5P21A 1T91A 2NG1A 4DRZA 4B32A 2OXRA 2FPLA 2KBFA 2DUDA 4HDCA 2CJWA 3TZUA 1AKYA 1B7YB 1HURA 2TMKA 5FUXA 2IX1A 2P6RA 2XNSA 5IHPA 3RN2A 1G16A 1W0KA 3PR1A 1GUAA 1RRPA 1T6NA 3HR7A 1U8ZA 2Z4RA 3KQUA 3UDIA 4AQYL 4LF9Q 2JEBI 2BEKA 1EFHA 1GVPA 2X2EA 1W0JA 2YTXA 3QKRA 5DISB 1EFTA 4DR5L 4BBSH 4LZZA 1YHBA 2GETA 1P2SA 5H1SE 5L8VA 1TUEA 4OL0A 4QGAA 4ZI2A 1XFAA 1EWQA 2L15A 1KO8A 1E2ZA 4GMXA 4JV5L 3QY0A 2YKGA 2QMUA 4AIMA 4TZ0A 2JIZA 4AD8A 4UP9A 4DNIA 3T1HL 121PA 2LKDA 1EOVA 1W3SA 1HJPA 3RLNA 2OCBA 2WSMA 4J0QA 2ONJA 5KDOA 3QF4A 3SNHA 3V00A 4B34A 2GHIA 2I1VB 2W2VA 2JJ8A 4JI1Q 1UBCA 1CKOA 2DFKB 2NO6A 1RYHA 2QNRA 4TTRA 3KLWA 1GKHA 4HJ8A 3HOUH 4WZ6A 4XSHA 5EUMA 1EWHA 1QHHA 3DKPA 2X8AA 4Q7JB 2ZS8A 1I4LD 2J41A 4DLVA 3R9XA 4PHTA 1Q46A 2QP4A 5BQ5A 1Q57A 1K8MA 4HZIA 2OZEA 4GNXA 2ZRJA 2YINC 2Q9AA 4DR3Q 1SVMA 4LJ6A 1ZKOA 4RD4A 4GKKQ 1SVOA 4TMZA 2Q2TA 3ZD6A 2DBYA 1H9SB 2V4DA 2NN6I 3CWQA 4X66Q 3ICQB 4XWOA 2L0XA 4LJ7A 2OSBA 1W36B 2H17A 2IA5A 1IW7C 2N8NA 2CHQA 2A69D 1YR8A 3KXKA 1GUSA 3R20A 3THYA 1EFCA 2IYQA 2AN9A 1G4UR 1B9NA 1GITA 4WXPA 3MEFA 2HIVA 4X65L 1QHGA 1JT8A 5GAHC 4OJQA 5LMNL 1GHKA 4UJ3A 4C3ZA 2XB2A 3RWMB 1IBKL 3NVAA 1VHTA 1VYUA 1SULA 4C9BA 2CL6X 4DLYA 5F3WB 1VQEA 3P32A 1OIVA 2ZYTX 3CIOA 1KRSA 1F3OA 4Q66C 4D81A 3FMFA 5A0FA 2W6ID 1J6QA 3P27A 1B23P 1OFTA 4BFXA 5DGXA 3UK6A 2V6IA 3KJPA 5EXSA 1KMHA 2VSOA 1PH4A 3M7NA 3CCMA 5DLQC 3FFAA 3ETLA 3SZRA 2O8CA 1EESA 3QQ5A 3OZXA 2F1MA 1Z6XA 4DR5Q 1VYTA 4A2PA 3EASA 2IYUA 2WJYA 2ZJPA 4PZ8A 4X6AH 5ELOA 1XJVA 3I4LA 2MQHA 1GILA 1IHUA 1CP2A 1KI2A 1MABA 2UZ3A 4V0NA 5DHAA 2CEAA 1TWGH 4KITB 3N6RA 3NEMA 3CCSA 3C8UA 3LX5A 2B63H 1Z47A 1J70A 3PCRB 4LRWA 1ZIOA 2A5FA 5L3SA 4KSBA 1RW4A 2JLUA 5EXTA 1E1QA 2J46A 2RKOA 4JK1C 1CKMA 2ODWA 3WHLA 4C3IH 3S1AA 5M3FH 2I0QA 1XZQA 2IHEA 5FPSA 5KDDA 1HCZA 1PA6A 2MSEB 1XPUA 2FX3A 2OXCA 3DM5A 4MYUA 3LW8A 2EJGC 5G41A 3IEVA 1AQUA 4YCUA 4A93G 4AIIA 4CEJA 1Y69U 5JECA 1YZTA 5IP9G 1Z22A 5IDVA 4OI2A 5KOYA 1GUNA 4QNMA 3J7A5 1CJUC 4HLQB 2ATWA 3KKOA 4X62L 1JALA 2BVNA 4JJZA 4M1WA 2FZLA 2GZAA 4YCWA 4LPKA 3GTKH 1ZCBA 2RGNC 3B60A 3TEHB 4DR4Q 1LF0A 4I1OA 1ZM4A 2OFWA 3VR2A 1TWAH 2GK7A 2IF0A 4YDHB 1E9EA 3RS2A 2D2CC 4WJ3M 2QY9A 3OF5A 4EPXA 1J5EQ 4EQ6B 4CGZA 2BH2A 2AD1A 4JI6Q 1TWHH 3R7WB 1CEEA 1FJGL 3U7EB 3U44B 1X3FA 3K9GA 4MKGA 1E2VA 4WVFA 4DXAA 1NMYA 4BFZA 2HF9A 1N32L 1VQKA 4F91B 4A3EG 3QEJA 4NYMR 2Z5FA 3RRMA 3EPJA 4HJ9A 2GAOA 3MWKA 3M4PA 2ZIAA 4GNKA 2F9LA 5JEAG 4POAA 4DV3Q 1CR1A 1NIJA 2QGNA 3E9IA 4WW0A 1RKBA 3QXHA 2VP9A 1K73C 1DAGA 2VL6A 2CBZA 2PMKA 4A2WA 4JJKA 3ZZ0A 4AG5A 4EAQA 4EIWA 3JVUA 5AJZA 1D8TA 2ZRCA 2YYZA 4XVRA 4B3GA 1VQCA 1C9OA 3EG5A 5DI3B 2PJRA 1XRJA 3H3VI 1ZNXA 2GF9A 2IBMA 4EUNA 3U58A 3MXNB 3C41J 4LJ9A 3BIFA 3LBIA 4PQFA 3U7GA 2J5XA 3MG9A 2NZHA 4UY8C 1CJMA 1GSIA 1L4YA 3UXMA 3VR3A 5TY0A 221PA 4KFUA 4MZ9A 2WKQA 1XWIA 1ZD1A 2ZANA 4PAOA 2EFEB 3L0SA 3QXCA 3GJ4A 4IO9A 1AZSC 1OIWA 2D3WA 2WM9B 1VQ8A 2DR3A 2F6RA 3FPPA 4KKSA 1NL3A 3AP3A 4P75A 2B92A 4NXML 1G19A 4RD6A 4YDSA 4DT1A 3U61B 4IFBA 1JR3A 4KO8A 4JBMA 4NMMA 3TVDA 2RGEA 4FINA 4OXPA 1OPXA 2CWPA 2Q2IA 2ZVQX 2A6EC 3AB9A 2XSZD 3B78A 4B35A 4BASA 1SVLA 1XD9A 4IOLA 4WAUA 3QE0A 2B29A 1WJJA 4RVCA 3T5GA 1IN5A 5B2ZA 5EE3A 1F2UA 4URYR 4XTRA 5G3ZA 1ZMXA 3IEUA 5FBWB 1GNPA 3NBXX 4IW3B 4MTNA 4W5WA 1A2BA 3KLRA 1PFSA 4KHPQ 4DSUA 1H9MA 4HR7B 4JV5Q 4LF7L 4JI4L 2JIZD 2ZRHA 3IGFA 4IOMA 2YTYA 1N6OA 4V0OA 3I72A 2KHJA 1W49A 2WMOB 3VMFA 1SROA 1Y14B 1ODFA 2IUTA 4JI4Q 1YJWA 1SKYE 3FMCA 5GJCA 4ACAA 1FPMA 4DV6L 1NBMD 2MSDB 1H8HA 4TN1A 2R2AA 2AWNA 2PBRA 3K0CA 4I99A 4KBFA 3MWLA 4O0MA 1IZ6A 4R4TA 4PAMA 3KXLA 3A58B 4Q1DA 2K5HA 4OQXA 3IRBA 3UG7A 2XOKD 5FTMA 1UBFA 2R6DA 3N2EA 1MT0A 2WFWA 3BRWD 3CPEA 3IO5A 3CLVA 1D9ZA 1SR3A 4LX0A 1JQLB 1UKYA 4F4IA 1S72A 3TS2A 2JE6I 1HT2E 4NCNA 4CDGA 5CDFE 3AVUA 1GD7A 2IUSA 4MRPA 3A74A 4R2HA 3A1WA 4Q9KA 5HKKA 3X1XA 5JJLA 3IPXA 4EPTA 2NZ8A 5AJ3L 2F4VQ 4LF5L 1UDWA 1KK2A 5D3QA 3RSOA 1P75A 2V1CC 3GTOH 3QI2A 4U02A 4A3FG 3T1VA 4EDHA 4DSTA 3MSXA 2WWIA 4OYHA 3PUXA 2PNHA 4BBRH 2E76C 3KKPA 1YZQA 4HUQA 1Z6HA 5J4VA 2JLWA 3AP1A 3OESA 4YLGA 4TQ9A 5DHFA 1OLOA 2AUJD 3VA7A 3GJ3A 3U6KA 3SFZA 4MGKR 4TT3D 1Z83A 1A7JA 1WOCA 1PV4A 2WJVA 4GL2A 3IQWA 1GRNA 4LNQA 3AF2A 1E32A 4PANA 4DLWA 1TX4B 2DN8A 4DT1B 3V4RA 2HT1A 3TW4A 4AH6A 3W1GA 2QRZA 4MKHA 4Q48A 4MUAA 4UJ5A 2EFHB 4Q01A 4R71A 2QM7A 1G5RA 1IXSB 3OOCA 5DYIA 1JQJC 4HAVA 3PGZA 4KAXA 1H65A 4A4DA 3PVSA 1T4GA 5HGQA 2BEJA 3SHWA 4GS3A 2OTJA 2NO0A 4LF4L 1DAIA 1KSHA 2YC4C 4CVNA 1YEZA 2ZJRA 2IY5B 1F2UB 1P4SA 1OFIA 4DWJA 1XXHA 1MO5A 1D7QA 5ELXA 1XU4A 4MGIR 3SJBA 4DV6Q 4BUJA 2UU9Q 5K8IA 1GL6A 4DVGA 1NNEA 4MYHA 2ZI7A 1TQ4A 3QF7A 1XNRQ 4KLKA 1KSFX 2FSGA 1EQRA 2WPDD 4ZIRB 5DN6A 1YNJC 2O5IC 1DARA 3SFVA 1E3PA 1N6IA 1FOEB 1OJLA 2B3GA 4JI5Q 1N2CE 4DUYQ 2ORIA 2IF2A 4FMDF 1H8HD 4JI0Q 1XCGB 5JEAJ 3U3RA 5AUPB 1HQYE 3GLGE 4IVQA 4OHZA 4HLCA 1A8VA 2FFQA 5H1YA 1XMOL 2MO1A 2EFCB 2X19A 3D7MA 3K09A 2CWAA 4PC2A 3FKIG 2F4VL 1KI7A 3PIRA 4US1R 4BLSA 3GPLA 4GLXA 2VH5R 4DR4L 3BAFA 4B3TL 4TL7A 5LB2A 1R0YA 2KBEA 4AYXA 1M7HA 4B2PA 1OW3B 5IT9c 1G3QA 2JGNA 4H44C 1OYWA 3NBYC 3UE1A 1Q8KA 4FD2A 4D0GA 2K32A 1G17A 3F2DA 4B3TQ 4PAQA 2OQ0A 2BIFA 1U0LA 1G6HA 2EJFC 3Q85A 2OBNA 2DNEA 1KOFA 1GG2A 3QKRB 4DLZA 1HNWL 2KCTA 3JAMi 3TVTA 4APVA 3KFUA 3L0OA 1X65A 3HOUG 2HF8A 4AYBE 4MRNA 2Y0SE 4A8JC 1E2HA 1KI1A 1NG9A 1X55A 1G9XA 2GJSA 4LHVA 5DI3A 4DR2Q 2CL7X 1SLJA 2UUAQ 1IBML 2V4ZA 4UNPA 4A3GG 3BGWA 3AKYA 2VHUA 1NSFA 4B2LA 2A68C 1R5BA 2K52A 1ZU5A 3BK7A 2GXSA 3E9HA 4DAYB 4YXWD 4IEEA 4GSYA 1KKLA 2IYSA 2RGCA 5LMNW 2ZRGA 5DN6D 3J7ZC 1MO6A 1Z06A 5FOTA 3EIVA 2OO7A 1DELA 3EZ2A 4BFUA 1UADA 3THOA 5FTNA 1U98A 1E9RA 5L3QA 3HU3A 1CFMA 1NMFA 1KKMA 2P5SA 3AVOA 1IYUA 2Q2UA 4US0R 3W6NA 3D8BA 1X3GA 5M3MH 5AJVB 4C4PA 2ZJZA 3EX7C 2WKPA 1XCPA 3QXJA 2BMDA 1E2WA 1GUOA 1FX0B 2OM2A 4DR7Q 3IKJA 1LY1A 2ZYVX 4FMCF 3OEED 2FEMA 3TAUA 2OQKA 4YQFA 2QAGA 4IDHA 4HSEA 3CR7A 2EVBA 1MJCA 4B3RQ 2C78A 3NH9A 4X8MA 4AQYQ 4DV5L 4LF9L 1G21E 1W48A 4TKOB 1M2OB 1YZNA 2XAUA 3NXSA 3AH8A 4FCTA 1NI3A 2JEOA 1Z7TA 5FL7A 1W0JD 2ZEJA 1FYCA 821PA 3I4NG 5TMPA 4YMVA 4HJAA 2QT1A 5K36H 5J40A 3B7GA 2WWYA 4ZIRA 2LSSA 4A75A 2PQAB 1VPLA 5LPNA 1B0UA 5C1BA 4P33A 3C5CA 5J47A 3IO3A 4V0KA 1BKBA 1PYBA 3QSYA 3TS0A 1E0KA 2A2ZA 1GRRA 3B85A 4QM6A 1N5KA 4B71A 4DCTA 3M85A 1HZAA 1A5TA 3W8RA 4TMTA 3E0EA 1YRAA 1PH8A 3I32A 4PPNA 2F43B 4WZAE 1HE1C 2KE5A 3RHFA 1OXTA 3X1ZA 2X1VA 3Q8XB 1NJFA 1C4OA 4DDVA 4A15A 4IXMA 5IY0A 1G5TA 4LWCA 3RN5A 2EWVA 1KAGA 3H0KA 4DCNA 1OB5A 2YV5A 2ZRPA 1US8A 4LV6A 3F3YA 3MJHA 4FN5A 2VRWA 1Q22A 4HB3A 1N6LA 4M8NE 1X6VA 4HEJA 1ONBA 3DO6A 3GTMH 2WIAA 1FNMA 1XTDA 1KIMA 1YR7A 4LC1A 4LY6A 4R4QA 3CP0A 3TUIC 2YWGA 4HAYA 4JLJA 1G3MA 1OSNA 1XMQL 2JA6H 3J81k 3ZJYA 4DNTB 5CLQA 4CEHA 1Z07A 1SE8A 2BV3A 1HPCA 1XD8A 4IPHA 2I5MX 2YU9H 1AS3A 3PF5A 1OHHD 3TR0A 4A8JB 4DC9A 4BZXA 1ASYA 1NY4A 2W6JD 3C5HA 3Q5DA 2QEQA 4X65Q 2BKEA 4QBFA 3LRPA 2DNCA 3A8KE 1VQLA 1IQPA 3QBTA 2JA7H 4BBSG 2JA1A 5J4LA 1JNYA 1RE0A 3ASZA 3O47A 4P4UA 1G7TA 2GNOA 1A0IA 4Z8YA 3B6EA 3ZGXA 3K0CC 2IHBA 2G6BA 3WMEA 3C14C 3VDYA 3KF6A 4DV3L 2C9OA 1SMYC 1IN8A 4JBXA 3BU2A 4FMBB 4UKDA 5DYGA 1J7KA 1K3RA 3K8AA 2AD5A 4LBWA 1Q21A 3T35A 3AF4A 1W44A 5A5GA 4UNRA 4OHWA 3OEHD 1C1YA 4QHTA 5FJ8G 1T0HB 2K5UA 4DR1L 1P8LA 1NBMA 4HIKA 3OAAD 3F1ZA 1TNDA 2ZRIA 3A37A 3Q8DA 2GVBA 3N70A 1R0WA 2BBSA 1PH7A 1XEXB 2R93G 2PEYA 3D6TB 3LNCA 3EWSA 4MYTA 3UMSA 4DSNA 4OO1H 3K9LA 2QRNA 5E3HA 4E22A 5HZKA 1W2HA 4M2LA 5IP9H 4X64L 4A9AA 3UWOA 3EAQA 3RRNA 4Y7NH 1GKIA 1K8AC 4DLXA 1I3QH 5JBQA 1P2TA 4I1UA 3WYFA 2H16A 4I4LA 3RWOA 5CJPA 3I73A 1HNXL 5JEAH 1DS6A 4GZLA 5C0XJ 5KSPA 4ZKDA 4L15A 3DM3A 4JI1L 1FW6A 2B6HA 4NBSA 2ZI9A 4URXR 1B9MA 2OAP1 1A2KC 1ZW6A 3BOSA 3L0PA 3K0FA 2F43A 3LVQE 3KZ1E 1Z29A 5DH9A 5GJBA 3CONA 1N9WA 3T1OA 2ZJ5A 4HLUA 1YZGA 1SMXA 2BDTA 3CCQA 4Q4JA 3FKSA 4DAMA 4L9WA 2UXCQ 4LYJA 4IRUB 2WOJA 4YMTA 1MKYA 2KENA 3LFUA 3FKIH 4DV2Q 3O8DA 4HUTA 1NKTA 1U0JA 3KJOA 2QI9C 2Q2HA 3EZ9A 2CW0C 1E9AA 4QXAA 3BJIC 4ZKEA 1T0JB 3B1ZA 4IJHA 4L5QA 1G64A 4TSFA 4QM7A 3WRYC 2IX0A 3CX8A 4JL5A 3ZS8A 1Q1ZA 2E9SA 4TTPA 3CAMA 1H95A 2VP5A 3UWKA 4IVPA 2FV8A 4JT4A 5FJ8H 1R0ZA 2ZI4A 3MRSA 3P26A 2R7FA 5LMNQ 1VG8A 3J80i 5C0XH 4YCVA 1YJNA 3TBKA 3FHTA 2FZ4A 3X2SA 4TTQA 1YITA 1L2FA 4X8HA 3ZVMA 3CCJA 1DGSA 4IDQA 3PEVA 1LACA 2ZRBA 4AYTA 1VF7A 3HYRA 4F93B 3PUYA 3U7FB 3H94A 4BFWA 5KPDA 1CULC 4OO1I 3IPYA 1UDXA 5E95A 3BD9A 2JDID 4BLTA 3I4OA 1LF5A 3UDXA 4RFVA 4BQSA 4HB0A 1EYGA 2C77A 2P6NA 2NVYH 1JAIA 2PZGA 3NC0C 4OQNA 2V54A 4YC7A 3EW9A 1L8QA 4LW1A 1VKJA 4ILEA 4Q1EA 2Z0MA 4ME3A 4BLOA 1ASZA 4P4SA 4CEIB 2QA4A 2VSFA 2ZU6A 5EE0A 2JATA 1GHJA 4OK6A 3SR0A 4LJ5A 5KUTA 3O8CA 4Q5IA 1S2MA 2ZJAA 4BLRA 5GAEC 2QAGB 2UU9L 3A1VA 1JMCA 3GMTA 3MMPA 4YMSA 2AKAB 2JLVA 1KK0A 3HR8A 4EPYA 3V9PA 1X8KA 2ZUCA 3GFPA 1HZBA 3NEJA 4D4KA 3K7AH 1G8FA 2ZXUA 1HTPA 4XH9B 5KNBA 2PQAA 4HIMA 1P5ZB 4UP8A 4QGHA 2EIFA 3ADCA 1SVSA 1KK3A 3OW7A 2OFXA 4I1VA 4OQFA 2R44A 4D26A 1Y8OB 2VZAA 1IM2A 1XJCA 4EX5A 3M4OH 2DFLA 3SBDA 5C0XI 1EWIA 1EG7A 1WCMH 2NN6G 1Z63A 2FEOA 1NN3A 4NHOA 2JA7G 4LYAA 3ZYCA 3P1JA 1N0VC 1HZ9A 2YWFA 2ZM5A 4L5SA 3AVVA 3KF8B 5DSZA 2HXYA 4P31A 4TMWA 4JLOA 5H68A 3TUJC 1KNXA 3NELA 2W6IA 3MCAA 3NE5B 1LFDB 1VG9B 3I92A 4YMWA 1LVGA 2WJGA 4D4MA 2GXUA 3GJ7A 1UPTA 3EPLA 4DK3C 1T9HA 3BB1A 2IHFA 1RJ9A 3BB3A 1YIJA 4F7WA 4PPQA 4N1AA 4ERNA 4JG2A 5HPYB 4HZUA 1NJIC 4XIGS 1UKVY 5IE8A 2ZJOA 3BDOA 3B1VA 1CRQA 4B6EA 2QE7A 1PUJA 1PH5A 1HV8A 1K5DA 2GDJA 2VL7A 2B21A 4DBLC 2I5LX 2XXAB 4DR3L 1NN1A 1ZD9A 1WF3A 3GLHE 4NYJQ 2P2LA 3KL4A 3HOYH 4DR6L 4LSGA 3U50C 1D2MA 3TGPA 2WTUA 4B3SQ 1E2LA 2RGGA 3FKQA 4M1TA 1PH2A 1KJYA 4M9XA 4GN3B 3RZDH 5C4JH 2ALYB 2QPAA 2RHMA 1G3UA 4DR2L 2AK3A 1COWD 1N0WA 1VQ6A 1OYYA 2SHKA 1GJXA 4OWWB 1DE0A 2OUKA 3CF2A 2FSIA 2ZUBA 3EWAA 4JLAA 3U60B 1MO4A 3EBEA 1NVUQ 2JEAI 5LMUL 1L1OC 2W0SA 3CXCA 4DCSA 3H0GG 2PLRA 4P71A 4K8OA 4Z1MD 4JBKA 1NLZA 2E2IH 2R92G 2PCLA 4UNQA 1XTKA 1E7ZA 1E2PA 1KO7A 1W46A 2QBYB 3LD9A 3ERSX 2QZ4A 2UXBQ 1BS1A 3GLFA 4ESHA 2O8FB 1PH3A 2G0NA 2ZSFA 3NHAA 4G3XA 3RZOH 3W6PA 2RF4A 4LJ4A 3UMFA 4KLNA 1N6HA 4QGUA 4TWZA 3Q7PA 2A5JA 4B3ML 3I3SR 2ZM6Q 2ZSDA 2D4HA 2HYDA 4PO1A 1PH1A 2EQBA 2XSZA 1YZUA 1JI0A 2ZM6L 2IYTA 1TWCH 1FVIA 3FMIA 3K70B 4JLVA 1SXJE 5FFMA 4A76A 1R4AA 1S3SA 2IWHA 1VDZA 4C2MH 2E2HH 1WDTA 1BDOA 4Q19A 4TVAB 1E9CA 1VCIA 4LOAA 1KSJA 4L5TA 4EFLA 3HGBA 4IOAA 5EP4A 3WY9A 2FPKA 3TSWA 1N36Q 1G5PA 2CK3A 1KNQA 3EIHA 2Z6KA 5CYOA 1NMGA 2O0JA 3QENA 5J4YA 5JMTA 3A8IE 4LWZA 1W2BA 4LBZA 3EPKA 2IHYA 5IP7H 3OIUA 1VQBA 4Q7KA 4Z8XA 3OTOQ 3SQXA 2MNAA 2GEDA 3B5JA 1P16A 3QUSA 1LS1A 4FMCB 1Z08A 3S15H 4HAWA 4NTZA 4OI1A 2R7ZH 1FTNA 1PH6A 1CUKA 1II8B 3EXAA 2N3SA 3OTOL 5FBVB 4QHYA 4PZLA 3EPHA 1CSQA 4DCVA 1XTQA 2GTPA 4KFTA 3ULLA 3NEYA 3H2YA 1AN0A 1E0SA 5FOUA 3OEHA 4DHEA 3ADBA 1IY0A 2WJHA 1T8TA 3T61A 3CF5A 3KFVA 1W2GA 1E94E 4OWXB 1QBKC 4DLSA 1DAFA 4M9SA 3CW2C 5K8TA 1XBTA 3GLGA 5E7JA 4YMUA 4WOPA 2WKRA 4Q1FA 4JSTA 3HJNA 1PHJA 4R2IA 4DUZQ 1QHIA 2I3BA 4DPGA 2K4KA 1QG4A 3V4FA 2ORVA 2X2FA 4RCNA 1Y1WH 1N5LA 2HCJB 3GJ8A 3A1UA 2XZOA 5JCPA 1H9RA 1GWNA 2B8TA 1U81A 2P6UA 3S2DH 2QPTA 3KB2A 3RNLA 5K36G 1YZLA 4LF8L 2XITA 2VUMG 3CM0A 3HPRA 2GXAA 3OYYA 2IS4A 3KUCA 5CK5A 2BBOA 2WICA 4DZZA 3TLXA 1A82A 1M74A 5E7NA 1E1QD 3FDIA 4NXNL 4IJMA 1OKKA 1S1CA 1TF5A 3PO2G 5B30A 1KJZA 2Z0SA 5ELNA 3B6YA 1B8AA 2FU5C 4QKQA 5IYBG 3F0TA 3CW2A 3FE2A 5CLLA 1FMLA 3AEVA 1UKZA 1EQQA 3KKQA 4UXIA 2XZLA 2VF7A 5AJXA 1XEFA 3NKVA 1OV4A 1QJOA 3QNUA 2J7KA 3KKNA 1AS0A 2GKSA 2E5LQ 1IL2A 1C0AA 2GBLA 4LHXA 4D2IA 2EYQA 1QVCA 4DKAC 3REGA 3M3YH 2FPMA 2PX0A 4NYIQ 4OK3A 1JR3E 1M6NA 4PX9A 5AJYA 5AJWA 4C7OB 2DWPA 2QU8A 2VYFA 4A2QA 4AY2A 1E9DA 2J9RA 1KXLA 4IEIA 2AR7A 3J81i 3Q72A 4KFSA 3ZLJA 4LFCQ 3THXB 2FSHA 2FE4A 3RABA 1Y63A 2IYXA 5FLMH 5M04A 5KPJA 4CEHB 5AUOB 2OCAA 2W2TA 3L8YA 1OXVA 3SBEA 2I1QA 1Q3TA 3S14H 4LYFA 5JI3E 4RY2A 5F9FA 3UDFA 2JLRA 2WV9A 1P6XA 4A3BH 2CNWA 4V03A 4HIDA 3T5DA 1RC8A 3LH5A 2RHSB 2WIBA 4QJ5A 4Q03A 4JBYA 3T1QA 2C9CA 4EJSB 1UEJA 2GA8A 4YXWA 3VR5A 1KI4A 2HDNB 4G7ZC 2QSZA 4HZUB 4M9ZA 3RRYA 1GIAA 1I5FA 3KUDA 4GP7A 4NPHA 2PCJA 2O8DA 1KY3A 2IT1A 1S1MA 4KHPL 1V5WA 4MYCA 2YZ2A 2CCKA 3P4YA 3I8XA 1QUQB 1Z2CA 3CRW1 4JIMA 4Z51A 2DB3A 2K14A 3IIMA 1MJEA 1KC8C 1W47A 2EWWA 1GKUB 4XD7A 1O78A 3JVVA 4DDWA 1W0KD 3U4ZA 2WJIA 2ZE8A 1PJRA 4GOPA 2L5TA 2OV2A 4PFSA 4M1YA 1I6VC 1SFOH 4E5UA 3HOXH 3PV0A 1G18A 2YVUA 5C4GB 2K7VA 3WDNA 4Q4AA 2JA8G 4JLKA 1T5LA 3THYB 3TRZA 4XOIA 3C15C 1ZYUA 1LB1B 2GEUA 4OK5A 4R4CA 5C46F 5DIFA 3K1JA 1KDPA 2QP9X 1D6JA 4PC7A 1TWFH 2AXPA 4KKUA 4R1JA 3W5OA 2DY1A 5BN5A 4JL6A 3GLFB 1NE3A 4QJ4A 5C4XH 4BFSA 2VW9A 2ZI5A 2CE2X 3A1SA 3ER0A 4IOKA 4QBGB 1PZNA 4TLDA 2CVFA 1HUQA 3T56B 4MKIA 3W5JA 1P73A 2NGRA 3VQTA 4JBJA 2QORA 2HUPA 3CX7A 5DE3A 1TXYA 2Z43A 4MNOA 1KMHB 2A9KA 4PZZA 3VX4A 4BGDA 5FR2A 3AYHB 4IHQA 2YOGA 5FTJA 4BE7B 3GEHA 3QF4B 1NJGA 1OH8A 1U5KA 4M1OA 3CR8A 5AWFC 1X8JA 4B3RL 5JHHB 1I4DD 3BB4A 3NBZC 4C0AC 4B3MQ 5EE5B 1S0UA 4AG6A 2ZE6A 5TB5A 2ZRMA 3LVRE 1JB7A 2MMCA 3WP0A 2GJAA 3QPVA 1NBME 1HTWA 4XVQA 5FH9A 4M9QA 4LGMA 4R4OA 1DAKA 1YE8A 4PSAA 4XWAA 4Q9JA 1AJEA 3DZ8A 3CCEA 2JJQA 1NG1A 1ZC3A 2GCNA 4F38A 1E96A 2VQSA 2IYRA 5D3MA 3UE0A 2RGNA 2OLKA 4PSVA 3REFA 3TR5A 2EJMA 2Q8IB 4DV0Q 1KZGB 4AI6A 2BA0A 4IFDJ 4IFDI 1HH4A 4LK1C 3VKGA 4KN7C 4MGYR 5IYCH 3UG6A 1ZCAA 1FL9A 2J87A 3HP1A 3QG5A 2V1UA 1AH9A 4YONB 1KD1C 2XGTA 1ESMA 4W5HA 4DR6Q 3SI7A 4A3FH 3T15A 2C99A 1OKKD 3MXUA 2NIPA 3CNLA 4LHWA 1MRSA 2IXFA 3SJAA 2ORWA 4PR0A 1Q1BA 4A3JH 4OO1G 3CZPA 4WIAA 3WYGA 1E9BA 2ZTDA 1Q0UA 4CT5A 1PMRA 1GL7A 2O5VA 3D4RA 3RNUA 1HT1E 1HR0L 3LLUA 3WMGA 4BRWA 2OILA 4EPVA 4DUYL 3I55A 3RVBA 3BWDD 4ZDWA 1CS4C 4RCYA 1S9HA 5G40A 3R9IA 3GEEA 2KB0A 3C16C 3SHFA 1WXQA 4ZV4A 2V55B 2CJWB 1MOZA 3BG3A 2GZDA 3LWNA 3SJCA 1DAHA 3J81j 5JEEA 3WHKA 3L43A 2H8KA 4YWLA 4JI3L 1SKYB 1XDBA 1G291 4HJ7A 5C4XG 4OQLA 4TQUS 4PC3A 1DADA 1NRJB 2ZRDA 4A3KG 1I94L 5IYDH 1MO3A 2KWIA 4BLPA 5L3SB 4RKEA 4WA7A 1OFUX 5C0XG 1GM5A 1FNNA 1GDDA 4HUQB 3ZD7A 3DXJC 4HI0E 1FP7A 1RFLA 1HQCA 5TDHA 3KJGA 5GJVC 1VQMA 1I94Q 5FI1B 2PPBC 5G3YA 1Z8FA 1M34E 3FFBA 1KZ7B 1G7SA 3WNBA 3RANA 4BLQA 3DZDA 1H8ED 2C35B 4DK6C 4A3IH 2HJGA 3BH7A 3CPJB 5FUYA 1Z3IX 3I62A 4AYWA 4ASUA 1E2FA 1E9SA 3OFNA 2J3EA 2O8BA 2ATVA 4WXRA 2CXXA 1GP2A 1KO4A 3NC1C 1II0A 4HLDA 4ZCMA 2J7PA 3S2HH 3BXZA 2G0TA 4M22A 2BJVA 1CKNB 3AFQA 1E9FA 5KU1A 4JYAL 4DK1A 3SC3A 4BY7G 4DV0L 2FN4A 3NBFA 1I4TD 3SYLA 4DJTA 2AK2A 3NIBA 4QIWE 1KY2A 3K9NA 1PLJA 4EQ6A 1UM8A 2F52A 2HXSA 4TLEA 3S1RH 2ZRAA 2FSFA 4BEJA 2ZSAA 1N36L 1ZUIA 1E0AA 1IBLL 4WZBE 1S96A 3EN2A 2ASEA 4N0DA 4JI5L 4GN4B 3KXIA 4K46A 2AFIE 5K8UA 5EE1A 1I50H 4LUZA 3KQLA 3A4MA 5KNDA 1O3YA 3HYTA 5JWHA 1HR0Q 2Q9CA 5BR8Q 5HCIA 2UXCL 1VQGA 4C0KA 2NPFA 3VHLB 3VFDA 3PUZA 3VHXA 3N5CA 3TREA 3ULJA 2WB1G 1J90A 1QVRA 2GBLC 3I4NH 4PHHA 1NKSA 1KL9A 1J5EL 2A78A 2RGAA 1A62A 2XJ4A 1E2IA 2FWRA 3RDPA 2CKZB 1LV7A 2XTMA 2EXDA 3IIJA 3KKMA 4JLMA 1YI2A 4NZYA 1N5IA 2RHDA 2ZE7A 3JC66 5DLQE 4A3EH 1JJ7A 2WZQA 3RSLA 4IFEA 3ULPA 1GRQA 1R7RA 4AURA 1XX6A 3ZQJA 2C95A 3BFXA 5M3FG 1R10A 3CC4A 2ZS9A 1WMSA 5M3MG 4G7HC 2NPIA 2OEPA 3SU8A 2IUUA 4JOIA 4P73A 3B82A 3PITA 3CF6R 4TYNA 3TMKA 1F60A 3IILA 1HQMC 3L2OB 2DWQA 3NWJA 1XMQQ 4OHVA 1QDEA 1X8LA 4EPRA 2ANCA 3FMPB 3VX3A 1FMJA 5IRCD 3LWUA 3CCRA 4DV7L 3H86A 3CQZH 4A3JG 1YVCA 1TQDA 1YU9A 5SZJA 4P4TA 1H9KA 4H1UA 3RS4A 2IX3A 2RCNA 1GO3E 1OHHA 1M1KC 5KO2A 1OH7A 4TYYA 1Y8NB 4CRWB 3K0SA 2QSYA 2NMVA 2QT0A 3ND8A 4C2TA
chains in the Genus database with same CATH superfamily
2NVWA 1FU8A 1V0JA 1K0UA 2E2WA 3R3YA 4E11A 2OXEA 4XWKA 3KB8A 5JSHA 5DLYA 2PAAA 3DPIA 2HYIC 1YVPA 1QSGA 2GHQA 4MUIA 4YQYA 1YQTA 2A6HC 4P2CB 3JVEA 4AICA 3KAQA 4LF8Q 3L0ZA 4BL5A 4E13A 4FSHA 3SHQA 2GLXA 5JHGB 1K9MC 4P93A 5F12A 2GD1O 1Y3IA 3GGOA 2YQ4A 2X41A 5DM1A 2R6JA 4F4CA 2B63G 4GNXC 3NHUA 3K72B 3M4JA 3PQ8A 3ZS9A 1GQSA 1QUQA 5F2EA 5NUCA 2F0NA 1EM8B 1PF7E 2Q2NA 3AJEA 1C0KA 3KUUA 3D0FA 2GAIA 3KZKA 4LOHA 3PR2B 1FX0A 4M1ZA 4Q0MA 3FTQA 1XQVA 4XM1A 4KDRA 2I6TA 1VFNA 1Y8PB 4MVJP 2A7XA 4FDLA 5HMMA 3T0GA 1YJCA 4W99A 1WVLA 1A3VA 2H2AA 3HXTA 4A3IG 2F0GA 4X84A 1UC8A 3OLQA 5EBCA 1IRIA 5CK4A 1GZ5A 1SQ0A 3LXRA 4YIHA 2BI7A 2XCTB 5HFNA 4OHJA 3VOBA 4DEYA 5LU8A 3GLFE 1PJ4A 2DG2A 3DPUA 3LV8A 2VP2A 4Q4HB 4R9VA 1KI3A 4RSHA 4U8GA 4LFCB 1J07A 1FFSA 4O4IB 2QUAA 3RYIA 3QB3A 1Z13A 4MVJH 5EKSA 5K8LA 2PX8A 2V8OA 3C6XA 4CQLB 4F1WA 1P4HA 1TYBE 3K8ZA 2VBGA 4F97A 2ASVA 4IZIA 5H0IA 1F9AA 4W6QA 3GTOB 4O8CA 3AVXA 5JS1A 2BCJQ 3IODA 4YGYA 1BKYA 2XYGA 1WABA 4V0MA 3IL8A 2VLBA 3A11A 3CMCO 3MPOA 4PSKA 4UUQA 4ER3A 2NUPA 1HDRA 4LDQA 3O38A 4D4HA 1TF2A 3LC1O 4PZAA 4BZQA 2WHYA 2B98A 2I4OA 1UFKA 1WDKA 2X2PA 2XUZA 3AI2A 3Q8KA 1J0BA 3L1UA 4FJ1A 2WRZA 4PCLA 4GKKL 1KVTA 3MJEA 1TU2B 1H0KA 3QXSA 3UH0A 1Q81C 5EP1A 3DVLA 4KG7A 1OI4A 3RS0A 4LGCA 2F3PA 3MBOA 4FKZA 2CFCA 3A1TA 4EENA 3AVQA 4AG5A 1NBHA 5CGKA 3AOGA 5JBNA 1N0IA 5E2AA 1VECA 1JE4A 3HOZG 4EGAA 5IDXA 4Q1BA 1DXMA 1EG2A 3GMDA 5HF6A 1Q7TA 4C6TB 4DAPA 1OF1A 3H2KA 3A9WA 3KSBC 4FOOA 4FB5A 1BBWA 2H1WA 4QQKA 2LKVA 2IS6A 1UE1A 2PX5A 2GPSA 2RHCA 3WGQA 2H31A 1P4RA 4RF3A 1LTLA 4CN9A 4ZAFA 4BE9A 3MC0B 1K06A 3OCWA 4AMZA 2F2TA 1PYDA 4B6FA 1WNFA 4J0CA 5FPKA 1SEPA 4MV0A 5GAGC 3DMDA 3OQVA 1B1CA 2ZXRA 5DWDA 4HYQA 4O2LA 5LJLA 1NR5A 1WEKA 1HFJA 4FR2A 4F1JA 2CMFA 4YRLA 1HRKA 3GZNB 1YE3A 2QDXA 4LCEA 4GNXB 1RL2A 1NW5A 2VK1A 3QE2A 4IDOA 2DT8A 1KY4A 3RV3A 4M99A 1QCDA 1YHYA 2JFQA 3UMBA 1HEYA 1TVKB 3JVIA 2YY6A 1EEFD 4F9TA 3H3VH 1SVKA 2B1RA 3MT0A 3WLKX 1CUSA 2OORC 2Z5GA 1R2QA 1GV1A 3PK0A 1HSOA 4OXRA 4P4GA 4UDNA 3SDBA 2G9HD 3R3ZA 1VQHA 1MT3A 3PIO3 1KI8A 1W1WA 1WYDA 4MVJG 2ACKA 3EOBI 4MI9A 4EFNA 1OJ7A 4DV1Q 2EU8A 1RAGA 3AR3A 3I2GA 3W79A 3HGMA 3ESYA 4ZYYA 1UP7A 4NOLA 4QNNA 1I24A 2ZR7A 3OE4A 3IFTA 4LF6Q 1R8QA 2B99A 2G82A 3UOGA 3FMVA 2H1CA 2RGUA 4R8VA 3R4CA 5I9MA 2GCOA 3KLMX 5M29A 1UMBB 2A9QA 3GLHA 2R3SA 5EUQB 2OQIA 3BK1A 1Z4PX 4C1BA 5HTOA 2DTXA 2ZZMA 1DCZA 1V3TA 1HM5A 1X3SA 1OZGA 2BRUC 3FPKA 2GCPA 3QEAZ 3KV1A 4MDEA 1EB8A 1QP0A 2FSVC 1FDUA 2E2JH 1T5IA 2WJPA 3NHMA 4BGIA 5A62A 1KTIA 3I64A 2V1XA 4PXSA 2D5IA 4FXPA 4B76A 3CPFA 4V0RA 4TT3A 4LVOA 4LDJA 3KQSA 3F5FA 5ETJA 2F3SA 2I4IA 4HN4B 1WBDA 3BWVA 3I05A 1YTUA 2JANA 4JZKA 1HNWQ 2P8JA 3F8TA 1GL3A 1NUUA 4RMGA 4URVR 3HB5X 4Y6RA 5JXHA 5MFZA 2ADMA 1FQOA 2XQIA 3M6VA 4G1BA 1E3MA 1PT7A 4FUTA 2PXXA 1Q90A 1BCPB 1P2VA 1IFXA 1O96B 1VJTA 1LNZA 2DVMA 1TQ6A 1EFVB 4G07A 5EKDA 3SFTA 2B2CA 3I6IA 4GICA 4LUCA 1I2CA 5EPJA 1YRBA 2YDYA 4ICIA 1I6KA 2RJ3A 3TQTA 5BYAA 2F0VA 2B39A 1EK6A 1U0HC 2ZGVA 3M6LA 1ZJJA 5LQDA 2J6HA 1GYQA 3CCLA 2OBLA 2ZT6A 2EY1A 3QH4A 4OV6B 4BLPA 1WD1A 3DHWC 3WLSA 1X9NA 1EVIA 1N36B 4KR3A 2A4MA 4NKRA 1I3OA 2DOKA 2LKCA 3LYUA 2YMQA 1XXHB 4UDXX 5B1EA 2WSSA 2G67A 3WSWA 4MWOA 1Y8QA 2EFYA 3QPUA 2D7CA 2VP0A 4MIKA 1Z4JA 3S2DB 5DK6A 3CBGA 3TD6A 5HQ3B 2R5FA 1ILEA 1GQ2A 4I50B 2OCPA 1XJ5A 3USZA 4N41A 3H8JA 1SUEA 2ZKLA 3EA5A 3PO3H 2JSOA 5C44G 4UAUA 4ZOAA 2JLBA 4LA4A 1Z3CA 1KYQA 2CLOB 4BHTA 5JNRA 3K70C 3WLPA 3RW9A 1J5XA 3AF3A 3A54A 4KE8A 1QOQB 4UP7A 1A1VA 2GJ8A 4PM4A 1Z88A 1J1IA 1AK1A 1JBKA 1UBUS 1C0LA 3K81C 1LW6E 2RONA 1FLDA 1M34A 3E15A 3EZ6A 4MW5A 5HGXA 3U44A 4YJ3A 1CIPA 1HXHA 3JQ7B 1K6IA 3HKSA 3IULA 3T4XA 1N9KA 2ZBVA 2V6BA 3WRXC 2ZWMA 3R5TA 2H92A 1P5RA 2PUAA 2XIQA 4OU4A 3WBFA 4L02A 2BMVA 4GMHA 1KC3A 1ABEA 1P9RA 4GVLA 4RJKA 2J0VA 3KHTA 3F4KA 5CX1B 3HKZE 1IJEA 1L6IA 4XYEA 1NQ5A 2AC4A 1UBMS 3H7AA 1OX4A 2VJKA 2RJOA 3GRKA 3ILHA 3K6KA 3MS2A 4RVUA 4XFDA 3ZX4A 2R6FA 3D4OA 2IH4A 3LWBA 3D43A 3VO8A 5I9LA 2QPOA 3Q6MA 4MV5A 3MS4A 2X0FA 4M1UB 3HKZG 5IP7G 4IVNA 4Q1AA 5EPEA 3WLIA 4E3WA 1N75A 2D2EA 3B5EA 1QOPB 3C4JA 4MV3A 4DM3A 1FVFA 3K96A 3RAFC 2IP4A 3K73O 4I46A 4ESVA 1VIMA 1Z75A 1ID8A 3RV4A 2W8ZA 5KRUA 1NTOA 2NUPB 4EJ0A 2JXMB 1T6BY 2ZITA 4DCUA 1XP8A 2NUTB 4Q4JB 2H7CA 4TZTA 1L5ZA 3H2BA 1KXJA 1T8WA 1M8PA 1QUEA 1C8KA 2HO5A 3DAYA 3E0QA 5GIOE 2BKAA 5KX5B 4IIYA 4TTJA 3LKVA 2RAPA 4IRXA 2GI4A 4L27A 2E48A 4M0LA 3DOIA 1CS0B 4R2XA 3PNOA 3CYFA 5T4BA 4EPWA 3KUPA 1MH9A 1U2EA 2P2SA 2XMDA 1LLCA 2RCYA 3RIXA 2GZHA 1BBUA 3N2KA 2J3HA 3VSEA 1V8FA 5FO0A 3ZVLA 5H9WA 2W42A 1K75A 4WCFB 4UHVA 2F67A 4QEKA 4W5OA 5JH7B 3NBUA 3OTHA 1MH1A 4I9HA 1HZCA 4JJ6A 2DHDA 4R8NA 1HL7A 3SICE 3WS7A 5CVCA 3UQYS 1XYIA 3NKLA 5JAQA 1Z15A 4DB2A 2JCYA 3OUTA 2BDNA 1THGA 2O6HA 3ZCSA 1SHTX 5KZMB 1M1YB 3GBSA 2FWBA 4BO0A 1EE1A 2FFHA 1OU0A 2QQ0A 2CNLA 3PF4A 2HV8A 4P38A 4WCVA 1Q3HA 1N92A 2PD6A 2WSSD 5KKAA 2PIAA 4NAUA 3IE0A 5TJHA 2BC9A 3IHKA 1G2PA 1Y4DE 3PFGA 3JRXA 5B1YA 3I56A 1KJJA 4KSCA 2XRQD 1AE1A 2HJHA 3I90A 3L07A 2ZQYA 1KSGA 4YO8A 2DP4E 4BJ1A 1M7BA 4IOCA 2D74A 2QTVA 3F2IA 4KXLA 4OCZA 3SM9A 4R2KA 2F3VA 2QBYA 5TPWB 1BO6A 5JI2E 3CUVA 4QUFA 3ZXUB 3T3HA 4I7AA 3MQFA 1QIGA 2EZ4A 5C5EA 3M82A 4R6WA 2VYNA 4UW9A 3UJ6A 3OZUA 1RP7A 3OOJA 4QYWA 3W9YA 2OG2A 4E0BA 1BX1A 1IM5A 1IL0A 1ESZA 2VQFQ 2AN4A 4MR9A 2F8SA 4S2EA 2VIIA 4GDMA 4TVOA 5AVSA 3I1YA 5BV2P 3LFTA 2WTEA 1OT3A 3T34A 6GPBA 5FR2A 5JVDA 3GDEA 4D8XA 5CMLA 2YWHA 1Y81A 2YS7A 3ESXA 4P5DA 1N8NA 4B1FA 1R6DA 2RE8A 4LNHA 3VXKA 3ROXA 2O2HA 2MWMA 1Y5LA 4IKEA 5DP1A 2F9FA 4JCVE 2AMVA 3SK8A 1TIID 4MIYA 3TQSA 4J0JA 3WJ1A 2R8EA 3OJOA 4LV5B 4U7WA 5C8ZA 4B3TB 5I7EA 1TLFA 3P2KA 4URFA 4KO3S 1PJSA 2DBVO 3B52X 1SVIA 5A4AA 5FB3A 4LFCL 1AHPA 4F2PA 2LS01 3TTTA 2APJA 4JQZA 2X5XA 2WB1B 1IEQA 4KGVA 3VNRA 4BMOB 3Q9NA 1EVJA 5IT5A 2H5XA 1P4JA 1USUA 3HKCA 4A3KH 2FLWA 3NM5A 1KMQA 2XB9A 3ZTWA 1Y5RA 1OMOA 2DCUA 2VP3A 3DH0A 3TB6A 2HI0A 2GF2A 3TZBA 1P29A 1BKDR 3PCOB 3R6TA 3HABA 4BFCA 1U9YA 4K3VA 1CUGA 1HTLD 4F8MA 1YOVA 4J90A 4X60A 5FA6A 4B82A 1YONA 3IQXA 4FFSA 4ZT3A 3HOWH 1S2LA 4QUDA 1X19A 4RMJA 3WB1A 1PFQA 3W9SA 1EE9A 4A1FA 4TKUA 1UKBA 3VVLA 1C4WA 2MMGA 2REXB 2Y1OA 4PAGA 4UREA 4UU0A 4JBWA 5E4TA 3WSVA 2E8GA 1RIPA 1FNCA 2ZT8A 1EP3B 3FCXA 1E2EA 4MEJA 2WKCA 2FSUA 3IHWA 4YBZA 3DOCA 3KWLA 4RHRA 2E5FA 1M90C 2XNKA 4RAUC 1MFPA 1NVWQ 3ETDA 4JHLA 5I5GA 2H5EA 2GPBA 4PY2A 4ETMA 1ZVVA 3SBXA 1CQIA 3MWDB 5D5QA 4M76B 4RWEA 2IYWA 2PS9A 1EY8A 5JJBA 5LDDC 5EQDA 4LJZC 1ISRA 5ED4A 3MB5A 1QOZA 1RCTE 2BI8A 4IOJA 4C3HB 3BJUA 4MP6A 5KCZA 3VKFA 1U0BB 4Z1MA 5A9SA 3QWHA 1W4CA 4JC8A 2FGKA 2FPPA 2Z9DA 4JL8A 4RY0A 4I50A 2WR8A 1ELOA 5SZIA 1KAHA 5FLMG 1H2XA 3D8SA 4CFZA 2AX4A 2FWAA 1JYSA 1SU6A 2ZWPA 5AKKA 1D0VA 4MEBA 2WP8J 3DFFA 1FZQA 4NMXB 2E82A 3VR0A 2RVLA 2QW0X 3NWSA 5JRJA 4JI8Q 2ILVA 2PA0A 3CSDA 3PMFA 3YASA 4PO3X 1A5AB 1Y3DE 2P9HA 3S1QB 5A35A 4RA9A 1CYEA 1GPYA 1NW4A 2DBQA 3F6YA 4TWIA 2EY6A 4BBJA 5C4IA 3ZVNA 4MQBA 2VQEL 4UDOA 4S1NA 1WSWA 2CE7A 2FPGA 4WBNA 1PT8A 2QR5A 2J7PD 4DR7L 4PN7A 2X1LA 3NBHB 3GTGH 5JJIA 1UPXA 3CKKA 3E8SA 4KXYA 3L4SO 4NF2A 4RMIA 3EVGA 2NM0A 3JASA 4RG1A 1OXBB 1DFIA 1Y8RA 4W1SA 1PN3A 3STXA 1HYEA 1L1QA 3PLNA 4JSYA 3FUUA 4DJEC 4YJKA 3EAFA 3QPAA 1P74A 3LUAA 5AUNB 4CU5A 4F3YA 3UMRA 4Q3CA 2B94A 3RAPR 4D4JA 1TAUA 1T5EA 2RG7A 4IWXA 1RJGA 1IXRA 2VSQA 1FS6A 2QYHA 4RJLA 3UT5B 2VJMB 3ZCUA 5GONF 2A5YB 1XEWX 4JSRA 5CDHA 1Z7GA 3M1IA 3QVVA 2K2WA 3S2IA 2ZCVA 1R0XA 2R5NA 1J99A 3MMNA 3MJCA 1BS2A 1IWOA 2VI5A 1N6KA 5INTA 3WBJA 2BFDA 4NJMB 3AKEA 2D0PB 3I61A 2OWOA 2UVQA 1JHPA 5DBOA 2ZB7A 4KMOA 1VCNA 1IVNA 4ECAA 2NXWA 3HS0C 1NBOA 5JZ9A 2I1LA 2P4QA 5FLXc 2J1LA 1PO7A 4LZZA 2ZTSA 4Y6SA 1YQ9A 4I7EA 1QB5D 4FPXA 3E58A 4PZ6A 1BCSA 3EC2A 4P3NA 5KHOC 1GNVA 2BL4A 2FE1A 2O3UA 3G9ZA 2VNUD 1WDWB 3ES9A 2PT7A 3HRHA 4M8IA 4MRRA 1FVHA 3EEBA 2PXHA 4HXYA 1KXZA 1KDRA 3DFZA 1OX6A 4PV1C 1W59A 2CL0X 4G89A 4S35A 3X1YA 2QV0A 2WY2D 4N0PA 3CB4A 4GOKA 1D2CA 3IP8A 2FPRA 3NANA 4WJ4A 4GP9A 4JI2L 5JPIA 3F2CA 4Z99A 2ZYDA 4LPSA 3M6MD 1PL0A 4RIEA 1HA3A 1SG9A 4KUHA 5KSOA 4JVNA 2BM1A 2NYUA 2ZJYA 4BNGA 1YJ9A 5C18A 1OYVA 1QANA 1R88A 1U4RA 2HGZA 1JLSA 3I53A 3OZSA 1X6OA 4IDBA 4LI0A 2VP4A 2RHTA 2K87A 2I4MA 5L4NA 1U4OA 1RYMA 3OU7A 2WWGA 1GKYA 2R4UA 4F5ZA 1SIOA 5PGMA 5THXA 2ZBUA 4JA2A 2BYTA 4X7BA 4G8JA 1X7DA 1CHQD 1R6XA 1V8ZA 4C2MB 3BZDB 1FRZA 3FYUA 1CVLA 2ZYSA 3LIIA 2ON6A 4AO7A 5ANRB 1Y9JA 3QLEA 1GV0A 3HCWA 4J07A 4KU4A 4X3PA 4FYJA 1ECCA 1T36B 1XTUA 3I1FA 3CLHA 4KXMA 3WIDA 1LPBB 1MRNA 1RC1A 3SZGA 3WV5A 3AHJA 4TRDA 1I30A 2Z1CA 2Z1MA 2GJ4A 4KQ1A 3DDCA 5K0LA 4EITA 1Z5ZA 3ER8A 3W9UA 1CM9A 5DIZA 2FUEA 4ZVQA 3HJGA 2AQ3B 2CD9A 1QPGA 4N8FA 1ZUHA 2QMEA 1K8RA 4XPIA 4WBXC 1OILA 2C42A 2XN9C 3CCFA 1V43A 3JZAA 3HXOA 1EJ0A 3PFWO 1II8A 4PQRA 5LNK6 1FLVA 2FY8A 2ZRKA 4LTMA 1FB5A 2BDEA 4A5SA 4CM6A 2GHTA 1ESDA 4PQYA 3BICA 2Y3IA 3PR3A 1APBA 2FFAA 3KOJA 2GT1A 3H5RA 4Y2TA 4YCCA 5L7YA 1E1RA 1V11A 1XKXA 2BHSA 1XDUA 5A4JA 4I9UA 4W6ZA 1OOEA 1P17A 1UBOS 4DMCA 5T8KA 1R3DA 1T1SA 2QWXA 3LRXA 2P35A 4HMQA 1HEIA 4R1PA 1EFWA 2PNJA 4B3XA 4NXMQ 2HF7A 1C4XA 5KNDD 5EINA 4OMUA 4QO7A 2CVOA 5ITSA 1HKHA 1PTOH 3C3CA 4B2IA 5G1NA 2NTTA 3ZIAA 1JG2A 1KYVA 4PLPA 4LW8A 1RXIA 2GN2A 4R8LA 3ZD9A 2JPDA 4BY1B 1TLLA 3RG2A 4BC0A 5JAUA 4A3MG 1W93A 1SZPA 4RGTA 2ZR0A 16PKA 3VAAA 5CV6A 1JUDA 1HDOA 1UJ2A 5LP1A 3MRVA 3ZIDA 3HOYG 2I8AA 3HDQA 4LUOA 4L8VA 1HORA 2YWEA 4YY3L 4KN8A 5FUBA 3D4NA 6AT1A 2EFDB 1XEXA 3ASYA 4LF7Q 1RPAA 1LDNA 4JQYA 3M4ZA 4CV1A 4OX9Q 4MUHA 1EY0A 1ZOOA 2L11A 1RJFA 4ZRMA 4MV4A 3GRVA 4XCQA 4TTAA 2NVXB 4JI6L 3HVUA 1IC6A 2XBUA 4GH5A 4MV1A 2DR0A 1O6GA 1A63A 2PT5A 1VSTA 4IPCA 1RRFA 3ZY6A 4PSUA 4AP5A 5FV4A 1WETA 5TARA 4KDEA 2MYTA 1P81A 2VDWB 4EVIA 1NOJA 4F72A 3NWTA 1VLJA 2MIIA 1B0AA 1V16A 1VG1A 2R62A 3O1JC 5AYVA 3VZSA 5JD4A 4XDXA 3KDSE 3H5LA 3ENWA 5FBHA 3CH7A 1IG3A 3T9BA 5IF9A 5JNLA 4IILA 1M8GA 4HYYA 2ZAGA 3TH5A 1Z34A 2GZ3A 3K0FB 4G5FA 1A3TA 3GP8A 3FIUA 2ZRNA 4R8KA 3FZNA 4L4YA 1IB6A 3VPXA 1ZMTA 2BGLA 4EQNA 3EAGA 4BO8A 3DMUA 3GQBB 3U16A 1FYVA 1Q7RA 2EX1A 1MOQA 1DPFA 2PKWA 2HDOA 1TYDE 1V8QA 2JJ1D 3H16A 3AESB 4GGPA 5K3AA