3PUZA

Crystal structure of a pre-translocation state mbp-maltose transporter complex bound to amp-pnp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the maltose transporter in a pretranslocation intermediate state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein, membrane protein
molecule keywords Maltose transporter subunit; periplasmic-binding component o
total genus 88
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2010-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3puzA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3puzA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3puzA01
2AD1A 1VQLA 2D5DA 1WQ1R 5LMNW 1Z28A 3CBQA 5BYKA 1DBSA 4F92B 3DKPA 4DHEA 3GLIE 2R6FA 1PYBA 2ZYWX 4Q48A 1R0XA 2G3YA 3GO5A 2W2TA 4H0LC 1P8LA 1BO6A 1DOAA 4RFSA 5KNDA 1HNZL 3GJ6A 1XMJA 2JJ1A 3H94A 4OGQC 5FPTA 1S4QA 4JKIA 2QQEA 4WJ4A 3T1QA 2XTZA 1AZTA 2IYRA 3GLFB 2WWYA 2V8OA 2MFIA 4JYAL 2R62A 2RHMA 2ZVQX 3AVPA 1NIPA 2WIBA 5EXPA 1KO4A 2Z83A 3EA0A 4M9XA 4GLVB 1E4VA 3KXLA 2ATXA 1E2IA 2CDNA 2FGKA 5TV2A 1VYVA 2FNAA 4LV6A 4AIIA 1R0ZA 4YMSA 2QTHA 3U44A 1Q46A 3HOVH 3IQWA 4FMCF 1WFQA 2J41A 3L8ZA 3O8RA 2Q2IA 3CC7A 1NJIC 1G21E 5DH9A 1YRAA 5TB5A 1WE2A 1IY1A 3TW4A 4ACBA 1X1RA 1XP8A 4BASA 3IFTA 5E4FA 5B30A 1MV5A 3NEJA 2UXCL 4NP6A 4G7HC 4BFTA 3U5ZB 3GCGA 1G8GA 1Z83A 3LXRA 4OI0A 1QUQB 1YZKA 4JKYA 1D8TA 3AVXA 3N6RA 3U58A 5DI3A 1KQSA 2QZ4A 2F1HA 3KLWA 4JLVA 1H95A 3QF7A 4YDSA 1P62B 2EYUA 1UJ2A 3C4JA 2KHJA 3ZD6A 2NVXH 1PH7A 4DUGA 4HEJA 2LWIA 2XTIA 4WJ3M 3TNFA 2R92G 3CF6R 2FA9A 8OHMA 4LF9Q 1SXJB 2DR3A 5DHAA 3BH7A 4KLKA 4NBSA 1N36L 1D2EA 4B32A 4ERNA 1D5CA 4HDOB 2ZRMA 3OYYA 4AH6A 2PT7A 5H1YA 2QGQA 3R9IA 4LGMA 2ZRIA 2D4HA 4LYAA 2O0KA 1P9RA 2WKQA 1AQYA 2K32A 4PG3A 2F43B 4Q7LA 4QJ5A 2JLSA 3LBIA 1LM0A 4EJSA 5DHFA 3NBFA 4LF4Q 4EPRA 4JL8A 2CL0X 3SJAA 3WDNA 5KYKA 4JOIA 5ELNA 1OV4A 4YMUA 4B3GA 3TSZA 3W90A 2JIZA 2QL6A 3IGFA 3UIEA 5BW8A 3OW7A 4B74A 4U5XA 3VDYA 1R2QA 2JQOA 1GTVA 4B35A 3L8YA 2ORWA 3X2SA 2UXBL 1MO4A 2YU9H 2ZI9A 1Z6AA 2Q3HA 4MKIA 1X54A 4QGUA 5FTJA 4AI6A 1O3YA 4OHWA 1FP6A 2ZSDA 1ZYRC 2VS1A 4A1FA 2XEXA 1JJ7A 1TF7A 1KK2A 1ZU4A 4IDNA 4KYIB 5LD2B 3THWA 1KRTA 1GP2A 1P2UA 4C0SA 1E2VA 2REXB 3KDSE 4N0DA 2J45A 2B63H 1AK2A 2X1VA 4JL6A 1KJYA 2IYVA 4A9AA 1E0AA 2V4DA 1GHKA 2B8WA 2BCGY 2WKRA 3QKRA 5TMPA 4JI7Q 1UKVY 2O8BB 3S1QH 1OH5A 2W6ID 1IBLQ 3K9GA 5FI0B 1MRSA 5J5CA 4ZDKA 2QPAA 2RGCA 5HR5A 2VF7A 1E9AA 1S1CA 2GBLC 2QF7A 1XJCA 3PCOB 3QVUA 2L0XA 4DRZA 4NPSA 1W0JD 3P4YA 1U5KA 3TAUA 1KI3A 4GZYC 3I4OA 4FDBA 1TMKA 1YR7A 2J3EA 1YR9A 3EG5A 5CLLA 4Z54A 2Q3MA 1GSIA 4L5QA 4TMXA 4MRVA 5CLQA 5F2EA 2D0OA 5CJ2A 3U3OA 4D82A 3CX7A 2XNDD 1OF1A 2GHIA 3Q5DA 1FOEB 4BA2I 2B6HA 4HJ8A 1VYUA 5JLJA 3PUWA 4QIWE 4C3IH 2QMOA 2CLCX 4EAQA 4LV5B 1F60A 5CJPA 3GLHE 3V4FA 3KJPA 5C4JH 2CWPA 5FOTA 1RC8A 3REFA 1E2PA 3RRNA 1X86B 4K46A 4R71A 2JJQA 1RRGA 4HIDA 3CW2C 5JECA 1KD1C 1FNMA 5HKKD 1WA5A 2MSCB 1VHTA 1VF7A 2I1VB 721PA 4ACAA 1KDTA 3EPJA 2E9SA 4PQYA 1T91A 5E7IA 4BGDA 3KDFA 4C0KA 4D80A 5C44H 4IW3B 1TPZA 4OWXB 1F2UA 4QBGB 5G3ZA 1G291 1MO5A 1IOZA 4XTRA 1S9DA 4B6FA 5TVKA 2FGJA 4Q01A 4TL7A 1EGAA 1I6HH 5FOWA 3EBEA 2KBFA 2E5LQ 1UBFA 1SULA 2CK3A 1KIXA 4OL0A 2BE5D 5C46F 5K8TA 2XXAB 1NIJA 5C44G 2R93H 4S2EA 2MO1A 3ZGXA 4HB4A 4G0NA 2MO0A 3LO5A 4HUQA 3FMCA 4TTQA 1ZC4A 2DWOA 1AQUA 5EXXA 4Q9IA 1M7BA 3TUZC 2GXUA 2ZAOA 3IBGA 1H9SA 4FN5A 1E94E 2K5UA 6Q21A 3SFVA 3T1VA 2HLDD 4B47A 5AK0A 3EZFA 3FWYA 1Q0UA 2IYTA 1OFHA 2FSGA 2A6ED 3CC2A 1NG1A 2FZLA 3LVQE 2NVYH 4D0GA 4EPTA 2NQ2C 1RYHA 2UXDL 2LSSA 1XWIA 2W0MA 3WMFA 2KHIA 2AMCB 3TH5A 2QT0A 5M3MG 1HCZA 4LFBQ 1TU2B 1C4OA 3RRZA 2IXEA 3LV8A 3NENA 2Y8EA 3KLRA 2Z6KA 3QUSA 1E2HA 4A3FH 3W9YA 3A8JE 1GRRA 1W4AA 3CPJB 4IEEA 1XD8A 1G6PA 1E9RA 2O5JC 4EQ6B 4XSHA 2G0NA 1WRBA 1PFSA 2ZJ8A 2IUTA 1P2TA 1EFUA 4NXML 1DE0A 4GN3B 5IY0A 1UF9A 4D4KA 1BYUA 3J81c 4JT2A 3ZS8A 4MGZR 1RVDA 2AD5A 5GROA 4Q00A 4Y0VA 5KSZA 3PENA 1JXMA 1Z5ZA 1X8JA 3ND9A 5IYCG 2NO7A 2ZS8A 2GWHA 3HOWG 5CYOA 2NZJA 5J40A 4AWXA 2WAYA 4AQYQ 2IY5B 3C8UA 1W4CA 2VHUA 3NIBA 3Q8XB 3SBDA 3K0SA 1FUUA 3ICEA 2W6JD 1GITA 4MYHA 3I3SR 5EZ5A 1J2JA 1YJ5A 3H1TA 3TK1A 1G18A 1R4AA 1I50H 3I4MH 3CPWA 4AKGA 1ZJ6A 2ID0A 4A3EH 1U8AA 3REGA 5FPKA 2ZYTX 2HYIC 4JZKA 1G1MA 2CHVA 4URXR 2EQSA 821PA 1KHTA 5A0FA 2O8FB 3R8CA 2GVAA 1DS6A 1XX6A 5G40A 4IFBA 5L3RA 5JJLA 2F3IA 2NTYC 2GTPA 2OCPA 2F52A 4A3MH 2JJ1D 2O0JA 1RIPA 1HUQA 2GESA 3HOXH 3AF2A 3FKQA 2H92A 3ADBA 4LOAA 3RABA 3IEVA 1EOVA 3H3VH 2PNHA 1VF5C 2BC9A 2E2IH 1VQ9A 1G9XA 3ZVLA 3I2ZA 3NH6A 1OLOA 1XD2A 3CWQA 4ME3A 4JC0A 3J7ZC 2RGEA 4LF8Q 2AHOA 3TLXA 5JZVA 1E32A 3EPLA 1XMVA 2JLQA 2IYWA 3OEHD 1DXMA 1XJVA 4Q9HA 2XZPA 1II0A 1P9NA 4B3RL 1DAKA 1YZLA 2JAQA 1GKYA 4C3JH 2KE5A 3UMFA 4NL4H 2V1CC 2FXQA 5KDOA 1V8QA 4GP6A 3CZQA 2DFLA 3GEIA 3LBNA 4A0FA 2O8CB 2AFIE 1MRNA 4OKSA 3BJUA 1Q1QA 2ZJZA 1U90A 3CONA 3HOYG 3DVLA 4MGYR 1YI2A 2ZRHA 1HJPA 4QJFA 5DGXA 4XD7D 4JI0Q 3PVSA 4KKUA 4LI0A 2ZUDA 3GP8A 3W1GA 2AXPA 2XNSA 2ZRJA 3W6PA 3I7FA 2OQ0A 4DXAA 3K1JA 3LNCA 2QRNA 3U3KA 2VSFA 4DJTA 4JSTA 1K83H 2WB1G 3B9QA 4QGAA 4C0AC 1TWFH 4PO9A 1GUNA 1ZD8A 1WCMH 2N42A 2RGDA 1PH2A 3BD9A 3SNHA 3WNDA 2ODEA 3VMFA 3QSYA 2NPFA 1VS0A 3L0IB 4DK3C 1OIWA 5FUYA 2ANCA 5HGQA 1XEWX 3QKUA 2PI2E 4IQZA 1N32L 2E74C 1HR0Q 2PZFA 3MJRA 2ZITA 2JASA 4ILEA 4PANA 1YR8A 1Q22A 2N3SA 1DAEA 3ZIAD 5FR2A 1OIXA 2ZR7A 3C5HA 4ITRC 1BH2A 1LVGA 3C5CA 4BFWA 1TQ6A 4CEIB 1CI3M 4PPQA 1EESA 4JK1C 2OSBA 3K0AA 1BMFA 2E5LL 4Q4AA 2BV3A 2Z4SA 5TDHA 1SGWA 2GILA 3D6TB 3V9PA 3UDFA 2I3BA 4GLXA 1NTGA 2X8AA 1FQKA 1M2OB 4TVAB 1D7QA 4RFVA 1HE1C 1NBMA 3QXCA 1N5JA 4M1TA 4LUZA 3GMTA 4TQUS 4BA1I 1KC8C 2OZEA 4DR7Q 4L15A 4G5OA 2IUUA 1KK1A 5IK2D 3U7GA 4CEJB 1Z0DA 4ZDJA 2AK2A 4A3BG 1C0AA 2ZTEA 1AS3A 4LHXA 3WMEA 4B6EA 4HAVA 1BS1A 5KNBA 4PSAA 1E3PA 1VCNA 4KKTA 4WZ6A 4ZCIA 2IWRA 2FSFA 2IW3A 2QSYA 3FFAA 3PO2G 3DL0A 4IDHA 5H68A 4DEXA 1GUOA 4AKEA 5AUPB 1BVSA 4BLPA 2GVBA 1LF5A 4Q66C 4BLTA 3GLHA 3U7FB 4MGIR 3WRYC 1XTQA 2FOLA 4A3CH 1I4DD 5K8LA 4TYYA 2VQEQ 1ZD9A 2OE2A 2N78A 4IFDI 2P6UA 2ZRPA 1HE8B 1H8EA 2OT3B 4TZ6A 1W3SA 1PZNA 2W0SA 2ZI6A 4JSYA 2OAQ1 3W5JA 3N2IA 1E2DA 2EJGC 2JDID 5CB6A 3S2DH 3RSLA 2W00A 3GLGA 2HHHQ 5JEAH 4HB0A 2QRZA 3F1ZA 3CCMA 1G8YA 3KJIA 3ADCA 1CULC 4C2MH 2O8FA 3CP0A 1K8MA 1TU4A 1GILA 2DY1A 2FPLA 3PITA 1HQCA 1IN8A 2BMEA 4UXHA 1OB2A 1UDXA 2IEYA 2WM9B 3DM3A 4UP9A 2I5LX 1J8YF 3I92A 2B3GA 1ZRHA 1GNRA 2ZUCA 3H2YA 4AYBE 1Z0FA 3S1AB 1UBCA 2GEDA 2Q2TA 2J0QA 2PCLA 3PIRA 3DEFA 4Q1AA 5IYDG 5SZIA 3W5OA 4UP8A 3SHFA 2DFNA 2FJUA 3EC2A 5EP1A 2RGNC 2C98A 1JMCA 2D7DA 4GP7A 2JJ2A 3QENA 4C30A 1Q7YC 1QVAA 4EIWA 2CLSA 4TYNA 1XXHE 4F91B 4G5GA 4LY6A 1IAQA 4QJ4A 3QVVA 1NBWA 2CCGA 1U0LA 2ZSAA 4Q4LA 3ZD7A 1T6NA 1ZNXA 1KL9A 4UPAA 3CH5A 3QOFA 3SR0A 4Y7NH 4DV5Q 4DDWA 3TZUA 4JI6L 2PLFA 1L7VC 5E95A 3FB4A 4A3DG 3OZXA 1G16A 2FPKA 4P3YA 4OI1A 2ZRFA 1NBME 3PF5A 4KN7C 2UUBQ 4QQBX 2XX3A 4MDFA 1A6XA 3EIEA 2OFOA 4OBEA 3VQTA 2IC5A 1Z6HA 1P60A 3FVQA 3Q8DA 4GBMA 3SJBA 3WNBA 1XCGB 4LUCA 1EXMA 1OE0A 3B7GA 4RZ2A 3U4VA 1NI3A 2R2AA 2H5XA 4HDCA 1VECA 4LFAL 2GXAA 4QL3A 4RSGA 1Y1VG 4DUZL 2UU9Q 4IPGA 1XTIA 3VR4A 2K5VA 1M1KC 2ONKA 4LJZC 2CJWB 4KODA 1O78A 3FDIA 4OJKA 1EX7A 2A5GA 2ZR0A 1ZC3A 3ZZUA 1PH1A 1EQQA 3KKOA 3HOYH 2QAGB 2Z4RA 5J3BA 1XF9A 4P4TA 1YJWA 4S35A 4B73A 3ZJYC 1XXHB 2XB4A 2DHRA 3CW2A 2AWOA 2YC4C 4JBXA 4BBRG 2WWIA 4LJ5A 4TTPA 4ZCLA 4PZ7A 2UXBQ 4QHSA 1T0JB 5G53C 4DSUA 1R8QA 1NKSA 1XU4A 1ZM7A 1YIJA 4TMWA 1N9WA 1F5NA 2FFQA 2OCAA 1LTLA 2RAPA 1U99A 4ON9A 2FWRA 1DAMA 2EVBA 1IBRA 4G01B 4TL8A 3H84A 1JNYA 3RAPR 3OAAD 3JZMA 3M4OH 3T1OA 3SQXA 3GTOH 1Z6TA 1L4YA 4LFBL 1MJEA 4RFSB 3RS0A 1HQYE 3GPLA 1N32Q 3X1DA 3SDZA 4HLUA 3EPHA 2ZS7A 3L2PA 4GOPA 1V9PA 1ZW6A 2V3CC 3SI7A 2KCMA 1VDZA 2VQFL 4DR5L 1SXJE 1KIMA 4BXXH 2WJVA 2FU5C 3HPQA 3QPVA 4Q4HB 4IOKA 2C35B 1Z2AA 2D3WA 5IRCD 4JVMA 1BKBA 1DCZA 3ULPA 2P2LA 3L0PA 2I5HA 3OIVA 1KHIA 1DG1G 5FL7A 1G4UR 4JI2L 4B3DA 4A3JG 2YVUA 5C1BA 4ZPXA 2DFTA 5GJBA 4B3BA 2HIXA 4TLBA 3L82B 4X64L 1XEXB 1PH5A 3QBTA 1GL6A 2X19A 4DV7Q 4GKJL 4A3MG 1CLUA 1RJ9B 3ER0A 4NPHA 2K5HA 2ZTSA 3B82A 3AM1A 3PSIA 2GEUA 3I72A 3AVQA 2LXJA 3GFTA 1XMOQ 3UMSA 4GOXA 5BXQC 3LRPA 3OEHA 3SZRA 2CXXA 2GCOB 1KDOA 2GKSA 5ELXA 3BZKA 1C9OA 3DMNA 2Z6KC 2BA0A 1VQDA 3VHXA 1U94A 1JJ2A 2WV9A 2WOJA 4LFCQ 4UNSA 4A3FG 1CEEA 3AFQA 5GAEC 3KTAB 1HURA 1HH2P 4OO1I 4C0QC 3FKSA 2EQBA 2C9YA 3VHLB 3UPUA 121PA 3PXGA 3U50C 4KBFA 2QI9C 1S40A 2IYYA 5JWOA 5M3MH 3T34A 2C9OA 1MKHA 1XMOL 2FF7A 1WCMG 2I0QA 2AHOB 2PEYA 3HYRA 1N3BA 3RSOA 3M9BA 2WMNB 4DWJA 2D2EA 4KFUA 2QAJA 1GO3E 4IXNA 4F38A 2OXRA 5EP4A 1PH4A 4HZUB 4CEHB 5HPYB 4DV1L 4RD3A 1UPTA 2JLWA 4HLQB 1D8LA 1E2LA 1T4GA 5EP3A 2RHQB 3EZ6A 4F4IA 4W5HA 4HSEA 2XTMA 4ARZA 4BFXA 3CPEA 3WYAA 3OIWA 5JRZA 4JV5L 1DD2A 1CIPA 1EFRA 1NJGA 3B78A 5BN5A 4XTCS 1VQIA 4W5JA 2AUKA 2KA7A 3P27A 5K36H 1DARA 3MXUA 1NNEA 5FLXc 3LWNA 2FMXA 1TEXA 2YWHA 2V1UA 3PR1A 3CB4A 3THWB 2BEJA 4DV0L 1KKMA 3PUVA 1H9MA 4IVRA 3NBYC 4LRWA 1HT2E 3EARA 1E69A 1Z22A 5D3MA 1WYDA 1AZSC 2SHKA 3THXB 1LFDB 1CSQA 1N34L 1ELOA 2IEZA 2RB4A 3BGWA 4NYJR 4HDQB 1TU3A 1N6HA 1FQJA 2EJMA 5FL3A 1GUAA 1WXQA 1XRJA 1T9HA 1IQPA 1XTJA 3F5FA 4BY7G 1YZ6A 4XVUA 3U7HB 1N6IA 1CRPA 1AGPA 1OW3B 4URWR 1OXSC 4A3EG 4Q7JB 3TRZA 1ASYA 3CF0A 3D7MA 5FTMA 4B76A 4Q18A 3ZZTA 2EFEB 3IPYA 2NPIA 1NSTA 3IHWA 4M9SA 4V0NA 2UZ3A 1M8PA 1ASZA 1E2FA 4GI7A 2ASBA 3TMKA 3G6EA 1QDEA 2A6HC 2VHJA 3CX6A 3Q85A 5GJCA 3IO5A 4JMPA 1CF4A 4DUZQ 5C4MA 4URZR 1Z47A 4X66L 2GVDC 4QBHA 4XWOA 2NMVA 3L7ZC 4CEJA 1GNQA 2OCEA 2OLJA 1KJZA 2DNEA 4RZ3A 1HH4A 4M2LA 3KTAA 1KSJA 4KFRA 4OHVA 4Q9LA 5JRJA 1DGSA 2XZOA 3TSWA 2JJ8A 2PX0A 1K8GA 1FW6A 4JI1Q 3UE1A 2VHQA 5JSZB 1VQNA 1Q44A 5J4KA 2JLYA 2HDNB 3AYHB 3HDTA 2ZQ5A 4A3JH 4JI0L 1KK0A 1US8B 3S1NH 1QG4A 3BZCA 3PEUA 5G41A 5FPYA 3GLGB 2UVQA 3KZ1E 3PV0A 1II8A 2AX4A 4BFVA 5F3WB 1TKWB 4DV6L 2ZAMA 1A0IA 4BY1G 4DB2A 1UKEA 1QVFA 3M7NA 3PCRB 3W1BA 4Q1DA 5EE9A 3TVTA 1Y8OB 4EFLA 4EJSC 1OKKA 2L5TA 1FP7A 1E6CA 1QF9A 4DUYQ 4B3CA 1M7HA 1JALA 1ZNWA 2V7QA 2JA6G 4IOCA 3I4NH 2PNRC 1XNJA 2QP3A 2EVWX 1AE3A 5FJ8G 2BWJA 3AF4A 3QNUA 4GFDA 3NH9A 3SFZA 4QM7A 5K8IA 1WBDA 1U2RA 3EPKA 5GADC 3OEED 4Q4HA 1KO1A 2O8EA 3QKRB 1VQBA 1XBTA 3LD9A 2FEMA 2YOGA 3CR8A 2F4VL 1YEZA 4LC0A 3I5YA 4MTNA 4QL5A 1Z0KA 2ZI7A 3PIPA 4QBIA 1MH1A 5FOSA 3S1AA 2BDOA 3JZAA 3DMDA 4B3RQ 3AEZA 2ZRKA 4RD2A 2R92H 3T61A 3WBKA 2H7VA 4YHHQ 3EN2A 1KMHB 3CRW1 3B1YA 4UNPA 4K0KL 5TY0A 3NG1A 1JECA 1BBUA 3ZS9A 1O87A 4YXWA 2C2HA 1AH9A 2JA9A 1AKEA 4P4SA 3EWAA 5B2ZA 2EFCB 1LACA 1XFAA 1AJEA 1L2TA 3ADKA 4A3KH 1W0KA 2F7SA 3L2OB 3RS5A 5LDDC 2WAQE 3UDIA 3ASYA 2JIZD 1J5EQ 2JA8G 3I1FA 5FOVA 2QG6A 4OWTB 5CM9C 1IY0A 1XNQL 2YWGA 3N5CA 4UY8C 1XD2B 2QT1A 2E8GA 1RRPA 2ASEA 2J0VA 1PLJA 4HB3A 4ESVA 3PF4A 1W5SA 2O5VA 3RDPA 3WYFA 1KI1A 3AFPA 4DV4Q 2D7CA 4G1UC 4I1UA 2VY3A 1OH6A 4OO1G 3SEAA 4DV1Q 4Q1CA 1NG9A 2RCNA 1I6VC 2F1JA 2VP0A 1BOFA 3C15C 4TQAA 3BE4A 4QNRA 1AS0A 1C1YA 3HOVG 4WZAE 3GLIA 1HR0L 2G0TA 3E2IA 4KI0A 4P0TA 4Z8XA 1I4TD 5JHGB 5DN6D 4D6PA 2FSIA 1NY5A 1B9MA 2ZE7A 2UU9L 2UXCQ 4GRAA 4K0KQ 3IHLA 1Y69U 2BIFA 3K9NA 1CR0A 2ATWA 1OHHD 5IT9c 1CJTC 1MJCA 4JBKA 1EFTA 1WP9A 3MRSA 5IF9A 3NEYA 2ZR9A 4OHXA 1BYIA 1KMQA 4C0LA 3GDEA 1C9KA 4I4LA 3CAMA 1QRAA 4E07A 4A3DH 3L0OA 3MUFA 1Y14B 2Z0SA 1VQ4A 1SVOA 2VO1A 1NLFA 1GKHA 3TEHB 3CMAA 4B3ML 1PVOA 1FGUA 4A3IG 1E2MA 2G77B 2I4IA 2XNDA 3X1XA 4F4JA 2PH1A 1E2KA 2OAP1 4APVA 1E2GA 4HYYA 1GUSA 1EIFA 3UG6A 1IN5A 2PCJA 4PSVA 2WWXA 2GK7A 5BN3A 1Z0AA 4DV7L 2A5DA 3NELA 5E7JA 2XXAA 2YWFA 5HE8A 1VCOA 3QIAA 2VP4A 1G5TA 3B9PA 1SZPA 4MDEA 4O2LA 3IRBA 3BS4A 5HKKA 2C8VA 2O8DB 2CJWA 5JEAG 1R7RA 1E2QA 3AKYA 3VKWA 2QM7A 3ZZ0A 4FWIB 1UBEA 1RW4A 2HUPA 1QUQA 4ZIRA 3CCRA 1A1VA 4LF7L 1TWHH 5C0XJ 1SKYB 5FLMH 4EFMA 1JT8A 5AJVB 4IHQA 2B7BA 2R65A 4UP7A 3LLMA 1G3MA 3BFVA 4JCVE 1XTRA 4TYWA 1OTCA 1RKBA 3NDBB 5C0XG 1NBMD 4Y0AA 1K9MC 3HFZB 2WSSD 4OQFA 1R0YA 2G6BA 4KBGA 3J81i 3CCQA 2ZRGA 4PMWA 1OT3A 1YU9A 4HJAA 2GCOA 4WXRA 4U02A 5LMUL 2ZIAA 3B13B 1NP6A 4FXPA 3K09C 4IPDA 4NCKA 4QNMA 2IYQA 3GLGE 4HUTA 2VPPA 1DVRA 5TARA 3AVTA 1HZBA 2HF9A 2Z6VA 4MYCA 3GLHB 1Y1VH 2ONJA 1B23P 2DYKA 1XXHA 1JR3E 3AB9A 2R7ZH 5E7NA 3A4NA 4L9SA 1PH3A 1X1SA 2MMCA 3MGCA 3HU2A 4O0MA 1GVNB 1D6JA 2C96A 1NVUQ 4N0EA 1XZQA 5DLQC 3U44B 1JJGA 2GF9A 4N3NA 1E9DA 3Q7PA 4IFDH 3KUCA 4DCTA 1Q21A 4FMBB 2EYQA 4E5UA 1KMHA 3UATA 5M5XH 3AV0B 1UADA 1RPZA 3G4SA 2R7DA 5B64A 2O8CA 2RH5A 2YC2C 5DIFA 3QXJA 1L8QA 1CP2A 2UKDA 4B3SQ 1F6BA 2CE2X 2WWGA 621PA 1Z06A 3CIOA 4L16A 3WP0A 4ZO4A 5IP7H 2UUAL 1TWCH 2CCJA 2ECKA 1K6MA 1VG0B 3WYGA 2R6DA 4R9UC 3P32A 4HAYA 3KUDA 4KSBA 3T5GA 3TSOA 4BRWA 4CEHA 1K5DA 5IP9G 4GMXA 2O52A 3G82C 3DLLA 2Q2HA 2H5EA 4F7WA 4CEIA 1QBKC 4TWZA 1KTVA 3LBHA 3X1WA 4US0R 1HPCA 3IKJA 4W7SA 4A3LG 1J6QA 3CLVA 4A36A 5IT5A 3EWSA 4E09A 4QXAA 4AG5A 4H9GA 2K33A 2F6RA 2XOKD 2VLIA 5J4HA 4AYBG 4KSCA 1DG3A 1KSGA 3B1XA 4Z1MA 3A1WA 1G64A 4D26A 3MLEA 4BZXA 5IK2A 1DAHA 1N5IA 2J59A 3C41J 4ASUD 1XNQQ 1N6PA 1SMXA 3HR7A 4GKJQ 1OH7A 3B6EA 3Q72A 2R7ZG 4FMDF 4TL9A 2YOFA 4JJKA 4DUGD 2AN9A 2D74A 3ZIAA 3VKHA 4LF9L 2G1JA 1U8ZA 2E87A 1LF0A 3QXSA 1KI2A 5KTYA 3T1YL 2ZS9A 4RKFA 2HJVA 2QENA 2WHXA 4JI2Q 5C4XH 3M85A 3RZDH 4FCVA 1SVSA 4CT5A 5EXTA 2MQHA 2O0HA 2OHFA 4W9MC 4OQLA 1VG1A 3KFXA 3WXMA 3TBKA 3SOPA 1CFMA 3HOZH 4M22A 3CO5A 1QJOA 2B92A 1X65A 4FINA 2CK3D 1IYUA 5LBIA 4DV6Q 4H02A 3GTMH 1QHNA 4MITA 2QUZA 4PSKA 4YQFA 2F1RA 3U7EB 1KI4A 3N2EA 4UQOA 3BXZA 4PTLA 2RGAA 1AE2A 1NL3A 1ZM4A 1ANKA 3FOZA 3G48A 2CCZA 3FMOB 1KI9A 1P2SA 3BOSA 3FP9A 3MG9A 3K53A 1QHGA 1J90A 2CBZA 2OUKA 2CKZB 3RNUA 1SLJA 2YZ2A 2QBYA 4DR2Q 2QQ0A 3CNNA 4XVQA 1KDPA 2F3RA 2K52A 4YWMA 2VP6A 2ZE5A 1XNRQ 3IEUA 4D4JA 3B2EA 1ZCAA 4JI7L 2WSMA 5EE5B 1OIVA 3MWLA 2VSXA 2ES2A 2IHYA 2Q9AA 5DLQE 3A4MA 2VL7A 3LQQA 3WP1B 1X56A 1JI0A 3OAAA 1P75A 5EP2A 1QHHB 3ICQB 4GLAC 1X6VA 1NMGA 3EZ9A 3THXA 1ZYUA 3A5UA 1JJVA 2OBMA 5H70A 4ZDWA 2XB2A 4IOJA 2QEXA 2AKYA 1P16A 2ZM5A 1SROA 1JQJC 4I81A 4JLDA 1G19A 1KYIA 4ARZB 4YMTA 2GF0A 1UBGA 4B3XA 2WMOB 3BB4A 2ZU6A 2QORA 2MNAA 2IK8A 2ORIA 1I5FA 4KHZA 1TWAH 1E1QD 2VA8A 3OIUA 5HCIA 2Q0HA 1GUGA 1KKLA 4E03A 2QE7D 4LJ8A 5JCZA 3AVUA 5IYBG 1XPOA 1SHZA 1PH8A 4PXAA 1RJ9A 4POAA 5JS7A 2XGJA 1COWD 1K5GA 3LXXA 4L5BA 5CM8B 1VQPA 1Q3HA 1X3FA 4IJMA 2AR7A 3SYNA 2ZRBA 2NO1A 3K09A 4JI3Q 3M6AA 2QMHA 1VKJA 2PMDA 1W44A 4D2IA 2ZETA 4DLXA 3RC8A 3ZYCA 3MJHA 3W6OA 2FPMA 2H16A 3KB1A 3U3JA 3THYB 1TEVA 5KSPA 4JVNA 3H3VI 1W2BA 1XTKA 5EQTA 4A15A 3EQLC 4JYBA 4KITB 1CS4C 2Z0MA 1SQ5A 4B3FX 2OFXA 3AVVA 1XPUA 2QNRA 4DV5L 2OWOA 4A2QA 3I4LA 5GAHC 5CYPA 3GTKH 2X77A 1X8LA 1YJ9A 4DKXA 4HJ9A 2NVQH 1AIPA 2LKCA 3S15H 1VQKA 5KPDA 4YY3L 5E7MA 4IOAA 2G88A 2JDIA 1PLLA 4WVFA 2A6HD 1U9IC 1JPNA 1X3EA 2P0EA 1KNXA 2PQAB 1FFHA 2VRWA 4GOJA 4HIMA 1JPJA 1UEIA 3AKEA 4B3TL 2YINC 3K8YA 2Y0SE 1LV7A 2EWWA 4MYUA 5LMNQ 4P4UA 4Q1BA 3TQYA 2CHQA 1XMQQ 4LJYA 1S96A 1TAGA 3B1ZA 1UE6A 1IL2A 2IF2A 2IYLD 1CJVC 2FEOA 3TUJC 3HKZG 3AF1A 3DZDA 4CF7A 1EG7A 2A19A 4PFSA 5TXGA 3K0EA 2FFHA 4C0JA 1LY1A 3NTUA 3T51B 4X62Q 1BKDR 4NTZA 4B71A 4O3MA 2N46A 3W3ZB 4A4DA 1E2WA 5L3SB 2CE7A 4MYTA 2CMKA 4TTRA 2CLDX 3QF4B 4A3GH 2X2EA 1FUKA 1ZIOA 4NHOA 4TMTA 4A8JA 2O8EB 2WAQG 2GJ9A 4NXMQ 4XJXA 1ZVQA 1FVIA 1MO6A 1Y1WH 4TLDA 1A5TA 1V43A 4YMWA 4YY3Q 2XJ4A 4OWWB 1G8PA 4LHWA 1OXUA 1PH9A 2WJHA 4AQYL 2XZLA 2FG5A 3NXSA 1WDTA 4DR4Q 4JI1L 1Y1WG 2WPDA 2JLZA 1IBMQ 4GNXA 2VQEL 4CDGA 5JI3E 1W0KD 1G5PA 1S3GA 2ZXUA 2JLRA 3IQXA 1CUKA 3DM9B 1W36C 3WRXC 5C3EH 2OBNA 1VQGA 2W6JA 4GDFA 5H1SE 2NN6H 2JCSA 3KDFB 521PA 5KO2A 2H1LA 3DZ8A 2V6JA 2H8KA 4JBYA 1Q86C 2K50A 4O0AA 221PA 3CPHA 4DCSA 2VL6A 4EPXA 1B0UA 4I99A 3P20A 3HPRA 4J15A 1NMFA 4TZ0A 1CR1A 4QOSA 3FKIH 2D06A 5D3MB 1GFIA 1TADA 3EW9A 4ZI3A 3AQQA 3CPFA 5GADl 5G3YA 1KGDA 4B75A 1G7CA 3ASZA 2WP8J 5SZHB 3H0GG 1YNJC 2ZRCA 4B48A 3HU3A 3HOZG 2FV8A 2F4VQ 1JEDA 2Q8IB 5FI1B 1EWRA 1VIYA 1EFRD 3GTLH 5LB2A 2OESA 1IBML 1BIFA 3RS4A 1YHQA 1CJKC 2BJWA 1IYVA 3TR0A 4AC9A 2IXGA 2ANBA 4DEYA 5J4YA 3BFKA 4B34A 2P5SA 2F55A 1XTDA 4LFCL 1PLKA 1VYTA 2FE4A 5C4XG 1GNPA 3NKVA 2V54A 3EX7C 1SVWA 1G7SA 2GJKA 1N33Q 4UNNA 3K70D 4M4SA 1YHBA 4LHYA 3HR8A 4DKAC 1PUIA 5K36G 3MWJA 2F1MA 3R9XA 2HCBA 4MKGA 3AP1A 1H9RA 2FX3A 2GDJA 1VPLA 3M4YA 4L8JA 3SJCA 5HCNA 3TR5A 2FH5B 3AKDA 4BRUA 1O7LA 2C5LA 1VMAA 1J5EL 4KLZA 3GJ3A 1E4YA 2IL1A 4LJ4A 4NKRA 4H13C 2EFGA 2UUBL 3CM0A 5CK4A 4R4OA 4OYHA 1NVWQ 2BBWA 1PH6A 3BU2A 3GTQH 2Q3FA 2VIIA 4L9WA 4MH0R 3U3RA 2A5JA 2HIVA 3WMGA 1R9TH 1N2CE 2C9CA 3K9LA 1EFWA 2R9VA 3T1YQ 1E24A 1HV8A 3FHOA 5L8VA 1LS6A 3VTKA 1NVXQ 2JJ2D 2CL7X 1HYQA 4OX9L 1SVIA 1K73C 2UUCL 4JI8L 2CFMA 3QQ5A 4HUQB 2NO6A 2RHDA 1VQJA 4Z51A 3IIKA 1QG2A 3Q5EA 1F2UB 4DBLC 4MRSA 3F2CA 2JLUA 3LGJA 5IP7G 2R6AA 2P65A 1H9KA 1CU1A 3CNLA 2HCJB 4GNXB 1XDBA 2ZI5A 1N33L 4OQXA 4M1MA 3R7WB 5DO9A 3SBEA 2CL6X 5FUWA 3E1SA 4LX0A 2ZROA 4KO8A 2ZE8A 1SHKA 3A8KE 3MFYA 4J0QA 1KRSA 1MR3F 2YWEA 3IBYA 1E3MA 3BERA 4A75A 2K5NA 3H86A 2CVHA 3KKMA 4KJZA 3VNUA 1IXRA 3DOFA 2WKPA 3FKSD 2E2JH 5JWRA 1RIFA 2NGRA 5LPNA 5EAYA 4JL5A 3VR2A 2ERYA 2NO9A 2P6NA 4HAWA 3EC1A 3LQRA 4JLJA 4URYR 2ZJYA 3M3YH 1MKYA 1YZGA 1KI6A 3VA7A 1NY6A 1H9SB 4XSGA 1TTTA 4KVGA 2K75A 3GTPH 4GNXC 2ZRLA 2A69C 2BCJQ 1RE0A 3OW2A 3AVOA 4OI2A 4BFUA 2KBNA 2BKEA 2GZDA 3KF6B 2JGNA 3OPOA 3M1IA 1HTWA 1A62A 1SR3A 2QN6A 3GEHA 3MWKA 4V0ME 2J0SA 1YNXA 5GAGC 3CCSA 1W46A 4XOIA 1VTKA 3K0XA 4GNKA 3QI2A 1KO8A 5FTNA 1P2VA 3TUIC 4UNRA 3G5UA 4YONB 1GUTA 4JBMA 2PJZA 4LJ9A 1NSFA 1E79A 2HV8A 1L4UA 4RD6A 5SZKB 4TLCA 3J81j 4LC1A 1ZIPA 2P5TB 4YLGA 1Z6GA 4AK9A 2E76C 3ZVMA 3KKPA 2DGYA 5M5YH 2HT1A 4KYUA 1JR3A 5JSZA 3GLFE 1XCMA 1N34Q 3P4XA 3MD0A 1SRUA 2WIAA 5FUVA 4L5TA 1DAFA 3S2HH 3DDCA 2RGGA 4BFYA 3O8BA 4BFSA 2QE7A 2DN8A 4P72A 5C2JB 2WTUA 4PO8A 2WWWA 3K70B 2JEOA 3OF5A 2JEAI 3BJIC 4A3CG 4BLOA 3BAFA 4JI4L 3CC4A 1OKKD 4B33A 3EZ2A 4UXJA 4Z1MD 2KBEA 2W83A 5KSOA 4AKIA 2WJGA 1X55A 3MSXA 3FYHA 1QVGA 1W1WA 1R5NA 4KFSA 4NCJA 1AN0A 2BE5C 1U9IA 4LZZA 4LYFA 4RD4A 3K9HA 5CDFA 2C99A 3VKGA 2VUMH 3CD6A 2YKGA 3S1RH 3CR7A 4FIDA 4X65L 2HEIA 2HF8A 2QPTA 1SN8A 2QM8A 4A3LH 1YRBA 1G7RA 3BB1A 1V1QA 2IHBA 4NDZA 3CQZH 2ZRDA 2QAGC 4QHYA 4QGHA 4I7ZC 4IVQA 1N6LA 1Q1BA 4TQ9A 3A7LA 2I5MX 2F9MA 2J0UA 1LNZA 1NJFA 2RGBA 5IP9H 1T8TA 1N6KA 3S14H 4Q4JA 1VQEA 3E70C 4C2TA 4BUJA 4YWKA 1XEXA 5AUNB 3TIFA 1BDOA 2AUJD 1HZCA 3FE2A 3VAAA 4BWYA 1S9HA 3K8AA 1TWGH 3GEEA 3SU8A 4B43A 3WHLA 5IYDH 4L5SA 2R6CA 2AWNA 5B58C 4CGZA 1Q81C 4M53A 5HTKA 4TSFA 3A37A 4JT4A 4PPNA 3QBVA 5FBRB 2JATA 4LF7Q 1R6BX 3CXCA 1ZAKA 2PT5A 4OJQA 4IFDG 1SXJA 2MSDB 4F93B 2V55B 1YJNA 2IS2A 5C0XH 5DNYB 2REOA 3PGZA 4LYJA 1LB1B 2WVJA 5DYGA 4Q5IA 2CNWD 4DLUA 4HLDA 3ZQJA 4M21A 1VQAA 2YNMA 4DV3Q 4IO9A 3LY5A 4DV2Q 4DC9A 2CCKA 1A2KC 3K80C 1EX6A 3K81C 2ODNA 4PHHA 4LBVA 3W8NA 1YVDA 1I94L 3W6NA 4EPVA 3K0AB 2V7QD 4IJHA 4V0MA 2JA5H 5LMUQ 3T5DA 4ZKDA 3GFOA 1YHAA 1OHHA 3B1VA 3T12A 3CUEF 3TGPA 3OEEA 4M9ZA 3C7KA 3ULLA 2IYUA 1N6RA 3RWMB 1PYSB 1N6NA 4CRWB 4DNRB 4BZPA 2QA5A 5LMNL 2NZOA 4BE7B 2J7PA 5BQ5A 5J47A 1ESMA 2IS6A 1UM8A 1JAIA 3AQ4A 3GJ7A 4KV9A 2ZYVX 4QFMA 1U81A 2G83A 3K7AH 1JQLB 1W5TA 1YZNA 2NOAA 4PHTA 1CKMA 4Q47A 4X64Q 1B7YB 4RMFA 3UDGA 1ZU5A 2C04A 5FJ8H 1YR6A 3PUYA 4LF5L 2P67A 4LK2A 4R7ZA 1COWA 4A92A 4YXWD 1HZAA 4TMKA 4TL6A 1GM5A 4ABYA 4C7OA 4HLUC 4KU4A 3ZDQA 2BHRA 3HOXG 4DDTA 1Y3AA 1G20E 2D62A 3B8HA 4HI0E 4A2PA 3NBZC 1HNXQ 1KZGB 3STBD 1G51A 2XAUA 3LX8A 4DCVA 2ZJ2A 4IVPA 5JS8A 1U98A 4Q9JA 4LV8B 1P7CA 3W5IA 1WBBA 4C9BA 3PJRA 2ZRNA 1G5RA 4A3BH 1YQTA 5DE3A 5M3FH 1OSNA 2BDTA 1SE8A 4R2IA 2DBYA 5DSZA 3DKVA 3SC3A 1ONLA 2XITA 3KQUA 3B6YA 1MABA 2KB0A 2ZTDA 4XVRA 2VSOA 2VP9A 2K14A 5L3VA 2A1AA 3HWSA 3VNVA 1YHNA 1CTQA 3AGPA 3UK6A 1NMZA 5D3QA 3FMFA 1N5LA 2DNCA 3CRLC 2V1XA 4DSNA 1ZKOA 1S3OA 1IBKL 5JBQA 3QXXA 3ZH9B 2IHEA 1E0KA 1HNXL 2B21A 1NF3A 1QHIA 3KYHC 2G1KA 1QHSA 3A5ZB 3CRRA 3FFBA 4LDJA 4RJLA 5EZ6B 4BLRA 1Q90A 1LYLA 2GZHA 4HZUA 3BC1A 4BFZA 4TKOB 4JVLA 5CB8A 4POFA 4A93G 1M7GA 2OM2A 3I61A 4KCGA 4E22A 3BBPA 4RZXA 5C18A 3PQCA 2PPBC 3W8RA 3J80i 2EIFA 4GMDA 2EJFC 2QSZA 2XJ9A 4QGFA 5AJ3Q 4OHZA 3NE5B 3SHWA 2OQKA 3AVWA 1M6NA 2PEZA 1R5OA 2A9KA 4WBSA 2MSEB 2ALYB 2D2FA 4FMDB 4AY2A 1GOTA 1QHXA 2RKOA 5J4VA 4M1WA 4EKDA 1EWIA 1OFTA 2BBTA 1CKNA 4OO1H 2GVZC 4HAUA 1GKUB 3OESA 4JLMA 4PZZA 4ZV4A 1E9BA 1QHYA 4QC2A 5GJWC 2JEBI 4LPSA 4R2HA 3RR5A 4B3TQ 2XOKA 3IIJA 3BB3A 3SJZA 4DDVA 4XWKA 1UAAA 4BQSA 1NRJB 4A0RA 4OX9Q 1IZ6A 4LYHA 3A7AB 1RRFA 2GK6A 5KUTA 4R98A 4FCWA 4DR3Q 1OJLA 4LF6L 2QMUA 4Q1EA 1KAGA 3MXNB 3I4NG 3RLFA 5JJKA 4H44C 4DR1L 2IUSA 1TX4B 4GZMA 4HR7B 4LSGA 5FPSA 1YZTA 3BH6A 2GJSA 1HEIA 2QROA 5FUXA 3J81k 2UXDQ 1IW7C 3E9IA 3TVDA 1G3IA 2OO7A 4IOMA 1W49A 5IE8A 1G7TA 1MOZA 3CRVA 4M1OA 4WAUA 1OXTA 1W2GA 4NYIQ 3ZQ6A 2WFWA 5JEEA 4OHYA 2QGNA 2A6EC 3QKTA 2YJTD 2VBCA 4DT1B 3H0GH 1OFUX 1NY4A 1T3SA 3PEVA 3ZVRA 3BDOA 4Q21A 1O7IA 4O2DA 1H8HA 1UEJA 3HP1A 2BM0A 2Q6TA 1KDRA 3U3MA 2XTNA 1A82A 4PHFA 3BIFA 4DIDA 3LVRE 2XSZA 2HXYA 1MIUA 2Z5FA 3CZPA 4JLBA 4WOPA 3TQCA 3HOWH 4LWZA 3A36A 2NN6G 3AEVA 2AFHE 1FMLA 3U9SA 3CRQA 3QEJA 4CYMA 4DV3L 2IS4A 3U2QA 1D9XA 3VU9B 3R9WA 2RHSB 1DAGA 3RS7A 2UZIR 4BY1H 3OTOL 1WCV1 2KSQA 1E1OA 4BZQA 4TMVA 4PQFA 5EUMA 5CITA 1XMSA 3I55A 4G3XA 3I62A 2KENA 2F3TA 3OFNA 2OILA 3T1TA 4BPBA 4KMUC 1ZUIA 2IT1A 4B3SL 4NCIA 5GJVC 4KN4C 1WJJA 3TREA 1K8RA 3MEFA 3RLNA 4DR6Q 5M5WH 2J87A 1K3RA 3FHCB 1DELA 1GRNA 3K70C 1E2ZA 4DV2L 1Q20A 1N8RC 4NYMR 2W2XA 4AIMA 3BG3A 3WHKA 4ZCMA 2IS1A 4A4IA 1Q82C 2E2HH 5FTLA 3GQBA 3KF6A 3A0JA 5KOYA 2VQSA 1Z0JA 1PMRA 4AD8A 4GPTA 2OTJA 4EPYA 4U7DA 1VG8A 1JJCB 1Q8KA 5GVSA 4WIAA 1OXVA 1QVRA 3NC0C 1K8AC 2GETA 4DCNA 2BMDA 2TMKA 3UE0A 3B60A 4LBYA 2H57A 2ATVA 2HQLA 4JLPA 3FPPA 1F2TA 4DK6C 3M4QA 4MUAA 2WBLC 1E98A 3WWVA 5A5GA 3OTOQ 4IFDJ 2VZAA 1TQ4A 3OIYA 2OFWA 2J46A 2ZJOA 3T1HQ 2N8NA 4PC6A 4G7ZC 3KOJA 3T53B 3Q9LA 4DLVA 2FDCA 1FL0A 4ASUA 1P3JA 1LABA 3O47A 1IN7A 2ZT9C 1IN6A 4IJLA 2VNUD 1I2MA 4Q7MB 1XJQA 4YCUA 1SXJC 4NMMA 3ERSX 4PZ8A 3KFVA 3NBHB 1T5EA 1P72A 2KJQA 2CW0C 4FW9A 1M34E 4GOPB 1OFIA 1YZUA 1A7JA 2J7KA 3GJ4A 4QJ3A 4PZLA 4G7OC 3KQHA 3THYA 2LKDA 3F0TA 1R0WA 1UEBA 1EIYB 1KI7A 2PZGA 1R8SA 1ZINA 4A6PA 4DT1A 3CMEA 5HZKA 1W4RA 3KXKA 3NEMA 2ZREA 3BRWD 2ZU0C 1ZUNB 1E0SA 3HGBA 3CWZA 5LD2C 4EDHA 3TKLA 4HJ7A 2RF4A 1SXJD 2FN4A 5BN4A 4JV5Q 1N36Q 3B1WA 4A8JB 3UMRA 4AG6A 4US2R 4R1JA 5FBVB 2EU8A 4QBFA 3B85A 2HYDA 4AKHA 2O8DA 5A4JA 2B29A 4IOLA 2ZSFA 4DR6L 4AURA 5IYBH 4LWCA 4LBZA 4W5WA 1Q3TA 3LNNA 4GOKA 4C4PA 1KAWA 3DM5A 1NLZA 3QKSB 4A93H 5L3QB 4IXMA 2WAXA 3UWOA 3LAWA 1AM4D 3PEWA 1Q1ZA 4HB2A 2D0PA 1VQ7A 4OXPA 1Z08A 4NYIR 1X9NA 1XNRL 2ZI4A 3UDXA 3ADDA 1VHLA 3B5JA 3P26A 1E9SA 1TF5A 3CCJA 5FR1A 3QG1A 3AUXA 1E1RA 1L1OC 1XZPA 3NWJA 1JAHA 1DADA 1KO7A 3EIQA 5DN6A 4DR3L 3VR6A 5JEAJ 3QY0A 4IFEA 2R7FA 4I1SA 2JXMB 3QF4A 5BYJA 3KQNA 2GXQA 5M3FG 4DUYL 2DWPA 1HQMC 1J70A 1SKQA 2F1IA 2OXCA 3AUYA 4I1VA 2A30A 4LHVA 4ESHA 3OE7D 2ZJBA 4B2IA 3D0FA 1E99A 3HOUG 5EE3A 5HY6A 1G6OA 2PI2A 3CRKC 3D3QA 4TT3A 1N0UA 3ONWA 5LB4A 3KB2A 1KK3A 4KXFB 4EUNA 1E1QA 2ZYUX 5E3HA 3KJHA 4DSTA 1RL2A 3A8IE 3CCUA 1WF3A 1Q1EA 1T5IA 1XEWY 4M1KA 4DZZA 4MKHA 2XGTA 1E2JA 4IRUB 1SVMA 1UDWA 4D4LA 2K4KA 2R8RA 4EX5A 4O25A 1S72A 1IN4A 1EFHA 3EXAA 1F3OA 1IJFA 3I56A 1JE5A 2BVNA 3A4LA 1WB9A 4US1R 3OHMA 4V0LA 2R44A 1E9FA 1XPRA 5AUQA 4CVNA 4NONA 4FCTA 1VIAA 3SGIA 3HJNA 4BBRH 5AUOB 3MWYW 1SFOH 4P73A 3H15A 2NZHA 5JWHA 2VW9A 4LF5Q 4LUOA 2WPDD 3FPAA 1EWHA 3P1JA 1Q57A 1ZD1A 2NN6I 1FTNA 2JK8A 4P75A 3S1MH 2GNOA 3BWDD 4DLZA 4DVGA 2JA5G 2QAGA 4LF4L 3LW7A 5FTKA 3FMPB 1KY3A 3RC3A 3T56B 3JVVA 4TMZA 1NN3A 3TRFA 2WSSA 4RCYA 1HT1E 3U4QA 2QU8A 1KY2A 3I8XA 3J80c 3F2BA 1K8OA 3GFPA 4MKFA 5IDVA 4ZI2A 1VCMA 2A78A 1SMYC 3QE0A 4GN4B 1I2DA 4BECA 4Q1FA 3AF0A 1W36D 2BH2A 4JI4Q 1MT0A 1T3HA 3O8CA 2EDGA 1QZXA 4RVCA 2UUCQ 1E2EA 3AKCA 4HAXA 3RRMA 2JA7G 4JBJA 3FTQA 3CCEA 2YV5A 4I1OA 4URUR 1G3RA 4DB4A 3GTGH 2AKAB 1VQFA 1E7ZA 2F43A 1T3LA 2V4ZA 4IPHA 5K8UA 3EA5A 1B8AA 3H0KA 2FFBA 2W6IA 4ALPA 3G71A 1ZM3A 2H17A 2ZJPA 2JA1A 1YBYA 1H65A 4PC1A 3SN6A 2VQFQ 4DR5Q 4KKSA 4X8MA 2VHTA 3G0HA 2E75C 1X6OA 4PPFA 1US8A 1IBLL 2OBLA 1EQRA 2A8VA 2GJAA 2GZAA 1D9ZA 2RGXA 1KNQA 1CXZA 2IF0A 5IWAQ 1CRQA 2ZJRA 5A35A 5L3SA 2VTKA 4ZDIA 5J4LA 3LW8A 3K7UC 1PUJA 2A5YB 4B2LA 1N0VC 1ONBA 3FHTA 5BWMA 3SYKA 1QZGA 4B2PA 1VQ8A 5KDLA 1N5KA 1WMSA 4Y52H 4DNIA 2V9PA 1A8VA 2VUMG 3S24A 2EW1A 3IUYA 3UXMA 2QBYB 3WY9A 4MNOA 1D2NA 4JI5L 1VQ6A 1OYYA 1Z2CA 1UE5A 1RFLA 4L5RC 1MO3A 2FSHA 1N6OA 4JYAQ 3L43A 3MAAC 3FMIA 5DISB 3RANA 4MZ9A 4M0LA 1E0JA 3DOEA 3PO3G 4KFTA 2PZEA 4DDUA 3FGNA 5AJXA 3QPWA 4GZLA 4UJ3A 4RD1A 4DR1Q 2VHCA 2P3SA 2IX0A 1CKEA 1EWQA 2NZ8A 3NDPA 4NCHA 4Q4JB 2GRJA 1Z7TA 3HKSA 4PPGA 2GBLA 3GTJH 1EUJA 2IBMA 3QXHA 1G41A 1II8B 3IPXA 5IWAL 1E1TA 2ODBA 1VCIA 1H8ED 2H18A 3IDQA 3K0FB 5AWFC 5SZJA 5DI9A 1MABB 3KKQA 4IKEA 1WOCA 2K7VA 1FJGL 4F4CA 1VQCA 1OYWA 4PC3A 5JI2E 3R8FA 2FZ4A 2QEQA 4WXPA 4TYPA 1U0JA 2ZVPX 4LPKA 3LDAA 1OXXK 1AKYA 4JLAA 3K0CC 4C3ZA 4IDPA 5FLMG 2PLRA 5AR1A 1PV4A 3RLOA 2N1BA 1KI6B 1W0JA 5KU1A 3AVYA 2C95A 1Y8NB 1M90C 3TJZA 1IJEA 1GWNA 2Q9CA 5CDFE 4GKKQ 3N70A 1L2FA 4II7A 4TN1A 1J7KA 1U8YA 3STBC 3QJYA 1P6XA 3E5HA 3CCVA 1FJGQ 3RZOH 2YTXA 5HZHA 2ZTCA 4NH0A 4DCUA 4DLRA 4QM6A 2A69D 2OCBA 4JI8Q 1WI5A 1Z07A 4FD2A 4RZUA 4DR2L 2PQAA 1M74A 2HJGA 4IEIA 3TQFA 2LCFA 2IXFA 4WA7A 4A3IH 3NBXX 3VX3A 1GL9B 3RS3A 1GL7A 3CF2A 2DPXA 3S17H 4NXNL 4D81A 1Z63A 5JFGA 1Q12A 1Z6YA 2I1QA 1CKNB 1ZCBA 2ZUBA 1L1OA 2B8FA 5FBWB 1CSPA 2KCCA 1IYJB 1FYCA 1BMFD 4ZIRB 1X3GA 1DO0A 2R6GA 3HU1A 3PIOA 3MMPA 4RKEA 4TLEA 4AYXA 4X66Q 1NN1A 1YKSA 2YHSA 4FMCB 4PAQA 5FBLB 3CNOA 2UUAQ 4XWAA 1FL9A 2GJ8A 1JBKA 3VR1A 5EUQB 4HAZA 3RHFA 2WZQA 1T5LA 4LF6Q 2ZSBA 3Q3JB 5IHPA 4TYQA 4URVR 2CQOA 1E96A 2D2CC 4OK3A 1H9JA 1DO2A 1DEKA 4TSFD 1UE1A 3R20A 2FFAA 4HATA 4RG1A 2BBSA 4JG2A 1J99A 1JXOA 4C2UA 4LJAA 4BLQA 4MRPA 4A3KG 2KCTA 2JA8H 1GDDA 4TLAA 3C16C 1IM2A 4YWLA 4JI3L 1HNZQ 1CJMA 1NN0A 2ZJ5A 3K0CA 3NC1C 3A1VA 3OFND 1RZ3A 2VP5A 1W47A 3A1UA 3VU9A 3TE6A 3PEYA 4R4IA 4BBSH 1W4BA 2GCNA 4DLYA 4AYTA 2QP9X 3GLFA 1ZNZA 1E1RD 2ZRAA 5F9HA 2BKUA 4XH9B 3VX4A 1JR6A 5C0XI 5CK5A 4HLCA 1JB7A 2IWHA 1W2HA 1XD9A 3EIVA 2BMJA 2KWIA 2KI5A 2RMKA 1NMXA 1Z3IX 1DAIA 3NHAA 4NYMQ 1UKZA 5EE1A 4EQ5A 2DFKB 2QA4A 3KJGA 1OPXA 2ZSEA 5FFMA 4M8NE 1G17A 4A8JC 1PHJA 3A74A 4P74A 2QPOA 3LWUA 1TUIA 2QTVB 5FBQB 2RGNA 2GAOA 3AF3A 1EK0A 5DI3B 5HE9A 4QG7A 4ZKEA 2PCFB 1GIAA 2HLDA 4LF8L 1P5ZB 1FMJA 3THOA 5KNCA 5CIQA 4QHTA 4X8OA 4KHPL 4BEBA 1NVVR 5JEDA 4FWTA 3FHWA 3JAMi 2B8TA 1P61B 2JA6H 2J0UB 2NG1A 2PX3A 2WOOA 3HYTA 4PR0A 1B9NA 5FL7D 1CKOA 5ELOA 1T8UA 2E1RA 2BEKA 4KAXA 4V03A 4OONA 4WW0A 2Z43A 4EQ6A 1HTPA 5C3EG 1IBKQ 3KFUA 5JJIA 3A1TA 4MRRA 4V0KA 4EJSB 3HOUH 4D4MA 1HNWQ 3BFXA 1SKYE 2ZJAA 4EPWA 4R4TA 1P4SA 3IILA 3UKDA 1TNDA 1GZSA 4MGKR 4P71A 3U6KA 1GD7A 1UWVA 3VR3A 3I4MG 2WICA 4PQRA 5AJZA 3M0EA 3SS8A 3FKIG 5F98A 4KHPQ 3T35A 4UJ5A 1KOFA 3U60B 2L15A 1AGRA 5FOUA 4PV1C 1II9A 2B8GA 2QMEA 5JMTA 1HA3A 1XJ0A 2J7PD 421PA 1E9CA 1KI8A 4DLSA 5H8WA 5UKDA 4KLNA 2GXSA 4PAOA 1TUEA 1A2BA 1ZBDA 2J9RA 3HKZE 4IDOA 1GVPA 1J8MF 2WJYA 4K81B 5IYCH 3WNCA 1VQMA 4M1SA 1X3SA 3GLIB 3TW8B 4A82A 4LNQA 2HXSA 3F3YA 1N25A 4DR4L 5KPJA 4JBWA 4LK1C 5AJWA 1ZMXA 4BEJA 4DLTA 4EFNA 3Q7QA 3VR5A 1GHJA 1YVCA 2J1LA 3W34A 4NB3A 3CRMA 1HY3A 3IIMA 1PA6A 1CBUA 4LCBA 1YZQA 3BK7A 5JCPA 3V4RA 2EXDA 2ERXA 5KDDA 1S0UA 1NE3A 2ZEJA 3F8TA 2N49A 1CR4A 1R10A 3EASA 4GSYA 4NCNA 1CR2A 2Q21A 2Q9BA 4YC7A 1G4AE 4R4QA 4C0HA 2QY9A 4GT1A 4P4SB 3I73A 3GJ5A 4WZBE 4BY7H 4IPCA 1JB1A 2ZI3A 2QTFA 2BM1A 4A0GA 4LJ7A 4PZ6A 1E9EA 4PC2A 3LH5A 2A3RA 2V6IA 3T06B 1OB5A 1W36B 3ULJA 4C3HH 1XB2A 4C7OB 2Y0SG 3EAQA 4QY7A 3RVBA 3ND8A 3S16H 4LUVA 4YHHL 1ZNYA 1ZM2A 2R93G 2ODWA 3L0SA 1IXZA 1KAOA 4NE2A 4JLOA 2ZE6A 2WWHA 4Q4AB 3RYTC 1IONA 4XD7A 3D31A 2IYZA 2BBOA 2ORVA 2VEDA 1E79D 1TXYA 3AP2A 3AGQA 1M1YE 3H4MA 3QKSA 5L3QA 2DCUA 1LUZA 5DYIA 4RY2A 2WJIA 4DK1A 4PHGA 1OH8A 1F48A 1A63A 1L1OB 2PL3A 2W58A 3KJEA 3PFIA 4G5RA 2AK3A 1QZHA 3ZVNA 2HHHL 3KKNA 2BOVA 3BH0A 2OG2A 4PC7A 4POGA 3CX8A 4C0BA 4DV0Q 3X1ZA 2QGZA 2VF8A 1EYGA 4DV4L 3OOCA 1XMQL 4Q9KA 1Y63A 1ETUA 3U4QB 2O8BA 1S3SA 3UANA 4D0LB 5B57C 3QG5A 2WWFA 5GQOA 4IDQA 1G3QA 2BJVA 3R7WA 2DWQA 4D25A 3ECCA 4H1VA 3KXIA 1Z8FA 1I4LD 3W3AA 4U00A 1AA9A 2VYFA 5EXSA 1RYFA 1TQ2A 4JYCA 4X62L 4OQMA 5C4GB 2GN5A 1FPMA 4JLKA 3SE0A 4B3MQ 1YE8A 1FZQA 3RNLA 4JI6Q 1B70B 5JHHB 2CWAA 1XEFA 4Z8YA 1NMYA 3F2DA 1FX0B 2A68D 1XCPA 4A76A 5AJ3L 3A1SA 2C03A 1ODFA 2PBRA 3DPUA 1IY2A 1E22A 4K8OA 4YDHB 2IYXA 3RWOA 4CZ2A 2JLXA 4AYWA 1KSFX 4DSOA 3MCAA 4A3GG 3CCLA 1LTQA 3DHWC 4A0HA 4MRNA 4X8HA 2GCPA 3UWKA 1D2MA 3DO6A 5BR8L 1VQ5A 2CVFA 2ZPTX 3RS2A 2PMKA 2QP4A 3TAHA 4QRHA 1JEEA 3KJOA 2CEAA 3CF5A 2IA5A 1GKIA 3LLUA 3J7A5 2AXNA 2XSZD 1ZUHA 1RRCA 1DTSA 5KHOC 3K0FA 4KVAA 1QHHA 2YOHA 4PO1A 4JS0A 4LJ6A 2B63G 1Z6XA 1U0HC 1S2MA 4LBWA 1EFCA 4NYJQ 4P32A 5FOXA 4BXXG 1UFQA 4GL2A 3WBJA 1Z9FA 2OCYC 2LXKA 3KF8B 4DPGA 5AJYA 2CNWA 4HJ5A 1GAJA 2C78A 1V5WA 2EFDB 3TS0A 4M9QA 4R4CA 1E2NA 4FI3C 1ZM9A 1GJXA 3D8BA 4B44A 1N0WA 2DUDA 1R5BA 3CKLA 4YCWA 3I32A 3E9HA 1C7YA 4Q7KA 4H1UA 2C77A 3GD7A 1ZP6A 3O8DA 4JJZA 3IO3A 3NVAA 1FTSA 5FPHA 1LW7A 4X8LA 3GJXC 1XTSA 1IXRC 1NLYA 3OE7A 1A4RA 4CIDA 2Q2UA 2OEPA 3PUZA 2REBA 4LFAQ 1PJRA 2NIPA 1SVKA 1P73A 1L0WA 2OV2A 4A6XA 3U6BA 1Z29A 3VFDA 2A5FA 3PUXA 1T0HB 3X1YA 1Z0IA 1JR3D 3KQLA 2B7CA 1F2TB 3LX5A 3KQKA 2CHGA 3V00A 4RCNA 1GG2A 1QVCA 4JI5Q 3SYLA 4GN5A 1FX0A 3AH8A 4G5QA 2WB1E 2VP2A 4NXNQ 3JC66 2IHFA 4BBSG 3A8TA 3TS2A 2OTLA 2X2FA 4OQNA 4NU0A 2MMGA 4N1AA 1KJWA 4DLWA 1YNNC 2BH8A 4HIOA 2G9NA 4D0NA 2PMZE 3U4ZA 3GJ8A 4PAMA 2OLKA 3PO3H 4M1YA 4CW7A 5M04A 3ZLJA 4HZIA 4DAMA 1CTMA 5BR8Q 4RCZA 3E0EA 2A7QA 4Q02A 3U61B 4JOIC 1KZ7B 1TL7C 2JLVA 3A6PC 3KX2A 4PX9A 1IXSB 4OI4A 4GOPC 4MUBA 4MQBA 2VH5R 4MA4A 2AKWB 1NN5A 3M4PA 2O5IC 1X8KA 3EIHA 1G3UA 1NKTA 4JIMA 4NZYA 1KSHA 1YITA 3CH4B 1TQDA 3A58B 3UG7A 1KO5A 1FNNA 4P31A 4DK0A 1I3QH 3RN2A 4O2RA 1AS2A 3I5XA 4DNTB 4DAYB 3BORA 5P21A 1TF2A 1UE7A 4HIKA 1CJUC 3EZ7A 4QGGA 1UKYA 3DXJC 2P6RA 4A2WA 4DIEA 2GA8A 4L4UA 1W7AA 2EFHB 3T1HL 2ZM6Q 2GAAA 4GKKL 2ZJQA 2W2VA 5KSYA 3JAMc 5EJEA 5FH9A 1VG9B 3RRYA 3I8SA 4G5SA 2IX3A 2NVTH 2GEVA 1DPFA 4V02A 2NO0A 3ZJYA 5ANRB 1NVVQ 4JLNA 1FR3A 1ESNA 4OK6A 4P33A 1S1MA 5F9FA 3JVUA 2A68C 2JE6I 2JA7H 4X6AH 3KL4A 4UNQA 5CIWA 1HR0W 1HZ9A 2LMCB 2YYZA 1I94Q 1W48A 3QEOA 4YCVA 4Q03A 3T15A 4PZYA 1S8FA 3NHBA 1SVLA 4RD0A 4BLSA 4JVSB 4QKQA 3C14C 4YMVA 3D4RA 3GJ0A 3LFUA 1Y8PB 4L8GA 4GS3A 3QPUA 2YTYA 1G8HA 1P9WA 2ZANA 1XMIA 3LA6A 2EWVA 4OK5A 1IHUA 3RN5A 4DR7L 2WJJA 1VQOA 4TT3D 1BBWA 3PG5A 4V0OA 3SQWA 4X65Q 2BA1A 4LHZA 4XIGS 1G8FA 1GRQA 2J5XA 4Q19A 4UXIA 4UKDA 2BMFA 1IW7D 3AB3A 1VQHA 2IX1A 2A2ZA 3AP3A 1HNWL 2ZM6L 1K0RA 1G6HA 4LW1A 2F9LA 2PJRA 1KXLA 5EE0A 2YTVA 2HT6A 1LS1A 5GVRA 3ETLA 2IYSA 3PO2H 1H8HD 2AL7A 4CT4B 2DB3A
chains in the Genus database with same CATH superfamily
2WD7A 5DBGA 1VQLA 1RYZA 4Y18A 1E3DA 3LU1A 4EAQA 2QXTA 4KE8A 1U65A 1SBNE 3CBQA 3JYOA 2OAEA 2OV8A 1EP2B 1P1IA 2JGLA 1A96A 2VDWB 4OKNA 5ARCA 2E4YA 5KTPA 1TPYA 3GO5A 2G3YA 1BO6A 1GV0A 3O8OB 4ZTBA 1P0FA 5KNDA 3EMVA 3RHTA 1NU8A 1Y3DE 3O4RA 3KNZA 3LZ6A 1ZVVA 1RKXA 3B1JA 3H94A 4CJ1B 3M6FA 4JKIA 4OM8A 3KBBA 1UAGA 1DJMA 5DM63 3VYUA 2JA8B 1DBRA 2ZVQX 2RHMA 1L4LA 5L7YA 5EPKA 3OHPA 5EXPA 2WIBA 4YGXB 3B5IA 3FKJA 4V0QA 2Z83A 1JWUD 2CLEB 3QFSA 4M9XA 4GLVB 1E4VA 4P08A 1NR5A 1NULA 1Y34E 2ATXA 4GMHA 5H81A 3V1KA 5HDQA 3L9XA 4JNCA 2FNAA 4LV6A 1R0ZA 3O9VA 4NVRA 3U44A 4ER6A 2OO3A 1QGDA 2XZTA 5DOVA 1KOLA 3HOVH 3W2DA 1WFQA 1B8OA 3L8ZA 4P1ZA 3HABA 4A73A 5TB5A 1G21E 5DH9A 3CZ4A 3A3NA 2C7BA 2C8JA 4BWFB 4UUPA 2ZBQA 1XP8A 4CIXA 6GPBA 5EXDA 4Q05A 1MV5A 3RAGA 3RUCA 2K1BA 1DXHA 1LPSA 4DYDA 5JVDB 4AS2A 4ZI7A 5C6AA 1M2EA 3LXRA 1AT1A 3L92A 5BN1A 3AVXA 1O9GA 2A14A 3KZKA 1KQSA 2QZ4A 1K8YB 2G80A 2G67A 4BU0A 1Y9JA 3QF7A 4ESEA 4ZMSA 2YN2A 1M0TA 3T3NA 1BD4A 3CUVA 1M8GA 4KXXA 2J3JA 1YGPA 3S1LA 3ZD6A 3MC0B 1PH7A 1R0RE 1T15A 4ID9A 4HMPA 4BV2A 4DUGA 2GO1A 1DRVA 2R92G 2Q46A 3NP8A 2QM3A 2RGYA 1L5FA 1X0VA 3CF6R 2FZEA 5DHAA 4D5EA 2W6CX 4QOEA 1DQSA 4KLKA 3BH7A 4MOWA 3PL5A 4B32A 3UZUA 5AVUA 2XUJA 1D5CA 3WIOA 1O58A 3OYYA 4AH6A 2JHCA 4ZQCB 4RGNA 1V8BA 4LYGA 4LGMA 2H48A 5EPOA 5L6MB 1S5FD 3ITKA 5B1EA 2L4NA 4XT1B 1JEAA 2XODA 3N0RA 2WKQA 2WKSA 2XLCA 4PG3A 5TQ0B 1IBLB 2C7GA 5EJAA 3DF7A 1QZTA 3LBIA 3UJCA 1GKKA 5JISA 5DHFA 4GEGA 4L0QA 5EIFA 3NBFA 3ZY6A 2WYWA 4CF5A 3E81A 4P2GA 3SJAA 1TWAB 2R97A 5DNCA 4LVNA 5KYKA 4G0PA 5MGBA 5BW8A 2JIZA 2QL6A 1Z7BA 3IGFA 5IC4A 3ANLA 4U5XA 3V7NA 4R8RA 4S12A 1E4OA 2QRJA 2QW1A 1ZA2A 3WJAA 4AJNA 2UXBL 1HWYA 1MO4A 2ZI9A 4WGFA 1X54A 4WA8A 1P4RA 4OHCA 1NSNS 4B9XA 2HGSA 1JWLA 2ZSDA 1KS9A 3PX2A 5T3UA 3TLGB 4AS3A 1JJ7A 1L5VA 1V4NA 5LD2B 1GP2A 4KIFA 4OAQA 2IYFA 4RX1A 1TZBA 4W4TA 5HNKA 2XUKA 3Q3VA 5KYWB 3BQNB 1SCKA 2X2PA 3PPVA 1IQ0A 2BEVB 2EOTA 3AL2A 4IY1A 3SM3A 4EGJA 2B8WA 2P9QA 4GQBA 4NK4A 4RVOA 1Q74A 3PD7A 4YUWA 2W6ID 1IBLQ 1DZ3A 1DINA 1FFAA 2B2UC 2YS7A 1U1CA 2RGCA 4HYTA 4J03A 2VF7A 4QBTA 1YHYA 1R3UA 2GBLC 3KR2A 5CYFA 2QF7A 1XJCA 3PCOB 4FHFA 4ZEWA 2L0XA 3ZH2A 1YULA 3GNSA 5BV2P 2ZYAA 2PBZA 4XEHA 3TAUA 3WKAA 1CIVA 3EG5A 1D1QA 5CLLA 3MJEA 1UOOA 2VDPB 3LKVA 4KYIB 4MRVA 5CLQA 2AUTA 3J81E 1P8JA 1XDGA 2BGTA 2PWBA 5CJ2A 2K5QA 5EJFA 2W37A 3K96A 3CX7A 4FI3F 2I7XA 1OF1A 2GHIA 1L4EA 3ZU3A 2F00A 3HJUA 1JTVA 4HJ8A 1VYUA 4JLSA 4C3IH 2CLCX 3OOWA 2SKEA 1F60A 5CJPA 2GHTA 3GLHE 3ER8A 5C4JH 3Q10A 3OE5A 4X6LA 1EIGA 5FOTA 1E2PA 3VV2A 1SY7A 1X86B 4K46A 5JECA 4HIDA 4EMTA 1KD1C 1FNMA 2JFOA 1V8PA 1YVEI 3NHJA 4OX9Y 1NMQA 3VVCA 3NIDB 2QX6A 3U40A 3ZX5A 3GRKA 1EE9A 2FW8A 3HB4X 2C2XA 2BFMA 1TMGE 2DLDA 2ZB7A 3C3JA 1KDTA 2CWWA 5DHPA 2PYKA 4DA8A 4PQYA 2WUWE 4TX1A 2PNJA 1XO1A 2AF3C 3ENQA 1AB6A 1T4BA 5J63A 4GEKA 4D80A 1TPZA 3V32A 4OWXB 3FPKA 1O0SA 3AQIA 4RORA 5HKLA 4XTRA 4B6FA 3U0BA 1GGNA 2Y1WA 1VGQA 3LG2A 4QTZA 1PJAA 4CR8A 3DCNA 3EBEA 2KBFA 1TEZA 4EI7A 1PSWA 1ZMRA 4CMHA 1UBFA 5ENVA 3LM8A 3W5CA 4GSKA 5K8TA 3WGHA 1WETA 2FUCA 1NIJA 1DBIA 5C44G 4S2EA 2MO1A 1GQ2A 3C8ZA 2FJ0A 3FWZA 3P97A 2MO0A 4G0NA 4HUQA 3ZWOA 3IP5A 4RZHA 4RGTA 4Q9IA 1ORDA 3LYUA 3OT1B 4J2OA 5DGTA 2VA9A 3HJRA 5GV8A 4BMPB 1FK8A 5CB4F 2J3LA 2V58A 3QIVA 3G9UA 3EZFA 4QGBA 5TS2A 4NOLA 3EB9A 3GLKA 5DGHA 5H7XA 3IP3A 5B37A 1QKJA 1OFHA 3BMCA 4H1HA 2HHAA 4NU6A 3UQZA 4UOEA 2A6ED 3CC2A 1NG1A 5A6VA 1V7CA 4GPBA 3SYRA 2W2PA 3LWBA 1RYHA 3PO2B 1FX1A 1Y1LA 3HKCA 2W0MA 4JXJA 4U9IS 1L5SA 2B5WA 3OHXC 1OLXB 3GVHA 1TU2B 3LV8A 3NENA 2WB2A 3QUSA 3W9YA 9MHTA 4DCMA 4PG4A 4TTAA 1E9RA 2O5JC 1E3TA 3K2BA 3OLZA 4JYMA 3RRBA 3OECA 5AKJA 1K28A 5D3IB 1EXWA 4PIMA 3M6LA 1SRQA 2IUTA 2AS0A 1P2TA 1NW3A 3ZHUA 2C4VA 2Q6OA 3VGJA 4NXML 1DE0A 4GN3B 2BFBA 4U7WA 2QLMA 5IY0A 1TTHA 3SP1A 2ZTVA 1UF9A 1XA4A 1TCVA 4JLWA 4JT2A 4YPVA 1E7SA 4BP1A 5JSKA 5KTOA 1EUYA 4Y0VA 2PZWA 5DT2A 3DQQA 2AGVA 3PENA 4H7JA 5IYCG 1IYZA 2ZS8A 2V03A 4AWXA 3T7JA 5EHNA 3B6JA 3GBSA 3Q8XB 1M2WA 1W4CA 3OJLA 3BTSA 3K0SA 1QF6A 1HTBA 2C58A 3ICEA 3BJRA 3EZLA 5DLYA 4QDTA 5HF9A 2EV9A 2PGNA 2R1VB 4K9DA 2H1EA 5MFPA 1V0JA 2EX0A 4AZWA 1I50H 4MS1B 1ZJ6A 2ZT8A 3WJ1A 1CW2B 4F9GA 1YJBA 4BTVA 2ZYTX 1JBEA 1SPXA 1PFUA 1SXHA 1ZOPA 5FWDA 1G1MA 2CHVA 5LP6C 3U3DA 5GWXA 4NF2A 4D9HA 821PA 3R8CA 4URXR 3S8YA 1DS6A 5IGGA 4CM1A 1TGYA 2XCIA 4ZAIA 2BFDB 2YZGA 1W9MA 2F3IA 2NTYC 1I3NA 3VI4B 2C5HA 2VJBA 1KRHA 2HRZA 3AF2A 3RIYA 4J90A 5AH0A 2H92A 3ABOB 3G9TA 1ZXTA 3IE2A 3FDZB 4LOAA 5FEMA 2NM0A 3O2QB 4WFQA 4TWRA 3I2ZA 3NH6A 4YV7A 3CWQA 3UT5A 4AUMA 3S9WA 3DNMA 2O6HA 5CRIA 4WFIA 1E32A 1XMVA 2FOXA 1H2ZA 4BJ5A 1DXMA 1XJVA 3D6FA 4OGLA 4KV6A 2GPYA 1DAKA 2KE5A 3VPHA 4ZUJA 4NL4H 4PZDA 4C3VA 4R81A 1XQ1A 3K6SA 3RAEC 3VKUA 3UH0A 5A04A 1NJ6A 1VE6A 4Q3AA 1RLMA 1GLNA 4GP6A 2X0DA 1Y1TA 3GEIA 2AFIE 3OURA 3SVLA 4MGYR 2HWUA 3R0XA 2XMDA 1YI2A 3OX3A 4JI0Q 2ZQZA 1ODCA 2QR2A 4PLHA 4R8SA 3U16A 1VBFA 1JYSA 2ZUDA 4LX8A 4MS3B 5BSVA 1GT6A 3GP8A 1FRQA 2J9FA 3W2EA 3UMCA 3WWEA 5E2BA 4ARUA 4MK4A 3M5WA 4DJTA 3NJRA 1K83H 2PX4A 4WRDA 3A3OA 4XZ3A 1ZD8A 2N42A 4MA5A 5GONA 1U2SA 2B4QA 4BIIA 5A9RA 1DQNA 5A02A 5A7HA 5I7SA 1VS0A 3ZZ1A 4BKPA 2YV2A 1OIWA 1XTVA 5HGQA 1XEWX 4V0BA 3JX9A 3KE8A 5IKPA 4IQZA 2N9UA 2ZBUA 2E74C 5GOZA 3ZCUA 3TBIB 3DQPA 4QYXA 5KYNA 5FWAA 2R2GA 7MHTA 3U62A 1JR4A 2RH4A 4CTMA 1GN8A 1P91A 5FR2A 2F0NA 1OIXA 3ILHA 1CFZA 1XKQA 3CLSC 3R0IA 4JD5A 4BFWA 1NQXA 1TQ6A 3KQVA 3U9OA 3ZXSA 5JOBA 3LT5A 4MP3A 4Q4AA 4IQ0A 3R0QA 2BV3A 3AI2A 4CLOA 3R93A 1QIGA 1ZSNA 5TDHA 1AQNA 4JP3A 1D5MC 3D6TB 16PKA 2QG9A 4RQTA 3V9PA 6ABPA 5COQA 5C44B 1SD5A 2DPHA 3QI7A 4M1TA 4LUZA 5B58T 1L8XA 1B93A 3GMTA 4PGMA 4J7CA 4NATA 4ZAYA 4BA1I 1KC8C 3J80E 2OZEA 2VT2A 3C3KA 2P6PA 1J1ZA 3KD2A 3OUUA 4L15A 4UEJA 2E5FA 3HP4A 3W7VA 4RA6A 5KAMA 1U2PA 2Z4IA 4WJWA 3WMEA 3PNPA 5A71A 4HADA 1BS1A 3L8GA 1LXCA 1W29A 4PSAA 1J0BA 1TZ2A 2Y0DA 3QRWA 1TZJA 2IWRA 1YUBA 3TQRA 4DJAA 3FFAA 4J0IA 3PO2G 1V11B 2QL5A 3DL0A 3M9WA 3V8NA 1TMYA 2AZTA 3E35A 2IP2A 4YJGB 2GVBA 1MQ8B 1JG4A 3PIIA 4Q66C 2UVPB 1XVLA 3GLHA 2DJ5A 3WRYC 3M3PA 4A3CH 3IUNA 5CFOA 2OE2A 3JVEA 4IFDI 4TKUA 2J9YB 2P6UA 2ZRPA 1P0CA 5KVQA 2XT0A 1SE2A 1T1RA 4FZJA 3L7BA 4KPUA 2FZKA 3Q6SA 2RIRA 1UJ6A 1LPOA 1GV1A 4LOJA 2WTNA 3LDHA 3MVEA 3E4DA 3N2IA 5CB6A 3S2DH 3GLGA 1SKMA 2HHHQ 1VLJA 3WO0A 5JEAH 4Z7JA 2W48A 2QRZA 3F1ZA 4AAYA 3MFGA 1T6YA 4O2BB 4C2MH 1B6GA 3CNQS 3LVFO 2W7TA 3CP0A 2CKMA 3DUWA 1GILA 1WX1A 3FCYA 4AP5A 1QOQB 3VJRA 2D8MA 1RI5A 2QHXA 1OI7A 4RVFA 3VISA 3WMXA 4J6HA 3DVAB 3LP5A 2Z2KA 2I5LX 5ITZA 1ZRHA 3X3NA 1GNRA 2ZUCA 1E18A 2ROQA 4AYBE 1QUFA 3IAHA 3IR6A 3FKIB 2CSXA 4PNZA 4XYGA 2Q2TA 1JEQA 2NT3A 2QGFA 4Z9XA 5K0NA 1B6RA 2LW7A 4HFJA 4ODIA 4U2CA 2GYWA 1ML3A 2WKDA 3DEFA 5IYDG 4EUKA 4JI8B 3CF4A 1EEXB 1R37A 3F3KA 1NMEA 2DUUA 2IP4A 5ESWA 2YNMC 4H0FA 5SY6A 3RQSA 5ALGA 2C98A 4KB5A 3CVOA 2NXCA 2LXNA 5THQA 1KGSA 2AI3A 3QENA 1QVAA 4KLCA 3SBOA 4F91B 1RKNA 4G5GA 3JAME 4M8AA 2JN4A 1IAQA 1TUBA 5D8DA 1BROA 1U04A 1U0LA 2CCGA 2ZSAA 5AM0A 4QYSA 3ZD7A 4P22A 1BRMA 3HB0A 3ZGYA 4CM7A 5I48A 4B5LA 4EVIA 5F21A 1NNXA 2Q6VA 1DUVG 4X1KA 1XK7A 3TZUA 1KJJA 4TMYA 3BX1A 3ET5A 1RYEA 4YRRA 5E95A 1KF0A 5BW6B 3R8XA 2VCHA 3OZXA 4P3YA 4C29A 9LDTA 2ECQA 1QHEA 2X5XA 5I9LA 1I4XA 4KN7C 2UUBQ 1WLYA 4OMFG 4EVSA 5HS4A 4BATA 2OFOA 1NYTA 2Q1SA 3IHTA 3VQTA 1Z6HA 3Q8DA 4DIFA 3PE4A 3N9IA 5SY4A 1F17A 1XC7A 5A2GA 3U31A 2XUZA 1EH5A 4LFAL 1FDRA 3P2EA 4LISA 2WF5A 2UU9Q 4LWOA 4R6XA 4RSGA 3VV3A 4PSCA 4LJZC 2HCRA 1QZZA 2A5GA 3CUKA 2Y77A 2GBIA 3K6RA 4CQNA 3N7UA 3FA2A 5E6RB 3HKDB 2EYMA 1EQQA 1PH1A 1QKIA 3HOYH 2WG0A 4MQEB 1UZUA 1FYEA 4OY3A 3S7TA 1EJ0A 2E4UA 4B73A 4HDKB 3ZJYC 1YOBA 1PFNA 1XXHB 2DHRA 4LJ5A 2AWOA 4JBXA 4QUHA 4NENA 4UAJA 3D7KA 1W6UA 4HX9A 4RTLA 3PE3A 4IIUA 4NZMA 5GINE 1EVZA 4WJLA 3AG6A 1SNMA 2GX6A 3QWBA 4PCUA 4DSUA 4EHIA 1F5NA 2CFIA 3QK7A 3UAZA 3DMTC 2RAPA 1JX6A 1U99A 3STTA 1XZLA 5IWCA 2FWRA 2BSXA 1BQEA 2ES4A 3EJWA 1IBRA 3H2ZA 3HL0A 4TL8A 1RQXA 2F64A 3H84A 4P82A 4WUTA 5FTKA 2FP4B 5T3YA 5DNAA 2RAVA 4JEHA 2WTXA 4OXXA 1AFPA 4ZT2A 4DV0B 3FI0A 2C83A 1PT5A 3W1WA 2HDLA 1N32Q 3EN0A 3OZFA 3NCTA 3LKDA 3H2SA 4Z9AA 3ORYA 4L28A 3SMQA 2R0QC 1ULHA 3Q9UA 3I91A 1OWNA 4YT2A 1PTOD 1DJRD 1NPTO 3ITPA 2GN0A 4KIWA 2AJLI 2V3CC 2ZXPA 1KIMA 2FXVA 2ZLBA 1F2LA 1RJGA 1C3VA 2FU5C 3AYXB 4IOKA 1Z2AA 2D3WA 3FTDA 4DWOA 2XB9A 5JBIA 2EIHA 2VJNA 4IH4A 5CA1A 1AUVA 1QWSA 4B3DA 2DFTA 1H0RA 3DO5A 3NASA 4FK8A 4QXOA 3FZQA 4ZYUA 4JDUA 2HIXA 2DLCX 1PX2A 1OQAA 2CXSA 5LLTA 2ODPA 4Q5VA 3NYIA 3OEYA 3QBTA 4BBPA 1AHNA 1J25A 5HOEA 2Q3LA 1CLUA 1RJ9B 2EY2A 1HA5A 1U1EA 3B82A 4EY7A 4CM6A 3AM1A 2ATEA 3PSIA 2Q5LA 4MI3A 4R1TA 3AVQA 3GFTA 5LBUA 4B84A 1GN9A 1XYGA 1V6SA 2CNLA 1RLTA 2DECA 2I4TA 4GOXA 4Z2AA 2F0DA 1Z4QA 1PHPA 2GCOB 2I55A 4W6ZA 3WAJA 3BZKA 1DHRA 1K83B 4JNKA 2CY0A 3DMNA 4ZOLB 5BV0A 5I4IA 1HNNA 1U94A 3ABQB 5I47A 1WQ4A 5A3VA 1U0FA 2WV9A 2NYRA 1ES9A 2WOJA 3ZBUA 1Y4SA 2FW7A 4LFCQ 1YCGA 2QQFA 4EA9A 1Y4DE 2R6JA 3AFQA 3BMNA 2ATIA 4FIZA 2PU7A 3SG0A 4JAVC 4OO1I 1BE8A 1KWGA 5H3CA 2WIIB 5F23A 2ZBVA 1RXCA 5IH3A 3PXGA 4QLOA 1CF9A 1HQDA 4KBFA 4BMVA 4ERXA 2Y3IA 5JWOA 2RI1A 2PW7A 2D59A 2C9OA 1XMOL 5C5CA 3KDAA 3Q0AA 4IQ8A 2PEYA 3K5LA 2XGSA 3D64A 3ELYA 4NK5A 3CXUA 1RHKA 1RXIA 4TZTA 5EQFA 4UDXX 5F4ZA 4EHHA 2WMNB 4RL6A 1G8ZD 4F3NA 1I4GA 4LDPA 2QAJA 1Z5VA 2GCIA 1BXRB 3N3BC 5D85A 4EJMA 4IZ6A 2UZ0A 5CLJA 1JL3A 3DTVD 4NENB 3ZWCA 1ZKMA 2ZVDA 3F5MA 2XCSB 1UQRA 4DV1L 3NC4A 4IIJF 4DMLA 4ZAXA 4HLQB 2JLWA 1T4GA 3GLVA 3BQMB 2RHQB 1UUFA 3EZ6A 4XB1A 5EYPA 4HSEA 2XTMA 4DLBA 4F4IA 2ENWA 4EKYA 5JY6A 3EGXA 1EFRA 3VR6H 3VSBA 4HVLA 3OM1A 1X92A 1YS9A 2FQ1A 3LQ2A 2FG6C 1L5GB 5FK9C 1YT5A 3P9XA 1VQIA 1W0CA 3H2IA 1J7JA 3V34A 1UP4A 2H4JA 3OSUA 4R54A 1XQ6A 1NNEA 5CLHA 1E7MA 1Z5PA 5JQWA 4HY3A 1XX8A 2O2LD 4JU8A 3PR1A 4Y6OA 3VH3A 2XD4A 3CB4A 4RK5A 1P2FA 3RBXA 1VB3A 3KCQA 2DJFC 5GIOE 2R86A 3C7AA 1U31A 4LRWA 1J23A 1J6UA 1E69A 3EARA 1NBHA 1FUIA 3BE6A 1ZS9A 2SHKA 4YYEA 4D9IA 3ESZA 1ELOA 3WO1A 3MHPA 2BHLA 2OWEA 3OLCX 4HDQB 4NYJR 1D7OA 3DVRX 2I9PA 3BRQA 1MEJA 4P83A 5JZBA 1EEFD 5M5YB 4CKBA 1N6HA 1R6UA 2EJMA 2IZ6A 3PS9A 1WXQA 4RVGA