3J81L

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
155
structure length
155
Chain Sequence
STELTVQSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYEKRHKNVPAHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVASATGKANKQFAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00366 Ribosomal_S17 Ribosomal protein S17
L PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3j81L00
5IT9L 3JAML 5A2QL 3J80L 5FLXL 3J81L 3J7AV 5LL6X
chains in the Genus database with same CATH superfamily
2VY3A 3QWNA 1B50A 1VQIA 3F2DA 2AWOA 4DUZL 3KLRA 2V1CC 4FF2A 4P2CB 2N55A 4A3KG 3MAQA 3ULJA 4X64L 4A3BG 4POGA 4R4CA 2KVMA 4DV3L 2PI2E 2EYMA 1BNZA 1PTOH 1T9HA 3HFZB 2XSCA 4A3FH 1U5KA 1SDFA 4NXNL 3I4OA 1XPOA 4WRDA 1NTGA 1SYDA 2BH8A 4L5QA 1TWHB 5CV6A 3AFPA 4LJZC 4EX5A 4DAMA 1H9SA 2VS1A 1RF2D 1HQRD 3Q8DA 4DAYA 4GKJL 1VQ7A 1JR0D 2I5MX 1MIUA 5GADC 1D7QA 2K5NA 1VQBA 4KTAA 4PV1C 5FJ8H 3K57A 3AB9A 3NK9A 4NPSA 1E24A 3GQBA 3M4YA 3H3VC 2UXBQ 3GV6A 1IKMA 1HFGA 2JA8G 4YCUA 5EBCA 2CQAA 1WCMG 4CJ1B 5IGCA 3NP8A 2YTXA 3BDLA 3H15A 1KRTA 1V43A 4FF1A 2Q8IB 3EVQA 3SK4A 1D6EC 1NCVA 2D0OA 2R7DA 3GP7A 4DR2Q 5C5LA 4BBSH 1F2YA 3X3MA 1HUNA 4K5WA 1G2TA 3P20A 2CVRA 2HIVA 3CP0A 3CC7A 1RCVD 3NXWA 1Z6HA 3H6MA 4A3GG 2KBNA 2XNAC 1HNWL 1BDOA 1G51A 1UE1A 2JEBI 1Q8KA 1LABA 2A19A 4OELB 3FKIG 2O5JC 2JXMB 3PIP3 4RCOA 4A3MH 1Q12A 2CCZA 1STNA 2R92B 4B3SQ 4XQJA 1EY4A 3PO2B 1G291 4DNTB 3CHBD 3PUZA 3KK7A 2UXCQ 5F2DA 3RN5A 1VQ5A 1HRJA 2F0HA 1GO3E 2UUAQ 3PIO3 3J80L 3K7UC 3A8JE 3FEWX 1N36L 2IX1A 4O42A 5C0XH 4L8JA 3PUWA 2KHJA 2F4VL 2VNUD 1K83B 4RGTA 2IY5B 1XXGA 4EQPA 2QGQA 4DR5Q 2RHSB 1R4PB 1D8LA 3J81i 4GNXA 1DZ1A 1SNCA 4OIJA 2JA5B 3GD7A 2K5QA 4TRDA 1QB5D 1NJIC 4LFBQ 2IHFA 1S4ZA 5FO8B 4LFAL 1OTCA 5AJ3L 1A6XA 4HIMA 4OX9Q 1EFID 3S15B 4QY7A 4JPBW 1CI3M 4IOAA 2JA7B 3PO3B 1CZGA 5JJZA 2ID0A 4GZYC 2F0WA 2WAQB 2PW7A 2C9OA 1N8RC 1EIHA 3GTGB 1SE8A 3S16H 1H9RA 3O13A 1HXYD 3GTLB 2ZXPA 4P71A 2VUMH 1PDQA 3HOYG 1QNKA 5FLXL 2GN5A 2E2IB 4A3IB 3M3YH 1Y14B 2FINB 4LF4L 2HQEA 1IW7C 2N88A 3W2DA 3J81L 1EQTA 4CKBA 4DV5L 1I3QH 3TRZA 4OIKA 4B08A 4LFCL 1HZAA 4R4TA 5GQOA 1D2BA 3T1HL 1BO0A 2PMZB 2B2TC 2CFMA 3E9HA 3FRPB 1QCBD 2WV6D 1SNDA 4X3KA 4XYQA 1Q90A 4B3MQ 4HJ7A 1U4RA 4HMJA 2AKWB 5CBEE 3RN2A 4HN7A 5D3DA 4AH6A 2K04A 3D31A 2NVQH 3ICEA 2Y0SB 4E6IA 3SEBA 3STBD 1PRTC 3ZJYC 2ZJPA 1LTAD 4LK1C 2QA4A 4LFAQ 5A35A 3HOUG 1L0WA 2F0UA 5M5WH 3I4MH 5IY0A 1EWCA 1ICFB 3QB3A 2JA6G 2ZJRA 2I46A 4A93H 2ENBA 3OMCA 2WB1G 4MTKA 1KL9A 1AW7A 1EEFD 3A7AB 3CCLA 1YJWA 4JI5L 1MKHA 4KHVA 4CDEC 2FFKB 3PQIA 5G3LD 5FKAC 2A5HA 1PVOA 5IP9G 1EEID 1XNRQ 2F0VA 4A4IA 5LMNW 1IBKQ 3DM3A 3I91A 1PH3A 5IYCG 5JJIA 1GM5A 1I4PA 4DV4L 4A3EB 3PCOB 2EQSA 2K01A 1RDPD 4ILWA 1PV4A 4UY8C 3EA6A 1SFOH 1PH1A 1PRTB 2RSNA 4K8IA 2CW0C 4XXEA 4OXPA 3GV3A 2F52A 2A6HC 4YIJA 2A1AA 1H9KA 1PFMA 1YVCA 5J1ZA 5IODA 3PMFA 3CKIB 5ISRA 4A3LH 4LFCQ 2PNRC 2IJ0A 3TP6A 3S2DH 3NE5B 2WIIB 2A73B 3RNUA 1N33L 4JI4Q 4XT3B 1SLJA 1ZYRC 4HJAA 1I6HB 3D4WA 5JOBA 1WVLA 4OO1I 2R93G 5I2YA 5DLQE 4DR4L 1AE2A 2RF4A 1S5ED 2EZVA 1VQOA 2B8FA 2PPBC 4C3HG 5CV5A 3M4PA 5EKIA 3OHXC 4H02A 2DY8A 4HCSA 2E8GA 4QGUA 3KF8B 2B63G 1CFMA 4KD4A 3TZUA 1EU3A 1ZKOA 4BY1B 1K3BC 1Y1VB 2IW3A 4LF6L 1JE4A 4JI5Q 5HGQA 3MXUA 3OOCA 1TU2B 2NBFA 5JPMC 3A8IE 5IWAL 1XMOQ 3KBXA 4PZ7A 3CAMA 5JEAH 1A8VA 3GO5A 1TWCH 2CWPA 4GOPA 1V1PB 1PTOC 2XGTA 2LMCB 1CA6A 5I6WA 3V96A 2R7ZB 3J80E 2O5IC 5L37A 2EYOA 1Z47A 4JW0A 1K9MC 4BXXH 2KEEA 4C3IB 3JAML 1PYBA 4HSPA 1ESFA 1MGSA 2D0PA 4KY5A 4A3CG 4DR7Q 2J4XA 2DUDA 5KNCA 1NMFA 3IRBA 3A56A 5IGFA 2B2WA 1ILPA 1QVGA 4EVOA 4DFAA 2A8VA 2R92H 3K0XA 2B2UC 3SXHA 2ZM6Q 4JBMA 1X3EA 1JC7A 1BXTA 2FMCA 1ZXTA 2IHEA 1QUQA 4U68A 2NZ1D 3J7AF 1YHQA 1WTPA 1K0SA 3L9AX 2YU9B 1A62A 1UAPA 4JI8L 2K32A 1QILA 1GXDC 1XPRA 2NVXB 5IYDH 2LXKA 2F0TA 1EYGA 1O7ZA 4IUUA 4IUNA 2VB3X 1LT6D 5FO7B 4QQBX 1HH2P 4YHHL 2HT1A 3K59A 4KHPL 2K05A 2M2LA 2RKSA 3K0YA 4RGMA 1ESRA 2K50A 3KOJA 1GJXA 1KDBA 1VF5C 4DUYL 5KGUA 3C46A 1YJ9A 1SYEA 5C4HA 2LS01 5FLXE 1J6QA 1XMQL 2Z9HA 5FK9C 1YZ6A 1P16A 4A3FG 5J39A 4RGNA 4RHRA 4DK0A 3R3OA 4K0KQ 1YI2A 1DM0B 3FDTA 5M5YB 3J7YW 5CV9A 3DM1A 4GN3B 1Y8PB 1YITA 4B3RQ 3W3AA 1VQNA 1K3RA 3I56A 1ASZA 1BBUA 1F9SA 1XWEA 3HKZB 3VR2A 4WJ3M 1STAA 1XNQQ 2DNCA 1TR5A 2MO1A 3D4RA 4G7ZC 1NMGA 4ZKCB 3AMUA 2L55A 4ZCKA 4B3TQ 3S14H 3OW2A 1EY0A 3CRLC 4A3DB 1R9TH 5FJ8G 5I4DA 3AU7A 4PQXA 3HOVB 1II3A 1K73C 4ULLA 1TWAB 3I8ZA 1XYIA 1RHPA 1HCZA 3BZKA 1B1ZA 5BR8Q 3KLWA 2PQAB 4H13C 1WTRA 1JJ2A 2PQEA 1ICWA 3P75A 3J7ZC 3ER0A 2KQ3A 1C0AA 2JE6I 2NVYB 3ONAB 4BBSG 4P72A 5M3MH 4NXMQ 5C4XB 1JICA 3M4QA 2UXDL 1SR3A 5EBDA 2JK8A 1KABA 5E7NA 5M3FB 4JI7Q 2K75A 3HOXB 1EZ8A 1PFBA 1SE3A 3C3LA 1S5FD 3L7ZC 2OTLA 4OEMB 2EVBA 4JI6L 1WJJA 3G6JB 3IFTA 2Q2UA 2ASBA 2IT1A 2WKDA 2VQEQ 1BUVT 4PMWA 5ELOA 4A3MG 3SHLA 1YNND 3IL8A 3CRKC 4LF9Q 1UNSA 5C44B 1JOKA 5TSSA 3A8KE 3TQYA 3TDQA 3BVZA 4R8IA 5LMUL 2B2YC 3BU2A 3UI2A 2IX0A 3PIPA 1N9WA 1YBYA 2I5HA 1UUPA 3KJOA 4JVZA 4R4IA 4LF5L 2ALYB 3CW2C 2KCMA 5C4ZA 3R8BA 1MSGA 5C3EH 1XPUA 1E3PA 1C4QA 2EXZA 3VDYA 4BBRB 4LUZA 1X3QA 3TN2A 5EKKA 5C0XG 1JE5A 3PIOA 3IAYA 4TKOB 1L1OC 4RKLA 4HIOA 1SNOA 5KIXA 1RKNA 3A5UA 4HSVA 1LO5D 2LFNA 3LNNA 4X3TA 3G6EA 1JB7A 1DCZA 4I65A 2I07B 4H0LC 1A2TA 1Q3LA 4KKSA 3C1FA 4ZKBB 1OO9B 5C3XA 2JP1A 1STHA 4YCVA 4DR1L 3K8AA 4HEDA 4MN3A 2AQ2B 4N9TA 5JJKA 3GTPH 1DOLA 3MEHA 3PSIA 2ATWA 1AEXA 1YHBA 4GLAC 4X62L 2EJMA 1A63A 1E22A 2EDGA 2VUMG 3MXNB 2F0NA 1WTWA 5LMUQ 2UUBQ 3HOWH 1OXUA 4EQ5A 1VQ9A 3JAME 2Z6KC 1IL8A 1VF7A 5CORA 1HZCA 2DGYA 3S1MH 1FR3A 4AQYQ 4A3BB 3S24A 3HRZC 3KDFB 2A69C 1KAAA 1FD7D 5FLXc 4ZYSA 4RKBA 3RZOB 3NELA 3BVMA 3AEVA 4KY7A 2XWJB 1TWGB 5DAUA 2Z0SA 2EE1A 1I5FA 5D65A 3Q22A 4M1UB 1VQKA 2EY2A 1EY9A 1Q86C 2UUCQ 1CKMA 3VYRA 2G5DA 2K5DA 4UP9A 4XQNA 3PUVA 1HNZL 4ZRZA 4C2MH 4DV2Q 3K5OA 4IPHA 3BZCA 1SNQA 3I4MG 2F0JA 4CJ0B 1VQEA 4DV1L 1YIJA 1W2BA 2VXWA 4A93G 2G9DA 5DM73 3G71A 3EFXD 2NB0A 5EQ0A 4CJ2C 2JA8B 2QCPX 3CXCA 1STEA 2Q8RE 1PFSA 1N32Q 1XX8A 2D2CC 5KRUA 3EROA 2ZTCA 2CH4W 3CF5A 1EWHA 1SYCA 2LKVA 2NVXH 2KHIA 4YWKA 5LMNQ 1TS5A 1JMCA 5IGGA 4A3GB 3H3VI 1ASYA 4OHJA 3WOFA 1STGA 1SBBB 4LWCA 3BS1A 1X55A 4JBKA 4GLXA 3M7NA 1HA6A 1GKHA 1S5BD 1TKWB 3VYUA 1JOQA 4KI0A 3T1YQ 3T13A 2VQFQ 4F87A 1VQAA 4A3LG 4DR6Q 3AQQA 3CQZB 4IJLA 1ONLA 4YY3L 1EZ6A 2DJFC 1FGUA 4JV5L 2F0MA 3U58A 1KXLA 4DUZQ 1IW7D 3T56B 4IFDJ 1CSQA 3SVMA 4RHSA 5M5YH 4G57A 5C4JH 3F2CA 3L3OC 4X64Q 4XDXA 1UWVA 3RZDB 5IIFA 3DHQA 1FJGL 4DV3Q 3R2TA 1JB3A 3QO2A 4FNFA 3M4OH 4IALA 2VB2X 3CCQA 1HR0L 3RD4A 3TSSA 3E5SA 3FHWA 4LF8L 2RA4A 4A3DH 1F9PA 5FO9B 4NXNQ 1B8AA 2N8NA 1PRTD 3OPOA 4J15A 3GTJH 2PZUA 1LUZA 3OIQA 1VQLA 3QOLA 3PUYA 3KF8A 5JEAG 4GKJQ 2EYJA 3D6CA 3U9OA 4KV6A 3P1HA 4K6LA 2A74C 2ZXRA 5IT9c 2V4DA 2L1BA 1KAWA 1BCPC 1YJNA 4BA2I 4UP8A 2ZJQA 3GTQB 3QIAA 5CMDA 2HHHL 4IUQA 4BXXG 4LW1A 1P8LA 5E3FA 2JJQA 2EYFA 4UPAA 2HCIA 1V1PA 1SXTA 3H0GH 1NR2A 4HR7B 2NVTH 4K6DA 3JAMc 1W3SA 3NBIA 2R92G 3S17B 3MZ5A 1HNWQ 1HHVA 2BA0A 1KNAA 1HUMA 1TS4A 2A6EC 5KNBA 1E7ZA 2XWBB 4PZ6A 3H09A 4J1MA 1XJVA 4DV6L 2WB1E 2AUKA 4YWLA 2YV5A 2QEJC 1HQMC 1SE2A 1MBYA 3MTSA 3CPWA 1ZYRD 3Q0AA 3B6YA 5ELDA 5IYDG 5EAYA 4BBRH 2K14A 1OXVA 2BA1A 5GAHC 4K2KA 4BY7H 1WTOA 3VR5A 2E2HB 4POFA 4BA1I 2JA9A 2KENA 2Q2IA 3GTMB 4DK1A 5KNDA 3HOZB 3RR5A 4V190 5IGDA 4JI1L 4G7HC 2B2VA 2EYHA 1CSPA 5G3LF 1N36Q 2JA5G 3HOUB 4DXGA 1U4MA 2GVAA 1IBML 4IFDI 3BVGA 3NBHB 2JA6B 2EXDA 4R4OA 2O4XA 3I4NB 3UDIA 3K7AH 1OXSC 2WB1B 3HKSA 1Y1WB 3H94A 2NN6I 2F4VQ 2SEBD 2RSOA 3DMUA 1U9RA 2CHBD 3BJUA 1A15A 2UU9L 2EJGC 2YTVA 1OXTA 5E1FA 4WJ4A 1WFQA 4J6HA 3I55A 1QJOA 2DN8A 2J7ZA 2NZOA 2WAQG 3K58A 3A0JA 3SR1A 2L15A 2SNMA 4NP5A 1KDCA 5AJ3Q 1HJPA 5I2XA 3T4AC 1Z9FA 1MI2A 2C35B 1JJCB 2RCFA 2YTYA 3R93A 4QL5A 2QILA 5BN3A 4JBJA 4DV6Q 1EOVA 4NMZA 3MXGA 3DLLA 1D5MC 3D3RA 4HTHA 3TBIB 2J0TD 4C1NI 5M5XB 1R4QB 4DAYB 4DNIA 1EYAA 1JQYD 5M3MG 1TY2A 4KKTA 2FJ2A 1PH4A 1BOSA 2R93B 1QWYA 4FO2A 4LF4Q 4A3JB 4JI3L 2RVLA 2WP8J 2NTSA 2Y0SG 4C3HB 2PQAA 3D4DA 3FP9A 4CHTB 3KUPA 4DV5Q 1VQHA 3MEFA 3T51B 2VW9A 1PA6A 3D0FA 2B63B 5C6AA 1M4VA 1DGSA 1TS2A 4HIKA 3T1HQ 3E9IA 1IXRA 3NPPA 1NUCA 1AFPA 4QF4A 2ES2A 3PF4A 2FHTA 3M7GA 1RL2A 2F0GA 1V1OA 1GUTA 4ID6A 4HCEA 4NB3A 1TWHH 1RD9D 3S1NB 3ND9A 1CKOA 5T1GA 4JG2A 1Q46A 3TP5A 2F0OA 3S1QB 2OT2A 3E0EA 1AZPA 5C3EG 4RA8A 1TIID 1A3TA 4IOCA 4ME5A 4GNXC 2OTJA 1EWIA 1I50B 1KNEA 2ZTEA 4O0AA 1PH6A 2KEDA 5GROA 2QF7A 4BS9A 4RMFA 4XT1B 1STYA 2A68C 1IBLL 5GAGC 3NQTA 3TS2A 3GDEA 4DKAC 4L5SA 4JOIA 2F0DA 4FXGC 4DV4Q 5EPJA 1PH9A 3U50C 1J8IA 1X32A 1FYCA 1HZ9A 4KHZA 2AMCB 2ZTDA 3OWFA 3CCSA 1HTPA 4JI3Q 3KBGA 3FPPA 1F9QA 2H5XA 1AH9A 4GNXB 2XRSD 1RTOA 1MJCA 3CMAA 3CU7A 1U4PA 1B53A 5ELCA 1CZWA 4ABNA 1PXUA 1EQVA 1N33Q 4X65L 3H3VH 4KMUC 3K5MA 3HOWG 3NUCA 5ELEA 4F7XA 1Y8OB 3CCMA 1QZHA 3PO2H 2D62A 2DJGC 4K8JA 4DR4Q 3GTOB 1LTTD 2E2JB 1HR0W 1Y69U 5HURA 3NTHA 3CPFA 3KF6A 4GN5A 2B8GA 1S40A 1PTOB 2K33A 4P75A 4QUCA 4LF7L 4NDXA 4PMBA 3MHBA 3MXNA 3NWTA 3RMHA 1F77A 2KOLA 4I7AA 1KD1C 5IE8A 4OO1G 2RCNA 4LF6Q 2Q2HA 5KYIA 4DU9A 1K83H 2D5DA 2PW5A 1B70B 4WJWA 2R7FA 1SYFA 5IWAQ 2CQOA 3M9BA 1EQQA 2ICEC 2JA5H 4IURA 2IL8A 2NTTA 1AN8A 1VQJA 3VR4A 1EL0A 5NUCA 1LLRD 5FLMH 1CHQD 1CHPD 1SYGA 2X69A 4EQOA 3S15H 1C48A 1VQ6A 2JA7H 1C7YA 4G4KA 3J81E 3PO3H 4RG1A 2XIWA 3CCEA 1I6VC 1JWSD 3EJIA 2B39A 2QKIC 3K5LA 4DV0L 1I4XA 5IP7H 1N34L 4MHEA 1WTHA 3GTGH 4BBSB 3OIPA 3HZXA 3CC4A 2XTIA 1QVFA 3GTLH 1G6PA 2TMPA 1GUSA 4IQZA 4ME3A 4IUVA 2E2IH 1SMXA 3MFYA 4FDBA 3CD6A 4A3IH 2E2HH 4K2LA 1PHJA 3RLOA 5M9OA 2K52A 3HOZH 3NSWA 4LAAA 1B4OA 4QUFA 2F0SA 2EPBA 2BCOA 4A3MB 1HFNA 4JI8Q 1WOCA 1SEBD 2PI2A 2KJXA 2Q2TA 3A5ZB 3I4NH 3FMCA 1PYWD 2X6LA 4YHHQ 1PZKD 1Q1EA 3M85A 1Y1WH 1EIFA 4KHPQ 2A69D 4ODGA 3ND8A 3FPUB 1FVIA 4CDCC 4DUYQ 3W1GA 1E2ZA 1KIXA 4PNYA 1E2VA 4DK6C 3NTIA 1SYBA 4RGOS 1XMQQ 3HKZG 1BF4A 4IUPA 3K5NA 1SNPA 1CM9A 2SOBA 3TS0A 2PZWA 4A75A 4A3DG 1PH5A 5A2QL 3OTOL 2HIXA 1JT8A 4GOPC 3K6OA 4JBWA 2Z6BA 4IPGA 4C3JB 1WTVA 1Q1BA 3G7LA 2RDHA 4C56C 4IN3A 1F2ZA 3K80C 1HNXL 1H9JA 4XYOA 2L11A 2I5LX 3U4ZA 5M5XH 2NN6H 2AWNA 1B3QA 4A3EH 3S9WA 2IPKD 3J80c 1Z7TA 1HPCA 1XTDA 1BBWA 2B2WC 1DJRD 3KFUA 2JEAI 4WORA 2E75C 4KD3A 4JYAL 1LT5D 1SJHD 2KCTA 1I94L 4O2DA 1LT4D 1ENFA 4BWGB 1VDZA 3SK6A 5CR3A 3UE1A 3VR3A 2VUMB 3QOJA 3H0GG 1KHIA 4DA2A 1X3PA 3A55A 1GUNA 1PH2A 2UXDQ 2F03A 3MC0B 2WINB 1SJED 2R6GA 1I6HH 1KQSA 3OMGA 4K5VA 4R9WA 5LL6S 4HMIA 3WOEA 5EPKA 3HP3A 4JI6Q 3W1BA 3S1NH 1U4LA 1ILQA 4KKUA 3TP7A 1NAPA 3HEJA 3UDGA 3T53B 1JJGA 1VQCA 1D1KA 1VQ4A 4AYBE 4YWMA 1JORA 1K28A 3A54A 4IUTA 1L1OB 4XIGS 4DV7L 1EOTA 1I50H 4BBRG 3QG1A 2IX3A 4KY6A 4BY7G 4BY1H 3FVQA 1Y1VH 4A3KB 4LF5Q 1MHWC 4FP5D 1BQQT 3ZYYX 2D9UA 1W6KA 4H44C 3I3CA 2I0QA 3OSOA 5DM63 4F88A 1LTID 5M5WB 1NE3A 1QOHA 1PLFA 3CCJA 5D3IB 5LL6X 1EYCA 4A93B 3ITPA 4DK3C 1YHAA 2HUGA 3NEMA 3J81c 4OO1H 3TP8A 4Y7NB 2R7ZH 2VZAA 3VYTA 1VMCA 4Q5VA 3VA7A 3CMEA 4C3IH 3D6WA 3KLSX 3NQIA 4QMGA 4DR3L 1S5DD 4DN4M 5C5MA 3E0JA 4DR2L 1K8GA 4F8MA 3J7AV 3G48A 1LTSD 1SMYC 1SFOB 1YNNC 1DD2A 1CTMA 2KECA 4AYBG 2L5TA 1AZQA 2GVBA 4QIWE 4L5TA 1WCMB 5KEEA 3GTOH 2BE5C 4DR1Q 3N52A 1BR9A 4N8FA 5I9OA 1A0IA 2E2JH 1XTCD 5ELNA 1TWFB 3TEHB 2KA7A 1YNJC 3S2DB 2YYZA 2MQHA 4X62Q 2YU9H 4DGZA 2B29A 4DV7Q 1VS0A 3UDFA 4RWSC 1GHKA 4IPCA 2A6ED 4B3SL 4LMQD 1BKBA 2UXCL 1PRTF 3FKIB 2JQOA 1GUOA 1KTKA 3CCVA 2UUAL 2B2TA 3E3XA 4CGYB 2QW7A 4QIWB 2K5WA 2XVSA 3SK8A 5I6YA 4X6AH 4O1NA 2LY7A 3U9SA 1D5XC 1EY5A 1T5XD 3SK5A 1V9PA 4V0BA 2KHSA 5BN4A 2TSSA 5EGTA 3U4VA 2BDOA 3J7A5 4WFN3 2CWAA 3I2ZA 5COYA 3T16A 2G9HD 3J80i 2VL6A 1GVPA 4DR5L 4DAVA 1LTRD 2OEOA 1HNZQ 2HDMA 4R1JA 2F0PA 3BG3A 4PG3A 4DR3Q 2OF1A 5CBAE 1O7LA 1Q82C 1VCIA 4FYDA 1TQOA 1TWCB 5K5PA 4LFBL 4PMCA 1IYVA 2DNEA 4DV1Q 3KJPA 4G7OC 5FOBB 2NWGA 5D14A 4ZUIA 4OX9L 4DNRB 4RCNA 4ALPA 1K0RA 3JC66 3HOVH 2OQ0A 5DEHA 2EY1A 1TWAH 1V1QA 3DWQA 5JPNC 2DY7A 3VYSA 5IGBA 4RAUC 3NHHA 3WWVA 5A2QE 3UDXA 2NVYH 4XTCS 5C4XH 4FVMA 2L4NA 5EPLA 5CV4A 1HA5A 1I4GA 4NKLA 5M3FH 1B9MA 1LTBD 1Q8IA 1X56A 3HOXH 2N78A 5ELBA 2SDFA 1T5EA 4YY3Q 2PZTA 2KCCA 4JV5Q 2WACA 3HOYB 1E0BA 1LM0A 5K36H 3GTKB 1IL2A 2N49A 2CW0D 4TVAB 5C44H 4B3ML 1RIPA 2EYLA 2WAQE 1I4QA 2A6HD 3PO2G 4NW2A 2QDLA 2PO4A 4Z9CB 2MNAA 4L6TB 1FJGQ 2N3SA 2K5VA 1YNXA 4C3JH 2K7VA 1F9RA 1TXYA 3A74A 3KLSA 1E1OA 3BZDB 3SGIA 1HR0Q 1BCPB 3DEOA 1PTOF 1AE3A 1ENAA 4LF8Q 1X65A 3N6RA 5IYBG 4IPDA 1LTLA 1WI5A 2HCCA 4ZUJA 3K81C 1M1KC 1TVXA 1D5ZC 1CK1A 1ML0D 4RFBA 1NSNS 3NTKA 3G4SA 3IFDA 2HDLA 1F2MA 4M8AA 2PMZE 5JJLA 1XNRL 3A7LA 4ZQ3A 4CDDC 1IBKL 5HY6A 2KUMA 4P74A 3S14B 1PZJD 3VR6A 1FNVA 1R9TB 2HQLA 5J22A 3R2IA 2OCEA 2Y0SE 4K5XA 5FLMG 1CKNB 3EN2A 1Y8NB 4KK7A 1KRSA 4L63B 2JN4A 4MNOA 2A68D 3EIVA 3S1RB 5T1IA 2JA7G 2HHHQ 2M9VA 2CKZB 1K8AC 1L2FA 2NYZD 3PO3G 4KN4C 5I9PA 1DYQA 3DEPA 2FXQA 1TY0A 1VQ8A 4FXDA 5IP7G 1PTOD 1YEZA 3C2PA 2B2UA 1GUWA 5M3MB 4DF7A 3KYHC 4OGQC 4P73A 2MHVA 3S2HB 3RUZA 3SDZA 5CC4A 5CGKA 1J9OA 4JI4L 1J5EL 1KC8C 4J8QA 3I7FA 3I70A 4DXFA 4GKKL 3SE0A 4A3IG 5KYLA 4A3KH 4JCVE 2F0QA 4KLKA 3HOZG 1E2WA 2EJFC 2KCNA 4A3BH 1NR4A 4B9WA 5LHY1 2EIFA 2PNHA 1D1IA 1CA5A 3RZOH 1EU4A 1H9SB 2ZXOA 3Q23A 1FNUA 4HJ8A 3HG9A 3MVVA 4X3UA 1TWGH 3I4NG 1SSOA 3ULPA 2AQ1B 3RLNA 1Y1WG 2L0CA 1VQPA 2C5CA 1FL0A 1K8OA 3Q24A 4GN4B 4JC0A 4Y7NH 4Y52H 1QG7A 3AFQA 4LNQA 4EQNA 1U0LA 4JI1Q 2E5LL 1PH8A 5C3EB 1IBMQ 1NNXA 2OQKA 1XMOL 2Z4IA 5BN5A 5JAVA 2LXJA 4DAPA 1IZ6A 3PGZA 3Q6SA 4GS3A 4EGVA 1C9OA 1CQFA 1GD7A 3I72A 1EUJA 1UE5A 2UU9Q 3DWPA 1EIYB 4B9XA 5IOCA 2JA8H 1KDAA 3LWEA 4MTNA 1WD0A 1WCMH 4UHVA 1DONA 3P7JA 5ELFA 1O7IA 2QDBA 3NWSA 5EJWA 4DR7L 4IFDG 1CT1D 1TWFH 4FXKC 1WYDA 2NN6G 1S72A 2E2DC 4A3EG 1J5EQ 3QJYA 4GKKQ 4A3GH 3LWUA 4ZAIA 1STBA 1M8AA 1MD2D 3JAMi 3PUXA 2F1MA 3MXPA 2ZM6L 4A3JG 1QVCA 1M90C 1FGBD 4FF3A 3FKIH 3OYYA 1B2TA 1VQFA 2Z1CA 4CKCA 3GTPB 5C0XJ 1UEBA 2QEXA 1H9MA 1A3UA 1UEAB 2Z4HA 3CQZH 5JVG3 3DWAA 3HOWB 2PYKA 2XN9C 1B44D 2MP1A 4Q0FA 1EIGA 3S1MB 1GOZA 5IT9L 1JWUD 2E5LQ 1PFNA 1I4RA 4TSSA 1LACA 2IWHA 4CDFC 2AQ3B 3RZDH 2XRQD 4R4QA 1WD1A 2B2YA 3STBC 1H95A 2F0IA 1EY6A 3TZDA 2B2VC 3BDCA 1EY8A 1X6OA 3DUZA 4K0KL 4BY1G 1IYJB 2E76C 1Y1VG 1JWMD 3OWEB 1JCKB 4B3RL 4C2MB 1RODA 1MSHA 5CV8A 2BDNA 3UE0A 4A3FB 1XNQL 1L1OA 2EY6A 3L0OA 4B3TL 5IYBH 3LGJA 4A76A 4JK1C 3LX0A 3I4LA 4C1NK 4GLVB 4ZK9B 2MUYA 2R7ZG 1QE6A 2MPMA 3KDFA 3GTQH 3I90A 1IBLQ 4IJHA 4KJOA 4C3IG 1K8MA 4KN7C 3W5OA 2WKCA 5BR8L 5CYUA 4CKEA 3E6ZX 4OWXB 4MIUA 1SN8A 1B3AA 1NBWA 3HOYH 4NXML 5E4XA 2NUCA 2BOSA 4CBVA 2WFWA 4JI2L 1W6JA 3GTKH 2K4KA 2L12A 1KLUD 3S17H 4HAEA 2O2LD 4JI7L 3BYTB 4OWWB 4HIDA 3HKZE 1DXMA 1ZEQX 1NY4A 1A2UA 1MJEA 2ZT9C 3C1EA 4HJ5A 5IGEA 1X3FA 3CC2A 2Z6KA 4QJFA 3F1ZA 4LUVA 2VQEL 3HGBA 4X65Q 3I73A 3EQLC 1G8ZD 5GAEC 4LF9L 1FNWA 2R3ZA 2MO0A 2CH4A 2R61A 1X54A 5H1SE 5C0XI 5HGTA 2K6AA 5C4JB 1SROA 1JOOA 1PMRA 4YCWA 3GTMH 2K1BA 4HJ9A 3BDOA 4IZ8A 3F8TA 5E4WC 1L0YB 5CV7A 3M4OB 4LF7Q 2PCFB 3WDNA 4FF4A 2Q8TA 3HOUH 1BVSA 1SE4A 1EQRA 2OXPA 2JA6H 2F0EA 3URYA 1IHZA 1G91A 2Z8LA 2L9HA 1GHJA 3TREA 1O7YA 1G2SA 2RDGA 4LUOA 3S1RH 3GTJB 2P5ZX 1VMPA 3RLFA 2HD3A 4JI0L 4AIMA 1IYUA 5IP9H 4QB4A 1EFWA 4N9PA 1LTGD 4U673 3HS0C 3BYYB 5IYCH 4TQUS 1OXXK 3CCRA 4KJNA 4JI2Q 1WTXA 3ULLA 4OONA 3S2HH 1SNMA 2F3VA 1DOMA 4JOIC 2B3GA 3X3NA 2JSOA 4PZ8A 1X3GA 4X66L 3HOVG 2RBMA 1Q81C 2F0KA 2F0FA 1WTQA 2EYPA 2RHQB 2NZHA 2RQXA 2RDFA 4ZLTF 4DV0Q 1N34Q 4IFDH 1S5CD 2F3IA 4H7BA 1SMYD 3AYHB 3H0GB 3DXJC 1LV9A 3H91A 2NVTB 3QR8A 1EY7A 2EY5A 2M00A 5C4XG 3MFGA 2MGSA 2BE5D 2UUBL 1O78A 4I7ZC 2R93H 5JEAJ 1QNUA 5M3FG 3HOXG 4A3JH 1YNJD 3EBEA 4AQYL 2AHOB 1X9NA 4C3HH 1CUKA 3S16B 3ERSX 4IO9A 1SAPA 3TMEA 3IKJA 4UAIA 4N8X1 2B63H 1EYDA 1IKLA 1O80A 3F2UA 2LSSA 2F4IA 5K36G 4MZ9A 4GOPB 4BY7B 1L0XB 5C44G 4APVA 4UDUC 4OWTB 3M3YB 4QCLA 2H4OA 2H1EA 2UUCL 2BH2A 4X3SA 3V2TA 4JI0Q 1CQVA 3MA2B 4K14A 4S3SA 1B7YB 3ERQA 3F2BA 1F2LA 4C3JG 1LT3D 1S3OA 2F0LA 1I3QB 1BBXC 1KLGD 2EOTA 2AUJD 4DV2L 3L2PA 3S1QH 3PV0A 1RTNA 3K7AB 1UE6A 1Q7YC 1BCPF 1V8QA 5IT9E 1SRUA 1UE7A 1ET9A 1TS3A 2SNSA 1LYLA 4UP7A 3OTOQ 4X66Q 1DOKA 2ICIA 2NVQB 1E1TA 2MFIA 4OL7A 3VA5A 2FMMA 2K28A 3CCUA 1G6ZA 1I4HA 4XQQA 1HZBA 4R8NA 4A3CH 1PH7A 2K5HA 1HNXQ 1QUQB 1VQGA 3OW7A 5C3WA 3KF6B 3I4MB 5AFWA 5J3BA 3MWYW 4L5RC 1N32L 3D8GA 5DNFA 5EKLA 5JVH3 2OWOA 2GA4B 1B9NA 1QZGA 2F3WA 1ENCA 2E74C 5LMNL 4AYBB 2X6GA 1GUGA 1ET6A 1PZID 4DPGA 3PF5A 1VQDA 3V05A 2UXBL 1C8CA 2MJ8A 4JYAQ 4RH6A 1I94Q 2JYOA 3NBHA 3T1YL 1TT2A 1A3VA 2VQFL 1VQMA 4DR6L 1BCPD 3NENA 1AP0A 1HTLD 1CKNA 2K03A 1RJTA 1PYSB 3J81j
chains in the Genus database with same CATH topology
3QWNA 1B50A 2AWOA 3KLRA 4FF2A 4P2CB 2N55A 3MAQA 2KVMA 2EYMA 1BNZA 1PTOH 2XSCA 1SDFA 4WRDA 1SYDA 1TWHB 5CV6A 4LJZC 1H9SA 1RF2D 1HQRD 4DAYA 1JR0D 4KTAA 4PV1C 3K57A 3AB9A 3NK9A 3GQBA 3M4YA 3H3VC 3GV6A 1IKMA 1HFGA 5EBCA 2CQAA 4CJ1B 5IGCA 3NP8A 3BDLA 1V43A 4FF1A 2Q8IB 3EVQA 3SK4A 1D6EC 1NCVA 3GP7A 5C5LA 1F2YA 3X3MA 1HUNA 4K5WA 1G2TA 3P20A 2CVRA 1RCVD 3NXWA 1Z6HA 3H6MA 2XNAC 1BDOA 2JEBI 1LABA 2O5JC 2JXMB 3PIP3 4RCOA 1Q12A 1STNA 2R92B 4XQJA 1EY4A 3PO2B 1G291 4DNTB 3CHBD 3PUZA 3KK7A 5F2DA 1HRJA 2F0HA 3PIO3 3J80L 3A8JE 3FEWX 2IX1A 4O42A 5C0XH 4L8JA 3PUWA 2VNUD 1K83B 4RGTA 1XXGA 4EQPA 1R4PB 1DZ1A 1SNCA 4OIJA 2JA5B 3GD7A 2K5QA 4TRDA 1QB5D 1S4ZA 5FO8B 1A6XA 1EFID 3S15B 1CI3M 2JA7B 3PO3B 1CZGA 5JJZA 2ID0A 4GZYC 2F0WA 2WAQB 2PW7A 2C9OA 1EIHA 3GTGB 1H9RA 3O13A 1HXYD 3GTLB 2ZXPA 1PDQA 1QNKA 5FLXL 2E2IB 4A3IB 2FINB 2HQEA 1IW7C 2N88A 3W2DA 3J81L 1EQTA 4CKBA 4OIKA 4B08A 1D2BA 1BO0A 2PMZB 2B2TC 3FRPB 4X3KA 1QCBD 2WV6D 1SNDA 4XYQA 1Q90A 1U4RA 4HMJA 5CBEE 4HN7A 5D3DA 2K04A 3D31A 2Y0SB 4E6IA 3SEBA 1PRTC 1LTAD 4LK1C 5A35A 2F0UA 1EWCA 3QB3A 2I46A 2ENBA 3OMCA 1AW7A 1EEFD 3A7AB 4KHVA 2FFKB 5G3LD 5FKAC 2A5HA 1EEID 2F0VA 3I91A 1I4PA 4A3EB 2K01A 1RDPD 4ILWA 3EA6A 1PRTB 2RSNA 4K8IA 2CW0C 4XXEA 3GV3A 2A6HC 4YIJA 1H9KA 1PFMA 5J1ZA 5IODA 3PMFA 3CKIB 5ISRA 2PNRC 2IJ0A 3TP6A 3NE5B 2WIIB 2A73B 4XT3B 1ZYRC 1I6HB 3D4WA 5JOBA 1WVLA 4OO1I 5I2YA 1S5ED 2EZVA 2B8FA 2PPBC 4C3HG 5CV5A 5EKIA 3OHXC 2DY8A 4HCSA 1CFMA 4KD4A 3TZUA 1EU3A 1ZKOA 4BY1B 1Y1VB 2IW3A 1JE4A 3MXUA 3OOCA 1TU2B 2NBFA 5JPMC 3A8IE 3KBXA 5JEAH 3GO5A 1V1PB 1PTOC 2LMCB 1CA6A 5I6WA 3V96A 2R7ZB 3J80E 2O5IC 2EYOA 1Z47A 2KEEA 4C3IB 3JAML 4HSPA 1ESFA 1MGSA 4KY5A 2J4XA 5KNCA 3A56A 5IGFA 2B2WA 1ILPA 4EVOA 4DFAA 2B2UC 3SXHA 1JC7A 1BXTA 2FMCA 1ZXTA 4U68A 2NZ1D 3J7AF 1WTPA 3L9AX 2YU9B 1UAPA 2K32A 1QILA 1GXDC 2NVXB 2F0TA 1O7ZA 4IUUA 4IUNA 2VB3X 1LT6D 5FO7B 3K59A 2K05A 2M2LA 2RKSA 3K0YA 4RGMA 1ESRA 1GJXA 1KDBA 1VF5C 5KGUA 3C46A 1SYEA 5C4HA 2LS01 5FLXE 5FK9C 5J39A 4RGNA 4RHRA 4DK0A 3R3OA 1DM0B 3FDTA 5M5YB 3J7YW 5CV9A 3DM1A 1Y8PB 3W3AA 1F9SA 1XWEA 3HKZB 3VR2A 1STAA 2DNCA 1TR5A 3D4RA 4G7ZC 4ZKCB 3AMUA 2L55A 1EY0A 3CRLC 4A3DB 5I4DA 3AU7A 4PQXA 3HOVB 1II3A 4ULLA 1TWAB 3I8ZA 1XYIA 1RHPA 1HCZA 1B1ZA 4H13C 1WTRA 2PQEA 1ICWA 3P75A 2KQ3A 2JE6I 2NVYB 3ONAB 5C4XB 1JICA 5EBDA 1KABA 5M3FB 3HOXB 1EZ8A 1PFBA 1SE3A 3C3LA 1S5FD 3L7ZC 2EVBA 3G6JB 3IFTA 2IT1A 2WKDA 1BUVT 4PMWA 3SHLA 1YNND 3IL8A 3CRKC 1UNSA 5C44B 1JOKA 5TSSA 3A8KE 3TDQA 3BVZA 4R8IA 2B2YC 3UI2A 2IX0A 1UUPA 5C4ZA 3R8BA 1MSGA 1C4QA 2EXZA 4BBRB 1X3QA 3TN2A 5EKKA 5C0XG 3IAYA 4TKOB 4RKLA 5KIXA 1SNOA 1RKNA 4HSVA 1LO5D 2LFNA 3LNNA 4X3TA 1DCZA 4I65A 2I07B 4H0LC 1A2TA 1Q3LA 4KKSA 3C1FA 4ZKBB 1OO9B 5C3XA 2JP1A 1STHA 4HEDA 4MN3A 2AQ2B 4N9TA 1DOLA 3MEHA 1AEXA 2EJMA 2EDGA 2F0NA 1WTWA 1OXUA 3JAME 1IL8A 1VF7A 5CORA 1FR3A 4A3BB 3HRZC 2A69C 1KAAA 1FD7D 4ZYSA 4RKBA 3RZOB 3BVMA 4KY7A 2XWJB 1TWGB 5DAUA 2EE1A 5D65A 3Q22A 4M1UB 2EY2A 1EY9A 3VYRA 2K5DA 4XQNA 3PUVA 4ZRZA 3K5OA 1SNQA 2F0JA 4CJ0B 2VXWA 2G9DA 5DM73 3EFXD 2NB0A 5EQ0A 4CJ2C 2JA8B 2QCPX 1STEA 2Q8RE 1XX8A 2D2CC 5KRUA 3EROA 1EWHA 1SYCA 2LKVA 1TS5A 5IGGA 4A3GB 4OHJA 3WOFA 1STGA 1SBBB 3BS1A 3M7NA 1HA6A 1S5BD 1TKWB 3VYUA 1JOQA 4KI0A 3T13A 4F87A 3CQZB 1ONLA 1EZ6A 2F0MA 1IW7D 3T56B 4IFDJ 3SVMA 4RHSA 4G57A 3L3OC 4XDXA 3RZDB 5IIFA 3DHQA 3R2TA 1JB3A 3QO2A 4FNFA 4IALA 2VB2X 3RD4A 3TSSA 3E5SA 2RA4A 1F9PA 5FO9B 1PRTD 3OPOA 2PZUA 3OIQA 3QOLA 3PUYA 3KF8A 5JEAG 2EYJA 3D6CA 3U9OA 4KV6A 3P1HA 4K6LA 2A74C 2ZXRA 2V4DA 2L1BA 1BCPC 4BA2I 3GTQB 3QIAA 5CMDA 4IUQA 5E3FA 2EYFA 2HCIA 1V1PA 1SXTA 1NR2A 4HR7B 4K6DA 3NBIA 3S17B 3MZ5A 1HHVA 2BA0A 1KNAA 1HUMA 1TS4A 2A6EC 5KNBA 2XWBB 3H09A 4J1MA 2AUKA 2QEJC 1HQMC 1SE2A 1MBYA 3MTSA 1ZYRD 3Q0AA 5ELDA 1OXVA 2BA1A 4K2KA 1WTOA 3VR5A 2E2HB 4BA1I 3GTMB 4DK1A 5KNDA 3HOZB 4V190 5IGDA 4G7HC 2B2VA 2EYHA 5G3LF 3HOUB 4DXGA 1U4MA 4IFDI 3BVGA 2JA6B 2O4XA 3I4NB 1OXSC 2WB1B 1Y1WB 3H94A 2NN6I 2SEBD 2RSOA 3DMUA 1U9RA 2CHBD 1A15A 2EJGC 5E1FA 1OXTA 4J6HA 1QJOA 2DN8A 2J7ZA 3K58A 3SR1A 2SNMA 4NP5A 1KDCA 5I2XA 3T4AC 1MI2A 3R93A 2QILA 5BN3A 4NMZA 3MXGA 1D5MC 3D3RA 4HTHA 3TBIB 2J0TD 4C1NI 5M5XB 1R4QB 1EYAA 1JQYD 1TY2A 4KKTA 2FJ2A 1BOSA 2R93B 1QWYA 4FO2A 4A3JB 2RVLA 2WP8J 2NTSA 4C3HB 3D4DA 4CHTB 3KUPA 3T51B 2B63B 5C6AA 1M4VA 1TS2A 3NPPA 1NUCA 1AFPA 4QF4A 2FHTA 3M7GA 2F0GA 1V1OA 1GUTA 4ID6A 4HCEA 1RD9D 3S1NB 3ND9A 5T1GA 3TP5A 2F0OA 3S1QB 2OT2A 1AZPA 4RA8A 1TIID 1A3TA 4ME5A 1I50B 1KNEA 2KEDA 2QF7A 4BS9A 4XT1B 1STYA 2A68C 3NQTA 2F0DA 4FXGC 5EPJA 1J8IA 1X32A 1FYCA 4KHZA 3OWFA 1HTPA 3KBGA 3FPPA 1F9QA 2XRSD 1RTOA 3CU7A 1U4PA 1B53A 5ELCA 1CZWA 4ABNA 1PXUA 1EQVA 4KMUC 3K5MA 3NUCA 5ELEA 4F7XA 1Y8OB 2D62A 4K8JA 3GTOB 1LTTD 2E2JB 1Y69U 5HURA 3NTHA 2B8GA 1PTOB 2K33A 4QUCA 4NDXA 4PMBA 3MHBA 3MXNA 3NWTA 3RMHA 1F77A 2KOLA 4OO1G 5KYIA 4DU9A 2D5DA 2PW5A 4WJWA 1SYFA 2ICEC 4IURA 2IL8A 2NTTA 1AN8A 3VR4A 1EL0A 5NUCA 1LLRD 1CHQD 1CHPD 1SYGA 2X69A 4EQOA 1C48A 4G4KA 3J81E 2XIWA 1I6VC 1JWSD 3EJIA 2B39A 2QKIC 3K5LA 1I4XA 4MHEA 4BBSB 3OIPA 3HZXA 2TMPA 1GUSA 4IQZA 4IUVA 3MFYA 4K2LA 5M9OA 3NSWA 4LAAA 1B4OA 4QUFA 2F0SA 2EPBA 2BCOA 4A3MB 1HFNA 1SEBD 2KJXA 3FMCA 1PYWD 2X6LA 1PZKD 1Q1EA 3M85A 2A69D 4ODGA 3ND8A 3FPUB 1E2ZA 4PNYA 1E2VA 3NTIA 1SYBA 4RGOS 1BF4A 4IUPA 3K5NA 1SNPA 1CM9A 2SOBA 2PZWA 5A2QL 3K6OA 4JBWA 4C3JB 1WTVA 1Q1BA 3G7LA 2RDHA 4C56C 4IN3A 1F2ZA 1H9JA 4XYOA 2L11A 2NN6H 2AWNA 3S9WA 2IPKD 1Z7TA 1HPCA 2B2WC 1DJRD 2JEAI 4WORA 2E75C 4KD3A 1LT5D 1SJHD 1LT4D 1ENFA 4BWGB 1VDZA 3SK6A 5CR3A 3VR3A 2VUMB 3QOJA 4DA2A 1X3PA 3A55A 1GUNA 2F03A 3MC0B 2WINB 1SJED 2R6GA 3OMGA 4K5VA 4R9WA 5LL6S 4HMIA 3WOEA 5EPKA 3HP3A 1U4LA 1ILQA 4KKUA 3TP7A 1NAPA 3HEJA 3T53B 1D1KA 1JORA 3A54A 4IUTA 4XIGS 1EOTA 3QG1A 2IX3A 4KY6A 3FVQA 4A3KB 4FP5D 1BQQT 3ZYYX 2D9UA 1W6KA 4H44C 3I3CA 3OSOA 5DM63 4F88A 1LTID 5M5WB 1QOHA 1PLFA 5D3IB 5LL6X 1EYCA 4A93B 3ITPA 2HUGA 4OO1H 3TP8A 4Y7NB 3VYTA 1VMCA 4Q5VA 3VA7A 3D6WA 3KLSX 3NQIA 4QMGA 1S5DD 4DN4M 5C5MA 3E0JA 4F8MA 3J7AV 1LTSD 1SMYC 1SFOB 1YNNC 1DD2A 1CTMA 2KECA 2L5TA 1AZQA 1WCMB 5KEEA 2BE5C 3N52A 1BR9A 5I9OA 1XTCD 1TWFB 2KA7A 1YNJC 3S2DB 2YYZA 4DGZA 4RWSC 1GHKA 2A6ED 4LMQD 1PRTF 3FKIB 1GUOA 1KTKA 2B2TA 4CGYB 4QIWB 2K5WA 2XVSA 3SK8A 5I6YA 4O1NA 2LY7A 3U9SA 1D5XC 1EY5A 1T5XD 3SK5A 4V0BA 2KHSA 5BN4A 2TSSA 5EGTA 2BDOA 4WFN3 5COYA 3T16A 2G9HD 4DAVA 1LTRD 2OEOA 2HDMA 2F0PA 3BG3A 2OF1A 5CBAE 1O7LA 1VCIA 4FYDA 1TQOA 1TWCB 5K5PA 4PMCA 1IYVA 2DNEA 4G7OC 5FOBB 2NWGA 5D14A 4ZUIA 4DNRB 4RCNA 5DEHA 2EY1A 3DWQA 5JPNC 2DY7A 3VYSA 5IGBA 4RAUC 3NHHA 5A2QE 4XTCS 4FVMA 2L4NA 5EPLA 5CV4A 1HA5A 1I4GA 4NKLA 1B9MA 1LTBD 1Q8IA 5ELBA 2SDFA 1T5EA 2PZTA 2KCCA 2WACA 3HOYB 1E0BA 5K36H 3GTKB 2CW0D 2EYLA 1I4QA 2A6HD 4NW2A 2PO4A 4Z9CB 4L6TB 2K7VA 1F9RA 3KLSA 3BZDB 1BCPB 3DEOA 1PTOF 1ENAA 3N6RA 2HCCA 4ZUJA 1TVXA 1D5ZC 1CK1A 1ML0D 4RFBA 1NSNS 3NTKA 3IFDA 2HDLA 1F2MA 4M8AA 3A7LA 4ZQ3A 2KUMA 3S14B 1PZJD 3VR6A 1FNVA 1R9TB 5J22A 3R2IA 4K5XA 1Y8NB 4KK7A 4L63B 2A68D 3S1RB 5T1IA 2M9VA 2NYZD 4KN4C 5I9PA 1DYQA 3DEPA 1TY0A 4FXDA 1PTOD 3C2PA 2B2UA 1GUWA 5M3MB 4DF7A 4OGQC 2MHVA 3S2HB 3RUZA 3SDZA 5CC4A 5CGKA 1J9OA 4J8QA 3I70A 4DXFA 3SE0A 5KYLA 2F0QA 1E2WA 2EJFC 2KCNA 1NR4A 4B9WA 5LHY1 1D1IA 1CA5A 1EU4A 1H9SB 2ZXOA 3Q23A 1FNUA 3HG9A 3MVVA 4X3UA 1SSOA 2AQ1B 2L0CA 2C5CA 1K8OA 3Q24A 1QG7A 4EQNA 5C3EB 2Z4IA 5BN5A 5JAVA 4DAPA 4EGVA 3Q6SA 1CQFA 3I72A 3DWPA 4B9XA 5IOCA 1KDAA 3LWEA 1WD0A 1DONA 3P7JA 5ELFA 2QDBA 3NWSA 5EJWA 4IFDG 1CT1D 4FXKC 2NN6G 2E2DC 3QJYA 3LWUA 4ZAIA 1STBA 1M8AA 1MD2D 3PUXA 2F1MA 3MXPA 1FGBD 4FF3A 1B2TA 2Z1CA 4CKCA 3GTPB 5C0XJ 1H9MA 1A3UA 1UEAB 2Z4HA 5JVG3 3DWAA 3HOWB 2PYKA 2XN9C 1B44D 2MP1A 4Q0FA 1EIGA 3S1MB 1GOZA 5IT9L 1JWUD 1PFNA 1I4RA 4TSSA 1LACA 2IWHA 2AQ3B 2XRQD 1WD1A 2B2YA 2F0IA 1EY6A 3TZDA 2B2VC 3BDCA 1EY8A 3DUZA 2E76C 1JWMD 3OWEB 1JCKB 4C2MB 1RODA 1MSHA 5CV8A 2BDNA 4A3FB 2EY6A 4JK1C 3LX0A 3I4LA 4C1NK 4ZK9B 2MUYA 1QE6A 2MPMA 3I90A 4KJOA 4C3IG 1K8MA 4KN7C 2WKCA 5CYUA 4CKEA 3E6ZX 4MIUA 1B3AA 5E4XA 2NUCA 2BOSA 4CBVA 1W6JA 2L12A 1KLUD 4HAEA 2O2LD 3BYTB 1DXMA 1ZEQX 1A2UA 2ZT9C 3C1EA 5IGEA 3HGBA 3I73A 3EQLC 1G8ZD 1FNWA 2R3ZA 2R61A 5C0XI 5HGTA 2K6AA 5C4JB 1JOOA 1PMRA 2K1BA 3BDOA 4IZ8A 5E4WC 1L0YB 5CV7A 3M4OB 2PCFB 3WDNA 4FF4A 2Q8TA 1SE4A 2OXPA 2F0EA 3URYA 1IHZA 1G91A 2Z8LA 2L9HA 1GHJA 1O7YA 1G2SA 2RDGA 3GTJB 1VMPA 3RLFA 1IYUA 4QB4A 4N9PA 1LTGD 4U673 3HS0C 3BYYB 4TQUS 1OXXK 4KJNA 1WTXA 1SNMA 2F3VA 1DOMA 3X3NA 2JSOA 2RBMA 2F0KA 2F0FA 1WTQA 2EYPA 2RQXA 2RDFA 4ZLTF 4IFDH 1S5CD 4H7BA 1SMYD 3H0GB 2NVTB 3DXJC 1LV9A 3H91A 1EY7A 2EY5A 2M00A 3MFGA 2MGSA 2BE5D 1O78A 4I7ZC 5JEAJ 1QNUA 1YNJD 3S16B 1SAPA 3TMEA 3IKJA 4UAIA 1EYDA 1IKLA 1O80A 3F2UA 2F4IA 5K36G 4BY7B 1L0XB 4UDUC 3M3YB 4QCLA 2H4OA 2H1EA 4X3SA 3V2TA 1CQVA 3MA2B 4K14A 4S3SA 3ERQA 1F2LA 4C3JG 1LT3D 2F0LA 1I3QB 1BBXC 1KLGD 2EOTA 2AUJD 3PV0A 1RTNA 3K7AB 1BCPF 1V8QA 5IT9E 1ET9A 1TS3A 2SNSA 1DOKA 2ICIA 2NVQB 4OL7A 3VA5A 2FMMA 2K28A 1G6ZA 1I4HA 4XQQA 4R8NA 5C3WA 3OW7A 3I4MB 5AFWA 3MWYW 3D8GA 5DNFA 5EKLA 5JVH3 2GA4B 1B9NA 2F3WA 1ENCA 2E74C 4AYBB 2X6GA 1GUGA 1ET6A 1PZID 3V05A 1C8CA 2MJ8A 4RH6A 2JYOA 3NBHA 1TT2A 1A3VA 1BCPD 1AP0A 1HTLD 2K03A 1RJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 L;  3JAM L;  5A2Q L;  3J80 L;  5FLX L;  3J81 L;  3J7A V;  5LL6 X; 
#chains in the Genus database with same CATH topology
 2VY3 A;  3QWN A;  1B50 A;  1VQI A;  3F2D A;  2AWO A;  4DUZ L;  3KLR A;  2V1C C;  4FF2 A;  4P2C B;  2N55 A;  4A3K G;  3MAQ A;  3ULJ A;  4X64 L;  4A3B G;  4POG A;  4R4C A;  2KVM A;  4DV3 L;  2PI2 E;  2EYM A;  1BNZ A;  1PTO H;  1T9H A;  3HFZ B;  2XSC A;  4A3F H;  1U5K A;  1SDF A;  4NXN L;  3I4O A;  1XPO A;  4WRD A;  1NTG A;  1SYD A;  2BH8 A;  4L5Q A;  1TWH B;  5CV6 A;  3AFP A;  4LJZ C;  4EX5 A;  4DAM A;  1H9S A;  2VS1 A;  1RF2 D;  1HQR D;  3Q8D A;  4DAY A;  4GKJ L;  1VQ7 A;  1JR0 D;  2I5M X;  1MIU A;  5GAD C;  1D7Q A;  2K5N A;  1VQB A;  4KTA A;  4PV1 C;  5FJ8 H;  3K57 A;  3AB9 A;  3NK9 A;  4NPS A;  1E24 A;  3GQB A;  3M4Y A;  3H3V C;  2UXB Q;  3GV6 A;  1IKM A;  1HFG A;  2JA8 G;  4YCU A;  5EBC A;  2CQA A;  1WCM G;  4CJ1 B;  5IGC A;  3NP8 A;  2YTX A;  3BDL A;  3H15 A;  1KRT A;  1V43 A;  4FF1 A;  2Q8I B;  3EVQ A;  3SK4 A;  1D6E C;  1NCV A;  2D0O A;  2R7D A;  3GP7 A;  4DR2 Q;  5C5L A;  4BBS H;  1F2Y A;  3X3M A;  1HUN A;  4K5W A;  1G2T A;  3P20 A;  2CVR A;  2HIV A;  3CP0 A;  3CC7 A;  1RCV D;  3NXW A;  1Z6H A;  3H6M A;  4A3G G;  2KBN A;  2XNA C;  1HNW L;  1BDO A;  1G51 A;  1UE1 A;  2JEB I;  1Q8K A;  1LAB A;  2A19 A;  4OEL B;  3FKI G;  2O5J C;  2JXM B;  3PIP 3;  4RCO A;  4A3M H;  1Q12 A;  2CCZ A;  1STN A;  2R92 B;  4B3S Q;  4XQJ A;  1EY4 A;  3PO2 B;  1G29 1;  4DNT B;  3CHB D;  3PUZ A;  3KK7 A;  2UXC Q;  5F2D A;  3RN5 A;  1VQ5 A;  1HRJ A;  2F0H A;  1GO3 E;  2UUA Q;  3PIO 3;  3J80 L;  3K7U C;  3A8J E;  3FEW X;  1N36 L;  2IX1 A;  4O42 A;  5C0X H;  4L8J A;  3PUW A;  2KHJ A;  2F4V L;  2VNU D;  1K83 B;  4RGT A;  2IY5 B;  1XXG A;  4EQP A;  2QGQ A;  4DR5 Q;  2RHS B;  1R4P B;  1D8L A;  3J81 i;  4GNX A;  1DZ1 A;  1SNC A;  4OIJ A;  2JA5 B;  3GD7 A;  2K5Q A;  4TRD A;  1QB5 D;  1NJI C;  4LFB Q;  2IHF A;  1S4Z A;  5FO8 B;  4LFA L;  1OTC A;  5AJ3 L;  1A6X A;  4HIM A;  4OX9 Q;  1EFI D;  3S15 B;  4QY7 A;  4JPB W;  1CI3 M;  4IOA A;  2JA7 B;  3PO3 B;  1CZG A;  5JJZ A;  2ID0 A;  4GZY C;  2F0W A;  2WAQ B;  2PW7 A;  2C9O A;  1N8R C;  1EIH A;  3GTG B;  1SE8 A;  3S16 H;  1H9R A;  3O13 A;  1HXY D;  3GTL B;  2ZXP A;  4P71 A;  2VUM H;  1PDQ A;  3HOY G;  1QNK A;  5FLX L;  2GN5 A;  2E2I B;  4A3I B;  3M3Y H;  1Y14 B;  2FIN B;  4LF4 L;  2HQE A;  1IW7 C;  2N88 A;  3W2D A;  3J81 L;  1EQT A;  4CKB A;  4DV5 L;  1I3Q H;  3TRZ A;  4OIK A;  4B08 A;  4LFC L;  1HZA A;  4R4T A;  5GQO A;  1D2B A;  3T1H L;  1BO0 A;  2PMZ B;  2B2T C;  2CFM A;  3E9H A;  3FRP B;  1QCB D;  2WV6 D;  1SND A;  4X3K A;  4XYQ A;  1Q90 A;  4B3M Q;  4HJ7 A;  1U4R A;  4HMJ A;  2AKW B;  5CBE E;  3RN2 A;  4HN7 A;  5D3D A;  4AH6 A;  2K04 A;  3D31 A;  2NVQ H;  3ICE A;  2Y0S B;  4E6I A;  3SEB A;  3STB D;  1PRT C;  3ZJY C;  2ZJP A;  1LTA D;  4LK1 C;  2QA4 A;  4LFA Q;  5A35 A;  3HOU G;  1L0W A;  2F0U A;  5M5W H;  3I4M H;  5IY0 A;  1EWC A;  1ICF B;  3QB3 A;  2JA6 G;  2ZJR A;  2I46 A;  4A93 H;  2ENB A;  3OMC A;  2WB1 G;  4MTK A;  1KL9 A;  1AW7 A;  1EEF D;  3A7A B;  3CCL A;  1YJW A;  4JI5 L;  1MKH A;  4KHV A;  4CDE C;  2FFK B;  3PQI A;  5G3L D;  5FKA C;  2A5H A;  1PVO A;  5IP9 G;  1EEI D;  1XNR Q;  2F0V A;  4A4I A;  5LMN W;  1IBK Q;  3DM3 A;  3I91 A;  1PH3 A;  5IYC G;  5JJI A;  1GM5 A;  1I4P A;  4DV4 L;  4A3E B;  3PCO B;  2EQS A;  2K01 A;  1RDP D;  4ILW A;  1PV4 A;  4UY8 C;  3EA6 A;  1SFO H;  1PH1 A;  1PRT B;  2RSN A;  4K8I A;  2CW0 C;  4XXE A;  4OXP A;  3GV3 A;  2F52 A;  2A6H C;  4YIJ A;  2A1A A;  1H9K A;  1PFM A;  1YVC A;  5J1Z A;  5IOD A;  3PMF A;  3CKI B;  5ISR A;  4A3L H;  4LFC Q;  2PNR C;  2IJ0 A;  3TP6 A;  3S2D H;  3NE5 B;  2WII B;  2A73 B;  3RNU A;  1N33 L;  4JI4 Q;  4XT3 B;  1SLJ A;  1ZYR C;  4HJA A;  1I6H B;  3D4W A;  5JOB A;  1WVL A;  4OO1 I;  2R93 G;  5I2Y A;  5DLQ E;  4DR4 L;  1AE2 A;  2RF4 A;  1S5E D;  2EZV A;  1VQO A;  2B8F A;  2PPB C;  4C3H G;  5CV5 A;  3M4P A;  5EKI A;  3OHX C;  4H02 A;  2DY8 A;  4HCS A;  2E8G A;  4QGU A;  3KF8 B;  2B63 G;  1CFM A;  4KD4 A;  3TZU A;  1EU3 A;  1ZKO A;  4BY1 B;  1K3B C;  1Y1V B;  2IW3 A;  4LF6 L;  1JE4 A;  4JI5 Q;  5HGQ A;  3MXU A;  3OOC A;  1TU2 B;  2NBF A;  5JPM C;  3A8I E;  5IWA L;  1XMO Q;  3KBX A;  4PZ7 A;  3CAM A;  5JEA H;  1A8V A;  3GO5 A;  1TWC H;  2CWP A;  4GOP A;  1V1P B;  1PTO C;  2XGT A;  2LMC B;  1CA6 A;  5I6W A;  3V96 A;  2R7Z B;  3J80 E;  2O5I C;  5L37 A;  2EYO A;  1Z47 A;  4JW0 A;  1K9M C;  4BXX H;  2KEE A;  4C3I B;  3JAM L;  1PYB A;  4HSP A;  1ESF A;  1MGS A;  2D0P A;  4KY5 A;  4A3C G;  4DR7 Q;  2J4X A;  2DUD A;  5KNC A;  1NMF A;  3IRB A;  3A56 A;  5IGF A;  2B2W A;  1ILP A;  1QVG A;  4EVO A;  4DFA A;  2A8V A;  2R92 H;  3K0X A;  2B2U C;  3SXH A;  2ZM6 Q;  4JBM A;  1X3E A;  1JC7 A;  1BXT A;  2FMC A;  1ZXT A;  2IHE A;  1QUQ A;  4U68 A;  2NZ1 D;  3J7A F;  1YHQ A;  1WTP A;  1K0S A;  3L9A X;  2YU9 B;  1A62 A;  1UAP A;  4JI8 L;  2K32 A;  1QIL A;  1GXD C;  1XPR A;  2NVX B;  5IYD H;  2LXK A;  2F0T A;  1EYG A;  1O7Z A;  4IUU A;  4IUN A;  2VB3 X;  1LT6 D;  5FO7 B;  4QQB X;  1HH2 P;  4YHH L;  2HT1 A;  3K59 A;  4KHP L;  2K05 A;  2M2L A;  2RKS A;  3K0Y A;  4RGM A;  1ESR A;  2K50 A;  3KOJ A;  1GJX A;  1KDB A;  1VF5 C;  4DUY L;  5KGU A;  3C46 A;  1YJ9 A;  1SYE A;  5C4H A;  2LS0 1;  5FLX E;  1J6Q A;  1XMQ L;  2Z9H A;  5FK9 C;  1YZ6 A;  1P16 A;  4A3F G;  5J39 A;  4RGN A;  4RHR A;  4DK0 A;  3R3O A;  4K0K Q;  1YI2 A;  1DM0 B;  3FDT A;  5M5Y B;  3J7Y W;  5CV9 A;  3DM1 A;  4GN3 B;  1Y8P B;  1YIT A;  4B3R Q;  3W3A A;  1VQN A;  1K3R A;  3I56 A;  1ASZ A;  1BBU A;  1F9S A;  1XWE A;  3HKZ B;  3VR2 A;  4WJ3 M;  1STA A;  1XNQ Q;  2DNC A;  1TR5 A;  2MO1 A;  3D4R A;  4G7Z C;  1NMG A;  4ZKC B;  3AMU A;  2L55 A;  4ZCK A;  4B3T Q;  3S14 H;  3OW2 A;  1EY0 A;  3CRL C;  4A3D B;  1R9T H;  5FJ8 G;  5I4D A;  3AU7 A;  4PQX A;  3HOV B;  1II3 A;  1K73 C;  4ULL A;  1TWA B;  3I8Z A;  1XYI A;  1RHP A;  1HCZ A;  3BZK A;  1B1Z A;  5BR8 Q;  3KLW A;  2PQA B;  4H13 C;  1WTR A;  1JJ2 A;  2PQE A;  1ICW A;  3P75 A;  3J7Z C;  3ER0 A;  2KQ3 A;  1C0A A;  2JE6 I;  2NVY B;  3ONA B;  4BBS G;  4P72 A;  5M3M H;  4NXM Q;  5C4X B;  1JIC A;  3M4Q A;  2UXD L;  1SR3 A;  5EBD A;  2JK8 A;  1KAB A;  5E7N A;  5M3F B;  4JI7 Q;  2K75 A;  3HOX B;  1EZ8 A;  1PFB A;  1SE3 A;  3C3L A;  1S5F D;  3L7Z C;  2OTL A;  4OEM B;  2EVB A;  4JI6 L;  1WJJ A;  3G6J B;  3IFT A;  2Q2U A;  2ASB A;  2IT1 A;  2WKD A;  2VQE Q;  1BUV T;  4PMW A;  5ELO A;  4A3M G;  3SHL A;  1YNN D;  3IL8 A;  3CRK C;  4LF9 Q;  1UNS A;  5C44 B;  1JOK A;  5TSS A;  3A8K E;  3TQY A;  3TDQ A;  3BVZ A;  4R8I A;  5LMU L;  2B2Y C;  3BU2 A;  3UI2 A;  2IX0 A;  3PIP A;  1N9W A;  1YBY A;  2I5H A;  1UUP A;  3KJO A;  4JVZ A;  4R4I A;  4LF5 L;  2ALY B;  3CW2 C;  2KCM A;  5C4Z A;  3R8B A;  1MSG A;  5C3E H;  1XPU A;  1E3P A;  1C4Q A;  2EXZ A;  3VDY A;  4BBR B;  4LUZ A;  1X3Q A;  3TN2 A;  5EKK A;  5C0X G;  1JE5 A;  3PIO A;  3IAY A;  4TKO B;  1L1O C;  4RKL A;  4HIO A;  1SNO A;  5KIX A;  1RKN A;  3A5U A;  4HSV A;  1LO5 D;  2LFN A;  3LNN A;  4X3T A;  3G6E A;  1JB7 A;  1DCZ A;  4I65 A;  2I07 B;  4H0L C;  1A2T A;  1Q3L A;  4KKS A;  3C1F A;  4ZKB B;  1OO9 B;  5C3X A;  2JP1 A;  1STH A;  4YCV A;  4DR1 L;  3K8A A;  4HED A;  4MN3 A;  2AQ2 B;  4N9T A;  5JJK A;  3GTP H;  1DOL A;  3MEH A;  3PSI A;  2ATW A;  1AEX A;  1YHB A;  4GLA C;  4X62 L;  2EJM A;  1A63 A;  1E22 A;  2EDG A;  2VUM G;  3MXN B;  2F0N A;  1WTW A;  5LMU Q;  2UUB Q;  3HOW H;  1OXU A;  4EQ5 A;  1VQ9 A;  3JAM E;  2Z6K C;  1IL8 A;  1VF7 A;  5COR A;  1HZC A;  2DGY A;  3S1M H;  1FR3 A;  4AQY Q;  4A3B B;  3S24 A;  3HRZ C;  3KDF B;  2A69 C;  1KAA A;  1FD7 D;  5FLX c;  4ZYS A;  4RKB A;  3RZO B;  3NEL A;  3BVM A;  3AEV A;  4KY7 A;  2XWJ B;  1TWG B;  5DAU A;  2Z0S A;  2EE1 A;  1I5F A;  5D65 A;  3Q22 A;  4M1U B;  1VQK A;  2EY2 A;  1EY9 A;  1Q86 C;  2UUC Q;  1CKM A;  3VYR A;  2G5D A;  2K5D A;  4UP9 A;  4XQN A;  3PUV A;  1HNZ L;  4ZRZ A;  4C2M H;  4DV2 Q;  3K5O A;  4IPH A;  3BZC A;  1SNQ A;  3I4M G;  2F0J A;  4CJ0 B;  1VQE A;  4DV1 L;  1YIJ A;  1W2B A;  2VXW A;  4A93 G;  2G9D A;  5DM7 3;  3G71 A;  3EFX D;  2NB0 A;  5EQ0 A;  4CJ2 C;  2JA8 B;  2QCP X;  3CXC A;  1STE A;  2Q8R E;  1PFS A;  1N32 Q;  1XX8 A;  2D2C C;  5KRU A;  3ERO A;  2ZTC A;  2CH4 W;  3CF5 A;  1EWH A;  1SYC A;  2LKV A;  2NVX H;  2KHI A;  4YWK A;  5LMN Q;  1TS5 A;  1JMC A;  5IGG A;  4A3G B;  3H3V I;  1ASY A;  4OHJ A;  3WOF A;  1STG A;  1SBB B;  4LWC A;  3BS1 A;  1X55 A;  4JBK A;  4GLX A;  3M7N A;  1HA6 A;  1GKH A;  1S5B D;  1TKW B;  3VYU A;  1JOQ A;  4KI0 A;  3T1Y Q;  3T13 A;  2VQF Q;  4F87 A;  1VQA A;  4A3L G;  4DR6 Q;  3AQQ A;  3CQZ B;  4IJL A;  1ONL A;  4YY3 L;  1EZ6 A;  2DJF C;  1FGU A;  4JV5 L;  2F0M A;  3U58 A;  1KXL A;  4DUZ Q;  1IW7 D;  3T56 B;  4IFD J;  1CSQ A;  3SVM A;  4RHS A;  5M5Y H;  4G57 A;  5C4J H;  3F2C A;  3L3O C;  4X64 Q;  4XDX A;  1UWV A;  3RZD B;  5IIF A;  3DHQ A;  1FJG L;  4DV3 Q;  3R2T A;  1JB3 A;  3QO2 A;  4FNF A;  3M4O H;  4IAL A;  2VB2 X;  3CCQ A;  1HR0 L;  3RD4 A;  3TSS A;  3E5S A;  3FHW A;  4LF8 L;  2RA4 A;  4A3D H;  1F9P A;  5FO9 B;  4NXN Q;  1B8A A;  2N8N A;  1PRT D;  3OPO A;  4J15 A;  3GTJ H;  2PZU A;  1LUZ A;  3OIQ A;  1VQL A;  3QOL A;  3PUY A;  3KF8 A;  5JEA G;  4GKJ Q;  2EYJ A;  3D6C A;  3U9O A;  4KV6 A;  3P1H A;  4K6L A;  2A74 C;  2ZXR A;  5IT9 c;  2V4D A;  2L1B A;  1KAW A;  1BCP C;  1YJN A;  4BA2 I;  4UP8 A;  2ZJQ A;  3GTQ B;  3QIA A;  5CMD A;  2HHH L;  4IUQ A;  4BXX G;  4LW1 A;  1P8L A;  5E3F A;  2JJQ A;  2EYF A;  4UPA A;  2HCI A;  1V1P A;  1SXT A;  3H0G H;  1NR2 A;  4HR7 B;  2NVT H;  4K6D A;  3JAM c;  1W3S A;  3NBI A;  2R92 G;  3S17 B;  3MZ5 A;  1HNW Q;  1HHV A;  2BA0 A;  1KNA A;  1HUM A;  1TS4 A;  2A6E C;  5KNB A;  1E7Z A;  2XWB B;  4PZ6 A;  3H09 A;  4J1M A;  1XJV A;  4DV6 L;  2WB1 E;  2AUK A;  4YWL A;  2YV5 A;  2QEJ C;  1HQM C;  1SE2 A;  1MBY A;  3MTS A;  3CPW A;  1ZYR D;  3Q0A A;  3B6Y A;  5ELD A;  5IYD G;  5EAY A;  4BBR H;  2K14 A;  1OXV A;  2BA1 A;  5GAH C;  4K2K A;  4BY7 H;  1WTO A;  3VR5 A;  2E2H B;  4POF A;  4BA1 I;  2JA9 A;  2KEN A;  2Q2I A;  3GTM B;  4DK1 A;  5KND A;  3HOZ B;  3RR5 A;  4V19 0;  5IGD A;  4JI1 L;  4G7H C;  2B2V A;  2EYH A;  1CSP A;  5G3L F;  1N36 Q;  2JA5 G;  3HOU B;  4DXG A;  1U4M A;  2GVA A;  1IBM L;  4IFD I;  3BVG A;  3NBH B;  2JA6 B;  2EXD A;  4R4O A;  2O4X A;  3I4N B;  3UDI A;  3K7A H;  1OXS C;  2WB1 B;  3HKS A;  1Y1W B;  3H94 A;  2NN6 I;  2F4V Q;  2SEB D;  2RSO A;  3DMU A;  1U9R A;  2CHB D;  3BJU A;  1A15 A;  2UU9 L;  2EJG C;  2YTV A;  1OXT A;  5E1F A;  4WJ4 A;  1WFQ A;  4J6H A;  3I55 A;  1QJO A;  2DN8 A;  2J7Z A;  2NZO A;  2WAQ G;  3K58 A;  3A0J A;  3SR1 A;  2L15 A;  2SNM A;  4NP5 A;  1KDC A;  5AJ3 Q;  1HJP A;  5I2X A;  3T4A C;  1Z9F A;  1MI2 A;  2C35 B;  1JJC B;  2RCF A;  2YTY A;  3R93 A;  4QL5 A;  2QIL A;  5BN3 A;  4JBJ A;  4DV6 Q;  1EOV A;  4NMZ A;  3MXG A;  3DLL A;  1D5M C;  3D3R A;  4HTH A;  3TBI B;  2J0T D;  4C1N I;  5M5X B;  1R4Q B;  4DAY B;  4DNI A;  1EYA A;  1JQY D;  5M3M G;  1TY2 A;  4KKT A;  2FJ2 A;  1PH4 A;  1BOS A;  2R93 B;  1QWY A;  4FO2 A;  4LF4 Q;  4A3J B;  4JI3 L;  2RVL A;  2WP8 J;  2NTS A;  2Y0S G;  4C3H B;  2PQA A;  3D4D A;  3FP9 A;  4CHT B;  3KUP A;  4DV5 Q;  1VQH A;  3MEF A;  3T51 B;  2VW9 A;  1PA6 A;  3D0F A;  2B63 B;  5C6A A;  1M4V A;  1DGS A;  1TS2 A;  4HIK A;  3T1H Q;  3E9I A;  1IXR A;  3NPP A;  1NUC A;  1AFP A;  4QF4 A;  2ES2 A;  3PF4 A;  2FHT A;  3M7G A;  1RL2 A;  2F0G A;  1V1O A;  1GUT A;  4ID6 A;  4HCE A;  4NB3 A;  1TWH H;  1RD9 D;  3S1N B;  3ND9 A;  1CKO A;  5T1G A;  4JG2 A;  1Q46 A;  3TP5 A;  2F0O A;  3S1Q B;  2OT2 A;  3E0E A;  1AZP A;  5C3E G;  4RA8 A;  1TII D;  1A3T A;  4IOC A;  4ME5 A;  4GNX C;  2OTJ A;  1EWI A;  1I50 B;  1KNE A;  2ZTE A;  4O0A A;  1PH6 A;  2KED A;  5GRO A;  2QF7 A;  4BS9 A;  4RMF A;  4XT1 B;  1STY A;  2A68 C;  1IBL L;  5GAG C;  3NQT A;  3TS2 A;  3GDE A;  4DKA C;  4L5S A;  4JOI A;  2F0D A;  4FXG C;  4DV4 Q;  5EPJ A;  1PH9 A;  3U50 C;  1J8I A;  1X32 A;  1FYC A;  1HZ9 A;  4KHZ A;  2AMC B;  2ZTD A;  3OWF A;  3CCS A;  1HTP A;  4JI3 Q;  3KBG A;  3FPP A;  1F9Q A;  2H5X A;  1AH9 A;  4GNX B;  2XRS D;  1RTO A;  1MJC A;  3CMA A;  3CU7 A;  1U4P A;  1B53 A;  5ELC A;  1CZW A;  4ABN A;  1PXU A;  1EQV A;  1N33 Q;  4X65 L;  3H3V H;  4KMU C;  3K5M A;  3HOW G;  3NUC A;  5ELE A;  4F7X A;  1Y8O B;  3CCM A;  1QZH A;  3PO2 H;  2D62 A;  2DJG C;  4K8J A;  4DR4 Q;  3GTO B;  1LTT D;  2E2J B;  1HR0 W;  1Y69 U;  5HUR A;  3NTH A;  3CPF A;  3KF6 A;  4GN5 A;  2B8G A;  1S40 A;  1PTO B;  2K33 A;  4P75 A;  4QUC A;  4LF7 L;  4NDX A;  4PMB A;  3MHB A;  3MXN A;  3NWT A;  3RMH A;  1F77 A;  2KOL A;  4I7A A;  1KD1 C;  5IE8 A;  4OO1 G;  2RCN A;  4LF6 Q;  2Q2H A;  5KYI A;  4DU9 A;  1K83 H;  2D5D A;  2PW5 A;  1B70 B;  4WJW A;  2R7F A;  1SYF A;  5IWA Q;  2CQO A;  3M9B A;  1EQQ A;  2ICE C;  2JA5 H;  4IUR A;  2IL8 A;  2NTT A;  1AN8 A;  1VQJ A;  3VR4 A;  1EL0 A;  5NUC A;  1LLR D;  5FLM H;  1CHQ D;  1CHP D;  1SYG A;  2X69 A;  4EQO A;  3S15 H;  1C48 A;  1VQ6 A;  2JA7 H;  1C7Y A;  4G4K A;  3J81 E;  3PO3 H;  4RG1 A;  2XIW A;  3CCE A;  1I6V C;  1JWS D;  3EJI A;  2B39 A;  2QKI C;  3K5L A;  4DV0 L;  1I4X A;  5IP7 H;  1N34 L;  4MHE A;  1WTH A;  3GTG H;  4BBS B;  3OIP A;  3HZX A;  3CC4 A;  2XTI A;  1QVF A;  3GTL H;  1G6P A;  2TMP A;  1GUS A;  4IQZ A;  4ME3 A;  4IUV A;  2E2I H;  1SMX A;  3MFY A;  4FDB A;  3CD6 A;  4A3I H;  2E2H H;  4K2L A;  1PHJ A;  3RLO A;  5M9O A;  2K52 A;  3HOZ H;  3NSW A;  4LAA A;  1B4O A;  4QUF A;  2F0S A;  2EPB A;  2BCO A;  4A3M B;  1HFN A;  4JI8 Q;  1WOC A;  1SEB D;  2PI2 A;  2KJX A;  2Q2T A;  3A5Z B;  3I4N H;  3FMC A;  1PYW D;  2X6L A;  4YHH Q;  1PZK D;  1Q1E A;  3M85 A;  1Y1W H;  1EIF A;  4KHP Q;  2A69 D;  4ODG A;  3ND8 A;  3FPU B;  1FVI A;  4CDC C;  4DUY Q;  3W1G A;  1E2Z A;  1KIX A;  4PNY A;  1E2V A;  4DK6 C;  3NTI A;  1SYB A;  4RGO S;  1XMQ Q;  3HKZ G;  1BF4 A;  4IUP A;  3K5N A;  1SNP A;  1CM9 A;  2SOB A;  3TS0 A;  2PZW A;  4A75 A;  4A3D G;  1PH5 A;  5A2Q L;  3OTO L;  2HIX A;  1JT8 A;  4GOP C;  3K6O A;  4JBW A;  2Z6B A;  4IPG A;  4C3J B;  1WTV A;  1Q1B A;  3G7L A;  2RDH A;  4C56 C;  4IN3 A;  1F2Z A;  3K80 C;  1HNX L;  1H9J A;  4XYO A;  2L11 A;  2I5L X;  3U4Z A;  5M5X H;  2NN6 H;  2AWN A;  1B3Q A;  4A3E H;  3S9W A;  2IPK D;  3J80 c;  1Z7T A;  1HPC A;  1XTD A;  1BBW A;  2B2W C;  1DJR D;  3KFU A;  2JEA I;  4WOR A;  2E75 C;  4KD3 A;  4JYA L;  1LT5 D;  1SJH D;  2KCT A;  1I94 L;  4O2D A;  1LT4 D;  1ENF A;  4BWG B;  1VDZ A;  3SK6 A;  5CR3 A;  3UE1 A;  3VR3 A;  2VUM B;  3QOJ A;  3H0G G;  1KHI A;  4DA2 A;  1X3P A;  3A55 A;  1GUN A;  1PH2 A;  2UXD Q;  2F03 A;  3MC0 B;  2WIN B;  1SJE D;  2R6G A;  1I6H H;  1KQS A;  3OMG A;  4K5V A;  4R9W A;  5LL6 S;  4HMI A;  3WOE A;  5EPK A;  3HP3 A;  4JI6 Q;  3W1B A;  3S1N H;  1U4L A;  1ILQ A;  4KKU A;  3TP7 A;  1NAP A;  3HEJ A;  3UDG A;  3T53 B;  1JJG A;  1VQC A;  1D1K A;  1VQ4 A;  4AYB E;  4YWM A;  1JOR A;  1K28 A;  3A54 A;  4IUT A;  1L1O B;  4XIG S;  4DV7 L;  1EOT A;  1I50 H;  4BBR G;  3QG1 A;  2IX3 A;  4KY6 A;  4BY7 G;  4BY1 H;  3FVQ A;  1Y1V H;  4A3K B;  4LF5 Q;  1MHW C;  4FP5 D;  1BQQ T;  3ZYY X;  2D9U A;  1W6K A;  4H44 C;  3I3C A;  2I0Q A;  3OSO A;  5DM6 3;  4F88 A;  1LTI D;  5M5W B;  1NE3 A;  1QOH A;  1PLF A;  3CCJ A;  5D3I B;  5LL6 X;  1EYC A;  4A93 B;  3ITP A;  4DK3 C;  1YHA A;  2HUG A;  3NEM A;  3J81 c;  4OO1 H;  3TP8 A;  4Y7N B;  2R7Z H;  2VZA A;  3VYT A;  1VMC A;  4Q5V A;  3VA7 A;  3CME A;  4C3I H;  3D6W A;  3KLS X;  3NQI A;  4QMG A;  4DR3 L;  1S5D D;  4DN4 M;  5C5M A;  3E0J A;  4DR2 L;  1K8G A;  4F8M A;  3J7A V;  3G48 A;  1LTS D;  1SMY C;  1SFO B;  1YNN C;  1DD2 A;  1CTM A;  2KEC A;  4AYB G;  2L5T A;  1AZQ A;  2GVB A;  4QIW E;  4L5T A;  1WCM B;  5KEE A;  3GTO H;  2BE5 C;  4DR1 Q;  3N52 A;  1BR9 A;  4N8F A;  5I9O A;  1A0I A;  2E2J H;  1XTC D;  5ELN A;  1TWF B;  3TEH B;  2KA7 A;  1YNJ C;  3S2D B;  2YYZ A;  2MQH A;  4X62 Q;  2YU9 H;  4DGZ A;  2B29 A;  4DV7 Q;  1VS0 A;  3UDF A;  4RWS C;  1GHK A;  4IPC A;  2A6E D;  4B3S L;  4LMQ D;  1BKB A;  2UXC L;  1PRT F;  3FKI B;  2JQO A;  1GUO A;  1KTK A;  3CCV A;  2UUA L;  2B2T A;  3E3X A;  4CGY B;  2QW7 A;  4QIW B;  2K5W A;  2XVS A;  3SK8 A;  5I6Y A;  4X6A H;  4O1N A;  2LY7 A;  3U9S A;  1D5X C;  1EY5 A;  1T5X D;  3SK5 A;  1V9P A;  4V0B A;  2KHS A;  5BN4 A;  2TSS A;  5EGT A;  3U4V A;  2BDO A;  3J7A 5;  4WFN 3;  2CWA A;  3I2Z A;  5COY A;  3T16 A;  2G9H D;  3J80 i;  2VL6 A;  1GVP A;  4DR5 L;  4DAV A;  1LTR D;  2OEO A;  1HNZ Q;  2HDM A;  4R1J A;  2F0P A;  3BG3 A;  4PG3 A;  4DR3 Q;  2OF1 A;  5CBA E;  1O7L A;  1Q82 C;  1VCI A;  4FYD A;  1TQO A;  1TWC B;  5K5P A;  4LFB L;  4PMC A;  1IYV A;  2DNE A;  4DV1 Q;  3KJP A;  4G7O C;  5FOB B;  2NWG A;  5D14 A;  4ZUI A;  4OX9 L;  4DNR B;  4RCN A;  4ALP A;  1K0R A;  3JC6 6;  3HOV H;  2OQ0 A;  5DEH A;  2EY1 A;  1TWA H;  1V1Q A;  3DWQ A;  5JPN C;  2DY7 A;  3VYS A;  5IGB A;  4RAU C;  3NHH A;  3WWV A;  5A2Q E;  3UDX A;  2NVY H;  4XTC S;  5C4X H;  4FVM A;  2L4N A;  5EPL A;  5CV4 A;  1HA5 A;  1I4G A;  4NKL A;  5M3F H;  1B9M A;  1LTB D;  1Q8I A;  1X56 A;  3HOX H;  2N78 A;  5ELB A;  2SDF A;  1T5E A;  4YY3 Q;  2PZT A;  2KCC A;  4JV5 Q;  2WAC A;  3HOY B;  1E0B A;  1LM0 A;  5K36 H;  3GTK B;  1IL2 A;  2N49 A;  2CW0 D;  4TVA B;  5C44 H;  4B3M L;  1RIP A;  2EYL A;  2WAQ E;  1I4Q A;  2A6H D;  3PO2 G;  4NW2 A;  2QDL A;  2PO4 A;  4Z9C B;  2MNA A;  4L6T B;  1FJG Q;  2N3S A;  2K5V A;  1YNX A;  4C3J H;  2K7V A;  1F9R A;  1TXY A;  3A74 A;  3KLS A;  1E1O A;  3BZD B;  3SGI A;  1HR0 Q;  1BCP B;  3DEO A;  1PTO F;  1AE3 A;  1ENA A;  4LF8 Q;  1X65 A;  3N6R A;  5IYB G;  4IPD A;  1LTL A;  1WI5 A;  2HCC A;  4ZUJ A;  3K81 C;  1M1K C;  1TVX A;  1D5Z C;  1CK1 A;  1ML0 D;  4RFB A;  1NSN S;  3NTK A;  3G4S A;  3IFD A;  2HDL A;  1F2M A;  4M8A A;  2PMZ E;  5JJL A;  1XNR L;  3A7L A;  4ZQ3 A;  4CDD C;  1IBK L;  5HY6 A;  2KUM A;  4P74 A;  3S14 B;  1PZJ D;  3VR6 A;  1FNV A;  1R9T B;  2HQL A;  5J22 A;  3R2I A;  2OCE A;  2Y0S E;  4K5X A;  5FLM G;  1CKN B;  3EN2 A;  1Y8N B;  4KK7 A;  1KRS A;  4L63 B;  2JN4 A;  4MNO A;  2A68 D;  3EIV A;  3S1R B;  5T1I A;  2JA7 G;  2HHH Q;  2M9V A;  2CKZ B;  1K8A C;  1L2F A;  2NYZ D;  3PO3 G;  4KN4 C;  5I9P A;  1DYQ A;  3DEP A;  2FXQ A;  1TY0 A;  1VQ8 A;  4FXD A;  5IP7 G;  1PTO D;  1YEZ A;  3C2P A;  2B2U A;  1GUW A;  5M3M B;  4DF7 A;  3KYH C;  4OGQ C;  4P73 A;  2MHV A;  3S2H B;  3RUZ A;  3SDZ A;  5CC4 A;  5CGK A;  1J9O A;  4JI4 L;  1J5E L;  1KC8 C;  4J8Q A;  3I7F A;  3I70 A;  4DXF A;  4GKK L;  3SE0 A;  4A3I G;  5KYL A;  4A3K H;  4JCV E;  2F0Q A;  4KLK A;  3HOZ G;  1E2W A;  2EJF C;  2KCN A;  4A3B H;  1NR4 A;  4B9W A;  5LHY 1;  2EIF A;  2PNH A;  1D1I A;  1CA5 A;  3RZO H;  1EU4 A;  1H9S B;  2ZXO A;  3Q23 A;  1FNU A;  4HJ8 A;  3HG9 A;  3MVV A;  4X3U A;  1TWG H;  3I4N G;  1SSO A;  3ULP A;  2AQ1 B;  3RLN A;  1Y1W G;  2L0C A;  1VQP A;  2C5C A;  1FL0 A;  1K8O A;  3Q24 A;  4GN4 B;  4JC0 A;  4Y7N H;  4Y52 H;  1QG7 A;  3AFQ A;  4LNQ A;  4EQN A;  1U0L A;  4JI1 Q;  2E5L L;  1PH8 A;  5C3E B;  1IBM Q;  1NNX A;  2OQK A;  1XMO L;  2Z4I A;  5BN5 A;  5JAV A;  2LXJ A;  4DAP A;  1IZ6 A;  3PGZ A;  3Q6S A;  4GS3 A;  4EGV A;  1C9O A;  1CQF A;  1GD7 A;  3I72 A;  1EUJ A;  1UE5 A;  2UU9 Q;  3DWP A;  1EIY B;  4B9X A;  5IOC A;  2JA8 H;  1KDA A;  3LWE A;  4MTN A;  1WD0 A;  1WCM H;  4UHV A;  1DON A;  3P7J A;  5ELF A;  1O7I A;  2QDB A;  3NWS A;  5EJW A;  4DR7 L;  4IFD G;  1CT1 D;  1TWF H;  4FXK C;  1WYD A;  2NN6 G;  1S72 A;  2E2D C;  4A3E G;  1J5E Q;  3QJY A;  4GKK Q;  4A3G H;  3LWU A;  4ZAI A;  1STB A;  1M8A A;  1MD2 D;  3JAM i;  3PUX A;  2F1M A;  3MXP A;  2ZM6 L;  4A3J G;  1QVC A;  1M90 C;  1FGB D;  4FF3 A;  3FKI H;  3OYY A;  1B2T A;  1VQF A;  2Z1C A;  4CKC A;  3GTP B;  5C0X J;  1UEB A;  2QEX A;  1H9M A;  1A3U A;  1UEA B;  2Z4H A;  3CQZ H;  5JVG 3;  3DWA A;  3HOW B;  2PYK A;  2XN9 C;  1B44 D;  2MP1 A;  4Q0F A;  1EIG A;  3S1M B;  1GOZ A;  5IT9 L;  1JWU D;  2E5L Q;  1PFN A;  1I4R A;  4TSS A;  1LAC A;  2IWH A;  4CDF C;  2AQ3 B;  3RZD H;  2XRQ D;  4R4Q A;  1WD1 A;  2B2Y A;  3STB C;  1H95 A;  2F0I A;  1EY6 A;  3TZD A;  2B2V C;  3BDC A;  1EY8 A;  1X6O A;  3DUZ A;  4K0K L;  4BY1 G;  1IYJ B;  2E76 C;  1Y1V G;  1JWM D;  3OWE B;  1JCK B;  4B3R L;  4C2M B;  1ROD A;  1MSH A;  5CV8 A;  2BDN A;  3UE0 A;  4A3F B;  1XNQ L;  1L1O A;  2EY6 A;  3L0O A;  4B3T L;  5IYB H;  3LGJ A;  4A76 A;  4JK1 C;  3LX0 A;  3I4L A;  4C1N K;  4GLV B;  4ZK9 B;  2MUY A;  2R7Z G;  1QE6 A;  2MPM A;  3KDF A;  3GTQ H;  3I90 A;  1IBL Q;  4IJH A;  4KJO A;  4C3I G;  1K8M A;  4KN7 C;  3W5O A;  2WKC A;  5BR8 L;  5CYU A;  4CKE A;  3E6Z X;  4OWX B;  4MIU A;  1SN8 A;  1B3A A;  1NBW A;  3HOY H;  4NXM L;  5E4X A;  2NUC A;  2BOS A;  4CBV A;  2WFW A;  4JI2 L;  1W6J A;  3GTK H;  2K4K A;  2L12 A;  1KLU D;  3S17 H;  4HAE A;  2O2L D;  4JI7 L;  3BYT B;  4OWW B;  4HID A;  3HKZ E;  1DXM A;  1ZEQ X;  1NY4 A;  1A2U A;  1MJE A;  2ZT9 C;  3C1E A;  4HJ5 A;  5IGE A;  1X3F A;  3CC2 A;  2Z6K A;  4QJF A;  3F1Z A;  4LUV A;  2VQE L;  3HGB A;  4X65 Q;  3I73 A;  3EQL C;  1G8Z D;  5GAE C;  4LF9 L;  1FNW A;  2R3Z A;  2MO0 A;  2CH4 A;  2R61 A;  1X54 A;  5H1S E;  5C0X I;  5HGT A;  2K6A A;  5C4J B;  1SRO A;  1JOO A;  1PMR A;  4YCW A;  3GTM H;  2K1B A;  4HJ9 A;  3BDO A;  4IZ8 A;  3F8T A;  5E4W C;  1L0Y B;  5CV7 A;  3M4O B;  4LF7 Q;  2PCF B;  3WDN A;  4FF4 A;  2Q8T A;  3HOU H;  1BVS A;  1SE4 A;  1EQR A;  2OXP A;  2JA6 H;  2F0E A;  3URY A;  1IHZ A;  1G91 A;  2Z8L A;  2L9H A;  1GHJ A;  3TRE A;  1O7Y A;  1G2S A;  2RDG A;  4LUO A;  3S1R H;  3GTJ B;  2P5Z X;  1VMP A;  3RLF A;  2HD3 A;  4JI0 L;  4AIM A;  1IYU A;  5IP9 H;  4QB4 A;  1EFW A;  4N9P A;  1LTG D;  4U67 3;  3HS0 C;  3BYY B;  5IYC H;  4TQU S;  1OXX K;  3CCR A;  4KJN A;  4JI2 Q;  1WTX A;  3ULL A;  4OON A;  3S2H H;  1SNM A;  2F3V A;  1DOM A;  4JOI C;  2B3G A;  3X3N A;  2JSO A;  4PZ8 A;  1X3G A;  4X66 L;  3HOV G;  2RBM A;  1Q81 C;  2F0K A;  2F0F A;  1WTQ A;  2EYP A;  2RHQ B;  2NZH A;  2RQX A;  2RDF A;  4ZLT F;  4DV0 Q;  1N34 Q;  4IFD H;  1S5C D;  2F3I A;  4H7B A;  1SMY D;  3AYH B;  3H0G B;  3DXJ C;  1LV9 A;  3H91 A;  2NVT B;  3QR8 A;  1EY7 A;  2EY5 A;  2M00 A;  5C4X G;  3MFG A;  2MGS A;  2BE5 D;  2UUB L;  1O78 A;  4I7Z C;  2R93 H;  5JEA J;  1QNU A;  5M3F G;  3HOX G;  4A3J H;  1YNJ D;  3EBE A;  4AQY L;  2AHO B;  1X9N A;  4C3H H;  1CUK A;  3S16 B;  3ERS X;  4IO9 A;  1SAP A;  3TME A;  3IKJ A;  4UAI A;  4N8X 1;  2B63 H;  1EYD A;  1IKL A;  1O80 A;  3F2U A;  2LSS A;  2F4I A;  5K36 G;  4MZ9 A;  4GOP B;  4BY7 B;  1L0X B;  5C44 G;  4APV A;  4UDU C;  4OWT B;  3M3Y B;  4QCL A;  2H4O A;  2H1E A;  2UUC L;  2BH2 A;  4X3S A;  3V2T A;  4JI0 Q;  1CQV A;  3MA2 B;  4K14 A;  4S3S A;  1B7Y B;  3ERQ A;  3F2B A;  1F2L A;  4C3J G;  1LT3 D;  1S3O A;  2F0L A;  1I3Q B;  1BBX C;  1KLG D;  2EOT A;  2AUJ D;  4DV2 L;  3L2P A;  3S1Q H;  3PV0 A;  1RTN A;  3K7A B;  1UE6 A;  1Q7Y C;  1BCP F;  1V8Q A;  5IT9 E;  1SRU A;  1UE7 A;  1ET9 A;  1TS3 A;  2SNS A;  1LYL A;  4UP7 A;  3OTO Q;  4X66 Q;  1DOK A;  2ICI A;  2NVQ B;  1E1T A;  2MFI A;  4OL7 A;  3VA5 A;  2FMM A;  2K28 A;  3CCU A;  1G6Z A;  1I4H A;  4XQQ A;  1HZB A;  4R8N A;  4A3C H;  1PH7 A;  2K5H A;  1HNX Q;  1QUQ B;  1VQG A;  3OW7 A;  5C3W A;  3KF6 B;  3I4M B;  5AFW A;  5J3B A;  3MWY W;  4L5R C;  1N32 L;  3D8G A;  5DNF A;  5EKL A;  5JVH 3;  2OWO A;  2GA4 B;  1B9N A;  1QZG A;  2F3W A;  1ENC A;  2E74 C;  5LMN L;  4AYB B;  2X6G A;  1GUG A;  1ET6 A;  1PZI D;  4DPG A;  3PF5 A;  1VQD A;  3V05 A;  2UXB L;  1C8C A;  2MJ8 A;  4JYA Q;  4RH6 A;  1I94 Q;  2JYO A;  3NBH A;  3T1Y L;  1TT2 A;  1A3V A;  2VQF L;  1VQM A;  4DR6 L;  1BCP D;  3NEN A;  1AP0 A;  1HTL D;  1CKN A;  2K03 A;  1RJT A;  1PYS B;  3J81 j; 
#chains in the Genus database with same CATH homology
 3QWN A;  1B50 A;  2AWO A;  3KLR A;  4FF2 A;  4P2C B;  2N55 A;  3MAQ A;  2KVM A;  2EYM A;  1BNZ A;  1PTO H;  2XSC A;  1SDF A;  4WRD A;  1SYD A;  1TWH B;  5CV6 A;  4LJZ C;  1H9S A;  1RF2 D;  1HQR D;  4DAY A;  1JR0 D;  4KTA A;  4PV1 C;  3K57 A;  3AB9 A;  3NK9 A;  3GQB A;  3M4Y A;  3H3V C;  3GV6 A;  1IKM A;  1HFG A;  5EBC A;  2CQA A;  4CJ1 B;  5IGC A;  3NP8 A;  3BDL A;  1V43 A;  4FF1 A;  2Q8I B;  3EVQ A;  3SK4 A;  1D6E C;  1NCV A;  3GP7 A;  5C5L A;  1F2Y A;  3X3M A;  1HUN A;  4K5W A;  1G2T A;  3P20 A;  2CVR A;  1RCV D;  3NXW A;  1Z6H A;  3H6M A;  2XNA C;  1BDO A;  2JEB I;  1LAB A;  2O5J C;  2JXM B;  3PIP 3;  4RCO A;  1Q12 A;  1STN A;  2R92 B;  4XQJ A;  1EY4 A;  3PO2 B;  1G29 1;  4DNT B;  3CHB D;  3PUZ A;  3KK7 A;  5F2D A;  1HRJ A;  2F0H A;  3PIO 3;  3J80 L;  3A8J E;  3FEW X;  2IX1 A;  4O42 A;  5C0X H;  4L8J A;  3PUW A;  2VNU D;  1K83 B;  4RGT A;  1XXG A;  4EQP A;  1R4P B;  1DZ1 A;  1SNC A;  4OIJ A;  2JA5 B;  3GD7 A;  2K5Q A;  4TRD A;  1QB5 D;  1S4Z A;  5FO8 B;  1A6X A;  1EFI D;  3S15 B;  1CI3 M;  2JA7 B;  3PO3 B;  1CZG A;  5JJZ A;  2ID0 A;  4GZY C;  2F0W A;  2WAQ B;  2PW7 A;  2C9O A;  1EIH A;  3GTG B;  1H9R A;  3O13 A;  1HXY D;  3GTL B;  2ZXP A;  1PDQ A;  1QNK A;  5FLX L;  2E2I B;  4A3I B;  2FIN B;  2HQE A;  1IW7 C;  2N88 A;  3W2D A;  3J81 L;  1EQT A;  4CKB A;  4OIK A;  4B08 A;  1D2B A;  1BO0 A;  2PMZ B;  2B2T C;  3FRP B;  4X3K A;  1QCB D;  2WV6 D;  1SND A;  4XYQ A;  1Q90 A;  1U4R A;  4HMJ A;  5CBE E;  4HN7 A;  5D3D A;  2K04 A;  3D31 A;  2Y0S B;  4E6I A;  3SEB A;  1PRT C;  1LTA D;  4LK1 C;  5A35 A;  2F0U A;  1EWC A;  3QB3 A;  2I46 A;  2ENB A;  3OMC A;  1AW7 A;  1EEF D;  3A7A B;  4KHV A;  2FFK B;  5G3L D;  5FKA C;  2A5H A;  1EEI D;  2F0V A;  3I91 A;  1I4P A;  4A3E B;  2K01 A;  1RDP D;  4ILW A;  3EA6 A;  1PRT B;  2RSN A;  4K8I A;  2CW0 C;  4XXE A;  3GV3 A;  2A6H C;  4YIJ A;  1H9K A;  1PFM A;  5J1Z A;  5IOD A;  3PMF A;  3CKI B;  5ISR A;  2PNR C;  2IJ0 A;  3TP6 A;  3NE5 B;  2WII B;  2A73 B;  4XT3 B;  1ZYR C;  1I6H B;  3D4W A;  5JOB A;  1WVL A;  4OO1 I;  5I2Y A;  1S5E D;  2EZV A;  2B8F A;  2PPB C;  4C3H G;  5CV5 A;  5EKI A;  3OHX C;  2DY8 A;  4HCS A;  1CFM A;  4KD4 A;  3TZU A;  1EU3 A;  1ZKO A;  4BY1 B;  1Y1V B;  2IW3 A;  1JE4 A;  3MXU A;  3OOC A;  1TU2 B;  2NBF A;  5JPM C;  3A8I E;  3KBX A;  5JEA H;  3GO5 A;  1V1P B;  1PTO C;  2LMC B;  1CA6 A;  5I6W A;  3V96 A;  2R7Z B;  3J80 E;  2O5I C;  2EYO A;  1Z47 A;  2KEE A;  4C3I B;  3JAM L;  4HSP A;  1ESF A;  1MGS A;  4KY5 A;  2J4X A;  5KNC A;  3A56 A;  5IGF A;  2B2W A;  1ILP A;  4EVO A;  4DFA A;  2B2U C;  3SXH A;  1JC7 A;  1BXT A;  2FMC A;  1ZXT A;  4U68 A;  2NZ1 D;  3J7A F;  1WTP A;  3L9A X;  2YU9 B;  1UAP A;  2K32 A;  1QIL A;  1GXD C;  2NVX B;  2F0T A;  1O7Z A;  4IUU A;  4IUN A;  2VB3 X;  1LT6 D;  5FO7 B;  3K59 A;  2K05 A;  2M2L A;  2RKS A;  3K0Y A;  4RGM A;  1ESR A;  1GJX A;  1KDB A;  1VF5 C;  5KGU A;  3C46 A;  1SYE A;  5C4H A;  2LS0 1;  5FLX E;  5FK9 C;  5J39 A;  4RGN A;  4RHR A;  4DK0 A;  3R3O A;  1DM0 B;  3FDT A;  5M5Y B;  3J7Y W;  5CV9 A;  3DM1 A;  1Y8P B;  3W3A A;  1F9S A;  1XWE A;  3HKZ B;  3VR2 A;  1STA A;  2DNC A;  1TR5 A;  3D4R A;  4G7Z C;  4ZKC B;  3AMU A;  2L55 A;  1EY0 A;  3CRL C;  4A3D B;  5I4D A;  3AU7 A;  4PQX A;  3HOV B;  1II3 A;  4ULL A;  1TWA B;  3I8Z A;  1XYI A;  1RHP A;  1HCZ A;  1B1Z A;  4H13 C;  1WTR A;  2PQE A;  1ICW A;  3P75 A;  2KQ3 A;  2JE6 I;  2NVY B;  3ONA B;  5C4X B;  1JIC A;  5EBD A;  1KAB A;  5M3F B;  3HOX B;  1EZ8 A;  1PFB A;  1SE3 A;  3C3L A;  1S5F D;  3L7Z C;  2EVB A;  3G6J B;  3IFT A;  2IT1 A;  2WKD A;  1BUV T;  4PMW A;  3SHL A;  1YNN D;  3IL8 A;  3CRK C;  1UNS A;  5C44 B;  1JOK A;  5TSS A;  3A8K E;  3TDQ A;  3BVZ A;  4R8I A;  2B2Y C;  3UI2 A;  2IX0 A;  1UUP A;  5C4Z A;  3R8B A;  1MSG A;  1C4Q A;  2EXZ A;  4BBR B;  1X3Q A;  3TN2 A;  5EKK A;  5C0X G;  3IAY A;  4TKO B;  4RKL A;  5KIX A;  1SNO A;  1RKN A;  4HSV A;  1LO5 D;  2LFN A;  3LNN A;  4X3T A;  1DCZ A;  4I65 A;  2I07 B;  4H0L C;  1A2T A;  1Q3L A;  4KKS A;  3C1F A;  4ZKB B;  1OO9 B;  5C3X A;  2JP1 A;  1STH A;  4HED A;  4MN3 A;  2AQ2 B;  4N9T A;  1DOL A;  3MEH A;  1AEX A;  2EJM A;  2EDG A;  2F0N A;  1WTW A;  1OXU A;  3JAM E;  1IL8 A;  1VF7 A;  5COR A;  1FR3 A;  4A3B B;  3HRZ C;  2A69 C;  1KAA A;  1FD7 D;  4ZYS A;  4RKB A;  3RZO B;  3BVM A;  4KY7 A;  2XWJ B;  1TWG B;  5DAU A;  2EE1 A;  5D65 A;  3Q22 A;  4M1U B;  2EY2 A;  1EY9 A;  3VYR A;  2K5D A;  4XQN A;  3PUV A;  4ZRZ A;  3K5O A;  1SNQ A;  2F0J A;  4CJ0 B;  2VXW A;  2G9D A;  5DM7 3;  3EFX D;  2NB0 A;  5EQ0 A;  4CJ2 C;  2JA8 B;  2QCP X;  1STE A;  2Q8R E;  1XX8 A;  2D2C C;  5KRU A;  3ERO A;  1EWH A;  1SYC A;  2LKV A;  1TS5 A;  5IGG A;  4A3G B;  4OHJ A;  3WOF A;  1STG A;  1SBB B;  3BS1 A;  3M7N A;  1HA6 A;  1S5B D;  1TKW B;  3VYU A;  1JOQ A;  4KI0 A;  3T13 A;  4F87 A;  3CQZ B;  1ONL A;  1EZ6 A;  2F0M A;  1IW7 D;  3T56 B;  4IFD J;  3SVM A;  4RHS A;  4G57 A;  3L3O C;  4XDX A;  3RZD B;  5IIF A;  3DHQ A;  3R2T A;  1JB3 A;  3QO2 A;  4FNF A;  4IAL A;  2VB2 X;  3RD4 A;  3TSS A;  3E5S A;  2RA4 A;  1F9P A;  5FO9 B;  1PRT D;  3OPO A;  2PZU A;  3OIQ A;  3QOL A;  3PUY A;  3KF8 A;  5JEA G;  2EYJ A;  3D6C A;  3U9O A;  4KV6 A;  3P1H A;  4K6L A;  2A74 C;  2ZXR A;  2V4D A;  2L1B A;  1BCP C;  4BA2 I;  3GTQ B;  3QIA A;  5CMD A;  4IUQ A;  5E3F A;  2EYF A;  2HCI A;  1V1P A;  1SXT A;  1NR2 A;  4HR7 B;  4K6D A;  3NBI A;  3S17 B;  3MZ5 A;  1HHV A;  2BA0 A;  1KNA A;  1HUM A;  1TS4 A;  2A6E C;  5KNB A;  2XWB B;  3H09 A;  4J1M A;  2AUK A;  2QEJ C;  1HQM C;  1SE2 A;  1MBY A;  3MTS A;  1ZYR D;  3Q0A A;  5ELD A;  1OXV A;  2BA1 A;  4K2K A;  1WTO A;  3VR5 A;  2E2H B;  4BA1 I;  3GTM B;  4DK1 A;  5KND A;  3HOZ B;  4V19 0;  5IGD A;  4G7H C;  2B2V A;  2EYH A;  5G3L F;  3HOU B;  4DXG A;  1U4M A;  4IFD I;  3BVG A;  2JA6 B;  2O4X A;  3I4N B;  1OXS C;  2WB1 B;  1Y1W B;  3H94 A;  2NN6 I;  2SEB D;  2RSO A;  3DMU A;  1U9R A;  2CHB D;  1A15 A;  2EJG C;  5E1F A;  1OXT A;  4J6H A;  1QJO A;  2DN8 A;  2J7Z A;  3K58 A;  3SR1 A;  2SNM A;  4NP5 A;  1KDC A;  5I2X A;  3T4A C;  1MI2 A;  3R93 A;  2QIL A;  5BN3 A;  4NMZ A;  3MXG A;  1D5M C;  3D3R A;  4HTH A;  3TBI B;  2J0T D;  4C1N I;  5M5X B;  1R4Q B;  1EYA A;  1JQY D;  1TY2 A;  4KKT A;  2FJ2 A;  1BOS A;  2R93 B;  1QWY A;  4FO2 A;  4A3J B;  2RVL A;  2WP8 J;  2NTS A;  4C3H B;  3D4D A;  4CHT B;  3KUP A;  3T51 B;  2B63 B;  5C6A A;  1M4V A;  1TS2 A;  3NPP A;  1NUC A;  1AFP A;  4QF4 A;  2FHT A;  3M7G A;  2F0G A;  1V1O A;  1GUT A;  4ID6 A;  4HCE A;  1RD9 D;  3S1N B;  3ND9 A;  5T1G A;  3TP5 A;  2F0O A;  3S1Q B;  2OT2 A;  1AZP A;  4RA8 A;  1TII D;  1A3T A;  4ME5 A;  1I50 B;  1KNE A;  2KED A;  2QF7 A;  4BS9 A;  4XT1 B;  1STY A;  2A68 C;  3NQT A;  2F0D A;  4FXG C;  5EPJ A;  1J8I A;  1X32 A;  1FYC A;  4KHZ A;  3OWF A;  1HTP A;  3KBG A;  3FPP A;  1F9Q A;  2XRS D;  1RTO A;  3CU7 A;  1U4P A;  1B53 A;  5ELC A;  1CZW A;  4ABN A;  1PXU A;  1EQV A;  4KMU C;  3K5M A;  3NUC A;  5ELE A;  4F7X A;  1Y8O B;  2D62 A;  4K8J A;  3GTO B;  1LTT D;  2E2J B;  1Y69 U;  5HUR A;  3NTH A;  2B8G A;  1PTO B;  2K33 A;  4QUC A;  4NDX A;  4PMB A;  3MHB A;  3MXN A;  3NWT A;  3RMH A;  1F77 A;  2KOL A;  4OO1 G;  5KYI A;  4DU9 A;  2D5D A;  2PW5 A;  4WJW A;  1SYF A;  2ICE C;  4IUR A;  2IL8 A;  2NTT A;  1AN8 A;  3VR4 A;  1EL0 A;  5NUC A;  1LLR D;  1CHQ D;  1CHP D;  1SYG A;  2X69 A;  4EQO A;  1C48 A;  4G4K A;  3J81 E;  2XIW A;  1I6V C;  1JWS D;  3EJI A;  2B39 A;  2QKI C;  3K5L A;  1I4X A;  4MHE A;  4BBS B;  3OIP A;  3HZX A;  2TMP A;  1GUS A;  4IQZ A;  4IUV A;  3MFY A;  4K2L A;  5M9O A;  3NSW A;  4LAA A;  1B4O A;  4QUF A;  2F0S A;  2EPB A;  2BCO A;  4A3M B;  1HFN A;  1SEB D;  2KJX A;  3FMC A;  1PYW D;  2X6L A;  1PZK D;  1Q1E A;  3M85 A;  2A69 D;  4ODG A;  3ND8 A;  3FPU B;  1E2Z A;  4PNY A;  1E2V A;  3NTI A;  1SYB A;  4RGO S;  1BF4 A;  4IUP A;  3K5N A;  1SNP A;  1CM9 A;  2SOB A;  2PZW A;  5A2Q L;  3K6O A;  4JBW A;  4C3J B;  1WTV A;  1Q1B A;  3G7L A;  2RDH A;  4C56 C;  4IN3 A;  1F2Z A;  1H9J A;  4XYO A;  2L11 A;  2NN6 H;  2AWN A;  3S9W A;  2IPK D;  1Z7T A;  1HPC A;  2B2W C;  1DJR D;  2JEA I;  4WOR A;  2E75 C;  4KD3 A;  1LT5 D;  1SJH D;  1LT4 D;  1ENF A;  4BWG B;  1VDZ A;  3SK6 A;  5CR3 A;  3VR3 A;  2VUM B;  3QOJ A;  4DA2 A;  1X3P A;  3A55 A;  1GUN A;  2F03 A;  3MC0 B;  2WIN B;  1SJE D;  2R6G A;  3OMG A;  4K5V A;  4R9W A;  5LL6 S;  4HMI A;  3WOE A;  5EPK A;  3HP3 A;  1U4L A;  1ILQ A;  4KKU A;  3TP7 A;  1NAP A;  3HEJ A;  3T53 B;  1D1K A;  1JOR A;  3A54 A;  4IUT A;  4XIG S;  1EOT A;  3QG1 A;  2IX3 A;  4KY6 A;  3FVQ A;  4A3K B;  4FP5 D;  1BQQ T;  3ZYY X;  2D9U A;  1W6K A;  4H44 C;  3I3C A;  3OSO A;  5DM6 3;  4F88 A;  1LTI D;  5M5W B;  1QOH A;  1PLF A;  5D3I B;  5LL6 X;  1EYC A;  4A93 B;  3ITP A;  2HUG A;  4OO1 H;  3TP8 A;  4Y7N B;  3VYT A;  1VMC A;  4Q5V A;  3VA7 A;  3D6W A;  3KLS X;  3NQI A;  4QMG A;  1S5D D;  4DN4 M;  5C5M A;  3E0J A;  4F8M A;  3J7A V;  1LTS D;  1SMY C;  1SFO B;  1YNN C;  1DD2 A;  1CTM A;  2KEC A;  2L5T A;  1AZQ A;  1WCM B;  5KEE A;  2BE5 C;  3N52 A;  1BR9 A;  5I9O A;  1XTC D;  1TWF B;  2KA7 A;  1YNJ C;  3S2D B;  2YYZ A;  4DGZ A;  4RWS C;  1GHK A;  2A6E D;  4LMQ D;  1PRT F;  3FKI B;  1GUO A;  1KTK A;  2B2T A;  4CGY B;  4QIW B;  2K5W A;  2XVS A;  3SK8 A;  5I6Y A;  4O1N A;  2LY7 A;  3U9S A;  1D5X C;  1EY5 A;  1T5X D;  3SK5 A;  4V0B A;  2KHS A;  5BN4 A;  2TSS A;  5EGT A;  2BDO A;  4WFN 3;  5COY A;  3T16 A;  2G9H D;  4DAV A;  1LTR D;  2OEO A;  2HDM A;  2F0P A;  3BG3 A;  2OF1 A;  5CBA E;  1O7L A;  1VCI A;  4FYD A;  1TQO A;  1TWC B;  5K5P A;  4PMC A;  1IYV A;  2DNE A;  4G7O C;  5FOB B;  2NWG A;  5D14 A;  4ZUI A;  4DNR B;  4RCN A;  5DEH A;  2EY1 A;  3DWQ A;  5JPN C;  2DY7 A;  3VYS A;  5IGB A;  4RAU C;  3NHH A;  5A2Q E;  4XTC S;  4FVM A;  2L4N A;  5EPL A;  5CV4 A;  1HA5 A;  1I4G A;  4NKL A;  1B9M A;  1LTB D;  1Q8I A;  5ELB A;  2SDF A;  1T5E A;  2PZT A;  2KCC A;  2WAC A;  3HOY B;  1E0B A;  5K36 H;  3GTK B;  2CW0 D;  2EYL A;  1I4Q A;  2A6H D;  4NW2 A;  2PO4 A;  4Z9C B;  4L6T B;  2K7V A;  1F9R A;  3KLS A;  3BZD B;  1BCP B;  3DEO A;  1PTO F;  1ENA A;  3N6R A;  2HCC A;  4ZUJ A;  1TVX A;  1D5Z C;  1CK1 A;  1ML0 D;  4RFB A;  1NSN S;  3NTK A;  3IFD A;  2HDL A;  1F2M A;  4M8A A;  3A7L A;  4ZQ3 A;  2KUM A;  3S14 B;  1PZJ D;  3VR6 A;  1FNV A;  1R9T B;  5J22 A;  3R2I A;  4K5X A;  1Y8N B;  4KK7 A;  4L63 B;  2A68 D;  3S1R B;  5T1I A;  2M9V A;  2NYZ D;  4KN4 C;  5I9P A;  1DYQ A;  3DEP A;  1TY0 A;  4FXD A;  1PTO D;  3C2P A;  2B2U A;  1GUW A;  5M3M B;  4DF7 A;  4OGQ C;  2MHV A;  3S2H B;  3RUZ A;  3SDZ A;  5CC4 A;  5CGK A;  1J9O A;  4J8Q A;  3I70 A;  4DXF A;  3SE0 A;  5KYL A;  2F0Q A;  1E2W A;  2EJF C;  2KCN A;  1NR4 A;  4B9W A;  5LHY 1;  1D1I A;  1CA5 A;  1EU4 A;  1H9S B;  2ZXO A;  3Q23 A;  1FNU A;  3HG9 A;  3MVV A;  4X3U A;  1SSO A;  2AQ1 B;  2L0C A;  2C5C A;  1K8O A;  3Q24 A;  1QG7 A;  4EQN A;  5C3E B;  2Z4I A;  5BN5 A;  5JAV A;  4DAP A;  4EGV A;  3Q6S A;  1CQF A;  3I72 A;  3DWP A;  4B9X A;  5IOC A;  1KDA A;  3LWE A;  1WD0 A;  1DON A;  3P7J A;  5ELF A;  2QDB A;  3NWS A;  5EJW A;  4IFD G;  1CT1 D;  4FXK C;  2NN6 G;  2E2D C;  3QJY A;  3LWU A;  4ZAI A;  1STB A;  1M8A A;  1MD2 D;  3PUX A;  2F1M A;  3MXP A;  1FGB D;  4FF3 A;  1B2T A;  2Z1C A;  4CKC A;  3GTP B;  5C0X J;  1H9M A;  1A3U A;  1UEA B;  2Z4H A;  5JVG 3;  3DWA A;  3HOW B;  2PYK A;  2XN9 C;  1B44 D;  2MP1 A;  4Q0F A;  1EIG A;  3S1M B;  1GOZ A;  5IT9 L;  1JWU D;  1PFN A;  1I4R A;  4TSS A;  1LAC A;  2IWH A;  2AQ3 B;  2XRQ D;  1WD1 A;  2B2Y A;  2F0I A;  1EY6 A;  3TZD A;  2B2V C;  3BDC A;  1EY8 A;  3DUZ A;  2E76 C;  1JWM D;  3OWE B;  1JCK B;  4C2M B;  1ROD A;  1MSH A;  5CV8 A;  2BDN A;  4A3F B;  2EY6 A;  4JK1 C;  3LX0 A;  3I4L A;  4C1N K;  4ZK9 B;  2MUY A;  1QE6 A;  2MPM A;  3I90 A;  4KJO A;  4C3I G;  1K8M A;  4KN7 C;  2WKC A;  5CYU A;  4CKE A;  3E6Z X;  4MIU A;  1B3A A;  5E4X A;  2NUC A;  2BOS A;  4CBV A;  1W6J A;  2L12 A;  1KLU D;  4HAE A;  2O2L D;  3BYT B;  1DXM A;  1ZEQ X;  1A2U A;  2ZT9 C;  3C1E A;  5IGE A;  3HGB A;  3I73 A;  3EQL C;  1G8Z D;  1FNW A;  2R3Z A;  2R61 A;  5C0X I;  5HGT A;  2K6A A;  5C4J B;  1JOO A;  1PMR A;  2K1B A;  3BDO A;  4IZ8 A;  5E4W C;  1L0Y B;  5CV7 A;  3M4O B;  2PCF B;  3WDN A;  4FF4 A;  2Q8T A;  1SE4 A;  2OXP A;  2F0E A;  3URY A;  1IHZ A;  1G91 A;  2Z8L A;  2L9H A;  1GHJ A;  1O7Y A;  1G2S A;  2RDG A;  3GTJ B;  1VMP A;  3RLF A;  1IYU A;  4QB4 A;  4N9P A;  1LTG D;  4U67 3;  3HS0 C;  3BYY B;  4TQU S;  1OXX K;  4KJN A;  1WTX A;  1SNM A;  2F3V A;  1DOM A;  3X3N A;  2JSO A;  2RBM A;  2F0K A;  2F0F A;  1WTQ A;  2EYP A;  2RQX A;  2RDF A;  4ZLT F;  4IFD H;  1S5C D;  4H7B A;  1SMY D;  3H0G B;  2NVT B;  3DXJ C;  1LV9 A;  3H91 A;  1EY7 A;  2EY5 A;  2M00 A;  3MFG A;  2MGS A;  2BE5 D;  1O78 A;  4I7Z C;  5JEA J;  1QNU A;  1YNJ D;  3S16 B;  1SAP A;  3TME A;  3IKJ A;  4UAI A;  1EYD A;  1IKL A;  1O80 A;  3F2U A;  2F4I A;  5K36 G;  4BY7 B;  1L0X B;  4UDU C;  3M3Y B;  4QCL A;  2H4O A;  2H1E A;  4X3S A;  3V2T A;  1CQV A;  3MA2 B;  4K14 A;  4S3S A;  3ERQ A;  1F2L A;  4C3J G;  1LT3 D;  2F0L A;  1I3Q B;  1BBX C;  1KLG D;  2EOT A;  2AUJ D;  3PV0 A;  1RTN A;  3K7A B;  1BCP F;  1V8Q A;  5IT9 E;  1ET9 A;  1TS3 A;  2SNS A;  1DOK A;  2ICI A;  2NVQ B;  4OL7 A;  3VA5 A;  2FMM A;  2K28 A;  1G6Z A;  1I4H A;  4XQQ A;  4R8N A;  5C3W A;  3OW7 A;  3I4M B;  5AFW A;  3MWY W;  3D8G A;  5DNF A;  5EKL A;  5JVH 3;  2GA4 B;  1B9N A;  2F3W A;  1ENC A;  2E74 C;  4AYB B;  2X6G A;  1GUG A;  1ET6 A;  1PZI D;  3V05 A;  1C8C A;  2MJ8 A;  4RH6 A;  2JYO A;  3NBH A;  1TT2 A;  1A3V A;  1BCP D;  1AP0 A;  1HTL D;  2K03 A;  1RJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...