3J81L

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
155
structure length
155
Chain Sequence
b'STELTVQSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYEKRHKNVPAHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVASATGKANKQFAKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 15
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00366 Ribosomal_S17 Ribosomal protein S17
L PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3j81L00
5A2QL 5IT9L 5FLXL 3J7AV 5LL6X 3JAML 3J80L 3J81L
chains in the Genus database with same CATH superfamily
1XYIA 2Y0SB 1XPRA 1L2FA 3HOWG 3HOXG 4A3MB 1CK1A 4JI7Q 1II3A 3B6YA 2JA6B 3L2PA 1G91A 3C1EA 1RHPA 2F0EA 4BY7B 4MTNA 1N34Q 1STAA 1RODA 1B44D 2J7ZA 3E0EA 3GDEA 3OMGA 1KHIA 4Z9CB 3GTLB 1XTCD 2GVBA 3OOCA 2NVXH 1PZKD 4CBVA 2AUJD 3PO2H 4IUNA 3G7LA 1Q90A 2PW7A 3KF6A 1TWHB 1Y1VG 2UUBQ 4BS9A 4HJ8A 1B9NA 3Q23A 2NVYB 2PQAB 2RBMA 1FYCA 4M1UB 4JI2L 2OEOA 4JBWA 3SR1A 1LT4D 4DV0Q 1SSOA 2GN5A 2H5XA 1WI5A 2K32A 2BA0A 3S2DH 1VQJA 5M3MB 4Y7NB 4OL7A 5GADC 2A69D 3D4RA 5IGCA 1I3QB 3GTGH 1AE2A 1U9RA 1DCZA 3VR2A 1QNUA 5C3EB 3LX0A 2F0QA 4QL5A 2D0OA 2WB1G 4DA2A 3A7LA 1ZXTA 1HQRD 4DAYB 4GNXB 2RQXA 4O2DA 5C5MA 3A0JA 1IKLA 1YBYA 2YTYA 4GN5A 1NTGA 1VQ8A 3J81c 2Z6KC 3A56A 3EROA 1OXSC 4R9WA 4DV4L 1Q3LA 1WYDA 2B2UC 2NVQH 5HGQA 4DV2Q 4JV5L 2RA4A 4QMGA 2F52A 4DUYL 1XPOA 1Q8IA 3CHBD 4A3JG 2Q2IA 1MSGA 4GKJL 3J7AF 3NHHA 1ASYA 1KLUD 4JI1Q 4RWSC 2MHVA 1BBXC 1SNCA 3L9AX 4R8NA 1ENCA 3CKIB 4IQZA 2E2IB 1X3PA 3TBIB 1XMOL 2EYJA 4XXEA 1JORA 3JC66 3TRZA 3I8ZA 3I4NG 4DR2Q 3G48A 4IFDG 5J1ZA 2NB0A 5CV4A 4UDUC 2A74C 3KJPA 2EVBA 2F0SA 1UE1A 1QILA 4QJFA 4C1NI 4B08A 5J3BA 4LFAQ 1S5CD 2AMCB 5E4WC 3JAML 4JI0Q 2WINB 5I6YA 1I4QA 3T4AC 1A3VA 3OSOA 3P75A 4WFN3 5EKKA 3J81j 2D9UA 4DKAC 1ILQA 3HS0C 4GN3B 1WD1A 2WAQE 4A3DB 1A2UA 4DV1L 5GROA 1PRTB 1NE3A 5I4DA 2A6EC 1XWEA 5IE8A 1RJTA 2IL8A 2EYLA 1DONA 1V1QA 4QGUA 3Q8DA 1JOQA 5C0XI 2F0UA 4ZQ3A 3STBD 2K5VA 2A6HC 2BOSA 1KQSA 1D5ZC 3I56A 3PIPA 1IBKQ 4ME3A 2QDBA 1SJED 2H1EA 3KF6B 2B2WA 4JPBW 4CJ2C 4QIWB 1H9JA 1X6OA 2G9DA 1EIFA 4P2CB 1JC7A 1CFMA 2ZJQA 3E9IA 3E3XA 1LTAD 1EWIA 1PYWD 1VQ7A 1GM5A 3QB3A 4DV6Q 1E7ZA 1E2ZA 2B2TA 3G4SA 1JWMD 1FD7D 3S16B 3M85A 3RLFA 4A3GG 1KRSA 4RFBA 2EZVA 4DU9A 2DNCA 2I5MX 5ELBA 4RA8A 4DK6C 1DZ1A 4KY5A 4A3EG 1A3TA 3UDIA 4NXNL 1VF5C 2JA7H 2LFNA 1TKWB 4HMIA 4A3FG 3DHQA 2HT1A 1J5EQ 2FINB 2EIFA 2F0HA 2KOLA 2FXQA 1V9PA 4X3KA 3EFXD 2JSOA 5J39A 4C3IH 2K5DA 3PF4A 3J80i 1LTRD 4DR1Q 3GQBA 3K0XA 2VL6A 3H0GH 1O7IA 4KY7A 1EY5A 2I46A 1L1OC 5CV8A 3M4YA 4QQBX 2Y0SG 4DNTB 3RUZA 4A3MG 2TMPA 3MWYW 1T5XD 2R61A 2JA6G 4U673 2KEDA 2NTTA 3T13A 4BY7G 2VUMB 3I7FA 1VQGA 1JT8A 1IBML 3OIQA 4FDBA 4GKKL 1WVLA 2IX1A 1YVCA 1HNXQ 4NW2A 3O13A 4K0KL 1SROA 2HDLA 3Q24A 1A15A 3CXCA 1FGBD 1LTSD 2XRSD 2CCZA 2ICIA 4KJOA 1FJGL 5ELDA 4PZ6A 5I9PA 4ID6A 1KC8C 4XDXA 5IOCA 1C7YA 4ZUIA 4ZK9B 1JICA 4B9XA 1PXUA 5DM63 2EYFA 4L6TB 4LFCQ 3D4DA 1RTOA 2K01A 3PIOA 3AQQA 1JJGA 1LABA 5M3MG 1HNWL 1NSNS 3R8BA 1M90C 4CGYB 2N55A 3BYTB 4A3IB 5FLXc 1SEBD 3NBIA 1HPCA 1STNA 5C3EG 2OT2A 3U58A 1PH3A 3TDQA 1YHQA 4QCLA 3CQZH 1DJRD 4YWKA 4DV7L 1VS0A 5FLMH 2R92H 1QVFA 2E5LQ 3VYSA 1F9SA 1ZYRD 5IYCG 4RGMA 1SNQA 3TQYA 3NEMA 4K6LA 5BR8L 4DN4M 2EY6A 4POGA 2UUAQ 5D65A 1CZGA 2NVTB 1BCPB 2DUDA 1GUGA 2CW0C 1W2BA 3UE0A 2NBFA 4J1MA 3D0FA 4YCUA 4XQNA 1KIXA 1I50B 3JAMc 4B3ML 4C3HH 5IIFA 2ASBA 3PGZA 4RCOA 3GTQB 1FNUA 1E2VA 4TVAB 3AU7A 1O7YA 2VZAA 5FOBB 5IP7H 3S14B 1PFSA 4LWCA 2F03A 2O5JC 1BQQT 2CWPA 3P7JA 2JXMB 1TS3A 2KCMA 1Q7YC 3K7AH 1Y8PB 2MJ8A 3OMCA 2F0PA 3EVQA 4FXDA 4CDEC 1WTWA 1F77A 2L15A 1L0XB 1NMFA 1AN8A 1BO0A 2Q2UA 1QUQA 4KD3A 5JJIA 1RD9D 4J8QA 1BR9A 4RGTA 1HR0Q 3CPWA 4N9TA 3PO2B 1IYJB 4OHJA 3PO3B 1PRTD 5IT9L 1I6VC 3BVZA 2HHHQ 5KRUA 3EA6A 2MFIA 1H9RA 1S3OA 4OWXB 1SRUA 3C2PA 1CA6A 2MPMA 1NNXA 4A3DG 5AJ3Q 2RHQB 2PNRC 5M5YH 3OWEB 3DM1A 2DJFC 3CC2A 4C1NK 1U0LA 3T1YQ 1LT3D 5T1IA 1PA6A 1CZWA 4A3CH 2K04A 1PTOF 2B2VA 3R2IA 4XQJA 1VQ9A 4RGNA 2ES2A 5DM73 1GHKA 1M8AA 2Q8RE 3A55A 1HR0W 1Q12A 4KHPQ 4BBRH 1DYQA 1XX8A 1RTNA 1O7ZA 2LY7A 2J0TD 1W6KA 1Q82C 3FPPA 3I2ZA 1SR3A 4A3BH 1EYDA 4HTHA 4C2MH 1VQPA 4H7BA 4MTKA 2NVQB 2MO0A 4L63B 2UXBL 1TWCH 5IGEA 1G51A 3UE1A 3H09A 1QB5D 2VQEQ 3BZKA 4OIJA 5IWAL 4IPHA 1PH7A 2EY1A 4QF4A 1WTVA 1UNSA 4OO1H 1BXTA 3LGJA 1IL2A 1QZHA 4NKLA 2JA5H 2BE5D 4FXKC 4ZKBB 2AWNA 4YHHL 1KDAA 2K5HA 2A8VA 2EQSA 5KNBA 2NUCA 5C44H 1G6PA 2RF4A 4FP5D 3TZUA 1QZGA 1Y1WB 3WDNA 1I4PA 2QDLA 3D4WA 2A73B 4APVA 4LF6L 5EPKA 1TS2A 3T1HQ 4JYAL 4ODGA 1JE5A 2E76C 1I4RA 3S1QH 1AH9A 2VQFL 3W2DA 2K03A 4CDFC 4LF4L 1GUNA 2JJQA 4F87A 1EY0A 2KHIA 3BJUA 1JMCA 2VUMG 4H0LC 2FFKB 1VQBA 2A69C 2EJGC 4BXXH 1QVGA 3BDCA 2NN6H 5I9OA 4JI7L 1HQMC 5GAGC 3FMCA 2CKZB 5ELCA 1N34L 4BBSH 2LS01 5JVG3 1C4QA 1TU2B 1G8ZD 1B7YB 5E1FA 2ZTDA 1SMYD 1QUQB 1ICFB 1PV4A 1P8LA 3T51B 2UUBL 4UAIA 2ZM6L 1IHZA 4A93B 1JOKA 1A63A 1NAPA 2WKDA 3KBXA 1DOMA 1VQLA 2AQ3B 5COYA 5TSSA 1U4MA 3J80E 2CQAA 1QE6A 1ONLA 1EU4A 4DV0L 2NTSA 4A3IG 1E3PA 1XXGA 2IHFA 4MHEA 1CUKA 3HGBA 5EBDA 4BY1H 2TSSA 1SYDA 3IL8A 4FF2A 3AFQA 2ZXPA 4KV6A 3TREA 4HSVA 1BCPD 2LMCB 5D14A 2K7VA 1SYCA 5C5LA 2E2JH 3N6RA 1A8VA 2AQ2B 2I07B 1YJWA 2ZTCA 4C3JH 3NQTA 4JI8Q 1WCMB 3M4OB 1I6HH 4DAPA 2B39A 3A8KE 3PMFA 1L0YB 1KRTA 4FF3A 2KCTA 1IKMA 2R6GA 2RDFA 2L55A 5IYBG 4C3IB 2CHBD 3CRKC 5L37A 5IT9c 3CC4A 3X3MA 4PNYA 3H0GB 3D8GA 1UEAB 4JC0A 2F0FA 4IUUA 4RKBA 1MI2A 5C3WA 3PSIA 4KMUC 2B8GA 1SLJA 2KVMA 3QOJA 4DR6Q 4JI1L 1MJCA 5JPNC 4IPCA 1PFBA 2EDGA 3RZDH 3QIAA 3TMEA 3W1BA 1B53A 1BKBA 1HUNA 2EY2A 2L0CA 3RN5A 3STBC 5LMUQ 1VMPA 5JVH3 3K59A 1I94L 4IALA 2F4IA 4GOPC 2VY3A 4FO2A 4CDCC 2RSOA 1LTID 5C0XG 1EIHA 1EY8A 2D0PA 1B1ZA 2IW3A 3PO2G 3PIP3 3PO3G 3ICEA 2LSSA 3OIPA 3K5LA 1VQ5A 2DN8A 2HIXA 1FNWA 2QF7A 4LFAL 3NTHA 1DD2A 2EPBA 1Q46A 4IN3A 4JI0L 2HQEA 2KECA 3CU7A 3NBHA 1N36Q 2DY8A 1LT6D 2XTIA 3VA7A 3NXWA 1MSHA 1SMXA 1Z6HA 2YU9B 4NP5A 3UDGA 1GUSA 3F8TA 1HTLD 3URYA 1T5EA 1H9MA 3PUWA 3SEBA 1NCVA 5HY6A 1Q86C 2AUKA 1PTOH 4N8X1 5AFWA 5IY0A 1CHQD 4HSPA 3CQZB 3MTSA 1IXRA 3HKZE 3HOZH 3CCUA 3VR6A 2JN4A 1N33Q 1IBKL 4FNFA 4HIKA 2XN9C 1A3UA 3X3NA 4IFDJ 1EQTA 1YNND 2R3ZA 5H1SE 3F1ZA 2P5ZX 3HKSA 4ULLA 1JB3A 1U5KA 1STBA 3EJIA 3WOEA 4TQUS 1VQNA 4JVZA 5BN3A 1I4GA 2OTLA 1TR5A 4JOIC 1NJIC 4JW0A 4LF9L 1PH8A 2R93B 2DY7A 3CCQA 1VQIA 2BCOA 1STHA 4DFAA 2F1MA 5JAVA 2E8GA 5ELNA 1PYSB 3HG9A 1YNJD 3R93A 2WACA 1B70B 3OW7A 1X65A 1X56A 4DR3L 2MNAA 1Y1VH 3I90A 1EQQA 1K3BC 3GTJH 1EIGA 3HP3A 3S15H 2G5DA 2D62A 3G71A 2UUCQ 4ALPA 1YI2A 2N78A 2F3WA 4EGVA 3Q0AA 5K36H 1LUZA 2RDGA 3CC7A 1Y1WG 1F9PA 2XWJB 4LAAA 1J5EL 4DR4Q 4QB4A 3OTOQ 4CKCA 4A4IA 3MXGA 1BOSA 1K8AC 4B3TQ 4RHRA 2Z4HA 3R2TA 3AYHB 4DR1L 2AQ1B 3CAMA 3QG1A 3QO2A 1TIID 5D3IB 1GD7A 3K8AA 5C4HA 4JBKA 4ZAIA 4EQNA 5JPMC 1EYGA 2C5CA 3BVMA 3PF5A 4B3RQ 3NTIA 4LK1C 4GNXC 1HXYD 4B3SQ 1JB7A 4J6HA 1STEA 1YIJA 2F0OA 2Q8TA 3U9OA 5ELFA 1HRJA 3K0YA 4GZYC 3TN2A 4MN3A 4AYBE 3VR5A 1ZYRC 3S17H 3E0JA 3U4VA 1HNXL 1R4QB 3HEJA 4XT3B 4A3JH 3DM3A 4A93G 4DR7Q 3IFDA 3NENA 1UE7A 1IL8A 2PPBC 4NB3A 4HIDA 3N52A 4YCWA 4BBRB 1PHJA 3K5MA 5KEEA 1J6QA 3S1RH 5FO9B 1KL9A 5IGBA 3DMUA 1JE4A 2Q2TA 3FKIH 4B9WA 3GTMH 3NBHB 5I2YA 4C2MB 3DWPA 3I4NH 4X66Q 4IFDH 1E1TA 4NMZA 2JA9A 5CV5A 5DAUA 1TWCB 5M5WH 2K28A 3NP8A 5FK9C 2VS1A 2XSCA 2HCCA 4H02A 4R4QA 1RCVD 1SNPA 1WCMG 1EFWA 2E5LL 4ABNA 3GTOH 1XNRQ 2JA5B 1E24A 1E22A 2QEXA 1NBWA 4DUZL 2UUAL 4X62Q 1S5ED 5K5PA 1RDPD 1RKNA 3HOVB 4F8MA 4C3IG 1VQEA 1K83B 1ENFA 1PRTC 3GV6A 2K1BA 5EPJA 2IX3A 1LM0A 2LKVA 3D6WA 3H0GG 5EJWA 3E6ZX 5JOBA 2KUMA 3F2CA 1JQYD 3K6OA 5IYDH 5DLQE 1K73C 4K5VA 2MQHA 2Z1CA 3S1QB 2KBNA 2Z4IA 3RNUA 5C4JH 1R9TH 2IT1A 1AZPA 3H3VH 1CA5A 2EY5A 2IWHA 1ASZA 2JA8H 1CSPA 1TS5A 3I4MH 2EJFC 1EOVA 3GTPH 5ELEA 2R7ZB 1A2TA 3CRLC 2OTJA 3HKZB 3CP0A 1EOTA 4HEDA 4S3SA 4XTCS 4DV4Q 1MHWC 1XPUA 3K57A 4Q0FA 3KOJA 3HRZC 3JAMi 4BBSB 4K8IA 4P73A 3TSSA 4YIJA 5GAEC 2UU9Q 1K8GA 4KN7C 1HR0L 2F0IA 1PYBA 2RCFA 3KLWA 3OPOA 4OONA 1BDOA 5CORA 2V1CC 1WD0A 5GQOA 2HHHL 4IOAA 4A3EH 2WIIB 1E1OA 1TWAB 3HZXA 2KEEA 2ZT9C 1QG7A 2ALYB 5EKIA 1SYBA 5AJ3L 3IFTA 2HCIA 3RN2A 1CT1D 4X64Q 4BY1B 2ID0A 3CCLA 5CBAE 3T1YL 3KLSA 4DV5Q 1LV9A 3ULJA 2FMMA 5CGKA 2WB1E 1GJXA 2X6GA 4U68A 1EQRA 5FLMG 4IPGA 2K5QA 1M4VA 2BE5C 5EPLA 4KJNA 3BU2A 4UP8A 5IODA 1VQ4A 2E2JB 2WKCA 2L1BA 1FNVA 3J81E 5C4XB 2MGSA 1IYUA 1DM0B 4WJ4A 1Q1BA 4A3MH 4KHPL 5NUCA 1LACA 1I5FA 1KNEA 2GVAA 1NY4A 5JEAJ 2R93G 3MA2B 1WJJA 4M8AA 1TT2A 4LJZC 4LF8Q 1J8IA 4X3TA 1ILPA 1EYCA 1VQMA 1O7LA 3A7AB 3OHXC 3S1NB 2F3VA 2L11A 2SEBD 5EKLA 5IP7G 1IW7D 2PMZE 2NVYH 4WJWA 3FHWA 4AYBB 1PMRA 2VQEL 1TWGH 3KJOA 4A3KB 4JI5Q 2PNHA 3UDFA 5E4XA 1WFQA 3M3YB 4WORA 2WAQB 1B8AA 1F2LA 1G291 1HZBA 4RH6A 5M3FH 3C1FA 2F0GA 3S1MH 1C9OA 1MGSA 5M3MH 4Y7NH 2RSNA 3TP5A 1SMYC 3ULLA 1S40A 4G57A 5GAHC 2F0KA 3MFGA 1VMCA 3K58A 3T1HL 1KLGD 1SBBB 2K5WA 4NXNQ 1OXTA 5HURA 4LF7Q 3H3VI 1S5FD 1GUWA 2CH4W 3VYTA 1LTGD 5FJ8H 3V05A 4G7ZC 1K0SA 2EOTA 1V43A 4LUOA 4OELB 1UWVA 2ZJPA 1Z7TA 2F4VQ 1D6EC 4BWGB 3PUYA 4DK1A 1PH6A 4A3LG 3FVQA 3I73A 2NVXB 1EWCA 5I6WA 4V0BA 3CMAA 3L7ZC 1BCPC 4KHVA 1EQVA 5G3LF 2B2WC 4A3CG 1JWSD 4FXGC 2XWBB 3MFYA 5T1GA 1PTOB 4DNIA 1F2MA 3AFPA 2PI2E 3TP7A 1K0RA 4XT1B 4BBRG 2B2TC 1EIYB 3I3CA 1PH4A 3S2DB 3T16A 3FDTA 1XMQL 1CKNA 4KKSA 3UI2A 3GTGB 4GKKQ 3SK4A 3A5UA 5A35A 2XGTA 4XQQA 2B2YA 2RDHA 4GLVB 4DR5Q 5KYLA 1WTQA 1CKOA 4NXMQ 4K0KQ 3I4OA 4PZ7A 1E0BA 1ESRA 1FJGQ 2M00A 4JK1C 5JEAH 5CMDA 4PMBA 3GTJB 4OO1G 3S15B 1KXLA 4EQPA 2E2DC 2JA5G 3NELA 4OIKA 1V1PA 1D2BA 4X6AH 5LMNQ 2E2HH 1B3QA 3CW2C 3HOVG 4A3DH 2AHOB 2IHEA 3MZ5A 1N8RC 3E9HA 3EN2A 3CMEA 1Z9FA 1X3QA 2PYKA 3OW2A 1HA5A 1JR0D 1SXTA 5EAYA 1VQ6A 1CM9A 1OXXK 3RLNA 4R4CA 2Y0SE 2B3GA 3I72A 3BG3A 3K81C 4BA2I 3CD6A 2I0QA 1A0IA 5BR8Q 2B8FA 5DNFA 1SYEA 3KF8A 3VR3A 1SNOA 2R7ZG 2NZ1D 5M5XH 3HKZG 4BXXG 4MNOA 1BBWA 4KHZA 1OTCA 2RVLA 3RR5A 3SGIA 3SDZA 1X3EA 3I4LA 1QOHA 5LMUL 4BBSG 1HZAA 3NE5B 5LMNW 4AQYQ 1M1KC 1MKHA 1TS4A 1TXYA 4L5SA 3WWVA 4DK0A 1VQCA 1LO5D 1GOZA 3F2BA 3S17B 4O42A 5CV6A 4EX5A 4LFBQ 3HOUH 1YNNC 1LT5D 4CKBA 3LWUA 3ONAB 3IRBA 4OX9Q 3QR8A 3EQLC 3PQIA 1L0WA 5FLXE 2PMZB 1NR2A 4NDXA 4YWMA 3MEFA 3S2HH 2AWOA 1N36L 4JI3Q 3KK7A 3FKIB 3IKJA 5J22A 4BY1G 1YNJC 2KJXA 4OWTB 3GTMB 5C6AA 4LW1A 5IP9H 3TP8A 2CVRA 1GO3E 3ZYYX 3RMHA 4RAUC 1HZ9A 4JBMA 2QW7A 1KAWA 2Z6KA 4L5QA 2A5HA 5FO8B 4FYDA 2BDOA 2KQ3A 4MIUA 4JI4Q 2IJ0A 5IGFA 5M5WB 4IURA 2B2UA 1AFPA 5C4XG 1SYFA 1G6ZA 1RL2A 1O80A 3J7A5 1BF4A 4PMWA 3SK5A 4KI0A 5C0XJ 2K05A 5DEHA 3SE0A 3DXJC 3GTOB 4K8JA 1PH5A 1HHVA 3JAME 4JI6Q 4R1JA 3LWEA 1SE3A 3OWFA 2OXPA 5KNDA 3BYYB 1CKNB 1IYVA 3CPFA 3SK8A 2KCNA 2JA7B 4FVMA 3ND8A 3GP7A 4XIGS 4AYBG 4JG2A 1R9TB 4WRDA 3BDOA 3HOYH 1DGSA 1V1OA 3L0OA 4A3KG 2JA8B 1PDQA 4L8JA 3I4MB 5FO7B 2Z9HA 1D1IA 3ER0A 1OO9B 2EXZA 2WAQG 1JOOA 1X3GA 1OXVA 3U4ZA 2F0JA 2UUCL 5A2QE 2PQEA 4PZ8A 3KYHC 1VQKA 3OYYA 1TVXA 4RMFA 4DV2L 1V1PB 1F9QA 5JJKA 1A6XA 3MHBA 4ZUJA 3ZJYC 4HAEA 2IPKD 4A76A 1EEFD 4B3TL 4OO1I 1LTLA 2YTVA 4YY3Q 5IWAQ 1Q81C 1Q8KA 1UE6A 1X54A 2F0VA 3SVMA 1N32Q 4LF5Q 4XYOA 2B2VC 3VA5A 4R4OA 5BN4A 1PTOD 4HJ9A 4UHVA 1CSQA 2NVTH 4DR2L 1TY2A 3KF8B 4X65Q 4B3RL 1HNZQ 2EYOA 3J7YW 4CJ1B 2XRQD 2CH4A 4PQXA 5E7NA 1PH1A 1KNAA 3PV0A 3FRPB 4K2KA 3ULPA 4QIWE 3GD7A 5M9OA 2B63H 1R4PB 2I5HA 1VQFA 2UXCQ 1WTXA 2NN6I 2KCCA 3BVGA 2MO1A 4DR7L 4IUPA 2Q2HA 4POFA 4F7XA 1CQFA 3NSWA 1WTHA 1S5BD 1F2ZA 4EQOA 2NZHA 3L3OC 3DWAA 2EJMA 2R92B 1T9HA 1YHBA 5C0XH 2F3IA 4LNQA 2ICEC 4X66L 4KD4A 3PO3H 5F2DA 2ZM6Q 1IBLQ 2IY5B 1YHAA 1CHPD 3HOWH 3W5OA 3HOXH 4J15A 3MXPA 1TWGB 1L1OA 1NR4A 3K80C 1I4HA 5K36G 2FHTA 1SNDA 3DWQA 4HR7B 1AE3A 4IO9A 1O78A 1PH2A 1MJEA 4E6IA 4C3HB 4DV6L 1XNRL 1SN8A 4IUTA 3CCSA 5M3FB 4X62L 1X3FA 3A8IE 2VW9A 3S1MB 3K5OA 4DXFA 2MUYA 3DLLA 3S24A 1WTPA 1H95A 1VDZA 4HCEA 1K3RA 1SAPA 2SNMA 3DUZA 1Z47A 3K7AB 1TWFH 3RZOH 5KIXA 1BUVT 2OF1A 4HIOA 1SE2A 2OQ0A 2NZOA 1XNQQ 2UXDQ 4N8FA 4TRDA 2JP1A 1FL0A 2QCPX 2ZJRA 4DAVA 1X32A 5BN5A 3D3RA 4DNRB 1SNMA 4EQ5A 1KDBA 4DV3Q 5ELOA 4OXPA 2SDFA 1KAAA 1KDCA 1ICWA 3KDFA 1NMGA 5FLXL 1HCZA 3PIO3 2X6LA 3U9SA 1JCKB 2UU9L 4LMQD 5M5YB 1GXDC 1HJPA 1NUCA 1X55A 3CCEA 4X3SA 3M4QA 1S72A 5EBCA 2F0TA 2L4NA 2AKWB 5JJZA 4OEMB 3FKIG 1I94Q 1HTPA 4OGQC 2K33A 4KLKA 4RHSA 2M2LA 1Y1WH 1B3AA 2ZTEA 3J80L 1IW7C 2JQOA 4UP9A 2VB3X 4X64L 1MIUA 2YV5A 4EVOA 3TS0A 5ISRA 2ZXOA 4AH6A 4QUFA 2JEAI 4DV5L 1C0AA 1ZEQX 2R7FA 4ZYSA 5D3DA 4LFCL 1EL0A 4A3BB 1KTKA 1UEBA 1KABA 3QOLA 3H6MA 3M9BA 1G2TA 2E2HB 2EYPA 4RG1A 1P16A 1EY9A 5EGTA 3D6CA 1AZQA 1EZ8A 1GVPA 5IT9E 1SFOH 4IUVA 4C56C 3NWTA 3QWNA 2E74C 2A68D 3V96A 1FVIA 3RD4A 4JI2Q 4UY8C 1DXMA 2EYHA 3BZDB 3MXNA 5IYDG 2L12A 1D7QA 1TQOA 2JA7G 1DOLA 1YJ9A 1YNXA 4HJ7A 4LF8L 2HD3A 2O4XA 3VYRA 3AEVA 5A2QL 2GA4B 4ILWA 4K6DA 1YJNA 3NQIA 5IGDA 4KKUA 4L5RC 2JA8G 4R8IA 3I4MG 1KD1C 3A8JE 1PRTF 4R4TA 2LXJA 3M4PA 2DNEA 4A93H 5C44B 2FJ2A 5M5XB 2NYZD 3FP9A 1PLFA 2Z8LA 1IZ6A 4H44C 4F88A 4JI5L 2OWOA 1Y14B 4LF9Q 1L1OB 1K28A 4I7ZC 3KBGA 3CCJA 1HH2P 4QY7A 1K8OA 4FF4A 2XNAC 3BZCA 1GHJA 1ET6A 3H15A 3I70A 3QJYA 4DR3Q 1WTRA 2K14A 4UP7A 3GV3A 1X9NA 3HOUB 3G6EA 3GTKH 2PZUA 4PV1C 1HFGA 1H9SA 1RIPA 1YEZA 3H91A 4LF7L 2JEBI 4JV5Q 3TS2A 4DUYQ 1WCMH 3M4OH 1C48A 1S5DD 2PO4A 3FEWX 1C8CA 2F4VL 4GKJQ 3S2HB 2N8NA 3TP6A 3DEOA 2C9OA 4A3GH 2HUGA 1S4ZA 3F2DA 1XMOQ 1SDFA 2V4DA 3DEPA 4ZLTF 4A3FH 4R4IA 3KDFB 1EEID 1GUOA 1ML0D 3Q22A 1PZJD 2L5TA 1EYAA 4XYQA 2RHSB 2WP8J 3D31A 4KTAA 2FMCA 1PZID 2R92G 1Y8NB 2K4KA 2QGQA 5CYUA 1B9MA 1B4OA 1D5XC 3TEHB 4NXML 5LL6X 4DR5L 3CCRA 3M7NA 2QA4A 1EY7A 2CWAA 1UAPA 3ND9A 1H9KA 3R3OA 4C3JB 4DV1Q 1SE4A 2JA6H 1I6HB 3HOYB 4BY7H 3LNNA 2NWGA 3GTLH 4C3HG 5I2XA 3AB9A 4IFDI 4KKTA 5M3FG 2YU9H 2F0MA 5LMNL 4HJAA 2A1AA 2A19A 2WFWA 1JJ2A 4G4KA 1TWHH 2Z0SA 2MP1A 2K50A 4HMJA 2BDNA 4RKLA 1CKMA 1VQDA 5CV9A 1ET9A 3KLRA 3MXNB 2ENBA 3S9WA 3RZDB 2KA7A 2XIWA 3H94A 3ERSX 1PFNA 5FJ8G 1HZCA 1U4RA 4AIMA 2ATWA 4DUZQ 2PZWA 3NK9A 4V190 2PCFB 3M7GA 3J80c 1I3QH 3GO5A 4RCNA 4DPGA 2VB2X 2CFMA 2J4XA 4H13C 2A6ED 4I7AA 3I91A 5LL6S 5C3EH 2DGYA 1ESFA 1D8LA 2R93H 3P1HA 1K8MA 2PZTA 4TSSA 4G7HC 3G6JB 4ME5A 2PW5A 4CHTB 4AQYL 2YYZA 4DGZA 2A6HD 5IYCH 4K5XA 1F9RA 1I4XA 3MVVA 5EQ0A 1QCBD 2B63B 4LFBL 1BCPF 2HIVA 3RLOA 1Y8OB 3ITPA 2Q8IB 1HUMA 5C4ZA 3FPUB 4HN7A 1UE5A 2K5NA 1DOKA 1VQOA 3J7ZC 1YITA 4OX9L 1STYA 3KLSX 1PVOA 4L5TA 1H9SB 4A75A 4HJ5A 2F0DA 4PMCA 3I55A 4GN4B 1Q1EA 5CR3A 1VF7A 1VQHA 1EY6A 4JI3L 3HOZB 4DXGA 1EY4A 2KHSA 2EE1A 3CCMA 1PFMA 3ERQA 3MEHA 5CC4A 1EUJA 1EU3A 5JEAG 4IOCA 3A74A 4OWWB 5KNCA 1IBMQ 2E2IH 2F0LA 4JI4L 1CTMA 4YWLA 2CQOA 2X69A 3HOXB 3HOWB 4A3BG 3MXUA 1E2WA 5CBEE 2F0WA 4P75A 3PUXA 2SOBA 2BA1A 2C35B 2L9HA 3UDXA 3W3AA 1LTBD 2JYOA 3W1GA 4LUVA 2XVSA 4A3LH 4IPDA 1JJCB 4TKOB 4JI6L 2BH8A 1BNZA 1Y1VB 2PI2A 1U4LA 2QEJC 2SNSA 2K6AA 4N9PA 4GOPA 1ENAA 1Y69U 1QWYA 5LHY1 1PTOC 1MBYA 3BS1A 1HNWQ 5C44G 4G7OC 1QVCA 3T56B 1TWFB 3RZOB 4JI8L 1WTOA 2K52A 2N88A 1VQAA 2QKIC 1MD2D 3PCOB 1N9WA 1D1KA 3CF5A 4DV7Q 2KHJA 2HQLA 3A54A 1K9MC 1EFID 3VYUA 1B2TA 3HOUG 5IGGA 4FF1A 2WB1B 1GKHA 4Y52H 1D5MC 4DR6L 1B50A 4CJ0B 2NN6G 4YY3L 3Q6SA 1SE8A 4P72A 1FR3A 1N32L 4B3MQ 2VNUD 4LF5L 4ZCKA 4K2LA 4GS3A 4GLAC 3S16H 2IX0A 5IP9G 3HOVH 1AP0A 3P20A 5JJLA 1K83H 4BA1I 4X65L 1HA6A 2RKSA 4MZ9A 4A3JB 4DK3C 1HNZL 4WJ3M 3HFZB 1XJVA 4JOIA 5E3FA 3NUCA 2N49A 2G9HD 1YZ6A 1LYLA 3SHLA 3S1RB 4Q5VA 3NWSA 2D5DA 1STGA 3MC0B 4P71A 2UXCL 2ZXRA 5CV7A 1UUPA 2B29A 2R7ZH 3J81L 3I4NB 2BH2A 4K5WA 1JWUD 4IUQA 2CW0D 2PQAA 1A62A 1SFOB 4I65A 2LXKA 4IJHA 4HCSA 3AMUA 2I5LX 4ZRZA 3BDLA 5HGTA 1WOCA 1SYGA 2O2LD 2EYMA 3EIVA 4C3JG 3EBEA 3MAQA 4IZ8A 1N33L 2EXDA 1CQVA 5KGUA 1BVSA 3E5SA 1AEXA 1W3SA 3HOYG 3IAYA 1QNKA 2VUMH 1J9OA 3U50C 5C3XA 1W6JA 1IBLL 4NPSA 2E75C 4JBJA 2DJGC 1XMQQ 1HFNA 1BBUA 2O5IC 3K7UC 4KY6A 1TWAH 1PH9A 5KYIA 1OXUA 1V8QA 1CI3M 3VR4A 3SK6A 2H4OA 4GLXA 3C3LA 4KK7A 2OCEA 3CCVA 3C46A 1AW7A 2HDMA 4DAMA 4DAYA 4GNXA 3A5ZB 1EWHA 2M9VA 1GUTA 5C4JB 4HIMA 1LLRD 2YTXA 1U4PA 3GTPB 1G2SA 2Z6BA 1LTTD 3GTKB 1XTDA 4LUZA 4UPAA 1FGUA 4GOPB 2F0NA 5G3LD 2RCNA 5C4XH 4IJLA 3KFUA 3K5NA 4ZKCB 4DF7A 3VDYA 4A3IH 4DR4L 2UXBQ 3WOFA 2OQKA 1QJOA 3V2TA 1XNQL 3OTOL 2UXDL 3F2UA 2N3SA 3PUZA 4O0AA 2WV6D 4KN4C 4A3GB 1VCIA 3KUPA 2VXWA 3SXHA 4YCVA 4DV3L 2B63G 4YHHQ 4A3EB 3S1NH 3T53B 2K75A 5FKAC 2B2YC 4A3FB 1RF2D 2JE6I 2QILA 4JCVE 1TY0A 3TZDA 4B3SL 4LF6Q 2D2CC 3H3VC 2A68C 4O1NA 4QUCA 1SJHD 4P74A 1EZ6A 4CKEA 4A3KH 4RGOS 2KENA 3NPPA 4JYAQ 3M3YH 1I50H 1F2YA 3J7AV 5IYBH 4K14A 3J81i 4X3UA 2VQFQ 2R7DA 3NTKA 3PUVA 3GTQH 3HOZG 4LF4Q 4PG3A 2JK8A 3S14H 1ZKOA 4CDDC
chains in the Genus database with same CATH topology
1XYIA 2Y0SB 4A3MB 1CK1A 1II3A 2JA6B 1G91A 3C1EA 1RHPA 2F0EA 4BY7B 1STAA 1RODA 1B44D 2J7ZA 3OMGA 4Z9CB 3GTLB 1XTCD 3OOCA 1PZKD 4CBVA 2AUJD 4IUNA 3G7LA 1Q90A 2PW7A 1TWHB 4BS9A 1B9NA 3Q23A 2NVYB 2RBMA 1FYCA 4M1UB 2OEOA 4JBWA 3SR1A 1LT4D 1SSOA 2K32A 2BA0A 5M3MB 4Y7NB 4OL7A 2A69D 3D4RA 5IGCA 1I3QB 1U9RA 1DCZA 3VR2A 1QNUA 5C3EB 3LX0A 2F0QA 4DA2A 3A7LA 1ZXTA 1HQRD 2RQXA 5C5MA 1IKLA 3A56A 3EROA 1OXSC 4R9WA 1Q3LA 2B2UC 2RA4A 4QMGA 1Q8IA 3CHBD 1MSGA 3J7AF 3NHHA 1KLUD 4RWSC 2MHVA 1BBXC 1SNCA 3L9AX 4R8NA 1ENCA 3CKIB 4IQZA 2E2IB 1X3PA 3TBIB 2EYJA 4XXEA 1JORA 3I8ZA 4IFDG 5J1ZA 2NB0A 5CV4A 4UDUC 2A74C 2EVBA 2F0SA 1QILA 4C1NI 4B08A 1S5CD 5E4WC 3JAML 2WINB 5I6YA 1I4QA 3T4AC 1A3VA 3OSOA 3P75A 4WFN3 5EKKA 2D9UA 1ILQA 3HS0C 1WD1A 4A3DB 1A2UA 1PRTB 5I4DA 2A6EC 1XWEA 1RJTA 2IL8A 2EYLA 1DONA 1JOQA 5C0XI 2F0UA 4ZQ3A 2A6HC 2BOSA 1D5ZC 2QDBA 1SJED 2H1EA 2B2WA 4CJ2C 4QIWB 1H9JA 2G9DA 4P2CB 1JC7A 1CFMA 1LTAD 1PYWD 3QB3A 1E2ZA 2B2TA 1JWMD 1FD7D 3S16B 3M85A 3RLFA 4RFBA 2EZVA 4DU9A 2DNCA 5ELBA 4RA8A 1DZ1A 4KY5A 1A3TA 1VF5C 2LFNA 1TKWB 4HMIA 3DHQA 2FINB 2F0HA 2KOLA 4X3KA 3EFXD 2JSOA 5J39A 2K5DA 1LTRD 3GQBA 4KY7A 1EY5A 2I46A 5CV8A 3M4YA 4DNTB 3RUZA 2TMPA 3MWYW 1T5XD 2R61A 4U673 2KEDA 2NTTA 3T13A 2VUMB 3OIQA 1WVLA 2IX1A 4NW2A 3O13A 2HDLA 3Q24A 1A15A 1FGBD 1LTSD 2XRSD 2ICIA 4KJOA 5ELDA 5I9PA 4ID6A 4XDXA 5IOCA 4ZUIA 4ZK9B 1JICA 4B9XA 1PXUA 5DM63 2EYFA 4L6TB 3D4DA 1RTOA 2K01A 1LABA 1NSNS 3R8BA 4CGYB 2N55A 3BYTB 4A3IB 1SEBD 3NBIA 1HPCA 1STNA 2OT2A 3TDQA 4QCLA 1DJRD 3VYSA 1F9SA 1ZYRD 4RGMA 1SNQA 4K6LA 4DN4M 2EY6A 5D65A 1CZGA 2NVTB 1BCPB 1GUGA 2CW0C 2NBFA 4J1MA 4XQNA 1I50B 5IIFA 4RCOA 3GTQB 1FNUA 1E2VA 3AU7A 1O7YA 5FOBB 3S14B 2F03A 2O5JC 1BQQT 3P7JA 2JXMB 1TS3A 1Y8PB 2MJ8A 3OMCA 2F0PA 3EVQA 4FXDA 1WTWA 1F77A 1L0XB 1AN8A 1BO0A 4KD3A 1RD9D 4J8QA 1BR9A 4RGTA 4N9TA 3PO2B 4OHJA 3PO3B 1PRTD 5IT9L 1I6VC 3BVZA 5KRUA 3EA6A 1H9RA 3C2PA 1CA6A 2MPMA 2PNRC 3OWEB 3DM1A 4C1NK 1LT3D 5T1IA 1CZWA 2K04A 1PTOF 2B2VA 3R2IA 4XQJA 4RGNA 5DM73 1GHKA 1M8AA 2Q8RE 3A55A 1Q12A 1DYQA 1XX8A 1RTNA 1O7ZA 2LY7A 2J0TD 1W6KA 3FPPA 1EYDA 4HTHA 4H7BA 2NVQB 4L63B 5IGEA 3H09A 1QB5D 4OIJA 2EY1A 4QF4A 1WTVA 1UNSA 4OO1H 1BXTA 4NKLA 2BE5D 4FXKC 4ZKBB 2AWNA 1KDAA 5KNBA 2NUCA 3TZUA 4FP5D 1Y1WB 3WDNA 1I4PA 3D4WA 2A73B 5EPKA 1TS2A 4ODGA 2E76C 1I4RA 3W2DA 2K03A 1GUNA 4F87A 1EY0A 4H0LC 2FFKB 2A69C 2EJGC 3BDCA 2NN6H 5I9OA 1HQMC 3FMCA 5ELCA 2LS01 5JVG3 1C4QA 1TU2B 1G8ZD 5E1FA 1SMYD 3T51B 4UAIA 1IHZA 4A93B 1JOKA 1NAPA 2WKDA 3KBXA 1DOMA 2AQ3B 5COYA 5TSSA 1U4MA 3J80E 2CQAA 1QE6A 1ONLA 1EU4A 2NTSA 1XXGA 4MHEA 3HGBA 5EBDA 2TSSA 1SYDA 3IL8A 4FF2A 2ZXPA 4KV6A 4HSVA 1BCPD 2LMCB 5D14A 2K7VA 1SYCA 5C5LA 3N6RA 2AQ2B 2I07B 3NQTA 1WCMB 3M4OB 4DAPA 2B39A 3A8KE 3PMFA 1L0YB 4FF3A 1IKMA 2R6GA 2RDFA 2L55A 4C3IB 2CHBD 3CRKC 3X3MA 4PNYA 3H0GB 3D8GA 1UEAB 2F0FA 4IUUA 4RKBA 1MI2A 5C3WA 4KMUC 2B8GA 3QOJA 2KVMA 5JPNC 1PFBA 2EDGA 3QIAA 3TMEA 1B53A 1HUNA 2EY2A 2L0CA 1VMPA 5JVH3 3K59A 4IALA 2F4IA 1EIHA 4FO2A 2RSOA 1LTID 5C0XG 1EY8A 1B1ZA 2IW3A 3PIP3 3OIPA 3K5LA 2DN8A 1FNWA 2QF7A 1DD2A 3NTHA 2EPBA 4IN3A 2HQEA 2KECA 3CU7A 3NBHA 2DY8A 1LT6D 3VA7A 3NXWA 1MSHA 1Z6HA 2YU9B 4NP5A 1GUSA 1HTLD 3URYA 1T5EA 1H9MA 3PUWA 3SEBA 1NCVA 2AUKA 1PTOH 5AFWA 1CHQD 4HSPA 3CQZB 3MTSA 3VR6A 4FNFA 2XN9C 1A3UA 3X3NA 4IFDJ 1EQTA 1YNND 2R3ZA 4ULLA 1JB3A 1STBA 3EJIA 3WOEA 4TQUS 5BN3A 1I4GA 1TR5A 2R93B 2DY7A 2BCOA 1STHA 4DFAA 2F1MA 5JAVA 3HG9A 1YNJD 3R93A 2WACA 3OW7A 3I90A 1EIGA 3HP3A 2D62A 2F3WA 4EGVA 3Q0AA 5K36H 2RDGA 1F9PA 2XWJB 4LAAA 4QB4A 4CKCA 3MXGA 1BOSA 4RHRA 2Z4HA 3R2TA 2AQ1B 3QG1A 3QO2A 1TIID 5D3IB 5C4HA 4ZAIA 4EQNA 5JPMC 2C5CA 3BVMA 3NTIA 4LK1C 1HXYD 4J6HA 1STEA 2F0OA 2Q8TA 3U9OA 5ELFA 1HRJA 3K0YA 4GZYC 3TN2A 4MN3A 3VR5A 1ZYRC 3E0JA 1R4QB 3HEJA 4XT3B 3IFDA 1IL8A 2PPBC 3N52A 4BBRB 3K5MA 5KEEA 5FO9B 5IGBA 3DMUA 1JE4A 4B9WA 5I2YA 4C2MB 3DWPA 4IFDH 4NMZA 5CV5A 5DAUA 1TWCB 2K28A 3NP8A 5FK9C 2XSCA 2HCCA 1RCVD 1SNPA 4ABNA 2JA5B 1S5ED 5K5PA 1RDPD 1RKNA 3HOVB 4F8MA 4C3IG 1K83B 1ENFA 1PRTC 3GV6A 2K1BA 5EPJA 2IX3A 2LKVA 3D6WA 5EJWA 3E6ZX 5JOBA 2KUMA 1JQYD 3K6OA 4K5VA 2Z1CA 3S1QB 2Z4IA 2IT1A 1AZPA 1CA5A 2EY5A 2IWHA 1TS5A 2EJFC 5ELEA 2R7ZB 1A2TA 3CRLC 3HKZB 1EOTA 4HEDA 4S3SA 4XTCS 3K57A 4Q0FA 3HRZC 4BBSB 4K8IA 3TSSA 4YIJA 4KN7C 2F0IA 3OPOA 1BDOA 5CORA 1WD0A 2WIIB 1TWAB 3HZXA 2KEEA 2ZT9C 1QG7A 5EKIA 1SYBA 3IFTA 2HCIA 1CT1D 4BY1B 2ID0A 5CBAE 3KLSA 1LV9A 2FMMA 5CGKA 1GJXA 2X6GA 4U68A 2K5QA 1M4VA 2BE5C 5EPLA 4KJNA 5IODA 2E2JB 2WKCA 2L1BA 1FNVA 3J81E 5C4XB 2MGSA 1IYUA 1DM0B 1Q1BA 5NUCA 1LACA 1KNEA 5JEAJ 3MA2B 4M8AA 1TT2A 4LJZC 1J8IA 4X3TA 1ILPA 1EYCA 1O7LA 3A7AB 3OHXC 3S1NB 2F3VA 2L11A 2SEBD 5EKLA 1IW7D 4WJWA 4AYBB 1PMRA 4A3KB 5E4XA 3M3YB 4WORA 2WAQB 1F2LA 1G291 4RH6A 3C1FA 2F0GA 1MGSA 2RSNA 3TP5A 1SMYC 4G57A 2F0KA 3MFGA 1VMCA 3K58A 1KLGD 1SBBB 2K5WA 1OXTA 5HURA 1S5FD 1GUWA 3VYTA 1LTGD 4G7ZC 3V05A 2EOTA 1V43A 1Z7TA 1D6EC 4BWGB 3PUYA 4DK1A 3FVQA 3I73A 2NVXB 1EWCA 5I6WA 4V0BA 3L7ZC 1BCPC 4KHVA 1EQVA 5G3LF 2B2WC 1JWSD 4FXGC 2XWBB 3MFYA 5T1GA 1PTOB 1F2MA 3TP7A 4XT1B 2B2TC 3I3CA 3S2DB 3T16A 3FDTA 4KKSA 3UI2A 3GTGB 3SK4A 5A35A 4XQQA 2B2YA 2RDHA 1WTQA 5KYLA 1E0BA 1ESRA 2M00A 4JK1C 5JEAH 5CMDA 4PMBA 3GTJB 4OO1G 3S15B 4EQPA 2E2DC 4OIKA 1V1PA 1D2BA 3MZ5A 1X3QA 2PYKA 1HA5A 1JR0D 1SXTA 1CM9A 1OXXK 3I72A 3BG3A 4BA2I 2B8FA 5DNFA 1SYEA 3KF8A 3VR3A 1SNOA 2NZ1D 4KHZA 2RVLA 3SDZA 3I4LA 1QOHA 3NE5B 1TS4A 4DK0A 1LO5D 1GOZA 3S17B 4O42A 5CV6A 1YNNC 1LT5D 4CKBA 3LWUA 3ONAB 3EQLC 5FLXE 2PMZB 1NR2A 4NDXA 2AWOA 3KK7A 3FKIB 3IKJA 5J22A 1YNJC 2KJXA 3GTMB 5C6AA 3TP8A 2CVRA 3ZYYX 3RMHA 4RAUC 2A5HA 5FO8B 4FYDA 2BDOA 2KQ3A 4MIUA 2IJ0A 5IGFA 5M5WB 4IURA 2B2UA 1AFPA 1SYFA 1G6ZA 1O80A 1BF4A 4PMWA 3SK5A 4KI0A 5C0XJ 2K05A 5DEHA 3SE0A 3DXJC 3GTOB 4K8JA 1HHVA 3JAME 3LWEA 1SE3A 3OWFA 2OXPA 5KNDA 3BYYB 1IYVA 3SK8A 2KCNA 2JA7B 4FVMA 3ND8A 3GP7A 4XIGS 1R9TB 4WRDA 3BDOA 1V1OA 2JA8B 1PDQA 4L8JA 3I4MB 5FO7B 1D1IA 1OO9B 2EXZA 1JOOA 1OXVA 2F0JA 5A2QE 2PQEA 1TVXA 1V1PB 1F9QA 1A6XA 3MHBA 4ZUJA 4HAEA 2IPKD 1EEFD 4OO1I 2F0VA 3SVMA 4XYOA 2B2VC 3VA5A 5BN4A 1PTOD 1TY2A 2EYOA 3J7YW 4CJ1B 2XRQD 4PQXA 1KNAA 3PV0A 3FRPB 4K2KA 3GD7A 5M9OA 1R4PB 1WTXA 2NN6I 2KCCA 3BVGA 4IUPA 4F7XA 1CQFA 3NSWA 1S5BD 1F2ZA 4EQOA 3L3OC 3DWAA 2EJMA 2R92B 5C0XH 2ICEC 4KD4A 5F2DA 1CHPD 3MXPA 1TWGB 1NR4A 1I4HA 5K36G 2FHTA 1SNDA 3DWQA 4HR7B 1O78A 4E6IA 4C3HB 4IUTA 5M3FB 3A8IE 3S1MB 3K5OA 4DXFA 2MUYA 1WTPA 1VDZA 4HCEA 1SAPA 2SNMA 3DUZA 1Z47A 3K7AB 5KIXA 1BUVT 2OF1A 1SE2A 4TRDA 2JP1A 2QCPX 4DAVA 1X32A 5BN5A 3D3RA 4DNRB 1SNMA 1KDBA 2SDFA 1KAAA 1KDCA 1ICWA 5FLXL 3PIO3 1HCZA 2X6LA 3U9SA 1JCKB 4LMQD 5M5YB 1GXDC 1NUCA 4X3SA 5EBCA 2F0TA 2L4NA 5JJZA 1HTPA 4OGQC 2K33A 4RHSA 2M2LA 1B3AA 3J80L 1IW7C 2VB3X 4EVOA 5ISRA 2ZXOA 4QUFA 2JEAI 1ZEQX 4ZYSA 5D3DA 1EL0A 4A3BB 1KTKA 3QOLA 1KABA 1G2TA 3H6MA 2E2HB 2EYPA 1EY9A 5EGTA 3D6CA 1AZQA 1EZ8A 5IT9E 4IUVA 4C56C 3NWTA 3QWNA 2E74C 2A68D 3V96A 3RD4A 1DXMA 2EYHA 3BZDB 3MXNA 2L12A 1TQOA 1DOLA 2O4XA 3VYRA 5A2QL 2GA4B 4ILWA 4K6DA 3NQIA 5IGDA 4KKUA 4R8IA 3A8JE 1PRTF 2DNEA 5C44B 2FJ2A 5M5XB 2NYZD 1PLFA 2Z8LA 4H44C 4F88A 4I7ZC 3KBGA 1K8OA 4FF4A 2XNAC 1GHJA 1ET6A 3I70A 3QJYA 1WTRA 3GV3A 3HOUB 2PZUA 4PV1C 1HFGA 1H9SA 3H91A 2JEBI 1C48A 1S5DD 2PO4A 3FEWX 1C8CA 3S2HB 3TP6A 3DEOA 2C9OA 2HUGA 1S4ZA 1SDFA 2V4DA 3DEPA 4ZLTF 1EEID 1GUOA 1ML0D 3Q22A 1PZJD 2L5TA 1EYAA 4XYQA 2WP8J 3D31A 4KTAA 2FMCA 1PZID 1Y8NB 5CYUA 1B9MA 1B4OA 1D5XC 5LL6X 3M7NA 1EY7A 1UAPA 3ND9A 1H9KA 3R3OA 4C3JB 1SE4A 1I6HB 3HOYB 3LNNA 2NWGA 4C3HG 5I2XA 3AB9A 4IFDI 4KKTA 2F0MA 4G4KA 2MP1A 4HMJA 2BDNA 4RKLA 5CV9A 1ET9A 3KLRA 2ENBA 3S9WA 3RZDB 2KA7A 2XIWA 3H94A 1PFNA 1U4RA 2PZWA 3NK9A 4V190 2PCFB 3M7GA 3GO5A 4RCNA 2VB2X 4H13C 2J4XA 2A6ED 3I91A 5LL6S 1ESFA 3P1HA 1K8MA 2PZTA 4TSSA 4G7HC 3G6JB 4ME5A 2PW5A 4CHTB 2YYZA 4DGZA 2A6HD 4K5XA 1F9RA 1I4XA 3MVVA 5EQ0A 1QCBD 2B63B 1BCPF 1Y8OB 3ITPA 2Q8IB 1HUMA 5C4ZA 3FPUB 4HN7A 1DOKA 1STYA 3KLSX 1H9SB 2F0DA 4PMCA 1Q1EA 5CR3A 1VF7A 1EY6A 3HOZB 4DXGA 1EY4A 2KHSA 2EE1A 1PFMA 3ERQA 3MEHA 5CC4A 1EU3A 5JEAG 5KNCA 2F0LA 1CTMA 3HOWB 2X69A 3HOXB 3MXUA 1E2WA 5CBEE 2F0WA 3PUXA 2SOBA 2BA1A 2L9HA 3W3AA 1LTBD 2JYOA 2XVSA 4TKOB 1BNZA 1Y1VB 1U4LA 2QEJC 2SNSA 2K6AA 4N9PA 1ENAA 1Y69U 1QWYA 5LHY1 1PTOC 1MBYA 3BS1A 4G7OC 3T56B 1TWFB 3RZOB 1WTOA 2N88A 2QKIC 1MD2D 1D1KA 3A54A 1EFID 3VYUA 1B2TA 5IGGA 4FF1A 2WB1B 1D5MC 1B50A 4CJ0B 2NN6G 3Q6SA 1FR3A 2VNUD 4K2LA 2IX0A 1AP0A 3P20A 4BA1I 1HA6A 2RKSA 4A3JB 5E3FA 3NUCA 2G9HD 3SHLA 3S1RB 4Q5VA 3NWSA 2D5DA 1STGA 3MC0B 2ZXRA 5CV7A 1UUPA 3J81L 3I4NB 4K5WA 1JWUD 4IUQA 2CW0D 1SFOB 4I65A 4HCSA 3AMUA 5HGTA 3BDLA 4ZRZA 2O2LD 1SYGA 2EYMA 4C3JG 3MAQA 4IZ8A 1CQVA 5KGUA 3E5SA 1AEXA 3IAYA 1QNKA 1J9OA 5C3XA 1W6JA 2E75C 1HFNA 2O5IC 4KY6A 5KYIA 1OXUA 1V8QA 1CI3M 3VR4A 3SK6A 2H4OA 3C3LA 4KK7A 3C46A 1AW7A 2HDMA 4DAYA 1EWHA 2M9VA 1GUTA 5C4JB 1LLRD 1U4PA 3GTPB 1G2SA 1LTTD 3GTKB 2F0NA 5G3LD 3K5NA 4ZKCB 4DF7A 3WOFA 1QJOA 3V2TA 3F2UA 3PUZA 2WV6D 4KN4C 4A3GB 1VCIA 3KUPA 2VXWA 3SXHA 4A3EB 3T53B 5FKAC 2B2YC 4A3FB 1RF2D 2JE6I 2QILA 1TY0A 3TZDA 2D2CC 3H3VC 2A68C 4O1NA 4QUCA 1SJHD 4CKEA 1EZ6A 4RGOS 3NPPA 1F2YA 3J7AV 4K14A 4X3UA 3NTKA 3PUVA 1ZKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q L;  5IT9 L;  5FLX L;  3J7A V;  5LL6 X;  3JAM L;  3J80 L;  3J81 L; 
#chains in the Genus database with same CATH topology
 1XYI A;  2Y0S B;  1XPR A;  1L2F A;  3HOW G;  3HOX G;  4A3M B;  1CK1 A;  4JI7 Q;  1II3 A;  3B6Y A;  2JA6 B;  3L2P A;  1G91 A;  3C1E A;  1RHP A;  2F0E A;  4BY7 B;  4MTN A;  1N34 Q;  1STA A;  1ROD A;  1B44 D;  2J7Z A;  3E0E A;  3GDE A;  3OMG A;  1KHI A;  4Z9C B;  3GTL B;  1XTC D;  2GVB A;  3OOC A;  2NVX H;  1PZK D;  4CBV A;  2AUJ D;  3PO2 H;  4IUN A;  3G7L A;  1Q90 A;  2PW7 A;  3KF6 A;  1TWH B;  1Y1V G;  2UUB Q;  4BS9 A;  4HJ8 A;  1B9N A;  3Q23 A;  2NVY B;  2PQA B;  2RBM A;  1FYC A;  4M1U B;  4JI2 L;  2OEO A;  4JBW A;  3SR1 A;  1LT4 D;  4DV0 Q;  1SSO A;  2GN5 A;  2H5X A;  1WI5 A;  2K32 A;  2BA0 A;  3S2D H;  1VQJ A;  5M3M B;  4Y7N B;  4OL7 A;  5GAD C;  2A69 D;  3D4R A;  5IGC A;  1I3Q B;  3GTG H;  1AE2 A;  1U9R A;  1DCZ A;  3VR2 A;  1QNU A;  5C3E B;  3LX0 A;  2F0Q A;  4QL5 A;  2D0O A;  2WB1 G;  4DA2 A;  3A7L A;  1ZXT A;  1HQR D;  4DAY B;  4GNX B;  2RQX A;  4O2D A;  5C5M A;  3A0J A;  1IKL A;  1YBY A;  2YTY A;  4GN5 A;  1NTG A;  1VQ8 A;  3J81 c;  2Z6K C;  3A56 A;  3ERO A;  1OXS C;  4R9W A;  4DV4 L;  1Q3L A;  1WYD A;  2B2U C;  2NVQ H;  5HGQ A;  4DV2 Q;  4JV5 L;  2RA4 A;  4QMG A;  2F52 A;  4DUY L;  1XPO A;  1Q8I A;  3CHB D;  4A3J G;  2Q2I A;  1MSG A;  4GKJ L;  3J7A F;  3NHH A;  1ASY A;  1KLU D;  4JI1 Q;  4RWS C;  2MHV A;  1BBX C;  1SNC A;  3L9A X;  4R8N A;  1ENC A;  3CKI B;  4IQZ A;  2E2I B;  1X3P A;  3TBI B;  1XMO L;  2EYJ A;  4XXE A;  1JOR A;  3JC6 6;  3TRZ A;  3I8Z A;  3I4N G;  4DR2 Q;  3G48 A;  4IFD G;  5J1Z A;  2NB0 A;  5CV4 A;  4UDU C;  2A74 C;  3KJP A;  2EVB A;  2F0S A;  1UE1 A;  1QIL A;  4QJF A;  4C1N I;  4B08 A;  5J3B A;  4LFA Q;  1S5C D;  2AMC B;  5E4W C;  3JAM L;  4JI0 Q;  2WIN B;  5I6Y A;  1I4Q A;  3T4A C;  1A3V A;  3OSO A;  3P75 A;  4WFN 3;  5EKK A;  3J81 j;  2D9U A;  4DKA C;  1ILQ A;  3HS0 C;  4GN3 B;  1WD1 A;  2WAQ E;  4A3D B;  1A2U A;  4DV1 L;  5GRO A;  1PRT B;  1NE3 A;  5I4D A;  2A6E C;  1XWE A;  5IE8 A;  1RJT A;  2IL8 A;  2EYL A;  1DON A;  1V1Q A;  4QGU A;  3Q8D A;  1JOQ A;  5C0X I;  2F0U A;  4ZQ3 A;  3STB D;  2K5V A;  2A6H C;  2BOS A;  1KQS A;  1D5Z C;  3I56 A;  3PIP A;  1IBK Q;  4ME3 A;  2QDB A;  1SJE D;  2H1E A;  3KF6 B;  2B2W A;  4JPB W;  4CJ2 C;  4QIW B;  1H9J A;  1X6O A;  2G9D A;  1EIF A;  4P2C B;  1JC7 A;  1CFM A;  2ZJQ A;  3E9I A;  3E3X A;  1LTA D;  1EWI A;  1PYW D;  1VQ7 A;  1GM5 A;  3QB3 A;  4DV6 Q;  1E7Z A;  1E2Z A;  2B2T A;  3G4S A;  1JWM D;  1FD7 D;  3S16 B;  3M85 A;  3RLF A;  4A3G G;  1KRS A;  4RFB A;  2EZV A;  4DU9 A;  2DNC A;  2I5M X;  5ELB A;  4RA8 A;  4DK6 C;  1DZ1 A;  4KY5 A;  4A3E G;  1A3T A;  3UDI A;  4NXN L;  1VF5 C;  2JA7 H;  2LFN A;  1TKW B;  4HMI A;  4A3F G;  3DHQ A;  2HT1 A;  1J5E Q;  2FIN B;  2EIF A;  2F0H A;  2KOL A;  2FXQ A;  1V9P A;  4X3K A;  3EFX D;  2JSO A;  5J39 A;  4C3I H;  2K5D A;  3PF4 A;  3J80 i;  1LTR D;  4DR1 Q;  3GQB A;  3K0X A;  2VL6 A;  3H0G H;  1O7I A;  4KY7 A;  1EY5 A;  2I46 A;  1L1O C;  5CV8 A;  3M4Y A;  4QQB X;  2Y0S G;  4DNT B;  3RUZ A;  4A3M G;  2TMP A;  3MWY W;  1T5X D;  2R61 A;  2JA6 G;  4U67 3;  2KED A;  2NTT A;  3T13 A;  4BY7 G;  2VUM B;  3I7F A;  1VQG A;  1JT8 A;  1IBM L;  3OIQ A;  4FDB A;  4GKK L;  1WVL A;  2IX1 A;  1YVC A;  1HNX Q;  4NW2 A;  3O13 A;  4K0K L;  1SRO A;  2HDL A;  3Q24 A;  1A15 A;  3CXC A;  1FGB D;  1LTS D;  2XRS D;  2CCZ A;  2ICI A;  4KJO A;  1FJG L;  5ELD A;  4PZ6 A;  5I9P A;  4ID6 A;  1KC8 C;  4XDX A;  5IOC A;  1C7Y A;  4ZUI A;  4ZK9 B;  1JIC A;  4B9X A;  1PXU A;  5DM6 3;  2EYF A;  4L6T B;  4LFC Q;  3D4D A;  1RTO A;  2K01 A;  3PIO A;  3AQQ A;  1JJG A;  1LAB A;  5M3M G;  1HNW L;  1NSN S;  3R8B A;  1M90 C;  4CGY B;  2N55 A;  3BYT B;  4A3I B;  5FLX c;  1SEB D;  3NBI A;  1HPC A;  1STN A;  5C3E G;  2OT2 A;  3U58 A;  1PH3 A;  3TDQ A;  1YHQ A;  4QCL A;  3CQZ H;  1DJR D;  4YWK A;  4DV7 L;  1VS0 A;  5FLM H;  2R92 H;  1QVF A;  2E5L Q;  3VYS A;  1F9S A;  1ZYR D;  5IYC G;  4RGM A;  1SNQ A;  3TQY A;  3NEM A;  4K6L A;  5BR8 L;  4DN4 M;  2EY6 A;  4POG A;  2UUA Q;  5D65 A;  1CZG A;  2NVT B;  1BCP B;  2DUD A;  1GUG A;  2CW0 C;  1W2B A;  3UE0 A;  2NBF A;  4J1M A;  3D0F A;  4YCU A;  4XQN A;  1KIX A;  1I50 B;  3JAM c;  4B3M L;  4C3H H;  5IIF A;  2ASB A;  3PGZ A;  4RCO A;  3GTQ B;  1FNU A;  1E2V A;  4TVA B;  3AU7 A;  1O7Y A;  2VZA A;  5FOB B;  5IP7 H;  3S14 B;  1PFS A;  4LWC A;  2F03 A;  2O5J C;  1BQQ T;  2CWP A;  3P7J A;  2JXM B;  1TS3 A;  2KCM A;  1Q7Y C;  3K7A H;  1Y8P B;  2MJ8 A;  3OMC A;  2F0P A;  3EVQ A;  4FXD A;  4CDE C;  1WTW A;  1F77 A;  2L15 A;  1L0X B;  1NMF A;  1AN8 A;  1BO0 A;  2Q2U A;  1QUQ A;  4KD3 A;  5JJI A;  1RD9 D;  4J8Q A;  1BR9 A;  4RGT A;  1HR0 Q;  3CPW A;  4N9T A;  3PO2 B;  1IYJ B;  4OHJ A;  3PO3 B;  1PRT D;  5IT9 L;  1I6V C;  3BVZ A;  2HHH Q;  5KRU A;  3EA6 A;  2MFI A;  1H9R A;  1S3O A;  4OWX B;  1SRU A;  3C2P A;  1CA6 A;  2MPM A;  1NNX A;  4A3D G;  5AJ3 Q;  2RHQ B;  2PNR C;  5M5Y H;  3OWE B;  3DM1 A;  2DJF C;  3CC2 A;  4C1N K;  1U0L A;  3T1Y Q;  1LT3 D;  5T1I A;  1PA6 A;  1CZW A;  4A3C H;  2K04 A;  1PTO F;  2B2V A;  3R2I A;  4XQJ A;  1VQ9 A;  4RGN A;  2ES2 A;  5DM7 3;  1GHK A;  1M8A A;  2Q8R E;  3A55 A;  1HR0 W;  1Q12 A;  4KHP Q;  4BBR H;  1DYQ A;  1XX8 A;  1RTN A;  1O7Z A;  2LY7 A;  2J0T D;  1W6K A;  1Q82 C;  3FPP A;  3I2Z A;  1SR3 A;  4A3B H;  1EYD A;  4HTH A;  4C2M H;  1VQP A;  4H7B A;  4MTK A;  2NVQ B;  2MO0 A;  4L63 B;  2UXB L;  1TWC H;  5IGE A;  1G51 A;  3UE1 A;  3H09 A;  1QB5 D;  2VQE Q;  3BZK A;  4OIJ A;  5IWA L;  4IPH A;  1PH7 A;  2EY1 A;  4QF4 A;  1WTV A;  1UNS A;  4OO1 H;  1BXT A;  3LGJ A;  1IL2 A;  1QZH A;  4NKL A;  2JA5 H;  2BE5 D;  4FXK C;  4ZKB B;  2AWN A;  4YHH L;  1KDA A;  2K5H A;  2A8V A;  2EQS A;  5KNB A;  2NUC A;  5C44 H;  1G6P A;  2RF4 A;  4FP5 D;  3TZU A;  1QZG A;  1Y1W B;  3WDN A;  1I4P A;  2QDL A;  3D4W A;  2A73 B;  4APV A;  4LF6 L;  5EPK A;  1TS2 A;  3T1H Q;  4JYA L;  4ODG A;  1JE5 A;  2E76 C;  1I4R A;  3S1Q H;  1AH9 A;  2VQF L;  3W2D A;  2K03 A;  4CDF C;  4LF4 L;  1GUN A;  2JJQ A;  4F87 A;  1EY0 A;  2KHI A;  3BJU A;  1JMC A;  2VUM G;  4H0L C;  2FFK B;  1VQB A;  2A69 C;  2EJG C;  4BXX H;  1QVG A;  3BDC A;  2NN6 H;  5I9O A;  4JI7 L;  1HQM C;  5GAG C;  3FMC A;  2CKZ B;  5ELC A;  1N34 L;  4BBS H;  2LS0 1;  5JVG 3;  1C4Q A;  1TU2 B;  1G8Z D;  1B7Y B;  5E1F A;  2ZTD A;  1SMY D;  1QUQ B;  1ICF B;  1PV4 A;  1P8L A;  3T51 B;  2UUB L;  4UAI A;  2ZM6 L;  1IHZ A;  4A93 B;  1JOK A;  1A63 A;  1NAP A;  2WKD A;  3KBX A;  1DOM A;  1VQL A;  2AQ3 B;  5COY A;  5TSS A;  1U4M A;  3J80 E;  2CQA A;  1QE6 A;  1ONL A;  1EU4 A;  4DV0 L;  2NTS A;  4A3I G;  1E3P A;  1XXG A;  2IHF A;  4MHE A;  1CUK A;  3HGB A;  5EBD A;  4BY1 H;  2TSS A;  1SYD A;  3IL8 A;  4FF2 A;  3AFQ A;  2ZXP A;  4KV6 A;  3TRE A;  4HSV A;  1BCP D;  2LMC B;  5D14 A;  2K7V A;  1SYC A;  5C5L A;  2E2J H;  3N6R A;  1A8V A;  2AQ2 B;  2I07 B;  1YJW A;  2ZTC A;  4C3J H;  3NQT A;  4JI8 Q;  1WCM B;  3M4O B;  1I6H H;  4DAP A;  2B39 A;  3A8K E;  3PMF A;  1L0Y B;  1KRT A;  4FF3 A;  2KCT A;  1IKM A;  2R6G A;  2RDF A;  2L55 A;  5IYB G;  4C3I B;  2CHB D;  3CRK C;  5L37 A;  5IT9 c;  3CC4 A;  3X3M A;  4PNY A;  3H0G B;  3D8G A;  1UEA B;  4JC0 A;  2F0F A;  4IUU A;  4RKB A;  1MI2 A;  5C3W A;  3PSI A;  4KMU C;  2B8G A;  1SLJ A;  2KVM A;  3QOJ A;  4DR6 Q;  4JI1 L;  1MJC A;  5JPN C;  4IPC A;  1PFB A;  2EDG A;  3RZD H;  3QIA A;  3TME A;  3W1B A;  1B53 A;  1BKB A;  1HUN A;  2EY2 A;  2L0C A;  3RN5 A;  3STB C;  5LMU Q;  1VMP A;  5JVH 3;  3K59 A;  1I94 L;  4IAL A;  2F4I A;  4GOP C;  2VY3 A;  4FO2 A;  4CDC C;  2RSO A;  1LTI D;  5C0X G;  1EIH A;  1EY8 A;  2D0P A;  1B1Z A;  2IW3 A;  3PO2 G;  3PIP 3;  3PO3 G;  3ICE A;  2LSS A;  3OIP A;  3K5L A;  1VQ5 A;  2DN8 A;  2HIX A;  1FNW A;  2QF7 A;  4LFA L;  3NTH A;  1DD2 A;  2EPB A;  1Q46 A;  4IN3 A;  4JI0 L;  2HQE A;  2KEC A;  3CU7 A;  3NBH A;  1N36 Q;  2DY8 A;  1LT6 D;  2XTI A;  3VA7 A;  3NXW A;  1MSH A;  1SMX A;  1Z6H A;  2YU9 B;  4NP5 A;  3UDG A;  1GUS A;  3F8T A;  1HTL D;  3URY A;  1T5E A;  1H9M A;  3PUW A;  3SEB A;  1NCV A;  5HY6 A;  1Q86 C;  2AUK A;  1PTO H;  4N8X 1;  5AFW A;  5IY0 A;  1CHQ D;  4HSP A;  3CQZ B;  3MTS A;  1IXR A;  3HKZ E;  3HOZ H;  3CCU A;  3VR6 A;  2JN4 A;  1N33 Q;  1IBK L;  4FNF A;  4HIK A;  2XN9 C;  1A3U A;  3X3N A;  4IFD J;  1EQT A;  1YNN D;  2R3Z A;  5H1S E;  3F1Z A;  2P5Z X;  3HKS A;  4ULL A;  1JB3 A;  1U5K A;  1STB A;  3EJI A;  3WOE A;  4TQU S;  1VQN A;  4JVZ A;  5BN3 A;  1I4G A;  2OTL A;  1TR5 A;  4JOI C;  1NJI C;  4JW0 A;  4LF9 L;  1PH8 A;  2R93 B;  2DY7 A;  3CCQ A;  1VQI A;  2BCO A;  1STH A;  4DFA A;  2F1M A;  5JAV A;  2E8G A;  5ELN A;  1PYS B;  3HG9 A;  1YNJ D;  3R93 A;  2WAC A;  1B70 B;  3OW7 A;  1X65 A;  1X56 A;  4DR3 L;  2MNA A;  1Y1V H;  3I90 A;  1EQQ A;  1K3B C;  3GTJ H;  1EIG A;  3HP3 A;  3S15 H;  2G5D A;  2D62 A;  3G71 A;  2UUC Q;  4ALP A;  1YI2 A;  2N78 A;  2F3W A;  4EGV A;  3Q0A A;  5K36 H;  1LUZ A;  2RDG A;  3CC7 A;  1Y1W G;  1F9P A;  2XWJ B;  4LAA A;  1J5E L;  4DR4 Q;  4QB4 A;  3OTO Q;  4CKC A;  4A4I A;  3MXG A;  1BOS A;  1K8A C;  4B3T Q;  4RHR A;  2Z4H A;  3R2T A;  3AYH B;  4DR1 L;  2AQ1 B;  3CAM A;  3QG1 A;  3QO2 A;  1TII D;  5D3I B;  1GD7 A;  3K8A A;  5C4H A;  4JBK A;  4ZAI A;  4EQN A;  5JPM C;  1EYG A;  2C5C A;  3BVM A;  3PF5 A;  4B3R Q;  3NTI A;  4LK1 C;  4GNX C;  1HXY D;  4B3S Q;  1JB7 A;  4J6H A;  1STE A;  1YIJ A;  2F0O A;  2Q8T A;  3U9O A;  5ELF A;  1HRJ A;  3K0Y A;  4GZY C;  3TN2 A;  4MN3 A;  4AYB E;  3VR5 A;  1ZYR C;  3S17 H;  3E0J A;  3U4V A;  1HNX L;  1R4Q B;  3HEJ A;  4XT3 B;  4A3J H;  3DM3 A;  4A93 G;  4DR7 Q;  3IFD A;  3NEN A;  1UE7 A;  1IL8 A;  2PPB C;  4NB3 A;  4HID A;  3N52 A;  4YCW A;  4BBR B;  1PHJ A;  3K5M A;  5KEE A;  1J6Q A;  3S1R H;  5FO9 B;  1KL9 A;  5IGB A;  3DMU A;  1JE4 A;  2Q2T A;  3FKI H;  4B9W A;  3GTM H;  3NBH B;  5I2Y A;  4C2M B;  3DWP A;  3I4N H;  4X66 Q;  4IFD H;  1E1T A;  4NMZ A;  2JA9 A;  5CV5 A;  5DAU A;  1TWC B;  5M5W H;  2K28 A;  3NP8 A;  5FK9 C;  2VS1 A;  2XSC A;  2HCC A;  4H02 A;  4R4Q A;  1RCV D;  1SNP A;  1WCM G;  1EFW A;  2E5L L;  4ABN A;  3GTO H;  1XNR Q;  2JA5 B;  1E24 A;  1E22 A;  2QEX A;  1NBW A;  4DUZ L;  2UUA L;  4X62 Q;  1S5E D;  5K5P A;  1RDP D;  1RKN A;  3HOV B;  4F8M A;  4C3I G;  1VQE A;  1K83 B;  1ENF A;  1PRT C;  3GV6 A;  2K1B A;  5EPJ A;  2IX3 A;  1LM0 A;  2LKV A;  3D6W A;  3H0G G;  5EJW A;  3E6Z X;  5JOB A;  2KUM A;  3F2C A;  1JQY D;  3K6O A;  5IYD H;  5DLQ E;  1K73 C;  4K5V A;  2MQH A;  2Z1C A;  3S1Q B;  2KBN A;  2Z4I A;  3RNU A;  5C4J H;  1R9T H;  2IT1 A;  1AZP A;  3H3V H;  1CA5 A;  2EY5 A;  2IWH A;  1ASZ A;  2JA8 H;  1CSP A;  1TS5 A;  3I4M H;  2EJF C;  1EOV A;  3GTP H;  5ELE A;  2R7Z B;  1A2T A;  3CRL C;  2OTJ A;  3HKZ B;  3CP0 A;  1EOT A;  4HED A;  4S3S A;  4XTC S;  4DV4 Q;  1MHW C;  1XPU A;  3K57 A;  4Q0F A;  3KOJ A;  3HRZ C;  3JAM i;  4BBS B;  4K8I A;  4P73 A;  3TSS A;  4YIJ A;  5GAE C;  2UU9 Q;  1K8G A;  4KN7 C;  1HR0 L;  2F0I A;  1PYB A;  2RCF A;  3KLW A;  3OPO A;  4OON A;  1BDO A;  5COR A;  2V1C C;  1WD0 A;  5GQO A;  2HHH L;  4IOA A;  4A3E H;  2WII B;  1E1O A;  1TWA B;  3HZX A;  2KEE A;  2ZT9 C;  1QG7 A;  2ALY B;  5EKI A;  1SYB A;  5AJ3 L;  3IFT A;  2HCI A;  3RN2 A;  1CT1 D;  4X64 Q;  4BY1 B;  2ID0 A;  3CCL A;  5CBA E;  3T1Y L;  3KLS A;  4DV5 Q;  1LV9 A;  3ULJ A;  2FMM A;  5CGK A;  2WB1 E;  1GJX A;  2X6G A;  4U68 A;  1EQR A;  5FLM G;  4IPG A;  2K5Q A;  1M4V A;  2BE5 C;  5EPL A;  4KJN A;  3BU2 A;  4UP8 A;  5IOD A;  1VQ4 A;  2E2J B;  2WKC A;  2L1B A;  1FNV A;  3J81 E;  5C4X B;  2MGS A;  1IYU A;  1DM0 B;  4WJ4 A;  1Q1B A;  4A3M H;  4KHP L;  5NUC A;  1LAC A;  1I5F A;  1KNE A;  2GVA A;  1NY4 A;  5JEA J;  2R93 G;  3MA2 B;  1WJJ A;  4M8A A;  1TT2 A;  4LJZ C;  4LF8 Q;  1J8I A;  4X3T A;  1ILP A;  1EYC A;  1VQM A;  1O7L A;  3A7A B;  3OHX C;  3S1N B;  2F3V A;  2L11 A;  2SEB D;  5EKL A;  5IP7 G;  1IW7 D;  2PMZ E;  2NVY H;  4WJW A;  3FHW A;  4AYB B;  1PMR A;  2VQE L;  1TWG H;  3KJO A;  4A3K B;  4JI5 Q;  2PNH A;  3UDF A;  5E4X A;  1WFQ A;  3M3Y B;  4WOR A;  2WAQ B;  1B8A A;  1F2L A;  1G29 1;  1HZB A;  4RH6 A;  5M3F H;  3C1F A;  2F0G A;  3S1M H;  1C9O A;  1MGS A;  5M3M H;  4Y7N H;  2RSN A;  3TP5 A;  1SMY C;  3ULL A;  1S40 A;  4G57 A;  5GAH C;  2F0K A;  3MFG A;  1VMC A;  3K58 A;  3T1H L;  1KLG D;  1SBB B;  2K5W A;  4NXN Q;  1OXT A;  5HUR A;  4LF7 Q;  3H3V I;  1S5F D;  1GUW A;  2CH4 W;  3VYT A;  1LTG D;  5FJ8 H;  3V05 A;  4G7Z C;  1K0S A;  2EOT A;  1V43 A;  4LUO A;  4OEL B;  1UWV A;  2ZJP A;  1Z7T A;  2F4V Q;  1D6E C;  4BWG B;  3PUY A;  4DK1 A;  1PH6 A;  4A3L G;  3FVQ A;  3I73 A;  2NVX B;  1EWC A;  5I6W A;  4V0B A;  3CMA A;  3L7Z C;  1BCP C;  4KHV A;  1EQV A;  5G3L F;  2B2W C;  4A3C G;  1JWS D;  4FXG C;  2XWB B;  3MFY A;  5T1G A;  1PTO B;  4DNI A;  1F2M A;  3AFP A;  2PI2 E;  3TP7 A;  1K0R A;  4XT1 B;  4BBR G;  2B2T C;  1EIY B;  3I3C A;  1PH4 A;  3S2D B;  3T16 A;  3FDT A;  1XMQ L;  1CKN A;  4KKS A;  3UI2 A;  3GTG B;  4GKK Q;  3SK4 A;  3A5U A;  5A35 A;  2XGT A;  4XQQ A;  2B2Y A;  2RDH A;  4GLV B;  4DR5 Q;  5KYL A;  1WTQ A;  1CKO A;  4NXM Q;  4K0K Q;  3I4O A;  4PZ7 A;  1E0B A;  1ESR A;  1FJG Q;  2M00 A;  4JK1 C;  5JEA H;  5CMD A;  4PMB A;  3GTJ B;  4OO1 G;  3S15 B;  1KXL A;  4EQP A;  2E2D C;  2JA5 G;  3NEL A;  4OIK A;  1V1P A;  1D2B A;  4X6A H;  5LMN Q;  2E2H H;  1B3Q A;  3CW2 C;  3HOV G;  4A3D H;  2AHO B;  2IHE A;  3MZ5 A;  1N8R C;  3E9H A;  3EN2 A;  3CME A;  1Z9F A;  1X3Q A;  2PYK A;  3OW2 A;  1HA5 A;  1JR0 D;  1SXT A;  5EAY A;  1VQ6 A;  1CM9 A;  1OXX K;  3RLN A;  4R4C A;  2Y0S E;  2B3G A;  3I72 A;  3BG3 A;  3K81 C;  4BA2 I;  3CD6 A;  2I0Q A;  1A0I A;  5BR8 Q;  2B8F A;  5DNF A;  1SYE A;  3KF8 A;  3VR3 A;  1SNO A;  2R7Z G;  2NZ1 D;  5M5X H;  3HKZ G;  4BXX G;  4MNO A;  1BBW A;  4KHZ A;  1OTC A;  2RVL A;  3RR5 A;  3SGI A;  3SDZ A;  1X3E A;  3I4L A;  1QOH A;  5LMU L;  4BBS G;  1HZA A;  3NE5 B;  5LMN W;  4AQY Q;  1M1K C;  1MKH A;  1TS4 A;  1TXY A;  4L5S A;  3WWV A;  4DK0 A;  1VQC A;  1LO5 D;  1GOZ A;  3F2B A;  3S17 B;  4O42 A;  5CV6 A;  4EX5 A;  4LFB Q;  3HOU H;  1YNN C;  1LT5 D;  4CKB A;  3LWU A;  3ONA B;  3IRB A;  4OX9 Q;  3QR8 A;  3EQL C;  3PQI A;  1L0W A;  5FLX E;  2PMZ B;  1NR2 A;  4NDX A;  4YWM A;  3MEF A;  3S2H H;  2AWO A;  1N36 L;  4JI3 Q;  3KK7 A;  3FKI B;  3IKJ A;  5J22 A;  4BY1 G;  1YNJ C;  2KJX A;  4OWT B;  3GTM B;  5C6A A;  4LW1 A;  5IP9 H;  3TP8 A;  2CVR A;  1GO3 E;  3ZYY X;  3RMH A;  4RAU C;  1HZ9 A;  4JBM A;  2QW7 A;  1KAW A;  2Z6K A;  4L5Q A;  2A5H A;  5FO8 B;  4FYD A;  2BDO A;  2KQ3 A;  4MIU A;  4JI4 Q;  2IJ0 A;  5IGF A;  5M5W B;  4IUR A;  2B2U A;  1AFP A;  5C4X G;  1SYF A;  1G6Z A;  1RL2 A;  1O80 A;  3J7A 5;  1BF4 A;  4PMW A;  3SK5 A;  4KI0 A;  5C0X J;  2K05 A;  5DEH A;  3SE0 A;  3DXJ C;  3GTO B;  4K8J A;  1PH5 A;  1HHV A;  3JAM E;  4JI6 Q;  4R1J A;  3LWE A;  1SE3 A;  3OWF A;  2OXP A;  5KND A;  3BYY B;  1CKN B;  1IYV A;  3CPF A;  3SK8 A;  2KCN A;  2JA7 B;  4FVM A;  3ND8 A;  3GP7 A;  4XIG S;  4AYB G;  4JG2 A;  1R9T B;  4WRD A;  3BDO A;  3HOY H;  1DGS A;  1V1O A;  3L0O A;  4A3K G;  2JA8 B;  1PDQ A;  4L8J A;  3I4M B;  5FO7 B;  2Z9H A;  1D1I A;  3ER0 A;  1OO9 B;  2EXZ A;  2WAQ G;  1JOO A;  1X3G A;  1OXV A;  3U4Z A;  2F0J A;  2UUC L;  5A2Q E;  2PQE A;  4PZ8 A;  3KYH C;  1VQK A;  3OYY A;  1TVX A;  4RMF A;  4DV2 L;  1V1P B;  1F9Q A;  5JJK A;  1A6X A;  3MHB A;  4ZUJ A;  3ZJY C;  4HAE A;  2IPK D;  4A76 A;  1EEF D;  4B3T L;  4OO1 I;  1LTL A;  2YTV A;  4YY3 Q;  5IWA Q;  1Q81 C;  1Q8K A;  1UE6 A;  1X54 A;  2F0V A;  3SVM A;  1N32 Q;  4LF5 Q;  4XYO A;  2B2V C;  3VA5 A;  4R4O A;  5BN4 A;  1PTO D;  4HJ9 A;  4UHV A;  1CSQ A;  2NVT H;  4DR2 L;  1TY2 A;  3KF8 B;  4X65 Q;  4B3R L;  1HNZ Q;  2EYO A;  3J7Y W;  4CJ1 B;  2XRQ D;  2CH4 A;  4PQX A;  5E7N A;  1PH1 A;  1KNA A;  3PV0 A;  3FRP B;  4K2K A;  3ULP A;  4QIW E;  3GD7 A;  5M9O A;  2B63 H;  1R4P B;  2I5H A;  1VQF A;  2UXC Q;  1WTX A;  2NN6 I;  2KCC A;  3BVG A;  2MO1 A;  4DR7 L;  4IUP A;  2Q2H A;  4POF A;  4F7X A;  1CQF A;  3NSW A;  1WTH A;  1S5B D;  1F2Z A;  4EQO A;  2NZH A;  3L3O C;  3DWA A;  2EJM A;  2R92 B;  1T9H A;  1YHB A;  5C0X H;  2F3I A;  4LNQ A;  2ICE C;  4X66 L;  4KD4 A;  3PO3 H;  5F2D A;  2ZM6 Q;  1IBL Q;  2IY5 B;  1YHA A;  1CHP D;  3HOW H;  3W5O A;  3HOX H;  4J15 A;  3MXP A;  1TWG B;  1L1O A;  1NR4 A;  3K80 C;  1I4H A;  5K36 G;  2FHT A;  1SND A;  3DWQ A;  4HR7 B;  1AE3 A;  4IO9 A;  1O78 A;  1PH2 A;  1MJE A;  4E6I A;  4C3H B;  4DV6 L;  1XNR L;  1SN8 A;  4IUT A;  3CCS A;  5M3F B;  4X62 L;  1X3F A;  3A8I E;  2VW9 A;  3S1M B;  3K5O A;  4DXF A;  2MUY A;  3DLL A;  3S24 A;  1WTP A;  1H95 A;  1VDZ A;  4HCE A;  1K3R A;  1SAP A;  2SNM A;  3DUZ A;  1Z47 A;  3K7A B;  1TWF H;  3RZO H;  5KIX A;  1BUV T;  2OF1 A;  4HIO A;  1SE2 A;  2OQ0 A;  2NZO A;  1XNQ Q;  2UXD Q;  4N8F A;  4TRD A;  2JP1 A;  1FL0 A;  2QCP X;  2ZJR A;  4DAV A;  1X32 A;  5BN5 A;  3D3R A;  4DNR B;  1SNM A;  4EQ5 A;  1KDB A;  4DV3 Q;  5ELO A;  4OXP A;  2SDF A;  1KAA A;  1KDC A;  1ICW A;  3KDF A;  1NMG A;  5FLX L;  1HCZ A;  3PIO 3;  2X6L A;  3U9S A;  1JCK B;  2UU9 L;  4LMQ D;  5M5Y B;  1GXD C;  1HJP A;  1NUC A;  1X55 A;  3CCE A;  4X3S A;  3M4Q A;  1S72 A;  5EBC A;  2F0T A;  2L4N A;  2AKW B;  5JJZ A;  4OEM B;  3FKI G;  1I94 Q;  1HTP A;  4OGQ C;  2K33 A;  4KLK A;  4RHS A;  2M2L A;  1Y1W H;  1B3A A;  2ZTE A;  3J80 L;  1IW7 C;  2JQO A;  4UP9 A;  2VB3 X;  4X64 L;  1MIU A;  2YV5 A;  4EVO A;  3TS0 A;  5ISR A;  2ZXO A;  4AH6 A;  4QUF A;  2JEA I;  4DV5 L;  1C0A A;  1ZEQ X;  2R7F A;  4ZYS A;  5D3D A;  4LFC L;  1EL0 A;  4A3B B;  1KTK A;  1UEB A;  1KAB A;  3QOL A;  3H6M A;  3M9B A;  1G2T A;  2E2H B;  2EYP A;  4RG1 A;  1P16 A;  1EY9 A;  5EGT A;  3D6C A;  1AZQ A;  1EZ8 A;  1GVP A;  5IT9 E;  1SFO H;  4IUV A;  4C56 C;  3NWT A;  3QWN A;  2E74 C;  2A68 D;  3V96 A;  1FVI A;  3RD4 A;  4JI2 Q;  4UY8 C;  1DXM A;  2EYH A;  3BZD B;  3MXN A;  5IYD G;  2L12 A;  1D7Q A;  1TQO A;  2JA7 G;  1DOL A;  1YJ9 A;  1YNX A;  4HJ7 A;  4LF8 L;  2HD3 A;  2O4X A;  3VYR A;  3AEV A;  5A2Q L;  2GA4 B;  4ILW A;  4K6D A;  1YJN A;  3NQI A;  5IGD A;  4KKU A;  4L5R C;  2JA8 G;  4R8I A;  3I4M G;  1KD1 C;  3A8J E;  1PRT F;  4R4T A;  2LXJ A;  3M4P A;  2DNE A;  4A93 H;  5C44 B;  2FJ2 A;  5M5X B;  2NYZ D;  3FP9 A;  1PLF A;  2Z8L A;  1IZ6 A;  4H44 C;  4F88 A;  4JI5 L;  2OWO A;  1Y14 B;  4LF9 Q;  1L1O B;  1K28 A;  4I7Z C;  3KBG A;  3CCJ A;  1HH2 P;  4QY7 A;  1K8O A;  4FF4 A;  2XNA C;  3BZC A;  1GHJ A;  1ET6 A;  3H15 A;  3I70 A;  3QJY A;  4DR3 Q;  1WTR A;  2K14 A;  4UP7 A;  3GV3 A;  1X9N A;  3HOU B;  3G6E A;  3GTK H;  2PZU A;  4PV1 C;  1HFG A;  1H9S A;  1RIP A;  1YEZ A;  3H91 A;  4LF7 L;  2JEB I;  4JV5 Q;  3TS2 A;  4DUY Q;  1WCM H;  3M4O H;  1C48 A;  1S5D D;  2PO4 A;  3FEW X;  1C8C A;  2F4V L;  4GKJ Q;  3S2H B;  2N8N A;  3TP6 A;  3DEO A;  2C9O A;  4A3G H;  2HUG A;  1S4Z A;  3F2D A;  1XMO Q;  1SDF A;  2V4D A;  3DEP A;  4ZLT F;  4A3F H;  4R4I A;  3KDF B;  1EEI D;  1GUO A;  1ML0 D;  3Q22 A;  1PZJ D;  2L5T A;  1EYA A;  4XYQ A;  2RHS B;  2WP8 J;  3D31 A;  4KTA A;  2FMC A;  1PZI D;  2R92 G;  1Y8N B;  2K4K A;  2QGQ A;  5CYU A;  1B9M A;  1B4O A;  1D5X C;  3TEH B;  4NXM L;  5LL6 X;  4DR5 L;  3CCR A;  3M7N A;  2QA4 A;  1EY7 A;  2CWA A;  1UAP A;  3ND9 A;  1H9K A;  3R3O A;  4C3J B;  4DV1 Q;  1SE4 A;  2JA6 H;  1I6H B;  3HOY B;  4BY7 H;  3LNN A;  2NWG A;  3GTL H;  4C3H G;  5I2X A;  3AB9 A;  4IFD I;  4KKT A;  5M3F G;  2YU9 H;  2F0M A;  5LMN L;  4HJA A;  2A1A A;  2A19 A;  2WFW A;  1JJ2 A;  4G4K A;  1TWH H;  2Z0S A;  2MP1 A;  2K50 A;  4HMJ A;  2BDN A;  4RKL A;  1CKM A;  1VQD A;  5CV9 A;  1ET9 A;  3KLR A;  3MXN B;  2ENB A;  3S9W A;  3RZD B;  2KA7 A;  2XIW A;  3H94 A;  3ERS X;  1PFN A;  5FJ8 G;  1HZC A;  1U4R A;  4AIM A;  2ATW A;  4DUZ Q;  2PZW A;  3NK9 A;  4V19 0;  2PCF B;  3M7G A;  3J80 c;  1I3Q H;  3GO5 A;  4RCN A;  4DPG A;  2VB2 X;  2CFM A;  2J4X A;  4H13 C;  2A6E D;  4I7A A;  3I91 A;  5LL6 S;  5C3E H;  2DGY A;  1ESF A;  1D8L A;  2R93 H;  3P1H A;  1K8M A;  2PZT A;  4TSS A;  4G7H C;  3G6J B;  4ME5 A;  2PW5 A;  4CHT B;  4AQY L;  2YYZ A;  4DGZ A;  2A6H D;  5IYC H;  4K5X A;  1F9R A;  1I4X A;  3MVV A;  5EQ0 A;  1QCB D;  2B63 B;  4LFB L;  1BCP F;  2HIV A;  3RLO A;  1Y8O B;  3ITP A;  2Q8I B;  1HUM A;  5C4Z A;  3FPU B;  4HN7 A;  1UE5 A;  2K5N A;  1DOK A;  1VQO A;  3J7Z C;  1YIT A;  4OX9 L;  1STY A;  3KLS X;  1PVO A;  4L5T A;  1H9S B;  4A75 A;  4HJ5 A;  2F0D A;  4PMC A;  3I55 A;  4GN4 B;  1Q1E A;  5CR3 A;  1VF7 A;  1VQH A;  1EY6 A;  4JI3 L;  3HOZ B;  4DXG A;  1EY4 A;  2KHS A;  2EE1 A;  3CCM A;  1PFM A;  3ERQ A;  3MEH A;  5CC4 A;  1EUJ A;  1EU3 A;  5JEA G;  4IOC A;  3A74 A;  4OWW B;  5KNC A;  1IBM Q;  2E2I H;  2F0L A;  4JI4 L;  1CTM A;  4YWL A;  2CQO A;  2X69 A;  3HOX B;  3HOW B;  4A3B G;  3MXU A;  1E2W A;  5CBE E;  2F0W A;  4P75 A;  3PUX A;  2SOB A;  2BA1 A;  2C35 B;  2L9H A;  3UDX A;  3W3A A;  1LTB D;  2JYO A;  3W1G A;  4LUV A;  2XVS A;  4A3L H;  4IPD A;  1JJC B;  4TKO B;  4JI6 L;  2BH8 A;  1BNZ A;  1Y1V B;  2PI2 A;  1U4L A;  2QEJ C;  2SNS A;  2K6A A;  4N9P A;  4GOP A;  1ENA A;  1Y69 U;  1QWY A;  5LHY 1;  1PTO C;  1MBY A;  3BS1 A;  1HNW Q;  5C44 G;  4G7O C;  1QVC A;  3T56 B;  1TWF B;  3RZO B;  4JI8 L;  1WTO A;  2K52 A;  2N88 A;  1VQA A;  2QKI C;  1MD2 D;  3PCO B;  1N9W A;  1D1K A;  3CF5 A;  4DV7 Q;  2KHJ A;  2HQL A;  3A54 A;  1K9M C;  1EFI D;  3VYU A;  1B2T A;  3HOU G;  5IGG A;  4FF1 A;  2WB1 B;  1GKH A;  4Y52 H;  1D5M C;  4DR6 L;  1B50 A;  4CJ0 B;  2NN6 G;  4YY3 L;  3Q6S A;  1SE8 A;  4P72 A;  1FR3 A;  1N32 L;  4B3M Q;  2VNU D;  4LF5 L;  4ZCK A;  4K2L A;  4GS3 A;  4GLA C;  3S16 H;  2IX0 A;  5IP9 G;  3HOV H;  1AP0 A;  3P20 A;  5JJL A;  1K83 H;  4BA1 I;  4X65 L;  1HA6 A;  2RKS A;  4MZ9 A;  4A3J B;  4DK3 C;  1HNZ L;  4WJ3 M;  3HFZ B;  1XJV A;  4JOI A;  5E3F A;  3NUC A;  2N49 A;  2G9H D;  1YZ6 A;  1LYL A;  3SHL A;  3S1R B;  4Q5V A;  3NWS A;  2D5D A;  1STG A;  3MC0 B;  4P71 A;  2UXC L;  2ZXR A;  5CV7 A;  1UUP A;  2B29 A;  2R7Z H;  3J81 L;  3I4N B;  2BH2 A;  4K5W A;  1JWU D;  4IUQ A;  2CW0 D;  2PQA A;  1A62 A;  1SFO B;  4I65 A;  2LXK A;  4IJH A;  4HCS A;  3AMU A;  2I5L X;  4ZRZ A;  3BDL A;  5HGT A;  1WOC A;  1SYG A;  2O2L D;  2EYM A;  3EIV A;  4C3J G;  3EBE A;  3MAQ A;  4IZ8 A;  1N33 L;  2EXD A;  1CQV A;  5KGU A;  1BVS A;  3E5S A;  1AEX A;  1W3S A;  3HOY G;  3IAY A;  1QNK A;  2VUM H;  1J9O A;  3U50 C;  5C3X A;  1W6J A;  1IBL L;  4NPS A;  2E75 C;  4JBJ A;  2DJG C;  1XMQ Q;  1HFN A;  1BBU A;  2O5I C;  3K7U C;  4KY6 A;  1TWA H;  1PH9 A;  5KYI A;  1OXU A;  1V8Q A;  1CI3 M;  3VR4 A;  3SK6 A;  2H4O A;  4GLX A;  3C3L A;  4KK7 A;  2OCE A;  3CCV A;  3C46 A;  1AW7 A;  2HDM A;  4DAM A;  4DAY A;  4GNX A;  3A5Z B;  1EWH A;  2M9V A;  1GUT A;  5C4J B;  4HIM A;  1LLR D;  2YTX A;  1U4P A;  3GTP B;  1G2S A;  2Z6B A;  1LTT D;  3GTK B;  1XTD A;  4LUZ A;  4UPA A;  1FGU A;  4GOP B;  2F0N A;  5G3L D;  2RCN A;  5C4X H;  4IJL A;  3KFU A;  3K5N A;  4ZKC B;  4DF7 A;  3VDY A;  4A3I H;  4DR4 L;  2UXB Q;  3WOF A;  2OQK A;  1QJO A;  3V2T A;  1XNQ L;  3OTO L;  2UXD L;  3F2U A;  2N3S A;  3PUZ A;  4O0A A;  2WV6 D;  4KN4 C;  4A3G B;  1VCI A;  3KUP A;  2VXW A;  3SXH A;  4YCV A;  4DV3 L;  2B63 G;  4YHH Q;  4A3E B;  3S1N H;  3T53 B;  2K75 A;  5FKA C;  2B2Y C;  4A3F B;  1RF2 D;  2JE6 I;  2QIL A;  4JCV E;  1TY0 A;  3TZD A;  4B3S L;  4LF6 Q;  2D2C C;  3H3V C;  2A68 C;  4O1N A;  4QUC A;  1SJH D;  4P74 A;  1EZ6 A;  4CKE A;  4A3K H;  4RGO S;  2KEN A;  3NPP A;  4JYA Q;  3M3Y H;  1I50 H;  1F2Y A;  3J7A V;  5IYB H;  4K14 A;  3J81 i;  4X3U A;  2VQF Q;  2R7D A;  3NTK A;  3PUV A;  3GTQ H;  3HOZ G;  4LF4 Q;  4PG3 A;  2JK8 A;  3S14 H;  1ZKO A;  4CDD C; 
#chains in the Genus database with same CATH homology
 1XYI A;  2Y0S B;  4A3M B;  1CK1 A;  1II3 A;  2JA6 B;  1G91 A;  3C1E A;  1RHP A;  2F0E A;  4BY7 B;  1STA A;  1ROD A;  1B44 D;  2J7Z A;  3OMG A;  4Z9C B;  3GTL B;  1XTC D;  3OOC A;  1PZK D;  4CBV A;  2AUJ D;  4IUN A;  3G7L A;  1Q90 A;  2PW7 A;  1TWH B;  4BS9 A;  1B9N A;  3Q23 A;  2NVY B;  2RBM A;  1FYC A;  4M1U B;  2OEO A;  4JBW A;  3SR1 A;  1LT4 D;  1SSO A;  2K32 A;  2BA0 A;  5M3M B;  4Y7N B;  4OL7 A;  2A69 D;  3D4R A;  5IGC A;  1I3Q B;  1U9R A;  1DCZ A;  3VR2 A;  1QNU A;  5C3E B;  3LX0 A;  2F0Q A;  4DA2 A;  3A7L A;  1ZXT A;  1HQR D;  2RQX A;  5C5M A;  1IKL A;  3A56 A;  3ERO A;  1OXS C;  4R9W A;  1Q3L A;  2B2U C;  2RA4 A;  4QMG A;  1Q8I A;  3CHB D;  1MSG A;  3J7A F;  3NHH A;  1KLU D;  4RWS C;  2MHV A;  1BBX C;  1SNC A;  3L9A X;  4R8N A;  1ENC A;  3CKI B;  4IQZ A;  2E2I B;  1X3P A;  3TBI B;  2EYJ A;  4XXE A;  1JOR A;  3I8Z A;  4IFD G;  5J1Z A;  2NB0 A;  5CV4 A;  4UDU C;  2A74 C;  2EVB A;  2F0S A;  1QIL A;  4C1N I;  4B08 A;  1S5C D;  5E4W C;  3JAM L;  2WIN B;  5I6Y A;  1I4Q A;  3T4A C;  1A3V A;  3OSO A;  3P75 A;  4WFN 3;  5EKK A;  2D9U A;  1ILQ A;  3HS0 C;  1WD1 A;  4A3D B;  1A2U A;  1PRT B;  5I4D A;  2A6E C;  1XWE A;  1RJT A;  2IL8 A;  2EYL A;  1DON A;  1JOQ A;  5C0X I;  2F0U A;  4ZQ3 A;  2A6H C;  2BOS A;  1D5Z C;  2QDB A;  1SJE D;  2H1E A;  2B2W A;  4CJ2 C;  4QIW B;  1H9J A;  2G9D A;  4P2C B;  1JC7 A;  1CFM A;  1LTA D;  1PYW D;  3QB3 A;  1E2Z A;  2B2T A;  1JWM D;  1FD7 D;  3S16 B;  3M85 A;  3RLF A;  4RFB A;  2EZV A;  4DU9 A;  2DNC A;  5ELB A;  4RA8 A;  1DZ1 A;  4KY5 A;  1A3T A;  1VF5 C;  2LFN A;  1TKW B;  4HMI A;  3DHQ A;  2FIN B;  2F0H A;  2KOL A;  4X3K A;  3EFX D;  2JSO A;  5J39 A;  2K5D A;  1LTR D;  3GQB A;  4KY7 A;  1EY5 A;  2I46 A;  5CV8 A;  3M4Y A;  4DNT B;  3RUZ A;  2TMP A;  3MWY W;  1T5X D;  2R61 A;  4U67 3;  2KED A;  2NTT A;  3T13 A;  2VUM B;  3OIQ A;  1WVL A;  2IX1 A;  4NW2 A;  3O13 A;  2HDL A;  3Q24 A;  1A15 A;  1FGB D;  1LTS D;  2XRS D;  2ICI A;  4KJO A;  5ELD A;  5I9P A;  4ID6 A;  4XDX A;  5IOC A;  4ZUI A;  4ZK9 B;  1JIC A;  4B9X A;  1PXU A;  5DM6 3;  2EYF A;  4L6T B;  3D4D A;  1RTO A;  2K01 A;  1LAB A;  1NSN S;  3R8B A;  4CGY B;  2N55 A;  3BYT B;  4A3I B;  1SEB D;  3NBI A;  1HPC A;  1STN A;  2OT2 A;  3TDQ A;  4QCL A;  1DJR D;  3VYS A;  1F9S A;  1ZYR D;  4RGM A;  1SNQ A;  4K6L A;  4DN4 M;  2EY6 A;  5D65 A;  1CZG A;  2NVT B;  1BCP B;  1GUG A;  2CW0 C;  2NBF A;  4J1M A;  4XQN A;  1I50 B;  5IIF A;  4RCO A;  3GTQ B;  1FNU A;  1E2V A;  3AU7 A;  1O7Y A;  5FOB B;  3S14 B;  2F03 A;  2O5J C;  1BQQ T;  3P7J A;  2JXM B;  1TS3 A;  1Y8P B;  2MJ8 A;  3OMC A;  2F0P A;  3EVQ A;  4FXD A;  1WTW A;  1F77 A;  1L0X B;  1AN8 A;  1BO0 A;  4KD3 A;  1RD9 D;  4J8Q A;  1BR9 A;  4RGT A;  4N9T A;  3PO2 B;  4OHJ A;  3PO3 B;  1PRT D;  5IT9 L;  1I6V C;  3BVZ A;  5KRU A;  3EA6 A;  1H9R A;  3C2P A;  1CA6 A;  2MPM A;  2PNR C;  3OWE B;  3DM1 A;  4C1N K;  1LT3 D;  5T1I A;  1CZW A;  2K04 A;  1PTO F;  2B2V A;  3R2I A;  4XQJ A;  4RGN A;  5DM7 3;  1GHK A;  1M8A A;  2Q8R E;  3A55 A;  1Q12 A;  1DYQ A;  1XX8 A;  1RTN A;  1O7Z A;  2LY7 A;  2J0T D;  1W6K A;  3FPP A;  1EYD A;  4HTH A;  4H7B A;  2NVQ B;  4L63 B;  5IGE A;  3H09 A;  1QB5 D;  4OIJ A;  2EY1 A;  4QF4 A;  1WTV A;  1UNS A;  4OO1 H;  1BXT A;  4NKL A;  2BE5 D;  4FXK C;  4ZKB B;  2AWN A;  1KDA A;  5KNB A;  2NUC A;  3TZU A;  4FP5 D;  1Y1W B;  3WDN A;  1I4P A;  3D4W A;  2A73 B;  5EPK A;  1TS2 A;  4ODG A;  2E76 C;  1I4R A;  3W2D A;  2K03 A;  1GUN A;  4F87 A;  1EY0 A;  4H0L C;  2FFK B;  2A69 C;  2EJG C;  3BDC A;  2NN6 H;  5I9O A;  1HQM C;  3FMC A;  5ELC A;  2LS0 1;  5JVG 3;  1C4Q A;  1TU2 B;  1G8Z D;  5E1F A;  1SMY D;  3T51 B;  4UAI A;  1IHZ A;  4A93 B;  1JOK A;  1NAP A;  2WKD A;  3KBX A;  1DOM A;  2AQ3 B;  5COY A;  5TSS A;  1U4M A;  3J80 E;  2CQA A;  1QE6 A;  1ONL A;  1EU4 A;  2NTS A;  1XXG A;  4MHE A;  3HGB A;  5EBD A;  2TSS A;  1SYD A;  3IL8 A;  4FF2 A;  2ZXP A;  4KV6 A;  4HSV A;  1BCP D;  2LMC B;  5D14 A;  2K7V A;  1SYC A;  5C5L A;  3N6R A;  2AQ2 B;  2I07 B;  3NQT A;  1WCM B;  3M4O B;  4DAP A;  2B39 A;  3A8K E;  3PMF A;  1L0Y B;  4FF3 A;  1IKM A;  2R6G A;  2RDF A;  2L55 A;  4C3I B;  2CHB D;  3CRK C;  3X3M A;  4PNY A;  3H0G B;  3D8G A;  1UEA B;  2F0F A;  4IUU A;  4RKB A;  1MI2 A;  5C3W A;  4KMU C;  2B8G A;  3QOJ A;  2KVM A;  5JPN C;  1PFB A;  2EDG A;  3QIA A;  3TME A;  1B53 A;  1HUN A;  2EY2 A;  2L0C A;  1VMP A;  5JVH 3;  3K59 A;  4IAL A;  2F4I A;  1EIH A;  4FO2 A;  2RSO A;  1LTI D;  5C0X G;  1EY8 A;  1B1Z A;  2IW3 A;  3PIP 3;  3OIP A;  3K5L A;  2DN8 A;  1FNW A;  2QF7 A;  1DD2 A;  3NTH A;  2EPB A;  4IN3 A;  2HQE A;  2KEC A;  3CU7 A;  3NBH A;  2DY8 A;  1LT6 D;  3VA7 A;  3NXW A;  1MSH A;  1Z6H A;  2YU9 B;  4NP5 A;  1GUS A;  1HTL D;  3URY A;  1T5E A;  1H9M A;  3PUW A;  3SEB A;  1NCV A;  2AUK A;  1PTO H;  5AFW A;  1CHQ D;  4HSP A;  3CQZ B;  3MTS A;  3VR6 A;  4FNF A;  2XN9 C;  1A3U A;  3X3N A;  4IFD J;  1EQT A;  1YNN D;  2R3Z A;  4ULL A;  1JB3 A;  1STB A;  3EJI A;  3WOE A;  4TQU S;  5BN3 A;  1I4G A;  1TR5 A;  2R93 B;  2DY7 A;  2BCO A;  1STH A;  4DFA A;  2F1M A;  5JAV A;  3HG9 A;  1YNJ D;  3R93 A;  2WAC A;  3OW7 A;  3I90 A;  1EIG A;  3HP3 A;  2D62 A;  2F3W A;  4EGV A;  3Q0A A;  5K36 H;  2RDG A;  1F9P A;  2XWJ B;  4LAA A;  4QB4 A;  4CKC A;  3MXG A;  1BOS A;  4RHR A;  2Z4H A;  3R2T A;  2AQ1 B;  3QG1 A;  3QO2 A;  1TII D;  5D3I B;  5C4H A;  4ZAI A;  4EQN A;  5JPM C;  2C5C A;  3BVM A;  3NTI A;  4LK1 C;  1HXY D;  4J6H A;  1STE A;  2F0O A;  2Q8T A;  3U9O A;  5ELF A;  1HRJ A;  3K0Y A;  4GZY C;  3TN2 A;  4MN3 A;  3VR5 A;  1ZYR C;  3E0J A;  1R4Q B;  3HEJ A;  4XT3 B;  3IFD A;  1IL8 A;  2PPB C;  3N52 A;  4BBR B;  3K5M A;  5KEE A;  5FO9 B;  5IGB A;  3DMU A;  1JE4 A;  4B9W A;  5I2Y A;  4C2M B;  3DWP A;  4IFD H;  4NMZ A;  5CV5 A;  5DAU A;  1TWC B;  2K28 A;  3NP8 A;  5FK9 C;  2XSC A;  2HCC A;  1RCV D;  1SNP A;  4ABN A;  2JA5 B;  1S5E D;  5K5P A;  1RDP D;  1RKN A;  3HOV B;  4F8M A;  4C3I G;  1K83 B;  1ENF A;  1PRT C;  3GV6 A;  2K1B A;  5EPJ A;  2IX3 A;  2LKV A;  3D6W A;  5EJW A;  3E6Z X;  5JOB A;  2KUM A;  1JQY D;  3K6O A;  4K5V A;  2Z1C A;  3S1Q B;  2Z4I A;  2IT1 A;  1AZP A;  1CA5 A;  2EY5 A;  2IWH A;  1TS5 A;  2EJF C;  5ELE A;  2R7Z B;  1A2T A;  3CRL C;  3HKZ B;  1EOT A;  4HED A;  4S3S A;  4XTC S;  3K57 A;  4Q0F A;  3HRZ C;  4BBS B;  4K8I A;  3TSS A;  4YIJ A;  4KN7 C;  2F0I A;  3OPO A;  1BDO A;  5COR A;  1WD0 A;  2WII B;  1TWA B;  3HZX A;  2KEE A;  2ZT9 C;  1QG7 A;  5EKI A;  1SYB A;  3IFT A;  2HCI A;  1CT1 D;  4BY1 B;  2ID0 A;  5CBA E;  3KLS A;  1LV9 A;  2FMM A;  5CGK A;  1GJX A;  2X6G A;  4U68 A;  2K5Q A;  1M4V A;  2BE5 C;  5EPL A;  4KJN A;  5IOD A;  2E2J B;  2WKC A;  2L1B A;  1FNV A;  3J81 E;  5C4X B;  2MGS A;  1IYU A;  1DM0 B;  1Q1B A;  5NUC A;  1LAC A;  1KNE A;  5JEA J;  3MA2 B;  4M8A A;  1TT2 A;  4LJZ C;  1J8I A;  4X3T A;  1ILP A;  1EYC A;  1O7L A;  3A7A B;  3OHX C;  3S1N B;  2F3V A;  2L11 A;  2SEB D;  5EKL A;  1IW7 D;  4WJW A;  4AYB B;  1PMR A;  4A3K B;  5E4X A;  3M3Y B;  4WOR A;  2WAQ B;  1F2L A;  1G29 1;  4RH6 A;  3C1F A;  2F0G A;  1MGS A;  2RSN A;  3TP5 A;  1SMY C;  4G57 A;  2F0K A;  3MFG A;  1VMC A;  3K58 A;  1KLG D;  1SBB B;  2K5W A;  1OXT A;  5HUR A;  1S5F D;  1GUW A;  3VYT A;  1LTG D;  4G7Z C;  3V05 A;  2EOT A;  1V43 A;  1Z7T A;  1D6E C;  4BWG B;  3PUY A;  4DK1 A;  3FVQ A;  3I73 A;  2NVX B;  1EWC A;  5I6W A;  4V0B A;  3L7Z C;  1BCP C;  4KHV A;  1EQV A;  5G3L F;  2B2W C;  1JWS D;  4FXG C;  2XWB B;  3MFY A;  5T1G A;  1PTO B;  1F2M A;  3TP7 A;  4XT1 B;  2B2T C;  3I3C A;  3S2D B;  3T16 A;  3FDT A;  4KKS A;  3UI2 A;  3GTG B;  3SK4 A;  5A35 A;  4XQQ A;  2B2Y A;  2RDH A;  1WTQ A;  5KYL A;  1E0B A;  1ESR A;  2M00 A;  4JK1 C;  5JEA H;  5CMD A;  4PMB A;  3GTJ B;  4OO1 G;  3S15 B;  4EQP A;  2E2D C;  4OIK A;  1V1P A;  1D2B A;  3MZ5 A;  1X3Q A;  2PYK A;  1HA5 A;  1JR0 D;  1SXT A;  1CM9 A;  1OXX K;  3I72 A;  3BG3 A;  4BA2 I;  2B8F A;  5DNF A;  1SYE A;  3KF8 A;  3VR3 A;  1SNO A;  2NZ1 D;  4KHZ A;  2RVL A;  3SDZ A;  3I4L A;  1QOH A;  3NE5 B;  1TS4 A;  4DK0 A;  1LO5 D;  1GOZ A;  3S17 B;  4O42 A;  5CV6 A;  1YNN C;  1LT5 D;  4CKB A;  3LWU A;  3ONA B;  3EQL C;  5FLX E;  2PMZ B;  1NR2 A;  4NDX A;  2AWO A;  3KK7 A;  3FKI B;  3IKJ A;  5J22 A;  1YNJ C;  2KJX A;  3GTM B;  5C6A A;  3TP8 A;  2CVR A;  3ZYY X;  3RMH A;  4RAU C;  2A5H A;  5FO8 B;  4FYD A;  2BDO A;  2KQ3 A;  4MIU A;  2IJ0 A;  5IGF A;  5M5W B;  4IUR A;  2B2U A;  1AFP A;  1SYF A;  1G6Z A;  1O80 A;  1BF4 A;  4PMW A;  3SK5 A;  4KI0 A;  5C0X J;  2K05 A;  5DEH A;  3SE0 A;  3DXJ C;  3GTO B;  4K8J A;  1HHV A;  3JAM E;  3LWE A;  1SE3 A;  3OWF A;  2OXP A;  5KND A;  3BYY B;  1IYV A;  3SK8 A;  2KCN A;  2JA7 B;  4FVM A;  3ND8 A;  3GP7 A;  4XIG S;  1R9T B;  4WRD A;  3BDO A;  1V1O A;  2JA8 B;  1PDQ A;  4L8J A;  3I4M B;  5FO7 B;  1D1I A;  1OO9 B;  2EXZ A;  1JOO A;  1OXV A;  2F0J A;  5A2Q E;  2PQE A;  1TVX A;  1V1P B;  1F9Q A;  1A6X A;  3MHB A;  4ZUJ A;  4HAE A;  2IPK D;  1EEF D;  4OO1 I;  2F0V A;  3SVM A;  4XYO A;  2B2V C;  3VA5 A;  5BN4 A;  1PTO D;  1TY2 A;  2EYO A;  3J7Y W;  4CJ1 B;  2XRQ D;  4PQX A;  1KNA A;  3PV0 A;  3FRP B;  4K2K A;  3GD7 A;  5M9O A;  1R4P B;  1WTX A;  2NN6 I;  2KCC A;  3BVG A;  4IUP A;  4F7X A;  1CQF A;  3NSW A;  1S5B D;  1F2Z A;  4EQO A;  3L3O C;  3DWA A;  2EJM A;  2R92 B;  5C0X H;  2ICE C;  4KD4 A;  5F2D A;  1CHP D;  3MXP A;  1TWG B;  1NR4 A;  1I4H A;  5K36 G;  2FHT A;  1SND A;  3DWQ A;  4HR7 B;  1O78 A;  4E6I A;  4C3H B;  4IUT A;  5M3F B;  3A8I E;  3S1M B;  3K5O A;  4DXF A;  2MUY A;  1WTP A;  1VDZ A;  4HCE A;  1SAP A;  2SNM A;  3DUZ A;  1Z47 A;  3K7A B;  5KIX A;  1BUV T;  2OF1 A;  1SE2 A;  4TRD A;  2JP1 A;  2QCP X;  4DAV A;  1X32 A;  5BN5 A;  3D3R A;  4DNR B;  1SNM A;  1KDB A;  2SDF A;  1KAA A;  1KDC A;  1ICW A;  5FLX L;  3PIO 3;  1HCZ A;  2X6L A;  3U9S A;  1JCK B;  4LMQ D;  5M5Y B;  1GXD C;  1NUC A;  4X3S A;  5EBC A;  2F0T A;  2L4N A;  5JJZ A;  1HTP A;  4OGQ C;  2K33 A;  4RHS A;  2M2L A;  1B3A A;  3J80 L;  1IW7 C;  2VB3 X;  4EVO A;  5ISR A;  2ZXO A;  4QUF A;  2JEA I;  1ZEQ X;  4ZYS A;  5D3D A;  1EL0 A;  4A3B B;  1KTK A;  3QOL A;  1KAB A;  1G2T A;  3H6M A;  2E2H B;  2EYP A;  1EY9 A;  5EGT A;  3D6C A;  1AZQ A;  1EZ8 A;  5IT9 E;  4IUV A;  4C56 C;  3NWT A;  3QWN A;  2E74 C;  2A68 D;  3V96 A;  3RD4 A;  1DXM A;  2EYH A;  3BZD B;  3MXN A;  2L12 A;  1TQO A;  1DOL A;  2O4X A;  3VYR A;  5A2Q L;  2GA4 B;  4ILW A;  4K6D A;  3NQI A;  5IGD A;  4KKU A;  4R8I A;  3A8J E;  1PRT F;  2DNE A;  5C44 B;  2FJ2 A;  5M5X B;  2NYZ D;  1PLF A;  2Z8L A;  4H44 C;  4F88 A;  4I7Z C;  3KBG A;  1K8O A;  4FF4 A;  2XNA C;  1GHJ A;  1ET6 A;  3I70 A;  3QJY A;  1WTR A;  3GV3 A;  3HOU B;  2PZU A;  4PV1 C;  1HFG A;  1H9S A;  3H91 A;  2JEB I;  1C48 A;  1S5D D;  2PO4 A;  3FEW X;  1C8C A;  3S2H B;  3TP6 A;  3DEO A;  2C9O A;  2HUG A;  1S4Z A;  1SDF A;  2V4D A;  3DEP A;  4ZLT F;  1EEI D;  1GUO A;  1ML0 D;  3Q22 A;  1PZJ D;  2L5T A;  1EYA A;  4XYQ A;  2WP8 J;  3D31 A;  4KTA A;  2FMC A;  1PZI D;  1Y8N B;  5CYU A;  1B9M A;  1B4O A;  1D5X C;  5LL6 X;  3M7N A;  1EY7 A;  1UAP A;  3ND9 A;  1H9K A;  3R3O A;  4C3J B;  1SE4 A;  1I6H B;  3HOY B;  3LNN A;  2NWG A;  4C3H G;  5I2X A;  3AB9 A;  4IFD I;  4KKT A;  2F0M A;  4G4K A;  2MP1 A;  4HMJ A;  2BDN A;  4RKL A;  5CV9 A;  1ET9 A;  3KLR A;  2ENB A;  3S9W A;  3RZD B;  2KA7 A;  2XIW A;  3H94 A;  1PFN A;  1U4R A;  2PZW A;  3NK9 A;  4V19 0;  2PCF B;  3M7G A;  3GO5 A;  4RCN A;  2VB2 X;  4H13 C;  2J4X A;  2A6E D;  3I91 A;  5LL6 S;  1ESF A;  3P1H A;  1K8M A;  2PZT A;  4TSS A;  4G7H C;  3G6J B;  4ME5 A;  2PW5 A;  4CHT B;  2YYZ A;  4DGZ A;  2A6H D;  4K5X A;  1F9R A;  1I4X A;  3MVV A;  5EQ0 A;  1QCB D;  2B63 B;  1BCP F;  1Y8O B;  3ITP A;  2Q8I B;  1HUM A;  5C4Z A;  3FPU B;  4HN7 A;  1DOK A;  1STY A;  3KLS X;  1H9S B;  2F0D A;  4PMC A;  1Q1E A;  5CR3 A;  1VF7 A;  1EY6 A;  3HOZ B;  4DXG A;  1EY4 A;  2KHS A;  2EE1 A;  1PFM A;  3ERQ A;  3MEH A;  5CC4 A;  1EU3 A;  5JEA G;  5KNC A;  2F0L A;  1CTM A;  3HOW B;  2X69 A;  3HOX B;  3MXU A;  1E2W A;  5CBE E;  2F0W A;  3PUX A;  2SOB A;  2BA1 A;  2L9H A;  3W3A A;  1LTB D;  2JYO A;  2XVS A;  4TKO B;  1BNZ A;  1Y1V B;  1U4L A;  2QEJ C;  2SNS A;  2K6A A;  4N9P A;  1ENA A;  1Y69 U;  1QWY A;  5LHY 1;  1PTO C;  1MBY A;  3BS1 A;  4G7O C;  3T56 B;  1TWF B;  3RZO B;  1WTO A;  2N88 A;  2QKI C;  1MD2 D;  1D1K A;  3A54 A;  1EFI D;  3VYU A;  1B2T A;  5IGG A;  4FF1 A;  2WB1 B;  1D5M C;  1B50 A;  4CJ0 B;  2NN6 G;  3Q6S A;  1FR3 A;  2VNU D;  4K2L A;  2IX0 A;  1AP0 A;  3P20 A;  4BA1 I;  1HA6 A;  2RKS A;  4A3J B;  5E3F A;  3NUC A;  2G9H D;  3SHL A;  3S1R B;  4Q5V A;  3NWS A;  2D5D A;  1STG A;  3MC0 B;  2ZXR A;  5CV7 A;  1UUP A;  3J81 L;  3I4N B;  4K5W A;  1JWU D;  4IUQ A;  2CW0 D;  1SFO B;  4I65 A;  4HCS A;  3AMU A;  5HGT A;  3BDL A;  4ZRZ A;  2O2L D;  1SYG A;  2EYM A;  4C3J G;  3MAQ A;  4IZ8 A;  1CQV A;  5KGU A;  3E5S A;  1AEX A;  3IAY A;  1QNK A;  1J9O A;  5C3X A;  1W6J A;  2E75 C;  1HFN A;  2O5I C;  4KY6 A;  5KYI A;  1OXU A;  1V8Q A;  1CI3 M;  3VR4 A;  3SK6 A;  2H4O A;  3C3L A;  4KK7 A;  3C46 A;  1AW7 A;  2HDM A;  4DAY A;  1EWH A;  2M9V A;  1GUT A;  5C4J B;  1LLR D;  1U4P A;  3GTP B;  1G2S A;  1LTT D;  3GTK B;  2F0N A;  5G3L D;  3K5N A;  4ZKC B;  4DF7 A;  3WOF A;  1QJO A;  3V2T A;  3F2U A;  3PUZ A;  2WV6 D;  4KN4 C;  4A3G B;  1VCI A;  3KUP A;  2VXW A;  3SXH A;  4A3E B;  3T53 B;  5FKA C;  2B2Y C;  4A3F B;  1RF2 D;  2JE6 I;  2QIL A;  1TY0 A;  3TZD A;  2D2C C;  3H3V C;  2A68 C;  4O1N A;  4QUC A;  1SJH D;  4CKE A;  1EZ6 A;  4RGO S;  3NPP A;  1F2Y A;  3J7A V;  4K14 A;  4X3U A;  3NTK A;  3PUV A;  1ZKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...