3J81L

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
155
structure length
155
Chain Sequence
STELTVQSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYEKRHKNVPAHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVASATGKANKQFAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 15
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00366 Ribosomal_S17 Ribosomal protein S17
L PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3j81L00
5A2QL 3J80L 3JAML 5LL6X 5FLXL 3J7AV 5IT9L 3J81L
chains in the Genus database with same CATH superfamily
1PRTB 4KJNA 1MI2A 2IWHA 1VQHA 4KMUC 3SR1A 1N33L 3M7NA 5C4JH 5EAYA 3BDCA 1Y69U 1F77A 1KTKA 5KIXA 4PNYA 3I3CA 5LL6S 3RZDH 4NKLA 1WJJA 1J9OA 4QB4A 1IBML 2E5LL 3G4SA 1EIFA 4OIKA 3I4MG 3TZDA 1BUVT 1A15A 2Q8IB 4R4QA 1Q8IA 4JI7L 2E2IH 2EYPA 3J80E 1XPOA 3T56B 1SXTA 1T5EA 1FYCA 5JJLA 2YTXA 2J4XA 2MNAA 1OXVA 1EYDA 3TS0A 2NVTH 1F2YA 3PUYA 3MHBA 4NPSA 1JB7A 2JA8G 1VDZA 1FD7D 4R9WA 3PUXA 3A7AB 3NPPA 3TP5A 3I4NG 2E2HB 4H13C 4X3KA 1AZPA 1PFMA 2NVYH 3CCSA 1XNRL 4GKJL 4J6HA 4BBSG 4DR4L 3CW2C 4A3CG 1VS0A 4IFDH 4PMBA 1TQOA 4N8X1 2G9DA 1G91A 1GUGA 1PLFA 1KL9A 1O7ZA 2A68C 2LS01 1JE4A 1K9MC 2D62A 5IWAL 2NVXH 2CCZA 4Y7NB 3UDIA 1WTXA 2B8FA 2B2UA 4JCVE 1EQQA 4NW2A 1PTOD 1CSQA 3HS0C 4CBVA 1N32L 4A3GG 1EQRA 5DM63 5C0XJ 3D0FA 1KRTA 5IGBA 1MKHA 1DYQA 4P73A 4JC0A 3ITPA 1K8MA 3I4LA 1CHQD 2F0QA 2N88A 3MXUA 4OWWB 3HOWH 1DGSA 3F2CA 2KCTA 1Z7TA 4LAAA 2KECA 4LUVA 1GUOA 3MXGA 1XMOL 4B9WA 4H44C 4KJOA 3C1EA 3H0GG 2NBFA 5M3MG 4LW1A 2F0NA 3J7ZC 1LT6D 4ME3A 5T1IA 4Q0FA 1I50H 3GP7A 3HOVH 4DR2L 1SYBA 1YI2A 2EPBA 4KN4C 4IFDI 3TEHB 3AMUA 3RUZA 3NBHB 2XSCA 4H0LC 4KY5A 3NHHA 2JEBI 1CQVA 2PMZE 1C4QA 1SMYC 5C5MA 3U4ZA 1ZYRD 2AWNA 5DM73 4DUYQ 3U9OA 1VMPA 5G3LD 1HUNA 2K5WA 1I6VC 4I7AA 3SVMA 2JK8A 2BH2A 2XN9C 2ZT9C 3AB9A 1NUCA 2LSSA 2JQOA 1H9SA 2N49A 3A74A 3IL8A 4K0KQ 2JA5H 2BE5C 2I0QA 2HIVA 1X9NA 4LMQD 1JOOA 5ELCA 5K36H 3J81j 4GNXA 4U673 3CMEA 3W1BA 1QNKA 4EQ5A 1IBLL 4F7XA 1FVIA 3CC7A 3GDEA 1PH1A 3ZJYC 3EROA 1E3PA 3GTPB 4UY8C 2K7VA 3S17H 2HUGA 4IURA 1PYBA 2Z8LA 5F2DA 2CW0C 4DV7Q 2B63G 3D3RA 3BVMA 2L12A 1JOQA 2K5DA 1STHA 2HD3A 4ID6A 1X56A 1I5FA 2QCPX 2OF1A 3I4MH 1K8GA 5CBAE 4A3DG 1B44D 3S1NH 4ZCKA 1SAPA 3IFTA 3KF6B 1K83B 1TU2B 5LMNQ 4HSPA 2XRQD 1SNPA 2K5VA 4ZAIA 3PIO3 4DV6Q 1BO0A 1DOLA 3PO3G 4A76A 4N9PA 2WKCA 4A3FG 4B9XA 1SNCA 3QWNA 3NELA 5DNFA 2JA8H 4KY7A 1NSNS 4EGVA 4OX9L 1SNMA 5I2XA 3AQQA 2H1EA 4DR3L 1E24A 3I4NH 4CJ2C 5IYDG 1LTBD 5LHY1 3F2DA 1BOSA 1WFQA 1UEAB 1YNND 3F1ZA 2F03A 1IL2A 1UE7A 4G7HC 2RF4A 2NVQH 2A69D 4BBSH 4HMJA 4GLXA 4A3MG 3CKIB 4JG2A 2F0LA 1E2WA 1TS4A 3FKIG 2GVAA 3K0YA 2AQ2B 4C3JB 1QJOA 2YTVA 4LF5L 1I3QB 2NTTA 1STAA 3MVVA 4KLKA 4TVAB 4U68A 3T1YQ 3KLSX 1K3BC 5IE8A 1NE3A 2O5JC 4M1UB 3FEWX 1VQPA 4POFA 1D7QA 3BU2A 2CH4A 3GTOH 1UWVA 2E8GA 1EFWA 4A3GH 2HHHL 2L15A 3NUCA 4QMGA 1IL8A 4WJ4A 2ID0A 5I4DA 4IPCA 5JVH3 4FNFA 4OONA 1WD0A 4RKBA 1KDBA 3LWUA 4FXGC 1OXXK 4ZLTF 1HA6A 3H0GH 2H5XA 2PZWA 5M3MH 3CD6A 1EY6A 2R7DA 5JOBA 3KOJA 1IHZA 3W1GA 1HJPA 2L4NA 3BVZA 3QJYA 4JYAL 3OOCA 2A5HA 1ASZA 1W3SA 2DNCA 4RCNA 4DV3L 2F1MA 2UXCQ 4GN3B 4C2MH 2XGTA 3NBHA 1WTOA 5BN5A 5D3DA 2B2UC 4QJFA 1B7YB 5ELOA 2PI2A 1NMFA 4EVOA 3T1HL 3ULLA 1Q3LA 4XQNA 4ILWA 3PO2B 1RJTA 1QZGA 1XNQQ 1STNA 4NXNL 3K80C 5EPKA 2ZXPA 3H6MA 4O42A 4BS9A 2L11A 4HTHA 3V96A 2VL6A 4JV5L 3D4RA 2R92B 4LFBQ 4UP7A 2UUAL 4FXKC 1VQ4A 1VQNA 5A35A 4JI1L 5D14A 4DR5Q 1A0IA 2TSSA 1F9PA 4LWCA 5M3FG 2FMCA 4RGNA 2VB2X 4MHEA 2DJGC 4CDCC 2B8GA 1N36L 1H95A 4DV0Q 1STGA 2MP1A 2IJ0A 2OTLA 1TS5A 5GROA 4B3RL 1ET9A 3S9WA 1J6QA 1R9TB 2F0PA 5FLXL 3S14B 1VQMA 1CT1D 1EWIA 4OXPA 3MFYA 3CC4A 4JI6Q 2B63H 1U4PA 2E2JH 3HZXA 1SFOB 3K5OA 5IODA 3S2DH 4JI4L 2F0GA 5GADC 3E3XA 2JP1A 4X3UA 4A3DH 3NTIA 1PYSB 3K58A 5I2YA 5KNBA 1F2MA 3KF6A 3Q0AA 2FFKB 3P1HA 1RTOA 2CHBD 4DUZQ 5J1ZA 2F0VA 2L1BA 3VYTA 3PO3H 1GO3E 4A3FH 1F2LA 1PRTC 2YV5A 1WTPA 5HURA 1EEFD 3RMHA 1QUQB 3KF8A 1L0YB 2L9HA 1ML0D 1LUZA 1O7LA 5CORA 2Q2HA 1Y1VG 2DY7A 2YTYA 1L0WA 1UE5A 4O0AA 1AH9A 1A6XA 3KLRA 5IYDH 4QY7A 1GHKA 3CMAA 2QDLA 4QQBX 4DV4Q 2H4OA 1PH7A 2J7ZA 4A3MH 3GTKH 3FKIH 3V2TA 4DR7Q 2A6HD 1CK1A 4YCVA 1Q1EA 3OW2A 4ZQ3A 1Q82C 1IBKQ 1D8LA 3PF4A 1WD1A 3T53B 1BBUA 3AU7A 4JI2L 4DK1A 4K14A 3K7UC 4ZK9B 3EIVA 3RR5A 4JI5L 1NTGA 1VQIA 4IUPA 3BS1A 4IOAA 3OIPA 4TRDA 3FHWA 4IPGA 3EA6A 1TWAH 2RDGA 3CCLA 4KHPL 4JI0Q 4FF1A 2KEDA 2IW3A 1JCKB 5KGUA 1EQTA 4UPAA 1NJIC 5GAEC 3NENA 4MTNA 1BDOA 1H9KA 1Q81C 4B3ML 2WAQG 1OXTA 3VR3A 1FJGL 2A74C 2K50A 1HRJA 2DUDA 4JBWA 1U5KA 1X54A 3CQZH 1XTDA 3HOXB 3TS2A 5NUCA 3IAYA 1QVCA 1S3OA 3RNUA 1EOTA 1RCVD 4FF3A 1EIHA 4K8IA 3A8KE 3QOLA 1S5DD 1VCIA 1YNJD 3CCQA 2WACA 3VA7A 1PH9A 3S1MB 3NQTA 3S2HH 3ONAB 3M4PA 4OWTB 2JA6B 4AQYQ 2BA1A 4A3IB 3S1QB 2RCFA 2A73B 4DV5L 3SK4A 5HGQA 3B6YA 4QL5A 4RHRA 4KTAA 3VDYA 1VQGA 2IX0A 5IT9L 3GTJH 3RZOH 3DUZA 4K6DA 1CSPA 1E0BA 5GAHC 3QOJA 4BWGB 2QEXA 1LTSD 2ZTEA 1EY8A 2NN6G 2VY3A 2F0HA 2UUBQ 3WWVA 1YVCA 4TSSA 3I4OA 5C4ZA 1YBYA 1ESFA 4IJHA 3SXHA 3JAME 2Z0SA 3FP9A 1WTWA 4GN5A 2XTIA 1IW7C 5M3FH 1CKNA 1HQRD 2WB1G 1HNXL 4QGUA 5LMUQ 5IGEA 3EFXD 4X62Q 1LM0A 1VQLA 5C5LA 1QNUA 2UXBQ 2XWJB 4K6LA 1M4VA 4J8QA 2QW7A 3LWEA 4IOCA 4FYDA 2LXKA 1KDCA 4YHHL 1JMCA 4X64Q 1UUPA 1EU4A 1JC7A 2F0SA 3A0JA 4O2DA 2ICEC 2M9VA 4K5VA 4LF4L 2WINB 4G4KA 4TQUS 4MZ9A 1KRSA 1TIID 1LTRD 2KBNA 2SNMA 2IPKD 2F0MA 1ESRA 1BVSA 1K8OA 5M5WB 5M5XB 4C3HB 5C0XI 4V190 2EIFA 2K5NA 4DAPA 2N55A 1ZKOA 1XMQQ 2FHTA 2D0PA 1Y1VH 2MFIA 2IHFA 1DOMA 1Q8KA 3UDFA 2VQFQ 5C4XB 1B2TA 3GO5A 4WRDA 2K03A 3M3YB 4ZUIA 2PZUA 4HAEA 3OYYA 4R4TA 3MXNA 4HN7A 5CGKA 4X66Q 2ES2A 5C3EH 4RAUC 3OTOQ 1CKOA 2EYLA 3OWEB 3HKZG 4C3IB 2LMCB 2LXJA 5KNDA 5IYCG 2QDBA 1M8AA 3BYYB 4BA1I 3C2PA 5IGFA 2Y0SB 1EWCA 2QILA 2EY5A 2KHSA 1SJHD 1LT3D 4DPGA 2PQAA 1XTCD 4DV1Q 3K57A 4F8MA 3TBIB 4RG1A 1SMXA 3M4QA 1BCPD 5JEAJ 1WCMB 1G291 1RD9D 4Y7NH 3MEFA 4ZRZA 1RHPA 4R8IA 1R4PB 3PQIA 4XDXA 4G7OC 4KKUA 4YWLA 3J81L 1V1PB 3BZKA 1BCPF 1LABA 2A6EC 3MWYW 1BNZA 1U9RA 4L5TA 1F9RA 2I46A 2F0JA 3CF5A 1MJCA 5GQOA 2EYOA 4A3KG 2P5ZX 3HOUB 4DK0A 1QOHA 1C48A 4CKBA 4A3EB 1KC8C 2KUMA 2SNSA 2UXDQ 3GV6A 4BBRB 3ULPA 1NR4A 2AUJD 2HQLA 3H3VC 3A8IE 3M9BA 3LNNA 2Z6BA 3SGIA 4CGYB 2KEEA 4RGOS 1KNAA 1I94Q 1X3EA 1GUWA 1CA5A 1RODA 1YIJA 2EY1A 3KBGA 1OXUA 4LF9Q 3SDZA 2RHSB 1G51A 1I4GA 3A54A 5IGCA 2NN6H 2E75C 2A19A 4CHTB 4OL7A 1MJEA 5FLXE 2VUMB 3D4WA 4XTCS 4DV2L 1U0LA 1UE6A 4X3TA 1TWCB 4DAYB 2ZM6Q 2RDFA 3CC2A 3KDFB 2CWPA 1MIUA 2HQEA 4X6AH 2DJFC 2EE1A 2J0TD 3SE0A 1D5MC 3W5OA 2FXQA 2L5TA 1KLGD 1IYJB 2R92G 2KCCA 3H91A 1IBMQ 3RLFA 2A8VA 2E5LQ 3PIP3 4DUYL 1KIXA 2B2VA 1VQEA 1C7YA 4LJZC 1OO9B 4J1MA 5E4WC 3TRZA 3T4AC 2DGYA 2PZTA 2AKWB 2CFMA 2NN6I 4BY1B 4K0KL 2BA0A 1TWHB 1QCBD 4APVA 5BR8L 2NZOA 2YYZA 1TWGB 2R7ZB 2ZXOA 2IT1A 1DCZA 3A55A 3RZDB 1AZQA 3C3LA 1VQ6A 1SSOA 1JORA 1DJRD 4K2KA 1WYDA 4ABNA 4LF7Q 1K83H 3DM3A 3I55A 3ERSX 3K6OA 5IP9G 3JAMi 5FKAC 4Q5VA 4L63B 1IZ6A 1XNRQ 1G2SA 5C3WA 2E2IB 3S16H 1EQVA 1TWFH 4A93G 4A75A 1VQFA 1HFGA 3VA5A 2JSOA 2RKSA 3SK8A 1S5BD 2AUKA 1SLJA 2RSOA 3L0OA 5IWAQ 5JAVA 3MC0B 1N8RC 3DWQA 4GOPB 2NZHA 3FRPB 4DXGA 5EJWA 3M4YA 4R4OA 2EJGC 3QIAA 4PZ6A 1L2FA 1QE6A 4RCOA 1B4OA 1Q46A 1JOKA 2NVYB 3HOYB 4OELB 3ICEA 3QG1A 1G8ZD 4DFAA 1JQYD 3PMFA 1I3QH 1PH4A 3LX0A 1EYCA 1L1OB 2F4VL 4HJ9A 4DR2Q 1PTOB 3PGZA 1PH3A 1J5EQ 1Q90A 4NXML 4UAIA 3JAMc 5J22A 4KV6A 5IT9E 2EYJA 1MGSA 4A3KH 4R4CA 1LTTD 1B70B 3F8TA 4UHVA 3X3MA 4EQPA 4JI3L 5ELNA 3RD4A 3FDTA 3EBEA 4RWSC 4FXDA 3E5SA 3KK7A 2Z9HA 3TN2A 2N78A 4B3TQ 1ONLA 4LNQA 1RTNA 1GHJA 3UDXA 1I50B 1GKHA 3HOVB 3NSWA 5FOBB 3KJOA 3M4OH 4NDXA 2HCCA 1SNQA 4L5SA 4XQJA 1AN8A 1LV9A 2B2WC 3ULJA 4ALPA 4A3IG 3D31A 1YHAA 4GN4B 4HEDA 2G5DA 3IFDA 1LO5D 5CV8A 3SK6A 5E7NA 3CCMA 2Z6KA 3BZCA 1FNVA 2K14A 1HUMA 4XXEA 1W6JA 2ZTCA 4B3SQ 4A3CH 5A2QL 1D6EC 5KNCA 3I56A 5JEAG 1X6OA 5H1SE 2AQ1B 1XPUA 1S4ZA 2K01A 1UAPA 3G7LA 2Q2UA 1X55A 3KDFA 2PNHA 5AJ3Q 1BKBA 2UXCL 3I91A 1A63A 1ASYA 2R92H 3E9IA 3RN5A 1S5FD 5DLQE 1F2ZA 2N8NA 2PQEA 3OSOA 1HZCA 4IPDA 1SE3A 2K75A 1E2VA 1W6KA 2EYHA 3J80i 1XNQL 3S15B 4BY7B 5ELBA 2EOTA 1DXMA 3S14H 1SMYD 2Y0SE 2I5LX 3S17B 1H9RA 4QIWB 4ZYSA 2KVMA 3L2PA 2GN5A 1SFOH 1PH5A 4A3LG 5BN3A 1VQAA 4OX9Q 5KEEA 2NB0A 3CCEA 1SE4A 4X65Q 3GTQH 4MN3A 5JPNC 3GTMH 1V1QA 4GLVB 3CAMA 1EY5A 5IP9H 2BE5D 4DV0L 1DM0B 4C3HG 4YY3Q 2B2TA 4LF8Q 4WFN3 2B2VC 5EKLA 1CTMA 1K8AC 1HNZQ 3TZUA 3V05A 2X6GA 2CWAA 1AEXA 5E1FA 4DR6Q 4A93H 4WJWA 4C56C 1XWEA 4OO1G 4AYBB 1MHWC 4N9TA 3KLWA 1FL0A 3OPOA 4JI8Q 4DXFA 4A3JG 2JA7G 2KHIA 1NY4A 1E2ZA 2QEJC 2JA8B 4RMFA 1RDPD 2VQEL 1B3QA 1EIYB 2VNUD 4GOPA 3MZ5A 3NP8A 3K7AH 3J80c 3J81E 3NEMA 4LF6Q 2CW0D 2HHHQ 2IX3A 1YNXA 4KI0A 1VF7A 3KJPA 4DUZL 4BBSB 3MEHA 1FR3A 1Q1BA 1AE3A 2UUCQ 3J7YW 2WIIB 1KQSA 1EY7A 3R2IA 2MJ8A 1WOCA 3J80L 2VXWA 2HDMA 1EWHA 2MQHA 5M9OA 4S3SA 1HHVA 2E74C 3A7LA 3GTOB 4P74A 5CYUA 2DY8A 4DV3Q 1PMRA 5IOCA 1F9SA 3CP0A 2X6LA 3TMEA 4R8NA 2HT1A 1HZBA 5HY6A 3NTHA 3T1HQ 5CV9A 4XQQA 1IBKL 1I6HB 4NB3A 1CM9A 4KK7A 3H0GB 3SEBA 1PFNA 2BDOA 5ELFA 3HOUG 3L9AX 2NUCA 5E4XA 4DNTB 1JJ2A 1PH8A 3WOFA 1P16A 2HDLA 1EY4A 4K5WA 3DWPA 3HOZB 2E2DC 1WVLA 1TY2A 4DF7A 4DKAC 4BBRG 3C1FA 5ISRA 1STEA 4HIMA 4A3IH 1WTRA 3S1QH 2HIXA 2Z1CA 1HPCA 3CCVA 4LFAL 1WTVA 1DOKA 1D5ZC 3STBC 4AIMA 4LFCQ 4M8AA 1TXYA 3NTKA 4CKCA 4GZYC 1AFPA 3D4DA 1V9PA 2KENA 4DR1L 2YU9H 1AP0A 5JEAH 1N36Q 1G6ZA 4KY6A 4IZ8A 1QVFA 5C4HA 3IKJA 3U50C 4DN4M 1ICFB 4UDUC 1A8VA 2VUMG 1A3VA 1N9WA 1Z9FA 5DEHA 4AQYL 4G7ZC 3K81C 2X69A 4POGA 4G57A 4IQZA 2SOBA 3DHQA 1TT2A 2R7FA 1BQQT 5ELEA 2B3GA 3I7FA 3E0EA 1MBYA 4KN7C 1XJVA 1CZGA 1EU3A 1EL0A 1K0SA 3T13A 2K1BA 2Z6KC 2M2LA 4K8JA 2UUBL 5LL6X 1BXTA 1I4RA 4GS3A 5EKIA 3AFPA 4HSVA 5CMDA 2E2JB 2B39A 5J39A 1CA6A 4A3LH 1SBBB 5JPMC 2K32A 4IUNA 1XPRA 4BY1G 4GKKQ 2OQ0A 5LMUL 4X62L 5M5XH 3I70A 4ODGA 4A3DB 3GQBA 1TS3A 4PMCA 4O1NA 4C3HH 1UNSA 2UXBL 2R7ZG 4FF4A 2E76C 4HR7B 4R1JA 1D2BA 3AYHB 3NE5B 2IX1A 3H15A 1E1OA 3PO3B 4X64L 4A3FB 4OO1H 2K52A 2RQXA 4PZ7A 4A3JH 2JA7H 5DAUA 2K5QA 4OEMB 1OTCA 1B9MA 2EXDA 1HQMC 3SK5A 1SDFA 2UU9Q 1HR0L 1NCVA 1PH2A 1UE1A 3M3YH 3U9SA 1PFBA 4WJ3M 4FO2A 4HCSA 4HJ5A 4A3BB 1RL2A 1X3QA 4KHPQ 1NNXA 1X3FA 5CV7A 2OQKA 4A3MB 3P75A 3PIOA 1HNWQ 2BH8A 4L5RC 1A3TA 3FKIB 5JJKA 2B2TC 2L0CA 3I90A 1I4PA 2QKIC 2V1CC 5EKKA 1XMQL 2L55A 2R93B 3HOYG 3OWFA 4XYOA 2KCMA 1VQ5A 3S1RH 4UP8A 2CH4W 4IFDG 2VQFL 4MTKA 4A4IA 3I2ZA 4P2CB 2Q8RE 2NTSA 2EY2A 1X3GA 3E9HA 4JOIC 2K4KA 1PRTD 3VYRA 5I9PA 4X66L 1S72A 4BXXG 1FGBD 3E6ZX 4GOPC 1N34L 2F0DA 2EJMA 3MTSA 4P72A 4QUCA 1CUKA 1PRTF 5I6YA 1PZJD 3AFQA 4JBMA 1GJXA 3N52A 3HOUH 3KBXA 3CQZB 1SROA 5TSSA 2JN4A 1YEZA 5FO7B 1XYIA 4DV1L 4QUFA 3NQIA 4BBRH 2F0FA 1QUQA 5FO9B 2OTJA 4QIWE 3GTGB 3QR8A 2F0IA 1YITA 3G6EA 1L1OC 4JBKA 5FLMG 3S2HB 1VQOA 1PTOC 4NMZA 4YCWA 1LTID 3HOVG 4JW0A 1KABA 3DEOA 3RLOA 1E7ZA 1V1OA 1TS2A 4DGZA 1EEID 3CCRA 1HNXQ 1EFID 1PH6A 3UI2A 3RZOB 2KCNA 2C5CA 4RA8A 5D3IB 4ZKCB 2E2HH 3H09A 1SEBD 3HRZC 4MIUA 1VF5C 1VQDA 3VYSA 4LK1C 2UXDL 1AE2A 4YHHQ 3S24A 2F0TA 1TWCH 4AYBE 4HJ8A 1H9SB 1XX8A 1MSGA 4C3JG 3R93A 4B08A 1I94L 2EY6A 1SYEA 5M3FB 3K5LA 2JE6I 1ET6A 1H9MA 4LF9L 3HEJA 1ZYRC 2ZJPA 4GNXB 4EQNA 5CBEE 1XXGA 2B2WA 4CJ1B 3K5NA 1LACA 3DLLA 1QZHA 1KHIA 5CR3A 2F0UA 2GA4B 3SHLA 4BY7G 4WORA 5CV4A 3QO2A 5T1GA 2ZM6L 1IYUA 1TVXA 4RHSA 3CCJA 4BY1H 1HZAA 1TWHH 1G2TA 3J7AV 2R3ZA 3CPFA 3GTLB 1LTAD 2K5HA 2VB3X 4KKTA 1TWGH 1CHPD 2O5IC 3K8AA 2R7ZH 1BBXC 3HKSA 1JT8A 1VQCA 2O2LD 3Q8DA 1Y8NB 4DAMA 2C35B 1H9JA 3I72A 1IW7D 4C1NI 1EYGA 2KHJA 3NK9A 5C44B 4L8JA 1HTLD 2MO0A 4ZUJA 4ZKBB 4E6IA 4BA2I 1QVGA 1HFNA 1Y1VB 3J7AF 4F87A 2PW7A 3PO2G 2O4XA 3TP7A 4AYBG 4NP5A 1ZEQX 2RVLA 3J7A5 3ER0A 1YHBA 2Q2IA 2PCFB 5M5YB 2RDHA 5CV6A 2M00A 1N33Q 2B2YC 5C3EB 1HCZA 1PZID 4LF7L 3DWAA 1DD2A 3HOYH 2AWOA 4DA2A 1EY0A 3HP3A 1K73C 2QGQA 3A5UA 5EQ0A 1SYGA 2IHEA 2PW5A 1Y1WB 1D1KA 1T9HA 1CKMA 5AFWA 3BJUA 1LT5D 4GLAC 3GTPH 1BCPB 5C3XA 4JI7Q 3AEVA 1PDQA 3LGJA 3GD7A 5JVG3 3OW7A 5K5PA 4BXXH 3FVQA 3R2TA 4HCEA 1YNNC 1PTOH 4CDFC 1ILPA 5C4JB 1SNOA 4YWKA 1MSHA 4IPHA 2A69C 3CHBD 2WAQB 3KYHC 1JB3A 1K0RA 2KOLA 3PUWA 2MUYA 2FJ2A 4KHZA 3OHXC 4MNOA 2D0OA 3BDOA 4JBJA 1PTOF 3BZDB 3ND8A 4R4IA 4H02A 2FINB 1IKMA 1A2TA 3NWSA 2RCNA 1I4HA 1C9OA 4C1NK 4DV2Q 4GKJQ 2AMCB 3A8JE 3CU7A 3TQYA 5FLMH 4DR4Q 1T5XD 1WI5A 2G9HD 1SN8A 1SYDA 1O7YA 3HOZG 5IYBG 5KYLA 4DV7L 3HG9A 3D6WA 3G71A 2NVTB 1U4RA 3M7GA 1YJNA 1S40A 1J5EL 2WV6D 1FNUA 3F2UA 2KA7A 1IYVA 1NR2A 2JJQA 5J3BA 1Y14B 1VQ8A 1Z6HA 1NAPA 1FGUA 2WP8J 3DM1A 1PYWD 2D9UA 1KAWA 3HGBA 5LMNL 1N32Q 2ATWA 5IYCH 1B50A 3UDGA 2F3IA 2I5HA 2A6ED 2XIWA 4DV6L 5JJIA 4B3TL 4JK1C 4C3JH 5G3LF 3FPPA 2EDGA 1TR5A 3JC66 2D5DA 1XMOQ 2WB1B 4DNRB 3H3VH 4OWXB 3WOEA 5BR8Q 1B1ZA 3NXWA 1EIGA 1YJ9A 2K28A 2LY7A 2NVXB 4YCUA 3C46A 2RBMA 3TP6A 4IALA 1V1PA 5C6AA 2XNAC 4IO9A 2N3SA 2K33A 2F3VA 3VR4A 4B3SL 3S15H 2VZAA 4BY7H 1EOVA 3OIQA 1QWYA 1X65A 2BDNA 2OEOA 2NZ1D 1VQ7A 3HOWB 1E22A 5AJ3L 3EN2A 1RF2D 5BN4A 3HOXG 4KKSA 2DN8A 1DZ1A 3T1YL 2OT2A 3JAML 1STBA 3PF5A 1W2BA 3H94A 3EVQA 3BDLA 4CJ0B 1EZ8A 5FO8B 4UP9A 2EZVA 1PV4A 4JPBW 2JA6G 2A68D 1M90C 3H3VI 1A3UA 3OMCA 4JVZA 2EXZA 4OHJA 2BOSA 1D1IA 2D2CC 3G48A 1QG7A 1IBLQ 3PO2H 4Z9CB 4IUQA 3ERQA 3S16B 1TWFB 1D5XC 1KXLA 2MPMA 3KF8B 4RGTA 2I5MX 3K59A 2I07B 1I4XA 4DAYA 4HJ7A 2XWBB 3CRKC 5COYA 4X65L 5I6WA 2PO4A 2KQ3A 2F4VQ 2JA5B 1Q86C 3KLSA 4K2LA 3HKZB 1AW7A 1ICWA 4YY3L 4NXMQ 4LF8L 4A3BG 4YWMA 3DEPA 1HNZL 4AH6A 2R6GA 3DMUA 4DR6L 1PVOA 3TP8A 5IP7G 4JI3Q 3L7ZC 2R93G 4JI8L 1R9TH 4HIKA 1HH2P 4PV1C 2VS1A 3U4VA 3L3OC 2ASBA 3O13A 3MXPA 4N8FA 4I65A 1LTGD 2JEAI 1ENCA 1CI3M 1EZ6A 2C9OA 1LT4D 3N6RA 4J15A 5EGTA 4LF6L 4LFBL 2JXMB 2PNRC 1SYCA 4DR5L 2ICIA 2A6HC 3P7JA 4IFDJ 4TKOB 3D8GA 2HCIA 4A3KB 3I4MB 2F0WA 4DR3Q 1K28A 2Q8TA 2UUCL 1KNEA 1NMGA 1PFSA 3S1NB 1I6HH 2JYOA 1F9QA 2QF7A 1U4MA 5GAGC 4CDEC 5IYBH 3HOZH 1IXRA 4JI6L 1C0AA 4I7ZC 1L0XB 2EYFA 2ZXRA 2F4IA 4LF5Q 2VW9A 3M4OB 2OXPA 2WKDA 4JOIA 2FMMA 2NWGA 3R3OA 1PXUA 5C4XG 4YIJA 3CRLC 3I4NB 2ALYB 2KJXA 2RHQB 1SE8A 1J8IA 3A5ZB 4DU9A 3Q22A 4FF2A 2AQ3B 5EBDA 1A2UA 1TKWB 2NVQB 5KYIA 2XVSA 1HA5A 1CFMA 1JWMD 2RA4A 4XYQA 1OXSC 1A62A 1HR0W 1YNJC 4C3IG 1IKLA 2Z4HA 2F0KA 1GD7A 2NYZD 1SR3A 1Z47A 2Y0SG 1GUSA 3VR5A 5C0XG 1GUNA 5FLXc 4KHVA 1L1OA 4FDBA 1CKNB 4JYAQ 4IN3A 1O78A 4DV4L 2Z4IA 4KD4A 5EPLA 4LFCL 3UE0A 1RIPA 2IY5B 1WCMG 2F0OA 4XT1B 4F88A 4A3GB 3GV3A 5FJ8G 4DR7L 1SYFA 2EYMA 3TREA 3E0JA 1ILQA 1YJWA 1SE2A 3HOXH 1JWSD 4OGQC 1LLRD 2JA9A 2PPBC 5M3MB 4NXNQ 5I9OA 4A3EG 5EPJA 3MFGA 3S1MH 4DK6C 2VQEQ 3BVGA 4JI0L 3PIPA 2JA6H 4JV5Q 1K3RA 3GTQB 3I73A 4C2MB 4GNXC 3GTMB 2TMPA 2WAQE 5CV5A 1VMCA 5D65A 2UUAQ 5IGGA 1BBWA 4JI1Q 1HZ9A 1Q12A 1EUJA 3CPWA 1V8QA 5C44G 5HGTA 4A93B 2CQOA 3FPUB 3UE1A 3PUVA 4CDDC 1BR9A 1VQ9A 4B3RQ 1SRUA 1P8LA 4GKKL 1R4QB 2CQAA 1DONA 1CZWA 5JJZA 4A3BH 2SEBD 3K7AB 1GM5A 1ENAA 2QA4A 3MXNB 1HXYD 1YHQA 3OMGA 4HIDA 4JI4Q 3I8ZA 2PI2E 5C3EG 3EQLC 3WDNA 3ZYYX 4HIOA 3VR2A 5IP7H 3M85A 4KD3A 1KDAA 1U4LA 2ZTDA 2R93H 1M1KC 1KD1C 4XIGS 1Y1WG 2UU9L 3R8BA 2PQAB 1ZXTA 3K5MA 4P71A 2EQSA 4EQOA 2B63B 4CKEA 3W2DA 1PA6A 2XRSD 2WB1E 2GVBA 3X3NA 1SNDA 3S2DB 1HNWL 5EBCA 5IGDA 4LFAQ 5M5WH 4PZ8A 4DNIA 2B2YA 4V0BA 2PMZB 3BG3A 2CKZB 2OCEA 1JICA 2SDFA 3U58A 1JWUD 4DR1Q 1Y8PB 4EX5A 4ME5A 1C8CA 4RFBA 3VYUA 5IT9c 1BCPC 1Y8OB 3VR6A 1B53A 1BF4A 1II3A 3GTGH 2F3WA 3T16A 1E1TA 1B9NA 1WTQA 3PV0A 4DAVA 4HJAA 4JI2Q 3D6CA 4RKLA 1VQBA 2AHOB 5ELDA 3BYTB 5E3FA 5C4XH 1JE5A 1JJGA 4JI5Q 2BCOA 3TSSA 4PQXA 3HFZB 1B3AA 1NBWA 2A1AA 4L5QA 2DNEA 4LUZA 4IUTA 3ND9A 1QB5D 4QF4A 3PCOB 3K0XA 3GTKB 2YU9B 3CCUA 2K6AA 4C3IH 2MGSA 1X3PA 4B3MQ 3P20A 1GUTA 1FJGQ 4IUVA 4Y52H 4HMIA 5C0XH 1JR0D 2K05A 2PYKA 3G6JB 2Q2TA 3DXJC 4OO1I 1JJCB 1WCMH 2ZJQA 4RGMA 1O80A 2CVRA 4LUOA 1GOZA 1TWAB 5FJ8H 3CXCA 3Q24A 2MO1A 2F0EA 3HKZE 3OTOL 1CQFA 4DV5Q 1LYLA 1X32A 3MAQA 5IIFA 5KRUA 4DK3C 3STBD 1GVPA 3KUPA 1QILA 1PHJA 2MHVA 1UEBA 5A2QE 4P75A 1YZ6A 3EJIA 5L37A 4A3EH 1I4QA 4L6TB 1G6PA 2R61A 3HOWG 5IY0A 3J81i 3GTLH 1ENFA 5CC4A 4OIJA 2V4DA 1HR0Q 1FNWA 2K04A 1RKNA 4ULLA 2IL8A 3PUZA 4XT3B 3QB3A 2LFNA 1S5ED 5C44H 3GTJB 1MD2D 3URYA 4FP5D 3Q6SA 4A3JB 2JA7B 1HTPA 1S5CD 4K5XA 2VUMH 5FK9C 4X3SA 2ZJRA 3A56A 2EVBA 3TDQA 4QCLA 1O7IA 3NWTA 2LKVA 3NBIA 4IJLA 2WFWA 3MA2B 1EY9A 1SJED 4H7BA 5M5YH 1KAAA 3KFUA 4FVMA 4LF4Q 2F52A 3W3AA 1VQKA 1N34Q 5LMNW 2B29A 4IUUA 1KLUD 1V43A 2JA5G 3F2BA 2EJFC 1WTHA 1GXDC 4RH6A 1VQJA 2RSNA 5K36G 1B8AA 1LTLA 3FMCA 3RN2A 1PZKD 3RLNA 3Q23A 4PG3A 1STYA 1Y1WH 3J81c 4PMWA 3PSIA 3IRBA 1Q7YC 1EYAA 1TY0A 3S1RB 2OWOA 3T51B 2ENBA
chains in the Genus database with same CATH topology
1PRTB 4KJNA 1MI2A 2IWHA 4KMUC 3SR1A 3M7NA 3BDCA 1Y69U 1F77A 1KTKA 5KIXA 4PNYA 3I3CA 5LL6S 4NKLA 1J9OA 4QB4A 4OIKA 3TZDA 1BUVT 1A15A 2Q8IB 1Q8IA 2EYPA 3J80E 3T56B 1SXTA 1T5EA 1FYCA 2J4XA 1OXVA 1EYDA 1F2YA 3PUYA 3MHBA 1VDZA 1FD7D 4R9WA 3PUXA 3A7AB 3NPPA 3TP5A 2E2HB 4H13C 4X3KA 1AZPA 1PFMA 4J6HA 4IFDH 4PMBA 1TQOA 2G9DA 1G91A 1GUGA 1PLFA 1O7ZA 2A68C 2LS01 1JE4A 2D62A 4Y7NB 1WTXA 2B8FA 2B2UA 4NW2A 1PTOD 3HS0C 4CBVA 5DM63 5C0XJ 5IGBA 1DYQA 3ITPA 1K8MA 3I4LA 1CHQD 2F0QA 2N88A 3MXUA 1Z7TA 4LAAA 2KECA 1GUOA 3MXGA 4B9WA 4H44C 4KJOA 3C1EA 2NBFA 2F0NA 1LT6D 5T1IA 4Q0FA 3GP7A 1SYBA 2EPBA 4KN4C 4IFDI 3AMUA 3RUZA 2XSCA 4H0LC 4KY5A 3NHHA 2JEBI 1CQVA 1C4QA 1SMYC 5C5MA 1ZYRD 2AWNA 5DM73 3U9OA 1VMPA 5G3LD 1HUNA 2K5WA 1I6VC 3SVMA 2XN9C 2ZT9C 3AB9A 1NUCA 1H9SA 3IL8A 2BE5C 4LMQD 1JOOA 5ELCA 5K36H 4U673 1QNKA 4F7XA 3EROA 3GTPB 2K7VA 2HUGA 4IURA 2Z8LA 5F2DA 2CW0C 3D3RA 3BVMA 2L12A 1JOQA 2K5DA 1STHA 4ID6A 2QCPX 2OF1A 5CBAE 1B44D 1SAPA 3IFTA 1K83B 1TU2B 4HSPA 2XRQD 1SNPA 4ZAIA 3PIO3 1BO0A 1DOLA 4N9PA 2WKCA 4B9XA 1SNCA 3QWNA 5DNFA 4KY7A 1NSNS 4EGVA 1SNMA 5I2XA 2H1EA 4CJ2C 1LTBD 5LHY1 1BOSA 1UEAB 1YNND 2F03A 4G7HC 2A69D 4HMJA 3CKIB 2F0LA 1E2WA 1TS4A 3K0YA 2AQ2B 4C3JB 1QJOA 1I3QB 2NTTA 1STAA 3MVVA 4U68A 3KLSX 2O5JC 4M1UB 3FEWX 3NUCA 4QMGA 1IL8A 2ID0A 5I4DA 5JVH3 4FNFA 1WD0A 4RKBA 1KDBA 3LWUA 4FXGC 1OXXK 4ZLTF 1HA6A 2PZWA 1EY6A 5JOBA 1IHZA 2L4NA 3BVZA 3QJYA 3OOCA 2A5HA 2DNCA 4RCNA 2F1MA 3NBHA 1WTOA 5BN5A 5D3DA 2B2UC 4EVOA 1Q3LA 4XQNA 4ILWA 3PO2B 1RJTA 1STNA 5EPKA 2ZXPA 3H6MA 4O42A 4BS9A 2L11A 4HTHA 3V96A 3D4RA 2R92B 4FXKC 5A35A 5D14A 2TSSA 1F9PA 2FMCA 4RGNA 2VB2X 4MHEA 2B8GA 1STGA 2MP1A 2IJ0A 1TS5A 1ET9A 3S9WA 1R9TB 2F0PA 5FLXL 3S14B 1CT1D 3MFYA 1U4PA 3HZXA 1SFOB 3K5OA 5IODA 2F0GA 2JP1A 4X3UA 3NTIA 3K58A 5I2YA 5KNBA 1F2MA 3Q0AA 2FFKB 3P1HA 1RTOA 2CHBD 5J1ZA 2F0VA 2L1BA 3VYTA 1F2LA 1PRTC 1WTPA 5HURA 1EEFD 3RMHA 3KF8A 1L0YB 2L9HA 1ML0D 1O7LA 5CORA 2DY7A 1A6XA 3KLRA 1GHKA 2H4OA 2J7ZA 3V2TA 2A6HD 1CK1A 1Q1EA 4ZQ3A 1WD1A 3T53B 3AU7A 4DK1A 4K14A 4ZK9B 4IUPA 3BS1A 3OIPA 4TRDA 3EA6A 2RDGA 4FF1A 2KEDA 2IW3A 1JCKB 5KGUA 1EQTA 1BDOA 1H9KA 1OXTA 3VR3A 2A74C 1HRJA 4JBWA 3HOXB 5NUCA 3IAYA 1EOTA 1RCVD 4FF3A 1EIHA 4K8IA 3A8KE 3QOLA 1S5DD 1VCIA 1YNJD 2WACA 3VA7A 3S1MB 3NQTA 3ONAB 2JA6B 2BA1A 4A3IB 3S1QB 2A73B 3SK4A 4RHRA 4KTAA 2IX0A 5IT9L 3DUZA 4K6DA 1E0BA 3QOJA 4BWGB 1LTSD 1EY8A 2NN6G 2F0HA 4TSSA 5C4ZA 1ESFA 3SXHA 3JAME 1WTWA 1IW7C 1HQRD 5IGEA 3EFXD 5C5LA 1QNUA 2XWJB 4K6LA 1M4VA 4J8QA 3LWEA 4FYDA 1KDCA 1UUPA 1EU4A 1JC7A 2F0SA 2ICEC 2M9VA 4K5VA 2WINB 4G4KA 4TQUS 1TIID 1LTRD 2SNMA 2IPKD 2F0MA 1ESRA 1K8OA 5M5WB 5M5XB 4C3HB 5C0XI 4V190 4DAPA 2N55A 1ZKOA 2FHTA 1DOMA 5C4XB 1B2TA 3GO5A 4WRDA 2K03A 3M3YB 4ZUIA 2PZUA 4HAEA 3MXNA 4HN7A 5CGKA 4RAUC 2EYLA 3OWEB 4C3IB 2LMCB 5KNDA 2QDBA 1M8AA 3BYYB 4BA1I 3C2PA 5IGFA 2Y0SB 1EWCA 2QILA 2EY5A 2KHSA 1SJHD 1LT3D 1XTCD 3K57A 4F8MA 3TBIB 5JEAJ 1BCPD 1WCMB 1G291 1RD9D 4ZRZA 1RHPA 4R8IA 1R4PB 4XDXA 4G7OC 4KKUA 3J81L 1V1PB 1BCPF 1LABA 2A6EC 3MWYW 1BNZA 1U9RA 1F9RA 2I46A 2F0JA 2EYOA 3HOUB 4DK0A 1QOHA 1C48A 4CKBA 4A3EB 2KUMA 2SNSA 3GV6A 4BBRB 1NR4A 2AUJD 3H3VC 3A8IE 3LNNA 4CGYB 2KEEA 4RGOS 1KNAA 1GUWA 1CA5A 1RODA 2EY1A 3KBGA 1OXUA 3SDZA 1I4GA 3A54A 5IGCA 2NN6H 2E75C 4CHTB 4OL7A 5FLXE 2VUMB 3D4WA 4XTCS 4X3TA 1TWCB 2RDFA 2HQEA 2EE1A 2J0TD 3SE0A 1D5MC 2L5TA 1KLGD 2KCCA 3H91A 3RLFA 3PIP3 2B2VA 4LJZC 1OO9B 4J1MA 5E4WC 3T4AC 2PZTA 2NN6I 4BY1B 2BA0A 1TWHB 1QCBD 2YYZA 1TWGB 2R7ZB 2ZXOA 2IT1A 1DCZA 3A55A 3RZDB 1AZQA 3C3LA 1SSOA 1JORA 1DJRD 4K2KA 4ABNA 3K6OA 4Q5VA 5FKAC 4L63B 1G2SA 5C3WA 2E2IB 1EQVA 1HFGA 3VA5A 2JSOA 2RKSA 3SK8A 1S5BD 2AUKA 2RSOA 5JAVA 3MC0B 3DWQA 3FRPB 4DXGA 5EJWA 3M4YA 2EJGC 3QIAA 1QE6A 4RCOA 1B4OA 1JOKA 2NVYB 3HOYB 3QG1A 1G8ZD 4DFAA 1JQYD 3PMFA 3LX0A 1EYCA 1PTOB 1Q90A 4UAIA 5J22A 4KV6A 5IT9E 2EYJA 1MGSA 1LTTD 3X3MA 4EQPA 3RD4A 3FDTA 4RWSC 4FXDA 3E5SA 3KK7A 3TN2A 1ONLA 1RTNA 1GHJA 1I50B 3HOVB 3NSWA 5FOBB 4NDXA 2HCCA 1SNQA 4XQJA 1AN8A 1LV9A 2B2WC 3D31A 4HEDA 3IFDA 1LO5D 5CV8A 3SK6A 1FNVA 1HUMA 4XXEA 1W6JA 5A2QL 1D6EC 5KNCA 5JEAG 2AQ1B 1S4ZA 2K01A 1UAPA 3G7LA 3I91A 1S5FD 1F2ZA 2PQEA 3OSOA 1SE3A 1E2VA 1W6KA 2EYHA 3S15B 4BY7B 5ELBA 2EOTA 1DXMA 1SMYD 3S17B 1H9RA 4QIWB 4ZYSA 2KVMA 5BN3A 5KEEA 2NB0A 1SE4A 4MN3A 5JPNC 1EY5A 2BE5D 4C3HG 1DM0B 2B2TA 4WFN3 2B2VC 5EKLA 1CTMA 3TZUA 3V05A 2X6GA 1AEXA 5E1FA 4WJWA 4C56C 1XWEA 4OO1G 4AYBB 4N9TA 3OPOA 4DXFA 1E2ZA 2QEJC 2JA8B 1RDPD 2VNUD 3MZ5A 3NP8A 3J81E 2CW0D 2IX3A 4KI0A 1VF7A 4BBSB 3MEHA 1FR3A 1Q1BA 3J7YW 2WIIB 1EY7A 3R2IA 2MJ8A 3J80L 2VXWA 2HDMA 1EWHA 5M9OA 4S3SA 1HHVA 2E74C 3A7LA 3GTOB 5CYUA 2DY8A 1PMRA 5IOCA 1F9SA 2X6LA 3TMEA 4R8NA 3NTHA 5CV9A 4XQQA 1I6HB 1CM9A 4KK7A 3H0GB 3SEBA 1PFNA 2BDOA 5ELFA 3L9AX 2NUCA 5E4XA 4DNTB 3WOFA 2HDLA 1EY4A 4K5WA 3DWPA 3HOZB 2E2DC 1WVLA 1TY2A 4DF7A 3C1FA 5ISRA 1STEA 1WTRA 2Z1CA 1HPCA 1WTVA 1DOKA 1D5ZC 4M8AA 1AFPA 3NTKA 4CKCA 4GZYC 3D4DA 1AP0A 5JEAH 1G6ZA 4KY6A 4IZ8A 5C4HA 3IKJA 4DN4M 4UDUC 1A3VA 5DEHA 4G7ZC 2X69A 4G57A 4IQZA 2SOBA 3DHQA 1TT2A 1BQQT 5ELEA 1MBYA 4KN7C 1CZGA 1EU3A 1EL0A 3T13A 2K1BA 2M2LA 4K8JA 5LL6X 1BXTA 1I4RA 5EKIA 4HSVA 5CMDA 2E2JB 2B39A 5J39A 1CA6A 1SBBB 5JPMC 2K32A 4IUNA 3I70A 4ODGA 4A3DB 3GQBA 1TS3A 4PMCA 4O1NA 1UNSA 4FF4A 2E76C 4HR7B 1D2BA 3NE5B 2IX1A 3PO3B 4OO1H 4A3FB 2RQXA 5DAUA 2K5QA 1B9MA 1HQMC 3SK5A 1SDFA 1NCVA 3U9SA 1PFBA 4FO2A 4HCSA 4A3BB 1X3QA 5CV7A 4A3MB 3P75A 1A3TA 3FKIB 2B2TC 2L0CA 3I90A 1I4PA 2QKIC 5EKKA 2L55A 2R93B 3OWFA 4XYOA 4IFDG 4P2CB 2Q8RE 2NTSA 2EY2A 1PRTD 3VYRA 5I9PA 1FGBD 3E6ZX 2F0DA 2EJMA 3MTSA 4QUCA 1PRTF 5I6YA 1PZJD 1GJXA 3N52A 3KBXA 3CQZB 5TSSA 5FO7B 1XYIA 4QUFA 3NQIA 2F0FA 5FO9B 3GTGB 2F0IA 3S2HB 1PTOC 4NMZA 1LTID 1KABA 3DEOA 1V1OA 1TS2A 4DGZA 1EEID 1EFID 3UI2A 3RZOB 2KCNA 2C5CA 4RA8A 5D3IB 4ZKCB 3H09A 1SEBD 3HRZC 4MIUA 1VF5C 3VYSA 4LK1C 2F0TA 1H9SB 1XX8A 1MSGA 4C3JG 3R93A 4B08A 2EY6A 1SYEA 5M3FB 3K5LA 2JE6I 1ET6A 1H9MA 3HEJA 1ZYRC 4EQNA 5CBEE 1XXGA 2B2WA 4CJ1B 3K5NA 1LACA 5CR3A 2F0UA 2GA4B 3SHLA 4WORA 5CV4A 3QO2A 5T1GA 1IYUA 1TVXA 4RHSA 1G2TA 3J7AV 2R3ZA 3GTLB 1LTAD 2VB3X 4KKTA 1CHPD 2O5IC 1BBXC 2O2LD 1Y8NB 1H9JA 3I72A 1IW7D 4C1NI 3NK9A 5C44B 4L8JA 1HTLD 4ZKBB 4ZUJA 4E6IA 4BA2I 1HFNA 1Y1VB 3J7AF 4F87A 2PW7A 2O4XA 3TP7A 4NP5A 1ZEQX 2RVLA 2PCFB 5M5YB 2RDHA 5CV6A 2M00A 2B2YC 5C3EB 1HCZA 1PZID 3DWAA 1DD2A 2AWOA 4DA2A 1EY0A 3HP3A 5EQ0A 1SYGA 2PW5A 1Y1WB 1D1KA 5AFWA 1LT5D 1BCPB 5C3XA 1PDQA 3GD7A 5JVG3 3OW7A 5K5PA 3FVQA 3R2TA 4HCEA 1YNNC 1PTOH 1ILPA 5C4JB 1SNOA 1MSHA 2A69C 3CHBD 2WAQB 1JB3A 2KOLA 3PUWA 2MUYA 2FJ2A 4KHZA 3OHXC 3BDOA 1PTOF 3BZDB 3ND8A 2FINB 1IKMA 1A2TA 3NWSA 1I4HA 4C1NK 3A8JE 3CU7A 1T5XD 2G9HD 1SYDA 1O7YA 5KYLA 3HG9A 3D6WA 2NVTB 1U4RA 3M7GA 2WV6D 1FNUA 3F2UA 2KA7A 1IYVA 1NR2A 1Z6HA 1NAPA 2WP8J 3DM1A 1PYWD 2D9UA 3HGBA 1B50A 2A6ED 2XIWA 4JK1C 5G3LF 3FPPA 2EDGA 1TR5A 2D5DA 2WB1B 4DNRB 3WOEA 1B1ZA 3NXWA 1EIGA 2K28A 2LY7A 2NVXB 3C46A 2RBMA 3TP6A 4IALA 1V1PA 5C6AA 2XNAC 2K33A 2F3VA 3VR4A 3OIQA 1QWYA 2BDNA 2OEOA 2NZ1D 3HOWB 1RF2D 5BN4A 4KKSA 2DN8A 1DZ1A 2OT2A 3JAML 1STBA 3H94A 3EVQA 3BDLA 4CJ0B 1EZ8A 5FO8B 2EZVA 2A68D 1A3UA 3OMCA 2EXZA 4OHJA 2BOSA 1D1IA 2D2CC 1QG7A 4Z9CB 4IUQA 3ERQA 3S16B 1TWFB 1D5XC 2MPMA 4RGTA 3K59A 2I07B 1I4XA 4DAYA 2XWBB 3CRKC 5COYA 5I6WA 2PO4A 2KQ3A 2JA5B 3KLSA 4K2LA 3HKZB 1AW7A 1ICWA 3DEPA 2R6GA 3DMUA 3TP8A 3L7ZC 4PV1C 3L3OC 3O13A 3MXPA 4I65A 1LTGD 2JEAI 1ENCA 1CI3M 1EZ6A 2C9OA 1LT4D 3N6RA 5EGTA 2JXMB 2PNRC 1SYCA 2ICIA 2A6HC 3P7JA 4IFDJ 4TKOB 3D8GA 2HCIA 4A3KB 3I4MB 2F0WA 2Q8TA 1KNEA 3S1NB 2JYOA 1F9QA 2QF7A 1U4MA 4I7ZC 1L0XB 2EYFA 2ZXRA 2F4IA 3M4OB 2OXPA 2WKDA 2FMMA 2NWGA 3R3OA 1PXUA 4YIJA 3CRLC 3I4NB 2KJXA 1J8IA 4DU9A 3Q22A 4FF2A 2AQ3B 5EBDA 1A2UA 1TKWB 2NVQB 5KYIA 2XVSA 1HA5A 1CFMA 1JWMD 2RA4A 4XYQA 1OXSC 1YNJC 4C3IG 1IKLA 2Z4HA 2F0KA 2NYZD 1Z47A 3VR5A 1GUSA 5C0XG 1GUNA 4KHVA 4IN3A 1O78A 2Z4IA 4KD4A 5EPLA 2F0OA 4XT1B 4F88A 4A3GB 3GV3A 1SYFA 2EYMA 3E0JA 1ILQA 1SE2A 1JWSD 4OGQC 1LLRD 2PPBC 5M3MB 5I9OA 5EPJA 3MFGA 3BVGA 3GTQB 3I73A 4C2MB 3GTMB 2TMPA 5CV5A 1VMCA 5D65A 5IGGA 1Q12A 1V8QA 5HGTA 4A93B 3FPUB 3PUVA 1BR9A 1R4QB 2CQAA 1DONA 1CZWA 5JJZA 2SEBD 3K7AB 1ENAA 1HXYD 3OMGA 3I8ZA 3EQLC 3WDNA 3ZYYX 3VR2A 3M85A 4KD3A 1KDAA 1U4LA 4XIGS 3R8BA 1ZXTA 3K5MA 4EQOA 2B63B 4CKEA 3W2DA 2XRSD 3X3NA 1SNDA 3S2DB 5EBCA 5IGDA 2B2YA 4V0BA 2PMZB 3BG3A 1JICA 2SDFA 1JWUD 1Y8PB 4ME5A 1C8CA 4RFBA 3VYUA 1BCPC 1Y8OB 3VR6A 1B53A 1BF4A 1II3A 2F3WA 3T16A 1B9NA 1WTQA 3PV0A 4DAVA 3D6CA 4RKLA 5ELDA 3BYTB 5E3FA 2BCOA 3TSSA 4PQXA 1B3AA 2DNEA 4IUTA 3ND9A 1QB5D 4QF4A 3GTKB 2YU9B 2K6AA 2MGSA 1X3PA 3P20A 1GUTA 4IUVA 4HMIA 5C0XH 1JR0D 2K05A 2PYKA 3G6JB 3DXJC 4OO1I 4RGMA 1O80A 2CVRA 1GOZA 1TWAB 3Q24A 2F0EA 1CQFA 1X32A 3MAQA 5IIFA 5KRUA 3KUPA 1QILA 2MHVA 5A2QE 3EJIA 1I4QA 4L6TB 2R61A 1ENFA 5CC4A 4OIJA 2V4DA 1FNWA 2K04A 1RKNA 4ULLA 2IL8A 3PUZA 4XT3B 3QB3A 2LFNA 1S5ED 3GTJB 1MD2D 3URYA 4FP5D 3Q6SA 4A3JB 2JA7B 1HTPA 1S5CD 4K5XA 5FK9C 4X3SA 3A56A 2EVBA 3TDQA 4QCLA 3NWTA 2LKVA 3NBIA 3MA2B 1EY9A 1SJED 4H7BA 1KAAA 4FVMA 3W3AA 4IUUA 1KLUD 1V43A 2EJFC 1GXDC 4RH6A 2RSNA 5K36G 3FMCA 1PZKD 3Q23A 1STYA 4PMWA 1EYAA 1TY0A 3S1RB 3T51B 2ENBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q L;  3J80 L;  3JAM L;  5LL6 X;  5FLX L;  3J7A V;  5IT9 L;  3J81 L; 
#chains in the Genus database with same CATH topology
 1PRT B;  4KJN A;  1MI2 A;  2IWH A;  1VQH A;  4KMU C;  3SR1 A;  1N33 L;  3M7N A;  5C4J H;  5EAY A;  3BDC A;  1Y69 U;  1F77 A;  1KTK A;  5KIX A;  4PNY A;  3I3C A;  5LL6 S;  3RZD H;  4NKL A;  1WJJ A;  1J9O A;  4QB4 A;  1IBM L;  2E5L L;  3G4S A;  1EIF A;  4OIK A;  3I4M G;  3TZD A;  1BUV T;  1A15 A;  2Q8I B;  4R4Q A;  1Q8I A;  4JI7 L;  2E2I H;  2EYP A;  3J80 E;  1XPO A;  3T56 B;  1SXT A;  1T5E A;  1FYC A;  5JJL A;  2YTX A;  2J4X A;  2MNA A;  1OXV A;  1EYD A;  3TS0 A;  2NVT H;  1F2Y A;  3PUY A;  3MHB A;  4NPS A;  1JB7 A;  2JA8 G;  1VDZ A;  1FD7 D;  4R9W A;  3PUX A;  3A7A B;  3NPP A;  3TP5 A;  3I4N G;  2E2H B;  4H13 C;  4X3K A;  1AZP A;  1PFM A;  2NVY H;  3CCS A;  1XNR L;  4GKJ L;  4J6H A;  4BBS G;  4DR4 L;  3CW2 C;  4A3C G;  1VS0 A;  4IFD H;  4PMB A;  1TQO A;  4N8X 1;  2G9D A;  1G91 A;  1GUG A;  1PLF A;  1KL9 A;  1O7Z A;  2A68 C;  2LS0 1;  1JE4 A;  1K9M C;  2D62 A;  5IWA L;  2NVX H;  2CCZ A;  4Y7N B;  3UDI A;  1WTX A;  2B8F A;  2B2U A;  4JCV E;  1EQQ A;  4NW2 A;  1PTO D;  1CSQ A;  3HS0 C;  4CBV A;  1N32 L;  4A3G G;  1EQR A;  5DM6 3;  5C0X J;  3D0F A;  1KRT A;  5IGB A;  1MKH A;  1DYQ A;  4P73 A;  4JC0 A;  3ITP A;  1K8M A;  3I4L A;  1CHQ D;  2F0Q A;  2N88 A;  3MXU A;  4OWW B;  3HOW H;  1DGS A;  3F2C A;  2KCT A;  1Z7T A;  4LAA A;  2KEC A;  4LUV A;  1GUO A;  3MXG A;  1XMO L;  4B9W A;  4H44 C;  4KJO A;  3C1E A;  3H0G G;  2NBF A;  5M3M G;  4LW1 A;  2F0N A;  3J7Z C;  1LT6 D;  4ME3 A;  5T1I A;  4Q0F A;  1I50 H;  3GP7 A;  3HOV H;  4DR2 L;  1SYB A;  1YI2 A;  2EPB A;  4KN4 C;  4IFD I;  3TEH B;  3AMU A;  3RUZ A;  3NBH B;  2XSC A;  4H0L C;  4KY5 A;  3NHH A;  2JEB I;  1CQV A;  2PMZ E;  1C4Q A;  1SMY C;  5C5M A;  3U4Z A;  1ZYR D;  2AWN A;  5DM7 3;  4DUY Q;  3U9O A;  1VMP A;  5G3L D;  1HUN A;  2K5W A;  1I6V C;  4I7A A;  3SVM A;  2JK8 A;  2BH2 A;  2XN9 C;  2ZT9 C;  3AB9 A;  1NUC A;  2LSS A;  2JQO A;  1H9S A;  2N49 A;  3A74 A;  3IL8 A;  4K0K Q;  2JA5 H;  2BE5 C;  2I0Q A;  2HIV A;  1X9N A;  4LMQ D;  1JOO A;  5ELC A;  5K36 H;  3J81 j;  4GNX A;  4U67 3;  3CME A;  3W1B A;  1QNK A;  4EQ5 A;  1IBL L;  4F7X A;  1FVI A;  3CC7 A;  3GDE A;  1PH1 A;  3ZJY C;  3ERO A;  1E3P A;  3GTP B;  4UY8 C;  2K7V A;  3S17 H;  2HUG A;  4IUR A;  1PYB A;  2Z8L A;  5F2D A;  2CW0 C;  4DV7 Q;  2B63 G;  3D3R A;  3BVM A;  2L12 A;  1JOQ A;  2K5D A;  1STH A;  2HD3 A;  4ID6 A;  1X56 A;  1I5F A;  2QCP X;  2OF1 A;  3I4M H;  1K8G A;  5CBA E;  4A3D G;  1B44 D;  3S1N H;  4ZCK A;  1SAP A;  3IFT A;  3KF6 B;  1K83 B;  1TU2 B;  5LMN Q;  4HSP A;  2XRQ D;  1SNP A;  2K5V A;  4ZAI A;  3PIO 3;  4DV6 Q;  1BO0 A;  1DOL A;  3PO3 G;  4A76 A;  4N9P A;  2WKC A;  4A3F G;  4B9X A;  1SNC A;  3QWN A;  3NEL A;  5DNF A;  2JA8 H;  4KY7 A;  1NSN S;  4EGV A;  4OX9 L;  1SNM A;  5I2X A;  3AQQ A;  2H1E A;  4DR3 L;  1E24 A;  3I4N H;  4CJ2 C;  5IYD G;  1LTB D;  5LHY 1;  3F2D A;  1BOS A;  1WFQ A;  1UEA B;  1YNN D;  3F1Z A;  2F03 A;  1IL2 A;  1UE7 A;  4G7H C;  2RF4 A;  2NVQ H;  2A69 D;  4BBS H;  4HMJ A;  4GLX A;  4A3M G;  3CKI B;  4JG2 A;  2F0L A;  1E2W A;  1TS4 A;  3FKI G;  2GVA A;  3K0Y A;  2AQ2 B;  4C3J B;  1QJO A;  2YTV A;  4LF5 L;  1I3Q B;  2NTT A;  1STA A;  3MVV A;  4KLK A;  4TVA B;  4U68 A;  3T1Y Q;  3KLS X;  1K3B C;  5IE8 A;  1NE3 A;  2O5J C;  4M1U B;  3FEW X;  1VQP A;  4POF A;  1D7Q A;  3BU2 A;  2CH4 A;  3GTO H;  1UWV A;  2E8G A;  1EFW A;  4A3G H;  2HHH L;  2L15 A;  3NUC A;  4QMG A;  1IL8 A;  4WJ4 A;  2ID0 A;  5I4D A;  4IPC A;  5JVH 3;  4FNF A;  4OON A;  1WD0 A;  4RKB A;  1KDB A;  3LWU A;  4FXG C;  1OXX K;  4ZLT F;  1HA6 A;  3H0G H;  2H5X A;  2PZW A;  5M3M H;  3CD6 A;  1EY6 A;  2R7D A;  5JOB A;  3KOJ A;  1IHZ A;  3W1G A;  1HJP A;  2L4N A;  3BVZ A;  3QJY A;  4JYA L;  3OOC A;  2A5H A;  1ASZ A;  1W3S A;  2DNC A;  4RCN A;  4DV3 L;  2F1M A;  2UXC Q;  4GN3 B;  4C2M H;  2XGT A;  3NBH A;  1WTO A;  5BN5 A;  5D3D A;  2B2U C;  4QJF A;  1B7Y B;  5ELO A;  2PI2 A;  1NMF A;  4EVO A;  3T1H L;  3ULL A;  1Q3L A;  4XQN A;  4ILW A;  3PO2 B;  1RJT A;  1QZG A;  1XNQ Q;  1STN A;  4NXN L;  3K80 C;  5EPK A;  2ZXP A;  3H6M A;  4O42 A;  4BS9 A;  2L11 A;  4HTH A;  3V96 A;  2VL6 A;  4JV5 L;  3D4R A;  2R92 B;  4LFB Q;  4UP7 A;  2UUA L;  4FXK C;  1VQ4 A;  1VQN A;  5A35 A;  4JI1 L;  5D14 A;  4DR5 Q;  1A0I A;  2TSS A;  1F9P A;  4LWC A;  5M3F G;  2FMC A;  4RGN A;  2VB2 X;  4MHE A;  2DJG C;  4CDC C;  2B8G A;  1N36 L;  1H95 A;  4DV0 Q;  1STG A;  2MP1 A;  2IJ0 A;  2OTL A;  1TS5 A;  5GRO A;  4B3R L;  1ET9 A;  3S9W A;  1J6Q A;  1R9T B;  2F0P A;  5FLX L;  3S14 B;  1VQM A;  1CT1 D;  1EWI A;  4OXP A;  3MFY A;  3CC4 A;  4JI6 Q;  2B63 H;  1U4P A;  2E2J H;  3HZX A;  1SFO B;  3K5O A;  5IOD A;  3S2D H;  4JI4 L;  2F0G A;  5GAD C;  3E3X A;  2JP1 A;  4X3U A;  4A3D H;  3NTI A;  1PYS B;  3K58 A;  5I2Y A;  5KNB A;  1F2M A;  3KF6 A;  3Q0A A;  2FFK B;  3P1H A;  1RTO A;  2CHB D;  4DUZ Q;  5J1Z A;  2F0V A;  2L1B A;  3VYT A;  3PO3 H;  1GO3 E;  4A3F H;  1F2L A;  1PRT C;  2YV5 A;  1WTP A;  5HUR A;  1EEF D;  3RMH A;  1QUQ B;  3KF8 A;  1L0Y B;  2L9H A;  1ML0 D;  1LUZ A;  1O7L A;  5COR A;  2Q2H A;  1Y1V G;  2DY7 A;  2YTY A;  1L0W A;  1UE5 A;  4O0A A;  1AH9 A;  1A6X A;  3KLR A;  5IYD H;  4QY7 A;  1GHK A;  3CMA A;  2QDL A;  4QQB X;  4DV4 Q;  2H4O A;  1PH7 A;  2J7Z A;  4A3M H;  3GTK H;  3FKI H;  3V2T A;  4DR7 Q;  2A6H D;  1CK1 A;  4YCV A;  1Q1E A;  3OW2 A;  4ZQ3 A;  1Q82 C;  1IBK Q;  1D8L A;  3PF4 A;  1WD1 A;  3T53 B;  1BBU A;  3AU7 A;  4JI2 L;  4DK1 A;  4K14 A;  3K7U C;  4ZK9 B;  3EIV A;  3RR5 A;  4JI5 L;  1NTG A;  1VQI A;  4IUP A;  3BS1 A;  4IOA A;  3OIP A;  4TRD A;  3FHW A;  4IPG A;  3EA6 A;  1TWA H;  2RDG A;  3CCL A;  4KHP L;  4JI0 Q;  4FF1 A;  2KED A;  2IW3 A;  1JCK B;  5KGU A;  1EQT A;  4UPA A;  1NJI C;  5GAE C;  3NEN A;  4MTN A;  1BDO A;  1H9K A;  1Q81 C;  4B3M L;  2WAQ G;  1OXT A;  3VR3 A;  1FJG L;  2A74 C;  2K50 A;  1HRJ A;  2DUD A;  4JBW A;  1U5K A;  1X54 A;  3CQZ H;  1XTD A;  3HOX B;  3TS2 A;  5NUC A;  3IAY A;  1QVC A;  1S3O A;  3RNU A;  1EOT A;  1RCV D;  4FF3 A;  1EIH A;  4K8I A;  3A8K E;  3QOL A;  1S5D D;  1VCI A;  1YNJ D;  3CCQ A;  2WAC A;  3VA7 A;  1PH9 A;  3S1M B;  3NQT A;  3S2H H;  3ONA B;  3M4P A;  4OWT B;  2JA6 B;  4AQY Q;  2BA1 A;  4A3I B;  3S1Q B;  2RCF A;  2A73 B;  4DV5 L;  3SK4 A;  5HGQ A;  3B6Y A;  4QL5 A;  4RHR A;  4KTA A;  3VDY A;  1VQG A;  2IX0 A;  5IT9 L;  3GTJ H;  3RZO H;  3DUZ A;  4K6D A;  1CSP A;  1E0B A;  5GAH C;  3QOJ A;  4BWG B;  2QEX A;  1LTS D;  2ZTE A;  1EY8 A;  2NN6 G;  2VY3 A;  2F0H A;  2UUB Q;  3WWV A;  1YVC A;  4TSS A;  3I4O A;  5C4Z A;  1YBY A;  1ESF A;  4IJH A;  3SXH A;  3JAM E;  2Z0S A;  3FP9 A;  1WTW A;  4GN5 A;  2XTI A;  1IW7 C;  5M3F H;  1CKN A;  1HQR D;  2WB1 G;  1HNX L;  4QGU A;  5LMU Q;  5IGE A;  3EFX D;  4X62 Q;  1LM0 A;  1VQL A;  5C5L A;  1QNU A;  2UXB Q;  2XWJ B;  4K6L A;  1M4V A;  4J8Q A;  2QW7 A;  3LWE A;  4IOC A;  4FYD A;  2LXK A;  1KDC A;  4YHH L;  1JMC A;  4X64 Q;  1UUP A;  1EU4 A;  1JC7 A;  2F0S A;  3A0J A;  4O2D A;  2ICE C;  2M9V A;  4K5V A;  4LF4 L;  2WIN B;  4G4K A;  4TQU S;  4MZ9 A;  1KRS A;  1TII D;  1LTR D;  2KBN A;  2SNM A;  2IPK D;  2F0M A;  1ESR A;  1BVS A;  1K8O A;  5M5W B;  5M5X B;  4C3H B;  5C0X I;  4V19 0;  2EIF A;  2K5N A;  4DAP A;  2N55 A;  1ZKO A;  1XMQ Q;  2FHT A;  2D0P A;  1Y1V H;  2MFI A;  2IHF A;  1DOM A;  1Q8K A;  3UDF A;  2VQF Q;  5C4X B;  1B2T A;  3GO5 A;  4WRD A;  2K03 A;  3M3Y B;  4ZUI A;  2PZU A;  4HAE A;  3OYY A;  4R4T A;  3MXN A;  4HN7 A;  5CGK A;  4X66 Q;  2ES2 A;  5C3E H;  4RAU C;  3OTO Q;  1CKO A;  2EYL A;  3OWE B;  3HKZ G;  4C3I B;  2LMC B;  2LXJ A;  5KND A;  5IYC G;  2QDB A;  1M8A A;  3BYY B;  4BA1 I;  3C2P A;  5IGF A;  2Y0S B;  1EWC A;  2QIL A;  2EY5 A;  2KHS A;  1SJH D;  1LT3 D;  4DPG A;  2PQA A;  1XTC D;  4DV1 Q;  3K57 A;  4F8M A;  3TBI B;  4RG1 A;  1SMX A;  3M4Q A;  1BCP D;  5JEA J;  1WCM B;  1G29 1;  1RD9 D;  4Y7N H;  3MEF A;  4ZRZ A;  1RHP A;  4R8I A;  1R4P B;  3PQI A;  4XDX A;  4G7O C;  4KKU A;  4YWL A;  3J81 L;  1V1P B;  3BZK A;  1BCP F;  1LAB A;  2A6E C;  3MWY W;  1BNZ A;  1U9R A;  4L5T A;  1F9R A;  2I46 A;  2F0J A;  3CF5 A;  1MJC A;  5GQO A;  2EYO A;  4A3K G;  2P5Z X;  3HOU B;  4DK0 A;  1QOH A;  1C48 A;  4CKB A;  4A3E B;  1KC8 C;  2KUM A;  2SNS A;  2UXD Q;  3GV6 A;  4BBR B;  3ULP A;  1NR4 A;  2AUJ D;  2HQL A;  3H3V C;  3A8I E;  3M9B A;  3LNN A;  2Z6B A;  3SGI A;  4CGY B;  2KEE A;  4RGO S;  1KNA A;  1I94 Q;  1X3E A;  1GUW A;  1CA5 A;  1ROD A;  1YIJ A;  2EY1 A;  3KBG A;  1OXU A;  4LF9 Q;  3SDZ A;  2RHS B;  1G51 A;  1I4G A;  3A54 A;  5IGC A;  2NN6 H;  2E75 C;  2A19 A;  4CHT B;  4OL7 A;  1MJE A;  5FLX E;  2VUM B;  3D4W A;  4XTC S;  4DV2 L;  1U0L A;  1UE6 A;  4X3T A;  1TWC B;  4DAY B;  2ZM6 Q;  2RDF A;  3CC2 A;  3KDF B;  2CWP A;  1MIU A;  2HQE A;  4X6A H;  2DJF C;  2EE1 A;  2J0T D;  3SE0 A;  1D5M C;  3W5O A;  2FXQ A;  2L5T A;  1KLG D;  1IYJ B;  2R92 G;  2KCC A;  3H91 A;  1IBM Q;  3RLF A;  2A8V A;  2E5L Q;  3PIP 3;  4DUY L;  1KIX A;  2B2V A;  1VQE A;  1C7Y A;  4LJZ C;  1OO9 B;  4J1M A;  5E4W C;  3TRZ A;  3T4A C;  2DGY A;  2PZT A;  2AKW B;  2CFM A;  2NN6 I;  4BY1 B;  4K0K L;  2BA0 A;  1TWH B;  1QCB D;  4APV A;  5BR8 L;  2NZO A;  2YYZ A;  1TWG B;  2R7Z B;  2ZXO A;  2IT1 A;  1DCZ A;  3A55 A;  3RZD B;  1AZQ A;  3C3L A;  1VQ6 A;  1SSO A;  1JOR A;  1DJR D;  4K2K A;  1WYD A;  4ABN A;  4LF7 Q;  1K83 H;  3DM3 A;  3I55 A;  3ERS X;  3K6O A;  5IP9 G;  3JAM i;  5FKA C;  4Q5V A;  4L63 B;  1IZ6 A;  1XNR Q;  1G2S A;  5C3W A;  2E2I B;  3S16 H;  1EQV A;  1TWF H;  4A93 G;  4A75 A;  1VQF A;  1HFG A;  3VA5 A;  2JSO A;  2RKS A;  3SK8 A;  1S5B D;  2AUK A;  1SLJ A;  2RSO A;  3L0O A;  5IWA Q;  5JAV A;  3MC0 B;  1N8R C;  3DWQ A;  4GOP B;  2NZH A;  3FRP B;  4DXG A;  5EJW A;  3M4Y A;  4R4O A;  2EJG C;  3QIA A;  4PZ6 A;  1L2F A;  1QE6 A;  4RCO A;  1B4O A;  1Q46 A;  1JOK A;  2NVY B;  3HOY B;  4OEL B;  3ICE A;  3QG1 A;  1G8Z D;  4DFA A;  1JQY D;  3PMF A;  1I3Q H;  1PH4 A;  3LX0 A;  1EYC A;  1L1O B;  2F4V L;  4HJ9 A;  4DR2 Q;  1PTO B;  3PGZ A;  1PH3 A;  1J5E Q;  1Q90 A;  4NXM L;  4UAI A;  3JAM c;  5J22 A;  4KV6 A;  5IT9 E;  2EYJ A;  1MGS A;  4A3K H;  4R4C A;  1LTT D;  1B70 B;  3F8T A;  4UHV A;  3X3M A;  4EQP A;  4JI3 L;  5ELN A;  3RD4 A;  3FDT A;  3EBE A;  4RWS C;  4FXD A;  3E5S A;  3KK7 A;  2Z9H A;  3TN2 A;  2N78 A;  4B3T Q;  1ONL A;  4LNQ A;  1RTN A;  1GHJ A;  3UDX A;  1I50 B;  1GKH A;  3HOV B;  3NSW A;  5FOB B;  3KJO A;  3M4O H;  4NDX A;  2HCC A;  1SNQ A;  4L5S A;  4XQJ A;  1AN8 A;  1LV9 A;  2B2W C;  3ULJ A;  4ALP A;  4A3I G;  3D31 A;  1YHA A;  4GN4 B;  4HED A;  2G5D A;  3IFD A;  1LO5 D;  5CV8 A;  3SK6 A;  5E7N A;  3CCM A;  2Z6K A;  3BZC A;  1FNV A;  2K14 A;  1HUM A;  4XXE A;  1W6J A;  2ZTC A;  4B3S Q;  4A3C H;  5A2Q L;  1D6E C;  5KNC A;  3I56 A;  5JEA G;  1X6O A;  5H1S E;  2AQ1 B;  1XPU A;  1S4Z A;  2K01 A;  1UAP A;  3G7L A;  2Q2U A;  1X55 A;  3KDF A;  2PNH A;  5AJ3 Q;  1BKB A;  2UXC L;  3I91 A;  1A63 A;  1ASY A;  2R92 H;  3E9I A;  3RN5 A;  1S5F D;  5DLQ E;  1F2Z A;  2N8N A;  2PQE A;  3OSO A;  1HZC A;  4IPD A;  1SE3 A;  2K75 A;  1E2V A;  1W6K A;  2EYH A;  3J80 i;  1XNQ L;  3S15 B;  4BY7 B;  5ELB A;  2EOT A;  1DXM A;  3S14 H;  1SMY D;  2Y0S E;  2I5L X;  3S17 B;  1H9R A;  4QIW B;  4ZYS A;  2KVM A;  3L2P A;  2GN5 A;  1SFO H;  1PH5 A;  4A3L G;  5BN3 A;  1VQA A;  4OX9 Q;  5KEE A;  2NB0 A;  3CCE A;  1SE4 A;  4X65 Q;  3GTQ H;  4MN3 A;  5JPN C;  3GTM H;  1V1Q A;  4GLV B;  3CAM A;  1EY5 A;  5IP9 H;  2BE5 D;  4DV0 L;  1DM0 B;  4C3H G;  4YY3 Q;  2B2T A;  4LF8 Q;  4WFN 3;  2B2V C;  5EKL A;  1CTM A;  1K8A C;  1HNZ Q;  3TZU A;  3V05 A;  2X6G A;  2CWA A;  1AEX A;  5E1F A;  4DR6 Q;  4A93 H;  4WJW A;  4C56 C;  1XWE A;  4OO1 G;  4AYB B;  1MHW C;  4N9T A;  3KLW A;  1FL0 A;  3OPO A;  4JI8 Q;  4DXF A;  4A3J G;  2JA7 G;  2KHI A;  1NY4 A;  1E2Z A;  2QEJ C;  2JA8 B;  4RMF A;  1RDP D;  2VQE L;  1B3Q A;  1EIY B;  2VNU D;  4GOP A;  3MZ5 A;  3NP8 A;  3K7A H;  3J80 c;  3J81 E;  3NEM A;  4LF6 Q;  2CW0 D;  2HHH Q;  2IX3 A;  1YNX A;  4KI0 A;  1VF7 A;  3KJP A;  4DUZ L;  4BBS B;  3MEH A;  1FR3 A;  1Q1B A;  1AE3 A;  2UUC Q;  3J7Y W;  2WII B;  1KQS A;  1EY7 A;  3R2I A;  2MJ8 A;  1WOC A;  3J80 L;  2VXW A;  2HDM A;  1EWH A;  2MQH A;  5M9O A;  4S3S A;  1HHV A;  2E74 C;  3A7L A;  3GTO B;  4P74 A;  5CYU A;  2DY8 A;  4DV3 Q;  1PMR A;  5IOC A;  1F9S A;  3CP0 A;  2X6L A;  3TME A;  4R8N A;  2HT1 A;  1HZB A;  5HY6 A;  3NTH A;  3T1H Q;  5CV9 A;  4XQQ A;  1IBK L;  1I6H B;  4NB3 A;  1CM9 A;  4KK7 A;  3H0G B;  3SEB A;  1PFN A;  2BDO A;  5ELF A;  3HOU G;  3L9A X;  2NUC A;  5E4X A;  4DNT B;  1JJ2 A;  1PH8 A;  3WOF A;  1P16 A;  2HDL A;  1EY4 A;  4K5W A;  3DWP A;  3HOZ B;  2E2D C;  1WVL A;  1TY2 A;  4DF7 A;  4DKA C;  4BBR G;  3C1F A;  5ISR A;  1STE A;  4HIM A;  4A3I H;  1WTR A;  3S1Q H;  2HIX A;  2Z1C A;  1HPC A;  3CCV A;  4LFA L;  1WTV A;  1DOK A;  1D5Z C;  3STB C;  4AIM A;  4LFC Q;  4M8A A;  1TXY A;  3NTK A;  4CKC A;  4GZY C;  1AFP A;  3D4D A;  1V9P A;  2KEN A;  4DR1 L;  2YU9 H;  1AP0 A;  5JEA H;  1N36 Q;  1G6Z A;  4KY6 A;  4IZ8 A;  1QVF A;  5C4H A;  3IKJ A;  3U50 C;  4DN4 M;  1ICF B;  4UDU C;  1A8V A;  2VUM G;  1A3V A;  1N9W A;  1Z9F A;  5DEH A;  4AQY L;  4G7Z C;  3K81 C;  2X69 A;  4POG A;  4G57 A;  4IQZ A;  2SOB A;  3DHQ A;  1TT2 A;  2R7F A;  1BQQ T;  5ELE A;  2B3G A;  3I7F A;  3E0E A;  1MBY A;  4KN7 C;  1XJV A;  1CZG A;  1EU3 A;  1EL0 A;  1K0S A;  3T13 A;  2K1B A;  2Z6K C;  2M2L A;  4K8J A;  2UUB L;  5LL6 X;  1BXT A;  1I4R A;  4GS3 A;  5EKI A;  3AFP A;  4HSV A;  5CMD A;  2E2J B;  2B39 A;  5J39 A;  1CA6 A;  4A3L H;  1SBB B;  5JPM C;  2K32 A;  4IUN A;  1XPR A;  4BY1 G;  4GKK Q;  2OQ0 A;  5LMU L;  4X62 L;  5M5X H;  3I70 A;  4ODG A;  4A3D B;  3GQB A;  1TS3 A;  4PMC A;  4O1N A;  4C3H H;  1UNS A;  2UXB L;  2R7Z G;  4FF4 A;  2E76 C;  4HR7 B;  4R1J A;  1D2B A;  3AYH B;  3NE5 B;  2IX1 A;  3H15 A;  1E1O A;  3PO3 B;  4X64 L;  4A3F B;  4OO1 H;  2K52 A;  2RQX A;  4PZ7 A;  4A3J H;  2JA7 H;  5DAU A;  2K5Q A;  4OEM B;  1OTC A;  1B9M A;  2EXD A;  1HQM C;  3SK5 A;  1SDF A;  2UU9 Q;  1HR0 L;  1NCV A;  1PH2 A;  1UE1 A;  3M3Y H;  3U9S A;  1PFB A;  4WJ3 M;  4FO2 A;  4HCS A;  4HJ5 A;  4A3B B;  1RL2 A;  1X3Q A;  4KHP Q;  1NNX A;  1X3F A;  5CV7 A;  2OQK A;  4A3M B;  3P75 A;  3PIO A;  1HNW Q;  2BH8 A;  4L5R C;  1A3T A;  3FKI B;  5JJK A;  2B2T C;  2L0C A;  3I90 A;  1I4P A;  2QKI C;  2V1C C;  5EKK A;  1XMQ L;  2L55 A;  2R93 B;  3HOY G;  3OWF A;  4XYO A;  2KCM A;  1VQ5 A;  3S1R H;  4UP8 A;  2CH4 W;  4IFD G;  2VQF L;  4MTK A;  4A4I A;  3I2Z A;  4P2C B;  2Q8R E;  2NTS A;  2EY2 A;  1X3G A;  3E9H A;  4JOI C;  2K4K A;  1PRT D;  3VYR A;  5I9P A;  4X66 L;  1S72 A;  4BXX G;  1FGB D;  3E6Z X;  4GOP C;  1N34 L;  2F0D A;  2EJM A;  3MTS A;  4P72 A;  4QUC A;  1CUK A;  1PRT F;  5I6Y A;  1PZJ D;  3AFQ A;  4JBM A;  1GJX A;  3N52 A;  3HOU H;  3KBX A;  3CQZ B;  1SRO A;  5TSS A;  2JN4 A;  1YEZ A;  5FO7 B;  1XYI A;  4DV1 L;  4QUF A;  3NQI A;  4BBR H;  2F0F A;  1QUQ A;  5FO9 B;  2OTJ A;  4QIW E;  3GTG B;  3QR8 A;  2F0I A;  1YIT A;  3G6E A;  1L1O C;  4JBK A;  5FLM G;  3S2H B;  1VQO A;  1PTO C;  4NMZ A;  4YCW A;  1LTI D;  3HOV G;  4JW0 A;  1KAB A;  3DEO A;  3RLO A;  1E7Z A;  1V1O A;  1TS2 A;  4DGZ A;  1EEI D;  3CCR A;  1HNX Q;  1EFI D;  1PH6 A;  3UI2 A;  3RZO B;  2KCN A;  2C5C A;  4RA8 A;  5D3I B;  4ZKC B;  2E2H H;  3H09 A;  1SEB D;  3HRZ C;  4MIU A;  1VF5 C;  1VQD A;  3VYS A;  4LK1 C;  2UXD L;  1AE2 A;  4YHH Q;  3S24 A;  2F0T A;  1TWC H;  4AYB E;  4HJ8 A;  1H9S B;  1XX8 A;  1MSG A;  4C3J G;  3R93 A;  4B08 A;  1I94 L;  2EY6 A;  1SYE A;  5M3F B;  3K5L A;  2JE6 I;  1ET6 A;  1H9M A;  4LF9 L;  3HEJ A;  1ZYR C;  2ZJP A;  4GNX B;  4EQN A;  5CBE E;  1XXG A;  2B2W A;  4CJ1 B;  3K5N A;  1LAC A;  3DLL A;  1QZH A;  1KHI A;  5CR3 A;  2F0U A;  2GA4 B;  3SHL A;  4BY7 G;  4WOR A;  5CV4 A;  3QO2 A;  5T1G A;  2ZM6 L;  1IYU A;  1TVX A;  4RHS A;  3CCJ A;  4BY1 H;  1HZA A;  1TWH H;  1G2T A;  3J7A V;  2R3Z A;  3CPF A;  3GTL B;  1LTA D;  2K5H A;  2VB3 X;  4KKT A;  1TWG H;  1CHP D;  2O5I C;  3K8A A;  2R7Z H;  1BBX C;  3HKS A;  1JT8 A;  1VQC A;  2O2L D;  3Q8D A;  1Y8N B;  4DAM A;  2C35 B;  1H9J A;  3I72 A;  1IW7 D;  4C1N I;  1EYG A;  2KHJ A;  3NK9 A;  5C44 B;  4L8J A;  1HTL D;  2MO0 A;  4ZUJ A;  4ZKB B;  4E6I A;  4BA2 I;  1QVG A;  1HFN A;  1Y1V B;  3J7A F;  4F87 A;  2PW7 A;  3PO2 G;  2O4X A;  3TP7 A;  4AYB G;  4NP5 A;  1ZEQ X;  2RVL A;  3J7A 5;  3ER0 A;  1YHB A;  2Q2I A;  2PCF B;  5M5Y B;  2RDH A;  5CV6 A;  2M00 A;  1N33 Q;  2B2Y C;  5C3E B;  1HCZ A;  1PZI D;  4LF7 L;  3DWA A;  1DD2 A;  3HOY H;  2AWO A;  4DA2 A;  1EY0 A;  3HP3 A;  1K73 C;  2QGQ A;  3A5U A;  5EQ0 A;  1SYG A;  2IHE A;  2PW5 A;  1Y1W B;  1D1K A;  1T9H A;  1CKM A;  5AFW A;  3BJU A;  1LT5 D;  4GLA C;  3GTP H;  1BCP B;  5C3X A;  4JI7 Q;  3AEV A;  1PDQ A;  3LGJ A;  3GD7 A;  5JVG 3;  3OW7 A;  5K5P A;  4BXX H;  3FVQ A;  3R2T A;  4HCE A;  1YNN C;  1PTO H;  4CDF C;  1ILP A;  5C4J B;  1SNO A;  4YWK A;  1MSH A;  4IPH A;  2A69 C;  3CHB D;  2WAQ B;  3KYH C;  1JB3 A;  1K0R A;  2KOL A;  3PUW A;  2MUY A;  2FJ2 A;  4KHZ A;  3OHX C;  4MNO A;  2D0O A;  3BDO A;  4JBJ A;  1PTO F;  3BZD B;  3ND8 A;  4R4I A;  4H02 A;  2FIN B;  1IKM A;  1A2T A;  3NWS A;  2RCN A;  1I4H A;  1C9O A;  4C1N K;  4DV2 Q;  4GKJ Q;  2AMC B;  3A8J E;  3CU7 A;  3TQY A;  5FLM H;  4DR4 Q;  1T5X D;  1WI5 A;  2G9H D;  1SN8 A;  1SYD A;  1O7Y A;  3HOZ G;  5IYB G;  5KYL A;  4DV7 L;  3HG9 A;  3D6W A;  3G71 A;  2NVT B;  1U4R A;  3M7G A;  1YJN A;  1S40 A;  1J5E L;  2WV6 D;  1FNU A;  3F2U A;  2KA7 A;  1IYV A;  1NR2 A;  2JJQ A;  5J3B A;  1Y14 B;  1VQ8 A;  1Z6H A;  1NAP A;  1FGU A;  2WP8 J;  3DM1 A;  1PYW D;  2D9U A;  1KAW A;  3HGB A;  5LMN L;  1N32 Q;  2ATW A;  5IYC H;  1B50 A;  3UDG A;  2F3I A;  2I5H A;  2A6E D;  2XIW A;  4DV6 L;  5JJI A;  4B3T L;  4JK1 C;  4C3J H;  5G3L F;  3FPP A;  2EDG A;  1TR5 A;  3JC6 6;  2D5D A;  1XMO Q;  2WB1 B;  4DNR B;  3H3V H;  4OWX B;  3WOE A;  5BR8 Q;  1B1Z A;  3NXW A;  1EIG A;  1YJ9 A;  2K28 A;  2LY7 A;  2NVX B;  4YCU A;  3C46 A;  2RBM A;  3TP6 A;  4IAL A;  1V1P A;  5C6A A;  2XNA C;  4IO9 A;  2N3S A;  2K33 A;  2F3V A;  3VR4 A;  4B3S L;  3S15 H;  2VZA A;  4BY7 H;  1EOV A;  3OIQ A;  1QWY A;  1X65 A;  2BDN A;  2OEO A;  2NZ1 D;  1VQ7 A;  3HOW B;  1E22 A;  5AJ3 L;  3EN2 A;  1RF2 D;  5BN4 A;  3HOX G;  4KKS A;  2DN8 A;  1DZ1 A;  3T1Y L;  2OT2 A;  3JAM L;  1STB A;  3PF5 A;  1W2B A;  3H94 A;  3EVQ A;  3BDL A;  4CJ0 B;  1EZ8 A;  5FO8 B;  4UP9 A;  2EZV A;  1PV4 A;  4JPB W;  2JA6 G;  2A68 D;  1M90 C;  3H3V I;  1A3U A;  3OMC A;  4JVZ A;  2EXZ A;  4OHJ A;  2BOS A;  1D1I A;  2D2C C;  3G48 A;  1QG7 A;  1IBL Q;  3PO2 H;  4Z9C B;  4IUQ A;  3ERQ A;  3S16 B;  1TWF B;  1D5X C;  1KXL A;  2MPM A;  3KF8 B;  4RGT A;  2I5M X;  3K59 A;  2I07 B;  1I4X A;  4DAY A;  4HJ7 A;  2XWB B;  3CRK C;  5COY A;  4X65 L;  5I6W A;  2PO4 A;  2KQ3 A;  2F4V Q;  2JA5 B;  1Q86 C;  3KLS A;  4K2L A;  3HKZ B;  1AW7 A;  1ICW A;  4YY3 L;  4NXM Q;  4LF8 L;  4A3B G;  4YWM A;  3DEP A;  1HNZ L;  4AH6 A;  2R6G A;  3DMU A;  4DR6 L;  1PVO A;  3TP8 A;  5IP7 G;  4JI3 Q;  3L7Z C;  2R93 G;  4JI8 L;  1R9T H;  4HIK A;  1HH2 P;  4PV1 C;  2VS1 A;  3U4V A;  3L3O C;  2ASB A;  3O13 A;  3MXP A;  4N8F A;  4I65 A;  1LTG D;  2JEA I;  1ENC A;  1CI3 M;  1EZ6 A;  2C9O A;  1LT4 D;  3N6R A;  4J15 A;  5EGT A;  4LF6 L;  4LFB L;  2JXM B;  2PNR C;  1SYC A;  4DR5 L;  2ICI A;  2A6H C;  3P7J A;  4IFD J;  4TKO B;  3D8G A;  2HCI A;  4A3K B;  3I4M B;  2F0W A;  4DR3 Q;  1K28 A;  2Q8T A;  2UUC L;  1KNE A;  1NMG A;  1PFS A;  3S1N B;  1I6H H;  2JYO A;  1F9Q A;  2QF7 A;  1U4M A;  5GAG C;  4CDE C;  5IYB H;  3HOZ H;  1IXR A;  4JI6 L;  1C0A A;  4I7Z C;  1L0X B;  2EYF A;  2ZXR A;  2F4I A;  4LF5 Q;  2VW9 A;  3M4O B;  2OXP A;  2WKD A;  4JOI A;  2FMM A;  2NWG A;  3R3O A;  1PXU A;  5C4X G;  4YIJ A;  3CRL C;  3I4N B;  2ALY B;  2KJX A;  2RHQ B;  1SE8 A;  1J8I A;  3A5Z B;  4DU9 A;  3Q22 A;  4FF2 A;  2AQ3 B;  5EBD A;  1A2U A;  1TKW B;  2NVQ B;  5KYI A;  2XVS A;  1HA5 A;  1CFM A;  1JWM D;  2RA4 A;  4XYQ A;  1OXS C;  1A62 A;  1HR0 W;  1YNJ C;  4C3I G;  1IKL A;  2Z4H A;  2F0K A;  1GD7 A;  2NYZ D;  1SR3 A;  1Z47 A;  2Y0S G;  1GUS A;  3VR5 A;  5C0X G;  1GUN A;  5FLX c;  4KHV A;  1L1O A;  4FDB A;  1CKN B;  4JYA Q;  4IN3 A;  1O78 A;  4DV4 L;  2Z4I A;  4KD4 A;  5EPL A;  4LFC L;  3UE0 A;  1RIP A;  2IY5 B;  1WCM G;  2F0O A;  4XT1 B;  4F88 A;  4A3G B;  3GV3 A;  5FJ8 G;  4DR7 L;  1SYF A;  2EYM A;  3TRE A;  3E0J A;  1ILQ A;  1YJW A;  1SE2 A;  3HOX H;  1JWS D;  4OGQ C;  1LLR D;  2JA9 A;  2PPB C;  5M3M B;  4NXN Q;  5I9O A;  4A3E G;  5EPJ A;  3MFG A;  3S1M H;  4DK6 C;  2VQE Q;  3BVG A;  4JI0 L;  3PIP A;  2JA6 H;  4JV5 Q;  1K3R A;  3GTQ B;  3I73 A;  4C2M B;  4GNX C;  3GTM B;  2TMP A;  2WAQ E;  5CV5 A;  1VMC A;  5D65 A;  2UUA Q;  5IGG A;  1BBW A;  4JI1 Q;  1HZ9 A;  1Q12 A;  1EUJ A;  3CPW A;  1V8Q A;  5C44 G;  5HGT A;  4A93 B;  2CQO A;  3FPU B;  3UE1 A;  3PUV A;  4CDD C;  1BR9 A;  1VQ9 A;  4B3R Q;  1SRU A;  1P8L A;  4GKK L;  1R4Q B;  2CQA A;  1DON A;  1CZW A;  5JJZ A;  4A3B H;  2SEB D;  3K7A B;  1GM5 A;  1ENA A;  2QA4 A;  3MXN B;  1HXY D;  1YHQ A;  3OMG A;  4HID A;  4JI4 Q;  3I8Z A;  2PI2 E;  5C3E G;  3EQL C;  3WDN A;  3ZYY X;  4HIO A;  3VR2 A;  5IP7 H;  3M85 A;  4KD3 A;  1KDA A;  1U4L A;  2ZTD A;  2R93 H;  1M1K C;  1KD1 C;  4XIG S;  1Y1W G;  2UU9 L;  3R8B A;  2PQA B;  1ZXT A;  3K5M A;  4P71 A;  2EQS A;  4EQO A;  2B63 B;  4CKE A;  3W2D A;  1PA6 A;  2XRS D;  2WB1 E;  2GVB A;  3X3N A;  1SND A;  3S2D B;  1HNW L;  5EBC A;  5IGD A;  4LFA Q;  5M5W H;  4PZ8 A;  4DNI A;  2B2Y A;  4V0B A;  2PMZ B;  3BG3 A;  2CKZ B;  2OCE A;  1JIC A;  2SDF A;  3U58 A;  1JWU D;  4DR1 Q;  1Y8P B;  4EX5 A;  4ME5 A;  1C8C A;  4RFB A;  3VYU A;  5IT9 c;  1BCP C;  1Y8O B;  3VR6 A;  1B53 A;  1BF4 A;  1II3 A;  3GTG H;  2F3W A;  3T16 A;  1E1T A;  1B9N A;  1WTQ A;  3PV0 A;  4DAV A;  4HJA A;  4JI2 Q;  3D6C A;  4RKL A;  1VQB A;  2AHO B;  5ELD A;  3BYT B;  5E3F A;  5C4X H;  1JE5 A;  1JJG A;  4JI5 Q;  2BCO A;  3TSS A;  4PQX A;  3HFZ B;  1B3A A;  1NBW A;  2A1A A;  4L5Q A;  2DNE A;  4LUZ A;  4IUT A;  3ND9 A;  1QB5 D;  4QF4 A;  3PCO B;  3K0X A;  3GTK B;  2YU9 B;  3CCU A;  2K6A A;  4C3I H;  2MGS A;  1X3P A;  4B3M Q;  3P20 A;  1GUT A;  1FJG Q;  4IUV A;  4Y52 H;  4HMI A;  5C0X H;  1JR0 D;  2K05 A;  2PYK A;  3G6J B;  2Q2T A;  3DXJ C;  4OO1 I;  1JJC B;  1WCM H;  2ZJQ A;  4RGM A;  1O80 A;  2CVR A;  4LUO A;  1GOZ A;  1TWA B;  5FJ8 H;  3CXC A;  3Q24 A;  2MO1 A;  2F0E A;  3HKZ E;  3OTO L;  1CQF A;  4DV5 Q;  1LYL A;  1X32 A;  3MAQ A;  5IIF A;  5KRU A;  4DK3 C;  3STB D;  1GVP A;  3KUP A;  1QIL A;  1PHJ A;  2MHV A;  1UEB A;  5A2Q E;  4P75 A;  1YZ6 A;  3EJI A;  5L37 A;  4A3E H;  1I4Q A;  4L6T B;  1G6P A;  2R61 A;  3HOW G;  5IY0 A;  3J81 i;  3GTL H;  1ENF A;  5CC4 A;  4OIJ A;  2V4D A;  1HR0 Q;  1FNW A;  2K04 A;  1RKN A;  4ULL A;  2IL8 A;  3PUZ A;  4XT3 B;  3QB3 A;  2LFN A;  1S5E D;  5C44 H;  3GTJ B;  1MD2 D;  3URY A;  4FP5 D;  3Q6S A;  4A3J B;  2JA7 B;  1HTP A;  1S5C D;  4K5X A;  2VUM H;  5FK9 C;  4X3S A;  2ZJR A;  3A56 A;  2EVB A;  3TDQ A;  4QCL A;  1O7I A;  3NWT A;  2LKV A;  3NBI A;  4IJL A;  2WFW A;  3MA2 B;  1EY9 A;  1SJE D;  4H7B A;  5M5Y H;  1KAA A;  3KFU A;  4FVM A;  4LF4 Q;  2F52 A;  3W3A A;  1VQK A;  1N34 Q;  5LMN W;  2B29 A;  4IUU A;  1KLU D;  1V43 A;  2JA5 G;  3F2B A;  2EJF C;  1WTH A;  1GXD C;  4RH6 A;  1VQJ A;  2RSN A;  5K36 G;  1B8A A;  1LTL A;  3FMC A;  3RN2 A;  1PZK D;  3RLN A;  3Q23 A;  4PG3 A;  1STY A;  1Y1W H;  3J81 c;  4PMW A;  3PSI A;  3IRB A;  1Q7Y C;  1EYA A;  1TY0 A;  3S1R B;  2OWO A;  3T51 B;  2ENB A; 
#chains in the Genus database with same CATH homology
 1PRT B;  4KJN A;  1MI2 A;  2IWH A;  4KMU C;  3SR1 A;  3M7N A;  3BDC A;  1Y69 U;  1F77 A;  1KTK A;  5KIX A;  4PNY A;  3I3C A;  5LL6 S;  4NKL A;  1J9O A;  4QB4 A;  4OIK A;  3TZD A;  1BUV T;  1A15 A;  2Q8I B;  1Q8I A;  2EYP A;  3J80 E;  3T56 B;  1SXT A;  1T5E A;  1FYC A;  2J4X A;  1OXV A;  1EYD A;  1F2Y A;  3PUY A;  3MHB A;  1VDZ A;  1FD7 D;  4R9W A;  3PUX A;  3A7A B;  3NPP A;  3TP5 A;  2E2H B;  4H13 C;  4X3K A;  1AZP A;  1PFM A;  4J6H A;  4IFD H;  4PMB A;  1TQO A;  2G9D A;  1G91 A;  1GUG A;  1PLF A;  1O7Z A;  2A68 C;  2LS0 1;  1JE4 A;  2D62 A;  4Y7N B;  1WTX A;  2B8F A;  2B2U A;  4NW2 A;  1PTO D;  3HS0 C;  4CBV A;  5DM6 3;  5C0X J;  5IGB A;  1DYQ A;  3ITP A;  1K8M A;  3I4L A;  1CHQ D;  2F0Q A;  2N88 A;  3MXU A;  1Z7T A;  4LAA A;  2KEC A;  1GUO A;  3MXG A;  4B9W A;  4H44 C;  4KJO A;  3C1E A;  2NBF A;  2F0N A;  1LT6 D;  5T1I A;  4Q0F A;  3GP7 A;  1SYB A;  2EPB A;  4KN4 C;  4IFD I;  3AMU A;  3RUZ A;  2XSC A;  4H0L C;  4KY5 A;  3NHH A;  2JEB I;  1CQV A;  1C4Q A;  1SMY C;  5C5M A;  1ZYR D;  2AWN A;  5DM7 3;  3U9O A;  1VMP A;  5G3L D;  1HUN A;  2K5W A;  1I6V C;  3SVM A;  2XN9 C;  2ZT9 C;  3AB9 A;  1NUC A;  1H9S A;  3IL8 A;  2BE5 C;  4LMQ D;  1JOO A;  5ELC A;  5K36 H;  4U67 3;  1QNK A;  4F7X A;  3ERO A;  3GTP B;  2K7V A;  2HUG A;  4IUR A;  2Z8L A;  5F2D A;  2CW0 C;  3D3R A;  3BVM A;  2L12 A;  1JOQ A;  2K5D A;  1STH A;  4ID6 A;  2QCP X;  2OF1 A;  5CBA E;  1B44 D;  1SAP A;  3IFT A;  1K83 B;  1TU2 B;  4HSP A;  2XRQ D;  1SNP A;  4ZAI A;  3PIO 3;  1BO0 A;  1DOL A;  4N9P A;  2WKC A;  4B9X A;  1SNC A;  3QWN A;  5DNF A;  4KY7 A;  1NSN S;  4EGV A;  1SNM A;  5I2X A;  2H1E A;  4CJ2 C;  1LTB D;  5LHY 1;  1BOS A;  1UEA B;  1YNN D;  2F03 A;  4G7H C;  2A69 D;  4HMJ A;  3CKI B;  2F0L A;  1E2W A;  1TS4 A;  3K0Y A;  2AQ2 B;  4C3J B;  1QJO A;  1I3Q B;  2NTT A;  1STA A;  3MVV A;  4U68 A;  3KLS X;  2O5J C;  4M1U B;  3FEW X;  3NUC A;  4QMG A;  1IL8 A;  2ID0 A;  5I4D A;  5JVH 3;  4FNF A;  1WD0 A;  4RKB A;  1KDB A;  3LWU A;  4FXG C;  1OXX K;  4ZLT F;  1HA6 A;  2PZW A;  1EY6 A;  5JOB A;  1IHZ A;  2L4N A;  3BVZ A;  3QJY A;  3OOC A;  2A5H A;  2DNC A;  4RCN A;  2F1M A;  3NBH A;  1WTO A;  5BN5 A;  5D3D A;  2B2U C;  4EVO A;  1Q3L A;  4XQN A;  4ILW A;  3PO2 B;  1RJT A;  1STN A;  5EPK A;  2ZXP A;  3H6M A;  4O42 A;  4BS9 A;  2L11 A;  4HTH A;  3V96 A;  3D4R A;  2R92 B;  4FXK C;  5A35 A;  5D14 A;  2TSS A;  1F9P A;  2FMC A;  4RGN A;  2VB2 X;  4MHE A;  2B8G A;  1STG A;  2MP1 A;  2IJ0 A;  1TS5 A;  1ET9 A;  3S9W A;  1R9T B;  2F0P A;  5FLX L;  3S14 B;  1CT1 D;  3MFY A;  1U4P A;  3HZX A;  1SFO B;  3K5O A;  5IOD A;  2F0G A;  2JP1 A;  4X3U A;  3NTI A;  3K58 A;  5I2Y A;  5KNB A;  1F2M A;  3Q0A A;  2FFK B;  3P1H A;  1RTO A;  2CHB D;  5J1Z A;  2F0V A;  2L1B A;  3VYT A;  1F2L A;  1PRT C;  1WTP A;  5HUR A;  1EEF D;  3RMH A;  3KF8 A;  1L0Y B;  2L9H A;  1ML0 D;  1O7L A;  5COR A;  2DY7 A;  1A6X A;  3KLR A;  1GHK A;  2H4O A;  2J7Z A;  3V2T A;  2A6H D;  1CK1 A;  1Q1E A;  4ZQ3 A;  1WD1 A;  3T53 B;  3AU7 A;  4DK1 A;  4K14 A;  4ZK9 B;  4IUP A;  3BS1 A;  3OIP A;  4TRD A;  3EA6 A;  2RDG A;  4FF1 A;  2KED A;  2IW3 A;  1JCK B;  5KGU A;  1EQT A;  1BDO A;  1H9K A;  1OXT A;  3VR3 A;  2A74 C;  1HRJ A;  4JBW A;  3HOX B;  5NUC A;  3IAY A;  1EOT A;  1RCV D;  4FF3 A;  1EIH A;  4K8I A;  3A8K E;  3QOL A;  1S5D D;  1VCI A;  1YNJ D;  2WAC A;  3VA7 A;  3S1M B;  3NQT A;  3ONA B;  2JA6 B;  2BA1 A;  4A3I B;  3S1Q B;  2A73 B;  3SK4 A;  4RHR A;  4KTA A;  2IX0 A;  5IT9 L;  3DUZ A;  4K6D A;  1E0B A;  3QOJ A;  4BWG B;  1LTS D;  1EY8 A;  2NN6 G;  2F0H A;  4TSS A;  5C4Z A;  1ESF A;  3SXH A;  3JAM E;  1WTW A;  1IW7 C;  1HQR D;  5IGE A;  3EFX D;  5C5L A;  1QNU A;  2XWJ B;  4K6L A;  1M4V A;  4J8Q A;  3LWE A;  4FYD A;  1KDC A;  1UUP A;  1EU4 A;  1JC7 A;  2F0S A;  2ICE C;  2M9V A;  4K5V A;  2WIN B;  4G4K A;  4TQU S;  1TII D;  1LTR D;  2SNM A;  2IPK D;  2F0M A;  1ESR A;  1K8O A;  5M5W B;  5M5X B;  4C3H B;  5C0X I;  4V19 0;  4DAP A;  2N55 A;  1ZKO A;  2FHT A;  1DOM A;  5C4X B;  1B2T A;  3GO5 A;  4WRD A;  2K03 A;  3M3Y B;  4ZUI A;  2PZU A;  4HAE A;  3MXN A;  4HN7 A;  5CGK A;  4RAU C;  2EYL A;  3OWE B;  4C3I B;  2LMC B;  5KND A;  2QDB A;  1M8A A;  3BYY B;  4BA1 I;  3C2P A;  5IGF A;  2Y0S B;  1EWC A;  2QIL A;  2EY5 A;  2KHS A;  1SJH D;  1LT3 D;  1XTC D;  3K57 A;  4F8M A;  3TBI B;  5JEA J;  1BCP D;  1WCM B;  1G29 1;  1RD9 D;  4ZRZ A;  1RHP A;  4R8I A;  1R4P B;  4XDX A;  4G7O C;  4KKU A;  3J81 L;  1V1P B;  1BCP F;  1LAB A;  2A6E C;  3MWY W;  1BNZ A;  1U9R A;  1F9R A;  2I46 A;  2F0J A;  2EYO A;  3HOU B;  4DK0 A;  1QOH A;  1C48 A;  4CKB A;  4A3E B;  2KUM A;  2SNS A;  3GV6 A;  4BBR B;  1NR4 A;  2AUJ D;  3H3V C;  3A8I E;  3LNN A;  4CGY B;  2KEE A;  4RGO S;  1KNA A;  1GUW A;  1CA5 A;  1ROD A;  2EY1 A;  3KBG A;  1OXU A;  3SDZ A;  1I4G A;  3A54 A;  5IGC A;  2NN6 H;  2E75 C;  4CHT B;  4OL7 A;  5FLX E;  2VUM B;  3D4W A;  4XTC S;  4X3T A;  1TWC B;  2RDF A;  2HQE A;  2EE1 A;  2J0T D;  3SE0 A;  1D5M C;  2L5T A;  1KLG D;  2KCC A;  3H91 A;  3RLF A;  3PIP 3;  2B2V A;  4LJZ C;  1OO9 B;  4J1M A;  5E4W C;  3T4A C;  2PZT A;  2NN6 I;  4BY1 B;  2BA0 A;  1TWH B;  1QCB D;  2YYZ A;  1TWG B;  2R7Z B;  2ZXO A;  2IT1 A;  1DCZ A;  3A55 A;  3RZD B;  1AZQ A;  3C3L A;  1SSO A;  1JOR A;  1DJR D;  4K2K A;  4ABN A;  3K6O A;  4Q5V A;  5FKA C;  4L63 B;  1G2S A;  5C3W A;  2E2I B;  1EQV A;  1HFG A;  3VA5 A;  2JSO A;  2RKS A;  3SK8 A;  1S5B D;  2AUK A;  2RSO A;  5JAV A;  3MC0 B;  3DWQ A;  3FRP B;  4DXG A;  5EJW A;  3M4Y A;  2EJG C;  3QIA A;  1QE6 A;  4RCO A;  1B4O A;  1JOK A;  2NVY B;  3HOY B;  3QG1 A;  1G8Z D;  4DFA A;  1JQY D;  3PMF A;  3LX0 A;  1EYC A;  1PTO B;  1Q90 A;  4UAI A;  5J22 A;  4KV6 A;  5IT9 E;  2EYJ A;  1MGS A;  1LTT D;  3X3M A;  4EQP A;  3RD4 A;  3FDT A;  4RWS C;  4FXD A;  3E5S A;  3KK7 A;  3TN2 A;  1ONL A;  1RTN A;  1GHJ A;  1I50 B;  3HOV B;  3NSW A;  5FOB B;  4NDX A;  2HCC A;  1SNQ A;  4XQJ A;  1AN8 A;  1LV9 A;  2B2W C;  3D31 A;  4HED A;  3IFD A;  1LO5 D;  5CV8 A;  3SK6 A;  1FNV A;  1HUM A;  4XXE A;  1W6J A;  5A2Q L;  1D6E C;  5KNC A;  5JEA G;  2AQ1 B;  1S4Z A;  2K01 A;  1UAP A;  3G7L A;  3I91 A;  1S5F D;  1F2Z A;  2PQE A;  3OSO A;  1SE3 A;  1E2V A;  1W6K A;  2EYH A;  3S15 B;  4BY7 B;  5ELB A;  2EOT A;  1DXM A;  1SMY D;  3S17 B;  1H9R A;  4QIW B;  4ZYS A;  2KVM A;  5BN3 A;  5KEE A;  2NB0 A;  1SE4 A;  4MN3 A;  5JPN C;  1EY5 A;  2BE5 D;  4C3H G;  1DM0 B;  2B2T A;  4WFN 3;  2B2V C;  5EKL A;  1CTM A;  3TZU A;  3V05 A;  2X6G A;  1AEX A;  5E1F A;  4WJW A;  4C56 C;  1XWE A;  4OO1 G;  4AYB B;  4N9T A;  3OPO A;  4DXF A;  1E2Z A;  2QEJ C;  2JA8 B;  1RDP D;  2VNU D;  3MZ5 A;  3NP8 A;  3J81 E;  2CW0 D;  2IX3 A;  4KI0 A;  1VF7 A;  4BBS B;  3MEH A;  1FR3 A;  1Q1B A;  3J7Y W;  2WII B;  1EY7 A;  3R2I A;  2MJ8 A;  3J80 L;  2VXW A;  2HDM A;  1EWH A;  5M9O A;  4S3S A;  1HHV A;  2E74 C;  3A7L A;  3GTO B;  5CYU A;  2DY8 A;  1PMR A;  5IOC A;  1F9S A;  2X6L A;  3TME A;  4R8N A;  3NTH A;  5CV9 A;  4XQQ A;  1I6H B;  1CM9 A;  4KK7 A;  3H0G B;  3SEB A;  1PFN A;  2BDO A;  5ELF A;  3L9A X;  2NUC A;  5E4X A;  4DNT B;  3WOF A;  2HDL A;  1EY4 A;  4K5W A;  3DWP A;  3HOZ B;  2E2D C;  1WVL A;  1TY2 A;  4DF7 A;  3C1F A;  5ISR A;  1STE A;  1WTR A;  2Z1C A;  1HPC A;  1WTV A;  1DOK A;  1D5Z C;  4M8A A;  1AFP A;  3NTK A;  4CKC A;  4GZY C;  3D4D A;  1AP0 A;  5JEA H;  1G6Z A;  4KY6 A;  4IZ8 A;  5C4H A;  3IKJ A;  4DN4 M;  4UDU C;  1A3V A;  5DEH A;  4G7Z C;  2X69 A;  4G57 A;  4IQZ A;  2SOB A;  3DHQ A;  1TT2 A;  1BQQ T;  5ELE A;  1MBY A;  4KN7 C;  1CZG A;  1EU3 A;  1EL0 A;  3T13 A;  2K1B A;  2M2L A;  4K8J A;  5LL6 X;  1BXT A;  1I4R A;  5EKI A;  4HSV A;  5CMD A;  2E2J B;  2B39 A;  5J39 A;  1CA6 A;  1SBB B;  5JPM C;  2K32 A;  4IUN A;  3I70 A;  4ODG A;  4A3D B;  3GQB A;  1TS3 A;  4PMC A;  4O1N A;  1UNS A;  4FF4 A;  2E76 C;  4HR7 B;  1D2B A;  3NE5 B;  2IX1 A;  3PO3 B;  4OO1 H;  4A3F B;  2RQX A;  5DAU A;  2K5Q A;  1B9M A;  1HQM C;  3SK5 A;  1SDF A;  1NCV A;  3U9S A;  1PFB A;  4FO2 A;  4HCS A;  4A3B B;  1X3Q A;  5CV7 A;  4A3M B;  3P75 A;  1A3T A;  3FKI B;  2B2T C;  2L0C A;  3I90 A;  1I4P A;  2QKI C;  5EKK A;  2L55 A;  2R93 B;  3OWF A;  4XYO A;  4IFD G;  4P2C B;  2Q8R E;  2NTS A;  2EY2 A;  1PRT D;  3VYR A;  5I9P A;  1FGB D;  3E6Z X;  2F0D A;  2EJM A;  3MTS A;  4QUC A;  1PRT F;  5I6Y A;  1PZJ D;  1GJX A;  3N52 A;  3KBX A;  3CQZ B;  5TSS A;  5FO7 B;  1XYI A;  4QUF A;  3NQI A;  2F0F A;  5FO9 B;  3GTG B;  2F0I A;  3S2H B;  1PTO C;  4NMZ A;  1LTI D;  1KAB A;  3DEO A;  1V1O A;  1TS2 A;  4DGZ A;  1EEI D;  1EFI D;  3UI2 A;  3RZO B;  2KCN A;  2C5C A;  4RA8 A;  5D3I B;  4ZKC B;  3H09 A;  1SEB D;  3HRZ C;  4MIU A;  1VF5 C;  3VYS A;  4LK1 C;  2F0T A;  1H9S B;  1XX8 A;  1MSG A;  4C3J G;  3R93 A;  4B08 A;  2EY6 A;  1SYE A;  5M3F B;  3K5L A;  2JE6 I;  1ET6 A;  1H9M A;  3HEJ A;  1ZYR C;  4EQN A;  5CBE E;  1XXG A;  2B2W A;  4CJ1 B;  3K5N A;  1LAC A;  5CR3 A;  2F0U A;  2GA4 B;  3SHL A;  4WOR A;  5CV4 A;  3QO2 A;  5T1G A;  1IYU A;  1TVX A;  4RHS A;  1G2T A;  3J7A V;  2R3Z A;  3GTL B;  1LTA D;  2VB3 X;  4KKT A;  1CHP D;  2O5I C;  1BBX C;  2O2L D;  1Y8N B;  1H9J A;  3I72 A;  1IW7 D;  4C1N I;  3NK9 A;  5C44 B;  4L8J A;  1HTL D;  4ZKB B;  4ZUJ A;  4E6I A;  4BA2 I;  1HFN A;  1Y1V B;  3J7A F;  4F87 A;  2PW7 A;  2O4X A;  3TP7 A;  4NP5 A;  1ZEQ X;  2RVL A;  2PCF B;  5M5Y B;  2RDH A;  5CV6 A;  2M00 A;  2B2Y C;  5C3E B;  1HCZ A;  1PZI D;  3DWA A;  1DD2 A;  2AWO A;  4DA2 A;  1EY0 A;  3HP3 A;  5EQ0 A;  1SYG A;  2PW5 A;  1Y1W B;  1D1K A;  5AFW A;  1LT5 D;  1BCP B;  5C3X A;  1PDQ A;  3GD7 A;  5JVG 3;  3OW7 A;  5K5P A;  3FVQ A;  3R2T A;  4HCE A;  1YNN C;  1PTO H;  1ILP A;  5C4J B;  1SNO A;  1MSH A;  2A69 C;  3CHB D;  2WAQ B;  1JB3 A;  2KOL A;  3PUW A;  2MUY A;  2FJ2 A;  4KHZ A;  3OHX C;  3BDO A;  1PTO F;  3BZD B;  3ND8 A;  2FIN B;  1IKM A;  1A2T A;  3NWS A;  1I4H A;  4C1N K;  3A8J E;  3CU7 A;  1T5X D;  2G9H D;  1SYD A;  1O7Y A;  5KYL A;  3HG9 A;  3D6W A;  2NVT B;  1U4R A;  3M7G A;  2WV6 D;  1FNU A;  3F2U A;  2KA7 A;  1IYV A;  1NR2 A;  1Z6H A;  1NAP A;  2WP8 J;  3DM1 A;  1PYW D;  2D9U A;  3HGB A;  1B50 A;  2A6E D;  2XIW A;  4JK1 C;  5G3L F;  3FPP A;  2EDG A;  1TR5 A;  2D5D A;  2WB1 B;  4DNR B;  3WOE A;  1B1Z A;  3NXW A;  1EIG A;  2K28 A;  2LY7 A;  2NVX B;  3C46 A;  2RBM A;  3TP6 A;  4IAL A;  1V1P A;  5C6A A;  2XNA C;  2K33 A;  2F3V A;  3VR4 A;  3OIQ A;  1QWY A;  2BDN A;  2OEO A;  2NZ1 D;  3HOW B;  1RF2 D;  5BN4 A;  4KKS A;  2DN8 A;  1DZ1 A;  2OT2 A;  3JAM L;  1STB A;  3H94 A;  3EVQ A;  3BDL A;  4CJ0 B;  1EZ8 A;  5FO8 B;  2EZV A;  2A68 D;  1A3U A;  3OMC A;  2EXZ A;  4OHJ A;  2BOS A;  1D1I A;  2D2C C;  1QG7 A;  4Z9C B;  4IUQ A;  3ERQ A;  3S16 B;  1TWF B;  1D5X C;  2MPM A;  4RGT A;  3K59 A;  2I07 B;  1I4X A;  4DAY A;  2XWB B;  3CRK C;  5COY A;  5I6W A;  2PO4 A;  2KQ3 A;  2JA5 B;  3KLS A;  4K2L A;  3HKZ B;  1AW7 A;  1ICW A;  3DEP A;  2R6G A;  3DMU A;  3TP8 A;  3L7Z C;  4PV1 C;  3L3O C;  3O13 A;  3MXP A;  4I65 A;  1LTG D;  2JEA I;  1ENC A;  1CI3 M;  1EZ6 A;  2C9O A;  1LT4 D;  3N6R A;  5EGT A;  2JXM B;  2PNR C;  1SYC A;  2ICI A;  2A6H C;  3P7J A;  4IFD J;  4TKO B;  3D8G A;  2HCI A;  4A3K B;  3I4M B;  2F0W A;  2Q8T A;  1KNE A;  3S1N B;  2JYO A;  1F9Q A;  2QF7 A;  1U4M A;  4I7Z C;  1L0X B;  2EYF A;  2ZXR A;  2F4I A;  3M4O B;  2OXP A;  2WKD A;  2FMM A;  2NWG A;  3R3O A;  1PXU A;  4YIJ A;  3CRL C;  3I4N B;  2KJX A;  1J8I A;  4DU9 A;  3Q22 A;  4FF2 A;  2AQ3 B;  5EBD A;  1A2U A;  1TKW B;  2NVQ B;  5KYI A;  2XVS A;  1HA5 A;  1CFM A;  1JWM D;  2RA4 A;  4XYQ A;  1OXS C;  1YNJ C;  4C3I G;  1IKL A;  2Z4H A;  2F0K A;  2NYZ D;  1Z47 A;  3VR5 A;  1GUS A;  5C0X G;  1GUN A;  4KHV A;  4IN3 A;  1O78 A;  2Z4I A;  4KD4 A;  5EPL A;  2F0O A;  4XT1 B;  4F88 A;  4A3G B;  3GV3 A;  1SYF A;  2EYM A;  3E0J A;  1ILQ A;  1SE2 A;  1JWS D;  4OGQ C;  1LLR D;  2PPB C;  5M3M B;  5I9O A;  5EPJ A;  3MFG A;  3BVG A;  3GTQ B;  3I73 A;  4C2M B;  3GTM B;  2TMP A;  5CV5 A;  1VMC A;  5D65 A;  5IGG A;  1Q12 A;  1V8Q A;  5HGT A;  4A93 B;  3FPU B;  3PUV A;  1BR9 A;  1R4Q B;  2CQA A;  1DON A;  1CZW A;  5JJZ A;  2SEB D;  3K7A B;  1ENA A;  1HXY D;  3OMG A;  3I8Z A;  3EQL C;  3WDN A;  3ZYY X;  3VR2 A;  3M85 A;  4KD3 A;  1KDA A;  1U4L A;  4XIG S;  3R8B A;  1ZXT A;  3K5M A;  4EQO A;  2B63 B;  4CKE A;  3W2D A;  2XRS D;  3X3N A;  1SND A;  3S2D B;  5EBC A;  5IGD A;  2B2Y A;  4V0B A;  2PMZ B;  3BG3 A;  1JIC A;  2SDF A;  1JWU D;  1Y8P B;  4ME5 A;  1C8C A;  4RFB A;  3VYU A;  1BCP C;  1Y8O B;  3VR6 A;  1B53 A;  1BF4 A;  1II3 A;  2F3W A;  3T16 A;  1B9N A;  1WTQ A;  3PV0 A;  4DAV A;  3D6C A;  4RKL A;  5ELD A;  3BYT B;  5E3F A;  2BCO A;  3TSS A;  4PQX A;  1B3A A;  2DNE A;  4IUT A;  3ND9 A;  1QB5 D;  4QF4 A;  3GTK B;  2YU9 B;  2K6A A;  2MGS A;  1X3P A;  3P20 A;  1GUT A;  4IUV A;  4HMI A;  5C0X H;  1JR0 D;  2K05 A;  2PYK A;  3G6J B;  3DXJ C;  4OO1 I;  4RGM A;  1O80 A;  2CVR A;  1GOZ A;  1TWA B;  3Q24 A;  2F0E A;  1CQF A;  1X32 A;  3MAQ A;  5IIF A;  5KRU A;  3KUP A;  1QIL A;  2MHV A;  5A2Q E;  3EJI A;  1I4Q A;  4L6T B;  2R61 A;  1ENF A;  5CC4 A;  4OIJ A;  2V4D A;  1FNW A;  2K04 A;  1RKN A;  4ULL A;  2IL8 A;  3PUZ A;  4XT3 B;  3QB3 A;  2LFN A;  1S5E D;  3GTJ B;  1MD2 D;  3URY A;  4FP5 D;  3Q6S A;  4A3J B;  2JA7 B;  1HTP A;  1S5C D;  4K5X A;  5FK9 C;  4X3S A;  3A56 A;  2EVB A;  3TDQ A;  4QCL A;  3NWT A;  2LKV A;  3NBI A;  3MA2 B;  1EY9 A;  1SJE D;  4H7B A;  1KAA A;  4FVM A;  3W3A A;  4IUU A;  1KLU D;  1V43 A;  2EJF C;  1GXD C;  4RH6 A;  2RSN A;  5K36 G;  3FMC A;  1PZK D;  3Q23 A;  1STY A;  4PMW A;  1EYA A;  1TY0 A;  3S1R B;  3T51 B;  2ENB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...