1EYAA

Structure of s. nuclease stabilizing quintuple mutant t33v/t41i/p117g/h124l/s128a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMVFRLLLVDIPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eyaA00
2F0FA 2OF1A 5C4HA 1SYDA 2M00A 1A2TA 2EYFA 2F0GA 4KD4A 4DF7A 4K5WA 5EGTA 3TMEA 5C3XA 4K14A 5HURA 1SYGA 4KTAA 2QDBA 4PMBA 2F0UA 2SOBA 4ZUJA 3LX0A 4KHVA 4KY5A 3NK9A 2F0NA 2F0HA 2KHSA 2PW5A 3HZXA 1SNPA 5I6YA 1ENCA 3NQTA 3U9OA 3NP8A 5KIXA 3DMUA 4RKLA 4TRDA 2EYMA 1JOKA 3C1EA 3EJIA 3PMFA 1KDBA 3DHQA 3OSOA 2LKVA 4IZ8A 1KABA 3OMCA 4DGZA 5IIFA 2EXZA 4R8NA 3VA5A 2O4XA 4HTHA 1EZ8A 1SNOA 1EY0A 2OXPA 5DAUA 3S9WA 1JORA 3QOJA 5E3FA 4ZUIA 4EQPA 5DEHA 5I6WA 1EYAA 2F0WA 4I65A 4LAAA 4B9XA 4F7XA 2F0EA 3D8GA 3MZ5A 5J39A 4K8IA 5C6AA 1SYBA 5CV5A 5I9PA 1KDAA 4KV6A 2F0PA 4KD3A 1EY6A 1NSNS 2EY6A 2NUCA 4WORA 5EKLA 5CC4A 1JOOA 4YIJA 1KAAA 3HEJA 3MVVA 3P1HA 4J6HA 4WRDA 5EKKA 1JOQA 4F8MA 1STBA 3D4DA 3EVQA 2EYPA 3TP6A 3OWFA 2F3VA 2F0SA 1EY5A 4IALA 4E6IA 3E5SA 5IGGA 5CV8A 2PYKA 1F2MA 5JOBA 1ENAA 1EY7A 4J1MA 2PZUA 2F0DA 5F2DA 4K2LA 3SHLA 1STYA 4NP5A 4HMIA 4DU9A 5KYLA 1AEXA 2F0TA 3MXPA 4N9PA 1STGA 3TP8A 4IUNA 5KGUA 2F0MA 2RKSA 5M9OA 1TT2A 2WACA 1SNDA 2EYLA 5ISRA 4QF4A 1IHZA 4K5XA 3SR1A 3T16A 3SK5A 3BDLA 4S3SA 1II3A 4ME5A 4ZQ3A 5K5PA 5IGDA 5J22A 3H6MA 2ENBA 4KJOA 4H7BA 2F0QA 5E1FA 5IGCA 2RDFA 1SYFA 1A2UA 2HQEA 5IGFA 1STHA 4K5VA 4EQNA 4NDXA 5IODA 1KDCA 4KJNA 3NUCA 3T13A 3V2TA 5CV9A 5JAVA 4HMJA 3MEHA 3OMGA 1SNMA 2PW7A 1F2ZA 1EY8A 3QOLA 1STNA 1EQVA 1EZ6A 2F0VA 2PZTA 4QB4A 3D4WA 2KQ3A 1EYDA 3NHHA 4KY7A 3ERQA 3NXWA 1A3TA 4MIUA 2F0JA 1SNCA 4G57A 4KY6A 3MHBA 4EVOA 5KEEA 5C3WA 4K8JA 5IGEA 1EY9A 2PZWA 4K2KA 1TQOA 4PMCA 5HGTA 4PNYA 5KRUA 5KYIA 2F0LA 4N9TA 1U9RA 5C5MA 3SXHA 2EYHA 3SK8A 1TR5A 2PQEA 2EY5A 2F3WA 1F2YA 2F0OA 3P75A 3QB3A 4K6DA 3ITPA 4EQOA 4QMGA 1A3UA 5IOCA 3D6CA 2RBMA 3SK6A 5C5LA 2F0IA 5NUCA 4NMZA 2EYOA 1EYCA 1A3VA 1SYEA 1EY4A 4NKLA 1NUCA 3RUZA 5IGBA 2OEOA 3R3OA 2F0KA 4ODGA 3SK4A 3TP7A 3TP5A 4DFAA 5C4ZA 5I9OA 2EYJA 3EROA 5CV6A 1SNQA 5CGKA 5CV4A 4OL7A 4ID6A 4RKBA 2SNMA 5CR3A 2SNSA 1STAA 1SYCA 1RKNA 2EY1A 5CV7A 5J1ZA 3C1FA 2EY2A 4B9WA 3BDCA
chains in the Genus database with same CATH superfamily
4A3MH 1A2TA 1IBKL 4CDCC 4KTAA 2JN4A 2QDBA 2XRQD 3R93A 2JA9A 2AWNA 3RZOH 3NP8A 2B63H 1JOKA 3K6OA 1B7YB 4KN7C 4X3UA 2LY7A 4G7OC 2LKVA 4DXGA 1HNWQ 3CCUA 3VYSA 3CCMA 3F2BA 2XWJB 1EYAA 2SEBD 3U50C 1CA6A 4DV4L 4JI8L 5LMNL 3GTOH 1UE7A 5IT9c 3J7AF 3HOVG 3PSIA 1EY6A 4NXNQ 3S15B 1IYJB 2FMMA 5I2YA 4Y7NB 3AFPA 3K5NA 1VQAA 2IHEA 1CSPA 4F87A 1EWIA 1E2ZA 1EY5A 3CHBD 3TRZA 5IGGA 2I5MX 5JOBA 2Q8TA 2V1CC 3S2DB 2BDNA 4IUTA 4K2LA 4JBJA 3MTSA 2TMPA 3GQBA 4ME3A 5KGUA 2F0MA 1S40A 3FKIH 3S2HB 3V96A 2R92B 2MQHA 3SR1A 4XQJA 1QVFA 2EJMA 2ATWA 1SLJA 4CJ2C 4A76A 1X32A 1EEID 1L1OC 2BH8A 1K83H 1LABA 4ZCKA 3HS0C 1H9SB 2KA7A 3MEHA 2RSOA 1ILQA 3I4NB 1IXRA 5C0XH 2R7FA 4OWWB 1LT4D 2WAQB 3N6RA 4B3RL 2IHFA 4L5SA 1UE1A 4G57A 2ZXOA 4YHHL 1N36L 5KEEA 5C3WA 2BH2A 4A3EB 1H9SA 4RAUC 4JI7L 3SK8A 1H9RA 1TR5A 1TWCH 2A6HD 5IWAQ 3D6CA 4JCVE 4O42A 4IOAA 4A3FB 1B53A 2A69C 2B8GA 1A3VA 4Z9CB 1DOMA 3MXNA 2H1EA 4DFAA 4HJ5A 1JB7A 3A8JE 3PUVA 4OL7A 1RL2A 3NQIA 1W6JA 2ALYB 1RKNA 3CCJA 3UDGA 1ASZA 4P71A 2JA6H 1SYDA 4YWKA 5EGTA 4DR5Q 1PRTC 1AZQA 1NE3A 1FJGL 4CKBA 1WTPA 1GKHA 2F0HA 3S1MH 2PNHA 2K5WA 2E5LL 1LT3D 1GUOA 1B4OA 1NMFA 1PHJA 1BVSA 2ZXPA 2FFKB 5BN4A 3T51B 3ULLA 3VA5A 4HN7A 3T1HL 1Q8IA 3STBC 4EGVA 3PIO3 4X3TA 1GM5A 2CWAA 3HOVB 3D8GA 1CT1D 1JE5A 1S5BD 4WJWA 1KDAA 4GN5A 1FNWA 4CKCA 5BN5A 4J6HA 4TSSA 2R7ZG 1UE5A 1YHBA 4OGQC 2B2YC 1N8RC 2LSSA 2PYKA 5IYDH 1PTOB 1QOHA 2NVQB 4HR7B 1TWGB 4YWMA 2R7DA 3KF8B 3HOZH 1EQTA 3A5ZB 1CM9A 2ZJPA 1OXTA 2OTLA 3NBHB 3CCRA 3UE0A 1VQIA 1PH2A 2A74C 2OQKA 2IWHA 4ZRZA 3S2DH 1UEAB 4PMWA 3WOFA 1HQMC 3KF8A 1PMRA 1SXTA 2K04A 3HKZB 4DR6L 2E8GA 4C3HG 4DR2L 5BR8L 5ELCA 3I2ZA 3S14B 3S2HH 5C44B 3NBHA 1I5FA 3E9HA 4FO2A 3V2TA 4C3IH 1IZ6A 1EY8A 2VY3A 2ZM6Q 1PFBA 2IL8A 2K5NA 4LJZC 4X64L 1K8AC 1QB5D 4RGNA 1EU4A 2QEJC 4JI2L 3M85A 1IBLQ 4LK1C 1E24A 5KYIA 5KNDA 3U9SA 2F1MA 4JG2A 5C5MA 5FLXE 4BA2I 5LMUQ 4LF9L 3OYYA 4AH6A 5C4JB 4DA2A 3HOYB 3SK6A 3KLSA 2MP1A 4NMZA 4NKLA 4IUUA 3SDZA 5IGBA 1S5ED 1PTOF 1V9PA 4CJ1B 1SNQA 1J5EL 5CGKA 1F2LA 1LO5D 3CRKC 3CF5A 4RKBA 1YEZA 1STAA 2EY1A 3PO3G 4A3FH 3ICEA 4B9WA 2JJQA 2ZTDA 4DR3L 4K5WA 3TMEA 1XTDA 2ICIA 3PIP3 1LT5D 2ASBA 3LX0A 5GAGC 3BJUA 3RZDB 2AUKA 3I7FA 1B44D 4DNTB 2F3IA 4IURA 3ZYYX 4AQYQ 4V190 3OMCA 4DGZA 4B3ML 3VA7A 4JI5Q 2AQ2B 4LFCQ 5M5YB 1QUQB 5E3FA 4GNXA 4I65A 1EQRA 5C6AA 5CV5A 3DWPA 4BY1G 1XNQQ 3MVVA 4C1NK 5EKKA 5JEAH 1G8ZD 1WTOA 1QUQA 2WB1E 4HAEA 2UXDL 2L12A 4HJ8A 3HOVH 2UUBL 1KQSA 5CV8A 2Q8IB 4R1JA 3F2DA 4NP5A 1YI2A 2C35B 2NZHA 2N49A 3VR5A 4DAYB 4DV1Q 1JC7A 3C46A 1W3SA 1Z47A 1YNJC 2NZ1D 1PTOH 1Y8NB 1TY0A 1S4ZA 5FJ8G 2Q2UA 2NVQH 3T16A 1TWGH 3AQQA 2KENA 4FDBA 1EOVA 1DJRD 4A3JB 1PFNA 1I6VC 2YTXA 2CW0C 2K05A 1SYFA 4DAYA 4WJ3M 3W5OA 1QZGA 4DNRB 4RFBA 2E76C 5M3MG 3T13A 2K52A 2RCFA 4A3IB 1F77A 5M3FG 1M1KC 1HXYD 5I2XA 1C8CA 1STNA 1EQVA 3CC7A 3VYUA 3M4QA 3NXWA 2BE5D 3S14H 5C44H 3I3CA 1YNNC 3IKJA 4FXKC 4JI1Q 3S16B 3VDYA 4DV5Q 2XNAC 2CQOA 2L1BA 4L8JA 4JI0Q 1CA5A 3OPOA 1NUCA 1WFQA 4DUYQ 2K5VA 4DV6L 3PO3B 1F9QA 1BNZA 2UXCL 1JWUD 4EX5A 3HOXG 4JI4L 3CMAA 5BN3A 1CHQD 2F52A 5AJ3Q 1VQ6A 3I56A 1K8MA 3BZKA 4J15A 3UE1A 1SYGA 2B2TA 1DGSA 1SMYD 4GKKQ 1PH9A 1LACA 1O7ZA 4RKLA 5G3LF 2EYMA 5T1GA 1ILPA 4UP7A 2Q2IA 3U4VA 4DR7L 1Z7TA 1SE2A 1ZYRC 4RA8A 4G7HC 4RHSA 3GDEA 2B2WC 1HNXL 2YTYA 3OW2A 3RZDH 1GUWA 2K75A 5LL6S 2UXBL 3PF5A 2F0WA 2HIVA 3RLFA 1BCPC 3J7ZC 4A3GG 1PYSB 2EY6A 4CHTB 2VUMG 2B2UA 3GTQB 5IYCG 3FEWX 5CMDA 3CQZB 1Z6HA 1D1IA 4DPGA 1Q86C 1VQOA 3PO2G 2EQSA 1KRSA 3TSSA 3GO5A 3ULPA 1F9SA 1HA6A 1I4RA 2VB3X 2K1BA 1O7YA 4LF4Q 1GOZA 1WTXA 4JI3Q 3UDFA 3H3VC 4IPGA 1CFMA 4DR4L 5M3FB 1HNZQ 3M9BA 4L5TA 3G48A 5D3DA 5JAVA 1WTQA 1GO3E 2JA5G 4AYBE 1BQQT 2HT1A 4KKSA 4C3HH 1LTBD 2CQAA 4OO1G 1S5FD 3H94A 4N8FA 2VQFL 1OXVA 4A3IH 4PMCA 5M5XB 1G2SA 5H1SE 3P75A 1F2YA 1SMXA 3DWQA 4OXPA 4QIWE 4QY7A 2XGTA 4XIGS 1PH4A 1HZCA 3CP0A 3HGBA 5DLQE 1GUGA 4IFDI 2OEOA 2F0KA 2IJ0A 2EYJA 3HOXB 5CV4A 1JWSD 2RHQB 4YCVA 1W6KA 4DV7Q 2AQ1B 1EQQA 2KCTA 4BY7G 1TIID 2VQEQ 3PO3H 1VQPA 3R2TA 3ND8A 4Q5VA 2LMCB 2HQLA 3MXUA 3NQTA 1BXTA 1GHJA 4TRDA 3K5LA 3J7YW 5C4XG 3GV6A 1EIFA 4A3MB 1IBML 4DV3L 3S9WA 1EZ8A 2JE6I 2WIIB 1S72A 4EQ5A 4A3GB 2NWGA 2UUCL 1U5KA 3RZOB 2VUMB 4XYOA 3DM1A 3MC0B 2SDFA 3DEOA 4OONA 3PUWA 1KAAA 5HGQA 4KN4C 1EYGA 3L0OA 2NN6I 4YY3L 1H9MA 3OWFA 1L0XB 4NPSA 1VQCA 1DOLA 1EWCA 2OTJA 3PO2B 3GTOB 1SE8A 4GKJQ 4K6LA 3GTQH 4RGMA 3T53B 4IUVA 4ZKBB 3GP7A 4A4IA 2G9DA 2OWOA 2GVBA 2I5HA 4OWXB 5IGDA 5J22A 2MJ8A 5IGCA 3KLWA 1NTGA 5FJ8H 3H91A 4OO1I 1C0AA 2JA5B 3NEMA 1STHA 2A1AA 5CYUA 1KDCA 2JEAI 3MAQA 1BOSA 3KLRA 3TZUA 3E9IA 4MHEA 5M5WH 3ULJA 2WB1G 5FLXL 1E3PA 1YHAA 3ERQA 3BU2A 4CKEA 5M3FH 5JJZA 2MHVA 2N88A 1SRUA 1V43A 2PZWA 1PFMA 2A19A 1UE6A 1I50H 1NY4A 2F0LA 3QB3A 4K6DA 1Y1WG 1WVLA 5LMNW 4LFBQ 3I72A 2F0IA 4BBSB 4POFA 4LUZA 4UY8C 3MFGA 3R3OA 5M5XH 4BA1I 4DK1A 1BF4A 5CBAE 5C3EG 1PZID 1JICA 1HCZA 5FLMG 4UPAA 1YITA 3NELA 4BY7B 2F0GA 4KD4A 1HNWL 5C3XA 3HOXH 3K57A 4L5RC 1ENCA 1RDPD 1PH1A 4MTNA 4P2CB 4XQNA 2JA6B 4NXNL 4HJ9A 1IYUA 3K0XA 1GUNA 1FGBD 1JCKB 4HTHA 5EQ0A 2K32A 1EL0A 4C3JB 1V1QA 4YWLA 4ZUIA 2PI2E 4L6TB 1VQBA 2RHSB 3K58A 2Z0SA 1GUSA 1S5CD 2Q8RE 4X6AH 2F0PA 3JC66 5KIXA 1Y69U 4OELB 4PZ8A 2N78A 4BWGB 1JE4A 4A3GH 2EYPA 2EIFA 1TWAB 2G9HD 4UDUC 1YIJA 2VUMH 1KL9A 1L0WA 1O7LA 1BCPB 4J1MA 5IYCH 4IPCA 2F0DA 1VDZA 1PRTD 3M7NA 4LF5Q 2KVMA 1FGUA 2RSNA 3PQIA 4HCSA 3OW7A 3PO2H 1PLFA 4JBKA 2RVLA 2DGYA 3BDLA 2NVXB 2K5DA 5ELNA 3HOZB 4JVZA 3STBD 3E0JA 1G51A 4DK3C 2MGSA 3NUCA 5CV9A 3OMGA 1AZPA 3H3VI 3QOLA 1KLGD 1Y8PB 1JMCA 4O0AA 1SROA 5IWAL 1G6PA 2PNRC 2Y0SB 2O2LD 4F88A 4GLXA 4KY6A 2JA5H 3JAME 4K8JA 5D3IB 1O80A 1Y1WB 3E3XA 3DUZA 4C3IB 4PNYA 4LF6Q 3SXHA 2EYHA 1UNSA 4TVAB 2OT2A 1B3AA 2GN5A 3SE0A 4EQOA 1MKHA 4KHPL 2EVBA 4GOPC 2L5TA 3Q0AA 4BS9A 5C0XJ 4IO9A 4DR5L 1SYEA 2KOLA 4LF8Q 5IE8A 1TWFB 4ODGA 5C3EB 3TP5A 3S1NB 5C4ZA 2KEDA 1AP0A 2X6LA 3TN2A 1HTPA 2A6EC 3K7AB 5ELOA 4BBSH 4KKTA 3PCOB 5D65A 4A3LG 1EFID 1GUTA 2A68C 3MXNB 3HOWG 4UHVA 1VQKA 4ZUJA 1HJPA 3A8KE 1HUNA 2KEEA 3A8IE 3DMUA 1BBWA 2D0OA 2ZTCA 4BY7H 3PMFA 1VS0A 1VQFA 2EXZA 3LWUA 2O4XA 2B3GA 1QCBD 2TSSA 3R2IA 2DN8A 5C4XH 2Z6KC 2QKIC 1I3QB 1SN8A 4LAAA 4JW0A 2R93G 1F9PA 4WORA 3CPWA 3TREA 3RLNA 4C3JH 2K50A 1TVXA 4GS3A 4FP5D 4E6IA 3LWEA 3QO2A 3V05A 1V1OA 3J7A5 2WKDA 1RIPA 1X55A 4DKAC 3G4SA 2L0CA 2XTIA 2CKZB 3A7AB 2KHIA 2D0PA 1TWAH 2RKSA 1ET6A 3J7AV 1TWHH 2L9HA 3HG9A 4FVMA 3VR2A 1TXYA 2ZM6L 4S3SA 1CQVA 5K5PA 1DD2A 4O1NA 2AWOA 2VZAA 1Q1BA 4YHHQ 3EQLC 3I4MG 2N55A 2E2IH 1IBLL 3JAMi 3S24A 4HIOA 1SNMA 4XT1B 4CGYB 5LMUL 2NVXH 2QW7A 2F0VA 4BBRG 1Q7YC 1LT6D 4ABNA 3I91A 3CD6A 4H02A 4XT3B 3G6JB 3CC2A 3J81j 2R3ZA 3KOJA 5KRUA 3UDXA 2PQEA 3FRPB 1HTLD 3AEVA 3AMUA 1VQ8A 2VW9A 1A3UA 1D5XC 3W3AA 1VF7A 1RHPA 1YNJD 1Y1WH 3HOUG 3TP7A 3CW2C 4TQUS 1TU2B 1XPUA 1XNRQ 1JB3A 4YCUA 1NCVA 2SNSA 4N8X1 1N34Q 2CW0D 1R9TH 3HOWB 3BDCA 3OOCA 4AQYL 2IX0A 3ERSX 1TWFH 1DYQA 5C3EH 3S1NH 4JI5L 5CBEE 3D4RA 5FLMH 2ZT9C 1WOCA 3S17B 4HEDA 4R4OA 3K7AH 1XNQL 1YNND 4G4KA 4DR1Q 1CKOA 3KUPA 1HA5A 3IRBA 4LNQA 5DEHA 1Q81C 1Q82C 3PUZA 3X3NA 4GLVB 3J80E 4R4IA 4UP9A 4KD3A 3FVQA 2NUCA 3SGIA 1TY2A 4RH6A 1B1ZA 2K03A 1A62A 4GNXB 1I3QH 3D4DA 4X65L 3TEHB 1D2BA 4IALA 1KHIA 1EU3A 4RCOA 1VQNA 1CZWA 1NAPA 5F2DA 4QL5A 3MXPA 2F0TA 4HJAA 5FO8B 1STGA 1U4LA 1I4QA 1XMQQ 1YJWA 4JOIA 4JYAQ 2I07B 5JEAJ 1OXUA 1PFSA 2KJXA 1ZYRD 2R7ZB 4DAPA 3L2PA 1WD0A 2JA8G 2XSCA 4A3CG 4JI1L 1BCPD 1XTCD 4DV5L 1N33Q 1EZ6A 4DXFA 4DV2Q 3D4WA 4JI0L 4LF9Q 3NE5B 2AUJD 4JI6Q 2E2DC 3L3OC 4EVOA 4M1UB 2R6GA 4DUYL 2A73B 4KKUA 5HGTA 1V8QA 2HD3A 3M4OH 4PQXA 1B50A 2F3WA 3X3MA 4C3HB 1D6EC 1HZAA 1E0BA 1AW7A 5AJ3L 2O5IC 1X3FA 5JPNC 5FO9B 3W1BA 1XPOA 1DZ1A 4GKKL 5CV6A 2Z4IA 2CH4W 4ID6A 2BCOA 4A3DG 2X69A 1L1OB 4GN3B 4DF7A 1M8AA 3DEPA 4POGA 3NSWA 4X66Q 4FXGC 5HURA 2PMZB 3OTOQ 2SOBA 4KI0A 2JEBI 3RR5A 2PW5A 1DXMA 3VYRA 1VQ9A 1WYDA 3HOWH 5EAYA 1DOKA 3EJIA 1U4PA 3IFTA 3UI2A 1L1OA 2RA4A 1YBYA 3J80i 2NVYB 4JPBW 4AIMA 5GAHC 2A8VA 2WAQE 2B2VC 4UP8A 1KNAA 1NR2A 1T5EA 1XJVA 3S17H 4JC0A 4FXDA 3MZ5A 1ICFB 2AKWB 1SYBA 1EUJA 1VQ5A 4KV6A 4IFDG 4M8AA 1QG7A 5EKLA 5TSSA 3P1HA 4WRDA 4DUZQ 3BZCA 2D9UA 4A3BG 4RGOS 3DLLA 2NTTA 2R93H 2IX1A 3TS0A 1G6ZA 2F0SA 2Q2HA 2PQAB 1AE3A 3KF6B 5GADC 1WI5A 2UU9Q 1B2TA 4MNOA 1STYA 1PRTB 4JI3L 1MJCA 1M90C 3MXGA 3ND9A 1KD1C 1HNZL 2E2HB 2BDOA 5ISRA 2EYLA 4PV1C 4BY1B 2PQAA 3D31A 3KF6A 3OHXC 3WOEA 5ELEA 4R4TA 2JA8B 3GTGH 1SDFA 4X3KA 3TQYA 3NWTA 3KJPA 3BZDB 4IQZA 1CK1A 1IW7C 3IFDA 3CKIB 1TS5A 1UWVA 4NDXA 1IKLA 1VMPA 1SFOH 3JAML 1IL8A 2ZXRA 2PW7A 2Z1CA 1R4QB 4A75A 1S5DD 2R7ZH 2IPKD 1KAWA 3I4MH 3BS1A 2NN6G 3FHWA 3JAMc 4PG3A 1Q46A 2JSOA 3AB9A 1E2VA 5HY6A 4NXMQ 3D0FA 1PH6A 3FDTA 4HSPA 5M5WB 4IN3A 5EPJA 1KLUD 5IYBG 4O2DA 5M3MB 2MO1A 4DV7L 1CKNB 2ICEC 4WFN3 3Q8DA 4DAMA 3DXJC 4DNIA 2B2YA 2VQEL 3PIOA 4QUFA 4A3DB 1I50B 2K7VA 1PRTF 1VQGA 3M4YA 1H95A 3HOUH 2F0FA 1XXGA 2OF1A 1CKNA 1HRJA 2EJGC 5EPKA 2QA4A 4J8QA 4LFAQ 2FINB 1QE6A 2LXKA 3HKZE 3RLOA 3C2PA 1HZ9A 4KHVA 2Z9HA 5EBCA 4A3KG 4C56C 1I94Q 1XPRA 1KRTA 3MFYA 5JJKA 2P5ZX 2HCIA 4IJLA 2YV5A 1QILA 4IZ8A 1KABA 3MWYW 4I7ZC 1E1OA 2EXDA 2XVSA 3HKSA 2CWPA 2K01A 1R4PB 1RJTA 3QOJA 4EQPA 3OWEB 3S1QB 4QQBX 2L15A 2NVYH 5EPLA 2HHHQ 3I4OA 4GKJL 4A3BB 1NSNS 4H44C 1MGSA 3NENA 3RMHA 4DV0L 2NBFA 4F8MA 4FF2A 1HFGA 1NR4A 2F4VQ 2NVTB 2JQOA 3EVQA 2FJ2A 1PV4A 3TP6A 5E4WC 1HQRD 1PZJD 4ZKCB 2IX3A 2PZUA 1BKBA 2WP8J 3A56A 4B3TQ 5KYLA 1XYIA 2O5JC 2KCNA 2Z6BA 2YU9B 1A15A 1I4HA 3PV0A 2JK8A 3HRZC 1IL2A 4RWSC 4A93G 2KCCA 3FMCA 4ZQ3A 1FL0A 4IJHA 2X6GA 1G2TA 2ENBA 3S1RB 4OX9Q 2E2HH 4K5VA 4EQNA 4BY1H 4P72A 4KLKA 5JJLA 2JA8H 4CDEC 5J3BA 2CHBD 3K7UC 4KY7A 4A3CH 2GA4B 4LFBL 4K0KQ 1I6HH 1A3TA 3PIPA 1L2FA 2K4KA 1YJ9A 1MI2A 1U9RA 2LXJA 1VQLA 5LL6X 1LYLA 2VB2X 3QJYA 5GAEC 4FYDA 4LF7Q 1RCVD 1EYCA 5E7NA 1EY4A 3RUZA 3M4PA 2N8NA 1ZXTA 1ICWA 1I4GA 1M4VA 2MO0A 4DAVA 3GTLB 1LTSD 2RCNA 1TS3A 5M3MH 1EIGA 1XMOL 1PTOC 3NTKA 1SEBD 4UAIA 2M00A 1AH9A 3RD4A 2R61A 4K14A 4A3DH 5FLXc 4FF3A 2EOTA 4KY5A 2ES2A 1VF5C 1K28A 1VCIA 1RTNA 3T1YQ 3BYTB 5FKAC 1HR0Q 1D7QA 1B3QA 2UUCQ 4B08A 3EN2A 1ET9A 1GD7A 3DHQA 3UDIA 3J80L 1PVOA 4ZLTF 3I4LA 3W1GA 3HP3A 4IUQA 2K28A 3BG3A 3KLSX 2PPBC 5COYA 1EIYB 2WFWA 4X62Q 2EPBA 1ZKOA 5C0XI 4F7XA 3J80c 3NBIA 3J81E 1DONA 1BR9A 3L9AX 2E75C 1LLRD 2R92G 4MN3A 2KUMA 3MEFA 5JVG3 2PO4A 4LF5L 1Z9FA 4NW2A 3SEBA 1WJJA 4DN4M 1STBA 3S1QH 4IFDH 1WTRA 5C4XB 1N32Q 5KNCA 4L5QA 1AE2A 3GD7A 1EEFD 4PZ6A 2A6ED 1F2MA 1V1PB 4QUCA 4A3BH 2A68D 2BA0A 4LUOA 4P73A 4I7AA 3I4NG 2NVTH 1TS4A 1ESFA 1LTID 1JR0D 2WAQG 4RHRA 2UUAQ 2A69D 1KTKA 4BXXG 2HCCA 1V1PA 4LUVA 3SK5A 3BYYB 4ME5A 4JK1C 4A3EG 3H6MA 4H7BA 2F0QA 1U4MA 1A2UA 2YU9H 1SJED 1E22A 2XN9C 4KJNA 1TWHB 4A3FG 2I46A 4HMJA 5DM73 3KDFB 2H4OA 3FPUB 3O13A 1PH3A 2L11A 1QVGA 4C2MH 3BVZA 4ZK9B 3S1RH 2B2WA 3HFZB 1B70B 1K0RA 1L0YB 3CPFA 1B8AA 4LF8L 3D6WA 1CKMA 2E2IB 1Y8OB 2DNEA 2NN6H 2F03A 2IY5B 3KDFA 1STEA 2EZVA 1YVCA 5NUCA 4OIJA 1K3RA 1K8GA 1N9WA 3CCEA 2D2CC 1K3BC 1Q8KA 2WB1B 3SK4A 5IYBH 4B3SQ 5IT9L 3VYTA 3QG1A 5I4DA 2L4NA 1OTCA 1JT8A 5J1ZA 4U673 2C5CA 1CI3M 5JEAG 1EOTA 5C4HA 4U68A 2EYFA 3A55A 3D3RA 4JV5Q 2EDGA 4CJ0B 3CU7A 1K8OA 3GTLH 2F0UA 3A54A 3I55A 1MBYA 4OO1H 3NK9A 3CCSA 1JJCB 2XRSD 3K5OA 3U9OA 3QIAA 1R9TB 3J81i 3PF4A 2DJFC 4A3KH 1IBKQ 2E2JH 1HH2P 1O78A 1U4RA 5K36G 1BCPF 1PZKD 1VMCA 3CRLC 1QNUA 1MSGA 1X56A 2IT1A 4AYBG 4KHZA 3I70A 3IL8A 3M3YH 3EFXD 3FP9A 4Q0FA 1B9NA 3K81C 1PYWD 2Q2TA 2HIXA 2HDMA 2M2LA 3HKZG 5LHY1 2H5XA 4DV4Q 4JI8Q 5LMNQ 1AN8A 1UAPA 3H09A 5C44G 1LTLA 3GTKB 4X3SA 1RTOA 5EBDA 1P16A 3TP8A 4RGTA 2L55A 4MTKA 5M9OA 2WACA 2B2TC 1OO9B 1SNDA 3NTHA 4QF4A 3CMEA 1K73C 1K9MC 1X3PA 1VQHA 3H15A 4QCLA 4XQQA 3VR3A 1CHPD 1Q3LA 2B29A 1HHVA 4A93H 5JVH3 3HOYG 1CUKA 2K14A 2D5DA 3A0JA 1K0SA 1HUMA 1RF2D 4KHPQ 2E74C 4QGUA 1YZ6A 2B2UC 1H9KA 2K33A 2KCMA 1EFWA 1C9OA 2JYOA 3KBXA 1XNRL 1MIUA 2KHJA 1N34L 5IOCA 1E7ZA 1G91A 4IPDA 5FOBB 5C5LA 1RODA 4B3RQ 1SSOA 3R8BA 1LM0A 3Q24A 1N36Q 1LTRD 5T1IA 1B9MA 4TKOB 1GHKA 2AHOB 1YHQA 2XIWA 3F2CA 3LNNA 3M4OB 4JI7Q 3CCQA 1NJIC 1JQYD 4HJ7A 4JBWA 3ITPA 3C1FA 2RF4A 2MUYA 1JJ2A 4GN4B 3TS2A 4CBVA 4DR1L 3W2DA 3G71A 3SVMA 1X3GA 2MFIA 1FNVA 1SNPA 2J4XA 3B6YA 4XXEA 1ASYA 1QVCA 1SJHD 3H3VH 1J9OA 3C1EA 3P20A 1KDBA 3I90A 3OSOA 2AQ3B 1ENFA 1C4QA 3S15H 1ESRA 4R8NA 1JJGA 1FJGQ 1SNOA 1XX8A 4Y7NH 5DAUA 4AYBB 1LTTD 4CDFC 2E5LQ 1HPCA 3FPPA 5CORA 2VS1A 3TDQA 4LFCL 3EA6A 4HIKA 3T1HQ 1WCMG 1XMQL 4A3JG 5DM63 4QIWB 1QWYA 2R92H 2ZTEA 3E5SA 4JYAL 1CZGA 3KFUA 1LTGD 2B39A 1GVPA 1MSHA 1Q12A 4HMIA 4A3IG 3EIVA 2AMCB 2A6HC 1AEXA 3VR4A 2KECA 2R93B 4ZAIA 5A2QE 3GTJB 1TT2A 4XTCS 2F4IA 3I4NH 3GTPB 2QF7A 1N33L 3GTKH 5FK9C 4DV2L 4JI6L 3VR6A 4DV1L 4OHJA 2HQEA 1S3OA 4BXXH 4L63B 3MA2B 4A3EH 2J7ZA 4CDDC 4FF1A 1T9HA 1F2ZA 3K0YA 1XWEA 1Y1VG 2JA7G 3GTGB 1PH7A 3NHHA 2HUGA 4DR6Q 4DR2Q 4PZ7A 2GVAA 1UUPA 5GQOA 5BR8Q 2K5QA 2M9VA 1BDOA 1RD9D 2RDHA 1SFOB 1U0LA 1DCZA 4GLAC 1C7YA 1DM0B 4QMGA 5IP9G 3I4MB 1J6QA 3K59A 1I4PA 3P7JA 4KK7A 4APVA 1YJNA 4X64Q 2CFMA 1VQMA 1PA6A 4MZ9A 5FO7B 1Y14B 1Q1EA 4X66L 4JI2Q 4FNFA 1E2WA 4BBRB 3OTOL 3F2UA 2WKCA 4IUPA 2NYZD 5CV7A 1IW7D 2I5LX 2OCEA 3H0GG 1OXXK 1ONLA 2FMCA 2N3SA 4GZYC 5GROA 4PMBA 1AFPA 4HCEA 2WINB 1J5EQ 5ELFA 2Z8LA 1GJXA 3G7LA 1FNUA 1LTAD 2NB0A 2JXMB 2YYZA 3HOUB 4DR3Q 1T5XD 2K5HA 3J81L 4KMUC 3E6ZX 2Y0SE 1WTHA 4DUZL 3A7LA 1JORA 1EY0A 1QZHA 4LMQD 3J81c 1D8LA 1KNEA 4XYQA 5I6WA 3RNUA 5JJIA 4X65Q 2F0EA 5K36H 4GOPB 2DY8A 3CCVA 2UU9L 5IT9E 1WCMB 5L37A 3DWAA 1JOOA 4HSVA 4YIJA 4B3MQ 4NB3A 1KXLA 1TKWB 4A3LH 4H0LC 1OXSC 2D62A 2F3VA 1IYVA 3Q22A 3KJOA 4GOPA 3C3LA 1BUVT 3SHLA 2CCZA 4LW1A 1WTVA 4N9PA 3Q6SA 1X3EA 2DY7A 2UXDQ 2UUBQ 3OIPA 2DUDA 4C1NI 3LGJA 1II3A 2B8FA 4KJOA 5E1FA 4OWTB 5IY0A 1UEBA 3GTJH 2JA7B 1Y1VB 3GV3A 4NXML 3GTPH 4LF4L 3AU7A 1F9RA 1E1TA 4P75A 1EYDA 5C4JH 1JWMD 3N52A 1W2BA 3HOYH 4OEMB 4XDXA 5IGEA 3OIQA 4RMFA 1KC8C 3KYHC 2Z6KA 4IOCA 4N9TA 1G291 2EE1A 2ZJQA 2EY5A 4P74A 3BVMA 1X54A 2MPMA 3PUXA 4H13C 3AYHB 1I6HB 1X3QA 1SAPA 5IP7G 1NBWA 4R4QA 4LFAL 4DK0A 1CSQA 3AFQA 2J0TD 2PI2A 2K6AA 4A3MG 1Q90A 1X9NA 1I94L 3H0GB 5CR3A 1SYCA 2BOSA 2RQXA 4BBRH 2B63G 5M5YH 3I73A 1D1KA 4DV6Q 2KHSA 3K5MA 2I0QA 2UXCQ 1MJEA 4JI4Q 3NPPA 1NNXA 4ZYSA 3A74A 2HHHL 5ELDA 3M7GA 1GXDC 1BBXC 3KK7A 2OXPA 2QGQA 3T56B 3RN2A 2F4VL 3WWVA 4Y52H 5J39A 1EWHA 1BO0A 1PDQA 4DK6C 1HR0W 4DR7Q 4B3TL 1PH5A 3KBGA 1HNXQ 2RDGA 2WV6D 5KNBA 1SR3A 3ONAB 3WDNA 2UXBQ 2BE5C 3EBEA 1PTOD 1BBUA 2VXWA 1WCMH 2CH4A 3FKIG 4A3JH 2BA1A 1FVIA 5D14A 2DJGC 4OX9L 1PXUA 2YTVA 1LUZA 2LFNA 3URYA 5AFWA 2VNUD 1IHZA 3ER0A 3K80C 4JBMA 5EJWA 4K0KL 3PUYA 5E4XA 2RDFA 1X6OA 5C0XG 2LS01 3IAYA 1VQJA 1PYBA 1H9JA 3S16H 1EIHA 3E0EA 4RCNA 1VQDA 4BBSG 1MD2D 1NMGA 1SMYC 4QB4A 1VQ7A 2KQ3A 1SE4A 2F0JA 4DR4Q 2NTSA 1VQEA 2EJFC 4LF7L 3F1ZA 1Y1VH 2JA7H 1EY9A 3RN5A 1LV9A 1A8VA 4LWCA 5JPMC 1TQOA 4WJ4A 2KBNA 1SBBB 3DM3A 1O7IA 2ZJRA 3GTMB 4IPHA 1PH8A 2RBMA 4C2MB 3QWNA 4G7ZC 3K8AA 4ILWA 1FR3A 1X65A 1YNXA 2VQFQ 2HDLA 1CTMA 5IP9H 2JA6G 3EROA 4R8IA 3L7ZC 3T4AC 3T1YL 2SNMA 1HR0L 4C3JG 2EY2A 4DU9A 2B63B 1A63A 1D5MC 3U4ZA 4V0BA 2PCFB 1TS2A 2A5HA 2F0NA 4FF4A 3H0GH 3HZXA 5I6YA 4X62L 4RG1A 2FXQA 3ZJYC 2V4DA 4DV0Q 5IIFA 3F8TA 3NWSA 5ELBA 1ML0D 3CAMA 1QNKA 4R4CA 3CQZH 4QJFA 1N32L 4B9XA 2G5DA 4K8IA 5I9PA 1FD7D 2C9OA 4A3KB 5CC4A 2E2JB 2VL6A 3CC4A 1IBMQ 1D5ZC 2ID0A 5IYDG 3HEJA 4DV3Q 1JOQA 3G6EA 4HIDA 3NTIA 3PGZA 2UUAL 3HOZG 1FYCA 3FKIB 1HFNA 5A2QL 1ENAA 1EY7A 3M3YB 2MNAA 3TZDA 4IUNA 1K83B 5DNFA 2PMZE 4YY3Q 1A6XA 2Y0SG 4K5XA 4HIMA 1WTWA 5A35A 2QEXA 4IFDJ 3TBIB 3BVGA 1A0IA 4C3IG 2Z4HA 2XWBB 5G3LD 4R9WA 2DNCA 5EKIA 1SE3A 5IGFA 4ALPA 3BDOA 3QR8A 5IODA 2CVRA 1WD1A 1QJOA 3U58A 4ULLA 1P8LA 1KIXA 2PZTA 1TWCB 3I8ZA 1J8IA 4MIUA 2B2VA 1SNCA 1C48A 2OQ0A 2QDLA 3MHBA 1HZBA 2NZOA 1CQFA 2IW3A 4K2KA 4A93B 4B3SL 4OIKA 2F0OA 1VQ4A 2JP1A 2FHTA 3CXCA 3Q23A 1XMOQ 2QILA 2EYOA 4JV5L 1MHWC 1ZEQX 4LF6L 4YCWA 5I9OA 3A5UA 1I4XA 4GNXC 3CCLA 4JOIC 5IP7H 3GTMH 3S1MB 2QCPX 1IKMA
chains in the Genus database with same CATH topology
1A2TA 4KTAA 2QDBA 2XRQD 3R93A 2AWNA 3NP8A 1JOKA 3K6OA 4KN7C 4X3UA 2LY7A 4G7OC 2LKVA 4DXGA 3VYSA 2XWJB 1EYAA 2SEBD 1CA6A 3J7AF 1EY6A 3S15B 2FMMA 5I2YA 4Y7NB 3K5NA 4F87A 1E2ZA 1EY5A 3CHBD 5IGGA 5JOBA 2Q8TA 3S2DB 2BDNA 4IUTA 4K2LA 3MTSA 2TMPA 3GQBA 5KGUA 2F0MA 3S2HB 3V96A 2R92B 3SR1A 4XQJA 2EJMA 4CJ2C 1X32A 1EEID 1LABA 3HS0C 1H9SB 2KA7A 3MEHA 2RSOA 1ILQA 3I4NB 5C0XH 1LT4D 2WAQB 3N6RA 4G57A 2ZXOA 5KEEA 5C3WA 4A3EB 1H9SA 4RAUC 3SK8A 1H9RA 1TR5A 2A6HD 3D6CA 4O42A 4A3FB 1B53A 2A69C 2B8GA 1A3VA 4Z9CB 1DOMA 3MXNA 2H1EA 4DFAA 3A8JE 3PUVA 4OL7A 3NQIA 1W6JA 1RKNA 1SYDA 5EGTA 1PRTC 1AZQA 4CKBA 1WTPA 2F0HA 2K5WA 1LT3D 1GUOA 1B4OA 2ZXPA 2FFKB 5BN4A 3T51B 3VA5A 4HN7A 1Q8IA 4EGVA 3PIO3 4X3TA 3HOVB 3D8GA 1CT1D 1S5BD 4WJWA 1KDAA 1FNWA 4CKCA 5BN5A 4J6HA 4TSSA 4OGQC 2B2YC 2PYKA 1PTOB 1QOHA 2NVQB 4HR7B 1TWGB 1EQTA 1CM9A 1OXTA 2A74C 2IWHA 4ZRZA 1UEAB 4PMWA 3WOFA 1HQMC 3KF8A 1SXTA 1PMRA 2K04A 3HKZB 4C3HG 5ELCA 3S14B 5C44B 3NBHA 4FO2A 3V2TA 1EY8A 1PFBA 2IL8A 4LJZC 1QB5D 4RGNA 1EU4A 2QEJC 3M85A 4LK1C 5KYIA 5KNDA 3U9SA 2F1MA 5C5MA 4BA2I 5FLXE 5C4JB 4DA2A 3HOYB 3SK6A 3KLSA 2MP1A 4NMZA 4NKLA 4IUUA 3SDZA 5IGBA 1S5ED 1PTOF 4CJ1B 1SNQA 5CGKA 1F2LA 1LO5D 3CRKC 4RKBA 1STAA 2EY1A 4B9WA 4K5WA 3TMEA 2ICIA 3PIP3 1LT5D 3LX0A 3RZDB 2AUKA 1B44D 4DNTB 4IURA 3ZYYX 4V190 3OMCA 4DGZA 3VA7A 2AQ2B 5M5YB 5E3FA 4I65A 5C6AA 5CV5A 3DWPA 3MVVA 4C1NK 5EKKA 5JEAH 1G8ZD 1WTOA 4HAEA 2L12A 5CV8A 2Q8IB 4NP5A 3VR5A 1JC7A 3C46A 1Z47A 1YNJC 2NZ1D 1PTOH 1Y8NB 1TY0A 1S4ZA 3T16A 1DJRD 4A3JB 1PFNA 1I6VC 2CW0C 2K05A 1SYFA 4DAYA 4DNRB 4RFBA 2E76C 3T13A 4A3IB 1F77A 1HXYD 5I2XA 1C8CA 1STNA 1EQVA 3VYUA 3NXWA 2BE5D 3I3CA 1YNNC 3IKJA 4FXKC 3S16B 2XNAC 2L1BA 4L8JA 1CA5A 3OPOA 1NUCA 3PO3B 1F9QA 1BNZA 1JWUD 5BN3A 1CHQD 1K8MA 1SYGA 2B2TA 1SMYD 1LACA 1O7ZA 4RKLA 5G3LF 2EYMA 5T1GA 1ILPA 1Z7TA 1SE2A 1ZYRC 4RA8A 4G7HC 4RHSA 2B2WC 1GUWA 5LL6S 2F0WA 3RLFA 1BCPC 4CHTB 2EY6A 2B2UA 3GTQB 3FEWX 5CMDA 3CQZB 1Z6HA 1D1IA 3TSSA 3GO5A 1F9SA 1HA6A 1I4RA 2VB3X 2K1BA 1O7YA 1GOZA 1WTXA 3H3VC 1CFMA 5M3FB 5D3DA 5JAVA 1WTQA 1BQQT 4KKSA 1LTBD 2CQAA 4OO1G 1S5FD 3H94A 1OXVA 4PMCA 5M5XB 1G2SA 3P75A 1F2YA 3DWQA 4XIGS 3HGBA 1GUGA 4IFDI 2OEOA 2F0KA 2IJ0A 2EYJA 3HOXB 5CV4A 1JWSD 1W6KA 2AQ1B 1TIID 3R2TA 3ND8A 4Q5VA 2LMCB 3MXUA 3NQTA 1BXTA 1GHJA 4TRDA 3K5LA 3J7YW 3GV6A 4A3MB 3S9WA 1EZ8A 2JE6I 2WIIB 4A3GB 2NWGA 3RZOB 2VUMB 4XYOA 3DM1A 3MC0B 2SDFA 3DEOA 3PUWA 1KAAA 4KN4C 2NN6I 1H9MA 3OWFA 1L0XB 1DOLA 1EWCA 3PO2B 3GTOB 4K6LA 4RGMA 3T53B 4IUVA 4ZKBB 3GP7A 2G9DA 5IGDA 5J22A 2MJ8A 5IGCA 3H91A 4OO1I 2JA5B 1STHA 5CYUA 1KDCA 2JEAI 3MAQA 1BOSA 3KLRA 3TZUA 4MHEA 5FLXL 3ERQA 4CKEA 5JJZA 2MHVA 2N88A 1V43A 2PZWA 1PFMA 2F0LA 3QB3A 4K6DA 1WVLA 3I72A 2F0IA 4BBSB 3MFGA 3R3OA 4BA1I 4DK1A 1BF4A 5CBAE 1PZID 1JICA 1HCZA 4BY7B 2F0GA 4KD4A 5C3XA 3K57A 1ENCA 1RDPD 4P2CB 4XQNA 2JA6B 1IYUA 1GUNA 1FGBD 1JCKB 4HTHA 5EQ0A 2K32A 1EL0A 4C3JB 4ZUIA 4L6TB 3K58A 1GUSA 1S5CD 2Q8RE 2F0PA 5KIXA 1Y69U 4BWGB 1JE4A 2EYPA 1TWAB 2G9HD 4UDUC 1O7LA 1BCPB 4J1MA 2F0DA 1VDZA 1PRTD 3M7NA 2KVMA 2RSNA 4HCSA 3OW7A 1PLFA 2RVLA 3BDLA 2NVXB 2K5DA 3HOZB 3E0JA 2MGSA 3NUCA 5CV9A 3OMGA 1AZPA 3QOLA 1KLGD 1Y8PB 2PNRC 2Y0SB 2O2LD 4F88A 4KY6A 3JAME 4K8JA 5D3IB 1O80A 1Y1WB 3DUZA 4C3IB 4PNYA 3SXHA 2EYHA 1UNSA 2OT2A 1B3AA 3SE0A 4EQOA 2EVBA 2L5TA 3Q0AA 4BS9A 5C0XJ 1SYEA 2KOLA 1TWFB 4ODGA 5C3EB 3TP5A 3S1NB 5C4ZA 2KEDA 1AP0A 2X6LA 3TN2A 1HTPA 2A6EC 3K7AB 4KKTA 5D65A 1EFID 1GUTA 2A68C 4ZUJA 3A8KE 1HUNA 2KEEA 3A8IE 3DMUA 3PMFA 2EXZA 3LWUA 2O4XA 1QCBD 2TSSA 3R2IA 2DN8A 2QKIC 1I3QB 4LAAA 1F9PA 4WORA 1TVXA 4FP5D 4E6IA 3LWEA 3QO2A 3V05A 1V1OA 2WKDA 2L0CA 3A7AB 2RKSA 1ET6A 3J7AV 2L9HA 3HG9A 4FVMA 3VR2A 4S3SA 1CQVA 5K5PA 1DD2A 4O1NA 2AWOA 1Q1BA 3EQLC 2N55A 1SNMA 4XT1B 4CGYB 2F0VA 1LT6D 4ABNA 3I91A 4XT3B 3G6JB 2R3ZA 5KRUA 2PQEA 3FRPB 1HTLD 3AMUA 1A3UA 1D5XC 3W3AA 1VF7A 1RHPA 1YNJD 3TP7A 4TQUS 1TU2B 1JB3A 1NCVA 2SNSA 2CW0D 3HOWB 3BDCA 3OOCA 2IX0A 1DYQA 5CBEE 3D4RA 2ZT9C 3S17B 4HEDA 1YNND 4G4KA 3KUPA 1HA5A 5DEHA 3PUZA 3X3NA 3J80E 4KD3A 3FVQA 2NUCA 1TY2A 4RH6A 1B1ZA 2K03A 3D4DA 1D2BA 4IALA 1EU3A 4RCOA 1CZWA 1NAPA 5F2DA 3MXPA 2F0TA 5FO8B 1STGA 1U4LA 1I4QA 2I07B 5JEAJ 1OXUA 2KJXA 1ZYRD 2R7ZB 4DAPA 1WD0A 2XSCA 1BCPD 1XTCD 1EZ6A 4DXFA 3D4WA 3NE5B 2AUJD 2E2DC 3L3OC 4EVOA 4M1UB 2R6GA 2A73B 4KKUA 5HGTA 1V8QA 4PQXA 1B50A 2F3WA 3X3MA 4C3HB 1D6EC 2O5IC 1E0BA 1AW7A 5JPNC 5FO9B 1DZ1A 5CV6A 2Z4IA 4ID6A 2BCOA 2X69A 4DF7A 1M8AA 3DEPA 3NSWA 4FXGC 5HURA 2PMZB 2SOBA 4KI0A 2JEBI 2PW5A 1DXMA 3VYRA 1DOKA 3EJIA 1U4PA 3IFTA 3UI2A 2RA4A 2NVYB 2B2VC 1KNAA 1NR2A 1T5EA 4FXDA 3MZ5A 1SYBA 4KV6A 4IFDG 4M8AA 1QG7A 5EKLA 5TSSA 3P1HA 4WRDA 2D9UA 4RGOS 2NTTA 2IX1A 1G6ZA 2F0SA 1B2TA 1STYA 1PRTB 3MXGA 3ND9A 2E2HB 2BDOA 5ISRA 2EYLA 4PV1C 4BY1B 3OHXC 3D31A 3WOEA 5ELEA 2JA8B 1SDFA 4X3KA 3NWTA 3BZDB 4IQZA 1CK1A 1IW7C 3IFDA 3CKIB 1TS5A 4NDXA 1IKLA 1VMPA 3JAML 1IL8A 2ZXRA 2PW7A 2Z1CA 1R4QB 1S5DD 2IPKD 3BS1A 2NN6G 2JSOA 3AB9A 1E2VA 3FDTA 4HSPA 5M5WB 4IN3A 5EPJA 1KLUD 5M3MB 2ICEC 4WFN3 3DXJC 2B2YA 4QUFA 4A3DB 1I50B 2K7VA 1PRTF 3M4YA 2F0FA 1XXGA 2OF1A 1HRJA 2EJGC 5EPKA 4J8QA 2FINB 1QE6A 3C2PA 4KHVA 5EBCA 4C56C 3MFYA 2HCIA 1QILA 4IZ8A 1KABA 3MWYW 4I7ZC 2XVSA 2K01A 1R4PB 1RJTA 3QOJA 4EQPA 3OWEB 3S1QB 5EPLA 4A3BB 1NSNS 4H44C 1MGSA 3RMHA 2NBFA 4F8MA 4FF2A 1HFGA 1NR4A 2NVTB 3EVQA 2FJ2A 3TP6A 5E4WC 1HQRD 1PZJD 4ZKCB 2IX3A 2PZUA 2WP8J 3A56A 5KYLA 1XYIA 2O5JC 2KCNA 2YU9B 1A15A 1I4HA 3PV0A 3HRZC 4RWSC 2KCCA 3FMCA 4ZQ3A 1G2TA 2X6GA 2ENBA 3S1RB 4K5VA 4EQNA 2CHBD 4KY7A 2GA4B 1A3TA 1MI2A 1U9RA 5LL6X 2VB2X 3QJYA 4FYDA 1RCVD 1EYCA 1EY4A 3RUZA 1ZXTA 1ICWA 1I4GA 1M4VA 4DAVA 3GTLB 1LTSD 1TS3A 1EIGA 1PTOC 3NTKA 1SEBD 4UAIA 2M00A 3RD4A 2R61A 4K14A 4FF3A 2EOTA 4KY5A 1VF5C 1VCIA 1RTNA 3BYTB 5FKAC 4B08A 1ET9A 3DHQA 3J80L 4ZLTF 3I4LA 3HP3A 4IUQA 2K28A 3BG3A 3KLSX 2PPBC 5COYA 2EPBA 1ZKOA 5C0XI 4F7XA 3J81E 3NBIA 1DONA 1BR9A 3L9AX 2E75C 1LLRD 4MN3A 2KUMA 5JVG3 2PO4A 4NW2A 3SEBA 4DN4M 1STBA 4IFDH 1WTRA 5C4XB 5KNCA 3GD7A 1EEFD 4QUCA 2A6ED 1F2MA 1V1PB 2A68D 2BA0A 1TS4A 1ESFA 1LTID 1JR0D 4RHRA 2A69D 1KTKA 2HCCA 1V1PA 3SK5A 3BYYB 4ME5A 4JK1C 3H6MA 4H7BA 2F0QA 1U4MA 1A2UA 1SJED 2XN9C 4KJNA 1TWHB 2I46A 4HMJA 5DM73 2H4OA 3FPUB 3O13A 2L11A 3BVZA 4ZK9B 2B2WA 1L0YB 3D6WA 2E2IB 1Y8OB 2DNEA 2NN6H 2F03A 1STEA 2EZVA 5NUCA 4OIJA 2D2CC 2WB1B 3SK4A 5IT9L 3VYTA 3QG1A 5I4DA 2L4NA 5J1ZA 4U673 2C5CA 1CI3M 5JEAG 1EOTA 5C4HA 4U68A 2EYFA 3A55A 3D3RA 2EDGA 4CJ0B 3CU7A 1K8OA 2F0UA 3A54A 1MBYA 4OO1H 3NK9A 2XRSD 3K5OA 3U9OA 3QIAA 1R9TB 1U4RA 1O78A 5K36G 1BCPF 1PZKD 1VMCA 3CRLC 1QNUA 1MSGA 2IT1A 4KHZA 3I70A 3IL8A 3EFXD 4Q0FA 1B9NA 1PYWD 2HDMA 2M2LA 5LHY1 1AN8A 1UAPA 3H09A 3GTKB 4X3SA 1RTOA 5EBDA 3TP8A 4RGTA 2L55A 5M9OA 2WACA 2B2TC 1OO9B 1SNDA 3NTHA 4QF4A 1X3PA 4QCLA 4XQQA 3VR3A 1CHPD 1Q3LA 1HHVA 5JVH3 2D5DA 1HUMA 1RF2D 2E74C 2B2UC 1H9KA 2K33A 2JYOA 3KBXA 5IOCA 1G91A 5FOBB 5C5LA 1RODA 1SSOA 3R8BA 3Q24A 1LTRD 5T1IA 1B9MA 4TKOB 1GHKA 2XIWA 3LNNA 3M4OB 1JQYD 4JBWA 3ITPA 3C1FA 2MUYA 4CBVA 3W2DA 3SVMA 1FNVA 1SNPA 2J4XA 4XXEA 1SJHD 1J9OA 3C1EA 3P20A 1KDBA 3I90A 3OSOA 2AQ3B 1ENFA 1C4QA 1ESRA 4R8NA 1SNOA 1XX8A 5DAUA 4AYBB 1LTTD 1HPCA 3FPPA 5CORA 3TDQA 3EA6A 5DM63 4QIWB 1QWYA 3E5SA 1CZGA 1LTGD 2B39A 1MSHA 1Q12A 4HMIA 2A6HC 3VR4A 1AEXA 2KECA 2R93B 4ZAIA 5A2QE 3GTJB 1TT2A 4XTCS 2F4IA 3GTPB 2QF7A 5FK9C 3VR6A 4OHJA 2HQEA 4L63B 3MA2B 2J7ZA 4FF1A 3K0YA 1F2ZA 1XWEA 3GTGB 3NHHA 2HUGA 1UUPA 2K5QA 2M9VA 1BDOA 1RD9D 2RDHA 1SFOB 1DCZA 1DM0B 4QMGA 3I4MB 3K59A 1I4PA 3P7JA 4KK7A 5FO7B 1Q1EA 4FNFA 1E2WA 4BBRB 3F2UA 2WKCA 4IUPA 2NYZD 5CV7A 1IW7D 1OXXK 1ONLA 2FMCA 4GZYC 4PMBA 1AFPA 4HCEA 2WINB 5ELFA 2Z8LA 1GJXA 3G7LA 1FNUA 1LTAD 2NB0A 2JXMB 2YYZA 3HOUB 1T5XD 3J81L 4KMUC 3E6ZX 3A7LA 1JORA 1EY0A 4LMQD 1KNEA 4XYQA 5I6WA 2F0EA 5K36H 2DY8A 5IT9E 1WCMB 3DWAA 1JOOA 4HSVA 4YIJA 1TKWB 1IYVA 4H0LC 1OXSC 2D62A 2F3VA 3Q22A 3C3LA 1BUVT 3SHLA 1WTVA 4N9PA 3Q6SA 2DY7A 3OIPA 4C1NI 1II3A 2B8FA 4KJOA 5E1FA 2JA7B 1Y1VB 3GV3A 3AU7A 1F9RA 1EYDA 1JWMD 3N52A 4XDXA 5IGEA 3OIQA 4N9TA 1G291 2EE1A 2EY5A 3BVMA 2MPMA 3PUXA 4H13C 1I6HB 1X3QA 1SAPA 4DK0A 2J0TD 2K6AA 1Q90A 3H0GB 5CR3A 1SYCA 2BOSA 2RQXA 3I73A 1D1KA 2KHSA 3K5MA 3NPPA 4ZYSA 5ELDA 3M7GA 1GXDC 1BBXC 3KK7A 2OXPA 3T56B 5J39A 1EWHA 1BO0A 1PDQA 3KBGA 2RDGA 2WV6D 5KNBA 3WDNA 3ONAB 2BE5C 1PTOD 2VXWA 2BA1A 5D14A 1PXUA 2LFNA 3URYA 5AFWA 2VNUD 1IHZA 5EJWA 3PUYA 5E4XA 2RDFA 5C0XG 2LS01 3IAYA 1H9JA 1EIHA 4RCNA 1MD2D 1SMYC 4QB4A 2KQ3A 1SE4A 2F0JA 2NTSA 2EJFC 1EY9A 1LV9A 5JPMC 1TQOA 1SBBB 3GTMB 2RBMA 4C2MB 3QWNA 4G7ZC 4ILWA 1FR3A 2HDLA 1CTMA 3EROA 4R8IA 3L7ZC 3T4AC 2SNMA 4C3JG 2EY2A 4DU9A 2B63B 1D5MC 4V0BA 2PCFB 1TS2A 2A5HA 2F0NA 4FF4A 3HZXA 5I6YA 2V4DA 5IIFA 3NWSA 5ELBA 1ML0D 1QNKA 4B9XA 4K8IA 5I9PA 1FD7D 2C9OA 4A3KB 5CC4A 2E2JB 1D5ZC 2ID0A 3HEJA 1JOQA 3NTIA 1FYCA 3FKIB 1HFNA 5A2QL 1ENAA 1EY7A 3M3YB 3TZDA 4IUNA 1K83B 5DNFA 1A6XA 4K5XA 1WTWA 5A35A 4IFDJ 3TBIB 3BVGA 4C3IG 2Z4HA 2XWBB 5G3LD 4R9WA 2DNCA 5EKIA 1SE3A 5IGFA 3BDOA 5IODA 2CVRA 1WD1A 1QJOA 4ULLA 2PZTA 1TWCB 3I8ZA 1J8IA 4MIUA 2B2VA 1SNCA 1C48A 3MHBA 1CQFA 2IW3A 4K2KA 4A93B 4OIKA 2F0OA 2JP1A 2FHTA 3Q23A 2QILA 2EYOA 1ZEQX 5I9OA 1I4XA 3S1MB 2QCPX 1IKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0F A;  2OF1 A;  5C4H A;  1SYD A;  2M00 A;  1A2T A;  2EYF A;  2F0G A;  4KD4 A;  4DF7 A;  4K5W A;  5EGT A;  3TME A;  5C3X A;  4K14 A;  5HUR A;  1SYG A;  4KTA A;  2QDB A;  4PMB A;  2F0U A;  2SOB A;  4ZUJ A;  3LX0 A;  4KHV A;  4KY5 A;  3NK9 A;  2F0N A;  2F0H A;  2KHS A;  2PW5 A;  3HZX A;  1SNP A;  5I6Y A;  1ENC A;  3NQT A;  3U9O A;  3NP8 A;  5KIX A;  3DMU A;  4RKL A;  4TRD A;  2EYM A;  1JOK A;  3C1E A;  3EJI A;  3PMF A;  1KDB A;  3DHQ A;  3OSO A;  2LKV A;  4IZ8 A;  1KAB A;  3OMC A;  4DGZ A;  5IIF A;  2EXZ A;  4R8N A;  3VA5 A;  2O4X A;  4HTH A;  1EZ8 A;  1SNO A;  1EY0 A;  2OXP A;  5DAU A;  3S9W A;  1JOR A;  3QOJ A;  5E3F A;  4ZUI A;  4EQP A;  5DEH A;  5I6W A;  1EYA A;  2F0W A;  4I65 A;  4LAA A;  4B9X A;  4F7X A;  2F0E A;  3D8G A;  3MZ5 A;  5J39 A;  4K8I A;  5C6A A;  1SYB A;  5CV5 A;  5I9P A;  1KDA A;  4KV6 A;  2F0P A;  4KD3 A;  1EY6 A;  1NSN S;  2EY6 A;  2NUC A;  4WOR A;  5EKL A;  5CC4 A;  1JOO A;  4YIJ A;  1KAA A;  3HEJ A;  3MVV A;  3P1H A;  4J6H A;  4WRD A;  5EKK A;  1JOQ A;  4F8M A;  1STB A;  3D4D A;  3EVQ A;  2EYP A;  3TP6 A;  3OWF A;  2F3V A;  2F0S A;  1EY5 A;  4IAL A;  4E6I A;  3E5S A;  5IGG A;  5CV8 A;  2PYK A;  1F2M A;  5JOB A;  1ENA A;  1EY7 A;  4J1M A;  2PZU A;  2F0D A;  5F2D A;  4K2L A;  3SHL A;  1STY A;  4NP5 A;  4HMI A;  4DU9 A;  5KYL A;  1AEX A;  2F0T A;  3MXP A;  4N9P A;  1STG A;  3TP8 A;  4IUN A;  5KGU A;  2F0M A;  2RKS A;  5M9O A;  1TT2 A;  2WAC A;  1SND A;  2EYL A;  5ISR A;  4QF4 A;  1IHZ A;  4K5X A;  3SR1 A;  3T16 A;  3SK5 A;  3BDL A;  4S3S A;  1II3 A;  4ME5 A;  4ZQ3 A;  5K5P A;  5IGD A;  5J22 A;  3H6M A;  2ENB A;  4KJO A;  4H7B A;  2F0Q A;  5E1F A;  5IGC A;  2RDF A;  1SYF A;  1A2U A;  2HQE A;  5IGF A;  1STH A;  4K5V A;  4EQN A;  4NDX A;  5IOD A;  1KDC A;  4KJN A;  3NUC A;  3T13 A;  3V2T A;  5CV9 A;  5JAV A;  4HMJ A;  3MEH A;  3OMG A;  1SNM A;  2PW7 A;  1F2Z A;  1EY8 A;  3QOL A;  1STN A;  1EQV A;  1EZ6 A;  2F0V A;  2PZT A;  4QB4 A;  3D4W A;  2KQ3 A;  1EYD A;  3NHH A;  4KY7 A;  3ERQ A;  3NXW A;  1A3T A;  4MIU A;  2F0J A;  1SNC A;  4G57 A;  4KY6 A;  3MHB A;  4EVO A;  5KEE A;  5C3W A;  4K8J A;  5IGE A;  1EY9 A;  2PZW A;  4K2K A;  1TQO A;  4PMC A;  5HGT A;  4PNY A;  5KRU A;  5KYI A;  2F0L A;  4N9T A;  1U9R A;  5C5M A;  3SXH A;  2EYH A;  3SK8 A;  1TR5 A;  2PQE A;  2EY5 A;  2F3W A;  1F2Y A;  2F0O A;  3P75 A;  3QB3 A;  4K6D A;  3ITP A;  4EQO A;  4QMG A;  1A3U A;  5IOC A;  3D6C A;  2RBM A;  3SK6 A;  5C5L A;  2F0I A;  5NUC A;  4NMZ A;  2EYO A;  1EYC A;  1A3V A;  1SYE A;  1EY4 A;  4NKL A;  1NUC A;  3RUZ A;  5IGB A;  2OEO A;  3R3O A;  2F0K A;  4ODG A;  3SK4 A;  3TP7 A;  3TP5 A;  4DFA A;  5C4Z A;  5I9O A;  2EYJ A;  3ERO A;  5CV6 A;  1SNQ A;  5CGK A;  5CV4 A;  4OL7 A;  4ID6 A;  4RKB A;  2SNM A;  5CR3 A;  2SNS A;  1STA A;  1SYC A;  1RKN A;  2EY1 A;  5CV7 A;  5J1Z A;  3C1F A;  2EY2 A;  4B9W A;  3BDC A; 
#chains in the Genus database with same CATH topology
 4A3M H;  1A2T A;  1IBK L;  4CDC C;  4KTA A;  2JN4 A;  2QDB A;  2XRQ D;  3R93 A;  2JA9 A;  2AWN A;  3RZO H;  3NP8 A;  2B63 H;  1JOK A;  3K6O A;  1B7Y B;  4KN7 C;  4X3U A;  2LY7 A;  4G7O C;  2LKV A;  4DXG A;  1HNW Q;  3CCU A;  3VYS A;  3CCM A;  3F2B A;  2XWJ B;  1EYA A;  2SEB D;  3U50 C;  1CA6 A;  4DV4 L;  4JI8 L;  5LMN L;  3GTO H;  1UE7 A;  5IT9 c;  3J7A F;  3HOV G;  3PSI A;  1EY6 A;  4NXN Q;  3S15 B;  1IYJ B;  2FMM A;  5I2Y A;  4Y7N B;  3AFP A;  3K5N A;  1VQA A;  2IHE A;  1CSP A;  4F87 A;  1EWI A;  1E2Z A;  1EY5 A;  3CHB D;  3TRZ A;  5IGG A;  2I5M X;  5JOB A;  2Q8T A;  2V1C C;  3S2D B;  2BDN A;  4IUT A;  4K2L A;  4JBJ A;  3MTS A;  2TMP A;  3GQB A;  4ME3 A;  5KGU A;  2F0M A;  1S40 A;  3FKI H;  3S2H B;  3V96 A;  2R92 B;  2MQH A;  3SR1 A;  4XQJ A;  1QVF A;  2EJM A;  2ATW A;  1SLJ A;  4CJ2 C;  4A76 A;  1X32 A;  1EEI D;  1L1O C;  2BH8 A;  1K83 H;  1LAB A;  4ZCK A;  3HS0 C;  1H9S B;  2KA7 A;  3MEH A;  2RSO A;  1ILQ A;  3I4N B;  1IXR A;  5C0X H;  2R7F A;  4OWW B;  1LT4 D;  2WAQ B;  3N6R A;  4B3R L;  2IHF A;  4L5S A;  1UE1 A;  4G57 A;  2ZXO A;  4YHH L;  1N36 L;  5KEE A;  5C3W A;  2BH2 A;  4A3E B;  1H9S A;  4RAU C;  4JI7 L;  3SK8 A;  1H9R A;  1TR5 A;  1TWC H;  2A6H D;  5IWA Q;  3D6C A;  4JCV E;  4O42 A;  4IOA A;  4A3F B;  1B53 A;  2A69 C;  2B8G A;  1A3V A;  4Z9C B;  1DOM A;  3MXN A;  2H1E A;  4DFA A;  4HJ5 A;  1JB7 A;  3A8J E;  3PUV A;  4OL7 A;  1RL2 A;  3NQI A;  1W6J A;  2ALY B;  1RKN A;  3CCJ A;  3UDG A;  1ASZ A;  4P71 A;  2JA6 H;  1SYD A;  4YWK A;  5EGT A;  4DR5 Q;  1PRT C;  1AZQ A;  1NE3 A;  1FJG L;  4CKB A;  1WTP A;  1GKH A;  2F0H A;  3S1M H;  2PNH A;  2K5W A;  2E5L L;  1LT3 D;  1GUO A;  1B4O A;  1NMF A;  1PHJ A;  1BVS A;  2ZXP A;  2FFK B;  5BN4 A;  3T51 B;  3ULL A;  3VA5 A;  4HN7 A;  3T1H L;  1Q8I A;  3STB C;  4EGV A;  3PIO 3;  4X3T A;  1GM5 A;  2CWA A;  3HOV B;  3D8G A;  1CT1 D;  1JE5 A;  1S5B D;  4WJW A;  1KDA A;  4GN5 A;  1FNW A;  4CKC A;  5BN5 A;  4J6H A;  4TSS A;  2R7Z G;  1UE5 A;  1YHB A;  4OGQ C;  2B2Y C;  1N8R C;  2LSS A;  2PYK A;  5IYD H;  1PTO B;  1QOH A;  2NVQ B;  4HR7 B;  1TWG B;  4YWM A;  2R7D A;  3KF8 B;  3HOZ H;  1EQT A;  3A5Z B;  1CM9 A;  2ZJP A;  1OXT A;  2OTL A;  3NBH B;  3CCR A;  3UE0 A;  1VQI A;  1PH2 A;  2A74 C;  2OQK A;  2IWH A;  4ZRZ A;  3S2D H;  1UEA B;  4PMW A;  3WOF A;  1HQM C;  3KF8 A;  1PMR A;  1SXT A;  2K04 A;  3HKZ B;  4DR6 L;  2E8G A;  4C3H G;  4DR2 L;  5BR8 L;  5ELC A;  3I2Z A;  3S14 B;  3S2H H;  5C44 B;  3NBH A;  1I5F A;  3E9H A;  4FO2 A;  3V2T A;  4C3I H;  1IZ6 A;  1EY8 A;  2VY3 A;  2ZM6 Q;  1PFB A;  2IL8 A;  2K5N A;  4LJZ C;  4X64 L;  1K8A C;  1QB5 D;  4RGN A;  1EU4 A;  2QEJ C;  4JI2 L;  3M85 A;  1IBL Q;  4LK1 C;  1E24 A;  5KYI A;  5KND A;  3U9S A;  2F1M A;  4JG2 A;  5C5M A;  5FLX E;  4BA2 I;  5LMU Q;  4LF9 L;  3OYY A;  4AH6 A;  5C4J B;  4DA2 A;  3HOY B;  3SK6 A;  3KLS A;  2MP1 A;  4NMZ A;  4NKL A;  4IUU A;  3SDZ A;  5IGB A;  1S5E D;  1PTO F;  1V9P A;  4CJ1 B;  1SNQ A;  1J5E L;  5CGK A;  1F2L A;  1LO5 D;  3CRK C;  3CF5 A;  4RKB A;  1YEZ A;  1STA A;  2EY1 A;  3PO3 G;  4A3F H;  3ICE A;  4B9W A;  2JJQ A;  2ZTD A;  4DR3 L;  4K5W A;  3TME A;  1XTD A;  2ICI A;  3PIP 3;  1LT5 D;  2ASB A;  3LX0 A;  5GAG C;  3BJU A;  3RZD B;  2AUK A;  3I7F A;  1B44 D;  4DNT B;  2F3I A;  4IUR A;  3ZYY X;  4AQY Q;  4V19 0;  3OMC A;  4DGZ A;  4B3M L;  3VA7 A;  4JI5 Q;  2AQ2 B;  4LFC Q;  5M5Y B;  1QUQ B;  5E3F A;  4GNX A;  4I65 A;  1EQR A;  5C6A A;  5CV5 A;  3DWP A;  4BY1 G;  1XNQ Q;  3MVV A;  4C1N K;  5EKK A;  5JEA H;  1G8Z D;  1WTO A;  1QUQ A;  2WB1 E;  4HAE A;  2UXD L;  2L12 A;  4HJ8 A;  3HOV H;  2UUB L;  1KQS A;  5CV8 A;  2Q8I B;  4R1J A;  3F2D A;  4NP5 A;  1YI2 A;  2C35 B;  2NZH A;  2N49 A;  3VR5 A;  4DAY B;  4DV1 Q;  1JC7 A;  3C46 A;  1W3S A;  1Z47 A;  1YNJ C;  2NZ1 D;  1PTO H;  1Y8N B;  1TY0 A;  1S4Z A;  5FJ8 G;  2Q2U A;  2NVQ H;  3T16 A;  1TWG H;  3AQQ A;  2KEN A;  4FDB A;  1EOV A;  1DJR D;  4A3J B;  1PFN A;  1I6V C;  2YTX A;  2CW0 C;  2K05 A;  1SYF A;  4DAY A;  4WJ3 M;  3W5O A;  1QZG A;  4DNR B;  4RFB A;  2E76 C;  5M3M G;  3T13 A;  2K52 A;  2RCF A;  4A3I B;  1F77 A;  5M3F G;  1M1K C;  1HXY D;  5I2X A;  1C8C A;  1STN A;  1EQV A;  3CC7 A;  3VYU A;  3M4Q A;  3NXW A;  2BE5 D;  3S14 H;  5C44 H;  3I3C A;  1YNN C;  3IKJ A;  4FXK C;  4JI1 Q;  3S16 B;  3VDY A;  4DV5 Q;  2XNA C;  2CQO A;  2L1B A;  4L8J A;  4JI0 Q;  1CA5 A;  3OPO A;  1NUC A;  1WFQ A;  4DUY Q;  2K5V A;  4DV6 L;  3PO3 B;  1F9Q A;  1BNZ A;  2UXC L;  1JWU D;  4EX5 A;  3HOX G;  4JI4 L;  3CMA A;  5BN3 A;  1CHQ D;  2F52 A;  5AJ3 Q;  1VQ6 A;  3I56 A;  1K8M A;  3BZK A;  4J15 A;  3UE1 A;  1SYG A;  2B2T A;  1DGS A;  1SMY D;  4GKK Q;  1PH9 A;  1LAC A;  1O7Z A;  4RKL A;  5G3L F;  2EYM A;  5T1G A;  1ILP A;  4UP7 A;  2Q2I A;  3U4V A;  4DR7 L;  1Z7T A;  1SE2 A;  1ZYR C;  4RA8 A;  4G7H C;  4RHS A;  3GDE A;  2B2W C;  1HNX L;  2YTY A;  3OW2 A;  3RZD H;  1GUW A;  2K75 A;  5LL6 S;  2UXB L;  3PF5 A;  2F0W A;  2HIV A;  3RLF A;  1BCP C;  3J7Z C;  4A3G G;  1PYS B;  2EY6 A;  4CHT B;  2VUM G;  2B2U A;  3GTQ B;  5IYC G;  3FEW X;  5CMD A;  3CQZ B;  1Z6H A;  1D1I A;  4DPG A;  1Q86 C;  1VQO A;  3PO2 G;  2EQS A;  1KRS A;  3TSS A;  3GO5 A;  3ULP A;  1F9S A;  1HA6 A;  1I4R A;  2VB3 X;  2K1B A;  1O7Y A;  4LF4 Q;  1GOZ A;  1WTX A;  4JI3 Q;  3UDF A;  3H3V C;  4IPG A;  1CFM A;  4DR4 L;  5M3F B;  1HNZ Q;  3M9B A;  4L5T A;  3G48 A;  5D3D A;  5JAV A;  1WTQ A;  1GO3 E;  2JA5 G;  4AYB E;  1BQQ T;  2HT1 A;  4KKS A;  4C3H H;  1LTB D;  2CQA A;  4OO1 G;  1S5F D;  3H94 A;  4N8F A;  2VQF L;  1OXV A;  4A3I H;  4PMC A;  5M5X B;  1G2S A;  5H1S E;  3P75 A;  1F2Y A;  1SMX A;  3DWQ A;  4OXP A;  4QIW E;  4QY7 A;  2XGT A;  4XIG S;  1PH4 A;  1HZC A;  3CP0 A;  3HGB A;  5DLQ E;  1GUG A;  4IFD I;  2OEO A;  2F0K A;  2IJ0 A;  2EYJ A;  3HOX B;  5CV4 A;  1JWS D;  2RHQ B;  4YCV A;  1W6K A;  4DV7 Q;  2AQ1 B;  1EQQ A;  2KCT A;  4BY7 G;  1TII D;  2VQE Q;  3PO3 H;  1VQP A;  3R2T A;  3ND8 A;  4Q5V A;  2LMC B;  2HQL A;  3MXU A;  3NQT A;  1BXT A;  1GHJ A;  4TRD A;  3K5L A;  3J7Y W;  5C4X G;  3GV6 A;  1EIF A;  4A3M B;  1IBM L;  4DV3 L;  3S9W A;  1EZ8 A;  2JE6 I;  2WII B;  1S72 A;  4EQ5 A;  4A3G B;  2NWG A;  2UUC L;  1U5K A;  3RZO B;  2VUM B;  4XYO A;  3DM1 A;  3MC0 B;  2SDF A;  3DEO A;  4OON A;  3PUW A;  1KAA A;  5HGQ A;  4KN4 C;  1EYG A;  3L0O A;  2NN6 I;  4YY3 L;  1H9M A;  3OWF A;  1L0X B;  4NPS A;  1VQC A;  1DOL A;  1EWC A;  2OTJ A;  3PO2 B;  3GTO B;  1SE8 A;  4GKJ Q;  4K6L A;  3GTQ H;  4RGM A;  3T53 B;  4IUV A;  4ZKB B;  3GP7 A;  4A4I A;  2G9D A;  2OWO A;  2GVB A;  2I5H A;  4OWX B;  5IGD A;  5J22 A;  2MJ8 A;  5IGC A;  3KLW A;  1NTG A;  5FJ8 H;  3H91 A;  4OO1 I;  1C0A A;  2JA5 B;  3NEM A;  1STH A;  2A1A A;  5CYU A;  1KDC A;  2JEA I;  3MAQ A;  1BOS A;  3KLR A;  3TZU A;  3E9I A;  4MHE A;  5M5W H;  3ULJ A;  2WB1 G;  5FLX L;  1E3P A;  1YHA A;  3ERQ A;  3BU2 A;  4CKE A;  5M3F H;  5JJZ A;  2MHV A;  2N88 A;  1SRU A;  1V43 A;  2PZW A;  1PFM A;  2A19 A;  1UE6 A;  1I50 H;  1NY4 A;  2F0L A;  3QB3 A;  4K6D A;  1Y1W G;  1WVL A;  5LMN W;  4LFB Q;  3I72 A;  2F0I A;  4BBS B;  4POF A;  4LUZ A;  4UY8 C;  3MFG A;  3R3O A;  5M5X H;  4BA1 I;  4DK1 A;  1BF4 A;  5CBA E;  5C3E G;  1PZI D;  1JIC A;  1HCZ A;  5FLM G;  4UPA A;  1YIT A;  3NEL A;  4BY7 B;  2F0G A;  4KD4 A;  1HNW L;  5C3X A;  3HOX H;  3K57 A;  4L5R C;  1ENC A;  1RDP D;  1PH1 A;  4MTN A;  4P2C B;  4XQN A;  2JA6 B;  4NXN L;  4HJ9 A;  1IYU A;  3K0X A;  1GUN A;  1FGB D;  1JCK B;  4HTH A;  5EQ0 A;  2K32 A;  1EL0 A;  4C3J B;  1V1Q A;  4YWL A;  4ZUI A;  2PI2 E;  4L6T B;  1VQB A;  2RHS B;  3K58 A;  2Z0S A;  1GUS A;  1S5C D;  2Q8R E;  4X6A H;  2F0P A;  3JC6 6;  5KIX A;  1Y69 U;  4OEL B;  4PZ8 A;  2N78 A;  4BWG B;  1JE4 A;  4A3G H;  2EYP A;  2EIF A;  1TWA B;  2G9H D;  4UDU C;  1YIJ A;  2VUM H;  1KL9 A;  1L0W A;  1O7L A;  1BCP B;  4J1M A;  5IYC H;  4IPC A;  2F0D A;  1VDZ A;  1PRT D;  3M7N A;  4LF5 Q;  2KVM A;  1FGU A;  2RSN A;  3PQI A;  4HCS A;  3OW7 A;  3PO2 H;  1PLF A;  4JBK A;  2RVL A;  2DGY A;  3BDL A;  2NVX B;  2K5D A;  5ELN A;  3HOZ B;  4JVZ A;  3STB D;  3E0J A;  1G51 A;  4DK3 C;  2MGS A;  3NUC A;  5CV9 A;  3OMG A;  1AZP A;  3H3V I;  3QOL A;  1KLG D;  1Y8P B;  1JMC A;  4O0A A;  1SRO A;  5IWA L;  1G6P A;  2PNR C;  2Y0S B;  2O2L D;  4F88 A;  4GLX A;  4KY6 A;  2JA5 H;  3JAM E;  4K8J A;  5D3I B;  1O80 A;  1Y1W B;  3E3X A;  3DUZ A;  4C3I B;  4PNY A;  4LF6 Q;  3SXH A;  2EYH A;  1UNS A;  4TVA B;  2OT2 A;  1B3A A;  2GN5 A;  3SE0 A;  4EQO A;  1MKH A;  4KHP L;  2EVB A;  4GOP C;  2L5T A;  3Q0A A;  4BS9 A;  5C0X J;  4IO9 A;  4DR5 L;  1SYE A;  2KOL A;  4LF8 Q;  5IE8 A;  1TWF B;  4ODG A;  5C3E B;  3TP5 A;  3S1N B;  5C4Z A;  2KED A;  1AP0 A;  2X6L A;  3TN2 A;  1HTP A;  2A6E C;  3K7A B;  5ELO A;  4BBS H;  4KKT A;  3PCO B;  5D65 A;  4A3L G;  1EFI D;  1GUT A;  2A68 C;  3MXN B;  3HOW G;  4UHV A;  1VQK A;  4ZUJ A;  1HJP A;  3A8K E;  1HUN A;  2KEE A;  3A8I E;  3DMU A;  1BBW A;  2D0O A;  2ZTC A;  4BY7 H;  3PMF A;  1VS0 A;  1VQF A;  2EXZ A;  3LWU A;  2O4X A;  2B3G A;  1QCB D;  2TSS A;  3R2I A;  2DN8 A;  5C4X H;  2Z6K C;  2QKI C;  1I3Q B;  1SN8 A;  4LAA A;  4JW0 A;  2R93 G;  1F9P A;  4WOR A;  3CPW A;  3TRE A;  3RLN A;  4C3J H;  2K50 A;  1TVX A;  4GS3 A;  4FP5 D;  4E6I A;  3LWE A;  3QO2 A;  3V05 A;  1V1O A;  3J7A 5;  2WKD A;  1RIP A;  1X55 A;  4DKA C;  3G4S A;  2L0C A;  2XTI A;  2CKZ B;  3A7A B;  2KHI A;  2D0P A;  1TWA H;  2RKS A;  1ET6 A;  3J7A V;  1TWH H;  2L9H A;  3HG9 A;  4FVM A;  3VR2 A;  1TXY A;  2ZM6 L;  4S3S A;  1CQV A;  5K5P A;  1DD2 A;  4O1N A;  2AWO A;  2VZA A;  1Q1B A;  4YHH Q;  3EQL C;  3I4M G;  2N55 A;  2E2I H;  1IBL L;  3JAM i;  3S24 A;  4HIO A;  1SNM A;  4XT1 B;  4CGY B;  5LMU L;  2NVX H;  2QW7 A;  2F0V A;  4BBR G;  1Q7Y C;  1LT6 D;  4ABN A;  3I91 A;  3CD6 A;  4H02 A;  4XT3 B;  3G6J B;  3CC2 A;  3J81 j;  2R3Z A;  3KOJ A;  5KRU A;  3UDX A;  2PQE A;  3FRP B;  1HTL D;  3AEV A;  3AMU A;  1VQ8 A;  2VW9 A;  1A3U A;  1D5X C;  3W3A A;  1VF7 A;  1RHP A;  1YNJ D;  1Y1W H;  3HOU G;  3TP7 A;  3CW2 C;  4TQU S;  1TU2 B;  1XPU A;  1XNR Q;  1JB3 A;  4YCU A;  1NCV A;  2SNS A;  4N8X 1;  1N34 Q;  2CW0 D;  1R9T H;  3HOW B;  3BDC A;  3OOC A;  4AQY L;  2IX0 A;  3ERS X;  1TWF H;  1DYQ A;  5C3E H;  3S1N H;  4JI5 L;  5CBE E;  3D4R A;  5FLM H;  2ZT9 C;  1WOC A;  3S17 B;  4HED A;  4R4O A;  3K7A H;  1XNQ L;  1YNN D;  4G4K A;  4DR1 Q;  1CKO A;  3KUP A;  1HA5 A;  3IRB A;  4LNQ A;  5DEH A;  1Q81 C;  1Q82 C;  3PUZ A;  3X3N A;  4GLV B;  3J80 E;  4R4I A;  4UP9 A;  4KD3 A;  3FVQ A;  2NUC A;  3SGI A;  1TY2 A;  4RH6 A;  1B1Z A;  2K03 A;  1A62 A;  4GNX B;  1I3Q H;  3D4D A;  4X65 L;  3TEH B;  1D2B A;  4IAL A;  1KHI A;  1EU3 A;  4RCO A;  1VQN A;  1CZW A;  1NAP A;  5F2D A;  4QL5 A;  3MXP A;  2F0T A;  4HJA A;  5FO8 B;  1STG A;  1U4L A;  1I4Q A;  1XMQ Q;  1YJW A;  4JOI A;  4JYA Q;  2I07 B;  5JEA J;  1OXU A;  1PFS A;  2KJX A;  1ZYR D;  2R7Z B;  4DAP A;  3L2P A;  1WD0 A;  2JA8 G;  2XSC A;  4A3C G;  4JI1 L;  1BCP D;  1XTC D;  4DV5 L;  1N33 Q;  1EZ6 A;  4DXF A;  4DV2 Q;  3D4W A;  4JI0 L;  4LF9 Q;  3NE5 B;  2AUJ D;  4JI6 Q;  2E2D C;  3L3O C;  4EVO A;  4M1U B;  2R6G A;  4DUY L;  2A73 B;  4KKU A;  5HGT A;  1V8Q A;  2HD3 A;  3M4O H;  4PQX A;  1B50 A;  2F3W A;  3X3M A;  4C3H B;  1D6E C;  1HZA A;  1E0B A;  1AW7 A;  5AJ3 L;  2O5I C;  1X3F A;  5JPN C;  5FO9 B;  3W1B A;  1XPO A;  1DZ1 A;  4GKK L;  5CV6 A;  2Z4I A;  2CH4 W;  4ID6 A;  2BCO A;  4A3D G;  2X69 A;  1L1O B;  4GN3 B;  4DF7 A;  1M8A A;  3DEP A;  4POG A;  3NSW A;  4X66 Q;  4FXG C;  5HUR A;  2PMZ B;  3OTO Q;  2SOB A;  4KI0 A;  2JEB I;  3RR5 A;  2PW5 A;  1DXM A;  3VYR A;  1VQ9 A;  1WYD A;  3HOW H;  5EAY A;  1DOK A;  3EJI A;  1U4P A;  3IFT A;  3UI2 A;  1L1O A;  2RA4 A;  1YBY A;  3J80 i;  2NVY B;  4JPB W;  4AIM A;  5GAH C;  2A8V A;  2WAQ E;  2B2V C;  4UP8 A;  1KNA A;  1NR2 A;  1T5E A;  1XJV A;  3S17 H;  4JC0 A;  4FXD A;  3MZ5 A;  1ICF B;  2AKW B;  1SYB A;  1EUJ A;  1VQ5 A;  4KV6 A;  4IFD G;  4M8A A;  1QG7 A;  5EKL A;  5TSS A;  3P1H A;  4WRD A;  4DUZ Q;  3BZC A;  2D9U A;  4A3B G;  4RGO S;  3DLL A;  2NTT A;  2R93 H;  2IX1 A;  3TS0 A;  1G6Z A;  2F0S A;  2Q2H A;  2PQA B;  1AE3 A;  3KF6 B;  5GAD C;  1WI5 A;  2UU9 Q;  1B2T A;  4MNO A;  1STY A;  1PRT B;  4JI3 L;  1MJC A;  1M90 C;  3MXG A;  3ND9 A;  1KD1 C;  1HNZ L;  2E2H B;  2BDO A;  5ISR A;  2EYL A;  4PV1 C;  4BY1 B;  2PQA A;  3D31 A;  3KF6 A;  3OHX C;  3WOE A;  5ELE A;  4R4T A;  2JA8 B;  3GTG H;  1SDF A;  4X3K A;  3TQY A;  3NWT A;  3KJP A;  3BZD B;  4IQZ A;  1CK1 A;  1IW7 C;  3IFD A;  3CKI B;  1TS5 A;  1UWV A;  4NDX A;  1IKL A;  1VMP A;  1SFO H;  3JAM L;  1IL8 A;  2ZXR A;  2PW7 A;  2Z1C A;  1R4Q B;  4A75 A;  1S5D D;  2R7Z H;  2IPK D;  1KAW A;  3I4M H;  3BS1 A;  2NN6 G;  3FHW A;  3JAM c;  4PG3 A;  1Q46 A;  2JSO A;  3AB9 A;  1E2V A;  5HY6 A;  4NXM Q;  3D0F A;  1PH6 A;  3FDT A;  4HSP A;  5M5W B;  4IN3 A;  5EPJ A;  1KLU D;  5IYB G;  4O2D A;  5M3M B;  2MO1 A;  4DV7 L;  1CKN B;  2ICE C;  4WFN 3;  3Q8D A;  4DAM A;  3DXJ C;  4DNI A;  2B2Y A;  2VQE L;  3PIO A;  4QUF A;  4A3D B;  1I50 B;  2K7V A;  1PRT F;  1VQG A;  3M4Y A;  1H95 A;  3HOU H;  2F0F A;  1XXG A;  2OF1 A;  1CKN A;  1HRJ A;  2EJG C;  5EPK A;  2QA4 A;  4J8Q A;  4LFA Q;  2FIN B;  1QE6 A;  2LXK A;  3HKZ E;  3RLO A;  3C2P A;  1HZ9 A;  4KHV A;  2Z9H A;  5EBC A;  4A3K G;  4C56 C;  1I94 Q;  1XPR A;  1KRT A;  3MFY A;  5JJK A;  2P5Z X;  2HCI A;  4IJL A;  2YV5 A;  1QIL A;  4IZ8 A;  1KAB A;  3MWY W;  4I7Z C;  1E1O A;  2EXD A;  2XVS A;  3HKS A;  2CWP A;  2K01 A;  1R4P B;  1RJT A;  3QOJ A;  4EQP A;  3OWE B;  3S1Q B;  4QQB X;  2L15 A;  2NVY H;  5EPL A;  2HHH Q;  3I4O A;  4GKJ L;  4A3B B;  1NSN S;  4H44 C;  1MGS A;  3NEN A;  3RMH A;  4DV0 L;  2NBF A;  4F8M A;  4FF2 A;  1HFG A;  1NR4 A;  2F4V Q;  2NVT B;  2JQO A;  3EVQ A;  2FJ2 A;  1PV4 A;  3TP6 A;  5E4W C;  1HQR D;  1PZJ D;  4ZKC B;  2IX3 A;  2PZU A;  1BKB A;  2WP8 J;  3A56 A;  4B3T Q;  5KYL A;  1XYI A;  2O5J C;  2KCN A;  2Z6B A;  2YU9 B;  1A15 A;  1I4H A;  3PV0 A;  2JK8 A;  3HRZ C;  1IL2 A;  4RWS C;  4A93 G;  2KCC A;  3FMC A;  4ZQ3 A;  1FL0 A;  4IJH A;  2X6G A;  1G2T A;  2ENB A;  3S1R B;  4OX9 Q;  2E2H H;  4K5V A;  4EQN A;  4BY1 H;  4P72 A;  4KLK A;  5JJL A;  2JA8 H;  4CDE C;  5J3B A;  2CHB D;  3K7U C;  4KY7 A;  4A3C H;  2GA4 B;  4LFB L;  4K0K Q;  1I6H H;  1A3T A;  3PIP A;  1L2F A;  2K4K A;  1YJ9 A;  1MI2 A;  1U9R A;  2LXJ A;  1VQL A;  5LL6 X;  1LYL A;  2VB2 X;  3QJY A;  5GAE C;  4FYD A;  4LF7 Q;  1RCV D;  1EYC A;  5E7N A;  1EY4 A;  3RUZ A;  3M4P A;  2N8N A;  1ZXT A;  1ICW A;  1I4G A;  1M4V A;  2MO0 A;  4DAV A;  3GTL B;  1LTS D;  2RCN A;  1TS3 A;  5M3M H;  1EIG A;  1XMO L;  1PTO C;  3NTK A;  1SEB D;  4UAI A;  2M00 A;  1AH9 A;  3RD4 A;  2R61 A;  4K14 A;  4A3D H;  5FLX c;  4FF3 A;  2EOT A;  4KY5 A;  2ES2 A;  1VF5 C;  1K28 A;  1VCI A;  1RTN A;  3T1Y Q;  3BYT B;  5FKA C;  1HR0 Q;  1D7Q A;  1B3Q A;  2UUC Q;  4B08 A;  3EN2 A;  1ET9 A;  1GD7 A;  3DHQ A;  3UDI A;  3J80 L;  1PVO A;  4ZLT F;  3I4L A;  3W1G A;  3HP3 A;  4IUQ A;  2K28 A;  3BG3 A;  3KLS X;  2PPB C;  5COY A;  1EIY B;  2WFW A;  4X62 Q;  2EPB A;  1ZKO A;  5C0X I;  4F7X A;  3J80 c;  3NBI A;  3J81 E;  1DON A;  1BR9 A;  3L9A X;  2E75 C;  1LLR D;  2R92 G;  4MN3 A;  2KUM A;  3MEF A;  5JVG 3;  2PO4 A;  4LF5 L;  1Z9F A;  4NW2 A;  3SEB A;  1WJJ A;  4DN4 M;  1STB A;  3S1Q H;  4IFD H;  1WTR A;  5C4X B;  1N32 Q;  5KNC A;  4L5Q A;  1AE2 A;  3GD7 A;  1EEF D;  4PZ6 A;  2A6E D;  1F2M A;  1V1P B;  4QUC A;  4A3B H;  2A68 D;  2BA0 A;  4LUO A;  4P73 A;  4I7A A;  3I4N G;  2NVT H;  1TS4 A;  1ESF A;  1LTI D;  1JR0 D;  2WAQ G;  4RHR A;  2UUA Q;  2A69 D;  1KTK A;  4BXX G;  2HCC A;  1V1P A;  4LUV A;  3SK5 A;  3BYY B;  4ME5 A;  4JK1 C;  4A3E G;  3H6M A;  4H7B A;  2F0Q A;  1U4M A;  1A2U A;  2YU9 H;  1SJE D;  1E22 A;  2XN9 C;  4KJN A;  1TWH B;  4A3F G;  2I46 A;  4HMJ A;  5DM7 3;  3KDF B;  2H4O A;  3FPU B;  3O13 A;  1PH3 A;  2L11 A;  1QVG A;  4C2M H;  3BVZ A;  4ZK9 B;  3S1R H;  2B2W A;  3HFZ B;  1B70 B;  1K0R A;  1L0Y B;  3CPF A;  1B8A A;  4LF8 L;  3D6W A;  1CKM A;  2E2I B;  1Y8O B;  2DNE A;  2NN6 H;  2F03 A;  2IY5 B;  3KDF A;  1STE A;  2EZV A;  1YVC A;  5NUC A;  4OIJ A;  1K3R A;  1K8G A;  1N9W A;  3CCE A;  2D2C C;  1K3B C;  1Q8K A;  2WB1 B;  3SK4 A;  5IYB H;  4B3S Q;  5IT9 L;  3VYT A;  3QG1 A;  5I4D A;  2L4N A;  1OTC A;  1JT8 A;  5J1Z A;  4U67 3;  2C5C A;  1CI3 M;  5JEA G;  1EOT A;  5C4H A;  4U68 A;  2EYF A;  3A55 A;  3D3R A;  4JV5 Q;  2EDG A;  4CJ0 B;  3CU7 A;  1K8O A;  3GTL H;  2F0U A;  3A54 A;  3I55 A;  1MBY A;  4OO1 H;  3NK9 A;  3CCS A;  1JJC B;  2XRS D;  3K5O A;  3U9O A;  3QIA A;  1R9T B;  3J81 i;  3PF4 A;  2DJF C;  4A3K H;  1IBK Q;  2E2J H;  1HH2 P;  1O78 A;  1U4R A;  5K36 G;  1BCP F;  1PZK D;  1VMC A;  3CRL C;  1QNU A;  1MSG A;  1X56 A;  2IT1 A;  4AYB G;  4KHZ A;  3I70 A;  3IL8 A;  3M3Y H;  3EFX D;  3FP9 A;  4Q0F A;  1B9N A;  3K81 C;  1PYW D;  2Q2T A;  2HIX A;  2HDM A;  2M2L A;  3HKZ G;  5LHY 1;  2H5X A;  4DV4 Q;  4JI8 Q;  5LMN Q;  1AN8 A;  1UAP A;  3H09 A;  5C44 G;  1LTL A;  3GTK B;  4X3S A;  1RTO A;  5EBD A;  1P16 A;  3TP8 A;  4RGT A;  2L55 A;  4MTK A;  5M9O A;  2WAC A;  2B2T C;  1OO9 B;  1SND A;  3NTH A;  4QF4 A;  3CME A;  1K73 C;  1K9M C;  1X3P A;  1VQH A;  3H15 A;  4QCL A;  4XQQ A;  3VR3 A;  1CHP D;  1Q3L A;  2B29 A;  1HHV A;  4A93 H;  5JVH 3;  3HOY G;  1CUK A;  2K14 A;  2D5D A;  3A0J A;  1K0S A;  1HUM A;  1RF2 D;  4KHP Q;  2E74 C;  4QGU A;  1YZ6 A;  2B2U C;  1H9K A;  2K33 A;  2KCM A;  1EFW A;  1C9O A;  2JYO A;  3KBX A;  1XNR L;  1MIU A;  2KHJ A;  1N34 L;  5IOC A;  1E7Z A;  1G91 A;  4IPD A;  5FOB B;  5C5L A;  1ROD A;  4B3R Q;  1SSO A;  3R8B A;  1LM0 A;  3Q24 A;  1N36 Q;  1LTR D;  5T1I A;  1B9M A;  4TKO B;  1GHK A;  2AHO B;  1YHQ A;  2XIW A;  3F2C A;  3LNN A;  3M4O B;  4JI7 Q;  3CCQ A;  1NJI C;  1JQY D;  4HJ7 A;  4JBW A;  3ITP A;  3C1F A;  2RF4 A;  2MUY A;  1JJ2 A;  4GN4 B;  3TS2 A;  4CBV A;  4DR1 L;  3W2D A;  3G71 A;  3SVM A;  1X3G A;  2MFI A;  1FNV A;  1SNP A;  2J4X A;  3B6Y A;  4XXE A;  1ASY A;  1QVC A;  1SJH D;  3H3V H;  1J9O A;  3C1E A;  3P20 A;  1KDB A;  3I90 A;  3OSO A;  2AQ3 B;  1ENF A;  1C4Q A;  3S15 H;  1ESR A;  4R8N A;  1JJG A;  1FJG Q;  1SNO A;  1XX8 A;  4Y7N H;  5DAU A;  4AYB B;  1LTT D;  4CDF C;  2E5L Q;  1HPC A;  3FPP A;  5COR A;  2VS1 A;  3TDQ A;  4LFC L;  3EA6 A;  4HIK A;  3T1H Q;  1WCM G;  1XMQ L;  4A3J G;  5DM6 3;  4QIW B;  1QWY A;  2R92 H;  2ZTE A;  3E5S A;  4JYA L;  1CZG A;  3KFU A;  1LTG D;  2B39 A;  1GVP A;  1MSH A;  1Q12 A;  4HMI A;  4A3I G;  3EIV A;  2AMC B;  2A6H C;  1AEX A;  3VR4 A;  2KEC A;  2R93 B;  4ZAI A;  5A2Q E;  3GTJ B;  1TT2 A;  4XTC S;  2F4I A;  3I4N H;  3GTP B;  2QF7 A;  1N33 L;  3GTK H;  5FK9 C;  4DV2 L;  4JI6 L;  3VR6 A;  4DV1 L;  4OHJ A;  2HQE A;  1S3O A;  4BXX H;  4L63 B;  3MA2 B;  4A3E H;  2J7Z A;  4CDD C;  4FF1 A;  1T9H A;  1F2Z A;  3K0Y A;  1XWE A;  1Y1V G;  2JA7 G;  3GTG B;  1PH7 A;  3NHH A;  2HUG A;  4DR6 Q;  4DR2 Q;  4PZ7 A;  2GVA A;  1UUP A;  5GQO A;  5BR8 Q;  2K5Q A;  2M9V A;  1BDO A;  1RD9 D;  2RDH A;  1SFO B;  1U0L A;  1DCZ A;  4GLA C;  1C7Y A;  1DM0 B;  4QMG A;  5IP9 G;  3I4M B;  1J6Q A;  3K59 A;  1I4P A;  3P7J A;  4KK7 A;  4APV A;  1YJN A;  4X64 Q;  2CFM A;  1VQM A;  1PA6 A;  4MZ9 A;  5FO7 B;  1Y14 B;  1Q1E A;  4X66 L;  4JI2 Q;  4FNF A;  1E2W A;  4BBR B;  3OTO L;  3F2U A;  2WKC A;  4IUP A;  2NYZ D;  5CV7 A;  1IW7 D;  2I5L X;  2OCE A;  3H0G G;  1OXX K;  1ONL A;  2FMC A;  2N3S A;  4GZY C;  5GRO A;  4PMB A;  1AFP A;  4HCE A;  2WIN B;  1J5E Q;  5ELF A;  2Z8L A;  1GJX A;  3G7L A;  1FNU A;  1LTA D;  2NB0 A;  2JXM B;  2YYZ A;  3HOU B;  4DR3 Q;  1T5X D;  2K5H A;  3J81 L;  4KMU C;  3E6Z X;  2Y0S E;  1WTH A;  4DUZ L;  3A7L A;  1JOR A;  1EY0 A;  1QZH A;  4LMQ D;  3J81 c;  1D8L A;  1KNE A;  4XYQ A;  5I6W A;  3RNU A;  5JJI A;  4X65 Q;  2F0E A;  5K36 H;  4GOP B;  2DY8 A;  3CCV A;  2UU9 L;  5IT9 E;  1WCM B;  5L37 A;  3DWA A;  1JOO A;  4HSV A;  4YIJ A;  4B3M Q;  4NB3 A;  1KXL A;  1TKW B;  4A3L H;  4H0L C;  1OXS C;  2D62 A;  2F3V A;  1IYV A;  3Q22 A;  3KJO A;  4GOP A;  3C3L A;  1BUV T;  3SHL A;  2CCZ A;  4LW1 A;  1WTV A;  4N9P A;  3Q6S A;  1X3E A;  2DY7 A;  2UXD Q;  2UUB Q;  3OIP A;  2DUD A;  4C1N I;  3LGJ A;  1II3 A;  2B8F A;  4KJO A;  5E1F A;  4OWT B;  5IY0 A;  1UEB A;  3GTJ H;  2JA7 B;  1Y1V B;  3GV3 A;  4NXM L;  3GTP H;  4LF4 L;  3AU7 A;  1F9R A;  1E1T A;  4P75 A;  1EYD A;  5C4J H;  1JWM D;  3N52 A;  1W2B A;  3HOY H;  4OEM B;  4XDX A;  5IGE A;  3OIQ A;  4RMF A;  1KC8 C;  3KYH C;  2Z6K A;  4IOC A;  4N9T A;  1G29 1;  2EE1 A;  2ZJQ A;  2EY5 A;  4P74 A;  3BVM A;  1X54 A;  2MPM A;  3PUX A;  4H13 C;  3AYH B;  1I6H B;  1X3Q A;  1SAP A;  5IP7 G;  1NBW A;  4R4Q A;  4LFA L;  4DK0 A;  1CSQ A;  3AFQ A;  2J0T D;  2PI2 A;  2K6A A;  4A3M G;  1Q90 A;  1X9N A;  1I94 L;  3H0G B;  5CR3 A;  1SYC A;  2BOS A;  2RQX A;  4BBR H;  2B63 G;  5M5Y H;  3I73 A;  1D1K A;  4DV6 Q;  2KHS A;  3K5M A;  2I0Q A;  2UXC Q;  1MJE A;  4JI4 Q;  3NPP A;  1NNX A;  4ZYS A;  3A74 A;  2HHH L;  5ELD A;  3M7G A;  1GXD C;  1BBX C;  3KK7 A;  2OXP A;  2QGQ A;  3T56 B;  3RN2 A;  2F4V L;  3WWV A;  4Y52 H;  5J39 A;  1EWH A;  1BO0 A;  1PDQ A;  4DK6 C;  1HR0 W;  4DR7 Q;  4B3T L;  1PH5 A;  3KBG A;  1HNX Q;  2RDG A;  2WV6 D;  5KNB A;  1SR3 A;  3ONA B;  3WDN A;  2UXB Q;  2BE5 C;  3EBE A;  1PTO D;  1BBU A;  2VXW A;  1WCM H;  2CH4 A;  3FKI G;  4A3J H;  2BA1 A;  1FVI A;  5D14 A;  2DJG C;  4OX9 L;  1PXU A;  2YTV A;  1LUZ A;  2LFN A;  3URY A;  5AFW A;  2VNU D;  1IHZ A;  3ER0 A;  3K80 C;  4JBM A;  5EJW A;  4K0K L;  3PUY A;  5E4X A;  2RDF A;  1X6O A;  5C0X G;  2LS0 1;  3IAY A;  1VQJ A;  1PYB A;  1H9J A;  3S16 H;  1EIH A;  3E0E A;  4RCN A;  1VQD A;  4BBS G;  1MD2 D;  1NMG A;  1SMY C;  4QB4 A;  1VQ7 A;  2KQ3 A;  1SE4 A;  2F0J A;  4DR4 Q;  2NTS A;  1VQE A;  2EJF C;  4LF7 L;  3F1Z A;  1Y1V H;  2JA7 H;  1EY9 A;  3RN5 A;  1LV9 A;  1A8V A;  4LWC A;  5JPM C;  1TQO A;  4WJ4 A;  2KBN A;  1SBB B;  3DM3 A;  1O7I A;  2ZJR A;  3GTM B;  4IPH A;  1PH8 A;  2RBM A;  4C2M B;  3QWN A;  4G7Z C;  3K8A A;  4ILW A;  1FR3 A;  1X65 A;  1YNX A;  2VQF Q;  2HDL A;  1CTM A;  5IP9 H;  2JA6 G;  3ERO A;  4R8I A;  3L7Z C;  3T4A C;  3T1Y L;  2SNM A;  1HR0 L;  4C3J G;  2EY2 A;  4DU9 A;  2B63 B;  1A63 A;  1D5M C;  3U4Z A;  4V0B A;  2PCF B;  1TS2 A;  2A5H A;  2F0N A;  4FF4 A;  3H0G H;  3HZX A;  5I6Y A;  4X62 L;  4RG1 A;  2FXQ A;  3ZJY C;  2V4D A;  4DV0 Q;  5IIF A;  3F8T A;  3NWS A;  5ELB A;  1ML0 D;  3CAM A;  1QNK A;  4R4C A;  3CQZ H;  4QJF A;  1N32 L;  4B9X A;  2G5D A;  4K8I A;  5I9P A;  1FD7 D;  2C9O A;  4A3K B;  5CC4 A;  2E2J B;  2VL6 A;  3CC4 A;  1IBM Q;  1D5Z C;  2ID0 A;  5IYD G;  3HEJ A;  4DV3 Q;  1JOQ A;  3G6E A;  4HID A;  3NTI A;  3PGZ A;  2UUA L;  3HOZ G;  1FYC A;  3FKI B;  1HFN A;  5A2Q L;  1ENA A;  1EY7 A;  3M3Y B;  2MNA A;  3TZD A;  4IUN A;  1K83 B;  5DNF A;  2PMZ E;  4YY3 Q;  1A6X A;  2Y0S G;  4K5X A;  4HIM A;  1WTW A;  5A35 A;  2QEX A;  4IFD J;  3TBI B;  3BVG A;  1A0I A;  4C3I G;  2Z4H A;  2XWB B;  5G3L D;  4R9W A;  2DNC A;  5EKI A;  1SE3 A;  5IGF A;  4ALP A;  3BDO A;  3QR8 A;  5IOD A;  2CVR A;  1WD1 A;  1QJO A;  3U58 A;  4ULL A;  1P8L A;  1KIX A;  2PZT A;  1TWC B;  3I8Z A;  1J8I A;  4MIU A;  2B2V A;  1SNC A;  1C48 A;  2OQ0 A;  2QDL A;  3MHB A;  1HZB A;  2NZO A;  1CQF A;  2IW3 A;  4K2K A;  4A93 B;  4B3S L;  4OIK A;  2F0O A;  1VQ4 A;  2JP1 A;  2FHT A;  3CXC A;  3Q23 A;  1XMO Q;  2QIL A;  2EYO A;  4JV5 L;  1MHW C;  1ZEQ X;  4LF6 L;  4YCW A;  5I9O A;  3A5U A;  1I4X A;  4GNX C;  3CCL A;  4JOI C;  5IP7 H;  3GTM H;  3S1M B;  2QCP X;  1IKM A; 
#chains in the Genus database with same CATH homology
 1A2T A;  4KTA A;  2QDB A;  2XRQ D;  3R93 A;  2AWN A;  3NP8 A;  1JOK A;  3K6O A;  4KN7 C;  4X3U A;  2LY7 A;  4G7O C;  2LKV A;  4DXG A;  3VYS A;  2XWJ B;  1EYA A;  2SEB D;  1CA6 A;  3J7A F;  1EY6 A;  3S15 B;  2FMM A;  5I2Y A;  4Y7N B;  3K5N A;  4F87 A;  1E2Z A;  1EY5 A;  3CHB D;  5IGG A;  5JOB A;  2Q8T A;  3S2D B;  2BDN A;  4IUT A;  4K2L A;  3MTS A;  2TMP A;  3GQB A;  5KGU A;  2F0M A;  3S2H B;  3V96 A;  2R92 B;  3SR1 A;  4XQJ A;  2EJM A;  4CJ2 C;  1X32 A;  1EEI D;  1LAB A;  3HS0 C;  1H9S B;  2KA7 A;  3MEH A;  2RSO A;  1ILQ A;  3I4N B;  5C0X H;  1LT4 D;  2WAQ B;  3N6R A;  4G57 A;  2ZXO A;  5KEE A;  5C3W A;  4A3E B;  1H9S A;  4RAU C;  3SK8 A;  1H9R A;  1TR5 A;  2A6H D;  3D6C A;  4O42 A;  4A3F B;  1B53 A;  2A69 C;  2B8G A;  1A3V A;  4Z9C B;  1DOM A;  3MXN A;  2H1E A;  4DFA A;  3A8J E;  3PUV A;  4OL7 A;  3NQI A;  1W6J A;  1RKN A;  1SYD A;  5EGT A;  1PRT C;  1AZQ A;  4CKB A;  1WTP A;  2F0H A;  2K5W A;  1LT3 D;  1GUO A;  1B4O A;  2ZXP A;  2FFK B;  5BN4 A;  3T51 B;  3VA5 A;  4HN7 A;  1Q8I A;  4EGV A;  3PIO 3;  4X3T A;  3HOV B;  3D8G A;  1CT1 D;  1S5B D;  4WJW A;  1KDA A;  1FNW A;  4CKC A;  5BN5 A;  4J6H A;  4TSS A;  4OGQ C;  2B2Y C;  2PYK A;  1PTO B;  1QOH A;  2NVQ B;  4HR7 B;  1TWG B;  1EQT A;  1CM9 A;  1OXT A;  2A74 C;  2IWH A;  4ZRZ A;  1UEA B;  4PMW A;  3WOF A;  1HQM C;  3KF8 A;  1SXT A;  1PMR A;  2K04 A;  3HKZ B;  4C3H G;  5ELC A;  3S14 B;  5C44 B;  3NBH A;  4FO2 A;  3V2T A;  1EY8 A;  1PFB A;  2IL8 A;  4LJZ C;  1QB5 D;  4RGN A;  1EU4 A;  2QEJ C;  3M85 A;  4LK1 C;  5KYI A;  5KND A;  3U9S A;  2F1M A;  5C5M A;  4BA2 I;  5FLX E;  5C4J B;  4DA2 A;  3HOY B;  3SK6 A;  3KLS A;  2MP1 A;  4NMZ A;  4NKL A;  4IUU A;  3SDZ A;  5IGB A;  1S5E D;  1PTO F;  4CJ1 B;  1SNQ A;  5CGK A;  1F2L A;  1LO5 D;  3CRK C;  4RKB A;  1STA A;  2EY1 A;  4B9W A;  4K5W A;  3TME A;  2ICI A;  3PIP 3;  1LT5 D;  3LX0 A;  3RZD B;  2AUK A;  1B44 D;  4DNT B;  4IUR A;  3ZYY X;  4V19 0;  3OMC A;  4DGZ A;  3VA7 A;  2AQ2 B;  5M5Y B;  5E3F A;  4I65 A;  5C6A A;  5CV5 A;  3DWP A;  3MVV A;  4C1N K;  5EKK A;  5JEA H;  1G8Z D;  1WTO A;  4HAE A;  2L12 A;  5CV8 A;  2Q8I B;  4NP5 A;  3VR5 A;  1JC7 A;  3C46 A;  1Z47 A;  1YNJ C;  2NZ1 D;  1PTO H;  1Y8N B;  1TY0 A;  1S4Z A;  3T16 A;  1DJR D;  4A3J B;  1PFN A;  1I6V C;  2CW0 C;  2K05 A;  1SYF A;  4DAY A;  4DNR B;  4RFB A;  2E76 C;  3T13 A;  4A3I B;  1F77 A;  1HXY D;  5I2X A;  1C8C A;  1STN A;  1EQV A;  3VYU A;  3NXW A;  2BE5 D;  3I3C A;  1YNN C;  3IKJ A;  4FXK C;  3S16 B;  2XNA C;  2L1B A;  4L8J A;  1CA5 A;  3OPO A;  1NUC A;  3PO3 B;  1F9Q A;  1BNZ A;  1JWU D;  5BN3 A;  1CHQ D;  1K8M A;  1SYG A;  2B2T A;  1SMY D;  1LAC A;  1O7Z A;  4RKL A;  5G3L F;  2EYM A;  5T1G A;  1ILP A;  1Z7T A;  1SE2 A;  1ZYR C;  4RA8 A;  4G7H C;  4RHS A;  2B2W C;  1GUW A;  5LL6 S;  2F0W A;  3RLF A;  1BCP C;  4CHT B;  2EY6 A;  2B2U A;  3GTQ B;  3FEW X;  5CMD A;  3CQZ B;  1Z6H A;  1D1I A;  3TSS A;  3GO5 A;  1F9S A;  1HA6 A;  1I4R A;  2VB3 X;  2K1B A;  1O7Y A;  1GOZ A;  1WTX A;  3H3V C;  1CFM A;  5M3F B;  5D3D A;  5JAV A;  1WTQ A;  1BQQ T;  4KKS A;  1LTB D;  2CQA A;  4OO1 G;  1S5F D;  3H94 A;  1OXV A;  4PMC A;  5M5X B;  1G2S A;  3P75 A;  1F2Y A;  3DWQ A;  4XIG S;  3HGB A;  1GUG A;  4IFD I;  2OEO A;  2F0K A;  2IJ0 A;  2EYJ A;  3HOX B;  5CV4 A;  1JWS D;  1W6K A;  2AQ1 B;  1TII D;  3R2T A;  3ND8 A;  4Q5V A;  2LMC B;  3MXU A;  3NQT A;  1BXT A;  1GHJ A;  4TRD A;  3K5L A;  3J7Y W;  3GV6 A;  4A3M B;  3S9W A;  1EZ8 A;  2JE6 I;  2WII B;  4A3G B;  2NWG A;  3RZO B;  2VUM B;  4XYO A;  3DM1 A;  3MC0 B;  2SDF A;  3DEO A;  3PUW A;  1KAA A;  4KN4 C;  2NN6 I;  1H9M A;  3OWF A;  1L0X B;  1DOL A;  1EWC A;  3PO2 B;  3GTO B;  4K6L A;  4RGM A;  3T53 B;  4IUV A;  4ZKB B;  3GP7 A;  2G9D A;  5IGD A;  5J22 A;  2MJ8 A;  5IGC A;  3H91 A;  4OO1 I;  2JA5 B;  1STH A;  5CYU A;  1KDC A;  2JEA I;  3MAQ A;  1BOS A;  3KLR A;  3TZU A;  4MHE A;  5FLX L;  3ERQ A;  4CKE A;  5JJZ A;  2MHV A;  2N88 A;  1V43 A;  2PZW A;  1PFM A;  2F0L A;  3QB3 A;  4K6D A;  1WVL A;  3I72 A;  2F0I A;  4BBS B;  3MFG A;  3R3O A;  4BA1 I;  4DK1 A;  1BF4 A;  5CBA E;  1PZI D;  1JIC A;  1HCZ A;  4BY7 B;  2F0G A;  4KD4 A;  5C3X A;  3K57 A;  1ENC A;  1RDP D;  4P2C B;  4XQN A;  2JA6 B;  1IYU A;  1GUN A;  1FGB D;  1JCK B;  4HTH A;  5EQ0 A;  2K32 A;  1EL0 A;  4C3J B;  4ZUI A;  4L6T B;  3K58 A;  1GUS A;  1S5C D;  2Q8R E;  2F0P A;  5KIX A;  1Y69 U;  4BWG B;  1JE4 A;  2EYP A;  1TWA B;  2G9H D;  4UDU C;  1O7L A;  1BCP B;  4J1M A;  2F0D A;  1VDZ A;  1PRT D;  3M7N A;  2KVM A;  2RSN A;  4HCS A;  3OW7 A;  1PLF A;  2RVL A;  3BDL A;  2NVX B;  2K5D A;  3HOZ B;  3E0J A;  2MGS A;  3NUC A;  5CV9 A;  3OMG A;  1AZP A;  3QOL A;  1KLG D;  1Y8P B;  2PNR C;  2Y0S B;  2O2L D;  4F88 A;  4KY6 A;  3JAM E;  4K8J A;  5D3I B;  1O80 A;  1Y1W B;  3DUZ A;  4C3I B;  4PNY A;  3SXH A;  2EYH A;  1UNS A;  2OT2 A;  1B3A A;  3SE0 A;  4EQO A;  2EVB A;  2L5T A;  3Q0A A;  4BS9 A;  5C0X J;  1SYE A;  2KOL A;  1TWF B;  4ODG A;  5C3E B;  3TP5 A;  3S1N B;  5C4Z A;  2KED A;  1AP0 A;  2X6L A;  3TN2 A;  1HTP A;  2A6E C;  3K7A B;  4KKT A;  5D65 A;  1EFI D;  1GUT A;  2A68 C;  4ZUJ A;  3A8K E;  1HUN A;  2KEE A;  3A8I E;  3DMU A;  3PMF A;  2EXZ A;  3LWU A;  2O4X A;  1QCB D;  2TSS A;  3R2I A;  2DN8 A;  2QKI C;  1I3Q B;  4LAA A;  1F9P A;  4WOR A;  1TVX A;  4FP5 D;  4E6I A;  3LWE A;  3QO2 A;  3V05 A;  1V1O A;  2WKD A;  2L0C A;  3A7A B;  2RKS A;  1ET6 A;  3J7A V;  2L9H A;  3HG9 A;  4FVM A;  3VR2 A;  4S3S A;  1CQV A;  5K5P A;  1DD2 A;  4O1N A;  2AWO A;  1Q1B A;  3EQL C;  2N55 A;  1SNM A;  4XT1 B;  4CGY B;  2F0V A;  1LT6 D;  4ABN A;  3I91 A;  4XT3 B;  3G6J B;  2R3Z A;  5KRU A;  2PQE A;  3FRP B;  1HTL D;  3AMU A;  1A3U A;  1D5X C;  3W3A A;  1VF7 A;  1RHP A;  1YNJ D;  3TP7 A;  4TQU S;  1TU2 B;  1JB3 A;  1NCV A;  2SNS A;  2CW0 D;  3HOW B;  3BDC A;  3OOC A;  2IX0 A;  1DYQ A;  5CBE E;  3D4R A;  2ZT9 C;  3S17 B;  4HED A;  1YNN D;  4G4K A;  3KUP A;  1HA5 A;  5DEH A;  3PUZ A;  3X3N A;  3J80 E;  4KD3 A;  3FVQ A;  2NUC A;  1TY2 A;  4RH6 A;  1B1Z A;  2K03 A;  3D4D A;  1D2B A;  4IAL A;  1EU3 A;  4RCO A;  1CZW A;  1NAP A;  5F2D A;  3MXP A;  2F0T A;  5FO8 B;  1STG A;  1U4L A;  1I4Q A;  2I07 B;  5JEA J;  1OXU A;  2KJX A;  1ZYR D;  2R7Z B;  4DAP A;  1WD0 A;  2XSC A;  1BCP D;  1XTC D;  1EZ6 A;  4DXF A;  3D4W A;  3NE5 B;  2AUJ D;  2E2D C;  3L3O C;  4EVO A;  4M1U B;  2R6G A;  2A73 B;  4KKU A;  5HGT A;  1V8Q A;  4PQX A;  1B50 A;  2F3W A;  3X3M A;  4C3H B;  1D6E C;  2O5I C;  1E0B A;  1AW7 A;  5JPN C;  5FO9 B;  1DZ1 A;  5CV6 A;  2Z4I A;  4ID6 A;  2BCO A;  2X69 A;  4DF7 A;  1M8A A;  3DEP A;  3NSW A;  4FXG C;  5HUR A;  2PMZ B;  2SOB A;  4KI0 A;  2JEB I;  2PW5 A;  1DXM A;  3VYR A;  1DOK A;  3EJI A;  1U4P A;  3IFT A;  3UI2 A;  2RA4 A;  2NVY B;  2B2V C;  1KNA A;  1NR2 A;  1T5E A;  4FXD A;  3MZ5 A;  1SYB A;  4KV6 A;  4IFD G;  4M8A A;  1QG7 A;  5EKL A;  5TSS A;  3P1H A;  4WRD A;  2D9U A;  4RGO S;  2NTT A;  2IX1 A;  1G6Z A;  2F0S A;  1B2T A;  1STY A;  1PRT B;  3MXG A;  3ND9 A;  2E2H B;  2BDO A;  5ISR A;  2EYL A;  4PV1 C;  4BY1 B;  3OHX C;  3D31 A;  3WOE A;  5ELE A;  2JA8 B;  1SDF A;  4X3K A;  3NWT A;  3BZD B;  4IQZ A;  1CK1 A;  1IW7 C;  3IFD A;  3CKI B;  1TS5 A;  4NDX A;  1IKL A;  1VMP A;  3JAM L;  1IL8 A;  2ZXR A;  2PW7 A;  2Z1C A;  1R4Q B;  1S5D D;  2IPK D;  3BS1 A;  2NN6 G;  2JSO A;  3AB9 A;  1E2V A;  3FDT A;  4HSP A;  5M5W B;  4IN3 A;  5EPJ A;  1KLU D;  5M3M B;  2ICE C;  4WFN 3;  3DXJ C;  2B2Y A;  4QUF A;  4A3D B;  1I50 B;  2K7V A;  1PRT F;  3M4Y A;  2F0F A;  1XXG A;  2OF1 A;  1HRJ A;  2EJG C;  5EPK A;  4J8Q A;  2FIN B;  1QE6 A;  3C2P A;  4KHV A;  5EBC A;  4C56 C;  3MFY A;  2HCI A;  1QIL A;  4IZ8 A;  1KAB A;  3MWY W;  4I7Z C;  2XVS A;  2K01 A;  1R4P B;  1RJT A;  3QOJ A;  4EQP A;  3OWE B;  3S1Q B;  5EPL A;  4A3B B;  1NSN S;  4H44 C;  1MGS A;  3RMH A;  2NBF A;  4F8M A;  4FF2 A;  1HFG A;  1NR4 A;  2NVT B;  3EVQ A;  2FJ2 A;  3TP6 A;  5E4W C;  1HQR D;  1PZJ D;  4ZKC B;  2IX3 A;  2PZU A;  2WP8 J;  3A56 A;  5KYL A;  1XYI A;  2O5J C;  2KCN A;  2YU9 B;  1A15 A;  1I4H A;  3PV0 A;  3HRZ C;  4RWS C;  2KCC A;  3FMC A;  4ZQ3 A;  1G2T A;  2X6G A;  2ENB A;  3S1R B;  4K5V A;  4EQN A;  2CHB D;  4KY7 A;  2GA4 B;  1A3T A;  1MI2 A;  1U9R A;  5LL6 X;  2VB2 X;  3QJY A;  4FYD A;  1RCV D;  1EYC A;  1EY4 A;  3RUZ A;  1ZXT A;  1ICW A;  1I4G A;  1M4V A;  4DAV A;  3GTL B;  1LTS D;  1TS3 A;  1EIG A;  1PTO C;  3NTK A;  1SEB D;  4UAI A;  2M00 A;  3RD4 A;  2R61 A;  4K14 A;  4FF3 A;  2EOT A;  4KY5 A;  1VF5 C;  1VCI A;  1RTN A;  3BYT B;  5FKA C;  4B08 A;  1ET9 A;  3DHQ A;  3J80 L;  4ZLT F;  3I4L A;  3HP3 A;  4IUQ A;  2K28 A;  3BG3 A;  3KLS X;  2PPB C;  5COY A;  2EPB A;  1ZKO A;  5C0X I;  4F7X A;  3J81 E;  3NBI A;  1DON A;  1BR9 A;  3L9A X;  2E75 C;  1LLR D;  4MN3 A;  2KUM A;  5JVG 3;  2PO4 A;  4NW2 A;  3SEB A;  4DN4 M;  1STB A;  4IFD H;  1WTR A;  5C4X B;  5KNC A;  3GD7 A;  1EEF D;  4QUC A;  2A6E D;  1F2M A;  1V1P B;  2A68 D;  2BA0 A;  1TS4 A;  1ESF A;  1LTI D;  1JR0 D;  4RHR A;  2A69 D;  1KTK A;  2HCC A;  1V1P A;  3SK5 A;  3BYY B;  4ME5 A;  4JK1 C;  3H6M A;  4H7B A;  2F0Q A;  1U4M A;  1A2U A;  1SJE D;  2XN9 C;  4KJN A;  1TWH B;  2I46 A;  4HMJ A;  5DM7 3;  2H4O A;  3FPU B;  3O13 A;  2L11 A;  3BVZ A;  4ZK9 B;  2B2W A;  1L0Y B;  3D6W A;  2E2I B;  1Y8O B;  2DNE A;  2NN6 H;  2F03 A;  1STE A;  2EZV A;  5NUC A;  4OIJ A;  2D2C C;  2WB1 B;  3SK4 A;  5IT9 L;  3VYT A;  3QG1 A;  5I4D A;  2L4N A;  5J1Z A;  4U67 3;  2C5C A;  1CI3 M;  5JEA G;  1EOT A;  5C4H A;  4U68 A;  2EYF A;  3A55 A;  3D3R A;  2EDG A;  4CJ0 B;  3CU7 A;  1K8O A;  2F0U A;  3A54 A;  1MBY A;  4OO1 H;  3NK9 A;  2XRS D;  3K5O A;  3U9O A;  3QIA A;  1R9T B;  1U4R A;  1O78 A;  5K36 G;  1BCP F;  1PZK D;  1VMC A;  3CRL C;  1QNU A;  1MSG A;  2IT1 A;  4KHZ A;  3I70 A;  3IL8 A;  3EFX D;  4Q0F A;  1B9N A;  1PYW D;  2HDM A;  2M2L A;  5LHY 1;  1AN8 A;  1UAP A;  3H09 A;  3GTK B;  4X3S A;  1RTO A;  5EBD A;  3TP8 A;  4RGT A;  2L55 A;  5M9O A;  2WAC A;  2B2T C;  1OO9 B;  1SND A;  3NTH A;  4QF4 A;  1X3P A;  4QCL A;  4XQQ A;  3VR3 A;  1CHP D;  1Q3L A;  1HHV A;  5JVH 3;  2D5D A;  1HUM A;  1RF2 D;  2E74 C;  2B2U C;  1H9K A;  2K33 A;  2JYO A;  3KBX A;  5IOC A;  1G91 A;  5FOB B;  5C5L A;  1ROD A;  1SSO A;  3R8B A;  3Q24 A;  1LTR D;  5T1I A;  1B9M A;  4TKO B;  1GHK A;  2XIW A;  3LNN A;  3M4O B;  1JQY D;  4JBW A;  3ITP A;  3C1F A;  2MUY A;  4CBV A;  3W2D A;  3SVM A;  1FNV A;  1SNP A;  2J4X A;  4XXE A;  1SJH D;  1J9O A;  3C1E A;  3P20 A;  1KDB A;  3I90 A;  3OSO A;  2AQ3 B;  1ENF A;  1C4Q A;  1ESR A;  4R8N A;  1SNO A;  1XX8 A;  5DAU A;  4AYB B;  1LTT D;  1HPC A;  3FPP A;  5COR A;  3TDQ A;  3EA6 A;  5DM6 3;  4QIW B;  1QWY A;  3E5S A;  1CZG A;  1LTG D;  2B39 A;  1MSH A;  1Q12 A;  4HMI A;  2A6H C;  3VR4 A;  1AEX A;  2KEC A;  2R93 B;  4ZAI A;  5A2Q E;  3GTJ B;  1TT2 A;  4XTC S;  2F4I A;  3GTP B;  2QF7 A;  5FK9 C;  3VR6 A;  4OHJ A;  2HQE A;  4L63 B;  3MA2 B;  2J7Z A;  4FF1 A;  3K0Y A;  1F2Z A;  1XWE A;  3GTG B;  3NHH A;  2HUG A;  1UUP A;  2K5Q A;  2M9V A;  1BDO A;  1RD9 D;  2RDH A;  1SFO B;  1DCZ A;  1DM0 B;  4QMG A;  3I4M B;  3K59 A;  1I4P A;  3P7J A;  4KK7 A;  5FO7 B;  1Q1E A;  4FNF A;  1E2W A;  4BBR B;  3F2U A;  2WKC A;  4IUP A;  2NYZ D;  5CV7 A;  1IW7 D;  1OXX K;  1ONL A;  2FMC A;  4GZY C;  4PMB A;  1AFP A;  4HCE A;  2WIN B;  5ELF A;  2Z8L A;  1GJX A;  3G7L A;  1FNU A;  1LTA D;  2NB0 A;  2JXM B;  2YYZ A;  3HOU B;  1T5X D;  3J81 L;  4KMU C;  3E6Z X;  3A7L A;  1JOR A;  1EY0 A;  4LMQ D;  1KNE A;  4XYQ A;  5I6W A;  2F0E A;  5K36 H;  2DY8 A;  5IT9 E;  1WCM B;  3DWA A;  1JOO A;  4HSV A;  4YIJ A;  1TKW B;  1IYV A;  4H0L C;  1OXS C;  2D62 A;  2F3V A;  3Q22 A;  3C3L A;  1BUV T;  3SHL A;  1WTV A;  4N9P A;  3Q6S A;  2DY7 A;  3OIP A;  4C1N I;  1II3 A;  2B8F A;  4KJO A;  5E1F A;  2JA7 B;  1Y1V B;  3GV3 A;  3AU7 A;  1F9R A;  1EYD A;  1JWM D;  3N52 A;  4XDX A;  5IGE A;  3OIQ A;  4N9T A;  1G29 1;  2EE1 A;  2EY5 A;  3BVM A;  2MPM A;  3PUX A;  4H13 C;  1I6H B;  1X3Q A;  1SAP A;  4DK0 A;  2J0T D;  2K6A A;  1Q90 A;  3H0G B;  5CR3 A;  1SYC A;  2BOS A;  2RQX A;  3I73 A;  1D1K A;  2KHS A;  3K5M A;  3NPP A;  4ZYS A;  5ELD A;  3M7G A;  1GXD C;  1BBX C;  3KK7 A;  2OXP A;  3T56 B;  5J39 A;  1EWH A;  1BO0 A;  1PDQ A;  3KBG A;  2RDG A;  2WV6 D;  5KNB A;  3WDN A;  3ONA B;  2BE5 C;  1PTO D;  2VXW A;  2BA1 A;  5D14 A;  1PXU A;  2LFN A;  3URY A;  5AFW A;  2VNU D;  1IHZ A;  5EJW A;  3PUY A;  5E4X A;  2RDF A;  5C0X G;  2LS0 1;  3IAY A;  1H9J A;  1EIH A;  4RCN A;  1MD2 D;  1SMY C;  4QB4 A;  2KQ3 A;  1SE4 A;  2F0J A;  2NTS A;  2EJF C;  1EY9 A;  1LV9 A;  5JPM C;  1TQO A;  1SBB B;  3GTM B;  2RBM A;  4C2M B;  3QWN A;  4G7Z C;  4ILW A;  1FR3 A;  2HDL A;  1CTM A;  3ERO A;  4R8I A;  3L7Z C;  3T4A C;  2SNM A;  4C3J G;  2EY2 A;  4DU9 A;  2B63 B;  1D5M C;  4V0B A;  2PCF B;  1TS2 A;  2A5H A;  2F0N A;  4FF4 A;  3HZX A;  5I6Y A;  2V4D A;  5IIF A;  3NWS A;  5ELB A;  1ML0 D;  1QNK A;  4B9X A;  4K8I A;  5I9P A;  1FD7 D;  2C9O A;  4A3K B;  5CC4 A;  2E2J B;  1D5Z C;  2ID0 A;  3HEJ A;  1JOQ A;  3NTI A;  1FYC A;  3FKI B;  1HFN A;  5A2Q L;  1ENA A;  1EY7 A;  3M3Y B;  3TZD A;  4IUN A;  1K83 B;  5DNF A;  1A6X A;  4K5X A;  1WTW A;  5A35 A;  4IFD J;  3TBI B;  3BVG A;  4C3I G;  2Z4H A;  2XWB B;  5G3L D;  4R9W A;  2DNC A;  5EKI A;  1SE3 A;  5IGF A;  3BDO A;  5IOD A;  2CVR A;  1WD1 A;  1QJO A;  4ULL A;  2PZT A;  1TWC B;  3I8Z A;  1J8I A;  4MIU A;  2B2V A;  1SNC A;  1C48 A;  3MHB A;  1CQF A;  2IW3 A;  4K2K A;  4A93 B;  4OIK A;  2F0O A;  2JP1 A;  2FHT A;  3Q23 A;  2QIL A;  2EYO A;  1ZEQ X;  5I9O A;  1I4X A;  3S1M B;  2QCP X;  1IKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...