1EYAA

Structure of s. nuclease stabilizing quintuple mutant t33v/t41i/p117g/h124l/s128a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMVFRLLLVDIPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eyaA00
2EY5A 1A3VA 5E1FA 1SNCA 2EY6A 2M00A 2F0NA 2PW7A 3LX0A 4KY7A 4IZ8A 4DGZA 5C4HA 5J22A 3BDCA 3NXWA 2F0IA 3P1HA 4PNYA 4ID6A 2F0EA 5CR3A 3OWFA 4KJOA 3SHLA 3TP8A 4ZUIA 2QDBA 2EYPA 3EVQA 2SNSA 4QB4A 4F8MA 4MIUA 3MZ5A 1EYDA 1TQOA 2F0SA 3NP8A 5CV6A 3SXHA 5KGUA 2F0KA 3E5SA 1SYDA 2EY1A 2PZUA 1II3A 3SK8A 2RKSA 5IGBA 3P75A 1U9RA 4K5VA 1SNQA 2F0VA 1AEXA 5EKLA 1EY6A 2F0LA 3T16A 3V2TA 4RKLA 1A2UA 4IUNA 5IGCA 1SNOA 5K5PA 3DMUA 3NHHA 5KYLA 1TR5A 4K2KA 4K5XA 4NDXA 4ZUJA 4K8JA 2NUCA 1EZ8A 4K5WA 1JOQA 2F3WA 1STNA 2PYKA 4RKBA 1EYAA 5CV4A 1STBA 1EY7A 1IHZA 1STGA 4J1MA 4EVOA 4KV6A 2O4XA 5CC4A 3MEHA 4KHVA 5F2DA 1F2MA 4K8IA 1STHA 4ODGA 4QMGA 2EYHA 3MVVA 1SNPA 4I65A 4KD4A 5CV5A 4B9WA 5EGTA 5I6WA 5I9PA 4QF4A 4PMBA 5KEEA 1STAA 2SOBA 5IOCA 5IIFA 1SYFA 2PZWA 5C4ZA 3QB3A 4DFAA 2PZTA 5KRUA 3OMGA 1NSNS 1JOOA 4HTHA 3PMFA 5ISRA 3D8GA 5IGGA 5JAVA 4TRDA 5E3FA 5C5LA 5C6AA 4IALA 1EY0A 4F7XA 4K6DA 4OL7A 3U9OA 2F0DA 1ENCA 3H6MA 4KTAA 4WORA 5I9OA 3ITPA 5IODA 1SYCA 1JORA 2PQEA 5CV8A 1F2YA 4N9TA 2F0TA 3QOJA 3DHQA 1TT2A 2EY2A 3HZXA 4EQOA 2F0PA 3MHBA 4E6IA 1EQVA 3C1FA 3ERQA 4HMJA 4PMCA 3SK5A 2KQ3A 5KIXA 5IGEA 1EY9A 1F2ZA 2F0WA 4NP5A 3EJIA 4LAAA 4S3SA 3TP6A 4DF7A 2SNMA 2F0QA 4R8NA 1EY8A 1JOKA 1EZ6A 2F0GA 2LKVA 2EYJA 3D4DA 4KY6A 5IGFA 5NUCA 2F0HA 1SYGA 5CV7A 3D4WA 4NMZA 3TP7A 1STYA 2EYLA 3R3OA 4H7BA 2OF1A 2OEOA 5DEHA 1A3TA 1SNDA 3BDLA 3TMEA 2ENBA 2HQEA 2F0FA 3NUCA 4KD3A 3RUZA 4B9XA 1SNMA 2F0MA 3HEJA 4KJNA 5HGTA 2PW5A 3D6CA 3MXPA 1KDAA 1NUCA 4NKLA 5C5MA 5JOBA 3NK9A 1ENAA 1KDBA 1SYEA 1KAAA 2OXPA 4DU9A 2KHSA 5IGDA 2F0UA 4WRDA 4K14A 3SR1A 1A2TA 4KY5A 5J39A 1KDCA 2F0OA 3C1EA 4ZQ3A 4G57A 3EROA 2F3VA 3T13A 2WACA 3VA5A 4ME5A 5M9OA 5C3WA 1EYCA 1SYBA 1RKNA 5EKKA 3S9WA 5DAUA 2F0JA 2RBMA 4HMIA 3NQTA 3TP5A 5C3XA 5J1ZA 2EXZA 1EY5A 4EQPA 5CGKA 3OSOA 3SK6A 1A3UA 5I6YA 3QOLA 1EY4A 2EYOA 3SK4A 1KABA 2EYFA 5HURA 4YIJA 4EQNA 3OMCA 5KYIA 2RDFA 2EYMA 4K2LA 4J6HA 5CV9A 4N9PA
chains in the Genus database with same CATH superfamily
4MTNA 1UE5A 3NXWA 5HY6A 1AW7A 4KKSA 2QEJC 4IUPA 2K4KA 5CR3A 3OWFA 3K5OA 3BG3A 4X65L 1YJNA 4B08A 1Y8OB 3E5SA 4FF4A 2QF7A 3A54A 1U9RA 2LY7A 4DN4M 3MA2B 2O5IC 3I4NH 4JI2Q 2BH2A 4A3JB 2PPBC 3D31A 2Z0SA 4ZKCB 1HZ9A 2BE5D 2KCCA 4YCWA 1IYVA 1NMFA 2IW3A 2RA4A 5I2XA 4DR6L 2BA1A 1YHBA 2JA5G 1HFNA 1STAA 1Q1BA 3PO2G 3C46A 4A3CH 1CZGA 3LWUA 1PXUA 2PCFB 5ELDA 1SDFA 3RN5A 2R7ZB 3OMGA 1JOOA 5IYBG 2OCEA 2JXMB 3PCOB 4TRDA 1PZJD 3HOXG 1PHJA 2NB0A 1KL9A 4TQUS 2MGSA 1VCIA 2CCZA 1BQQT 4DXFA 4GLXA 1QVCA 3KDFB 4GN3B 4UDUC 1FD7D 4C3IG 2ZTCA 2EE1A 1MHWC 1SEBD 1YBYA 3T1HQ 1JJGA 2F0HA 1SYGA 1IBLQ 3D4WA 1JMCA 1ONLA 2XWBB 4HJ7A 3IKJA 3K8AA 2UUBQ 1G51A 3M4YA 1YJWA 1ZYRC 4X64Q 1H9RA 4PMWA 1HNWQ 1O7LA 1WFQA 5LMNQ 2PO4A 4B9XA 3MFGA 1V1QA 4DV2L 1SAPA 4JG2A 3D3RA 2K14A 1KDBA 5IGDA 4X66L 4KY5A 4GN4B 2L11A 1D1IA 2RCFA 1FNWA 5LHY1 1GUWA 4KHPQ 4FVMA 1DGSA 1DOKA 4H44C 4A3LH 5C3XA 2Y0SE 2N88A 1BO0A 3QOLA 3DUZA 2KJXA 2JA9A 4CBVA 1L1OC 1HA6A 1IKLA 2IJ0A 2EY5A 2R7FA 2ZM6Q 3K0XA 1WOCA 4HIOA 2A74C 4A3EG 4LF6L 3GTPB 3U9SA 1VQCA 4DK1A 1YHQA 4LF4Q 4AYBE 1Q7YC 1RCVD 1L1OA 2JE6I 3NP8A 5JJLA 2N78A 1CK1A 2IX0A 5IGBA 1PTOC 2RKSA 1ZYRD 3A5UA 3HFZB 1EY6A 3A55A 3TSSA 3MEFA 1LT3D 1A2UA 4O2DA 3LGJA 1NBWA 5FJ8G 1P8LA 3BZDB 1PH1A 1BCPC 5DM73 1EY7A 4JI2L 2O4XA 1EQTA 4OGQC 2HDLA 3K58A 2JA6H 3I70A 3MVVA 1N8RC 2X69A 2HCCA 1EOVA 2YTXA 4PMBA 1C8CA 2RSOA 1PH7A 2D0OA 5C4ZA 1T5EA 2JEAI 1LTSD 3P20A 5ISRA 2JA5B 5K36G 5C4XB 4UAIA 3H6MA 4WORA 2KHIA 1SJHD 2EDGA 2YU9B 2QCPX 2K03A 5JEAJ 4BY7G 1K8MA 3FKIG 1Y69U 4HMJA 1K3BC 2EIFA 5KIXA 4BXXH 1EY9A 3R2IA 2QKIC 1AFPA 1JOKA 4HSPA 1EZ6A 3HOWB 1R4PB 3J81E 2NYZD 3QIAA 4OEMB 2R93H 2JYOA 4A3BH 2LS01 2OEOA 1CKOA 4JI4Q 3CPFA 4KD3A 1BCPD 1H9SB 2JSOA 5LMNL 2E74C 1JQYD 3S1RB 5M3MG 4IO9A 1WTOA 2PQAB 4BBSG 1VQIA 1WCMB 3CKIB 4GNXC 2VW9A 4KHPL 4EQPA 2Z6BA 3Q23A 4MNOA 4JI7L 1EY4A 3UDFA 2CQAA 4G7HC 3F2BA 2AUJD 4DR2Q 1ASYA 2K50A 4GNXA 1HXYD 1R9TB 1SNCA 5C3EB 3UDXA 1LABA 1YIJA 1KAWA 4A75A 2XSCA 3P1HA 2ZM6L 3PIP3 4F8MA 4GKKQ 4QB4A 1JWSD 4L5QA 4LF4L 4HJAA 1Y1WG 4JOIC 4KHZA 2MNAA 2K5NA 2VY3A 2ZXOA 1HFGA 4HN7A 1QWYA 4JOIA 3J81j 4JI3Q 4QJFA 1LLRD 1U4MA 1OXXK 3A7LA 5CV5A 4BBRB 3RMHA 1U0LA 1DCZA 3VYTA 3CF5A 2WKDA 3HKZG 3QJYA 4R4IA 1SE2A 2KCTA 1PRTF 1G6ZA 4LUVA 3U9OA 2UU9Q 2JA7B 1A0IA 2NVYB 4YHHL 4A3JH 4P75A 3PUYA 1TWFH 2EY2A 4I7AA 5FLXc 2XNAC 1EIGA 3ND8A 4A3FB 2LXKA 1PYBA 1OTCA 2IX3A 2VUMG 3V05A 4B3MQ 1B2TA 1IKMA 4QIWE 2UXBQ 1I4HA 5EPLA 2CH4A 2E2DC 2R7ZH 3STBC 2B63B 4R9WA 1CSPA 2A6EC 3I91A 2HHHL 1VMCA 4JI4L 5BN4A 1DYQA 4IJHA 2H1EA 2VQFL 3G6JB 1ENAA 4PZ7A 2F4VQ 3H3VH 3FMCA 1ILPA 4A3GG 1WTHA 3RLFA 4GKJL 3S1NB 4JI5Q 2B2VC 5M3FB 4L5SA 2CVRA 3SK6A 3F2DA 4DK6C 4RHSA 1IBML 2V1CC 4EQ5A 5IT9c 2B2VA 2YTYA 3F2UA 2FINB 1AH9A 1NCVA 3KLWA 1A3VA 2PW7A 1EUJA 1ICWA 4DR2L 4QUCA 4DGZA 4RMFA 2AUKA 3OOCA 1K0RA 2WAQB 2KHJA 1EYDA 3DEOA 3CQZB 4GKKL 1QG7A 4JYAQ 3STBD 2F0VA 2E8GA 2A6ED 5T1IA 4A3KB 4UY8C 3KBGA 1JJ2A 2HD3A 1EZ8A 1A6XA 2K01A 1STNA 1STBA 4OWTB 3MXUA 4A3IH 2ICIA 5FOBB 1PH3A 4JI3L 4IUTA 1L0YB 2KBNA 3CCVA 4DR7Q 5EGTA 4QF4A 3J80L 2SOBA 1BVSA 1VF7A 1IYUA 3GTKH 3NQIA 4IOAA 3Q0AA 1G8ZD 3E0EA 2B8GA 5C6AA 1T9HA 4L8JA 4H02A 3HG9A 2AWNA 4L5TA 2K33A 2JEBI 5E4WC 2AQ1B 5TSSA 1VQ5A 2QGQA 3MHBA 3P7JA 3ERQA 1UEBA 4A3DG 1IBKL 1GVPA 1V43A 3GTJB 1GJXA 4KY6A 3KJPA 1B8AA 4KI0A 2N3SA 3K0YA 3HOZG 1HNZQ 2JQOA 1CHQD 5JPMC 4B3ML 1EIFA 2UXBL 2JA5H 3S2DB 2ENBA 5ELBA 1SROA 1JB3A 1E2ZA 1SNMA 5C4XH 3BYYB 3HEJA 1IZ6A 5HGTA 3FP9A 1B3AA 4OIKA 3M85A 4LF5Q 3HS0C 5JOBA 1I4XA 2YU9H 5IYBH 1CA6A 1XTCD 1I94L 1LV9A 3RD4A 3HOXH 1ASZA 2A6HC 4B3SQ 3GD7A 2F4VL 1XNQQ 1SXTA 2AHOB 3VYUA 2MO0A 2I07B 1GHJA 5C3WA 3HOWH 1EYCA 2C9OA 1TWGB 3VR4A 1WYDA 3R2TA 4F87A 1TS4A 4JV5Q 2EJGC 1U5KA 4GOPA 1XMQQ 1TIID 3A0JA 1HUMA 4PZ8A 3KF6A 1S5ED 2A5HA 3I4LA 1YVCA 2RDFA 2EYMA 1KQSA 4DV0Q 4LFCQ 4UP9A 5ELEA 1SN8A 2XTIA 2A8VA 4IZ8A 2RCNA 3S1RH 3NE5B 5KYIA 3SHLA 5JJIA 4WJ3M 1EIYB 2EY1A 2SDFA 4JCVE 5A2QE 4UP8A 3OPOA 3CCLA 5IGCA 3E9HA 1V1OA 4LNQA 1VDZA 2OQKA 1PH6A 2RSNA 1CKMA 1UUPA 2MHVA 3T56B 2A6HD 3UDGA 1R9TH 5C3EH 1E2WA 1I50B 2HIXA 4EVOA 1STHA 3NBHB 4OHJA 2WB1G 2J0TD 1SFOH 4FYDA 5M5XB 1KC8C 5I9PA 3R8BA 5FLXE 1D2BA 2X6GA 4A3EH 4DR7L 5GROA 3U4ZA 2HDMA 2Y0SB 4DFAA 4P73A 4EGVA 1EL0A 1EY0A 5IWAQ 4OL7A 4KTAA 1ENCA 2XIWA 1RTOA 4KKUA 4K0KQ 3I73A 3QOJA 3HRZC 1X3FA 1LTAD 3GTMH 5FJ8H 3OHXC 4JI6Q 4IURA 4AYBB 1LO5D 1PFBA 3EJIA 4S3SA 3M7GA 1S5FD 2F0GA 4Q5VA 2K52A 4BBRH 1X65A 4X6AH 4JBMA 2HQLA 4RGOS 2R93B 4NXML 4A3BB 4DR3Q 4NW2A 2BDNA 1HNZL 1X3PA 3BZKA 3A74A 4LW1A 3I90A 3NEMA 2F0MA 2K5VA 1TWAB 4NPSA 4TSSA 5FO9B 2JA7H 2NVYH 4RWSC 3J80i 4G7ZC 3CC2A 1VQDA 5HGQA 1BOSA 4OO1H 5K36H 4LF5L 4K14A 2B2WC 1VMPA 3CXCA 3KJOA 4B3SL 3MXNB 1Y8PB 1PFMA 1Q8KA 4Z9CB 2K5DA 1XNQL 3KDFA 4G7OC 5BR8Q 2B2WA 3H0GB 1S5CD 4LFBQ 2B63H 3HOVG 4JV5L 1V9PA 3MTSA 2K6AA 3H91A 1MGSA 4IUVA 4JBKA 4WJWA 4C3HG 4LFCL 4DV0L 1QILA 3J81c 1BBWA 3M3YB 4ID6A 5FKAC 4OELB 3S1NH 4HIMA 4MIUA 3FRPB 3WOEA 5JEAG 4DAMA 2UUAQ 1Q86C 2UUCQ 1NY4A 2PZUA 1II3A 1N9WA 4IPGA 4YY3Q 3UI2A 1RIPA 1BNZA 2G9HD 1Q8IA 1SE3A 4YCVA 4LF7Q 4RAUC 1SNOA 4DV6Q 3BZCA 4K8JA 3BS1A 2NUCA 4EX5A 1YNXA 2F3WA 3HKZE 1C4QA 3TQYA 1ESRA 2FJ2A 4HAEA 1Q1EA 4JI8L 1IHZA 4DUYQ 2JA8G 1O80A 1O7IA 4J1MA 4KV6A 5CC4A 1F2MA 4QMGA 2IWHA 3ULPA 1BF4A 1SNPA 3HKSA 5I6WA 2JK8A 3CQZH 1WTPA 2KENA 1NR2A 1E3PA 1EEID 3SVMA 1J9OA 3N6RA 4X3TA 3KLRA 4DNTB 1NNXA 2XVSA 5BN3A 4X62Q 1RD9D 1AN8A 2PZTA 4A3KH 5JAVA 4OWWB 1MI2A 4IALA 1I3QH 1Y1WH 1F2YA 5IWAL 1TT2A 3GTLB 1TWFB 2NZOA 3AMUA 1VQJA 1E0BA 1PFSA 4H0LC 1VQ6A 2CWAA 3I4OA 2IL8A 4J8QA 1XYIA 4L63B 1SJED 5GAGC 2SNMA 5IY0A 1EQQA 1EY8A 5EJWA 2ICEC 2OT2A 2AQ2B 4IQZA 1K8GA 3K5MA 1D7QA 1QVGA 5CV7A 3TP7A 1STYA 1YHAA 2ZJRA 3CMEA 1A3TA 5JVH3 4DR3L 3BVGA 4DR5Q 3E0JA 4LFAQ 4NKLA 4U68A 1MBYA 2A68C 2CQOA 3URYA 1KDCA 1OXSC 2MQHA 2F3VA 1GO3E 4YCUA 1H95A 3GTJH 4DUZQ 2EPBA 4CJ0B 4DV5L 1QNUA 4U673 4KMUC 2F0JA 2MFIA 3S15H 2B2TC 1BUVT 3J7ZC 2L5TA 1KABA 3S2DH 5HURA 1Q46A 1ENFA 5BR8L 4JI0Q 2NN6I 1X3QA 5E1FA 2B2TA 1QUQB 4ZLTF 3H94A 3BDCA 5T1GA 1MJCA 1YEZA 1HTLD 1L2FA 1DONA 5L37A 1L0XB 3S1QH 3SXHA 4IPDA 4C3HB 4FF3A 3L2PA 4QIWB 1TWGH 2BA0A 4K5VA 3QG1A 1IL8A 2UUAL 4IUNA 5FO7B 5K5PA 3OTOL 2UUCL 3W3AA 4V0BA 4YY3L 4K2KA 1K3RA 4KN4C 3NTHA 4LF7L 3NELA 1CA5A 1EU4A 3JAMc 2A68D 4Q0FA 4DV6L 1EFID 1EYAA 5C44G 1MIUA 4L6TB 4XIGS 1GUTA 4IJLA 3ULLA 4A3IB 3AEVA 2E2HB 1RF2D 1D6EC 2DY7A 4DUYL 3W5OA 3GQBA 4B9WA 1XX8A 4FF1A 4XDXA 3R93A 3D6WA 1TWHH 1KD1C 2G5DA 5I4DA 1RDPD 2K32A 3I4MG 2BDOA 3UDIA 4IFDJ 4JBWA 1DD2A 2R7DA 3GTKB 4HTHA 5ELNA 1B70B 3B6YA 5FLMH 1O78A 1X56A 4X62L 3J7AF 1OXTA 1B50A 2NTSA 4HIKA 3HOYG 1G2TA 2OWOA 2TSSA 1E1OA 2R61A 1CM9A 1I50H 4RCOA 2I46A 4RGNA 4GZYC 4PMCA 5D3IB 1GD7A 4LMQD 2Q2UA 5M5XH 1XMOQ 2GA4B 3FHWA 4DPGA 3HOUG 1LT4D 4A76A 5IE8A 4DK0A 1HQRD 3E3XA 5AFWA 4HJ9A 5ELOA 2JJQA 2XGTA 3LNNA 4FNFA 3RR5A 3I55A 3CCQA 4OX9Q 2DJGC 1Q81C 3PO2B 3T1YQ 1PTOF 2B3GA 4DR5L 2K5HA 3HOXB 1EQRA 1HA5A 2F0OA 3TZUA 1A8VA 3GO5A 2F4IA 4A4IA 3S1MB 2PNHA 2L1BA 1BCPF 5M9OA 1VQFA 1PTOD 4R4OA 1X54A 2RBMA 3OW2A 4O1NA 1C0AA 3CW2C 4DUZL 4V190 4GN5A 1B9NA 2L12A 3T1HL 4C3IB 1IBLL 3OYYA 3HOZH 1BBXC 1TWAH 2UUBL 2B29A 4X64L 1HNWL 2IHEA 1PZKD 5KNDA 3ULJA 5J22A 4JI0L 1S3OA 2L4NA 1TS2A 5C0XH 2GVBA 2QDBA 1HZAA 3NWTA 1JC7A 1ILQA 1WTWA 1Z7TA 4OONA 4ME3A 2WB1E 4QGUA 3H0GH 4BS9A 4IFDI 5DLQE 5M5YB 1VQNA 4DV7Q 3VR6A 1JOQA 4C2MB 4R8IA 1OO9B 4L5RC 2PYKA 1K9MC 3AB9A 3S16B 2R92G 1JJCB 4K8IA 3U58A 1N33Q 2K05A 3M3YH 3CMAA 4WJ4A 4I65A 4BY1G 3VYSA 3L7ZC 4DR1Q 1SFOB 4RGMA 4IUQA 1FR3A 2VB2X 5JPNC 4A3EB 1F9PA 2UXDQ 1Y1VG 4X3UA 5IP9G 1D5MC 4AH6A 4ALPA 2F0DA 5I9OA 2WV6D 1SYCA 1PVOA 1L1OB 2F52A 2QW7A 3IFDA 5A35A 3DWQA 3T4AC 3CRLC 4E6IA 3GTMB 1Q90A 3ERSX 3KOJA 2AMCB 1K28A 4DF7A 3CC4A 3I4NG 1WD0A 1NR4A 4NMZA 3T53B 5KNCA 1XMOL 3F8TA 3HGBA 4BWGB 1JWUD 1PV4A 3BDLA 1AE3A 4C1NK 1IXRA 1NAPA 4KJNA 2PW5A 2ZJPA 5AJ3Q 2M9VA 3Q8DA 1SYEA 3GTLH 4OX9L 2O5JC 4DV1Q 4A3MG 1RJTA 4A3CG 3C1EA 3T1YL 1XTDA 4POGA 1QCBD 3KYHC 2VQEQ 2PMZE 2ZT9C 1WTQA 1FNVA 4BY7B 3TBIB 3FKIB 2ASBA 2E5LQ 2EYOA 1O7ZA 1YNJC 3PIO3 3OMCA 4UPAA 2EY6A 2IY5B 2F0NA 1VQLA 5JJZA 2DJFC 1IYJB 2PI2A 1AP0A 1AE2A 3K80C 3JAME 2FHTA 4C1NI 1EWIA 3KF8A 4JBJA 4I7ZC 4FO2A 5M3MB 1WTVA 3IFTA 4HEDA 4BBSB 2Z9HA 2F03A 4QCLA 5G3LD 5E4XA 1JCKB 1LTRD 1QZGA 4X3KA 4DV7L 3KFUA 4JW0A 4HSVA 1B4OA 4N8X1 3EBEA 1CFMA 2Z6KC 2LXJA 3PO3G 3T51B 4PG3A 5EPJA 4C3HH 1H9MA 3KBXA 4DR1L 5IIFA 5FLXL 4GNXB 2PZWA 3KLSA 3KUPA 3LWEA 1NSNS 1YNJD 3FEWX 5E3FA 2Z6KA 3I72A 2UXDL 1I3QB 1PH5A 5IODA 1Y1WB 3CC7A 2WIIB 4BA2I 5H1SE 2LSSA 1DZ1A 3DHQA 3HZXA 3M4OB 3MXGA 2E2HH 4DKAC 1VQKA 3Q6SA 1RTNA 2Q2HA 1NE3A 1PRTB 2LMCB 1BBUA 1EFWA 3NSWA 1F77A 2EYLA 3R3OA 3ZJYC 1XPOA 4JPBW 2C5CA 1HR0Q 3PGZA 1KNAA 3NUCA 2JA6G 3HKZB 1K83B 4XQJA 1X6OA 3NPPA 2NN6G 2B8FA 2EJMA 2UU9L 1A2TA 4P2CB 5IT9L 4DV1L 3I3CA 4DXGA 1CI3M 3A8JE 3E6ZX 5IYDG 1ET6A 5J1ZA 1TY2A 1TVXA 3CCEA 3BJUA 1J5EQ 2K75A 3S15B 2IT1A 3OIQA 4A93G 3SE0A 2EYFA 4OXPA 2VUMB 2E2IB 4BXXG 2E5LL 3PO2H 1O7YA 2BOSA 1XNRQ 3O13A 2KEDA 1XPRA 2N49A 3DLLA 3LX0A 4KY7A 1A15A 2F0IA 5CBEE 1K0SA 1PFNA 3PF4A 2DN8A 2NVTB 2FFKB 3S1MH 5DM63 4QY7A 3S1QB 4DV3Q 2HIVA 1PMRA 3K81C 2GN5A 2B2UC 1V8QA 4A3GB 1KXLA 4JI5L 2CH4W 3M7NA 2Q2IA 1OXVA 3H09A 4C3IH 2PNRC 2P5ZX 1MKHA 1VQPA 3EIVA 4M8AA 5I2YA 4QQBX 4NXNQ 2B2UA 1STGA 2L55A 3MEHA 1X32A 4TKOB 1FGUA 1D8LA 1HR0W 1OXUA 1PLFA 1TWHB 1SE4A 2VB3X 3WDNA 4NB3A 1RL2A 3W2DA 3AFPA 4OO1I 5JVG3 1N34Q 3OWEB 3A8IE 5C5LA 1CQFA 3K7AH 5M5YH 4JYAL 1IW7C 2XRQD 4G4KA 2RQXA 4C2MH 1I5FA 3ITPA 3H15A 1HCZA 5CV8A 1VQ4A 3VR5A 3S16H 1W3SA 4LUOA 2DY8A 2V4DA 2R6GA 5IGEA 1F2ZA 4LAAA 1UE1A 2F0QA 2LKVA 1X55A 2Z8LA 5J3BA 1M8AA 3E9IA 4LF9Q 2SEBD 5CORA 1FL0A 1BDOA 1UNSA 2WKCA 3I8ZA 4HCSA 3WWVA 3GP7A 2A19A 4X65Q 4WRDA 1DM0B 2RDHA 4ZQ3A 1S5BD 4G57A 1LM0A 2VNUD 1UEAB 4UP7A 1GUSA 1B3QA 1HJPA 4A3JG 5DAUA 1YJ9A 1EY5A 1I6VC 1PTOH 4A3DB 1TXYA 5ELFA 1SSOA 4JC0A 1IW7D 1RODA 3HOUH 3QR8A 3FPUB 4YIJA 4YWKA 4EQNA 1J5EL 1G6PA 4IFDG 3HOZB 1UWVA 3PIPA 5BN5A 1KTKA 3J7YW 3G48A 4DR6Q 1STEA 4DNIA 5C4HA 2RHQB 2K7VA 4GLVB 1CKNB 1VF5C 1XNRL 1IL2A 3J80E 2R7ZG 4RFBA 3MZ5A 3U4VA 3GV6A 4KKTA 5GAEC 4QUFA 4BY7H 3FKIH 1ZXTA 1M90C 1KRTA 2CKZB 3A5ZB 4K5XA 4NDXA 1AZPA 3MAQA 2RHSB 4P72A 5FO8B 4WFN3 1XMQL 3RZOB 1HNXQ 1VQ8A 3RLNA 1VS0A 1Q12A 4NXNL 2AWOA 1KIXA 4GOPB 5CYUA 1JE4A 3SEBA 1UAPA 3CPWA 1LTTD 3NTIA 4CDDC 4DAYB 1GUGA 1EWCA 4JK1C 5M3MH 2NVXH 3F2CA 4BBSH 2LFNA 1E7ZA 1I6HH 4RG1A 4K6DA 5IYCG 4O42A 3GDEA 1DOMA 1Z6HA 4C3JG 1W6JA 1B7YB 4RH6A 3N52A 3EQLC 3NTKA 1XXGA 3S2HB 2F3IA 3GTGB 1AZQA 4FXDA 4OIJA 2R92H 2DUDA 1B1ZA 2EOTA 4Y7NH 3PUVA 2WB1B 4BY1H 1K8AC 2MJ8A 5DEHA 3TMEA 4LF9L 2NWGA 4XT3B 1Y1VH 3D6CA 1KDAA 1NUCA 2AQ3B 2I0QA 4TVAB 3ZYYX 5IP9H 1E24A 4R4QA 3CAMA 1PH4A 2VZAA 3AFQA 1KAAA 1TWCB 3M4OH 4K0KL 1VQAA 3I56A 4B3TQ 3VA7A 1ESFA 1TS5A 5EKKA 1VQHA 5C0XJ 4JI6L 3TP5A 1S40A 1V1PB 2Z4IA 1A3UA 2QDLA 1G2SA 3J81L 1N36Q 1ZEQX 5D65A 3DXJC 2PI2E 1YZ6A 3J7A5 2NVQB 4IN3A 1K83H 1KHIA 3M9BA 3M4PA 3TN2A 3S17B 1G91A 1PA6A 4GS3A 5EAYA 3TP8A 2VS1A 2EYPA 2YYZA 1TQOA 2B2YC 5C4XG 2F0KA 4A3MH 3SK8A 1SNQA 5EKLA 4CKCA 4XTCS 3DMUA 3FPPA 4LWCA 1H9JA 3BVZA 2VUMH 2D5DA 2B2YA 3SDZA 2E2IH 1E22A 3CD6A 3Q24A 4FF2A 3A7AB 3HP3A 2H4OA 4LFBL 1TS3A 2Q8RE 3HOWG 3GTOB 1VQ9A 2I5HA 2QILA 4KHVA 1Y14B 4IOCA 3HOVB 3MC0B 1HNXL 1H9SA 1R4QB 2DNEA 2YV5A 4DK3C 2NVTH 2EYHA 4KD4A 2PMZB 3JC66 5COYA 2ZTDA 4KN7C 2HT1A 3PSIA 5IOCA 2MO1A 1C48A 1MJEA 2HUGA 3DWPA 4A3GH 2C35B 1KNEA 2IPKD 2PQAA 3D8GA 3VYRA 4PV1C 4F7XA 2ZXRA 1JORA 1WCMG 2IX1A 2F0TA 3GV3A 1NTGA 2L0CA 2F0WA 4NP5A 4C3JB 1WD1A 4JI7Q 1B9MA 1E2VA 1SR3A 2JA8B 2Q8TA 5IGFA 5NUCA 2TMPA 3RZDH 2OF1A 4R4CA 5C3EG 1QJOA 1M1KC 3PO3H 5C0XI 2E2JB 2I5LX 1T5XD 3D0FA 3MXPA 1W6KA 1BR9A 2RF4A 1P16A 3X3NA 3RNUA 1XPUA 2CW0C 1VQMA 4KLKA 3RLOA 4XYOA 1N32Q 5LMUQ 1FJGQ 5C4JH 4RCNA 1D5XC 4AIMA 3BDOA 2KECA 3BYTB 2X6LA 2NTTA 3NQTA 4HMIA 4B3TL 5EPKA 4R4TA 2FMCA 3PF5A 2NZHA 4DR4Q 4IPHA 1SMYC 2JN4A 3UE1A 5FK9C 1N36L 5CV9A 4N9PA 3IRBA 2EJFC 4BBRG 4XXEA 1CUKA 1YITA 5LMNW 4LFAL 3CHBD 1B44D 4KJOA 1UE6A 2SNSA 1K73C 3KK7A 3S24A 2F0SA 2NN6H 3JAML 2Q2TA 1LYLA 4Y52H 2JA7G 5E7NA 2MPMA 4DV4Q 3L0OA 3AU7A 4A3DH 5DNFA 3T16A 5IP7G 4YHHQ 1Z47A 3C2PA 2A69C 4OO1G 1TY0A 3NHHA 1ML0D 4A3FG 2KA7A 5IYDH 2WFWA 2KCNA 2N55A 3NBIA 4A93H 4RKBA 2H5XA 5M5WH 2KCMA 4PZ6A 3ICEA 2CW0D 3L9AX 4CDEC 2Z4HA 3J81i 3WOFA 2B63G 2L9HA 4CKEA 2HHHQ 4DA2A 3QB3A 1HH2P 1QE6A 1SMYD 2J7ZA 1QB5D 2VQFQ 3K7AB 3S14B 3Q22A 2MP1A 1L0WA 2WP8J 3G7LA 2PQEA 4GKJQ 3RZOH 5M3FG 1JICA 3IAYA 1E1TA 1X3EA 1ICFB 1VQEA 3C1FA 4XT1B 3RN2A 1LTID 4FXGC 3TS0A 5C44B 5D3DA 1PH8A 1IBMQ 3TDQA 4CDCC 1B53A 5KNBA 1NJIC 2A69D 1I4GA 1FGBD 3H3VI 2ALYB 3GTQB 1SNDA 2N8NA 3DWAA 2CWPA 4LK1C 3DM3A 3CCMA 4X3SA 5EBCA 3I4MB 2WAQG 3M4QA 1LTLA 1DXMA 1HHVA 2XRSD 3I2ZA 3S2HH 4A3KG 1PRTC 2K5QA 2J4XA 1HZBA 1KLGD 3GTGH 3HOYB 1CZWA 3A56A 2ZTEA 1EIHA 4ME5A 1JWMD 5GAHC 1Z9FA 4MTKA 1I4RA 4POFA 1N32L 4FDBA 2MUYA 3OSOA 5LMUL 1FJGL 4J15A 1PTOB 4LJZC 1CQVA 4K6LA 1F9QA 3HOUB 3OW7A 1JE5A 1PYWD 4BA1I 4J6HA 3MWYW 2EXDA 4YWMA 4M1UB 4DR4L 2M00A 1BCPB 1TWCH 1EYGA 1LUZA 2R3ZA 2F0EA 3PQIA 1SMXA 1H9KA 4GLAC 4MN3A 1GUOA 3G71A 5CV6A 4CDFC 4XQNA 4R1JA 3K5NA 1WTRA 4O0AA 4ZRZA 2F0LA 3CRKC 4RKLA 2BH8A 4DV4L 1WVLA 4ZUJA 3ER0A 2NVQH 1Y8NB 5CV4A 1IBKQ 1LACA 3QO2A 2D0PA 1XJVA 3S17H 1PRTD 1LTBD 4IFDH 1QOHA 4ZCKA 2O2LD 1J6QA 2VL6A 1FNUA 5G3LF 1EWHA 3EA6A 3TEHB 4LF8Q 1CTMA 2K28A 2NVXB 5IGGA 1SLJA 1J8IA 3PV0A 1K8OA 1I94Q 5A2QL 4RGTA 1I6HB 2B39A 1GKHA 3I7FA 1FVIA 1GM5A 3JAMi 1S72A 3J80c 3GTOH 2OTJA 4B3RQ 1SRUA 1EQVA 4A3LG 3CCSA 3HOVH 3CU7A 1ZKOA 1PH2A 2R92B 1TU2B 1N33L 2RVLA 2AKWB 1FYCA 4Y7NB 1EOTA 4H7BA 3K7UC 3G4SA 2G9DA 1KRSA 1UE7A 3ND9A 4BY1B 2Q8IB 3RUZA 5JEAH 3K6OA 4IUUA 1HUNA 5CBAE 2K5WA 1Y1VB 2I5MX 2NBFA 4ABNA 4DU9A 2K04A 1DJRD 2F0UA 5J39A 5IYCH 3PUXA 1LT6D 5FLMG 3T13A 3CCUA 2L15A 4C3JH 4ZK9B 2WACA 1HTPA 2FXQA 4CJ2C 2FMMA 4FP5D 2JA8H 3S9WA 3NBHA 5EBDA 3J7AV 4CKBA 2ES2A 2OTLA 4P74A 4LUZA 3CCRA 3SK4A 2E2JH 1KLUD 3I4NB 1A62A 5GQOA 2EQSA 2KUMA 4K2LA 1I4QA 3X3MA 3VDYA 3GTPH 2JP1A 1WTXA 3W1GA 1JR0D 2Y0SG 1RHPA 5LL6S 1Q82C 4PNYA 1QVFA 4AQYQ 5AJ3L 4ZUIA 4XQQA 3AQQA 4XYQA 2QA4A 3FVQA 2UXCQ 1D5ZC 2D2CC 2ID0A 1F9SA 3P75A 2VQEL 4A3MB 1PH9A 3V96A 5KYLA 3BVMA 3U50C 1TR5A 2DNCA 5EQ0A 4DAVA 4AYBG 1DOLA 1XWEA 1NMGA 2NZ1D 5LL6X 3SGIA 2Z1CA 4ODGA 2R93G 4A3BG 2D9UA 1SE8A 1EU3A 4JI1Q 5CMDA 4PQXA 1HRJA 5D14A 4NXMQ 2KVMA 1VQBA 2E75C 1U4RA 1VQ7A 2VXWA 4C56C 4CJ1B 1CKNA 1SYFA 2F1MA 1LTGD 4ZYSA 3CCJA 5KRUA 3PMFA 1TKWB 1G291 4HR7B 1F2LA 3MXNA 5C0XG 4LF8L 2KOLA 3KLSX 3KF8B 4RHRA 3DM1A 3BU2A 4MHEA 2F0PA 1CSQA 4GOPC 1A63A 2DGYA 3TREA 3VR2A 1EEFD 4JVZA 1JB7A 3H0GG 4B3RL 3D4DA 2EYJA 2XN9C 4MZ9A 4P71A 4HJ8A 3RZDB 3TS2A 2M2LA 4APVA 3PO3B 4DAYA 1C9OA 2ZJQA 2HQEA 3PUWA 4F88A 3S14H 1BXTA 1GHKA 1PZID 1MSHA 2CHBD 5C5MA 1SBBB 4ZAIA 3NK9A 2OXPA 2KHSA 2KEEA 1S5DD 2WINB 3A8KE 3EROA 1WCMH 4N8FA 4ZKBB 3OIPA 5C44H 5C4JB 1U4LA 5JJKA 1PDQA 2ATWA 1BKBA 3GTQH 4OWXB 1VQOA 4HIDA 3FDTA 4JI8Q 3VR3A 4HCEA 2EZVA 1HQMC 2K1BA 3I4MH 1MSGA 1GOZA 4ULLA 1HR0L 3UE0A 2JA6B 1Q3LA 3EVQA 3HOYH 2YTVA 5KGUA 5GADC 4AQYL 1GXDC 1SYDA 2XWJB 2IHFA 1AEXA 1QNKA 3V2TA 4CGYB 3C3LA 1LT5D 1JT8A 2UXCL 1PYSB 4FXKC 2A73B 4K5WA 3EFXD 1M4VA 1S4ZA 1V1PA 1W2BA 4UHVA 4A93B 3W1BA 1MD2D 3H3VC 5M5WB 5F2DA 2E76C 3IL8A 1ET9A 5EKIA 3G6EA 4IPCA 5KEEA 1YNNC 4JI1L 3EN2A 4DNRB 1I4PA 1WJJA 4DV3L 3L3OC 2EVBA 5ELCA 2ZXPA 4YWLA 3K57A 4KK7A 2RDGA 3K5LA 4N9TA 5IP7H 2HCIA 5IT9E 4EQOA 3NENA 4A3FH 1U4PA 1GUNA 4DV5Q 1VQGA 3SK5A 2KQ3A 4CHTB 2BCOA 3NWSA 1HPCA 3TP6A 4R8NA 1QZHA 2WAQE 1QUQA 3KF6B 1C7YA 2CFMA 1X3GA 2D62A 3D4RA 4ILWA 4HJ5A 4DV2Q 1F9RA 4RA8A 3CP0A 1CT1D 1HZCA 2GVAA 2F0FA 3QWNA 4X66Q 1X9NA 1N34L 3TRZA 4DAPA 2OQ0A 2QEXA 4H13C 3SR1A 3DEPA 3ONAB 1YNND 2BE5C 2A1AA 4QL5A 5M3FH 3VA5A 3PIOA 1SYBA 1RKNA 3OTOQ 3MFYA 3F1ZA 1D1KA 3K59A 5CGKA 2EXZA 5I6YA 3AYHB 1WI5A 1CHPD 1YI2A 4A3IG 3PUZA 4LF6Q 3TZDA
chains in the Genus database with same CATH topology
3NXWA 1AW7A 4KKSA 2QEJC 4IUPA 5CR3A 3OWFA 3K5OA 3BG3A 4B08A 1Y8OB 3E5SA 4FF4A 2QF7A 3A54A 1U9RA 2LY7A 4DN4M 3MA2B 2O5IC 4A3JB 2PPBC 3D31A 4ZKCB 2BE5D 2KCCA 1IYVA 2IW3A 2RA4A 5I2XA 2BA1A 1HFNA 1STAA 1Q1BA 3C46A 1CZGA 3LWUA 1PXUA 2PCFB 5ELDA 1SDFA 2R7ZB 3OMGA 1JOOA 2JXMB 4TRDA 1PZJD 2NB0A 4TQUS 2MGSA 1VCIA 1BQQT 4DXFA 4UDUC 1FD7D 4C3IG 2EE1A 1SEBD 2F0HA 1SYGA 3D4WA 1ONLA 2XWBB 3IKJA 3M4YA 1ZYRC 1H9RA 4PMWA 1O7LA 2PO4A 4B9XA 3MFGA 1SAPA 3D3RA 1KDBA 5IGDA 4KY5A 2L11A 1D1IA 1FNWA 5LHY1 1GUWA 4FVMA 1DOKA 4H44C 5C3XA 2N88A 1BO0A 3QOLA 3DUZA 2KJXA 4CBVA 1HA6A 1IKLA 2IJ0A 2EY5A 2A74C 3GTPB 3U9SA 4DK1A 1RCVD 2JE6I 3NP8A 1CK1A 2IX0A 5IGBA 1PTOC 2RKSA 1ZYRD 1EY6A 3A55A 3TSSA 1LT3D 1A2UA 3BZDB 1BCPC 5DM73 1EY7A 2O4XA 1EQTA 4OGQC 2HDLA 3K58A 3I70A 3MVVA 2X69A 2HCCA 4PMBA 1C8CA 2RSOA 5C4ZA 1T5EA 2JEAI 1LTSD 3P20A 5ISRA 2JA5B 5K36G 5C4XB 4UAIA 3H6MA 4WORA 1SJHD 2EDGA 2YU9B 2QCPX 2K03A 5JEAJ 1K8MA 1Y69U 4HMJA 5KIXA 1EY9A 3R2IA 2QKIC 1AFPA 1JOKA 4HSPA 1EZ6A 3HOWB 1R4PB 3J81E 2NYZD 3QIAA 2JYOA 2LS01 2OEOA 4KD3A 1BCPD 1H9SB 2JSOA 2E74C 1JQYD 3S1RB 1WTOA 1WCMB 3CKIB 4EQPA 3Q23A 1EY4A 2CQAA 4G7HC 2AUJD 1HXYD 1R9TB 1SNCA 5C3EB 1LABA 2XSCA 3P1HA 3PIP3 4F8MA 4QB4A 1JWSD 4KHZA 2ZXOA 1HFGA 4HN7A 1QWYA 1LLRD 1U4MA 1OXXK 3A7LA 5CV5A 4BBRB 3RMHA 1DCZA 3VYTA 2WKDA 3QJYA 1SE2A 1PRTF 1G6ZA 3U9OA 2JA7B 2NVYB 3PUYA 2EY2A 2XNAC 1EIGA 3ND8A 4A3FB 2IX3A 3V05A 1B2TA 1IKMA 1I4HA 5EPLA 2E2DC 2B63B 4R9WA 2A6EC 3I91A 1VMCA 5BN4A 1DYQA 2H1EA 3G6JB 1ENAA 3FMCA 1ILPA 3RLFA 3S1NB 2B2VC 5M3FB 2CVRA 3SK6A 4RHSA 2B2VA 3F2UA 2FINB 1NCVA 1A3VA 2PW7A 1ICWA 4QUCA 4DGZA 2AUKA 3OOCA 2WAQB 3DEOA 1EYDA 3CQZB 1QG7A 2F0VA 2A6ED 5T1IA 4A3KB 3KBGA 1EZ8A 1A6XA 2K01A 1STNA 1STBA 3MXUA 2ICIA 5FOBB 4IUTA 1L0YB 5EGTA 4QF4A 3J80L 2SOBA 1VF7A 1IYUA 3NQIA 3Q0AA 1G8ZD 2B8GA 5C6AA 4L8JA 3HG9A 2AWNA 2K33A 2JEBI 5E4WC 2AQ1B 5TSSA 3MHBA 3P7JA 3ERQA 1V43A 3GTJB 1GJXA 4KY6A 4KI0A 3K0YA 1CHQD 5JPMC 3S2DB 2ENBA 5ELBA 1JB3A 1E2ZA 1SNMA 3BYYB 3HEJA 5HGTA 1B3AA 4OIKA 3M85A 3HS0C 5JOBA 1I4XA 1CA6A 1XTCD 1LV9A 3RD4A 2A6HC 3GD7A 1SXTA 3VYUA 2I07B 1GHJA 5C3WA 1EYCA 2C9OA 3VR4A 1TWGB 3R2TA 4F87A 1TS4A 2EJGC 1TIID 1HUMA 1S5ED 2A5HA 3I4LA 2RDFA 2EYMA 5ELEA 4IZ8A 3NE5B 5KYIA 3SHLA 2EY1A 2SDFA 5A2QE 3OPOA 5IGCA 1V1OA 1VDZA 2RSNA 1UUPA 2MHVA 3T56B 2A6HD 1E2WA 1I50B 4EVOA 1STHA 4OHJA 2J0TD 4FYDA 5M5XB 5I9PA 3R8BA 5FLXE 1D2BA 2X6GA 2HDMA 2Y0SB 4DFAA 4EGVA 1EL0A 1EY0A 4OL7A 4KTAA 1ENCA 2XIWA 1RTOA 4KKUA 3I73A 3QOJA 3HRZC 1LTAD 3OHXC 4IURA 4AYBB 1LO5D 1PFBA 3EJIA 4S3SA 3M7GA 1S5FD 2F0GA 4Q5VA 4RGOS 2R93B 4A3BB 4NW2A 2BDNA 1X3PA 3I90A 2F0MA 5FO9B 1TWAB 4TSSA 4RWSC 4G7ZC 1BOSA 4OO1H 5K36H 4K14A 2B2WC 1VMPA 1Y8PB 1PFMA 4Z9CB 2K5DA 4G7OC 2B2WA 3H0GB 1S5CD 3MTSA 2K6AA 3H91A 1MGSA 4IUVA 4WJWA 4C3HG 1QILA 3M3YB 4ID6A 5FKAC 4MIUA 3FRPB 3WOEA 5JEAG 2PZUA 1II3A 3UI2A 1BNZA 2G9HD 1Q8IA 1SE3A 4RAUC 1SNOA 4K8JA 3BS1A 2NUCA 2F3WA 1C4QA 1ESRA 2FJ2A 4HAEA 1Q1EA 1IHZA 1O80A 4J1MA 4KV6A 5CC4A 1F2MA 4QMGA 2IWHA 1BF4A 1SNPA 5I6WA 1WTPA 1NR2A 1EEID 3SVMA 1J9OA 3N6RA 4X3TA 3KLRA 4DNTB 2XVSA 5BN3A 1RD9D 1AN8A 2PZTA 5JAVA 1MI2A 4IALA 1F2YA 1TT2A 3GTLB 1TWFB 3AMUA 1E0BA 4H0LC 2IL8A 4J8QA 1XYIA 4L63B 1SJED 2SNMA 1EY8A 5EJWA 2ICEC 2OT2A 2AQ2B 4IQZA 3K5MA 5CV7A 3TP7A 1STYA 1A3TA 5JVH3 3BVGA 3E0JA 4NKLA 4U68A 1MBYA 2A68C 3URYA 1KDCA 1OXSC 2F3VA 2EPBA 4CJ0B 1QNUA 4U673 4KMUC 2F0JA 2B2TC 1BUVT 2L5TA 1KABA 5HURA 1ENFA 2NN6I 1X3QA 5E1FA 2B2TA 4ZLTF 3H94A 3BDCA 5T1GA 1HTLD 1DONA 1L0XB 3SXHA 4C3HB 4FF3A 4QIWB 2BA0A 4K5VA 3QG1A 1IL8A 4IUNA 5FO7B 5K5PA 3W3AA 4V0BA 4K2KA 4KN4C 3NTHA 1CA5A 1EU4A 2A68D 4Q0FA 1EFID 1EYAA 4L6TB 4XIGS 1GUTA 4A3IB 2E2HB 1RF2D 1D6EC 2DY7A 3GQBA 4B9WA 1XX8A 4FF1A 4XDXA 3R93A 3D6WA 5I4DA 1RDPD 2K32A 2BDOA 4IFDJ 4JBWA 1DD2A 3GTKB 4HTHA 1O78A 3J7AF 1OXTA 1B50A 2NTSA 1G2TA 2TSSA 2R61A 1CM9A 4RCOA 2I46A 4RGNA 4GZYC 4PMCA 5D3IB 4LMQD 2GA4B 1LT4D 4DK0A 1HQRD 5AFWA 3LNNA 4FNFA 3PO2B 1PTOF 3HOXB 1HA5A 2F0OA 3TZUA 3GO5A 2F4IA 3S1MB 2L1BA 1BCPF 5M9OA 1PTOD 2RBMA 4O1NA 4V190 1B9NA 2L12A 4C3IB 1BBXC 1PZKD 5KNDA 5J22A 2L4NA 1TS2A 5C0XH 2QDBA 3NWTA 1JC7A 1ILQA 1WTWA 1Z7TA 4BS9A 4IFDI 5M5YB 3VR6A 1JOQA 4C2MB 4R8IA 1OO9B 2PYKA 3AB9A 3S16B 4K8IA 2K05A 4I65A 3VYSA 3L7ZC 1SFOB 4RGMA 4IUQA 1FR3A 2VB2X 5JPNC 4A3EB 1F9PA 4X3UA 1D5MC 2F0DA 5I9OA 2WV6D 1SYCA 3IFDA 5A35A 3DWQA 3T4AC 3CRLC 4E6IA 3GTMB 1Q90A 4DF7A 1WD0A 1NR4A 4NMZA 3T53B 5KNCA 3HGBA 4BWGB 1JWUD 3BDLA 4C1NK 1NAPA 4KJNA 2PW5A 2M9VA 1SYEA 2O5JC 1RJTA 3C1EA 1QCBD 2ZT9C 1WTQA 1FNVA 4BY7B 3TBIB 3FKIB 2EYOA 1O7ZA 1YNJC 3PIO3 3OMCA 2EY6A 2F0NA 5JJZA 1AP0A 3JAME 2FHTA 4C1NI 3KF8A 4I7ZC 4FO2A 5M3MB 1WTVA 3IFTA 4HEDA 4BBSB 2F03A 4QCLA 5G3LD 5E4XA 1JCKB 1LTRD 4X3KA 4HSVA 1B4OA 1CFMA 3T51B 5EPJA 1H9MA 3KBXA 5IIFA 5FLXL 2PZWA 3KLSA 3KUPA 3LWEA 1NSNS 1YNJD 3FEWX 5E3FA 3I72A 1I3QB 5IODA 1Y1WB 2WIIB 4BA2I 1DZ1A 3DHQA 3HZXA 3M4OB 3MXGA 3Q6SA 1RTNA 1PRTB 2LMCB 3NSWA 1F77A 2EYLA 3R3OA 2C5CA 1KNAA 3NUCA 3HKZB 1K83B 4XQJA 3NPPA 2NN6G 2B8FA 2EJMA 1A2TA 4P2CB 5IT9L 3I3CA 4DXGA 1CI3M 3A8JE 3E6ZX 1ET6A 5J1ZA 1TY2A 1TVXA 3S15B 2IT1A 3OIQA 3SE0A 2EYFA 2VUMB 2E2IB 1O7YA 2BOSA 3O13A 2KEDA 3LX0A 4KY7A 1A15A 2F0IA 5CBEE 1PFNA 2NVTB 2DN8A 2FFKB 5DM63 3S1QB 1PMRA 2B2UC 1V8QA 4A3GB 3M7NA 1OXVA 3H09A 2PNRC 4M8AA 5I2YA 2B2UA 1STGA 2L55A 3MEHA 1X32A 4TKOB 1OXUA 1PLFA 1TWHB 1SE4A 2VB3X 3WDNA 3W2DA 4OO1I 5JVG3 3OWEB 3A8IE 5C5LA 1CQFA 1IW7C 2XRQD 4G4KA 2RQXA 3ITPA 1HCZA 5CV8A 3VR5A 2DY8A 2V4DA 2R6GA 5IGEA 1F2ZA 4LAAA 2F0QA 2LKVA 2Z8LA 1M8AA 2SEBD 5CORA 1BDOA 1UNSA 2WKCA 3I8ZA 4HCSA 3GP7A 4WRDA 1DM0B 2RDHA 4ZQ3A 1S5BD 4G57A 2VNUD 1UEAB 1GUSA 5DAUA 1EY5A 1I6VC 1PTOH 4A3DB 5ELFA 1SSOA 1IW7D 1RODA 4YIJA 3FPUB 4EQNA 4IFDG 3HOZB 5BN5A 1KTKA 3J7YW 1STEA 5C4HA 2K7VA 1VF5C 3J80E 4RFBA 3MZ5A 3GV6A 4KKTA 4QUFA 1ZXTA 4K5XA 4NDXA 1AZPA 3MAQA 5FO8B 4WFN3 3RZOB 1Q12A 2AWOA 5CYUA 1JE4A 3SEBA 1UAPA 1LTTD 3NTIA 1GUGA 1EWCA 4JK1C 2LFNA 4K6DA 4O42A 1DOMA 1Z6HA 4C3JG 1W6JA 4RH6A 3N52A 3EQLC 3NTKA 1XXGA 3S2HB 3GTGB 1AZQA 4FXDA 4OIJA 1B1ZA 2EOTA 3PUVA 2WB1B 2MJ8A 5DEHA 3TMEA 2NWGA 4XT3B 3D6CA 1KDAA 1NUCA 2AQ3B 3ZYYX 1KAAA 1TWCB 3VA7A 1ESFA 1TS5A 5EKKA 5C0XJ 3TP5A 1V1PB 2Z4IA 1A3UA 1G2SA 3J81L 1ZEQX 5D65A 3DXJC 2NVQB 4IN3A 3TN2A 3S17B 1G91A 3TP8A 2EYPA 2YYZA 1TQOA 2B2YC 2F0KA 3SK8A 1SNQA 5EKLA 4CKCA 4XTCS 3DMUA 3FPPA 1H9JA 3BVZA 2D5DA 2B2YA 3SDZA 3Q24A 4FF2A 3A7AB 3HP3A 2H4OA 1TS3A 2Q8RE 3GTOB 2QILA 4KHVA 3HOVB 3MC0B 1H9SA 1R4QB 2DNEA 2EYHA 4KD4A 2PMZB 5COYA 4KN7C 5IOCA 1C48A 2HUGA 3DWPA 1KNEA 2IPKD 3D8GA 3VYRA 4PV1C 4F7XA 2ZXRA 1JORA 2IX1A 2F0TA 3GV3A 2L0CA 2F0WA 4NP5A 4C3JB 1WD1A 1B9MA 1E2VA 2JA8B 2Q8TA 5IGFA 5NUCA 2TMPA 2OF1A 1QJOA 5C0XI 2E2JB 1T5XD 3MXPA 1W6KA 1BR9A 3X3NA 2CW0C 4XYOA 4RCNA 1D5XC 3BDOA 2KECA 3BYTB 2X6LA 2NTTA 3NQTA 4HMIA 5EPKA 2FMCA 1SMYC 5FK9C 5CV9A 4N9PA 2EJFC 4XXEA 3CHBD 1B44D 4KJOA 2SNSA 3KK7A 2F0SA 2NN6H 3JAML 2MPMA 3AU7A 5DNFA 3T16A 1Z47A 3C2PA 2A69C 4OO1G 1TY0A 3NHHA 1ML0D 2KA7A 2KCNA 2N55A 3NBIA 4RKBA 2CW0D 3L9AX 2Z4HA 3WOFA 2L9HA 4CKEA 4DA2A 3QB3A 1QE6A 1SMYD 2J7ZA 1QB5D 3K7AB 3S14B 3Q22A 2MP1A 2WP8J 3G7LA 2PQEA 1JICA 3IAYA 3C1FA 4XT1B 1LTID 4FXGC 5C44B 5D3DA 3TDQA 5KNBA 1B53A 2A69D 1I4GA 1FGBD 3GTQB 1SNDA 3DWAA 4LK1C 4X3SA 5EBCA 3I4MB 1DXMA 1HHVA 2XRSD 1PRTC 2K5QA 2J4XA 1KLGD 3HOYB 1CZWA 3A56A 1EIHA 4ME5A 1JWMD 1I4RA 2MUYA 3OSOA 4LJZC 1PTOB 1CQVA 4K6LA 1F9QA 3HOUB 3OW7A 1PYWD 4BA1I 4J6HA 3MWYW 4M1UB 2M00A 1BCPB 2R3ZA 2F0EA 1H9KA 4MN3A 1GUOA 5CV6A 4XQNA 3K5NA 1WTRA 4ZRZA 2F0LA 3CRKC 4RKLA 1WVLA 4ZUJA 1Y8NB 5CV4A 1LACA 3QO2A 1PRTD 1LTBD 4IFDH 1QOHA 2O2LD 1FNUA 5G3LF 1EWHA 3EA6A 1CTMA 2K28A 2NVXB 5IGGA 1J8IA 3PV0A 1K8OA 5A2QL 4RGTA 1I6HB 2B39A 1EQVA 3CU7A 1ZKOA 2R92B 1TU2B 2RVLA 1FYCA 4Y7NB 1EOTA 4H7BA 2G9DA 3ND9A 4BY1B 2Q8IB 3RUZA 5JEAH 3K6OA 4IUUA 1HUNA 5CBAE 2K5WA 1Y1VB 2NBFA 4ABNA 4DU9A 2K04A 1DJRD 2F0UA 5J39A 3PUXA 1LT6D 3T13A 4ZK9B 2WACA 1HTPA 4CJ2C 2FMMA 4FP5D 3S9WA 3NBHA 5EBDA 3J7AV 4CKBA 3SK4A 1KLUD 3I4NB 2KUMA 4K2LA 1I4QA 3X3MA 2JP1A 1WTXA 1JR0D 1RHPA 5LL6S 4PNYA 4ZUIA 4XQQA 4XYQA 3FVQA 1D5ZC 2D2CC 2ID0A 1F9SA 3P75A 4A3MB 3V96A 5KYLA 3BVMA 1TR5A 2DNCA 5EQ0A 4DAVA 1DOLA 1XWEA 2NZ1D 5LL6X 2Z1CA 4ODGA 2D9UA 1EU3A 5CMDA 4PQXA 1HRJA 5D14A 2KVMA 2E75C 1U4RA 2VXWA 4C56C 4CJ1B 1SYFA 2F1MA 1LTGD 4ZYSA 5KRUA 3PMFA 1TKWB 1G291 4HR7B 1F2LA 3MXNA 5C0XG 2KOLA 3KLSX 4RHRA 3DM1A 4MHEA 2F0PA 3VR2A 1EEFD 3D4DA 2EYJA 2XN9C 3RZDB 2M2LA 3PO3B 4DAYA 2HQEA 3PUWA 4F88A 1BXTA 1GHKA 1PZID 1MSHA 2CHBD 5C5MA 1SBBB 4ZAIA 3NK9A 2OXPA 2KHSA 2KEEA 1S5DD 2WINB 3A8KE 3EROA 4ZKBB 3OIPA 5C4JB 1U4LA 1PDQA 3FDTA 3VR3A 4HCEA 2EZVA 1HQMC 2K1BA 1MSGA 1GOZA 4ULLA 2JA6B 1Q3LA 3EVQA 5KGUA 1GXDC 1SYDA 2XWJB 1AEXA 1QNKA 3V2TA 4CGYB 3C3LA 1LT5D 4FXKC 2A73B 4K5WA 3EFXD 1M4VA 1S4ZA 1V1PA 4A93B 1MD2D 3H3VC 5M5WB 5F2DA 2E76C 3IL8A 1ET9A 5EKIA 5KEEA 1YNNC 4DNRB 1I4PA 3L3OC 2EVBA 5ELCA 2ZXPA 3K57A 4KK7A 2RDGA 3K5LA 4N9TA 2HCIA 5IT9E 4EQOA 1U4PA 1GUNA 3SK5A 2KQ3A 4CHTB 2BCOA 3NWSA 1HPCA 3TP6A 4R8NA 2D62A 4ILWA 3D4RA 1F9RA 4RA8A 1CT1D 2F0FA 3QWNA 4DAPA 4H13C 3SR1A 3DEPA 3ONAB 1YNND 2BE5C 3VA5A 1SYBA 1RKNA 3MFYA 1D1KA 3K59A 5CGKA 2EXZA 5I6YA 1CHPD 3PUZA 3TZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY5 A;  1A3V A;  5E1F A;  1SNC A;  2EY6 A;  2M00 A;  2F0N A;  2PW7 A;  3LX0 A;  4KY7 A;  4IZ8 A;  4DGZ A;  5C4H A;  5J22 A;  3BDC A;  3NXW A;  2F0I A;  3P1H A;  4PNY A;  4ID6 A;  2F0E A;  5CR3 A;  3OWF A;  4KJO A;  3SHL A;  3TP8 A;  4ZUI A;  2QDB A;  2EYP A;  3EVQ A;  2SNS A;  4QB4 A;  4F8M A;  4MIU A;  3MZ5 A;  1EYD A;  1TQO A;  2F0S A;  3NP8 A;  5CV6 A;  3SXH A;  5KGU A;  2F0K A;  3E5S A;  1SYD A;  2EY1 A;  2PZU A;  1II3 A;  3SK8 A;  2RKS A;  5IGB A;  3P75 A;  1U9R A;  4K5V A;  1SNQ A;  2F0V A;  1AEX A;  5EKL A;  1EY6 A;  2F0L A;  3T16 A;  3V2T A;  4RKL A;  1A2U A;  4IUN A;  5IGC A;  1SNO A;  5K5P A;  3DMU A;  3NHH A;  5KYL A;  1TR5 A;  4K2K A;  4K5X A;  4NDX A;  4ZUJ A;  4K8J A;  2NUC A;  1EZ8 A;  4K5W A;  1JOQ A;  2F3W A;  1STN A;  2PYK A;  4RKB A;  1EYA A;  5CV4 A;  1STB A;  1EY7 A;  1IHZ A;  1STG A;  4J1M A;  4EVO A;  4KV6 A;  2O4X A;  5CC4 A;  3MEH A;  4KHV A;  5F2D A;  1F2M A;  4K8I A;  1STH A;  4ODG A;  4QMG A;  2EYH A;  3MVV A;  1SNP A;  4I65 A;  4KD4 A;  5CV5 A;  4B9W A;  5EGT A;  5I6W A;  5I9P A;  4QF4 A;  4PMB A;  5KEE A;  1STA A;  2SOB A;  5IOC A;  5IIF A;  1SYF A;  2PZW A;  5C4Z A;  3QB3 A;  4DFA A;  2PZT A;  5KRU A;  3OMG A;  1NSN S;  1JOO A;  4HTH A;  3PMF A;  5ISR A;  3D8G A;  5IGG A;  5JAV A;  4TRD A;  5E3F A;  5C5L A;  5C6A A;  4IAL A;  1EY0 A;  4F7X A;  4K6D A;  4OL7 A;  3U9O A;  2F0D A;  1ENC A;  3H6M A;  4KTA A;  4WOR A;  5I9O A;  3ITP A;  5IOD A;  1SYC A;  1JOR A;  2PQE A;  5CV8 A;  1F2Y A;  4N9T A;  2F0T A;  3QOJ A;  3DHQ A;  1TT2 A;  2EY2 A;  3HZX A;  4EQO A;  2F0P A;  3MHB A;  4E6I A;  1EQV A;  3C1F A;  3ERQ A;  4HMJ A;  4PMC A;  3SK5 A;  2KQ3 A;  5KIX A;  5IGE A;  1EY9 A;  1F2Z A;  2F0W A;  4NP5 A;  3EJI A;  4LAA A;  4S3S A;  3TP6 A;  4DF7 A;  2SNM A;  2F0Q A;  4R8N A;  1EY8 A;  1JOK A;  1EZ6 A;  2F0G A;  2LKV A;  2EYJ A;  3D4D A;  4KY6 A;  5IGF A;  5NUC A;  2F0H A;  1SYG A;  5CV7 A;  3D4W A;  4NMZ A;  3TP7 A;  1STY A;  2EYL A;  3R3O A;  4H7B A;  2OF1 A;  2OEO A;  5DEH A;  1A3T A;  1SND A;  3BDL A;  3TME A;  2ENB A;  2HQE A;  2F0F A;  3NUC A;  4KD3 A;  3RUZ A;  4B9X A;  1SNM A;  2F0M A;  3HEJ A;  4KJN A;  5HGT A;  2PW5 A;  3D6C A;  3MXP A;  1KDA A;  1NUC A;  4NKL A;  5C5M A;  5JOB A;  3NK9 A;  1ENA A;  1KDB A;  1SYE A;  1KAA A;  2OXP A;  4DU9 A;  2KHS A;  5IGD A;  2F0U A;  4WRD A;  4K14 A;  3SR1 A;  1A2T A;  4KY5 A;  5J39 A;  1KDC A;  2F0O A;  3C1E A;  4ZQ3 A;  4G57 A;  3ERO A;  2F3V A;  3T13 A;  2WAC A;  3VA5 A;  4ME5 A;  5M9O A;  5C3W A;  1EYC A;  1SYB A;  1RKN A;  5EKK A;  3S9W A;  5DAU A;  2F0J A;  2RBM A;  4HMI A;  3NQT A;  3TP5 A;  5C3X A;  5J1Z A;  2EXZ A;  1EY5 A;  4EQP A;  5CGK A;  3OSO A;  3SK6 A;  1A3U A;  5I6Y A;  3QOL A;  1EY4 A;  2EYO A;  3SK4 A;  1KAB A;  2EYF A;  5HUR A;  4YIJ A;  4EQN A;  3OMC A;  5KYI A;  2RDF A;  2EYM A;  4K2L A;  4J6H A;  5CV9 A;  4N9P A; 
#chains in the Genus database with same CATH topology
 4MTN A;  1UE5 A;  3NXW A;  5HY6 A;  1AW7 A;  4KKS A;  2QEJ C;  4IUP A;  2K4K A;  5CR3 A;  3OWF A;  3K5O A;  3BG3 A;  4X65 L;  1YJN A;  4B08 A;  1Y8O B;  3E5S A;  4FF4 A;  2QF7 A;  3A54 A;  1U9R A;  2LY7 A;  4DN4 M;  3MA2 B;  2O5I C;  3I4N H;  4JI2 Q;  2BH2 A;  4A3J B;  2PPB C;  3D31 A;  2Z0S A;  4ZKC B;  1HZ9 A;  2BE5 D;  2KCC A;  4YCW A;  1IYV A;  1NMF A;  2IW3 A;  2RA4 A;  5I2X A;  4DR6 L;  2BA1 A;  1YHB A;  2JA5 G;  1HFN A;  1STA A;  1Q1B A;  3PO2 G;  3C46 A;  4A3C H;  1CZG A;  3LWU A;  1PXU A;  2PCF B;  5ELD A;  1SDF A;  3RN5 A;  2R7Z B;  3OMG A;  1JOO A;  5IYB G;  2OCE A;  2JXM B;  3PCO B;  4TRD A;  1PZJ D;  3HOX G;  1PHJ A;  2NB0 A;  1KL9 A;  4TQU S;  2MGS A;  1VCI A;  2CCZ A;  1BQQ T;  4DXF A;  4GLX A;  1QVC A;  3KDF B;  4GN3 B;  4UDU C;  1FD7 D;  4C3I G;  2ZTC A;  2EE1 A;  1MHW C;  1SEB D;  1YBY A;  3T1H Q;  1JJG A;  2F0H A;  1SYG A;  1IBL Q;  3D4W A;  1JMC A;  1ONL A;  2XWB B;  4HJ7 A;  3IKJ A;  3K8A A;  2UUB Q;  1G51 A;  3M4Y A;  1YJW A;  1ZYR C;  4X64 Q;  1H9R A;  4PMW A;  1HNW Q;  1O7L A;  1WFQ A;  5LMN Q;  2PO4 A;  4B9X A;  3MFG A;  1V1Q A;  4DV2 L;  1SAP A;  4JG2 A;  3D3R A;  2K14 A;  1KDB A;  5IGD A;  4X66 L;  4KY5 A;  4GN4 B;  2L11 A;  1D1I A;  2RCF A;  1FNW A;  5LHY 1;  1GUW A;  4KHP Q;  4FVM A;  1DGS A;  1DOK A;  4H44 C;  4A3L H;  5C3X A;  2Y0S E;  2N88 A;  1BO0 A;  3QOL A;  3DUZ A;  2KJX A;  2JA9 A;  4CBV A;  1L1O C;  1HA6 A;  1IKL A;  2IJ0 A;  2EY5 A;  2R7F A;  2ZM6 Q;  3K0X A;  1WOC A;  4HIO A;  2A74 C;  4A3E G;  4LF6 L;  3GTP B;  3U9S A;  1VQC A;  4DK1 A;  1YHQ A;  4LF4 Q;  4AYB E;  1Q7Y C;  1RCV D;  1L1O A;  2JE6 I;  3NP8 A;  5JJL A;  2N78 A;  1CK1 A;  2IX0 A;  5IGB A;  1PTO C;  2RKS A;  1ZYR D;  3A5U A;  3HFZ B;  1EY6 A;  3A55 A;  3TSS A;  3MEF A;  1LT3 D;  1A2U A;  4O2D A;  3LGJ A;  1NBW A;  5FJ8 G;  1P8L A;  3BZD B;  1PH1 A;  1BCP C;  5DM7 3;  1EY7 A;  4JI2 L;  2O4X A;  1EQT A;  4OGQ C;  2HDL A;  3K58 A;  2JA6 H;  3I70 A;  3MVV A;  1N8R C;  2X69 A;  2HCC A;  1EOV A;  2YTX A;  4PMB A;  1C8C A;  2RSO A;  1PH7 A;  2D0O A;  5C4Z A;  1T5E A;  2JEA I;  1LTS D;  3P20 A;  5ISR A;  2JA5 B;  5K36 G;  5C4X B;  4UAI A;  3H6M A;  4WOR A;  2KHI A;  1SJH D;  2EDG A;  2YU9 B;  2QCP X;  2K03 A;  5JEA J;  4BY7 G;  1K8M A;  3FKI G;  1Y69 U;  4HMJ A;  1K3B C;  2EIF A;  5KIX A;  4BXX H;  1EY9 A;  3R2I A;  2QKI C;  1AFP A;  1JOK A;  4HSP A;  1EZ6 A;  3HOW B;  1R4P B;  3J81 E;  2NYZ D;  3QIA A;  4OEM B;  2R93 H;  2JYO A;  4A3B H;  2LS0 1;  2OEO A;  1CKO A;  4JI4 Q;  3CPF A;  4KD3 A;  1BCP D;  1H9S B;  2JSO A;  5LMN L;  2E74 C;  1JQY D;  3S1R B;  5M3M G;  4IO9 A;  1WTO A;  2PQA B;  4BBS G;  1VQI A;  1WCM B;  3CKI B;  4GNX C;  2VW9 A;  4KHP L;  4EQP A;  2Z6B A;  3Q23 A;  4MNO A;  4JI7 L;  1EY4 A;  3UDF A;  2CQA A;  4G7H C;  3F2B A;  2AUJ D;  4DR2 Q;  1ASY A;  2K50 A;  4GNX A;  1HXY D;  1R9T B;  1SNC A;  5C3E B;  3UDX A;  1LAB A;  1YIJ A;  1KAW A;  4A75 A;  2XSC A;  3P1H A;  2ZM6 L;  3PIP 3;  4F8M A;  4GKK Q;  4QB4 A;  1JWS D;  4L5Q A;  4LF4 L;  4HJA A;  1Y1W G;  4JOI C;  4KHZ A;  2MNA A;  2K5N A;  2VY3 A;  2ZXO A;  1HFG A;  4HN7 A;  1QWY A;  4JOI A;  3J81 j;  4JI3 Q;  4QJF A;  1LLR D;  1U4M A;  1OXX K;  3A7L A;  5CV5 A;  4BBR B;  3RMH A;  1U0L A;  1DCZ A;  3VYT A;  3CF5 A;  2WKD A;  3HKZ G;  3QJY A;  4R4I A;  1SE2 A;  2KCT A;  1PRT F;  1G6Z A;  4LUV A;  3U9O A;  2UU9 Q;  2JA7 B;  1A0I A;  2NVY B;  4YHH L;  4A3J H;  4P75 A;  3PUY A;  1TWF H;  2EY2 A;  4I7A A;  5FLX c;  2XNA C;  1EIG A;  3ND8 A;  4A3F B;  2LXK A;  1PYB A;  1OTC A;  2IX3 A;  2VUM G;  3V05 A;  4B3M Q;  1B2T A;  1IKM A;  4QIW E;  2UXB Q;  1I4H A;  5EPL A;  2CH4 A;  2E2D C;  2R7Z H;  3STB C;  2B63 B;  4R9W A;  1CSP A;  2A6E C;  3I91 A;  2HHH L;  1VMC A;  4JI4 L;  5BN4 A;  1DYQ A;  4IJH A;  2H1E A;  2VQF L;  3G6J B;  1ENA A;  4PZ7 A;  2F4V Q;  3H3V H;  3FMC A;  1ILP A;  4A3G G;  1WTH A;  3RLF A;  4GKJ L;  3S1N B;  4JI5 Q;  2B2V C;  5M3F B;  4L5S A;  2CVR A;  3SK6 A;  3F2D A;  4DK6 C;  4RHS A;  1IBM L;  2V1C C;  4EQ5 A;  5IT9 c;  2B2V A;  2YTY A;  3F2U A;  2FIN B;  1AH9 A;  1NCV A;  3KLW A;  1A3V A;  2PW7 A;  1EUJ A;  1ICW A;  4DR2 L;  4QUC A;  4DGZ A;  4RMF A;  2AUK A;  3OOC A;  1K0R A;  2WAQ B;  2KHJ A;  1EYD A;  3DEO A;  3CQZ B;  4GKK L;  1QG7 A;  4JYA Q;  3STB D;  2F0V A;  2E8G A;  2A6E D;  5T1I A;  4A3K B;  4UY8 C;  3KBG A;  1JJ2 A;  2HD3 A;  1EZ8 A;  1A6X A;  2K01 A;  1STN A;  1STB A;  4OWT B;  3MXU A;  4A3I H;  2ICI A;  5FOB B;  1PH3 A;  4JI3 L;  4IUT A;  1L0Y B;  2KBN A;  3CCV A;  4DR7 Q;  5EGT A;  4QF4 A;  3J80 L;  2SOB A;  1BVS A;  1VF7 A;  1IYU A;  3GTK H;  3NQI A;  4IOA A;  3Q0A A;  1G8Z D;  3E0E A;  2B8G A;  5C6A A;  1T9H A;  4L8J A;  4H02 A;  3HG9 A;  2AWN A;  4L5T A;  2K33 A;  2JEB I;  5E4W C;  2AQ1 B;  5TSS A;  1VQ5 A;  2QGQ A;  3MHB A;  3P7J A;  3ERQ A;  1UEB A;  4A3D G;  1IBK L;  1GVP A;  1V43 A;  3GTJ B;  1GJX A;  4KY6 A;  3KJP A;  1B8A A;  4KI0 A;  2N3S A;  3K0Y A;  3HOZ G;  1HNZ Q;  2JQO A;  1CHQ D;  5JPM C;  4B3M L;  1EIF A;  2UXB L;  2JA5 H;  3S2D B;  2ENB A;  5ELB A;  1SRO A;  1JB3 A;  1E2Z A;  1SNM A;  5C4X H;  3BYY B;  3HEJ A;  1IZ6 A;  5HGT A;  3FP9 A;  1B3A A;  4OIK A;  3M85 A;  4LF5 Q;  3HS0 C;  5JOB A;  1I4X A;  2YU9 H;  5IYB H;  1CA6 A;  1XTC D;  1I94 L;  1LV9 A;  3RD4 A;  3HOX H;  1ASZ A;  2A6H C;  4B3S Q;  3GD7 A;  2F4V L;  1XNQ Q;  1SXT A;  2AHO B;  3VYU A;  2MO0 A;  2I07 B;  1GHJ A;  5C3W A;  3HOW H;  1EYC A;  2C9O A;  1TWG B;  3VR4 A;  1WYD A;  3R2T A;  4F87 A;  1TS4 A;  4JV5 Q;  2EJG C;  1U5K A;  4GOP A;  1XMQ Q;  1TII D;  3A0J A;  1HUM A;  4PZ8 A;  3KF6 A;  1S5E D;  2A5H A;  3I4L A;  1YVC A;  2RDF A;  2EYM A;  1KQS A;  4DV0 Q;  4LFC Q;  4UP9 A;  5ELE A;  1SN8 A;  2XTI A;  2A8V A;  4IZ8 A;  2RCN A;  3S1R H;  3NE5 B;  5KYI A;  3SHL A;  5JJI A;  4WJ3 M;  1EIY B;  2EY1 A;  2SDF A;  4JCV E;  5A2Q E;  4UP8 A;  3OPO A;  3CCL A;  5IGC A;  3E9H A;  1V1O A;  4LNQ A;  1VDZ A;  2OQK A;  1PH6 A;  2RSN A;  1CKM A;  1UUP A;  2MHV A;  3T56 B;  2A6H D;  3UDG A;  1R9T H;  5C3E H;  1E2W A;  1I50 B;  2HIX A;  4EVO A;  1STH A;  3NBH B;  4OHJ A;  2WB1 G;  2J0T D;  1SFO H;  4FYD A;  5M5X B;  1KC8 C;  5I9P A;  3R8B A;  5FLX E;  1D2B A;  2X6G A;  4A3E H;  4DR7 L;  5GRO A;  3U4Z A;  2HDM A;  2Y0S B;  4DFA A;  4P73 A;  4EGV A;  1EL0 A;  1EY0 A;  5IWA Q;  4OL7 A;  4KTA A;  1ENC A;  2XIW A;  1RTO A;  4KKU A;  4K0K Q;  3I73 A;  3QOJ A;  3HRZ C;  1X3F A;  1LTA D;  3GTM H;  5FJ8 H;  3OHX C;  4JI6 Q;  4IUR A;  4AYB B;  1LO5 D;  1PFB A;  3EJI A;  4S3S A;  3M7G A;  1S5F D;  2F0G A;  4Q5V A;  2K52 A;  4BBR H;  1X65 A;  4X6A H;  4JBM A;  2HQL A;  4RGO S;  2R93 B;  4NXM L;  4A3B B;  4DR3 Q;  4NW2 A;  2BDN A;  1HNZ L;  1X3P A;  3BZK A;  3A74 A;  4LW1 A;  3I90 A;  3NEM A;  2F0M A;  2K5V A;  1TWA B;  4NPS A;  4TSS A;  5FO9 B;  2JA7 H;  2NVY H;  4RWS C;  3J80 i;  4G7Z C;  3CC2 A;  1VQD A;  5HGQ A;  1BOS A;  4OO1 H;  5K36 H;  4LF5 L;  4K14 A;  2B2W C;  1VMP A;  3CXC A;  3KJO A;  4B3S L;  3MXN B;  1Y8P B;  1PFM A;  1Q8K A;  4Z9C B;  2K5D A;  1XNQ L;  3KDF A;  4G7O C;  5BR8 Q;  2B2W A;  3H0G B;  1S5C D;  4LFB Q;  2B63 H;  3HOV G;  4JV5 L;  1V9P A;  3MTS A;  2K6A A;  3H91 A;  1MGS A;  4IUV A;  4JBK A;  4WJW A;  4C3H G;  4LFC L;  4DV0 L;  1QIL A;  3J81 c;  1BBW A;  3M3Y B;  4ID6 A;  5FKA C;  4OEL B;  3S1N H;  4HIM A;  4MIU A;  3FRP B;  3WOE A;  5JEA G;  4DAM A;  2UUA Q;  1Q86 C;  2UUC Q;  1NY4 A;  2PZU A;  1II3 A;  1N9W A;  4IPG A;  4YY3 Q;  3UI2 A;  1RIP A;  1BNZ A;  2G9H D;  1Q8I A;  1SE3 A;  4YCV A;  4LF7 Q;  4RAU C;  1SNO A;  4DV6 Q;  3BZC A;  4K8J A;  3BS1 A;  2NUC A;  4EX5 A;  1YNX A;  2F3W A;  3HKZ E;  1C4Q A;  3TQY A;  1ESR A;  2FJ2 A;  4HAE A;  1Q1E A;  4JI8 L;  1IHZ A;  4DUY Q;  2JA8 G;  1O80 A;  1O7I A;  4J1M A;  4KV6 A;  5CC4 A;  1F2M A;  4QMG A;  2IWH A;  3ULP A;  1BF4 A;  1SNP A;  3HKS A;  5I6W A;  2JK8 A;  3CQZ H;  1WTP A;  2KEN A;  1NR2 A;  1E3P A;  1EEI D;  3SVM A;  1J9O A;  3N6R A;  4X3T A;  3KLR A;  4DNT B;  1NNX A;  2XVS A;  5BN3 A;  4X62 Q;  1RD9 D;  1AN8 A;  2PZT A;  4A3K H;  5JAV A;  4OWW B;  1MI2 A;  4IAL A;  1I3Q H;  1Y1W H;  1F2Y A;  5IWA L;  1TT2 A;  3GTL B;  1TWF B;  2NZO A;  3AMU A;  1VQJ A;  1E0B A;  1PFS A;  4H0L C;  1VQ6 A;  2CWA A;  3I4O A;  2IL8 A;  4J8Q A;  1XYI A;  4L63 B;  1SJE D;  5GAG C;  2SNM A;  5IY0 A;  1EQQ A;  1EY8 A;  5EJW A;  2ICE C;  2OT2 A;  2AQ2 B;  4IQZ A;  1K8G A;  3K5M A;  1D7Q A;  1QVG A;  5CV7 A;  3TP7 A;  1STY A;  1YHA A;  2ZJR A;  3CME A;  1A3T A;  5JVH 3;  4DR3 L;  3BVG A;  4DR5 Q;  3E0J A;  4LFA Q;  4NKL A;  4U68 A;  1MBY A;  2A68 C;  2CQO A;  3URY A;  1KDC A;  1OXS C;  2MQH A;  2F3V A;  1GO3 E;  4YCU A;  1H95 A;  3GTJ H;  4DUZ Q;  2EPB A;  4CJ0 B;  4DV5 L;  1QNU A;  4U67 3;  4KMU C;  2F0J A;  2MFI A;  3S15 H;  2B2T C;  1BUV T;  3J7Z C;  2L5T A;  1KAB A;  3S2D H;  5HUR A;  1Q46 A;  1ENF A;  5BR8 L;  4JI0 Q;  2NN6 I;  1X3Q A;  5E1F A;  2B2T A;  1QUQ B;  4ZLT F;  3H94 A;  3BDC A;  5T1G A;  1MJC A;  1YEZ A;  1HTL D;  1L2F A;  1DON A;  5L37 A;  1L0X B;  3S1Q H;  3SXH A;  4IPD A;  4C3H B;  4FF3 A;  3L2P A;  4QIW B;  1TWG H;  2BA0 A;  4K5V A;  3QG1 A;  1IL8 A;  2UUA L;  4IUN A;  5FO7 B;  5K5P A;  3OTO L;  2UUC L;  3W3A A;  4V0B A;  4YY3 L;  4K2K A;  1K3R A;  4KN4 C;  3NTH A;  4LF7 L;  3NEL A;  1CA5 A;  1EU4 A;  3JAM c;  2A68 D;  4Q0F A;  4DV6 L;  1EFI D;  1EYA A;  5C44 G;  1MIU A;  4L6T B;  4XIG S;  1GUT A;  4IJL A;  3ULL A;  4A3I B;  3AEV A;  2E2H B;  1RF2 D;  1D6E C;  2DY7 A;  4DUY L;  3W5O A;  3GQB A;  4B9W A;  1XX8 A;  4FF1 A;  4XDX A;  3R93 A;  3D6W A;  1TWH H;  1KD1 C;  2G5D A;  5I4D A;  1RDP D;  2K32 A;  3I4M G;  2BDO A;  3UDI A;  4IFD J;  4JBW A;  1DD2 A;  2R7D A;  3GTK B;  4HTH A;  5ELN A;  1B70 B;  3B6Y A;  5FLM H;  1O78 A;  1X56 A;  4X62 L;  3J7A F;  1OXT A;  1B50 A;  2NTS A;  4HIK A;  3HOY G;  1G2T A;  2OWO A;  2TSS A;  1E1O A;  2R61 A;  1CM9 A;  1I50 H;  4RCO A;  2I46 A;  4RGN A;  4GZY C;  4PMC A;  5D3I B;  1GD7 A;  4LMQ D;  2Q2U A;  5M5X H;  1XMO Q;  2GA4 B;  3FHW A;  4DPG A;  3HOU G;  1LT4 D;  4A76 A;  5IE8 A;  4DK0 A;  1HQR D;  3E3X A;  5AFW A;  4HJ9 A;  5ELO A;  2JJQ A;  2XGT A;  3LNN A;  4FNF A;  3RR5 A;  3I55 A;  3CCQ A;  4OX9 Q;  2DJG C;  1Q81 C;  3PO2 B;  3T1Y Q;  1PTO F;  2B3G A;  4DR5 L;  2K5H A;  3HOX B;  1EQR A;  1HA5 A;  2F0O A;  3TZU A;  1A8V A;  3GO5 A;  2F4I A;  4A4I A;  3S1M B;  2PNH A;  2L1B A;  1BCP F;  5M9O A;  1VQF A;  1PTO D;  4R4O A;  1X54 A;  2RBM A;  3OW2 A;  4O1N A;  1C0A A;  3CW2 C;  4DUZ L;  4V19 0;  4GN5 A;  1B9N A;  2L12 A;  3T1H L;  4C3I B;  1IBL L;  3OYY A;  3HOZ H;  1BBX C;  1TWA H;  2UUB L;  2B29 A;  4X64 L;  1HNW L;  2IHE A;  1PZK D;  5KND A;  3ULJ A;  5J22 A;  4JI0 L;  1S3O A;  2L4N A;  1TS2 A;  5C0X H;  2GVB A;  2QDB A;  1HZA A;  3NWT A;  1JC7 A;  1ILQ A;  1WTW A;  1Z7T A;  4OON A;  4ME3 A;  2WB1 E;  4QGU A;  3H0G H;  4BS9 A;  4IFD I;  5DLQ E;  5M5Y B;  1VQN A;  4DV7 Q;  3VR6 A;  1JOQ A;  4C2M B;  4R8I A;  1OO9 B;  4L5R C;  2PYK A;  1K9M C;  3AB9 A;  3S16 B;  2R92 G;  1JJC B;  4K8I A;  3U58 A;  1N33 Q;  2K05 A;  3M3Y H;  3CMA A;  4WJ4 A;  4I65 A;  4BY1 G;  3VYS A;  3L7Z C;  4DR1 Q;  1SFO B;  4RGM A;  4IUQ A;  1FR3 A;  2VB2 X;  5JPN C;  4A3E B;  1F9P A;  2UXD Q;  1Y1V G;  4X3U A;  5IP9 G;  1D5M C;  4AH6 A;  4ALP A;  2F0D A;  5I9O A;  2WV6 D;  1SYC A;  1PVO A;  1L1O B;  2F52 A;  2QW7 A;  3IFD A;  5A35 A;  3DWQ A;  3T4A C;  3CRL C;  4E6I A;  3GTM B;  1Q90 A;  3ERS X;  3KOJ A;  2AMC B;  1K28 A;  4DF7 A;  3CC4 A;  3I4N G;  1WD0 A;  1NR4 A;  4NMZ A;  3T53 B;  5KNC A;  1XMO L;  3F8T A;  3HGB A;  4BWG B;  1JWU D;  1PV4 A;  3BDL A;  1AE3 A;  4C1N K;  1IXR A;  1NAP A;  4KJN A;  2PW5 A;  2ZJP A;  5AJ3 Q;  2M9V A;  3Q8D A;  1SYE A;  3GTL H;  4OX9 L;  2O5J C;  4DV1 Q;  4A3M G;  1RJT A;  4A3C G;  3C1E A;  3T1Y L;  1XTD A;  4POG A;  1QCB D;  3KYH C;  2VQE Q;  2PMZ E;  2ZT9 C;  1WTQ A;  1FNV A;  4BY7 B;  3TBI B;  3FKI B;  2ASB A;  2E5L Q;  2EYO A;  1O7Z A;  1YNJ C;  3PIO 3;  3OMC A;  4UPA A;  2EY6 A;  2IY5 B;  2F0N A;  1VQL A;  5JJZ A;  2DJF C;  1IYJ B;  2PI2 A;  1AP0 A;  1AE2 A;  3K80 C;  3JAM E;  2FHT A;  4C1N I;  1EWI A;  3KF8 A;  4JBJ A;  4I7Z C;  4FO2 A;  5M3M B;  1WTV A;  3IFT A;  4HED A;  4BBS B;  2Z9H A;  2F03 A;  4QCL A;  5G3L D;  5E4X A;  1JCK B;  1LTR D;  1QZG A;  4X3K A;  4DV7 L;  3KFU A;  4JW0 A;  4HSV A;  1B4O A;  4N8X 1;  3EBE A;  1CFM A;  2Z6K C;  2LXJ A;  3PO3 G;  3T51 B;  4PG3 A;  5EPJ A;  4C3H H;  1H9M A;  3KBX A;  4DR1 L;  5IIF A;  5FLX L;  4GNX B;  2PZW A;  3KLS A;  3KUP A;  3LWE A;  1NSN S;  1YNJ D;  3FEW X;  5E3F A;  2Z6K A;  3I72 A;  2UXD L;  1I3Q B;  1PH5 A;  5IOD A;  1Y1W B;  3CC7 A;  2WII B;  4BA2 I;  5H1S E;  2LSS A;  1DZ1 A;  3DHQ A;  3HZX A;  3M4O B;  3MXG A;  2E2H H;  4DKA C;  1VQK A;  3Q6S A;  1RTN A;  2Q2H A;  1NE3 A;  1PRT B;  2LMC B;  1BBU A;  1EFW A;  3NSW A;  1F77 A;  2EYL A;  3R3O A;  3ZJY C;  1XPO A;  4JPB W;  2C5C A;  1HR0 Q;  3PGZ A;  1KNA A;  3NUC A;  2JA6 G;  3HKZ B;  1K83 B;  4XQJ A;  1X6O A;  3NPP A;  2NN6 G;  2B8F A;  2EJM A;  2UU9 L;  1A2T A;  4P2C B;  5IT9 L;  4DV1 L;  3I3C A;  4DXG A;  1CI3 M;  3A8J E;  3E6Z X;  5IYD G;  1ET6 A;  5J1Z A;  1TY2 A;  1TVX A;  3CCE A;  3BJU A;  1J5E Q;  2K75 A;  3S15 B;  2IT1 A;  3OIQ A;  4A93 G;  3SE0 A;  2EYF A;  4OXP A;  2VUM B;  2E2I B;  4BXX G;  2E5L L;  3PO2 H;  1O7Y A;  2BOS A;  1XNR Q;  3O13 A;  2KED A;  1XPR A;  2N49 A;  3DLL A;  3LX0 A;  4KY7 A;  1A15 A;  2F0I A;  5CBE E;  1K0S A;  1PFN A;  3PF4 A;  2DN8 A;  2NVT B;  2FFK B;  3S1M H;  5DM6 3;  4QY7 A;  3S1Q B;  4DV3 Q;  2HIV A;  1PMR A;  3K81 C;  2GN5 A;  2B2U C;  1V8Q A;  4A3G B;  1KXL A;  4JI5 L;  2CH4 W;  3M7N A;  2Q2I A;  1OXV A;  3H09 A;  4C3I H;  2PNR C;  2P5Z X;  1MKH A;  1VQP A;  3EIV A;  4M8A A;  5I2Y A;  4QQB X;  4NXN Q;  2B2U A;  1STG A;  2L55 A;  3MEH A;  1X32 A;  4TKO B;  1FGU A;  1D8L A;  1HR0 W;  1OXU A;  1PLF A;  1TWH B;  1SE4 A;  2VB3 X;  3WDN A;  4NB3 A;  1RL2 A;  3W2D A;  3AFP A;  4OO1 I;  5JVG 3;  1N34 Q;  3OWE B;  3A8I E;  5C5L A;  1CQF A;  3K7A H;  5M5Y H;  4JYA L;  1IW7 C;  2XRQ D;  4G4K A;  2RQX A;  4C2M H;  1I5F A;  3ITP A;  3H15 A;  1HCZ A;  5CV8 A;  1VQ4 A;  3VR5 A;  3S16 H;  1W3S A;  4LUO A;  2DY8 A;  2V4D A;  2R6G A;  5IGE A;  1F2Z A;  4LAA A;  1UE1 A;  2F0Q A;  2LKV A;  1X55 A;  2Z8L A;  5J3B A;  1M8A A;  3E9I A;  4LF9 Q;  2SEB D;  5COR A;  1FL0 A;  1BDO A;  1UNS A;  2WKC A;  3I8Z A;  4HCS A;  3WWV A;  3GP7 A;  2A19 A;  4X65 Q;  4WRD A;  1DM0 B;  2RDH A;  4ZQ3 A;  1S5B D;  4G57 A;  1LM0 A;  2VNU D;  1UEA B;  4UP7 A;  1GUS A;  1B3Q A;  1HJP A;  4A3J G;  5DAU A;  1YJ9 A;  1EY5 A;  1I6V C;  1PTO H;  4A3D B;  1TXY A;  5ELF A;  1SSO A;  4JC0 A;  1IW7 D;  1ROD A;  3HOU H;  3QR8 A;  3FPU B;  4YIJ A;  4YWK A;  4EQN A;  1J5E L;  1G6P A;  4IFD G;  3HOZ B;  1UWV A;  3PIP A;  5BN5 A;  1KTK A;  3J7Y W;  3G48 A;  4DR6 Q;  1STE A;  4DNI A;  5C4H A;  2RHQ B;  2K7V A;  4GLV B;  1CKN B;  1VF5 C;  1XNR L;  1IL2 A;  3J80 E;  2R7Z G;  4RFB A;  3MZ5 A;  3U4V A;  3GV6 A;  4KKT A;  5GAE C;  4QUF A;  4BY7 H;  3FKI H;  1ZXT A;  1M90 C;  1KRT A;  2CKZ B;  3A5Z B;  4K5X A;  4NDX A;  1AZP A;  3MAQ A;  2RHS B;  4P72 A;  5FO8 B;  4WFN 3;  1XMQ L;  3RZO B;  1HNX Q;  1VQ8 A;  3RLN A;  1VS0 A;  1Q12 A;  4NXN L;  2AWO A;  1KIX A;  4GOP B;  5CYU A;  1JE4 A;  3SEB A;  1UAP A;  3CPW A;  1LTT D;  3NTI A;  4CDD C;  4DAY B;  1GUG A;  1EWC A;  4JK1 C;  5M3M H;  2NVX H;  3F2C A;  4BBS H;  2LFN A;  1E7Z A;  1I6H H;  4RG1 A;  4K6D A;  5IYC G;  4O42 A;  3GDE A;  1DOM A;  1Z6H A;  4C3J G;  1W6J A;  1B7Y B;  4RH6 A;  3N52 A;  3EQL C;  3NTK A;  1XXG A;  3S2H B;  2F3I A;  3GTG B;  1AZQ A;  4FXD A;  4OIJ A;  2R92 H;  2DUD A;  1B1Z A;  2EOT A;  4Y7N H;  3PUV A;  2WB1 B;  4BY1 H;  1K8A C;  2MJ8 A;  5DEH A;  3TME A;  4LF9 L;  2NWG A;  4XT3 B;  1Y1V H;  3D6C A;  1KDA A;  1NUC A;  2AQ3 B;  2I0Q A;  4TVA B;  3ZYY X;  5IP9 H;  1E24 A;  4R4Q A;  3CAM A;  1PH4 A;  2VZA A;  3AFQ A;  1KAA A;  1TWC B;  3M4O H;  4K0K L;  1VQA A;  3I56 A;  4B3T Q;  3VA7 A;  1ESF A;  1TS5 A;  5EKK A;  1VQH A;  5C0X J;  4JI6 L;  3TP5 A;  1S40 A;  1V1P B;  2Z4I A;  1A3U A;  2QDL A;  1G2S A;  3J81 L;  1N36 Q;  1ZEQ X;  5D65 A;  3DXJ C;  2PI2 E;  1YZ6 A;  3J7A 5;  2NVQ B;  4IN3 A;  1K83 H;  1KHI A;  3M9B A;  3M4P A;  3TN2 A;  3S17 B;  1G91 A;  1PA6 A;  4GS3 A;  5EAY A;  3TP8 A;  2VS1 A;  2EYP A;  2YYZ A;  1TQO A;  2B2Y C;  5C4X G;  2F0K A;  4A3M H;  3SK8 A;  1SNQ A;  5EKL A;  4CKC A;  4XTC S;  3DMU A;  3FPP A;  4LWC A;  1H9J A;  3BVZ A;  2VUM H;  2D5D A;  2B2Y A;  3SDZ A;  2E2I H;  1E22 A;  3CD6 A;  3Q24 A;  4FF2 A;  3A7A B;  3HP3 A;  2H4O A;  4LFB L;  1TS3 A;  2Q8R E;  3HOW G;  3GTO B;  1VQ9 A;  2I5H A;  2QIL A;  4KHV A;  1Y14 B;  4IOC A;  3HOV B;  3MC0 B;  1HNX L;  1H9S A;  1R4Q B;  2DNE A;  2YV5 A;  4DK3 C;  2NVT H;  2EYH A;  4KD4 A;  2PMZ B;  3JC6 6;  5COY A;  2ZTD A;  4KN7 C;  2HT1 A;  3PSI A;  5IOC A;  2MO1 A;  1C48 A;  1MJE A;  2HUG A;  3DWP A;  4A3G H;  2C35 B;  1KNE A;  2IPK D;  2PQA A;  3D8G A;  3VYR A;  4PV1 C;  4F7X A;  2ZXR A;  1JOR A;  1WCM G;  2IX1 A;  2F0T A;  3GV3 A;  1NTG A;  2L0C A;  2F0W A;  4NP5 A;  4C3J B;  1WD1 A;  4JI7 Q;  1B9M A;  1E2V A;  1SR3 A;  2JA8 B;  2Q8T A;  5IGF A;  5NUC A;  2TMP A;  3RZD H;  2OF1 A;  4R4C A;  5C3E G;  1QJO A;  1M1K C;  3PO3 H;  5C0X I;  2E2J B;  2I5L X;  1T5X D;  3D0F A;  3MXP A;  1W6K A;  1BR9 A;  2RF4 A;  1P16 A;  3X3N A;  3RNU A;  1XPU A;  2CW0 C;  1VQM A;  4KLK A;  3RLO A;  4XYO A;  1N32 Q;  5LMU Q;  1FJG Q;  5C4J H;  4RCN A;  1D5X C;  4AIM A;  3BDO A;  2KEC A;  3BYT B;  2X6L A;  2NTT A;  3NQT A;  4HMI A;  4B3T L;  5EPK A;  4R4T A;  2FMC A;  3PF5 A;  2NZH A;  4DR4 Q;  4IPH A;  1SMY C;  2JN4 A;  3UE1 A;  5FK9 C;  1N36 L;  5CV9 A;  4N9P A;  3IRB A;  2EJF C;  4BBR G;  4XXE A;  1CUK A;  1YIT A;  5LMN W;  4LFA L;  3CHB D;  1B44 D;  4KJO A;  1UE6 A;  2SNS A;  1K73 C;  3KK7 A;  3S24 A;  2F0S A;  2NN6 H;  3JAM L;  2Q2T A;  1LYL A;  4Y52 H;  2JA7 G;  5E7N A;  2MPM A;  4DV4 Q;  3L0O A;  3AU7 A;  4A3D H;  5DNF A;  3T16 A;  5IP7 G;  4YHH Q;  1Z47 A;  3C2P A;  2A69 C;  4OO1 G;  1TY0 A;  3NHH A;  1ML0 D;  4A3F G;  2KA7 A;  5IYD H;  2WFW A;  2KCN A;  2N55 A;  3NBI A;  4A93 H;  4RKB A;  2H5X A;  5M5W H;  2KCM A;  4PZ6 A;  3ICE A;  2CW0 D;  3L9A X;  4CDE C;  2Z4H A;  3J81 i;  3WOF A;  2B63 G;  2L9H A;  4CKE A;  2HHH Q;  4DA2 A;  3QB3 A;  1HH2 P;  1QE6 A;  1SMY D;  2J7Z A;  1QB5 D;  2VQF Q;  3K7A B;  3S14 B;  3Q22 A;  2MP1 A;  1L0W A;  2WP8 J;  3G7L A;  2PQE A;  4GKJ Q;  3RZO H;  5M3F G;  1JIC A;  3IAY A;  1E1T A;  1X3E A;  1ICF B;  1VQE A;  3C1F A;  4XT1 B;  3RN2 A;  1LTI D;  4FXG C;  3TS0 A;  5C44 B;  5D3D A;  1PH8 A;  1IBM Q;  3TDQ A;  4CDC C;  1B53 A;  5KNB A;  1NJI C;  2A69 D;  1I4G A;  1FGB D;  3H3V I;  2ALY B;  3GTQ B;  1SND A;  2N8N A;  3DWA A;  2CWP A;  4LK1 C;  3DM3 A;  3CCM A;  4X3S A;  5EBC A;  3I4M B;  2WAQ G;  3M4Q A;  1LTL A;  1DXM A;  1HHV A;  2XRS D;  3I2Z A;  3S2H H;  4A3K G;  1PRT C;  2K5Q A;  2J4X A;  1HZB A;  1KLG D;  3GTG H;  3HOY B;  1CZW A;  3A56 A;  2ZTE A;  1EIH A;  4ME5 A;  1JWM D;  5GAH C;  1Z9F A;  4MTK A;  1I4R A;  4POF A;  1N32 L;  4FDB A;  2MUY A;  3OSO A;  5LMU L;  1FJG L;  4J15 A;  1PTO B;  4LJZ C;  1CQV A;  4K6L A;  1F9Q A;  3HOU B;  3OW7 A;  1JE5 A;  1PYW D;  4BA1 I;  4J6H A;  3MWY W;  2EXD A;  4YWM A;  4M1U B;  4DR4 L;  2M00 A;  1BCP B;  1TWC H;  1EYG A;  1LUZ A;  2R3Z A;  2F0E A;  3PQI A;  1SMX A;  1H9K A;  4GLA C;  4MN3 A;  1GUO A;  3G71 A;  5CV6 A;  4CDF C;  4XQN A;  4R1J A;  3K5N A;  1WTR A;  4O0A A;  4ZRZ A;  2F0L A;  3CRK C;  4RKL A;  2BH8 A;  4DV4 L;  1WVL A;  4ZUJ A;  3ER0 A;  2NVQ H;  1Y8N B;  5CV4 A;  1IBK Q;  1LAC A;  3QO2 A;  2D0P A;  1XJV A;  3S17 H;  1PRT D;  1LTB D;  4IFD H;  1QOH A;  4ZCK A;  2O2L D;  1J6Q A;  2VL6 A;  1FNU A;  5G3L F;  1EWH A;  3EA6 A;  3TEH B;  4LF8 Q;  1CTM A;  2K28 A;  2NVX B;  5IGG A;  1SLJ A;  1J8I A;  3PV0 A;  1K8O A;  1I94 Q;  5A2Q L;  4RGT A;  1I6H B;  2B39 A;  1GKH A;  3I7F A;  1FVI A;  1GM5 A;  3JAM i;  1S72 A;  3J80 c;  3GTO H;  2OTJ A;  4B3R Q;  1SRU A;  1EQV A;  4A3L G;  3CCS A;  3HOV H;  3CU7 A;  1ZKO A;  1PH2 A;  2R92 B;  1TU2 B;  1N33 L;  2RVL A;  2AKW B;  1FYC A;  4Y7N B;  1EOT A;  4H7B A;  3K7U C;  3G4S A;  2G9D A;  1KRS A;  1UE7 A;  3ND9 A;  4BY1 B;  2Q8I B;  3RUZ A;  5JEA H;  3K6O A;  4IUU A;  1HUN A;  5CBA E;  2K5W A;  1Y1V B;  2I5M X;  2NBF A;  4ABN A;  4DU9 A;  2K04 A;  1DJR D;  2F0U A;  5J39 A;  5IYC H;  3PUX A;  1LT6 D;  5FLM G;  3T13 A;  3CCU A;  2L15 A;  4C3J H;  4ZK9 B;  2WAC A;  1HTP A;  2FXQ A;  4CJ2 C;  2FMM A;  4FP5 D;  2JA8 H;  3S9W A;  3NBH A;  5EBD A;  3J7A V;  4CKB A;  2ES2 A;  2OTL A;  4P74 A;  4LUZ A;  3CCR A;  3SK4 A;  2E2J H;  1KLU D;  3I4N B;  1A62 A;  5GQO A;  2EQS A;  2KUM A;  4K2L A;  1I4Q A;  3X3M A;  3VDY A;  3GTP H;  2JP1 A;  1WTX A;  3W1G A;  1JR0 D;  2Y0S G;  1RHP A;  5LL6 S;  1Q82 C;  4PNY A;  1QVF A;  4AQY Q;  5AJ3 L;  4ZUI A;  4XQQ A;  3AQQ A;  4XYQ A;  2QA4 A;  3FVQ A;  2UXC Q;  1D5Z C;  2D2C C;  2ID0 A;  1F9S A;  3P75 A;  2VQE L;  4A3M B;  1PH9 A;  3V96 A;  5KYL A;  3BVM A;  3U50 C;  1TR5 A;  2DNC A;  5EQ0 A;  4DAV A;  4AYB G;  1DOL A;  1XWE A;  1NMG A;  2NZ1 D;  5LL6 X;  3SGI A;  2Z1C A;  4ODG A;  2R93 G;  4A3B G;  2D9U A;  1SE8 A;  1EU3 A;  4JI1 Q;  5CMD A;  4PQX A;  1HRJ A;  5D14 A;  4NXM Q;  2KVM A;  1VQB A;  2E75 C;  1U4R A;  1VQ7 A;  2VXW A;  4C56 C;  4CJ1 B;  1CKN A;  1SYF A;  2F1M A;  1LTG D;  4ZYS A;  3CCJ A;  5KRU A;  3PMF A;  1TKW B;  1G29 1;  4HR7 B;  1F2L A;  3MXN A;  5C0X G;  4LF8 L;  2KOL A;  3KLS X;  3KF8 B;  4RHR A;  3DM1 A;  3BU2 A;  4MHE A;  2F0P A;  1CSQ A;  4GOP C;  1A63 A;  2DGY A;  3TRE A;  3VR2 A;  1EEF D;  4JVZ A;  1JB7 A;  3H0G G;  4B3R L;  3D4D A;  2EYJ A;  2XN9 C;  4MZ9 A;  4P71 A;  4HJ8 A;  3RZD B;  3TS2 A;  2M2L A;  4APV A;  3PO3 B;  4DAY A;  1C9O A;  2ZJQ A;  2HQE A;  3PUW A;  4F88 A;  3S14 H;  1BXT A;  1GHK A;  1PZI D;  1MSH A;  2CHB D;  5C5M A;  1SBB B;  4ZAI A;  3NK9 A;  2OXP A;  2KHS A;  2KEE A;  1S5D D;  2WIN B;  3A8K E;  3ERO A;  1WCM H;  4N8F A;  4ZKB B;  3OIP A;  5C44 H;  5C4J B;  1U4L A;  5JJK A;  1PDQ A;  2ATW A;  1BKB A;  3GTQ H;  4OWX B;  1VQO A;  4HID A;  3FDT A;  4JI8 Q;  3VR3 A;  4HCE A;  2EZV A;  1HQM C;  2K1B A;  3I4M H;  1MSG A;  1GOZ A;  4ULL A;  1HR0 L;  3UE0 A;  2JA6 B;  1Q3L A;  3EVQ A;  3HOY H;  2YTV A;  5KGU A;  5GAD C;  4AQY L;  1GXD C;  1SYD A;  2XWJ B;  2IHF A;  1AEX A;  1QNK A;  3V2T A;  4CGY B;  3C3L A;  1LT5 D;  1JT8 A;  2UXC L;  1PYS B;  4FXK C;  2A73 B;  4K5W A;  3EFX D;  1M4V A;  1S4Z A;  1V1P A;  1W2B A;  4UHV A;  4A93 B;  3W1B A;  1MD2 D;  3H3V C;  5M5W B;  5F2D A;  2E76 C;  3IL8 A;  1ET9 A;  5EKI A;  3G6E A;  4IPC A;  5KEE A;  1YNN C;  4JI1 L;  3EN2 A;  4DNR B;  1I4P A;  1WJJ A;  4DV3 L;  3L3O C;  2EVB A;  5ELC A;  2ZXP A;  4YWL A;  3K57 A;  4KK7 A;  2RDG A;  3K5L A;  4N9T A;  5IP7 H;  2HCI A;  5IT9 E;  4EQO A;  3NEN A;  4A3F H;  1U4P A;  1GUN A;  4DV5 Q;  1VQG A;  3SK5 A;  2KQ3 A;  4CHT B;  2BCO A;  3NWS A;  1HPC A;  3TP6 A;  4R8N A;  1QZH A;  2WAQ E;  1QUQ A;  3KF6 B;  1C7Y A;  2CFM A;  1X3G A;  2D62 A;  3D4R A;  4ILW A;  4HJ5 A;  4DV2 Q;  1F9R A;  4RA8 A;  3CP0 A;  1CT1 D;  1HZC A;  2GVA A;  2F0F A;  3QWN A;  4X66 Q;  1X9N A;  1N34 L;  3TRZ A;  4DAP A;  2OQ0 A;  2QEX A;  4H13 C;  3SR1 A;  3DEP A;  3ONA B;  1YNN D;  2BE5 C;  2A1A A;  4QL5 A;  5M3F H;  3VA5 A;  3PIO A;  1SYB A;  1RKN A;  3OTO Q;  3MFY A;  3F1Z A;  1D1K A;  3K59 A;  5CGK A;  2EXZ A;  5I6Y A;  3AYH B;  1WI5 A;  1CHP D;  1YI2 A;  4A3I G;  3PUZ A;  4LF6 Q;  3TZD A; 
#chains in the Genus database with same CATH homology
 3NXW A;  1AW7 A;  4KKS A;  2QEJ C;  4IUP A;  5CR3 A;  3OWF A;  3K5O A;  3BG3 A;  4B08 A;  1Y8O B;  3E5S A;  4FF4 A;  2QF7 A;  3A54 A;  1U9R A;  2LY7 A;  4DN4 M;  3MA2 B;  2O5I C;  4A3J B;  2PPB C;  3D31 A;  4ZKC B;  2BE5 D;  2KCC A;  1IYV A;  2IW3 A;  2RA4 A;  5I2X A;  2BA1 A;  1HFN A;  1STA A;  1Q1B A;  3C46 A;  1CZG A;  3LWU A;  1PXU A;  2PCF B;  5ELD A;  1SDF A;  2R7Z B;  3OMG A;  1JOO A;  2JXM B;  4TRD A;  1PZJ D;  2NB0 A;  4TQU S;  2MGS A;  1VCI A;  1BQQ T;  4DXF A;  4UDU C;  1FD7 D;  4C3I G;  2EE1 A;  1SEB D;  2F0H A;  1SYG A;  3D4W A;  1ONL A;  2XWB B;  3IKJ A;  3M4Y A;  1ZYR C;  1H9R A;  4PMW A;  1O7L A;  2PO4 A;  4B9X A;  3MFG A;  1SAP A;  3D3R A;  1KDB A;  5IGD A;  4KY5 A;  2L11 A;  1D1I A;  1FNW A;  5LHY 1;  1GUW A;  4FVM A;  1DOK A;  4H44 C;  5C3X A;  2N88 A;  1BO0 A;  3QOL A;  3DUZ A;  2KJX A;  4CBV A;  1HA6 A;  1IKL A;  2IJ0 A;  2EY5 A;  2A74 C;  3GTP B;  3U9S A;  4DK1 A;  1RCV D;  2JE6 I;  3NP8 A;  1CK1 A;  2IX0 A;  5IGB A;  1PTO C;  2RKS A;  1ZYR D;  1EY6 A;  3A55 A;  3TSS A;  1LT3 D;  1A2U A;  3BZD B;  1BCP C;  5DM7 3;  1EY7 A;  2O4X A;  1EQT A;  4OGQ C;  2HDL A;  3K58 A;  3I70 A;  3MVV A;  2X69 A;  2HCC A;  4PMB A;  1C8C A;  2RSO A;  5C4Z A;  1T5E A;  2JEA I;  1LTS D;  3P20 A;  5ISR A;  2JA5 B;  5K36 G;  5C4X B;  4UAI A;  3H6M A;  4WOR A;  1SJH D;  2EDG A;  2YU9 B;  2QCP X;  2K03 A;  5JEA J;  1K8M A;  1Y69 U;  4HMJ A;  5KIX A;  1EY9 A;  3R2I A;  2QKI C;  1AFP A;  1JOK A;  4HSP A;  1EZ6 A;  3HOW B;  1R4P B;  3J81 E;  2NYZ D;  3QIA A;  2JYO A;  2LS0 1;  2OEO A;  4KD3 A;  1BCP D;  1H9S B;  2JSO A;  2E74 C;  1JQY D;  3S1R B;  1WTO A;  1WCM B;  3CKI B;  4EQP A;  3Q23 A;  1EY4 A;  2CQA A;  4G7H C;  2AUJ D;  1HXY D;  1R9T B;  1SNC A;  5C3E B;  1LAB A;  2XSC A;  3P1H A;  3PIP 3;  4F8M A;  4QB4 A;  1JWS D;  4KHZ A;  2ZXO A;  1HFG A;  4HN7 A;  1QWY A;  1LLR D;  1U4M A;  1OXX K;  3A7L A;  5CV5 A;  4BBR B;  3RMH A;  1DCZ A;  3VYT A;  2WKD A;  3QJY A;  1SE2 A;  1PRT F;  1G6Z A;  3U9O A;  2JA7 B;  2NVY B;  3PUY A;  2EY2 A;  2XNA C;  1EIG A;  3ND8 A;  4A3F B;  2IX3 A;  3V05 A;  1B2T A;  1IKM A;  1I4H A;  5EPL A;  2E2D C;  2B63 B;  4R9W A;  2A6E C;  3I91 A;  1VMC A;  5BN4 A;  1DYQ A;  2H1E A;  3G6J B;  1ENA A;  3FMC A;  1ILP A;  3RLF A;  3S1N B;  2B2V C;  5M3F B;  2CVR A;  3SK6 A;  4RHS A;  2B2V A;  3F2U A;  2FIN B;  1NCV A;  1A3V A;  2PW7 A;  1ICW A;  4QUC A;  4DGZ A;  2AUK A;  3OOC A;  2WAQ B;  3DEO A;  1EYD A;  3CQZ B;  1QG7 A;  2F0V A;  2A6E D;  5T1I A;  4A3K B;  3KBG A;  1EZ8 A;  1A6X A;  2K01 A;  1STN A;  1STB A;  3MXU A;  2ICI A;  5FOB B;  4IUT A;  1L0Y B;  5EGT A;  4QF4 A;  3J80 L;  2SOB A;  1VF7 A;  1IYU A;  3NQI A;  3Q0A A;  1G8Z D;  2B8G A;  5C6A A;  4L8J A;  3HG9 A;  2AWN A;  2K33 A;  2JEB I;  5E4W C;  2AQ1 B;  5TSS A;  3MHB A;  3P7J A;  3ERQ A;  1V43 A;  3GTJ B;  1GJX A;  4KY6 A;  4KI0 A;  3K0Y A;  1CHQ D;  5JPM C;  3S2D B;  2ENB A;  5ELB A;  1JB3 A;  1E2Z A;  1SNM A;  3BYY B;  3HEJ A;  5HGT A;  1B3A A;  4OIK A;  3M85 A;  3HS0 C;  5JOB A;  1I4X A;  1CA6 A;  1XTC D;  1LV9 A;  3RD4 A;  2A6H C;  3GD7 A;  1SXT A;  3VYU A;  2I07 B;  1GHJ A;  5C3W A;  1EYC A;  2C9O A;  3VR4 A;  1TWG B;  3R2T A;  4F87 A;  1TS4 A;  2EJG C;  1TII D;  1HUM A;  1S5E D;  2A5H A;  3I4L A;  2RDF A;  2EYM A;  5ELE A;  4IZ8 A;  3NE5 B;  5KYI A;  3SHL A;  2EY1 A;  2SDF A;  5A2Q E;  3OPO A;  5IGC A;  1V1O A;  1VDZ A;  2RSN A;  1UUP A;  2MHV A;  3T56 B;  2A6H D;  1E2W A;  1I50 B;  4EVO A;  1STH A;  4OHJ A;  2J0T D;  4FYD A;  5M5X B;  5I9P A;  3R8B A;  5FLX E;  1D2B A;  2X6G A;  2HDM A;  2Y0S B;  4DFA A;  4EGV A;  1EL0 A;  1EY0 A;  4OL7 A;  4KTA A;  1ENC A;  2XIW A;  1RTO A;  4KKU A;  3I73 A;  3QOJ A;  3HRZ C;  1LTA D;  3OHX C;  4IUR A;  4AYB B;  1LO5 D;  1PFB A;  3EJI A;  4S3S A;  3M7G A;  1S5F D;  2F0G A;  4Q5V A;  4RGO S;  2R93 B;  4A3B B;  4NW2 A;  2BDN A;  1X3P A;  3I90 A;  2F0M A;  5FO9 B;  1TWA B;  4TSS A;  4RWS C;  4G7Z C;  1BOS A;  4OO1 H;  5K36 H;  4K14 A;  2B2W C;  1VMP A;  1Y8P B;  1PFM A;  4Z9C B;  2K5D A;  4G7O C;  2B2W A;  3H0G B;  1S5C D;  3MTS A;  2K6A A;  3H91 A;  1MGS A;  4IUV A;  4WJW A;  4C3H G;  1QIL A;  3M3Y B;  4ID6 A;  5FKA C;  4MIU A;  3FRP B;  3WOE A;  5JEA G;  2PZU A;  1II3 A;  3UI2 A;  1BNZ A;  2G9H D;  1Q8I A;  1SE3 A;  4RAU C;  1SNO A;  4K8J A;  3BS1 A;  2NUC A;  2F3W A;  1C4Q A;  1ESR A;  2FJ2 A;  4HAE A;  1Q1E A;  1IHZ A;  1O80 A;  4J1M A;  4KV6 A;  5CC4 A;  1F2M A;  4QMG A;  2IWH A;  1BF4 A;  1SNP A;  5I6W A;  1WTP A;  1NR2 A;  1EEI D;  3SVM A;  1J9O A;  3N6R A;  4X3T A;  3KLR A;  4DNT B;  2XVS A;  5BN3 A;  1RD9 D;  1AN8 A;  2PZT A;  5JAV A;  1MI2 A;  4IAL A;  1F2Y A;  1TT2 A;  3GTL B;  1TWF B;  3AMU A;  1E0B A;  4H0L C;  2IL8 A;  4J8Q A;  1XYI A;  4L63 B;  1SJE D;  2SNM A;  1EY8 A;  5EJW A;  2ICE C;  2OT2 A;  2AQ2 B;  4IQZ A;  3K5M A;  5CV7 A;  3TP7 A;  1STY A;  1A3T A;  5JVH 3;  3BVG A;  3E0J A;  4NKL A;  4U68 A;  1MBY A;  2A68 C;  3URY A;  1KDC A;  1OXS C;  2F3V A;  2EPB A;  4CJ0 B;  1QNU A;  4U67 3;  4KMU C;  2F0J A;  2B2T C;  1BUV T;  2L5T A;  1KAB A;  5HUR A;  1ENF A;  2NN6 I;  1X3Q A;  5E1F A;  2B2T A;  4ZLT F;  3H94 A;  3BDC A;  5T1G A;  1HTL D;  1DON A;  1L0X B;  3SXH A;  4C3H B;  4FF3 A;  4QIW B;  2BA0 A;  4K5V A;  3QG1 A;  1IL8 A;  4IUN A;  5FO7 B;  5K5P A;  3W3A A;  4V0B A;  4K2K A;  4KN4 C;  3NTH A;  1CA5 A;  1EU4 A;  2A68 D;  4Q0F A;  1EFI D;  1EYA A;  4L6T B;  4XIG S;  1GUT A;  4A3I B;  2E2H B;  1RF2 D;  1D6E C;  2DY7 A;  3GQB A;  4B9W A;  1XX8 A;  4FF1 A;  4XDX A;  3R93 A;  3D6W A;  5I4D A;  1RDP D;  2K32 A;  2BDO A;  4IFD J;  4JBW A;  1DD2 A;  3GTK B;  4HTH A;  1O78 A;  3J7A F;  1OXT A;  1B50 A;  2NTS A;  1G2T A;  2TSS A;  2R61 A;  1CM9 A;  4RCO A;  2I46 A;  4RGN A;  4GZY C;  4PMC A;  5D3I B;  4LMQ D;  2GA4 B;  1LT4 D;  4DK0 A;  1HQR D;  5AFW A;  3LNN A;  4FNF A;  3PO2 B;  1PTO F;  3HOX B;  1HA5 A;  2F0O A;  3TZU A;  3GO5 A;  2F4I A;  3S1M B;  2L1B A;  1BCP F;  5M9O A;  1PTO D;  2RBM A;  4O1N A;  4V19 0;  1B9N A;  2L12 A;  4C3I B;  1BBX C;  1PZK D;  5KND A;  5J22 A;  2L4N A;  1TS2 A;  5C0X H;  2QDB A;  3NWT A;  1JC7 A;  1ILQ A;  1WTW A;  1Z7T A;  4BS9 A;  4IFD I;  5M5Y B;  3VR6 A;  1JOQ A;  4C2M B;  4R8I A;  1OO9 B;  2PYK A;  3AB9 A;  3S16 B;  4K8I A;  2K05 A;  4I65 A;  3VYS A;  3L7Z C;  1SFO B;  4RGM A;  4IUQ A;  1FR3 A;  2VB2 X;  5JPN C;  4A3E B;  1F9P A;  4X3U A;  1D5M C;  2F0D A;  5I9O A;  2WV6 D;  1SYC A;  3IFD A;  5A35 A;  3DWQ A;  3T4A C;  3CRL C;  4E6I A;  3GTM B;  1Q90 A;  4DF7 A;  1WD0 A;  1NR4 A;  4NMZ A;  3T53 B;  5KNC A;  3HGB A;  4BWG B;  1JWU D;  3BDL A;  4C1N K;  1NAP A;  4KJN A;  2PW5 A;  2M9V A;  1SYE A;  2O5J C;  1RJT A;  3C1E A;  1QCB D;  2ZT9 C;  1WTQ A;  1FNV A;  4BY7 B;  3TBI B;  3FKI B;  2EYO A;  1O7Z A;  1YNJ C;  3PIO 3;  3OMC A;  2EY6 A;  2F0N A;  5JJZ A;  1AP0 A;  3JAM E;  2FHT A;  4C1N I;  3KF8 A;  4I7Z C;  4FO2 A;  5M3M B;  1WTV A;  3IFT A;  4HED A;  4BBS B;  2F03 A;  4QCL A;  5G3L D;  5E4X A;  1JCK B;  1LTR D;  4X3K A;  4HSV A;  1B4O A;  1CFM A;  3T51 B;  5EPJ A;  1H9M A;  3KBX A;  5IIF A;  5FLX L;  2PZW A;  3KLS A;  3KUP A;  3LWE A;  1NSN S;  1YNJ D;  3FEW X;  5E3F A;  3I72 A;  1I3Q B;  5IOD A;  1Y1W B;  2WII B;  4BA2 I;  1DZ1 A;  3DHQ A;  3HZX A;  3M4O B;  3MXG A;  3Q6S A;  1RTN A;  1PRT B;  2LMC B;  3NSW A;  1F77 A;  2EYL A;  3R3O A;  2C5C A;  1KNA A;  3NUC A;  3HKZ B;  1K83 B;  4XQJ A;  3NPP A;  2NN6 G;  2B8F A;  2EJM A;  1A2T A;  4P2C B;  5IT9 L;  3I3C A;  4DXG A;  1CI3 M;  3A8J E;  3E6Z X;  1ET6 A;  5J1Z A;  1TY2 A;  1TVX A;  3S15 B;  2IT1 A;  3OIQ A;  3SE0 A;  2EYF A;  2VUM B;  2E2I B;  1O7Y A;  2BOS A;  3O13 A;  2KED A;  3LX0 A;  4KY7 A;  1A15 A;  2F0I A;  5CBE E;  1PFN A;  2NVT B;  2DN8 A;  2FFK B;  5DM6 3;  3S1Q B;  1PMR A;  2B2U C;  1V8Q A;  4A3G B;  3M7N A;  1OXV A;  3H09 A;  2PNR C;  4M8A A;  5I2Y A;  2B2U A;  1STG A;  2L55 A;  3MEH A;  1X32 A;  4TKO B;  1OXU A;  1PLF A;  1TWH B;  1SE4 A;  2VB3 X;  3WDN A;  3W2D A;  4OO1 I;  5JVG 3;  3OWE B;  3A8I E;  5C5L A;  1CQF A;  1IW7 C;  2XRQ D;  4G4K A;  2RQX A;  3ITP A;  1HCZ A;  5CV8 A;  3VR5 A;  2DY8 A;  2V4D A;  2R6G A;  5IGE A;  1F2Z A;  4LAA A;  2F0Q A;  2LKV A;  2Z8L A;  1M8A A;  2SEB D;  5COR A;  1BDO A;  1UNS A;  2WKC A;  3I8Z A;  4HCS A;  3GP7 A;  4WRD A;  1DM0 B;  2RDH A;  4ZQ3 A;  1S5B D;  4G57 A;  2VNU D;  1UEA B;  1GUS A;  5DAU A;  1EY5 A;  1I6V C;  1PTO H;  4A3D B;  5ELF A;  1SSO A;  1IW7 D;  1ROD A;  4YIJ A;  3FPU B;  4EQN A;  4IFD G;  3HOZ B;  5BN5 A;  1KTK A;  3J7Y W;  1STE A;  5C4H A;  2K7V A;  1VF5 C;  3J80 E;  4RFB A;  3MZ5 A;  3GV6 A;  4KKT A;  4QUF A;  1ZXT A;  4K5X A;  4NDX A;  1AZP A;  3MAQ A;  5FO8 B;  4WFN 3;  3RZO B;  1Q12 A;  2AWO A;  5CYU A;  1JE4 A;  3SEB A;  1UAP A;  1LTT D;  3NTI A;  1GUG A;  1EWC A;  4JK1 C;  2LFN A;  4K6D A;  4O42 A;  1DOM A;  1Z6H A;  4C3J G;  1W6J A;  4RH6 A;  3N52 A;  3EQL C;  3NTK A;  1XXG A;  3S2H B;  3GTG B;  1AZQ A;  4FXD A;  4OIJ A;  1B1Z A;  2EOT A;  3PUV A;  2WB1 B;  2MJ8 A;  5DEH A;  3TME A;  2NWG A;  4XT3 B;  3D6C A;  1KDA A;  1NUC A;  2AQ3 B;  3ZYY X;  1KAA A;  1TWC B;  3VA7 A;  1ESF A;  1TS5 A;  5EKK A;  5C0X J;  3TP5 A;  1V1P B;  2Z4I A;  1A3U A;  1G2S A;  3J81 L;  1ZEQ X;  5D65 A;  3DXJ C;  2NVQ B;  4IN3 A;  3TN2 A;  3S17 B;  1G91 A;  3TP8 A;  2EYP A;  2YYZ A;  1TQO A;  2B2Y C;  2F0K A;  3SK8 A;  1SNQ A;  5EKL A;  4CKC A;  4XTC S;  3DMU A;  3FPP A;  1H9J A;  3BVZ A;  2D5D A;  2B2Y A;  3SDZ A;  3Q24 A;  4FF2 A;  3A7A B;  3HP3 A;  2H4O A;  1TS3 A;  2Q8R E;  3GTO B;  2QIL A;  4KHV A;  3HOV B;  3MC0 B;  1H9S A;  1R4Q B;  2DNE A;  2EYH A;  4KD4 A;  2PMZ B;  5COY A;  4KN7 C;  5IOC A;  1C48 A;  2HUG A;  3DWP A;  1KNE A;  2IPK D;  3D8G A;  3VYR A;  4PV1 C;  4F7X A;  2ZXR A;  1JOR A;  2IX1 A;  2F0T A;  3GV3 A;  2L0C A;  2F0W A;  4NP5 A;  4C3J B;  1WD1 A;  1B9M A;  1E2V A;  2JA8 B;  2Q8T A;  5IGF A;  5NUC A;  2TMP A;  2OF1 A;  1QJO A;  5C0X I;  2E2J B;  1T5X D;  3MXP A;  1W6K A;  1BR9 A;  3X3N A;  2CW0 C;  4XYO A;  4RCN A;  1D5X C;  3BDO A;  2KEC A;  3BYT B;  2X6L A;  2NTT A;  3NQT A;  4HMI A;  5EPK A;  2FMC A;  1SMY C;  5FK9 C;  5CV9 A;  4N9P A;  2EJF C;  4XXE A;  3CHB D;  1B44 D;  4KJO A;  2SNS A;  3KK7 A;  2F0S A;  2NN6 H;  3JAM L;  2MPM A;  3AU7 A;  5DNF A;  3T16 A;  1Z47 A;  3C2P A;  2A69 C;  4OO1 G;  1TY0 A;  3NHH A;  1ML0 D;  2KA7 A;  2KCN A;  2N55 A;  3NBI A;  4RKB A;  2CW0 D;  3L9A X;  2Z4H A;  3WOF A;  2L9H A;  4CKE A;  4DA2 A;  3QB3 A;  1QE6 A;  1SMY D;  2J7Z A;  1QB5 D;  3K7A B;  3S14 B;  3Q22 A;  2MP1 A;  2WP8 J;  3G7L A;  2PQE A;  1JIC A;  3IAY A;  3C1F A;  4XT1 B;  1LTI D;  4FXG C;  5C44 B;  5D3D A;  3TDQ A;  5KNB A;  1B53 A;  2A69 D;  1I4G A;  1FGB D;  3GTQ B;  1SND A;  3DWA A;  4LK1 C;  4X3S A;  5EBC A;  3I4M B;  1DXM A;  1HHV A;  2XRS D;  1PRT C;  2K5Q A;  2J4X A;  1KLG D;  3HOY B;  1CZW A;  3A56 A;  1EIH A;  4ME5 A;  1JWM D;  1I4R A;  2MUY A;  3OSO A;  4LJZ C;  1PTO B;  1CQV A;  4K6L A;  1F9Q A;  3HOU B;  3OW7 A;  1PYW D;  4BA1 I;  4J6H A;  3MWY W;  4M1U B;  2M00 A;  1BCP B;  2R3Z A;  2F0E A;  1H9K A;  4MN3 A;  1GUO A;  5CV6 A;  4XQN A;  3K5N A;  1WTR A;  4ZRZ A;  2F0L A;  3CRK C;  4RKL A;  1WVL A;  4ZUJ A;  1Y8N B;  5CV4 A;  1LAC A;  3QO2 A;  1PRT D;  1LTB D;  4IFD H;  1QOH A;  2O2L D;  1FNU A;  5G3L F;  1EWH A;  3EA6 A;  1CTM A;  2K28 A;  2NVX B;  5IGG A;  1J8I A;  3PV0 A;  1K8O A;  5A2Q L;  4RGT A;  1I6H B;  2B39 A;  1EQV A;  3CU7 A;  1ZKO A;  2R92 B;  1TU2 B;  2RVL A;  1FYC A;  4Y7N B;  1EOT A;  4H7B A;  2G9D A;  3ND9 A;  4BY1 B;  2Q8I B;  3RUZ A;  5JEA H;  3K6O A;  4IUU A;  1HUN A;  5CBA E;  2K5W A;  1Y1V B;  2NBF A;  4ABN A;  4DU9 A;  2K04 A;  1DJR D;  2F0U A;  5J39 A;  3PUX A;  1LT6 D;  3T13 A;  4ZK9 B;  2WAC A;  1HTP A;  4CJ2 C;  2FMM A;  4FP5 D;  3S9W A;  3NBH A;  5EBD A;  3J7A V;  4CKB A;  3SK4 A;  1KLU D;  3I4N B;  2KUM A;  4K2L A;  1I4Q A;  3X3M A;  2JP1 A;  1WTX A;  1JR0 D;  1RHP A;  5LL6 S;  4PNY A;  4ZUI A;  4XQQ A;  4XYQ A;  3FVQ A;  1D5Z C;  2D2C C;  2ID0 A;  1F9S A;  3P75 A;  4A3M B;  3V96 A;  5KYL A;  3BVM A;  1TR5 A;  2DNC A;  5EQ0 A;  4DAV A;  1DOL A;  1XWE A;  2NZ1 D;  5LL6 X;  2Z1C A;  4ODG A;  2D9U A;  1EU3 A;  5CMD A;  4PQX A;  1HRJ A;  5D14 A;  2KVM A;  2E75 C;  1U4R A;  2VXW A;  4C56 C;  4CJ1 B;  1SYF A;  2F1M A;  1LTG D;  4ZYS A;  5KRU A;  3PMF A;  1TKW B;  1G29 1;  4HR7 B;  1F2L A;  3MXN A;  5C0X G;  2KOL A;  3KLS X;  4RHR A;  3DM1 A;  4MHE A;  2F0P A;  3VR2 A;  1EEF D;  3D4D A;  2EYJ A;  2XN9 C;  3RZD B;  2M2L A;  3PO3 B;  4DAY A;  2HQE A;  3PUW A;  4F88 A;  1BXT A;  1GHK A;  1PZI D;  1MSH A;  2CHB D;  5C5M A;  1SBB B;  4ZAI A;  3NK9 A;  2OXP A;  2KHS A;  2KEE A;  1S5D D;  2WIN B;  3A8K E;  3ERO A;  4ZKB B;  3OIP A;  5C4J B;  1U4L A;  1PDQ A;  3FDT A;  3VR3 A;  4HCE A;  2EZV A;  1HQM C;  2K1B A;  1MSG A;  1GOZ A;  4ULL A;  2JA6 B;  1Q3L A;  3EVQ A;  5KGU A;  1GXD C;  1SYD A;  2XWJ B;  1AEX A;  1QNK A;  3V2T A;  4CGY B;  3C3L A;  1LT5 D;  4FXK C;  2A73 B;  4K5W A;  3EFX D;  1M4V A;  1S4Z A;  1V1P A;  4A93 B;  1MD2 D;  3H3V C;  5M5W B;  5F2D A;  2E76 C;  3IL8 A;  1ET9 A;  5EKI A;  5KEE A;  1YNN C;  4DNR B;  1I4P A;  3L3O C;  2EVB A;  5ELC A;  2ZXP A;  3K57 A;  4KK7 A;  2RDG A;  3K5L A;  4N9T A;  2HCI A;  5IT9 E;  4EQO A;  1U4P A;  1GUN A;  3SK5 A;  2KQ3 A;  4CHT B;  2BCO A;  3NWS A;  1HPC A;  3TP6 A;  4R8N A;  2D62 A;  4ILW A;  3D4R A;  1F9R A;  4RA8 A;  1CT1 D;  2F0F A;  3QWN A;  4DAP A;  4H13 C;  3SR1 A;  3DEP A;  3ONA B;  1YNN D;  2BE5 C;  3VA5 A;  1SYB A;  1RKN A;  3MFY A;  1D1K A;  3K59 A;  5CGK A;  2EXZ A;  5I6Y A;  1CHP D;  3PUZ A;  3TZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...