1EYAA

Structure of s. nuclease stabilizing quintuple mutant t33v/t41i/p117g/h124l/s128a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMVFRLLLVDIPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eyaA00
2RBMA 1II3A 1STGA 3MZ5A 3R3OA 5EKLA 5ISRA 5JAVA 4HMJA 3SR1A 2F3VA 2EY6A 5I9PA 5KRUA 2F0FA 1JOKA 3C1FA 1STHA 2KHSA 3DHQA 3OSOA 5I9OA 3U9OA 3TP6A 1A2UA 5CV7A 3VA5A 1TR5A 2PYKA 4K8IA 4KV6A 4PMCA 5HGTA 4NKLA 4PMBA 5IGEA 1JOQA 4R8NA 3SHLA 1JOOA 3HEJA 3QB3A 4WORA 1A3TA 4K5WA 3H6MA 1SYGA 2OXPA 4DGZA 2OF1A 4ZQ3A 3OMCA 2F0EA 1EY8A 2F0JA 2KQ3A 4N9PA 3TP5A 4EQOA 1EY5A 4EVOA 3EVQA 1SYEA 4KY7A 4K6DA 1SNOA 5J1ZA 1ENAA 1SYDA 4K2LA 3V2TA 5KGUA 4F8MA 3D6CA 4F7XA 5NUCA 4S3SA 2F0HA 5J22A 4H7BA 1IHZA 1STYA 5CC4A 5IGCA 4ZUIA 5C3XA 1SNDA 2F3WA 3QOLA 4N9TA 4EQNA 1A3VA 2PZWA 4NP5A 3SK6A 2ENBA 3NP8A 3NK9A 3T16A 5K5PA 3NXWA 1SYFA 4K5XA 1EY9A 5IGBA 4NDXA 2F0LA 1EY7A 4HTHA 4QB4A 4DU9A 5KIXA 2F0SA 3C1EA 5KYLA 2EYLA 4NMZA 4IUNA 1F2YA 2F0UA 5E1FA 3RUZA 4E6IA 2F0WA 1AEXA 4G57A 3LX0A 5IIFA 2EYFA 5J39A 1SNPA 2F0PA 2PW5A 1JORA 5C5MA 3HZXA 2F0MA 1SYBA 2EY2A 2F0GA 2M00A 4B9XA 2OEOA 5EGTA 2EY5A 3ITPA 2RDFA 4ID6A 1KDCA 3OMGA 4KD3A 3T13A 3BDLA 2EYPA 1EZ8A 5KYIA 2EYJA 3BDCA 1NUCA 1KABA 3D8GA 3NHHA 3EJIA 5CV5A 4K8JA 2PW7A 2F0IA 3NQTA 1U9RA 5I6WA 1EYCA 1A2TA 1EY4A 2F0DA 2PQEA 2WACA 1SYCA 3MXPA 1F2MA 4KY5A 5DEHA 3S9WA 4J6HA 4K2KA 4KJOA 5JOBA 1KDBA 1ENCA 2F0TA 3MHBA 4RKLA 3DMUA 3NUCA 3PMFA 5CR3A 4EQPA 4IALA 2NUCA 3SK8A 2SNSA 1NSNS 2F0NA 2F0VA 1SNCA 3SK5A 5IGFA 3MEHA 3TP7A 4B9WA 5IODA 4KHVA 4QMGA 1KDAA 5CV8A 3SK4A 1SNMA 4ZUJA 2F0KA 3TMEA 5CGKA 5IGGA 1SNQA 5KEEA 2HQEA 1EYDA 5C3WA 3D4WA 4DF7A 2EYHA 4HMIA 5I6YA 5C6AA 1EY0A 4J1MA 2PZUA 3ERQA 3EROA 4KJNA 5C5LA 5C4ZA 5F2DA 2F0OA 4K5VA 5CV4A 5IGDA 4KD4A 5E3FA 5CV6A 4ODGA 4ME5A 3TP8A 1EQVA 3OWFA 4IZ8A 2RKSA 4KTAA 2EYMA 1TQOA 4PNYA 3E5SA 3SXHA 1STBA 1EY6A 1EZ6A 2SOBA 5DAUA 2EXZA 2EYOA 4K14A 5HURA 4I65A 1EYAA 2LKVA 1STAA 2PZTA 1RKNA 2O4XA 2QDBA 5CV9A 3P75A 2F0QA 4OL7A 4QF4A 5M9OA 1TT2A 4RKBA 4TRDA 4YIJA 3QOJA 4LAAA 1F2ZA 4KY6A 3MVVA 5C4HA 1A3UA 2SNMA 3P1HA 2EY1A 3D4DA 1STNA 1KAAA 4MIUA 4WRDA 4DFAA 5IOCA 5EKKA
chains in the Genus database with same CATH superfamily
2RA4A 4A3KH 3IFDA 4A3CH 3ONAB 3W1GA 3AQQA 1CSPA 1JOKA 3CQZH 4DN4M 1YZ6A 1NBWA 3NBHA 4DR3Q 1PH4A 1MBYA 4KV6A 4J15A 1RF2D 3U50C 3G48A 2QA4A 5IT9L 3OMCA 2OCEA 3FKIG 1EY8A 4EVOA 1TY0A 3ER0A 5EAYA 2NZ1D 2CVRA 4C3IB 3TS2A 3V2TA 2B2WC 3HOZH 1N9WA 3OWEB 1EWIA 4AH6A 5FKAC 4DPGA 4EQNA 2EJGC 4DV4L 3S2DB 4A3JB 4ABNA 5FLXE 3I73A 5JJIA 1RTOA 1SMYD 1FL0A 2ZM6Q 1IYJB 4OIKA 2JA6H 1CSQA 4DR1L 1H9RA 1SE3A 3LX0A 4G57A 3PIPA 1ET6A 2A68D 3H3VI 5J39A 3M4OH 1SNPA 4DUZQ 4BBRB 2KBNA 1PH6A 4C2MH 3ERSX 2F52A 3A8IE 2IX3A 2RDFA 3TDQA 3G71A 1G51A 1TS3A 1JB3A 2EYPA 4DR1Q 1BF4A 1PTOB 1EOVA 1NAPA 1WTRA 2NVXH 5DEHA 2NYZD 1I4QA 1SMYC 1D2BA 4GNXB 1XPRA 3I4MH 4RGOS 2A68C 1CUKA 3CF5A 3Q23A 1PH5A 4YHHQ 3CCJA 4QMGA 3K0YA 1I4GA 1HZBA 1O78A 2AQ3B 3TMEA 1MJCA 2LY7A 3S1RH 2J7ZA 2JJQA 2LXJA 3J80E 2R7FA 2R7ZG 4A76A 3A8JE 3NQIA 1LTRD 2ZTDA 1Q8KA 1H95A 3HKZB 2K04A 1I6HH 2N55A 2VB3X 1UAPA 4DNRB 2F1MA 1XNRL 2O4XA 4A3KB 3I4NB 4OL7A 1LTGD 1K0SA 4YIJA 4LAAA 3F2BA 3AFQA 3CQZB 3PUYA 2XRSD 5JVH3 2Q8TA 1STNA 4HSPA 3HKZE 3I4LA 4KLKA 3EIVA 5EKKA 1II3A 2MO1A 2K5DA 5LMNW 1NMGA 1I50H 1X3GA 4X62L 1D5MC 3J81c 2QEJC 4KK7A 2HHHL 4XT1B 2E2DC 1HNXL 1Q12A 3HOZB 1DCZA 1K9MC 5C4JH 4WORA 4R4TA 2JA5G 4IUUA 4X62Q 4HIDA 2HHHQ 1Y14B 3BVZA 5E4XA 3JAMi 1HNXQ 5CYUA 4K0KL 1RDPD 1PA6A 2B63G 2HIXA 2F3IA 5CC4A 1ML0D 3QOLA 4CBVA 1NMFA 2ICEC 1VQKA 1LV9A 4PZ6A 1XX8A 4EGVA 2JYOA 3SE0A 5JVG3 1VQHA 3PIO3 4A3MH 4K0KQ 4AYBG 1KHIA 4B3ML 1GXDC 4UY8C 1QB5D 4XXEA 2MJ8A 2PNRC 4QQBX 1R4PB 1A15A 1ET9A 3RLNA 2JA8H 2IX0A 2L15A 3A55A 5EGTA 1W3SA 3NE5B 1IXRA 1K28A 2AQ2B 3T56B 1EYGA 2E2IH 2K5NA 1SN8A 1VQBA 4IOAA 5E7NA 2CH4A 1P8LA 1Z9FA 1A8VA 4QGUA 4NB3A 4QY7A 1YNXA 3MXNA 5FJ8G 1X65A 1S5CD 3NENA 3S1RB 1QUQA 1PH9A 5IGFA 3H15A 3TP7A 1AP0A 3GQBA 3CRKC 1HZ9A 4CJ0B 1H9JA 2F0KA 3IL8A 2VB2X 5C44H 1QNUA 3E9IA 3URYA 3EROA 2EDGA 3K6OA 2F0OA 2RKSA 5BN3A 1HQMC 2L0CA 2R3ZA 2SOBA 1BDOA 2A6HD 5ELDA 1EYAA 4ULLA 1IYVA 1STAA 2JK8A 1UEAB 4KY6A 1I50B 4N8X1 5C4HA 1RHPA 1KAAA 4Q0FA 3OYYA 4CDDC 1E22A 4FO2A 1LTSD 2WKDA 4ILWA 1Q81C 1MD2D 5ELOA 2A6HC 2QKIC 1XPOA 3H3VH 4IJLA 1JB7A 5FLXc 3CCMA 1TWAH 2EVBA 3GTOH 1LT3D 2KHIA 1HRJA 4IOCA 3CC2A 3ICEA 2A6ED 1HTPA 4C3HB 5NUCA 2ASBA 1GD7A 1STYA 4RWSC 2B2UA 1MGSA 3TZUA 2NTTA 3TQYA 1DONA 1XNQL 4K5XA 3VR2A 2K52A 2F0LA 4DU9A 4FNFA 3TREA 4JK1C 1CKOA 1WYDA 4MN3A 5C5MA 1XNQQ 2A6EC 4FF3A 4UP8A 1KDCA 3OMGA 1DOKA 1H9SB 3F1ZA 3OTOL 4BY7G 3EJIA 1GUOA 3BJUA 4K8JA 4Q5VA 1PVOA 3EN2A 1RCVD 1B1ZA 1EYCA 3DM1A 3RZDH 2MNAA 1K83H 3J80c 1CKNA 4CKEA 3OTOQ 2MUYA 4BS9A 3PMFA 4ZKCB 2JA5H 3OW7A 3QO2A 4LFCL 3NEMA 2K5VA 1WTWA 1X3EA 3PUVA 4DK1A 1Q8IA 3J7YW 2AQ1B 4LFCQ 4L6TB 1C7YA 2JE6I 3BYYB 1IL8A 4V190 4JBKA 4K5VA 1RODA 3RZOB 1TWCH 3CXCA 4GLXA 2L55A 4UP9A 3PF4A 1PH2A 1ZKOA 2XGTA 1M1KC 2FJ2A 2YU9H 2PCFB 3FPPA 3J81i 2PQAB 4JI8L 1EEID 2Q2IA 4QF4A 5I4DA 3I56A 4LUZA 2K01A 4JBWA 1CZGA 1F2ZA 4DAYA 3I90A 2EY1A 3D4DA 1EWCA 4WRDA 2RHSB 3RNUA 5LL6X 3TZDA 5M3FB 4JI0L 1Y1WG 1Y8OB 2YTVA 5JAVA 4L8JA 1NTGA 2FINB 1PZKD 4TSSA 1GUGA 1HZCA 4G7HC 1I4PA 1SR3A 1HR0L 3WOFA 1L1OB 4JI0Q 3PUWA 3GTKH 3QB3A 2Z1CA 2X69A 1O7LA 5FLMG 1E3PA 1EQTA 5D65A 4A4IA 1JJGA 4C1NK 2BE5D 4IN3A 1PRTF 1VF7A 3MWYW 3HOXB 1E24A 3EVQA 3MAQA 1HR0Q 1I5FA 2PMZE 4K6LA 1AZPA 1IHZA 1N8RC 4Y7NH 2F3WA 1Z47A 3NTHA 1G91A 1ESRA 3K7AH 3NP8A 2I07B 3C46A 1Q1BA 1LTAD 3O13A 1N34Q 4POGA 4NMZA 5EJWA 4DR6Q 3L3OC 5ELBA 3GP7A 1OXTA 5IGBA 4A3DG 1AEXA 1SLJA 2BE5C 2I5MX 2PW5A 1XMOL 3AMUA 1JORA 2I5LX 4A3GG 2CKZB 4RAUC 1K83B 1PLFA 3GTMH 1TXYA 2K33A 1VQCA 1EZ8A 3F8TA 3ULJA 2SDFA 4H13C 1XMOQ 2D9UA 1CI3M 4KKTA 3CAMA 5TSSA 1EY4A 2HQLA 4B08A 2AWOA 1FNUA 4IFDI 3A7LA 2JEBI 4YCWA 5FOBB 1DZ1A 3D31A 2ZJPA 5IP9G 1PH7A 3T1YL 3I72A 1YVCA 1TWCB 5EPKA 2VQFL 4BY1H 1EYDA 5C3EH 1BKBA 1JWMD 2YU9B 3T1YQ 3IRBA 5A2QE 2VQFQ 5JPNC 1NY4A 5M3MG 2R93B 1W6JA 1N36L 1CFMA 1SAPA 2NN6I 4AYBE 4LMQD 2H5XA 4A3FB 1VQMA 2FMMA 4GKKQ 5M9OA 5DNFA 3EA6A 1N36Q 3KF8A 2IW3A 4IPDA 1X54A 4DFAA 3GTKB 2QDLA 4R9WA 1STGA 5IYDH 1YNJD 5J3BA 1VQGA 1LTLA 4OIJA 1DD2A 4POFA 1Y1VB 3GTPH 3PIP3 3JC66 1A6XA 2GN5A 2NN6G 1TS4A 3AYHB 4GN4B 2Y0SB 1JOOA 2XNAC 4JV5L 3SEBA 2KEEA 1JQYD 3OHXC 4Y7NB 2HDLA 1A0IA 2UXDL 1AE2A 2OF1A 4ZQ3A 3K7AB 2F0JA 1FJGL 1S5ED 2WFWA 3VYUA 3TSSA 4X3UA 2E5LL 1YNJC 1FNVA 1Q46A 1YHBA 3I7FA 4ZUIA 2JXMB 3P7JA 1FJGQ 2ENBA 1XWEA 2Y0SE 2OWOA 1T5XD 2Q2TA 1E2ZA 1ICFB 2WB1B 2E5LQ 3GTMB 4KN7C 3J80i 3CCVA 4DUYQ 2EYFA 1KRTA 2EXDA 1FGBD 5LMUL 2N49A 1PFSA 3HZXA 2D0PA 1GHKA 2F0GA 1KD1C 4DNIA 3ZJYC 4A3IB 3BDCA 5LMUQ 3KF6A 2WB1E 3VYRA 2ATWA 1ZYRD 2OTJA 2F0DA 3S15H 3DEOA 2IWHA 1G6PA 3CMAA 1G8ZD 3T4AC 2BDOA 4LF6L 4LF8L 4BY1B 1YJ9A 5C3EB 1N33L 3S14B 1PRTD 5FLMH 3ULPA 4WJ4A 1VQIA 2WAQB 2TMPA 3DM3A 3QJYA 3M4QA 4LF6Q 1JT8A 4HIKA 4MTNA 3HRZC 4A3EB 1N33Q 4A3BG 2B3GA 3I91A 4IJHA 1WJJA 4HCSA 2KECA 5C4XG 3ERQA 5F2DA 2FFKB 3TBIB 1E7ZA 1ICWA 1CQVA 1N32L 1J9OA 1G2SA 2K5WA 1IZ6A 3J7ZC 3GD7A 1PRTC 3HP3A 3HOWG 2WAQE 2VW9A 2P5ZX 3I70A 2G9DA 1S72A 2K4KA 1VF5C 2UXBL 3PCOB 2Z6BA 3P75A 1P16A 1N32Q 2VL6A 3GTPB 1YHQA 2N88A 2SNMA 4ZKBB 3HOUH 1CHPD 4GNXC 3V96A 1I3QH 1OXUA 1RD9D 2UXBQ 2KOLA 3R3OA 4OXPA 2UXCL 3I55A 3NWTA 4OWXB 1STHA 1EIGA 4DV0L 2L12A 3Q6SA 2PYKA 3BDOA 4PMBA 3S1MB 5ELNA 2ZXOA 3S1QH 4DK6C 4DGZA 2KJXA 3I3CA 4DV0Q 4OELB 5LL6S 1TWHB 1SYEA 3STBD 2N8NA 3NPPA 4R4IA 5D3IB 5ELCA 4F8MA 2B29A 3PO2G 4AQYL 1FVIA 1FD7D 5C3XA 5M3MH 4IFDH 2CQOA 1Q3LA 2LMCB 3MFGA 3NK9A 3HOVH 3QR8A 4JI5L 1U4MA 2IL8A 5KYLA 4AQYQ 3PQIA 4IUNA 3T53B 4RHSA 2VUMG 5GAEC 1KRSA 2MQHA 3LNNA 1PH8A 2F0MA 4UP7A 3STBC 1BQQT 4JI5Q 3S15B 2EY5A 1YHAA 4OEMB 2K6AA 1HTLD 4F88A 3CPWA 1TWGH 2M9VA 1KABA 2ZM6L 4DV2L 2MGSA 4KY5A 3X3NA 4DR2L 1WTPA 1GUSA 4A93G 4DUZL 1D8LA 2NN6H 2C9OA 2LSSA 1VQ4A 4ME3A 4F87A 4EQPA 3UI2A 2I46A 4DV2Q 2Z4IA 2DNEA 4PMWA 1EIHA 3TN2A 4OONA 4DR2Q 4J8QA 1CM9A 4OHJA 2QEXA 3GTJB 3P20A 1K73C 2JA7G 1O80A 4QIWB 3PO3G 1PYWD 3G6JB 2NVYH 5LHY1 3KBXA 4HIOA 2KENA 3H91A 4CKBA 4YHHL 2JEAI 4DK0A 4LFAQ 3GTLB 4A3LG 4L5TA 2XWBB 3HOUB 2PI2A 5DAUA 4QIWE 1J8IA 1I3QB 5HURA 2K14A 4XYQA 2F0QA 3NBIA 3GTQB 1WCMH 2DY8A 1QVGA 4BWGB 3A8KE 1K8MA 1RTNA 1K8GA 3CW2C 1VQ8A 5GAGC 4PQXA 3VYSA 3S1QB 2EY6A 3EFXD 1B9MA 1HNZL 1JC7A 2Z6KC 5GAHC 3MEFA 2K32A 3HEJA 2UUBL 1HNZQ 1KQSA 4JI2L 1PYBA 3I4OA 3PUZA 2MP1A 4A3BH 3HOVB 3J81j 2B39A 2NB0A 2B2UC 1G291 2UUBQ 3HOYH 3OOCA 3A0JA 4JI2Q 4N8FA 4RHRA 1LACA 4GNXA 3SK6A 3R8BA 5K5PA 2EPBA 3HOWH 4TVAB 2Z0SA 1IBKQ 1GO3E 5KIXA 2UUCL 1HXYD 3M7GA 4E6IA 2CHBD 3T51B 1TWGB 1QVCA 3BYTB 1UUPA 1V43A 5DM73 4XYOA 5BN5A 1CT1D 1NR4A 1W2BA 2UUCQ 1YJWA 1EU3A 3IKJA 3ITPA 4OGQC 1CQFA 3W1BA 2L5TA 2JA6B 4R1JA 3M4OB 1UEBA 2ALYB 3DXJC 1EWHA 3MTSA 4C2MB 3KFUA 4FF4A 4MZ9A 2NVYB 5CR3A 3N6RA 4DXGA 1C0AA 2KCNA 4B9WA 3M85A 1BCPB 1PDQA 2NVXB 1XTDA 4M1UB 3PO2H 2RVLA 5CBAE 3I4MB 1BO0A 4Z9CB 5BR8L 5I6YA 5C6AA 3JAML 5C4ZA 5CV4A 4JYAL 1TWFH 1BNZA 1UE1A 1B70B 2VUMH 2Z8LA 3MFYA 2OQ0A 3SXHA 4YWMA 5BR8Q 2EQSA 2HD3A 1EY6A 2H4OA 2E8GA 2EXZA 2A69D 1YJNA 4JYAQ 1MSGA 3FKIH 1ESFA 5IT9E 1I6HB 1RJTA 1SJED 1YNND 2OQKA 3H0GG 4A93H 3K58A 5HGQA 2F3VA 2L9HA 5GROA 5DM63 3GDEA 2R61A 3TP6A 1A2UA 4XQJA 1JICA 2IT1A 2C5CA 4QL5A 2DGYA 2XRQD 4DV6L 3HOYB 4C3JG 2BOSA 3PO3H 2EJMA 1QE6A 3Q24A 4DXFA 1YNNC 1ENAA 4JBMA 4XDXA 3DLLA 3S24A 4DV6Q 3ULLA 1SNDA 1A3VA 4CDCC 5C4JB 2ZTEA 4NPSA 4DK3C 4X3TA 2Q2UA 1HPCA 4FYDA 3QWNA 4ALPA 4C56C 2CWPA 4HSVA 4KKUA 3S2HH 2F0UA 3H94A 5IIFA 2IHFA 4B3RL 2Z6KA 4XIGS 1TU2B 1B9NA 2F0PA 3U58A 2EY2A 1HFNA 1TS2A 2OEOA 4IQZA 1NR2A 1PFBA 4ID6A 3OIQA 2Q8RE 4A3MB 1HFGA 1X56A 4B3RQ 2YTYA 1BBUA 2R7ZH 1V1PA 3A54A 5I6WA 2PQEA 2JA8B 4OX9L 5JOBA 3CCLA 4LJZC 4KN4C 2XTIA 3MHBA 3DMUA 5IYBG 2G9HD 4IALA 4ZLTF 2E2IB 3SK8A 3K8AA 4IUVA 1SNCA 1VCIA 4HN7A 4OX9Q 5AFWA 4PV1C 2C35B 3M9BA 1CA5A 2D0OA 2HCCA 2ZXRA 5AJ3L 1VQ7A 4KMUC 4JI4L 1JE4A 3FKIB 1LT5D 3TP8A 1F9PA 1SE8A 3OWFA 3MA2B 5AJ3Q 1L0YB 2ZJQA 1HHVA 4U673 1EZ6A 4JI4Q 3BZDB 3KJOA 5C44B 1A62A 1RKNA 2BH8A 4DV7Q 4JW0A 4MHEA 2E2HH 1C4QA 4R4OA 2NVTH 2B63H 3L0OA 2VY3A 1TKWB 5IOCA 2ZT9C 5EPLA 1QILA 3RD4A 2F0FA 4JCVE 5JPMC 2R92G 3OSOA 1IKMA 3G4SA 1GKHA 1AE3A 1V1OA 1TR5A 2JP1A 3PUXA 4RGNA 1A63A 3T1HQ 4NKLA 1ZXTA 1EIYB 4DAPA 3FVQA 1Y8NB 4BBSG 4IURA 4OO1I 1G6ZA 1H9SA 1Q1EA 3NELA 3KLSX 4EQOA 2VNUD 2FHTA 1NE3A 1SYDA 3A5ZB 4K2LA 2E76C 3D3RA 3S2HB 4S3SA 3L7ZC 3K80C 1LLRD 1TWAB 5CORA 2PZWA 1R4QB 3S1NH 1I94L 2PMZB 4TQUS 2NZHA 1NCVA 1EY9A 4JI1L 5FJ8H 3GTOB 2R6GA 2EYLA 1LO5D 1V1QA 4LF4Q 3PIOA 2R7ZB 2M2LA 3FEWX 4OO1G 4GLAC 1D5XC 4L63B 1I94Q 1KNAA 1YIJA 4JI1Q 3CCRA 3UDIA 3J81L 3T13A 5KNDA 3WDNA 2NVQH 5DLQE 3H0GH 1N34L 1PTOF 3LWEA 1K8OA 1E1OA 4DR6L 3NQTA 4NW2A 1SE4A 4B3TL 4LNQA 3MXPA 4G7ZC 4H02A 2RCFA 3A56A 1GJXA 1MHWC 2F0TA 1TS5A 2PQAA 4C3IG 2KHJA 2WIIB 4CGYB 4B3TQ 3PGZA 4FDBA 1O7IA 1BXTA 2I5HA 2IPKD 5IYCG 5CV8A 4A3JG 3RZDB 5IGGA 4G4KA 2HQEA 3BZCA 3E0JA 4RFBA 5A35A 2L1BA 2VQEL 2V1CC 1WTVA 2JA5B 4BBRG 1S5FD 3VA7A 5IT9c 1OXXK 1B2TA 1L1OA 4JVZA 4UHVA 2E2HB 1IW7D 3CRLC 3M7NA 2VQEQ 1STBA 2NVTB 4NXNL 5FO7B 4G7OC 1NJIC 4TRDA 4HAEA 3PF5A 2MO0A 1GOZA 4I7AA 4AYBB 1KL9A 2AUKA 4NXNQ 1J5EL 4IPGA 4X64L 2IY5B 1X55A 2LS01 4OWTB 1B7YB 4X3KA 4OWWB 1MKHA 3SR1A 4YY3L 1IW7C 1F9SA 2K05A 1FR3A 4O1NA 1V8QA 3C1FA 4GKKL 3S17H 1JWSD 5IP7G 5IYBH 5FK9C 1PXUA 3KDFB 1J5EQ 4X64Q 5H1SE 4YCVA 4GLVB 4CDEC 4GOPB 4HJ8A 4YY3Q 5IWAL 1L2FA 1JJ2A 3K5NA 3FDTA 1SYGA 1GUNA 4X66Q 3MC0B 3S1NB 3W3AA 3TP5A 3RLFA 2RSOA 3HKZG 4BY7H 1HUMA 1EIFA 1ONLA 4U68A 2RF4A 1ZEQX 4RA8A 1VQOA 5IWAQ 2EOTA 2XVSA 1B50A 2SEBD 4APVA 1U4LA 4A3KG 5I2YA 3I4NG 4A3CG 2O2LD 4DR5L 5M5WH 1SBBB 2RQXA 3C1EA 4FXKC 2VXWA 3WOEA 1KXLA 2XSCA 1B44D 3C2PA 4P2CB 1DOMA 4DR5Q 1BCPF 3FHWA 3IFTA 3TEHB 1SSOA 4LW1A 3F2CA 2GA4B 4P71A 3HGBA 5FLXL 5GQOA 1FNWA 4YCUA 3Q22A 1SFOH 4IUTA 3HOZG 3J7AF 4LF9L 4RGMA 4DUYL 1PZID 2GVBA 1VQ9A 4CJ2C 2OTLA 2EIFA 4MNOA 1EFWA 1TY2A 4LF9Q 4BBSH 1D6EC 1K8AC 3CD6A 3BZKA 1O7YA 2EE1A 1MJEA 4QCLA 2NBFA 1H9MA 2ID0A 1PH3A 2J4XA 1BBXC 1KLGD 5C0XJ 1OXSC 2G5DA 1Y1WH 1EY0A 5T1GA 4BXXG 4JG2A 5GADC 1WOCA 5E3FA 1X6OA 3DWAA 4DR7L 4ME5A 4FXGC 1RIPA 3GV6A 4KTAA 1GUTA 4OO1H 2HDMA 3R93A 4WFN3 1M90C 1SJHD 2LXKA 4DR7Q 3J80L 1TT2A 1CZWA 3DWPA 4RKBA 1VQDA 1PTOD 4H44C 3S17B 3S16H 3AFPA 1NNXA 1ZYRC 2E75C 3UE0A 3V05A 4LF5Q 1KNEA 1S5BD 5I9OA 1PZJD 4HJ9A 4C3IH 4GN3B 1B53A 2ICIA 4BY7B 4A3DH 2ES2A 2V4DA 4K8IA 5L37A 3U9SA 3MXGA 5G3LD 5IYCH 1Q82C 1A3TA 1PTOC 4A3GH 4O0AA 3MXUA 5HY6A 1EY5A 3U4ZA 2DY7A 2GVAA 2MHVA 1OXVA 2JSOA 2BCOA 2DNCA 4LUOA 1IYUA 5FO9B 3KLWA 4ZCKA 4BBRH 4X6AH 1TIID 4A75A 5COYA 1I6VC 1BUVT 2X6LA 4NDXA 1MI2A 2K7VA 1PYSB 1F2YA 1GM5A 3NBHB 2K5HA 5IP9H 1VQEA 1SFOB 4X3SA 1DJRD 4CHTB 1UE7A 3VYTA 2FXQA 3K0XA 4QJFA 4XQNA 3CCEA 3M3YH 4RCOA 1ASYA 4NXML 1CA6A 1EQRA 1JCKB 2D2CC 4DAMA 2K1BA 1U5KA 2DJGC 4KI0A 3RN2A 1LTID 1A2TA 3SGIA 3C3LA 4J6HA 4K2KA 2KUMA 3CPFA 3QG1A 4NXMQ 2RHQB 4C3HG 3SK5A 1CTMA 3I2ZA 1Y1WB 2EZVA 4QUCA 4HJ5A 2K03A 2OT2A 1SNMA 3K81C 1VQLA 4ZAIA 4HMIA 2A8VA 4L5QA 3OIPA 1LUZA 3G6EA 3I4NH 5C5LA 4J1MA 4HIMA 2D62A 4FVMA 5IGDA 4EX5A 5CV6A 1AFPA 2CFMA 2YV5A 3NSWA 2E74C 2KCCA 3S16B 1BCPD 1C9OA 2QDBA 3G7LA 2HCIA 1WVLA 5ELFA 3P1HA 1VQNA 3K5MA 4DV5L 4A3DB 4LFAL 1YI2A 5C44G 4LK1C 3MZ5A 5EKLA 4A3GB 1AW7A 4HMJA 3UDFA 1ASZA 1SXTA 2PI2E 4O42A 3DHQA 1WTOA 1BCPC 1AZQA 2UUAL 4DV5Q 1LTTD 1X3FA 3VR6A 3VA5A 1B8AA 3K5OA 1IBML 4I7ZC 4DV4Q 1PRTB 1FGUA 5M5XH 2UUAQ 5JEAG 2YYZA 3K57A 3VR3A 1K3BC 1SNOA 1IBMQ 4TKOB 4RGTA 3K7UC 3CCUA 4BXXH 2K28A 3D6CA 1L0XB 3KK7A 3CCQA 2F4IA 4FF1A 4HCEA 5EQ0A 2QGQA 3DWQA 3BG3A 1SYFA 4C1NI 2MFIA 4QB4A 4HTHA 3IAYA 1RL2A 4LF7L 4RMFA 3RUZA 3M3YB 1BVSA 2B2VA 2Q2HA 3H09A 5M3FG 4QUFA 2Z9HA 4DR4L 4YWKA 2D5DA 1UE6A 5M3MB 1X9NA 1C48A 4Y52H 4LF7Q 1JWUD 3KBGA 4P73A 3BDLA 4WJWA 1MSHA 1IBKL 1C8CA 5C4XH 4H0LC 5CV5A 4DR4Q 1GHJA 1U9RA 2JA9A 1EL0A 3FMCA 3HOXG 2K75A 4RCNA 1FYCA 1E2WA 1LTBD 1NSNS 2QW7A 2XN9C 3MEHA 2CW0D 2O5JC 3SK4A 1QOHA 1D5ZC 3E6ZX 2A74C 3ND8A 1XNRQ 1ILPA 5I2XA 3BVMA 2EYHA 4R8IA 4KD4A 3R2IA 5JJLA 1EU4A 3VDYA 1JE5A 2CW0C 1EQQA 3MXNB 1HNWL 3CKIB 5CV9A 1YEZA 1QUQB 3QOJA 3SDZA 1LABA 3MVVA 1W6KA 1GUWA 4XQQA 2KA7A 5EPJA 1HNWQ 5CMDA 1KIXA 4UPAA 2WV6D 2CH4W 4DNTB 1VQFA 5I9PA 5M5XB 1KC8C 2Z4HA 1WCMB 4C3HH 4HR7B 3L2PA 3UDXA 1DGSA 2DUDA 2RDHA 1UNSA 4K5WA 1IL2A 3H6MA 4UDUC 3TS0A 4B3MQ 4P72A 1VS0A 2R93G 3VR4A 4K6DA 5J1ZA 4RG1A 5JEAJ 1E2VA 4YWLA 4F7XA 1WFQA 2F0HA 3K5LA 2BDNA 4A3FG 5D14A 2B2YC 2RCNA 4N9TA 1Y8PB 2B2WA 4NP5A 5BN4A 4RH6A 4BA2I 1D1IA 2F0SA 4A3BB 2A69C 2F03A 4KHZA 2F0WA 3CP0A 4JI7L 5C4XB 2JA7H 2M00A 1Y1VG 2QF7A 4FP5D 4KD3A 3HOWB 1YBYA 1KAWA 5FO8B 4JI7Q 1Q86C 1M4VA 3CC4A 2Y0SG 1QZGA 3GTGH 1HJPA 1V1PB 1F2MA 3KYHC 2F4VL 4A3LH 2PPBC 4RKLA 1QZHA 4DKAC 3NUCA 4CDFC 1S4ZA 2SNSA 1O7ZA 2K50A 4MTKA 3RZOH 3H3VC 3AEVA 1ENFA 2BA0A 4JBJA 5JEAH 3Q0AA 4HJ7A 2F4VQ 1U4RA 2H1EA 3AU7A 1CKMA 1SE2A 2AKWB 1SNQA 2WB1G 4M8AA 2FMCA 5C3WA 1Z6HA 2IHEA 2PNHA 3VR5A 4AIMA 1ILQA 1L1OC 2EJFC 3W2DA 4DV3L 1QJOA 4ODGA 1LM0A 4B3SL 4JI6L 3EQLC 1CKNB 1HA6A 3PO2B 5M3FH 4A3IG 4I65A 4LUVA 2NZOA 1QVFA 2LKVA 1SMXA 2KVMA 4DV3Q 1QCBD 4B3SQ 4JI6Q 3KLSA 1TWFB 5A2QL 3NTKA 1A3UA 3HFZB 4BY1G 2VUMB 4LFBL 5C3EG 2HIVA 1QWYA 5JJKA 3CU7A 3HOXH 1Q90A 3J7A5 2WAQG 5KNBA 4DV7L 4KKSA 4A3EG 3U9OA 4P75A 4LFBQ 4HJAA 4EQ5A 5HGTA 1X3PA 1JOQA 3SHLA 4JC0A 4V0BA 1U4PA 3A5UA 3F2DA 2F0EA 3NWSA 1L0WA 1GVPA 4A93B 4KY7A 4X65L 1QG7A 2CCZA 2NWGA 1R9TH 1G2TA 4DAYB 4P74A 1VDZA 3OPOA 3T1HL 1EEFD 1JR0D 5IYDG 4FXDA 4UAIA 2A19A 3T16A 2JA7B 4GN5A 3NXWA 2HT1A 2QCPX 4X65Q 1EFID 1EY7A 1M8AA 3PV0A 5D3DA 1DXMA 3PO3B 2B8FA 1PFNA 1OO9B 1I4XA 3GTGB 1Z7TA 3PSIA 4HEDA 3FPUB 3D8GA 4GOPC 1HA5A 3GO5A 2PW7A 2F0IA 4LF4L 1SRUA 2AUJD 1HQRD 3FRPB 2B2YA 1K0RA 2N78A 3JAME 1S40A 1E0BA 1VQJA 2RDGA 2NUCA 2CWAA 4LWCA 2F0NA 2F0VA 2QILA 3BS1A 5IODA 1K3RA 1QNKA 2R93H 1KDAA 3EBEA 2O5IC 1D7QA 5C0XI 3RMHA 1VQAA 2BH2A 3KLRA 4JI8Q 4A3FH 1DYQA 1AH9A 3F2UA 4DF7A 4L5SA 4JOIC 3M4YA 1AN8A 3Q8DA 4KJNA 1WTQA 4WJ3M 4DA2A 5KNCA 2B2TC 4PNYA 3HKSA 4KHPL 3RN5A 2KEDA 2ZXPA 4C3JH 2PZTA 1Y1VH 1XXGA 5C0XG 4ZK9B 4PZ7A 1B3QA 5G3LF 5JJZA 4KHPQ 3NTIA 2KCTA 2VS1A 1LT4D 4XTCS 4MIUA 3CHBD 2ZJRA 3CC7A 1F77A 2RBMA 5ISRA 5IE8A 2HUGA 2ZTCA 5KRUA 4FF2A 2KHSA 4BA1I 1VQ5A 1HCZA 1IKLA 5CV7A 3D6WA 2E2JH 4R8NA 1R9TB 2B63B 1XJVA 3RLOA 2XWJB 2AMCB 3W5OA 2TSSA 4GS3A 1OTCA 3RR5A 4N9PA 1E1TA 2KCMA 4IUQA 2R7DA 5KGUA 3X3MA 3HOUG 3UE1A 3KF8B 4H7BA 4CKCA 1PFMA 3SVMA 4A3IH 4X66L 5CBEE 3KOJA 1Q7YC 2XIWA 3J7AV 3AB9A 1LT6D 2Q8IB 1PHJA 4B9XA 2I0QA 4PZ8A 1WTXA 1B4OA 3GV3A 3S14H 3U4VA 1J6QA 5KYIA 5K36G 3NHHA 4ZYSA 3D4RA 3E3XA 4IFDG 1SYCA 4A3EH 5EBCA 3S9WA 4KJOA 3KUPA 1T9HA 1JMCA 3HOVG 1MIUA 1KDBA 1ENCA 1WD1A 3TRZA 2NVQB 1UWVA 1VMPA 3H0GB 3M4PA 1PMRA 4XT3B 3LGJA 3BVGA 2WKCA 1PV4A 5CGKA 2X6GA 5KEEA 1KTKA 1IBLL 1BR9A 4C3JB 2PZUA 1BOSA 3WWVA 3KF6B 2R92H 3KDFA 3B6YA 1EQVA 4IZ8A 4GOPA 1VQPA 1XPUA 3E5SA 1IBLQ 1V9PA 1T5EA 1XTCD 2MPMA 1DOLA 4K14A 1XYIA 2JA6G 2J0TD 3HS0C 2WINB 3FP9A 2IX1A 1F9QA 2IJ0A 3ZYYX 5M5YH 3S1MH 4JV5Q 3A7AB 2E2JB 2UXDQ 4JI3L 3ND9A 1WD0A 1X32A 3BU2A 3E9HA 4R4QA 1TWHH 4JOIA 1SEBD 4PMCA 3I4MG 4JI3Q 5IGEA 3D0FA 2B2TA 2OXPA 4DV1L 1H9KA 1UE5A 2KQ3A 4LF5L 1B3AA 3L9AX 1WCMG 1HR0W 2AHOB 5J22A 4IUPA 3CMEA 5T1IA 5IGCA 3J81E 4DV1Q 1HUNA 4DAVA 1CK1A 1YITA 2NTSA 1DM0B 1EUJA 2B2VC 2UU9L 5EBDA 4ZRZA 2B8GA 5EKIA 4PG3A 2JQOA 5E1FA 1CHQD 4JPBW 1I4HA 5C0XH 3JAMc 1SYBA 3QIAA 4A3JH 3S2DH 1U0LA 4LF8Q 1S5DD 4IO9A 1D1KA 2UU9Q 2VZAA 3R2TA 3OW2A 5ELEA 1X3QA 1WTHA 5M5WB 4R4CA 2EYJA 2L4NA 1NUCA 1KLUD 3N52A 3UDGA 2RSNA 3GTJH 1SROA 3HOYG 4CJ1B 1PH1A 1HH2P 2WACA 2WP8J 2DJFC 2L11A 4L5RC 3DEPA 3DUZA 2DN8A 4IFDJ 1PTOH 2A5HA 1WI5A 1F2LA 3K59A 3KJPA 3CCSA 5LMNL 2YTXA 4KHVA 2LFNA 1Y69U 3GTLH 5E4WC 1BBWA 2R92B 4ZUJA 4GKJL 1VMCA 3I8ZA 2A1AA 4GZYC 1I4RA 5IY0A 3D4WA 1VQ6A 1S3OA 1SDFA 5LMNQ 2A73B 4BBSB 3GTQH 1XMQL 2JN4A 5IP7H 4IPCA 4GKJQ 1EOTA 4O2DA 4IPHA 2EYMA 1TQOA 5M5YB 2K5QA 3HG9A 4A3MG 3E0EA 1STEA 2EYOA 2UXCQ 1XMQQ 1F9RA 1TVXA 1JJCB 3LWUA 1LYLA 2JA8G 2AWNA 1HZAA 5K36H 2BA1A 2N3SA 2PO4A 4DR3L 3A74A 2CQAA
chains in the Genus database with same CATH topology
2RA4A 3IFDA 3ONAB 1JOKA 4DN4M 3NBHA 1MBYA 4KV6A 1RF2D 5IT9L 3OMCA 1EY8A 4EVOA 1TY0A 2NZ1D 2CVRA 4C3IB 3V2TA 2B2WC 3OWEB 5FKAC 4EQNA 2EJGC 3S2DB 4A3JB 4ABNA 5FLXE 3I73A 1RTOA 1SMYD 4OIKA 1H9RA 1SE3A 3LX0A 4G57A 1ET6A 2A68D 5J39A 1SNPA 4BBRB 3A8IE 2IX3A 2RDFA 3TDQA 1TS3A 1JB3A 2EYPA 1BF4A 1PTOB 1NAPA 1WTRA 5DEHA 2NYZD 1I4QA 1SMYC 1D2BA 4RGOS 2A68C 3Q23A 4QMGA 3K0YA 1I4GA 1O78A 2AQ3B 3TMEA 2LY7A 2J7ZA 3J80E 3A8JE 3NQIA 1LTRD 3HKZB 2K04A 2N55A 2VB3X 1UAPA 4DNRB 2F1MA 2O4XA 4A3KB 3I4NB 4OL7A 1LTGD 4YIJA 4LAAA 3CQZB 3PUYA 2XRSD 5JVH3 2Q8TA 1STNA 4HSPA 3I4LA 5EKKA 1II3A 2K5DA 1D5MC 2QEJC 4KK7A 4XT1B 2E2DC 1Q12A 3HOZB 1DCZA 4WORA 4IUUA 3BVZA 5E4XA 5CYUA 1RDPD 5CC4A 1ML0D 3QOLA 4CBVA 2ICEC 1LV9A 1XX8A 4EGVA 2JYOA 3SE0A 5JVG3 3PIO3 1GXDC 1QB5D 4XXEA 2MJ8A 2PNRC 1R4PB 1A15A 1ET9A 2IX0A 3A55A 5EGTA 3NE5B 2AQ2B 3T56B 3MXNA 1S5CD 3S1RB 5IGFA 3TP7A 1AP0A 3GQBA 3CRKC 4CJ0B 1H9JA 2F0KA 3IL8A 2VB2X 1QNUA 3URYA 3EROA 2EDGA 3K6OA 2F0OA 2RKSA 5BN3A 1HQMC 2L0CA 2R3ZA 2SOBA 1BDOA 2A6HD 5ELDA 1EYAA 4ULLA 1IYVA 1STAA 1UEAB 4KY6A 1I50B 5C4HA 1RHPA 1KAAA 4Q0FA 4FO2A 1LTSD 2WKDA 4ILWA 1MD2D 2A6HC 2QKIC 2EVBA 1LT3D 1HRJA 2A6ED 1HTPA 4C3HB 5NUCA 1STYA 4RWSC 2B2UA 1MGSA 3TZUA 2NTTA 1DONA 4K5XA 3VR2A 2F0LA 4DU9A 4FNFA 4JK1C 4MN3A 5C5MA 2A6EC 4FF3A 1KDCA 3OMGA 1DOKA 1H9SB 3EJIA 1GUOA 4K8JA 4Q5VA 1RCVD 1B1ZA 1EYCA 3DM1A 4CKEA 2MUYA 4BS9A 3PMFA 4ZKCB 3OW7A 3QO2A 1WTWA 3PUVA 4DK1A 1Q8IA 3J7YW 2AQ1B 4L6TB 2JE6I 3BYYB 1IL8A 4V190 4K5VA 1RODA 3RZOB 2L55A 1ZKOA 2FJ2A 2PCFB 3FPPA 1EEID 4QF4A 5I4DA 2K01A 4JBWA 1CZGA 1F2ZA 4DAYA 3I90A 2EY1A 3D4DA 1EWCA 4WRDA 5LL6X 3TZDA 5M3FB 1Y8OB 5JAVA 4L8JA 2FINB 1PZKD 4TSSA 1GUGA 4G7HC 1I4PA 3WOFA 3PUWA 3QB3A 2Z1CA 2X69A 1O7LA 1EQTA 5D65A 4C1NK 2BE5D 4IN3A 1PRTF 1VF7A 3MWYW 3HOXB 3EVQA 3MAQA 4K6LA 1AZPA 1IHZA 2F3WA 1Z47A 3NTHA 1G91A 1ESRA 3NP8A 2I07B 3C46A 1Q1BA 1LTAD 3O13A 4NMZA 5EJWA 3L3OC 5ELBA 3GP7A 1OXTA 5IGBA 1AEXA 2BE5C 2PW5A 3AMUA 1JORA 4RAUC 1K83B 1PLFA 2K33A 1EZ8A 2SDFA 4H13C 2D9UA 1CI3M 4KKTA 5TSSA 1EY4A 4B08A 2AWOA 1FNUA 4IFDI 3A7LA 2JEBI 5FOBB 1DZ1A 3D31A 3I72A 1TWCB 5EPKA 1EYDA 1JWMD 2YU9B 5A2QE 5JPNC 2R93B 1W6JA 1CFMA 1SAPA 2NN6I 4LMQD 4A3FB 2FMMA 5M9OA 5DNFA 3EA6A 3KF8A 2IW3A 4DFAA 3GTKB 4R9WA 1STGA 1YNJD 4OIJA 1DD2A 1Y1VB 3PIP3 1A6XA 2NN6G 1TS4A 2Y0SB 1JOOA 2XNAC 3SEBA 2KEEA 1JQYD 3OHXC 4Y7NB 2HDLA 2OF1A 4ZQ3A 3K7AB 2F0JA 1S5ED 3VYUA 3TSSA 4X3UA 1YNJC 1FNVA 4ZUIA 2JXMB 3P7JA 2ENBA 1XWEA 1T5XD 1E2ZA 2WB1B 3GTMB 4KN7C 2EYFA 1FGBD 3HZXA 1GHKA 2F0GA 4A3IB 3BDCA 3VYRA 1ZYRD 2F0DA 3DEOA 2IWHA 1G8ZD 3T4AC 2BDOA 4BY1B 5C3EB 3S14B 1PRTD 2WAQB 2TMPA 3QJYA 3HRZC 4A3EB 3I91A 4HCSA 2KECA 3ERQA 5F2DA 2FFKB 3TBIB 1ICWA 1CQVA 1J9OA 1G2SA 2K5WA 3GD7A 1PRTC 3HP3A 3I70A 2G9DA 1VF5C 3P75A 3GTPB 2N88A 2SNMA 4ZKBB 1CHPD 3V96A 1OXUA 1RD9D 2KOLA 3R3OA 3NWTA 1STHA 1EIGA 2L12A 3Q6SA 2PYKA 3BDOA 4PMBA 3S1MB 2ZXOA 4DGZA 2KJXA 3I3CA 5LL6S 1TWHB 1SYEA 3NPPA 5D3IB 5ELCA 4F8MA 1FD7D 5C3XA 4IFDH 1Q3LA 2LMCB 3MFGA 3NK9A 1U4MA 2IL8A 5KYLA 4IUNA 3T53B 4RHSA 3LNNA 2F0MA 1BQQT 3S15B 2EY5A 2K6AA 1HTLD 4F88A 2M9VA 1KABA 2MGSA 4KY5A 3X3NA 1WTPA 1GUSA 2NN6H 2C9OA 4F87A 4EQPA 3UI2A 2I46A 2Z4IA 2DNEA 4PMWA 1EIHA 3TN2A 4J8QA 1CM9A 4OHJA 3GTJB 3P20A 1O80A 4QIWB 1PYWD 3G6JB 5LHY1 3KBXA 3H91A 4CKBA 2JEAI 4DK0A 3GTLB 2XWBB 3HOUB 5DAUA 1J8IA 1I3QB 5HURA 4XYQA 2F0QA 3NBIA 3GTQB 2DY8A 4BWGB 3A8KE 1K8MA 1RTNA 4PQXA 3VYSA 3S1QB 2EY6A 3EFXD 1B9MA 1JC7A 2K32A 3HEJA 3PUZA 2MP1A 3HOVB 2B39A 2NB0A 2B2UC 1G291 3OOCA 4RHRA 1LACA 3SK6A 3R8BA 5K5PA 2EPBA 5KIXA 1HXYD 3M7GA 4E6IA 2CHBD 3T51B 1TWGB 3BYTB 5BN5A 1UUPA 5DM73 1V43A 4XYOA 1CT1D 1NR4A 1EU3A 3IKJA 3ITPA 4OGQC 1CQFA 2L5TA 2JA6B 3M4OB 3DXJC 1EWHA 3MTSA 4C2MB 4FF4A 2NVYB 5CR3A 3N6RA 4DXGA 2KCNA 4B9WA 3M85A 1BCPB 1PDQA 2NVXB 4M1UB 2RVLA 5CBAE 3I4MB 1BO0A 4Z9CB 5I6YA 5C6AA 3JAML 5C4ZA 5CV4A 1BNZA 2Z8LA 3MFYA 3SXHA 1EY6A 2H4OA 2EXZA 2A69D 1MSGA 1ESFA 5IT9E 1I6HB 1RJTA 1SJED 1YNND 3K58A 2F3VA 2L9HA 5DM63 2R61A 3TP6A 1A2UA 4XQJA 1JICA 2IT1A 2C5CA 2XRQD 3HOYB 4C3JG 2BOSA 2EJMA 1QE6A 3Q24A 4DXFA 1YNNC 1ENAA 4XDXA 1SNDA 1A3VA 5C4JB 4X3TA 1HPCA 4FYDA 3QWNA 4C56C 4HSVA 4KKUA 2F0UA 3H94A 5IIFA 4XIGS 1TU2B 1B9NA 2F0PA 1HFNA 2EY2A 1TS2A 2OEOA 4IQZA 1NR2A 1PFBA 4ID6A 3OIQA 2Q8RE 4A3MB 1HFGA 1V1PA 3A54A 5I6WA 2PQEA 2JA8B 5JOBA 4LJZC 4KN4C 3MHBA 3DMUA 2G9HD 4IALA 4ZLTF 2E2IB 3SK8A 4IUVA 1SNCA 1VCIA 4HN7A 5AFWA 4PV1C 1CA5A 2HCCA 2ZXRA 4KMUC 1JE4A 3FKIB 1LT5D 3TP8A 1F9PA 3OWFA 3MA2B 1L0YB 1HHVA 4U673 1EZ6A 3BZDB 5C44B 1RKNA 4MHEA 1C4QA 1TKWB 5IOCA 2ZT9C 5EPLA 1QILA 3RD4A 2F0FA 5JPMC 3OSOA 1IKMA 1V1OA 1TR5A 2JP1A 3PUXA 4RGNA 4NKLA 1ZXTA 4DAPA 3FVQA 1Y8NB 4IURA 4OO1I 1G6ZA 1H9SA 1Q1EA 3KLSX 4EQOA 2VNUD 2FHTA 1SYDA 4K2LA 2E76C 3D3RA 3S2HB 4S3SA 3L7ZC 1LLRD 1TWAB 5CORA 2PZWA 1R4QB 2PMZB 4TQUS 1EY9A 1NCVA 3GTOB 2R6GA 2EYLA 1LO5D 2R7ZB 2M2LA 3FEWX 4OO1G 1D5XC 4L63B 1KNAA 3J81L 3T13A 5KNDA 3WDNA 1PTOF 3LWEA 1K8OA 3NQTA 4NW2A 1SE4A 3MXPA 4G7ZC 3A56A 1GJXA 2F0TA 1TS5A 4C3IG 2WIIB 4CGYB 1BXTA 2IPKD 5CV8A 3RZDB 5IGGA 4G4KA 2HQEA 3E0JA 4RFBA 5A35A 2L1BA 1WTVA 2JA5B 1S5FD 3VA7A 1OXXK 1B2TA 2E2HB 1IW7D 3CRLC 3M7NA 1STBA 2NVTB 5FO7B 4G7OC 4TRDA 4HAEA 1GOZA 4AYBB 2AUKA 2LS01 4X3KA 3SR1A 1IW7C 1F9SA 2K05A 1FR3A 4O1NA 1V8QA 3C1FA 1JWSD 5FK9C 1PXUA 3K5NA 3FDTA 1SYGA 1GUNA 3MC0B 3S1NB 3W3AA 3TP5A 3RLFA 2RSOA 1HUMA 1ONLA 4U68A 1ZEQX 4RA8A 2EOTA 2XVSA 1B50A 2SEBD 1U4LA 5I2YA 2O2LD 1SBBB 2RQXA 3C1EA 4FXKC 2VXWA 3WOEA 2XSCA 1B44D 3C2PA 4P2CB 1DOMA 1BCPF 3IFTA 1SSOA 2GA4B 3HGBA 5FLXL 1FNWA 3Q22A 3J7AF 4IUTA 4RGMA 1PZID 4CJ2C 1TY2A 1D6EC 1O7YA 2EE1A 4QCLA 2NBFA 1H9MA 2ID0A 2J4XA 1BBXC 1KLGD 5C0XJ 1OXSC 1EY0A 5T1GA 5E3FA 3DWAA 4ME5A 4FXGC 3GV6A 4KTAA 1GUTA 4OO1H 2HDMA 3R93A 4WFN3 1SJHD 3J80L 1TT2A 1CZWA 3DWPA 4RKBA 1PTOD 4H44C 3S17B 1ZYRC 2E75C 3V05A 1KNEA 1S5BD 5I9OA 1PZJD 1B53A 2ICIA 4BY7B 2V4DA 4K8IA 3U9SA 3MXGA 5G3LD 1A3TA 1PTOC 3MXUA 1EY5A 2DY7A 2MHVA 1OXVA 2JSOA 2BCOA 2DNCA 1IYUA 5FO9B 1TIID 5COYA 1I6VC 1BUVT 2X6LA 4NDXA 1MI2A 2K7VA 1F2YA 1SFOB 4X3SA 1DJRD 4CHTB 3VYTA 4XQNA 4RCOA 1CA6A 1JCKB 2D2CC 2K1BA 4KI0A 1LTID 1A2TA 3C3LA 4J6HA 4K2KA 2KUMA 3QG1A 4C3HG 3SK5A 1CTMA 1Y1WB 2EZVA 4QUCA 2K03A 2OT2A 1SNMA 4ZAIA 4HMIA 3OIPA 5C5LA 4J1MA 2D62A 4FVMA 5IGDA 5CV6A 1AFPA 3NSWA 2E74C 2KCCA 3S16B 1BCPD 2QDBA 3G7LA 2HCIA 1WVLA 5ELFA 3P1HA 3K5MA 4A3DB 4LK1C 3MZ5A 5EKLA 4A3GB 1AW7A 4HMJA 1SXTA 4O42A 1WTOA 3DHQA 1AZQA 1BCPC 1LTTD 3VR6A 3VA5A 3K5OA 4I7ZC 1PRTB 5JEAG 2YYZA 3K57A 3VR3A 1SNOA 4TKOB 4RGTA 2K28A 3D6CA 1L0XB 3KK7A 2F4IA 4FF1A 4HCEA 5EQ0A 3DWQA 3BG3A 1SYFA 4C1NI 4QB4A 4HTHA 3IAYA 3RUZA 3M3YB 2B2VA 3H09A 4QUFA 2D5DA 5M3MB 1C48A 1JWUD 3KBGA 3BDLA 4WJWA 1MSHA 1C8CA 4H0LC 5CV5A 1GHJA 1U9RA 1EL0A 3FMCA 4RCNA 1FYCA 1E2WA 1LTBD 1NSNS 2XN9C 3MEHA 2CW0D 2O5JC 3SK4A 1QOHA 1D5ZC 3E6ZX 2A74C 3ND8A 1ILPA 5I2XA 3BVMA 2EYHA 4R8IA 4KD4A 3R2IA 1EU4A 2CW0C 3CKIB 5CV9A 3QOJA 3SDZA 1LABA 3MVVA 1W6KA 1GUWA 4XQQA 2KA7A 5EPJA 5CMDA 2WV6D 4DNTB 5I9PA 5M5XB 2Z4HA 1WCMB 4HR7B 2RDHA 1UNSA 4K5WA 3H6MA 4UDUC 3VR4A 4K6DA 5J1ZA 5JEAJ 1E2VA 4F7XA 2F0HA 3K5LA 2BDNA 5D14A 2B2YC 4N9TA 1Y8PB 2B2WA 4NP5A 5BN4A 4RH6A 4BA2I 1D1IA 2F0SA 4A3BB 2A69C 2F03A 4KHZA 2F0WA 5C4XB 2M00A 2QF7A 4FP5D 4KD3A 3HOWB 5FO8B 1M4VA 1V1PB 1F2MA 2PPBC 4RKLA 3NUCA 1S4ZA 2SNSA 1O7ZA 3H3VC 1ENFA 2BA0A 5JEAH 3Q0AA 1U4RA 2H1EA 3AU7A 1SE2A 1SNQA 4M8AA 2FMCA 5C3WA 1Z6HA 3VR5A 1ILQA 2EJFC 3W2DA 1QJOA 4ODGA 3EQLC 1HA6A 3PO2B 4I65A 2LKVA 2KVMA 1QCBD 3KLSA 1TWFB 5A2QL 3NTKA 1A3UA 2VUMB 1QWYA 3CU7A 1Q90A 5KNBA 4KKSA 3U9OA 5HGTA 1X3PA 1JOQA 3SHLA 4V0BA 1U4PA 2F0EA 3NWSA 4A93B 4KY7A 1QG7A 2NWGA 1G2TA 1VDZA 3OPOA 1EEFD 1JR0D 4FXDA 4UAIA 3T16A 2JA7B 3NXWA 2QCPX 1EFID 1EY7A 1M8AA 3PV0A 5D3DA 1DXMA 3PO3B 2B8FA 1PFNA 1OO9B 1I4XA 3GTGB 1Z7TA 4HEDA 3FPUB 3D8GA 1HA5A 3GO5A 2PW7A 2F0IA 2AUJD 1HQRD 3FRPB 2B2YA 3JAME 1E0BA 2RDGA 2NUCA 2F0NA 2F0VA 2QILA 3BS1A 5IODA 1QNKA 1KDAA 2O5IC 5C0XI 3RMHA 3KLRA 1DYQA 3F2UA 4DF7A 3M4YA 1AN8A 1WTQA 4KJNA 4DA2A 5KNCA 2B2TC 4PNYA 2KEDA 2ZXPA 2PZTA 1XXGA 5C0XG 4ZK9B 5G3LF 5JJZA 3NTIA 1LT4D 4XTCS 4MIUA 3CHBD 1F77A 2RBMA 5ISRA 2HUGA 5KRUA 4FF2A 2KHSA 4BA1I 1HCZA 1IKLA 5CV7A 3D6WA 4R8NA 1R9TB 2B63B 2XWJB 2TSSA 4N9PA 4IUQA 5KGUA 3X3MA 4H7BA 4CKCA 1PFMA 3SVMA 5CBEE 2XIWA 3J7AV 3AB9A 1LT6D 2Q8IB 4B9XA 1WTXA 1B4OA 3GV3A 5KYIA 5K36G 3NHHA 4ZYSA 3D4RA 4IFDG 1SYCA 5EBCA 3S9WA 4KJOA 3KUPA 1KDBA 1ENCA 1WD1A 2NVQB 1VMPA 3H0GB 1PMRA 4XT3B 3BVGA 2WKCA 5CGKA 2X6GA 5KEEA 1KTKA 1BR9A 4C3JB 2PZUA 1BOSA 1EQVA 4IZ8A 3E5SA 1T5EA 1XTCD 2MPMA 1DOLA 4K14A 1XYIA 2J0TD 3HS0C 2WINB 2IX1A 1F9QA 2IJ0A 3ZYYX 3A7AB 2E2JB 3ND9A 1WD0A 1X32A 1SEBD 4PMCA 5IGEA 2B2TA 2OXPA 1H9KA 2KQ3A 1B3AA 3L9AX 5J22A 4IUPA 5T1IA 5IGCA 3J81E 1HUNA 4DAVA 1CK1A 2NTSA 1DM0B 2B2VC 5EBDA 4ZRZA 2B8GA 5EKIA 5E1FA 1CHQD 1I4HA 5C0XH 1SYBA 3QIAA 1S5DD 1D1KA 3R2TA 5ELEA 1X3QA 5M5WB 2EYJA 2L4NA 1NUCA 1KLUD 3N52A 2RSNA 4CJ1B 2WACA 2WP8J 2L11A 3DEPA 3DUZA 2DN8A 4IFDJ 1PTOH 2A5HA 3K59A 1F2LA 4KHVA 2LFNA 1Y69U 5E4WC 2R92B 4ZUJA 1VMCA 3I8ZA 4GZYC 1I4RA 3D4WA 1SDFA 2A73B 4BBSB 1EOTA 2EYMA 1TQOA 5M5YB 2K5QA 3HG9A 1STEA 2EYOA 1F9RA 1TVXA 3LWUA 2AWNA 5K36H 2BA1A 2PO4A 2CQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RBM A;  1II3 A;  1STG A;  3MZ5 A;  3R3O A;  5EKL A;  5ISR A;  5JAV A;  4HMJ A;  3SR1 A;  2F3V A;  2EY6 A;  5I9P A;  5KRU A;  2F0F A;  1JOK A;  3C1F A;  1STH A;  2KHS A;  3DHQ A;  3OSO A;  5I9O A;  3U9O A;  3TP6 A;  1A2U A;  5CV7 A;  3VA5 A;  1TR5 A;  2PYK A;  4K8I A;  4KV6 A;  4PMC A;  5HGT A;  4NKL A;  4PMB A;  5IGE A;  1JOQ A;  4R8N A;  3SHL A;  1JOO A;  3HEJ A;  3QB3 A;  4WOR A;  1A3T A;  4K5W A;  3H6M A;  1SYG A;  2OXP A;  4DGZ A;  2OF1 A;  4ZQ3 A;  3OMC A;  2F0E A;  1EY8 A;  2F0J A;  2KQ3 A;  4N9P A;  3TP5 A;  4EQO A;  1EY5 A;  4EVO A;  3EVQ A;  1SYE A;  4KY7 A;  4K6D A;  1SNO A;  5J1Z A;  1ENA A;  1SYD A;  4K2L A;  3V2T A;  5KGU A;  4F8M A;  3D6C A;  4F7X A;  5NUC A;  4S3S A;  2F0H A;  5J22 A;  4H7B A;  1IHZ A;  1STY A;  5CC4 A;  5IGC A;  4ZUI A;  5C3X A;  1SND A;  2F3W A;  3QOL A;  4N9T A;  4EQN A;  1A3V A;  2PZW A;  4NP5 A;  3SK6 A;  2ENB A;  3NP8 A;  3NK9 A;  3T16 A;  5K5P A;  3NXW A;  1SYF A;  4K5X A;  1EY9 A;  5IGB A;  4NDX A;  2F0L A;  1EY7 A;  4HTH A;  4QB4 A;  4DU9 A;  5KIX A;  2F0S A;  3C1E A;  5KYL A;  2EYL A;  4NMZ A;  4IUN A;  1F2Y A;  2F0U A;  5E1F A;  3RUZ A;  4E6I A;  2F0W A;  1AEX A;  4G57 A;  3LX0 A;  5IIF A;  2EYF A;  5J39 A;  1SNP A;  2F0P A;  2PW5 A;  1JOR A;  5C5M A;  3HZX A;  2F0M A;  1SYB A;  2EY2 A;  2F0G A;  2M00 A;  4B9X A;  2OEO A;  5EGT A;  2EY5 A;  3ITP A;  2RDF A;  4ID6 A;  1KDC A;  3OMG A;  4KD3 A;  3T13 A;  3BDL A;  2EYP A;  1EZ8 A;  5KYI A;  2EYJ A;  3BDC A;  1NUC A;  1KAB A;  3D8G A;  3NHH A;  3EJI A;  5CV5 A;  4K8J A;  2PW7 A;  2F0I A;  3NQT A;  1U9R A;  5I6W A;  1EYC A;  1A2T A;  1EY4 A;  2F0D A;  2PQE A;  2WAC A;  1SYC A;  3MXP A;  1F2M A;  4KY5 A;  5DEH A;  3S9W A;  4J6H A;  4K2K A;  4KJO A;  5JOB A;  1KDB A;  1ENC A;  2F0T A;  3MHB A;  4RKL A;  3DMU A;  3NUC A;  3PMF A;  5CR3 A;  4EQP A;  4IAL A;  2NUC A;  3SK8 A;  2SNS A;  1NSN S;  2F0N A;  2F0V A;  1SNC A;  3SK5 A;  5IGF A;  3MEH A;  3TP7 A;  4B9W A;  5IOD A;  4KHV A;  4QMG A;  1KDA A;  5CV8 A;  3SK4 A;  1SNM A;  4ZUJ A;  2F0K A;  3TME A;  5CGK A;  5IGG A;  1SNQ A;  5KEE A;  2HQE A;  1EYD A;  5C3W A;  3D4W A;  4DF7 A;  2EYH A;  4HMI A;  5I6Y A;  5C6A A;  1EY0 A;  4J1M A;  2PZU A;  3ERQ A;  3ERO A;  4KJN A;  5C5L A;  5C4Z A;  5F2D A;  2F0O A;  4K5V A;  5CV4 A;  5IGD A;  4KD4 A;  5E3F A;  5CV6 A;  4ODG A;  4ME5 A;  3TP8 A;  1EQV A;  3OWF A;  4IZ8 A;  2RKS A;  4KTA A;  2EYM A;  1TQO A;  4PNY A;  3E5S A;  3SXH A;  1STB A;  1EY6 A;  1EZ6 A;  2SOB A;  5DAU A;  2EXZ A;  2EYO A;  4K14 A;  5HUR A;  4I65 A;  1EYA A;  2LKV A;  1STA A;  2PZT A;  1RKN A;  2O4X A;  2QDB A;  5CV9 A;  3P75 A;  2F0Q A;  4OL7 A;  4QF4 A;  5M9O A;  1TT2 A;  4RKB A;  4TRD A;  4YIJ A;  3QOJ A;  4LAA A;  1F2Z A;  4KY6 A;  3MVV A;  5C4H A;  1A3U A;  2SNM A;  3P1H A;  2EY1 A;  3D4D A;  1STN A;  1KAA A;  4MIU A;  4WRD A;  4DFA A;  5IOC A;  5EKK A; 
#chains in the Genus database with same CATH topology
 2RA4 A;  4A3K H;  3IFD A;  4A3C H;  3ONA B;  3W1G A;  3AQQ A;  1CSP A;  1JOK A;  3CQZ H;  4DN4 M;  1YZ6 A;  1NBW A;  3NBH A;  4DR3 Q;  1PH4 A;  1MBY A;  4KV6 A;  4J15 A;  1RF2 D;  3U50 C;  3G48 A;  2QA4 A;  5IT9 L;  3OMC A;  2OCE A;  3FKI G;  1EY8 A;  4EVO A;  1TY0 A;  3ER0 A;  5EAY A;  2NZ1 D;  2CVR A;  4C3I B;  3TS2 A;  3V2T A;  2B2W C;  3HOZ H;  1N9W A;  3OWE B;  1EWI A;  4AH6 A;  5FKA C;  4DPG A;  4EQN A;  2EJG C;  4DV4 L;  3S2D B;  4A3J B;  4ABN A;  5FLX E;  3I73 A;  5JJI A;  1RTO A;  1SMY D;  1FL0 A;  2ZM6 Q;  1IYJ B;  4OIK A;  2JA6 H;  1CSQ A;  4DR1 L;  1H9R A;  1SE3 A;  3LX0 A;  4G57 A;  3PIP A;  1ET6 A;  2A68 D;  3H3V I;  5J39 A;  3M4O H;  1SNP A;  4DUZ Q;  4BBR B;  2KBN A;  1PH6 A;  4C2M H;  3ERS X;  2F52 A;  3A8I E;  2IX3 A;  2RDF A;  3TDQ A;  3G71 A;  1G51 A;  1TS3 A;  1JB3 A;  2EYP A;  4DR1 Q;  1BF4 A;  1PTO B;  1EOV A;  1NAP A;  1WTR A;  2NVX H;  5DEH A;  2NYZ D;  1I4Q A;  1SMY C;  1D2B A;  4GNX B;  1XPR A;  3I4M H;  4RGO S;  2A68 C;  1CUK A;  3CF5 A;  3Q23 A;  1PH5 A;  4YHH Q;  3CCJ A;  4QMG A;  3K0Y A;  1I4G A;  1HZB A;  1O78 A;  2AQ3 B;  3TME A;  1MJC A;  2LY7 A;  3S1R H;  2J7Z A;  2JJQ A;  2LXJ A;  3J80 E;  2R7F A;  2R7Z G;  4A76 A;  3A8J E;  3NQI A;  1LTR D;  2ZTD A;  1Q8K A;  1H95 A;  3HKZ B;  2K04 A;  1I6H H;  2N55 A;  2VB3 X;  1UAP A;  4DNR B;  2F1M A;  1XNR L;  2O4X A;  4A3K B;  3I4N B;  4OL7 A;  1LTG D;  1K0S A;  4YIJ A;  4LAA A;  3F2B A;  3AFQ A;  3CQZ B;  3PUY A;  2XRS D;  5JVH 3;  2Q8T A;  1STN A;  4HSP A;  3HKZ E;  3I4L A;  4KLK A;  3EIV A;  5EKK A;  1II3 A;  2MO1 A;  2K5D A;  5LMN W;  1NMG A;  1I50 H;  1X3G A;  4X62 L;  1D5M C;  3J81 c;  2QEJ C;  4KK7 A;  2HHH L;  4XT1 B;  2E2D C;  1HNX L;  1Q12 A;  3HOZ B;  1DCZ A;  1K9M C;  5C4J H;  4WOR A;  4R4T A;  2JA5 G;  4IUU A;  4X62 Q;  4HID A;  2HHH Q;  1Y14 B;  3BVZ A;  5E4X A;  3JAM i;  1HNX Q;  5CYU A;  4K0K L;  1RDP D;  1PA6 A;  2B63 G;  2HIX A;  2F3I A;  5CC4 A;  1ML0 D;  3QOL A;  4CBV A;  1NMF A;  2ICE C;  1VQK A;  1LV9 A;  4PZ6 A;  1XX8 A;  4EGV A;  2JYO A;  3SE0 A;  5JVG 3;  1VQH A;  3PIO 3;  4A3M H;  4K0K Q;  4AYB G;  1KHI A;  4B3M L;  1GXD C;  4UY8 C;  1QB5 D;  4XXE A;  2MJ8 A;  2PNR C;  4QQB X;  1R4P B;  1A15 A;  1ET9 A;  3RLN A;  2JA8 H;  2IX0 A;  2L15 A;  3A55 A;  5EGT A;  1W3S A;  3NE5 B;  1IXR A;  1K28 A;  2AQ2 B;  3T56 B;  1EYG A;  2E2I H;  2K5N A;  1SN8 A;  1VQB A;  4IOA A;  5E7N A;  2CH4 A;  1P8L A;  1Z9F A;  1A8V A;  4QGU A;  4NB3 A;  4QY7 A;  1YNX A;  3MXN A;  5FJ8 G;  1X65 A;  1S5C D;  3NEN A;  3S1R B;  1QUQ A;  1PH9 A;  5IGF A;  3H15 A;  3TP7 A;  1AP0 A;  3GQB A;  3CRK C;  1HZ9 A;  4CJ0 B;  1H9J A;  2F0K A;  3IL8 A;  2VB2 X;  5C44 H;  1QNU A;  3E9I A;  3URY A;  3ERO A;  2EDG A;  3K6O A;  2F0O A;  2RKS A;  5BN3 A;  1HQM C;  2L0C A;  2R3Z A;  2SOB A;  1BDO A;  2A6H D;  5ELD A;  1EYA A;  4ULL A;  1IYV A;  1STA A;  2JK8 A;  1UEA B;  4KY6 A;  1I50 B;  4N8X 1;  5C4H A;  1RHP A;  1KAA A;  4Q0F A;  3OYY A;  4CDD C;  1E22 A;  4FO2 A;  1LTS D;  2WKD A;  4ILW A;  1Q81 C;  1MD2 D;  5ELO A;  2A6H C;  2QKI C;  1XPO A;  3H3V H;  4IJL A;  1JB7 A;  5FLX c;  3CCM A;  1TWA H;  2EVB A;  3GTO H;  1LT3 D;  2KHI A;  1HRJ A;  4IOC A;  3CC2 A;  3ICE A;  2A6E D;  1HTP A;  4C3H B;  5NUC A;  2ASB A;  1GD7 A;  1STY A;  4RWS C;  2B2U A;  1MGS A;  3TZU A;  2NTT A;  3TQY A;  1DON A;  1XNQ L;  4K5X A;  3VR2 A;  2K52 A;  2F0L A;  4DU9 A;  4FNF A;  3TRE A;  4JK1 C;  1CKO A;  1WYD A;  4MN3 A;  5C5M A;  1XNQ Q;  2A6E C;  4FF3 A;  4UP8 A;  1KDC A;  3OMG A;  1DOK A;  1H9S B;  3F1Z A;  3OTO L;  4BY7 G;  3EJI A;  1GUO A;  3BJU A;  4K8J A;  4Q5V A;  1PVO A;  3EN2 A;  1RCV D;  1B1Z A;  1EYC A;  3DM1 A;  3RZD H;  2MNA A;  1K83 H;  3J80 c;  1CKN A;  4CKE A;  3OTO Q;  2MUY A;  4BS9 A;  3PMF A;  4ZKC B;  2JA5 H;  3OW7 A;  3QO2 A;  4LFC L;  3NEM A;  2K5V A;  1WTW A;  1X3E A;  3PUV A;  4DK1 A;  1Q8I A;  3J7Y W;  2AQ1 B;  4LFC Q;  4L6T B;  1C7Y A;  2JE6 I;  3BYY B;  1IL8 A;  4V19 0;  4JBK A;  4K5V A;  1ROD A;  3RZO B;  1TWC H;  3CXC A;  4GLX A;  2L55 A;  4UP9 A;  3PF4 A;  1PH2 A;  1ZKO A;  2XGT A;  1M1K C;  2FJ2 A;  2YU9 H;  2PCF B;  3FPP A;  3J81 i;  2PQA B;  4JI8 L;  1EEI D;  2Q2I A;  4QF4 A;  5I4D A;  3I56 A;  4LUZ A;  2K01 A;  4JBW A;  1CZG A;  1F2Z A;  4DAY A;  3I90 A;  2EY1 A;  3D4D A;  1EWC A;  4WRD A;  2RHS B;  3RNU A;  5LL6 X;  3TZD A;  5M3F B;  4JI0 L;  1Y1W G;  1Y8O B;  2YTV A;  5JAV A;  4L8J A;  1NTG A;  2FIN B;  1PZK D;  4TSS A;  1GUG A;  1HZC A;  4G7H C;  1I4P A;  1SR3 A;  1HR0 L;  3WOF A;  1L1O B;  4JI0 Q;  3PUW A;  3GTK H;  3QB3 A;  2Z1C A;  2X69 A;  1O7L A;  5FLM G;  1E3P A;  1EQT A;  5D65 A;  4A4I A;  1JJG A;  4C1N K;  2BE5 D;  4IN3 A;  1PRT F;  1VF7 A;  3MWY W;  3HOX B;  1E24 A;  3EVQ A;  3MAQ A;  1HR0 Q;  1I5F A;  2PMZ E;  4K6L A;  1AZP A;  1IHZ A;  1N8R C;  4Y7N H;  2F3W A;  1Z47 A;  3NTH A;  1G91 A;  1ESR A;  3K7A H;  3NP8 A;  2I07 B;  3C46 A;  1Q1B A;  1LTA D;  3O13 A;  1N34 Q;  4POG A;  4NMZ A;  5EJW A;  4DR6 Q;  3L3O C;  5ELB A;  3GP7 A;  1OXT A;  5IGB A;  4A3D G;  1AEX A;  1SLJ A;  2BE5 C;  2I5M X;  2PW5 A;  1XMO L;  3AMU A;  1JOR A;  2I5L X;  4A3G G;  2CKZ B;  4RAU C;  1K83 B;  1PLF A;  3GTM H;  1TXY A;  2K33 A;  1VQC A;  1EZ8 A;  3F8T A;  3ULJ A;  2SDF A;  4H13 C;  1XMO Q;  2D9U A;  1CI3 M;  4KKT A;  3CAM A;  5TSS A;  1EY4 A;  2HQL A;  4B08 A;  2AWO A;  1FNU A;  4IFD I;  3A7L A;  2JEB I;  4YCW A;  5FOB B;  1DZ1 A;  3D31 A;  2ZJP A;  5IP9 G;  1PH7 A;  3T1Y L;  3I72 A;  1YVC A;  1TWC B;  5EPK A;  2VQF L;  4BY1 H;  1EYD A;  5C3E H;  1BKB A;  1JWM D;  2YU9 B;  3T1Y Q;  3IRB A;  5A2Q E;  2VQF Q;  5JPN C;  1NY4 A;  5M3M G;  2R93 B;  1W6J A;  1N36 L;  1CFM A;  1SAP A;  2NN6 I;  4AYB E;  4LMQ D;  2H5X A;  4A3F B;  1VQM A;  2FMM A;  4GKK Q;  5M9O A;  5DNF A;  3EA6 A;  1N36 Q;  3KF8 A;  2IW3 A;  4IPD A;  1X54 A;  4DFA A;  3GTK B;  2QDL A;  4R9W A;  1STG A;  5IYD H;  1YNJ D;  5J3B A;  1VQG A;  1LTL A;  4OIJ A;  1DD2 A;  4POF A;  1Y1V B;  3GTP H;  3PIP 3;  3JC6 6;  1A6X A;  2GN5 A;  2NN6 G;  1TS4 A;  3AYH B;  4GN4 B;  2Y0S B;  1JOO A;  2XNA C;  4JV5 L;  3SEB A;  2KEE A;  1JQY D;  3OHX C;  4Y7N B;  2HDL A;  1A0I A;  2UXD L;  1AE2 A;  2OF1 A;  4ZQ3 A;  3K7A B;  2F0J A;  1FJG L;  1S5E D;  2WFW A;  3VYU A;  3TSS A;  4X3U A;  2E5L L;  1YNJ C;  1FNV A;  1Q46 A;  1YHB A;  3I7F A;  4ZUI A;  2JXM B;  3P7J A;  1FJG Q;  2ENB A;  1XWE A;  2Y0S E;  2OWO A;  1T5X D;  2Q2T A;  1E2Z A;  1ICF B;  2WB1 B;  2E5L Q;  3GTM B;  4KN7 C;  3J80 i;  3CCV A;  4DUY Q;  2EYF A;  1KRT A;  2EXD A;  1FGB D;  5LMU L;  2N49 A;  1PFS A;  3HZX A;  2D0P A;  1GHK A;  2F0G A;  1KD1 C;  4DNI A;  3ZJY C;  4A3I B;  3BDC A;  5LMU Q;  3KF6 A;  2WB1 E;  3VYR A;  2ATW A;  1ZYR D;  2OTJ A;  2F0D A;  3S15 H;  3DEO A;  2IWH A;  1G6P A;  3CMA A;  1G8Z D;  3T4A C;  2BDO A;  4LF6 L;  4LF8 L;  4BY1 B;  1YJ9 A;  5C3E B;  1N33 L;  3S14 B;  1PRT D;  5FLM H;  3ULP A;  4WJ4 A;  1VQI A;  2WAQ B;  2TMP A;  3DM3 A;  3QJY A;  3M4Q A;  4LF6 Q;  1JT8 A;  4HIK A;  4MTN A;  3HRZ C;  4A3E B;  1N33 Q;  4A3B G;  2B3G A;  3I91 A;  4IJH A;  1WJJ A;  4HCS A;  2KEC A;  5C4X G;  3ERQ A;  5F2D A;  2FFK B;  3TBI B;  1E7Z A;  1ICW A;  1CQV A;  1N32 L;  1J9O A;  1G2S A;  2K5W A;  1IZ6 A;  3J7Z C;  3GD7 A;  1PRT C;  3HP3 A;  3HOW G;  2WAQ E;  2VW9 A;  2P5Z X;  3I70 A;  2G9D A;  1S72 A;  2K4K A;  1VF5 C;  2UXB L;  3PCO B;  2Z6B A;  3P75 A;  1P16 A;  1N32 Q;  2VL6 A;  3GTP B;  1YHQ A;  2N88 A;  2SNM A;  4ZKB B;  3HOU H;  1CHP D;  4GNX C;  3V96 A;  1I3Q H;  1OXU A;  1RD9 D;  2UXB Q;  2KOL A;  3R3O A;  4OXP A;  2UXC L;  3I55 A;  3NWT A;  4OWX B;  1STH A;  1EIG A;  4DV0 L;  2L12 A;  3Q6S A;  2PYK A;  3BDO A;  4PMB A;  3S1M B;  5ELN A;  2ZXO A;  3S1Q H;  4DK6 C;  4DGZ A;  2KJX A;  3I3C A;  4DV0 Q;  4OEL B;  5LL6 S;  1TWH B;  1SYE A;  3STB D;  2N8N A;  3NPP A;  4R4I A;  5D3I B;  5ELC A;  4F8M A;  2B29 A;  3PO2 G;  4AQY L;  1FVI A;  1FD7 D;  5C3X A;  5M3M H;  4IFD H;  2CQO A;  1Q3L A;  2LMC B;  3MFG A;  3NK9 A;  3HOV H;  3QR8 A;  4JI5 L;  1U4M A;  2IL8 A;  5KYL A;  4AQY Q;  3PQI A;  4IUN A;  3T53 B;  4RHS A;  2VUM G;  5GAE C;  1KRS A;  2MQH A;  3LNN A;  1PH8 A;  2F0M A;  4UP7 A;  3STB C;  1BQQ T;  4JI5 Q;  3S15 B;  2EY5 A;  1YHA A;  4OEM B;  2K6A A;  1HTL D;  4F88 A;  3CPW A;  1TWG H;  2M9V A;  1KAB A;  2ZM6 L;  4DV2 L;  2MGS A;  4KY5 A;  3X3N A;  4DR2 L;  1WTP A;  1GUS A;  4A93 G;  4DUZ L;  1D8L A;  2NN6 H;  2C9O A;  2LSS A;  1VQ4 A;  4ME3 A;  4F87 A;  4EQP A;  3UI2 A;  2I46 A;  4DV2 Q;  2Z4I A;  2DNE A;  4PMW A;  1EIH A;  3TN2 A;  4OON A;  4DR2 Q;  4J8Q A;  1CM9 A;  4OHJ A;  2QEX A;  3GTJ B;  3P20 A;  1K73 C;  2JA7 G;  1O80 A;  4QIW B;  3PO3 G;  1PYW D;  3G6J B;  2NVY H;  5LHY 1;  3KBX A;  4HIO A;  2KEN A;  3H91 A;  4CKB A;  4YHH L;  2JEA I;  4DK0 A;  4LFA Q;  3GTL B;  4A3L G;  4L5T A;  2XWB B;  3HOU B;  2PI2 A;  5DAU A;  4QIW E;  1J8I A;  1I3Q B;  5HUR A;  2K14 A;  4XYQ A;  2F0Q A;  3NBI A;  3GTQ B;  1WCM H;  2DY8 A;  1QVG A;  4BWG B;  3A8K E;  1K8M A;  1RTN A;  1K8G A;  3CW2 C;  1VQ8 A;  5GAG C;  4PQX A;  3VYS A;  3S1Q B;  2EY6 A;  3EFX D;  1B9M A;  1HNZ L;  1JC7 A;  2Z6K C;  5GAH C;  3MEF A;  2K32 A;  3HEJ A;  2UUB L;  1HNZ Q;  1KQS A;  4JI2 L;  1PYB A;  3I4O A;  3PUZ A;  2MP1 A;  4A3B H;  3HOV B;  3J81 j;  2B39 A;  2NB0 A;  2B2U C;  1G29 1;  2UUB Q;  3HOY H;  3OOC A;  3A0J A;  4JI2 Q;  4N8F A;  4RHR A;  1LAC A;  4GNX A;  3SK6 A;  3R8B A;  5K5P A;  2EPB A;  3HOW H;  4TVA B;  2Z0S A;  1IBK Q;  1GO3 E;  5KIX A;  2UUC L;  1HXY D;  3M7G A;  4E6I A;  2CHB D;  3T51 B;  1TWG B;  1QVC A;  3BYT B;  1UUP A;  1V43 A;  5DM7 3;  4XYO A;  5BN5 A;  1CT1 D;  1NR4 A;  1W2B A;  2UUC Q;  1YJW A;  1EU3 A;  3IKJ A;  3ITP A;  4OGQ C;  1CQF A;  3W1B A;  2L5T A;  2JA6 B;  4R1J A;  3M4O B;  1UEB A;  2ALY B;  3DXJ C;  1EWH A;  3MTS A;  4C2M B;  3KFU A;  4FF4 A;  4MZ9 A;  2NVY B;  5CR3 A;  3N6R A;  4DXG A;  1C0A A;  2KCN A;  4B9W A;  3M85 A;  1BCP B;  1PDQ A;  2NVX B;  1XTD A;  4M1U B;  3PO2 H;  2RVL A;  5CBA E;  3I4M B;  1BO0 A;  4Z9C B;  5BR8 L;  5I6Y A;  5C6A A;  3JAM L;  5C4Z A;  5CV4 A;  4JYA L;  1TWF H;  1BNZ A;  1UE1 A;  1B70 B;  2VUM H;  2Z8L A;  3MFY A;  2OQ0 A;  3SXH A;  4YWM A;  5BR8 Q;  2EQS A;  2HD3 A;  1EY6 A;  2H4O A;  2E8G A;  2EXZ A;  2A69 D;  1YJN A;  4JYA Q;  1MSG A;  3FKI H;  1ESF A;  5IT9 E;  1I6H B;  1RJT A;  1SJE D;  1YNN D;  2OQK A;  3H0G G;  4A93 H;  3K58 A;  5HGQ A;  2F3V A;  2L9H A;  5GRO A;  5DM6 3;  3GDE A;  2R61 A;  3TP6 A;  1A2U A;  4XQJ A;  1JIC A;  2IT1 A;  2C5C A;  4QL5 A;  2DGY A;  2XRQ D;  4DV6 L;  3HOY B;  4C3J G;  2BOS A;  3PO3 H;  2EJM A;  1QE6 A;  3Q24 A;  4DXF A;  1YNN C;  1ENA A;  4JBM A;  4XDX A;  3DLL A;  3S24 A;  4DV6 Q;  3ULL A;  1SND A;  1A3V A;  4CDC C;  5C4J B;  2ZTE A;  4NPS A;  4DK3 C;  4X3T A;  2Q2U A;  1HPC A;  4FYD A;  3QWN A;  4ALP A;  4C56 C;  2CWP A;  4HSV A;  4KKU A;  3S2H H;  2F0U A;  3H94 A;  5IIF A;  2IHF A;  4B3R L;  2Z6K A;  4XIG S;  1TU2 B;  1B9N A;  2F0P A;  3U58 A;  2EY2 A;  1HFN A;  1TS2 A;  2OEO A;  4IQZ A;  1NR2 A;  1PFB A;  4ID6 A;  3OIQ A;  2Q8R E;  4A3M B;  1HFG A;  1X56 A;  4B3R Q;  2YTY A;  1BBU A;  2R7Z H;  1V1P A;  3A54 A;  5I6W A;  2PQE A;  2JA8 B;  4OX9 L;  5JOB A;  3CCL A;  4LJZ C;  4KN4 C;  2XTI A;  3MHB A;  3DMU A;  5IYB G;  2G9H D;  4IAL A;  4ZLT F;  2E2I B;  3SK8 A;  3K8A A;  4IUV A;  1SNC A;  1VCI A;  4HN7 A;  4OX9 Q;  5AFW A;  4PV1 C;  2C35 B;  3M9B A;  1CA5 A;  2D0O A;  2HCC A;  2ZXR A;  5AJ3 L;  1VQ7 A;  4KMU C;  4JI4 L;  1JE4 A;  3FKI B;  1LT5 D;  3TP8 A;  1F9P A;  1SE8 A;  3OWF A;  3MA2 B;  5AJ3 Q;  1L0Y B;  2ZJQ A;  1HHV A;  4U67 3;  1EZ6 A;  4JI4 Q;  3BZD B;  3KJO A;  5C44 B;  1A62 A;  1RKN A;  2BH8 A;  4DV7 Q;  4JW0 A;  4MHE A;  2E2H H;  1C4Q A;  4R4O A;  2NVT H;  2B63 H;  3L0O A;  2VY3 A;  1TKW B;  5IOC A;  2ZT9 C;  5EPL A;  1QIL A;  3RD4 A;  2F0F A;  4JCV E;  5JPM C;  2R92 G;  3OSO A;  1IKM A;  3G4S A;  1GKH A;  1AE3 A;  1V1O A;  1TR5 A;  2JP1 A;  3PUX A;  4RGN A;  1A63 A;  3T1H Q;  4NKL A;  1ZXT A;  1EIY B;  4DAP A;  3FVQ A;  1Y8N B;  4BBS G;  4IUR A;  4OO1 I;  1G6Z A;  1H9S A;  1Q1E A;  3NEL A;  3KLS X;  4EQO A;  2VNU D;  2FHT A;  1NE3 A;  1SYD A;  3A5Z B;  4K2L A;  2E76 C;  3D3R A;  3S2H B;  4S3S A;  3L7Z C;  3K80 C;  1LLR D;  1TWA B;  5COR A;  2PZW A;  1R4Q B;  3S1N H;  1I94 L;  2PMZ B;  4TQU S;  2NZH A;  1NCV A;  1EY9 A;  4JI1 L;  5FJ8 H;  3GTO B;  2R6G A;  2EYL A;  1LO5 D;  1V1Q A;  4LF4 Q;  3PIO A;  2R7Z B;  2M2L A;  3FEW X;  4OO1 G;  4GLA C;  1D5X C;  4L63 B;  1I94 Q;  1KNA A;  1YIJ A;  4JI1 Q;  3CCR A;  3UDI A;  3J81 L;  3T13 A;  5KND A;  3WDN A;  2NVQ H;  5DLQ E;  3H0G H;  1N34 L;  1PTO F;  3LWE A;  1K8O A;  1E1O A;  4DR6 L;  3NQT A;  4NW2 A;  1SE4 A;  4B3T L;  4LNQ A;  3MXP A;  4G7Z C;  4H02 A;  2RCF A;  3A56 A;  1GJX A;  1MHW C;  2F0T A;  1TS5 A;  2PQA A;  4C3I G;  2KHJ A;  2WII B;  4CGY B;  4B3T Q;  3PGZ A;  4FDB A;  1O7I A;  1BXT A;  2I5H A;  2IPK D;  5IYC G;  5CV8 A;  4A3J G;  3RZD B;  5IGG A;  4G4K A;  2HQE A;  3BZC A;  3E0J A;  4RFB A;  5A35 A;  2L1B A;  2VQE L;  2V1C C;  1WTV A;  2JA5 B;  4BBR G;  1S5F D;  3VA7 A;  5IT9 c;  1OXX K;  1B2T A;  1L1O A;  4JVZ A;  4UHV A;  2E2H B;  1IW7 D;  3CRL C;  3M7N A;  2VQE Q;  1STB A;  2NVT B;  4NXN L;  5FO7 B;  4G7O C;  1NJI C;  4TRD A;  4HAE A;  3PF5 A;  2MO0 A;  1GOZ A;  4I7A A;  4AYB B;  1KL9 A;  2AUK A;  4NXN Q;  1J5E L;  4IPG A;  4X64 L;  2IY5 B;  1X55 A;  2LS0 1;  4OWT B;  1B7Y B;  4X3K A;  4OWW B;  1MKH A;  3SR1 A;  4YY3 L;  1IW7 C;  1F9S A;  2K05 A;  1FR3 A;  4O1N A;  1V8Q A;  3C1F A;  4GKK L;  3S17 H;  1JWS D;  5IP7 G;  5IYB H;  5FK9 C;  1PXU A;  3KDF B;  1J5E Q;  4X64 Q;  5H1S E;  4YCV A;  4GLV B;  4CDE C;  4GOP B;  4HJ8 A;  4YY3 Q;  5IWA L;  1L2F A;  1JJ2 A;  3K5N A;  3FDT A;  1SYG A;  1GUN A;  4X66 Q;  3MC0 B;  3S1N B;  3W3A A;  3TP5 A;  3RLF A;  2RSO A;  3HKZ G;  4BY7 H;  1HUM A;  1EIF A;  1ONL A;  4U68 A;  2RF4 A;  1ZEQ X;  4RA8 A;  1VQO A;  5IWA Q;  2EOT A;  2XVS A;  1B50 A;  2SEB D;  4APV A;  1U4L A;  4A3K G;  5I2Y A;  3I4N G;  4A3C G;  2O2L D;  4DR5 L;  5M5W H;  1SBB B;  2RQX A;  3C1E A;  4FXK C;  2VXW A;  3WOE A;  1KXL A;  2XSC A;  1B44 D;  3C2P A;  4P2C B;  1DOM A;  4DR5 Q;  1BCP F;  3FHW A;  3IFT A;  3TEH B;  1SSO A;  4LW1 A;  3F2C A;  2GA4 B;  4P71 A;  3HGB A;  5FLX L;  5GQO A;  1FNW A;  4YCU A;  3Q22 A;  1SFO H;  4IUT A;  3HOZ G;  3J7A F;  4LF9 L;  4RGM A;  4DUY L;  1PZI D;  2GVB A;  1VQ9 A;  4CJ2 C;  2OTL A;  2EIF A;  4MNO A;  1EFW A;  1TY2 A;  4LF9 Q;  4BBS H;  1D6E C;  1K8A C;  3CD6 A;  3BZK A;  1O7Y A;  2EE1 A;  1MJE A;  4QCL A;  2NBF A;  1H9M A;  2ID0 A;  1PH3 A;  2J4X A;  1BBX C;  1KLG D;  5C0X J;  1OXS C;  2G5D A;  1Y1W H;  1EY0 A;  5T1G A;  4BXX G;  4JG2 A;  5GAD C;  1WOC A;  5E3F A;  1X6O A;  3DWA A;  4DR7 L;  4ME5 A;  4FXG C;  1RIP A;  3GV6 A;  4KTA A;  1GUT A;  4OO1 H;  2HDM A;  3R93 A;  4WFN 3;  1M90 C;  1SJH D;  2LXK A;  4DR7 Q;  3J80 L;  1TT2 A;  1CZW A;  3DWP A;  4RKB A;  1VQD A;  1PTO D;  4H44 C;  3S17 B;  3S16 H;  3AFP A;  1NNX A;  1ZYR C;  2E75 C;  3UE0 A;  3V05 A;  4LF5 Q;  1KNE A;  1S5B D;  5I9O A;  1PZJ D;  4HJ9 A;  4C3I H;  4GN3 B;  1B53 A;  2ICI A;  4BY7 B;  4A3D H;  2ES2 A;  2V4D A;  4K8I A;  5L37 A;  3U9S A;  3MXG A;  5G3L D;  5IYC H;  1Q82 C;  1A3T A;  1PTO C;  4A3G H;  4O0A A;  3MXU A;  5HY6 A;  1EY5 A;  3U4Z A;  2DY7 A;  2GVA A;  2MHV A;  1OXV A;  2JSO A;  2BCO A;  2DNC A;  4LUO A;  1IYU A;  5FO9 B;  3KLW A;  4ZCK A;  4BBR H;  4X6A H;  1TII D;  4A75 A;  5COY A;  1I6V C;  1BUV T;  2X6L A;  4NDX A;  1MI2 A;  2K7V A;  1PYS B;  1F2Y A;  1GM5 A;  3NBH B;  2K5H A;  5IP9 H;  1VQE A;  1SFO B;  4X3S A;  1DJR D;  4CHT B;  1UE7 A;  3VYT A;  2FXQ A;  3K0X A;  4QJF A;  4XQN A;  3CCE A;  3M3Y H;  4RCO A;  1ASY A;  4NXM L;  1CA6 A;  1EQR A;  1JCK B;  2D2C C;  4DAM A;  2K1B A;  1U5K A;  2DJG C;  4KI0 A;  3RN2 A;  1LTI D;  1A2T A;  3SGI A;  3C3L A;  4J6H A;  4K2K A;  2KUM A;  3CPF A;  3QG1 A;  4NXM Q;  2RHQ B;  4C3H G;  3SK5 A;  1CTM A;  3I2Z A;  1Y1W B;  2EZV A;  4QUC A;  4HJ5 A;  2K03 A;  2OT2 A;  1SNM A;  3K81 C;  1VQL A;  4ZAI A;  4HMI A;  2A8V A;  4L5Q A;  3OIP A;  1LUZ A;  3G6E A;  3I4N H;  5C5L A;  4J1M A;  4HIM A;  2D62 A;  4FVM A;  5IGD A;  4EX5 A;  5CV6 A;  1AFP A;  2CFM A;  2YV5 A;  3NSW A;  2E74 C;  2KCC A;  3S16 B;  1BCP D;  1C9O A;  2QDB A;  3G7L A;  2HCI A;  1WVL A;  5ELF A;  3P1H A;  1VQN A;  3K5M A;  4DV5 L;  4A3D B;  4LFA L;  1YI2 A;  5C44 G;  4LK1 C;  3MZ5 A;  5EKL A;  4A3G B;  1AW7 A;  4HMJ A;  3UDF A;  1ASZ A;  1SXT A;  2PI2 E;  4O42 A;  3DHQ A;  1WTO A;  1BCP C;  1AZQ A;  2UUA L;  4DV5 Q;  1LTT D;  1X3F A;  3VR6 A;  3VA5 A;  1B8A A;  3K5O A;  1IBM L;  4I7Z C;  4DV4 Q;  1PRT B;  1FGU A;  5M5X H;  2UUA Q;  5JEA G;  2YYZ A;  3K57 A;  3VR3 A;  1K3B C;  1SNO A;  1IBM Q;  4TKO B;  4RGT A;  3K7U C;  3CCU A;  4BXX H;  2K28 A;  3D6C A;  1L0X B;  3KK7 A;  3CCQ A;  2F4I A;  4FF1 A;  4HCE A;  5EQ0 A;  2QGQ A;  3DWQ A;  3BG3 A;  1SYF A;  4C1N I;  2MFI A;  4QB4 A;  4HTH A;  3IAY A;  1RL2 A;  4LF7 L;  4RMF A;  3RUZ A;  3M3Y B;  1BVS A;  2B2V A;  2Q2H A;  3H09 A;  5M3F G;  4QUF A;  2Z9H A;  4DR4 L;  4YWK A;  2D5D A;  1UE6 A;  5M3M B;  1X9N A;  1C48 A;  4Y52 H;  4LF7 Q;  1JWU D;  3KBG A;  4P73 A;  3BDL A;  4WJW A;  1MSH A;  1IBK L;  1C8C A;  5C4X H;  4H0L C;  5CV5 A;  4DR4 Q;  1GHJ A;  1U9R A;  2JA9 A;  1EL0 A;  3FMC A;  3HOX G;  2K75 A;  4RCN A;  1FYC A;  1E2W A;  1LTB D;  1NSN S;  2QW7 A;  2XN9 C;  3MEH A;  2CW0 D;  2O5J C;  3SK4 A;  1QOH A;  1D5Z C;  3E6Z X;  2A74 C;  3ND8 A;  1XNR Q;  1ILP A;  5I2X A;  3BVM A;  2EYH A;  4R8I A;  4KD4 A;  3R2I A;  5JJL A;  1EU4 A;  3VDY A;  1JE5 A;  2CW0 C;  1EQQ A;  3MXN B;  1HNW L;  3CKI B;  5CV9 A;  1YEZ A;  1QUQ B;  3QOJ A;  3SDZ A;  1LAB A;  3MVV A;  1W6K A;  1GUW A;  4XQQ A;  2KA7 A;  5EPJ A;  1HNW Q;  5CMD A;  1KIX A;  4UPA A;  2WV6 D;  2CH4 W;  4DNT B;  1VQF A;  5I9P A;  5M5X B;  1KC8 C;  2Z4H A;  1WCM B;  4C3H H;  4HR7 B;  3L2P A;  3UDX A;  1DGS A;  2DUD A;  2RDH A;  1UNS A;  4K5W A;  1IL2 A;  3H6M A;  4UDU C;  3TS0 A;  4B3M Q;  4P72 A;  1VS0 A;  2R93 G;  3VR4 A;  4K6D A;  5J1Z A;  4RG1 A;  5JEA J;  1E2V A;  4YWL A;  4F7X A;  1WFQ A;  2F0H A;  3K5L A;  2BDN A;  4A3F G;  5D14 A;  2B2Y C;  2RCN A;  4N9T A;  1Y8P B;  2B2W A;  4NP5 A;  5BN4 A;  4RH6 A;  4BA2 I;  1D1I A;  2F0S A;  4A3B B;  2A69 C;  2F03 A;  4KHZ A;  2F0W A;  3CP0 A;  4JI7 L;  5C4X B;  2JA7 H;  2M00 A;  1Y1V G;  2QF7 A;  4FP5 D;  4KD3 A;  3HOW B;  1YBY A;  1KAW A;  5FO8 B;  4JI7 Q;  1Q86 C;  1M4V A;  3CC4 A;  2Y0S G;  1QZG A;  3GTG H;  1HJP A;  1V1P B;  1F2M A;  3KYH C;  2F4V L;  4A3L H;  2PPB C;  4RKL A;  1QZH A;  4DKA C;  3NUC A;  4CDF C;  1S4Z A;  2SNS A;  1O7Z A;  2K50 A;  4MTK A;  3RZO H;  3H3V C;  3AEV A;  1ENF A;  2BA0 A;  4JBJ A;  5JEA H;  3Q0A A;  4HJ7 A;  2F4V Q;  1U4R A;  2H1E A;  3AU7 A;  1CKM A;  1SE2 A;  2AKW B;  1SNQ A;  2WB1 G;  4M8A A;  2FMC A;  5C3W A;  1Z6H A;  2IHE A;  2PNH A;  3VR5 A;  4AIM A;  1ILQ A;  1L1O C;  2EJF C;  3W2D A;  4DV3 L;  1QJO A;  4ODG A;  1LM0 A;  4B3S L;  4JI6 L;  3EQL C;  1CKN B;  1HA6 A;  3PO2 B;  5M3F H;  4A3I G;  4I65 A;  4LUV A;  2NZO A;  1QVF A;  2LKV A;  1SMX A;  2KVM A;  4DV3 Q;  1QCB D;  4B3S Q;  4JI6 Q;  3KLS A;  1TWF B;  5A2Q L;  3NTK A;  1A3U A;  3HFZ B;  4BY1 G;  2VUM B;  4LFB L;  5C3E G;  2HIV A;  1QWY A;  5JJK A;  3CU7 A;  3HOX H;  1Q90 A;  3J7A 5;  2WAQ G;  5KNB A;  4DV7 L;  4KKS A;  4A3E G;  3U9O A;  4P75 A;  4LFB Q;  4HJA A;  4EQ5 A;  5HGT A;  1X3P A;  1JOQ A;  3SHL A;  4JC0 A;  4V0B A;  1U4P A;  3A5U A;  3F2D A;  2F0E A;  3NWS A;  1L0W A;  1GVP A;  4A93 B;  4KY7 A;  4X65 L;  1QG7 A;  2CCZ A;  2NWG A;  1R9T H;  1G2T A;  4DAY B;  4P74 A;  1VDZ A;  3OPO A;  3T1H L;  1EEF D;  1JR0 D;  5IYD G;  4FXD A;  4UAI A;  2A19 A;  3T16 A;  2JA7 B;  4GN5 A;  3NXW A;  2HT1 A;  2QCP X;  4X65 Q;  1EFI D;  1EY7 A;  1M8A A;  3PV0 A;  5D3D A;  1DXM A;  3PO3 B;  2B8F A;  1PFN A;  1OO9 B;  1I4X A;  3GTG B;  1Z7T A;  3PSI A;  4HED A;  3FPU B;  3D8G A;  4GOP C;  1HA5 A;  3GO5 A;  2PW7 A;  2F0I A;  4LF4 L;  1SRU A;  2AUJ D;  1HQR D;  3FRP B;  2B2Y A;  1K0R A;  2N78 A;  3JAM E;  1S40 A;  1E0B A;  1VQJ A;  2RDG A;  2NUC A;  2CWA A;  4LWC A;  2F0N A;  2F0V A;  2QIL A;  3BS1 A;  5IOD A;  1K3R A;  1QNK A;  2R93 H;  1KDA A;  3EBE A;  2O5I C;  1D7Q A;  5C0X I;  3RMH A;  1VQA A;  2BH2 A;  3KLR A;  4JI8 Q;  4A3F H;  1DYQ A;  1AH9 A;  3F2U A;  4DF7 A;  4L5S A;  4JOI C;  3M4Y A;  1AN8 A;  3Q8D A;  4KJN A;  1WTQ A;  4WJ3 M;  4DA2 A;  5KNC A;  2B2T C;  4PNY A;  3HKS A;  4KHP L;  3RN5 A;  2KED A;  2ZXP A;  4C3J H;  2PZT A;  1Y1V H;  1XXG A;  5C0X G;  4ZK9 B;  4PZ7 A;  1B3Q A;  5G3L F;  5JJZ A;  4KHP Q;  3NTI A;  2KCT A;  2VS1 A;  1LT4 D;  4XTC S;  4MIU A;  3CHB D;  2ZJR A;  3CC7 A;  1F77 A;  2RBM A;  5ISR A;  5IE8 A;  2HUG A;  2ZTC A;  5KRU A;  4FF2 A;  2KHS A;  4BA1 I;  1VQ5 A;  1HCZ A;  1IKL A;  5CV7 A;  3D6W A;  2E2J H;  4R8N A;  1R9T B;  2B63 B;  1XJV A;  3RLO A;  2XWJ B;  2AMC B;  3W5O A;  2TSS A;  4GS3 A;  1OTC A;  3RR5 A;  4N9P A;  1E1T A;  2KCM A;  4IUQ A;  2R7D A;  5KGU A;  3X3M A;  3HOU G;  3UE1 A;  3KF8 B;  4H7B A;  4CKC A;  1PFM A;  3SVM A;  4A3I H;  4X66 L;  5CBE E;  3KOJ A;  1Q7Y C;  2XIW A;  3J7A V;  3AB9 A;  1LT6 D;  2Q8I B;  1PHJ A;  4B9X A;  2I0Q A;  4PZ8 A;  1WTX A;  1B4O A;  3GV3 A;  3S14 H;  3U4V A;  1J6Q A;  5KYI A;  5K36 G;  3NHH A;  4ZYS A;  3D4R A;  3E3X A;  4IFD G;  1SYC A;  4A3E H;  5EBC A;  3S9W A;  4KJO A;  3KUP A;  1T9H A;  1JMC A;  3HOV G;  1MIU A;  1KDB A;  1ENC A;  1WD1 A;  3TRZ A;  2NVQ B;  1UWV A;  1VMP A;  3H0G B;  3M4P A;  1PMR A;  4XT3 B;  3LGJ A;  3BVG A;  2WKC A;  1PV4 A;  5CGK A;  2X6G A;  5KEE A;  1KTK A;  1IBL L;  1BR9 A;  4C3J B;  2PZU A;  1BOS A;  3WWV A;  3KF6 B;  2R92 H;  3KDF A;  3B6Y A;  1EQV A;  4IZ8 A;  4GOP A;  1VQP A;  1XPU A;  3E5S A;  1IBL Q;  1V9P A;  1T5E A;  1XTC D;  2MPM A;  1DOL A;  4K14 A;  1XYI A;  2JA6 G;  2J0T D;  3HS0 C;  2WIN B;  3FP9 A;  2IX1 A;  1F9Q A;  2IJ0 A;  3ZYY X;  5M5Y H;  3S1M H;  4JV5 Q;  3A7A B;  2E2J B;  2UXD Q;  4JI3 L;  3ND9 A;  1WD0 A;  1X32 A;  3BU2 A;  3E9H A;  4R4Q A;  1TWH H;  4JOI A;  1SEB D;  4PMC A;  3I4M G;  4JI3 Q;  5IGE A;  3D0F A;  2B2T A;  2OXP A;  4DV1 L;  1H9K A;  1UE5 A;  2KQ3 A;  4LF5 L;  1B3A A;  3L9A X;  1WCM G;  1HR0 W;  2AHO B;  5J22 A;  4IUP A;  3CME A;  5T1I A;  5IGC A;  3J81 E;  4DV1 Q;  1HUN A;  4DAV A;  1CK1 A;  1YIT A;  2NTS A;  1DM0 B;  1EUJ A;  2B2V C;  2UU9 L;  5EBD A;  4ZRZ A;  2B8G A;  5EKI A;  4PG3 A;  2JQO A;  5E1F A;  1CHQ D;  4JPB W;  1I4H A;  5C0X H;  3JAM c;  1SYB A;  3QIA A;  4A3J H;  3S2D H;  1U0L A;  4LF8 Q;  1S5D D;  4IO9 A;  1D1K A;  2UU9 Q;  2VZA A;  3R2T A;  3OW2 A;  5ELE A;  1X3Q A;  1WTH A;  5M5W B;  4R4C A;  2EYJ A;  2L4N A;  1NUC A;  1KLU D;  3N52 A;  3UDG A;  2RSN A;  3GTJ H;  1SRO A;  3HOY G;  4CJ1 B;  1PH1 A;  1HH2 P;  2WAC A;  2WP8 J;  2DJF C;  2L11 A;  4L5R C;  3DEP A;  3DUZ A;  2DN8 A;  4IFD J;  1PTO H;  2A5H A;  1WI5 A;  1F2L A;  3K59 A;  3KJP A;  3CCS A;  5LMN L;  2YTX A;  4KHV A;  2LFN A;  1Y69 U;  3GTL H;  5E4W C;  1BBW A;  2R92 B;  4ZUJ A;  4GKJ L;  1VMC A;  3I8Z A;  2A1A A;  4GZY C;  1I4R A;  5IY0 A;  3D4W A;  1VQ6 A;  1S3O A;  1SDF A;  5LMN Q;  2A73 B;  4BBS B;  3GTQ H;  1XMQ L;  2JN4 A;  5IP7 H;  4IPC A;  4GKJ Q;  1EOT A;  4O2D A;  4IPH A;  2EYM A;  1TQO A;  5M5Y B;  2K5Q A;  3HG9 A;  4A3M G;  3E0E A;  1STE A;  2EYO A;  2UXC Q;  1XMQ Q;  1F9R A;  1TVX A;  1JJC B;  3LWU A;  1LYL A;  2JA8 G;  2AWN A;  1HZA A;  5K36 H;  2BA1 A;  2N3S A;  2PO4 A;  4DR3 L;  3A74 A;  2CQA A; 
#chains in the Genus database with same CATH homology
 2RA4 A;  3IFD A;  3ONA B;  1JOK A;  4DN4 M;  3NBH A;  1MBY A;  4KV6 A;  1RF2 D;  5IT9 L;  3OMC A;  1EY8 A;  4EVO A;  1TY0 A;  2NZ1 D;  2CVR A;  4C3I B;  3V2T A;  2B2W C;  3OWE B;  5FKA C;  4EQN A;  2EJG C;  3S2D B;  4A3J B;  4ABN A;  5FLX E;  3I73 A;  1RTO A;  1SMY D;  4OIK A;  1H9R A;  1SE3 A;  3LX0 A;  4G57 A;  1ET6 A;  2A68 D;  5J39 A;  1SNP A;  4BBR B;  3A8I E;  2IX3 A;  2RDF A;  3TDQ A;  1TS3 A;  1JB3 A;  2EYP A;  1BF4 A;  1PTO B;  1NAP A;  1WTR A;  5DEH A;  2NYZ D;  1I4Q A;  1SMY C;  1D2B A;  4RGO S;  2A68 C;  3Q23 A;  4QMG A;  3K0Y A;  1I4G A;  1O78 A;  2AQ3 B;  3TME A;  2LY7 A;  2J7Z A;  3J80 E;  3A8J E;  3NQI A;  1LTR D;  3HKZ B;  2K04 A;  2N55 A;  2VB3 X;  1UAP A;  4DNR B;  2F1M A;  2O4X A;  4A3K B;  3I4N B;  4OL7 A;  1LTG D;  4YIJ A;  4LAA A;  3CQZ B;  3PUY A;  2XRS D;  5JVH 3;  2Q8T A;  1STN A;  4HSP A;  3I4L A;  5EKK A;  1II3 A;  2K5D A;  1D5M C;  2QEJ C;  4KK7 A;  4XT1 B;  2E2D C;  1Q12 A;  3HOZ B;  1DCZ A;  4WOR A;  4IUU A;  3BVZ A;  5E4X A;  5CYU A;  1RDP D;  5CC4 A;  1ML0 D;  3QOL A;  4CBV A;  2ICE C;  1LV9 A;  1XX8 A;  4EGV A;  2JYO A;  3SE0 A;  5JVG 3;  3PIO 3;  1GXD C;  1QB5 D;  4XXE A;  2MJ8 A;  2PNR C;  1R4P B;  1A15 A;  1ET9 A;  2IX0 A;  3A55 A;  5EGT A;  3NE5 B;  2AQ2 B;  3T56 B;  3MXN A;  1S5C D;  3S1R B;  5IGF A;  3TP7 A;  1AP0 A;  3GQB A;  3CRK C;  4CJ0 B;  1H9J A;  2F0K A;  3IL8 A;  2VB2 X;  1QNU A;  3URY A;  3ERO A;  2EDG A;  3K6O A;  2F0O A;  2RKS A;  5BN3 A;  1HQM C;  2L0C A;  2R3Z A;  2SOB A;  1BDO A;  2A6H D;  5ELD A;  1EYA A;  4ULL A;  1IYV A;  1STA A;  1UEA B;  4KY6 A;  1I50 B;  5C4H A;  1RHP A;  1KAA A;  4Q0F A;  4FO2 A;  1LTS D;  2WKD A;  4ILW A;  1MD2 D;  2A6H C;  2QKI C;  2EVB A;  1LT3 D;  1HRJ A;  2A6E D;  1HTP A;  4C3H B;  5NUC A;  1STY A;  4RWS C;  2B2U A;  1MGS A;  3TZU A;  2NTT A;  1DON A;  4K5X A;  3VR2 A;  2F0L A;  4DU9 A;  4FNF A;  4JK1 C;  4MN3 A;  5C5M A;  2A6E C;  4FF3 A;  1KDC A;  3OMG A;  1DOK A;  1H9S B;  3EJI A;  1GUO A;  4K8J A;  4Q5V A;  1RCV D;  1B1Z A;  1EYC A;  3DM1 A;  4CKE A;  2MUY A;  4BS9 A;  3PMF A;  4ZKC B;  3OW7 A;  3QO2 A;  1WTW A;  3PUV A;  4DK1 A;  1Q8I A;  3J7Y W;  2AQ1 B;  4L6T B;  2JE6 I;  3BYY B;  1IL8 A;  4V19 0;  4K5V A;  1ROD A;  3RZO B;  2L55 A;  1ZKO A;  2FJ2 A;  2PCF B;  3FPP A;  1EEI D;  4QF4 A;  5I4D A;  2K01 A;  4JBW A;  1CZG A;  1F2Z A;  4DAY A;  3I90 A;  2EY1 A;  3D4D A;  1EWC A;  4WRD A;  5LL6 X;  3TZD A;  5M3F B;  1Y8O B;  5JAV A;  4L8J A;  2FIN B;  1PZK D;  4TSS A;  1GUG A;  4G7H C;  1I4P A;  3WOF A;  3PUW A;  3QB3 A;  2Z1C A;  2X69 A;  1O7L A;  1EQT A;  5D65 A;  4C1N K;  2BE5 D;  4IN3 A;  1PRT F;  1VF7 A;  3MWY W;  3HOX B;  3EVQ A;  3MAQ A;  4K6L A;  1AZP A;  1IHZ A;  2F3W A;  1Z47 A;  3NTH A;  1G91 A;  1ESR A;  3NP8 A;  2I07 B;  3C46 A;  1Q1B A;  1LTA D;  3O13 A;  4NMZ A;  5EJW A;  3L3O C;  5ELB A;  3GP7 A;  1OXT A;  5IGB A;  1AEX A;  2BE5 C;  2PW5 A;  3AMU A;  1JOR A;  4RAU C;  1K83 B;  1PLF A;  2K33 A;  1EZ8 A;  2SDF A;  4H13 C;  2D9U A;  1CI3 M;  4KKT A;  5TSS A;  1EY4 A;  4B08 A;  2AWO A;  1FNU A;  4IFD I;  3A7L A;  2JEB I;  5FOB B;  1DZ1 A;  3D31 A;  3I72 A;  1TWC B;  5EPK A;  1EYD A;  1JWM D;  2YU9 B;  5A2Q E;  5JPN C;  2R93 B;  1W6J A;  1CFM A;  1SAP A;  2NN6 I;  4LMQ D;  4A3F B;  2FMM A;  5M9O A;  5DNF A;  3EA6 A;  3KF8 A;  2IW3 A;  4DFA A;  3GTK B;  4R9W A;  1STG A;  1YNJ D;  4OIJ A;  1DD2 A;  1Y1V B;  3PIP 3;  1A6X A;  2NN6 G;  1TS4 A;  2Y0S B;  1JOO A;  2XNA C;  3SEB A;  2KEE A;  1JQY D;  3OHX C;  4Y7N B;  2HDL A;  2OF1 A;  4ZQ3 A;  3K7A B;  2F0J A;  1S5E D;  3VYU A;  3TSS A;  4X3U A;  1YNJ C;  1FNV A;  4ZUI A;  2JXM B;  3P7J A;  2ENB A;  1XWE A;  1T5X D;  1E2Z A;  2WB1 B;  3GTM B;  4KN7 C;  2EYF A;  1FGB D;  3HZX A;  1GHK A;  2F0G A;  4A3I B;  3BDC A;  3VYR A;  1ZYR D;  2F0D A;  3DEO A;  2IWH A;  1G8Z D;  3T4A C;  2BDO A;  4BY1 B;  5C3E B;  3S14 B;  1PRT D;  2WAQ B;  2TMP A;  3QJY A;  3HRZ C;  4A3E B;  3I91 A;  4HCS A;  2KEC A;  3ERQ A;  5F2D A;  2FFK B;  3TBI B;  1ICW A;  1CQV A;  1J9O A;  1G2S A;  2K5W A;  3GD7 A;  1PRT C;  3HP3 A;  3I70 A;  2G9D A;  1VF5 C;  3P75 A;  3GTP B;  2N88 A;  2SNM A;  4ZKB B;  1CHP D;  3V96 A;  1OXU A;  1RD9 D;  2KOL A;  3R3O A;  3NWT A;  1STH A;  1EIG A;  2L12 A;  3Q6S A;  2PYK A;  3BDO A;  4PMB A;  3S1M B;  2ZXO A;  4DGZ A;  2KJX A;  3I3C A;  5LL6 S;  1TWH B;  1SYE A;  3NPP A;  5D3I B;  5ELC A;  4F8M A;  1FD7 D;  5C3X A;  4IFD H;  1Q3L A;  2LMC B;  3MFG A;  3NK9 A;  1U4M A;  2IL8 A;  5KYL A;  4IUN A;  3T53 B;  4RHS A;  3LNN A;  2F0M A;  1BQQ T;  3S15 B;  2EY5 A;  2K6A A;  1HTL D;  4F88 A;  2M9V A;  1KAB A;  2MGS A;  4KY5 A;  3X3N A;  1WTP A;  1GUS A;  2NN6 H;  2C9O A;  4F87 A;  4EQP A;  3UI2 A;  2I46 A;  2Z4I A;  2DNE A;  4PMW A;  1EIH A;  3TN2 A;  4J8Q A;  1CM9 A;  4OHJ A;  3GTJ B;  3P20 A;  1O80 A;  4QIW B;  1PYW D;  3G6J B;  5LHY 1;  3KBX A;  3H91 A;  4CKB A;  2JEA I;  4DK0 A;  3GTL B;  2XWB B;  3HOU B;  5DAU A;  1J8I A;  1I3Q B;  5HUR A;  4XYQ A;  2F0Q A;  3NBI A;  3GTQ B;  2DY8 A;  4BWG B;  3A8K E;  1K8M A;  1RTN A;  4PQX A;  3VYS A;  3S1Q B;  2EY6 A;  3EFX D;  1B9M A;  1JC7 A;  2K32 A;  3HEJ A;  3PUZ A;  2MP1 A;  3HOV B;  2B39 A;  2NB0 A;  2B2U C;  1G29 1;  3OOC A;  4RHR A;  1LAC A;  3SK6 A;  3R8B A;  5K5P A;  2EPB A;  5KIX A;  1HXY D;  3M7G A;  4E6I A;  2CHB D;  3T51 B;  1TWG B;  3BYT B;  5BN5 A;  1UUP A;  5DM7 3;  1V43 A;  4XYO A;  1CT1 D;  1NR4 A;  1EU3 A;  3IKJ A;  3ITP A;  4OGQ C;  1CQF A;  2L5T A;  2JA6 B;  3M4O B;  3DXJ C;  1EWH A;  3MTS A;  4C2M B;  4FF4 A;  2NVY B;  5CR3 A;  3N6R A;  4DXG A;  2KCN A;  4B9W A;  3M85 A;  1BCP B;  1PDQ A;  2NVX B;  4M1U B;  2RVL A;  5CBA E;  3I4M B;  1BO0 A;  4Z9C B;  5I6Y A;  5C6A A;  3JAM L;  5C4Z A;  5CV4 A;  1BNZ A;  2Z8L A;  3MFY A;  3SXH A;  1EY6 A;  2H4O A;  2EXZ A;  2A69 D;  1MSG A;  1ESF A;  5IT9 E;  1I6H B;  1RJT A;  1SJE D;  1YNN D;  3K58 A;  2F3V A;  2L9H A;  5DM6 3;  2R61 A;  3TP6 A;  1A2U A;  4XQJ A;  1JIC A;  2IT1 A;  2C5C A;  2XRQ D;  3HOY B;  4C3J G;  2BOS A;  2EJM A;  1QE6 A;  3Q24 A;  4DXF A;  1YNN C;  1ENA A;  4XDX A;  1SND A;  1A3V A;  5C4J B;  4X3T A;  1HPC A;  4FYD A;  3QWN A;  4C56 C;  4HSV A;  4KKU A;  2F0U A;  3H94 A;  5IIF A;  4XIG S;  1TU2 B;  1B9N A;  2F0P A;  1HFN A;  2EY2 A;  1TS2 A;  2OEO A;  4IQZ A;  1NR2 A;  1PFB A;  4ID6 A;  3OIQ A;  2Q8R E;  4A3M B;  1HFG A;  1V1P A;  3A54 A;  5I6W A;  2PQE A;  2JA8 B;  5JOB A;  4LJZ C;  4KN4 C;  3MHB A;  3DMU A;  2G9H D;  4IAL A;  4ZLT F;  2E2I B;  3SK8 A;  4IUV A;  1SNC A;  1VCI A;  4HN7 A;  5AFW A;  4PV1 C;  1CA5 A;  2HCC A;  2ZXR A;  4KMU C;  1JE4 A;  3FKI B;  1LT5 D;  3TP8 A;  1F9P A;  3OWF A;  3MA2 B;  1L0Y B;  1HHV A;  4U67 3;  1EZ6 A;  3BZD B;  5C44 B;  1RKN A;  4MHE A;  1C4Q A;  1TKW B;  5IOC A;  2ZT9 C;  5EPL A;  1QIL A;  3RD4 A;  2F0F A;  5JPM C;  3OSO A;  1IKM A;  1V1O A;  1TR5 A;  2JP1 A;  3PUX A;  4RGN A;  4NKL A;  1ZXT A;  4DAP A;  3FVQ A;  1Y8N B;  4IUR A;  4OO1 I;  1G6Z A;  1H9S A;  1Q1E A;  3KLS X;  4EQO A;  2VNU D;  2FHT A;  1SYD A;  4K2L A;  2E76 C;  3D3R A;  3S2H B;  4S3S A;  3L7Z C;  1LLR D;  1TWA B;  5COR A;  2PZW A;  1R4Q B;  2PMZ B;  4TQU S;  1EY9 A;  1NCV A;  3GTO B;  2R6G A;  2EYL A;  1LO5 D;  2R7Z B;  2M2L A;  3FEW X;  4OO1 G;  1D5X C;  4L63 B;  1KNA A;  3J81 L;  3T13 A;  5KND A;  3WDN A;  1PTO F;  3LWE A;  1K8O A;  3NQT A;  4NW2 A;  1SE4 A;  3MXP A;  4G7Z C;  3A56 A;  1GJX A;  2F0T A;  1TS5 A;  4C3I G;  2WII B;  4CGY B;  1BXT A;  2IPK D;  5CV8 A;  3RZD B;  5IGG A;  4G4K A;  2HQE A;  3E0J A;  4RFB A;  5A35 A;  2L1B A;  1WTV A;  2JA5 B;  1S5F D;  3VA7 A;  1OXX K;  1B2T A;  2E2H B;  1IW7 D;  3CRL C;  3M7N A;  1STB A;  2NVT B;  5FO7 B;  4G7O C;  4TRD A;  4HAE A;  1GOZ A;  4AYB B;  2AUK A;  2LS0 1;  4X3K A;  3SR1 A;  1IW7 C;  1F9S A;  2K05 A;  1FR3 A;  4O1N A;  1V8Q A;  3C1F A;  1JWS D;  5FK9 C;  1PXU A;  3K5N A;  3FDT A;  1SYG A;  1GUN A;  3MC0 B;  3S1N B;  3W3A A;  3TP5 A;  3RLF A;  2RSO A;  1HUM A;  1ONL A;  4U68 A;  1ZEQ X;  4RA8 A;  2EOT A;  2XVS A;  1B50 A;  2SEB D;  1U4L A;  5I2Y A;  2O2L D;  1SBB B;  2RQX A;  3C1E A;  4FXK C;  2VXW A;  3WOE A;  2XSC A;  1B44 D;  3C2P A;  4P2C B;  1DOM A;  1BCP F;  3IFT A;  1SSO A;  2GA4 B;  3HGB A;  5FLX L;  1FNW A;  3Q22 A;  3J7A F;  4IUT A;  4RGM A;  1PZI D;  4CJ2 C;  1TY2 A;  1D6E C;  1O7Y A;  2EE1 A;  4QCL A;  2NBF A;  1H9M A;  2ID0 A;  2J4X A;  1BBX C;  1KLG D;  5C0X J;  1OXS C;  1EY0 A;  5T1G A;  5E3F A;  3DWA A;  4ME5 A;  4FXG C;  3GV6 A;  4KTA A;  1GUT A;  4OO1 H;  2HDM A;  3R93 A;  4WFN 3;  1SJH D;  3J80 L;  1TT2 A;  1CZW A;  3DWP A;  4RKB A;  1PTO D;  4H44 C;  3S17 B;  1ZYR C;  2E75 C;  3V05 A;  1KNE A;  1S5B D;  5I9O A;  1PZJ D;  1B53 A;  2ICI A;  4BY7 B;  2V4D A;  4K8I A;  3U9S A;  3MXG A;  5G3L D;  1A3T A;  1PTO C;  3MXU A;  1EY5 A;  2DY7 A;  2MHV A;  1OXV A;  2JSO A;  2BCO A;  2DNC A;  1IYU A;  5FO9 B;  1TII D;  5COY A;  1I6V C;  1BUV T;  2X6L A;  4NDX A;  1MI2 A;  2K7V A;  1F2Y A;  1SFO B;  4X3S A;  1DJR D;  4CHT B;  3VYT A;  4XQN A;  4RCO A;  1CA6 A;  1JCK B;  2D2C C;  2K1B A;  4KI0 A;  1LTI D;  1A2T A;  3C3L A;  4J6H A;  4K2K A;  2KUM A;  3QG1 A;  4C3H G;  3SK5 A;  1CTM A;  1Y1W B;  2EZV A;  4QUC A;  2K03 A;  2OT2 A;  1SNM A;  4ZAI A;  4HMI A;  3OIP A;  5C5L A;  4J1M A;  2D62 A;  4FVM A;  5IGD A;  5CV6 A;  1AFP A;  3NSW A;  2E74 C;  2KCC A;  3S16 B;  1BCP D;  2QDB A;  3G7L A;  2HCI A;  1WVL A;  5ELF A;  3P1H A;  3K5M A;  4A3D B;  4LK1 C;  3MZ5 A;  5EKL A;  4A3G B;  1AW7 A;  4HMJ A;  1SXT A;  4O42 A;  1WTO A;  3DHQ A;  1AZQ A;  1BCP C;  1LTT D;  3VR6 A;  3VA5 A;  3K5O A;  4I7Z C;  1PRT B;  5JEA G;  2YYZ A;  3K57 A;  3VR3 A;  1SNO A;  4TKO B;  4RGT A;  2K28 A;  3D6C A;  1L0X B;  3KK7 A;  2F4I A;  4FF1 A;  4HCE A;  5EQ0 A;  3DWQ A;  3BG3 A;  1SYF A;  4C1N I;  4QB4 A;  4HTH A;  3IAY A;  3RUZ A;  3M3Y B;  2B2V A;  3H09 A;  4QUF A;  2D5D A;  5M3M B;  1C48 A;  1JWU D;  3KBG A;  3BDL A;  4WJW A;  1MSH A;  1C8C A;  4H0L C;  5CV5 A;  1GHJ A;  1U9R A;  1EL0 A;  3FMC A;  4RCN A;  1FYC A;  1E2W A;  1LTB D;  1NSN S;  2XN9 C;  3MEH A;  2CW0 D;  2O5J C;  3SK4 A;  1QOH A;  1D5Z C;  3E6Z X;  2A74 C;  3ND8 A;  1ILP A;  5I2X A;  3BVM A;  2EYH A;  4R8I A;  4KD4 A;  3R2I A;  1EU4 A;  2CW0 C;  3CKI B;  5CV9 A;  3QOJ A;  3SDZ A;  1LAB A;  3MVV A;  1W6K A;  1GUW A;  4XQQ A;  2KA7 A;  5EPJ A;  5CMD A;  2WV6 D;  4DNT B;  5I9P A;  5M5X B;  2Z4H A;  1WCM B;  4HR7 B;  2RDH A;  1UNS A;  4K5W A;  3H6M A;  4UDU C;  3VR4 A;  4K6D A;  5J1Z A;  5JEA J;  1E2V A;  4F7X A;  2F0H A;  3K5L A;  2BDN A;  5D14 A;  2B2Y C;  4N9T A;  1Y8P B;  2B2W A;  4NP5 A;  5BN4 A;  4RH6 A;  4BA2 I;  1D1I A;  2F0S A;  4A3B B;  2A69 C;  2F03 A;  4KHZ A;  2F0W A;  5C4X B;  2M00 A;  2QF7 A;  4FP5 D;  4KD3 A;  3HOW B;  5FO8 B;  1M4V A;  1V1P B;  1F2M A;  2PPB C;  4RKL A;  3NUC A;  1S4Z A;  2SNS A;  1O7Z A;  3H3V C;  1ENF A;  2BA0 A;  5JEA H;  3Q0A A;  1U4R A;  2H1E A;  3AU7 A;  1SE2 A;  1SNQ A;  4M8A A;  2FMC A;  5C3W A;  1Z6H A;  3VR5 A;  1ILQ A;  2EJF C;  3W2D A;  1QJO A;  4ODG A;  3EQL C;  1HA6 A;  3PO2 B;  4I65 A;  2LKV A;  2KVM A;  1QCB D;  3KLS A;  1TWF B;  5A2Q L;  3NTK A;  1A3U A;  2VUM B;  1QWY A;  3CU7 A;  1Q90 A;  5KNB A;  4KKS A;  3U9O A;  5HGT A;  1X3P A;  1JOQ A;  3SHL A;  4V0B A;  1U4P A;  2F0E A;  3NWS A;  4A93 B;  4KY7 A;  1QG7 A;  2NWG A;  1G2T A;  1VDZ A;  3OPO A;  1EEF D;  1JR0 D;  4FXD A;  4UAI A;  3T16 A;  2JA7 B;  3NXW A;  2QCP X;  1EFI D;  1EY7 A;  1M8A A;  3PV0 A;  5D3D A;  1DXM A;  3PO3 B;  2B8F A;  1PFN A;  1OO9 B;  1I4X A;  3GTG B;  1Z7T A;  4HED A;  3FPU B;  3D8G A;  1HA5 A;  3GO5 A;  2PW7 A;  2F0I A;  2AUJ D;  1HQR D;  3FRP B;  2B2Y A;  3JAM E;  1E0B A;  2RDG A;  2NUC A;  2F0N A;  2F0V A;  2QIL A;  3BS1 A;  5IOD A;  1QNK A;  1KDA A;  2O5I C;  5C0X I;  3RMH A;  3KLR A;  1DYQ A;  3F2U A;  4DF7 A;  3M4Y A;  1AN8 A;  1WTQ A;  4KJN A;  4DA2 A;  5KNC A;  2B2T C;  4PNY A;  2KED A;  2ZXP A;  2PZT A;  1XXG A;  5C0X G;  4ZK9 B;  5G3L F;  5JJZ A;  3NTI A;  1LT4 D;  4XTC S;  4MIU A;  3CHB D;  1F77 A;  2RBM A;  5ISR A;  2HUG A;  5KRU A;  4FF2 A;  2KHS A;  4BA1 I;  1HCZ A;  1IKL A;  5CV7 A;  3D6W A;  4R8N A;  1R9T B;  2B63 B;  2XWJ B;  2TSS A;  4N9P A;  4IUQ A;  5KGU A;  3X3M A;  4H7B A;  4CKC A;  1PFM A;  3SVM A;  5CBE E;  2XIW A;  3J7A V;  3AB9 A;  1LT6 D;  2Q8I B;  4B9X A;  1WTX A;  1B4O A;  3GV3 A;  5KYI A;  5K36 G;  3NHH A;  4ZYS A;  3D4R A;  4IFD G;  1SYC A;  5EBC A;  3S9W A;  4KJO A;  3KUP A;  1KDB A;  1ENC A;  1WD1 A;  2NVQ B;  1VMP A;  3H0G B;  1PMR A;  4XT3 B;  3BVG A;  2WKC A;  5CGK A;  2X6G A;  5KEE A;  1KTK A;  1BR9 A;  4C3J B;  2PZU A;  1BOS A;  1EQV A;  4IZ8 A;  3E5S A;  1T5E A;  1XTC D;  2MPM A;  1DOL A;  4K14 A;  1XYI A;  2J0T D;  3HS0 C;  2WIN B;  2IX1 A;  1F9Q A;  2IJ0 A;  3ZYY X;  3A7A B;  2E2J B;  3ND9 A;  1WD0 A;  1X32 A;  1SEB D;  4PMC A;  5IGE A;  2B2T A;  2OXP A;  1H9K A;  2KQ3 A;  1B3A A;  3L9A X;  5J22 A;  4IUP A;  5T1I A;  5IGC A;  3J81 E;  1HUN A;  4DAV A;  1CK1 A;  2NTS A;  1DM0 B;  2B2V C;  5EBD A;  4ZRZ A;  2B8G A;  5EKI A;  5E1F A;  1CHQ D;  1I4H A;  5C0X H;  1SYB A;  3QIA A;  1S5D D;  1D1K A;  3R2T A;  5ELE A;  1X3Q A;  5M5W B;  2EYJ A;  2L4N A;  1NUC A;  1KLU D;  3N52 A;  2RSN A;  4CJ1 B;  2WAC A;  2WP8 J;  2L11 A;  3DEP A;  3DUZ A;  2DN8 A;  4IFD J;  1PTO H;  2A5H A;  3K59 A;  1F2L A;  4KHV A;  2LFN A;  1Y69 U;  5E4W C;  2R92 B;  4ZUJ A;  1VMC A;  3I8Z A;  4GZY C;  1I4R A;  3D4W A;  1SDF A;  2A73 B;  4BBS B;  1EOT A;  2EYM A;  1TQO A;  5M5Y B;  2K5Q A;  3HG9 A;  1STE A;  2EYO A;  1F9R A;  1TVX A;  3LWU A;  2AWN A;  5K36 H;  2BA1 A;  2PO4 A;  2CQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...