1CSPA

Crystal structure of the bacillus subtilis major cold shock protein, cspb: a universal nucleic-acid binding domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords COLD SHOCK PROTEIN B(CSPB)
publication title Universal nucleic acid-binding domain revealed by crystal structure of the B. subtilis major cold-shock protein.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1993-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1cspA00
1J6QA 1YITA 1OXSC 4JI4Q 1OTCA 2R7ZG 1P8LA 4UP7A 4WJ4A 4B3TL 4GN5A 4A75A 4A3EH 2K4KA 1SN8A 3ERSX 3PUZA 3H3VH 3BU2A 5GAHC 1PH3A 4C3HH 1Q1EA 4X66Q 1JE5A 5M5WH 3S16H 1X65A 3M4PA 1PH6A 2I5MX 1NBWA 2K14A 4EX5A 2JEAI 2YV5A 2OTLA 2WP8J 1PH7A 3ICEA 3M7NA 4RMFA 2ZM6L 1Q8KA 3CPWA 2PI2E 1U0LA 1PA6A 4BBSH 3JAMi 1YIJA 1Q86C 1UE6A 4DK3C 5FLMH 1FGUA 1Z47A 1K8AC 2ZTEA 3NEMA 1LUZA 1K0RA 5IY0A 2UUCL 3NENA 1LYLA 1WCMH 3STBD 3CCVA 3U4VA 5C0XG 5IYCH 1KQSA 1SROA 2XTIA 1IBLL 3GO5A 4A93H 5E7NA 3I4MH 5BR8L 1HNWQ 2B3GA 3JAMc 1YJ9A 4DAYB 5IWAL 2A19A 1XNQL 4A3DG 1E7ZA 1TWFH 1KD1C 4GKKL 2YYZA 2IX1A 4DR2Q 3GTMH 1LTLA 5C3EG 4DUZL 5IYDH 3S17H 1V43A 1HNZL 5EAYA 4A3KG 2YTXA 4DV3L 1S72A 1FJGQ 3EBEA 4A3MG 4R1JA 4A3BG 4DV7L 4IOCA 4JI2L 3S1QH 1FL0A 3TREA 3A5UA 4A3IH 4LF5Q 2A1AA 4NB3A 3FP9A 2VUMG 4BXXG 1KAWA 4JYAL 4LF6L 1W2BA 2HHHQ 1N33Q 2VQFQ 1CKNB 4LUVA 4AH6A 3J7ZC 1M1KC 2ES2A 1L0WA 4POFA 4YHHL 1HNXL 2D0PA 3GD7A 4R4OA 1M90C 3RZOH 2E5LL 5C4XG 2Q2UA 2E8GA 1V1QA 4PZ6A 4LF7Q 4X6AH 1QZHA 3U58A 2IHEA 4JC0A 1EOVA 3CD6A 4IPGA 1A62A 3KF6B 4GOPB 1KRTA 3ER0A 4OX9Q 3GTKH 4GLVB 1IBKQ 3GTPH 1N9WA 1E24A 1PV4A 1SR3A 4JI1L 1TWGH 4A3CH 1JJ2A 2MQHA 2HIXA 1BBWA 1NTGA 2MFIA 4KHZA 4DAMA 4JG2A 3BZCA 3CXCA 3E0EA 2HIVA 4R4TA 2UU9Q 5C0XJ 4JI7L 1OXTA 4P72A 2ZJQA 1VQJA 4AIMA 4OONA 4JV5Q 2RCNA 1NE3A 4DR6Q 4B3TQ 2R7FA 4PG3A 1X6OA 1WOCA 3E9IA 2R6GA 2JA7H 4DR4Q 3L7ZC 4HJ7A 2WAQG 4LW1A 5LMUL 1PH2A 1QVCA 4POGA 2A8VA 1A8VA 4EQ5A 1PH5A 2LXJA 4ME3A 3K7AH 4APVA 2F4VL 1Q1BA 4P71A 1Q81C 3CPFA 4KHPL 4OWWB 1X3FA 2PMZE 4YY3L 2ZM6Q 5M3FG 5IYBH 3STBC 3GDEA 1IYJB 4DV6L 5IP9G 4GNXB 1OXUA 2Z0SA 1JJGA 1TWHH 2R7ZH 5GAEC 1VS0A 5FLXc 4H02A 4B3RL 2UUCQ 1E1TA 2CWPA 3KF6A 5ELNA 4C3JH 4GOPA 1KC8C 5HGQA 3PF5A 1C0AA 1H95A 1IBLQ 2KCTA 4HJAA 3VDYA 4DUYL 1W3SA 5IWAQ 3ULLA 1XNQQ 4JI8L 3HFZB 3S14H 4X64Q 4B3SL 3KLWA 1YJWA 4DUZQ 4HIOA 4BA1I 5GQOA 2CFMA 3PGZA 1HNZQ 1CKMA 4MNOA 3M4OH 1I94L 1E22A 1S3OA 4DV3Q 5IT9c 1MJCA 1N34L 3T1HL 2JA8G 4KI0A 4AYBE 1PH4A 3W1BA 4DV7Q 2JEBI 4JI2Q 4X62Q 1K8GA 4LNQA 3MEFA 3RLFA 2CKZB 1VQMA 1PHJA 3K81C 4P73A 2MNAA 1UE5A 4LUZA 2UUAQ 3KJPA 4LF6Q 3HOYG 4JYAQ 4KLKA 4OXPA 1IXRA 1N32L 4YHHQ 1WI5A 4DV0L 4IPCA 4HJ9A 2E5LQ 1QUQB 3D0FA 3PUXA 1I3QH 1VQFA 1VQHA 3UDGA 1VQIA 3KYHC 3PSIA 4A3DH 3AEVA 2R7DA 4P75A 1L2FA 5M3MH 4LFCL 3FHWA 2KENA 5JJIA 1IBML 3PV0A 4GNXA 1LM0A 3GTGH 1UE7A 4A3MH 5C44H 4A3BH 4JI1Q 1NMFA 3RR5A 2OCEA 4GOPC 4NPSA 4JI6L 3HKZG 4UY8C 4GS3A 1L1OC 1HZAA 1ASZA 2R92H 3H0GH 1UE1A 4UPAA 2EIFA 5GADC 3RNUA 1FVIA 4BBRG 2UXCL 1VQNA 3HOUG 1WJJA 2L15A 4JI7Q 3OYYA 4WJ3M 1MJEA 1PFSA 4R4IA 4DV5L 3F8TA 3IRBA 3PO3H 4BY1G 5C4XH 1X55A 1VQ5A 4IJHA 1YHBA 3M9BA 5JEAJ 4C3IH 4IJLA 4JBKA 2VL6A 2B63G 4GN4B 2VUMH 2R93G 2ZTCA 3D31A 3GTLH 1VQDA 2KHIA 4X65Q 4HJ5A 4LFAL 4DV2L 5LMNL 5LMUQ 4YCUA 4LF8L 3LGJA 3I4NH 3PO2G 4GLAC 5LMNW 4BY7G 2F3IA 3BZKA 4NXMQ 3KFUA 4OWXB 1XMQL 1Y1WG 4DR5L 3AYHB 3RN2A 2F4VQ 3PUYA 1VCIA 3T1YQ 1TXYA 3ULJA 4DV1L 1VQ8A 4GKJL 1HR0L 4XIGS 3CQZH 1HR0W 2VY3A 1QUQA 1QVFA 2AKWB 3G48A 2ZJRA 1YVCA 4OWTB 3UE0A 1WFQA 2JA9A 5DLQE 1A0IA 1Y14B 2N49A 3F1ZA 3CP0A 3OTOL 2NN6I 3M85A 1Q12A 4JCVE 3HOXG 4GNXC 1HH2P 5IP7G 2VNUD 2NVYH 3PIPA 2AWNA 2Z6KA 3K8AA 2Y0SE 4JI5L 4DR1L 2JK8A 3HOWH 4JI8Q 4OO1G 2YTVA 3TS0A 3UDFA 3CCUA 3S1MH 1E3PA 4BBSG 3W5OA 4A3LG 4GLXA 1HJPA 1E1OA 2VQEL 3H3VI 1VQEA 5FLMG 1XMOL 1I94Q 2GVBA 5M5XH 4A4IA 2N78A 3TEHB 1VQLA 4J15A 4JOIA 1N34Q 2AMCB 3T1HQ 1PVOA 1WCMG 4TQUS 3PCOB 2BA0A 5IP9H 2JJQA 4A3JH 1AE2A 1UWVA 3HOZH 4A3GG 1G51A 5AJ3Q 3CCRA 1NY4A 2KHJA 1AH9A 3A74A 4X66L 4AQYL 1VQPA 4IFDG 1EIFA 3I4MG 1GVPA 3I4OA 3M3YH 2K5NA 2JA5H 4L5QA 4QL5A 4OO1I 1XTDA 4DV0Q 2D62A 3FKIH 3I2ZA 3RLNA 5IYDG 1EQQA 1VQ6A 1KIXA 1VQBA 2I5LX 2RHQB 1CSPA 3CC4A 2OWOA 4LF4L 1SE8A 4DR7L 4QGUA 4NXNL 1Y1VG 1VQGA 1YZ6A 1XJVA 4UP9A 3F2DA 4LFCQ 1CUKA 3A5ZB 2AWOA 1IBMQ 2K75A 2ASBA 1IL2A 4LF9L 2WB1G 4A3FG 4IFDI 3EN2A 3M4QA 1VQCA 1GM5A 2VZAA 3CCSA 1Q7YC 3MXNB 5HY6A 3PUWA 2YU9H 3S2DH 3HOVG 2OQ0A 3CMAA 1D8LA 3UDXA 3HOYH 1HNWL 4Y52H 1N36L 4JI3L 4JI0L 2HT1A 4DV5Q 1B8AA 1OXXK 4DR2L 3B6YA 1X3GA 1YHQA 2PQAA 5BR8Q 2JA6G 3S1RH 3RLOA 1RIPA 4JBWA 1FJGL 4GKKQ 4JOIC 2IT1A 3H15A 3BJUA 4LFAQ 3KJOA 4A3CG 1X54A 1YBYA 5LMNQ 1WYDA 4LF8Q 4LF5L 4QJFA 3AFPA 1XMQQ 3J7A5 4DR5Q 2HHHL 2B29A 3I55A 4L5SA 5K36G 1RL2A 3J80i 3GTOH 4IO9A 4DNIA 4GKJQ 1HR0Q 3NBHB 4BBRH 2H5XA 2NVQH 4YWLA 4XTCS 3K0XA 2KCMA 4PZ8A 1YHAA 1SFOH 3UE1A 4IOAA 1HNXQ 1V9PA 1Q82C 2PNHA 2NZHA 3OTOQ 2Q2IA 4LFBL 2YTYA 3CF5A 1DGSA 3J80c 2R93H 1G6PA 1HZ9A 4ALPA 3SGIA 5C3EH 2UXDL 1JB7A 1YI2A 4JI5Q 4DR1Q 3PO2H 3S2HH 4A3KH 1X56A 2DUDA 4C2MH 4QY7A 2CQOA 2CCZA 4HIDA 2UU9L 1YEZA 5ELOA 2DGYA 2EXDA 4LWCA 5FJ8G 2VQEQ 1KXLA 4TVAB 3RZDH 1XMOQ 1VQ7A 2ZTDA 4HJ8A 4PZ7A 4DR6L 4BXXH 1PH9A 3S1NH 2BA1A 4DR4L 1K3RA 1JMCA 3GTJH 2K52A 1UEBA 1EQRA 4BA2I 3S24A 2WFWA 1K9MC 4AQYQ 4PMWA 3I56A 3U4ZA 1B70B 2MO0A 2N8NA 2Q2HA 4B3ML 1VQAA 2QGQA 3UDIA 3KDFA 4YCWA 1A63A 2CWAA 1HZCA 3EIVA 3HOXH 1XNRL 1T9HA 4DR3L 1VQ4A 5IP7H 5H1SE 5C4JH 1VQ9A 1P16A 3ZJYC 2IHFA 1X3EA 2KBNA 3NELA 3TQYA 3PF4A 2LXKA 2JQOA 4LF4Q 2NN6G 2RF4A 4DR7Q 4NXNQ 3G4SA 4DV4L 2NVTH 3J81i 1QVGA 4AYBG 2I5HA 4A3LH 3DM3A 1JJCB 2E2HH 4KHPQ 4LF9Q 1XPOA 3GTQH 4DK6C 2K5HA 1I5FA 4YY3Q 1I50H 4A3EG 4A3GH 4DV6Q 4FDBA 1OXVA 3A0JA 1SRUA 4MTNA 1KL9A 4UP8A 1YJNA 1PH1A 1S40A 2IX0A 3J81c 4B3RQ 5JJKA 2OQKA 1N36Q 1SMXA 3PUVA 4YCVA 4JI3Q 2ID0A 4JI0Q 2MO1A 4X64L 1NJIC 3S15H 1EWIA 4MZ9A 1N8RC 5M3MG 2WAQE 2IY5B 1SLJA 2UXBL 3F2CA 1J5EL 4DUYQ 2BH2A 1BKBA 1Y1VH 3CC7A 5C44G 4Y7NH 3CCMA 2PQAB 3G6EA 3ULPA 4B3SQ 2UUBL 3TS2A 4K0KL 2EQSA 5C0XI 4X62L 2N3SA 1ASYA 2ATWA 3F2BA 2R92G 3AQQA 3H0GG 2UUAL 4JI4L 4A3FH 2WB1E 2PI2A 5M3FH 2K50A 1C9OA 3U50C 1PH8A 1EUJA 3CMEA 5IYCG 3HOVH 3PO3G 2ALYB 4L5TA 3E9HA 3AFQA 4A93G 1AE3A 1TWAH 3G71A 4DPGA 2JE6I 4O2DA 4GN3B 3CW2C 4IPDA 5IE8A 1N32Q 1VQKA 2OTJA 4P74A 3RN5A 3CC2A 1L1OB 1HZBA 1CSQA 2LSSA 3WWVA 2JA6H 3I4NG 4LFBQ 1NMGA 4QQBX 3J81j 3HKSA 1KHIA 2GN5A 2RHSB 4R4QA 2C35B 3OW2A 1X9NA 2UXDQ 1YNXA 5J3BA 4LUOA 1C7YA 1R9TH 5M5YH 2NVXH 4A3IG 2XGTA 3TRZA 5GAGC 1D7QA 2JA8H 1XPUA 2VS1A 4L5RC 3L2PA 2ZJPA 1CKOA 1PYSB 4JI6Q 2HQLA 2Z6KC 2FXQA 1TWCH 2UXCQ 4R4CA 3CCQA 1JT8A 4B3MQ 4DKAC 4X65L 5JJLA 1GO3E 1VQOA 2Y0SG 1GD7A 1QZGA 3HOWG 1XNRQ 4NXML 4DR3Q 2E2IH 1IZ6A 3CCJA 4IPHA 3L0OA 1PYBA 3KDFB 3T1YL 2Q2TA 1I6HH 4DV2Q 3CCEA 2I0QA 1CKNA 3Q8DA 3K7UC 1BVSA 4DV4Q 2K5VA 1MKHA 1O7IA 2F52A 3I7FA 4YWKA 4A3JG 2AHOB 5FJ8H 3HOZG 1N33L 2VQFL 1K73C 4QIWE 4HIMA 3HKZE 4YWMA 4IFDJ 4DV1Q 1Z9FA 4LF7L 3JC66 3CCLA 2D0OA 2JA5G 3HOUH 1EYGA 1L1OA 1EFWA 2JA7G 4A76A 2QEXA 3FKIG 3CAMA 4O0AA 1MIUA 4HIKA 3DLLA 4RG1A 4BY1H 2NZOA 4JBMA 4OX9L 5JEAG 1BBUA 3K80C 1U5KA 3W1GA 2BH8A 2B63H 2VW9A 1IBKL 2UXBQ 2V1CC 1EIYB 1GKHA 1J5EQ 1XPRA 1K83H 4BY7H 5GROA 1Q46A 4JBJA 1B7YB 2E2JH 1KRSA 5IYBG 1Y1WH 3KOJA 2QA4A 2UUBQ 4K0KQ 2GVAA 3PIOA 5AJ3L 1G291 4JV5L 3KF8B
chains in the Genus database with same CATH superfamily
5M3MB 1YITA 3AB9A 4B3TL 1JQYD 4GN5A 4HEDA 4A75A 3PUZA 3BVMA 4C3JG 5C44B 3BU2A 1STGA 1EL0A 4X66Q 1JE5A 5M5WH 5C3WA 2EOTA 2NWGA 2R92B 3M4PA 1PH6A 2B2YA 3A7LA 1E0BA 3PO3B 1XYIA 2FMMA 3R3OA 1PH7A 3ICEA 5C4ZA 1MSGA 1Q8KA 2PI2E 1U0LA 5FLMH 3NEMA 3K59A 1YNJC 1RODA 1E2WA 3U4VA 5C0XG 2XTIA 1IBLL 2F0KA 5E7NA 4DXGA 4A3IB 4DAYB 2MP1A 1WD1A 5C3EG 5IYDH 5CBAE 4NMZA 2LFNA 2L11A 4A3BG 1HFGA 4DV7L 4IOCA 1FL0A 1KTKA 2XWJB 4IUQA 4HCSA 2A1AA 5CV6A 3TREA 4LF5Q 1BCPC 1KAWA 1CKNB 1M1KC 1HHVA 5CV5A 1M90C 1TWGB 5C4XG 5HURA 4PZ6A 4X6AH 3U58A 1Y8NB 1JC7A 3GTKH 2Q8RE 3IFTA 1N9WA 2JA7B 3FKIB 2HIXA 4FP5D 4ME5A 2DJFC 1BXTA 1DXMA 1EU3A 2PQEA 2A69D 1BUVT 5E3FA 2UU9Q 2ZJQA 4XDXA 1NCVA 1SNPA 1F9SA 5EPKA 4PG3A 2F0UA 1CHPD 2PZWA 4F88A 1A8VA 2LXJA 2KCCA 2PNRC 4ME3A 3EA6A 1EZ6A 1R4PB 4CJ1B 1EWCA 1X3FA 2J0TD 2ZT9C 3OMCA 3GDEA 3S1RB 4JW0A 1EYAA 1JJGA 5GAEC 4UHVA 3TDQA 2K33A 4H02A 5DEHA 2UUCQ 1GUSA 3KF6A 4C3JH 4C1NI 2G5DA 3K5LA 5JPMC 1H9KA 4HJAA 3GTOB 5IWAQ 1X3QA 1XNQQ 1YJWA 4HIOA 1CZGA 1SNDA 5FOBB 3M4OH 1SXTA 5EKIA 1S3OA 1GUTA 5IGDA 1EYCA 5IT9c 1N34L 2JA8G 1PH4A 1IHZA 3T53B 3NE5B 5JPNC 4JI2Q 4X62Q 4LNQA 3MEFA 4MN3A 1VQMA 1PHJA 1LLRD 3K81C 5EJWA 2B2UC 2UUAQ 4LUZA 2KVMA 3AEVA 1YNND 4JYAQ 2HDLA 5C0XH 4KLKA 4YHHQ 1WI5A 2WKDA 4IPCA 3TZDA 1KABA 4XXEA 1LABA 4K8IA 1VQIA 3UDGA 3C3LA 3PSIA 3S1NB 1TY0A 2J7ZA 3A8KE 2QEJC 2B8FA 2KENA 4KY6A 2JYOA 3GTGH 2A69C 4A3BH 4JI1Q 3R8BA 3RR5A 4GOPC 2ICIA 4JI6L 3EQLC 1L1OC 1HZAA 1ASZA 3H0GH 3X3NA 2B2VA 2EIFA 4HSVA 5GADC 4BBRG 1PRTB 2UXCL 3HOUG 3OYYA 5F2DA 1UNSA 5BN5A 1MJEA 2EYFA 3H94A 5C4XH 1NSNS 1O80A 4ID6A 2PO4A 4C3IH 4JK1C 4O1NA 4JBKA 1O7ZA 1BF4A 2R93G 3D31A 4HJ5A 2K28A 5LMUQ 4DV2L 2SOBA 3V2TA 1L0YB 2F3IA 3BZKA 1Y8OB 1XMQL 3AYHB 2F4VQ 4RCOA 2F0TA 3DWQA 3K58A 1TXYA 1KAAA 4CDEC 1QUQA 1QVFA 3G48A 1PZKD 2ZJRA 5CV7A 3MAQA 3UE0A 1LACA 1QNUA 3P20A 2N49A 5I6WA 5M3FB 3M85A 2VNUD 2NVYH 2IJ0A 2Z6KA 3K8AA 2B2TC 4JPBW 2YTVA 3UDFA 2RDGA 1SDFA 4BBSG 3W5OA 1I4QA 3TP7A 2N78A 3TEHB 2L55A 3FVQA 1YNNC 4J15A 2AMCB 1PVOA 2BA0A 4A3JH 3FDTA 4A3GG 1AH9A 4IFDG 1VQPA 3ND9A 4LAAA 3M3YH 4RFBA 2JA5H 3SK8A 4DV0Q 3I2ZA 1EQQA 4J8QA 1VQBA 5HGTA 1TWCB 1Y1VG 5FLXL 3OOCA 5JAVA 4QUFA 2VZAA 2E2IB 3C2PA 3PUWA 4IALA 3MXPA 1HNWL 4PQXA 4JI3L 4ULLA 3DMUA 1E2ZA 4XYQA 1X3GA 4DR2L 1SAPA 3HKZB 5D14A 1QG7A 1DZ1A 4EVOA 2CH4W 3SEBA 2JA6G 2NVQB 3H15A 1SNOA 5T1IA 1YBYA 3BVGA 4BY1B 3A8IE 2F0JA 3J7A5 3I90A 3E5SA 3I55A 2B63B 1RL2A 1GHKA 1HR0Q 4BBRH 1K83B 4BY7B 3OWEB 3D4WA 4PZ8A 2KCMA 1SFOH 1Z7TA 3VR4A 5D3DA 1I4RA 4LFBL 4KMUC 3J80c 2R93H 3FPPA 1TT2A 1HZ9A 2UXDL 2E75C 1GJXA 3S2HH 4A3KH 3QG1A 3TP6A 3D4RA 2DUDA 3H09A 2KEEA 3R2TA 4EQPA 1M8AA 2EYLA 4NDXA 2CCZA 2PZTA 2Q8TA 4HIDA 2AUJD 5ELOA 5IGGA 2VQEQ 4LWCA 4TVAB 1XMOQ 3PIO3 4HJ8A 4DR6L 5FKAC 4BXXH 4K8JA 1HXYD 1UEAB 1K3RA 2A68D 3GTJH 1UEBA 5EKLA 2EYOA 2QGQA 3UDIA 1NR2A 2KUMA 3KDFA 1PFBA 4YCWA 5J39A 3R2IA 1KDAA 1HQRD 1VQ4A 1P16A 1Q90A 3G7LA 3AU7A 2NN6G 3G4SA 4DV4L 2NVTH 1QVGA 3J81L 2EY6A 1JJCB 4QF4A 1DYQA 3TP8A 1U4RA 3NHHA 1CM9A 1ENCA 5I4DA 4A3GH 1A15A 4Y7NB 4UDUC 2EJMA 2WINB 1N36Q 1QNKA 1SMXA 3PUVA 1Z6HA 2ID0A 2MO1A 4YIJA 3S15H 2K5WA 4HTHA 2IY5B 5ELFA 3VYTA 4P2CB 4ZLTF 2A6ED 2MJ8A 1UUPA 3KF8A 1ET6A 1Y1VH 5EBDA 4RAUC 2UUBL 4KKSA 2K5QA 5ELDA 2ICEC 4UAIA 1C9OA 2HDMA 3EJIA 5IYCG 3NP8A 2ALYB 3E9HA 2QW7A 3NSWA 4A93G 3TN2A 5M5YB 2JE6I 2CQAA 3NTKA 2IX3A 1F9RA 4O2DA 2PPBC 5IE8A 5K5PA 1VQKA 2OTJA 1EQVA 1QOHA 3I4NG 4LMQD 3TZUA 3BDLA 2JA6H 1NMGA 3J81j 1PMRA 1KHIA 2C35B 5CV8A 3K5NA 2NVXH 2XGTA 1DOKA 2O5JC 2A68C 4JI6Q 2O4XA 4DAYA 1XXGA 2UXCQ 2B2WC 4MTKA 4KV6A 1ESRA 5I2YA 5CV9A 5JJLA 1VQOA 4RHRA 2Y0SG 1GD7A 1XNRQ 1BCPB 1ENAA 2RSNA 4DR3Q 4C3JB 1IZ6A 3CCJA 2MPMA 1PTOF 2Q8IB 1QE6A 2Q2TA 1FNVA 4DV2Q 1CKNA 3MXGA 3OPOA 1O7IA 1JWUD 3HKZE 2KEDA 4YWMA 4IFDJ 3M4OB 3J7AF 3JC66 2RA4A 1QCBD 1EFWA 4AYBB 1MIUA 4HIKA 1S5DD 2A6EC 1U5KA 1LTTD 2BH8A 4GZYC 3CU7A 4B9XA 1J5EQ 2NN6H 4C3HB 4OELB 1KRSA 2K5DA 2GVAA 1G291 2F03A 1J6QA 3T16A 1TIID 1OTCA 2R7ZG 1SYEA 3TBIB 3H3VH 4A3BB 5GAHC 5IIFA 2SDFA 4HSPA 3H0GB 2I5MX 2RBMA 1A3UA 4EX5A 1EWHA 2WP8J 1D1IA 4C3IB 3CPWA 5JVG3 1PA6A 5FO8B 1DCZA 1RHPA 1YIJA 1ENFA 4DK3C 1FGUA 1K8AC 5C4HA 1LUZA 1EIHA 1B3QA 1K0RA 2UUCL 3NENA 1WCMH 1IW7D 3K5OA 1Q8IA 5IYCH 1WTQA 3IAYA 4A93H 2AQ3B 4KJNA 3S1QB 5BR8L 1HNWQ 3JAMc 1AEXA 5IWAL 2A19A 1XNQL 1T5EA 1E7ZA 1STNA 1TWFH 1B2TA 4DR2Q 3GTMH 1LTLA 2SNMA 3S17H 3C46A 4KD4A 1S72A 4R1JA 2NVYB 4JI2L 3FPUB 3LNNA 2VUMG 3FP9A 4JYAL 1S4ZA 2K01A 4ODGA 2A6HD 2L0CA 2NTSA 4JVZA 3DEOA 4POFA 1HNXL 4YHHL 4R4OA 4XQNA 2IHEA 4JC0A 4A3JB 3CD6A 4IPGA 5KNDA 1A62A 4GOPB 3MTSA 3ER0A 1RDPD 1STHA 4GLVB 4FXGC 3WDNA 2JA5B 3QB3A 1QILA 1SR3A 4JI1L 2BDOA 1BBWA 3CRLC 4KHZA 1WTHA 4DAMA 2HIVA 1OXTA 3K7AB 1A3TA 1NE3A 1LT5D 4DR6Q 2R7FA 3BYYB 4IUVA 5DAUA 3L3OC 1BO0A 1K8OA 2OEOA 2WAQG 5CMDA 3MC0B 5LMUL 4CKEA 4G7OC 5IGBA 1FR3A 2Z6BA 4EQ5A 3V05A 2F4VL 1Q1BA 2O2LD 4OWWB 4YY3L 2ZM6Q 2XSCA 1B4OA 4DK1A 1IW7C 2E2DC 4OGQC 1OXUA 3S14B 2R7ZH 3IL8A 5LL6S 5ELNA 1KC8C 1I4XA 5IT9L 1HA5A 3VDYA 2F4IA 4IUTA 5IOCA 4DUZQ 2CFMA 1MD2D 4MNOA 4KN4C 5ELCA 1D5XC 1XX8A 2Z8LA 2A6HC 4KI0A 4AYBE 2F0PA 2JEBI 1PTOH 3OW7A 2CKZB 4P73A 2MNAA 3KJPA 3S2HB 1KLUD 2ZXOA 4A3KB 4U673 3HOYG 4N9PA 4A3MB 1N32L 3HEJA 4DV0L 3PUXA 1I3QH 1W6JA 1DOLA 1QB5D 3GTJB 1V1PA 3I72A 1LV9A 4GNXA 1LM0A 3BVZA 1JB3A 4FXKC 1X3PA 2B8GA 1NMFA 1HPCA 2OCEA 2N55A 2VUMH 4GS3A 1UE1A 1FVIA 1VQNA 4J1MA 4JI7Q 2NVTB 1VQ5A 1PFMA 1VF7A 1STYA 1B1ZA 1SYBA 4GN4B 3GTLH 2HQEA 4YCUA 1HTLD 3PO2G 1Y8PB 3C1FA 1Y1WG 2FFKB 3PUYA 1VCIA 2E76C 2N88A 4XYOA 1VQ8A 1HR0L 1BNZA 5KNBA 5EBCA 3CQZH 3SHLA 1HR0W 1WFQA 1L0XB 2JA9A 1A0IA 3F1ZA 1Q12A 3ERQA 3HOXG 2DN8A 1HH2P 2DY7A 4QB4A 3PIPA 3NUCA 4Q5VA 2QCPX 2K7VA 5TSSA 3HOWH 1D1KA 2EY1A 4CKCA 1ILPA 1SNQA 1E1OA 2VQEL 1I94Q 1XMOL 5M5XH 1MI2A 3PCOB 3HOZH 1G51A 3U9OA 3CCRA 2F1MA 3A74A 4K5WA 1J9OA 2NVXB 3I4MG 4K2KA 5ELEA 2XNAC 2F0GA 1BQQT 2I5LX 1CSPA 1CT1D 1CTMA 4IUNA 1XJVA 3A5ZB 1FD7D 1IL2A 2WB1G 4A3FG 1Q7YC 3MXNB 5HY6A 1QWYA 2YU9H 3S2DH 3HOVG 4C1NK 2OQ0A 4ZUJA 1XTCD 3HOYH 4HN7A 3NWSA 4L6TB 4TKOB 1N36L 3VA5A 3BDCA 1YHQA 5FLXE 1JICA 2KJXA 5IGFA 2WACA 5BR8Q 2NZ1D 5EKKA 4JBWA 1EZ8A 4LFAQ 3CHBD 4A3CG 1J8IA 4QJFA 2HHHL 4I65A 2B29A 3P7JA 4L5SA 1B3AA 4IO9A 4DNIA 3J80L 4GKJQ 3NBHB 3A56A 2F0FA 4XT3B 1HNXQ 4N8FA 4I7ZC 3OTOQ 2Q2IA 2YTYA 1DGSA 1G6PA 1I4PA 5KIXA 2D9UA 5C3EH 1JB7A 1PZID 3PO2H 3ND8A 4C2MH 2CQOA 3SXHA 1GXDC 1YEZA 3RZDH 5C4JB 2ZTDA 4ZUIA 4CGYB 5E4XA 3EVQA 2F3WA 1LTAD 4DR4L 2XRQD 2H4OA 3BG3A 4FYDA 4QMGA 4PMWA 2FHTA 3I56A 1B70B 4IQZA 1VQAA 3GTQB 1A63A 3EFXD 3HOXH 1PXUA 3EIVA 1XNRL 1WCMB 2EJFC 4DR3L 1EY0A 4CBVA 1VQ9A 3ZJYC 1DONA 3NELA 2JQOA 4LF4Q 4DR7Q 4NXNQ 3J81i 2I5HA 1T5XD 3GTMB 5ELBA 3S17B 1CHQD 4YY3Q 1I50H 4A3EG 4ZKCB 1NNXA 4MTNA 1WTXA 1YJNA 1KL9A 2F0HA 4CDCC 1S40A 2OQKA 2OT2A 4TRDA 1DJRD 5M3MG 1SJHD 3F2CA 1J5EL 2BH2A 1BKBA 5KYIA 3CC7A 5C44G 4BWGB 3ULPA 2KQ3A 5C0XI 3P1HA 2R92G 3AQQA 2DY8A 4A3FH 2PI2A 1S5FD 1TQOA 1UAPA 3E6ZX 3WOFA 4DF7A 3KBGA 1PH8A 1EUJA 3HOVH 3PO3G 4L5TA 3AFQA 1TWAH 1R9TB 3CW2C 1N32Q 2VB2X 1WTVA 3OSOA 3SVMA 1O7LA 3VA7A 4R4QA 1H9SB 5J3BA 4LUOA 2F0SA 1TKWB 4A3IG 3I73A 3TRZA 4KD3A 5GAGC 1S5BD 2JA8H 1XPUA 4FF1A 4PMCA 4L5RC 2ZJPA 1PYSB 5T1GA 3D4DA 4IUUA 5A2QL 2FXQA 5KYLA 5KNCA 1DOMA 2B2UA 1SYFA 4DKAC 4X65L 2HUGA 4IN3A 4DNRB 3M4YA 1EEID 4IPHA 4R9WA 3D8GA 3OHXC 2NYZD 3T1YL 3CCEA 1EY6A 4KY7A 2K5VA 1MKHA 4YWKA 3K6OA 1K73C 3J7AV 2LY7A 1H9MA 3HOUH 3Q0AA 1L1OA 5L37A 2E2JB 2JA7G 2QEXA 3FKIG 4RG1A 2NZOA 3CRKC 1PFNA 5JEAG 1BBUA 2L4NA 3NXWA 3T56B 3W1GA 4X3KA 2EVBA 1LTSD 1XPRA 4JBJA 5M5WB 2QKIC 4M1UB 5IYBG 4K0KQ 2RDHA 3NQIA 1NR4A 4JI4Q 1P8LA 4A3EH 2K4KA 1SN8A 3ERSX 1PH3A 2LS01 3J7YW 1B9MA 3NWTA 1NBWA 2CW0D 2IWHA 2DNEA 2JEAI 3DUZA 3M7NA 1C48A 3PQIA 3DWAA 4RMFA 2ZM6L 4BBSH 4KN7C 2B2TA 2QDLA 3JAML 1UE6A 1SBBB 3R93A 2ZTEA 1I4GA 5IY0A 1LYLA 3CCVA 1SROA 1MSHA 3GO5A 4IFDH 1EOTA 1YJ9A 2YYZA 2ZXRA 4G57A 4DUZL 1EU4A 4L63B 1V43A 1TS2A 1TS3A 4X3SA 2YTXA 4FF4A 4B08A 2C9OA 4WORA 4A3IH 4NB3A 3GTKB 3ITPA 2F0EA 3HOWB 1W2BA 2HHHQ 1A3VA 2VQFQ 4LUVA 2ES2A 1L0WA 1FNUA 5I9PA 3GD7A 1V8QA 1G91A 3RZOH 3N6RA 3K5MA 5M5XB 1V1QA 2F0QA 1CA6A 3URYA 1FNWA 3HOZB 3KF6B 1KRTA 5BN3A 4OX9Q 1IKMA 1EY8A 2EPBA 4IUPA 1IBKQ 1B9NA 4EQNA 1PV4A 4HMIA 1TWGH 1BR9A 1JJ2A 2MQHA 1EY7A 1SJED 2MFIA 3HGBA 4JG2A 3CXCA 1IL8A 3E0EA 3QJYA 4RCNA 4DK0A 3TMEA 3H3VC 1HFNA 4JI7L 4P72A 4JV5Q 1VQJA 4AIMA 3QO2A 5C5MA 4RHSA 1H9JA 3SK4A 1PZJD 2JN4A 2F0IA 4DR4Q 2R6GA 2JA7H 3L7ZC 1RTNA 2CW0C 3VYUA 2YU9B 1EEFD 3S2DB 1I6VC 4LW1A 1PH2A 3HOYB 4POGA 1LTID 1U4PA 1HRJA 4P71A 1EYDA 2SNSA 5M3FG 1JOKA 5IYBH 4DV6L 1TWHH 5IGCA 5FLXc 3RUZA 2ZXPA 2CWPA 1ESFA 1H95A 2I07B 4DUYL 1W3SA 3ULLA 3HFZB 2TSSA 4B3SL 4FO2A 5GQOA 3PGZA 1HNZQ 1CKMA 1I94L 3I70A 4LK1C 4DV3Q 4C56C 1NAPA 5EPJA 5C5LA 3W1BA 2X6LA 4N8X1 5C3EB 1PTOD 3RLFA 1HCZA 1EFID 3PO2B 4LF6Q 2NBFA 5C6AA 1C8CA 1TU2B 3NBIA 4OXPA 4C2MB 3GTGB 1IXRA 3NTIA 3I8ZA 4KKTA 5KGUA 4HJ9A 3RZDB 2E5LQ 1QUQB 3UI2A 3KYHC 2R7DA 1JORA 3FHWA 1KDCA 3QWNA 3NK9A 3MXNA 2EYJA 5C4XB 5EQ0A 1UE7A 1FGBD 4CDDC 1DD2A 2BDNA 3HKZG 4UPAA 3IKJA 3OIQA 3RNUA 4G7HC 2F0WA 1WJJA 2L15A 3HG9A 1F2MA 4R4IA 3F8TA 4MIUA 3P75A 4BY1G 1S5CD 3DXJC 2EXZA 4H0LC 1YHBA 3M9BA 5JEAJ 1I50B 1D5MC 2B63G 1JCKB 3SE0A 4M8AA 1K28A 4EGVA 4X65Q 4U68A 4LFAL 3I4NH 2A73B 3BZDB 3LGJA 5CV4A 4BY7G 3SDZA 3GP7A 3KFUA 3RN2A 1LO5D 1KLGD 3T1YQ 1EIGA 1KDBA 2QILA 1K8MA 4DV1L 4GKJL 4QUCA 2VY3A 2AUKA 3TSSA 2C5CA 2AKWB 2Z9HA 2B2YC 2L1BA 1YVCA 3MZ5A 5DLQE 1JOOA 1VF5C 2K03A 1Y14B 3OTOL 2NN6I 4GNXC 2FMCA 2KHSA 5IP7G 1CQVA 2AWNA 1X32A 3HP3A 1MHWC 2B2WA 1EQTA 1PYWD 2JK8A 4JI8Q 3TS0A 1U9RA 3FRPB 3S1MH 1E3PA 3M3YB 1BBXC 3Q23A 2EYPA 4GLXA 3U9SA 3H3VI 1VQEA 1PTOC 3A7AB 5FLMG 3KK7A 4CJ2C 5DNFA 4V190 4JOIA 3DHQA 3WOEA 3T1HQ 3OWFA 4TQUS 4ZYSA 1AE2A 1UWVA 2KHJA 1EY5A 1EIFA 3I4OA 4L5QA 1JWMD 5CC4A 1XTDA 4EQOA 2JA8B 2O5IC 4OO1I 1RCVD 1VQ6A 5IYDG 2RQXA 1KIXA 2RHQB 3CC4A 5JJZA 2OWOA 4LF4L 4DR7L 4QGUA 4NXNL 1D6EC 1YZ6A 2XIWA 3F2DA 1CUKA 4WJWA 4LFCQ 1BCPF 1IBMQ 2K75A 1Q3LA 3EN2A 3M4QA 4MHEA 2GA4B 3CMAA 3UDXA 4Y52H 1CK1A 2CHBD 2XWBB 4DV5Q 1OXXK 3B6YA 1AN8A 4DN4M 4QIWB 1HUNA 2NTTA 3L9AX 1SE4A 4F8MA 4XT1B 4BBRB 1RIPA 1FJGL 3HOUB 2JSOA 5JOBA 1ONLA 2KOLA 3HZXA 3KJOA 4LF8Q 5LMNQ 1SFOB 1CZWA 1WYDA 1MGSA 1ZXTA 1LT6D 4DR5Q 2R93B 5K36G 3J80i 2L9HA 2NVQH 4V0BA 3K0XA 5J1ZA 3UE1A 4R8IA 4IOAA 1C4QA 1V9PA 5E4WC 1Q82C 2F0DA 5AFWA 2PNHA 4H44C 1SYGA 2R61A 1SEBD 2F0MA 1WTOA 4DAVA 4A3EB 2OXPA 1WVLA 4ALPA 3RMHA 3FMCA 1YI2A 4JI5Q 4DR1Q 1X56A 2DNCA 3BS1A 3J80E 1RF2D 4X3UA 2EXDA 5FJ8G 4H13C 1VQ7A 2IW3A 4PZ7A 4KKUA 3N52A 5G3LF 4HR7B 1A2TA 2K52A 4DGZA 1EQRA 4BBSB 3S24A 2WFWA 1K9MC 4AQYQ 2MO0A 2N8NA 4ILWA 2CWAA 1HZCA 1T9HA 4F87A 3T13A 4NKLA 5IP7H 5H1SE 4A3GB 2KBNA 1X3EA 1ICWA 3IFDA 3TQYA 3K0YA 5LL6X 2A74C 2XVSA 3QR8A 4AYBG 1GUWA 1MBYA 3BYTB 2VXWA 3S15B 4HAEA 2E2HH 1S5ED 5CYUA 5LHY1 1XPOA 4DK6C 1SYDA 2K5HA 1I5FA 4LF9Q 2QDBA 3VYRA 3CKIB 4DV6Q 1RTOA 1Y1VB 1D2BA 3A0JA 4RGNA 1SRUA 1U4LA 4UP8A 4C3HG 1F2YA 5JJKA 5G3LD 5I2XA 4JI0Q 4X64L 3E0JA 4RGOS 1SLJA 5CBEE 1TY2A 4DUYQ 3RZOB 4FVMA 4Y7NH 4Z9CB 2B2VC 2PQAB 3G6EA 4B3SQ 3TS2A 4K0KL 2EQSA 1STAA 1SE2A 2G9DA 3F2BA 4X3TA 3H0GG 4JI4L 2WB1E 2JA6B 4KK7A 2K1BA 4ZKBB 1D5ZC 3OIPA 3G71A 1WD0A 3GV3A 3H91A 4C3IG 1TVXA 1G8ZD 2QF7A 2FJ2A 2L5TA 3I91A 1I4HA 4P74A 3CC2A 4FF3A 1E2VA 4ABNA 1HZBA 2LSSA 4L8JA 2GN5A 1X9NA 3A8JE 1C7YA 5M5YH 3GV6A 4PV1C 1D7QA 2VS1A 2AQ2B 1CKOA 4CJ0B 5K36H 2EY5A 2MGSA 2KA7A 2HQLA 2Z6KC 2PMZB 3CCQA 4B3MQ 1TWHB 1GO3E 1QZGA 1SE3A 2F0LA 4NXML 2ENBA 2FINB 1O78A 1PYBA 3MWYW 5JVH3 2I0QA 1I6HH 3Q8DA 2NB0A 1CA5A 5A2QE 4A3JG 2AHOB 5FJ8H 4ZK9B 2VQFL 1A6XA 4QIWE 4DNTB 5C3XA 4DV1Q 2HCCA 1Z9FA 3LWUA 2JA5G 4RGTA 1EYGA 1CFMA 1TS4A 2EDGA 4O0AA 4CDFC 4OX9L 3VR5A 3K80C 2XN9C 2X69A 2LKVA 1GUOA 2VW9A 1IBKL 3GQBA 2UXBQ 1EIYB 1WTPA 1II3A 1BOSA 1Y1WH 3KOJA 2QA4A 5AJ3L 1G2TA 4JV5L 1OXSC 4FXDA 4WJ4A 4UP7A 2PYKA 4B9WA 2RVLA 1SMYD 4ZAIA 4C3HH 1Q1EA 4G7ZC 2BE5D 3S16H 1X65A 1SSOA 2K14A 2YV5A 2OTLA 2AQ1B 2LMCB 5I6YA 4A93B 2A5HA 3BDOA 1F9QA 2RDFA 1ILQA 5COYA 3JAMi 1TWFB 1Q86C 1Z47A 5I9OA 3I4NB 3SK5A 3STBD 4WRDA 1KQSA 4TSSA 3KLSA 2Z4HA 3I4MH 4ZQ3A 3HRZC 2B3GA 4A3DG 4GKKL 3KUPA 1KD1C 2IX1A 3NQTA 3J81E 1HNZL 3JAME 5EAYA 4A3KG 4DV3L 3NPPA 1FJGQ 3EBEA 4A3MG 1HA6A 1GOZA 3S1QH 3A5UA 4BXXG 2Y0SB 1F9PA 4LF6L 1N33Q 1LTBD 3S1MB 1CQFA 3DWPA 4AH6A 3J7ZC 2D0PA 2E5LL 3I3CA 2Q2UA 2E8GA 4LF7Q 3PMFA 4QCLA 1QZHA 5KEEA 4PNYA 1EOVA 1LTGD 1W6KA 5NUCA 3F2UA 3D6CA 2L12A 3GTPH 1E24A 3QOJA 2MHVA 3KLSX 4A3CH 1AP0A 1TS5A 1NTGA 2JXMB 1U4MA 3BZCA 1JWSD 4DAPA 4R4TA 1SMYC 1LTRD 5C0XJ 2HCIA 4IURA 4OONA 2KCNA 2RCNA 2RKSA 4B3TQ 2WIIB 3VR2A 2BE5C 1X6OA 1WOCA 1RD9D 3E9IA 3K57A 2DJGC 1V1OA 4HJ7A 4NW2A 2R7ZB 2PW5A 1QVCA 2A8VA 5E1FA 1A2UA 1PH5A 4APVA 3K7AH 2Z1CA 1Q81C 3CPFA 4KHPL 3O13A 1V1PB 2PMZE 2SEBD 3MXUA 4K5VA 3V96A 3STBC 1IYJB 4DFAA 5IP9G 4GNXB 2Z0SA 1NUCA 1EY9A 1VS0A 4B3RL 5IODA 1E1TA 4GOPA 4K2LA 5HGQA 3PF5A 1C0AA 1IBLQ 1IYUA 4DXFA 1JE4A 5J22A 1ET9A 2EJGC 2KCTA 1PTOB 4R8NA 4JI8L 3S14H 4X64Q 3KLWA 4FF2A 4BA1I 1QJOA 2CVRA 3E3XA 2H1EA 1E22A 1I3QB 1MJCA 3T1HL 1STEA 4DV7Q 1K8GA 1UE5A 3DM1A 2F0VA 2BCOA 2EYHA 1PRTF 3D0FA 1VQFA 2VUMB 1VQHA 4A3DH 2M00A 2RSOA 4P75A 1L2FA 2EE1A 4LFCL 5M3MH 5JJIA 4KHVA 1IBML 2IPKD 3PV0A 4KTAA 4A3MH 5C44H 4XQJA 4NPSA 1F2ZA 3OMGA 5ISRA 4UY8C 4O42A 2R92H 3GTLB 3Q24A 1RKNA 3M7GA 3MEHA 3S9WA 4WJ3M 4IZ8A 1PFSA 4DV5L 2CH4A 3PO3H 3IRBA 2WV6D 1X55A 2D5DA 4CKBA 2TMPA 2E2HB 4IJHA 4IJLA 2PW7A 2VL6A 3CQZB 2ZTCA 1VQDA 2KHIA 4K6DA 1O7YA 3T51B 1AZPA 4LF8L 5LMNL 2X6GA 3SK6A 2R3ZA 1PRTD 4GLAC 5LMNW 4NXMQ 4OWXB 2NUCA 4G4KA 4DR5L 2WAQB 3MFGA 3ULJA 4DU9A 4XIGS 2V4DA 4KJOA 1B50A 4DA2A 4HCEA 4CHTB 5FO7B 4OWTB 4ZRZA 3CP0A 4JCVE 1IKLA 2Y0SE 4JI5L 4DR1L 3PIP3 4OO1G 3CCUA 4H7BA 3LX0A 4A3LG 5BN4A 1HJPA 2GVBA 4A4IA 1VQLA 3W3AA 1N34Q 1WCMG 2D2CC 5IP9H 2JJQA 5AJ3Q 1NY4A 5D3IB 4AQYL 4X66L 3W2DA 1PLFA 1KNAA 5FK9C 1GVPA 2K5NA 3G6JB 1BDOA 4QL5A 2D62A 3FKIH 3RLNA 5JEAH 1G6ZA 4K14A 2B39A 1B53A 1SE8A 3I4LA 5D65A 2K05A 1VQGA 4OL7A 3A55A 4UP9A 1R4QB 1SNMA 2AWOA 2ASBA 4LF9L 4IFDI 1GM5A 1VQCA 2EY2A 5CR3A 1PDQA 4RWSC 3CCSA 3AMUA 4PMBA 1I6HB 1D8LA 4JI0L 2HT1A 1B8AA 2J4XA 5KRUA 1H9RA 2E74C 2PQAA 5EPLA 1PRTC 3S1RH 3RLOA 4GKKQ 4JOIC 2IT1A 3BJUA 4S3SA 1JOQA 1X54A 4LF5L 3VR6A 1KNEA 3H6MA 3AFPA 1XMQQ 1VMPA 1VDZA 3MHBA 3GTOH 5IT9E 2H5XA 4BS9A 4YWLA 4HMJA 2K04A 4OHJA 4XTCS 1YHAA 1Y1WB 5DM63 1IYVA 2F0NA 3C1EA 2NZHA 2IL8A 3CF5A 3MFYA 3SGIA 3VYSA 1HTPA 2P5ZX 3KBXA 1K0SA 2K6AA 3S16B 2K32A 4QY7A 2UU9L 3HOXB 2OF1A 4RGMA 2DGYA 4Q0FA 1KXLA 4F7XA 1EY4A 1WTWA 1PH9A 3S1NH 2BA1A 5M9OA 1JMCA 5IGEA 4BA2I 5CORA 4RA8A 1ZKOA 2PCFB 3U4ZA 4B3ML 1JR0D 2Q2HA 4XQQA 1GUGA 5FO9B 4FNFA 2VB3X 3Q22A 3MVVA 4KY5A 1AFPA 5DM73 5C4JH 2IHFA 3HS0C 3PF4A 2LXKA 4OO1H 2RF4A 3I4MB 1ZEQX 3Q6SA 4A3LH 2BOSA 3NBHA 3DM3A 3TP5A 4KHPQ 3GTQH 2JP1A 3VR3A 1VMCA 3ZYYX 3D3RA 2HD3A 3QOLA 3T4AC 4FDBA 4K5XA 3D6WA 1ZYRD 1OXVA 1Y69U 4ZCKA 1PH1A 2IX0A 3J81c 1FYCA 4B3RQ 4YCVA 2WB1B 4A3FB 4JI3Q 1F77A 1NJIC 3A54A 1EWIA 3LWEA 4MZ9A 1N8RC 2WAQE 2UXBL 2KECA 3HOVB 2M2LA 1TWAB 3CCMA 1K3BC 2PZUA 5A35A 5CGKA 4NP5A 1AZQA 4X62L 2N3SA 1ASYA 2ATWA 1AW7A 2G9HD 3MA2B 2UUAL 2XRSD 2MUYA 1SNCA 2K50A 5M3FH 3U50C 3GTPB 3CMEA 3SR1A 1XWEA 1F2LA 3NTHA 1AE3A 1TR5A 4DPGA 4LJZC 2M9VA 3FEWX 4GN3B 3X3MA 4IPDA 3RN5A 1DM0B 4RH6A 4RKLA 5EGTA 1L1OB 3WWVA 1CSQA 4QQBX 1GHJA 4LFBQ 3HKSA 4OIJA 2RHSB 3OW2A 2UXDQ 1YNXA 1M4VA 1CI3M 4OEMB 1R9TH 3DEPA 1GUNA 3L2PA 2EYMA 1YNJD 1TWCH 4K6LA 1WTRA 4RKBA 4R4CA 1JT8A 3HOWG 1LT4D 2E2IH 2EZVA 1G2SA 3L0OA 3KDFB 3QIAA 4OIKA 2WKCA 3K7UC 1LT3D 2RCFA 3ONAB 1BVSA 4DV4Q 2F52A 3I7FA 4WFN3 3HOZG 1N33L 1RJTA 1B44D 1ZYRC 1ML0D 4HIMA 4I7AA 4N9TA 1BCPD 2I46A 4LF7L 3CCLA 2D0OA 2F3VA 4J6HA 4A76A 3CAMA 4BY1H 4JBMA 3DLLA 1H9SA 3KLRA 1STBA 2B63H 2F0OA 1SYCA 2Z4IA 1OO9B 2V1CC 1HUMA 1GKHA 1K83H 4BY7H 1HQMC 5GROA 1Q46A 1B7YB 3RD4A 2E2JH 4A3DB 3EROA 2UUBQ 1ICFB 3PIOA 4E6IA 3KF8B
chains in the Genus database with same CATH topology
1J6QA 1YITA 1OXSC 4JI4Q 1OTCA 2R7ZG 1P8LA 4UP7A 4WJ4A 4B3TL 4GN5A 4A75A 4A3EH 2K4KA 1SN8A 3ERSX 3PUZA 3H3VH 3BU2A 5GAHC 1PH3A 4C3HH 1Q1EA 4X66Q 1JE5A 5M5WH 3S16H 1X65A 3M4PA 1PH6A 2I5MX 1NBWA 2K14A 4EX5A 2JEAI 2YV5A 2OTLA 2WP8J 1PH7A 3ICEA 3M7NA 4RMFA 2ZM6L 1Q8KA 3CPWA 2PI2E 1U0LA 1PA6A 4BBSH 3JAMi 1YIJA 1Q86C 1UE6A 4DK3C 5FLMH 1FGUA 1Z47A 1K8AC 2ZTEA 3NEMA 1LUZA 1K0RA 5IY0A 2UUCL 3NENA 1LYLA 1WCMH 3STBD 3CCVA 3U4VA 5C0XG 5IYCH 1KQSA 1SROA 2XTIA 1IBLL 3GO5A 4A93H 5E7NA 3I4MH 5BR8L 1HNWQ 2B3GA 3JAMc 1YJ9A 4DAYB 5IWAL 2A19A 1XNQL 4A3DG 1E7ZA 1TWFH 1KD1C 4GKKL 2YYZA 2IX1A 4DR2Q 3GTMH 1LTLA 5C3EG 4DUZL 5IYDH 3S17H 1V43A 1HNZL 5EAYA 4A3KG 2YTXA 4DV3L 1S72A 1FJGQ 3EBEA 4A3MG 4R1JA 4A3BG 4DV7L 4IOCA 4JI2L 3S1QH 1FL0A 3TREA 3A5UA 4A3IH 4LF5Q 2A1AA 4NB3A 3FP9A 2VUMG 4BXXG 1KAWA 4JYAL 4LF6L 1W2BA 2HHHQ 1N33Q 2VQFQ 1CKNB 4LUVA 4AH6A 3J7ZC 1M1KC 2ES2A 1L0WA 4POFA 4YHHL 1HNXL 2D0PA 3GD7A 4R4OA 1M90C 3RZOH 2E5LL 5C4XG 2Q2UA 2E8GA 1V1QA 4PZ6A 4LF7Q 4X6AH 1QZHA 3U58A 2IHEA 4JC0A 1EOVA 3CD6A 4IPGA 1A62A 3KF6B 4GOPB 1KRTA 3ER0A 4OX9Q 3GTKH 4GLVB 1IBKQ 3GTPH 1N9WA 1E24A 1PV4A 1SR3A 4JI1L 1TWGH 4A3CH 1JJ2A 2MQHA 2HIXA 1BBWA 1NTGA 2MFIA 4KHZA 4DAMA 4JG2A 3BZCA 3CXCA 3E0EA 2HIVA 4R4TA 2UU9Q 5C0XJ 4JI7L 1OXTA 4P72A 2ZJQA 1VQJA 4AIMA 4OONA 4JV5Q 2RCNA 1NE3A 4DR6Q 4B3TQ 2R7FA 4PG3A 1X6OA 1WOCA 3E9IA 2R6GA 2JA7H 4DR4Q 3L7ZC 4HJ7A 2WAQG 4LW1A 5LMUL 1PH2A 1QVCA 4POGA 2A8VA 1A8VA 4EQ5A 1PH5A 2LXJA 4ME3A 3K7AH 4APVA 2F4VL 1Q1BA 4P71A 1Q81C 3CPFA 4KHPL 4OWWB 1X3FA 2PMZE 4YY3L 2ZM6Q 5M3FG 5IYBH 3STBC 3GDEA 1IYJB 4DV6L 5IP9G 4GNXB 1OXUA 2Z0SA 1JJGA 1TWHH 2R7ZH 5GAEC 1VS0A 5FLXc 4H02A 4B3RL 2UUCQ 1E1TA 2CWPA 3KF6A 5ELNA 4C3JH 4GOPA 1KC8C 5HGQA 3PF5A 1C0AA 1H95A 1IBLQ 2KCTA 4HJAA 3VDYA 4DUYL 1W3SA 5IWAQ 3ULLA 1XNQQ 4JI8L 3HFZB 3S14H 4X64Q 4B3SL 3KLWA 1YJWA 4DUZQ 4HIOA 4BA1I 5GQOA 2CFMA 3PGZA 1HNZQ 1CKMA 4MNOA 3M4OH 1I94L 1E22A 1S3OA 4DV3Q 5IT9c 1MJCA 1N34L 3T1HL 2JA8G 4KI0A 4AYBE 1PH4A 3W1BA 4DV7Q 2JEBI 4JI2Q 4X62Q 1K8GA 4LNQA 3MEFA 3RLFA 2CKZB 1VQMA 1PHJA 3K81C 4P73A 2MNAA 1UE5A 4LUZA 2UUAQ 3KJPA 4LF6Q 3HOYG 4JYAQ 4KLKA 4OXPA 1IXRA 1N32L 4YHHQ 1WI5A 4DV0L 4IPCA 4HJ9A 2E5LQ 1QUQB 3D0FA 3PUXA 1I3QH 1VQFA 1VQHA 3UDGA 1VQIA 3KYHC 3PSIA 4A3DH 3AEVA 2R7DA 4P75A 1L2FA 5M3MH 4LFCL 3FHWA 2KENA 5JJIA 1IBML 3PV0A 4GNXA 1LM0A 3GTGH 1UE7A 4A3MH 5C44H 4A3BH 4JI1Q 1NMFA 3RR5A 2OCEA 4GOPC 4NPSA 4JI6L 3HKZG 4UY8C 4GS3A 1L1OC 1HZAA 1ASZA 2R92H 3H0GH 1UE1A 4UPAA 2EIFA 5GADC 3RNUA 1FVIA 4BBRG 2UXCL 1VQNA 3HOUG 1WJJA 2L15A 4JI7Q 3OYYA 4WJ3M 1MJEA 1PFSA 4R4IA 4DV5L 3F8TA 3IRBA 3PO3H 4BY1G 5C4XH 1X55A 1VQ5A 4IJHA 1YHBA 3M9BA 5JEAJ 4C3IH 4IJLA 4JBKA 2VL6A 2B63G 4GN4B 2VUMH 2R93G 2ZTCA 3D31A 3GTLH 1VQDA 2KHIA 4X65Q 4HJ5A 4LFAL 4DV2L 5LMNL 5LMUQ 4YCUA 4LF8L 3LGJA 3I4NH 3PO2G 4GLAC 5LMNW 4BY7G 2F3IA 3BZKA 4NXMQ 3KFUA 4OWXB 1XMQL 1Y1WG 4DR5L 3AYHB 3RN2A 2F4VQ 3PUYA 1VCIA 3T1YQ 1TXYA 3ULJA 4DV1L 1VQ8A 4GKJL 1HR0L 4XIGS 3CQZH 1HR0W 2VY3A 1QUQA 1QVFA 2AKWB 3G48A 2ZJRA 1YVCA 4OWTB 3UE0A 1WFQA 2JA9A 5DLQE 1A0IA 1Y14B 2N49A 3F1ZA 3CP0A 3OTOL 2NN6I 3M85A 1Q12A 4JCVE 3HOXG 4GNXC 1HH2P 5IP7G 2VNUD 2NVYH 3PIPA 2AWNA 2Z6KA 3K8AA 2Y0SE 4JI5L 4DR1L 2JK8A 3HOWH 4JI8Q 4OO1G 2YTVA 3TS0A 3UDFA 3CCUA 3S1MH 1E3PA 4BBSG 3W5OA 4A3LG 4GLXA 1HJPA 1E1OA 2VQEL 3H3VI 1VQEA 5FLMG 1XMOL 1I94Q 2GVBA 5M5XH 4A4IA 2N78A 3TEHB 1VQLA 4J15A 4JOIA 1N34Q 2AMCB 3T1HQ 1PVOA 1WCMG 4TQUS 3PCOB 2BA0A 5IP9H 2JJQA 4A3JH 1AE2A 1UWVA 3HOZH 4A3GG 1G51A 5AJ3Q 3CCRA 1NY4A 2KHJA 1AH9A 3A74A 4X66L 4AQYL 1VQPA 4IFDG 1EIFA 3I4MG 1GVPA 3I4OA 3M3YH 2K5NA 2JA5H 4L5QA 4QL5A 4OO1I 1XTDA 4DV0Q 2D62A 3FKIH 3I2ZA 3RLNA 5IYDG 1EQQA 1VQ6A 1KIXA 1VQBA 2I5LX 2RHQB 1CSPA 3CC4A 2OWOA 4LF4L 1SE8A 4DR7L 4QGUA 4NXNL 1Y1VG 1VQGA 1YZ6A 1XJVA 4UP9A 3F2DA 4LFCQ 1CUKA 3A5ZB 2AWOA 1IBMQ 2K75A 2ASBA 1IL2A 4LF9L 2WB1G 4A3FG 4IFDI 3EN2A 3M4QA 1VQCA 1GM5A 2VZAA 3CCSA 1Q7YC 3MXNB 5HY6A 3PUWA 2YU9H 3S2DH 3HOVG 2OQ0A 3CMAA 1D8LA 3UDXA 3HOYH 1HNWL 4Y52H 1N36L 4JI3L 4JI0L 2HT1A 4DV5Q 1B8AA 1OXXK 4DR2L 3B6YA 1X3GA 1YHQA 2PQAA 5BR8Q 2JA6G 3S1RH 3RLOA 1RIPA 4JBWA 1FJGL 4GKKQ 4JOIC 2IT1A 3H15A 3BJUA 4LFAQ 3KJOA 4A3CG 1X54A 1YBYA 5LMNQ 1WYDA 4LF8Q 4LF5L 4QJFA 3AFPA 1XMQQ 3J7A5 4DR5Q 2HHHL 2B29A 3I55A 4L5SA 5K36G 1RL2A 3J80i 3GTOH 4IO9A 4DNIA 4GKJQ 1HR0Q 3NBHB 4BBRH 2H5XA 2NVQH 4YWLA 4XTCS 3K0XA 2KCMA 4PZ8A 1YHAA 1SFOH 3UE1A 4IOAA 1HNXQ 1V9PA 1Q82C 2PNHA 2NZHA 3OTOQ 2Q2IA 4LFBL 2YTYA 3CF5A 1DGSA 3J80c 2R93H 1G6PA 1HZ9A 4ALPA 3SGIA 5C3EH 2UXDL 1JB7A 1YI2A 4JI5Q 4DR1Q 3PO2H 3S2HH 4A3KH 1X56A 2DUDA 4C2MH 4QY7A 2CQOA 2CCZA 4HIDA 2UU9L 1YEZA 5ELOA 2DGYA 2EXDA 4LWCA 5FJ8G 2VQEQ 1KXLA 4TVAB 3RZDH 1XMOQ 1VQ7A 2ZTDA 4HJ8A 4PZ7A 4DR6L 4BXXH 1PH9A 3S1NH 2BA1A 4DR4L 1K3RA 1JMCA 3GTJH 2K52A 1UEBA 1EQRA 4BA2I 3S24A 2WFWA 1K9MC 4AQYQ 4PMWA 3I56A 3U4ZA 1B70B 2MO0A 2N8NA 2Q2HA 4B3ML 1VQAA 2QGQA 3UDIA 3KDFA 4YCWA 1A63A 2CWAA 1HZCA 3EIVA 3HOXH 1XNRL 1T9HA 4DR3L 1VQ4A 5IP7H 5H1SE 5C4JH 1VQ9A 1P16A 3ZJYC 2IHFA 1X3EA 2KBNA 3NELA 3TQYA 3PF4A 2LXKA 2JQOA 4LF4Q 2NN6G 2RF4A 4DR7Q 4NXNQ 3G4SA 4DV4L 2NVTH 3J81i 1QVGA 4AYBG 2I5HA 4A3LH 3DM3A 1JJCB 2E2HH 4KHPQ 4LF9Q 1XPOA 3GTQH 4DK6C 2K5HA 1I5FA 4YY3Q 1I50H 4A3EG 4A3GH 4DV6Q 4FDBA 1OXVA 3A0JA 1SRUA 4MTNA 1KL9A 4UP8A 1YJNA 1PH1A 1S40A 2IX0A 3J81c 4B3RQ 5JJKA 2OQKA 1N36Q 1SMXA 3PUVA 4YCVA 4JI3Q 2ID0A 4JI0Q 2MO1A 4X64L 1NJIC 3S15H 1EWIA 4MZ9A 1N8RC 5M3MG 2WAQE 2IY5B 1SLJA 2UXBL 3F2CA 1J5EL 4DUYQ 2BH2A 1BKBA 1Y1VH 3CC7A 5C44G 4Y7NH 3CCMA 2PQAB 3G6EA 3ULPA 4B3SQ 2UUBL 3TS2A 4K0KL 2EQSA 5C0XI 4X62L 2N3SA 1ASYA 2ATWA 3F2BA 2R92G 3AQQA 3H0GG 2UUAL 4JI4L 4A3FH 2WB1E 2PI2A 5M3FH 2K50A 1C9OA 3U50C 1PH8A 1EUJA 3CMEA 5IYCG 3HOVH 3PO3G 2ALYB 4L5TA 3E9HA 3AFQA 4A93G 1AE3A 1TWAH 3G71A 4DPGA 2JE6I 4O2DA 4GN3B 3CW2C 4IPDA 5IE8A 1N32Q 1VQKA 2OTJA 4P74A 3RN5A 3CC2A 1L1OB 1HZBA 1CSQA 2LSSA 3WWVA 2JA6H 3I4NG 4LFBQ 1NMGA 4QQBX 3J81j 3HKSA 1KHIA 2GN5A 2RHSB 4R4QA 2C35B 3OW2A 1X9NA 2UXDQ 1YNXA 5J3BA 4LUOA 1C7YA 1R9TH 5M5YH 2NVXH 4A3IG 2XGTA 3TRZA 5GAGC 1D7QA 2JA8H 1XPUA 2VS1A 4L5RC 3L2PA 2ZJPA 1CKOA 1PYSB 4JI6Q 2HQLA 2Z6KC 2FXQA 1TWCH 2UXCQ 4R4CA 3CCQA 1JT8A 4B3MQ 4DKAC 4X65L 5JJLA 1GO3E 1VQOA 2Y0SG 1GD7A 1QZGA 3HOWG 1XNRQ 4NXML 4DR3Q 2E2IH 1IZ6A 3CCJA 4IPHA 3L0OA 1PYBA 3KDFB 3T1YL 2Q2TA 1I6HH 4DV2Q 3CCEA 2I0QA 1CKNA 3Q8DA 3K7UC 1BVSA 4DV4Q 2K5VA 1MKHA 1O7IA 2F52A 3I7FA 4YWKA 4A3JG 2AHOB 5FJ8H 3HOZG 1N33L 2VQFL 1K73C 4QIWE 4HIMA 3HKZE 4YWMA 4IFDJ 4DV1Q 1Z9FA 4LF7L 3JC66 3CCLA 2D0OA 2JA5G 3HOUH 1EYGA 1L1OA 1EFWA 2JA7G 4A76A 2QEXA 3FKIG 3CAMA 4O0AA 1MIUA 4HIKA 3DLLA 4RG1A 4BY1H 2NZOA 4JBMA 4OX9L 5JEAG 1BBUA 3K80C 1U5KA 3W1GA 2BH8A 2B63H 2VW9A 1IBKL 2UXBQ 2V1CC 1EIYB 1GKHA 1J5EQ 1XPRA 1K83H 4BY7H 5GROA 1Q46A 4JBJA 1B7YB 2E2JH 1KRSA 5IYBG 1Y1WH 3KOJA 2QA4A 2UUBQ 4K0KQ 2GVAA 3PIOA 5AJ3L 1G291 4JV5L 3KF8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6Q A;  1YIT A;  1OXS C;  4JI4 Q;  1OTC A;  2R7Z G;  1P8L A;  4UP7 A;  4WJ4 A;  4B3T L;  4GN5 A;  4A75 A;  4A3E H;  2K4K A;  1SN8 A;  3ERS X;  3PUZ A;  3H3V H;  3BU2 A;  5GAH C;  1PH3 A;  4C3H H;  1Q1E A;  4X66 Q;  1JE5 A;  5M5W H;  3S16 H;  1X65 A;  3M4P A;  1PH6 A;  2I5M X;  1NBW A;  2K14 A;  4EX5 A;  2JEA I;  2YV5 A;  2OTL A;  2WP8 J;  1PH7 A;  3ICE A;  3M7N A;  4RMF A;  2ZM6 L;  1Q8K A;  3CPW A;  2PI2 E;  1U0L A;  1PA6 A;  4BBS H;  3JAM i;  1YIJ A;  1Q86 C;  1UE6 A;  4DK3 C;  5FLM H;  1FGU A;  1Z47 A;  1K8A C;  2ZTE A;  3NEM A;  1LUZ A;  1K0R A;  5IY0 A;  2UUC L;  3NEN A;  1LYL A;  1WCM H;  3STB D;  3CCV A;  3U4V A;  5C0X G;  5IYC H;  1KQS A;  1SRO A;  2XTI A;  1IBL L;  3GO5 A;  4A93 H;  5E7N A;  3I4M H;  5BR8 L;  1HNW Q;  2B3G A;  3JAM c;  1YJ9 A;  4DAY B;  5IWA L;  2A19 A;  1XNQ L;  4A3D G;  1E7Z A;  1TWF H;  1KD1 C;  4GKK L;  2YYZ A;  2IX1 A;  4DR2 Q;  3GTM H;  1LTL A;  5C3E G;  4DUZ L;  5IYD H;  3S17 H;  1V43 A;  1HNZ L;  5EAY A;  4A3K G;  2YTX A;  4DV3 L;  1S72 A;  1FJG Q;  3EBE A;  4A3M G;  4R1J A;  4A3B G;  4DV7 L;  4IOC A;  4JI2 L;  3S1Q H;  1FL0 A;  3TRE A;  3A5U A;  4A3I H;  4LF5 Q;  2A1A A;  4NB3 A;  3FP9 A;  2VUM G;  4BXX G;  1KAW A;  4JYA L;  4LF6 L;  1W2B A;  2HHH Q;  1N33 Q;  2VQF Q;  1CKN B;  4LUV A;  4AH6 A;  3J7Z C;  1M1K C;  2ES2 A;  1L0W A;  4POF A;  4YHH L;  1HNX L;  2D0P A;  3GD7 A;  4R4O A;  1M90 C;  3RZO H;  2E5L L;  5C4X G;  2Q2U A;  2E8G A;  1V1Q A;  4PZ6 A;  4LF7 Q;  4X6A H;  1QZH A;  3U58 A;  2IHE A;  4JC0 A;  1EOV A;  3CD6 A;  4IPG A;  1A62 A;  3KF6 B;  4GOP B;  1KRT A;  3ER0 A;  4OX9 Q;  3GTK H;  4GLV B;  1IBK Q;  3GTP H;  1N9W A;  1E24 A;  1PV4 A;  1SR3 A;  4JI1 L;  1TWG H;  4A3C H;  1JJ2 A;  2MQH A;  2HIX A;  1BBW A;  1NTG A;  2MFI A;  4KHZ A;  4DAM A;  4JG2 A;  3BZC A;  3CXC A;  3E0E A;  2HIV A;  4R4T A;  2UU9 Q;  5C0X J;  4JI7 L;  1OXT A;  4P72 A;  2ZJQ A;  1VQJ A;  4AIM A;  4OON A;  4JV5 Q;  2RCN A;  1NE3 A;  4DR6 Q;  4B3T Q;  2R7F A;  4PG3 A;  1X6O A;  1WOC A;  3E9I A;  2R6G A;  2JA7 H;  4DR4 Q;  3L7Z C;  4HJ7 A;  2WAQ G;  4LW1 A;  5LMU L;  1PH2 A;  1QVC A;  4POG A;  2A8V A;  1A8V A;  4EQ5 A;  1PH5 A;  2LXJ A;  4ME3 A;  3K7A H;  4APV A;  2F4V L;  1Q1B A;  4P71 A;  1Q81 C;  3CPF A;  4KHP L;  4OWW B;  1X3F A;  2PMZ E;  4YY3 L;  2ZM6 Q;  5M3F G;  5IYB H;  3STB C;  3GDE A;  1IYJ B;  4DV6 L;  5IP9 G;  4GNX B;  1OXU A;  2Z0S A;  1JJG A;  1TWH H;  2R7Z H;  5GAE C;  1VS0 A;  5FLX c;  4H02 A;  4B3R L;  2UUC Q;  1E1T A;  2CWP A;  3KF6 A;  5ELN A;  4C3J H;  4GOP A;  1KC8 C;  5HGQ A;  3PF5 A;  1C0A A;  1H95 A;  1IBL Q;  2KCT A;  4HJA A;  3VDY A;  4DUY L;  1W3S A;  5IWA Q;  3ULL A;  1XNQ Q;  4JI8 L;  3HFZ B;  3S14 H;  4X64 Q;  4B3S L;  3KLW A;  1YJW A;  4DUZ Q;  4HIO A;  4BA1 I;  5GQO A;  2CFM A;  3PGZ A;  1HNZ Q;  1CKM A;  4MNO A;  3M4O H;  1I94 L;  1E22 A;  1S3O A;  4DV3 Q;  5IT9 c;  1MJC A;  1N34 L;  3T1H L;  2JA8 G;  4KI0 A;  4AYB E;  1PH4 A;  3W1B A;  4DV7 Q;  2JEB I;  4JI2 Q;  4X62 Q;  1K8G A;  4LNQ A;  3MEF A;  3RLF A;  2CKZ B;  1VQM A;  1PHJ A;  3K81 C;  4P73 A;  2MNA A;  1UE5 A;  4LUZ A;  2UUA Q;  3KJP A;  4LF6 Q;  3HOY G;  4JYA Q;  4KLK A;  4OXP A;  1IXR A;  1N32 L;  4YHH Q;  1WI5 A;  4DV0 L;  4IPC A;  4HJ9 A;  2E5L Q;  1QUQ B;  3D0F A;  3PUX A;  1I3Q H;  1VQF A;  1VQH A;  3UDG A;  1VQI A;  3KYH C;  3PSI A;  4A3D H;  3AEV A;  2R7D A;  4P75 A;  1L2F A;  5M3M H;  4LFC L;  3FHW A;  2KEN A;  5JJI A;  1IBM L;  3PV0 A;  4GNX A;  1LM0 A;  3GTG H;  1UE7 A;  4A3M H;  5C44 H;  4A3B H;  4JI1 Q;  1NMF A;  3RR5 A;  2OCE A;  4GOP C;  4NPS A;  4JI6 L;  3HKZ G;  4UY8 C;  4GS3 A;  1L1O C;  1HZA A;  1ASZ A;  2R92 H;  3H0G H;  1UE1 A;  4UPA A;  2EIF A;  5GAD C;  3RNU A;  1FVI A;  4BBR G;  2UXC L;  1VQN A;  3HOU G;  1WJJ A;  2L15 A;  4JI7 Q;  3OYY A;  4WJ3 M;  1MJE A;  1PFS A;  4R4I A;  4DV5 L;  3F8T A;  3IRB A;  3PO3 H;  4BY1 G;  5C4X H;  1X55 A;  1VQ5 A;  4IJH A;  1YHB A;  3M9B A;  5JEA J;  4C3I H;  4IJL A;  4JBK A;  2VL6 A;  2B63 G;  4GN4 B;  2VUM H;  2R93 G;  2ZTC A;  3D31 A;  3GTL H;  1VQD A;  2KHI A;  4X65 Q;  4HJ5 A;  4LFA L;  4DV2 L;  5LMN L;  5LMU Q;  4YCU A;  4LF8 L;  3LGJ A;  3I4N H;  3PO2 G;  4GLA C;  5LMN W;  4BY7 G;  2F3I A;  3BZK A;  4NXM Q;  3KFU A;  4OWX B;  1XMQ L;  1Y1W G;  4DR5 L;  3AYH B;  3RN2 A;  2F4V Q;  3PUY A;  1VCI A;  3T1Y Q;  1TXY A;  3ULJ A;  4DV1 L;  1VQ8 A;  4GKJ L;  1HR0 L;  4XIG S;  3CQZ H;  1HR0 W;  2VY3 A;  1QUQ A;  1QVF A;  2AKW B;  3G48 A;  2ZJR A;  1YVC A;  4OWT B;  3UE0 A;  1WFQ A;  2JA9 A;  5DLQ E;  1A0I A;  1Y14 B;  2N49 A;  3F1Z A;  3CP0 A;  3OTO L;  2NN6 I;  3M85 A;  1Q12 A;  4JCV E;  3HOX G;  4GNX C;  1HH2 P;  5IP7 G;  2VNU D;  2NVY H;  3PIP A;  2AWN A;  2Z6K A;  3K8A A;  2Y0S E;  4JI5 L;  4DR1 L;  2JK8 A;  3HOW H;  4JI8 Q;  4OO1 G;  2YTV A;  3TS0 A;  3UDF A;  3CCU A;  3S1M H;  1E3P A;  4BBS G;  3W5O A;  4A3L G;  4GLX A;  1HJP A;  1E1O A;  2VQE L;  3H3V I;  1VQE A;  5FLM G;  1XMO L;  1I94 Q;  2GVB A;  5M5X H;  4A4I A;  2N78 A;  3TEH B;  1VQL A;  4J15 A;  4JOI A;  1N34 Q;  2AMC B;  3T1H Q;  1PVO A;  1WCM G;  4TQU S;  3PCO B;  2BA0 A;  5IP9 H;  2JJQ A;  4A3J H;  1AE2 A;  1UWV A;  3HOZ H;  4A3G G;  1G51 A;  5AJ3 Q;  3CCR A;  1NY4 A;  2KHJ A;  1AH9 A;  3A74 A;  4X66 L;  4AQY L;  1VQP A;  4IFD G;  1EIF A;  3I4M G;  1GVP A;  3I4O A;  3M3Y H;  2K5N A;  2JA5 H;  4L5Q A;  4QL5 A;  4OO1 I;  1XTD A;  4DV0 Q;  2D62 A;  3FKI H;  3I2Z A;  3RLN A;  5IYD G;  1EQQ A;  1VQ6 A;  1KIX A;  1VQB A;  2I5L X;  2RHQ B;  1CSP A;  3CC4 A;  2OWO A;  4LF4 L;  1SE8 A;  4DR7 L;  4QGU A;  4NXN L;  1Y1V G;  1VQG A;  1YZ6 A;  1XJV A;  4UP9 A;  3F2D A;  4LFC Q;  1CUK A;  3A5Z B;  2AWO A;  1IBM Q;  2K75 A;  2ASB A;  1IL2 A;  4LF9 L;  2WB1 G;  4A3F G;  4IFD I;  3EN2 A;  3M4Q A;  1VQC A;  1GM5 A;  2VZA A;  3CCS A;  1Q7Y C;  3MXN B;  5HY6 A;  3PUW A;  2YU9 H;  3S2D H;  3HOV G;  2OQ0 A;  3CMA A;  1D8L A;  3UDX A;  3HOY H;  1HNW L;  4Y52 H;  1N36 L;  4JI3 L;  4JI0 L;  2HT1 A;  4DV5 Q;  1B8A A;  1OXX K;  4DR2 L;  3B6Y A;  1X3G A;  1YHQ A;  2PQA A;  5BR8 Q;  2JA6 G;  3S1R H;  3RLO A;  1RIP A;  4JBW A;  1FJG L;  4GKK Q;  4JOI C;  2IT1 A;  3H15 A;  3BJU A;  4LFA Q;  3KJO A;  4A3C G;  1X54 A;  1YBY A;  5LMN Q;  1WYD A;  4LF8 Q;  4LF5 L;  4QJF A;  3AFP A;  1XMQ Q;  3J7A 5;  4DR5 Q;  2HHH L;  2B29 A;  3I55 A;  4L5S A;  5K36 G;  1RL2 A;  3J80 i;  3GTO H;  4IO9 A;  4DNI A;  4GKJ Q;  1HR0 Q;  3NBH B;  4BBR H;  2H5X A;  2NVQ H;  4YWL A;  4XTC S;  3K0X A;  2KCM A;  4PZ8 A;  1YHA A;  1SFO H;  3UE1 A;  4IOA A;  1HNX Q;  1V9P A;  1Q82 C;  2PNH A;  2NZH A;  3OTO Q;  2Q2I A;  4LFB L;  2YTY A;  3CF5 A;  1DGS A;  3J80 c;  2R93 H;  1G6P A;  1HZ9 A;  4ALP A;  3SGI A;  5C3E H;  2UXD L;  1JB7 A;  1YI2 A;  4JI5 Q;  4DR1 Q;  3PO2 H;  3S2H H;  4A3K H;  1X56 A;  2DUD A;  4C2M H;  4QY7 A;  2CQO A;  2CCZ A;  4HID A;  2UU9 L;  1YEZ A;  5ELO A;  2DGY A;  2EXD A;  4LWC A;  5FJ8 G;  2VQE Q;  1KXL A;  4TVA B;  3RZD H;  1XMO Q;  1VQ7 A;  2ZTD A;  4HJ8 A;  4PZ7 A;  4DR6 L;  4BXX H;  1PH9 A;  3S1N H;  2BA1 A;  4DR4 L;  1K3R A;  1JMC A;  3GTJ H;  2K52 A;  1UEB A;  1EQR A;  4BA2 I;  3S24 A;  2WFW A;  1K9M C;  4AQY Q;  4PMW A;  3I56 A;  3U4Z A;  1B70 B;  2MO0 A;  2N8N A;  2Q2H A;  4B3M L;  1VQA A;  2QGQ A;  3UDI A;  3KDF A;  4YCW A;  1A63 A;  2CWA A;  1HZC A;  3EIV A;  3HOX H;  1XNR L;  1T9H A;  4DR3 L;  1VQ4 A;  5IP7 H;  5H1S E;  5C4J H;  1VQ9 A;  1P16 A;  3ZJY C;  2IHF A;  1X3E A;  2KBN A;  3NEL A;  3TQY A;  3PF4 A;  2LXK A;  2JQO A;  4LF4 Q;  2NN6 G;  2RF4 A;  4DR7 Q;  4NXN Q;  3G4S A;  4DV4 L;  2NVT H;  3J81 i;  1QVG A;  4AYB G;  2I5H A;  4A3L H;  3DM3 A;  1JJC B;  2E2H H;  4KHP Q;  4LF9 Q;  1XPO A;  3GTQ H;  4DK6 C;  2K5H A;  1I5F A;  4YY3 Q;  1I50 H;  4A3E G;  4A3G H;  4DV6 Q;  4FDB A;  1OXV A;  3A0J A;  1SRU A;  4MTN A;  1KL9 A;  4UP8 A;  1YJN A;  1PH1 A;  1S40 A;  2IX0 A;  3J81 c;  4B3R Q;  5JJK A;  2OQK A;  1N36 Q;  1SMX A;  3PUV A;  4YCV A;  4JI3 Q;  2ID0 A;  4JI0 Q;  2MO1 A;  4X64 L;  1NJI C;  3S15 H;  1EWI A;  4MZ9 A;  1N8R C;  5M3M G;  2WAQ E;  2IY5 B;  1SLJ A;  2UXB L;  3F2C A;  1J5E L;  4DUY Q;  2BH2 A;  1BKB A;  1Y1V H;  3CC7 A;  5C44 G;  4Y7N H;  3CCM A;  2PQA B;  3G6E A;  3ULP A;  4B3S Q;  2UUB L;  3TS2 A;  4K0K L;  2EQS A;  5C0X I;  4X62 L;  2N3S A;  1ASY A;  2ATW A;  3F2B A;  2R92 G;  3AQQ A;  3H0G G;  2UUA L;  4JI4 L;  4A3F H;  2WB1 E;  2PI2 A;  5M3F H;  2K50 A;  1C9O A;  3U50 C;  1PH8 A;  1EUJ A;  3CME A;  5IYC G;  3HOV H;  3PO3 G;  2ALY B;  4L5T A;  3E9H A;  3AFQ A;  4A93 G;  1AE3 A;  1TWA H;  3G71 A;  4DPG A;  2JE6 I;  4O2D A;  4GN3 B;  3CW2 C;  4IPD A;  5IE8 A;  1N32 Q;  1VQK A;  2OTJ A;  4P74 A;  3RN5 A;  3CC2 A;  1L1O B;  1HZB A;  1CSQ A;  2LSS A;  3WWV A;  2JA6 H;  3I4N G;  4LFB Q;  1NMG A;  4QQB X;  3J81 j;  3HKS A;  1KHI A;  2GN5 A;  2RHS B;  4R4Q A;  2C35 B;  3OW2 A;  1X9N A;  2UXD Q;  1YNX A;  5J3B A;  4LUO A;  1C7Y A;  1R9T H;  5M5Y H;  2NVX H;  4A3I G;  2XGT A;  3TRZ A;  5GAG C;  1D7Q A;  2JA8 H;  1XPU A;  2VS1 A;  4L5R C;  3L2P A;  2ZJP A;  1CKO A;  1PYS B;  4JI6 Q;  2HQL A;  2Z6K C;  2FXQ A;  1TWC H;  2UXC Q;  4R4C A;  3CCQ A;  1JT8 A;  4B3M Q;  4DKA C;  4X65 L;  5JJL A;  1GO3 E;  1VQO A;  2Y0S G;  1GD7 A;  1QZG A;  3HOW G;  1XNR Q;  4NXM L;  4DR3 Q;  2E2I H;  1IZ6 A;  3CCJ A;  4IPH A;  3L0O A;  1PYB A;  3KDF B;  3T1Y L;  2Q2T A;  1I6H H;  4DV2 Q;  3CCE A;  2I0Q A;  1CKN A;  3Q8D A;  3K7U C;  1BVS A;  4DV4 Q;  2K5V A;  1MKH A;  1O7I A;  2F52 A;  3I7F A;  4YWK A;  4A3J G;  2AHO B;  5FJ8 H;  3HOZ G;  1N33 L;  2VQF L;  1K73 C;  4QIW E;  4HIM A;  3HKZ E;  4YWM A;  4IFD J;  4DV1 Q;  1Z9F A;  4LF7 L;  3JC6 6;  3CCL A;  2D0O A;  2JA5 G;  3HOU H;  1EYG A;  1L1O A;  1EFW A;  2JA7 G;  4A76 A;  2QEX A;  3FKI G;  3CAM A;  4O0A A;  1MIU A;  4HIK A;  3DLL A;  4RG1 A;  4BY1 H;  2NZO A;  4JBM A;  4OX9 L;  5JEA G;  1BBU A;  3K80 C;  1U5K A;  3W1G A;  2BH8 A;  2B63 H;  2VW9 A;  1IBK L;  2UXB Q;  2V1C C;  1EIY B;  1GKH A;  1J5E Q;  1XPR A;  1K83 H;  4BY7 H;  5GRO A;  1Q46 A;  4JBJ A;  1B7Y B;  2E2J H;  1KRS A;  5IYB G;  1Y1W H;  3KOJ A;  2QA4 A;  2UUB Q;  4K0K Q;  2GVA A;  3PIO A;  5AJ3 L;  1G29 1;  4JV5 L;  3KF8 B; 
#chains in the Genus database with same CATH topology
 5M3M B;  1YIT A;  3AB9 A;  4B3T L;  1JQY D;  4GN5 A;  4HED A;  4A75 A;  3PUZ A;  3BVM A;  4C3J G;  5C44 B;  3BU2 A;  1STG A;  1EL0 A;  4X66 Q;  1JE5 A;  5M5W H;  5C3W A;  2EOT A;  2NWG A;  2R92 B;  3M4P A;  1PH6 A;  2B2Y A;  3A7L A;  1E0B A;  3PO3 B;  1XYI A;  2FMM A;  3R3O A;  1PH7 A;  3ICE A;  5C4Z A;  1MSG A;  1Q8K A;  2PI2 E;  1U0L A;  5FLM H;  3NEM A;  3K59 A;  1YNJ C;  1ROD A;  1E2W A;  3U4V A;  5C0X G;  2XTI A;  1IBL L;  2F0K A;  5E7N A;  4DXG A;  4A3I B;  4DAY B;  2MP1 A;  1WD1 A;  5C3E G;  5IYD H;  5CBA E;  4NMZ A;  2LFN A;  2L11 A;  4A3B G;  1HFG A;  4DV7 L;  4IOC A;  1FL0 A;  1KTK A;  2XWJ B;  4IUQ A;  4HCS A;  2A1A A;  5CV6 A;  3TRE A;  4LF5 Q;  1BCP C;  1KAW A;  1CKN B;  1M1K C;  1HHV A;  5CV5 A;  1M90 C;  1TWG B;  5C4X G;  5HUR A;  4PZ6 A;  4X6A H;  3U58 A;  1Y8N B;  1JC7 A;  3GTK H;  2Q8R E;  3IFT A;  1N9W A;  2JA7 B;  3FKI B;  2HIX A;  4FP5 D;  4ME5 A;  2DJF C;  1BXT A;  1DXM A;  1EU3 A;  2PQE A;  2A69 D;  1BUV T;  5E3F A;  2UU9 Q;  2ZJQ A;  4XDX A;  1NCV A;  1SNP A;  1F9S A;  5EPK A;  4PG3 A;  2F0U A;  1CHP D;  2PZW A;  4F88 A;  1A8V A;  2LXJ A;  2KCC A;  2PNR C;  4ME3 A;  3EA6 A;  1EZ6 A;  1R4P B;  4CJ1 B;  1EWC A;  1X3F A;  2J0T D;  2ZT9 C;  3OMC A;  3GDE A;  3S1R B;  4JW0 A;  1EYA A;  1JJG A;  5GAE C;  4UHV A;  3TDQ A;  2K33 A;  4H02 A;  5DEH A;  2UUC Q;  1GUS A;  3KF6 A;  4C3J H;  4C1N I;  2G5D A;  3K5L A;  5JPM C;  1H9K A;  4HJA A;  3GTO B;  5IWA Q;  1X3Q A;  1XNQ Q;  1YJW A;  4HIO A;  1CZG A;  1SND A;  5FOB B;  3M4O H;  1SXT A;  5EKI A;  1S3O A;  1GUT A;  5IGD A;  1EYC A;  5IT9 c;  1N34 L;  2JA8 G;  1PH4 A;  1IHZ A;  3T53 B;  3NE5 B;  5JPN C;  4JI2 Q;  4X62 Q;  4LNQ A;  3MEF A;  4MN3 A;  1VQM A;  1PHJ A;  1LLR D;  3K81 C;  5EJW A;  2B2U C;  2UUA Q;  4LUZ A;  2KVM A;  3AEV A;  1YNN D;  4JYA Q;  2HDL A;  5C0X H;  4KLK A;  4YHH Q;  1WI5 A;  2WKD A;  4IPC A;  3TZD A;  1KAB A;  4XXE A;  1LAB A;  4K8I A;  1VQI A;  3UDG A;  3C3L A;  3PSI A;  3S1N B;  1TY0 A;  2J7Z A;  3A8K E;  2QEJ C;  2B8F A;  2KEN A;  4KY6 A;  2JYO A;  3GTG H;  2A69 C;  4A3B H;  4JI1 Q;  3R8B A;  3RR5 A;  4GOP C;  2ICI A;  4JI6 L;  3EQL C;  1L1O C;  1HZA A;  1ASZ A;  3H0G H;  3X3N A;  2B2V A;  2EIF A;  4HSV A;  5GAD C;  4BBR G;  1PRT B;  2UXC L;  3HOU G;  3OYY A;  5F2D A;  1UNS A;  5BN5 A;  1MJE A;  2EYF A;  3H94 A;  5C4X H;  1NSN S;  1O80 A;  4ID6 A;  2PO4 A;  4C3I H;  4JK1 C;  4O1N A;  4JBK A;  1O7Z A;  1BF4 A;  2R93 G;  3D31 A;  4HJ5 A;  2K28 A;  5LMU Q;  4DV2 L;  2SOB A;  3V2T A;  1L0Y B;  2F3I A;  3BZK A;  1Y8O B;  1XMQ L;  3AYH B;  2F4V Q;  4RCO A;  2F0T A;  3DWQ A;  3K58 A;  1TXY A;  1KAA A;  4CDE C;  1QUQ A;  1QVF A;  3G48 A;  1PZK D;  2ZJR A;  5CV7 A;  3MAQ A;  3UE0 A;  1LAC A;  1QNU A;  3P20 A;  2N49 A;  5I6W A;  5M3F B;  3M85 A;  2VNU D;  2NVY H;  2IJ0 A;  2Z6K A;  3K8A A;  2B2T C;  4JPB W;  2YTV A;  3UDF A;  2RDG A;  1SDF A;  4BBS G;  3W5O A;  1I4Q A;  3TP7 A;  2N78 A;  3TEH B;  2L55 A;  3FVQ A;  1YNN C;  4J15 A;  2AMC B;  1PVO A;  2BA0 A;  4A3J H;  3FDT A;  4A3G G;  1AH9 A;  4IFD G;  1VQP A;  3ND9 A;  4LAA A;  3M3Y H;  4RFB A;  2JA5 H;  3SK8 A;  4DV0 Q;  3I2Z A;  1EQQ A;  4J8Q A;  1VQB A;  5HGT A;  1TWC B;  1Y1V G;  5FLX L;  3OOC A;  5JAV A;  4QUF A;  2VZA A;  2E2I B;  3C2P A;  3PUW A;  4IAL A;  3MXP A;  1HNW L;  4PQX A;  4JI3 L;  4ULL A;  3DMU A;  1E2Z A;  4XYQ A;  1X3G A;  4DR2 L;  1SAP A;  3HKZ B;  5D14 A;  1QG7 A;  1DZ1 A;  4EVO A;  2CH4 W;  3SEB A;  2JA6 G;  2NVQ B;  3H15 A;  1SNO A;  5T1I A;  1YBY A;  3BVG A;  4BY1 B;  3A8I E;  2F0J A;  3J7A 5;  3I90 A;  3E5S A;  3I55 A;  2B63 B;  1RL2 A;  1GHK A;  1HR0 Q;  4BBR H;  1K83 B;  4BY7 B;  3OWE B;  3D4W A;  4PZ8 A;  2KCM A;  1SFO H;  1Z7T A;  3VR4 A;  5D3D A;  1I4R A;  4LFB L;  4KMU C;  3J80 c;  2R93 H;  3FPP A;  1TT2 A;  1HZ9 A;  2UXD L;  2E75 C;  1GJX A;  3S2H H;  4A3K H;  3QG1 A;  3TP6 A;  3D4R A;  2DUD A;  3H09 A;  2KEE A;  3R2T A;  4EQP A;  1M8A A;  2EYL A;  4NDX A;  2CCZ A;  2PZT A;  2Q8T A;  4HID A;  2AUJ D;  5ELO A;  5IGG A;  2VQE Q;  4LWC A;  4TVA B;  1XMO Q;  3PIO 3;  4HJ8 A;  4DR6 L;  5FKA C;  4BXX H;  4K8J A;  1HXY D;  1UEA B;  1K3R A;  2A68 D;  3GTJ H;  1UEB A;  5EKL A;  2EYO A;  2QGQ A;  3UDI A;  1NR2 A;  2KUM A;  3KDF A;  1PFB A;  4YCW A;  5J39 A;  3R2I A;  1KDA A;  1HQR D;  1VQ4 A;  1P16 A;  1Q90 A;  3G7L A;  3AU7 A;  2NN6 G;  3G4S A;  4DV4 L;  2NVT H;  1QVG A;  3J81 L;  2EY6 A;  1JJC B;  4QF4 A;  1DYQ A;  3TP8 A;  1U4R A;  3NHH A;  1CM9 A;  1ENC A;  5I4D A;  4A3G H;  1A15 A;  4Y7N B;  4UDU C;  2EJM A;  2WIN B;  1N36 Q;  1QNK A;  1SMX A;  3PUV A;  1Z6H A;  2ID0 A;  2MO1 A;  4YIJ A;  3S15 H;  2K5W A;  4HTH A;  2IY5 B;  5ELF A;  3VYT A;  4P2C B;  4ZLT F;  2A6E D;  2MJ8 A;  1UUP A;  3KF8 A;  1ET6 A;  1Y1V H;  5EBD A;  4RAU C;  2UUB L;  4KKS A;  2K5Q A;  5ELD A;  2ICE C;  4UAI A;  1C9O A;  2HDM A;  3EJI A;  5IYC G;  3NP8 A;  2ALY B;  3E9H A;  2QW7 A;  3NSW A;  4A93 G;  3TN2 A;  5M5Y B;  2JE6 I;  2CQA A;  3NTK A;  2IX3 A;  1F9R A;  4O2D A;  2PPB C;  5IE8 A;  5K5P A;  1VQK A;  2OTJ A;  1EQV A;  1QOH A;  3I4N G;  4LMQ D;  3TZU A;  3BDL A;  2JA6 H;  1NMG A;  3J81 j;  1PMR A;  1KHI A;  2C35 B;  5CV8 A;  3K5N A;  2NVX H;  2XGT A;  1DOK A;  2O5J C;  2A68 C;  4JI6 Q;  2O4X A;  4DAY A;  1XXG A;  2UXC Q;  2B2W C;  4MTK A;  4KV6 A;  1ESR A;  5I2Y A;  5CV9 A;  5JJL A;  1VQO A;  4RHR A;  2Y0S G;  1GD7 A;  1XNR Q;  1BCP B;  1ENA A;  2RSN A;  4DR3 Q;  4C3J B;  1IZ6 A;  3CCJ A;  2MPM A;  1PTO F;  2Q8I B;  1QE6 A;  2Q2T A;  1FNV A;  4DV2 Q;  1CKN A;  3MXG A;  3OPO A;  1O7I A;  1JWU D;  3HKZ E;  2KED A;  4YWM A;  4IFD J;  3M4O B;  3J7A F;  3JC6 6;  2RA4 A;  1QCB D;  1EFW A;  4AYB B;  1MIU A;  4HIK A;  1S5D D;  2A6E C;  1U5K A;  1LTT D;  2BH8 A;  4GZY C;  3CU7 A;  4B9X A;  1J5E Q;  2NN6 H;  4C3H B;  4OEL B;  1KRS A;  2K5D A;  2GVA A;  1G29 1;  2F03 A;  1J6Q A;  3T16 A;  1TII D;  1OTC A;  2R7Z G;  1SYE A;  3TBI B;  3H3V H;  4A3B B;  5GAH C;  5IIF A;  2SDF A;  4HSP A;  3H0G B;  2I5M X;  2RBM A;  1A3U A;  4EX5 A;  1EWH A;  2WP8 J;  1D1I A;  4C3I B;  3CPW A;  5JVG 3;  1PA6 A;  5FO8 B;  1DCZ A;  1RHP A;  1YIJ A;  1ENF A;  4DK3 C;  1FGU A;  1K8A C;  5C4H A;  1LUZ A;  1EIH A;  1B3Q A;  1K0R A;  2UUC L;  3NEN A;  1WCM H;  1IW7 D;  3K5O A;  1Q8I A;  5IYC H;  1WTQ A;  3IAY A;  4A93 H;  2AQ3 B;  4KJN A;  3S1Q B;  5BR8 L;  1HNW Q;  3JAM c;  1AEX A;  5IWA L;  2A19 A;  1XNQ L;  1T5E A;  1E7Z A;  1STN A;  1TWF H;  1B2T A;  4DR2 Q;  3GTM H;  1LTL A;  2SNM A;  3S17 H;  3C46 A;  4KD4 A;  1S72 A;  4R1J A;  2NVY B;  4JI2 L;  3FPU B;  3LNN A;  2VUM G;  3FP9 A;  4JYA L;  1S4Z A;  2K01 A;  4ODG A;  2A6H D;  2L0C A;  2NTS A;  4JVZ A;  3DEO A;  4POF A;  1HNX L;  4YHH L;  4R4O A;  4XQN A;  2IHE A;  4JC0 A;  4A3J B;  3CD6 A;  4IPG A;  5KND A;  1A62 A;  4GOP B;  3MTS A;  3ER0 A;  1RDP D;  1STH A;  4GLV B;  4FXG C;  3WDN A;  2JA5 B;  3QB3 A;  1QIL A;  1SR3 A;  4JI1 L;  2BDO A;  1BBW A;  3CRL C;  4KHZ A;  1WTH A;  4DAM A;  2HIV A;  1OXT A;  3K7A B;  1A3T A;  1NE3 A;  1LT5 D;  4DR6 Q;  2R7F A;  3BYY B;  4IUV A;  5DAU A;  3L3O C;  1BO0 A;  1K8O A;  2OEO A;  2WAQ G;  5CMD A;  3MC0 B;  5LMU L;  4CKE A;  4G7O C;  5IGB A;  1FR3 A;  2Z6B A;  4EQ5 A;  3V05 A;  2F4V L;  1Q1B A;  2O2L D;  4OWW B;  4YY3 L;  2ZM6 Q;  2XSC A;  1B4O A;  4DK1 A;  1IW7 C;  2E2D C;  4OGQ C;  1OXU A;  3S14 B;  2R7Z H;  3IL8 A;  5LL6 S;  5ELN A;  1KC8 C;  1I4X A;  5IT9 L;  1HA5 A;  3VDY A;  2F4I A;  4IUT A;  5IOC A;  4DUZ Q;  2CFM A;  1MD2 D;  4MNO A;  4KN4 C;  5ELC A;  1D5X C;  1XX8 A;  2Z8L A;  2A6H C;  4KI0 A;  4AYB E;  2F0P A;  2JEB I;  1PTO H;  3OW7 A;  2CKZ B;  4P73 A;  2MNA A;  3KJP A;  3S2H B;  1KLU D;  2ZXO A;  4A3K B;  4U67 3;  3HOY G;  4N9P A;  4A3M B;  1N32 L;  3HEJ A;  4DV0 L;  3PUX A;  1I3Q H;  1W6J A;  1DOL A;  1QB5 D;  3GTJ B;  1V1P A;  3I72 A;  1LV9 A;  4GNX A;  1LM0 A;  3BVZ A;  1JB3 A;  4FXK C;  1X3P A;  2B8G A;  1NMF A;  1HPC A;  2OCE A;  2N55 A;  2VUM H;  4GS3 A;  1UE1 A;  1FVI A;  1VQN A;  4J1M A;  4JI7 Q;  2NVT B;  1VQ5 A;  1PFM A;  1VF7 A;  1STY A;  1B1Z A;  1SYB A;  4GN4 B;  3GTL H;  2HQE A;  4YCU A;  1HTL D;  3PO2 G;  1Y8P B;  3C1F A;  1Y1W G;  2FFK B;  3PUY A;  1VCI A;  2E76 C;  2N88 A;  4XYO A;  1VQ8 A;  1HR0 L;  1BNZ A;  5KNB A;  5EBC A;  3CQZ H;  3SHL A;  1HR0 W;  1WFQ A;  1L0X B;  2JA9 A;  1A0I A;  3F1Z A;  1Q12 A;  3ERQ A;  3HOX G;  2DN8 A;  1HH2 P;  2DY7 A;  4QB4 A;  3PIP A;  3NUC A;  4Q5V A;  2QCP X;  2K7V A;  5TSS A;  3HOW H;  1D1K A;  2EY1 A;  4CKC A;  1ILP A;  1SNQ A;  1E1O A;  2VQE L;  1I94 Q;  1XMO L;  5M5X H;  1MI2 A;  3PCO B;  3HOZ H;  1G51 A;  3U9O A;  3CCR A;  2F1M A;  3A74 A;  4K5W A;  1J9O A;  2NVX B;  3I4M G;  4K2K A;  5ELE A;  2XNA C;  2F0G A;  1BQQ T;  2I5L X;  1CSP A;  1CT1 D;  1CTM A;  4IUN A;  1XJV A;  3A5Z B;  1FD7 D;  1IL2 A;  2WB1 G;  4A3F G;  1Q7Y C;  3MXN B;  5HY6 A;  1QWY A;  2YU9 H;  3S2D H;  3HOV G;  4C1N K;  2OQ0 A;  4ZUJ A;  1XTC D;  3HOY H;  4HN7 A;  3NWS A;  4L6T B;  4TKO B;  1N36 L;  3VA5 A;  3BDC A;  1YHQ A;  5FLX E;  1JIC A;  2KJX A;  5IGF A;  2WAC A;  5BR8 Q;  2NZ1 D;  5EKK A;  4JBW A;  1EZ8 A;  4LFA Q;  3CHB D;  4A3C G;  1J8I A;  4QJF A;  2HHH L;  4I65 A;  2B29 A;  3P7J A;  4L5S A;  1B3A A;  4IO9 A;  4DNI A;  3J80 L;  4GKJ Q;  3NBH B;  3A56 A;  2F0F A;  4XT3 B;  1HNX Q;  4N8F A;  4I7Z C;  3OTO Q;  2Q2I A;  2YTY A;  1DGS A;  1G6P A;  1I4P A;  5KIX A;  2D9U A;  5C3E H;  1JB7 A;  1PZI D;  3PO2 H;  3ND8 A;  4C2M H;  2CQO A;  3SXH A;  1GXD C;  1YEZ A;  3RZD H;  5C4J B;  2ZTD A;  4ZUI A;  4CGY B;  5E4X A;  3EVQ A;  2F3W A;  1LTA D;  4DR4 L;  2XRQ D;  2H4O A;  3BG3 A;  4FYD A;  4QMG A;  4PMW A;  2FHT A;  3I56 A;  1B70 B;  4IQZ A;  1VQA A;  3GTQ B;  1A63 A;  3EFX D;  3HOX H;  1PXU A;  3EIV A;  1XNR L;  1WCM B;  2EJF C;  4DR3 L;  1EY0 A;  4CBV A;  1VQ9 A;  3ZJY C;  1DON A;  3NEL A;  2JQO A;  4LF4 Q;  4DR7 Q;  4NXN Q;  3J81 i;  2I5H A;  1T5X D;  3GTM B;  5ELB A;  3S17 B;  1CHQ D;  4YY3 Q;  1I50 H;  4A3E G;  4ZKC B;  1NNX A;  4MTN A;  1WTX A;  1YJN A;  1KL9 A;  2F0H A;  4CDC C;  1S40 A;  2OQK A;  2OT2 A;  4TRD A;  1DJR D;  5M3M G;  1SJH D;  3F2C A;  1J5E L;  2BH2 A;  1BKB A;  5KYI A;  3CC7 A;  5C44 G;  4BWG B;  3ULP A;  2KQ3 A;  5C0X I;  3P1H A;  2R92 G;  3AQQ A;  2DY8 A;  4A3F H;  2PI2 A;  1S5F D;  1TQO A;  1UAP A;  3E6Z X;  3WOF A;  4DF7 A;  3KBG A;  1PH8 A;  1EUJ A;  3HOV H;  3PO3 G;  4L5T A;  3AFQ A;  1TWA H;  1R9T B;  3CW2 C;  1N32 Q;  2VB2 X;  1WTV A;  3OSO A;  3SVM A;  1O7L A;  3VA7 A;  4R4Q A;  1H9S B;  5J3B A;  4LUO A;  2F0S A;  1TKW B;  4A3I G;  3I73 A;  3TRZ A;  4KD3 A;  5GAG C;  1S5B D;  2JA8 H;  1XPU A;  4FF1 A;  4PMC A;  4L5R C;  2ZJP A;  1PYS B;  5T1G A;  3D4D A;  4IUU A;  5A2Q L;  2FXQ A;  5KYL A;  5KNC A;  1DOM A;  2B2U A;  1SYF A;  4DKA C;  4X65 L;  2HUG A;  4IN3 A;  4DNR B;  3M4Y A;  1EEI D;  4IPH A;  4R9W A;  3D8G A;  3OHX C;  2NYZ D;  3T1Y L;  3CCE A;  1EY6 A;  4KY7 A;  2K5V A;  1MKH A;  4YWK A;  3K6O A;  1K73 C;  3J7A V;  2LY7 A;  1H9M A;  3HOU H;  3Q0A A;  1L1O A;  5L37 A;  2E2J B;  2JA7 G;  2QEX A;  3FKI G;  4RG1 A;  2NZO A;  3CRK C;  1PFN A;  5JEA G;  1BBU A;  2L4N A;  3NXW A;  3T56 B;  3W1G A;  4X3K A;  2EVB A;  1LTS D;  1XPR A;  4JBJ A;  5M5W B;  2QKI C;  4M1U B;  5IYB G;  4K0K Q;  2RDH A;  3NQI A;  1NR4 A;  4JI4 Q;  1P8L A;  4A3E H;  2K4K A;  1SN8 A;  3ERS X;  1PH3 A;  2LS0 1;  3J7Y W;  1B9M A;  3NWT A;  1NBW A;  2CW0 D;  2IWH A;  2DNE A;  2JEA I;  3DUZ A;  3M7N A;  1C48 A;  3PQI A;  3DWA A;  4RMF A;  2ZM6 L;  4BBS H;  4KN7 C;  2B2T A;  2QDL A;  3JAM L;  1UE6 A;  1SBB B;  3R93 A;  2ZTE A;  1I4G A;  5IY0 A;  1LYL A;  3CCV A;  1SRO A;  1MSH A;  3GO5 A;  4IFD H;  1EOT A;  1YJ9 A;  2YYZ A;  2ZXR A;  4G57 A;  4DUZ L;  1EU4 A;  4L63 B;  1V43 A;  1TS2 A;  1TS3 A;  4X3S A;  2YTX A;  4FF4 A;  4B08 A;  2C9O A;  4WOR A;  4A3I H;  4NB3 A;  3GTK B;  3ITP A;  2F0E A;  3HOW B;  1W2B A;  2HHH Q;  1A3V A;  2VQF Q;  4LUV A;  2ES2 A;  1L0W A;  1FNU A;  5I9P A;  3GD7 A;  1V8Q A;  1G91 A;  3RZO H;  3N6R A;  3K5M A;  5M5X B;  1V1Q A;  2F0Q A;  1CA6 A;  3URY A;  1FNW A;  3HOZ B;  3KF6 B;  1KRT A;  5BN3 A;  4OX9 Q;  1IKM A;  1EY8 A;  2EPB A;  4IUP A;  1IBK Q;  1B9N A;  4EQN A;  1PV4 A;  4HMI A;  1TWG H;  1BR9 A;  1JJ2 A;  2MQH A;  1EY7 A;  1SJE D;  2MFI A;  3HGB A;  4JG2 A;  3CXC A;  1IL8 A;  3E0E A;  3QJY A;  4RCN A;  4DK0 A;  3TME A;  3H3V C;  1HFN A;  4JI7 L;  4P72 A;  4JV5 Q;  1VQJ A;  4AIM A;  3QO2 A;  5C5M A;  4RHS A;  1H9J A;  3SK4 A;  1PZJ D;  2JN4 A;  2F0I A;  4DR4 Q;  2R6G A;  2JA7 H;  3L7Z C;  1RTN A;  2CW0 C;  3VYU A;  2YU9 B;  1EEF D;  3S2D B;  1I6V C;  4LW1 A;  1PH2 A;  3HOY B;  4POG A;  1LTI D;  1U4P A;  1HRJ A;  4P71 A;  1EYD A;  2SNS A;  5M3F G;  1JOK A;  5IYB H;  4DV6 L;  1TWH H;  5IGC A;  5FLX c;  3RUZ A;  2ZXP A;  2CWP A;  1ESF A;  1H95 A;  2I07 B;  4DUY L;  1W3S A;  3ULL A;  3HFZ B;  2TSS A;  4B3S L;  4FO2 A;  5GQO A;  3PGZ A;  1HNZ Q;  1CKM A;  1I94 L;  3I70 A;  4LK1 C;  4DV3 Q;  4C56 C;  1NAP A;  5EPJ A;  5C5L A;  3W1B A;  2X6L A;  4N8X 1;  5C3E B;  1PTO D;  3RLF A;  1HCZ A;  1EFI D;  3PO2 B;  4LF6 Q;  2NBF A;  5C6A A;  1C8C A;  1TU2 B;  3NBI A;  4OXP A;  4C2M B;  3GTG B;  1IXR A;  3NTI A;  3I8Z A;  4KKT A;  5KGU A;  4HJ9 A;  3RZD B;  2E5L Q;  1QUQ B;  3UI2 A;  3KYH C;  2R7D A;  1JOR A;  3FHW A;  1KDC A;  3QWN A;  3NK9 A;  3MXN A;  2EYJ A;  5C4X B;  5EQ0 A;  1UE7 A;  1FGB D;  4CDD C;  1DD2 A;  2BDN A;  3HKZ G;  4UPA A;  3IKJ A;  3OIQ A;  3RNU A;  4G7H C;  2F0W A;  1WJJ A;  2L15 A;  3HG9 A;  1F2M A;  4R4I A;  3F8T A;  4MIU A;  3P75 A;  4BY1 G;  1S5C D;  3DXJ C;  2EXZ A;  4H0L C;  1YHB A;  3M9B A;  5JEA J;  1I50 B;  1D5M C;  2B63 G;  1JCK B;  3SE0 A;  4M8A A;  1K28 A;  4EGV A;  4X65 Q;  4U68 A;  4LFA L;  3I4N H;  2A73 B;  3BZD B;  3LGJ A;  5CV4 A;  4BY7 G;  3SDZ A;  3GP7 A;  3KFU A;  3RN2 A;  1LO5 D;  1KLG D;  3T1Y Q;  1EIG A;  1KDB A;  2QIL A;  1K8M A;  4DV1 L;  4GKJ L;  4QUC A;  2VY3 A;  2AUK A;  3TSS A;  2C5C A;  2AKW B;  2Z9H A;  2B2Y C;  2L1B A;  1YVC A;  3MZ5 A;  5DLQ E;  1JOO A;  1VF5 C;  2K03 A;  1Y14 B;  3OTO L;  2NN6 I;  4GNX C;  2FMC A;  2KHS A;  5IP7 G;  1CQV A;  2AWN A;  1X32 A;  3HP3 A;  1MHW C;  2B2W A;  1EQT A;  1PYW D;  2JK8 A;  4JI8 Q;  3TS0 A;  1U9R A;  3FRP B;  3S1M H;  1E3P A;  3M3Y B;  1BBX C;  3Q23 A;  2EYP A;  4GLX A;  3U9S A;  3H3V I;  1VQE A;  1PTO C;  3A7A B;  5FLM G;  3KK7 A;  4CJ2 C;  5DNF A;  4V19 0;  4JOI A;  3DHQ A;  3WOE A;  3T1H Q;  3OWF A;  4TQU S;  4ZYS A;  1AE2 A;  1UWV A;  2KHJ A;  1EY5 A;  1EIF A;  3I4O A;  4L5Q A;  1JWM D;  5CC4 A;  1XTD A;  4EQO A;  2JA8 B;  2O5I C;  4OO1 I;  1RCV D;  1VQ6 A;  5IYD G;  2RQX A;  1KIX A;  2RHQ B;  3CC4 A;  5JJZ A;  2OWO A;  4LF4 L;  4DR7 L;  4QGU A;  4NXN L;  1D6E C;  1YZ6 A;  2XIW A;  3F2D A;  1CUK A;  4WJW A;  4LFC Q;  1BCP F;  1IBM Q;  2K75 A;  1Q3L A;  3EN2 A;  3M4Q A;  4MHE A;  2GA4 B;  3CMA A;  3UDX A;  4Y52 H;  1CK1 A;  2CHB D;  2XWB B;  4DV5 Q;  1OXX K;  3B6Y A;  1AN8 A;  4DN4 M;  4QIW B;  1HUN A;  2NTT A;  3L9A X;  1SE4 A;  4F8M A;  4XT1 B;  4BBR B;  1RIP A;  1FJG L;  3HOU B;  2JSO A;  5JOB A;  1ONL A;  2KOL A;  3HZX A;  3KJO A;  4LF8 Q;  5LMN Q;  1SFO B;  1CZW A;  1WYD A;  1MGS A;  1ZXT A;  1LT6 D;  4DR5 Q;  2R93 B;  5K36 G;  3J80 i;  2L9H A;  2NVQ H;  4V0B A;  3K0X A;  5J1Z A;  3UE1 A;  4R8I A;  4IOA A;  1C4Q A;  1V9P A;  5E4W C;  1Q82 C;  2F0D A;  5AFW A;  2PNH A;  4H44 C;  1SYG A;  2R61 A;  1SEB D;  2F0M A;  1WTO A;  4DAV A;  4A3E B;  2OXP A;  1WVL A;  4ALP A;  3RMH A;  3FMC A;  1YI2 A;  4JI5 Q;  4DR1 Q;  1X56 A;  2DNC A;  3BS1 A;  3J80 E;  1RF2 D;  4X3U A;  2EXD A;  5FJ8 G;  4H13 C;  1VQ7 A;  2IW3 A;  4PZ7 A;  4KKU A;  3N52 A;  5G3L F;  4HR7 B;  1A2T A;  2K52 A;  4DGZ A;  1EQR A;  4BBS B;  3S24 A;  2WFW A;  1K9M C;  4AQY Q;  2MO0 A;  2N8N A;  4ILW A;  2CWA A;  1HZC A;  1T9H A;  4F87 A;  3T13 A;  4NKL A;  5IP7 H;  5H1S E;  4A3G B;  2KBN A;  1X3E A;  1ICW A;  3IFD A;  3TQY A;  3K0Y A;  5LL6 X;  2A74 C;  2XVS A;  3QR8 A;  4AYB G;  1GUW A;  1MBY A;  3BYT B;  2VXW A;  3S15 B;  4HAE A;  2E2H H;  1S5E D;  5CYU A;  5LHY 1;  1XPO A;  4DK6 C;  1SYD A;  2K5H A;  1I5F A;  4LF9 Q;  2QDB A;  3VYR A;  3CKI B;  4DV6 Q;  1RTO A;  1Y1V B;  1D2B A;  3A0J A;  4RGN A;  1SRU A;  1U4L A;  4UP8 A;  4C3H G;  1F2Y A;  5JJK A;  5G3L D;  5I2X A;  4JI0 Q;  4X64 L;  3E0J A;  4RGO S;  1SLJ A;  5CBE E;  1TY2 A;  4DUY Q;  3RZO B;  4FVM A;  4Y7N H;  4Z9C B;  2B2V C;  2PQA B;  3G6E A;  4B3S Q;  3TS2 A;  4K0K L;  2EQS A;  1STA A;  1SE2 A;  2G9D A;  3F2B A;  4X3T A;  3H0G G;  4JI4 L;  2WB1 E;  2JA6 B;  4KK7 A;  2K1B A;  4ZKB B;  1D5Z C;  3OIP A;  3G71 A;  1WD0 A;  3GV3 A;  3H91 A;  4C3I G;  1TVX A;  1G8Z D;  2QF7 A;  2FJ2 A;  2L5T A;  3I91 A;  1I4H A;  4P74 A;  3CC2 A;  4FF3 A;  1E2V A;  4ABN A;  1HZB A;  2LSS A;  4L8J A;  2GN5 A;  1X9N A;  3A8J E;  1C7Y A;  5M5Y H;  3GV6 A;  4PV1 C;  1D7Q A;  2VS1 A;  2AQ2 B;  1CKO A;  4CJ0 B;  5K36 H;  2EY5 A;  2MGS A;  2KA7 A;  2HQL A;  2Z6K C;  2PMZ B;  3CCQ A;  4B3M Q;  1TWH B;  1GO3 E;  1QZG A;  1SE3 A;  2F0L A;  4NXM L;  2ENB A;  2FIN B;  1O78 A;  1PYB A;  3MWY W;  5JVH 3;  2I0Q A;  1I6H H;  3Q8D A;  2NB0 A;  1CA5 A;  5A2Q E;  4A3J G;  2AHO B;  5FJ8 H;  4ZK9 B;  2VQF L;  1A6X A;  4QIW E;  4DNT B;  5C3X A;  4DV1 Q;  2HCC A;  1Z9F A;  3LWU A;  2JA5 G;  4RGT A;  1EYG A;  1CFM A;  1TS4 A;  2EDG A;  4O0A A;  4CDF C;  4OX9 L;  3VR5 A;  3K80 C;  2XN9 C;  2X69 A;  2LKV A;  1GUO A;  2VW9 A;  1IBK L;  3GQB A;  2UXB Q;  1EIY B;  1WTP A;  1II3 A;  1BOS A;  1Y1W H;  3KOJ A;  2QA4 A;  5AJ3 L;  1G2T A;  4JV5 L;  1OXS C;  4FXD A;  4WJ4 A;  4UP7 A;  2PYK A;  4B9W A;  2RVL A;  1SMY D;  4ZAI A;  4C3H H;  1Q1E A;  4G7Z C;  2BE5 D;  3S16 H;  1X65 A;  1SSO A;  2K14 A;  2YV5 A;  2OTL A;  2AQ1 B;  2LMC B;  5I6Y A;  4A93 B;  2A5H A;  3BDO A;  1F9Q A;  2RDF A;  1ILQ A;  5COY A;  3JAM i;  1TWF B;  1Q86 C;  1Z47 A;  5I9O A;  3I4N B;  3SK5 A;  3STB D;  4WRD A;  1KQS A;  4TSS A;  3KLS A;  2Z4H A;  3I4M H;  4ZQ3 A;  3HRZ C;  2B3G A;  4A3D G;  4GKK L;  3KUP A;  1KD1 C;  2IX1 A;  3NQT A;  3J81 E;  1HNZ L;  3JAM E;  5EAY A;  4A3K G;  4DV3 L;  3NPP A;  1FJG Q;  3EBE A;  4A3M G;  1HA6 A;  1GOZ A;  3S1Q H;  3A5U A;  4BXX G;  2Y0S B;  1F9P A;  4LF6 L;  1N33 Q;  1LTB D;  3S1M B;  1CQF A;  3DWP A;  4AH6 A;  3J7Z C;  2D0P A;  2E5L L;  3I3C A;  2Q2U A;  2E8G A;  4LF7 Q;  3PMF A;  4QCL A;  1QZH A;  5KEE A;  4PNY A;  1EOV A;  1LTG D;  1W6K A;  5NUC A;  3F2U A;  3D6C A;  2L12 A;  3GTP H;  1E24 A;  3QOJ A;  2MHV A;  3KLS X;  4A3C H;  1AP0 A;  1TS5 A;  1NTG A;  2JXM B;  1U4M A;  3BZC A;  1JWS D;  4DAP A;  4R4T A;  1SMY C;  1LTR D;  5C0X J;  2HCI A;  4IUR A;  4OON A;  2KCN A;  2RCN A;  2RKS A;  4B3T Q;  2WII B;  3VR2 A;  2BE5 C;  1X6O A;  1WOC A;  1RD9 D;  3E9I A;  3K57 A;  2DJG C;  1V1O A;  4HJ7 A;  4NW2 A;  2R7Z B;  2PW5 A;  1QVC A;  2A8V A;  5E1F A;  1A2U A;  1PH5 A;  4APV A;  3K7A H;  2Z1C A;  1Q81 C;  3CPF A;  4KHP L;  3O13 A;  1V1P B;  2PMZ E;  2SEB D;  3MXU A;  4K5V A;  3V96 A;  3STB C;  1IYJ B;  4DFA A;  5IP9 G;  4GNX B;  2Z0S A;  1NUC A;  1EY9 A;  1VS0 A;  4B3R L;  5IOD A;  1E1T A;  4GOP A;  4K2L A;  5HGQ A;  3PF5 A;  1C0A A;  1IBL Q;  1IYU A;  4DXF A;  1JE4 A;  5J22 A;  1ET9 A;  2EJG C;  2KCT A;  1PTO B;  4R8N A;  4JI8 L;  3S14 H;  4X64 Q;  3KLW A;  4FF2 A;  4BA1 I;  1QJO A;  2CVR A;  3E3X A;  2H1E A;  1E22 A;  1I3Q B;  1MJC A;  3T1H L;  1STE A;  4DV7 Q;  1K8G A;  1UE5 A;  3DM1 A;  2F0V A;  2BCO A;  2EYH A;  1PRT F;  3D0F A;  1VQF A;  2VUM B;  1VQH A;  4A3D H;  2M00 A;  2RSO A;  4P75 A;  1L2F A;  2EE1 A;  4LFC L;  5M3M H;  5JJI A;  4KHV A;  1IBM L;  2IPK D;  3PV0 A;  4KTA A;  4A3M H;  5C44 H;  4XQJ A;  4NPS A;  1F2Z A;  3OMG A;  5ISR A;  4UY8 C;  4O42 A;  2R92 H;  3GTL B;  3Q24 A;  1RKN A;  3M7G A;  3MEH A;  3S9W A;  4WJ3 M;  4IZ8 A;  1PFS A;  4DV5 L;  2CH4 A;  3PO3 H;  3IRB A;  2WV6 D;  1X55 A;  2D5D A;  4CKB A;  2TMP A;  2E2H B;  4IJH A;  4IJL A;  2PW7 A;  2VL6 A;  3CQZ B;  2ZTC A;  1VQD A;  2KHI A;  4K6D A;  1O7Y A;  3T51 B;  1AZP A;  4LF8 L;  5LMN L;  2X6G A;  3SK6 A;  2R3Z A;  1PRT D;  4GLA C;  5LMN W;  4NXM Q;  4OWX B;  2NUC A;  4G4K A;  4DR5 L;  2WAQ B;  3MFG A;  3ULJ A;  4DU9 A;  4XIG S;  2V4D A;  4KJO A;  1B50 A;  4DA2 A;  4HCE A;  4CHT B;  5FO7 B;  4OWT B;  4ZRZ A;  3CP0 A;  4JCV E;  1IKL A;  2Y0S E;  4JI5 L;  4DR1 L;  3PIP 3;  4OO1 G;  3CCU A;  4H7B A;  3LX0 A;  4A3L G;  5BN4 A;  1HJP A;  2GVB A;  4A4I A;  1VQL A;  3W3A A;  1N34 Q;  1WCM G;  2D2C C;  5IP9 H;  2JJQ A;  5AJ3 Q;  1NY4 A;  5D3I B;  4AQY L;  4X66 L;  3W2D A;  1PLF A;  1KNA A;  5FK9 C;  1GVP A;  2K5N A;  3G6J B;  1BDO A;  4QL5 A;  2D62 A;  3FKI H;  3RLN A;  5JEA H;  1G6Z A;  4K14 A;  2B39 A;  1B53 A;  1SE8 A;  3I4L A;  5D65 A;  2K05 A;  1VQG A;  4OL7 A;  3A55 A;  4UP9 A;  1R4Q B;  1SNM A;  2AWO A;  2ASB A;  4LF9 L;  4IFD I;  1GM5 A;  1VQC A;  2EY2 A;  5CR3 A;  1PDQ A;  4RWS C;  3CCS A;  3AMU A;  4PMB A;  1I6H B;  1D8L A;  4JI0 L;  2HT1 A;  1B8A A;  2J4X A;  5KRU A;  1H9R A;  2E74 C;  2PQA A;  5EPL A;  1PRT C;  3S1R H;  3RLO A;  4GKK Q;  4JOI C;  2IT1 A;  3BJU A;  4S3S A;  1JOQ A;  1X54 A;  4LF5 L;  3VR6 A;  1KNE A;  3H6M A;  3AFP A;  1XMQ Q;  1VMP A;  1VDZ A;  3MHB A;  3GTO H;  5IT9 E;  2H5X A;  4BS9 A;  4YWL A;  4HMJ A;  2K04 A;  4OHJ A;  4XTC S;  1YHA A;  1Y1W B;  5DM6 3;  1IYV A;  2F0N A;  3C1E A;  2NZH A;  2IL8 A;  3CF5 A;  3MFY A;  3SGI A;  3VYS A;  1HTP A;  2P5Z X;  3KBX A;  1K0S A;  2K6A A;  3S16 B;  2K32 A;  4QY7 A;  2UU9 L;  3HOX B;  2OF1 A;  4RGM A;  2DGY A;  4Q0F A;  1KXL A;  4F7X A;  1EY4 A;  1WTW A;  1PH9 A;  3S1N H;  2BA1 A;  5M9O A;  1JMC A;  5IGE A;  4BA2 I;  5COR A;  4RA8 A;  1ZKO A;  2PCF B;  3U4Z A;  4B3M L;  1JR0 D;  2Q2H A;  4XQQ A;  1GUG A;  5FO9 B;  4FNF A;  2VB3 X;  3Q22 A;  3MVV A;  4KY5 A;  1AFP A;  5DM7 3;  5C4J H;  2IHF A;  3HS0 C;  3PF4 A;  2LXK A;  4OO1 H;  2RF4 A;  3I4M B;  1ZEQ X;  3Q6S A;  4A3L H;  2BOS A;  3NBH A;  3DM3 A;  3TP5 A;  4KHP Q;  3GTQ H;  2JP1 A;  3VR3 A;  1VMC A;  3ZYY X;  3D3R A;  2HD3 A;  3QOL A;  3T4A C;  4FDB A;  4K5X A;  3D6W A;  1ZYR D;  1OXV A;  1Y69 U;  4ZCK A;  1PH1 A;  2IX0 A;  3J81 c;  1FYC A;  4B3R Q;  4YCV A;  2WB1 B;  4A3F B;  4JI3 Q;  1F77 A;  1NJI C;  3A54 A;  1EWI A;  3LWE A;  4MZ9 A;  1N8R C;  2WAQ E;  2UXB L;  2KEC A;  3HOV B;  2M2L A;  1TWA B;  3CCM A;  1K3B C;  2PZU A;  5A35 A;  5CGK A;  4NP5 A;  1AZQ A;  4X62 L;  2N3S A;  1ASY A;  2ATW A;  1AW7 A;  2G9H D;  3MA2 B;  2UUA L;  2XRS D;  2MUY A;  1SNC A;  2K50 A;  5M3F H;  3U50 C;  3GTP B;  3CME A;  3SR1 A;  1XWE A;  1F2L A;  3NTH A;  1AE3 A;  1TR5 A;  4DPG A;  4LJZ C;  2M9V A;  3FEW X;  4GN3 B;  3X3M A;  4IPD A;  3RN5 A;  1DM0 B;  4RH6 A;  4RKL A;  5EGT A;  1L1O B;  3WWV A;  1CSQ A;  4QQB X;  1GHJ A;  4LFB Q;  3HKS A;  4OIJ A;  2RHS B;  3OW2 A;  2UXD Q;  1YNX A;  1M4V A;  1CI3 M;  4OEM B;  1R9T H;  3DEP A;  1GUN A;  3L2P A;  2EYM A;  1YNJ D;  1TWC H;  4K6L A;  1WTR A;  4RKB A;  4R4C A;  1JT8 A;  3HOW G;  1LT4 D;  2E2I H;  2EZV A;  1G2S A;  3L0O A;  3KDF B;  3QIA A;  4OIK A;  2WKC A;  3K7U C;  1LT3 D;  2RCF A;  3ONA B;  1BVS A;  4DV4 Q;  2F52 A;  3I7F A;  4WFN 3;  3HOZ G;  1N33 L;  1RJT A;  1B44 D;  1ZYR C;  1ML0 D;  4HIM A;  4I7A A;  4N9T A;  1BCP D;  2I46 A;  4LF7 L;  3CCL A;  2D0O A;  2F3V A;  4J6H A;  4A76 A;  3CAM A;  4BY1 H;  4JBM A;  3DLL A;  1H9S A;  3KLR A;  1STB A;  2B63 H;  2F0O A;  1SYC A;  2Z4I A;  1OO9 B;  2V1C C;  1HUM A;  1GKH A;  1K83 H;  4BY7 H;  1HQM C;  5GRO A;  1Q46 A;  1B7Y B;  3RD4 A;  2E2J H;  4A3D B;  3ERO A;  2UUB Q;  1ICF B;  3PIO A;  4E6I A;  3KF8 B; 
#chains in the Genus database with same CATH homology
 1J6Q A;  1YIT A;  1OXS C;  4JI4 Q;  1OTC A;  2R7Z G;  1P8L A;  4UP7 A;  4WJ4 A;  4B3T L;  4GN5 A;  4A75 A;  4A3E H;  2K4K A;  1SN8 A;  3ERS X;  3PUZ A;  3H3V H;  3BU2 A;  5GAH C;  1PH3 A;  4C3H H;  1Q1E A;  4X66 Q;  1JE5 A;  5M5W H;  3S16 H;  1X65 A;  3M4P A;  1PH6 A;  2I5M X;  1NBW A;  2K14 A;  4EX5 A;  2JEA I;  2YV5 A;  2OTL A;  2WP8 J;  1PH7 A;  3ICE A;  3M7N A;  4RMF A;  2ZM6 L;  1Q8K A;  3CPW A;  2PI2 E;  1U0L A;  1PA6 A;  4BBS H;  3JAM i;  1YIJ A;  1Q86 C;  1UE6 A;  4DK3 C;  5FLM H;  1FGU A;  1Z47 A;  1K8A C;  2ZTE A;  3NEM A;  1LUZ A;  1K0R A;  5IY0 A;  2UUC L;  3NEN A;  1LYL A;  1WCM H;  3STB D;  3CCV A;  3U4V A;  5C0X G;  5IYC H;  1KQS A;  1SRO A;  2XTI A;  1IBL L;  3GO5 A;  4A93 H;  5E7N A;  3I4M H;  5BR8 L;  1HNW Q;  2B3G A;  3JAM c;  1YJ9 A;  4DAY B;  5IWA L;  2A19 A;  1XNQ L;  4A3D G;  1E7Z A;  1TWF H;  1KD1 C;  4GKK L;  2YYZ A;  2IX1 A;  4DR2 Q;  3GTM H;  1LTL A;  5C3E G;  4DUZ L;  5IYD H;  3S17 H;  1V43 A;  1HNZ L;  5EAY A;  4A3K G;  2YTX A;  4DV3 L;  1S72 A;  1FJG Q;  3EBE A;  4A3M G;  4R1J A;  4A3B G;  4DV7 L;  4IOC A;  4JI2 L;  3S1Q H;  1FL0 A;  3TRE A;  3A5U A;  4A3I H;  4LF5 Q;  2A1A A;  4NB3 A;  3FP9 A;  2VUM G;  4BXX G;  1KAW A;  4JYA L;  4LF6 L;  1W2B A;  2HHH Q;  1N33 Q;  2VQF Q;  1CKN B;  4LUV A;  4AH6 A;  3J7Z C;  1M1K C;  2ES2 A;  1L0W A;  4POF A;  4YHH L;  1HNX L;  2D0P A;  3GD7 A;  4R4O A;  1M90 C;  3RZO H;  2E5L L;  5C4X G;  2Q2U A;  2E8G A;  1V1Q A;  4PZ6 A;  4LF7 Q;  4X6A H;  1QZH A;  3U58 A;  2IHE A;  4JC0 A;  1EOV A;  3CD6 A;  4IPG A;  1A62 A;  3KF6 B;  4GOP B;  1KRT A;  3ER0 A;  4OX9 Q;  3GTK H;  4GLV B;  1IBK Q;  3GTP H;  1N9W A;  1E24 A;  1PV4 A;  1SR3 A;  4JI1 L;  1TWG H;  4A3C H;  1JJ2 A;  2MQH A;  2HIX A;  1BBW A;  1NTG A;  2MFI A;  4KHZ A;  4DAM A;  4JG2 A;  3BZC A;  3CXC A;  3E0E A;  2HIV A;  4R4T A;  2UU9 Q;  5C0X J;  4JI7 L;  1OXT A;  4P72 A;  2ZJQ A;  1VQJ A;  4AIM A;  4OON A;  4JV5 Q;  2RCN A;  1NE3 A;  4DR6 Q;  4B3T Q;  2R7F A;  4PG3 A;  1X6O A;  1WOC A;  3E9I A;  2R6G A;  2JA7 H;  4DR4 Q;  3L7Z C;  4HJ7 A;  2WAQ G;  4LW1 A;  5LMU L;  1PH2 A;  1QVC A;  4POG A;  2A8V A;  1A8V A;  4EQ5 A;  1PH5 A;  2LXJ A;  4ME3 A;  3K7A H;  4APV A;  2F4V L;  1Q1B A;  4P71 A;  1Q81 C;  3CPF A;  4KHP L;  4OWW B;  1X3F A;  2PMZ E;  4YY3 L;  2ZM6 Q;  5M3F G;  5IYB H;  3STB C;  3GDE A;  1IYJ B;  4DV6 L;  5IP9 G;  4GNX B;  1OXU A;  2Z0S A;  1JJG A;  1TWH H;  2R7Z H;  5GAE C;  1VS0 A;  5FLX c;  4H02 A;  4B3R L;  2UUC Q;  1E1T A;  2CWP A;  3KF6 A;  5ELN A;  4C3J H;  4GOP A;  1KC8 C;  5HGQ A;  3PF5 A;  1C0A A;  1H95 A;  1IBL Q;  2KCT A;  4HJA A;  3VDY A;  4DUY L;  1W3S A;  5IWA Q;  3ULL A;  1XNQ Q;  4JI8 L;  3HFZ B;  3S14 H;  4X64 Q;  4B3S L;  3KLW A;  1YJW A;  4DUZ Q;  4HIO A;  4BA1 I;  5GQO A;  2CFM A;  3PGZ A;  1HNZ Q;  1CKM A;  4MNO A;  3M4O H;  1I94 L;  1E22 A;  1S3O A;  4DV3 Q;  5IT9 c;  1MJC A;  1N34 L;  3T1H L;  2JA8 G;  4KI0 A;  4AYB E;  1PH4 A;  3W1B A;  4DV7 Q;  2JEB I;  4JI2 Q;  4X62 Q;  1K8G A;  4LNQ A;  3MEF A;  3RLF A;  2CKZ B;  1VQM A;  1PHJ A;  3K81 C;  4P73 A;  2MNA A;  1UE5 A;  4LUZ A;  2UUA Q;  3KJP A;  4LF6 Q;  3HOY G;  4JYA Q;  4KLK A;  4OXP A;  1IXR A;  1N32 L;  4YHH Q;  1WI5 A;  4DV0 L;  4IPC A;  4HJ9 A;  2E5L Q;  1QUQ B;  3D0F A;  3PUX A;  1I3Q H;  1VQF A;  1VQH A;  3UDG A;  1VQI A;  3KYH C;  3PSI A;  4A3D H;  3AEV A;  2R7D A;  4P75 A;  1L2F A;  5M3M H;  4LFC L;  3FHW A;  2KEN A;  5JJI A;  1IBM L;  3PV0 A;  4GNX A;  1LM0 A;  3GTG H;  1UE7 A;  4A3M H;  5C44 H;  4A3B H;  4JI1 Q;  1NMF A;  3RR5 A;  2OCE A;  4GOP C;  4NPS A;  4JI6 L;  3HKZ G;  4UY8 C;  4GS3 A;  1L1O C;  1HZA A;  1ASZ A;  2R92 H;  3H0G H;  1UE1 A;  4UPA A;  2EIF A;  5GAD C;  3RNU A;  1FVI A;  4BBR G;  2UXC L;  1VQN A;  3HOU G;  1WJJ A;  2L15 A;  4JI7 Q;  3OYY A;  4WJ3 M;  1MJE A;  1PFS A;  4R4I A;  4DV5 L;  3F8T A;  3IRB A;  3PO3 H;  4BY1 G;  5C4X H;  1X55 A;  1VQ5 A;  4IJH A;  1YHB A;  3M9B A;  5JEA J;  4C3I H;  4IJL A;  4JBK A;  2VL6 A;  2B63 G;  4GN4 B;  2VUM H;  2R93 G;  2ZTC A;  3D31 A;  3GTL H;  1VQD A;  2KHI A;  4X65 Q;  4HJ5 A;  4LFA L;  4DV2 L;  5LMN L;  5LMU Q;  4YCU A;  4LF8 L;  3LGJ A;  3I4N H;  3PO2 G;  4GLA C;  5LMN W;  4BY7 G;  2F3I A;  3BZK A;  4NXM Q;  3KFU A;  4OWX B;  1XMQ L;  1Y1W G;  4DR5 L;  3AYH B;  3RN2 A;  2F4V Q;  3PUY A;  1VCI A;  3T1Y Q;  1TXY A;  3ULJ A;  4DV1 L;  1VQ8 A;  4GKJ L;  1HR0 L;  4XIG S;  3CQZ H;  1HR0 W;  2VY3 A;  1QUQ A;  1QVF A;  2AKW B;  3G48 A;  2ZJR A;  1YVC A;  4OWT B;  3UE0 A;  1WFQ A;  2JA9 A;  5DLQ E;  1A0I A;  1Y14 B;  2N49 A;  3F1Z A;  3CP0 A;  3OTO L;  2NN6 I;  3M85 A;  1Q12 A;  4JCV E;  3HOX G;  4GNX C;  1HH2 P;  5IP7 G;  2VNU D;  2NVY H;  3PIP A;  2AWN A;  2Z6K A;  3K8A A;  2Y0S E;  4JI5 L;  4DR1 L;  2JK8 A;  3HOW H;  4JI8 Q;  4OO1 G;  2YTV A;  3TS0 A;  3UDF A;  3CCU A;  3S1M H;  1E3P A;  4BBS G;  3W5O A;  4A3L G;  4GLX A;  1HJP A;  1E1O A;  2VQE L;  3H3V I;  1VQE A;  5FLM G;  1XMO L;  1I94 Q;  2GVB A;  5M5X H;  4A4I A;  2N78 A;  3TEH B;  1VQL A;  4J15 A;  4JOI A;  1N34 Q;  2AMC B;  3T1H Q;  1PVO A;  1WCM G;  4TQU S;  3PCO B;  2BA0 A;  5IP9 H;  2JJQ A;  4A3J H;  1AE2 A;  1UWV A;  3HOZ H;  4A3G G;  1G51 A;  5AJ3 Q;  3CCR A;  1NY4 A;  2KHJ A;  1AH9 A;  3A74 A;  4X66 L;  4AQY L;  1VQP A;  4IFD G;  1EIF A;  3I4M G;  1GVP A;  3I4O A;  3M3Y H;  2K5N A;  2JA5 H;  4L5Q A;  4QL5 A;  4OO1 I;  1XTD A;  4DV0 Q;  2D62 A;  3FKI H;  3I2Z A;  3RLN A;  5IYD G;  1EQQ A;  1VQ6 A;  1KIX A;  1VQB A;  2I5L X;  2RHQ B;  1CSP A;  3CC4 A;  2OWO A;  4LF4 L;  1SE8 A;  4DR7 L;  4QGU A;  4NXN L;  1Y1V G;  1VQG A;  1YZ6 A;  1XJV A;  4UP9 A;  3F2D A;  4LFC Q;  1CUK A;  3A5Z B;  2AWO A;  1IBM Q;  2K75 A;  2ASB A;  1IL2 A;  4LF9 L;  2WB1 G;  4A3F G;  4IFD I;  3EN2 A;  3M4Q A;  1VQC A;  1GM5 A;  2VZA A;  3CCS A;  1Q7Y C;  3MXN B;  5HY6 A;  3PUW A;  2YU9 H;  3S2D H;  3HOV G;  2OQ0 A;  3CMA A;  1D8L A;  3UDX A;  3HOY H;  1HNW L;  4Y52 H;  1N36 L;  4JI3 L;  4JI0 L;  2HT1 A;  4DV5 Q;  1B8A A;  1OXX K;  4DR2 L;  3B6Y A;  1X3G A;  1YHQ A;  2PQA A;  5BR8 Q;  2JA6 G;  3S1R H;  3RLO A;  1RIP A;  4JBW A;  1FJG L;  4GKK Q;  4JOI C;  2IT1 A;  3H15 A;  3BJU A;  4LFA Q;  3KJO A;  4A3C G;  1X54 A;  1YBY A;  5LMN Q;  1WYD A;  4LF8 Q;  4LF5 L;  4QJF A;  3AFP A;  1XMQ Q;  3J7A 5;  4DR5 Q;  2HHH L;  2B29 A;  3I55 A;  4L5S A;  5K36 G;  1RL2 A;  3J80 i;  3GTO H;  4IO9 A;  4DNI A;  4GKJ Q;  1HR0 Q;  3NBH B;  4BBR H;  2H5X A;  2NVQ H;  4YWL A;  4XTC S;  3K0X A;  2KCM A;  4PZ8 A;  1YHA A;  1SFO H;  3UE1 A;  4IOA A;  1HNX Q;  1V9P A;  1Q82 C;  2PNH A;  2NZH A;  3OTO Q;  2Q2I A;  4LFB L;  2YTY A;  3CF5 A;  1DGS A;  3J80 c;  2R93 H;  1G6P A;  1HZ9 A;  4ALP A;  3SGI A;  5C3E H;  2UXD L;  1JB7 A;  1YI2 A;  4JI5 Q;  4DR1 Q;  3PO2 H;  3S2H H;  4A3K H;  1X56 A;  2DUD A;  4C2M H;  4QY7 A;  2CQO A;  2CCZ A;  4HID A;  2UU9 L;  1YEZ A;  5ELO A;  2DGY A;  2EXD A;  4LWC A;  5FJ8 G;  2VQE Q;  1KXL A;  4TVA B;  3RZD H;  1XMO Q;  1VQ7 A;  2ZTD A;  4HJ8 A;  4PZ7 A;  4DR6 L;  4BXX H;  1PH9 A;  3S1N H;  2BA1 A;  4DR4 L;  1K3R A;  1JMC A;  3GTJ H;  2K52 A;  1UEB A;  1EQR A;  4BA2 I;  3S24 A;  2WFW A;  1K9M C;  4AQY Q;  4PMW A;  3I56 A;  3U4Z A;  1B70 B;  2MO0 A;  2N8N A;  2Q2H A;  4B3M L;  1VQA A;  2QGQ A;  3UDI A;  3KDF A;  4YCW A;  1A63 A;  2CWA A;  1HZC A;  3EIV A;  3HOX H;  1XNR L;  1T9H A;  4DR3 L;  1VQ4 A;  5IP7 H;  5H1S E;  5C4J H;  1VQ9 A;  1P16 A;  3ZJY C;  2IHF A;  1X3E A;  2KBN A;  3NEL A;  3TQY A;  3PF4 A;  2LXK A;  2JQO A;  4LF4 Q;  2NN6 G;  2RF4 A;  4DR7 Q;  4NXN Q;  3G4S A;  4DV4 L;  2NVT H;  3J81 i;  1QVG A;  4AYB G;  2I5H A;  4A3L H;  3DM3 A;  1JJC B;  2E2H H;  4KHP Q;  4LF9 Q;  1XPO A;  3GTQ H;  4DK6 C;  2K5H A;  1I5F A;  4YY3 Q;  1I50 H;  4A3E G;  4A3G H;  4DV6 Q;  4FDB A;  1OXV A;  3A0J A;  1SRU A;  4MTN A;  1KL9 A;  4UP8 A;  1YJN A;  1PH1 A;  1S40 A;  2IX0 A;  3J81 c;  4B3R Q;  5JJK A;  2OQK A;  1N36 Q;  1SMX A;  3PUV A;  4YCV A;  4JI3 Q;  2ID0 A;  4JI0 Q;  2MO1 A;  4X64 L;  1NJI C;  3S15 H;  1EWI A;  4MZ9 A;  1N8R C;  5M3M G;  2WAQ E;  2IY5 B;  1SLJ A;  2UXB L;  3F2C A;  1J5E L;  4DUY Q;  2BH2 A;  1BKB A;  1Y1V H;  3CC7 A;  5C44 G;  4Y7N H;  3CCM A;  2PQA B;  3G6E A;  3ULP A;  4B3S Q;  2UUB L;  3TS2 A;  4K0K L;  2EQS A;  5C0X I;  4X62 L;  2N3S A;  1ASY A;  2ATW A;  3F2B A;  2R92 G;  3AQQ A;  3H0G G;  2UUA L;  4JI4 L;  4A3F H;  2WB1 E;  2PI2 A;  5M3F H;  2K50 A;  1C9O A;  3U50 C;  1PH8 A;  1EUJ A;  3CME A;  5IYC G;  3HOV H;  3PO3 G;  2ALY B;  4L5T A;  3E9H A;  3AFQ A;  4A93 G;  1AE3 A;  1TWA H;  3G71 A;  4DPG A;  2JE6 I;  4O2D A;  4GN3 B;  3CW2 C;  4IPD A;  5IE8 A;  1N32 Q;  1VQK A;  2OTJ A;  4P74 A;  3RN5 A;  3CC2 A;  1L1O B;  1HZB A;  1CSQ A;  2LSS A;  3WWV A;  2JA6 H;  3I4N G;  4LFB Q;  1NMG A;  4QQB X;  3J81 j;  3HKS A;  1KHI A;  2GN5 A;  2RHS B;  4R4Q A;  2C35 B;  3OW2 A;  1X9N A;  2UXD Q;  1YNX A;  5J3B A;  4LUO A;  1C7Y A;  1R9T H;  5M5Y H;  2NVX H;  4A3I G;  2XGT A;  3TRZ A;  5GAG C;  1D7Q A;  2JA8 H;  1XPU A;  2VS1 A;  4L5R C;  3L2P A;  2ZJP A;  1CKO A;  1PYS B;  4JI6 Q;  2HQL A;  2Z6K C;  2FXQ A;  1TWC H;  2UXC Q;  4R4C A;  3CCQ A;  1JT8 A;  4B3M Q;  4DKA C;  4X65 L;  5JJL A;  1GO3 E;  1VQO A;  2Y0S G;  1GD7 A;  1QZG A;  3HOW G;  1XNR Q;  4NXM L;  4DR3 Q;  2E2I H;  1IZ6 A;  3CCJ A;  4IPH A;  3L0O A;  1PYB A;  3KDF B;  3T1Y L;  2Q2T A;  1I6H H;  4DV2 Q;  3CCE A;  2I0Q A;  1CKN A;  3Q8D A;  3K7U C;  1BVS A;  4DV4 Q;  2K5V A;  1MKH A;  1O7I A;  2F52 A;  3I7F A;  4YWK A;  4A3J G;  2AHO B;  5FJ8 H;  3HOZ G;  1N33 L;  2VQF L;  1K73 C;  4QIW E;  4HIM A;  3HKZ E;  4YWM A;  4IFD J;  4DV1 Q;  1Z9F A;  4LF7 L;  3JC6 6;  3CCL A;  2D0O A;  2JA5 G;  3HOU H;  1EYG A;  1L1O A;  1EFW A;  2JA7 G;  4A76 A;  2QEX A;  3FKI G;  3CAM A;  4O0A A;  1MIU A;  4HIK A;  3DLL A;  4RG1 A;  4BY1 H;  2NZO A;  4JBM A;  4OX9 L;  5JEA G;  1BBU A;  3K80 C;  1U5K A;  3W1G A;  2BH8 A;  2B63 H;  2VW9 A;  1IBK L;  2UXB Q;  2V1C C;  1EIY B;  1GKH A;  1J5E Q;  1XPR A;  1K83 H;  4BY7 H;  5GRO A;  1Q46 A;  4JBJ A;  1B7Y B;  2E2J H;  1KRS A;  5IYB G;  1Y1W H;  3KOJ A;  2QA4 A;  2UUB Q;  4K0K Q;  2GVA A;  3PIO A;  5AJ3 L;  1G29 1;  4JV5 L;  3KF8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...