1CSPA

Crystal structure of the bacillus subtilis major cold shock protein, cspb: a universal nucleic-acid binding domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
b'MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD SHOCK PROTEIN B(CSPB)
publication title Universal nucleic acid-binding domain revealed by crystal structure of the B. subtilis major cold-shock protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulation
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1993-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1cspA00
3U4ZA 4PMWA 3PIPA 3Q8DA 4AH6A 4HJ9A 1A62A 2R6GA 1KRTA 1VS0A 2JA6H 2LSSA 2UUBQ 1OXVA 1Q8KA 1T9HA 3HOXH 1YHAA 2FXQA 1NE3A 3CMEA 1JB7A 5GROA 2KCMA 5E7NA 2F52A 4A3FG 3K0XA 2B63H 3M3YH 1NMFA 2UXCQ 4L5QA 4X6AH 1KQSA 4JI3L 2AWNA 2JA5H 3S1RH 4DR6L 1FGUA 4DV7L 3A74A 2ZJRA 3ERSX 1KXLA 3CCRA 3KDFA 1WOCA 2PI2A 2JA7H 3RZOH 1HR0Q 4R4IA 1A8VA 1JT8A 3RZDH 4BBSG 1SMXA 2IY5B 1OXUA 4DR1L 2BH8A 3I55A 3RN2A 4A3MH 3H0GH 3CP0A 3M4OH 1X3FA 2AWOA 4P71A 5IYBG 2Q2TA 3MXNB 4DR3L 4DR4L 5H1SE 4YCVA 3S15H 4GKJQ 4JI4L 4X65L 4DR6Q 4DV7Q 1PH4A 2QA4A 2Q2IA 1I94Q 5LMUL 3K7UC 3MEFA 1CSQA 3J81j 5C0XJ 5C3EH 3S16H 2AKWB 1BVSA 2RF4A 2VQFL 2ZM6L 1KAWA 4QGUA 1VQLA 3GTPH 3ER0A 3GDEA 4A3IG 1PH7A 1HNZQ 4HIOA 4LFAL 2IX1A 3TS0A 1L1OB 4YWLA 4A3FH 1VQMA 1XNQL 1YNXA 1TWCH 5IY0A 1TWFH 3BJUA 4IPGA 3CMAA 1IBLL 4X65Q 3HKZE 1HZ9A 4JI5L 3PO3H 4YCUA 3L2PA 2UUAQ 3VDYA 5LMUQ 2Y0SE 4A3LH 1SRUA 4A3BG 3PUZA 4C3JH 5C44H 4AQYQ 1QVFA 1U0LA 4NXNQ 3S1MH 1OXXK 4BBSH 2CQOA 4KHZA 5ELOA 2UXDL 2R92H 1AE3A 4JYAQ 1YJ9A 1K0RA 2K5VA 4HJAA 4DNIA 1RL2A 5EAYA 2YYZA 4LF8Q 4C3HH 5IYBH 4C2MH 2HHHL 3TREA 1CKNA 1Q1EA 4L5TA 2AHOB 4TVAB 4MNOA 2A8VA 5IWAL 2IHEA 2R7FA 3CPFA 1QVCA 4XIGS 2NVTH 1E1TA 2N78A 1N8RC 1HR0W 2ASBA 3T1HL 1C9OA 1QZGA 1E7ZA 4JI5Q 1O7IA 2E2IH 2WB1E 2ES2A 3GTQH 2Q2UA 3T1YL 4GLAC 4LFCL 4DV0L 4QY7A 1S3OA 2ATWA 3HOYH 4JI0L 4A3IH 3G6EA 2UXDQ 5AJ3L 1E1OA 3J7A5 5JJLA 2WP8J 1PYSB 3CPWA 3HOUG 1GKHA 1YZ6A 4IO9A 1G51A 3HKSA 1X56A 3AFQA 3K80C 3BU2A 1SN8A 4DUZQ 1VQOA 2HHHQ 4BY1H 1LM0A 1TWHH 2KHIA 3K8AA 1WI5A 4O0AA 1K83H 3K7AH 1YVCA 1Y1WG 3T1HQ 4BBRH 4QIWE 4YCWA 1YHQA 4LF7Q 1N33Q 4LW1A 4LF9L 1PH2A 4B3ML 4UP7A 1XPRA 4A3BH 1DGSA 4LFCQ 1I3QH 2VUMG 1FL0A 3KLWA 2HT1A 2WAQE 4JI0Q 5GADC 3B6YA 4HIDA 1AE2A 1UE5A 2NVYH 2JE6I 3J7ZC 2VNUD 2B63G 4POGA 3J80i 4JI2L 4A75A 3CCLA 3M4PA 4GOPA 2HIVA 1XMQL 2BA0A 1S72A 4LF4L 1B8AA 1ASZA 4WJ3M 1YIJA 3UE1A 3OW2A 2JA5G 1LUZA 3GTOH 4IFDJ 4NPSA 4PG3A 3UDIA 3CQZH 2UXBL 4IJLA 1CUKA 4B3RQ 2VL6A 3CAMA 3D31A 2MNAA 4Y7NH 2R7DA 2JA7G 1XPOA 4NXML 1Y14B 2NVXH 3HOUH 4A3MG 1TXYA 1V43A 3ULPA 1VQAA 4YHHL 3H0GG 3U4VA 3AFPA 3TS2A 3S1QH 4DV2Q 3RLFA 4JV5Q 1VQDA 2I5LX 1HZBA 4IPHA 2BA1A 4GN4B 3E0EA 3EIVA 4OX9L 1HNWQ 1Y1WH 1JJGA 2RHQB 2E2HH 1VQ8A 1K8AC 3M4QA 1MIUA 3HOZH 4KHPL 1VQFA 1L1OC 4A3JG 1IZ6A 1PH5A 3RR5A 2UUCL 2VUMH 1SLJA 1KL9A 3BZKA 4HJ5A 2VW9A 1N34L 3HOVG 2ZTCA 4R1JA 4YWKA 1N36L 1PHJA 4R4QA 3IRBA 5JEAJ 2I0QA 4K0KL 4P73A 2F4VQ 1SROA 4APVA 2VY3A 3KF6A 4UY8C 5C4JH 3CC2A 2ID0A 2K5NA 4LUZA 4OWTB 3RNUA 1K73C 4BA2I 3S17H 1FJGL 3U58A 2JJQA 1JMCA 4DV5L 3PO3G 1KC8C 2CKZB 2ALYB 1Z47A 4JOIC 3DLLA 2CFMA 4QQBX 5JJIA 4A3LG 1WJJA 2XTIA 5C44G 3CC7A 4FDBA 4DKAC 4JI6L 4A3CG 5FLMG 1VQ7A 5C4XG 1N34Q 2R92G 1L1OA 1B7YB 3GTJH 4OWXB 3E9IA 4NB3A 4PZ8A 4R4OA 1A63A 1VQ6A 4JC0A 1G6PA 4JI3Q 4JI7L 4POFA 3FKIG 3G48A 4DUYL 1I50H 1GD7A 1XMOL 1FJGQ 3GTLH 1VQ4A 1FVIA 2E8GA 1Q86C 1VQ9A 3STBD 3K81C 4A3JH 1L2FA 1VQKA 2JEBI 4B3SL 3PO2H 3WWVA 1EOVA 3HOYG 2MFIA 1M90C 4O2DA 3NBHB 3HOVH 2H5XA 2WFWA 1D8LA 4DR1Q 3PUVA 1EWIA 2AMCB 2NZOA 3W1BA 1PVOA 4R4TA 2ZJPA 3TEHB 3UE0A 5M5XH 1EIFA 2E2JH 4BY1G 4DR3Q 1PH9A 2KENA 2D0PA 2DGYA 4DUYQ 4JI4Q 2EQSA 1EQRA 1HH2P 3RN5A 3I2ZA 4P75A 1UWVA 4BBRG 4JI8L 3CCSA 1MKHA 3A5UA 3S1NH 1NMGA 3KJPA 1X65A 4OXPA 4B3SQ 2VQFQ 1YJNA 4DV3L 4A3CH 5FLMH 1CSPA 1CKOA 5C4XH 2ZM6Q 1X55A 4L5SA 2JA8G 1I6HH 1TWAH 4LFAQ 3ULJA 3PV0A 2UU9L 1XNQQ 4A93H 1YBYA 3H15A 3FKIH 5C0XI 1Q81C 1KD1C 3KOJA 1IBLQ 1X9NA 3CD6A 1J6QA 1SE8A 2VZAA 2CWPA 2LXJA 2JA9A 3JC66 3A0JA 4EX5A 2I5MX 3KJOA 1GM5A 1NJIC 2E5LL 4JBKA 1XPUA 4DV3Q 4JBWA 5BR8L 1Z9FA 1CKMA 3STBC 1RIPA 3UDGA 2GVBA 1HNXL 3KFUA 2LXKA 4KI0A 4P74A 1YEZA 5M3MG 4DV4L 1PFSA 3J80c 2UU9Q 1JJ2A 2MQHA 4GKKL 1IBML 4DV1L 5IWAQ 3JAMi 1UE6A 2VQEL 3CCUA 1VQHA 1X54A 4B3TL 4A3EG 1EUJA 3HOZG 2IHFA 3F2CA 1QUQB 2QEXA 2Q2HA 3T1YQ 1HZCA 4DV0Q 4LFBL 5M5YH 5C0XG 4QL5A 2K5HA 2JA8H 2PI2E 4OWWB 4LF6L 5BR8Q 5AJ3Q 1VQPA 3I4MH 1AH9A 3I7FA 4X64L 2PQAB 5J3BA 3CCJA 3KF8B 4DV4Q 4DV6L 2GN5A 1VQGA 5IE8A 1IBMQ 4IOCA 2NVQH 1LTLA 1WCMH 2NN6I 2GVAA 3S2DH 2OTLA 4LF9Q 1PYBA 4B3MQ 4Y52H 1P16A 2Z6KC 3PUXA 2R7ZG 3CC4A 1Y1VH 4LUOA 4LF6Q 1I5FA 3OYYA 4GN3B 4UP9A 5M3MH 1YJWA 4JI2Q 3BZCA 4DR2L 1XMQQ 2ZTDA 1IBKL 1VQ5A 1V1QA 4LF4Q 3U50C 3AEVA 4A3EH 3PSIA 1J5EL 1N32L 1PH1A 5HY6A 4IJHA 1VQNA 4AYBG 4HIKA 1Q46A 1OXSC 1XTDA 1C0AA 2UXBQ 1E22A 2HIXA 1EYGA 3PO2G 4GNXB 1LYLA 2YV5A 1UEBA 2RCNA 3S14H 1R9TH 2NN6G 4BY7G 4NXMQ 5M3FG 4DR7L 2PMZE 4C3IH 2UUBL 2YTYA 3I56A 1OTCA 5FLXc 4YHHQ 2JK8A 4QJFA 1HR0L 4IFDI 3PUWA 1L0WA 5IYCG 3L7ZC 4OO1G 3EBEA 1IBKQ 1XNRL 1EIYB 5IP9G 4A4IA 4OX9Q 4GOPB 4UP8A 5GAGC 1GVPA 2N49A 1VQBA 5GAEC 2OCEA 1QZHA 4KHPQ 4MTNA 2N3SA 3F8TA 2R7ZH 2C35B 1E24A 2UUCQ 2YU9H 1WYDA 4JBMA 4P72A 1N36Q 3UDFA 4HJ7A 2NZHA 4GLXA 2DUDA 4DR7Q 5HGQA 3PIOA 2EIFA 4K0KQ 3J81i 4A93G 2B29A 4A3GG 3PUYA 2JQOA 4BXXG 1IYJB 4LF5L 3RLNA 1K3RA 3F2BA 2RHSB 1XNRQ 3EN2A 4IPCA 4JCVE 4AIMA 4GKJL 4DV5Q 4A3KG 1C7YA 1I94L 3CCEA 2K75A 4IFDG 3ICEA 5JJKA 5IYDH 2YTVA 4JI1L 4PZ6A 3A5ZB 4DPGA 5LMNL 3UDXA 2F3IA 4X66L 4JOIA 4JI6Q 3KF6B 4LNQA 3GO5A 4BY7H 5M3FH 4WJ4A 1HNZL 3G71A 3GD7A 5IYCH 1KHIA 2BH2A 2D0OA 1BBUA 4HJ8A 2KHJA 3ULLA 5IP9H 4JI7Q 4LF5Q 4RMFA 3OTOL 2B3GA 4YY3L 1XMOQ 1V9PA 5FJ8G 5GAHC 3SGIA 4DK6C 1S40A 3I4NG 1A0IA 4GLVB 1YITA 1UE7A 1QVGA 2UUAL 1IL2A 1Q82C 4JI1Q 2Z0SA 1VCIA 4DAMA 2V1CC 5LMNQ 5DLQE 4AQYL 1H95A 3KDFB 4PZ7A 4NXNL 4X66Q 3HOWG 1X3GA 3CF5A 3CCMA 1PH3A 3AYHB 4JYAL 3I4MG 3M7NA 4A3GH 1Q1BA 4GN5A 4LF8L 2I5HA 1NBWA 5JEAG 1VQIA 4L5RC 1VQCA 5IT9c 3FP9A 4BXXH 2D62A 4R4CA 3JAMc 2R93G 1JE5A 3OTOQ 1WCMG 3H3VH 4YY3Q 4A3KH 1QUQA 3M9BA 3G4SA 3NELA 1VQJA 4JI8Q 1B70B 1U5KA 4X62L 4A3DG 2A19A 4MZ9A 2ZTEA 4H02A 1Q7YC 3F1ZA 4JG2A 3PF4A 1Y1VG 2QGQA 4JBJA 1GO3E 2VS1A 1KRSA 4TQUS 2PQAA 3E9HA 4UPAA 2K4KA 2YTXA 1W3SA 2L15A 4LUVA 1D7QA 1WFQA 2A1AA 3CW2C 3I4OA 4DUZL 1BBWA 2K14A 4GNXC 1MJCA 4YWMA 1W2BA 3NENA 3F2DA 1YI2A 1PH6A 1K9MC 5FJ8H 3GTGH 2ZJQA 3I4NH 4LF7L 1K8GA 1N33L 1JJCB 5ELNA 3TQYA 1X3EA 2E5LQ 4XTCS 4X62Q 4AYBE 1P8LA 3NEMA 2IT1A 3ZJYC 3HOWH 3PF5A 1KIXA 3DM3A 1HNXQ 2XGTA 5GQOA 4GOPC 3PCOB 2KBNA 4KLKA 3M85A 3W5OA 1YHBA 4DR5L 1TWGH 1EQQA 3TRZA 3LGJA 4GKKQ 2JEAI 2R93H 4DV1Q 2KCTA 3HKZG 4IPDA 2VQEQ 1MJEA 3GTMH 1CKNB 2CWAA 2K50A 4B3TQ 5M5WH 4IOAA 1M1KC 2Y0SG 2OWOA 4A3DH 3FHWA 3S24A 5IP7G 1PH8A 4GNXA 2MO0A 4OO1I 4B3RL 4LFBQ 2OQ0A 4ALPA 2OQKA 2CCZA 2K52A 5K36G 4A76A 1PV4A 4DK3C 1OXTA 4X64Q 4HIMA 1HJPA 2JA6G 5LMNW 4DV6Q 3HOXG 3W1GA 2HQLA 2IX0A 4DR5Q 1ASYA 4DV2L 2OTJA 4JV5L 2EXDA 2PNHA 4DR4Q 4DAYB 3AQQA 4LWCA 2WB1G 1HNWL 3CXCA 4GS3A 4RG1A 4EQ5A 1EFWA 5IYDG 3L0OA 3S2HH 1Q12A 3KYHC 4J15A 3CCVA 3H3VI 2Z6KA 1N9WA 1NY4A 1XJVA 1IXRA 3J81c 2N8NA 2F4VL 1G291 3CCQA 3HFZB 4DR2Q 1UE1A 2UXCL 4OONA 1E3PA 3GTKH 1SR3A 1PA6A 3PGZA 3RLOA 1J5EQ 1N32Q 4ME3A 1VQEA 5IP7H 1HZAA 2MO1A 3D0FA 1NTGA 1X6OA 4BA1I 1SFOH 1BKBA 2WAQG 5C3EG
chains in the Genus database with same CATH superfamily
4V0BA 3PIPA 4FXKC 2K33A 2B2VC 2LSSA 1ESFA 2RKSA 4B9XA 1T9HA 1CZGA 2FXQA 5GROA 5E7NA 2LMCB 2UXCQ 4X6AH 1ICWA 5DNFA 4DR6L 3S1RH 1FGUA 2ZJRA 4FF4A 3TSSA 4KMUC 2WINB 4X3SA 2XN9C 2F0DA 3RZOH 1FNUA 1SJHD 4KD4A 4PQXA 3I55A 4A3MH 4FF3A 4KY7A 1A2UA 3CP0A 3BDOA 1X3FA 2D5DA 2AWOA 4C3HG 5IYBG 4DAPA 1SJED 4XQNA 4GKJQ 2QA4A 4EQPA 2CH4W 5LMUL 1I50B 3K7UC 4WRDA 3J81j 1CSQA 1V8QA 3GTLB 4AYBB 2VQFL 4OGQC 3LWEA 5T1GA 1L1OB 4PMCA 4KKUA 3K5MA 1UUPA 1R4QB 3C1EA 3GV6A 5BN5A 4X65Q 2E2JB 3PO3H 4U68A 3J81L 2OF1A 3L2PA 2UUAQ 2PZWA 5EKLA 2Y0SE 5NUCA 3S1MH 3S1NB 1K3BC 1OXXK 3QG1A 4EQOA 2UXDL 3MZ5A 1GHJA 1K0RA 2A73B 4KY5A 1RL2A 4LF8Q 4C3HH 5IYBH 4X3UA 1SBBB 2AHOB 4MNOA 4NP5A 1HUNA 2R7FA 1E1TA 5IGCA 3UI2A 4ZUJA 4JI5Q 3NQTA 4CDFC 1B53A 3HOYH 2I46A 3W2DA 1CQFA 4QCLA 3IL8A 3M4YA 5JJLA 1VDZA 3CPWA 4IO9A 4MIUA 3K80C 3AFQA 4DUZQ 1EFID 2G5DA 1LM0A 2EYLA 5KNBA 1PTOD 1K83H 1I4PA 3T1HQ 4BBRH 4LW1A 4LF9L 1PH2A 4UP7A 2SEBD 3I4NB 1I3QH 2F0MA 4JI0Q 2E76C 3B6YA 4JW0A 3T56B 2MUYA 3J7ZC 3J80i 3CCLA 4MTKA 4GOPA 3I4MB 1GXDC 1ASZA 5EPKA 3OMGA 4WJ3M 2JA5G 4KK7A 4C1NK 3GTOH 4OIJA 1B44D 4IFDJ 1HCZA 4NPSA 4PG3A 3UDIA 1CQVA 4B3RQ 1IL8A 1KABA 4N9PA 3T13A 4F8MA 1Y14B 3DWAA 1V43A 1VQAA 4G7OC 4B08A 4N9TA 3MA2B 5EGTA 4R8NA 2H1EA 2I5LX 4IPHA 2BA1A 4OX9L 3EIVA 3TMEA 5J39A 4G57A 4KHPL 3LX0A 5KEEA 1IZ6A 4KV6A 2ICEC 5C0XH 2QCPX 1KL9A 3BZKA 5C4HA 4JPBW 3OMCA 2Z4IA 5FO9B 1PHJA 2JSOA 4K0KL 5KYIA 4P73A 3HGBA 3MXNA 1HRJA 1SROA 4RAUC 3CC2A 4C3IB 2NB0A 1STEA 5I9PA 2JJQA 5LL6X 3EJIA 3DLLA 4CKBA 4A3LG 2B2TA 4HMJA 4JI6L 5FLMG 5C4XG 4N8X1 1N34Q 1B7YB 1RD9D 2R3ZA 4R4OA 1MSHA 3VA5A 1ESRA 3H3VC 3FKIG 2MGSA 1I50H 3GTLH 3V2TA 1Q86C 1L2FA 1VQKA 2JEBI 2O2LD 3MXUA 3WWVA 2MFIA 2EOTA 1EIGA 4XQQA 3NXWA 3PUVA 1B4OA 2NZOA 3SK5A 4BY7B 1PTOB 1EIFA 2E2JH 1C8CA 2XWBB 1SE4A 3BG3A 3H6MA 3RN5A 1BNZA 1D1IA 1IW7C 3A5UA 3S1NH 1U9RA 4QIWB 1PDQA 3KJPA 1EY0A 1X65A 3S15B 4OXPA 2VQFQ 1GUGA 3ERQA 5FLMH 5C4XH 2B2YC 2JA8G 4IUUA 2WAQB 2A74C 3PV0A 3MC0B 1QB5D 1QILA 1S5FD 1QG7A 2FMCA 3FKIH 5D3DA 4M8AA 2E75C 5CV4A 2CWPA 2Q8IB 2JA9A 2FJ2A 4XYOA 1GM5A 5FLXL 4A3KB 4K6DA 1XPUA 4DV3Q 1ET6A 2EYJA 2NTSA 5BR8L 2O5IC 1RIPA 2GVBA 4C3JB 1YEZA 4DV4L 1G2SA 2QF7A 3OW7A 1JJ2A 3KLSA 1VMCA 1IBML 4DV1L 3D3RA 1SAPA 2EE1A 2RVLA 1VQHA 2PW5A 1SNDA 1ILQA 1KDAA 3U9OA 1ML0D 2BE5D 1HZCA 2K05A 1X32A 2CHBD 2K5HA 2JA8H 4OWWB 1H9MA 3I4MH 3HOWB 3I91A 5IGEA 2EPBA 2QILA 3KF8B 4DV6L 4KJNA 5G3LD 4G4KA 2NVQH 1LTLA 2NN6I 3KBGA 3R2IA 1EY4A 5I6WA 1STHA 3FPUB 4LF9Q 4Y52H 3TP6A 5CV8A 1YNNC 3PUXA 4A3DB 4J1MA 1SYGA 4KHVA 1B9MA 4DA2A 4DR2L 5KRUA 3AEVA 3E6ZX 1VQNA 4HIKA 3BYTB 1C0AA 3IFDA 1MGSA 1EYGA 2KECA 4DU9A 1O80A 3SR1A 3CQZB 2NN6G 4BY7G 4RKLA 4C3IH 3I56A 3MEHA 4RHRA 5FLXc 4IFDI 2JK8A 2A6ED 3L7ZC 1IBKQ 5IP9G 4A4IA 4DN4M 1BXTA 4OX9Q 2K1BA 3TZUA 5GAEC 3S1QB 3GTKB 4KHPQ 2N3SA 5I2YA 4V190 2TSSA 1E0BA 2C35B 5FLXE 1WYDA 3UDFA 4HJ7A 1JB3A 2DUDA 4K0KQ 1EY5A 3J81i 2B29A 2EJFC 4LF5L 1XNRQ 2RHSB 3K5LA 4XXEA 2B63B 2VB3X 1WD0A 4A3KG 2QDBA 1C7YA 1F2YA 2K03A 1I94L 4ZAIA 2K75A 4IFDG 5JJKA 1RDPD 3A5ZB 3FVQA 1HUMA 1QCBD 5KGUA 2F3IA 4X66L 4G7ZC 4JI6Q 4LNQA 4BY7H 3ZYYX 1PTOH 1XTCD 3HP3A 1HNZL 3G71A 2BH2A 1D5MC 2D0OA 1STGA 5IP9H 3OTOL 3H0GB 1E2ZA 5GAHC 1S40A 1F2ZA 4O42A 1UAPA 2Z0SA 1VCIA 1SNCA 1H95A 1E2VA 3HOWG 1GJXA 5CBAE 4A3JB 1VF7A 3S16B 4JYAL 4CBVA 1KLUD 2HCCA 1FD7D 1FR3A 3FP9A 2HCIA 3L3OC 3TP5A 1HFGA 4A3KH 1QUQA 1DCZA 2F0VA 2IW3A 1WTHA 3J7YW 3R2TA 1TWFB 4A3DG 3Q0AA 4MZ9A 4H02A 4JVZA 3RD4A 1Y1VG 4TQUS 1GO3E 1SSOA 5C44B 2XSCA 2EZVA 4DNTB 3IAYA 1XX8A 2K14A 1DZ1A 1KNAA 1YI2A 1EQVA 4LF7L 1N33L 1TS4A 2NVTB 5ELNA 4XTCS 5EPJA 2N55A 3ZJYC 3HOWH 2HD3A 1VMPA 5D14A 1BCPD 2QDLA 3D6WA 3PCOB 2KBNA 4KLKA 3Q24A 5FKAC 3W5OA 3VYUA 3QR8A 1EQQA 3TRZA 1X3QA 1ZXTA 2EYFA 2JEAI 4DV1Q 3CKIB 2KCTA 4IPDA 1D5XC 2K50A 2B8FA 4BY1B 2BDOA 4A3DH 1TVXA 1PH8A 1KLGD 2F0TA 2CCZA 2OQKA 2LY7A 3A8JE 2EYMA 2JA6G 3KLSX 4DV6Q 3HOXG 2HQLA 2RDHA 1QOHA 2NVYB 3FRPB 2M2LA 2PNHA 2IWHA 5CMDA 4DAYB 2WB1G 1HNWL 3CXCA 4ME5A 3PIO3 2K7VA 3L0OA 5IT9L 5EJWA 5IYDG 2A69D 2K28A 2A68D 4TSSA 3KYHC 1PRTD 2ZT9C 3H3VI 1CTMA 1N9WA 2F0JA 1NY4A 3VR2A 2N8NA 4OEMB 2F4VL 4DR2Q 2UXCL 2KVMA 3GTKH 2NVXB 2B39A 3RLOA 5IIFA 4A3EB 1Y1WB 1PYWD 3HOZB 2QW7A 5C3EG 2HDLA 4AH6A 4HJ9A 1A62A 1AN8A 2LS01 2IL8A 1VS0A 4Q5VA 2JA6H 2VUMB 1OXVA 3HOXH 3CMEA 1NE3A 1JB7A 2B63H 1DYQA 1LTTD 4DGZA 3MFGA 1NMFA 4L5QA 4IUPA 3DHQA 3S17B 3SK6A 3MWYW 5DEHA 2PI2A 2PQEA 1A8VA 3DWQA 4BBSG 1SMXA 2CW0C 2IY5B 4DR1L 3H0GH 2A6HD 4P71A 5F2DA 2Q2TA 4FYDA 5H1SE 4YCVA 2F3VA 1MBYA 4X65L 1ICFB 4DV7Q 1PH4A 2H4OA 1M4VA 2Q2IA 1I94Q 1PFMA 1IKMA 5FO7B 3MEFA 5C0XJ 1EIHA 5C3EH 3S16H 2RF4A 4K2KA 1KAWA 1A3VA 4QGUA 1EWHA 1VQLA 2IX1A 1HNZQ 3PO2B 4HIOA 3TS0A 3HOVB 5IOCA 1YNXA 1TWCH 2XNAC 5IY0A 1TWFH 3BJUA 4IPGA 1AP0A 5M5XB 1IBLL 3HKZE 2C5CA 4JI5L 4H44C 2RA4A 1ZYRD 1IYUA 5C44H 1QVFA 1K28A 4BBSH 2CQOA 4JYAQ 4QMGA 1YJ9A 3O13A 2K5VA 4HJAA 4RCNA 4RA8A 5EAYA 1I6VC 5EKIA 1TWAB 5L37A 1CKNA 3VYSA 2NVTH 5IWAL 2IHEA 3CPFA 4XIGS 2R61A 5AFWA 1N8RC 1B2TA 1B50A 3T1HL 1C9OA 1QZGA 1O7IA 2ES2A 1PRTB 3L9AX 4DV0L 4QY7A 1S3OA 2EY6A 2DN8A 4JI0L 1V1PB 2K01A 5AJ3L 1E1OA 5CR3A 1PYSB 1GUTA 3DEPA 2X6GA 5E3FA 5KNCA 3BU2A 1SN8A 1VQOA 2HHHQ 4BY1H 1I4XA 4FNFA 1U4PA 4O0AA 3EA6A 1Y1WG 1YVCA 4LF7Q 1N33Q 1QE6A 1LTBD 4B3ML 1MD2D 1DGSA 2SNSA 2VUMG 1EY7A 1U4MA 4KN4C 2NVYH 1XWEA 4POGA 3DEOA 3M4PA 2HIVA 4LF4L 1YIJA 4XT3B 1KAAA 3K0YA 1CUKA 2VL6A 3D31A 3S2DB 1XPOA 2NVXH 4A3MG 3HRZC 4YHHL 4ZQ3A 3RLFA 5M3MB 1B3QA 5BN3A 3E0EA 1HNWQ 1Y1WH 1JJGA 2B2TC 1VQ8A 3HOZH 1MIUA 2KA7A 4RWSC 1PH5A 3QB3A 4E6IA 3ND8A 2UUCL 2VUMH 1EEFD 4KN7C 4U673 1N34L 3HOVG 4R1JA 4YWKA 4CDEC 1F2MA 2ZXOA 1VF5C 3IRBA 5JEAJ 2F4VQ 3S14B 5E4XA 4APVA 5JJIA 1MSGA 2VY3A 2G9DA 1SYEA 4UY8C 2DNEA 3PMFA 4OWTB 1K73C 3S17H 2QEJC 3DWPA 1RCVD 1JMCA 1SNOA 2J0TD 3PO3G 2CKZB 3TDQA 4KKSA 5ISRA 3P20A 2Y0SB 3NTKA 4FDBA 1AW7A 1L1OA 3F2UA 3GTJH 4NB3A 4RFBA 2HUGA 4JC0A 1G6PA 4JI7L 2IX3A 1CFMA 4CJ0B 1GD7A 1H9SB 1RHPA 3STBD 2WIIB 3K81C 1F9PA 2AUKA 2RDFA 3PO2H 4HTHA 3K6OA 3HOYG 1QNKA 4O2DA 3NBHB 3HOVH 4OIKA 3CU7A 2L12A 2WFWA 4DR1Q 3URYA 1I4HA 4ZK9B 3W1BA 4R4TA 4RCOA 3TEHB 2ZJPA 5M5XH 1TY2A 2D0PA 3KBXA 2DGYA 1STYA 1EQRA 1HH2P 2XVSA 1SYBA 1UWVA 1YNJC 4BBRG 4B3SQ 1YJNA 4DV3L 2RSOA 3GV3A 1II3A 3K5OA 4HMIA 3R8BA 1TWAH 3ULJA 2B8GA 1NSNS 3H15A 2MP1A 5C0XI 4A3FB 1IBLQ 2VZAA 2LXJA 4EX5A 5CYUA 3ND9A 1SE3A 5JPMC 4JBWA 4IUVA 1Z9FA 4C1NI 2LXKA 2HQEA 5M3MG 1PFSA 2MQHA 3K57A 5IWAQ 3CCUA 1X54A 4B3TL 2MJ8A 1U4LA 3VR6A 2IHFA 3F2CA 2QEXA 3GTGB 2AQ1B 2Q2HA 4IUQA 4Q0FA 4DV0Q 4LFBL 3TP8A 5C0XG 1H9RA 1Y8PB 1A15A 3GTQB 5AJ3Q 1B3AA 4K8IA 2PQAB 5J3BA 5TSSA 4A3IB 1DOKA 1VQGA 1ZEQX 1LABA 2L11A 5IGBA 1TS2A 4FXDA 2R93B 3X3MA 2RBMA 3S2DH 4B3MQ 2JN4A 5M5WB 4GZYC 1NUCA 1TIID 2Z6KC 1TU2B 5D65A 4TRDA 4LUOA 5CV7A 1PFNA 4LF6Q 4A3BB 4UP9A 1EQTA 5M3MH 3OSOA 4CKCA 1SE2A 4Z9CB 1PZJD 1IBKL 1V1QA 4LF4Q 4K5WA 2B2WC 3PSIA 1J5EL 1N32L 4IJHA 4AYBG 1Q46A 1EWCA 1XTDA 1OO9B 2RCFA 4I7AA 4ID6A 1E22A 3A55A 4IN3A 4X3TA 4GNXB 5C3WA 1LYLA 1HXYD 2YV5A 1UEBA 3S14H 1C48A 4J8QA 2PMZE 2BE5C 1OTCA 4YHHQ 4OO1G 3PUWA 1H9JA 4J6HA 1XNRL 1EIYB 2DNCA 2Z6BA 1KDCA 4GOPB 1GVPA 3QIAA 2UUCQ 1SFOB 1EU3A 5I9OA 3PUYA 3SDZA 1IYJB 2PYKA 3RLNA 1K3RA 3EN2A 5KNDA 3CCEA 3ICEA 2YTVA 2LKVA 3UDXA 4FO2A 5T1IA 1K0SA 3KF6B 1D2BA 2JA7B 3H91A 4OO1H 3RZDB 2ICIA 2KHJA 3ULLA 3A8IE 4JI7Q 2B3GA 1S5CD 4ZKCB 1V9PA 2K5DA 3SGIA 2A6EC 3I4NG 1A0IA 1YITA 1Q82C 4JI1Q 4AQYL 1WTVA 2V1CC 5DLQE 3KDFB 1X3GA 4DF7A 1PH3A 3OHXC 3I4MG 1EY8A 3M7NA 3T4AC 2I5HA 1NBWA 1SNPA 1VQIA 5JEAG 4L5RC 2Q8RE 2O4XA 2D62A 4R4CA 3JAMc 2R93G 4YY3Q 5ELEA 4LK1C 4ZUIA 3SXHA 1IHZA 2MHVA 2PO4A 2ZTEA 4K2LA 4RGNA 1F77A 2VS1A 3E3XA 1KRSA 1F2LA 2D9UA 2L4NA 3KF8A 3MXGA 5G3LF 3JAME 3NBIA 1GUWA 1W3SA 3QOLA 4LUVA 2R92B 5EQ0A 1JCKB 2A1AA 5EPLA 1D7QA 1BBWA 3GTGH 1PH6A 1K9MC 4C2MB 2ZJQA 3I4NH 5COYA 2SDFA 3NEMA 2IT1A 2XRSD 4DK1A 3PF5A 2E2IB 1LLRD 3VYTA 1QJOA 2XGTA 4C3IG 3M85A 5JEAH 3C2PA 4LMQD 2DY7A 2R93H 1JWMD 5KIXA 2CWAA 4B3TQ 5M5WH 1D5ZC 3V96A 1TWHB 3GQBA 2IPKD 1SYCA 3TN2A 4LFBQ 3IFTA 4ALPA 3DMUA 4IURA 3BDCA 4A76A 1PV4A 4I7ZC 4PMBA 1OXTA 4HIMA 5CV9A 2IX0A 2BDNA 4DR5Q 3BVZA 2AQ3B 3V05A 2OTJA 4FXGC 4CDCC 3K5NA 2FINB 3MHBA 4GS3A 2KCCA 3MAQA 2N88A 1DM0B 3D4DA 2XRQD 2Z6KA 4PV1C 3ONAB 1G291 3LNNA 3CCQA 1UE1A 4OONA 3HOUB 1PA6A 2SNMA 3PGZA 1BCPC 1J5EQ 2F0KA 1N32Q 1HZAA 2B2WA 3D0FA 1NTGA 4BA1I 4BS9A 1SFOH 4FF2A 2PPBC 2E2HB 2WAQG 3Q8DA 3BVGA 2AQ2B 1BO0A 1YHAA 3K0XA 2XIWA 3R93A 1SMYD 2AWNA 3SEBA 4EVOA 4DV7L 2HDMA 3CCRA 1EL0A 4C3JG 2JA7H 2EY5A 1D6EC 1JT8A 3RZDH 1NR4A 1S5ED 2BH8A 3RN2A 1NAPA 2DJFC 2A68C 1WTRA 1PRTC 3S15H 3P75A 1BQQT 4JI4L 1TY0A 3R3OA 4DXGA 2ZM6L 2J4XA 4X3KA 1RODA 3J7AV 4LFAL 4YWLA 1XNQL 4IQZA 2KEDA 1EYAA 1A3UA 1LT4D 2RDGA 1EYDA 1HZ9A 3NUCA 4ZYSA 4YCUA 4CJ2C 4C56C 1BCPF 4C3JH 4AQYQ 4KHZA 5ELOA 1CHQD 2F0WA 2R92H 1AE3A 1CT1D 4F7XA 2C9OA 1I6HB 1MI2A 4C2MH 2HHHL 3TREA 4L5TA 3KUPA 4TVAB 4A93B 1HTPA 1QVCA 1BDOA 2N78A 3FMCA 2X69A 3BYYB 5CGKA 2ASBA 1E7ZA 2E2IH 2WB1E 1FNWA 2A6HC 2Q2UA 4DXFA 2VB2X 2Z1CA 4GLAC 5A35A 3Q22A 4ZRZA 3H94A 1PFBA 3G6EA 2NTTA 4UDUC 3HOUG 4OELB 1YZ6A 1G51A 1X56A 4H0LC 4DAYA 2KJXA 1TWHH 2KHIA 3K8AA 3VR5A 1WI5A 1YHQA 4YCWA 5JVH3 3NPPA 2EYPA 5JAVA 1PRTF 4K5XA 4LFCQ 3WOFA 5C6AA 1FL0A 3KLWA 3D4WA 1ZYRC 4HIDA 5CC4A 5M5YB 1UE5A 1CZWA 2JE6I 2B63G 4JI2L 1GOZA 1AH9A 1S72A 2BOSA 2CH4A 1WTXA 3UE1A 5I2XA 1STAA 5I4DA 4BWGB 3CQZH 3GTMB 4IJLA 1WCMB 3CAMA 5DAUA 4WORA 2MNAA 2R7DA 1LTGD 4NXML 4LAAA 3HOUH 1TXYA 3ULPA 4FP5D 2F0LA 3H0GG 3TP7A 3S1QH 1PZID 1ZKOA 1M8AA 2F03A 1VQDA 1HZBA 4GN4B 3BZDB 4K6LA 1Q3LA 2RHQB 2E2HH 4F88A 3A8KE 1GUOA 1L1OC 1VQFA 1HQRD 4A3JG 3RR5A 4CJ1B 1SLJA 4HJ5A 2ZTCA 4QUCA 2RSNA 3DUZA 3SE0A 2NUCA 5IGFA 1MHWC 1BR9A 4IOAA 2ID0A 2K5NA 4LUZA 3RNUA 5KYLA 3U58A 2F0NA 1KC8C 3HKZB 1SYDA 2ALYB 1Z47A 4JOIC 4QQBX 2L0CA 4CKEA 5DM63 5C44G 2L5TA 4YIJA 1CHPD 2GA4B 1VQ7A 2R7ZB 3BS1A 4OWXB 3E9IA 2YU9B 4PZ8A 4ZCKA 3A7LA 3BVMA 1A63A 3CRKC 1JWUD 1VQ6A 2KCNA 3G48A 4HAEA 1XMOL 1FJGQ 1VQ4A 2E8GA 1HQMC 4A3JH 4B3SL 4ZLTF 1EOVA 1M90C 5CORA 1AZPA 1TR5A 1PVOA 3RZOB 5M3FB 1SDFA 3UE0A 2EY2A 4BY1G 1PH9A 4WJWA 4DUYQ 1BF4A 4JI4Q 1ONLA 1RTOA 1LTID 3NK9A 2KEEA 1MKHA 1SEBD 4QF4A 2PZUA 4JI8L 3CCSA 1HA6A 1G2TA 3I8ZA 1JOOA 1V1PA 2ZM6Q 1CSPA 1CKOA 4L5SA 5CV5A 1I6HH 4LFAQ 1Q90A 4K8JA 1XNQQ 4A93H 1YBYA 5M9OA 1EOTA 2RQXA 1Q81C 4A3GB 3Q6SA 2ZXRA 3KJOA 4HEDA 4JBKA 3A0JA 2I5MX 2E5LL 3D6CA 2V4DA 3NWSA 2OEOA 5A2QE 4DNRB 1CKMA 3STBC 1HNXL 2LFNA 4KI0A 1T5XD 1JC7A 4P74A 2UU9Q 3J80c 4GKKL 1UE6A 5BN4A 4A3EG 1EUJA 2ZXPA 3HOZG 3SVMA 3OWEB 3NP8A 1LO5D 2F0GA 5M5YH 4QL5A 3J80E 2PI2E 4LF6L 3I72A 2K32A 1VQPA 4X64L 3K59A 5IE8A 4IOCA 3D8GA 4K14A 1WCMH 1TWGB 2J7ZA 1A3TA 2OTLA 1L0YB 3P7JA 1P16A 1JQYD 4QB4A 2R7ZG 1Z6HA 3CC4A 4EQNA 4F87A 1I5FA 3OYYA 4GN3B 2EY1A 1PMRA 2F0OA 4UHVA 4JI2Q 3BZCA 2K04A 4OHJA 2ZTDA 1JOQA 1VQ5A 3MVVA 2NYZD 4A3EH 1PH1A 1OXSC 1TQOA 5E1FA 2HIXA 3PO2G 1PTOC 1GUSA 2RCNA 4NXMQ 3A54A 5M3FG 1F9SA 3S2HB 2DY8A 4G7HC 2YTYA 2UUBL 1HR0L 1L0WA 5IYCG 2KUMA 4OL7A 3T51B 1EYCA 4RKBA 1CI3M 4UP8A 1T5EA 1VQBA 4MTNA 3W3AA 5C5LA 3F8TA 2R7ZH 3NBHA 2D2CC 2YU9H 2B2UC 5K36H 3S9WA 4GLXA 4DR7Q 5HGQA 4RHSA 4A3GG 2JQOA 1I4RA 3N52A 2F3WA 3M3YB 4IPCA 4M1UB 5D3IB 4AIMA 1S5DD 2JA5B 5C4ZA 4JI1L 4PZ6A 2M9VA 1DOLA 2M00A 4JOIA 5EBDA 3GO5A 3QJYA 5M3FH 4WJ4A 5IYCH 1BBUA 4HJ8A 1RF2D 1H9KA 4RMFA 2EJMA 2X6LA 3PQIA 4YY3L 1XMOQ 3M4OB 1IKLA 5FJ8G 1CA6A 4GLVB 1UE7A 1FGBD 1SYFA 1AZQA 1UEAB 4DAMA 5LMNQ 2CQAA 4PZ7A 4NXNL 1TKWB 3CCMA 2NBFA 3AYHB 5ELDA 4A3GH 1Q1BA 1PTOF 1I4QA 4GN5A 2MPMA 3GTPB 1VQCA 3OWFA 2E2DC 4L8JA 3SHLA 2F0EA 1L0XB 4DK0A 3NELA 4JI8Q 1GHKA 1V1OA 2KOLA 4FF1A 1FNVA 4I65A 4JG2A 2QGQA 5FK9C 3EROA 2PQAA 1G6ZA 2K4KA 5C4XB 2DJGC 3I4OA 1MJCA 4YWMA 4KY6A 5FJ8H 2F0FA 1JJCB 3FKIB 4TKOB 3TQYA 2E5LQ 4X62Q 4AYBE 1P8LA 4L63B 1C4QA 2L1BA 1KIXA 1TS5A 3DM3A 2EVBA 1HNXQ 1S4ZA 5GQOA 2PMZB 1ILPA 1YHBA 4DR5L 1TWGH 5K5PA 4GKKQ 1M1KC 2Y0SG 1JE4A 1DONA 1G8ZD 4WFN3 3LWUA 2L9HA 3VYRA 2MO0A 4EGVA 4GNXA 4OO1I 3K7AB 2IJ0A 3EFXD 4RGMA 4X64Q 2Z4HA 3DXJC 4IUTA 5LMNW 2I07B 2JA8B 2JP1A 2WV6D 1ASYA 4DV2L 4JV5L 2EXZA 4DR4Q 4LWCA 1O7LA 1EFWA 3OOCA 2NVQB 3S2HH 4NDXA 3JAML 1Q12A 4J15A 4Y7NB 1IXRA 3J81c 3E5SA 4XT1B 4FVMA 3HFZB 1QNUA 2NZ1D 1SR3A 3FDTA 1VQEA 4JK1C 1X6OA 1JOKA 1BKBA 3KF6A 3U4ZA 4PMWA 3J81E 2R6GA 1KRTA 3QO2A 5CBEE 2JXMB 2UUBQ 1Q8KA 1LTSD 3SK4A 1HR0Q 3M3YH 1Q8IA 2KCMA 2F52A 1YNJD 3Q23A 4A3FG 1KQSA 4JI3L 4PNYA 2JA5H 3A74A 5C4JB 4ZKBB 1QWYA 3ERSX 1UNSA 1KXLA 2K5QA 1RTNA 5JVG3 3KDFA 1R4PB 1WOCA 1B9NA 5FOBB 2EYOA 4R4IA 4CDDC 2PNRC 2F0HA 1OXUA 2B2UA 1SNQA 3M4OH 2B2VA 3MXNB 3T53B 4DR3L 1SNMA 4DR6Q 1LT3D 1K8OA 2AKWB 1BVSA 1LV9A 1JICA 3GTPH 3ER0A 3GDEA 4A3IG 1PH7A 1HHVA 2F0PA 4A3FH 1VQMA 2AUJD 4CHTB 1DOMA 1X3PA 3VA7A 3CMAA 3VDYA 5LMUQ 3NTHA 4A3LH 1SRUA 4A3BG 3PUZA 1KNEA 1SMYC 1U0LA 2EJGC 4NXNQ 1A6XA 2QKIC 1BBXC 4HCSA 4DNIA 3C3LA 2YYZA 1LTAD 1Q1EA 2A8VA 4HCEA 3ITPA 1IYVA 1S5BD 1HR0W 1ET9A 3WOEA 3GTQH 3HS0C 3T1YL 4LFCL 2ATWA 2KHSA 1LT6D 1EEID 4A3IH 2UXDQ 1BUVT 3J7A5 2WACA 2G9HD 2WP8J 5IODA 5J22A 1GKHA 3HKSA 5JJZA 5HGTA 4QUFA 4KTAA 4UAIA 2FHTA 3K7AH 4QIWE 5E4WC 3P1HA 4A3BH 1XPRA 1JWSD 1CM9A 4H7BA 3CHBD 2HT1A 2WAQE 1Y69U 5GADC 1AE2A 2VNUD 5CV6A 4A75A 1XMQL 2BA0A 1B8AA 3N6RA 3OW2A 3CRLC 4LJZC 1LUZA 3A56A 2UXBL 3EVQA 3NQIA 5IGDA 4Y7NH 1EU4A 2JA7G 4IUNA 1RJTA 1Y1VB 1EZ8A 3C1FA 4KD3A 3K58A 3U4VA 3AFPA 3TS2A 3X3NA 3BDLA 3E0JA 4DV2Q 4JV5Q 3VR3A 3H09A 1STBA 4DAVA 5ELCA 1K8AC 3M4QA 3KLRA 1CA5A 4ODGA 2VW9A 4MHEA 1SXTA 3FEWX 4R9WA 1N36L 4R4QA 2I0QA 4P2CB 1R9TB 2A5HA 1RKNA 1IW7D 2NWGA 5C4JH 4BA2I 2PZTA 1FJGL 5DM73 4MN3A 4DV5L 1AEXA 1LT5D 2CFMA 1Y8NB 1WJJA 2XTIA 3DM1A 3CC7A 1F9QA 2EDGA 4DKAC 4A3CG 3RUZA 2VXWA 3MTSA 2R92G 4XQJA 2F1MA 2A69C 2JA6B 4JI3Q 4POFA 4CGYB 4DUYL 3T16A 3HOXB 3FPPA 1EY6A 3I3CA 3C46A 1FVIA 4RGOS 1VQ9A 2PW7A 2WB1B 2WKCA 2NN6H 1HFNA 2H5XA 1D8LA 1ENAA 5ELBA 1EWIA 2BCOA 2AMCB 3NSWA 1F9RA 1NNXA 3MFYA 3OIQA 4NMZA 4DR3Q 1NCVA 2KENA 3A7AB 2JYOA 2EQSA 3I2ZA 4P75A 1NMGA 3TZDA 4A3CH 1X55A 1E2WA 5C3EB 3D4RA 3AMUA 2UU9L 4ULLA 1B1ZA 1STNA 2L55A 1YNND 1KD1C 3KOJA 1X9NA 4HR7B 1TWCB 3CD6A 1J6QA 1SE8A 3JC66 3QOJA 1LTRD 1Z7TA 4IFDH 1NJIC 1JORA 2CVRA 3UDGA 1HA5A 1BOSA 3KFUA 5LL6S 4ABNA 2B2YA 4BBSB 5LHY1 3JAMi 2VQEL 1W6KA 1QUQB 3T1YQ 3QWNA 3GP7A 5FO8B 5BR8Q 3NWTA 1FYCA 1KTKA 2K6AA 3G6JB 3I7FA 1WTQA 3CCJA 3HZXA 4DV4Q 2GN5A 4O1NA 2TMPA 1IBMQ 1DXMA 1WTOA 2GVAA 5JPNC 1NR2A 1PYBA 2Q8TA 3I73A 4IZ8A 4DFAA 1Y1VH 2F0IA 3MXPA 1ENCA 1YJWA 2WKDA 1EZ6A 1JR0D 1XMQQ 1XYIA 3U50C 3EQLC 1TT2A 4XDXA 3WDNA 5HY6A 2OXPA 3RMHA 2UXBQ 5A2QL 2Z9HA 2F4IA 5C3XA 1R9TH 1O7ZA 4DR7L 4QJFA 3EBEA 5GAGC 2N49A 1QZHA 2OCEA 3J80L 2F0QA 4L6TB 1E24A 4XYQA 4JBMA 4P72A 5HURA 3NTIA 1N36Q 2NZHA 2XWJB 3PIOA 2EIFA 4A93G 2EYHA 4BXXG 1D1KA 3F2BA 4HN7A 4H13C 4JCVE 4GKJL 5C5MA 4DV5Q 1KDBA 3S1RB 5IYDH 4DPGA 5LMNL 3IKJA 1PXUA 3OPOA 1EY9A 2KQ3A 3SK8A 5EBCA 3AB9A 4KKTA 1PLFA 3GD7A 1KHIA 4R8IA 3OIPA 3GTJB 4LF5Q 4A3MB 2ENBA 4S3SA 4K5VA 3J7AF 4B9WA 4DK6C 2FMMA 1QVGA 2UUAL 1IL2A 1U4RA 1BCPB 1TS3A 4X66Q 5JOBA 3CF5A 1O7YA 5IGGA 1WTWA 5J1ZA 4LF8L 2P5ZX 2E74C 3U9SA 4BXXH 5IT9c 1JE5A 3OTOQ 1WCMG 2Z8LA 3H3VH 3M9BA 1AFPA 3G4SA 3KK7A 1VQJA 1B70B 1U5KA 4X62L 2A19A 1Q7YC 3PO3B 3F1ZA 3PF4A 1LACA 3HEJA 1O78A 4JBJA 4RGTA 5IT9E 3E9HA 3I70A 4UPAA 3S1MB 2YTXA 2L15A 3TBIB 2F0UA 1WFQA 2OT2A 3CW2C 4DUZL 4GNXC 1W2BA 3NENA 3F2DA 4C3HB 1A2TA 3VR4A 1PZKD 3NHHA 1K8GA 1DJRD 2FFKB 1X3EA 1GUNA 5EKKA 5I6YA 1WD1A 4GOPC 3HOYB 4ILWA 1J8IA 3HG9A 3LGJA 1XXGA 3HKZG 1WTPA 2VQEQ 1MJEA 3GTMH 1CKNB 4DR4L 3AU7A 2OWOA 1ENFA 2PCFB 3FHWA 3S24A 5IP7G 1K8MA 4N8FA 4B3RL 1K83B 2OQ0A 3I90A 1G91A 4BBRB 2K52A 4RH6A 5K36G 2O5JC 4KJOA 4DK3C 1HJPA 1HPCA 1I3QB 3NE5B 1Y8OB 1WVLA 4IALA 3W1GA 3I4LA 2EXDA 3PIP3 3AQQA 1HTLD 1DD2A 4NW2A 4RG1A 4EQ5A 2CW0D 2SOBA 3GTOB 4NKLA 1CK1A 3CCVA 1J9OA 1XJVA 1I4GA 2K5WA 4HSPA 1H9SA 1E3PA 3G7LA 2F0SA 4ME3A 5IP7H 5ELFA 2MO1A 1W6JA 4HSVA 3M7GA
chains in the Genus database with same CATH topology
3U4ZA 4PMWA 3PIPA 3Q8DA 4AH6A 4HJ9A 1A62A 2R6GA 1KRTA 1VS0A 2JA6H 2LSSA 2UUBQ 1OXVA 1Q8KA 1T9HA 3HOXH 1YHAA 2FXQA 1NE3A 3CMEA 1JB7A 5GROA 2KCMA 5E7NA 2F52A 4A3FG 3K0XA 2B63H 3M3YH 1NMFA 2UXCQ 4L5QA 4X6AH 1KQSA 4JI3L 2AWNA 2JA5H 3S1RH 4DR6L 1FGUA 4DV7L 3A74A 2ZJRA 3ERSX 1KXLA 3CCRA 3KDFA 1WOCA 2PI2A 2JA7H 3RZOH 1HR0Q 4R4IA 1A8VA 1JT8A 3RZDH 4BBSG 1SMXA 2IY5B 1OXUA 4DR1L 2BH8A 3I55A 3RN2A 4A3MH 3H0GH 3CP0A 3M4OH 1X3FA 2AWOA 4P71A 5IYBG 2Q2TA 3MXNB 4DR3L 4DR4L 5H1SE 4YCVA 3S15H 4GKJQ 4JI4L 4X65L 4DR6Q 4DV7Q 1PH4A 2QA4A 2Q2IA 1I94Q 5LMUL 3K7UC 3MEFA 1CSQA 3J81j 5C0XJ 5C3EH 3S16H 2AKWB 1BVSA 2RF4A 2VQFL 2ZM6L 1KAWA 4QGUA 1VQLA 3GTPH 3ER0A 3GDEA 4A3IG 1PH7A 1HNZQ 4HIOA 4LFAL 2IX1A 3TS0A 1L1OB 4YWLA 4A3FH 1VQMA 1XNQL 1YNXA 1TWCH 5IY0A 1TWFH 3BJUA 4IPGA 3CMAA 1IBLL 4X65Q 3HKZE 1HZ9A 4JI5L 3PO3H 4YCUA 3L2PA 2UUAQ 3VDYA 5LMUQ 2Y0SE 4A3LH 1SRUA 4A3BG 3PUZA 4C3JH 5C44H 4AQYQ 1QVFA 1U0LA 4NXNQ 3S1MH 1OXXK 4BBSH 2CQOA 4KHZA 5ELOA 2UXDL 2R92H 1AE3A 4JYAQ 1YJ9A 1K0RA 2K5VA 4HJAA 4DNIA 1RL2A 5EAYA 2YYZA 4LF8Q 4C3HH 5IYBH 4C2MH 2HHHL 3TREA 1CKNA 1Q1EA 4L5TA 2AHOB 4TVAB 4MNOA 2A8VA 5IWAL 2IHEA 2R7FA 3CPFA 1QVCA 4XIGS 2NVTH 1E1TA 2N78A 1N8RC 1HR0W 2ASBA 3T1HL 1C9OA 1QZGA 1E7ZA 4JI5Q 1O7IA 2E2IH 2WB1E 2ES2A 3GTQH 2Q2UA 3T1YL 4GLAC 4LFCL 4DV0L 4QY7A 1S3OA 2ATWA 3HOYH 4JI0L 4A3IH 3G6EA 2UXDQ 5AJ3L 1E1OA 3J7A5 5JJLA 2WP8J 1PYSB 3CPWA 3HOUG 1GKHA 1YZ6A 4IO9A 1G51A 3HKSA 1X56A 3AFQA 3K80C 3BU2A 1SN8A 4DUZQ 1VQOA 2HHHQ 4BY1H 1LM0A 1TWHH 2KHIA 3K8AA 1WI5A 4O0AA 1K83H 3K7AH 1YVCA 1Y1WG 3T1HQ 4BBRH 4QIWE 4YCWA 1YHQA 4LF7Q 1N33Q 4LW1A 4LF9L 1PH2A 4B3ML 4UP7A 1XPRA 4A3BH 1DGSA 4LFCQ 1I3QH 2VUMG 1FL0A 3KLWA 2HT1A 2WAQE 4JI0Q 5GADC 3B6YA 4HIDA 1AE2A 1UE5A 2NVYH 2JE6I 3J7ZC 2VNUD 2B63G 4POGA 3J80i 4JI2L 4A75A 3CCLA 3M4PA 4GOPA 2HIVA 1XMQL 2BA0A 1S72A 4LF4L 1B8AA 1ASZA 4WJ3M 1YIJA 3UE1A 3OW2A 2JA5G 1LUZA 3GTOH 4IFDJ 4NPSA 4PG3A 3UDIA 3CQZH 2UXBL 4IJLA 1CUKA 4B3RQ 2VL6A 3CAMA 3D31A 2MNAA 4Y7NH 2R7DA 2JA7G 1XPOA 4NXML 1Y14B 2NVXH 3HOUH 4A3MG 1TXYA 1V43A 3ULPA 1VQAA 4YHHL 3H0GG 3U4VA 3AFPA 3TS2A 3S1QH 4DV2Q 3RLFA 4JV5Q 1VQDA 2I5LX 1HZBA 4IPHA 2BA1A 4GN4B 3E0EA 3EIVA 4OX9L 1HNWQ 1Y1WH 1JJGA 2RHQB 2E2HH 1VQ8A 1K8AC 3M4QA 1MIUA 3HOZH 4KHPL 1VQFA 1L1OC 4A3JG 1IZ6A 1PH5A 3RR5A 2UUCL 2VUMH 1SLJA 1KL9A 3BZKA 4HJ5A 2VW9A 1N34L 3HOVG 2ZTCA 4R1JA 4YWKA 1N36L 1PHJA 4R4QA 3IRBA 5JEAJ 2I0QA 4K0KL 4P73A 2F4VQ 1SROA 4APVA 2VY3A 3KF6A 4UY8C 5C4JH 3CC2A 2ID0A 2K5NA 4LUZA 4OWTB 3RNUA 1K73C 4BA2I 3S17H 1FJGL 3U58A 2JJQA 1JMCA 4DV5L 3PO3G 1KC8C 2CKZB 2ALYB 1Z47A 4JOIC 3DLLA 2CFMA 4QQBX 5JJIA 4A3LG 1WJJA 2XTIA 5C44G 3CC7A 4FDBA 4DKAC 4JI6L 4A3CG 5FLMG 1VQ7A 5C4XG 1N34Q 2R92G 1L1OA 1B7YB 3GTJH 4OWXB 3E9IA 4NB3A 4PZ8A 4R4OA 1A63A 1VQ6A 4JC0A 1G6PA 4JI3Q 4JI7L 4POFA 3FKIG 3G48A 4DUYL 1I50H 1GD7A 1XMOL 1FJGQ 3GTLH 1VQ4A 1FVIA 2E8GA 1Q86C 1VQ9A 3STBD 3K81C 4A3JH 1L2FA 1VQKA 2JEBI 4B3SL 3PO2H 3WWVA 1EOVA 3HOYG 2MFIA 1M90C 4O2DA 3NBHB 3HOVH 2H5XA 2WFWA 1D8LA 4DR1Q 3PUVA 1EWIA 2AMCB 2NZOA 3W1BA 1PVOA 4R4TA 2ZJPA 3TEHB 3UE0A 5M5XH 1EIFA 2E2JH 4BY1G 4DR3Q 1PH9A 2KENA 2D0PA 2DGYA 4DUYQ 4JI4Q 2EQSA 1EQRA 1HH2P 3RN5A 3I2ZA 4P75A 1UWVA 4BBRG 4JI8L 3CCSA 1MKHA 3A5UA 3S1NH 1NMGA 3KJPA 1X65A 4OXPA 4B3SQ 2VQFQ 1YJNA 4DV3L 4A3CH 5FLMH 1CSPA 1CKOA 5C4XH 2ZM6Q 1X55A 4L5SA 2JA8G 1I6HH 1TWAH 4LFAQ 3ULJA 3PV0A 2UU9L 1XNQQ 4A93H 1YBYA 3H15A 3FKIH 5C0XI 1Q81C 1KD1C 3KOJA 1IBLQ 1X9NA 3CD6A 1J6QA 1SE8A 2VZAA 2CWPA 2LXJA 2JA9A 3JC66 3A0JA 4EX5A 2I5MX 3KJOA 1GM5A 1NJIC 2E5LL 4JBKA 1XPUA 4DV3Q 4JBWA 5BR8L 1Z9FA 1CKMA 3STBC 1RIPA 3UDGA 2GVBA 1HNXL 3KFUA 2LXKA 4KI0A 4P74A 1YEZA 5M3MG 4DV4L 1PFSA 3J80c 2UU9Q 1JJ2A 2MQHA 4GKKL 1IBML 4DV1L 5IWAQ 3JAMi 1UE6A 2VQEL 3CCUA 1VQHA 1X54A 4B3TL 4A3EG 1EUJA 3HOZG 2IHFA 3F2CA 1QUQB 2QEXA 2Q2HA 3T1YQ 1HZCA 4DV0Q 4LFBL 5M5YH 5C0XG 4QL5A 2K5HA 2JA8H 2PI2E 4OWWB 4LF6L 5BR8Q 5AJ3Q 1VQPA 3I4MH 1AH9A 3I7FA 4X64L 2PQAB 5J3BA 3CCJA 3KF8B 4DV4Q 4DV6L 2GN5A 1VQGA 5IE8A 1IBMQ 4IOCA 2NVQH 1LTLA 1WCMH 2NN6I 2GVAA 3S2DH 2OTLA 4LF9Q 1PYBA 4B3MQ 4Y52H 1P16A 2Z6KC 3PUXA 2R7ZG 3CC4A 1Y1VH 4LUOA 4LF6Q 1I5FA 3OYYA 4GN3B 4UP9A 5M3MH 1YJWA 4JI2Q 3BZCA 4DR2L 1XMQQ 2ZTDA 1IBKL 1VQ5A 1V1QA 4LF4Q 3U50C 3AEVA 4A3EH 3PSIA 1J5EL 1N32L 1PH1A 5HY6A 4IJHA 1VQNA 4AYBG 4HIKA 1Q46A 1OXSC 1XTDA 1C0AA 2UXBQ 1E22A 2HIXA 1EYGA 3PO2G 4GNXB 1LYLA 2YV5A 1UEBA 2RCNA 3S14H 1R9TH 2NN6G 4BY7G 4NXMQ 5M3FG 4DR7L 2PMZE 4C3IH 2UUBL 2YTYA 3I56A 1OTCA 5FLXc 4YHHQ 2JK8A 4QJFA 1HR0L 4IFDI 3PUWA 1L0WA 5IYCG 3L7ZC 4OO1G 3EBEA 1IBKQ 1XNRL 1EIYB 5IP9G 4A4IA 4OX9Q 4GOPB 4UP8A 5GAGC 1GVPA 2N49A 1VQBA 5GAEC 2OCEA 1QZHA 4KHPQ 4MTNA 2N3SA 3F8TA 2R7ZH 2C35B 1E24A 2UUCQ 2YU9H 1WYDA 4JBMA 4P72A 1N36Q 3UDFA 4HJ7A 2NZHA 4GLXA 2DUDA 4DR7Q 5HGQA 3PIOA 2EIFA 4K0KQ 3J81i 4A93G 2B29A 4A3GG 3PUYA 2JQOA 4BXXG 1IYJB 4LF5L 3RLNA 1K3RA 3F2BA 2RHSB 1XNRQ 3EN2A 4IPCA 4JCVE 4AIMA 4GKJL 4DV5Q 4A3KG 1C7YA 1I94L 3CCEA 2K75A 4IFDG 3ICEA 5JJKA 5IYDH 2YTVA 4JI1L 4PZ6A 3A5ZB 4DPGA 5LMNL 3UDXA 2F3IA 4X66L 4JOIA 4JI6Q 3KF6B 4LNQA 3GO5A 4BY7H 5M3FH 4WJ4A 1HNZL 3G71A 3GD7A 5IYCH 1KHIA 2BH2A 2D0OA 1BBUA 4HJ8A 2KHJA 3ULLA 5IP9H 4JI7Q 4LF5Q 4RMFA 3OTOL 2B3GA 4YY3L 1XMOQ 1V9PA 5FJ8G 5GAHC 3SGIA 4DK6C 1S40A 3I4NG 1A0IA 4GLVB 1YITA 1UE7A 1QVGA 2UUAL 1IL2A 1Q82C 4JI1Q 2Z0SA 1VCIA 4DAMA 2V1CC 5LMNQ 5DLQE 4AQYL 1H95A 3KDFB 4PZ7A 4NXNL 4X66Q 3HOWG 1X3GA 3CF5A 3CCMA 1PH3A 3AYHB 4JYAL 3I4MG 3M7NA 4A3GH 1Q1BA 4GN5A 4LF8L 2I5HA 1NBWA 5JEAG 1VQIA 4L5RC 1VQCA 5IT9c 3FP9A 4BXXH 2D62A 4R4CA 3JAMc 2R93G 1JE5A 3OTOQ 1WCMG 3H3VH 4YY3Q 4A3KH 1QUQA 3M9BA 3G4SA 3NELA 1VQJA 4JI8Q 1B70B 1U5KA 4X62L 4A3DG 2A19A 4MZ9A 2ZTEA 4H02A 1Q7YC 3F1ZA 4JG2A 3PF4A 1Y1VG 2QGQA 4JBJA 1GO3E 2VS1A 1KRSA 4TQUS 2PQAA 3E9HA 4UPAA 2K4KA 2YTXA 1W3SA 2L15A 4LUVA 1D7QA 1WFQA 2A1AA 3CW2C 3I4OA 4DUZL 1BBWA 2K14A 4GNXC 1MJCA 4YWMA 1W2BA 3NENA 3F2DA 1YI2A 1PH6A 1K9MC 5FJ8H 3GTGH 2ZJQA 3I4NH 4LF7L 1K8GA 1N33L 1JJCB 5ELNA 3TQYA 1X3EA 2E5LQ 4XTCS 4X62Q 4AYBE 1P8LA 3NEMA 2IT1A 3ZJYC 3HOWH 3PF5A 1KIXA 3DM3A 1HNXQ 2XGTA 5GQOA 4GOPC 3PCOB 2KBNA 4KLKA 3M85A 3W5OA 1YHBA 4DR5L 1TWGH 1EQQA 3TRZA 3LGJA 4GKKQ 2JEAI 2R93H 4DV1Q 2KCTA 3HKZG 4IPDA 2VQEQ 1MJEA 3GTMH 1CKNB 2CWAA 2K50A 4B3TQ 5M5WH 4IOAA 1M1KC 2Y0SG 2OWOA 4A3DH 3FHWA 3S24A 5IP7G 1PH8A 4GNXA 2MO0A 4OO1I 4B3RL 4LFBQ 2OQ0A 4ALPA 2OQKA 2CCZA 2K52A 5K36G 4A76A 1PV4A 4DK3C 1OXTA 4X64Q 4HIMA 1HJPA 2JA6G 5LMNW 4DV6Q 3HOXG 3W1GA 2HQLA 2IX0A 4DR5Q 1ASYA 4DV2L 2OTJA 4JV5L 2EXDA 2PNHA 4DR4Q 4DAYB 3AQQA 4LWCA 2WB1G 1HNWL 3CXCA 4GS3A 4RG1A 4EQ5A 1EFWA 5IYDG 3L0OA 3S2HH 1Q12A 3KYHC 4J15A 3CCVA 3H3VI 2Z6KA 1N9WA 1NY4A 1XJVA 1IXRA 3J81c 2N8NA 2F4VL 1G291 3CCQA 3HFZB 4DR2Q 1UE1A 2UXCL 4OONA 1E3PA 3GTKH 1SR3A 1PA6A 3PGZA 3RLOA 1J5EQ 1N32Q 4ME3A 1VQEA 5IP7H 1HZAA 2MO1A 3D0FA 1NTGA 1X6OA 4BA1I 1SFOH 1BKBA 2WAQG 5C3EG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U4Z A;  4PMW A;  3PIP A;  3Q8D A;  4AH6 A;  4HJ9 A;  1A62 A;  2R6G A;  1KRT A;  1VS0 A;  2JA6 H;  2LSS A;  2UUB Q;  1OXV A;  1Q8K A;  1T9H A;  3HOX H;  1YHA A;  2FXQ A;  1NE3 A;  3CME A;  1JB7 A;  5GRO A;  2KCM A;  5E7N A;  2F52 A;  4A3F G;  3K0X A;  2B63 H;  3M3Y H;  1NMF A;  2UXC Q;  4L5Q A;  4X6A H;  1KQS A;  4JI3 L;  2AWN A;  2JA5 H;  3S1R H;  4DR6 L;  1FGU A;  4DV7 L;  3A74 A;  2ZJR A;  3ERS X;  1KXL A;  3CCR A;  3KDF A;  1WOC A;  2PI2 A;  2JA7 H;  3RZO H;  1HR0 Q;  4R4I A;  1A8V A;  1JT8 A;  3RZD H;  4BBS G;  1SMX A;  2IY5 B;  1OXU A;  4DR1 L;  2BH8 A;  3I55 A;  3RN2 A;  4A3M H;  3H0G H;  3CP0 A;  3M4O H;  1X3F A;  2AWO A;  4P71 A;  5IYB G;  2Q2T A;  3MXN B;  4DR3 L;  4DR4 L;  5H1S E;  4YCV A;  3S15 H;  4GKJ Q;  4JI4 L;  4X65 L;  4DR6 Q;  4DV7 Q;  1PH4 A;  2QA4 A;  2Q2I A;  1I94 Q;  5LMU L;  3K7U C;  3MEF A;  1CSQ A;  3J81 j;  5C0X J;  5C3E H;  3S16 H;  2AKW B;  1BVS A;  2RF4 A;  2VQF L;  2ZM6 L;  1KAW A;  4QGU A;  1VQL A;  3GTP H;  3ER0 A;  3GDE A;  4A3I G;  1PH7 A;  1HNZ Q;  4HIO A;  4LFA L;  2IX1 A;  3TS0 A;  1L1O B;  4YWL A;  4A3F H;  1VQM A;  1XNQ L;  1YNX A;  1TWC H;  5IY0 A;  1TWF H;  3BJU A;  4IPG A;  3CMA A;  1IBL L;  4X65 Q;  3HKZ E;  1HZ9 A;  4JI5 L;  3PO3 H;  4YCU A;  3L2P A;  2UUA Q;  3VDY A;  5LMU Q;  2Y0S E;  4A3L H;  1SRU A;  4A3B G;  3PUZ A;  4C3J H;  5C44 H;  4AQY Q;  1QVF A;  1U0L A;  4NXN Q;  3S1M H;  1OXX K;  4BBS H;  2CQO A;  4KHZ A;  5ELO A;  2UXD L;  2R92 H;  1AE3 A;  4JYA Q;  1YJ9 A;  1K0R A;  2K5V A;  4HJA A;  4DNI A;  1RL2 A;  5EAY A;  2YYZ A;  4LF8 Q;  4C3H H;  5IYB H;  4C2M H;  2HHH L;  3TRE A;  1CKN A;  1Q1E A;  4L5T A;  2AHO B;  4TVA B;  4MNO A;  2A8V A;  5IWA L;  2IHE A;  2R7F A;  3CPF A;  1QVC A;  4XIG S;  2NVT H;  1E1T A;  2N78 A;  1N8R C;  1HR0 W;  2ASB A;  3T1H L;  1C9O A;  1QZG A;  1E7Z A;  4JI5 Q;  1O7I A;  2E2I H;  2WB1 E;  2ES2 A;  3GTQ H;  2Q2U A;  3T1Y L;  4GLA C;  4LFC L;  4DV0 L;  4QY7 A;  1S3O A;  2ATW A;  3HOY H;  4JI0 L;  4A3I H;  3G6E A;  2UXD Q;  5AJ3 L;  1E1O A;  3J7A 5;  5JJL A;  2WP8 J;  1PYS B;  3CPW A;  3HOU G;  1GKH A;  1YZ6 A;  4IO9 A;  1G51 A;  3HKS A;  1X56 A;  3AFQ A;  3K80 C;  3BU2 A;  1SN8 A;  4DUZ Q;  1VQO A;  2HHH Q;  4BY1 H;  1LM0 A;  1TWH H;  2KHI A;  3K8A A;  1WI5 A;  4O0A A;  1K83 H;  3K7A H;  1YVC A;  1Y1W G;  3T1H Q;  4BBR H;  4QIW E;  4YCW A;  1YHQ A;  4LF7 Q;  1N33 Q;  4LW1 A;  4LF9 L;  1PH2 A;  4B3M L;  4UP7 A;  1XPR A;  4A3B H;  1DGS A;  4LFC Q;  1I3Q H;  2VUM G;  1FL0 A;  3KLW A;  2HT1 A;  2WAQ E;  4JI0 Q;  5GAD C;  3B6Y A;  4HID A;  1AE2 A;  1UE5 A;  2NVY H;  2JE6 I;  3J7Z C;  2VNU D;  2B63 G;  4POG A;  3J80 i;  4JI2 L;  4A75 A;  3CCL A;  3M4P A;  4GOP A;  2HIV A;  1XMQ L;  2BA0 A;  1S72 A;  4LF4 L;  1B8A A;  1ASZ A;  4WJ3 M;  1YIJ A;  3UE1 A;  3OW2 A;  2JA5 G;  1LUZ A;  3GTO H;  4IFD J;  4NPS A;  4PG3 A;  3UDI A;  3CQZ H;  2UXB L;  4IJL A;  1CUK A;  4B3R Q;  2VL6 A;  3CAM A;  3D31 A;  2MNA A;  4Y7N H;  2R7D A;  2JA7 G;  1XPO A;  4NXM L;  1Y14 B;  2NVX H;  3HOU H;  4A3M G;  1TXY A;  1V43 A;  3ULP A;  1VQA A;  4YHH L;  3H0G G;  3U4V A;  3AFP A;  3TS2 A;  3S1Q H;  4DV2 Q;  3RLF A;  4JV5 Q;  1VQD A;  2I5L X;  1HZB A;  4IPH A;  2BA1 A;  4GN4 B;  3E0E A;  3EIV A;  4OX9 L;  1HNW Q;  1Y1W H;  1JJG A;  2RHQ B;  2E2H H;  1VQ8 A;  1K8A C;  3M4Q A;  1MIU A;  3HOZ H;  4KHP L;  1VQF A;  1L1O C;  4A3J G;  1IZ6 A;  1PH5 A;  3RR5 A;  2UUC L;  2VUM H;  1SLJ A;  1KL9 A;  3BZK A;  4HJ5 A;  2VW9 A;  1N34 L;  3HOV G;  2ZTC A;  4R1J A;  4YWK A;  1N36 L;  1PHJ A;  4R4Q A;  3IRB A;  5JEA J;  2I0Q A;  4K0K L;  4P73 A;  2F4V Q;  1SRO A;  4APV A;  2VY3 A;  3KF6 A;  4UY8 C;  5C4J H;  3CC2 A;  2ID0 A;  2K5N A;  4LUZ A;  4OWT B;  3RNU A;  1K73 C;  4BA2 I;  3S17 H;  1FJG L;  3U58 A;  2JJQ A;  1JMC A;  4DV5 L;  3PO3 G;  1KC8 C;  2CKZ B;  2ALY B;  1Z47 A;  4JOI C;  3DLL A;  2CFM A;  4QQB X;  5JJI A;  4A3L G;  1WJJ A;  2XTI A;  5C44 G;  3CC7 A;  4FDB A;  4DKA C;  4JI6 L;  4A3C G;  5FLM G;  1VQ7 A;  5C4X G;  1N34 Q;  2R92 G;  1L1O A;  1B7Y B;  3GTJ H;  4OWX B;  3E9I A;  4NB3 A;  4PZ8 A;  4R4O A;  1A63 A;  1VQ6 A;  4JC0 A;  1G6P A;  4JI3 Q;  4JI7 L;  4POF A;  3FKI G;  3G48 A;  4DUY L;  1I50 H;  1GD7 A;  1XMO L;  1FJG Q;  3GTL H;  1VQ4 A;  1FVI A;  2E8G A;  1Q86 C;  1VQ9 A;  3STB D;  3K81 C;  4A3J H;  1L2F A;  1VQK A;  2JEB I;  4B3S L;  3PO2 H;  3WWV A;  1EOV A;  3HOY G;  2MFI A;  1M90 C;  4O2D A;  3NBH B;  3HOV H;  2H5X A;  2WFW A;  1D8L A;  4DR1 Q;  3PUV A;  1EWI A;  2AMC B;  2NZO A;  3W1B A;  1PVO A;  4R4T A;  2ZJP A;  3TEH B;  3UE0 A;  5M5X H;  1EIF A;  2E2J H;  4BY1 G;  4DR3 Q;  1PH9 A;  2KEN A;  2D0P A;  2DGY A;  4DUY Q;  4JI4 Q;  2EQS A;  1EQR A;  1HH2 P;  3RN5 A;  3I2Z A;  4P75 A;  1UWV A;  4BBR G;  4JI8 L;  3CCS A;  1MKH A;  3A5U A;  3S1N H;  1NMG A;  3KJP A;  1X65 A;  4OXP A;  4B3S Q;  2VQF Q;  1YJN A;  4DV3 L;  4A3C H;  5FLM H;  1CSP A;  1CKO A;  5C4X H;  2ZM6 Q;  1X55 A;  4L5S A;  2JA8 G;  1I6H H;  1TWA H;  4LFA Q;  3ULJ A;  3PV0 A;  2UU9 L;  1XNQ Q;  4A93 H;  1YBY A;  3H15 A;  3FKI H;  5C0X I;  1Q81 C;  1KD1 C;  3KOJ A;  1IBL Q;  1X9N A;  3CD6 A;  1J6Q A;  1SE8 A;  2VZA A;  2CWP A;  2LXJ A;  2JA9 A;  3JC6 6;  3A0J A;  4EX5 A;  2I5M X;  3KJO A;  1GM5 A;  1NJI C;  2E5L L;  4JBK A;  1XPU A;  4DV3 Q;  4JBW A;  5BR8 L;  1Z9F A;  1CKM A;  3STB C;  1RIP A;  3UDG A;  2GVB A;  1HNX L;  3KFU A;  2LXK A;  4KI0 A;  4P74 A;  1YEZ A;  5M3M G;  4DV4 L;  1PFS A;  3J80 c;  2UU9 Q;  1JJ2 A;  2MQH A;  4GKK L;  1IBM L;  4DV1 L;  5IWA Q;  3JAM i;  1UE6 A;  2VQE L;  3CCU A;  1VQH A;  1X54 A;  4B3T L;  4A3E G;  1EUJ A;  3HOZ G;  2IHF A;  3F2C A;  1QUQ B;  2QEX A;  2Q2H A;  3T1Y Q;  1HZC A;  4DV0 Q;  4LFB L;  5M5Y H;  5C0X G;  4QL5 A;  2K5H A;  2JA8 H;  2PI2 E;  4OWW B;  4LF6 L;  5BR8 Q;  5AJ3 Q;  1VQP A;  3I4M H;  1AH9 A;  3I7F A;  4X64 L;  2PQA B;  5J3B A;  3CCJ A;  3KF8 B;  4DV4 Q;  4DV6 L;  2GN5 A;  1VQG A;  5IE8 A;  1IBM Q;  4IOC A;  2NVQ H;  1LTL A;  1WCM H;  2NN6 I;  2GVA A;  3S2D H;  2OTL A;  4LF9 Q;  1PYB A;  4B3M Q;  4Y52 H;  1P16 A;  2Z6K C;  3PUX A;  2R7Z G;  3CC4 A;  1Y1V H;  4LUO A;  4LF6 Q;  1I5F A;  3OYY A;  4GN3 B;  4UP9 A;  5M3M H;  1YJW A;  4JI2 Q;  3BZC A;  4DR2 L;  1XMQ Q;  2ZTD A;  1IBK L;  1VQ5 A;  1V1Q A;  4LF4 Q;  3U50 C;  3AEV A;  4A3E H;  3PSI A;  1J5E L;  1N32 L;  1PH1 A;  5HY6 A;  4IJH A;  1VQN A;  4AYB G;  4HIK A;  1Q46 A;  1OXS C;  1XTD A;  1C0A A;  2UXB Q;  1E22 A;  2HIX A;  1EYG A;  3PO2 G;  4GNX B;  1LYL A;  2YV5 A;  1UEB A;  2RCN A;  3S14 H;  1R9T H;  2NN6 G;  4BY7 G;  4NXM Q;  5M3F G;  4DR7 L;  2PMZ E;  4C3I H;  2UUB L;  2YTY A;  3I56 A;  1OTC A;  5FLX c;  4YHH Q;  2JK8 A;  4QJF A;  1HR0 L;  4IFD I;  3PUW A;  1L0W A;  5IYC G;  3L7Z C;  4OO1 G;  3EBE A;  1IBK Q;  1XNR L;  1EIY B;  5IP9 G;  4A4I A;  4OX9 Q;  4GOP B;  4UP8 A;  5GAG C;  1GVP A;  2N49 A;  1VQB A;  5GAE C;  2OCE A;  1QZH A;  4KHP Q;  4MTN A;  2N3S A;  3F8T A;  2R7Z H;  2C35 B;  1E24 A;  2UUC Q;  2YU9 H;  1WYD A;  4JBM A;  4P72 A;  1N36 Q;  3UDF A;  4HJ7 A;  2NZH A;  4GLX A;  2DUD A;  4DR7 Q;  5HGQ A;  3PIO A;  2EIF A;  4K0K Q;  3J81 i;  4A93 G;  2B29 A;  4A3G G;  3PUY A;  2JQO A;  4BXX G;  1IYJ B;  4LF5 L;  3RLN A;  1K3R A;  3F2B A;  2RHS B;  1XNR Q;  3EN2 A;  4IPC A;  4JCV E;  4AIM A;  4GKJ L;  4DV5 Q;  4A3K G;  1C7Y A;  1I94 L;  3CCE A;  2K75 A;  4IFD G;  3ICE A;  5JJK A;  5IYD H;  2YTV A;  4JI1 L;  4PZ6 A;  3A5Z B;  4DPG A;  5LMN L;  3UDX A;  2F3I A;  4X66 L;  4JOI A;  4JI6 Q;  3KF6 B;  4LNQ A;  3GO5 A;  4BY7 H;  5M3F H;  4WJ4 A;  1HNZ L;  3G71 A;  3GD7 A;  5IYC H;  1KHI A;  2BH2 A;  2D0O A;  1BBU A;  4HJ8 A;  2KHJ A;  3ULL A;  5IP9 H;  4JI7 Q;  4LF5 Q;  4RMF A;  3OTO L;  2B3G A;  4YY3 L;  1XMO Q;  1V9P A;  5FJ8 G;  5GAH C;  3SGI A;  4DK6 C;  1S40 A;  3I4N G;  1A0I A;  4GLV B;  1YIT A;  1UE7 A;  1QVG A;  2UUA L;  1IL2 A;  1Q82 C;  4JI1 Q;  2Z0S A;  1VCI A;  4DAM A;  2V1C C;  5LMN Q;  5DLQ E;  4AQY L;  1H95 A;  3KDF B;  4PZ7 A;  4NXN L;  4X66 Q;  3HOW G;  1X3G A;  3CF5 A;  3CCM A;  1PH3 A;  3AYH B;  4JYA L;  3I4M G;  3M7N A;  4A3G H;  1Q1B A;  4GN5 A;  4LF8 L;  2I5H A;  1NBW A;  5JEA G;  1VQI A;  4L5R C;  1VQC A;  5IT9 c;  3FP9 A;  4BXX H;  2D62 A;  4R4C A;  3JAM c;  2R93 G;  1JE5 A;  3OTO Q;  1WCM G;  3H3V H;  4YY3 Q;  4A3K H;  1QUQ A;  3M9B A;  3G4S A;  3NEL A;  1VQJ A;  4JI8 Q;  1B70 B;  1U5K A;  4X62 L;  4A3D G;  2A19 A;  4MZ9 A;  2ZTE A;  4H02 A;  1Q7Y C;  3F1Z A;  4JG2 A;  3PF4 A;  1Y1V G;  2QGQ A;  4JBJ A;  1GO3 E;  2VS1 A;  1KRS A;  4TQU S;  2PQA A;  3E9H A;  4UPA A;  2K4K A;  2YTX A;  1W3S A;  2L15 A;  4LUV A;  1D7Q A;  1WFQ A;  2A1A A;  3CW2 C;  3I4O A;  4DUZ L;  1BBW A;  2K14 A;  4GNX C;  1MJC A;  4YWM A;  1W2B A;  3NEN A;  3F2D A;  1YI2 A;  1PH6 A;  1K9M C;  5FJ8 H;  3GTG H;  2ZJQ A;  3I4N H;  4LF7 L;  1K8G A;  1N33 L;  1JJC B;  5ELN A;  3TQY A;  1X3E A;  2E5L Q;  4XTC S;  4X62 Q;  4AYB E;  1P8L A;  3NEM A;  2IT1 A;  3ZJY C;  3HOW H;  3PF5 A;  1KIX A;  3DM3 A;  1HNX Q;  2XGT A;  5GQO A;  4GOP C;  3PCO B;  2KBN A;  4KLK A;  3M85 A;  3W5O A;  1YHB A;  4DR5 L;  1TWG H;  1EQQ A;  3TRZ A;  3LGJ A;  4GKK Q;  2JEA I;  2R93 H;  4DV1 Q;  2KCT A;  3HKZ G;  4IPD A;  2VQE Q;  1MJE A;  3GTM H;  1CKN B;  2CWA A;  2K50 A;  4B3T Q;  5M5W H;  4IOA A;  1M1K C;  2Y0S G;  2OWO A;  4A3D H;  3FHW A;  3S24 A;  5IP7 G;  1PH8 A;  4GNX A;  2MO0 A;  4OO1 I;  4B3R L;  4LFB Q;  2OQ0 A;  4ALP A;  2OQK A;  2CCZ A;  2K52 A;  5K36 G;  4A76 A;  1PV4 A;  4DK3 C;  1OXT A;  4X64 Q;  4HIM A;  1HJP A;  2JA6 G;  5LMN W;  4DV6 Q;  3HOX G;  3W1G A;  2HQL A;  2IX0 A;  4DR5 Q;  1ASY A;  4DV2 L;  2OTJ A;  4JV5 L;  2EXD A;  2PNH A;  4DR4 Q;  4DAY B;  3AQQ A;  4LWC A;  2WB1 G;  1HNW L;  3CXC A;  4GS3 A;  4RG1 A;  4EQ5 A;  1EFW A;  5IYD G;  3L0O A;  3S2H H;  1Q12 A;  3KYH C;  4J15 A;  3CCV A;  3H3V I;  2Z6K A;  1N9W A;  1NY4 A;  1XJV A;  1IXR A;  3J81 c;  2N8N A;  2F4V L;  1G29 1;  3CCQ A;  3HFZ B;  4DR2 Q;  1UE1 A;  2UXC L;  4OON A;  1E3P A;  3GTK H;  1SR3 A;  1PA6 A;  3PGZ A;  3RLO A;  1J5E Q;  1N32 Q;  4ME3 A;  1VQE A;  5IP7 H;  1HZA A;  2MO1 A;  3D0F A;  1NTG A;  1X6O A;  4BA1 I;  1SFO H;  1BKB A;  2WAQ G;  5C3E G; 
#chains in the Genus database with same CATH topology
 4V0B A;  3PIP A;  4FXK C;  2K33 A;  2B2V C;  2LSS A;  1ESF A;  2RKS A;  4B9X A;  1T9H A;  1CZG A;  2FXQ A;  5GRO A;  5E7N A;  2LMC B;  2UXC Q;  4X6A H;  1ICW A;  5DNF A;  4DR6 L;  3S1R H;  1FGU A;  2ZJR A;  4FF4 A;  3TSS A;  4KMU C;  2WIN B;  4X3S A;  2XN9 C;  2F0D A;  3RZO H;  1FNU A;  1SJH D;  4KD4 A;  4PQX A;  3I55 A;  4A3M H;  4FF3 A;  4KY7 A;  1A2U A;  3CP0 A;  3BDO A;  1X3F A;  2D5D A;  2AWO A;  4C3H G;  5IYB G;  4DAP A;  1SJE D;  4XQN A;  4GKJ Q;  2QA4 A;  4EQP A;  2CH4 W;  5LMU L;  1I50 B;  3K7U C;  4WRD A;  3J81 j;  1CSQ A;  1V8Q A;  3GTL B;  4AYB B;  2VQF L;  4OGQ C;  3LWE A;  5T1G A;  1L1O B;  4PMC A;  4KKU A;  3K5M A;  1UUP A;  1R4Q B;  3C1E A;  3GV6 A;  5BN5 A;  4X65 Q;  2E2J B;  3PO3 H;  4U68 A;  3J81 L;  2OF1 A;  3L2P A;  2UUA Q;  2PZW A;  5EKL A;  2Y0S E;  5NUC A;  3S1M H;  3S1N B;  1K3B C;  1OXX K;  3QG1 A;  4EQO A;  2UXD L;  3MZ5 A;  1GHJ A;  1K0R A;  2A73 B;  4KY5 A;  1RL2 A;  4LF8 Q;  4C3H H;  5IYB H;  4X3U A;  1SBB B;  2AHO B;  4MNO A;  4NP5 A;  1HUN A;  2R7F A;  1E1T A;  5IGC A;  3UI2 A;  4ZUJ A;  4JI5 Q;  3NQT A;  4CDF C;  1B53 A;  3HOY H;  2I46 A;  3W2D A;  1CQF A;  4QCL A;  3IL8 A;  3M4Y A;  5JJL A;  1VDZ A;  3CPW A;  4IO9 A;  4MIU A;  3K80 C;  3AFQ A;  4DUZ Q;  1EFI D;  2G5D A;  1LM0 A;  2EYL A;  5KNB A;  1PTO D;  1K83 H;  1I4P A;  3T1H Q;  4BBR H;  4LW1 A;  4LF9 L;  1PH2 A;  4UP7 A;  2SEB D;  3I4N B;  1I3Q H;  2F0M A;  4JI0 Q;  2E76 C;  3B6Y A;  4JW0 A;  3T56 B;  2MUY A;  3J7Z C;  3J80 i;  3CCL A;  4MTK A;  4GOP A;  3I4M B;  1GXD C;  1ASZ A;  5EPK A;  3OMG A;  4WJ3 M;  2JA5 G;  4KK7 A;  4C1N K;  3GTO H;  4OIJ A;  1B44 D;  4IFD J;  1HCZ A;  4NPS A;  4PG3 A;  3UDI A;  1CQV A;  4B3R Q;  1IL8 A;  1KAB A;  4N9P A;  3T13 A;  4F8M A;  1Y14 B;  3DWA A;  1V43 A;  1VQA A;  4G7O C;  4B08 A;  4N9T A;  3MA2 B;  5EGT A;  4R8N A;  2H1E A;  2I5L X;  4IPH A;  2BA1 A;  4OX9 L;  3EIV A;  3TME A;  5J39 A;  4G57 A;  4KHP L;  3LX0 A;  5KEE A;  1IZ6 A;  4KV6 A;  2ICE C;  5C0X H;  2QCP X;  1KL9 A;  3BZK A;  5C4H A;  4JPB W;  3OMC A;  2Z4I A;  5FO9 B;  1PHJ A;  2JSO A;  4K0K L;  5KYI A;  4P73 A;  3HGB A;  3MXN A;  1HRJ A;  1SRO A;  4RAU C;  3CC2 A;  4C3I B;  2NB0 A;  1STE A;  5I9P A;  2JJQ A;  5LL6 X;  3EJI A;  3DLL A;  4CKB A;  4A3L G;  2B2T A;  4HMJ A;  4JI6 L;  5FLM G;  5C4X G;  4N8X 1;  1N34 Q;  1B7Y B;  1RD9 D;  2R3Z A;  4R4O A;  1MSH A;  3VA5 A;  1ESR A;  3H3V C;  3FKI G;  2MGS A;  1I50 H;  3GTL H;  3V2T A;  1Q86 C;  1L2F A;  1VQK A;  2JEB I;  2O2L D;  3MXU A;  3WWV A;  2MFI A;  2EOT A;  1EIG A;  4XQQ A;  3NXW A;  3PUV A;  1B4O A;  2NZO A;  3SK5 A;  4BY7 B;  1PTO B;  1EIF A;  2E2J H;  1C8C A;  2XWB B;  1SE4 A;  3BG3 A;  3H6M A;  3RN5 A;  1BNZ A;  1D1I A;  1IW7 C;  3A5U A;  3S1N H;  1U9R A;  4QIW B;  1PDQ A;  3KJP A;  1EY0 A;  1X65 A;  3S15 B;  4OXP A;  2VQF Q;  1GUG A;  3ERQ A;  5FLM H;  5C4X H;  2B2Y C;  2JA8 G;  4IUU A;  2WAQ B;  2A74 C;  3PV0 A;  3MC0 B;  1QB5 D;  1QIL A;  1S5F D;  1QG7 A;  2FMC A;  3FKI H;  5D3D A;  4M8A A;  2E75 C;  5CV4 A;  2CWP A;  2Q8I B;  2JA9 A;  2FJ2 A;  4XYO A;  1GM5 A;  5FLX L;  4A3K B;  4K6D A;  1XPU A;  4DV3 Q;  1ET6 A;  2EYJ A;  2NTS A;  5BR8 L;  2O5I C;  1RIP A;  2GVB A;  4C3J B;  1YEZ A;  4DV4 L;  1G2S A;  2QF7 A;  3OW7 A;  1JJ2 A;  3KLS A;  1VMC A;  1IBM L;  4DV1 L;  3D3R A;  1SAP A;  2EE1 A;  2RVL A;  1VQH A;  2PW5 A;  1SND A;  1ILQ A;  1KDA A;  3U9O A;  1ML0 D;  2BE5 D;  1HZC A;  2K05 A;  1X32 A;  2CHB D;  2K5H A;  2JA8 H;  4OWW B;  1H9M A;  3I4M H;  3HOW B;  3I91 A;  5IGE A;  2EPB A;  2QIL A;  3KF8 B;  4DV6 L;  4KJN A;  5G3L D;  4G4K A;  2NVQ H;  1LTL A;  2NN6 I;  3KBG A;  3R2I A;  1EY4 A;  5I6W A;  1STH A;  3FPU B;  4LF9 Q;  4Y52 H;  3TP6 A;  5CV8 A;  1YNN C;  3PUX A;  4A3D B;  4J1M A;  1SYG A;  4KHV A;  1B9M A;  4DA2 A;  4DR2 L;  5KRU A;  3AEV A;  3E6Z X;  1VQN A;  4HIK A;  3BYT B;  1C0A A;  3IFD A;  1MGS A;  1EYG A;  2KEC A;  4DU9 A;  1O80 A;  3SR1 A;  3CQZ B;  2NN6 G;  4BY7 G;  4RKL A;  4C3I H;  3I56 A;  3MEH A;  4RHR A;  5FLX c;  4IFD I;  2JK8 A;  2A6E D;  3L7Z C;  1IBK Q;  5IP9 G;  4A4I A;  4DN4 M;  1BXT A;  4OX9 Q;  2K1B A;  3TZU A;  5GAE C;  3S1Q B;  3GTK B;  4KHP Q;  2N3S A;  5I2Y A;  4V19 0;  2TSS A;  1E0B A;  2C35 B;  5FLX E;  1WYD A;  3UDF A;  4HJ7 A;  1JB3 A;  2DUD A;  4K0K Q;  1EY5 A;  3J81 i;  2B29 A;  2EJF C;  4LF5 L;  1XNR Q;  2RHS B;  3K5L A;  4XXE A;  2B63 B;  2VB3 X;  1WD0 A;  4A3K G;  2QDB A;  1C7Y A;  1F2Y A;  2K03 A;  1I94 L;  4ZAI A;  2K75 A;  4IFD G;  5JJK A;  1RDP D;  3A5Z B;  3FVQ A;  1HUM A;  1QCB D;  5KGU A;  2F3I A;  4X66 L;  4G7Z C;  4JI6 Q;  4LNQ A;  4BY7 H;  3ZYY X;  1PTO H;  1XTC D;  3HP3 A;  1HNZ L;  3G71 A;  2BH2 A;  1D5M C;  2D0O A;  1STG A;  5IP9 H;  3OTO L;  3H0G B;  1E2Z A;  5GAH C;  1S40 A;  1F2Z A;  4O42 A;  1UAP A;  2Z0S A;  1VCI A;  1SNC A;  1H95 A;  1E2V A;  3HOW G;  1GJX A;  5CBA E;  4A3J B;  1VF7 A;  3S16 B;  4JYA L;  4CBV A;  1KLU D;  2HCC A;  1FD7 D;  1FR3 A;  3FP9 A;  2HCI A;  3L3O C;  3TP5 A;  1HFG A;  4A3K H;  1QUQ A;  1DCZ A;  2F0V A;  2IW3 A;  1WTH A;  3J7Y W;  3R2T A;  1TWF B;  4A3D G;  3Q0A A;  4MZ9 A;  4H02 A;  4JVZ A;  3RD4 A;  1Y1V G;  4TQU S;  1GO3 E;  1SSO A;  5C44 B;  2XSC A;  2EZV A;  4DNT B;  3IAY A;  1XX8 A;  2K14 A;  1DZ1 A;  1KNA A;  1YI2 A;  1EQV A;  4LF7 L;  1N33 L;  1TS4 A;  2NVT B;  5ELN A;  4XTC S;  5EPJ A;  2N55 A;  3ZJY C;  3HOW H;  2HD3 A;  1VMP A;  5D14 A;  1BCP D;  2QDL A;  3D6W A;  3PCO B;  2KBN A;  4KLK A;  3Q24 A;  5FKA C;  3W5O A;  3VYU A;  3QR8 A;  1EQQ A;  3TRZ A;  1X3Q A;  1ZXT A;  2EYF A;  2JEA I;  4DV1 Q;  3CKI B;  2KCT A;  4IPD A;  1D5X C;  2K50 A;  2B8F A;  4BY1 B;  2BDO A;  4A3D H;  1TVX A;  1PH8 A;  1KLG D;  2F0T A;  2CCZ A;  2OQK A;  2LY7 A;  3A8J E;  2EYM A;  2JA6 G;  3KLS X;  4DV6 Q;  3HOX G;  2HQL A;  2RDH A;  1QOH A;  2NVY B;  3FRP B;  2M2L A;  2PNH A;  2IWH A;  5CMD A;  4DAY B;  2WB1 G;  1HNW L;  3CXC A;  4ME5 A;  3PIO 3;  2K7V A;  3L0O A;  5IT9 L;  5EJW A;  5IYD G;  2A69 D;  2K28 A;  2A68 D;  4TSS A;  3KYH C;  1PRT D;  2ZT9 C;  3H3V I;  1CTM A;  1N9W A;  2F0J A;  1NY4 A;  3VR2 A;  2N8N A;  4OEM B;  2F4V L;  4DR2 Q;  2UXC L;  2KVM A;  3GTK H;  2NVX B;  2B39 A;  3RLO A;  5IIF A;  4A3E B;  1Y1W B;  1PYW D;  3HOZ B;  2QW7 A;  5C3E G;  2HDL A;  4AH6 A;  4HJ9 A;  1A62 A;  1AN8 A;  2LS0 1;  2IL8 A;  1VS0 A;  4Q5V A;  2JA6 H;  2VUM B;  1OXV A;  3HOX H;  3CME A;  1NE3 A;  1JB7 A;  2B63 H;  1DYQ A;  1LTT D;  4DGZ A;  3MFG A;  1NMF A;  4L5Q A;  4IUP A;  3DHQ A;  3S17 B;  3SK6 A;  3MWY W;  5DEH A;  2PI2 A;  2PQE A;  1A8V A;  3DWQ A;  4BBS G;  1SMX A;  2CW0 C;  2IY5 B;  4DR1 L;  3H0G H;  2A6H D;  4P71 A;  5F2D A;  2Q2T A;  4FYD A;  5H1S E;  4YCV A;  2F3V A;  1MBY A;  4X65 L;  1ICF B;  4DV7 Q;  1PH4 A;  2H4O A;  1M4V A;  2Q2I A;  1I94 Q;  1PFM A;  1IKM A;  5FO7 B;  3MEF A;  5C0X J;  1EIH A;  5C3E H;  3S16 H;  2RF4 A;  4K2K A;  1KAW A;  1A3V A;  4QGU A;  1EWH A;  1VQL A;  2IX1 A;  1HNZ Q;  3PO2 B;  4HIO A;  3TS0 A;  3HOV B;  5IOC A;  1YNX A;  1TWC H;  2XNA C;  5IY0 A;  1TWF H;  3BJU A;  4IPG A;  1AP0 A;  5M5X B;  1IBL L;  3HKZ E;  2C5C A;  4JI5 L;  4H44 C;  2RA4 A;  1ZYR D;  1IYU A;  5C44 H;  1QVF A;  1K28 A;  4BBS H;  2CQO A;  4JYA Q;  4QMG A;  1YJ9 A;  3O13 A;  2K5V A;  4HJA A;  4RCN A;  4RA8 A;  5EAY A;  1I6V C;  5EKI A;  1TWA B;  5L37 A;  1CKN A;  3VYS A;  2NVT H;  5IWA L;  2IHE A;  3CPF A;  4XIG S;  2R61 A;  5AFW A;  1N8R C;  1B2T A;  1B50 A;  3T1H L;  1C9O A;  1QZG A;  1O7I A;  2ES2 A;  1PRT B;  3L9A X;  4DV0 L;  4QY7 A;  1S3O A;  2EY6 A;  2DN8 A;  4JI0 L;  1V1P B;  2K01 A;  5AJ3 L;  1E1O A;  5CR3 A;  1PYS B;  1GUT A;  3DEP A;  2X6G A;  5E3F A;  5KNC A;  3BU2 A;  1SN8 A;  1VQO A;  2HHH Q;  4BY1 H;  1I4X A;  4FNF A;  1U4P A;  4O0A A;  3EA6 A;  1Y1W G;  1YVC A;  4LF7 Q;  1N33 Q;  1QE6 A;  1LTB D;  4B3M L;  1MD2 D;  1DGS A;  2SNS A;  2VUM G;  1EY7 A;  1U4M A;  4KN4 C;  2NVY H;  1XWE A;  4POG A;  3DEO A;  3M4P A;  2HIV A;  4LF4 L;  1YIJ A;  4XT3 B;  1KAA A;  3K0Y A;  1CUK A;  2VL6 A;  3D31 A;  3S2D B;  1XPO A;  2NVX H;  4A3M G;  3HRZ C;  4YHH L;  4ZQ3 A;  3RLF A;  5M3M B;  1B3Q A;  5BN3 A;  3E0E A;  1HNW Q;  1Y1W H;  1JJG A;  2B2T C;  1VQ8 A;  3HOZ H;  1MIU A;  2KA7 A;  4RWS C;  1PH5 A;  3QB3 A;  4E6I A;  3ND8 A;  2UUC L;  2VUM H;  1EEF D;  4KN7 C;  4U67 3;  1N34 L;  3HOV G;  4R1J A;  4YWK A;  4CDE C;  1F2M A;  2ZXO A;  1VF5 C;  3IRB A;  5JEA J;  2F4V Q;  3S14 B;  5E4X A;  4APV A;  5JJI A;  1MSG A;  2VY3 A;  2G9D A;  1SYE A;  4UY8 C;  2DNE A;  3PMF A;  4OWT B;  1K73 C;  3S17 H;  2QEJ C;  3DWP A;  1RCV D;  1JMC A;  1SNO A;  2J0T D;  3PO3 G;  2CKZ B;  3TDQ A;  4KKS A;  5ISR A;  3P20 A;  2Y0S B;  3NTK A;  4FDB A;  1AW7 A;  1L1O A;  3F2U A;  3GTJ H;  4NB3 A;  4RFB A;  2HUG A;  4JC0 A;  1G6P A;  4JI7 L;  2IX3 A;  1CFM A;  4CJ0 B;  1GD7 A;  1H9S B;  1RHP A;  3STB D;  2WII B;  3K81 C;  1F9P A;  2AUK A;  2RDF A;  3PO2 H;  4HTH A;  3K6O A;  3HOY G;  1QNK A;  4O2D A;  3NBH B;  3HOV H;  4OIK A;  3CU7 A;  2L12 A;  2WFW A;  4DR1 Q;  3URY A;  1I4H A;  4ZK9 B;  3W1B A;  4R4T A;  4RCO A;  3TEH B;  2ZJP A;  5M5X H;  1TY2 A;  2D0P A;  3KBX A;  2DGY A;  1STY A;  1EQR A;  1HH2 P;  2XVS A;  1SYB A;  1UWV A;  1YNJ C;  4BBR G;  4B3S Q;  1YJN A;  4DV3 L;  2RSO A;  3GV3 A;  1II3 A;  3K5O A;  4HMI A;  3R8B A;  1TWA H;  3ULJ A;  2B8G A;  1NSN S;  3H15 A;  2MP1 A;  5C0X I;  4A3F B;  1IBL Q;  2VZA A;  2LXJ A;  4EX5 A;  5CYU A;  3ND9 A;  1SE3 A;  5JPM C;  4JBW A;  4IUV A;  1Z9F A;  4C1N I;  2LXK A;  2HQE A;  5M3M G;  1PFS A;  2MQH A;  3K57 A;  5IWA Q;  3CCU A;  1X54 A;  4B3T L;  2MJ8 A;  1U4L A;  3VR6 A;  2IHF A;  3F2C A;  2QEX A;  3GTG B;  2AQ1 B;  2Q2H A;  4IUQ A;  4Q0F A;  4DV0 Q;  4LFB L;  3TP8 A;  5C0X G;  1H9R A;  1Y8P B;  1A15 A;  3GTQ B;  5AJ3 Q;  1B3A A;  4K8I A;  2PQA B;  5J3B A;  5TSS A;  4A3I B;  1DOK A;  1VQG A;  1ZEQ X;  1LAB A;  2L11 A;  5IGB A;  1TS2 A;  4FXD A;  2R93 B;  3X3M A;  2RBM A;  3S2D H;  4B3M Q;  2JN4 A;  5M5W B;  4GZY C;  1NUC A;  1TII D;  2Z6K C;  1TU2 B;  5D65 A;  4TRD A;  4LUO A;  5CV7 A;  1PFN A;  4LF6 Q;  4A3B B;  4UP9 A;  1EQT A;  5M3M H;  3OSO A;  4CKC A;  1SE2 A;  4Z9C B;  1PZJ D;  1IBK L;  1V1Q A;  4LF4 Q;  4K5W A;  2B2W C;  3PSI A;  1J5E L;  1N32 L;  4IJH A;  4AYB G;  1Q46 A;  1EWC A;  1XTD A;  1OO9 B;  2RCF A;  4I7A A;  4ID6 A;  1E22 A;  3A55 A;  4IN3 A;  4X3T A;  4GNX B;  5C3W A;  1LYL A;  1HXY D;  2YV5 A;  1UEB A;  3S14 H;  1C48 A;  4J8Q A;  2PMZ E;  2BE5 C;  1OTC A;  4YHH Q;  4OO1 G;  3PUW A;  1H9J A;  4J6H A;  1XNR L;  1EIY B;  2DNC A;  2Z6B A;  1KDC A;  4GOP B;  1GVP A;  3QIA A;  2UUC Q;  1SFO B;  1EU3 A;  5I9O A;  3PUY A;  3SDZ A;  1IYJ B;  2PYK A;  3RLN A;  1K3R A;  3EN2 A;  5KND A;  3CCE A;  3ICE A;  2YTV A;  2LKV A;  3UDX A;  4FO2 A;  5T1I A;  1K0S A;  3KF6 B;  1D2B A;  2JA7 B;  3H91 A;  4OO1 H;  3RZD B;  2ICI A;  2KHJ A;  3ULL A;  3A8I E;  4JI7 Q;  2B3G A;  1S5C D;  4ZKC B;  1V9P A;  2K5D A;  3SGI A;  2A6E C;  3I4N G;  1A0I A;  1YIT A;  1Q82 C;  4JI1 Q;  4AQY L;  1WTV A;  2V1C C;  5DLQ E;  3KDF B;  1X3G A;  4DF7 A;  1PH3 A;  3OHX C;  3I4M G;  1EY8 A;  3M7N A;  3T4A C;  2I5H A;  1NBW A;  1SNP A;  1VQI A;  5JEA G;  4L5R C;  2Q8R E;  2O4X A;  2D62 A;  4R4C A;  3JAM c;  2R93 G;  4YY3 Q;  5ELE A;  4LK1 C;  4ZUI A;  3SXH A;  1IHZ A;  2MHV A;  2PO4 A;  2ZTE A;  4K2L A;  4RGN A;  1F77 A;  2VS1 A;  3E3X A;  1KRS A;  1F2L A;  2D9U A;  2L4N A;  3KF8 A;  3MXG A;  5G3L F;  3JAM E;  3NBI A;  1GUW A;  1W3S A;  3QOL A;  4LUV A;  2R92 B;  5EQ0 A;  1JCK B;  2A1A A;  5EPL A;  1D7Q A;  1BBW A;  3GTG H;  1PH6 A;  1K9M C;  4C2M B;  2ZJQ A;  3I4N H;  5COY A;  2SDF A;  3NEM A;  2IT1 A;  2XRS D;  4DK1 A;  3PF5 A;  2E2I B;  1LLR D;  3VYT A;  1QJO A;  2XGT A;  4C3I G;  3M85 A;  5JEA H;  3C2P A;  4LMQ D;  2DY7 A;  2R93 H;  1JWM D;  5KIX A;  2CWA A;  4B3T Q;  5M5W H;  1D5Z C;  3V96 A;  1TWH B;  3GQB A;  2IPK D;  1SYC A;  3TN2 A;  4LFB Q;  3IFT A;  4ALP A;  3DMU A;  4IUR A;  3BDC A;  4A76 A;  1PV4 A;  4I7Z C;  4PMB A;  1OXT A;  4HIM A;  5CV9 A;  2IX0 A;  2BDN A;  4DR5 Q;  3BVZ A;  2AQ3 B;  3V05 A;  2OTJ A;  4FXG C;  4CDC C;  3K5N A;  2FIN B;  3MHB A;  4GS3 A;  2KCC A;  3MAQ A;  2N88 A;  1DM0 B;  3D4D A;  2XRQ D;  2Z6K A;  4PV1 C;  3ONA B;  1G29 1;  3LNN A;  3CCQ A;  1UE1 A;  4OON A;  3HOU B;  1PA6 A;  2SNM A;  3PGZ A;  1BCP C;  1J5E Q;  2F0K A;  1N32 Q;  1HZA A;  2B2W A;  3D0F A;  1NTG A;  4BA1 I;  4BS9 A;  1SFO H;  4FF2 A;  2PPB C;  2E2H B;  2WAQ G;  3Q8D A;  3BVG A;  2AQ2 B;  1BO0 A;  1YHA A;  3K0X A;  2XIW A;  3R93 A;  1SMY D;  2AWN A;  3SEB A;  4EVO A;  4DV7 L;  2HDM A;  3CCR A;  1EL0 A;  4C3J G;  2JA7 H;  2EY5 A;  1D6E C;  1JT8 A;  3RZD H;  1NR4 A;  1S5E D;  2BH8 A;  3RN2 A;  1NAP A;  2DJF C;  2A68 C;  1WTR A;  1PRT C;  3S15 H;  3P75 A;  1BQQ T;  4JI4 L;  1TY0 A;  3R3O A;  4DXG A;  2ZM6 L;  2J4X A;  4X3K A;  1ROD A;  3J7A V;  4LFA L;  4YWL A;  1XNQ L;  4IQZ A;  2KED A;  1EYA A;  1A3U A;  1LT4 D;  2RDG A;  1EYD A;  1HZ9 A;  3NUC A;  4ZYS A;  4YCU A;  4CJ2 C;  4C56 C;  1BCP F;  4C3J H;  4AQY Q;  4KHZ A;  5ELO A;  1CHQ D;  2F0W A;  2R92 H;  1AE3 A;  1CT1 D;  4F7X A;  2C9O A;  1I6H B;  1MI2 A;  4C2M H;  2HHH L;  3TRE A;  4L5T A;  3KUP A;  4TVA B;  4A93 B;  1HTP A;  1QVC A;  1BDO A;  2N78 A;  3FMC A;  2X69 A;  3BYY B;  5CGK A;  2ASB A;  1E7Z A;  2E2I H;  2WB1 E;  1FNW A;  2A6H C;  2Q2U A;  4DXF A;  2VB2 X;  2Z1C A;  4GLA C;  5A35 A;  3Q22 A;  4ZRZ A;  3H94 A;  1PFB A;  3G6E A;  2NTT A;  4UDU C;  3HOU G;  4OEL B;  1YZ6 A;  1G51 A;  1X56 A;  4H0L C;  4DAY A;  2KJX A;  1TWH H;  2KHI A;  3K8A A;  3VR5 A;  1WI5 A;  1YHQ A;  4YCW A;  5JVH 3;  3NPP A;  2EYP A;  5JAV A;  1PRT F;  4K5X A;  4LFC Q;  3WOF A;  5C6A A;  1FL0 A;  3KLW A;  3D4W A;  1ZYR C;  4HID A;  5CC4 A;  5M5Y B;  1UE5 A;  1CZW A;  2JE6 I;  2B63 G;  4JI2 L;  1GOZ A;  1AH9 A;  1S72 A;  2BOS A;  2CH4 A;  1WTX A;  3UE1 A;  5I2X A;  1STA A;  5I4D A;  4BWG B;  3CQZ H;  3GTM B;  4IJL A;  1WCM B;  3CAM A;  5DAU A;  4WOR A;  2MNA A;  2R7D A;  1LTG D;  4NXM L;  4LAA A;  3HOU H;  1TXY A;  3ULP A;  4FP5 D;  2F0L A;  3H0G G;  3TP7 A;  3S1Q H;  1PZI D;  1ZKO A;  1M8A A;  2F03 A;  1VQD A;  1HZB A;  4GN4 B;  3BZD B;  4K6L A;  1Q3L A;  2RHQ B;  2E2H H;  4F88 A;  3A8K E;  1GUO A;  1L1O C;  1VQF A;  1HQR D;  4A3J G;  3RR5 A;  4CJ1 B;  1SLJ A;  4HJ5 A;  2ZTC A;  4QUC A;  2RSN A;  3DUZ A;  3SE0 A;  2NUC A;  5IGF A;  1MHW C;  1BR9 A;  4IOA A;  2ID0 A;  2K5N A;  4LUZ A;  3RNU A;  5KYL A;  3U58 A;  2F0N A;  1KC8 C;  3HKZ B;  1SYD A;  2ALY B;  1Z47 A;  4JOI C;  4QQB X;  2L0C A;  4CKE A;  5DM6 3;  5C44 G;  2L5T A;  4YIJ A;  1CHP D;  2GA4 B;  1VQ7 A;  2R7Z B;  3BS1 A;  4OWX B;  3E9I A;  2YU9 B;  4PZ8 A;  4ZCK A;  3A7L A;  3BVM A;  1A63 A;  3CRK C;  1JWU D;  1VQ6 A;  2KCN A;  3G48 A;  4HAE A;  1XMO L;  1FJG Q;  1VQ4 A;  2E8G A;  1HQM C;  4A3J H;  4B3S L;  4ZLT F;  1EOV A;  1M90 C;  5COR A;  1AZP A;  1TR5 A;  1PVO A;  3RZO B;  5M3F B;  1SDF A;  3UE0 A;  2EY2 A;  4BY1 G;  1PH9 A;  4WJW A;  4DUY Q;  1BF4 A;  4JI4 Q;  1ONL A;  1RTO A;  1LTI D;  3NK9 A;  2KEE A;  1MKH A;  1SEB D;  4QF4 A;  2PZU A;  4JI8 L;  3CCS A;  1HA6 A;  1G2T A;  3I8Z A;  1JOO A;  1V1P A;  2ZM6 Q;  1CSP A;  1CKO A;  4L5S A;  5CV5 A;  1I6H H;  4LFA Q;  1Q90 A;  4K8J A;  1XNQ Q;  4A93 H;  1YBY A;  5M9O A;  1EOT A;  2RQX A;  1Q81 C;  4A3G B;  3Q6S A;  2ZXR A;  3KJO A;  4HED A;  4JBK A;  3A0J A;  2I5M X;  2E5L L;  3D6C A;  2V4D A;  3NWS A;  2OEO A;  5A2Q E;  4DNR B;  1CKM A;  3STB C;  1HNX L;  2LFN A;  4KI0 A;  1T5X D;  1JC7 A;  4P74 A;  2UU9 Q;  3J80 c;  4GKK L;  1UE6 A;  5BN4 A;  4A3E G;  1EUJ A;  2ZXP A;  3HOZ G;  3SVM A;  3OWE B;  3NP8 A;  1LO5 D;  2F0G A;  5M5Y H;  4QL5 A;  3J80 E;  2PI2 E;  4LF6 L;  3I72 A;  2K32 A;  1VQP A;  4X64 L;  3K59 A;  5IE8 A;  4IOC A;  3D8G A;  4K14 A;  1WCM H;  1TWG B;  2J7Z A;  1A3T A;  2OTL A;  1L0Y B;  3P7J A;  1P16 A;  1JQY D;  4QB4 A;  2R7Z G;  1Z6H A;  3CC4 A;  4EQN A;  4F87 A;  1I5F A;  3OYY A;  4GN3 B;  2EY1 A;  1PMR A;  2F0O A;  4UHV A;  4JI2 Q;  3BZC A;  2K04 A;  4OHJ A;  2ZTD A;  1JOQ A;  1VQ5 A;  3MVV A;  2NYZ D;  4A3E H;  1PH1 A;  1OXS C;  1TQO A;  5E1F A;  2HIX A;  3PO2 G;  1PTO C;  1GUS A;  2RCN A;  4NXM Q;  3A54 A;  5M3F G;  1F9S A;  3S2H B;  2DY8 A;  4G7H C;  2YTY A;  2UUB L;  1HR0 L;  1L0W A;  5IYC G;  2KUM A;  4OL7 A;  3T51 B;  1EYC A;  4RKB A;  1CI3 M;  4UP8 A;  1T5E A;  1VQB A;  4MTN A;  3W3A A;  5C5L A;  3F8T A;  2R7Z H;  3NBH A;  2D2C C;  2YU9 H;  2B2U C;  5K36 H;  3S9W A;  4GLX A;  4DR7 Q;  5HGQ A;  4RHS A;  4A3G G;  2JQO A;  1I4R A;  3N52 A;  2F3W A;  3M3Y B;  4IPC A;  4M1U B;  5D3I B;  4AIM A;  1S5D D;  2JA5 B;  5C4Z A;  4JI1 L;  4PZ6 A;  2M9V A;  1DOL A;  2M00 A;  4JOI A;  5EBD A;  3GO5 A;  3QJY A;  5M3F H;  4WJ4 A;  5IYC H;  1BBU A;  4HJ8 A;  1RF2 D;  1H9K A;  4RMF A;  2EJM A;  2X6L A;  3PQI A;  4YY3 L;  1XMO Q;  3M4O B;  1IKL A;  5FJ8 G;  1CA6 A;  4GLV B;  1UE7 A;  1FGB D;  1SYF A;  1AZQ A;  1UEA B;  4DAM A;  5LMN Q;  2CQA A;  4PZ7 A;  4NXN L;  1TKW B;  3CCM A;  2NBF A;  3AYH B;  5ELD A;  4A3G H;  1Q1B A;  1PTO F;  1I4Q A;  4GN5 A;  2MPM A;  3GTP B;  1VQC A;  3OWF A;  2E2D C;  4L8J A;  3SHL A;  2F0E A;  1L0X B;  4DK0 A;  3NEL A;  4JI8 Q;  1GHK A;  1V1O A;  2KOL A;  4FF1 A;  1FNV A;  4I65 A;  4JG2 A;  2QGQ A;  5FK9 C;  3ERO A;  2PQA A;  1G6Z A;  2K4K A;  5C4X B;  2DJG C;  3I4O A;  1MJC A;  4YWM A;  4KY6 A;  5FJ8 H;  2F0F A;  1JJC B;  3FKI B;  4TKO B;  3TQY A;  2E5L Q;  4X62 Q;  4AYB E;  1P8L A;  4L63 B;  1C4Q A;  2L1B A;  1KIX A;  1TS5 A;  3DM3 A;  2EVB A;  1HNX Q;  1S4Z A;  5GQO A;  2PMZ B;  1ILP A;  1YHB A;  4DR5 L;  1TWG H;  5K5P A;  4GKK Q;  1M1K C;  2Y0S G;  1JE4 A;  1DON A;  1G8Z D;  4WFN 3;  3LWU A;  2L9H A;  3VYR A;  2MO0 A;  4EGV A;  4GNX A;  4OO1 I;  3K7A B;  2IJ0 A;  3EFX D;  4RGM A;  4X64 Q;  2Z4H A;  3DXJ C;  4IUT A;  5LMN W;  2I07 B;  2JA8 B;  2JP1 A;  2WV6 D;  1ASY A;  4DV2 L;  4JV5 L;  2EXZ A;  4DR4 Q;  4LWC A;  1O7L A;  1EFW A;  3OOC A;  2NVQ B;  3S2H H;  4NDX A;  3JAM L;  1Q12 A;  4J15 A;  4Y7N B;  1IXR A;  3J81 c;  3E5S A;  4XT1 B;  4FVM A;  3HFZ B;  1QNU A;  2NZ1 D;  1SR3 A;  3FDT A;  1VQE A;  4JK1 C;  1X6O A;  1JOK A;  1BKB A;  3KF6 A;  3U4Z A;  4PMW A;  3J81 E;  2R6G A;  1KRT A;  3QO2 A;  5CBE E;  2JXM B;  2UUB Q;  1Q8K A;  1LTS D;  3SK4 A;  1HR0 Q;  3M3Y H;  1Q8I A;  2KCM A;  2F52 A;  1YNJ D;  3Q23 A;  4A3F G;  1KQS A;  4JI3 L;  4PNY A;  2JA5 H;  3A74 A;  5C4J B;  4ZKB B;  1QWY A;  3ERS X;  1UNS A;  1KXL A;  2K5Q A;  1RTN A;  5JVG 3;  3KDF A;  1R4P B;  1WOC A;  1B9N A;  5FOB B;  2EYO A;  4R4I A;  4CDD C;  2PNR C;  2F0H A;  1OXU A;  2B2U A;  1SNQ A;  3M4O H;  2B2V A;  3MXN B;  3T53 B;  4DR3 L;  1SNM A;  4DR6 Q;  1LT3 D;  1K8O A;  2AKW B;  1BVS A;  1LV9 A;  1JIC A;  3GTP H;  3ER0 A;  3GDE A;  4A3I G;  1PH7 A;  1HHV A;  2F0P A;  4A3F H;  1VQM A;  2AUJ D;  4CHT B;  1DOM A;  1X3P A;  3VA7 A;  3CMA A;  3VDY A;  5LMU Q;  3NTH A;  4A3L H;  1SRU A;  4A3B G;  3PUZ A;  1KNE A;  1SMY C;  1U0L A;  2EJG C;  4NXN Q;  1A6X A;  2QKI C;  1BBX C;  4HCS A;  4DNI A;  3C3L A;  2YYZ A;  1LTA D;  1Q1E A;  2A8V A;  4HCE A;  3ITP A;  1IYV A;  1S5B D;  1HR0 W;  1ET9 A;  3WOE A;  3GTQ H;  3HS0 C;  3T1Y L;  4LFC L;  2ATW A;  2KHS A;  1LT6 D;  1EEI D;  4A3I H;  2UXD Q;  1BUV T;  3J7A 5;  2WAC A;  2G9H D;  2WP8 J;  5IOD A;  5J22 A;  1GKH A;  3HKS A;  5JJZ A;  5HGT A;  4QUF A;  4KTA A;  4UAI A;  2FHT A;  3K7A H;  4QIW E;  5E4W C;  3P1H A;  4A3B H;  1XPR A;  1JWS D;  1CM9 A;  4H7B A;  3CHB D;  2HT1 A;  2WAQ E;  1Y69 U;  5GAD C;  1AE2 A;  2VNU D;  5CV6 A;  4A75 A;  1XMQ L;  2BA0 A;  1B8A A;  3N6R A;  3OW2 A;  3CRL C;  4LJZ C;  1LUZ A;  3A56 A;  2UXB L;  3EVQ A;  3NQI A;  5IGD A;  4Y7N H;  1EU4 A;  2JA7 G;  4IUN A;  1RJT A;  1Y1V B;  1EZ8 A;  3C1F A;  4KD3 A;  3K58 A;  3U4V A;  3AFP A;  3TS2 A;  3X3N A;  3BDL A;  3E0J A;  4DV2 Q;  4JV5 Q;  3VR3 A;  3H09 A;  1STB A;  4DAV A;  5ELC A;  1K8A C;  3M4Q A;  3KLR A;  1CA5 A;  4ODG A;  2VW9 A;  4MHE A;  1SXT A;  3FEW X;  4R9W A;  1N36 L;  4R4Q A;  2I0Q A;  4P2C B;  1R9T B;  2A5H A;  1RKN A;  1IW7 D;  2NWG A;  5C4J H;  4BA2 I;  2PZT A;  1FJG L;  5DM7 3;  4MN3 A;  4DV5 L;  1AEX A;  1LT5 D;  2CFM A;  1Y8N B;  1WJJ A;  2XTI A;  3DM1 A;  3CC7 A;  1F9Q A;  2EDG A;  4DKA C;  4A3C G;  3RUZ A;  2VXW A;  3MTS A;  2R92 G;  4XQJ A;  2F1M A;  2A69 C;  2JA6 B;  4JI3 Q;  4POF A;  4CGY B;  4DUY L;  3T16 A;  3HOX B;  3FPP A;  1EY6 A;  3I3C A;  3C46 A;  1FVI A;  4RGO S;  1VQ9 A;  2PW7 A;  2WB1 B;  2WKC A;  2NN6 H;  1HFN A;  2H5X A;  1D8L A;  1ENA A;  5ELB A;  1EWI A;  2BCO A;  2AMC B;  3NSW A;  1F9R A;  1NNX A;  3MFY A;  3OIQ A;  4NMZ A;  4DR3 Q;  1NCV A;  2KEN A;  3A7A B;  2JYO A;  2EQS A;  3I2Z A;  4P75 A;  1NMG A;  3TZD A;  4A3C H;  1X55 A;  1E2W A;  5C3E B;  3D4R A;  3AMU A;  2UU9 L;  4ULL A;  1B1Z A;  1STN A;  2L55 A;  1YNN D;  1KD1 C;  3KOJ A;  1X9N A;  4HR7 B;  1TWC B;  3CD6 A;  1J6Q A;  1SE8 A;  3JC6 6;  3QOJ A;  1LTR D;  1Z7T A;  4IFD H;  1NJI C;  1JOR A;  2CVR A;  3UDG A;  1HA5 A;  1BOS A;  3KFU A;  5LL6 S;  4ABN A;  2B2Y A;  4BBS B;  5LHY 1;  3JAM i;  2VQE L;  1W6K A;  1QUQ B;  3T1Y Q;  3QWN A;  3GP7 A;  5FO8 B;  5BR8 Q;  3NWT A;  1FYC A;  1KTK A;  2K6A A;  3G6J B;  3I7F A;  1WTQ A;  3CCJ A;  3HZX A;  4DV4 Q;  2GN5 A;  4O1N A;  2TMP A;  1IBM Q;  1DXM A;  1WTO A;  2GVA A;  5JPN C;  1NR2 A;  1PYB A;  2Q8T A;  3I73 A;  4IZ8 A;  4DFA A;  1Y1V H;  2F0I A;  3MXP A;  1ENC A;  1YJW A;  2WKD A;  1EZ6 A;  1JR0 D;  1XMQ Q;  1XYI A;  3U50 C;  3EQL C;  1TT2 A;  4XDX A;  3WDN A;  5HY6 A;  2OXP A;  3RMH A;  2UXB Q;  5A2Q L;  2Z9H A;  2F4I A;  5C3X A;  1R9T H;  1O7Z A;  4DR7 L;  4QJF A;  3EBE A;  5GAG C;  2N49 A;  1QZH A;  2OCE A;  3J80 L;  2F0Q A;  4L6T B;  1E24 A;  4XYQ A;  4JBM A;  4P72 A;  5HUR A;  3NTI A;  1N36 Q;  2NZH A;  2XWJ B;  3PIO A;  2EIF A;  4A93 G;  2EYH A;  4BXX G;  1D1K A;  3F2B A;  4HN7 A;  4H13 C;  4JCV E;  4GKJ L;  5C5M A;  4DV5 Q;  1KDB A;  3S1R B;  5IYD H;  4DPG A;  5LMN L;  3IKJ A;  1PXU A;  3OPO A;  1EY9 A;  2KQ3 A;  3SK8 A;  5EBC A;  3AB9 A;  4KKT A;  1PLF A;  3GD7 A;  1KHI A;  4R8I A;  3OIP A;  3GTJ B;  4LF5 Q;  4A3M B;  2ENB A;  4S3S A;  4K5V A;  3J7A F;  4B9W A;  4DK6 C;  2FMM A;  1QVG A;  2UUA L;  1IL2 A;  1U4R A;  1BCP B;  1TS3 A;  4X66 Q;  5JOB A;  3CF5 A;  1O7Y A;  5IGG A;  1WTW A;  5J1Z A;  4LF8 L;  2P5Z X;  2E74 C;  3U9S A;  4BXX H;  5IT9 c;  1JE5 A;  3OTO Q;  1WCM G;  2Z8L A;  3H3V H;  3M9B A;  1AFP A;  3G4S A;  3KK7 A;  1VQJ A;  1B70 B;  1U5K A;  4X62 L;  2A19 A;  1Q7Y C;  3PO3 B;  3F1Z A;  3PF4 A;  1LAC A;  3HEJ A;  1O78 A;  4JBJ A;  4RGT A;  5IT9 E;  3E9H A;  3I70 A;  4UPA A;  3S1M B;  2YTX A;  2L15 A;  3TBI B;  2F0U A;  1WFQ A;  2OT2 A;  3CW2 C;  4DUZ L;  4GNX C;  1W2B A;  3NEN A;  3F2D A;  4C3H B;  1A2T A;  3VR4 A;  1PZK D;  3NHH A;  1K8G A;  1DJR D;  2FFK B;  1X3E A;  1GUN A;  5EKK A;  5I6Y A;  1WD1 A;  4GOP C;  3HOY B;  4ILW A;  1J8I A;  3HG9 A;  3LGJ A;  1XXG A;  3HKZ G;  1WTP A;  2VQE Q;  1MJE A;  3GTM H;  1CKN B;  4DR4 L;  3AU7 A;  2OWO A;  1ENF A;  2PCF B;  3FHW A;  3S24 A;  5IP7 G;  1K8M A;  4N8F A;  4B3R L;  1K83 B;  2OQ0 A;  3I90 A;  1G91 A;  4BBR B;  2K52 A;  4RH6 A;  5K36 G;  2O5J C;  4KJO A;  4DK3 C;  1HJP A;  1HPC A;  1I3Q B;  3NE5 B;  1Y8O B;  1WVL A;  4IAL A;  3W1G A;  3I4L A;  2EXD A;  3PIP 3;  3AQQ A;  1HTL D;  1DD2 A;  4NW2 A;  4RG1 A;  4EQ5 A;  2CW0 D;  2SOB A;  3GTO B;  4NKL A;  1CK1 A;  3CCV A;  1J9O A;  1XJV A;  1I4G A;  2K5W A;  4HSP A;  1H9S A;  1E3P A;  3G7L A;  2F0S A;  4ME3 A;  5IP7 H;  5ELF A;  2MO1 A;  1W6J A;  4HSV A;  3M7G A; 
#chains in the Genus database with same CATH homology
 3U4Z A;  4PMW A;  3PIP A;  3Q8D A;  4AH6 A;  4HJ9 A;  1A62 A;  2R6G A;  1KRT A;  1VS0 A;  2JA6 H;  2LSS A;  2UUB Q;  1OXV A;  1Q8K A;  1T9H A;  3HOX H;  1YHA A;  2FXQ A;  1NE3 A;  3CME A;  1JB7 A;  5GRO A;  2KCM A;  5E7N A;  2F52 A;  4A3F G;  3K0X A;  2B63 H;  3M3Y H;  1NMF A;  2UXC Q;  4L5Q A;  4X6A H;  1KQS A;  4JI3 L;  2AWN A;  2JA5 H;  3S1R H;  4DR6 L;  1FGU A;  4DV7 L;  3A74 A;  2ZJR A;  3ERS X;  1KXL A;  3CCR A;  3KDF A;  1WOC A;  2PI2 A;  2JA7 H;  3RZO H;  1HR0 Q;  4R4I A;  1A8V A;  1JT8 A;  3RZD H;  4BBS G;  1SMX A;  2IY5 B;  1OXU A;  4DR1 L;  2BH8 A;  3I55 A;  3RN2 A;  4A3M H;  3H0G H;  3CP0 A;  3M4O H;  1X3F A;  2AWO A;  4P71 A;  5IYB G;  2Q2T A;  3MXN B;  4DR3 L;  4DR4 L;  5H1S E;  4YCV A;  3S15 H;  4GKJ Q;  4JI4 L;  4X65 L;  4DR6 Q;  4DV7 Q;  1PH4 A;  2QA4 A;  2Q2I A;  1I94 Q;  5LMU L;  3K7U C;  3MEF A;  1CSQ A;  3J81 j;  5C0X J;  5C3E H;  3S16 H;  2AKW B;  1BVS A;  2RF4 A;  2VQF L;  2ZM6 L;  1KAW A;  4QGU A;  1VQL A;  3GTP H;  3ER0 A;  3GDE A;  4A3I G;  1PH7 A;  1HNZ Q;  4HIO A;  4LFA L;  2IX1 A;  3TS0 A;  1L1O B;  4YWL A;  4A3F H;  1VQM A;  1XNQ L;  1YNX A;  1TWC H;  5IY0 A;  1TWF H;  3BJU A;  4IPG A;  3CMA A;  1IBL L;  4X65 Q;  3HKZ E;  1HZ9 A;  4JI5 L;  3PO3 H;  4YCU A;  3L2P A;  2UUA Q;  3VDY A;  5LMU Q;  2Y0S E;  4A3L H;  1SRU A;  4A3B G;  3PUZ A;  4C3J H;  5C44 H;  4AQY Q;  1QVF A;  1U0L A;  4NXN Q;  3S1M H;  1OXX K;  4BBS H;  2CQO A;  4KHZ A;  5ELO A;  2UXD L;  2R92 H;  1AE3 A;  4JYA Q;  1YJ9 A;  1K0R A;  2K5V A;  4HJA A;  4DNI A;  1RL2 A;  5EAY A;  2YYZ A;  4LF8 Q;  4C3H H;  5IYB H;  4C2M H;  2HHH L;  3TRE A;  1CKN A;  1Q1E A;  4L5T A;  2AHO B;  4TVA B;  4MNO A;  2A8V A;  5IWA L;  2IHE A;  2R7F A;  3CPF A;  1QVC A;  4XIG S;  2NVT H;  1E1T A;  2N78 A;  1N8R C;  1HR0 W;  2ASB A;  3T1H L;  1C9O A;  1QZG A;  1E7Z A;  4JI5 Q;  1O7I A;  2E2I H;  2WB1 E;  2ES2 A;  3GTQ H;  2Q2U A;  3T1Y L;  4GLA C;  4LFC L;  4DV0 L;  4QY7 A;  1S3O A;  2ATW A;  3HOY H;  4JI0 L;  4A3I H;  3G6E A;  2UXD Q;  5AJ3 L;  1E1O A;  3J7A 5;  5JJL A;  2WP8 J;  1PYS B;  3CPW A;  3HOU G;  1GKH A;  1YZ6 A;  4IO9 A;  1G51 A;  3HKS A;  1X56 A;  3AFQ A;  3K80 C;  3BU2 A;  1SN8 A;  4DUZ Q;  1VQO A;  2HHH Q;  4BY1 H;  1LM0 A;  1TWH H;  2KHI A;  3K8A A;  1WI5 A;  4O0A A;  1K83 H;  3K7A H;  1YVC A;  1Y1W G;  3T1H Q;  4BBR H;  4QIW E;  4YCW A;  1YHQ A;  4LF7 Q;  1N33 Q;  4LW1 A;  4LF9 L;  1PH2 A;  4B3M L;  4UP7 A;  1XPR A;  4A3B H;  1DGS A;  4LFC Q;  1I3Q H;  2VUM G;  1FL0 A;  3KLW A;  2HT1 A;  2WAQ E;  4JI0 Q;  5GAD C;  3B6Y A;  4HID A;  1AE2 A;  1UE5 A;  2NVY H;  2JE6 I;  3J7Z C;  2VNU D;  2B63 G;  4POG A;  3J80 i;  4JI2 L;  4A75 A;  3CCL A;  3M4P A;  4GOP A;  2HIV A;  1XMQ L;  2BA0 A;  1S72 A;  4LF4 L;  1B8A A;  1ASZ A;  4WJ3 M;  1YIJ A;  3UE1 A;  3OW2 A;  2JA5 G;  1LUZ A;  3GTO H;  4IFD J;  4NPS A;  4PG3 A;  3UDI A;  3CQZ H;  2UXB L;  4IJL A;  1CUK A;  4B3R Q;  2VL6 A;  3CAM A;  3D31 A;  2MNA A;  4Y7N H;  2R7D A;  2JA7 G;  1XPO A;  4NXM L;  1Y14 B;  2NVX H;  3HOU H;  4A3M G;  1TXY A;  1V43 A;  3ULP A;  1VQA A;  4YHH L;  3H0G G;  3U4V A;  3AFP A;  3TS2 A;  3S1Q H;  4DV2 Q;  3RLF A;  4JV5 Q;  1VQD A;  2I5L X;  1HZB A;  4IPH A;  2BA1 A;  4GN4 B;  3E0E A;  3EIV A;  4OX9 L;  1HNW Q;  1Y1W H;  1JJG A;  2RHQ B;  2E2H H;  1VQ8 A;  1K8A C;  3M4Q A;  1MIU A;  3HOZ H;  4KHP L;  1VQF A;  1L1O C;  4A3J G;  1IZ6 A;  1PH5 A;  3RR5 A;  2UUC L;  2VUM H;  1SLJ A;  1KL9 A;  3BZK A;  4HJ5 A;  2VW9 A;  1N34 L;  3HOV G;  2ZTC A;  4R1J A;  4YWK A;  1N36 L;  1PHJ A;  4R4Q A;  3IRB A;  5JEA J;  2I0Q A;  4K0K L;  4P73 A;  2F4V Q;  1SRO A;  4APV A;  2VY3 A;  3KF6 A;  4UY8 C;  5C4J H;  3CC2 A;  2ID0 A;  2K5N A;  4LUZ A;  4OWT B;  3RNU A;  1K73 C;  4BA2 I;  3S17 H;  1FJG L;  3U58 A;  2JJQ A;  1JMC A;  4DV5 L;  3PO3 G;  1KC8 C;  2CKZ B;  2ALY B;  1Z47 A;  4JOI C;  3DLL A;  2CFM A;  4QQB X;  5JJI A;  4A3L G;  1WJJ A;  2XTI A;  5C44 G;  3CC7 A;  4FDB A;  4DKA C;  4JI6 L;  4A3C G;  5FLM G;  1VQ7 A;  5C4X G;  1N34 Q;  2R92 G;  1L1O A;  1B7Y B;  3GTJ H;  4OWX B;  3E9I A;  4NB3 A;  4PZ8 A;  4R4O A;  1A63 A;  1VQ6 A;  4JC0 A;  1G6P A;  4JI3 Q;  4JI7 L;  4POF A;  3FKI G;  3G48 A;  4DUY L;  1I50 H;  1GD7 A;  1XMO L;  1FJG Q;  3GTL H;  1VQ4 A;  1FVI A;  2E8G A;  1Q86 C;  1VQ9 A;  3STB D;  3K81 C;  4A3J H;  1L2F A;  1VQK A;  2JEB I;  4B3S L;  3PO2 H;  3WWV A;  1EOV A;  3HOY G;  2MFI A;  1M90 C;  4O2D A;  3NBH B;  3HOV H;  2H5X A;  2WFW A;  1D8L A;  4DR1 Q;  3PUV A;  1EWI A;  2AMC B;  2NZO A;  3W1B A;  1PVO A;  4R4T A;  2ZJP A;  3TEH B;  3UE0 A;  5M5X H;  1EIF A;  2E2J H;  4BY1 G;  4DR3 Q;  1PH9 A;  2KEN A;  2D0P A;  2DGY A;  4DUY Q;  4JI4 Q;  2EQS A;  1EQR A;  1HH2 P;  3RN5 A;  3I2Z A;  4P75 A;  1UWV A;  4BBR G;  4JI8 L;  3CCS A;  1MKH A;  3A5U A;  3S1N H;  1NMG A;  3KJP A;  1X65 A;  4OXP A;  4B3S Q;  2VQF Q;  1YJN A;  4DV3 L;  4A3C H;  5FLM H;  1CSP A;  1CKO A;  5C4X H;  2ZM6 Q;  1X55 A;  4L5S A;  2JA8 G;  1I6H H;  1TWA H;  4LFA Q;  3ULJ A;  3PV0 A;  2UU9 L;  1XNQ Q;  4A93 H;  1YBY A;  3H15 A;  3FKI H;  5C0X I;  1Q81 C;  1KD1 C;  3KOJ A;  1IBL Q;  1X9N A;  3CD6 A;  1J6Q A;  1SE8 A;  2VZA A;  2CWP A;  2LXJ A;  2JA9 A;  3JC6 6;  3A0J A;  4EX5 A;  2I5M X;  3KJO A;  1GM5 A;  1NJI C;  2E5L L;  4JBK A;  1XPU A;  4DV3 Q;  4JBW A;  5BR8 L;  1Z9F A;  1CKM A;  3STB C;  1RIP A;  3UDG A;  2GVB A;  1HNX L;  3KFU A;  2LXK A;  4KI0 A;  4P74 A;  1YEZ A;  5M3M G;  4DV4 L;  1PFS A;  3J80 c;  2UU9 Q;  1JJ2 A;  2MQH A;  4GKK L;  1IBM L;  4DV1 L;  5IWA Q;  3JAM i;  1UE6 A;  2VQE L;  3CCU A;  1VQH A;  1X54 A;  4B3T L;  4A3E G;  1EUJ A;  3HOZ G;  2IHF A;  3F2C A;  1QUQ B;  2QEX A;  2Q2H A;  3T1Y Q;  1HZC A;  4DV0 Q;  4LFB L;  5M5Y H;  5C0X G;  4QL5 A;  2K5H A;  2JA8 H;  2PI2 E;  4OWW B;  4LF6 L;  5BR8 Q;  5AJ3 Q;  1VQP A;  3I4M H;  1AH9 A;  3I7F A;  4X64 L;  2PQA B;  5J3B A;  3CCJ A;  3KF8 B;  4DV4 Q;  4DV6 L;  2GN5 A;  1VQG A;  5IE8 A;  1IBM Q;  4IOC A;  2NVQ H;  1LTL A;  1WCM H;  2NN6 I;  2GVA A;  3S2D H;  2OTL A;  4LF9 Q;  1PYB A;  4B3M Q;  4Y52 H;  1P16 A;  2Z6K C;  3PUX A;  2R7Z G;  3CC4 A;  1Y1V H;  4LUO A;  4LF6 Q;  1I5F A;  3OYY A;  4GN3 B;  4UP9 A;  5M3M H;  1YJW A;  4JI2 Q;  3BZC A;  4DR2 L;  1XMQ Q;  2ZTD A;  1IBK L;  1VQ5 A;  1V1Q A;  4LF4 Q;  3U50 C;  3AEV A;  4A3E H;  3PSI A;  1J5E L;  1N32 L;  1PH1 A;  5HY6 A;  4IJH A;  1VQN A;  4AYB G;  4HIK A;  1Q46 A;  1OXS C;  1XTD A;  1C0A A;  2UXB Q;  1E22 A;  2HIX A;  1EYG A;  3PO2 G;  4GNX B;  1LYL A;  2YV5 A;  1UEB A;  2RCN A;  3S14 H;  1R9T H;  2NN6 G;  4BY7 G;  4NXM Q;  5M3F G;  4DR7 L;  2PMZ E;  4C3I H;  2UUB L;  2YTY A;  3I56 A;  1OTC A;  5FLX c;  4YHH Q;  2JK8 A;  4QJF A;  1HR0 L;  4IFD I;  3PUW A;  1L0W A;  5IYC G;  3L7Z C;  4OO1 G;  3EBE A;  1IBK Q;  1XNR L;  1EIY B;  5IP9 G;  4A4I A;  4OX9 Q;  4GOP B;  4UP8 A;  5GAG C;  1GVP A;  2N49 A;  1VQB A;  5GAE C;  2OCE A;  1QZH A;  4KHP Q;  4MTN A;  2N3S A;  3F8T A;  2R7Z H;  2C35 B;  1E24 A;  2UUC Q;  2YU9 H;  1WYD A;  4JBM A;  4P72 A;  1N36 Q;  3UDF A;  4HJ7 A;  2NZH A;  4GLX A;  2DUD A;  4DR7 Q;  5HGQ A;  3PIO A;  2EIF A;  4K0K Q;  3J81 i;  4A93 G;  2B29 A;  4A3G G;  3PUY A;  2JQO A;  4BXX G;  1IYJ B;  4LF5 L;  3RLN A;  1K3R A;  3F2B A;  2RHS B;  1XNR Q;  3EN2 A;  4IPC A;  4JCV E;  4AIM A;  4GKJ L;  4DV5 Q;  4A3K G;  1C7Y A;  1I94 L;  3CCE A;  2K75 A;  4IFD G;  3ICE A;  5JJK A;  5IYD H;  2YTV A;  4JI1 L;  4PZ6 A;  3A5Z B;  4DPG A;  5LMN L;  3UDX A;  2F3I A;  4X66 L;  4JOI A;  4JI6 Q;  3KF6 B;  4LNQ A;  3GO5 A;  4BY7 H;  5M3F H;  4WJ4 A;  1HNZ L;  3G71 A;  3GD7 A;  5IYC H;  1KHI A;  2BH2 A;  2D0O A;  1BBU A;  4HJ8 A;  2KHJ A;  3ULL A;  5IP9 H;  4JI7 Q;  4LF5 Q;  4RMF A;  3OTO L;  2B3G A;  4YY3 L;  1XMO Q;  1V9P A;  5FJ8 G;  5GAH C;  3SGI A;  4DK6 C;  1S40 A;  3I4N G;  1A0I A;  4GLV B;  1YIT A;  1UE7 A;  1QVG A;  2UUA L;  1IL2 A;  1Q82 C;  4JI1 Q;  2Z0S A;  1VCI A;  4DAM A;  2V1C C;  5LMN Q;  5DLQ E;  4AQY L;  1H95 A;  3KDF B;  4PZ7 A;  4NXN L;  4X66 Q;  3HOW G;  1X3G A;  3CF5 A;  3CCM A;  1PH3 A;  3AYH B;  4JYA L;  3I4M G;  3M7N A;  4A3G H;  1Q1B A;  4GN5 A;  4LF8 L;  2I5H A;  1NBW A;  5JEA G;  1VQI A;  4L5R C;  1VQC A;  5IT9 c;  3FP9 A;  4BXX H;  2D62 A;  4R4C A;  3JAM c;  2R93 G;  1JE5 A;  3OTO Q;  1WCM G;  3H3V H;  4YY3 Q;  4A3K H;  1QUQ A;  3M9B A;  3G4S A;  3NEL A;  1VQJ A;  4JI8 Q;  1B70 B;  1U5K A;  4X62 L;  4A3D G;  2A19 A;  4MZ9 A;  2ZTE A;  4H02 A;  1Q7Y C;  3F1Z A;  4JG2 A;  3PF4 A;  1Y1V G;  2QGQ A;  4JBJ A;  1GO3 E;  2VS1 A;  1KRS A;  4TQU S;  2PQA A;  3E9H A;  4UPA A;  2K4K A;  2YTX A;  1W3S A;  2L15 A;  4LUV A;  1D7Q A;  1WFQ A;  2A1A A;  3CW2 C;  3I4O A;  4DUZ L;  1BBW A;  2K14 A;  4GNX C;  1MJC A;  4YWM A;  1W2B A;  3NEN A;  3F2D A;  1YI2 A;  1PH6 A;  1K9M C;  5FJ8 H;  3GTG H;  2ZJQ A;  3I4N H;  4LF7 L;  1K8G A;  1N33 L;  1JJC B;  5ELN A;  3TQY A;  1X3E A;  2E5L Q;  4XTC S;  4X62 Q;  4AYB E;  1P8L A;  3NEM A;  2IT1 A;  3ZJY C;  3HOW H;  3PF5 A;  1KIX A;  3DM3 A;  1HNX Q;  2XGT A;  5GQO A;  4GOP C;  3PCO B;  2KBN A;  4KLK A;  3M85 A;  3W5O A;  1YHB A;  4DR5 L;  1TWG H;  1EQQ A;  3TRZ A;  3LGJ A;  4GKK Q;  2JEA I;  2R93 H;  4DV1 Q;  2KCT A;  3HKZ G;  4IPD A;  2VQE Q;  1MJE A;  3GTM H;  1CKN B;  2CWA A;  2K50 A;  4B3T Q;  5M5W H;  4IOA A;  1M1K C;  2Y0S G;  2OWO A;  4A3D H;  3FHW A;  3S24 A;  5IP7 G;  1PH8 A;  4GNX A;  2MO0 A;  4OO1 I;  4B3R L;  4LFB Q;  2OQ0 A;  4ALP A;  2OQK A;  2CCZ A;  2K52 A;  5K36 G;  4A76 A;  1PV4 A;  4DK3 C;  1OXT A;  4X64 Q;  4HIM A;  1HJP A;  2JA6 G;  5LMN W;  4DV6 Q;  3HOX G;  3W1G A;  2HQL A;  2IX0 A;  4DR5 Q;  1ASY A;  4DV2 L;  2OTJ A;  4JV5 L;  2EXD A;  2PNH A;  4DR4 Q;  4DAY B;  3AQQ A;  4LWC A;  2WB1 G;  1HNW L;  3CXC A;  4GS3 A;  4RG1 A;  4EQ5 A;  1EFW A;  5IYD G;  3L0O A;  3S2H H;  1Q12 A;  3KYH C;  4J15 A;  3CCV A;  3H3V I;  2Z6K A;  1N9W A;  1NY4 A;  1XJV A;  1IXR A;  3J81 c;  2N8N A;  2F4V L;  1G29 1;  3CCQ A;  3HFZ B;  4DR2 Q;  1UE1 A;  2UXC L;  4OON A;  1E3P A;  3GTK H;  1SR3 A;  1PA6 A;  3PGZ A;  3RLO A;  1J5E Q;  1N32 Q;  4ME3 A;  1VQE A;  5IP7 H;  1HZA A;  2MO1 A;  3D0F A;  1NTG A;  1X6O A;  4BA1 I;  1SFO H;  1BKB A;  2WAQ G;  5C3E G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...