3D8GA

Crystal structure of staphylococcal nuclease variant delta+phs i72r at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKREVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Arginine residues at internal positions in a protein are always charged.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mw2
total genus 35
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d8gA00
4IZ8A 1SYFA 2HQEA 3OMGA 4R8NA 1JOQA 4PNYA 4DU9A 1TR5A 2F0HA 2KHSA 2PQEA 1AEXA 1SNQA 2F0MA 1II3A 2EY5A 3LX0A 3HZXA 4EVOA 5M9OA 3SK8A 1F2MA 3EROA 4NDXA 5C4ZA 4KHVA 2F3WA 5CV5A 3R3OA 4NKLA 1SYDA 4RKLA 2EY2A 1STHA 2RBMA 2RDFA 3SR1A 1F2YA 4KD3A 4B9XA 3U9OA 4ME5A 1KABA 4K8JA 1EY4A 5IODA 1SYBA 1STYA 4ODGA 3SHLA 5C4HA 1EY0A 3OMCA 1KDAA 1TT2A 3MEHA 3RUZA 2F0JA 3SK5A 5HURA 2PW5A 1JOKA 2OEOA 4NMZA 3D4WA 5C5LA 1EZ8A 1EY8A 1STBA 3TP6A 4ID6A 1A3UA 4KJNA 2EY1A 3ITPA 4B9WA 5CC4A 3NUCA 4IUNA 5IIFA 5CGKA 2F0IA 5EGTA 1EYDA 4S3SA 2ENBA 2OF1A 4WORA 4N9TA 4HMJA 5I9OA 3V2TA 2F0LA 5C3WA 2EYLA 1F2ZA 4TRDA 5CV7A 2EYHA 2F0DA 3C1EA 4MIUA 2NUCA 5CR3A 5DAUA 3TP5A 4E6IA 3NXWA 4F8MA 2F0NA 2F0VA 3E5SA 2EYFA 3MHBA 1EYCA 1SNMA 3EJIA 4K6DA 5C5MA 1JORA 2SOBA 2F0FA 3S9WA 4KV6A 5JAVA 4NP5A 1EZ6A 1KDCA 2F0SA 1EYAA 2SNSA 3BDCA 5NUCA 3SXHA 4EQOA 1JOOA 4QMGA 4IALA 2F0QA 4EQPA 2EYOA 4OL7A 3EVQA 4K5XA 4H7BA 3NHHA 4ZUJA 3BDLA 3T13A 5IGDA 2PZTA 5J39A 3ERQA 4LAAA 5CV4A 2KQ3A 3QOJA 4G57A 4PMCA 2F0TA 4ZUIA 3T16A 3TMEA 5JOBA 1NSNS 2F0OA 3C1FA 2M00A 2PZWA 3P1HA 2OXPA 4K8IA 5CV8A 2F0KA 1A3TA 3QB3A 4HMIA 5KYLA 2EXZA 4KD4A 1EY5A 4F7XA 3TP7A 4K5VA 4WRDA 4ZQ3A 1KAAA 3OWFA 3QOLA 4QF4A 5EKKA 5IGGA 1IHZA 1A2TA 2RKSA 3SK4A 4DF7A 3PMFA 5EKLA 5C3XA 4K14A 4KY5A 5CV6A 4DGZA 5IOCA 2QDBA 3HEJA 4HTHA 5I6YA 1A3VA 1EY9A 1SYCA 4RKBA 4DFAA 5IGCA 5J22A 5KYIA 5I6WA 2EYJA 1SNOA 3SK6A 3P75A 5E1FA 1KDBA 3D8GA 3NQTA 3H6MA 4QB4A 5KRUA 1STAA 5CV9A 4K2LA 4KJOA 2F0EA 2F3VA 5KIXA 1U9RA 2PZUA 5C6AA 5KGUA 5KEEA 3MXPA 4PMBA 3TP8A 3DHQA 5HGTA 3DMUA 5I9PA 1ENCA 5IGFA 4K5WA 1SYEA 4K2KA 3D6CA 5IGBA 4I65A 2F0UA 1STNA 4EQNA 2EYPA 1SYGA 5F2DA 2PYKA 4KY7A 1TQOA 4KY6A 1STGA 4J6HA 2PW7A 3VA5A 3OSOA 4J1MA 5E3FA 2F0WA 3NP8A 1SNCA 4N9PA 2EY6A 2LKVA 1SNPA 2EYMA 3D4DA 2SNMA 4YIJA 1RKNA 1EQVA 2WACA 1EY6A 1EY7A 3MVVA 5IGEA 1A2UA 2O4XA 5J1ZA 5ISRA 2F0GA 1SNDA 2F0PA 4KTAA 5DEHA 5K5PA 3MZ5A 1NUCA 3NK9A 1ENAA
chains in the Genus database with same CATH superfamily
2DJFC 4DR4L 2K5HA 4A3KG 4BS9A 2KEEA 4DU9A 4JI5Q 1LTTD 1L0WA 1BCPC 5KNDA 2UUAL 2HCCA 1CUKA 5CV5A 3SVMA 2C35B 3RN5A 2EY2A 3NBIA 1D1KA 4L5QA 5IODA 2Q8IB 2VB2X 4DK1A 2PW5A 4NMZA 3I7FA 1YJWA 4UAIA 2KJXA 3QG1A 4OWWB 4OHJA 4HMJA 2HUGA 5IYBH 1N34Q 4LF6L 1F2ZA 1I4PA 3H3VC 4BXXG 3GQBA 1Y1WH 5GAHC 1XNQQ 1D2BA 4RMFA 3VYUA 4EQ5A 1B50A 3BVGA 3KJOA 4QY7A 4EQPA 2UXDQ 4GN4B 1HUNA 2EYOA 4X66L 1GOZA 1Y1WB 5J39A 1TY0A 4G57A 4PMCA 4DV4L 1X3QA 4Z9CB 1OO9B 1U5KA 3TN2A 4KN4C 2IX0A 4QF4A 3E6ZX 3BVZA 1A2TA 2RF4A 4X3TA 2JE6I 4C3IH 1RODA 4B3TQ 2R7ZH 2JQOA 4ZCKA 3W3AA 2E2IH 4AYBE 3OHXC 4JBKA 4OIJA 5DNFA 3DXJC 1H9RA 2LFNA 1PFMA 1KDBA 1VQBA 3H6MA 5KIXA 5KGUA 1CKNB 5A2QL 4C3IB 2YYZA 1N36L 2R7ZB 1NAPA 2E2IB 1VCIA 2NTSA 1LT6D 2E2DC 1HZCA 4KY6A 2EE1A 3H3VI 1XMQL 1FNVA 1TU2B 3CCMA 2F0WA 4HJ7A 4K6LA 2JK8A 1BDOA 4WJWA 2HQLA 1EY7A 2MGSA 1VQ4A 4A3GG 4H0LC 3IL8A 1JOQA 1L0YB 1BCPB 4FF3A 1TR5A 2MQHA 2NZHA 1EIHA 3AFQA 5FJ8G 4DV6Q 3D6WA 1PH1A 5C4ZA 1HNWL 2I46A 1E22A 2WAQB 2CCZA 3H3VH 3DEPA 1RF2D 1DZ1A 3U9OA 1X55A 2CWPA 1F77A 1JE4A 1G8ZD 1ZXTA 5EJWA 2OEOA 2AWOA 1IBMQ 5JJLA 4B3RQ 2HT1A 4KJNA 1O7YA 4DV7Q 1NJIC 1QVFA 2JEAI 4JV5L 2EJFC 3U4VA 2ZXOA 5C5MA 4BA1I 3F2CA 5C4XH 5BR8L 3MXGA 4YY3L 1UE7A 4DV1L 1XYIA 1WFQA 1K83H 4EQOA 2IX3A 4R8IA 4FXDA 2LMCB 1NY4A 1UWVA 2JA7G 4HIKA 4OL7A 1I6VC 1RTOA 5CBAE 1Y8PB 4P2CB 4DPGA 1PYWD 2VL6A 2A6ED 3E0JA 5C4XB 2F0OA 1Q82C 3I3CA 4UDUC 1K83B 2OXPA 4HMIA 4JBJA 1UEAB 3TP7A 1LT4D 2O2LD 1VDZA 4ULLA 3J80i 2Q2TA 4KLKA 1S72A 2WV6D 1S5BD 4CDCC 2DUDA 4RKBA 1GUSA 3KBGA 1DOLA 2A6HC 3OOCA 4HIMA 2JA8G 2UUCL 3FPUB 1UEBA 1YNJD 3NQTA 4O1NA 2VXWA 3Q24A 2DY7A 1G291 3CMAA 1KLUD 1S5DD 2FINB 1MSHA 3PQIA 3DMUA 1A0IA 2ZTEA 5LMUL 5C0XJ 1PH6A 1SSOA 4R4OA 2EYPA 2K5VA 4J6HA 1SXTA 4XDXA 5CMDA 2B2VA 1SNCA 3HFZB 1PFNA 2EYMA 2D0PA 2SNMA 4DV3Q 1RKNA 3CPFA 4GKKL 5IYBG 5LMNW 5J1ZA 1HQMC 5EBDA 2A68C 4JOIA 1P8LA 3IAYA 1JCKB 1Y1WG 4A3IH 4DV2Q 2WB1B 2MO0A 1PH3A 1WCMH 1FNUA 4CKBA 4LF4Q 2F0HA 1VF7A 1CM9A 2PQEA 1MI2A 3HS0C 3S16H 2E8GA 3FKIG 3RLNA 4DR2Q 4KKUA 1F2YA 4DNRB 4HSPA 4A3IB 4TVAB 1IW7C 1WCMB 3K57A 1BBUA 2WFWA 1KDAA 2CQOA 3MEHA 2DGYA 1JOKA 3FP9A 1X54A 3S16B 3M85A 3CCUA 5IIFA 5DLQE 1Q86C 3OTOQ 1O78A 3G48A 2YU9H 2LXJA 2R7ZG 1AZPA 4F8MA 5EPLA 1LT3D 1TWCH 4K6DA 2NZOA 2Z6KA 5D3DA 5ELNA 3I4NG 4AIMA 3SXHA 1EQTA 1GUNA 4J8QA 3K80C 2YU9B 4GKJQ 1DM0B 2XNAC 1C8CA 2UXBL 4HJ5A 5JEAJ 5KNBA 2KQ3A 1TWCB 2Q2HA 5M3MH 2K33A 1NSNS 4O0AA 1G51A 1IYVA 4K0KL 3A55A 1QCBD 1EEFD 3RR5A 3HOYH 1NMGA 4KD4A 1EY5A 1Y8OB 4WFN3 4LF6Q 5C3XA 1H9JA 2WAQG 1O7LA 4QUFA 1C7YA 3VYRA 4R4QA 5M3MB 1JWMD 4UHVA 2ALYB 2P5ZX 4GN3B 3WOFA 3WDNA 2EYJA 1XNRQ 1RL2A 3HOYB 2ZJQA 2HHHL 3WOEA 1QZGA 4HIOA 3GTOB 4QIWE 2IWHA 2KOLA 1U9RA 5FLMG 2B2WA 1NCVA 2HCIA 3I55A 3RNUA 1HR0Q 1D5XC 4CKCA 4X3SA 2JA9A 3KK7A 4IPCA 1LO5D 2NTTA 2IW3A 3BJUA 2R92H 1R4QB 2Y0SB 3WWVA 4GN5A 2D62A 4MNOA 3K0YA 1MBYA 1XXGA 1HQRD 2C9OA 1LTID 1UUPA 4Y52H 1W3SA 1G91A 4A3JG 1JR0D 1CSPA 4JI5L 4L5SA 2R92B 1EL0A 1H9MA 3I73A 1HFNA 1ET9A 5C4XG 3EIVA 4NW2A 3HZXA 1VQAA 3JC66 4XT1B 2HDLA 3CQZH 4NKLA 1VQ7A 4GZYC 2RBMA 1MGSA 3IFDA 4PG3A 1Q1BA 5C4HA 2DY8A 1SJED 1FL0A 5C5LA 4BY1H 2KHIA 3PIOA 4JW0A 3GP7A 3S1MH 1N34L 2F0IA 3HKZE 1FNWA 5TSSA 3CQZB 4WORA 1SMYD 2A5HA 3V2TA 2GN5A 4KMUC 1XNQL 2XGTA 1Z7TA 1CKOA 1LV9A 1X9NA 2EVBA 5FLXE 4BY1B 3J81E 2SOBA 4A3BH 3S1MB 2R6GA 2UXDL 1G6PA 2LSSA 4LMQD 2E2HH 1TS4A 1TS2A 4RGNA 3RLOA 4LF8L 1JICA 4NB3A 3NBHA 4JI8Q 3LWEA 1Z6HA 1JQYD 4A3BB 5JOBA 1DCZA 1K8MA 3CU7A 1CSQA 1X3PA 3C1FA 1SROA 1HZAA 2ID0A 3UDFA 2F0KA 4R4CA 2JP1A 2E2HB 1E24A 2A6HD 3FDTA 4ZQ3A 4B3TL 4HCEA 3GTJH 2AQ2B 4BY7H 5T1IA 3KJPA 3JAMc 3GD7A 1XMOQ 3HEJA 5I6YA 1KNAA 4A3IG 2V1CC 1ZKOA 4DAMA 2HDMA 1V1QA 3TSSA 4RCNA 3GTJB 4KHPQ 4BY7B 3QWNA 2ZM6Q 1F9PA 4K5WA 2VQFQ 3HOXG 2F0UA 1KNEA 3TZUA 1KLGD 1S5FD 2A68D 4JPBW 1B7YB 4DV0Q 1BXTA 2CHBD 1SNPA 1C4QA 2NVYH 1EY6A 2UXCQ 1BUVT 3KDFB 3UE0A 2H5XA 1VQJA 1YIJA 4MN3A 3I4LA 3E9HA 2YV5A 1CT1D 3EBEA 3PUXA 4DV6L 1AE2A 4DN4M 3I4OA 4OO1G 1PZID 1QILA 1IW7D 2NVYB 3EROA 1VQEA 3STBD 4XTCS 1TS5A 4DR7Q 1VQ8A 1IBML 3T56B 5M3MG 4B3RL 4DV7L 1JE5A 1VMPA 4LF5Q 3HOYG 1F9SA 4NPSA 1K8GA 4RGMA 1P16A 1DXMA 1IL8A 4MIUA 3TP5A 1K3BC 2F0VA 2JA6G 4C56C 3TBIB 4R1JA 1C48A 2Y0SG 3MC0B 3E9IA 2ZXPA 4QMGA 5GQOA 4X64Q 1R9TH 2VUMG 4R4IA 3M4QA 1EQRA 4HAEA 4DA2A 2KEDA 4LAAA 1CFMA 3KFUA 3BZDB 2RHSB 1WD0A 4DUYQ 4F87A 1R9TB 2AWNA 4WJ4A 2K5WA 2I5MX 4G7ZC 1GXDC 4JBWA 1Q90A 1RD9D 5IYDH 1KXLA 4APVA 5G3LF 4HTHA 1HPCA 1BF4A 4HJ9A 4KKTA 1GD7A 4LFCQ 1STEA 5E1FA 2RQXA 4QB4A 3GV3A 1HCZA 3RZOH 4YWLA 2CH4W 3TEHB 1JB3A 1GJXA 1SYEA 5IGBA 1RTNA 3N52A 1EOTA 4FXGC 2KA7A 3HOUH 4BY1G 1PHJA 3J7AV 4DV3L 1TIID 3RZOB 4N9PA 1J6QA 3G6EA 1PH8A 3D4DA 3NEMA 2OTLA 1QUQB 1FVIA 4LJZC 2FXQA 2BOSA 5IGEA 1A2UA 5IY0A 4DV2L 4FDBA 2BCOA 4LF4L 1J5EQ 1O7ZA 3HOUB 2Z8LA 2HHHQ 3VR2A 4A3BG 1SNQA 3LX0A 1MJCA 4A3LH 1EIFA 1YNJC 4DR2L 2F3WA 2E5LQ 1JJCB 1I4XA 4A3CH 3DLLA 4ME5A 1EY4A 1LTRD 2CH4A 2QCPX 2F0JA 3DWQA 3D4WA 2QF7A 3OTOL 1EUJA 5IE8A 4IUNA 1YNND 2IT1A 4ME3A 4M8AA 4RFBA 4TRDA 3OYYA 1X65A 1X56A 3NXWA 1XPUA 2C5CA 5C0XI 4O2DA 1FYCA 4OEMB 2OQ0A 3TS0A 4GKJL 5ELCA 3GTPH 2SNSA 3Q23A 2F0QA 2X6GA 4DR5Q 3I4MG 1K0RA 3K5NA 2PMZB 4KKSA 3H09A 3W2DA 2M00A 3GTPB 2RDHA 2K5QA 3TS2A 1Y8NB 4F7XA 1ZYRD 4L63B 4WRDA 1SE3A 2ZT9C 4H44C 5C0XH 1N33Q 4DF7A 4BA2I 3OPOA 1VQGA 4LNQA 1XNRL 4TQUS 2B2TC 3CXCA 1RCVD 5IT9c 3TDQA 3CAMA 2VW9A 5CV9A 2D5DA 4LF8Q 3KF8B 1HR0L 2AUKA 4HJAA 2BA0A 1HUMA 1GVPA 1I6HH 1S40A 4I65A 2N8NA 4CKEA 3D0FA 3GDEA 1STGA 2I5LX 3VYTA 3CC2A 2E2JH 3K59A 4LK1C 2A8VA 3KDFA 1RHPA 1ASZA 3UDXA 1KC8C 1KL9A 4HIDA 1I6HB 3GTKH 2K75A 3NK9A 3RLFA 1L0XB 4IFDJ 1O7IA 2E2JB 1PH9A 1V1OA 1AEXA 2F0MA 1B44D 2ASBA 1IL2A 1F2MA 4NDXA 1E3PA 3GTKB 4G4KA 3R3OA 5EKIA 2EIFA 1SYDA 1XTCD 1RIPA 4LFAQ 1S5CD 1G6ZA 1GKHA 4X65Q 1W6JA 1STYA 1J9OA 5M3FH 4OONA 1MIUA 4YWMA 3QO2A 1B70B 3URYA 4R4TA 1ILPA 4DXGA 3HRZC 1EYDA 3PUVA 5FLXL 5JEAH 3J81L 2L15A 5BN4A 1DONA 2EYLA 3I8ZA 5IP9H 3DM1A 4YCWA 5ELEA 4E6IA 4GLVB 1QZHA 5M3FB 4JI4Q 2L11A 2L5TA 4HCSA 5JAVA 2B8FA 1WVLA 3KLSX 3M9BA 1NMFA 1IXRA 4UP9A 3A7LA 4JI8L 1ESRA 1DGSA 5CORA 3J80E 3UI2A 5LMNQ 2M2LA 5JPMC 3ERQA 4KN7C 2G9HD 3HOUG 1QE6A 1ICFB 4LUZA 1YHQA 3X3MA 4IPHA 4FNFA 3MFYA 1PFSA 1LM0A 4CDEC 1KAAA 2IPKD 5EKKA 1XMOL 2HIXA 3MXNB 2Z1CA 2ZTCA 1SMYC 2PQAA 1NTGA 1E2VA 1D5MC 1I5FA 2PO4A 1A3VA 5FO9B 4C3JH 3AMUA 2Z6BA 5J22A 5KYIA 3NWTA 1QOHA 4KHPL 4UP8A 2FMCA 4ZYSA 2ZM6L 1QVCA 4KJOA 2XWBB 5K36H 2VQFL 3U58A 4OIKA 1YITA 4C3JB 3RN2A 1UE5A 1VQ5A 3C2PA 1HFGA 1QB5D 4DV0L 1S5ED 2PW7A 1QUQA 1B8AA 1CI3M 4X62L 3NP8A 2UXCL 2EY6A 4R9WA 1K28A 2K14A 2XIWA 4IO9A 4BWGB 1MHWC 2O4XA 4DKAC 5DEHA 3VYSA 4JI1Q 1Q7YC 1PYSB 3VR6A 1W2BA 2PPBC 4IJHA 1OXTA 5C3EH 1T5EA 3AQQA 3CP0A 4XQQA 4PZ8A 4TSSA 2MFIA 2NBFA 1N9WA 4DR7L 4HJ8A 4YCVA 1ICWA 1NBWA 3PCOB 2L4NA 4KD3A 4B9XA 2F03A 3BZKA 3SGIA 3SHLA 3J81j 4DNTB 4FF4A 4LF5L 3K0XA 3RUZA 2O5IC 5C3EB 1BQQT 5FK9C 1H95A 3TP6A 3T1YQ 2IHEA 1WJJA 2WAQE 2EY1A 2BE5D 4MTKA 3JAME 1QJOA 1GHKA 2VNUD 1X3GA 5C0XG 1QNKA 1B53A 2B2UA 1PH5A 1ET6A 2EYHA 5ELDA 1U4MA 1EFWA 4YHHQ 3Q6SA 1YI2A 1SNMA 3K58A 1JORA 3CCEA 4X64L 4A93H 1ILQA 2RDGA 4NP5A 3PUYA 3X3NA 1EWCA 5AJ3Q 4P73A 2NWGA 3STBC 2B2YC 2VQEQ 1JJGA 3GV6A 4IURA 1CZGA 1TVXA 3OW2A 4DUYL 1YJNA 4A93B 1EEID 1OXXK 4U673 4C3IG 1XTDA 2EXZA 4B3MQ 3DM3A 3CKIB 2KCTA 2KECA 1L1OC 3A5UA 3PSIA 4PZ7A 4RG1A 4QCLA 4KY5A 3N6RA 4DR6Q 3HGBA 3CMEA 3JAMi 2N55A 4LFCL 1E0BA 2CQAA 4U68A 4JI2Q 1WTPA 3D8GA 2JXMB 1U4LA 4C1NK 4C3HH 5EPJA 3S17H 2F3VA 1WOCA 3K8AA 4M1UB 1SJHD 4TKOB 5BN5A 4A3DH 5IWAQ 1GHJA 4DR1Q 4KHZA 5F2DA 1BOSA 2RCFA 1TQOA 5M3FG 1IBLQ 3GTOH 4ZRZA 1GUWA 4C3HB 1VQPA 1WTWA 3S17B 1ML0D 2MNAA 4DR3Q 3S1NH 2EJGC 5M5XH 4CGYB 4DAYB 1SE8A 1HA6A 5IP9G 1J5EL 4A3DB 1CKNA 3J7ZC 3MXUA 1PRTD 4LWCA 2AQ1B 4RH6A 2HQEA 1AZQA 1PV4A 4AQYQ 1WTXA 1H9SB 4X3UA 2F4VQ 4FO2A 1II3A 1D1IA 4EVOA 2E5LL 3S1NB 5M5XB 2VS1A 3HKSA 1K73C 3SEBA 1VQIA 3Q22A 4OX9Q 1AFPA 1PH2A 4FYDA 4BBRH 4K8JA 2MO1A 1HHVA 3IFTA 3UE1A 1MKHA 4XQNA 4OXPA 1A3UA 4JG2A 4B9WA 1S3OA 1VQMA 3L9AX 4ZLTF 2LY7A 1LLRD 4BBRB 3BYTB 4QQBX 4LFBQ 2MUYA 1SE2A 1WTHA 4C3JG 3NQIA 4POFA 3EJIA 3F2UA 1PH7A 3S9WA 5GAEC 4DR5L 3GTGH 1E1TA 1VQHA 3H91A 1ASYA 3FRPB 3VR4A 4ZKBB 3ZYYX 3EVQA 5JVG3 1MSGA 3PIP3 4BBSH 2R93H 2JN4A 5IGDA 1QNUA 2Z4HA 5JPNC 2F0TA 3E3XA 3GTGB 3MXNA 4CDDC 5KYLA 2B2TA 1HXYD 1L1OB 1YVCA 4OGQC 1X32A 1N33L 3F1ZA 4ZAIA 2NB0A 4BBSB 2R93B 1YNNC 5CYUA 4L5RC 4GNXC 1V1PB 1PRTF 3KUPA 1Y1VH 3DWAA 2KHJA 3I72A 4A3FH 4ABNA 1ENFA 1B9MA 3TQYA 4LF9Q 2M9VA 2K03A 3BU2A 5C3EG 1UNSA 3PUZA 3J7AF 1AP0A 3HOZH 3J7A5 3A0JA 1CQVA 3NWSA 3C3LA 5DM73 1Q3LA 1SFOH 2QW7A 5C6AA 5KEEA 2QKIC 2KCNA 2CKZB 3DHQA 1I4HA 2WB1G 1Y1VB 3K6OA 1N8RC 1ENCA 5IGFA 4A3FB 1STNA 4KY7A 3TRZA 1CK1A 3HOZB 3KF6B 3OSOA 5E3FA 1O80A 2EOTA 1VQOA 2PCFB 1SFOB 1M1KC 2KUMA 2H4OA 1ZYRC 1WCMG 2MP1A 3MVVA 3R2TA 2F0GA 1SNDA 2NVQH 4KTAA 2PNHA 4UP7A 3FMCA 2Y0SE 1D6EC 1TXYA 4A93G 3H94A 3SK8A 1DD2A 2ZXRA 1AH9A 4LFAL 4DV5Q 1LACA 3CCLA 2NVQB 4X65L 4KK7A 2AHOB 5DM63 1PYBA 2X6LA 3G4SA 4UY8C 1EWHA 4XXEA 1BBWA 4X62Q 2K50A 1I3QH 3NPPA 3AB9A 3AYHB 2OWOA 4JC0A 5G3LD 4XYQA 5I9OA 1Q8IA 2L12A 3BDOA 1LUZA 1NR2A 4JI4L 5FO8B 5IT9E 5JJZA 4N8FA 3ZJYC 1I3QB 2ICEC 3J80L 4DUZQ 1BR9A 1Y69U 1EYGA 4IALA 5LMNL 3G71A 1CZWA 5FO7B 4ZUJA 3LWUA 4A3DG 1ONLA 5J3BA 4ZUIA 3A7AB 3I70A 3CC4A 4CBVA 4IFDI 3T51B 1A3TA 3J7YW 1N32Q 3ULPA 4GNXB 3GTQH 5EBCA 4PMWA 2J7ZA 1HNXQ 3P7JA 2PNRC 2DNCA 3I56A 1UAPA 1CTMA 4GOPC 3I2ZA 3S15H 1F9QA 4A4IA 4LW1A 4L8JA 4CDFC 3QIAA 4A75A 1EY9A 4JYAQ 1ESFA 2D0OA 4XQJA 1DOKA 1U0LA 4DXFA 1SNOA 1EU3A 3GTQB 2YTYA 5KRUA 4IJLA 4NXMQ 2I0QA 2FHTA 2F0EA 2PZUA 3TP8A 4KI0A 4POGA 2R92G 3S15B 5LL6S 4IFDH 4BBRG 1AN8A 1EFID 1SLJA 1ZEQX 2I07B 3D3RA 2N88A 4PZ6A 4DAYA 2Z9HA 3CCRA 4JCVE 4Q0FA 4YIJA 4JI1L 4JI3L 5FOBB 2K01A 1YHBA 2J4XA 1H9SA 1T9HA 2CW0C 4C2MH 1XJVA 4A3EH 4A3GH 1DJRD 2EY5A 2EZVA 1PTOD 5L37A 4XT3B 1VQNA 4BBSG 2R93G 2BA1A 3SR1A 2PI2A 3I90A 3JAML 1C9OA 4C2MB 1XWEA 4A3EB 3T1YL 1X3FA 4ODGA 1B1ZA 1EY0A 3NENA 4A3GB 3OWEB 1PLFA 1SAPA 4ZK9B 3S2HH 2SDFA 1YHAA 2Z6KC 3ITPA 3PO3H 2JSOA 4RWSC 5EGTA 1K9MC 2K5DA 4YHHL 3S1QH 3QR8A 1LTBD 1GM5A 1A15A 2K5NA 2NUCA 1Y1VG 3HP3A 2QEJC 4A3FG 1I94Q 2F0NA 4LUVA 5EAYA 2Z4IA 3S2HB 1B3AA 5M5WH 3PO3B 2VB3X 3HOZG 2LS01 5E4WC 5AJ3L 3MTSA 4JVZA 1AW7A 2VQEL 3S1QB 1I4QA 1YZ6A 1JC7A 4AH6A 3HOVH 2F1MA 1KAWA 2L1BA 1NE3A 3T13A 2PZTA 2TMPA 2NVXH 5FLXc 4B3SQ 2RSOA 3I91A 3FEWX 4B3ML 3CCSA 1UE6A 5M5WB 4BY7G 3RZDH 3QB3A 1RDPD 4AYBB 4CJ1B 1V1PA 4GOPB 2BE5C 3HOVB 4DR6L 3S2DH 4IOAA 4CJ2C 1B4OA 2NVXB 5IOCA 3H15A 1BVSA 4JI2L 2IJ0A 4DAPA 1D7QA 3Q8DA 1EOVA 3RZDB 2EPBA 3SK6A 4DK3C 1WI5A 1PTOF 2YTXA 1GUOA 3BVMA 3S2DB 2JA8H 3OW7A 5IWAL 5HGTA 2O5JC 4DR1L 2XRSD 1M8AA 1IBLL 2B8GA 4K2KA 3D6CA 3EN2A 3CPWA 3KF6A 1PDQA 4JK1C 2ATWA 1W6KA 2VZAA 1CA5A 3VA5A 1SDFA 4YCUA 4DR3L 5LL6X 1JWUD 2LKVA 2JA8B 4OWXB 1TWAH 1FGBD 1S4ZA 4OWTB 3M7GA 5ELFA 4AQYL 1B2TA 3KYHC 1SYFA 4IQZA 3OMGA 4R8NA 2F4VL 4JI6Q 1B9NA 2IL8A 3F8TA 3CRKC 2AUJD 3M7NA 1WTRA 4LUOA 1TWAB 4OX9L 1LTAD 2G9DA 1F2LA 1SRUA 1KHIA 1TS3A 3V05A 1VF5C 1QG7A 2WKDA 3UDIA 4FF1A 3FVQA 1SYBA 2IX1A 4JI0Q 4H02A 1TKWB 5GROA 3FKIH 3FPPA 1TT2A 2KCMA 3NTIA 2NZ1D 3T1HQ 1EY8A 2GVAA 1M4VA 5C4JH 1C0AA 2MPMA 2ENBA 1IBKQ 3GTMH 1TWFH 3DWPA 3PGZA 5H1SE 4LFBL 5C3WA 1IYUA 4IN3A 3ER0A 4P75A 5CR3A 2FMMA 3FKIB 3MA2B 1BO0A 1PRTC 2EYFA 2Q8RE 3MHBA 4EX5A 3BG3A 2F0FA 5C4JB 4KV6A 2F0SA 5NUCA 1KRTA 1EYAA 3GTMB 1TWFB 1JOOA 4MTNA 3CF5A 3I4NH 4K5XA 4UPAA 3NHHA 2DNEA 4IFDG 3DEOA 2ES2A 1HH2P 4JI7L 5GADC 3CCQA 4WJ3M 1E7ZA 3ICEA 5KNCA 3CW2C 5EQ0A 4GNXA 1YJ9A 2HIVA 5ELBA 3P1HA 3L3OC 2R7FA 2QA4A 2K52A 1YNXA 4ILWA 1A62A 3V96A 5IP7H 5IYDG 2G5DA 2A73B 3I4NB 3QOLA 2PMZE 5IGGA 2X69A 1D8LA 1DOMA 2RKSA 2B3GA 3SK4A 2ZJRA 1FJGQ 2K05A 3ND8A 4CJ0B 4K14A 5CV6A 4LF9L 2GVBA 1KTKA 2NN6I 2VY3A 2EJMA 4DFAA 2QDLA 4A3EG 1K3RA 3F2BA 2ICIA 1FR3A 1VQ6A 1VQKA 5JJKA 1Q81C 3A8KE 3L2PA 5I9PA 4NXNQ 1PXUA 2L0CA 4EQNA 1E1OA 5FLMH 3VR3A 2DJGC 3LNNA 1GUTA 2A69D 4DAVA 4A3MH 4J1MA 2CW0D 3PO3G 2NN6H 3DUZA 3U9SA 4GLAC 5D3IB 2JA5H 2F0PA 3KBXA 1NUCA 1U4PA 4A3LG 4IPGA 3K5OA 3TREA 3F2DA 4PNYA 4A3MB 1HNZQ 4A3JH 3K7AH 1UE1A 4IUVA 4DV5L 1LT5D 2AMCB 3AEVA 4A3CG 2CWAA 2KVMA 4KHVA 4AYBG 3R8BA 2K32A 2JA5B 3HOVG 4PQXA 4MZ9A 2B39A 1STHA 2CFMA 1EU4A 1KABA 2DN8A 2Q8TA 1F9RA 4F88A 4A3JB 3K7AB 4OELB 4PV1C 1M90C 1Q12A 5IT9L 4JI3Q 1I50H 1MD2D 3CCVA 2OF1A 3NBHB 1PRTB 2A1AA 2D9UA 3ERSX 2RCNA 5DAUA 1BKBA 3VA7A 3KLSA 4DUZL 1VQ9A 4L6TB 1G2TA 1EYCA 1LTSD 5AFWA 3MEFA 1I50B 1KDCA 4QGUA 2UU9Q 4HEDA 1KD1C 2QILA 1A63A 3GO5A 4XIGS 2K4KA 1NR4A 1GO3E 4ZKCB 5CV4A 4HN7A 2KCCA 1N32L 4GOPA 4RA8A 1HTLD 3L7ZC 2F52A 2PZWA 2D2CC 2AKWB 3K81C 1HNXL 2A74C 2WKCA 5JVH3 5IYCH 1AE3A 2OTJA 4JYAL 4QIWB 2QDBA 3M4OH 1PH4A 4IPDA 1CKMA 5M5YH 4NXML 2RVLA 1BCPD 1OXSC 2JYOA 3EA6A 1STAA 2N49A 4K2LA 2UUBQ 1XPOA 1PMRA 2N3SA 1RJTA 1CQFA 5I4DA 3M4OB 1KRSA 3K5MA 1Y14B 4RHRA 1CHQD 4G7HC 1TY2A 1HZBA 1K0SA 5M5YB 1K8OA 4GLXA 1KQSA 4XYOA 4FP5D 4QJFA 3L0OA 1WTQA 2Z0SA 1U4RA 5BN3A 4OO1I 2AQ3B 2V4DA 3H0GH 3HOXH 4RAUC 2I5HA 1A8VA 3P20A 4LF7Q 3KF8A 1EQQA 2PYKA 3MWYW 3PF4A 4IZ8A 2QEXA 2K6AA 4DR4Q 3H0GB 1OXVA 3HOXB 4RGTA 4X6AH 1K8AC 5C44H 4RCOA 1H9KA 4DK6C 3K5LA 3S1RH 3T53B 2UUAQ 4Q5VA 4OO1H 3HKZB 4MHEA 3E0EA 3NTKA 3OMCA 5T1GA 3KOJA 1B3QA 5JEAG 2H1EA 5C44B 5IP7G 2B63H 5CGKA 3S1RB 3PIPA 5CBEE 2K7VA 4DK0A 4V0BA 3ND9A 1I94L 3LGJA 3M3YH 1PVOA 5LHY1 3VDYA 1SN8A 1A6XA 3A8JE 1Q8KA 1PZJD 3A8IE 4O42A 3IRBA 4I7AA 1BBXC 1BCPF 1SMXA 2B63B 2WB1E 3FHWA 1L2FA 1EZ6A 2XWJB 1YEZA 3M3YB 3QJYA 3NELA 2JA6H 1V9PA 1PTOC 2OCEA 2NYZD 4B3SL 1SEBD 4H7BA 1QWYA 4X66Q 2Q2UA 3GTLH 1Z47A 3QOJA 2VUMH 5FKAC 2OT2A 3M4PA 2MJ8A 5JJIA 4A3MG 2L9HA 4DV4Q 2WIIB 3C46A 4FF2A 2NN6G 2JA6B 5E7NA 2IY5B 1EIYB 3OWFA 3RMHA 3OIQA 3J80c 2JA5G 3GTLB 3HG9A 1FD7D 2VUMB 4DNIA 2BH8A 1I4RA 3UDGA 5IGCA 1JWSD 1NNXA 5K36G 1D5ZC 3P75A 1Q1EA 5I2YA 3R2IA 1IYJB 3MXPA 1HJPA 4PMBA 4JI7Q 4HSVA 3KLRA 2YTVA 4P72A 1N36Q 1JJ2A 3D4RA 4N8X1 5D65A 5A2QE 1DYQA 5I2XA 3CHBD 1XMQQ 1JMCA 3HOWH 4QUCA 2KENA 2R3ZA 5K5PA 5EPKA 4JI6L 3MZ5A 2OQKA 5ELOA 3ULLA 1J8IA 2CVRA 2XN9C 2KHSA 2E75C 3A54A 3HOWB 3EFXD 3EQLC 2J0TD 1LTLA 2XVSA 2RDFA 3S24A 4JI0L 5HGQA 2R61A 1HTPA 1R4PB 1HNWQ 3OIPA 2RA4A 3T1HL 3PO2H 3SK5A 5HURA 1STBA 3U50C 1IBKL 2BDNA 4I7ZC 4EGVA 1PTOH 4IUQA 4CHTB 2EQSA 1OXUA 3A5ZB 3KLWA 5IYCG 3PF5A 1HR0W 3PUWA 1X6OA 2PI2E 2K1BA 4RHSA 5CV7A 3PO2B 3O13A 1IKLA 2F3IA 3E5SA 3BYYB 4A3KH 4JV5Q 3A74A 3NTHA 5D14A 1EWIA 3CC7A 1TWHH 2L55A 1PTOB 4GS3A 4YWKA 3PIO3 2K04A 1Q46A 3CD6A 4FVMA 5BR8Q 4P74A 4YY3Q 3BS1A 4DV1Q 1CA6A 2ZTDA 1PA6A 3BDLA 2BDOA 2BH2A 4A3KB 3T16A 1XPRA 5GAGC 3TMEA 1TWHB 3I4MH 4P71A 3J81i 3MFGA 2R7DA 3G6JB 3IKJA 4X3KA 5CV8A 1SBBB 3H0GG 1VMCA 4K5VA 3SE0A 1FJGL 1IZ6A 4RGOS 2Q2IA 1IHZA 3SDZA 3PMFA 5EKLA 4IUUA 1VQFA 3NSWA 4DGZA 4BXXH 3HKZG 3I4MB 4IUPA 5HY6A 3W1BA 4C3HG 4Y7NH 3MAQA 1FGUA 5A35A 5C44G 2XSCA 2UUCQ 4NXNL 4A76A 2EDGA 3S14H 1VQLA 3A56A 4J15A 4Y7NB 5LMUQ 3R93A 3Q0AA 1LTGD 2A19A 2B63G 4FXKC 2SEBD 3S14B 5COYA 1EQVA 1SE4A 1SR3A 2TSSA 3VR5A 5ISRA 2B29A 3M4YA 3CCJA 2FFKB 1ENAA 4GKKQ 1HNZL 2B2VC 4V190 4HR7B 4IUTA 3AFPA 5M9OA 1V8QA 4JOIC 3NE5B 2EXDA 3AU7A 2MHVA 4RKLA 1VS0A 2B2UC 2E74C 2WINB 1WD1A 2F4IA 2QGQA 1LABA 1V43A 1QVGA 2RHQB 1KIXA 1EZ8A 4ID6A 1WTVA 1OTCA 2A69C 5CC4A 3NUCA 1E2WA 4S3SA 3D31A 3PV0A 4N9TA 4C1NI 1PFBA 2F0LA 1WTOA 4B08A 2LXKA 2F0DA 3C1EA 4G7OC 1BNZA 2N78A 1EIGA 1X3EA 4QL5A 2UU9L 1E2ZA 2JEBI 5FJ8H 1Z9FA 3K7UC 3BDCA 1VQDA 1HRJA 1GUGA 5E4XA 2PQAB 2RSNA 2HD3A 4IOCA 1CHPD 3ONAB 2UXBQ 3CRLC 3RD4A 2E76C 2NVTH 2K28A 1T5XD 4K8IA 3T4AC 1WYDA 4H13C 2ZJPA 4K0KQ 2A6EC 3HOWG 2B2YA 1IKMA 1PZKD 3G7LA 1MJEA 2NVTB 1SYCA 1HZ9A 2KBNA 5I6WA 2GA4B 4ALPA 1I4GA 2UUBL 1HA5A 1YBYA 3U4ZA 2JA7H 3ULJA 1VQCA 1G2SA 1L1OA 3J81c 2FJ2A 1TWGH 2JJQA 3B6YA 4L5TA 3PO2G 1JB7A 1SYGA 2IHFA 3W1GA 1JT8A 2B2WC 2JA7B 2XRQD 3BZCA 3TZDA 4LF7L 4JBMA 2WACA 1TWGB 2XTIA 1XX8A 1LYLA 3W5OA 2WP8J
chains in the Genus database with same CATH topology
4BS9A 2KEEA 4DU9A 1LTTD 1BCPC 5KNDA 2HCCA 5CV5A 3SVMA 2EY2A 3NBIA 1D1KA 5IODA 2Q8IB 2VB2X 4DK1A 2PW5A 4NMZA 4UAIA 2KJXA 3QG1A 4OHJA 4HMJA 2HUGA 1F2ZA 1I4PA 3H3VC 3GQBA 1D2BA 3VYUA 1B50A 3BVGA 4EQPA 1HUNA 2EYOA 1GOZA 1Y1WB 5J39A 1TY0A 4G57A 4PMCA 1X3QA 4Z9CB 1OO9B 3TN2A 4KN4C 2IX0A 4QF4A 3E6ZX 3BVZA 1A2TA 4X3TA 2JE6I 1RODA 3W3AA 3OHXC 4OIJA 5DNFA 3DXJC 1H9RA 2LFNA 1PFMA 1KDBA 3H6MA 5KIXA 5KGUA 5A2QL 4C3IB 2YYZA 2R7ZB 1NAPA 2E2IB 1VCIA 2NTSA 1LT6D 2E2DC 4KY6A 2EE1A 1FNVA 1TU2B 2F0WA 4K6LA 1BDOA 4WJWA 1EY7A 2MGSA 4H0LC 3IL8A 1JOQA 1L0YB 1BCPB 4FF3A 1TR5A 1EIHA 3D6WA 5C4ZA 2I46A 2WAQB 3DEPA 1RF2D 1DZ1A 3U9OA 1F77A 1JE4A 1G8ZD 1ZXTA 5EJWA 2OEOA 2AWOA 4KJNA 1O7YA 2JEAI 2EJFC 2ZXOA 5C5MA 4BA1I 3MXGA 1XYIA 2IX3A 4EQOA 4R8IA 4FXDA 2LMCB 4OL7A 1I6VC 1RTOA 5CBAE 1Y8PB 4P2CB 1PYWD 2A6ED 3E0JA 5C4XB 2F0OA 3I3CA 4UDUC 1K83B 2OXPA 4HMIA 1UEAB 3TP7A 1LT4D 2O2LD 1VDZA 4ULLA 2WV6D 1S5BD 4RKBA 1GUSA 3KBGA 1DOLA 2A6HC 3OOCA 3FPUB 1YNJD 3NQTA 4O1NA 2VXWA 3Q24A 2DY7A 1G291 1KLUD 1S5DD 2FINB 1MSHA 3DMUA 5C0XJ 1SSOA 2EYPA 4J6HA 1SXTA 4XDXA 5CMDA 2B2VA 1SNCA 1PFNA 2EYMA 2SNMA 1RKNA 5J1ZA 1HQMC 5EBDA 2A68C 3IAYA 1JCKB 2WB1B 1FNUA 4CKBA 2F0HA 1VF7A 1CM9A 2PQEA 1MI2A 3HS0C 4KKUA 1F2YA 4DNRB 4HSPA 4A3IB 1IW7C 1WCMB 3K57A 1KDAA 3MEHA 1JOKA 3S16B 3M85A 5IIFA 1O78A 1AZPA 4F8MA 5EPLA 1LT3D 4K6DA 5D3DA 3SXHA 1EQTA 1GUNA 4J8QA 2YU9B 1DM0B 2XNAC 1C8CA 5JEAJ 5KNBA 2KQ3A 1TWCB 2K33A 1NSNS 1IYVA 3A55A 1QCBD 1EEFD 4KD4A 1EY5A 1Y8OB 4WFN3 5C3XA 1H9JA 1O7LA 4QUFA 3VYRA 5M3MB 1JWMD 3WOFA 3WDNA 2EYJA 3HOYB 3WOEA 3GTOB 2IWHA 2KOLA 1U9RA 2B2WA 1NCVA 2HCIA 1D5XC 4CKCA 4X3SA 3KK7A 1LO5D 2NTTA 2IW3A 1R4QB 2Y0SB 2D62A 3K0YA 1MBYA 1XXGA 1HQRD 2C9OA 1LTID 1UUPA 1G91A 1JR0D 2R92B 1EL0A 1H9MA 3I73A 1HFNA 1ET9A 4NW2A 3HZXA 4XT1B 2HDLA 4NKLA 4GZYC 2RBMA 1MGSA 3IFDA 1Q1BA 5C4HA 2DY8A 1SJED 5C5LA 3GP7A 2F0IA 1FNWA 5TSSA 3CQZB 4WORA 1SMYD 2A5HA 3V2TA 4KMUC 1Z7TA 1LV9A 2EVBA 5FLXE 4BY1B 3J81E 2SOBA 3S1MB 2R6GA 4LMQD 1TS4A 1TS2A 4RGNA 1JICA 3NBHA 3LWEA 1Z6HA 1JQYD 4A3BB 5JOBA 1DCZA 1K8MA 3CU7A 1X3PA 3C1FA 2ID0A 2F0KA 2JP1A 2E2HB 2A6HD 3FDTA 4ZQ3A 4HCEA 2AQ2B 5T1IA 3GD7A 3HEJA 5I6YA 1KNAA 1ZKOA 2HDMA 3TSSA 4RCNA 3GTJB 4BY7B 3QWNA 1F9PA 4K5WA 2F0UA 1KNEA 3TZUA 1KLGD 1S5FD 2A68D 1BXTA 2CHBD 1SNPA 1C4QA 1EY6A 1BUVT 4MN3A 3I4LA 1CT1D 3PUXA 4DN4M 4OO1G 1PZID 1QILA 1IW7D 2NVYB 3EROA 4XTCS 1TS5A 3T56B 1VMPA 1F9SA 4RGMA 1DXMA 1IL8A 4MIUA 3TP5A 2F0VA 4C56C 3TBIB 1C48A 3MC0B 2ZXPA 4QMGA 4HAEA 4DA2A 2KEDA 4LAAA 1CFMA 3BZDB 1WD0A 4F87A 1R9TB 2AWNA 2K5WA 4G7ZC 1GXDC 4JBWA 1Q90A 1RD9D 5G3LF 4HTHA 1HPCA 1BF4A 4KKTA 1STEA 5E1FA 2RQXA 4QB4A 3GV3A 1HCZA 1JB3A 1GJXA 1SYEA 5IGBA 1RTNA 3N52A 1EOTA 4FXGC 2KA7A 3J7AV 1TIID 3RZOB 4N9PA 3D4DA 4LJZC 2BOSA 5IGEA 1A2UA 2BCOA 1O7ZA 3HOUB 2Z8LA 3VR2A 1SNQA 3LX0A 1YNJC 2F3WA 1I4XA 4ME5A 1EY4A 1LTRD 2QCPX 2F0JA 3DWQA 3D4WA 2QF7A 4IUNA 1YNND 2IT1A 4M8AA 4RFBA 4TRDA 3NXWA 2C5CA 5C0XI 1FYCA 5ELCA 2SNSA 3Q23A 2F0QA 2X6GA 3K5NA 2PMZB 4KKSA 3H09A 3W2DA 2M00A 3GTPB 2RDHA 2K5QA 1Y8NB 4F7XA 1ZYRD 4L63B 4WRDA 1SE3A 2ZT9C 4H44C 5C0XH 4DF7A 4BA2I 3OPOA 4TQUS 2B2TC 1RCVD 3TDQA 5CV9A 2D5DA 2AUKA 2BA0A 1HUMA 4I65A 4CKEA 1STGA 3VYTA 3K59A 4LK1C 1RHPA 1I6HB 3NK9A 3RLFA 1L0XB 4IFDJ 2E2JB 1V1OA 1AEXA 2F0MA 1B44D 1F2MA 4NDXA 3GTKB 4G4KA 3R3OA 5EKIA 1SYDA 1XTCD 1S5CD 1G6ZA 1W6JA 1STYA 1J9OA 3QO2A 3URYA 1ILPA 4DXGA 3HRZC 1EYDA 3PUVA 5FLXL 5JEAH 3J81L 5BN4A 1DONA 2EYLA 3I8ZA 3DM1A 5ELEA 4E6IA 5M3FB 2L11A 2L5TA 4HCSA 5JAVA 2B8FA 1WVLA 3KLSX 3A7LA 1ESRA 5CORA 3J80E 3UI2A 2M2LA 5JPMC 3ERQA 4KN7C 2G9HD 1QE6A 3X3MA 4FNFA 3MFYA 1KAAA 2IPKD 5EKKA 2Z1CA 1SMYC 1E2VA 1D5MC 2PO4A 1A3VA 5FO9B 3AMUA 5J22A 5KYIA 3NWTA 1QOHA 2FMCA 4ZYSA 4KJOA 2XWBB 5K36H 4OIKA 4C3JB 3C2PA 1HFGA 1QB5D 1S5ED 2PW7A 1CI3M 3NP8A 2EY6A 4R9WA 2XIWA 4BWGB 2O4XA 5DEHA 3VYSA 3VR6A 2PPBC 1OXTA 1T5EA 4XQQA 4TSSA 2NBFA 1ICWA 2L4NA 4KD3A 4B9XA 2F03A 3SHLA 4DNTB 4FF4A 2O5IC 3RUZA 5C3EB 1BQQT 5FK9C 3TP6A 2EY1A 2BE5D 3JAME 1QJOA 1GHKA 2VNUD 5C0XG 1QNKA 1B53A 2B2UA 1ET6A 2EYHA 5ELDA 1U4MA 3Q6SA 1SNMA 3K58A 1JORA 1ILQA 2RDGA 4NP5A 3PUYA 3X3NA 1EWCA 2NWGA 2B2YC 3GV6A 4IURA 1CZGA 1TVXA 4A93B 1EEID 1OXXK 4U673 4C3IG 2EXZA 3CKIB 2KECA 4QCLA 4KY5A 3N6RA 3HGBA 2N55A 1E0BA 2CQAA 4U68A 1WTPA 3D8GA 2JXMB 1U4LA 4C1NK 5EPJA 2F3VA 4M1UB 1SJHD 4TKOB 5BN5A 1GHJA 4KHZA 5F2DA 1BOSA 1TQOA 4ZRZA 1GUWA 4C3HB 1WTWA 3S17B 1ML0D 1HA6A 2EJGC 4CGYB 4A3DB 4RH6A 3MXUA 1PRTD 2AQ1B 2HQEA 1AZQA 1WTXA 1H9SB 4X3UA 4FO2A 1II3A 1D1IA 4EVOA 3S1NB 5M5XB 3SEBA 1AFPA 3Q22A 4FYDA 4K8JA 1HHVA 3IFTA 4XQNA 1A3UA 4B9WA 3L9AX 4ZLTF 2LY7A 1LLRD 4BBRB 3BYTB 2MUYA 1SE2A 4C3JG 3NQIA 3EJIA 3F2UA 3S9WA 3H91A 3FRPB 3VR4A 4ZKBB 3ZYYX 3EVQA 5JVG3 1MSGA 3PIP3 5IGDA 1QNUA 2Z4HA 5JPNC 2F0TA 3GTGB 3MXNA 5KYLA 2B2TA 1HXYD 4OGQC 1X32A 4ZAIA 2NB0A 4BBSB 2R93B 1YNNC 5CYUA 1V1PB 1PRTF 3KUPA 3DWAA 3I72A 4ABNA 1ENFA 1B9MA 2M9VA 2K03A 1UNSA 3PUZA 3J7AF 1AP0A 1CQVA 3NWSA 3C3LA 5DM73 1Q3LA 5C6AA 5KEEA 2QKIC 2KCNA 3DHQA 1I4HA 1Y1VB 3K6OA 1ENCA 5IGFA 4A3FB 1STNA 4KY7A 1CK1A 3HOZB 3OSOA 5E3FA 1O80A 2EOTA 1SFOB 2PCFB 2KUMA 2H4OA 1ZYRC 2MP1A 3MVVA 3R2TA 2F0GA 1SNDA 4KTAA 3FMCA 1D6EC 3H94A 3SK8A 1DD2A 2ZXRA 1LACA 2NVQB 4KK7A 5DM63 2X6LA 1EWHA 4XXEA 3NPPA 3AB9A 5G3LD 4XYQA 5I9OA 1Q8IA 2L12A 3BDOA 1NR2A 5FO8B 5IT9E 5JJZA 1I3QB 2ICEC 3J80L 1BR9A 1Y69U 4IALA 1CZWA 5FO7B 4ZUJA 3LWUA 1ONLA 4ZUIA 3A7AB 3I70A 4CBVA 4IFDI 3T51B 1A3TA 3J7YW 5EBCA 4PMWA 2J7ZA 3P7JA 2PNRC 2DNCA 1UAPA 1CTMA 1F9QA 4L8JA 3QIAA 1EY9A 1ESFA 4XQJA 1DOKA 4DXFA 1SNOA 1EU3A 3GTQB 5KRUA 2FHTA 2F0EA 2PZUA 3TP8A 4KI0A 3S15B 5LL6S 4IFDH 1AN8A 1EFID 1ZEQX 2I07B 3D3RA 2N88A 4DAYA 4Q0FA 4YIJA 5FOBB 2K01A 2J4XA 1H9SA 2CW0C 1DJRD 2EY5A 2EZVA 1PTOD 4XT3B 2BA1A 3SR1A 3I90A 3JAML 4C2MB 1XWEA 4A3EB 4ODGA 1B1ZA 1EY0A 4A3GB 3OWEB 1PLFA 1SAPA 4ZK9B 2SDFA 3ITPA 2JSOA 4RWSC 5EGTA 2K5DA 1LTBD 1A15A 2NUCA 3HP3A 2QEJC 2F0NA 2Z4IA 3S2HB 1B3AA 3PO3B 2VB3X 2LS01 5E4WC 3MTSA 1AW7A 3S1QB 1I4QA 1JC7A 2F1MA 2L1BA 3T13A 2PZTA 2TMPA 2RSOA 3I91A 3FEWX 5M5WB 3QB3A 1RDPD 4AYBB 4CJ1B 1V1PA 2BE5C 3HOVB 4CJ2C 1B4OA 2NVXB 5IOCA 2IJ0A 4DAPA 3RZDB 2EPBA 3SK6A 1PTOF 1GUOA 3BVMA 3S2DB 3OW7A 5HGTA 2O5JC 2XRSD 1M8AA 2B8GA 4K2KA 3D6CA 1PDQA 4JK1C 1W6KA 1CA5A 3VA5A 1SDFA 5LL6X 1JWUD 2LKVA 2JA8B 1FGBD 1S4ZA 3M7GA 5ELFA 1B2TA 1SYFA 4IQZA 3OMGA 4R8NA 1B9NA 2IL8A 3CRKC 2AUJD 3M7NA 1WTRA 1TWAB 1LTAD 2G9DA 1F2LA 1TS3A 3V05A 1VF5C 1QG7A 2WKDA 4FF1A 3FVQA 1SYBA 2IX1A 1TKWB 3FPPA 1TT2A 3NTIA 2NZ1D 1EY8A 1M4VA 2MPMA 2ENBA 3DWPA 5C3WA 1IYUA 4IN3A 5CR3A 2FMMA 3FKIB 3MA2B 1BO0A 1PRTC 2EYFA 2Q8RE 3MHBA 3BG3A 2F0FA 5C4JB 4KV6A 2F0SA 5NUCA 1EYAA 3GTMB 1TWFB 1JOOA 4K5XA 3NHHA 2DNEA 4IFDG 3DEOA 5KNCA 5EQ0A 5ELBA 3L3OC 3P1HA 4ILWA 3V96A 2A73B 3I4NB 3QOLA 5IGGA 2X69A 1DOMA 3SK4A 2RKSA 2K05A 3ND8A 4CJ0B 4K14A 5CV6A 1KTKA 2NN6I 2EJMA 4DFAA 2ICIA 1FR3A 3A8KE 5I9PA 1PXUA 2L0CA 4EQNA 3VR3A 3LNNA 1GUTA 2A69D 4DAVA 4J1MA 2CW0D 2NN6H 3DUZA 3U9SA 5D3IB 2F0PA 3KBXA 1NUCA 1U4PA 3K5OA 4PNYA 4A3MB 4IUVA 1LT5D 2KVMA 4KHVA 3R8BA 2K32A 2JA5B 4PQXA 2B39A 1STHA 1EU4A 1KABA 2DN8A 2Q8TA 1F9RA 4F88A 4A3JB 3K7AB 4PV1C 1Q12A 5IT9L 1MD2D 2OF1A 1PRTB 2D9UA 5DAUA 3VA7A 3KLSA 4L6TB 1G2TA 1EYCA 1LTSD 5AFWA 1I50B 1KDCA 4HEDA 2QILA 3GO5A 4XIGS 1NR4A 4ZKCB 5CV4A 4HN7A 2KCCA 4RA8A 1HTLD 3L7ZC 2PZWA 2D2CC 2A74C 2WKCA 5JVH3 4QIWB 2QDBA 2RVLA 1BCPD 1OXSC 2JYOA 3EA6A 1STAA 4K2LA 1PMRA 5I4DA 1RJTA 1CQFA 3M4OB 3K5MA 4RHRA 1CHQD 4G7HC 1TY2A 5M5YB 1K8OA 4XYOA 4FP5D 1WTQA 1U4RA 5BN3A 4OO1I 2AQ3B 2V4DA 4RAUC 3P20A 3KF8A 2PYKA 3MWYW 4IZ8A 2K6AA 3H0GB 1OXVA 3HOXB 4RGTA 4RCOA 1H9KA 3K5LA 3T53B 4Q5VA 4OO1H 3HKZB 4MHEA 3NTKA 3OMCA 5T1GA 5JEAG 2H1EA 5C44B 5CGKA 3S1RB 5CBEE 2K7VA 4DK0A 4V0BA 3ND9A 5LHY1 1A6XA 3A8JE 1PZJD 3A8IE 4O42A 1BBXC 1BCPF 2B63B 1EZ6A 2XWJB 3M3YB 3QJYA 1PTOC 2NYZD 1SEBD 4H7BA 1QWYA 1Z47A 3QOJA 5FKAC 2OT2A 2MJ8A 2L9HA 2WIIB 3C46A 4FF2A 2NN6G 2JA6B 3OWFA 3RMHA 3OIQA 3GTLB 3HG9A 1FD7D 2VUMB 1I4RA 5IGCA 1JWSD 5K36G 1D5ZC 3P75A 1Q1EA 5I2YA 3R2IA 3MXPA 4PMBA 4HSVA 3KLRA 3D4RA 5D65A 5A2QE 1DYQA 5I2XA 3CHBD 4QUCA 2R3ZA 5K5PA 5EPKA 3MZ5A 1J8IA 2CVRA 2XN9C 2KHSA 2E75C 3A54A 3HOWB 3EFXD 3EQLC 2J0TD 2XVSA 2RDFA 2R61A 1HTPA 1R4PB 3OIPA 2RA4A 3SK5A 5HURA 1STBA 2BDNA 4I7ZC 4EGVA 1PTOH 4IUQA 4CHTB 1OXUA 3PUWA 4RHSA 2K1BA 5CV7A 3PO2B 3O13A 1IKLA 3E5SA 3BYYB 3NTHA 5D14A 2L55A 1PTOB 3PIO3 2K04A 4FVMA 3BS1A 1CA6A 3BDLA 2BDOA 4A3KB 3T16A 3TMEA 1TWHB 3MFGA 3G6JB 3IKJA 4X3KA 5CV8A 1SBBB 1VMCA 4K5VA 3SE0A 4RGOS 1IHZA 3SDZA 3PMFA 5EKLA 4IUUA 3NSWA 4DGZA 3I4MB 4IUPA 4C3HG 3MAQA 5A35A 2XSCA 2EDGA 3A56A 4Y7NB 3R93A 3Q0AA 1LTGD 4FXKC 2SEBD 3S14B 5COYA 1EQVA 1SE4A 2TSSA 3VR5A 5ISRA 3M4YA 2FFKB 1ENAA 2B2VC 4V190 4HR7B 4IUTA 5M9OA 1V8QA 3NE5B 3AU7A 2MHVA 4RKLA 2B2UC 2E74C 2WINB 1WD1A 2F4IA 1LABA 1V43A 1EZ8A 4ID6A 1WTVA 2A69C 5CC4A 3NUCA 1E2WA 4S3SA 3D31A 3PV0A 4N9TA 4C1NI 1PFBA 2F0LA 1WTOA 4B08A 2F0DA 3C1EA 4G7OC 1BNZA 1EIGA 1E2ZA 2JEBI 3BDCA 1HRJA 1GUGA 5E4XA 2RSNA 1CHPD 3ONAB 3RD4A 3CRLC 2E76C 2K28A 1T5XD 4K8IA 3T4AC 4H13C 2A6EC 2B2YA 1IKMA 1PZKD 3G7LA 2NVTB 1SYCA 5I6WA 2GA4B 1I4GA 1HA5A 1G2SA 2FJ2A 1SYGA 2B2WC 2JA7B 2XRQD 3TZDA 2WACA 1TWGB 1XX8A 2WP8J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZ8 A;  1SYF A;  2HQE A;  3OMG A;  4R8N A;  1JOQ A;  4PNY A;  4DU9 A;  1TR5 A;  2F0H A;  2KHS A;  2PQE A;  1AEX A;  1SNQ A;  2F0M A;  1II3 A;  2EY5 A;  3LX0 A;  3HZX A;  4EVO A;  5M9O A;  3SK8 A;  1F2M A;  3ERO A;  4NDX A;  5C4Z A;  4KHV A;  2F3W A;  5CV5 A;  3R3O A;  4NKL A;  1SYD A;  4RKL A;  2EY2 A;  1STH A;  2RBM A;  2RDF A;  3SR1 A;  1F2Y A;  4KD3 A;  4B9X A;  3U9O A;  4ME5 A;  1KAB A;  4K8J A;  1EY4 A;  5IOD A;  1SYB A;  1STY A;  4ODG A;  3SHL A;  5C4H A;  1EY0 A;  3OMC A;  1KDA A;  1TT2 A;  3MEH A;  3RUZ A;  2F0J A;  3SK5 A;  5HUR A;  2PW5 A;  1JOK A;  2OEO A;  4NMZ A;  3D4W A;  5C5L A;  1EZ8 A;  1EY8 A;  1STB A;  3TP6 A;  4ID6 A;  1A3U A;  4KJN A;  2EY1 A;  3ITP A;  4B9W A;  5CC4 A;  3NUC A;  4IUN A;  5IIF A;  5CGK A;  2F0I A;  5EGT A;  1EYD A;  4S3S A;  2ENB A;  2OF1 A;  4WOR A;  4N9T A;  4HMJ A;  5I9O A;  3V2T A;  2F0L A;  5C3W A;  2EYL A;  1F2Z A;  4TRD A;  5CV7 A;  2EYH A;  2F0D A;  3C1E A;  4MIU A;  2NUC A;  5CR3 A;  5DAU A;  3TP5 A;  4E6I A;  3NXW A;  4F8M A;  2F0N A;  2F0V A;  3E5S A;  2EYF A;  3MHB A;  1EYC A;  1SNM A;  3EJI A;  4K6D A;  5C5M A;  1JOR A;  2SOB A;  2F0F A;  3S9W A;  4KV6 A;  5JAV A;  4NP5 A;  1EZ6 A;  1KDC A;  2F0S A;  1EYA A;  2SNS A;  3BDC A;  5NUC A;  3SXH A;  4EQO A;  1JOO A;  4QMG A;  4IAL A;  2F0Q A;  4EQP A;  2EYO A;  4OL7 A;  3EVQ A;  4K5X A;  4H7B A;  3NHH A;  4ZUJ A;  3BDL A;  3T13 A;  5IGD A;  2PZT A;  5J39 A;  3ERQ A;  4LAA A;  5CV4 A;  2KQ3 A;  3QOJ A;  4G57 A;  4PMC A;  2F0T A;  4ZUI A;  3T16 A;  3TME A;  5JOB A;  1NSN S;  2F0O A;  3C1F A;  2M00 A;  2PZW A;  3P1H A;  2OXP A;  4K8I A;  5CV8 A;  2F0K A;  1A3T A;  3QB3 A;  4HMI A;  5KYL A;  2EXZ A;  4KD4 A;  1EY5 A;  4F7X A;  3TP7 A;  4K5V A;  4WRD A;  4ZQ3 A;  1KAA A;  3OWF A;  3QOL A;  4QF4 A;  5EKK A;  5IGG A;  1IHZ A;  1A2T A;  2RKS A;  3SK4 A;  4DF7 A;  3PMF A;  5EKL A;  5C3X A;  4K14 A;  4KY5 A;  5CV6 A;  4DGZ A;  5IOC A;  2QDB A;  3HEJ A;  4HTH A;  5I6Y A;  1A3V A;  1EY9 A;  1SYC A;  4RKB A;  4DFA A;  5IGC A;  5J22 A;  5KYI A;  5I6W A;  2EYJ A;  1SNO A;  3SK6 A;  3P75 A;  5E1F A;  1KDB A;  3D8G A;  3NQT A;  3H6M A;  4QB4 A;  5KRU A;  1STA A;  5CV9 A;  4K2L A;  4KJO A;  2F0E A;  2F3V A;  5KIX A;  1U9R A;  2PZU A;  5C6A A;  5KGU A;  5KEE A;  3MXP A;  4PMB A;  3TP8 A;  3DHQ A;  5HGT A;  3DMU A;  5I9P A;  1ENC A;  5IGF A;  4K5W A;  1SYE A;  4K2K A;  3D6C A;  5IGB A;  4I65 A;  2F0U A;  1STN A;  4EQN A;  2EYP A;  1SYG A;  5F2D A;  2PYK A;  4KY7 A;  1TQO A;  4KY6 A;  1STG A;  4J6H A;  2PW7 A;  3VA5 A;  3OSO A;  4J1M A;  5E3F A;  2F0W A;  3NP8 A;  1SNC A;  4N9P A;  2EY6 A;  2LKV A;  1SNP A;  2EYM A;  3D4D A;  2SNM A;  4YIJ A;  1RKN A;  1EQV A;  2WAC A;  1EY6 A;  1EY7 A;  3MVV A;  5IGE A;  1A2U A;  2O4X A;  5J1Z A;  5ISR A;  2F0G A;  1SND A;  2F0P A;  4KTA A;  5DEH A;  5K5P A;  3MZ5 A;  1NUC A;  3NK9 A;  1ENA A; 
#chains in the Genus database with same CATH topology
 2DJF C;  4DR4 L;  2K5H A;  4A3K G;  4BS9 A;  2KEE A;  4DU9 A;  4JI5 Q;  1LTT D;  1L0W A;  1BCP C;  5KND A;  2UUA L;  2HCC A;  1CUK A;  5CV5 A;  3SVM A;  2C35 B;  3RN5 A;  2EY2 A;  3NBI A;  1D1K A;  4L5Q A;  5IOD A;  2Q8I B;  2VB2 X;  4DK1 A;  2PW5 A;  4NMZ A;  3I7F A;  1YJW A;  4UAI A;  2KJX A;  3QG1 A;  4OWW B;  4OHJ A;  4HMJ A;  2HUG A;  5IYB H;  1N34 Q;  4LF6 L;  1F2Z A;  1I4P A;  3H3V C;  4BXX G;  3GQB A;  1Y1W H;  5GAH C;  1XNQ Q;  1D2B A;  4RMF A;  3VYU A;  4EQ5 A;  1B50 A;  3BVG A;  3KJO A;  4QY7 A;  4EQP A;  2UXD Q;  4GN4 B;  1HUN A;  2EYO A;  4X66 L;  1GOZ A;  1Y1W B;  5J39 A;  1TY0 A;  4G57 A;  4PMC A;  4DV4 L;  1X3Q A;  4Z9C B;  1OO9 B;  1U5K A;  3TN2 A;  4KN4 C;  2IX0 A;  4QF4 A;  3E6Z X;  3BVZ A;  1A2T A;  2RF4 A;  4X3T A;  2JE6 I;  4C3I H;  1ROD A;  4B3T Q;  2R7Z H;  2JQO A;  4ZCK A;  3W3A A;  2E2I H;  4AYB E;  3OHX C;  4JBK A;  4OIJ A;  5DNF A;  3DXJ C;  1H9R A;  2LFN A;  1PFM A;  1KDB A;  1VQB A;  3H6M A;  5KIX A;  5KGU A;  1CKN B;  5A2Q L;  4C3I B;  2YYZ A;  1N36 L;  2R7Z B;  1NAP A;  2E2I B;  1VCI A;  2NTS A;  1LT6 D;  2E2D C;  1HZC A;  4KY6 A;  2EE1 A;  3H3V I;  1XMQ L;  1FNV A;  1TU2 B;  3CCM A;  2F0W A;  4HJ7 A;  4K6L A;  2JK8 A;  1BDO A;  4WJW A;  2HQL A;  1EY7 A;  2MGS A;  1VQ4 A;  4A3G G;  4H0L C;  3IL8 A;  1JOQ A;  1L0Y B;  1BCP B;  4FF3 A;  1TR5 A;  2MQH A;  2NZH A;  1EIH A;  3AFQ A;  5FJ8 G;  4DV6 Q;  3D6W A;  1PH1 A;  5C4Z A;  1HNW L;  2I46 A;  1E22 A;  2WAQ B;  2CCZ A;  3H3V H;  3DEP A;  1RF2 D;  1DZ1 A;  3U9O A;  1X55 A;  2CWP A;  1F77 A;  1JE4 A;  1G8Z D;  1ZXT A;  5EJW A;  2OEO A;  2AWO A;  1IBM Q;  5JJL A;  4B3R Q;  2HT1 A;  4KJN A;  1O7Y A;  4DV7 Q;  1NJI C;  1QVF A;  2JEA I;  4JV5 L;  2EJF C;  3U4V A;  2ZXO A;  5C5M A;  4BA1 I;  3F2C A;  5C4X H;  5BR8 L;  3MXG A;  4YY3 L;  1UE7 A;  4DV1 L;  1XYI A;  1WFQ A;  1K83 H;  4EQO A;  2IX3 A;  4R8I A;  4FXD A;  2LMC B;  1NY4 A;  1UWV A;  2JA7 G;  4HIK A;  4OL7 A;  1I6V C;  1RTO A;  5CBA E;  1Y8P B;  4P2C B;  4DPG A;  1PYW D;  2VL6 A;  2A6E D;  3E0J A;  5C4X B;  2F0O A;  1Q82 C;  3I3C A;  4UDU C;  1K83 B;  2OXP A;  4HMI A;  4JBJ A;  1UEA B;  3TP7 A;  1LT4 D;  2O2L D;  1VDZ A;  4ULL A;  3J80 i;  2Q2T A;  4KLK A;  1S72 A;  2WV6 D;  1S5B D;  4CDC C;  2DUD A;  4RKB A;  1GUS A;  3KBG A;  1DOL A;  2A6H C;  3OOC A;  4HIM A;  2JA8 G;  2UUC L;  3FPU B;  1UEB A;  1YNJ D;  3NQT A;  4O1N A;  2VXW A;  3Q24 A;  2DY7 A;  1G29 1;  3CMA A;  1KLU D;  1S5D D;  2FIN B;  1MSH A;  3PQI A;  3DMU A;  1A0I A;  2ZTE A;  5LMU L;  5C0X J;  1PH6 A;  1SSO A;  4R4O A;  2EYP A;  2K5V A;  4J6H A;  1SXT A;  4XDX A;  5CMD A;  2B2V A;  1SNC A;  3HFZ B;  1PFN A;  2EYM A;  2D0P A;  2SNM A;  4DV3 Q;  1RKN A;  3CPF A;  4GKK L;  5IYB G;  5LMN W;  5J1Z A;  1HQM C;  5EBD A;  2A68 C;  4JOI A;  1P8L A;  3IAY A;  1JCK B;  1Y1W G;  4A3I H;  4DV2 Q;  2WB1 B;  2MO0 A;  1PH3 A;  1WCM H;  1FNU A;  4CKB A;  4LF4 Q;  2F0H A;  1VF7 A;  1CM9 A;  2PQE A;  1MI2 A;  3HS0 C;  3S16 H;  2E8G A;  3FKI G;  3RLN A;  4DR2 Q;  4KKU A;  1F2Y A;  4DNR B;  4HSP A;  4A3I B;  4TVA B;  1IW7 C;  1WCM B;  3K57 A;  1BBU A;  2WFW A;  1KDA A;  2CQO A;  3MEH A;  2DGY A;  1JOK A;  3FP9 A;  1X54 A;  3S16 B;  3M85 A;  3CCU A;  5IIF A;  5DLQ E;  1Q86 C;  3OTO Q;  1O78 A;  3G48 A;  2YU9 H;  2LXJ A;  2R7Z G;  1AZP A;  4F8M A;  5EPL A;  1LT3 D;  1TWC H;  4K6D A;  2NZO A;  2Z6K A;  5D3D A;  5ELN A;  3I4N G;  4AIM A;  3SXH A;  1EQT A;  1GUN A;  4J8Q A;  3K80 C;  2YU9 B;  4GKJ Q;  1DM0 B;  2XNA C;  1C8C A;  2UXB L;  4HJ5 A;  5JEA J;  5KNB A;  2KQ3 A;  1TWC B;  2Q2H A;  5M3M H;  2K33 A;  1NSN S;  4O0A A;  1G51 A;  1IYV A;  4K0K L;  3A55 A;  1QCB D;  1EEF D;  3RR5 A;  3HOY H;  1NMG A;  4KD4 A;  1EY5 A;  1Y8O B;  4WFN 3;  4LF6 Q;  5C3X A;  1H9J A;  2WAQ G;  1O7L A;  4QUF A;  1C7Y A;  3VYR A;  4R4Q A;  5M3M B;  1JWM D;  4UHV A;  2ALY B;  2P5Z X;  4GN3 B;  3WOF A;  3WDN A;  2EYJ A;  1XNR Q;  1RL2 A;  3HOY B;  2ZJQ A;  2HHH L;  3WOE A;  1QZG A;  4HIO A;  3GTO B;  4QIW E;  2IWH A;  2KOL A;  1U9R A;  5FLM G;  2B2W A;  1NCV A;  2HCI A;  3I55 A;  3RNU A;  1HR0 Q;  1D5X C;  4CKC A;  4X3S A;  2JA9 A;  3KK7 A;  4IPC A;  1LO5 D;  2NTT A;  2IW3 A;  3BJU A;  2R92 H;  1R4Q B;  2Y0S B;  3WWV A;  4GN5 A;  2D62 A;  4MNO A;  3K0Y A;  1MBY A;  1XXG A;  1HQR D;  2C9O A;  1LTI D;  1UUP A;  4Y52 H;  1W3S A;  1G91 A;  4A3J G;  1JR0 D;  1CSP A;  4JI5 L;  4L5S A;  2R92 B;  1EL0 A;  1H9M A;  3I73 A;  1HFN A;  1ET9 A;  5C4X G;  3EIV A;  4NW2 A;  3HZX A;  1VQA A;  3JC6 6;  4XT1 B;  2HDL A;  3CQZ H;  4NKL A;  1VQ7 A;  4GZY C;  2RBM A;  1MGS A;  3IFD A;  4PG3 A;  1Q1B A;  5C4H A;  2DY8 A;  1SJE D;  1FL0 A;  5C5L A;  4BY1 H;  2KHI A;  3PIO A;  4JW0 A;  3GP7 A;  3S1M H;  1N34 L;  2F0I A;  3HKZ E;  1FNW A;  5TSS A;  3CQZ B;  4WOR A;  1SMY D;  2A5H A;  3V2T A;  2GN5 A;  4KMU C;  1XNQ L;  2XGT A;  1Z7T A;  1CKO A;  1LV9 A;  1X9N A;  2EVB A;  5FLX E;  4BY1 B;  3J81 E;  2SOB A;  4A3B H;  3S1M B;  2R6G A;  2UXD L;  1G6P A;  2LSS A;  4LMQ D;  2E2H H;  1TS4 A;  1TS2 A;  4RGN A;  3RLO A;  4LF8 L;  1JIC A;  4NB3 A;  3NBH A;  4JI8 Q;  3LWE A;  1Z6H A;  1JQY D;  4A3B B;  5JOB A;  1DCZ A;  1K8M A;  3CU7 A;  1CSQ A;  1X3P A;  3C1F A;  1SRO A;  1HZA A;  2ID0 A;  3UDF A;  2F0K A;  4R4C A;  2JP1 A;  2E2H B;  1E24 A;  2A6H D;  3FDT A;  4ZQ3 A;  4B3T L;  4HCE A;  3GTJ H;  2AQ2 B;  4BY7 H;  5T1I A;  3KJP A;  3JAM c;  3GD7 A;  1XMO Q;  3HEJ A;  5I6Y A;  1KNA A;  4A3I G;  2V1C C;  1ZKO A;  4DAM A;  2HDM A;  1V1Q A;  3TSS A;  4RCN A;  3GTJ B;  4KHP Q;  4BY7 B;  3QWN A;  2ZM6 Q;  1F9P A;  4K5W A;  2VQF Q;  3HOX G;  2F0U A;  1KNE A;  3TZU A;  1KLG D;  1S5F D;  2A68 D;  4JPB W;  1B7Y B;  4DV0 Q;  1BXT A;  2CHB D;  1SNP A;  1C4Q A;  2NVY H;  1EY6 A;  2UXC Q;  1BUV T;  3KDF B;  3UE0 A;  2H5X A;  1VQJ A;  1YIJ A;  4MN3 A;  3I4L A;  3E9H A;  2YV5 A;  1CT1 D;  3EBE A;  3PUX A;  4DV6 L;  1AE2 A;  4DN4 M;  3I4O A;  4OO1 G;  1PZI D;  1QIL A;  1IW7 D;  2NVY B;  3ERO A;  1VQE A;  3STB D;  4XTC S;  1TS5 A;  4DR7 Q;  1VQ8 A;  1IBM L;  3T56 B;  5M3M G;  4B3R L;  4DV7 L;  1JE5 A;  1VMP A;  4LF5 Q;  3HOY G;  1F9S A;  4NPS A;  1K8G A;  4RGM A;  1P16 A;  1DXM A;  1IL8 A;  4MIU A;  3TP5 A;  1K3B C;  2F0V A;  2JA6 G;  4C56 C;  3TBI B;  4R1J A;  1C48 A;  2Y0S G;  3MC0 B;  3E9I A;  2ZXP A;  4QMG A;  5GQO A;  4X64 Q;  1R9T H;  2VUM G;  4R4I A;  3M4Q A;  1EQR A;  4HAE A;  4DA2 A;  2KED A;  4LAA A;  1CFM A;  3KFU A;  3BZD B;  2RHS B;  1WD0 A;  4DUY Q;  4F87 A;  1R9T B;  2AWN A;  4WJ4 A;  2K5W A;  2I5M X;  4G7Z C;  1GXD C;  4JBW A;  1Q90 A;  1RD9 D;  5IYD H;  1KXL A;  4APV A;  5G3L F;  4HTH A;  1HPC A;  1BF4 A;  4HJ9 A;  4KKT A;  1GD7 A;  4LFC Q;  1STE A;  5E1F A;  2RQX A;  4QB4 A;  3GV3 A;  1HCZ A;  3RZO H;  4YWL A;  2CH4 W;  3TEH B;  1JB3 A;  1GJX A;  1SYE A;  5IGB A;  1RTN A;  3N52 A;  1EOT A;  4FXG C;  2KA7 A;  3HOU H;  4BY1 G;  1PHJ A;  3J7A V;  4DV3 L;  1TII D;  3RZO B;  4N9P A;  1J6Q A;  3G6E A;  1PH8 A;  3D4D A;  3NEM A;  2OTL A;  1QUQ B;  1FVI A;  4LJZ C;  2FXQ A;  2BOS A;  5IGE A;  1A2U A;  5IY0 A;  4DV2 L;  4FDB A;  2BCO A;  4LF4 L;  1J5E Q;  1O7Z A;  3HOU B;  2Z8L A;  2HHH Q;  3VR2 A;  4A3B G;  1SNQ A;  3LX0 A;  1MJC A;  4A3L H;  1EIF A;  1YNJ C;  4DR2 L;  2F3W A;  2E5L Q;  1JJC B;  1I4X A;  4A3C H;  3DLL A;  4ME5 A;  1EY4 A;  1LTR D;  2CH4 A;  2QCP X;  2F0J A;  3DWQ A;  3D4W A;  2QF7 A;  3OTO L;  1EUJ A;  5IE8 A;  4IUN A;  1YNN D;  2IT1 A;  4ME3 A;  4M8A A;  4RFB A;  4TRD A;  3OYY A;  1X65 A;  1X56 A;  3NXW A;  1XPU A;  2C5C A;  5C0X I;  4O2D A;  1FYC A;  4OEM B;  2OQ0 A;  3TS0 A;  4GKJ L;  5ELC A;  3GTP H;  2SNS A;  3Q23 A;  2F0Q A;  2X6G A;  4DR5 Q;  3I4M G;  1K0R A;  3K5N A;  2PMZ B;  4KKS A;  3H09 A;  3W2D A;  2M00 A;  3GTP B;  2RDH A;  2K5Q A;  3TS2 A;  1Y8N B;  4F7X A;  1ZYR D;  4L63 B;  4WRD A;  1SE3 A;  2ZT9 C;  4H44 C;  5C0X H;  1N33 Q;  4DF7 A;  4BA2 I;  3OPO A;  1VQG A;  4LNQ A;  1XNR L;  4TQU S;  2B2T C;  3CXC A;  1RCV D;  5IT9 c;  3TDQ A;  3CAM A;  2VW9 A;  5CV9 A;  2D5D A;  4LF8 Q;  3KF8 B;  1HR0 L;  2AUK A;  4HJA A;  2BA0 A;  1HUM A;  1GVP A;  1I6H H;  1S40 A;  4I65 A;  2N8N A;  4CKE A;  3D0F A;  3GDE A;  1STG A;  2I5L X;  3VYT A;  3CC2 A;  2E2J H;  3K59 A;  4LK1 C;  2A8V A;  3KDF A;  1RHP A;  1ASZ A;  3UDX A;  1KC8 C;  1KL9 A;  4HID A;  1I6H B;  3GTK H;  2K75 A;  3NK9 A;  3RLF A;  1L0X B;  4IFD J;  1O7I A;  2E2J B;  1PH9 A;  1V1O A;  1AEX A;  2F0M A;  1B44 D;  2ASB A;  1IL2 A;  1F2M A;  4NDX A;  1E3P A;  3GTK B;  4G4K A;  3R3O A;  5EKI A;  2EIF A;  1SYD A;  1XTC D;  1RIP A;  4LFA Q;  1S5C D;  1G6Z A;  1GKH A;  4X65 Q;  1W6J A;  1STY A;  1J9O A;  5M3F H;  4OON A;  1MIU A;  4YWM A;  3QO2 A;  1B70 B;  3URY A;  4R4T A;  1ILP A;  4DXG A;  3HRZ C;  1EYD A;  3PUV A;  5FLX L;  5JEA H;  3J81 L;  2L15 A;  5BN4 A;  1DON A;  2EYL A;  3I8Z A;  5IP9 H;  3DM1 A;  4YCW A;  5ELE A;  4E6I A;  4GLV B;  1QZH A;  5M3F B;  4JI4 Q;  2L11 A;  2L5T A;  4HCS A;  5JAV A;  2B8F A;  1WVL A;  3KLS X;  3M9B A;  1NMF A;  1IXR A;  4UP9 A;  3A7L A;  4JI8 L;  1ESR A;  1DGS A;  5COR A;  3J80 E;  3UI2 A;  5LMN Q;  2M2L A;  5JPM C;  3ERQ A;  4KN7 C;  2G9H D;  3HOU G;  1QE6 A;  1ICF B;  4LUZ A;  1YHQ A;  3X3M A;  4IPH A;  4FNF A;  3MFY A;  1PFS A;  1LM0 A;  4CDE C;  1KAA A;  2IPK D;  5EKK A;  1XMO L;  2HIX A;  3MXN B;  2Z1C A;  2ZTC A;  1SMY C;  2PQA A;  1NTG A;  1E2V A;  1D5M C;  1I5F A;  2PO4 A;  1A3V A;  5FO9 B;  4C3J H;  3AMU A;  2Z6B A;  5J22 A;  5KYI A;  3NWT A;  1QOH A;  4KHP L;  4UP8 A;  2FMC A;  4ZYS A;  2ZM6 L;  1QVC A;  4KJO A;  2XWB B;  5K36 H;  2VQF L;  3U58 A;  4OIK A;  1YIT A;  4C3J B;  3RN2 A;  1UE5 A;  1VQ5 A;  3C2P A;  1HFG A;  1QB5 D;  4DV0 L;  1S5E D;  2PW7 A;  1QUQ A;  1B8A A;  1CI3 M;  4X62 L;  3NP8 A;  2UXC L;  2EY6 A;  4R9W A;  1K28 A;  2K14 A;  2XIW A;  4IO9 A;  4BWG B;  1MHW C;  2O4X A;  4DKA C;  5DEH A;  3VYS A;  4JI1 Q;  1Q7Y C;  1PYS B;  3VR6 A;  1W2B A;  2PPB C;  4IJH A;  1OXT A;  5C3E H;  1T5E A;  3AQQ A;  3CP0 A;  4XQQ A;  4PZ8 A;  4TSS A;  2MFI A;  2NBF A;  1N9W A;  4DR7 L;  4HJ8 A;  4YCV A;  1ICW A;  1NBW A;  3PCO B;  2L4N A;  4KD3 A;  4B9X A;  2F03 A;  3BZK A;  3SGI A;  3SHL A;  3J81 j;  4DNT B;  4FF4 A;  4LF5 L;  3K0X A;  3RUZ A;  2O5I C;  5C3E B;  1BQQ T;  5FK9 C;  1H95 A;  3TP6 A;  3T1Y Q;  2IHE A;  1WJJ A;  2WAQ E;  2EY1 A;  2BE5 D;  4MTK A;  3JAM E;  1QJO A;  1GHK A;  2VNU D;  1X3G A;  5C0X G;  1QNK A;  1B53 A;  2B2U A;  1PH5 A;  1ET6 A;  2EYH A;  5ELD A;  1U4M A;  1EFW A;  4YHH Q;  3Q6S A;  1YI2 A;  1SNM A;  3K58 A;  1JOR A;  3CCE A;  4X64 L;  4A93 H;  1ILQ A;  2RDG A;  4NP5 A;  3PUY A;  3X3N A;  1EWC A;  5AJ3 Q;  4P73 A;  2NWG A;  3STB C;  2B2Y C;  2VQE Q;  1JJG A;  3GV6 A;  4IUR A;  1CZG A;  1TVX A;  3OW2 A;  4DUY L;  1YJN A;  4A93 B;  1EEI D;  1OXX K;  4U67 3;  4C3I G;  1XTD A;  2EXZ A;  4B3M Q;  3DM3 A;  3CKI B;  2KCT A;  2KEC A;  1L1O C;  3A5U A;  3PSI A;  4PZ7 A;  4RG1 A;  4QCL A;  4KY5 A;  3N6R A;  4DR6 Q;  3HGB A;  3CME A;  3JAM i;  2N55 A;  4LFC L;  1E0B A;  2CQA A;  4U68 A;  4JI2 Q;  1WTP A;  3D8G A;  2JXM B;  1U4L A;  4C1N K;  4C3H H;  5EPJ A;  3S17 H;  2F3V A;  1WOC A;  3K8A A;  4M1U B;  1SJH D;  4TKO B;  5BN5 A;  4A3D H;  5IWA Q;  1GHJ A;  4DR1 Q;  4KHZ A;  5F2D A;  1BOS A;  2RCF A;  1TQO A;  5M3F G;  1IBL Q;  3GTO H;  4ZRZ A;  1GUW A;  4C3H B;  1VQP A;  1WTW A;  3S17 B;  1ML0 D;  2MNA A;  4DR3 Q;  3S1N H;  2EJG C;  5M5X H;  4CGY B;  4DAY B;  1SE8 A;  1HA6 A;  5IP9 G;  1J5E L;  4A3D B;  1CKN A;  3J7Z C;  3MXU A;  1PRT D;  4LWC A;  2AQ1 B;  4RH6 A;  2HQE A;  1AZQ A;  1PV4 A;  4AQY Q;  1WTX A;  1H9S B;  4X3U A;  2F4V Q;  4FO2 A;  1II3 A;  1D1I A;  4EVO A;  2E5L L;  3S1N B;  5M5X B;  2VS1 A;  3HKS A;  1K73 C;  3SEB A;  1VQI A;  3Q22 A;  4OX9 Q;  1AFP A;  1PH2 A;  4FYD A;  4BBR H;  4K8J A;  2MO1 A;  1HHV A;  3IFT A;  3UE1 A;  1MKH A;  4XQN A;  4OXP A;  1A3U A;  4JG2 A;  4B9W A;  1S3O A;  1VQM A;  3L9A X;  4ZLT F;  2LY7 A;  1LLR D;  4BBR B;  3BYT B;  4QQB X;  4LFB Q;  2MUY A;  1SE2 A;  1WTH A;  4C3J G;  3NQI A;  4POF A;  3EJI A;  3F2U A;  1PH7 A;  3S9W A;  5GAE C;  4DR5 L;  3GTG H;  1E1T A;  1VQH A;  3H91 A;  1ASY A;  3FRP B;  3VR4 A;  4ZKB B;  3ZYY X;  3EVQ A;  5JVG 3;  1MSG A;  3PIP 3;  4BBS H;  2R93 H;  2JN4 A;  5IGD A;  1QNU A;  2Z4H A;  5JPN C;  2F0T A;  3E3X A;  3GTG B;  3MXN A;  4CDD C;  5KYL A;  2B2T A;  1HXY D;  1L1O B;  1YVC A;  4OGQ C;  1X32 A;  1N33 L;  3F1Z A;  4ZAI A;  2NB0 A;  4BBS B;  2R93 B;  1YNN C;  5CYU A;  4L5R C;  4GNX C;  1V1P B;  1PRT F;  3KUP A;  1Y1V H;  3DWA A;  2KHJ A;  3I72 A;  4A3F H;  4ABN A;  1ENF A;  1B9M A;  3TQY A;  4LF9 Q;  2M9V A;  2K03 A;  3BU2 A;  5C3E G;  1UNS A;  3PUZ A;  3J7A F;  1AP0 A;  3HOZ H;  3J7A 5;  3A0J A;  1CQV A;  3NWS A;  3C3L A;  5DM7 3;  1Q3L A;  1SFO H;  2QW7 A;  5C6A A;  5KEE A;  2QKI C;  2KCN A;  2CKZ B;  3DHQ A;  1I4H A;  2WB1 G;  1Y1V B;  3K6O A;  1N8R C;  1ENC A;  5IGF A;  4A3F B;  1STN A;  4KY7 A;  3TRZ A;  1CK1 A;  3HOZ B;  3KF6 B;  3OSO A;  5E3F A;  1O80 A;  2EOT A;  1VQO A;  2PCF B;  1SFO B;  1M1K C;  2KUM A;  2H4O A;  1ZYR C;  1WCM G;  2MP1 A;  3MVV A;  3R2T A;  2F0G A;  1SND A;  2NVQ H;  4KTA A;  2PNH A;  4UP7 A;  3FMC A;  2Y0S E;  1D6E C;  1TXY A;  4A93 G;  3H94 A;  3SK8 A;  1DD2 A;  2ZXR A;  1AH9 A;  4LFA L;  4DV5 Q;  1LAC A;  3CCL A;  2NVQ B;  4X65 L;  4KK7 A;  2AHO B;  5DM6 3;  1PYB A;  2X6L A;  3G4S A;  4UY8 C;  1EWH A;  4XXE A;  1BBW A;  4X62 Q;  2K50 A;  1I3Q H;  3NPP A;  3AB9 A;  3AYH B;  2OWO A;  4JC0 A;  5G3L D;  4XYQ A;  5I9O A;  1Q8I A;  2L12 A;  3BDO A;  1LUZ A;  1NR2 A;  4JI4 L;  5FO8 B;  5IT9 E;  5JJZ A;  4N8F A;  3ZJY C;  1I3Q B;  2ICE C;  3J80 L;  4DUZ Q;  1BR9 A;  1Y69 U;  1EYG A;  4IAL A;  5LMN L;  3G71 A;  1CZW A;  5FO7 B;  4ZUJ A;  3LWU A;  4A3D G;  1ONL A;  5J3B A;  4ZUI A;  3A7A B;  3I70 A;  3CC4 A;  4CBV A;  4IFD I;  3T51 B;  1A3T A;  3J7Y W;  1N32 Q;  3ULP A;  4GNX B;  3GTQ H;  5EBC A;  4PMW A;  2J7Z A;  1HNX Q;  3P7J A;  2PNR C;  2DNC A;  3I56 A;  1UAP A;  1CTM A;  4GOP C;  3I2Z A;  3S15 H;  1F9Q A;  4A4I A;  4LW1 A;  4L8J A;  4CDF C;  3QIA A;  4A75 A;  1EY9 A;  4JYA Q;  1ESF A;  2D0O A;  4XQJ A;  1DOK A;  1U0L A;  4DXF A;  1SNO A;  1EU3 A;  3GTQ B;  2YTY A;  5KRU A;  4IJL A;  4NXM Q;  2I0Q A;  2FHT A;  2F0E A;  2PZU A;  3TP8 A;  4KI0 A;  4POG A;  2R92 G;  3S15 B;  5LL6 S;  4IFD H;  4BBR G;  1AN8 A;  1EFI D;  1SLJ A;  1ZEQ X;  2I07 B;  3D3R A;  2N88 A;  4PZ6 A;  4DAY A;  2Z9H A;  3CCR A;  4JCV E;  4Q0F A;  4YIJ A;  4JI1 L;  4JI3 L;  5FOB B;  2K01 A;  1YHB A;  2J4X A;  1H9S A;  1T9H A;  2CW0 C;  4C2M H;  1XJV A;  4A3E H;  4A3G H;  1DJR D;  2EY5 A;  2EZV A;  1PTO D;  5L37 A;  4XT3 B;  1VQN A;  4BBS G;  2R93 G;  2BA1 A;  3SR1 A;  2PI2 A;  3I90 A;  3JAM L;  1C9O A;  4C2M B;  1XWE A;  4A3E B;  3T1Y L;  1X3F A;  4ODG A;  1B1Z A;  1EY0 A;  3NEN A;  4A3G B;  3OWE B;  1PLF A;  1SAP A;  4ZK9 B;  3S2H H;  2SDF A;  1YHA A;  2Z6K C;  3ITP A;  3PO3 H;  2JSO A;  4RWS C;  5EGT A;  1K9M C;  2K5D A;  4YHH L;  3S1Q H;  3QR8 A;  1LTB D;  1GM5 A;  1A15 A;  2K5N A;  2NUC A;  1Y1V G;  3HP3 A;  2QEJ C;  4A3F G;  1I94 Q;  2F0N A;  4LUV A;  5EAY A;  2Z4I A;  3S2H B;  1B3A A;  5M5W H;  3PO3 B;  2VB3 X;  3HOZ G;  2LS0 1;  5E4W C;  5AJ3 L;  3MTS A;  4JVZ A;  1AW7 A;  2VQE L;  3S1Q B;  1I4Q A;  1YZ6 A;  1JC7 A;  4AH6 A;  3HOV H;  2F1M A;  1KAW A;  2L1B A;  1NE3 A;  3T13 A;  2PZT A;  2TMP A;  2NVX H;  5FLX c;  4B3S Q;  2RSO A;  3I91 A;  3FEW X;  4B3M L;  3CCS A;  1UE6 A;  5M5W B;  4BY7 G;  3RZD H;  3QB3 A;  1RDP D;  4AYB B;  4CJ1 B;  1V1P A;  4GOP B;  2BE5 C;  3HOV B;  4DR6 L;  3S2D H;  4IOA A;  4CJ2 C;  1B4O A;  2NVX B;  5IOC A;  3H15 A;  1BVS A;  4JI2 L;  2IJ0 A;  4DAP A;  1D7Q A;  3Q8D A;  1EOV A;  3RZD B;  2EPB A;  3SK6 A;  4DK3 C;  1WI5 A;  1PTO F;  2YTX A;  1GUO A;  3BVM A;  3S2D B;  2JA8 H;  3OW7 A;  5IWA L;  5HGT A;  2O5J C;  4DR1 L;  2XRS D;  1M8A A;  1IBL L;  2B8G A;  4K2K A;  3D6C A;  3EN2 A;  3CPW A;  3KF6 A;  1PDQ A;  4JK1 C;  2ATW A;  1W6K A;  2VZA A;  1CA5 A;  3VA5 A;  1SDF A;  4YCU A;  4DR3 L;  5LL6 X;  1JWU D;  2LKV A;  2JA8 B;  4OWX B;  1TWA H;  1FGB D;  1S4Z A;  4OWT B;  3M7G A;  5ELF A;  4AQY L;  1B2T A;  3KYH C;  1SYF A;  4IQZ A;  3OMG A;  4R8N A;  2F4V L;  4JI6 Q;  1B9N A;  2IL8 A;  3F8T A;  3CRK C;  2AUJ D;  3M7N A;  1WTR A;  4LUO A;  1TWA B;  4OX9 L;  1LTA D;  2G9D A;  1F2L A;  1SRU A;  1KHI A;  1TS3 A;  3V05 A;  1VF5 C;  1QG7 A;  2WKD A;  3UDI A;  4FF1 A;  3FVQ A;  1SYB A;  2IX1 A;  4JI0 Q;  4H02 A;  1TKW B;  5GRO A;  3FKI H;  3FPP A;  1TT2 A;  2KCM A;  3NTI A;  2NZ1 D;  3T1H Q;  1EY8 A;  2GVA A;  1M4V A;  5C4J H;  1C0A A;  2MPM A;  2ENB A;  1IBK Q;  3GTM H;  1TWF H;  3DWP A;  3PGZ A;  5H1S E;  4LFB L;  5C3W A;  1IYU A;  4IN3 A;  3ER0 A;  4P75 A;  5CR3 A;  2FMM A;  3FKI B;  3MA2 B;  1BO0 A;  1PRT C;  2EYF A;  2Q8R E;  3MHB A;  4EX5 A;  3BG3 A;  2F0F A;  5C4J B;  4KV6 A;  2F0S A;  5NUC A;  1KRT A;  1EYA A;  3GTM B;  1TWF B;  1JOO A;  4MTN A;  3CF5 A;  3I4N H;  4K5X A;  4UPA A;  3NHH A;  2DNE A;  4IFD G;  3DEO A;  2ES2 A;  1HH2 P;  4JI7 L;  5GAD C;  3CCQ A;  4WJ3 M;  1E7Z A;  3ICE A;  5KNC A;  3CW2 C;  5EQ0 A;  4GNX A;  1YJ9 A;  2HIV A;  5ELB A;  3P1H A;  3L3O C;  2R7F A;  2QA4 A;  2K52 A;  1YNX A;  4ILW A;  1A62 A;  3V96 A;  5IP7 H;  5IYD G;  2G5D A;  2A73 B;  3I4N B;  3QOL A;  2PMZ E;  5IGG A;  2X69 A;  1D8L A;  1DOM A;  2RKS A;  2B3G A;  3SK4 A;  2ZJR A;  1FJG Q;  2K05 A;  3ND8 A;  4CJ0 B;  4K14 A;  5CV6 A;  4LF9 L;  2GVB A;  1KTK A;  2NN6 I;  2VY3 A;  2EJM A;  4DFA A;  2QDL A;  4A3E G;  1K3R A;  3F2B A;  2ICI A;  1FR3 A;  1VQ6 A;  1VQK A;  5JJK A;  1Q81 C;  3A8K E;  3L2P A;  5I9P A;  4NXN Q;  1PXU A;  2L0C A;  4EQN A;  1E1O A;  5FLM H;  3VR3 A;  2DJG C;  3LNN A;  1GUT A;  2A69 D;  4DAV A;  4A3M H;  4J1M A;  2CW0 D;  3PO3 G;  2NN6 H;  3DUZ A;  3U9S A;  4GLA C;  5D3I B;  2JA5 H;  2F0P A;  3KBX A;  1NUC A;  1U4P A;  4A3L G;  4IPG A;  3K5O A;  3TRE A;  3F2D A;  4PNY A;  4A3M B;  1HNZ Q;  4A3J H;  3K7A H;  1UE1 A;  4IUV A;  4DV5 L;  1LT5 D;  2AMC B;  3AEV A;  4A3C G;  2CWA A;  2KVM A;  4KHV A;  4AYB G;  3R8B A;  2K32 A;  2JA5 B;  3HOV G;  4PQX A;  4MZ9 A;  2B39 A;  1STH A;  2CFM A;  1EU4 A;  1KAB A;  2DN8 A;  2Q8T A;  1F9R A;  4F88 A;  4A3J B;  3K7A B;  4OEL B;  4PV1 C;  1M90 C;  1Q12 A;  5IT9 L;  4JI3 Q;  1I50 H;  1MD2 D;  3CCV A;  2OF1 A;  3NBH B;  1PRT B;  2A1A A;  2D9U A;  3ERS X;  2RCN A;  5DAU A;  1BKB A;  3VA7 A;  3KLS A;  4DUZ L;  1VQ9 A;  4L6T B;  1G2T A;  1EYC A;  1LTS D;  5AFW A;  3MEF A;  1I50 B;  1KDC A;  4QGU A;  2UU9 Q;  4HED A;  1KD1 C;  2QIL A;  1A63 A;  3GO5 A;  4XIG S;  2K4K A;  1NR4 A;  1GO3 E;  4ZKC B;  5CV4 A;  4HN7 A;  2KCC A;  1N32 L;  4GOP A;  4RA8 A;  1HTL D;  3L7Z C;  2F52 A;  2PZW A;  2D2C C;  2AKW B;  3K81 C;  1HNX L;  2A74 C;  2WKC A;  5JVH 3;  5IYC H;  1AE3 A;  2OTJ A;  4JYA L;  4QIW B;  2QDB A;  3M4O H;  1PH4 A;  4IPD A;  1CKM A;  5M5Y H;  4NXM L;  2RVL A;  1BCP D;  1OXS C;  2JYO A;  3EA6 A;  1STA A;  2N49 A;  4K2L A;  2UUB Q;  1XPO A;  1PMR A;  2N3S A;  1RJT A;  1CQF A;  5I4D A;  3M4O B;  1KRS A;  3K5M A;  1Y14 B;  4RHR A;  1CHQ D;  4G7H C;  1TY2 A;  1HZB A;  1K0S A;  5M5Y B;  1K8O A;  4GLX A;  1KQS A;  4XYO A;  4FP5 D;  4QJF A;  3L0O A;  1WTQ A;  2Z0S A;  1U4R A;  5BN3 A;  4OO1 I;  2AQ3 B;  2V4D A;  3H0G H;  3HOX H;  4RAU C;  2I5H A;  1A8V A;  3P20 A;  4LF7 Q;  3KF8 A;  1EQQ A;  2PYK A;  3MWY W;  3PF4 A;  4IZ8 A;  2QEX A;  2K6A A;  4DR4 Q;  3H0G B;  1OXV A;  3HOX B;  4RGT A;  4X6A H;  1K8A C;  5C44 H;  4RCO A;  1H9K A;  4DK6 C;  3K5L A;  3S1R H;  3T53 B;  2UUA Q;  4Q5V A;  4OO1 H;  3HKZ B;  4MHE A;  3E0E A;  3NTK A;  3OMC A;  5T1G A;  3KOJ A;  1B3Q A;  5JEA G;  2H1E A;  5C44 B;  5IP7 G;  2B63 H;  5CGK A;  3S1R B;  3PIP A;  5CBE E;  2K7V A;  4DK0 A;  4V0B A;  3ND9 A;  1I94 L;  3LGJ A;  3M3Y H;  1PVO A;  5LHY 1;  3VDY A;  1SN8 A;  1A6X A;  3A8J E;  1Q8K A;  1PZJ D;  3A8I E;  4O42 A;  3IRB A;  4I7A A;  1BBX C;  1BCP F;  1SMX A;  2B63 B;  2WB1 E;  3FHW A;  1L2F A;  1EZ6 A;  2XWJ B;  1YEZ A;  3M3Y B;  3QJY A;  3NEL A;  2JA6 H;  1V9P A;  1PTO C;  2OCE A;  2NYZ D;  4B3S L;  1SEB D;  4H7B A;  1QWY A;  4X66 Q;  2Q2U A;  3GTL H;  1Z47 A;  3QOJ A;  2VUM H;  5FKA C;  2OT2 A;  3M4P A;  2MJ8 A;  5JJI A;  4A3M G;  2L9H A;  4DV4 Q;  2WII B;  3C46 A;  4FF2 A;  2NN6 G;  2JA6 B;  5E7N A;  2IY5 B;  1EIY B;  3OWF A;  3RMH A;  3OIQ A;  3J80 c;  2JA5 G;  3GTL B;  3HG9 A;  1FD7 D;  2VUM B;  4DNI A;  2BH8 A;  1I4R A;  3UDG A;  5IGC A;  1JWS D;  1NNX A;  5K36 G;  1D5Z C;  3P75 A;  1Q1E A;  5I2Y A;  3R2I A;  1IYJ B;  3MXP A;  1HJP A;  4PMB A;  4JI7 Q;  4HSV A;  3KLR A;  2YTV A;  4P72 A;  1N36 Q;  1JJ2 A;  3D4R A;  4N8X 1;  5D65 A;  5A2Q E;  1DYQ A;  5I2X A;  3CHB D;  1XMQ Q;  1JMC A;  3HOW H;  4QUC A;  2KEN A;  2R3Z A;  5K5P A;  5EPK A;  4JI6 L;  3MZ5 A;  2OQK A;  5ELO A;  3ULL A;  1J8I A;  2CVR A;  2XN9 C;  2KHS A;  2E75 C;  3A54 A;  3HOW B;  3EFX D;  3EQL C;  2J0T D;  1LTL A;  2XVS A;  2RDF A;  3S24 A;  4JI0 L;  5HGQ A;  2R61 A;  1HTP A;  1R4P B;  1HNW Q;  3OIP A;  2RA4 A;  3T1H L;  3PO2 H;  3SK5 A;  5HUR A;  1STB A;  3U50 C;  1IBK L;  2BDN A;  4I7Z C;  4EGV A;  1PTO H;  4IUQ A;  4CHT B;  2EQS A;  1OXU A;  3A5Z B;  3KLW A;  5IYC G;  3PF5 A;  1HR0 W;  3PUW A;  1X6O A;  2PI2 E;  2K1B A;  4RHS A;  5CV7 A;  3PO2 B;  3O13 A;  1IKL A;  2F3I A;  3E5S A;  3BYY B;  4A3K H;  4JV5 Q;  3A74 A;  3NTH A;  5D14 A;  1EWI A;  3CC7 A;  1TWH H;  2L55 A;  1PTO B;  4GS3 A;  4YWK A;  3PIO 3;  2K04 A;  1Q46 A;  3CD6 A;  4FVM A;  5BR8 Q;  4P74 A;  4YY3 Q;  3BS1 A;  4DV1 Q;  1CA6 A;  2ZTD A;  1PA6 A;  3BDL A;  2BDO A;  2BH2 A;  4A3K B;  3T16 A;  1XPR A;  5GAG C;  3TME A;  1TWH B;  3I4M H;  4P71 A;  3J81 i;  3MFG A;  2R7D A;  3G6J B;  3IKJ A;  4X3K A;  5CV8 A;  1SBB B;  3H0G G;  1VMC A;  4K5V A;  3SE0 A;  1FJG L;  1IZ6 A;  4RGO S;  2Q2I A;  1IHZ A;  3SDZ A;  3PMF A;  5EKL A;  4IUU A;  1VQF A;  3NSW A;  4DGZ A;  4BXX H;  3HKZ G;  3I4M B;  4IUP A;  5HY6 A;  3W1B A;  4C3H G;  4Y7N H;  3MAQ A;  1FGU A;  5A35 A;  5C44 G;  2XSC A;  2UUC Q;  4NXN L;  4A76 A;  2EDG A;  3S14 H;  1VQL A;  3A56 A;  4J15 A;  4Y7N B;  5LMU Q;  3R93 A;  3Q0A A;  1LTG D;  2A19 A;  2B63 G;  4FXK C;  2SEB D;  3S14 B;  5COY A;  1EQV A;  1SE4 A;  1SR3 A;  2TSS A;  3VR5 A;  5ISR A;  2B29 A;  3M4Y A;  3CCJ A;  2FFK B;  1ENA A;  4GKK Q;  1HNZ L;  2B2V C;  4V19 0;  4HR7 B;  4IUT A;  3AFP A;  5M9O A;  1V8Q A;  4JOI C;  3NE5 B;  2EXD A;  3AU7 A;  2MHV A;  4RKL A;  1VS0 A;  2B2U C;  2E74 C;  2WIN B;  1WD1 A;  2F4I A;  2QGQ A;  1LAB A;  1V43 A;  1QVG A;  2RHQ B;  1KIX A;  1EZ8 A;  4ID6 A;  1WTV A;  1OTC A;  2A69 C;  5CC4 A;  3NUC A;  1E2W A;  4S3S A;  3D31 A;  3PV0 A;  4N9T A;  4C1N I;  1PFB A;  2F0L A;  1WTO A;  4B08 A;  2LXK A;  2F0D A;  3C1E A;  4G7O C;  1BNZ A;  2N78 A;  1EIG A;  1X3E A;  4QL5 A;  2UU9 L;  1E2Z A;  2JEB I;  5FJ8 H;  1Z9F A;  3K7U C;  3BDC A;  1VQD A;  1HRJ A;  1GUG A;  5E4X A;  2PQA B;  2RSN A;  2HD3 A;  4IOC A;  1CHP D;  3ONA B;  2UXB Q;  3CRL C;  3RD4 A;  2E76 C;  2NVT H;  2K28 A;  1T5X D;  4K8I A;  3T4A C;  1WYD A;  4H13 C;  2ZJP A;  4K0K Q;  2A6E C;  3HOW G;  2B2Y A;  1IKM A;  1PZK D;  3G7L A;  1MJE A;  2NVT B;  1SYC A;  1HZ9 A;  2KBN A;  5I6W A;  2GA4 B;  4ALP A;  1I4G A;  2UUB L;  1HA5 A;  1YBY A;  3U4Z A;  2JA7 H;  3ULJ A;  1VQC A;  1G2S A;  1L1O A;  3J81 c;  2FJ2 A;  1TWG H;  2JJQ A;  3B6Y A;  4L5T A;  3PO2 G;  1JB7 A;  1SYG A;  2IHF A;  3W1G A;  1JT8 A;  2B2W C;  2JA7 B;  2XRQ D;  3BZC A;  3TZD A;  4LF7 L;  4JBM A;  2WAC A;  1TWG B;  2XTI A;  1XX8 A;  1LYL A;  3W5O A;  2WP8 J; 
#chains in the Genus database with same CATH homology
 4BS9 A;  2KEE A;  4DU9 A;  1LTT D;  1BCP C;  5KND A;  2HCC A;  5CV5 A;  3SVM A;  2EY2 A;  3NBI A;  1D1K A;  5IOD A;  2Q8I B;  2VB2 X;  4DK1 A;  2PW5 A;  4NMZ A;  4UAI A;  2KJX A;  3QG1 A;  4OHJ A;  4HMJ A;  2HUG A;  1F2Z A;  1I4P A;  3H3V C;  3GQB A;  1D2B A;  3VYU A;  1B50 A;  3BVG A;  4EQP A;  1HUN A;  2EYO A;  1GOZ A;  1Y1W B;  5J39 A;  1TY0 A;  4G57 A;  4PMC A;  1X3Q A;  4Z9C B;  1OO9 B;  3TN2 A;  4KN4 C;  2IX0 A;  4QF4 A;  3E6Z X;  3BVZ A;  1A2T A;  4X3T A;  2JE6 I;  1ROD A;  3W3A A;  3OHX C;  4OIJ A;  5DNF A;  3DXJ C;  1H9R A;  2LFN A;  1PFM A;  1KDB A;  3H6M A;  5KIX A;  5KGU A;  5A2Q L;  4C3I B;  2YYZ A;  2R7Z B;  1NAP A;  2E2I B;  1VCI A;  2NTS A;  1LT6 D;  2E2D C;  4KY6 A;  2EE1 A;  1FNV A;  1TU2 B;  2F0W A;  4K6L A;  1BDO A;  4WJW A;  1EY7 A;  2MGS A;  4H0L C;  3IL8 A;  1JOQ A;  1L0Y B;  1BCP B;  4FF3 A;  1TR5 A;  1EIH A;  3D6W A;  5C4Z A;  2I46 A;  2WAQ B;  3DEP A;  1RF2 D;  1DZ1 A;  3U9O A;  1F77 A;  1JE4 A;  1G8Z D;  1ZXT A;  5EJW A;  2OEO A;  2AWO A;  4KJN A;  1O7Y A;  2JEA I;  2EJF C;  2ZXO A;  5C5M A;  4BA1 I;  3MXG A;  1XYI A;  2IX3 A;  4EQO A;  4R8I A;  4FXD A;  2LMC B;  4OL7 A;  1I6V C;  1RTO A;  5CBA E;  1Y8P B;  4P2C B;  1PYW D;  2A6E D;  3E0J A;  5C4X B;  2F0O A;  3I3C A;  4UDU C;  1K83 B;  2OXP A;  4HMI A;  1UEA B;  3TP7 A;  1LT4 D;  2O2L D;  1VDZ A;  4ULL A;  2WV6 D;  1S5B D;  4RKB A;  1GUS A;  3KBG A;  1DOL A;  2A6H C;  3OOC A;  3FPU B;  1YNJ D;  3NQT A;  4O1N A;  2VXW A;  3Q24 A;  2DY7 A;  1G29 1;  1KLU D;  1S5D D;  2FIN B;  1MSH A;  3DMU A;  5C0X J;  1SSO A;  2EYP A;  4J6H A;  1SXT A;  4XDX A;  5CMD A;  2B2V A;  1SNC A;  1PFN A;  2EYM A;  2SNM A;  1RKN A;  5J1Z A;  1HQM C;  5EBD A;  2A68 C;  3IAY A;  1JCK B;  2WB1 B;  1FNU A;  4CKB A;  2F0H A;  1VF7 A;  1CM9 A;  2PQE A;  1MI2 A;  3HS0 C;  4KKU A;  1F2Y A;  4DNR B;  4HSP A;  4A3I B;  1IW7 C;  1WCM B;  3K57 A;  1KDA A;  3MEH A;  1JOK A;  3S16 B;  3M85 A;  5IIF A;  1O78 A;  1AZP A;  4F8M A;  5EPL A;  1LT3 D;  4K6D A;  5D3D A;  3SXH A;  1EQT A;  1GUN A;  4J8Q A;  2YU9 B;  1DM0 B;  2XNA C;  1C8C A;  5JEA J;  5KNB A;  2KQ3 A;  1TWC B;  2K33 A;  1NSN S;  1IYV A;  3A55 A;  1QCB D;  1EEF D;  4KD4 A;  1EY5 A;  1Y8O B;  4WFN 3;  5C3X A;  1H9J A;  1O7L A;  4QUF A;  3VYR A;  5M3M B;  1JWM D;  3WOF A;  3WDN A;  2EYJ A;  3HOY B;  3WOE A;  3GTO B;  2IWH A;  2KOL A;  1U9R A;  2B2W A;  1NCV A;  2HCI A;  1D5X C;  4CKC A;  4X3S A;  3KK7 A;  1LO5 D;  2NTT A;  2IW3 A;  1R4Q B;  2Y0S B;  2D62 A;  3K0Y A;  1MBY A;  1XXG A;  1HQR D;  2C9O A;  1LTI D;  1UUP A;  1G91 A;  1JR0 D;  2R92 B;  1EL0 A;  1H9M A;  3I73 A;  1HFN A;  1ET9 A;  4NW2 A;  3HZX A;  4XT1 B;  2HDL A;  4NKL A;  4GZY C;  2RBM A;  1MGS A;  3IFD A;  1Q1B A;  5C4H A;  2DY8 A;  1SJE D;  5C5L A;  3GP7 A;  2F0I A;  1FNW A;  5TSS A;  3CQZ B;  4WOR A;  1SMY D;  2A5H A;  3V2T A;  4KMU C;  1Z7T A;  1LV9 A;  2EVB A;  5FLX E;  4BY1 B;  3J81 E;  2SOB A;  3S1M B;  2R6G A;  4LMQ D;  1TS4 A;  1TS2 A;  4RGN A;  1JIC A;  3NBH A;  3LWE A;  1Z6H A;  1JQY D;  4A3B B;  5JOB A;  1DCZ A;  1K8M A;  3CU7 A;  1X3P A;  3C1F A;  2ID0 A;  2F0K A;  2JP1 A;  2E2H B;  2A6H D;  3FDT A;  4ZQ3 A;  4HCE A;  2AQ2 B;  5T1I A;  3GD7 A;  3HEJ A;  5I6Y A;  1KNA A;  1ZKO A;  2HDM A;  3TSS A;  4RCN A;  3GTJ B;  4BY7 B;  3QWN A;  1F9P A;  4K5W A;  2F0U A;  1KNE A;  3TZU A;  1KLG D;  1S5F D;  2A68 D;  1BXT A;  2CHB D;  1SNP A;  1C4Q A;  1EY6 A;  1BUV T;  4MN3 A;  3I4L A;  1CT1 D;  3PUX A;  4DN4 M;  4OO1 G;  1PZI D;  1QIL A;  1IW7 D;  2NVY B;  3ERO A;  4XTC S;  1TS5 A;  3T56 B;  1VMP A;  1F9S A;  4RGM A;  1DXM A;  1IL8 A;  4MIU A;  3TP5 A;  2F0V A;  4C56 C;  3TBI B;  1C48 A;  3MC0 B;  2ZXP A;  4QMG A;  4HAE A;  4DA2 A;  2KED A;  4LAA A;  1CFM A;  3BZD B;  1WD0 A;  4F87 A;  1R9T B;  2AWN A;  2K5W A;  4G7Z C;  1GXD C;  4JBW A;  1Q90 A;  1RD9 D;  5G3L F;  4HTH A;  1HPC A;  1BF4 A;  4KKT A;  1STE A;  5E1F A;  2RQX A;  4QB4 A;  3GV3 A;  1HCZ A;  1JB3 A;  1GJX A;  1SYE A;  5IGB A;  1RTN A;  3N52 A;  1EOT A;  4FXG C;  2KA7 A;  3J7A V;  1TII D;  3RZO B;  4N9P A;  3D4D A;  4LJZ C;  2BOS A;  5IGE A;  1A2U A;  2BCO A;  1O7Z A;  3HOU B;  2Z8L A;  3VR2 A;  1SNQ A;  3LX0 A;  1YNJ C;  2F3W A;  1I4X A;  4ME5 A;  1EY4 A;  1LTR D;  2QCP X;  2F0J A;  3DWQ A;  3D4W A;  2QF7 A;  4IUN A;  1YNN D;  2IT1 A;  4M8A A;  4RFB A;  4TRD A;  3NXW A;  2C5C A;  5C0X I;  1FYC A;  5ELC A;  2SNS A;  3Q23 A;  2F0Q A;  2X6G A;  3K5N A;  2PMZ B;  4KKS A;  3H09 A;  3W2D A;  2M00 A;  3GTP B;  2RDH A;  2K5Q A;  1Y8N B;  4F7X A;  1ZYR D;  4L63 B;  4WRD A;  1SE3 A;  2ZT9 C;  4H44 C;  5C0X H;  4DF7 A;  4BA2 I;  3OPO A;  4TQU S;  2B2T C;  1RCV D;  3TDQ A;  5CV9 A;  2D5D A;  2AUK A;  2BA0 A;  1HUM A;  4I65 A;  4CKE A;  1STG A;  3VYT A;  3K59 A;  4LK1 C;  1RHP A;  1I6H B;  3NK9 A;  3RLF A;  1L0X B;  4IFD J;  2E2J B;  1V1O A;  1AEX A;  2F0M A;  1B44 D;  1F2M A;  4NDX A;  3GTK B;  4G4K A;  3R3O A;  5EKI A;  1SYD A;  1XTC D;  1S5C D;  1G6Z A;  1W6J A;  1STY A;  1J9O A;  3QO2 A;  3URY A;  1ILP A;  4DXG A;  3HRZ C;  1EYD A;  3PUV A;  5FLX L;  5JEA H;  3J81 L;  5BN4 A;  1DON A;  2EYL A;  3I8Z A;  3DM1 A;  5ELE A;  4E6I A;  5M3F B;  2L11 A;  2L5T A;  4HCS A;  5JAV A;  2B8F A;  1WVL A;  3KLS X;  3A7L A;  1ESR A;  5COR A;  3J80 E;  3UI2 A;  2M2L A;  5JPM C;  3ERQ A;  4KN7 C;  2G9H D;  1QE6 A;  3X3M A;  4FNF A;  3MFY A;  1KAA A;  2IPK D;  5EKK A;  2Z1C A;  1SMY C;  1E2V A;  1D5M C;  2PO4 A;  1A3V A;  5FO9 B;  3AMU A;  5J22 A;  5KYI A;  3NWT A;  1QOH A;  2FMC A;  4ZYS A;  4KJO A;  2XWB B;  5K36 H;  4OIK A;  4C3J B;  3C2P A;  1HFG A;  1QB5 D;  1S5E D;  2PW7 A;  1CI3 M;  3NP8 A;  2EY6 A;  4R9W A;  2XIW A;  4BWG B;  2O4X A;  5DEH A;  3VYS A;  3VR6 A;  2PPB C;  1OXT A;  1T5E A;  4XQQ A;  4TSS A;  2NBF A;  1ICW A;  2L4N A;  4KD3 A;  4B9X A;  2F03 A;  3SHL A;  4DNT B;  4FF4 A;  2O5I C;  3RUZ A;  5C3E B;  1BQQ T;  5FK9 C;  3TP6 A;  2EY1 A;  2BE5 D;  3JAM E;  1QJO A;  1GHK A;  2VNU D;  5C0X G;  1QNK A;  1B53 A;  2B2U A;  1ET6 A;  2EYH A;  5ELD A;  1U4M A;  3Q6S A;  1SNM A;  3K58 A;  1JOR A;  1ILQ A;  2RDG A;  4NP5 A;  3PUY A;  3X3N A;  1EWC A;  2NWG A;  2B2Y C;  3GV6 A;  4IUR A;  1CZG A;  1TVX A;  4A93 B;  1EEI D;  1OXX K;  4U67 3;  4C3I G;  2EXZ A;  3CKI B;  2KEC A;  4QCL A;  4KY5 A;  3N6R A;  3HGB A;  2N55 A;  1E0B A;  2CQA A;  4U68 A;  1WTP A;  3D8G A;  2JXM B;  1U4L A;  4C1N K;  5EPJ A;  2F3V A;  4M1U B;  1SJH D;  4TKO B;  5BN5 A;  1GHJ A;  4KHZ A;  5F2D A;  1BOS A;  1TQO A;  4ZRZ A;  1GUW A;  4C3H B;  1WTW A;  3S17 B;  1ML0 D;  1HA6 A;  2EJG C;  4CGY B;  4A3D B;  4RH6 A;  3MXU A;  1PRT D;  2AQ1 B;  2HQE A;  1AZQ A;  1WTX A;  1H9S B;  4X3U A;  4FO2 A;  1II3 A;  1D1I A;  4EVO A;  3S1N B;  5M5X B;  3SEB A;  1AFP A;  3Q22 A;  4FYD A;  4K8J A;  1HHV A;  3IFT A;  4XQN A;  1A3U A;  4B9W A;  3L9A X;  4ZLT F;  2LY7 A;  1LLR D;  4BBR B;  3BYT B;  2MUY A;  1SE2 A;  4C3J G;  3NQI A;  3EJI A;  3F2U A;  3S9W A;  3H91 A;  3FRP B;  3VR4 A;  4ZKB B;  3ZYY X;  3EVQ A;  5JVG 3;  1MSG A;  3PIP 3;  5IGD A;  1QNU A;  2Z4H A;  5JPN C;  2F0T A;  3GTG B;  3MXN A;  5KYL A;  2B2T A;  1HXY D;  4OGQ C;  1X32 A;  4ZAI A;  2NB0 A;  4BBS B;  2R93 B;  1YNN C;  5CYU A;  1V1P B;  1PRT F;  3KUP A;  3DWA A;  3I72 A;  4ABN A;  1ENF A;  1B9M A;  2M9V A;  2K03 A;  1UNS A;  3PUZ A;  3J7A F;  1AP0 A;  1CQV A;  3NWS A;  3C3L A;  5DM7 3;  1Q3L A;  5C6A A;  5KEE A;  2QKI C;  2KCN A;  3DHQ A;  1I4H A;  1Y1V B;  3K6O A;  1ENC A;  5IGF A;  4A3F B;  1STN A;  4KY7 A;  1CK1 A;  3HOZ B;  3OSO A;  5E3F A;  1O80 A;  2EOT A;  1SFO B;  2PCF B;  2KUM A;  2H4O A;  1ZYR C;  2MP1 A;  3MVV A;  3R2T A;  2F0G A;  1SND A;  4KTA A;  3FMC A;  1D6E C;  3H94 A;  3SK8 A;  1DD2 A;  2ZXR A;  1LAC A;  2NVQ B;  4KK7 A;  5DM6 3;  2X6L A;  1EWH A;  4XXE A;  3NPP A;  3AB9 A;  5G3L D;  4XYQ A;  5I9O A;  1Q8I A;  2L12 A;  3BDO A;  1NR2 A;  5FO8 B;  5IT9 E;  5JJZ A;  1I3Q B;  2ICE C;  3J80 L;  1BR9 A;  1Y69 U;  4IAL A;  1CZW A;  5FO7 B;  4ZUJ A;  3LWU A;  1ONL A;  4ZUI A;  3A7A B;  3I70 A;  4CBV A;  4IFD I;  3T51 B;  1A3T A;  3J7Y W;  5EBC A;  4PMW A;  2J7Z A;  3P7J A;  2PNR C;  2DNC A;  1UAP A;  1CTM A;  1F9Q A;  4L8J A;  3QIA A;  1EY9 A;  1ESF A;  4XQJ A;  1DOK A;  4DXF A;  1SNO A;  1EU3 A;  3GTQ B;  5KRU A;  2FHT A;  2F0E A;  2PZU A;  3TP8 A;  4KI0 A;  3S15 B;  5LL6 S;  4IFD H;  1AN8 A;  1EFI D;  1ZEQ X;  2I07 B;  3D3R A;  2N88 A;  4DAY A;  4Q0F A;  4YIJ A;  5FOB B;  2K01 A;  2J4X A;  1H9S A;  2CW0 C;  1DJR D;  2EY5 A;  2EZV A;  1PTO D;  4XT3 B;  2BA1 A;  3SR1 A;  3I90 A;  3JAM L;  4C2M B;  1XWE A;  4A3E B;  4ODG A;  1B1Z A;  1EY0 A;  4A3G B;  3OWE B;  1PLF A;  1SAP A;  4ZK9 B;  2SDF A;  3ITP A;  2JSO A;  4RWS C;  5EGT A;  2K5D A;  1LTB D;  1A15 A;  2NUC A;  3HP3 A;  2QEJ C;  2F0N A;  2Z4I A;  3S2H B;  1B3A A;  3PO3 B;  2VB3 X;  2LS0 1;  5E4W C;  3MTS A;  1AW7 A;  3S1Q B;  1I4Q A;  1JC7 A;  2F1M A;  2L1B A;  3T13 A;  2PZT A;  2TMP A;  2RSO A;  3I91 A;  3FEW X;  5M5W B;  3QB3 A;  1RDP D;  4AYB B;  4CJ1 B;  1V1P A;  2BE5 C;  3HOV B;  4CJ2 C;  1B4O A;  2NVX B;  5IOC A;  2IJ0 A;  4DAP A;  3RZD B;  2EPB A;  3SK6 A;  1PTO F;  1GUO A;  3BVM A;  3S2D B;  3OW7 A;  5HGT A;  2O5J C;  2XRS D;  1M8A A;  2B8G A;  4K2K A;  3D6C A;  1PDQ A;  4JK1 C;  1W6K A;  1CA5 A;  3VA5 A;  1SDF A;  5LL6 X;  1JWU D;  2LKV A;  2JA8 B;  1FGB D;  1S4Z A;  3M7G A;  5ELF A;  1B2T A;  1SYF A;  4IQZ A;  3OMG A;  4R8N A;  1B9N A;  2IL8 A;  3CRK C;  2AUJ D;  3M7N A;  1WTR A;  1TWA B;  1LTA D;  2G9D A;  1F2L A;  1TS3 A;  3V05 A;  1VF5 C;  1QG7 A;  2WKD A;  4FF1 A;  3FVQ A;  1SYB A;  2IX1 A;  1TKW B;  3FPP A;  1TT2 A;  3NTI A;  2NZ1 D;  1EY8 A;  1M4V A;  2MPM A;  2ENB A;  3DWP A;  5C3W A;  1IYU A;  4IN3 A;  5CR3 A;  2FMM A;  3FKI B;  3MA2 B;  1BO0 A;  1PRT C;  2EYF A;  2Q8R E;  3MHB A;  3BG3 A;  2F0F A;  5C4J B;  4KV6 A;  2F0S A;  5NUC A;  1EYA A;  3GTM B;  1TWF B;  1JOO A;  4K5X A;  3NHH A;  2DNE A;  4IFD G;  3DEO A;  5KNC A;  5EQ0 A;  5ELB A;  3L3O C;  3P1H A;  4ILW A;  3V96 A;  2A73 B;  3I4N B;  3QOL A;  5IGG A;  2X69 A;  1DOM A;  3SK4 A;  2RKS A;  2K05 A;  3ND8 A;  4CJ0 B;  4K14 A;  5CV6 A;  1KTK A;  2NN6 I;  2EJM A;  4DFA A;  2ICI A;  1FR3 A;  3A8K E;  5I9P A;  1PXU A;  2L0C A;  4EQN A;  3VR3 A;  3LNN A;  1GUT A;  2A69 D;  4DAV A;  4J1M A;  2CW0 D;  2NN6 H;  3DUZ A;  3U9S A;  5D3I B;  2F0P A;  3KBX A;  1NUC A;  1U4P A;  3K5O A;  4PNY A;  4A3M B;  4IUV A;  1LT5 D;  2KVM A;  4KHV A;  3R8B A;  2K32 A;  2JA5 B;  4PQX A;  2B39 A;  1STH A;  1EU4 A;  1KAB A;  2DN8 A;  2Q8T A;  1F9R A;  4F88 A;  4A3J B;  3K7A B;  4PV1 C;  1Q12 A;  5IT9 L;  1MD2 D;  2OF1 A;  1PRT B;  2D9U A;  5DAU A;  3VA7 A;  3KLS A;  4L6T B;  1G2T A;  1EYC A;  1LTS D;  5AFW A;  1I50 B;  1KDC A;  4HED A;  2QIL A;  3GO5 A;  4XIG S;  1NR4 A;  4ZKC B;  5CV4 A;  4HN7 A;  2KCC A;  4RA8 A;  1HTL D;  3L7Z C;  2PZW A;  2D2C C;  2A74 C;  2WKC A;  5JVH 3;  4QIW B;  2QDB A;  2RVL A;  1BCP D;  1OXS C;  2JYO A;  3EA6 A;  1STA A;  4K2L A;  1PMR A;  5I4D A;  1RJT A;  1CQF A;  3M4O B;  3K5M A;  4RHR A;  1CHQ D;  4G7H C;  1TY2 A;  5M5Y B;  1K8O A;  4XYO A;  4FP5 D;  1WTQ A;  1U4R A;  5BN3 A;  4OO1 I;  2AQ3 B;  2V4D A;  4RAU C;  3P20 A;  3KF8 A;  2PYK A;  3MWY W;  4IZ8 A;  2K6A A;  3H0G B;  1OXV A;  3HOX B;  4RGT A;  4RCO A;  1H9K A;  3K5L A;  3T53 B;  4Q5V A;  4OO1 H;  3HKZ B;  4MHE A;  3NTK A;  3OMC A;  5T1G A;  5JEA G;  2H1E A;  5C44 B;  5CGK A;  3S1R B;  5CBE E;  2K7V A;  4DK0 A;  4V0B A;  3ND9 A;  5LHY 1;  1A6X A;  3A8J E;  1PZJ D;  3A8I E;  4O42 A;  1BBX C;  1BCP F;  2B63 B;  1EZ6 A;  2XWJ B;  3M3Y B;  3QJY A;  1PTO C;  2NYZ D;  1SEB D;  4H7B A;  1QWY A;  1Z47 A;  3QOJ A;  5FKA C;  2OT2 A;  2MJ8 A;  2L9H A;  2WII B;  3C46 A;  4FF2 A;  2NN6 G;  2JA6 B;  3OWF A;  3RMH A;  3OIQ A;  3GTL B;  3HG9 A;  1FD7 D;  2VUM B;  1I4R A;  5IGC A;  1JWS D;  5K36 G;  1D5Z C;  3P75 A;  1Q1E A;  5I2Y A;  3R2I A;  3MXP A;  4PMB A;  4HSV A;  3KLR A;  3D4R A;  5D65 A;  5A2Q E;  1DYQ A;  5I2X A;  3CHB D;  4QUC A;  2R3Z A;  5K5P A;  5EPK A;  3MZ5 A;  1J8I A;  2CVR A;  2XN9 C;  2KHS A;  2E75 C;  3A54 A;  3HOW B;  3EFX D;  3EQL C;  2J0T D;  2XVS A;  2RDF A;  2R61 A;  1HTP A;  1R4P B;  3OIP A;  2RA4 A;  3SK5 A;  5HUR A;  1STB A;  2BDN A;  4I7Z C;  4EGV A;  1PTO H;  4IUQ A;  4CHT B;  1OXU A;  3PUW A;  4RHS A;  2K1B A;  5CV7 A;  3PO2 B;  3O13 A;  1IKL A;  3E5S A;  3BYY B;  3NTH A;  5D14 A;  2L55 A;  1PTO B;  3PIO 3;  2K04 A;  4FVM A;  3BS1 A;  1CA6 A;  3BDL A;  2BDO A;  4A3K B;  3T16 A;  3TME A;  1TWH B;  3MFG A;  3G6J B;  3IKJ A;  4X3K A;  5CV8 A;  1SBB B;  1VMC A;  4K5V A;  3SE0 A;  4RGO S;  1IHZ A;  3SDZ A;  3PMF A;  5EKL A;  4IUU A;  3NSW A;  4DGZ A;  3I4M B;  4IUP A;  4C3H G;  3MAQ A;  5A35 A;  2XSC A;  2EDG A;  3A56 A;  4Y7N B;  3R93 A;  3Q0A A;  1LTG D;  4FXK C;  2SEB D;  3S14 B;  5COY A;  1EQV A;  1SE4 A;  2TSS A;  3VR5 A;  5ISR A;  3M4Y A;  2FFK B;  1ENA A;  2B2V C;  4V19 0;  4HR7 B;  4IUT A;  5M9O A;  1V8Q A;  3NE5 B;  3AU7 A;  2MHV A;  4RKL A;  2B2U C;  2E74 C;  2WIN B;  1WD1 A;  2F4I A;  1LAB A;  1V43 A;  1EZ8 A;  4ID6 A;  1WTV A;  2A69 C;  5CC4 A;  3NUC A;  1E2W A;  4S3S A;  3D31 A;  3PV0 A;  4N9T A;  4C1N I;  1PFB A;  2F0L A;  1WTO A;  4B08 A;  2F0D A;  3C1E A;  4G7O C;  1BNZ A;  1EIG A;  1E2Z A;  2JEB I;  3BDC A;  1HRJ A;  1GUG A;  5E4X A;  2RSN A;  1CHP D;  3ONA B;  3RD4 A;  3CRL C;  2E76 C;  2K28 A;  1T5X D;  4K8I A;  3T4A C;  4H13 C;  2A6E C;  2B2Y A;  1IKM A;  1PZK D;  3G7L A;  2NVT B;  1SYC A;  5I6W A;  2GA4 B;  1I4G A;  1HA5 A;  1G2S A;  2FJ2 A;  1SYG A;  2B2W C;  2JA7 B;  2XRQ D;  3TZD A;  2WAC A;  1TWG B;  1XX8 A;  2WP8 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...