3D8GA

Crystal structure of staphylococcal nuclease variant delta+phs i72r at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
130
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKREVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Arginine residues at internal positions in a protein are always charged.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mw2
molecule tags Hydrolase
total genus 35
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d8gA00
4KD3A 1NSNS 1NUCA 1F2YA 1SYEA 2EY2A 2EYOA 2PQEA 3DMUA 5C4ZA 5IIFA 4DFAA 5IGBA 5KIXA 1SNCA 2EXZA 1A3TA 4B9XA 5IGEA 3NUCA 1EYCA 3NP8A 4B9WA 5KYIA 4DF7A 5EGTA 2RDFA 2F0KA 2F0NA 4ZUJA 1SNDA 1KDBA 1JORA 3TP6A 1EYDA 2EYPA 5I6WA 1IHZA 5JAVA 1A2UA 1SYDA 5I6YA 1KDCA 4HTHA 3OMCA 2F0IA 2F0OA 2ENBA 2PW7A 4J6HA 3NHHA 5M9OA 1EYAA 4K5VA 4QB4A 4E6IA 5J1ZA 3VA5A 2F3WA 2PYKA 3EROA 5HURA 1A3VA 4DGZA 4F7XA 1SNPA 4G57A 2F3VA 4RKLA 2NUCA 3TP7A 5IODA 4DU9A 1STBA 5IGGA 2F0TA 1EY6A 4EQPA 1RKNA 2F0LA 3D4DA 3MEHA 4HMIA 1SYCA 3D8GA 3MVVA 4IUNA 4I65A 5C5LA 1EY7A 5C3XA 2PZWA 2WACA 3C1EA 3SR1A 4ZUIA 3ERQA 5I9PA 5IGCA 2RBMA 1TR5A 5CV4A 2PZUA 3P1HA 1STNA 4WORA 3SXHA 3D4WA 3TP8A 1EY9A 3MXPA 1EY8A 5CV7A 1AEXA 4ODGA 4PMBA 1STAA 1JOOA 1EY0A 2EYHA 1II3A 3BDLA 5NUCA 3TMEA 2EY5A 3D6CA 5EKLA 2LKVA 2OF1A 2EYMA 2F0EA 4K2LA 4K5WA 4N9PA 4IALA 4PNYA 4YIJA 5E3FA 5KGUA 1JOQA 3TP5A 2OEOA 2EY6A 1TQOA 5K5PA 4RKBA 3OSOA 5JOBA 3SHLA 5KEEA 1SNOA 1SYFA 5CV8A 4K14A 3E5SA 4NMZA 2F0DA 2PW5A 1A3UA 2OXPA 4K8JA 2KQ3A 4K8IA 3BDCA 1A2TA 1KDAA 3EVQA 5DAUA 4MIUA 2KHSA 1KAAA 4QF4A 3NXWA 5J39A 3HEJA 4ME5A 1EZ8A 3SK4A 3DHQA 5IOCA 3HZXA 3PMFA 4IZ8A 4KY6A 2O4XA 1F2ZA 4R8NA 2F0FA 2F0HA 2SNSA 3H6MA 3NK9A 3C1FA 5E1FA 4WRDA 1EY5A 1EZ6A 2SOBA 1STGA 3T13A 5C6AA 1SYBA 3LX0A 4N9TA 5C5MA 2EY1A 2F0UA 2F0GA 4OL7A 5EKKA 1ENAA 4KHVA 5HGTA 5CGKA 3ITPA 3QOJA 4NKLA 4NP5A 5F2DA 1EY4A 4K5XA 4EQOA 1EQVA 4K2KA 3U9OA 5C3WA 1U9RA 2F0SA 1TT2A 2EYLA 2M00A 4KJNA 2QDBA 4S3SA 1KABA 5ISRA 5CR3A 1STYA 3NQTA 2SNMA 3QOLA 5KYLA 5C4HA 1JOKA 3MZ5A 2F0WA 3OWFA 2F0QA 3EJIA 1F2MA 4KTAA 3T16A 4KD4A 3S9WA 1SNQA 5I9OA 4EQNA 4H7BA 2F0MA 5IGFA 3RUZA 4KV6A 4F8MA 3P75A 4HMJA 5CV6A 4ID6A 5KRUA 5J22A 3OMGA 4J1MA 2F0JA 3QB3A 4LAAA 2HQEA 1SNMA 2F0VA 3R3OA 5CV9A 4TRDA 2EYJA 4K6DA 5DEHA 5IGDA 4EVOA 3V2TA 3SK8A 3MHBA 4NDXA 1ENCA 4KJOA 5CV5A 2RKSA 3SK5A 2PZTA 4QMGA 5CC4A 4KY7A 4KY5A 1SYGA 4PMCA 4ZQ3A 2EYFA 2F0PA 1STHA 3SK6A
chains in the Genus database with same CATH superfamily
2KEEA 1SXTA 5KIXA 4DUZQ 2A69C 2K5DA 3S2HH 1TKWB 2F0NA 4ZUJA 1SNDA 1JORA 2RHQB 5EAYA 2EQSA 1R9TB 2CHBD 4HTHA 3FKIB 2B2TC 3H3VI 1F9SA 4K5VA 1SSOA 1UEBA 2UXCL 1CZWA 2BH8A 1O7LA 2F3VA 3TP7A 3GTLH 2JE6I 4IJHA 2PMZE 4DR7Q 2ZXPA 1EUJA 4BA2I 2RDGA 2K01A 2E2DC 4HMIA 1EIYB 3HOXG 5FLXc 1PH6A 4AYBG 1TR5A 3A0JA 1E24A 1L1OC 2YU9B 2NVQH 4P72A 3GV6A 3NENA 1QVCA 1XMQQ 3G7LA 1Z47A 2D0OA 4JI3Q 3IFTA 3J7ZC 1SRUA 2KCMA 3TP5A 1XYIA 2ZJRA 4DV4L 4PZ7A 3SHLA 4LF7L 4IUTA 2O2LD 1JMCA 4K8IA 5DAUA 1A2TA 3HOXB 1VCIA 2CW0D 2NN6G 4HSPA 3S14H 3PSIA 4AYBB 5I2YA 3TSSA 5M5XB 1XNQL 1EZ8A 3TN2A 2ZM6L 4R8NA 3I91A 3CC7A 1IYVA 1WTHA 1EU3A 2SOBA 1SE2A 2L15A 5M3MG 3E3XA 4CHTB 4C2MH 1ENAA 2H4OA 4B3TQ 2HCCA 2K5NA 4IPCA 4K2KA 4CDFC 3KF6A 1SROA 4HCSA 4XQNA 1I6VC 1LYLA 1FNVA 1OXXK 1YITA 3BVGA 4MNOA 4UDUC 1JWUD 3JAML 1SNQA 1OO9B 4GKJL 2VB2X 1Y1WG 4TKOB 4KV6A 5CV6A 1CZGA 3MA2B 3FPPA 1CA6A 2E75C 3T1YQ 1ILPA 1IL8A 1N32L 1I50H 1MSHA 5D14A 2PNRC 5M3MB 1Q81C 1TWGH 4NDXA 3H3VC 2C35B 3GTQB 2OWOA 2NYZD 3HOUB 4JK1C 5IIFA 3VYTA 1F2YA 1QCBD 1TY2A 4LF8Q 2EXZA 1Y8PB 2XRSD 5FLMH 4HJ5A 4JI6L 3EN2A 1GUTA 3OIQA 4DF7A 5EGTA 2B3GA 1EWCA 2EZVA 1Y1WB 4OO1G 3QJYA 2CH4A 4X62L 4A3GG 1DOMA 3CC4A 1PH5A 4IFDI 4V190 3WDNA 2UXDQ 2E8GA 1HQRD 1AFPA 3K7AB 3CU7A 4B08A 4A3DH 2QDLA 4IO9A 2I46A 3KLSX 2F0LA 3D4DA 5C5LA 2JA7G 1ZEQX 2XWBB 1ONLA 2PZWA 1I94L 1E0BA 2WIIB 3DM3A 1FD7D 1TWHH 2HDMA 4RCNA 5IP9H 4A3FG 1HXYD 2RSNA 4PQXA 4JI7Q 4A3GB 4BBSG 4KHPL 2AMCB 4K2LA 3FRPB 3A54A 4PG3A 4OWXB 2A6HC 4H44C 1Q46A 2HD3A 5JJKA 5LMUQ 1JWMD 4C3JG 2M2LA 2KUMA 4ZAIA 4DUYL 2JA7B 1G2TA 4JI5Q 1IBMQ 4ULLA 1XNRL 4A3FB 3G71A 4AQYQ 4WJ4A 1DOLA 4IZ8A 2XTIA 2AQ2B 5C44H 3CMEA 3RLOA 4BBSB 4L63B 1CKOA 2K52A 1OXVA 4C3HH 2JA6G 4OL7A 4RWSC 3T56B 4DKAC 1EEID 2PQAA 5CGKA 3ITPA 1KAWA 3U4VA 3S17B 1U4LA 4C3JB 5CYUA 1KTKA 2L1BA 2BDOA 2YV5A 2WAQG 3MZ5A 3OWFA 3PIO3 3A8KE 3RUZA 4DR2Q 2ASBA 2JK8A 3P75A 4ZRZA 4HJ8A 4HSVA 1RF2D 4J1MA 1FL0A 2HQEA 3MWYW 4PV1C 4RAUC 3GTJB 1K8OA 4LFBL 3TZDA 4JI4Q 2JA6B 1AZQA 1PRTD 4LNQA 5A2QE 1EWIA 3FEWX 5BN4A 2JA8G 1PH3A 2Z1CA 1QILA 5IGBA 2WAQB 4RGMA 4K0KQ 1D6EC 5ELOA 2G9DA 4X64Q 1PYBA 1PYSB 2RDFA 4X3UA 4BWGB 4UP9A 3H91A 2QEXA 3I4MH 3S16B 1C0AA 4QB4A 3CKIB 5J1ZA 3GTKH 3GQBA 2X6GA 3HRZC 2Y0SG 1CT1D 1FYCA 4YWMA 1T5XD 1AE3A 3H09A 2WAQE 1H9SA 1STBA 2F0TA 1FNWA 1BDOA 1EY6A 3SVMA 1KIXA 4DR6L 2JA8B 3W3AA 4CKEA 5IGCA 2WACA 2A5HA 2E2HH 2NBFA 2KHJA 3ERQA 1PHJA 1GD7A 1YEZA 4B3TL 1WTVA 3I2ZA 1EY8A 4OHJA 1TS2A 4R8IA 4PMBA 2KHIA 3M85A 1E7ZA 1J9OA 4K5WA 5E3FA 4PNYA 3EQLC 1TVXA 1Q12A 2Y0SB 3NEMA 2VQFQ 1JE5A 4ABNA 4LUVA 3E5SA 1E2VA 2KENA 4QJFA 4LF9Q 4K8JA 4Z9CB 3MXUA 4LFCL 3HOYH 1PRTF 2HT1A 1J5EL 3FKIH 3K5MA 3U50C 4JOIA 4BY1G 1AZPA 3PO3H 2XRQD 2L5TA 1YZ6A 3QWNA 3BVMA 3STBD 1STGA 4JV5L 5DM73 2BA0A 2VZAA 4XT1B 2E2JB 3QOJA 1TWFH 3K0XA 3F2UA 1O80A 2DJFC 3KDFA 4S3SA 3RZDB 3PUWA 4OGQC 5C4HA 1O7YA 4QCLA 4CGYB 4CJ1B 3S9WA 4BY1B 5AJ3L 5IGFA 2R7ZH 4ID6A 4UY8C 2F0JA 2RF4A 5GAGC 3S2HB 2IY5B 4P71A 1PFSA 1V1PA 5D3DA 2A1AA 1Z7TA 4X65L 1EIGA 4DR3L 1ESFA 3SK5A 2PZTA 4B3MQ 2EY2A 3A8JE 1G8ZD 4HEDA 3S1QB 1EQTA 2LFNA 4O0AA 1UNSA 3GTLB 3NP8A 1B2TA 4JW0A 2AWNA 3M4PA 1LV9A 2V1CC 2XVSA 2YTVA 5LMUL 5JAVA 1NJIC 4KN7C 3OMCA 1S5DD 2CH4W 1B1ZA 5C3EH 2MP1A 5J3BA 3M4QA 1WTQA 1YNNC 2Z9HA 2N3SA 4RMFA 4GLXA 4Y52H 3CPFA 4DA2A 1VQIA 1XMOQ 2N8NA 3P7JA 2F4VQ 3M7NA 4QIWB 2E74C 2HUGA 4LF6Q 4OWTB 3U9SA 1MJEA 1E1TA 1Y8NB 4RA8A 1FGBD 3MXPA 4DR1L 4DAPA 4ZKCB 4JG2A 1V8QA 5CMDA 4YY3Q 3PUYA 2OF1A 1J6QA 1E3PA 3HOUH 4IFDJ 1EFID 3VR4A 3OSOA 2Q2UA 1I4XA 4EQ5A 3HKSA 4DR2L 4NMZA 3T53B 4DR5Q 1PH1A 4AH6A 2OXPA 4DV1Q 2ID0A 5GQOA 2KCNA 4QUFA 2UUAL 3UDFA 3PCOB 4MIUA 1PFNA 1L0XB 1PH2A 4C2MB 2VS1A 3CP0A 2A19A 4ME5A 3CW2C 5IOCA 1F2ZA 4L8JA 1G91A 3K7AH 4WRDA 1HQMC 3H3VH 5FLMG 1PZID 2B2VC 2HDLA 3HP3A 3F2CA 3WOEA 2QKIC 5C5MA 3RLFA 1WVLA 4DK1A 1MIUA 1K3BC 3OW2A 3RZOH 2E2IH 3M7GA 1EFWA 3DXJC 1N34L 2A69D 1JCKB 2M00A 2QDBA 1STYA 3K6OA 3PUVA 1HTPA 1PRTB 2SNMA 1F9RA 1TWGB 4P74A 2F0WA 4HIDA 1F2MA 1RIPA 2QF7A 3GTMH 4A3DG 4CDDC 5I9OA 2A6ED 2F0MA 3JAMc 3L9AX 4DV3L 3K80C 3CF5A 1VMPA 1GUWA 4R9WA 3QB3A 3J81E 3J7YW 3CMAA 1KNAA 4AIMA 1Y1VG 2K6AA 5IP9G 1VQ6A 5DM63 3RMHA 1PH8A 4PMCA 1KXLA 3ZYYX 3BZDB 1STHA 2WKDA 3A74A 2LS01 1L0YB 4DFAA 1UE6A 3ICEA 2EDGA 5IYDH 4H0LC 4A3DB 4WFN3 5IWAL 1SEBD 1RL2A 3KK7A 3Q8DA 2PW7A 1NMFA 3S17H 2PCFB 2HQLA 1TWHB 3NTKA 3OPOA 1Y1VB 2IX3A 1K8GA 2YTXA 1JICA 1QUQA 3OIPA 1BXTA 5C44G 1JB7A 5FO7B 5LHY1 3J81i 1D8LA 1C9OA 3GDEA 1U4PA 3NELA 1LTID 3W5OA 4GOPB 4A3IH 4A75A 2O5IC 1CKMA 2VL6A 2YTYA 3MEFA 2JQOA 2N49A 2K05A 1V9PA 3SXHA 3IAYA 1WJJA 2C9OA 4OEMB 1Q82C 1AEXA 1XTCD 4I7ZC 2DY7A 1II3A 4DV7L 3D6CA 5C0XI 2F0EA 4CJ2C 5GAHC 2XNAC 2OEOA 4RKBA 3U58A 2MFIA 3NBHB 3URYA 3S1RB 1SYFA 1UAPA 5C44B 5FLXE 1U4MA 1VQBA 1WTPA 4A3BH 3NE5B 5EPLA 1HNZL 3Q6SA 4B3RQ 4QL5A 4QGUA 2NVYB 1PH9A 1B9MA 3T1HQ 5BR8L 2O4XA 2F0HA 3BJUA 1D7QA 2I5HA 1HNWL 3GTGH 2ZTEA 3BU2A 5C6AA 1KRSA 2JA8H 4IFDH 2F3IA 1YI2A 5EKKA 5D65A 1H9MA 3TBIB 3I4MG 4EQOA 3U9OA 4JPBW 1AE2A 1DONA 4KMUC 5K36G 3QOLA 3FP9A 4Q0FA 2WP8J 4LUOA 3T16A 3W1BA 5FK9C 3X3NA 4DAVA 3E9HA 4HMJA 3CCJA 4IOCA 1IYUA 4LF4L 4OELB 2R7DA 1BUVT 1ZXTA 2K5HA 4X66L 4LF6L 3R2IA 1HNXQ 1PH4A 2VUMH 3SK8A 1ICWA 1E2ZA 4DV2Q 2VW9A 3I4MB 1X54A 3GTKB 1NUCA 1HZCA 4FF1A 1GUNA 1I4QA 3K7UC 5KYIA 4ME3A 4DV0Q 5HGQA 4R4OA 2WB1E 3F1ZA 4GNXC 1PZJD 2E2JH 5I6YA 5M3FH 3HOYG 2IWHA 1G2SA 2A6HD 4Y7NH 2E2HB 4HIKA 2UUBQ 2F3WA 3RZDH 1VQ5A 3PO3G 2A68D 1CSQA 1B8AA 4RKLA 4HIMA 1B44D 5C4JH 1SYCA 3RD4A 2IJ0A 2K50A 1KHIA 2GVBA 5T1GA 1ENFA 2EJFC 2B39A 1WYDA 2ZXOA 3TP8A 4B3SQ 2E5LQ 4TVAB 2P5ZX 1C7YA 2D0PA 1F2LA 1STAA 1IBLL 3HOYB 2IPKD 2LKVA 4IALA 1BF4A 2MO1A 1JWSD 2D62A 5JVG3 1SE8A 5JOBA 3S1QH 3PO3B 2R7ZG 1SNOA 1CKNA 1RODA 4JCVE 1JE4A 3K81C 5A2QL 1DXMA 1K8MA 1SR3A 1KAAA 4JYAQ 2MGSA 1TWFB 1RD9D 4L6TB 2MO0A 4CJ0B 4CKCA 5EQ0A 3CQZB 1BBXC 4FXKC 1MSGA 1HJPA 2EY1A 2R7ZB 4IUQA 5HGTA 3K59A 5F2DA 4A3EG 5C3EG 1HFGA 2R93H 1XPUA 2ZXRA 2G9HD 4NPSA 3OTOL 2HHHL 2UUCL 3LWUA 3E9IA 2R3ZA 4RHRA 5KYLA 2CKZB 3A5ZB 3EJIA 1WD0A 1Q3LA 1LT4D 1I4GA 3OMGA 2AHOB 2A74C 4NXNQ 4LAAA 1XX8A 1SNMA 1L1OB 2F0VA 2IW3A 4CDCC 2VQEL 1BOSA 3PIOA 4CBVA 2LMCB 4JBKA 2K5QA 4FF2A 4QMGA 4A3EB 5C3EB 4AYBE 1YVCA 3Q23A 1CQFA 2XN9C 3HOUG 1VQJA 3B6YA 1SNCA 4RGNA 2AUJD 1VQ4A 1ZYRC 3OWEB 4MTKA 4P73A 1D5MC 2L4NA 5E7NA 2K28A 3TZUA 1MI2A 1VQLA 4FO2A 5I6WA 2EYPA 1IBKL 3A56A 2JXMB 1VDZA 4JI2L 3ULLA 3PV0A 5M9OA 3T51B 3A7LA 4QY7A 3TEHB 1IL2A 3I70A 1A3VA 3CCEA 1GM5A 5D3IB 4K6LA 1PVOA 1LABA 5CBAE 3LGJA 2Q2IA 4G4KA 1LT6D 4DR4Q 5A35A 4WORA 1LTBD 1E2WA 5ELEA 5LL6S 5JVH3 2Z6KA 2R7FA 2L12A 3ULPA 2CFMA 3WWVA 3TRZA 4YWLA 2OQ0A 1RCVD 4BY7G 3A8IE 4BXXG 3H0GG 1X65A 1A8VA 5I2XA 3CRKC 5KNBA 2JA9A 2PW5A 1LTSD 2NTSA 3W1GA 3RZOB 2KHSA 1HNXL 2E2IB 2I0QA 1S3OA 1VF7A 3DHQA 2JSOA 1Y1VH 3PF5A 4KY6A 4XIGS 4RCOA 1NBWA 1SFOH 4BY7B 1HPCA 2JN4A 5C0XJ 5IYDG 4GS3A 1WD1A 2CQOA 1GOZA 1SYBA 3H0GB 3GTMB 1IKMA 2F0GA 1VMCA 2A8VA 4YCVA 4G7OC 4U673 2ZTCA 5FOBB 2B2TA 4LK1C 1SMYC 3MTSA 2R6GA 1K9MC 1CK1A 3KYHC 5DNFA 2UXBL 4LFAQ 4L5SA 4OX9Q 5ELDA 2B2YA 5ELBA 4A3IG 3S1RH 1YNND 1L0WA 4DUZL 2B2WA 1ET6A 5CORA 2NVYH 4P75A 1VQPA 4FXDA 3L0OA 1L1OA 2E76C 2K04A 1PXUA 2FMCA 1FJGQ 1SYEA 5LMNQ 4B9XA 3J80E 2PPBC 2VY3A 1EYCA 5C4XH 4A76A 2BA1A 3DUZA 1PV4A 4A3BG 3PGZA 4DR7L 1IHZA 4A3IB 1KDCA 3DM1A 5IT9E 2ENBA 1RDPD 4J6HA 3C2PA 1N33Q 1EYAA 3DWQA 1SJED 4F7XA 3MFYA 2BH2A 2NUCA 3KLRA 1QE6A 3MAQA 3M4YA 2ZTDA 3L3OC 1XMQL 4ZK9B 4GN3B 4JI3L 4IFDG 1IW7D 2N55A 4A93H 3TS2A 3S1MH 1GJXA 3FVQA 2PZUA 3A7AB 1WOCA 1CFMA 1UE1A 1LTLA 3C46A 4A3BB 5CV7A 4GKKQ 3EA6A 3E6ZX 2RQXA 1A0IA 3J80i 4N9PA 3I56A 1HR0Q 1JOQA 3PO2G 5K36H 5H1SE 4KK7A 3J81L 1EWHA 4K14A 4RFBA 4TSSA 1EOTA 4NXNL 1KD1C 2I5MX 3GTGB 3GD7A 1LO5D 3Q24A 2VUMG 4HAEA 3RN2A 4OXPA 1K83B 4NXMQ 3AU7A 4Q5VA 1BNZA 5GROA 2FMMA 4LJZC 1G6ZA 3H6MA 5IY0A 1VQCA 4MZ9A 1EY5A 1EZ6A 1KLUD 1UEAB 3I72A 4GLAC 4IPDA 3PO2B 2F0UA 2MQHA 1D1IA 1YNJD 1YHBA 2DGYA 5M3FG 1DCZA 4POFA 1NY4A 1EQVA 4R4TA 3I4NH 2EYLA 5ISRA 3T1YL 2VUMB 3BS1A 2F0QA 1NCVA 4KTAA 3I8ZA 3HOVG 1CTMA 4GN5A 2K5WA 3KFUA 3M9BA 2Y0SE 1YBYA 3M3YH 1HCZA 4PZ6A 5C0XH 4LF8L 4YCUA 1XWEA 4EVOA 1Y69U 1ESRA 5M3FB 2NVTH 3KF8B 4Y7NB 4ZQ3A 4P2CB 4FDBA 2GA4B 5LMNW 3CQZH 2LXJA 2FHTA 2ICEC 2UXDL 3GTOB 4O2DA 1TS5A 3HOVB 3P20A 5C4JB 1N36Q 3RNUA 3KBXA 4MHEA 4A3JH 3VA5A 2PYKA 1X3QA 5HURA 2OCEA 2BE5D 4G7ZC 3KLSA 4JI1Q 1S40A 2B2UA 4JI7L 4X3TA 2J0TD 4JI8Q 2KVMA 2XSCA 3UDGA 1S5CD 1PMRA 1S5ED 1VQNA 3AYHB 1ASYA 4XDXA 3AEVA 1VQ9A 3NBIA 2R93G 2AUKA 2WKCA 3TMEA 3CCVA 2FJ2A 2HCIA 5EKLA 5JEAJ 1P8LA 1SE3A 4A4IA 4A3EH 1NTGA 1CHQD 3K5OA 4JI5L 1IBML 1VQFA 3D4RA 1EU4A 4OIJA 2WV6D 5JPMC 4AQYL 4IQZA 2DN8A 1EQQA 1Q8IA 2XWJB 4QUCA 3KJOA 4JI0Q 3GO5A 1E1OA 3RN5A 1X3FA 1GO3E 3ND9A 1XPRA 4L5RC 2K1BA 3PMFA 2L55A 1S5BD 1YHQA 2R93B 1WFQA 4LWCA 1W6KA 1H95A 5I4DA 1BO0A 1FGUA 1F9QA 5E4XA 4RH6A 2UU9Q 4QIWE 3AMUA 1EY4A 4K5XA 2JJQA 2G5DA 2F0SA 4ZKBB 2CQAA 4UP8A 3NQTA 2MUYA 4X3SA 3IFDA 1JOKA 3DWAA 4JI4L 1IZ6A 1AW7A 1L2FA 3UE1A 1HRJA 1BR9A 4H7BA 1XXGA 1WI5A 4ALPA 4XTCS 3BZCA 4KN4C 3BYYB 3A5UA 1CUKA 2PI2E 4K0KL 4X64L 3MHBA 3K0YA 4PMWA 1UWVA 3RLNA 4LF5Q 4KY7A 3PF4A 4J15A 3D31A 1EY7A 4KD3A 1NSNS 3E0EA 4WJ3M 1EOVA 1YJ9A 3IRBA 4BY7H 3NUCA 3J81j 1ZKOA 4BXXH 3H0GH 1EEFD 3KUPA 4HJAA 4A3MH 1N9WA 1EYDA 2Z0SA 4PZ8A 1EYGA 1BQQT 1LLRD 1A62A 2BDNA 2ZT9C 4A3KH 4FXGC 3EROA 1I4RA 1SNPA 2EJGC 3GP7A 1VQDA 1S72A 1PLFA 2GVAA 1XJVA 3MVVA 1STEA 2QW7A 5C3XA 5JPNC 3C1EA 5I9PA 1W3SA 4XT3B 2K7VA 1IKLA 1M4VA 4DAYB 2RBMA 2DJGC 2VQFL 5EPKA 1K8AC 4XYOA 3CPWA 4LF9L 1OXUA 4OIKA 2EXDA 5TSSA 3UE0A 4KHZA 2EYMA 4DV6Q 1CHPD 1GUOA 3LNNA 4IPGA 3CCSA 4JC0A 1TQOA 2I5LX 1QZHA 1VF5C 1BBWA 1M90C 2F0DA 4LMQD 1SFOB 1H9KA 2EIFA 2KQ3A 3K5LA 4V0BA 4CDEC 2IX1A 1SMXA 4LF7Q 3C1FA 2F03A 1J8IA 1ICFB 1F77A 5KNDA 5JEAH 1NMGA 1VQMA 5C4XG 3STBC 1XNQQ 4GN4B 1LTRD 2DNEA 1DM0B 2XIWA 2ZM6Q 1N36L 3WOFA 1ZYRD 1B9NA 1TWCH 2R61A 4TQUS 2PI2A 1NNXA 2K32A 2K75A 3HOZH 1B7YB 3H15A 4B3ML 2JA5G 4DXFA 4R4CA 4A93G 1D2BA 3BVZA 4L5TA 5C4XB 5AFWA 1HZBA 1K0RA 3HKZG 2B63H 3ONAB 1PDQA 1K83H 3DLLA 4RGOS 2C5CA 1VQ8A 1X6OA 5J22A 1N32Q 5CBEE 1SE4A 3AQQA 1EQRA 4L5QA 1QOHA 3J7AF 1TY0A 3PO2H 1QB5D 1XMOL 3KOJA 2JA5B 4A93B 2F4VL 3NHHA 5JJZA 5IP7H 3F2DA 2R92H 1TWAH 3S1MB 1YIJA 4JI6Q 5E4WC 3BDOA 1JJ2A 3Q0AA 3HKZB 3CCMA 3CD6A 5IGGA 1BCPC 2MPMA 4DXGA 4YY3L 4EX5A 2NVXB 3CCRA 4ZUIA 2B2VA 2RVLA 5BN5A 2CWAA 2F52A 1CA5A 1GUSA 3F2BA 1HFNA 3I4NG 4UPAA 4DR5L 1JOOA 4DV1L 1VQEA 2EY5A 3FDTA 1KRTA 3KF6B 4C56C 5KGUA 1I94Q 3R93A 2B29A 2K5VA 2NN6I 2QA4A 1QVFA 1QNKA 2OQKA 2Z6KC 1Q90A 4ZYSA 3J81c 4APVA 3GTOH 1QZGA 1UE7A 3LWEA 3HOVH 1PTOC 5C0XG 4KHPQ 2Z4IA 1PYWD 3T4AC 1PZKD 2FFKB 4U68A 2AWOA 1V1OA 3HZXA 3J80L 4GOPA 3I4NB 2LSSA 3I90A 3I7FA 1TS3A 4GNXB 2VNUD 2Q8TA 1PA6A 2X6LA 4N9TA 5IT9L 3W2DA 1EL0A 1XNRQ 2IHEA 1O78A 3UDXA 2BCOA 4KHVA 4C3IH 1KLGD 4A3JG 3M3YB 5C3WA 5KNCA 5DLQE 5GAEC 4NB3A 1KABA 2PMZB 1PTOB 2HIXA 3NBHA 3K58A 2AQ1B 3L2PA 2NVTB 1WTXA 1Q1BA 2IX0A 2A6EC 4FVMA 1A63A 2YYZA 1GUGA 2KA7A 4M8AA 1BBUA 2KBNA 1XPOA 3C3LA 1BVSA 4TRDA 4K6DA 5DEHA 1YJWA 1HA6A 4I7AA 3RR5A 3V2TA 1O7ZA 5LL6X 3CC2A 2B2YC 2RKSA 1SN8A 1QWYA 3QIAA 3N6RA 5GADC 2SDFA 4A3JB 4OO1I 2B8GA 2EYFA 2F0PA 3EIVA 4DV6L 2PQEA 2EYOA 2B2WC 3HFZB 3X3MA 3UI2A 4LFBQ 2KCCA 1A3TA 4HJ7A 2QILA 1AH9A 2TSSA 4KKUA 4ZCKA 1A2UA 2ZJQA 3MXNB 1TIID 3EFXD 1KNEA 4IUPA 4A3CH 3G6JB 1JC7A 3S1NB 3OHXC 2D5DA 3JC66 1DD2A 1DZ1A 2LY7A 4XXEA 2MNAA 4I65A 5FO9B 1X9NA 1CM9A 2OTJA 3FPUB 1RHPA 2DNCA 2Z6BA 1R4QB 3VYSA 4BBRG 1LACA 2PQAB 4DR6Q 1MKHA 5EPJA 4DPGA 4B3RL 4H02A 3DWPA 3T1HL 4FF4A 2RDHA 2CWPA 2ATWA 2K33A 1VQAA 2Q2HA 1OXTA 4HJ9A 1I5FA 4QF4A 2KJXA 3SK4A 1TU2B 4X6AH 1BKBA 3KLWA 2DY8A 1V1QA 3ERSX 3NK9A 4BBRB 1JJCB 1GVPA 4IURA 4LFCQ 1KC8C 2O5JC 1J5EQ 1WCMH 3LX0A 2NWGA 1D5ZC 5EBCA 4A3MG 2ES2A 2DUDA 3S15H 3K57A 4GNXA 3NTHA 1U9RA 4A3KG 5EJWA 3HOWH 3OOCA 4JV5Q 2L11A 1IXRA 1X3EA 1A6XA 2F4IA 3PQIA 4FNFA 1H9RA 3K5NA 1X56A 4DV2L 4FYDA 1H9SB 3BZKA 3M4OH 1S4ZA 5ELNA 1M8AA 4C1NK 4JOIC 4ILWA 1VQGA 2L9HA 4A3MB 5AJ3Q 1ENCA 4DV0L 4LW1A 4KJOA 4UHVA 1LTAD 1KL9A 1LTGD 1RJTA 4A3KB 5JJIA 1TXYA 2UUBL 1E22A 4X65Q 4DR3Q 3VA7A 4XYQA 4X3KA 1KDBA 4DV5Q 2IHFA 3AB9A 1SYDA 2KEDA 1Y14B 3UDIA 1GKHA 4KKTA 3V05A 3SE0A 3MXNA 1LTTD 4B3SL 2E5LL 2A68C 2PNHA 4EQPA 1U5KA 3GTPB 3FHWA 5JEAG 4IOAA 1I4PA 3L7ZC 3S2DH 4IPHA 3MC0B 1JT8A 2NB0A 3D4WA 3NPPA 2A73B 2B2UC 3I3CA 1PH7A 2VXWA 2NZOA 1FVIA 2EVBA 3D3RA 3BDLA 3QG1A 1B4OA 2Z4HA 4MN3A 5FJ8H 3KDFB 1RTOA 4JYAL 3HOZG 1AP0A 4DR1Q 1G291 1DGSA 5M5WB 1MGSA 1WTRA 4DNRB 3GV3A 5IYBG 1C8CA 4POGA 1TS4A 3EVQA 2JA5H 2B63G 1MJCA 3ULJA 4A3LH 3VR3A 1V1PB 4F8MA 1I3QB 1K0SA 2F0FA 1LT3D 2H1EA 4OONA 1IYJB 4F88A 2UUAQ 2RCFA 3S24A 3TDQA 4N8X1 1FNUA 1SBBB 1TWCB 1NE3A 4IUVA 2NVXH 4M1UB 3HOZB 4HR7B 2QEJC 5IP7G 2R92G 1F9PA 3VR6A 4XQJA 4DN4M 4IJLA 4EGVA 3PIPA 3VR2A 2K03A 2NZHA 5M5YH 2B63B 4KD4A 4RG1A 2CW0C 5IE8A 4JBWA 5HY6A 1KQSA 1N34Q 3O13A 3N52A 2EYJA 4DK6C 2MJ8A 1GHJA 3Q22A 3IKJA 1QNUA 4KLKA 3G6EA 4DV3Q 2M9VA 4KY5A 1SYGA 4C1NI 3HGBA 4GLVB 2R92B 1TWAB 3SK6A 1B53A 4HN7A 3TREA 3G4SA 3H94A 3CAMA 4NW2A 1W6JA 4B9WA 1DOKA 1G51A 1X55A 2F0KA 3MXGA 3U4ZA 3NWSA 5IYCH 1K3RA 3NSWA 1JJGA 4DR4L 1PTOH 1U4RA 1VS0A 5IWAQ 1W2BA 2NZ1D 4DU9A 1DJRD 3MEHA 4XQQA 4IUNA 2J7ZA 1R9TH 5FLXL 3SR1A 3JAME 2Q8IB 3PUXA 1VQ7A 3P1HA 1STNA 1NR2A 4C3IG 1Q8KA 1B70B 4LUZA 1EY9A 3IL8A 1HUMA 1HZ9A 3VR5A 5NUCA 1MHWC 4YIJA 1I6HB 4O42A 2L0CA 2EY6A 4R1JA 3KJPA 5CV8A 2H5XA 4DNIA 4DV7Q 2YU9H 4OWWB 1KDAA 1Y8OB 3NXWA 3HEJA 4C3IB 4QQBX 3VYRA 3JAMi 3J80c 3S1NH 1HNZQ 1UE5A 3CCQA 1LT5D 1SJHD 3OYYA 1HR0W 3HOXH 1S5FD 5BR8Q 4LFAL 5IT9c 3I55A 1H9JA 5M5XH 4DV5L 2EJMA 2K4KA 4OX9L 2FXQA 3BYTB 1V43A 2IT1A 4KJNA 1HNWQ 4DK0A 4UAIA 4A3CG 4IN3A 3NQIA 1QUQB 4IUUA 1K73C 2I07B 4HCEA 1EIHA 2PO4A 3AFQA 4G7HC 2GN5A 1FJGL 1UUPA 5LMNL 3SEBA 3PIP3 1OTCA 2NN6H 2NVQB 1BCPD 2J4XA 5G3LD 3R2TA 5CV5A 3SDZA 3HG9A 1YNXA 2EPBA 1WTWA 4LF4Q 3DMUA 4BBRH 4X66Q 1N33L 3OW7A 3EBEA 5BN3A 5ELFA 5M3MH 3TP6A 3AFPA 4KI0A 3GTQH 4YHHQ 2N88A 2F0IA 3S14B 4DAMA 2QGQA 1JQYD 4DGZA 4FP5D 4G57A 4RHSA 1PTOD 1P16A 1B50A 4GKKL 5EKIA 1T9HA 1PRTC 1Y1WH 2XGTA 1WCMG 2KOLA 3BG3A 1YJNA 2HIVA 1MBYA 3MFGA 1D1KA 1HR0L 1IW7C 5CV4A 1X3GA 3KF8A 4HIOA 2IL8A 2KCTA 3NTIA 4ODGA 2NTTA 3HOWG 1XTDA 1HHVA 2TMPA 2RSOA 3I4LA 3G48A 4GZYC 3NWTA 1PFMA 1N8RC 3ZJYC 5T1IA 4NXML 1U0LA 3CHBD 3J7AV 1A3UA 2LXKA 1I50B 1IBLQ 1WCMB 4OO1H 1BCPF 1JB3A 5G3LF 4A3GH 1I4HA 5J39A 2UXCQ 5ELCA 3S15B 4N8FA 2ZJPA 5E1FA 2SNSA 1Z6HA 3HOWB 1CI3M 1EIFA 3T13A 1LM0A 3GTPH 4JBJA 2JA7H 1QJOA 1SLJA 2AKWB 2CCZA 1HZAA 2V4DA 4GOPC 5EBDA 4KKSA 2D2CC 3V96A 1YNJC 4A3FH 1B3AA 4CKBA 1A15A 3KBGA 1QVGA 4H13C 3M4OB 5JJLA 1GXDC 5CR3A 1B3QA 2Z8LA 1PTOF 4BBSH 2X69A 4DV4Q 5FKAC 1SDFA 1C48A 2Q8RE 3E0JA 1VQOA 4C3JH 5M5WH 3OTOQ 2HHHQ 5CV9A 2UUCQ 2Q2TA 2EOTA 1Z9FA 1ASZA 3F8TA 4F87A 2FINB 4J8QA 4FF3A 2RHSB 4C3HG 5CC4A 1ET9A 1K28A 4WJWA 1DYQA 5FJ8G 1I3QH 3VDYA 5C4ZA 1JR0D 4DNTB 3GTJH 2VQEQ 1HTLD 5IGEA 1QG7A 1SAPA 1X32A 2WINB 1WTOA 2JA6H 1GHKA 5COYA 2JYOA 4JI1L 1C4QA 3S2DB 1CKNB 3QR8A 2F0OA 3VYUA 4E6IA 2KECA 4JI8L 2ICIA 5IYBH 3R8BA 1ML0D 1CSPA 4A3LG 4BS9A 1Q1EA 5IODA 4GKJQ 1OXSC 1IBKQ 4C3HB 2BE5C 1X3PA 3K8AA 1RKNA 2CVRA 4JI2Q 1NR4A 3D8GA 4JVZA 1AN8A 4YCWA 3S16H 2N78A 3D0FA 4MTNA 3DEOA 1O7IA 5FO8B 1Q86C 3CRLC 3TS0A 1EY0A 2EYHA 2QCPX 2WB1G 2F1MA 2EE1A 4JI0L 2SEBD 2WFWA 1D5XC 3HS0C 3CCLA 3FMCA 5K5PA 5KEEA 2AQ3B 1VQHA 2BOSA 2OT2A 1Q7YC 4UP7A 1CQVA 4X62Q 1M1KC 3D6WA 1G6PA 3J7A5 3BDCA 3A55A 2ALYB 1T5EA 2B8FA 3ER0A 2UU9L 4JBMA 2JP1A 1HA5A 1R4PB 4BA1I 2RA4A 2JEAI 3CXCA 2WB1B 4DAYA 3ND8A 1NAPA 3HKZE 5M5YB 3DEPA 2K14A 4DK3C 1LUZA 1RTNA 2MHVA 1MD2D 3I4OA 4NKLA 4NP5A 4R4IA 2D9UA 4YHHL 2VB3X 1SMYD 4ZLTF 5IYCG 5L37A 1TT2A 2RCNA 1BCPB 4R4QA 4O1NA 2OTLA 1FR3A 1PFBA 2JEBI 1I6HH 4EQNA 3CCUA 5KRUA 1VQKA 4LF5L 4YWKA 4RGTA 3FKIG 4DUYQ 3TQYA 3R3OA 1ILQA 3SGIA 2UXBQ 5IGDA 1HH2P 3QO2A 1YHAA 3PUZA 4BY1H 1HUNA 3I73A
chains in the Genus database with same CATH topology
2KEEA 1SXTA 5KIXA 2A69C 2K5DA 1TKWB 2F0NA 4ZUJA 1SNDA 1JORA 1R9TB 2CHBD 4HTHA 3FKIB 2B2TC 1F9SA 4K5VA 1SSOA 1CZWA 1O7LA 2F3VA 3TP7A 2JE6I 2ZXPA 4BA2I 2RDGA 2K01A 2E2DC 4HMIA 1TR5A 2YU9B 3GV6A 3G7LA 1Z47A 3IFTA 3TP5A 1XYIA 3SHLA 4IUTA 2O2LD 3HOXB 4K8IA 5DAUA 1A2TA 1VCIA 2CW0D 2NN6G 4HSPA 4AYBB 5I2YA 3TSSA 5M5XB 1EZ8A 3TN2A 4R8NA 3I91A 1IYVA 1EU3A 2SOBA 1SE2A 4CHTB 1ENAA 2H4OA 2HCCA 4K2KA 4HCSA 4XQNA 1I6VC 1FNVA 1OXXK 3BVGA 4UDUC 1JWUD 3JAML 1SNQA 1OO9B 2VB2X 4TKOB 4KV6A 5CV6A 1CZGA 3MA2B 3FPPA 1CA6A 2E75C 1ILPA 1IL8A 1MSHA 5D14A 2PNRC 5M3MB 4NDXA 3H3VC 3GTQB 2NYZD 3HOUB 4JK1C 5IIFA 3VYTA 1F2YA 1QCBD 1TY2A 2EXZA 1Y8PB 2XRSD 1GUTA 3OIQA 4DF7A 5EGTA 1EWCA 2EZVA 1Y1WB 4OO1G 3QJYA 1DOMA 4IFDI 4V190 3WDNA 1HQRD 1AFPA 3K7AB 3CU7A 4B08A 2I46A 3KLSX 2F0LA 3D4DA 5C5LA 1ZEQX 2XWBB 1ONLA 2PZWA 1E0BA 2WIIB 1FD7D 2HDMA 4RCNA 1HXYD 2RSNA 4PQXA 4A3GB 4K2LA 3FRPB 3A54A 2A6HC 4H44C 1JWMD 4C3JG 2M2LA 2KUMA 4ZAIA 2JA7B 1G2TA 4ULLA 4A3FB 1DOLA 4IZ8A 2AQ2B 4BBSB 4L63B 1OXVA 4OL7A 4RWSC 3T56B 1EEID 5CGKA 3ITPA 3S17B 1U4LA 4C3JB 5CYUA 1KTKA 2L1BA 2BDOA 3MZ5A 3OWFA 3PIO3 3A8KE 3RUZA 3P75A 4ZRZA 4HSVA 1RF2D 4J1MA 2HQEA 3MWYW 4PV1C 4RAUC 3GTJB 1K8OA 3TZDA 2JA6B 1AZQA 1PRTD 5A2QE 3FEWX 5BN4A 2Z1CA 1QILA 5IGBA 2WAQB 4RGMA 1D6EC 2G9DA 2RDFA 4X3UA 4BWGB 3H91A 3S16B 4QB4A 3CKIB 5J1ZA 3GQBA 2X6GA 3HRZC 1CT1D 1FYCA 1T5XD 3H09A 1H9SA 1STBA 2F0TA 1FNWA 1BDOA 1EY6A 3SVMA 2JA8B 3W3AA 4CKEA 5IGCA 2WACA 2A5HA 2NBFA 3ERQA 1WTVA 1EY8A 4OHJA 1TS2A 4R8IA 4PMBA 3M85A 1J9OA 4K5WA 5E3FA 4PNYA 3EQLC 1TVXA 1Q12A 2Y0SB 4ABNA 3E5SA 1E2VA 4K8JA 4Z9CB 3MXUA 1PRTF 3K5MA 1AZPA 2XRQD 2L5TA 3QWNA 3BVMA 1STGA 5DM73 2BA0A 4XT1B 2E2JB 3QOJA 3F2UA 1O80A 4S3SA 3RZDB 3PUWA 4OGQC 5C4HA 1O7YA 4QCLA 4CGYB 4CJ1B 3S9WA 4BY1B 5IGFA 4ID6A 2F0JA 3S2HB 1V1PA 5D3DA 1Z7TA 1EIGA 1ESFA 3SK5A 2PZTA 2EY2A 3A8JE 1G8ZD 4HEDA 3S1QB 1EQTA 2LFNA 1UNSA 3GTLB 3NP8A 1B2TA 2AWNA 1LV9A 2XVSA 5JAVA 4KN7C 3OMCA 1S5DD 1B1ZA 2MP1A 1WTQA 1YNNC 4DA2A 3P7JA 3M7NA 4QIWB 2E74C 2HUGA 3U9SA 1Y8NB 4RA8A 1FGBD 3MXPA 4DAPA 4ZKCB 1V8QA 5CMDA 3PUYA 2OF1A 4IFDJ 1EFID 3VR4A 3OSOA 1I4XA 4NMZA 3T53B 2OXPA 2ID0A 2KCNA 4QUFA 4MIUA 1PFNA 1L0XB 4C2MB 4ME5A 5IOCA 1F2ZA 4L8JA 1G91A 4WRDA 1HQMC 1PZID 2B2VC 2HDLA 3HP3A 3WOEA 2QKIC 5C5MA 3RLFA 1WVLA 4DK1A 3M7GA 3DXJC 2A69D 1JCKB 2M00A 2QDBA 1STYA 3K6OA 3PUVA 1HTPA 1PRTB 2SNMA 1F9RA 1TWGB 2F0WA 1F2MA 2QF7A 5I9OA 2A6ED 2F0MA 3L9AX 1GUWA 1VMPA 4R9WA 3QB3A 3J81E 3J7YW 1KNAA 2K6AA 5DM63 3RMHA 4PMCA 3ZYYX 3BZDB 1STHA 2WKDA 2LS01 1L0YB 4DFAA 2EDGA 4H0LC 4A3DB 4WFN3 1SEBD 3KK7A 2PW7A 2PCFB 3NTKA 1TWHB 3OPOA 1Y1VB 2IX3A 1JICA 3OIPA 1BXTA 5FO7B 5LHY1 1U4PA 1LTID 2O5IC 2K05A 3SXHA 3IAYA 2C9OA 1AEXA 1XTCD 4I7ZC 2DY7A 1II3A 3D6CA 5C0XI 2F0EA 4CJ2C 2XNAC 2OEOA 4RKBA 3URYA 3S1RB 1SYFA 1UAPA 5C44B 5FLXE 1U4MA 1WTPA 3NE5B 5EPLA 3Q6SA 2NVYB 1B9MA 2O4XA 2F0HA 5C6AA 4IFDH 5EKKA 5D65A 1H9MA 3TBIB 4EQOA 3U9OA 1DONA 4KMUC 5K36G 3QOLA 4Q0FA 2WP8J 3T16A 5FK9C 3X3NA 4DAVA 4HMJA 1IYUA 1BUVT 1ZXTA 3R2IA 3SK8A 1ICWA 1E2ZA 3I4MB 3GTKB 1NUCA 4FF1A 1GUNA 1I4QA 5KYIA 1PZJD 5I6YA 2IWHA 1G2SA 2A6HD 2E2HB 2F3WA 2A68D 4RKLA 1B44D 1SYCA 3RD4A 2IJ0A 5T1GA 1ENFA 2EJFC 2B39A 2ZXOA 3TP8A 1F2LA 1STAA 3HOYB 2IPKD 2LKVA 4IALA 1BF4A 1JWSD 2D62A 5JVG3 5JOBA 3PO3B 1SNOA 1RODA 1JE4A 5A2QL 1DXMA 1K8MA 1KAAA 2MGSA 1TWFB 1RD9D 4L6TB 4CJ0B 4CKCA 5EQ0A 3CQZB 1BBXC 4FXKC 1MSGA 2EY1A 2R7ZB 4IUQA 5HGTA 3K59A 5F2DA 1HFGA 2ZXRA 2G9HD 3LWUA 2R3ZA 4RHRA 5KYLA 3EJIA 1WD0A 1Q3LA 1LT4D 1I4GA 3OMGA 2A74C 4LAAA 1XX8A 1SNMA 2F0VA 2IW3A 1BOSA 4CBVA 2LMCB 2K5QA 4FF2A 4QMGA 4A3EB 5C3EB 3Q23A 1CQFA 2XN9C 1SNCA 4RGNA 2AUJD 1ZYRC 3OWEB 1D5MC 2L4NA 3TZUA 2K28A 1MI2A 4FO2A 5I6WA 2EYPA 3A56A 2JXMB 1VDZA 3PV0A 5M9OA 3T51B 3A7LA 3I70A 1A3VA 5D3IB 4K6LA 1LABA 5CBAE 4G4KA 1LT6D 5A35A 4WORA 1LTBD 1E2WA 5ELEA 5LL6S 5JVH3 2L12A 1RCVD 3A8IE 5I2XA 3CRKC 5KNBA 2PW5A 1LTSD 2NTSA 3RZOB 2KHSA 2E2IB 1VF7A 3DHQA 2JSOA 4KY6A 4XIGS 4RCOA 4BY7B 1HPCA 5C0XJ 1WD1A 1GOZA 1SYBA 3H0GB 3GTMB 1IKMA 2F0GA 1VMCA 4G7OC 4U673 5FOBB 2B2TA 4LK1C 1SMYC 3MTSA 2R6GA 1CK1A 5DNFA 5ELDA 2B2YA 5ELBA 1YNND 2B2WA 1ET6A 5CORA 4FXDA 2E76C 2K04A 1PXUA 2FMCA 1SYEA 4B9XA 3J80E 2PPBC 1EYCA 2BA1A 3DUZA 1IHZA 4A3IB 1KDCA 3DM1A 5IT9E 2ENBA 1RDPD 4J6HA 3C2PA 1EYAA 3DWQA 1SJED 4F7XA 3MFYA 2NUCA 3KLRA 1QE6A 3MAQA 3M4YA 3L3OC 4ZK9B 4IFDG 1IW7D 2N55A 1GJXA 3FVQA 2PZUA 3A7AB 1CFMA 3C46A 4A3BB 5CV7A 3EA6A 3E6ZX 2RQXA 4N9PA 1JOQA 5K36H 4KK7A 3J81L 1EWHA 4K14A 4RFBA 4TSSA 1EOTA 3GTGB 3GD7A 1LO5D 3Q24A 4HAEA 1K83B 3AU7A 4Q5VA 1BNZA 2FMMA 4LJZC 1G6ZA 3H6MA 1EY5A 1EZ6A 1KLUD 1UEAB 3I72A 3PO2B 2F0UA 1D1IA 1YNJD 1DCZA 1EQVA 2EYLA 5ISRA 2VUMB 3BS1A 2F0QA 1NCVA 4KTAA 3I8ZA 1CTMA 2K5WA 1HCZA 5C0XH 1XWEA 4EVOA 1Y69U 1ESRA 5M3FB 4Y7NB 4ZQ3A 4P2CB 2GA4B 2FHTA 2ICEC 3GTOB 1TS5A 3HOVB 3P20A 5C4JB 3KBXA 4MHEA 3VA5A 2PYKA 1X3QA 5HURA 2BE5D 4G7ZC 3KLSA 2B2UA 4X3TA 2J0TD 2KVMA 2XSCA 1S5CD 1PMRA 1S5ED 4XDXA 3NBIA 2AUKA 2WKCA 3TMEA 2FJ2A 2HCIA 5EKLA 5JEAJ 1SE3A 1CHQD 3K5OA 3D4RA 1EU4A 4OIJA 2WV6D 5JPMC 4IQZA 2DN8A 1Q8IA 2XWJB 4QUCA 3GO5A 3ND9A 2K1BA 3PMFA 2L55A 1S5BD 2R93B 1W6KA 5I4DA 1BO0A 1F9QA 5E4XA 4RH6A 3AMUA 1EY4A 4K5XA 2F0SA 4ZKBB 2CQAA 3NQTA 2MUYA 4X3SA 3IFDA 1JOKA 3DWAA 1AW7A 1HRJA 1BR9A 4H7BA 1XXGA 4XTCS 4KN4C 3BYYB 3MHBA 3K0YA 4PMWA 4KY7A 3D31A 1EY7A 4KD3A 1NSNS 3NUCA 1ZKOA 3KUPA 1EEFD 1EYDA 1BQQT 1LLRD 2BDNA 2ZT9C 4FXGC 3EROA 1I4RA 1SNPA 2EJGC 3GP7A 1PLFA 3MVVA 1STEA 5C3XA 5JPNC 3C1EA 5I9PA 4XT3B 2K7VA 1IKLA 1M4VA 2RBMA 5EPKA 4XYOA 1OXUA 4OIKA 5TSSA 4KHZA 2EYMA 1CHPD 1GUOA 3LNNA 1TQOA 1VF5C 2F0DA 4LMQD 1SFOB 1H9KA 2KQ3A 3K5LA 4V0BA 2IX1A 3C1FA 2F03A 1J8IA 1F77A 5KNDA 5JEAH 1LTRD 2DNEA 1DM0B 2XIWA 3WOFA 1ZYRD 1B9NA 2R61A 4TQUS 2K32A 4DXFA 1D2BA 3BVZA 5C4XB 5AFWA 3ONAB 1PDQA 4RGOS 2C5CA 5J22A 5CBEE 1SE4A 1QOHA 3J7AF 1TY0A 1QB5D 2JA5B 4A93B 3NHHA 5JJZA 3S1MB 5E4WC 3BDOA 3Q0AA 3HKZB 5IGGA 1BCPC 2MPMA 4DXGA 2NVXB 4ZUIA 2B2VA 2RVLA 5BN5A 1CA5A 1GUSA 1HFNA 1JOOA 2EY5A 3FDTA 5KGUA 4C56C 3R93A 2NN6I 1QNKA 1Q90A 4ZYSA 3LWEA 1PTOC 5C0XG 2Z4IA 1PYWD 3T4AC 1PZKD 2FFKB 4U68A 2AWOA 1V1OA 3HZXA 3J80L 3I4NB 3I90A 1TS3A 2VNUD 2Q8TA 2X6LA 4N9TA 5IT9L 3W2DA 1EL0A 1O78A 2BCOA 4KHVA 1KLGD 3M3YB 5C3WA 5KNCA 1KABA 2PMZB 1PTOB 3NBHA 3K58A 2AQ1B 2NVTB 1WTXA 1Q1BA 2IX0A 2A6EC 4FVMA 2YYZA 1GUGA 2KA7A 4M8AA 3C3LA 4TRDA 4K6DA 5DEHA 1HA6A 3V2TA 1O7ZA 5LL6X 2B2YC 2RKSA 3QIAA 1QWYA 3N6RA 2SDFA 4A3JB 4OO1I 2B8GA 2EYFA 2F0PA 3X3MA 2EYOA 2B2WC 2PQEA 3UI2A 2KCCA 1A3TA 2QILA 2TSSA 4KKUA 1A2UA 1TIID 3EFXD 1KNEA 4IUPA 3G6JB 1JC7A 3S1NB 3OHXC 2D5DA 1DD2A 1DZ1A 2LY7A 4XXEA 4I65A 5FO9B 1CM9A 3FPUB 1RHPA 2DNCA 1R4QB 3VYSA 1LACA 5EPJA 3DWPA 4FF4A 2RDHA 2K33A 1OXTA 4QF4A 2KJXA 3SK4A 1TU2B 2DY8A 4BBRB 3NK9A 4IURA 2O5JC 3LX0A 2NWGA 1D5ZC 5EBCA 3K57A 3NTHA 1U9RA 5EJWA 3OOCA 2L11A 1A6XA 2F4IA 4FNFA 1H9RA 3K5NA 4FYDA 1H9SB 1S4ZA 1M8AA 4C1NK 4ILWA 4A3MB 2L9HA 1ENCA 4KJOA 1LTAD 1LTGD 1RJTA 4A3KB 3VA7A 4XYQA 4X3KA 1KDBA 3AB9A 1SYDA 2KEDA 4KKTA 3V05A 3SE0A 3MXNA 1LTTD 2A68C 4EQPA 3GTPB 5JEAG 1I4PA 3L7ZC 3MC0B 2NB0A 3D4WA 3NPPA 2A73B 2B2UC 3I3CA 2VXWA 2EVBA 3D3RA 3BDLA 3QG1A 1B4OA 2Z4HA 4MN3A 1RTOA 1AP0A 1G291 5M5WB 1MGSA 1WTRA 4DNRB 3GV3A 1C8CA 1TS4A 3EVQA 3VR3A 1V1PB 4F8MA 1I3QB 2F0FA 1LT3D 2H1EA 4F88A 3TDQA 1FNUA 1SBBB 1TWCB 4IUVA 4M1UB 3HOZB 4HR7B 2QEJC 1F9PA 3VR6A 4XQJA 4DN4M 4EGVA 3VR2A 2K03A 2B63B 4KD4A 2CW0C 4JBWA 3O13A 3N52A 2EYJA 2MJ8A 1GHJA 3Q22A 3IKJA 1QNUA 2M9VA 4KY5A 1SYGA 4C1NI 3HGBA 2R92B 1TWAB 3SK6A 1B53A 4HN7A 3H94A 4NW2A 1W6JA 4B9WA 1DOKA 2F0KA 3MXGA 3NWSA 3NSWA 1PTOH 1U4RA 2NZ1D 4DU9A 1DJRD 3MEHA 4XQQA 4IUNA 2J7ZA 5FLXL 3SR1A 3JAME 2Q8IB 3PUXA 3P1HA 1STNA 1NR2A 4C3IG 1EY9A 3IL8A 1HUMA 3VR5A 5NUCA 4YIJA 1I6HB 4O42A 2L0CA 2EY6A 5CV8A 1KDAA 1Y8OB 3NXWA 3HEJA 4C3IB 3VYRA 1LT5D 1SJHD 1S5FD 1H9JA 2EJMA 3BYTB 1V43A 2IT1A 4KJNA 4DK0A 4UAIA 4IN3A 3NQIA 4IUUA 2I07B 4HCEA 1EIHA 2PO4A 4G7HC 1UUPA 3SEBA 3PIP3 2NN6H 2NVQB 1BCPD 2J4XA 5G3LD 3R2TA 5CV5A 3SDZA 3HG9A 2EPBA 1WTWA 3DMUA 3OW7A 5BN3A 5ELFA 3TP6A 4KI0A 2N88A 2F0IA 3S14B 1JQYD 4DGZA 4FP5D 4G57A 4RHSA 1PTOD 1B50A 5EKIA 1PRTC 2KOLA 3BG3A 1MBYA 3MFGA 1D1KA 1IW7C 5CV4A 3KF8A 2IL8A 3NTIA 4ODGA 2NTTA 1HHVA 2TMPA 2RSOA 3I4LA 4GZYC 3NWTA 1PFMA 5T1IA 3CHBD 3J7AV 1A3UA 1I50B 1WCMB 4OO1H 1BCPF 1JB3A 5G3LF 1I4HA 5J39A 5ELCA 3S15B 5E1FA 2SNSA 1Z6HA 3HOWB 1CI3M 3T13A 1QJOA 2V4DA 5EBDA 4KKSA 2D2CC 3V96A 1YNJC 1B3AA 4CKBA 1A15A 3KBGA 4H13C 3M4OB 1GXDC 5CR3A 2Z8LA 1PTOF 2X69A 5FKAC 1SDFA 1C48A 2Q8RE 3E0JA 5CV9A 2EOTA 4F87A 2FINB 4J8QA 4FF3A 4C3HG 5CC4A 1ET9A 4WJWA 1DYQA 5C4ZA 1JR0D 4DNTB 1HTLD 5IGEA 1QG7A 1SAPA 1X32A 2WINB 1WTOA 1GHKA 5COYA 2JYOA 1C4QA 3S2DB 2F0OA 3VYUA 4E6IA 2KECA 2ICIA 3R8BA 1ML0D 4BS9A 1Q1EA 5IODA 1OXSC 4C3HB 2BE5C 1X3PA 1RKNA 2CVRA 1NR4A 3D8GA 1AN8A 3DEOA 5FO8B 3CRLC 1EY0A 2EYHA 2QCPX 2F1MA 2EE1A 2SEBD 1D5XC 3HS0C 3FMCA 5K5PA 5KEEA 2AQ3B 2BOSA 2OT2A 1CQVA 3D6WA 3BDCA 3A55A 1T5EA 2B8FA 2JP1A 1HA5A 1R4PB 4BA1I 2RA4A 2JEAI 2WB1B 4DAYA 3ND8A 1NAPA 5M5YB 3DEPA 1RTNA 2MHVA 1MD2D 4NKLA 4NP5A 2D9UA 2VB3X 1SMYD 4ZLTF 1TT2A 1BCPB 4O1NA 1FR3A 1PFBA 2JEBI 4EQNA 5KRUA 4RGTA 3R3OA 1ILQA 5IGDA 3QO2A 3PUZA 1HUNA 3I73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KD3 A;  1NSN S;  1NUC A;  1F2Y A;  1SYE A;  2EY2 A;  2EYO A;  2PQE A;  3DMU A;  5C4Z A;  5IIF A;  4DFA A;  5IGB A;  5KIX A;  1SNC A;  2EXZ A;  1A3T A;  4B9X A;  5IGE A;  3NUC A;  1EYC A;  3NP8 A;  4B9W A;  5KYI A;  4DF7 A;  5EGT A;  2RDF A;  2F0K A;  2F0N A;  4ZUJ A;  1SND A;  1KDB A;  1JOR A;  3TP6 A;  1EYD A;  2EYP A;  5I6W A;  1IHZ A;  5JAV A;  1A2U A;  1SYD A;  5I6Y A;  1KDC A;  4HTH A;  3OMC A;  2F0I A;  2F0O A;  2ENB A;  2PW7 A;  4J6H A;  3NHH A;  5M9O A;  1EYA A;  4K5V A;  4QB4 A;  4E6I A;  5J1Z A;  3VA5 A;  2F3W A;  2PYK A;  3ERO A;  5HUR A;  1A3V A;  4DGZ A;  4F7X A;  1SNP A;  4G57 A;  2F3V A;  4RKL A;  2NUC A;  3TP7 A;  5IOD A;  4DU9 A;  1STB A;  5IGG A;  2F0T A;  1EY6 A;  4EQP A;  1RKN A;  2F0L A;  3D4D A;  3MEH A;  4HMI A;  1SYC A;  3D8G A;  3MVV A;  4IUN A;  4I65 A;  5C5L A;  1EY7 A;  5C3X A;  2PZW A;  2WAC A;  3C1E A;  3SR1 A;  4ZUI A;  3ERQ A;  5I9P A;  5IGC A;  2RBM A;  1TR5 A;  5CV4 A;  2PZU A;  3P1H A;  1STN A;  4WOR A;  3SXH A;  3D4W A;  3TP8 A;  1EY9 A;  3MXP A;  1EY8 A;  5CV7 A;  1AEX A;  4ODG A;  4PMB A;  1STA A;  1JOO A;  1EY0 A;  2EYH A;  1II3 A;  3BDL A;  5NUC A;  3TME A;  2EY5 A;  3D6C A;  5EKL A;  2LKV A;  2OF1 A;  2EYM A;  2F0E A;  4K2L A;  4K5W A;  4N9P A;  4IAL A;  4PNY A;  4YIJ A;  5E3F A;  5KGU A;  1JOQ A;  3TP5 A;  2OEO A;  2EY6 A;  1TQO A;  5K5P A;  4RKB A;  3OSO A;  5JOB A;  3SHL A;  5KEE A;  1SNO A;  1SYF A;  5CV8 A;  4K14 A;  3E5S A;  4NMZ A;  2F0D A;  2PW5 A;  1A3U A;  2OXP A;  4K8J A;  2KQ3 A;  4K8I A;  3BDC A;  1A2T A;  1KDA A;  3EVQ A;  5DAU A;  4MIU A;  2KHS A;  1KAA A;  4QF4 A;  3NXW A;  5J39 A;  3HEJ A;  4ME5 A;  1EZ8 A;  3SK4 A;  3DHQ A;  5IOC A;  3HZX A;  3PMF A;  4IZ8 A;  4KY6 A;  2O4X A;  1F2Z A;  4R8N A;  2F0F A;  2F0H A;  2SNS A;  3H6M A;  3NK9 A;  3C1F A;  5E1F A;  4WRD A;  1EY5 A;  1EZ6 A;  2SOB A;  1STG A;  3T13 A;  5C6A A;  1SYB A;  3LX0 A;  4N9T A;  5C5M A;  2EY1 A;  2F0U A;  2F0G A;  4OL7 A;  5EKK A;  1ENA A;  4KHV A;  5HGT A;  5CGK A;  3ITP A;  3QOJ A;  4NKL A;  4NP5 A;  5F2D A;  1EY4 A;  4K5X A;  4EQO A;  1EQV A;  4K2K A;  3U9O A;  5C3W A;  1U9R A;  2F0S A;  1TT2 A;  2EYL A;  2M00 A;  4KJN A;  2QDB A;  4S3S A;  1KAB A;  5ISR A;  5CR3 A;  1STY A;  3NQT A;  2SNM A;  3QOL A;  5KYL A;  5C4H A;  1JOK A;  3MZ5 A;  2F0W A;  3OWF A;  2F0Q A;  3EJI A;  1F2M A;  4KTA A;  3T16 A;  4KD4 A;  3S9W A;  1SNQ A;  5I9O A;  4EQN A;  4H7B A;  2F0M A;  5IGF A;  3RUZ A;  4KV6 A;  4F8M A;  3P75 A;  4HMJ A;  5CV6 A;  4ID6 A;  5KRU A;  5J22 A;  3OMG A;  4J1M A;  2F0J A;  3QB3 A;  4LAA A;  2HQE A;  1SNM A;  2F0V A;  3R3O A;  5CV9 A;  4TRD A;  2EYJ A;  4K6D A;  5DEH A;  5IGD A;  4EVO A;  3V2T A;  3SK8 A;  3MHB A;  4NDX A;  1ENC A;  4KJO A;  5CV5 A;  2RKS A;  3SK5 A;  2PZT A;  4QMG A;  5CC4 A;  4KY7 A;  4KY5 A;  1SYG A;  4PMC A;  4ZQ3 A;  2EYF A;  2F0P A;  1STH A;  3SK6 A; 
#chains in the Genus database with same CATH topology
 2KEE A;  1SXT A;  5KIX A;  4DUZ Q;  2A69 C;  2K5D A;  3S2H H;  1TKW B;  2F0N A;  4ZUJ A;  1SND A;  1JOR A;  2RHQ B;  5EAY A;  2EQS A;  1R9T B;  2CHB D;  4HTH A;  3FKI B;  2B2T C;  3H3V I;  1F9S A;  4K5V A;  1SSO A;  1UEB A;  2UXC L;  1CZW A;  2BH8 A;  1O7L A;  2F3V A;  3TP7 A;  3GTL H;  2JE6 I;  4IJH A;  2PMZ E;  4DR7 Q;  2ZXP A;  1EUJ A;  4BA2 I;  2RDG A;  2K01 A;  2E2D C;  4HMI A;  1EIY B;  3HOX G;  5FLX c;  1PH6 A;  4AYB G;  1TR5 A;  3A0J A;  1E24 A;  1L1O C;  2YU9 B;  2NVQ H;  4P72 A;  3GV6 A;  3NEN A;  1QVC A;  1XMQ Q;  3G7L A;  1Z47 A;  2D0O A;  4JI3 Q;  3IFT A;  3J7Z C;  1SRU A;  2KCM A;  3TP5 A;  1XYI A;  2ZJR A;  4DV4 L;  4PZ7 A;  3SHL A;  4LF7 L;  4IUT A;  2O2L D;  1JMC A;  4K8I A;  5DAU A;  1A2T A;  3HOX B;  1VCI A;  2CW0 D;  2NN6 G;  4HSP A;  3S14 H;  3PSI A;  4AYB B;  5I2Y A;  3TSS A;  5M5X B;  1XNQ L;  1EZ8 A;  3TN2 A;  2ZM6 L;  4R8N A;  3I91 A;  3CC7 A;  1IYV A;  1WTH A;  1EU3 A;  2SOB A;  1SE2 A;  2L15 A;  5M3M G;  3E3X A;  4CHT B;  4C2M H;  1ENA A;  2H4O A;  4B3T Q;  2HCC A;  2K5N A;  4IPC A;  4K2K A;  4CDF C;  3KF6 A;  1SRO A;  4HCS A;  4XQN A;  1I6V C;  1LYL A;  1FNV A;  1OXX K;  1YIT A;  3BVG A;  4MNO A;  4UDU C;  1JWU D;  3JAM L;  1SNQ A;  1OO9 B;  4GKJ L;  2VB2 X;  1Y1W G;  4TKO B;  4KV6 A;  5CV6 A;  1CZG A;  3MA2 B;  3FPP A;  1CA6 A;  2E75 C;  3T1Y Q;  1ILP A;  1IL8 A;  1N32 L;  1I50 H;  1MSH A;  5D14 A;  2PNR C;  5M3M B;  1Q81 C;  1TWG H;  4NDX A;  3H3V C;  2C35 B;  3GTQ B;  2OWO A;  2NYZ D;  3HOU B;  4JK1 C;  5IIF A;  3VYT A;  1F2Y A;  1QCB D;  1TY2 A;  4LF8 Q;  2EXZ A;  1Y8P B;  2XRS D;  5FLM H;  4HJ5 A;  4JI6 L;  3EN2 A;  1GUT A;  3OIQ A;  4DF7 A;  5EGT A;  2B3G A;  1EWC A;  2EZV A;  1Y1W B;  4OO1 G;  3QJY A;  2CH4 A;  4X62 L;  4A3G G;  1DOM A;  3CC4 A;  1PH5 A;  4IFD I;  4V19 0;  3WDN A;  2UXD Q;  2E8G A;  1HQR D;  1AFP A;  3K7A B;  3CU7 A;  4B08 A;  4A3D H;  2QDL A;  4IO9 A;  2I46 A;  3KLS X;  2F0L A;  3D4D A;  5C5L A;  2JA7 G;  1ZEQ X;  2XWB B;  1ONL A;  2PZW A;  1I94 L;  1E0B A;  2WII B;  3DM3 A;  1FD7 D;  1TWH H;  2HDM A;  4RCN A;  5IP9 H;  4A3F G;  1HXY D;  2RSN A;  4PQX A;  4JI7 Q;  4A3G B;  4BBS G;  4KHP L;  2AMC B;  4K2L A;  3FRP B;  3A54 A;  4PG3 A;  4OWX B;  2A6H C;  4H44 C;  1Q46 A;  2HD3 A;  5JJK A;  5LMU Q;  1JWM D;  4C3J G;  2M2L A;  2KUM A;  4ZAI A;  4DUY L;  2JA7 B;  1G2T A;  4JI5 Q;  1IBM Q;  4ULL A;  1XNR L;  4A3F B;  3G71 A;  4AQY Q;  4WJ4 A;  1DOL A;  4IZ8 A;  2XTI A;  2AQ2 B;  5C44 H;  3CME A;  3RLO A;  4BBS B;  4L63 B;  1CKO A;  2K52 A;  1OXV A;  4C3H H;  2JA6 G;  4OL7 A;  4RWS C;  3T56 B;  4DKA C;  1EEI D;  2PQA A;  5CGK A;  3ITP A;  1KAW A;  3U4V A;  3S17 B;  1U4L A;  4C3J B;  5CYU A;  1KTK A;  2L1B A;  2BDO A;  2YV5 A;  2WAQ G;  3MZ5 A;  3OWF A;  3PIO 3;  3A8K E;  3RUZ A;  4DR2 Q;  2ASB A;  2JK8 A;  3P75 A;  4ZRZ A;  4HJ8 A;  4HSV A;  1RF2 D;  4J1M A;  1FL0 A;  2HQE A;  3MWY W;  4PV1 C;  4RAU C;  3GTJ B;  1K8O A;  4LFB L;  3TZD A;  4JI4 Q;  2JA6 B;  1AZQ A;  1PRT D;  4LNQ A;  5A2Q E;  1EWI A;  3FEW X;  5BN4 A;  2JA8 G;  1PH3 A;  2Z1C A;  1QIL A;  5IGB A;  2WAQ B;  4RGM A;  4K0K Q;  1D6E C;  5ELO A;  2G9D A;  4X64 Q;  1PYB A;  1PYS B;  2RDF A;  4X3U A;  4BWG B;  4UP9 A;  3H91 A;  2QEX A;  3I4M H;  3S16 B;  1C0A A;  4QB4 A;  3CKI B;  5J1Z A;  3GTK H;  3GQB A;  2X6G A;  3HRZ C;  2Y0S G;  1CT1 D;  1FYC A;  4YWM A;  1T5X D;  1AE3 A;  3H09 A;  2WAQ E;  1H9S A;  1STB A;  2F0T A;  1FNW A;  1BDO A;  1EY6 A;  3SVM A;  1KIX A;  4DR6 L;  2JA8 B;  3W3A A;  4CKE A;  5IGC A;  2WAC A;  2A5H A;  2E2H H;  2NBF A;  2KHJ A;  3ERQ A;  1PHJ A;  1GD7 A;  1YEZ A;  4B3T L;  1WTV A;  3I2Z A;  1EY8 A;  4OHJ A;  1TS2 A;  4R8I A;  4PMB A;  2KHI A;  3M85 A;  1E7Z A;  1J9O A;  4K5W A;  5E3F A;  4PNY A;  3EQL C;  1TVX A;  1Q12 A;  2Y0S B;  3NEM A;  2VQF Q;  1JE5 A;  4ABN A;  4LUV A;  3E5S A;  1E2V A;  2KEN A;  4QJF A;  4LF9 Q;  4K8J A;  4Z9C B;  3MXU A;  4LFC L;  3HOY H;  1PRT F;  2HT1 A;  1J5E L;  3FKI H;  3K5M A;  3U50 C;  4JOI A;  4BY1 G;  1AZP A;  3PO3 H;  2XRQ D;  2L5T A;  1YZ6 A;  3QWN A;  3BVM A;  3STB D;  1STG A;  4JV5 L;  5DM7 3;  2BA0 A;  2VZA A;  4XT1 B;  2E2J B;  3QOJ A;  1TWF H;  3K0X A;  3F2U A;  1O80 A;  2DJF C;  3KDF A;  4S3S A;  3RZD B;  3PUW A;  4OGQ C;  5C4H A;  1O7Y A;  4QCL A;  4CGY B;  4CJ1 B;  3S9W A;  4BY1 B;  5AJ3 L;  5IGF A;  2R7Z H;  4ID6 A;  4UY8 C;  2F0J A;  2RF4 A;  5GAG C;  3S2H B;  2IY5 B;  4P71 A;  1PFS A;  1V1P A;  5D3D A;  2A1A A;  1Z7T A;  4X65 L;  1EIG A;  4DR3 L;  1ESF A;  3SK5 A;  2PZT A;  4B3M Q;  2EY2 A;  3A8J E;  1G8Z D;  4HED A;  3S1Q B;  1EQT A;  2LFN A;  4O0A A;  1UNS A;  3GTL B;  3NP8 A;  1B2T A;  4JW0 A;  2AWN A;  3M4P A;  1LV9 A;  2V1C C;  2XVS A;  2YTV A;  5LMU L;  5JAV A;  1NJI C;  4KN7 C;  3OMC A;  1S5D D;  2CH4 W;  1B1Z A;  5C3E H;  2MP1 A;  5J3B A;  3M4Q A;  1WTQ A;  1YNN C;  2Z9H A;  2N3S A;  4RMF A;  4GLX A;  4Y52 H;  3CPF A;  4DA2 A;  1VQI A;  1XMO Q;  2N8N A;  3P7J A;  2F4V Q;  3M7N A;  4QIW B;  2E74 C;  2HUG A;  4LF6 Q;  4OWT B;  3U9S A;  1MJE A;  1E1T A;  1Y8N B;  4RA8 A;  1FGB D;  3MXP A;  4DR1 L;  4DAP A;  4ZKC B;  4JG2 A;  1V8Q A;  5CMD A;  4YY3 Q;  3PUY A;  2OF1 A;  1J6Q A;  1E3P A;  3HOU H;  4IFD J;  1EFI D;  3VR4 A;  3OSO A;  2Q2U A;  1I4X A;  4EQ5 A;  3HKS A;  4DR2 L;  4NMZ A;  3T53 B;  4DR5 Q;  1PH1 A;  4AH6 A;  2OXP A;  4DV1 Q;  2ID0 A;  5GQO A;  2KCN A;  4QUF A;  2UUA L;  3UDF A;  3PCO B;  4MIU A;  1PFN A;  1L0X B;  1PH2 A;  4C2M B;  2VS1 A;  3CP0 A;  2A19 A;  4ME5 A;  3CW2 C;  5IOC A;  1F2Z A;  4L8J A;  1G91 A;  3K7A H;  4WRD A;  1HQM C;  3H3V H;  5FLM G;  1PZI D;  2B2V C;  2HDL A;  3HP3 A;  3F2C A;  3WOE A;  2QKI C;  5C5M A;  3RLF A;  1WVL A;  4DK1 A;  1MIU A;  1K3B C;  3OW2 A;  3RZO H;  2E2I H;  3M7G A;  1EFW A;  3DXJ C;  1N34 L;  2A69 D;  1JCK B;  2M00 A;  2QDB A;  1STY A;  3K6O A;  3PUV A;  1HTP A;  1PRT B;  2SNM A;  1F9R A;  1TWG B;  4P74 A;  2F0W A;  4HID A;  1F2M A;  1RIP A;  2QF7 A;  3GTM H;  4A3D G;  4CDD C;  5I9O A;  2A6E D;  2F0M A;  3JAM c;  3L9A X;  4DV3 L;  3K80 C;  3CF5 A;  1VMP A;  1GUW A;  4R9W A;  3QB3 A;  3J81 E;  3J7Y W;  3CMA A;  1KNA A;  4AIM A;  1Y1V G;  2K6A A;  5IP9 G;  1VQ6 A;  5DM6 3;  3RMH A;  1PH8 A;  4PMC A;  1KXL A;  3ZYY X;  3BZD B;  1STH A;  2WKD A;  3A74 A;  2LS0 1;  1L0Y B;  4DFA A;  1UE6 A;  3ICE A;  2EDG A;  5IYD H;  4H0L C;  4A3D B;  4WFN 3;  5IWA L;  1SEB D;  1RL2 A;  3KK7 A;  3Q8D A;  2PW7 A;  1NMF A;  3S17 H;  2PCF B;  2HQL A;  1TWH B;  3NTK A;  3OPO A;  1Y1V B;  2IX3 A;  1K8G A;  2YTX A;  1JIC A;  1QUQ A;  3OIP A;  1BXT A;  5C44 G;  1JB7 A;  5FO7 B;  5LHY 1;  3J81 i;  1D8L A;  1C9O A;  3GDE A;  1U4P A;  3NEL A;  1LTI D;  3W5O A;  4GOP B;  4A3I H;  4A75 A;  2O5I C;  1CKM A;  2VL6 A;  2YTY A;  3MEF A;  2JQO A;  2N49 A;  2K05 A;  1V9P A;  3SXH A;  3IAY A;  1WJJ A;  2C9O A;  4OEM B;  1Q82 C;  1AEX A;  1XTC D;  4I7Z C;  2DY7 A;  1II3 A;  4DV7 L;  3D6C A;  5C0X I;  2F0E A;  4CJ2 C;  5GAH C;  2XNA C;  2OEO A;  4RKB A;  3U58 A;  2MFI A;  3NBH B;  3URY A;  3S1R B;  1SYF A;  1UAP A;  5C44 B;  5FLX E;  1U4M A;  1VQB A;  1WTP A;  4A3B H;  3NE5 B;  5EPL A;  1HNZ L;  3Q6S A;  4B3R Q;  4QL5 A;  4QGU A;  2NVY B;  1PH9 A;  1B9M A;  3T1H Q;  5BR8 L;  2O4X A;  2F0H A;  3BJU A;  1D7Q A;  2I5H A;  1HNW L;  3GTG H;  2ZTE A;  3BU2 A;  5C6A A;  1KRS A;  2JA8 H;  4IFD H;  2F3I A;  1YI2 A;  5EKK A;  5D65 A;  1H9M A;  3TBI B;  3I4M G;  4EQO A;  3U9O A;  4JPB W;  1AE2 A;  1DON A;  4KMU C;  5K36 G;  3QOL A;  3FP9 A;  4Q0F A;  2WP8 J;  4LUO A;  3T16 A;  3W1B A;  5FK9 C;  3X3N A;  4DAV A;  3E9H A;  4HMJ A;  3CCJ A;  4IOC A;  1IYU A;  4LF4 L;  4OEL B;  2R7D A;  1BUV T;  1ZXT A;  2K5H A;  4X66 L;  4LF6 L;  3R2I A;  1HNX Q;  1PH4 A;  2VUM H;  3SK8 A;  1ICW A;  1E2Z A;  4DV2 Q;  2VW9 A;  3I4M B;  1X54 A;  3GTK B;  1NUC A;  1HZC A;  4FF1 A;  1GUN A;  1I4Q A;  3K7U C;  5KYI A;  4ME3 A;  4DV0 Q;  5HGQ A;  4R4O A;  2WB1 E;  3F1Z A;  4GNX C;  1PZJ D;  2E2J H;  5I6Y A;  5M3F H;  3HOY G;  2IWH A;  1G2S A;  2A6H D;  4Y7N H;  2E2H B;  4HIK A;  2UUB Q;  2F3W A;  3RZD H;  1VQ5 A;  3PO3 G;  2A68 D;  1CSQ A;  1B8A A;  4RKL A;  4HIM A;  1B44 D;  5C4J H;  1SYC A;  3RD4 A;  2IJ0 A;  2K50 A;  1KHI A;  2GVB A;  5T1G A;  1ENF A;  2EJF C;  2B39 A;  1WYD A;  2ZXO A;  3TP8 A;  4B3S Q;  2E5L Q;  4TVA B;  2P5Z X;  1C7Y A;  2D0P A;  1F2L A;  1STA A;  1IBL L;  3HOY B;  2IPK D;  2LKV A;  4IAL A;  1BF4 A;  2MO1 A;  1JWS D;  2D62 A;  5JVG 3;  1SE8 A;  5JOB A;  3S1Q H;  3PO3 B;  2R7Z G;  1SNO A;  1CKN A;  1ROD A;  4JCV E;  1JE4 A;  3K81 C;  5A2Q L;  1DXM A;  1K8M A;  1SR3 A;  1KAA A;  4JYA Q;  2MGS A;  1TWF B;  1RD9 D;  4L6T B;  2MO0 A;  4CJ0 B;  4CKC A;  5EQ0 A;  3CQZ B;  1BBX C;  4FXK C;  1MSG A;  1HJP A;  2EY1 A;  2R7Z B;  4IUQ A;  5HGT A;  3K59 A;  5F2D A;  4A3E G;  5C3E G;  1HFG A;  2R93 H;  1XPU A;  2ZXR A;  2G9H D;  4NPS A;  3OTO L;  2HHH L;  2UUC L;  3LWU A;  3E9I A;  2R3Z A;  4RHR A;  5KYL A;  2CKZ B;  3A5Z B;  3EJI A;  1WD0 A;  1Q3L A;  1LT4 D;  1I4G A;  3OMG A;  2AHO B;  2A74 C;  4NXN Q;  4LAA A;  1XX8 A;  1SNM A;  1L1O B;  2F0V A;  2IW3 A;  4CDC C;  2VQE L;  1BOS A;  3PIO A;  4CBV A;  2LMC B;  4JBK A;  2K5Q A;  4FF2 A;  4QMG A;  4A3E B;  5C3E B;  4AYB E;  1YVC A;  3Q23 A;  1CQF A;  2XN9 C;  3HOU G;  1VQJ A;  3B6Y A;  1SNC A;  4RGN A;  2AUJ D;  1VQ4 A;  1ZYR C;  3OWE B;  4MTK A;  4P73 A;  1D5M C;  2L4N A;  5E7N A;  2K28 A;  3TZU A;  1MI2 A;  1VQL A;  4FO2 A;  5I6W A;  2EYP A;  1IBK L;  3A56 A;  2JXM B;  1VDZ A;  4JI2 L;  3ULL A;  3PV0 A;  5M9O A;  3T51 B;  3A7L A;  4QY7 A;  3TEH B;  1IL2 A;  3I70 A;  1A3V A;  3CCE A;  1GM5 A;  5D3I B;  4K6L A;  1PVO A;  1LAB A;  5CBA E;  3LGJ A;  2Q2I A;  4G4K A;  1LT6 D;  4DR4 Q;  5A35 A;  4WOR A;  1LTB D;  1E2W A;  5ELE A;  5LL6 S;  5JVH 3;  2Z6K A;  2R7F A;  2L12 A;  3ULP A;  2CFM A;  3WWV A;  3TRZ A;  4YWL A;  2OQ0 A;  1RCV D;  4BY7 G;  3A8I E;  4BXX G;  3H0G G;  1X65 A;  1A8V A;  5I2X A;  3CRK C;  5KNB A;  2JA9 A;  2PW5 A;  1LTS D;  2NTS A;  3W1G A;  3RZO B;  2KHS A;  1HNX L;  2E2I B;  2I0Q A;  1S3O A;  1VF7 A;  3DHQ A;  2JSO A;  1Y1V H;  3PF5 A;  4KY6 A;  4XIG S;  4RCO A;  1NBW A;  1SFO H;  4BY7 B;  1HPC A;  2JN4 A;  5C0X J;  5IYD G;  4GS3 A;  1WD1 A;  2CQO A;  1GOZ A;  1SYB A;  3H0G B;  3GTM B;  1IKM A;  2F0G A;  1VMC A;  2A8V A;  4YCV A;  4G7O C;  4U67 3;  2ZTC A;  5FOB B;  2B2T A;  4LK1 C;  1SMY C;  3MTS A;  2R6G A;  1K9M C;  1CK1 A;  3KYH C;  5DNF A;  2UXB L;  4LFA Q;  4L5S A;  4OX9 Q;  5ELD A;  2B2Y A;  5ELB A;  4A3I G;  3S1R H;  1YNN D;  1L0W A;  4DUZ L;  2B2W A;  1ET6 A;  5COR A;  2NVY H;  4P75 A;  1VQP A;  4FXD A;  3L0O A;  1L1O A;  2E76 C;  2K04 A;  1PXU A;  2FMC A;  1FJG Q;  1SYE A;  5LMN Q;  4B9X A;  3J80 E;  2PPB C;  2VY3 A;  1EYC A;  5C4X H;  4A76 A;  2BA1 A;  3DUZ A;  1PV4 A;  4A3B G;  3PGZ A;  4DR7 L;  1IHZ A;  4A3I B;  1KDC A;  3DM1 A;  5IT9 E;  2ENB A;  1RDP D;  4J6H A;  3C2P A;  1N33 Q;  1EYA A;  3DWQ A;  1SJE D;  4F7X A;  3MFY A;  2BH2 A;  2NUC A;  3KLR A;  1QE6 A;  3MAQ A;  3M4Y A;  2ZTD A;  3L3O C;  1XMQ L;  4ZK9 B;  4GN3 B;  4JI3 L;  4IFD G;  1IW7 D;  2N55 A;  4A93 H;  3TS2 A;  3S1M H;  1GJX A;  3FVQ A;  2PZU A;  3A7A B;  1WOC A;  1CFM A;  1UE1 A;  1LTL A;  3C46 A;  4A3B B;  5CV7 A;  4GKK Q;  3EA6 A;  3E6Z X;  2RQX A;  1A0I A;  3J80 i;  4N9P A;  3I56 A;  1HR0 Q;  1JOQ A;  3PO2 G;  5K36 H;  5H1S E;  4KK7 A;  3J81 L;  1EWH A;  4K14 A;  4RFB A;  4TSS A;  1EOT A;  4NXN L;  1KD1 C;  2I5M X;  3GTG B;  3GD7 A;  1LO5 D;  3Q24 A;  2VUM G;  4HAE A;  3RN2 A;  4OXP A;  1K83 B;  4NXM Q;  3AU7 A;  4Q5V A;  1BNZ A;  5GRO A;  2FMM A;  4LJZ C;  1G6Z A;  3H6M A;  5IY0 A;  1VQC A;  4MZ9 A;  1EY5 A;  1EZ6 A;  1KLU D;  1UEA B;  3I72 A;  4GLA C;  4IPD A;  3PO2 B;  2F0U A;  2MQH A;  1D1I A;  1YNJ D;  1YHB A;  2DGY A;  5M3F G;  1DCZ A;  4POF A;  1NY4 A;  1EQV A;  4R4T A;  3I4N H;  2EYL A;  5ISR A;  3T1Y L;  2VUM B;  3BS1 A;  2F0Q A;  1NCV A;  4KTA A;  3I8Z A;  3HOV G;  1CTM A;  4GN5 A;  2K5W A;  3KFU A;  3M9B A;  2Y0S E;  1YBY A;  3M3Y H;  1HCZ A;  4PZ6 A;  5C0X H;  4LF8 L;  4YCU A;  1XWE A;  4EVO A;  1Y69 U;  1ESR A;  5M3F B;  2NVT H;  3KF8 B;  4Y7N B;  4ZQ3 A;  4P2C B;  4FDB A;  2GA4 B;  5LMN W;  3CQZ H;  2LXJ A;  2FHT A;  2ICE C;  2UXD L;  3GTO B;  4O2D A;  1TS5 A;  3HOV B;  3P20 A;  5C4J B;  1N36 Q;  3RNU A;  3KBX A;  4MHE A;  4A3J H;  3VA5 A;  2PYK A;  1X3Q A;  5HUR A;  2OCE A;  2BE5 D;  4G7Z C;  3KLS A;  4JI1 Q;  1S40 A;  2B2U A;  4JI7 L;  4X3T A;  2J0T D;  4JI8 Q;  2KVM A;  2XSC A;  3UDG A;  1S5C D;  1PMR A;  1S5E D;  1VQN A;  3AYH B;  1ASY A;  4XDX A;  3AEV A;  1VQ9 A;  3NBI A;  2R93 G;  2AUK A;  2WKC A;  3TME A;  3CCV A;  2FJ2 A;  2HCI A;  5EKL A;  5JEA J;  1P8L A;  1SE3 A;  4A4I A;  4A3E H;  1NTG A;  1CHQ D;  3K5O A;  4JI5 L;  1IBM L;  1VQF A;  3D4R A;  1EU4 A;  4OIJ A;  2WV6 D;  5JPM C;  4AQY L;  4IQZ A;  2DN8 A;  1EQQ A;  1Q8I A;  2XWJ B;  4QUC A;  3KJO A;  4JI0 Q;  3GO5 A;  1E1O A;  3RN5 A;  1X3F A;  1GO3 E;  3ND9 A;  1XPR A;  4L5R C;  2K1B A;  3PMF A;  2L55 A;  1S5B D;  1YHQ A;  2R93 B;  1WFQ A;  4LWC A;  1W6K A;  1H95 A;  5I4D A;  1BO0 A;  1FGU A;  1F9Q A;  5E4X A;  4RH6 A;  2UU9 Q;  4QIW E;  3AMU A;  1EY4 A;  4K5X A;  2JJQ A;  2G5D A;  2F0S A;  4ZKB B;  2CQA A;  4UP8 A;  3NQT A;  2MUY A;  4X3S A;  3IFD A;  1JOK A;  3DWA A;  4JI4 L;  1IZ6 A;  1AW7 A;  1L2F A;  3UE1 A;  1HRJ A;  1BR9 A;  4H7B A;  1XXG A;  1WI5 A;  4ALP A;  4XTC S;  3BZC A;  4KN4 C;  3BYY B;  3A5U A;  1CUK A;  2PI2 E;  4K0K L;  4X64 L;  3MHB A;  3K0Y A;  4PMW A;  1UWV A;  3RLN A;  4LF5 Q;  4KY7 A;  3PF4 A;  4J15 A;  3D31 A;  1EY7 A;  4KD3 A;  1NSN S;  3E0E A;  4WJ3 M;  1EOV A;  1YJ9 A;  3IRB A;  4BY7 H;  3NUC A;  3J81 j;  1ZKO A;  4BXX H;  3H0G H;  1EEF D;  3KUP A;  4HJA A;  4A3M H;  1N9W A;  1EYD A;  2Z0S A;  4PZ8 A;  1EYG A;  1BQQ T;  1LLR D;  1A62 A;  2BDN A;  2ZT9 C;  4A3K H;  4FXG C;  3ERO A;  1I4R A;  1SNP A;  2EJG C;  3GP7 A;  1VQD A;  1S72 A;  1PLF A;  2GVA A;  1XJV A;  3MVV A;  1STE A;  2QW7 A;  5C3X A;  5JPN C;  3C1E A;  5I9P A;  1W3S A;  4XT3 B;  2K7V A;  1IKL A;  1M4V A;  4DAY B;  2RBM A;  2DJG C;  2VQF L;  5EPK A;  1K8A C;  4XYO A;  3CPW A;  4LF9 L;  1OXU A;  4OIK A;  2EXD A;  5TSS A;  3UE0 A;  4KHZ A;  2EYM A;  4DV6 Q;  1CHP D;  1GUO A;  3LNN A;  4IPG A;  3CCS A;  4JC0 A;  1TQO A;  2I5L X;  1QZH A;  1VF5 C;  1BBW A;  1M90 C;  2F0D A;  4LMQ D;  1SFO B;  1H9K A;  2EIF A;  2KQ3 A;  3K5L A;  4V0B A;  4CDE C;  2IX1 A;  1SMX A;  4LF7 Q;  3C1F A;  2F03 A;  1J8I A;  1ICF B;  1F77 A;  5KND A;  5JEA H;  1NMG A;  1VQM A;  5C4X G;  3STB C;  1XNQ Q;  4GN4 B;  1LTR D;  2DNE A;  1DM0 B;  2XIW A;  2ZM6 Q;  1N36 L;  3WOF A;  1ZYR D;  1B9N A;  1TWC H;  2R61 A;  4TQU S;  2PI2 A;  1NNX A;  2K32 A;  2K75 A;  3HOZ H;  1B7Y B;  3H15 A;  4B3M L;  2JA5 G;  4DXF A;  4R4C A;  4A93 G;  1D2B A;  3BVZ A;  4L5T A;  5C4X B;  5AFW A;  1HZB A;  1K0R A;  3HKZ G;  2B63 H;  3ONA B;  1PDQ A;  1K83 H;  3DLL A;  4RGO S;  2C5C A;  1VQ8 A;  1X6O A;  5J22 A;  1N32 Q;  5CBE E;  1SE4 A;  3AQQ A;  1EQR A;  4L5Q A;  1QOH A;  3J7A F;  1TY0 A;  3PO2 H;  1QB5 D;  1XMO L;  3KOJ A;  2JA5 B;  4A93 B;  2F4V L;  3NHH A;  5JJZ A;  5IP7 H;  3F2D A;  2R92 H;  1TWA H;  3S1M B;  1YIJ A;  4JI6 Q;  5E4W C;  3BDO A;  1JJ2 A;  3Q0A A;  3HKZ B;  3CCM A;  3CD6 A;  5IGG A;  1BCP C;  2MPM A;  4DXG A;  4YY3 L;  4EX5 A;  2NVX B;  3CCR A;  4ZUI A;  2B2V A;  2RVL A;  5BN5 A;  2CWA A;  2F52 A;  1CA5 A;  1GUS A;  3F2B A;  1HFN A;  3I4N G;  4UPA A;  4DR5 L;  1JOO A;  4DV1 L;  1VQE A;  2EY5 A;  3FDT A;  1KRT A;  3KF6 B;  4C56 C;  5KGU A;  1I94 Q;  3R93 A;  2B29 A;  2K5V A;  2NN6 I;  2QA4 A;  1QVF A;  1QNK A;  2OQK A;  2Z6K C;  1Q90 A;  4ZYS A;  3J81 c;  4APV A;  3GTO H;  1QZG A;  1UE7 A;  3LWE A;  3HOV H;  1PTO C;  5C0X G;  4KHP Q;  2Z4I A;  1PYW D;  3T4A C;  1PZK D;  2FFK B;  4U68 A;  2AWO A;  1V1O A;  3HZX A;  3J80 L;  4GOP A;  3I4N B;  2LSS A;  3I90 A;  3I7F A;  1TS3 A;  4GNX B;  2VNU D;  2Q8T A;  1PA6 A;  2X6L A;  4N9T A;  5IT9 L;  3W2D A;  1EL0 A;  1XNR Q;  2IHE A;  1O78 A;  3UDX A;  2BCO A;  4KHV A;  4C3I H;  1KLG D;  4A3J G;  3M3Y B;  5C3W A;  5KNC A;  5DLQ E;  5GAE C;  4NB3 A;  1KAB A;  2PMZ B;  1PTO B;  2HIX A;  3NBH A;  3K58 A;  2AQ1 B;  3L2P A;  2NVT B;  1WTX A;  1Q1B A;  2IX0 A;  2A6E C;  4FVM A;  1A63 A;  2YYZ A;  1GUG A;  2KA7 A;  4M8A A;  1BBU A;  2KBN A;  1XPO A;  3C3L A;  1BVS A;  4TRD A;  4K6D A;  5DEH A;  1YJW A;  1HA6 A;  4I7A A;  3RR5 A;  3V2T A;  1O7Z A;  5LL6 X;  3CC2 A;  2B2Y C;  2RKS A;  1SN8 A;  1QWY A;  3QIA A;  3N6R A;  5GAD C;  2SDF A;  4A3J B;  4OO1 I;  2B8G A;  2EYF A;  2F0P A;  3EIV A;  4DV6 L;  2PQE A;  2EYO A;  2B2W C;  3HFZ B;  3X3M A;  3UI2 A;  4LFB Q;  2KCC A;  1A3T A;  4HJ7 A;  2QIL A;  1AH9 A;  2TSS A;  4KKU A;  4ZCK A;  1A2U A;  2ZJQ A;  3MXN B;  1TII D;  3EFX D;  1KNE A;  4IUP A;  4A3C H;  3G6J B;  1JC7 A;  3S1N B;  3OHX C;  2D5D A;  3JC6 6;  1DD2 A;  1DZ1 A;  2LY7 A;  4XXE A;  2MNA A;  4I65 A;  5FO9 B;  1X9N A;  1CM9 A;  2OTJ A;  3FPU B;  1RHP A;  2DNC A;  2Z6B A;  1R4Q B;  3VYS A;  4BBR G;  1LAC A;  2PQA B;  4DR6 Q;  1MKH A;  5EPJ A;  4DPG A;  4B3R L;  4H02 A;  3DWP A;  3T1H L;  4FF4 A;  2RDH A;  2CWP A;  2ATW A;  2K33 A;  1VQA A;  2Q2H A;  1OXT A;  4HJ9 A;  1I5F A;  4QF4 A;  2KJX A;  3SK4 A;  1TU2 B;  4X6A H;  1BKB A;  3KLW A;  2DY8 A;  1V1Q A;  3ERS X;  3NK9 A;  4BBR B;  1JJC B;  1GVP A;  4IUR A;  4LFC Q;  1KC8 C;  2O5J C;  1J5E Q;  1WCM H;  3LX0 A;  2NWG A;  1D5Z C;  5EBC A;  4A3M G;  2ES2 A;  2DUD A;  3S15 H;  3K57 A;  4GNX A;  3NTH A;  1U9R A;  4A3K G;  5EJW A;  3HOW H;  3OOC A;  4JV5 Q;  2L11 A;  1IXR A;  1X3E A;  1A6X A;  2F4I A;  3PQI A;  4FNF A;  1H9R A;  3K5N A;  1X56 A;  4DV2 L;  4FYD A;  1H9S B;  3BZK A;  3M4O H;  1S4Z A;  5ELN A;  1M8A A;  4C1N K;  4JOI C;  4ILW A;  1VQG A;  2L9H A;  4A3M B;  5AJ3 Q;  1ENC A;  4DV0 L;  4LW1 A;  4KJO A;  4UHV A;  1LTA D;  1KL9 A;  1LTG D;  1RJT A;  4A3K B;  5JJI A;  1TXY A;  2UUB L;  1E22 A;  4X65 Q;  4DR3 Q;  3VA7 A;  4XYQ A;  4X3K A;  1KDB A;  4DV5 Q;  2IHF A;  3AB9 A;  1SYD A;  2KED A;  1Y14 B;  3UDI A;  1GKH A;  4KKT A;  3V05 A;  3SE0 A;  3MXN A;  1LTT D;  4B3S L;  2E5L L;  2A68 C;  2PNH A;  4EQP A;  1U5K A;  3GTP B;  3FHW A;  5JEA G;  4IOA A;  1I4P A;  3L7Z C;  3S2D H;  4IPH A;  3MC0 B;  1JT8 A;  2NB0 A;  3D4W A;  3NPP A;  2A73 B;  2B2U C;  3I3C A;  1PH7 A;  2VXW A;  2NZO A;  1FVI A;  2EVB A;  3D3R A;  3BDL A;  3QG1 A;  1B4O A;  2Z4H A;  4MN3 A;  5FJ8 H;  3KDF B;  1RTO A;  4JYA L;  3HOZ G;  1AP0 A;  4DR1 Q;  1G29 1;  1DGS A;  5M5W B;  1MGS A;  1WTR A;  4DNR B;  3GV3 A;  5IYB G;  1C8C A;  4POG A;  1TS4 A;  3EVQ A;  2JA5 H;  2B63 G;  1MJC A;  3ULJ A;  4A3L H;  3VR3 A;  1V1P B;  4F8M A;  1I3Q B;  1K0S A;  2F0F A;  1LT3 D;  2H1E A;  4OON A;  1IYJ B;  4F88 A;  2UUA Q;  2RCF A;  3S24 A;  3TDQ A;  4N8X 1;  1FNU A;  1SBB B;  1TWC B;  1NE3 A;  4IUV A;  2NVX H;  4M1U B;  3HOZ B;  4HR7 B;  2QEJ C;  5IP7 G;  2R92 G;  1F9P A;  3VR6 A;  4XQJ A;  4DN4 M;  4IJL A;  4EGV A;  3PIP A;  3VR2 A;  2K03 A;  2NZH A;  5M5Y H;  2B63 B;  4KD4 A;  4RG1 A;  2CW0 C;  5IE8 A;  4JBW A;  5HY6 A;  1KQS A;  1N34 Q;  3O13 A;  3N52 A;  2EYJ A;  4DK6 C;  2MJ8 A;  1GHJ A;  3Q22 A;  3IKJ A;  1QNU A;  4KLK A;  3G6E A;  4DV3 Q;  2M9V A;  4KY5 A;  1SYG A;  4C1N I;  3HGB A;  4GLV B;  2R92 B;  1TWA B;  3SK6 A;  1B53 A;  4HN7 A;  3TRE A;  3G4S A;  3H94 A;  3CAM A;  4NW2 A;  1W6J A;  4B9W A;  1DOK A;  1G51 A;  1X55 A;  2F0K A;  3MXG A;  3U4Z A;  3NWS A;  5IYC H;  1K3R A;  3NSW A;  1JJG A;  4DR4 L;  1PTO H;  1U4R A;  1VS0 A;  5IWA Q;  1W2B A;  2NZ1 D;  4DU9 A;  1DJR D;  3MEH A;  4XQQ A;  4IUN A;  2J7Z A;  1R9T H;  5FLX L;  3SR1 A;  3JAM E;  2Q8I B;  3PUX A;  1VQ7 A;  3P1H A;  1STN A;  1NR2 A;  4C3I G;  1Q8K A;  1B70 B;  4LUZ A;  1EY9 A;  3IL8 A;  1HUM A;  1HZ9 A;  3VR5 A;  5NUC A;  1MHW C;  4YIJ A;  1I6H B;  4O42 A;  2L0C A;  2EY6 A;  4R1J A;  3KJP A;  5CV8 A;  2H5X A;  4DNI A;  4DV7 Q;  2YU9 H;  4OWW B;  1KDA A;  1Y8O B;  3NXW A;  3HEJ A;  4C3I B;  4QQB X;  3VYR A;  3JAM i;  3J80 c;  3S1N H;  1HNZ Q;  1UE5 A;  3CCQ A;  1LT5 D;  1SJH D;  3OYY A;  1HR0 W;  3HOX H;  1S5F D;  5BR8 Q;  4LFA L;  5IT9 c;  3I55 A;  1H9J A;  5M5X H;  4DV5 L;  2EJM A;  2K4K A;  4OX9 L;  2FXQ A;  3BYT B;  1V43 A;  2IT1 A;  4KJN A;  1HNW Q;  4DK0 A;  4UAI A;  4A3C G;  4IN3 A;  3NQI A;  1QUQ B;  4IUU A;  1K73 C;  2I07 B;  4HCE A;  1EIH A;  2PO4 A;  3AFQ A;  4G7H C;  2GN5 A;  1FJG L;  1UUP A;  5LMN L;  3SEB A;  3PIP 3;  1OTC A;  2NN6 H;  2NVQ B;  1BCP D;  2J4X A;  5G3L D;  3R2T A;  5CV5 A;  3SDZ A;  3HG9 A;  1YNX A;  2EPB A;  1WTW A;  4LF4 Q;  3DMU A;  4BBR H;  4X66 Q;  1N33 L;  3OW7 A;  3EBE A;  5BN3 A;  5ELF A;  5M3M H;  3TP6 A;  3AFP A;  4KI0 A;  3GTQ H;  4YHH Q;  2N88 A;  2F0I A;  3S14 B;  4DAM A;  2QGQ A;  1JQY D;  4DGZ A;  4FP5 D;  4G57 A;  4RHS A;  1PTO D;  1P16 A;  1B50 A;  4GKK L;  5EKI A;  1T9H A;  1PRT C;  1Y1W H;  2XGT A;  1WCM G;  2KOL A;  3BG3 A;  1YJN A;  2HIV A;  1MBY A;  3MFG A;  1D1K A;  1HR0 L;  1IW7 C;  5CV4 A;  1X3G A;  3KF8 A;  4HIO A;  2IL8 A;  2KCT A;  3NTI A;  4ODG A;  2NTT A;  3HOW G;  1XTD A;  1HHV A;  2TMP A;  2RSO A;  3I4L A;  3G48 A;  4GZY C;  3NWT A;  1PFM A;  1N8R C;  3ZJY C;  5T1I A;  4NXM L;  1U0L A;  3CHB D;  3J7A V;  1A3U A;  2LXK A;  1I50 B;  1IBL Q;  1WCM B;  4OO1 H;  1BCP F;  1JB3 A;  5G3L F;  4A3G H;  1I4H A;  5J39 A;  2UXC Q;  5ELC A;  3S15 B;  4N8F A;  2ZJP A;  5E1F A;  2SNS A;  1Z6H A;  3HOW B;  1CI3 M;  1EIF A;  3T13 A;  1LM0 A;  3GTP H;  4JBJ A;  2JA7 H;  1QJO A;  1SLJ A;  2AKW B;  2CCZ A;  1HZA A;  2V4D A;  4GOP C;  5EBD A;  4KKS A;  2D2C C;  3V96 A;  1YNJ C;  4A3F H;  1B3A A;  4CKB A;  1A15 A;  3KBG A;  1QVG A;  4H13 C;  3M4O B;  5JJL A;  1GXD C;  5CR3 A;  1B3Q A;  2Z8L A;  1PTO F;  4BBS H;  2X69 A;  4DV4 Q;  5FKA C;  1SDF A;  1C48 A;  2Q8R E;  3E0J A;  1VQO A;  4C3J H;  5M5W H;  3OTO Q;  2HHH Q;  5CV9 A;  2UUC Q;  2Q2T A;  2EOT A;  1Z9F A;  1ASZ A;  3F8T A;  4F87 A;  2FIN B;  4J8Q A;  4FF3 A;  2RHS B;  4C3H G;  5CC4 A;  1ET9 A;  1K28 A;  4WJW A;  1DYQ A;  5FJ8 G;  1I3Q H;  3VDY A;  5C4Z A;  1JR0 D;  4DNT B;  3GTJ H;  2VQE Q;  1HTL D;  5IGE A;  1QG7 A;  1SAP A;  1X32 A;  2WIN B;  1WTO A;  2JA6 H;  1GHK A;  5COY A;  2JYO A;  4JI1 L;  1C4Q A;  3S2D B;  1CKN B;  3QR8 A;  2F0O A;  3VYU A;  4E6I A;  2KEC A;  4JI8 L;  2ICI A;  5IYB H;  3R8B A;  1ML0 D;  1CSP A;  4A3L G;  4BS9 A;  1Q1E A;  5IOD A;  4GKJ Q;  1OXS C;  1IBK Q;  4C3H B;  2BE5 C;  1X3P A;  3K8A A;  1RKN A;  2CVR A;  4JI2 Q;  1NR4 A;  3D8G A;  4JVZ A;  1AN8 A;  4YCW A;  3S16 H;  2N78 A;  3D0F A;  4MTN A;  3DEO A;  1O7I A;  5FO8 B;  1Q86 C;  3CRL C;  3TS0 A;  1EY0 A;  2EYH A;  2QCP X;  2WB1 G;  2F1M A;  2EE1 A;  4JI0 L;  2SEB D;  2WFW A;  1D5X C;  3HS0 C;  3CCL A;  3FMC A;  5K5P A;  5KEE A;  2AQ3 B;  1VQH A;  2BOS A;  2OT2 A;  1Q7Y C;  4UP7 A;  1CQV A;  4X62 Q;  1M1K C;  3D6W A;  1G6P A;  3J7A 5;  3BDC A;  3A55 A;  2ALY B;  1T5E A;  2B8F A;  3ER0 A;  2UU9 L;  4JBM A;  2JP1 A;  1HA5 A;  1R4P B;  4BA1 I;  2RA4 A;  2JEA I;  3CXC A;  2WB1 B;  4DAY A;  3ND8 A;  1NAP A;  3HKZ E;  5M5Y B;  3DEP A;  2K14 A;  4DK3 C;  1LUZ A;  1RTN A;  2MHV A;  1MD2 D;  3I4O A;  4NKL A;  4NP5 A;  4R4I A;  2D9U A;  4YHH L;  2VB3 X;  1SMY D;  4ZLT F;  5IYC G;  5L37 A;  1TT2 A;  2RCN A;  1BCP B;  4R4Q A;  4O1N A;  2OTL A;  1FR3 A;  1PFB A;  2JEB I;  1I6H H;  4EQN A;  3CCU A;  5KRU A;  1VQK A;  4LF5 L;  4YWK A;  4RGT A;  3FKI G;  4DUY Q;  3TQY A;  3R3O A;  1ILQ A;  3SGI A;  2UXB Q;  5IGD A;  1HH2 P;  3QO2 A;  1YHA A;  3PUZ A;  4BY1 H;  1HUN A;  3I73 A; 
#chains in the Genus database with same CATH homology
 2KEE A;  1SXT A;  5KIX A;  2A69 C;  2K5D A;  1TKW B;  2F0N A;  4ZUJ A;  1SND A;  1JOR A;  1R9T B;  2CHB D;  4HTH A;  3FKI B;  2B2T C;  1F9S A;  4K5V A;  1SSO A;  1CZW A;  1O7L A;  2F3V A;  3TP7 A;  2JE6 I;  2ZXP A;  4BA2 I;  2RDG A;  2K01 A;  2E2D C;  4HMI A;  1TR5 A;  2YU9 B;  3GV6 A;  3G7L A;  1Z47 A;  3IFT A;  3TP5 A;  1XYI A;  3SHL A;  4IUT A;  2O2L D;  3HOX B;  4K8I A;  5DAU A;  1A2T A;  1VCI A;  2CW0 D;  2NN6 G;  4HSP A;  4AYB B;  5I2Y A;  3TSS A;  5M5X B;  1EZ8 A;  3TN2 A;  4R8N A;  3I91 A;  1IYV A;  1EU3 A;  2SOB A;  1SE2 A;  4CHT B;  1ENA A;  2H4O A;  2HCC A;  4K2K A;  4HCS A;  4XQN A;  1I6V C;  1FNV A;  1OXX K;  3BVG A;  4UDU C;  1JWU D;  3JAM L;  1SNQ A;  1OO9 B;  2VB2 X;  4TKO B;  4KV6 A;  5CV6 A;  1CZG A;  3MA2 B;  3FPP A;  1CA6 A;  2E75 C;  1ILP A;  1IL8 A;  1MSH A;  5D14 A;  2PNR C;  5M3M B;  4NDX A;  3H3V C;  3GTQ B;  2NYZ D;  3HOU B;  4JK1 C;  5IIF A;  3VYT A;  1F2Y A;  1QCB D;  1TY2 A;  2EXZ A;  1Y8P B;  2XRS D;  1GUT A;  3OIQ A;  4DF7 A;  5EGT A;  1EWC A;  2EZV A;  1Y1W B;  4OO1 G;  3QJY A;  1DOM A;  4IFD I;  4V19 0;  3WDN A;  1HQR D;  1AFP A;  3K7A B;  3CU7 A;  4B08 A;  2I46 A;  3KLS X;  2F0L A;  3D4D A;  5C5L A;  1ZEQ X;  2XWB B;  1ONL A;  2PZW A;  1E0B A;  2WII B;  1FD7 D;  2HDM A;  4RCN A;  1HXY D;  2RSN A;  4PQX A;  4A3G B;  4K2L A;  3FRP B;  3A54 A;  2A6H C;  4H44 C;  1JWM D;  4C3J G;  2M2L A;  2KUM A;  4ZAI A;  2JA7 B;  1G2T A;  4ULL A;  4A3F B;  1DOL A;  4IZ8 A;  2AQ2 B;  4BBS B;  4L63 B;  1OXV A;  4OL7 A;  4RWS C;  3T56 B;  1EEI D;  5CGK A;  3ITP A;  3S17 B;  1U4L A;  4C3J B;  5CYU A;  1KTK A;  2L1B A;  2BDO A;  3MZ5 A;  3OWF A;  3PIO 3;  3A8K E;  3RUZ A;  3P75 A;  4ZRZ A;  4HSV A;  1RF2 D;  4J1M A;  2HQE A;  3MWY W;  4PV1 C;  4RAU C;  3GTJ B;  1K8O A;  3TZD A;  2JA6 B;  1AZQ A;  1PRT D;  5A2Q E;  3FEW X;  5BN4 A;  2Z1C A;  1QIL A;  5IGB A;  2WAQ B;  4RGM A;  1D6E C;  2G9D A;  2RDF A;  4X3U A;  4BWG B;  3H91 A;  3S16 B;  4QB4 A;  3CKI B;  5J1Z A;  3GQB A;  2X6G A;  3HRZ C;  1CT1 D;  1FYC A;  1T5X D;  3H09 A;  1H9S A;  1STB A;  2F0T A;  1FNW A;  1BDO A;  1EY6 A;  3SVM A;  2JA8 B;  3W3A A;  4CKE A;  5IGC A;  2WAC A;  2A5H A;  2NBF A;  3ERQ A;  1WTV A;  1EY8 A;  4OHJ A;  1TS2 A;  4R8I A;  4PMB A;  3M85 A;  1J9O A;  4K5W A;  5E3F A;  4PNY A;  3EQL C;  1TVX A;  1Q12 A;  2Y0S B;  4ABN A;  3E5S A;  1E2V A;  4K8J A;  4Z9C B;  3MXU A;  1PRT F;  3K5M A;  1AZP A;  2XRQ D;  2L5T A;  3QWN A;  3BVM A;  1STG A;  5DM7 3;  2BA0 A;  4XT1 B;  2E2J B;  3QOJ A;  3F2U A;  1O80 A;  4S3S A;  3RZD B;  3PUW A;  4OGQ C;  5C4H A;  1O7Y A;  4QCL A;  4CGY B;  4CJ1 B;  3S9W A;  4BY1 B;  5IGF A;  4ID6 A;  2F0J A;  3S2H B;  1V1P A;  5D3D A;  1Z7T A;  1EIG A;  1ESF A;  3SK5 A;  2PZT A;  2EY2 A;  3A8J E;  1G8Z D;  4HED A;  3S1Q B;  1EQT A;  2LFN A;  1UNS A;  3GTL B;  3NP8 A;  1B2T A;  2AWN A;  1LV9 A;  2XVS A;  5JAV A;  4KN7 C;  3OMC A;  1S5D D;  1B1Z A;  2MP1 A;  1WTQ A;  1YNN C;  4DA2 A;  3P7J A;  3M7N A;  4QIW B;  2E74 C;  2HUG A;  3U9S A;  1Y8N B;  4RA8 A;  1FGB D;  3MXP A;  4DAP A;  4ZKC B;  1V8Q A;  5CMD A;  3PUY A;  2OF1 A;  4IFD J;  1EFI D;  3VR4 A;  3OSO A;  1I4X A;  4NMZ A;  3T53 B;  2OXP A;  2ID0 A;  2KCN A;  4QUF A;  4MIU A;  1PFN A;  1L0X B;  4C2M B;  4ME5 A;  5IOC A;  1F2Z A;  4L8J A;  1G91 A;  4WRD A;  1HQM C;  1PZI D;  2B2V C;  2HDL A;  3HP3 A;  3WOE A;  2QKI C;  5C5M A;  3RLF A;  1WVL A;  4DK1 A;  3M7G A;  3DXJ C;  2A69 D;  1JCK B;  2M00 A;  2QDB A;  1STY A;  3K6O A;  3PUV A;  1HTP A;  1PRT B;  2SNM A;  1F9R A;  1TWG B;  2F0W A;  1F2M A;  2QF7 A;  5I9O A;  2A6E D;  2F0M A;  3L9A X;  1GUW A;  1VMP A;  4R9W A;  3QB3 A;  3J81 E;  3J7Y W;  1KNA A;  2K6A A;  5DM6 3;  3RMH A;  4PMC A;  3ZYY X;  3BZD B;  1STH A;  2WKD A;  2LS0 1;  1L0Y B;  4DFA A;  2EDG A;  4H0L C;  4A3D B;  4WFN 3;  1SEB D;  3KK7 A;  2PW7 A;  2PCF B;  3NTK A;  1TWH B;  3OPO A;  1Y1V B;  2IX3 A;  1JIC A;  3OIP A;  1BXT A;  5FO7 B;  5LHY 1;  1U4P A;  1LTI D;  2O5I C;  2K05 A;  3SXH A;  3IAY A;  2C9O A;  1AEX A;  1XTC D;  4I7Z C;  2DY7 A;  1II3 A;  3D6C A;  5C0X I;  2F0E A;  4CJ2 C;  2XNA C;  2OEO A;  4RKB A;  3URY A;  3S1R B;  1SYF A;  1UAP A;  5C44 B;  5FLX E;  1U4M A;  1WTP A;  3NE5 B;  5EPL A;  3Q6S A;  2NVY B;  1B9M A;  2O4X A;  2F0H A;  5C6A A;  4IFD H;  5EKK A;  5D65 A;  1H9M A;  3TBI B;  4EQO A;  3U9O A;  1DON A;  4KMU C;  5K36 G;  3QOL A;  4Q0F A;  2WP8 J;  3T16 A;  5FK9 C;  3X3N A;  4DAV A;  4HMJ A;  1IYU A;  1BUV T;  1ZXT A;  3R2I A;  3SK8 A;  1ICW A;  1E2Z A;  3I4M B;  3GTK B;  1NUC A;  4FF1 A;  1GUN A;  1I4Q A;  5KYI A;  1PZJ D;  5I6Y A;  2IWH A;  1G2S A;  2A6H D;  2E2H B;  2F3W A;  2A68 D;  4RKL A;  1B44 D;  1SYC A;  3RD4 A;  2IJ0 A;  5T1G A;  1ENF A;  2EJF C;  2B39 A;  2ZXO A;  3TP8 A;  1F2L A;  1STA A;  3HOY B;  2IPK D;  2LKV A;  4IAL A;  1BF4 A;  1JWS D;  2D62 A;  5JVG 3;  5JOB A;  3PO3 B;  1SNO A;  1ROD A;  1JE4 A;  5A2Q L;  1DXM A;  1K8M A;  1KAA A;  2MGS A;  1TWF B;  1RD9 D;  4L6T B;  4CJ0 B;  4CKC A;  5EQ0 A;  3CQZ B;  1BBX C;  4FXK C;  1MSG A;  2EY1 A;  2R7Z B;  4IUQ A;  5HGT A;  3K59 A;  5F2D A;  1HFG A;  2ZXR A;  2G9H D;  3LWU A;  2R3Z A;  4RHR A;  5KYL A;  3EJI A;  1WD0 A;  1Q3L A;  1LT4 D;  1I4G A;  3OMG A;  2A74 C;  4LAA A;  1XX8 A;  1SNM A;  2F0V A;  2IW3 A;  1BOS A;  4CBV A;  2LMC B;  2K5Q A;  4FF2 A;  4QMG A;  4A3E B;  5C3E B;  3Q23 A;  1CQF A;  2XN9 C;  1SNC A;  4RGN A;  2AUJ D;  1ZYR C;  3OWE B;  1D5M C;  2L4N A;  3TZU A;  2K28 A;  1MI2 A;  4FO2 A;  5I6W A;  2EYP A;  3A56 A;  2JXM B;  1VDZ A;  3PV0 A;  5M9O A;  3T51 B;  3A7L A;  3I70 A;  1A3V A;  5D3I B;  4K6L A;  1LAB A;  5CBA E;  4G4K A;  1LT6 D;  5A35 A;  4WOR A;  1LTB D;  1E2W A;  5ELE A;  5LL6 S;  5JVH 3;  2L12 A;  1RCV D;  3A8I E;  5I2X A;  3CRK C;  5KNB A;  2PW5 A;  1LTS D;  2NTS A;  3RZO B;  2KHS A;  2E2I B;  1VF7 A;  3DHQ A;  2JSO A;  4KY6 A;  4XIG S;  4RCO A;  4BY7 B;  1HPC A;  5C0X J;  1WD1 A;  1GOZ A;  1SYB A;  3H0G B;  3GTM B;  1IKM A;  2F0G A;  1VMC A;  4G7O C;  4U67 3;  5FOB B;  2B2T A;  4LK1 C;  1SMY C;  3MTS A;  2R6G A;  1CK1 A;  5DNF A;  5ELD A;  2B2Y A;  5ELB A;  1YNN D;  2B2W A;  1ET6 A;  5COR A;  4FXD A;  2E76 C;  2K04 A;  1PXU A;  2FMC A;  1SYE A;  4B9X A;  3J80 E;  2PPB C;  1EYC A;  2BA1 A;  3DUZ A;  1IHZ A;  4A3I B;  1KDC A;  3DM1 A;  5IT9 E;  2ENB A;  1RDP D;  4J6H A;  3C2P A;  1EYA A;  3DWQ A;  1SJE D;  4F7X A;  3MFY A;  2NUC A;  3KLR A;  1QE6 A;  3MAQ A;  3M4Y A;  3L3O C;  4ZK9 B;  4IFD G;  1IW7 D;  2N55 A;  1GJX A;  3FVQ A;  2PZU A;  3A7A B;  1CFM A;  3C46 A;  4A3B B;  5CV7 A;  3EA6 A;  3E6Z X;  2RQX A;  4N9P A;  1JOQ A;  5K36 H;  4KK7 A;  3J81 L;  1EWH A;  4K14 A;  4RFB A;  4TSS A;  1EOT A;  3GTG B;  3GD7 A;  1LO5 D;  3Q24 A;  4HAE A;  1K83 B;  3AU7 A;  4Q5V A;  1BNZ A;  2FMM A;  4LJZ C;  1G6Z A;  3H6M A;  1EY5 A;  1EZ6 A;  1KLU D;  1UEA B;  3I72 A;  3PO2 B;  2F0U A;  1D1I A;  1YNJ D;  1DCZ A;  1EQV A;  2EYL A;  5ISR A;  2VUM B;  3BS1 A;  2F0Q A;  1NCV A;  4KTA A;  3I8Z A;  1CTM A;  2K5W A;  1HCZ A;  5C0X H;  1XWE A;  4EVO A;  1Y69 U;  1ESR A;  5M3F B;  4Y7N B;  4ZQ3 A;  4P2C B;  2GA4 B;  2FHT A;  2ICE C;  3GTO B;  1TS5 A;  3HOV B;  3P20 A;  5C4J B;  3KBX A;  4MHE A;  3VA5 A;  2PYK A;  1X3Q A;  5HUR A;  2BE5 D;  4G7Z C;  3KLS A;  2B2U A;  4X3T A;  2J0T D;  2KVM A;  2XSC A;  1S5C D;  1PMR A;  1S5E D;  4XDX A;  3NBI A;  2AUK A;  2WKC A;  3TME A;  2FJ2 A;  2HCI A;  5EKL A;  5JEA J;  1SE3 A;  1CHQ D;  3K5O A;  3D4R A;  1EU4 A;  4OIJ A;  2WV6 D;  5JPM C;  4IQZ A;  2DN8 A;  1Q8I A;  2XWJ B;  4QUC A;  3GO5 A;  3ND9 A;  2K1B A;  3PMF A;  2L55 A;  1S5B D;  2R93 B;  1W6K A;  5I4D A;  1BO0 A;  1F9Q A;  5E4X A;  4RH6 A;  3AMU A;  1EY4 A;  4K5X A;  2F0S A;  4ZKB B;  2CQA A;  3NQT A;  2MUY A;  4X3S A;  3IFD A;  1JOK A;  3DWA A;  1AW7 A;  1HRJ A;  1BR9 A;  4H7B A;  1XXG A;  4XTC S;  4KN4 C;  3BYY B;  3MHB A;  3K0Y A;  4PMW A;  4KY7 A;  3D31 A;  1EY7 A;  4KD3 A;  1NSN S;  3NUC A;  1ZKO A;  3KUP A;  1EEF D;  1EYD A;  1BQQ T;  1LLR D;  2BDN A;  2ZT9 C;  4FXG C;  3ERO A;  1I4R A;  1SNP A;  2EJG C;  3GP7 A;  1PLF A;  3MVV A;  1STE A;  5C3X A;  5JPN C;  3C1E A;  5I9P A;  4XT3 B;  2K7V A;  1IKL A;  1M4V A;  2RBM A;  5EPK A;  4XYO A;  1OXU A;  4OIK A;  5TSS A;  4KHZ A;  2EYM A;  1CHP D;  1GUO A;  3LNN A;  1TQO A;  1VF5 C;  2F0D A;  4LMQ D;  1SFO B;  1H9K A;  2KQ3 A;  3K5L A;  4V0B A;  2IX1 A;  3C1F A;  2F03 A;  1J8I A;  1F77 A;  5KND A;  5JEA H;  1LTR D;  2DNE A;  1DM0 B;  2XIW A;  3WOF A;  1ZYR D;  1B9N A;  2R61 A;  4TQU S;  2K32 A;  4DXF A;  1D2B A;  3BVZ A;  5C4X B;  5AFW A;  3ONA B;  1PDQ A;  4RGO S;  2C5C A;  5J22 A;  5CBE E;  1SE4 A;  1QOH A;  3J7A F;  1TY0 A;  1QB5 D;  2JA5 B;  4A93 B;  3NHH A;  5JJZ A;  3S1M B;  5E4W C;  3BDO A;  3Q0A A;  3HKZ B;  5IGG A;  1BCP C;  2MPM A;  4DXG A;  2NVX B;  4ZUI A;  2B2V A;  2RVL A;  5BN5 A;  1CA5 A;  1GUS A;  1HFN A;  1JOO A;  2EY5 A;  3FDT A;  5KGU A;  4C56 C;  3R93 A;  2NN6 I;  1QNK A;  1Q90 A;  4ZYS A;  3LWE A;  1PTO C;  5C0X G;  2Z4I A;  1PYW D;  3T4A C;  1PZK D;  2FFK B;  4U68 A;  2AWO A;  1V1O A;  3HZX A;  3J80 L;  3I4N B;  3I90 A;  1TS3 A;  2VNU D;  2Q8T A;  2X6L A;  4N9T A;  5IT9 L;  3W2D A;  1EL0 A;  1O78 A;  2BCO A;  4KHV A;  1KLG D;  3M3Y B;  5C3W A;  5KNC A;  1KAB A;  2PMZ B;  1PTO B;  3NBH A;  3K58 A;  2AQ1 B;  2NVT B;  1WTX A;  1Q1B A;  2IX0 A;  2A6E C;  4FVM A;  2YYZ A;  1GUG A;  2KA7 A;  4M8A A;  3C3L A;  4TRD A;  4K6D A;  5DEH A;  1HA6 A;  3V2T A;  1O7Z A;  5LL6 X;  2B2Y C;  2RKS A;  3QIA A;  1QWY A;  3N6R A;  2SDF A;  4A3J B;  4OO1 I;  2B8G A;  2EYF A;  2F0P A;  3X3M A;  2EYO A;  2B2W C;  2PQE A;  3UI2 A;  2KCC A;  1A3T A;  2QIL A;  2TSS A;  4KKU A;  1A2U A;  1TII D;  3EFX D;  1KNE A;  4IUP A;  3G6J B;  1JC7 A;  3S1N B;  3OHX C;  2D5D A;  1DD2 A;  1DZ1 A;  2LY7 A;  4XXE A;  4I65 A;  5FO9 B;  1CM9 A;  3FPU B;  1RHP A;  2DNC A;  1R4Q B;  3VYS A;  1LAC A;  5EPJ A;  3DWP A;  4FF4 A;  2RDH A;  2K33 A;  1OXT A;  4QF4 A;  2KJX A;  3SK4 A;  1TU2 B;  2DY8 A;  4BBR B;  3NK9 A;  4IUR A;  2O5J C;  3LX0 A;  2NWG A;  1D5Z C;  5EBC A;  3K57 A;  3NTH A;  1U9R A;  5EJW A;  3OOC A;  2L11 A;  1A6X A;  2F4I A;  4FNF A;  1H9R A;  3K5N A;  4FYD A;  1H9S B;  1S4Z A;  1M8A A;  4C1N K;  4ILW A;  4A3M B;  2L9H A;  1ENC A;  4KJO A;  1LTA D;  1LTG D;  1RJT A;  4A3K B;  3VA7 A;  4XYQ A;  4X3K A;  1KDB A;  3AB9 A;  1SYD A;  2KED A;  4KKT A;  3V05 A;  3SE0 A;  3MXN A;  1LTT D;  2A68 C;  4EQP A;  3GTP B;  5JEA G;  1I4P A;  3L7Z C;  3MC0 B;  2NB0 A;  3D4W A;  3NPP A;  2A73 B;  2B2U C;  3I3C A;  2VXW A;  2EVB A;  3D3R A;  3BDL A;  3QG1 A;  1B4O A;  2Z4H A;  4MN3 A;  1RTO A;  1AP0 A;  1G29 1;  5M5W B;  1MGS A;  1WTR A;  4DNR B;  3GV3 A;  1C8C A;  1TS4 A;  3EVQ A;  3VR3 A;  1V1P B;  4F8M A;  1I3Q B;  2F0F A;  1LT3 D;  2H1E A;  4F88 A;  3TDQ A;  1FNU A;  1SBB B;  1TWC B;  4IUV A;  4M1U B;  3HOZ B;  4HR7 B;  2QEJ C;  1F9P A;  3VR6 A;  4XQJ A;  4DN4 M;  4EGV A;  3VR2 A;  2K03 A;  2B63 B;  4KD4 A;  2CW0 C;  4JBW A;  3O13 A;  3N52 A;  2EYJ A;  2MJ8 A;  1GHJ A;  3Q22 A;  3IKJ A;  1QNU A;  2M9V A;  4KY5 A;  1SYG A;  4C1N I;  3HGB A;  2R92 B;  1TWA B;  3SK6 A;  1B53 A;  4HN7 A;  3H94 A;  4NW2 A;  1W6J A;  4B9W A;  1DOK A;  2F0K A;  3MXG A;  3NWS A;  3NSW A;  1PTO H;  1U4R A;  2NZ1 D;  4DU9 A;  1DJR D;  3MEH A;  4XQQ A;  4IUN A;  2J7Z A;  5FLX L;  3SR1 A;  3JAM E;  2Q8I B;  3PUX A;  3P1H A;  1STN A;  1NR2 A;  4C3I G;  1EY9 A;  3IL8 A;  1HUM A;  3VR5 A;  5NUC A;  4YIJ A;  1I6H B;  4O42 A;  2L0C A;  2EY6 A;  5CV8 A;  1KDA A;  1Y8O B;  3NXW A;  3HEJ A;  4C3I B;  3VYR A;  1LT5 D;  1SJH D;  1S5F D;  1H9J A;  2EJM A;  3BYT B;  1V43 A;  2IT1 A;  4KJN A;  4DK0 A;  4UAI A;  4IN3 A;  3NQI A;  4IUU A;  2I07 B;  4HCE A;  1EIH A;  2PO4 A;  4G7H C;  1UUP A;  3SEB A;  3PIP 3;  2NN6 H;  2NVQ B;  1BCP D;  2J4X A;  5G3L D;  3R2T A;  5CV5 A;  3SDZ A;  3HG9 A;  2EPB A;  1WTW A;  3DMU A;  3OW7 A;  5BN3 A;  5ELF A;  3TP6 A;  4KI0 A;  2N88 A;  2F0I A;  3S14 B;  1JQY D;  4DGZ A;  4FP5 D;  4G57 A;  4RHS A;  1PTO D;  1B50 A;  5EKI A;  1PRT C;  2KOL A;  3BG3 A;  1MBY A;  3MFG A;  1D1K A;  1IW7 C;  5CV4 A;  3KF8 A;  2IL8 A;  3NTI A;  4ODG A;  2NTT A;  1HHV A;  2TMP A;  2RSO A;  3I4L A;  4GZY C;  3NWT A;  1PFM A;  5T1I A;  3CHB D;  3J7A V;  1A3U A;  1I50 B;  1WCM B;  4OO1 H;  1BCP F;  1JB3 A;  5G3L F;  1I4H A;  5J39 A;  5ELC A;  3S15 B;  5E1F A;  2SNS A;  1Z6H A;  3HOW B;  1CI3 M;  3T13 A;  1QJO A;  2V4D A;  5EBD A;  4KKS A;  2D2C C;  3V96 A;  1YNJ C;  1B3A A;  4CKB A;  1A15 A;  3KBG A;  4H13 C;  3M4O B;  1GXD C;  5CR3 A;  2Z8L A;  1PTO F;  2X69 A;  5FKA C;  1SDF A;  1C48 A;  2Q8R E;  3E0J A;  5CV9 A;  2EOT A;  4F87 A;  2FIN B;  4J8Q A;  4FF3 A;  4C3H G;  5CC4 A;  1ET9 A;  4WJW A;  1DYQ A;  5C4Z A;  1JR0 D;  4DNT B;  1HTL D;  5IGE A;  1QG7 A;  1SAP A;  1X32 A;  2WIN B;  1WTO A;  1GHK A;  5COY A;  2JYO A;  1C4Q A;  3S2D B;  2F0O A;  3VYU A;  4E6I A;  2KEC A;  2ICI A;  3R8B A;  1ML0 D;  4BS9 A;  1Q1E A;  5IOD A;  1OXS C;  4C3H B;  2BE5 C;  1X3P A;  1RKN A;  2CVR A;  1NR4 A;  3D8G A;  1AN8 A;  3DEO A;  5FO8 B;  3CRL C;  1EY0 A;  2EYH A;  2QCP X;  2F1M A;  2EE1 A;  2SEB D;  1D5X C;  3HS0 C;  3FMC A;  5K5P A;  5KEE A;  2AQ3 B;  2BOS A;  2OT2 A;  1CQV A;  3D6W A;  3BDC A;  3A55 A;  1T5E A;  2B8F A;  2JP1 A;  1HA5 A;  1R4P B;  4BA1 I;  2RA4 A;  2JEA I;  2WB1 B;  4DAY A;  3ND8 A;  1NAP A;  5M5Y B;  3DEP A;  1RTN A;  2MHV A;  1MD2 D;  4NKL A;  4NP5 A;  2D9U A;  2VB3 X;  1SMY D;  4ZLT F;  1TT2 A;  1BCP B;  4O1N A;  1FR3 A;  1PFB A;  2JEB I;  4EQN A;  5KRU A;  4RGT A;  3R3O A;  1ILQ A;  5IGD A;  3QO2 A;  3PUZ A;  1HUN A;  3I73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...