3D8GA

Crystal structure of staphylococcal nuclease variant delta+phs i72r at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKREVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Arginine residues at internal positions in a protein are always charged.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mw2
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d8gA00
1EY0A 5CV6A 2HQEA 5CV5A 3NXWA 2F0TA 1NUCA 5KRUA 1IHZA 4F8MA 4KD3A 3D4WA 1EY8A 3TP7A 2F0WA 4QB4A 3SR1A 5C3WA 3S9WA 4N9PA 1RKNA 1SYFA 1STNA 3NUCA 3MHBA 3OMCA 1A2TA 3EVQA 4K2LA 4QMGA 2EY5A 5E3FA 1F2YA 4E6IA 2M00A 4DF7A 1KDAA 2F0EA 2WACA 3SXHA 4F7XA 4KHVA 1ENCA 2F3VA 3BDCA 4EQNA 3MVVA 1EQVA 4G57A 4YIJA 5DAUA 3NP8A 3HZXA 2PW7A 2NUCA 5CV4A 2EYOA 2F0NA 1SNCA 3TP5A 2PZUA 1TR5A 3QOLA 5IOCA 2F0FA 1ENAA 1A3UA 2F0PA 1STAA 3SK4A 1EY5A 5I9PA 5C4HA 2KQ3A 4MIUA 2RKSA 4N9TA 4S3SA 3D6CA 4K5WA 3ITPA 4KTAA 3C1EA 2PZWA 4PMCA 2F3WA 1SNDA 5J22A 2EY6A 2F0GA 4HTHA 1EY7A 1EY9A 2F0SA 4H7BA 2EYPA 5I6WA 3DMUA 1STGA 4I65A 4DGZA 1SNMA 4KV6A 2QDBA 4OL7A 5CGKA 1SNPA 4K14A 4RKBA 5JAVA 1U9RA 1EYAA 4PNYA 4KY5A 5CV7A 1STYA 5M9OA 3P75A 3BDLA 5IGBA 3PMFA 2PW5A 5F2DA 5I6YA 5C5LA 4HMIA 4ZQ3A 3T13A 1SYDA 4IALA 5EKKA 1KABA 4K6DA 5KYLA 1A3VA 1SYEA 2EYJA 3NQTA 4ME5A 1TT2A 4J6HA 4RKLA 5C4ZA 2PQEA 5IGGA 1JOQA 1KDBA 4K2KA 2O4XA 3OMGA 2F0JA 1F2ZA 4ODGA 1JOKA 4EQPA 2PZTA 3V2TA 3D8GA 5IGFA 3ERQA 2OXPA 1A2UA 3D4DA 5CV9A 4TRDA 2F0DA 4ID6A 1EZ6A 1KDCA 2SNMA 1EZ8A 2F0MA 4KD4A 4HMJA 5C5MA 3HEJA 2EYHA 1SNQA 4WRDA 4B9WA 1STHA 1SYGA 5CC4A 5KGUA 3SK5A 2F0QA 3DHQA 5KIXA 5KYIA 1NSNS 2SNSA 3P1HA 2LKVA 5IGDA 2SOBA 4KJNA 4ZUIA 3MXPA 5HGTA 5IIFA 3LX0A 2RDFA 3RUZA 4WORA 4K5XA 3NHHA 3OWFA 4J1MA 1EY4A 4ZUJA 1KAAA 2EY2A 5ISRA 3R3OA 4QF4A 2F0LA 2EXZA 1F2MA 3TMEA 1JORA 2KHSA 1EY6A 3QOJA 3SK6A 1AEXA 2F0VA 4IUNA 5EKLA 3U9OA 4NP5A 5C3XA 2PYKA 1EYCA 3QB3A 2F0HA 1EYDA 3EROA 5CR3A 4IZ8A 4K8JA 4LAAA 4DFAA 5KEEA 3H6MA 3TP6A 5IODA 4KY7A 1SYCA 4KY6A 3C1FA 1SYBA 2OF1A 5NUCA 2ENBA 5J1ZA 2EYMA 4B9XA 5C6AA 5DEHA 2F0UA 4DU9A 4NMZA 1A3TA 1JOOA 5IGCA 2F0KA 3SHLA 2F0OA 3NK9A 3OSOA 5EGTA 1II3A 2EYLA 2EY1A 3E5SA 1STBA 4NKLA 4PMBA 3SK8A 5CV8A 3T16A 3VA5A 2F0IA 3TP8A 4EQOA 5HURA 5IGEA 2OEOA 4K8IA 2EYFA 1TQOA 5JOBA 5I9OA 1SNOA 3EJIA 4K5VA 4KJOA 4EVOA 5E1FA 3MEHA 5J39A 5K5PA 4NDXA 4R8NA 2RBMA 3MZ5A
chains in the Genus database with same CATH superfamily
1BCPD 1HA5A 5K36H 1EY8A 5C3WA 1ET9A 3HOXG 5GAEC 1Y1WG 1BBUA 3J81j 4B3MQ 4OX9L 4QMGA 3M3YH 1BNZA 3BDCA 1EWIA 4JI3L 3MVVA 2K5NA 2B2WA 2RA4A 2K05A 1SMYD 4P74A 4BBSG 2I5HA 4JBJA 3M4PA 1LV9A 4JI0L 2HUGA 2LS01 4BXXG 4DV1Q 1ILPA 3GTPB 2EY6A 3HRZC 3RZDB 4NXML 2IL8A 1LABA 4DR1Q 2VNUD 5JJKA 2PNHA 3CXCA 3OIQA 2CQAA 1WJJA 3ZYYX 1L0XB 3DM1A 5FKAC 2ZXRA 5IYCG 2BDOA 2J7ZA 3SDZA 4ME5A 4J6HA 3WOFA 4A3EG 3S17B 2G9HD 1PYWD 1O7ZA 3V2TA 2OXPA 3D4DA 4OO1H 1K8MA 4DV3L 1I50B 3HOZB 1GHJA 2BH2A 2J4XA 1PYSB 3PQIA 3HOUH 3CCJA 3H3VI 3PGZA 1N8RC 5BR8Q 1J5EL 5G3LD 1OO9B 4CBVA 1N36Q 2OQKA 5CMDA 1EU3A 3LGJA 1PMRA 5C4JB 2KHSA 1Y8NB 5E4XA 3L3OC 3G7LA 3OHXC 4BBRB 4AIMA 5KNDA 3RLNA 5C3EB 1FNVA 3TQYA 1WI5A 5IP7H 3CC7A 3PUYA 3VDYA 3S1RB 4JI5L 5LMNW 5EAYA 2F0OA 3OWEB 4YHHL 3VYUA 1A6XA 3I4MB 4EQOA 1RL2A 1CSQA 4DR2Q 4K5VA 3NWTA 5E1FA 4A3JB 4DR3Q 1SE4A 2A19A 1VQ7A 4NDXA 2Y0SG 3VR6A 3MZ5A 1QVFA 3DWAA 3H15A 3DLLA 1VQAA 1DOMA 5C0XH 1XTDA 3F8TA 4KI0A 3AB9A 4F8MA 4KD3A 3S9WA 4U673 4H02A 4N9PA 1STNA 2M9VA 5D65A 4B3RL 1PDQA 1YNJC 2M00A 1XMQL 5JEAH 2MPMA 4Y7NB 2R7ZG 5BN5A 5C0XI 3M7NA 1PTOC 2KOLA 1P16A 2F0FA 1ENAA 2GVBA 3VR2A 4DK3C 1N36L 2FXQA 2R93G 2K03A 3JAMi 4IFDJ 4S3SA 3AYHB 4J8QA 3VR4A 3S2HB 5M5XB 1KTKA 1ZXTA 1TKWB 1MSGA 4HJ8A 1K3BC 1K0RA 4DGZA 1AZPA 4DV6L 4ME3A 2AHOB 1HNZL 1O80A 4ZRZA 2PW5A 5C4XH 1H9JA 3SVMA 3UDFA 4QGUA 1MKHA 1JOQA 4DPGA 2JA5G 4C3JH 1ZYRC 1PFSA 3KUPA 3D8GA 1DXMA 3EA6A 4YY3L 4OWWB 1A62A 2F0MA 2K5WA 4LUVA 4Z9CB 3HEJA 2A69D 2X6GA 3GD7A 1VMCA 4C2MH 3HOZH 3RUZA 1JWSD 3Q23A 2O2LD 2QCPX 1L1OA 4OO1I 1QE6A 2A6HD 2F0LA 3UE0A 2A73B 2F0VA 2FJ2A 2R6GA 5LHY1 2FINB 1XTCD 2UU9L 1KQSA 3MXNA 2PO4A 4BY1G 5C4JH 3MXGA 3PUXA 4KY7A 1RF2D 3FDTA 4JG2A 4LFBL 2IJ0A 1TWCH 2E2IB 1R4PB 4HAEA 4A3CH 5C3EH 1LT4D 3OPOA 4A93B 2WP8J 4OELB 3U4ZA 1UAPA 1B1ZA 2EY1A 4NKLA 3S1QH 4RG1A 4C56C 1TQOA 1PH2A 4DV2L 1PRTF 4JBKA 2A1AA 2NZOA 1VQGA 2JA8G 2IPKD 5JPMC 2C9OA 2A6ED 2JK8A 4R8NA 3I4MH 2N55A 4KK7A 4FXGC 1K8AC 1G6PA 2EJGC 3U4VA 2F0TA 3W5OA 1RTOA 4A3JH 2Q2IA 1CI3M 4OXPA 4QB4A 3SR1A 3DM3A 3H0GH 1G6ZA 1TY2A 2F03A 4XYOA 5JVH3 1X9NA 1WTVA 2F0EA 3KBGA 1Q3LA 1MJEA 3I2ZA 5IWAL 2HDMA 4A3GG 1PH1A 2UXCL 2F0PA 1I4XA 2KVMA 5M3MB 3U50C 1M4VA 5CYUA 4RAUC 4C3IG 4DR7L 4DR3L 4GOPA 1GVPA 1M90C 1BCPC 2F3IA 1EFWA 2K5QA 3BYTB 2JEBI 2B2TA 5M3FB 3HOXB 1JJGA 1HNXL 4V190 4OL7A 5GAHC 5TSSA 1U9RA 2AWOA 1LTGD 5M5XH 1JQYD 1IXRA 4LF9Q 3KF6B 3GTMB 1EUJA 2EYJA 3W1BA 1G291 4GOPC 3PO3G 4IUVA 3STBC 3TDQA 1HFGA 2GA4B 3J81i 2B2WC 4RH6A 2R61A 2ZTDA 3PSIA 4JPBW 4TRDA 4BY7H 3H91A 5IT9L 4C3JB 2V4DA 4A3IB 4PV1C 1CA6A 3HOZG 1STHA 5M5WH 3PUZA 3DHQA 1TS2A 2SOBA 1L2FA 2BE5D 1C48A 2ICEC 1EIFA 1Y1VB 1H9MA 4FXKC 4HR7B 5FOBB 4JC0A 4IUNA 4BY1H 2B2VC 1Q12A 5IYBH 1SXTA 2TSSA 2DN8A 2RSNA 2Y0SE 4LMQD 1SYBA 2CW0D 3K59A 2NN6I 5ELDA 3Q0AA 4X64L 2E75C 4NPSA 4B3SQ 3NK9A 4MTNA 2WB1E 2DNEA 4PMBA 3SK8A 1D5ZC 2E2IH 4NXMQ 1SNOA 2UXCQ 3ND8A 4KJOA 3HOWG 3J81c 1Y1WB 1XNQQ 1IW7D 3A74A 1NJIC 1HUMA 3MFGA 1HXYD 1B3QA 2A5HA 4PQXA 1H9SA 5CV6A 1I5FA 2AUKA 1I4GA 4LF4L 3GTLH 4Q0FA 1MHWC 3RLOA 3F2BA 2JSOA 3H0GB 3NTHA 4YIJA 1HR0Q 2JP1A 1B7YB 1EEFD 4XTCS 4HIOA 2HHHQ 3GTJB 1IKMA 3UI2A 3VR5A 3I4NB 3PIO3 1F2LA 4HJAA 4CDCC 3F2DA 1JB7A 5IE8A 1JWMD 4PMCA 5D3DA 1STEA 3K80C 5D14A 1SRUA 2F4IA 1L0YB 2F0SA 4H13C 4X65Q 2MFIA 4KV6A 2V1CC 4K14A 3NSWA 1K73C 4X3UA 3T4AC 3BDLA 4JI6L 1ESFA 5M3FH 4HMIA 1EQQA 1EEID 2JA6G 4DV4L 2Q2UA 1BCPB 3QJYA 4DNTB 1O7IA 5M3MG 2F52A 3M4QA 1PRTC 2CCZA 4EQPA 1WCMH 3QR8A 4EX5A 3HOVG 1J9OA 5EKIA 2CH4A 1YHAA 5FO8B 1SAPA 2KUMA 3W3AA 1PH9A 4OO1G 5I2XA 5CC4A 4IPGA 2OTLA 1PRTB 3I8ZA 3NTKA 5IGDA 3TN2A 3MC0B 5IIFA 1MBYA 2R92G 1YI2A 3Q24A 2YTXA 1N34L 3A55A 4K0KL 3U9OA 2CVRA 1Y1VH 2SDFA 2PYKA 1FJGL 3EROA 2QGQA 4DV2Q 2JA5B 2EIFA 4BY1B 1PTOH 3JC66 2ZJRA 4N8X1 5I2YA 1GOZA 1XMOQ 1II3A 2K6AA 4DV7Q 3J7A5 4A3CG 4QIWE 2F0IA 1Z6HA 1CKMA 2R7FA 4IFDG 3U9SA 4AQYQ 4L8JA 3DWPA 2RCFA 3KK7A 3BU2A 5CV5A 4JCVE 1Y1WH 1HCZA 3I90A 5FK9C 1DONA 5C0XG 2NVTH 1B70B 1F9RA 1N33Q 2CWPA 1B50A 4A93G 2PW7A 2O5JC 4F88A 2F0NA 3OYYA 3S16B 1LUZA 4L6TB 4DK1A 5JEAG 1I3QB 4BXXH 4A3GH 1LLRD 4GKKL 4XQJA 2A6EC 3VA7A 2R93H 4HEDA 3I4NH 1SFOB 4FF1A 4HTHA 2K33A 2QEJC 1NMGA 5CGKA 3BS1A 5M3FG 3K57A 1STYA 1HNZQ 4G7HC 1AE3A 1IYUA 4ZQ3A 1KABA 2HIVA 2AUJD 4POFA 3NWSA 4JI1L 2VUMG 1TT2A 1Q7YC 4K2KA 2G5DA 5JJIA 1KNAA 1BXTA 2Z9HA 1JOKA 1G2SA 4C3JG 1HRJA 4X3KA 3S24A 4QUFA 1VMPA 1WCMB 2F4VQ 2B2TC 5C44H 1TWGB 2X6LA 2Z6KC 1W6KA 5EPKA 4JI2Q 2K5DA 2RQXA 3PIPA 3DXJC 2KECA 4J1MA 3NBHA 1WTPA 3URYA 1BBXC 1HJPA 3TMEA 2CWAA 2WINB 2K28A 3HS0C 1XPRA 1PYBA 1F9SA 1SDFA 3CRKC 5EPLA 1XJVA 2H1EA 1U4LA 1XMQQ 2UXBQ 4GKKQ 2XSCA 4L5QA 5FLMH 1C7YA 2P5ZX 5I4DA 3VYTA 1B3AA 3PO2H 2D9UA 3KFUA 3ER0A 2F0UA 2B39A 1WTOA 1JOOA 2F0KA 3IFTA 3SHLA 3ZJYC 4HJ9A 3CPFA 1IBMQ 4EGVA 2E2HB 2PPBC 3HKZB 3TP8A 3CMAA 4ALPA 2I07B 4DA2A 5ELNA 1YNND 2K50A 5GROA 4DUZL 2Q8IB 3E3XA 1O7LA 2M2LA 5IYDH 1FNUA 2XGTA 2XN9C 4ZK9B 3BVGA 2Z1CA 3PIOA 3TS2A 3NBIA 4K2LA 2CW0C 1Q46A 1F2YA 1LT3D 4ZAIA 2O5IC 4GLXA 2XTIA 5DAUA 1EQVA 3K7AB 3AFPA 4R4IA 3GP7A 4UP8A 1X54A 4K6LA 3SK4A 3HOWB 2N78A 1EY5A 4LF6L 2NWGA 5AJ3Q 1I3QH 1VQ8A 5A2QL 4DR7Q 2H5XA 2KHIA 4OWXB 2WAQB 3Q6SA 1VF5C 2KCCA 3UE1A 1RIPA 2A69C 1GUTA 4KY5A 1SFOH 3CPWA 4TKOB 4FNFA 1Q81C 3J81E 1T5XD 3K8AA 4A3MH 3M9BA 2ZJQA 2B63H 3L2PA 1DGSA 3SEBA 1A3VA 4A3EB 1MJCA 3MFYA 4KHPL 2PQEA 2Q2TA 4DAYB 3GDEA 1A0IA 3AQQA 4KHZA 3CAMA 1X3FA 4P2CB 3I56A 4RWSC 3BVZA 1E3PA 5D3IB 3HOYB 3A0JA 1K3RA 4KKTA 1NSNS 3O13A 1TWFH 4FP5D 1CHPD 1EQRA 3NELA 1I94Q 3BJUA 2AWNA 3IFDA 5C44B 1KAAA 1JORA 2EXZA 1OXVA 1ILQA 4IURA 1TY0A 4X65L 2IX0A 1H9RA 4A3LH 1TVXA 4RGTA 4KMUC 4GZYC 5IODA 1EYGA 2OF1A 2OWOA 2ZTCA 4YCUA 3I4OA 1YBYA 1RJTA 1YZ6A 3TZDA 1GUOA 1E7ZA 2UXBL 3DEPA 3PO2B 1NR2A 1C8CA 1Q90A 3STBD 4LK1C 1GD7A 1ET6A 3GTPH 4NXNL 4GN5A 1DOKA 4RGMA 5C0XJ 3E0EA 3GV6A 2VQFQ 5JJZA 1Q8IA 1EY0A 4BA1I 3CCVA 3E9HA 1IBML 5KRUA 3H3VC 3FMCA 2IX3A 1RKNA 2RCNA 5K36G 2OT2A 5BN4A 1VQJA 2ZTEA 4DUYQ 4UDUC 4F7XA 2B3GA 2PI2A 4JK1C 5HGQA 4MN3A 2X69A 2B8FA 4CDFC 3TP5A 4HIMA 2PZUA 3ERSX 2XWBB 1U4RA 2B2YC 3GTGB 3A8KE 4JOIC 4N9TA 2N49A 1KD1C 4LUZA 4KKSA 3W1GA 1BVSA 1V1PA 2DUDA 4XT1B 5J22A 5CORA 5JPNC 3MAQA 2JA7G 1HHVA 1NTGA 2B63G 2NTSA 4A3KG 5FO7B 4R4QA 1AH9A 2PQAB 4V0BA 3T1HL 5AJ3L 3I72A 1VQ6A 4OIJA 2QA4A 2B63B 4DV5L 1JE4A 4IPCA 1ESRA 3DWQA 4YCWA 4A3EH 3HGBA 1A2UA 4ID6A 1KDCA 1BBWA 2SNMA 4X3TA 3S1RH 4DKAC 3HFZB 4O42A 1SNQA 4LWCA 1CTMA 2BA0A 1LTTD 4GLAC 4JW0A 1D8LA 1NCVA 4ZUIA 4IJLA 2RDFA 2JA9A 4A3BH 3BZKA 1U5KA 3UDXA 1JMCA 4OX9Q 1JWUD 1TWFB 2BA1A 2DY8A 5ELEA 1HNXQ 1TXYA 1YNXA 4XXEA 2SEBD 4UP7A 3A5ZB 2CKZB 4DFAA 4ZCKA 5LMUQ 1Y8OB 4C3HG 1I6HB 4KY6A 1UE6A 3BDOA 4J15A 4IUPA 4IUQA 1D6EC 4B9XA 2RDHA 5DEHA 3CC4A 1LO5D 1KRTA 3RMHA 1ICFB 4Q5VA 1CZGA 5CV8A 3FPPA 2Q8TA 3AMUA 2K32A 1KAWA 3S2HH 1T9HA 1B4OA 1JC7A 4H0LC 1EWHA 4WJ3M 4JI8L 1QILA 2RBMA 3FKIG 4GNXC 3S15B 1Z7TA 1KC8C 1E2VA 3RD4A 1JCKB 3KLSX 2K04A 1B8AA 4DK6C 3CCRA 3IAYA 2HDLA 3K5OA 2CFMA 2JQOA 1SYFA 4YWMA 4X66Q 3NTIA 1PTOF 1BO0A 1EFID 2WACA 1N33L 1SLJA 3X3NA 2RDGA 3RR5A 3HKZG 4DR4Q 1K8OA 3JAMc 3FPUB 5C4HA 2RKSA 4GN3B 3KDFA 3I3CA 4ULLA 1Q8KA 1HZBA 3GTGH 2F0GA 2E5LL 2NN6G 4C2MB 4IFDI 2HHHL 4I65A 4A3KB 4B3RQ 2DJGC 4IOAA 1LM0A 2FFKB 1LT5D 5ELBA 1FR3A 3TRZA 1GO3E 4QUCA 4RKLA 5C4XG 3DUZA 2K5HA 1KDBA 1UUPA 3OMGA 1VQNA 2YTVA 3MTSA 5E4WC 3QWNA 3KJPA 2N88A 4LNQA 2D5DA 4LFCQ 4LFAQ 1TWHH 1EZ6A 3OW2A 1VQOA 2UUCQ 2EZVA 4AQYL 1DJRD 1BDOA 4BY7G 2EPBA 3P1HA 2BCOA 4FYDA 1QZHA 1SMXA 1HPCA 3EBEA 2K5VA 4A3FB 2H4OA 2IHFA 3V05A 5LL6X 1AP0A 3C2PA 4A3BB 3QB3A 1TWAH 1XNRQ 3I70A 1X3EA 4CJ2C 4K0KQ 5EBCA 1U4MA 2XWJB 3FP9A 3CP0A 4IFDH 4NXNQ 2AQ1B 3L0OA 3P7JA 2HT1A 4DR5Q 1CKNA 1OXUA 1W3SA 5DNFA 4K8IA 3CCQA 4IOCA 3KLSA 1FYCA 1IW7C 4TVAB 1AN8A 4IQZA 2AQ2B 3I7FA 4X6AH 3HKZE 1YEZA 1I4PA 2KENA 3A7AB 3HOXH 2VZAA 3NXWA 2A68D 1D1KA 3D4WA 4R9WA 1WFQA 3S15H 5IYDG 1JT8A 2AKWB 2L4NA 1O78A 1HR0L 1VCIA 4B08A 1BCPF 5T1GA 2RHSB 4BWGB 3GTMH 3CRLC 3SXHA 2LXJA 4L5RC 2R7ZH 4LFCL 4IPDA 1LTAD 4JI5Q 2HCIA 4UAIA 4X3SA 1GUSA 2K52A 4BY7B 1HTPA 4I7ZC 3QIAA 2UXDL 2MP1A 4A3IH 2IW3A 1RCVD 5EBDA 1OTCA 4JI8Q 3GTKH 3C1EA 1S4ZA 1QNUA 5M5WB 1EY7A 2EDGA 1FGUA 4IPHA 3N6RA 4JYAL 3G48A 4RKBA 4B3SL 2I5MX 3A5UA 1IL2A 1Z47A 4RCNA 1EL0A 4A3KH 1XXGA 1IBKQ 4KHPQ 5LL6S 5IGGA 1H9KA 1G2TA 2HCCA 1SR3A 2O4XA 3DEOA 3M7GA 5FJ8H 2D0OA 2DJFC 2JEAI 1V9PA 5ELFA 5IGFA 1I4RA 5CV9A 1F9PA 3QO2A 1XNRL 3TSSA 1IYVA 2NB0A 2EYHA 3TEHB 5KGUA 1XX8A 2JXMB 2F0QA 1HH2P 2WAQE 2OQ0A 1TWHB 4JVZA 3HOUG 2PQAA 2VXWA 5G3LF 3D3RA 4GKJQ 4ZUJA 2ASBA 3P20A 3SK6A 4A3BG 1LYLA 4CJ1B 4P71A 4NP5A 4DUZQ 2NVQB 1A63A 4IZ8A 4LAAA 1VQ4A 2YU9B 3FHWA 1Y1VG 4O0AA 3GTLB 2XRSD 2QDLA 3C1FA 4DV0Q 1G51A 4UPAA 1PH6A 1WD1A 1PFMA 3KF8A 1C0AA 3RZOB 2WV6D 2Z6BA 1S5BD 4NB3A 4PZ7A 1TWAB 4DU9A 3GTJH 5IGCA 4JI0Q 5IP7G 3I55A 2EJFC 3T16A 2JA8H 4LF8Q 3C46A 3CD6A 1TS4A 1VQIA 4LF8L 1D2BA 2B29A 1SJED 1DYQA 3K81C 4DN4M 2ID0A 1B53A 1TS5A 2HD3A 2B2VA 3K0XA 1OXTA 1DCZA 3TP7A 3GO5A 2GN5A 4IO9A 3KYHC 3C3LA 1KNEA 4A3DG 1PFBA 2E2JH 1X3PA 4DR6Q 1CQVA 4FO2A 4OHJA 1S5DD 1VQ5A 4UP9A 2PMZB 4KN7C 1ZKOA 1A3UA 2R7ZB 2ZXPA 1SEBD 2IX1A 3RN5A 2K14A 5BR8L 1Q1BA 4ZYSA 2L1BA 3ITPA 1S40A 1E1OA 4B3TL 4ZLTF 1W2BA 4HCEA 2PI2E 2WIIB 4CKCA 1MIUA 1YHQA 1SNMA 4LF4Q 3ND9A 3D6WA 1SSOA 3U58A 1HUNA 1QVGA 4P73A 1FJGQ 3PMFA 4MNOA 5F2DA 3T13A 5A2QE 4ILWA 4QCLA 4DAYA 1SYEA 1PH3A 1VDZA 4CDEC 4JBMA 2I46A 1LT6D 4PZ6A 2F0JA 5JEAJ 2K7VA 2D2CC 2JA5H 1K8GA 1WVLA 4C3IB 3RN2A 1PTOB 3KF6A 5JVG3 4DR2L 3NENA 5EQ0A 4OWTB 4WRDA 4YHHQ 3BVMA 3PIP3 1WYDA 4HIDA 3JAME 4KJNA 2RHQB 1NMFA 2NVYB 3B6YA 1GXDC 1EY4A 5ISRA 1I4QA 3R3OA 3JAML 4A3LG 2PNRC 2XRQD 3MXNB 1CK1A 3D31A 4POGA 5EKLA 1QZGA 1IBLQ 1A15A 2F0HA 2NTTA 2NVTB 4K8JA 1LTRD 1BUVT 5KEEA 1D1IA 2K01A 3HG9A 4RGNA 1N32Q 1IL8A 2NVQH 2ENBA 2WKCA 2KEEA 4C3HH 1H9SB 2YU9H 1A3TA 1B2TA 5J3BA 2EYLA 3IL8A 1BF4A 3VA5A 1QWYA 4A3GB 3RZOH 1VQMA 2KCTA 2R93B 4DNRB 3ULJA 5CBAE 1YNNC 4C1NK 2D62A 1VF7A 1BOSA 5IP9G 2AQ3B 1CKOA 1UWVA 3EIVA 4BBSB 2A8VA 2DGYA 1E2WA 2EE1A 2EY5A 3KDFB 4DF7A 3H0GG 3PUWA 4JV5Q 1F9QA 3E6ZX 4YY3Q 3NP8A 1XPUA 2EYOA 1SNCA 4PG3A 2UUCL 3WOEA 5IOCA 2E2JB 2DNCA 4RHRA 5IWAQ 2KQ3A 3OOCA 1FD7D 1OXXK 4X64Q 1E24A 2C35B 2N3SA 2L55A 3PCOB 4R4TA 1ZEQX 4CGYB 2HQLA 2JA7H 4KTAA 1QNKA 4JI7Q 4IJHA 1TWGH 2VQFL 4DR1L 5I6WA 3CCSA 2QF7A 4AYBB 1MI2A 4QY7A 3MXUA 1EYAA 4P72A 3GTQB 3P75A 5IGBA 3PV0A 3PO3H 1HA6A 1SYDA 3CCMA 1KLGD 1HFNA 2FMMA 4DXGA 1RHPA 3TBIB 1NNXA 3HOVB 1JICA 1V1PB 2KCNA 3CU7A 3GTOB 3UDGA 1BR9A 2NVXH 4LF7Q 2IHEA 2ZJPA 3AU7A 4KN4C 3BG3A 3BYYB 3RZDH 1LACA 5KIXA 1HR0W 2SNSA 5JJLA 4WORA 4FVMA 2MNAA 2ICIA 3K7UC 2Q8RE 2A74C 1JJ2A 2WB1G 1AW7A 3T1HQ 3BZCA 4HJ5A 2NVYH 1YJ9A 1U4PA 3CF5A 2Z4IA 1LTID 1S72A 5M5YB 5CR3A 4QQBX 2MQHA 1K28A 3KF8B 3S17H 1DD2A 1X55A 1V43A 4GS3A 5J1ZA 3K5LA 1Y69U 3WWVA 3A56A 3K7AH 4JV5L 1RODA 4DR5L 4H44C 3HOWH 3NE5B 5IGEA 3K6OA 4MHEA 5I9OA 5H1SE 3X3MA 4LUOA 2VW9A 2FMCA 3K5NA 5K5PA 2Q2HA 3NEMA 4RMFA 1MD2D 2BH8A 3I73A 1NUCA 2R3ZA 2VY3A 4NW2A 4KLKA 3OMCA 3UDIA 3MHBA 5LMUL 2MJ8A 4E6IA 2Y0SB 1GM5A 3R8BA 2IY5B 4KHVA 1ENCA 1YITA 4BBSH 3HZXA 2WAQG 4CDDC 1TR5A 2B8GA 3QOLA 1SMYC 1STAA 1W6JA 3RNUA 1CUKA 4LFBQ 4RCOA 2ALYB 1CKNB 5IY0A 4WFN3 1KLUD 4H7BA 1UE1A 3DMUA 2MUYA 4TQUS 1XPOA 2JA7B 3NBHB 4A3FG 2L12A 2E74C 5CV7A 5IYCH 2EXDA 4QIWB 1YNJD 1RTNA 2VL6A 3CKIB 1L0WA 2HIXA 3CCUA 3S1NB 5C5LA 4GOPB 1CA5A 4DV1L 3T1YQ 4A3MG 3GTQH 3Q22A 1MSHA 4Y7NH 3BZDB 3PO3B 1CFMA 5FO9B 5IT9c 4DV4Q 4L63B 2A68C 1EOTA 1SN8A 2F0DA 5C44G 4JI4Q 3HOVH 3LNNA 1GUWA 4HSPA 3GTOH 1X6OA 1SE3A 1FVIA 2NVXB 1QCBD 3MXPA 4U68A 4GKJL 1IYJB 2ZXOA 4QF4A 5C4XB 3KLRA 1E1TA 3QOJA 4PZ8A 4MZ9A 4APVA 2LY7A 4HJ7A 2L15A 1VQPA 1YHBA 5C3XA 1FGBD 3L7ZC 4GNXA 3M4OH 5E7NA 1UE5A 3TP6A 1ASYA 1R4QB 1TS3A 2F1MA 4UHVA 5M5YH 4FXDA 3A7LA 3ICEA 4JI6Q 1LTBD 4A75A 3S14H 1I6VC 1HNWL 5HURA 1CSPA 2OEOA 3I4MG 4EVOA 4JOIA 1QB5D 4N8FA 1AZQA 2PCFB 5J39A 4XYQA 2ATWA 4A3JG 2KA7A 2EJMA 1L1OC 3KJOA 1ICWA 5FLXL 1QG7A 1P8LA 1ML0D 2J0TD 2F0WA 4AH6A 2LFNA 1WOCA 2RSOA 1B9NA 1KDAA 1AFPA 2E76C 3MEFA 1IBLL 1TWCB 1AE2A 4G57A 5IT9E 4A3DH 2UUBQ 5CV4A 3W2DA 4A93H 5FLXE 4A3IG 4JI7L 2Z8LA 3S1QB 3AEVA 1YJWA 4XIGS 5DM73 3K5MA 4MIUA 4WJWA 1M1KC 3ULLA 2PMZE 2JA6B 3L9AX 4JBWA 2OCEA 4A4IA 3I4NG 3OW7A 3T53B 3I4LA 2K75A 3R2TA 4B3ML 1E2ZA 2VB2X 4YWKA 1PXUA 1EWCA 2VB3X 3NQTA 5C4ZA 1B44D 3J81L 4EQ5A 2L11A 1XWEA 1PH5A 3S1NH 3N52A 1RD9D 4M1UB 1J5EQ 1I6HH 2N8NA 5DLQE 5M3MH 3PUVA 2RVLA 2KEDA 1EIYB 1WTHA 1HTLD 2ZM6Q 4PMWA 5CBEE 2LKVA 1LTLA 1RDPD 3AFQA 5HGTA 3J7YW 1IKLA 1KL9A 3PF4A 2K4KA 5LMNQ 1EY6A 3CW2C 2KCMA 5IYBG 3FVQA 4DR6L 4YWLA 1M8AA 2LMCB 1UNSA 1T5EA 4TSSA 1EU4A 2OTJA 4FF2A 3H6MA 4UY8C 1VQ9A 1VQFA 5C3EG 1N32L 2EYMA 3LWEA 5C6AA 2KJXA 3SE0A 1J6QA 4FDBA 5COYA 2EVBA 4NMZA 3M4OB 1ONLA 3EN2A 3OSOA 1JB3A 1PVOA 3E5SA 2IT1A 1I4HA 2JE6I 3EJIA 2EOTA 1DM0B 3S14B 2MHVA 5DM63 1Z9FA 1ZYRD 5ELCA 2FHTA 1NAPA 5AFWA 2VQEQ 3SGIA 4XT3B 5EJWA 2HQEA 1SJHD 1PV4A 2I5LX 1XYIA 3S1MB 1QUQB 2NYZD 1Q82C 1G91A 2QILA 1A2TA 3EVQA 4GLVB 4JI2L 5EPJA 1HZCA 3VYRA 4AYBE 4QJFA 1V1QA 3TS0A 3NPPA 3S2DB 2NUCA 1VQDA 1HZAA 1VQHA 3J80c 3D4RA 3ULPA 4A3DB 2LXKA 2JJQA 1EIGA 1Q1EA 2D0PA 3I91A 4A76A 2UUAQ 4K5WA 1SNDA 3D0FA 2F4VL 1YVCA 1JR0D 1E22A 1X65A 1O7YA 2QEXA 1SNPA 5M9OA 2JA6H 2B2UC 4A3FH 3MWYW 2Z6KA 3OTOQ 3J7AF 5KYLA 4DAMA 3OTOL 4YCVA 4JYAQ 4K6DA 4JI4L 1Q86C 3FRPB 1WTQA 4DUYL 4HN7A 2A6HC 1X3QA 4ODGA 1XNQL 4Y52H 1GHKA 1CHQD 3NQIA 1Y14B 4ZKCB 1PZJD 1VQCA 3ERQA 3A8IE 5FJ8G 3LWUA 3F2CA 1EZ8A 5C5MA 1ASZA 1I94L 1SYGA 2MO0A 4BBRG 5KNBA 5A35A 1K83H 5KYIA 5FLXc 4P75A 4CKEA 3VYSA 3LX0A 2BE5C 4K5XA 4B3TQ 2IWHA 4DV0L 5HY6A 3J80i 2EY2A 1KHIA 1S5ED 1F2MA 1UEBA 3H09A 4IUUA 1PFNA 1AEXA 1YIJA 1HQMC 4L5SA 1SBBB 5GADC 2NZ1D 3OIPA 4F87A 1C9OA 2KBNA 1E0BA 5NUCA 4LF5Q 1GUNA 2YV5A 4IN3A 3HOYG 3PO2G 1TU2B 4OIKA 1S5CD 5EGTA 2ZM6L 3K0YA 1CM9A 4M8AA 5JOBA 4DV3Q 4CHTB 3FKIH 3GV3A 3IKJA 4X62L 2ZT9C 3GTKB 5GQOA 2Z4HA 4OONA 4O1NA 1U0LA 4R8IA 1FL0A 1IHZA 4ABNA 1WD0A 1N34Q 1KXLA 3NUCA 2CH4W 2MO1A 4DAVA 1UEAB 1JE5A 2BOSA 3EFXD 3EQLC 3WDNA 3S1MH 4EQNA 1PH8A 1HZ9A 1JJCB 2XVSA 2L5TA 3A8JE 2NZHA 1BQQT 5T1IA 3S2DH 1GKHA 1VQBA 4DAPA 1PA6A 1D5MC 1K0SA 1PH7A 2PZWA 2F3WA 1PZKD 3QG1A 1PLFA 1HNWQ 2QW7A 1EY9A 1SE8A 1L1OB 2QDBA 4L5TA 5JAVA 1K9MC 4PNYA 4HSVA 3KBXA 3T51B 2BDNA 2YTYA 1V1OA 2VUMH 5I6YA 4G7ZC 3ONAB 4RFBA 3HKSA 1WCMG 1WTXA 4CJ0B 3FEWX 4X62Q 2XNAC 2XIWA 1DOLA 1R9TH 3S16H 3CQZB 1ENFA 3CC2A 4C1NI 1A8VA 4DR4L 3M4YA 4DV5Q 2CQOA 2EQSA 1PHJA 3CCLA 3SK5A 3H3VH 2JYOA 2JA8B 2R92B 4DNIA 2UUBL 4RGOS 3V96A 2TMPA 1VQEA 3A54A 2VQEL 1K83B 2QKIC 1X56A 2G9DA 3PF5A 4OGQC 4FF4A 1HQRD 2CHBD 1TIID 3T56B 2VS1A 1D5XC 3IRBA 1SYCA 2L9HA 4JI1Q 1F77A 2GVAA 2DY7A 3J80L 1CQFA 2WB1B 4QL5A 4G4KA 2E8GA 4R4OA 3E9IA 3H94A 2WFWA 3CCEA 3KLWA 4DK0A 2LSSA 1NBWA 1VQLA 1PTOD 2EYFA 1XMOL 1NE3A 1WTWA 1VS0A 4DV6Q 1BKBA 4XQQA 3MEHA 2I0QA 1PRTD 1DZ1A 3M85A 2B2YA 4KKUA 3G6EA 1Y8PB 2UXDQ 4MTKA 1VQKA 1CT1D 1N9WA 3FKIB 2WKDA 3M3YB 4DV7L 5BN3A 4BS9A 5IP9H 3MA2B 3R2IA 4LFAL 1LTSD 2MGSA 5E3FA 4GNXB 1X32A 3TZUA 4I7AA 2F3VA 4LF5L 1C4QA 4XQNA 3CHBD 2R7DA 3RLFA 2UUAL 4DXFA 3CMEA 2E2HH 4LF6Q 4C3IH 1B9MA 5I9PA 1EIHA 3E0JA 3KOJA 3TREA 3D6CA 2ES2A 2E2DC 4HCSA 3F2UA 2YYZA 4AYBG 4IUTA 2EYPA 1STGA 4O2DA 1CZWA 1J8IA 1QVCA 2NBFA 4LF9L 2NN6H 2UU9Q 1OXSC 1EQTA 4BA2I 3J7ZC 4IALA 5EKKA 1PH4A 3R93A 2C5CA 4R1JA 1NY4A 4G7OC 1S5FD 1X3GA 3GQBA 2VUMB 1F2ZA 1I50H 1YJNA 3K58A 2L0CA 1WTRA 2PZTA 2KHJA 3HOUB 3G4SA 1GUGA 1D7QA 2RF4A 4GN4B 4LJZC 4JI3Q 4CKBA 4C3HB 4FF3A 4KD4A 4HMJA 1R9TB 3CQZH 4B9WA 1NR4A 4R4CA 2Z0SA 1QOHA 4LF7L 4OEMB 3F1ZA 4BBRH 4XDXA 3NHHA 2B2UA 3OWFA 5KNCA 1V8QA 1EOVA 4HIKA 2K1BA 4A3MB 2R92H 4X66L 5ELOA 1MGSA 1S3OA 5LMNL 5FLMG 1QUQA 1KIXA 1EYCA 1EYDA 1FNWA 1H95A 3VR3A 1SE2A 3T1YL 4WJ4A 3HP3A 1QJOA 2AMCB 3J7AV 3J80E 5L37A 4RA8A 1STBA 5GAGC 3HOYH 4ZKBB 3G6JB 2E5LQ 1PZID 3Q8DA 1SROA 1UE7A 1IBKL 1IZ6A 2JN4A 3G71A 4LW1A 1GJXA 1KRSA 4RHSA 1G8ZD
chains in the Genus database with same CATH topology
1BCPD 1HA5A 5K36H 1EY8A 5C3WA 1ET9A 4QMGA 1BNZA 3BDCA 3MVVA 2B2WA 2RA4A 2K05A 1SMYD 1LV9A 2HUGA 2LS01 1ILPA 3GTPB 2EY6A 3HRZC 3RZDB 2IL8A 1LABA 2VNUD 3OIQA 2CQAA 3ZYYX 1L0XB 3DM1A 5FKAC 2ZXRA 2BDOA 2J7ZA 3SDZA 4ME5A 4J6HA 3WOFA 3S17B 2G9HD 1PYWD 1O7ZA 3V2TA 2OXPA 3D4DA 4OO1H 1K8MA 3HOZB 1I50B 1GHJA 2J4XA 5G3LD 1OO9B 4CBVA 5CMDA 1EU3A 1PMRA 5C4JB 2KHSA 1Y8NB 5E4XA 3L3OC 3G7LA 3OHXC 4BBRB 5KNDA 5C3EB 1FNVA 3PUYA 3S1RB 2F0OA 3OWEB 3VYUA 1A6XA 3I4MB 4EQOA 4K5VA 3NWTA 5E1FA 4A3JB 1SE4A 4NDXA 3VR6A 3MZ5A 3DWAA 1DOMA 5C0XH 4KI0A 3AB9A 4F8MA 4KD3A 3S9WA 4U673 4N9PA 1STNA 2M9VA 5D65A 1PDQA 1YNJC 2M00A 5JEAH 2MPMA 4Y7NB 5BN5A 5C0XI 3M7NA 1PTOC 2KOLA 2F0FA 1ENAA 3VR2A 2K03A 4IFDJ 4S3SA 3VR4A 4J8QA 3S2HB 5M5XB 1KTKA 1ZXTA 1TKWB 1MSGA 4DGZA 1AZPA 1O80A 4ZRZA 2PW5A 1H9JA 3SVMA 1JOQA 1ZYRC 3KUPA 3D8GA 1DXMA 3EA6A 2F0MA 2K5WA 4Z9CB 3HEJA 2A69D 2X6GA 3GD7A 1VMCA 3RUZA 1JWSD 3Q23A 2O2LD 2QCPX 4OO1I 1QE6A 2A6HD 2F0LA 2A73B 2F0VA 2FJ2A 2R6GA 5LHY1 2FINB 1XTCD 3MXNA 2PO4A 3MXGA 3PUXA 4KY7A 1RF2D 3FDTA 2IJ0A 2E2IB 1R4PB 4HAEA 1LT4D 3OPOA 4A93B 2WP8J 1UAPA 1B1ZA 2EY1A 4NKLA 4C56C 1TQOA 1PRTF 2IPKD 5JPMC 2C9OA 2A6ED 4R8NA 2N55A 4KK7A 4FXGC 2EJGC 2F0TA 1RTOA 1CI3M 4QB4A 3SR1A 1G6ZA 1TY2A 2F03A 4XYOA 5JVH3 1WTVA 2F0EA 3KBGA 1Q3LA 2HDMA 2F0PA 1I4XA 2KVMA 5M3MB 1M4VA 5CYUA 4RAUC 4C3IG 1BCPC 2K5QA 3BYTB 2JEBI 2B2TA 5M3FB 3HOXB 4V190 4OL7A 5TSSA 1U9RA 2AWOA 1LTGD 1JQYD 3GTMB 2EYJA 1G291 4IUVA 3TDQA 1HFGA 2GA4B 2B2WC 4RH6A 2R61A 4TRDA 3H91A 5IT9L 4C3JB 2V4DA 4A3IB 4PV1C 1CA6A 1STHA 3PUZA 3DHQA 1TS2A 2SOBA 2BE5D 1C48A 2ICEC 1Y1VB 1H9MA 4FXKC 4HR7B 5FOBB 4IUNA 2B2VC 1Q12A 1SXTA 2TSSA 2DN8A 2RSNA 4LMQD 1SYBA 2CW0D 3K59A 2NN6I 5ELDA 3Q0AA 2E75C 3NK9A 2DNEA 4PMBA 3SK8A 1D5ZC 1SNOA 3ND8A 4KJOA 1Y1WB 1IW7D 1HUMA 3MFGA 1HXYD 2A5HA 4PQXA 1H9SA 5CV6A 2AUKA 1I4GA 4Q0FA 2JSOA 3H0GB 3NTHA 4YIJA 2JP1A 3GTJB 1EEFD 4XTCS 1IKMA 3UI2A 3VR5A 3I4NB 3PIO3 1F2LA 1JWMD 4PMCA 5D3DA 1STEA 5D14A 2F4IA 1L0YB 2F0SA 4H13C 4KV6A 4K14A 3NSWA 4X3UA 3T4AC 3BDLA 1ESFA 4HMIA 1EEID 1BCPB 3QJYA 4DNTB 1PRTC 4EQPA 1J9OA 5EKIA 5FO8B 1SAPA 2KUMA 3W3AA 4OO1G 5I2XA 5CC4A 1PRTB 3I8ZA 3NTKA 5IGDA 3TN2A 3MC0B 5IIFA 1MBYA 3Q24A 3A55A 3U9OA 2CVRA 2SDFA 2PYKA 3EROA 2JA5B 4BY1B 1PTOH 5I2YA 1GOZA 1II3A 2K6AA 2F0IA 1Z6HA 4IFDG 3U9SA 4L8JA 3DWPA 3KK7A 5CV5A 1HCZA 3I90A 5FK9C 1DONA 5C0XG 1F9RA 1B50A 2PW7A 2O5JC 4F88A 2F0NA 3S16B 4DK1A 4L6TB 5JEAG 1I3QB 1LLRD 4XQJA 2A6EC 3VA7A 4HEDA 1SFOB 4FF1A 4HTHA 2K33A 2QEJC 5CGKA 3BS1A 3K57A 1STYA 4G7HC 1IYUA 4ZQ3A 1KABA 2AUJD 3NWSA 1TT2A 4K2KA 1KNAA 1BXTA 1JOKA 1G2SA 4C3JG 1HRJA 4X3KA 4QUFA 1VMPA 1WCMB 2B2TC 1TWGB 2X6LA 1W6KA 5EPKA 2K5DA 2RQXA 3DXJC 2KECA 4J1MA 3NBHA 1WTPA 3URYA 1BBXC 3TMEA 2WINB 2K28A 3HS0C 1F9SA 1SDFA 3CRKC 5EPLA 2H1EA 1U4LA 2XSCA 5I4DA 3VYTA 1B3AA 2D9UA 2F0UA 2B39A 1WTOA 1JOOA 2F0KA 3IFTA 3SHLA 4EGVA 2E2HB 2PPBC 3HKZB 3TP8A 2I07B 4DA2A 1YNND 2Q8IB 1O7LA 2M2LA 1FNUA 2XN9C 4ZK9B 3BVGA 2Z1CA 3NBIA 4K2LA 2CW0C 1F2YA 1LT3D 4ZAIA 2O5IC 5DAUA 1EQVA 3K7AB 3GP7A 4K6LA 3SK4A 3HOWB 1EY5A 2NWGA 5A2QL 2WAQB 3Q6SA 1VF5C 2KCCA 2A69C 1GUTA 4KY5A 4TKOB 4FNFA 3J81E 1T5XD 3SEBA 1A3VA 4A3EB 3MFYA 2PQEA 4KHZA 4P2CB 4RWSC 3BVZA 5D3IB 3HOYB 4KKTA 1NSNS 3O13A 4FP5D 1CHPD 2AWNA 3IFDA 5C44B 1KAAA 1JORA 2EXZA 1OXVA 1ILQA 4IURA 1TY0A 2IX0A 1H9RA 1TVXA 4RGTA 4KMUC 4GZYC 5IODA 2OF1A 1RJTA 3TZDA 1GUOA 3DEPA 3PO2B 1NR2A 1C8CA 1Q90A 4LK1C 1ET6A 4RGMA 1DOKA 5C0XJ 3GV6A 5JJZA 1Q8IA 1EY0A 4BA1I 5KRUA 3H3VC 3FMCA 2IX3A 1RKNA 5K36G 2OT2A 5BN4A 4UDUC 4F7XA 4JK1C 4MN3A 2X69A 2B8FA 3TP5A 2PZUA 2XWBB 1U4RA 2B2YC 3GTGB 3A8KE 4N9TA 4KKSA 1V1PA 4XT1B 5J22A 5CORA 5JPNC 3MAQA 1HHVA 2NTSA 5FO7B 4V0BA 3I72A 4OIJA 2B63B 1JE4A 1ESRA 3DWQA 3HGBA 1A2UA 4ID6A 1KDCA 2SNMA 4X3TA 4O42A 1SNQA 1CTMA 2BA0A 1LTTD 1NCVA 4ZUIA 2RDFA 1JWUD 1TWFB 2BA1A 2DY8A 5ELEA 4XXEA 2SEBD 4DFAA 1Y8OB 4C3HG 1I6HB 4KY6A 3BDOA 4IUPA 4IUQA 1D6EC 4B9XA 2RDHA 5DEHA 1LO5D 3RMHA 4Q5VA 1CZGA 5CV8A 3FPPA 2Q8TA 3AMUA 2K32A 1B4OA 1JC7A 4H0LC 1EWHA 1QILA 2RBMA 3S15B 1Z7TA 1E2VA 3RD4A 1JCKB 3KLSX 2K04A 3IAYA 2HDLA 3K5OA 1SYFA 3NTIA 1PTOF 1BO0A 1EFID 2WACA 3X3NA 2RDGA 1K8OA 3FPUB 5C4HA 2RKSA 3I3CA 4ULLA 2F0GA 2NN6G 4C2MB 4IFDI 4I65A 4A3KB 2FFKB 1LT5D 5ELBA 1FR3A 4QUCA 4RKLA 3DUZA 1KDBA 1UUPA 3OMGA 3MTSA 5E4WC 3QWNA 2N88A 2D5DA 1EZ6A 2EZVA 1DJRD 1BDOA 2EPBA 3P1HA 2BCOA 4FYDA 1HPCA 4A3FB 2H4OA 3V05A 5LL6X 1AP0A 3C2PA 4A3BB 3QB3A 3I70A 4CJ2C 5EBCA 1U4MA 2XWJB 4IFDH 2AQ1B 3P7JA 1OXUA 5DNFA 4K8IA 3KLSA 1FYCA 1IW7C 1AN8A 4IQZA 2AQ2B 1I4PA 3A7AB 3NXWA 2A68D 1D1KA 3D4WA 4R9WA 2L4NA 1O78A 1VCIA 4B08A 1BCPF 5T1GA 4BWGB 3CRLC 3SXHA 1LTAD 2HCIA 4UAIA 4X3SA 1GUSA 4BY7B 1HTPA 4I7ZC 3QIAA 2MP1A 2IW3A 1RCVD 5EBDA 3C1EA 1S4ZA 1QNUA 5M5WB 1EY7A 2EDGA 3N6RA 4RKBA 1Z47A 4RCNA 1EL0A 1XXGA 5LL6S 5IGGA 1H9KA 1G2TA 2HCCA 2O4XA 3M7GA 3DEOA 2JEAI 5ELFA 5IGFA 1I4RA 5CV9A 1F9PA 3QO2A 3TSSA 1IYVA 2NB0A 2EYHA 5KGUA 1XX8A 2JXMB 2F0QA 1TWHB 2VXWA 5G3LF 3D3RA 4ZUJA 3P20A 3SK6A 4CJ1B 4NP5A 2NVQB 4IZ8A 4LAAA 2YU9B 3GTLB 2XRSD 3C1FA 1WD1A 1PFMA 3KF8A 3RZOB 2WV6D 4DU9A 1S5BD 1TWAB 5IGCA 2EJFC 3T16A 3C46A 1TS4A 1D2BA 1SJED 1DYQA 4DN4M 2ID0A 1B53A 1TS5A 2B2VA 1OXTA 1DCZA 3TP7A 3GO5A 3C3LA 1KNEA 1PFBA 1X3PA 1CQVA 4FO2A 4OHJA 1S5DD 2PMZB 4KN7C 1ZKOA 1A3UA 2R7ZB 2ZXPA 1SEBD 2IX1A 1Q1BA 4ZYSA 2L1BA 3ITPA 4ZLTF 4HCEA 2WIIB 4CKCA 1SNMA 3ND9A 3D6WA 1SSOA 1HUNA 3PMFA 5F2DA 3T13A 5A2QE 4ILWA 4QCLA 4DAYA 1SYEA 1VDZA 2I46A 1LT6D 2F0JA 5JEAJ 2K7VA 2D2CC 1WVLA 4C3IB 1PTOB 5JVG3 5EQ0A 4WRDA 3BVMA 3PIP3 3JAME 4KJNA 2NVYB 1GXDC 1EY4A 5ISRA 1I4QA 3JAML 3R3OA 2PNRC 1CK1A 2XRQD 3D31A 5EKLA 1A15A 2F0HA 2NTTA 2NVTB 4K8JA 1LTRD 1BUVT 5KEEA 1D1IA 2K01A 3HG9A 4RGNA 1IL8A 2ENBA 2WKCA 2KEEA 1H9SB 1A3TA 1B2TA 2EYLA 3IL8A 1BF4A 3VA5A 1QWYA 4A3GB 2R93B 4DNRB 5CBAE 1YNNC 4C1NK 2D62A 1VF7A 1BOSA 2AQ3B 4BBSB 1E2WA 2EE1A 2EY5A 4DF7A 3PUWA 1F9QA 3E6ZX 3NP8A 2EYOA 1SNCA 3WOEA 5IOCA 2E2JB 2DNCA 4RHRA 2KQ3A 3OOCA 1FD7D 1OXXK 2L55A 1ZEQX 4CGYB 4KTAA 1QNKA 5I6WA 2QF7A 4AYBB 1MI2A 3MXUA 1EYAA 3GTQB 3P75A 5IGBA 3PV0A 1HA6A 1SYDA 1KLGD 1HFNA 2FMMA 4DXGA 1RHPA 3TBIB 3HOVB 1JICA 1V1PB 2KCNA 3CU7A 3GTOB 1BR9A 3AU7A 4KN4C 3BG3A 3BYYB 1LACA 5KIXA 2SNSA 4WORA 4FVMA 2ICIA 2Q8RE 2A74C 1AW7A 1U4PA 2Z4IA 1LTID 5M5YB 5CR3A 1DD2A 1V43A 5J1ZA 3K5LA 1Y69U 3A56A 1RODA 4H44C 3NE5B 5IGEA 3K6OA 4MHEA 5I9OA 3X3MA 2FMCA 3K5NA 5K5PA 1MD2D 3I73A 1NUCA 2R3ZA 4NW2A 3OMCA 3MHBA 2MJ8A 4E6IA 2Y0SB 3R8BA 4KHVA 1ENCA 3HZXA 1TR5A 2B8GA 3QOLA 1SMYC 1STAA 1W6JA 4RCOA 4WFN3 1KLUD 4H7BA 3DMUA 2MUYA 4TQUS 2JA7B 2L12A 2E74C 5CV7A 4QIWB 1YNJD 1RTNA 3CKIB 3S1NB 5C5LA 1CA5A 3Q22A 1MSHA 3BZDB 3PO3B 1CFMA 5FO9B 4L63B 2A68C 1EOTA 2F0DA 3LNNA 1GUWA 4HSPA 1SE3A 2NVXB 1QCBD 3MXPA 4U68A 2ZXOA 4QF4A 5C4XB 3KLRA 3QOJA 2LY7A 5C3XA 1FGBD 3L7ZC 3TP6A 1R4QB 1TS3A 2F1MA 4FXDA 3A7LA 1LTBD 1I6VC 5HURA 2OEOA 4EVOA 1QB5D 1AZQA 2PCFB 5J39A 4XYQA 2KA7A 2EJMA 1ICWA 5FLXL 1QG7A 1ML0D 2J0TD 2F0WA 2LFNA 2RSOA 1B9NA 1KDAA 1AFPA 2E76C 1TWCB 4G57A 5IT9E 5CV4A 3W2DA 5FLXE 2Z8LA 3S1QB 4XIGS 5DM73 3K5MA 4MIUA 4WJWA 2JA6B 3L9AX 4JBWA 3OW7A 3T53B 3I4LA 3R2TA 1E2ZA 2VB2X 1PXUA 1EWCA 2VB3X 3NQTA 5C4ZA 1B44D 3J81L 2L11A 1XWEA 3N52A 1RD9D 4M1UB 3PUVA 2RVLA 2KEDA 1HTLD 4PMWA 5CBEE 2LKVA 1RDPD 5HGTA 3J7YW 1IKLA 1EY6A 3FVQA 1M8AA 2LMCB 1UNSA 1T5EA 4TSSA 1EU4A 4FF2A 3H6MA 2EYMA 3LWEA 5C6AA 2KJXA 3SE0A 5COYA 2EVBA 4NMZA 3M4OB 1ONLA 3OSOA 1JB3A 3E5SA 2IT1A 1I4HA 2JE6I 3EJIA 2EOTA 1DM0B 3S14B 2MHVA 5DM63 1ZYRD 5ELCA 2FHTA 1NAPA 5AFWA 4XT3B 5EJWA 2HQEA 1SJHD 1XYIA 3S1MB 2NYZD 1G91A 2QILA 1A2TA 3EVQA 5EPJA 3VYRA 3NPPA 3S2DB 2NUCA 3D4RA 4A3DB 1EIGA 1Q1EA 3I91A 4K5WA 1SNDA 1JR0D 1O7YA 1SNPA 5M9OA 2B2UC 3J7AF 3MWYW 5KYLA 4K6DA 3FRPB 1WTQA 4HN7A 2A6HC 1X3QA 4ODGA 1GHKA 1CHQD 3NQIA 4ZKCB 1PZJD 3ERQA 3A8IE 3LWUA 1EZ8A 5C5MA 1SYGA 5KNBA 5A35A 5KYIA 4CKEA 3VYSA 3LX0A 2BE5C 4K5XA 2IWHA 2EY2A 1S5ED 1F2MA 3H09A 4IUUA 1PFNA 1AEXA 1HQMC 1SBBB 2NZ1D 3OIPA 4F87A 1E0BA 5NUCA 1GUNA 4IN3A 1TU2B 4OIKA 1S5CD 5EGTA 3K0YA 1CM9A 4M8AA 5JOBA 4CHTB 3GV3A 3IKJA 3GTKB 2ZT9C 2Z4HA 4O1NA 4R8IA 1IHZA 4ABNA 1WD0A 3NUCA 4DAVA 1UEAB 2BOSA 3EFXD 3EQLC 3WDNA 4EQNA 2XVSA 2L5TA 3A8JE 1BQQT 5T1IA 4DAPA 1D5MC 2PZWA 2F3WA 1PZKD 3QG1A 1PLFA 1EY9A 5JAVA 2QDBA 4PNYA 4HSVA 3KBXA 3T51B 2BDNA 1V1OA 5I6YA 4G7ZC 3ONAB 4RFBA 1WTXA 4CJ0B 3FEWX 2XNAC 2XIWA 1DOLA 3CQZB 1ENFA 4C1NI 3M4YA 3SK5A 2JYOA 2JA8B 2R92B 4RGOS 3V96A 2TMPA 3A54A 1K83B 2QKIC 2G9DA 4OGQC 4FF4A 1HQRD 2CHBD 1TIID 3T56B 1D5XC 1SYCA 2L9HA 1F77A 3J80L 2DY7A 1CQFA 2WB1B 4G4KA 3H94A 4DK0A 1PTOD 2EYFA 1WTWA 4XQQA 3MEHA 1PRTD 1DZ1A 3M85A 2B2YA 4KKUA 1Y8PB 1CT1D 3FKIB 2WKDA 3M3YB 5BN3A 4BS9A 3MA2B 3R2IA 1LTSD 2MGSA 5E3FA 1X32A 3TZUA 2F3VA 1C4QA 4XQNA 3CHBD 3RLFA 4DXFA 1B9MA 5I9PA 1EIHA 3E0JA 3D6CA 2E2DC 4HCSA 3F2UA 2YYZA 4IUTA 2EYPA 1STGA 1CZWA 1J8IA 2NBFA 2NN6H 1OXSC 1EQTA 4BA2I 4IALA 5EKKA 3R93A 2C5CA 4G7OC 1S5FD 3GQBA 2VUMB 1F2ZA 3K58A 2L0CA 1WTRA 2PZTA 3HOUB 1GUGA 4LJZC 4CKBA 4C3HB 4FF3A 4KD4A 4HMJA 1R9TB 4B9WA 1NR4A 1QOHA 4XDXA 3NHHA 2B2UA 3OWFA 5KNCA 1V8QA 2K1BA 4A3MB 1MGSA 1EYCA 1EYDA 1FNWA 3VR3A 1SE2A 3HP3A 1QJOA 3J7AV 3J80E 4RA8A 1STBA 4ZKBB 3G6JB 1PZID 1GJXA 4RHSA 1G8ZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY0 A;  5CV6 A;  2HQE A;  5CV5 A;  3NXW A;  2F0T A;  1NUC A;  5KRU A;  1IHZ A;  4F8M A;  4KD3 A;  3D4W A;  1EY8 A;  3TP7 A;  2F0W A;  4QB4 A;  3SR1 A;  5C3W A;  3S9W A;  4N9P A;  1RKN A;  1SYF A;  1STN A;  3NUC A;  3MHB A;  3OMC A;  1A2T A;  3EVQ A;  4K2L A;  4QMG A;  2EY5 A;  5E3F A;  1F2Y A;  4E6I A;  2M00 A;  4DF7 A;  1KDA A;  2F0E A;  2WAC A;  3SXH A;  4F7X A;  4KHV A;  1ENC A;  2F3V A;  3BDC A;  4EQN A;  3MVV A;  1EQV A;  4G57 A;  4YIJ A;  5DAU A;  3NP8 A;  3HZX A;  2PW7 A;  2NUC A;  5CV4 A;  2EYO A;  2F0N A;  1SNC A;  3TP5 A;  2PZU A;  1TR5 A;  3QOL A;  5IOC A;  2F0F A;  1ENA A;  1A3U A;  2F0P A;  1STA A;  3SK4 A;  1EY5 A;  5I9P A;  5C4H A;  2KQ3 A;  4MIU A;  2RKS A;  4N9T A;  4S3S A;  3D6C A;  4K5W A;  3ITP A;  4KTA A;  3C1E A;  2PZW A;  4PMC A;  2F3W A;  1SND A;  5J22 A;  2EY6 A;  2F0G A;  4HTH A;  1EY7 A;  1EY9 A;  2F0S A;  4H7B A;  2EYP A;  5I6W A;  3DMU A;  1STG A;  4I65 A;  4DGZ A;  1SNM A;  4KV6 A;  2QDB A;  4OL7 A;  5CGK A;  1SNP A;  4K14 A;  4RKB A;  5JAV A;  1U9R A;  1EYA A;  4PNY A;  4KY5 A;  5CV7 A;  1STY A;  5M9O A;  3P75 A;  3BDL A;  5IGB A;  3PMF A;  2PW5 A;  5F2D A;  5I6Y A;  5C5L A;  4HMI A;  4ZQ3 A;  3T13 A;  1SYD A;  4IAL A;  5EKK A;  1KAB A;  4K6D A;  5KYL A;  1A3V A;  1SYE A;  2EYJ A;  3NQT A;  4ME5 A;  1TT2 A;  4J6H A;  4RKL A;  5C4Z A;  2PQE A;  5IGG A;  1JOQ A;  1KDB A;  4K2K A;  2O4X A;  3OMG A;  2F0J A;  1F2Z A;  4ODG A;  1JOK A;  4EQP A;  2PZT A;  3V2T A;  3D8G A;  5IGF A;  3ERQ A;  2OXP A;  1A2U A;  3D4D A;  5CV9 A;  4TRD A;  2F0D A;  4ID6 A;  1EZ6 A;  1KDC A;  2SNM A;  1EZ8 A;  2F0M A;  4KD4 A;  4HMJ A;  5C5M A;  3HEJ A;  2EYH A;  1SNQ A;  4WRD A;  4B9W A;  1STH A;  1SYG A;  5CC4 A;  5KGU A;  3SK5 A;  2F0Q A;  3DHQ A;  5KIX A;  5KYI A;  1NSN S;  2SNS A;  3P1H A;  2LKV A;  5IGD A;  2SOB A;  4KJN A;  4ZUI A;  3MXP A;  5HGT A;  5IIF A;  3LX0 A;  2RDF A;  3RUZ A;  4WOR A;  4K5X A;  3NHH A;  3OWF A;  4J1M A;  1EY4 A;  4ZUJ A;  1KAA A;  2EY2 A;  5ISR A;  3R3O A;  4QF4 A;  2F0L A;  2EXZ A;  1F2M A;  3TME A;  1JOR A;  2KHS A;  1EY6 A;  3QOJ A;  3SK6 A;  1AEX A;  2F0V A;  4IUN A;  5EKL A;  3U9O A;  4NP5 A;  5C3X A;  2PYK A;  1EYC A;  3QB3 A;  2F0H A;  1EYD A;  3ERO A;  5CR3 A;  4IZ8 A;  4K8J A;  4LAA A;  4DFA A;  5KEE A;  3H6M A;  3TP6 A;  5IOD A;  4KY7 A;  1SYC A;  4KY6 A;  3C1F A;  1SYB A;  2OF1 A;  5NUC A;  2ENB A;  5J1Z A;  2EYM A;  4B9X A;  5C6A A;  5DEH A;  2F0U A;  4DU9 A;  4NMZ A;  1A3T A;  1JOO A;  5IGC A;  2F0K A;  3SHL A;  2F0O A;  3NK9 A;  3OSO A;  5EGT A;  1II3 A;  2EYL A;  2EY1 A;  3E5S A;  1STB A;  4NKL A;  4PMB A;  3SK8 A;  5CV8 A;  3T16 A;  3VA5 A;  2F0I A;  3TP8 A;  4EQO A;  5HUR A;  5IGE A;  2OEO A;  4K8I A;  2EYF A;  1TQO A;  5JOB A;  5I9O A;  1SNO A;  3EJI A;  4K5V A;  4KJO A;  4EVO A;  5E1F A;  3MEH A;  5J39 A;  5K5P A;  4NDX A;  4R8N A;  2RBM A;  3MZ5 A; 
#chains in the Genus database with same CATH topology
 1BCP D;  1HA5 A;  5K36 H;  1EY8 A;  5C3W A;  1ET9 A;  3HOX G;  5GAE C;  1Y1W G;  1BBU A;  3J81 j;  4B3M Q;  4OX9 L;  4QMG A;  3M3Y H;  1BNZ A;  3BDC A;  1EWI A;  4JI3 L;  3MVV A;  2K5N A;  2B2W A;  2RA4 A;  2K05 A;  1SMY D;  4P74 A;  4BBS G;  2I5H A;  4JBJ A;  3M4P A;  1LV9 A;  4JI0 L;  2HUG A;  2LS0 1;  4BXX G;  4DV1 Q;  1ILP A;  3GTP B;  2EY6 A;  3HRZ C;  3RZD B;  4NXM L;  2IL8 A;  1LAB A;  4DR1 Q;  2VNU D;  5JJK A;  2PNH A;  3CXC A;  3OIQ A;  2CQA A;  1WJJ A;  3ZYY X;  1L0X B;  3DM1 A;  5FKA C;  2ZXR A;  5IYC G;  2BDO A;  2J7Z A;  3SDZ A;  4ME5 A;  4J6H A;  3WOF A;  4A3E G;  3S17 B;  2G9H D;  1PYW D;  1O7Z A;  3V2T A;  2OXP A;  3D4D A;  4OO1 H;  1K8M A;  4DV3 L;  1I50 B;  3HOZ B;  1GHJ A;  2BH2 A;  2J4X A;  1PYS B;  3PQI A;  3HOU H;  3CCJ A;  3H3V I;  3PGZ A;  1N8R C;  5BR8 Q;  1J5E L;  5G3L D;  1OO9 B;  4CBV A;  1N36 Q;  2OQK A;  5CMD A;  1EU3 A;  3LGJ A;  1PMR A;  5C4J B;  2KHS A;  1Y8N B;  5E4X A;  3L3O C;  3G7L A;  3OHX C;  4BBR B;  4AIM A;  5KND A;  3RLN A;  5C3E B;  1FNV A;  3TQY A;  1WI5 A;  5IP7 H;  3CC7 A;  3PUY A;  3VDY A;  3S1R B;  4JI5 L;  5LMN W;  5EAY A;  2F0O A;  3OWE B;  4YHH L;  3VYU A;  1A6X A;  3I4M B;  4EQO A;  1RL2 A;  1CSQ A;  4DR2 Q;  4K5V A;  3NWT A;  5E1F A;  4A3J B;  4DR3 Q;  1SE4 A;  2A19 A;  1VQ7 A;  4NDX A;  2Y0S G;  3VR6 A;  3MZ5 A;  1QVF A;  3DWA A;  3H15 A;  3DLL A;  1VQA A;  1DOM A;  5C0X H;  1XTD A;  3F8T A;  4KI0 A;  3AB9 A;  4F8M A;  4KD3 A;  3S9W A;  4U67 3;  4H02 A;  4N9P A;  1STN A;  2M9V A;  5D65 A;  4B3R L;  1PDQ A;  1YNJ C;  2M00 A;  1XMQ L;  5JEA H;  2MPM A;  4Y7N B;  2R7Z G;  5BN5 A;  5C0X I;  3M7N A;  1PTO C;  2KOL A;  1P16 A;  2F0F A;  1ENA A;  2GVB A;  3VR2 A;  4DK3 C;  1N36 L;  2FXQ A;  2R93 G;  2K03 A;  3JAM i;  4IFD J;  4S3S A;  3AYH B;  4J8Q A;  3VR4 A;  3S2H B;  5M5X B;  1KTK A;  1ZXT A;  1TKW B;  1MSG A;  4HJ8 A;  1K3B C;  1K0R A;  4DGZ A;  1AZP A;  4DV6 L;  4ME3 A;  2AHO B;  1HNZ L;  1O80 A;  4ZRZ A;  2PW5 A;  5C4X H;  1H9J A;  3SVM A;  3UDF A;  4QGU A;  1MKH A;  1JOQ A;  4DPG A;  2JA5 G;  4C3J H;  1ZYR C;  1PFS A;  3KUP A;  3D8G A;  1DXM A;  3EA6 A;  4YY3 L;  4OWW B;  1A62 A;  2F0M A;  2K5W A;  4LUV A;  4Z9C B;  3HEJ A;  2A69 D;  2X6G A;  3GD7 A;  1VMC A;  4C2M H;  3HOZ H;  3RUZ A;  1JWS D;  3Q23 A;  2O2L D;  2QCP X;  1L1O A;  4OO1 I;  1QE6 A;  2A6H D;  2F0L A;  3UE0 A;  2A73 B;  2F0V A;  2FJ2 A;  2R6G A;  5LHY 1;  2FIN B;  1XTC D;  2UU9 L;  1KQS A;  3MXN A;  2PO4 A;  4BY1 G;  5C4J H;  3MXG A;  3PUX A;  4KY7 A;  1RF2 D;  3FDT A;  4JG2 A;  4LFB L;  2IJ0 A;  1TWC H;  2E2I B;  1R4P B;  4HAE A;  4A3C H;  5C3E H;  1LT4 D;  3OPO A;  4A93 B;  2WP8 J;  4OEL B;  3U4Z A;  1UAP A;  1B1Z A;  2EY1 A;  4NKL A;  3S1Q H;  4RG1 A;  4C56 C;  1TQO A;  1PH2 A;  4DV2 L;  1PRT F;  4JBK A;  2A1A A;  2NZO A;  1VQG A;  2JA8 G;  2IPK D;  5JPM C;  2C9O A;  2A6E D;  2JK8 A;  4R8N A;  3I4M H;  2N55 A;  4KK7 A;  4FXG C;  1K8A C;  1G6P A;  2EJG C;  3U4V A;  2F0T A;  3W5O A;  1RTO A;  4A3J H;  2Q2I A;  1CI3 M;  4OXP A;  4QB4 A;  3SR1 A;  3DM3 A;  3H0G H;  1G6Z A;  1TY2 A;  2F03 A;  4XYO A;  5JVH 3;  1X9N A;  1WTV A;  2F0E A;  3KBG A;  1Q3L A;  1MJE A;  3I2Z A;  5IWA L;  2HDM A;  4A3G G;  1PH1 A;  2UXC L;  2F0P A;  1I4X A;  2KVM A;  5M3M B;  3U50 C;  1M4V A;  5CYU A;  4RAU C;  4C3I G;  4DR7 L;  4DR3 L;  4GOP A;  1GVP A;  1M90 C;  1BCP C;  2F3I A;  1EFW A;  2K5Q A;  3BYT B;  2JEB I;  2B2T A;  5M3F B;  3HOX B;  1JJG A;  1HNX L;  4V19 0;  4OL7 A;  5GAH C;  5TSS A;  1U9R A;  2AWO A;  1LTG D;  5M5X H;  1JQY D;  1IXR A;  4LF9 Q;  3KF6 B;  3GTM B;  1EUJ A;  2EYJ A;  3W1B A;  1G29 1;  4GOP C;  3PO3 G;  4IUV A;  3STB C;  3TDQ A;  1HFG A;  2GA4 B;  3J81 i;  2B2W C;  4RH6 A;  2R61 A;  2ZTD A;  3PSI A;  4JPB W;  4TRD A;  4BY7 H;  3H91 A;  5IT9 L;  4C3J B;  2V4D A;  4A3I B;  4PV1 C;  1CA6 A;  3HOZ G;  1STH A;  5M5W H;  3PUZ A;  3DHQ A;  1TS2 A;  2SOB A;  1L2F A;  2BE5 D;  1C48 A;  2ICE C;  1EIF A;  1Y1V B;  1H9M A;  4FXK C;  4HR7 B;  5FOB B;  4JC0 A;  4IUN A;  4BY1 H;  2B2V C;  1Q12 A;  5IYB H;  1SXT A;  2TSS A;  2DN8 A;  2RSN A;  2Y0S E;  4LMQ D;  1SYB A;  2CW0 D;  3K59 A;  2NN6 I;  5ELD A;  3Q0A A;  4X64 L;  2E75 C;  4NPS A;  4B3S Q;  3NK9 A;  4MTN A;  2WB1 E;  2DNE A;  4PMB A;  3SK8 A;  1D5Z C;  2E2I H;  4NXM Q;  1SNO A;  2UXC Q;  3ND8 A;  4KJO A;  3HOW G;  3J81 c;  1Y1W B;  1XNQ Q;  1IW7 D;  3A74 A;  1NJI C;  1HUM A;  3MFG A;  1HXY D;  1B3Q A;  2A5H A;  4PQX A;  1H9S A;  5CV6 A;  1I5F A;  2AUK A;  1I4G A;  4LF4 L;  3GTL H;  4Q0F A;  1MHW C;  3RLO A;  3F2B A;  2JSO A;  3H0G B;  3NTH A;  4YIJ A;  1HR0 Q;  2JP1 A;  1B7Y B;  1EEF D;  4XTC S;  4HIO A;  2HHH Q;  3GTJ B;  1IKM A;  3UI2 A;  3VR5 A;  3I4N B;  3PIO 3;  1F2L A;  4HJA A;  4CDC C;  3F2D A;  1JB7 A;  5IE8 A;  1JWM D;  4PMC A;  5D3D A;  1STE A;  3K80 C;  5D14 A;  1SRU A;  2F4I A;  1L0Y B;  2F0S A;  4H13 C;  4X65 Q;  2MFI A;  4KV6 A;  2V1C C;  4K14 A;  3NSW A;  1K73 C;  4X3U A;  3T4A C;  3BDL A;  4JI6 L;  1ESF A;  5M3F H;  4HMI A;  1EQQ A;  1EEI D;  2JA6 G;  4DV4 L;  2Q2U A;  1BCP B;  3QJY A;  4DNT B;  1O7I A;  5M3M G;  2F52 A;  3M4Q A;  1PRT C;  2CCZ A;  4EQP A;  1WCM H;  3QR8 A;  4EX5 A;  3HOV G;  1J9O A;  5EKI A;  2CH4 A;  1YHA A;  5FO8 B;  1SAP A;  2KUM A;  3W3A A;  1PH9 A;  4OO1 G;  5I2X A;  5CC4 A;  4IPG A;  2OTL A;  1PRT B;  3I8Z A;  3NTK A;  5IGD A;  3TN2 A;  3MC0 B;  5IIF A;  1MBY A;  2R92 G;  1YI2 A;  3Q24 A;  2YTX A;  1N34 L;  3A55 A;  4K0K L;  3U9O A;  2CVR A;  1Y1V H;  2SDF A;  2PYK A;  1FJG L;  3ERO A;  2QGQ A;  4DV2 Q;  2JA5 B;  2EIF A;  4BY1 B;  1PTO H;  3JC6 6;  2ZJR A;  4N8X 1;  5I2Y A;  1GOZ A;  1XMO Q;  1II3 A;  2K6A A;  4DV7 Q;  3J7A 5;  4A3C G;  4QIW E;  2F0I A;  1Z6H A;  1CKM A;  2R7F A;  4IFD G;  3U9S A;  4AQY Q;  4L8J A;  3DWP A;  2RCF A;  3KK7 A;  3BU2 A;  5CV5 A;  4JCV E;  1Y1W H;  1HCZ A;  3I90 A;  5FK9 C;  1DON A;  5C0X G;  2NVT H;  1B70 B;  1F9R A;  1N33 Q;  2CWP A;  1B50 A;  4A93 G;  2PW7 A;  2O5J C;  4F88 A;  2F0N A;  3OYY A;  3S16 B;  1LUZ A;  4L6T B;  4DK1 A;  5JEA G;  1I3Q B;  4BXX H;  4A3G H;  1LLR D;  4GKK L;  4XQJ A;  2A6E C;  3VA7 A;  2R93 H;  4HED A;  3I4N H;  1SFO B;  4FF1 A;  4HTH A;  2K33 A;  2QEJ C;  1NMG A;  5CGK A;  3BS1 A;  5M3F G;  3K57 A;  1STY A;  1HNZ Q;  4G7H C;  1AE3 A;  1IYU A;  4ZQ3 A;  1KAB A;  2HIV A;  2AUJ D;  4POF A;  3NWS A;  4JI1 L;  2VUM G;  1TT2 A;  1Q7Y C;  4K2K A;  2G5D A;  5JJI A;  1KNA A;  1BXT A;  2Z9H A;  1JOK A;  1G2S A;  4C3J G;  1HRJ A;  4X3K A;  3S24 A;  4QUF A;  1VMP A;  1WCM B;  2F4V Q;  2B2T C;  5C44 H;  1TWG B;  2X6L A;  2Z6K C;  1W6K A;  5EPK A;  4JI2 Q;  2K5D A;  2RQX A;  3PIP A;  3DXJ C;  2KEC A;  4J1M A;  3NBH A;  1WTP A;  3URY A;  1BBX C;  1HJP A;  3TME A;  2CWA A;  2WIN B;  2K28 A;  3HS0 C;  1XPR A;  1PYB A;  1F9S A;  1SDF A;  3CRK C;  5EPL A;  1XJV A;  2H1E A;  1U4L A;  1XMQ Q;  2UXB Q;  4GKK Q;  2XSC A;  4L5Q A;  5FLM H;  1C7Y A;  2P5Z X;  5I4D A;  3VYT A;  1B3A A;  3PO2 H;  2D9U A;  3KFU A;  3ER0 A;  2F0U A;  2B39 A;  1WTO A;  1JOO A;  2F0K A;  3IFT A;  3SHL A;  3ZJY C;  4HJ9 A;  3CPF A;  1IBM Q;  4EGV A;  2E2H B;  2PPB C;  3HKZ B;  3TP8 A;  3CMA A;  4ALP A;  2I07 B;  4DA2 A;  5ELN A;  1YNN D;  2K50 A;  5GRO A;  4DUZ L;  2Q8I B;  3E3X A;  1O7L A;  2M2L A;  5IYD H;  1FNU A;  2XGT A;  2XN9 C;  4ZK9 B;  3BVG A;  2Z1C A;  3PIO A;  3TS2 A;  3NBI A;  4K2L A;  2CW0 C;  1Q46 A;  1F2Y A;  1LT3 D;  4ZAI A;  2O5I C;  4GLX A;  2XTI A;  5DAU A;  1EQV A;  3K7A B;  3AFP A;  4R4I A;  3GP7 A;  4UP8 A;  1X54 A;  4K6L A;  3SK4 A;  3HOW B;  2N78 A;  1EY5 A;  4LF6 L;  2NWG A;  5AJ3 Q;  1I3Q H;  1VQ8 A;  5A2Q L;  4DR7 Q;  2H5X A;  2KHI A;  4OWX B;  2WAQ B;  3Q6S A;  1VF5 C;  2KCC A;  3UE1 A;  1RIP A;  2A69 C;  1GUT A;  4KY5 A;  1SFO H;  3CPW A;  4TKO B;  4FNF A;  1Q81 C;  3J81 E;  1T5X D;  3K8A A;  4A3M H;  3M9B A;  2ZJQ A;  2B63 H;  3L2P A;  1DGS A;  3SEB A;  1A3V A;  4A3E B;  1MJC A;  3MFY A;  4KHP L;  2PQE A;  2Q2T A;  4DAY B;  3GDE A;  1A0I A;  3AQQ A;  4KHZ A;  3CAM A;  1X3F A;  4P2C B;  3I56 A;  4RWS C;  3BVZ A;  1E3P A;  5D3I B;  3HOY B;  3A0J A;  1K3R A;  4KKT A;  1NSN S;  3O13 A;  1TWF H;  4FP5 D;  1CHP D;  1EQR A;  3NEL A;  1I94 Q;  3BJU A;  2AWN A;  3IFD A;  5C44 B;  1KAA A;  1JOR A;  2EXZ A;  1OXV A;  1ILQ A;  4IUR A;  1TY0 A;  4X65 L;  2IX0 A;  1H9R A;  4A3L H;  1TVX A;  4RGT A;  4KMU C;  4GZY C;  5IOD A;  1EYG A;  2OF1 A;  2OWO A;  2ZTC A;  4YCU A;  3I4O A;  1YBY A;  1RJT A;  1YZ6 A;  3TZD A;  1GUO A;  1E7Z A;  2UXB L;  3DEP A;  3PO2 B;  1NR2 A;  1C8C A;  1Q90 A;  3STB D;  4LK1 C;  1GD7 A;  1ET6 A;  3GTP H;  4NXN L;  4GN5 A;  1DOK A;  4RGM A;  5C0X J;  3E0E A;  3GV6 A;  2VQF Q;  5JJZ A;  1Q8I A;  1EY0 A;  4BA1 I;  3CCV A;  3E9H A;  1IBM L;  5KRU A;  3H3V C;  3FMC A;  2IX3 A;  1RKN A;  2RCN A;  5K36 G;  2OT2 A;  5BN4 A;  1VQJ A;  2ZTE A;  4DUY Q;  4UDU C;  4F7X A;  2B3G A;  2PI2 A;  4JK1 C;  5HGQ A;  4MN3 A;  2X69 A;  2B8F A;  4CDF C;  3TP5 A;  4HIM A;  2PZU A;  3ERS X;  2XWB B;  1U4R A;  2B2Y C;  3GTG B;  3A8K E;  4JOI C;  4N9T A;  2N49 A;  1KD1 C;  4LUZ A;  4KKS A;  3W1G A;  1BVS A;  1V1P A;  2DUD A;  4XT1 B;  5J22 A;  5COR A;  5JPN C;  3MAQ A;  2JA7 G;  1HHV A;  1NTG A;  2B63 G;  2NTS A;  4A3K G;  5FO7 B;  4R4Q A;  1AH9 A;  2PQA B;  4V0B A;  3T1H L;  5AJ3 L;  3I72 A;  1VQ6 A;  4OIJ A;  2QA4 A;  2B63 B;  4DV5 L;  1JE4 A;  4IPC A;  1ESR A;  3DWQ A;  4YCW A;  4A3E H;  3HGB A;  1A2U A;  4ID6 A;  1KDC A;  1BBW A;  2SNM A;  4X3T A;  3S1R H;  4DKA C;  3HFZ B;  4O42 A;  1SNQ A;  4LWC A;  1CTM A;  2BA0 A;  1LTT D;  4GLA C;  4JW0 A;  1D8L A;  1NCV A;  4ZUI A;  4IJL A;  2RDF A;  2JA9 A;  4A3B H;  3BZK A;  1U5K A;  3UDX A;  1JMC A;  4OX9 Q;  1JWU D;  1TWF B;  2BA1 A;  2DY8 A;  5ELE A;  1HNX Q;  1TXY A;  1YNX A;  4XXE A;  2SEB D;  4UP7 A;  3A5Z B;  2CKZ B;  4DFA A;  4ZCK A;  5LMU Q;  1Y8O B;  4C3H G;  1I6H B;  4KY6 A;  1UE6 A;  3BDO A;  4J15 A;  4IUP A;  4IUQ A;  1D6E C;  4B9X A;  2RDH A;  5DEH A;  3CC4 A;  1LO5 D;  1KRT A;  3RMH A;  1ICF B;  4Q5V A;  1CZG A;  5CV8 A;  3FPP A;  2Q8T A;  3AMU A;  2K32 A;  1KAW A;  3S2H H;  1T9H A;  1B4O A;  1JC7 A;  4H0L C;  1EWH A;  4WJ3 M;  4JI8 L;  1QIL A;  2RBM A;  3FKI G;  4GNX C;  3S15 B;  1Z7T A;  1KC8 C;  1E2V A;  3RD4 A;  1JCK B;  3KLS X;  2K04 A;  1B8A A;  4DK6 C;  3CCR A;  3IAY A;  2HDL A;  3K5O A;  2CFM A;  2JQO A;  1SYF A;  4YWM A;  4X66 Q;  3NTI A;  1PTO F;  1BO0 A;  1EFI D;  2WAC A;  1N33 L;  1SLJ A;  3X3N A;  2RDG A;  3RR5 A;  3HKZ G;  4DR4 Q;  1K8O A;  3JAM c;  3FPU B;  5C4H A;  2RKS A;  4GN3 B;  3KDF A;  3I3C A;  4ULL A;  1Q8K A;  1HZB A;  3GTG H;  2F0G A;  2E5L L;  2NN6 G;  4C2M B;  4IFD I;  2HHH L;  4I65 A;  4A3K B;  4B3R Q;  2DJG C;  4IOA A;  1LM0 A;  2FFK B;  1LT5 D;  5ELB A;  1FR3 A;  3TRZ A;  1GO3 E;  4QUC A;  4RKL A;  5C4X G;  3DUZ A;  2K5H A;  1KDB A;  1UUP A;  3OMG A;  1VQN A;  2YTV A;  3MTS A;  5E4W C;  3QWN A;  3KJP A;  2N88 A;  4LNQ A;  2D5D A;  4LFC Q;  4LFA Q;  1TWH H;  1EZ6 A;  3OW2 A;  1VQO A;  2UUC Q;  2EZV A;  4AQY L;  1DJR D;  1BDO A;  4BY7 G;  2EPB A;  3P1H A;  2BCO A;  4FYD A;  1QZH A;  1SMX A;  1HPC A;  3EBE A;  2K5V A;  4A3F B;  2H4O A;  2IHF A;  3V05 A;  5LL6 X;  1AP0 A;  3C2P A;  4A3B B;  3QB3 A;  1TWA H;  1XNR Q;  3I70 A;  1X3E A;  4CJ2 C;  4K0K Q;  5EBC A;  1U4M A;  2XWJ B;  3FP9 A;  3CP0 A;  4IFD H;  4NXN Q;  2AQ1 B;  3L0O A;  3P7J A;  2HT1 A;  4DR5 Q;  1CKN A;  1OXU A;  1W3S A;  5DNF A;  4K8I A;  3CCQ A;  4IOC A;  3KLS A;  1FYC A;  1IW7 C;  4TVA B;  1AN8 A;  4IQZ A;  2AQ2 B;  3I7F A;  4X6A H;  3HKZ E;  1YEZ A;  1I4P A;  2KEN A;  3A7A B;  3HOX H;  2VZA A;  3NXW A;  2A68 D;  1D1K A;  3D4W A;  4R9W A;  1WFQ A;  3S15 H;  5IYD G;  1JT8 A;  2AKW B;  2L4N A;  1O78 A;  1HR0 L;  1VCI A;  4B08 A;  1BCP F;  5T1G A;  2RHS B;  4BWG B;  3GTM H;  3CRL C;  3SXH A;  2LXJ A;  4L5R C;  2R7Z H;  4LFC L;  4IPD A;  1LTA D;  4JI5 Q;  2HCI A;  4UAI A;  4X3S A;  1GUS A;  2K52 A;  4BY7 B;  1HTP A;  4I7Z C;  3QIA A;  2UXD L;  2MP1 A;  4A3I H;  2IW3 A;  1RCV D;  5EBD A;  1OTC A;  4JI8 Q;  3GTK H;  3C1E A;  1S4Z A;  1QNU A;  5M5W B;  1EY7 A;  2EDG A;  1FGU A;  4IPH A;  3N6R A;  4JYA L;  3G48 A;  4RKB A;  4B3S L;  2I5M X;  3A5U A;  1IL2 A;  1Z47 A;  4RCN A;  1EL0 A;  4A3K H;  1XXG A;  1IBK Q;  4KHP Q;  5LL6 S;  5IGG A;  1H9K A;  1G2T A;  2HCC A;  1SR3 A;  2O4X A;  3DEO A;  3M7G A;  5FJ8 H;  2D0O A;  2DJF C;  2JEA I;  1V9P A;  5ELF A;  5IGF A;  1I4R A;  5CV9 A;  1F9P A;  3QO2 A;  1XNR L;  3TSS A;  1IYV A;  2NB0 A;  2EYH A;  3TEH B;  5KGU A;  1XX8 A;  2JXM B;  2F0Q A;  1HH2 P;  2WAQ E;  2OQ0 A;  1TWH B;  4JVZ A;  3HOU G;  2PQA A;  2VXW A;  5G3L F;  3D3R A;  4GKJ Q;  4ZUJ A;  2ASB A;  3P20 A;  3SK6 A;  4A3B G;  1LYL A;  4CJ1 B;  4P71 A;  4NP5 A;  4DUZ Q;  2NVQ B;  1A63 A;  4IZ8 A;  4LAA A;  1VQ4 A;  2YU9 B;  3FHW A;  1Y1V G;  4O0A A;  3GTL B;  2XRS D;  2QDL A;  3C1F A;  4DV0 Q;  1G51 A;  4UPA A;  1PH6 A;  1WD1 A;  1PFM A;  3KF8 A;  1C0A A;  3RZO B;  2WV6 D;  2Z6B A;  1S5B D;  4NB3 A;  4PZ7 A;  1TWA B;  4DU9 A;  3GTJ H;  5IGC A;  4JI0 Q;  5IP7 G;  3I55 A;  2EJF C;  3T16 A;  2JA8 H;  4LF8 Q;  3C46 A;  3CD6 A;  1TS4 A;  1VQI A;  4LF8 L;  1D2B A;  2B29 A;  1SJE D;  1DYQ A;  3K81 C;  4DN4 M;  2ID0 A;  1B53 A;  1TS5 A;  2HD3 A;  2B2V A;  3K0X A;  1OXT A;  1DCZ A;  3TP7 A;  3GO5 A;  2GN5 A;  4IO9 A;  3KYH C;  3C3L A;  1KNE A;  4A3D G;  1PFB A;  2E2J H;  1X3P A;  4DR6 Q;  1CQV A;  4FO2 A;  4OHJ A;  1S5D D;  1VQ5 A;  4UP9 A;  2PMZ B;  4KN7 C;  1ZKO A;  1A3U A;  2R7Z B;  2ZXP A;  1SEB D;  2IX1 A;  3RN5 A;  2K14 A;  5BR8 L;  1Q1B A;  4ZYS A;  2L1B A;  3ITP A;  1S40 A;  1E1O A;  4B3T L;  4ZLT F;  1W2B A;  4HCE A;  2PI2 E;  2WII B;  4CKC A;  1MIU A;  1YHQ A;  1SNM A;  4LF4 Q;  3ND9 A;  3D6W A;  1SSO A;  3U58 A;  1HUN A;  1QVG A;  4P73 A;  1FJG Q;  3PMF A;  4MNO A;  5F2D A;  3T13 A;  5A2Q E;  4ILW A;  4QCL A;  4DAY A;  1SYE A;  1PH3 A;  1VDZ A;  4CDE C;  4JBM A;  2I46 A;  1LT6 D;  4PZ6 A;  2F0J A;  5JEA J;  2K7V A;  2D2C C;  2JA5 H;  1K8G A;  1WVL A;  4C3I B;  3RN2 A;  1PTO B;  3KF6 A;  5JVG 3;  4DR2 L;  3NEN A;  5EQ0 A;  4OWT B;  4WRD A;  4YHH Q;  3BVM A;  3PIP 3;  1WYD A;  4HID A;  3JAM E;  4KJN A;  2RHQ B;  1NMF A;  2NVY B;  3B6Y A;  1GXD C;  1EY4 A;  5ISR A;  1I4Q A;  3R3O A;  3JAM L;  4A3L G;  2PNR C;  2XRQ D;  3MXN B;  1CK1 A;  3D31 A;  4POG A;  5EKL A;  1QZG A;  1IBL Q;  1A15 A;  2F0H A;  2NTT A;  2NVT B;  4K8J A;  1LTR D;  1BUV T;  5KEE A;  1D1I A;  2K01 A;  3HG9 A;  4RGN A;  1N32 Q;  1IL8 A;  2NVQ H;  2ENB A;  2WKC A;  2KEE A;  4C3H H;  1H9S B;  2YU9 H;  1A3T A;  1B2T A;  5J3B A;  2EYL A;  3IL8 A;  1BF4 A;  3VA5 A;  1QWY A;  4A3G B;  3RZO H;  1VQM A;  2KCT A;  2R93 B;  4DNR B;  3ULJ A;  5CBA E;  1YNN C;  4C1N K;  2D62 A;  1VF7 A;  1BOS A;  5IP9 G;  2AQ3 B;  1CKO A;  1UWV A;  3EIV A;  4BBS B;  2A8V A;  2DGY A;  1E2W A;  2EE1 A;  2EY5 A;  3KDF B;  4DF7 A;  3H0G G;  3PUW A;  4JV5 Q;  1F9Q A;  3E6Z X;  4YY3 Q;  3NP8 A;  1XPU A;  2EYO A;  1SNC A;  4PG3 A;  2UUC L;  3WOE A;  5IOC A;  2E2J B;  2DNC A;  4RHR A;  5IWA Q;  2KQ3 A;  3OOC A;  1FD7 D;  1OXX K;  4X64 Q;  1E24 A;  2C35 B;  2N3S A;  2L55 A;  3PCO B;  4R4T A;  1ZEQ X;  4CGY B;  2HQL A;  2JA7 H;  4KTA A;  1QNK A;  4JI7 Q;  4IJH A;  1TWG H;  2VQF L;  4DR1 L;  5I6W A;  3CCS A;  2QF7 A;  4AYB B;  1MI2 A;  4QY7 A;  3MXU A;  1EYA A;  4P72 A;  3GTQ B;  3P75 A;  5IGB A;  3PV0 A;  3PO3 H;  1HA6 A;  1SYD A;  3CCM A;  1KLG D;  1HFN A;  2FMM A;  4DXG A;  1RHP A;  3TBI B;  1NNX A;  3HOV B;  1JIC A;  1V1P B;  2KCN A;  3CU7 A;  3GTO B;  3UDG A;  1BR9 A;  2NVX H;  4LF7 Q;  2IHE A;  2ZJP A;  3AU7 A;  4KN4 C;  3BG3 A;  3BYY B;  3RZD H;  1LAC A;  5KIX A;  1HR0 W;  2SNS A;  5JJL A;  4WOR A;  4FVM A;  2MNA A;  2ICI A;  3K7U C;  2Q8R E;  2A74 C;  1JJ2 A;  2WB1 G;  1AW7 A;  3T1H Q;  3BZC A;  4HJ5 A;  2NVY H;  1YJ9 A;  1U4P A;  3CF5 A;  2Z4I A;  1LTI D;  1S72 A;  5M5Y B;  5CR3 A;  4QQB X;  2MQH A;  1K28 A;  3KF8 B;  3S17 H;  1DD2 A;  1X55 A;  1V43 A;  4GS3 A;  5J1Z A;  3K5L A;  1Y69 U;  3WWV A;  3A56 A;  3K7A H;  4JV5 L;  1ROD A;  4DR5 L;  4H44 C;  3HOW H;  3NE5 B;  5IGE A;  3K6O A;  4MHE A;  5I9O A;  5H1S E;  3X3M A;  4LUO A;  2VW9 A;  2FMC A;  3K5N A;  5K5P A;  2Q2H A;  3NEM A;  4RMF A;  1MD2 D;  2BH8 A;  3I73 A;  1NUC A;  2R3Z A;  2VY3 A;  4NW2 A;  4KLK A;  3OMC A;  3UDI A;  3MHB A;  5LMU L;  2MJ8 A;  4E6I A;  2Y0S B;  1GM5 A;  3R8B A;  2IY5 B;  4KHV A;  1ENC A;  1YIT A;  4BBS H;  3HZX A;  2WAQ G;  4CDD C;  1TR5 A;  2B8G A;  3QOL A;  1SMY C;  1STA A;  1W6J A;  3RNU A;  1CUK A;  4LFB Q;  4RCO A;  2ALY B;  1CKN B;  5IY0 A;  4WFN 3;  1KLU D;  4H7B A;  1UE1 A;  3DMU A;  2MUY A;  4TQU S;  1XPO A;  2JA7 B;  3NBH B;  4A3F G;  2L12 A;  2E74 C;  5CV7 A;  5IYC H;  2EXD A;  4QIW B;  1YNJ D;  1RTN A;  2VL6 A;  3CKI B;  1L0W A;  2HIX A;  3CCU A;  3S1N B;  5C5L A;  4GOP B;  1CA5 A;  4DV1 L;  3T1Y Q;  4A3M G;  3GTQ H;  3Q22 A;  1MSH A;  4Y7N H;  3BZD B;  3PO3 B;  1CFM A;  5FO9 B;  5IT9 c;  4DV4 Q;  4L63 B;  2A68 C;  1EOT A;  1SN8 A;  2F0D A;  5C44 G;  4JI4 Q;  3HOV H;  3LNN A;  1GUW A;  4HSP A;  3GTO H;  1X6O A;  1SE3 A;  1FVI A;  2NVX B;  1QCB D;  3MXP A;  4U68 A;  4GKJ L;  1IYJ B;  2ZXO A;  4QF4 A;  5C4X B;  3KLR A;  1E1T A;  3QOJ A;  4PZ8 A;  4MZ9 A;  4APV A;  2LY7 A;  4HJ7 A;  2L15 A;  1VQP A;  1YHB A;  5C3X A;  1FGB D;  3L7Z C;  4GNX A;  3M4O H;  5E7N A;  1UE5 A;  3TP6 A;  1ASY A;  1R4Q B;  1TS3 A;  2F1M A;  4UHV A;  5M5Y H;  4FXD A;  3A7L A;  3ICE A;  4JI6 Q;  1LTB D;  4A75 A;  3S14 H;  1I6V C;  1HNW L;  5HUR A;  1CSP A;  2OEO A;  3I4M G;  4EVO A;  4JOI A;  1QB5 D;  4N8F A;  1AZQ A;  2PCF B;  5J39 A;  4XYQ A;  2ATW A;  4A3J G;  2KA7 A;  2EJM A;  1L1O C;  3KJO A;  1ICW A;  5FLX L;  1QG7 A;  1P8L A;  1ML0 D;  2J0T D;  2F0W A;  4AH6 A;  2LFN A;  1WOC A;  2RSO A;  1B9N A;  1KDA A;  1AFP A;  2E76 C;  3MEF A;  1IBL L;  1TWC B;  1AE2 A;  4G57 A;  5IT9 E;  4A3D H;  2UUB Q;  5CV4 A;  3W2D A;  4A93 H;  5FLX E;  4A3I G;  4JI7 L;  2Z8L A;  3S1Q B;  3AEV A;  1YJW A;  4XIG S;  5DM7 3;  3K5M A;  4MIU A;  4WJW A;  1M1K C;  3ULL A;  2PMZ E;  2JA6 B;  3L9A X;  4JBW A;  2OCE A;  4A4I A;  3I4N G;  3OW7 A;  3T53 B;  3I4L A;  2K75 A;  3R2T A;  4B3M L;  1E2Z A;  2VB2 X;  4YWK A;  1PXU A;  1EWC A;  2VB3 X;  3NQT A;  5C4Z A;  1B44 D;  3J81 L;  4EQ5 A;  2L11 A;  1XWE A;  1PH5 A;  3S1N H;  3N52 A;  1RD9 D;  4M1U B;  1J5E Q;  1I6H H;  2N8N A;  5DLQ E;  5M3M H;  3PUV A;  2RVL A;  2KED A;  1EIY B;  1WTH A;  1HTL D;  2ZM6 Q;  4PMW A;  5CBE E;  2LKV A;  1LTL A;  1RDP D;  3AFQ A;  5HGT A;  3J7Y W;  1IKL A;  1KL9 A;  3PF4 A;  2K4K A;  5LMN Q;  1EY6 A;  3CW2 C;  2KCM A;  5IYB G;  3FVQ A;  4DR6 L;  4YWL A;  1M8A A;  2LMC B;  1UNS A;  1T5E A;  4TSS A;  1EU4 A;  2OTJ A;  4FF2 A;  3H6M A;  4UY8 C;  1VQ9 A;  1VQF A;  5C3E G;  1N32 L;  2EYM A;  3LWE A;  5C6A A;  2KJX A;  3SE0 A;  1J6Q A;  4FDB A;  5COY A;  2EVB A;  4NMZ A;  3M4O B;  1ONL A;  3EN2 A;  3OSO A;  1JB3 A;  1PVO A;  3E5S A;  2IT1 A;  1I4H A;  2JE6 I;  3EJI A;  2EOT A;  1DM0 B;  3S14 B;  2MHV A;  5DM6 3;  1Z9F A;  1ZYR D;  5ELC A;  2FHT A;  1NAP A;  5AFW A;  2VQE Q;  3SGI A;  4XT3 B;  5EJW A;  2HQE A;  1SJH D;  1PV4 A;  2I5L X;  1XYI A;  3S1M B;  1QUQ B;  2NYZ D;  1Q82 C;  1G91 A;  2QIL A;  1A2T A;  3EVQ A;  4GLV B;  4JI2 L;  5EPJ A;  1HZC A;  3VYR A;  4AYB E;  4QJF A;  1V1Q A;  3TS0 A;  3NPP A;  3S2D B;  2NUC A;  1VQD A;  1HZA A;  1VQH A;  3J80 c;  3D4R A;  3ULP A;  4A3D B;  2LXK A;  2JJQ A;  1EIG A;  1Q1E A;  2D0P A;  3I91 A;  4A76 A;  2UUA Q;  4K5W A;  1SND A;  3D0F A;  2F4V L;  1YVC A;  1JR0 D;  1E22 A;  1X65 A;  1O7Y A;  2QEX A;  1SNP A;  5M9O A;  2JA6 H;  2B2U C;  4A3F H;  3MWY W;  2Z6K A;  3OTO Q;  3J7A F;  5KYL A;  4DAM A;  3OTO L;  4YCV A;  4JYA Q;  4K6D A;  4JI4 L;  1Q86 C;  3FRP B;  1WTQ A;  4DUY L;  4HN7 A;  2A6H C;  1X3Q A;  4ODG A;  1XNQ L;  4Y52 H;  1GHK A;  1CHQ D;  3NQI A;  1Y14 B;  4ZKC B;  1PZJ D;  1VQC A;  3ERQ A;  3A8I E;  5FJ8 G;  3LWU A;  3F2C A;  1EZ8 A;  5C5M A;  1ASZ A;  1I94 L;  1SYG A;  2MO0 A;  4BBR G;  5KNB A;  5A35 A;  1K83 H;  5KYI A;  5FLX c;  4P75 A;  4CKE A;  3VYS A;  3LX0 A;  2BE5 C;  4K5X A;  4B3T Q;  2IWH A;  4DV0 L;  5HY6 A;  3J80 i;  2EY2 A;  1KHI A;  1S5E D;  1F2M A;  1UEB A;  3H09 A;  4IUU A;  1PFN A;  1AEX A;  1YIJ A;  1HQM C;  4L5S A;  1SBB B;  5GAD C;  2NZ1 D;  3OIP A;  4F87 A;  1C9O A;  2KBN A;  1E0B A;  5NUC A;  4LF5 Q;  1GUN A;  2YV5 A;  4IN3 A;  3HOY G;  3PO2 G;  1TU2 B;  4OIK A;  1S5C D;  5EGT A;  2ZM6 L;  3K0Y A;  1CM9 A;  4M8A A;  5JOB A;  4DV3 Q;  4CHT B;  3FKI H;  3GV3 A;  3IKJ A;  4X62 L;  2ZT9 C;  3GTK B;  5GQO A;  2Z4H A;  4OON A;  4O1N A;  1U0L A;  4R8I A;  1FL0 A;  1IHZ A;  4ABN A;  1WD0 A;  1N34 Q;  1KXL A;  3NUC A;  2CH4 W;  2MO1 A;  4DAV A;  1UEA B;  1JE5 A;  2BOS A;  3EFX D;  3EQL C;  3WDN A;  3S1M H;  4EQN A;  1PH8 A;  1HZ9 A;  1JJC B;  2XVS A;  2L5T A;  3A8J E;  2NZH A;  1BQQ T;  5T1I A;  3S2D H;  1GKH A;  1VQB A;  4DAP A;  1PA6 A;  1D5M C;  1K0S A;  1PH7 A;  2PZW A;  2F3W A;  1PZK D;  3QG1 A;  1PLF A;  1HNW Q;  2QW7 A;  1EY9 A;  1SE8 A;  1L1O B;  2QDB A;  4L5T A;  5JAV A;  1K9M C;  4PNY A;  4HSV A;  3KBX A;  3T51 B;  2BDN A;  2YTY A;  1V1O A;  2VUM H;  5I6Y A;  4G7Z C;  3ONA B;  4RFB A;  3HKS A;  1WCM G;  1WTX A;  4CJ0 B;  3FEW X;  4X62 Q;  2XNA C;  2XIW A;  1DOL A;  1R9T H;  3S16 H;  3CQZ B;  1ENF A;  3CC2 A;  4C1N I;  1A8V A;  4DR4 L;  3M4Y A;  4DV5 Q;  2CQO A;  2EQS A;  1PHJ A;  3CCL A;  3SK5 A;  3H3V H;  2JYO A;  2JA8 B;  2R92 B;  4DNI A;  2UUB L;  4RGO S;  3V96 A;  2TMP A;  1VQE A;  3A54 A;  2VQE L;  1K83 B;  2QKI C;  1X56 A;  2G9D A;  3PF5 A;  4OGQ C;  4FF4 A;  1HQR D;  2CHB D;  1TII D;  3T56 B;  2VS1 A;  1D5X C;  3IRB A;  1SYC A;  2L9H A;  4JI1 Q;  1F77 A;  2GVA A;  2DY7 A;  3J80 L;  1CQF A;  2WB1 B;  4QL5 A;  4G4K A;  2E8G A;  4R4O A;  3E9I A;  3H94 A;  2WFW A;  3CCE A;  3KLW A;  4DK0 A;  2LSS A;  1NBW A;  1VQL A;  1PTO D;  2EYF A;  1XMO L;  1NE3 A;  1WTW A;  1VS0 A;  4DV6 Q;  1BKB A;  4XQQ A;  3MEH A;  2I0Q A;  1PRT D;  1DZ1 A;  3M85 A;  2B2Y A;  4KKU A;  3G6E A;  1Y8P B;  2UXD Q;  4MTK A;  1VQK A;  1CT1 D;  1N9W A;  3FKI B;  2WKD A;  3M3Y B;  4DV7 L;  5BN3 A;  4BS9 A;  5IP9 H;  3MA2 B;  3R2I A;  4LFA L;  1LTS D;  2MGS A;  5E3F A;  4GNX B;  1X32 A;  3TZU A;  4I7A A;  2F3V A;  4LF5 L;  1C4Q A;  4XQN A;  3CHB D;  2R7D A;  3RLF A;  2UUA L;  4DXF A;  3CME A;  2E2H H;  4LF6 Q;  4C3I H;  1B9M A;  5I9P A;  1EIH A;  3E0J A;  3KOJ A;  3TRE A;  3D6C A;  2ES2 A;  2E2D C;  4HCS A;  3F2U A;  2YYZ A;  4AYB G;  4IUT A;  2EYP A;  1STG A;  4O2D A;  1CZW A;  1J8I A;  1QVC A;  2NBF A;  4LF9 L;  2NN6 H;  2UU9 Q;  1OXS C;  1EQT A;  4BA2 I;  3J7Z C;  4IAL A;  5EKK A;  1PH4 A;  3R93 A;  2C5C A;  4R1J A;  1NY4 A;  4G7O C;  1S5F D;  1X3G A;  3GQB A;  2VUM B;  1F2Z A;  1I50 H;  1YJN A;  3K58 A;  2L0C A;  1WTR A;  2PZT A;  2KHJ A;  3HOU B;  3G4S A;  1GUG A;  1D7Q A;  2RF4 A;  4GN4 B;  4LJZ C;  4JI3 Q;  4CKB A;  4C3H B;  4FF3 A;  4KD4 A;  4HMJ A;  1R9T B;  3CQZ H;  4B9W A;  1NR4 A;  4R4C A;  2Z0S A;  1QOH A;  4LF7 L;  4OEM B;  3F1Z A;  4BBR H;  4XDX A;  3NHH A;  2B2U A;  3OWF A;  5KNC A;  1V8Q A;  1EOV A;  4HIK A;  2K1B A;  4A3M B;  2R92 H;  4X66 L;  5ELO A;  1MGS A;  1S3O A;  5LMN L;  5FLM G;  1QUQ A;  1KIX A;  1EYC A;  1EYD A;  1FNW A;  1H95 A;  3VR3 A;  1SE2 A;  3T1Y L;  4WJ4 A;  3HP3 A;  1QJO A;  2AMC B;  3J7A V;  3J80 E;  5L37 A;  4RA8 A;  1STB A;  5GAG C;  3HOY H;  4ZKB B;  3G6J B;  2E5L Q;  1PZI D;  3Q8D A;  1SRO A;  1UE7 A;  1IBK L;  1IZ6 A;  2JN4 A;  3G71 A;  4LW1 A;  1GJX A;  1KRS A;  4RHS A;  1G8Z D; 
#chains in the Genus database with same CATH homology
 1BCP D;  1HA5 A;  5K36 H;  1EY8 A;  5C3W A;  1ET9 A;  4QMG A;  1BNZ A;  3BDC A;  3MVV A;  2B2W A;  2RA4 A;  2K05 A;  1SMY D;  1LV9 A;  2HUG A;  2LS0 1;  1ILP A;  3GTP B;  2EY6 A;  3HRZ C;  3RZD B;  2IL8 A;  1LAB A;  2VNU D;  3OIQ A;  2CQA A;  3ZYY X;  1L0X B;  3DM1 A;  5FKA C;  2ZXR A;  2BDO A;  2J7Z A;  3SDZ A;  4ME5 A;  4J6H A;  3WOF A;  3S17 B;  2G9H D;  1PYW D;  1O7Z A;  3V2T A;  2OXP A;  3D4D A;  4OO1 H;  1K8M A;  3HOZ B;  1I50 B;  1GHJ A;  2J4X A;  5G3L D;  1OO9 B;  4CBV A;  5CMD A;  1EU3 A;  1PMR A;  5C4J B;  2KHS A;  1Y8N B;  5E4X A;  3L3O C;  3G7L A;  3OHX C;  4BBR B;  5KND A;  5C3E B;  1FNV A;  3PUY A;  3S1R B;  2F0O A;  3OWE B;  3VYU A;  1A6X A;  3I4M B;  4EQO A;  4K5V A;  3NWT A;  5E1F A;  4A3J B;  1SE4 A;  4NDX A;  3VR6 A;  3MZ5 A;  3DWA A;  1DOM A;  5C0X H;  4KI0 A;  3AB9 A;  4F8M A;  4KD3 A;  3S9W A;  4U67 3;  4N9P A;  1STN A;  2M9V A;  5D65 A;  1PDQ A;  1YNJ C;  2M00 A;  5JEA H;  2MPM A;  4Y7N B;  5BN5 A;  5C0X I;  3M7N A;  1PTO C;  2KOL A;  2F0F A;  1ENA A;  3VR2 A;  2K03 A;  4IFD J;  4S3S A;  3VR4 A;  4J8Q A;  3S2H B;  5M5X B;  1KTK A;  1ZXT A;  1TKW B;  1MSG A;  4DGZ A;  1AZP A;  1O80 A;  4ZRZ A;  2PW5 A;  1H9J A;  3SVM A;  1JOQ A;  1ZYR C;  3KUP A;  3D8G A;  1DXM A;  3EA6 A;  2F0M A;  2K5W A;  4Z9C B;  3HEJ A;  2A69 D;  2X6G A;  3GD7 A;  1VMC A;  3RUZ A;  1JWS D;  3Q23 A;  2O2L D;  2QCP X;  4OO1 I;  1QE6 A;  2A6H D;  2F0L A;  2A73 B;  2F0V A;  2FJ2 A;  2R6G A;  5LHY 1;  2FIN B;  1XTC D;  3MXN A;  2PO4 A;  3MXG A;  3PUX A;  4KY7 A;  1RF2 D;  3FDT A;  2IJ0 A;  2E2I B;  1R4P B;  4HAE A;  1LT4 D;  3OPO A;  4A93 B;  2WP8 J;  1UAP A;  1B1Z A;  2EY1 A;  4NKL A;  4C56 C;  1TQO A;  1PRT F;  2IPK D;  5JPM C;  2C9O A;  2A6E D;  4R8N A;  2N55 A;  4KK7 A;  4FXG C;  2EJG C;  2F0T A;  1RTO A;  1CI3 M;  4QB4 A;  3SR1 A;  1G6Z A;  1TY2 A;  2F03 A;  4XYO A;  5JVH 3;  1WTV A;  2F0E A;  3KBG A;  1Q3L A;  2HDM A;  2F0P A;  1I4X A;  2KVM A;  5M3M B;  1M4V A;  5CYU A;  4RAU C;  4C3I G;  1BCP C;  2K5Q A;  3BYT B;  2JEB I;  2B2T A;  5M3F B;  3HOX B;  4V19 0;  4OL7 A;  5TSS A;  1U9R A;  2AWO A;  1LTG D;  1JQY D;  3GTM B;  2EYJ A;  1G29 1;  4IUV A;  3TDQ A;  1HFG A;  2GA4 B;  2B2W C;  4RH6 A;  2R61 A;  4TRD A;  3H91 A;  5IT9 L;  4C3J B;  2V4D A;  4A3I B;  4PV1 C;  1CA6 A;  1STH A;  3PUZ A;  3DHQ A;  1TS2 A;  2SOB A;  2BE5 D;  1C48 A;  2ICE C;  1Y1V B;  1H9M A;  4FXK C;  4HR7 B;  5FOB B;  4IUN A;  2B2V C;  1Q12 A;  1SXT A;  2TSS A;  2DN8 A;  2RSN A;  4LMQ D;  1SYB A;  2CW0 D;  3K59 A;  2NN6 I;  5ELD A;  3Q0A A;  2E75 C;  3NK9 A;  2DNE A;  4PMB A;  3SK8 A;  1D5Z C;  1SNO A;  3ND8 A;  4KJO A;  1Y1W B;  1IW7 D;  1HUM A;  3MFG A;  1HXY D;  2A5H A;  4PQX A;  1H9S A;  5CV6 A;  2AUK A;  1I4G A;  4Q0F A;  2JSO A;  3H0G B;  3NTH A;  4YIJ A;  2JP1 A;  3GTJ B;  1EEF D;  4XTC S;  1IKM A;  3UI2 A;  3VR5 A;  3I4N B;  3PIO 3;  1F2L A;  1JWM D;  4PMC A;  5D3D A;  1STE A;  5D14 A;  2F4I A;  1L0Y B;  2F0S A;  4H13 C;  4KV6 A;  4K14 A;  3NSW A;  4X3U A;  3T4A C;  3BDL A;  1ESF A;  4HMI A;  1EEI D;  1BCP B;  3QJY A;  4DNT B;  1PRT C;  4EQP A;  1J9O A;  5EKI A;  5FO8 B;  1SAP A;  2KUM A;  3W3A A;  4OO1 G;  5I2X A;  5CC4 A;  1PRT B;  3I8Z A;  3NTK A;  5IGD A;  3TN2 A;  3MC0 B;  5IIF A;  1MBY A;  3Q24 A;  3A55 A;  3U9O A;  2CVR A;  2SDF A;  2PYK A;  3ERO A;  2JA5 B;  4BY1 B;  1PTO H;  5I2Y A;  1GOZ A;  1II3 A;  2K6A A;  2F0I A;  1Z6H A;  4IFD G;  3U9S A;  4L8J A;  3DWP A;  3KK7 A;  5CV5 A;  1HCZ A;  3I90 A;  5FK9 C;  1DON A;  5C0X G;  1F9R A;  1B50 A;  2PW7 A;  2O5J C;  4F88 A;  2F0N A;  3S16 B;  4DK1 A;  4L6T B;  5JEA G;  1I3Q B;  1LLR D;  4XQJ A;  2A6E C;  3VA7 A;  4HED A;  1SFO B;  4FF1 A;  4HTH A;  2K33 A;  2QEJ C;  5CGK A;  3BS1 A;  3K57 A;  1STY A;  4G7H C;  1IYU A;  4ZQ3 A;  1KAB A;  2AUJ D;  3NWS A;  1TT2 A;  4K2K A;  1KNA A;  1BXT A;  1JOK A;  1G2S A;  4C3J G;  1HRJ A;  4X3K A;  4QUF A;  1VMP A;  1WCM B;  2B2T C;  1TWG B;  2X6L A;  1W6K A;  5EPK A;  2K5D A;  2RQX A;  3DXJ C;  2KEC A;  4J1M A;  3NBH A;  1WTP A;  3URY A;  1BBX C;  3TME A;  2WIN B;  2K28 A;  3HS0 C;  1F9S A;  1SDF A;  3CRK C;  5EPL A;  2H1E A;  1U4L A;  2XSC A;  5I4D A;  3VYT A;  1B3A A;  2D9U A;  2F0U A;  2B39 A;  1WTO A;  1JOO A;  2F0K A;  3IFT A;  3SHL A;  4EGV A;  2E2H B;  2PPB C;  3HKZ B;  3TP8 A;  2I07 B;  4DA2 A;  1YNN D;  2Q8I B;  1O7L A;  2M2L A;  1FNU A;  2XN9 C;  4ZK9 B;  3BVG A;  2Z1C A;  3NBI A;  4K2L A;  2CW0 C;  1F2Y A;  1LT3 D;  4ZAI A;  2O5I C;  5DAU A;  1EQV A;  3K7A B;  3GP7 A;  4K6L A;  3SK4 A;  3HOW B;  1EY5 A;  2NWG A;  5A2Q L;  2WAQ B;  3Q6S A;  1VF5 C;  2KCC A;  2A69 C;  1GUT A;  4KY5 A;  4TKO B;  4FNF A;  3J81 E;  1T5X D;  3SEB A;  1A3V A;  4A3E B;  3MFY A;  2PQE A;  4KHZ A;  4P2C B;  4RWS C;  3BVZ A;  5D3I B;  3HOY B;  4KKT A;  1NSN S;  3O13 A;  4FP5 D;  1CHP D;  2AWN A;  3IFD A;  5C44 B;  1KAA A;  1JOR A;  2EXZ A;  1OXV A;  1ILQ A;  4IUR A;  1TY0 A;  2IX0 A;  1H9R A;  1TVX A;  4RGT A;  4KMU C;  4GZY C;  5IOD A;  2OF1 A;  1RJT A;  3TZD A;  1GUO A;  3DEP A;  3PO2 B;  1NR2 A;  1C8C A;  1Q90 A;  4LK1 C;  1ET6 A;  4RGM A;  1DOK A;  5C0X J;  3GV6 A;  5JJZ A;  1Q8I A;  1EY0 A;  4BA1 I;  5KRU A;  3H3V C;  3FMC A;  2IX3 A;  1RKN A;  5K36 G;  2OT2 A;  5BN4 A;  4UDU C;  4F7X A;  4JK1 C;  4MN3 A;  2X69 A;  2B8F A;  3TP5 A;  2PZU A;  2XWB B;  1U4R A;  2B2Y C;  3GTG B;  3A8K E;  4N9T A;  4KKS A;  1V1P A;  4XT1 B;  5J22 A;  5COR A;  5JPN C;  3MAQ A;  1HHV A;  2NTS A;  5FO7 B;  4V0B A;  3I72 A;  4OIJ A;  2B63 B;  1JE4 A;  1ESR A;  3DWQ A;  3HGB A;  1A2U A;  4ID6 A;  1KDC A;  2SNM A;  4X3T A;  4O42 A;  1SNQ A;  1CTM A;  2BA0 A;  1LTT D;  1NCV A;  4ZUI A;  2RDF A;  1JWU D;  1TWF B;  2BA1 A;  2DY8 A;  5ELE A;  4XXE A;  2SEB D;  4DFA A;  1Y8O B;  4C3H G;  1I6H B;  4KY6 A;  3BDO A;  4IUP A;  4IUQ A;  1D6E C;  4B9X A;  2RDH A;  5DEH A;  1LO5 D;  3RMH A;  4Q5V A;  1CZG A;  5CV8 A;  3FPP A;  2Q8T A;  3AMU A;  2K32 A;  1B4O A;  1JC7 A;  4H0L C;  1EWH A;  1QIL A;  2RBM A;  3S15 B;  1Z7T A;  1E2V A;  3RD4 A;  1JCK B;  3KLS X;  2K04 A;  3IAY A;  2HDL A;  3K5O A;  1SYF A;  3NTI A;  1PTO F;  1BO0 A;  1EFI D;  2WAC A;  3X3N A;  2RDG A;  1K8O A;  3FPU B;  5C4H A;  2RKS A;  3I3C A;  4ULL A;  2F0G A;  2NN6 G;  4C2M B;  4IFD I;  4I65 A;  4A3K B;  2FFK B;  1LT5 D;  5ELB A;  1FR3 A;  4QUC A;  4RKL A;  3DUZ A;  1KDB A;  1UUP A;  3OMG A;  3MTS A;  5E4W C;  3QWN A;  2N88 A;  2D5D A;  1EZ6 A;  2EZV A;  1DJR D;  1BDO A;  2EPB A;  3P1H A;  2BCO A;  4FYD A;  1HPC A;  4A3F B;  2H4O A;  3V05 A;  5LL6 X;  1AP0 A;  3C2P A;  4A3B B;  3QB3 A;  3I70 A;  4CJ2 C;  5EBC A;  1U4M A;  2XWJ B;  4IFD H;  2AQ1 B;  3P7J A;  1OXU A;  5DNF A;  4K8I A;  3KLS A;  1FYC A;  1IW7 C;  1AN8 A;  4IQZ A;  2AQ2 B;  1I4P A;  3A7A B;  3NXW A;  2A68 D;  1D1K A;  3D4W A;  4R9W A;  2L4N A;  1O78 A;  1VCI A;  4B08 A;  1BCP F;  5T1G A;  4BWG B;  3CRL C;  3SXH A;  1LTA D;  2HCI A;  4UAI A;  4X3S A;  1GUS A;  4BY7 B;  1HTP A;  4I7Z C;  3QIA A;  2MP1 A;  2IW3 A;  1RCV D;  5EBD A;  3C1E A;  1S4Z A;  1QNU A;  5M5W B;  1EY7 A;  2EDG A;  3N6R A;  4RKB A;  1Z47 A;  4RCN A;  1EL0 A;  1XXG A;  5LL6 S;  5IGG A;  1H9K A;  1G2T A;  2HCC A;  2O4X A;  3M7G A;  3DEO A;  2JEA I;  5ELF A;  5IGF A;  1I4R A;  5CV9 A;  1F9P A;  3QO2 A;  3TSS A;  1IYV A;  2NB0 A;  2EYH A;  5KGU A;  1XX8 A;  2JXM B;  2F0Q A;  1TWH B;  2VXW A;  5G3L F;  3D3R A;  4ZUJ A;  3P20 A;  3SK6 A;  4CJ1 B;  4NP5 A;  2NVQ B;  4IZ8 A;  4LAA A;  2YU9 B;  3GTL B;  2XRS D;  3C1F A;  1WD1 A;  1PFM A;  3KF8 A;  3RZO B;  2WV6 D;  4DU9 A;  1S5B D;  1TWA B;  5IGC A;  2EJF C;  3T16 A;  3C46 A;  1TS4 A;  1D2B A;  1SJE D;  1DYQ A;  4DN4 M;  2ID0 A;  1B53 A;  1TS5 A;  2B2V A;  1OXT A;  1DCZ A;  3TP7 A;  3GO5 A;  3C3L A;  1KNE A;  1PFB A;  1X3P A;  1CQV A;  4FO2 A;  4OHJ A;  1S5D D;  2PMZ B;  4KN7 C;  1ZKO A;  1A3U A;  2R7Z B;  2ZXP A;  1SEB D;  2IX1 A;  1Q1B A;  4ZYS A;  2L1B A;  3ITP A;  4ZLT F;  4HCE A;  2WII B;  4CKC A;  1SNM A;  3ND9 A;  3D6W A;  1SSO A;  1HUN A;  3PMF A;  5F2D A;  3T13 A;  5A2Q E;  4ILW A;  4QCL A;  4DAY A;  1SYE A;  1VDZ A;  2I46 A;  1LT6 D;  2F0J A;  5JEA J;  2K7V A;  2D2C C;  1WVL A;  4C3I B;  1PTO B;  5JVG 3;  5EQ0 A;  4WRD A;  3BVM A;  3PIP 3;  3JAM E;  4KJN A;  2NVY B;  1GXD C;  1EY4 A;  5ISR A;  1I4Q A;  3JAM L;  3R3O A;  2PNR C;  1CK1 A;  2XRQ D;  3D31 A;  5EKL A;  1A15 A;  2F0H A;  2NTT A;  2NVT B;  4K8J A;  1LTR D;  1BUV T;  5KEE A;  1D1I A;  2K01 A;  3HG9 A;  4RGN A;  1IL8 A;  2ENB A;  2WKC A;  2KEE A;  1H9S B;  1A3T A;  1B2T A;  2EYL A;  3IL8 A;  1BF4 A;  3VA5 A;  1QWY A;  4A3G B;  2R93 B;  4DNR B;  5CBA E;  1YNN C;  4C1N K;  2D62 A;  1VF7 A;  1BOS A;  2AQ3 B;  4BBS B;  1E2W A;  2EE1 A;  2EY5 A;  4DF7 A;  3PUW A;  1F9Q A;  3E6Z X;  3NP8 A;  2EYO A;  1SNC A;  3WOE A;  5IOC A;  2E2J B;  2DNC A;  4RHR A;  2KQ3 A;  3OOC A;  1FD7 D;  1OXX K;  2L55 A;  1ZEQ X;  4CGY B;  4KTA A;  1QNK A;  5I6W A;  2QF7 A;  4AYB B;  1MI2 A;  3MXU A;  1EYA A;  3GTQ B;  3P75 A;  5IGB A;  3PV0 A;  1HA6 A;  1SYD A;  1KLG D;  1HFN A;  2FMM A;  4DXG A;  1RHP A;  3TBI B;  3HOV B;  1JIC A;  1V1P B;  2KCN A;  3CU7 A;  3GTO B;  1BR9 A;  3AU7 A;  4KN4 C;  3BG3 A;  3BYY B;  1LAC A;  5KIX A;  2SNS A;  4WOR A;  4FVM A;  2ICI A;  2Q8R E;  2A74 C;  1AW7 A;  1U4P A;  2Z4I A;  1LTI D;  5M5Y B;  5CR3 A;  1DD2 A;  1V43 A;  5J1Z A;  3K5L A;  1Y69 U;  3A56 A;  1ROD A;  4H44 C;  3NE5 B;  5IGE A;  3K6O A;  4MHE A;  5I9O A;  3X3M A;  2FMC A;  3K5N A;  5K5P A;  1MD2 D;  3I73 A;  1NUC A;  2R3Z A;  4NW2 A;  3OMC A;  3MHB A;  2MJ8 A;  4E6I A;  2Y0S B;  3R8B A;  4KHV A;  1ENC A;  3HZX A;  1TR5 A;  2B8G A;  3QOL A;  1SMY C;  1STA A;  1W6J A;  4RCO A;  4WFN 3;  1KLU D;  4H7B A;  3DMU A;  2MUY A;  4TQU S;  2JA7 B;  2L12 A;  2E74 C;  5CV7 A;  4QIW B;  1YNJ D;  1RTN A;  3CKI B;  3S1N B;  5C5L A;  1CA5 A;  3Q22 A;  1MSH A;  3BZD B;  3PO3 B;  1CFM A;  5FO9 B;  4L63 B;  2A68 C;  1EOT A;  2F0D A;  3LNN A;  1GUW A;  4HSP A;  1SE3 A;  2NVX B;  1QCB D;  3MXP A;  4U68 A;  2ZXO A;  4QF4 A;  5C4X B;  3KLR A;  3QOJ A;  2LY7 A;  5C3X A;  1FGB D;  3L7Z C;  3TP6 A;  1R4Q B;  1TS3 A;  2F1M A;  4FXD A;  3A7L A;  1LTB D;  1I6V C;  5HUR A;  2OEO A;  4EVO A;  1QB5 D;  1AZQ A;  2PCF B;  5J39 A;  4XYQ A;  2KA7 A;  2EJM A;  1ICW A;  5FLX L;  1QG7 A;  1ML0 D;  2J0T D;  2F0W A;  2LFN A;  2RSO A;  1B9N A;  1KDA A;  1AFP A;  2E76 C;  1TWC B;  4G57 A;  5IT9 E;  5CV4 A;  3W2D A;  5FLX E;  2Z8L A;  3S1Q B;  4XIG S;  5DM7 3;  3K5M A;  4MIU A;  4WJW A;  2JA6 B;  3L9A X;  4JBW A;  3OW7 A;  3T53 B;  3I4L A;  3R2T A;  1E2Z A;  2VB2 X;  1PXU A;  1EWC A;  2VB3 X;  3NQT A;  5C4Z A;  1B44 D;  3J81 L;  2L11 A;  1XWE A;  3N52 A;  1RD9 D;  4M1U B;  3PUV A;  2RVL A;  2KED A;  1HTL D;  4PMW A;  5CBE E;  2LKV A;  1RDP D;  5HGT A;  3J7Y W;  1IKL A;  1EY6 A;  3FVQ A;  1M8A A;  2LMC B;  1UNS A;  1T5E A;  4TSS A;  1EU4 A;  4FF2 A;  3H6M A;  2EYM A;  3LWE A;  5C6A A;  2KJX A;  3SE0 A;  5COY A;  2EVB A;  4NMZ A;  3M4O B;  1ONL A;  3OSO A;  1JB3 A;  3E5S A;  2IT1 A;  1I4H A;  2JE6 I;  3EJI A;  2EOT A;  1DM0 B;  3S14 B;  2MHV A;  5DM6 3;  1ZYR D;  5ELC A;  2FHT A;  1NAP A;  5AFW A;  4XT3 B;  5EJW A;  2HQE A;  1SJH D;  1XYI A;  3S1M B;  2NYZ D;  1G91 A;  2QIL A;  1A2T A;  3EVQ A;  5EPJ A;  3VYR A;  3NPP A;  3S2D B;  2NUC A;  3D4R A;  4A3D B;  1EIG A;  1Q1E A;  3I91 A;  4K5W A;  1SND A;  1JR0 D;  1O7Y A;  1SNP A;  5M9O A;  2B2U C;  3J7A F;  3MWY W;  5KYL A;  4K6D A;  3FRP B;  1WTQ A;  4HN7 A;  2A6H C;  1X3Q A;  4ODG A;  1GHK A;  1CHQ D;  3NQI A;  4ZKC B;  1PZJ D;  3ERQ A;  3A8I E;  3LWU A;  1EZ8 A;  5C5M A;  1SYG A;  5KNB A;  5A35 A;  5KYI A;  4CKE A;  3VYS A;  3LX0 A;  2BE5 C;  4K5X A;  2IWH A;  2EY2 A;  1S5E D;  1F2M A;  3H09 A;  4IUU A;  1PFN A;  1AEX A;  1HQM C;  1SBB B;  2NZ1 D;  3OIP A;  4F87 A;  1E0B A;  5NUC A;  1GUN A;  4IN3 A;  1TU2 B;  4OIK A;  1S5C D;  5EGT A;  3K0Y A;  1CM9 A;  4M8A A;  5JOB A;  4CHT B;  3GV3 A;  3IKJ A;  3GTK B;  2ZT9 C;  2Z4H A;  4O1N A;  4R8I A;  1IHZ A;  4ABN A;  1WD0 A;  3NUC A;  4DAV A;  1UEA B;  2BOS A;  3EFX D;  3EQL C;  3WDN A;  4EQN A;  2XVS A;  2L5T A;  3A8J E;  1BQQ T;  5T1I A;  4DAP A;  1D5M C;  2PZW A;  2F3W A;  1PZK D;  3QG1 A;  1PLF A;  1EY9 A;  5JAV A;  2QDB A;  4PNY A;  4HSV A;  3KBX A;  3T51 B;  2BDN A;  1V1O A;  5I6Y A;  4G7Z C;  3ONA B;  4RFB A;  1WTX A;  4CJ0 B;  3FEW X;  2XNA C;  2XIW A;  1DOL A;  3CQZ B;  1ENF A;  4C1N I;  3M4Y A;  3SK5 A;  2JYO A;  2JA8 B;  2R92 B;  4RGO S;  3V96 A;  2TMP A;  3A54 A;  1K83 B;  2QKI C;  2G9D A;  4OGQ C;  4FF4 A;  1HQR D;  2CHB D;  1TII D;  3T56 B;  1D5X C;  1SYC A;  2L9H A;  1F77 A;  3J80 L;  2DY7 A;  1CQF A;  2WB1 B;  4G4K A;  3H94 A;  4DK0 A;  1PTO D;  2EYF A;  1WTW A;  4XQQ A;  3MEH A;  1PRT D;  1DZ1 A;  3M85 A;  2B2Y A;  4KKU A;  1Y8P B;  1CT1 D;  3FKI B;  2WKD A;  3M3Y B;  5BN3 A;  4BS9 A;  3MA2 B;  3R2I A;  1LTS D;  2MGS A;  5E3F A;  1X32 A;  3TZU A;  2F3V A;  1C4Q A;  4XQN A;  3CHB D;  3RLF A;  4DXF A;  1B9M A;  5I9P A;  1EIH A;  3E0J A;  3D6C A;  2E2D C;  4HCS A;  3F2U A;  2YYZ A;  4IUT A;  2EYP A;  1STG A;  1CZW A;  1J8I A;  2NBF A;  2NN6 H;  1OXS C;  1EQT A;  4BA2 I;  4IAL A;  5EKK A;  3R93 A;  2C5C A;  4G7O C;  1S5F D;  3GQB A;  2VUM B;  1F2Z A;  3K58 A;  2L0C A;  1WTR A;  2PZT A;  3HOU B;  1GUG A;  4LJZ C;  4CKB A;  4C3H B;  4FF3 A;  4KD4 A;  4HMJ A;  1R9T B;  4B9W A;  1NR4 A;  1QOH A;  4XDX A;  3NHH A;  2B2U A;  3OWF A;  5KNC A;  1V8Q A;  2K1B A;  4A3M B;  1MGS A;  1EYC A;  1EYD A;  1FNW A;  3VR3 A;  1SE2 A;  3HP3 A;  1QJO A;  3J7A V;  3J80 E;  4RA8 A;  1STB A;  4ZKB B;  3G6J B;  1PZI D;  1GJX A;  4RHS A;  1G8Z D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...