3D8GA

Crystal structure of staphylococcal nuclease variant delta+phs i72r at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
130
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKREVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Arginine residues at internal positions in a protein are always charged.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mw2
molecule tags Hydrolase
total genus 35
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d8gA00
1A3VA 3MHBA 5I6YA 1A2UA 3P1HA 2PZTA 4KV6A 2EY6A 1AEXA 5IODA 3OWFA 5CR3A 5C3WA 1SNQA 3SK6A 4F8MA 4K14A 2WACA 1KABA 4B9XA 3D8GA 3T13A 5KGUA 1STBA 2OF1A 1A2TA 1TQOA 3NXWA 1EY6A 3BDLA 4IZ8A 1EY5A 4RKLA 3T16A 5IGCA 1EYCA 1ENCA 2F0GA 5CV4A 5CV7A 5KIXA 1STGA 4K8IA 4TRDA 5C6AA 5EKLA 4E6IA 3V2TA 5CV8A 1STYA 2EY1A 2F0DA 3LX0A 3EJIA 3OSOA 3NHHA 2SNMA 2SOBA 3H6MA 2O4XA 5J22A 5E3FA 5J1ZA 3DMUA 5CV5A 4WORA 3SHLA 4KD3A 1NSNS 1F2MA 1EY0A 2F0UA 1EYDA 2F0WA 3PMFA 3NP8A 5C4HA 1STAA 2F0FA 1EZ8A 2PYKA 4K2KA 1EZ6A 3R3OA 3TP6A 1JORA 1JOOA 2OEOA 3QOJA 3C1FA 4QF4A 5NUCA 4KY6A 4B9WA 5I6WA 1TR5A 1SYDA 4KD4A 1F2ZA 2EYHA 2EYFA 1U9RA 2NUCA 4HTHA 4K5XA 5DEHA 4ZUIA 2RDFA 1EQVA 4KJNA 4ZUJA 4K2LA 4ME5A 5IIFA 2EY5A 4IALA 4K8JA 2F0EA 4K6DA 3C1EA 4HMIA 5EKKA 5F2DA 5C3XA 5KYIA 4J6HA 5KYLA 1EY7A 5M9OA 3NQTA 4S3SA 4DU9A 5ISRA 2ENBA 2PW7A 5IOCA 2EYPA 3TP8A 4N9PA 3E5SA 4ID6A 1KDBA 3U9OA 1A3TA 4LAAA 1EY8A 3D4WA 2LKVA 2EYOA 3HEJA 3TP7A 5KEEA 4KY5A 4ZQ3A 5IGFA 1SYFA 5CV9A 5IGGA 4J1MA 2F0JA 5C5MA 1JOQA 5IGDA 4KJOA 4EVOA 5CC4A 1JOKA 2F0VA 3D4DA 1II3A 4NMZA 5EGTA 1SNDA 1SYGA 4PMCA 1IHZA 1F2YA 1NUCA 3OMGA 3EROA 1SYEA 2EYJA 2M00A 3QOLA 4KY7A 2EYLA 4H7BA 3SK8A 5C4ZA 2OXPA 2PW5A 2RKSA 4R8NA 4QMGA 1TT2A 1STHA 2EYMA 4G57A 5I9PA 4N9TA 4IUNA 4PMBA 4KHVA 1ENAA 4DGZA 5JAVA 2F0MA 3MZ5A 4KTAA 5HURA 5KRUA 3TMEA 4DF7A 2F0QA 1SYCA 3MXPA 2F0LA 2QDBA 1SNOA 3QB3A 4MIUA 2RBMA 2F0KA 2F0IA 5E1FA 2EY2A 2F0OA 3ITPA 3S9WA 4F7XA 3EVQA 4HMJA 2F0HA 1EY9A 4NKLA 2PQEA 2F0SA 3RUZA 2F0NA 5J39A 3HZXA 2KHSA 1KDCA 2PZUA 4WRDA 5IGEA 1RKNA 5CV6A 1SNPA 3SR1A 2F0PA 2PZWA 1A3UA 3P75A 3SK4A 3SXHA 4EQPA 2F3VA 4RKBA 5C5LA 5CGKA 5K5PA 2SNSA 3MVVA 3DHQA 4K5WA 1EYAA 4NDXA 3VA5A 1SYBA 5IGBA 3D6CA 5HGTA 4I65A 4YIJA 4K5VA 4PNYA 3ERQA 4OL7A 4QB4A 4DFAA 5JOBA 4EQNA 1SNMA 5DAUA 2F0TA 5I9OA 3SK5A 4EQOA 2KQ3A 2HQEA 3OMCA 3BDCA 2F3WA 3NK9A 1SNCA 4NP5A 1KAAA 1EY4A 2EXZA 1KDAA 1STNA 3MEHA 3TP5A 3NUCA 4ODGA
chains in the Genus database with same CATH superfamily
2CVRA 1VQIA 1A62A 4RGNA 1FJGL 3A5ZB 3ULJA 4J15A 4JI6L 2YYZA 4HEDA 5BN3A 2GVAA 1O7ZA 4G4KA 2LXJA 1Y69U 3K58A 1Q1BA 1LT6D 2O5IC 1JE4A 2F0DA 3K8AA 5IP9H 3EJIA 1RF2D 5J1ZA 4L5QA 3PO3H 4WORA 2WKDA 3HKZB 1CM9A 2ZJRA 3U4ZA 2V1CC 1S3OA 1SE3A 3OTOQ 4LF5Q 1WVLA 2I5MX 4FF1A 3HOVB 4DV2Q 4OX9Q 4QF4A 5NUCA 1DONA 5IWAQ 3J81E 1YITA 2A19A 4HTHA 2UXDL 4NXMQ 1QCBD 1D5MC 2YTXA 1MIUA 4DXFA 4OEMB 2F0EA 5F2DA 5KYLA 2EVBA 3QWNA 3RZOB 4DV0Q 1N33Q 2EXDA 1Y8OB 1WYDA 4HIKA 1A3TA 5K36H 3GDEA 3TP7A 4GLVB 4ZRZA 4HSPA 2R7FA 4EVOA 5CC4A 2DUDA 3DM1A 2OWOA 1WTQA 3PO3B 3AQQA 4YWLA 2OXPA 4DV4Q 5I9PA 4OWXB 5ELCA 5D14A 5M3MB 1VQ4A 3HRZC 2JA8B 3H94A 2AQ2B 3QB3A 2F0IA 2B63B 1P8LA 3G6JB 2MO0A 4IUVA 3W1BA 1DM0B 4LWCA 2A6HD 2B2YC 1RKNA 3R2IA 3EQLC 1Q3LA 4POGA 1D6EC 2R7ZG 1L1OC 4UY8C 1E1TA 3KJPA 1CSPA 5IGBA 1CQFA 1KIXA 3TS2A 4K5VA 3IFTA 3D0FA 1BCPF 3LWEA 1BR9A 1TWHH 1YHBA 3NK9A 3IAYA 4DV3Q 1STNA 1EQRA 1E3PA 2B2UA 3MXNA 5I6YA 1C0AA 3D31A 4PQXA 1Y8PB 4QIWB 1LT4D 2A68C 1L1OA 1WCMH 4A3EB 1UEBA 2KVMA 4LFAQ 1ENCA 3HKZE 2NB0A 4B3RQ 3ZJYC 4MN3A 1STYA 4EQPA 5LMUQ 4XQJA 3E6ZX 1TKWB 3AFPA 2NN6G 1PMRA 4JI8Q 2P5ZX 5C4HA 1CHPD 3A8JE 5ELBA 1PH4A 2K28A 3GTQH 1PH9A 3VR3A 1HNXQ 4R4TA 5IYCG 3C1FA 2VQEQ 4B9WA 1TWFH 4MNOA 1TWHB 2WB1G 3I4NG 2EDGA 2HHHQ 3M4PA 5EJWA 1CI3M 1PTOD 1GVPA 1KDBA 4LF6Q 2IWHA 1WTHA 1LACA 1EY8A 2PQAA 1YNNC 1JOQA 3CRLC 1MJEA 3OMGA 3T1HQ 2PMZB 3ONAB 2L11A 3M4OB 4JBJA 4JOIA 4G57A 3PIO3 1EEFD 4C2MH 3D6WA 5KRUA 3GTQB 2JYOA 4UAIA 1JWUD 1TWFB 5AJ3L 3CC7A 4MIUA 1G6ZA 1VQLA 2RBMA 4LFCL 3GTJH 1EQQA 4LF8Q 2L0CA 2N49A 3KYHC 2PZUA 2CH4A 3N6RA 3Q22A 1LABA 4KKUA 2F0PA 4PZ8A 4RKBA 1TWAH 3TQYA 3PUWA 1SE4A 5IYDH 5HGTA 5M5XH 1Q12A 1YHQA 3HOXG 3ZYYX 2AWNA 4EQNA 1IYVA 2UUCL 1H9SA 1UE5A 1PYWD 3MA2B 1E1OA 1EIGA 2VY3A 3T4AC 4QIWE 2XWJB 3S1NH 1A3VA 4A3MH 4L5SA 1JC7A 4GZYC 4LW1A 3OWFA 1C8CA 2B8GA 2VL6A 2XGTA 2WACA 1JJ2A 3D8GA 3D3RA 1STBA 4R4IA 1A2TA 2H1EA 3T16A 3F2BA 1VQCA 2BH2A 1BCPB 4G7HC 3GTJB 1B4OA 2X6GA 4E6IA 1I4RA 4AYBB 1BOSA 3V2TA 1WD0A 4JI4L 2G9HD 1K8OA 3S1QH 5DLQE 4N8FA 1NSNS 1WI5A 3A7AB 4ZCKA 4A3DB 1L2FA 1TWAB 4O0AA 1L0XB 4PV1C 3T1YQ 1Q46A 5M5XB 4A76A 2PI2A 2K5QA 3J80i 1TS3A 3BYTB 4DN4M 2UXCL 1S5DD 1OXVA 4YY3L 3S1NB 5C3XA 2A69D 3QIAA 3FRPB 5ISRA 4A3MB 5C4XB 2K5WA 1NR4A 1QNKA 1EL0A 1T5EA 4RMFA 1ESFA 3M4YA 4ZQ3A 2PMZE 2F0JA 3HGBA 2K33A 5HY6A 4KHPQ 1CKNA 1IHZA 4RCOA 4KY7A 4A3KG 1HPCA 3A8KE 2CWAA 5C4ZA 5M3FG 1UWVA 3IL8A 4H13C 5HGQA 4DAVA 1HTPA 4JYAL 1IZ6A 4OO1G 1TWGH 2F0LA 5DM73 1KLGD 3EIVA 3ULPA 1GUGA 2NTSA 2DNCA 1MBYA 3NEMA 4C3HH 1CFMA 4JBWA 2IJ0A 4F7XA 2R7ZH 2DNEA 3K6OA 4RFBA 4Q0FA 2NVXH 5J39A 1V43A 2Z8LA 1FR3A 3MXUA 2N8NA 3SK4A 2O5JC 4RGOS 1SROA 3A8IE 4GKJL 1LTGD 5K5PA 2VQFQ 4NDXA 3MEFA 3G7LA 3GO5A 3CP0A 2WIIB 4YCUA 4P75A 1RDPD 3M4QA 3S1RH 4U68A 1NMGA 4KHZA 1Q81C 1YVCA 4OONA 2MP1A 4DR6L 3L7ZC 1G51A 4KV6A 1B8AA 1PA6A 1QZHA 1TY0A 1TWGB 4YHHQ 1JQYD 1I94Q 1M90C 5IYBG 3W3AA 4AYBE 1Q7YC 4XIGS 4C3HB 2I0QA 2F0GA 2GA4B 1XWEA 2EY1A 3TS0A 3LX0A 2NVXB 3HKZG 2O4XA 1WD1A 5IYCH 1SJED 2ZM6L 1SSOA 1PFBA 1B1ZA 2A73B 1K3BC 1Q90A 1U4LA 3HOVG 4HR7B 1PRTF 2Z1CA 4DK1A 2K6AA 2MNAA 3MFYA 2PO4A 1NR2A 4K5XA 2EYFA 3BU2A 4ZUIA 5GAGC 4DR4Q 4X62L 3S1RB 2BDNA 1F9RA 2B8FA 2J4XA 1FD7D 2EY5A 2Z6BA 5C44H 3CC4A 2K50A 3CCSA 4DU9A 1YNXA 3G71A 5EPKA 1Q1EA 2K5DA 4GOPC 5D65A 1UEAB 4HJ8A 3VA7A 2RVLA 2ICIA 3A74A 2BE5C 1SE2A 5LL6X 1JT8A 3H3VI 4B3SL 2HCIA 3S1MB 1HTLD 1XMOL 2Q2UA 1IL8A 5I6WA 3M85A 3PO3G 1XNQQ 1ZYRC 2NZ1D 2Z4HA 3CMAA 1LTSD 1D1KA 1TT2A 3FHWA 3NQIA 4PMBA 5M3MG 1YNJC 2QEJC 1LTAD 2E76C 3MZ5A 4A3JB 2JA8G 3TMEA 4X66L 5GAHC 3C2PA 2RHSB 3I73A 3UDXA 2HDMA 5IT9L 2B63G 4DV1Q 4NW2A 2WAQB 4DUZQ 1B3AA 5AFWA 1OXTA 1XPRA 1GUTA 4HMJA 2NVTH 2F0NA 5C44B 1A6XA 2YU9H 4A93H 1R9TB 5CV6A 1SNPA 5KNCA 3HOXH 1MGSA 3I55A 4ME3A 3T53B 1PH5A 1HZ9A 3CCRA 5K36G 5C0XI 1EYAA 3SDZA 1PH2A 1PH7A 2CW0C 4IQZA 4FF3A 3I4MG 3ERQA 3HOUB 4DFAA 3J80L 1N32L 4EQOA 2HQEA 1PRTC 2VZAA 2KA7A 3BVZA 4CDEC 4GOPB 1PH3A 2F3WA 1BKBA 1SAPA 3H0GH 2XNAC 3KDFA 1KHIA 2J7ZA 4NMZA 4JI2Q 1TWCH 3RN2A 1WTPA 5JJKA 3L0OA 3F2UA 1VQDA 3CW2C 3GTPH 3SK6A 4A3EG 1VQHA 1JB3A 5E7NA 1HXYD 1JJGA 4LF9Q 3I4LA 5CV4A 1PXUA 1STGA 2ICEC 3HKSA 3NPPA 2NVTB 5CV8A 2D0OA 2Z0SA 4LF7Q 4A93B 2Z6KA 4DR3L 2K52A 3U4VA 2K5HA 5GADC 2F0FA 3DWAA 3CXCA 1YJNA 4J8QA 4BY7B 1CUKA 1VF7A 1RIPA 4BBRB 4RA8A 1SYDA 1BO0A 1F2ZA 4HCSA 1U9RA 2QGQA 3K7AB 2D9UA 3D4RA 1B9NA 3H0GB 4GNXA 5FO8B 2X6LA 3P7JA 3C1EA 1K0SA 1ESRA 4QCLA 3LGJA 2ENBA 3HOYB 3F1ZA 5FJ8H 3TP8A 3GTPB 3V05A 4DV7L 1SFOH 1KL9A 4CDFC 4DAYB 5IGFA 4B3ML 3D4DA 2F0VA 4G7ZC 4K0KL 4L8JA 1TXYA 2ZTEA 3CCVA 5A35A 1LUZA 2OQKA 4R4QA 2LSSA 2IPKD 1GHJA 4JV5L 4QMGA 5G3LD 1AZQA 3J7AF 1FJGQ 4IUNA 4DGZA 4IOAA 3KFUA 2ZXOA 2WAQE 4HJ7A 2FXQA 2RA4A 3URYA 4IJLA 2IX1A 4PMWA 5JJZA 4AIMA 2F0HA 1JB7A 4QGUA 4DK3C 1TS5A 2NZHA 2KHSA 1PH1A 2NWGA 5GQOA 1PZJD 2DGYA 1ASZA 1IBKQ 4C1NI 1U0LA 2LY7A 1SFOB 5GROA 3OPOA 4DR5L 4PNYA 2F0TA 1IKMA 4CJ0B 2B2TC 4A3LH 4OIKA 2TMPA 1Z7TA 4YCVA 2DN8A 5IYBH 1HZAA 2PZTA 1JWSD 5CR3A 1SEBD 4A3CG 1MHWC 4XQNA 1Q86C 2IL8A 1TQOA 1SXTA 2E5LQ 1EY5A 1KAWA 1Y1VH 2C35B 4DPGA 4QUCA 3M7NA 1LTRD 4ZKCB 3W2DA 3HOVH 4MTKA 4A3DG 1HZBA 3ND8A 1Y1WG 3PUXA 1H95A 5IYDG 1ZXTA 3QJYA 5JJIA 1KRSA 1EZ6A 1EU3A 3RLOA 3TP6A 2WV6D 4C3IB 2K32A 1RTNA 3RZOH 2OCEA 1IBLQ 1LLRD 1I6HH 1KXLA 3NBIA 4UP9A 1EQVA 2YTVA 1X3EA 2XSCA 1S40A 4A3MG 2QILA 5C4XG 2B2VC 1JICA 2BA1A 5M5YB 3AB9A 1NNXA 3A55A 5FO9B 1JJCB 3D4WA 2RQXA 1Y1VB 1EWIA 5IGGA 4CHTB 1PH8A 2K75A 1XMQL 5M3MH 3E0EA 1XJVA 1I4PA 3EROA 2JA8H 2M00A 1PYSB 4H7BA 2JQOA 4BWGB 4M8AA 4QJFA 2B63H 2IW3A 2B3GA 3TBIB 3AMUA 2Y0SB 4PZ7A 5BR8L 2VB2X 5JAVA 5TSSA 1XPOA 4Y7NH 4HSVA 1PZKD 4APVA 1IBML 1F9SA 4BXXH 4JK1C 3HP3A 4JI0L 1I6HB 4DUYL 1GJXA 2FMMA 1U4MA 4DV5Q 1QVGA 1DD2A 1HR0L 3I4MH 2FMCA 2MFIA 5JVG3 1X9NA 4A3IH 3MVVA 3ICEA 4L5RC 2MQHA 1SYBA 5CBEE 1PV4A 2AQ1B 5D3DA 1E22A 1D5ZC 2ZXRA 3SK5A 4MHEA 1WTOA 4JI3L 1V1QA 4A3EH 3QO2A 1KAAA 1B53A 1A15A 1NBWA 3M3YH 2J0TD 3NUCA 3TZUA 4FYDA 2MGSA 2EIFA 1L0WA 3OW2A 3KUPA 2JA7H 2Q2HA 3JC66 4Y7NB 4F8MA 4HJ5A 2RCFA 3OHXC 4K14A 3WOFA 4C3HG 5C4JB 3KK7A 2AUKA 1QVCA 2OTLA 2O2LD 5C6AA 5EKLA 4Z9CB 4R4OA 1QE6A 1SMYD 1V1PB 1B44D 2JA9A 3VDYA 3NHHA 1SMYC 2GVBA 2RSNA 2R92H 3I4MB 5EPJA 1STEA 1CKOA 2K4KA 2L5TA 4A3IB 4CJ2C 3G48A 4DR2Q 4X65Q 1DYQA 4R4CA 2B2YA 2OEOA 3FP9A 3QOJA 1GD7A 2PPBC 1XNRQ 4QL5A 3TN2A 2A68D 1Z47A 5AJ3Q 4BY1B 3E3XA 4KD4A 4BBSB 1A0IA 4O42A 3OTOL 4LF5L 3M3YB 1X65A 4HMIA 5ELDA 3ND9A 4DV2L 4OX9L 4X6AH 1AW7A 3BZKA 5IWAL 5CORA 3PV0A 4N9PA 2JA7B 1AE3A 2OT2A 3I7FA 3M4OH 4NXML 2ALYB 2ZJQA 4P71A 5KEEA 1KLUD 1Q8KA 1JCKB 3TDQA 4J1MA 3PIP3 3PQIA 3PIOA 1FGUA 4X3UA 5EAYA 2XWBB 1NY4A 2Y0SE 4DV0L 2R92B 2FHTA 3K5MA 3OOCA 4UP8A 1V1OA 2N3SA 3Q24A 2MHVA 4A3JG 5J3BA 3CRKC 4JI5Q 2UXBQ 4KTAA 3GTKB 4JVZA 2JA5H 4NXNQ 2JXMB 3G4SA 4IPCA 2WAQG 3RMHA 2ZTCA 2DJFC 1U4RA 1XXGA 2FJ2A 5E1FA 1OXXK 2E74C 2EY2A 2IT1A 1MI2A 4DV4L 1YNND 3CAMA 5C44G 1D7QA 1EY9A 2PQEA 4JCVE 2IY5B 3MXNB 4X3KA 2Q8TA 1E24A 2ASBA 3F8TA 4CJ1B 4A3FB 1VQJA 3S2HH 2F3VA 1N8RC 1KRTA 4ABNA 4EX5A 1HCZA 1PFMA 1BCPC 5I2XA 4K5WA 1D1IA 3HOUG 3FKIB 1SMXA 4PZ6A 4XDXA 2A8VA 4JI1Q 1VCIA 2L1BA 2UUBQ 1LO5D 2Q2IA 1VF5C 4A3CH 5BN5A 2EPBA 3F2DA 5IE8A 2ES2A 4IO9A 4FO2A 3CCMA 5DNFA 3E9IA 4H0LC 4IOCA 2JA5B 1VQBA 3IKJA 3HG9A 4A3DH 4DV3L 4DK6C 1VQGA 1Y1WH 2AHOB 4A93G 5FLMG 2K04A 2I46A 1BBUA 5JEAG 3J81L 2G5DA 3J81c 1QUQB 1GKHA 1UAPA 3S2HB 4DR1Q 1CTMA 1ENFA 1AE2A 1F9PA 2HQLA 4LFAL 4BY7G 4BBRG 3P20A 5A2QL 3NBHB 1XTDA 1J5EQ 4B3RL 1KNAA 2A1AA 3JAML 2A74C 5C4XH 5LMUL 3JAMc 2UUAQ 1PZID 2E2IH 4P72A 1TR5A 4N8X1 1IYJB 3H0GG 4JI8L 1O7IA 2RDFA 4JPBW 4ME5A 1MSHA 2FFKB 2RSOA 5EQ0A 3CPFA 5FLXE 1HNXL 3HOYG 2VQEL 5CBAE 4WJ3M 1VS0A 2HUGA 2H4OA 4JI7Q 2HHHL 1IW7C 2EJGC 2YV5A 1N34Q 1YJ9A 1Y1WB 1Z9FA 4IUQA 3CCQA 4MZ9A 2MUYA 2VXWA 1II3A 1SYGA 5IT9E 1F2YA 3QOLA 2D0PA 4LF6L 1X3PA 5C3EB 3S15B 3AFQA 3UI2A 1EWCA 4FVMA 4BA2I 3MXPA 2E2IB 1SNOA 1J6QA 2UU9Q 3RNUA 4DNIA 1GXDC 4KK7A 1RL2A 1I50B 1VQNA 1FVIA 3J80E 2ID0A 5FJ8G 2VUMB 2GN5A 4L63B 1K3RA 2KCNA 4RH6A 3S17H 4B3TQ 1I4GA 2PZWA 2ZM6Q 2JEAI 1JR0D 1U4PA 2JP1A 5CGKA 4LF8L 4H02A 1PFNA 2R93B 3GTMB 2YTYA 2EE1A 1D8LA 3KLRA 1VMPA 3OMCA 1YI2A 4X62Q 3K80C 1EY4A 1ICFB 2EXZA 1K28A 3MEHA 3KJOA 2D62A 2QA4A 5E4XA 3KF6B 1SJHD 1T5XD 3K5OA 2N78A 1HA5A 1N36Q 3X3MA 2JSOA 1T9HA 1EOTA 4EQ5A 5IP7H 4DV6Q 2R7DA 1W2BA 3DUZA 4B3SQ 1QOHA 3W1GA 1DOMA 3U58A 3H3VC 2SNMA 1Z6HA 4GN4B 4KI0A 2CH4W 3S17B 5JEAJ 2K05A 5DM63 1EY0A 2IHEA 2G9DA 1D5XC 1STAA 1YBYA 4C3IG 3CF5A 1VMCA 1X56A 2FINB 2KJXA 3RD4A 3H3VH 1A8VA 1XPUA 1XYIA 1CA6A 4A3LG 4RGTA 1CKNB 2I5HA 2NUCA 1C7YA 2F03A 2PNRC 4XYOA 1QG7A 4X64Q 1HRJA 2EJFC 4AQYQ 3T1YL 3S1MH 5EKKA 2KUMA 1RCVD 3TSSA 1QJOA 2B2WC 3KF8A 4A3GH 2EYPA 1G91A 1M1KC 3I90A 3E5SA 1OTCA 2BOSA 2B39A 1Y1VG 1HFGA 3RN5A 1X3FA 2PNHA 4A3JH 1DCZA 2CWPA 3A54A 4EGVA 1NTGA 3CKIB 1IL2A 2Y0SG 4L5TA 4R8NA 1XTCD 3J7A5 2C5CA 1STHA 2KBNA 4LUZA 4N9TA 1ET6A 3SE0A 2B2WA 2KHJA 4KLKA 5C0XH 4FXDA 4KHPL 1SE8A 4PG3A 1R9TH 3HS0C 3G6EA 2BE5D 3PSIA 4DR7Q 1G2SA 3UE0A 3RUZA 1HQMC 3VR2A 1ZKOA 3M7GA 2QKIC 4UDUC 3HZXA 4WJWA 3HOUH 1KNEA 4H44C 1ZYRD 4A3GB 1M8AA 1CSQA 3WWVA 1HNWQ 4FF4A 3DHQA 3K5NA 1YNJD 2MPMA 4YIJA 1HHVA 4LF4Q 4IFDH 4M1UB 1V8QA 4GOPA 1KQSA 3CMEA 1FNWA 4KN7C 4RG1A 3CD6A 1O7LA 4GLXA 3H09A 2VQFL 1JWMD 3PUZA 2PI2E 3MHBA 1O80A 1M4VA 1S5ED 4C56C 3GTGB 2EY6A 1I4QA 1AEXA 4TSSA 5BN4A 1SNQA 4IUPA 4BXXG 1VQEA 5FLMH 2NN6I 1BUVT 2M2LA 5JEAH 5ELNA 2RDHA 3NXWA 1EY6A 3NENA 3VYSA 2CW0D 5ELOA 4K8IA 4BY7H 4BBRH 2WKCA 4YHHL 1PRTD 2EOTA 1I94L 3DMUA 3FDTA 4A3IG 3K7AH 2JK8A 1IYUA 2L9HA 2XIWA 4DXGA 1HH2P 4HIDA 1VQPA 1EFID 1HNZQ 2F4VQ 3I3CA 4GKKL 4BY1G 1NMFA 3CCUA 1VQ6A 3HOYH 4BBSG 1GM5A 2EYHA 3K0XA 1PHJA 4RAUC 4IFDI 4J6HA 1EY7A 3NTKA 1E7ZA 4S3SA 2JA7G 1KTKA 1W3SA 5G3LF 4DR4L 1SRUA 1TS4A 3B6YA 4DAYA 2K5NA 1HUMA 2K14A 3S14H 4RGMA 3R2TA 4A4IA 1WTRA 2R92G 1F9QA 3W5OA 1C9OA 5FO7B 3GP7A 1ONLA 1SLJA 3NE5B 4KHVA 3K81C 5HURA 2OTJA 5ELFA 2QF7A 5LMNQ 2QCPX 4G7OC 1BXTA 1XNQL 2QDBA 5T1GA 2F0KA 4KN4C 1GUWA 3VYUA 1TIID 3KDFB 3K57A 1S5BD 1DOKA 4A3FG 3I4OA 4LFBQ 2MO1A 2ZT9C 1CA5A 3PUVA 4DV1L 4ZLTF 4DUZL 4ZAIA 3FKIG 1K8GA 5FKAC 1J8IA 3S14B 3D6CA 1NE3A 4OL7A 2N88A 4JG2A 3MWYW 4JI6Q 5KNBA 2A6EC 3S2DB 1O7YA 4R1JA 4FP5D 2KCTA 4X3TA 2JA5G 4I7AA 3HFZB 2F4IA 1WTXA 1HA6A 1QZGA 1LT3D 4CBVA 3UDGA 2M9VA 4IPDA 2OF1A 1HZCA 3J7AV 4JI2L 1HJPA 4TRDA 4JBKA 1U5KA 1ICWA 2C9OA 4C3IH 2EQSA 2MJ8A 3SHLA 1PH6A 3T56B 3SEBA 5ELEA 2DY7A 2NTTA 2UXDQ 1HUNA 3I8ZA 3K59A 1ZEQX 2L55A 3GV6A 4K2KA 1VQ7A 3KOJA 5M5YH 1TU2B 3H15A 4LF7L 4KY6A 3FMCA 3BVMA 2L4NA 1RODA 1UE1A 2HDLA 2KCMA 2V4DA 3KLSX 3C46A 1FL0A 3VR4A 4K2LA 4BA1I 1K83H 1LM0A 1I3QH 2F52A 1ASYA 3F2CA 5IOCA 3BG3A 1HR0Q 1H9KA 2B2TA 4YWKA 1J9OA 3CCEA 3OWEB 1YZ6A 3ERSX 2BH8A 2K03A 2CCZA 3CPWA 2JA6H 1G6PA 4OO1I 4K6LA 3Q8DA 1SYEA 1QWYA 5C3EG 3HOZH 2IHFA 4C3JB 2WP8J 3HOWH 4HJ9A 4OWWB 1DJRD 1K9MC 2NYZD 4XT1B 3STBC 1EIHA 1TS2A 3T51B 5COYA 2VUMG 1K83B 1KDCA 2F3IA 1I3QB 1QVFA 3SR1A 2XTIA 1VQ8A 3J81i 2XRSD 3CQZH 1S72A 1GUOA 2SNSA 2R93G 2B2VA 3VA5A 4OWTB 2JA6B 4UP7A 1BNZA 3Q23A 5JPMC 1JE5A 2HIXA 1B7YB 2XN9C 3JAMi 2KQ3A 1IBKL 3BVGA 3M9BA 2RCNA 3UDIA 5C4JH 1GHKA 4ULLA 5IY0A 3HOZB 3ULLA 4I7ZC 4A3BH 3VYRA 2CKZB 1ILQA 5C3WA 3HOWB 4HJAA 3E9HA 3T13A 2X69A 5T1IA 1IXRA 1PLFA 1Y8NB 3UE1A 5A2QE 5CV7A 1V1PA 2F1MA 2HD3A 3JAME 1UE7A 2KEDA 4HN7A 3GQBA 3OSOA 4ZK9B 4BY1H 1G8ZD 3ER0A 4JW0A 5CV5A 4BBSH 4DAPA 2F0UA 1EYDA 2E5LL 1GUSA 3GV3A 2AKWB 3CQZB 2Q2TA 5CYUA 3R3OA 1JORA 4OGQC 1WFQA 1ILPA 4QQBX 2JEBI 4OXPA 4FXKC 4A3BB 3VYTA 5JPNC 3NQTA 3PIPA 1I4XA 1VQAA 1IBLL 4ID6A 5IP7G 3C3LA 4POFA 2N55A 3HEJA 1PTOF 2K5VA 4KY5A 2D2CC 2B2UC 5C5MA 5IGDA 4ILWA 3PGZA 3GTKH 1AN8A 2A6HC 1S5FD 3U9SA 1I4HA 4FF2A 2RHQB 2Z9HA 4LFCQ 2EYMA 4QUFA 3L3OC 3NSWA 4F88A 4XTCS 2ZTDA 4A3FH 2VW9A 5FOBB 3SGIA 2VB3X 1VQKA 1I5FA 2TSSA 4V0BA 4CDCC 3PF5A 2F0SA 3FKIH 2HT1A 4A3GG 4DA2A 2UUCQ 4A75A 1A3UA 1TVXA 3P75A 2BDOA 1N33L 3PO2G 4R9WA 3L9AX 5LHY1 4GS3A 4DV5L 4U673 3O13A 3PUYA 5KNDA 3NELA 2PCFB 1G291 4IURA 1CK1A 1SDFA 2AMCB 1SNCA 3OW7A 4DKAC 3TP5A 5IGEA 5C0XG 1A2UA 4CKBA 4JI4Q 3AEVA 4QY7A 3A7LA 1KABA 1BCPD 1L1OB 1DOLA 4RKLA 3CCLA 1OXUA 2IX0A 5KIXA 4JOIC 4KMUC 2E2DC 1QUQA 1EIYB 1PTOC 1WCMB 1EFWA 2JJQA 3A0JA 4JC0A 5EPLA 4C1NK 3PMFA 1AFPA 3NBHA 2UXCQ 1EZ8A 4JBMA 4YY3Q 4IFDG 3MC0B 2Q8RE 1VQOA 4V190 3FEWX 1PTOH 4CKCA 2K7VA 4TQUS 4KJNA 3FVQA 4WFN3 1W6KA 4IALA 4DR2L 5I4DA 4RCNA 4X65L 1RHPA 3LNNA 5LL6S 3DM3A 1XNRL 1HFNA 1LTLA 1YEZA 2EJMA 4IPGA 1YIJA 3DXJC 3A5UA 1Q8IA 4LAAA 3J7YW 3BS1A 1C4QA 4ZKBB 2LKVA 5C3EH 3S15H 1I6VC 3E0JA 4DK0A 4JYAQ 3TEHB 2PQAB 2XVSA 3TRZA 1JOKA 5KGUA 1SNDA 3SK8A 3K7UC 2QEXA 5EBDA 1I50H 1BVSA 4DNRB 2F0MA 1K0RA 2Q8IB 2K01A 4DF7A 2F0QA 3L2PA 2VUMH 5JVH3 1PTOB 4NPSA 4GKJQ 2F0OA 2HIVA 2HCCA 1IW7D 1QB5D 2R6GA 1AH9A 4NKLA 4JI5L 2UXBL 5L37A 4C2MB 1X55A 3GTMH 2EZVA 2R93H 4IPHA 4NXNL 2CFMA 1BBXC 1E2VA 4XT3B 3EA6A 1WOCA 2Z4IA 3NWTA 3AU7A 4HIOA 4DR6Q 1CQVA 4QB4A 3PF4A 5JOBA 2E2JH 3T1HL 1H9SB 3K0YA 4IUTA 2RF4A 2A5HA 3KF6A 1PVOA 4GLAC 5C0XJ 1GO3E 5IODA 3NWSA 4JI1L 4AH6A 2UUBL 1H9RA 1P16A 4B9XA 2AWOA 1X32A 1SBBB 1KD1C 1V9PA 2A69C 4FDBA 3CCJA 1R4QB 1FYCA 3I91A 3S16H 2SEBD 2SOBA 3NTIA 2AQ3B 1E0BA 3EFXD 1MSGA 3WOEA 1SN8A 3Q6SA 3NP8A 3J81j 1D2BA 1EIFA 5EBCA 4BS9A 1LTID 2PYKA 1VQMA 4IFDJ 2BA0A 2B29A 2E2JB 3S1QB 1L0YB 4F87A 4DR1L 3BZDB 3WDNA 3OIPA 1GOZA 4K8JA 4WJ4A 1J5EL 1XMOQ 2QW7A 2UUAL 3OYYA 3U9OA 2JE6I 3SVMA 1LYLA 2KEEA 5JJLA 1CKMA 5CV9A 5I2YA 4KJOA 4P74A 3RZDH 3AYHB 4X66Q 4PMCA 4UPAA 5M5WH 3MXGA 1X54A 4NB3A 3S16B 1X3GA 1E2ZA 4KKSA 4JI7L 4Y52H 1N34L 4C3JG 1EU4A 1ENAA 2LXKA 2SDFA 2QDLA 3FPPA 1N9WA 1SYCA 1H9MA 1LTBD 3Q0AA 1YJWA 5FK9C 2KOLA 3CC2A 3ITPA 4LNQA 1H9JA 3EVQA 3LWUA 3PO2H 3GD7A 2L12A 1Y14B 2E75C 1UUPA 3IFDA 1O78A 1CHQD 4CDDC 1N32Q 3EBEA 2UU9L 5C5LA 2NN6H 1VQ9A 3H91A 4FNFA 2JA6G 2R7ZB 1C48A 1FNVA 4GKKQ 1B2TA 3GTGH 3RZDB 3RLFA 1BF4A 4B3TL 4DNTB 1PDQA 5M5WB 1F2LA 1VDZA 2RDGA 3BDCA 2E2HH 3HOZG 4NP5A 3I72A 5E4WC 3I4NH 4LJZC 1F77A 2D5DA 4OIJA 4ODGA 3P1HA 4XYQA 4P73A 3HOWG 2AUJD 3MAQA 2DY8A 5LMNW 4LMQD 5GAEC 1HQRD 4DR3Q 1K73C 3N52A 1EYCA 2H5XA 1MJCA 4IJHA 4LUVA 3PO2B 3TZDA 1OO9B 1WTWA 3BYYB 1N36L 1QNUA 3KF8B 5E3FA 2BCOA 4KD3A 4DV6L 2F0WA 1NJIC 1CZGA 4GN5A 5FLXL 5IP9G 1EYGA 5FLXc 4KKTA 2ZJPA 2VS1A 1CZWA 3CU7A 5DEHA 5EKIA 4DV7Q 2E2HB 3KBGA 4XQQA 4O1NA 2WB1B 5IIFA 4A3BG 3I4NB 3R93A 1FNUA 2CQAA 2XRQD 4B3MQ 3DWQA 4IN3A 4K0KQ 5IT9c 3R8BA 3FPUB 2LFNA 2L15A 1S4ZA 4XXEA 2NVQH 4X64L 4JV5Q 2EYOA 1LV9A 3VR6A 2IX3A 4AQYL 2KCCA 3DLLA 1X3QA 1MKHA 1MD2D 1TY2A 1B50A 2LS01 3GTLH 4LUOA 1EQTA 1PYBA 2EYJA 2EYLA 2R61A 1EEID 2PW5A 1ML0D 4P2CB 4CKEA 4MTNA 1EOVA 3J80c 3UDFA 3V96A 4LK1C 1RJTA 3RR5A 1B3QA 3GTOH 1E2WA 2VNUD 1LTTD 2Z6KC 3S9WA 4ZYSA 5CMDA 1JMCA 3NTHA 4DR5Q 4WRDA 4YCWA 2WFWA 1WJJA 1LT5D 3SXHA 4TKOB 1DXMA 1HR0W 3KLSA 3S2DH 3TREA 1B9MA 1AZPA 3OIQA 1RD9D 1BQQT 1SR3A 4OELB 4DR7L 2NVQB 4GNXC 4HCEA 4Q5VA 2YU9B 3I70A 1SNMA 5DAUA 3GTLB 2KENA 3HOXB 3BJUA 1B70B 1HNWL 1YHAA 4LF4L 1VQFA 3S24A 3GTOB 1K8AC 1EWHA 3BDLA 4IZ8A 5IGCA 1EUJA 3X3NA 1TWCB 2KHIA 4HAEA 1NAPA 1OXSC 4YWMA 1RTOA 1WCMG 5J22A 2WINB 3H6MA 4GN3B 2DJGC 1PRTB 1R4PB 2A6ED 5D3IB 3I56A 3CHBD 4A3KH 1F2MA 5M3FH 3MFGA 4L6TB 1BDOA 4FXGC 3KLWA 3MTSA 3QG1A 1JOOA 1W6JA 4X3SA 2JN4A 2WB1E 4OO1H 3QR8A 1NCVA 4R8IA 4ZUJA 1QILA 4O2DA 4CGYB 4ALPA 1HNZL 2F4VL 1FGBD 3BZCA 1GUNA 4K6DA 4HIMA 5M9OA 5KYIA 4GNXB 2I5LX 1XMQQ 1ET9A 2PW7A 1CT1D 3VR5A 2OQ0A 1G2TA 2NVYH 2E8GA 1X6OA 4LF9L 2R3ZA 3DEPA 5BR8Q 2KECA 1PFSA 1SYFA 2NZOA 3KBXA 4C3JH 1KC8C 5EGTA 3I2ZA 1NUCA 1A63A 1IKLA 2K1BA 1IBMQ 4JI0Q 4OHJA 2RKSA 4A3KB 2I07B 4DUYQ 2CQOA 4RHRA 5M3FB 3IRBA 3PCOB 1DZ1A 4UHVA 5H1SE 4IUUA 1UNSA 3A56A 2ZXPA 4B08A 1K8MA 3J7ZC 1DGSA 2ATWA 1Q82C 4RHSA 2NBFA 3K5LA 1WTVA 3EN2A 5LMNL 4DAMA 4JI3Q 1UE6A 2NVYB 3DWPA 4AYBG 4RWSC 2LMCB 4TVAB 4I65A 3RLNA 4LFBL 1VQ5A 3BDOA 5I9OA 2CHBD 1BBWA 1XX8A 3DEOA 3STBD 1AP0A 1S5CD 1KDAA 3U50C
chains in the Genus database with same CATH topology
2CVRA 4RGNA 2YYZA 4HEDA 5BN3A 1O7ZA 4G4KA 1Y69U 3K58A 1Q1BA 1LT6D 2O5IC 1JE4A 2F0DA 3EJIA 1RF2D 5J1ZA 4WORA 2WKDA 3HKZB 1CM9A 1SE3A 1WVLA 4FF1A 3HOVB 4QF4A 5NUCA 1DONA 3J81E 4HTHA 1QCBD 1D5MC 4DXFA 2F0EA 5F2DA 5KYLA 2EVBA 3QWNA 3RZOB 1Y8OB 1A3TA 5K36H 3TP7A 4ZRZA 4HSPA 4EVOA 5CC4A 3DM1A 1WTQA 3PO3B 2OXPA 5I9PA 5ELCA 5D14A 5M3MB 3HRZC 2JA8B 3H94A 2AQ2B 3QB3A 2F0IA 2B63B 3G6JB 4IUVA 1DM0B 2A6HD 2B2YC 1RKNA 3R2IA 3EQLC 1Q3LA 1D6EC 5IGBA 1CQFA 4K5VA 3IFTA 1BCPF 3LWEA 1BR9A 3NK9A 3IAYA 1STNA 2B2UA 3MXNA 5I6YA 3D31A 4PQXA 1Y8PB 4QIWB 1LT4D 2A68C 4A3EB 2KVMA 1ENCA 2NB0A 4MN3A 1STYA 4EQPA 4XQJA 3E6ZX 1TKWB 2NN6G 1PMRA 5C4HA 1CHPD 3A8JE 5ELBA 2K28A 3VR3A 3C1FA 4B9WA 1TWHB 2EDGA 5EJWA 1CI3M 1PTOD 1KDBA 2IWHA 1LACA 1EY8A 1YNNC 1JOQA 3CRLC 3OMGA 2PMZB 3ONAB 2L11A 3M4OB 4G57A 3PIO3 1EEFD 3GTQB 3D6WA 5KRUA 2JYOA 4UAIA 1JWUD 1TWFB 4MIUA 1G6ZA 2RBMA 2L0CA 2PZUA 3N6RA 3Q22A 1LABA 4KKUA 2F0PA 4RKBA 3PUWA 1SE4A 5HGTA 1Q12A 3ZYYX 2AWNA 4EQNA 1IYVA 1H9SA 1PYWD 3MA2B 1EIGA 3T4AC 2XWJB 1A3VA 1JC7A 4GZYC 1C8CA 3OWFA 2B8GA 2WACA 3D8GA 3D3RA 1STBA 1A2TA 2H1EA 3T16A 1BCPB 4G7HC 3GTJB 1B4OA 2X6GA 4E6IA 1I4RA 4AYBB 1BOSA 3V2TA 1WD0A 2G9HD 1K8OA 1NSNS 3A7AB 4A3DB 1TWAB 4PV1C 1L0XB 5M5XB 2K5QA 1TS3A 3BYTB 4DN4M 1S5DD 1OXVA 3S1NB 5C3XA 2A69D 3QIAA 3FRPB 5ISRA 4A3MB 5C4XB 2K5WA 1NR4A 1QNKA 1EL0A 1T5EA 1ESFA 3M4YA 4ZQ3A 2F0JA 3HGBA 2K33A 1IHZA 4RCOA 4KY7A 1HPCA 3A8KE 5C4ZA 4H13C 3IL8A 4DAVA 1HTPA 4OO1G 2F0LA 5DM73 1KLGD 1GUGA 2NTSA 2DNCA 1MBYA 1CFMA 4JBWA 2IJ0A 4F7XA 2DNEA 3K6OA 4RFBA 4Q0FA 5J39A 1V43A 2Z8LA 1FR3A 3MXUA 3SK4A 2O5JC 4RGOS 3A8IE 1LTGD 5K5PA 4NDXA 3G7LA 3GO5A 2WIIB 1RDPD 4U68A 4KHZA 2MP1A 3L7ZC 4KV6A 1TY0A 1TWGB 1JQYD 3W3AA 4XIGS 4C3HB 2F0GA 2GA4B 1XWEA 2EY1A 2NVXB 3LX0A 2O4XA 1WD1A 1SJED 1SSOA 1PFBA 1B1ZA 2A73B 1Q90A 1U4LA 4HR7B 1PRTF 2Z1CA 4DK1A 2K6AA 3MFYA 2PO4A 1NR2A 4K5XA 2EYFA 4ZUIA 3S1RB 2BDNA 1F9RA 2B8FA 2J4XA 1FD7D 2EY5A 4DU9A 5EPKA 1Q1EA 2K5DA 5D65A 1UEAB 3VA7A 2RVLA 2ICIA 2BE5C 1SE2A 5LL6X 2HCIA 3S1MB 1HTLD 1IL8A 5I6WA 3M85A 1ZYRC 2NZ1D 2Z4HA 1LTSD 1D1KA 1TT2A 3NQIA 4PMBA 1YNJC 2QEJC 1LTAD 2E76C 3MZ5A 4A3JB 3TMEA 3C2PA 3I73A 2HDMA 5IT9L 4NW2A 2WAQB 1B3AA 5AFWA 1OXTA 1GUTA 4HMJA 2F0NA 5C44B 1A6XA 1R9TB 5CV6A 1SNPA 5KNCA 1MGSA 3T53B 5K36G 5C0XI 1EYAA 3SDZA 2CW0C 4IQZA 4FF3A 3ERQA 3HOUB 4DFAA 3J80L 4EQOA 2HQEA 1PRTC 2KA7A 3BVZA 2F3WA 1SAPA 2XNAC 2J7ZA 4NMZA 1WTPA 3F2UA 3SK6A 1JB3A 1HXYD 3I4LA 5CV4A 1PXUA 1STGA 2ICEC 3NPPA 2NVTB 5CV8A 4A93B 2F0FA 3DWAA 4J8QA 4BY7B 1VF7A 4BBRB 4RA8A 1SYDA 1BO0A 1F2ZA 4HCSA 1U9RA 3K7AB 2D9UA 3D4RA 1B9NA 3H0GB 5FO8B 2X6LA 3P7JA 3C1EA 1ESRA 4QCLA 2ENBA 3HOYB 3TP8A 3GTPB 3V05A 5IGFA 3D4DA 2F0VA 4G7ZC 4L8JA 5A35A 2IPKD 1GHJA 4QMGA 5G3LD 1AZQA 3J7AF 4IUNA 4DGZA 2ZXOA 2RA4A 3URYA 2IX1A 4PMWA 5JJZA 2F0HA 1TS5A 2KHSA 2NWGA 1PZJD 4C1NI 2LY7A 1SFOB 3OPOA 4PNYA 2F0TA 1IKMA 4CJ0B 2B2TC 4OIKA 2TMPA 1Z7TA 2DN8A 2PZTA 1JWSD 5CR3A 1SEBD 4XQNA 2IL8A 1TQOA 1SXTA 1EY5A 4QUCA 3M7NA 1LTRD 4ZKCB 3W2DA 3ND8A 3PUXA 1ZXTA 3QJYA 1EZ6A 1EU3A 3TP6A 2WV6D 4C3IB 2K32A 1RTNA 1LLRD 3NBIA 1EQVA 2XSCA 2QILA 2B2VC 1JICA 2BA1A 5M5YB 3AB9A 3A55A 5FO9B 3D4WA 2RQXA 1Y1VB 5IGGA 4CHTB 1I4PA 3EROA 2M00A 4H7BA 4BWGB 4M8AA 2IW3A 3TBIB 3AMUA 2Y0SB 2VB2X 5JAVA 5TSSA 4HSVA 1PZKD 1F9SA 4JK1C 3HP3A 1I6HB 1GJXA 2FMMA 1U4MA 1DD2A 2FMCA 5JVG3 3MVVA 5CBEE 1SYBA 2AQ1B 5D3DA 1D5ZC 2ZXRA 3SK5A 4MHEA 1WTOA 3QO2A 1KAAA 1B53A 1A15A 2J0TD 3NUCA 3TZUA 4FYDA 2MGSA 3KUPA 4Y7NB 4F8MA 3OHXC 4K14A 3WOFA 4C3HG 5C4JB 3KK7A 2AUKA 2O2LD 5C6AA 5EKLA 4Z9CB 1QE6A 1SMYD 1V1PB 1B44D 3NHHA 1SMYC 2RSNA 3I4MB 5EPJA 1STEA 2L5TA 4A3IB 4CJ2C 1DYQA 2B2YA 2OEOA 3QOJA 2PPBC 3TN2A 2A68D 1Z47A 4BY1B 4KD4A 4BBSB 4O42A 3M3YB 4HMIA 5ELDA 3ND9A 1AW7A 5CORA 3PV0A 4N9PA 2JA7B 2OT2A 5KEEA 1KLUD 1JCKB 3TDQA 4J1MA 3PIP3 4X3UA 2XWBB 2R92B 2FHTA 3K5MA 3OOCA 1V1OA 3Q24A 2MHVA 3CRKC 4KTAA 3GTKB 2JXMB 3RMHA 1U4RA 1XXGA 2FJ2A 5E1FA 1OXXK 2E74C 2EY2A 2IT1A 1MI2A 1YNND 1EY9A 2PQEA 4X3KA 2Q8TA 4CJ1B 4A3FB 2F3VA 4ABNA 1HCZA 1PFMA 1BCPC 5I2XA 4K5WA 1D1IA 3FKIB 4XDXA 1VCIA 2L1BA 1LO5D 1VF5C 5BN5A 2EPBA 4FO2A 5DNFA 4H0LC 2JA5B 3IKJA 3HG9A 2K04A 2I46A 5JEAG 3J81L 1UAPA 3S2HB 1CTMA 1ENFA 1F9PA 3P20A 5A2QL 1KNAA 3JAML 2A74C 1PZID 1TR5A 2RDFA 4ME5A 1MSHA 2FFKB 2RSOA 5EQ0A 5FLXE 5CBAE 2HUGA 2H4OA 1IW7C 2EJGC 1Y1WB 4IUQA 2MUYA 2VXWA 1II3A 1SYGA 5IT9E 1F2YA 3QOLA 1X3PA 5C3EB 3S15B 3UI2A 1EWCA 4FVMA 4BA2I 3MXPA 2E2IB 1SNOA 1GXDC 4KK7A 1I50B 3J80E 2ID0A 2VUMB 4L63B 2KCNA 4RH6A 1I4GA 2PZWA 2JEAI 1JR0D 1U4PA 2JP1A 5CGKA 1PFNA 2R93B 3GTMB 2EE1A 3KLRA 1VMPA 3OMCA 1EY4A 2EXZA 3MEHA 2D62A 5E4XA 1SJHD 1T5XD 3K5OA 1HA5A 3X3MA 2JSOA 1EOTA 3DUZA 1QOHA 1DOMA 3H3VC 2SNMA 1Z6HA 4KI0A 3S17B 5JEAJ 2K05A 5DM63 1EY0A 2G9DA 1D5XC 1STAA 4C3IG 1VMCA 2FINB 2KJXA 3RD4A 1XYIA 1CA6A 4RGTA 2NUCA 2F03A 2PNRC 4XYOA 1QG7A 1HRJA 2EJFC 5EKKA 2KUMA 1RCVD 3TSSA 1QJOA 2B2WC 3KF8A 2EYPA 1G91A 3I90A 3E5SA 2BOSA 2B39A 1HFGA 1DCZA 3A54A 4EGVA 3CKIB 4R8NA 1XTCD 2C5CA 1STHA 4N9TA 1ET6A 3SE0A 2B2WA 4FXDA 5C0XH 3HS0C 2BE5D 1G2SA 3RUZA 1HQMC 3VR2A 1ZKOA 3M7GA 2QKIC 4UDUC 3HZXA 4WJWA 1KNEA 4H44C 1ZYRD 4A3GB 1M8AA 4FF4A 3DHQA 3K5NA 1YNJD 2MPMA 4YIJA 1HHVA 4IFDH 4M1UB 1V8QA 1FNWA 4KN7C 1O7LA 3H09A 1JWMD 3PUZA 3MHBA 1O80A 1M4VA 1S5ED 4C56C 3GTGB 2EY6A 1I4QA 1AEXA 4TSSA 5BN4A 1SNQA 4IUPA 2NN6I 1BUVT 2M2LA 5JEAH 2RDHA 3NXWA 1EY6A 3VYSA 2CW0D 4K8IA 2WKCA 1PRTD 2EOTA 3DMUA 3FDTA 1IYUA 2L9HA 2XIWA 4DXGA 1EFID 3I3CA 2EYHA 4RAUC 4IFDI 4J6HA 1EY7A 3NTKA 4S3SA 1KTKA 5G3LF 1TS4A 4DAYA 1HUMA 4RGMA 3R2TA 1WTRA 1F9QA 5FO7B 3GP7A 1ONLA 3NE5B 4KHVA 5HURA 5ELFA 2QF7A 2QCPX 4G7OC 1BXTA 2QDBA 5T1GA 2F0KA 4KN4C 1GUWA 3VYUA 1TIID 3K57A 1S5BD 1DOKA 2ZT9C 1CA5A 3PUVA 4ZLTF 4ZAIA 5FKAC 1J8IA 3S14B 3D6CA 4OL7A 2N88A 3MWYW 5KNBA 2A6EC 3S2DB 1O7YA 4FP5D 4X3TA 1HA6A 2F4IA 1WTXA 1LT3D 4CBVA 2M9VA 2OF1A 3J7AV 4TRDA 1ICWA 2C9OA 2MJ8A 3SHLA 3T56B 3SEBA 5ELEA 2DY7A 2NTTA 1HUNA 3I8ZA 3K59A 1ZEQX 2L55A 3GV6A 4K2KA 1TU2B 4KY6A 3FMCA 3BVMA 2L4NA 1RODA 2HDLA 2V4DA 3KLSX 3C46A 3VR4A 4K2LA 4BA1I 5IOCA 3BG3A 1H9KA 2B2TA 1J9OA 3OWEB 2K03A 4OO1I 4K6LA 1SYEA 1QWYA 4C3JB 2WP8J 1DJRD 2NYZD 4XT1B 1EIHA 1TS2A 3T51B 5COYA 1K83B 1KDCA 1I3QB 3SR1A 2XRSD 1GUOA 2SNSA 2B2VA 3VA5A 2JA6B 1BNZA 3Q23A 5JPMC 2XN9C 2KQ3A 3BVGA 1GHKA 4ULLA 3HOZB 4I7ZC 3VYRA 1ILQA 5C3WA 3HOWB 3T13A 2X69A 5T1IA 1PLFA 1Y8NB 5A2QE 5CV7A 1V1PA 2F1MA 3JAME 2KEDA 4HN7A 3GQBA 3OSOA 4ZK9B 1G8ZD 5CV5A 4DAPA 1EYDA 2F0UA 1GUSA 3GV3A 3CQZB 5CYUA 3R3OA 1JORA 4OGQC 1ILPA 2JEBI 4FXKC 4A3BB 3VYTA 5JPNC 3NQTA 1I4XA 4ID6A 3C3LA 2N55A 3HEJA 1PTOF 4KY5A 2D2CC 2B2UC 5C5MA 5IGDA 4ILWA 1AN8A 2A6HC 1S5FD 3U9SA 1I4HA 4FF2A 2EYMA 4QUFA 3L3OC 3NSWA 4F88A 4XTCS 5FOBB 2VB3X 2TSSA 4V0BA 2F0SA 4DA2A 1A3UA 1TVXA 3P75A 2BDOA 4R9WA 3L9AX 5LHY1 4U673 3O13A 3PUYA 5KNDA 2PCFB 4IURA 1G291 1CK1A 1SDFA 1SNCA 3OW7A 3TP5A 5IGEA 5C0XG 1A2UA 4CKBA 3A7LA 1KABA 1BCPD 1DOLA 4RKLA 1OXUA 2IX0A 5KIXA 4KMUC 2E2DC 1PTOC 1WCMB 5EPLA 4C1NK 3PMFA 1AFPA 3NBHA 1EZ8A 4IFDG 3MC0B 2Q8RE 4V190 3FEWX 1PTOH 4CKCA 2K7VA 4TQUS 4KJNA 3FVQA 4WFN3 1W6KA 4IALA 5I4DA 4RCNA 1RHPA 3LNNA 5LL6S 1HFNA 2EJMA 3DXJC 1Q8IA 4LAAA 3J7YW 3BS1A 1C4QA 4ZKBB 2LKVA 1I6VC 3E0JA 4DK0A 2XVSA 1JOKA 5KGUA 1SNDA 3SK8A 5EBDA 4DNRB 2F0MA 2Q8IB 2K01A 4DF7A 2F0QA 5JVH3 1PTOB 2F0OA 2HCCA 1IW7D 1QB5D 2R6GA 4NKLA 4C2MB 2EZVA 1BBXC 1E2VA 4XT3B 3EA6A 2Z4IA 3NWTA 3AU7A 1CQVA 4QB4A 5JOBA 1H9SB 3K0YA 4IUTA 2A5HA 5C0XJ 5IODA 3NWSA 1H9RA 4B9XA 2AWOA 1X32A 1SBBB 2A69C 1R4QB 1FYCA 3I91A 2SEBD 2SOBA 3NTIA 2AQ3B 1E0BA 3EFXD 1MSGA 3WOEA 3Q6SA 3NP8A 1D2BA 5EBCA 4BS9A 1LTID 2PYKA 4IFDJ 2BA0A 2E2JB 3S1QB 1L0YB 4F87A 3BZDB 3WDNA 3OIPA 1GOZA 4K8JA 3U9OA 2JE6I 3SVMA 2KEEA 5CV9A 5I2YA 4KJOA 4PMCA 3S16B 3MXGA 1E2ZA 4KKSA 4C3JG 1EU4A 1ENAA 2SDFA 3FPPA 1SYCA 1H9MA 1LTBD 3Q0AA 5FK9C 2KOLA 3ITPA 1H9JA 3EVQA 3LWUA 3GD7A 2L12A 2E75C 1UUPA 3IFDA 1O78A 1CHQD 5C5LA 2NN6H 3H91A 4FNFA 2R7ZB 1C48A 1FNVA 1B2TA 3RZDB 3RLFA 1BF4A 4DNTB 1PDQA 5M5WB 1F2LA 1VDZA 2RDGA 3BDCA 4NP5A 3I72A 5E4WC 4LJZC 1F77A 2D5DA 4OIJA 4ODGA 3P1HA 4XYQA 2AUJD 3MAQA 2DY8A 4LMQD 1HQRD 3N52A 1EYCA 3PO2B 3TZDA 1OO9B 1WTWA 3BYYB 1QNUA 5E3FA 2BCOA 4KD3A 2F0WA 1CZGA 5FLXL 4KKTA 1CZWA 3CU7A 5DEHA 5EKIA 2E2HB 3KBGA 4XQQA 4O1NA 2WB1B 5IIFA 3I4NB 3R93A 1FNUA 2CQAA 2XRQD 3DWQA 4IN3A 3R8BA 3FPUB 2LFNA 1S4ZA 4XXEA 2EYOA 1LV9A 3VR6A 2IX3A 2KCCA 1X3QA 1MD2D 1TY2A 1B50A 2LS01 1EQTA 2EYJA 2EYLA 2R61A 1EEID 2PW5A 1ML0D 4P2CB 4CKEA 3V96A 4LK1C 1RJTA 1E2WA 2VNUD 1LTTD 3S9WA 4ZYSA 5CMDA 3NTHA 4WRDA 1LT5D 3SXHA 4TKOB 1DXMA 3KLSA 1B9MA 1AZPA 3OIQA 1RD9D 1BQQT 2NVQB 4HCEA 4Q5VA 2YU9B 3I70A 1SNMA 5DAUA 3GTLB 3HOXB 3GTOB 1EWHA 3BDLA 4IZ8A 5IGCA 3X3NA 1TWCB 4HAEA 1NAPA 1OXSC 1RTOA 5J22A 2WINB 3H6MA 1PRTB 1R4PB 2A6ED 5D3IB 3CHBD 1F2MA 3MFGA 4L6TB 1BDOA 4FXGC 3MTSA 3QG1A 1JOOA 1W6JA 4X3SA 4OO1H 1NCVA 4R8IA 4ZUJA 1QILA 4CGYB 1FGBD 1GUNA 4K6DA 5M9OA 5KYIA 1ET9A 2PW7A 1CT1D 3VR5A 1G2TA 2R3ZA 3DEPA 2KECA 3KBXA 1SYFA 5EGTA 1NUCA 1IKLA 2K1BA 4OHJA 2RKSA 4A3KB 2I07B 4RHRA 5M3FB 1DZ1A 4IUUA 1UNSA 3A56A 2ZXPA 4B08A 1K8MA 4RHSA 2NBFA 3K5LA 1WTVA 2NVYB 3DWPA 4RWSC 2LMCB 4I65A 3BDOA 5I9OA 2CHBD 3DEOA 1XX8A 1AP0A 1S5CD 1KDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A3V A;  3MHB A;  5I6Y A;  1A2U A;  3P1H A;  2PZT A;  4KV6 A;  2EY6 A;  1AEX A;  5IOD A;  3OWF A;  5CR3 A;  5C3W A;  1SNQ A;  3SK6 A;  4F8M A;  4K14 A;  2WAC A;  1KAB A;  4B9X A;  3D8G A;  3T13 A;  5KGU A;  1STB A;  2OF1 A;  1A2T A;  1TQO A;  3NXW A;  1EY6 A;  3BDL A;  4IZ8 A;  1EY5 A;  4RKL A;  3T16 A;  5IGC A;  1EYC A;  1ENC A;  2F0G A;  5CV4 A;  5CV7 A;  5KIX A;  1STG A;  4K8I A;  4TRD A;  5C6A A;  5EKL A;  4E6I A;  3V2T A;  5CV8 A;  1STY A;  2EY1 A;  2F0D A;  3LX0 A;  3EJI A;  3OSO A;  3NHH A;  2SNM A;  2SOB A;  3H6M A;  2O4X A;  5J22 A;  5E3F A;  5J1Z A;  3DMU A;  5CV5 A;  4WOR A;  3SHL A;  4KD3 A;  1NSN S;  1F2M A;  1EY0 A;  2F0U A;  1EYD A;  2F0W A;  3PMF A;  3NP8 A;  5C4H A;  1STA A;  2F0F A;  1EZ8 A;  2PYK A;  4K2K A;  1EZ6 A;  3R3O A;  3TP6 A;  1JOR A;  1JOO A;  2OEO A;  3QOJ A;  3C1F A;  4QF4 A;  5NUC A;  4KY6 A;  4B9W A;  5I6W A;  1TR5 A;  1SYD A;  4KD4 A;  1F2Z A;  2EYH A;  2EYF A;  1U9R A;  2NUC A;  4HTH A;  4K5X A;  5DEH A;  4ZUI A;  2RDF A;  1EQV A;  4KJN A;  4ZUJ A;  4K2L A;  4ME5 A;  5IIF A;  2EY5 A;  4IAL A;  4K8J A;  2F0E A;  4K6D A;  3C1E A;  4HMI A;  5EKK A;  5F2D A;  5C3X A;  5KYI A;  4J6H A;  5KYL A;  1EY7 A;  5M9O A;  3NQT A;  4S3S A;  4DU9 A;  5ISR A;  2ENB A;  2PW7 A;  5IOC A;  2EYP A;  3TP8 A;  4N9P A;  3E5S A;  4ID6 A;  1KDB A;  3U9O A;  1A3T A;  4LAA A;  1EY8 A;  3D4W A;  2LKV A;  2EYO A;  3HEJ A;  3TP7 A;  5KEE A;  4KY5 A;  4ZQ3 A;  5IGF A;  1SYF A;  5CV9 A;  5IGG A;  4J1M A;  2F0J A;  5C5M A;  1JOQ A;  5IGD A;  4KJO A;  4EVO A;  5CC4 A;  1JOK A;  2F0V A;  3D4D A;  1II3 A;  4NMZ A;  5EGT A;  1SND A;  1SYG A;  4PMC A;  1IHZ A;  1F2Y A;  1NUC A;  3OMG A;  3ERO A;  1SYE A;  2EYJ A;  2M00 A;  3QOL A;  4KY7 A;  2EYL A;  4H7B A;  3SK8 A;  5C4Z A;  2OXP A;  2PW5 A;  2RKS A;  4R8N A;  4QMG A;  1TT2 A;  1STH A;  2EYM A;  4G57 A;  5I9P A;  4N9T A;  4IUN A;  4PMB A;  4KHV A;  1ENA A;  4DGZ A;  5JAV A;  2F0M A;  3MZ5 A;  4KTA A;  5HUR A;  5KRU A;  3TME A;  4DF7 A;  2F0Q A;  1SYC A;  3MXP A;  2F0L A;  2QDB A;  1SNO A;  3QB3 A;  4MIU A;  2RBM A;  2F0K A;  2F0I A;  5E1F A;  2EY2 A;  2F0O A;  3ITP A;  3S9W A;  4F7X A;  3EVQ A;  4HMJ A;  2F0H A;  1EY9 A;  4NKL A;  2PQE A;  2F0S A;  3RUZ A;  2F0N A;  5J39 A;  3HZX A;  2KHS A;  1KDC A;  2PZU A;  4WRD A;  5IGE A;  1RKN A;  5CV6 A;  1SNP A;  3SR1 A;  2F0P A;  2PZW A;  1A3U A;  3P75 A;  3SK4 A;  3SXH A;  4EQP A;  2F3V A;  4RKB A;  5C5L A;  5CGK A;  5K5P A;  2SNS A;  3MVV A;  3DHQ A;  4K5W A;  1EYA A;  4NDX A;  3VA5 A;  1SYB A;  5IGB A;  3D6C A;  5HGT A;  4I65 A;  4YIJ A;  4K5V A;  4PNY A;  3ERQ A;  4OL7 A;  4QB4 A;  4DFA A;  5JOB A;  4EQN A;  1SNM A;  5DAU A;  2F0T A;  5I9O A;  3SK5 A;  4EQO A;  2KQ3 A;  2HQE A;  3OMC A;  3BDC A;  2F3W A;  3NK9 A;  1SNC A;  4NP5 A;  1KAA A;  1EY4 A;  2EXZ A;  1KDA A;  1STN A;  3MEH A;  3TP5 A;  3NUC A;  4ODG A; 
#chains in the Genus database with same CATH topology
 2CVR A;  1VQI A;  1A62 A;  4RGN A;  1FJG L;  3A5Z B;  3ULJ A;  4J15 A;  4JI6 L;  2YYZ A;  4HED A;  5BN3 A;  2GVA A;  1O7Z A;  4G4K A;  2LXJ A;  1Y69 U;  3K58 A;  1Q1B A;  1LT6 D;  2O5I C;  1JE4 A;  2F0D A;  3K8A A;  5IP9 H;  3EJI A;  1RF2 D;  5J1Z A;  4L5Q A;  3PO3 H;  4WOR A;  2WKD A;  3HKZ B;  1CM9 A;  2ZJR A;  3U4Z A;  2V1C C;  1S3O A;  1SE3 A;  3OTO Q;  4LF5 Q;  1WVL A;  2I5M X;  4FF1 A;  3HOV B;  4DV2 Q;  4OX9 Q;  4QF4 A;  5NUC A;  1DON A;  5IWA Q;  3J81 E;  1YIT A;  2A19 A;  4HTH A;  2UXD L;  4NXM Q;  1QCB D;  1D5M C;  2YTX A;  1MIU A;  4DXF A;  4OEM B;  2F0E A;  5F2D A;  5KYL A;  2EVB A;  3QWN A;  3RZO B;  4DV0 Q;  1N33 Q;  2EXD A;  1Y8O B;  1WYD A;  4HIK A;  1A3T A;  5K36 H;  3GDE A;  3TP7 A;  4GLV B;  4ZRZ A;  4HSP A;  2R7F A;  4EVO A;  5CC4 A;  2DUD A;  3DM1 A;  2OWO A;  1WTQ A;  3PO3 B;  3AQQ A;  4YWL A;  2OXP A;  4DV4 Q;  5I9P A;  4OWX B;  5ELC A;  5D14 A;  5M3M B;  1VQ4 A;  3HRZ C;  2JA8 B;  3H94 A;  2AQ2 B;  3QB3 A;  2F0I A;  2B63 B;  1P8L A;  3G6J B;  2MO0 A;  4IUV A;  3W1B A;  1DM0 B;  4LWC A;  2A6H D;  2B2Y C;  1RKN A;  3R2I A;  3EQL C;  1Q3L A;  4POG A;  1D6E C;  2R7Z G;  1L1O C;  4UY8 C;  1E1T A;  3KJP A;  1CSP A;  5IGB A;  1CQF A;  1KIX A;  3TS2 A;  4K5V A;  3IFT A;  3D0F A;  1BCP F;  3LWE A;  1BR9 A;  1TWH H;  1YHB A;  3NK9 A;  3IAY A;  4DV3 Q;  1STN A;  1EQR A;  1E3P A;  2B2U A;  3MXN A;  5I6Y A;  1C0A A;  3D31 A;  4PQX A;  1Y8P B;  4QIW B;  1LT4 D;  2A68 C;  1L1O A;  1WCM H;  4A3E B;  1UEB A;  2KVM A;  4LFA Q;  1ENC A;  3HKZ E;  2NB0 A;  4B3R Q;  3ZJY C;  4MN3 A;  1STY A;  4EQP A;  5LMU Q;  4XQJ A;  3E6Z X;  1TKW B;  3AFP A;  2NN6 G;  1PMR A;  4JI8 Q;  2P5Z X;  5C4H A;  1CHP D;  3A8J E;  5ELB A;  1PH4 A;  2K28 A;  3GTQ H;  1PH9 A;  3VR3 A;  1HNX Q;  4R4T A;  5IYC G;  3C1F A;  2VQE Q;  4B9W A;  1TWF H;  4MNO A;  1TWH B;  2WB1 G;  3I4N G;  2EDG A;  2HHH Q;  3M4P A;  5EJW A;  1CI3 M;  1PTO D;  1GVP A;  1KDB A;  4LF6 Q;  2IWH A;  1WTH A;  1LAC A;  1EY8 A;  2PQA A;  1YNN C;  1JOQ A;  3CRL C;  1MJE A;  3OMG A;  3T1H Q;  2PMZ B;  3ONA B;  2L11 A;  3M4O B;  4JBJ A;  4JOI A;  4G57 A;  3PIO 3;  1EEF D;  4C2M H;  3D6W A;  5KRU A;  3GTQ B;  2JYO A;  4UAI A;  1JWU D;  1TWF B;  5AJ3 L;  3CC7 A;  4MIU A;  1G6Z A;  1VQL A;  2RBM A;  4LFC L;  3GTJ H;  1EQQ A;  4LF8 Q;  2L0C A;  2N49 A;  3KYH C;  2PZU A;  2CH4 A;  3N6R A;  3Q22 A;  1LAB A;  4KKU A;  2F0P A;  4PZ8 A;  4RKB A;  1TWA H;  3TQY A;  3PUW A;  1SE4 A;  5IYD H;  5HGT A;  5M5X H;  1Q12 A;  1YHQ A;  3HOX G;  3ZYY X;  2AWN A;  4EQN A;  1IYV A;  2UUC L;  1H9S A;  1UE5 A;  1PYW D;  3MA2 B;  1E1O A;  1EIG A;  2VY3 A;  3T4A C;  4QIW E;  2XWJ B;  3S1N H;  1A3V A;  4A3M H;  4L5S A;  1JC7 A;  4GZY C;  4LW1 A;  3OWF A;  1C8C A;  2B8G A;  2VL6 A;  2XGT A;  2WAC A;  1JJ2 A;  3D8G A;  3D3R A;  1STB A;  4R4I A;  1A2T A;  2H1E A;  3T16 A;  3F2B A;  1VQC A;  2BH2 A;  1BCP B;  4G7H C;  3GTJ B;  1B4O A;  2X6G A;  4E6I A;  1I4R A;  4AYB B;  1BOS A;  3V2T A;  1WD0 A;  4JI4 L;  2G9H D;  1K8O A;  3S1Q H;  5DLQ E;  4N8F A;  1NSN S;  1WI5 A;  3A7A B;  4ZCK A;  4A3D B;  1L2F A;  1TWA B;  4O0A A;  1L0X B;  4PV1 C;  3T1Y Q;  1Q46 A;  5M5X B;  4A76 A;  2PI2 A;  2K5Q A;  3J80 i;  1TS3 A;  3BYT B;  4DN4 M;  2UXC L;  1S5D D;  1OXV A;  4YY3 L;  3S1N B;  5C3X A;  2A69 D;  3QIA A;  3FRP B;  5ISR A;  4A3M B;  5C4X B;  2K5W A;  1NR4 A;  1QNK A;  1EL0 A;  1T5E A;  4RMF A;  1ESF A;  3M4Y A;  4ZQ3 A;  2PMZ E;  2F0J A;  3HGB A;  2K33 A;  5HY6 A;  4KHP Q;  1CKN A;  1IHZ A;  4RCO A;  4KY7 A;  4A3K G;  1HPC A;  3A8K E;  2CWA A;  5C4Z A;  5M3F G;  1UWV A;  3IL8 A;  4H13 C;  5HGQ A;  4DAV A;  1HTP A;  4JYA L;  1IZ6 A;  4OO1 G;  1TWG H;  2F0L A;  5DM7 3;  1KLG D;  3EIV A;  3ULP A;  1GUG A;  2NTS A;  2DNC A;  1MBY A;  3NEM A;  4C3H H;  1CFM A;  4JBW A;  2IJ0 A;  4F7X A;  2R7Z H;  2DNE A;  3K6O A;  4RFB A;  4Q0F A;  2NVX H;  5J39 A;  1V43 A;  2Z8L A;  1FR3 A;  3MXU A;  2N8N A;  3SK4 A;  2O5J C;  4RGO S;  1SRO A;  3A8I E;  4GKJ L;  1LTG D;  5K5P A;  2VQF Q;  4NDX A;  3MEF A;  3G7L A;  3GO5 A;  3CP0 A;  2WII B;  4YCU A;  4P75 A;  1RDP D;  3M4Q A;  3S1R H;  4U68 A;  1NMG A;  4KHZ A;  1Q81 C;  1YVC A;  4OON A;  2MP1 A;  4DR6 L;  3L7Z C;  1G51 A;  4KV6 A;  1B8A A;  1PA6 A;  1QZH A;  1TY0 A;  1TWG B;  4YHH Q;  1JQY D;  1I94 Q;  1M90 C;  5IYB G;  3W3A A;  4AYB E;  1Q7Y C;  4XIG S;  4C3H B;  2I0Q A;  2F0G A;  2GA4 B;  1XWE A;  2EY1 A;  3TS0 A;  3LX0 A;  2NVX B;  3HKZ G;  2O4X A;  1WD1 A;  5IYC H;  1SJE D;  2ZM6 L;  1SSO A;  1PFB A;  1B1Z A;  2A73 B;  1K3B C;  1Q90 A;  1U4L A;  3HOV G;  4HR7 B;  1PRT F;  2Z1C A;  4DK1 A;  2K6A A;  2MNA A;  3MFY A;  2PO4 A;  1NR2 A;  4K5X A;  2EYF A;  3BU2 A;  4ZUI A;  5GAG C;  4DR4 Q;  4X62 L;  3S1R B;  2BDN A;  1F9R A;  2B8F A;  2J4X A;  1FD7 D;  2EY5 A;  2Z6B A;  5C44 H;  3CC4 A;  2K50 A;  3CCS A;  4DU9 A;  1YNX A;  3G71 A;  5EPK A;  1Q1E A;  2K5D A;  4GOP C;  5D65 A;  1UEA B;  4HJ8 A;  3VA7 A;  2RVL A;  2ICI A;  3A74 A;  2BE5 C;  1SE2 A;  5LL6 X;  1JT8 A;  3H3V I;  4B3S L;  2HCI A;  3S1M B;  1HTL D;  1XMO L;  2Q2U A;  1IL8 A;  5I6W A;  3M85 A;  3PO3 G;  1XNQ Q;  1ZYR C;  2NZ1 D;  2Z4H A;  3CMA A;  1LTS D;  1D1K A;  1TT2 A;  3FHW A;  3NQI A;  4PMB A;  5M3M G;  1YNJ C;  2QEJ C;  1LTA D;  2E76 C;  3MZ5 A;  4A3J B;  2JA8 G;  3TME A;  4X66 L;  5GAH C;  3C2P A;  2RHS B;  3I73 A;  3UDX A;  2HDM A;  5IT9 L;  2B63 G;  4DV1 Q;  4NW2 A;  2WAQ B;  4DUZ Q;  1B3A A;  5AFW A;  1OXT A;  1XPR A;  1GUT A;  4HMJ A;  2NVT H;  2F0N A;  5C44 B;  1A6X A;  2YU9 H;  4A93 H;  1R9T B;  5CV6 A;  1SNP A;  5KNC A;  3HOX H;  1MGS A;  3I55 A;  4ME3 A;  3T53 B;  1PH5 A;  1HZ9 A;  3CCR A;  5K36 G;  5C0X I;  1EYA A;  3SDZ A;  1PH2 A;  1PH7 A;  2CW0 C;  4IQZ A;  4FF3 A;  3I4M G;  3ERQ A;  3HOU B;  4DFA A;  3J80 L;  1N32 L;  4EQO A;  2HQE A;  1PRT C;  2VZA A;  2KA7 A;  3BVZ A;  4CDE C;  4GOP B;  1PH3 A;  2F3W A;  1BKB A;  1SAP A;  3H0G H;  2XNA C;  3KDF A;  1KHI A;  2J7Z A;  4NMZ A;  4JI2 Q;  1TWC H;  3RN2 A;  1WTP A;  5JJK A;  3L0O A;  3F2U A;  1VQD A;  3CW2 C;  3GTP H;  3SK6 A;  4A3E G;  1VQH A;  1JB3 A;  5E7N A;  1HXY D;  1JJG A;  4LF9 Q;  3I4L A;  5CV4 A;  1PXU A;  1STG A;  2ICE C;  3HKS A;  3NPP A;  2NVT B;  5CV8 A;  2D0O A;  2Z0S A;  4LF7 Q;  4A93 B;  2Z6K A;  4DR3 L;  2K52 A;  3U4V A;  2K5H A;  5GAD C;  2F0F A;  3DWA A;  3CXC A;  1YJN A;  4J8Q A;  4BY7 B;  1CUK A;  1VF7 A;  1RIP A;  4BBR B;  4RA8 A;  1SYD A;  1BO0 A;  1F2Z A;  4HCS A;  1U9R A;  2QGQ A;  3K7A B;  2D9U A;  3D4R A;  1B9N A;  3H0G B;  4GNX A;  5FO8 B;  2X6L A;  3P7J A;  3C1E A;  1K0S A;  1ESR A;  4QCL A;  3LGJ A;  2ENB A;  3HOY B;  3F1Z A;  5FJ8 H;  3TP8 A;  3GTP B;  3V05 A;  4DV7 L;  1SFO H;  1KL9 A;  4CDF C;  4DAY B;  5IGF A;  4B3M L;  3D4D A;  2F0V A;  4G7Z C;  4K0K L;  4L8J A;  1TXY A;  2ZTE A;  3CCV A;  5A35 A;  1LUZ A;  2OQK A;  4R4Q A;  2LSS A;  2IPK D;  1GHJ A;  4JV5 L;  4QMG A;  5G3L D;  1AZQ A;  3J7A F;  1FJG Q;  4IUN A;  4DGZ A;  4IOA A;  3KFU A;  2ZXO A;  2WAQ E;  4HJ7 A;  2FXQ A;  2RA4 A;  3URY A;  4IJL A;  2IX1 A;  4PMW A;  5JJZ A;  4AIM A;  2F0H A;  1JB7 A;  4QGU A;  4DK3 C;  1TS5 A;  2NZH A;  2KHS A;  1PH1 A;  2NWG A;  5GQO A;  1PZJ D;  2DGY A;  1ASZ A;  1IBK Q;  4C1N I;  1U0L A;  2LY7 A;  1SFO B;  5GRO A;  3OPO A;  4DR5 L;  4PNY A;  2F0T A;  1IKM A;  4CJ0 B;  2B2T C;  4A3L H;  4OIK A;  2TMP A;  1Z7T A;  4YCV A;  2DN8 A;  5IYB H;  1HZA A;  2PZT A;  1JWS D;  5CR3 A;  1SEB D;  4A3C G;  1MHW C;  4XQN A;  1Q86 C;  2IL8 A;  1TQO A;  1SXT A;  2E5L Q;  1EY5 A;  1KAW A;  1Y1V H;  2C35 B;  4DPG A;  4QUC A;  3M7N A;  1LTR D;  4ZKC B;  3W2D A;  3HOV H;  4MTK A;  4A3D G;  1HZB A;  3ND8 A;  1Y1W G;  3PUX A;  1H95 A;  5IYD G;  1ZXT A;  3QJY A;  5JJI A;  1KRS A;  1EZ6 A;  1EU3 A;  3RLO A;  3TP6 A;  2WV6 D;  4C3I B;  2K32 A;  1RTN A;  3RZO H;  2OCE A;  1IBL Q;  1LLR D;  1I6H H;  1KXL A;  3NBI A;  4UP9 A;  1EQV A;  2YTV A;  1X3E A;  2XSC A;  1S40 A;  4A3M G;  2QIL A;  5C4X G;  2B2V C;  1JIC A;  2BA1 A;  5M5Y B;  3AB9 A;  1NNX A;  3A55 A;  5FO9 B;  1JJC B;  3D4W A;  2RQX A;  1Y1V B;  1EWI A;  5IGG A;  4CHT B;  1PH8 A;  2K75 A;  1XMQ L;  5M3M H;  3E0E A;  1XJV A;  1I4P A;  3ERO A;  2JA8 H;  2M00 A;  1PYS B;  4H7B A;  2JQO A;  4BWG B;  4M8A A;  4QJF A;  2B63 H;  2IW3 A;  2B3G A;  3TBI B;  3AMU A;  2Y0S B;  4PZ7 A;  5BR8 L;  2VB2 X;  5JAV A;  5TSS A;  1XPO A;  4Y7N H;  4HSV A;  1PZK D;  4APV A;  1IBM L;  1F9S A;  4BXX H;  4JK1 C;  3HP3 A;  4JI0 L;  1I6H B;  4DUY L;  1GJX A;  2FMM A;  1U4M A;  4DV5 Q;  1QVG A;  1DD2 A;  1HR0 L;  3I4M H;  2FMC A;  2MFI A;  5JVG 3;  1X9N A;  4A3I H;  3MVV A;  3ICE A;  4L5R C;  2MQH A;  1SYB A;  5CBE E;  1PV4 A;  2AQ1 B;  5D3D A;  1E22 A;  1D5Z C;  2ZXR A;  3SK5 A;  4MHE A;  1WTO A;  4JI3 L;  1V1Q A;  4A3E H;  3QO2 A;  1KAA A;  1B53 A;  1A15 A;  1NBW A;  3M3Y H;  2J0T D;  3NUC A;  3TZU A;  4FYD A;  2MGS A;  2EIF A;  1L0W A;  3OW2 A;  3KUP A;  2JA7 H;  2Q2H A;  3JC6 6;  4Y7N B;  4F8M A;  4HJ5 A;  2RCF A;  3OHX C;  4K14 A;  3WOF A;  4C3H G;  5C4J B;  3KK7 A;  2AUK A;  1QVC A;  2OTL A;  2O2L D;  5C6A A;  5EKL A;  4Z9C B;  4R4O A;  1QE6 A;  1SMY D;  1V1P B;  1B44 D;  2JA9 A;  3VDY A;  3NHH A;  1SMY C;  2GVB A;  2RSN A;  2R92 H;  3I4M B;  5EPJ A;  1STE A;  1CKO A;  2K4K A;  2L5T A;  4A3I B;  4CJ2 C;  3G48 A;  4DR2 Q;  4X65 Q;  1DYQ A;  4R4C A;  2B2Y A;  2OEO A;  3FP9 A;  3QOJ A;  1GD7 A;  2PPB C;  1XNR Q;  4QL5 A;  3TN2 A;  2A68 D;  1Z47 A;  5AJ3 Q;  4BY1 B;  3E3X A;  4KD4 A;  4BBS B;  1A0I A;  4O42 A;  3OTO L;  4LF5 L;  3M3Y B;  1X65 A;  4HMI A;  5ELD A;  3ND9 A;  4DV2 L;  4OX9 L;  4X6A H;  1AW7 A;  3BZK A;  5IWA L;  5COR A;  3PV0 A;  4N9P A;  2JA7 B;  1AE3 A;  2OT2 A;  3I7F A;  3M4O H;  4NXM L;  2ALY B;  2ZJQ A;  4P71 A;  5KEE A;  1KLU D;  1Q8K A;  1JCK B;  3TDQ A;  4J1M A;  3PIP 3;  3PQI A;  3PIO A;  1FGU A;  4X3U A;  5EAY A;  2XWB B;  1NY4 A;  2Y0S E;  4DV0 L;  2R92 B;  2FHT A;  3K5M A;  3OOC A;  4UP8 A;  1V1O A;  2N3S A;  3Q24 A;  2MHV A;  4A3J G;  5J3B A;  3CRK C;  4JI5 Q;  2UXB Q;  4KTA A;  3GTK B;  4JVZ A;  2JA5 H;  4NXN Q;  2JXM B;  3G4S A;  4IPC A;  2WAQ G;  3RMH A;  2ZTC A;  2DJF C;  1U4R A;  1XXG A;  2FJ2 A;  5E1F A;  1OXX K;  2E74 C;  2EY2 A;  2IT1 A;  1MI2 A;  4DV4 L;  1YNN D;  3CAM A;  5C44 G;  1D7Q A;  1EY9 A;  2PQE A;  4JCV E;  2IY5 B;  3MXN B;  4X3K A;  2Q8T A;  1E24 A;  2ASB A;  3F8T A;  4CJ1 B;  4A3F B;  1VQJ A;  3S2H H;  2F3V A;  1N8R C;  1KRT A;  4ABN A;  4EX5 A;  1HCZ A;  1PFM A;  1BCP C;  5I2X A;  4K5W A;  1D1I A;  3HOU G;  3FKI B;  1SMX A;  4PZ6 A;  4XDX A;  2A8V A;  4JI1 Q;  1VCI A;  2L1B A;  2UUB Q;  1LO5 D;  2Q2I A;  1VF5 C;  4A3C H;  5BN5 A;  2EPB A;  3F2D A;  5IE8 A;  2ES2 A;  4IO9 A;  4FO2 A;  3CCM A;  5DNF A;  3E9I A;  4H0L C;  4IOC A;  2JA5 B;  1VQB A;  3IKJ A;  3HG9 A;  4A3D H;  4DV3 L;  4DK6 C;  1VQG A;  1Y1W H;  2AHO B;  4A93 G;  5FLM G;  2K04 A;  2I46 A;  1BBU A;  5JEA G;  3J81 L;  2G5D A;  3J81 c;  1QUQ B;  1GKH A;  1UAP A;  3S2H B;  4DR1 Q;  1CTM A;  1ENF A;  1AE2 A;  1F9P A;  2HQL A;  4LFA L;  4BY7 G;  4BBR G;  3P20 A;  5A2Q L;  3NBH B;  1XTD A;  1J5E Q;  4B3R L;  1KNA A;  2A1A A;  3JAM L;  2A74 C;  5C4X H;  5LMU L;  3JAM c;  2UUA Q;  1PZI D;  2E2I H;  4P72 A;  1TR5 A;  4N8X 1;  1IYJ B;  3H0G G;  4JI8 L;  1O7I A;  2RDF A;  4JPB W;  4ME5 A;  1MSH A;  2FFK B;  2RSO A;  5EQ0 A;  3CPF A;  5FLX E;  1HNX L;  3HOY G;  2VQE L;  5CBA E;  4WJ3 M;  1VS0 A;  2HUG A;  2H4O A;  4JI7 Q;  2HHH L;  1IW7 C;  2EJG C;  2YV5 A;  1N34 Q;  1YJ9 A;  1Y1W B;  1Z9F A;  4IUQ A;  3CCQ A;  4MZ9 A;  2MUY A;  2VXW A;  1II3 A;  1SYG A;  5IT9 E;  1F2Y A;  3QOL A;  2D0P A;  4LF6 L;  1X3P A;  5C3E B;  3S15 B;  3AFQ A;  3UI2 A;  1EWC A;  4FVM A;  4BA2 I;  3MXP A;  2E2I B;  1SNO A;  1J6Q A;  2UU9 Q;  3RNU A;  4DNI A;  1GXD C;  4KK7 A;  1RL2 A;  1I50 B;  1VQN A;  1FVI A;  3J80 E;  2ID0 A;  5FJ8 G;  2VUM B;  2GN5 A;  4L63 B;  1K3R A;  2KCN A;  4RH6 A;  3S17 H;  4B3T Q;  1I4G A;  2PZW A;  2ZM6 Q;  2JEA I;  1JR0 D;  1U4P A;  2JP1 A;  5CGK A;  4LF8 L;  4H02 A;  1PFN A;  2R93 B;  3GTM B;  2YTY A;  2EE1 A;  1D8L A;  3KLR A;  1VMP A;  3OMC A;  1YI2 A;  4X62 Q;  3K80 C;  1EY4 A;  1ICF B;  2EXZ A;  1K28 A;  3MEH A;  3KJO A;  2D62 A;  2QA4 A;  5E4X A;  3KF6 B;  1SJH D;  1T5X D;  3K5O A;  2N78 A;  1HA5 A;  1N36 Q;  3X3M A;  2JSO A;  1T9H A;  1EOT A;  4EQ5 A;  5IP7 H;  4DV6 Q;  2R7D A;  1W2B A;  3DUZ A;  4B3S Q;  1QOH A;  3W1G A;  1DOM A;  3U58 A;  3H3V C;  2SNM A;  1Z6H A;  4GN4 B;  4KI0 A;  2CH4 W;  3S17 B;  5JEA J;  2K05 A;  5DM6 3;  1EY0 A;  2IHE A;  2G9D A;  1D5X C;  1STA A;  1YBY A;  4C3I G;  3CF5 A;  1VMC A;  1X56 A;  2FIN B;  2KJX A;  3RD4 A;  3H3V H;  1A8V A;  1XPU A;  1XYI A;  1CA6 A;  4A3L G;  4RGT A;  1CKN B;  2I5H A;  2NUC A;  1C7Y A;  2F03 A;  2PNR C;  4XYO A;  1QG7 A;  4X64 Q;  1HRJ A;  2EJF C;  4AQY Q;  3T1Y L;  3S1M H;  5EKK A;  2KUM A;  1RCV D;  3TSS A;  1QJO A;  2B2W C;  3KF8 A;  4A3G H;  2EYP A;  1G91 A;  1M1K C;  3I90 A;  3E5S A;  1OTC A;  2BOS A;  2B39 A;  1Y1V G;  1HFG A;  3RN5 A;  1X3F A;  2PNH A;  4A3J H;  1DCZ A;  2CWP A;  3A54 A;  4EGV A;  1NTG A;  3CKI B;  1IL2 A;  2Y0S G;  4L5T A;  4R8N A;  1XTC D;  3J7A 5;  2C5C A;  1STH A;  2KBN A;  4LUZ A;  4N9T A;  1ET6 A;  3SE0 A;  2B2W A;  2KHJ A;  4KLK A;  5C0X H;  4FXD A;  4KHP L;  1SE8 A;  4PG3 A;  1R9T H;  3HS0 C;  3G6E A;  2BE5 D;  3PSI A;  4DR7 Q;  1G2S A;  3UE0 A;  3RUZ A;  1HQM C;  3VR2 A;  1ZKO A;  3M7G A;  2QKI C;  4UDU C;  3HZX A;  4WJW A;  3HOU H;  1KNE A;  4H44 C;  1ZYR D;  4A3G B;  1M8A A;  1CSQ A;  3WWV A;  1HNW Q;  4FF4 A;  3DHQ A;  3K5N A;  1YNJ D;  2MPM A;  4YIJ A;  1HHV A;  4LF4 Q;  4IFD H;  4M1U B;  1V8Q A;  4GOP A;  1KQS A;  3CME A;  1FNW A;  4KN7 C;  4RG1 A;  3CD6 A;  1O7L A;  4GLX A;  3H09 A;  2VQF L;  1JWM D;  3PUZ A;  2PI2 E;  3MHB A;  1O80 A;  1M4V A;  1S5E D;  4C56 C;  3GTG B;  2EY6 A;  1I4Q A;  1AEX A;  4TSS A;  5BN4 A;  1SNQ A;  4IUP A;  4BXX G;  1VQE A;  5FLM H;  2NN6 I;  1BUV T;  2M2L A;  5JEA H;  5ELN A;  2RDH A;  3NXW A;  1EY6 A;  3NEN A;  3VYS A;  2CW0 D;  5ELO A;  4K8I A;  4BY7 H;  4BBR H;  2WKC A;  4YHH L;  1PRT D;  2EOT A;  1I94 L;  3DMU A;  3FDT A;  4A3I G;  3K7A H;  2JK8 A;  1IYU A;  2L9H A;  2XIW A;  4DXG A;  1HH2 P;  4HID A;  1VQP A;  1EFI D;  1HNZ Q;  2F4V Q;  3I3C A;  4GKK L;  4BY1 G;  1NMF A;  3CCU A;  1VQ6 A;  3HOY H;  4BBS G;  1GM5 A;  2EYH A;  3K0X A;  1PHJ A;  4RAU C;  4IFD I;  4J6H A;  1EY7 A;  3NTK A;  1E7Z A;  4S3S A;  2JA7 G;  1KTK A;  1W3S A;  5G3L F;  4DR4 L;  1SRU A;  1TS4 A;  3B6Y A;  4DAY A;  2K5N A;  1HUM A;  2K14 A;  3S14 H;  4RGM A;  3R2T A;  4A4I A;  1WTR A;  2R92 G;  1F9Q A;  3W5O A;  1C9O A;  5FO7 B;  3GP7 A;  1ONL A;  1SLJ A;  3NE5 B;  4KHV A;  3K81 C;  5HUR A;  2OTJ A;  5ELF A;  2QF7 A;  5LMN Q;  2QCP X;  4G7O C;  1BXT A;  1XNQ L;  2QDB A;  5T1G A;  2F0K A;  4KN4 C;  1GUW A;  3VYU A;  1TII D;  3KDF B;  3K57 A;  1S5B D;  1DOK A;  4A3F G;  3I4O A;  4LFB Q;  2MO1 A;  2ZT9 C;  1CA5 A;  3PUV A;  4DV1 L;  4ZLT F;  4DUZ L;  4ZAI A;  3FKI G;  1K8G A;  5FKA C;  1J8I A;  3S14 B;  3D6C A;  1NE3 A;  4OL7 A;  2N88 A;  4JG2 A;  3MWY W;  4JI6 Q;  5KNB A;  2A6E C;  3S2D B;  1O7Y A;  4R1J A;  4FP5 D;  2KCT A;  4X3T A;  2JA5 G;  4I7A A;  3HFZ B;  2F4I A;  1WTX A;  1HA6 A;  1QZG A;  1LT3 D;  4CBV A;  3UDG A;  2M9V A;  4IPD A;  2OF1 A;  1HZC A;  3J7A V;  4JI2 L;  1HJP A;  4TRD A;  4JBK A;  1U5K A;  1ICW A;  2C9O A;  4C3I H;  2EQS A;  2MJ8 A;  3SHL A;  1PH6 A;  3T56 B;  3SEB A;  5ELE A;  2DY7 A;  2NTT A;  2UXD Q;  1HUN A;  3I8Z A;  3K59 A;  1ZEQ X;  2L55 A;  3GV6 A;  4K2K A;  1VQ7 A;  3KOJ A;  5M5Y H;  1TU2 B;  3H15 A;  4LF7 L;  4KY6 A;  3FMC A;  3BVM A;  2L4N A;  1ROD A;  1UE1 A;  2HDL A;  2KCM A;  2V4D A;  3KLS X;  3C46 A;  1FL0 A;  3VR4 A;  4K2L A;  4BA1 I;  1K83 H;  1LM0 A;  1I3Q H;  2F52 A;  1ASY A;  3F2C A;  5IOC A;  3BG3 A;  1HR0 Q;  1H9K A;  2B2T A;  4YWK A;  1J9O A;  3CCE A;  3OWE B;  1YZ6 A;  3ERS X;  2BH8 A;  2K03 A;  2CCZ A;  3CPW A;  2JA6 H;  1G6P A;  4OO1 I;  4K6L A;  3Q8D A;  1SYE A;  1QWY A;  5C3E G;  3HOZ H;  2IHF A;  4C3J B;  2WP8 J;  3HOW H;  4HJ9 A;  4OWW B;  1DJR D;  1K9M C;  2NYZ D;  4XT1 B;  3STB C;  1EIH A;  1TS2 A;  3T51 B;  5COY A;  2VUM G;  1K83 B;  1KDC A;  2F3I A;  1I3Q B;  1QVF A;  3SR1 A;  2XTI A;  1VQ8 A;  3J81 i;  2XRS D;  3CQZ H;  1S72 A;  1GUO A;  2SNS A;  2R93 G;  2B2V A;  3VA5 A;  4OWT B;  2JA6 B;  4UP7 A;  1BNZ A;  3Q23 A;  5JPM C;  1JE5 A;  2HIX A;  1B7Y B;  2XN9 C;  3JAM i;  2KQ3 A;  1IBK L;  3BVG A;  3M9B A;  2RCN A;  3UDI A;  5C4J H;  1GHK A;  4ULL A;  5IY0 A;  3HOZ B;  3ULL A;  4I7Z C;  4A3B H;  3VYR A;  2CKZ B;  1ILQ A;  5C3W A;  3HOW B;  4HJA A;  3E9H A;  3T13 A;  2X69 A;  5T1I A;  1IXR A;  1PLF A;  1Y8N B;  3UE1 A;  5A2Q E;  5CV7 A;  1V1P A;  2F1M A;  2HD3 A;  3JAM E;  1UE7 A;  2KED A;  4HN7 A;  3GQB A;  3OSO A;  4ZK9 B;  4BY1 H;  1G8Z D;  3ER0 A;  4JW0 A;  5CV5 A;  4BBS H;  4DAP A;  2F0U A;  1EYD A;  2E5L L;  1GUS A;  3GV3 A;  2AKW B;  3CQZ B;  2Q2T A;  5CYU A;  3R3O A;  1JOR A;  4OGQ C;  1WFQ A;  1ILP A;  4QQB X;  2JEB I;  4OXP A;  4FXK C;  4A3B B;  3VYT A;  5JPN C;  3NQT A;  3PIP A;  1I4X A;  1VQA A;  1IBL L;  4ID6 A;  5IP7 G;  3C3L A;  4POF A;  2N55 A;  3HEJ A;  1PTO F;  2K5V A;  4KY5 A;  2D2C C;  2B2U C;  5C5M A;  5IGD A;  4ILW A;  3PGZ A;  3GTK H;  1AN8 A;  2A6H C;  1S5F D;  3U9S A;  1I4H A;  4FF2 A;  2RHQ B;  2Z9H A;  4LFC Q;  2EYM A;  4QUF A;  3L3O C;  3NSW A;  4F88 A;  4XTC S;  2ZTD A;  4A3F H;  2VW9 A;  5FOB B;  3SGI A;  2VB3 X;  1VQK A;  1I5F A;  2TSS A;  4V0B A;  4CDC C;  3PF5 A;  2F0S A;  3FKI H;  2HT1 A;  4A3G G;  4DA2 A;  2UUC Q;  4A75 A;  1A3U A;  1TVX A;  3P75 A;  2BDO A;  1N33 L;  3PO2 G;  4R9W A;  3L9A X;  5LHY 1;  4GS3 A;  4DV5 L;  4U67 3;  3O13 A;  3PUY A;  5KND A;  3NEL A;  2PCF B;  1G29 1;  4IUR A;  1CK1 A;  1SDF A;  2AMC B;  1SNC A;  3OW7 A;  4DKA C;  3TP5 A;  5IGE A;  5C0X G;  1A2U A;  4CKB A;  4JI4 Q;  3AEV A;  4QY7 A;  3A7L A;  1KAB A;  1BCP D;  1L1O B;  1DOL A;  4RKL A;  3CCL A;  1OXU A;  2IX0 A;  5KIX A;  4JOI C;  4KMU C;  2E2D C;  1QUQ A;  1EIY B;  1PTO C;  1WCM B;  1EFW A;  2JJQ A;  3A0J A;  4JC0 A;  5EPL A;  4C1N K;  3PMF A;  1AFP A;  3NBH A;  2UXC Q;  1EZ8 A;  4JBM A;  4YY3 Q;  4IFD G;  3MC0 B;  2Q8R E;  1VQO A;  4V19 0;  3FEW X;  1PTO H;  4CKC A;  2K7V A;  4TQU S;  4KJN A;  3FVQ A;  4WFN 3;  1W6K A;  4IAL A;  4DR2 L;  5I4D A;  4RCN A;  4X65 L;  1RHP A;  3LNN A;  5LL6 S;  3DM3 A;  1XNR L;  1HFN A;  1LTL A;  1YEZ A;  2EJM A;  4IPG A;  1YIJ A;  3DXJ C;  3A5U A;  1Q8I A;  4LAA A;  3J7Y W;  3BS1 A;  1C4Q A;  4ZKB B;  2LKV A;  5C3E H;  3S15 H;  1I6V C;  3E0J A;  4DK0 A;  4JYA Q;  3TEH B;  2PQA B;  2XVS A;  3TRZ A;  1JOK A;  5KGU A;  1SND A;  3SK8 A;  3K7U C;  2QEX A;  5EBD A;  1I50 H;  1BVS A;  4DNR B;  2F0M A;  1K0R A;  2Q8I B;  2K01 A;  4DF7 A;  2F0Q A;  3L2P A;  2VUM H;  5JVH 3;  1PTO B;  4NPS A;  4GKJ Q;  2F0O A;  2HIV A;  2HCC A;  1IW7 D;  1QB5 D;  2R6G A;  1AH9 A;  4NKL A;  4JI5 L;  2UXB L;  5L37 A;  4C2M B;  1X55 A;  3GTM H;  2EZV A;  2R93 H;  4IPH A;  4NXN L;  2CFM A;  1BBX C;  1E2V A;  4XT3 B;  3EA6 A;  1WOC A;  2Z4I A;  3NWT A;  3AU7 A;  4HIO A;  4DR6 Q;  1CQV A;  4QB4 A;  3PF4 A;  5JOB A;  2E2J H;  3T1H L;  1H9S B;  3K0Y A;  4IUT A;  2RF4 A;  2A5H A;  3KF6 A;  1PVO A;  4GLA C;  5C0X J;  1GO3 E;  5IOD A;  3NWS A;  4JI1 L;  4AH6 A;  2UUB L;  1H9R A;  1P16 A;  4B9X A;  2AWO A;  1X32 A;  1SBB B;  1KD1 C;  1V9P A;  2A69 C;  4FDB A;  3CCJ A;  1R4Q B;  1FYC A;  3I91 A;  3S16 H;  2SEB D;  2SOB A;  3NTI A;  2AQ3 B;  1E0B A;  3EFX D;  1MSG A;  3WOE A;  1SN8 A;  3Q6S A;  3NP8 A;  3J81 j;  1D2B A;  1EIF A;  5EBC A;  4BS9 A;  1LTI D;  2PYK A;  1VQM A;  4IFD J;  2BA0 A;  2B29 A;  2E2J B;  3S1Q B;  1L0Y B;  4F87 A;  4DR1 L;  3BZD B;  3WDN A;  3OIP A;  1GOZ A;  4K8J A;  4WJ4 A;  1J5E L;  1XMO Q;  2QW7 A;  2UUA L;  3OYY A;  3U9O A;  2JE6 I;  3SVM A;  1LYL A;  2KEE A;  5JJL A;  1CKM A;  5CV9 A;  5I2Y A;  4KJO A;  4P74 A;  3RZD H;  3AYH B;  4X66 Q;  4PMC A;  4UPA A;  5M5W H;  3MXG A;  1X54 A;  4NB3 A;  3S16 B;  1X3G A;  1E2Z A;  4KKS A;  4JI7 L;  4Y52 H;  1N34 L;  4C3J G;  1EU4 A;  1ENA A;  2LXK A;  2SDF A;  2QDL A;  3FPP A;  1N9W A;  1SYC A;  1H9M A;  1LTB D;  3Q0A A;  1YJW A;  5FK9 C;  2KOL A;  3CC2 A;  3ITP A;  4LNQ A;  1H9J A;  3EVQ A;  3LWU A;  3PO2 H;  3GD7 A;  2L12 A;  1Y14 B;  2E75 C;  1UUP A;  3IFD A;  1O78 A;  1CHQ D;  4CDD C;  1N32 Q;  3EBE A;  2UU9 L;  5C5L A;  2NN6 H;  1VQ9 A;  3H91 A;  4FNF A;  2JA6 G;  2R7Z B;  1C48 A;  1FNV A;  4GKK Q;  1B2T A;  3GTG H;  3RZD B;  3RLF A;  1BF4 A;  4B3T L;  4DNT B;  1PDQ A;  5M5W B;  1F2L A;  1VDZ A;  2RDG A;  3BDC A;  2E2H H;  3HOZ G;  4NP5 A;  3I72 A;  5E4W C;  3I4N H;  4LJZ C;  1F77 A;  2D5D A;  4OIJ A;  4ODG A;  3P1H A;  4XYQ A;  4P73 A;  3HOW G;  2AUJ D;  3MAQ A;  2DY8 A;  5LMN W;  4LMQ D;  5GAE C;  1HQR D;  4DR3 Q;  1K73 C;  3N52 A;  1EYC A;  2H5X A;  1MJC A;  4IJH A;  4LUV A;  3PO2 B;  3TZD A;  1OO9 B;  1WTW A;  3BYY B;  1N36 L;  1QNU A;  3KF8 B;  5E3F A;  2BCO A;  4KD3 A;  4DV6 L;  2F0W A;  1NJI C;  1CZG A;  4GN5 A;  5FLX L;  5IP9 G;  1EYG A;  5FLX c;  4KKT A;  2ZJP A;  2VS1 A;  1CZW A;  3CU7 A;  5DEH A;  5EKI A;  4DV7 Q;  2E2H B;  3KBG A;  4XQQ A;  4O1N A;  2WB1 B;  5IIF A;  4A3B G;  3I4N B;  3R93 A;  1FNU A;  2CQA A;  2XRQ D;  4B3M Q;  3DWQ A;  4IN3 A;  4K0K Q;  5IT9 c;  3R8B A;  3FPU B;  2LFN A;  2L15 A;  1S4Z A;  4XXE A;  2NVQ H;  4X64 L;  4JV5 Q;  2EYO A;  1LV9 A;  3VR6 A;  2IX3 A;  4AQY L;  2KCC A;  3DLL A;  1X3Q A;  1MKH A;  1MD2 D;  1TY2 A;  1B50 A;  2LS0 1;  3GTL H;  4LUO A;  1EQT A;  1PYB A;  2EYJ A;  2EYL A;  2R61 A;  1EEI D;  2PW5 A;  1ML0 D;  4P2C B;  4CKE A;  4MTN A;  1EOV A;  3J80 c;  3UDF A;  3V96 A;  4LK1 C;  1RJT A;  3RR5 A;  1B3Q A;  3GTO H;  1E2W A;  2VNU D;  1LTT D;  2Z6K C;  3S9W A;  4ZYS A;  5CMD A;  1JMC A;  3NTH A;  4DR5 Q;  4WRD A;  4YCW A;  2WFW A;  1WJJ A;  1LT5 D;  3SXH A;  4TKO B;  1DXM A;  1HR0 W;  3KLS A;  3S2D H;  3TRE A;  1B9M A;  1AZP A;  3OIQ A;  1RD9 D;  1BQQ T;  1SR3 A;  4OEL B;  4DR7 L;  2NVQ B;  4GNX C;  4HCE A;  4Q5V A;  2YU9 B;  3I70 A;  1SNM A;  5DAU A;  3GTL B;  2KEN A;  3HOX B;  3BJU A;  1B70 B;  1HNW L;  1YHA A;  4LF4 L;  1VQF A;  3S24 A;  3GTO B;  1K8A C;  1EWH A;  3BDL A;  4IZ8 A;  5IGC A;  1EUJ A;  3X3N A;  1TWC B;  2KHI A;  4HAE A;  1NAP A;  1OXS C;  4YWM A;  1RTO A;  1WCM G;  5J22 A;  2WIN B;  3H6M A;  4GN3 B;  2DJG C;  1PRT B;  1R4P B;  2A6E D;  5D3I B;  3I56 A;  3CHB D;  4A3K H;  1F2M A;  5M3F H;  3MFG A;  4L6T B;  1BDO A;  4FXG C;  3KLW A;  3MTS A;  3QG1 A;  1JOO A;  1W6J A;  4X3S A;  2JN4 A;  2WB1 E;  4OO1 H;  3QR8 A;  1NCV A;  4R8I A;  4ZUJ A;  1QIL A;  4O2D A;  4CGY B;  4ALP A;  1HNZ L;  2F4V L;  1FGB D;  3BZC A;  1GUN A;  4K6D A;  4HIM A;  5M9O A;  5KYI A;  4GNX B;  2I5L X;  1XMQ Q;  1ET9 A;  2PW7 A;  1CT1 D;  3VR5 A;  2OQ0 A;  1G2T A;  2NVY H;  2E8G A;  1X6O A;  4LF9 L;  2R3Z A;  3DEP A;  5BR8 Q;  2KEC A;  1PFS A;  1SYF A;  2NZO A;  3KBX A;  4C3J H;  1KC8 C;  5EGT A;  3I2Z A;  1NUC A;  1A63 A;  1IKL A;  2K1B A;  1IBM Q;  4JI0 Q;  4OHJ A;  2RKS A;  4A3K B;  2I07 B;  4DUY Q;  2CQO A;  4RHR A;  5M3F B;  3IRB A;  3PCO B;  1DZ1 A;  4UHV A;  5H1S E;  4IUU A;  1UNS A;  3A56 A;  2ZXP A;  4B08 A;  1K8M A;  3J7Z C;  1DGS A;  2ATW A;  1Q82 C;  4RHS A;  2NBF A;  3K5L A;  1WTV A;  3EN2 A;  5LMN L;  4DAM A;  4JI3 Q;  1UE6 A;  2NVY B;  3DWP A;  4AYB G;  4RWS C;  2LMC B;  4TVA B;  4I65 A;  3RLN A;  4LFB L;  1VQ5 A;  3BDO A;  5I9O A;  2CHB D;  1BBW A;  1XX8 A;  3DEO A;  3STB D;  1AP0 A;  1S5C D;  1KDA A;  3U50 C; 
#chains in the Genus database with same CATH homology
 2CVR A;  4RGN A;  2YYZ A;  4HED A;  5BN3 A;  1O7Z A;  4G4K A;  1Y69 U;  3K58 A;  1Q1B A;  1LT6 D;  2O5I C;  1JE4 A;  2F0D A;  3EJI A;  1RF2 D;  5J1Z A;  4WOR A;  2WKD A;  3HKZ B;  1CM9 A;  1SE3 A;  1WVL A;  4FF1 A;  3HOV B;  4QF4 A;  5NUC A;  1DON A;  3J81 E;  4HTH A;  1QCB D;  1D5M C;  4DXF A;  2F0E A;  5F2D A;  5KYL A;  2EVB A;  3QWN A;  3RZO B;  1Y8O B;  1A3T A;  5K36 H;  3TP7 A;  4ZRZ A;  4HSP A;  4EVO A;  5CC4 A;  3DM1 A;  1WTQ A;  3PO3 B;  2OXP A;  5I9P A;  5ELC A;  5D14 A;  5M3M B;  3HRZ C;  2JA8 B;  3H94 A;  2AQ2 B;  3QB3 A;  2F0I A;  2B63 B;  3G6J B;  4IUV A;  1DM0 B;  2A6H D;  2B2Y C;  1RKN A;  3R2I A;  3EQL C;  1Q3L A;  1D6E C;  5IGB A;  1CQF A;  4K5V A;  3IFT A;  1BCP F;  3LWE A;  1BR9 A;  3NK9 A;  3IAY A;  1STN A;  2B2U A;  3MXN A;  5I6Y A;  3D31 A;  4PQX A;  1Y8P B;  4QIW B;  1LT4 D;  2A68 C;  4A3E B;  2KVM A;  1ENC A;  2NB0 A;  4MN3 A;  1STY A;  4EQP A;  4XQJ A;  3E6Z X;  1TKW B;  2NN6 G;  1PMR A;  5C4H A;  1CHP D;  3A8J E;  5ELB A;  2K28 A;  3VR3 A;  3C1F A;  4B9W A;  1TWH B;  2EDG A;  5EJW A;  1CI3 M;  1PTO D;  1KDB A;  2IWH A;  1LAC A;  1EY8 A;  1YNN C;  1JOQ A;  3CRL C;  3OMG A;  2PMZ B;  3ONA B;  2L11 A;  3M4O B;  4G57 A;  3PIO 3;  1EEF D;  3GTQ B;  3D6W A;  5KRU A;  2JYO A;  4UAI A;  1JWU D;  1TWF B;  4MIU A;  1G6Z A;  2RBM A;  2L0C A;  2PZU A;  3N6R A;  3Q22 A;  1LAB A;  4KKU A;  2F0P A;  4RKB A;  3PUW A;  1SE4 A;  5HGT A;  1Q12 A;  3ZYY X;  2AWN A;  4EQN A;  1IYV A;  1H9S A;  1PYW D;  3MA2 B;  1EIG A;  3T4A C;  2XWJ B;  1A3V A;  1JC7 A;  4GZY C;  1C8C A;  3OWF A;  2B8G A;  2WAC A;  3D8G A;  3D3R A;  1STB A;  1A2T A;  2H1E A;  3T16 A;  1BCP B;  4G7H C;  3GTJ B;  1B4O A;  2X6G A;  4E6I A;  1I4R A;  4AYB B;  1BOS A;  3V2T A;  1WD0 A;  2G9H D;  1K8O A;  1NSN S;  3A7A B;  4A3D B;  1TWA B;  4PV1 C;  1L0X B;  5M5X B;  2K5Q A;  1TS3 A;  3BYT B;  4DN4 M;  1S5D D;  1OXV A;  3S1N B;  5C3X A;  2A69 D;  3QIA A;  3FRP B;  5ISR A;  4A3M B;  5C4X B;  2K5W A;  1NR4 A;  1QNK A;  1EL0 A;  1T5E A;  1ESF A;  3M4Y A;  4ZQ3 A;  2F0J A;  3HGB A;  2K33 A;  1IHZ A;  4RCO A;  4KY7 A;  1HPC A;  3A8K E;  5C4Z A;  4H13 C;  3IL8 A;  4DAV A;  1HTP A;  4OO1 G;  2F0L A;  5DM7 3;  1KLG D;  1GUG A;  2NTS A;  2DNC A;  1MBY A;  1CFM A;  4JBW A;  2IJ0 A;  4F7X A;  2DNE A;  3K6O A;  4RFB A;  4Q0F A;  5J39 A;  1V43 A;  2Z8L A;  1FR3 A;  3MXU A;  3SK4 A;  2O5J C;  4RGO S;  3A8I E;  1LTG D;  5K5P A;  4NDX A;  3G7L A;  3GO5 A;  2WII B;  1RDP D;  4U68 A;  4KHZ A;  2MP1 A;  3L7Z C;  4KV6 A;  1TY0 A;  1TWG B;  1JQY D;  3W3A A;  4XIG S;  4C3H B;  2F0G A;  2GA4 B;  1XWE A;  2EY1 A;  2NVX B;  3LX0 A;  2O4X A;  1WD1 A;  1SJE D;  1SSO A;  1PFB A;  1B1Z A;  2A73 B;  1Q90 A;  1U4L A;  4HR7 B;  1PRT F;  2Z1C A;  4DK1 A;  2K6A A;  3MFY A;  2PO4 A;  1NR2 A;  4K5X A;  2EYF A;  4ZUI A;  3S1R B;  2BDN A;  1F9R A;  2B8F A;  2J4X A;  1FD7 D;  2EY5 A;  4DU9 A;  5EPK A;  1Q1E A;  2K5D A;  5D65 A;  1UEA B;  3VA7 A;  2RVL A;  2ICI A;  2BE5 C;  1SE2 A;  5LL6 X;  2HCI A;  3S1M B;  1HTL D;  1IL8 A;  5I6W A;  3M85 A;  1ZYR C;  2NZ1 D;  2Z4H A;  1LTS D;  1D1K A;  1TT2 A;  3NQI A;  4PMB A;  1YNJ C;  2QEJ C;  1LTA D;  2E76 C;  3MZ5 A;  4A3J B;  3TME A;  3C2P A;  3I73 A;  2HDM A;  5IT9 L;  4NW2 A;  2WAQ B;  1B3A A;  5AFW A;  1OXT A;  1GUT A;  4HMJ A;  2F0N A;  5C44 B;  1A6X A;  1R9T B;  5CV6 A;  1SNP A;  5KNC A;  1MGS A;  3T53 B;  5K36 G;  5C0X I;  1EYA A;  3SDZ A;  2CW0 C;  4IQZ A;  4FF3 A;  3ERQ A;  3HOU B;  4DFA A;  3J80 L;  4EQO A;  2HQE A;  1PRT C;  2KA7 A;  3BVZ A;  2F3W A;  1SAP A;  2XNA C;  2J7Z A;  4NMZ A;  1WTP A;  3F2U A;  3SK6 A;  1JB3 A;  1HXY D;  3I4L A;  5CV4 A;  1PXU A;  1STG A;  2ICE C;  3NPP A;  2NVT B;  5CV8 A;  4A93 B;  2F0F A;  3DWA A;  4J8Q A;  4BY7 B;  1VF7 A;  4BBR B;  4RA8 A;  1SYD A;  1BO0 A;  1F2Z A;  4HCS A;  1U9R A;  3K7A B;  2D9U A;  3D4R A;  1B9N A;  3H0G B;  5FO8 B;  2X6L A;  3P7J A;  3C1E A;  1ESR A;  4QCL A;  2ENB A;  3HOY B;  3TP8 A;  3GTP B;  3V05 A;  5IGF A;  3D4D A;  2F0V A;  4G7Z C;  4L8J A;  5A35 A;  2IPK D;  1GHJ A;  4QMG A;  5G3L D;  1AZQ A;  3J7A F;  4IUN A;  4DGZ A;  2ZXO A;  2RA4 A;  3URY A;  2IX1 A;  4PMW A;  5JJZ A;  2F0H A;  1TS5 A;  2KHS A;  2NWG A;  1PZJ D;  4C1N I;  2LY7 A;  1SFO B;  3OPO A;  4PNY A;  2F0T A;  1IKM A;  4CJ0 B;  2B2T C;  4OIK A;  2TMP A;  1Z7T A;  2DN8 A;  2PZT A;  1JWS D;  5CR3 A;  1SEB D;  4XQN A;  2IL8 A;  1TQO A;  1SXT A;  1EY5 A;  4QUC A;  3M7N A;  1LTR D;  4ZKC B;  3W2D A;  3ND8 A;  3PUX A;  1ZXT A;  3QJY A;  1EZ6 A;  1EU3 A;  3TP6 A;  2WV6 D;  4C3I B;  2K32 A;  1RTN A;  1LLR D;  3NBI A;  1EQV A;  2XSC A;  2QIL A;  2B2V C;  1JIC A;  2BA1 A;  5M5Y B;  3AB9 A;  3A55 A;  5FO9 B;  3D4W A;  2RQX A;  1Y1V B;  5IGG A;  4CHT B;  1I4P A;  3ERO A;  2M00 A;  4H7B A;  4BWG B;  4M8A A;  2IW3 A;  3TBI B;  3AMU A;  2Y0S B;  2VB2 X;  5JAV A;  5TSS A;  4HSV A;  1PZK D;  1F9S A;  4JK1 C;  3HP3 A;  1I6H B;  1GJX A;  2FMM A;  1U4M A;  1DD2 A;  2FMC A;  5JVG 3;  3MVV A;  5CBE E;  1SYB A;  2AQ1 B;  5D3D A;  1D5Z C;  2ZXR A;  3SK5 A;  4MHE A;  1WTO A;  3QO2 A;  1KAA A;  1B53 A;  1A15 A;  2J0T D;  3NUC A;  3TZU A;  4FYD A;  2MGS A;  3KUP A;  4Y7N B;  4F8M A;  3OHX C;  4K14 A;  3WOF A;  4C3H G;  5C4J B;  3KK7 A;  2AUK A;  2O2L D;  5C6A A;  5EKL A;  4Z9C B;  1QE6 A;  1SMY D;  1V1P B;  1B44 D;  3NHH A;  1SMY C;  2RSN A;  3I4M B;  5EPJ A;  1STE A;  2L5T A;  4A3I B;  4CJ2 C;  1DYQ A;  2B2Y A;  2OEO A;  3QOJ A;  2PPB C;  3TN2 A;  2A68 D;  1Z47 A;  4BY1 B;  4KD4 A;  4BBS B;  4O42 A;  3M3Y B;  4HMI A;  5ELD A;  3ND9 A;  1AW7 A;  5COR A;  3PV0 A;  4N9P A;  2JA7 B;  2OT2 A;  5KEE A;  1KLU D;  1JCK B;  3TDQ A;  4J1M A;  3PIP 3;  4X3U A;  2XWB B;  2R92 B;  2FHT A;  3K5M A;  3OOC A;  1V1O A;  3Q24 A;  2MHV A;  3CRK C;  4KTA A;  3GTK B;  2JXM B;  3RMH A;  1U4R A;  1XXG A;  2FJ2 A;  5E1F A;  1OXX K;  2E74 C;  2EY2 A;  2IT1 A;  1MI2 A;  1YNN D;  1EY9 A;  2PQE A;  4X3K A;  2Q8T A;  4CJ1 B;  4A3F B;  2F3V A;  4ABN A;  1HCZ A;  1PFM A;  1BCP C;  5I2X A;  4K5W A;  1D1I A;  3FKI B;  4XDX A;  1VCI A;  2L1B A;  1LO5 D;  1VF5 C;  5BN5 A;  2EPB A;  4FO2 A;  5DNF A;  4H0L C;  2JA5 B;  3IKJ A;  3HG9 A;  2K04 A;  2I46 A;  5JEA G;  3J81 L;  1UAP A;  3S2H B;  1CTM A;  1ENF A;  1F9P A;  3P20 A;  5A2Q L;  1KNA A;  3JAM L;  2A74 C;  1PZI D;  1TR5 A;  2RDF A;  4ME5 A;  1MSH A;  2FFK B;  2RSO A;  5EQ0 A;  5FLX E;  5CBA E;  2HUG A;  2H4O A;  1IW7 C;  2EJG C;  1Y1W B;  4IUQ A;  2MUY A;  2VXW A;  1II3 A;  1SYG A;  5IT9 E;  1F2Y A;  3QOL A;  1X3P A;  5C3E B;  3S15 B;  3UI2 A;  1EWC A;  4FVM A;  4BA2 I;  3MXP A;  2E2I B;  1SNO A;  1GXD C;  4KK7 A;  1I50 B;  3J80 E;  2ID0 A;  2VUM B;  4L63 B;  2KCN A;  4RH6 A;  1I4G A;  2PZW A;  2JEA I;  1JR0 D;  1U4P A;  2JP1 A;  5CGK A;  1PFN A;  2R93 B;  3GTM B;  2EE1 A;  3KLR A;  1VMP A;  3OMC A;  1EY4 A;  2EXZ A;  3MEH A;  2D62 A;  5E4X A;  1SJH D;  1T5X D;  3K5O A;  1HA5 A;  3X3M A;  2JSO A;  1EOT A;  3DUZ A;  1QOH A;  1DOM A;  3H3V C;  2SNM A;  1Z6H A;  4KI0 A;  3S17 B;  5JEA J;  2K05 A;  5DM6 3;  1EY0 A;  2G9D A;  1D5X C;  1STA A;  4C3I G;  1VMC A;  2FIN B;  2KJX A;  3RD4 A;  1XYI A;  1CA6 A;  4RGT A;  2NUC A;  2F03 A;  2PNR C;  4XYO A;  1QG7 A;  1HRJ A;  2EJF C;  5EKK A;  2KUM A;  1RCV D;  3TSS A;  1QJO A;  2B2W C;  3KF8 A;  2EYP A;  1G91 A;  3I90 A;  3E5S A;  2BOS A;  2B39 A;  1HFG A;  1DCZ A;  3A54 A;  4EGV A;  3CKI B;  4R8N A;  1XTC D;  2C5C A;  1STH A;  4N9T A;  1ET6 A;  3SE0 A;  2B2W A;  4FXD A;  5C0X H;  3HS0 C;  2BE5 D;  1G2S A;  3RUZ A;  1HQM C;  3VR2 A;  1ZKO A;  3M7G A;  2QKI C;  4UDU C;  3HZX A;  4WJW A;  1KNE A;  4H44 C;  1ZYR D;  4A3G B;  1M8A A;  4FF4 A;  3DHQ A;  3K5N A;  1YNJ D;  2MPM A;  4YIJ A;  1HHV A;  4IFD H;  4M1U B;  1V8Q A;  1FNW A;  4KN7 C;  1O7L A;  3H09 A;  1JWM D;  3PUZ A;  3MHB A;  1O80 A;  1M4V A;  1S5E D;  4C56 C;  3GTG B;  2EY6 A;  1I4Q A;  1AEX A;  4TSS A;  5BN4 A;  1SNQ A;  4IUP A;  2NN6 I;  1BUV T;  2M2L A;  5JEA H;  2RDH A;  3NXW A;  1EY6 A;  3VYS A;  2CW0 D;  4K8I A;  2WKC A;  1PRT D;  2EOT A;  3DMU A;  3FDT A;  1IYU A;  2L9H A;  2XIW A;  4DXG A;  1EFI D;  3I3C A;  2EYH A;  4RAU C;  4IFD I;  4J6H A;  1EY7 A;  3NTK A;  4S3S A;  1KTK A;  5G3L F;  1TS4 A;  4DAY A;  1HUM A;  4RGM A;  3R2T A;  1WTR A;  1F9Q A;  5FO7 B;  3GP7 A;  1ONL A;  3NE5 B;  4KHV A;  5HUR A;  5ELF A;  2QF7 A;  2QCP X;  4G7O C;  1BXT A;  2QDB A;  5T1G A;  2F0K A;  4KN4 C;  1GUW A;  3VYU A;  1TII D;  3K57 A;  1S5B D;  1DOK A;  2ZT9 C;  1CA5 A;  3PUV A;  4ZLT F;  4ZAI A;  5FKA C;  1J8I A;  3S14 B;  3D6C A;  4OL7 A;  2N88 A;  3MWY W;  5KNB A;  2A6E C;  3S2D B;  1O7Y A;  4FP5 D;  4X3T A;  1HA6 A;  2F4I A;  1WTX A;  1LT3 D;  4CBV A;  2M9V A;  2OF1 A;  3J7A V;  4TRD A;  1ICW A;  2C9O A;  2MJ8 A;  3SHL A;  3T56 B;  3SEB A;  5ELE A;  2DY7 A;  2NTT A;  1HUN A;  3I8Z A;  3K59 A;  1ZEQ X;  2L55 A;  3GV6 A;  4K2K A;  1TU2 B;  4KY6 A;  3FMC A;  3BVM A;  2L4N A;  1ROD A;  2HDL A;  2V4D A;  3KLS X;  3C46 A;  3VR4 A;  4K2L A;  4BA1 I;  5IOC A;  3BG3 A;  1H9K A;  2B2T A;  1J9O A;  3OWE B;  2K03 A;  4OO1 I;  4K6L A;  1SYE A;  1QWY A;  4C3J B;  2WP8 J;  1DJR D;  2NYZ D;  4XT1 B;  1EIH A;  1TS2 A;  3T51 B;  5COY A;  1K83 B;  1KDC A;  1I3Q B;  3SR1 A;  2XRS D;  1GUO A;  2SNS A;  2B2V A;  3VA5 A;  2JA6 B;  1BNZ A;  3Q23 A;  5JPM C;  2XN9 C;  2KQ3 A;  3BVG A;  1GHK A;  4ULL A;  3HOZ B;  4I7Z C;  3VYR A;  1ILQ A;  5C3W A;  3HOW B;  3T13 A;  2X69 A;  5T1I A;  1PLF A;  1Y8N B;  5A2Q E;  5CV7 A;  1V1P A;  2F1M A;  3JAM E;  2KED A;  4HN7 A;  3GQB A;  3OSO A;  4ZK9 B;  1G8Z D;  5CV5 A;  4DAP A;  1EYD A;  2F0U A;  1GUS A;  3GV3 A;  3CQZ B;  5CYU A;  3R3O A;  1JOR A;  4OGQ C;  1ILP A;  2JEB I;  4FXK C;  4A3B B;  3VYT A;  5JPN C;  3NQT A;  1I4X A;  4ID6 A;  3C3L A;  2N55 A;  3HEJ A;  1PTO F;  4KY5 A;  2D2C C;  2B2U C;  5C5M A;  5IGD A;  4ILW A;  1AN8 A;  2A6H C;  1S5F D;  3U9S A;  1I4H A;  4FF2 A;  2EYM A;  4QUF A;  3L3O C;  3NSW A;  4F88 A;  4XTC S;  5FOB B;  2VB3 X;  2TSS A;  4V0B A;  2F0S A;  4DA2 A;  1A3U A;  1TVX A;  3P75 A;  2BDO A;  4R9W A;  3L9A X;  5LHY 1;  4U67 3;  3O13 A;  3PUY A;  5KND A;  2PCF B;  4IUR A;  1G29 1;  1CK1 A;  1SDF A;  1SNC A;  3OW7 A;  3TP5 A;  5IGE A;  5C0X G;  1A2U A;  4CKB A;  3A7L A;  1KAB A;  1BCP D;  1DOL A;  4RKL A;  1OXU A;  2IX0 A;  5KIX A;  4KMU C;  2E2D C;  1PTO C;  1WCM B;  5EPL A;  4C1N K;  3PMF A;  1AFP A;  3NBH A;  1EZ8 A;  4IFD G;  3MC0 B;  2Q8R E;  4V19 0;  3FEW X;  1PTO H;  4CKC A;  2K7V A;  4TQU S;  4KJN A;  3FVQ A;  4WFN 3;  1W6K A;  4IAL A;  5I4D A;  4RCN A;  1RHP A;  3LNN A;  5LL6 S;  1HFN A;  2EJM A;  3DXJ C;  1Q8I A;  4LAA A;  3J7Y W;  3BS1 A;  1C4Q A;  4ZKB B;  2LKV A;  1I6V C;  3E0J A;  4DK0 A;  2XVS A;  1JOK A;  5KGU A;  1SND A;  3SK8 A;  5EBD A;  4DNR B;  2F0M A;  2Q8I B;  2K01 A;  4DF7 A;  2F0Q A;  5JVH 3;  1PTO B;  2F0O A;  2HCC A;  1IW7 D;  1QB5 D;  2R6G A;  4NKL A;  4C2M B;  2EZV A;  1BBX C;  1E2V A;  4XT3 B;  3EA6 A;  2Z4I A;  3NWT A;  3AU7 A;  1CQV A;  4QB4 A;  5JOB A;  1H9S B;  3K0Y A;  4IUT A;  2A5H A;  5C0X J;  5IOD A;  3NWS A;  1H9R A;  4B9X A;  2AWO A;  1X32 A;  1SBB B;  2A69 C;  1R4Q B;  1FYC A;  3I91 A;  2SEB D;  2SOB A;  3NTI A;  2AQ3 B;  1E0B A;  3EFX D;  1MSG A;  3WOE A;  3Q6S A;  3NP8 A;  1D2B A;  5EBC A;  4BS9 A;  1LTI D;  2PYK A;  4IFD J;  2BA0 A;  2E2J B;  3S1Q B;  1L0Y B;  4F87 A;  3BZD B;  3WDN A;  3OIP A;  1GOZ A;  4K8J A;  3U9O A;  2JE6 I;  3SVM A;  2KEE A;  5CV9 A;  5I2Y A;  4KJO A;  4PMC A;  3S16 B;  3MXG A;  1E2Z A;  4KKS A;  4C3J G;  1EU4 A;  1ENA A;  2SDF A;  3FPP A;  1SYC A;  1H9M A;  1LTB D;  3Q0A A;  5FK9 C;  2KOL A;  3ITP A;  1H9J A;  3EVQ A;  3LWU A;  3GD7 A;  2L12 A;  2E75 C;  1UUP A;  3IFD A;  1O78 A;  1CHQ D;  5C5L A;  2NN6 H;  3H91 A;  4FNF A;  2R7Z B;  1C48 A;  1FNV A;  1B2T A;  3RZD B;  3RLF A;  1BF4 A;  4DNT B;  1PDQ A;  5M5W B;  1F2L A;  1VDZ A;  2RDG A;  3BDC A;  4NP5 A;  3I72 A;  5E4W C;  4LJZ C;  1F77 A;  2D5D A;  4OIJ A;  4ODG A;  3P1H A;  4XYQ A;  2AUJ D;  3MAQ A;  2DY8 A;  4LMQ D;  1HQR D;  3N52 A;  1EYC A;  3PO2 B;  3TZD A;  1OO9 B;  1WTW A;  3BYY B;  1QNU A;  5E3F A;  2BCO A;  4KD3 A;  2F0W A;  1CZG A;  5FLX L;  4KKT A;  1CZW A;  3CU7 A;  5DEH A;  5EKI A;  2E2H B;  3KBG A;  4XQQ A;  4O1N A;  2WB1 B;  5IIF A;  3I4N B;  3R93 A;  1FNU A;  2CQA A;  2XRQ D;  3DWQ A;  4IN3 A;  3R8B A;  3FPU B;  2LFN A;  1S4Z A;  4XXE A;  2EYO A;  1LV9 A;  3VR6 A;  2IX3 A;  2KCC A;  1X3Q A;  1MD2 D;  1TY2 A;  1B50 A;  2LS0 1;  1EQT A;  2EYJ A;  2EYL A;  2R61 A;  1EEI D;  2PW5 A;  1ML0 D;  4P2C B;  4CKE A;  3V96 A;  4LK1 C;  1RJT A;  1E2W A;  2VNU D;  1LTT D;  3S9W A;  4ZYS A;  5CMD A;  3NTH A;  4WRD A;  1LT5 D;  3SXH A;  4TKO B;  1DXM A;  3KLS A;  1B9M A;  1AZP A;  3OIQ A;  1RD9 D;  1BQQ T;  2NVQ B;  4HCE A;  4Q5V A;  2YU9 B;  3I70 A;  1SNM A;  5DAU A;  3GTL B;  3HOX B;  3GTO B;  1EWH A;  3BDL A;  4IZ8 A;  5IGC A;  3X3N A;  1TWC B;  4HAE A;  1NAP A;  1OXS C;  1RTO A;  5J22 A;  2WIN B;  3H6M A;  1PRT B;  1R4P B;  2A6E D;  5D3I B;  3CHB D;  1F2M A;  3MFG A;  4L6T B;  1BDO A;  4FXG C;  3MTS A;  3QG1 A;  1JOO A;  1W6J A;  4X3S A;  4OO1 H;  1NCV A;  4R8I A;  4ZUJ A;  1QIL A;  4CGY B;  1FGB D;  1GUN A;  4K6D A;  5M9O A;  5KYI A;  1ET9 A;  2PW7 A;  1CT1 D;  3VR5 A;  1G2T A;  2R3Z A;  3DEP A;  2KEC A;  3KBX A;  1SYF A;  5EGT A;  1NUC A;  1IKL A;  2K1B A;  4OHJ A;  2RKS A;  4A3K B;  2I07 B;  4RHR A;  5M3F B;  1DZ1 A;  4IUU A;  1UNS A;  3A56 A;  2ZXP A;  4B08 A;  1K8M A;  4RHS A;  2NBF A;  3K5L A;  1WTV A;  2NVY B;  3DWP A;  4RWS C;  2LMC B;  4I65 A;  3BDO A;  5I9O A;  2CHB D;  3DEO A;  1XX8 A;  1AP0 A;  1S5C D;  1KDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...