5JVG3

The large ribosomal subunit from deinococcus radiodurans in complex with avilamycin
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
59
structure length
59
Chain Sequence
THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
total genus 3
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jvg300
5DM73 5DM63 3PIP3 5JVG3 4U673 3PIO3 5JVH3 4WFN3
chains in the Genus database with same CATH superfamily
4K5XA 1B53A 4M1UB 2N78A 4NXNL 2PMZE 2FMCA 1IBML 4O2DA 1QUQB 5G3LD 5CV4A 4DNIA 2PYKA 3VA5A 1N9WA 3E5SA 4RGNA 4KJOA 1CA5A 3Q23A 4JI3Q 3GP7A 1TWGH 1Y14B 1QG7A 1R9TB 4L5QA 3D4WA 1ZXTA 2EY6A 2QA4A 1C8CA 4KY6A 4B9WA 3PIOA 4JPBW 4YWLA 3W5OA 1Q3LA 2X6GA 3EIVA 4TVAB 4DV2L 3HOWB 3M4OB 1S72A 1Q81C 5DM63 4BXXG 4BBSB 3EFXD 3M4YA 1E2VA 4AIMA 1IW7C 3S14H 4R4OA 5DM73 4CDCC 5I2XA 4LFCL 3A7LA 3URYA 5IOCA 2AQ1B 3PO2B 4B3RQ 4KHVA 1Q1BA 4LAAA 2QCPX 2ASBA 5G3LF 2QEJC 2R7FA 3H3VH 1STYA 2UU9Q 4DR7Q 4B3TL 3GTLH 1V9PA 4EQOA 2DNEA 4CJ1B 1X32A 1WI5A 4ILWA 4GOPB 3UE0A 2L0CA 4RG1A 2LXJA 1IL8A 4WORA 2D9UA 5JEAG 4BBRB 5BN3A 3A8JE 4B3MQ 4JI6Q 1QNKA 2NN6G 4DXFA 1CHQD 3SK4A 3J7AF 1MGSA 2WINB 3E3XA 3NPPA 1XPOA 2JQOA 2Q2TA 2M2LA 3OYYA 1B8AA 1LO5D 4LF4L 4OWTB 2K52A 1RTNA 3MEHA 2F03A 3IKJA 1G8ZD 4BA1I 2MQHA 4NB3A 1A3UA 2VS1A 2L12A 3OTOL 2EZVA 3CCUA 4LW1A 5CBAE 3VYRA 3BZKA 4IALA 5EBDA 2PQAA 1XNRL 3N52A 4MTNA 2D62A 3PIP3 1WTHA 3A8IE 4JI5Q 5E7NA 5M3MG 3AU7A 3DM3A 4O42A 4OHJA 2ALYB 3VYSA 4C3JG 1D7QA 5KNBA 4EQPA 2A68C 1IXRA 4K5VA 3U9OA 1GUNA 2L9HA 1HNWL 2F0LA 3QOLA 1HZ9A 1I3QB 3G4SA 1TWFH 3OOCA 2EPBA 2UUBL 3KOJA 2O5IC 1B9NA 1H9JA 1HR0Q 4JYAQ 1ASZA 5JJKA 3M7GA 2RDHA 3R2IA 4A3DB 3VA7A 2JEAI 1WCMB 1VMCA 1KL9A 4JOIA 4G57A 4DUZL 2AWNA 3BVZA 1MD2D 1KNAA 3M9BA 1SROA 5I2YA 3V96A 3Q0AA 3FP9A 5J3BA 1GVPA 1E3PA 1N8RC 1GD7A 5IT9c 1CA6A 5H1SE 3J80L 1CKNA 4IPCA 1RCVD 3W1GA 5IGDA 1QVGA 4IJLA 2DN8A 5IIFA 2K5NA 5M3FB 1R9TH 1BQQT 4RCNA 3CRKC 4H44C 2N88A 4LUVA 2B2WC 3K8AA 4B9XA 4A93B 2BA0A 3IRBA 4F87A 3SXHA 4A3KG 1FNVA 1QE6A 3HOWH 3M4OH 3MVVA 4QCLA 1A15A 4UDUC 2K14A 3E0JA 2WP8J 4BBSH 1EWHA 2LXKA 1K8MA 1TIID 5M5XB 4JI1Q 1GOZA 1B4OA 5FLXL 3AQQA 4NW2A 1I50B 4MN3A 2UXDQ 1DJRD 1V1QA 2IX3A 3CRLC 3JAML 2LFNA 4PMWA 5M5YB 2QGQA 3SR1A 1ZEQX 4JG2A 3I4LA 4IZ8A 2ES2A 3ZYYX 2D5DA 4BBRH 3A5ZB 1S3OA 3ULJA 4L5SA 3KLRA 3E9IA 4UP8A 4OL7A 1F2MA 5C4XB 4KKSA 4DV5L 1KDBA 2RDGA 4DR4L 3D3RA 1SYCA 4DF7A 3MTSA 4X3TA 2TMPA 3H09A 5IYCG 3RD4A 5FLMG 2EYJA 1I4PA 3T1HQ 2CCZA 3ND8A 2HCIA 3FPPA 2K1BA 2RHSB 4GKKL 1EQQA 1F77A 4JBMA 4GNXB 2NVXB 2ZM6Q 1OXUA 1VQJA 1A2UA 4LFBQ 2KEDA 1YITA 1HNXQ 3E9HA 5HGQA 2UXBL 3KJPA 1OXSC 3EJIA 1YHQA 2K04A 2N3SA 2WACA 1KLGD 5I4DA 1X3EA 1EIFA 1I3QH 2PQEA 4PQXA 3TREA 1JORA 2YV5A 5D3DA 3FMCA 3I3CA 4NKLA 2PZTA 3RMHA 3NP8A 2B63B 4A3DH 1XNQL 3EVQA 2NN6I 2EVBA 1WCMH 2MUYA 3T53B 4YWMA 4O1NA 1KABA 1BXTA 5CV6A 5EJWA 3HOXG 5FK9C 3G6JB 4XYQA 2ZXRA 1EQTA 2WAQG 4DR1L 4ALPA 2VB3X 3RLFA 2BOSA 4OWXB 1Y8OB 3MXPA 4IQZA 2WB1G 2XVSA 1A62A 2OTLA 1IHZA 4OO1H 3I4MG 4DV1Q 4FF1A 2A74C 2F0OA 1GUWA 3QIAA 1GUSA 2A5HA 3UDIA 3STBC 2CKZB 1VMPA 4JOIC 1PZID 3F2UA 2QEXA 4A93H 5M9OA 2ZXOA 5IGFA 2CH4A 4HEDA 1QCBD 4JK1C 1R4QB 3EN2A 1AEXA 1Q90A 5GADC 3C46A 5M5XH 3GTKB 4PZ6A 5FO8B 1EOVA 5DEHA 3I4NH 3CCMA 2KECA 1X6OA 3CD6A 1SMYD 3AYHB 1WD0A 2FFKB 1ENCA 2VUMB 5M5YH 1KD1C 1TVXA 1A6XA 1KHIA 3K59A 4A3FB 3NXWA 3UDXA 1JJ2A 1PFMA 1A0IA 3SVMA 2CVRA 4KJNA 1YNJD 3UE1A 4P73A 3DWPA 1N36L 1UE7A 2A19A 2RCNA 2DJGC 2KCMA 3K7AB 5EBCA 5JJLA 1ICFB 1JWMD 2A6HD 1B3QA 5IYDH 1W2BA 5C4XH 1H9MA 3FKIB 1AFPA 1IYJB 1STBA 1J5EQ 4A3EG 3PUYA 1PH1A 2OQKA 1TU2B 3OSOA 2OQ0A 4CDFC 2XWBB 4X66L 1K73C 1I94L 1PYBA 4DV6L 1I5FA 2OEOA 2B2YA 1MJCA 4FXKC 3OW2A 1NMFA 3I7FA 3CC2A 1N33Q 1Q46A 2NVXH 4JBKA 3GTGB 2JEBI 1SXTA 5JAVA 4DV4Q 1EY5A 1JB7A 2DY8A 2HQEA 3A5UA 1V8QA 1J9OA 3M85A 1VQ8A 3I4OA 1BNZA 2NUCA 3CMAA 4DR6Q 5C3EG 4IFDJ 2FXQA 3HOUG 1HUMA 3HGBA 1HTLD 2SNMA 4C3HG 2E5LL 2B63H 1LTRD 2HIVA 4JV5L 4P71A 3I73A 2PZUA 2XGTA 4CJ0B 4HIMA 3U58A 1CSQA 4CKCA 1SR3A 4JVZA 3KUPA 1QNUA 1O7YA 4JCVE 2EQSA 2X6LA 2J4XA 1QB5D 1MIUA 1TY0A 3RLOA 1HCZA 1ZYRD 3GDEA 3PMFA 3K5LA 5DNFA 1UUPA 1M90C 3EQLC 4R4QA 2BCOA 1NSNS 2MFIA 5GQOA 1SEBD 1AE2A 2JN4A 1QVFA 5KEEA 4A3LG 1PFBA 2E8GA 2EJFC 2SOBA 1KAWA 2F3IA 4EVOA 5I9PA 5C44G 4HMIA 4X64Q 4A3CH 2CW0D 1F9SA 4NMZA 4A3IG 2R7ZB 4L5TA 2R92G 4BY1B 1PHJA 4RKBA 5E4WC 2E2DC 3E6ZX 4R4IA 4UHVA 2JA7G 3GTKH 1HR0W 2DGYA 2IJ0A 1Y1VB 4RKLA 2F52A 4DV7L 4BY7G 2F0JA 4JI0Q 1CZGA 3HKZE 4DR2L 2Q8TA 2OF1A 2XWJB 1EQRA 2K32A 3BYTB 2Q2IA 2ZJQA 4H13C 4DV3L 3UDFA 3L9AX 1BBWA 3T16A 1KIXA 4FXGC 2VUMH 4KHPQ 2NVQB 3N6RA 2MP1A 2Z6KA 4ZQ3A 4LF8L 4A3FH 4DAYA 4RGTA 3CXCA 4XIGS 4DKAC 1PXUA 1SNCA 3U9SA 2OWOA 3LGJA 4HJAA 2R93H 5JEAJ 5JPMC 3NWTA 1RTOA 4QY7A 3K7AH 1ET6A 3T4AC 1V1PA 1NNXA 1EYAA 3S17B 2JP1A 2QKIC 3FKIH 1UEBA 4Q0FA 1ILPA 2B2TA 3G6EA 1FGBD 2EIFA 4YWKA 1SNOA 2F4VL 2PZWA 4A76A 1QUQA 1YIJA 5A2QL 3SDZA 5FKAC 1HH2P 2YYZA 4NXMQ 3BVMA 3FHWA 4R9WA 5A35A 4LF6Q 3NK9A 5LMNQ 1VQEA 1XJVA 3ZJYC 3NQIA 1JWSD 1EQVA 3GTGH 2NBFA 1LYLA 1S4ZA 5FJ8G 1BBXC 4JI2Q 3RUZA 3SHLA 1PLFA 4I65A 5LMUQ 1Q82C 4ZUJA 1CM9A 1ONLA 1FYCA 1YEZA 4ZAIA 2JJQA 1D5MC 1XYIA 3GTOB 4LF9L 1EY9A 4APVA 1CT1D 4J6HA 1VQIA 5EQ0A 4N9TA 4KMUC 2HHHQ 3K0XA 4R4CA 4DU9A 3S14B 2UUCL 1HQMC 3LWEA 4IUVA 4OX9Q 1BR9A 2KVMA 3A54A 2ZJPA 1E1TA 3F2BA 4DK0A 1XPUA 2NVYB 3NUCA 2ZTDA 1TQOA 3BU2A 1YNNC 2KCTA 1K3BC 3DXJC 4L63B 3P1HA 3DEOA 2R6GA 4OEMB 5EAYA 5KGUA 5GAGC 4GZYC 2RA4A 1IKLA 3PO3B 2AKWB 3C1FA 5LHY1 1BCPC 1I4RA 1EU3A 2BDNA 2HIXA 2KBNA 4FF3A 2F0DA 2NVTB 5T1IA 3D6WA 4DR3Q 5K5PA 3DWAA 2VQFL 4LF5L 2R7ZH 4BY1H 2NZ1D 2JA6G 4C3JB 1NUCA 1RHPA 3EROA 1GM5A 4YHHL 4AQYQ 1Y1VH 5TSSA 4HJ7A 4IFDH 1S40A 4K5WA 1PRTD 2MJ8A 1DOLA 3NQTA 5FO7B 5C0XG 4YY3L 3J81E 1XMOQ 2V1CC 1BVSA 4ZKBB 4DR5L 4A3GG 4DAMA 1PFNA 1X9NA 5BR8L 2NVQH 3H0GB 2K75A 4B3RL 3PQIA 4DV0Q 2F0NA 3I70A 1DYQA 1TWFB 4PZ7A 3A56A 3I91A 5IE8A 2UU9L 4DR7L 4RHRA 1YI2A 4HIKA 3VYTA 5FLXE 1JR0D 3BDCA 3KBGA 1E2ZA 1LT4D 4R4TA 1Q7YC 1Y8PB 3J7YW 3S17H 3HZXA 1PTOC 1PRTF 2F0UA 1S5FD 3ND9A 4B3ML 1ESFA 1WD1A 3S2HB 1RDPD 3JAME 4X62L 2Z6KC 2LY7A 4A3KB 1L1OA 3CCSA 5CV9A 5C4ZA 4IPDA 1VQBA 5COYA 4G7OC 4KKUA 5CMDA 3CC4A 3W1BA 1BKBA 2PO4A 2ZTCA 2KENA 1QWYA 1J6QA 3TZDA 1YJ9A 3T1YL 2EJGC 3K5NA 2BE5D 3F2CA 2A6ED 1JJCB 3GTOH 3IL8A 4I7AA 3TZUA 2B2TC 2KOLA 2K28A 4ZYSA 5IWAQ 4OGQC 1TS4A 1LT5D 3R93A 2B2VA 5IP9G 2ID0A 3HEJA 5JEAH 2K50A 1SYDA 5EKKA 4XDXA 2NN6H 3BZCA 3QB3A 5JOBA 2NVYH 3WWVA 1HR0L 4RMFA 4AYBG 3H91A 2PW5A 2B8FA 3JC66 2DNCA 3R8BA 3U4ZA 3UI2A 1LV9A 5IGCA 5M5WB 1KXLA 5NUCA 3TDQA 3PO3H 3H15A 1ICWA 2A1AA 2HUGA 4DPGA 3CCRA 2FJ2A 4P74A 2NVTH 3M4PA 4PG3A 2B29A 4DK6C 1WTVA 1G6PA 4C3JH 1IBLL 1VQDA 2EE1A 4LFAL 4GKJL 2ENBA 1JOQA 1AE3A 4GN4B 4A3MB 3G71A 4ZCKA 2JK8A 3VYUA 4GNXA 5GAHC 2NTTA 3OHXC 4IOCA 4NXNQ 5JJZA 4XTCS 1SLJA 1IBMQ 2Y0SB 3IFTA 1VF7A 4DAPA 3MC0B 3PF5A 2EYHA 1KDCA 2OXPA 4JI1L 1I4XA 1U4RA 4BS9A 3HOXB 3H0GH 4WJ4A 1D5XC 4Y7NH 2WAQB 3TMEA 3CHBD 3BVGA 3TP7A 1VQ7A 4FYDA 2F0FA 4C2MB 2OCEA 4ABNA 2WB1B 1VQCA 4LF7L 2K01A 5LL6S 2CQOA 1WTOA 1SRUA 2MHVA 4TQUS 3VR3A 2XIWA 4LFCQ 2K33A 4KI0A 1JOKA 2KEEA 3S2HH 4A3KH 4HCSA 1B9MA 5CV7A 3NTHA 4QIWE 3WDNA 5IGBA 2RSOA 4B3TQ 1PH6A 1OXTA 1T9HA 3K5MA 4RHSA 5C0XI 1K83B 1VQLA 4C1NI 1O7ZA 1L0WA 1UNSA 3PGZA 2Z6BA 1CKOA 1VQ6A 1FD7D 4JBWA 1L1OC 1X3QA 4LJZC 5CR3A 1HNZQ 4GLAC 1EFID 1SJED 2VL6A 3I4NB 4LUZA 3HOVB 4DK3C 1PH7A 4OXPA 3CMEA 3LWUA 3OTOQ 5C3WA 4FO2A 3D4RA 3HKZG 1XNRQ 2WKCA 4ID6A 4C56C 3R3OA 1WTQA 3KF8A 5M5WH 2NYZD 4AH6A 5FLMH 5LMNW 1VCIA 3KYHC 2PCFB 1YHBA 4PMBA 3NSWA 2B2VC 3BDLA 1SN8A 1X55A 1HNWQ 5EKLA 2YTYA 3KLWA 2PMZB 2D2CC 5CV8A 2UUBQ 4YCVA 1VQOA 3HOWG 4KLKA 4BBSG 4ULLA 4A3BB 3PIO3 3MWYW 3TS0A 4N8FA 4K6DA 1NJIC 4A3MH 5C3EB 3FPUB 1OXXK 4DUZQ 4IUNA 4KY7A 3TP6A 3PO2G 3CCEA 3HOUB 4O0AA 1NY4A 2KCNA 3S1MB 1VQGA 4WJ3M 4BWGB 1ILQA 2XTIA 5CBEE 3BJUA 1HXYD 1B1ZA 2I5MX 2R61A 4A3JG 3RN5A 2IL8A 3F2DA 4GLVB 3GV6A 2K5QA 1D1IA 3HOXH 3NELA 3K80C 1FJGL 3X3NA 4NPSA 3DHQA 2K7VA 3EBEA 4HJ8A 4C2MH 1SYBA 5C5MA 2CWAA 3M3YB 5ELEA 4GNXC 2YTVA 3I2ZA 2JA5B 4HIOA 4TKOB 4NDXA 5IODA 4HSVA 4P2CB 4A3IB 3RZDB 2R92B 4YCWA 3J7A5 1QJOA 3BYYB 3SK6A 5C4JB 1NR2A 1G2TA 2JA7B 1BO0A 1EY8A 1TWCB 2EY2A 2VZAA 1JQYD 2LS01 4BY7B 1K83H 3S2DB 1SE2A 3KDFA 5ELDA 4PNYA 1YBYA 3H3VI 1G291 1KRSA 2I0QA 3CCQA 2QDLA 2AQ3B 2LSSA 1EY0A 3A8KE 3BG3A 1W3SA 1CKMA 2Z1CA 4QMGA 1MSHA 1F9RA 1VQ9A 1N32L 1S5BD 1O7IA 1TKWB 1IBKL 1OTCA 3C1EA 4DV5Q 4F8MA 4DR4Q 2WKDA 1L2FA 3NHHA 4QB4A 4B3SL 1PVOA 1GHJA 1WCMG 4RGOS 4FVMA 2DJFC 1CKNB 1WYDA 2L55A 3HOVH 3L2PA 3S1NB 4ME3A 4E6IA 1K8OA 4AYBE 3S24A 3P7JA 1LTID 1TS2A 4N9PA 4K8IA 3NENA 4GLXA 2A73B 1Q86C 4GKKQ 4Y52H 1G2SA 2F0MA 5FOBB 4EX5A 3PUVA 1LLRD 2NZOA 1MHWC 3PUWA 1F2LA 1STNA 1EIHA 4A3EH 2R93B 5M3FG 4K0KL 2UXBQ 3BZDB 3CKIB 1ENFA 1JICA 3D4DA 5JVG3 4A93G 2PNRC 1EL0A 1SMYC 4IUTA 4HIDA 1SDFA 4QL5A 1D5ZC 5K36G 1HZBA 4A3BH 1XNQQ 1UE1A 2ZTEA 4LK1C 5LL6X 2E2JB 2G9DA 2CHBD 2PW7A 4JI4L 3D31A 5C3EH 2J7ZA 3QR8A 3Q6SA 5C4HA 1STEA 1YNJC 2ZXPA 1CHPD 3ULLA 3HOUH 4DR1Q 3I55A 3S1MH 1TY2A 3H94A 3RZOB 1Y8NB 2A6HC 3TRZA 3I72A 1BF4A 2XN9C 2EXDA 3P20A 2JXMB 4C3IB 1NCVA 4DN4M 1LTAD 2QW7A 4FF4A 1H9KA 3F8TA 4QJFA 2VXWA 4LMQD 1EY4A 1PYSB 3M3YH 4KHPL 1XWEA 3RR5A 2JA5H 4IPHA 4A3LH 5ELBA 3ER0A 4OONA 3OMCA 3CPFA 4DK1A 5C44H 4EGVA 4A3IH 3RZDH 2R92H 1F2ZA 1WOCA 2JA6B 1X3GA 5FO9B 5C4JH 2JA7H 3VR6A 3TSSA 1TWCH 4FP5D 1N34L 2Q8RE 3GV3A 4BY7H 1E2WA 1SYGA 5CGKA 3S2DH 3KLSX 4H02A 1N36Q 1LTGD 4A3GB 4JC0A 1ZYRC 3RN2A 5KYLA 2UUAL 1O7LA 5JJIA 4CHTB 3KBXA 2B39A 5IT9L 3VR5A 3HOZG 4K2KA 5KYIA 1SFOB 3S1NH 1PH8A 4UP7A 4OELB 1PYWD 1KC8C 2AQ2B 3X3MA 4OWWB 1I94Q 1XX8A 2CW0C 3OIPA 2RCFA 5IYBG 4K14A 3J81i 1HQRD 1HUNA 1P8LA 3SGIA 3W3AA 4WFN3 3DEPA 3MHBA 1U4PA 3OWEB 3HOYG 3UDGA 3TBIB 3ERQA 2N55A 1U9RA 1VF5C 2VNUD 3EA6A 4JI8L 4JI7Q 1SMXA 1ESRA 5FJ8H 3S1RB 4X65L 2HDMA 2E5LQ 4JV5Q 2IY5B 2IHFA 5I6WA 2E2JH 3S15B 3GTMB 3J81c 4I7ZC 3V2TA 2VB2X 3K0YA 1P16A 1ET9A 1EZ6A 2I46A 2KA7A 2NB0A 3RZOH 2EY5A 1XTCD 1EUJA 3K58A 1JE4A 5IP7G 2ATWA 2E76C 2UXCL 1TWHB 1MKHA 5ELOA 5AJ3L 2SDFA 1GUTA 2NTSA 4KY5A 4IUQA 4C3IH 3DUZA 4B08A 1Q8IA 4OO1I 3NTKA 3SE0A 1MSGA 3CPWA 3A55A 4IO9A 2PNHA 1I4GA 3V05A 2KHSA 1STAA 2B2YC 2A69C 5J22A 1EYDA 3JAMc 5HURA 2JA8G 4DV7Q 1L0XB 3IFDA 2D0OA 5BN5A 4GOPA 4DR2Q 3GO5A 3M7NA 2GA4B 2JA6H 1YNND 3PUZA 3WOEA 3T56B 1YHAA 2I5HA 5IGGA 2N49A 2EYMA 4DV3Q 2HT1A 1Z6HA 4HAEA 3DWQA 3PIPA 1GUOA 4LF8Q 3NBHB 2YU9B 1BCPD 1BCPB 1B44D 2G9HD 1HHVA 4V0BA 1GO3E 4UY8C 1E0BA 3CW2C 5C0XH 1A3TA 3H3VC 1WTWA 3BDOA 4A3GH 2O2LD 1XTDA 5M3MB 1U4MA 2VW9A 4JI3L 1S5CD 1E24A 2GVBA 3IAYA 4LWCA 1SYEA 3L7ZC 4F88A 2F4VQ 2L11A 4HCEA 1SFOH 4KKTA 4CDDC 3J80E 1FNUA 3CQZB 4R1JA 1L0YB 3WOFA 1HFGA 5IGEA 2BDOA 4NP5A 2Z4HA 2R7DA 4XYOA 1F9PA 3S16B 1NAPA 5E3FA 2Z9HA 1BCPF 1W6KA 1STHA 4U673 4Y7NB 3Q24A 1PRTC 1CTMA 3AFQA 2Z0SA 4MNOA 5DLQE 1EEID 1V1OA 1A63A 4LF9Q 3NEMA 4KD3A 2AUJD 1EEFD 1R4PB 1SNQA 4DUYQ 1HFNA 4V190 1K8AC 3S1RH 1PZKD 1SNMA 2CWPA 5KNCA 4HN7A 1K3RA 1PTOD 1PTOB 4QGUA 1Y1WG 4JI6L 3MXNB 4ME5A 2VQEQ 3S15H 1Y1VG 4IFDG 2F0PA 3GTMH 3KF6B 1JB3A 4DAYB 1Z7TA 2D0PA 4BXXH 4X6AH 1X3PA 3OMGA 1DM0B 5IP9H 2IX0A 3ERSX 4OIKA 2B2WA 1TWHH 2MPMA 1K9MC 2FHTA 3BS1A 1V1PB 2KCCA 4G7HC 1ML0D 2AHOB 4PV1C 3HKZB 4JW0A 4P75A 2WV6D 4JI5L 1HA5A 1VQKA 1RODA 2E2IB 4ZKCB 4LF5Q 2VQFQ 2L5TA 1IW7D 3K5OA 4LNQA 1PTOF 1GHKA 4HR7B 4RA8A 4YHHQ 3TN2A 4LUOA 4RH6A 4TSSA 2BE5C 2IT1A 2A6EC 1DCZA 3S1QB 4EQ5A 4JYAL 1PFSA 1D2BA 3PSIA 4YY3Q 3PF4A 4DR5Q 1EZ8A 1YJWA 1G51A 2RKSA 2JE6I 4K2LA 5BR8Q 1C7YA 3KFUA 1C9OA 1C4QA 2BA1A 4KD4A 3S9WA 3CU7A 4XQNA 3MXGA 2YU9H 1PH2A 2Q2UA 2O4XA 2QILA 4GN3B 2N8NA 4HJ9A 2Z8LA 1SAPA 5M3MH 4A3JB 3HP3A 2E2HB 2RSNA 5CV5A 4GOPC 3FRPB 1FGUA 1C0AA 1J8IA 1V43A 1K0RA 1O78A 5KIXA 2H4OA 2M00A 1XMQQ 1B7YB 1E22A 3CCJA 4XQQA 1X65A 1NR4A 4JBJA 4YCUA 2WFWA 5DAUA 4X62Q 3Q22A 3CQZH 3L3OC 3FVQA 4KN4C 1YVCA 1F9QA 1HNZL 4DNTB 1W6JA 1QZGA 1CQVA 1U4LA 4XXEA 3S16H 2A68D 4DFAA 1SNPA 3D6CA 2IHEA 4XT1B 3C3LA 3HG9A 3PO3G 1SBBB 1SYFA 2UXDL 3T1YQ 2WIIB 4RWSC 5BN4A 1WFQA 3R2TA 2IWHA 2EDGA 3QG1A 1H9SB 3U4VA 4DV2Q 3M4QA 1DZ1A 1DGSA 2CFMA 2VY3A 5J1ZA 3I4MB 2F0GA 2Q8IB 4DXGA 4L8JA 1PTOH 2F0SA 2HQLA 3RNUA 2F0IA 3OW7A 4OIJA 5I6YA 1PMRA 2EYPA 1FNWA 5L37A 3CF5A 4UPAA 2ZT9C 2LMCB 1B70B 5C6AA 2F0EA 4RGMA 1LM0A 1Q1EA 1JJGA 3HRZC 1I6HB 1DOKA 2F0WA 3FEWX 3T1HL 1JC7A 1M1KC 4IPGA 5JVH3 3H0GG 2KHIA 2P5ZX 1LTSD 4A4IA 1LABA 1NMGA 1MI2A 3A7AB 4KHZA 4MIUA 1DONA 3SEBA 1OO9B 2ZM6L 1X3FA 1H9RA 3DMUA 3J81L 2E2IH 1L1OB 1PA6A 1X56A 1AH9A 3VR2A 2EJMA 4LFBL 1HNXL 4IUPA 1IBLQ 4LF4Q 3ULPA 1EIYB 1C48A 4LFAQ 4GKJQ 1FVIA 3E0EA 4POGA 3CC7A 3S1QH 3W2DA 3RLNA 3PV0A 1CI3M 4RAUC 4F7XA 1GJXA 1TWAB 3MFYA 4IFDI 4S3SA 2NWGA 1JOOA 4MHEA 5IYCH 4A3EB 1EYCA 1LT6D 4GS3A 3PO2H 2FMMA 2ICEC 4K6LA 4A75A 1ENAA 1U0LA 4ZK9B 4QUFA 1NBWA 2AMCB 4A3JH 2NZHA 1QOHA 2E2HH 1HRJA 4LF7Q 4DV1L 1UE5A 4RCOA 4ZUIA 1II3A 1SJHD 1M8AA 2H1EA 1IYVA 4C3HB 2M9VA 2CH4W 1WTXA 2C9OA 2JYOA 3DM1A 1MJEA 4QUCA 4X3KA 1TS5A 1RIPA 2G5DA 3AEVA 4ODGA 4J1MA 2SNSA 4YIJA 1OXVA 3OPOA 1K28A 4BBRG 4KK7A 2J0TD 4QF4A 3D0FA 2KJXA 1RKNA 2BH8A 3ICEA 5C3XA 2JSOA 4R8IA 1D6EC 5IT9E 1KAAA 3I4MH 1KRTA 2PQAB 1X54A 5D65A 2DY7A 5EPKA 1VQFA 2PI2E 5C44B 4A3MG 5I9OA 1VS0A 1G6ZA 4FXDA 1IYUA 1BDOA 3LX0A 3MXUA 2Y0SG 3CCVA 1PDQA 3K57A 1I6HH 3HOZB 1J5EL 1PH9A 3TS2A 3OIQA 1AZPA 3STBD 1VQMA 1B2TA 4X3SA 1CK1A 1LUZA 3VR4A 1N33L 4IUUA 2MO0A 4DA2A 2F0KA 2B2UA 4DV4L 1IL2A 2C5CA 2JA9A 1DD2A 2PI2A 2AUKA 4A3DG 2H5XA 3I90A 5A2QE 2EYOA 4CJ2C 4HSPA 1BUVT 2F3VA 3CP0A 5M3FH 3TP5A 4GN5A 3HOYB 1TT2A 4DR6L 1IKMA 4POFA 1CFMA 1F2YA 1JE5A 4MZ9A 2HDLA 3PCOB 5ELCA 3L0OA 2B3GA 3MEFA 2XRQD 2OT2A 5J39A 1TWAH 2LKVA 3QJYA 4KV6A 3NTIA 4P72A 5K36H 1FL0A 4OO1G 1O80A 5T1GA 4CKBA 3J81j 4CBVA 2RF4A 2I5LX 3VDYA 1I50H 1FJGQ 1HA6A 2KQ3A 4FDBA 1XPRA 2L1BA 1RL2A 3I8ZA 4QIWB 3GQBA 3OWFA 1EOTA 1I4HA 4N8X1 2K05A 5ELFA 5IY0A 2EY1A 1SNDA 5ISRA 3ITPA 1AP0A 4HTHA 4HJ5A 3I4NG 1PH5A 4CGYB 3QOJA 3HOVG 2OTJA 4X64L 2HD3A 3KF8B 2SEBD 5KNDA 4DNRB 5C0XJ 4C3HH 3SK8A 2A8VA 1T5EA 2C35B 1KNEA 1ASYA 3GTJB 1VQ5A 1EFWA 3TQYA 1HZAA 1HJPA 3HFZB 2JA8B 3D8GA 1ZKOA 1KTKA 4JI0L 2O5JC 2Q2HA 2QF7A 5GAEC 1GXDC 1S5ED 4PMCA 2TSSA 3I56A 4H0LC 1M4VA 2XSCA 1Y69U 1EU4A 5D3IB 1WTRA 4RFBA 5IYDG 5C4XG 1HZCA 1N32Q 2FINB 5EGTA 1IBKQ 2GN5A 4A3BG 3CCLA 1Q12A 5F2DA 4B3SQ 1S5DD 4PZ8A 3AB9A 5ELNA 2I07B 4EQNA 4C1NK 3SK5A 3FDTA 1STGA 2V4DA 4IN3A 4JI7L 3G48A 3HKSA 1WVLA 3NBHA 4ZLTF 1MBYA 1WTPA 1PH3A 3KLSA 3C2PA 3QWNA 2B8GA 2F0HA 2HCCA 4UAIA 3HOZH 1T5XD 1GKHA 2MGSA 4HMJA 2F1MA 2AWOA 4K0KQ 2GVAA 1EYGA 4NXML 1SE8A 1VQ4A 1D8LA 3LNNA 4LF6L 5LMNL 1NE3A 5KRUA 2CQAA 5IYBH 3U50C 2XNAC 4JI2L 4CDEC 2B63G 1EIGA 5LMUL 2X69A 2JA5G 2R3ZA 2RQXA 1RJTA 3H6MA 3DLLA 1HTPA 2K03A 3HOYH 1IZ6A 2BH2A 1Z9FA 3GTQB 1A8VA 4WJWA 4JI4Q 4X66Q 2RDFA 3KDFB 4DV6Q 2HHHL 1I6VC 2K5HA 3GTPB 1PH4A 3J7ZC 3J80i 4OX9L 4L5RC 3A74A 3ONAB 5CORA 3TP8A 1CUKA 1Y1WB 1LACA 2B2UC 2EOTA 1KLUD 3HS0C 5HGTA 1XXGA 3QO2A 4A3CG 5IP7H 2IX1A 1Z47A 3MXNA 2F0VA 4KN7C 1QZHA 3MAQA 3KF6A 3PUXA 5EPJA 1UEAB 1DXMA 3P75A 3J80c 1AN8A 2MO1A 3NE5B 2EYFA 1VQAA 5E4XA 1EY6A 4DR3L 1A3VA 1TS3A 1U5KA 4J15A 3JAMi 4G7ZC 3MZ5A 1VDZA 1EWCA 4X3UA 4AQYL 2VUMG 3GTJH 1KDAA 4A3FG 1N34Q 2JA8H 3MFGA 1GUGA 5EPLA 4FNFA 2R93G 1XMOL 1H95A 1LTTD 4AYBB 1JCKB 5FLXc 1RD9D 3TEHB 1YNXA 2K5DA 4Q5VA 1HPCA 4K8JA 1D1KA 2A69D 1QVCA 4KTAA 1TWGB 2UUAQ 3FKIG 4H7BA 4J8QA 4DV0L 1VQPA 3G7LA 1LT3D 1JT8A 3O13A 3NBIA 4XQJA 1PV4A 2E74C 2Y0SE 1A2TA 2ICIA 4MTKA 4QQBX 4WRDA 4DUYL 5AFWA 3NWSA 1VQNA 2F0QA 4BA2I 4IOAA 2K4KA 1QILA 4ZRZA 4TRDA 2VQEL 2EYLA 3T51B 2WAQE 1LTBD 1SE3A 3J7AV 1B50A 4C3IG 5EKIA 1EY7A 1TXYA 2F4IA 5CYUA 1AW7A 4IJHA 2WB1E 3B6YA 3GTLB 1TR5A 4M8AA 2K6AA 4IURA 1KQSA 2F3WA 4JI8Q 2ZJRA 3F1ZA 1JMCA 2F0TA 4DGZA 4X65Q 2Z4IA 4UP9A 2QDBA 2YTXA 1E7ZA 2MNAA 1G91A 1CZWA 3GTQH 3T13A 5IWAL 1SE4A 2EXZA 4FF2A 1Q8KA 1PZJD 1K0SA 2L4NA 3GTPH 2KUMA 3K6OA 1LTLA 5CC4A 2K5VA 1DOMA 1I4QA 2PPBC 2L15A 3MA2B 2UXCQ 1Y1WH 3CAMA 1H9SA 1SSOA 5AJ3Q 3KJOA 1K8GA 2KHJA 4G4KA 4L6TB 1PRTB 5C5LA 1UWVA 1CQFA 3AFPA 5E1FA 1JWUD 2XRSD 2IPKD 3Q8DA 5HY6A 2E75C 1UE6A 5GROA 1NTGA 5D14A 3GD7A 1EWIA 2R7ZG 4BY1G 1CSPA 2UUCQ 1E1OA 3K7UC 1VQHA 4XT3B 1B3AA 2IW3A 4DAVA 1AZQA 3A0JA 2RHQB 1YZ6A 1WJJA 1YJNA 2RVLA 4CKEA 4U68A 4R8NA 3KK7A 2DUDA 1UAPA 1BBUA 1RF2D 3AMUA 4Z9CB 5JPNC 1XMQL 1FR3A 2K5WA 1BOSA 2RBMA 3K81C
chains in the Genus database with same CATH topology
4K5XA 1B53A 4M1UB 2FMCA 5G3LD 5CV4A 2PYKA 3VA5A 3E5SA 4RGNA 4KJOA 1CA5A 3Q23A 3GP7A 1QG7A 1R9TB 3D4WA 1ZXTA 2EY6A 1C8CA 4KY6A 4B9WA 1Q3LA 2X6GA 3HOWB 3M4OB 5DM63 4BBSB 3EFXD 3M4YA 1E2VA 1IW7C 5DM73 5I2XA 3A7LA 3URYA 5IOCA 2AQ1B 3PO2B 4KHVA 1Q1BA 4LAAA 2QCPX 5G3LF 2QEJC 1STYA 4EQOA 2DNEA 4CJ1B 1X32A 4ILWA 2L0CA 1IL8A 4WORA 2D9UA 5JEAG 4BBRB 5BN3A 3A8JE 1QNKA 2NN6G 4DXFA 1CHQD 3SK4A 3J7AF 1MGSA 2WINB 3NPPA 2M2LA 1LO5D 1RTNA 3MEHA 2F03A 3IKJA 1G8ZD 4BA1I 1A3UA 2L12A 2EZVA 5CBAE 3VYRA 4IALA 5EBDA 3N52A 2D62A 3PIP3 3A8IE 3AU7A 4O42A 4OHJA 3VYSA 4C3JG 5KNBA 4EQPA 2A68C 4K5VA 3U9OA 1GUNA 2L9HA 2F0LA 3QOLA 1I3QB 3OOCA 2EPBA 2O5IC 1B9NA 1H9JA 3M7GA 2RDHA 3R2IA 4A3DB 3VA7A 2JEAI 1WCMB 1VMCA 4G57A 2AWNA 3BVZA 1MD2D 1KNAA 5I2YA 3V96A 3Q0AA 1CA6A 3J80L 1RCVD 5IGDA 2DN8A 5IIFA 5M3FB 1BQQT 4RCNA 3CRKC 4H44C 2N88A 2B2WC 4B9XA 4A93B 2BA0A 4F87A 3SXHA 1FNVA 1QE6A 4QCLA 3MVVA 1A15A 4UDUC 3E0JA 2WP8J 1EWHA 1K8MA 1TIID 5M5XB 1GOZA 1B4OA 5FLXL 4NW2A 1I50B 4MN3A 1DJRD 2IX3A 3CRLC 3JAML 2LFNA 4PMWA 5M5YB 3SR1A 1ZEQX 3I4LA 4IZ8A 3ZYYX 2D5DA 3KLRA 4OL7A 1F2MA 5C4XB 4KKSA 1KDBA 2RDGA 3D3RA 1SYCA 4DF7A 3MTSA 4X3TA 2TMPA 3H09A 3RD4A 2EYJA 1I4PA 3ND8A 2HCIA 3FPPA 2K1BA 1F77A 2NVXB 1OXUA 1A2UA 2KEDA 1OXSC 3EJIA 2K04A 2WACA 1KLGD 5I4DA 2PQEA 4PQXA 1JORA 5D3DA 3FMCA 3I3CA 4NKLA 2PZTA 3RMHA 3NP8A 2B63B 3EVQA 2NN6I 2EVBA 2MUYA 3T53B 4O1NA 1KABA 1BXTA 5CV6A 5EJWA 5FK9C 3G6JB 4XYQA 2ZXRA 1EQTA 2VB3X 3RLFA 2BOSA 1Y8OB 3MXPA 4IQZA 2XVSA 1IHZA 4OO1H 4FF1A 2A74C 2F0OA 1GUWA 3QIAA 1GUSA 2A5HA 1VMPA 1PZID 3F2UA 5M9OA 2ZXOA 5IGFA 4HEDA 1QCBD 4JK1C 1R4QB 1AEXA 1Q90A 3C46A 3GTKB 5FO8B 5DEHA 2KECA 1SMYD 1WD0A 2FFKB 1ENCA 2VUMB 1TVXA 1A6XA 4A3FB 3K59A 3NXWA 1PFMA 3SVMA 2CVRA 4KJNA 1YNJD 3DWPA 3K7AB 5EBCA 1JWMD 2A6HD 1H9MA 3FKIB 1AFPA 1STBA 3PUYA 1TU2B 3OSOA 2XWBB 2OEOA 2B2YA 4FXKC 3GTGB 2JEBI 1SXTA 5JAVA 1EY5A 2DY8A 2HQEA 1V8QA 1J9OA 3M85A 1BNZA 2NUCA 4IFDJ 1HUMA 3HGBA 1HTLD 2SNMA 4C3HG 1LTRD 3I73A 2PZUA 4CJ0B 4CKCA 3KUPA 1QNUA 1O7YA 2X6LA 2J4XA 1QB5D 1TY0A 1HCZA 1ZYRD 3PMFA 3K5LA 5DNFA 1UUPA 3EQLC 2BCOA 1NSNS 1SEBD 5KEEA 1PFBA 2EJFC 2SOBA 4EVOA 5I9PA 4HMIA 2CW0D 1F9SA 4NMZA 2R7ZB 4BY1B 4RKBA 5E4WC 2E2DC 3E6ZX 2IJ0A 4RKLA 1Y1VB 2F0JA 1CZGA 2Q8TA 2OF1A 2XWJB 2K32A 3BYTB 4H13C 3L9AX 3T16A 4FXGC 2NVQB 3N6RA 2MP1A 4ZQ3A 4DAYA 4RGTA 4XIGS 1PXUA 3U9SA 1SNCA 5JEAJ 5JPMC 3NWTA 1RTOA 1ET6A 3T4AC 1V1PA 1EYAA 3S17B 2JP1A 2QKIC 4Q0FA 1ILPA 2B2TA 1FGBD 1SNOA 2PZWA 5A2QL 3SDZA 5FKAC 2YYZA 3BVMA 4R9WA 5A35A 3NK9A 3NQIA 1JWSD 1EQVA 2NBFA 1S4ZA 1BBXC 3RUZA 3SHLA 1PLFA 4I65A 4ZUJA 1CM9A 1ONLA 1FYCA 4ZAIA 1D5MC 1XYIA 3GTOB 1EY9A 1CT1D 4J6HA 5EQ0A 4N9TA 4KMUC 4DU9A 3S14B 1HQMC 3LWEA 4IUVA 1BR9A 2KVMA 3A54A 4DK0A 2NVYB 3NUCA 1TQOA 1YNNC 3DXJC 4L63B 3P1HA 3DEOA 2R6GA 5KGUA 4GZYC 2RA4A 1IKLA 3PO3B 3C1FA 5LHY1 1BCPC 1I4RA 1EU3A 2BDNA 4FF3A 2F0DA 2NVTB 5T1IA 3D6WA 5K5PA 3DWAA 2NZ1D 4C3JB 1NUCA 1RHPA 3EROA 5TSSA 4IFDH 4K5WA 1PRTD 2MJ8A 1DOLA 3NQTA 5FO7B 5C0XG 3J81E 4ZKBB 1PFNA 3H0GB 2F0NA 3I70A 1DYQA 1TWFB 3A56A 3I91A 4RHRA 3VYTA 5FLXE 1JR0D 3BDCA 3KBGA 1E2ZA 1LT4D 1Y8PB 3J7YW 3HZXA 1PTOC 1PRTF 2F0UA 1S5FD 3ND9A 1ESFA 1WD1A 3S2HB 1RDPD 3JAME 2LY7A 4A3KB 5CV9A 5C4ZA 5COYA 4G7OC 4KKUA 5CMDA 2PO4A 1QWYA 3TZDA 2EJGC 3K5NA 2BE5D 2A6ED 3IL8A 3TZUA 2B2TC 2KOLA 2K28A 4ZYSA 4OGQC 1TS4A 1LT5D 3R93A 2B2VA 2ID0A 3HEJA 5JEAH 1SYDA 5EKKA 4XDXA 2NN6H 3QB3A 5JOBA 3H91A 2PW5A 2B8FA 2DNCA 3R8BA 3UI2A 1LV9A 5IGCA 5M5WB 5NUCA 3TDQA 1ICWA 2HUGA 2FJ2A 1WTVA 2EE1A 1JOQA 2ENBA 4A3MB 3VYUA 2NTTA 3OHXC 5JJZA 4XTCS 2Y0SB 3IFTA 1VF7A 4DAPA 3MC0B 2EYHA 1KDCA 2OXPA 1I4XA 1U4RA 4BS9A 3HOXB 1D5XC 2WAQB 3TMEA 3CHBD 3BVGA 3TP7A 4FYDA 2F0FA 4C2MB 4ABNA 2WB1B 2K01A 5LL6S 1WTOA 2MHVA 4TQUS 3VR3A 2XIWA 2K33A 4KI0A 1JOKA 2KEEA 4HCSA 1B9MA 5CV7A 3NTHA 3WDNA 5IGBA 2RSOA 1OXTA 3K5MA 4RHSA 5C0XI 1K83B 4C1NI 1O7ZA 1UNSA 1FD7D 4JBWA 1X3QA 4LJZC 5CR3A 1EFID 1SJED 3I4NB 3HOVB 3LWUA 5C3WA 4FO2A 3D4RA 2WKCA 4ID6A 4C56C 3R3OA 1WTQA 3KF8A 2NYZD 1VCIA 2PCFB 4PMBA 3NSWA 2B2VC 3BDLA 5EKLA 2PMZB 2D2CC 5CV8A 4ULLA 4A3BB 3PIO3 3MWYW 4K6DA 5C3EB 3FPUB 1OXXK 4IUNA 4KY7A 3TP6A 3HOUB 2KCNA 3S1MB 4BWGB 1ILQA 5CBEE 1HXYD 1B1ZA 2R61A 2IL8A 3GV6A 2K5QA 1D1IA 3X3NA 3DHQA 2K7VA 1SYBA 5C5MA 3M3YB 5ELEA 2JA5B 4TKOB 4NDXA 5IODA 4HSVA 4P2CB 4A3IB 3RZDB 2R92B 1QJOA 3BYYB 3SK6A 5C4JB 1NR2A 1G2TA 2JA7B 1BO0A 1EY8A 1TWCB 2EY2A 1JQYD 2LS01 4BY7B 3S2DB 1SE2A 5ELDA 4PNYA 1G291 2AQ3B 1EY0A 3A8KE 3BG3A 2Z1CA 4QMGA 1MSHA 1F9RA 1S5BD 1TKWB 3C1EA 4F8MA 2WKDA 3NHHA 4QB4A 1GHJA 4RGOS 4FVMA 2L55A 3S1NB 4E6IA 1K8OA 1LTID 3P7JA 1TS2A 4N9PA 4K8IA 2A73B 1G2SA 2F0MA 5FOBB 3PUVA 1LLRD 3PUWA 1F2LA 1STNA 1EIHA 2R93B 3BZDB 3CKIB 1ENFA 1JICA 3D4DA 5JVG3 2PNRC 1EL0A 1SMYC 4IUTA 1SDFA 1D5ZC 5K36G 4LK1C 5LL6X 2E2JB 2G9DA 2CHBD 2PW7A 3D31A 2J7ZA 3Q6SA 5C4HA 1STEA 1YNJC 2ZXPA 1CHPD 1TY2A 3H94A 3RZOB 1Y8NB 2A6HC 3I72A 1BF4A 2XN9C 3P20A 2JXMB 4C3IB 1NCVA 4DN4M 1LTAD 4FF4A 1H9KA 2VXWA 4LMQD 1EY4A 1XWEA 5ELBA 3OMCA 4DK1A 4EGVA 1F2ZA 2JA6B 5FO9B 3VR6A 3TSSA 4FP5D 2Q8RE 3GV3A 1E2WA 1SYGA 5CGKA 3KLSX 1LTGD 4A3GB 1ZYRC 5KYLA 1O7LA 4CHTB 3KBXA 2B39A 5IT9L 3VR5A 4K2KA 5KYIA 1SFOB 1PYWD 2AQ2B 3X3MA 1XX8A 2CW0C 3OIPA 4K14A 1HQRD 1HUNA 3W3AA 4WFN3 3DEPA 3MHBA 1U4PA 3OWEB 3TBIB 3ERQA 2N55A 1U9RA 1VF5C 2VNUD 3EA6A 1ESRA 3S1RB 2HDMA 5I6WA 3S15B 3GTMB 4I7ZC 3V2TA 2VB2X 3K0YA 1ET9A 1EZ6A 2I46A 2KA7A 2NB0A 2EY5A 1XTCD 3K58A 1JE4A 2E76C 1TWHB 2SDFA 1GUTA 2NTSA 4KY5A 4IUQA 3DUZA 4B08A 1Q8IA 4OO1I 3NTKA 3SE0A 1MSGA 3A55A 1I4GA 3V05A 2KHSA 1STAA 2B2YC 2A69C 5J22A 1EYDA 5HURA 1L0XB 3IFDA 5BN5A 3M7NA 3GO5A 2GA4B 1YNND 3PUZA 3WOEA 3T56B 5IGGA 2EYMA 1Z6HA 4HAEA 3DWQA 1GUOA 2YU9B 1BCPD 1BCPB 1B44D 2G9HD 1HHVA 4V0BA 1E0BA 5C0XH 1A3TA 3H3VC 1WTWA 3BDOA 2O2LD 5M3MB 1U4MA 1S5CD 3IAYA 1SYEA 3L7ZC 4F88A 2L11A 4HCEA 4KKTA 3J80E 1FNUA 3CQZB 5IGEA 1L0YB 1HFGA 3WOFA 2BDOA 4NP5A 2Z4HA 4XYOA 1F9PA 3S16B 1NAPA 5E3FA 1BCPF 1W6KA 1STHA 4U673 4Y7NB 3Q24A 1PRTC 1CTMA 1EEID 1V1OA 4KD3A 2AUJD 1EEFD 1R4PB 1SNQA 1HFNA 4V190 1PZKD 1SNMA 5KNCA 4HN7A 1PTOD 1PTOB 4ME5A 4IFDG 2F0PA 1JB3A 1Z7TA 1X3PA 3OMGA 1DM0B 2IX0A 4OIKA 2B2WA 2MPMA 2FHTA 3BS1A 1V1PB 2KCCA 4G7HC 1ML0D 4PV1C 3HKZB 2WV6D 1HA5A 1RODA 2E2IB 4ZKCB 2L5TA 1IW7D 3K5OA 1PTOF 1GHKA 4HR7B 4RA8A 3TN2A 4RH6A 4TSSA 2BE5C 2IT1A 2A6EC 1DCZA 3S1QB 1D2BA 1EZ8A 2RKSA 2JE6I 4K2LA 1C4QA 2BA1A 4KD4A 3S9WA 3CU7A 4XQNA 3MXGA 2O4XA 2QILA 2Z8LA 1SAPA 4A3JB 3HP3A 2E2HB 2RSNA 5CV5A 3FRPB 1J8IA 1V43A 1O78A 5KIXA 2H4OA 2M00A 4XQQA 1NR4A 5DAUA 3Q22A 3L3OC 3FVQA 4KN4C 1F9QA 4DNTB 1W6JA 1CQVA 1U4LA 4XXEA 2A68D 4DFAA 1SNPA 3D6CA 4XT1B 3C3LA 3HG9A 1SBBB 1SYFA 2WIIB 4RWSC 5BN4A 2IWHA 3R2TA 2EDGA 3QG1A 1H9SB 1DZ1A 3I4MB 5J1ZA 2F0GA 2Q8IB 4DXGA 4L8JA 1PTOH 2F0SA 2F0IA 3OW7A 4OIJA 5I6YA 1PMRA 2EYPA 1FNWA 2ZT9C 2LMCB 5C6AA 2F0EA 4RGMA 1Q1EA 3HRZC 1I6HB 1DOKA 2F0WA 3FEWX 1JC7A 5JVH3 1LTSD 1LABA 3A7AB 1MI2A 4KHZA 4MIUA 1DONA 3SEBA 1OO9B 1H9RA 3DMUA 3J81L 3VR2A 2EJMA 4IUPA 1C48A 3W2DA 3PV0A 1CI3M 4RAUC 4F7XA 1GJXA 1TWAB 3MFYA 4IFDI 4S3SA 2NWGA 1JOOA 4MHEA 4A3EB 1EYCA 1LT6D 2FMMA 2ICEC 4K6LA 1ENAA 4ZK9B 4QUFA 1QOHA 1HRJA 4RCOA 4ZUIA 1II3A 1SJHD 1M8AA 2H1EA 1IYVA 4C3HB 2M9VA 1WTXA 2C9OA 2JYOA 3DM1A 4QUCA 4X3KA 1TS5A 4ODGA 4J1MA 2SNSA 4YIJA 1OXVA 3OPOA 4KK7A 2J0TD 4QF4A 2KJXA 1RKNA 5C3XA 2JSOA 4R8IA 1D6EC 5IT9E 1KAAA 5D65A 2DY7A 5EPKA 5C44B 5I9OA 1G6ZA 4FXDA 1IYUA 1BDOA 3LX0A 3MXUA 1PDQA 3K57A 3HOZB 3OIQA 1AZPA 1B2TA 4X3SA 1CK1A 3VR4A 4IUUA 4DA2A 2F0KA 2B2UA 2C5CA 1DD2A 2AUKA 3I90A 5A2QE 2EYOA 4CJ2C 4HSPA 1BUVT 2F3VA 3TP5A 3HOYB 1TT2A 1IKMA 1CFMA 1F2YA 2HDLA 5ELCA 2XRQD 2OT2A 5J39A 2LKVA 3QJYA 4KV6A 3NTIA 5K36H 4OO1G 1O80A 5T1GA 4CKBA 4CBVA 1HA6A 2KQ3A 2L1BA 3I8ZA 4QIWB 3GQBA 3OWFA 1EOTA 1I4HA 2K05A 5ELFA 2EY1A 1SNDA 5ISRA 3ITPA 1AP0A 4HTHA 4CGYB 3QOJA 2SEBD 5KNDA 4DNRB 5C0XJ 3SK8A 1T5EA 1KNEA 3GTJB 2JA8B 3D8GA 1ZKOA 1KTKA 2O5JC 2QF7A 1GXDC 1S5ED 4PMCA 2TSSA 4H0LC 1M4VA 2XSCA 1Y69U 1EU4A 5D3IB 1WTRA 4RFBA 2FINB 5EGTA 1Q12A 5F2DA 1S5DD 3AB9A 4EQNA 2I07B 4C1NK 3SK5A 3FDTA 1STGA 2V4DA 4IN3A 1WVLA 3NBHA 4ZLTF 1MBYA 1WTPA 3KLSA 3C2PA 3QWNA 2B8GA 2F0HA 2HCCA 4UAIA 1T5XD 2MGSA 4HMJA 2F1MA 2AWOA 3LNNA 5KRUA 2CQAA 2XNAC 1EIGA 2X69A 2R3ZA 2RQXA 1RJTA 3H6MA 1HTPA 2K03A 3GTQB 4WJWA 2RDFA 1I6VC 3GTPB 3ONAB 5CORA 3TP8A 1Y1WB 1LACA 2B2UC 2EOTA 1KLUD 3HS0C 5HGTA 1XXGA 3QO2A 2IX1A 1Z47A 3MXNA 2F0VA 4KN7C 3MAQA 3PUXA 5EPJA 1UEAB 1DXMA 3P75A 1AN8A 3NE5B 2EYFA 5E4XA 1EY6A 1A3VA 1TS3A 4G7ZC 3MZ5A 1VDZA 1EWCA 4X3UA 1KDAA 3MFGA 1GUGA 5EPLA 4FNFA 1LTTD 4AYBB 1JCKB 1RD9D 2K5DA 4Q5VA 1HPCA 4K8JA 1D1KA 2A69D 4KTAA 1TWGB 4H7BA 4J8QA 3G7LA 1LT3D 3O13A 3NBIA 4XQJA 2E74C 1A2TA 2ICIA 4WRDA 5AFWA 3NWSA 2F0QA 4BA2I 1QILA 4ZRZA 4TRDA 2EYLA 3T51B 1LTBD 1SE3A 3J7AV 1B50A 4C3IG 5EKIA 1EY7A 2F4IA 5CYUA 1AW7A 3GTLB 1TR5A 4M8AA 2K6AA 4IURA 2F3WA 2F0TA 4DGZA 2Z4IA 2QDBA 1G91A 1CZWA 3T13A 1SE4A 2EXZA 4FF2A 1PZJD 2L4NA 2KUMA 3K6OA 5CC4A 1DOMA 1I4QA 2PPBC 3MA2B 1H9SA 1SSOA 4G4KA 4L6TB 1PRTB 5C5LA 1CQFA 5E1FA 1JWUD 2XRSD 2IPKD 2E75C 5D14A 3GD7A 4XT3B 1B3AA 2IW3A 4DAVA 1AZQA 2RVLA 4CKEA 4U68A 4R8NA 3KK7A 1UAPA 1RF2D 3AMUA 4Z9CB 5JPNC 1FR3A 2K5WA 1BOSA 2RBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 3;  5DM6 3;  3PIP 3;  5JVG 3;  4U67 3;  3PIO 3;  5JVH 3;  4WFN 3; 
#chains in the Genus database with same CATH topology
 4K5X A;  1B53 A;  4M1U B;  2N78 A;  4NXN L;  2PMZ E;  2FMC A;  1IBM L;  4O2D A;  1QUQ B;  5G3L D;  5CV4 A;  4DNI A;  2PYK A;  3VA5 A;  1N9W A;  3E5S A;  4RGN A;  4KJO A;  1CA5 A;  3Q23 A;  4JI3 Q;  3GP7 A;  1TWG H;  1Y14 B;  1QG7 A;  1R9T B;  4L5Q A;  3D4W A;  1ZXT A;  2EY6 A;  2QA4 A;  1C8C A;  4KY6 A;  4B9W A;  3PIO A;  4JPB W;  4YWL A;  3W5O A;  1Q3L A;  2X6G A;  3EIV A;  4TVA B;  4DV2 L;  3HOW B;  3M4O B;  1S72 A;  1Q81 C;  5DM6 3;  4BXX G;  4BBS B;  3EFX D;  3M4Y A;  1E2V A;  4AIM A;  1IW7 C;  3S14 H;  4R4O A;  5DM7 3;  4CDC C;  5I2X A;  4LFC L;  3A7L A;  3URY A;  5IOC A;  2AQ1 B;  3PO2 B;  4B3R Q;  4KHV A;  1Q1B A;  4LAA A;  2QCP X;  2ASB A;  5G3L F;  2QEJ C;  2R7F A;  3H3V H;  1STY A;  2UU9 Q;  4DR7 Q;  4B3T L;  3GTL H;  1V9P A;  4EQO A;  2DNE A;  4CJ1 B;  1X32 A;  1WI5 A;  4ILW A;  4GOP B;  3UE0 A;  2L0C A;  4RG1 A;  2LXJ A;  1IL8 A;  4WOR A;  2D9U A;  5JEA G;  4BBR B;  5BN3 A;  3A8J E;  4B3M Q;  4JI6 Q;  1QNK A;  2NN6 G;  4DXF A;  1CHQ D;  3SK4 A;  3J7A F;  1MGS A;  2WIN B;  3E3X A;  3NPP A;  1XPO A;  2JQO A;  2Q2T A;  2M2L A;  3OYY A;  1B8A A;  1LO5 D;  4LF4 L;  4OWT B;  2K52 A;  1RTN A;  3MEH A;  2F03 A;  3IKJ A;  1G8Z D;  4BA1 I;  2MQH A;  4NB3 A;  1A3U A;  2VS1 A;  2L12 A;  3OTO L;  2EZV A;  3CCU A;  4LW1 A;  5CBA E;  3VYR A;  3BZK A;  4IAL A;  5EBD A;  2PQA A;  1XNR L;  3N52 A;  4MTN A;  2D62 A;  3PIP 3;  1WTH A;  3A8I E;  4JI5 Q;  5E7N A;  5M3M G;  3AU7 A;  3DM3 A;  4O42 A;  4OHJ A;  2ALY B;  3VYS A;  4C3J G;  1D7Q A;  5KNB A;  4EQP A;  2A68 C;  1IXR A;  4K5V A;  3U9O A;  1GUN A;  2L9H A;  1HNW L;  2F0L A;  3QOL A;  1HZ9 A;  1I3Q B;  3G4S A;  1TWF H;  3OOC A;  2EPB A;  2UUB L;  3KOJ A;  2O5I C;  1B9N A;  1H9J A;  1HR0 Q;  4JYA Q;  1ASZ A;  5JJK A;  3M7G A;  2RDH A;  3R2I A;  4A3D B;  3VA7 A;  2JEA I;  1WCM B;  1VMC A;  1KL9 A;  4JOI A;  4G57 A;  4DUZ L;  2AWN A;  3BVZ A;  1MD2 D;  1KNA A;  3M9B A;  1SRO A;  5I2Y A;  3V96 A;  3Q0A A;  3FP9 A;  5J3B A;  1GVP A;  1E3P A;  1N8R C;  1GD7 A;  5IT9 c;  1CA6 A;  5H1S E;  3J80 L;  1CKN A;  4IPC A;  1RCV D;  3W1G A;  5IGD A;  1QVG A;  4IJL A;  2DN8 A;  5IIF A;  2K5N A;  5M3F B;  1R9T H;  1BQQ T;  4RCN A;  3CRK C;  4H44 C;  2N88 A;  4LUV A;  2B2W C;  3K8A A;  4B9X A;  4A93 B;  2BA0 A;  3IRB A;  4F87 A;  3SXH A;  4A3K G;  1FNV A;  1QE6 A;  3HOW H;  3M4O H;  3MVV A;  4QCL A;  1A15 A;  4UDU C;  2K14 A;  3E0J A;  2WP8 J;  4BBS H;  1EWH A;  2LXK A;  1K8M A;  1TII D;  5M5X B;  4JI1 Q;  1GOZ A;  1B4O A;  5FLX L;  3AQQ A;  4NW2 A;  1I50 B;  4MN3 A;  2UXD Q;  1DJR D;  1V1Q A;  2IX3 A;  3CRL C;  3JAM L;  2LFN A;  4PMW A;  5M5Y B;  2QGQ A;  3SR1 A;  1ZEQ X;  4JG2 A;  3I4L A;  4IZ8 A;  2ES2 A;  3ZYY X;  2D5D A;  4BBR H;  3A5Z B;  1S3O A;  3ULJ A;  4L5S A;  3KLR A;  3E9I A;  4UP8 A;  4OL7 A;  1F2M A;  5C4X B;  4KKS A;  4DV5 L;  1KDB A;  2RDG A;  4DR4 L;  3D3R A;  1SYC A;  4DF7 A;  3MTS A;  4X3T A;  2TMP A;  3H09 A;  5IYC G;  3RD4 A;  5FLM G;  2EYJ A;  1I4P A;  3T1H Q;  2CCZ A;  3ND8 A;  2HCI A;  3FPP A;  2K1B A;  2RHS B;  4GKK L;  1EQQ A;  1F77 A;  4JBM A;  4GNX B;  2NVX B;  2ZM6 Q;  1OXU A;  1VQJ A;  1A2U A;  4LFB Q;  2KED A;  1YIT A;  1HNX Q;  3E9H A;  5HGQ A;  2UXB L;  3KJP A;  1OXS C;  3EJI A;  1YHQ A;  2K04 A;  2N3S A;  2WAC A;  1KLG D;  5I4D A;  1X3E A;  1EIF A;  1I3Q H;  2PQE A;  4PQX A;  3TRE A;  1JOR A;  2YV5 A;  5D3D A;  3FMC A;  3I3C A;  4NKL A;  2PZT A;  3RMH A;  3NP8 A;  2B63 B;  4A3D H;  1XNQ L;  3EVQ A;  2NN6 I;  2EVB A;  1WCM H;  2MUY A;  3T53 B;  4YWM A;  4O1N A;  1KAB A;  1BXT A;  5CV6 A;  5EJW A;  3HOX G;  5FK9 C;  3G6J B;  4XYQ A;  2ZXR A;  1EQT A;  2WAQ G;  4DR1 L;  4ALP A;  2VB3 X;  3RLF A;  2BOS A;  4OWX B;  1Y8O B;  3MXP A;  4IQZ A;  2WB1 G;  2XVS A;  1A62 A;  2OTL A;  1IHZ A;  4OO1 H;  3I4M G;  4DV1 Q;  4FF1 A;  2A74 C;  2F0O A;  1GUW A;  3QIA A;  1GUS A;  2A5H A;  3UDI A;  3STB C;  2CKZ B;  1VMP A;  4JOI C;  1PZI D;  3F2U A;  2QEX A;  4A93 H;  5M9O A;  2ZXO A;  5IGF A;  2CH4 A;  4HED A;  1QCB D;  4JK1 C;  1R4Q B;  3EN2 A;  1AEX A;  1Q90 A;  5GAD C;  3C46 A;  5M5X H;  3GTK B;  4PZ6 A;  5FO8 B;  1EOV A;  5DEH A;  3I4N H;  3CCM A;  2KEC A;  1X6O A;  3CD6 A;  1SMY D;  3AYH B;  1WD0 A;  2FFK B;  1ENC A;  2VUM B;  5M5Y H;  1KD1 C;  1TVX A;  1A6X A;  1KHI A;  3K59 A;  4A3F B;  3NXW A;  3UDX A;  1JJ2 A;  1PFM A;  1A0I A;  3SVM A;  2CVR A;  4KJN A;  1YNJ D;  3UE1 A;  4P73 A;  3DWP A;  1N36 L;  1UE7 A;  2A19 A;  2RCN A;  2DJG C;  2KCM A;  3K7A B;  5EBC A;  5JJL A;  1ICF B;  1JWM D;  2A6H D;  1B3Q A;  5IYD H;  1W2B A;  5C4X H;  1H9M A;  3FKI B;  1AFP A;  1IYJ B;  1STB A;  1J5E Q;  4A3E G;  3PUY A;  1PH1 A;  2OQK A;  1TU2 B;  3OSO A;  2OQ0 A;  4CDF C;  2XWB B;  4X66 L;  1K73 C;  1I94 L;  1PYB A;  4DV6 L;  1I5F A;  2OEO A;  2B2Y A;  1MJC A;  4FXK C;  3OW2 A;  1NMF A;  3I7F A;  3CC2 A;  1N33 Q;  1Q46 A;  2NVX H;  4JBK A;  3GTG B;  2JEB I;  1SXT A;  5JAV A;  4DV4 Q;  1EY5 A;  1JB7 A;  2DY8 A;  2HQE A;  3A5U A;  1V8Q A;  1J9O A;  3M85 A;  1VQ8 A;  3I4O A;  1BNZ A;  2NUC A;  3CMA A;  4DR6 Q;  5C3E G;  4IFD J;  2FXQ A;  3HOU G;  1HUM A;  3HGB A;  1HTL D;  2SNM A;  4C3H G;  2E5L L;  2B63 H;  1LTR D;  2HIV A;  4JV5 L;  4P71 A;  3I73 A;  2PZU A;  2XGT A;  4CJ0 B;  4HIM A;  3U58 A;  1CSQ A;  4CKC A;  1SR3 A;  4JVZ A;  3KUP A;  1QNU A;  1O7Y A;  4JCV E;  2EQS A;  2X6L A;  2J4X A;  1QB5 D;  1MIU A;  1TY0 A;  3RLO A;  1HCZ A;  1ZYR D;  3GDE A;  3PMF A;  3K5L A;  5DNF A;  1UUP A;  1M90 C;  3EQL C;  4R4Q A;  2BCO A;  1NSN S;  2MFI A;  5GQO A;  1SEB D;  1AE2 A;  2JN4 A;  1QVF A;  5KEE A;  4A3L G;  1PFB A;  2E8G A;  2EJF C;  2SOB A;  1KAW A;  2F3I A;  4EVO A;  5I9P A;  5C44 G;  4HMI A;  4X64 Q;  4A3C H;  2CW0 D;  1F9S A;  4NMZ A;  4A3I G;  2R7Z B;  4L5T A;  2R92 G;  4BY1 B;  1PHJ A;  4RKB A;  5E4W C;  2E2D C;  3E6Z X;  4R4I A;  4UHV A;  2JA7 G;  3GTK H;  1HR0 W;  2DGY A;  2IJ0 A;  1Y1V B;  4RKL A;  2F52 A;  4DV7 L;  4BY7 G;  2F0J A;  4JI0 Q;  1CZG A;  3HKZ E;  4DR2 L;  2Q8T A;  2OF1 A;  2XWJ B;  1EQR A;  2K32 A;  3BYT B;  2Q2I A;  2ZJQ A;  4H13 C;  4DV3 L;  3UDF A;  3L9A X;  1BBW A;  3T16 A;  1KIX A;  4FXG C;  2VUM H;  4KHP Q;  2NVQ B;  3N6R A;  2MP1 A;  2Z6K A;  4ZQ3 A;  4LF8 L;  4A3F H;  4DAY A;  4RGT A;  3CXC A;  4XIG S;  4DKA C;  1PXU A;  1SNC A;  3U9S A;  2OWO A;  3LGJ A;  4HJA A;  2R93 H;  5JEA J;  5JPM C;  3NWT A;  1RTO A;  4QY7 A;  3K7A H;  1ET6 A;  3T4A C;  1V1P A;  1NNX A;  1EYA A;  3S17 B;  2JP1 A;  2QKI C;  3FKI H;  1UEB A;  4Q0F A;  1ILP A;  2B2T A;  3G6E A;  1FGB D;  2EIF A;  4YWK A;  1SNO A;  2F4V L;  2PZW A;  4A76 A;  1QUQ A;  1YIJ A;  5A2Q L;  3SDZ A;  5FKA C;  1HH2 P;  2YYZ A;  4NXM Q;  3BVM A;  3FHW A;  4R9W A;  5A35 A;  4LF6 Q;  3NK9 A;  5LMN Q;  1VQE A;  1XJV A;  3ZJY C;  3NQI A;  1JWS D;  1EQV A;  3GTG H;  2NBF A;  1LYL A;  1S4Z A;  5FJ8 G;  1BBX C;  4JI2 Q;  3RUZ A;  3SHL A;  1PLF A;  4I65 A;  5LMU Q;  1Q82 C;  4ZUJ A;  1CM9 A;  1ONL A;  1FYC A;  1YEZ A;  4ZAI A;  2JJQ A;  1D5M C;  1XYI A;  3GTO B;  4LF9 L;  1EY9 A;  4APV A;  1CT1 D;  4J6H A;  1VQI A;  5EQ0 A;  4N9T A;  4KMU C;  2HHH Q;  3K0X A;  4R4C A;  4DU9 A;  3S14 B;  2UUC L;  1HQM C;  3LWE A;  4IUV A;  4OX9 Q;  1BR9 A;  2KVM A;  3A54 A;  2ZJP A;  1E1T A;  3F2B A;  4DK0 A;  1XPU A;  2NVY B;  3NUC A;  2ZTD A;  1TQO A;  3BU2 A;  1YNN C;  2KCT A;  1K3B C;  3DXJ C;  4L63 B;  3P1H A;  3DEO A;  2R6G A;  4OEM B;  5EAY A;  5KGU A;  5GAG C;  4GZY C;  2RA4 A;  1IKL A;  3PO3 B;  2AKW B;  3C1F A;  5LHY 1;  1BCP C;  1I4R A;  1EU3 A;  2BDN A;  2HIX A;  2KBN A;  4FF3 A;  2F0D A;  2NVT B;  5T1I A;  3D6W A;  4DR3 Q;  5K5P A;  3DWA A;  2VQF L;  4LF5 L;  2R7Z H;  4BY1 H;  2NZ1 D;  2JA6 G;  4C3J B;  1NUC A;  1RHP A;  3ERO A;  1GM5 A;  4YHH L;  4AQY Q;  1Y1V H;  5TSS A;  4HJ7 A;  4IFD H;  1S40 A;  4K5W A;  1PRT D;  2MJ8 A;  1DOL A;  3NQT A;  5FO7 B;  5C0X G;  4YY3 L;  3J81 E;  1XMO Q;  2V1C C;  1BVS A;  4ZKB B;  4DR5 L;  4A3G G;  4DAM A;  1PFN A;  1X9N A;  5BR8 L;  2NVQ H;  3H0G B;  2K75 A;  4B3R L;  3PQI A;  4DV0 Q;  2F0N A;  3I70 A;  1DYQ A;  1TWF B;  4PZ7 A;  3A56 A;  3I91 A;  5IE8 A;  2UU9 L;  4DR7 L;  4RHR A;  1YI2 A;  4HIK A;  3VYT A;  5FLX E;  1JR0 D;  3BDC A;  3KBG A;  1E2Z A;  1LT4 D;  4R4T A;  1Q7Y C;  1Y8P B;  3J7Y W;  3S17 H;  3HZX A;  1PTO C;  1PRT F;  2F0U A;  1S5F D;  3ND9 A;  4B3M L;  1ESF A;  1WD1 A;  3S2H B;  1RDP D;  3JAM E;  4X62 L;  2Z6K C;  2LY7 A;  4A3K B;  1L1O A;  3CCS A;  5CV9 A;  5C4Z A;  4IPD A;  1VQB A;  5COY A;  4G7O C;  4KKU A;  5CMD A;  3CC4 A;  3W1B A;  1BKB A;  2PO4 A;  2ZTC A;  2KEN A;  1QWY A;  1J6Q A;  3TZD A;  1YJ9 A;  3T1Y L;  2EJG C;  3K5N A;  2BE5 D;  3F2C A;  2A6E D;  1JJC B;  3GTO H;  3IL8 A;  4I7A A;  3TZU A;  2B2T C;  2KOL A;  2K28 A;  4ZYS A;  5IWA Q;  4OGQ C;  1TS4 A;  1LT5 D;  3R93 A;  2B2V A;  5IP9 G;  2ID0 A;  3HEJ A;  5JEA H;  2K50 A;  1SYD A;  5EKK A;  4XDX A;  2NN6 H;  3BZC A;  3QB3 A;  5JOB A;  2NVY H;  3WWV A;  1HR0 L;  4RMF A;  4AYB G;  3H91 A;  2PW5 A;  2B8F A;  3JC6 6;  2DNC A;  3R8B A;  3U4Z A;  3UI2 A;  1LV9 A;  5IGC A;  5M5W B;  1KXL A;  5NUC A;  3TDQ A;  3PO3 H;  3H15 A;  1ICW A;  2A1A A;  2HUG A;  4DPG A;  3CCR A;  2FJ2 A;  4P74 A;  2NVT H;  3M4P A;  4PG3 A;  2B29 A;  4DK6 C;  1WTV A;  1G6P A;  4C3J H;  1IBL L;  1VQD A;  2EE1 A;  4LFA L;  4GKJ L;  2ENB A;  1JOQ A;  1AE3 A;  4GN4 B;  4A3M B;  3G71 A;  4ZCK A;  2JK8 A;  3VYU A;  4GNX A;  5GAH C;  2NTT A;  3OHX C;  4IOC A;  4NXN Q;  5JJZ A;  4XTC S;  1SLJ A;  1IBM Q;  2Y0S B;  3IFT A;  1VF7 A;  4DAP A;  3MC0 B;  3PF5 A;  2EYH A;  1KDC A;  2OXP A;  4JI1 L;  1I4X A;  1U4R A;  4BS9 A;  3HOX B;  3H0G H;  4WJ4 A;  1D5X C;  4Y7N H;  2WAQ B;  3TME A;  3CHB D;  3BVG A;  3TP7 A;  1VQ7 A;  4FYD A;  2F0F A;  4C2M B;  2OCE A;  4ABN A;  2WB1 B;  1VQC A;  4LF7 L;  2K01 A;  5LL6 S;  2CQO A;  1WTO A;  1SRU A;  2MHV A;  4TQU S;  3VR3 A;  2XIW A;  4LFC Q;  2K33 A;  4KI0 A;  1JOK A;  2KEE A;  3S2H H;  4A3K H;  4HCS A;  1B9M A;  5CV7 A;  3NTH A;  4QIW E;  3WDN A;  5IGB A;  2RSO A;  4B3T Q;  1PH6 A;  1OXT A;  1T9H A;  3K5M A;  4RHS A;  5C0X I;  1K83 B;  1VQL A;  4C1N I;  1O7Z A;  1L0W A;  1UNS A;  3PGZ A;  2Z6B A;  1CKO A;  1VQ6 A;  1FD7 D;  4JBW A;  1L1O C;  1X3Q A;  4LJZ C;  5CR3 A;  1HNZ Q;  4GLA C;  1EFI D;  1SJE D;  2VL6 A;  3I4N B;  4LUZ A;  3HOV B;  4DK3 C;  1PH7 A;  4OXP A;  3CME A;  3LWU A;  3OTO Q;  5C3W A;  4FO2 A;  3D4R A;  3HKZ G;  1XNR Q;  2WKC A;  4ID6 A;  4C56 C;  3R3O A;  1WTQ A;  3KF8 A;  5M5W H;  2NYZ D;  4AH6 A;  5FLM H;  5LMN W;  1VCI A;  3KYH C;  2PCF B;  1YHB A;  4PMB A;  3NSW A;  2B2V C;  3BDL A;  1SN8 A;  1X55 A;  1HNW Q;  5EKL A;  2YTY A;  3KLW A;  2PMZ B;  2D2C C;  5CV8 A;  2UUB Q;  4YCV A;  1VQO A;  3HOW G;  4KLK A;  4BBS G;  4ULL A;  4A3B B;  3PIO 3;  3MWY W;  3TS0 A;  4N8F A;  4K6D A;  1NJI C;  4A3M H;  5C3E B;  3FPU B;  1OXX K;  4DUZ Q;  4IUN A;  4KY7 A;  3TP6 A;  3PO2 G;  3CCE A;  3HOU B;  4O0A A;  1NY4 A;  2KCN A;  3S1M B;  1VQG A;  4WJ3 M;  4BWG B;  1ILQ A;  2XTI A;  5CBE E;  3BJU A;  1HXY D;  1B1Z A;  2I5M X;  2R61 A;  4A3J G;  3RN5 A;  2IL8 A;  3F2D A;  4GLV B;  3GV6 A;  2K5Q A;  1D1I A;  3HOX H;  3NEL A;  3K80 C;  1FJG L;  3X3N A;  4NPS A;  3DHQ A;  2K7V A;  3EBE A;  4HJ8 A;  4C2M H;  1SYB A;  5C5M A;  2CWA A;  3M3Y B;  5ELE A;  4GNX C;  2YTV A;  3I2Z A;  2JA5 B;  4HIO A;  4TKO B;  4NDX A;  5IOD A;  4HSV A;  4P2C B;  4A3I B;  3RZD B;  2R92 B;  4YCW A;  3J7A 5;  1QJO A;  3BYY B;  3SK6 A;  5C4J B;  1NR2 A;  1G2T A;  2JA7 B;  1BO0 A;  1EY8 A;  1TWC B;  2EY2 A;  2VZA A;  1JQY D;  2LS0 1;  4BY7 B;  1K83 H;  3S2D B;  1SE2 A;  3KDF A;  5ELD A;  4PNY A;  1YBY A;  3H3V I;  1G29 1;  1KRS A;  2I0Q A;  3CCQ A;  2QDL A;  2AQ3 B;  2LSS A;  1EY0 A;  3A8K E;  3BG3 A;  1W3S A;  1CKM A;  2Z1C A;  4QMG A;  1MSH A;  1F9R A;  1VQ9 A;  1N32 L;  1S5B D;  1O7I A;  1TKW B;  1IBK L;  1OTC A;  3C1E A;  4DV5 Q;  4F8M A;  4DR4 Q;  2WKD A;  1L2F A;  3NHH A;  4QB4 A;  4B3S L;  1PVO A;  1GHJ A;  1WCM G;  4RGO S;  4FVM A;  2DJF C;  1CKN B;  1WYD A;  2L55 A;  3HOV H;  3L2P A;  3S1N B;  4ME3 A;  4E6I A;  1K8O A;  4AYB E;  3S24 A;  3P7J A;  1LTI D;  1TS2 A;  4N9P A;  4K8I A;  3NEN A;  4GLX A;  2A73 B;  1Q86 C;  4GKK Q;  4Y52 H;  1G2S A;  2F0M A;  5FOB B;  4EX5 A;  3PUV A;  1LLR D;  2NZO A;  1MHW C;  3PUW A;  1F2L A;  1STN A;  1EIH A;  4A3E H;  2R93 B;  5M3F G;  4K0K L;  2UXB Q;  3BZD B;  3CKI B;  1ENF A;  1JIC A;  3D4D A;  5JVG 3;  4A93 G;  2PNR C;  1EL0 A;  1SMY C;  4IUT A;  4HID A;  1SDF A;  4QL5 A;  1D5Z C;  5K36 G;  1HZB A;  4A3B H;  1XNQ Q;  1UE1 A;  2ZTE A;  4LK1 C;  5LL6 X;  2E2J B;  2G9D A;  2CHB D;  2PW7 A;  4JI4 L;  3D31 A;  5C3E H;  2J7Z A;  3QR8 A;  3Q6S A;  5C4H A;  1STE A;  1YNJ C;  2ZXP A;  1CHP D;  3ULL A;  3HOU H;  4DR1 Q;  3I55 A;  3S1M H;  1TY2 A;  3H94 A;  3RZO B;  1Y8N B;  2A6H C;  3TRZ A;  3I72 A;  1BF4 A;  2XN9 C;  2EXD A;  3P20 A;  2JXM B;  4C3I B;  1NCV A;  4DN4 M;  1LTA D;  2QW7 A;  4FF4 A;  1H9K A;  3F8T A;  4QJF A;  2VXW A;  4LMQ D;  1EY4 A;  1PYS B;  3M3Y H;  4KHP L;  1XWE A;  3RR5 A;  2JA5 H;  4IPH A;  4A3L H;  5ELB A;  3ER0 A;  4OON A;  3OMC A;  3CPF A;  4DK1 A;  5C44 H;  4EGV A;  4A3I H;  3RZD H;  2R92 H;  1F2Z A;  1WOC A;  2JA6 B;  1X3G A;  5FO9 B;  5C4J H;  2JA7 H;  3VR6 A;  3TSS A;  1TWC H;  4FP5 D;  1N34 L;  2Q8R E;  3GV3 A;  4BY7 H;  1E2W A;  1SYG A;  5CGK A;  3S2D H;  3KLS X;  4H02 A;  1N36 Q;  1LTG D;  4A3G B;  4JC0 A;  1ZYR C;  3RN2 A;  5KYL A;  2UUA L;  1O7L A;  5JJI A;  4CHT B;  3KBX A;  2B39 A;  5IT9 L;  3VR5 A;  3HOZ G;  4K2K A;  5KYI A;  1SFO B;  3S1N H;  1PH8 A;  4UP7 A;  4OEL B;  1PYW D;  1KC8 C;  2AQ2 B;  3X3M A;  4OWW B;  1I94 Q;  1XX8 A;  2CW0 C;  3OIP A;  2RCF A;  5IYB G;  4K14 A;  3J81 i;  1HQR D;  1HUN A;  1P8L A;  3SGI A;  3W3A A;  4WFN 3;  3DEP A;  3MHB A;  1U4P A;  3OWE B;  3HOY G;  3UDG A;  3TBI B;  3ERQ A;  2N55 A;  1U9R A;  1VF5 C;  2VNU D;  3EA6 A;  4JI8 L;  4JI7 Q;  1SMX A;  1ESR A;  5FJ8 H;  3S1R B;  4X65 L;  2HDM A;  2E5L Q;  4JV5 Q;  2IY5 B;  2IHF A;  5I6W A;  2E2J H;  3S15 B;  3GTM B;  3J81 c;  4I7Z C;  3V2T A;  2VB2 X;  3K0Y A;  1P16 A;  1ET9 A;  1EZ6 A;  2I46 A;  2KA7 A;  2NB0 A;  3RZO H;  2EY5 A;  1XTC D;  1EUJ A;  3K58 A;  1JE4 A;  5IP7 G;  2ATW A;  2E76 C;  2UXC L;  1TWH B;  1MKH A;  5ELO A;  5AJ3 L;  2SDF A;  1GUT A;  2NTS A;  4KY5 A;  4IUQ A;  4C3I H;  3DUZ A;  4B08 A;  1Q8I A;  4OO1 I;  3NTK A;  3SE0 A;  1MSG A;  3CPW A;  3A55 A;  4IO9 A;  2PNH A;  1I4G A;  3V05 A;  2KHS A;  1STA A;  2B2Y C;  2A69 C;  5J22 A;  1EYD A;  3JAM c;  5HUR A;  2JA8 G;  4DV7 Q;  1L0X B;  3IFD A;  2D0O A;  5BN5 A;  4GOP A;  4DR2 Q;  3GO5 A;  3M7N A;  2GA4 B;  2JA6 H;  1YNN D;  3PUZ A;  3WOE A;  3T56 B;  1YHA A;  2I5H A;  5IGG A;  2N49 A;  2EYM A;  4DV3 Q;  2HT1 A;  1Z6H A;  4HAE A;  3DWQ A;  3PIP A;  1GUO A;  4LF8 Q;  3NBH B;  2YU9 B;  1BCP D;  1BCP B;  1B44 D;  2G9H D;  1HHV A;  4V0B A;  1GO3 E;  4UY8 C;  1E0B A;  3CW2 C;  5C0X H;  1A3T A;  3H3V C;  1WTW A;  3BDO A;  4A3G H;  2O2L D;  1XTD A;  5M3M B;  1U4M A;  2VW9 A;  4JI3 L;  1S5C D;  1E24 A;  2GVB A;  3IAY A;  4LWC A;  1SYE A;  3L7Z C;  4F88 A;  2F4V Q;  2L11 A;  4HCE A;  1SFO H;  4KKT A;  4CDD C;  3J80 E;  1FNU A;  3CQZ B;  4R1J A;  1L0Y B;  3WOF A;  1HFG A;  5IGE A;  2BDO A;  4NP5 A;  2Z4H A;  2R7D A;  4XYO A;  1F9P A;  3S16 B;  1NAP A;  5E3F A;  2Z9H A;  1BCP F;  1W6K A;  1STH A;  4U67 3;  4Y7N B;  3Q24 A;  1PRT C;  1CTM A;  3AFQ A;  2Z0S A;  4MNO A;  5DLQ E;  1EEI D;  1V1O A;  1A63 A;  4LF9 Q;  3NEM A;  4KD3 A;  2AUJ D;  1EEF D;  1R4P B;  1SNQ A;  4DUY Q;  1HFN A;  4V19 0;  1K8A C;  3S1R H;  1PZK D;  1SNM A;  2CWP A;  5KNC A;  4HN7 A;  1K3R A;  1PTO D;  1PTO B;  4QGU A;  1Y1W G;  4JI6 L;  3MXN B;  4ME5 A;  2VQE Q;  3S15 H;  1Y1V G;  4IFD G;  2F0P A;  3GTM H;  3KF6 B;  1JB3 A;  4DAY B;  1Z7T A;  2D0P A;  4BXX H;  4X6A H;  1X3P A;  3OMG A;  1DM0 B;  5IP9 H;  2IX0 A;  3ERS X;  4OIK A;  2B2W A;  1TWH H;  2MPM A;  1K9M C;  2FHT A;  3BS1 A;  1V1P B;  2KCC A;  4G7H C;  1ML0 D;  2AHO B;  4PV1 C;  3HKZ B;  4JW0 A;  4P75 A;  2WV6 D;  4JI5 L;  1HA5 A;  1VQK A;  1ROD A;  2E2I B;  4ZKC B;  4LF5 Q;  2VQF Q;  2L5T A;  1IW7 D;  3K5O A;  4LNQ A;  1PTO F;  1GHK A;  4HR7 B;  4RA8 A;  4YHH Q;  3TN2 A;  4LUO A;  4RH6 A;  4TSS A;  2BE5 C;  2IT1 A;  2A6E C;  1DCZ A;  3S1Q B;  4EQ5 A;  4JYA L;  1PFS A;  1D2B A;  3PSI A;  4YY3 Q;  3PF4 A;  4DR5 Q;  1EZ8 A;  1YJW A;  1G51 A;  2RKS A;  2JE6 I;  4K2L A;  5BR8 Q;  1C7Y A;  3KFU A;  1C9O A;  1C4Q A;  2BA1 A;  4KD4 A;  3S9W A;  3CU7 A;  4XQN A;  3MXG A;  2YU9 H;  1PH2 A;  2Q2U A;  2O4X A;  2QIL A;  4GN3 B;  2N8N A;  4HJ9 A;  2Z8L A;  1SAP A;  5M3M H;  4A3J B;  3HP3 A;  2E2H B;  2RSN A;  5CV5 A;  4GOP C;  3FRP B;  1FGU A;  1C0A A;  1J8I A;  1V43 A;  1K0R A;  1O78 A;  5KIX A;  2H4O A;  2M00 A;  1XMQ Q;  1B7Y B;  1E22 A;  3CCJ A;  4XQQ A;  1X65 A;  1NR4 A;  4JBJ A;  4YCU A;  2WFW A;  5DAU A;  4X62 Q;  3Q22 A;  3CQZ H;  3L3O C;  3FVQ A;  4KN4 C;  1YVC A;  1F9Q A;  1HNZ L;  4DNT B;  1W6J A;  1QZG A;  1CQV A;  1U4L A;  4XXE A;  3S16 H;  2A68 D;  4DFA A;  1SNP A;  3D6C A;  2IHE A;  4XT1 B;  3C3L A;  3HG9 A;  3PO3 G;  1SBB B;  1SYF A;  2UXD L;  3T1Y Q;  2WII B;  4RWS C;  5BN4 A;  1WFQ A;  3R2T A;  2IWH A;  2EDG A;  3QG1 A;  1H9S B;  3U4V A;  4DV2 Q;  3M4Q A;  1DZ1 A;  1DGS A;  2CFM A;  2VY3 A;  5J1Z A;  3I4M B;  2F0G A;  2Q8I B;  4DXG A;  4L8J A;  1PTO H;  2F0S A;  2HQL A;  3RNU A;  2F0I A;  3OW7 A;  4OIJ A;  5I6Y A;  1PMR A;  2EYP A;  1FNW A;  5L37 A;  3CF5 A;  4UPA A;  2ZT9 C;  2LMC B;  1B70 B;  5C6A A;  2F0E A;  4RGM A;  1LM0 A;  1Q1E A;  1JJG A;  3HRZ C;  1I6H B;  1DOK A;  2F0W A;  3FEW X;  3T1H L;  1JC7 A;  1M1K C;  4IPG A;  5JVH 3;  3H0G G;  2KHI A;  2P5Z X;  1LTS D;  4A4I A;  1LAB A;  1NMG A;  1MI2 A;  3A7A B;  4KHZ A;  4MIU A;  1DON A;  3SEB A;  1OO9 B;  2ZM6 L;  1X3F A;  1H9R A;  3DMU A;  3J81 L;  2E2I H;  1L1O B;  1PA6 A;  1X56 A;  1AH9 A;  3VR2 A;  2EJM A;  4LFB L;  1HNX L;  4IUP A;  1IBL Q;  4LF4 Q;  3ULP A;  1EIY B;  1C48 A;  4LFA Q;  4GKJ Q;  1FVI A;  3E0E A;  4POG A;  3CC7 A;  3S1Q H;  3W2D A;  3RLN A;  3PV0 A;  1CI3 M;  4RAU C;  4F7X A;  1GJX A;  1TWA B;  3MFY A;  4IFD I;  4S3S A;  2NWG A;  1JOO A;  4MHE A;  5IYC H;  4A3E B;  1EYC A;  1LT6 D;  4GS3 A;  3PO2 H;  2FMM A;  2ICE C;  4K6L A;  4A75 A;  1ENA A;  1U0L A;  4ZK9 B;  4QUF A;  1NBW A;  2AMC B;  4A3J H;  2NZH A;  1QOH A;  2E2H H;  1HRJ A;  4LF7 Q;  4DV1 L;  1UE5 A;  4RCO A;  4ZUI A;  1II3 A;  1SJH D;  1M8A A;  2H1E A;  1IYV A;  4C3H B;  2M9V A;  2CH4 W;  1WTX A;  2C9O A;  2JYO A;  3DM1 A;  1MJE A;  4QUC A;  4X3K A;  1TS5 A;  1RIP A;  2G5D A;  3AEV A;  4ODG A;  4J1M A;  2SNS A;  4YIJ A;  1OXV A;  3OPO A;  1K28 A;  4BBR G;  4KK7 A;  2J0T D;  4QF4 A;  3D0F A;  2KJX A;  1RKN A;  2BH8 A;  3ICE A;  5C3X A;  2JSO A;  4R8I A;  1D6E C;  5IT9 E;  1KAA A;  3I4M H;  1KRT A;  2PQA B;  1X54 A;  5D65 A;  2DY7 A;  5EPK A;  1VQF A;  2PI2 E;  5C44 B;  4A3M G;  5I9O A;  1VS0 A;  1G6Z A;  4FXD A;  1IYU A;  1BDO A;  3LX0 A;  3MXU A;  2Y0S G;  3CCV A;  1PDQ A;  3K57 A;  1I6H H;  3HOZ B;  1J5E L;  1PH9 A;  3TS2 A;  3OIQ A;  1AZP A;  3STB D;  1VQM A;  1B2T A;  4X3S A;  1CK1 A;  1LUZ A;  3VR4 A;  1N33 L;  4IUU A;  2MO0 A;  4DA2 A;  2F0K A;  2B2U A;  4DV4 L;  1IL2 A;  2C5C A;  2JA9 A;  1DD2 A;  2PI2 A;  2AUK A;  4A3D G;  2H5X A;  3I90 A;  5A2Q E;  2EYO A;  4CJ2 C;  4HSP A;  1BUV T;  2F3V A;  3CP0 A;  5M3F H;  3TP5 A;  4GN5 A;  3HOY B;  1TT2 A;  4DR6 L;  1IKM A;  4POF A;  1CFM A;  1F2Y A;  1JE5 A;  4MZ9 A;  2HDL A;  3PCO B;  5ELC A;  3L0O A;  2B3G A;  3MEF A;  2XRQ D;  2OT2 A;  5J39 A;  1TWA H;  2LKV A;  3QJY A;  4KV6 A;  3NTI A;  4P72 A;  5K36 H;  1FL0 A;  4OO1 G;  1O80 A;  5T1G A;  4CKB A;  3J81 j;  4CBV A;  2RF4 A;  2I5L X;  3VDY A;  1I50 H;  1FJG Q;  1HA6 A;  2KQ3 A;  4FDB A;  1XPR A;  2L1B A;  1RL2 A;  3I8Z A;  4QIW B;  3GQB A;  3OWF A;  1EOT A;  1I4H A;  4N8X 1;  2K05 A;  5ELF A;  5IY0 A;  2EY1 A;  1SND A;  5ISR A;  3ITP A;  1AP0 A;  4HTH A;  4HJ5 A;  3I4N G;  1PH5 A;  4CGY B;  3QOJ A;  3HOV G;  2OTJ A;  4X64 L;  2HD3 A;  3KF8 B;  2SEB D;  5KND A;  4DNR B;  5C0X J;  4C3H H;  3SK8 A;  2A8V A;  1T5E A;  2C35 B;  1KNE A;  1ASY A;  3GTJ B;  1VQ5 A;  1EFW A;  3TQY A;  1HZA A;  1HJP A;  3HFZ B;  2JA8 B;  3D8G A;  1ZKO A;  1KTK A;  4JI0 L;  2O5J C;  2Q2H A;  2QF7 A;  5GAE C;  1GXD C;  1S5E D;  4PMC A;  2TSS A;  3I56 A;  4H0L C;  1M4V A;  2XSC A;  1Y69 U;  1EU4 A;  5D3I B;  1WTR A;  4RFB A;  5IYD G;  5C4X G;  1HZC A;  1N32 Q;  2FIN B;  5EGT A;  1IBK Q;  2GN5 A;  4A3B G;  3CCL A;  1Q12 A;  5F2D A;  4B3S Q;  1S5D D;  4PZ8 A;  3AB9 A;  5ELN A;  2I07 B;  4EQN A;  4C1N K;  3SK5 A;  3FDT A;  1STG A;  2V4D A;  4IN3 A;  4JI7 L;  3G48 A;  3HKS A;  1WVL A;  3NBH A;  4ZLT F;  1MBY A;  1WTP A;  1PH3 A;  3KLS A;  3C2P A;  3QWN A;  2B8G A;  2F0H A;  2HCC A;  4UAI A;  3HOZ H;  1T5X D;  1GKH A;  2MGS A;  4HMJ A;  2F1M A;  2AWO A;  4K0K Q;  2GVA A;  1EYG A;  4NXM L;  1SE8 A;  1VQ4 A;  1D8L A;  3LNN A;  4LF6 L;  5LMN L;  1NE3 A;  5KRU A;  2CQA A;  5IYB H;  3U50 C;  2XNA C;  4JI2 L;  4CDE C;  2B63 G;  1EIG A;  5LMU L;  2X69 A;  2JA5 G;  2R3Z A;  2RQX A;  1RJT A;  3H6M A;  3DLL A;  1HTP A;  2K03 A;  3HOY H;  1IZ6 A;  2BH2 A;  1Z9F A;  3GTQ B;  1A8V A;  4WJW A;  4JI4 Q;  4X66 Q;  2RDF A;  3KDF B;  4DV6 Q;  2HHH L;  1I6V C;  2K5H A;  3GTP B;  1PH4 A;  3J7Z C;  3J80 i;  4OX9 L;  4L5R C;  3A74 A;  3ONA B;  5COR A;  3TP8 A;  1CUK A;  1Y1W B;  1LAC A;  2B2U C;  2EOT A;  1KLU D;  3HS0 C;  5HGT A;  1XXG A;  3QO2 A;  4A3C G;  5IP7 H;  2IX1 A;  1Z47 A;  3MXN A;  2F0V A;  4KN7 C;  1QZH A;  3MAQ A;  3KF6 A;  3PUX A;  5EPJ A;  1UEA B;  1DXM A;  3P75 A;  3J80 c;  1AN8 A;  2MO1 A;  3NE5 B;  2EYF A;  1VQA A;  5E4X A;  1EY6 A;  4DR3 L;  1A3V A;  1TS3 A;  1U5K A;  4J15 A;  3JAM i;  4G7Z C;  3MZ5 A;  1VDZ A;  1EWC A;  4X3U A;  4AQY L;  2VUM G;  3GTJ H;  1KDA A;  4A3F G;  1N34 Q;  2JA8 H;  3MFG A;  1GUG A;  5EPL A;  4FNF A;  2R93 G;  1XMO L;  1H95 A;  1LTT D;  4AYB B;  1JCK B;  5FLX c;  1RD9 D;  3TEH B;  1YNX A;  2K5D A;  4Q5V A;  1HPC A;  4K8J A;  1D1K A;  2A69 D;  1QVC A;  4KTA A;  1TWG B;  2UUA Q;  3FKI G;  4H7B A;  4J8Q A;  4DV0 L;  1VQP A;  3G7L A;  1LT3 D;  1JT8 A;  3O13 A;  3NBI A;  4XQJ A;  1PV4 A;  2E74 C;  2Y0S E;  1A2T A;  2ICI A;  4MTK A;  4QQB X;  4WRD A;  4DUY L;  5AFW A;  3NWS A;  1VQN A;  2F0Q A;  4BA2 I;  4IOA A;  2K4K A;  1QIL A;  4ZRZ A;  4TRD A;  2VQE L;  2EYL A;  3T51 B;  2WAQ E;  1LTB D;  1SE3 A;  3J7A V;  1B50 A;  4C3I G;  5EKI A;  1EY7 A;  1TXY A;  2F4I A;  5CYU A;  1AW7 A;  4IJH A;  2WB1 E;  3B6Y A;  3GTL B;  1TR5 A;  4M8A A;  2K6A A;  4IUR A;  1KQS A;  2F3W A;  4JI8 Q;  2ZJR A;  3F1Z A;  1JMC A;  2F0T A;  4DGZ A;  4X65 Q;  2Z4I A;  4UP9 A;  2QDB A;  2YTX A;  1E7Z A;  2MNA A;  1G91 A;  1CZW A;  3GTQ H;  3T13 A;  5IWA L;  1SE4 A;  2EXZ A;  4FF2 A;  1Q8K A;  1PZJ D;  1K0S A;  2L4N A;  3GTP H;  2KUM A;  3K6O A;  1LTL A;  5CC4 A;  2K5V A;  1DOM A;  1I4Q A;  2PPB C;  2L15 A;  3MA2 B;  2UXC Q;  1Y1W H;  3CAM A;  1H9S A;  1SSO A;  5AJ3 Q;  3KJO A;  1K8G A;  2KHJ A;  4G4K A;  4L6T B;  1PRT B;  5C5L A;  1UWV A;  1CQF A;  3AFP A;  5E1F A;  1JWU D;  2XRS D;  2IPK D;  3Q8D A;  5HY6 A;  2E75 C;  1UE6 A;  5GRO A;  1NTG A;  5D14 A;  3GD7 A;  1EWI A;  2R7Z G;  4BY1 G;  1CSP A;  2UUC Q;  1E1O A;  3K7U C;  1VQH A;  4XT3 B;  1B3A A;  2IW3 A;  4DAV A;  1AZQ A;  3A0J A;  2RHQ B;  1YZ6 A;  1WJJ A;  1YJN A;  2RVL A;  4CKE A;  4U68 A;  4R8N A;  3KK7 A;  2DUD A;  1UAP A;  1BBU A;  1RF2 D;  3AMU A;  4Z9C B;  5JPN C;  1XMQ L;  1FR3 A;  2K5W A;  1BOS A;  2RBM A;  3K81 C; 
#chains in the Genus database with same CATH homology
 4K5X A;  1B53 A;  4M1U B;  2FMC A;  5G3L D;  5CV4 A;  2PYK A;  3VA5 A;  3E5S A;  4RGN A;  4KJO A;  1CA5 A;  3Q23 A;  3GP7 A;  1QG7 A;  1R9T B;  3D4W A;  1ZXT A;  2EY6 A;  1C8C A;  4KY6 A;  4B9W A;  1Q3L A;  2X6G A;  3HOW B;  3M4O B;  5DM6 3;  4BBS B;  3EFX D;  3M4Y A;  1E2V A;  1IW7 C;  5DM7 3;  5I2X A;  3A7L A;  3URY A;  5IOC A;  2AQ1 B;  3PO2 B;  4KHV A;  1Q1B A;  4LAA A;  2QCP X;  5G3L F;  2QEJ C;  1STY A;  4EQO A;  2DNE A;  4CJ1 B;  1X32 A;  4ILW A;  2L0C A;  1IL8 A;  4WOR A;  2D9U A;  5JEA G;  4BBR B;  5BN3 A;  3A8J E;  1QNK A;  2NN6 G;  4DXF A;  1CHQ D;  3SK4 A;  3J7A F;  1MGS A;  2WIN B;  3NPP A;  2M2L A;  1LO5 D;  1RTN A;  3MEH A;  2F03 A;  3IKJ A;  1G8Z D;  4BA1 I;  1A3U A;  2L12 A;  2EZV A;  5CBA E;  3VYR A;  4IAL A;  5EBD A;  3N52 A;  2D62 A;  3PIP 3;  3A8I E;  3AU7 A;  4O42 A;  4OHJ A;  3VYS A;  4C3J G;  5KNB A;  4EQP A;  2A68 C;  4K5V A;  3U9O A;  1GUN A;  2L9H A;  2F0L A;  3QOL A;  1I3Q B;  3OOC A;  2EPB A;  2O5I C;  1B9N A;  1H9J A;  3M7G A;  2RDH A;  3R2I A;  4A3D B;  3VA7 A;  2JEA I;  1WCM B;  1VMC A;  4G57 A;  2AWN A;  3BVZ A;  1MD2 D;  1KNA A;  5I2Y A;  3V96 A;  3Q0A A;  1CA6 A;  3J80 L;  1RCV D;  5IGD A;  2DN8 A;  5IIF A;  5M3F B;  1BQQ T;  4RCN A;  3CRK C;  4H44 C;  2N88 A;  2B2W C;  4B9X A;  4A93 B;  2BA0 A;  4F87 A;  3SXH A;  1FNV A;  1QE6 A;  4QCL A;  3MVV A;  1A15 A;  4UDU C;  3E0J A;  2WP8 J;  1EWH A;  1K8M A;  1TII D;  5M5X B;  1GOZ A;  1B4O A;  5FLX L;  4NW2 A;  1I50 B;  4MN3 A;  1DJR D;  2IX3 A;  3CRL C;  3JAM L;  2LFN A;  4PMW A;  5M5Y B;  3SR1 A;  1ZEQ X;  3I4L A;  4IZ8 A;  3ZYY X;  2D5D A;  3KLR A;  4OL7 A;  1F2M A;  5C4X B;  4KKS A;  1KDB A;  2RDG A;  3D3R A;  1SYC A;  4DF7 A;  3MTS A;  4X3T A;  2TMP A;  3H09 A;  3RD4 A;  2EYJ A;  1I4P A;  3ND8 A;  2HCI A;  3FPP A;  2K1B A;  1F77 A;  2NVX B;  1OXU A;  1A2U A;  2KED A;  1OXS C;  3EJI A;  2K04 A;  2WAC A;  1KLG D;  5I4D A;  2PQE A;  4PQX A;  1JOR A;  5D3D A;  3FMC A;  3I3C A;  4NKL A;  2PZT A;  3RMH A;  3NP8 A;  2B63 B;  3EVQ A;  2NN6 I;  2EVB A;  2MUY A;  3T53 B;  4O1N A;  1KAB A;  1BXT A;  5CV6 A;  5EJW A;  5FK9 C;  3G6J B;  4XYQ A;  2ZXR A;  1EQT A;  2VB3 X;  3RLF A;  2BOS A;  1Y8O B;  3MXP A;  4IQZ A;  2XVS A;  1IHZ A;  4OO1 H;  4FF1 A;  2A74 C;  2F0O A;  1GUW A;  3QIA A;  1GUS A;  2A5H A;  1VMP A;  1PZI D;  3F2U A;  5M9O A;  2ZXO A;  5IGF A;  4HED A;  1QCB D;  4JK1 C;  1R4Q B;  1AEX A;  1Q90 A;  3C46 A;  3GTK B;  5FO8 B;  5DEH A;  2KEC A;  1SMY D;  1WD0 A;  2FFK B;  1ENC A;  2VUM B;  1TVX A;  1A6X A;  4A3F B;  3K59 A;  3NXW A;  1PFM A;  3SVM A;  2CVR A;  4KJN A;  1YNJ D;  3DWP A;  3K7A B;  5EBC A;  1JWM D;  2A6H D;  1H9M A;  3FKI B;  1AFP A;  1STB A;  3PUY A;  1TU2 B;  3OSO A;  2XWB B;  2OEO A;  2B2Y A;  4FXK C;  3GTG B;  2JEB I;  1SXT A;  5JAV A;  1EY5 A;  2DY8 A;  2HQE A;  1V8Q A;  1J9O A;  3M85 A;  1BNZ A;  2NUC A;  4IFD J;  1HUM A;  3HGB A;  1HTL D;  2SNM A;  4C3H G;  1LTR D;  3I73 A;  2PZU A;  4CJ0 B;  4CKC A;  3KUP A;  1QNU A;  1O7Y A;  2X6L A;  2J4X A;  1QB5 D;  1TY0 A;  1HCZ A;  1ZYR D;  3PMF A;  3K5L A;  5DNF A;  1UUP A;  3EQL C;  2BCO A;  1NSN S;  1SEB D;  5KEE A;  1PFB A;  2EJF C;  2SOB A;  4EVO A;  5I9P A;  4HMI A;  2CW0 D;  1F9S A;  4NMZ A;  2R7Z B;  4BY1 B;  4RKB A;  5E4W C;  2E2D C;  3E6Z X;  2IJ0 A;  4RKL A;  1Y1V B;  2F0J A;  1CZG A;  2Q8T A;  2OF1 A;  2XWJ B;  2K32 A;  3BYT B;  4H13 C;  3L9A X;  3T16 A;  4FXG C;  2NVQ B;  3N6R A;  2MP1 A;  4ZQ3 A;  4DAY A;  4RGT A;  4XIG S;  1PXU A;  3U9S A;  1SNC A;  5JEA J;  5JPM C;  3NWT A;  1RTO A;  1ET6 A;  3T4A C;  1V1P A;  1EYA A;  3S17 B;  2JP1 A;  2QKI C;  4Q0F A;  1ILP A;  2B2T A;  1FGB D;  1SNO A;  2PZW A;  5A2Q L;  3SDZ A;  5FKA C;  2YYZ A;  3BVM A;  4R9W A;  5A35 A;  3NK9 A;  3NQI A;  1JWS D;  1EQV A;  2NBF A;  1S4Z A;  1BBX C;  3RUZ A;  3SHL A;  1PLF A;  4I65 A;  4ZUJ A;  1CM9 A;  1ONL A;  1FYC A;  4ZAI A;  1D5M C;  1XYI A;  3GTO B;  1EY9 A;  1CT1 D;  4J6H A;  5EQ0 A;  4N9T A;  4KMU C;  4DU9 A;  3S14 B;  1HQM C;  3LWE A;  4IUV A;  1BR9 A;  2KVM A;  3A54 A;  4DK0 A;  2NVY B;  3NUC A;  1TQO A;  1YNN C;  3DXJ C;  4L63 B;  3P1H A;  3DEO A;  2R6G A;  5KGU A;  4GZY C;  2RA4 A;  1IKL A;  3PO3 B;  3C1F A;  5LHY 1;  1BCP C;  1I4R A;  1EU3 A;  2BDN A;  4FF3 A;  2F0D A;  2NVT B;  5T1I A;  3D6W A;  5K5P A;  3DWA A;  2NZ1 D;  4C3J B;  1NUC A;  1RHP A;  3ERO A;  5TSS A;  4IFD H;  4K5W A;  1PRT D;  2MJ8 A;  1DOL A;  3NQT A;  5FO7 B;  5C0X G;  3J81 E;  4ZKB B;  1PFN A;  3H0G B;  2F0N A;  3I70 A;  1DYQ A;  1TWF B;  3A56 A;  3I91 A;  4RHR A;  3VYT A;  5FLX E;  1JR0 D;  3BDC A;  3KBG A;  1E2Z A;  1LT4 D;  1Y8P B;  3J7Y W;  3HZX A;  1PTO C;  1PRT F;  2F0U A;  1S5F D;  3ND9 A;  1ESF A;  1WD1 A;  3S2H B;  1RDP D;  3JAM E;  2LY7 A;  4A3K B;  5CV9 A;  5C4Z A;  5COY A;  4G7O C;  4KKU A;  5CMD A;  2PO4 A;  1QWY A;  3TZD A;  2EJG C;  3K5N A;  2BE5 D;  2A6E D;  3IL8 A;  3TZU A;  2B2T C;  2KOL A;  2K28 A;  4ZYS A;  4OGQ C;  1TS4 A;  1LT5 D;  3R93 A;  2B2V A;  2ID0 A;  3HEJ A;  5JEA H;  1SYD A;  5EKK A;  4XDX A;  2NN6 H;  3QB3 A;  5JOB A;  3H91 A;  2PW5 A;  2B8F A;  2DNC A;  3R8B A;  3UI2 A;  1LV9 A;  5IGC A;  5M5W B;  5NUC A;  3TDQ A;  1ICW A;  2HUG A;  2FJ2 A;  1WTV A;  2EE1 A;  1JOQ A;  2ENB A;  4A3M B;  3VYU A;  2NTT A;  3OHX C;  5JJZ A;  4XTC S;  2Y0S B;  3IFT A;  1VF7 A;  4DAP A;  3MC0 B;  2EYH A;  1KDC A;  2OXP A;  1I4X A;  1U4R A;  4BS9 A;  3HOX B;  1D5X C;  2WAQ B;  3TME A;  3CHB D;  3BVG A;  3TP7 A;  4FYD A;  2F0F A;  4C2M B;  4ABN A;  2WB1 B;  2K01 A;  5LL6 S;  1WTO A;  2MHV A;  4TQU S;  3VR3 A;  2XIW A;  2K33 A;  4KI0 A;  1JOK A;  2KEE A;  4HCS A;  1B9M A;  5CV7 A;  3NTH A;  3WDN A;  5IGB A;  2RSO A;  1OXT A;  3K5M A;  4RHS A;  5C0X I;  1K83 B;  4C1N I;  1O7Z A;  1UNS A;  1FD7 D;  4JBW A;  1X3Q A;  4LJZ C;  5CR3 A;  1EFI D;  1SJE D;  3I4N B;  3HOV B;  3LWU A;  5C3W A;  4FO2 A;  3D4R A;  2WKC A;  4ID6 A;  4C56 C;  3R3O A;  1WTQ A;  3KF8 A;  2NYZ D;  1VCI A;  2PCF B;  4PMB A;  3NSW A;  2B2V C;  3BDL A;  5EKL A;  2PMZ B;  2D2C C;  5CV8 A;  4ULL A;  4A3B B;  3PIO 3;  3MWY W;  4K6D A;  5C3E B;  3FPU B;  1OXX K;  4IUN A;  4KY7 A;  3TP6 A;  3HOU B;  2KCN A;  3S1M B;  4BWG B;  1ILQ A;  5CBE E;  1HXY D;  1B1Z A;  2R61 A;  2IL8 A;  3GV6 A;  2K5Q A;  1D1I A;  3X3N A;  3DHQ A;  2K7V A;  1SYB A;  5C5M A;  3M3Y B;  5ELE A;  2JA5 B;  4TKO B;  4NDX A;  5IOD A;  4HSV A;  4P2C B;  4A3I B;  3RZD B;  2R92 B;  1QJO A;  3BYY B;  3SK6 A;  5C4J B;  1NR2 A;  1G2T A;  2JA7 B;  1BO0 A;  1EY8 A;  1TWC B;  2EY2 A;  1JQY D;  2LS0 1;  4BY7 B;  3S2D B;  1SE2 A;  5ELD A;  4PNY A;  1G29 1;  2AQ3 B;  1EY0 A;  3A8K E;  3BG3 A;  2Z1C A;  4QMG A;  1MSH A;  1F9R A;  1S5B D;  1TKW B;  3C1E A;  4F8M A;  2WKD A;  3NHH A;  4QB4 A;  1GHJ A;  4RGO S;  4FVM A;  2L55 A;  3S1N B;  4E6I A;  1K8O A;  1LTI D;  3P7J A;  1TS2 A;  4N9P A;  4K8I A;  2A73 B;  1G2S A;  2F0M A;  5FOB B;  3PUV A;  1LLR D;  3PUW A;  1F2L A;  1STN A;  1EIH A;  2R93 B;  3BZD B;  3CKI B;  1ENF A;  1JIC A;  3D4D A;  5JVG 3;  2PNR C;  1EL0 A;  1SMY C;  4IUT A;  1SDF A;  1D5Z C;  5K36 G;  4LK1 C;  5LL6 X;  2E2J B;  2G9D A;  2CHB D;  2PW7 A;  3D31 A;  2J7Z A;  3Q6S A;  5C4H A;  1STE A;  1YNJ C;  2ZXP A;  1CHP D;  1TY2 A;  3H94 A;  3RZO B;  1Y8N B;  2A6H C;  3I72 A;  1BF4 A;  2XN9 C;  3P20 A;  2JXM B;  4C3I B;  1NCV A;  4DN4 M;  1LTA D;  4FF4 A;  1H9K A;  2VXW A;  4LMQ D;  1EY4 A;  1XWE A;  5ELB A;  3OMC A;  4DK1 A;  4EGV A;  1F2Z A;  2JA6 B;  5FO9 B;  3VR6 A;  3TSS A;  4FP5 D;  2Q8R E;  3GV3 A;  1E2W A;  1SYG A;  5CGK A;  3KLS X;  1LTG D;  4A3G B;  1ZYR C;  5KYL A;  1O7L A;  4CHT B;  3KBX A;  2B39 A;  5IT9 L;  3VR5 A;  4K2K A;  5KYI A;  1SFO B;  1PYW D;  2AQ2 B;  3X3M A;  1XX8 A;  2CW0 C;  3OIP A;  4K14 A;  1HQR D;  1HUN A;  3W3A A;  4WFN 3;  3DEP A;  3MHB A;  1U4P A;  3OWE B;  3TBI B;  3ERQ A;  2N55 A;  1U9R A;  1VF5 C;  2VNU D;  3EA6 A;  1ESR A;  3S1R B;  2HDM A;  5I6W A;  3S15 B;  3GTM B;  4I7Z C;  3V2T A;  2VB2 X;  3K0Y A;  1ET9 A;  1EZ6 A;  2I46 A;  2KA7 A;  2NB0 A;  2EY5 A;  1XTC D;  3K58 A;  1JE4 A;  2E76 C;  1TWH B;  2SDF A;  1GUT A;  2NTS A;  4KY5 A;  4IUQ A;  3DUZ A;  4B08 A;  1Q8I A;  4OO1 I;  3NTK A;  3SE0 A;  1MSG A;  3A55 A;  1I4G A;  3V05 A;  2KHS A;  1STA A;  2B2Y C;  2A69 C;  5J22 A;  1EYD A;  5HUR A;  1L0X B;  3IFD A;  5BN5 A;  3M7N A;  3GO5 A;  2GA4 B;  1YNN D;  3PUZ A;  3WOE A;  3T56 B;  5IGG A;  2EYM A;  1Z6H A;  4HAE A;  3DWQ A;  1GUO A;  2YU9 B;  1BCP D;  1BCP B;  1B44 D;  2G9H D;  1HHV A;  4V0B A;  1E0B A;  5C0X H;  1A3T A;  3H3V C;  1WTW A;  3BDO A;  2O2L D;  5M3M B;  1U4M A;  1S5C D;  3IAY A;  1SYE A;  3L7Z C;  4F88 A;  2L11 A;  4HCE A;  4KKT A;  3J80 E;  1FNU A;  3CQZ B;  5IGE A;  1L0Y B;  1HFG A;  3WOF A;  2BDO A;  4NP5 A;  2Z4H A;  4XYO A;  1F9P A;  3S16 B;  1NAP A;  5E3F A;  1BCP F;  1W6K A;  1STH A;  4U67 3;  4Y7N B;  3Q24 A;  1PRT C;  1CTM A;  1EEI D;  1V1O A;  4KD3 A;  2AUJ D;  1EEF D;  1R4P B;  1SNQ A;  1HFN A;  4V19 0;  1PZK D;  1SNM A;  5KNC A;  4HN7 A;  1PTO D;  1PTO B;  4ME5 A;  4IFD G;  2F0P A;  1JB3 A;  1Z7T A;  1X3P A;  3OMG A;  1DM0 B;  2IX0 A;  4OIK A;  2B2W A;  2MPM A;  2FHT A;  3BS1 A;  1V1P B;  2KCC A;  4G7H C;  1ML0 D;  4PV1 C;  3HKZ B;  2WV6 D;  1HA5 A;  1ROD A;  2E2I B;  4ZKC B;  2L5T A;  1IW7 D;  3K5O A;  1PTO F;  1GHK A;  4HR7 B;  4RA8 A;  3TN2 A;  4RH6 A;  4TSS A;  2BE5 C;  2IT1 A;  2A6E C;  1DCZ A;  3S1Q B;  1D2B A;  1EZ8 A;  2RKS A;  2JE6 I;  4K2L A;  1C4Q A;  2BA1 A;  4KD4 A;  3S9W A;  3CU7 A;  4XQN A;  3MXG A;  2O4X A;  2QIL A;  2Z8L A;  1SAP A;  4A3J B;  3HP3 A;  2E2H B;  2RSN A;  5CV5 A;  3FRP B;  1J8I A;  1V43 A;  1O78 A;  5KIX A;  2H4O A;  2M00 A;  4XQQ A;  1NR4 A;  5DAU A;  3Q22 A;  3L3O C;  3FVQ A;  4KN4 C;  1F9Q A;  4DNT B;  1W6J A;  1CQV A;  1U4L A;  4XXE A;  2A68 D;  4DFA A;  1SNP A;  3D6C A;  4XT1 B;  3C3L A;  3HG9 A;  1SBB B;  1SYF A;  2WII B;  4RWS C;  5BN4 A;  2IWH A;  3R2T A;  2EDG A;  3QG1 A;  1H9S B;  1DZ1 A;  3I4M B;  5J1Z A;  2F0G A;  2Q8I B;  4DXG A;  4L8J A;  1PTO H;  2F0S A;  2F0I A;  3OW7 A;  4OIJ A;  5I6Y A;  1PMR A;  2EYP A;  1FNW A;  2ZT9 C;  2LMC B;  5C6A A;  2F0E A;  4RGM A;  1Q1E A;  3HRZ C;  1I6H B;  1DOK A;  2F0W A;  3FEW X;  1JC7 A;  5JVH 3;  1LTS D;  1LAB A;  3A7A B;  1MI2 A;  4KHZ A;  4MIU A;  1DON A;  3SEB A;  1OO9 B;  1H9R A;  3DMU A;  3J81 L;  3VR2 A;  2EJM A;  4IUP A;  1C48 A;  3W2D A;  3PV0 A;  1CI3 M;  4RAU C;  4F7X A;  1GJX A;  1TWA B;  3MFY A;  4IFD I;  4S3S A;  2NWG A;  1JOO A;  4MHE A;  4A3E B;  1EYC A;  1LT6 D;  2FMM A;  2ICE C;  4K6L A;  1ENA A;  4ZK9 B;  4QUF A;  1QOH A;  1HRJ A;  4RCO A;  4ZUI A;  1II3 A;  1SJH D;  1M8A A;  2H1E A;  1IYV A;  4C3H B;  2M9V A;  1WTX A;  2C9O A;  2JYO A;  3DM1 A;  4QUC A;  4X3K A;  1TS5 A;  4ODG A;  4J1M A;  2SNS A;  4YIJ A;  1OXV A;  3OPO A;  4KK7 A;  2J0T D;  4QF4 A;  2KJX A;  1RKN A;  5C3X A;  2JSO A;  4R8I A;  1D6E C;  5IT9 E;  1KAA A;  5D65 A;  2DY7 A;  5EPK A;  5C44 B;  5I9O A;  1G6Z A;  4FXD A;  1IYU A;  1BDO A;  3LX0 A;  3MXU A;  1PDQ A;  3K57 A;  3HOZ B;  3OIQ A;  1AZP A;  1B2T A;  4X3S A;  1CK1 A;  3VR4 A;  4IUU A;  4DA2 A;  2F0K A;  2B2U A;  2C5C A;  1DD2 A;  2AUK A;  3I90 A;  5A2Q E;  2EYO A;  4CJ2 C;  4HSP A;  1BUV T;  2F3V A;  3TP5 A;  3HOY B;  1TT2 A;  1IKM A;  1CFM A;  1F2Y A;  2HDL A;  5ELC A;  2XRQ D;  2OT2 A;  5J39 A;  2LKV A;  3QJY A;  4KV6 A;  3NTI A;  5K36 H;  4OO1 G;  1O80 A;  5T1G A;  4CKB A;  4CBV A;  1HA6 A;  2KQ3 A;  2L1B A;  3I8Z A;  4QIW B;  3GQB A;  3OWF A;  1EOT A;  1I4H A;  2K05 A;  5ELF A;  2EY1 A;  1SND A;  5ISR A;  3ITP A;  1AP0 A;  4HTH A;  4CGY B;  3QOJ A;  2SEB D;  5KND A;  4DNR B;  5C0X J;  3SK8 A;  1T5E A;  1KNE A;  3GTJ B;  2JA8 B;  3D8G A;  1ZKO A;  1KTK A;  2O5J C;  2QF7 A;  1GXD C;  1S5E D;  4PMC A;  2TSS A;  4H0L C;  1M4V A;  2XSC A;  1Y69 U;  1EU4 A;  5D3I B;  1WTR A;  4RFB A;  2FIN B;  5EGT A;  1Q12 A;  5F2D A;  1S5D D;  3AB9 A;  4EQN A;  2I07 B;  4C1N K;  3SK5 A;  3FDT A;  1STG A;  2V4D A;  4IN3 A;  1WVL A;  3NBH A;  4ZLT F;  1MBY A;  1WTP A;  3KLS A;  3C2P A;  3QWN A;  2B8G A;  2F0H A;  2HCC A;  4UAI A;  1T5X D;  2MGS A;  4HMJ A;  2F1M A;  2AWO A;  3LNN A;  5KRU A;  2CQA A;  2XNA C;  1EIG A;  2X69 A;  2R3Z A;  2RQX A;  1RJT A;  3H6M A;  1HTP A;  2K03 A;  3GTQ B;  4WJW A;  2RDF A;  1I6V C;  3GTP B;  3ONA B;  5COR A;  3TP8 A;  1Y1W B;  1LAC A;  2B2U C;  2EOT A;  1KLU D;  3HS0 C;  5HGT A;  1XXG A;  3QO2 A;  2IX1 A;  1Z47 A;  3MXN A;  2F0V A;  4KN7 C;  3MAQ A;  3PUX A;  5EPJ A;  1UEA B;  1DXM A;  3P75 A;  1AN8 A;  3NE5 B;  2EYF A;  5E4X A;  1EY6 A;  1A3V A;  1TS3 A;  4G7Z C;  3MZ5 A;  1VDZ A;  1EWC A;  4X3U A;  1KDA A;  3MFG A;  1GUG A;  5EPL A;  4FNF A;  1LTT D;  4AYB B;  1JCK B;  1RD9 D;  2K5D A;  4Q5V A;  1HPC A;  4K8J A;  1D1K A;  2A69 D;  4KTA A;  1TWG B;  4H7B A;  4J8Q A;  3G7L A;  1LT3 D;  3O13 A;  3NBI A;  4XQJ A;  2E74 C;  1A2T A;  2ICI A;  4WRD A;  5AFW A;  3NWS A;  2F0Q A;  4BA2 I;  1QIL A;  4ZRZ A;  4TRD A;  2EYL A;  3T51 B;  1LTB D;  1SE3 A;  3J7A V;  1B50 A;  4C3I G;  5EKI A;  1EY7 A;  2F4I A;  5CYU A;  1AW7 A;  3GTL B;  1TR5 A;  4M8A A;  2K6A A;  4IUR A;  2F3W A;  2F0T A;  4DGZ A;  2Z4I A;  2QDB A;  1G91 A;  1CZW A;  3T13 A;  1SE4 A;  2EXZ A;  4FF2 A;  1PZJ D;  2L4N A;  2KUM A;  3K6O A;  5CC4 A;  1DOM A;  1I4Q A;  2PPB C;  3MA2 B;  1H9S A;  1SSO A;  4G4K A;  4L6T B;  1PRT B;  5C5L A;  1CQF A;  5E1F A;  1JWU D;  2XRS D;  2IPK D;  2E75 C;  5D14 A;  3GD7 A;  4XT3 B;  1B3A A;  2IW3 A;  4DAV A;  1AZQ A;  2RVL A;  4CKE A;  4U68 A;  4R8N A;  3KK7 A;  1UAP A;  1RF2 D;  3AMU A;  4Z9C B;  5JPN C;  1FR3 A;  2K5W A;  1BOS A;  2RBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...