5JVG3

The large ribosomal subunit from deinococcus radiodurans in complex with avilamycin
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
59
structure length
59
Chain Sequence
b'THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
molecule tags Ribosome
total genus 3
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jvg300
3PIP3 3PIO3 4WFN3 5DM73 4U673 5JVH3 5DM63 5JVG3
chains in the Genus database with same CATH superfamily
2D0PA 1H9KA 2JEBI 1IYUA 4ZK9B 2B2VA 2D9UA 2I07B 5CV9A 2WINB 2K05A 4HJ7A 1YNNC 4LF7Q 1Q8IA 4JI3Q 4KKUA 1KLGD 1WOCA 4DUZL 4KJNA 2WB1E 1WTXA 3NWSA 2E2DC 1BCPD 4JCVE 3BZCA 2AQ2B 2L0CA 3L2PA 2RA4A 1HR0W 3QO2A 3KJOA 4LAAA 1ESRA 5I2YA 2SDFA 3PUWA 1HR0L 1O80A 1EU3A 2CWPA 1CKNB 4G4KA 5D14A 4OX9L 1NAPA 3W3AA 4BY7H 5FLXL 3NSWA 1OTCA 3H3VI 2WB1G 4FNFA 4L6TB 4XQNA 1WTHA 1AP0A 4OEMB 3GTLB 3BZKA 3HOVB 2NN6H 2KEEA 1CK1A 4JI5Q 1HFNA 3CAMA 1WTRA 3H6MA 1HTPA 1Y1WH 3C3LA 4JBJA 1BF4A 2WKCA 3K6OA 1ICFB 4HJ5A 2VS1A 4ZAIA 4IUQA 4P71A 2HHHL 1W6JA 4BXXH 2E2IB 1GD7A 2LS01 3V96A 1CKOA 3W1GA 1VQHA 4IQZA 2A5HA 1PH8A 4IUUA 1PYSB 1RL2A 5A2QE 1QNUA 3MA2B 1NNXA 1YBYA 5COYA 3PUVA 1Q3LA 2R3ZA 3KF6B 1RTOA 2ES2A 4NB3A 2DNEA 5F2DA 1EEID 2ASBA 5CV5A 1Y1VB 2NZHA 2WFWA 2PNRC 1UNSA 2KCMA 1I4QA 1KDAA 2VXWA 3DEOA 2C5CA 1I94L 4QUCA 5C4ZA 4X62Q 5IYCH 4FXDA 4IPDA 1A2UA 4GNXC 4X3UA 1E2VA 4Y52H 1CHQD 2PQEA 1CT1D 3LWEA 1Q90A 3GD7A 1P16A 3E9IA 3NP8A 2E2JB 3PO2B 1UE6A 4I7AA 2EIFA 3EN2A 3NE5B 3J80L 3I4MB 4JV5Q 4AQYQ 4K8JA 3KJPA 3E0EA 2RBMA 4WJ3M 3OWFA 2MGSA 3JC66 1JJCB 4NDXA 1RD9D 1LTBD 1SYCA 4B3MQ 1TQOA 5I6WA 4N8FA 4A3KG 3R2IA 3AB9A 5BN5A 3HOYG 2JA5H 3PO3H 2EYHA 2A6EC 4X3KA 3SHLA 3A8JE 1V1PA 5IGCA 1EWCA 1LABA 4YCUA 1CSPA 1SMYD 3VR5A 3GTOH 3NTHA 1Q46A 2QA4A 1LT4D 2EYPA 1STBA 4G57A 2Q2HA 4LF4Q 1XXGA 2LXJA 1D5XC 5C5LA 4K5VA 4IUNA 4OGQC 4LF5Q 3CF5A 1QE6A 1EY0A 4R4CA 3EA6A 2J4XA 5I6YA 2UU9Q 3CMEA 3HKZE 5H1SE 1I50H 1XX8A 1EL0A 4HIMA 3VYTA 2X6LA 4DR3Q 1BBXC 1JOOA 4JI2L 2L5TA 5CBEE 1F2LA 2OCEA 1SFOH 3AU7A 1ILPA 4DF7A 4B08A 4K6LA 5LHY1 1WFQA 2FMMA 4A3CG 4ZKCB 3TP6A 2ZXOA 4I65A 2O5IC 2R7ZH 4KHZA 3TZUA 1IZ6A 3BJUA 4FDBA 4B3TQ 1XNRL 2A68D 4HIDA 1SE8A 1SLJA 3BVGA 1PLFA 4K6DA 4YCVA 1FNUA 5ELBA 4NPSA 4CJ1B 1KC8C 1E7ZA 4KD3A 2OQ0A 1J5EQ 4K5WA 2QEJC 3T1YL 1PFSA 1TIID 1WCMB 2CCZA 3SXHA 3C1EA 3VYUA 3M3YB 1ENFA 3HOVG 3T51B 4EQNA 2IT1A 2M9VA 2DUDA 2IY5B 1NUCA 3EFXD 4MN3A 1AE3A 3KUPA 3DLLA 2L12A 2A69C 3BYYB 1M90C 1E3PA 1EOVA 2VB3X 4H7BA 2F0GA 5KNCA 3CHBD 3NQIA 4O1NA 3M7NA 1PHJA 4C3JH 1STHA 3A5UA 3ULLA 1T5EA 3J81E 4XT3B 5ELEA 1N36L 1BCPF 5C4XH 3K8AA 4C3IB 4JBWA 3PIOA 2R93B 3MFYA 3RR5A 3ULPA 4CGYB 1Y69U 2QDBA 2NVYB 4UP7A 2MJ8A 4BY1H 2E5LL 3K5OA 1A6XA 2NVTB 4RA8A 2E2HB 3M4YA 4RHSA 2P5ZX 1TWCH 3D4DA 1F9RA 5KIXA 1LT5D 5JOBA 1PH7A 1KAAA 1YNJC 2B3GA 2ENBA 1PTOC 1RODA 3MHBA 4B9XA 1EWIA 2B29A 3D6CA 4IPGA 2NN6G 2E75C 2X6GA 4A3GH 1SJED 2N55A 3PO2G 3MTSA 3OSOA 3S1RH 4A3FH 1FVIA 1GHJA 3IL8A 4A3BB 1STAA 1YEZA 1SMXA 1B9NA 2PI2E 3CC4A 3K0YA 1I4RA 3S2DB 1BNZA 4P72A 5CR3A 3GTJB 2QILA 1QZHA 1SYBA 2UUAQ 4ID6A 2BA1A 5JVG3 2KA7A 4C3HH 1FYCA 4DAVA 1L0YB 4JI0Q 2LXKA 5D3IB 5J3BA 3PV0A 4JPBW 1X65A 3F2UA 3HOZB 4OWWB 2VY3A 3M85A 1Y8OB 3WDNA 3I73A 4MNOA 1A15A 5IWAQ 1XMQQ 4OO1G 1I4XA 1BBWA 1EIFA 2KUMA 4ZUJA 3MEFA 1QUQB 1YHAA 4ZYSA 3R93A 2UXBQ 2BE5C 1K9MC 4NXML 1PYWD 1A8VA 2VW9A 2CH4A 5GAGC 4MZ9A 2KCTA 1CM9A 1LT6D 2F0VA 1X3PA 3VR6A 3H0GB 1G291 2SNSA 2F3VA 3CQZH 2B2UC 5C44H 5M3MH 1W2BA 1IKMA 1MI2A 3DXJC 4HEDA 2VB2X 3RN2A 3K7AB 3M4QA 4GKJQ 2R7DA 2XNAC 2NWGA 2IWHA 1B2TA 4GKKQ 1QVCA 1TS3A 1PXUA 1WTQA 1GHKA 1EY5A 5G3LD 4WJ4A 1WCMG 3SK8A 1AE2A 5IGBA 1PA6A 4FP5D 4L63B 3ERQA 1AH9A 1JT8A 1CI3M 3MXNA 4KHVA 2PI2A 5FOBB 5IGFA 5M5YB 3GV6A 3KBGA 1TWAH 1TVXA 1EOTA 1VQCA 4JI1L 3TBIB 2RCFA 3EJIA 2EY6A 2FHTA 3S1QB 2UUCQ 1CKMA 3HOWH 1VQ5A 2KCCA 1CQFA 3HP3A 1EY6A 2QKIC 4A3JG 3HEJA 3I56A 1EFWA 3DM3A 4JI8Q 4TVAB 4JI6Q 2B8GA 4XDXA 4LF4L 1T5XD 4OXPA 2K4KA 1DGSA 3M4OB 1E0BA 1WI5A 2NN6I 3LGJA 2XTIA 2F0IA 3S1NB 4LJZC 3BVMA 3KLSX 2CHBD 1PFMA 1O7LA 1PDQA 1YIJA 1WD1A 2NVXB 1PFBA 3G6EA 4C3IG 4XQJA 3QB3A 5LMNL 2R93G 2IHFA 3ERSX 2F0WA 1NTGA 3OW2A 4V190 3OWEB 3PMFA 2D0OA 1JB3A 4DR3L 4LK1C 1TWHB 1EWHA 3IFDA 3U50C 2JA7G 4QQBX 1B7YB 3VYSA 1TXYA 1SE4A 4HJ8A 4LUZA 4NP5A 2K7VA 3QJYA 1X3FA 3PUYA 1E1OA 2F0LA 1EYGA 1AW7A 4DV7Q 4ILWA 1TR5A 4LW1A 1HNZL 4AH6A 3CCLA 2B2TC 2O5JC 2I0QA 3GTMH 2BCOA 5JVH3 4YHHQ 5EPLA 2WB1B 3I2ZA 2PO4A 3OMCA 5JPNC 5C4JB 4DV0Q 1F2MA 1CA5A 2B2YC 2OTLA 2PMZE 4LWCA 4UDUC 2NBFA 1J5EL 4C2MB 3MZ5A 2F0SA 4Q0FA 2L55A 2EY5A 2XVSA 4DR4Q 2QGQA 4C3JG 4A3BG 1KABA 1KLUD 2LSSA 3CRLC 5EJWA 5T1IA 5IYDH 4KY6A 5ELDA 4F8MA 2A6HD 3RLFA 1B44D 1NMFA 3AMUA 4WORA 1QILA 1HFGA 5C4XG 1IBLQ 1UE7A 2N88A 3GTQH 4RAUC 1UAPA 2PZTA 5GADC 3X3MA 1GUNA 4QMGA 1NSNS 5EPJA 3VYRA 1EY9A 1PTOH 5IP7H 4Y7NB 1N34Q 4DV2Q 1AZPA 1VF5C 4QIWE 4ZLTF 5A2QL 1FNWA 1I4PA 2IX0A 3HOZG 3P75A 1T9HA 5DEHA 3M7GA 4R4TA 1V1PB 1GVPA 1NR4A 4HCEA 1XPOA 1HQRD 3GTGB 3OMGA 4DGZA 2F0JA 1BUVT 3KFUA 1YNND 4JVZA 4A3GG 3CC7A 1TWFH 1IW7C 3H91A 2ZM6L 1TY0A 3A74A 4KKSA 1GUSA 1PH3A 1ZEQX 5EBDA 3J81c 4P75A 3CCJA 5CORA 4ZCKA 3HKSA 4A3FG 2IHEA 3HOUG 4XXEA 4L5SA 2LFNA 1XTCD 1R4PB 4A3IH 2TSSA 1RJTA 2VL6A 2JA8H 4BBRH 1YJNA 4H13C 4A3DH 4ALPA 4JG2A 5DAUA 5EQ0A 2JA6H 1SSOA 2ZXRA 4A3KB 1RIPA 2ZTDA 2VQEQ 4R8NA 1V43A 2QDLA 2MNAA 4E6IA 5C3XA 1AZQA 4QJFA 1A2TA 3QOJA 5IGEA 3NUCA 2VZAA 3S9WA 1A62A 1KDBA 5FJ8G 1VQ4A 2WACA 4KY7A 2VQFQ 1GXDC 1SROA 5JEAJ 5JEAH 3BDOA 3SK6A 1X3EA 2RDGA 3J7AV 2JXMB 2DY7A 2ATWA 2OF1A 1SYEA 2B63H 3A55A 3PCOB 2A8VA 4EQOA 3PF4A 2ZJPA 1W3SA 3KLRA 4DAMA 3W1BA 4DV5Q 2MQHA 3K81C 2HCIA 3FKIB 3A7AB 5IWAL 1XMQL 1TWGB 4FYDA 5C0XJ 2FJ2A 4OWXB 3FEWX 1S5DD 2Z0SA 2D62A 1MSHA 2F0PA 4POFA 2A1AA 1MSGA 3NENA 2X69A 4PMCA 3G7LA 5CGKA 3E5SA 1DCZA 1Y8NB 2K5WA 2L15A 4GNXA 5JJKA 1ESFA 1STYA 2MP1A 1E24A 1XMOQ 1DOMA 1G2TA 4B9WA 2RKSA 3HKZB 2AWOA 5HY6A 1VQOA 1FR3A 1KDCA 4OIJA 3H09A 4P74A 5G3LF 3OW7A 3ZYYX 3CCSA 2H4OA 1PV4A 4R8IA 5IT9E 2UUBQ 4A3MB 2K03A 4LFBQ 4CKBA 5I4DA 1VQLA 5K36H 1HPCA 3Q8DA 3WOEA 1KD1C 3DUZA 2KECA 1HZAA 1PRTD 4RGOS 4X6AH 1Y1VH 4UPAA 1LTGD 5IY0A 2YTYA 1F2YA 1VQKA 3EIVA 3MAQA 3J7A5 1K83B 1X9NA 1ZKOA 2KVMA 4X66L 1SNQA 1BOSA 3DHQA 4TSSA 3CU7A 1WTVA 1EIYB 2CFMA 2A6ED 1H9SA 1S40A 4OWTB 2F4IA 2WKDA 2K5DA 5E1FA 3H3VC 1U0LA 4PMBA 2UUCL 4LF9Q 2Q8TA 2JP1A 1G51A 2HUGA 3FDTA 2MO0A 3RZDH 1GO3E 5AJ3Q 3OTOQ 1TY2A 1SR3A 2J7ZA 1HXYD 4JI8L 1TT2A 3Q22A 3J81L 3Q24A 3KK7A 1B8AA 5J1ZA 1SN8A 2JSOA 1YNXA 1VMPA 3DWPA 4DR7L 5JJZA 4POGA 1ENCA 2CH4W 2EYJA 3K7UC 2ZJRA 2KENA 4BY7B 4NXNQ 2YYZA 4HR7B 4DR6Q 4K0KQ 2EJFC 3TS2A 3NBHB 3ITPA 2OT2A 4KHPL 1PZID 1Y1WB 1Z7TA 3T16A 1D1IA 1CZGA 4LF6Q 3IRBA 1GUTA 2B8FA 3RUZA 1HZBA 1BCPC 2WV6D 1K28A 1GJXA 2PPBC 1M8AA 5IYDG 3OIPA 1HA6A 4YHHL 1QVFA 5I9PA 3EBEA 5ELFA 3IKJA 4IUPA 2F4VQ 3CRKC 4DKAC 4BS9A 1EYAA 1BQQT 2ZT9C 4GOPB 3I4OA 3S16B 4BBSH 2ZXPA 4DR4L 2QCPX 2VUMH 1NCVA 2NYZD 2L1BA 2KHSA 1JC7A 1QB5D 2F52A 4CDCC 5IP9H 3TMEA 3QR8A 1HNWL 1D5MC 2N3SA 1SEBD 1ILQA 4IPCA 1K8GA 3ND9A 1HA5A 3GTPH 1U9RA 3TSSA 1IXRA 5IYBH 3MXNB 2B2WC 2EXZA 3RNUA 4JW0A 3ND8A 3V05A 5HGTA 4IUVA 3SGIA 2PQAA 5KNDA 1WJJA 4DV1Q 1JWUD 1VQBA 1B70B 1II3A 5C3EH 3S14H 3FKIG 3K5LA 1B1ZA 4NMZA 1F9QA 3RMHA 2OXPA 1XNQL 2FMCA 4LFCQ 4DNRB 2Z1CA 2B39A 1STEA 1IBMQ 4ZUIA 3K80C 4PG3A 5TSSA 4V0BA 2JA8G 2K04A 4BBRG 2ICIA 1V1OA 2L4NA 4X65L 2OWOA 1D7QA 1R4QB 1MJCA 4U673 1QCBD 4M1UB 3HKZG 2KEDA 2JA5B 3PO3B 1AN8A 4A3LG 1CTMA 4KMUC 4EGVA 3CMAA 4JI4L 4RKLA 4JYAL 1SYGA 2Q8RE 1OXVA 1LO5D 1SNPA 2EDGA 3GTOB 3MFGA 4A3MG 1DONA 4FF2A 2M2LA 2NUCA 2A73B 3I4NH 4PMWA 4ABNA 5KGUA 4O2DA 4O0AA 4R4OA 4JI7Q 1N32L 2VQEL 1MJEA 4DR1Q 1ZYRC 3S15H 4DV4Q 2R92H 3C1FA 2QF7A 1JR0D 1VCIA 2K50A 3JAMi 1QZGA 1I50B 3OIQA 5M5WH 1ICWA 4HAEA 4A3JB 2NZOA 2VQFL 2XSCA 1BKBA 2RHSB 1R9TH 3URYA 1SAPA 1BR9A 1EQRA 4C56C 5LMUL 1YI2A 2RVLA 1S5CD 1SFOB 1VQGA 2EOTA 2EE1A 3PUXA 1CFMA 2F0HA 1LYLA 3D0FA 2R7ZB 4TKOB 4JC0A 2K14A 1I4GA 2ZJQA 2HDLA 1RDPD 5M3FH 2NVQB 1L1OA 4I7ZC 4LF7L 4RCOA 4JI3L 2Z6KA 1YHBA 1EQTA 1PZKD 4QGUA 2JA7B 4R1JA 4BY7G 5NUCA 1FGBD 2TMPA 3K0XA 3TP7A 4IFDH 4IFDJ 2AWNA 2UXCQ 2B2UA 2HIXA 1LV9A 3AFPA 2AHOB 3I8ZA 2JE6I 1C48A 1H9JA 1XMOL 2XN9C 1E1TA 1S3OA 1SBBB 3FRPB 3NELA 1F2ZA 3H3VH 4G7ZC 1BDOA 1X55A 1Y1WG 1PRTF 1G2SA 1ET6A 4HMJA 4PV1C 4DA2A 1LTID 1C4QA 4ZRZA 1RTNA 3BU2A 3HG9A 3O13A 2SOBA 3PIO3 3HOXH 4BXXG 2A68C 3L9AX 4C3JB 2DJGC 4A3EH 2ID0A 5J39A 3RN5A 4JI5L 2FINB 3I72A 4LF8Q 1JJ2A 5JAVA 4YY3Q 2AMCB 5IOCA 2ALYB 3Q23A 5GAHC 4HJAA 2Q2UA 5C4XB 2Q8IB 3P20A 5IT9c 3CD6A 1YHQA 4JOIA 1D2BA 2PMZB 4ME3A 1K3BC 2QW7A 4BY1B 1OO9B 3D3RA 5EKLA 5AJ3L 3OHXC 1FJGQ 3NBHA 4DK6C 1TWCB 2SNMA 1NMGA 2JA9A 5IYCG 3T56B 4A93H 1Q81C 1SRUA 2EXDA 3PIPA 3J7YW 3Q0AA 1J9OA 4A3GB 1KXLA 3TS0A 2YU9H 1STNA 4X3SA 4OONA 1EY8A 2Z4IA 3T53B 4X62L 3GTKB 3FMCA 4QIWB 3S1RB 4A3FB 3HOUB 1UEBA 1KQSA 4A4IA 1M1KC 4GOPA 2Z8LA 4K14A 4X64Q 2XIWA 4DUZQ 1PFNA 2B2TA 4IJLA 1B3AA 2K52A 4QF4A 3TQYA 1SJHD 2JA5G 3TREA 3ONAB 2VUMG 3PO3G 4YWMA 5LL6S 1PH1A 4L5QA 2B2YA 1I3QH 3L7ZC 4C3HB 4JV5L 4AQYL 4GNXB 1HR0Q 4B3ML 3CCEA 2F4VL 3SK5A 5M9OA 4OX9Q 4J6HA 1K8AC 2SEBD 5JJIA 2A74C 3A5ZB 5CV8A 5DNFA 3T1HQ 5IYBG 2AUJD 3GQBA 1VQ7A 2WAQE 1D8LA 4KI0A 1DOKA 1PRTB 1BBUA 3KOJA 4GLVB 2LKVA 5C3EG 2AQ3B 3F2BA 1UWVA 1Q86C 3A56A 3D8GA 4EVOA 3G48A 4M8AA 3S24A 4DV6Q 1NE3A 1LLRD 3LX0A 3BDCA 4FF4A 1E2WA 5FKAC 2XRQD 3R2TA 3KLWA 2Z6BA 1VQ6A 2H5XA 4CJ2C 4LF5L 3MXPA 2K5HA 3CQZB 2JYOA 5C44B 5M3MB 3G6JB 3RZOH 4APVA 3S17H 2UU9L 2E74C 4DV1L 1H9SB 1HQMC 1JE4A 2R7ZG 4J15A 1CQVA 3W2DA 3NTKA 2LY7A 3FPUB 2BDOA 4WRDA 3AFQA 4LFCL 1LUZA 3I7FA 1EFID 1IL2A 1VQPA 4ODGA 4FF3A 3D6WA 4WFN3 2OQKA 1ENAA 2K28A 1VDZA 3U4ZA 3P1HA 4ULLA 1CUKA 1JWSD 2Y0SE 3EROA 5FK9C 2F0OA 5M5XH 4B3SQ 3ER0A 4B3TL 1KNAA 2GVAA 3UDFA 4LUVA 1IHZA 1Z47A 4KKTA 2R92G 1RF2D 5IT9L 2GN5A 3HOWB 3M9BA 1SNMA 3AYHB 3S1MH 1A3VA 2XWJB 1X6OA 1NR2A 3TEHB 4DK3C 3F2CA 2E76C 4QUFA 2DGYA 5ELCA 1JWMD 1ET9A 4AIMA 4DR1L 1K0RA 1HNXQ 3D4WA 3Q6SA 4KLKA 3TP5A 3D4RA 3NBIA 2ZTCA 3K57A 2F0DA 1FL0A 3CCUA 3CKIB 4CDEC 4PZ7A 1S5ED 5M3FG 3QWNA 5GAEC 4ZQ3A 1MHWC 1V9PA 4BY1G 3E3XA 3A8KE 1C9OA 2WP8J 1EY7A 4UP9A 3STBD 4C1NK 4GLXA 2G5DA 4ME5A 1SYFA 4HTHA 1X54A 4RHRA 2KCNA 3F8TA 1G6PA 4PZ6A 2K01A 4NW2A 5D3DA 3GTMB 3HOYH 5T1GA 1V1QA 1S4ZA 1YJWA 1QOHA 2HCCA 3BG3A 1JMCA 1Q1EA 1B53A 4RMFA 4LFAQ 4F87A 2BOSA 2CW0C 5FLMH 3NHHA 1Q8KA 2PQAB 2ZTEA 3HOXG 2KJXA 2EPBA 2G9DA 2CWAA 4RFBA 1EQVA 3JAME 2MFIA 5KYLA 1AEXA 1FGUA 2KHJA 1PVOA 4GZYC 5EKIA 3ICEA 1JE5A 3B6YA 4JI2Q 4AYBE 2PZWA 2DY8A 1I6HH 2PW5A 3S2HH 1F77A 1KIXA 1VQAA 1S5FD 3NTIA 3AEVA 4LMQD 4DAYB 1PYBA 3GTQB 4TQUS 5L37A 4C3HG 1XPRA 3IFTA 5IE8A 1PTOB 1XNRQ 2UXDQ 1F9PA 1TKWB 4DR2Q 3R3OA 4RKBA 2I46A 4LUOA 3SEBA 2F0QA 4HMIA 2L9HA 4L8JA 4LF8L 2RHQB 2J0TD 2MUYA 3T1YQ 4YY3L 3C2PA 3GO5A 5DLQE 3CXCA 1S5BD 1M4VA 5HGQA 5CYUA 1HZ9A 4YIJA 3OPOA 2D2CC 4XQQA 4A3CH 2K1BA 1PH5A 2UUAL 3CCVA 1WVLA 2DJFC 4JI0L 4GN3B 1TWFB 1K8OA 3UDIA 3I3CA 2A6HC 1GUOA 3H94A 2K5NA 2F3WA 3J80i 5C0XH 2R7FA 5C44G 5M3MG 1AFPA 3GTLH 3HOVH 4HSPA 3WWVA 2UXBL 3MXGA 4A3IB 4IOCA 1KL9A 2JA8B 4BBRB 3TN2A 2R6GA 3E6ZX 3K5NA 4A3DB 3KLSA 5CMDA 1N36Q 2JA6B 1LTTD 2Q2TA 2BA0A 3VA7A 3J7AF 3BZDB 4OELB 3ZJYC 2E2IH 2E5LQ 4X64L 3BDLA 4FVMA 1L1OB 2MHVA 3UI2A 4IURA 4GKJL 3HRZC 1G8ZD 5KEEA 2DNCA 3J7ZC 3VR4A 1GM5A 1LM0A 4CHTB 2HIVA 4GKKL 3IAYA 3HOWG 4A76A 2F1MA 2MPMA 2I5MX 3G4SA 3UDGA 1SNOA 4IOAA 2B63B 4IFDI 2L11A 4KK7A 1S72A 1U4LA 1JOKA 1XYIA 2HQLA 3AQQA 1VQ8A 3E0JA 2R61A 4P2CB 1VQEA 1D1KA 2AQ1B 3T1HL 5BR8Q 5KYIA 3TRZA 1V8QA 1YJ9A 1DJRD 3K5MA 4DXGA 5EPKA 2N49A 1G91A 4HIKA 1IKLA 4DV6L 2B2WA 3CW2C 1L2FA 2E2JH 4JI6L 4K2LA 3PO2H 2GA4B 2XWBB 3SR1A 2H1EA 3HFZB 3I70A 2V1CC 4XT1B 3PF5A 1HCZA 2BH8A 3I4MH 1A0IA 3F1ZA 1Z6HA 3MEHA 3P7JA 4DN4M 1VQNA 4DV3Q 4DK1A 1VQJA 3I91A 1UE1A 3TP8A 1XPUA 1O78A 2C35B 1MD2D 4EQPA 3A8IE 3DM1A 5FO9B 3KF8A 4MTNA 5HURA 3S16H 4RGMA 4GLAC 1DD2A 1PMRA 1TU2B 1Y8PB 1C7YA 1MKHA 3HS0C 2RF4A 2WIIB 4IPHA 2AKWB 5I9OA 3VR2A 2B2VC 2HD3A 2EY2A 3I4LA 4OHJA 1IBKQ 4NXMQ 4UP8A 4S3SA 1HUNA 1LACA 4DUYQ 2DN8A 2Q2IA 2NTSA 4DV7L 1A3TA 3DEPA 1VQMA 1EEFD 3CPFA 4B3SL 1WYDA 4GN4B 4OO1H 2BDNA 3QIAA 1VQDA 3VR3A 1I6VC 2PYKA 5CC4A 3QG1A 4DV0L 3RZDB 1SNCA 3MXUA 4IUTA 2N8NA 2PNHA 4IJHA 2GVBA 5IP7G 2FFKB 1N33Q 4EQ5A 2VNUD 1DYQA 3BYTB 1RCVD 1ZYRD 1J8IA 1X32A 1HUMA 1HNXL 1Q12A 2A69D 1PRTC 1U4PA 1O7YA 2K32A 3NQTA 4GN5A 3NEMA 4MTKA 1MBYA 2JN4A 3EQLC 3T13A 3T4AC 1X3QA 1CZWA 1IBLL 5E4XA 4HIOA 4PQXA 4JI1Q 3EVQA 1N34L 2I5HA 4DV2L 4CDFC 1ASYA 3TDQA 1DZ1A 3N6RA 2C9OA 3RD4A 1WCMH 1K8MA 5FLMG 2E8GA 2NB0A 4RGNA 4G7HC 1CA6A 3M3YH 4X3TA 1EZ6A 3U9SA 4DAYA 4A3IG 1GKHA 3MWYW 5DM73 1NY4A 1HHVA 4H02A 1EQQA 4A3DG 2A19A 2RSNA 1PZJD 5KNBA 2JA6G 3U58A 1MGSA 5LMNQ 4J8QA 2JQOA 1YNJD 4N9PA 1KRSA 1K73C 4LFAL 3C46A 3TZDA 1PTOD 4FXGC 4CDDC 4A3JH 4BBSB 4K5XA 2VUMB 1STGA 4DNTB 1B9MA 1QG7A 3K59A 5IGDA 1EUJA 1IL8A 4KD4A 2CQAA 1E22A 3NWTA 1YZ6A 4DAPA 1OXSC 2EYLA 3CCRA 2MO1A 3KDFA 4C3IH 5JEAG 2K33A 3A7LA 1LTAD 2YTVA 3RLOA 3GTPB 1HNZQ 2R93H 2PCFB 3A54A 2UXDL 4RH6A 5FLXE 2B63G 3W5OA 4DR2L 2NVQH 1J6QA 3JAMc 4BA2I 1SDFA 2NVYH 1FD7D 2NVTH 2XGTA 1C0AA 2JA7H 2E2HH 5D65A 5C3EB 3S14B 5IODA 4H0LC 5C0XG 1U5KA 1BO0A 4JBKA 1EYDA 1N8RC 1HH2P 2O2LD 4DFAA 4CBVA 1HTLD 4BA1I 3GP7A 2KQ3A 2CQOA 4O42A 2F0NA 1ASZA 1SMYC 1ONLA 4ZKBB 5EGTA 4DK0A 4EX5A 1A63A 2RSOA 1SE2A 2WAQB 4DV5L 1K3RA 4IN3A 5CV4A 1VMCA 2FXQA 2NZ1D 2BE5D 3SK4A 4A3BH 2D5DA 1UUPA 2KHIA 4J1MA 1HRJA 4TRDA 1SNDA 3S2DH 1EY4A 1VS0A 3I4NB 3U4VA 3GTJH 1SYDA 3MVVA 4B3RQ 5K36G 4YWKA 4KJOA 5BN4A 5E3FA 1CKNA 1XWEA 2YV5A 3BS1A 1HZCA 5EBCA 4G7OC 2RQXA 1Y1VG 4RG1A 3S15B 3DWQA 2ZM6Q 4N9TA 2R92B 1U4MA 3KYHC 1KTKA 5M5WB 2F3IA 3HOZH 3H15A 4R4IA 4OL7A 1Q7YC 1NJIC 1D5ZC 2UUBL 1U4RA 4IZ8A 3CC2A 4LFBL 4DPGA 3A0JA 1NBWA 1SXTA 1R9TB 3J80E 2IPKD 2Y0SB 3L3OC 2RDHA 2EJMA 1DM0B 3PSIA 1Z9FA 3I55A 1L0XB 1P8LA 1EIGA 3H0GH 3I4MG 2EQSA 3FPPA 4L5TA 3V2TA 3GTKH 5M3FB 5BR8L 4DR5Q 3HOUH 4K8IA 5E4WC 4LF9L 3NXWA 5LL6X 1WD0A 1I4HA 1B4OA 4WJWA 3OTOL 3CPWA 3K7AH 3KF6A 4NKLA 3I90A 4C1NI 2K75A 4PNYA 2YTXA 4IO9A 1ZXTA 1MIUA 4DV3L 1X3GA 2EZVA 4KTAA 2IL8A 2IX1A 3DWAA 4DNIA 4YCWA 1I5FA 5M5YH 1KAWA 5EKKA 1XJVA 5FJ8H 4NXNL 4DR6L 4K0KL 3CP0A 3E9HA 1UEAB 3N52A 1DXMA 3HOXB 1LTSD 2F0MA 1H95A 3S1QH 5DM63 4BWGB 4A3EB 2Z9HA 1IBKL 3UDXA 1XTDA 4H44C 1OXXK 4LF6L 1L1OC 3JAML 5C0XI 4BBSG 3D31A 3L0OA 2Z6KC 5CV7A 2F03A 4DUYL 2QEXA 1H9RA 5IP9G 4KN4C 3M4OH 3PIP3 4HJ9A 3S1NH 4QB4A 2K6AA 4OIKA 1JB7A 2F0TA 2NVXH 3KBXA 2M00A 1N9WA 3CCMA 4RWSC 1PH2A 1BCPB 5ELOA 4AYBB 1SE3A 4A93B 4UHVA 1L0WA 2G9HD 1N33L 4Z9CB 3GV3A 4KV6A 1Q82C 1TWHH 1GUWA 4P73A 1EU4A 4QCLA 1CSQA 4XYOA 2IW3A 3SE0A 1PH9A 5C3WA 5CV6A 2YU9B 3SDZA 4XTCS 4GS3A 1OXUA 1G6ZA 4X66Q 1HJPA 2BH2A 2HHHQ 3HGBA 3PUZA 3SVMA 3MC0B 5C4JH 4CJ0B 4JOIC 2WAQG 4FXKC 1RHPA 4C2MH 4MIUA 1IYVA 3NPPA 3GDEA 1EIHA 1Y14B 4CKEA 1JORA 1BXTA 1PTOF 3BVZA 1I3QB 4R9WA 5J22A 1IBML 1IW7D 5K5PA 1EZ8A 5C6AA 4HCSA 5BN3A 2EJGC 5LMNW 1OXTA 4KN7C 4DR7Q 3M4PA 3FP9A 3I4NG 2ICEC 2JEAI 4DXFA 2CW0D 3RLNA 1B50A 1I94Q 1TWAB 4PZ8A 1O7ZA 4Y7NH 1UE5A 1VQ9A 1A3UA 2EY1A 5GROA 5GQOA 3KF8B 3LNNA 5ISRA 4LNQA 4KHPQ 2EYFA 3UE1A 2CKZB 1JJGA 1E2ZA 2JK8A 3HZXA 2N78A 1KRTA 5FO8B 3G71A 2NTTA 4HN7A 3J81j 3CCQA 4GOPC 2KBNA 2AUKA 3X3NA 1JCKB 3GTGH 4JI7L 4Q5VA 1BVSA 5JJLA 3NK9A 2Y0SG 3WOFA 4N8X1 4U68A 4DV4L 3RZOB 3S17B 1LTRD 1B3QA 1C8CA 1K0SA 3ULJA 4DU9A 1LT3D 4L5RC 4XYQA 2OEOA 4OO1I 2F0FA 4IALA 1EYCA 1DOLA 1FNVA 1TS4A 2CVRA 2I5LX 4KY5A 1CHPD 1O7IA 2IX3A 2OTJA 3FHWA 1IYJB 2RDFA 2XRSD 1HNWQ 4CKCA 5FLXc 4FF1A 1KHIA 1TS2A 4IFDG 1KNEA 2EVBA 2V4DA 3PQIA 5IIFA 3FVQA 4A3KH 1WTWA 5M5XB 1QJOA 3VA5A 1GUGA 1RKNA 4R4QA 4HSVA 1JQYD 2RCNA 1QVGA 1LTLA 1VQIA 2PW7A 2K5QA 3QOLA 3R8BA 1PH4A 1YITA 5AFWA 2EYOA 4QL5A 2HDMA 1VF7A 3S1MB 5IGGA 2UXCL 4YWLA 1Q1BA 1XNQQ 4B3RL 1JOQA 1GOZA 4A3EG 4RCNA 1JICA 1H9MA 3OYYA 3VDYA 4X65Q 4UY8C 1QNKA 1TS5A 2HT1A 5FO7B 1W6KA 2JJQA 3H0GG 3UE0A 1PH6A 3J81i 4JBMA 3FKIH 1TWGH 3F2DA 5C4HA 2KOLA 2LMCB 5CBAE 1QWYA 3K58A 4JI4Q 4JYAQ 2Z4HA 2K5VA 2F0KA 1VQFA 1F9SA 4AYBG 2F0UA 4A93G 5KRUA 3LWUA 3DMUA 5C5MA 4UAIA 1X56A 5E7NA 1WTOA 1N32Q 2EYMA 4QY7A 3HOYB 4FO2A 2IJ0A 4DR5L 1YVCA 3KDFB 4A3LH 2PZUA 2HQEA 3J80c 2O4XA 4MHEA 1FJGL 4K2KA 1QUQA 4A3MH 5A35A 1ML0D 3U9OA 2F0EA 4A75A 4JK1C 1I6HB 4RGTA 5LMUQ 5ELNA 4F7XA 5EAYA 4XIGS 3S2HB 1D6EC 1WTPA 5JPMC 1K83H 3OOCA 4F88A 3STBC 5I2XA 3PGZA
chains in the Genus database with same CATH topology
1H9KA 2JEBI 1IYUA 4ZK9B 2B2VA 2D9UA 2I07B 5CV9A 2WINB 2K05A 1YNNC 1Q8IA 4KKUA 1KLGD 4KJNA 1WTXA 3NWSA 2E2DC 1BCPD 2AQ2B 2L0CA 2RA4A 3QO2A 4LAAA 1ESRA 5I2YA 2SDFA 3PUWA 1O80A 1EU3A 4G4KA 5D14A 1NAPA 3W3AA 5FLXL 3NSWA 4FNFA 4L6TB 4XQNA 1AP0A 3GTLB 3HOVB 2NN6H 2KEEA 1CK1A 1HFNA 1WTRA 3H6MA 1HTPA 3C3LA 1BF4A 2WKCA 3K6OA 4ZAIA 4IUQA 1W6JA 2E2IB 2LS01 3V96A 4IQZA 2A5HA 4IUUA 5A2QE 1QNUA 3MA2B 5COYA 3PUVA 1Q3LA 2R3ZA 1RTOA 2DNEA 5F2DA 1EEID 5CV5A 1Y1VB 2PNRC 1UNSA 1I4QA 1KDAA 2VXWA 3DEOA 2C5CA 4QUCA 5C4ZA 4FXDA 1A2UA 4X3UA 1E2VA 1CHQD 2PQEA 1CT1D 3LWEA 1Q90A 3GD7A 3NP8A 2E2JB 3PO2B 3J80L 3NE5B 3I4MB 4K8JA 2RBMA 2MGSA 3OWFA 4NDXA 1RD9D 1LTBD 1SYCA 1TQOA 5I6WA 3R2IA 3AB9A 5BN5A 2EYHA 3SHLA 2A6EC 4X3KA 3A8JE 1V1PA 5IGCA 1EWCA 1LABA 3VR5A 1SMYD 3NTHA 1LT4D 2EYPA 1STBA 4G57A 1XXGA 1D5XC 5C5LA 4K5VA 4IUNA 4OGQC 1QE6A 1EY0A 3EA6A 2J4XA 5I6YA 1XX8A 1EL0A 3VYTA 2X6LA 1BBXC 1JOOA 2L5TA 5CBEE 1F2LA 3AU7A 1ILPA 4DF7A 4B08A 4K6LA 5LHY1 2FMMA 4ZKCB 3TP6A 2ZXOA 4I65A 2O5IC 4KHZA 3TZUA 2A68D 3BVGA 1PLFA 4K6DA 1FNUA 5ELBA 4CJ1B 4KD3A 4K5WA 2QEJC 1TIID 1WCMB 3SXHA 3C1EA 3VYUA 3M3YB 1ENFA 3T51B 4EQNA 2IT1A 2M9VA 1NUCA 3EFXD 4MN3A 3KUPA 2L12A 2A69C 3BYYB 2VB3X 4H7BA 2F0GA 5KNCA 3CHBD 3NQIA 4O1NA 3M7NA 1STHA 3J81E 1T5EA 4XT3B 5ELEA 1BCPF 4C3IB 4JBWA 2R93B 3MFYA 4CGYB 1Y69U 2QDBA 2NVYB 2MJ8A 3K5OA 1A6XA 2NVTB 4RA8A 2E2HB 3M4YA 4RHSA 3D4DA 5KIXA 1F9RA 1LT5D 5JOBA 1KAAA 1YNJC 2ENBA 1PTOC 1RODA 3MHBA 4B9XA 3D6CA 2NN6G 2E75C 2X6GA 1SJED 2N55A 3MTSA 3OSOA 1GHJA 3IL8A 4A3BB 1STAA 1B9NA 3K0YA 1I4RA 3S2DB 1BNZA 5CR3A 3GTJB 2QILA 1SYBA 4ID6A 2BA1A 5JVG3 2KA7A 1FYCA 4DAVA 1L0YB 5D3IB 3PV0A 3F2UA 3HOZB 3M85A 1Y8OB 3WDNA 3I73A 1A15A 4OO1G 1I4XA 2KUMA 4ZUJA 4ZYSA 3R93A 2BE5C 1PYWD 1CM9A 1LT6D 2F0VA 1X3PA 3VR6A 3H0GB 1G291 2SNSA 2F3VA 2B2UC 1IKMA 1MI2A 3DXJC 4HEDA 2VB2X 3K7AB 2XNAC 2NWGA 2IWHA 1B2TA 1TS3A 1PXUA 1WTQA 1GHKA 1EY5A 5G3LD 3SK8A 5IGBA 4FP5D 4L63B 3ERQA 1CI3M 3MXNA 4KHVA 5FOBB 5IGFA 5M5YB 3GV6A 3KBGA 1TVXA 1EOTA 3TBIB 3EJIA 2EY6A 2FHTA 3S1QB 2KCCA 1CQFA 3HP3A 1EY6A 2QKIC 3HEJA 2B8GA 4XDXA 1T5XD 3M4OB 1E0BA 2NN6I 2F0IA 3S1NB 4LJZC 3BVMA 3KLSX 2CHBD 1PFMA 1O7LA 1PDQA 1WD1A 2NVXB 1PFBA 4C3IG 4XQJA 3QB3A 2F0WA 4V190 3OWEB 3PMFA 1JB3A 4LK1C 1TWHB 1EWHA 3IFDA 3VYSA 1SE4A 4NP5A 2K7VA 3QJYA 3PUYA 2F0LA 1AW7A 4ILWA 1TR5A 2B2TC 2O5JC 2BCOA 5JVH3 5EPLA 2WB1B 2PO4A 3OMCA 5JPNC 5C4JB 1F2MA 1CA5A 2B2YC 4UDUC 2NBFA 4C2MB 3MZ5A 2F0SA 4Q0FA 2L55A 2EY5A 2XVSA 4C3JG 1KABA 1KLUD 3CRLC 5EJWA 5T1IA 4KY6A 5ELDA 4F8MA 2A6HD 3RLFA 1B44D 3AMUA 4WORA 1QILA 1HFGA 2N88A 4RAUC 1UAPA 2PZTA 3X3MA 1GUNA 4QMGA 1NSNS 5EPJA 3VYRA 1EY9A 1PTOH 4Y7NB 1AZPA 1VF5C 4ZLTF 5A2QL 1FNWA 1I4PA 2IX0A 3P75A 5DEHA 3M7GA 1V1PB 1NR4A 4HCEA 1HQRD 3GTGB 3OMGA 4DGZA 2F0JA 1BUVT 1YNND 1IW7C 3H91A 1TY0A 4KKSA 1GUSA 1ZEQX 5EBDA 5CORA 4XXEA 2LFNA 1XTCD 1R4PB 2TSSA 1RJTA 4H13C 5DAUA 5EQ0A 1SSOA 2ZXRA 4A3KB 4R8NA 1V43A 4E6IA 5C3XA 1AZQA 1A2TA 3QOJA 5IGEA 3NUCA 3S9WA 1KDBA 2WACA 4KY7A 1GXDC 5JEAJ 5JEAH 3BDOA 3SK6A 2RDGA 3J7AV 2JXMB 2DY7A 2OF1A 1SYEA 3A55A 4EQOA 3KLRA 2HCIA 3FKIB 3A7AB 1TWGB 4FYDA 5C0XJ 2FJ2A 3FEWX 1S5DD 2D62A 1MSHA 2F0PA 1MSGA 2X69A 4PMCA 5CGKA 3G7LA 3E5SA 1DCZA 1Y8NB 2K5WA 1ESFA 1STYA 2MP1A 1DOMA 1G2TA 4B9WA 2RKSA 3HKZB 2AWOA 1FR3A 1KDCA 4OIJA 3H09A 5G3LF 3OW7A 3ZYYX 2H4OA 4R8IA 5IT9E 4A3MB 2K03A 4CKBA 5I4DA 5K36H 1HPCA 3WOEA 3DUZA 2KECA 1PRTD 4RGOS 1LTGD 1F2YA 3MAQA 1K83B 1ZKOA 2KVMA 1SNQA 1BOSA 3DHQA 4TSSA 3CU7A 1WTVA 2A6ED 1H9SA 2F4IA 5E1FA 2WKDA 2K5DA 3H3VC 4PMBA 2Q8TA 2JP1A 2HUGA 3FDTA 1TY2A 2J7ZA 1HXYD 1TT2A 3Q22A 3J81L 3Q24A 3KK7A 5J1ZA 2JSOA 1VMPA 3DWPA 5JJZA 1ENCA 2EYJA 4BY7B 2YYZA 4HR7B 2EJFC 3ITPA 2OT2A 1PZID 1Y1WB 1Z7TA 3T16A 1D1IA 1CZGA 1GUTA 2B8FA 3RUZA 1BCPC 2WV6D 1GJXA 2PPBC 1M8AA 3OIPA 1HA6A 5I9PA 5ELFA 3IKJA 4IUPA 3CRKC 4BS9A 1EYAA 1BQQT 2ZT9C 3S16B 2ZXPA 2QCPX 1NCVA 2NYZD 2L1BA 2KHSA 1JC7A 1QB5D 3TMEA 1D5MC 1SEBD 1ILQA 3ND9A 1HA5A 1U9RA 3TSSA 2B2WC 2EXZA 3ND8A 3V05A 5HGTA 4IUVA 5KNDA 1JWUD 1II3A 3K5LA 1B1ZA 4NMZA 1F9QA 3RMHA 2OXPA 2FMCA 4DNRB 2Z1CA 2B39A 1STEA 4ZUIA 5TSSA 4V0BA 2K04A 2ICIA 1V1OA 2L4NA 1R4QB 4U673 1QCBD 4M1UB 2KEDA 2JA5B 3PO3B 1AN8A 1CTMA 4KMUC 4EGVA 4RKLA 1SYGA 2Q8RE 1OXVA 1LO5D 1SNPA 2EDGA 3GTOB 3MFGA 1DONA 4FF2A 2M2LA 2NUCA 2A73B 4PMWA 4ABNA 5KGUA 1ZYRC 3C1FA 2QF7A 1JR0D 1VCIA 1I50B 3OIQA 1ICWA 4HAEA 4A3JB 2XSCA 3URYA 1SAPA 1BR9A 4C56C 2RVLA 1S5CD 1SFOB 2EOTA 2EE1A 3PUXA 1CFMA 2F0HA 2R7ZB 4TKOB 1I4GA 2HDLA 1RDPD 2NVQB 4I7ZC 4RCOA 1EQTA 1PZKD 2JA7B 5NUCA 1FGBD 2TMPA 3TP7A 4IFDJ 4IFDH 2AWNA 2B2UA 1LV9A 2JE6I 3I8ZA 1C48A 1H9JA 2XN9C 1SBBB 3FRPB 1F2ZA 4G7ZC 1BDOA 1PRTF 1G2SA 1ET6A 4HMJA 4PV1C 4DA2A 1LTID 1C4QA 4ZRZA 1RTNA 3HG9A 3O13A 2SOBA 3PIO3 2A68C 4C3JB 3L9AX 2ID0A 5J39A 2FINB 3I72A 5JAVA 5IOCA 3Q23A 5C4XB 2Q8IB 3P20A 1D2BA 2PMZB 4BY1B 1OO9B 3D3RA 5EKLA 3OHXC 3NBHA 1TWCB 2SNMA 3T56B 3J7YW 3Q0AA 1J9OA 4A3GB 1STNA 4X3SA 1EY8A 2Z4IA 3T53B 3GTKB 3FMCA 4QIWB 3S1RB 4A3FB 3HOUB 2Z8LA 4K14A 2XIWA 1PFNA 2B2TA 1B3AA 4QF4A 1SJHD 3ONAB 5LL6S 2B2YA 3L7ZC 4C3HB 3SK5A 5M9OA 4J6HA 2SEBD 2A74C 5DNFA 5CV8A 2AUJD 3GQBA 4KI0A 1DOKA 1PRTB 2LKVA 2AQ3B 3A56A 3D8GA 4EVOA 4M8AA 1LLRD 3LX0A 3BDCA 4FF4A 1E2WA 5FKAC 2XRQD 3R2TA 4CJ2C 3MXPA 3CQZB 2JYOA 5C44B 5M3MB 3G6JB 2E74C 1H9SB 1HQMC 1JE4A 1CQVA 3W2DA 2LY7A 3NTKA 3FPUB 2BDOA 4WRDA 1EFID 4ODGA 4FF3A 3D6WA 4WFN3 1ENAA 2K28A 1VDZA 3P1HA 4ULLA 1JWSD 3EROA 5FK9C 2F0OA 1KNAA 1IHZA 1Z47A 4KKTA 1RF2D 5IT9L 3HOWB 1SNMA 1A3VA 2XWJB 1NR2A 2E76C 4QUFA 5ELCA 1JWMD 1ET9A 3D4WA 3Q6SA 3TP5A 3D4RA 3NBIA 3K57A 2F0DA 3CKIB 1S5ED 3QWNA 4ZQ3A 3A8KE 2WP8J 1EY7A 4C1NK 4ME5A 1SYFA 4HTHA 4RHRA 2KCNA 2K01A 4NW2A 5D3DA 3GTMB 5T1GA 1S4ZA 1QOHA 2HCCA 3BG3A 1Q1EA 1B53A 4F87A 2BOSA 2CW0C 3NHHA 2KJXA 2EPBA 2G9DA 4RFBA 1EQVA 3JAME 5KYLA 1AEXA 4GZYC 5EKIA 2PZWA 2DY8A 2PW5A 1F77A 1S5FD 3NTIA 4LMQD 3GTQB 4TQUS 4C3HG 3IFTA 1PTOB 1F9PA 1TKWB 3R3OA 4RKBA 2I46A 3SEBA 2F0QA 4HMIA 2L9HA 4L8JA 2J0TD 2MUYA 3C2PA 3GO5A 1S5BD 1M4VA 5CYUA 4YIJA 4XQQA 3OPOA 2D2CC 2K1BA 1WVLA 1TWFB 1K8OA 3I3CA 2A6HC 1GUOA 3H94A 2F3WA 5C0XH 1AFPA 4HSPA 3MXGA 4A3IB 2JA8B 4BBRB 3TN2A 2R6GA 3E6ZX 3K5NA 4A3DB 3KLSA 5CMDA 2JA6B 1LTTD 2BA0A 3VA7A 3J7AF 3BZDB 3BDLA 4FVMA 2MHVA 3UI2A 4IURA 3HRZC 1G8ZD 5KEEA 2DNCA 3VR4A 4CHTB 3IAYA 2F1MA 2MPMA 1SNOA 2B63B 4IFDI 2L11A 4KK7A 1U4LA 1JOKA 1XYIA 3E0JA 2R61A 4P2CB 1D1KA 2AQ1B 5KYIA 1V8QA 1DJRD 3K5MA 4DXGA 5EPKA 1G91A 1IKLA 2B2WA 4K2LA 2GA4B 2XWBB 3SR1A 2H1EA 3I70A 4XT1B 1HCZA 1Z6HA 3MEHA 3P7JA 4DN4M 4DK1A 3I91A 3TP8A 1O78A 1MD2D 4EQPA 3A8IE 3DM1A 5FO9B 3KF8A 5HURA 4RGMA 1DD2A 1PMRA 1TU2B 1Y8PB 3HS0C 2WIIB 5I9OA 3VR2A 2B2VC 2EY2A 3I4LA 4OHJA 4S3SA 1HUNA 1LACA 2DN8A 2NTSA 1A3TA 3DEPA 1EEFD 4OO1H 2BDNA 3QIAA 3VR3A 1I6VC 2PYKA 5CC4A 3QG1A 3RZDB 1SNCA 3MXUA 4IUTA 2FFKB 2VNUD 1DYQA 3BYTB 1RCVD 1ZYRD 1J8IA 1X32A 1HUMA 1Q12A 2A69D 1PRTC 1U4PA 1O7YA 2K32A 3NQTA 3T13A 3T4AC 1MBYA 3EQLC 1X3QA 1CZWA 5E4XA 4PQXA 3EVQA 3TDQA 1DZ1A 3N6RA 2C9OA 3RD4A 1K8MA 2NB0A 4RGNA 4G7HC 1CA6A 4X3TA 1EZ6A 3U9SA 4DAYA 3MWYW 5DM73 1HHVA 2RSNA 1PZJD 5KNBA 1MGSA 4J8QA 1YNJD 4N9PA 3C46A 3TZDA 1PTOD 4FXGC 4BBSB 4K5XA 2VUMB 1STGA 4DNTB 1B9MA 1QG7A 3K59A 5IGDA 1IL8A 4KD4A 2CQAA 3NWTA 4DAPA 1OXSC 2EYLA 5JEAG 2K33A 3A7LA 1LTAD 3GTPB 2PCFB 3A54A 4RH6A 5FLXE 4BA2I 1SDFA 1FD7D 5D65A 5C3EB 3S14B 5IODA 4H0LC 5C0XG 1BO0A 1EYDA 2O2LD 4DFAA 4CBVA 1HTLD 4BA1I 3GP7A 2KQ3A 4O42A 2F0NA 1SMYC 1ONLA 4ZKBB 5EGTA 4DK0A 2RSOA 1SE2A 2WAQB 4IN3A 5CV4A 1VMCA 2NZ1D 2BE5D 3SK4A 2D5DA 1UUPA 4J1MA 1HRJA 4TRDA 1SNDA 1EY4A 3I4NB 1SYDA 3MVVA 5K36G 4KJOA 5BN4A 5E3FA 1XWEA 3BS1A 5EBCA 4G7OC 2RQXA 3S15B 3DWQA 2R92B 4N9TA 1U4MA 1KTKA 5M5WB 4OL7A 1D5ZC 1U4RA 4IZ8A 1SXTA 1R9TB 3J80E 2IPKD 2Y0SB 3L3OC 2RDHA 2EJMA 1DM0B 1L0XB 1EIGA 3FPPA 3V2TA 5M3FB 4K8IA 5E4WC 3NXWA 5LL6X 1WD0A 1I4HA 1B4OA 4WJWA 4NKLA 3I90A 4C1NI 4PNYA 1ZXTA 2EZVA 4KTAA 2IL8A 2IX1A 3DWAA 5EKKA 3N52A 1UEAB 1DXMA 3HOXB 1LTSD 2F0MA 5DM63 4BWGB 4A3EB 4H44C 1OXXK 3JAML 5C0XI 3D31A 2F03A 5CV7A 1H9RA 4KN4C 3PIP3 4QB4A 2K6AA 4OIKA 2F0TA 3KBXA 2M00A 4RWSC 1BCPB 4AYBB 1SE3A 4A93B 2G9HD 4Z9CB 3GV3A 4KV6A 1GUWA 1EU4A 4QCLA 4XYOA 2IW3A 3SE0A 5C3WA 5CV6A 2YU9B 3SDZA 4XTCS 1OXUA 1G6ZA 3HGBA 3PUZA 3SVMA 3MC0B 4CJ0B 4FXKC 1RHPA 4MIUA 1IYVA 3NPPA 1EIHA 4CKEA 1JORA 1BXTA 1PTOF 3BVZA 1I3QB 4R9WA 5J22A 1IW7D 5K5PA 1EZ8A 5C6AA 4HCSA 5BN3A 2EJGC 1OXTA 4KN7C 2ICEC 2JEAI 4DXFA 2CW0D 1B50A 1TWAB 1O7ZA 1A3UA 2EY1A 3LNNA 5ISRA 2EYFA 1E2ZA 5FO8B 3HZXA 2NTTA 4HN7A 2AUKA 3X3NA 1JCKB 4Q5VA 3NK9A 3WOFA 4U68A 3RZOB 3S17B 1LTRD 1C8CA 4DU9A 1LT3D 4XYQA 2OEOA 4OO1I 2F0FA 4IALA 1EYCA 1DOLA 1FNVA 1TS4A 2CVRA 4KY5A 1CHPD 2IX3A 2RDFA 2XRSD 4CKCA 4FF1A 1TS2A 4IFDG 1KNEA 2EVBA 2V4DA 5IIFA 3FVQA 1WTWA 5M5XB 1QJOA 3VA5A 1GUGA 1RKNA 4HSVA 1JQYD 2PW7A 2K5QA 3QOLA 3R8BA 5AFWA 2EYOA 2HDMA 1VF7A 3S1MB 5IGGA 1Q1BA 1JOQA 1GOZA 4RCNA 1JICA 1H9MA 1QNKA 1TS5A 5FO7B 1W6KA 5C4HA 2KOLA 2LMCB 5CBAE 1QWYA 3K58A 2Z4HA 2F0KA 1F9SA 2F0UA 5KRUA 3LWUA 3DMUA 5C5MA 4UAIA 1WTOA 2EYMA 3HOYB 2IJ0A 4FO2A 2PZUA 2HQEA 2O4XA 4MHEA 4K2KA 5A35A 1ML0D 3U9OA 2F0EA 4JK1C 1I6HB 4RGTA 4F7XA 4XIGS 3S2HB 1D6EC 1WTPA 5JPMC 3OOCA 4F88A 5I2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIP 3;  3PIO 3;  4WFN 3;  5DM7 3;  4U67 3;  5JVH 3;  5DM6 3;  5JVG 3; 
#chains in the Genus database with same CATH topology
 2D0P A;  1H9K A;  2JEB I;  1IYU A;  4ZK9 B;  2B2V A;  2D9U A;  2I07 B;  5CV9 A;  2WIN B;  2K05 A;  4HJ7 A;  1YNN C;  4LF7 Q;  1Q8I A;  4JI3 Q;  4KKU A;  1KLG D;  1WOC A;  4DUZ L;  4KJN A;  2WB1 E;  1WTX A;  3NWS A;  2E2D C;  1BCP D;  4JCV E;  3BZC A;  2AQ2 B;  2L0C A;  3L2P A;  2RA4 A;  1HR0 W;  3QO2 A;  3KJO A;  4LAA A;  1ESR A;  5I2Y A;  2SDF A;  3PUW A;  1HR0 L;  1O80 A;  1EU3 A;  2CWP A;  1CKN B;  4G4K A;  5D14 A;  4OX9 L;  1NAP A;  3W3A A;  4BY7 H;  5FLX L;  3NSW A;  1OTC A;  3H3V I;  2WB1 G;  4FNF A;  4L6T B;  4XQN A;  1WTH A;  1AP0 A;  4OEM B;  3GTL B;  3BZK A;  3HOV B;  2NN6 H;  2KEE A;  1CK1 A;  4JI5 Q;  1HFN A;  3CAM A;  1WTR A;  3H6M A;  1HTP A;  1Y1W H;  3C3L A;  4JBJ A;  1BF4 A;  2WKC A;  3K6O A;  1ICF B;  4HJ5 A;  2VS1 A;  4ZAI A;  4IUQ A;  4P71 A;  2HHH L;  1W6J A;  4BXX H;  2E2I B;  1GD7 A;  2LS0 1;  3V96 A;  1CKO A;  3W1G A;  1VQH A;  4IQZ A;  2A5H A;  1PH8 A;  4IUU A;  1PYS B;  1RL2 A;  5A2Q E;  1QNU A;  3MA2 B;  1NNX A;  1YBY A;  5COY A;  3PUV A;  1Q3L A;  2R3Z A;  3KF6 B;  1RTO A;  2ES2 A;  4NB3 A;  2DNE A;  5F2D A;  1EEI D;  2ASB A;  5CV5 A;  1Y1V B;  2NZH A;  2WFW A;  2PNR C;  1UNS A;  2KCM A;  1I4Q A;  1KDA A;  2VXW A;  3DEO A;  2C5C A;  1I94 L;  4QUC A;  5C4Z A;  4X62 Q;  5IYC H;  4FXD A;  4IPD A;  1A2U A;  4GNX C;  4X3U A;  1E2V A;  4Y52 H;  1CHQ D;  2PQE A;  1CT1 D;  3LWE A;  1Q90 A;  3GD7 A;  1P16 A;  3E9I A;  3NP8 A;  2E2J B;  3PO2 B;  1UE6 A;  4I7A A;  2EIF A;  3EN2 A;  3NE5 B;  3J80 L;  3I4M B;  4JV5 Q;  4AQY Q;  4K8J A;  3KJP A;  3E0E A;  2RBM A;  4WJ3 M;  3OWF A;  2MGS A;  3JC6 6;  1JJC B;  4NDX A;  1RD9 D;  1LTB D;  1SYC A;  4B3M Q;  1TQO A;  5I6W A;  4N8F A;  4A3K G;  3R2I A;  3AB9 A;  5BN5 A;  3HOY G;  2JA5 H;  3PO3 H;  2EYH A;  2A6E C;  4X3K A;  3SHL A;  3A8J E;  1V1P A;  5IGC A;  1EWC A;  1LAB A;  4YCU A;  1CSP A;  1SMY D;  3VR5 A;  3GTO H;  3NTH A;  1Q46 A;  2QA4 A;  1LT4 D;  2EYP A;  1STB A;  4G57 A;  2Q2H A;  4LF4 Q;  1XXG A;  2LXJ A;  1D5X C;  5C5L A;  4K5V A;  4IUN A;  4OGQ C;  4LF5 Q;  3CF5 A;  1QE6 A;  1EY0 A;  4R4C A;  3EA6 A;  2J4X A;  5I6Y A;  2UU9 Q;  3CME A;  3HKZ E;  5H1S E;  1I50 H;  1XX8 A;  1EL0 A;  4HIM A;  3VYT A;  2X6L A;  4DR3 Q;  1BBX C;  1JOO A;  4JI2 L;  2L5T A;  5CBE E;  1F2L A;  2OCE A;  1SFO H;  3AU7 A;  1ILP A;  4DF7 A;  4B08 A;  4K6L A;  5LHY 1;  1WFQ A;  2FMM A;  4A3C G;  4ZKC B;  3TP6 A;  2ZXO A;  4I65 A;  2O5I C;  2R7Z H;  4KHZ A;  3TZU A;  1IZ6 A;  3BJU A;  4FDB A;  4B3T Q;  1XNR L;  2A68 D;  4HID A;  1SE8 A;  1SLJ A;  3BVG A;  1PLF A;  4K6D A;  4YCV A;  1FNU A;  5ELB A;  4NPS A;  4CJ1 B;  1KC8 C;  1E7Z A;  4KD3 A;  2OQ0 A;  1J5E Q;  4K5W A;  2QEJ C;  3T1Y L;  1PFS A;  1TII D;  1WCM B;  2CCZ A;  3SXH A;  3C1E A;  3VYU A;  3M3Y B;  1ENF A;  3HOV G;  3T51 B;  4EQN A;  2IT1 A;  2M9V A;  2DUD A;  2IY5 B;  1NUC A;  3EFX D;  4MN3 A;  1AE3 A;  3KUP A;  3DLL A;  2L12 A;  2A69 C;  3BYY B;  1M90 C;  1E3P A;  1EOV A;  2VB3 X;  4H7B A;  2F0G A;  5KNC A;  3CHB D;  3NQI A;  4O1N A;  3M7N A;  1PHJ A;  4C3J H;  1STH A;  3A5U A;  3ULL A;  1T5E A;  3J81 E;  4XT3 B;  5ELE A;  1N36 L;  1BCP F;  5C4X H;  3K8A A;  4C3I B;  4JBW A;  3PIO A;  2R93 B;  3MFY A;  3RR5 A;  3ULP A;  4CGY B;  1Y69 U;  2QDB A;  2NVY B;  4UP7 A;  2MJ8 A;  4BY1 H;  2E5L L;  3K5O A;  1A6X A;  2NVT B;  4RA8 A;  2E2H B;  3M4Y A;  4RHS A;  2P5Z X;  1TWC H;  3D4D A;  1F9R A;  5KIX A;  1LT5 D;  5JOB A;  1PH7 A;  1KAA A;  1YNJ C;  2B3G A;  2ENB A;  1PTO C;  1ROD A;  3MHB A;  4B9X A;  1EWI A;  2B29 A;  3D6C A;  4IPG A;  2NN6 G;  2E75 C;  2X6G A;  4A3G H;  1SJE D;  2N55 A;  3PO2 G;  3MTS A;  3OSO A;  3S1R H;  4A3F H;  1FVI A;  1GHJ A;  3IL8 A;  4A3B B;  1STA A;  1YEZ A;  1SMX A;  1B9N A;  2PI2 E;  3CC4 A;  3K0Y A;  1I4R A;  3S2D B;  1BNZ A;  4P72 A;  5CR3 A;  3GTJ B;  2QIL A;  1QZH A;  1SYB A;  2UUA Q;  4ID6 A;  2BA1 A;  5JVG 3;  2KA7 A;  4C3H H;  1FYC A;  4DAV A;  1L0Y B;  4JI0 Q;  2LXK A;  5D3I B;  5J3B A;  3PV0 A;  4JPB W;  1X65 A;  3F2U A;  3HOZ B;  4OWW B;  2VY3 A;  3M85 A;  1Y8O B;  3WDN A;  3I73 A;  4MNO A;  1A15 A;  5IWA Q;  1XMQ Q;  4OO1 G;  1I4X A;  1BBW A;  1EIF A;  2KUM A;  4ZUJ A;  3MEF A;  1QUQ B;  1YHA A;  4ZYS A;  3R93 A;  2UXB Q;  2BE5 C;  1K9M C;  4NXM L;  1PYW D;  1A8V A;  2VW9 A;  2CH4 A;  5GAG C;  4MZ9 A;  2KCT A;  1CM9 A;  1LT6 D;  2F0V A;  1X3P A;  3VR6 A;  3H0G B;  1G29 1;  2SNS A;  2F3V A;  3CQZ H;  2B2U C;  5C44 H;  5M3M H;  1W2B A;  1IKM A;  1MI2 A;  3DXJ C;  4HED A;  2VB2 X;  3RN2 A;  3K7A B;  3M4Q A;  4GKJ Q;  2R7D A;  2XNA C;  2NWG A;  2IWH A;  1B2T A;  4GKK Q;  1QVC A;  1TS3 A;  1PXU A;  1WTQ A;  1GHK A;  1EY5 A;  5G3L D;  4WJ4 A;  1WCM G;  3SK8 A;  1AE2 A;  5IGB A;  1PA6 A;  4FP5 D;  4L63 B;  3ERQ A;  1AH9 A;  1JT8 A;  1CI3 M;  3MXN A;  4KHV A;  2PI2 A;  5FOB B;  5IGF A;  5M5Y B;  3GV6 A;  3KBG A;  1TWA H;  1TVX A;  1EOT A;  1VQC A;  4JI1 L;  3TBI B;  2RCF A;  3EJI A;  2EY6 A;  2FHT A;  3S1Q B;  2UUC Q;  1CKM A;  3HOW H;  1VQ5 A;  2KCC A;  1CQF A;  3HP3 A;  1EY6 A;  2QKI C;  4A3J G;  3HEJ A;  3I56 A;  1EFW A;  3DM3 A;  4JI8 Q;  4TVA B;  4JI6 Q;  2B8G A;  4XDX A;  4LF4 L;  1T5X D;  4OXP A;  2K4K A;  1DGS A;  3M4O B;  1E0B A;  1WI5 A;  2NN6 I;  3LGJ A;  2XTI A;  2F0I A;  3S1N B;  4LJZ C;  3BVM A;  3KLS X;  2CHB D;  1PFM A;  1O7L A;  1PDQ A;  1YIJ A;  1WD1 A;  2NVX B;  1PFB A;  3G6E A;  4C3I G;  4XQJ A;  3QB3 A;  5LMN L;  2R93 G;  2IHF A;  3ERS X;  2F0W A;  1NTG A;  3OW2 A;  4V19 0;  3OWE B;  3PMF A;  2D0O A;  1JB3 A;  4DR3 L;  4LK1 C;  1TWH B;  1EWH A;  3IFD A;  3U50 C;  2JA7 G;  4QQB X;  1B7Y B;  3VYS A;  1TXY A;  1SE4 A;  4HJ8 A;  4LUZ A;  4NP5 A;  2K7V A;  3QJY A;  1X3F A;  3PUY A;  1E1O A;  2F0L A;  1EYG A;  1AW7 A;  4DV7 Q;  4ILW A;  1TR5 A;  4LW1 A;  1HNZ L;  4AH6 A;  3CCL A;  2B2T C;  2O5J C;  2I0Q A;  3GTM H;  2BCO A;  5JVH 3;  4YHH Q;  5EPL A;  2WB1 B;  3I2Z A;  2PO4 A;  3OMC A;  5JPN C;  5C4J B;  4DV0 Q;  1F2M A;  1CA5 A;  2B2Y C;  2OTL A;  2PMZ E;  4LWC A;  4UDU C;  2NBF A;  1J5E L;  4C2M B;  3MZ5 A;  2F0S A;  4Q0F A;  2L55 A;  2EY5 A;  2XVS A;  4DR4 Q;  2QGQ A;  4C3J G;  4A3B G;  1KAB A;  1KLU D;  2LSS A;  3CRL C;  5EJW A;  5T1I A;  5IYD H;  4KY6 A;  5ELD A;  4F8M A;  2A6H D;  3RLF A;  1B44 D;  1NMF A;  3AMU A;  4WOR A;  1QIL A;  1HFG A;  5C4X G;  1IBL Q;  1UE7 A;  2N88 A;  3GTQ H;  4RAU C;  1UAP A;  2PZT A;  5GAD C;  3X3M A;  1GUN A;  4QMG A;  1NSN S;  5EPJ A;  3VYR A;  1EY9 A;  1PTO H;  5IP7 H;  4Y7N B;  1N34 Q;  4DV2 Q;  1AZP A;  1VF5 C;  4QIW E;  4ZLT F;  5A2Q L;  1FNW A;  1I4P A;  2IX0 A;  3HOZ G;  3P75 A;  1T9H A;  5DEH A;  3M7G A;  4R4T A;  1V1P B;  1GVP A;  1NR4 A;  4HCE A;  1XPO A;  1HQR D;  3GTG B;  3OMG A;  4DGZ A;  2F0J A;  1BUV T;  3KFU A;  1YNN D;  4JVZ A;  4A3G G;  3CC7 A;  1TWF H;  1IW7 C;  3H91 A;  2ZM6 L;  1TY0 A;  3A74 A;  4KKS A;  1GUS A;  1PH3 A;  1ZEQ X;  5EBD A;  3J81 c;  4P75 A;  3CCJ A;  5COR A;  4ZCK A;  3HKS A;  4A3F G;  2IHE A;  3HOU G;  4XXE A;  4L5S A;  2LFN A;  1XTC D;  1R4P B;  4A3I H;  2TSS A;  1RJT A;  2VL6 A;  2JA8 H;  4BBR H;  1YJN A;  4H13 C;  4A3D H;  4ALP A;  4JG2 A;  5DAU A;  5EQ0 A;  2JA6 H;  1SSO A;  2ZXR A;  4A3K B;  1RIP A;  2ZTD A;  2VQE Q;  4R8N A;  1V43 A;  2QDL A;  2MNA A;  4E6I A;  5C3X A;  1AZQ A;  4QJF A;  1A2T A;  3QOJ A;  5IGE A;  3NUC A;  2VZA A;  3S9W A;  1A62 A;  1KDB A;  5FJ8 G;  1VQ4 A;  2WAC A;  4KY7 A;  2VQF Q;  1GXD C;  1SRO A;  5JEA J;  5JEA H;  3BDO A;  3SK6 A;  1X3E A;  2RDG A;  3J7A V;  2JXM B;  2DY7 A;  2ATW A;  2OF1 A;  1SYE A;  2B63 H;  3A55 A;  3PCO B;  2A8V A;  4EQO A;  3PF4 A;  2ZJP A;  1W3S A;  3KLR A;  4DAM A;  3W1B A;  4DV5 Q;  2MQH A;  3K81 C;  2HCI A;  3FKI B;  3A7A B;  5IWA L;  1XMQ L;  1TWG B;  4FYD A;  5C0X J;  2FJ2 A;  4OWX B;  3FEW X;  1S5D D;  2Z0S A;  2D62 A;  1MSH A;  2F0P A;  4POF A;  2A1A A;  1MSG A;  3NEN A;  2X69 A;  4PMC A;  3G7L A;  5CGK A;  3E5S A;  1DCZ A;  1Y8N B;  2K5W A;  2L15 A;  4GNX A;  5JJK A;  1ESF A;  1STY A;  2MP1 A;  1E24 A;  1XMO Q;  1DOM A;  1G2T A;  4B9W A;  2RKS A;  3HKZ B;  2AWO A;  5HY6 A;  1VQO A;  1FR3 A;  1KDC A;  4OIJ A;  3H09 A;  4P74 A;  5G3L F;  3OW7 A;  3ZYY X;  3CCS A;  2H4O A;  1PV4 A;  4R8I A;  5IT9 E;  2UUB Q;  4A3M B;  2K03 A;  4LFB Q;  4CKB A;  5I4D A;  1VQL A;  5K36 H;  1HPC A;  3Q8D A;  3WOE A;  1KD1 C;  3DUZ A;  2KEC A;  1HZA A;  1PRT D;  4RGO S;  4X6A H;  1Y1V H;  4UPA A;  1LTG D;  5IY0 A;  2YTY A;  1F2Y A;  1VQK A;  3EIV A;  3MAQ A;  3J7A 5;  1K83 B;  1X9N A;  1ZKO A;  2KVM A;  4X66 L;  1SNQ A;  1BOS A;  3DHQ A;  4TSS A;  3CU7 A;  1WTV A;  1EIY B;  2CFM A;  2A6E D;  1H9S A;  1S40 A;  4OWT B;  2F4I A;  2WKD A;  2K5D A;  5E1F A;  3H3V C;  1U0L A;  4PMB A;  2UUC L;  4LF9 Q;  2Q8T A;  2JP1 A;  1G51 A;  2HUG A;  3FDT A;  2MO0 A;  3RZD H;  1GO3 E;  5AJ3 Q;  3OTO Q;  1TY2 A;  1SR3 A;  2J7Z A;  1HXY D;  4JI8 L;  1TT2 A;  3Q22 A;  3J81 L;  3Q24 A;  3KK7 A;  1B8A A;  5J1Z A;  1SN8 A;  2JSO A;  1YNX A;  1VMP A;  3DWP A;  4DR7 L;  5JJZ A;  4POG A;  1ENC A;  2CH4 W;  2EYJ A;  3K7U C;  2ZJR A;  2KEN A;  4BY7 B;  4NXN Q;  2YYZ A;  4HR7 B;  4DR6 Q;  4K0K Q;  2EJF C;  3TS2 A;  3NBH B;  3ITP A;  2OT2 A;  4KHP L;  1PZI D;  1Y1W B;  1Z7T A;  3T16 A;  1D1I A;  1CZG A;  4LF6 Q;  3IRB A;  1GUT A;  2B8F A;  3RUZ A;  1HZB A;  1BCP C;  2WV6 D;  1K28 A;  1GJX A;  2PPB C;  1M8A A;  5IYD G;  3OIP A;  1HA6 A;  4YHH L;  1QVF A;  5I9P A;  3EBE A;  5ELF A;  3IKJ A;  4IUP A;  2F4V Q;  3CRK C;  4DKA C;  4BS9 A;  1EYA A;  1BQQ T;  2ZT9 C;  4GOP B;  3I4O A;  3S16 B;  4BBS H;  2ZXP A;  4DR4 L;  2QCP X;  2VUM H;  1NCV A;  2NYZ D;  2L1B A;  2KHS A;  1JC7 A;  1QB5 D;  2F52 A;  4CDC C;  5IP9 H;  3TME A;  3QR8 A;  1HNW L;  1D5M C;  2N3S A;  1SEB D;  1ILQ A;  4IPC A;  1K8G A;  3ND9 A;  1HA5 A;  3GTP H;  1U9R A;  3TSS A;  1IXR A;  5IYB H;  3MXN B;  2B2W C;  2EXZ A;  3RNU A;  4JW0 A;  3ND8 A;  3V05 A;  5HGT A;  4IUV A;  3SGI A;  2PQA A;  5KND A;  1WJJ A;  4DV1 Q;  1JWU D;  1VQB A;  1B70 B;  1II3 A;  5C3E H;  3S14 H;  3FKI G;  3K5L A;  1B1Z A;  4NMZ A;  1F9Q A;  3RMH A;  2OXP A;  1XNQ L;  2FMC A;  4LFC Q;  4DNR B;  2Z1C A;  2B39 A;  1STE A;  1IBM Q;  4ZUI A;  3K80 C;  4PG3 A;  5TSS A;  4V0B A;  2JA8 G;  2K04 A;  4BBR G;  2ICI A;  1V1O A;  2L4N A;  4X65 L;  2OWO A;  1D7Q A;  1R4Q B;  1MJC A;  4U67 3;  1QCB D;  4M1U B;  3HKZ G;  2KED A;  2JA5 B;  3PO3 B;  1AN8 A;  4A3L G;  1CTM A;  4KMU C;  4EGV A;  3CMA A;  4JI4 L;  4RKL A;  4JYA L;  1SYG A;  2Q8R E;  1OXV A;  1LO5 D;  1SNP A;  2EDG A;  3GTO B;  3MFG A;  4A3M G;  1DON A;  4FF2 A;  2M2L A;  2NUC A;  2A73 B;  3I4N H;  4PMW A;  4ABN A;  5KGU A;  4O2D A;  4O0A A;  4R4O A;  4JI7 Q;  1N32 L;  2VQE L;  1MJE A;  4DR1 Q;  1ZYR C;  3S15 H;  4DV4 Q;  2R92 H;  3C1F A;  2QF7 A;  1JR0 D;  1VCI A;  2K50 A;  3JAM i;  1QZG A;  1I50 B;  3OIQ A;  5M5W H;  1ICW A;  4HAE A;  4A3J B;  2NZO A;  2VQF L;  2XSC A;  1BKB A;  2RHS B;  1R9T H;  3URY A;  1SAP A;  1BR9 A;  1EQR A;  4C56 C;  5LMU L;  1YI2 A;  2RVL A;  1S5C D;  1SFO B;  1VQG A;  2EOT A;  2EE1 A;  3PUX A;  1CFM A;  2F0H A;  1LYL A;  3D0F A;  2R7Z B;  4TKO B;  4JC0 A;  2K14 A;  1I4G A;  2ZJQ A;  2HDL A;  1RDP D;  5M3F H;  2NVQ B;  1L1O A;  4I7Z C;  4LF7 L;  4RCO A;  4JI3 L;  2Z6K A;  1YHB A;  1EQT A;  1PZK D;  4QGU A;  2JA7 B;  4R1J A;  4BY7 G;  5NUC A;  1FGB D;  2TMP A;  3K0X A;  3TP7 A;  4IFD H;  4IFD J;  2AWN A;  2UXC Q;  2B2U A;  2HIX A;  1LV9 A;  3AFP A;  2AHO B;  3I8Z A;  2JE6 I;  1C48 A;  1H9J A;  1XMO L;  2XN9 C;  1E1T A;  1S3O A;  1SBB B;  3FRP B;  3NEL A;  1F2Z A;  3H3V H;  4G7Z C;  1BDO A;  1X55 A;  1Y1W G;  1PRT F;  1G2S A;  1ET6 A;  4HMJ A;  4PV1 C;  4DA2 A;  1LTI D;  1C4Q A;  4ZRZ A;  1RTN A;  3BU2 A;  3HG9 A;  3O13 A;  2SOB A;  3PIO 3;  3HOX H;  4BXX G;  2A68 C;  3L9A X;  4C3J B;  2DJG C;  4A3E H;  2ID0 A;  5J39 A;  3RN5 A;  4JI5 L;  2FIN B;  3I72 A;  4LF8 Q;  1JJ2 A;  5JAV A;  4YY3 Q;  2AMC B;  5IOC A;  2ALY B;  3Q23 A;  5GAH C;  4HJA A;  2Q2U A;  5C4X B;  2Q8I B;  3P20 A;  5IT9 c;  3CD6 A;  1YHQ A;  4JOI A;  1D2B A;  2PMZ B;  4ME3 A;  1K3B C;  2QW7 A;  4BY1 B;  1OO9 B;  3D3R A;  5EKL A;  5AJ3 L;  3OHX C;  1FJG Q;  3NBH A;  4DK6 C;  1TWC B;  2SNM A;  1NMG A;  2JA9 A;  5IYC G;  3T56 B;  4A93 H;  1Q81 C;  1SRU A;  2EXD A;  3PIP A;  3J7Y W;  3Q0A A;  1J9O A;  4A3G B;  1KXL A;  3TS0 A;  2YU9 H;  1STN A;  4X3S A;  4OON A;  1EY8 A;  2Z4I A;  3T53 B;  4X62 L;  3GTK B;  3FMC A;  4QIW B;  3S1R B;  4A3F B;  3HOU B;  1UEB A;  1KQS A;  4A4I A;  1M1K C;  4GOP A;  2Z8L A;  4K14 A;  4X64 Q;  2XIW A;  4DUZ Q;  1PFN A;  2B2T A;  4IJL A;  1B3A A;  2K52 A;  4QF4 A;  3TQY A;  1SJH D;  2JA5 G;  3TRE A;  3ONA B;  2VUM G;  3PO3 G;  4YWM A;  5LL6 S;  1PH1 A;  4L5Q A;  2B2Y A;  1I3Q H;  3L7Z C;  4C3H B;  4JV5 L;  4AQY L;  4GNX B;  1HR0 Q;  4B3M L;  3CCE A;  2F4V L;  3SK5 A;  5M9O A;  4OX9 Q;  4J6H A;  1K8A C;  2SEB D;  5JJI A;  2A74 C;  3A5Z B;  5CV8 A;  5DNF A;  3T1H Q;  5IYB G;  2AUJ D;  3GQB A;  1VQ7 A;  2WAQ E;  1D8L A;  4KI0 A;  1DOK A;  1PRT B;  1BBU A;  3KOJ A;  4GLV B;  2LKV A;  5C3E G;  2AQ3 B;  3F2B A;  1UWV A;  1Q86 C;  3A56 A;  3D8G A;  4EVO A;  3G48 A;  4M8A A;  3S24 A;  4DV6 Q;  1NE3 A;  1LLR D;  3LX0 A;  3BDC A;  4FF4 A;  1E2W A;  5FKA C;  2XRQ D;  3R2T A;  3KLW A;  2Z6B A;  1VQ6 A;  2H5X A;  4CJ2 C;  4LF5 L;  3MXP A;  2K5H A;  3CQZ B;  2JYO A;  5C44 B;  5M3M B;  3G6J B;  3RZO H;  4APV A;  3S17 H;  2UU9 L;  2E74 C;  4DV1 L;  1H9S B;  1HQM C;  1JE4 A;  2R7Z G;  4J15 A;  1CQV A;  3W2D A;  3NTK A;  2LY7 A;  3FPU B;  2BDO A;  4WRD A;  3AFQ A;  4LFC L;  1LUZ A;  3I7F A;  1EFI D;  1IL2 A;  1VQP A;  4ODG A;  4FF3 A;  3D6W A;  4WFN 3;  2OQK A;  1ENA A;  2K28 A;  1VDZ A;  3U4Z A;  3P1H A;  4ULL A;  1CUK A;  1JWS D;  2Y0S E;  3ERO A;  5FK9 C;  2F0O A;  5M5X H;  4B3S Q;  3ER0 A;  4B3T L;  1KNA A;  2GVA A;  3UDF A;  4LUV A;  1IHZ A;  1Z47 A;  4KKT A;  2R92 G;  1RF2 D;  5IT9 L;  2GN5 A;  3HOW B;  3M9B A;  1SNM A;  3AYH B;  3S1M H;  1A3V A;  2XWJ B;  1X6O A;  1NR2 A;  3TEH B;  4DK3 C;  3F2C A;  2E76 C;  4QUF A;  2DGY A;  5ELC A;  1JWM D;  1ET9 A;  4AIM A;  4DR1 L;  1K0R A;  1HNX Q;  3D4W A;  3Q6S A;  4KLK A;  3TP5 A;  3D4R A;  3NBI A;  2ZTC A;  3K57 A;  2F0D A;  1FL0 A;  3CCU A;  3CKI B;  4CDE C;  4PZ7 A;  1S5E D;  5M3F G;  3QWN A;  5GAE C;  4ZQ3 A;  1MHW C;  1V9P A;  4BY1 G;  3E3X A;  3A8K E;  1C9O A;  2WP8 J;  1EY7 A;  4UP9 A;  3STB D;  4C1N K;  4GLX A;  2G5D A;  4ME5 A;  1SYF A;  4HTH A;  1X54 A;  4RHR A;  2KCN A;  3F8T A;  1G6P A;  4PZ6 A;  2K01 A;  4NW2 A;  5D3D A;  3GTM B;  3HOY H;  5T1G A;  1V1Q A;  1S4Z A;  1YJW A;  1QOH A;  2HCC A;  3BG3 A;  1JMC A;  1Q1E A;  1B53 A;  4RMF A;  4LFA Q;  4F87 A;  2BOS A;  2CW0 C;  5FLM H;  3NHH A;  1Q8K A;  2PQA B;  2ZTE A;  3HOX G;  2KJX A;  2EPB A;  2G9D A;  2CWA A;  4RFB A;  1EQV A;  3JAM E;  2MFI A;  5KYL A;  1AEX A;  1FGU A;  2KHJ A;  1PVO A;  4GZY C;  5EKI A;  3ICE A;  1JE5 A;  3B6Y A;  4JI2 Q;  4AYB E;  2PZW A;  2DY8 A;  1I6H H;  2PW5 A;  3S2H H;  1F77 A;  1KIX A;  1VQA A;  1S5F D;  3NTI A;  3AEV A;  4LMQ D;  4DAY B;  1PYB A;  3GTQ B;  4TQU S;  5L37 A;  4C3H G;  1XPR A;  3IFT A;  5IE8 A;  1PTO B;  1XNR Q;  2UXD Q;  1F9P A;  1TKW B;  4DR2 Q;  3R3O A;  4RKB A;  2I46 A;  4LUO A;  3SEB A;  2F0Q A;  4HMI A;  2L9H A;  4L8J A;  4LF8 L;  2RHQ B;  2J0T D;  2MUY A;  3T1Y Q;  4YY3 L;  3C2P A;  3GO5 A;  5DLQ E;  3CXC A;  1S5B D;  1M4V A;  5HGQ A;  5CYU A;  1HZ9 A;  4YIJ A;  3OPO A;  2D2C C;  4XQQ A;  4A3C H;  2K1B A;  1PH5 A;  2UUA L;  3CCV A;  1WVL A;  2DJF C;  4JI0 L;  4GN3 B;  1TWF B;  1K8O A;  3UDI A;  3I3C A;  2A6H C;  1GUO A;  3H94 A;  2K5N A;  2F3W A;  3J80 i;  5C0X H;  2R7F A;  5C44 G;  5M3M G;  1AFP A;  3GTL H;  3HOV H;  4HSP A;  3WWV A;  2UXB L;  3MXG A;  4A3I B;  4IOC A;  1KL9 A;  2JA8 B;  4BBR B;  3TN2 A;  2R6G A;  3E6Z X;  3K5N A;  4A3D B;  3KLS A;  5CMD A;  1N36 Q;  2JA6 B;  1LTT D;  2Q2T A;  2BA0 A;  3VA7 A;  3J7A F;  3BZD B;  4OEL B;  3ZJY C;  2E2I H;  2E5L Q;  4X64 L;  3BDL A;  4FVM A;  1L1O B;  2MHV A;  3UI2 A;  4IUR A;  4GKJ L;  3HRZ C;  1G8Z D;  5KEE A;  2DNC A;  3J7Z C;  3VR4 A;  1GM5 A;  1LM0 A;  4CHT B;  2HIV A;  4GKK L;  3IAY A;  3HOW G;  4A76 A;  2F1M A;  2MPM A;  2I5M X;  3G4S A;  3UDG A;  1SNO A;  4IOA A;  2B63 B;  4IFD I;  2L11 A;  4KK7 A;  1S72 A;  1U4L A;  1JOK A;  1XYI A;  2HQL A;  3AQQ A;  1VQ8 A;  3E0J A;  2R61 A;  4P2C B;  1VQE A;  1D1K A;  2AQ1 B;  3T1H L;  5BR8 Q;  5KYI A;  3TRZ A;  1V8Q A;  1YJ9 A;  1DJR D;  3K5M A;  4DXG A;  5EPK A;  2N49 A;  1G91 A;  4HIK A;  1IKL A;  4DV6 L;  2B2W A;  3CW2 C;  1L2F A;  2E2J H;  4JI6 L;  4K2L A;  3PO2 H;  2GA4 B;  2XWB B;  3SR1 A;  2H1E A;  3HFZ B;  3I70 A;  2V1C C;  4XT1 B;  3PF5 A;  1HCZ A;  2BH8 A;  3I4M H;  1A0I A;  3F1Z A;  1Z6H A;  3MEH A;  3P7J A;  4DN4 M;  1VQN A;  4DV3 Q;  4DK1 A;  1VQJ A;  3I91 A;  1UE1 A;  3TP8 A;  1XPU A;  1O78 A;  2C35 B;  1MD2 D;  4EQP A;  3A8I E;  3DM1 A;  5FO9 B;  3KF8 A;  4MTN A;  5HUR A;  3S16 H;  4RGM A;  4GLA C;  1DD2 A;  1PMR A;  1TU2 B;  1Y8P B;  1C7Y A;  1MKH A;  3HS0 C;  2RF4 A;  2WII B;  4IPH A;  2AKW B;  5I9O A;  3VR2 A;  2B2V C;  2HD3 A;  2EY2 A;  3I4L A;  4OHJ A;  1IBK Q;  4NXM Q;  4UP8 A;  4S3S A;  1HUN A;  1LAC A;  4DUY Q;  2DN8 A;  2Q2I A;  2NTS A;  4DV7 L;  1A3T A;  3DEP A;  1VQM A;  1EEF D;  3CPF A;  4B3S L;  1WYD A;  4GN4 B;  4OO1 H;  2BDN A;  3QIA A;  1VQD A;  3VR3 A;  1I6V C;  2PYK A;  5CC4 A;  3QG1 A;  4DV0 L;  3RZD B;  1SNC A;  3MXU A;  4IUT A;  2N8N A;  2PNH A;  4IJH A;  2GVB A;  5IP7 G;  2FFK B;  1N33 Q;  4EQ5 A;  2VNU D;  1DYQ A;  3BYT B;  1RCV D;  1ZYR D;  1J8I A;  1X32 A;  1HUM A;  1HNX L;  1Q12 A;  2A69 D;  1PRT C;  1U4P A;  1O7Y A;  2K32 A;  3NQT A;  4GN5 A;  3NEM A;  4MTK A;  1MBY A;  2JN4 A;  3EQL C;  3T13 A;  3T4A C;  1X3Q A;  1CZW A;  1IBL L;  5E4X A;  4HIO A;  4PQX A;  4JI1 Q;  3EVQ A;  1N34 L;  2I5H A;  4DV2 L;  4CDF C;  1ASY A;  3TDQ A;  1DZ1 A;  3N6R A;  2C9O A;  3RD4 A;  1WCM H;  1K8M A;  5FLM G;  2E8G A;  2NB0 A;  4RGN A;  4G7H C;  1CA6 A;  3M3Y H;  4X3T A;  1EZ6 A;  3U9S A;  4DAY A;  4A3I G;  1GKH A;  3MWY W;  5DM7 3;  1NY4 A;  1HHV A;  4H02 A;  1EQQ A;  4A3D G;  2A19 A;  2RSN A;  1PZJ D;  5KNB A;  2JA6 G;  3U58 A;  1MGS A;  5LMN Q;  4J8Q A;  2JQO A;  1YNJ D;  4N9P A;  1KRS A;  1K73 C;  4LFA L;  3C46 A;  3TZD A;  1PTO D;  4FXG C;  4CDD C;  4A3J H;  4BBS B;  4K5X A;  2VUM B;  1STG A;  4DNT B;  1B9M A;  1QG7 A;  3K59 A;  5IGD A;  1EUJ A;  1IL8 A;  4KD4 A;  2CQA A;  1E22 A;  3NWT A;  1YZ6 A;  4DAP A;  1OXS C;  2EYL A;  3CCR A;  2MO1 A;  3KDF A;  4C3I H;  5JEA G;  2K33 A;  3A7L A;  1LTA D;  2YTV A;  3RLO A;  3GTP B;  1HNZ Q;  2R93 H;  2PCF B;  3A54 A;  2UXD L;  4RH6 A;  5FLX E;  2B63 G;  3W5O A;  4DR2 L;  2NVQ H;  1J6Q A;  3JAM c;  4BA2 I;  1SDF A;  2NVY H;  1FD7 D;  2NVT H;  2XGT A;  1C0A A;  2JA7 H;  2E2H H;  5D65 A;  5C3E B;  3S14 B;  5IOD A;  4H0L C;  5C0X G;  1U5K A;  1BO0 A;  4JBK A;  1EYD A;  1N8R C;  1HH2 P;  2O2L D;  4DFA A;  4CBV A;  1HTL D;  4BA1 I;  3GP7 A;  2KQ3 A;  2CQO A;  4O42 A;  2F0N A;  1ASZ A;  1SMY C;  1ONL A;  4ZKB B;  5EGT A;  4DK0 A;  4EX5 A;  1A63 A;  2RSO A;  1SE2 A;  2WAQ B;  4DV5 L;  1K3R A;  4IN3 A;  5CV4 A;  1VMC A;  2FXQ A;  2NZ1 D;  2BE5 D;  3SK4 A;  4A3B H;  2D5D A;  1UUP A;  2KHI A;  4J1M A;  1HRJ A;  4TRD A;  1SND A;  3S2D H;  1EY4 A;  1VS0 A;  3I4N B;  3U4V A;  3GTJ H;  1SYD A;  3MVV A;  4B3R Q;  5K36 G;  4YWK A;  4KJO A;  5BN4 A;  5E3F A;  1CKN A;  1XWE A;  2YV5 A;  3BS1 A;  1HZC A;  5EBC A;  4G7O C;  2RQX A;  1Y1V G;  4RG1 A;  3S15 B;  3DWQ A;  2ZM6 Q;  4N9T A;  2R92 B;  1U4M A;  3KYH C;  1KTK A;  5M5W B;  2F3I A;  3HOZ H;  3H15 A;  4R4I A;  4OL7 A;  1Q7Y C;  1NJI C;  1D5Z C;  2UUB L;  1U4R A;  4IZ8 A;  3CC2 A;  4LFB L;  4DPG A;  3A0J A;  1NBW A;  1SXT A;  1R9T B;  3J80 E;  2IPK D;  2Y0S B;  3L3O C;  2RDH A;  2EJM A;  1DM0 B;  3PSI A;  1Z9F A;  3I55 A;  1L0X B;  1P8L A;  1EIG A;  3H0G H;  3I4M G;  2EQS A;  3FPP A;  4L5T A;  3V2T A;  3GTK H;  5M3F B;  5BR8 L;  4DR5 Q;  3HOU H;  4K8I A;  5E4W C;  4LF9 L;  3NXW A;  5LL6 X;  1WD0 A;  1I4H A;  1B4O A;  4WJW A;  3OTO L;  3CPW A;  3K7A H;  3KF6 A;  4NKL A;  3I90 A;  4C1N I;  2K75 A;  4PNY A;  2YTX A;  4IO9 A;  1ZXT A;  1MIU A;  4DV3 L;  1X3G A;  2EZV A;  4KTA A;  2IL8 A;  2IX1 A;  3DWA A;  4DNI A;  4YCW A;  1I5F A;  5M5Y H;  1KAW A;  5EKK A;  1XJV A;  5FJ8 H;  4NXN L;  4DR6 L;  4K0K L;  3CP0 A;  3E9H A;  1UEA B;  3N52 A;  1DXM A;  3HOX B;  1LTS D;  2F0M A;  1H95 A;  3S1Q H;  5DM6 3;  4BWG B;  4A3E B;  2Z9H A;  1IBK L;  3UDX A;  1XTD A;  4H44 C;  1OXX K;  4LF6 L;  1L1O C;  3JAM L;  5C0X I;  4BBS G;  3D31 A;  3L0O A;  2Z6K C;  5CV7 A;  2F03 A;  4DUY L;  2QEX A;  1H9R A;  5IP9 G;  4KN4 C;  3M4O H;  3PIP 3;  4HJ9 A;  3S1N H;  4QB4 A;  2K6A A;  4OIK A;  1JB7 A;  2F0T A;  2NVX H;  3KBX A;  2M00 A;  1N9W A;  3CCM A;  4RWS C;  1PH2 A;  1BCP B;  5ELO A;  4AYB B;  1SE3 A;  4A93 B;  4UHV A;  1L0W A;  2G9H D;  1N33 L;  4Z9C B;  3GV3 A;  4KV6 A;  1Q82 C;  1TWH H;  1GUW A;  4P73 A;  1EU4 A;  4QCL A;  1CSQ A;  4XYO A;  2IW3 A;  3SE0 A;  1PH9 A;  5C3W A;  5CV6 A;  2YU9 B;  3SDZ A;  4XTC S;  4GS3 A;  1OXU A;  1G6Z A;  4X66 Q;  1HJP A;  2BH2 A;  2HHH Q;  3HGB A;  3PUZ A;  3SVM A;  3MC0 B;  5C4J H;  4CJ0 B;  4JOI C;  2WAQ G;  4FXK C;  1RHP A;  4C2M H;  4MIU A;  1IYV A;  3NPP A;  3GDE A;  1EIH A;  1Y14 B;  4CKE A;  1JOR A;  1BXT A;  1PTO F;  3BVZ A;  1I3Q B;  4R9W A;  5J22 A;  1IBM L;  1IW7 D;  5K5P A;  1EZ8 A;  5C6A A;  4HCS A;  5BN3 A;  2EJG C;  5LMN W;  1OXT A;  4KN7 C;  4DR7 Q;  3M4P A;  3FP9 A;  3I4N G;  2ICE C;  2JEA I;  4DXF A;  2CW0 D;  3RLN A;  1B50 A;  1I94 Q;  1TWA B;  4PZ8 A;  1O7Z A;  4Y7N H;  1UE5 A;  1VQ9 A;  1A3U A;  2EY1 A;  5GRO A;  5GQO A;  3KF8 B;  3LNN A;  5ISR A;  4LNQ A;  4KHP Q;  2EYF A;  3UE1 A;  2CKZ B;  1JJG A;  1E2Z A;  2JK8 A;  3HZX A;  2N78 A;  1KRT A;  5FO8 B;  3G71 A;  2NTT A;  4HN7 A;  3J81 j;  3CCQ A;  4GOP C;  2KBN A;  2AUK A;  3X3N A;  1JCK B;  3GTG H;  4JI7 L;  4Q5V A;  1BVS A;  5JJL A;  3NK9 A;  2Y0S G;  3WOF A;  4N8X 1;  4U68 A;  4DV4 L;  3RZO B;  3S17 B;  1LTR D;  1B3Q A;  1C8C A;  1K0S A;  3ULJ A;  4DU9 A;  1LT3 D;  4L5R C;  4XYQ A;  2OEO A;  4OO1 I;  2F0F A;  4IAL A;  1EYC A;  1DOL A;  1FNV A;  1TS4 A;  2CVR A;  2I5L X;  4KY5 A;  1CHP D;  1O7I A;  2IX3 A;  2OTJ A;  3FHW A;  1IYJ B;  2RDF A;  2XRS D;  1HNW Q;  4CKC A;  5FLX c;  4FF1 A;  1KHI A;  1TS2 A;  4IFD G;  1KNE A;  2EVB A;  2V4D A;  3PQI A;  5IIF A;  3FVQ A;  4A3K H;  1WTW A;  5M5X B;  1QJO A;  3VA5 A;  1GUG A;  1RKN A;  4R4Q A;  4HSV A;  1JQY D;  2RCN A;  1QVG A;  1LTL A;  1VQI A;  2PW7 A;  2K5Q A;  3QOL A;  3R8B A;  1PH4 A;  1YIT A;  5AFW A;  2EYO A;  4QL5 A;  2HDM A;  1VF7 A;  3S1M B;  5IGG A;  2UXC L;  4YWL A;  1Q1B A;  1XNQ Q;  4B3R L;  1JOQ A;  1GOZ A;  4A3E G;  4RCN A;  1JIC A;  1H9M A;  3OYY A;  3VDY A;  4X65 Q;  4UY8 C;  1QNK A;  1TS5 A;  2HT1 A;  5FO7 B;  1W6K A;  2JJQ A;  3H0G G;  3UE0 A;  1PH6 A;  3J81 i;  4JBM A;  3FKI H;  1TWG H;  3F2D A;  5C4H A;  2KOL A;  2LMC B;  5CBA E;  1QWY A;  3K58 A;  4JI4 Q;  4JYA Q;  2Z4H A;  2K5V A;  2F0K A;  1VQF A;  1F9S A;  4AYB G;  2F0U A;  4A93 G;  5KRU A;  3LWU A;  3DMU A;  5C5M A;  4UAI A;  1X56 A;  5E7N A;  1WTO A;  1N32 Q;  2EYM A;  4QY7 A;  3HOY B;  4FO2 A;  2IJ0 A;  4DR5 L;  1YVC A;  3KDF B;  4A3L H;  2PZU A;  2HQE A;  3J80 c;  2O4X A;  4MHE A;  1FJG L;  4K2K A;  1QUQ A;  4A3M H;  5A35 A;  1ML0 D;  3U9O A;  2F0E A;  4A75 A;  4JK1 C;  1I6H B;  4RGT A;  5LMU Q;  5ELN A;  4F7X A;  5EAY A;  4XIG S;  3S2H B;  1D6E C;  1WTP A;  5JPM C;  1K83 H;  3OOC A;  4F88 A;  3STB C;  5I2X A;  3PGZ A; 
#chains in the Genus database with same CATH homology
 1H9K A;  2JEB I;  1IYU A;  4ZK9 B;  2B2V A;  2D9U A;  2I07 B;  5CV9 A;  2WIN B;  2K05 A;  1YNN C;  1Q8I A;  4KKU A;  1KLG D;  4KJN A;  1WTX A;  3NWS A;  2E2D C;  1BCP D;  2AQ2 B;  2L0C A;  2RA4 A;  3QO2 A;  4LAA A;  1ESR A;  5I2Y A;  2SDF A;  3PUW A;  1O80 A;  1EU3 A;  4G4K A;  5D14 A;  1NAP A;  3W3A A;  5FLX L;  3NSW A;  4FNF A;  4L6T B;  4XQN A;  1AP0 A;  3GTL B;  3HOV B;  2NN6 H;  2KEE A;  1CK1 A;  1HFN A;  1WTR A;  3H6M A;  1HTP A;  3C3L A;  1BF4 A;  2WKC A;  3K6O A;  4ZAI A;  4IUQ A;  1W6J A;  2E2I B;  2LS0 1;  3V96 A;  4IQZ A;  2A5H A;  4IUU A;  5A2Q E;  1QNU A;  3MA2 B;  5COY A;  3PUV A;  1Q3L A;  2R3Z A;  1RTO A;  2DNE A;  5F2D A;  1EEI D;  5CV5 A;  1Y1V B;  2PNR C;  1UNS A;  1I4Q A;  1KDA A;  2VXW A;  3DEO A;  2C5C A;  4QUC A;  5C4Z A;  4FXD A;  1A2U A;  4X3U A;  1E2V A;  1CHQ D;  2PQE A;  1CT1 D;  3LWE A;  1Q90 A;  3GD7 A;  3NP8 A;  2E2J B;  3PO2 B;  3J80 L;  3NE5 B;  3I4M B;  4K8J A;  2RBM A;  2MGS A;  3OWF A;  4NDX A;  1RD9 D;  1LTB D;  1SYC A;  1TQO A;  5I6W A;  3R2I A;  3AB9 A;  5BN5 A;  2EYH A;  3SHL A;  2A6E C;  4X3K A;  3A8J E;  1V1P A;  5IGC A;  1EWC A;  1LAB A;  3VR5 A;  1SMY D;  3NTH A;  1LT4 D;  2EYP A;  1STB A;  4G57 A;  1XXG A;  1D5X C;  5C5L A;  4K5V A;  4IUN A;  4OGQ C;  1QE6 A;  1EY0 A;  3EA6 A;  2J4X A;  5I6Y A;  1XX8 A;  1EL0 A;  3VYT A;  2X6L A;  1BBX C;  1JOO A;  2L5T A;  5CBE E;  1F2L A;  3AU7 A;  1ILP A;  4DF7 A;  4B08 A;  4K6L A;  5LHY 1;  2FMM A;  4ZKC B;  3TP6 A;  2ZXO A;  4I65 A;  2O5I C;  4KHZ A;  3TZU A;  2A68 D;  3BVG A;  1PLF A;  4K6D A;  1FNU A;  5ELB A;  4CJ1 B;  4KD3 A;  4K5W A;  2QEJ C;  1TII D;  1WCM B;  3SXH A;  3C1E A;  3VYU A;  3M3Y B;  1ENF A;  3T51 B;  4EQN A;  2IT1 A;  2M9V A;  1NUC A;  3EFX D;  4MN3 A;  3KUP A;  2L12 A;  2A69 C;  3BYY B;  2VB3 X;  4H7B A;  2F0G A;  5KNC A;  3CHB D;  3NQI A;  4O1N A;  3M7N A;  1STH A;  3J81 E;  1T5E A;  4XT3 B;  5ELE A;  1BCP F;  4C3I B;  4JBW A;  2R93 B;  3MFY A;  4CGY B;  1Y69 U;  2QDB A;  2NVY B;  2MJ8 A;  3K5O A;  1A6X A;  2NVT B;  4RA8 A;  2E2H B;  3M4Y A;  4RHS A;  3D4D A;  5KIX A;  1F9R A;  1LT5 D;  5JOB A;  1KAA A;  1YNJ C;  2ENB A;  1PTO C;  1ROD A;  3MHB A;  4B9X A;  3D6C A;  2NN6 G;  2E75 C;  2X6G A;  1SJE D;  2N55 A;  3MTS A;  3OSO A;  1GHJ A;  3IL8 A;  4A3B B;  1STA A;  1B9N A;  3K0Y A;  1I4R A;  3S2D B;  1BNZ A;  5CR3 A;  3GTJ B;  2QIL A;  1SYB A;  4ID6 A;  2BA1 A;  5JVG 3;  2KA7 A;  1FYC A;  4DAV A;  1L0Y B;  5D3I B;  3PV0 A;  3F2U A;  3HOZ B;  3M85 A;  1Y8O B;  3WDN A;  3I73 A;  1A15 A;  4OO1 G;  1I4X A;  2KUM A;  4ZUJ A;  4ZYS A;  3R93 A;  2BE5 C;  1PYW D;  1CM9 A;  1LT6 D;  2F0V A;  1X3P A;  3VR6 A;  3H0G B;  1G29 1;  2SNS A;  2F3V A;  2B2U C;  1IKM A;  1MI2 A;  3DXJ C;  4HED A;  2VB2 X;  3K7A B;  2XNA C;  2NWG A;  2IWH A;  1B2T A;  1TS3 A;  1PXU A;  1WTQ A;  1GHK A;  1EY5 A;  5G3L D;  3SK8 A;  5IGB A;  4FP5 D;  4L63 B;  3ERQ A;  1CI3 M;  3MXN A;  4KHV A;  5FOB B;  5IGF A;  5M5Y B;  3GV6 A;  3KBG A;  1TVX A;  1EOT A;  3TBI B;  3EJI A;  2EY6 A;  2FHT A;  3S1Q B;  2KCC A;  1CQF A;  3HP3 A;  1EY6 A;  2QKI C;  3HEJ A;  2B8G A;  4XDX A;  1T5X D;  3M4O B;  1E0B A;  2NN6 I;  2F0I A;  3S1N B;  4LJZ C;  3BVM A;  3KLS X;  2CHB D;  1PFM A;  1O7L A;  1PDQ A;  1WD1 A;  2NVX B;  1PFB A;  4C3I G;  4XQJ A;  3QB3 A;  2F0W A;  4V19 0;  3OWE B;  3PMF A;  1JB3 A;  4LK1 C;  1TWH B;  1EWH A;  3IFD A;  3VYS A;  1SE4 A;  4NP5 A;  2K7V A;  3QJY A;  3PUY A;  2F0L A;  1AW7 A;  4ILW A;  1TR5 A;  2B2T C;  2O5J C;  2BCO A;  5JVH 3;  5EPL A;  2WB1 B;  2PO4 A;  3OMC A;  5JPN C;  5C4J B;  1F2M A;  1CA5 A;  2B2Y C;  4UDU C;  2NBF A;  4C2M B;  3MZ5 A;  2F0S A;  4Q0F A;  2L55 A;  2EY5 A;  2XVS A;  4C3J G;  1KAB A;  1KLU D;  3CRL C;  5EJW A;  5T1I A;  4KY6 A;  5ELD A;  4F8M A;  2A6H D;  3RLF A;  1B44 D;  3AMU A;  4WOR A;  1QIL A;  1HFG A;  2N88 A;  4RAU C;  1UAP A;  2PZT A;  3X3M A;  1GUN A;  4QMG A;  1NSN S;  5EPJ A;  3VYR A;  1EY9 A;  1PTO H;  4Y7N B;  1AZP A;  1VF5 C;  4ZLT F;  5A2Q L;  1FNW A;  1I4P A;  2IX0 A;  3P75 A;  5DEH A;  3M7G A;  1V1P B;  1NR4 A;  4HCE A;  1HQR D;  3GTG B;  3OMG A;  4DGZ A;  2F0J A;  1BUV T;  1YNN D;  1IW7 C;  3H91 A;  1TY0 A;  4KKS A;  1GUS A;  1ZEQ X;  5EBD A;  5COR A;  4XXE A;  2LFN A;  1XTC D;  1R4P B;  2TSS A;  1RJT A;  4H13 C;  5DAU A;  5EQ0 A;  1SSO A;  2ZXR A;  4A3K B;  4R8N A;  1V43 A;  4E6I A;  5C3X A;  1AZQ A;  1A2T A;  3QOJ A;  5IGE A;  3NUC A;  3S9W A;  1KDB A;  2WAC A;  4KY7 A;  1GXD C;  5JEA J;  5JEA H;  3BDO A;  3SK6 A;  2RDG A;  3J7A V;  2JXM B;  2DY7 A;  2OF1 A;  1SYE A;  3A55 A;  4EQO A;  3KLR A;  2HCI A;  3FKI B;  3A7A B;  1TWG B;  4FYD A;  5C0X J;  2FJ2 A;  3FEW X;  1S5D D;  2D62 A;  1MSH A;  2F0P A;  1MSG A;  2X69 A;  4PMC A;  5CGK A;  3G7L A;  3E5S A;  1DCZ A;  1Y8N B;  2K5W A;  1ESF A;  1STY A;  2MP1 A;  1DOM A;  1G2T A;  4B9W A;  2RKS A;  3HKZ B;  2AWO A;  1FR3 A;  1KDC A;  4OIJ A;  3H09 A;  5G3L F;  3OW7 A;  3ZYY X;  2H4O A;  4R8I A;  5IT9 E;  4A3M B;  2K03 A;  4CKB A;  5I4D A;  5K36 H;  1HPC A;  3WOE A;  3DUZ A;  2KEC A;  1PRT D;  4RGO S;  1LTG D;  1F2Y A;  3MAQ A;  1K83 B;  1ZKO A;  2KVM A;  1SNQ A;  1BOS A;  3DHQ A;  4TSS A;  3CU7 A;  1WTV A;  2A6E D;  1H9S A;  2F4I A;  5E1F A;  2WKD A;  2K5D A;  3H3V C;  4PMB A;  2Q8T A;  2JP1 A;  2HUG A;  3FDT A;  1TY2 A;  2J7Z A;  1HXY D;  1TT2 A;  3Q22 A;  3J81 L;  3Q24 A;  3KK7 A;  5J1Z A;  2JSO A;  1VMP A;  3DWP A;  5JJZ A;  1ENC A;  2EYJ A;  4BY7 B;  2YYZ A;  4HR7 B;  2EJF C;  3ITP A;  2OT2 A;  1PZI D;  1Y1W B;  1Z7T A;  3T16 A;  1D1I A;  1CZG A;  1GUT A;  2B8F A;  3RUZ A;  1BCP C;  2WV6 D;  1GJX A;  2PPB C;  1M8A A;  3OIP A;  1HA6 A;  5I9P A;  5ELF A;  3IKJ A;  4IUP A;  3CRK C;  4BS9 A;  1EYA A;  1BQQ T;  2ZT9 C;  3S16 B;  2ZXP A;  2QCP X;  1NCV A;  2NYZ D;  2L1B A;  2KHS A;  1JC7 A;  1QB5 D;  3TME A;  1D5M C;  1SEB D;  1ILQ A;  3ND9 A;  1HA5 A;  1U9R A;  3TSS A;  2B2W C;  2EXZ A;  3ND8 A;  3V05 A;  5HGT A;  4IUV A;  5KND A;  1JWU D;  1II3 A;  3K5L A;  1B1Z A;  4NMZ A;  1F9Q A;  3RMH A;  2OXP A;  2FMC A;  4DNR B;  2Z1C A;  2B39 A;  1STE A;  4ZUI A;  5TSS A;  4V0B A;  2K04 A;  2ICI A;  1V1O A;  2L4N A;  1R4Q B;  4U67 3;  1QCB D;  4M1U B;  2KED A;  2JA5 B;  3PO3 B;  1AN8 A;  1CTM A;  4KMU C;  4EGV A;  4RKL A;  1SYG A;  2Q8R E;  1OXV A;  1LO5 D;  1SNP A;  2EDG A;  3GTO B;  3MFG A;  1DON A;  4FF2 A;  2M2L A;  2NUC A;  2A73 B;  4PMW A;  4ABN A;  5KGU A;  1ZYR C;  3C1F A;  2QF7 A;  1JR0 D;  1VCI A;  1I50 B;  3OIQ A;  1ICW A;  4HAE A;  4A3J B;  2XSC A;  3URY A;  1SAP A;  1BR9 A;  4C56 C;  2RVL A;  1S5C D;  1SFO B;  2EOT A;  2EE1 A;  3PUX A;  1CFM A;  2F0H A;  2R7Z B;  4TKO B;  1I4G A;  2HDL A;  1RDP D;  2NVQ B;  4I7Z C;  4RCO A;  1EQT A;  1PZK D;  2JA7 B;  5NUC A;  1FGB D;  2TMP A;  3TP7 A;  4IFD J;  4IFD H;  2AWN A;  2B2U A;  1LV9 A;  2JE6 I;  3I8Z A;  1C48 A;  1H9J A;  2XN9 C;  1SBB B;  3FRP B;  1F2Z A;  4G7Z C;  1BDO A;  1PRT F;  1G2S A;  1ET6 A;  4HMJ A;  4PV1 C;  4DA2 A;  1LTI D;  1C4Q A;  4ZRZ A;  1RTN A;  3HG9 A;  3O13 A;  2SOB A;  3PIO 3;  2A68 C;  4C3J B;  3L9A X;  2ID0 A;  5J39 A;  2FIN B;  3I72 A;  5JAV A;  5IOC A;  3Q23 A;  5C4X B;  2Q8I B;  3P20 A;  1D2B A;  2PMZ B;  4BY1 B;  1OO9 B;  3D3R A;  5EKL A;  3OHX C;  3NBH A;  1TWC B;  2SNM A;  3T56 B;  3J7Y W;  3Q0A A;  1J9O A;  4A3G B;  1STN A;  4X3S A;  1EY8 A;  2Z4I A;  3T53 B;  3GTK B;  3FMC A;  4QIW B;  3S1R B;  4A3F B;  3HOU B;  2Z8L A;  4K14 A;  2XIW A;  1PFN A;  2B2T A;  1B3A A;  4QF4 A;  1SJH D;  3ONA B;  5LL6 S;  2B2Y A;  3L7Z C;  4C3H B;  3SK5 A;  5M9O A;  4J6H A;  2SEB D;  2A74 C;  5DNF A;  5CV8 A;  2AUJ D;  3GQB A;  4KI0 A;  1DOK A;  1PRT B;  2LKV A;  2AQ3 B;  3A56 A;  3D8G A;  4EVO A;  4M8A A;  1LLR D;  3LX0 A;  3BDC A;  4FF4 A;  1E2W A;  5FKA C;  2XRQ D;  3R2T A;  4CJ2 C;  3MXP A;  3CQZ B;  2JYO A;  5C44 B;  5M3M B;  3G6J B;  2E74 C;  1H9S B;  1HQM C;  1JE4 A;  1CQV A;  3W2D A;  2LY7 A;  3NTK A;  3FPU B;  2BDO A;  4WRD A;  1EFI D;  4ODG A;  4FF3 A;  3D6W A;  4WFN 3;  1ENA A;  2K28 A;  1VDZ A;  3P1H A;  4ULL A;  1JWS D;  3ERO A;  5FK9 C;  2F0O A;  1KNA A;  1IHZ A;  1Z47 A;  4KKT A;  1RF2 D;  5IT9 L;  3HOW B;  1SNM A;  1A3V A;  2XWJ B;  1NR2 A;  2E76 C;  4QUF A;  5ELC A;  1JWM D;  1ET9 A;  3D4W A;  3Q6S A;  3TP5 A;  3D4R A;  3NBI A;  3K57 A;  2F0D A;  3CKI B;  1S5E D;  3QWN A;  4ZQ3 A;  3A8K E;  2WP8 J;  1EY7 A;  4C1N K;  4ME5 A;  1SYF A;  4HTH A;  4RHR A;  2KCN A;  2K01 A;  4NW2 A;  5D3D A;  3GTM B;  5T1G A;  1S4Z A;  1QOH A;  2HCC A;  3BG3 A;  1Q1E A;  1B53 A;  4F87 A;  2BOS A;  2CW0 C;  3NHH A;  2KJX A;  2EPB A;  2G9D A;  4RFB A;  1EQV A;  3JAM E;  5KYL A;  1AEX A;  4GZY C;  5EKI A;  2PZW A;  2DY8 A;  2PW5 A;  1F77 A;  1S5F D;  3NTI A;  4LMQ D;  3GTQ B;  4TQU S;  4C3H G;  3IFT A;  1PTO B;  1F9P A;  1TKW B;  3R3O A;  4RKB A;  2I46 A;  3SEB A;  2F0Q A;  4HMI A;  2L9H A;  4L8J A;  2J0T D;  2MUY A;  3C2P A;  3GO5 A;  1S5B D;  1M4V A;  5CYU A;  4YIJ A;  4XQQ A;  3OPO A;  2D2C C;  2K1B A;  1WVL A;  1TWF B;  1K8O A;  3I3C A;  2A6H C;  1GUO A;  3H94 A;  2F3W A;  5C0X H;  1AFP A;  4HSP A;  3MXG A;  4A3I B;  2JA8 B;  4BBR B;  3TN2 A;  2R6G A;  3E6Z X;  3K5N A;  4A3D B;  3KLS A;  5CMD A;  2JA6 B;  1LTT D;  2BA0 A;  3VA7 A;  3J7A F;  3BZD B;  3BDL A;  4FVM A;  2MHV A;  3UI2 A;  4IUR A;  3HRZ C;  1G8Z D;  5KEE A;  2DNC A;  3VR4 A;  4CHT B;  3IAY A;  2F1M A;  2MPM A;  1SNO A;  2B63 B;  4IFD I;  2L11 A;  4KK7 A;  1U4L A;  1JOK A;  1XYI A;  3E0J A;  2R61 A;  4P2C B;  1D1K A;  2AQ1 B;  5KYI A;  1V8Q A;  1DJR D;  3K5M A;  4DXG A;  5EPK A;  1G91 A;  1IKL A;  2B2W A;  4K2L A;  2GA4 B;  2XWB B;  3SR1 A;  2H1E A;  3I70 A;  4XT1 B;  1HCZ A;  1Z6H A;  3MEH A;  3P7J A;  4DN4 M;  4DK1 A;  3I91 A;  3TP8 A;  1O78 A;  1MD2 D;  4EQP A;  3A8I E;  3DM1 A;  5FO9 B;  3KF8 A;  5HUR A;  4RGM A;  1DD2 A;  1PMR A;  1TU2 B;  1Y8P B;  3HS0 C;  2WII B;  5I9O A;  3VR2 A;  2B2V C;  2EY2 A;  3I4L A;  4OHJ A;  4S3S A;  1HUN A;  1LAC A;  2DN8 A;  2NTS A;  1A3T A;  3DEP A;  1EEF D;  4OO1 H;  2BDN A;  3QIA A;  3VR3 A;  1I6V C;  2PYK A;  5CC4 A;  3QG1 A;  3RZD B;  1SNC A;  3MXU A;  4IUT A;  2FFK B;  2VNU D;  1DYQ A;  3BYT B;  1RCV D;  1ZYR D;  1J8I A;  1X32 A;  1HUM A;  1Q12 A;  2A69 D;  1PRT C;  1U4P A;  1O7Y A;  2K32 A;  3NQT A;  3T13 A;  3T4A C;  1MBY A;  3EQL C;  1X3Q A;  1CZW A;  5E4X A;  4PQX A;  3EVQ A;  3TDQ A;  1DZ1 A;  3N6R A;  2C9O A;  3RD4 A;  1K8M A;  2NB0 A;  4RGN A;  4G7H C;  1CA6 A;  4X3T A;  1EZ6 A;  3U9S A;  4DAY A;  3MWY W;  5DM7 3;  1HHV A;  2RSN A;  1PZJ D;  5KNB A;  1MGS A;  4J8Q A;  1YNJ D;  4N9P A;  3C46 A;  3TZD A;  1PTO D;  4FXG C;  4BBS B;  4K5X A;  2VUM B;  1STG A;  4DNT B;  1B9M A;  1QG7 A;  3K59 A;  5IGD A;  1IL8 A;  4KD4 A;  2CQA A;  3NWT A;  4DAP A;  1OXS C;  2EYL A;  5JEA G;  2K33 A;  3A7L A;  1LTA D;  3GTP B;  2PCF B;  3A54 A;  4RH6 A;  5FLX E;  4BA2 I;  1SDF A;  1FD7 D;  5D65 A;  5C3E B;  3S14 B;  5IOD A;  4H0L C;  5C0X G;  1BO0 A;  1EYD A;  2O2L D;  4DFA A;  4CBV A;  1HTL D;  4BA1 I;  3GP7 A;  2KQ3 A;  4O42 A;  2F0N A;  1SMY C;  1ONL A;  4ZKB B;  5EGT A;  4DK0 A;  2RSO A;  1SE2 A;  2WAQ B;  4IN3 A;  5CV4 A;  1VMC A;  2NZ1 D;  2BE5 D;  3SK4 A;  2D5D A;  1UUP A;  4J1M A;  1HRJ A;  4TRD A;  1SND A;  1EY4 A;  3I4N B;  1SYD A;  3MVV A;  5K36 G;  4KJO A;  5BN4 A;  5E3F A;  1XWE A;  3BS1 A;  5EBC A;  4G7O C;  2RQX A;  3S15 B;  3DWQ A;  2R92 B;  4N9T A;  1U4M A;  1KTK A;  5M5W B;  4OL7 A;  1D5Z C;  1U4R A;  4IZ8 A;  1SXT A;  1R9T B;  3J80 E;  2IPK D;  2Y0S B;  3L3O C;  2RDH A;  2EJM A;  1DM0 B;  1L0X B;  1EIG A;  3FPP A;  3V2T A;  5M3F B;  4K8I A;  5E4W C;  3NXW A;  5LL6 X;  1WD0 A;  1I4H A;  1B4O A;  4WJW A;  4NKL A;  3I90 A;  4C1N I;  4PNY A;  1ZXT A;  2EZV A;  4KTA A;  2IL8 A;  2IX1 A;  3DWA A;  5EKK A;  3N52 A;  1UEA B;  1DXM A;  3HOX B;  1LTS D;  2F0M A;  5DM6 3;  4BWG B;  4A3E B;  4H44 C;  1OXX K;  3JAM L;  5C0X I;  3D31 A;  2F03 A;  5CV7 A;  1H9R A;  4KN4 C;  3PIP 3;  4QB4 A;  2K6A A;  4OIK A;  2F0T A;  3KBX A;  2M00 A;  4RWS C;  1BCP B;  4AYB B;  1SE3 A;  4A93 B;  2G9H D;  4Z9C B;  3GV3 A;  4KV6 A;  1GUW A;  1EU4 A;  4QCL A;  4XYO A;  2IW3 A;  3SE0 A;  5C3W A;  5CV6 A;  2YU9 B;  3SDZ A;  4XTC S;  1OXU A;  1G6Z A;  3HGB A;  3PUZ A;  3SVM A;  3MC0 B;  4CJ0 B;  4FXK C;  1RHP A;  4MIU A;  1IYV A;  3NPP A;  1EIH A;  4CKE A;  1JOR A;  1BXT A;  1PTO F;  3BVZ A;  1I3Q B;  4R9W A;  5J22 A;  1IW7 D;  5K5P A;  1EZ8 A;  5C6A A;  4HCS A;  5BN3 A;  2EJG C;  1OXT A;  4KN7 C;  2ICE C;  2JEA I;  4DXF A;  2CW0 D;  1B50 A;  1TWA B;  1O7Z A;  1A3U A;  2EY1 A;  3LNN A;  5ISR A;  2EYF A;  1E2Z A;  5FO8 B;  3HZX A;  2NTT A;  4HN7 A;  2AUK A;  3X3N A;  1JCK B;  4Q5V A;  3NK9 A;  3WOF A;  4U68 A;  3RZO B;  3S17 B;  1LTR D;  1C8C A;  4DU9 A;  1LT3 D;  4XYQ A;  2OEO A;  4OO1 I;  2F0F A;  4IAL A;  1EYC A;  1DOL A;  1FNV A;  1TS4 A;  2CVR A;  4KY5 A;  1CHP D;  2IX3 A;  2RDF A;  2XRS D;  4CKC A;  4FF1 A;  1TS2 A;  4IFD G;  1KNE A;  2EVB A;  2V4D A;  5IIF A;  3FVQ A;  1WTW A;  5M5X B;  1QJO A;  3VA5 A;  1GUG A;  1RKN A;  4HSV A;  1JQY D;  2PW7 A;  2K5Q A;  3QOL A;  3R8B A;  5AFW A;  2EYO A;  2HDM A;  1VF7 A;  3S1M B;  5IGG A;  1Q1B A;  1JOQ A;  1GOZ A;  4RCN A;  1JIC A;  1H9M A;  1QNK A;  1TS5 A;  5FO7 B;  1W6K A;  5C4H A;  2KOL A;  2LMC B;  5CBA E;  1QWY A;  3K58 A;  2Z4H A;  2F0K A;  1F9S A;  2F0U A;  5KRU A;  3LWU A;  3DMU A;  5C5M A;  4UAI A;  1WTO A;  2EYM A;  3HOY B;  2IJ0 A;  4FO2 A;  2PZU A;  2HQE A;  2O4X A;  4MHE A;  4K2K A;  5A35 A;  1ML0 D;  3U9O A;  2F0E A;  4JK1 C;  1I6H B;  4RGT A;  4F7X A;  4XIG S;  3S2H B;  1D6E C;  1WTP A;  5JPM C;  3OOC A;  4F88 A;  5I2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...