1K8OA

Solution structure of the lipoic acid-bearing domain of the e2 component of human, mitochondrial branched-chain alpha-ketoacid dehydrogenase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
87
structure length
87
Chain Sequence
b'MGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E2 component of Branched-Chain alpha-Ketoacid Dehydrogenase
publication title Solution structure and dynamics of the lipoic acid-bearing domain of human mitochondrial branched-chain alpha-keto acid dehydrogenase complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 7
structure length 87
sequence length 87
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1k8oA00
1Q1BA 1Q90A 3LNNA 3PUZA 2O5IC 3OPOA 2B8GA 1A6XA 2NN6I 3TZUA 5K36H 1CFMA 2K33A 1QJOA 3NE5B 3GQBA 1TKWB 1OXTA 1OXSC 2JXMB 2R6GA 3QJYA 3T53B 1VF7A 5JEAG 3P20A 1Z7TA 3OOCA 3M85A 2JEAI 2BDOA 1H9SB 4OGQC 1GHJA 4KKUA 2A69D 1VCIA 2LMCB 2AUKA 2CW0C 2DNEA 4KN7C 3A7AB 2A68C 2A68D 2K32A 4KI0A 4G7ZC 1H9JA 2IT1A 1O78A 3A8JE 3IFTA 4XTCS 3KLRA 3LWUA 4KMUC 1Y8PB 4BA2I 4TKOB 5KNBA 1EWHA 4H44C 4TQUS 2BA1A 4JK1C 3D31A 4RCNA 3M7NA 5K36G 2E75C 3PUWA 3DXJC 3VR6A 2F1MA 3I4LA 3VR3A 1HTPA 3VA7A 1ONLA 2K7VA 1GUOA 1ZYRC 1Y69U 3GD7A 4XIGS 4HR7B 4GZYC 1HPCA 3I73A 2EDGA 2JE6I 4OO1H 2D62A 1GJXA 3BG3A 2DN8A 1OXXK 1IW7C 1IW7D 3MFYA 1Y8NB 2DNCA 2Q8IB 3WDNA 1H9RA 1HQMC 2A69C 1DCZA 1BDOA 5BN5A 1B9MA 3ND8A 5C0XG 1V43A 1Z6HA 3U9SA 1E2ZA 2O5JC 4LJZC 1E2VA 3T56B 4DK0A 4KKSA 1OXUA 2A6HC 2A6HD 2EJFC 3MXUA 4H13C 1IYUA 2QF7A 3OW7A 2KA7A 3FPPA 1GUSA 1GUTA 2PCFB 3VR4A 2PNRC 3BDOA 3W3AA 3T51B 2D2CC 3H94A 4OO1G 3FMCA 4IFDH 1H9MA 2BE5C 2BE5D 5BN4A 4IQZA 1PMRA 4H0LC 1Q12A 1GUGA 2E74C 3VR2A 5A35A 2NN6H 1ZKOA 4G7HC 3CRLC 2EJMA 1K8MA 3I72A 3QG1A 1H9SA 1GHKA 4KHZA 3PUXA 3PV0A 4G7OC 1OXVA 1K8OA 4KKTA 1CI3M 1O7LA 4LK1C 3A8IE 3M4YA 1Y8OB 2YYZA 4PV1C 4DK1A 4JBWA 3D4RA 1H9KA 1YNNC 3A8KE 1FR3A 3RLFA 1G291 3PUYA 1T5EA 4BA1I 5BN3A 2A6EC 2A6ED 4IFDG 1FYCA 1CTMA 1DXMA 1SMYC 3N6RA 5KNDA 2AUJD 3SDZA 2PPBC 3SE0A 1Q1EA 2JEBI 3IKJA 3VR5A 3PUVA 3L7ZC 1LACA 1YNJC 3QIAA 3HGBA 1GUNA 2NN6G 2BA0A 5JEAH 2AWOA 2KCCA 1DD2A 4KN4C 2EVBA 3A7LA 1LABA 1HCZA 4DNRB 2EJGC 2B8FA 4I7ZC 5KNCA 1VDZA 2ZT9C 1V8QA 2V4DA 4DNTB 3CRKC 5C0XH 4L8JA 1I6VC 1VF5C 3ND9A 1IYVA 2L5TA 2D5DA 1E2WA 1B9NA 3AB9A 2E76C 1TU2B 3EQLC
chains in the Genus database with same CATH superfamily
4YWMA 1X3GA 2Z0SA 4KHPL 2KUMA 1CQFA 2NN6I 1MGSA 1Y1WB 2R92H 4O42A 4APVA 4ME3A 1EFID 1C8CA 1Y14B 2XNAC 2JEAI 2K52A 3MZ5A 5I9PA 3NWSA 4DR6Q 4QF4A 5IYCG 4EQPA 2EOTA 2B2YC 4A93H 3PIO3 5AJ3L 3MEHA 4NXNQ 3BYYB 1STAA 5IYDG 1D1KA 2VW9A 4OWTB 2PW5A 1GUOA 1NMFA 5LL6S 3C2PA 5CV8A 2EYFA 3EVQA 1KLUD 4A76A 4FP5D 4C3IH 4JI2Q 2EY6A 1VQAA 3NHHA 2L0CA 4DR5Q 4LF4Q 2KHJA 1B7YB 4K2LA 1WD1A 1BCPF 4Y7NB 4LF6L 3SVMA 4DAYB 1WFQA 5M9OA 1JWSD 2IHEA 1ESFA 1WVLA 4MN3A 5C4XH 4LFAL 4HJ9A 5EKIA 4H13C 1N8RC 3HOYH 3SR1A 3H3VH 3TP5A 5EGTA 1TWFB 3D6WA 3CQZB 3T51B 5IY0A 4ZKCB 5JJKA 2MO0A 3KK7A 2GA4B 5IGEA 3E3XA 1K8AC 1ZKOA 2EPBA 1B3QA 3OIQA 2MJ8A 1T9HA 1K8OA 1G8ZD 1O7IA 4LUZA 3J7ZC 3CCLA 2CKZB 3BDCA 4M8AA 1D1IA 2ES2A 2VL6A 1TS4A 2RCNA 1XYIA 1G291 4QGUA 4J1MA 4IO9A 2XIWA 2I07B 2YTVA 4JPBW 3S2HB 3DWQA 2LXJA 1NUCA 1SXTA 4P75A 2RVLA 2M00A 2NN6G 1C0AA 2MHVA 1B8AA 1G6PA 4KN4C 1F77A 4JBJA 1VQLA 1I4RA 2V4DA 4KHVA 4ZRZA 4JI8L 4DR6L 1DGSA 3NTHA 4JI0L 4A3GH 1FJGQ 2B3GA 1L1OB 1E2WA 3L3OC 1PH2A 4IPCA 3K5MA 1UEBA 1VQHA 2ID0A 1RKNA 4DV2L 3NWTA 4DF7A 1HZAA 1Z7TA 4ZUJA 1O7YA 3GTOH 1SYCA 1LUZA 1XNRQ 4GLXA 2WKCA 1KLGD 2DNEA 1V9PA 2EQSA 1ML0D 1RHPA 4DAVA 3BZDB 3IFTA 1EYDA 3P1HA 4KMUC 3GTPH 2H4OA 1BBWA 2OQ0A 2FINB 4NMZA 2R7FA 4UPAA 4A3MG 4ME5A 1A3UA 4XQJA 1TWHB 2WAQE 3M4OH 4DU9A 4MTKA 3I4LA 1GD7A 1HTPA 2K7VA 5HY6A 1KAWA 1TS3A 3Q8DA 3GD7A 4IUPA 4BS9A 1R4QB 2NZ1D 4QIWB 2D62A 1CHQD 1PTOH 4DXFA 1IW7C 5E1FA 1F9SA 2WB1E 1H9RA 1WTPA 1ASYA 2NVXH 2C5CA 2MQHA 1QUQA 3G4SA 1TWCB 1XXGA 1BCPC 2Q2TA 3K0YA 4MZ9A 4PMBA 1Q86C 1NY4A 4A3FH 4IUQA 1PDQA 3TS0A 1S5ED 4K2KA 4ZUIA 3H94A 2B2WA 2KEDA 5C4ZA 3M3YB 3N52A 1N34L 4IQZA 4FF1A 1RTNA 1IHZA 4GNXC 3Q24A 3G6JB 1K8MA 4A3KG 1GHKA 3CP0A 2SDFA 2KHSA 2NB0A 4C3HG 2AQ3B 1WTQA 4DK6C 2IY5B 4PV1C 4JI1Q 1YJNA 1EUJA 1VMCA 3FRPB 3PO2G 5KNDA 1EQRA 3SDZA 3RZDB 4FVMA 4LF7Q 3GTQH 1SE4A 2QKIC 2VUMH 3FHWA 2PQAA 2EVBA 4K5WA 1K83B 3OTOL 2NVQH 2ZT9C 4OIKA 2BDNA 2RF4A 4BY1G 3HRZC 3S1MH 5FLXE 4JI7Q 1PRTD 1TU2B 2E76C 2HQLA 1HJPA 1AN8A 4UP7A 5IGGA 2B39A 2EYJA 4AYBG 4X3TA 1EOVA 1KDCA 2YU9B 3TP7A 1OXTA 1EYCA 2VQEL 1BXTA 4QJFA 1H9SB 2CW0D 4AH6A 4BBRH 4K5XA 3HOZG 2UXCL 3CCVA 3EIVA 4Y52H 1LTSD 2HT1A 1RF2D 3HOUB 1EEID 4ILWA 2CVRA 3NSWA 4GZYC 1A63A 1CZGA 4GKKQ 4MHEA 3X3MA 4HJ8A 2B2TA 4K6DA 3T16A 2QEXA 1VQ6A 1PTOD 1NE3A 4C3JB 5K5PA 2JA7G 2F0KA 4R4IA 3U4VA 2O5JC 3FPUB 1ENAA 1OXUA 2NWGA 3C1EA 4Q5VA 3I91A 5GADC 4Q0FA 2HIVA 3UE0A 1B53A 3KDFB 4J15A 4R4TA 5LMNQ 3CCUA 1VQKA 4B9XA 5ISRA 2E2HH 4CDFC 1SNMA 4IFDH 2N3SA 3STBD 2BE5D 4LF7L 3T1HQ 3K58A 2F0EA 1XJVA 1F2YA 1ET9A 4DV4Q 4ID6A 2EJMA 3QR8A 1AP0A 4J8QA 3PV0A 4A3KB 3R2TA 4LK1C 1MI2A 5IP7H 1SDFA 3M4YA 4A3EH 4JI7L 2BOSA 3GTKB 4R4OA 1MHWC 3ER0A 2RSNA 4YHHQ 1PLFA 1B70B 3K81C 4GOPB 3PO2B 1LACA 1BR9A 3U58A 3J7AV 4EQOA 2Z6KC 4KY7A 4FF4A 4P73A 4DAMA 5I9OA 1GXDC 4JOIC 1E24A 3T13A 4DAYA 4BY1B 3M7GA 3GTGB 1E22A 3KLWA 2JP1A 3LNNA 1XMQQ 1X3EA 1AH9A 2F03A 1CFMA 2B2UA 3TEHB 3CCJA 1OXSC 4AYBB 1UNSA 2JA6H 2MPMA 3P20A 4WORA 1XPUA 4CGYB 1SNQA 4IN3A 5FLXL 2G9HD 3R3OA 4GS3A 2QILA 1VMPA 2AUKA 2VZAA 2E5LQ 2K32A 2Q8TA 2XWBB 2CH4W 4FXDA 3IRBA 3HOZB 1JB3A 3DHQA 3JAME 1JOOA 1AE2A 2QDBA 2L15A 1JWUD 4H44C 1Z47A 1B3AA 4UAIA 3S2DH 5K36G 4X66L 1N9WA 1PZJD 4P74A 5H1SE 4DR3Q 1ZYRD 3PIPA 5LMNL 3PSIA 1BBXC 2E2JB 2SNMA 1I50H 2YTYA 4PNYA 2VY3A 3BG3A 3MXGA 5IYBG 4N8FA 4DV6Q 2E8GA 1LTGD 2Z4HA 5IODA 1IL8A 2IHFA 1LT5D 3TDQA 1X9NA 1DOMA 3JAMi 1DCZA 4DV4L 1WTVA 2ZJRA 4C2MH 1B9MA 1PH4A 1EEFD 2N55A 5DAUA 2JA7B 3KUPA 1CSQA 5JOBA 1ENCA 3LX0A 4KKSA 1VQ4A 1IYUA 1L1OA 4DR7Q 1PH1A 2F0SA 4A3BG 4WJ4A 1A2UA 2N49A 1WTWA 5D3DA 1HQRD 4B3RL 1K73C 5FLMH 5IT9E 1AW7A 3A55A 1GKHA 2ICIA 4RHRA 5IIFA 1R9TH 4IUNA 4IOAA 4DGZA 1D5MC 1AFPA 4ABNA 1WCMH 3S16H 2IPKD 2EYMA 2VXWA 2K1BA 4GN5A 1H9KA 3ULLA 2E2IH 5IGBA 5D3IB 1DOLA 2TSSA 1PXUA 1XMQL 3PF4A 3KBGA 1E1TA 4BY7H 4G57A 1W6JA 3Q0AA 2ZJPA 1G2SA 1HNZL 2E5LL 1Q81C 1PRTF 4L8JA 4LF9L 3MAQA 5ELEA 4JCVE 2VB2X 1CKOA 3QO2A 3GV6A 2B2YA 1WTRA 5JJLA 2CCZA 4UHVA 4IFDJ 1DOKA 3MFGA 3NEMA 1VQJA 4DR3L 3DLLA 1W3SA 4DV6L 1STYA 4DK3C 4YWKA 1HZBA 3SK5A 1QUQB 4LWCA 4LAAA 1O78A 2WV6D 3KLRA 1N32Q 3TRZA 4IOCA 3Q23A 2NZOA 1TXYA 2OXPA 2ALYB 2BCOA 3HKZE 2R92G 1SE8A 3MVVA 3MXPA 2BH2A 4DR7L 1NSNS 1SMXA 4IJHA 4RFBA 2PI2A 1HHVA 1Y69U 1LLRD 4WJ3M 4NB3A 4JI3Q 1JJ2A 2JA5H 3SHLA 1X32A 1PTOF 1TVXA 2G5DA 4X64Q 1GJXA 2YV5A 1K28A 2DNCA 3JAML 5C3EH 5J3BA 1F2LA 1J5EQ 3K7AB 1SROA 3TS2A 4A93G 2NTSA 4C56C 1F9RA 1W6KA 3J81E 3M9BA 4AIMA 4GKJL 2B2VC 4KHPQ 1Z9FA 4K0KL 3AFPA 3VDYA 4A3BB 2SNSA 3DEOA 3PMFA 4MNOA 3FMCA 4C3IG 2PYKA 3A5ZB 4DPGA 4DR4L 2F0WA 4K5VA 1EY4A 1CM9A 3I4MH 3TP6A 4A3CH 1H9SA 1QOHA 5JJIA 5NUCA 1EFWA 2UUBQ 4G7OC 4KKTA 5C4XG 1TS2A 4ZQ3A 2YYZA 3CCEA 5AJ3Q 5D65A 1EQVA 2K01A 5BN3A 4JV5Q 2L4NA 1NAPA 1EY9A 2QCPX 3W1BA 1YNJD 4LFCQ 5CBAE 3NQIA 3HKZB 2CWPA 2Z8LA 1CUKA 2EJGC 5C5LA 2J7ZA 2XGTA 2IL8A 3OMCA 1VQPA 3HOVG 3S14B 2EYPA 5C0XH 1L0YB 4HMJA 1PRTC 5CC4A 2B63H 3L2PA 1DJRD 1PZKD 1QJOA 5JVH3 1F2ZA 3QJYA 1CKNA 3T53B 1D5ZC 1HZ9A 4JI3L 4KD4A 3I55A 3C46A 2N8NA 1I3QH 2P5ZX 4ODGA 4DV7L 2CW0C 1J5EL 4EQ5A 1M90C 1G2TA 4HJ7A 4OIJA 4ZKBB 4A3GG 1TWGH 2R7ZH 4UP8A 3K57A 4HAEA 1EWIA 3BVZA 1RDPD 4NDXA 1BVSA 1CQVA 1I4GA 3VR3A 3HOWH 1K0SA 2R92B 4EX5A 4CKBA 3RUZA 4FXGC 5M3MH 1LT4D 4XXEA 4GOPA 4GNXA 1JB7A 4JI6Q 2Q8IB 2H5XA 1LTBD 1PTOC 3A54A 1QCBD 3U4ZA 3MXNA 1KDBA 4JI8Q 5M3FB 3T1YQ 1LTID 2F0HA 2UUBL 4JI0Q 1HXYD 3SK6A 1C4QA 5I6WA 4RAUC 4LJZC 2A6HD 3KOJA 4WJWA 1L0WA 1L0XB 1EOTA 1D7QA 1Y1WH 1FNUA 2KCMA 4JV5L 3NK9A 4DV2Q 3W3AA 1QE6A 2D2CC 4RKBA 1J8IA 1UEAB 2WFWA 4IPDA 1ASZA 5J1ZA 2ZM6L 2BE5C 3CCSA 1B50A 1SNDA 1PMRA 1JORA 4LFCL 5GAHC 3J7AF 1TIID 2RBMA 4PMCA 3J81L 4I65A 4IJLA 3E9HA 4HIDA 4QUCA 5C5MA 2PZUA 4HSPA 1PFMA 4IUVA 4IPHA 2OCEA 4A3JH 1F2MA 4DK1A 4A3FG 5C4XB 2HHHQ 4HJ5A 1A3VA 4NW2A 1FR3A 2Z4IA 3BDLA 3ICEA 1MJCA 2F0IA 3ITPA 1O80A 3NP8A 4NKLA 1NNXA 1LTTD 5KYIA 5M5YB 2Q2IA 4RHSA 3GP7A 1AZQA 3FKIH 3PIP3 2AHOB 1EZ8A 4IFDI 3HOVB 3AB9A 4PZ6A 4QIWE 4A3DH 4B3SQ 2HDLA 3AFQA 3EJIA 1UE6A 1KIXA 3K5NA 2JJQA 3NUCA 2LFNA 1N34Q 1VF7A 1LT3D 1K3RA 3CPFA 2XRQD 2L55A 3HOXB 1IKMA 1SYDA 4JI6L 2X6LA 4ZCKA 2A68D 2ICEC 1H9JA 3S17B 3DWAA 1Y8PB 1SYFA 1YJ9A 5DLQE 3T1YL 4A3GB 3W5OA 3D31A 4RCNA 3M7NA 4IPGA 3PUWA 2K5QA 4CBVA 1VQMA 3T4AC 3VA7A 2QGQA 2I5HA 2AKWB 1ZYRC 1WJJA 3OWFA 5C4JH 2JYOA 4OO1H 3GTOB 1P16A 1Y8NB 4BBRG 1JOKA 3QWNA 4OL7A 1U5KA 2I5MX 4P71A 3OTOQ 5BN5A 1PFSA 3R93A 4AQYL 2X6GA 1EWCA 3GTPB 4B08A 3DEPA 2L9HA 5KYLA 3C3LA 2HHHL 1PHJA 3FPPA 3KBXA 2FMCA 1U0LA 3I4NH 3S1RB 3KLSX 3VR4A 4X6AH 4POFA 2A5HA 2VQEQ 4DXGA 4DUZQ 4P72A 2L12A 2Z6KA 1I4QA 4KY5A 2A1AA 1ILQA 2NVXB 4S3SA 2KOLA 2DY7A 2UUAL 2UXCQ 4PZ8A 4JOIA 3HEJA 4L5QA 1Y8OB 2GN5A 3I56A 3RZOH 1TWHH 1AEXA 4B3SL 1MSGA 4A3FB 4KK7A 3S1NB 4CJ2C 4IFDG 1IYJB 1HR0W 4DV0L 2QW7A 3HKSA 3RN5A 1GUNA 3DMUA 3U50C 5JEAH 2K5WA 3F2CA 5IGFA 4MTNA 2B8FA 2RA4A 3RLOA 1VDZA 2KEEA 5I2XA 1PYBA 5IP7G 1I6VC 4A3EG 4LNQA 5DEHA 2L5TA 1QVGA 2D5DA 2HQEA 3NPPA 4BBSH 2NVTB 4QB4A 3PUZA 1VQBA 4XT1B 1MJEA 1FNWA 4A3IG 3ERSX 4QQBX 1WTXA 3M3YH 4X3SA 1TKWB 2JXMB 3GTQB 3OWEB 3BVGA 1D6EC 2H1EA 3U9OA 2HIXA 3GTJB 4FO2A 2MNAA 1MIUA 3RNUA 1LTLA 2NVQB 1UE7A 3LWUA 1JE4A 1PFNA 3S1MB 4TRDA 3SEBA 1JQYD 1N33Q 2ZXRA 5EPLA 5EKLA 4YIJA 2F0JA 1KNEA 4DN4M 4DV3L 2JA6G 5FK9C 3X3NA 3NTIA 2F0QA 1RJTA 3FP9A 2JSOA 1E3PA 2F0OA 3F2UA 1C7YA 4DUZL 2NVYB 1K83H 1NMGA 2F4IA 2A69C 4DR2Q 3M4QA 2IX3A 4POGA 4DV1Q 4DKAC 1E2ZA 2RKSA 1XTCD 1XNQQ 4F88A 2EJFC 4DR1Q 3CW2C 1BUVT 4HCEA 1NR4A 4A3MB 3GV3A 2ZTDA 3H91A 2PNRC 1OO9B 2K75A 2ASBA 1W2BA 4H0LC 3VA5A 3VR2A 1M1KC 1HZCA 3G6EA 3UDIA 4ZAIA 1L2FA 2KCTA 2DJFC 1DM0B 1D8LA 1CI3M 1QILA 4AYBE 3A8IE 4OX9L 3HOUH 1DZ1A 4X66Q 1XX8A 5IWAL 2ZXPA 3GO5A 5FLMG 1PH3A 4HJAA 3QOJA 1CKNB 3L0OA 4ZYSA 1XPRA 1S5BD 1SMYD 1VQGA 2XRSD 2E2HB 2JEBI 1CT1D 3OMGA 1YNJC 1LO5D 3TREA 4DNIA 1TWAH 4C3JH 1PH9A 2RCFA 3EA6A 1Y1VG 1OTCA 3W1GA 1WCMG 1PH7A 1BCPB 1C48A 2EY1A 4KD3A 3OIPA 1X3QA 4A3EB 2NZHA 3QOLA 4C3HB 1N33L 1A6XA 1QG7A 2XVSA 4B3RQ 1TT2A 3DM1A 1S40A 1XMOL 3ZYYX 2D0OA 2R6GA 4A3IB 2R3ZA 4BY7G 4GNXB 3KJPA 3MHBA 2BH8A 5TSSA 2SOBA 2ZJQA 4TVAB 1LTRD 3MXNB 4DR2L 4KI0A 1IL2A 5FLXc 1S4ZA 3TN2A 2HUGA 4BA2I 4N9PA 1BQQT 1BO0A 3K59A 4DV1L 3F8TA 4OELB 4G4KA 2B2VA 3BVMA 1XNQL 4DR1L 2WACA 3CC2A 3NTKA 5CV5A 5C3XA 1EIGA 1HPCA 5C0XI 3C1FA 2JA6B 5JEAJ 4DFAA 5C3WA 4FDBA 3MFYA 2UXBL 1IBML 4LF5Q 1X3FA 1HNZQ 2DGYA 3P75A 4LF9Q 4C1NI 1K9MC 3GTGH 1SSOA 4C1NK 4N8X1 4L5RC 2A6HC 1KNAA 2QF7A 3OW7A 3S2DB 4PQXA 5EBCA 2LSSA 4H02A 1STHA 5EBDA 2B2WC 3BDOA 2JA5G 1YBYA 3PF5A 3MC0B 3AU7A 2K05A 1VQCA 2EYHA 5C3EG 2E74C 3TMEA 2FXQA 3J80E 5J39A 4OWXB 2F0MA 3IFDA 2NUCA 3HOZH 1EU4A 4XQNA 5FO9B 1ESRA 1FD7D 5JAVA 3D4RA 3NENA 1KQSA 2PZTA 1YNND 3GTLH 1JMCA 2A6ED 4CKCA 1RTOA 5EKKA 2E2JH 3IKJA 2A73B 3QIAA 1CSPA 3I4MG 2AQ2B 2CH4A 4A3CG 3L9AX 1HCZA 4B3MQ 4R9WA 5M5WB 5KNCA 1NTGA 1Y1VB 3TQYA 1WCMB 3S16B 1EY7A 3SK8A 3ULJA 1B9NA 2N88A 4GKJQ 2F4VL 2E2IB 4K0KQ 2R93H 4QUFA 1K8GA 2ATWA 4R1JA 4DR4Q 4RWSC 2FJ2A 4BY7B 3TSSA 4RGMA 5LMUQ 4LF5L 2A68C 2PMZE 2K6AA 2Q8RE 4X3UA 1YNXA 5C44H 3A8JE 1WTOA 1IBKL 2OTLA 4XTCS 5CV7A 1E1OA 1SE3A 3H09A 2B63G 4TQUS 2K28A 4JK1C 3HS0C 4KY6A 4BXXH 4CDDC 1HA5A 1ONLA 2DUDA 1KHIA 1M8AA 4HR7B 1G91A 1NR2A 2VQFQ 4K14A 1JC7A 1MSHA 1B1ZA 4ULLA 1CKMA 3S24A 4O0AA 5KEEA 1EZ6A 4FYDA 2R7ZG 1BDOA 3I90A 4LUOA 1PV4A 1Z6HA 1YZ6A 3JAMc 5D14A 2WIIB 3D8GA 3HOWG 5T1IA 2ZXOA 5IE8A 3MA2B 3J7YW 5J22A 3DM3A 1K0RA 1XPOA 1X55A 1YEZA 2K5DA 3ERQA 5C3EB 4DV7Q 4B3ML 4P2CB 1SAPA 2EZVA 1SFOB 4LW1A 3CAMA 3KLSA 3P7JA 1STGA 5JPMC 1HNXQ 4KJNA 3RR5A 4OO1I 1KXLA 1SRUA 2I0QA 4V190 3UE1A 3E9IA 2PMZB 1ET6A 3S1QH 5IT9c 3J80L 3KF6B 1FGBD 1TY2A 2F0UA 3QB3A 2BA0A 3BYTB 1Q82C 1JWMD 2F0LA 3AYHB 2HDMA 4CDEC 5LMUL 1EIHA 3J81i 4DUYL 2MGSA 1J6QA 1CA6A 4A3JG 3Q6SA 1I4HA 4HSVA 1I6HB 1EIFA 5IT9L 3CMAA 3EQLC 3J81j 2WINB 3CF5A 1DYQA 2KCNA 2JA8H 3GTMH 3HOYG 5CYUA 4CJ0B 5GROA 2K33A 2Y0SG 2ZM6Q 3NBHB 3BU2A 3OOCA 2VQFL 3D0FA 5ELNA 2Z1CA 3NQTA 1N36Q 3AEVA 4X62Q 4F87A 3FKIG 4KN7C 4HIOA 1X3PA 5M5XB 4UDUC 1YVCA 2FHTA 1WTHA 5I4DA 4YCVA 2EY5A 2A8VA 4JI5Q 4A3DG 1EL0A 1JICA 1E7ZA 3R8BA 4F7XA 1FL0A 2B63B 2K03A 2M2LA 2OF1A 3VR6A 4R8IA 1UUPA 5E3FA 1HNWQ 1EYAA 3MEFA 1M4VA 2IW3A 2GVBA 2J0TD 3VYUA 3BJUA 2JE6I 1NCVA 1OXXK 1SJHD 3S9WA 4KJOA 5LMNW 1EQQA 1SNOA 4Z9CB 3PO3H 3J7A5 4NPSA 3H0GH 2IJ0A 3FVQA 4HN7A 1X65A 2R7ZB 2CQAA 1CA5A 3TZDA 3T56B 1HR0L 1L1OC 2D0PA 1HNXL 2K5NA 1QB5D 1SBBB 2L11A 1UWVA 1V1PB 2PCFB 3S15H 5FJ8H 2Z9HA 3URYA 4A3LH 2PW7A 4OO1G 5BN4A 5EAYA 4JBKA 1ZXTA 2EYLA 3I70A 4B9WA 1UAPA 5AFWA 3Q22A 1VQ9A 1IBLQ 3D6CA 4RKLA 1SJED 2JK8A 1U4MA 3D4DA 4DAPA 4E6IA 3J81c 1MKHA 1HFGA 3A8KE 3E6ZX 2XTIA 4OWWB 4A93B 3I4NG 4R8NA 1CTMA 1SMYC 5ELCA 1EIYB 5F2DA 1PFBA 3SE0A 3OYYA 2CHBD 4JC0A 3STBC 1QVCA 2X69A 3HGBA 4WFN3 1XWEA 2UUCL 1GUWA 2Z6BA 1ILPA 4C3IB 2AWOA 2KCCA 5HGTA 5IP9H 1N36L 2C9OA 4X62L 3BZKA 3LGJA 3MWYW 5M3FH 3TBIB 4AQYQ 2AQ1B 4B3TQ 1I94Q 1C9OA 4QY7A 2PNHA 2TMPA 3I7FA 4JI5L 2K50A 1SYGA 4A3JB 3EROA 2PQEA 3EBEA 1D5XC 3TZUA 1STBA 1U4LA 4L5TA 4F8MA 1QZGA 3IAYA 3HOYB 1HNWL 2OEOA 3CD6A 2Y0SB 5JEAG 3CXCA 2BDOA 1LYLA 1TQOA 3I3CA 4Y7NH 2UUAQ 3FKIB 4BBSG 1RODA 1STEA 4CKEA 4NP5A 1MD2D 4TKOB 2LY7A 4A3DB 3I4OA 1VQNA 3F2BA 2F1MA 4HIMA 5L37A 1TWFH 3CQZH 5CMDA 4DV0Q 4QMGA 3SK4A 2VUMG 3GDEA 2EDGA 2DN8A 3OHXC 1EY6A 5M5YH 1HA6A 2K04A 3A5UA 1CZWA 1ICFB 1EYGA 1PH6A 2UU9L 1IBLL 4LFBQ 3I2ZA 3JC66 5ELFA 3HOVH 1PRTB 2ZTEA 4NXMQ 2F3IA 5FO7B 5DM63 3R2IA 4DK0A 2Q2UA 1LTAD 1Q8IA 4HIKA 2KQ3A 1K3BC 1I4PA 3S2HH 3IL8A 5C4JB 2WAQG 3HOXH 2C35B 1GUGA 4WRDA 4HMIA 1DONA 3UI2A 1HUMA 2PI2E 3K5LA 5C0XJ 1VQ5A 3S17H 1PH5A 1AE3A 3PUXA 4KV6A 4BWGB 1HFNA 4GN3B 2EIFA 4B3TL 4DV5Q 2WB1G 1HH2P 1JCKB 3UDFA 4O1NA 1I94L 2RDHA 4RCOA 3E5SA 1YNNC 4NXNL 4JBMA 4FF3A 3M4OB 2A6EC 5EQ0A 5KRUA 4DV3Q 3I4NB 2I5LX 3RN2A 3N6RA 3KF8B 1Q1EA 1JE5A 3EN2A 1YI2A 2RDFA 1A15A 4JI2L 4A4IA 4IUTA 1PTOB 1DD2A 1J9OA 4DR5L 4LF4L 1LABA 1S3OA 4DNRB 4I7ZC 5IGCA 4L6TB 2CFMA 2VS1A 1I4XA 1MBYA 4DNTB 3K80C 4FNFA 3MTSA 3ND9A 3CCMA 3HOUG 2JQOA 5IYCH 2ZTCA 4RGOS 1D2BA 1Q1BA 3RZOB 5GAGC 2Q2HA 2O5IC 3S1RH 1R4PB 3NXWA 4R4CA 3I8ZA 1X56A 5IYDH 2LKVA 4DA2A 1Q8KA 2XWJB 3ZJYC 2RHSB 3WOEA 4C3JG 4OGQC 1E0BA 5BR8Q 4CDCC 1HTLD 3A7AB 1SYBA 5COYA 1S72A 1TWCH 2UXDQ 2N78A 4LFBL 2RDGA 5G3LD 1YIJA 5ELBA 5KNBA 1Q7YC 4NXML 4OX9Q 4BBSB 1SR3A 1YITA 5A2QE 3WOFA 3DXJC 5IWAQ 1BF4A 3S1NH 2EY2A 3AQQA 3RD4A 4XIGS 3E0JA 4GOPC 3KF6A 4ZLTF 4HTHA 2VUMB 1RCVD 1FGUA 1F9PA 5CV9A 4XDXA 4RGTA 3G71A 1V43A 4KTAA 4UY8C 2NVTH 3V96A 1P8LA 1ICWA 4DV5L 1SNCA 4FF2A 1FJGL 5CBEE 3KFUA 1BNZA 1Q3LA 2F3WA 3MXUA 5EPKA 5DM73 5CV6A 1H95A 1X6OA 1XMOQ 2F0TA 2XN9C 5CGKA 3RZDH 4HCSA 4YY3Q 3GTJH 3KJOA 4XYOA 2MO1A 4GN4B 1SN8A 1PYSB 3DUZA 2WAQB 3CMEA 2FMMA 1XNRL 3NBHA 3V2TA 2NN6H 4G7HC 3CRLC 3I72A 4PG3A 3QG1A 4LUVA 3ULPA 3EFXD 1GM5A 4JG2A 4BBRB 1O7LA 1S5FD 4CJ1B 4JBWA 2WB1B 4IUUA 5KGUA 2F0NA 5CR3A 2KVMA 1A8VA 3TP8A 2YU9H 1DXMA 1RIPA 4RMFA 1VQOA 1XTDA 3OW2A 2MFIA 2NVYH 1O7ZA 2UXBQ 1LV9A 1IBMQ 3LWEA 2KHIA 3F2DA 2LXKA 3PCOB 5BR8L 1EQTA 2F0GA 1BBUA 1V8QA 5GQOA 4K8IA 2K5HA 3H15A 2UXDL 1LT6D 2JN4A 2K4KA 3OPOA 4A3MH 1KRSA 2D9UA 2R61A 3NBIA 3VYSA 3A0JA 3NE5B 1KD1C 1SLJA 2M9VA 1V1PA 4X3KA 2VB3X 4RGNA 3K0XA 1TWAB 1KL9A 4FXKC 1JJCB 3VYTA 4V0BA 4K8JA 4MIUA 1EY8A 4I7AA 3K5OA 4IZ8A 4JI1L 4YCWA 1QVFA 4ZK9B 2R93G 1U4PA 1U4RA 4JVZA 1FVIA 4QCLA 2A74C 3I73A 1V1OA 4YY3L 4GLVB 1RL2A 3V05A 4ALPA 2QEJC 5C44G 5A2QL 3BS1A 2K14A 4A3KH 3W2DA 1X54A 3U9SA 2AWNA 1UE5A 1UE1A 1WOCA 2F52A 4C3HH 4BXXG 5IOCA 2CWAA 3SXHA 3GTKH 2L1BA 2F4VQ 5T1GA 1PZID 1BKBA 2O2LD 3F1ZA 1GUSA 4HEDA 3CC7A 4A3IH 2E2DC 2MUYA 2O4XA 3PO2H 1JT8A 2EXDA 3G48A 3A56A 1Q12A 2CQOA 5FOBB 1VQIA 3PIOA 5DNFA 5A35A 2R7DA 3K8AA 2RHQB 2WKDA 4JI4Q 1IBKQ 2QA4A 1OXVA 1U9RA 3K6OA 1II3A 3PQIA 4BY1H 3HFZB 1IZ6A 2KJXA 4EGVA 4J6HA 1BOSA 1VQ7A 4PZ7A 4OEMB 2KECA 2PPBC 1KDAA 3VR5A 3B6YA 2I46A 1EY5A 3PUVA 2ENBA 5CORA 4GKKL 3SGIA 1I50B 1VQ8A 5HGQA 1KC8C 3A74A 4N9TA 5E7NA 5FKAC 3VYRA 4C2MB 5ELOA 3CCQA 4YWLA 1IYVA 2DJGC 5E4WC 1RD9D 3GTLB 2NYZD 1NJIC 4JW0A 1A3TA 3GQBA 1SE2A 1LM0A 4LF8Q 4O2DA 3J80i 3T1HL 3M85A 1VQDA 2KENA 4PMWA 1GHJA 1IXRA 4KKUA 1R9TB 3G7LA 2LMCB 1QNKA 5E4XA 5G3LF 3UDGA 2RSOA 2IT1A 4XQQA 1HRJA 5JPNC 2HD3A 2JA7H 2WP8J 1G6ZA 1G51A 2JA8G 2BA1A 5I2YA 1KABA 2E75C 2J4XA 4YHHL 1CHPD 1PYWD 3HG9A 1ZEQX 2R93B 4OONA 2EXZA 3KF8A 1IW7D 1PA6A 2KBNA 1TS5A 1VQFA 2PZWA 5M5WH 1Y1VH 4JI4L 5C0XG 4DUYQ 3NELA 5C44B 1B4OA 1BCPD 1EU3A 2JA9A 1E2VA 3CU7A 3O13A 1YHBA 2KA7A 2F0VA 2XSCA 4YCUA 1B2TA 4CHTB 2OQKA 3HKZG 4EQNA 3DWPA 2G9DA 2IX1A 2MP1A 2B2TC 3PO3G 1S5DD 4IALA 3H0GG 4OHJA 1TR5A 2IX0A 2NBFA 3E0EA 3H3VI 1SNPA 5FO8B 3CHBD 3FEWX 3WWVA 1T5XD 5I6YA 4QL5A 1WYDA 3PUYA 1T5EA 5FJ8G 1A2TA 4A3LG 3KYHC 5LL6X 4UP9A 1FYCA 2AUJD 4IURA 5ELDA 2K5VA 4X65Q 5M3MG 1KRTA 2HCCA 4LF8L 1PVOA 2F0FA 2JA5B 3J80c 5HURA 1JJGA 2PO4A 4M1UB 1WI5A 1B44D 1QZHA 2FFKB 2OT2A 2F3VA 3CC4A 1KTKA 5LHY1 3ONAB 4RH6A 5CV4A 4XYQA 4L63B 1HR0Q 1Q90A 2B29A 2B8GA 4H7BA 4KLKA 1Y1WG 1GO3E 5K36H 3S1QB 2HCIA 4LMQD 2YTXA 5C6AA 4XT3B 2F0PA 2SEBD 2AMCB 4JYAQ 1HUNA 5IP9G 2LS01 3CPWA 5IYBH 2A69D 1VCIA 2EYOA 5M3FG 3I4MB 4G7ZC 3K7AH 2EE1A 3BZCA 1SFOH 4GLAC 1YHAA 1EWHA 3OSOA 4RA8A 1AZPA 2JA8B 3GTMB 3FDTA 2V1CC 1VQEA 2IWHA 4TSSA 2B2UC 4A3BH 1S5CD 3RMHA 3PGZA 1CK1A 1GVPA 3H3VC 1YJWA 2PQAB 2UUCQ 3CKIB 3WDNA 1Q46A 1EY0A 1HQMC 5JJZA 3D3RA 5IGDA 3HZXA 3ND8A 1I6HH 1A0IA 5EJWA 1QWYA 1SEBD 1FNVA 5GAEC 3UDXA 2OTJA 5JVG3 2RQXA 1GUTA 5EPJA 1YHQA 1GOZA 4X65L 1H9MA 1IKLA 2DY8A 1PH8A 4K6LA 5KIXA 3H6MA 2A19A 3M4PA 2NTTA 2QDLA 4U68A 1I3QB 5M5XH 4LF6Q 2VNUD 2OWOA 4R4QA 3PO3B 1F9QA 4KHZA 3S14H 3H0GB 3D4WA 1N32L 1TWGB 4A75A 1JR0D 4LFAQ 1SYEA 3HP3A 4EVOA 2Y0SE 1STNA 3RLFA 4U673 4BA1I 3RLNA 1QNUA 3S15B 2F0DA 3AMUA 3HOWB 3HOXG 2GVAA 1KAAA 1JOQA 3KDFA 4L5SA 3L7ZC 1WD0A 4X64L 1TY0A 5M3MB 4JYAL 1A62A 3A7LA 4RG1A 3CCRA 2UU9Q 3CRKC 1V1QA 4OXPA 3K7UC 1VF5C 1ENFA 1VS0A 1I5FA 1NBWA 5C4HA
chains in the Genus database with same CATH topology
2KUMA 1CQFA 2NN6I 1MGSA 1Y1WB 4O42A 1EFID 1C8CA 2XNAC 2JEAI 3MZ5A 5I9PA 3NWSA 4QF4A 4EQPA 2EOTA 2B2YC 3PIO3 3MEHA 3BYYB 1STAA 1D1KA 2PW5A 1GUOA 5LL6S 3C2PA 5CV8A 2EYFA 3EVQA 1KLUD 4FP5D 2EY6A 3NHHA 2L0CA 4K2LA 1WD1A 1BCPF 4Y7NB 3SVMA 5M9OA 1JWSD 1WVLA 1ESFA 4MN3A 5EKIA 4H13C 3SR1A 3TP5A 5EGTA 1TWFB 3D6WA 3CQZB 3T51B 4ZKCB 3KK7A 2GA4B 5IGEA 1ZKOA 2EPBA 3OIQA 2MJ8A 1K8OA 1G8ZD 3BDCA 4M8AA 1D1IA 1TS4A 1XYIA 1G291 4J1MA 2XIWA 2I07B 3S2HB 3DWQA 1NUCA 1SXTA 2RVLA 2M00A 2NN6G 2MHVA 4KN4C 1F77A 1I4RA 2V4DA 4KHVA 4ZRZA 3NTHA 1E2WA 3L3OC 3K5MA 2ID0A 1RKNA 3NWTA 4DF7A 1Z7TA 4ZUJA 1O7YA 1SYCA 2WKCA 1KLGD 2DNEA 1ML0D 1RHPA 4DAVA 3BZDB 3IFTA 1EYDA 3P1HA 4KMUC 2H4OA 2FINB 4NMZA 4ME5A 1A3UA 4XQJA 1TWHB 4DU9A 3I4LA 1HTPA 2K7VA 1TS3A 3GD7A 4IUPA 4BS9A 1R4QB 2NZ1D 4QIWB 2D62A 1CHQD 1PTOH 4DXFA 1IW7C 5E1FA 1F9SA 1H9RA 1WTPA 2C5CA 1TWCB 1XXGA 1BCPC 3K0YA 4PMBA 4IUQA 1PDQA 1S5ED 4K2KA 4ZUIA 3H94A 2B2WA 2KEDA 5C4ZA 3M3YB 3N52A 4IQZA 4FF1A 1RTNA 1IHZA 3Q24A 3G6JB 1K8MA 1GHKA 2SDFA 2KHSA 2NB0A 4C3HG 2AQ3B 1WTQA 4PV1C 1VMCA 3FRPB 5KNDA 3SDZA 3RZDB 4FVMA 1SE4A 2QKIC 2EVBA 4K5WA 1K83B 2ZT9C 4OIKA 2BDNA 3HRZC 5FLXE 1PRTD 1TU2B 2E76C 1AN8A 5IGGA 2B39A 2EYJA 4X3TA 1KDCA 2YU9B 3TP7A 1OXTA 1EYCA 1BXTA 1H9SB 2CW0D 4K5XA 1LTSD 1RF2D 3HOUB 1EEID 4ILWA 2CVRA 3NSWA 4GZYC 1CZGA 4MHEA 3X3MA 2B2TA 4K6DA 3T16A 1PTOD 4C3JB 5K5PA 2F0KA 2O5JC 3FPUB 1ENAA 1OXUA 2NWGA 3C1EA 4Q5VA 3I91A 4Q0FA 1B53A 4B9XA 5ISRA 1SNMA 4IFDH 2BE5D 3K58A 2F0EA 1F2YA 1ET9A 4ID6A 2EJMA 1AP0A 4J8QA 3PV0A 4A3KB 3R2TA 4LK1C 1MI2A 1SDFA 3M4YA 2BOSA 3GTKB 2RSNA 1PLFA 3PO2B 1LACA 1BR9A 3J7AV 4EQOA 4KY7A 4FF4A 5I9OA 1GXDC 3T13A 4DAYA 4BY1B 3M7GA 3GTGB 2JP1A 3LNNA 2F03A 1CFMA 2B2UA 1OXSC 4AYBB 1UNSA 2MPMA 3P20A 4WORA 4CGYB 1SNQA 4IN3A 5FLXL 2G9HD 3R3OA 2QILA 1VMPA 2AUKA 2K32A 2Q8TA 2XWBB 4FXDA 3HOZB 1JB3A 3DHQA 3JAME 1JOOA 2QDBA 4H44C 1JWUD 1Z47A 1B3AA 4UAIA 5K36G 1PZJD 1ZYRD 1BBXC 2E2JB 2SNMA 4PNYA 3BG3A 3MXGA 1LTGD 2Z4HA 5IODA 1IL8A 1LT5D 3TDQA 1DOMA 1DCZA 1WTVA 1B9MA 1EEFD 2N55A 5DAUA 2JA7B 3KUPA 5JOBA 1ENCA 3LX0A 4KKSA 1IYUA 2F0SA 1A2UA 1WTWA 5D3DA 1HQRD 5IT9E 1AW7A 3A55A 2ICIA 4RHRA 5IIFA 4IUNA 4DGZA 1D5MC 1AFPA 4ABNA 2IPKD 2EYMA 2VXWA 2K1BA 1H9KA 5IGBA 5D3IB 1DOLA 2TSSA 1PXUA 3KBGA 4G57A 1W6JA 3Q0AA 1G2SA 1PRTF 4L8JA 3MAQA 5ELEA 2VB2X 3QO2A 3GV6A 2B2YA 1WTRA 4IFDJ 1DOKA 3MFGA 1STYA 3SK5A 4LAAA 1O78A 2WV6D 3KLRA 3Q23A 2OXPA 2BCOA 3MVVA 3MXPA 1NSNS 4RFBA 1HHVA 1Y69U 1LLRD 3SHLA 1X32A 1PTOF 1TVXA 1GJXA 2DNCA 3JAML 1F2LA 3K7AB 2NTSA 4C56C 1F9RA 1W6KA 3J81E 2B2VC 4A3BB 2SNSA 3DEOA 3PMFA 3FMCA 4C3IG 2PYKA 2F0WA 4K5VA 1EY4A 1CM9A 3TP6A 1H9SA 1QOHA 5NUCA 4G7OC 4KKTA 1TS2A 4ZQ3A 2YYZA 5D65A 1EQVA 2K01A 5BN3A 2L4NA 1NAPA 1EY9A 2QCPX 1YNJD 5CBAE 3NQIA 3HKZB 2Z8LA 2EJGC 5C5LA 2J7ZA 2IL8A 3OMCA 3S14B 2EYPA 5C0XH 1L0YB 4HMJA 1PRTC 5CC4A 1DJRD 1PZKD 1QJOA 5JVH3 1F2ZA 3QJYA 3T53B 1D5ZC 4KD4A 3C46A 4ODGA 2CW0C 1G2TA 4ZKBB 4OIJA 3K57A 4HAEA 3BVZA 1RDPD 4NDXA 1CQVA 1I4GA 3VR3A 2R92B 4CKBA 3RUZA 4FXGC 1LT4D 4XXEA 2Q8IB 1LTBD 1PTOC 3A54A 1QCBD 3MXNA 1KDBA 5M3FB 1LTID 2F0HA 1HXYD 3SK6A 1C4QA 5I6WA 4RAUC 4LJZC 2A6HD 4WJWA 1L0XB 1EOTA 1FNUA 3NK9A 3W3AA 1QE6A 2D2CC 4RKBA 1J8IA 1UEAB 5J1ZA 1B50A 2BE5C 1SNDA 1PMRA 1JORA 3J7AF 1TIID 2RBMA 4PMCA 3J81L 4I65A 4QUCA 5C5MA 2PZUA 4HSPA 1PFMA 4IUVA 1F2MA 4DK1A 5C4XB 1A3VA 4NW2A 1FR3A 2Z4IA 3BDLA 2F0IA 3ITPA 1O80A 3NP8A 4NKLA 1LTTD 5KYIA 5M5YB 4RHSA 3GP7A 1AZQA 3PIP3 1EZ8A 4IFDI 3HOVB 3AB9A 2HDLA 3EJIA 3K5NA 3NUCA 2LFNA 1VF7A 1LT3D 2XRQD 2L55A 3HOXB 1IKMA 1SYDA 2X6LA 2A68D 2ICEC 1H9JA 3S17B 3DWAA 1Y8PB 1SYFA 4A3GB 3D31A 4RCNA 3M7NA 3PUWA 2K5QA 4CBVA 3T4AC 3VA7A 1ZYRC 3OWFA 2JYOA 4OO1H 3GTOB 1Y8NB 1JOKA 3QWNA 4OL7A 5BN5A 3R93A 2X6GA 1EWCA 3GTPB 4B08A 3DEPA 2L9HA 5KYLA 3C3LA 3FPPA 3KBXA 2FMCA 3S1RB 3KLSX 3VR4A 2A5HA 4DXGA 2L12A 1I4QA 4KY5A 1ILQA 2NVXB 4S3SA 2KOLA 2DY7A 3HEJA 1Y8OB 1AEXA 1MSGA 4A3FB 4KK7A 3S1NB 4CJ2C 4IFDG 1GUNA 3DMUA 5JEAH 2K5WA 5IGFA 2B8FA 2RA4A 1VDZA 2KEEA 5I2XA 1I6VC 5DEHA 2L5TA 2D5DA 2HQEA 3NPPA 2NVTB 4QB4A 3PUZA 4XT1B 1FNWA 1WTXA 4X3SA 1TKWB 2JXMB 3GTQB 3OWEB 3BVGA 1D6EC 2H1EA 3U9OA 3GTJB 4FO2A 2NVQB 3LWUA 1JE4A 1PFNA 3S1MB 4TRDA 3SEBA 1JQYD 2ZXRA 5EPLA 5EKLA 4YIJA 2F0JA 1KNEA 4DN4M 5FK9C 3X3NA 3NTIA 2F0QA 1RJTA 2JSOA 2F0OA 3F2UA 2F4IA 2NVYB 2A69C 2IX3A 1E2ZA 2RKSA 1XTCD 4F88A 2EJFC 1BUVT 4HCEA 1NR4A 4A3MB 3GV3A 3H91A 2PNRC 1OO9B 4H0LC 3VA5A 3VR2A 4ZAIA 1DM0B 1CI3M 1QILA 3A8IE 1DZ1A 1XX8A 2ZXPA 3GO5A 3QOJA 4ZYSA 1S5BD 1SMYD 2XRSD 2E2HB 2JEBI 1CT1D 3OMGA 1YNJC 1LO5D 3EA6A 1BCPB 1C48A 2EY1A 4KD3A 3OIPA 1X3QA 4A3EB 3QOLA 4C3HB 1A6XA 1QG7A 2XVSA 1TT2A 3DM1A 3ZYYX 2R6GA 4A3IB 2R3ZA 3MHBA 5TSSA 2SOBA 1LTRD 4KI0A 1S4ZA 3TN2A 2HUGA 4BA2I 4N9PA 1BQQT 1BO0A 3K59A 4G4KA 2B2VA 3BVMA 2WACA 3NTKA 5CV5A 5C3XA 1EIGA 1HPCA 5C0XI 3C1FA 2JA6B 5JEAJ 4DFAA 5C3WA 3MFYA 3P75A 4C1NI 1SSOA 4C1NK 2A6HC 1KNAA 2QF7A 3OW7A 3S2DB 4PQXA 5EBCA 1STHA 5EBDA 2B2WC 3BDOA 3MC0B 3AU7A 2K05A 2EYHA 2E74C 3TMEA 3J80E 5J39A 2F0MA 3IFDA 2NUCA 1EU4A 4XQNA 5FO9B 1ESRA 1FD7D 5JAVA 3D4RA 2PZTA 1YNND 2A6ED 4CKCA 1RTOA 5EKKA 3IKJA 2A73B 3QIAA 2AQ2B 3L9AX 1HCZA 4R9WA 5M5WB 5KNCA 1Y1VB 1WCMB 3S16B 1EY7A 3SK8A 1B9NA 2N88A 2E2IB 4QUFA 4BY7B 4RWSC 2FJ2A 3TSSA 4RGMA 2A68C 2K6AA 2Q8RE 4X3UA 1WTOA 3A8JE 4XTCS 5CV7A 1SE3A 3H09A 4TQUS 2K28A 4JK1C 3HS0C 4KY6A 1HA5A 1ONLA 1M8AA 4HR7B 1G91A 1NR2A 4K14A 1JC7A 1MSHA 1B1ZA 4ULLA 5KEEA 1EZ6A 4FYDA 1BDOA 3I90A 1Z6HA 5D14A 2WIIB 3D8GA 5T1IA 2ZXOA 3MA2B 3J7YW 5J22A 2K5DA 3ERQA 5C3EB 4P2CB 1SAPA 2EZVA 1SFOB 3KLSA 3P7JA 1STGA 5JPMC 4OO1I 4KJNA 4V190 2PMZB 1ET6A 3J80L 1FGBD 1TY2A 2F0UA 3QB3A 2BA0A 3BYTB 1JWMD 2F0LA 2HDMA 1EIHA 2MGSA 1CA6A 3Q6SA 1I4HA 4HSVA 1I6HB 5IT9L 3EQLC 2WINB 1DYQA 2KCNA 5CYUA 4CJ0B 2K33A 3OOCA 2Z1CA 3NQTA 4F87A 4KN7C 1X3PA 5M5XB 4UDUC 2FHTA 5I4DA 2EY5A 1EL0A 1JICA 3R8BA 4F7XA 2B63B 2K03A 3VR6A 2M2LA 2OF1A 4R8IA 1UUPA 5E3FA 1EYAA 1M4VA 2IW3A 2J0TD 3VYUA 2JE6I 1NCVA 1OXXK 1SJHD 3S9WA 4KJOA 1SNOA 4Z9CB 2IJ0A 3FVQA 4HN7A 2R7ZB 2CQAA 1CA5A 3TZDA 3T56B 1QB5D 1SBBB 2L11A 1V1PB 2PCFB 3URYA 2PW7A 4OO1G 5BN4A 1ZXTA 2EYLA 3I70A 4B9WA 1UAPA 5AFWA 3Q22A 3D6CA 4RKLA 1SJED 1U4MA 3D4DA 4DAPA 4E6IA 1HFGA 3A8KE 3E6ZX 4A93B 4R8NA 1CTMA 1SMYC 5ELCA 5F2DA 1PFBA 3SE0A 2CHBD 3HGBA 2X69A 4WFN3 1XWEA 1GUWA 1ILPA 4C3IB 2AWOA 2KCCA 5HGTA 2C9OA 3MWYW 3TBIB 2AQ1B 2TMPA 4A3JB 1SYGA 3EROA 2PQEA 1D5XC 3TZUA 1STBA 1U4LA 4F8MA 3IAYA 3HOYB 2OEOA 2Y0SB 5JEAG 2BDOA 1TQOA 3I3CA 3FKIB 1RODA 1STEA 4CKEA 4NP5A 1MD2D 4TKOB 2LY7A 4A3DB 2F1MA 5CMDA 4QMGA 3SK4A 2EDGA 2DN8A 3OHXC 1EY6A 1HA6A 2K04A 1CZWA 5ELFA 1PRTB 5FO7B 5DM63 3R2IA 4DK0A 1LTAD 1Q8IA 2KQ3A 1I4PA 3IL8A 5C4JB 1GUGA 4WRDA 4HMIA 1DONA 3UI2A 1HUMA 3K5LA 5C0XJ 3PUXA 4KV6A 4BWGB 1HFNA 1JCKB 4O1NA 2RDHA 4RCOA 3E5SA 1YNNC 4FF3A 3M4OB 2A6EC 5EQ0A 5KRUA 3I4NB 3N6RA 1Q1EA 2RDFA 1A15A 4IUTA 1PTOB 1DD2A 1J9OA 1LABA 4DNRB 4I7ZC 5IGCA 4L6TB 1I4XA 1MBYA 4DNTB 4FNFA 3MTSA 3ND9A 4RGOS 1D2BA 1Q1BA 3RZOB 2O5IC 1R4PB 3NXWA 3I8ZA 2LKVA 4DA2A 2XWJB 3WOEA 4C3JG 4OGQC 1E0BA 1HTLD 3A7AB 1SYBA 5COYA 2RDGA 5G3LD 5ELBA 5KNBA 4BBSB 5A2QE 3WOFA 3DXJC 1BF4A 2EY2A 3RD4A 4XIGS 3E0JA 4ZLTF 4HTHA 2VUMB 1RCVD 1F9PA 5CV9A 4XDXA 4RGTA 1V43A 4KTAA 3V96A 1ICWA 4FF2A 1SNCA 5CBEE 1BNZA 1Q3LA 2F3WA 3MXUA 5EPKA 5DM73 5CV6A 2F0TA 2XN9C 5CGKA 4HCSA 4XYOA 3DUZA 2WAQB 2FMMA 3NBHA 3V2TA 2NN6H 4G7HC 3CRLC 3I72A 3QG1A 3EFXD 4BBRB 1O7LA 1S5FD 4CJ1B 4JBWA 2WB1B 4IUUA 5KGUA 2F0NA 5CR3A 2KVMA 3TP8A 1DXMA 1O7ZA 1LV9A 3LWEA 1EQTA 2F0GA 1V8QA 4K8IA 1LT6D 3OPOA 2D9UA 2R61A 3NBIA 3VYSA 3NE5B 2M9VA 1V1PA 4X3KA 2VB3X 4RGNA 1TWAB 4FXKC 3VYTA 4V0BA 4K8JA 4MIUA 1EY8A 3K5OA 4IZ8A 4ZK9B 1U4PA 1U4RA 4QCLA 2A74C 3I73A 1V1OA 3V05A 2QEJC 5A2QL 3BS1A 3W2DA 3U9SA 2AWNA 5IOCA 3SXHA 2L1BA 5T1GA 1PZID 2O2LD 1GUSA 4HEDA 2E2DC 2MUYA 2O4XA 3A56A 1Q12A 5FOBB 5DNFA 5A35A 2WKDA 1OXVA 1U9RA 3K6OA 1II3A 2KJXA 4EGVA 4J6HA 1BOSA 2KECA 2PPBC 1KDAA 3VR5A 2I46A 1EY5A 3PUVA 2ENBA 5CORA 1I50B 4N9TA 3VYRA 5FKAC 4C2MB 1IYVA 5E4WC 1RD9D 3GTLB 2NYZD 1A3TA 3GQBA 1SE2A 3M85A 4PMWA 1GHJA 4KKUA 1R9TB 3G7LA 2LMCB 1QNKA 5E4XA 5G3LF 2RSOA 2IT1A 4XQQA 1HRJA 5JPNC 2WP8J 1G6ZA 2BA1A 5I2YA 1KABA 2E75C 2J4XA 1CHPD 1PYWD 3HG9A 1ZEQX 2R93B 2EXZA 3KF8A 1IW7D 2PZWA 1TS5A 5C0XG 5C44B 1B4OA 1BCPD 1EU3A 1E2VA 3CU7A 3O13A 2KA7A 2F0VA 2XSCA 1B2TA 4CHTB 4EQNA 3DWPA 2G9DA 2IX1A 2MP1A 2B2TC 1S5DD 4IALA 4OHJA 1TR5A 2IX0A 2NBFA 1SNPA 5FO8B 3CHBD 3FEWX 1T5XD 5I6YA 3PUYA 1T5EA 1A2TA 5LL6X 1FYCA 2AUJD 4IURA 5ELDA 2HCCA 2F0FA 2JA5B 5HURA 2PO4A 4M1UB 1B44D 2FFKB 2OT2A 2F3VA 1KTKA 5LHY1 3ONAB 4RH6A 5CV4A 4XYQA 4L63B 1Q90A 2B8GA 4H7BA 5K36H 3S1QB 2HCIA 4LMQD 5C6AA 4XT3B 2F0PA 2SEBD 1HUNA 2LS01 2A69D 1VCIA 2EYOA 3I4MB 4G7ZC 2EE1A 1EWHA 3OSOA 4RA8A 1AZPA 2JA8B 3GTMB 3FDTA 2IWHA 4TSSA 2B2UC 1S5CD 3RMHA 1CK1A 3H3VC 3CKIB 3WDNA 1EY0A 1HQMC 5JJZA 3D3RA 5IGDA 3HZXA 3ND8A 5EJWA 1QWYA 1SEBD 1FNVA 5JVG3 2RQXA 1GUTA 5EPJA 1GOZA 1H9MA 1IKLA 2DY8A 4K6LA 5KIXA 3H6MA 4U68A 2NTTA 1I3QB 2VNUD 3PO3B 1F9QA 4KHZA 3H0GB 3D4WA 1TWGB 1JR0D 1SYEA 3HP3A 4EVOA 1STNA 3RLFA 4U673 4BA1I 1QNUA 3S15B 2F0DA 3AMUA 3HOWB 1KAAA 1JOQA 3L7ZC 1WD0A 1TY0A 5M3MB 3A7LA 3CRKC 1VF5C 1ENFA 5C4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q1B A;  1Q90 A;  3LNN A;  3PUZ A;  2O5I C;  3OPO A;  2B8G A;  1A6X A;  2NN6 I;  3TZU A;  5K36 H;  1CFM A;  2K33 A;  1QJO A;  3NE5 B;  3GQB A;  1TKW B;  1OXT A;  1OXS C;  2JXM B;  2R6G A;  3QJY A;  3T53 B;  1VF7 A;  5JEA G;  3P20 A;  1Z7T A;  3OOC A;  3M85 A;  2JEA I;  2BDO A;  1H9S B;  4OGQ C;  1GHJ A;  4KKU A;  2A69 D;  1VCI A;  2LMC B;  2AUK A;  2CW0 C;  2DNE A;  4KN7 C;  3A7A B;  2A68 C;  2A68 D;  2K32 A;  4KI0 A;  4G7Z C;  1H9J A;  2IT1 A;  1O78 A;  3A8J E;  3IFT A;  4XTC S;  3KLR A;  3LWU A;  4KMU C;  1Y8P B;  4BA2 I;  4TKO B;  5KNB A;  1EWH A;  4H44 C;  4TQU S;  2BA1 A;  4JK1 C;  3D31 A;  4RCN A;  3M7N A;  5K36 G;  2E75 C;  3PUW A;  3DXJ C;  3VR6 A;  2F1M A;  3I4L A;  3VR3 A;  1HTP A;  3VA7 A;  1ONL A;  2K7V A;  1GUO A;  1ZYR C;  1Y69 U;  3GD7 A;  4XIG S;  4HR7 B;  4GZY C;  1HPC A;  3I73 A;  2EDG A;  2JE6 I;  4OO1 H;  2D62 A;  1GJX A;  3BG3 A;  2DN8 A;  1OXX K;  1IW7 C;  1IW7 D;  3MFY A;  1Y8N B;  2DNC A;  2Q8I B;  3WDN A;  1H9R A;  1HQM C;  2A69 C;  1DCZ A;  1BDO A;  5BN5 A;  1B9M A;  3ND8 A;  5C0X G;  1V43 A;  1Z6H A;  3U9S A;  1E2Z A;  2O5J C;  4LJZ C;  1E2V A;  3T56 B;  4DK0 A;  4KKS A;  1OXU A;  2A6H C;  2A6H D;  2EJF C;  3MXU A;  4H13 C;  1IYU A;  2QF7 A;  3OW7 A;  2KA7 A;  3FPP A;  1GUS A;  1GUT A;  2PCF B;  3VR4 A;  2PNR C;  3BDO A;  3W3A A;  3T51 B;  2D2C C;  3H94 A;  4OO1 G;  3FMC A;  4IFD H;  1H9M A;  2BE5 C;  2BE5 D;  5BN4 A;  4IQZ A;  1PMR A;  4H0L C;  1Q12 A;  1GUG A;  2E74 C;  3VR2 A;  5A35 A;  2NN6 H;  1ZKO A;  4G7H C;  3CRL C;  2EJM A;  1K8M A;  3I72 A;  3QG1 A;  1H9S A;  1GHK A;  4KHZ A;  3PUX A;  3PV0 A;  4G7O C;  1OXV A;  1K8O A;  4KKT A;  1CI3 M;  1O7L A;  4LK1 C;  3A8I E;  3M4Y A;  1Y8O B;  2YYZ A;  4PV1 C;  4DK1 A;  4JBW A;  3D4R A;  1H9K A;  1YNN C;  3A8K E;  1FR3 A;  3RLF A;  1G29 1;  3PUY A;  1T5E A;  4BA1 I;  5BN3 A;  2A6E C;  2A6E D;  4IFD G;  1FYC A;  1CTM A;  1DXM A;  1SMY C;  3N6R A;  5KND A;  2AUJ D;  3SDZ A;  2PPB C;  3SE0 A;  1Q1E A;  2JEB I;  3IKJ A;  3VR5 A;  3PUV A;  3L7Z C;  1LAC A;  1YNJ C;  3QIA A;  3HGB A;  1GUN A;  2NN6 G;  2BA0 A;  5JEA H;  2AWO A;  2KCC A;  1DD2 A;  4KN4 C;  2EVB A;  3A7L A;  1LAB A;  1HCZ A;  4DNR B;  2EJG C;  2B8F A;  4I7Z C;  5KNC A;  1VDZ A;  2ZT9 C;  1V8Q A;  2V4D A;  4DNT B;  3CRK C;  5C0X H;  4L8J A;  1I6V C;  1VF5 C;  3ND9 A;  1IYV A;  2L5T A;  2D5D A;  1E2W A;  1B9N A;  3AB9 A;  2E76 C;  1TU2 B;  3EQL C; 
#chains in the Genus database with same CATH topology
 4YWM A;  1X3G A;  2Z0S A;  4KHP L;  2KUM A;  1CQF A;  2NN6 I;  1MGS A;  1Y1W B;  2R92 H;  4O42 A;  4APV A;  4ME3 A;  1EFI D;  1C8C A;  1Y14 B;  2XNA C;  2JEA I;  2K52 A;  3MZ5 A;  5I9P A;  3NWS A;  4DR6 Q;  4QF4 A;  5IYC G;  4EQP A;  2EOT A;  2B2Y C;  4A93 H;  3PIO 3;  5AJ3 L;  3MEH A;  4NXN Q;  3BYY B;  1STA A;  5IYD G;  1D1K A;  2VW9 A;  4OWT B;  2PW5 A;  1GUO A;  1NMF A;  5LL6 S;  3C2P A;  5CV8 A;  2EYF A;  3EVQ A;  1KLU D;  4A76 A;  4FP5 D;  4C3I H;  4JI2 Q;  2EY6 A;  1VQA A;  3NHH A;  2L0C A;  4DR5 Q;  4LF4 Q;  2KHJ A;  1B7Y B;  4K2L A;  1WD1 A;  1BCP F;  4Y7N B;  4LF6 L;  3SVM A;  4DAY B;  1WFQ A;  5M9O A;  1JWS D;  2IHE A;  1ESF A;  1WVL A;  4MN3 A;  5C4X H;  4LFA L;  4HJ9 A;  5EKI A;  4H13 C;  1N8R C;  3HOY H;  3SR1 A;  3H3V H;  3TP5 A;  5EGT A;  1TWF B;  3D6W A;  3CQZ B;  3T51 B;  5IY0 A;  4ZKC B;  5JJK A;  2MO0 A;  3KK7 A;  2GA4 B;  5IGE A;  3E3X A;  1K8A C;  1ZKO A;  2EPB A;  1B3Q A;  3OIQ A;  2MJ8 A;  1T9H A;  1K8O A;  1G8Z D;  1O7I A;  4LUZ A;  3J7Z C;  3CCL A;  2CKZ B;  3BDC A;  4M8A A;  1D1I A;  2ES2 A;  2VL6 A;  1TS4 A;  2RCN A;  1XYI A;  1G29 1;  4QGU A;  4J1M A;  4IO9 A;  2XIW A;  2I07 B;  2YTV A;  4JPB W;  3S2H B;  3DWQ A;  2LXJ A;  1NUC A;  1SXT A;  4P75 A;  2RVL A;  2M00 A;  2NN6 G;  1C0A A;  2MHV A;  1B8A A;  1G6P A;  4KN4 C;  1F77 A;  4JBJ A;  1VQL A;  1I4R A;  2V4D A;  4KHV A;  4ZRZ A;  4JI8 L;  4DR6 L;  1DGS A;  3NTH A;  4JI0 L;  4A3G H;  1FJG Q;  2B3G A;  1L1O B;  1E2W A;  3L3O C;  1PH2 A;  4IPC A;  3K5M A;  1UEB A;  1VQH A;  2ID0 A;  1RKN A;  4DV2 L;  3NWT A;  4DF7 A;  1HZA A;  1Z7T A;  4ZUJ A;  1O7Y A;  3GTO H;  1SYC A;  1LUZ A;  1XNR Q;  4GLX A;  2WKC A;  1KLG D;  2DNE A;  1V9P A;  2EQS A;  1ML0 D;  1RHP A;  4DAV A;  3BZD B;  3IFT A;  1EYD A;  3P1H A;  4KMU C;  3GTP H;  2H4O A;  1BBW A;  2OQ0 A;  2FIN B;  4NMZ A;  2R7F A;  4UPA A;  4A3M G;  4ME5 A;  1A3U A;  4XQJ A;  1TWH B;  2WAQ E;  3M4O H;  4DU9 A;  4MTK A;  3I4L A;  1GD7 A;  1HTP A;  2K7V A;  5HY6 A;  1KAW A;  1TS3 A;  3Q8D A;  3GD7 A;  4IUP A;  4BS9 A;  1R4Q B;  2NZ1 D;  4QIW B;  2D62 A;  1CHQ D;  1PTO H;  4DXF A;  1IW7 C;  5E1F A;  1F9S A;  2WB1 E;  1H9R A;  1WTP A;  1ASY A;  2NVX H;  2C5C A;  2MQH A;  1QUQ A;  3G4S A;  1TWC B;  1XXG A;  1BCP C;  2Q2T A;  3K0Y A;  4MZ9 A;  4PMB A;  1Q86 C;  1NY4 A;  4A3F H;  4IUQ A;  1PDQ A;  3TS0 A;  1S5E D;  4K2K A;  4ZUI A;  3H94 A;  2B2W A;  2KED A;  5C4Z A;  3M3Y B;  3N52 A;  1N34 L;  4IQZ A;  4FF1 A;  1RTN A;  1IHZ A;  4GNX C;  3Q24 A;  3G6J B;  1K8M A;  4A3K G;  1GHK A;  3CP0 A;  2SDF A;  2KHS A;  2NB0 A;  4C3H G;  2AQ3 B;  1WTQ A;  4DK6 C;  2IY5 B;  4PV1 C;  4JI1 Q;  1YJN A;  1EUJ A;  1VMC A;  3FRP B;  3PO2 G;  5KND A;  1EQR A;  3SDZ A;  3RZD B;  4FVM A;  4LF7 Q;  3GTQ H;  1SE4 A;  2QKI C;  2VUM H;  3FHW A;  2PQA A;  2EVB A;  4K5W A;  1K83 B;  3OTO L;  2NVQ H;  2ZT9 C;  4OIK A;  2BDN A;  2RF4 A;  4BY1 G;  3HRZ C;  3S1M H;  5FLX E;  4JI7 Q;  1PRT D;  1TU2 B;  2E76 C;  2HQL A;  1HJP A;  1AN8 A;  4UP7 A;  5IGG A;  2B39 A;  2EYJ A;  4AYB G;  4X3T A;  1EOV A;  1KDC A;  2YU9 B;  3TP7 A;  1OXT A;  1EYC A;  2VQE L;  1BXT A;  4QJF A;  1H9S B;  2CW0 D;  4AH6 A;  4BBR H;  4K5X A;  3HOZ G;  2UXC L;  3CCV A;  3EIV A;  4Y52 H;  1LTS D;  2HT1 A;  1RF2 D;  3HOU B;  1EEI D;  4ILW A;  2CVR A;  3NSW A;  4GZY C;  1A63 A;  1CZG A;  4GKK Q;  4MHE A;  3X3M A;  4HJ8 A;  2B2T A;  4K6D A;  3T16 A;  2QEX A;  1VQ6 A;  1PTO D;  1NE3 A;  4C3J B;  5K5P A;  2JA7 G;  2F0K A;  4R4I A;  3U4V A;  2O5J C;  3FPU B;  1ENA A;  1OXU A;  2NWG A;  3C1E A;  4Q5V A;  3I91 A;  5GAD C;  4Q0F A;  2HIV A;  3UE0 A;  1B53 A;  3KDF B;  4J15 A;  4R4T A;  5LMN Q;  3CCU A;  1VQK A;  4B9X A;  5ISR A;  2E2H H;  4CDF C;  1SNM A;  4IFD H;  2N3S A;  3STB D;  2BE5 D;  4LF7 L;  3T1H Q;  3K58 A;  2F0E A;  1XJV A;  1F2Y A;  1ET9 A;  4DV4 Q;  4ID6 A;  2EJM A;  3QR8 A;  1AP0 A;  4J8Q A;  3PV0 A;  4A3K B;  3R2T A;  4LK1 C;  1MI2 A;  5IP7 H;  1SDF A;  3M4Y A;  4A3E H;  4JI7 L;  2BOS A;  3GTK B;  4R4O A;  1MHW C;  3ER0 A;  2RSN A;  4YHH Q;  1PLF A;  1B70 B;  3K81 C;  4GOP B;  3PO2 B;  1LAC A;  1BR9 A;  3U58 A;  3J7A V;  4EQO A;  2Z6K C;  4KY7 A;  4FF4 A;  4P73 A;  4DAM A;  5I9O A;  1GXD C;  4JOI C;  1E24 A;  3T13 A;  4DAY A;  4BY1 B;  3M7G A;  3GTG B;  1E22 A;  3KLW A;  2JP1 A;  3LNN A;  1XMQ Q;  1X3E A;  1AH9 A;  2F03 A;  1CFM A;  2B2U A;  3TEH B;  3CCJ A;  1OXS C;  4AYB B;  1UNS A;  2JA6 H;  2MPM A;  3P20 A;  4WOR A;  1XPU A;  4CGY B;  1SNQ A;  4IN3 A;  5FLX L;  2G9H D;  3R3O A;  4GS3 A;  2QIL A;  1VMP A;  2AUK A;  2VZA A;  2E5L Q;  2K32 A;  2Q8T A;  2XWB B;  2CH4 W;  4FXD A;  3IRB A;  3HOZ B;  1JB3 A;  3DHQ A;  3JAM E;  1JOO A;  1AE2 A;  2QDB A;  2L15 A;  1JWU D;  4H44 C;  1Z47 A;  1B3A A;  4UAI A;  3S2D H;  5K36 G;  4X66 L;  1N9W A;  1PZJ D;  4P74 A;  5H1S E;  4DR3 Q;  1ZYR D;  3PIP A;  5LMN L;  3PSI A;  1BBX C;  2E2J B;  2SNM A;  1I50 H;  2YTY A;  4PNY A;  2VY3 A;  3BG3 A;  3MXG A;  5IYB G;  4N8F A;  4DV6 Q;  2E8G A;  1LTG D;  2Z4H A;  5IOD A;  1IL8 A;  2IHF A;  1LT5 D;  3TDQ A;  1X9N A;  1DOM A;  3JAM i;  1DCZ A;  4DV4 L;  1WTV A;  2ZJR A;  4C2M H;  1B9M A;  1PH4 A;  1EEF D;  2N55 A;  5DAU A;  2JA7 B;  3KUP A;  1CSQ A;  5JOB A;  1ENC A;  3LX0 A;  4KKS A;  1VQ4 A;  1IYU A;  1L1O A;  4DR7 Q;  1PH1 A;  2F0S A;  4A3B G;  4WJ4 A;  1A2U A;  2N49 A;  1WTW A;  5D3D A;  1HQR D;  4B3R L;  1K73 C;  5FLM H;  5IT9 E;  1AW7 A;  3A55 A;  1GKH A;  2ICI A;  4RHR A;  5IIF A;  1R9T H;  4IUN A;  4IOA A;  4DGZ A;  1D5M C;  1AFP A;  4ABN A;  1WCM H;  3S16 H;  2IPK D;  2EYM A;  2VXW A;  2K1B A;  4GN5 A;  1H9K A;  3ULL A;  2E2I H;  5IGB A;  5D3I B;  1DOL A;  2TSS A;  1PXU A;  1XMQ L;  3PF4 A;  3KBG A;  1E1T A;  4BY7 H;  4G57 A;  1W6J A;  3Q0A A;  2ZJP A;  1G2S A;  1HNZ L;  2E5L L;  1Q81 C;  1PRT F;  4L8J A;  4LF9 L;  3MAQ A;  5ELE A;  4JCV E;  2VB2 X;  1CKO A;  3QO2 A;  3GV6 A;  2B2Y A;  1WTR A;  5JJL A;  2CCZ A;  4UHV A;  4IFD J;  1DOK A;  3MFG A;  3NEM A;  1VQJ A;  4DR3 L;  3DLL A;  1W3S A;  4DV6 L;  1STY A;  4DK3 C;  4YWK A;  1HZB A;  3SK5 A;  1QUQ B;  4LWC A;  4LAA A;  1O78 A;  2WV6 D;  3KLR A;  1N32 Q;  3TRZ A;  4IOC A;  3Q23 A;  2NZO A;  1TXY A;  2OXP A;  2ALY B;  2BCO A;  3HKZ E;  2R92 G;  1SE8 A;  3MVV A;  3MXP A;  2BH2 A;  4DR7 L;  1NSN S;  1SMX A;  4IJH A;  4RFB A;  2PI2 A;  1HHV A;  1Y69 U;  1LLR D;  4WJ3 M;  4NB3 A;  4JI3 Q;  1JJ2 A;  2JA5 H;  3SHL A;  1X32 A;  1PTO F;  1TVX A;  2G5D A;  4X64 Q;  1GJX A;  2YV5 A;  1K28 A;  2DNC A;  3JAM L;  5C3E H;  5J3B A;  1F2L A;  1J5E Q;  3K7A B;  1SRO A;  3TS2 A;  4A93 G;  2NTS A;  4C56 C;  1F9R A;  1W6K A;  3J81 E;  3M9B A;  4AIM A;  4GKJ L;  2B2V C;  4KHP Q;  1Z9F A;  4K0K L;  3AFP A;  3VDY A;  4A3B B;  2SNS A;  3DEO A;  3PMF A;  4MNO A;  3FMC A;  4C3I G;  2PYK A;  3A5Z B;  4DPG A;  4DR4 L;  2F0W A;  4K5V A;  1EY4 A;  1CM9 A;  3I4M H;  3TP6 A;  4A3C H;  1H9S A;  1QOH A;  5JJI A;  5NUC A;  1EFW A;  2UUB Q;  4G7O C;  4KKT A;  5C4X G;  1TS2 A;  4ZQ3 A;  2YYZ A;  3CCE A;  5AJ3 Q;  5D65 A;  1EQV A;  2K01 A;  5BN3 A;  4JV5 Q;  2L4N A;  1NAP A;  1EY9 A;  2QCP X;  3W1B A;  1YNJ D;  4LFC Q;  5CBA E;  3NQI A;  3HKZ B;  2CWP A;  2Z8L A;  1CUK A;  2EJG C;  5C5L A;  2J7Z A;  2XGT A;  2IL8 A;  3OMC A;  1VQP A;  3HOV G;  3S14 B;  2EYP A;  5C0X H;  1L0Y B;  4HMJ A;  1PRT C;  5CC4 A;  2B63 H;  3L2P A;  1DJR D;  1PZK D;  1QJO A;  5JVH 3;  1F2Z A;  3QJY A;  1CKN A;  3T53 B;  1D5Z C;  1HZ9 A;  4JI3 L;  4KD4 A;  3I55 A;  3C46 A;  2N8N A;  1I3Q H;  2P5Z X;  4ODG A;  4DV7 L;  2CW0 C;  1J5E L;  4EQ5 A;  1M90 C;  1G2T A;  4HJ7 A;  4OIJ A;  4ZKB B;  4A3G G;  1TWG H;  2R7Z H;  4UP8 A;  3K57 A;  4HAE A;  1EWI A;  3BVZ A;  1RDP D;  4NDX A;  1BVS A;  1CQV A;  1I4G A;  3VR3 A;  3HOW H;  1K0S A;  2R92 B;  4EX5 A;  4CKB A;  3RUZ A;  4FXG C;  5M3M H;  1LT4 D;  4XXE A;  4GOP A;  4GNX A;  1JB7 A;  4JI6 Q;  2Q8I B;  2H5X A;  1LTB D;  1PTO C;  3A54 A;  1QCB D;  3U4Z A;  3MXN A;  1KDB A;  4JI8 Q;  5M3F B;  3T1Y Q;  1LTI D;  2F0H A;  2UUB L;  4JI0 Q;  1HXY D;  3SK6 A;  1C4Q A;  5I6W A;  4RAU C;  4LJZ C;  2A6H D;  3KOJ A;  4WJW A;  1L0W A;  1L0X B;  1EOT A;  1D7Q A;  1Y1W H;  1FNU A;  2KCM A;  4JV5 L;  3NK9 A;  4DV2 Q;  3W3A A;  1QE6 A;  2D2C C;  4RKB A;  1J8I A;  1UEA B;  2WFW A;  4IPD A;  1ASZ A;  5J1Z A;  2ZM6 L;  2BE5 C;  3CCS A;  1B50 A;  1SND A;  1PMR A;  1JOR A;  4LFC L;  5GAH C;  3J7A F;  1TII D;  2RBM A;  4PMC A;  3J81 L;  4I65 A;  4IJL A;  3E9H A;  4HID A;  4QUC A;  5C5M A;  2PZU A;  4HSP A;  1PFM A;  4IUV A;  4IPH A;  2OCE A;  4A3J H;  1F2M A;  4DK1 A;  4A3F G;  5C4X B;  2HHH Q;  4HJ5 A;  1A3V A;  4NW2 A;  1FR3 A;  2Z4I A;  3BDL A;  3ICE A;  1MJC A;  2F0I A;  3ITP A;  1O80 A;  3NP8 A;  4NKL A;  1NNX A;  1LTT D;  5KYI A;  5M5Y B;  2Q2I A;  4RHS A;  3GP7 A;  1AZQ A;  3FKI H;  3PIP 3;  2AHO B;  1EZ8 A;  4IFD I;  3HOV B;  3AB9 A;  4PZ6 A;  4QIW E;  4A3D H;  4B3S Q;  2HDL A;  3AFQ A;  3EJI A;  1UE6 A;  1KIX A;  3K5N A;  2JJQ A;  3NUC A;  2LFN A;  1N34 Q;  1VF7 A;  1LT3 D;  1K3R A;  3CPF A;  2XRQ D;  2L55 A;  3HOX B;  1IKM A;  1SYD A;  4JI6 L;  2X6L A;  4ZCK A;  2A68 D;  2ICE C;  1H9J A;  3S17 B;  3DWA A;  1Y8P B;  1SYF A;  1YJ9 A;  5DLQ E;  3T1Y L;  4A3G B;  3W5O A;  3D31 A;  4RCN A;  3M7N A;  4IPG A;  3PUW A;  2K5Q A;  4CBV A;  1VQM A;  3T4A C;  3VA7 A;  2QGQ A;  2I5H A;  2AKW B;  1ZYR C;  1WJJ A;  3OWF A;  5C4J H;  2JYO A;  4OO1 H;  3GTO B;  1P16 A;  1Y8N B;  4BBR G;  1JOK A;  3QWN A;  4OL7 A;  1U5K A;  2I5M X;  4P71 A;  3OTO Q;  5BN5 A;  1PFS A;  3R93 A;  4AQY L;  2X6G A;  1EWC A;  3GTP B;  4B08 A;  3DEP A;  2L9H A;  5KYL A;  3C3L A;  2HHH L;  1PHJ A;  3FPP A;  3KBX A;  2FMC A;  1U0L A;  3I4N H;  3S1R B;  3KLS X;  3VR4 A;  4X6A H;  4POF A;  2A5H A;  2VQE Q;  4DXG A;  4DUZ Q;  4P72 A;  2L12 A;  2Z6K A;  1I4Q A;  4KY5 A;  2A1A A;  1ILQ A;  2NVX B;  4S3S A;  2KOL A;  2DY7 A;  2UUA L;  2UXC Q;  4PZ8 A;  4JOI A;  3HEJ A;  4L5Q A;  1Y8O B;  2GN5 A;  3I56 A;  3RZO H;  1TWH H;  1AEX A;  4B3S L;  1MSG A;  4A3F B;  4KK7 A;  3S1N B;  4CJ2 C;  4IFD G;  1IYJ B;  1HR0 W;  4DV0 L;  2QW7 A;  3HKS A;  3RN5 A;  1GUN A;  3DMU A;  3U50 C;  5JEA H;  2K5W A;  3F2C A;  5IGF A;  4MTN A;  2B8F A;  2RA4 A;  3RLO A;  1VDZ A;  2KEE A;  5I2X A;  1PYB A;  5IP7 G;  1I6V C;  4A3E G;  4LNQ A;  5DEH A;  2L5T A;  1QVG A;  2D5D A;  2HQE A;  3NPP A;  4BBS H;  2NVT B;  4QB4 A;  3PUZ A;  1VQB A;  4XT1 B;  1MJE A;  1FNW A;  4A3I G;  3ERS X;  4QQB X;  1WTX A;  3M3Y H;  4X3S A;  1TKW B;  2JXM B;  3GTQ B;  3OWE B;  3BVG A;  1D6E C;  2H1E A;  3U9O A;  2HIX A;  3GTJ B;  4FO2 A;  2MNA A;  1MIU A;  3RNU A;  1LTL A;  2NVQ B;  1UE7 A;  3LWU A;  1JE4 A;  1PFN A;  3S1M B;  4TRD A;  3SEB A;  1JQY D;  1N33 Q;  2ZXR A;  5EPL A;  5EKL A;  4YIJ A;  2F0J A;  1KNE A;  4DN4 M;  4DV3 L;  2JA6 G;  5FK9 C;  3X3N A;  3NTI A;  2F0Q A;  1RJT A;  3FP9 A;  2JSO A;  1E3P A;  2F0O A;  3F2U A;  1C7Y A;  4DUZ L;  2NVY B;  1K83 H;  1NMG A;  2F4I A;  2A69 C;  4DR2 Q;  3M4Q A;  2IX3 A;  4POG A;  4DV1 Q;  4DKA C;  1E2Z A;  2RKS A;  1XTC D;  1XNQ Q;  4F88 A;  2EJF C;  4DR1 Q;  3CW2 C;  1BUV T;  4HCE A;  1NR4 A;  4A3M B;  3GV3 A;  2ZTD A;  3H91 A;  2PNR C;  1OO9 B;  2K75 A;  2ASB A;  1W2B A;  4H0L C;  3VA5 A;  3VR2 A;  1M1K C;  1HZC A;  3G6E A;  3UDI A;  4ZAI A;  1L2F A;  2KCT A;  2DJF C;  1DM0 B;  1D8L A;  1CI3 M;  1QIL A;  4AYB E;  3A8I E;  4OX9 L;  3HOU H;  1DZ1 A;  4X66 Q;  1XX8 A;  5IWA L;  2ZXP A;  3GO5 A;  5FLM G;  1PH3 A;  4HJA A;  3QOJ A;  1CKN B;  3L0O A;  4ZYS A;  1XPR A;  1S5B D;  1SMY D;  1VQG A;  2XRS D;  2E2H B;  2JEB I;  1CT1 D;  3OMG A;  1YNJ C;  1LO5 D;  3TRE A;  4DNI A;  1TWA H;  4C3J H;  1PH9 A;  2RCF A;  3EA6 A;  1Y1V G;  1OTC A;  3W1G A;  1WCM G;  1PH7 A;  1BCP B;  1C48 A;  2EY1 A;  4KD3 A;  3OIP A;  1X3Q A;  4A3E B;  2NZH A;  3QOL A;  4C3H B;  1N33 L;  1A6X A;  1QG7 A;  2XVS A;  4B3R Q;  1TT2 A;  3DM1 A;  1S40 A;  1XMO L;  3ZYY X;  2D0O A;  2R6G A;  4A3I B;  2R3Z A;  4BY7 G;  4GNX B;  3KJP A;  3MHB A;  2BH8 A;  5TSS A;  2SOB A;  2ZJQ A;  4TVA B;  1LTR D;  3MXN B;  4DR2 L;  4KI0 A;  1IL2 A;  5FLX c;  1S4Z A;  3TN2 A;  2HUG A;  4BA2 I;  4N9P A;  1BQQ T;  1BO0 A;  3K59 A;  4DV1 L;  3F8T A;  4OEL B;  4G4K A;  2B2V A;  3BVM A;  1XNQ L;  4DR1 L;  2WAC A;  3CC2 A;  3NTK A;  5CV5 A;  5C3X A;  1EIG A;  1HPC A;  5C0X I;  3C1F A;  2JA6 B;  5JEA J;  4DFA A;  5C3W A;  4FDB A;  3MFY A;  2UXB L;  1IBM L;  4LF5 Q;  1X3F A;  1HNZ Q;  2DGY A;  3P75 A;  4LF9 Q;  4C1N I;  1K9M C;  3GTG H;  1SSO A;  4C1N K;  4N8X 1;  4L5R C;  2A6H C;  1KNA A;  2QF7 A;  3OW7 A;  3S2D B;  4PQX A;  5EBC A;  2LSS A;  4H02 A;  1STH A;  5EBD A;  2B2W C;  3BDO A;  2JA5 G;  1YBY A;  3PF5 A;  3MC0 B;  3AU7 A;  2K05 A;  1VQC A;  2EYH A;  5C3E G;  2E74 C;  3TME A;  2FXQ A;  3J80 E;  5J39 A;  4OWX B;  2F0M A;  3IFD A;  2NUC A;  3HOZ H;  1EU4 A;  4XQN A;  5FO9 B;  1ESR A;  1FD7 D;  5JAV A;  3D4R A;  3NEN A;  1KQS A;  2PZT A;  1YNN D;  3GTL H;  1JMC A;  2A6E D;  4CKC A;  1RTO A;  5EKK A;  2E2J H;  3IKJ A;  2A73 B;  3QIA A;  1CSP A;  3I4M G;  2AQ2 B;  2CH4 A;  4A3C G;  3L9A X;  1HCZ A;  4B3M Q;  4R9W A;  5M5W B;  5KNC A;  1NTG A;  1Y1V B;  3TQY A;  1WCM B;  3S16 B;  1EY7 A;  3SK8 A;  3ULJ A;  1B9N A;  2N88 A;  4GKJ Q;  2F4V L;  2E2I B;  4K0K Q;  2R93 H;  4QUF A;  1K8G A;  2ATW A;  4R1J A;  4DR4 Q;  4RWS C;  2FJ2 A;  4BY7 B;  3TSS A;  4RGM A;  5LMU Q;  4LF5 L;  2A68 C;  2PMZ E;  2K6A A;  2Q8R E;  4X3U A;  1YNX A;  5C44 H;  3A8J E;  1WTO A;  1IBK L;  2OTL A;  4XTC S;  5CV7 A;  1E1O A;  1SE3 A;  3H09 A;  2B63 G;  4TQU S;  2K28 A;  4JK1 C;  3HS0 C;  4KY6 A;  4BXX H;  4CDD C;  1HA5 A;  1ONL A;  2DUD A;  1KHI A;  1M8A A;  4HR7 B;  1G91 A;  1NR2 A;  2VQF Q;  4K14 A;  1JC7 A;  1MSH A;  1B1Z A;  4ULL A;  1CKM A;  3S24 A;  4O0A A;  5KEE A;  1EZ6 A;  4FYD A;  2R7Z G;  1BDO A;  3I90 A;  4LUO A;  1PV4 A;  1Z6H A;  1YZ6 A;  3JAM c;  5D14 A;  2WII B;  3D8G A;  3HOW G;  5T1I A;  2ZXO A;  5IE8 A;  3MA2 B;  3J7Y W;  5J22 A;  3DM3 A;  1K0R A;  1XPO A;  1X55 A;  1YEZ A;  2K5D A;  3ERQ A;  5C3E B;  4DV7 Q;  4B3M L;  4P2C B;  1SAP A;  2EZV A;  1SFO B;  4LW1 A;  3CAM A;  3KLS A;  3P7J A;  1STG A;  5JPM C;  1HNX Q;  4KJN A;  3RR5 A;  4OO1 I;  1KXL A;  1SRU A;  2I0Q A;  4V19 0;  3UE1 A;  3E9I A;  2PMZ B;  1ET6 A;  3S1Q H;  5IT9 c;  3J80 L;  3KF6 B;  1FGB D;  1TY2 A;  2F0U A;  3QB3 A;  2BA0 A;  3BYT B;  1Q82 C;  1JWM D;  2F0L A;  3AYH B;  2HDM A;  4CDE C;  5LMU L;  1EIH A;  3J81 i;  4DUY L;  2MGS A;  1J6Q A;  1CA6 A;  4A3J G;  3Q6S A;  1I4H A;  4HSV A;  1I6H B;  1EIF A;  5IT9 L;  3CMA A;  3EQL C;  3J81 j;  2WIN B;  3CF5 A;  1DYQ A;  2KCN A;  2JA8 H;  3GTM H;  3HOY G;  5CYU A;  4CJ0 B;  5GRO A;  2K33 A;  2Y0S G;  2ZM6 Q;  3NBH B;  3BU2 A;  3OOC A;  2VQF L;  3D0F A;  5ELN A;  2Z1C A;  3NQT A;  1N36 Q;  3AEV A;  4X62 Q;  4F87 A;  3FKI G;  4KN7 C;  4HIO A;  1X3P A;  5M5X B;  4UDU C;  1YVC A;  2FHT A;  1WTH A;  5I4D A;  4YCV A;  2EY5 A;  2A8V A;  4JI5 Q;  4A3D G;  1EL0 A;  1JIC A;  1E7Z A;  3R8B A;  4F7X A;  1FL0 A;  2B63 B;  2K03 A;  2M2L A;  2OF1 A;  3VR6 A;  4R8I A;  1UUP A;  5E3F A;  1HNW Q;  1EYA A;  3MEF A;  1M4V A;  2IW3 A;  2GVB A;  2J0T D;  3VYU A;  3BJU A;  2JE6 I;  1NCV A;  1OXX K;  1SJH D;  3S9W A;  4KJO A;  5LMN W;  1EQQ A;  1SNO A;  4Z9C B;  3PO3 H;  3J7A 5;  4NPS A;  3H0G H;  2IJ0 A;  3FVQ A;  4HN7 A;  1X65 A;  2R7Z B;  2CQA A;  1CA5 A;  3TZD A;  3T56 B;  1HR0 L;  1L1O C;  2D0P A;  1HNX L;  2K5N A;  1QB5 D;  1SBB B;  2L11 A;  1UWV A;  1V1P B;  2PCF B;  3S15 H;  5FJ8 H;  2Z9H A;  3URY A;  4A3L H;  2PW7 A;  4OO1 G;  5BN4 A;  5EAY A;  4JBK A;  1ZXT A;  2EYL A;  3I70 A;  4B9W A;  1UAP A;  5AFW A;  3Q22 A;  1VQ9 A;  1IBL Q;  3D6C A;  4RKL A;  1SJE D;  2JK8 A;  1U4M A;  3D4D A;  4DAP A;  4E6I A;  3J81 c;  1MKH A;  1HFG A;  3A8K E;  3E6Z X;  2XTI A;  4OWW B;  4A93 B;  3I4N G;  4R8N A;  1CTM A;  1SMY C;  5ELC A;  1EIY B;  5F2D A;  1PFB A;  3SE0 A;  3OYY A;  2CHB D;  4JC0 A;  3STB C;  1QVC A;  2X69 A;  3HGB A;  4WFN 3;  1XWE A;  2UUC L;  1GUW A;  2Z6B A;  1ILP A;  4C3I B;  2AWO A;  2KCC A;  5HGT A;  5IP9 H;  1N36 L;  2C9O A;  4X62 L;  3BZK A;  3LGJ A;  3MWY W;  5M3F H;  3TBI B;  4AQY Q;  2AQ1 B;  4B3T Q;  1I94 Q;  1C9O A;  4QY7 A;  2PNH A;  2TMP A;  3I7F A;  4JI5 L;  2K50 A;  1SYG A;  4A3J B;  3ERO A;  2PQE A;  3EBE A;  1D5X C;  3TZU A;  1STB A;  1U4L A;  4L5T A;  4F8M A;  1QZG A;  3IAY A;  3HOY B;  1HNW L;  2OEO A;  3CD6 A;  2Y0S B;  5JEA G;  3CXC A;  2BDO A;  1LYL A;  1TQO A;  3I3C A;  4Y7N H;  2UUA Q;  3FKI B;  4BBS G;  1ROD A;  1STE A;  4CKE A;  4NP5 A;  1MD2 D;  4TKO B;  2LY7 A;  4A3D B;  3I4O A;  1VQN A;  3F2B A;  2F1M A;  4HIM A;  5L37 A;  1TWF H;  3CQZ H;  5CMD A;  4DV0 Q;  4QMG A;  3SK4 A;  2VUM G;  3GDE A;  2EDG A;  2DN8 A;  3OHX C;  1EY6 A;  5M5Y H;  1HA6 A;  2K04 A;  3A5U A;  1CZW A;  1ICF B;  1EYG A;  1PH6 A;  2UU9 L;  1IBL L;  4LFB Q;  3I2Z A;  3JC6 6;  5ELF A;  3HOV H;  1PRT B;  2ZTE A;  4NXM Q;  2F3I A;  5FO7 B;  5DM6 3;  3R2I A;  4DK0 A;  2Q2U A;  1LTA D;  1Q8I A;  4HIK A;  2KQ3 A;  1K3B C;  1I4P A;  3S2H H;  3IL8 A;  5C4J B;  2WAQ G;  3HOX H;  2C35 B;  1GUG A;  4WRD A;  4HMI A;  1DON A;  3UI2 A;  1HUM A;  2PI2 E;  3K5L A;  5C0X J;  1VQ5 A;  3S17 H;  1PH5 A;  1AE3 A;  3PUX A;  4KV6 A;  4BWG B;  1HFN A;  4GN3 B;  2EIF A;  4B3T L;  4DV5 Q;  2WB1 G;  1HH2 P;  1JCK B;  3UDF A;  4O1N A;  1I94 L;  2RDH A;  4RCO A;  3E5S A;  1YNN C;  4NXN L;  4JBM A;  4FF3 A;  3M4O B;  2A6E C;  5EQ0 A;  5KRU A;  4DV3 Q;  3I4N B;  2I5L X;  3RN2 A;  3N6R A;  3KF8 B;  1Q1E A;  1JE5 A;  3EN2 A;  1YI2 A;  2RDF A;  1A15 A;  4JI2 L;  4A4I A;  4IUT A;  1PTO B;  1DD2 A;  1J9O A;  4DR5 L;  4LF4 L;  1LAB A;  1S3O A;  4DNR B;  4I7Z C;  5IGC A;  4L6T B;  2CFM A;  2VS1 A;  1I4X A;  1MBY A;  4DNT B;  3K80 C;  4FNF A;  3MTS A;  3ND9 A;  3CCM A;  3HOU G;  2JQO A;  5IYC H;  2ZTC A;  4RGO S;  1D2B A;  1Q1B A;  3RZO B;  5GAG C;  2Q2H A;  2O5I C;  3S1R H;  1R4P B;  3NXW A;  4R4C A;  3I8Z A;  1X56 A;  5IYD H;  2LKV A;  4DA2 A;  1Q8K A;  2XWJ B;  3ZJY C;  2RHS B;  3WOE A;  4C3J G;  4OGQ C;  1E0B A;  5BR8 Q;  4CDC C;  1HTL D;  3A7A B;  1SYB A;  5COY A;  1S72 A;  1TWC H;  2UXD Q;  2N78 A;  4LFB L;  2RDG A;  5G3L D;  1YIJ A;  5ELB A;  5KNB A;  1Q7Y C;  4NXM L;  4OX9 Q;  4BBS B;  1SR3 A;  1YIT A;  5A2Q E;  3WOF A;  3DXJ C;  5IWA Q;  1BF4 A;  3S1N H;  2EY2 A;  3AQQ A;  3RD4 A;  4XIG S;  3E0J A;  4GOP C;  3KF6 A;  4ZLT F;  4HTH A;  2VUM B;  1RCV D;  1FGU A;  1F9P A;  5CV9 A;  4XDX A;  4RGT A;  3G71 A;  1V43 A;  4KTA A;  4UY8 C;  2NVT H;  3V96 A;  1P8L A;  1ICW A;  4DV5 L;  1SNC A;  4FF2 A;  1FJG L;  5CBE E;  3KFU A;  1BNZ A;  1Q3L A;  2F3W A;  3MXU A;  5EPK A;  5DM7 3;  5CV6 A;  1H95 A;  1X6O A;  1XMO Q;  2F0T A;  2XN9 C;  5CGK A;  3RZD H;  4HCS A;  4YY3 Q;  3GTJ H;  3KJO A;  4XYO A;  2MO1 A;  4GN4 B;  1SN8 A;  1PYS B;  3DUZ A;  2WAQ B;  3CME A;  2FMM A;  1XNR L;  3NBH A;  3V2T A;  2NN6 H;  4G7H C;  3CRL C;  3I72 A;  4PG3 A;  3QG1 A;  4LUV A;  3ULP A;  3EFX D;  1GM5 A;  4JG2 A;  4BBR B;  1O7L A;  1S5F D;  4CJ1 B;  4JBW A;  2WB1 B;  4IUU A;  5KGU A;  2F0N A;  5CR3 A;  2KVM A;  1A8V A;  3TP8 A;  2YU9 H;  1DXM A;  1RIP A;  4RMF A;  1VQO A;  1XTD A;  3OW2 A;  2MFI A;  2NVY H;  1O7Z A;  2UXB Q;  1LV9 A;  1IBM Q;  3LWE A;  2KHI A;  3F2D A;  2LXK A;  3PCO B;  5BR8 L;  1EQT A;  2F0G A;  1BBU A;  1V8Q A;  5GQO A;  4K8I A;  2K5H A;  3H15 A;  2UXD L;  1LT6 D;  2JN4 A;  2K4K A;  3OPO A;  4A3M H;  1KRS A;  2D9U A;  2R61 A;  3NBI A;  3VYS A;  3A0J A;  3NE5 B;  1KD1 C;  1SLJ A;  2M9V A;  1V1P A;  4X3K A;  2VB3 X;  4RGN A;  3K0X A;  1TWA B;  1KL9 A;  4FXK C;  1JJC B;  3VYT A;  4V0B A;  4K8J A;  4MIU A;  1EY8 A;  4I7A A;  3K5O A;  4IZ8 A;  4JI1 L;  4YCW A;  1QVF A;  4ZK9 B;  2R93 G;  1U4P A;  1U4R A;  4JVZ A;  1FVI A;  4QCL A;  2A74 C;  3I73 A;  1V1O A;  4YY3 L;  4GLV B;  1RL2 A;  3V05 A;  4ALP A;  2QEJ C;  5C44 G;  5A2Q L;  3BS1 A;  2K14 A;  4A3K H;  3W2D A;  1X54 A;  3U9S A;  2AWN A;  1UE5 A;  1UE1 A;  1WOC A;  2F52 A;  4C3H H;  4BXX G;  5IOC A;  2CWA A;  3SXH A;  3GTK H;  2L1B A;  2F4V Q;  5T1G A;  1PZI D;  1BKB A;  2O2L D;  3F1Z A;  1GUS A;  4HED A;  3CC7 A;  4A3I H;  2E2D C;  2MUY A;  2O4X A;  3PO2 H;  1JT8 A;  2EXD A;  3G48 A;  3A56 A;  1Q12 A;  2CQO A;  5FOB B;  1VQI A;  3PIO A;  5DNF A;  5A35 A;  2R7D A;  3K8A A;  2RHQ B;  2WKD A;  4JI4 Q;  1IBK Q;  2QA4 A;  1OXV A;  1U9R A;  3K6O A;  1II3 A;  3PQI A;  4BY1 H;  3HFZ B;  1IZ6 A;  2KJX A;  4EGV A;  4J6H A;  1BOS A;  1VQ7 A;  4PZ7 A;  4OEM B;  2KEC A;  2PPB C;  1KDA A;  3VR5 A;  3B6Y A;  2I46 A;  1EY5 A;  3PUV A;  2ENB A;  5COR A;  4GKK L;  3SGI A;  1I50 B;  1VQ8 A;  5HGQ A;  1KC8 C;  3A74 A;  4N9T A;  5E7N A;  5FKA C;  3VYR A;  4C2M B;  5ELO A;  3CCQ A;  4YWL A;  1IYV A;  2DJG C;  5E4W C;  1RD9 D;  3GTL B;  2NYZ D;  1NJI C;  4JW0 A;  1A3T A;  3GQB A;  1SE2 A;  1LM0 A;  4LF8 Q;  4O2D A;  3J80 i;  3T1H L;  3M85 A;  1VQD A;  2KEN A;  4PMW A;  1GHJ A;  1IXR A;  4KKU A;  1R9T B;  3G7L A;  2LMC B;  1QNK A;  5E4X A;  5G3L F;  3UDG A;  2RSO A;  2IT1 A;  4XQQ A;  1HRJ A;  5JPN C;  2HD3 A;  2JA7 H;  2WP8 J;  1G6Z A;  1G51 A;  2JA8 G;  2BA1 A;  5I2Y A;  1KAB A;  2E75 C;  2J4X A;  4YHH L;  1CHP D;  1PYW D;  3HG9 A;  1ZEQ X;  2R93 B;  4OON A;  2EXZ A;  3KF8 A;  1IW7 D;  1PA6 A;  2KBN A;  1TS5 A;  1VQF A;  2PZW A;  5M5W H;  1Y1V H;  4JI4 L;  5C0X G;  4DUY Q;  3NEL A;  5C44 B;  1B4O A;  1BCP D;  1EU3 A;  2JA9 A;  1E2V A;  3CU7 A;  3O13 A;  1YHB A;  2KA7 A;  2F0V A;  2XSC A;  4YCU A;  1B2T A;  4CHT B;  2OQK A;  3HKZ G;  4EQN A;  3DWP A;  2G9D A;  2IX1 A;  2MP1 A;  2B2T C;  3PO3 G;  1S5D D;  4IAL A;  3H0G G;  4OHJ A;  1TR5 A;  2IX0 A;  2NBF A;  3E0E A;  3H3V I;  1SNP A;  5FO8 B;  3CHB D;  3FEW X;  3WWV A;  1T5X D;  5I6Y A;  4QL5 A;  1WYD A;  3PUY A;  1T5E A;  5FJ8 G;  1A2T A;  4A3L G;  3KYH C;  5LL6 X;  4UP9 A;  1FYC A;  2AUJ D;  4IUR A;  5ELD A;  2K5V A;  4X65 Q;  5M3M G;  1KRT A;  2HCC A;  4LF8 L;  1PVO A;  2F0F A;  2JA5 B;  3J80 c;  5HUR A;  1JJG A;  2PO4 A;  4M1U B;  1WI5 A;  1B44 D;  1QZH A;  2FFK B;  2OT2 A;  2F3V A;  3CC4 A;  1KTK A;  5LHY 1;  3ONA B;  4RH6 A;  5CV4 A;  4XYQ A;  4L63 B;  1HR0 Q;  1Q90 A;  2B29 A;  2B8G A;  4H7B A;  4KLK A;  1Y1W G;  1GO3 E;  5K36 H;  3S1Q B;  2HCI A;  4LMQ D;  2YTX A;  5C6A A;  4XT3 B;  2F0P A;  2SEB D;  2AMC B;  4JYA Q;  1HUN A;  5IP9 G;  2LS0 1;  3CPW A;  5IYB H;  2A69 D;  1VCI A;  2EYO A;  5M3F G;  3I4M B;  4G7Z C;  3K7A H;  2EE1 A;  3BZC A;  1SFO H;  4GLA C;  1YHA A;  1EWH A;  3OSO A;  4RA8 A;  1AZP A;  2JA8 B;  3GTM B;  3FDT A;  2V1C C;  1VQE A;  2IWH A;  4TSS A;  2B2U C;  4A3B H;  1S5C D;  3RMH A;  3PGZ A;  1CK1 A;  1GVP A;  3H3V C;  1YJW A;  2PQA B;  2UUC Q;  3CKI B;  3WDN A;  1Q46 A;  1EY0 A;  1HQM C;  5JJZ A;  3D3R A;  5IGD A;  3HZX A;  3ND8 A;  1I6H H;  1A0I A;  5EJW A;  1QWY A;  1SEB D;  1FNV A;  5GAE C;  3UDX A;  2OTJ A;  5JVG 3;  2RQX A;  1GUT A;  5EPJ A;  1YHQ A;  1GOZ A;  4X65 L;  1H9M A;  1IKL A;  2DY8 A;  1PH8 A;  4K6L A;  5KIX A;  3H6M A;  2A19 A;  3M4P A;  2NTT A;  2QDL A;  4U68 A;  1I3Q B;  5M5X H;  4LF6 Q;  2VNU D;  2OWO A;  4R4Q A;  3PO3 B;  1F9Q A;  4KHZ A;  3S14 H;  3H0G B;  3D4W A;  1N32 L;  1TWG B;  4A75 A;  1JR0 D;  4LFA Q;  1SYE A;  3HP3 A;  4EVO A;  2Y0S E;  1STN A;  3RLF A;  4U67 3;  4BA1 I;  3RLN A;  1QNU A;  3S15 B;  2F0D A;  3AMU A;  3HOW B;  3HOX G;  2GVA A;  1KAA A;  1JOQ A;  3KDF A;  4L5S A;  3L7Z C;  1WD0 A;  4X64 L;  1TY0 A;  5M3M B;  4JYA L;  1A62 A;  3A7L A;  4RG1 A;  3CCR A;  2UU9 Q;  3CRK C;  1V1Q A;  4OXP A;  3K7U C;  1VF5 C;  1ENF A;  1VS0 A;  1I5F A;  1NBW A;  5C4H A; 
#chains in the Genus database with same CATH homology
 2KUM A;  1CQF A;  2NN6 I;  1MGS A;  1Y1W B;  4O42 A;  1EFI D;  1C8C A;  2XNA C;  2JEA I;  3MZ5 A;  5I9P A;  3NWS A;  4QF4 A;  4EQP A;  2EOT A;  2B2Y C;  3PIO 3;  3MEH A;  3BYY B;  1STA A;  1D1K A;  2PW5 A;  1GUO A;  5LL6 S;  3C2P A;  5CV8 A;  2EYF A;  3EVQ A;  1KLU D;  4FP5 D;  2EY6 A;  3NHH A;  2L0C A;  4K2L A;  1WD1 A;  1BCP F;  4Y7N B;  3SVM A;  5M9O A;  1JWS D;  1WVL A;  1ESF A;  4MN3 A;  5EKI A;  4H13 C;  3SR1 A;  3TP5 A;  5EGT A;  1TWF B;  3D6W A;  3CQZ B;  3T51 B;  4ZKC B;  3KK7 A;  2GA4 B;  5IGE A;  1ZKO A;  2EPB A;  3OIQ A;  2MJ8 A;  1K8O A;  1G8Z D;  3BDC A;  4M8A A;  1D1I A;  1TS4 A;  1XYI A;  1G29 1;  4J1M A;  2XIW A;  2I07 B;  3S2H B;  3DWQ A;  1NUC A;  1SXT A;  2RVL A;  2M00 A;  2NN6 G;  2MHV A;  4KN4 C;  1F77 A;  1I4R A;  2V4D A;  4KHV A;  4ZRZ A;  3NTH A;  1E2W A;  3L3O C;  3K5M A;  2ID0 A;  1RKN A;  3NWT A;  4DF7 A;  1Z7T A;  4ZUJ A;  1O7Y A;  1SYC A;  2WKC A;  1KLG D;  2DNE A;  1ML0 D;  1RHP A;  4DAV A;  3BZD B;  3IFT A;  1EYD A;  3P1H A;  4KMU C;  2H4O A;  2FIN B;  4NMZ A;  4ME5 A;  1A3U A;  4XQJ A;  1TWH B;  4DU9 A;  3I4L A;  1HTP A;  2K7V A;  1TS3 A;  3GD7 A;  4IUP A;  4BS9 A;  1R4Q B;  2NZ1 D;  4QIW B;  2D62 A;  1CHQ D;  1PTO H;  4DXF A;  1IW7 C;  5E1F A;  1F9S A;  1H9R A;  1WTP A;  2C5C A;  1TWC B;  1XXG A;  1BCP C;  3K0Y A;  4PMB A;  4IUQ A;  1PDQ A;  1S5E D;  4K2K A;  4ZUI A;  3H94 A;  2B2W A;  2KED A;  5C4Z A;  3M3Y B;  3N52 A;  4IQZ A;  4FF1 A;  1RTN A;  1IHZ A;  3Q24 A;  3G6J B;  1K8M A;  1GHK A;  2SDF A;  2KHS A;  2NB0 A;  4C3H G;  2AQ3 B;  1WTQ A;  4PV1 C;  1VMC A;  3FRP B;  5KND A;  3SDZ A;  3RZD B;  4FVM A;  1SE4 A;  2QKI C;  2EVB A;  4K5W A;  1K83 B;  2ZT9 C;  4OIK A;  2BDN A;  3HRZ C;  5FLX E;  1PRT D;  1TU2 B;  2E76 C;  1AN8 A;  5IGG A;  2B39 A;  2EYJ A;  4X3T A;  1KDC A;  2YU9 B;  3TP7 A;  1OXT A;  1EYC A;  1BXT A;  1H9S B;  2CW0 D;  4K5X A;  1LTS D;  1RF2 D;  3HOU B;  1EEI D;  4ILW A;  2CVR A;  3NSW A;  4GZY C;  1CZG A;  4MHE A;  3X3M A;  2B2T A;  4K6D A;  3T16 A;  1PTO D;  4C3J B;  5K5P A;  2F0K A;  2O5J C;  3FPU B;  1ENA A;  1OXU A;  2NWG A;  3C1E A;  4Q5V A;  3I91 A;  4Q0F A;  1B53 A;  4B9X A;  5ISR A;  1SNM A;  4IFD H;  2BE5 D;  3K58 A;  2F0E A;  1F2Y A;  1ET9 A;  4ID6 A;  2EJM A;  1AP0 A;  4J8Q A;  3PV0 A;  4A3K B;  3R2T A;  4LK1 C;  1MI2 A;  1SDF A;  3M4Y A;  2BOS A;  3GTK B;  2RSN A;  1PLF A;  3PO2 B;  1LAC A;  1BR9 A;  3J7A V;  4EQO A;  4KY7 A;  4FF4 A;  5I9O A;  1GXD C;  3T13 A;  4DAY A;  4BY1 B;  3M7G A;  3GTG B;  2JP1 A;  3LNN A;  2F03 A;  1CFM A;  2B2U A;  1OXS C;  4AYB B;  1UNS A;  2MPM A;  3P20 A;  4WOR A;  4CGY B;  1SNQ A;  4IN3 A;  5FLX L;  2G9H D;  3R3O A;  2QIL A;  1VMP A;  2AUK A;  2K32 A;  2Q8T A;  2XWB B;  4FXD A;  3HOZ B;  1JB3 A;  3DHQ A;  3JAM E;  1JOO A;  2QDB A;  4H44 C;  1JWU D;  1Z47 A;  1B3A A;  4UAI A;  5K36 G;  1PZJ D;  1ZYR D;  1BBX C;  2E2J B;  2SNM A;  4PNY A;  3BG3 A;  3MXG A;  1LTG D;  2Z4H A;  5IOD A;  1IL8 A;  1LT5 D;  3TDQ A;  1DOM A;  1DCZ A;  1WTV A;  1B9M A;  1EEF D;  2N55 A;  5DAU A;  2JA7 B;  3KUP A;  5JOB A;  1ENC A;  3LX0 A;  4KKS A;  1IYU A;  2F0S A;  1A2U A;  1WTW A;  5D3D A;  1HQR D;  5IT9 E;  1AW7 A;  3A55 A;  2ICI A;  4RHR A;  5IIF A;  4IUN A;  4DGZ A;  1D5M C;  1AFP A;  4ABN A;  2IPK D;  2EYM A;  2VXW A;  2K1B A;  1H9K A;  5IGB A;  5D3I B;  1DOL A;  2TSS A;  1PXU A;  3KBG A;  4G57 A;  1W6J A;  3Q0A A;  1G2S A;  1PRT F;  4L8J A;  3MAQ A;  5ELE A;  2VB2 X;  3QO2 A;  3GV6 A;  2B2Y A;  1WTR A;  4IFD J;  1DOK A;  3MFG A;  1STY A;  3SK5 A;  4LAA A;  1O78 A;  2WV6 D;  3KLR A;  3Q23 A;  2OXP A;  2BCO A;  3MVV A;  3MXP A;  1NSN S;  4RFB A;  1HHV A;  1Y69 U;  1LLR D;  3SHL A;  1X32 A;  1PTO F;  1TVX A;  1GJX A;  2DNC A;  3JAM L;  1F2L A;  3K7A B;  2NTS A;  4C56 C;  1F9R A;  1W6K A;  3J81 E;  2B2V C;  4A3B B;  2SNS A;  3DEO A;  3PMF A;  3FMC A;  4C3I G;  2PYK A;  2F0W A;  4K5V A;  1EY4 A;  1CM9 A;  3TP6 A;  1H9S A;  1QOH A;  5NUC A;  4G7O C;  4KKT A;  1TS2 A;  4ZQ3 A;  2YYZ A;  5D65 A;  1EQV A;  2K01 A;  5BN3 A;  2L4N A;  1NAP A;  1EY9 A;  2QCP X;  1YNJ D;  5CBA E;  3NQI A;  3HKZ B;  2Z8L A;  2EJG C;  5C5L A;  2J7Z A;  2IL8 A;  3OMC A;  3S14 B;  2EYP A;  5C0X H;  1L0Y B;  4HMJ A;  1PRT C;  5CC4 A;  1DJR D;  1PZK D;  1QJO A;  5JVH 3;  1F2Z A;  3QJY A;  3T53 B;  1D5Z C;  4KD4 A;  3C46 A;  4ODG A;  2CW0 C;  1G2T A;  4ZKB B;  4OIJ A;  3K57 A;  4HAE A;  3BVZ A;  1RDP D;  4NDX A;  1CQV A;  1I4G A;  3VR3 A;  2R92 B;  4CKB A;  3RUZ A;  4FXG C;  1LT4 D;  4XXE A;  2Q8I B;  1LTB D;  1PTO C;  3A54 A;  1QCB D;  3MXN A;  1KDB A;  5M3F B;  1LTI D;  2F0H A;  1HXY D;  3SK6 A;  1C4Q A;  5I6W A;  4RAU C;  4LJZ C;  2A6H D;  4WJW A;  1L0X B;  1EOT A;  1FNU A;  3NK9 A;  3W3A A;  1QE6 A;  2D2C C;  4RKB A;  1J8I A;  1UEA B;  5J1Z A;  1B50 A;  2BE5 C;  1SND A;  1PMR A;  1JOR A;  3J7A F;  1TII D;  2RBM A;  4PMC A;  3J81 L;  4I65 A;  4QUC A;  5C5M A;  2PZU A;  4HSP A;  1PFM A;  4IUV A;  1F2M A;  4DK1 A;  5C4X B;  1A3V A;  4NW2 A;  1FR3 A;  2Z4I A;  3BDL A;  2F0I A;  3ITP A;  1O80 A;  3NP8 A;  4NKL A;  1LTT D;  5KYI A;  5M5Y B;  4RHS A;  3GP7 A;  1AZQ A;  3PIP 3;  1EZ8 A;  4IFD I;  3HOV B;  3AB9 A;  2HDL A;  3EJI A;  3K5N A;  3NUC A;  2LFN A;  1VF7 A;  1LT3 D;  2XRQ D;  2L55 A;  3HOX B;  1IKM A;  1SYD A;  2X6L A;  2A68 D;  2ICE C;  1H9J A;  3S17 B;  3DWA A;  1Y8P B;  1SYF A;  4A3G B;  3D31 A;  4RCN A;  3M7N A;  3PUW A;  2K5Q A;  4CBV A;  3T4A C;  3VA7 A;  1ZYR C;  3OWF A;  2JYO A;  4OO1 H;  3GTO B;  1Y8N B;  1JOK A;  3QWN A;  4OL7 A;  5BN5 A;  3R93 A;  2X6G A;  1EWC A;  3GTP B;  4B08 A;  3DEP A;  2L9H A;  5KYL A;  3C3L A;  3FPP A;  3KBX A;  2FMC A;  3S1R B;  3KLS X;  3VR4 A;  2A5H A;  4DXG A;  2L12 A;  1I4Q A;  4KY5 A;  1ILQ A;  2NVX B;  4S3S A;  2KOL A;  2DY7 A;  3HEJ A;  1Y8O B;  1AEX A;  1MSG A;  4A3F B;  4KK7 A;  3S1N B;  4CJ2 C;  4IFD G;  1GUN A;  3DMU A;  5JEA H;  2K5W A;  5IGF A;  2B8F A;  2RA4 A;  1VDZ A;  2KEE A;  5I2X A;  1I6V C;  5DEH A;  2L5T A;  2D5D A;  2HQE A;  3NPP A;  2NVT B;  4QB4 A;  3PUZ A;  4XT1 B;  1FNW A;  1WTX A;  4X3S A;  1TKW B;  2JXM B;  3GTQ B;  3OWE B;  3BVG A;  1D6E C;  2H1E A;  3U9O A;  3GTJ B;  4FO2 A;  2NVQ B;  3LWU A;  1JE4 A;  1PFN A;  3S1M B;  4TRD A;  3SEB A;  1JQY D;  2ZXR A;  5EPL A;  5EKL A;  4YIJ A;  2F0J A;  1KNE A;  4DN4 M;  5FK9 C;  3X3N A;  3NTI A;  2F0Q A;  1RJT A;  2JSO A;  2F0O A;  3F2U A;  2F4I A;  2NVY B;  2A69 C;  2IX3 A;  1E2Z A;  2RKS A;  1XTC D;  4F88 A;  2EJF C;  1BUV T;  4HCE A;  1NR4 A;  4A3M B;  3GV3 A;  3H91 A;  2PNR C;  1OO9 B;  4H0L C;  3VA5 A;  3VR2 A;  4ZAI A;  1DM0 B;  1CI3 M;  1QIL A;  3A8I E;  1DZ1 A;  1XX8 A;  2ZXP A;  3GO5 A;  3QOJ A;  4ZYS A;  1S5B D;  1SMY D;  2XRS D;  2E2H B;  2JEB I;  1CT1 D;  3OMG A;  1YNJ C;  1LO5 D;  3EA6 A;  1BCP B;  1C48 A;  2EY1 A;  4KD3 A;  3OIP A;  1X3Q A;  4A3E B;  3QOL A;  4C3H B;  1A6X A;  1QG7 A;  2XVS A;  1TT2 A;  3DM1 A;  3ZYY X;  2R6G A;  4A3I B;  2R3Z A;  3MHB A;  5TSS A;  2SOB A;  1LTR D;  4KI0 A;  1S4Z A;  3TN2 A;  2HUG A;  4BA2 I;  4N9P A;  1BQQ T;  1BO0 A;  3K59 A;  4G4K A;  2B2V A;  3BVM A;  2WAC A;  3NTK A;  5CV5 A;  5C3X A;  1EIG A;  1HPC A;  5C0X I;  3C1F A;  2JA6 B;  5JEA J;  4DFA A;  5C3W A;  3MFY A;  3P75 A;  4C1N I;  1SSO A;  4C1N K;  2A6H C;  1KNA A;  2QF7 A;  3OW7 A;  3S2D B;  4PQX A;  5EBC A;  1STH A;  5EBD A;  2B2W C;  3BDO A;  3MC0 B;  3AU7 A;  2K05 A;  2EYH A;  2E74 C;  3TME A;  3J80 E;  5J39 A;  2F0M A;  3IFD A;  2NUC A;  1EU4 A;  4XQN A;  5FO9 B;  1ESR A;  1FD7 D;  5JAV A;  3D4R A;  2PZT A;  1YNN D;  2A6E D;  4CKC A;  1RTO A;  5EKK A;  3IKJ A;  2A73 B;  3QIA A;  2AQ2 B;  3L9A X;  1HCZ A;  4R9W A;  5M5W B;  5KNC A;  1Y1V B;  1WCM B;  3S16 B;  1EY7 A;  3SK8 A;  1B9N A;  2N88 A;  2E2I B;  4QUF A;  4BY7 B;  4RWS C;  2FJ2 A;  3TSS A;  4RGM A;  2A68 C;  2K6A A;  2Q8R E;  4X3U A;  1WTO A;  3A8J E;  4XTC S;  5CV7 A;  1SE3 A;  3H09 A;  4TQU S;  2K28 A;  4JK1 C;  3HS0 C;  4KY6 A;  1HA5 A;  1ONL A;  1M8A A;  4HR7 B;  1G91 A;  1NR2 A;  4K14 A;  1JC7 A;  1MSH A;  1B1Z A;  4ULL A;  5KEE A;  1EZ6 A;  4FYD A;  1BDO A;  3I90 A;  1Z6H A;  5D14 A;  2WII B;  3D8G A;  5T1I A;  2ZXO A;  3MA2 B;  3J7Y W;  5J22 A;  2K5D A;  3ERQ A;  5C3E B;  4P2C B;  1SAP A;  2EZV A;  1SFO B;  3KLS A;  3P7J A;  1STG A;  5JPM C;  4OO1 I;  4KJN A;  4V19 0;  2PMZ B;  1ET6 A;  3J80 L;  1FGB D;  1TY2 A;  2F0U A;  3QB3 A;  2BA0 A;  3BYT B;  1JWM D;  2F0L A;  2HDM A;  1EIH A;  2MGS A;  1CA6 A;  3Q6S A;  1I4H A;  4HSV A;  1I6H B;  5IT9 L;  3EQL C;  2WIN B;  1DYQ A;  2KCN A;  5CYU A;  4CJ0 B;  2K33 A;  3OOC A;  2Z1C A;  3NQT A;  4F87 A;  4KN7 C;  1X3P A;  5M5X B;  4UDU C;  2FHT A;  5I4D A;  2EY5 A;  1EL0 A;  1JIC A;  3R8B A;  4F7X A;  2B63 B;  2K03 A;  3VR6 A;  2M2L A;  2OF1 A;  4R8I A;  1UUP A;  5E3F A;  1EYA A;  1M4V A;  2IW3 A;  2J0T D;  3VYU A;  2JE6 I;  1NCV A;  1OXX K;  1SJH D;  3S9W A;  4KJO A;  1SNO A;  4Z9C B;  2IJ0 A;  3FVQ A;  4HN7 A;  2R7Z B;  2CQA A;  1CA5 A;  3TZD A;  3T56 B;  1QB5 D;  1SBB B;  2L11 A;  1V1P B;  2PCF B;  3URY A;  2PW7 A;  4OO1 G;  5BN4 A;  1ZXT A;  2EYL A;  3I70 A;  4B9W A;  1UAP A;  5AFW A;  3Q22 A;  3D6C A;  4RKL A;  1SJE D;  1U4M A;  3D4D A;  4DAP A;  4E6I A;  1HFG A;  3A8K E;  3E6Z X;  4A93 B;  4R8N A;  1CTM A;  1SMY C;  5ELC A;  5F2D A;  1PFB A;  3SE0 A;  2CHB D;  3HGB A;  2X69 A;  4WFN 3;  1XWE A;  1GUW A;  1ILP A;  4C3I B;  2AWO A;  2KCC A;  5HGT A;  2C9O A;  3MWY W;  3TBI B;  2AQ1 B;  2TMP A;  4A3J B;  1SYG A;  3ERO A;  2PQE A;  1D5X C;  3TZU A;  1STB A;  1U4L A;  4F8M A;  3IAY A;  3HOY B;  2OEO A;  2Y0S B;  5JEA G;  2BDO A;  1TQO A;  3I3C A;  3FKI B;  1ROD A;  1STE A;  4CKE A;  4NP5 A;  1MD2 D;  4TKO B;  2LY7 A;  4A3D B;  2F1M A;  5CMD A;  4QMG A;  3SK4 A;  2EDG A;  2DN8 A;  3OHX C;  1EY6 A;  1HA6 A;  2K04 A;  1CZW A;  5ELF A;  1PRT B;  5FO7 B;  5DM6 3;  3R2I A;  4DK0 A;  1LTA D;  1Q8I A;  2KQ3 A;  1I4P A;  3IL8 A;  5C4J B;  1GUG A;  4WRD A;  4HMI A;  1DON A;  3UI2 A;  1HUM A;  3K5L A;  5C0X J;  3PUX A;  4KV6 A;  4BWG B;  1HFN A;  1JCK B;  4O1N A;  2RDH A;  4RCO A;  3E5S A;  1YNN C;  4FF3 A;  3M4O B;  2A6E C;  5EQ0 A;  5KRU A;  3I4N B;  3N6R A;  1Q1E A;  2RDF A;  1A15 A;  4IUT A;  1PTO B;  1DD2 A;  1J9O A;  1LAB A;  4DNR B;  4I7Z C;  5IGC A;  4L6T B;  1I4X A;  1MBY A;  4DNT B;  4FNF A;  3MTS A;  3ND9 A;  4RGO S;  1D2B A;  1Q1B A;  3RZO B;  2O5I C;  1R4P B;  3NXW A;  3I8Z A;  2LKV A;  4DA2 A;  2XWJ B;  3WOE A;  4C3J G;  4OGQ C;  1E0B A;  1HTL D;  3A7A B;  1SYB A;  5COY A;  2RDG A;  5G3L D;  5ELB A;  5KNB A;  4BBS B;  5A2Q E;  3WOF A;  3DXJ C;  1BF4 A;  2EY2 A;  3RD4 A;  4XIG S;  3E0J A;  4ZLT F;  4HTH A;  2VUM B;  1RCV D;  1F9P A;  5CV9 A;  4XDX A;  4RGT A;  1V43 A;  4KTA A;  3V96 A;  1ICW A;  4FF2 A;  1SNC A;  5CBE E;  1BNZ A;  1Q3L A;  2F3W A;  3MXU A;  5EPK A;  5DM7 3;  5CV6 A;  2F0T A;  2XN9 C;  5CGK A;  4HCS A;  4XYO A;  3DUZ A;  2WAQ B;  2FMM A;  3NBH A;  3V2T A;  2NN6 H;  4G7H C;  3CRL C;  3I72 A;  3QG1 A;  3EFX D;  4BBR B;  1O7L A;  1S5F D;  4CJ1 B;  4JBW A;  2WB1 B;  4IUU A;  5KGU A;  2F0N A;  5CR3 A;  2KVM A;  3TP8 A;  1DXM A;  1O7Z A;  1LV9 A;  3LWE A;  1EQT A;  2F0G A;  1V8Q A;  4K8I A;  1LT6 D;  3OPO A;  2D9U A;  2R61 A;  3NBI A;  3VYS A;  3NE5 B;  2M9V A;  1V1P A;  4X3K A;  2VB3 X;  4RGN A;  1TWA B;  4FXK C;  3VYT A;  4V0B A;  4K8J A;  4MIU A;  1EY8 A;  3K5O A;  4IZ8 A;  4ZK9 B;  1U4P A;  1U4R A;  4QCL A;  2A74 C;  3I73 A;  1V1O A;  3V05 A;  2QEJ C;  5A2Q L;  3BS1 A;  3W2D A;  3U9S A;  2AWN A;  5IOC A;  3SXH A;  2L1B A;  5T1G A;  1PZI D;  2O2L D;  1GUS A;  4HED A;  2E2D C;  2MUY A;  2O4X A;  3A56 A;  1Q12 A;  5FOB B;  5DNF A;  5A35 A;  2WKD A;  1OXV A;  1U9R A;  3K6O A;  1II3 A;  2KJX A;  4EGV A;  4J6H A;  1BOS A;  2KEC A;  2PPB C;  1KDA A;  3VR5 A;  2I46 A;  1EY5 A;  3PUV A;  2ENB A;  5COR A;  1I50 B;  4N9T A;  3VYR A;  5FKA C;  4C2M B;  1IYV A;  5E4W C;  1RD9 D;  3GTL B;  2NYZ D;  1A3T A;  3GQB A;  1SE2 A;  3M85 A;  4PMW A;  1GHJ A;  4KKU A;  1R9T B;  3G7L A;  2LMC B;  1QNK A;  5E4X A;  5G3L F;  2RSO A;  2IT1 A;  4XQQ A;  1HRJ A;  5JPN C;  2WP8 J;  1G6Z A;  2BA1 A;  5I2Y A;  1KAB A;  2E75 C;  2J4X A;  1CHP D;  1PYW D;  3HG9 A;  1ZEQ X;  2R93 B;  2EXZ A;  3KF8 A;  1IW7 D;  2PZW A;  1TS5 A;  5C0X G;  5C44 B;  1B4O A;  1BCP D;  1EU3 A;  1E2V A;  3CU7 A;  3O13 A;  2KA7 A;  2F0V A;  2XSC A;  1B2T A;  4CHT B;  4EQN A;  3DWP A;  2G9D A;  2IX1 A;  2MP1 A;  2B2T C;  1S5D D;  4IAL A;  4OHJ A;  1TR5 A;  2IX0 A;  2NBF A;  1SNP A;  5FO8 B;  3CHB D;  3FEW X;  1T5X D;  5I6Y A;  3PUY A;  1T5E A;  1A2T A;  5LL6 X;  1FYC A;  2AUJ D;  4IUR A;  5ELD A;  2HCC A;  2F0F A;  2JA5 B;  5HUR A;  2PO4 A;  4M1U B;  1B44 D;  2FFK B;  2OT2 A;  2F3V A;  1KTK A;  5LHY 1;  3ONA B;  4RH6 A;  5CV4 A;  4XYQ A;  4L63 B;  1Q90 A;  2B8G A;  4H7B A;  5K36 H;  3S1Q B;  2HCI A;  4LMQ D;  5C6A A;  4XT3 B;  2F0P A;  2SEB D;  1HUN A;  2LS0 1;  2A69 D;  1VCI A;  2EYO A;  3I4M B;  4G7Z C;  2EE1 A;  1EWH A;  3OSO A;  4RA8 A;  1AZP A;  2JA8 B;  3GTM B;  3FDT A;  2IWH A;  4TSS A;  2B2U C;  1S5C D;  3RMH A;  1CK1 A;  3H3V C;  3CKI B;  3WDN A;  1EY0 A;  1HQM C;  5JJZ A;  3D3R A;  5IGD A;  3HZX A;  3ND8 A;  5EJW A;  1QWY A;  1SEB D;  1FNV A;  5JVG 3;  2RQX A;  1GUT A;  5EPJ A;  1GOZ A;  1H9M A;  1IKL A;  2DY8 A;  4K6L A;  5KIX A;  3H6M A;  4U68 A;  2NTT A;  1I3Q B;  2VNU D;  3PO3 B;  1F9Q A;  4KHZ A;  3H0G B;  3D4W A;  1TWG B;  1JR0 D;  1SYE A;  3HP3 A;  4EVO A;  1STN A;  3RLF A;  4U67 3;  4BA1 I;  1QNU A;  3S15 B;  2F0D A;  3AMU A;  3HOW B;  1KAA A;  1JOQ A;  3L7Z C;  1WD0 A;  1TY0 A;  5M3M B;  3A7L A;  3CRK C;  1VF5 C;  1ENF A;  5C4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...