1K8OA

Solution structure of the lipoic acid-bearing domain of the e2 component of human, mitochondrial branched-chain alpha-ketoacid dehydrogenase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
87
structure length
87
Chain Sequence
MGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords E2 component of Branched-Chain alpha-Ketoacid Dehydrogenase
publication title Solution structure and dynamics of the lipoic acid-bearing domain of human mitochondrial branched-chain alpha-keto acid dehydrogenase complex
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 87
sequence length 87
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1k8oA00
4G7ZC 1E2WA 4IFDG 4DNTB 5K36G 1OXTA 4HR7B 4PV1C 1OXSC 3T56B 1TKWB 3VR5A 2R6GA 1PMRA 3IFTA 3OW7A 2NN6H 2A68C 1V43A 1YNNC 2QF7A 3FMCA 3DXJC 3ND8A 3EQLC 3PUVA 4KN7C 2EDGA 2DNCA 3T53B 1H9SB 4OO1H 1T5EA 1GJXA 1HQMC 1VDZA 2L5TA 1GHJA 1H9RA 1Y8PB 3LNNA 1B9NA 1K8MA 2E75C 5JEAG 3VR2A 3LWUA 3I4LA 3SE0A 2NN6I 4BA2I 2BA1A 3AB9A 4LJZC 3WDNA 3BG3A 1E2ZA 1VCIA 3W3AA 2PCFB 1DD2A 4JBWA 1K8OA 3M85A 4G7OC 2B8FA 4XTCS 3PUWA 1Y69U 1GUGA 4TKOB 3A8KE 2CW0C 1HCZA 3VR6A 3A7AB 3I72A 1H9MA 2AUKA 4I7ZC 4KN4C 2AUJD 2K7VA 4KKSA 4BA1I 2NN6G 1GHKA 1BDOA 4JK1C 5C0XH 1H9SA 4DNRB 1GUSA 3IKJA 4H13C 4LK1C 5KNCA 3A8JE 3KLRA 1O78A 4OO1G 1O7LA 3MXUA 2KA7A 3QIAA 2EJMA 2A69D 2BDOA 4TQUS 3GD7A 4KI0A 2EVBA 1LACA 5KNDA 3BDOA 3M4YA 3MFYA 3VR3A 2D5DA 3L7ZC 3QG1A 3OPOA 5BN4A 2JE6I 4OGQC 1QJOA 1Z6HA 2KCCA 2O5JC 2BE5D 1SMYC 1ZKOA 3CRLC 3A8IE 4XIGS 2JEAI 3A7LA 1HTPA 1Q90A 2ZT9C 4KMUC 2B8GA 3QJYA 5C0XG 3I73A 2K33A 2YYZA 4L8JA 4KKUA 2AWOA 3OOCA 5A35A 1IYVA 2V4DA 1IW7C 1HPCA 1GUOA 2BA0A 4G7HC 4DK0A 1IW7D 1CFMA 2A69C 1G291 1Y8NB 2DN8A 3PUZA 1V8QA 1B9MA 2E74C 3RLFA 4IQZA 1VF7A 5KNBA 1IYUA 2Q8IB 3VA7A 1OXVA 2E76C 3ND9A 1LABA 1EWHA 2D2CC 3P20A 3T51B 1ONLA 2EJFC 2BE5C 2A6HD 1A6XA 3D31A 1Z7TA 1I6VC 3VR4A 1DXMA 4H44C 4IFDH 1FR3A 4DK1A 2EJGC 2K32A 1OXUA 3HGBA 1Q12A 5K36H 3FPPA 3H94A 4GZYC 1CI3M 1OXXK 2LMCB 1GUTA 3SDZA 1DCZA 1H9JA 5BN3A 1H9KA 2O5IC 2A68D 3TZUA 4KHZA 2D62A 5BN5A 1TU2B 4KKTA 3N6RA 2A6EC 2F1MA 2JEBI 1ZYRC 2PNRC 3D4RA 2JXMB 1Q1BA 3PUYA 2PPBC 3M7NA 1VF5C 2A6ED 1Y8OB 1E2VA 5JEAH 4H0LC 3PV0A 3PUXA 2A6HC 1GUNA 2IT1A 1Q1EA 1CTMA 1YNJC 3CRKC 4RCNA 1FYCA 3U9SA 2DNEA 3GQBA 3NE5B
chains in the Genus database with same CATH superfamily
5CV4A 1QNKA 4DUYL 4DGZA 4IPDA 4X66Q 5IP9G 1PH4A 4P75A 1UAPA 3VR5A 3NXWA 4UAIA 1PTOD 5FO7B 5C5MA 1ZEQX 1SBBB 3S1NH 2AWNA 3ITPA 4OO1H 1H9SB 4A3JB 3R8BA 1P16A 3TP5A 4J8QA 1Y8PB 2R7ZB 4JI4Q 4KHPQ 3MXPA 3ERSX 3GO5A 1TWCB 1PH2A 2F0WA 3V2TA 2R3ZA 3GTPH 1SE3A 1K8OA 2ZXRA 1IBMQ 4B3RQ 4E6IA 1V1PA 5K5PA 3PUWA 3FKIH 3CPWA 3K58A 2I46A 2E2DC 4JV5Q 3CQZB 3GTQB 5I2XA 2K5DA 1WVLA 1PA6A 1HFNA 4DFAA 1E1TA 3F2BA 2UU9Q 1LT3D 2PW5A 5HY6A 5KNDA 3GTOB 3BVZA 2A74C 1Y1WH 5D14A 2WIIB 2K52A 2KCCA 1ESFA 5D3DA 1KXLA 2JA8B 1SMYC 1AW7A 2K4KA 3HOZB 2MPMA 4LF6L 1NMGA 3F2CA 4CDFC 1SNPA 4FXGC 4C3HG 1J9OA 2VY3A 1EQTA 2V4DA 3U9OA 3CC7A 2HCIA 2JP1A 2MO0A 1HZ9A 4FF3A 2KUMA 3PUZA 3GTGB 2E74C 2FINB 1JR0D 2XRSD 2IW3A 3EVQA 4L5SA 4Q0FA 1MSHA 4BY7H 1O7ZA 4DXGA 2F03A 3HOVH 1EQQA 2KEEA 4NPSA 3TS0A 3VR4A 1EYCA 5GAGC 3RN5A 2F4VL 4U68A 1F9QA 3D3RA 4ODGA 4DA2A 4ME5A 3PSIA 4GZYC 5IP9H 4IOCA 2WFWA 4A3FG 1BOSA 4X62Q 2H5XA 4RKBA 3S15H 1KDAA 2D62A 1J6QA 2Q2HA 2IWHA 4JPBW 4KKTA 4N9PA 2DUDA 1BNZA 1B3AA 4GLXA 1Y8OB 2IY5B 3KDFA 3GTPB 5TSSA 2BH2A 4AQYL 2DNEA 1L2FA 4C56C 3FKIB 1HUNA 3SR1A 3G71A 1WD0A 2Q8RE 1RL2A 2CW0D 3NBHA 1XMOL 4HJ7A 3E5SA 3TP6A 3M4QA 4UY8C 3STBD 3I91A 4HJ8A 4ZUIA 1KRTA 3SGIA 1Y1WB 1EYDA 5JEAG 3I4LA 4A75A 1EYAA 3WDNA 4B3SL 4HSVA 4RGNA 1FJGQ 4DR2L 3E9IA 1O7YA 2RQXA 5JPNC 4RA8A 4ZRZA 4MTNA 1K28A 2NN6G 1GHKA 2K04A 1BDOA 5AJ3L 4HJ9A 1TS2A 3LGJA 4ILWA 4C3HH 2EYPA 2N8NA 5C4HA 2EJMA 3OTOQ 2RHQB 3KLSA 1SMXA 2B2WA 3PO2H 4YCWA 3OHXC 1GXDC 2OQKA 5CC4A 5IWAL 5BN4A 1KD1C 1JMCA 1QJOA 4YCVA 1CKOA 2K5NA 2VQEQ 1AZQA 1UNSA 1QILA 2MFIA 3T13A 1HTPA 5KIXA 3H6MA 1VQOA 2B8GA 2Q2TA 3G7LA 2ENBA 3JAML 4DR1L 2FFKB 4ULLA 2ZJQA 4L8JA 4B3TQ 1BVSA 1IYVA 3S15B 2NTSA 4IUUA 4A3FH 3HKSA 3T1HQ 2Z0SA 1EL0A 1STHA 4FDBA 1JB7A 1NY4A 2VUMG 3F2UA 2DY7A 4XQNA 3ND9A 4LF5Q 1UE6A 3PIO3 4PMBA 2VQFQ 1EZ8A 1WOCA 3A0JA 1B53A 4RKLA 4BY1B 1D5MC 5DM63 4XQQA 1FR3A 4LUOA 4DV2Q 3HGBA 5EQ0A 2I5LX 4JI2Q 1LM0A 1N36L 1JE4A 1BO0A 1SSOA 3TZUA 3J81j 3A55A 4A3LG 4CDCC 1HFGA 1TU2B 3U4VA 3D8GA 3UE0A 2K1BA 1B3QA 1OO9B 2QDLA 3MEFA 1NR4A 1I4HA 1TWAH 3JAME 5JEAH 4K5VA 3EIVA 3I7FA 4O1NA 1A8VA 3G48A 3GQBA 4M1UB 1WJJA 1JOKA 5D65A 5C4XB 4OX9L 1IXRA 4JI7L 4DV1Q 4TRDA 1WTHA 1W3SA 3NTHA 3TEHB 2UUBQ 3C1EA 1E24A 4C3HB 2NN6H 2FJ2A 1V43A 4K0KQ 1C48A 1XNQL 1VQEA 2IJ0A 4JOIA 2B2VA 3PO2B 1SYFA 4FP5D 1K8MA 2EXDA 3M4OB 4OONA 3S24A 1ICFB 1QOHA 5IGGA 1I94Q 5CV6A 2C35B 5EKLA 5T1GA 1VQFA 4R4IA 1HR0Q 1UEAB 2CW0C 3I55A 2KCMA 3DEPA 3CXCA 1ICWA 5M5YH 1EY6A 2LSSA 2X69A 4DNRB 4KY7A 3STBC 1IBKL 1I4XA 1STAA 2VUMH 3VYRA 1LYLA 5IOCA 3D0FA 3GP7A 3VR3A 2D0PA 3FPUB 3PIOA 3Q6SA 3L3OC 3UDFA 1TWFB 1VQLA 1EFID 3W2DA 1QB5D 3L0OA 4XIGS 1UE5A 3KF6A 1XPUA 2NTTA 2XNAC 1MJEA 3MA2B 2B2UC 4OWWB 1LTTD 3HOUH 1S3OA 1B70B 2EYJA 2F0QA 4XT3B 3DWAA 1A3TA 4A3LH 5C6AA 2UUCL 2SOBA 2R93G 1TWAB 1L1OC 2F0EA 2E76C 2D2CC 3TQYA 1JE5A 4OIKA 3J80c 4HEDA 4A3DG 1L1OB 1EY0A 3H3VH 3RZDB 1BXTA 2I07B 5JAVA 1J5EQ 3BS1A 2QCPX 5IT9c 2L9HA 3MXNB 2WKCA 3K0XA 4HN7A 1XJVA 3IAYA 4QIWB 4U673 2NUCA 3SK5A 1HNWQ 5M3MG 5BN5A 1VMCA 3H15A 1NE3A 4ZKCB 4A3KG 2CFMA 3PV0A 3PGZA 2G5DA 5IGBA 4XQJA 4EQPA 5DLQE 4A3CG 2OEOA 3J81E 3J7YW 4DR4Q 5CV8A 5M5YB 1B50A 2AMCB 4Q5VA 2DY8A 4GKJL 4GS3A 1DZ1A 1NJIC 5C4JH 1F2ZA 3SK6A 2QF7A 2DNCA 2YV5A 4X64Q 1B9NA 3LX0A 3QWNA 4BA2I 4YY3L 4PZ7A 4YHHL 1VQ5A 4P71A 2A19A 4CKEA 3CCVA 2JK8A 4I7AA 2JN4A 4GOPB 1VQ9A 1STGA 1GUWA 4C3IB 2K7VA 3HOUB 5E4WC 3U58A 3BYTB 1N34Q 3A8JE 1EQVA 1I5FA 2JA7G 1YHBA 4DV4L 2MHVA 1NBWA 2A1AA 4IJHA 2EY5A 3S1MH 3H3VC 3TP7A 2R93H 1CKMA 1BKBA 1ENFA 2E8GA 2XGTA 2J0TD 3KBXA 3CRLC 1KAAA 1RF2D 2YTVA 4A3DH 2OQ0A 2A5HA 1X54A 3A7LA 3Q8DA 2ES2A 3TMEA 1XTCD 5G3LF 1TWHH 5IODA 4WJ3M 2YYZA 1I6HH 3GTMH 1K83B 3I4NG 1X3PA 1HPCA 1LTID 3S17B 1KNAA 5FOBB 1YJWA 3A54A 5M3MH 1VF7A 2RCFA 3NTKA 3GTLB 4A3KH 1ONLA 3CMEA 2E2HH 2EIFA 3CCMA 4A3CH 2Z1CA 1Q12A 1CQFA 5LL6X 4QIWE 1XXGA 3OIPA 4RGMA 4Y7NB 5JOBA 4DAYA 4KV6A 3HKZB 2CWAA 4M8AA 1JJGA 2K75A 1SE8A 2HT1A 2A6ED 1LV9A 3GTKH 2R7ZG 2EYMA 2WACA 2FMMA 2MNAA 1KHIA 4UPAA 1JB3A 5KYIA 2X6LA 4O0AA 1VMPA 1TT2A 1EFWA 4DR3L 1TKWB 1B4OA 4IURA 4RFBA 2FHTA 3WWVA 4DUZL 2F0IA 3FMCA 5I9PA 1EIHA 1KLUD 3S1MB 3S14B 2JA7H 4CJ1B 1E7ZA 2RSOA 2NVXH 3I70A 1TS4A 2PQAA 3LWUA 2ALYB 1PFMA 3BG3A 4I65A 5C3EB 3ICEA 2JA8G 3SK4A 5CGKA 4XTCS 3HOZG 3I4MG 4DV3Q 2AUKA 4RAUC 4DV0L 3RN2A 5JJIA 2QEXA 3IKJA 4X65Q 5M3MB 3BDCA 3MXUA 2BDNA 3I4NH 1HA6A 4NXML 2UXCL 1XMQL 5CV9A 4V190 2J7ZA 4RMFA 4LF9Q 3NBIA 3MFYA 4LW1A 5C0XI 2E2HB 4DV5Q 3G6EA 1B1ZA 3MFGA 2WV6D 1SFOH 4B9WA 4DR5L 3AQQA 1D7QA 1L0WA 4GNXC 2F0VA 1Q90A 3UDIA 1CZWA 2F0KA 4MNOA 3DMUA 3ZYYX 3S2HB 1EOTA 3AU7A 1JCKB 4LUZA 5CMDA 2B2YA 1Y8NB 1VQ7A 3GTKB 2KBNA 1RDPD 4LF8Q 4CHTB 4LFCL 2E2JB 1XYIA 4JI5Q 3VA5A 3R2TA 4QUFA 1FVIA 1LTGD 2EOTA 4K5XA 3TRZA 2NZ1D 3IFDA 3FKIG 3A5ZB 2B63B 2IHEA 1MBYA 1V1PB 4TVAB 4POGA 1IZ6A 1PVOA 3B6YA 2WP8J 5IYDG 2JQOA 3SDZA 3TP8A 1IBLQ 2OF1A 3CQZH 3C1FA 3GTQH 2QDBA 1QUQA 5IYBG 4IZ8A 1KIXA 3K81C 1B8AA 1ZYRC 4BBRG 4ZKBB 1F9PA 2NVXB 3HKZE 3U50C 4FO2A 3R3OA 3GTOH 4DU9A 4LF7L 4JI8Q 1X3FA 1FGUA 4G7ZC 4Z9CB 4DNTB 2JA8H 1VQHA 1W6JA 5EAYA 5EPLA 2Q8TA 2EPBA 4ZCKA 4PV1C 3HOZH 3I4MH 4CKCA 2WINB 1I50H 2ASBA 1STNA 2IX3A 4BBSB 5EGTA 4OWXB 2WAQB 5LMUL 3FDTA 1PYWD 3PF4A 2Z6KC 3NPPA 1QVGA 1PRTC 2SNMA 3G6JB 1M8AA 2RVLA 1EOVA 5DEHA 1HA5A 1GHJA 1H9RA 4QGUA 3RZOB 1PRTB 5M9OA 1KDBA 2BA1A 3DM1A 1LT5D 1DD2A 4JBWA 1ENAA 3Q24A 4IUTA 1FNUA 4K8JA 2AUJD 1D2BA 1BF4A 1BCPC 1TQOA 1CQVA 3RD4A 4H13C 3EN2A 3R2IA 2O2LD 1BCPB 1SNDA 2KA7A 3QIAA 4XYQA 4DR6Q 4A76A 1SNCA 3GD7A 1ENCA 5C0XJ 1ZXTA 2D5DA 3J81i 5DM73 3ULPA 2TSSA 3SEBA 2L0CA 3KDFB 4BY1G 2JEAI 3DM3A 1D5ZC 1PFSA 4KHVA 4CJ0B 3NUCA 2E2IB 1KDCA 1BBXC 2CQAA 2XSCA 3NBHB 1IL8A 5IYDH 1XPOA 2F4IA 1D6EC 5IYBH 4BBRH 4B3ML 1MI2A 1BBUA 5KEEA 1CK1A 3D31A 3KF8B 1YJ9A 1A2UA 2ATWA 1MGSA 3I4MB 5COYA 3FHWA 1I50B 4DAVA 1KC8C 2YU9B 3D4WA 5C4XG 5JJKA 4EQ5A 4DV6L 1EIYB 3HOXB 3DEOA 1B2TA 2F0HA 3DHQA 2C5CA 1ET9A 1B44D 2A68D 1YI2A 5FO9B 4DAPA 4IFDI 3M7NA 1SN8A 4A93B 3PO2G 2MQHA 4EQNA 4KJOA 5CBAE 4NXNQ 3Q0AA 4RCNA 1QVCA 3T1YQ 4JI4L 3CC4A 3MZ5A 5K36G 1F2YA 2AQ3B 3VYUA 2JJQA 2OTLA 5CORA 4NDXA 2WAQE 1IBML 4JVZA 4B3RL 4JI0Q 1G6ZA 2HDLA 4CDDC 3AEVA 3ND8A 3PUVA 3PO3G 4JV5L 2L5TA 1HUMA 2O4XA 1S72A 3K80C 4WFN3 4DV7Q 1I4QA 3AB9A 2K05A 1E2ZA 1K9MC 2IHFA 2UU9L 1PRTF 4J1MA 4BY1H 1SNOA 2GA4B 3M9BA 4QMGA 4F7XA 4TKOB 4R1JA 2EE1A 1UWVA 2NWGA 1H9SA 2V1CC 4NP5A 4K5WA 1YITA 1JORA 1KAWA 2WKDA 5KYLA 4K2LA 4XDXA 2HHHQ 1DOLA 2L55A 2KVMA 5C44G 4BBRB 2BDOA 2F3VA 4UP8A 4HIOA 1LACA 2RDFA 2K5VA 3M4YA 1BCPF 5G3LD 2QGQA 3QG1A 1TR5A 1D8LA 2ZTEA 4N8FA 2PW7A 3A8IE 5JVG3 4IN3A 2EYOA 3TZDA 4RWSC 4QL5A 2Y0SB 3K5MA 5C4XH 4A3GB 2B29A 1WFQA 2LXKA 4A4IA 3ER0A 5C4ZA 4C2MB 1HH2P 4QB4A 3EJIA 2PZWA 4ZAIA 4HJ5A 4G7HC 4G4KA 1SXTA 2B2VC 2MGSA 2VW9A 1B9MA 1WI5A 3KFUA 1PH9A 1RD9D 1X65A 4IPCA 3CU7A 2PI2A 3K8AA 5CR3A 4X62L 2QEJC 1YZ6A 2ZM6Q 3M4OH 3EROA 1A3VA 1C8CA 4A3BB 2C9OA 4XT1B 2OCEA 5K36H 5ELNA 2VL6A 4JI3Q 2K01A 2KHJA 4K8IA 1VQPA 5A2QE 1PTOB 1QNUA 4IFDJ 1HHVA 1MKHA 4DR7L 1TS3A 2DJFC 5ELFA 3PO3H 3RR5A 1M1KC 3P7JA 1HNXQ 1XX8A 3A56A 2Z4HA 3NELA 3NQIA 4MZ9A 1Q8IA 1TWFH 2ZXOA 1PZID 1XNQQ 2EXZA 3QB3A 3KF6B 4DN4M 1JICA 3HOWH 2R6GA 1PMRA 2XIWA 4AYBB 4C3IG 1FJGL 3HOUG 1Q82C 1K8AC 2A68C 1STEA 1Y1VB 4DPGA 1QCBD 4P74A 1Q8KA 3C46A 4OIJA 3WOEA 4FNFA 5C44H 1PYSB 3VR2A 1L0XB 2QA4A 1SYCA 2NZOA 3OTOL 4PQXA 4QCLA 4S3SA 1YHQA 4G7OC 1EYGA 2VXWA 3Q22A 1X56A 2OXPA 4K2KA 3RZDH 3I72A 3L9AX 1G2TA 3IL8A 3EBEA 2AQ2B 2VQEL 4KY5A 5JJZA 1GUSA 4JYAL 4JBKA 1O7LA 2UUAQ 1EIFA 2A73B 1LLRD 4B3TL 2EVBA 4A3MH 5DAUA 4JBMA 2R61A 3T1HL 2JE6I 4JI6Q 4LMQD 1K3RA 2O5JC 1NNXA 3KLSX 1PDQA 3MTSA 1N9WA 5E7NA 2UXBQ 2XRQD 1EZ6A 2VQFL 2Y0SE 3ONAB 3JAMc 2ZJRA 1AH9A 5A35A 2M9VA 3AFQA 4UP7A 1JWSD 2BA0A 4DV2L 4HIKA 3PO3B 4JI2L 2DN8A 3RLFA 3HKZG 3CW2C 4J6HA 1EY9A 1OXVA 1LABA 3CD6A 2Z6BA 1A6XA 3F1ZA 4R4OA 2RSNA 4H02A 1HNZQ 1YNXA 3K57A 4HAEA 4FXKC 3DWQA 3HOWB 3FPPA 1GVPA 3J80E 1DOMA 1SR3A 5GADC 3CP0A 4C3IH 2F0SA 4EVOA 2D9UA 1H9KA 1N32Q 1NMFA 5LL6S 1V1OA 3CMAA 4DV1L 3BYYB 4LWCA 2CH4W 3J81L 5C44B 2UUBL 5BR8Q 1Q1BA 5GAHC 1T5XD 2YTYA 3U9SA 1Q1EA 2K5QA 3L2PA 3K5OA 1E2WA 5C3EG 4L5TA 4DK3C 3E0JA 3I3CA 3T56B 1SROA 2XN9C 1I94L 2VB3X 1AE2A 1W2BA 4POFA 3S1QH 4AYBE 1ASZA 4FXDA 1QZGA 1YNNC 4F88A 1HR0L 2HCCA 1K83H 4X3TA 4A3MB 2PYKA 1JT8A 3BVMA 3S17H 3LNNA 3D6CA 5IGFA 2EZVA 1A62A 3ERQA 3A5UA 1VCIA 2DGYA 2NVYB 5EBCA 3GTLH 2F0JA 4EQOA 4R4QA 3RLNA 4L6TB 3TREA 4OXPA 2RBMA 3A8KE 5FKAC 2K5HA 4YWKA 2QILA 3VR6A 2HDMA 4KKSA 5HGTA 1E3PA 4JK1C 3VDYA 5GAEC 2OT2A 2LY7A 4Y7NH 4DAYB 2AKWB 1UE7A 2EYLA 3EA6A 2JA6B 1PZKD 1D5XC 3CCJA 3S16H 2OTJA 1QZHA 5I6YA 1EY4A 4GOPC 4B08A 4KD3A 4OELB 1BUVT 1D1IA 2B63G 1X3GA 2JSOA 2KQ3A 3RLOA 1SYGA 5C0XG 1WD1A 3MEHA 1DM0B 1E22A 1J5EL 2JYOA 3HZXA 1GUOA 2MJ8A 1XNRQ 4DK0A 1V8QA 2RKSA 2B2TA 1Q86C 2R7DA 2F0DA 2PNHA 3S14H 2E5LQ 3CCQA 3E9HA 2IL8A 1EWHA 3RNUA 1HNWL 5M5WH 3FP9A 2PQAB 2IPKD 2A8VA 1VQJA 4PZ6A 1ML0D 1YIJA 1S5BD 1I4GA 5C3EH 1QVFA 4YWMA 3LWEA 2I5MX 4JI1Q 3H94A 2B2UA 3S1QB 1CM9A 1GO3E 4BBSG 1S4ZA 2WAQG 1H9JA 1K8GA 4QJFA 3CCRA 4DR4L 1ILQA 1YJNA 1ZYRD 1L1OA 3OWFA 1JQYD 1F77A 1JWMD 2ICIA 5LMNQ 4V0BA 2IT1A 5ELDA 5JJLA 1CTMA 4QUCA 1FYCA 3HS0C 3NE5B 4X64L 2KECA 1SRUA 1V9PA 1RJTA 1P8LA 1WCMB 1XTDA 5FJ8G 1A63A 5J3BA 2XTIA 4GKKQ 3OWEB 2MUYA 3S2HH 2PMZB 1UEBA 1WTPA 2N88A 2R92H 4PMWA 1C4QA 2F0OA 1AE3A 1PRTD 1VDZA 5KRUA 4LUVA 1N34L 1O80A 1PZJD 3AMUA 3K59A 2ZJPA 3S16B 4AH6A 1HZBA 2F0NA 4XYOA 2Q2UA 2E2JH 3M85A 4K6DA 1YVCA 5F2DA 1WYDA 4JBJA 4K6LA 2J4XA 2D0OA 3M7GA 3P75A 5EKKA 3SK8A 2B63H 2CCZA 5C0XH 4LF4Q 4ZLTF 1BCPD 1O78A 5JPMC 1PHJA 5HURA 2XWJB 3BZDB 1EY5A 1EY8A 2EY1A 3PCOB 1QUQB 1LO5D 2SDFA 2KJXA 3BDOA 1SEBD 1VQAA 4FVMA 5M5WB 3F2DA 2BCOA 3HOYB 3P1HA 1Z6HA 5FLXL 1KNEA 2PZUA 2MP1A 4MIUA 4NKLA 2N49A 3I8ZA 2RA4A 4BWGB 2MO1A 4LFAQ 1VQMA 3HFZB 2HIVA 1KQSA 2NBFA 1FGBD 4KKUA 2AWOA 3HOXG 1U4PA 5CV7A 1CA5A 3BU2A 1GM5A 4BBSH 2K03A 1CFMA 5FLMG 1EY7A 3URYA 1F2LA 4OEMB 2UXDQ 4A93G 1IYUA 4IUVA 1SNQA 2GN5A 4ZK9B 4R4TA 4RHRA 1MIUA 3RZOH 1MSGA 3K5NA 1MJCA 4LFBQ 4WORA 1I3QB 2B3GA 3PIP3 1YBYA 1W6KA 4KD4A 5J1ZA 2F0MA 3J7AF 1SDFA 5FJ8H 4NB3A 4F8MA 2R92B 1R4QB 4MN3A 2SNSA 4KHZA 4KLKA 5FLXE 3PUYA 1VF5C 3KOJA 2M00A 1EEFD 5M5XB 2XWBB 4H0LC 4L5RC 3CC2A 1GUNA 1N33Q 1II3A 4X3UA 4IFDG 5T1IA 1WTWA 3DLLA 1EU3A 1EUJA 3OW7A 2E2IH 3FEWX 1PH3A 3S1RB 2PMZE 4KN7C 3QO2A 1HQMC 2ICEC 1GKHA 3S9WA 3RUZA 4DUYQ 3TS2A 1TIID 2QW7A 4LJZC 1NTGA 2PCFB 2LKVA 3K7UC 1J8IA 3J80i 2TMPA 4LF9L 4WJ4A 1L0YB 4DV5L 1CUKA 5E4XA 2F52A 3A7AB 1H9MA 2F0LA 4I7ZC 2Y0SG 4KN4C 3F8TA 3PMFA 2YU9H 4EX5A 4A3GG 4NW2A 3HOXH 5HGQA 4A3IG 1TWGB 1SYEA 1X3EA 4TQUS 1SJHD 4KI0A 5FLMH 1DONA 4A93H 2BOSA 4RCOA 1Q81C 1RCVD 1VQCA 2CHBD 1EWCA 5AFWA 3S2DB 2K5WA 1FD7D 3X3MA 4LF8L 4A3BG 2NVTB 3PIPA 4ME3A 4KMUC 1FL0A 3QJYA 4OHJA 1PLFA 4JI5L 3KJOA 2YTXA 4B3MQ 1A3UA 2ZXPA 4WRDA 1AN8A 3M3YB 3KLWA 3T4AC 3J7A5 1IBLL 1ESRA 4OL7A 1LTBD 5FK9C 4QF4A 5IY0A 4LF6Q 4LNQA 4FF4A 1QG7A 3IRBA 1I6VC 2OWOA 2WB1B 3TDQA 1FNVA 4GNXA 1JJ2A 3CCUA 4IFDH 4HCEA 3TN2A 3AFPA 3W5OA 1R9TB 1IKMA 4UHVA 3CPFA 2KCTA 4JI8L 1CZGA 2EYFA 4AYBG 2NVQH 1XPRA 1DJRD 1Y1VG 3MC0B 2NZHA 3N6RA 3K5LA 2F4VQ 1BQQT 3KK7A 2RCNA 2VS1A 5CV5A 1RKNA 3MAQA 4PG3A 3HP3A 4O42A 2CQOA 5IYCG 1U4RA 1WTOA 2RDHA 3E0EA 2ZTCA 5LMNW 1PH5A 1Y14B 1RTNA 5M3FH 1DYQA 4A3GH 1O7IA 3JC66 3DWPA 3SVMA 3KJPA 4B9XA 4DNIA 4X66L 4C2MH 4AQYQ 4A3IH 1T5EA 2F0GA 1CT1D 1I4PA 1UE1A 2B2WC 2P5ZX 3GDEA 3GTJH 3CF5A 2E75C 1C0AA 1M90C 4JC0A 5ELBA 1X3QA 1XMOQ 4DR6L 1CKNA 4OO1I 1PH1A 1NCVA 2HD3A 5EBDA 1Y69U 4A3BH 4KHPL 1HCZA 2Z6KA 4ID6A 2H1EA 2R7FA 4B3SQ 1PTOH 4CJ2C 4DR2Q 1TVXA 1G2SA 2F0PA 1CHPD 4TSSA 1WTVA 1X9NA 1VQ6A 1CSPA 3D6WA 2LS01 2HIXA 1VQ8A 5J39A 5AJ3Q 3I56A 2CVRA 5GROA 1Q3LA 1VQGA 4IUQA 3HOWG 2NVQB 4YIJA 3HEJA 1SAPA 4DF7A 1QE6A 2EYHA 5I2YA 3S1NB 1IW7C 5IWAQ 1U4LA 1Y1VH 2K6AA 2DJGC 3OIQA 5KNBA 5ELCA 2N3SA 5A2QL 4DR1Q 3U4ZA 2CH4A 2L15A 4GN4B 4HMIA 1EU4A 5IYCH 2PO4A 1U0LA 2WB1E 4NXNL 1OXUA 4DR7Q 5M3FB 1OXXK 4DK6C 1S5ED 4EGVA 3T1YL 1S5FD 2NYZD 4APVA 4A3IB 2LFNA 2IX1A 4JOIC 2I5HA 2G9DA 4R9WA 2F1MA 3GTJB 4K14A 3J7ZC 4A3MG 1HXYD 3KF8A 3PQIA 4JI0L 3PUXA 4P72A 5IIFA 5KGUA 1SNMA 1N36Q 1M4VA 1OXTA 4X3SA 4DV7L 1OXSC 1PFNA 4ALPA 1PTOC 2VB2X 1U9RA 3BZCA 3CCLA 1MHWC 1VQBA 1VQKA 4YCUA 4GLVB 1YNND 4R8IA 3C2PA 4BY7B 4A3EG 1GJXA 3MHBA 4JCVE 3HOVB 4BXXG 4RGTA 4OX9Q 4JI7Q 4CBVA 4RGOS 5IE8A 4CGYB 3BJUA 2HHHL 3A74A 5JVH3 2JA6G 2PI2E 2EY2A 3NENA 4JYAQ 2B8FA 1LTLA 1BBWA 2CWPA 4R8NA 5EPKA 4IPHA 4IUNA 4N8X1 3TSSA 1HZCA 3KYHC 1PH7A 3ULJA 4HMJA 2L1BA 3H0GG 3OMGA 3FRPB 5ELOA 3NHHA 3L7ZC 1VQ4A 3OPOA 3H09A 4OGQC 3NTIA 3CCSA 4J15A 3UDGA 2BE5D 2L12A 5CYUA 2BH8A 3HG9A 2ID0A 1KL9A 1IBKQ 2ZM6L 4L5QA 5C3XA 4HJAA 3I2ZA 3MVVA 5I6WA 3FVQA 3HRZC 5C3WA 2Z4IA 2L4NA 4JI3L 3CHBD 3VYSA 3K6OA 5EPJA 3VA7A 3J80L 1HRJA 4X3KA 1G6PA 2A6HD 2EY6A 4ABNA 4KY6A 3SXHA 2NVYH 5IT9L 1E1OA 4IJLA 2K32A 4KK7A 1K3BC 1HJPA 1NAPA 3BZKA 1HNXL 4LF5L 3BVGA 2UUCQ 4YWLA 1WCMG 2N78A 4UP9A 2HUGA 2LMCB 1NSNS 2KHSA 2O5IC 4H7BA 1STBA 1T9HA 1F2MA 1IKLA 1EEID 2HQEA 4A3EH 3AYHB 2XVSA 4BXXH 4KJNA 3E6ZX 3M4PA 2RDGA 2JA6H 4IOAA 1KABA 4HTHA 1RODA 2PZTA 1SYDA 4FF2A 1AP0A 1F9RA 2RF4A 2RHSB 3IFTA 3EFXD 5IGCA 4A3FB 3WOFA 3OW2A 1D1KA 3KBGA 4Y52H 5IP7G 3E3XA 1Z9FA 2B2TC 2I0QA 4F87A 2K50A 1JWUD 5IT9E 1PTOF 1R4PB 3H0GH 3Q23A 2NN6I 2JA5G 2ZTDA 1X55A 4K0KL 2UUAL 3W3AA 3HOYG 4MHEA 4GKJQ 1C7YA 1C9OA 4ZQ3A 3NSWA 5IGEA 2LXJA 1GUGA 2EQSA 2QKIC 4JI6L 4BA1I 1LTAD 1K73C 4IO9A 3KLRA 4YY3Q 4YHHQ 2UXBL 1GD7A 1VQDA 2A69D 2GVAA 1ASYA 5ISRA 1K0RA 4RH6A 3J7AV 2H4OA 2KOLA 1IL2A 3UE1A 2ZT9C 4DAMA 1X32A 5L37A 2AHOB 3CAMA 4DV4Q 1B7YB 3I73A 4LAAA 2PQEA 2KEDA 2G9HD 1WCMH 3NK9A 1HNZL 1U5KA 4G57A 2R92G 1BR9A 1TY2A 4C1NK 1HZAA 5LHY1 1G291 4A3EB 4JG2A 1N32L 1LUZA 1IHZA 1WTXA 1SYBA 5FO8B 1LTRD 4R4CA 2BE5C 3V96A 1YNJD 5C5LA 5BR8L 3QOLA 4H44C 2NB0A 1XWEA 3NQTA 5ELEA 3QOJA 4HIDA 3KUPA 1CI3M 1DCZA 3H3VI 5BN3A 1JOQA 2VUMB 4UDUC 2M2LA 5IP7H 1H95A 1SJED 2PNRC 3J81c 2JXMB 1SE4A 3H0GB 4PNYA 2B39A 1E2VA 1CHQD 3ULLA 2A6HC 2L11A 4DK1A 2JA5H 1KRSA 2F0UA 3CRKC 1VQIA 1Q7YC 3HOYH 3NWSA 1AFPA 5NUCA 2HQLA 5JEAJ 3CKIB 5E3FA 4IUPA 2SEBD 1EWIA 1TXYA 3K0YA 1F9SA 2EDGA 4IALA 5J22A 3H91A 1HQRD 3SE0A 4DR3Q 1NR2A 3SHLA 3NP8A 2FMCA 4JW0A 3N52A 2AQ1B 1IYJB 4DUZQ 1FNWA 3MXNA 4C3JG 3DUZA 1I3QH 4O2DA 1HTLD 2N55A 4RHSA 5KNCA 1CSQA 2Q2IA 3OMCA 2B2YC 2FXQA 3C3LA 1E0BA 1PYBA 1S40A 1XNRL 5E1FA 4DV0Q 5M5XH 4GLAC 2E5LL 1KTKA 2WB1G 1EIGA 5EJWA 3W1BA 4NXMQ 1UUPA 5C4JB 2UXCQ 2K33A 1JOOA 4C1NI 1XMQQ 3OOCA 1PV4A 3K7AH 1SE2A 3NWTA 5H1SE 4NMZA 2A69C 4JI1L 4ZUJA 4A3JG 4DR5Q 3S1RH 4HCSA 1PFBA 2Z8LA 1GOZA 1LT4D 2Q8IB 5I4DA 1WTRA 1PH8A 2JA5B 3T51B 2CKZB 1MD2D 2X6GA 3MWYW 2EJFC 1QWYA 3GV6A 1DGSA 2KHIA 1DXMA 4GOPA 1LTSD 4N9TA 5LMNL 4RG1A 1A2TA 1X6OA 1GUTA 3R93A 4GN5A 4LFCQ 1LT6D 1VS0A 2R93B 4GKKL 1TWGH 1RHPA 5I9OA 4MTKA 3BDLA 4A3DB 1S5DD 1YNJC 2KENA 3D4RA 1JC7A 1CA6A 1TWHB 3GV3A 3VYTA 3PF5A 3S2DH 1ET6A 4HR7B 2F3IA 1G91A 1I6HB 3GTMB 4C3JH 1JJCB 1G8ZD 2NVTH 1WTQA 4WJWA 3MXGA 3OSOA 5EKIA 1HR0W 3JAMi 4IPGA 1ILPA 3DXJC 1PH6A 3EQLC 1G51A 3T53B 4LF7Q 3M3YH 4A3KB 4LF4L 1S5CD 1VQNA 4L63B 4AIMA 4CKBA 1Q46A 2F3WA 2K14A 5GQOA 4QY7A 5IGDA 5LMUQ 1SMYD 1EQRA 3I90A 4CDEC 3UDXA 1A15A 3V05A 2VNUD 4GNXB 3D4DA 4OWTB 3K7AB 4X6AH 1Z47A 1R9TH 2GVBA 4LK1C 3CCEA 4OO1G 4DV3L 4LFAL 1RTOA 5CBEE 4A3JH 2R7ZH 4X65L 2IX0A 2KCNA 1K0SA 1AZPA 4FYDA 1STYA 1YHAA 5D3IB 1TWCH 1ZKOA 3G4SA 2UXDL 5FLXc 4P73A 1N8RC 2F0FA 1I4RA 4FF1A 3W1GA 5M3FG 4KTAA 4HSPA 4XXEA 4ZYSA 4LFBL 2JA7B 4QQBX 2JA9A 1IW7D 1DOKA 1PXUA 4P2CB 3O13A 1KLGD 4IQZA 3X3NA 1TS5A 1Y1WG 4PMCA 3NEMA 4PZ8A 3P20A 2K28A 3RMHA 4BS9A 3I4OA 3ZJYC 1Z7TA 3TBIB 1CKNB 4C3JB 1SLJA 2EJGC 4DKAC 2VZAA 1N33L 1AEXA 1V1QA 1A0IA 1RIPA 3T16A 3I4NB 1TY0A 2Z9HA 3UI2A 4DXFA 2F0TA 2A6EC 1OTCA 2JEBI 3QR8A 5DNFA 2PPBC 1YEZA 4BY7G 3OYYA 3GTGH 3HOVG 1NUCA 1SFOB 4GN3B 1U4MA 4DV6Q 4HIMA
chains in the Genus database with same CATH topology
5CV4A 1QNKA 4DGZA 1UAPA 3VR5A 3NXWA 4UAIA 1PTOD 5FO7B 5C5MA 1ZEQX 1SBBB 2AWNA 3ITPA 4OO1H 1H9SB 4A3JB 3R8BA 3TP5A 4J8QA 1Y8PB 2R7ZB 3MXPA 3GO5A 1TWCB 2F0WA 3V2TA 2R3ZA 1SE3A 1K8OA 2ZXRA 4E6IA 1V1PA 5K5PA 3PUWA 3K58A 2I46A 2E2DC 3CQZB 3GTQB 5I2XA 2K5DA 1WVLA 1HFNA 4DFAA 1LT3D 2PW5A 5KNDA 3GTOB 3BVZA 2A74C 5D14A 2WIIB 2KCCA 1ESFA 5D3DA 2JA8B 1SMYC 1AW7A 3HOZB 2MPMA 1SNPA 4FXGC 4C3HG 1J9OA 1EQTA 2V4DA 3U9OA 2HCIA 2JP1A 4FF3A 2KUMA 3PUZA 3GTGB 2E74C 2FINB 1JR0D 2XRSD 2IW3A 3EVQA 4Q0FA 1MSHA 1O7ZA 4DXGA 2F03A 2KEEA 3VR4A 1EYCA 4U68A 1F9QA 3D3RA 4ODGA 4DA2A 4ME5A 4GZYC 1BOSA 4RKBA 1KDAA 2D62A 2IWHA 4KKTA 4N9PA 1BNZA 1B3AA 1Y8OB 3GTPB 5TSSA 2DNEA 4C56C 3FKIB 1HUNA 3SR1A 1WD0A 2Q8RE 2CW0D 3NBHA 3E5SA 3TP6A 3I91A 4ZUIA 1Y1WB 1EYDA 5JEAG 3I4LA 1EYAA 3WDNA 4HSVA 4RGNA 1O7YA 2RQXA 5JPNC 4RA8A 4ZRZA 2NN6G 1GHKA 2K04A 1BDOA 1TS2A 4ILWA 2EYPA 5C4HA 2EJMA 3KLSA 2B2WA 3OHXC 1GXDC 5CC4A 5BN4A 1QJOA 1AZQA 1UNSA 1QILA 3T13A 1HTPA 5KIXA 3H6MA 2B8GA 3G7LA 2ENBA 3JAML 2FFKB 4ULLA 4L8JA 1IYVA 3S15B 2NTSA 4IUUA 1EL0A 1STHA 3F2UA 2DY7A 4XQNA 3ND9A 3PIO3 4PMBA 1EZ8A 4RKLA 1B53A 4BY1B 1D5MC 5DM63 4XQQA 1FR3A 3HGBA 5EQ0A 1JE4A 1BO0A 1SSOA 3TZUA 3A55A 1HFGA 1TU2B 3D8GA 2K1BA 1OO9B 1NR4A 1I4HA 3JAME 5JEAH 4K5VA 4O1NA 3GQBA 4M1UB 5D65A 1JOKA 5C4XB 4TRDA 3NTHA 3C1EA 4C3HB 2NN6H 2FJ2A 1V43A 1C48A 2IJ0A 2B2VA 3PO2B 1SYFA 4FP5D 1K8MA 3M4OB 5IGGA 1QOHA 5CV6A 5EKLA 5T1GA 1UEAB 2CW0C 3DEPA 1ICWA 1EY6A 2X69A 4DNRB 4KY7A 1I4XA 1STAA 3VYRA 5IOCA 3VR3A 3GP7A 3FPUB 3Q6SA 3L3OC 1TWFB 1EFID 3W2DA 1QB5D 4XIGS 2NTTA 2XNAC 3MA2B 2B2UC 1LTTD 2EYJA 2F0QA 4XT3B 3DWAA 1A3TA 5C6AA 2SOBA 1TWAB 2F0EA 2E76C 2D2CC 4OIKA 4HEDA 1EY0A 3RZDB 1BXTA 2I07B 5JAVA 3BS1A 2QCPX 2L9HA 2WKCA 4HN7A 3IAYA 4QIWB 4U673 2NUCA 3SK5A 5BN5A 1VMCA 4ZKCB 3PV0A 5IGBA 4XQJA 4EQPA 2OEOA 3J81E 3J7YW 5M5YB 5CV8A 1B50A 4Q5VA 2DY8A 1DZ1A 1F2ZA 3SK6A 2QF7A 2DNCA 1B9NA 3LX0A 3QWNA 4BA2I 4CKEA 1STGA 1GUWA 4C3IB 2K7VA 3HOUB 5E4WC 3BYTB 3A8JE 1EQVA 2MHVA 2EY5A 3H3VC 3TP7A 1ENFA 2J0TD 3KBXA 3CRLC 1KAAA 1RF2D 2A5HA 3A7LA 3TMEA 1XTCD 5G3LF 5IODA 2YYZA 1K83B 1X3PA 1HPCA 1LTID 3S17B 1KNAA 5FOBB 3A54A 1VF7A 3NTKA 3GTLB 1ONLA 2Z1CA 1Q12A 1CQFA 5LL6X 1XXGA 3OIPA 4RGMA 4Y7NB 5JOBA 4DAYA 4KV6A 3HKZB 4M8AA 2A6ED 1LV9A 2EYMA 2WACA 2FMMA 1JB3A 5KYIA 2X6LA 1VMPA 1TT2A 1TKWB 1B4OA 4IURA 4RFBA 2FHTA 2F0IA 3FMCA 5I9PA 1EIHA 1KLUD 3S1MB 3S14B 4CJ1B 2RSOA 3I70A 1TS4A 3LWUA 1PFMA 3BG3A 4I65A 5C3EB 3SK4A 5CGKA 4XTCS 2AUKA 4RAUC 3IKJA 5M3MB 3BDCA 3MXUA 2BDNA 1HA6A 5CV9A 4V190 2J7ZA 3NBIA 3MFYA 5C0XI 2E2HB 1B1ZA 3MFGA 2WV6D 4B9WA 2F0VA 1Q90A 1CZWA 2F0KA 3DMUA 3ZYYX 3S2HB 1EOTA 3AU7A 1JCKB 5CMDA 2B2YA 1Y8NB 3GTKB 1RDPD 4CHTB 2E2JB 1XYIA 3VA5A 3R2TA 4QUFA 2EOTA 1LTGD 4K5XA 2NZ1D 3IFDA 2B63B 1MBYA 1V1PB 2WP8J 3SDZA 3TP8A 2OF1A 3C1FA 2QDBA 4IZ8A 1ZYRC 2NVXB 4ZKBB 1F9PA 4FO2A 3R3OA 4DU9A 4G7ZC 4Z9CB 4DNTB 1W6JA 5EPLA 2Q8TA 2EPBA 4PV1C 4CKCA 2WINB 1STNA 2IX3A 4BBSB 5EGTA 2WAQB 3FDTA 1PYWD 3NPPA 1PRTC 2SNMA 3G6JB 1M8AA 2RVLA 5DEHA 1HA5A 1GHJA 1H9RA 3RZOB 1PRTB 5M9OA 1KDBA 2BA1A 3DM1A 1LT5D 1DD2A 4JBWA 1ENAA 3Q24A 4IUTA 1FNUA 4K8JA 2AUJD 1D2BA 1BF4A 1BCPC 1TQOA 1CQVA 3RD4A 4H13C 3R2IA 2O2LD 1BCPB 1SNDA 2KA7A 3QIAA 4XYQA 1SNCA 3GD7A 1ENCA 5C0XJ 1ZXTA 2D5DA 5DM73 2TSSA 3SEBA 2L0CA 2JEAI 1D5ZC 4KHVA 4CJ0B 3NUCA 2E2IB 1KDCA 1BBXC 2CQAA 2XSCA 1IL8A 2F4IA 1D6EC 1MI2A 5KEEA 1CK1A 3D31A 1A2UA 1MGSA 3I4MB 5COYA 1I50B 4DAVA 2YU9B 3D4WA 3HOXB 3DEOA 1B2TA 2F0HA 3DHQA 2C5CA 1ET9A 1B44D 2A68D 5FO9B 4DAPA 4IFDI 3M7NA 4A93B 4EQNA 4KJOA 5CBAE 3Q0AA 4RCNA 3MZ5A 5K36G 1F2YA 2AQ3B 3VYUA 5CORA 4NDXA 1G6ZA 2HDLA 3ND8A 3PUVA 2L5TA 1HUMA 2O4XA 4WFN3 1I4QA 3AB9A 2K05A 1E2ZA 1PRTF 4J1MA 1SNOA 2GA4B 4QMGA 4F7XA 4TKOB 2EE1A 2NWGA 1H9SA 4NP5A 4K5WA 1JORA 2WKDA 5KYLA 4K2LA 4XDXA 1DOLA 2L55A 2KVMA 4BBRB 2BDOA 2F3VA 1LACA 2RDFA 3M4YA 1BCPF 5G3LD 3QG1A 1TR5A 2PW7A 3A8IE 5JVG3 4IN3A 2EYOA 3TZDA 4RWSC 2Y0SB 3K5MA 4A3GB 5C4ZA 4C2MB 4QB4A 4ZAIA 3EJIA 2PZWA 4G7HC 4G4KA 1SXTA 2B2VC 2MGSA 1B9MA 1RD9D 3CU7A 5CR3A 2QEJC 3EROA 1A3VA 1C8CA 4A3BB 2C9OA 4XT1B 5K36H 2K01A 4K8IA 5A2QE 1PTOB 1QNUA 4IFDJ 1HHVA 1TS3A 5ELFA 3P7JA 1XX8A 3A56A 2Z4HA 3NQIA 1Q8IA 2ZXOA 1PZID 2EXZA 3QB3A 4DN4M 1JICA 2R6GA 1PMRA 2XIWA 4AYBB 4C3IG 2A68C 1STEA 1Y1VB 1QCBD 3C46A 4OIJA 3WOEA 4FNFA 3VR2A 1L0XB 1SYCA 4PQXA 4QCLA 4S3SA 4G7OC 2VXWA 3Q22A 2OXPA 4K2KA 1G2TA 3I72A 3L9AX 3IL8A 2AQ2B 4KY5A 5JJZA 1GUSA 1O7LA 2A73B 1LLRD 2EVBA 5DAUA 2R61A 2JE6I 4LMQD 2O5JC 3KLSX 1PDQA 3MTSA 2XRQD 1EZ6A 3ONAB 5A35A 2M9VA 1JWSD 2BA0A 3PO3B 2DN8A 3RLFA 4J6HA 1EY9A 1OXVA 1LABA 1A6XA 2RSNA 3K57A 4HAEA 4FXKC 3DWQA 3HOWB 3FPPA 3J80E 1DOMA 4EVOA 2F0SA 2D9UA 1H9KA 5LL6S 1V1OA 3BYYB 3J81L 5C44B 1Q1BA 1T5XD 3U9SA 1Q1EA 2K5QA 3K5OA 1E2WA 3E0JA 3I3CA 3T56B 2XN9C 2VB3X 4FXDA 1YNNC 4F88A 2HCCA 4X3TA 4A3MB 2PYKA 3BVMA 3LNNA 3D6CA 5IGFA 2EZVA 3ERQA 1VCIA 2NVYB 5EBCA 2F0JA 4EQOA 4L6TB 2RBMA 3A8KE 5FKAC 3VR6A 2QILA 2HDMA 4KKSA 5HGTA 4JK1C 2OT2A 2LY7A 2EYLA 3EA6A 2JA6B 1PZKD 1D5XC 5I6YA 1EY4A 4B08A 4KD3A 1BUVT 1D1IA 2JSOA 2KQ3A 5C0XG 1SYGA 1WD1A 3MEHA 1DM0B 2JYOA 3HZXA 1GUOA 2MJ8A 4DK0A 1V8QA 2RKSA 2B2TA 2F0DA 2IL8A 1EWHA 2IPKD 1ML0D 1S5BD 1I4GA 3LWEA 3H94A 2B2UA 3S1QB 1CM9A 1S4ZA 1H9JA 1ILQA 1ZYRD 3OWFA 1JQYD 1F77A 1JWMD 2ICIA 4V0BA 2IT1A 5ELDA 1CTMA 4QUCA 1FYCA 3HS0C 3NE5B 2KECA 1RJTA 1WCMB 3OWEB 2MUYA 2PMZB 1WTPA 2N88A 4PMWA 1C4QA 2F0OA 1PRTD 1VDZA 5KRUA 1O80A 1PZJD 3AMUA 3K59A 3S16B 2F0NA 4XYOA 3M85A 4K6DA 5F2DA 4K6LA 2J4XA 3M7GA 3P75A 5EKKA 3SK8A 5C0XH 4ZLTF 1BCPD 1O78A 5JPMC 5HURA 2XWJB 3BZDB 1EY5A 1EY8A 2EY1A 1LO5D 2SDFA 2KJXA 3BDOA 1SEBD 4FVMA 5M5WB 2BCOA 3HOYB 3P1HA 1Z6HA 5FLXL 1KNEA 2PZUA 2MP1A 4MIUA 4NKLA 3I8ZA 2RA4A 4BWGB 2NBFA 1FGBD 4KKUA 2AWOA 1U4PA 5CV7A 1CA5A 2K03A 1CFMA 1EY7A 3URYA 1F2LA 1IYUA 4IUVA 1SNQA 4ZK9B 4RHRA 1MSGA 3K5NA 4WORA 1I3QB 3PIP3 1W6KA 4KD4A 5J1ZA 2F0MA 3J7AF 1SDFA 4F8MA 2R92B 1R4QB 4MN3A 2SNSA 4KHZA 5FLXE 3PUYA 1VF5C 2M00A 1EEFD 5M5XB 2XWBB 4H0LC 1GUNA 1II3A 4X3UA 4IFDG 5T1IA 1WTWA 1EU3A 3OW7A 3FEWX 3S1RB 4KN7C 3QO2A 1HQMC 2ICEC 3S9WA 3RUZA 1TIID 4LJZC 2PCFB 2LKVA 1J8IA 2TMPA 1L0YB 5E4XA 3A7AB 1H9MA 2F0LA 4I7ZC 4KN4C 3PMFA 4NW2A 1TWGB 1SYEA 4TQUS 1SJHD 4KI0A 1DONA 2BOSA 4RCOA 1RCVD 2CHBD 1EWCA 5AFWA 3S2DB 2K5WA 1FD7D 3X3MA 2NVTB 4KMUC 3QJYA 4OHJA 1PLFA 1A3UA 2ZXPA 4WRDA 1AN8A 3M3YB 3T4AC 1ESRA 4OL7A 1LTBD 5FK9C 4QF4A 4FF4A 1QG7A 1I6VC 2WB1B 3TDQA 1FNVA 4IFDH 4HCEA 3TN2A 1R9TB 1IKMA 1CZGA 2EYFA 1DJRD 3MC0B 3N6RA 3K5LA 1BQQT 3KK7A 5CV5A 1RKNA 3MAQA 3HP3A 4O42A 1U4RA 1WTOA 2RDHA 1RTNA 1DYQA 3DWPA 3SVMA 4B9XA 1T5EA 2F0GA 1CT1D 1I4PA 2B2WC 2E75C 5ELBA 1X3QA 4OO1I 1NCVA 5EBDA 1Y69U 1HCZA 4ID6A 2H1EA 1PTOH 4CJ2C 1TVXA 1G2SA 2F0PA 1CHPD 4TSSA 1WTVA 3D6WA 2LS01 5J39A 2CVRA 1Q3LA 4IUQA 2NVQB 4YIJA 3HEJA 1SAPA 4DF7A 1QE6A 2EYHA 5I2YA 3S1NB 1IW7C 1U4LA 2K6AA 3OIQA 5KNBA 5ELCA 5A2QL 4HMIA 1EU4A 2PO4A 1OXUA 5M3FB 1OXXK 1S5ED 4EGVA 1S5FD 2NYZD 4A3IB 2IX1A 2LFNA 2G9DA 4R9WA 2F1MA 3GTJB 4K14A 1HXYD 3KF8A 3PUXA 5IIFA 5KGUA 1SNMA 1M4VA 1OXTA 4X3SA 1OXSC 1PFNA 1PTOC 2VB2X 1U9RA 1YNND 4R8IA 3C2PA 4BY7B 1GJXA 3MHBA 3HOVB 4RGTA 4CBVA 4RGOS 4CGYB 5JVH3 2EY2A 2B8FA 4R8NA 5EPKA 4IUNA 3TSSA 4HMJA 2L1BA 3OMGA 3FRPB 3NHHA 3L7ZC 3OPOA 3H09A 4OGQC 3NTIA 2BE5D 2L12A 5CYUA 3HG9A 2ID0A 5C3XA 3MVVA 5I6WA 3FVQA 3HRZC 5C3WA 2Z4IA 2L4NA 3CHBD 3VYSA 3K6OA 5EPJA 3VA7A 3J80L 1HRJA 4X3KA 2A6HD 2EY6A 4ABNA 4KY6A 3SXHA 5IT9L 2K32A 4KK7A 1NAPA 3BVGA 2HUGA 2LMCB 1NSNS 2KHSA 2O5IC 4H7BA 1STBA 1F2MA 1IKLA 1EEID 2HQEA 2XVSA 4KJNA 3E6ZX 2RDGA 1KABA 4HTHA 1RODA 2PZTA 1SYDA 4FF2A 1AP0A 1F9RA 3IFTA 3EFXD 5IGCA 4A3FB 3WOFA 1D1KA 3KBGA 2B2TC 4F87A 1JWUD 5IT9E 1PTOF 1R4PB 3Q23A 2NN6I 3W3AA 4MHEA 4ZQ3A 3NSWA 5IGEA 1GUGA 2QKIC 4BA1I 1LTAD 3KLRA 2A69D 5ISRA 4RH6A 3J7AV 2H4OA 2KOLA 2ZT9C 1X32A 3I73A 4LAAA 2PQEA 2KEDA 2G9HD 3NK9A 4G57A 1BR9A 1TY2A 4C1NK 5LHY1 1G291 4A3EB 1IHZA 1WTXA 1SYBA 5FO8B 1LTRD 2BE5C 3V96A 1YNJD 5C5LA 3QOLA 4H44C 2NB0A 1XWEA 3NQTA 5ELEA 3QOJA 3KUPA 1CI3M 1DCZA 1JOQA 5BN3A 2VUMB 4UDUC 2M2LA 1SJED 2PNRC 2JXMB 1SE4A 3H0GB 4PNYA 2B39A 1E2VA 1CHQD 2A6HC 2L11A 4DK1A 2F0UA 3CRKC 3NWSA 1AFPA 5NUCA 5JEAJ 3CKIB 5E3FA 4IUPA 2SEBD 3K0YA 1F9SA 2EDGA 4IALA 5J22A 3H91A 1HQRD 3SE0A 1NR2A 3SHLA 3NP8A 2FMCA 3N52A 2AQ1B 1FNWA 3MXNA 4C3JG 3DUZA 1HTLD 2N55A 4RHSA 5KNCA 3OMCA 2B2YC 3C3LA 1E0BA 5E1FA 1KTKA 1EIGA 5EJWA 1UUPA 5C4JB 2K33A 1JOOA 4C1NI 3OOCA 1SE2A 3NWTA 4NMZA 2A69C 4ZUJA 4HCSA 1PFBA 2Z8LA 1GOZA 1LT4D 2Q8IB 5I4DA 1WTRA 2JA5B 3T51B 1MD2D 2X6GA 3MWYW 2EJFC 1QWYA 3GV6A 1DXMA 1LTSD 4N9TA 1A2TA 1GUTA 3R93A 1LT6D 2R93B 1RHPA 5I9OA 3BDLA 4A3DB 1S5DD 1YNJC 3D4RA 1JC7A 1CA6A 1TWHB 3GV3A 3VYTA 1ET6A 4HR7B 1G91A 1I6HB 3GTMB 1G8ZD 1WTQA 4WJWA 3MXGA 3OSOA 5EKIA 1ILPA 3DXJC 3EQLC 3T53B 4A3KB 1S5CD 4L63B 4CKBA 2F3WA 5IGDA 1SMYD 3I90A 1A15A 3V05A 2VNUD 3D4DA 3K7AB 1Z47A 4LK1C 4OO1G 1RTOA 5CBEE 2IX0A 2KCNA 1AZPA 4FYDA 1STYA 5D3IB 1ZKOA 2F0FA 1I4RA 4FF1A 4KTAA 4HSPA 4XXEA 4ZYSA 2JA7B 1IW7D 1DOKA 1PXUA 4P2CB 3O13A 1KLGD 4IQZA 3X3NA 1TS5A 4PMCA 3P20A 2K28A 3RMHA 4BS9A 1Z7TA 3TBIB 4C3JB 2EJGC 1AEXA 3T16A 3I4NB 1TY0A 3UI2A 4DXFA 2F0TA 2A6EC 2PPBC 2JEBI 5DNFA 1NUCA 1SFOB 1U4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7Z C;  1E2W A;  4IFD G;  4DNT B;  5K36 G;  1OXT A;  4HR7 B;  4PV1 C;  1OXS C;  3T56 B;  1TKW B;  3VR5 A;  2R6G A;  1PMR A;  3IFT A;  3OW7 A;  2NN6 H;  2A68 C;  1V43 A;  1YNN C;  2QF7 A;  3FMC A;  3DXJ C;  3ND8 A;  3EQL C;  3PUV A;  4KN7 C;  2EDG A;  2DNC A;  3T53 B;  1H9S B;  4OO1 H;  1T5E A;  1GJX A;  1HQM C;  1VDZ A;  2L5T A;  1GHJ A;  1H9R A;  1Y8P B;  3LNN A;  1B9N A;  1K8M A;  2E75 C;  5JEA G;  3VR2 A;  3LWU A;  3I4L A;  3SE0 A;  2NN6 I;  4BA2 I;  2BA1 A;  3AB9 A;  4LJZ C;  3WDN A;  3BG3 A;  1E2Z A;  1VCI A;  3W3A A;  2PCF B;  1DD2 A;  4JBW A;  1K8O A;  3M85 A;  4G7O C;  2B8F A;  4XTC S;  3PUW A;  1Y69 U;  1GUG A;  4TKO B;  3A8K E;  2CW0 C;  1HCZ A;  3VR6 A;  3A7A B;  3I72 A;  1H9M A;  2AUK A;  4I7Z C;  4KN4 C;  2AUJ D;  2K7V A;  4KKS A;  4BA1 I;  2NN6 G;  1GHK A;  1BDO A;  4JK1 C;  5C0X H;  1H9S A;  4DNR B;  1GUS A;  3IKJ A;  4H13 C;  4LK1 C;  5KNC A;  3A8J E;  3KLR A;  1O78 A;  4OO1 G;  1O7L A;  3MXU A;  2KA7 A;  3QIA A;  2EJM A;  2A69 D;  2BDO A;  4TQU S;  3GD7 A;  4KI0 A;  2EVB A;  1LAC A;  5KND A;  3BDO A;  3M4Y A;  3MFY A;  3VR3 A;  2D5D A;  3L7Z C;  3QG1 A;  3OPO A;  5BN4 A;  2JE6 I;  4OGQ C;  1QJO A;  1Z6H A;  2KCC A;  2O5J C;  2BE5 D;  1SMY C;  1ZKO A;  3CRL C;  3A8I E;  4XIG S;  2JEA I;  3A7L A;  1HTP A;  1Q90 A;  2ZT9 C;  4KMU C;  2B8G A;  3QJY A;  5C0X G;  3I73 A;  2K33 A;  2YYZ A;  4L8J A;  4KKU A;  2AWO A;  3OOC A;  5A35 A;  1IYV A;  2V4D A;  1IW7 C;  1HPC A;  1GUO A;  2BA0 A;  4G7H C;  4DK0 A;  1IW7 D;  1CFM A;  2A69 C;  1G29 1;  1Y8N B;  2DN8 A;  3PUZ A;  1V8Q A;  1B9M A;  2E74 C;  3RLF A;  4IQZ A;  1VF7 A;  5KNB A;  1IYU A;  2Q8I B;  3VA7 A;  1OXV A;  2E76 C;  3ND9 A;  1LAB A;  1EWH A;  2D2C C;  3P20 A;  3T51 B;  1ONL A;  2EJF C;  2BE5 C;  2A6H D;  1A6X A;  3D31 A;  1Z7T A;  1I6V C;  3VR4 A;  1DXM A;  4H44 C;  4IFD H;  1FR3 A;  4DK1 A;  2EJG C;  2K32 A;  1OXU A;  3HGB A;  1Q12 A;  5K36 H;  3FPP A;  3H94 A;  4GZY C;  1CI3 M;  1OXX K;  2LMC B;  1GUT A;  3SDZ A;  1DCZ A;  1H9J A;  5BN3 A;  1H9K A;  2O5I C;  2A68 D;  3TZU A;  4KHZ A;  2D62 A;  5BN5 A;  1TU2 B;  4KKT A;  3N6R A;  2A6E C;  2F1M A;  2JEB I;  1ZYR C;  2PNR C;  3D4R A;  2JXM B;  1Q1B A;  3PUY A;  2PPB C;  3M7N A;  1VF5 C;  2A6E D;  1Y8O B;  1E2V A;  5JEA H;  4H0L C;  3PV0 A;  3PUX A;  2A6H C;  1GUN A;  2IT1 A;  1Q1E A;  1CTM A;  1YNJ C;  3CRK C;  4RCN A;  1FYC A;  3U9S A;  2DNE A;  3GQB A;  3NE5 B; 
#chains in the Genus database with same CATH topology
 5CV4 A;  1QNK A;  4DUY L;  4DGZ A;  4IPD A;  4X66 Q;  5IP9 G;  1PH4 A;  4P75 A;  1UAP A;  3VR5 A;  3NXW A;  4UAI A;  1PTO D;  5FO7 B;  5C5M A;  1ZEQ X;  1SBB B;  3S1N H;  2AWN A;  3ITP A;  4OO1 H;  1H9S B;  4A3J B;  3R8B A;  1P16 A;  3TP5 A;  4J8Q A;  1Y8P B;  2R7Z B;  4JI4 Q;  4KHP Q;  3MXP A;  3ERS X;  3GO5 A;  1TWC B;  1PH2 A;  2F0W A;  3V2T A;  2R3Z A;  3GTP H;  1SE3 A;  1K8O A;  2ZXR A;  1IBM Q;  4B3R Q;  4E6I A;  1V1P A;  5K5P A;  3PUW A;  3FKI H;  3CPW A;  3K58 A;  2I46 A;  2E2D C;  4JV5 Q;  3CQZ B;  3GTQ B;  5I2X A;  2K5D A;  1WVL A;  1PA6 A;  1HFN A;  4DFA A;  1E1T A;  3F2B A;  2UU9 Q;  1LT3 D;  2PW5 A;  5HY6 A;  5KND A;  3GTO B;  3BVZ A;  2A74 C;  1Y1W H;  5D14 A;  2WII B;  2K52 A;  2KCC A;  1ESF A;  5D3D A;  1KXL A;  2JA8 B;  1SMY C;  1AW7 A;  2K4K A;  3HOZ B;  2MPM A;  4LF6 L;  1NMG A;  3F2C A;  4CDF C;  1SNP A;  4FXG C;  4C3H G;  1J9O A;  2VY3 A;  1EQT A;  2V4D A;  3U9O A;  3CC7 A;  2HCI A;  2JP1 A;  2MO0 A;  1HZ9 A;  4FF3 A;  2KUM A;  3PUZ A;  3GTG B;  2E74 C;  2FIN B;  1JR0 D;  2XRS D;  2IW3 A;  3EVQ A;  4L5S A;  4Q0F A;  1MSH A;  4BY7 H;  1O7Z A;  4DXG A;  2F03 A;  3HOV H;  1EQQ A;  2KEE A;  4NPS A;  3TS0 A;  3VR4 A;  1EYC A;  5GAG C;  3RN5 A;  2F4V L;  4U68 A;  1F9Q A;  3D3R A;  4ODG A;  4DA2 A;  4ME5 A;  3PSI A;  4GZY C;  5IP9 H;  4IOC A;  2WFW A;  4A3F G;  1BOS A;  4X62 Q;  2H5X A;  4RKB A;  3S15 H;  1KDA A;  2D62 A;  1J6Q A;  2Q2H A;  2IWH A;  4JPB W;  4KKT A;  4N9P A;  2DUD A;  1BNZ A;  1B3A A;  4GLX A;  1Y8O B;  2IY5 B;  3KDF A;  3GTP B;  5TSS A;  2BH2 A;  4AQY L;  2DNE A;  1L2F A;  4C56 C;  3FKI B;  1HUN A;  3SR1 A;  3G71 A;  1WD0 A;  2Q8R E;  1RL2 A;  2CW0 D;  3NBH A;  1XMO L;  4HJ7 A;  3E5S A;  3TP6 A;  3M4Q A;  4UY8 C;  3STB D;  3I91 A;  4HJ8 A;  4ZUI A;  1KRT A;  3SGI A;  1Y1W B;  1EYD A;  5JEA G;  3I4L A;  4A75 A;  1EYA A;  3WDN A;  4B3S L;  4HSV A;  4RGN A;  1FJG Q;  4DR2 L;  3E9I A;  1O7Y A;  2RQX A;  5JPN C;  4RA8 A;  4ZRZ A;  4MTN A;  1K28 A;  2NN6 G;  1GHK A;  2K04 A;  1BDO A;  5AJ3 L;  4HJ9 A;  1TS2 A;  3LGJ A;  4ILW A;  4C3H H;  2EYP A;  2N8N A;  5C4H A;  2EJM A;  3OTO Q;  2RHQ B;  3KLS A;  1SMX A;  2B2W A;  3PO2 H;  4YCW A;  3OHX C;  1GXD C;  2OQK A;  5CC4 A;  5IWA L;  5BN4 A;  1KD1 C;  1JMC A;  1QJO A;  4YCV A;  1CKO A;  2K5N A;  2VQE Q;  1AZQ A;  1UNS A;  1QIL A;  2MFI A;  3T13 A;  1HTP A;  5KIX A;  3H6M A;  1VQO A;  2B8G A;  2Q2T A;  3G7L A;  2ENB A;  3JAM L;  4DR1 L;  2FFK B;  4ULL A;  2ZJQ A;  4L8J A;  4B3T Q;  1BVS A;  1IYV A;  3S15 B;  2NTS A;  4IUU A;  4A3F H;  3HKS A;  3T1H Q;  2Z0S A;  1EL0 A;  1STH A;  4FDB A;  1JB7 A;  1NY4 A;  2VUM G;  3F2U A;  2DY7 A;  4XQN A;  3ND9 A;  4LF5 Q;  1UE6 A;  3PIO 3;  4PMB A;  2VQF Q;  1EZ8 A;  1WOC A;  3A0J A;  1B53 A;  4RKL A;  4BY1 B;  1D5M C;  5DM6 3;  4XQQ A;  1FR3 A;  4LUO A;  4DV2 Q;  3HGB A;  5EQ0 A;  2I5L X;  4JI2 Q;  1LM0 A;  1N36 L;  1JE4 A;  1BO0 A;  1SSO A;  3TZU A;  3J81 j;  3A55 A;  4A3L G;  4CDC C;  1HFG A;  1TU2 B;  3U4V A;  3D8G A;  3UE0 A;  2K1B A;  1B3Q A;  1OO9 B;  2QDL A;  3MEF A;  1NR4 A;  1I4H A;  1TWA H;  3JAM E;  5JEA H;  4K5V A;  3EIV A;  3I7F A;  4O1N A;  1A8V A;  3G48 A;  3GQB A;  4M1U B;  1WJJ A;  1JOK A;  5D65 A;  5C4X B;  4OX9 L;  1IXR A;  4JI7 L;  4DV1 Q;  4TRD A;  1WTH A;  1W3S A;  3NTH A;  3TEH B;  2UUB Q;  3C1E A;  1E24 A;  4C3H B;  2NN6 H;  2FJ2 A;  1V43 A;  4K0K Q;  1C48 A;  1XNQ L;  1VQE A;  2IJ0 A;  4JOI A;  2B2V A;  3PO2 B;  1SYF A;  4FP5 D;  1K8M A;  2EXD A;  3M4O B;  4OON A;  3S24 A;  1ICF B;  1QOH A;  5IGG A;  1I94 Q;  5CV6 A;  2C35 B;  5EKL A;  5T1G A;  1VQF A;  4R4I A;  1HR0 Q;  1UEA B;  2CW0 C;  3I55 A;  2KCM A;  3DEP A;  3CXC A;  1ICW A;  5M5Y H;  1EY6 A;  2LSS A;  2X69 A;  4DNR B;  4KY7 A;  3STB C;  1IBK L;  1I4X A;  1STA A;  2VUM H;  3VYR A;  1LYL A;  5IOC A;  3D0F A;  3GP7 A;  3VR3 A;  2D0P A;  3FPU B;  3PIO A;  3Q6S A;  3L3O C;  3UDF A;  1TWF B;  1VQL A;  1EFI D;  3W2D A;  1QB5 D;  3L0O A;  4XIG S;  1UE5 A;  3KF6 A;  1XPU A;  2NTT A;  2XNA C;  1MJE A;  3MA2 B;  2B2U C;  4OWW B;  1LTT D;  3HOU H;  1S3O A;  1B70 B;  2EYJ A;  2F0Q A;  4XT3 B;  3DWA A;  1A3T A;  4A3L H;  5C6A A;  2UUC L;  2SOB A;  2R93 G;  1TWA B;  1L1O C;  2F0E A;  2E76 C;  2D2C C;  3TQY A;  1JE5 A;  4OIK A;  3J80 c;  4HED A;  4A3D G;  1L1O B;  1EY0 A;  3H3V H;  3RZD B;  1BXT A;  2I07 B;  5JAV A;  1J5E Q;  3BS1 A;  2QCP X;  5IT9 c;  2L9H A;  3MXN B;  2WKC A;  3K0X A;  4HN7 A;  1XJV A;  3IAY A;  4QIW B;  4U67 3;  2NUC A;  3SK5 A;  1HNW Q;  5M3M G;  5BN5 A;  1VMC A;  3H15 A;  1NE3 A;  4ZKC B;  4A3K G;  2CFM A;  3PV0 A;  3PGZ A;  2G5D A;  5IGB A;  4XQJ A;  4EQP A;  5DLQ E;  4A3C G;  2OEO A;  3J81 E;  3J7Y W;  4DR4 Q;  5CV8 A;  5M5Y B;  1B50 A;  2AMC B;  4Q5V A;  2DY8 A;  4GKJ L;  4GS3 A;  1DZ1 A;  1NJI C;  5C4J H;  1F2Z A;  3SK6 A;  2QF7 A;  2DNC A;  2YV5 A;  4X64 Q;  1B9N A;  3LX0 A;  3QWN A;  4BA2 I;  4YY3 L;  4PZ7 A;  4YHH L;  1VQ5 A;  4P71 A;  2A19 A;  4CKE A;  3CCV A;  2JK8 A;  4I7A A;  2JN4 A;  4GOP B;  1VQ9 A;  1STG A;  1GUW A;  4C3I B;  2K7V A;  3HOU B;  5E4W C;  3U58 A;  3BYT B;  1N34 Q;  3A8J E;  1EQV A;  1I5F A;  2JA7 G;  1YHB A;  4DV4 L;  2MHV A;  1NBW A;  2A1A A;  4IJH A;  2EY5 A;  3S1M H;  3H3V C;  3TP7 A;  2R93 H;  1CKM A;  1BKB A;  1ENF A;  2E8G A;  2XGT A;  2J0T D;  3KBX A;  3CRL C;  1KAA A;  1RF2 D;  2YTV A;  4A3D H;  2OQ0 A;  2A5H A;  1X54 A;  3A7L A;  3Q8D A;  2ES2 A;  3TME A;  1XTC D;  5G3L F;  1TWH H;  5IOD A;  4WJ3 M;  2YYZ A;  1I6H H;  3GTM H;  1K83 B;  3I4N G;  1X3P A;  1HPC A;  1LTI D;  3S17 B;  1KNA A;  5FOB B;  1YJW A;  3A54 A;  5M3M H;  1VF7 A;  2RCF A;  3NTK A;  3GTL B;  4A3K H;  1ONL A;  3CME A;  2E2H H;  2EIF A;  3CCM A;  4A3C H;  2Z1C A;  1Q12 A;  1CQF A;  5LL6 X;  4QIW E;  1XXG A;  3OIP A;  4RGM A;  4Y7N B;  5JOB A;  4DAY A;  4KV6 A;  3HKZ B;  2CWA A;  4M8A A;  1JJG A;  2K75 A;  1SE8 A;  2HT1 A;  2A6E D;  1LV9 A;  3GTK H;  2R7Z G;  2EYM A;  2WAC A;  2FMM A;  2MNA A;  1KHI A;  4UPA A;  1JB3 A;  5KYI A;  2X6L A;  4O0A A;  1VMP A;  1TT2 A;  1EFW A;  4DR3 L;  1TKW B;  1B4O A;  4IUR A;  4RFB A;  2FHT A;  3WWV A;  4DUZ L;  2F0I A;  3FMC A;  5I9P A;  1EIH A;  1KLU D;  3S1M B;  3S14 B;  2JA7 H;  4CJ1 B;  1E7Z A;  2RSO A;  2NVX H;  3I70 A;  1TS4 A;  2PQA A;  3LWU A;  2ALY B;  1PFM A;  3BG3 A;  4I65 A;  5C3E B;  3ICE A;  2JA8 G;  3SK4 A;  5CGK A;  4XTC S;  3HOZ G;  3I4M G;  4DV3 Q;  2AUK A;  4RAU C;  4DV0 L;  3RN2 A;  5JJI A;  2QEX A;  3IKJ A;  4X65 Q;  5M3M B;  3BDC A;  3MXU A;  2BDN A;  3I4N H;  1HA6 A;  4NXM L;  2UXC L;  1XMQ L;  5CV9 A;  4V19 0;  2J7Z A;  4RMF A;  4LF9 Q;  3NBI A;  3MFY A;  4LW1 A;  5C0X I;  2E2H B;  4DV5 Q;  3G6E A;  1B1Z A;  3MFG A;  2WV6 D;  1SFO H;  4B9W A;  4DR5 L;  3AQQ A;  1D7Q A;  1L0W A;  4GNX C;  2F0V A;  1Q90 A;  3UDI A;  1CZW A;  2F0K A;  4MNO A;  3DMU A;  3ZYY X;  3S2H B;  1EOT A;  3AU7 A;  1JCK B;  4LUZ A;  5CMD A;  2B2Y A;  1Y8N B;  1VQ7 A;  3GTK B;  2KBN A;  1RDP D;  4LF8 Q;  4CHT B;  4LFC L;  2E2J B;  1XYI A;  4JI5 Q;  3VA5 A;  3R2T A;  4QUF A;  1FVI A;  1LTG D;  2EOT A;  4K5X A;  3TRZ A;  2NZ1 D;  3IFD A;  3FKI G;  3A5Z B;  2B63 B;  2IHE A;  1MBY A;  1V1P B;  4TVA B;  4POG A;  1IZ6 A;  1PVO A;  3B6Y A;  2WP8 J;  5IYD G;  2JQO A;  3SDZ A;  3TP8 A;  1IBL Q;  2OF1 A;  3CQZ H;  3C1F A;  3GTQ H;  2QDB A;  1QUQ A;  5IYB G;  4IZ8 A;  1KIX A;  3K81 C;  1B8A A;  1ZYR C;  4BBR G;  4ZKB B;  1F9P A;  2NVX B;  3HKZ E;  3U50 C;  4FO2 A;  3R3O A;  3GTO H;  4DU9 A;  4LF7 L;  4JI8 Q;  1X3F A;  1FGU A;  4G7Z C;  4Z9C B;  4DNT B;  2JA8 H;  1VQH A;  1W6J A;  5EAY A;  5EPL A;  2Q8T A;  2EPB A;  4ZCK A;  4PV1 C;  3HOZ H;  3I4M H;  4CKC A;  2WIN B;  1I50 H;  2ASB A;  1STN A;  2IX3 A;  4BBS B;  5EGT A;  4OWX B;  2WAQ B;  5LMU L;  3FDT A;  1PYW D;  3PF4 A;  2Z6K C;  3NPP A;  1QVG A;  1PRT C;  2SNM A;  3G6J B;  1M8A A;  2RVL A;  1EOV A;  5DEH A;  1HA5 A;  1GHJ A;  1H9R A;  4QGU A;  3RZO B;  1PRT B;  5M9O A;  1KDB A;  2BA1 A;  3DM1 A;  1LT5 D;  1DD2 A;  4JBW A;  1ENA A;  3Q24 A;  4IUT A;  1FNU A;  4K8J A;  2AUJ D;  1D2B A;  1BF4 A;  1BCP C;  1TQO A;  1CQV A;  3RD4 A;  4H13 C;  3EN2 A;  3R2I A;  2O2L D;  1BCP B;  1SND A;  2KA7 A;  3QIA A;  4XYQ A;  4DR6 Q;  4A76 A;  1SNC A;  3GD7 A;  1ENC A;  5C0X J;  1ZXT A;  2D5D A;  3J81 i;  5DM7 3;  3ULP A;  2TSS A;  3SEB A;  2L0C A;  3KDF B;  4BY1 G;  2JEA I;  3DM3 A;  1D5Z C;  1PFS A;  4KHV A;  4CJ0 B;  3NUC A;  2E2I B;  1KDC A;  1BBX C;  2CQA A;  2XSC A;  3NBH B;  1IL8 A;  5IYD H;  1XPO A;  2F4I A;  1D6E C;  5IYB H;  4BBR H;  4B3M L;  1MI2 A;  1BBU A;  5KEE A;  1CK1 A;  3D31 A;  3KF8 B;  1YJ9 A;  1A2U A;  2ATW A;  1MGS A;  3I4M B;  5COY A;  3FHW A;  1I50 B;  4DAV A;  1KC8 C;  2YU9 B;  3D4W A;  5C4X G;  5JJK A;  4EQ5 A;  4DV6 L;  1EIY B;  3HOX B;  3DEO A;  1B2T A;  2F0H A;  3DHQ A;  2C5C A;  1ET9 A;  1B44 D;  2A68 D;  1YI2 A;  5FO9 B;  4DAP A;  4IFD I;  3M7N A;  1SN8 A;  4A93 B;  3PO2 G;  2MQH A;  4EQN A;  4KJO A;  5CBA E;  4NXN Q;  3Q0A A;  4RCN A;  1QVC A;  3T1Y Q;  4JI4 L;  3CC4 A;  3MZ5 A;  5K36 G;  1F2Y A;  2AQ3 B;  3VYU A;  2JJQ A;  2OTL A;  5COR A;  4NDX A;  2WAQ E;  1IBM L;  4JVZ A;  4B3R L;  4JI0 Q;  1G6Z A;  2HDL A;  4CDD C;  3AEV A;  3ND8 A;  3PUV A;  3PO3 G;  4JV5 L;  2L5T A;  1HUM A;  2O4X A;  1S72 A;  3K80 C;  4WFN 3;  4DV7 Q;  1I4Q A;  3AB9 A;  2K05 A;  1E2Z A;  1K9M C;  2IHF A;  2UU9 L;  1PRT F;  4J1M A;  4BY1 H;  1SNO A;  2GA4 B;  3M9B A;  4QMG A;  4F7X A;  4TKO B;  4R1J A;  2EE1 A;  1UWV A;  2NWG A;  1H9S A;  2V1C C;  4NP5 A;  4K5W A;  1YIT A;  1JOR A;  1KAW A;  2WKD A;  5KYL A;  4K2L A;  4XDX A;  2HHH Q;  1DOL A;  2L55 A;  2KVM A;  5C44 G;  4BBR B;  2BDO A;  2F3V A;  4UP8 A;  4HIO A;  1LAC A;  2RDF A;  2K5V A;  3M4Y A;  1BCP F;  5G3L D;  2QGQ A;  3QG1 A;  1TR5 A;  1D8L A;  2ZTE A;  4N8F A;  2PW7 A;  3A8I E;  5JVG 3;  4IN3 A;  2EYO A;  3TZD A;  4RWS C;  4QL5 A;  2Y0S B;  3K5M A;  5C4X H;  4A3G B;  2B29 A;  1WFQ A;  2LXK A;  4A4I A;  3ER0 A;  5C4Z A;  4C2M B;  1HH2 P;  4QB4 A;  3EJI A;  2PZW A;  4ZAI A;  4HJ5 A;  4G7H C;  4G4K A;  1SXT A;  2B2V C;  2MGS A;  2VW9 A;  1B9M A;  1WI5 A;  3KFU A;  1PH9 A;  1RD9 D;  1X65 A;  4IPC A;  3CU7 A;  2PI2 A;  3K8A A;  5CR3 A;  4X62 L;  2QEJ C;  1YZ6 A;  2ZM6 Q;  3M4O H;  3ERO A;  1A3V A;  1C8C A;  4A3B B;  2C9O A;  4XT1 B;  2OCE A;  5K36 H;  5ELN A;  2VL6 A;  4JI3 Q;  2K01 A;  2KHJ A;  4K8I A;  1VQP A;  5A2Q E;  1PTO B;  1QNU A;  4IFD J;  1HHV A;  1MKH A;  4DR7 L;  1TS3 A;  2DJF C;  5ELF A;  3PO3 H;  3RR5 A;  1M1K C;  3P7J A;  1HNX Q;  1XX8 A;  3A56 A;  2Z4H A;  3NEL A;  3NQI A;  4MZ9 A;  1Q8I A;  1TWF H;  2ZXO A;  1PZI D;  1XNQ Q;  2EXZ A;  3QB3 A;  3KF6 B;  4DN4 M;  1JIC A;  3HOW H;  2R6G A;  1PMR A;  2XIW A;  4AYB B;  4C3I G;  1FJG L;  3HOU G;  1Q82 C;  1K8A C;  2A68 C;  1STE A;  1Y1V B;  4DPG A;  1QCB D;  4P74 A;  1Q8K A;  3C46 A;  4OIJ A;  3WOE A;  4FNF A;  5C44 H;  1PYS B;  3VR2 A;  1L0X B;  2QA4 A;  1SYC A;  2NZO A;  3OTO L;  4PQX A;  4QCL A;  4S3S A;  1YHQ A;  4G7O C;  1EYG A;  2VXW A;  3Q22 A;  1X56 A;  2OXP A;  4K2K A;  3RZD H;  3I72 A;  3L9A X;  1G2T A;  3IL8 A;  3EBE A;  2AQ2 B;  2VQE L;  4KY5 A;  5JJZ A;  1GUS A;  4JYA L;  4JBK A;  1O7L A;  2UUA Q;  1EIF A;  2A73 B;  1LLR D;  4B3T L;  2EVB A;  4A3M H;  5DAU A;  4JBM A;  2R61 A;  3T1H L;  2JE6 I;  4JI6 Q;  4LMQ D;  1K3R A;  2O5J C;  1NNX A;  3KLS X;  1PDQ A;  3MTS A;  1N9W A;  5E7N A;  2UXB Q;  2XRQ D;  1EZ6 A;  2VQF L;  2Y0S E;  3ONA B;  3JAM c;  2ZJR A;  1AH9 A;  5A35 A;  2M9V A;  3AFQ A;  4UP7 A;  1JWS D;  2BA0 A;  4DV2 L;  4HIK A;  3PO3 B;  4JI2 L;  2DN8 A;  3RLF A;  3HKZ G;  3CW2 C;  4J6H A;  1EY9 A;  1OXV A;  1LAB A;  3CD6 A;  2Z6B A;  1A6X A;  3F1Z A;  4R4O A;  2RSN A;  4H02 A;  1HNZ Q;  1YNX A;  3K57 A;  4HAE A;  4FXK C;  3DWQ A;  3HOW B;  3FPP A;  1GVP A;  3J80 E;  1DOM A;  1SR3 A;  5GAD C;  3CP0 A;  4C3I H;  2F0S A;  4EVO A;  2D9U A;  1H9K A;  1N32 Q;  1NMF A;  5LL6 S;  1V1O A;  3CMA A;  4DV1 L;  3BYY B;  4LWC A;  2CH4 W;  3J81 L;  5C44 B;  2UUB L;  5BR8 Q;  1Q1B A;  5GAH C;  1T5X D;  2YTY A;  3U9S A;  1Q1E A;  2K5Q A;  3L2P A;  3K5O A;  1E2W A;  5C3E G;  4L5T A;  4DK3 C;  3E0J A;  3I3C A;  3T56 B;  1SRO A;  2XN9 C;  1I94 L;  2VB3 X;  1AE2 A;  1W2B A;  4POF A;  3S1Q H;  4AYB E;  1ASZ A;  4FXD A;  1QZG A;  1YNN C;  4F88 A;  1HR0 L;  2HCC A;  1K83 H;  4X3T A;  4A3M B;  2PYK A;  1JT8 A;  3BVM A;  3S17 H;  3LNN A;  3D6C A;  5IGF A;  2EZV A;  1A62 A;  3ERQ A;  3A5U A;  1VCI A;  2DGY A;  2NVY B;  5EBC A;  3GTL H;  2F0J A;  4EQO A;  4R4Q A;  3RLN A;  4L6T B;  3TRE A;  4OXP A;  2RBM A;  3A8K E;  5FKA C;  2K5H A;  4YWK A;  2QIL A;  3VR6 A;  2HDM A;  4KKS A;  5HGT A;  1E3P A;  4JK1 C;  3VDY A;  5GAE C;  2OT2 A;  2LY7 A;  4Y7N H;  4DAY B;  2AKW B;  1UE7 A;  2EYL A;  3EA6 A;  2JA6 B;  1PZK D;  1D5X C;  3CCJ A;  3S16 H;  2OTJ A;  1QZH A;  5I6Y A;  1EY4 A;  4GOP C;  4B08 A;  4KD3 A;  4OEL B;  1BUV T;  1D1I A;  2B63 G;  1X3G A;  2JSO A;  2KQ3 A;  3RLO A;  1SYG A;  5C0X G;  1WD1 A;  3MEH A;  1DM0 B;  1E22 A;  1J5E L;  2JYO A;  3HZX A;  1GUO A;  2MJ8 A;  1XNR Q;  4DK0 A;  1V8Q A;  2RKS A;  2B2T A;  1Q86 C;  2R7D A;  2F0D A;  2PNH A;  3S14 H;  2E5L Q;  3CCQ A;  3E9H A;  2IL8 A;  1EWH A;  3RNU A;  1HNW L;  5M5W H;  3FP9 A;  2PQA B;  2IPK D;  2A8V A;  1VQJ A;  4PZ6 A;  1ML0 D;  1YIJ A;  1S5B D;  1I4G A;  5C3E H;  1QVF A;  4YWM A;  3LWE A;  2I5M X;  4JI1 Q;  3H94 A;  2B2U A;  3S1Q B;  1CM9 A;  1GO3 E;  4BBS G;  1S4Z A;  2WAQ G;  1H9J A;  1K8G A;  4QJF A;  3CCR A;  4DR4 L;  1ILQ A;  1YJN A;  1ZYR D;  1L1O A;  3OWF A;  1JQY D;  1F77 A;  1JWM D;  2ICI A;  5LMN Q;  4V0B A;  2IT1 A;  5ELD A;  5JJL A;  1CTM A;  4QUC A;  1FYC A;  3HS0 C;  3NE5 B;  4X64 L;  2KEC A;  1SRU A;  1V9P A;  1RJT A;  1P8L A;  1WCM B;  1XTD A;  5FJ8 G;  1A63 A;  5J3B A;  2XTI A;  4GKK Q;  3OWE B;  2MUY A;  3S2H H;  2PMZ B;  1UEB A;  1WTP A;  2N88 A;  2R92 H;  4PMW A;  1C4Q A;  2F0O A;  1AE3 A;  1PRT D;  1VDZ A;  5KRU A;  4LUV A;  1N34 L;  1O80 A;  1PZJ D;  3AMU A;  3K59 A;  2ZJP A;  3S16 B;  4AH6 A;  1HZB A;  2F0N A;  4XYO A;  2Q2U A;  2E2J H;  3M85 A;  4K6D A;  1YVC A;  5F2D A;  1WYD A;  4JBJ A;  4K6L A;  2J4X A;  2D0O A;  3M7G A;  3P75 A;  5EKK A;  3SK8 A;  2B63 H;  2CCZ A;  5C0X H;  4LF4 Q;  4ZLT F;  1BCP D;  1O78 A;  5JPM C;  1PHJ A;  5HUR A;  2XWJ B;  3BZD B;  1EY5 A;  1EY8 A;  2EY1 A;  3PCO B;  1QUQ B;  1LO5 D;  2SDF A;  2KJX A;  3BDO A;  1SEB D;  1VQA A;  4FVM A;  5M5W B;  3F2D A;  2BCO A;  3HOY B;  3P1H A;  1Z6H A;  5FLX L;  1KNE A;  2PZU A;  2MP1 A;  4MIU A;  4NKL A;  2N49 A;  3I8Z A;  2RA4 A;  4BWG B;  2MO1 A;  4LFA Q;  1VQM A;  3HFZ B;  2HIV A;  1KQS A;  2NBF A;  1FGB D;  4KKU A;  2AWO A;  3HOX G;  1U4P A;  5CV7 A;  1CA5 A;  3BU2 A;  1GM5 A;  4BBS H;  2K03 A;  1CFM A;  5FLM G;  1EY7 A;  3URY A;  1F2L A;  4OEM B;  2UXD Q;  4A93 G;  1IYU A;  4IUV A;  1SNQ A;  2GN5 A;  4ZK9 B;  4R4T A;  4RHR A;  1MIU A;  3RZO H;  1MSG A;  3K5N A;  1MJC A;  4LFB Q;  4WOR A;  1I3Q B;  2B3G A;  3PIP 3;  1YBY A;  1W6K A;  4KD4 A;  5J1Z A;  2F0M A;  3J7A F;  1SDF A;  5FJ8 H;  4NB3 A;  4F8M A;  2R92 B;  1R4Q B;  4MN3 A;  2SNS A;  4KHZ A;  4KLK A;  5FLX E;  3PUY A;  1VF5 C;  3KOJ A;  2M00 A;  1EEF D;  5M5X B;  2XWB B;  4H0L C;  4L5R C;  3CC2 A;  1GUN A;  1N33 Q;  1II3 A;  4X3U A;  4IFD G;  5T1I A;  1WTW A;  3DLL A;  1EU3 A;  1EUJ A;  3OW7 A;  2E2I H;  3FEW X;  1PH3 A;  3S1R B;  2PMZ E;  4KN7 C;  3QO2 A;  1HQM C;  2ICE C;  1GKH A;  3S9W A;  3RUZ A;  4DUY Q;  3TS2 A;  1TII D;  2QW7 A;  4LJZ C;  1NTG A;  2PCF B;  2LKV A;  3K7U C;  1J8I A;  3J80 i;  2TMP A;  4LF9 L;  4WJ4 A;  1L0Y B;  4DV5 L;  1CUK A;  5E4X A;  2F52 A;  3A7A B;  1H9M A;  2F0L A;  4I7Z C;  2Y0S G;  4KN4 C;  3F8T A;  3PMF A;  2YU9 H;  4EX5 A;  4A3G G;  4NW2 A;  3HOX H;  5HGQ A;  4A3I G;  1TWG B;  1SYE A;  1X3E A;  4TQU S;  1SJH D;  4KI0 A;  5FLM H;  1DON A;  4A93 H;  2BOS A;  4RCO A;  1Q81 C;  1RCV D;  1VQC A;  2CHB D;  1EWC A;  5AFW A;  3S2D B;  2K5W A;  1FD7 D;  3X3M A;  4LF8 L;  4A3B G;  2NVT B;  3PIP A;  4ME3 A;  4KMU C;  1FL0 A;  3QJY A;  4OHJ A;  1PLF A;  4JI5 L;  3KJO A;  2YTX A;  4B3M Q;  1A3U A;  2ZXP A;  4WRD A;  1AN8 A;  3M3Y B;  3KLW A;  3T4A C;  3J7A 5;  1IBL L;  1ESR A;  4OL7 A;  1LTB D;  5FK9 C;  4QF4 A;  5IY0 A;  4LF6 Q;  4LNQ A;  4FF4 A;  1QG7 A;  3IRB A;  1I6V C;  2OWO A;  2WB1 B;  3TDQ A;  1FNV A;  4GNX A;  1JJ2 A;  3CCU A;  4IFD H;  4HCE A;  3TN2 A;  3AFP A;  3W5O A;  1R9T B;  1IKM A;  4UHV A;  3CPF A;  2KCT A;  4JI8 L;  1CZG A;  2EYF A;  4AYB G;  2NVQ H;  1XPR A;  1DJR D;  1Y1V G;  3MC0 B;  2NZH A;  3N6R A;  3K5L A;  2F4V Q;  1BQQ T;  3KK7 A;  2RCN A;  2VS1 A;  5CV5 A;  1RKN A;  3MAQ A;  4PG3 A;  3HP3 A;  4O42 A;  2CQO A;  5IYC G;  1U4R A;  1WTO A;  2RDH A;  3E0E A;  2ZTC A;  5LMN W;  1PH5 A;  1Y14 B;  1RTN A;  5M3F H;  1DYQ A;  4A3G H;  1O7I A;  3JC6 6;  3DWP A;  3SVM A;  3KJP A;  4B9X A;  4DNI A;  4X66 L;  4C2M H;  4AQY Q;  4A3I H;  1T5E A;  2F0G A;  1CT1 D;  1I4P A;  1UE1 A;  2B2W C;  2P5Z X;  3GDE A;  3GTJ H;  3CF5 A;  2E75 C;  1C0A A;  1M90 C;  4JC0 A;  5ELB A;  1X3Q A;  1XMO Q;  4DR6 L;  1CKN A;  4OO1 I;  1PH1 A;  1NCV A;  2HD3 A;  5EBD A;  1Y69 U;  4A3B H;  4KHP L;  1HCZ A;  2Z6K A;  4ID6 A;  2H1E A;  2R7F A;  4B3S Q;  1PTO H;  4CJ2 C;  4DR2 Q;  1TVX A;  1G2S A;  2F0P A;  1CHP D;  4TSS A;  1WTV A;  1X9N A;  1VQ6 A;  1CSP A;  3D6W A;  2LS0 1;  2HIX A;  1VQ8 A;  5J39 A;  5AJ3 Q;  3I56 A;  2CVR A;  5GRO A;  1Q3L A;  1VQG A;  4IUQ A;  3HOW G;  2NVQ B;  4YIJ A;  3HEJ A;  1SAP A;  4DF7 A;  1QE6 A;  2EYH A;  5I2Y A;  3S1N B;  1IW7 C;  5IWA Q;  1U4L A;  1Y1V H;  2K6A A;  2DJG C;  3OIQ A;  5KNB A;  5ELC A;  2N3S A;  5A2Q L;  4DR1 Q;  3U4Z A;  2CH4 A;  2L15 A;  4GN4 B;  4HMI A;  1EU4 A;  5IYC H;  2PO4 A;  1U0L A;  2WB1 E;  4NXN L;  1OXU A;  4DR7 Q;  5M3F B;  1OXX K;  4DK6 C;  1S5E D;  4EGV A;  3T1Y L;  1S5F D;  2NYZ D;  4APV A;  4A3I B;  2LFN A;  2IX1 A;  4JOI C;  2I5H A;  2G9D A;  4R9W A;  2F1M A;  3GTJ B;  4K14 A;  3J7Z C;  4A3M G;  1HXY D;  3KF8 A;  3PQI A;  4JI0 L;  3PUX A;  4P72 A;  5IIF A;  5KGU A;  1SNM A;  1N36 Q;  1M4V A;  1OXT A;  4X3S A;  4DV7 L;  1OXS C;  1PFN A;  4ALP A;  1PTO C;  2VB2 X;  1U9R A;  3BZC A;  3CCL A;  1MHW C;  1VQB A;  1VQK A;  4YCU A;  4GLV B;  1YNN D;  4R8I A;  3C2P A;  4BY7 B;  4A3E G;  1GJX A;  3MHB A;  4JCV E;  3HOV B;  4BXX G;  4RGT A;  4OX9 Q;  4JI7 Q;  4CBV A;  4RGO S;  5IE8 A;  4CGY B;  3BJU A;  2HHH L;  3A74 A;  5JVH 3;  2JA6 G;  2PI2 E;  2EY2 A;  3NEN A;  4JYA Q;  2B8F A;  1LTL A;  1BBW A;  2CWP A;  4R8N A;  5EPK A;  4IPH A;  4IUN A;  4N8X 1;  3TSS A;  1HZC A;  3KYH C;  1PH7 A;  3ULJ A;  4HMJ A;  2L1B A;  3H0G G;  3OMG A;  3FRP B;  5ELO A;  3NHH A;  3L7Z C;  1VQ4 A;  3OPO A;  3H09 A;  4OGQ C;  3NTI A;  3CCS A;  4J15 A;  3UDG A;  2BE5 D;  2L12 A;  5CYU A;  2BH8 A;  3HG9 A;  2ID0 A;  1KL9 A;  1IBK Q;  2ZM6 L;  4L5Q A;  5C3X A;  4HJA A;  3I2Z A;  3MVV A;  5I6W A;  3FVQ A;  3HRZ C;  5C3W A;  2Z4I A;  2L4N A;  4JI3 L;  3CHB D;  3VYS A;  3K6O A;  5EPJ A;  3VA7 A;  3J80 L;  1HRJ A;  4X3K A;  1G6P A;  2A6H D;  2EY6 A;  4ABN A;  4KY6 A;  3SXH A;  2NVY H;  5IT9 L;  1E1O A;  4IJL A;  2K32 A;  4KK7 A;  1K3B C;  1HJP A;  1NAP A;  3BZK A;  1HNX L;  4LF5 L;  3BVG A;  2UUC Q;  4YWL A;  1WCM G;  2N78 A;  4UP9 A;  2HUG A;  2LMC B;  1NSN S;  2KHS A;  2O5I C;  4H7B A;  1STB A;  1T9H A;  1F2M A;  1IKL A;  1EEI D;  2HQE A;  4A3E H;  3AYH B;  2XVS A;  4BXX H;  4KJN A;  3E6Z X;  3M4P A;  2RDG A;  2JA6 H;  4IOA A;  1KAB A;  4HTH A;  1ROD A;  2PZT A;  1SYD A;  4FF2 A;  1AP0 A;  1F9R A;  2RF4 A;  2RHS B;  3IFT A;  3EFX D;  5IGC A;  4A3F B;  3WOF A;  3OW2 A;  1D1K A;  3KBG A;  4Y52 H;  5IP7 G;  3E3X A;  1Z9F A;  2B2T C;  2I0Q A;  4F87 A;  2K50 A;  1JWU D;  5IT9 E;  1PTO F;  1R4P B;  3H0G H;  3Q23 A;  2NN6 I;  2JA5 G;  2ZTD A;  1X55 A;  4K0K L;  2UUA L;  3W3A A;  3HOY G;  4MHE A;  4GKJ Q;  1C7Y A;  1C9O A;  4ZQ3 A;  3NSW A;  5IGE A;  2LXJ A;  1GUG A;  2EQS A;  2QKI C;  4JI6 L;  4BA1 I;  1LTA D;  1K73 C;  4IO9 A;  3KLR A;  4YY3 Q;  4YHH Q;  2UXB L;  1GD7 A;  1VQD A;  2A69 D;  2GVA A;  1ASY A;  5ISR A;  1K0R A;  4RH6 A;  3J7A V;  2H4O A;  2KOL A;  1IL2 A;  3UE1 A;  2ZT9 C;  4DAM A;  1X32 A;  5L37 A;  2AHO B;  3CAM A;  4DV4 Q;  1B7Y B;  3I73 A;  4LAA A;  2PQE A;  2KED A;  2G9H D;  1WCM H;  3NK9 A;  1HNZ L;  1U5K A;  4G57 A;  2R92 G;  1BR9 A;  1TY2 A;  4C1N K;  1HZA A;  5LHY 1;  1G29 1;  4A3E B;  4JG2 A;  1N32 L;  1LUZ A;  1IHZ A;  1WTX A;  1SYB A;  5FO8 B;  1LTR D;  4R4C A;  2BE5 C;  3V96 A;  1YNJ D;  5C5L A;  5BR8 L;  3QOL A;  4H44 C;  2NB0 A;  1XWE A;  3NQT A;  5ELE A;  3QOJ A;  4HID A;  3KUP A;  1CI3 M;  1DCZ A;  3H3V I;  5BN3 A;  1JOQ A;  2VUM B;  4UDU C;  2M2L A;  5IP7 H;  1H95 A;  1SJE D;  2PNR C;  3J81 c;  2JXM B;  1SE4 A;  3H0G B;  4PNY A;  2B39 A;  1E2V A;  1CHQ D;  3ULL A;  2A6H C;  2L11 A;  4DK1 A;  2JA5 H;  1KRS A;  2F0U A;  3CRK C;  1VQI A;  1Q7Y C;  3HOY H;  3NWS A;  1AFP A;  5NUC A;  2HQL A;  5JEA J;  3CKI B;  5E3F A;  4IUP A;  2SEB D;  1EWI A;  1TXY A;  3K0Y A;  1F9S A;  2EDG A;  4IAL A;  5J22 A;  3H91 A;  1HQR D;  3SE0 A;  4DR3 Q;  1NR2 A;  3SHL A;  3NP8 A;  2FMC A;  4JW0 A;  3N52 A;  2AQ1 B;  1IYJ B;  4DUZ Q;  1FNW A;  3MXN A;  4C3J G;  3DUZ A;  1I3Q H;  4O2D A;  1HTL D;  2N55 A;  4RHS A;  5KNC A;  1CSQ A;  2Q2I A;  3OMC A;  2B2Y C;  2FXQ A;  3C3L A;  1E0B A;  1PYB A;  1S40 A;  1XNR L;  5E1F A;  4DV0 Q;  5M5X H;  4GLA C;  2E5L L;  1KTK A;  2WB1 G;  1EIG A;  5EJW A;  3W1B A;  4NXM Q;  1UUP A;  5C4J B;  2UXC Q;  2K33 A;  1JOO A;  4C1N I;  1XMQ Q;  3OOC A;  1PV4 A;  3K7A H;  1SE2 A;  3NWT A;  5H1S E;  4NMZ A;  2A69 C;  4JI1 L;  4ZUJ A;  4A3J G;  4DR5 Q;  3S1R H;  4HCS A;  1PFB A;  2Z8L A;  1GOZ A;  1LT4 D;  2Q8I B;  5I4D A;  1WTR A;  1PH8 A;  2JA5 B;  3T51 B;  2CKZ B;  1MD2 D;  2X6G A;  3MWY W;  2EJF C;  1QWY A;  3GV6 A;  1DGS A;  2KHI A;  1DXM A;  4GOP A;  1LTS D;  4N9T A;  5LMN L;  4RG1 A;  1A2T A;  1X6O A;  1GUT A;  3R93 A;  4GN5 A;  4LFC Q;  1LT6 D;  1VS0 A;  2R93 B;  4GKK L;  1TWG H;  1RHP A;  5I9O A;  4MTK A;  3BDL A;  4A3D B;  1S5D D;  1YNJ C;  2KEN A;  3D4R A;  1JC7 A;  1CA6 A;  1TWH B;  3GV3 A;  3VYT A;  3PF5 A;  3S2D H;  1ET6 A;  4HR7 B;  2F3I A;  1G91 A;  1I6H B;  3GTM B;  4C3J H;  1JJC B;  1G8Z D;  2NVT H;  1WTQ A;  4WJW A;  3MXG A;  3OSO A;  5EKI A;  1HR0 W;  3JAM i;  4IPG A;  1ILP A;  3DXJ C;  1PH6 A;  3EQL C;  1G51 A;  3T53 B;  4LF7 Q;  3M3Y H;  4A3K B;  4LF4 L;  1S5C D;  1VQN A;  4L63 B;  4AIM A;  4CKB A;  1Q46 A;  2F3W A;  2K14 A;  5GQO A;  4QY7 A;  5IGD A;  5LMU Q;  1SMY D;  1EQR A;  3I90 A;  4CDE C;  3UDX A;  1A15 A;  3V05 A;  2VNU D;  4GNX B;  3D4D A;  4OWT B;  3K7A B;  4X6A H;  1Z47 A;  1R9T H;  2GVB A;  4LK1 C;  3CCE A;  4OO1 G;  4DV3 L;  4LFA L;  1RTO A;  5CBE E;  4A3J H;  2R7Z H;  4X65 L;  2IX0 A;  2KCN A;  1K0S A;  1AZP A;  4FYD A;  1STY A;  1YHA A;  5D3I B;  1TWC H;  1ZKO A;  3G4S A;  2UXD L;  5FLX c;  4P73 A;  1N8R C;  2F0F A;  1I4R A;  4FF1 A;  3W1G A;  5M3F G;  4KTA A;  4HSP A;  4XXE A;  4ZYS A;  4LFB L;  2JA7 B;  4QQB X;  2JA9 A;  1IW7 D;  1DOK A;  1PXU A;  4P2C B;  3O13 A;  1KLG D;  4IQZ A;  3X3N A;  1TS5 A;  1Y1W G;  4PMC A;  3NEM A;  4PZ8 A;  3P20 A;  2K28 A;  3RMH A;  4BS9 A;  3I4O A;  3ZJY C;  1Z7T A;  3TBI B;  1CKN B;  4C3J B;  1SLJ A;  2EJG C;  4DKA C;  2VZA A;  1N33 L;  1AEX A;  1V1Q A;  1A0I A;  1RIP A;  3T16 A;  3I4N B;  1TY0 A;  2Z9H A;  3UI2 A;  4DXF A;  2F0T A;  2A6E C;  1OTC A;  2JEB I;  3QR8 A;  5DNF A;  2PPB C;  1YEZ A;  4BY7 G;  3OYY A;  3GTG H;  3HOV G;  1NUC A;  1SFO B;  4GN3 B;  1U4M A;  4DV6 Q;  4HIM A; 
#chains in the Genus database with same CATH homology
 5CV4 A;  1QNK A;  4DGZ A;  1UAP A;  3VR5 A;  3NXW A;  4UAI A;  1PTO D;  5FO7 B;  5C5M A;  1ZEQ X;  1SBB B;  2AWN A;  3ITP A;  4OO1 H;  1H9S B;  4A3J B;  3R8B A;  3TP5 A;  4J8Q A;  1Y8P B;  2R7Z B;  3MXP A;  3GO5 A;  1TWC B;  2F0W A;  3V2T A;  2R3Z A;  1SE3 A;  1K8O A;  2ZXR A;  4E6I A;  1V1P A;  5K5P A;  3PUW A;  3K58 A;  2I46 A;  2E2D C;  3CQZ B;  3GTQ B;  5I2X A;  2K5D A;  1WVL A;  1HFN A;  4DFA A;  1LT3 D;  2PW5 A;  5KND A;  3GTO B;  3BVZ A;  2A74 C;  5D14 A;  2WII B;  2KCC A;  1ESF A;  5D3D A;  2JA8 B;  1SMY C;  1AW7 A;  3HOZ B;  2MPM A;  1SNP A;  4FXG C;  4C3H G;  1J9O A;  1EQT A;  2V4D A;  3U9O A;  2HCI A;  2JP1 A;  4FF3 A;  2KUM A;  3PUZ A;  3GTG B;  2E74 C;  2FIN B;  1JR0 D;  2XRS D;  2IW3 A;  3EVQ A;  4Q0F A;  1MSH A;  1O7Z A;  4DXG A;  2F03 A;  2KEE A;  3VR4 A;  1EYC A;  4U68 A;  1F9Q A;  3D3R A;  4ODG A;  4DA2 A;  4ME5 A;  4GZY C;  1BOS A;  4RKB A;  1KDA A;  2D62 A;  2IWH A;  4KKT A;  4N9P A;  1BNZ A;  1B3A A;  1Y8O B;  3GTP B;  5TSS A;  2DNE A;  4C56 C;  3FKI B;  1HUN A;  3SR1 A;  1WD0 A;  2Q8R E;  2CW0 D;  3NBH A;  3E5S A;  3TP6 A;  3I91 A;  4ZUI A;  1Y1W B;  1EYD A;  5JEA G;  3I4L A;  1EYA A;  3WDN A;  4HSV A;  4RGN A;  1O7Y A;  2RQX A;  5JPN C;  4RA8 A;  4ZRZ A;  2NN6 G;  1GHK A;  2K04 A;  1BDO A;  1TS2 A;  4ILW A;  2EYP A;  5C4H A;  2EJM A;  3KLS A;  2B2W A;  3OHX C;  1GXD C;  5CC4 A;  5BN4 A;  1QJO A;  1AZQ A;  1UNS A;  1QIL A;  3T13 A;  1HTP A;  5KIX A;  3H6M A;  2B8G A;  3G7L A;  2ENB A;  3JAM L;  2FFK B;  4ULL A;  4L8J A;  1IYV A;  3S15 B;  2NTS A;  4IUU A;  1EL0 A;  1STH A;  3F2U A;  2DY7 A;  4XQN A;  3ND9 A;  3PIO 3;  4PMB A;  1EZ8 A;  4RKL A;  1B53 A;  4BY1 B;  1D5M C;  5DM6 3;  4XQQ A;  1FR3 A;  3HGB A;  5EQ0 A;  1JE4 A;  1BO0 A;  1SSO A;  3TZU A;  3A55 A;  1HFG A;  1TU2 B;  3D8G A;  2K1B A;  1OO9 B;  1NR4 A;  1I4H A;  3JAM E;  5JEA H;  4K5V A;  4O1N A;  3GQB A;  4M1U B;  5D65 A;  1JOK A;  5C4X B;  4TRD A;  3NTH A;  3C1E A;  4C3H B;  2NN6 H;  2FJ2 A;  1V43 A;  1C48 A;  2IJ0 A;  2B2V A;  3PO2 B;  1SYF A;  4FP5 D;  1K8M A;  3M4O B;  5IGG A;  1QOH A;  5CV6 A;  5EKL A;  5T1G A;  1UEA B;  2CW0 C;  3DEP A;  1ICW A;  1EY6 A;  2X69 A;  4DNR B;  4KY7 A;  1I4X A;  1STA A;  3VYR A;  5IOC A;  3VR3 A;  3GP7 A;  3FPU B;  3Q6S A;  3L3O C;  1TWF B;  1EFI D;  3W2D A;  1QB5 D;  4XIG S;  2NTT A;  2XNA C;  3MA2 B;  2B2U C;  1LTT D;  2EYJ A;  2F0Q A;  4XT3 B;  3DWA A;  1A3T A;  5C6A A;  2SOB A;  1TWA B;  2F0E A;  2E76 C;  2D2C C;  4OIK A;  4HED A;  1EY0 A;  3RZD B;  1BXT A;  2I07 B;  5JAV A;  3BS1 A;  2QCP X;  2L9H A;  2WKC A;  4HN7 A;  3IAY A;  4QIW B;  4U67 3;  2NUC A;  3SK5 A;  5BN5 A;  1VMC A;  4ZKC B;  3PV0 A;  5IGB A;  4XQJ A;  4EQP A;  2OEO A;  3J81 E;  3J7Y W;  5M5Y B;  5CV8 A;  1B50 A;  4Q5V A;  2DY8 A;  1DZ1 A;  1F2Z A;  3SK6 A;  2QF7 A;  2DNC A;  1B9N A;  3LX0 A;  3QWN A;  4BA2 I;  4CKE A;  1STG A;  1GUW A;  4C3I B;  2K7V A;  3HOU B;  5E4W C;  3BYT B;  3A8J E;  1EQV A;  2MHV A;  2EY5 A;  3H3V C;  3TP7 A;  1ENF A;  2J0T D;  3KBX A;  3CRL C;  1KAA A;  1RF2 D;  2A5H A;  3A7L A;  3TME A;  1XTC D;  5G3L F;  5IOD A;  2YYZ A;  1K83 B;  1X3P A;  1HPC A;  1LTI D;  3S17 B;  1KNA A;  5FOB B;  3A54 A;  1VF7 A;  3NTK A;  3GTL B;  1ONL A;  2Z1C A;  1Q12 A;  1CQF A;  5LL6 X;  1XXG A;  3OIP A;  4RGM A;  4Y7N B;  5JOB A;  4DAY A;  4KV6 A;  3HKZ B;  4M8A A;  2A6E D;  1LV9 A;  2EYM A;  2WAC A;  2FMM A;  1JB3 A;  5KYI A;  2X6L A;  1VMP A;  1TT2 A;  1TKW B;  1B4O A;  4IUR A;  4RFB A;  2FHT A;  2F0I A;  3FMC A;  5I9P A;  1EIH A;  1KLU D;  3S1M B;  3S14 B;  4CJ1 B;  2RSO A;  3I70 A;  1TS4 A;  3LWU A;  1PFM A;  3BG3 A;  4I65 A;  5C3E B;  3SK4 A;  5CGK A;  4XTC S;  2AUK A;  4RAU C;  3IKJ A;  5M3M B;  3BDC A;  3MXU A;  2BDN A;  1HA6 A;  5CV9 A;  4V19 0;  2J7Z A;  3NBI A;  3MFY A;  5C0X I;  2E2H B;  1B1Z A;  3MFG A;  2WV6 D;  4B9W A;  2F0V A;  1Q90 A;  1CZW A;  2F0K A;  3DMU A;  3ZYY X;  3S2H B;  1EOT A;  3AU7 A;  1JCK B;  5CMD A;  2B2Y A;  1Y8N B;  3GTK B;  1RDP D;  4CHT B;  2E2J B;  1XYI A;  3VA5 A;  3R2T A;  4QUF A;  2EOT A;  1LTG D;  4K5X A;  2NZ1 D;  3IFD A;  2B63 B;  1MBY A;  1V1P B;  2WP8 J;  3SDZ A;  3TP8 A;  2OF1 A;  3C1F A;  2QDB A;  4IZ8 A;  1ZYR C;  2NVX B;  4ZKB B;  1F9P A;  4FO2 A;  3R3O A;  4DU9 A;  4G7Z C;  4Z9C B;  4DNT B;  1W6J A;  5EPL A;  2Q8T A;  2EPB A;  4PV1 C;  4CKC A;  2WIN B;  1STN A;  2IX3 A;  4BBS B;  5EGT A;  2WAQ B;  3FDT A;  1PYW D;  3NPP A;  1PRT C;  2SNM A;  3G6J B;  1M8A A;  2RVL A;  5DEH A;  1HA5 A;  1GHJ A;  1H9R A;  3RZO B;  1PRT B;  5M9O A;  1KDB A;  2BA1 A;  3DM1 A;  1LT5 D;  1DD2 A;  4JBW A;  1ENA A;  3Q24 A;  4IUT A;  1FNU A;  4K8J A;  2AUJ D;  1D2B A;  1BF4 A;  1BCP C;  1TQO A;  1CQV A;  3RD4 A;  4H13 C;  3R2I A;  2O2L D;  1BCP B;  1SND A;  2KA7 A;  3QIA A;  4XYQ A;  1SNC A;  3GD7 A;  1ENC A;  5C0X J;  1ZXT A;  2D5D A;  5DM7 3;  2TSS A;  3SEB A;  2L0C A;  2JEA I;  1D5Z C;  4KHV A;  4CJ0 B;  3NUC A;  2E2I B;  1KDC A;  1BBX C;  2CQA A;  2XSC A;  1IL8 A;  2F4I A;  1D6E C;  1MI2 A;  5KEE A;  1CK1 A;  3D31 A;  1A2U A;  1MGS A;  3I4M B;  5COY A;  1I50 B;  4DAV A;  2YU9 B;  3D4W A;  3HOX B;  3DEO A;  1B2T A;  2F0H A;  3DHQ A;  2C5C A;  1ET9 A;  1B44 D;  2A68 D;  5FO9 B;  4DAP A;  4IFD I;  3M7N A;  4A93 B;  4EQN A;  4KJO A;  5CBA E;  3Q0A A;  4RCN A;  3MZ5 A;  5K36 G;  1F2Y A;  2AQ3 B;  3VYU A;  5COR A;  4NDX A;  1G6Z A;  2HDL A;  3ND8 A;  3PUV A;  2L5T A;  1HUM A;  2O4X A;  4WFN 3;  1I4Q A;  3AB9 A;  2K05 A;  1E2Z A;  1PRT F;  4J1M A;  1SNO A;  2GA4 B;  4QMG A;  4F7X A;  4TKO B;  2EE1 A;  2NWG A;  1H9S A;  4NP5 A;  4K5W A;  1JOR A;  2WKD A;  5KYL A;  4K2L A;  4XDX A;  1DOL A;  2L55 A;  2KVM A;  4BBR B;  2BDO A;  2F3V A;  1LAC A;  2RDF A;  3M4Y A;  1BCP F;  5G3L D;  3QG1 A;  1TR5 A;  2PW7 A;  3A8I E;  5JVG 3;  4IN3 A;  2EYO A;  3TZD A;  4RWS C;  2Y0S B;  3K5M A;  4A3G B;  5C4Z A;  4C2M B;  4QB4 A;  4ZAI A;  3EJI A;  2PZW A;  4G7H C;  4G4K A;  1SXT A;  2B2V C;  2MGS A;  1B9M A;  1RD9 D;  3CU7 A;  5CR3 A;  2QEJ C;  3ERO A;  1A3V A;  1C8C A;  4A3B B;  2C9O A;  4XT1 B;  5K36 H;  2K01 A;  4K8I A;  5A2Q E;  1PTO B;  1QNU A;  4IFD J;  1HHV A;  1TS3 A;  5ELF A;  3P7J A;  1XX8 A;  3A56 A;  2Z4H A;  3NQI A;  1Q8I A;  2ZXO A;  1PZI D;  2EXZ A;  3QB3 A;  4DN4 M;  1JIC A;  2R6G A;  1PMR A;  2XIW A;  4AYB B;  4C3I G;  2A68 C;  1STE A;  1Y1V B;  1QCB D;  3C46 A;  4OIJ A;  3WOE A;  4FNF A;  3VR2 A;  1L0X B;  1SYC A;  4PQX A;  4QCL A;  4S3S A;  4G7O C;  2VXW A;  3Q22 A;  2OXP A;  4K2K A;  1G2T A;  3I72 A;  3L9A X;  3IL8 A;  2AQ2 B;  4KY5 A;  5JJZ A;  1GUS A;  1O7L A;  2A73 B;  1LLR D;  2EVB A;  5DAU A;  2R61 A;  2JE6 I;  4LMQ D;  2O5J C;  3KLS X;  1PDQ A;  3MTS A;  2XRQ D;  1EZ6 A;  3ONA B;  5A35 A;  2M9V A;  1JWS D;  2BA0 A;  3PO3 B;  2DN8 A;  3RLF A;  4J6H A;  1EY9 A;  1OXV A;  1LAB A;  1A6X A;  2RSN A;  3K57 A;  4HAE A;  4FXK C;  3DWQ A;  3HOW B;  3FPP A;  3J80 E;  1DOM A;  4EVO A;  2F0S A;  2D9U A;  1H9K A;  5LL6 S;  1V1O A;  3BYY B;  3J81 L;  5C44 B;  1Q1B A;  1T5X D;  3U9S A;  1Q1E A;  2K5Q A;  3K5O A;  1E2W A;  3E0J A;  3I3C A;  3T56 B;  2XN9 C;  2VB3 X;  4FXD A;  1YNN C;  4F88 A;  2HCC A;  4X3T A;  4A3M B;  2PYK A;  3BVM A;  3LNN A;  3D6C A;  5IGF A;  2EZV A;  3ERQ A;  1VCI A;  2NVY B;  5EBC A;  2F0J A;  4EQO A;  4L6T B;  2RBM A;  3A8K E;  5FKA C;  3VR6 A;  2QIL A;  2HDM A;  4KKS A;  5HGT A;  4JK1 C;  2OT2 A;  2LY7 A;  2EYL A;  3EA6 A;  2JA6 B;  1PZK D;  1D5X C;  5I6Y A;  1EY4 A;  4B08 A;  4KD3 A;  1BUV T;  1D1I A;  2JSO A;  2KQ3 A;  5C0X G;  1SYG A;  1WD1 A;  3MEH A;  1DM0 B;  2JYO A;  3HZX A;  1GUO A;  2MJ8 A;  4DK0 A;  1V8Q A;  2RKS A;  2B2T A;  2F0D A;  2IL8 A;  1EWH A;  2IPK D;  1ML0 D;  1S5B D;  1I4G A;  3LWE A;  3H94 A;  2B2U A;  3S1Q B;  1CM9 A;  1S4Z A;  1H9J A;  1ILQ A;  1ZYR D;  3OWF A;  1JQY D;  1F77 A;  1JWM D;  2ICI A;  4V0B A;  2IT1 A;  5ELD A;  1CTM A;  4QUC A;  1FYC A;  3HS0 C;  3NE5 B;  2KEC A;  1RJT A;  1WCM B;  3OWE B;  2MUY A;  2PMZ B;  1WTP A;  2N88 A;  4PMW A;  1C4Q A;  2F0O A;  1PRT D;  1VDZ A;  5KRU A;  1O80 A;  1PZJ D;  3AMU A;  3K59 A;  3S16 B;  2F0N A;  4XYO A;  3M85 A;  4K6D A;  5F2D A;  4K6L A;  2J4X A;  3M7G A;  3P75 A;  5EKK A;  3SK8 A;  5C0X H;  4ZLT F;  1BCP D;  1O78 A;  5JPM C;  5HUR A;  2XWJ B;  3BZD B;  1EY5 A;  1EY8 A;  2EY1 A;  1LO5 D;  2SDF A;  2KJX A;  3BDO A;  1SEB D;  4FVM A;  5M5W B;  2BCO A;  3HOY B;  3P1H A;  1Z6H A;  5FLX L;  1KNE A;  2PZU A;  2MP1 A;  4MIU A;  4NKL A;  3I8Z A;  2RA4 A;  4BWG B;  2NBF A;  1FGB D;  4KKU A;  2AWO A;  1U4P A;  5CV7 A;  1CA5 A;  2K03 A;  1CFM A;  1EY7 A;  3URY A;  1F2L A;  1IYU A;  4IUV A;  1SNQ A;  4ZK9 B;  4RHR A;  1MSG A;  3K5N A;  4WOR A;  1I3Q B;  3PIP 3;  1W6K A;  4KD4 A;  5J1Z A;  2F0M A;  3J7A F;  1SDF A;  4F8M A;  2R92 B;  1R4Q B;  4MN3 A;  2SNS A;  4KHZ A;  5FLX E;  3PUY A;  1VF5 C;  2M00 A;  1EEF D;  5M5X B;  2XWB B;  4H0L C;  1GUN A;  1II3 A;  4X3U A;  4IFD G;  5T1I A;  1WTW A;  1EU3 A;  3OW7 A;  3FEW X;  3S1R B;  4KN7 C;  3QO2 A;  1HQM C;  2ICE C;  3S9W A;  3RUZ A;  1TII D;  4LJZ C;  2PCF B;  2LKV A;  1J8I A;  2TMP A;  1L0Y B;  5E4X A;  3A7A B;  1H9M A;  2F0L A;  4I7Z C;  4KN4 C;  3PMF A;  4NW2 A;  1TWG B;  1SYE A;  4TQU S;  1SJH D;  4KI0 A;  1DON A;  2BOS A;  4RCO A;  1RCV D;  2CHB D;  1EWC A;  5AFW A;  3S2D B;  2K5W A;  1FD7 D;  3X3M A;  2NVT B;  4KMU C;  3QJY A;  4OHJ A;  1PLF A;  1A3U A;  2ZXP A;  4WRD A;  1AN8 A;  3M3Y B;  3T4A C;  1ESR A;  4OL7 A;  1LTB D;  5FK9 C;  4QF4 A;  4FF4 A;  1QG7 A;  1I6V C;  2WB1 B;  3TDQ A;  1FNV A;  4IFD H;  4HCE A;  3TN2 A;  1R9T B;  1IKM A;  1CZG A;  2EYF A;  1DJR D;  3MC0 B;  3N6R A;  3K5L A;  1BQQ T;  3KK7 A;  5CV5 A;  1RKN A;  3MAQ A;  3HP3 A;  4O42 A;  1U4R A;  1WTO A;  2RDH A;  1RTN A;  1DYQ A;  3DWP A;  3SVM A;  4B9X A;  1T5E A;  2F0G A;  1CT1 D;  1I4P A;  2B2W C;  2E75 C;  5ELB A;  1X3Q A;  4OO1 I;  1NCV A;  5EBD A;  1Y69 U;  1HCZ A;  4ID6 A;  2H1E A;  1PTO H;  4CJ2 C;  1TVX A;  1G2S A;  2F0P A;  1CHP D;  4TSS A;  1WTV A;  3D6W A;  2LS0 1;  5J39 A;  2CVR A;  1Q3L A;  4IUQ A;  2NVQ B;  4YIJ A;  3HEJ A;  1SAP A;  4DF7 A;  1QE6 A;  2EYH A;  5I2Y A;  3S1N B;  1IW7 C;  1U4L A;  2K6A A;  3OIQ A;  5KNB A;  5ELC A;  5A2Q L;  4HMI A;  1EU4 A;  2PO4 A;  1OXU A;  5M3F B;  1OXX K;  1S5E D;  4EGV A;  1S5F D;  2NYZ D;  4A3I B;  2IX1 A;  2LFN A;  2G9D A;  4R9W A;  2F1M A;  3GTJ B;  4K14 A;  1HXY D;  3KF8 A;  3PUX A;  5IIF A;  5KGU A;  1SNM A;  1M4V A;  1OXT A;  4X3S A;  1OXS C;  1PFN A;  1PTO C;  2VB2 X;  1U9R A;  1YNN D;  4R8I A;  3C2P A;  4BY7 B;  1GJX A;  3MHB A;  3HOV B;  4RGT A;  4CBV A;  4RGO S;  4CGY B;  5JVH 3;  2EY2 A;  2B8F A;  4R8N A;  5EPK A;  4IUN A;  3TSS A;  4HMJ A;  2L1B A;  3OMG A;  3FRP B;  3NHH A;  3L7Z C;  3OPO A;  3H09 A;  4OGQ C;  3NTI A;  2BE5 D;  2L12 A;  5CYU A;  3HG9 A;  2ID0 A;  5C3X A;  3MVV A;  5I6W A;  3FVQ A;  3HRZ C;  5C3W A;  2Z4I A;  2L4N A;  3CHB D;  3VYS A;  3K6O A;  5EPJ A;  3VA7 A;  3J80 L;  1HRJ A;  4X3K A;  2A6H D;  2EY6 A;  4ABN A;  4KY6 A;  3SXH A;  5IT9 L;  2K32 A;  4KK7 A;  1NAP A;  3BVG A;  2HUG A;  2LMC B;  1NSN S;  2KHS A;  2O5I C;  4H7B A;  1STB A;  1F2M A;  1IKL A;  1EEI D;  2HQE A;  2XVS A;  4KJN A;  3E6Z X;  2RDG A;  1KAB A;  4HTH A;  1ROD A;  2PZT A;  1SYD A;  4FF2 A;  1AP0 A;  1F9R A;  3IFT A;  3EFX D;  5IGC A;  4A3F B;  3WOF A;  1D1K A;  3KBG A;  2B2T C;  4F87 A;  1JWU D;  5IT9 E;  1PTO F;  1R4P B;  3Q23 A;  2NN6 I;  3W3A A;  4MHE A;  4ZQ3 A;  3NSW A;  5IGE A;  1GUG A;  2QKI C;  4BA1 I;  1LTA D;  3KLR A;  2A69 D;  5ISR A;  4RH6 A;  3J7A V;  2H4O A;  2KOL A;  2ZT9 C;  1X32 A;  3I73 A;  4LAA A;  2PQE A;  2KED A;  2G9H D;  3NK9 A;  4G57 A;  1BR9 A;  1TY2 A;  4C1N K;  5LHY 1;  1G29 1;  4A3E B;  1IHZ A;  1WTX A;  1SYB A;  5FO8 B;  1LTR D;  2BE5 C;  3V96 A;  1YNJ D;  5C5L A;  3QOL A;  4H44 C;  2NB0 A;  1XWE A;  3NQT A;  5ELE A;  3QOJ A;  3KUP A;  1CI3 M;  1DCZ A;  1JOQ A;  5BN3 A;  2VUM B;  4UDU C;  2M2L A;  1SJE D;  2PNR C;  2JXM B;  1SE4 A;  3H0G B;  4PNY A;  2B39 A;  1E2V A;  1CHQ D;  2A6H C;  2L11 A;  4DK1 A;  2F0U A;  3CRK C;  3NWS A;  1AFP A;  5NUC A;  5JEA J;  3CKI B;  5E3F A;  4IUP A;  2SEB D;  3K0Y A;  1F9S A;  2EDG A;  4IAL A;  5J22 A;  3H91 A;  1HQR D;  3SE0 A;  1NR2 A;  3SHL A;  3NP8 A;  2FMC A;  3N52 A;  2AQ1 B;  1FNW A;  3MXN A;  4C3J G;  3DUZ A;  1HTL D;  2N55 A;  4RHS A;  5KNC A;  3OMC A;  2B2Y C;  3C3L A;  1E0B A;  5E1F A;  1KTK A;  1EIG A;  5EJW A;  1UUP A;  5C4J B;  2K33 A;  1JOO A;  4C1N I;  3OOC A;  1SE2 A;  3NWT A;  4NMZ A;  2A69 C;  4ZUJ A;  4HCS A;  1PFB A;  2Z8L A;  1GOZ A;  1LT4 D;  2Q8I B;  5I4D A;  1WTR A;  2JA5 B;  3T51 B;  1MD2 D;  2X6G A;  3MWY W;  2EJF C;  1QWY A;  3GV6 A;  1DXM A;  1LTS D;  4N9T A;  1A2T A;  1GUT A;  3R93 A;  1LT6 D;  2R93 B;  1RHP A;  5I9O A;  3BDL A;  4A3D B;  1S5D D;  1YNJ C;  3D4R A;  1JC7 A;  1CA6 A;  1TWH B;  3GV3 A;  3VYT A;  1ET6 A;  4HR7 B;  1G91 A;  1I6H B;  3GTM B;  1G8Z D;  1WTQ A;  4WJW A;  3MXG A;  3OSO A;  5EKI A;  1ILP A;  3DXJ C;  3EQL C;  3T53 B;  4A3K B;  1S5C D;  4L63 B;  4CKB A;  2F3W A;  5IGD A;  1SMY D;  3I90 A;  1A15 A;  3V05 A;  2VNU D;  3D4D A;  3K7A B;  1Z47 A;  4LK1 C;  4OO1 G;  1RTO A;  5CBE E;  2IX0 A;  2KCN A;  1AZP A;  4FYD A;  1STY A;  5D3I B;  1ZKO A;  2F0F A;  1I4R A;  4FF1 A;  4KTA A;  4HSP A;  4XXE A;  4ZYS A;  2JA7 B;  1IW7 D;  1DOK A;  1PXU A;  4P2C B;  3O13 A;  1KLG D;  4IQZ A;  3X3N A;  1TS5 A;  4PMC A;  3P20 A;  2K28 A;  3RMH A;  4BS9 A;  1Z7T A;  3TBI B;  4C3J B;  2EJG C;  1AEX A;  3T16 A;  3I4N B;  1TY0 A;  3UI2 A;  4DXF A;  2F0T A;  2A6E C;  2PPB C;  2JEB I;  5DNF A;  1NUC A;  1SFO B;  1U4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...