1K8OA

Solution structure of the lipoic acid-bearing domain of the e2 component of human, mitochondrial branched-chain alpha-ketoacid dehydrogenase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
87
structure length
87
Chain Sequence
MGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of the lipoic acid-bearing domain of human mitochondrial branched-chain alpha-keto acid dehydrogenase complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords E2 component of Branched-Chain alpha-Ketoacid Dehydrogenase
total genus 7
structure length 87
sequence length 87
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1k8oA00
2B8FA 1CFMA 2BE5D 3D31A 3SE0A 3EQLC 4PV1C 2K33A 2KCCA 1HCZA 3AB9A 1TKWB 1E2WA 1YNNC 4H44C 3MFYA 3WDNA 3KLRA 1Y8NB 2O5JC 1Y69U 1I6VC 1V8QA 1H9SA 2K7VA 1GHKA 1GHJA 4KN4C 4XIGS 2QF7A 2B8GA 5BN4A 4DK1A 2PNRC 3BG3A 1G291 1K8MA 3DXJC 3TZUA 2EDGA 3I73A 2AUKA 4KKSA 4TKOB 1LABA 1Q12A 1T5EA 5KNDA 1SMYC 1IW7C 1GUOA 3H94A 2A6HC 1H9KA 1OXXK 1Y8OB 1HPCA 2JE6I 2A68D 1OXSC 2CW0C 1BDOA 4OO1G 2IT1A 3VA7A 1GUTA 1VDZA 3A8KE 4BA2I 4KHZA 3A8JE 3IKJA 2LMCB 3IFTA 2V4DA 4G7ZC 3M85A 2DN8A 1HTPA 2AWOA 4IQZA 4GZYC 4IFDG 3BDOA 1B9NA 4I7ZC 2E75C 2YYZA 4DK0A 1ZYRC 3A7LA 3D4RA 3OOCA 3PUVA 1YNJC 1FYCA 1Z6HA 1Q90A 5A35A 5JEAH 4H0LC 4LJZC 3QIAA 3L7ZC 3U9SA 1QJOA 2BA1A 1H9MA 1H9JA 5BN3A 2JXMB 1FR3A 2O5IC 2A6HD 4JK1C 1OXTA 2DNEA 2D5DA 4LK1C 4TQUS 2JEAI 2EJMA 1GJXA 2D62A 4KKTA 1H9SB 1VCIA 5JEAG 3VR2A 4BA1I 5C0XG 1VF7A 2BA0A 1A6XA 2E76C 2F1MA 4RCNA 3MXUA 3VR3A 4JBWA 2K32A 1Y8PB 3VR5A 2Q8IB 2A69C 3FPPA 2A6ED 3VR6A 1CI3M 4KKUA 1E2ZA 3CRLC 1V43A 1GUNA 2EVBA 3ND8A 3RLFA 2EJFC 3A8IE 1IW7D 4IFDH 3I4LA 4L8JA 3FMCA 2NN6G 1K8OA 1IYUA 2PPBC 1DCZA 1Q1EA 1Z7TA 3SDZA 2A68C 3T56B 3GQBA 4H13C 3OPOA 2NN6I 3CRKC 3PUXA 2PCFB 4G7HC 3M7NA 3HGBA 1E2VA 2JEBI 3LNNA 5KNCA 2A69D 2DNCA 1ONLA 1TU2B 1HQMC 1B9MA 1O78A 4HR7B 2BE5C 2KA7A 2NN6H 3I72A 3LWUA 5C0XH 2R6GA 3ND9A 4DNRB 1PMRA 3PUZA 5K36H 1O7LA 3A7AB 1H9RA 2EJGC 3M4YA 3QJYA 2ZT9C 5KNBA 3PV0A 4OGQC 4G7OC 3OW7A 3T51B 5BN5A 3NE5B 4KN7C 1ZKOA 3PUWA 1OXVA 3T53B 2BDOA 3PUYA 1DD2A 1LACA 4OO1H 5K36G 2L5TA 2D2CC 3W3AA 4KMUC 1DXMA 4DNTB 3P20A 4XTCS 1Q1BA 1VF5C 1IYVA 2AUJD 2A6EC 2E74C 1EWHA 4KI0A 3N6RA 3VR4A 1OXUA 1CTMA 3QG1A 1GUGA 1GUSA 3GD7A
chains in the Genus database with same CATH superfamily
2XIWA 4R9WA 4UPAA 1EY5A 1XYIA 4KD3A 2B63H 3TP6A 1HZBA 2K28A 1G8ZD 3C3LA 5FOBB 1VQJA 1HHVA 5BN4A 1R9TB 3I4MG 1S5DD 3HOVB 1EIGA 5C0XJ 4IO9A 1JICA 2F0KA 2F0IA 4UDUC 2OF1A 2FHTA 5LMNW 4CKBA 2G5DA 1M1KC 2Q2UA 1B44D 3GTMH 3GTKB 1KHIA 4GNXC 4GKKQ 4LFBL 5C3EH 2PZWA 2KUMA 3EVQA 4FXKC 5GAEC 3OOCA 3PUVA 3OTOQ 2R7DA 3G7LA 2Y0SB 4FXDA 5AFWA 3CPWA 3F2DA 1BBWA 2ZJRA 4BY7B 2EJMA 2EY1A 5C3EB 4DV5L 1A2UA 2QA4A 4BXXG 3RMHA 4A93G 3NEMA 3GTMB 4PMWA 1ILQA 2L9HA 2VZAA 3FDTA 1I6HH 3E5SA 4RG1A 4OWXB 3LWEA 1F9QA 4C2MB 1SYDA 4DR6L 1KD1C 3D6CA 4U673 5CV8A 2QDLA 3EIVA 1EU3A 1EQQA 4CDDC 5C44H 4NDXA 2PPBC 1DCZA 5JPMC 2UU9Q 3GTLB 3HKZG 3OPOA 2K4KA 5JVH3 4H7BA 1Q7YC 1KRSA 1TU2B 3I72A 1UNSA 3S1MB 1EL0A 4BWGB 4RKBA 2F0QA 3PUZA 5K36H 2WAQB 1H9RA 4B9WA 3D4WA 1ML0D 1DM0B 3QOJA 1X3FA 2ZXOA 4R4IA 4RAUC 4KN7C 4K5VA 4B3RQ 1JWSD 1EYAA 2NVQH 3K5NA 4HJ9A 3KDFB 3HP3A 1J6QA 3FKIB 1W3SA 3MXGA 1KDBA 1MSGA 3RN5A 2VUMG 1SNQA 3RR5A 1D5XC 3I56A 1EIYB 1X3QA 5I9PA 3GTPB 4OWWB 1HR0W 1X54A 4LFAQ 1VQAA 4KLKA 4AH6A 3TMEA 2GA4B 4AYBE 3MVVA 4BY1H 1MI2A 2LMCB 2AQ3B 3KK7A 5G3LF 1A3UA 1M90C 5E4WC 1XPUA 4KK7A 4HCEA 3OYYA 4JYAL 5KIXA 5KYIA 2F0UA 3L7ZC 4B9XA 3J80L 1B3AA 2EZVA 3L3OC 4AQYQ 4J15A 3BDLA 4DUZQ 3K7AH 4LW1A 2OWOA 1Y1WH 1K83B 3DUZA 3BZCA 3PF4A 2BA0A 1A6XA 2E76C 2SNMA 4JBWA 3CC2A 3GP7A 1VQDA 4JBJA 1VQ9A 3KFUA 4ZKBB 1IZ6A 1ENAA 1LTRD 3S17H 4A4IA 1D8LA 2A1AA 3DMUA 4APVA 1O7ZA 1HTLD 2ES2A 3P75A 2UXCQ 1S5ED 2G9HD 2MJ8A 4RGOS 2N49A 4KY5A 3SGIA 1Z7TA 2K5NA 2CW0D 3R93A 4JOIC 2F0WA 2IHFA 1GUWA 2NZ1D 2F0LA 5IT9c 1JOOA 1WD0A 1EYCA 2NVYB 2JA7H 3T1YQ 2F0TA 4HR7B 2IWHA 5C0XH 4RCOA 1LT6D 1Q46A 3PO3H 2R6GA 4MZ9A 4JI6Q 4R4QA 5M3FH 3W2DA 3VYTA 4HTHA 3PV0A 2DJFC 1P8LA 5KNBA 3KLWA 3NBHB 3CP0A 5GQOA 4A3EG 3PUYA 4RGNA 3GO5A 1O7YA 4BS9A 1BCPB 4DNTB 1HUMA 4DPGA 3NBHA 4OX9Q 5IP9H 4LUOA 2AUJD 5FJ8G 2MO0A 4IFDJ 3BZKA 1QCBD 1EFWA 3D31A 4BBRG 5C0XI 2KCCA 2NB0A 3KLRA 3RLNA 4A3KB 3KDFA 3S15B 1QWYA 4EQNA 4LWCA 5KGUA 1WCMG 4C3JH 3J80i 1PVOA 2EY6A 3NTKA 3H94A 4XQNA 1STHA 1IL8A 3BYTB 4NXNQ 2UXBL 5ELNA 1PRTD 2ZJPA 3MA2B 3HOUG 4MHEA 2K5QA 4ZLTF 5FKAC 2NZOA 4KHVA 4I7ZC 3KLSA 1VQ5A 4QCLA 1Q90A 1KTKA 1Q86C 3ULJA 4LJZC 1U4MA 1QJOA 2DJGC 2BA1A 1WTPA 1N9WA 1VQFA 1CQVA 1DGSA 2HT1A 2OCEA 5IYDG 4DV0Q 2F1MA 3OIPA 1WJJA 2PQEA 3S15H 1SMXA 2K32A 1D7QA 3SEBA 3VR5A 1ZYRD 4A3KH 2A6ED 2R7FA 3WOEA 1JOKA 5J3BA 2RHSB 2YV5A 1I4GA 4DV6L 1PH8A 1I4RA 1LTID 1M8AA 2VXWA 1PRTC 5J39A 1PH3A 1MJCA 4OO1I 2JA5B 3TN2A 3FP9A 1NY4A 4C3HH 4N9TA 3M7NA 3H91A 2DGYA 1KRTA 1NE3A 2JEBI 3LNNA 4DU9A 1W6JA 3GTOH 3E0JA 4YHHQ 2UU9L 1QG7A 2B2VA 1N34Q 1YVCA 1SFOB 1SXTA 3A56A 1EOTA 4BY7G 3A5UA 4DNRB 4DR6Q 5I6YA 4LF4Q 1ICWA 3HZXA 3OW2A 2ATWA 3OW7A 3KYHC 1YEZA 2NVYH 5COYA 1XNQL 3NWTA 2F0HA 1GOZA 4KD4A 2IL8A 1CM9A 1WTVA 5NUCA 5ELCA 2CKZB 2ID0A 5C3EG 2JA5H 3S2DH 2RDHA 3CMEA 1LT3D 3K59A 1TKWB 4H44C 3G48A 5C4XH 3S24A 4GN5A 3J81L 4A3JH 2EQSA 3R8BA 2MHVA 1G291 2D0OA 3PIP3 2PMZE 1AH9A 2KECA 3I73A 4QMGA 3RD4A 1HNWL 4GKJL 1YNJD 1IBKQ 1X56A 2ZJQA 2KEEA 2N88A 2F0MA 1UEAB 4L5RC 1A62A 2NVXH 3A8JE 3MXNB 1R4PB 1RTOA 3CQZB 1NR4A 3M4OH 1JT8A 2GVAA 1TS4A 1PH2A 1JE4A 3NK9A 1NMGA 4YWKA 1EOVA 1AW7A 1JE5A 1YNJC 3E0EA 4YCVA 2VB3X 1UWVA 1N33L 4X64L 4JBMA 4IOCA 3UE0A 1PTOH 4P74A 2CH4W 1L1OC 1H9SB 1A15A 2J7ZA 2AQ1B 3HEJA 2XTIA 5D65A 1SAPA 2WIIB 4C3JB 2E2JB 1BNZA 1CUKA 4B3MQ 3J80c 1EIFA 4OL7A 3HOUH 1F77A 3H0GB 2IY5B 1GVPA 2F0NA 2A5HA 2KCNA 1LTLA 1VQGA 2B2WC 2F52A 4C3JG 1W2BA 4OHJA 1Q1EA 4RMFA 5FJ8H 3NSWA 3CQZH 3SVMA 3M4OB 1L0YB 5IP9G 2HQEA 4B3TQ 4ZYSA 4O42A 4HCSA 3GTGH 2NVXB 4GLAC 4DV1Q 4ZQ3A 1VQ7A 1KDCA 4OWTB 1L2FA 5IGCA 3HOWG 1HFNA 2RSNA 4DXGA 1QVGA 4X3SA 1HXYD 1STAA 1SJHD 1Y14B 4M8AA 4RGTA 1KAAA 1IL2A 5IT9L 3J81i 2ZT9C 1LT5D 2X6LA 4JC0A 5ELBA 4JI1Q 4DR2Q 4KHPQ 5BN5A 2AHOB 4K8IA 1PRTB 4ZUJA 5DM73 4EX5A 1NCVA 1STGA 2DY8A 3S2DB 4LUZA 1Q1BA 2LY7A 4R1JA 4XTCS 2VW9A 4MNOA 1ASYA 4DV4Q 1SEBD 4N8X1 2UUCQ 5CC4A 3LX0A 3D3RA 2F0JA 2ICEC 5IGDA 1IBML 5DM63 2GVBA 3PIOA 2Z1CA 3S2HB 4QUCA 2CWAA 2RDFA 4X3KA 4F7XA 1YITA 1I6HB 4QIWE 3SR1A 3MXPA 3H3VH 3PO2H 4X65Q 3EN2A 1SMYC 2MP1A 2A6HC 1OXXK 1Y8OB 2CH4A 3K7AB 4JW0A 1EIHA 3ICEA 5E4XA 1VQNA 1I94Q 1S40A 1PA6A 4JI1L 2ENBA 2FJ2A 1X3PA 2PZUA 1G6PA 1Z6HA 3CHBD 3E9HA 1WTRA 1XJVA 1EY4A 1LT4D 1X3GA 3WWVA 3J80E 5BN3A 4TQUS 2PW7A 2CCZA 4WJ3M 4A3KG 2WKCA 5ELEA 3VR2A 1B53A 4RCNA 5E1FA 3I3CA 5ELFA 4PNYA 2L4NA 4UAIA 2B2TA 4YCWA 3VR6A 3U58A 3P7JA 3S16H 1SYGA 4IFDH 3A8IE 5C3WA 2MNAA 1HUNA 3MHBA 2NN6G 2B2YC 2F0PA 3T56B 5D3IB 1SR3A 3I4NB 3V05A 3H6MA 2IW3A 2BDNA 3I55A 2JSOA 1JR0D 3UI2A 4HJ7A 2EIFA 3PF5A 3HGBA 4S3SA 3ITPA 2RVLA 3MEHA 2NVQB 2JQOA 4LF9Q 1ONLA 3NTHA 1IKMA 1PFSA 2A74C 2LXJA 4A3GG 3TRZA 4IZ8A 5M5XB 2NUCA 3TBIB 3KOJA 2R93B 2Q8TA 1XMOL 1PMRA 5IP7H 3K81C 1VQOA 2XNAC 4A75A 4GKJQ 3KUPA 1SYEA 3P1HA 2WKDA 3NENA 2F4IA 1OXVA 3FEWX 3CCEA 4HIDA 4MIUA 4MN3A 2VY3A 1N33Q 4IPGA 4KMUC 1DXMA 4KY7A 3S16B 1IYVA 1RL2A 3Q6SA 5EJWA 2R92G 4TVAB 1CKNB 2KEDA 2NWGA 5CV5A 1DOLA 1B4OA 1II3A 2K1BA 3GTLH 1G51A 1G2TA 1GXDC 1WI5A 5IWAQ 1RKNA 4A93B 3AB9A 1YNNC 1I50H 3WDNA 1I3QH 1YZ6A 2IHEA 3G6EA 1I6VC 5CYUA 1SYFA 2B2UA 4X62L 4YWLA 1L0WA 2F0VA 3JAMc 2HD3A 1JC7A 3GTJH 5A2QL 2Q2IA 2SNSA 4EQ5A 3I7FA 5IIFA 2F0EA 2JA7B 3J81c 2UUAL 1VDZA 4BA2I 2K5WA 1FVIA 3U50C 3GTQB 1EYDA 1CHQD 2QW7A 1HNXL 2EY5A 3F2CA 1AE3A 1C8CA 1FD7D 1MSHA 5EKLA 5GAGC 4LF5L 1FYCA 4H0LC 2UUCL 4A3EH 2Q2TA 4EQOA 3GTKH 4GLVB 1PZKD 1V1PA 3CF5A 2E2DC 4IOAA 4RKLA 1JJ2A 3J7AV 1VCIA 2UXDQ 3CCMA 3MXUA 4L6TB 1VQPA 4DV3L 2Q8IB 2B39A 2EY2A 3JAME 4QJFA 1N34L 1KDAA 4X62Q 4KKUA 3A0JA 1TS3A 3CRLC 3EROA 2EYFA 4J8QA 1QVFA 2YU9H 5CV4A 1BUVT 2MPMA 3SDZA 1LTSD 2NN6I 1HJPA 3G4SA 1SNDA 3PCOB 1SBBB 2HQLA 3MWYW 2PYKA 1PV4A 4XT3B 4K2LA 2HDLA 3BVZA 1HQMC 2F4VQ 2HDMA 2XGTA 2B29A 1SRUA 3I91A 1CA6A 1LO5D 3OWFA 3F2BA 1O7LA 2I5HA 1TIID 4P73A 4GLXA 1K73C 1Q8IA 2XRSD 4UP8A 3H3VC 5LMUQ 1PFNA 4BBRB 1IXRA 1IBKL 3DM1A 4WFN3 1EY8A 4JV5Q 4QB4A 4XXEA 4KI0A 1OO9B 4FDBA 4FF2A 1BO0A 2WB1G 3UDXA 1TWFH 4N9PA 1TWAH 1F2MA 3TZDA 4FF3A 1PFMA 1Y8NB 1Y69U 2LSSA 4CHTB 1BVSA 1GHJA 5HY6A 4GS3A 1A2TA 1V1PB 2PNRC 1CZWA 4ABNA 2DY7A 2JA8B 4WRDA 3DEPA 3I4MB 1T9HA 4DR3L 1XNQQ 2F3VA 4GN3B 2RA4A 4CDFC 1SE8A 3V96A 3D8GA 4YY3L 2UXBQ 1I4HA 2C5CA 1JJCB 3W1GA 1E1TA 1ESRA 5IGBA 4BBSH 4DK0A 3A7LA 2HHHQ 4FO2A 5BR8Q 4OX9L 3KBXA 1UAPA 1PH1A 3BDCA 3M3YB 1ICFB 1H9MA 4O1NA 4A3IB 4DKAC 4JK1C 2DNEA 3BZDB 4IALA 2D62A 5C4HA 4A3EB 5C0XG 5CV6A 2Y0SG 4DNIA 3TEHB 1LTBD 3BVMA 3M7GA 1CI3M 3OIQA 4DUZL 4RHSA 4GOPC 1CKNA 2EYPA 1NSNS 3ND8A 2KENA 4DGZA 1B8AA 1S5BD 3GTQH 1U4RA 5C3XA 5C5LA 2ICIA 4JYAQ 1E0BA 1AEXA 3I90A 3J7ZC 5G3LD 4HIMA 2M00A 3QO2A 1Q81C 4ZAIA 1C48A 3H15A 1BCPD 4P72A 1J9OA 1YNXA 3D0FA 3Q22A 1Y1WG 4JBKA 4WJ4A 3TP7A 4A93H 2JA6H 4C3HB 3M4YA 2B2TC 3QJYA 5IT9E 1R9TH 1HZCA 1EUJA 1SROA 3LGJA 4DV7L 2L12A 1KXLA 1LACA 4OO1H 2B2YA 1CQFA 4JOIA 1F2ZA 2C35B 1BF4A 4YY3Q 4L5SA 1PFBA 4FP5D 4CDCC 4JV5L 1CTMA 2WFWA 5KNDA 2MQHA 4NXMQ 1K0RA 2MO1A 1EY9A 1NUCA 3K6OA 4FF1A 1E2WA 1WTQA 1PXUA 3MFYA 3DEOA 4Q0FA 1KNEA 1WD1A 4ID6A 2XRQD 5DAUA 1PH5A 4AIMA 4DV2Q 1VQ8A 2B8GA 1OTCA 2Q2HA 2F3WA 5IYCH 3DXJC 4KKSA 1LABA 5C44G 5H1SE 3U4ZA 1F9SA 3URYA 5C4ZA 4KTAA 1X32A 3EFXD 1PTOC 3G71A 4LFCQ 1RF2D 1YBYA 3K8AA 1WYDA 4DR5Q 1Q8KA 5M9OA 4JI6L 3AMUA 3KF6A 4L63B 2OEOA 1E3PA 5CR3A 5IY0A 2KVMA 4IQZA 1SNOA 5IYBH 4OEMB 1PH7A 4IPCA 5FLMH 1XMQQ 1EQVA 1FNVA 1TWGB 2AQ2B 4GNXB 1PHJA 3DM3A 1GO3E 3PSIA 2EYJA 5EBCA 4DN4M 2WACA 2ASBA 1OXTA 1H95A 1Z9FA 4RWSC 2CHBD 4DAVA 1WTWA 1KLGD 3GV6A 2M2LA 1ZXTA 2PNHA 5DNFA 1IBLL 1PTOF 5C5MA 1QVCA 3C1EA 4JI8L 3M4QA 3BJUA 3I70A 1HNWQ 1LUZA 5IODA 3RLFA 1NNXA 1TWCH 1A3VA 2TSSA 1CSQA 2MGSA 2WB1B 1S4ZA 1IYUA 2HHHL 1BOSA 4B3SQ 5CMDA 4XYQA 3HOYB 3AQQA 4QL5A 5M3MH 2R61A 5FO8B 2CFMA 5M5WH 4ODGA 2OTJA 2SDFA 2PQAB 2QEXA 5I6WA 1CHPD 1KAWA 2KA7A 4HIOA 5IYDH 1ENCA 4DV7Q 3VA5A 4RGMA 1L1OB 1KNAA 3R2TA 2K14A 4F87A 1HNZL 1D5ZC 4ZKCB 2NTTA 3TS0A 1N32L 2KCTA 3K5OA 3NE5B 1R4QB 1A0IA 2KBNA 2MFIA 1B1ZA 3CPFA 5J22A 4IURA 2D2CC 1STNA 4C1NK 3P20A 4XYOA 1VF5C 2HIXA 4P2CB 1WFQA 2F0SA 5M5WB 4QF4A 4DV5Q 3BU2A 3K5LA 3EQLC 1B3QA 3M3YH 1AZQA 2O5JC 4LMQD 2EYHA 1V1OA 4KJNA 4BBSB 1FNWA 2XWJB 3ULLA 1MIUA 2EDGA 1Q12A 1RTNA 2QILA 2H4OA 1TWHB 1ZEQX 4X3UA 1SN8A 3AFPA 1XMQL 1RHPA 4YIJA 3CD6A 4HSVA 4X3TA 2ZM6Q 3V2TA 1PH9A 2JN4A 1LYLA 3IFTA 3IRBA 5T1IA 1D1KA 2XWBB 4DR5L 3HOUB 2ZXRA 2NVTB 1SNCA 1C4QA 4CJ2C 3HOWB 1UEBA 1TWGH 5JAVA 1EY7A 1P16A 3RN2A 3FKIG 3SK4A 1XMOQ 3F8TA 1K9MC 1AE2A 3SK6A 2O5IC 2WAQE 4O0AA 2D5DA 4LK1C 4A3LG 3PGZA 2CQAA 2KHJA 5IYCG 2K50A 1FGBD 3U4VA 5CBAE 2VQFL 3AU7A 1E1OA 4DXFA 4BBRH 2XN9C 2RCNA 1I5FA 1QILA 5EGTA 3Q24A 4K2KA 1TWHH 2EJFC 3NP8A 1O80A 3ERSX 3T1HQ 1I4XA 1S5CD 4HJ5A 4DAYB 2A68C 4R8IA 2E2HH 3TS2A 4V0BA 5DLQE 3CRKC 4IUUA 4NMZA 2PCFB 4XQJA 1EWCA 2HCIA 2FMMA 4I7AA 2JA5G 1EZ8A 1IHZA 3S1MH 4IUNA 1B9MA 2NZHA 4B3ML 2R3ZA 4K5WA 1BR9A 4R4TA 2VQEQ 4A3IG 1JJGA 1KQSA 1VQEA 1NBWA 3FVQA 3L2PA 4IFDI 4IPDA 3S1RH 4QIWB 3T53B 4UP9A 5K36G 4NPSA 1Y1VG 5LHY1 2JK8A 5JJLA 2ZM6L 2E74C 3N6RA 2BE5D 2BOSA 3BS1A 2B3GA 2FMCA 4JI5Q 1W6KA 1YHAA 5FO9B 1VQIA 1NMFA 4HJAA 2PW5A 3WOFA 1K3BC 3CCRA 3J7AF 2K5DA 3PIPA 1NJIC 4DV3Q 2ZXPA 3SK8A 3JAMi 1EU4A 4IUVA 1GUOA 1LTTD 2SOBA 4IPHA 1PH4A 2B2VC 3I4NG 2IT1A 2Z0SA 3HKZB 4KHZA 3IKJA 4AYBG 1EYGA 5TSSA 1KIXA 4MTNA 2I07B 3M85A 4ZRZA 1PZJD 1PYSB 2AWOA 4A3IH 4A3FH 4GZYC 1C9OA 4LF5Q 1LTGD 1LM0A 1I4PA 3K7UC 2V1CC 1ENFA 2JYOA 4Y52H 1HA5A 5A35A 4HMIA 1CZGA 2O2LD 4HAEA 1HNZQ 2H5XA 1D2BA 1F9RA 1K8GA 1SLJA 1WTHA 4R4OA 1N36Q 2VB2X 1XX8A 4ZUIA 3HG9A 1PZID 1QUQA 5J1ZA 3RUZA 4WJWA 1CKOA 1QUQB 2OQKA 3G6JB 1BXTA 4PG3A 1G91A 4A3DH 2ZTDA 1VQ4A 1GUNA 2QDBA 2E2IB 3FMCA 5I4DA 4RHRA 3RZOH 4GN4B 2X69A 5IP7G 3H0GG 1XTCD 3H3VI 1MBYA 1X3EA 4G7HC 1FGUA 2B63G 5EQ0A 1HFGA 1XXGA 1K8AC 2CVRA 1YJWA 5T1GA 4LUVA 1I4QA 1U5KA 5ISRA 3T16A 4P71A 2Z8LA 4DV2L 1PTOD 2EYLA 2RF4A 1EEID 1E22A 1HR0L 4DUYQ 3TP8A 4C3IB 4JI0Q 4NXML 3DWAA 2EOTA 4JI2L 1JOQA 5FO7B 5C4JB 5M3FG 1HNXQ 4KJOA 2WINB 4LFCL 1NAPA 1GUGA 4JI7L 1CFMA 1QZHA 4GOPA 3J7A5 5JOBA 5HGQA 5M3FB 1Y1VH 2K33A 3J7YW 1CT1D 1SNMA 3DWQA 4JI4L 5L37A 2B2WA 3RNUA 1V8QA 3J81E 2YU9B 4UY8C 4XIGS 2QF7A 3CC7A 5EBDA 4OONA 4WORA 1T5EA 1HPCA 4CJ0B 4OO1G 1OXSC 3TDQA 3QR8A 2JA8G 2HCCA 4Y7NB 1CA5A 4JI8Q 3PO2B 4TSSA 1J5EL 3FHWA 2OTLA 1B9NA 2K01A 1YI2A 2UUAQ 1PH6A 1G6ZA 1K0SA 3E3XA 1KL9A 2LS01 1K83H 1QZGA 1Y1WB 2B2UC 5EPLA 1BBXC 3A54A 1EWIA 4M1UB 1H9JA 4HMJA 3VDYA 4LFBQ 1FR3A 2A6HD 4JVZA 5CV7A 1K3RA 4PQXA 5FLMG 3RZDH 3VR3A 1EY6A 2GN5A 4HN7A 5FLXL 3NUCA 2IX0A 4LF9L 3ER0A 1TQOA 2A69C 1L1OA 3M9BA 5JJIA 3CKIB 4A3MH 3AEVA 3K80C 1Y1VB 5BR8L 2E5LQ 1V43A 1IW7D 2F0DA 1EQTA 4L8JA 2I46A 4YHHL 2Z4IA 3Q0AA 1GD7A 5CV9A 1XNRQ 3EBEA 3W1BA 3QWNA 1A8VA 3N52A 2EPBA 3I2ZA 5KNCA 1YHQA 3DHQA 4PV1C 1BQQT 2BE5C 1F2LA 4DV6Q 2R7ZB 1EY0A 1SE2A 3C2PA 3NQTA 1RD9D 5D14A 5LMNL 1AFPA 3FRPB 4LFAL 4A3BB 1FJGQ 2R7ZH 2K5VA 2FINB 3VYUA 2L5TA 3CCJA 2RCFA 4B3TL 3DWPA 1BKBA 1TR5A 1OXUA 4GNXA 3QG1A 2F0OA 5LMNQ 2B8FA 3MEFA 1EFID 1LTAD 4JPBW 1J8IA 2J0TD 2HIVA 2K04A 2L11A 4FVMA 3KF6B 4K6LA 1QE6A 1GHKA 1L0XB 4G57A 1DJRD 2EXDA 4LF8L 3UDIA 3BG3A 2TMPA 1K8MA 1ESFA 3C1FA 3ERQA 1YJ9A 2K05A 1YHBA 4DAYA 3RZDB 1YIJA 4DAMA 1EZ6A 1E24A 5C44B 3VA7A 1EEFD 2PMZB 4LF7L 4OXPA 1B2TA 4CJ1B 1LV9A 3CCUA 4ILWA 4RFBA 2IX1A 1SYBA 1JORA 3J81j 1VMPA 2IX3A 1IKLA 2PQAA 2MUYA 1SMYD 5C4XB 2NYZD 1AZPA 3QIAA 3X3NA 2RSOA 3HOXB 4RA8A 1YJNA 4J1MA 1E7ZA 3K0XA 5GADC 1S72A 1DYQA 2N78A 2N3SA 4BA1I 1HZAA 2OT2A 4DR7Q 1RODA 3BVGA 4CKCA 3T4AC 2HUGA 1N32Q 3E6ZX 2KOLA 4XT1B 2OXPA 3KLSX 3KF8A 2M9VA 1RIPA 3I4LA 2Z4HA 3S2HH 4PZ8A 3DLLA 1C0AA 3UDGA 2VQFQ 5LL6S 2KHIA 4KHPL 1ASZA 1I3QB 3GTOB 5C4JH 4B3SL 2EYMA 2F0FA 4J6HA 5CGKA 3S1RB 2WB1E 1O78A 3TSSA 5DEHA 2K6AA 4RH6A 1KC8C 4DF7A 1X6OA 1TT2A 1D1IA 2B63B 1VQMA 2L0CA 1TY0A 4G7OC 1JB7A 4XDXA 1CK1A 1MHWC 1TS5A 1V9PA 2BDOA 5CBEE 4NKLA 3A55A 3M4PA 4DR3Q 1Q82C 1UE1A 4X66Q 1LLRD 1TS2A 5LMUL 2F0GA 3OTOL 1HR0Q 2FFKB 1Z47A 2Z9HA 3S1QH 1HA6A 2VS1A 3VR4A 5M5XH 1D6EC 3GTGB 5IYBG 3GD7A 3UE1A 1DZ1A 1WVLA 3CAMA 3NWSA 3SK5A 4JI3L 4P75A 4H02A 1XNRL 3HOVG 3PMFA 1WCMB 1FL0A 3F2UA 5ELDA 3TP5A 4A3DB 1XWEA 3KJPA 3RLOA 1MJEA 1BCPF 3I4NH 1VQBA 2C9OA 2I5LX 1MKHA 1RJTA 2RBMA 2RDGA 3IAYA 2AUKA 4LF7Q 4NW2A 4DV0L 5A2QE 2E2JH 5GROA 2JE6I 2A68D 1BDOA 3GDEA 4UHVA 4OELB 3C46A 1O7IA 3HOWH 2DN8A 1HTPA 2NVTH 4C56C 1YNND 2H1EA 2K5HA 1N8RC 2F4VL 2CWPA 2I5MX 4DA2A 4X66L 4A3FB 4A3GB 2JA9A 3HRZC 2QGQA 1G2SA 2R92B 2LKVA 1SSOA 4K8JA 3L9AX 1DOKA 2JEAI 1JCKB 3SXHA 2EE1A 1X9NA 5JPNC 1HH2P 1SE4A 4DR4L 2PO4A 4K5XA 2G9DA 2N8NA 3HFZB 4FXGC 5JEAJ 1SE3A 1TY2A 3R2IA 3L0OA 2QEJC 3PQIA 5I9OA 4DR4Q 5EPJA 5E3FA 1DONA 1K8OA 3PO3B 2ZTCA 4LNQA 2JA7G 3F1ZA 5AJ3L 4H13C 3OSOA 1ET6A 1EQRA 2BCOA 4X6AH 3KF8B 4IUPA 4JI7Q 3FPUB 3W5OA 5JJZA 1HQRD 3LWUA 2K03A 5IE8A 1XTDA 2ZTEA 2RQXA 2PZTA 3ND9A 3OWEB 1VS0A 4DR7L 4YCUA 2EJGC 4QQBX 2CQOA 2DUDA 2KQ3A 3Q8DA 1AP0A 4OGQC 4HJ8A 4A3CG 1ZKOA 3PUWA 4ME5A 2WAQG 4CGYB 3STBD 4A3BG 1PYBA 3OMCA 2E2HB 5CORA 2YTXA 5HGTA 1HCZA 4X65L 3BYYB 4LF8Q 2QKIC 2XVSA 3CC4A 4JI5L 2K7VA 4KN4C 1STEA 5KYLA 2Z6BA 2R92H 1V1QA 3KJOA 4AYBB 4QUFA 3TZUA 1FJGL 2IPKD 2AMCB 1IW7C 1QOHA 4LF6L 3H0GH 4FYDA 2CW0C 1RDPD 4ULLA 4NP5A 1GUTA 3A74A 3GV3A 3R3OA 4G7ZC 3GTPH 4L5QA 1MGSA 2X6GA 1KABA 3BDOA 4A3LH 3SHLA 2Z6KA 2UUBL 2E75C 3I8ZA 3U9OA 3D4RA 3EJIA 4KY6A 1PTOB 4Q5VA 1UE5A 5I2XA 1RCVD 3CCSA 5GAHC 5JEAH 3TQYA 5IOCA 3QB3A 3U9SA 1A3TA 2UUBQ 1UE6A 1B70B 1WCMH 4DK6C 1GJXA 3T13A 4OIJA 1QB5D 4KKTA 1UE7A 5JEAG 3VYSA 2Z6KC 3NXWA 4Z9CB 1WTOA 5FLXE 1AN8A 2N55A 4L5TA 2ALYB 4IUQA 1STYA 3FPPA 5E7NA 4LAAA 4FF4A 5LL6X 4HSPA 4ME3A 5JVG3 3KBGA 1NR2A 2VNUD 2E8GA 2K75A 1JWMD 4A3JB 4N8FA 3PUXA 4IN3A 1E2VA 1VQCA 4HEDA 3CCLA 2JA6G 2DNCA 1NTGA 4O2DA 2I0QA 4BXXH 3STBC 4A3JG 2JA6B 2EYOA 4ZCKA 3HOYG 4F88A 3PIO3 4AQYL 3CMAA 4HIKA 2AKWB 3B6YA 3K5MA 3T51B 4CBVA 4FNFA 1J5EQ 2E5LL 1JMCA 4TRDA 1JQYD 2UXDL 4V190 4QGUA 4CKEA 1IYJB 4C3IG 5M3MB 4DR2L 4A3CH 3HOYH 1TVXA 1K28A 3HOXG 5AJ3Q 1SFOH 4A3FG 3NBIA 5EPKA 1PRTF 5KRUA 4DR1Q 1S3OA 1H9SA 1VQ6A 4DK1A 3HOXH 1SDFA 4C1NI 3TREA 3D4DA 4BBSG 2A19A 1DOMA 1M4VA 2KHSA 4U68A 5ELOA 4ALPA 2BH2A 4JG2A 3PO3G 2V4DA 3AFQA 5EAYA 2A8VA 4G4KA 2EXZA 3CCVA 3MXNA 4IFDG 1B7YB 2WV6D 1UUPA 5IWAL 3CU7A 2R7ZG 2D9UA 5K5PA 3QOLA 3EA6A 1D5MC 1A63A 2JXMB 4DK3C 4DUYL 3I4MH 4MTKA 2FXQA 2L15A 1HZ9A 2P5ZX 4PMBA 2VUMB 1XPRA 1VQKA 1VF7A 2JP1A 1TXYA 3HS0C 1Y8PB 3JAML 1U9RA 3OHXC 3D6WA 1E2ZA 3H09A 1TWAB 4JI0L 3OMGA 2EVBA 1T5XD 1ET9A 3MC0B 4JI3Q 4DAPA 3S9WA 2A73B 4ZK9B 3CXCA 5IGFA 1STBA 3K58A 1FNUA 3HKSA 4B3RL 4A3BH 1U0LA 4A3DG 3AYHB 5F2DA 1SNPA 4X64Q 5FK9C 4A76A 3S14H 2R93G 3FKIH 2A69D 4K14A 5EKKA 3ONAB 3VYRA 4DR1L 4POGA 3PO2G 1KLUD 1VMCA 2YTVA 3CW2C 2WP8J 1WTXA 2LXKA 2IJ0A 1WOCA 3W3AA 4K6DA 4JCVE 2AWNA 3HKZE 4A3MB 1VQHA 4GKKL 5IGGA 5FLXc 2OQ0A 3NTIA 1B50A 1GUSA 3SE0A 3S1NB 3NPPA 4UP7A 4JI4Q 3E9IA 5M5YH 5KEEA 4A3MG 4CDEC 3HOZH 1C7YA 4PMCA 1U4LA 4XQQA 5D3DA 2F03A 2K52A 4F8MA 1VQLA 4LF4L 1F2YA 1S5FD 2O4XA 4C2MH 4TKOB 2PI2A 4K0KL 3A5ZB 3MAQA 2JJQA 4KV6A 1F9PA 2NBFA 1H9KA 3IL8A 3ZYYX 3IFDA 1IBLQ 3O13A 2VQEL 3S17B 3JC66 4PZ6A 3A8KE 1U4PA 3K57A 4Y7NH 1X65A 2Y0SE 3MZ5A 4QY7A 2PI2E 4BY7H 3X3MA 2Q8RE 1PYWD 1I94L 2KJXA 1JB3A 2YYZA 2UXCL 1ZYRC 2KCMA 2L55A 3ULPA 4EGVA 4EVOA 3Q23A 1TWCB 1IBMQ 4YWMA 4OIKA 3HOZB 5M5YB 4C3HG 4JI2Q 3S1NH 1BBUA 5EKIA 4R4CA 1MD2D 1XPOA 1PLFA 1CKMA 3GTJB 3T1YL 4A3GH 2J4XA 4K0KQ 1X55A 4R8NA 2RKSA 1Q3LA 4BY1B 1JWUD 1SYCA 2L1BA 2RHQB 2JA8H 3HOZG 3K0YA 3NELA 1I50B 1GKHA 3HOVH 5M3MG 4DV4L 4POFA 4BY1G 3ZJYC 2LFNA 2QCPX 4C3IH 1SJED 2F3IA 1TWFB 3GQBA 5HURA 3NQIA 5I2YA 1QNUA 2YTYA 4DV1L 2VL6A 4B08A 3S14B 4IUTA 4IJHA 4I65A 4IJLA 3UDFA 4NB3A 4E6IA 2NN6H 5C6AA 1BCPC 2SEBD 4DFAA 4EQPA 4GOPB 2R93H 1PDQA 3A7AB 3MFGA 3T1HL 1CSPA 1ILPA 2D0PA 3RZOB 5IGEA 3S1QB 1N36L 5JJKA 4LF6Q 1QNKA 2E2IH 1HRJA 1DD2A 5C4XG 2NTSA 3MTSA 4NXNL 3NHHA 2VUMH 4PZ7A 1GM5A 2A6EC 1EWHA 2XSCA 3CCQA 2BH8A 3I4OA
chains in the Genus database with same CATH topology
2XIWA 4R9WA 1EY5A 1XYIA 4KD3A 3TP6A 2K28A 1G8ZD 3C3LA 5FOBB 1HHVA 5BN4A 1R9TB 1S5DD 3HOVB 1EIGA 5C0XJ 1JICA 2F0KA 2F0IA 4UDUC 2OF1A 2FHTA 4CKBA 1B44D 3GTKB 2PZWA 2KUMA 3EVQA 4FXKC 3OOCA 3PUVA 3G7LA 2Y0SB 4FXDA 5AFWA 4BY7B 2EJMA 2EY1A 5C3EB 1A2UA 3RMHA 3GTMB 4PMWA 1ILQA 2L9HA 3FDTA 3E5SA 3LWEA 1F9QA 4C2MB 1SYDA 3D6CA 4U673 5CV8A 1EU3A 4NDXA 2PPBC 1DCZA 5JPMC 3GTLB 3OPOA 5JVH3 4H7BA 1TU2B 3I72A 1UNSA 3S1MB 1EL0A 4BWGB 4RKBA 2F0QA 3PUZA 5K36H 2WAQB 1H9RA 4B9WA 3D4WA 1ML0D 1DM0B 3QOJA 2ZXOA 4RAUC 4KN7C 4K5VA 1JWSD 1EYAA 3K5NA 3HP3A 3FKIB 3MXGA 1KDBA 1MSGA 1SNQA 1D5XC 1X3QA 5I9PA 3GTPB 3TMEA 2GA4B 3MVVA 1MI2A 2LMCB 2AQ3B 3KK7A 5G3LF 1A3UA 5E4WC 4KK7A 4HCEA 5KIXA 5KYIA 2F0UA 3L7ZC 4B9XA 3J80L 1B3AA 2EZVA 3L3OC 3BDLA 1K83B 3DUZA 2BA0A 1A6XA 2E76C 2SNMA 4JBWA 3GP7A 4ZKBB 1ENAA 1LTRD 3DMUA 1O7ZA 1HTLD 3P75A 1S5ED 2G9HD 2MJ8A 4RGOS 4KY5A 1Z7TA 3R93A 2CW0D 2F0WA 1GUWA 2NZ1D 2F0LA 1JOOA 1WD0A 1EYCA 2NVYB 2F0TA 4HR7B 2IWHA 5C0XH 4RCOA 1LT6D 2R6GA 3W2DA 3VYTA 4HTHA 3PV0A 5KNBA 3PUYA 4RGNA 3GO5A 1O7YA 4BS9A 1BCPB 4DNTB 1HUMA 3NBHA 2AUJD 4IFDJ 1QCBD 3D31A 5C0XI 2KCCA 2NB0A 3KLRA 4A3KB 3S15B 1QWYA 4EQNA 5KGUA 2EY6A 3NTKA 3H94A 4XQNA 1STHA 1IL8A 3BYTB 1PRTD 3MA2B 4MHEA 2K5QA 4ZLTF 5FKAC 4KHVA 4I7ZC 3KLSA 4QCLA 1Q90A 1KTKA 4LJZC 1U4MA 1QJOA 1WTPA 2BA1A 1CQVA 2F1MA 3OIPA 2PQEA 2K32A 3SEBA 3VR5A 1ZYRD 2A6ED 3WOEA 1JOKA 1I4GA 1I4RA 1LTID 1M8AA 2VXWA 1PRTC 5J39A 2JA5B 4OO1I 3TN2A 4N9TA 3M7NA 3H91A 2JEBI 3LNNA 4DU9A 1W6JA 3E0JA 1QG7A 2B2VA 1SFOB 1SXTA 3A56A 1EOTA 4DNRB 5I6YA 1ICWA 3HZXA 3OW7A 5COYA 3NWTA 2F0HA 1GOZA 4KD4A 2IL8A 1CM9A 1WTVA 5NUCA 5ELCA 2ID0A 2RDHA 1LT3D 3K59A 1TKWB 4H44C 3J81L 3R8BA 2MHVA 1G291 3PIP3 2KECA 3I73A 4QMGA 3RD4A 1YNJD 2KEEA 2N88A 2F0MA 1UEAB 3A8JE 1R4PB 1RTOA 3CQZB 1NR4A 1TS4A 1JE4A 3NK9A 1AW7A 1YNJC 2VB3X 1PTOH 1H9SB 1A15A 2J7ZA 2AQ1B 3HEJA 5D65A 1SAPA 2WIIB 4C3JB 2E2JB 1BNZA 4OL7A 1F77A 3H0GB 2F0NA 2A5HA 2KCNA 2B2WC 4C3JG 4OHJA 1Q1EA 3NSWA 3SVMA 3M4OB 1L0YB 2HQEA 4ZYSA 4O42A 4HCSA 2NVXB 4ZQ3A 1KDCA 5IGCA 1HFNA 2RSNA 4DXGA 4X3SA 1HXYD 1STAA 1SJHD 4M8AA 4RGTA 1KAAA 5IT9L 2ZT9C 1LT5D 2X6LA 5ELBA 5BN5A 4K8IA 1PRTB 4ZUJA 5DM73 1NCVA 1STGA 2DY8A 3S2DB 4XTCS 1Q1BA 2LY7A 1SEBD 5CC4A 3LX0A 3D3RA 2F0JA 2ICEC 5IGDA 5DM63 2Z1CA 3S2HB 4QUCA 2RDFA 4X3KA 4F7XA 1I6HB 3SR1A 3MXPA 1SMYC 2MP1A 2A6HC 1OXXK 1Y8OB 3K7AB 1EIHA 5E4XA 2ENBA 2FJ2A 1X3PA 2PZUA 1Z6HA 3CHBD 1WTRA 1EY4A 1LT4D 3J80E 5BN3A 4TQUS 2PW7A 2WKCA 5ELEA 3VR2A 1B53A 4RCNA 5E1FA 3I3CA 5ELFA 4PNYA 2L4NA 4UAIA 2B2TA 3VR6A 3P7JA 1SYGA 4IFDH 3A8IE 5C3WA 1HUNA 3MHBA 2NN6G 2B2YC 2F0PA 3T56B 5D3IB 3I4NB 3V05A 3H6MA 2IW3A 2BDNA 2JSOA 1JR0D 3UI2A 3HGBA 4S3SA 3ITPA 2RVLA 3MEHA 2NVQB 1ONLA 3NTHA 1IKMA 2A74C 4IZ8A 5M5XB 2NUCA 3TBIB 2R93B 2Q8TA 1PMRA 2XNAC 3KUPA 1SYEA 3P1HA 2WKDA 2F4IA 1OXVA 3FEWX 4MIUA 4MN3A 4KMUC 1DXMA 4KY7A 3S16B 1IYVA 3Q6SA 5EJWA 2KEDA 2NWGA 5CV5A 1DOLA 1B4OA 1II3A 2K1BA 1G2TA 1GXDC 1RKNA 4A93B 3AB9A 1YNNC 3WDNA 1I6VC 5CYUA 1SYFA 2B2UA 2F0VA 1JC7A 5A2QL 2SNSA 5IIFA 2F0EA 2JA7B 1VDZA 4BA2I 2K5WA 3GTQB 1EYDA 1CHQD 2EY5A 1C8CA 1FD7D 1MSHA 5EKLA 1FYCA 4H0LC 4EQOA 1PZKD 1V1PA 2E2DC 4RKLA 3J7AV 1VCIA 3MXUA 4L6TB 2Q8IB 2B39A 2EY2A 3JAME 1KDAA 4KKUA 1TS3A 3CRLC 3EROA 2EYFA 4J8QA 5CV4A 1BUVT 2MPMA 3SDZA 1LTSD 2NN6I 1SNDA 1SBBB 3MWYW 2PYKA 4XT3B 4K2LA 2HDLA 3BVZA 1HQMC 2HDMA 3I91A 1CA6A 1LO5D 3OWFA 1O7LA 1TIID 1Q8IA 2XRSD 3H3VC 1PFNA 4BBRB 3DM1A 4WFN3 1EY8A 4QB4A 4XXEA 4KI0A 1OO9B 4FF2A 1BO0A 4N9PA 1F2MA 3TZDA 4FF3A 1PFMA 1Y8NB 1Y69U 4CHTB 1GHJA 1A2TA 1V1PB 2PNRC 1CZWA 4ABNA 2DY7A 2JA8B 4WRDA 3DEPA 3I4MB 2F3VA 2RA4A 3V96A 3D8GA 1I4HA 2C5CA 1ESRA 5IGBA 4DK0A 3A7LA 4FO2A 3KBXA 1UAPA 3BDCA 3M3YB 1H9MA 4O1NA 4A3IB 4JK1C 2DNEA 3BZDB 4IALA 2D62A 5C4HA 4A3EB 5C0XG 5CV6A 1LTBD 3BVMA 3M7GA 1CI3M 3OIQA 4RHSA 2EYPA 1NSNS 3ND8A 4DGZA 1S5BD 1U4RA 5C3XA 5C5LA 2ICIA 1E0BA 1AEXA 3I90A 5G3LD 2M00A 3QO2A 4ZAIA 1C48A 1BCPD 1J9OA 3Q22A 3TP7A 4C3HB 3M4YA 2B2TC 3QJYA 5IT9E 2L12A 1LACA 4OO1H 2B2YA 1CQFA 1F2ZA 1BF4A 1PFBA 4FP5D 1CTMA 5KNDA 1EY9A 1NUCA 3K6OA 4FF1A 1E2WA 1WTQA 1PXUA 3MFYA 3DEOA 4Q0FA 1KNEA 1WD1A 4ID6A 2XRQD 5DAUA 2B8GA 2F3WA 3DXJC 4KKSA 1LABA 1F9SA 3URYA 5C4ZA 4KTAA 1X32A 3EFXD 1PTOC 1RF2D 5M9OA 3AMUA 4L63B 2OEOA 5CR3A 2KVMA 4IQZA 1SNOA 1EQVA 1FNVA 1TWGB 2AQ2B 2EYJA 5EBCA 4DN4M 2WACA 1OXTA 4RWSC 2CHBD 1WTWA 4DAVA 1KLGD 3GV6A 2M2LA 1ZXTA 5DNFA 1PTOF 5C5MA 3C1EA 3I70A 5IODA 3RLFA 1A3VA 2TSSA 2MGSA 2WB1B 1S4ZA 1IYUA 1BOSA 5CMDA 4XYQA 3HOYB 2R61A 5FO8B 4ODGA 2SDFA 5I6WA 1CHPD 2KA7A 1ENCA 3VA5A 4RGMA 1KNAA 3R2TA 4F87A 1D5ZC 4ZKCB 2NTTA 3K5OA 3NE5B 1R4QB 1B1ZA 5J22A 4IURA 2D2CC 1STNA 4C1NK 3P20A 4XYOA 1VF5C 4P2CB 2F0SA 5M5WB 4QF4A 3K5LA 3EQLC 1AZQA 2O5JC 4LMQD 2EYHA 1V1OA 4KJNA 4BBSB 1FNWA 2XWJB 2EDGA 1Q12A 1RTNA 2QILA 2H4OA 1TWHB 1ZEQX 4X3UA 1RHPA 4YIJA 4HSVA 4X3TA 3V2TA 3IFTA 5T1IA 1D1KA 2XWBB 3HOUB 2ZXRA 2NVTB 1SNCA 1C4QA 4CJ2C 3HOWB 5JAVA 1EY7A 3SK4A 3SK6A 2O5IC 2D5DA 4LK1C 2CQAA 1FGBD 5CBAE 3AU7A 4DXFA 2XN9C 1QILA 5EGTA 3Q24A 4K2KA 2EJFC 3NP8A 1O80A 1I4XA 1S5CD 4R8IA 2A68C 4V0BA 3CRKC 4IUUA 4NMZA 2PCFB 4XQJA 1EWCA 2HCIA 2FMMA 1EZ8A 1IHZA 4IUNA 1B9MA 2R3ZA 4K5WA 1BR9A 3FVQA 4IFDI 4QIWB 3T53B 5K36G 5LHY1 2E74C 3N6RA 2BE5D 2BOSA 3BS1A 2FMCA 1W6KA 5FO9B 2PW5A 3WOFA 3J7AF 2K5DA 2ZXPA 3SK8A 1EU4A 4IUVA 1GUOA 1LTTD 2SOBA 2B2VC 2IT1A 3HKZB 4KHZA 3IKJA 5TSSA 2I07B 3M85A 4ZRZA 1PZJD 2AWOA 4GZYC 1LTGD 1I4PA 1ENFA 2JYOA 1HA5A 5A35A 4HMIA 1CZGA 2O2LD 4HAEA 1D2BA 1F9RA 2VB2X 1XX8A 4ZUIA 3HG9A 1PZID 5J1ZA 3RUZA 4WJWA 3G6JB 1BXTA 1G91A 1GUNA 2QDBA 2E2IB 3FMCA 5I4DA 4RHRA 2X69A 1XTCD 1MBYA 4G7HC 5EQ0A 1HFGA 1XXGA 2CVRA 5T1GA 1I4QA 5ISRA 3T16A 2Z8LA 1PTOD 2EYLA 1EEID 3TP8A 4C3IB 3DWAA 2EOTA 1JOQA 5FO7B 5C4JB 4KJOA 2WINB 1NAPA 1GUGA 1CFMA 5JOBA 5M3FB 2K33A 3J7YW 1CT1D 1SNMA 3DWQA 2B2WA 1V8QA 3J81E 2YU9B 4XIGS 2QF7A 5EBDA 4WORA 1T5EA 1HPCA 4CJ0B 4OO1G 1OXSC 3TDQA 2HCCA 4Y7NB 1CA5A 3PO2B 4TSSA 1B9NA 2K01A 1G6ZA 2LS01 1Y1WB 2B2UC 1BBXC 5EPLA 3A54A 4M1UB 1H9JA 4HMJA 1FR3A 2A6HD 5CV7A 4PQXA 3VR3A 1EY6A 4HN7A 5FLXL 3NUCA 2IX0A 1TQOA 2A69C 3CKIB 1Y1VB 1V43A 1IW7D 2F0DA 1EQTA 4L8JA 2I46A 2Z4IA 3Q0AA 5CV9A 3QWNA 3N52A 2EPBA 5KNCA 3DHQA 4PV1C 1BQQT 2BE5C 1F2LA 2R7ZB 1EY0A 1SE2A 3C2PA 3NQTA 1RD9D 5D14A 1AFPA 3FRPB 4A3BB 3VYUA 2FINB 2L5TA 3DWPA 1TR5A 1OXUA 3QG1A 2F0OA 2B8FA 1EFID 1LTAD 1J8IA 2J0TD 2K04A 2L11A 4FVMA 4K6LA 1QE6A 1GHKA 1L0XB 4G57A 1DJRD 2TMPA 1K8MA 3BG3A 1ESFA 3C1FA 3ERQA 2K05A 4DAYA 3RZDB 1EZ6A 5C44B 3VA7A 1EEFD 2PMZB 1B2TA 4CJ1B 1LV9A 2IX1A 4ILWA 4RFBA 1SYBA 1JORA 1VMPA 2IX3A 1IKLA 2MUYA 1SMYD 5C4XB 2NYZD 1AZPA 3QIAA 3X3NA 2RSOA 3HOXB 4RA8A 4J1MA 1DYQA 4BA1I 2OT2A 1RODA 3BVGA 4CKCA 3T4AC 2HUGA 3E6ZX 2KOLA 4XT1B 2OXPA 3KLSX 3KF8A 2M9VA 3I4LA 2Z4HA 5LL6S 1I3QB 3GTOB 2EYMA 2F0FA 4J6HA 5CGKA 3S1RB 1O78A 3TSSA 5DEHA 2K6AA 4RH6A 4DF7A 1TT2A 1D1IA 2B63B 2L0CA 1TY0A 4G7OC 4XDXA 1CK1A 1TS5A 2BDOA 5CBEE 4NKLA 3A55A 1LLRD 1TS2A 2F0GA 2FFKB 1Z47A 1HA6A 3VR4A 1D6EC 3GTGB 3GD7A 1DZ1A 1WVLA 3NWSA 3SK5A 3PMFA 1WCMB 3F2UA 5ELDA 3TP5A 4A3DB 1XWEA 1BCPF 2RBMA 2C9OA 2RDGA 1RJTA 3IAYA 2AUKA 4NW2A 5A2QE 2JE6I 2A68D 1BDOA 3C46A 2DN8A 1HTPA 4C56C 1YNND 2H1EA 4DA2A 4A3FB 4A3GB 3HRZC 1G2SA 2R92B 2LKVA 1SSOA 4K8JA 3L9AX 1DOKA 2JEAI 1JCKB 3SXHA 2EE1A 5JPNC 1SE4A 2PO4A 4K5XA 2G9DA 4FXGC 5JEAJ 1SE3A 1TY2A 3R2IA 2QEJC 5I9OA 5EPJA 5E3FA 1DONA 1K8OA 3PO3B 4H13C 3OSOA 1ET6A 2BCOA 4IUPA 3FPUB 5JJZA 1HQRD 3LWUA 2K03A 2RQXA 2PZTA 3ND9A 3OWEB 2EJGC 2KQ3A 1AP0A 4OGQC 1ZKOA 3PUWA 4ME5A 4CGYB 3OMCA 2E2HB 5CORA 5HGTA 1HCZA 3BYYB 2QKIC 2XVSA 2K7VA 4KN4C 1STEA 5KYLA 4AYBB 4QUFA 3TZUA 2IPKD 1IW7C 1QOHA 4FYDA 2CW0C 1RDPD 4ULLA 4NP5A 1GUTA 3GV3A 3R3OA 4G7ZC 1MGSA 2X6GA 1KABA 3BDOA 3SHLA 2E75C 3I8ZA 3U9OA 3D4RA 3EJIA 4KY6A 1PTOB 4Q5VA 5I2XA 1RCVD 5JEAH 5IOCA 3QB3A 3U9SA 1A3TA 1GJXA 3T13A 4OIJA 1QB5D 4KKTA 5JEAG 3VYSA 3NXWA 4Z9CB 1WTOA 5FLXE 1AN8A 2N55A 3FPPA 4IUQA 1STYA 4FF4A 4LAAA 5LL6X 4HSPA 5JVG3 3KBGA 1NR2A 2VNUD 1JWMD 4A3JB 3PUXA 4IN3A 1E2VA 4HEDA 2DNCA 2JA6B 2EYOA 4F88A 3PIO3 3K5MA 3T51B 4CBVA 4FNFA 4TRDA 1JQYD 4V190 4CKEA 4C3IG 5M3MB 1TVXA 3NBIA 5EPKA 1PRTF 5KRUA 1H9SA 4DK1A 1SDFA 4C1NI 3D4DA 1DOMA 1M4VA 2KHSA 4U68A 2V4DA 4G4KA 2EXZA 3MXNA 4IFDG 2WV6D 1UUPA 3CU7A 2D9UA 5K5PA 3EA6A 3QOLA 1D5MC 2JXMB 4PMBA 2VUMB 1VF7A 2JP1A 3HS0C 1Y8PB 3JAML 1U9RA 3OHXC 3D6WA 1E2ZA 3H09A 1TWAB 3OMGA 2EVBA 1T5XD 1ET9A 3MC0B 4DAPA 3S9WA 2A73B 4ZK9B 5IGFA 1STBA 3K58A 1FNUA 5F2DA 1SNPA 5FK9C 2A69D 4K14A 5EKKA 3ONAB 3VYRA 1KLUD 1VMCA 2WP8J 1WTXA 2IJ0A 3W3AA 4K6DA 2AWNA 4A3MB 5IGGA 3NTIA 1B50A 1GUSA 3SE0A 3S1NB 3NPPA 5KEEA 4PMCA 1U4LA 4XQQA 5D3DA 2F03A 4F8MA 1F2YA 1S5FD 2O4XA 4TKOB 3MAQA 4KV6A 1F9PA 2NBFA 1H9KA 3IL8A 3ZYYX 3IFDA 3O13A 3S17B 3A8KE 1U4PA 3K57A 3MZ5A 3X3MA 2Q8RE 1PYWD 2KJXA 1JB3A 2YYZA 1ZYRC 2L55A 4EGVA 4EVOA 3Q23A 1TWCB 4OIKA 3HOZB 5M5YB 4C3HG 5EKIA 1MD2D 1PLFA 3GTJB 2J4XA 4R8NA 2RKSA 1Q3LA 4BY1B 1JWUD 1SYCA 2L1BA 3K0YA 1I50B 2LFNA 2QCPX 1SJED 1TWFB 3GQBA 5HURA 3NQIA 5I2YA 1QNUA 4B08A 3S14B 4IUTA 4I65A 4E6IA 2NN6H 5C6AA 1BCPC 2SEBD 4DFAA 4EQPA 1PDQA 3A7AB 3MFGA 1ILPA 3RZOB 5IGEA 3S1QB 1QNKA 1HRJA 1DD2A 2NTSA 3MTSA 3NHHA 2A6EC 1EWHA 2XSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8F A;  1CFM A;  2BE5 D;  3D31 A;  3SE0 A;  3EQL C;  4PV1 C;  2K33 A;  2KCC A;  1HCZ A;  3AB9 A;  1TKW B;  1E2W A;  1YNN C;  4H44 C;  3MFY A;  3WDN A;  3KLR A;  1Y8N B;  2O5J C;  1Y69 U;  1I6V C;  1V8Q A;  1H9S A;  2K7V A;  1GHK A;  1GHJ A;  4KN4 C;  4XIG S;  2QF7 A;  2B8G A;  5BN4 A;  4DK1 A;  2PNR C;  3BG3 A;  1G29 1;  1K8M A;  3DXJ C;  3TZU A;  2EDG A;  3I73 A;  2AUK A;  4KKS A;  4TKO B;  1LAB A;  1Q12 A;  1T5E A;  5KND A;  1SMY C;  1IW7 C;  1GUO A;  3H94 A;  2A6H C;  1H9K A;  1OXX K;  1Y8O B;  1HPC A;  2JE6 I;  2A68 D;  1OXS C;  2CW0 C;  1BDO A;  4OO1 G;  2IT1 A;  3VA7 A;  1GUT A;  1VDZ A;  3A8K E;  4BA2 I;  4KHZ A;  3A8J E;  3IKJ A;  2LMC B;  3IFT A;  2V4D A;  4G7Z C;  3M85 A;  2DN8 A;  1HTP A;  2AWO A;  4IQZ A;  4GZY C;  4IFD G;  3BDO A;  1B9N A;  4I7Z C;  2E75 C;  2YYZ A;  4DK0 A;  1ZYR C;  3A7L A;  3D4R A;  3OOC A;  3PUV A;  1YNJ C;  1FYC A;  1Z6H A;  1Q90 A;  5A35 A;  5JEA H;  4H0L C;  4LJZ C;  3QIA A;  3L7Z C;  3U9S A;  1QJO A;  2BA1 A;  1H9M A;  1H9J A;  5BN3 A;  2JXM B;  1FR3 A;  2O5I C;  2A6H D;  4JK1 C;  1OXT A;  2DNE A;  2D5D A;  4LK1 C;  4TQU S;  2JEA I;  2EJM A;  1GJX A;  2D62 A;  4KKT A;  1H9S B;  1VCI A;  5JEA G;  3VR2 A;  4BA1 I;  5C0X G;  1VF7 A;  2BA0 A;  1A6X A;  2E76 C;  2F1M A;  4RCN A;  3MXU A;  3VR3 A;  4JBW A;  2K32 A;  1Y8P B;  3VR5 A;  2Q8I B;  2A69 C;  3FPP A;  2A6E D;  3VR6 A;  1CI3 M;  4KKU A;  1E2Z A;  3CRL C;  1V43 A;  1GUN A;  2EVB A;  3ND8 A;  3RLF A;  2EJF C;  3A8I E;  1IW7 D;  4IFD H;  3I4L A;  4L8J A;  3FMC A;  2NN6 G;  1K8O A;  1IYU A;  2PPB C;  1DCZ A;  1Q1E A;  1Z7T A;  3SDZ A;  2A68 C;  3T56 B;  3GQB A;  4H13 C;  3OPO A;  2NN6 I;  3CRK C;  3PUX A;  2PCF B;  4G7H C;  3M7N A;  3HGB A;  1E2V A;  2JEB I;  3LNN A;  5KNC A;  2A69 D;  2DNC A;  1ONL A;  1TU2 B;  1HQM C;  1B9M A;  1O78 A;  4HR7 B;  2BE5 C;  2KA7 A;  2NN6 H;  3I72 A;  3LWU A;  5C0X H;  2R6G A;  3ND9 A;  4DNR B;  1PMR A;  3PUZ A;  5K36 H;  1O7L A;  3A7A B;  1H9R A;  2EJG C;  3M4Y A;  3QJY A;  2ZT9 C;  5KNB A;  3PV0 A;  4OGQ C;  4G7O C;  3OW7 A;  3T51 B;  5BN5 A;  3NE5 B;  4KN7 C;  1ZKO A;  3PUW A;  1OXV A;  3T53 B;  2BDO A;  3PUY A;  1DD2 A;  1LAC A;  4OO1 H;  5K36 G;  2L5T A;  2D2C C;  3W3A A;  4KMU C;  1DXM A;  4DNT B;  3P20 A;  4XTC S;  1Q1B A;  1VF5 C;  1IYV A;  2AUJ D;  2A6E C;  2E74 C;  1EWH A;  4KI0 A;  3N6R A;  3VR4 A;  1OXU A;  1CTM A;  3QG1 A;  1GUG A;  1GUS A;  3GD7 A; 
#chains in the Genus database with same CATH topology
 2XIW A;  4R9W A;  4UPA A;  1EY5 A;  1XYI A;  4KD3 A;  2B63 H;  3TP6 A;  1HZB A;  2K28 A;  1G8Z D;  3C3L A;  5FOB B;  1VQJ A;  1HHV A;  5BN4 A;  1R9T B;  3I4M G;  1S5D D;  3HOV B;  1EIG A;  5C0X J;  4IO9 A;  1JIC A;  2F0K A;  2F0I A;  4UDU C;  2OF1 A;  2FHT A;  5LMN W;  4CKB A;  2G5D A;  1M1K C;  2Q2U A;  1B44 D;  3GTM H;  3GTK B;  1KHI A;  4GNX C;  4GKK Q;  4LFB L;  5C3E H;  2PZW A;  2KUM A;  3EVQ A;  4FXK C;  5GAE C;  3OOC A;  3PUV A;  3OTO Q;  2R7D A;  3G7L A;  2Y0S B;  4FXD A;  5AFW A;  3CPW A;  3F2D A;  1BBW A;  2ZJR A;  4BY7 B;  2EJM A;  2EY1 A;  5C3E B;  4DV5 L;  1A2U A;  2QA4 A;  4BXX G;  3RMH A;  4A93 G;  3NEM A;  3GTM B;  4PMW A;  1ILQ A;  2L9H A;  2VZA A;  3FDT A;  1I6H H;  3E5S A;  4RG1 A;  4OWX B;  3LWE A;  1F9Q A;  4C2M B;  1SYD A;  4DR6 L;  1KD1 C;  3D6C A;  4U67 3;  5CV8 A;  2QDL A;  3EIV A;  1EU3 A;  1EQQ A;  4CDD C;  5C44 H;  4NDX A;  2PPB C;  1DCZ A;  5JPM C;  2UU9 Q;  3GTL B;  3HKZ G;  3OPO A;  2K4K A;  5JVH 3;  4H7B A;  1Q7Y C;  1KRS A;  1TU2 B;  3I72 A;  1UNS A;  3S1M B;  1EL0 A;  4BWG B;  4RKB A;  2F0Q A;  3PUZ A;  5K36 H;  2WAQ B;  1H9R A;  4B9W A;  3D4W A;  1ML0 D;  1DM0 B;  3QOJ A;  1X3F A;  2ZXO A;  4R4I A;  4RAU C;  4KN7 C;  4K5V A;  4B3R Q;  1JWS D;  1EYA A;  2NVQ H;  3K5N A;  4HJ9 A;  3KDF B;  3HP3 A;  1J6Q A;  3FKI B;  1W3S A;  3MXG A;  1KDB A;  1MSG A;  3RN5 A;  2VUM G;  1SNQ A;  3RR5 A;  1D5X C;  3I56 A;  1EIY B;  1X3Q A;  5I9P A;  3GTP B;  4OWW B;  1HR0 W;  1X54 A;  4LFA Q;  1VQA A;  4KLK A;  4AH6 A;  3TME A;  2GA4 B;  4AYB E;  3MVV A;  4BY1 H;  1MI2 A;  2LMC B;  2AQ3 B;  3KK7 A;  5G3L F;  1A3U A;  1M90 C;  5E4W C;  1XPU A;  4KK7 A;  4HCE A;  3OYY A;  4JYA L;  5KIX A;  5KYI A;  2F0U A;  3L7Z C;  4B9X A;  3J80 L;  1B3A A;  2EZV A;  3L3O C;  4AQY Q;  4J15 A;  3BDL A;  4DUZ Q;  3K7A H;  4LW1 A;  2OWO A;  1Y1W H;  1K83 B;  3DUZ A;  3BZC A;  3PF4 A;  2BA0 A;  1A6X A;  2E76 C;  2SNM A;  4JBW A;  3CC2 A;  3GP7 A;  1VQD A;  4JBJ A;  1VQ9 A;  3KFU A;  4ZKB B;  1IZ6 A;  1ENA A;  1LTR D;  3S17 H;  4A4I A;  1D8L A;  2A1A A;  3DMU A;  4APV A;  1O7Z A;  1HTL D;  2ES2 A;  3P75 A;  2UXC Q;  1S5E D;  2G9H D;  2MJ8 A;  4RGO S;  2N49 A;  4KY5 A;  3SGI A;  1Z7T A;  2K5N A;  2CW0 D;  3R93 A;  4JOI C;  2F0W A;  2IHF A;  1GUW A;  2NZ1 D;  2F0L A;  5IT9 c;  1JOO A;  1WD0 A;  1EYC A;  2NVY B;  2JA7 H;  3T1Y Q;  2F0T A;  4HR7 B;  2IWH A;  5C0X H;  4RCO A;  1LT6 D;  1Q46 A;  3PO3 H;  2R6G A;  4MZ9 A;  4JI6 Q;  4R4Q A;  5M3F H;  3W2D A;  3VYT A;  4HTH A;  3PV0 A;  2DJF C;  1P8L A;  5KNB A;  3KLW A;  3NBH B;  3CP0 A;  5GQO A;  4A3E G;  3PUY A;  4RGN A;  3GO5 A;  1O7Y A;  4BS9 A;  1BCP B;  4DNT B;  1HUM A;  4DPG A;  3NBH A;  4OX9 Q;  5IP9 H;  4LUO A;  2AUJ D;  5FJ8 G;  2MO0 A;  4IFD J;  3BZK A;  1QCB D;  1EFW A;  3D31 A;  4BBR G;  5C0X I;  2KCC A;  2NB0 A;  3KLR A;  3RLN A;  4A3K B;  3KDF A;  3S15 B;  1QWY A;  4EQN A;  4LWC A;  5KGU A;  1WCM G;  4C3J H;  3J80 i;  1PVO A;  2EY6 A;  3NTK A;  3H94 A;  4XQN A;  1STH A;  1IL8 A;  3BYT B;  4NXN Q;  2UXB L;  5ELN A;  1PRT D;  2ZJP A;  3MA2 B;  3HOU G;  4MHE A;  2K5Q A;  4ZLT F;  5FKA C;  2NZO A;  4KHV A;  4I7Z C;  3KLS A;  1VQ5 A;  4QCL A;  1Q90 A;  1KTK A;  1Q86 C;  3ULJ A;  4LJZ C;  1U4M A;  1QJO A;  2DJG C;  2BA1 A;  1WTP A;  1N9W A;  1VQF A;  1CQV A;  1DGS A;  2HT1 A;  2OCE A;  5IYD G;  4DV0 Q;  2F1M A;  3OIP A;  1WJJ A;  2PQE A;  3S15 H;  1SMX A;  2K32 A;  1D7Q A;  3SEB A;  3VR5 A;  1ZYR D;  4A3K H;  2A6E D;  2R7F A;  3WOE A;  1JOK A;  5J3B A;  2RHS B;  2YV5 A;  1I4G A;  4DV6 L;  1PH8 A;  1I4R A;  1LTI D;  1M8A A;  2VXW A;  1PRT C;  5J39 A;  1PH3 A;  1MJC A;  4OO1 I;  2JA5 B;  3TN2 A;  3FP9 A;  1NY4 A;  4C3H H;  4N9T A;  3M7N A;  3H91 A;  2DGY A;  1KRT A;  1NE3 A;  2JEB I;  3LNN A;  4DU9 A;  1W6J A;  3GTO H;  3E0J A;  4YHH Q;  2UU9 L;  1QG7 A;  2B2V A;  1N34 Q;  1YVC A;  1SFO B;  1SXT A;  3A56 A;  1EOT A;  4BY7 G;  3A5U A;  4DNR B;  4DR6 Q;  5I6Y A;  4LF4 Q;  1ICW A;  3HZX A;  3OW2 A;  2ATW A;  3OW7 A;  3KYH C;  1YEZ A;  2NVY H;  5COY A;  1XNQ L;  3NWT A;  2F0H A;  1GOZ A;  4KD4 A;  2IL8 A;  1CM9 A;  1WTV A;  5NUC A;  5ELC A;  2CKZ B;  2ID0 A;  5C3E G;  2JA5 H;  3S2D H;  2RDH A;  3CME A;  1LT3 D;  3K59 A;  1TKW B;  4H44 C;  3G48 A;  5C4X H;  3S24 A;  4GN5 A;  3J81 L;  4A3J H;  2EQS A;  3R8B A;  2MHV A;  1G29 1;  2D0O A;  3PIP 3;  2PMZ E;  1AH9 A;  2KEC A;  3I73 A;  4QMG A;  3RD4 A;  1HNW L;  4GKJ L;  1YNJ D;  1IBK Q;  1X56 A;  2ZJQ A;  2KEE A;  2N88 A;  2F0M A;  1UEA B;  4L5R C;  1A62 A;  2NVX H;  3A8J E;  3MXN B;  1R4P B;  1RTO A;  3CQZ B;  1NR4 A;  3M4O H;  1JT8 A;  2GVA A;  1TS4 A;  1PH2 A;  1JE4 A;  3NK9 A;  1NMG A;  4YWK A;  1EOV A;  1AW7 A;  1JE5 A;  1YNJ C;  3E0E A;  4YCV A;  2VB3 X;  1UWV A;  1N33 L;  4X64 L;  4JBM A;  4IOC A;  3UE0 A;  1PTO H;  4P74 A;  2CH4 W;  1L1O C;  1H9S B;  1A15 A;  2J7Z A;  2AQ1 B;  3HEJ A;  2XTI A;  5D65 A;  1SAP A;  2WII B;  4C3J B;  2E2J B;  1BNZ A;  1CUK A;  4B3M Q;  3J80 c;  1EIF A;  4OL7 A;  3HOU H;  1F77 A;  3H0G B;  2IY5 B;  1GVP A;  2F0N A;  2A5H A;  2KCN A;  1LTL A;  1VQG A;  2B2W C;  2F52 A;  4C3J G;  1W2B A;  4OHJ A;  1Q1E A;  4RMF A;  5FJ8 H;  3NSW A;  3CQZ H;  3SVM A;  3M4O B;  1L0Y B;  5IP9 G;  2HQE A;  4B3T Q;  4ZYS A;  4O42 A;  4HCS A;  3GTG H;  2NVX B;  4GLA C;  4DV1 Q;  4ZQ3 A;  1VQ7 A;  1KDC A;  4OWT B;  1L2F A;  5IGC A;  3HOW G;  1HFN A;  2RSN A;  4DXG A;  1QVG A;  4X3S A;  1HXY D;  1STA A;  1SJH D;  1Y14 B;  4M8A A;  4RGT A;  1KAA A;  1IL2 A;  5IT9 L;  3J81 i;  2ZT9 C;  1LT5 D;  2X6L A;  4JC0 A;  5ELB A;  4JI1 Q;  4DR2 Q;  4KHP Q;  5BN5 A;  2AHO B;  4K8I A;  1PRT B;  4ZUJ A;  5DM7 3;  4EX5 A;  1NCV A;  1STG A;  2DY8 A;  3S2D B;  4LUZ A;  1Q1B A;  2LY7 A;  4R1J A;  4XTC S;  2VW9 A;  4MNO A;  1ASY A;  4DV4 Q;  1SEB D;  4N8X 1;  2UUC Q;  5CC4 A;  3LX0 A;  3D3R A;  2F0J A;  2ICE C;  5IGD A;  1IBM L;  5DM6 3;  2GVB A;  3PIO A;  2Z1C A;  3S2H B;  4QUC A;  2CWA A;  2RDF A;  4X3K A;  4F7X A;  1YIT A;  1I6H B;  4QIW E;  3SR1 A;  3MXP A;  3H3V H;  3PO2 H;  4X65 Q;  3EN2 A;  1SMY C;  2MP1 A;  2A6H C;  1OXX K;  1Y8O B;  2CH4 A;  3K7A B;  4JW0 A;  1EIH A;  3ICE A;  5E4X A;  1VQN A;  1I94 Q;  1S40 A;  1PA6 A;  4JI1 L;  2ENB A;  2FJ2 A;  1X3P A;  2PZU A;  1G6P A;  1Z6H A;  3CHB D;  3E9H A;  1WTR A;  1XJV A;  1EY4 A;  1LT4 D;  1X3G A;  3WWV A;  3J80 E;  5BN3 A;  4TQU S;  2PW7 A;  2CCZ A;  4WJ3 M;  4A3K G;  2WKC A;  5ELE A;  3VR2 A;  1B53 A;  4RCN A;  5E1F A;  3I3C A;  5ELF A;  4PNY A;  2L4N A;  4UAI A;  2B2T A;  4YCW A;  3VR6 A;  3U58 A;  3P7J A;  3S16 H;  1SYG A;  4IFD H;  3A8I E;  5C3W A;  2MNA A;  1HUN A;  3MHB A;  2NN6 G;  2B2Y C;  2F0P A;  3T56 B;  5D3I B;  1SR3 A;  3I4N B;  3V05 A;  3H6M A;  2IW3 A;  2BDN A;  3I55 A;  2JSO A;  1JR0 D;  3UI2 A;  4HJ7 A;  2EIF A;  3PF5 A;  3HGB A;  4S3S A;  3ITP A;  2RVL A;  3MEH A;  2NVQ B;  2JQO A;  4LF9 Q;  1ONL A;  3NTH A;  1IKM A;  1PFS A;  2A74 C;  2LXJ A;  4A3G G;  3TRZ A;  4IZ8 A;  5M5X B;  2NUC A;  3TBI B;  3KOJ A;  2R93 B;  2Q8T A;  1XMO L;  1PMR A;  5IP7 H;  3K81 C;  1VQO A;  2XNA C;  4A75 A;  4GKJ Q;  3KUP A;  1SYE A;  3P1H A;  2WKD A;  3NEN A;  2F4I A;  1OXV A;  3FEW X;  3CCE A;  4HID A;  4MIU A;  4MN3 A;  2VY3 A;  1N33 Q;  4IPG A;  4KMU C;  1DXM A;  4KY7 A;  3S16 B;  1IYV A;  1RL2 A;  3Q6S A;  5EJW A;  2R92 G;  4TVA B;  1CKN B;  2KED A;  2NWG A;  5CV5 A;  1DOL A;  1B4O A;  1II3 A;  2K1B A;  3GTL H;  1G51 A;  1G2T A;  1GXD C;  1WI5 A;  5IWA Q;  1RKN A;  4A93 B;  3AB9 A;  1YNN C;  1I50 H;  3WDN A;  1I3Q H;  1YZ6 A;  2IHE A;  3G6E A;  1I6V C;  5CYU A;  1SYF A;  2B2U A;  4X62 L;  4YWL A;  1L0W A;  2F0V A;  3JAM c;  2HD3 A;  1JC7 A;  3GTJ H;  5A2Q L;  2Q2I A;  2SNS A;  4EQ5 A;  3I7F A;  5IIF A;  2F0E A;  2JA7 B;  3J81 c;  2UUA L;  1VDZ A;  4BA2 I;  2K5W A;  1FVI A;  3U50 C;  3GTQ B;  1EYD A;  1CHQ D;  2QW7 A;  1HNX L;  2EY5 A;  3F2C A;  1AE3 A;  1C8C A;  1FD7 D;  1MSH A;  5EKL A;  5GAG C;  4LF5 L;  1FYC A;  4H0L C;  2UUC L;  4A3E H;  2Q2T A;  4EQO A;  3GTK H;  4GLV B;  1PZK D;  1V1P A;  3CF5 A;  2E2D C;  4IOA A;  4RKL A;  1JJ2 A;  3J7A V;  1VCI A;  2UXD Q;  3CCM A;  3MXU A;  4L6T B;  1VQP A;  4DV3 L;  2Q8I B;  2B39 A;  2EY2 A;  3JAM E;  4QJF A;  1N34 L;  1KDA A;  4X62 Q;  4KKU A;  3A0J A;  1TS3 A;  3CRL C;  3ERO A;  2EYF A;  4J8Q A;  1QVF A;  2YU9 H;  5CV4 A;  1BUV T;  2MPM A;  3SDZ A;  1LTS D;  2NN6 I;  1HJP A;  3G4S A;  1SND A;  3PCO B;  1SBB B;  2HQL A;  3MWY W;  2PYK A;  1PV4 A;  4XT3 B;  4K2L A;  2HDL A;  3BVZ A;  1HQM C;  2F4V Q;  2HDM A;  2XGT A;  2B29 A;  1SRU A;  3I91 A;  1CA6 A;  1LO5 D;  3OWF A;  3F2B A;  1O7L A;  2I5H A;  1TII D;  4P73 A;  4GLX A;  1K73 C;  1Q8I A;  2XRS D;  4UP8 A;  3H3V C;  5LMU Q;  1PFN A;  4BBR B;  1IXR A;  1IBK L;  3DM1 A;  4WFN 3;  1EY8 A;  4JV5 Q;  4QB4 A;  4XXE A;  4KI0 A;  1OO9 B;  4FDB A;  4FF2 A;  1BO0 A;  2WB1 G;  3UDX A;  1TWF H;  4N9P A;  1TWA H;  1F2M A;  3TZD A;  4FF3 A;  1PFM A;  1Y8N B;  1Y69 U;  2LSS A;  4CHT B;  1BVS A;  1GHJ A;  5HY6 A;  4GS3 A;  1A2T A;  1V1P B;  2PNR C;  1CZW A;  4ABN A;  2DY7 A;  2JA8 B;  4WRD A;  3DEP A;  3I4M B;  1T9H A;  4DR3 L;  1XNQ Q;  2F3V A;  4GN3 B;  2RA4 A;  4CDF C;  1SE8 A;  3V96 A;  3D8G A;  4YY3 L;  2UXB Q;  1I4H A;  2C5C A;  1JJC B;  3W1G A;  1E1T A;  1ESR A;  5IGB A;  4BBS H;  4DK0 A;  3A7L A;  2HHH Q;  4FO2 A;  5BR8 Q;  4OX9 L;  3KBX A;  1UAP A;  1PH1 A;  3BDC A;  3M3Y B;  1ICF B;  1H9M A;  4O1N A;  4A3I B;  4DKA C;  4JK1 C;  2DNE A;  3BZD B;  4IAL A;  2D62 A;  5C4H A;  4A3E B;  5C0X G;  5CV6 A;  2Y0S G;  4DNI A;  3TEH B;  1LTB D;  3BVM A;  3M7G A;  1CI3 M;  3OIQ A;  4DUZ L;  4RHS A;  4GOP C;  1CKN A;  2EYP A;  1NSN S;  3ND8 A;  2KEN A;  4DGZ A;  1B8A A;  1S5B D;  3GTQ H;  1U4R A;  5C3X A;  5C5L A;  2ICI A;  4JYA Q;  1E0B A;  1AEX A;  3I90 A;  3J7Z C;  5G3L D;  4HIM A;  2M00 A;  3QO2 A;  1Q81 C;  4ZAI A;  1C48 A;  3H15 A;  1BCP D;  4P72 A;  1J9O A;  1YNX A;  3D0F A;  3Q22 A;  1Y1W G;  4JBK A;  4WJ4 A;  3TP7 A;  4A93 H;  2JA6 H;  4C3H B;  3M4Y A;  2B2T C;  3QJY A;  5IT9 E;  1R9T H;  1HZC A;  1EUJ A;  1SRO A;  3LGJ A;  4DV7 L;  2L12 A;  1KXL A;  1LAC A;  4OO1 H;  2B2Y A;  1CQF A;  4JOI A;  1F2Z A;  2C35 B;  1BF4 A;  4YY3 Q;  4L5S A;  1PFB A;  4FP5 D;  4CDC C;  4JV5 L;  1CTM A;  2WFW A;  5KND A;  2MQH A;  4NXM Q;  1K0R A;  2MO1 A;  1EY9 A;  1NUC A;  3K6O A;  4FF1 A;  1E2W A;  1WTQ A;  1PXU A;  3MFY A;  3DEO A;  4Q0F A;  1KNE A;  1WD1 A;  4ID6 A;  2XRQ D;  5DAU A;  1PH5 A;  4AIM A;  4DV2 Q;  1VQ8 A;  2B8G A;  1OTC A;  2Q2H A;  2F3W A;  5IYC H;  3DXJ C;  4KKS A;  1LAB A;  5C44 G;  5H1S E;  3U4Z A;  1F9S A;  3URY A;  5C4Z A;  4KTA A;  1X32 A;  3EFX D;  1PTO C;  3G71 A;  4LFC Q;  1RF2 D;  1YBY A;  3K8A A;  1WYD A;  4DR5 Q;  1Q8K A;  5M9O A;  4JI6 L;  3AMU A;  3KF6 A;  4L63 B;  2OEO A;  1E3P A;  5CR3 A;  5IY0 A;  2KVM A;  4IQZ A;  1SNO A;  5IYB H;  4OEM B;  1PH7 A;  4IPC A;  5FLM H;  1XMQ Q;  1EQV A;  1FNV A;  1TWG B;  2AQ2 B;  4GNX B;  1PHJ A;  3DM3 A;  1GO3 E;  3PSI A;  2EYJ A;  5EBC A;  4DN4 M;  2WAC A;  2ASB A;  1OXT A;  1H95 A;  1Z9F A;  4RWS C;  2CHB D;  4DAV A;  1WTW A;  1KLG D;  3GV6 A;  2M2L A;  1ZXT A;  2PNH A;  5DNF A;  1IBL L;  1PTO F;  5C5M A;  1QVC A;  3C1E A;  4JI8 L;  3M4Q A;  3BJU A;  3I70 A;  1HNW Q;  1LUZ A;  5IOD A;  3RLF A;  1NNX A;  1TWC H;  1A3V A;  2TSS A;  1CSQ A;  2MGS A;  2WB1 B;  1S4Z A;  1IYU A;  2HHH L;  1BOS A;  4B3S Q;  5CMD A;  4XYQ A;  3HOY B;  3AQQ A;  4QL5 A;  5M3M H;  2R61 A;  5FO8 B;  2CFM A;  5M5W H;  4ODG A;  2OTJ A;  2SDF A;  2PQA B;  2QEX A;  5I6W A;  1CHP D;  1KAW A;  2KA7 A;  4HIO A;  5IYD H;  1ENC A;  4DV7 Q;  3VA5 A;  4RGM A;  1L1O B;  1KNA A;  3R2T A;  2K14 A;  4F87 A;  1HNZ L;  1D5Z C;  4ZKC B;  2NTT A;  3TS0 A;  1N32 L;  2KCT A;  3K5O A;  3NE5 B;  1R4Q B;  1A0I A;  2KBN A;  2MFI A;  1B1Z A;  3CPF A;  5J22 A;  4IUR A;  2D2C C;  1STN A;  4C1N K;  3P20 A;  4XYO A;  1VF5 C;  2HIX A;  4P2C B;  1WFQ A;  2F0S A;  5M5W B;  4QF4 A;  4DV5 Q;  3BU2 A;  3K5L A;  3EQL C;  1B3Q A;  3M3Y H;  1AZQ A;  2O5J C;  4LMQ D;  2EYH A;  1V1O A;  4KJN A;  4BBS B;  1FNW A;  2XWJ B;  3ULL A;  1MIU A;  2EDG A;  1Q12 A;  1RTN A;  2QIL A;  2H4O A;  1TWH B;  1ZEQ X;  4X3U A;  1SN8 A;  3AFP A;  1XMQ L;  1RHP A;  4YIJ A;  3CD6 A;  4HSV A;  4X3T A;  2ZM6 Q;  3V2T A;  1PH9 A;  2JN4 A;  1LYL A;  3IFT A;  3IRB A;  5T1I A;  1D1K A;  2XWB B;  4DR5 L;  3HOU B;  2ZXR A;  2NVT B;  1SNC A;  1C4Q A;  4CJ2 C;  3HOW B;  1UEB A;  1TWG H;  5JAV A;  1EY7 A;  1P16 A;  3RN2 A;  3FKI G;  3SK4 A;  1XMO Q;  3F8T A;  1K9M C;  1AE2 A;  3SK6 A;  2O5I C;  2WAQ E;  4O0A A;  2D5D A;  4LK1 C;  4A3L G;  3PGZ A;  2CQA A;  2KHJ A;  5IYC G;  2K50 A;  1FGB D;  3U4V A;  5CBA E;  2VQF L;  3AU7 A;  1E1O A;  4DXF A;  4BBR H;  2XN9 C;  2RCN A;  1I5F A;  1QIL A;  5EGT A;  3Q24 A;  4K2K A;  1TWH H;  2EJF C;  3NP8 A;  1O80 A;  3ERS X;  3T1H Q;  1I4X A;  1S5C D;  4HJ5 A;  4DAY B;  2A68 C;  4R8I A;  2E2H H;  3TS2 A;  4V0B A;  5DLQ E;  3CRK C;  4IUU A;  4NMZ A;  2PCF B;  4XQJ A;  1EWC A;  2HCI A;  2FMM A;  4I7A A;  2JA5 G;  1EZ8 A;  1IHZ A;  3S1M H;  4IUN A;  1B9M A;  2NZH A;  4B3M L;  2R3Z A;  4K5W A;  1BR9 A;  4R4T A;  2VQE Q;  4A3I G;  1JJG A;  1KQS A;  1VQE A;  1NBW A;  3FVQ A;  3L2P A;  4IFD I;  4IPD A;  3S1R H;  4QIW B;  3T53 B;  4UP9 A;  5K36 G;  4NPS A;  1Y1V G;  5LHY 1;  2JK8 A;  5JJL A;  2ZM6 L;  2E74 C;  3N6R A;  2BE5 D;  2BOS A;  3BS1 A;  2B3G A;  2FMC A;  4JI5 Q;  1W6K A;  1YHA A;  5FO9 B;  1VQI A;  1NMF A;  4HJA A;  2PW5 A;  3WOF A;  1K3B C;  3CCR A;  3J7A F;  2K5D A;  3PIP A;  1NJI C;  4DV3 Q;  2ZXP A;  3SK8 A;  3JAM i;  1EU4 A;  4IUV A;  1GUO A;  1LTT D;  2SOB A;  4IPH A;  1PH4 A;  2B2V C;  3I4N G;  2IT1 A;  2Z0S A;  3HKZ B;  4KHZ A;  3IKJ A;  4AYB G;  1EYG A;  5TSS A;  1KIX A;  4MTN A;  2I07 B;  3M85 A;  4ZRZ A;  1PZJ D;  1PYS B;  2AWO A;  4A3I H;  4A3F H;  4GZY C;  1C9O A;  4LF5 Q;  1LTG D;  1LM0 A;  1I4P A;  3K7U C;  2V1C C;  1ENF A;  2JYO A;  4Y52 H;  1HA5 A;  5A35 A;  4HMI A;  1CZG A;  2O2L D;  4HAE A;  1HNZ Q;  2H5X A;  1D2B A;  1F9R A;  1K8G A;  1SLJ A;  1WTH A;  4R4O A;  1N36 Q;  2VB2 X;  1XX8 A;  4ZUI A;  3HG9 A;  1PZI D;  1QUQ A;  5J1Z A;  3RUZ A;  4WJW A;  1CKO A;  1QUQ B;  2OQK A;  3G6J B;  1BXT A;  4PG3 A;  1G91 A;  4A3D H;  2ZTD A;  1VQ4 A;  1GUN A;  2QDB A;  2E2I B;  3FMC A;  5I4D A;  4RHR A;  3RZO H;  4GN4 B;  2X69 A;  5IP7 G;  3H0G G;  1XTC D;  3H3V I;  1MBY A;  1X3E A;  4G7H C;  1FGU A;  2B63 G;  5EQ0 A;  1HFG A;  1XXG A;  1K8A C;  2CVR A;  1YJW A;  5T1G A;  4LUV A;  1I4Q A;  1U5K A;  5ISR A;  3T16 A;  4P71 A;  2Z8L A;  4DV2 L;  1PTO D;  2EYL A;  2RF4 A;  1EEI D;  1E22 A;  1HR0 L;  4DUY Q;  3TP8 A;  4C3I B;  4JI0 Q;  4NXM L;  3DWA A;  2EOT A;  4JI2 L;  1JOQ A;  5FO7 B;  5C4J B;  5M3F G;  1HNX Q;  4KJO A;  2WIN B;  4LFC L;  1NAP A;  1GUG A;  4JI7 L;  1CFM A;  1QZH A;  4GOP A;  3J7A 5;  5JOB A;  5HGQ A;  5M3F B;  1Y1V H;  2K33 A;  3J7Y W;  1CT1 D;  1SNM A;  3DWQ A;  4JI4 L;  5L37 A;  2B2W A;  3RNU A;  1V8Q A;  3J81 E;  2YU9 B;  4UY8 C;  4XIG S;  2QF7 A;  3CC7 A;  5EBD A;  4OON A;  4WOR A;  1T5E A;  1HPC A;  4CJ0 B;  4OO1 G;  1OXS C;  3TDQ A;  3QR8 A;  2JA8 G;  2HCC A;  4Y7N B;  1CA5 A;  4JI8 Q;  3PO2 B;  4TSS A;  1J5E L;  3FHW A;  2OTL A;  1B9N A;  2K01 A;  1YI2 A;  2UUA Q;  1PH6 A;  1G6Z A;  1K0S A;  3E3X A;  1KL9 A;  2LS0 1;  1K83 H;  1QZG A;  1Y1W B;  2B2U C;  5EPL A;  1BBX C;  3A54 A;  1EWI A;  4M1U B;  1H9J A;  4HMJ A;  3VDY A;  4LFB Q;  1FR3 A;  2A6H D;  4JVZ A;  5CV7 A;  1K3R A;  4PQX A;  5FLM G;  3RZD H;  3VR3 A;  1EY6 A;  2GN5 A;  4HN7 A;  5FLX L;  3NUC A;  2IX0 A;  4LF9 L;  3ER0 A;  1TQO A;  2A69 C;  1L1O A;  3M9B A;  5JJI A;  3CKI B;  4A3M H;  3AEV A;  3K80 C;  1Y1V B;  5BR8 L;  2E5L Q;  1V43 A;  1IW7 D;  2F0D A;  1EQT A;  4L8J A;  2I46 A;  4YHH L;  2Z4I A;  3Q0A A;  1GD7 A;  5CV9 A;  1XNR Q;  3EBE A;  3W1B A;  3QWN A;  1A8V A;  3N52 A;  2EPB A;  3I2Z A;  5KNC A;  1YHQ A;  3DHQ A;  4PV1 C;  1BQQ T;  2BE5 C;  1F2L A;  4DV6 Q;  2R7Z B;  1EY0 A;  1SE2 A;  3C2P A;  3NQT A;  1RD9 D;  5D14 A;  5LMN L;  1AFP A;  3FRP B;  4LFA L;  4A3B B;  1FJG Q;  2R7Z H;  2K5V A;  2FIN B;  3VYU A;  2L5T A;  3CCJ A;  2RCF A;  4B3T L;  3DWP A;  1BKB A;  1TR5 A;  1OXU A;  4GNX A;  3QG1 A;  2F0O A;  5LMN Q;  2B8F A;  3MEF A;  1EFI D;  1LTA D;  4JPB W;  1J8I A;  2J0T D;  2HIV A;  2K04 A;  2L11 A;  4FVM A;  3KF6 B;  4K6L A;  1QE6 A;  1GHK A;  1L0X B;  4G57 A;  1DJR D;  2EXD A;  4LF8 L;  3UDI A;  3BG3 A;  2TMP A;  1K8M A;  1ESF A;  3C1F A;  3ERQ A;  1YJ9 A;  2K05 A;  1YHB A;  4DAY A;  3RZD B;  1YIJ A;  4DAM A;  1EZ6 A;  1E24 A;  5C44 B;  3VA7 A;  1EEF D;  2PMZ B;  4LF7 L;  4OXP A;  1B2T A;  4CJ1 B;  1LV9 A;  3CCU A;  4ILW A;  4RFB A;  2IX1 A;  1SYB A;  1JOR A;  3J81 j;  1VMP A;  2IX3 A;  1IKL A;  2PQA A;  2MUY A;  1SMY D;  5C4X B;  2NYZ D;  1AZP A;  3QIA A;  3X3N A;  2RSO A;  3HOX B;  4RA8 A;  1YJN A;  4J1M A;  1E7Z A;  3K0X A;  5GAD C;  1S72 A;  1DYQ A;  2N78 A;  2N3S A;  4BA1 I;  1HZA A;  2OT2 A;  4DR7 Q;  1ROD A;  3BVG A;  4CKC A;  3T4A C;  2HUG A;  1N32 Q;  3E6Z X;  2KOL A;  4XT1 B;  2OXP A;  3KLS X;  3KF8 A;  2M9V A;  1RIP A;  3I4L A;  2Z4H A;  3S2H H;  4PZ8 A;  3DLL A;  1C0A A;  3UDG A;  2VQF Q;  5LL6 S;  2KHI A;  4KHP L;  1ASZ A;  1I3Q B;  3GTO B;  5C4J H;  4B3S L;  2EYM A;  2F0F A;  4J6H A;  5CGK A;  3S1R B;  2WB1 E;  1O78 A;  3TSS A;  5DEH A;  2K6A A;  4RH6 A;  1KC8 C;  4DF7 A;  1X6O A;  1TT2 A;  1D1I A;  2B63 B;  1VQM A;  2L0C A;  1TY0 A;  4G7O C;  1JB7 A;  4XDX A;  1CK1 A;  1MHW C;  1TS5 A;  1V9P A;  2BDO A;  5CBE E;  4NKL A;  3A55 A;  3M4P A;  4DR3 Q;  1Q82 C;  1UE1 A;  4X66 Q;  1LLR D;  1TS2 A;  5LMU L;  2F0G A;  3OTO L;  1HR0 Q;  2FFK B;  1Z47 A;  2Z9H A;  3S1Q H;  1HA6 A;  2VS1 A;  3VR4 A;  5M5X H;  1D6E C;  3GTG B;  5IYB G;  3GD7 A;  3UE1 A;  1DZ1 A;  1WVL A;  3CAM A;  3NWS A;  3SK5 A;  4JI3 L;  4P75 A;  4H02 A;  1XNR L;  3HOV G;  3PMF A;  1WCM B;  1FL0 A;  3F2U A;  5ELD A;  3TP5 A;  4A3D B;  1XWE A;  3KJP A;  3RLO A;  1MJE A;  1BCP F;  3I4N H;  1VQB A;  2C9O A;  2I5L X;  1MKH A;  1RJT A;  2RBM A;  2RDG A;  3IAY A;  2AUK A;  4LF7 Q;  4NW2 A;  4DV0 L;  5A2Q E;  2E2J H;  5GRO A;  2JE6 I;  2A68 D;  1BDO A;  3GDE A;  4UHV A;  4OEL B;  3C46 A;  1O7I A;  3HOW H;  2DN8 A;  1HTP A;  2NVT H;  4C56 C;  1YNN D;  2H1E A;  2K5H A;  1N8R C;  2F4V L;  2CWP A;  2I5M X;  4DA2 A;  4X66 L;  4A3F B;  4A3G B;  2JA9 A;  3HRZ C;  2QGQ A;  1G2S A;  2R92 B;  2LKV A;  1SSO A;  4K8J A;  3L9A X;  1DOK A;  2JEA I;  1JCK B;  3SXH A;  2EE1 A;  1X9N A;  5JPN C;  1HH2 P;  1SE4 A;  4DR4 L;  2PO4 A;  4K5X A;  2G9D A;  2N8N A;  3HFZ B;  4FXG C;  5JEA J;  1SE3 A;  1TY2 A;  3R2I A;  3L0O A;  2QEJ C;  3PQI A;  5I9O A;  4DR4 Q;  5EPJ A;  5E3F A;  1DON A;  1K8O A;  3PO3 B;  2ZTC A;  4LNQ A;  2JA7 G;  3F1Z A;  5AJ3 L;  4H13 C;  3OSO A;  1ET6 A;  1EQR A;  2BCO A;  4X6A H;  3KF8 B;  4IUP A;  4JI7 Q;  3FPU B;  3W5O A;  5JJZ A;  1HQR D;  3LWU A;  2K03 A;  5IE8 A;  1XTD A;  2ZTE A;  2RQX A;  2PZT A;  3ND9 A;  3OWE B;  1VS0 A;  4DR7 L;  4YCU A;  2EJG C;  4QQB X;  2CQO A;  2DUD A;  2KQ3 A;  3Q8D A;  1AP0 A;  4OGQ C;  4HJ8 A;  4A3C G;  1ZKO A;  3PUW A;  4ME5 A;  2WAQ G;  4CGY B;  3STB D;  4A3B G;  1PYB A;  3OMC A;  2E2H B;  5COR A;  2YTX A;  5HGT A;  1HCZ A;  4X65 L;  3BYY B;  4LF8 Q;  2QKI C;  2XVS A;  3CC4 A;  4JI5 L;  2K7V A;  4KN4 C;  1STE A;  5KYL A;  2Z6B A;  2R92 H;  1V1Q A;  3KJO A;  4AYB B;  4QUF A;  3TZU A;  1FJG L;  2IPK D;  2AMC B;  1IW7 C;  1QOH A;  4LF6 L;  3H0G H;  4FYD A;  2CW0 C;  1RDP D;  4ULL A;  4NP5 A;  1GUT A;  3A74 A;  3GV3 A;  3R3O A;  4G7Z C;  3GTP H;  4L5Q A;  1MGS A;  2X6G A;  1KAB A;  3BDO A;  4A3L H;  3SHL A;  2Z6K A;  2UUB L;  2E75 C;  3I8Z A;  3U9O A;  3D4R A;  3EJI A;  4KY6 A;  1PTO B;  4Q5V A;  1UE5 A;  5I2X A;  1RCV D;  3CCS A;  5GAH C;  5JEA H;  3TQY A;  5IOC A;  3QB3 A;  3U9S A;  1A3T A;  2UUB Q;  1UE6 A;  1B70 B;  1WCM H;  4DK6 C;  1GJX A;  3T13 A;  4OIJ A;  1QB5 D;  4KKT A;  1UE7 A;  5JEA G;  3VYS A;  2Z6K C;  3NXW A;  4Z9C B;  1WTO A;  5FLX E;  1AN8 A;  2N55 A;  4L5T A;  2ALY B;  4IUQ A;  1STY A;  3FPP A;  5E7N A;  4LAA A;  4FF4 A;  5LL6 X;  4HSP A;  4ME3 A;  5JVG 3;  3KBG A;  1NR2 A;  2VNU D;  2E8G A;  2K75 A;  1JWM D;  4A3J B;  4N8F A;  3PUX A;  4IN3 A;  1E2V A;  1VQC A;  4HED A;  3CCL A;  2JA6 G;  2DNC A;  1NTG A;  4O2D A;  2I0Q A;  4BXX H;  3STB C;  4A3J G;  2JA6 B;  2EYO A;  4ZCK A;  3HOY G;  4F88 A;  3PIO 3;  4AQY L;  3CMA A;  4HIK A;  2AKW B;  3B6Y A;  3K5M A;  3T51 B;  4CBV A;  4FNF A;  1J5E Q;  2E5L L;  1JMC A;  4TRD A;  1JQY D;  2UXD L;  4V19 0;  4QGU A;  4CKE A;  1IYJ B;  4C3I G;  5M3M B;  4DR2 L;  4A3C H;  3HOY H;  1TVX A;  1K28 A;  3HOX G;  5AJ3 Q;  1SFO H;  4A3F G;  3NBI A;  5EPK A;  1PRT F;  5KRU A;  4DR1 Q;  1S3O A;  1H9S A;  1VQ6 A;  4DK1 A;  3HOX H;  1SDF A;  4C1N I;  3TRE A;  3D4D A;  4BBS G;  2A19 A;  1DOM A;  1M4V A;  2KHS A;  4U68 A;  5ELO A;  4ALP A;  2BH2 A;  4JG2 A;  3PO3 G;  2V4D A;  3AFQ A;  5EAY A;  2A8V A;  4G4K A;  2EXZ A;  3CCV A;  3MXN A;  4IFD G;  1B7Y B;  2WV6 D;  1UUP A;  5IWA L;  3CU7 A;  2R7Z G;  2D9U A;  5K5P A;  3QOL A;  3EA6 A;  1D5M C;  1A63 A;  2JXM B;  4DK3 C;  4DUY L;  3I4M H;  4MTK A;  2FXQ A;  2L15 A;  1HZ9 A;  2P5Z X;  4PMB A;  2VUM B;  1XPR A;  1VQK A;  1VF7 A;  2JP1 A;  1TXY A;  3HS0 C;  1Y8P B;  3JAM L;  1U9R A;  3OHX C;  3D6W A;  1E2Z A;  3H09 A;  1TWA B;  4JI0 L;  3OMG A;  2EVB A;  1T5X D;  1ET9 A;  3MC0 B;  4JI3 Q;  4DAP A;  3S9W A;  2A73 B;  4ZK9 B;  3CXC A;  5IGF A;  1STB A;  3K58 A;  1FNU A;  3HKS A;  4B3R L;  4A3B H;  1U0L A;  4A3D G;  3AYH B;  5F2D A;  1SNP A;  4X64 Q;  5FK9 C;  4A76 A;  3S14 H;  2R93 G;  3FKI H;  2A69 D;  4K14 A;  5EKK A;  3ONA B;  3VYR A;  4DR1 L;  4POG A;  3PO2 G;  1KLU D;  1VMC A;  2YTV A;  3CW2 C;  2WP8 J;  1WTX A;  2LXK A;  2IJ0 A;  1WOC A;  3W3A A;  4K6D A;  4JCV E;  2AWN A;  3HKZ E;  4A3M B;  1VQH A;  4GKK L;  5IGG A;  5FLX c;  2OQ0 A;  3NTI A;  1B50 A;  1GUS A;  3SE0 A;  3S1N B;  3NPP A;  4UP7 A;  4JI4 Q;  3E9I A;  5M5Y H;  5KEE A;  4A3M G;  4CDE C;  3HOZ H;  1C7Y A;  4PMC A;  1U4L A;  4XQQ A;  5D3D A;  2F03 A;  2K52 A;  4F8M A;  1VQL A;  4LF4 L;  1F2Y A;  1S5F D;  2O4X A;  4C2M H;  4TKO B;  2PI2 A;  4K0K L;  3A5Z B;  3MAQ A;  2JJQ A;  4KV6 A;  1F9P A;  2NBF A;  1H9K A;  3IL8 A;  3ZYY X;  3IFD A;  1IBL Q;  3O13 A;  2VQE L;  3S17 B;  3JC6 6;  4PZ6 A;  3A8K E;  1U4P A;  3K57 A;  4Y7N H;  1X65 A;  2Y0S E;  3MZ5 A;  4QY7 A;  2PI2 E;  4BY7 H;  3X3M A;  2Q8R E;  1PYW D;  1I94 L;  2KJX A;  1JB3 A;  2YYZ A;  2UXC L;  1ZYR C;  2KCM A;  2L55 A;  3ULP A;  4EGV A;  4EVO A;  3Q23 A;  1TWC B;  1IBM Q;  4YWM A;  4OIK A;  3HOZ B;  5M5Y B;  4C3H G;  4JI2 Q;  3S1N H;  1BBU A;  5EKI A;  4R4C A;  1MD2 D;  1XPO A;  1PLF A;  1CKM A;  3GTJ B;  3T1Y L;  4A3G H;  2J4X A;  4K0K Q;  1X55 A;  4R8N A;  2RKS A;  1Q3L A;  4BY1 B;  1JWU D;  1SYC A;  2L1B A;  2RHQ B;  2JA8 H;  3HOZ G;  3K0Y A;  3NEL A;  1I50 B;  1GKH A;  3HOV H;  5M3M G;  4DV4 L;  4POF A;  4BY1 G;  3ZJY C;  2LFN A;  2QCP X;  4C3I H;  1SJE D;  2F3I A;  1TWF B;  3GQB A;  5HUR A;  3NQI A;  5I2Y A;  1QNU A;  2YTY A;  4DV1 L;  2VL6 A;  4B08 A;  3S14 B;  4IUT A;  4IJH A;  4I65 A;  4IJL A;  3UDF A;  4NB3 A;  4E6I A;  2NN6 H;  5C6A A;  1BCP C;  2SEB D;  4DFA A;  4EQP A;  4GOP B;  2R93 H;  1PDQ A;  3A7A B;  3MFG A;  3T1H L;  1CSP A;  1ILP A;  2D0P A;  3RZO B;  5IGE A;  3S1Q B;  1N36 L;  5JJK A;  4LF6 Q;  1QNK A;  2E2I H;  1HRJ A;  1DD2 A;  5C4X G;  2NTS A;  3MTS A;  4NXN L;  3NHH A;  2VUM H;  4PZ7 A;  1GM5 A;  2A6E C;  1EWH A;  2XSC A;  3CCQ A;  2BH8 A;  3I4O A; 
#chains in the Genus database with same CATH homology
 2XIW A;  4R9W A;  1EY5 A;  1XYI A;  4KD3 A;  3TP6 A;  2K28 A;  1G8Z D;  3C3L A;  5FOB B;  1HHV A;  5BN4 A;  1R9T B;  1S5D D;  3HOV B;  1EIG A;  5C0X J;  1JIC A;  2F0K A;  2F0I A;  4UDU C;  2OF1 A;  2FHT A;  4CKB A;  1B44 D;  3GTK B;  2PZW A;  2KUM A;  3EVQ A;  4FXK C;  3OOC A;  3PUV A;  3G7L A;  2Y0S B;  4FXD A;  5AFW A;  4BY7 B;  2EJM A;  2EY1 A;  5C3E B;  1A2U A;  3RMH A;  3GTM B;  4PMW A;  1ILQ A;  2L9H A;  3FDT A;  3E5S A;  3LWE A;  1F9Q A;  4C2M B;  1SYD A;  3D6C A;  4U67 3;  5CV8 A;  1EU3 A;  4NDX A;  2PPB C;  1DCZ A;  5JPM C;  3GTL B;  3OPO A;  5JVH 3;  4H7B A;  1TU2 B;  3I72 A;  1UNS A;  3S1M B;  1EL0 A;  4BWG B;  4RKB A;  2F0Q A;  3PUZ A;  5K36 H;  2WAQ B;  1H9R A;  4B9W A;  3D4W A;  1ML0 D;  1DM0 B;  3QOJ A;  2ZXO A;  4RAU C;  4KN7 C;  4K5V A;  1JWS D;  1EYA A;  3K5N A;  3HP3 A;  3FKI B;  3MXG A;  1KDB A;  1MSG A;  1SNQ A;  1D5X C;  1X3Q A;  5I9P A;  3GTP B;  3TME A;  2GA4 B;  3MVV A;  1MI2 A;  2LMC B;  2AQ3 B;  3KK7 A;  5G3L F;  1A3U A;  5E4W C;  4KK7 A;  4HCE A;  5KIX A;  5KYI A;  2F0U A;  3L7Z C;  4B9X A;  3J80 L;  1B3A A;  2EZV A;  3L3O C;  3BDL A;  1K83 B;  3DUZ A;  2BA0 A;  1A6X A;  2E76 C;  2SNM A;  4JBW A;  3GP7 A;  4ZKB B;  1ENA A;  1LTR D;  3DMU A;  1O7Z A;  1HTL D;  3P75 A;  1S5E D;  2G9H D;  2MJ8 A;  4RGO S;  4KY5 A;  1Z7T A;  3R93 A;  2CW0 D;  2F0W A;  1GUW A;  2NZ1 D;  2F0L A;  1JOO A;  1WD0 A;  1EYC A;  2NVY B;  2F0T A;  4HR7 B;  2IWH A;  5C0X H;  4RCO A;  1LT6 D;  2R6G A;  3W2D A;  3VYT A;  4HTH A;  3PV0 A;  5KNB A;  3PUY A;  4RGN A;  3GO5 A;  1O7Y A;  4BS9 A;  1BCP B;  4DNT B;  1HUM A;  3NBH A;  2AUJ D;  4IFD J;  1QCB D;  3D31 A;  5C0X I;  2KCC A;  2NB0 A;  3KLR A;  4A3K B;  3S15 B;  1QWY A;  4EQN A;  5KGU A;  2EY6 A;  3NTK A;  3H94 A;  4XQN A;  1STH A;  1IL8 A;  3BYT B;  1PRT D;  3MA2 B;  4MHE A;  2K5Q A;  4ZLT F;  5FKA C;  4KHV A;  4I7Z C;  3KLS A;  4QCL A;  1Q90 A;  1KTK A;  4LJZ C;  1U4M A;  1QJO A;  1WTP A;  2BA1 A;  1CQV A;  2F1M A;  3OIP A;  2PQE A;  2K32 A;  3SEB A;  3VR5 A;  1ZYR D;  2A6E D;  3WOE A;  1JOK A;  1I4G A;  1I4R A;  1LTI D;  1M8A A;  2VXW A;  1PRT C;  5J39 A;  2JA5 B;  4OO1 I;  3TN2 A;  4N9T A;  3M7N A;  3H91 A;  2JEB I;  3LNN A;  4DU9 A;  1W6J A;  3E0J A;  1QG7 A;  2B2V A;  1SFO B;  1SXT A;  3A56 A;  1EOT A;  4DNR B;  5I6Y A;  1ICW A;  3HZX A;  3OW7 A;  5COY A;  3NWT A;  2F0H A;  1GOZ A;  4KD4 A;  2IL8 A;  1CM9 A;  1WTV A;  5NUC A;  5ELC A;  2ID0 A;  2RDH A;  1LT3 D;  3K59 A;  1TKW B;  4H44 C;  3J81 L;  3R8B A;  2MHV A;  1G29 1;  3PIP 3;  2KEC A;  3I73 A;  4QMG A;  3RD4 A;  1YNJ D;  2KEE A;  2N88 A;  2F0M A;  1UEA B;  3A8J E;  1R4P B;  1RTO A;  3CQZ B;  1NR4 A;  1TS4 A;  1JE4 A;  3NK9 A;  1AW7 A;  1YNJ C;  2VB3 X;  1PTO H;  1H9S B;  1A15 A;  2J7Z A;  2AQ1 B;  3HEJ A;  5D65 A;  1SAP A;  2WII B;  4C3J B;  2E2J B;  1BNZ A;  4OL7 A;  1F77 A;  3H0G B;  2F0N A;  2A5H A;  2KCN A;  2B2W C;  4C3J G;  4OHJ A;  1Q1E A;  3NSW A;  3SVM A;  3M4O B;  1L0Y B;  2HQE A;  4ZYS A;  4O42 A;  4HCS A;  2NVX B;  4ZQ3 A;  1KDC A;  5IGC A;  1HFN A;  2RSN A;  4DXG A;  4X3S A;  1HXY D;  1STA A;  1SJH D;  4M8A A;  4RGT A;  1KAA A;  5IT9 L;  2ZT9 C;  1LT5 D;  2X6L A;  5ELB A;  5BN5 A;  4K8I A;  1PRT B;  4ZUJ A;  5DM7 3;  1NCV A;  1STG A;  2DY8 A;  3S2D B;  4XTC S;  1Q1B A;  2LY7 A;  1SEB D;  5CC4 A;  3LX0 A;  3D3R A;  2F0J A;  2ICE C;  5IGD A;  5DM6 3;  2Z1C A;  3S2H B;  4QUC A;  2RDF A;  4X3K A;  4F7X A;  1I6H B;  3SR1 A;  3MXP A;  1SMY C;  2MP1 A;  2A6H C;  1OXX K;  1Y8O B;  3K7A B;  1EIH A;  5E4X A;  2ENB A;  2FJ2 A;  1X3P A;  2PZU A;  1Z6H A;  3CHB D;  1WTR A;  1EY4 A;  1LT4 D;  3J80 E;  5BN3 A;  4TQU S;  2PW7 A;  2WKC A;  5ELE A;  3VR2 A;  1B53 A;  4RCN A;  5E1F A;  3I3C A;  5ELF A;  4PNY A;  2L4N A;  4UAI A;  2B2T A;  3VR6 A;  3P7J A;  1SYG A;  4IFD H;  3A8I E;  5C3W A;  1HUN A;  3MHB A;  2NN6 G;  2B2Y C;  2F0P A;  3T56 B;  5D3I B;  3I4N B;  3V05 A;  3H6M A;  2IW3 A;  2BDN A;  2JSO A;  1JR0 D;  3UI2 A;  3HGB A;  4S3S A;  3ITP A;  2RVL A;  3MEH A;  2NVQ B;  1ONL A;  3NTH A;  1IKM A;  2A74 C;  4IZ8 A;  5M5X B;  2NUC A;  3TBI B;  2R93 B;  2Q8T A;  1PMR A;  2XNA C;  3KUP A;  1SYE A;  3P1H A;  2WKD A;  2F4I A;  1OXV A;  3FEW X;  4MIU A;  4MN3 A;  4KMU C;  1DXM A;  4KY7 A;  3S16 B;  1IYV A;  3Q6S A;  5EJW A;  2KED A;  2NWG A;  5CV5 A;  1DOL A;  1B4O A;  1II3 A;  2K1B A;  1G2T A;  1GXD C;  1RKN A;  4A93 B;  3AB9 A;  1YNN C;  3WDN A;  1I6V C;  5CYU A;  1SYF A;  2B2U A;  2F0V A;  1JC7 A;  5A2Q L;  2SNS A;  5IIF A;  2F0E A;  2JA7 B;  1VDZ A;  4BA2 I;  2K5W A;  3GTQ B;  1EYD A;  1CHQ D;  2EY5 A;  1C8C A;  1FD7 D;  1MSH A;  5EKL A;  1FYC A;  4H0L C;  4EQO A;  1PZK D;  1V1P A;  2E2D C;  4RKL A;  3J7A V;  1VCI A;  3MXU A;  4L6T B;  2Q8I B;  2B39 A;  2EY2 A;  3JAM E;  1KDA A;  4KKU A;  1TS3 A;  3CRL C;  3ERO A;  2EYF A;  4J8Q A;  5CV4 A;  1BUV T;  2MPM A;  3SDZ A;  1LTS D;  2NN6 I;  1SND A;  1SBB B;  3MWY W;  2PYK A;  4XT3 B;  4K2L A;  2HDL A;  3BVZ A;  1HQM C;  2HDM A;  3I91 A;  1CA6 A;  1LO5 D;  3OWF A;  1O7L A;  1TII D;  1Q8I A;  2XRS D;  3H3V C;  1PFN A;  4BBR B;  3DM1 A;  4WFN 3;  1EY8 A;  4QB4 A;  4XXE A;  4KI0 A;  1OO9 B;  4FF2 A;  1BO0 A;  4N9P A;  1F2M A;  3TZD A;  4FF3 A;  1PFM A;  1Y8N B;  1Y69 U;  4CHT B;  1GHJ A;  1A2T A;  1V1P B;  2PNR C;  1CZW A;  4ABN A;  2DY7 A;  2JA8 B;  4WRD A;  3DEP A;  3I4M B;  2F3V A;  2RA4 A;  3V96 A;  3D8G A;  1I4H A;  2C5C A;  1ESR A;  5IGB A;  4DK0 A;  3A7L A;  4FO2 A;  3KBX A;  1UAP A;  3BDC A;  3M3Y B;  1H9M A;  4O1N A;  4A3I B;  4JK1 C;  2DNE A;  3BZD B;  4IAL A;  2D62 A;  5C4H A;  4A3E B;  5C0X G;  5CV6 A;  1LTB D;  3BVM A;  3M7G A;  1CI3 M;  3OIQ A;  4RHS A;  2EYP A;  1NSN S;  3ND8 A;  4DGZ A;  1S5B D;  1U4R A;  5C3X A;  5C5L A;  2ICI A;  1E0B A;  1AEX A;  3I90 A;  5G3L D;  2M00 A;  3QO2 A;  4ZAI A;  1C48 A;  1BCP D;  1J9O A;  3Q22 A;  3TP7 A;  4C3H B;  3M4Y A;  2B2T C;  3QJY A;  5IT9 E;  2L12 A;  1LAC A;  4OO1 H;  2B2Y A;  1CQF A;  1F2Z A;  1BF4 A;  1PFB A;  4FP5 D;  1CTM A;  5KND A;  1EY9 A;  1NUC A;  3K6O A;  4FF1 A;  1E2W A;  1WTQ A;  1PXU A;  3MFY A;  3DEO A;  4Q0F A;  1KNE A;  1WD1 A;  4ID6 A;  2XRQ D;  5DAU A;  2B8G A;  2F3W A;  3DXJ C;  4KKS A;  1LAB A;  1F9S A;  3URY A;  5C4Z A;  4KTA A;  1X32 A;  3EFX D;  1PTO C;  1RF2 D;  5M9O A;  3AMU A;  4L63 B;  2OEO A;  5CR3 A;  2KVM A;  4IQZ A;  1SNO A;  1EQV A;  1FNV A;  1TWG B;  2AQ2 B;  2EYJ A;  5EBC A;  4DN4 M;  2WAC A;  1OXT A;  4RWS C;  2CHB D;  1WTW A;  4DAV A;  1KLG D;  3GV6 A;  2M2L A;  1ZXT A;  5DNF A;  1PTO F;  5C5M A;  3C1E A;  3I70 A;  5IOD A;  3RLF A;  1A3V A;  2TSS A;  2MGS A;  2WB1 B;  1S4Z A;  1IYU A;  1BOS A;  5CMD A;  4XYQ A;  3HOY B;  2R61 A;  5FO8 B;  4ODG A;  2SDF A;  5I6W A;  1CHP D;  2KA7 A;  1ENC A;  3VA5 A;  4RGM A;  1KNA A;  3R2T A;  4F87 A;  1D5Z C;  4ZKC B;  2NTT A;  3K5O A;  3NE5 B;  1R4Q B;  1B1Z A;  5J22 A;  4IUR A;  2D2C C;  1STN A;  4C1N K;  3P20 A;  4XYO A;  1VF5 C;  4P2C B;  2F0S A;  5M5W B;  4QF4 A;  3K5L A;  3EQL C;  1AZQ A;  2O5J C;  4LMQ D;  2EYH A;  1V1O A;  4KJN A;  4BBS B;  1FNW A;  2XWJ B;  2EDG A;  1Q12 A;  1RTN A;  2QIL A;  2H4O A;  1TWH B;  1ZEQ X;  4X3U A;  1RHP A;  4YIJ A;  4HSV A;  4X3T A;  3V2T A;  3IFT A;  5T1I A;  1D1K A;  2XWB B;  3HOU B;  2ZXR A;  2NVT B;  1SNC A;  1C4Q A;  4CJ2 C;  3HOW B;  5JAV A;  1EY7 A;  3SK4 A;  3SK6 A;  2O5I C;  2D5D A;  4LK1 C;  2CQA A;  1FGB D;  5CBA E;  3AU7 A;  4DXF A;  2XN9 C;  1QIL A;  5EGT A;  3Q24 A;  4K2K A;  2EJF C;  3NP8 A;  1O80 A;  1I4X A;  1S5C D;  4R8I A;  2A68 C;  4V0B A;  3CRK C;  4IUU A;  4NMZ A;  2PCF B;  4XQJ A;  1EWC A;  2HCI A;  2FMM A;  1EZ8 A;  1IHZ A;  4IUN A;  1B9M A;  2R3Z A;  4K5W A;  1BR9 A;  3FVQ A;  4IFD I;  4QIW B;  3T53 B;  5K36 G;  5LHY 1;  2E74 C;  3N6R A;  2BE5 D;  2BOS A;  3BS1 A;  2FMC A;  1W6K A;  5FO9 B;  2PW5 A;  3WOF A;  3J7A F;  2K5D A;  2ZXP A;  3SK8 A;  1EU4 A;  4IUV A;  1GUO A;  1LTT D;  2SOB A;  2B2V C;  2IT1 A;  3HKZ B;  4KHZ A;  3IKJ A;  5TSS A;  2I07 B;  3M85 A;  4ZRZ A;  1PZJ D;  2AWO A;  4GZY C;  1LTG D;  1I4P A;  1ENF A;  2JYO A;  1HA5 A;  5A35 A;  4HMI A;  1CZG A;  2O2L D;  4HAE A;  1D2B A;  1F9R A;  2VB2 X;  1XX8 A;  4ZUI A;  3HG9 A;  1PZI D;  5J1Z A;  3RUZ A;  4WJW A;  3G6J B;  1BXT A;  1G91 A;  1GUN A;  2QDB A;  2E2I B;  3FMC A;  5I4D A;  4RHR A;  2X69 A;  1XTC D;  1MBY A;  4G7H C;  5EQ0 A;  1HFG A;  1XXG A;  2CVR A;  5T1G A;  1I4Q A;  5ISR A;  3T16 A;  2Z8L A;  1PTO D;  2EYL A;  1EEI D;  3TP8 A;  4C3I B;  3DWA A;  2EOT A;  1JOQ A;  5FO7 B;  5C4J B;  4KJO A;  2WIN B;  1NAP A;  1GUG A;  1CFM A;  5JOB A;  5M3F B;  2K33 A;  3J7Y W;  1CT1 D;  1SNM A;  3DWQ A;  2B2W A;  1V8Q A;  3J81 E;  2YU9 B;  4XIG S;  2QF7 A;  5EBD A;  4WOR A;  1T5E A;  1HPC A;  4CJ0 B;  4OO1 G;  1OXS C;  3TDQ A;  2HCC A;  4Y7N B;  1CA5 A;  3PO2 B;  4TSS A;  1B9N A;  2K01 A;  1G6Z A;  2LS0 1;  1Y1W B;  2B2U C;  1BBX C;  5EPL A;  3A54 A;  4M1U B;  1H9J A;  4HMJ A;  1FR3 A;  2A6H D;  5CV7 A;  4PQX A;  3VR3 A;  1EY6 A;  4HN7 A;  5FLX L;  3NUC A;  2IX0 A;  1TQO A;  2A69 C;  3CKI B;  1Y1V B;  1V43 A;  1IW7 D;  2F0D A;  1EQT A;  4L8J A;  2I46 A;  2Z4I A;  3Q0A A;  5CV9 A;  3QWN A;  3N52 A;  2EPB A;  5KNC A;  3DHQ A;  4PV1 C;  1BQQ T;  2BE5 C;  1F2L A;  2R7Z B;  1EY0 A;  1SE2 A;  3C2P A;  3NQT A;  1RD9 D;  5D14 A;  1AFP A;  3FRP B;  4A3B B;  3VYU A;  2FIN B;  2L5T A;  3DWP A;  1TR5 A;  1OXU A;  3QG1 A;  2F0O A;  2B8F A;  1EFI D;  1LTA D;  1J8I A;  2J0T D;  2K04 A;  2L11 A;  4FVM A;  4K6L A;  1QE6 A;  1GHK A;  1L0X B;  4G57 A;  1DJR D;  2TMP A;  1K8M A;  3BG3 A;  1ESF A;  3C1F A;  3ERQ A;  2K05 A;  4DAY A;  3RZD B;  1EZ6 A;  5C44 B;  3VA7 A;  1EEF D;  2PMZ B;  1B2T A;  4CJ1 B;  1LV9 A;  2IX1 A;  4ILW A;  4RFB A;  1SYB A;  1JOR A;  1VMP A;  2IX3 A;  1IKL A;  2MUY A;  1SMY D;  5C4X B;  2NYZ D;  1AZP A;  3QIA A;  3X3N A;  2RSO A;  3HOX B;  4RA8 A;  4J1M A;  1DYQ A;  4BA1 I;  2OT2 A;  1ROD A;  3BVG A;  4CKC A;  3T4A C;  2HUG A;  3E6Z X;  2KOL A;  4XT1 B;  2OXP A;  3KLS X;  3KF8 A;  2M9V A;  3I4L A;  2Z4H A;  5LL6 S;  1I3Q B;  3GTO B;  2EYM A;  2F0F A;  4J6H A;  5CGK A;  3S1R B;  1O78 A;  3TSS A;  5DEH A;  2K6A A;  4RH6 A;  4DF7 A;  1TT2 A;  1D1I A;  2B63 B;  2L0C A;  1TY0 A;  4G7O C;  4XDX A;  1CK1 A;  1TS5 A;  2BDO A;  5CBE E;  4NKL A;  3A55 A;  1LLR D;  1TS2 A;  2F0G A;  2FFK B;  1Z47 A;  1HA6 A;  3VR4 A;  1D6E C;  3GTG B;  3GD7 A;  1DZ1 A;  1WVL A;  3NWS A;  3SK5 A;  3PMF A;  1WCM B;  3F2U A;  5ELD A;  3TP5 A;  4A3D B;  1XWE A;  1BCP F;  2RBM A;  2C9O A;  2RDG A;  1RJT A;  3IAY A;  2AUK A;  4NW2 A;  5A2Q E;  2JE6 I;  2A68 D;  1BDO A;  3C46 A;  2DN8 A;  1HTP A;  4C56 C;  1YNN D;  2H1E A;  4DA2 A;  4A3F B;  4A3G B;  3HRZ C;  1G2S A;  2R92 B;  2LKV A;  1SSO A;  4K8J A;  3L9A X;  1DOK A;  2JEA I;  1JCK B;  3SXH A;  2EE1 A;  5JPN C;  1SE4 A;  2PO4 A;  4K5X A;  2G9D A;  4FXG C;  5JEA J;  1SE3 A;  1TY2 A;  3R2I A;  2QEJ C;  5I9O A;  5EPJ A;  5E3F A;  1DON A;  1K8O A;  3PO3 B;  4H13 C;  3OSO A;  1ET6 A;  2BCO A;  4IUP A;  3FPU B;  5JJZ A;  1HQR D;  3LWU A;  2K03 A;  2RQX A;  2PZT A;  3ND9 A;  3OWE B;  2EJG C;  2KQ3 A;  1AP0 A;  4OGQ C;  1ZKO A;  3PUW A;  4ME5 A;  4CGY B;  3OMC A;  2E2H B;  5COR A;  5HGT A;  1HCZ A;  3BYY B;  2QKI C;  2XVS A;  2K7V A;  4KN4 C;  1STE A;  5KYL A;  4AYB B;  4QUF A;  3TZU A;  2IPK D;  1IW7 C;  1QOH A;  4FYD A;  2CW0 C;  1RDP D;  4ULL A;  4NP5 A;  1GUT A;  3GV3 A;  3R3O A;  4G7Z C;  1MGS A;  2X6G A;  1KAB A;  3BDO A;  3SHL A;  2E75 C;  3I8Z A;  3U9O A;  3D4R A;  3EJI A;  4KY6 A;  1PTO B;  4Q5V A;  5I2X A;  1RCV D;  5JEA H;  5IOC A;  3QB3 A;  3U9S A;  1A3T A;  1GJX A;  3T13 A;  4OIJ A;  1QB5 D;  4KKT A;  5JEA G;  3VYS A;  3NXW A;  4Z9C B;  1WTO A;  5FLX E;  1AN8 A;  2N55 A;  3FPP A;  4IUQ A;  1STY A;  4FF4 A;  4LAA A;  5LL6 X;  4HSP A;  5JVG 3;  3KBG A;  1NR2 A;  2VNU D;  1JWM D;  4A3J B;  3PUX A;  4IN3 A;  1E2V A;  4HED A;  2DNC A;  2JA6 B;  2EYO A;  4F88 A;  3PIO 3;  3K5M A;  3T51 B;  4CBV A;  4FNF A;  4TRD A;  1JQY D;  4V19 0;  4CKE A;  4C3I G;  5M3M B;  1TVX A;  3NBI A;  5EPK A;  1PRT F;  5KRU A;  1H9S A;  4DK1 A;  1SDF A;  4C1N I;  3D4D A;  1DOM A;  1M4V A;  2KHS A;  4U68 A;  2V4D A;  4G4K A;  2EXZ A;  3MXN A;  4IFD G;  2WV6 D;  1UUP A;  3CU7 A;  2D9U A;  5K5P A;  3EA6 A;  3QOL A;  1D5M C;  2JXM B;  4PMB A;  2VUM B;  1VF7 A;  2JP1 A;  3HS0 C;  1Y8P B;  3JAM L;  1U9R A;  3OHX C;  3D6W A;  1E2Z A;  3H09 A;  1TWA B;  3OMG A;  2EVB A;  1T5X D;  1ET9 A;  3MC0 B;  4DAP A;  3S9W A;  2A73 B;  4ZK9 B;  5IGF A;  1STB A;  3K58 A;  1FNU A;  5F2D A;  1SNP A;  5FK9 C;  2A69 D;  4K14 A;  5EKK A;  3ONA B;  3VYR A;  1KLU D;  1VMC A;  2WP8 J;  1WTX A;  2IJ0 A;  3W3A A;  4K6D A;  2AWN A;  4A3M B;  5IGG A;  3NTI A;  1B50 A;  1GUS A;  3SE0 A;  3S1N B;  3NPP A;  5KEE A;  4PMC A;  1U4L A;  4XQQ A;  5D3D A;  2F03 A;  4F8M A;  1F2Y A;  1S5F D;  2O4X A;  4TKO B;  3MAQ A;  4KV6 A;  1F9P A;  2NBF A;  1H9K A;  3IL8 A;  3ZYY X;  3IFD A;  3O13 A;  3S17 B;  3A8K E;  1U4P A;  3K57 A;  3MZ5 A;  3X3M A;  2Q8R E;  1PYW D;  2KJX A;  1JB3 A;  2YYZ A;  1ZYR C;  2L55 A;  4EGV A;  4EVO A;  3Q23 A;  1TWC B;  4OIK A;  3HOZ B;  5M5Y B;  4C3H G;  5EKI A;  1MD2 D;  1PLF A;  3GTJ B;  2J4X A;  4R8N A;  2RKS A;  1Q3L A;  4BY1 B;  1JWU D;  1SYC A;  2L1B A;  3K0Y A;  1I50 B;  2LFN A;  2QCP X;  1SJE D;  1TWF B;  3GQB A;  5HUR A;  3NQI A;  5I2Y A;  1QNU A;  4B08 A;  3S14 B;  4IUT A;  4I65 A;  4E6I A;  2NN6 H;  5C6A A;  1BCP C;  2SEB D;  4DFA A;  4EQP A;  1PDQ A;  3A7A B;  3MFG A;  1ILP A;  3RZO B;  5IGE A;  3S1Q B;  1QNK A;  1HRJ A;  1DD2 A;  2NTS A;  3MTS A;  3NHH A;  2A6E C;  1EWH A;  2XSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...