4BY1H

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by1H00
4IJLA 1S40A 5LMUL 1Z9FA 4B3TL 4DUZQ 1TXYA 4OWWB 4A3JG 1L1OA 2PQAB 1XMOQ 2NVXH 2WB1G 4AIMA 3RZDH 4A3LG 3D0FA 1HZCA 1SROA 1Q1EA 4DV5Q 4P75A 3UDGA 5GQOA 1XNQL 1Y1WH 2ZTEA 4BBRH 4WJ3M 1VQPA 4L5RC 2IY5B 2RHSB 3I55A 3J80i 1CKNB 2R93G 1B70B 2WAQE 2NZHA 3UE1A 1N9WA 5FLMG 4B3SQ 1AH9A 2IHFA 2K4KA 4IJHA 4C3JH 2KCMA 4A4IA 1NMGA 3KF6A 4YWMA 2JJQA 2KHIA 1L0WA 2AWOA 3RN5A 1N36L 2QGQA 4JI4L 2VQFQ 2K5NA 4LNQA 2K50A 2E5LQ 4DR4L 1A8VA 2VZAA 4L5SA 4BY7H 4GNXC 4X62Q 1G51A 2AHOB 3S24A 1UE7A 4DV7L 4QY7A 2YTXA 4UP8A 4DNIA 1K73C 2E8GA 3A74A 4JYAQ 1HJPA 1OXSC 1IZ6A 4P74A 4A3FH 1I94Q 4DR2L 1IXRA 1VQGA 2OQ0A 1K3RA 3BZKA 4GLVB 1KRTA 2JA9A 1Q7YC 3F1ZA 1VQLA 5BR8L 2ZM6L 5ELOA 1IBML 1VQ8A 1K83H 2MO0A 4B3SL 1PH2A 1KRSA 3HOWH 1N33L 3HKZE 4IFDI 5IYCH 2CFMA 1XMQQ 3CC2A 3CCRA 1N8RC 1JMCA 4DUYQ 2PI2E 2YTVA 5C0XJ 2ES2A 2DUDA 3K0XA 3DLLA 2JA8H 5IP7H 4LF7L 3NEMA 4QQBX 1ASZA 3AFPA 3ULLA 2QA4A 2XTIA 4X66L 4EQ5A 3CPWA 4DV1Q 4O2DA 3GDEA 4GNXB 1Y1VH 1FJGL 1OXTA 5M3MG 2BA0A 4QGUA 4PG3A 2FXQA 5GROA 1YZ6A 3CC7A 3OTOQ 2KENA 1IBKQ 4NPSA 2Z6KC 5E7NA 3J81j 2MQHA 1X56A 3PGZA 4UPAA 2EIFA 1X3EA 2CQOA 4DR6Q 3KDFB 1E1TA 4A93G 1KIXA 1X6OA 2PI2A 4GLXA 4IPGA 3U50C 4YCWA 3HOZG 1TWAH 3I4MH 3HOXG 3L7ZC 3K81C 4DR3Q 1HR0Q 4LF6L 2DGYA 2UUBL 3PIOA 4DV2L 2A8VA 2B63G 3TEHB 1S3OA 4H02A 3PIPA 2NVQH 4MZ9A 3FKIH 4TVAB 3S14H 4L5QA 2YTYA 4YHHL 3WWVA 1J5EL 4DV0Q 1VCIA 1B8AA 1SE8A 4BY1H 1OXVA 2KBNA 4JI5Q 3SGIA 1G6PA 4P73A 3TREA 1Q1BA 3W1BA 4IPCA 3M3YH 5C44H 3T1HQ 1D8LA 4RMFA 5GADC 1EIYB 3FP9A 1CSQA 2PNHA 4Y7NH 1OXXK 2MFIA 5C0XG 4DR7Q 1L1OC 4AYBG 3J80c 1EUJA 4DPGA 3HOYH 3NENA 3MEFA 2UXDQ 2EQSA 4LF8L 4BBSG 1YITA 3KYHC 5AJ3L 1PH3A 2MO1A 2NN6G 4P71A 4POFA 3L2PA 2CKZB 4DR3L 1KL9A 1PH4A 4QJFA 3UDFA 4JI7L 1O7IA 4LF4L 3AQQA 1J6QA 1YJ9A 3ERSX 3T1YQ 1MIUA 3JC66 4NXNL 1I3QH 3E9IA 2HHHL 5IYBG 1X3FA 4MTNA 1QVCA 1XPRA 2Y0SE 1YIJA 4JI5L 1X54A 2UU9Q 4A75A 2YV5A 3F8TA 3PO3G 4JI0Q 1YJNA 1PH7A 3OW2A 1L2FA 2B3GA 1HZAA 3HOVH 5M5XH 2VQEQ 4LUVA 1YNXA 1HNXQ 1K0RA 4R4TA 4JI2L 2JQOA 1SN8A 2UXCQ 1S72A 1VQEA 1HZ9A 1Q12A 2AMCB 1N32L 3IRBA 3NELA 3PUXA 4K0KL 1XPUA 1I6HH 1XNRL 2UXDL 3M4QA 3JAMi 3KJOA 3PV0A 3S1MH 1GD7A 5DLQE 3CF5A 2VUMH 2UXBL 3I56A 1NTGA 1UE6A 1FVIA 4C3IH 3CCSA 1E22A 3NBHB 5LMNQ 4A3IG 1Q86C 1L1OB 4LFBQ 3STBC 5GAGC 5EAYA 4X64Q 4YY3L 2YU9H 4A3GG 3S2HH 1YJWA 1CSPA 1V1QA 4A3JH 1WCMG 1YVCA 2CWAA 2CWPA 5GAEC 4JOIA 4GS3A 2ZJPA 4GOPA 3G6EA 3ULPA 4DAMA 4A3LH 2WP8J 1XJVA 3CC4A 3DM3A 4JI0L 4OWXB 3I4NG 3BJUA 1PYSB 4GKKQ 1EOVA 1XPOA 2I0QA 3AFQA 1VQMA 5HY6A 1JB7A 2OQKA 2ZJRA 1GO3E 1A62A 2KCTA 5IE8A 4DAYB 2R7DA 2NVTH 1PH5A 2R92G 2R93H 3B6YA 4A76A 3KF6B 5FLMH 2VS1A 1QVFA 3CCLA 3S16H 4LF5Q 3S2DH 4JI3L 3K7AH 2LXKA 2F4VQ 4HIMA 5JJIA 1P8LA 5IYDG 1NMFA 2K52A 4DUZL 4JCVE 1AE3A 4A3BG 3S1NH 1Q46A 1Q81C 1RIPA 3CD6A 1G291 1VQ4A 1A63A 1XMOL 3K80C 4JV5Q 2BA1A 2JE6I 4OXPA 3RR5A 3J81i 4A3MG 1FL0A 3S1QH 2LXJA 4DV5L 1PA6A 1VQKA 3CCEA 4JBMA 3FHWA 2D0OA 4X65Q 1MJEA 3GTQH 1TWCH 2PQAA 4J15A 3I2ZA 1N34Q 1EYGA 5FLXc 1CKMA 4A3DG 1PYBA 1U5KA 1PH9A 4GN5A 3CPFA 1FGUA 2N49A 3HOUG 4R4QA 1YEZA 4LFCQ 5IWAQ 2WAQG 1GM5A 2K75A 2WFWA 2Q2UA 3BZCA 4LF9Q 2VQFL 4C2MH 2E5LL 4A3EG 1HNZQ 1BBWA 4PZ8A 3M85A 1IBLQ 4X62L 1CUKA 1VQ5A 4JYAL 1EIFA 1WOCA 1BKBA 3UDIA 4LW1A 4HJ9A 2ASBA 1I94L 3CCUA 2NZOA 5M3FG 3M4OH 2VW9A 1PV4A 1VQNA 4JI8Q 5LMNW 4GKJQ 1MKHA 2R7ZH 3HOZH 2E2IH 3HOXH 1E1OA 4R4OA 2IX1A 1YI2A 5C4XH 1HNWQ 3HOWG 1WI5A 1XMQL 2JA5G 3KF8B 2C35B 3HKZG 3K7UC 1JE5A 3HFZB 4UP9A 1X3GA 4BA1I 4DUYL 2N78A 4KI0A 4HIDA 1V43A 4DV4Q 1R9TH 2IX0A 4HIOA 2E2JH 4YWKA 1XTDA 1GKHA 1ASYA 4UY8C 4IFDG 4BA2I 4PZ7A 5C0XI 4GN3B 1NJIC 2JEAI 4R1JA 4OO1G 4DV1L 1QVGA 3PSIA 2UUAQ 2JA7G 1UE1A 2KHJA 4AQYQ 1BVSA 4DV3Q 3ICEA 3D31A 3OTOL 4JG2A 1IBKL 4DR1Q 3PUWA 3CCJA 1Y1VG 4AYBE 1VQ9A 4JOIC 1SR3A 4GOPC 4HJ5A 2Q2IA 3RNUA 1VQ7A 3J7A5 1T9HA 3HOUH 3PF4A 1SRUA 1V9PA 4BY7G 4DR6L 1C0AA 2MNAA 4NXMQ 3KJPA 4NB3A 2CCZA 3GTMH 4KLKA 1EWIA 3S1RH 1QZHA 1PH1A 1HR0L 1SFOH 5IYBH 5K36G 3KLWA 4P72A 5FJ8H 2B29A 3MXNB 4A3CG 3PO3H 2K14A 4DV0L 1KAWA 2R6GA 3VDYA 4JC0A 1I50H 1VQBA 4KHZA 4LUZA 3H3VH 1NBWA 3J81c 3G4SA 1SMXA 3I4OA 3H0GG 3RZOH 5HGQA 3T1HL 1QZGA 4BBSH 4DK3C 1VS0A 1UWVA 2HIVA 4DR7L 3RN2A 4APVA 1VQOA 4JI6Q 3CW2C 3HKSA 1VQCA 4A3IH 2ZJQA 3TS2A 1VQHA 2K5VA 5IP9G 4A3GH 4LFAQ 4UP7A 1CKOA 2OTLA 4BXXG 3Q8DA 4GOPB 2OTJA 1Q8KA 2JA6G 1WCMH 4KHPQ 1X9NA 1VQIA 4B3MQ 3CCVA 3T1YL 1IYJB 1TWFH 1HZBA 4PMWA 3STBD 2VL6A 4DKAC 5LMUQ 4B3TQ 3PF5A 1A0IA 2WB1E 2UU9L 3G71A 1E3PA 1C7YA 3GD7A 2VY3A 2GVAA 2K5HA 3CCMA 2VQEL 1LUZA 3GTKH 1HNXL 2R92H 4DV6Q 4IPHA 2UXCL 3PO2G 1HH2P 1Y14B 2F52A 2PMZE 4A3KG 1XNQQ 2Q2HA 2QEXA 3RLFA 2E2HH 1M90C 1K8GA 5C3EG 3ER0A 4R4IA 1VQDA 1DGSA 5LMNL 3KFUA 4LFBL 2VUMG 4X64L 1HR0W 4B3RQ 5IYDH 2XGTA 4HJ7A 4DR5Q 1OTCA 4A3BH 5H1SE 3BU2A 1QUQA 2GN5A 3EBEA 1N36Q 1VQFA 4A3MH 3CQZH 4JI4Q 4GLAC 4DR4Q 2OWOA 4GKKL 2VNUD 3EIVA 2IT1A 3F2BA 3G48A 4DV6L 5C4JH 3CMAA 1EQQA 4DV7Q 1NY4A 1LYLA 4YWLA 3U4VA 2A19A 2ID0A 1PHJA 1X65A 4A3DH 1AE2A 4AH6A 1JT8A 1C9OA 1WYDA 2ZTDA 3A5ZB 1I5FA 3CP0A 4DR2Q 1Y1WG 4LWCA 4BBRG 5BR8Q 2ZM6Q 1IBMQ 4LF5L 4B3RL 4IFDJ 1JJCB 4DR5L 2NVYH 4OX9Q 1JJGA 1BBUA 1LM0A 4EX5A 1YHQA 2F4VL 3PUZA 4ALPA 4O0AA 1N33Q 2I5HA 4A3EH 3RLNA 3E9HA 4MNOA 1CKNA 1Z47A 2D0PA 4HIKA 1D7QA 4XTCS 2HIXA 2BH2A 1VQAA 1YHAA 2JK8A 3M9BA 2I5LX 4QIWE 4JV5L 3PUVA 4C3HH 5GAHC 4LF7Q 1VQJA 3AYHB 2UUCQ 5JJLA 4RG1A 1NE3A 3GO5A 3ZJYC 4PZ6A 5M3MH 4X65L 5M3FH 3U58A 3GTGH 4X66Q 3H15A 1N34L 4L5TA 1FJGQ 1K8AC 1X55A 4JI1Q 3PCOB 4XIGS 4QL5A 4X6AH 2D62A 4A3FG 1WJJA 3U4ZA 4A93H 4OX9L 4LFCL 2JA5H 3CAMA 5IWAL 4JBJA 3JAMc 3K8AA 4YCUA 2BH8A 2RCNA 1P16A 1TWGH 2Z0SA 2HQLA 4LF9L 4OO1I 2B63H 1MJCA 3W1GA 1HNZL 1IBLL 3KOJA 5IYCG 4LF6Q 2UUBQ 4TQUS 4DV2Q 2AKWB 3OYYA 5J3BA 1PH6A 2UUCL 2JA7H 1PVOA 4YHHQ 5IY0A 3CXCA 1J5EQ 5IT9c 2JA8G 5JEAJ 1W3SA 5IP7G 1KD1C 4JBWA 1WFQA 2LSSA 4JI1L 1PFSA 2AWNA 3L0OA 2F3IA 1Q82C 2ZTCA 1EFWA 1RL2A 4JI8L 4GKJL 1SLJA 2NN6I 4FDBA 1E24A 1YHBA 1UE5A 5M5WH 4GNXA 1HNWL 2R7ZG 2GVBA 2YYZA 2ATWA 4LF8Q 3ULJA 2H5XA 2JEBI 5AJ3Q 4WJ4A 4LUOA 4POGA 1OXUA 1LTLA 5C4XG 4A3CH 4DV4L 1JJ2A 1YBYA 4JI7Q 4LF4Q 3I4MG 3KDFA 1TWHH 4IO9A 3W5OA 3H3VI 5ELNA 3TRZA 2Q2TA 4NXNQ 2OCEA 2HHHQ 1VQ6A 1KQSA 1H95A 3H0GH 2HT1A 3A0JA 4ME3A 4JBKA 2UUAL 3FKIG 4IPDA 4AQYL 4DV3L 3TQYA 1E7ZA 2N8NA 4HJ8A 2IHEA 4DR1L 4BY1G 4OONA 1K9MC 4JI2Q 2N3SA 5IP9H 3S15H 5C44G 4BXXH 1N32Q 2R7FA 4R4CA 1KC8C 4NXML 4K0KQ 1XNRQ 4YCVA 4OWTB 2JA6H 2UXBQ 3M7NA 1W2BA 5JEAG 3HOYG 3CCQA 4HJAA 3GTLH 1UEBA 4YY3Q 5M5YH 3RLOA 3PUYA 4IOCA 2Z6KA 3I4NH 3J7ZC 5FJ8G 3UDXA 1U0LA 4GN4B 4DK6C 1PH8A 3A5UA 3PO2H 4A3KH 3TS0A 2Y0SG 1KXLA 2ALYB 2RHQB 1M1KC 2L15A 3GTJH 3F2DA 3HOVG 5C3EH 3M4PA 4IOAA 4JI6L 1B7YB 2EXDA 5JJKA 3LGJA 1EQRA 1GVPA 1QUQB 3EN2A 3S17H 2I5MX 3UE0A 4LFAL 3F2CA 1IL2A 1KHIA 3GTOH 3GTPH 2V1CC 2RF4A 3CMEA 3E0EA 3AEVA 4KHPL 4B3ML 4JI3Q 3I7FA 4Y52H 2A1AA
chains in the Genus database with same CATH superfamily
2CVRA 4IJLA 1S40A 1Z9FA 2L1BA 4B3TL 2F0WA 3G6JB 1L1OA 4L8JA 2PQAB 2NVXH 4A3LG 3K0YA 3K59A 1HZCA 2I07B 3UI2A 1PTOC 1SE3A 1Y1WH 4KN4C 4BBRH 2F0TA 4M8AA 4RAUC 4JW0A 4A3MB 4L5RC 2WV6D 3J80i 4XQJA 1BNZA 2NZHA 3UE1A 4C3JH 2F0LA 4A4IA 1NMGA 4YWMA 1L0WA 1IHZA 1PLFA 2A5HA 2JXMB 4GNXC 4HCSA 3TMEA 2YTXA 4UP8A 1K73C 2PW5A 4K5WA 2XWJB 1OXSC 3QOJA 4RGMA 4A3FH 1VQGA 3BZKA 1FYCA 1K3RA 1KRTA 3TN2A 5ELOA 5EGTA 1PH2A 5TSSA 5IYCH 1E0BA 1XMQQ 1F2MA 1JMCA 1EOTA 4A93B 3K0XA 3DLLA 2JA8H 4KKTA 2K5DA 3AFPA 3ULLA 5BN4A 1RTOA 2XTIA 3CPWA 3GDEA 2A6EC 2PZWA 1FJGL 1HRJA 2FXQA 2DJGC 1Q8IA 3OTOQ 2KENA 2JA7B 1EZ6A 5ELEA 3KDFB 1TY2A 1U4PA 3MXUA 1F2ZA 1CHQD 4HMIA 3U50C 2FMCA 1I4PA 2EOTA 2CW0D 3K81C 4DR3Q 4LF6L 5DM73 1HA5A 1HCZA 4H02A 3S14H 2PCFB 4TVAB 3WWVA 4OHJA 4ZK9B 1J5EL 3VYRA 1VCIA 1B8AA 3SGIA 1FGBD 4NW2A 4P73A 5I6YA 3I72A 3VR6A 3W1BA 5C44H 3T1HQ 2DY8A 1CSQA 4RGOS 4AYBG 1EUJA 4HMJA 3MEFA 1B9NA 1YITA 3D6CA 2NN6G 3L2PA 3J81E 4LF4L 3S15B 1J6QA 4KY7A 1TIID 4NXNL 5KIXA 2NUCA 3T13A 2PPBC 2B2WC 1XPRA 2UU9Q 4JI5L 1X54A 4A75A 2YV5A 3Q23A 1YJNA 3HOVH 1HZAA 1CT1D 1BCPB 4R4TA 5JJZA 4JI2L 1KDAA 2UXCQ 1C48A 2AMCB 1EY4A 1MGSA 3M4QA 3PV0A 1O78A 4N8X1 2VUMH 3I56A 4CBVA 3CCSA 1WTWA 3J7AF 1E22A 2RKSA 5LMNQ 2F0KA 2R92B 4CKEA 1NSNS 2WINB 5GAGC 4YY3L 3OWFA 3WDNA 2YU9H 3S2HH 3HEJA 1V1QA 1YVCA 3K5LA 2CWAA 2F0UA 1JCKB 3S17B 1QG7A 3MTSA 4DAMA 4JI0L 4OWXB 1EZ8A 3N52A 1XPOA 4A3BB 4FF2A 3DXJC 1PH5A 2R93H 1LTID 3B6YA 4A76A 2XSCA 1SE2A 3KF6B 3PMFA 4H0LC 1ZXTA 1GUOA 3IAYA 4JPBW 4JI3L 3K7AH 4KY5A 1CA6A 1LT3D 4DUZL 1CZGA 3NWTA 1AE3A 1PRTF 1VQ4A 3D4RA 4IZ8A 2BA1A 3ZYYX 4A3MG 3RD4A 4JBMA 2G9HD 5D3DA 3AB9A 1MJEA 4J15A 3V96A 2EJMA 2IL8A 2KOLA 4GN5A 3GV3A 3HOUG 4R4QA 1D1KA 1YEZA 3ERQA 4RHRA 2BE5C 4S3SA 2A69C 2DN8A 1EY5A 1H9KA 4LF9Q 2VQFL 2E5LL 1DCZA 2Q8RE 5G3LF 4J1MA 1Q3LA 1VQ5A 1WTQA 2K03A 3NBIA 1WD0A 2M00A 1I94L 3EROA 4ABNA 1M4VA 5M3FG 2VW9A 1PV4A 3OPOA 4JI8Q 5LMNW 4K2KA 1KLUD 4UAIA 3HOXH 2IX1A 5C4XH 1HNWQ 1STHA 3R3OA 3KF8B 5IT9E 1C4QA 2F0JA 1HFGA 3HFZB 3K7UC 4J6HA 4UP9A 4DUYL 4KI0A 1DXMA 1V43A 2IX0A 3TP5A 1XTDA 3PQIA 4IFDG 4BA2I 2JN4A 3C1EA 1HPCA 3PSIA 1MI2A 2UUAQ 2JA7G 4G57A 1BVSA 3ICEA 1BCPD 4Q5VA 1BOSA 3D31A 2NVQB 1IBKL 2L9HA 2K5WA 4GOPC 4HJ5A 4BBSH 1S5BD 1SRUA 5EPLA 4PQXA 2CCZA 4NXMQ 4B9XA 3S1RH 1QZHA 1PH1A 1SJED 1TU2B 1HR0L 5IGGA 4H44C 4FF4A 2Z9HA 3PO3H 2K14A 1KAWA 3VDYA 1VQBA 4LUZA 1NBWA 3I4OA 3H0GG 2O4XA 4DK3C 3URYA 2RCFA 1EL0A 3R2IA 4JI6Q 3M4YA 2XIWA 4IALA 2K5VA 4LFAQ 4BXXG 2X6LA 5FO7B 3Q8DA 1B3AA 3SR1A 4KHPQ 1ET6A 3T1YL 1U4MA 4PMWA 4B3TQ 1Y69U 1A0IA 4KHVA 3PIP3 1S5FD 2GVAA 2K5HA 1WTVA 3GTKH 1GUWA 2R92H 4QCLA 1X32A 1SBBB 4K14A 1HH2P 2PMZE 3NSWA 4DGZA 2HUGA 3RLFA 3OHXC 1K8GA 5KEEA 1PTOD 1JB3A 5C3EG 3SVMA 1CTMA 1VQDA 1DGSA 4LFBL 1EY8A 3MC0B 4X64L 4RFBA 2NVTB 2EE1A 4A3BH 2EYLA 4RCOA 2GN5A 1EYAA 4KY6A 2CH4W 3A55A 4GLAC 2EYFA 3OOCA 2OWOA 5ISRA 4R8NA 4X3SA 2VNUD 2WKCA 3F2BA 2QKIC 2D5DA 2EVBA 1NY4A 1PHJA 2A19A 3S9WA 4A3DH 3I91A 4AH6A 3S1NB 4FXGC 2E74C 1I5FA 2Q8IB 5HGTA 1WTXA 1TKWB 3L3OC 1JJCB 4DR5L 2GA4B 5JOBA 3VR2A 1YHQA 3DEOA 1EEFD 2F4VL 2OF1A 4A3EH 5DAUA 4XTCS 4CDFC 4JV5L 4QIWE 2FMMA 2I5LX 3PUVA 4CKBA 1G2SA 1PTOH 2KEEA 5GAHC 1OO9B 5T1IA 1JICA 3GO5A 4X65L 1TQOA 3H15A 1SNQA 1N34L 1IL8A 2KA7A 1SNPA 1FJGQ 2FFKB 1I6VC 4X6AH 2A6ED 1LO5D 5IWAL 2EZVA 2BH8A 1P16A 4HEDA 3W1GA 1EYCA 4LF6Q 5C6AA 2AKWB 4MTKA 3OYYA 5J3BA 2EYPA 2KCCA 2ZXOA 3CXCA 1GUGA 1J5EQ 5JEAJ 5IP7G 3FRPB 2J0TD 4LK1C 2LSSA 3MFGA 4JI1L 1Q82C 3H3VC 3L0OA 5EJWA 2B2UC 2ZTCA 2B39A 3FKIB 1QB5D 2CHBD 5CV5A 2GVBA 2CW0C 3J80L 2ATWA 4OELB 3E3XA 4WJ4A 1BDOA 1LTLA 3RUZA 1PDQA 4A3CH 1YBYA 4LF4Q 3W5OA 3TRZA 4NXNQ 1VQ6A 1YNND 1CHPD 4FP5D 4AQYL 3TQYA 1SFOB 4UDUC 3T56B 1SE4A 4OONA 4JI2Q 2M2LA 2N3SA 5IP9H 4TRDA 1I50B 4R4CA 4YCVA 2K33A 4QF4A 3RZOB 3M7NA 2HQEA 5JEAG 5C4ZA 1STEA 3QG1A 3GQBA 5EPJA 2EY5A 4YY3Q 1H9SB 1IW7C 3RLOA 3PUYA 1EFID 3KK7A 3I4NH 3T16A 4QB4A 2PO4A 1PH8A 3A5UA 1PMRA 3PO2H 2Y0SG 2RHQB 3OMCA 3T51B 2L15A 3GTJH 1FNVA 4IOAA 2K04A 2Z4IA 4K2LA 1QUQB 2I5MX 1S5DD 2V1CC 3BG3A 1EU3A 3AEVA 4JI3Q 4Y52H 2A1AA 2RVLA 3P1HA 4R8IA 1JWSD 1LTSD 4DUZQ 4WFN3 3BVZA 2M9VA 1VF7A 4AIMA 3C3LA 1SEBD 4NDXA 3TP6A 1SROA 3VYSA 3UDGA 4P75A 5EKLA 4KD4A 2L0CA 2AQ2B 3I55A 3P75A 4IUUA 5C4JB 2WAQE 2XWBB 3J7YW 1SJHD 1O80A 2IHFA 4IJHA 2WKDA 3RN5A 2JJQA 2AWOA 2QILA 2VQFQ 4LNQA 1EWCA 1MD2D 5C3XA 2E5LQ 1LV9A 1UE7A 4DV7L 1KDBA 1UAPA 4QY7A 2E8GA 3F2UA 1HJPA 1IZ6A 2QEJC 1S5CD 1I94Q 4DR2L 2OQ0A 4IUQA 2JA9A 1J9OA 1VQLA 1EY9A 1VQ8A 4IURA 4B3SL 1KRSA 3HOWH 3GTGB 1GJXA 5JPNC 2F0OA 5I9PA 2PNRC 5IGCA 1SYDA 2A74C 4GZYC 4UHVA 4DUYQ 2PI2E 2YTVA 3R2TA 2JA5B 2DUDA 4LF7L 2K7VA 4QQBX 1ONLA 4X66L 4EQ5A 1Y1VH 2F3VA 1ZKOA 5M3MG 4QGUA 2AUKA 2IPKD 1IBKQ 3A8IE 2Z6KC 5E7NA 2MQHA 1X56A 2A73B 1Q90A 2EIFA 4ZKCB 2CQOA 4MN3A 2KECA 1U4RA 2OT2A 2PI2A 1M8AA 4GLXA 1TS2A 3HOZG 1TWAH 3L7ZC 3TZUA 1HR0Q 1HUMA 5M5WB 2B63G 3PIPA 3FKIH 2AQ3B 2YTYA 4L5QA 1XYIA 1BCPC 1SE8A 3TREA 1IYUA 1Q1BA 2EY1A 5CV8A 4P2CB 4RMFA 3NHHA 3FP9A 2HDMA 1JORA 1JQYD 4Y7NH 1OXXK 3CU7A 2Z4HA 4DPGA 1U9RA 1H9MA 4LF8L 4N8FA 1NCVA 5AJ3L 2MO1A 2CKZB 3UDFA 5M9OA 1EIHA 2R3ZA 1EEID 3T1YQ 4FXKC 2JA6B 3E9IA 3ND9A 5IYBG 4MTNA 5JVG3 1CM9A 2MUYA 3VR5A 2F0QA 1PH7A 2B3GA 2PYKA 2E76C 5M5XH 4LUVA 1JOKA 1S72A 4EQPA 3NELA 4BS9A 1PXUA 1XPUA 2UXDL 1FD7D 4KK7A 3SE0A 2UXBL 2B2YC 4C3IH 4LFBQ 1Q86C 4KN7C 1L1OB 4X64Q 3HS0C 1IYVA 1CSPA 1WCMG 1BXTA 1RCVD 4OGQC 4JOIA 4A3LH 3ULPA 2WP8J 3DM3A 3GTOB 2B2TC 1PYSB 3W3AA 2ZJRA 2J4XA 1A3TA 2OXPA 1GO3E 5IE8A 4KTAA 5F2DA 4DAYB 3D3RA 4DU9A 4E6IA 3CQZB 2ENBA 2VS1A 4WJWA 5KNCA 3S2DH 4DK1A 2F4VQ 1P8LA 4ZYSA 3HOUB 1Q81C 1RIPA 2KUMA 1A3UA 1G291 3SDZA 1VMPA 3K80C 1XMOL 4JV5Q 2LFNA 3TSSA 2F0NA 1FL0A 3HP3A 4DV5L 1PA6A 1F9SA 1LTGD 4HSVA 5IODA 4X65Q 1AP0A 2PQAA 1N34Q 4EQOA 1CKMA 1PH9A 2C5CA 1SNDA 2LY7A 5IWAQ 1MSGA 2WAQG 5M3FB 3L9AX 2K75A 1FNWA 3OW7A 4C3JG 4PZ8A 1ILPA 1CUKA 2OEOA 5JPMC 1EIFA 3UDIA 4PMBA 2RSNA 2O5IC 4LW1A 4C3HG 1BO0A 2HD3A 3JAME 1SMYC 2ASBA 1E2VA 2K6AA 3VR3A 1LT6D 3KBGA 2R7ZH 4HN7A 2E2IH 1KDCA 1WI5A 2JA5G 3KBXA 1R9TH 4L6TB 3SK4A 1PZID 2VXWA 2XVSA 4PZ7A 2F0EA 2JEAI 4R1JA 4DV1L 1QVGA 3X3MA 4AQYQ 2KCNA 3PUWA 4FO2A 1SR3A 3RNUA 1GXDC 5J1ZA 4M1UB 3H0GB 1QWYA 3CHBD 3X3NA 5A2QL 1C0AA 3FVQA 3KJPA 1EWIA 3K6OA 3NTIA 3IL8A 4P72A 5FJ8H 1YNNC 2RQXA 3HOYB 1WVLA 4DV0L 2R6GA 1IW7D 3H3VH 4KHZA 3ONAB 1SYBA 1RHPA 3J81c 1SMXA 3MAQA 2F03A 1UWVA 3WOEA 2IX3A 4DR7L 4F87A 4DXFA 2PZUA 1VQHA 1B50A 3DM1A 3EQLC 1CKOA 1QNKA 5DEHA 2LS01 2JA6G 1X9NA 2NB0A 2PW7A 5C3EB 1CK1A 4XYQA 2FINB 5KRUA 2XN9C 4Z9CB 2WB1E 1XWEA 5E4WC 3CCMA 3K58A 2HCCA 4IPHA 1XXGA 2KEDA 4A3KG 1Y8OB 1M90C 1HTLD 1NAPA 3G7LA 3U9OA 1S5ED 3Q0AA 2VUMG 5EBDA 1EYDA 1OTCA 4ZLTF 3E6ZX 3BU2A 5H1SE 4A3MH 3CQZH 3S16B 2O2LD 4GKKL 2B8FA 3G48A 4DV6L 4DV7Q 4YWLA 1LYLA 1X65A 4C56C 4OEMB 1C9OA 3A5ZB 3HOUH 4IUTA 4DR2Q 4LWCA 5FOBB 4LF5L 4B3RL 4IFDJ 1EQVA 3V05A 1JJGA 1LM0A 4EX5A 4ALPA 4O0AA 3RLNA 3E9HA 4FF1A 1CKNA 3T53B 4G7HC 1QNUA 2D0PA 4HIKA 5FO9B 1NUCA 1ILQA 1CFMA 3M9BA 1VQAA 1K83B 5FO8B 2A68D 2L5TA 1DM0B 4LF7Q 4C1NI 2UUCQ 5JJLA 2DNCA 3ZJYC 1BF4A 3U58A 4BY7G 1V8QA 5M3FH 4X66Q 4C2MB 4L5TA 4V190 1K8AC 1X55A 3NUCA 1KNAA 4QL5A 4DNTB 3ND8A 5EQ0A 3U4ZA 4OX9L 4A93H 1TT2A 3D4WA 3CAMA 2L11A 4DA2A 3K8AA 1G91A 2Z0SA 3A56A 1STAA 1MJCA 2WIIB 4XT3B 1HNZL 3HZXA 1IBLL 3NQTA 4TQUS 3VR4A 1PH6A 2JA7H 1PVOA 3KLSA 4C1NK 1A2UA 1XX8A 5DM63 5IT9c 5CV4A 3VYTA 1C8CA 1QILA 1F9RA 2F3IA 1RL2A 1TS4A 1E24A 1UE5A 1AEXA 4GNXA 5C4HA 4RHSA 2SOBA 3T4AC 1G6ZA 1EIGA 4LF8Q 2EYHA 5AJ3Q 2JEBI 3M3YB 5C4XG 1OXUA 4NP5A 4DV4L 1JJ2A 3I4MG 1D6EC 3GTMB 2F0FA 3H0GH 1BQQT 3A0JA 4ME3A 2HT1A 4CDCC 4K5XA 1W6JA 3J80E 4IPDA 4KKSA 2BOSA 1E7ZA 1NNXA 4BY1G 1KABA 1STGA 4ULLA 3S15H 4BXXH 2Y0SB 5IGEA 1KLGD 2UXBQ 1B9MA 1SSOA 4LMQD 3QIAA 3Q6SA 4F7XA 3HOYG 1UEBA 1MBYA 4DN4M 4EGVA 3J7ZC 4A3GB 1I4HA 2F0DA 2B2VC 5JVH3 3Q22A 1KXLA 2N55A 5COYA 3FPPA 5C3EH 3M4PA 1EY6A 3LGJA 1EQRA 1GVPA 3S17H 3UE0A 1BUVT 1IL2A 1KHIA 1EQTA 3C2PA 2RF4A 3E0EA 1JWUD 3MZ5A 4B3ML 2PMZB 2EDGA 1TXYA 1ESRA 1X3PA 4OWWB 3NBHA 4A3JG 5D3IB 1XMOQ 2WB1G 3D0FA 4DV5Q 1XNQL 2ZTEA 5FKAC 3TP7A 2IY5B 1GHKA 4XYOA 1LLRD 1R4QB 1HFNA 1TR5A 1K8OA 1N9WA 5FLMG 1AH9A 2K4KA 4Q0FA 4ZRZA 1TWCB 2K1BA 4HR7B 2KHIA 2MP1A 1YNJD 2K5NA 4DR4L 1A8VA 2VZAA 1E2ZA 3BVMA 2NVYB 5FLXE 1G51A 2AHOB 4L5SA 3S24A 1EWHA 1O7ZA 3A74A 2QF7A 4QIWB 1TVXA 3F1ZA 5BR8L 1V1PA 2BDNA 1SMYD 1K83H 2MO0A 2F0HA 4IUVA 5M3MB 2R61A 5E1FA 2EPBA 1TS5A 3HKZE 3AMUA 2CFMA 3CC2A 4I65A 3CCRA 3M4OB 2RSOA 1SYCA 4XQNA 5CORA 5C0XJ 1CI3M 5ELDA 5IP7H 3HOZB 3NEMA 3LX0A 5NUCA 3C46A 3MFYA 2H1EA 4DV1Q 2B63B 1K8MA 3V2TA 3BZDB 1YZ6A 3CC7A 1WD1A 1SYEA 2E2JB 1GOZA 3J81j 3PGZA 4UPAA 3BDCA 1QE6A 3KUPA 1E1TA 3R93A 2IW3A 1X6OA 1KIXA 1QCBD 1AZPA 2NZ1D 1BBXC 3QJYA 2UUBL 2NVQH 3DMUA 4WORA 2AUJD 1LACA 4YHHL 4DV0Q 1Y8PB 1CZWA 2RDHA 1T5EA 3CRLC 4XDXA 4JI5Q 1BCPF 5DNFA 2XRSD 3M3YH 1D8LA 3I90A 1EIYB 2PNHA 4X3KA 2MFIA 5C0XG 4DR7Q 1L1OC 1K28A 5JEAH 3NENA 2EQSA 1EY7A 3QOLA 1ZEQX 4KJNA 1PH3A 3FPUB 4DR3L 1KL9A 1PH4A 2F0MA 4JI7L 3ERSX 1MIUA 4R9WA 3NXWA 3I3CA 1QVCA 1A2TA 5CV7A 3W2DA 4JI0Q 1WCMB 3OW2A 1L2FA 1K0SA 4CDEC 3MXNA 1YNXA 1TWFB 1K0RA 5ELFA 1VQEA 1HZ9A 1ENCA 3NQIA 1B3QA 1F2LA 2CH4A 3PUXA 4KMUC 1XNRL 1JE4A 4XXEA 3JAMi 5C5MA 3CF5A 1NTGA 1UE6A 1FVIA 1B2TA 3TZDA 4A3IG 1STNA 1EU4A 4A3GG 1AFPA 2E2HB 1SXTA 2CWPA 2Z6BA 4GS3A 4GOPA 3G6EA 1D5MC 3CC4A 4BWGB 3GTPB 3I4NG 5C3WA 4GKKQ 2I0QA 1XTCD 1VQMA 5HY6A 1DJRD 1JB7A 1D5ZC 5BN5A 4XT1B 4JVZA 1A62A 2KCTA 2NVTH 1PTOF 2KVMA 2NVXB 1RTNA 1HQMC 3CCLA 4LF5Q 2A6HD 4CKCA 4QMGA 3QB3A 4BBRB 4RWSC 4HIMA 5IYDG 2K52A 4JCVE 3NWSA 1I4QA 3S1NH 1Q46A 2WAQB 4DXGA 2JE6I 3J81i 2CQAA 4C3JB 1VQKA 4CJ0B 3CCEA 1Y8NB 3K5MA 3FHWA 1TWCH 4YIJA 1QOHA 1EYGA 3A54A 3NTKA 1PYBA 2ICEC 2NTTA 1U5KA 2SEBD 2K5QA 2Z1CA 1FGUA 2EJFC 2N49A 4C3HB 1SYGA 3HGBA 3I70A 1D2BA 4A3FB 3NPPA 2A68C 3A8KE 2B8GA 1B4OA 2QDBA 1HNZQ 3MXPA 1IBLQ 4X62L 1PRTB 1RF2D 3SEBA 1QJOA 4JYAL 1BKBA 3OWEB 1TWGB 2JSOA 1I4GA 2N88A 3CCUA 3M4OH 2RDFA 2KQ3A 3VA5A 1MKHA 4CJ1B 3BYYB 3HOZH 4DFAA 3K5OA 3FEWX 3KLRA 1YI2A 3HOWG 4NKLA 1B1ZA 3HKZG 3FDTA 1JE5A 4BA1I 2DY7A 2N78A 3I73A 4DV4Q 4HIOA 2E2JH 1GKHA 3I4LA 4UY8C 3K57A 3MEHA 1NJIC 4OO1G 2EXZA 1UE1A 4TKOB 2EY2A 4JG2A 3S14B 1Y1VG 1TWHB 4AYBE 2EYMA 1VQ7A 3J7A5 1T9HA 4DR6L 1V9PA 3MXGA 4NB3A 4KLKA 2MHVA 4G4KA 4FF3A 3MHBA 1SFOH 5IYBH 5K36G 3KLWA 5KNDA 1I50H 1SDFA 3DUZA 4NMZA 1ZYRC 3G4SA 4V0BA 3RZOH 3GTLB 1QZGA 3GP7A 4IQZA 2HIVA 5C5LA 2J7ZA 4APVA 1VQOA 3LNNA 3HKSA 1VQCA 1PFBA 3D4DA 1F2YA 4UP7A 4A3KB 1NR2A 2OTJA 1Q8KA 1WCMH 2ZT9C 2K28A 3H94A 2F0GA 2MGSA 4B3MQ 3CCVA 1TWFH 2B2UA 3STBD 2VL6A 4DKAC 1RKNA 3PF5A 2VUMB 3G71A 3PIO3 3N6RA 1C7YA 4K8IA 2VY3A 1ML0D 1H9JA 2YU9B 3S2HB 2VQEL 1LUZA 2XRQD 1HNXL 5IGDA 1Y14B 1XNQQ 2Q2HA 2E2HH 3EFXD 3CKIB 4R4IA 3RZDB 3KFUA 1ESFA 1HR0W 4H7BA 4C3IG 4DR5Q 4RGNA 2R93B 3DWAA 5D65A 5IGFA 1LTTD 1VQFA 3D8GA 1PRTD 1KTKA 4DR4Q 4ODGA 1JR0D 3EIVA 3K7AB 5C4JH 2HDLA 1L0YB 5CBAE 1EQQA 3U4VA 2ID0A 1AE2A 1JT8A 1WYDA 2ZTDA 1X3QA 1Y1WG 4BBRG 4BY7B 1AW7A 4MIUA 5BR8Q 2JYOA 3IKJA 5ELCA 4DAYA 3SXHA 1YNJC 3PUZA 2K05A 2I5HA 2ZXPA 1D7QA 2NYZD 2JK8A 1G2TA 1B44D 3LWEA 3E5SA 1DYQA 2F1MA 3MA2B 4C3HH 5G3LD 1VQJA 4RG1A 3GTGH 1LABA 2X6GA 4JI1Q 3A7LA 1DOLA 4FNFA 4A3FG 3ITPA 4LFCL 2JA5H 5BN3A 4JBJA 3JAMc 5L37A 2RCNA 1TWGH 1FR3A 2HQLA 3SK8A 3WOFA 1ET9A 4F88A 3SK5A 4LJZC 5IYCG 4RA8A 2UUBQ 5CMDA 1Z6HA 1G8ZD 3HOXB 1HXYD 2K01A 5C4XB 4YHHQ 1K3BC 4CHTB 2JA8G 3I4MB 1NR4A 1WFQA 3VA7A 4B08A 1EFWA 4GKJL 1SLJA 2NN6I 1YHBA 5I2YA 5M5WH 3VYUA 2NN6H 4IUNA 4BY1B 2R7ZG 3ULJA 2H5XA 1D1IA 2Q8TA 4JI7Q 2BDOA 4BBSB 3KDFA 1TWHH 4IO9A 4X3UA 3H3VI 4O1NA 2Q2TA 1H95A 1S4ZA 4JBKA 1LT5D 3S1RB 4DV3L 2N8NA 4HJ8A 4DR1L 5KNBA 3P7JA 4N9TA 3PO3B 1I3QB 3H91A 5C44G 2R7FA 1KC8C 1XNRQ 2JA6H 4KJOA 1WTPA 3H09A 3EJIA 3CRKC 3GTLH 1O7YA 2QDLA 3NTHA 2XNAC 1I6HB 4IOCA 2Z6KA 4DF7A 3S1MB 5FJ8G 5LL6X 1VF5C 4A3KH 4DAVA 1SNMA 4A3JB 3HOVG 4RCNA 4I7AA 2WB1B 1B7YB 2EXDA 5D14A 3DWQA 5CR3A 1UUPA 1GUNA 3F2CA 3GTKB 3GTOH 3I8ZA 5LHY1 1PFMA 5LMUL 5HURA 4G7OC 2NWGA 3RZDH 2IWHA 1F9PA 1Q1EA 4MHEA 5GQOA 4WJ3M 1VQPA 2A6HC 2RHSB 1DOMA 1CKNB 2R93G 1B70B 5AFWA 4OL7A 3S1QB 1EY0A 1STBA 4B3SQ 4A3DB 4HTHA 3GTQB 4RKLA 2KCMA 3KF6A 5J22A 1N36L 2QGQA 4JI4L 4FYDA 2SNMA 4FVMA 2K50A 2QCPX 3QO2A 4BY7H 4X62Q 2B2YA 4OIJA 3U9SA 4DNIA 2MPMA 4A3EB 4JYAQ 3C1FA 1RJTA 4P74A 1IXRA 4GLVB 3DWPA 4ZQ3A 1Q7YC 1PTOB 2ZM6L 1IBML 4K8JA 2B2TA 4TSSA 1HTPA 1A3VA 3JAML 1N33L 4IFDI 1N8RC 2D2CC 2NTSA 4B9WA 4IFDH 2ES2A 3IFTA 1ASZA 2F3WA 2G9DA 2QA4A 4O2DA 5EKKA 3SHLA 4GNXB 1OXTA 2BA0A 1TY0A 2EJGC 4PG3A 5GROA 1Z7TA 3QWNA 4NPSA 4CDDC 1WTHA 1X3EA 4IUPA 4DR6Q 4A93G 1LTBD 4IPGA 1HQRD 1LTRD 4YCWA 3I4MH 3HOXG 2A8VA 2DGYA 5I4DA 1VDZA 3PIOA 4DV2L 3TEHB 1S3OA 4U673 4MZ9A 2TSSA 3QR8A 3K5NA 3KF8A 2Z8LA 1PZJD 4BY1H 1G6PA 1OXVA 2KBNA 3J81L 4IPCA 3OMGA 1TS3A 5GADC 2RBMA 1ZYRD 5KGUA 1IKMA 4X3TA 1MSHA 1IKLA 3J80c 2BCOA 2HCIA 3HOYH 5IOCA 2UXDQ 4BBSG 3KYHC 4POFA 4P71A 4ZKBB 4QJFA 1RD9D 1O7IA 3AQQA 5J39A 1YJ9A 5CC4A 3JC66 1I3QH 2LMCB 2HHHL 2P5ZX 4A3IB 1X3FA 2Y0SE 1YIJA 4DK0A 3F8TA 2FJ2A 3PO3G 2VB3X 2D9UA 2VQEQ 4ILWA 1PFNA 2E75C 1HNXQ 2EYJA 1SN8A 2JQOA 3BVGA 3I4NB 1Q12A 4O42A 1N32L 3IRBA 4K0KL 1I6HH 3KJOA 2KJXA 3S1MH 1BR9A 1GD7A 5DLQE 3PO2B 3NBHB 1D5XC 5JJIA 3GTJB 3STBC 5EAYA 2F0IA 1DZ1A 1YJWA 5FK9C 4ME5A 4A3JH 5EBCA 3LWUA 1SNCA 5CYUA 1GUSA 5GAEC 2ZJPA 3OIPA 1WTOA 1XJVA 3BJUA 1ICWA 1EOVA 3BDOA 3AFQA 2OQKA 1CA5A 5EKIA 2R7DA 4KD3A 2R92G 1A6XA 5FLMH 1VMCA 5IIFA 1QVFA 2B2WA 3S16H 4EVOA 2G5DA 2LXKA 1PRTC 4KV6A 1NMFA 3MVVA 4A3BG 3DEPA 5KYLA 3CD6A 1A63A 1JWMD 3IFDA 4OXPA 3RR5A 4HCEA 1UEAB 3S1QH 5JAVA 2LXJA 1V1PB 2JP1A 5KYIA 3GTQH 2D0OA 3I2ZA 4U68A 2QW7A 5FLXc 2F0SA 3Q24A 4A3DG 2IJ0A 2C9OA 3CPFA 2DNEA 1T5XD 2L55A 4HAEA 2NBFA 3BYTB 4LFCQ 1ENFA 1FNUA 3TP8A 1GM5A 5CV6A 2WFWA 2Q2UA 3BZCA 4C2MH 2X69A 2VB2X 4A3EG 1BBWA 3M85A 3HOWB 5E3FA 1L0XB 5T1GA 3HKZB 1WOCA 1KAAA 5IT9L 4HJ9A 4XQQA 2NZOA 1V1OA 4PV1C 1VQNA 4GKJQ 3P20A 1E1OA 4R4OA 1MHWC 1RODA 4RGTA 1Y1VB 2DJFC 1WTRA 3MWYW 1XMQL 2EYOA 1HHVA 2C35B 4HIDA 1X3GA 1B53A 3FMCA 4YWKA 2ICIA 2K32A 1ASYA 4DNRB 5C0XI 4GN3B 4F8MA 1TWAB 2KHJA 4H13C 4DV3Q 5C0XH 3OTOL 4DR1Q 3CCJA 1VQ9A 4JOIC 2Q2IA 3PF4A 2V4DA 4K5VA 2MNAA 4RH6A 3GTMH 1O7LA 4LAAA 4ZCKA 4OIKA 4Y7NB 2B29A 3MXNB 4A3CG 4JC0A 3A8JE 1CQFA 3BS1A 4PNYA 2MJ8A 2H4OA 5HGQA 3T1HL 5M5YB 1F77A 1VS0A 3RN2A 1ICFB 3CW2C 3EA6A 4A3IH 2ZJQA 3TS2A 3DHQA 5IP9G 5E4XA 4A3GH 5M5XB 2OTLA 4GOPB 3OSOA 1SYFA 1VQIA 1IYJB 4J8QA 1HZBA 2E2DC 4QUCA 1PYWD 5LMUQ 2UU9L 5A35A 1E3PA 4C3IB 3GD7A 5IGBA 5LL6S 1H9SA 3TDQA 4DV6Q 2UXCL 3PO2G 2F52A 2ZXRA 2QEXA 2AQ1B 4WRDA 5CBEE 4N9PA 2EY6A 3ER0A 1SNOA 3NP8A 4RKBA 1AZQA 5LMNL 1GHJA 5K5PA 5I6WA 5IYDH 4B3RQ 1RDPD 2XGTA 4HJ7A 1Y1WB 1QUQA 3R8BA 4KKUA 2RDGA 5I2XA 3EBEA 1N36Q 3BDLA 1UNSA 4JI4Q 3S2DB 2IT1A 1H9RA 3SK6A 3CMAA 1E2WA 3O13A 1HA6A 3CP0A 4PMCA 2SDFA 5FLXL 3J7AV 3KLSX 2KHSA 2ZM6Q 1IBMQ 2B2VA 4QUFA 4ZUJA 1GUTA 2NVYH 4OX9Q 1BBUA 2L4NA 1N33Q 4MNOA 2BE5D 2RA4A 4I7ZC 1Z47A 2A69D 2HIXA 2BH2A 1YHAA 4IN3A 4CGYB 4FXDA 3D6WA 3AYHB 1NE3A 2F0VA 5M3MH 4PZ6A 4K6LA 1JOOA 2LKVA 1W6KA 1KNEA 3HG9A 3PCOB 4XIGS 2JA8B 2D62A 1DOKA 5I9OA 1WJJA 2FHTA 2PQEA 2I46A 4YCUA 4G7ZC 4LF9L 3TBIB 2B63H 4OO1I 2F4IA 4EQNA 3KOJA 2WACA 1I4XA 2L12A 2R7ZB 4DV2Q 4OO1H 2E2IB 1PZKD 2UUCL 5IY0A 1STYA 1W3SA 1KD1C 4JBWA 4JK1C 1PFSA 2AWNA 3M7GA 1R9TB 4JI8L 1A15A 4FDBA 3EVQA 1ENAA 1AN8A 1R4PB 1JOQA 1HNWL 3NE5B 2TMPA 2YYZA 1CQVA 1LTAD 5K36H 5EPKA 5C44B 4LUOA 4POGA 4AYBB 5CGKA 3OIQA 3RMHA 5ELNA 2OCEA 2HHHQ 4CJ2C 1KQSA 4ID6A 2O5JC 5ELBA 2UUAL 3FKIG 5A2QE 3AU7A 2IHEA 1II3A 1K9MC 1N32Q 1J8IA 2SNSA 4K0KQ 4NXML 4OWTB 1DD2A 4K6DA 5CV9A 3HOVB 2PZTA 1W2BA 3CCQA 4HJAA 5M5YH 1I4RA 4DAPA 1LT4D 3UDXA 3HRZC 4ZUIA 1U0LA 1U4LA 4GN4B 4DK6C 3TS0A 2ALYB 2F0PA 4HSPA 3NK9A 3GV6A 1M1KC 3F2DA 4JI6L 3E0JA 5JJKA 1DONA 1HUNA 1JC7A 3EN2A 3H6MA 1F9QA 4LFAL 4L63B 4ZAIA 3A7AB 3GTPH 3CMEA 4KHPL 3I7FA 1SAPA
chains in the Genus database with same CATH topology
4IJLA 1S40A 5LMUL 1Z9FA 4B3TL 4DUZQ 1TXYA 4OWWB 4A3JG 1L1OA 2PQAB 1XMOQ 2NVXH 2WB1G 4AIMA 3RZDH 4A3LG 3D0FA 1HZCA 1SROA 1Q1EA 4DV5Q 4P75A 3UDGA 5GQOA 1XNQL 1Y1WH 2ZTEA 4BBRH 4WJ3M 1VQPA 4L5RC 2IY5B 2RHSB 3I55A 3J80i 1CKNB 2R93G 1B70B 2WAQE 2NZHA 3UE1A 1N9WA 5FLMG 4B3SQ 1AH9A 2IHFA 2K4KA 4IJHA 4C3JH 2KCMA 4A4IA 1NMGA 3KF6A 4YWMA 2JJQA 2KHIA 1L0WA 2AWOA 3RN5A 1N36L 2QGQA 4JI4L 2VQFQ 2K5NA 4LNQA 2K50A 2E5LQ 4DR4L 1A8VA 2VZAA 4L5SA 4BY7H 4GNXC 4X62Q 1G51A 2AHOB 3S24A 1UE7A 4DV7L 4QY7A 2YTXA 4UP8A 4DNIA 1K73C 2E8GA 3A74A 4JYAQ 1HJPA 1OXSC 1IZ6A 4P74A 4A3FH 1I94Q 4DR2L 1IXRA 1VQGA 2OQ0A 1K3RA 3BZKA 4GLVB 1KRTA 2JA9A 1Q7YC 3F1ZA 1VQLA 5BR8L 2ZM6L 5ELOA 1IBML 1VQ8A 1K83H 2MO0A 4B3SL 1PH2A 1KRSA 3HOWH 1N33L 3HKZE 4IFDI 5IYCH 2CFMA 1XMQQ 3CC2A 3CCRA 1N8RC 1JMCA 4DUYQ 2PI2E 2YTVA 5C0XJ 2ES2A 2DUDA 3K0XA 3DLLA 2JA8H 5IP7H 4LF7L 3NEMA 4QQBX 1ASZA 3AFPA 3ULLA 2QA4A 2XTIA 4X66L 4EQ5A 3CPWA 4DV1Q 4O2DA 3GDEA 4GNXB 1Y1VH 1FJGL 1OXTA 5M3MG 2BA0A 4QGUA 4PG3A 2FXQA 5GROA 1YZ6A 3CC7A 3OTOQ 2KENA 1IBKQ 4NPSA 2Z6KC 5E7NA 3J81j 2MQHA 1X56A 3PGZA 4UPAA 2EIFA 1X3EA 2CQOA 4DR6Q 3KDFB 1E1TA 4A93G 1KIXA 1X6OA 2PI2A 4GLXA 4IPGA 3U50C 4YCWA 3HOZG 1TWAH 3I4MH 3HOXG 3L7ZC 3K81C 4DR3Q 1HR0Q 4LF6L 2DGYA 2UUBL 3PIOA 4DV2L 2A8VA 2B63G 3TEHB 1S3OA 4H02A 3PIPA 2NVQH 4MZ9A 3FKIH 4TVAB 3S14H 4L5QA 2YTYA 4YHHL 3WWVA 1J5EL 4DV0Q 1VCIA 1B8AA 1SE8A 4BY1H 1OXVA 2KBNA 4JI5Q 3SGIA 1G6PA 4P73A 3TREA 1Q1BA 3W1BA 4IPCA 3M3YH 5C44H 3T1HQ 1D8LA 4RMFA 5GADC 1EIYB 3FP9A 1CSQA 2PNHA 4Y7NH 1OXXK 2MFIA 5C0XG 4DR7Q 1L1OC 4AYBG 3J80c 1EUJA 4DPGA 3HOYH 3NENA 3MEFA 2UXDQ 2EQSA 4LF8L 4BBSG 1YITA 3KYHC 5AJ3L 1PH3A 2MO1A 2NN6G 4P71A 4POFA 3L2PA 2CKZB 4DR3L 1KL9A 1PH4A 4QJFA 3UDFA 4JI7L 1O7IA 4LF4L 3AQQA 1J6QA 1YJ9A 3ERSX 3T1YQ 1MIUA 3JC66 4NXNL 1I3QH 3E9IA 2HHHL 5IYBG 1X3FA 4MTNA 1QVCA 1XPRA 2Y0SE 1YIJA 4JI5L 1X54A 2UU9Q 4A75A 2YV5A 3F8TA 3PO3G 4JI0Q 1YJNA 1PH7A 3OW2A 1L2FA 2B3GA 1HZAA 3HOVH 5M5XH 2VQEQ 4LUVA 1YNXA 1HNXQ 1K0RA 4R4TA 4JI2L 2JQOA 1SN8A 2UXCQ 1S72A 1VQEA 1HZ9A 1Q12A 2AMCB 1N32L 3IRBA 3NELA 3PUXA 4K0KL 1XPUA 1I6HH 1XNRL 2UXDL 3M4QA 3JAMi 3KJOA 3PV0A 3S1MH 1GD7A 5DLQE 3CF5A 2VUMH 2UXBL 3I56A 1NTGA 1UE6A 1FVIA 4C3IH 3CCSA 1E22A 3NBHB 5LMNQ 4A3IG 1Q86C 1L1OB 4LFBQ 3STBC 5GAGC 5EAYA 4X64Q 4YY3L 2YU9H 4A3GG 3S2HH 1YJWA 1CSPA 1V1QA 4A3JH 1WCMG 1YVCA 2CWAA 2CWPA 5GAEC 4JOIA 4GS3A 2ZJPA 4GOPA 3G6EA 3ULPA 4DAMA 4A3LH 2WP8J 1XJVA 3CC4A 3DM3A 4JI0L 4OWXB 3I4NG 3BJUA 1PYSB 4GKKQ 1EOVA 1XPOA 2I0QA 3AFQA 1VQMA 5HY6A 1JB7A 2OQKA 2ZJRA 1GO3E 1A62A 2KCTA 5IE8A 4DAYB 2R7DA 2NVTH 1PH5A 2R92G 2R93H 3B6YA 4A76A 3KF6B 5FLMH 2VS1A 1QVFA 3CCLA 3S16H 4LF5Q 3S2DH 4JI3L 3K7AH 2LXKA 2F4VQ 4HIMA 5JJIA 1P8LA 5IYDG 1NMFA 2K52A 4DUZL 4JCVE 1AE3A 4A3BG 3S1NH 1Q46A 1Q81C 1RIPA 3CD6A 1G291 1VQ4A 1A63A 1XMOL 3K80C 4JV5Q 2BA1A 2JE6I 4OXPA 3RR5A 3J81i 4A3MG 1FL0A 3S1QH 2LXJA 4DV5L 1PA6A 1VQKA 3CCEA 4JBMA 3FHWA 2D0OA 4X65Q 1MJEA 3GTQH 1TWCH 2PQAA 4J15A 3I2ZA 1N34Q 1EYGA 5FLXc 1CKMA 4A3DG 1PYBA 1U5KA 1PH9A 4GN5A 3CPFA 1FGUA 2N49A 3HOUG 4R4QA 1YEZA 4LFCQ 5IWAQ 2WAQG 1GM5A 2K75A 2WFWA 2Q2UA 3BZCA 4LF9Q 2VQFL 4C2MH 2E5LL 4A3EG 1HNZQ 1BBWA 4PZ8A 3M85A 1IBLQ 4X62L 1CUKA 1VQ5A 4JYAL 1EIFA 1WOCA 1BKBA 3UDIA 4LW1A 4HJ9A 2ASBA 1I94L 3CCUA 2NZOA 5M3FG 3M4OH 2VW9A 1PV4A 1VQNA 4JI8Q 5LMNW 4GKJQ 1MKHA 2R7ZH 3HOZH 2E2IH 3HOXH 1E1OA 4R4OA 2IX1A 1YI2A 5C4XH 1HNWQ 3HOWG 1WI5A 1XMQL 2JA5G 3KF8B 2C35B 3HKZG 3K7UC 1JE5A 3HFZB 4UP9A 1X3GA 4BA1I 4DUYL 2N78A 4KI0A 4HIDA 1V43A 4DV4Q 1R9TH 2IX0A 4HIOA 2E2JH 4YWKA 1XTDA 1GKHA 1ASYA 4UY8C 4IFDG 4BA2I 4PZ7A 5C0XI 4GN3B 1NJIC 2JEAI 4R1JA 4OO1G 4DV1L 1QVGA 3PSIA 2UUAQ 2JA7G 1UE1A 2KHJA 4AQYQ 1BVSA 4DV3Q 3ICEA 3D31A 3OTOL 4JG2A 1IBKL 4DR1Q 3PUWA 3CCJA 1Y1VG 4AYBE 1VQ9A 4JOIC 1SR3A 4GOPC 4HJ5A 2Q2IA 3RNUA 1VQ7A 3J7A5 1T9HA 3HOUH 3PF4A 1SRUA 1V9PA 4BY7G 4DR6L 1C0AA 2MNAA 4NXMQ 3KJPA 4NB3A 2CCZA 3GTMH 4KLKA 1EWIA 3S1RH 1QZHA 1PH1A 1HR0L 1SFOH 5IYBH 5K36G 3KLWA 4P72A 5FJ8H 2B29A 3MXNB 4A3CG 3PO3H 2K14A 4DV0L 1KAWA 2R6GA 3VDYA 4JC0A 1I50H 1VQBA 4KHZA 4LUZA 3H3VH 1NBWA 3J81c 3G4SA 1SMXA 3I4OA 3H0GG 3RZOH 5HGQA 3T1HL 1QZGA 4BBSH 4DK3C 1VS0A 1UWVA 2HIVA 4DR7L 3RN2A 4APVA 1VQOA 4JI6Q 3CW2C 3HKSA 1VQCA 4A3IH 2ZJQA 3TS2A 1VQHA 2K5VA 5IP9G 4A3GH 4LFAQ 4UP7A 1CKOA 2OTLA 4BXXG 3Q8DA 4GOPB 2OTJA 1Q8KA 2JA6G 1WCMH 4KHPQ 1X9NA 1VQIA 4B3MQ 3CCVA 3T1YL 1IYJB 1TWFH 1HZBA 4PMWA 3STBD 2VL6A 4DKAC 5LMUQ 4B3TQ 3PF5A 1A0IA 2WB1E 2UU9L 3G71A 1E3PA 1C7YA 3GD7A 2VY3A 2GVAA 2K5HA 3CCMA 2VQEL 1LUZA 3GTKH 1HNXL 2R92H 4DV6Q 4IPHA 2UXCL 3PO2G 1HH2P 1Y14B 2F52A 2PMZE 4A3KG 1XNQQ 2Q2HA 2QEXA 3RLFA 2E2HH 1M90C 1K8GA 5C3EG 3ER0A 4R4IA 1VQDA 1DGSA 5LMNL 3KFUA 4LFBL 2VUMG 4X64L 1HR0W 4B3RQ 5IYDH 2XGTA 4HJ7A 4DR5Q 1OTCA 4A3BH 5H1SE 3BU2A 1QUQA 2GN5A 3EBEA 1N36Q 1VQFA 4A3MH 3CQZH 4JI4Q 4GLAC 4DR4Q 2OWOA 4GKKL 2VNUD 3EIVA 2IT1A 3F2BA 3G48A 4DV6L 5C4JH 3CMAA 1EQQA 4DV7Q 1NY4A 1LYLA 4YWLA 3U4VA 2A19A 2ID0A 1PHJA 1X65A 4A3DH 1AE2A 4AH6A 1JT8A 1C9OA 1WYDA 2ZTDA 3A5ZB 1I5FA 3CP0A 4DR2Q 1Y1WG 4LWCA 4BBRG 5BR8Q 2ZM6Q 1IBMQ 4LF5L 4B3RL 4IFDJ 1JJCB 4DR5L 2NVYH 4OX9Q 1JJGA 1BBUA 1LM0A 4EX5A 1YHQA 2F4VL 3PUZA 4ALPA 4O0AA 1N33Q 2I5HA 4A3EH 3RLNA 3E9HA 4MNOA 1CKNA 1Z47A 2D0PA 4HIKA 1D7QA 4XTCS 2HIXA 2BH2A 1VQAA 1YHAA 2JK8A 3M9BA 2I5LX 4QIWE 4JV5L 3PUVA 4C3HH 5GAHC 4LF7Q 1VQJA 3AYHB 2UUCQ 5JJLA 4RG1A 1NE3A 3GO5A 3ZJYC 4PZ6A 5M3MH 4X65L 5M3FH 3U58A 3GTGH 4X66Q 3H15A 1N34L 4L5TA 1FJGQ 1K8AC 1X55A 4JI1Q 3PCOB 4XIGS 4QL5A 4X6AH 2D62A 4A3FG 1WJJA 3U4ZA 4A93H 4OX9L 4LFCL 2JA5H 3CAMA 5IWAL 4JBJA 3JAMc 3K8AA 4YCUA 2BH8A 2RCNA 1P16A 1TWGH 2Z0SA 2HQLA 4LF9L 4OO1I 2B63H 1MJCA 3W1GA 1HNZL 1IBLL 3KOJA 5IYCG 4LF6Q 2UUBQ 4TQUS 4DV2Q 2AKWB 3OYYA 5J3BA 1PH6A 2UUCL 2JA7H 1PVOA 4YHHQ 5IY0A 3CXCA 1J5EQ 5IT9c 2JA8G 5JEAJ 1W3SA 5IP7G 1KD1C 4JBWA 1WFQA 2LSSA 4JI1L 1PFSA 2AWNA 3L0OA 2F3IA 1Q82C 2ZTCA 1EFWA 1RL2A 4JI8L 4GKJL 1SLJA 2NN6I 4FDBA 1E24A 1YHBA 1UE5A 5M5WH 4GNXA 1HNWL 2R7ZG 2GVBA 2YYZA 2ATWA 4LF8Q 3ULJA 2H5XA 2JEBI 5AJ3Q 4WJ4A 4LUOA 4POGA 1OXUA 1LTLA 5C4XG 4A3CH 4DV4L 1JJ2A 1YBYA 4JI7Q 4LF4Q 3I4MG 3KDFA 1TWHH 4IO9A 3W5OA 3H3VI 5ELNA 3TRZA 2Q2TA 4NXNQ 2OCEA 2HHHQ 1VQ6A 1KQSA 1H95A 3H0GH 2HT1A 3A0JA 4ME3A 4JBKA 2UUAL 3FKIG 4IPDA 4AQYL 4DV3L 3TQYA 1E7ZA 2N8NA 4HJ8A 2IHEA 4DR1L 4BY1G 4OONA 1K9MC 4JI2Q 2N3SA 5IP9H 3S15H 5C44G 4BXXH 1N32Q 2R7FA 4R4CA 1KC8C 4NXML 4K0KQ 1XNRQ 4YCVA 4OWTB 2JA6H 2UXBQ 3M7NA 1W2BA 5JEAG 3HOYG 3CCQA 4HJAA 3GTLH 1UEBA 4YY3Q 5M5YH 3RLOA 3PUYA 4IOCA 2Z6KA 3I4NH 3J7ZC 5FJ8G 3UDXA 1U0LA 4GN4B 4DK6C 1PH8A 3A5UA 3PO2H 4A3KH 3TS0A 2Y0SG 1KXLA 2ALYB 2RHQB 1M1KC 2L15A 3GTJH 3F2DA 3HOVG 5C3EH 3M4PA 4IOAA 4JI6L 1B7YB 2EXDA 5JJKA 3LGJA 1EQRA 1GVPA 1QUQB 3EN2A 3S17H 2I5MX 3UE0A 4LFAL 3F2CA 1IL2A 1KHIA 3GTOH 3GTPH 2V1CC 2RF4A 3CMEA 3E0EA 3AEVA 4KHPL 4B3ML 4JI3Q 3I7FA 4Y52H 2A1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJL A;  1S40 A;  5LMU L;  1Z9F A;  4B3T L;  4DUZ Q;  1TXY A;  4OWW B;  4A3J G;  1L1O A;  2PQA B;  1XMO Q;  2NVX H;  2WB1 G;  4AIM A;  3RZD H;  4A3L G;  3D0F A;  1HZC A;  1SRO A;  1Q1E A;  4DV5 Q;  4P75 A;  3UDG A;  5GQO A;  1XNQ L;  1Y1W H;  2ZTE A;  4BBR H;  4WJ3 M;  1VQP A;  4L5R C;  2IY5 B;  2RHS B;  3I55 A;  3J80 i;  1CKN B;  2R93 G;  1B70 B;  2WAQ E;  2NZH A;  3UE1 A;  1N9W A;  5FLM G;  4B3S Q;  1AH9 A;  2IHF A;  2K4K A;  4IJH A;  4C3J H;  2KCM A;  4A4I A;  1NMG A;  3KF6 A;  4YWM A;  2JJQ A;  2KHI A;  1L0W A;  2AWO A;  3RN5 A;  1N36 L;  2QGQ A;  4JI4 L;  2VQF Q;  2K5N A;  4LNQ A;  2K50 A;  2E5L Q;  4DR4 L;  1A8V A;  2VZA A;  4L5S A;  4BY7 H;  4GNX C;  4X62 Q;  1G51 A;  2AHO B;  3S24 A;  1UE7 A;  4DV7 L;  4QY7 A;  2YTX A;  4UP8 A;  4DNI A;  1K73 C;  2E8G A;  3A74 A;  4JYA Q;  1HJP A;  1OXS C;  1IZ6 A;  4P74 A;  4A3F H;  1I94 Q;  4DR2 L;  1IXR A;  1VQG A;  2OQ0 A;  1K3R A;  3BZK A;  4GLV B;  1KRT A;  2JA9 A;  1Q7Y C;  3F1Z A;  1VQL A;  5BR8 L;  2ZM6 L;  5ELO A;  1IBM L;  1VQ8 A;  1K83 H;  2MO0 A;  4B3S L;  1PH2 A;  1KRS A;  3HOW H;  1N33 L;  3HKZ E;  4IFD I;  5IYC H;  2CFM A;  1XMQ Q;  3CC2 A;  3CCR A;  1N8R C;  1JMC A;  4DUY Q;  2PI2 E;  2YTV A;  5C0X J;  2ES2 A;  2DUD A;  3K0X A;  3DLL A;  2JA8 H;  5IP7 H;  4LF7 L;  3NEM A;  4QQB X;  1ASZ A;  3AFP A;  3ULL A;  2QA4 A;  2XTI A;  4X66 L;  4EQ5 A;  3CPW A;  4DV1 Q;  4O2D A;  3GDE A;  4GNX B;  1Y1V H;  1FJG L;  1OXT A;  5M3M G;  2BA0 A;  4QGU A;  4PG3 A;  2FXQ A;  5GRO A;  1YZ6 A;  3CC7 A;  3OTO Q;  2KEN A;  1IBK Q;  4NPS A;  2Z6K C;  5E7N A;  3J81 j;  2MQH A;  1X56 A;  3PGZ A;  4UPA A;  2EIF A;  1X3E A;  2CQO A;  4DR6 Q;  3KDF B;  1E1T A;  4A93 G;  1KIX A;  1X6O A;  2PI2 A;  4GLX A;  4IPG A;  3U50 C;  4YCW A;  3HOZ G;  1TWA H;  3I4M H;  3HOX G;  3L7Z C;  3K81 C;  4DR3 Q;  1HR0 Q;  4LF6 L;  2DGY A;  2UUB L;  3PIO A;  4DV2 L;  2A8V A;  2B63 G;  3TEH B;  1S3O A;  4H02 A;  3PIP A;  2NVQ H;  4MZ9 A;  3FKI H;  4TVA B;  3S14 H;  4L5Q A;  2YTY A;  4YHH L;  3WWV A;  1J5E L;  4DV0 Q;  1VCI A;  1B8A A;  1SE8 A;  4BY1 H;  1OXV A;  2KBN A;  4JI5 Q;  3SGI A;  1G6P A;  4P73 A;  3TRE A;  1Q1B A;  3W1B A;  4IPC A;  3M3Y H;  5C44 H;  3T1H Q;  1D8L A;  4RMF A;  5GAD C;  1EIY B;  3FP9 A;  1CSQ A;  2PNH A;  4Y7N H;  1OXX K;  2MFI A;  5C0X G;  4DR7 Q;  1L1O C;  4AYB G;  3J80 c;  1EUJ A;  4DPG A;  3HOY H;  3NEN A;  3MEF A;  2UXD Q;  2EQS A;  4LF8 L;  4BBS G;  1YIT A;  3KYH C;  5AJ3 L;  1PH3 A;  2MO1 A;  2NN6 G;  4P71 A;  4POF A;  3L2P A;  2CKZ B;  4DR3 L;  1KL9 A;  1PH4 A;  4QJF A;  3UDF A;  4JI7 L;  1O7I A;  4LF4 L;  3AQQ A;  1J6Q A;  1YJ9 A;  3ERS X;  3T1Y Q;  1MIU A;  3JC6 6;  4NXN L;  1I3Q H;  3E9I A;  2HHH L;  5IYB G;  1X3F A;  4MTN A;  1QVC A;  1XPR A;  2Y0S E;  1YIJ A;  4JI5 L;  1X54 A;  2UU9 Q;  4A75 A;  2YV5 A;  3F8T A;  3PO3 G;  4JI0 Q;  1YJN A;  1PH7 A;  3OW2 A;  1L2F A;  2B3G A;  1HZA A;  3HOV H;  5M5X H;  2VQE Q;  4LUV A;  1YNX A;  1HNX Q;  1K0R A;  4R4T A;  4JI2 L;  2JQO A;  1SN8 A;  2UXC Q;  1S72 A;  1VQE A;  1HZ9 A;  1Q12 A;  2AMC B;  1N32 L;  3IRB A;  3NEL A;  3PUX A;  4K0K L;  1XPU A;  1I6H H;  1XNR L;  2UXD L;  3M4Q A;  3JAM i;  3KJO A;  3PV0 A;  3S1M H;  1GD7 A;  5DLQ E;  3CF5 A;  2VUM H;  2UXB L;  3I56 A;  1NTG A;  1UE6 A;  1FVI A;  4C3I H;  3CCS A;  1E22 A;  3NBH B;  5LMN Q;  4A3I G;  1Q86 C;  1L1O B;  4LFB Q;  3STB C;  5GAG C;  5EAY A;  4X64 Q;  4YY3 L;  2YU9 H;  4A3G G;  3S2H H;  1YJW A;  1CSP A;  1V1Q A;  4A3J H;  1WCM G;  1YVC A;  2CWA A;  2CWP A;  5GAE C;  4JOI A;  4GS3 A;  2ZJP A;  4GOP A;  3G6E A;  3ULP A;  4DAM A;  4A3L H;  2WP8 J;  1XJV A;  3CC4 A;  3DM3 A;  4JI0 L;  4OWX B;  3I4N G;  3BJU A;  1PYS B;  4GKK Q;  1EOV A;  1XPO A;  2I0Q A;  3AFQ A;  1VQM A;  5HY6 A;  1JB7 A;  2OQK A;  2ZJR A;  1GO3 E;  1A62 A;  2KCT A;  5IE8 A;  4DAY B;  2R7D A;  2NVT H;  1PH5 A;  2R92 G;  2R93 H;  3B6Y A;  4A76 A;  3KF6 B;  5FLM H;  2VS1 A;  1QVF A;  3CCL A;  3S16 H;  4LF5 Q;  3S2D H;  4JI3 L;  3K7A H;  2LXK A;  2F4V Q;  4HIM A;  5JJI A;  1P8L A;  5IYD G;  1NMF A;  2K52 A;  4DUZ L;  4JCV E;  1AE3 A;  4A3B G;  3S1N H;  1Q46 A;  1Q81 C;  1RIP A;  3CD6 A;  1G29 1;  1VQ4 A;  1A63 A;  1XMO L;  3K80 C;  4JV5 Q;  2BA1 A;  2JE6 I;  4OXP A;  3RR5 A;  3J81 i;  4A3M G;  1FL0 A;  3S1Q H;  2LXJ A;  4DV5 L;  1PA6 A;  1VQK A;  3CCE A;  4JBM A;  3FHW A;  2D0O A;  4X65 Q;  1MJE A;  3GTQ H;  1TWC H;  2PQA A;  4J15 A;  3I2Z A;  1N34 Q;  1EYG A;  5FLX c;  1CKM A;  4A3D G;  1PYB A;  1U5K A;  1PH9 A;  4GN5 A;  3CPF A;  1FGU A;  2N49 A;  3HOU G;  4R4Q A;  1YEZ A;  4LFC Q;  5IWA Q;  2WAQ G;  1GM5 A;  2K75 A;  2WFW A;  2Q2U A;  3BZC A;  4LF9 Q;  2VQF L;  4C2M H;  2E5L L;  4A3E G;  1HNZ Q;  1BBW A;  4PZ8 A;  3M85 A;  1IBL Q;  4X62 L;  1CUK A;  1VQ5 A;  4JYA L;  1EIF A;  1WOC A;  1BKB A;  3UDI A;  4LW1 A;  4HJ9 A;  2ASB A;  1I94 L;  3CCU A;  2NZO A;  5M3F G;  3M4O H;  2VW9 A;  1PV4 A;  1VQN A;  4JI8 Q;  5LMN W;  4GKJ Q;  1MKH A;  2R7Z H;  3HOZ H;  2E2I H;  3HOX H;  1E1O A;  4R4O A;  2IX1 A;  1YI2 A;  5C4X H;  1HNW Q;  3HOW G;  1WI5 A;  1XMQ L;  2JA5 G;  3KF8 B;  2C35 B;  3HKZ G;  3K7U C;  1JE5 A;  3HFZ B;  4UP9 A;  1X3G A;  4BA1 I;  4DUY L;  2N78 A;  4KI0 A;  4HID A;  1V43 A;  4DV4 Q;  1R9T H;  2IX0 A;  4HIO A;  2E2J H;  4YWK A;  1XTD A;  1GKH A;  1ASY A;  4UY8 C;  4IFD G;  4BA2 I;  4PZ7 A;  5C0X I;  4GN3 B;  1NJI C;  2JEA I;  4R1J A;  4OO1 G;  4DV1 L;  1QVG A;  3PSI A;  2UUA Q;  2JA7 G;  1UE1 A;  2KHJ A;  4AQY Q;  1BVS A;  4DV3 Q;  3ICE A;  3D31 A;  3OTO L;  4JG2 A;  1IBK L;  4DR1 Q;  3PUW A;  3CCJ A;  1Y1V G;  4AYB E;  1VQ9 A;  4JOI C;  1SR3 A;  4GOP C;  4HJ5 A;  2Q2I A;  3RNU A;  1VQ7 A;  3J7A 5;  1T9H A;  3HOU H;  3PF4 A;  1SRU A;  1V9P A;  4BY7 G;  4DR6 L;  1C0A A;  2MNA A;  4NXM Q;  3KJP A;  4NB3 A;  2CCZ A;  3GTM H;  4KLK A;  1EWI A;  3S1R H;  1QZH A;  1PH1 A;  1HR0 L;  1SFO H;  5IYB H;  5K36 G;  3KLW A;  4P72 A;  5FJ8 H;  2B29 A;  3MXN B;  4A3C G;  3PO3 H;  2K14 A;  4DV0 L;  1KAW A;  2R6G A;  3VDY A;  4JC0 A;  1I50 H;  1VQB A;  4KHZ A;  4LUZ A;  3H3V H;  1NBW A;  3J81 c;  3G4S A;  1SMX A;  3I4O A;  3H0G G;  3RZO H;  5HGQ A;  3T1H L;  1QZG A;  4BBS H;  4DK3 C;  1VS0 A;  1UWV A;  2HIV A;  4DR7 L;  3RN2 A;  4APV A;  1VQO A;  4JI6 Q;  3CW2 C;  3HKS A;  1VQC A;  4A3I H;  2ZJQ A;  3TS2 A;  1VQH A;  2K5V A;  5IP9 G;  4A3G H;  4LFA Q;  4UP7 A;  1CKO A;  2OTL A;  4BXX G;  3Q8D A;  4GOP B;  2OTJ A;  1Q8K A;  2JA6 G;  1WCM H;  4KHP Q;  1X9N A;  1VQI A;  4B3M Q;  3CCV A;  3T1Y L;  1IYJ B;  1TWF H;  1HZB A;  4PMW A;  3STB D;  2VL6 A;  4DKA C;  5LMU Q;  4B3T Q;  3PF5 A;  1A0I A;  2WB1 E;  2UU9 L;  3G71 A;  1E3P A;  1C7Y A;  3GD7 A;  2VY3 A;  2GVA A;  2K5H A;  3CCM A;  2VQE L;  1LUZ A;  3GTK H;  1HNX L;  2R92 H;  4DV6 Q;  4IPH A;  2UXC L;  3PO2 G;  1HH2 P;  1Y14 B;  2F52 A;  2PMZ E;  4A3K G;  1XNQ Q;  2Q2H A;  2QEX A;  3RLF A;  2E2H H;  1M90 C;  1K8G A;  5C3E G;  3ER0 A;  4R4I A;  1VQD A;  1DGS A;  5LMN L;  3KFU A;  4LFB L;  2VUM G;  4X64 L;  1HR0 W;  4B3R Q;  5IYD H;  2XGT A;  4HJ7 A;  4DR5 Q;  1OTC A;  4A3B H;  5H1S E;  3BU2 A;  1QUQ A;  2GN5 A;  3EBE A;  1N36 Q;  1VQF A;  4A3M H;  3CQZ H;  4JI4 Q;  4GLA C;  4DR4 Q;  2OWO A;  4GKK L;  2VNU D;  3EIV A;  2IT1 A;  3F2B A;  3G48 A;  4DV6 L;  5C4J H;  3CMA A;  1EQQ A;  4DV7 Q;  1NY4 A;  1LYL A;  4YWL A;  3U4V A;  2A19 A;  2ID0 A;  1PHJ A;  1X65 A;  4A3D H;  1AE2 A;  4AH6 A;  1JT8 A;  1C9O A;  1WYD A;  2ZTD A;  3A5Z B;  1I5F A;  3CP0 A;  4DR2 Q;  1Y1W G;  4LWC A;  4BBR G;  5BR8 Q;  2ZM6 Q;  1IBM Q;  4LF5 L;  4B3R L;  4IFD J;  1JJC B;  4DR5 L;  2NVY H;  4OX9 Q;  1JJG A;  1BBU A;  1LM0 A;  4EX5 A;  1YHQ A;  2F4V L;  3PUZ A;  4ALP A;  4O0A A;  1N33 Q;  2I5H A;  4A3E H;  3RLN A;  3E9H A;  4MNO A;  1CKN A;  1Z47 A;  2D0P A;  4HIK A;  1D7Q A;  4XTC S;  2HIX A;  2BH2 A;  1VQA A;  1YHA A;  2JK8 A;  3M9B A;  2I5L X;  4QIW E;  4JV5 L;  3PUV A;  4C3H H;  5GAH C;  4LF7 Q;  1VQJ A;  3AYH B;  2UUC Q;  5JJL A;  4RG1 A;  1NE3 A;  3GO5 A;  3ZJY C;  4PZ6 A;  5M3M H;  4X65 L;  5M3F H;  3U58 A;  3GTG H;  4X66 Q;  3H15 A;  1N34 L;  4L5T A;  1FJG Q;  1K8A C;  1X55 A;  4JI1 Q;  3PCO B;  4XIG S;  4QL5 A;  4X6A H;  2D62 A;  4A3F G;  1WJJ A;  3U4Z A;  4A93 H;  4OX9 L;  4LFC L;  2JA5 H;  3CAM A;  5IWA L;  4JBJ A;  3JAM c;  3K8A A;  4YCU A;  2BH8 A;  2RCN A;  1P16 A;  1TWG H;  2Z0S A;  2HQL A;  4LF9 L;  4OO1 I;  2B63 H;  1MJC A;  3W1G A;  1HNZ L;  1IBL L;  3KOJ A;  5IYC G;  4LF6 Q;  2UUB Q;  4TQU S;  4DV2 Q;  2AKW B;  3OYY A;  5J3B A;  1PH6 A;  2UUC L;  2JA7 H;  1PVO A;  4YHH Q;  5IY0 A;  3CXC A;  1J5E Q;  5IT9 c;  2JA8 G;  5JEA J;  1W3S A;  5IP7 G;  1KD1 C;  4JBW A;  1WFQ A;  2LSS A;  4JI1 L;  1PFS A;  2AWN A;  3L0O A;  2F3I A;  1Q82 C;  2ZTC A;  1EFW A;  1RL2 A;  4JI8 L;  4GKJ L;  1SLJ A;  2NN6 I;  4FDB A;  1E24 A;  1YHB A;  1UE5 A;  5M5W H;  4GNX A;  1HNW L;  2R7Z G;  2GVB A;  2YYZ A;  2ATW A;  4LF8 Q;  3ULJ A;  2H5X A;  2JEB I;  5AJ3 Q;  4WJ4 A;  4LUO A;  4POG A;  1OXU A;  1LTL A;  5C4X G;  4A3C H;  4DV4 L;  1JJ2 A;  1YBY A;  4JI7 Q;  4LF4 Q;  3I4M G;  3KDF A;  1TWH H;  4IO9 A;  3W5O A;  3H3V I;  5ELN A;  3TRZ A;  2Q2T A;  4NXN Q;  2OCE A;  2HHH Q;  1VQ6 A;  1KQS A;  1H95 A;  3H0G H;  2HT1 A;  3A0J A;  4ME3 A;  4JBK A;  2UUA L;  3FKI G;  4IPD A;  4AQY L;  4DV3 L;  3TQY A;  1E7Z A;  2N8N A;  4HJ8 A;  2IHE A;  4DR1 L;  4BY1 G;  4OON A;  1K9M C;  4JI2 Q;  2N3S A;  5IP9 H;  3S15 H;  5C44 G;  4BXX H;  1N32 Q;  2R7F A;  4R4C A;  1KC8 C;  4NXM L;  4K0K Q;  1XNR Q;  4YCV A;  4OWT B;  2JA6 H;  2UXB Q;  3M7N A;  1W2B A;  5JEA G;  3HOY G;  3CCQ A;  4HJA A;  3GTL H;  1UEB A;  4YY3 Q;  5M5Y H;  3RLO A;  3PUY A;  4IOC A;  2Z6K A;  3I4N H;  3J7Z C;  5FJ8 G;  3UDX A;  1U0L A;  4GN4 B;  4DK6 C;  1PH8 A;  3A5U A;  3PO2 H;  4A3K H;  3TS0 A;  2Y0S G;  1KXL A;  2ALY B;  2RHQ B;  1M1K C;  2L15 A;  3GTJ H;  3F2D A;  3HOV G;  5C3E H;  3M4P A;  4IOA A;  4JI6 L;  1B7Y B;  2EXD A;  5JJK A;  3LGJ A;  1EQR A;  1GVP A;  1QUQ B;  3EN2 A;  3S17 H;  2I5M X;  3UE0 A;  4LFA L;  3F2C A;  1IL2 A;  1KHI A;  3GTO H;  3GTP H;  2V1C C;  2RF4 A;  3CME A;  3E0E A;  3AEV A;  4KHP L;  4B3M L;  4JI3 Q;  3I7F A;  4Y52 H;  2A1A A; 
#chains in the Genus database with same CATH topology
 2CVR A;  4IJL A;  1S40 A;  1Z9F A;  2L1B A;  4B3T L;  2F0W A;  3G6J B;  1L1O A;  4L8J A;  2PQA B;  2NVX H;  4A3L G;  3K0Y A;  3K59 A;  1HZC A;  2I07 B;  3UI2 A;  1PTO C;  1SE3 A;  1Y1W H;  4KN4 C;  4BBR H;  2F0T A;  4M8A A;  4RAU C;  4JW0 A;  4A3M B;  4L5R C;  2WV6 D;  3J80 i;  4XQJ A;  1BNZ A;  2NZH A;  3UE1 A;  4C3J H;  2F0L A;  4A4I A;  1NMG A;  4YWM A;  1L0W A;  1IHZ A;  1PLF A;  2A5H A;  2JXM B;  4GNX C;  4HCS A;  3TME A;  2YTX A;  4UP8 A;  1K73 C;  2PW5 A;  4K5W A;  2XWJ B;  1OXS C;  3QOJ A;  4RGM A;  4A3F H;  1VQG A;  3BZK A;  1FYC A;  1K3R A;  1KRT A;  3TN2 A;  5ELO A;  5EGT A;  1PH2 A;  5TSS A;  5IYC H;  1E0B A;  1XMQ Q;  1F2M A;  1JMC A;  1EOT A;  4A93 B;  3K0X A;  3DLL A;  2JA8 H;  4KKT A;  2K5D A;  3AFP A;  3ULL A;  5BN4 A;  1RTO A;  2XTI A;  3CPW A;  3GDE A;  2A6E C;  2PZW A;  1FJG L;  1HRJ A;  2FXQ A;  2DJG C;  1Q8I A;  3OTO Q;  2KEN A;  2JA7 B;  1EZ6 A;  5ELE A;  3KDF B;  1TY2 A;  1U4P A;  3MXU A;  1F2Z A;  1CHQ D;  4HMI A;  3U50 C;  2FMC A;  1I4P A;  2EOT A;  2CW0 D;  3K81 C;  4DR3 Q;  4LF6 L;  5DM7 3;  1HA5 A;  1HCZ A;  4H02 A;  3S14 H;  2PCF B;  4TVA B;  3WWV A;  4OHJ A;  4ZK9 B;  1J5E L;  3VYR A;  1VCI A;  1B8A A;  3SGI A;  1FGB D;  4NW2 A;  4P73 A;  5I6Y A;  3I72 A;  3VR6 A;  3W1B A;  5C44 H;  3T1H Q;  2DY8 A;  1CSQ A;  4RGO S;  4AYB G;  1EUJ A;  4HMJ A;  3MEF A;  1B9N A;  1YIT A;  3D6C A;  2NN6 G;  3L2P A;  3J81 E;  4LF4 L;  3S15 B;  1J6Q A;  4KY7 A;  1TII D;  4NXN L;  5KIX A;  2NUC A;  3T13 A;  2PPB C;  2B2W C;  1XPR A;  2UU9 Q;  4JI5 L;  1X54 A;  4A75 A;  2YV5 A;  3Q23 A;  1YJN A;  3HOV H;  1HZA A;  1CT1 D;  1BCP B;  4R4T A;  5JJZ A;  4JI2 L;  1KDA A;  2UXC Q;  1C48 A;  2AMC B;  1EY4 A;  1MGS A;  3M4Q A;  3PV0 A;  1O78 A;  4N8X 1;  2VUM H;  3I56 A;  4CBV A;  3CCS A;  1WTW A;  3J7A F;  1E22 A;  2RKS A;  5LMN Q;  2F0K A;  2R92 B;  4CKE A;  1NSN S;  2WIN B;  5GAG C;  4YY3 L;  3OWF A;  3WDN A;  2YU9 H;  3S2H H;  3HEJ A;  1V1Q A;  1YVC A;  3K5L A;  2CWA A;  2F0U A;  1JCK B;  3S17 B;  1QG7 A;  3MTS A;  4DAM A;  4JI0 L;  4OWX B;  1EZ8 A;  3N52 A;  1XPO A;  4A3B B;  4FF2 A;  3DXJ C;  1PH5 A;  2R93 H;  1LTI D;  3B6Y A;  4A76 A;  2XSC A;  1SE2 A;  3KF6 B;  3PMF A;  4H0L C;  1ZXT A;  1GUO A;  3IAY A;  4JPB W;  4JI3 L;  3K7A H;  4KY5 A;  1CA6 A;  1LT3 D;  4DUZ L;  1CZG A;  3NWT A;  1AE3 A;  1PRT F;  1VQ4 A;  3D4R A;  4IZ8 A;  2BA1 A;  3ZYY X;  4A3M G;  3RD4 A;  4JBM A;  2G9H D;  5D3D A;  3AB9 A;  1MJE A;  4J15 A;  3V96 A;  2EJM A;  2IL8 A;  2KOL A;  4GN5 A;  3GV3 A;  3HOU G;  4R4Q A;  1D1K A;  1YEZ A;  3ERQ A;  4RHR A;  2BE5 C;  4S3S A;  2A69 C;  2DN8 A;  1EY5 A;  1H9K A;  4LF9 Q;  2VQF L;  2E5L L;  1DCZ A;  2Q8R E;  5G3L F;  4J1M A;  1Q3L A;  1VQ5 A;  1WTQ A;  2K03 A;  3NBI A;  1WD0 A;  2M00 A;  1I94 L;  3ERO A;  4ABN A;  1M4V A;  5M3F G;  2VW9 A;  1PV4 A;  3OPO A;  4JI8 Q;  5LMN W;  4K2K A;  1KLU D;  4UAI A;  3HOX H;  2IX1 A;  5C4X H;  1HNW Q;  1STH A;  3R3O A;  3KF8 B;  5IT9 E;  1C4Q A;  2F0J A;  1HFG A;  3HFZ B;  3K7U C;  4J6H A;  4UP9 A;  4DUY L;  4KI0 A;  1DXM A;  1V43 A;  2IX0 A;  3TP5 A;  1XTD A;  3PQI A;  4IFD G;  4BA2 I;  2JN4 A;  3C1E A;  1HPC A;  3PSI A;  1MI2 A;  2UUA Q;  2JA7 G;  4G57 A;  1BVS A;  3ICE A;  1BCP D;  4Q5V A;  1BOS A;  3D31 A;  2NVQ B;  1IBK L;  2L9H A;  2K5W A;  4GOP C;  4HJ5 A;  4BBS H;  1S5B D;  1SRU A;  5EPL A;  4PQX A;  2CCZ A;  4NXM Q;  4B9X A;  3S1R H;  1QZH A;  1PH1 A;  1SJE D;  1TU2 B;  1HR0 L;  5IGG A;  4H44 C;  4FF4 A;  2Z9H A;  3PO3 H;  2K14 A;  1KAW A;  3VDY A;  1VQB A;  4LUZ A;  1NBW A;  3I4O A;  3H0G G;  2O4X A;  4DK3 C;  3URY A;  2RCF A;  1EL0 A;  3R2I A;  4JI6 Q;  3M4Y A;  2XIW A;  4IAL A;  2K5V A;  4LFA Q;  4BXX G;  2X6L A;  5FO7 B;  3Q8D A;  1B3A A;  3SR1 A;  4KHP Q;  1ET6 A;  3T1Y L;  1U4M A;  4PMW A;  4B3T Q;  1Y69 U;  1A0I A;  4KHV A;  3PIP 3;  1S5F D;  2GVA A;  2K5H A;  1WTV A;  3GTK H;  1GUW A;  2R92 H;  4QCL A;  1X32 A;  1SBB B;  4K14 A;  1HH2 P;  2PMZ E;  3NSW A;  4DGZ A;  2HUG A;  3RLF A;  3OHX C;  1K8G A;  5KEE A;  1PTO D;  1JB3 A;  5C3E G;  3SVM A;  1CTM A;  1VQD A;  1DGS A;  4LFB L;  1EY8 A;  3MC0 B;  4X64 L;  4RFB A;  2NVT B;  2EE1 A;  4A3B H;  2EYL A;  4RCO A;  2GN5 A;  1EYA A;  4KY6 A;  2CH4 W;  3A55 A;  4GLA C;  2EYF A;  3OOC A;  2OWO A;  5ISR A;  4R8N A;  4X3S A;  2VNU D;  2WKC A;  3F2B A;  2QKI C;  2D5D A;  2EVB A;  1NY4 A;  1PHJ A;  2A19 A;  3S9W A;  4A3D H;  3I91 A;  4AH6 A;  3S1N B;  4FXG C;  2E74 C;  1I5F A;  2Q8I B;  5HGT A;  1WTX A;  1TKW B;  3L3O C;  1JJC B;  4DR5 L;  2GA4 B;  5JOB A;  3VR2 A;  1YHQ A;  3DEO A;  1EEF D;  2F4V L;  2OF1 A;  4A3E H;  5DAU A;  4XTC S;  4CDF C;  4JV5 L;  4QIW E;  2FMM A;  2I5L X;  3PUV A;  4CKB A;  1G2S A;  1PTO H;  2KEE A;  5GAH C;  1OO9 B;  5T1I A;  1JIC A;  3GO5 A;  4X65 L;  1TQO A;  3H15 A;  1SNQ A;  1N34 L;  1IL8 A;  2KA7 A;  1SNP A;  1FJG Q;  2FFK B;  1I6V C;  4X6A H;  2A6E D;  1LO5 D;  5IWA L;  2EZV A;  2BH8 A;  1P16 A;  4HED A;  3W1G A;  1EYC A;  4LF6 Q;  5C6A A;  2AKW B;  4MTK A;  3OYY A;  5J3B A;  2EYP A;  2KCC A;  2ZXO A;  3CXC A;  1GUG A;  1J5E Q;  5JEA J;  5IP7 G;  3FRP B;  2J0T D;  4LK1 C;  2LSS A;  3MFG A;  4JI1 L;  1Q82 C;  3H3V C;  3L0O A;  5EJW A;  2B2U C;  2ZTC A;  2B39 A;  3FKI B;  1QB5 D;  2CHB D;  5CV5 A;  2GVB A;  2CW0 C;  3J80 L;  2ATW A;  4OEL B;  3E3X A;  4WJ4 A;  1BDO A;  1LTL A;  3RUZ A;  1PDQ A;  4A3C H;  1YBY A;  4LF4 Q;  3W5O A;  3TRZ A;  4NXN Q;  1VQ6 A;  1YNN D;  1CHP D;  4FP5 D;  4AQY L;  3TQY A;  1SFO B;  4UDU C;  3T56 B;  1SE4 A;  4OON A;  4JI2 Q;  2M2L A;  2N3S A;  5IP9 H;  4TRD A;  1I50 B;  4R4C A;  4YCV A;  2K33 A;  4QF4 A;  3RZO B;  3M7N A;  2HQE A;  5JEA G;  5C4Z A;  1STE A;  3QG1 A;  3GQB A;  5EPJ A;  2EY5 A;  4YY3 Q;  1H9S B;  1IW7 C;  3RLO A;  3PUY A;  1EFI D;  3KK7 A;  3I4N H;  3T16 A;  4QB4 A;  2PO4 A;  1PH8 A;  3A5U A;  1PMR A;  3PO2 H;  2Y0S G;  2RHQ B;  3OMC A;  3T51 B;  2L15 A;  3GTJ H;  1FNV A;  4IOA A;  2K04 A;  2Z4I A;  4K2L A;  1QUQ B;  2I5M X;  1S5D D;  2V1C C;  3BG3 A;  1EU3 A;  3AEV A;  4JI3 Q;  4Y52 H;  2A1A A;  2RVL A;  3P1H A;  4R8I A;  1JWS D;  1LTS D;  4DUZ Q;  4WFN 3;  3BVZ A;  2M9V A;  1VF7 A;  4AIM A;  3C3L A;  1SEB D;  4NDX A;  3TP6 A;  1SRO A;  3VYS A;  3UDG A;  4P75 A;  5EKL A;  4KD4 A;  2L0C A;  2AQ2 B;  3I55 A;  3P75 A;  4IUU A;  5C4J B;  2WAQ E;  2XWB B;  3J7Y W;  1SJH D;  1O80 A;  2IHF A;  4IJH A;  2WKD A;  3RN5 A;  2JJQ A;  2AWO A;  2QIL A;  2VQF Q;  4LNQ A;  1EWC A;  1MD2 D;  5C3X A;  2E5L Q;  1LV9 A;  1UE7 A;  4DV7 L;  1KDB A;  1UAP A;  4QY7 A;  2E8G A;  3F2U A;  1HJP A;  1IZ6 A;  2QEJ C;  1S5C D;  1I94 Q;  4DR2 L;  2OQ0 A;  4IUQ A;  2JA9 A;  1J9O A;  1VQL A;  1EY9 A;  1VQ8 A;  4IUR A;  4B3S L;  1KRS A;  3HOW H;  3GTG B;  1GJX A;  5JPN C;  2F0O A;  5I9P A;  2PNR C;  5IGC A;  1SYD A;  2A74 C;  4GZY C;  4UHV A;  4DUY Q;  2PI2 E;  2YTV A;  3R2T A;  2JA5 B;  2DUD A;  4LF7 L;  2K7V A;  4QQB X;  1ONL A;  4X66 L;  4EQ5 A;  1Y1V H;  2F3V A;  1ZKO A;  5M3M G;  4QGU A;  2AUK A;  2IPK D;  1IBK Q;  3A8I E;  2Z6K C;  5E7N A;  2MQH A;  1X56 A;  2A73 B;  1Q90 A;  2EIF A;  4ZKC B;  2CQO A;  4MN3 A;  2KEC A;  1U4R A;  2OT2 A;  2PI2 A;  1M8A A;  4GLX A;  1TS2 A;  3HOZ G;  1TWA H;  3L7Z C;  3TZU A;  1HR0 Q;  1HUM A;  5M5W B;  2B63 G;  3PIP A;  3FKI H;  2AQ3 B;  2YTY A;  4L5Q A;  1XYI A;  1BCP C;  1SE8 A;  3TRE A;  1IYU A;  1Q1B A;  2EY1 A;  5CV8 A;  4P2C B;  4RMF A;  3NHH A;  3FP9 A;  2HDM A;  1JOR A;  1JQY D;  4Y7N H;  1OXX K;  3CU7 A;  2Z4H A;  4DPG A;  1U9R A;  1H9M A;  4LF8 L;  4N8F A;  1NCV A;  5AJ3 L;  2MO1 A;  2CKZ B;  3UDF A;  5M9O A;  1EIH A;  2R3Z A;  1EEI D;  3T1Y Q;  4FXK C;  2JA6 B;  3E9I A;  3ND9 A;  5IYB G;  4MTN A;  5JVG 3;  1CM9 A;  2MUY A;  3VR5 A;  2F0Q A;  1PH7 A;  2B3G A;  2PYK A;  2E76 C;  5M5X H;  4LUV A;  1JOK A;  1S72 A;  4EQP A;  3NEL A;  4BS9 A;  1PXU A;  1XPU A;  2UXD L;  1FD7 D;  4KK7 A;  3SE0 A;  2UXB L;  2B2Y C;  4C3I H;  4LFB Q;  1Q86 C;  4KN7 C;  1L1O B;  4X64 Q;  3HS0 C;  1IYV A;  1CSP A;  1WCM G;  1BXT A;  1RCV D;  4OGQ C;  4JOI A;  4A3L H;  3ULP A;  2WP8 J;  3DM3 A;  3GTO B;  2B2T C;  1PYS B;  3W3A A;  2ZJR A;  2J4X A;  1A3T A;  2OXP A;  1GO3 E;  5IE8 A;  4KTA A;  5F2D A;  4DAY B;  3D3R A;  4DU9 A;  4E6I A;  3CQZ B;  2ENB A;  2VS1 A;  4WJW A;  5KNC A;  3S2D H;  4DK1 A;  2F4V Q;  1P8L A;  4ZYS A;  3HOU B;  1Q81 C;  1RIP A;  2KUM A;  1A3U A;  1G29 1;  3SDZ A;  1VMP A;  3K80 C;  1XMO L;  4JV5 Q;  2LFN A;  3TSS A;  2F0N A;  1FL0 A;  3HP3 A;  4DV5 L;  1PA6 A;  1F9S A;  1LTG D;  4HSV A;  5IOD A;  4X65 Q;  1AP0 A;  2PQA A;  1N34 Q;  4EQO A;  1CKM A;  1PH9 A;  2C5C A;  1SND A;  2LY7 A;  5IWA Q;  1MSG A;  2WAQ G;  5M3F B;  3L9A X;  2K75 A;  1FNW A;  3OW7 A;  4C3J G;  4PZ8 A;  1ILP A;  1CUK A;  2OEO A;  5JPM C;  1EIF A;  3UDI A;  4PMB A;  2RSN A;  2O5I C;  4LW1 A;  4C3H G;  1BO0 A;  2HD3 A;  3JAM E;  1SMY C;  2ASB A;  1E2V A;  2K6A A;  3VR3 A;  1LT6 D;  3KBG A;  2R7Z H;  4HN7 A;  2E2I H;  1KDC A;  1WI5 A;  2JA5 G;  3KBX A;  1R9T H;  4L6T B;  3SK4 A;  1PZI D;  2VXW A;  2XVS A;  4PZ7 A;  2F0E A;  2JEA I;  4R1J A;  4DV1 L;  1QVG A;  3X3M A;  4AQY Q;  2KCN A;  3PUW A;  4FO2 A;  1SR3 A;  3RNU A;  1GXD C;  5J1Z A;  4M1U B;  3H0G B;  1QWY A;  3CHB D;  3X3N A;  5A2Q L;  1C0A A;  3FVQ A;  3KJP A;  1EWI A;  3K6O A;  3NTI A;  3IL8 A;  4P72 A;  5FJ8 H;  1YNN C;  2RQX A;  3HOY B;  1WVL A;  4DV0 L;  2R6G A;  1IW7 D;  3H3V H;  4KHZ A;  3ONA B;  1SYB A;  1RHP A;  3J81 c;  1SMX A;  3MAQ A;  2F03 A;  1UWV A;  3WOE A;  2IX3 A;  4DR7 L;  4F87 A;  4DXF A;  2PZU A;  1VQH A;  1B50 A;  3DM1 A;  3EQL C;  1CKO A;  1QNK A;  5DEH A;  2LS0 1;  2JA6 G;  1X9N A;  2NB0 A;  2PW7 A;  5C3E B;  1CK1 A;  4XYQ A;  2FIN B;  5KRU A;  2XN9 C;  4Z9C B;  2WB1 E;  1XWE A;  5E4W C;  3CCM A;  3K58 A;  2HCC A;  4IPH A;  1XXG A;  2KED A;  4A3K G;  1Y8O B;  1M90 C;  1HTL D;  1NAP A;  3G7L A;  3U9O A;  1S5E D;  3Q0A A;  2VUM G;  5EBD A;  1EYD A;  1OTC A;  4ZLT F;  3E6Z X;  3BU2 A;  5H1S E;  4A3M H;  3CQZ H;  3S16 B;  2O2L D;  4GKK L;  2B8F A;  3G48 A;  4DV6 L;  4DV7 Q;  4YWL A;  1LYL A;  1X65 A;  4C56 C;  4OEM B;  1C9O A;  3A5Z B;  3HOU H;  4IUT A;  4DR2 Q;  4LWC A;  5FOB B;  4LF5 L;  4B3R L;  4IFD J;  1EQV A;  3V05 A;  1JJG A;  1LM0 A;  4EX5 A;  4ALP A;  4O0A A;  3RLN A;  3E9H A;  4FF1 A;  1CKN A;  3T53 B;  4G7H C;  1QNU A;  2D0P A;  4HIK A;  5FO9 B;  1NUC A;  1ILQ A;  1CFM A;  3M9B A;  1VQA A;  1K83 B;  5FO8 B;  2A68 D;  2L5T A;  1DM0 B;  4LF7 Q;  4C1N I;  2UUC Q;  5JJL A;  2DNC A;  3ZJY C;  1BF4 A;  3U58 A;  4BY7 G;  1V8Q A;  5M3F H;  4X66 Q;  4C2M B;  4L5T A;  4V19 0;  1K8A C;  1X55 A;  3NUC A;  1KNA A;  4QL5 A;  4DNT B;  3ND8 A;  5EQ0 A;  3U4Z A;  4OX9 L;  4A93 H;  1TT2 A;  3D4W A;  3CAM A;  2L11 A;  4DA2 A;  3K8A A;  1G91 A;  2Z0S A;  3A56 A;  1STA A;  1MJC A;  2WII B;  4XT3 B;  1HNZ L;  3HZX A;  1IBL L;  3NQT A;  4TQU S;  3VR4 A;  1PH6 A;  2JA7 H;  1PVO A;  3KLS A;  4C1N K;  1A2U A;  1XX8 A;  5DM6 3;  5IT9 c;  5CV4 A;  3VYT A;  1C8C A;  1QIL A;  1F9R A;  2F3I A;  1RL2 A;  1TS4 A;  1E24 A;  1UE5 A;  1AEX A;  4GNX A;  5C4H A;  4RHS A;  2SOB A;  3T4A C;  1G6Z A;  1EIG A;  4LF8 Q;  2EYH A;  5AJ3 Q;  2JEB I;  3M3Y B;  5C4X G;  1OXU A;  4NP5 A;  4DV4 L;  1JJ2 A;  3I4M G;  1D6E C;  3GTM B;  2F0F A;  3H0G H;  1BQQ T;  3A0J A;  4ME3 A;  2HT1 A;  4CDC C;  4K5X A;  1W6J A;  3J80 E;  4IPD A;  4KKS A;  2BOS A;  1E7Z A;  1NNX A;  4BY1 G;  1KAB A;  1STG A;  4ULL A;  3S15 H;  4BXX H;  2Y0S B;  5IGE A;  1KLG D;  2UXB Q;  1B9M A;  1SSO A;  4LMQ D;  3QIA A;  3Q6S A;  4F7X A;  3HOY G;  1UEB A;  1MBY A;  4DN4 M;  4EGV A;  3J7Z C;  4A3G B;  1I4H A;  2F0D A;  2B2V C;  5JVH 3;  3Q22 A;  1KXL A;  2N55 A;  5COY A;  3FPP A;  5C3E H;  3M4P A;  1EY6 A;  3LGJ A;  1EQR A;  1GVP A;  3S17 H;  3UE0 A;  1BUV T;  1IL2 A;  1KHI A;  1EQT A;  3C2P A;  2RF4 A;  3E0E A;  1JWU D;  3MZ5 A;  4B3M L;  2PMZ B;  2EDG A;  1TXY A;  1ESR A;  1X3P A;  4OWW B;  3NBH A;  4A3J G;  5D3I B;  1XMO Q;  2WB1 G;  3D0F A;  4DV5 Q;  1XNQ L;  2ZTE A;  5FKA C;  3TP7 A;  2IY5 B;  1GHK A;  4XYO A;  1LLR D;  1R4Q B;  1HFN A;  1TR5 A;  1K8O A;  1N9W A;  5FLM G;  1AH9 A;  2K4K A;  4Q0F A;  4ZRZ A;  1TWC B;  2K1B A;  4HR7 B;  2KHI A;  2MP1 A;  1YNJ D;  2K5N A;  4DR4 L;  1A8V A;  2VZA A;  1E2Z A;  3BVM A;  2NVY B;  5FLX E;  1G51 A;  2AHO B;  4L5S A;  3S24 A;  1EWH A;  1O7Z A;  3A74 A;  2QF7 A;  4QIW B;  1TVX A;  3F1Z A;  5BR8 L;  1V1P A;  2BDN A;  1SMY D;  1K83 H;  2MO0 A;  2F0H A;  4IUV A;  5M3M B;  2R61 A;  5E1F A;  2EPB A;  1TS5 A;  3HKZ E;  3AMU A;  2CFM A;  3CC2 A;  4I65 A;  3CCR A;  3M4O B;  2RSO A;  1SYC A;  4XQN A;  5COR A;  5C0X J;  1CI3 M;  5ELD A;  5IP7 H;  3HOZ B;  3NEM A;  3LX0 A;  5NUC A;  3C46 A;  3MFY A;  2H1E A;  4DV1 Q;  2B63 B;  1K8M A;  3V2T A;  3BZD B;  1YZ6 A;  3CC7 A;  1WD1 A;  1SYE A;  2E2J B;  1GOZ A;  3J81 j;  3PGZ A;  4UPA A;  3BDC A;  1QE6 A;  3KUP A;  1E1T A;  3R93 A;  2IW3 A;  1X6O A;  1KIX A;  1QCB D;  1AZP A;  2NZ1 D;  1BBX C;  3QJY A;  2UUB L;  2NVQ H;  3DMU A;  4WOR A;  2AUJ D;  1LAC A;  4YHH L;  4DV0 Q;  1Y8P B;  1CZW A;  2RDH A;  1T5E A;  3CRL C;  4XDX A;  4JI5 Q;  1BCP F;  5DNF A;  2XRS D;  3M3Y H;  1D8L A;  3I90 A;  1EIY B;  2PNH A;  4X3K A;  2MFI A;  5C0X G;  4DR7 Q;  1L1O C;  1K28 A;  5JEA H;  3NEN A;  2EQS A;  1EY7 A;  3QOL A;  1ZEQ X;  4KJN A;  1PH3 A;  3FPU B;  4DR3 L;  1KL9 A;  1PH4 A;  2F0M A;  4JI7 L;  3ERS X;  1MIU A;  4R9W A;  3NXW A;  3I3C A;  1QVC A;  1A2T A;  5CV7 A;  3W2D A;  4JI0 Q;  1WCM B;  3OW2 A;  1L2F A;  1K0S A;  4CDE C;  3MXN A;  1YNX A;  1TWF B;  1K0R A;  5ELF A;  1VQE A;  1HZ9 A;  1ENC A;  3NQI A;  1B3Q A;  1F2L A;  2CH4 A;  3PUX A;  4KMU C;  1XNR L;  1JE4 A;  4XXE A;  3JAM i;  5C5M A;  3CF5 A;  1NTG A;  1UE6 A;  1FVI A;  1B2T A;  3TZD A;  4A3I G;  1STN A;  1EU4 A;  4A3G G;  1AFP A;  2E2H B;  1SXT A;  2CWP A;  2Z6B A;  4GS3 A;  4GOP A;  3G6E A;  1D5M C;  3CC4 A;  4BWG B;  3GTP B;  3I4N G;  5C3W A;  4GKK Q;  2I0Q A;  1XTC D;  1VQM A;  5HY6 A;  1DJR D;  1JB7 A;  1D5Z C;  5BN5 A;  4XT1 B;  4JVZ A;  1A62 A;  2KCT A;  2NVT H;  1PTO F;  2KVM A;  2NVX B;  1RTN A;  1HQM C;  3CCL A;  4LF5 Q;  2A6H D;  4CKC A;  4QMG A;  3QB3 A;  4BBR B;  4RWS C;  4HIM A;  5IYD G;  2K52 A;  4JCV E;  3NWS A;  1I4Q A;  3S1N H;  1Q46 A;  2WAQ B;  4DXG A;  2JE6 I;  3J81 i;  2CQA A;  4C3J B;  1VQK A;  4CJ0 B;  3CCE A;  1Y8N B;  3K5M A;  3FHW A;  1TWC H;  4YIJ A;  1QOH A;  1EYG A;  3A54 A;  3NTK A;  1PYB A;  2ICE C;  2NTT A;  1U5K A;  2SEB D;  2K5Q A;  2Z1C A;  1FGU A;  2EJF C;  2N49 A;  4C3H B;  1SYG A;  3HGB A;  3I70 A;  1D2B A;  4A3F B;  3NPP A;  2A68 C;  3A8K E;  2B8G A;  1B4O A;  2QDB A;  1HNZ Q;  3MXP A;  1IBL Q;  4X62 L;  1PRT B;  1RF2 D;  3SEB A;  1QJO A;  4JYA L;  1BKB A;  3OWE B;  1TWG B;  2JSO A;  1I4G A;  2N88 A;  3CCU A;  3M4O H;  2RDF A;  2KQ3 A;  3VA5 A;  1MKH A;  4CJ1 B;  3BYY B;  3HOZ H;  4DFA A;  3K5O A;  3FEW X;  3KLR A;  1YI2 A;  3HOW G;  4NKL A;  1B1Z A;  3HKZ G;  3FDT A;  1JE5 A;  4BA1 I;  2DY7 A;  2N78 A;  3I73 A;  4DV4 Q;  4HIO A;  2E2J H;  1GKH A;  3I4L A;  4UY8 C;  3K57 A;  3MEH A;  1NJI C;  4OO1 G;  2EXZ A;  1UE1 A;  4TKO B;  2EY2 A;  4JG2 A;  3S14 B;  1Y1V G;  1TWH B;  4AYB E;  2EYM A;  1VQ7 A;  3J7A 5;  1T9H A;  4DR6 L;  1V9P A;  3MXG A;  4NB3 A;  4KLK A;  2MHV A;  4G4K A;  4FF3 A;  3MHB A;  1SFO H;  5IYB H;  5K36 G;  3KLW A;  5KND A;  1I50 H;  1SDF A;  3DUZ A;  4NMZ A;  1ZYR C;  3G4S A;  4V0B A;  3RZO H;  3GTL B;  1QZG A;  3GP7 A;  4IQZ A;  2HIV A;  5C5L A;  2J7Z A;  4APV A;  1VQO A;  3LNN A;  3HKS A;  1VQC A;  1PFB A;  3D4D A;  1F2Y A;  4UP7 A;  4A3K B;  1NR2 A;  2OTJ A;  1Q8K A;  1WCM H;  2ZT9 C;  2K28 A;  3H94 A;  2F0G A;  2MGS A;  4B3M Q;  3CCV A;  1TWF H;  2B2U A;  3STB D;  2VL6 A;  4DKA C;  1RKN A;  3PF5 A;  2VUM B;  3G71 A;  3PIO 3;  3N6R A;  1C7Y A;  4K8I A;  2VY3 A;  1ML0 D;  1H9J A;  2YU9 B;  3S2H B;  2VQE L;  1LUZ A;  2XRQ D;  1HNX L;  5IGD A;  1Y14 B;  1XNQ Q;  2Q2H A;  2E2H H;  3EFX D;  3CKI B;  4R4I A;  3RZD B;  3KFU A;  1ESF A;  1HR0 W;  4H7B A;  4C3I G;  4DR5 Q;  4RGN A;  2R93 B;  3DWA A;  5D65 A;  5IGF A;  1LTT D;  1VQF A;  3D8G A;  1PRT D;  1KTK A;  4DR4 Q;  4ODG A;  1JR0 D;  3EIV A;  3K7A B;  5C4J H;  2HDL A;  1L0Y B;  5CBA E;  1EQQ A;  3U4V A;  2ID0 A;  1AE2 A;  1JT8 A;  1WYD A;  2ZTD A;  1X3Q A;  1Y1W G;  4BBR G;  4BY7 B;  1AW7 A;  4MIU A;  5BR8 Q;  2JYO A;  3IKJ A;  5ELC A;  4DAY A;  3SXH A;  1YNJ C;  3PUZ A;  2K05 A;  2I5H A;  2ZXP A;  1D7Q A;  2NYZ D;  2JK8 A;  1G2T A;  1B44 D;  3LWE A;  3E5S A;  1DYQ A;  2F1M A;  3MA2 B;  4C3H H;  5G3L D;  1VQJ A;  4RG1 A;  3GTG H;  1LAB A;  2X6G A;  4JI1 Q;  3A7L A;  1DOL A;  4FNF A;  4A3F G;  3ITP A;  4LFC L;  2JA5 H;  5BN3 A;  4JBJ A;  3JAM c;  5L37 A;  2RCN A;  1TWG H;  1FR3 A;  2HQL A;  3SK8 A;  3WOF A;  1ET9 A;  4F88 A;  3SK5 A;  4LJZ C;  5IYC G;  4RA8 A;  2UUB Q;  5CMD A;  1Z6H A;  1G8Z D;  3HOX B;  1HXY D;  2K01 A;  5C4X B;  4YHH Q;  1K3B C;  4CHT B;  2JA8 G;  3I4M B;  1NR4 A;  1WFQ A;  3VA7 A;  4B08 A;  1EFW A;  4GKJ L;  1SLJ A;  2NN6 I;  1YHB A;  5I2Y A;  5M5W H;  3VYU A;  2NN6 H;  4IUN A;  4BY1 B;  2R7Z G;  3ULJ A;  2H5X A;  1D1I A;  2Q8T A;  4JI7 Q;  2BDO A;  4BBS B;  3KDF A;  1TWH H;  4IO9 A;  4X3U A;  3H3V I;  4O1N A;  2Q2T A;  1H95 A;  1S4Z A;  4JBK A;  1LT5 D;  3S1R B;  4DV3 L;  2N8N A;  4HJ8 A;  4DR1 L;  5KNB A;  3P7J A;  4N9T A;  3PO3 B;  1I3Q B;  3H91 A;  5C44 G;  2R7F A;  1KC8 C;  1XNR Q;  2JA6 H;  4KJO A;  1WTP A;  3H09 A;  3EJI A;  3CRK C;  3GTL H;  1O7Y A;  2QDL A;  3NTH A;  2XNA C;  1I6H B;  4IOC A;  2Z6K A;  4DF7 A;  3S1M B;  5FJ8 G;  5LL6 X;  1VF5 C;  4A3K H;  4DAV A;  1SNM A;  4A3J B;  3HOV G;  4RCN A;  4I7A A;  2WB1 B;  1B7Y B;  2EXD A;  5D14 A;  3DWQ A;  5CR3 A;  1UUP A;  1GUN A;  3F2C A;  3GTK B;  3GTO H;  3I8Z A;  5LHY 1;  1PFM A;  5LMU L;  5HUR A;  4G7O C;  2NWG A;  3RZD H;  2IWH A;  1F9P A;  1Q1E A;  4MHE A;  5GQO A;  4WJ3 M;  1VQP A;  2A6H C;  2RHS B;  1DOM A;  1CKN B;  2R93 G;  1B70 B;  5AFW A;  4OL7 A;  3S1Q B;  1EY0 A;  1STB A;  4B3S Q;  4A3D B;  4HTH A;  3GTQ B;  4RKL A;  2KCM A;  3KF6 A;  5J22 A;  1N36 L;  2QGQ A;  4JI4 L;  4FYD A;  2SNM A;  4FVM A;  2K50 A;  2QCP X;  3QO2 A;  4BY7 H;  4X62 Q;  2B2Y A;  4OIJ A;  3U9S A;  4DNI A;  2MPM A;  4A3E B;  4JYA Q;  3C1F A;  1RJT A;  4P74 A;  1IXR A;  4GLV B;  3DWP A;  4ZQ3 A;  1Q7Y C;  1PTO B;  2ZM6 L;  1IBM L;  4K8J A;  2B2T A;  4TSS A;  1HTP A;  1A3V A;  3JAM L;  1N33 L;  4IFD I;  1N8R C;  2D2C C;  2NTS A;  4B9W A;  4IFD H;  2ES2 A;  3IFT A;  1ASZ A;  2F3W A;  2G9D A;  2QA4 A;  4O2D A;  5EKK A;  3SHL A;  4GNX B;  1OXT A;  2BA0 A;  1TY0 A;  2EJG C;  4PG3 A;  5GRO A;  1Z7T A;  3QWN A;  4NPS A;  4CDD C;  1WTH A;  1X3E A;  4IUP A;  4DR6 Q;  4A93 G;  1LTB D;  4IPG A;  1HQR D;  1LTR D;  4YCW A;  3I4M H;  3HOX G;  2A8V A;  2DGY A;  5I4D A;  1VDZ A;  3PIO A;  4DV2 L;  3TEH B;  1S3O A;  4U67 3;  4MZ9 A;  2TSS A;  3QR8 A;  3K5N A;  3KF8 A;  2Z8L A;  1PZJ D;  4BY1 H;  1G6P A;  1OXV A;  2KBN A;  3J81 L;  4IPC A;  3OMG A;  1TS3 A;  5GAD C;  2RBM A;  1ZYR D;  5KGU A;  1IKM A;  4X3T A;  1MSH A;  1IKL A;  3J80 c;  2BCO A;  2HCI A;  3HOY H;  5IOC A;  2UXD Q;  4BBS G;  3KYH C;  4POF A;  4P71 A;  4ZKB B;  4QJF A;  1RD9 D;  1O7I A;  3AQQ A;  5J39 A;  1YJ9 A;  5CC4 A;  3JC6 6;  1I3Q H;  2LMC B;  2HHH L;  2P5Z X;  4A3I B;  1X3F A;  2Y0S E;  1YIJ A;  4DK0 A;  3F8T A;  2FJ2 A;  3PO3 G;  2VB3 X;  2D9U A;  2VQE Q;  4ILW A;  1PFN A;  2E75 C;  1HNX Q;  2EYJ A;  1SN8 A;  2JQO A;  3BVG A;  3I4N B;  1Q12 A;  4O42 A;  1N32 L;  3IRB A;  4K0K L;  1I6H H;  3KJO A;  2KJX A;  3S1M H;  1BR9 A;  1GD7 A;  5DLQ E;  3PO2 B;  3NBH B;  1D5X C;  5JJI A;  3GTJ B;  3STB C;  5EAY A;  2F0I A;  1DZ1 A;  1YJW A;  5FK9 C;  4ME5 A;  4A3J H;  5EBC A;  3LWU A;  1SNC A;  5CYU A;  1GUS A;  5GAE C;  2ZJP A;  3OIP A;  1WTO A;  1XJV A;  3BJU A;  1ICW A;  1EOV A;  3BDO A;  3AFQ A;  2OQK A;  1CA5 A;  5EKI A;  2R7D A;  4KD3 A;  2R92 G;  1A6X A;  5FLM H;  1VMC A;  5IIF A;  1QVF A;  2B2W A;  3S16 H;  4EVO A;  2G5D A;  2LXK A;  1PRT C;  4KV6 A;  1NMF A;  3MVV A;  4A3B G;  3DEP A;  5KYL A;  3CD6 A;  1A63 A;  1JWM D;  3IFD A;  4OXP A;  3RR5 A;  4HCE A;  1UEA B;  3S1Q H;  5JAV A;  2LXJ A;  1V1P B;  2JP1 A;  5KYI A;  3GTQ H;  2D0O A;  3I2Z A;  4U68 A;  2QW7 A;  5FLX c;  2F0S A;  3Q24 A;  4A3D G;  2IJ0 A;  2C9O A;  3CPF A;  2DNE A;  1T5X D;  2L55 A;  4HAE A;  2NBF A;  3BYT B;  4LFC Q;  1ENF A;  1FNU A;  3TP8 A;  1GM5 A;  5CV6 A;  2WFW A;  2Q2U A;  3BZC A;  4C2M H;  2X69 A;  2VB2 X;  4A3E G;  1BBW A;  3M85 A;  3HOW B;  5E3F A;  1L0X B;  5T1G A;  3HKZ B;  1WOC A;  1KAA A;  5IT9 L;  4HJ9 A;  4XQQ A;  2NZO A;  1V1O A;  4PV1 C;  1VQN A;  4GKJ Q;  3P20 A;  1E1O A;  4R4O A;  1MHW C;  1ROD A;  4RGT A;  1Y1V B;  2DJF C;  1WTR A;  3MWY W;  1XMQ L;  2EYO A;  1HHV A;  2C35 B;  4HID A;  1X3G A;  1B53 A;  3FMC A;  4YWK A;  2ICI A;  2K32 A;  1ASY A;  4DNR B;  5C0X I;  4GN3 B;  4F8M A;  1TWA B;  2KHJ A;  4H13 C;  4DV3 Q;  5C0X H;  3OTO L;  4DR1 Q;  3CCJ A;  1VQ9 A;  4JOI C;  2Q2I A;  3PF4 A;  2V4D A;  4K5V A;  2MNA A;  4RH6 A;  3GTM H;  1O7L A;  4LAA A;  4ZCK A;  4OIK A;  4Y7N B;  2B29 A;  3MXN B;  4A3C G;  4JC0 A;  3A8J E;  1CQF A;  3BS1 A;  4PNY A;  2MJ8 A;  2H4O A;  5HGQ A;  3T1H L;  5M5Y B;  1F77 A;  1VS0 A;  3RN2 A;  1ICF B;  3CW2 C;  3EA6 A;  4A3I H;  2ZJQ A;  3TS2 A;  3DHQ A;  5IP9 G;  5E4X A;  4A3G H;  5M5X B;  2OTL A;  4GOP B;  3OSO A;  1SYF A;  1VQI A;  1IYJ B;  4J8Q A;  1HZB A;  2E2D C;  4QUC A;  1PYW D;  5LMU Q;  2UU9 L;  5A35 A;  1E3P A;  4C3I B;  3GD7 A;  5IGB A;  5LL6 S;  1H9S A;  3TDQ A;  4DV6 Q;  2UXC L;  3PO2 G;  2F52 A;  2ZXR A;  2QEX A;  2AQ1 B;  4WRD A;  5CBE E;  4N9P A;  2EY6 A;  3ER0 A;  1SNO A;  3NP8 A;  4RKB A;  1AZQ A;  5LMN L;  1GHJ A;  5K5P A;  5I6W A;  5IYD H;  4B3R Q;  1RDP D;  2XGT A;  4HJ7 A;  1Y1W B;  1QUQ A;  3R8B A;  4KKU A;  2RDG A;  5I2X A;  3EBE A;  1N36 Q;  3BDL A;  1UNS A;  4JI4 Q;  3S2D B;  2IT1 A;  1H9R A;  3SK6 A;  3CMA A;  1E2W A;  3O13 A;  1HA6 A;  3CP0 A;  4PMC A;  2SDF A;  5FLX L;  3J7A V;  3KLS X;  2KHS A;  2ZM6 Q;  1IBM Q;  2B2V A;  4QUF A;  4ZUJ A;  1GUT A;  2NVY H;  4OX9 Q;  1BBU A;  2L4N A;  1N33 Q;  4MNO A;  2BE5 D;  2RA4 A;  4I7Z C;  1Z47 A;  2A69 D;  2HIX A;  2BH2 A;  1YHA A;  4IN3 A;  4CGY B;  4FXD A;  3D6W A;  3AYH B;  1NE3 A;  2F0V A;  5M3M H;  4PZ6 A;  4K6L A;  1JOO A;  2LKV A;  1W6K A;  1KNE A;  3HG9 A;  3PCO B;  4XIG S;  2JA8 B;  2D62 A;  1DOK A;  5I9O A;  1WJJ A;  2FHT A;  2PQE A;  2I46 A;  4YCU A;  4G7Z C;  4LF9 L;  3TBI B;  2B63 H;  4OO1 I;  2F4I A;  4EQN A;  3KOJ A;  2WAC A;  1I4X A;  2L12 A;  2R7Z B;  4DV2 Q;  4OO1 H;  2E2I B;  1PZK D;  2UUC L;  5IY0 A;  1STY A;  1W3S A;  1KD1 C;  4JBW A;  4JK1 C;  1PFS A;  2AWN A;  3M7G A;  1R9T B;  4JI8 L;  1A15 A;  4FDB A;  3EVQ A;  1ENA A;  1AN8 A;  1R4P B;  1JOQ A;  1HNW L;  3NE5 B;  2TMP A;  2YYZ A;  1CQV A;  1LTA D;  5K36 H;  5EPK A;  5C44 B;  4LUO A;  4POG A;  4AYB B;  5CGK A;  3OIQ A;  3RMH A;  5ELN A;  2OCE A;  2HHH Q;  4CJ2 C;  1KQS A;  4ID6 A;  2O5J C;  5ELB A;  2UUA L;  3FKI G;  5A2Q E;  3AU7 A;  2IHE A;  1II3 A;  1K9M C;  1N32 Q;  1J8I A;  2SNS A;  4K0K Q;  4NXM L;  4OWT B;  1DD2 A;  4K6D A;  5CV9 A;  3HOV B;  2PZT A;  1W2B A;  3CCQ A;  4HJA A;  5M5Y H;  1I4R A;  4DAP A;  1LT4 D;  3UDX A;  3HRZ C;  4ZUI A;  1U0L A;  1U4L A;  4GN4 B;  4DK6 C;  3TS0 A;  2ALY B;  2F0P A;  4HSP A;  3NK9 A;  3GV6 A;  1M1K C;  3F2D A;  4JI6 L;  3E0J A;  5JJK A;  1DON A;  1HUN A;  1JC7 A;  3EN2 A;  3H6M A;  1F9Q A;  4LFA L;  4L63 B;  4ZAI A;  3A7A B;  3GTP H;  3CME A;  4KHP L;  3I7F A;  1SAP A; 
#chains in the Genus database with same CATH homology
 4IJL A;  1S40 A;  5LMU L;  1Z9F A;  4B3T L;  4DUZ Q;  1TXY A;  4OWW B;  4A3J G;  1L1O A;  2PQA B;  1XMO Q;  2NVX H;  2WB1 G;  4AIM A;  3RZD H;  4A3L G;  3D0F A;  1HZC A;  1SRO A;  1Q1E A;  4DV5 Q;  4P75 A;  3UDG A;  5GQO A;  1XNQ L;  1Y1W H;  2ZTE A;  4BBR H;  4WJ3 M;  1VQP A;  4L5R C;  2IY5 B;  2RHS B;  3I55 A;  3J80 i;  1CKN B;  2R93 G;  1B70 B;  2WAQ E;  2NZH A;  3UE1 A;  1N9W A;  5FLM G;  4B3S Q;  1AH9 A;  2IHF A;  2K4K A;  4IJH A;  4C3J H;  2KCM A;  4A4I A;  1NMG A;  3KF6 A;  4YWM A;  2JJQ A;  2KHI A;  1L0W A;  2AWO A;  3RN5 A;  1N36 L;  2QGQ A;  4JI4 L;  2VQF Q;  2K5N A;  4LNQ A;  2K50 A;  2E5L Q;  4DR4 L;  1A8V A;  2VZA A;  4L5S A;  4BY7 H;  4GNX C;  4X62 Q;  1G51 A;  2AHO B;  3S24 A;  1UE7 A;  4DV7 L;  4QY7 A;  2YTX A;  4UP8 A;  4DNI A;  1K73 C;  2E8G A;  3A74 A;  4JYA Q;  1HJP A;  1OXS C;  1IZ6 A;  4P74 A;  4A3F H;  1I94 Q;  4DR2 L;  1IXR A;  1VQG A;  2OQ0 A;  1K3R A;  3BZK A;  4GLV B;  1KRT A;  2JA9 A;  1Q7Y C;  3F1Z A;  1VQL A;  5BR8 L;  2ZM6 L;  5ELO A;  1IBM L;  1VQ8 A;  1K83 H;  2MO0 A;  4B3S L;  1PH2 A;  1KRS A;  3HOW H;  1N33 L;  3HKZ E;  4IFD I;  5IYC H;  2CFM A;  1XMQ Q;  3CC2 A;  3CCR A;  1N8R C;  1JMC A;  4DUY Q;  2PI2 E;  2YTV A;  5C0X J;  2ES2 A;  2DUD A;  3K0X A;  3DLL A;  2JA8 H;  5IP7 H;  4LF7 L;  3NEM A;  4QQB X;  1ASZ A;  3AFP A;  3ULL A;  2QA4 A;  2XTI A;  4X66 L;  4EQ5 A;  3CPW A;  4DV1 Q;  4O2D A;  3GDE A;  4GNX B;  1Y1V H;  1FJG L;  1OXT A;  5M3M G;  2BA0 A;  4QGU A;  4PG3 A;  2FXQ A;  5GRO A;  1YZ6 A;  3CC7 A;  3OTO Q;  2KEN A;  1IBK Q;  4NPS A;  2Z6K C;  5E7N A;  3J81 j;  2MQH A;  1X56 A;  3PGZ A;  4UPA A;  2EIF A;  1X3E A;  2CQO A;  4DR6 Q;  3KDF B;  1E1T A;  4A93 G;  1KIX A;  1X6O A;  2PI2 A;  4GLX A;  4IPG A;  3U50 C;  4YCW A;  3HOZ G;  1TWA H;  3I4M H;  3HOX G;  3L7Z C;  3K81 C;  4DR3 Q;  1HR0 Q;  4LF6 L;  2DGY A;  2UUB L;  3PIO A;  4DV2 L;  2A8V A;  2B63 G;  3TEH B;  1S3O A;  4H02 A;  3PIP A;  2NVQ H;  4MZ9 A;  3FKI H;  4TVA B;  3S14 H;  4L5Q A;  2YTY A;  4YHH L;  3WWV A;  1J5E L;  4DV0 Q;  1VCI A;  1B8A A;  1SE8 A;  4BY1 H;  1OXV A;  2KBN A;  4JI5 Q;  3SGI A;  1G6P A;  4P73 A;  3TRE A;  1Q1B A;  3W1B A;  4IPC A;  3M3Y H;  5C44 H;  3T1H Q;  1D8L A;  4RMF A;  5GAD C;  1EIY B;  3FP9 A;  1CSQ A;  2PNH A;  4Y7N H;  1OXX K;  2MFI A;  5C0X G;  4DR7 Q;  1L1O C;  4AYB G;  3J80 c;  1EUJ A;  4DPG A;  3HOY H;  3NEN A;  3MEF A;  2UXD Q;  2EQS A;  4LF8 L;  4BBS G;  1YIT A;  3KYH C;  5AJ3 L;  1PH3 A;  2MO1 A;  2NN6 G;  4P71 A;  4POF A;  3L2P A;  2CKZ B;  4DR3 L;  1KL9 A;  1PH4 A;  4QJF A;  3UDF A;  4JI7 L;  1O7I A;  4LF4 L;  3AQQ A;  1J6Q A;  1YJ9 A;  3ERS X;  3T1Y Q;  1MIU A;  3JC6 6;  4NXN L;  1I3Q H;  3E9I A;  2HHH L;  5IYB G;  1X3F A;  4MTN A;  1QVC A;  1XPR A;  2Y0S E;  1YIJ A;  4JI5 L;  1X54 A;  2UU9 Q;  4A75 A;  2YV5 A;  3F8T A;  3PO3 G;  4JI0 Q;  1YJN A;  1PH7 A;  3OW2 A;  1L2F A;  2B3G A;  1HZA A;  3HOV H;  5M5X H;  2VQE Q;  4LUV A;  1YNX A;  1HNX Q;  1K0R A;  4R4T A;  4JI2 L;  2JQO A;  1SN8 A;  2UXC Q;  1S72 A;  1VQE A;  1HZ9 A;  1Q12 A;  2AMC B;  1N32 L;  3IRB A;  3NEL A;  3PUX A;  4K0K L;  1XPU A;  1I6H H;  1XNR L;  2UXD L;  3M4Q A;  3JAM i;  3KJO A;  3PV0 A;  3S1M H;  1GD7 A;  5DLQ E;  3CF5 A;  2VUM H;  2UXB L;  3I56 A;  1NTG A;  1UE6 A;  1FVI A;  4C3I H;  3CCS A;  1E22 A;  3NBH B;  5LMN Q;  4A3I G;  1Q86 C;  1L1O B;  4LFB Q;  3STB C;  5GAG C;  5EAY A;  4X64 Q;  4YY3 L;  2YU9 H;  4A3G G;  3S2H H;  1YJW A;  1CSP A;  1V1Q A;  4A3J H;  1WCM G;  1YVC A;  2CWA A;  2CWP A;  5GAE C;  4JOI A;  4GS3 A;  2ZJP A;  4GOP A;  3G6E A;  3ULP A;  4DAM A;  4A3L H;  2WP8 J;  1XJV A;  3CC4 A;  3DM3 A;  4JI0 L;  4OWX B;  3I4N G;  3BJU A;  1PYS B;  4GKK Q;  1EOV A;  1XPO A;  2I0Q A;  3AFQ A;  1VQM A;  5HY6 A;  1JB7 A;  2OQK A;  2ZJR A;  1GO3 E;  1A62 A;  2KCT A;  5IE8 A;  4DAY B;  2R7D A;  2NVT H;  1PH5 A;  2R92 G;  2R93 H;  3B6Y A;  4A76 A;  3KF6 B;  5FLM H;  2VS1 A;  1QVF A;  3CCL A;  3S16 H;  4LF5 Q;  3S2D H;  4JI3 L;  3K7A H;  2LXK A;  2F4V Q;  4HIM A;  5JJI A;  1P8L A;  5IYD G;  1NMF A;  2K52 A;  4DUZ L;  4JCV E;  1AE3 A;  4A3B G;  3S1N H;  1Q46 A;  1Q81 C;  1RIP A;  3CD6 A;  1G29 1;  1VQ4 A;  1A63 A;  1XMO L;  3K80 C;  4JV5 Q;  2BA1 A;  2JE6 I;  4OXP A;  3RR5 A;  3J81 i;  4A3M G;  1FL0 A;  3S1Q H;  2LXJ A;  4DV5 L;  1PA6 A;  1VQK A;  3CCE A;  4JBM A;  3FHW A;  2D0O A;  4X65 Q;  1MJE A;  3GTQ H;  1TWC H;  2PQA A;  4J15 A;  3I2Z A;  1N34 Q;  1EYG A;  5FLX c;  1CKM A;  4A3D G;  1PYB A;  1U5K A;  1PH9 A;  4GN5 A;  3CPF A;  1FGU A;  2N49 A;  3HOU G;  4R4Q A;  1YEZ A;  4LFC Q;  5IWA Q;  2WAQ G;  1GM5 A;  2K75 A;  2WFW A;  2Q2U A;  3BZC A;  4LF9 Q;  2VQF L;  4C2M H;  2E5L L;  4A3E G;  1HNZ Q;  1BBW A;  4PZ8 A;  3M85 A;  1IBL Q;  4X62 L;  1CUK A;  1VQ5 A;  4JYA L;  1EIF A;  1WOC A;  1BKB A;  3UDI A;  4LW1 A;  4HJ9 A;  2ASB A;  1I94 L;  3CCU A;  2NZO A;  5M3F G;  3M4O H;  2VW9 A;  1PV4 A;  1VQN A;  4JI8 Q;  5LMN W;  4GKJ Q;  1MKH A;  2R7Z H;  3HOZ H;  2E2I H;  3HOX H;  1E1O A;  4R4O A;  2IX1 A;  1YI2 A;  5C4X H;  1HNW Q;  3HOW G;  1WI5 A;  1XMQ L;  2JA5 G;  3KF8 B;  2C35 B;  3HKZ G;  3K7U C;  1JE5 A;  3HFZ B;  4UP9 A;  1X3G A;  4BA1 I;  4DUY L;  2N78 A;  4KI0 A;  4HID A;  1V43 A;  4DV4 Q;  1R9T H;  2IX0 A;  4HIO A;  2E2J H;  4YWK A;  1XTD A;  1GKH A;  1ASY A;  4UY8 C;  4IFD G;  4BA2 I;  4PZ7 A;  5C0X I;  4GN3 B;  1NJI C;  2JEA I;  4R1J A;  4OO1 G;  4DV1 L;  1QVG A;  3PSI A;  2UUA Q;  2JA7 G;  1UE1 A;  2KHJ A;  4AQY Q;  1BVS A;  4DV3 Q;  3ICE A;  3D31 A;  3OTO L;  4JG2 A;  1IBK L;  4DR1 Q;  3PUW A;  3CCJ A;  1Y1V G;  4AYB E;  1VQ9 A;  4JOI C;  1SR3 A;  4GOP C;  4HJ5 A;  2Q2I A;  3RNU A;  1VQ7 A;  3J7A 5;  1T9H A;  3HOU H;  3PF4 A;  1SRU A;  1V9P A;  4BY7 G;  4DR6 L;  1C0A A;  2MNA A;  4NXM Q;  3KJP A;  4NB3 A;  2CCZ A;  3GTM H;  4KLK A;  1EWI A;  3S1R H;  1QZH A;  1PH1 A;  1HR0 L;  1SFO H;  5IYB H;  5K36 G;  3KLW A;  4P72 A;  5FJ8 H;  2B29 A;  3MXN B;  4A3C G;  3PO3 H;  2K14 A;  4DV0 L;  1KAW A;  2R6G A;  3VDY A;  4JC0 A;  1I50 H;  1VQB A;  4KHZ A;  4LUZ A;  3H3V H;  1NBW A;  3J81 c;  3G4S A;  1SMX A;  3I4O A;  3H0G G;  3RZO H;  5HGQ A;  3T1H L;  1QZG A;  4BBS H;  4DK3 C;  1VS0 A;  1UWV A;  2HIV A;  4DR7 L;  3RN2 A;  4APV A;  1VQO A;  4JI6 Q;  3CW2 C;  3HKS A;  1VQC A;  4A3I H;  2ZJQ A;  3TS2 A;  1VQH A;  2K5V A;  5IP9 G;  4A3G H;  4LFA Q;  4UP7 A;  1CKO A;  2OTL A;  4BXX G;  3Q8D A;  4GOP B;  2OTJ A;  1Q8K A;  2JA6 G;  1WCM H;  4KHP Q;  1X9N A;  1VQI A;  4B3M Q;  3CCV A;  3T1Y L;  1IYJ B;  1TWF H;  1HZB A;  4PMW A;  3STB D;  2VL6 A;  4DKA C;  5LMU Q;  4B3T Q;  3PF5 A;  1A0I A;  2WB1 E;  2UU9 L;  3G71 A;  1E3P A;  1C7Y A;  3GD7 A;  2VY3 A;  2GVA A;  2K5H A;  3CCM A;  2VQE L;  1LUZ A;  3GTK H;  1HNX L;  2R92 H;  4DV6 Q;  4IPH A;  2UXC L;  3PO2 G;  1HH2 P;  1Y14 B;  2F52 A;  2PMZ E;  4A3K G;  1XNQ Q;  2Q2H A;  2QEX A;  3RLF A;  2E2H H;  1M90 C;  1K8G A;  5C3E G;  3ER0 A;  4R4I A;  1VQD A;  1DGS A;  5LMN L;  3KFU A;  4LFB L;  2VUM G;  4X64 L;  1HR0 W;  4B3R Q;  5IYD H;  2XGT A;  4HJ7 A;  4DR5 Q;  1OTC A;  4A3B H;  5H1S E;  3BU2 A;  1QUQ A;  2GN5 A;  3EBE A;  1N36 Q;  1VQF A;  4A3M H;  3CQZ H;  4JI4 Q;  4GLA C;  4DR4 Q;  2OWO A;  4GKK L;  2VNU D;  3EIV A;  2IT1 A;  3F2B A;  3G48 A;  4DV6 L;  5C4J H;  3CMA A;  1EQQ A;  4DV7 Q;  1NY4 A;  1LYL A;  4YWL A;  3U4V A;  2A19 A;  2ID0 A;  1PHJ A;  1X65 A;  4A3D H;  1AE2 A;  4AH6 A;  1JT8 A;  1C9O A;  1WYD A;  2ZTD A;  3A5Z B;  1I5F A;  3CP0 A;  4DR2 Q;  1Y1W G;  4LWC A;  4BBR G;  5BR8 Q;  2ZM6 Q;  1IBM Q;  4LF5 L;  4B3R L;  4IFD J;  1JJC B;  4DR5 L;  2NVY H;  4OX9 Q;  1JJG A;  1BBU A;  1LM0 A;  4EX5 A;  1YHQ A;  2F4V L;  3PUZ A;  4ALP A;  4O0A A;  1N33 Q;  2I5H A;  4A3E H;  3RLN A;  3E9H A;  4MNO A;  1CKN A;  1Z47 A;  2D0P A;  4HIK A;  1D7Q A;  4XTC S;  2HIX A;  2BH2 A;  1VQA A;  1YHA A;  2JK8 A;  3M9B A;  2I5L X;  4QIW E;  4JV5 L;  3PUV A;  4C3H H;  5GAH C;  4LF7 Q;  1VQJ A;  3AYH B;  2UUC Q;  5JJL A;  4RG1 A;  1NE3 A;  3GO5 A;  3ZJY C;  4PZ6 A;  5M3M H;  4X65 L;  5M3F H;  3U58 A;  3GTG H;  4X66 Q;  3H15 A;  1N34 L;  4L5T A;  1FJG Q;  1K8A C;  1X55 A;  4JI1 Q;  3PCO B;  4XIG S;  4QL5 A;  4X6A H;  2D62 A;  4A3F G;  1WJJ A;  3U4Z A;  4A93 H;  4OX9 L;  4LFC L;  2JA5 H;  3CAM A;  5IWA L;  4JBJ A;  3JAM c;  3K8A A;  4YCU A;  2BH8 A;  2RCN A;  1P16 A;  1TWG H;  2Z0S A;  2HQL A;  4LF9 L;  4OO1 I;  2B63 H;  1MJC A;  3W1G A;  1HNZ L;  1IBL L;  3KOJ A;  5IYC G;  4LF6 Q;  2UUB Q;  4TQU S;  4DV2 Q;  2AKW B;  3OYY A;  5J3B A;  1PH6 A;  2UUC L;  2JA7 H;  1PVO A;  4YHH Q;  5IY0 A;  3CXC A;  1J5E Q;  5IT9 c;  2JA8 G;  5JEA J;  1W3S A;  5IP7 G;  1KD1 C;  4JBW A;  1WFQ A;  2LSS A;  4JI1 L;  1PFS A;  2AWN A;  3L0O A;  2F3I A;  1Q82 C;  2ZTC A;  1EFW A;  1RL2 A;  4JI8 L;  4GKJ L;  1SLJ A;  2NN6 I;  4FDB A;  1E24 A;  1YHB A;  1UE5 A;  5M5W H;  4GNX A;  1HNW L;  2R7Z G;  2GVB A;  2YYZ A;  2ATW A;  4LF8 Q;  3ULJ A;  2H5X A;  2JEB I;  5AJ3 Q;  4WJ4 A;  4LUO A;  4POG A;  1OXU A;  1LTL A;  5C4X G;  4A3C H;  4DV4 L;  1JJ2 A;  1YBY A;  4JI7 Q;  4LF4 Q;  3I4M G;  3KDF A;  1TWH H;  4IO9 A;  3W5O A;  3H3V I;  5ELN A;  3TRZ A;  2Q2T A;  4NXN Q;  2OCE A;  2HHH Q;  1VQ6 A;  1KQS A;  1H95 A;  3H0G H;  2HT1 A;  3A0J A;  4ME3 A;  4JBK A;  2UUA L;  3FKI G;  4IPD A;  4AQY L;  4DV3 L;  3TQY A;  1E7Z A;  2N8N A;  4HJ8 A;  2IHE A;  4DR1 L;  4BY1 G;  4OON A;  1K9M C;  4JI2 Q;  2N3S A;  5IP9 H;  3S15 H;  5C44 G;  4BXX H;  1N32 Q;  2R7F A;  4R4C A;  1KC8 C;  4NXM L;  4K0K Q;  1XNR Q;  4YCV A;  4OWT B;  2JA6 H;  2UXB Q;  3M7N A;  1W2B A;  5JEA G;  3HOY G;  3CCQ A;  4HJA A;  3GTL H;  1UEB A;  4YY3 Q;  5M5Y H;  3RLO A;  3PUY A;  4IOC A;  2Z6K A;  3I4N H;  3J7Z C;  5FJ8 G;  3UDX A;  1U0L A;  4GN4 B;  4DK6 C;  1PH8 A;  3A5U A;  3PO2 H;  4A3K H;  3TS0 A;  2Y0S G;  1KXL A;  2ALY B;  2RHQ B;  1M1K C;  2L15 A;  3GTJ H;  3F2D A;  3HOV G;  5C3E H;  3M4P A;  4IOA A;  4JI6 L;  1B7Y B;  2EXD A;  5JJK A;  3LGJ A;  1EQR A;  1GVP A;  1QUQ B;  3EN2 A;  3S17 H;  2I5M X;  3UE0 A;  4LFA L;  3F2C A;  1IL2 A;  1KHI A;  3GTO H;  3GTP H;  2V1C C;  2RF4 A;  3CME A;  3E0E A;  3AEV A;  4KHP L;  4B3M L;  4JI3 Q;  3I7F A;  4Y52 H;  2A1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...