4BY1H

Elongating rna polymerase ii-bye1 tld complex soaked with ampcpp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by1H00
2WB1E 3AFQA 5ELOA 5JJIA 4JI2L 4JBWA 1HR0Q 3M3YH 1E1OA 2XGTA 1S40A 2N78A 4R1JA 1IBLL 1B8AA 3BZKA 2Q2IA 1PV4A 3GTKH 4GKKL 4FDBA 3HOXG 3S1RH 1OTCA 1PYSB 1SRUA 3IRBA 5IWAQ 3KJPA 2HIXA 3H0GG 5M3MG 2DGYA 3HKZG 1VQPA 1WJJA 4B3SQ 4JYAQ 3JAMi 1HZBA 1I50H 5C3EH 1IL2A 1Y1VG 3TEHB 5JJLA 2UU9Q 2UUBQ 3HOXH 2PQAB 3F1ZA 4DNIA 3K8AA 3I4MG 3MEFA 1CUKA 4R4OA 5IYCG 4X65Q 5EAYA 4AQYL 3ICEA 2RCNA 2JQOA 1VQBA 2IX0A 4UP8A 5IP7G 1IBML 3LGJA 1OXVA 1N9WA 3KDFB 5C0XG 4PG3A 2K5VA 2VUMG 1L2FA 2NVTH 1HZAA 1FVIA 4L5TA 3M4QA 5C4JH 4PMWA 3PUVA 4A93H 2ZJQA 1NE3A 4DR6Q 1FL0A 5IYDH 1QUQB 3I56A 1HJPA 1IBMQ 5GAEC 2HIVA 3U4VA 4POFA 2LXJA 1K73C 4L5SA 1JE5A 1VQ5A 4TVAB 1KRTA 1J5EQ 4JI7Q 4GN5A 4JBJA 4X6AH 4A3GH 4HIKA 3CCSA 4GOPA 2UUBL 4DV4Q 1VQ9A 4LFAL 1XNQQ 4OXPA 3H0GH 3PGZA 4JYAL 4DV3Q 3I2ZA 1A63A 1KL9A 2MFIA 4DR7Q 3GTMH 3KDFA 1Y1VH 3HFZB 2R92H 1PA6A 1IXRA 2IY5B 4GS3A 3W1GA 1K8AC 2NVYH 1Q8KA 1HR0L 1WFQA 4IOCA 4POGA 5H1SE 4A3BH 4HJ5A 1VQFA 4X62L 3RLFA 3CCRA 1I94Q 4K0KQ 3TQYA 5GAGC 2Q2HA 5GADC 3EN2A 3CCMA 3M4PA 4GOPB 2ZTCA 1I3QH 5DLQE 1L1OA 3T1YL 4X66Q 3CQZH 3AFPA 5E7NA 2JEAI 2K52A 1UE1A 1MIUA 3CP0A 3TREA 4NXNL 1QZHA 1E3PA 2OTLA 4L5RC 4JBMA 4LFCQ 4JOIA 4LF8Q 2EXDA 2WB1G 4A3CG 3G71A 4BY1H 4QQBX 3HKZE 3FP9A 1IBLQ 4LF6Q 3J81c 4J15A 3KFUA 2A1AA 2I5HA 1UE5A 1YVCA 4ME3A 4P75A 5FLMG 4B3ML 2R6GA 3HOWH 3S2HH 2JA7H 4GOPC 2QGQA 3GTJH 3PF5A 3W1BA 3G48A 3T1YQ 4EQ5A 3J81i 1CKOA 3I4NG 3RR5A 3SGIA 3CC7A 4DUZQ 1JT8A 4DR3Q 4DKAC 4BBSG 2JA7G 2KCTA 5AJ3L 4OX9L 1NY4A 1TWAH 1YZ6A 3UDXA 1WOCA 3M9BA 1OXSC 3PUWA 1PH7A 4A3LG 2UXCL 1E7ZA 1K83H 2CQOA 2KHIA 1N33Q 2RHQB 4AYBG 5IYBH 2B3GA 4DV5L 1N32L 4P71A 2GVAA 1G51A 4YWKA 3J7ZC 2VQFQ 1IZ6A 1QVGA 4A3JG 4P72A 1E24A 1Q1EA 4MNOA 3OTOQ 1HNXQ 4DAMA 4XIGS 3FKIH 1SN8A 3S1MH 4DV4L 1BBUA 1E22A 4R4QA 5LMUL 4R4IA 3UDFA 4JI6L 3PF4A 4WJ4A 5K36G 4UP9A 1HZ9A 4IFDI 1WCMH 1PH3A 4JI7L 4DUYL 1VQCA 3E9HA 2GVBA 2Z0SA 3F8TA 1YEZA 4JI8Q 1RL2A 4KHPL 3KYHC 1PVOA 1JJCB 1XMOL 1M90C 2E2IH 4NXMQ 2K50A 2L15A 3RN2A 1X55A 3G4SA 4HIDA 1TWHH 4NXNQ 4OWWB 1YHBA 2V1CC 1YITA 3AEVA 4X65L 4AQYQ 2R7DA 3GO5A 2WAQE 2I5MX 3PO2G 1G6PA 1RIPA 1HNWQ 3DLLA 4X62Q 1I94L 3HOUH 1ASYA 1MKHA 3HOZG 2A8VA 1IYJB 3KF6A 2E2JH 1KQSA 4NXML 3D0FA 3CF5A 1XMOQ 4IPHA 3T1HL 4ALPA 2JA8G 3H15A 4JI5Q 2VW9A 4YCVA 4P73A 1GM5A 4JI8L 1I6HH 3CW2C 5GQOA 4B3RQ 4DUYQ 2MO1A 2HQLA 2PMZE 2NZHA 4GLAC 2YTVA 5IP9G 1R9TH 2KBNA 1EYGA 1HZCA 2IX1A 3J80i 5C0XJ 1Z47A 4LFAQ 2XTIA 3DM3A 1X9NA 4LF5Q 1XNQL 4DV6L 1FGUA 3STBC 3VDYA 4R4CA 1X56A 2JA9A 4NPSA 1MJEA 1N34Q 1H95A 1VQJA 1XPUA 4YWMA 4QGUA 3ULJA 3HOYG 2NVQH 1NBWA 2ZM6L 4DR1L 1Q86C 5BR8Q 1EWIA 3CCLA 3PO2H 4DPGA 1W3SA 5M5YH 2R93H 1VQOA 2YTXA 4IFDG 4DR4Q 1N34L 1PFSA 1OXUA 3WWVA 1M1KC 4OO1I 1HR0W 2KHJA 4DR3L 1YJNA 4GLXA 2E5LQ 4LF5L 2Z6KA 1KHIA 2UU9L 1UWVA 3CAMA 4B3RL 1U0LA 4YCWA 2JEBI 2WP8J 1SFOH 1QVFA 3D31A 2AMCB 3S24A 4HIMA 4HIOA 4JI5L 2YYZA 2EIFA 4GLVB 4QIWE 1PHJA 2K75A 3AQQA 4Y7NH 2B29A 1NMFA 4JI4L 3K7AH 2A19A 4BBRG 3S1NH 3J7A5 4BA2I 4LFCL 1HNZQ 2OCEA 3MXNB 3GTQH 1A0IA 3HOYH 3S15H 1QUQA 1VQEA 2VQEQ 2UUAQ 2R93G 2CKZB 2F4VL 1FJGL 3HKSA 4LF7L 4LWCA 2VZAA 4PZ8A 2KCMA 5C4XH 5M3FH 4YHHQ 5M3MH 1D8LA 4GKJQ 2N3SA 4IFDJ 2ZTDA 1X6OA 4X64L 1YJ9A 2B63H 1EIYB 2UXDQ 1VQAA 4JG2A 1V9PA 4DK3C 4DR7L 4WJ3M 4TQUS 1V1QA 5FJ8H 2K5HA 1VS0A 3U58A 3HOVG 2AWOA 3ULPA 4OO1G 2RF4A 3GTGH 3KLWA 2JA6G 1K3RA 1HH2P 2CFMA 3NEMA 1L1OB 2IHEA 1EIFA 3CMAA 1AE3A 3HOVH 2GN5A 2VY3A 2LSSA 2N8NA 3CCQA 5GAHC 2PI2E 2H5XA 1XMQL 2OQKA 2N49A 1WYDA 5BR8L 2ZM6Q 4DR1Q 4GKJL 3KF8B 1D7QA 4YHHL 4B3TL 3I4MH 1XTDA 2BA1A 3GD7A 5HGQA 5AJ3Q 4HJ7A 3M7NA 3S14H 3I4OA 1N8RC 4LF9L 1UE6A 3KOJA 4IPCA 3RLNA 4JBKA 2ATWA 2VUMH 1PH1A 2B63G 4JV5Q 1JJGA 1VQKA 4DV1L 2OWOA 3PCOB 3E9IA 4A3IG 4GNXC 4A3EH 3RZDH 1BVSA 1Y1WG 2WAQG 2WFWA 3CXCA 2MNAA 2CWAA 1VQHA 4A3BG 2JE6I 5IWAL 3S17H 3CC2A 2RHSB 4OWTB 5LMNW 4JI4Q 2JA6H 3RLOA 4GKKQ 4LUVA 1ASZA 1KXLA 5ELNA 1LTLA 2LXKA 4C3JH 3CCJA 5IP7H 4DV2L 4MTNA 2Q2UA 3A5ZB 4C3IH 1N36Q 1VQNA 4X66L 1TWFH 2NN6G 3W5OA 1QZGA 3L7ZC 3PUYA 1K9MC 4JI0Q 2K4KA 3GDEA 4LUZA 1A8VA 1IBKQ 3NELA 2F52A 4DR5Q 4K0KL 4YWLA 2NVXH 3EIVA 3PO3H 4JV5L 1VQDA 3BU2A 2OQ0A 4LF9Q 4RG1A 1UEBA 3AYHB 3HOWG 4DV2Q 4DR4L 3CCVA 3JC66 5IY0A 4B3TQ 1J6QA 4P74A 1PYBA 4A3IH 1Q46A 1X54A 1Y1WH 5C44H 4IJLA 3PO3G 3K80C 2HHHL 4APVA 4GN3B 1KD1C 3TS0A 3CCEA 1SE8A 1LM0A 4BY7G 3UE1A 1X3GA 4H02A 1SLJA 1P16A 4A3MH 3J80c 2MO0A 2QA4A 1JMCA 4A3LH 3TS2A 4A93G 2IHFA 1V43A 5IYDG 1A62A 1CSQA 3OTOL 3F2CA 2ID0A 1WI5A 5IT9c 3KJOA 1C9OA 3F2DA 4BY7H 3RN5A 3UE0A 1I5FA 2PNHA 5IE8A 4A3GG 1K8GA 2Q2TA 1PH9A 1N33L 3UDIA 1BBWA 3ULLA 1XMQQ 1VQGA 1UE7A 5LMNL 3K0XA 2UXCQ 4YY3Q 1KC8C 2JK8A 1XNRQ 3ZJYC 4AIMA 4A76A 1KIXA 1XPOA 3K81C 1VQ7A 2R92G 2D0OA 4DAYB 1KAWA 2D62A 5JEAJ 2JJQA 1VCIA 2YV5A 3M85A 2I0QA 4A3CH 5C44G 4XTCS 4HJAA 1FJGQ 5GROA 2ZTEA 2ALYB 4KHZA 4B3SL 4IO9A 2VQEL 4A75A 1AE2A 1KRSA 5FLMH 2K5NA 1LYLA 1OXTA 2YTYA 2NN6I 3ERSX 4LFBQ 1CKNB 4DR2Q 3CD6A 5JJKA 1HNZL 2EQSA 2ZJRA 4AYBE 4A3MG 3A0JA 1O7IA 1YNXA 4LF6L 1SR3A 4X64Q 1YJWA 2UUCQ 3FKIG 3OW2A 4QY7A 4LF4Q 4KHPQ 2JA5G 1XPRA 1NMGA 4A3DG 1PH6A 4GNXA 4JOIC 3H3VI 3CPWA 4DV7L 1WCMG 4DR2L 2E2HH 4JI1Q 2CCZA 2R7FA 4GN4B 2Z6KC 4IPGA 3PUXA 3HOZH 4BY1G 1VQ6A 2I5LX 3CCUA 2JA5H 1SROA 3G6EA 4YCUA 5M5WH 4JI0L 4A3DH 1QVCA 4EX5A 3UDGA 1C0AA 1VQIA 3PSIA 1W2BA 4UY8C 1CKNA 1TXYA 2K14A 1N32Q 2UXBL 2VS1A 2BH8A 1L0WA 4DK6C 5IP9H 4PZ7A 2MQHA 3I4NH 4QJFA 1DGSA 4QL5A 4BBSH 4DV0L 1OXXK 1CKMA 5JEAG 3STBD 3F2BA 1LUZA 4LW1A 1YHAA 4DV3L 4BXXH 1X3FA 3J81j 2Y0SE 1JB7A 3RNUA 2OTJA 1Q81C 5HY6A 1YBYA 4JI3Q 1Q1BA 3FHWA 5IYBG 3U4ZA 4JI3L 1EUJA 4RMFA 4A3KG 4O0AA 3A5UA 2E5LL 4NB3A 3L0OA 4IPDA 2PI2A 4JCVE 1S3OA 4A3JH 1PH2A 1T9HA 1JJ2A 3PUZA 4BXXG 3OYYA 2FXQA 4OONA 3M4OH 4DR6L 4DV0Q 4A3FH 3T1HQ 3CMEA 4PZ6A 2VNUD 4OWXB 4HJ8A 4KI0A 1TWGH 4LF8L 4KLKA 1Q12A 1CSPA 4LUOA 1L1OC 1YIJA 1XJVA 3HOUG 2E8GA 1SMXA 1P8LA 2UXBQ 1YI2A 1HNWL 4Y52H 2CWPA 4DR5L 2NZOA 5FLXc 2AHOB 4DV6Q 1PH5A 2JA8H 1IBKL 3E0EA 3NENA 2HT1A 4JC0A 2AKWB 4R4TA 4LNQA 1N36L 3CC4A 3S1QH 5M5XH 3NBHB 1VQLA 1K0RA 4JI1L 3A74A 1MJCA 4DV7Q 3KF6B 4BA1I 1PH8A 1VQ4A 4A3KH 1B7YB 4LF4L 3S2DH 4GNXB 2UUCL 2YU9H 1NJIC 3GTPH 1GKHA 3BZCA 3I55A 3JAMc 4A3FG 4LF7Q 1U5KA 5LMUQ 2VL6A 3BJUA 2ASBA 4LFBL 2ZJPA 1VQMA 2F3IA 3U50C 1PH4A 4DV1Q 1Y14B 3B6YA 4BBRH 1J5EL 2F4VQ 1HNXL 2PQAA 2UUAL 4AH6A 1B70B 2ES2A 3I7FA 3CPFA 4MZ9A 4IOAA 1GO3E 3PV0A 1XNRL 4DV5Q 4YY3L 1EQRA 3RZOH 3GTOH 1G291 3L2PA 1Q82C 5LMNQ 1GD7A 1X3EA 2C35B 1VQ8A 3Q8DA 2AWNA 4C3HH 2R7ZH 4UPAA 1YHQA 4HJ9A 4DUZL 4IJHA 5M3FG 4L5QA 3GTLH 4C2MH 4O2DA 5C0XI 1NTGA 4UP7A 4JI6Q 1TWCH 1EOVA 1X65A 3EBEA 3S16H 2VQFL 2R7ZG 4A4IA 2UXDL 1S72A 4B3MQ 1GVPA 3K7UC 2HHHQ 5FJ8G 1Z9FA 1BKBA 1E1TA 3PIPA 2DUDA 2BH2A 5C3EG 3ER0A 1EQQA 1Q7YC 2KENA 3PIOA 4JI2Q 2BA0A 2QEXA 4OX9Q 3TRZA 4A3EG 5IYCH 5C4XG 3H3VH 1AH9A 1C7YA 5J3BA 1EFWA 2Y0SG 2D0PA 2IT1A
chains in the Genus database with same CATH superfamily
5ELOA 2F0VA 3HG9A 5ELEA 3C2PA 1E1OA 2XGTA 1I6HB 5NUCA 1B8AA 1LT3D 4GKKL 2QDBA 3KJPA 2HIXA 3PIP3 3HKZG 1EY0A 3NTIA 1BNZA 4PMBA 2AQ1B 2L55A 5KYLA 1HZBA 5JJLA 3F1ZA 2OF1A 4R4OA 4AQYL 5EAYA 3ICEA 1FNVA 2JQOA 5IP7G 2BDOA 2KCNA 4RCOA 1NAPA 2NVTH 1LV9A 4BBSB 1HZAA 1SMYC 3VR6A 4A93H 1FL0A 2EY2A 3I56A 1LACA 1IBMQ 5GAEC 5C0XH 4FXGC 1JE5A 1YNJD 1KRTA 1XXGA 3CKIB 4LFAL 1VQ9A 4WFN3 4OXPA 1EFID 5M5XB 1ESFA 2BE5C 5EJWA 3OHXC 3TP5A 1FGBD 1JB3A 3H09A 1IXRA 1X3QA 2X6LA 1WFQA 4IOCA 4POGA 4A3BH 1F9RA 4HJ5A 1VQFA 2DJGC 3RLFA 4X62L 1H9KA 2VB3X 3NQTA 3TQYA 2Q2HA 2E2JB 1STAA 3J7AV 3T1YL 3CQZH 2K52A 1MIUA 1QZHA 2OTLA 1A15A 1PZJD 2KECA 1TWAB 3O13A 5DNFA 2JP1A 4LFCQ 1ET9A 2EXDA 3G71A 4QQBX 3FP9A 3S9WA 4P75A 4ME3A 3HOWH 1EOTA 5CV8A 4OIKA 1LT4D 4N9PA 3GTJH 3VYUA 3G48A 3T1YQ 4EQ5A 3I91A 4AYBB 4RHSA 5AJ3L 4OX9L 3UDXA 3M9BA 1OXSC 3PUWA 2HCIA 2O2LD 3MHBA 5IYBH 3TP6A 1TS2A 2K32A 4YWKA 1QVGA 2PZTA 1E24A 1TR5A 2MP1A 4FO2A 1AN8A 3FKIH 3EJIA 3V05A 3PF4A 1E22A 5E4WC 4DUYL 1F9PA 3E9HA 1RL2A 3KYHC 3SE0A 3RN2A 4HCSA 1IKLA 2ZT9C 1MSGA 2F0DA 1YITA 2R7DA 1UEAB 2I5MX 1G6PA 1RIPA 1HNWQ 2CH4W 5E4XA 3HOZG 3VYRA 2A8VA 2D9UA 2EYMA 1DJRD 1XMOQ 2VW9A 4HN7A 4P73A 2B8GA 2F0WA 2WAQB 3CW2C 5GQOA 4DUYQ 1AP0A 2HQLA 2NZHA 2YTVA 1HZCA 2FINB 4DV6L 2FHTA 2JXMB 1X56A 4NPSA 1N34Q 1F2MA 3E0JA 2PPBC 3HOYG 2NVQH 3OMCA 3PO2H 2R93H 4DPGA 1W3SA 5M5YH 1VQOA 5G3LF 1EQVA 4XQJA 4S3SA 1N34L 4KK7A 1PFSA 1M4VA 1OO9B 4OO1I 3Q0AA 3DWAA 2Z6KA 3KBXA 1KHIA 5HURA 2UU9L 1UWVA 4A3GB 2JA6B 5KYIA 5CGKA 3CAMA 1U0LA 1SFOH 1QVFA 1GUWA 4HIMA 2YYZA 2EIFA 3I4LA 4K14A 4QIWE 4JI4L 1NMFA 3G6JB 2J0TD 4K5XA 2A19A 2PZUA 1ENCA 4LFCL 3MVVA 1E0BA 5LL6S 1VQEA 1Z7TA 3ITPA 1NR2A 1FJGL 3NSWA 1MHWC 3A7AB 3GV6A 5C4XH 2F0EA 1XYIA 4V190 4GKJQ 1A2UA 4FYDA 3QOLA 1X6OA 3DEOA 1YJ9A 3NP8A 1C4QA 4IUNA 1HTPA 2L4NA 5FJ8H 3U58A 3HOVG 1GHKA 5FLXL 1K3RA 3NWSA 2CFMA 3C46A 1L1OB 1U9RA 1STGA 1S5FD 1AE3A 2GN5A 3VA7A 2SNMA 5BR8L 2N49A 4GKJL 1D7QA 1XTDA 5AJ3Q 4HJ7A 4LMQD 3I4OA 3K7AB 3BVMA 3KOJA 4IPCA 2B2WC 1SNOA 5D3DA 4C2MB 2QCPX 4K6LA 1YNNC 3RZDH 1PDQA 5JAVA 4A3BG 3N52A 5JJZA 5IWAL 3S17H 1HUMA 2A6HD 5J22A 3CC2A 4C3JH 4LJZC 3W2DA 2Q2UA 4C3IH 3W5OA 4JI0Q 4UDUC 1IBKQ 3WOEA 3J7AF 1SYFA 3Q24A 4DR5Q 4HEDA 2EPBA 3EIVA 4YWLA 4JV5L 4LF9Q 2WINB 4RG1A 2KVMA 3HOWG 4H0LC 4PNYA 3WDNA 1PYBA 1Q46A 1B3QA 2ZXOA 4X3TA 3TZUA 1SMYD 3TS0A 4BY7G 3UE1A 3D4RA 2IHFA 1GUTA 1V43A 3BYYB 2ID0A 5FOBB 4J8QA 3FDTA 2QEJC 3UE0A 5IE8A 1EEFD 3QIAA 1XMQQ 1S5ED 1SFOB 4I7ZC 3K0XA 2UXCQ 5EPKA 1EQTA 1KC8C 2RBMA 1KAWA 2JJQA 1VCIA 1ONLA 5GROA 2ZTEA 4A75A 1KRSA 3Q23A 1LYLA 3ERSX 3NTKA 1CKNB 4XYQA 2JA5B 4A3BB 1WCMB 2EYOA 1G91A 3DWPA 3A0JA 4CJ0B 4PV1C 2UUCQ 4X64Q 1YJWA 3FKIG 1EWCA 4A3DG 4GNXA 2PO4A 4DR2L 1H9SA 4A3MB 4Q5VA 4LAAA 1FNWA 5F2DA 3HOZH 5C44B 5CR3A 2I5LX 2JA5H 4YCUA 4B9WA 4JI0L 1C0AA 4ZQ3A 1TXYA 1S5BD 1IL8A 4HR7B 2BE5D 4QJFA 4QL5A 1TWFB 2HDMA 4BBSH 2RDGA 4LW1A 4K6DA 4A93B 3P1HA 3J81j 1F77A 1ET6A 3GQBA 1Q81C 4JI3Q 5C4HA 1Q1BA 4N8X1 4RMFA 2E5LL 4O0AA 3A5UA 4NB3A 3MFYA 1HFNA 1S3OA 3HS0C 4BXXG 3PUZA 3OYYA 4DR6L 4DV0Q 4PZ6A 3IAYA 4HJ8A 4KI0A 1ZKOA 2K33A 1XJVA 4B08A 1SMXA 2UXBQ 1KDAA 4ABNA 1BCPF 1HNWL 5JPMC 1PH5A 1Y1VB 2JA8H 3E0EA 4CKEA 5TSSA 2AKWB 4R4TA 3PMFA 3H0GB 1K0RA 1CT1D 2F0IA 1AFPA 4KV6A 3M3YB 2F0HA 1B7YB 3WOFA 2YU9H 1Z6HA 1NJIC 1EY6A 5I6WA 5M3FB 4LF7Q 4LFBL 1TU2B 2VL6A 1QOHA 2ZJPA 2B63B 1DZ1A 4IURA 1EU3A 1PH4A 1ESRA 2X69A 3HOWB 1EYCA 3NBHA 2EJFC 3HOYB 4JK1C 2SNSA 1GO3E 3PV0A 3D3RA 4G7ZC 3RZOH 1PLFA 5LMNQ 1GD7A 1X3EA 3OWEB 2AWNA 4HAEA 2F3VA 4QF4A 4UPAA 1UAPA 4DUZL 4IJHA 1NTGA 1AZQA 4KJNA 5BN5A 1L0XB 2B2YA 1EOVA 2R61A 2BDNA 2R7ZG 4A4IA 2EZVA 2E74C 3NQIA 2HHHQ 1MBYA 3NK9A 5FJ8G 1Z9FA 3OIPA 3SK6A 3ER0A 1Q7YC 2KENA 3IFTA 3MXGA 4JI2Q 3TRZA 1WTXA 5IYCH 1STNA 3BVGA 1G6ZA 5J3BA 1S40A 2ASBA 2WKCA 5BN4A 3D8GA 2I07B 4JBWA 2FJ2A 1FR3A 4MHEA 2N78A 4R1JA 3QJYA 3MAQA 1PV4A 3HOXG 3S1RH 1PYSB 2Z6BA 1WTPA 1VQPA 3L3OC 1WJJA 1I50H 3IKJA 4XQQA 5C3EH 1TWCB 4DU9A 2R3ZA 5D3IB 1SJED 2C5CA 3CRKC 3MEFA 2RCNA 2IX0A 5C5LA 4DNTB 1N9WA 3UI2A 5BN3A 4K2KA 4L5TA 3BDOA 1SNPA 3PUVA 4DR6Q 1JWSD 4ZUIA 4OHJA 4IQZA 3U4VA 5M5YB 1KAAA 4RAUC 4X6AH 4HIKA 3CCSA 1XNQQ 1G8ZD 4DR7Q 4DNRB 3EFXD 2A68D 2IY5B 2LS01 2K5DA 1K8AC 3SDZA 2R92B 1GUOA 2A6HC 3CCRA 1STHA 4XYOA 5GAGC 4PQXA 5DM63 4GOPB 2ZTCA 4CKBA 1SEBD 1L1OA 5E7NA 1UE1A 4L5RC 1B4OA 2M2LA 4LF8Q 4TRDA 2WB1G 3NXWA 2G9DA 3HKZE 3CRLC 3J81c 3KFUA 3MWYW 2ZXRA 4Z9CB 1F2LA 2TSSA 3S2HH 2JA7H 4GOPC 3W1BA 3RR5A 2E76C 4DUZQ 4DKAC 2NZ1D 4BBSG 3FPUB 2KCTA 1B1ZA 1SJHD 1NY4A 1YZ6A 4F7XA 4A3LG 3V2TA 3QG1A 3BG3A 1K83H 2KHIA 4X3UA 1CQVA 3OOCA 1N33Q 2EYFA 5K36H 4P71A 3J7ZC 1IZ6A 1F2YA 4DFAA 4P72A 3HKZB 2KJXA 1SN8A 4FF4A 4JI6L 1PH3A 5E3FA 4LK1C 3PO3B 3A55A 2Z0SA 3F8TA 2M9VA 1JJCB 4FXKC 1M90C 1EZ6A 2K50A 3S17B 1X55A 3G4SA 4HIDA 4YIJA 4NXNQ 1TIID 2MHVA 2V1CC 4AQYQ 3GO5A 4XQNA 4CHTB 4CJ1B 2WAQE 5KNDA 2A74C 2B39A 1I4HA 3I72A 4K2LA 4FNFA 1I94L 2TMPA 1ASYA 1HUNA 1IYJB 4IZ8A 5KNCA 1VDZA 2PQEA 2L9HA 4BY1B 4NXML 1EY5A 2JA8G 2AUKA 4ALPA 4NW2A 3H15A 3U9OA 1EYDA 4JI8L 1HPCA 2QW7A 1EIYB 2PMZE 2QKIC 2KBNA 2HUGA 5CBEE 4R8NA 5C0XJ 3SHLA 1XNQL 4R4CA 1RD9D 2NB0A 2JA9A 4YWMA 1DOKA 4QGUA 3ULJA 1NBWA 3M4YA 3GTGB 5BR8Q 1EY4A 3S2DB 4ZYSA 3A8KE 1HR0W 1SDFA 2KHJA 4DR3L 1YJNA 4C3JB 4X3KA 2SEBD 4KHVA 2A69D 5M3MB 1IYVA 1D1IA 2AMCB 4DK1A 4HIOA 1EY8A 4K8IA 1ZYRD 4GLVB 2K75A 3AQQA 2B29A 3S1NH 1TQOA 2F0OA 2K05A 2IW3A 5EBCA 1ILPA 1Y8PB 3HOYH 1T5EA 3NWTA 2UUAQ 2R93G 3M7GA 2B2WA 1DYQA 1CHPD 1D5ZC 2K7VA 3J80E 3ND8A 3MFGA 1A3TA 2PW5A 2KCMA 5M3FH 1PMRA 1D8LA 2N3SA 5CV6A 4IFDJ 2B63H 2K28A 5D14A 1I4RA 2EYLA 4DXGA 1BCPD 1KDCA 4JG2A 1I4QA 2K5HA 2B2YC 2EY1A 1BOSA 4IUVA 1H9MA 3KLWA 2JA6G 1K0SA 3NEMA 4HSVA 1AW7A 4O42A 2X6GA 1XX8A 3CMAA 4CJ2C 4HMIA 4CDEC 2PI2E 3DXJC 5A35A 1WYDA 4YHHL 4B3TL 3GD7A 4CDCC 2HD3A 3M7NA 3X3MA 4ZRZA 1GUGA 4LF9L 2ATWA 4C3HB 4JV5Q 1VQKA 3PCOB 3S1NB 1S5CD 3E9IA 1Y1WG 5C6AA 3V96A 2R7ZB 2WAQG 2WFWA 2MNAA 2CWAA 2JE6I 5I2XA 5LMNW 4G57A 3RLOA 1ASZA 5ELNA 3KF8A 1LT6D 2LXKA 3MXNA 1E2WA 4RGMA 4F88A 3A5ZB 3RUZA 2B2VA 3A54A 1JQYD 1TWFH 2NN6G 3L7ZC 1K9MC 2L1BA 4RGTA 2K4KA 3GDEA 4LUZA 1A8VA 3NELA 2NVXH 1VQDA 3BU2A 3HP3A 3DMUA 2I46A 2VXWA 3CCVA 3JC66 1X3PA 5E1FA 1X54A 5C44H 3PO3G 1H9RA 4CBVA 4RHRA 3SK8A 1KD1C 3CCEA 1SE8A 1P16A 4A3MH 3J80c 1PTOH 2MO0A 3J7YW 1I4GA 4A3LH 1SYCA 1TY2A 1TS5A 3F2CA 1Q3LA 4RH6A 1PRTD 5CV4A 3RN5A 5C3XA 3LX0A 2Q2TA 1PH9A 1N33L 4RWSC 3C1EA 2G9HD 4YY3Q 5JOBA 1XNRQ 4A76A 2XRQD 1VQ7A 3HGBA 2R92G 1SYDA 2D0OA 2L12A 4DAYB 2JA7B 2YV5A 4G4KA 2I0QA 5M9OA 2IX3A 4XTCS 4HJAA 1FJGQ 1CM9A 5FLXE 4IO9A 2VQEL 2YTYA 1OXTA 5IGBA 5JJKA 3DUZA 3CD6A 2VB2X 1TT2A 4KKUA 4AYBE 4M8AA 2P5ZX 3FEWX 1CA6A 3OW2A 4KHPQ 1R4QB 4ID6A 1NMGA 3H6MA 4JOIC 1SNQA 1B9MA 3CPWA 1PTOF 3GTMB 2IJ0A 2Z6KC 3IL8A 4IPGA 3PUXA 3K6OA 3X3NA 1ML0D 1PFMA 1HXYD 1SROA 1K83B 3D6CA 5M5WH 2F0FA 1QVCA 3OPOA 4EX5A 3UDGA 1VQIA 1W2BA 2K14A 1N32Q 3TBIB 2F4IA 3I4NH 1FYCA 4ZAIA 2K04A 1DGSA 5KRUA 3T4AC 2LKVA 4GZYC 1OXXK 3STBD 3DEPA 3NUCA 3S2HB 1CK1A 1YHAA 1X3FA 1BQQT 2NUCA 2OTJA 1WTVA 2EOTA 1YBYA 5JPNC 1YNND 4QB4A 3RD4A 4A3KG 2CW0C 4RCNA 4IPDA 2A6ED 1NUCA 1STEA 4A3JH 1STYA 1PH2A 3GTLB 3AB9A 3CMEA 4KLKA 2Y0SB 2QILA 1L1OC 2E75C 2F03A 1Y8NB 1P8LA 1I50B 4DR5L 2NZOA 4RKLA 1IBKL 2LFNA 4JC0A 1D6EC 1JC7A 1XTCD 4LNQA 3NBHB 3VYTA 4JI1L 3A74A 1MJCA 1HTLD 1W6KA 5CV5A 1GOZA 1PH8A 5KEEA 4X3SA 4DF7A 2F0MA 1U5KA 2EYHA 3R2IA 2EXZA 2A6EC 5ISRA 4IFDH 2F4VQ 2PQAA 3A8IE 5KNBA 3MEHA 4C3HG 1ZYRC 2CH4A 4MZ9A 2XNAC 3MXPA 1XNRL 2N88A 3PIO3 3L2PA 5IODA 3S14B 2XN9C 1PFNA 3Q8DA 5J1ZA 3A8JE 4L8JA 3S1RB 1I4XA 4C1NK 5M3FG 4L5QA 4JI6Q 1TY0A 1B50A 1TWCH 4RKBA 5G3LD 1KTKA 2ICEC 3S16H 3CU7A 2VQFL 5T1GA 5IIFA 4FF2A 4UHVA 1BKBA 1J8IA 2O5JC 2A69C 3PIPA 2BH2A 4G7OC 4KD3A 3I8ZA 1EQQA 4DN4M 3PIOA 1DD2A 3H3VH 2L11A 4QUFA 4K5VA 2NTTA 5FK9C 2QF7A 2Y0SG 3QOJA 3QB3A 1ENAA 2WB1E 3AFQA 4N9TA 4KMUC 3S16B 5JJIA 2NVQB 3KLRA 1HR0Q 2F0SA 2K03A 1IBLL 5J39A 1E2ZA 2DY7A 2Q2IA 4FDBA 3T13A 4OL7A 1OTCA 1SRUA 3IRBA 2RA4A 2CVRA 3H0GG 4I7AA 2Z9HA 5LL6X 4B3SQ 4JYAQ 4KJOA 3K5LA 1Y1VG 2MJ8A 2UU9Q 2PQAB 1GUNA 1MGSA 3K8AA 3I4MG 1CUKA 5IYCG 4KN7C 2ICIA 1VQBA 3OMGA 1A2TA 1IBML 3LGJA 1OXVA 3KDFB 5C0XG 1JICA 2K5VA 1L2FA 1QWYA 2K6AA 2O4XA 5A2QL 2RQXA 3LWEA 3M4QA 5C4JH 4PMWA 3F2UA 2DN8A 1QUQB 3C3LA 1AH9A 1JOQA 4L5SA 2LXJA 1VQ5A 4TVAB 1J5EQ 4GN5A 2DJFC 4C56C 4GOPA 2UUBL 5DM73 4DV4Q 1F2ZA 3E5SA 3P7JA 1BXTA 2MFIA 4IN3A 3HFZB 2R92H 2JA8B 1D1KA 3W1GA 1LABA 2NVYH 1Q8KA 5H1SE 3D6WA 2XVSA 1I94Q 3HOZB 1O80A 1SE4A 5I2YA 3M4PA 1I3QH 5KIXA 4X66Q 3AFPA 1SE3A 4RGNA 3VR2A 2HDLA 1TS3A 4NXNL 1E3PA 4XXEA 1CI3M 3MC0B 4ULLA 3I90A 3J80L 5IGEA 1IBLQ 2A1AA 1YVCA 4H44C 3HZXA 4B3ML 2L5TA 4ZKCB 5IGDA 4MN3A 3PF5A 1NSNS 1CQFA 5CYUA 3I4NG 4CKCA 3PQIA 1QNUA 3OWFA 3VR5A 1M8AA 4DR3Q 5M5WB 5HGTA 1TWAH 2UXCL 1PH7A 1WTHA 4N8FA 4DV5L 2B3GA 1N32L 3A7LA 3H91A 3P75A 1D5MC 1G51A 2VQFQ 3FMCA 4A3JG 1HNXQ 4MNOA 3OSOA 4JVZA 2SDFA 4R4QA 5LMUL 1UNSA 4WJ4A 4UP9A 1WCMH 4JI7L 4U68A 5I9PA 1VQCA 3I73A 4JI8Q 2E2IH 1K28A 1TWHH 5CV9A 1H9SB 4OWWB 3P20A 3AEVA 5C4XB 4KN4C 4X65L 2HCCA 4R9WA 2C9OA 1GXDC 3QO2A 3DLLA 3EQLC 1V8QA 4FF1A 2ZXPA 3KF6A 3J81L 2E2JH 1DONA 3TMEA 1PYWD 3T1HL 2K01A 4JI5Q 1MD2D 4YCVA 1GM5A 1JWMD 1I6HH 4B3RQ 1R9TH 1Z47A 4LFAQ 2XTIA 3DM3A 3K5NA 1Y69U 1X9NA 4OEMB 1FGUA 3STBC 3VDYA 4LF5Q 2B2TA 4V0BA 1MJEA 3OIQA 1H95A 1VQJA 1XPUA 1EWIA 3KK7A 1SYEA 3CCLA 4IFDG 1DXMA 4DR4Q 4MIUA 5IT9L 3Q22A 5K5PA 1OXUA 5LHY1 1V1PA 2KEEA 4LF5L 3KUPA 2QDLA 2B2VC 4YCWA 2F0NA 3D31A 3S24A 4KY7A 4JI5L 1PHJA 1O7ZA 3RZDB 1IHZA 1I6VC 3HOXB 2WIIB 3J7A5 1SE2A 4BA2I 1HNZQ 4TSSA 3S15H 1A0IA 5FO7B 1BUVT 2CKZB 1LTBD 4BS9A 2WKDA 1J9OA 3HKSA 1W6JA 5I4DA 3SK4A 4YHHQ 2FFKB 2ZTDA 1HA6A 1Q8IA 4X64L 4B9XA 4H13C 4DR7L 4TQUS 1D2BA 1EL0A 3ULPA 4OO1G 2RF4A 4KTAA 1CA5A 1I4PA 4OELB 3SK5A 1U4LA 1R9TB 1EIFA 2BCOA 3HOVH 2VY3A 1LLRD 2PCFB 4XDXA 2LSSA 2N8NA 3CCQA 2NVTB 1IKMA 1KLUD 2G5DA 2ZM6Q 1PXUA 4DR1Q 3KF8B 1II3A 1GJXA 3I4MH 2BA1A 3R3OA 5HGQA 3H3VC 2Q8TA 1N8RC 2XWBB 3BDCA 1UE6A 3RLNA 1FD7D 2B63G 4ZKBB 2OWOA 2Z1CA 4A3IG 4GNXC 4ME5A 3K5OA 1BVSA 5EKKA 4P2CB 1WTWA 1VQHA 2RHSB 4DAVA 1RDPD 4OWTB 2JA6H 1A6XA 3TP7A 2F0LA 1ENFA 1B44D 3E3XA 1VQNA 4X66L 3PUYA 1Y8OB 2OEOA 3AMUA 2EE1A 2RCFA 2EY6A 2F52A 4K0KL 3QWNA 3EA6A 2EVBA 4QIWB 4C3IG 3AYHB 1S4ZA 4DR4L 1MI2A 5IY0A 2NBFA 4EGVA 2R93B 3K57A 4R8IA 2JSOA 1Y1WH 4IJLA 2K5QA 5FO9B 3VYSA 2HHHL 5IGFA 1LM0A 4CGYB 1WVLA 1X3GA 4H02A 3M4OB 2QA4A 1JMCA 3FRPB 3TS2A 5C4ZA 5IYDG 1A62A 1CSQA 3JAME 2WB1B 3OTOL 1WI5A 1LTID 1C9OA 1TVXA 2NN6H 3F2DA 4BY7H 1HQMC 1JOOA 1I5FA 2D5DA 2PNHA 4A3GG 3MA2B 1K8GA 1HRJA 4DAPA 3UDIA 2MPMA 2IWHA 2PYKA 1S5DD 3ULLA 5CORA 5LMNL 2XIWA 2NYZD 4AIMA 5JEAJ 2KEDA 5COYA 4A3CH 5C44G 4KHZA 1HFGA 5I6YA 1EIGA 1AE2A 5FLMH 2K5NA 2NN6I 4DR2Q 2H4OA 3MTSA 2EQSA 4A3MG 1HNZL 1QCBD 1O7IA 1YNXA 4LF6L 1SR3A 4A3IB 4QY7A 1WTRA 2JA5G 1KABA 1PH6A 3H3VI 3GP7A 4DXFA 1WCMG 1QB5D 4HSPA 4OGQC 4JI1Q 2CCZA 2R7FA 4GN4B 2E2HH 2J4XA 3ERQA 2Z4IA 4BY1G 1WTOA 4J1MA 4HCEA 1FNUA 3BS1A 4A3DH 3NPPA 3PSIA 1JWUD 4UY8C 1CZGA 4DA2A 2UXBL 2VS1A 2BH8A 1L0WA 1KNAA 1WTQA 2PMZB 4JPBW 1SNDA 2PW7A 3G7LA 5FKAC 4DV0L 3R8BA 3F2BA 4DV3L 4BXXH 2Y0SE 1JB7A 3RNUA 2B8FA 3FHWA 2F0KA 1EUJA 2RDFA 2LY7A 2OT2A 2PI2A 4PMCA 5CBAE 4BY7B 1T9HA 3FVQA 2FXQA 4OONA 3M4OH 4C1NI 4A3FH 4LF8L 1TWGH 1Q12A 4LUOA 2VUMB 1WD0A 2MUYA 3ZYYX 3E6ZX 3HOUG 1UUPA 2E8GA 5CMDA 2Z4HA 5D65A 1HA5A 5FLXc 2AHOB 1KLGD 1DCZA 3NENA 3SVMA 2IL8A 4KY5A 4CDDC 4G7HC 3BYTB 1VQ4A 5I9OA 4A3KH 3MZ5A 3S2DH 4GNXB 4CDFC 1GKHA 3I55A 3TP8A 3JAMc 4FF3A 5LMUQ 3DHQA 3BJUA 1VQMA 2F3IA 4XT3B 5A2QE 1JR0D 3SEBA 1J5EL 4L6TB 4C3IB 1CTMA 4AH6A 4A3EB 2RSOA 3I7FA 4JW0A 3CPFA 2NTSA 2KUMA 5IGCA 4FVMA 4DV5Q 2J7ZA 4YY3L 1EQRA 5C3EB 1G291 4ZUJA 4OO1H 1XWEA 2C35B 1VQ8A 3GTQB 2R7ZH 1KDBA 1YHQA 1EZ8A 1A3VA 1B3AA 4C2MH 4O2DA 5T1IA 5C0XI 1VMCA 3HOVB 1BCPB 2DY8A 4ZLTF 1EU4A 2B2UC 4K5WA 2UXDL 1S72A 4B3MQ 4HTHA 4OIJA 3K7UC 3NE5B 5C5MA 1E1TA 1DM0B 3PO2B 2CQAA 2BA0A 2QEXA 5IT9E 1C48A 3LWUA 2D0PA 1QNKA 2YU9B 2F0TA 3D4WA 4JI2L 3M3YH 4HMJA 3BZKA 1JORA 3GTKH 2N55A 2B2UA 1Q90A 5IWAQ 1RCVD 5M3MG 2DGYA 3KLSX 3JAMi 1IL2A 4FXDA 3TEHB 1SBBB 1PZKD 2UUBQ 2BOSA 2CW0D 3HOXH 4DNIA 1NR4A 1QG7A 4X65Q 4UP8A 5EBDA 2V4DA 3GTKB 2VUMG 1EEID 4PG3A 2PZWA 3GV3A 1HCZA 1FVIA 2FMCA 2A5HA 2ZJQA 1NE3A 4RGOS 5IYDH 1HJPA 2HIVA 4POFA 1K73C 1O7YA 3EROA 3LNNA 4JI7Q 4JBJA 4A3DB 4A3GH 1TWHB 4H7BA 4NKLA 3S1MB 5JVG3 3HRZC 1JCKB 3H0GH 1EY7A 3PGZA 2EJMA 4JYAL 4DV3Q 3I2ZA 1A63A 1KL9A 1CFMA 3GTMH 3KDFA 3R2TA 3IFDA 1Y1VH 2IPKD 3BZDB 4WJWA 1MSHA 2L0CA 1PA6A 1VF5C 4GS3A 4DK0A 2PNRC 1HR0L 3S1QB 5DAUA 3N6RA 4UAIA 4K0KQ 5GADC 3EN2A 4TKOB 3CCMA 3J81E 5DLQE 1LTSD 2RKSA 4DGZA 1ICWA 1STBA 1SNCA 2JEAI 3CP0A 3MXUA 3TREA 2Q8RE 4JBMA 3URYA 4FP5D 4JOIA 4A3CG 4BY1H 4QCLA 4LF6Q 4J15A 1L0YB 2I5HA 1UE5A 5FLMG 2R6GA 5ELDA 1PTOC 2E2DC 3U9SA 2QGQA 1KNEA 4KKSA 1AZPA 3J81i 1CKOA 1PRTB 1EY9A 4KD4A 3QR8A 4NP5A 3SGIA 3CC7A 1JT8A 1LT5D 2JA7G 1WOCA 1E7ZA 3L9AX 2XSCA 4QUCA 1ICFB 2CQOA 3NHHA 2RVLA 3I4MB 2RHQB 4MTKA 4AYBG 3K5MA 2GVAA 2WACA 5L37A 3KLSA 1RF2D 2XRSD 2F0QA 1Q1EA 3OTOQ 4DAMA 4XIGS 3S1MH 1HQRD 4DV4L 1F9SA 5KGUA 1BBUA 4R4IA 3UDFA 5K36G 4KY6A 1HZ9A 4EQNA 4IFDI 1BF4A 3NTHA 2GVBA 1YEZA 2NWGA 2F0JA 4KHPL 1RJTA 1PVOA 1IW7C 1XMOL 1LTRD 4NXMQ 1PTOD 2L15A 1C8CA 1YHBA 2KQ3A 5JVH3 3OW7A 4RA8A 1K3BC 3PO2G 4X62Q 3HOUH 1MKHA 1O7LA 1I3QB 4IUPA 2Z8LA 3I4NB 1KQSA 3D0FA 5EKLA 3CF5A 4IPHA 1VMPA 4ILWA 3RZOB 2MO1A 3FKIB 4GLAC 5IP9G 1EYGA 2IX1A 1V1PB 3J80i 1Y1WB 4NMZA 1PRTF 1DOLA 5JEAH 3I3CA 2A73B 3TDQA 4EVOA 3DWQA 1Q86C 2ZM6L 4DR1L 3GTPB 1U4RA 2K1BA 3JAML 2YTXA 1PRTC 4F8MA 1LTGD 3WWVA 3AU7A 1M1KC 4GLXA 2E5LQ 2A68C 1RODA 4J6HA 2DNEA 4M1UB 1BO0A 4B3RL 4KKTA 3R93A 2JEBI 2WP8J 2F0GA 3KBGA 1B9NA 3VA5A 4EQOA 3SXHA 4Y7NH 3K7AH 4BBRG 5C3WA 3CQZB 4I65A 3T53B 2OCEA 3MXNB 4XT1B 3GTQH 1QUQA 2VQEQ 5AFWA 2Q8IB 3HOUB 2F4VL 3T51B 1G2SA 3EVQA 4U673 4LWCA 2VZAA 4PZ8A 3T16A 4Y7NB 3TSSA 4LF7L 2EDGA 5M3MH 3ONAB 3K58A 4BBRB 4A3KB 3A56A 2E2IB 2HQEA 2UXDQ 1VQAA 5ELFA 1V9PA 1JOKA 1SXTA 4DK3C 4WJ3M 1V1QA 1VS0A 2AWOA 1SYBA 3GTGH 4F87A 1HH2P 2O5IC 4ZK9B 2IHEA 4C3JG 5GAHC 1EWHA 2H5XA 1YNJC 1XMQL 2OQKA 3C1FA 1O78A 3S14H 4JBKA 2VUMH 2M00A 1JJGA 1PH1A 1WD1A 3H94A 4DAYA 4DV1L 4EQPA 1ILQA 4A3EH 2EY5A 3CXCA 2MGSA 4WORA 1RKNA 4E6IA 1JE4A 1BDOA 4JI4Q 1KXLA 4GKKQ 4LUVA 1LTLA 2JN4A 3CCJA 5IP7H 4DV2L 4MTNA 1N36Q 1QZGA 4IALA 1E2VA 2WV6D 1D5XC 3PO3H 2OQ0A 1UEBA 1G2TA 2F0UA 4DV2Q 4B3TQ 1J6QA 4P74A 1U4MA 4A3IH 2NVYB 2AUJD 1ZXTA 3K80C 4APVA 4GN3B 2AQ3B 1TWGB 1IYUA 1VF7A 3SR1A 1SLJA 2E2HB 1B2TA 4QMGA 4A93G 1X32A 1U4PA 3KJOA 1SAPA 5IT9c 2LMCB 3ND9A 2AQ2B 4A3JB 1HHVA 1GHJA 1BBWA 1VQGA 1UE7A 1B53A 5C4JB 1PFBA 2JK8A 5CV7A 1K8OA 3ZJYC 1KIXA 1XPOA 3K81C 5IGGA 3GTJB 1RHPA 2D62A 1GUSA 3M85A 4NDXA 2B2TC 2ALYB 4B3SL 1R4PB 4LFBQ 2ZJRA 2D2CC 1H9JA 2F0PA 4LF4Q 5FO8B 1XPRA 1K8MA 1ZEQX 4IUUA 4DV7L 3HEJA 2DNCA 4ZCKA 4WRDA 1VQ6A 5ELCA 3TZDA 3CCUA 3G6EA 3T56B 4IUTA 3K59A 1CKNA 2ENBA 1BCPC 4DK6C 1CHQD 5IP9H 4PZ7A 2MQHA 3VR4A 2NVXB 1LTAD 5EQ0A 5EGTA 1A3UA 1CKMA 5JEAG 1SYGA 1LUZA 2KHSA 2SOBA 1RTNA 1SSOA 1TS4A 2H1EA 5HY6A 1F9QA 3K0YA 5IYBG 3U4ZA 4JI3L 3D4DA 2GA4B 1AEXA 5EKIA 3L0OA 4JCVE 3TN2A 2K5WA 1JJ2A 1PTOB 1RTOA 3DM1A 3T1HQ 2VNUD 2KCCA 4OWXB 1CSPA 4RFBA 1YIJA 3NBIA 1EYAA 2OXPA 1YI2A 1QILA 2EYPA 2RSNA 4Y52H 2CWPA 4DV6Q 1BBXC 1NNXA 4ODGA 2HT1A 1DOMA 1N36L 3CC4A 3S1QH 5M5XH 1VQLA 2XWJB 1LTTD 4DV7Q 1QJOA 3KF6B 1PZID 4BA1I 3RMHA 4LF4L 2UUCL 1EIHA 3GTPH 3BZCA 3BVZA 2KA7A 1BR9A 4A3FG 5EPLA 4BWGB 3U50C 4DV1Q 1Y14B 3B6YA 2EJGC 4BBRH 4L63B 3Q6SA 1HNXL 3BDLA 4IUQA 4O1NA 2KOLA 1B70B 2ES2A 2UUAL 4IOAA 2FMMA 4Q0FA 5CC4A 3GTOH 1Q82C 2CHBD 3CHBD 2RDHA 3S15B 4C3HH 1IW7D 5EPJA 5DEHA 4A3FB 1T5XD 4HJ9A 3GTLH 3I70A 4UP7A 3VR3A 2F3WA 1X65A 3EBEA 5IOCA 3GTOB 4K8JA 1QE6A 1GVPA 1SNMA 2DUDA 1LO5D 5C3EG 1CZWA 3FPPA 1V1OA 4OX9Q 1TKWB 4A3EG 2JYOA 5C4XG 2EYJA 1C7YA 1NCVA 5ELBA 2F1MA 1EFWA 3W3AA 2IT1A
chains in the Genus database with same CATH topology
2WB1E 3AFQA 5ELOA 5JJIA 4JI2L 4JBWA 1HR0Q 3M3YH 1E1OA 2XGTA 1S40A 2N78A 4R1JA 1IBLL 1B8AA 3BZKA 2Q2IA 1PV4A 3GTKH 4GKKL 4FDBA 3HOXG 3S1RH 1OTCA 1PYSB 1SRUA 3IRBA 5IWAQ 3KJPA 2HIXA 3H0GG 5M3MG 2DGYA 3HKZG 1VQPA 1WJJA 4B3SQ 4JYAQ 3JAMi 1HZBA 1I50H 5C3EH 1IL2A 1Y1VG 3TEHB 5JJLA 2UU9Q 2UUBQ 3HOXH 2PQAB 3F1ZA 4DNIA 3K8AA 3I4MG 3MEFA 1CUKA 4R4OA 5IYCG 4X65Q 5EAYA 4AQYL 3ICEA 2RCNA 2JQOA 1VQBA 2IX0A 4UP8A 5IP7G 1IBML 3LGJA 1OXVA 1N9WA 3KDFB 5C0XG 4PG3A 2K5VA 2VUMG 1L2FA 2NVTH 1HZAA 1FVIA 4L5TA 3M4QA 5C4JH 4PMWA 3PUVA 4A93H 2ZJQA 1NE3A 4DR6Q 1FL0A 5IYDH 1QUQB 3I56A 1HJPA 1IBMQ 5GAEC 2HIVA 3U4VA 4POFA 2LXJA 1K73C 4L5SA 1JE5A 1VQ5A 4TVAB 1KRTA 1J5EQ 4JI7Q 4GN5A 4JBJA 4X6AH 4A3GH 4HIKA 3CCSA 4GOPA 2UUBL 4DV4Q 1VQ9A 4LFAL 1XNQQ 4OXPA 3H0GH 3PGZA 4JYAL 4DV3Q 3I2ZA 1A63A 1KL9A 2MFIA 4DR7Q 3GTMH 3KDFA 1Y1VH 3HFZB 2R92H 1PA6A 1IXRA 2IY5B 4GS3A 3W1GA 1K8AC 2NVYH 1Q8KA 1HR0L 1WFQA 4IOCA 4POGA 5H1SE 4A3BH 4HJ5A 1VQFA 4X62L 3RLFA 3CCRA 1I94Q 4K0KQ 3TQYA 5GAGC 2Q2HA 5GADC 3EN2A 3CCMA 3M4PA 4GOPB 2ZTCA 1I3QH 5DLQE 1L1OA 3T1YL 4X66Q 3CQZH 3AFPA 5E7NA 2JEAI 2K52A 1UE1A 1MIUA 3CP0A 3TREA 4NXNL 1QZHA 1E3PA 2OTLA 4L5RC 4JBMA 4LFCQ 4JOIA 4LF8Q 2EXDA 2WB1G 4A3CG 3G71A 4BY1H 4QQBX 3HKZE 3FP9A 1IBLQ 4LF6Q 3J81c 4J15A 3KFUA 2A1AA 2I5HA 1UE5A 1YVCA 4ME3A 4P75A 5FLMG 4B3ML 2R6GA 3HOWH 3S2HH 2JA7H 4GOPC 2QGQA 3GTJH 3PF5A 3W1BA 3G48A 3T1YQ 4EQ5A 3J81i 1CKOA 3I4NG 3RR5A 3SGIA 3CC7A 4DUZQ 1JT8A 4DR3Q 4DKAC 4BBSG 2JA7G 2KCTA 5AJ3L 4OX9L 1NY4A 1TWAH 1YZ6A 3UDXA 1WOCA 3M9BA 1OXSC 3PUWA 1PH7A 4A3LG 2UXCL 1E7ZA 1K83H 2CQOA 2KHIA 1N33Q 2RHQB 4AYBG 5IYBH 2B3GA 4DV5L 1N32L 4P71A 2GVAA 1G51A 4YWKA 3J7ZC 2VQFQ 1IZ6A 1QVGA 4A3JG 4P72A 1E24A 1Q1EA 4MNOA 3OTOQ 1HNXQ 4DAMA 4XIGS 3FKIH 1SN8A 3S1MH 4DV4L 1BBUA 1E22A 4R4QA 5LMUL 4R4IA 3UDFA 4JI6L 3PF4A 4WJ4A 5K36G 4UP9A 1HZ9A 4IFDI 1WCMH 1PH3A 4JI7L 4DUYL 1VQCA 3E9HA 2GVBA 2Z0SA 3F8TA 1YEZA 4JI8Q 1RL2A 4KHPL 3KYHC 1PVOA 1JJCB 1XMOL 1M90C 2E2IH 4NXMQ 2K50A 2L15A 3RN2A 1X55A 3G4SA 4HIDA 1TWHH 4NXNQ 4OWWB 1YHBA 2V1CC 1YITA 3AEVA 4X65L 4AQYQ 2R7DA 3GO5A 2WAQE 2I5MX 3PO2G 1G6PA 1RIPA 1HNWQ 3DLLA 4X62Q 1I94L 3HOUH 1ASYA 1MKHA 3HOZG 2A8VA 1IYJB 3KF6A 2E2JH 1KQSA 4NXML 3D0FA 3CF5A 1XMOQ 4IPHA 3T1HL 4ALPA 2JA8G 3H15A 4JI5Q 2VW9A 4YCVA 4P73A 1GM5A 4JI8L 1I6HH 3CW2C 5GQOA 4B3RQ 4DUYQ 2MO1A 2HQLA 2PMZE 2NZHA 4GLAC 2YTVA 5IP9G 1R9TH 2KBNA 1EYGA 1HZCA 2IX1A 3J80i 5C0XJ 1Z47A 4LFAQ 2XTIA 3DM3A 1X9NA 4LF5Q 1XNQL 4DV6L 1FGUA 3STBC 3VDYA 4R4CA 1X56A 2JA9A 4NPSA 1MJEA 1N34Q 1H95A 1VQJA 1XPUA 4YWMA 4QGUA 3ULJA 3HOYG 2NVQH 1NBWA 2ZM6L 4DR1L 1Q86C 5BR8Q 1EWIA 3CCLA 3PO2H 4DPGA 1W3SA 5M5YH 2R93H 1VQOA 2YTXA 4IFDG 4DR4Q 1N34L 1PFSA 1OXUA 3WWVA 1M1KC 4OO1I 1HR0W 2KHJA 4DR3L 1YJNA 4GLXA 2E5LQ 4LF5L 2Z6KA 1KHIA 2UU9L 1UWVA 3CAMA 4B3RL 1U0LA 4YCWA 2JEBI 2WP8J 1SFOH 1QVFA 3D31A 2AMCB 3S24A 4HIMA 4HIOA 4JI5L 2YYZA 2EIFA 4GLVB 4QIWE 1PHJA 2K75A 3AQQA 4Y7NH 2B29A 1NMFA 4JI4L 3K7AH 2A19A 4BBRG 3S1NH 3J7A5 4BA2I 4LFCL 1HNZQ 2OCEA 3MXNB 3GTQH 1A0IA 3HOYH 3S15H 1QUQA 1VQEA 2VQEQ 2UUAQ 2R93G 2CKZB 2F4VL 1FJGL 3HKSA 4LF7L 4LWCA 2VZAA 4PZ8A 2KCMA 5C4XH 5M3FH 4YHHQ 5M3MH 1D8LA 4GKJQ 2N3SA 4IFDJ 2ZTDA 1X6OA 4X64L 1YJ9A 2B63H 1EIYB 2UXDQ 1VQAA 4JG2A 1V9PA 4DK3C 4DR7L 4WJ3M 4TQUS 1V1QA 5FJ8H 2K5HA 1VS0A 3U58A 3HOVG 2AWOA 3ULPA 4OO1G 2RF4A 3GTGH 3KLWA 2JA6G 1K3RA 1HH2P 2CFMA 3NEMA 1L1OB 2IHEA 1EIFA 3CMAA 1AE3A 3HOVH 2GN5A 2VY3A 2LSSA 2N8NA 3CCQA 5GAHC 2PI2E 2H5XA 1XMQL 2OQKA 2N49A 1WYDA 5BR8L 2ZM6Q 4DR1Q 4GKJL 3KF8B 1D7QA 4YHHL 4B3TL 3I4MH 1XTDA 2BA1A 3GD7A 5HGQA 5AJ3Q 4HJ7A 3M7NA 3S14H 3I4OA 1N8RC 4LF9L 1UE6A 3KOJA 4IPCA 3RLNA 4JBKA 2ATWA 2VUMH 1PH1A 2B63G 4JV5Q 1JJGA 1VQKA 4DV1L 2OWOA 3PCOB 3E9IA 4A3IG 4GNXC 4A3EH 3RZDH 1BVSA 1Y1WG 2WAQG 2WFWA 3CXCA 2MNAA 2CWAA 1VQHA 4A3BG 2JE6I 5IWAL 3S17H 3CC2A 2RHSB 4OWTB 5LMNW 4JI4Q 2JA6H 3RLOA 4GKKQ 4LUVA 1ASZA 1KXLA 5ELNA 1LTLA 2LXKA 4C3JH 3CCJA 5IP7H 4DV2L 4MTNA 2Q2UA 3A5ZB 4C3IH 1N36Q 1VQNA 4X66L 1TWFH 2NN6G 3W5OA 1QZGA 3L7ZC 3PUYA 1K9MC 4JI0Q 2K4KA 3GDEA 4LUZA 1A8VA 1IBKQ 3NELA 2F52A 4DR5Q 4K0KL 4YWLA 2NVXH 3EIVA 3PO3H 4JV5L 1VQDA 3BU2A 2OQ0A 4LF9Q 4RG1A 1UEBA 3AYHB 3HOWG 4DV2Q 4DR4L 3CCVA 3JC66 5IY0A 4B3TQ 1J6QA 4P74A 1PYBA 4A3IH 1Q46A 1X54A 1Y1WH 5C44H 4IJLA 3PO3G 3K80C 2HHHL 4APVA 4GN3B 1KD1C 3TS0A 3CCEA 1SE8A 1LM0A 4BY7G 3UE1A 1X3GA 4H02A 1SLJA 1P16A 4A3MH 3J80c 2MO0A 2QA4A 1JMCA 4A3LH 3TS2A 4A93G 2IHFA 1V43A 5IYDG 1A62A 1CSQA 3OTOL 3F2CA 2ID0A 1WI5A 5IT9c 3KJOA 1C9OA 3F2DA 4BY7H 3RN5A 3UE0A 1I5FA 2PNHA 5IE8A 4A3GG 1K8GA 2Q2TA 1PH9A 1N33L 3UDIA 1BBWA 3ULLA 1XMQQ 1VQGA 1UE7A 5LMNL 3K0XA 2UXCQ 4YY3Q 1KC8C 2JK8A 1XNRQ 3ZJYC 4AIMA 4A76A 1KIXA 1XPOA 3K81C 1VQ7A 2R92G 2D0OA 4DAYB 1KAWA 2D62A 5JEAJ 2JJQA 1VCIA 2YV5A 3M85A 2I0QA 4A3CH 5C44G 4XTCS 4HJAA 1FJGQ 5GROA 2ZTEA 2ALYB 4KHZA 4B3SL 4IO9A 2VQEL 4A75A 1AE2A 1KRSA 5FLMH 2K5NA 1LYLA 1OXTA 2YTYA 2NN6I 3ERSX 4LFBQ 1CKNB 4DR2Q 3CD6A 5JJKA 1HNZL 2EQSA 2ZJRA 4AYBE 4A3MG 3A0JA 1O7IA 1YNXA 4LF6L 1SR3A 4X64Q 1YJWA 2UUCQ 3FKIG 3OW2A 4QY7A 4LF4Q 4KHPQ 2JA5G 1XPRA 1NMGA 4A3DG 1PH6A 4GNXA 4JOIC 3H3VI 3CPWA 4DV7L 1WCMG 4DR2L 2E2HH 4JI1Q 2CCZA 2R7FA 4GN4B 2Z6KC 4IPGA 3PUXA 3HOZH 4BY1G 1VQ6A 2I5LX 3CCUA 2JA5H 1SROA 3G6EA 4YCUA 5M5WH 4JI0L 4A3DH 1QVCA 4EX5A 3UDGA 1C0AA 1VQIA 3PSIA 1W2BA 4UY8C 1CKNA 1TXYA 2K14A 1N32Q 2UXBL 2VS1A 2BH8A 1L0WA 4DK6C 5IP9H 4PZ7A 2MQHA 3I4NH 4QJFA 1DGSA 4QL5A 4BBSH 4DV0L 1OXXK 1CKMA 5JEAG 3STBD 3F2BA 1LUZA 4LW1A 1YHAA 4DV3L 4BXXH 1X3FA 3J81j 2Y0SE 1JB7A 3RNUA 2OTJA 1Q81C 5HY6A 1YBYA 4JI3Q 1Q1BA 3FHWA 5IYBG 3U4ZA 4JI3L 1EUJA 4RMFA 4A3KG 4O0AA 3A5UA 2E5LL 4NB3A 3L0OA 4IPDA 2PI2A 4JCVE 1S3OA 4A3JH 1PH2A 1T9HA 1JJ2A 3PUZA 4BXXG 3OYYA 2FXQA 4OONA 3M4OH 4DR6L 4DV0Q 4A3FH 3T1HQ 3CMEA 4PZ6A 2VNUD 4OWXB 4HJ8A 4KI0A 1TWGH 4LF8L 4KLKA 1Q12A 1CSPA 4LUOA 1L1OC 1YIJA 1XJVA 3HOUG 2E8GA 1SMXA 1P8LA 2UXBQ 1YI2A 1HNWL 4Y52H 2CWPA 4DR5L 2NZOA 5FLXc 2AHOB 4DV6Q 1PH5A 2JA8H 1IBKL 3E0EA 3NENA 2HT1A 4JC0A 2AKWB 4R4TA 4LNQA 1N36L 3CC4A 3S1QH 5M5XH 3NBHB 1VQLA 1K0RA 4JI1L 3A74A 1MJCA 4DV7Q 3KF6B 4BA1I 1PH8A 1VQ4A 4A3KH 1B7YB 4LF4L 3S2DH 4GNXB 2UUCL 2YU9H 1NJIC 3GTPH 1GKHA 3BZCA 3I55A 3JAMc 4A3FG 4LF7Q 1U5KA 5LMUQ 2VL6A 3BJUA 2ASBA 4LFBL 2ZJPA 1VQMA 2F3IA 3U50C 1PH4A 4DV1Q 1Y14B 3B6YA 4BBRH 1J5EL 2F4VQ 1HNXL 2PQAA 2UUAL 4AH6A 1B70B 2ES2A 3I7FA 3CPFA 4MZ9A 4IOAA 1GO3E 3PV0A 1XNRL 4DV5Q 4YY3L 1EQRA 3RZOH 3GTOH 1G291 3L2PA 1Q82C 5LMNQ 1GD7A 1X3EA 2C35B 1VQ8A 3Q8DA 2AWNA 4C3HH 2R7ZH 4UPAA 1YHQA 4HJ9A 4DUZL 4IJHA 5M3FG 4L5QA 3GTLH 4C2MH 4O2DA 5C0XI 1NTGA 4UP7A 4JI6Q 1TWCH 1EOVA 1X65A 3EBEA 3S16H 2VQFL 2R7ZG 4A4IA 2UXDL 1S72A 4B3MQ 1GVPA 3K7UC 2HHHQ 5FJ8G 1Z9FA 1BKBA 1E1TA 3PIPA 2DUDA 2BH2A 5C3EG 3ER0A 1EQQA 1Q7YC 2KENA 3PIOA 4JI2Q 2BA0A 2QEXA 4OX9Q 3TRZA 4A3EG 5IYCH 5C4XG 3H3VH 1AH9A 1C7YA 5J3BA 1EFWA 2Y0SG 2D0PA 2IT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 E;  3AFQ A;  5ELO A;  5JJI A;  4JI2 L;  4JBW A;  1HR0 Q;  3M3Y H;  1E1O A;  2XGT A;  1S40 A;  2N78 A;  4R1J A;  1IBL L;  1B8A A;  3BZK A;  2Q2I A;  1PV4 A;  3GTK H;  4GKK L;  4FDB A;  3HOX G;  3S1R H;  1OTC A;  1PYS B;  1SRU A;  3IRB A;  5IWA Q;  3KJP A;  2HIX A;  3H0G G;  5M3M G;  2DGY A;  3HKZ G;  1VQP A;  1WJJ A;  4B3S Q;  4JYA Q;  3JAM i;  1HZB A;  1I50 H;  5C3E H;  1IL2 A;  1Y1V G;  3TEH B;  5JJL A;  2UU9 Q;  2UUB Q;  3HOX H;  2PQA B;  3F1Z A;  4DNI A;  3K8A A;  3I4M G;  3MEF A;  1CUK A;  4R4O A;  5IYC G;  4X65 Q;  5EAY A;  4AQY L;  3ICE A;  2RCN A;  2JQO A;  1VQB A;  2IX0 A;  4UP8 A;  5IP7 G;  1IBM L;  3LGJ A;  1OXV A;  1N9W A;  3KDF B;  5C0X G;  4PG3 A;  2K5V A;  2VUM G;  1L2F A;  2NVT H;  1HZA A;  1FVI A;  4L5T A;  3M4Q A;  5C4J H;  4PMW A;  3PUV A;  4A93 H;  2ZJQ A;  1NE3 A;  4DR6 Q;  1FL0 A;  5IYD H;  1QUQ B;  3I56 A;  1HJP A;  1IBM Q;  5GAE C;  2HIV A;  3U4V A;  4POF A;  2LXJ A;  1K73 C;  4L5S A;  1JE5 A;  1VQ5 A;  4TVA B;  1KRT A;  1J5E Q;  4JI7 Q;  4GN5 A;  4JBJ A;  4X6A H;  4A3G H;  4HIK A;  3CCS A;  4GOP A;  2UUB L;  4DV4 Q;  1VQ9 A;  4LFA L;  1XNQ Q;  4OXP A;  3H0G H;  3PGZ A;  4JYA L;  4DV3 Q;  3I2Z A;  1A63 A;  1KL9 A;  2MFI A;  4DR7 Q;  3GTM H;  3KDF A;  1Y1V H;  3HFZ B;  2R92 H;  1PA6 A;  1IXR A;  2IY5 B;  4GS3 A;  3W1G A;  1K8A C;  2NVY H;  1Q8K A;  1HR0 L;  1WFQ A;  4IOC A;  4POG A;  5H1S E;  4A3B H;  4HJ5 A;  1VQF A;  4X62 L;  3RLF A;  3CCR A;  1I94 Q;  4K0K Q;  3TQY A;  5GAG C;  2Q2H A;  5GAD C;  3EN2 A;  3CCM A;  3M4P A;  4GOP B;  2ZTC A;  1I3Q H;  5DLQ E;  1L1O A;  3T1Y L;  4X66 Q;  3CQZ H;  3AFP A;  5E7N A;  2JEA I;  2K52 A;  1UE1 A;  1MIU A;  3CP0 A;  3TRE A;  4NXN L;  1QZH A;  1E3P A;  2OTL A;  4L5R C;  4JBM A;  4LFC Q;  4JOI A;  4LF8 Q;  2EXD A;  2WB1 G;  4A3C G;  3G71 A;  4BY1 H;  4QQB X;  3HKZ E;  3FP9 A;  1IBL Q;  4LF6 Q;  3J81 c;  4J15 A;  3KFU A;  2A1A A;  2I5H A;  1UE5 A;  1YVC A;  4ME3 A;  4P75 A;  5FLM G;  4B3M L;  2R6G A;  3HOW H;  3S2H H;  2JA7 H;  4GOP C;  2QGQ A;  3GTJ H;  3PF5 A;  3W1B A;  3G48 A;  3T1Y Q;  4EQ5 A;  3J81 i;  1CKO A;  3I4N G;  3RR5 A;  3SGI A;  3CC7 A;  4DUZ Q;  1JT8 A;  4DR3 Q;  4DKA C;  4BBS G;  2JA7 G;  2KCT A;  5AJ3 L;  4OX9 L;  1NY4 A;  1TWA H;  1YZ6 A;  3UDX A;  1WOC A;  3M9B A;  1OXS C;  3PUW A;  1PH7 A;  4A3L G;  2UXC L;  1E7Z A;  1K83 H;  2CQO A;  2KHI A;  1N33 Q;  2RHQ B;  4AYB G;  5IYB H;  2B3G A;  4DV5 L;  1N32 L;  4P71 A;  2GVA A;  1G51 A;  4YWK A;  3J7Z C;  2VQF Q;  1IZ6 A;  1QVG A;  4A3J G;  4P72 A;  1E24 A;  1Q1E A;  4MNO A;  3OTO Q;  1HNX Q;  4DAM A;  4XIG S;  3FKI H;  1SN8 A;  3S1M H;  4DV4 L;  1BBU A;  1E22 A;  4R4Q A;  5LMU L;  4R4I A;  3UDF A;  4JI6 L;  3PF4 A;  4WJ4 A;  5K36 G;  4UP9 A;  1HZ9 A;  4IFD I;  1WCM H;  1PH3 A;  4JI7 L;  4DUY L;  1VQC A;  3E9H A;  2GVB A;  2Z0S A;  3F8T A;  1YEZ A;  4JI8 Q;  1RL2 A;  4KHP L;  3KYH C;  1PVO A;  1JJC B;  1XMO L;  1M90 C;  2E2I H;  4NXM Q;  2K50 A;  2L15 A;  3RN2 A;  1X55 A;  3G4S A;  4HID A;  1TWH H;  4NXN Q;  4OWW B;  1YHB A;  2V1C C;  1YIT A;  3AEV A;  4X65 L;  4AQY Q;  2R7D A;  3GO5 A;  2WAQ E;  2I5M X;  3PO2 G;  1G6P A;  1RIP A;  1HNW Q;  3DLL A;  4X62 Q;  1I94 L;  3HOU H;  1ASY A;  1MKH A;  3HOZ G;  2A8V A;  1IYJ B;  3KF6 A;  2E2J H;  1KQS A;  4NXM L;  3D0F A;  3CF5 A;  1XMO Q;  4IPH A;  3T1H L;  4ALP A;  2JA8 G;  3H15 A;  4JI5 Q;  2VW9 A;  4YCV A;  4P73 A;  1GM5 A;  4JI8 L;  1I6H H;  3CW2 C;  5GQO A;  4B3R Q;  4DUY Q;  2MO1 A;  2HQL A;  2PMZ E;  2NZH A;  4GLA C;  2YTV A;  5IP9 G;  1R9T H;  2KBN A;  1EYG A;  1HZC A;  2IX1 A;  3J80 i;  5C0X J;  1Z47 A;  4LFA Q;  2XTI A;  3DM3 A;  1X9N A;  4LF5 Q;  1XNQ L;  4DV6 L;  1FGU A;  3STB C;  3VDY A;  4R4C A;  1X56 A;  2JA9 A;  4NPS A;  1MJE A;  1N34 Q;  1H95 A;  1VQJ A;  1XPU A;  4YWM A;  4QGU A;  3ULJ A;  3HOY G;  2NVQ H;  1NBW A;  2ZM6 L;  4DR1 L;  1Q86 C;  5BR8 Q;  1EWI A;  3CCL A;  3PO2 H;  4DPG A;  1W3S A;  5M5Y H;  2R93 H;  1VQO A;  2YTX A;  4IFD G;  4DR4 Q;  1N34 L;  1PFS A;  1OXU A;  3WWV A;  1M1K C;  4OO1 I;  1HR0 W;  2KHJ A;  4DR3 L;  1YJN A;  4GLX A;  2E5L Q;  4LF5 L;  2Z6K A;  1KHI A;  2UU9 L;  1UWV A;  3CAM A;  4B3R L;  1U0L A;  4YCW A;  2JEB I;  2WP8 J;  1SFO H;  1QVF A;  3D31 A;  2AMC B;  3S24 A;  4HIM A;  4HIO A;  4JI5 L;  2YYZ A;  2EIF A;  4GLV B;  4QIW E;  1PHJ A;  2K75 A;  3AQQ A;  4Y7N H;  2B29 A;  1NMF A;  4JI4 L;  3K7A H;  2A19 A;  4BBR G;  3S1N H;  3J7A 5;  4BA2 I;  4LFC L;  1HNZ Q;  2OCE A;  3MXN B;  3GTQ H;  1A0I A;  3HOY H;  3S15 H;  1QUQ A;  1VQE A;  2VQE Q;  2UUA Q;  2R93 G;  2CKZ B;  2F4V L;  1FJG L;  3HKS A;  4LF7 L;  4LWC A;  2VZA A;  4PZ8 A;  2KCM A;  5C4X H;  5M3F H;  4YHH Q;  5M3M H;  1D8L A;  4GKJ Q;  2N3S A;  4IFD J;  2ZTD A;  1X6O A;  4X64 L;  1YJ9 A;  2B63 H;  1EIY B;  2UXD Q;  1VQA A;  4JG2 A;  1V9P A;  4DK3 C;  4DR7 L;  4WJ3 M;  4TQU S;  1V1Q A;  5FJ8 H;  2K5H A;  1VS0 A;  3U58 A;  3HOV G;  2AWO A;  3ULP A;  4OO1 G;  2RF4 A;  3GTG H;  3KLW A;  2JA6 G;  1K3R A;  1HH2 P;  2CFM A;  3NEM A;  1L1O B;  2IHE A;  1EIF A;  3CMA A;  1AE3 A;  3HOV H;  2GN5 A;  2VY3 A;  2LSS A;  2N8N A;  3CCQ A;  5GAH C;  2PI2 E;  2H5X A;  1XMQ L;  2OQK A;  2N49 A;  1WYD A;  5BR8 L;  2ZM6 Q;  4DR1 Q;  4GKJ L;  3KF8 B;  1D7Q A;  4YHH L;  4B3T L;  3I4M H;  1XTD A;  2BA1 A;  3GD7 A;  5HGQ A;  5AJ3 Q;  4HJ7 A;  3M7N A;  3S14 H;  3I4O A;  1N8R C;  4LF9 L;  1UE6 A;  3KOJ A;  4IPC A;  3RLN A;  4JBK A;  2ATW A;  2VUM H;  1PH1 A;  2B63 G;  4JV5 Q;  1JJG A;  1VQK A;  4DV1 L;  2OWO A;  3PCO B;  3E9I A;  4A3I G;  4GNX C;  4A3E H;  3RZD H;  1BVS A;  1Y1W G;  2WAQ G;  2WFW A;  3CXC A;  2MNA A;  2CWA A;  1VQH A;  4A3B G;  2JE6 I;  5IWA L;  3S17 H;  3CC2 A;  2RHS B;  4OWT B;  5LMN W;  4JI4 Q;  2JA6 H;  3RLO A;  4GKK Q;  4LUV A;  1ASZ A;  1KXL A;  5ELN A;  1LTL A;  2LXK A;  4C3J H;  3CCJ A;  5IP7 H;  4DV2 L;  4MTN A;  2Q2U A;  3A5Z B;  4C3I H;  1N36 Q;  1VQN A;  4X66 L;  1TWF H;  2NN6 G;  3W5O A;  1QZG A;  3L7Z C;  3PUY A;  1K9M C;  4JI0 Q;  2K4K A;  3GDE A;  4LUZ A;  1A8V A;  1IBK Q;  3NEL A;  2F52 A;  4DR5 Q;  4K0K L;  4YWL A;  2NVX H;  3EIV A;  3PO3 H;  4JV5 L;  1VQD A;  3BU2 A;  2OQ0 A;  4LF9 Q;  4RG1 A;  1UEB A;  3AYH B;  3HOW G;  4DV2 Q;  4DR4 L;  3CCV A;  3JC6 6;  5IY0 A;  4B3T Q;  1J6Q A;  4P74 A;  1PYB A;  4A3I H;  1Q46 A;  1X54 A;  1Y1W H;  5C44 H;  4IJL A;  3PO3 G;  3K80 C;  2HHH L;  4APV A;  4GN3 B;  1KD1 C;  3TS0 A;  3CCE A;  1SE8 A;  1LM0 A;  4BY7 G;  3UE1 A;  1X3G A;  4H02 A;  1SLJ A;  1P16 A;  4A3M H;  3J80 c;  2MO0 A;  2QA4 A;  1JMC A;  4A3L H;  3TS2 A;  4A93 G;  2IHF A;  1V43 A;  5IYD G;  1A62 A;  1CSQ A;  3OTO L;  3F2C A;  2ID0 A;  1WI5 A;  5IT9 c;  3KJO A;  1C9O A;  3F2D A;  4BY7 H;  3RN5 A;  3UE0 A;  1I5F A;  2PNH A;  5IE8 A;  4A3G G;  1K8G A;  2Q2T A;  1PH9 A;  1N33 L;  3UDI A;  1BBW A;  3ULL A;  1XMQ Q;  1VQG A;  1UE7 A;  5LMN L;  3K0X A;  2UXC Q;  4YY3 Q;  1KC8 C;  2JK8 A;  1XNR Q;  3ZJY C;  4AIM A;  4A76 A;  1KIX A;  1XPO A;  3K81 C;  1VQ7 A;  2R92 G;  2D0O A;  4DAY B;  1KAW A;  2D62 A;  5JEA J;  2JJQ A;  1VCI A;  2YV5 A;  3M85 A;  2I0Q A;  4A3C H;  5C44 G;  4XTC S;  4HJA A;  1FJG Q;  5GRO A;  2ZTE A;  2ALY B;  4KHZ A;  4B3S L;  4IO9 A;  2VQE L;  4A75 A;  1AE2 A;  1KRS A;  5FLM H;  2K5N A;  1LYL A;  1OXT A;  2YTY A;  2NN6 I;  3ERS X;  4LFB Q;  1CKN B;  4DR2 Q;  3CD6 A;  5JJK A;  1HNZ L;  2EQS A;  2ZJR A;  4AYB E;  4A3M G;  3A0J A;  1O7I A;  1YNX A;  4LF6 L;  1SR3 A;  4X64 Q;  1YJW A;  2UUC Q;  3FKI G;  3OW2 A;  4QY7 A;  4LF4 Q;  4KHP Q;  2JA5 G;  1XPR A;  1NMG A;  4A3D G;  1PH6 A;  4GNX A;  4JOI C;  3H3V I;  3CPW A;  4DV7 L;  1WCM G;  4DR2 L;  2E2H H;  4JI1 Q;  2CCZ A;  2R7F A;  4GN4 B;  2Z6K C;  4IPG A;  3PUX A;  3HOZ H;  4BY1 G;  1VQ6 A;  2I5L X;  3CCU A;  2JA5 H;  1SRO A;  3G6E A;  4YCU A;  5M5W H;  4JI0 L;  4A3D H;  1QVC A;  4EX5 A;  3UDG A;  1C0A A;  1VQI A;  3PSI A;  1W2B A;  4UY8 C;  1CKN A;  1TXY A;  2K14 A;  1N32 Q;  2UXB L;  2VS1 A;  2BH8 A;  1L0W A;  4DK6 C;  5IP9 H;  4PZ7 A;  2MQH A;  3I4N H;  4QJF A;  1DGS A;  4QL5 A;  4BBS H;  4DV0 L;  1OXX K;  1CKM A;  5JEA G;  3STB D;  3F2B A;  1LUZ A;  4LW1 A;  1YHA A;  4DV3 L;  4BXX H;  1X3F A;  3J81 j;  2Y0S E;  1JB7 A;  3RNU A;  2OTJ A;  1Q81 C;  5HY6 A;  1YBY A;  4JI3 Q;  1Q1B A;  3FHW A;  5IYB G;  3U4Z A;  4JI3 L;  1EUJ A;  4RMF A;  4A3K G;  4O0A A;  3A5U A;  2E5L L;  4NB3 A;  3L0O A;  4IPD A;  2PI2 A;  4JCV E;  1S3O A;  4A3J H;  1PH2 A;  1T9H A;  1JJ2 A;  3PUZ A;  4BXX G;  3OYY A;  2FXQ A;  4OON A;  3M4O H;  4DR6 L;  4DV0 Q;  4A3F H;  3T1H Q;  3CME A;  4PZ6 A;  2VNU D;  4OWX B;  4HJ8 A;  4KI0 A;  1TWG H;  4LF8 L;  4KLK A;  1Q12 A;  1CSP A;  4LUO A;  1L1O C;  1YIJ A;  1XJV A;  3HOU G;  2E8G A;  1SMX A;  1P8L A;  2UXB Q;  1YI2 A;  1HNW L;  4Y52 H;  2CWP A;  4DR5 L;  2NZO A;  5FLX c;  2AHO B;  4DV6 Q;  1PH5 A;  2JA8 H;  1IBK L;  3E0E A;  3NEN A;  2HT1 A;  4JC0 A;  2AKW B;  4R4T A;  4LNQ A;  1N36 L;  3CC4 A;  3S1Q H;  5M5X H;  3NBH B;  1VQL A;  1K0R A;  4JI1 L;  3A74 A;  1MJC A;  4DV7 Q;  3KF6 B;  4BA1 I;  1PH8 A;  1VQ4 A;  4A3K H;  1B7Y B;  4LF4 L;  3S2D H;  4GNX B;  2UUC L;  2YU9 H;  1NJI C;  3GTP H;  1GKH A;  3BZC A;  3I55 A;  3JAM c;  4A3F G;  4LF7 Q;  1U5K A;  5LMU Q;  2VL6 A;  3BJU A;  2ASB A;  4LFB L;  2ZJP A;  1VQM A;  2F3I A;  3U50 C;  1PH4 A;  4DV1 Q;  1Y14 B;  3B6Y A;  4BBR H;  1J5E L;  2F4V Q;  1HNX L;  2PQA A;  2UUA L;  4AH6 A;  1B70 B;  2ES2 A;  3I7F A;  3CPF A;  4MZ9 A;  4IOA A;  1GO3 E;  3PV0 A;  1XNR L;  4DV5 Q;  4YY3 L;  1EQR A;  3RZO H;  3GTO H;  1G29 1;  3L2P A;  1Q82 C;  5LMN Q;  1GD7 A;  1X3E A;  2C35 B;  1VQ8 A;  3Q8D A;  2AWN A;  4C3H H;  2R7Z H;  4UPA A;  1YHQ A;  4HJ9 A;  4DUZ L;  4IJH A;  5M3F G;  4L5Q A;  3GTL H;  4C2M H;  4O2D A;  5C0X I;  1NTG A;  4UP7 A;  4JI6 Q;  1TWC H;  1EOV A;  1X65 A;  3EBE A;  3S16 H;  2VQF L;  2R7Z G;  4A4I A;  2UXD L;  1S72 A;  4B3M Q;  1GVP A;  3K7U C;  2HHH Q;  5FJ8 G;  1Z9F A;  1BKB A;  1E1T A;  3PIP A;  2DUD A;  2BH2 A;  5C3E G;  3ER0 A;  1EQQ A;  1Q7Y C;  2KEN A;  3PIO A;  4JI2 Q;  2BA0 A;  2QEX A;  4OX9 Q;  3TRZ A;  4A3E G;  5IYC H;  5C4X G;  3H3V H;  1AH9 A;  1C7Y A;  5J3B A;  1EFW A;  2Y0S G;  2D0P A;  2IT1 A; 
#chains in the Genus database with same CATH topology
 5ELO A;  2F0V A;  3HG9 A;  5ELE A;  3C2P A;  1E1O A;  2XGT A;  1I6H B;  5NUC A;  1B8A A;  1LT3 D;  4GKK L;  2QDB A;  3KJP A;  2HIX A;  3PIP 3;  3HKZ G;  1EY0 A;  3NTI A;  1BNZ A;  4PMB A;  2AQ1 B;  2L55 A;  5KYL A;  1HZB A;  5JJL A;  3F1Z A;  2OF1 A;  4R4O A;  4AQY L;  5EAY A;  3ICE A;  1FNV A;  2JQO A;  5IP7 G;  2BDO A;  2KCN A;  4RCO A;  1NAP A;  2NVT H;  1LV9 A;  4BBS B;  1HZA A;  1SMY C;  3VR6 A;  4A93 H;  1FL0 A;  2EY2 A;  3I56 A;  1LAC A;  1IBM Q;  5GAE C;  5C0X H;  4FXG C;  1JE5 A;  1YNJ D;  1KRT A;  1XXG A;  3CKI B;  4LFA L;  1VQ9 A;  4WFN 3;  4OXP A;  1EFI D;  5M5X B;  1ESF A;  2BE5 C;  5EJW A;  3OHX C;  3TP5 A;  1FGB D;  1JB3 A;  3H09 A;  1IXR A;  1X3Q A;  2X6L A;  1WFQ A;  4IOC A;  4POG A;  4A3B H;  1F9R A;  4HJ5 A;  1VQF A;  2DJG C;  3RLF A;  4X62 L;  1H9K A;  2VB3 X;  3NQT A;  3TQY A;  2Q2H A;  2E2J B;  1STA A;  3J7A V;  3T1Y L;  3CQZ H;  2K52 A;  1MIU A;  1QZH A;  2OTL A;  1A15 A;  1PZJ D;  2KEC A;  1TWA B;  3O13 A;  5DNF A;  2JP1 A;  4LFC Q;  1ET9 A;  2EXD A;  3G71 A;  4QQB X;  3FP9 A;  3S9W A;  4P75 A;  4ME3 A;  3HOW H;  1EOT A;  5CV8 A;  4OIK A;  1LT4 D;  4N9P A;  3GTJ H;  3VYU A;  3G48 A;  3T1Y Q;  4EQ5 A;  3I91 A;  4AYB B;  4RHS A;  5AJ3 L;  4OX9 L;  3UDX A;  3M9B A;  1OXS C;  3PUW A;  2HCI A;  2O2L D;  3MHB A;  5IYB H;  3TP6 A;  1TS2 A;  2K32 A;  4YWK A;  1QVG A;  2PZT A;  1E24 A;  1TR5 A;  2MP1 A;  4FO2 A;  1AN8 A;  3FKI H;  3EJI A;  3V05 A;  3PF4 A;  1E22 A;  5E4W C;  4DUY L;  1F9P A;  3E9H A;  1RL2 A;  3KYH C;  3SE0 A;  3RN2 A;  4HCS A;  1IKL A;  2ZT9 C;  1MSG A;  2F0D A;  1YIT A;  2R7D A;  1UEA B;  2I5M X;  1G6P A;  1RIP A;  1HNW Q;  2CH4 W;  5E4X A;  3HOZ G;  3VYR A;  2A8V A;  2D9U A;  2EYM A;  1DJR D;  1XMO Q;  2VW9 A;  4HN7 A;  4P73 A;  2B8G A;  2F0W A;  2WAQ B;  3CW2 C;  5GQO A;  4DUY Q;  1AP0 A;  2HQL A;  2NZH A;  2YTV A;  1HZC A;  2FIN B;  4DV6 L;  2FHT A;  2JXM B;  1X56 A;  4NPS A;  1N34 Q;  1F2M A;  3E0J A;  2PPB C;  3HOY G;  2NVQ H;  3OMC A;  3PO2 H;  2R93 H;  4DPG A;  1W3S A;  5M5Y H;  1VQO A;  5G3L F;  1EQV A;  4XQJ A;  4S3S A;  1N34 L;  4KK7 A;  1PFS A;  1M4V A;  1OO9 B;  4OO1 I;  3Q0A A;  3DWA A;  2Z6K A;  3KBX A;  1KHI A;  5HUR A;  2UU9 L;  1UWV A;  4A3G B;  2JA6 B;  5KYI A;  5CGK A;  3CAM A;  1U0L A;  1SFO H;  1QVF A;  1GUW A;  4HIM A;  2YYZ A;  2EIF A;  3I4L A;  4K14 A;  4QIW E;  4JI4 L;  1NMF A;  3G6J B;  2J0T D;  4K5X A;  2A19 A;  2PZU A;  1ENC A;  4LFC L;  3MVV A;  1E0B A;  5LL6 S;  1VQE A;  1Z7T A;  3ITP A;  1NR2 A;  1FJG L;  3NSW A;  1MHW C;  3A7A B;  3GV6 A;  5C4X H;  2F0E A;  1XYI A;  4V19 0;  4GKJ Q;  1A2U A;  4FYD A;  3QOL A;  1X6O A;  3DEO A;  1YJ9 A;  3NP8 A;  1C4Q A;  4IUN A;  1HTP A;  2L4N A;  5FJ8 H;  3U58 A;  3HOV G;  1GHK A;  5FLX L;  1K3R A;  3NWS A;  2CFM A;  3C46 A;  1L1O B;  1U9R A;  1STG A;  1S5F D;  1AE3 A;  2GN5 A;  3VA7 A;  2SNM A;  5BR8 L;  2N49 A;  4GKJ L;  1D7Q A;  1XTD A;  5AJ3 Q;  4HJ7 A;  4LMQ D;  3I4O A;  3K7A B;  3BVM A;  3KOJ A;  4IPC A;  2B2W C;  1SNO A;  5D3D A;  4C2M B;  2QCP X;  4K6L A;  1YNN C;  3RZD H;  1PDQ A;  5JAV A;  4A3B G;  3N52 A;  5JJZ A;  5IWA L;  3S17 H;  1HUM A;  2A6H D;  5J22 A;  3CC2 A;  4C3J H;  4LJZ C;  3W2D A;  2Q2U A;  4C3I H;  3W5O A;  4JI0 Q;  4UDU C;  1IBK Q;  3WOE A;  3J7A F;  1SYF A;  3Q24 A;  4DR5 Q;  4HED A;  2EPB A;  3EIV A;  4YWL A;  4JV5 L;  4LF9 Q;  2WIN B;  4RG1 A;  2KVM A;  3HOW G;  4H0L C;  4PNY A;  3WDN A;  1PYB A;  1Q46 A;  1B3Q A;  2ZXO A;  4X3T A;  3TZU A;  1SMY D;  3TS0 A;  4BY7 G;  3UE1 A;  3D4R A;  2IHF A;  1GUT A;  1V43 A;  3BYY B;  2ID0 A;  5FOB B;  4J8Q A;  3FDT A;  2QEJ C;  3UE0 A;  5IE8 A;  1EEF D;  3QIA A;  1XMQ Q;  1S5E D;  1SFO B;  4I7Z C;  3K0X A;  2UXC Q;  5EPK A;  1EQT A;  1KC8 C;  2RBM A;  1KAW A;  2JJQ A;  1VCI A;  1ONL A;  5GRO A;  2ZTE A;  4A75 A;  1KRS A;  3Q23 A;  1LYL A;  3ERS X;  3NTK A;  1CKN B;  4XYQ A;  2JA5 B;  4A3B B;  1WCM B;  2EYO A;  1G91 A;  3DWP A;  3A0J A;  4CJ0 B;  4PV1 C;  2UUC Q;  4X64 Q;  1YJW A;  3FKI G;  1EWC A;  4A3D G;  4GNX A;  2PO4 A;  4DR2 L;  1H9S A;  4A3M B;  4Q5V A;  4LAA A;  1FNW A;  5F2D A;  3HOZ H;  5C44 B;  5CR3 A;  2I5L X;  2JA5 H;  4YCU A;  4B9W A;  4JI0 L;  1C0A A;  4ZQ3 A;  1TXY A;  1S5B D;  1IL8 A;  4HR7 B;  2BE5 D;  4QJF A;  4QL5 A;  1TWF B;  2HDM A;  4BBS H;  2RDG A;  4LW1 A;  4K6D A;  4A93 B;  3P1H A;  3J81 j;  1F77 A;  1ET6 A;  3GQB A;  1Q81 C;  4JI3 Q;  5C4H A;  1Q1B A;  4N8X 1;  4RMF A;  2E5L L;  4O0A A;  3A5U A;  4NB3 A;  3MFY A;  1HFN A;  1S3O A;  3HS0 C;  4BXX G;  3PUZ A;  3OYY A;  4DR6 L;  4DV0 Q;  4PZ6 A;  3IAY A;  4HJ8 A;  4KI0 A;  1ZKO A;  2K33 A;  1XJV A;  4B08 A;  1SMX A;  2UXB Q;  1KDA A;  4ABN A;  1BCP F;  1HNW L;  5JPM C;  1PH5 A;  1Y1V B;  2JA8 H;  3E0E A;  4CKE A;  5TSS A;  2AKW B;  4R4T A;  3PMF A;  3H0G B;  1K0R A;  1CT1 D;  2F0I A;  1AFP A;  4KV6 A;  3M3Y B;  2F0H A;  1B7Y B;  3WOF A;  2YU9 H;  1Z6H A;  1NJI C;  1EY6 A;  5I6W A;  5M3F B;  4LF7 Q;  4LFB L;  1TU2 B;  2VL6 A;  1QOH A;  2ZJP A;  2B63 B;  1DZ1 A;  4IUR A;  1EU3 A;  1PH4 A;  1ESR A;  2X69 A;  3HOW B;  1EYC A;  3NBH A;  2EJF C;  3HOY B;  4JK1 C;  2SNS A;  1GO3 E;  3PV0 A;  3D3R A;  4G7Z C;  3RZO H;  1PLF A;  5LMN Q;  1GD7 A;  1X3E A;  3OWE B;  2AWN A;  4HAE A;  2F3V A;  4QF4 A;  4UPA A;  1UAP A;  4DUZ L;  4IJH A;  1NTG A;  1AZQ A;  4KJN A;  5BN5 A;  1L0X B;  2B2Y A;  1EOV A;  2R61 A;  2BDN A;  2R7Z G;  4A4I A;  2EZV A;  2E74 C;  3NQI A;  2HHH Q;  1MBY A;  3NK9 A;  5FJ8 G;  1Z9F A;  3OIP A;  3SK6 A;  3ER0 A;  1Q7Y C;  2KEN A;  3IFT A;  3MXG A;  4JI2 Q;  3TRZ A;  1WTX A;  5IYC H;  1STN A;  3BVG A;  1G6Z A;  5J3B A;  1S40 A;  2ASB A;  2WKC A;  5BN4 A;  3D8G A;  2I07 B;  4JBW A;  2FJ2 A;  1FR3 A;  4MHE A;  2N78 A;  4R1J A;  3QJY A;  3MAQ A;  1PV4 A;  3HOX G;  3S1R H;  1PYS B;  2Z6B A;  1WTP A;  1VQP A;  3L3O C;  1WJJ A;  1I50 H;  3IKJ A;  4XQQ A;  5C3E H;  1TWC B;  4DU9 A;  2R3Z A;  5D3I B;  1SJE D;  2C5C A;  3CRK C;  3MEF A;  2RCN A;  2IX0 A;  5C5L A;  4DNT B;  1N9W A;  3UI2 A;  5BN3 A;  4K2K A;  4L5T A;  3BDO A;  1SNP A;  3PUV A;  4DR6 Q;  1JWS D;  4ZUI A;  4OHJ A;  4IQZ A;  3U4V A;  5M5Y B;  1KAA A;  4RAU C;  4X6A H;  4HIK A;  3CCS A;  1XNQ Q;  1G8Z D;  4DR7 Q;  4DNR B;  3EFX D;  2A68 D;  2IY5 B;  2LS0 1;  2K5D A;  1K8A C;  3SDZ A;  2R92 B;  1GUO A;  2A6H C;  3CCR A;  1STH A;  4XYO A;  5GAG C;  4PQX A;  5DM6 3;  4GOP B;  2ZTC A;  4CKB A;  1SEB D;  1L1O A;  5E7N A;  1UE1 A;  4L5R C;  1B4O A;  2M2L A;  4LF8 Q;  4TRD A;  2WB1 G;  3NXW A;  2G9D A;  3HKZ E;  3CRL C;  3J81 c;  3KFU A;  3MWY W;  2ZXR A;  4Z9C B;  1F2L A;  2TSS A;  3S2H H;  2JA7 H;  4GOP C;  3W1B A;  3RR5 A;  2E76 C;  4DUZ Q;  4DKA C;  2NZ1 D;  4BBS G;  3FPU B;  2KCT A;  1B1Z A;  1SJH D;  1NY4 A;  1YZ6 A;  4F7X A;  4A3L G;  3V2T A;  3QG1 A;  3BG3 A;  1K83 H;  2KHI A;  4X3U A;  1CQV A;  3OOC A;  1N33 Q;  2EYF A;  5K36 H;  4P71 A;  3J7Z C;  1IZ6 A;  1F2Y A;  4DFA A;  4P72 A;  3HKZ B;  2KJX A;  1SN8 A;  4FF4 A;  4JI6 L;  1PH3 A;  5E3F A;  4LK1 C;  3PO3 B;  3A55 A;  2Z0S A;  3F8T A;  2M9V A;  1JJC B;  4FXK C;  1M90 C;  1EZ6 A;  2K50 A;  3S17 B;  1X55 A;  3G4S A;  4HID A;  4YIJ A;  4NXN Q;  1TII D;  2MHV A;  2V1C C;  4AQY Q;  3GO5 A;  4XQN A;  4CHT B;  4CJ1 B;  2WAQ E;  5KND A;  2A74 C;  2B39 A;  1I4H A;  3I72 A;  4K2L A;  4FNF A;  1I94 L;  2TMP A;  1ASY A;  1HUN A;  1IYJ B;  4IZ8 A;  5KNC A;  1VDZ A;  2PQE A;  2L9H A;  4BY1 B;  4NXM L;  1EY5 A;  2JA8 G;  2AUK A;  4ALP A;  4NW2 A;  3H15 A;  3U9O A;  1EYD A;  4JI8 L;  1HPC A;  2QW7 A;  1EIY B;  2PMZ E;  2QKI C;  2KBN A;  2HUG A;  5CBE E;  4R8N A;  5C0X J;  3SHL A;  1XNQ L;  4R4C A;  1RD9 D;  2NB0 A;  2JA9 A;  4YWM A;  1DOK A;  4QGU A;  3ULJ A;  1NBW A;  3M4Y A;  3GTG B;  5BR8 Q;  1EY4 A;  3S2D B;  4ZYS A;  3A8K E;  1HR0 W;  1SDF A;  2KHJ A;  4DR3 L;  1YJN A;  4C3J B;  4X3K A;  2SEB D;  4KHV A;  2A69 D;  5M3M B;  1IYV A;  1D1I A;  2AMC B;  4DK1 A;  4HIO A;  1EY8 A;  4K8I A;  1ZYR D;  4GLV B;  2K75 A;  3AQQ A;  2B29 A;  3S1N H;  1TQO A;  2F0O A;  2K05 A;  2IW3 A;  5EBC A;  1ILP A;  1Y8P B;  3HOY H;  1T5E A;  3NWT A;  2UUA Q;  2R93 G;  3M7G A;  2B2W A;  1DYQ A;  1CHP D;  1D5Z C;  2K7V A;  3J80 E;  3ND8 A;  3MFG A;  1A3T A;  2PW5 A;  2KCM A;  5M3F H;  1PMR A;  1D8L A;  2N3S A;  5CV6 A;  4IFD J;  2B63 H;  2K28 A;  5D14 A;  1I4R A;  2EYL A;  4DXG A;  1BCP D;  1KDC A;  4JG2 A;  1I4Q A;  2K5H A;  2B2Y C;  2EY1 A;  1BOS A;  4IUV A;  1H9M A;  3KLW A;  2JA6 G;  1K0S A;  3NEM A;  4HSV A;  1AW7 A;  4O42 A;  2X6G A;  1XX8 A;  3CMA A;  4CJ2 C;  4HMI A;  4CDE C;  2PI2 E;  3DXJ C;  5A35 A;  1WYD A;  4YHH L;  4B3T L;  3GD7 A;  4CDC C;  2HD3 A;  3M7N A;  3X3M A;  4ZRZ A;  1GUG A;  4LF9 L;  2ATW A;  4C3H B;  4JV5 Q;  1VQK A;  3PCO B;  3S1N B;  1S5C D;  3E9I A;  1Y1W G;  5C6A A;  3V96 A;  2R7Z B;  2WAQ G;  2WFW A;  2MNA A;  2CWA A;  2JE6 I;  5I2X A;  5LMN W;  4G57 A;  3RLO A;  1ASZ A;  5ELN A;  3KF8 A;  1LT6 D;  2LXK A;  3MXN A;  1E2W A;  4RGM A;  4F88 A;  3A5Z B;  3RUZ A;  2B2V A;  3A54 A;  1JQY D;  1TWF H;  2NN6 G;  3L7Z C;  1K9M C;  2L1B A;  4RGT A;  2K4K A;  3GDE A;  4LUZ A;  1A8V A;  3NEL A;  2NVX H;  1VQD A;  3BU2 A;  3HP3 A;  3DMU A;  2I46 A;  2VXW A;  3CCV A;  3JC6 6;  1X3P A;  5E1F A;  1X54 A;  5C44 H;  3PO3 G;  1H9R A;  4CBV A;  4RHR A;  3SK8 A;  1KD1 C;  3CCE A;  1SE8 A;  1P16 A;  4A3M H;  3J80 c;  1PTO H;  2MO0 A;  3J7Y W;  1I4G A;  4A3L H;  1SYC A;  1TY2 A;  1TS5 A;  3F2C A;  1Q3L A;  4RH6 A;  1PRT D;  5CV4 A;  3RN5 A;  5C3X A;  3LX0 A;  2Q2T A;  1PH9 A;  1N33 L;  4RWS C;  3C1E A;  2G9H D;  4YY3 Q;  5JOB A;  1XNR Q;  4A76 A;  2XRQ D;  1VQ7 A;  3HGB A;  2R92 G;  1SYD A;  2D0O A;  2L12 A;  4DAY B;  2JA7 B;  2YV5 A;  4G4K A;  2I0Q A;  5M9O A;  2IX3 A;  4XTC S;  4HJA A;  1FJG Q;  1CM9 A;  5FLX E;  4IO9 A;  2VQE L;  2YTY A;  1OXT A;  5IGB A;  5JJK A;  3DUZ A;  3CD6 A;  2VB2 X;  1TT2 A;  4KKU A;  4AYB E;  4M8A A;  2P5Z X;  3FEW X;  1CA6 A;  3OW2 A;  4KHP Q;  1R4Q B;  4ID6 A;  1NMG A;  3H6M A;  4JOI C;  1SNQ A;  1B9M A;  3CPW A;  1PTO F;  3GTM B;  2IJ0 A;  2Z6K C;  3IL8 A;  4IPG A;  3PUX A;  3K6O A;  3X3N A;  1ML0 D;  1PFM A;  1HXY D;  1SRO A;  1K83 B;  3D6C A;  5M5W H;  2F0F A;  1QVC A;  3OPO A;  4EX5 A;  3UDG A;  1VQI A;  1W2B A;  2K14 A;  1N32 Q;  3TBI B;  2F4I A;  3I4N H;  1FYC A;  4ZAI A;  2K04 A;  1DGS A;  5KRU A;  3T4A C;  2LKV A;  4GZY C;  1OXX K;  3STB D;  3DEP A;  3NUC A;  3S2H B;  1CK1 A;  1YHA A;  1X3F A;  1BQQ T;  2NUC A;  2OTJ A;  1WTV A;  2EOT A;  1YBY A;  5JPN C;  1YNN D;  4QB4 A;  3RD4 A;  4A3K G;  2CW0 C;  4RCN A;  4IPD A;  2A6E D;  1NUC A;  1STE A;  4A3J H;  1STY A;  1PH2 A;  3GTL B;  3AB9 A;  3CME A;  4KLK A;  2Y0S B;  2QIL A;  1L1O C;  2E75 C;  2F03 A;  1Y8N B;  1P8L A;  1I50 B;  4DR5 L;  2NZO A;  4RKL A;  1IBK L;  2LFN A;  4JC0 A;  1D6E C;  1JC7 A;  1XTC D;  4LNQ A;  3NBH B;  3VYT A;  4JI1 L;  3A74 A;  1MJC A;  1HTL D;  1W6K A;  5CV5 A;  1GOZ A;  1PH8 A;  5KEE A;  4X3S A;  4DF7 A;  2F0M A;  1U5K A;  2EYH A;  3R2I A;  2EXZ A;  2A6E C;  5ISR A;  4IFD H;  2F4V Q;  2PQA A;  3A8I E;  5KNB A;  3MEH A;  4C3H G;  1ZYR C;  2CH4 A;  4MZ9 A;  2XNA C;  3MXP A;  1XNR L;  2N88 A;  3PIO 3;  3L2P A;  5IOD A;  3S14 B;  2XN9 C;  1PFN A;  3Q8D A;  5J1Z A;  3A8J E;  4L8J A;  3S1R B;  1I4X A;  4C1N K;  5M3F G;  4L5Q A;  4JI6 Q;  1TY0 A;  1B50 A;  1TWC H;  4RKB A;  5G3L D;  1KTK A;  2ICE C;  3S16 H;  3CU7 A;  2VQF L;  5T1G A;  5IIF A;  4FF2 A;  4UHV A;  1BKB A;  1J8I A;  2O5J C;  2A69 C;  3PIP A;  2BH2 A;  4G7O C;  4KD3 A;  3I8Z A;  1EQQ A;  4DN4 M;  3PIO A;  1DD2 A;  3H3V H;  2L11 A;  4QUF A;  4K5V A;  2NTT A;  5FK9 C;  2QF7 A;  2Y0S G;  3QOJ A;  3QB3 A;  1ENA A;  2WB1 E;  3AFQ A;  4N9T A;  4KMU C;  3S16 B;  5JJI A;  2NVQ B;  3KLR A;  1HR0 Q;  2F0S A;  2K03 A;  1IBL L;  5J39 A;  1E2Z A;  2DY7 A;  2Q2I A;  4FDB A;  3T13 A;  4OL7 A;  1OTC A;  1SRU A;  3IRB A;  2RA4 A;  2CVR A;  3H0G G;  4I7A A;  2Z9H A;  5LL6 X;  4B3S Q;  4JYA Q;  4KJO A;  3K5L A;  1Y1V G;  2MJ8 A;  2UU9 Q;  2PQA B;  1GUN A;  1MGS A;  3K8A A;  3I4M G;  1CUK A;  5IYC G;  4KN7 C;  2ICI A;  1VQB A;  3OMG A;  1A2T A;  1IBM L;  3LGJ A;  1OXV A;  3KDF B;  5C0X G;  1JIC A;  2K5V A;  1L2F A;  1QWY A;  2K6A A;  2O4X A;  5A2Q L;  2RQX A;  3LWE A;  3M4Q A;  5C4J H;  4PMW A;  3F2U A;  2DN8 A;  1QUQ B;  3C3L A;  1AH9 A;  1JOQ A;  4L5S A;  2LXJ A;  1VQ5 A;  4TVA B;  1J5E Q;  4GN5 A;  2DJF C;  4C56 C;  4GOP A;  2UUB L;  5DM7 3;  4DV4 Q;  1F2Z A;  3E5S A;  3P7J A;  1BXT A;  2MFI A;  4IN3 A;  3HFZ B;  2R92 H;  2JA8 B;  1D1K A;  3W1G A;  1LAB A;  2NVY H;  1Q8K A;  5H1S E;  3D6W A;  2XVS A;  1I94 Q;  3HOZ B;  1O80 A;  1SE4 A;  5I2Y A;  3M4P A;  1I3Q H;  5KIX A;  4X66 Q;  3AFP A;  1SE3 A;  4RGN A;  3VR2 A;  2HDL A;  1TS3 A;  4NXN L;  1E3P A;  4XXE A;  1CI3 M;  3MC0 B;  4ULL A;  3I90 A;  3J80 L;  5IGE A;  1IBL Q;  2A1A A;  1YVC A;  4H44 C;  3HZX A;  4B3M L;  2L5T A;  4ZKC B;  5IGD A;  4MN3 A;  3PF5 A;  1NSN S;  1CQF A;  5CYU A;  3I4N G;  4CKC A;  3PQI A;  1QNU A;  3OWF A;  3VR5 A;  1M8A A;  4DR3 Q;  5M5W B;  5HGT A;  1TWA H;  2UXC L;  1PH7 A;  1WTH A;  4N8F A;  4DV5 L;  2B3G A;  1N32 L;  3A7L A;  3H91 A;  3P75 A;  1D5M C;  1G51 A;  2VQF Q;  3FMC A;  4A3J G;  1HNX Q;  4MNO A;  3OSO A;  4JVZ A;  2SDF A;  4R4Q A;  5LMU L;  1UNS A;  4WJ4 A;  4UP9 A;  1WCM H;  4JI7 L;  4U68 A;  5I9P A;  1VQC A;  3I73 A;  4JI8 Q;  2E2I H;  1K28 A;  1TWH H;  5CV9 A;  1H9S B;  4OWW B;  3P20 A;  3AEV A;  5C4X B;  4KN4 C;  4X65 L;  2HCC A;  4R9W A;  2C9O A;  1GXD C;  3QO2 A;  3DLL A;  3EQL C;  1V8Q A;  4FF1 A;  2ZXP A;  3KF6 A;  3J81 L;  2E2J H;  1DON A;  3TME A;  1PYW D;  3T1H L;  2K01 A;  4JI5 Q;  1MD2 D;  4YCV A;  1GM5 A;  1JWM D;  1I6H H;  4B3R Q;  1R9T H;  1Z47 A;  4LFA Q;  2XTI A;  3DM3 A;  3K5N A;  1Y69 U;  1X9N A;  4OEM B;  1FGU A;  3STB C;  3VDY A;  4LF5 Q;  2B2T A;  4V0B A;  1MJE A;  3OIQ A;  1H95 A;  1VQJ A;  1XPU A;  1EWI A;  3KK7 A;  1SYE A;  3CCL A;  4IFD G;  1DXM A;  4DR4 Q;  4MIU A;  5IT9 L;  3Q22 A;  5K5P A;  1OXU A;  5LHY 1;  1V1P A;  2KEE A;  4LF5 L;  3KUP A;  2QDL A;  2B2V C;  4YCW A;  2F0N A;  3D31 A;  3S24 A;  4KY7 A;  4JI5 L;  1PHJ A;  1O7Z A;  3RZD B;  1IHZ A;  1I6V C;  3HOX B;  2WII B;  3J7A 5;  1SE2 A;  4BA2 I;  1HNZ Q;  4TSS A;  3S15 H;  1A0I A;  5FO7 B;  1BUV T;  2CKZ B;  1LTB D;  4BS9 A;  2WKD A;  1J9O A;  3HKS A;  1W6J A;  5I4D A;  3SK4 A;  4YHH Q;  2FFK B;  2ZTD A;  1HA6 A;  1Q8I A;  4X64 L;  4B9X A;  4H13 C;  4DR7 L;  4TQU S;  1D2B A;  1EL0 A;  3ULP A;  4OO1 G;  2RF4 A;  4KTA A;  1CA5 A;  1I4P A;  4OEL B;  3SK5 A;  1U4L A;  1R9T B;  1EIF A;  2BCO A;  3HOV H;  2VY3 A;  1LLR D;  2PCF B;  4XDX A;  2LSS A;  2N8N A;  3CCQ A;  2NVT B;  1IKM A;  1KLU D;  2G5D A;  2ZM6 Q;  1PXU A;  4DR1 Q;  3KF8 B;  1II3 A;  1GJX A;  3I4M H;  2BA1 A;  3R3O A;  5HGQ A;  3H3V C;  2Q8T A;  1N8R C;  2XWB B;  3BDC A;  1UE6 A;  3RLN A;  1FD7 D;  2B63 G;  4ZKB B;  2OWO A;  2Z1C A;  4A3I G;  4GNX C;  4ME5 A;  3K5O A;  1BVS A;  5EKK A;  4P2C B;  1WTW A;  1VQH A;  2RHS B;  4DAV A;  1RDP D;  4OWT B;  2JA6 H;  1A6X A;  3TP7 A;  2F0L A;  1ENF A;  1B44 D;  3E3X A;  1VQN A;  4X66 L;  3PUY A;  1Y8O B;  2OEO A;  3AMU A;  2EE1 A;  2RCF A;  2EY6 A;  2F52 A;  4K0K L;  3QWN A;  3EA6 A;  2EVB A;  4QIW B;  4C3I G;  3AYH B;  1S4Z A;  4DR4 L;  1MI2 A;  5IY0 A;  2NBF A;  4EGV A;  2R93 B;  3K57 A;  4R8I A;  2JSO A;  1Y1W H;  4IJL A;  2K5Q A;  5FO9 B;  3VYS A;  2HHH L;  5IGF A;  1LM0 A;  4CGY B;  1WVL A;  1X3G A;  4H02 A;  3M4O B;  2QA4 A;  1JMC A;  3FRP B;  3TS2 A;  5C4Z A;  5IYD G;  1A62 A;  1CSQ A;  3JAM E;  2WB1 B;  3OTO L;  1WI5 A;  1LTI D;  1C9O A;  1TVX A;  2NN6 H;  3F2D A;  4BY7 H;  1HQM C;  1JOO A;  1I5F A;  2D5D A;  2PNH A;  4A3G G;  3MA2 B;  1K8G A;  1HRJ A;  4DAP A;  3UDI A;  2MPM A;  2IWH A;  2PYK A;  1S5D D;  3ULL A;  5COR A;  5LMN L;  2XIW A;  2NYZ D;  4AIM A;  5JEA J;  2KED A;  5COY A;  4A3C H;  5C44 G;  4KHZ A;  1HFG A;  5I6Y A;  1EIG A;  1AE2 A;  5FLM H;  2K5N A;  2NN6 I;  4DR2 Q;  2H4O A;  3MTS A;  2EQS A;  4A3M G;  1HNZ L;  1QCB D;  1O7I A;  1YNX A;  4LF6 L;  1SR3 A;  4A3I B;  4QY7 A;  1WTR A;  2JA5 G;  1KAB A;  1PH6 A;  3H3V I;  3GP7 A;  4DXF A;  1WCM G;  1QB5 D;  4HSP A;  4OGQ C;  4JI1 Q;  2CCZ A;  2R7F A;  4GN4 B;  2E2H H;  2J4X A;  3ERQ A;  2Z4I A;  4BY1 G;  1WTO A;  4J1M A;  4HCE A;  1FNU A;  3BS1 A;  4A3D H;  3NPP A;  3PSI A;  1JWU D;  4UY8 C;  1CZG A;  4DA2 A;  2UXB L;  2VS1 A;  2BH8 A;  1L0W A;  1KNA A;  1WTQ A;  2PMZ B;  4JPB W;  1SND A;  2PW7 A;  3G7L A;  5FKA C;  4DV0 L;  3R8B A;  3F2B A;  4DV3 L;  4BXX H;  2Y0S E;  1JB7 A;  3RNU A;  2B8F A;  3FHW A;  2F0K A;  1EUJ A;  2RDF A;  2LY7 A;  2OT2 A;  2PI2 A;  4PMC A;  5CBA E;  4BY7 B;  1T9H A;  3FVQ A;  2FXQ A;  4OON A;  3M4O H;  4C1N I;  4A3F H;  4LF8 L;  1TWG H;  1Q12 A;  4LUO A;  2VUM B;  1WD0 A;  2MUY A;  3ZYY X;  3E6Z X;  3HOU G;  1UUP A;  2E8G A;  5CMD A;  2Z4H A;  5D65 A;  1HA5 A;  5FLX c;  2AHO B;  1KLG D;  1DCZ A;  3NEN A;  3SVM A;  2IL8 A;  4KY5 A;  4CDD C;  4G7H C;  3BYT B;  1VQ4 A;  5I9O A;  4A3K H;  3MZ5 A;  3S2D H;  4GNX B;  4CDF C;  1GKH A;  3I55 A;  3TP8 A;  3JAM c;  4FF3 A;  5LMU Q;  3DHQ A;  3BJU A;  1VQM A;  2F3I A;  4XT3 B;  5A2Q E;  1JR0 D;  3SEB A;  1J5E L;  4L6T B;  4C3I B;  1CTM A;  4AH6 A;  4A3E B;  2RSO A;  3I7F A;  4JW0 A;  3CPF A;  2NTS A;  2KUM A;  5IGC A;  4FVM A;  4DV5 Q;  2J7Z A;  4YY3 L;  1EQR A;  5C3E B;  1G29 1;  4ZUJ A;  4OO1 H;  1XWE A;  2C35 B;  1VQ8 A;  3GTQ B;  2R7Z H;  1KDB A;  1YHQ A;  1EZ8 A;  1A3V A;  1B3A A;  4C2M H;  4O2D A;  5T1I A;  5C0X I;  1VMC A;  3HOV B;  1BCP B;  2DY8 A;  4ZLT F;  1EU4 A;  2B2U C;  4K5W A;  2UXD L;  1S72 A;  4B3M Q;  4HTH A;  4OIJ A;  3K7U C;  3NE5 B;  5C5M A;  1E1T A;  1DM0 B;  3PO2 B;  2CQA A;  2BA0 A;  2QEX A;  5IT9 E;  1C48 A;  3LWU A;  2D0P A;  1QNK A;  2YU9 B;  2F0T A;  3D4W A;  4JI2 L;  3M3Y H;  4HMJ A;  3BZK A;  1JOR A;  3GTK H;  2N55 A;  2B2U A;  1Q90 A;  5IWA Q;  1RCV D;  5M3M G;  2DGY A;  3KLS X;  3JAM i;  1IL2 A;  4FXD A;  3TEH B;  1SBB B;  1PZK D;  2UUB Q;  2BOS A;  2CW0 D;  3HOX H;  4DNI A;  1NR4 A;  1QG7 A;  4X65 Q;  4UP8 A;  5EBD A;  2V4D A;  3GTK B;  2VUM G;  1EEI D;  4PG3 A;  2PZW A;  3GV3 A;  1HCZ A;  1FVI A;  2FMC A;  2A5H A;  2ZJQ A;  1NE3 A;  4RGO S;  5IYD H;  1HJP A;  2HIV A;  4POF A;  1K73 C;  1O7Y A;  3ERO A;  3LNN A;  4JI7 Q;  4JBJ A;  4A3D B;  4A3G H;  1TWH B;  4H7B A;  4NKL A;  3S1M B;  5JVG 3;  3HRZ C;  1JCK B;  3H0G H;  1EY7 A;  3PGZ A;  2EJM A;  4JYA L;  4DV3 Q;  3I2Z A;  1A63 A;  1KL9 A;  1CFM A;  3GTM H;  3KDF A;  3R2T A;  3IFD A;  1Y1V H;  2IPK D;  3BZD B;  4WJW A;  1MSH A;  2L0C A;  1PA6 A;  1VF5 C;  4GS3 A;  4DK0 A;  2PNR C;  1HR0 L;  3S1Q B;  5DAU A;  3N6R A;  4UAI A;  4K0K Q;  5GAD C;  3EN2 A;  4TKO B;  3CCM A;  3J81 E;  5DLQ E;  1LTS D;  2RKS A;  4DGZ A;  1ICW A;  1STB A;  1SNC A;  2JEA I;  3CP0 A;  3MXU A;  3TRE A;  2Q8R E;  4JBM A;  3URY A;  4FP5 D;  4JOI A;  4A3C G;  4BY1 H;  4QCL A;  4LF6 Q;  4J15 A;  1L0Y B;  2I5H A;  1UE5 A;  5FLM G;  2R6G A;  5ELD A;  1PTO C;  2E2D C;  3U9S A;  2QGQ A;  1KNE A;  4KKS A;  1AZP A;  3J81 i;  1CKO A;  1PRT B;  1EY9 A;  4KD4 A;  3QR8 A;  4NP5 A;  3SGI A;  3CC7 A;  1JT8 A;  1LT5 D;  2JA7 G;  1WOC A;  1E7Z A;  3L9A X;  2XSC A;  4QUC A;  1ICF B;  2CQO A;  3NHH A;  2RVL A;  3I4M B;  2RHQ B;  4MTK A;  4AYB G;  3K5M A;  2GVA A;  2WAC A;  5L37 A;  3KLS A;  1RF2 D;  2XRS D;  2F0Q A;  1Q1E A;  3OTO Q;  4DAM A;  4XIG S;  3S1M H;  1HQR D;  4DV4 L;  1F9S A;  5KGU A;  1BBU A;  4R4I A;  3UDF A;  5K36 G;  4KY6 A;  1HZ9 A;  4EQN A;  4IFD I;  1BF4 A;  3NTH A;  2GVB A;  1YEZ A;  2NWG A;  2F0J A;  4KHP L;  1RJT A;  1PVO A;  1IW7 C;  1XMO L;  1LTR D;  4NXM Q;  1PTO D;  2L15 A;  1C8C A;  1YHB A;  2KQ3 A;  5JVH 3;  3OW7 A;  4RA8 A;  1K3B C;  3PO2 G;  4X62 Q;  3HOU H;  1MKH A;  1O7L A;  1I3Q B;  4IUP A;  2Z8L A;  3I4N B;  1KQS A;  3D0F A;  5EKL A;  3CF5 A;  4IPH A;  1VMP A;  4ILW A;  3RZO B;  2MO1 A;  3FKI B;  4GLA C;  5IP9 G;  1EYG A;  2IX1 A;  1V1P B;  3J80 i;  1Y1W B;  4NMZ A;  1PRT F;  1DOL A;  5JEA H;  3I3C A;  2A73 B;  3TDQ A;  4EVO A;  3DWQ A;  1Q86 C;  2ZM6 L;  4DR1 L;  3GTP B;  1U4R A;  2K1B A;  3JAM L;  2YTX A;  1PRT C;  4F8M A;  1LTG D;  3WWV A;  3AU7 A;  1M1K C;  4GLX A;  2E5L Q;  2A68 C;  1ROD A;  4J6H A;  2DNE A;  4M1U B;  1BO0 A;  4B3R L;  4KKT A;  3R93 A;  2JEB I;  2WP8 J;  2F0G A;  3KBG A;  1B9N A;  3VA5 A;  4EQO A;  3SXH A;  4Y7N H;  3K7A H;  4BBR G;  5C3W A;  3CQZ B;  4I65 A;  3T53 B;  2OCE A;  3MXN B;  4XT1 B;  3GTQ H;  1QUQ A;  2VQE Q;  5AFW A;  2Q8I B;  3HOU B;  2F4V L;  3T51 B;  1G2S A;  3EVQ A;  4U67 3;  4LWC A;  2VZA A;  4PZ8 A;  3T16 A;  4Y7N B;  3TSS A;  4LF7 L;  2EDG A;  5M3M H;  3ONA B;  3K58 A;  4BBR B;  4A3K B;  3A56 A;  2E2I B;  2HQE A;  2UXD Q;  1VQA A;  5ELF A;  1V9P A;  1JOK A;  1SXT A;  4DK3 C;  4WJ3 M;  1V1Q A;  1VS0 A;  2AWO A;  1SYB A;  3GTG H;  4F87 A;  1HH2 P;  2O5I C;  4ZK9 B;  2IHE A;  4C3J G;  5GAH C;  1EWH A;  2H5X A;  1YNJ C;  1XMQ L;  2OQK A;  3C1F A;  1O78 A;  3S14 H;  4JBK A;  2VUM H;  2M00 A;  1JJG A;  1PH1 A;  1WD1 A;  3H94 A;  4DAY A;  4DV1 L;  4EQP A;  1ILQ A;  4A3E H;  2EY5 A;  3CXC A;  2MGS A;  4WOR A;  1RKN A;  4E6I A;  1JE4 A;  1BDO A;  4JI4 Q;  1KXL A;  4GKK Q;  4LUV A;  1LTL A;  2JN4 A;  3CCJ A;  5IP7 H;  4DV2 L;  4MTN A;  1N36 Q;  1QZG A;  4IAL A;  1E2V A;  2WV6 D;  1D5X C;  3PO3 H;  2OQ0 A;  1UEB A;  1G2T A;  2F0U A;  4DV2 Q;  4B3T Q;  1J6Q A;  4P74 A;  1U4M A;  4A3I H;  2NVY B;  2AUJ D;  1ZXT A;  3K80 C;  4APV A;  4GN3 B;  2AQ3 B;  1TWG B;  1IYU A;  1VF7 A;  3SR1 A;  1SLJ A;  2E2H B;  1B2T A;  4QMG A;  4A93 G;  1X32 A;  1U4P A;  3KJO A;  1SAP A;  5IT9 c;  2LMC B;  3ND9 A;  2AQ2 B;  4A3J B;  1HHV A;  1GHJ A;  1BBW A;  1VQG A;  1UE7 A;  1B53 A;  5C4J B;  1PFB A;  2JK8 A;  5CV7 A;  1K8O A;  3ZJY C;  1KIX A;  1XPO A;  3K81 C;  5IGG A;  3GTJ B;  1RHP A;  2D62 A;  1GUS A;  3M85 A;  4NDX A;  2B2T C;  2ALY B;  4B3S L;  1R4P B;  4LFB Q;  2ZJR A;  2D2C C;  1H9J A;  2F0P A;  4LF4 Q;  5FO8 B;  1XPR A;  1K8M A;  1ZEQ X;  4IUU A;  4DV7 L;  3HEJ A;  2DNC A;  4ZCK A;  4WRD A;  1VQ6 A;  5ELC A;  3TZD A;  3CCU A;  3G6E A;  3T56 B;  4IUT A;  3K59 A;  1CKN A;  2ENB A;  1BCP C;  4DK6 C;  1CHQ D;  5IP9 H;  4PZ7 A;  2MQH A;  3VR4 A;  2NVX B;  1LTA D;  5EQ0 A;  5EGT A;  1A3U A;  1CKM A;  5JEA G;  1SYG A;  1LUZ A;  2KHS A;  2SOB A;  1RTN A;  1SSO A;  1TS4 A;  2H1E A;  5HY6 A;  1F9Q A;  3K0Y A;  5IYB G;  3U4Z A;  4JI3 L;  3D4D A;  2GA4 B;  1AEX A;  5EKI A;  3L0O A;  4JCV E;  3TN2 A;  2K5W A;  1JJ2 A;  1PTO B;  1RTO A;  3DM1 A;  3T1H Q;  2VNU D;  2KCC A;  4OWX B;  1CSP A;  4RFB A;  1YIJ A;  3NBI A;  1EYA A;  2OXP A;  1YI2 A;  1QIL A;  2EYP A;  2RSN A;  4Y52 H;  2CWP A;  4DV6 Q;  1BBX C;  1NNX A;  4ODG A;  2HT1 A;  1DOM A;  1N36 L;  3CC4 A;  3S1Q H;  5M5X H;  1VQL A;  2XWJ B;  1LTT D;  4DV7 Q;  1QJO A;  3KF6 B;  1PZI D;  4BA1 I;  3RMH A;  4LF4 L;  2UUC L;  1EIH A;  3GTP H;  3BZC A;  3BVZ A;  2KA7 A;  1BR9 A;  4A3F G;  5EPL A;  4BWG B;  3U50 C;  4DV1 Q;  1Y14 B;  3B6Y A;  2EJG C;  4BBR H;  4L63 B;  3Q6S A;  1HNX L;  3BDL A;  4IUQ A;  4O1N A;  2KOL A;  1B70 B;  2ES2 A;  2UUA L;  4IOA A;  2FMM A;  4Q0F A;  5CC4 A;  3GTO H;  1Q82 C;  2CHB D;  3CHB D;  2RDH A;  3S15 B;  4C3H H;  1IW7 D;  5EPJ A;  5DEH A;  4A3F B;  1T5X D;  4HJ9 A;  3GTL H;  3I70 A;  4UP7 A;  3VR3 A;  2F3W A;  1X65 A;  3EBE A;  5IOC A;  3GTO B;  4K8J A;  1QE6 A;  1GVP A;  1SNM A;  2DUD A;  1LO5 D;  5C3E G;  1CZW A;  3FPP A;  1V1O A;  4OX9 Q;  1TKW B;  4A3E G;  2JYO A;  5C4X G;  2EYJ A;  1C7Y A;  1NCV A;  5ELB A;  2F1M A;  1EFW A;  3W3A A;  2IT1 A; 
#chains in the Genus database with same CATH homology
 2WB1 E;  3AFQ A;  5ELO A;  5JJI A;  4JI2 L;  4JBW A;  1HR0 Q;  3M3Y H;  1E1O A;  2XGT A;  1S40 A;  2N78 A;  4R1J A;  1IBL L;  1B8A A;  3BZK A;  2Q2I A;  1PV4 A;  3GTK H;  4GKK L;  4FDB A;  3HOX G;  3S1R H;  1OTC A;  1PYS B;  1SRU A;  3IRB A;  5IWA Q;  3KJP A;  2HIX A;  3H0G G;  5M3M G;  2DGY A;  3HKZ G;  1VQP A;  1WJJ A;  4B3S Q;  4JYA Q;  3JAM i;  1HZB A;  1I50 H;  5C3E H;  1IL2 A;  1Y1V G;  3TEH B;  5JJL A;  2UU9 Q;  2UUB Q;  3HOX H;  2PQA B;  3F1Z A;  4DNI A;  3K8A A;  3I4M G;  3MEF A;  1CUK A;  4R4O A;  5IYC G;  4X65 Q;  5EAY A;  4AQY L;  3ICE A;  2RCN A;  2JQO A;  1VQB A;  2IX0 A;  4UP8 A;  5IP7 G;  1IBM L;  3LGJ A;  1OXV A;  1N9W A;  3KDF B;  5C0X G;  4PG3 A;  2K5V A;  2VUM G;  1L2F A;  2NVT H;  1HZA A;  1FVI A;  4L5T A;  3M4Q A;  5C4J H;  4PMW A;  3PUV A;  4A93 H;  2ZJQ A;  1NE3 A;  4DR6 Q;  1FL0 A;  5IYD H;  1QUQ B;  3I56 A;  1HJP A;  1IBM Q;  5GAE C;  2HIV A;  3U4V A;  4POF A;  2LXJ A;  1K73 C;  4L5S A;  1JE5 A;  1VQ5 A;  4TVA B;  1KRT A;  1J5E Q;  4JI7 Q;  4GN5 A;  4JBJ A;  4X6A H;  4A3G H;  4HIK A;  3CCS A;  4GOP A;  2UUB L;  4DV4 Q;  1VQ9 A;  4LFA L;  1XNQ Q;  4OXP A;  3H0G H;  3PGZ A;  4JYA L;  4DV3 Q;  3I2Z A;  1A63 A;  1KL9 A;  2MFI A;  4DR7 Q;  3GTM H;  3KDF A;  1Y1V H;  3HFZ B;  2R92 H;  1PA6 A;  1IXR A;  2IY5 B;  4GS3 A;  3W1G A;  1K8A C;  2NVY H;  1Q8K A;  1HR0 L;  1WFQ A;  4IOC A;  4POG A;  5H1S E;  4A3B H;  4HJ5 A;  1VQF A;  4X62 L;  3RLF A;  3CCR A;  1I94 Q;  4K0K Q;  3TQY A;  5GAG C;  2Q2H A;  5GAD C;  3EN2 A;  3CCM A;  3M4P A;  4GOP B;  2ZTC A;  1I3Q H;  5DLQ E;  1L1O A;  3T1Y L;  4X66 Q;  3CQZ H;  3AFP A;  5E7N A;  2JEA I;  2K52 A;  1UE1 A;  1MIU A;  3CP0 A;  3TRE A;  4NXN L;  1QZH A;  1E3P A;  2OTL A;  4L5R C;  4JBM A;  4LFC Q;  4JOI A;  4LF8 Q;  2EXD A;  2WB1 G;  4A3C G;  3G71 A;  4BY1 H;  4QQB X;  3HKZ E;  3FP9 A;  1IBL Q;  4LF6 Q;  3J81 c;  4J15 A;  3KFU A;  2A1A A;  2I5H A;  1UE5 A;  1YVC A;  4ME3 A;  4P75 A;  5FLM G;  4B3M L;  2R6G A;  3HOW H;  3S2H H;  2JA7 H;  4GOP C;  2QGQ A;  3GTJ H;  3PF5 A;  3W1B A;  3G48 A;  3T1Y Q;  4EQ5 A;  3J81 i;  1CKO A;  3I4N G;  3RR5 A;  3SGI A;  3CC7 A;  4DUZ Q;  1JT8 A;  4DR3 Q;  4DKA C;  4BBS G;  2JA7 G;  2KCT A;  5AJ3 L;  4OX9 L;  1NY4 A;  1TWA H;  1YZ6 A;  3UDX A;  1WOC A;  3M9B A;  1OXS C;  3PUW A;  1PH7 A;  4A3L G;  2UXC L;  1E7Z A;  1K83 H;  2CQO A;  2KHI A;  1N33 Q;  2RHQ B;  4AYB G;  5IYB H;  2B3G A;  4DV5 L;  1N32 L;  4P71 A;  2GVA A;  1G51 A;  4YWK A;  3J7Z C;  2VQF Q;  1IZ6 A;  1QVG A;  4A3J G;  4P72 A;  1E24 A;  1Q1E A;  4MNO A;  3OTO Q;  1HNX Q;  4DAM A;  4XIG S;  3FKI H;  1SN8 A;  3S1M H;  4DV4 L;  1BBU A;  1E22 A;  4R4Q A;  5LMU L;  4R4I A;  3UDF A;  4JI6 L;  3PF4 A;  4WJ4 A;  5K36 G;  4UP9 A;  1HZ9 A;  4IFD I;  1WCM H;  1PH3 A;  4JI7 L;  4DUY L;  1VQC A;  3E9H A;  2GVB A;  2Z0S A;  3F8T A;  1YEZ A;  4JI8 Q;  1RL2 A;  4KHP L;  3KYH C;  1PVO A;  1JJC B;  1XMO L;  1M90 C;  2E2I H;  4NXM Q;  2K50 A;  2L15 A;  3RN2 A;  1X55 A;  3G4S A;  4HID A;  1TWH H;  4NXN Q;  4OWW B;  1YHB A;  2V1C C;  1YIT A;  3AEV A;  4X65 L;  4AQY Q;  2R7D A;  3GO5 A;  2WAQ E;  2I5M X;  3PO2 G;  1G6P A;  1RIP A;  1HNW Q;  3DLL A;  4X62 Q;  1I94 L;  3HOU H;  1ASY A;  1MKH A;  3HOZ G;  2A8V A;  1IYJ B;  3KF6 A;  2E2J H;  1KQS A;  4NXM L;  3D0F A;  3CF5 A;  1XMO Q;  4IPH A;  3T1H L;  4ALP A;  2JA8 G;  3H15 A;  4JI5 Q;  2VW9 A;  4YCV A;  4P73 A;  1GM5 A;  4JI8 L;  1I6H H;  3CW2 C;  5GQO A;  4B3R Q;  4DUY Q;  2MO1 A;  2HQL A;  2PMZ E;  2NZH A;  4GLA C;  2YTV A;  5IP9 G;  1R9T H;  2KBN A;  1EYG A;  1HZC A;  2IX1 A;  3J80 i;  5C0X J;  1Z47 A;  4LFA Q;  2XTI A;  3DM3 A;  1X9N A;  4LF5 Q;  1XNQ L;  4DV6 L;  1FGU A;  3STB C;  3VDY A;  4R4C A;  1X56 A;  2JA9 A;  4NPS A;  1MJE A;  1N34 Q;  1H95 A;  1VQJ A;  1XPU A;  4YWM A;  4QGU A;  3ULJ A;  3HOY G;  2NVQ H;  1NBW A;  2ZM6 L;  4DR1 L;  1Q86 C;  5BR8 Q;  1EWI A;  3CCL A;  3PO2 H;  4DPG A;  1W3S A;  5M5Y H;  2R93 H;  1VQO A;  2YTX A;  4IFD G;  4DR4 Q;  1N34 L;  1PFS A;  1OXU A;  3WWV A;  1M1K C;  4OO1 I;  1HR0 W;  2KHJ A;  4DR3 L;  1YJN A;  4GLX A;  2E5L Q;  4LF5 L;  2Z6K A;  1KHI A;  2UU9 L;  1UWV A;  3CAM A;  4B3R L;  1U0L A;  4YCW A;  2JEB I;  2WP8 J;  1SFO H;  1QVF A;  3D31 A;  2AMC B;  3S24 A;  4HIM A;  4HIO A;  4JI5 L;  2YYZ A;  2EIF A;  4GLV B;  4QIW E;  1PHJ A;  2K75 A;  3AQQ A;  4Y7N H;  2B29 A;  1NMF A;  4JI4 L;  3K7A H;  2A19 A;  4BBR G;  3S1N H;  3J7A 5;  4BA2 I;  4LFC L;  1HNZ Q;  2OCE A;  3MXN B;  3GTQ H;  1A0I A;  3HOY H;  3S15 H;  1QUQ A;  1VQE A;  2VQE Q;  2UUA Q;  2R93 G;  2CKZ B;  2F4V L;  1FJG L;  3HKS A;  4LF7 L;  4LWC A;  2VZA A;  4PZ8 A;  2KCM A;  5C4X H;  5M3F H;  4YHH Q;  5M3M H;  1D8L A;  4GKJ Q;  2N3S A;  4IFD J;  2ZTD A;  1X6O A;  4X64 L;  1YJ9 A;  2B63 H;  1EIY B;  2UXD Q;  1VQA A;  4JG2 A;  1V9P A;  4DK3 C;  4DR7 L;  4WJ3 M;  4TQU S;  1V1Q A;  5FJ8 H;  2K5H A;  1VS0 A;  3U58 A;  3HOV G;  2AWO A;  3ULP A;  4OO1 G;  2RF4 A;  3GTG H;  3KLW A;  2JA6 G;  1K3R A;  1HH2 P;  2CFM A;  3NEM A;  1L1O B;  2IHE A;  1EIF A;  3CMA A;  1AE3 A;  3HOV H;  2GN5 A;  2VY3 A;  2LSS A;  2N8N A;  3CCQ A;  5GAH C;  2PI2 E;  2H5X A;  1XMQ L;  2OQK A;  2N49 A;  1WYD A;  5BR8 L;  2ZM6 Q;  4DR1 Q;  4GKJ L;  3KF8 B;  1D7Q A;  4YHH L;  4B3T L;  3I4M H;  1XTD A;  2BA1 A;  3GD7 A;  5HGQ A;  5AJ3 Q;  4HJ7 A;  3M7N A;  3S14 H;  3I4O A;  1N8R C;  4LF9 L;  1UE6 A;  3KOJ A;  4IPC A;  3RLN A;  4JBK A;  2ATW A;  2VUM H;  1PH1 A;  2B63 G;  4JV5 Q;  1JJG A;  1VQK A;  4DV1 L;  2OWO A;  3PCO B;  3E9I A;  4A3I G;  4GNX C;  4A3E H;  3RZD H;  1BVS A;  1Y1W G;  2WAQ G;  2WFW A;  3CXC A;  2MNA A;  2CWA A;  1VQH A;  4A3B G;  2JE6 I;  5IWA L;  3S17 H;  3CC2 A;  2RHS B;  4OWT B;  5LMN W;  4JI4 Q;  2JA6 H;  3RLO A;  4GKK Q;  4LUV A;  1ASZ A;  1KXL A;  5ELN A;  1LTL A;  2LXK A;  4C3J H;  3CCJ A;  5IP7 H;  4DV2 L;  4MTN A;  2Q2U A;  3A5Z B;  4C3I H;  1N36 Q;  1VQN A;  4X66 L;  1TWF H;  2NN6 G;  3W5O A;  1QZG A;  3L7Z C;  3PUY A;  1K9M C;  4JI0 Q;  2K4K A;  3GDE A;  4LUZ A;  1A8V A;  1IBK Q;  3NEL A;  2F52 A;  4DR5 Q;  4K0K L;  4YWL A;  2NVX H;  3EIV A;  3PO3 H;  4JV5 L;  1VQD A;  3BU2 A;  2OQ0 A;  4LF9 Q;  4RG1 A;  1UEB A;  3AYH B;  3HOW G;  4DV2 Q;  4DR4 L;  3CCV A;  3JC6 6;  5IY0 A;  4B3T Q;  1J6Q A;  4P74 A;  1PYB A;  4A3I H;  1Q46 A;  1X54 A;  1Y1W H;  5C44 H;  4IJL A;  3PO3 G;  3K80 C;  2HHH L;  4APV A;  4GN3 B;  1KD1 C;  3TS0 A;  3CCE A;  1SE8 A;  1LM0 A;  4BY7 G;  3UE1 A;  1X3G A;  4H02 A;  1SLJ A;  1P16 A;  4A3M H;  3J80 c;  2MO0 A;  2QA4 A;  1JMC A;  4A3L H;  3TS2 A;  4A93 G;  2IHF A;  1V43 A;  5IYD G;  1A62 A;  1CSQ A;  3OTO L;  3F2C A;  2ID0 A;  1WI5 A;  5IT9 c;  3KJO A;  1C9O A;  3F2D A;  4BY7 H;  3RN5 A;  3UE0 A;  1I5F A;  2PNH A;  5IE8 A;  4A3G G;  1K8G A;  2Q2T A;  1PH9 A;  1N33 L;  3UDI A;  1BBW A;  3ULL A;  1XMQ Q;  1VQG A;  1UE7 A;  5LMN L;  3K0X A;  2UXC Q;  4YY3 Q;  1KC8 C;  2JK8 A;  1XNR Q;  3ZJY C;  4AIM A;  4A76 A;  1KIX A;  1XPO A;  3K81 C;  1VQ7 A;  2R92 G;  2D0O A;  4DAY B;  1KAW A;  2D62 A;  5JEA J;  2JJQ A;  1VCI A;  2YV5 A;  3M85 A;  2I0Q A;  4A3C H;  5C44 G;  4XTC S;  4HJA A;  1FJG Q;  5GRO A;  2ZTE A;  2ALY B;  4KHZ A;  4B3S L;  4IO9 A;  2VQE L;  4A75 A;  1AE2 A;  1KRS A;  5FLM H;  2K5N A;  1LYL A;  1OXT A;  2YTY A;  2NN6 I;  3ERS X;  4LFB Q;  1CKN B;  4DR2 Q;  3CD6 A;  5JJK A;  1HNZ L;  2EQS A;  2ZJR A;  4AYB E;  4A3M G;  3A0J A;  1O7I A;  1YNX A;  4LF6 L;  1SR3 A;  4X64 Q;  1YJW A;  2UUC Q;  3FKI G;  3OW2 A;  4QY7 A;  4LF4 Q;  4KHP Q;  2JA5 G;  1XPR A;  1NMG A;  4A3D G;  1PH6 A;  4GNX A;  4JOI C;  3H3V I;  3CPW A;  4DV7 L;  1WCM G;  4DR2 L;  2E2H H;  4JI1 Q;  2CCZ A;  2R7F A;  4GN4 B;  2Z6K C;  4IPG A;  3PUX A;  3HOZ H;  4BY1 G;  1VQ6 A;  2I5L X;  3CCU A;  2JA5 H;  1SRO A;  3G6E A;  4YCU A;  5M5W H;  4JI0 L;  4A3D H;  1QVC A;  4EX5 A;  3UDG A;  1C0A A;  1VQI A;  3PSI A;  1W2B A;  4UY8 C;  1CKN A;  1TXY A;  2K14 A;  1N32 Q;  2UXB L;  2VS1 A;  2BH8 A;  1L0W A;  4DK6 C;  5IP9 H;  4PZ7 A;  2MQH A;  3I4N H;  4QJF A;  1DGS A;  4QL5 A;  4BBS H;  4DV0 L;  1OXX K;  1CKM A;  5JEA G;  3STB D;  3F2B A;  1LUZ A;  4LW1 A;  1YHA A;  4DV3 L;  4BXX H;  1X3F A;  3J81 j;  2Y0S E;  1JB7 A;  3RNU A;  2OTJ A;  1Q81 C;  5HY6 A;  1YBY A;  4JI3 Q;  1Q1B A;  3FHW A;  5IYB G;  3U4Z A;  4JI3 L;  1EUJ A;  4RMF A;  4A3K G;  4O0A A;  3A5U A;  2E5L L;  4NB3 A;  3L0O A;  4IPD A;  2PI2 A;  4JCV E;  1S3O A;  4A3J H;  1PH2 A;  1T9H A;  1JJ2 A;  3PUZ A;  4BXX G;  3OYY A;  2FXQ A;  4OON A;  3M4O H;  4DR6 L;  4DV0 Q;  4A3F H;  3T1H Q;  3CME A;  4PZ6 A;  2VNU D;  4OWX B;  4HJ8 A;  4KI0 A;  1TWG H;  4LF8 L;  4KLK A;  1Q12 A;  1CSP A;  4LUO A;  1L1O C;  1YIJ A;  1XJV A;  3HOU G;  2E8G A;  1SMX A;  1P8L A;  2UXB Q;  1YI2 A;  1HNW L;  4Y52 H;  2CWP A;  4DR5 L;  2NZO A;  5FLX c;  2AHO B;  4DV6 Q;  1PH5 A;  2JA8 H;  1IBK L;  3E0E A;  3NEN A;  2HT1 A;  4JC0 A;  2AKW B;  4R4T A;  4LNQ A;  1N36 L;  3CC4 A;  3S1Q H;  5M5X H;  3NBH B;  1VQL A;  1K0R A;  4JI1 L;  3A74 A;  1MJC A;  4DV7 Q;  3KF6 B;  4BA1 I;  1PH8 A;  1VQ4 A;  4A3K H;  1B7Y B;  4LF4 L;  3S2D H;  4GNX B;  2UUC L;  2YU9 H;  1NJI C;  3GTP H;  1GKH A;  3BZC A;  3I55 A;  3JAM c;  4A3F G;  4LF7 Q;  1U5K A;  5LMU Q;  2VL6 A;  3BJU A;  2ASB A;  4LFB L;  2ZJP A;  1VQM A;  2F3I A;  3U50 C;  1PH4 A;  4DV1 Q;  1Y14 B;  3B6Y A;  4BBR H;  1J5E L;  2F4V Q;  1HNX L;  2PQA A;  2UUA L;  4AH6 A;  1B70 B;  2ES2 A;  3I7F A;  3CPF A;  4MZ9 A;  4IOA A;  1GO3 E;  3PV0 A;  1XNR L;  4DV5 Q;  4YY3 L;  1EQR A;  3RZO H;  3GTO H;  1G29 1;  3L2P A;  1Q82 C;  5LMN Q;  1GD7 A;  1X3E A;  2C35 B;  1VQ8 A;  3Q8D A;  2AWN A;  4C3H H;  2R7Z H;  4UPA A;  1YHQ A;  4HJ9 A;  4DUZ L;  4IJH A;  5M3F G;  4L5Q A;  3GTL H;  4C2M H;  4O2D A;  5C0X I;  1NTG A;  4UP7 A;  4JI6 Q;  1TWC H;  1EOV A;  1X65 A;  3EBE A;  3S16 H;  2VQF L;  2R7Z G;  4A4I A;  2UXD L;  1S72 A;  4B3M Q;  1GVP A;  3K7U C;  2HHH Q;  5FJ8 G;  1Z9F A;  1BKB A;  1E1T A;  3PIP A;  2DUD A;  2BH2 A;  5C3E G;  3ER0 A;  1EQQ A;  1Q7Y C;  2KEN A;  3PIO A;  4JI2 Q;  2BA0 A;  2QEX A;  4OX9 Q;  3TRZ A;  4A3E G;  5IYC H;  5C4X G;  3H3V H;  1AH9 A;  1C7Y A;  5J3B A;  1EFW A;  2Y0S G;  2D0P A;  2IT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...