3WWVA

C-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
64
structure length
64
Chain Sequence
RTGKEEMIGLIGTVVEELNPEGMIKVRGELWKARSKFNGKIEKGEKVRVVDMDGLTLIVVRERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stomatin operon partner protein
publication title Crystal structure of the stomatin operon partner protein from Pyrococcus horikoshii indicates the formation of a multimeric assembly
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Unknown function
total genus 17
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2014-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3wwvA00
4LUOA 1S72A 4TQUS 5DLQE 1SRUA 1VQCA 4A3CG 2FXQA 2VQEL 5BR8Q 4DK3C 4C3IH 4PMWA 1VQ5A 4LF6L 4DR7L 4O0AA 4HIKA 4DR3L 2IT1A 5LMNW 2PQAB 2WAQG 1QZGA 5M3FG 3STBD 5J3BA 2JA7H 2JK8A 2HQLA 2UXDL 1HR0W 5M5YH 4C3HH 4YY3Q 3AFPA 3CPFA 1M1KC 3HFZB 5JEAG 4JI0Q 4LF8L 3HOYG 3PSIA 5IYBG 4AYBG 3M7NA 4A3BG 4DV4Q 1JB7A 1VCIA 5IT9c 1EIYB 3HKZG 2K14A 1HZ9A 3G71A 2F4VL 4LFAL 4DNIA 2OTJA 1HH2P 3PIPA 4A3JG 1IL2A 1NJIC 1VQ8A 1LYLA 2YTYA 3W5OA 1Y1WG 3B6YA 2LSSA 4JYAL 4X62Q 4X65L 2UXCQ 2BH2A 4XIGS 2MFIA 3S24A 4DUYQ 1Q86C 1CUKA 3KDFA 2QGQA 1CKOA 1G291 5LMUL 4IFDG 2ZM6L 1XPOA 4A3MH 3I55A 2HIVA 1M90C 1G51A 1UE1A 3HOVH 3UE0A 3F2BA 4APVA 3F2DA 2MO1A 2A8VA 1Q12A 4DR5Q 1X6OA 4JI7Q 5LMNQ 4AQYL 3UDFA 2DUDA 4KHPQ 4DR4Q 3DLLA 2UUAQ 2VNUD 2R7FA 1OXVA 1IZ6A 1B70B 2ALYB 3KF6B 1SE8A 3KJOA 1FJGQ 2YV5A 1DGSA 4JI8L 3GTLH 2Y0SE 1FVIA 4A3IH 2ZTEA 2YU9H 4HJAA 1VQKA 2RF4A 3CXCA 1N33Q 3M85A 5C4XH 5GQOA 4A3DH 1D7QA 3ERSX 5IP7G 2AKWB 1N34L 1MKHA 2VQFQ 4LF5Q 3A74A 4GKKL 5IWAL 4NPSA 1PFSA 4YCWA 1HNWL 1VQBA 5C3EG 4DAMA 1CSQA 4J15A 1XJVA 3HOXG 1LUZA 1HNZQ 4DV1L 1VQ6A 3I4MG 3J81j 2JA7G 3S16H 4DV0Q 1O7IA 1PH1A 3M4QA 1I5FA 2PQAA 1KRTA 1N32Q 3E9IA 2PNHA 1VQEA 1UE7A 4EX5A 1PA6A 1R9TH 1K8GA 1YVCA 4LF9L 4JOIC 2XTIA 4A93H 2MQHA 4NXMQ 1EQRA 3D0FA 1UE5A 1I94Q 4YWKA 3H3VI 3RZDH 3AEVA 4C3JH 4Y52H 1Y14B 1OXSC 2EQSA 1AH9A 1NMGA 1E3PA 4PZ8A 3TREA 5FLXc 1TWFH 3WWVA 1N36L 4B3RQ 4IPHA 4P73A 1V1QA 1WJJA 4RG1A 2ASBA 1YJ9A 3S15H 1L2FA 3W1BA 3FP9A 4A3MG 1A8VA 1IYJB 2E2HH 4DKAC 4DUZQ 3HOYH 3HOVG 3HKSA 3UDGA 3ULLA 2VQEQ 1PYSB 2PI2A 1E22A 1JE5A 3RN5A 1VQDA 1I50H 1CKMA 1VQHA 4OONA 5GAGC 4B3TQ 3H3VH 2R7DA 3K8AA 3PUYA 2KCTA 4HJ9A 4QIWE 4LF8Q 4TVAB 3RZOH 5K36G 2ZTDA 3M4OH 1Y1VH 3GTOH 2UXBQ 1YJWA 4A3DG 2VY3A 5ELNA 4DAYB 4JI3Q 3PF5A 4JI2L 3GTMH 1TWAH 2V1CC 3CCMA 2CKZB 2EIFA 1MJEA 2N8NA 1A62A 4GOPC 2NN6I 2KHIA 1GKHA 1VQ9A 1A0IA 1KHIA 1YHQA 2NVXH 1TWCH 2ATWA 1C9OA 4JBKA 1SFOH 4OX9L 4PZ6A 3BJUA 2CWAA 2JA6G 1WCMG 1J6QA 4DR1Q 1JJ2A 4NB3A 1TXYA 4IOAA 2RHQB 1UWVA 2ZTCA 4XTCS 5IYCG 4LFCQ 4LNQA 4LUVA 3ZJYC 2BA1A 1KIXA 5JEAJ 2E2IH 1NY4A 5IP7H 3GTQH 3CP0A 3D31A 1YIJA 3CC4A 3RR5A 1PH5A 1VQLA 4BBSG 4X66L 5C4JH 2Q2UA 1S40A 4JI4L 1GO3E 3L2PA 5GAHC 1N9WA 3OYYA 1XNQL 3KFUA 5C3EH 2JA5H 4L5RC 4JI1L 3K0XA 4A93G 4JG2A 3HOXH 4P71A 3CD6A 4K0KL 5EAYA 3J7ZC 2F52A 2KBNA 2N3SA 4B3MQ 3I4MH 3OTOL 2Q2HA 4QQBX 4KLKA 1W3SA 4IPCA 1QUQB 4JV5L 1IBLL 4O2DA 4A3GH 4GS3A 1YI2A 1N34Q 1YZ6A 2UUBL 2ID0A 4JI5L 3TEHB 1PH4A 1Q8KA 1N8RC 1LM0A 3KF8B 3TS0A 1EUJA 2K5VA 1P8LA 2OCEA 3IRBA 1X3GA 2VL6A 5M5XH 4QGUA 2WFWA 4DV2Q 4OWTB 1XNRL 4JBMA 1KAWA 1V9PA 4OO1I 4LF7L 1WFQA 4GOPB 3NELA 2UU9L 4X64L 2HHHL 3GD7A 1Y1VG 4IPDA 4LUZA 4HJ8A 1Q7YC 4B3SQ 1BVSA 3I56A 2MO0A 2JE6I 5GADC 2D0PA 4KHZA 4QY7A 4LW1A 3JC66 3PUXA 1VQPA 1XMQQ 1GD7A 4DR6Q 3I2ZA 2N49A 3EIVA 3EN2A 3ULJA 4POFA 1SR3A 1KD1C 4JOIA 4ME3A 5M3MH 5JJLA 2KHJA 4GKJL 1BKBA 3G4SA 3T1YQ 4GLXA 3F8TA 2LXJA 3U4VA 2E5LL 4LFBQ 1TWGH 3U58A 1K9MC 1PVOA 4DV5L 1E24A 4YCUA 4A75A 4R4QA 4NXNL 5H1SE 3T1HQ 1JJCB 4BY1H 4HJ5A 2JA5G 4BXXH 1X56A 4YHHL 1YBYA 4POGA 5JJKA 1K8AC 2BA0A 3RLOA 2NN6G 3CCVA 3CC2A 2VUMH 1VQ4A 2JA6H 3J7A5 5BR8L 1WCMH 3BZCA 2VS1A 4KI0A 1VQJA 4A3GG 1EIFA 4BA1I 5IYCH 4JI2Q 2R93H 1QUQA 2RHSB 2B29A 1SLJA 2N78A 4UP9A 5AJ3L 2Q2TA 1E1TA 2MNAA 2JEBI 4BBSH 1PYBA 1NTGA 2NZOA 4YY3L 1QVFA 4OXPA 1KL9A 2ZJQA 1OTCA 4LF4Q 5FLMH 1IBKL 4UY8C 1KQSA 3PUVA 1MIUA 2GVAA 3PGZA 4P74A 4A3LG 1AE2A 3EBEA 4GN3B 4GOPA 3A5UA 2K4KA 4X62L 4JBJA 1VQAA 2WAQE 2UXCL 2H5XA 1NBWA 5ELOA 1YJNA 3PO3G 1UEBA 4X66Q 4BBRH 3PUWA 2CCZA 3PIOA 3DM3A 4JI4Q 3HOZH 3S1MH 1XNQQ 1AE3A 2I5HA 4AYBE 5M5WH 1XMOL 4LF6Q 3S2DH 3HKZE 2JEAI 2R92G 4DR7Q 4GLVB 4DR3Q 2OWOA 4Y7NH 3U4ZA 2QA4A 1E1OA 3KOJA 5M3MG 1EOVA 2E2JH 1D8LA 3K7AH 2IHEA 2KCMA 1RIPA 4DV3L 4DR5L 1FGUA 2XGTA 1HJPA 4JBWA 2E8GA 5LMNL 1YITA 1PV4A 4JI7L 3S14H 4DR4L 4OO1G 3CCSA 2AWNA 4IOCA 1YNXA 2WB1G 2D62A 1QZHA 1HR0L 3I4OA 1FJGL 1VS0A 3KJPA 2CFMA 4DV6L 4QJFA 2F4VQ 2Z6KA 3F1ZA 1PH2A 4LFAQ 4DPGA 3CPWA 4BY7H 1G6PA 5FJ8H 4PZ7A 3UDXA 4BY1G 1N33L 4BXXG 4JYAQ 4X65Q 1XPUA 4LF5L 4HIDA 2VQFL 2IX1A 1JMCA 2JA8H 1Q81C 5C44H 4P72A 3UE1A 2ZM6Q 5LMUQ 2HHHQ 3A0JA 2CWPA 2VUMG 2L15A 1K3RA 2Y0SG 4R4CA 4A76A 1X55A 1PH6A 3SGIA 2R7ZG 4GNXC 3MXNB 3PV0A 1HNZL 1IBML 2R93G 3S1QH 1Z9FA 4DR2L 4UPAA 1Q1EA 4DV0L 2JQOA 1NMFA 2OQ0A 3GTJH 1XPRA 1EQQA 4AQYQ 1VQOA 3PO2H 2WP8J 4P75A 3F2CA 3L0OA 5C0XG 5FLMG 4NXML 4ALPA 4UP8A 4A4IA 1VQNA 4JI8Q 1I94L 3RN2A 2Z6KC 2K75A 2I5LX 1GVPA 1KC8C 4MZ9A 2E5LQ 1HZAA 2ES2A 1X3FA 3ULPA 2JJQA 2Z0SA 4YCVA 1C0AA 4A3EH 3ICEA 2HT1A 1X65A 4AH6A 1OXTA 4B3RL 4JI6L 1I3QH 1QVCA 5IP9G 1EYGA 4DV5Q 1C7YA 4PG3A 4BBRG 4GKKQ 5IWAQ 3S1NH 1HNWQ 3W1GA 4HIMA 3HOZG 2LXKA 3Q8DA 1L0WA 2EXDA 4DUZL 4YHHQ 1PH7A 4GN4B 1J5EL 5IYDH 4H02A 1H95A 2B3GA 5GAEC 4DV1Q 4R4IA 1K0RA 3RLNA 3S2HH 4A3LH 3PUZA 1T9HA 4FDBA 5HGQA 2ZJPA 1OXXK 4JV5Q 3MEFA 4A3FG 5AJ3Q 4HJ7A 4B3TL 2CQOA 4LF9Q 2GN5A 2GVBA 1JT8A 3NBHB 3I7FA 3STBC 4IPGA 2NVQH 3PO3H 1HZCA 3BZKA 3CCUA 4WJ4A 4BY7G 5FJ8G 4GNXB 1YHAA 1IBKQ 4QL5A 4RMFA 4GN5A 4IFDI 2UXBL 1N36Q 2R92H 4JI3L 4MTNA 3H0GH 3I4NH 2JA8G 5C44G 2VW9A 1JJGA 1SN8A 2UUCL 2IX0A 4R4OA 4OWXB 1ASYA 2B63H 3HOUH 3BU2A 3U50C 1HNXL 5IY0A 1PHJA 1YEZA 5IE8A 3HOWG 4X6AH 2WB1E 1Q46A 3TQYA 4EQ5A 4DR1L 5C0XI 1L1OB 1P16A 2K52A 1XMOQ 3PO2G 4LFCL 4IJHA 3GTKH 1S3OA 3CCJA 4DV7L 1Z47A 2AHOB 3E0EA 4GLAC 3UDIA 1K73C 2OTLA 2NVYH 1B7YB 4DV3Q 1CSPA 3CF5A 1CKNB 4L5TA 4UP7A 2IHFA 1HR0Q 1K83H 3JAMc 2OQKA 3AQQA 3E9HA 4YWLA 3H15A 4DV6Q 4A3EG 1VQ7A 3G48A 2R7ZH 2YYZA 3J80c 5JJIA 4B3ML 4L5QA 4HIOA 2KENA 2A19A 1IXRA 3FKIH 5IYDG 2C35B 2ZJRA 1OXUA 4JI0L 3CCRA 4JCVE 3G6EA 4DV4L 4OX9Q 2D0OA 1WYDA 1VQIA 4BA2I 2DGYA 1VQFA 3CMAA 4DV2L 1V43A 1IBMQ 3RNUA 1KXLA 5E7NA 4R1JA 1WI5A 1VQGA 4DR2Q 4A3KH 1VQMA 3GTGH 3TS2A 1UE6A 3JAMi 4DUYL 2HIXA 5IP9H 1NE3A 1EWIA 3M4PA 1Q82C 2VZAA 4L5SA 3TRZA 3J80i 4LWCA 3PF4A 3PCOB 2BH8A 1SROA 1HZBA 3M9BA 2R6GA 4JI1Q 4AIMA 1X9NA 4GNXA 4B3SL 2PI2E 2RCNA 3CC7A 3H0GG 2NVTH 3L7ZC 3CCLA 1X54A 2K50A 1XTDA 3I4NG 1TWHH 4A3CH 5GROA 4K0KQ 3OTOQ 4IFDJ 4R4TA 1BBWA 1XMQL 3NEMA 1QVGA 1IBLQ 2B63G 3S1RH 1W2BA 4JI6Q 3HOUG 4DR6L 4KHPL 1I6HH 2UUAL 2UUBQ 1A63A 4A3FH 3KYHC 1Q1BA 4JI5Q 3GO5A 3J81c 5M3FH 3T1YL 1J5EQ 5HY6A 2JA9A 4IJLA 3AFQA 3GDEA 1XNRQ 4LFBL 1L1OA 5IYBH 4A3BH 3CCQA 5C0XJ 2K5NA 3OW2A 4LF7Q 1WOCA 1X3EA 1MJCA 3FHWA 2UU9Q 3M3YH 1B8AA 4A3JH 4DK6C 2K5HA 1GM5A 1Y1WH 1U5KA 4X64Q 3T1HL 1ASZA 1CKNA 3KDFB 1FL0A 2AWOA 3CQZH 1U0LA 3ER0A 1E7ZA 3KF6A 4A3IG 3KLWA 3HOWH 3LGJA 2AMCB 2NZHA 4JC0A 1BBUA 2UXDQ 2YTXA 3J81i 5C4XG 2F3IA 3FKIG 1N32L 1PH3A 1KRSA 3K7UC 2A1AA 2Q2IA 1PH8A 3GTPH 4GKJQ 3CW2C 2UUCQ 3VDYA 4WJ3M 1HNXQ 3K81C 4LF4L 1EFWA 4IO9A 3S17H 2IY5B 2QEXA 3CCEA 3AYHB 2I0QA 1L1OC 4A3KG 3A5ZB 3K80C 1YHBA 2YTVA 4MNOA 1SMXA 3CMEA 1PH9A 2PMZE 4OWWB 2I5MX 3RLFA 1RL2A 3NENA 4DV7Q 4NXNQ 4C2MH 3CAMA 4YWMA 1LTLA
chains in the Genus database with same CATH superfamily
1WVLA 4CGYB 2KVMA 5BN4A 1PFBA 1F9PA 4RCNA 4A3CG 1IW7D 4Z9CB 4DK3C 5EJWA 4PMWA 1PRTB 3TZUA 4O0AA 3HS0C 2RKSA 1ILQA 2PQAB 2WAQG 2RSNA 2HQLA 4FYDA 1M1KC 3HFZB 3DMUA 1ONLA 4S3SA 3EFXD 3HKZG 4A3JG 1NJIC 2YTYA 3S15B 2KUMA 4X65L 1Q86C 2QGQA 2B2UC 5LMUL 2B8GA 2WACA 3HOYB 2RQXA 4A3MH 3C1EA 1CQFA 1M90C 5EKKA 4ZCKA 3UE0A 2A6HC 1WD0A 2MO1A 3LWEA 1I50B 2B2WA 4RGMA 2AQ2B 2B2VA 5LMNQ 4JI7Q 2K32A 1HA6A 3OMCA 2CW0D 4IUVA 2R7FA 3SR1A 2ALYB 1VDZA 1SE8A 3ND8A 4N8FA 1Y1VB 1EY8A 4HJAA 5D3IB 2EYLA 3GTMB 1TWAB 5C4XH 5IP7G 2AKWB 5I4DA 5IWAL 1HNWL 5EPJA 5C3EG 4DAMA 2IJ0A 1SFOB 3MXPA 1WTVA 1A6XA 3J81j 4DV0Q 1ZXTA 1MBYA 4KJNA 3M4QA 3Q22A 2PQAA 2MHVA 3BDCA 3KBGA 1B50A 2QEJC 4EX5A 3GTQB 1K8GA 1YVCA 5EGTA 2RCFA 1EQRA 4IALA 1EYAA 1UE5A 2PZTA 5C4HA 1B9NA 2D2CC 1SSOA 1DONA 3CRLC 4IUTA 4PZ8A 5FLXc 5I9OA 4B3RQ 3S15H 1ZKOA 3E0JA 4CDFC 4DKAC 5C5LA 3HOYH 3HOVG 1HUMA 3ONAB 1PRTD 3C46A 1SE4A 3HKSA 5M5XB 5T1GA 1E22A 1CI3M 1I50H 1CKMA 1SE3A 4OONA 4B3TQ 2QW7A 2FMMA 3DM1A 5FO7B 3V2TA 3T51B 1Y1VH 1YJWA 5FLXL 2F03A 4JI2L 4JI3Q 3GTMH 1Y8OB 1TWAH 2V1CC 3V05A 2EIFA 1MJEA 4NW2A 1V1PB 4IUNA 1YHQA 1YNJD 2K04A 2ENBA 1QNKA 1SFOH 4PZ6A 1X3PA 1BNZA 2WB1B 4NB3A 1JJ2A 4LFCQ 1HHVA 3S9WA 1KIXA 4EQNA 2Q8TA 3K58A 2E2IH 1EYDA 1B44D 2EOTA 3GTQH 4BBSG 3CP0A 3D31A 4M8AA 2BOSA 1DOMA 1U4MA 3L2PA 3KFUA 1Q8IA 2N55A 4L63B 4JG2A 4K0KL 1KABA 4B3MQ 2F52A 1U4RA 2Q2HA 1TR5A 1W3SA 4IPCA 4JV5L 2R93B 4KMUC 1IBLL 1DXMA 1N34Q 1YZ6A 5FLXE 4FVMA 1Q8KA 1N8RC 1LM0A 1SEBD 3KF8B 3IAYA 1STAA 2OCEA 3K6OA 2PQEA 2VL6A 5M5XH 4QGUA 1T5EA 2F0QA 4OWTB 1EYCA 1X3QA 1TQOA 1KAWA 3MVVA 1DZ1A 1JWSD 3OWEB 2K05A 1O78A 3QJYA 4HJ8A 1SNCA 3ITPA 2XSCA 2A6HD 1CA6A 3HOZB 2MO0A 2D0PA 5NUCA 2L55A 2J0TD 4J8QA 3MAQA 1ET6A 5CYUA 1UAPA 4DR6Q 3EIVA 4RH6A 1UNSA 4K2KA 1V1PA 2F3VA 1STBA 5CC4A 3WOFA 3F8TA 2EE1A 2LXJA 3U4VA 3K57A 3N52A 3SK5A 1EY6A 1RCVD 1K9MC 3FPUB 4QMGA 5BN3A 1E24A 5DAUA 4H0LC 4YCUA 4NXNL 5H1SE 2JA5G 2JA8B 5C44B 2EVBA 1GHJA 2K33A 5I6WA 4KI0A 1NR2A 4ODGA 5IOCA 2R93H 5HURA 2Q2TA 4HN7A 3I73A 2JEBI 2KQ3A 4YY3L 4OXPA 3KF8A 1FR3A 1KL9A 4MTKA 3VR3A 1OTCA 1F2YA 5FLMH 3SEBA 5DM73 1MI2A 4A3LG 1JOKA 3D4WA 1I3QB 2K4KA 4X62L 4YIJA 2UXCL 1CM9A 4CJ0B 1NBWA 4X66Q 4JI4Q 2N88A 5CORA 3HOZH 1AE3A 4H44C 2JEAI 2R92G 4GLVB 2QA4A 3KOJA 5M3MG 1D8LA 3VR5A 3J80L 2KCMA 4DR5L 3NQTA 4JBWA 2E8GA 2AWNA 1HR0L 2EXZA 2NVQB 1AW7A 1GUSA 5CMDA 1G6PA 5IGCA 1N33L 2F0NA 4X65Q 4KJOA 4LF5L 4HIDA 2VQFL 4FXKC 4X3TA 1JMCA 2JA8H 1Q81C 2L12A 4P72A 5C44H 5LMUQ 4IFDG 2CWPA 1U4LA 3SGIA 5BN5A 4GNXC 4B9XA 1IBML 1Q1EA 4K8IA 3X3MA 1NMFA 5ELEA 2K01A 3GTJH 1VQOA 4KD3A 1KAAA 2WP8J 5FOBB 3LWUA 4NXML 2SOBA 1VQNA 4MZ9A 1I4QA 1X3FA 4DNTB 1RJTA 3ULPA 2HT1A 5DNFA 1I3QH 4O1NA 5IP9G 1PMRA 4B08A 1CA5A 1B4OA 5IWAQ 1HNWQ 2M00A 3Q8DA 5IYDH 2EXDA 1KTKA 4LJZC 4WRDA 1H95A 1JWUD 4IUUA 1PTOC 3RLNA 3OPOA 4RAUC 5LL6X 2DY8A 2B2YA 5CV4A 1RD9D 2GVBA 1TY0A 1IHZA 3NBHB 4JPBW 1JT8A 2NVQH 1HZCA 1NCVA 2L4NA 4GNXB 1YHAA 1U4PA 4ZLTF 3M7GA 3VYRA 1JJGA 4A3FB 3K5NA 3HOUH 1IYUA 3BU2A 3EVQA 5M3FB 1HNXL 3CHBD 3A7AB 3NTKA 3MXGA 1B9MA 1Q46A 3TQYA 2K52A 3G7LA 1S3OA 2F0WA 2AHOB 1LTRD 2NYZD 3E0EA 3UDIA 3M3YB 5CBEE 1RTOA 1EQVA 1AP0A 2IHFA 2OF1A 2OQKA 2M9VA 4A3EG 2F0LA 3BVGA 3OW7A 1STNA 5JJIA 1F9SA 3MXUA 4HIOA 4HSVA 2C35B 3QOJA 3CCRA 1TY2A 3G6EA 2D0OA 5CV9A 2NB0A 3IKJA 1V43A 3ND9A 1KXLA 4R1JA 1WI5A 1VQGA 3H09A 2Z6BA 4C2MB 1NE3A 1EWIA 3OIPA 2VZAA 3NBHA 3GP7A 3J80i 1K3BC 4LWCA 2A6ED 3I70A 2BH8A 1HZBA 3M9BA 2R6GA 4GNXA 3CC7A 3H0GG 3I4NG 4K0KQ 2HCCA 2R3ZA 1SYCA 4JV5Q 1IBLQ 1W2BA 4JI6Q 1A63A 4A3FH 2NTTA 4C3HB 5M3FH 3T1YL 4XQQA 3I8ZA 4IUQA 2JA9A 4IJLA 4LFBL 5JPNC 5D14A 2K5NA 1MJCA 3M3YH 3QR8A 2BE5C 1E2ZA 3MZ5A 2K5HA 4CDEC 1FL0A 2PNRC 1U0LA 3NPPA 4C1NI 5KNCA 2NZHA 3J81i 5C4XG 4ID6A 2A73B 1BOSA 3TP5A 2Q2IA 3R2TA 3G6JB 4V0BA 2TSSA 4WJ3M 1SXTA 3K81C 1RKNA 3EROA 4KKSA 2O5IC 3CCEA 3GTLB 3AYHB 1L1OC 1MSHA 3A5ZB 4A3KG 2YU9B 1YHBA 2YTVA 1SYBA 3NENA 4A3DB 1EWHA 4NXNQ 4C2MH 5L37A 1VQ5A 1SNOA 1S4ZA 5J22A 5DLQE 1VQCA 1XX8A 1F2LA 2FXQA 1EIGA 4K5XA 4MIUA 4LF6L 4HIKA 3S16B 4WORA 1I4XA 1NUCA 2IT1A 4C3HH 4YY3Q 1D2BA 3AFPA 3HOYG 3PSIA 4A3BG 3KK7A 4AYBG 1VCIA 5IT9c 3DWQA 4C3JB 3BVMA 4E6IA 4LFAL 4DNIA 2OTJA 4O42A 2FINB 2LSSA 4X62Q 5FO8B 2UXCQ 2K28A 4DUYQ 5A2QL 1SNPA 2PCFB 3K59A 3AMUA 2JP1A 4M1UB 1UE1A 1SYGA 3F2BA 3I4LA 3F2DA 2A8VA 1Q12A 1TIID 4DR5Q 1X6OA 2OT2A 1Y1WB 3UDFA 2DUDA 4KHPQ 2UUAQ 1ZYRC 4ZQ3A 3KJOA 1B70B 2L9HA 2HD3A 4JI8L 5IT9L 4RKBA 3GTLH 2Y0SE 1GJXA 4XYOA 2ZTEA 2YU9H 1VQKA 5CV8A 4R8NA 3CXCA 1N33Q 1JOOA 5GQOA 2KCNA 4A3DH 4LF5Q 1HA5A 1N34L 2VQFQ 2OEOA 1Q90A 4CKEA 1AFPA 2IX3A 2IW3A 4J15A 1ESRA 2X6LA 3P75A 2JA7G 3S16H 4ZYSA 1KDCA 1N32Q 3T53B 1UE7A 4JOIC 4F88A 1Y8NB 4NXMQ 5C4JB 1FNUA 4YWKA 4LK1C 5M9OA 3AEVA 1CFMA 4C3JH 2EQSA 3HOXB 4F8MA 2ASBA 1WJJA 3I4MB 1S5BD 1YJ9A 5IT9E 2WINB 5JVH3 3W1BA 1K8OA 3FP9A 1E0BA 3A56A 2KCCA 5JEAH 5DEHA 2BE5D 1VQDA 3VYTA 1VQHA 1A3UA 1EY4A 5E1FA 2R7DA 3E3XA 2B8FA 1LV9A 3PUYA 1ICWA 1VMCA 2ZTDA 4UHVA 1G2SA 4K5VA 2DN8A 3R3OA 3HRZC 5ELNA 4DAYB 3CCMA 1MHWC 2CKZB 2NN6I 2LS01 1GKHA 4RGNA 1A0IA 1B2TA 1D5ZC 3BYTB 4OX9L 3BJUA 2CWAA 1WTHA 3FMCA 2CH4A 2EDGA 2RHQB 2ZTCA 2BA1A 4KY7A 2Q8IB 1NY4A 2EY1A 3CC4A 1SNQA 1VQLA 4BY1B 4F87A 4X66L 5C4JH 1SMYC 2Q2UA 4JI4L 1DCZA 1EEID 3OYYA 2SNMA 4L5RC 2VUMB 2RA4A 3DWAA 3K0XA 1WCMB 3HOXH 2NN6H 2Y0SB 5EAYA 2N3SA 2KBNA 3I4MH 4FO2A 4QQBX 4KLKA 4OELB 1DYQA 4L8JA 2ZXPA 1LT4D 2ID0A 3TEHB 1PH4A 2JYOA 4GZYC 3IRBA 3URYA 2WFWA 1PXUA 3RMHA 4OO1I 2EJGC 1WFQA 1HCZA 3T16A 3J7AF 4IQZA 1GXDC 3I56A 3S1MB 1RODA 5M5WB 4KN4C 2XN9C 3JC66 1SYFA 4DAYA 4EQOA 4Y7NB 2E2JB 3EN2A 1ZYRD 3ULJA 2KHSA 4JOIA 1PZKD 3T1YQ 4DAVA 1A15A 2RBMA 1F9RA 4LFBQ 3OHXC 2LMCB 1BCPF 1NAPA 5K36H 3TP8A 3U58A 1V1OA 3NHHA 4BY7B 5K5PA 2XNAC 4BY1H 1HPCA 1TKWB 1YBYA 3Q0AA 1GHKA 5JJKA 3J7YW 2VUMH 1VQ4A 4DXGA 1WCMH 4A3GG 2L5TA 1EIFA 2I07B 4KTAA 4BA1I 2E2IB 4FF3A 4UP9A 2RHSB 3C3LA 1JR0D 4XYQA 1QVFA 2NZOA 2EYPA 4OEMB 5IODA 1LTBD 3DHQA 1KQSA 1MIUA 5I6YA 2PZWA 1QE6A 2WV6D 2RVLA 2C5CA 3A5UA 4K2LA 1VQAA 2WAQE 2H5XA 3X3NA 1F9QA 3PIOA 3VR2A 3S1MH 5M5WH 2QF7A 4LF6Q 1G6ZA 3HKZE 2FHTA 4QUFA 4Y7NH 1E1OA 2E2JH 4G4KA 4CJ1B 1UEAB 1FGUA 2XGTA 1HJPA 3VR4A 3S14H 4DR4L 4CDCC 2D62A 3HG9A 3I4OA 1LTID 2NUCA 4RGOS 3VYSA 2Z6KA 1PH2A 4LFAQ 4DPGA 4BY7H 3D4RA 4BXXG 3W3AA 1LLRD 3H6MA 3I72A 2L0CA 1SNMA 4IZ8A 3UE1A 2HHHQ 4ILWA 4R4CA 4A76A 1STGA 3MXNB 2WIIB 1QILA 2OXPA 3GTKB 1ET9A 1QG7A 2JQOA 5E4XA 2XVSA 4KY5A 1XPRA 1SAPA 4DAPA 1SMYD 2NVYB 4P75A 3L0OA 4HSPA 3OMGA 1YNND 1JQYD 4OIKA 1M4VA 1ILPA 1HQRD 4UP8A 4JI8Q 4K5WA 1I94L 3RN2A 2K75A 1Z6HA 2JJQA 1C0AA 3ICEA 1BDOA 5EBCA 5CV7A 1CHQD 1OXTA 3AB9A 4JI6L 2KEEA 1EYGA 1GOZA 1C7YA 4PG3A 4BBRG 4Q0FA 3SK4A 4KN7C 3PIO3 2ZT9C 3A8KE 3QIAA 1T9HA 1D5XC 2EPBA 3GTGB 4FDBA 2ZJPA 2EY2A 4A3FG 5AJ3Q 2RSOA 5LL6S 2FFKB 2GN5A 3I7FA 4NDXA 3STBC 1Y8PB 4IPGA 1RTNA 3VR6A 5JJZA 5FJ8G 2F0KA 4QL5A 3TZDA 2UXBL 1IKMA 1BO0A 2XRQD 4RHRA 4MTNA 5TSSA 1WD1A 4H7BA 4XDXA 1SN8A 4ZKBB 2IX0A 4R4OA 1EOTA 2F3WA 1QJOA 3P7JA 4TSSA 1PHJA 4X6AH 3CU7A 3MXNA 5KIXA 5C0XI 3PO2G 5FKAC 3GTKH 1G8ZD 2B2YC 2DNEA 2NVYH 2E74C 4A3JB 1CSPA 1CKNB 4L5TA 4UP7A 2EYFA 3E9HA 3MC0B 4YWLA 3H15A 4DV6Q 3GTJB 1QWYA 3J80c 1LACA 4XT1B 3FKIH 3GTPB 2ZJRA 3DEOA 5C0XH 2X6GA 4OX9Q 2A68C 3BDOA 3P1HA 2ICIA 4BA2I 1VQFA 3CMAA 4DV2L 3RNUA 4DR2Q 3GTGH 3TS2A 4DUYL 2KEDA 2HIXA 4C3HG 4L5SA 1FD7D 2BDNA 5C5MA 3PF4A 1X9NA 1DM0B 3QG1A 1TS3A 2A6EC 4B3SL 2Q8RE 3C2PA 4C56C 2RCNA 3L7ZC 2K50A 4A3CH 1IKLA 4IFDJ 4FXDA 4R4TA 1XMQL 2B63G 3NE5B 4KHPL 5IGEA 4XQNA 1HFGA 2UUAL 2XRSD 4K6LA 3J81c 4I7AA 2DY7A 5HY6A 4PQXA 3AFQA 3I3CA 3CCQA 2G5DA 1WOCA 3FHWA 4A3JH 4DK6C 5ELCA 3SVMA 3T1HL 3HOUB 1CKNA 3ER0A 1EU4A 1E7ZA 3KF6A 3Q23A 1EL0A 3HOVB 4JC0A 2YTXA 3V96A 1N32L 3K7UC 2KA7A 2MPMA 2PZUA 4RHSA 3GTPH 3CW2C 3J80E 3J81L 2UUCQ 2Z1CA 4MHEA 4LF4L 2NBFA 1LTGD 3K0YA 1SMXA 3CMEA 3T56B 2PMZE 1PH9A 5EQ0A 1RL2A 1BBXC 1FNVA 3CAMA 4YWMA 2RDHA 4LUOA 3A8JE 3NXWA 1GUTA 2DJGC 5I2XA 1A2UA 1SRUA 2EJMA 2LY7A 4CKCA 4OGQC 3BYYB 4DR3L 1S5FD 5LMNW 2O2LD 3D3RA 1QZGA 3R93A 3STBD 3BG3A 4A93B 3CPFA 4RKLA 5JEAG 4JI0Q 1EY5A 2F0DA 5IYBG 3R2IA 1QOHA 1JB7A 1D5MC 3SXHA 2F4VL 2K14A 3J81E 1O7ZA 1TWFB 1F77A 5IGBA 4U673 1Y1WG 3L9AX 3ERQA 2EYHA 2BH2A 1CUKA 4RA8A 1B53A 2HIVA 3RUZA 2SEBD 3HOVH 4APVA 4DR4Q 4ZRZA 1BQQT 1IZ6A 2F0JA 2QCPX 3RZOB 3GTOB 4G7HC 1F2ZA 3M85A 1D7QA 1MKHA 1JORA 3HZXA 2A68D 5CV5A 2EY5A 3A74A 3A7LA 4GKKL 1HFNA 1PFSA 1GUNA 4YCWA 2NVXB 1CSQA 1PFNA 1XJVA 3HOXG 4DV1L 3I4MG 1SJHD 1PH1A 1I5FA 2VB3X 5ELFA 4DK1A 3E9IA 4PMCA 4LF9L 4A93H 2XTIA 4EGVA 4I65A 1I94Q 2JA5B 4Y52H 1Y14B 1OXSC 1AH9A 1NMGA 3TREA 3BZDB 1TWFH 1I4RA 1ML0D 3T13A 4IPHA 4RG1A 3WWVA 1N36L 1JB3A 4XT3B 1XWEA 1B3AA 1HTLD 4A3MG 1A3VA 1A8VA 2E2HH 4BS9A 4FP5D 1RHPA 4FXGC 1PYWD 2VQEQ 3SK6A 1JE5A 3RN5A 1KDAA 4RWSC 3BDLA 2F0IA 4G7OC 1DD2A 1Y69U 4QIWE 4LF8Q 4TVAB 3RZOH 5K36G 4I7ZC 3GTOH 1ENAA 2UXBQ 2Z4HA 2MGSA 3PF5A 1QCBD 2M2LA 3H91A 2Z4IA 2N8NA 1A62A 1KHIA 2NVXH 2ATWA 3NWSA 4JBKA 3NTHA 4FNFA 3TMEA 1HTPA 4CBVA 1HQMC 1FNWA 1WCMG 1TWGB 2AQ1B 4J6HA 5D65A 4XTCS 4LNQA 2XIWA 4LUVA 4ZUIA 3ZJYC 3K5LA 4V190 1YIJA 3RR5A 1PH5A 1K28A 2PPBC 3SHLA 1S40A 1RF2D 2A69C 1MSGA 2WKDA 2JA5H 5HGTA 1O7YA 1NSNS 2JA6B 4P71A 3CD6A 2HCIA 1O80A 3OTOL 5DM63 1QUQB 4O2DA 1NNXA 5IIFA 1YI2A 2UUBL 4G57A 4K6DA 3TS0A 4ME5A 1EUJA 3R8BA 2K5VA 1P8LA 2PW7A 4DV2Q 2MJ8A 5EPKA 1D1IA 1V9PA 1C4QA 4LF7L 3SDZA 3NELA 2UU9L 2HHHL 5CBAE 3GD7A 1Y1VG 1Q7YC 4B3SQ 3D6WA 3S2DB 4QY7A 4LW1A 3PUXA 3EA6A 1XMQQ 3I2ZA 5CGKA 1BUVT 1SYDA 1KD1C 2F0EA 3AU7A 5LHY1 5M3MH 5JJLA 2KHJA 1BKBA 3G4SA 4OL7A 4GLXA 1PLFA 1TWGH 4N9PA 4PMBA 2F0FA 3I90A 4A75A 2QDLA 3IFDA 3T1HQ 1X56A 2A5HA 3J7AV 4KKUA 4POGA 1K8AC 2BA0A 3RLOA 3KUPA 1J9OA 5A2QE 3HP3A 3CCVA 4QIWB 2JA6H 1PZJD 5BR8L 5A35A 1XYIA 3N6RA 4KD4A 5IYCH 1C8CA 1QUQA 4LAAA 5AJ3L 1E1TA 4X3UA 4DU9A 1EQTA 1NTGA 3DWPA 4LF4Q 2PO4A 3PUVA 3PGZA 3Q6SA 4EQPA 4OIJA 2K5WA 4GN3B 4JBJA 5ELOA 5G3LF 1UEBA 3H94A 4K14A 1XNQQ 4AYBE 1EY0A 2I5HA 3JAML 3S2DH 1BCPC 1A2TA 2OWOA 4DR3Q 1EOVA 3OIQA 2IHEA 4IN3A 1CZWA 1D1KA 5EBDA 4UAIA 3NTIA 3CCSA 4ZAIA 1QZHA 1YNXA 1ZEQX 2WB1G 4DA2A 1BF4A 3PO3B 2K6AA 1FJGL 1VS0A 3KJPA 2CFMA 4DV6L 1H9JA 4QJFA 1EZ8A 3F1ZA 1DOKA 2F4VQ 1F2MA 1CTMA 1EY7A 5T1IA 1E2VA 1L0XB 3CPWA 4Q5VA 3EQLC 5JAVA 1S5ED 4XQJA 3H0GB 3I4NB 1XPUA 5COYA 1XTCD 1I4HA 1LT5D 5JVG3 1H9SB 4ZUJA 3A0JA 5KEEA 2HDLA 1K3RA 2C9OA 2XWBB 1PH6A 4U68A 3PV0A 1HNZL 2R93G 2AUJD 1TS5A 1Z9FA 4DR2L 2A69D 5C0XG 5FLMG 1YNNC 5ELDA 2IWHA 1K83B 4DXFA 2Z6KC 1JCKB 1BCPB 2I5LX 1GVPA 1KC8C 2E5LQ 1MGSA 1HZAA 2ES2A 2R7ZB 4A3EH 4AH6A 5E4WC 3TN2A 1JC7A 4DV5Q 4H13C 4QF4A 5C6AA 4GKKQ 3W1GA 3HOZG 3LNNA 1IYVA 2LXKA 4DUZL 4YHHQ 3OSOA 4GN4B 1WTPA 3LX0A 4NMZA 2B3GA 1EZ6A 2F0MA 4DV1Q 2A74C 1K0RA 4CJ2C 1R4PB 3PUZA 4A3KB 1OXXK 5D3DA 3NBIA 2CQOA 4LF9Q 3PO3H 3BZKA 3CCUA 4WJ4A 1IBKQ 1LO5D 2NVTB 1N36Q 3BVZA 3S14B 3H0GH 3I4NH 2JA8G 5C44G 3NWTA 1T5XD 3S1RB 2VW9A 1J8IA 1I6HB 2B2TC 2UUCL 3TP6A 1H9SA 4OWXB 1ASYA 4OO1H 3U50C 5IY0A 5J39A 2F0OA 2E2DC 2F0GA 2WB1E 4DR1L 4A3BB 4AYBB 1XMOQ 3CCJA 1CK1A 1B3QA 2RDFA 1K73C 2OTLA 2HQEA 1OO9B 1B7YB 4DV3Q 2D5DA 1K83H 3AQQA 3HOWB 2F0PA 1VQ7A 2R7ZH 1PRTF 2YYZA 4K8JA 3QOLA 1WTQA 4L5QA 5KNBA 2KENA 5IYDG 4JI0L 4PNYA 1SNDA 5E3FA 3S17B 2DGYA 5E7NA 1VQMA 3BS1A 4A3KH 3HEJA 2WKCA 3JAMi 3GQBA 1Q82C 4DK0A 1I4GA 3I91A 4WJWA 1CZGA 1BCPD 3PCOB 1SROA 5AFWA 2PI2E 4FF1A 2DNCA 2NVTH 1R4QB 4C3IB 1CT1D 1XTDA 3L3OC 1II3A 3OTOQ 3CRKC 3HOUG 3S1RH 1LABA 2JA7B 2Z9HA 3TDQA 1I6HH 2UUBQ 5M5YB 1Q1BA 3GO5A 2DJFC 3MA2B 4CDDC 1LTAD 2EYMA 1JICA 4N8X1 1J5EQ 3A8IE 4HR7B 4A3BH 4HMIA 3OW2A 1DOLA 4LF7Q 1X3EA 3EJIA 1H9MA 4XXEA 2RDGA 1B8AA 1SBBB 2UU9Q 3FRPB 1GM5A 3UI2A 1U5KA 3O13A 2SNSA 3KDFB 5JOBA 3WOEA 1B1ZA 3HOWH 3LGJA 2AMCB 4UDUC 5EKLA 5FK9C 1PH3A 2EJFC 4KY6A 2A1AA 1PH8A 4KV6A 3VDYA 3IL8A 2MUYA 2H1EA 2EYOA 3S17H 1EFWA 4IO9A 4A3IB 4MNOA 4OWWB 2QKIC 2I5MX 3RLFA 3FKIB 4DV7Q 2B2TA 4A93G 2P5ZX 5CV6A 3H3VC 5I9PA 1UUPA 2B2UA 3A55A 1S72A 4TQUS 4HEDA 1BXTA 2IL8A 2VQEL 2FMCA 5BR8Q 4C3IH 4DR7L 5KRUA 4ZKCB 5M3FG 2JA7H 5J3BA 2UXDL 2JK8A 1HR0W 5M5YH 1W6KA 1R9TB 4LF8L 1DJRD 1VF5C 3M7NA 3RZDB 4DV4Q 1EIYB 3G71A 1HZ9A 2PYKA 2E75C 1HH2P 3PIPA 1IL2A 4IUPA 1VQ8A 1LYLA 3W5OA 1XXGA 3B6YA 4JYAL 1SE2A 4XIGS 2MFIA 3S24A 2WAQB 3KDFA 5IGDA 1CKOA 1G291 2ZM6L 1XPOA 1FGBD 2AQ3B 3I55A 1G51A 1AZQA 1C48A 3HKZB 2X69A 3M4YA 2F0SA 4AQYL 3DLLA 3MEHA 2VNUD 1OXVA 4DF7A 3KF6B 1FJGQ 5CR3A 2YV5A 1DGSA 1X32A 3M4OB 1FVIA 4A3IH 2JXMB 2RF4A 4FF4A 4WFN3 3ERSX 1W6JA 4X3KA 4NPSA 1VQBA 1TWCB 5JPMC 2EYJA 1LUZA 2H4OA 2CVRA 1HNZQ 1JE4A 1VQ6A 1G2TA 1O7IA 2G9DA 4JW0A 1ENFA 1KRTA 2PNHA 1VQEA 1PA6A 1GUGA 1R9TH 2MQHA 2ZXRA 3D0FA 3H3VI 3RZDH 4B9WA 5C3EB 3PIP3 4BWGB 1E3PA 4HTHA 1LTSD 2VXWA 4P73A 1V1QA 4PV1C 1L2FA 3SK8A 4A3GB 4J1MA 2B39A 1IYJB 3GV3A 2QDBA 3D8GA 4DUZQ 1A3TA 4X3SA 3UDGA 4CKBA 3ULLA 4QB4A 1PYSB 2PI2A 3MWYW 2EY6A 3RD4A 5GAGC 3H3VH 1CHPD 2K1BA 3K8AA 4HJ9A 2KCTA 3C1FA 3M4OH 3U9SA 4A3DG 2AUKA 4G7ZC 1KDBA 2VY3A 4ABNA 4R8IA 2V4DA 5ISRA 4GOPC 1VQ9A 2KHIA 2CQAA 1TWCH 4HMJA 1C9OA 3MFYA 1HXYD 1IL8A 2JA6G 1J6QA 4DR1Q 4MN3A 1TXYA 1UWVA 5IYCG 1MD2D 3KBXA 3HGBA 2CH4W 2ICEC 1GUOA 3FVQA 5JEAJ 3CKIB 4LMQD 2EZVA 1O7LA 5IP7H 4C3JG 2XWJB 1GO3E 1M8AA 5GAHC 1N9WA 1XNQL 5C3EH 4DN4M 4JI1L 4FF2A 5FO9B 1Z7TA 3J7ZC 2HUGA 2L11A 4A3GH 4GS3A 3MHBA 4HCEA 1PDQA 3VA5A 4BBSB 4JI5L 1SJED 2NTSA 1KLGD 3QO2A 4NKLA 2ZXOA 1ICFB 1X3GA 4C1NK 1XNRL 1STEA 2K7VA 3NSWA 4JBMA 4GOPB 3FPPA 3F2UA 2E2HB 4X64L 1PZID 4LUZA 1AEXA 4IPDA 4BBRB 1BVSA 3Q24A 5GADC 2JE6I 4KHZA 5EKIA 5C3XA 4ZK9B 2LKVA 1VQPA 1GD7A 3VA7A 3K7AB 1K0SA 2N49A 4POFA 1SR3A 2KOLA 2F0TA 4ME3A 4GKJL 1E2WA 2BCOA 4KK7A 2E5LL 2F0HA 2D9UA 3D4DA 1FYCA 1WTXA 1PVOA 4EVOA 1S5CD 4DV5L 1I4PA 4R4QA 1JJCB 4BXXH 4HJ5A 1VF7A 2K5QA 2LFNA 4YHHL 2JSOA 3CC2A 2NN6G 2KECA 2SDFA 3J7A5 3BZCA 2VS1A 1PTOB 3S1QB 1VQJA 1TS4A 4JI2Q 1SLJA 2B29A 2N78A 2E76C 3PO2B 2MNAA 4BBSH 1PYBA 2O5JC 2F0VA 2ZJQA 3KLRA 3DUZA 1IBKL 4UY8C 3NUCA 2GVAA 1JOQA 3OWFA 4P74A 2VB2X 1AE2A 2PMZB 1STYA 3EBEA 4DGZA 3K5OA 4GOPA 1ESFA 4CHTB 3S1NB 1YJNA 2Z8LA 3PO3G 4BBRH 3PUWA 2CCZA 3DM3A 1RDPD 2G9HD 2KJXA 3GV6A 2F1MA 4TRDA 1S5DD 1XMOL 4DR7Q 4HAEA 3S2HB 3U4ZA 1LTTD 3KLSX 3K7AH 2JN4A 1HUNA 1RIPA 4DV3L 1PV4A 2UXDQ 4JI7L 3NQIA 5LMNL 1YITA 4OO1G 4IOCA 4RCOA 3NP8A 4TKOB 1PTOF 1EU3A 1QNUA 5F2DA 5FJ8H 2R92B 4PZ7A 3UDXA 3DXJC 4BY1G 2BDOA 1L0YB 4JYAQ 1Q3LA 3D6CA 5M3MB 2IX1A 1TVXA 2B63B 2ZM6Q 2VUMG 4ULLA 2L15A 2Y0SG 4RFBA 1QB5D 1I6VC 1X55A 3E5SA 2R7ZG 1PTOH 3S1QH 4UPAA 1VMPA 5IGGA 4DV0L 5KGUA 2OQ0A 1EQQA 4AQYQ 3PO2H 4KHVA 3F2CA 1AN8A 1SYEA 3QB3A 4A4IA 5ELBA 4ALPA 4F7XA 3TP7A 3FDTA 4YCVA 1V8QA 2Z0SA 1X65A 4B3RL 1QVCA 3QWNA 3ZYYX 3S1NH 2NWGA 2O4XA 4HIMA 1H9RA 1PH7A 1J5EL 1L0WA 2PW5A 3SE0A 4H02A 1PTOD 5GAEC 4R4IA 1IW7C 3S2HH 4A3LH 5HGQA 3MEFA 3NK9A 4B3TL 4HJ7A 4OHJA 4QCLA 2J7ZA 3FEWX 4P2CB 5I2YA 5IGFA 3DEPA 1LT3D 4BY7G 4DFAA 4RMFA 4GN5A 4IFDI 2F4IA 1TWHB 2R92H 4JI3L 1EY9A 1JWMD 4DNRB 2MP1A 2B63H 1KNAA 4JK1C 1YEZA 3VYUA 5IE8A 3HOWG 4EQ5A 1L1OB 1P16A 2IPKD 4LFCL 4IJHA 2F0UA 3MFGA 4DV7L 1Z47A 4GLAC 1LT6D 2QILA 3PMFA 1NR4A 3KLSA 2FJ2A 3CF5A 2NZ1D 3CQZB 4IFDH 1STHA 4HCSA 1HR0Q 2CW0C 3JAMc 5KYLA 3U9OA 3TBIB 3G48A 3IFTA 4KKTA 4B3ML 3K5MA 2A19A 1IXRA 1OXUA 1EIHA 3PQIA 4JCVE 4DV4L 1HRJA 1CQVA 1WYDA 1VQIA 4C3IG 4A3EB 2K03A 5C4ZA 1IBMQ 2J4XA 2K5DA 1UE6A 2B2WC 1EWCA 3M4PA 2B2VC 4IURA 4N9TA 4RGTA 5IP9H 1G91A 3TRZA 1TS2A 3MTSA 4AIMA 3TSSA 4JI1Q 2TMPA 2L1BA 3CCLA 1X54A 5KYIA 1TWHH 5GROA 1WTOA 1KNEA 2R61A 1BBWA 4DR6L 3NEMA 1QVGA 4IOAA 3WDNA 3KYHC 4JI5Q 1BR9A 4R9WA 1K8MA 2I46A 1ENCA 3GDEA 3P20A 1XNRQ 1L1OA 5IYBH 5C3WA 1PRTC 5C0XJ 5EPLA 1WTRA 3W2DA 1Y1WH 4X64Q 2CHBD 1ASZA 1SDFA 3OOCA 4QUCA 2AWOA 3A54A 3CQZH 1EEFD 1KLUD 4A3MB 2GA4B 4A3IG 3KLWA 1D6EC 3E6ZX 4NP5A 1BBUA 2F3IA 3FKIG 4L6TB 5KNDA 3JAME 1KRSA 1PFMA 1TU2B 1WTWA 1AZPA 5G3LD 1H9KA 4GKJQ 1U9RA 3T4AC 2HDMA 1HNXQ 4JVZA 2IY5B 1YNJC 2QEXA 2I0QA 1TT2A 3K80C 1GUWA 5C4XB 1EFID 5J1ZA 1LTLA
chains in the Genus database with same CATH topology
4LUOA 1S72A 4TQUS 5DLQE 1SRUA 1VQCA 4A3CG 2FXQA 2VQEL 5BR8Q 4DK3C 4C3IH 4PMWA 1VQ5A 4LF6L 4DR7L 4O0AA 4HIKA 4DR3L 2IT1A 5LMNW 2PQAB 2WAQG 1QZGA 5M3FG 3STBD 5J3BA 2JA7H 2JK8A 2HQLA 2UXDL 1HR0W 5M5YH 4C3HH 4YY3Q 3AFPA 3CPFA 1M1KC 3HFZB 5JEAG 4JI0Q 4LF8L 3HOYG 3PSIA 5IYBG 4AYBG 3M7NA 4A3BG 4DV4Q 1JB7A 1VCIA 5IT9c 1EIYB 3HKZG 2K14A 1HZ9A 3G71A 2F4VL 4LFAL 4DNIA 2OTJA 1HH2P 3PIPA 4A3JG 1IL2A 1NJIC 1VQ8A 1LYLA 2YTYA 3W5OA 1Y1WG 3B6YA 2LSSA 4JYAL 4X62Q 4X65L 2UXCQ 2BH2A 4XIGS 2MFIA 3S24A 4DUYQ 1Q86C 1CUKA 3KDFA 2QGQA 1CKOA 1G291 5LMUL 4IFDG 2ZM6L 1XPOA 4A3MH 3I55A 2HIVA 1M90C 1G51A 1UE1A 3HOVH 3UE0A 3F2BA 4APVA 3F2DA 2MO1A 2A8VA 1Q12A 4DR5Q 1X6OA 4JI7Q 5LMNQ 4AQYL 3UDFA 2DUDA 4KHPQ 4DR4Q 3DLLA 2UUAQ 2VNUD 2R7FA 1OXVA 1IZ6A 1B70B 2ALYB 3KF6B 1SE8A 3KJOA 1FJGQ 2YV5A 1DGSA 4JI8L 3GTLH 2Y0SE 1FVIA 4A3IH 2ZTEA 2YU9H 4HJAA 1VQKA 2RF4A 3CXCA 1N33Q 3M85A 5C4XH 5GQOA 4A3DH 1D7QA 3ERSX 5IP7G 2AKWB 1N34L 1MKHA 2VQFQ 4LF5Q 3A74A 4GKKL 5IWAL 4NPSA 1PFSA 4YCWA 1HNWL 1VQBA 5C3EG 4DAMA 1CSQA 4J15A 1XJVA 3HOXG 1LUZA 1HNZQ 4DV1L 1VQ6A 3I4MG 3J81j 2JA7G 3S16H 4DV0Q 1O7IA 1PH1A 3M4QA 1I5FA 2PQAA 1KRTA 1N32Q 3E9IA 2PNHA 1VQEA 1UE7A 4EX5A 1PA6A 1R9TH 1K8GA 1YVCA 4LF9L 4JOIC 2XTIA 4A93H 2MQHA 4NXMQ 1EQRA 3D0FA 1UE5A 1I94Q 4YWKA 3H3VI 3RZDH 3AEVA 4C3JH 4Y52H 1Y14B 1OXSC 2EQSA 1AH9A 1NMGA 1E3PA 4PZ8A 3TREA 5FLXc 1TWFH 3WWVA 1N36L 4B3RQ 4IPHA 4P73A 1V1QA 1WJJA 4RG1A 2ASBA 1YJ9A 3S15H 1L2FA 3W1BA 3FP9A 4A3MG 1A8VA 1IYJB 2E2HH 4DKAC 4DUZQ 3HOYH 3HOVG 3HKSA 3UDGA 3ULLA 2VQEQ 1PYSB 2PI2A 1E22A 1JE5A 3RN5A 1VQDA 1I50H 1CKMA 1VQHA 4OONA 5GAGC 4B3TQ 3H3VH 2R7DA 3K8AA 3PUYA 2KCTA 4HJ9A 4QIWE 4LF8Q 4TVAB 3RZOH 5K36G 2ZTDA 3M4OH 1Y1VH 3GTOH 2UXBQ 1YJWA 4A3DG 2VY3A 5ELNA 4DAYB 4JI3Q 3PF5A 4JI2L 3GTMH 1TWAH 2V1CC 3CCMA 2CKZB 2EIFA 1MJEA 2N8NA 1A62A 4GOPC 2NN6I 2KHIA 1GKHA 1VQ9A 1A0IA 1KHIA 1YHQA 2NVXH 1TWCH 2ATWA 1C9OA 4JBKA 1SFOH 4OX9L 4PZ6A 3BJUA 2CWAA 2JA6G 1WCMG 1J6QA 4DR1Q 1JJ2A 4NB3A 1TXYA 4IOAA 2RHQB 1UWVA 2ZTCA 4XTCS 5IYCG 4LFCQ 4LNQA 4LUVA 3ZJYC 2BA1A 1KIXA 5JEAJ 2E2IH 1NY4A 5IP7H 3GTQH 3CP0A 3D31A 1YIJA 3CC4A 3RR5A 1PH5A 1VQLA 4BBSG 4X66L 5C4JH 2Q2UA 1S40A 4JI4L 1GO3E 3L2PA 5GAHC 1N9WA 3OYYA 1XNQL 3KFUA 5C3EH 2JA5H 4L5RC 4JI1L 3K0XA 4A93G 4JG2A 3HOXH 4P71A 3CD6A 4K0KL 5EAYA 3J7ZC 2F52A 2KBNA 2N3SA 4B3MQ 3I4MH 3OTOL 2Q2HA 4QQBX 4KLKA 1W3SA 4IPCA 1QUQB 4JV5L 1IBLL 4O2DA 4A3GH 4GS3A 1YI2A 1N34Q 1YZ6A 2UUBL 2ID0A 4JI5L 3TEHB 1PH4A 1Q8KA 1N8RC 1LM0A 3KF8B 3TS0A 1EUJA 2K5VA 1P8LA 2OCEA 3IRBA 1X3GA 2VL6A 5M5XH 4QGUA 2WFWA 4DV2Q 4OWTB 1XNRL 4JBMA 1KAWA 1V9PA 4OO1I 4LF7L 1WFQA 4GOPB 3NELA 2UU9L 4X64L 2HHHL 3GD7A 1Y1VG 4IPDA 4LUZA 4HJ8A 1Q7YC 4B3SQ 1BVSA 3I56A 2MO0A 2JE6I 5GADC 2D0PA 4KHZA 4QY7A 4LW1A 3JC66 3PUXA 1VQPA 1XMQQ 1GD7A 4DR6Q 3I2ZA 2N49A 3EIVA 3EN2A 3ULJA 4POFA 1SR3A 1KD1C 4JOIA 4ME3A 5M3MH 5JJLA 2KHJA 4GKJL 1BKBA 3G4SA 3T1YQ 4GLXA 3F8TA 2LXJA 3U4VA 2E5LL 4LFBQ 1TWGH 3U58A 1K9MC 1PVOA 4DV5L 1E24A 4YCUA 4A75A 4R4QA 4NXNL 5H1SE 3T1HQ 1JJCB 4BY1H 4HJ5A 2JA5G 4BXXH 1X56A 4YHHL 1YBYA 4POGA 5JJKA 1K8AC 2BA0A 3RLOA 2NN6G 3CCVA 3CC2A 2VUMH 1VQ4A 2JA6H 3J7A5 5BR8L 1WCMH 3BZCA 2VS1A 4KI0A 1VQJA 4A3GG 1EIFA 4BA1I 5IYCH 4JI2Q 2R93H 1QUQA 2RHSB 2B29A 1SLJA 2N78A 4UP9A 5AJ3L 2Q2TA 1E1TA 2MNAA 2JEBI 4BBSH 1PYBA 1NTGA 2NZOA 4YY3L 1QVFA 4OXPA 1KL9A 2ZJQA 1OTCA 4LF4Q 5FLMH 1IBKL 4UY8C 1KQSA 3PUVA 1MIUA 2GVAA 3PGZA 4P74A 4A3LG 1AE2A 3EBEA 4GN3B 4GOPA 3A5UA 2K4KA 4X62L 4JBJA 1VQAA 2WAQE 2UXCL 2H5XA 1NBWA 5ELOA 1YJNA 3PO3G 1UEBA 4X66Q 4BBRH 3PUWA 2CCZA 3PIOA 3DM3A 4JI4Q 3HOZH 3S1MH 1XNQQ 1AE3A 2I5HA 4AYBE 5M5WH 1XMOL 4LF6Q 3S2DH 3HKZE 2JEAI 2R92G 4DR7Q 4GLVB 4DR3Q 2OWOA 4Y7NH 3U4ZA 2QA4A 1E1OA 3KOJA 5M3MG 1EOVA 2E2JH 1D8LA 3K7AH 2IHEA 2KCMA 1RIPA 4DV3L 4DR5L 1FGUA 2XGTA 1HJPA 4JBWA 2E8GA 5LMNL 1YITA 1PV4A 4JI7L 3S14H 4DR4L 4OO1G 3CCSA 2AWNA 4IOCA 1YNXA 2WB1G 2D62A 1QZHA 1HR0L 3I4OA 1FJGL 1VS0A 3KJPA 2CFMA 4DV6L 4QJFA 2F4VQ 2Z6KA 3F1ZA 1PH2A 4LFAQ 4DPGA 3CPWA 4BY7H 1G6PA 5FJ8H 4PZ7A 3UDXA 4BY1G 1N33L 4BXXG 4JYAQ 4X65Q 1XPUA 4LF5L 4HIDA 2VQFL 2IX1A 1JMCA 2JA8H 1Q81C 5C44H 4P72A 3UE1A 2ZM6Q 5LMUQ 2HHHQ 3A0JA 2CWPA 2VUMG 2L15A 1K3RA 2Y0SG 4R4CA 4A76A 1X55A 1PH6A 3SGIA 2R7ZG 4GNXC 3MXNB 3PV0A 1HNZL 1IBML 2R93G 3S1QH 1Z9FA 4DR2L 4UPAA 1Q1EA 4DV0L 2JQOA 1NMFA 2OQ0A 3GTJH 1XPRA 1EQQA 4AQYQ 1VQOA 3PO2H 2WP8J 4P75A 3F2CA 3L0OA 5C0XG 5FLMG 4NXML 4ALPA 4UP8A 4A4IA 1VQNA 4JI8Q 1I94L 3RN2A 2Z6KC 2K75A 2I5LX 1GVPA 1KC8C 4MZ9A 2E5LQ 1HZAA 2ES2A 1X3FA 3ULPA 2JJQA 2Z0SA 4YCVA 1C0AA 4A3EH 3ICEA 2HT1A 1X65A 4AH6A 1OXTA 4B3RL 4JI6L 1I3QH 1QVCA 5IP9G 1EYGA 4DV5Q 1C7YA 4PG3A 4BBRG 4GKKQ 5IWAQ 3S1NH 1HNWQ 3W1GA 4HIMA 3HOZG 2LXKA 3Q8DA 1L0WA 2EXDA 4DUZL 4YHHQ 1PH7A 4GN4B 1J5EL 5IYDH 4H02A 1H95A 2B3GA 5GAEC 4DV1Q 4R4IA 1K0RA 3RLNA 3S2HH 4A3LH 3PUZA 1T9HA 4FDBA 5HGQA 2ZJPA 1OXXK 4JV5Q 3MEFA 4A3FG 5AJ3Q 4HJ7A 4B3TL 2CQOA 4LF9Q 2GN5A 2GVBA 1JT8A 3NBHB 3I7FA 3STBC 4IPGA 2NVQH 3PO3H 1HZCA 3BZKA 3CCUA 4WJ4A 4BY7G 5FJ8G 4GNXB 1YHAA 1IBKQ 4QL5A 4RMFA 4GN5A 4IFDI 2UXBL 1N36Q 2R92H 4JI3L 4MTNA 3H0GH 3I4NH 2JA8G 5C44G 2VW9A 1JJGA 1SN8A 2UUCL 2IX0A 4R4OA 4OWXB 1ASYA 2B63H 3HOUH 3BU2A 3U50C 1HNXL 5IY0A 1PHJA 1YEZA 5IE8A 3HOWG 4X6AH 2WB1E 1Q46A 3TQYA 4EQ5A 4DR1L 5C0XI 1L1OB 1P16A 2K52A 1XMOQ 3PO2G 4LFCL 4IJHA 3GTKH 1S3OA 3CCJA 4DV7L 1Z47A 2AHOB 3E0EA 4GLAC 3UDIA 1K73C 2OTLA 2NVYH 1B7YB 4DV3Q 1CSPA 3CF5A 1CKNB 4L5TA 4UP7A 2IHFA 1HR0Q 1K83H 3JAMc 2OQKA 3AQQA 3E9HA 4YWLA 3H15A 4DV6Q 4A3EG 1VQ7A 3G48A 2R7ZH 2YYZA 3J80c 5JJIA 4B3ML 4L5QA 4HIOA 2KENA 2A19A 1IXRA 3FKIH 5IYDG 2C35B 2ZJRA 1OXUA 4JI0L 3CCRA 4JCVE 3G6EA 4DV4L 4OX9Q 2D0OA 1WYDA 1VQIA 4BA2I 2DGYA 1VQFA 3CMAA 4DV2L 1V43A 1IBMQ 3RNUA 1KXLA 5E7NA 4R1JA 1WI5A 1VQGA 4DR2Q 4A3KH 1VQMA 3GTGH 3TS2A 1UE6A 3JAMi 4DUYL 2HIXA 5IP9H 1NE3A 1EWIA 3M4PA 1Q82C 2VZAA 4L5SA 3TRZA 3J80i 4LWCA 3PF4A 3PCOB 2BH8A 1SROA 1HZBA 3M9BA 2R6GA 4JI1Q 4AIMA 1X9NA 4GNXA 4B3SL 2PI2E 2RCNA 3CC7A 3H0GG 2NVTH 3L7ZC 3CCLA 1X54A 2K50A 1XTDA 3I4NG 1TWHH 4A3CH 5GROA 4K0KQ 3OTOQ 4IFDJ 4R4TA 1BBWA 1XMQL 3NEMA 1QVGA 1IBLQ 2B63G 3S1RH 1W2BA 4JI6Q 3HOUG 4DR6L 4KHPL 1I6HH 2UUAL 2UUBQ 1A63A 4A3FH 3KYHC 1Q1BA 4JI5Q 3GO5A 3J81c 5M3FH 3T1YL 1J5EQ 5HY6A 2JA9A 4IJLA 3AFQA 3GDEA 1XNRQ 4LFBL 1L1OA 5IYBH 4A3BH 3CCQA 5C0XJ 2K5NA 3OW2A 4LF7Q 1WOCA 1X3EA 1MJCA 3FHWA 2UU9Q 3M3YH 1B8AA 4A3JH 4DK6C 2K5HA 1GM5A 1Y1WH 1U5KA 4X64Q 3T1HL 1ASZA 1CKNA 3KDFB 1FL0A 2AWOA 3CQZH 1U0LA 3ER0A 1E7ZA 3KF6A 4A3IG 3KLWA 3HOWH 3LGJA 2AMCB 2NZHA 4JC0A 1BBUA 2UXDQ 2YTXA 3J81i 5C4XG 2F3IA 3FKIG 1N32L 1PH3A 1KRSA 3K7UC 2A1AA 2Q2IA 1PH8A 3GTPH 4GKJQ 3CW2C 2UUCQ 3VDYA 4WJ3M 1HNXQ 3K81C 4LF4L 1EFWA 4IO9A 3S17H 2IY5B 2QEXA 3CCEA 3AYHB 2I0QA 1L1OC 4A3KG 3A5ZB 3K80C 1YHBA 2YTVA 4MNOA 1SMXA 3CMEA 1PH9A 2PMZE 4OWWB 2I5MX 3RLFA 1RL2A 3NENA 4DV7Q 4NXNQ 4C2MH 3CAMA 4YWMA 1LTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LUO A;  1S72 A;  4TQU S;  5DLQ E;  1SRU A;  1VQC A;  4A3C G;  2FXQ A;  2VQE L;  5BR8 Q;  4DK3 C;  4C3I H;  4PMW A;  1VQ5 A;  4LF6 L;  4DR7 L;  4O0A A;  4HIK A;  4DR3 L;  2IT1 A;  5LMN W;  2PQA B;  2WAQ G;  1QZG A;  5M3F G;  3STB D;  5J3B A;  2JA7 H;  2JK8 A;  2HQL A;  2UXD L;  1HR0 W;  5M5Y H;  4C3H H;  4YY3 Q;  3AFP A;  3CPF A;  1M1K C;  3HFZ B;  5JEA G;  4JI0 Q;  4LF8 L;  3HOY G;  3PSI A;  5IYB G;  4AYB G;  3M7N A;  4A3B G;  4DV4 Q;  1JB7 A;  1VCI A;  5IT9 c;  1EIY B;  3HKZ G;  2K14 A;  1HZ9 A;  3G71 A;  2F4V L;  4LFA L;  4DNI A;  2OTJ A;  1HH2 P;  3PIP A;  4A3J G;  1IL2 A;  1NJI C;  1VQ8 A;  1LYL A;  2YTY A;  3W5O A;  1Y1W G;  3B6Y A;  2LSS A;  4JYA L;  4X62 Q;  4X65 L;  2UXC Q;  2BH2 A;  4XIG S;  2MFI A;  3S24 A;  4DUY Q;  1Q86 C;  1CUK A;  3KDF A;  2QGQ A;  1CKO A;  1G29 1;  5LMU L;  4IFD G;  2ZM6 L;  1XPO A;  4A3M H;  3I55 A;  2HIV A;  1M90 C;  1G51 A;  1UE1 A;  3HOV H;  3UE0 A;  3F2B A;  4APV A;  3F2D A;  2MO1 A;  2A8V A;  1Q12 A;  4DR5 Q;  1X6O A;  4JI7 Q;  5LMN Q;  4AQY L;  3UDF A;  2DUD A;  4KHP Q;  4DR4 Q;  3DLL A;  2UUA Q;  2VNU D;  2R7F A;  1OXV A;  1IZ6 A;  1B70 B;  2ALY B;  3KF6 B;  1SE8 A;  3KJO A;  1FJG Q;  2YV5 A;  1DGS A;  4JI8 L;  3GTL H;  2Y0S E;  1FVI A;  4A3I H;  2ZTE A;  2YU9 H;  4HJA A;  1VQK A;  2RF4 A;  3CXC A;  1N33 Q;  3M85 A;  5C4X H;  5GQO A;  4A3D H;  1D7Q A;  3ERS X;  5IP7 G;  2AKW B;  1N34 L;  1MKH A;  2VQF Q;  4LF5 Q;  3A74 A;  4GKK L;  5IWA L;  4NPS A;  1PFS A;  4YCW A;  1HNW L;  1VQB A;  5C3E G;  4DAM A;  1CSQ A;  4J15 A;  1XJV A;  3HOX G;  1LUZ A;  1HNZ Q;  4DV1 L;  1VQ6 A;  3I4M G;  3J81 j;  2JA7 G;  3S16 H;  4DV0 Q;  1O7I A;  1PH1 A;  3M4Q A;  1I5F A;  2PQA A;  1KRT A;  1N32 Q;  3E9I A;  2PNH A;  1VQE A;  1UE7 A;  4EX5 A;  1PA6 A;  1R9T H;  1K8G A;  1YVC A;  4LF9 L;  4JOI C;  2XTI A;  4A93 H;  2MQH A;  4NXM Q;  1EQR A;  3D0F A;  1UE5 A;  1I94 Q;  4YWK A;  3H3V I;  3RZD H;  3AEV A;  4C3J H;  4Y52 H;  1Y14 B;  1OXS C;  2EQS A;  1AH9 A;  1NMG A;  1E3P A;  4PZ8 A;  3TRE A;  5FLX c;  1TWF H;  3WWV A;  1N36 L;  4B3R Q;  4IPH A;  4P73 A;  1V1Q A;  1WJJ A;  4RG1 A;  2ASB A;  1YJ9 A;  3S15 H;  1L2F A;  3W1B A;  3FP9 A;  4A3M G;  1A8V A;  1IYJ B;  2E2H H;  4DKA C;  4DUZ Q;  3HOY H;  3HOV G;  3HKS A;  3UDG A;  3ULL A;  2VQE Q;  1PYS B;  2PI2 A;  1E22 A;  1JE5 A;  3RN5 A;  1VQD A;  1I50 H;  1CKM A;  1VQH A;  4OON A;  5GAG C;  4B3T Q;  3H3V H;  2R7D A;  3K8A A;  3PUY A;  2KCT A;  4HJ9 A;  4QIW E;  4LF8 Q;  4TVA B;  3RZO H;  5K36 G;  2ZTD A;  3M4O H;  1Y1V H;  3GTO H;  2UXB Q;  1YJW A;  4A3D G;  2VY3 A;  5ELN A;  4DAY B;  4JI3 Q;  3PF5 A;  4JI2 L;  3GTM H;  1TWA H;  2V1C C;  3CCM A;  2CKZ B;  2EIF A;  1MJE A;  2N8N A;  1A62 A;  4GOP C;  2NN6 I;  2KHI A;  1GKH A;  1VQ9 A;  1A0I A;  1KHI A;  1YHQ A;  2NVX H;  1TWC H;  2ATW A;  1C9O A;  4JBK A;  1SFO H;  4OX9 L;  4PZ6 A;  3BJU A;  2CWA A;  2JA6 G;  1WCM G;  1J6Q A;  4DR1 Q;  1JJ2 A;  4NB3 A;  1TXY A;  4IOA A;  2RHQ B;  1UWV A;  2ZTC A;  4XTC S;  5IYC G;  4LFC Q;  4LNQ A;  4LUV A;  3ZJY C;  2BA1 A;  1KIX A;  5JEA J;  2E2I H;  1NY4 A;  5IP7 H;  3GTQ H;  3CP0 A;  3D31 A;  1YIJ A;  3CC4 A;  3RR5 A;  1PH5 A;  1VQL A;  4BBS G;  4X66 L;  5C4J H;  2Q2U A;  1S40 A;  4JI4 L;  1GO3 E;  3L2P A;  5GAH C;  1N9W A;  3OYY A;  1XNQ L;  3KFU A;  5C3E H;  2JA5 H;  4L5R C;  4JI1 L;  3K0X A;  4A93 G;  4JG2 A;  3HOX H;  4P71 A;  3CD6 A;  4K0K L;  5EAY A;  3J7Z C;  2F52 A;  2KBN A;  2N3S A;  4B3M Q;  3I4M H;  3OTO L;  2Q2H A;  4QQB X;  4KLK A;  1W3S A;  4IPC A;  1QUQ B;  4JV5 L;  1IBL L;  4O2D A;  4A3G H;  4GS3 A;  1YI2 A;  1N34 Q;  1YZ6 A;  2UUB L;  2ID0 A;  4JI5 L;  3TEH B;  1PH4 A;  1Q8K A;  1N8R C;  1LM0 A;  3KF8 B;  3TS0 A;  1EUJ A;  2K5V A;  1P8L A;  2OCE A;  3IRB A;  1X3G A;  2VL6 A;  5M5X H;  4QGU A;  2WFW A;  4DV2 Q;  4OWT B;  1XNR L;  4JBM A;  1KAW A;  1V9P A;  4OO1 I;  4LF7 L;  1WFQ A;  4GOP B;  3NEL A;  2UU9 L;  4X64 L;  2HHH L;  3GD7 A;  1Y1V G;  4IPD A;  4LUZ A;  4HJ8 A;  1Q7Y C;  4B3S Q;  1BVS A;  3I56 A;  2MO0 A;  2JE6 I;  5GAD C;  2D0P A;  4KHZ A;  4QY7 A;  4LW1 A;  3JC6 6;  3PUX A;  1VQP A;  1XMQ Q;  1GD7 A;  4DR6 Q;  3I2Z A;  2N49 A;  3EIV A;  3EN2 A;  3ULJ A;  4POF A;  1SR3 A;  1KD1 C;  4JOI A;  4ME3 A;  5M3M H;  5JJL A;  2KHJ A;  4GKJ L;  1BKB A;  3G4S A;  3T1Y Q;  4GLX A;  3F8T A;  2LXJ A;  3U4V A;  2E5L L;  4LFB Q;  1TWG H;  3U58 A;  1K9M C;  1PVO A;  4DV5 L;  1E24 A;  4YCU A;  4A75 A;  4R4Q A;  4NXN L;  5H1S E;  3T1H Q;  1JJC B;  4BY1 H;  4HJ5 A;  2JA5 G;  4BXX H;  1X56 A;  4YHH L;  1YBY A;  4POG A;  5JJK A;  1K8A C;  2BA0 A;  3RLO A;  2NN6 G;  3CCV A;  3CC2 A;  2VUM H;  1VQ4 A;  2JA6 H;  3J7A 5;  5BR8 L;  1WCM H;  3BZC A;  2VS1 A;  4KI0 A;  1VQJ A;  4A3G G;  1EIF A;  4BA1 I;  5IYC H;  4JI2 Q;  2R93 H;  1QUQ A;  2RHS B;  2B29 A;  1SLJ A;  2N78 A;  4UP9 A;  5AJ3 L;  2Q2T A;  1E1T A;  2MNA A;  2JEB I;  4BBS H;  1PYB A;  1NTG A;  2NZO A;  4YY3 L;  1QVF A;  4OXP A;  1KL9 A;  2ZJQ A;  1OTC A;  4LF4 Q;  5FLM H;  1IBK L;  4UY8 C;  1KQS A;  3PUV A;  1MIU A;  2GVA A;  3PGZ A;  4P74 A;  4A3L G;  1AE2 A;  3EBE A;  4GN3 B;  4GOP A;  3A5U A;  2K4K A;  4X62 L;  4JBJ A;  1VQA A;  2WAQ E;  2UXC L;  2H5X A;  1NBW A;  5ELO A;  1YJN A;  3PO3 G;  1UEB A;  4X66 Q;  4BBR H;  3PUW A;  2CCZ A;  3PIO A;  3DM3 A;  4JI4 Q;  3HOZ H;  3S1M H;  1XNQ Q;  1AE3 A;  2I5H A;  4AYB E;  5M5W H;  1XMO L;  4LF6 Q;  3S2D H;  3HKZ E;  2JEA I;  2R92 G;  4DR7 Q;  4GLV B;  4DR3 Q;  2OWO A;  4Y7N H;  3U4Z A;  2QA4 A;  1E1O A;  3KOJ A;  5M3M G;  1EOV A;  2E2J H;  1D8L A;  3K7A H;  2IHE A;  2KCM A;  1RIP A;  4DV3 L;  4DR5 L;  1FGU A;  2XGT A;  1HJP A;  4JBW A;  2E8G A;  5LMN L;  1YIT A;  1PV4 A;  4JI7 L;  3S14 H;  4DR4 L;  4OO1 G;  3CCS A;  2AWN A;  4IOC A;  1YNX A;  2WB1 G;  2D62 A;  1QZH A;  1HR0 L;  3I4O A;  1FJG L;  1VS0 A;  3KJP A;  2CFM A;  4DV6 L;  4QJF A;  2F4V Q;  2Z6K A;  3F1Z A;  1PH2 A;  4LFA Q;  4DPG A;  3CPW A;  4BY7 H;  1G6P A;  5FJ8 H;  4PZ7 A;  3UDX A;  4BY1 G;  1N33 L;  4BXX G;  4JYA Q;  4X65 Q;  1XPU A;  4LF5 L;  4HID A;  2VQF L;  2IX1 A;  1JMC A;  2JA8 H;  1Q81 C;  5C44 H;  4P72 A;  3UE1 A;  2ZM6 Q;  5LMU Q;  2HHH Q;  3A0J A;  2CWP A;  2VUM G;  2L15 A;  1K3R A;  2Y0S G;  4R4C A;  4A76 A;  1X55 A;  1PH6 A;  3SGI A;  2R7Z G;  4GNX C;  3MXN B;  3PV0 A;  1HNZ L;  1IBM L;  2R93 G;  3S1Q H;  1Z9F A;  4DR2 L;  4UPA A;  1Q1E A;  4DV0 L;  2JQO A;  1NMF A;  2OQ0 A;  3GTJ H;  1XPR A;  1EQQ A;  4AQY Q;  1VQO A;  3PO2 H;  2WP8 J;  4P75 A;  3F2C A;  3L0O A;  5C0X G;  5FLM G;  4NXM L;  4ALP A;  4UP8 A;  4A4I A;  1VQN A;  4JI8 Q;  1I94 L;  3RN2 A;  2Z6K C;  2K75 A;  2I5L X;  1GVP A;  1KC8 C;  4MZ9 A;  2E5L Q;  1HZA A;  2ES2 A;  1X3F A;  3ULP A;  2JJQ A;  2Z0S A;  4YCV A;  1C0A A;  4A3E H;  3ICE A;  2HT1 A;  1X65 A;  4AH6 A;  1OXT A;  4B3R L;  4JI6 L;  1I3Q H;  1QVC A;  5IP9 G;  1EYG A;  4DV5 Q;  1C7Y A;  4PG3 A;  4BBR G;  4GKK Q;  5IWA Q;  3S1N H;  1HNW Q;  3W1G A;  4HIM A;  3HOZ G;  2LXK A;  3Q8D A;  1L0W A;  2EXD A;  4DUZ L;  4YHH Q;  1PH7 A;  4GN4 B;  1J5E L;  5IYD H;  4H02 A;  1H95 A;  2B3G A;  5GAE C;  4DV1 Q;  4R4I A;  1K0R A;  3RLN A;  3S2H H;  4A3L H;  3PUZ A;  1T9H A;  4FDB A;  5HGQ A;  2ZJP A;  1OXX K;  4JV5 Q;  3MEF A;  4A3F G;  5AJ3 Q;  4HJ7 A;  4B3T L;  2CQO A;  4LF9 Q;  2GN5 A;  2GVB A;  1JT8 A;  3NBH B;  3I7F A;  3STB C;  4IPG A;  2NVQ H;  3PO3 H;  1HZC A;  3BZK A;  3CCU A;  4WJ4 A;  4BY7 G;  5FJ8 G;  4GNX B;  1YHA A;  1IBK Q;  4QL5 A;  4RMF A;  4GN5 A;  4IFD I;  2UXB L;  1N36 Q;  2R92 H;  4JI3 L;  4MTN A;  3H0G H;  3I4N H;  2JA8 G;  5C44 G;  2VW9 A;  1JJG A;  1SN8 A;  2UUC L;  2IX0 A;  4R4O A;  4OWX B;  1ASY A;  2B63 H;  3HOU H;  3BU2 A;  3U50 C;  1HNX L;  5IY0 A;  1PHJ A;  1YEZ A;  5IE8 A;  3HOW G;  4X6A H;  2WB1 E;  1Q46 A;  3TQY A;  4EQ5 A;  4DR1 L;  5C0X I;  1L1O B;  1P16 A;  2K52 A;  1XMO Q;  3PO2 G;  4LFC L;  4IJH A;  3GTK H;  1S3O A;  3CCJ A;  4DV7 L;  1Z47 A;  2AHO B;  3E0E A;  4GLA C;  3UDI A;  1K73 C;  2OTL A;  2NVY H;  1B7Y B;  4DV3 Q;  1CSP A;  3CF5 A;  1CKN B;  4L5T A;  4UP7 A;  2IHF A;  1HR0 Q;  1K83 H;  3JAM c;  2OQK A;  3AQQ A;  3E9H A;  4YWL A;  3H15 A;  4DV6 Q;  4A3E G;  1VQ7 A;  3G48 A;  2R7Z H;  2YYZ A;  3J80 c;  5JJI A;  4B3M L;  4L5Q A;  4HIO A;  2KEN A;  2A19 A;  1IXR A;  3FKI H;  5IYD G;  2C35 B;  2ZJR A;  1OXU A;  4JI0 L;  3CCR A;  4JCV E;  3G6E A;  4DV4 L;  4OX9 Q;  2D0O A;  1WYD A;  1VQI A;  4BA2 I;  2DGY A;  1VQF A;  3CMA A;  4DV2 L;  1V43 A;  1IBM Q;  3RNU A;  1KXL A;  5E7N A;  4R1J A;  1WI5 A;  1VQG A;  4DR2 Q;  4A3K H;  1VQM A;  3GTG H;  3TS2 A;  1UE6 A;  3JAM i;  4DUY L;  2HIX A;  5IP9 H;  1NE3 A;  1EWI A;  3M4P A;  1Q82 C;  2VZA A;  4L5S A;  3TRZ A;  3J80 i;  4LWC A;  3PF4 A;  3PCO B;  2BH8 A;  1SRO A;  1HZB A;  3M9B A;  2R6G A;  4JI1 Q;  4AIM A;  1X9N A;  4GNX A;  4B3S L;  2PI2 E;  2RCN A;  3CC7 A;  3H0G G;  2NVT H;  3L7Z C;  3CCL A;  1X54 A;  2K50 A;  1XTD A;  3I4N G;  1TWH H;  4A3C H;  5GRO A;  4K0K Q;  3OTO Q;  4IFD J;  4R4T A;  1BBW A;  1XMQ L;  3NEM A;  1QVG A;  1IBL Q;  2B63 G;  3S1R H;  1W2B A;  4JI6 Q;  3HOU G;  4DR6 L;  4KHP L;  1I6H H;  2UUA L;  2UUB Q;  1A63 A;  4A3F H;  3KYH C;  1Q1B A;  4JI5 Q;  3GO5 A;  3J81 c;  5M3F H;  3T1Y L;  1J5E Q;  5HY6 A;  2JA9 A;  4IJL A;  3AFQ A;  3GDE A;  1XNR Q;  4LFB L;  1L1O A;  5IYB H;  4A3B H;  3CCQ A;  5C0X J;  2K5N A;  3OW2 A;  4LF7 Q;  1WOC A;  1X3E A;  1MJC A;  3FHW A;  2UU9 Q;  3M3Y H;  1B8A A;  4A3J H;  4DK6 C;  2K5H A;  1GM5 A;  1Y1W H;  1U5K A;  4X64 Q;  3T1H L;  1ASZ A;  1CKN A;  3KDF B;  1FL0 A;  2AWO A;  3CQZ H;  1U0L A;  3ER0 A;  1E7Z A;  3KF6 A;  4A3I G;  3KLW A;  3HOW H;  3LGJ A;  2AMC B;  2NZH A;  4JC0 A;  1BBU A;  2UXD Q;  2YTX A;  3J81 i;  5C4X G;  2F3I A;  3FKI G;  1N32 L;  1PH3 A;  1KRS A;  3K7U C;  2A1A A;  2Q2I A;  1PH8 A;  3GTP H;  4GKJ Q;  3CW2 C;  2UUC Q;  3VDY A;  4WJ3 M;  1HNX Q;  3K81 C;  4LF4 L;  1EFW A;  4IO9 A;  3S17 H;  2IY5 B;  2QEX A;  3CCE A;  3AYH B;  2I0Q A;  1L1O C;  4A3K G;  3A5Z B;  3K80 C;  1YHB A;  2YTV A;  4MNO A;  1SMX A;  3CME A;  1PH9 A;  2PMZ E;  4OWW B;  2I5M X;  3RLF A;  1RL2 A;  3NEN A;  4DV7 Q;  4NXN Q;  4C2M H;  3CAM A;  4YWM A;  1LTL A; 
#chains in the Genus database with same CATH topology
 1WVL A;  4CGY B;  2KVM A;  5BN4 A;  1PFB A;  1F9P A;  4RCN A;  4A3C G;  1IW7 D;  4Z9C B;  4DK3 C;  5EJW A;  4PMW A;  1PRT B;  3TZU A;  4O0A A;  3HS0 C;  2RKS A;  1ILQ A;  2PQA B;  2WAQ G;  2RSN A;  2HQL A;  4FYD A;  1M1K C;  3HFZ B;  3DMU A;  1ONL A;  4S3S A;  3EFX D;  3HKZ G;  4A3J G;  1NJI C;  2YTY A;  3S15 B;  2KUM A;  4X65 L;  1Q86 C;  2QGQ A;  2B2U C;  5LMU L;  2B8G A;  2WAC A;  3HOY B;  2RQX A;  4A3M H;  3C1E A;  1CQF A;  1M90 C;  5EKK A;  4ZCK A;  3UE0 A;  2A6H C;  1WD0 A;  2MO1 A;  3LWE A;  1I50 B;  2B2W A;  4RGM A;  2AQ2 B;  2B2V A;  5LMN Q;  4JI7 Q;  2K32 A;  1HA6 A;  3OMC A;  2CW0 D;  4IUV A;  2R7F A;  3SR1 A;  2ALY B;  1VDZ A;  1SE8 A;  3ND8 A;  4N8F A;  1Y1V B;  1EY8 A;  4HJA A;  5D3I B;  2EYL A;  3GTM B;  1TWA B;  5C4X H;  5IP7 G;  2AKW B;  5I4D A;  5IWA L;  1HNW L;  5EPJ A;  5C3E G;  4DAM A;  2IJ0 A;  1SFO B;  3MXP A;  1WTV A;  1A6X A;  3J81 j;  4DV0 Q;  1ZXT A;  1MBY A;  4KJN A;  3M4Q A;  3Q22 A;  2PQA A;  2MHV A;  3BDC A;  3KBG A;  1B50 A;  2QEJ C;  4EX5 A;  3GTQ B;  1K8G A;  1YVC A;  5EGT A;  2RCF A;  1EQR A;  4IAL A;  1EYA A;  1UE5 A;  2PZT A;  5C4H A;  1B9N A;  2D2C C;  1SSO A;  1DON A;  3CRL C;  4IUT A;  4PZ8 A;  5FLX c;  5I9O A;  4B3R Q;  3S15 H;  1ZKO A;  3E0J A;  4CDF C;  4DKA C;  5C5L A;  3HOY H;  3HOV G;  1HUM A;  3ONA B;  1PRT D;  3C46 A;  1SE4 A;  3HKS A;  5M5X B;  5T1G A;  1E22 A;  1CI3 M;  1I50 H;  1CKM A;  1SE3 A;  4OON A;  4B3T Q;  2QW7 A;  2FMM A;  3DM1 A;  5FO7 B;  3V2T A;  3T51 B;  1Y1V H;  1YJW A;  5FLX L;  2F03 A;  4JI2 L;  4JI3 Q;  3GTM H;  1Y8O B;  1TWA H;  2V1C C;  3V05 A;  2EIF A;  1MJE A;  4NW2 A;  1V1P B;  4IUN A;  1YHQ A;  1YNJ D;  2K04 A;  2ENB A;  1QNK A;  1SFO H;  4PZ6 A;  1X3P A;  1BNZ A;  2WB1 B;  4NB3 A;  1JJ2 A;  4LFC Q;  1HHV A;  3S9W A;  1KIX A;  4EQN A;  2Q8T A;  3K58 A;  2E2I H;  1EYD A;  1B44 D;  2EOT A;  3GTQ H;  4BBS G;  3CP0 A;  3D31 A;  4M8A A;  2BOS A;  1DOM A;  1U4M A;  3L2P A;  3KFU A;  1Q8I A;  2N55 A;  4L63 B;  4JG2 A;  4K0K L;  1KAB A;  4B3M Q;  2F52 A;  1U4R A;  2Q2H A;  1TR5 A;  1W3S A;  4IPC A;  4JV5 L;  2R93 B;  4KMU C;  1IBL L;  1DXM A;  1N34 Q;  1YZ6 A;  5FLX E;  4FVM A;  1Q8K A;  1N8R C;  1LM0 A;  1SEB D;  3KF8 B;  3IAY A;  1STA A;  2OCE A;  3K6O A;  2PQE A;  2VL6 A;  5M5X H;  4QGU A;  1T5E A;  2F0Q A;  4OWT B;  1EYC A;  1X3Q A;  1TQO A;  1KAW A;  3MVV A;  1DZ1 A;  1JWS D;  3OWE B;  2K05 A;  1O78 A;  3QJY A;  4HJ8 A;  1SNC A;  3ITP A;  2XSC A;  2A6H D;  1CA6 A;  3HOZ B;  2MO0 A;  2D0P A;  5NUC A;  2L55 A;  2J0T D;  4J8Q A;  3MAQ A;  1ET6 A;  5CYU A;  1UAP A;  4DR6 Q;  3EIV A;  4RH6 A;  1UNS A;  4K2K A;  1V1P A;  2F3V A;  1STB A;  5CC4 A;  3WOF A;  3F8T A;  2EE1 A;  2LXJ A;  3U4V A;  3K57 A;  3N52 A;  3SK5 A;  1EY6 A;  1RCV D;  1K9M C;  3FPU B;  4QMG A;  5BN3 A;  1E24 A;  5DAU A;  4H0L C;  4YCU A;  4NXN L;  5H1S E;  2JA5 G;  2JA8 B;  5C44 B;  2EVB A;  1GHJ A;  2K33 A;  5I6W A;  4KI0 A;  1NR2 A;  4ODG A;  5IOC A;  2R93 H;  5HUR A;  2Q2T A;  4HN7 A;  3I73 A;  2JEB I;  2KQ3 A;  4YY3 L;  4OXP A;  3KF8 A;  1FR3 A;  1KL9 A;  4MTK A;  3VR3 A;  1OTC A;  1F2Y A;  5FLM H;  3SEB A;  5DM7 3;  1MI2 A;  4A3L G;  1JOK A;  3D4W A;  1I3Q B;  2K4K A;  4X62 L;  4YIJ A;  2UXC L;  1CM9 A;  4CJ0 B;  1NBW A;  4X66 Q;  4JI4 Q;  2N88 A;  5COR A;  3HOZ H;  1AE3 A;  4H44 C;  2JEA I;  2R92 G;  4GLV B;  2QA4 A;  3KOJ A;  5M3M G;  1D8L A;  3VR5 A;  3J80 L;  2KCM A;  4DR5 L;  3NQT A;  4JBW A;  2E8G A;  2AWN A;  1HR0 L;  2EXZ A;  2NVQ B;  1AW7 A;  1GUS A;  5CMD A;  1G6P A;  5IGC A;  1N33 L;  2F0N A;  4X65 Q;  4KJO A;  4LF5 L;  4HID A;  2VQF L;  4FXK C;  4X3T A;  1JMC A;  2JA8 H;  1Q81 C;  2L12 A;  4P72 A;  5C44 H;  5LMU Q;  4IFD G;  2CWP A;  1U4L A;  3SGI A;  5BN5 A;  4GNX C;  4B9X A;  1IBM L;  1Q1E A;  4K8I A;  3X3M A;  1NMF A;  5ELE A;  2K01 A;  3GTJ H;  1VQO A;  4KD3 A;  1KAA A;  2WP8 J;  5FOB B;  3LWU A;  4NXM L;  2SOB A;  1VQN A;  4MZ9 A;  1I4Q A;  1X3F A;  4DNT B;  1RJT A;  3ULP A;  2HT1 A;  5DNF A;  1I3Q H;  4O1N A;  5IP9 G;  1PMR A;  4B08 A;  1CA5 A;  1B4O A;  5IWA Q;  1HNW Q;  2M00 A;  3Q8D A;  5IYD H;  2EXD A;  1KTK A;  4LJZ C;  4WRD A;  1H95 A;  1JWU D;  4IUU A;  1PTO C;  3RLN A;  3OPO A;  4RAU C;  5LL6 X;  2DY8 A;  2B2Y A;  5CV4 A;  1RD9 D;  2GVB A;  1TY0 A;  1IHZ A;  3NBH B;  4JPB W;  1JT8 A;  2NVQ H;  1HZC A;  1NCV A;  2L4N A;  4GNX B;  1YHA A;  1U4P A;  4ZLT F;  3M7G A;  3VYR A;  1JJG A;  4A3F B;  3K5N A;  3HOU H;  1IYU A;  3BU2 A;  3EVQ A;  5M3F B;  1HNX L;  3CHB D;  3A7A B;  3NTK A;  3MXG A;  1B9M A;  1Q46 A;  3TQY A;  2K52 A;  3G7L A;  1S3O A;  2F0W A;  2AHO B;  1LTR D;  2NYZ D;  3E0E A;  3UDI A;  3M3Y B;  5CBE E;  1RTO A;  1EQV A;  1AP0 A;  2IHF A;  2OF1 A;  2OQK A;  2M9V A;  4A3E G;  2F0L A;  3BVG A;  3OW7 A;  1STN A;  5JJI A;  1F9S A;  3MXU A;  4HIO A;  4HSV A;  2C35 B;  3QOJ A;  3CCR A;  1TY2 A;  3G6E A;  2D0O A;  5CV9 A;  2NB0 A;  3IKJ A;  1V43 A;  3ND9 A;  1KXL A;  4R1J A;  1WI5 A;  1VQG A;  3H09 A;  2Z6B A;  4C2M B;  1NE3 A;  1EWI A;  3OIP A;  2VZA A;  3NBH A;  3GP7 A;  3J80 i;  1K3B C;  4LWC A;  2A6E D;  3I70 A;  2BH8 A;  1HZB A;  3M9B A;  2R6G A;  4GNX A;  3CC7 A;  3H0G G;  3I4N G;  4K0K Q;  2HCC A;  2R3Z A;  1SYC A;  4JV5 Q;  1IBL Q;  1W2B A;  4JI6 Q;  1A63 A;  4A3F H;  2NTT A;  4C3H B;  5M3F H;  3T1Y L;  4XQQ A;  3I8Z A;  4IUQ A;  2JA9 A;  4IJL A;  4LFB L;  5JPN C;  5D14 A;  2K5N A;  1MJC A;  3M3Y H;  3QR8 A;  2BE5 C;  1E2Z A;  3MZ5 A;  2K5H A;  4CDE C;  1FL0 A;  2PNR C;  1U0L A;  3NPP A;  4C1N I;  5KNC A;  2NZH A;  3J81 i;  5C4X G;  4ID6 A;  2A73 B;  1BOS A;  3TP5 A;  2Q2I A;  3R2T A;  3G6J B;  4V0B A;  2TSS A;  4WJ3 M;  1SXT A;  3K81 C;  1RKN A;  3ERO A;  4KKS A;  2O5I C;  3CCE A;  3GTL B;  3AYH B;  1L1O C;  1MSH A;  3A5Z B;  4A3K G;  2YU9 B;  1YHB A;  2YTV A;  1SYB A;  3NEN A;  4A3D B;  1EWH A;  4NXN Q;  4C2M H;  5L37 A;  1VQ5 A;  1SNO A;  1S4Z A;  5J22 A;  5DLQ E;  1VQC A;  1XX8 A;  1F2L A;  2FXQ A;  1EIG A;  4K5X A;  4MIU A;  4LF6 L;  4HIK A;  3S16 B;  4WOR A;  1I4X A;  1NUC A;  2IT1 A;  4C3H H;  4YY3 Q;  1D2B A;  3AFP A;  3HOY G;  3PSI A;  4A3B G;  3KK7 A;  4AYB G;  1VCI A;  5IT9 c;  3DWQ A;  4C3J B;  3BVM A;  4E6I A;  4LFA L;  4DNI A;  2OTJ A;  4O42 A;  2FIN B;  2LSS A;  4X62 Q;  5FO8 B;  2UXC Q;  2K28 A;  4DUY Q;  5A2Q L;  1SNP A;  2PCF B;  3K59 A;  3AMU A;  2JP1 A;  4M1U B;  1UE1 A;  1SYG A;  3F2B A;  3I4L A;  3F2D A;  2A8V A;  1Q12 A;  1TII D;  4DR5 Q;  1X6O A;  2OT2 A;  1Y1W B;  3UDF A;  2DUD A;  4KHP Q;  2UUA Q;  1ZYR C;  4ZQ3 A;  3KJO A;  1B70 B;  2L9H A;  2HD3 A;  4JI8 L;  5IT9 L;  4RKB A;  3GTL H;  2Y0S E;  1GJX A;  4XYO A;  2ZTE A;  2YU9 H;  1VQK A;  5CV8 A;  4R8N A;  3CXC A;  1N33 Q;  1JOO A;  5GQO A;  2KCN A;  4A3D H;  4LF5 Q;  1HA5 A;  1N34 L;  2VQF Q;  2OEO A;  1Q90 A;  4CKE A;  1AFP A;  2IX3 A;  2IW3 A;  4J15 A;  1ESR A;  2X6L A;  3P75 A;  2JA7 G;  3S16 H;  4ZYS A;  1KDC A;  1N32 Q;  3T53 B;  1UE7 A;  4JOI C;  4F88 A;  1Y8N B;  4NXM Q;  5C4J B;  1FNU A;  4YWK A;  4LK1 C;  5M9O A;  3AEV A;  1CFM A;  4C3J H;  2EQS A;  3HOX B;  4F8M A;  2ASB A;  1WJJ A;  3I4M B;  1S5B D;  1YJ9 A;  5IT9 E;  2WIN B;  5JVH 3;  3W1B A;  1K8O A;  3FP9 A;  1E0B A;  3A56 A;  2KCC A;  5JEA H;  5DEH A;  2BE5 D;  1VQD A;  3VYT A;  1VQH A;  1A3U A;  1EY4 A;  5E1F A;  2R7D A;  3E3X A;  2B8F A;  1LV9 A;  3PUY A;  1ICW A;  1VMC A;  2ZTD A;  4UHV A;  1G2S A;  4K5V A;  2DN8 A;  3R3O A;  3HRZ C;  5ELN A;  4DAY B;  3CCM A;  1MHW C;  2CKZ B;  2NN6 I;  2LS0 1;  1GKH A;  4RGN A;  1A0I A;  1B2T A;  1D5Z C;  3BYT B;  4OX9 L;  3BJU A;  2CWA A;  1WTH A;  3FMC A;  2CH4 A;  2EDG A;  2RHQ B;  2ZTC A;  2BA1 A;  4KY7 A;  2Q8I B;  1NY4 A;  2EY1 A;  3CC4 A;  1SNQ A;  1VQL A;  4BY1 B;  4F87 A;  4X66 L;  5C4J H;  1SMY C;  2Q2U A;  4JI4 L;  1DCZ A;  1EEI D;  3OYY A;  2SNM A;  4L5R C;  2VUM B;  2RA4 A;  3DWA A;  3K0X A;  1WCM B;  3HOX H;  2NN6 H;  2Y0S B;  5EAY A;  2N3S A;  2KBN A;  3I4M H;  4FO2 A;  4QQB X;  4KLK A;  4OEL B;  1DYQ A;  4L8J A;  2ZXP A;  1LT4 D;  2ID0 A;  3TEH B;  1PH4 A;  2JYO A;  4GZY C;  3IRB A;  3URY A;  2WFW A;  1PXU A;  3RMH A;  4OO1 I;  2EJG C;  1WFQ A;  1HCZ A;  3T16 A;  3J7A F;  4IQZ A;  1GXD C;  3I56 A;  3S1M B;  1ROD A;  5M5W B;  4KN4 C;  2XN9 C;  3JC6 6;  1SYF A;  4DAY A;  4EQO A;  4Y7N B;  2E2J B;  3EN2 A;  1ZYR D;  3ULJ A;  2KHS A;  4JOI A;  1PZK D;  3T1Y Q;  4DAV A;  1A15 A;  2RBM A;  1F9R A;  4LFB Q;  3OHX C;  2LMC B;  1BCP F;  1NAP A;  5K36 H;  3TP8 A;  3U58 A;  1V1O A;  3NHH A;  4BY7 B;  5K5P A;  2XNA C;  4BY1 H;  1HPC A;  1TKW B;  1YBY A;  3Q0A A;  1GHK A;  5JJK A;  3J7Y W;  2VUM H;  1VQ4 A;  4DXG A;  1WCM H;  4A3G G;  2L5T A;  1EIF A;  2I07 B;  4KTA A;  4BA1 I;  2E2I B;  4FF3 A;  4UP9 A;  2RHS B;  3C3L A;  1JR0 D;  4XYQ A;  1QVF A;  2NZO A;  2EYP A;  4OEM B;  5IOD A;  1LTB D;  3DHQ A;  1KQS A;  1MIU A;  5I6Y A;  2PZW A;  1QE6 A;  2WV6 D;  2RVL A;  2C5C A;  3A5U A;  4K2L A;  1VQA A;  2WAQ E;  2H5X A;  3X3N A;  1F9Q A;  3PIO A;  3VR2 A;  3S1M H;  5M5W H;  2QF7 A;  4LF6 Q;  1G6Z A;  3HKZ E;  2FHT A;  4QUF A;  4Y7N H;  1E1O A;  2E2J H;  4G4K A;  4CJ1 B;  1UEA B;  1FGU A;  2XGT A;  1HJP A;  3VR4 A;  3S14 H;  4DR4 L;  4CDC C;  2D62 A;  3HG9 A;  3I4O A;  1LTI D;  2NUC A;  4RGO S;  3VYS A;  2Z6K A;  1PH2 A;  4LFA Q;  4DPG A;  4BY7 H;  3D4R A;  4BXX G;  3W3A A;  1LLR D;  3H6M A;  3I72 A;  2L0C A;  1SNM A;  4IZ8 A;  3UE1 A;  2HHH Q;  4ILW A;  4R4C A;  4A76 A;  1STG A;  3MXN B;  2WII B;  1QIL A;  2OXP A;  3GTK B;  1ET9 A;  1QG7 A;  2JQO A;  5E4X A;  2XVS A;  4KY5 A;  1XPR A;  1SAP A;  4DAP A;  1SMY D;  2NVY B;  4P75 A;  3L0O A;  4HSP A;  3OMG A;  1YNN D;  1JQY D;  4OIK A;  1M4V A;  1ILP A;  1HQR D;  4UP8 A;  4JI8 Q;  4K5W A;  1I94 L;  3RN2 A;  2K75 A;  1Z6H A;  2JJQ A;  1C0A A;  3ICE A;  1BDO A;  5EBC A;  5CV7 A;  1CHQ D;  1OXT A;  3AB9 A;  4JI6 L;  2KEE A;  1EYG A;  1GOZ A;  1C7Y A;  4PG3 A;  4BBR G;  4Q0F A;  3SK4 A;  4KN7 C;  3PIO 3;  2ZT9 C;  3A8K E;  3QIA A;  1T9H A;  1D5X C;  2EPB A;  3GTG B;  4FDB A;  2ZJP A;  2EY2 A;  4A3F G;  5AJ3 Q;  2RSO A;  5LL6 S;  2FFK B;  2GN5 A;  3I7F A;  4NDX A;  3STB C;  1Y8P B;  4IPG A;  1RTN A;  3VR6 A;  5JJZ A;  5FJ8 G;  2F0K A;  4QL5 A;  3TZD A;  2UXB L;  1IKM A;  1BO0 A;  2XRQ D;  4RHR A;  4MTN A;  5TSS A;  1WD1 A;  4H7B A;  4XDX A;  1SN8 A;  4ZKB B;  2IX0 A;  4R4O A;  1EOT A;  2F3W A;  1QJO A;  3P7J A;  4TSS A;  1PHJ A;  4X6A H;  3CU7 A;  3MXN A;  5KIX A;  5C0X I;  3PO2 G;  5FKA C;  3GTK H;  1G8Z D;  2B2Y C;  2DNE A;  2NVY H;  2E74 C;  4A3J B;  1CSP A;  1CKN B;  4L5T A;  4UP7 A;  2EYF A;  3E9H A;  3MC0 B;  4YWL A;  3H15 A;  4DV6 Q;  3GTJ B;  1QWY A;  3J80 c;  1LAC A;  4XT1 B;  3FKI H;  3GTP B;  2ZJR A;  3DEO A;  5C0X H;  2X6G A;  4OX9 Q;  2A68 C;  3BDO A;  3P1H A;  2ICI A;  4BA2 I;  1VQF A;  3CMA A;  4DV2 L;  3RNU A;  4DR2 Q;  3GTG H;  3TS2 A;  4DUY L;  2KED A;  2HIX A;  4C3H G;  4L5S A;  1FD7 D;  2BDN A;  5C5M A;  3PF4 A;  1X9N A;  1DM0 B;  3QG1 A;  1TS3 A;  2A6E C;  4B3S L;  2Q8R E;  3C2P A;  4C56 C;  2RCN A;  3L7Z C;  2K50 A;  4A3C H;  1IKL A;  4IFD J;  4FXD A;  4R4T A;  1XMQ L;  2B63 G;  3NE5 B;  4KHP L;  5IGE A;  4XQN A;  1HFG A;  2UUA L;  2XRS D;  4K6L A;  3J81 c;  4I7A A;  2DY7 A;  5HY6 A;  4PQX A;  3AFQ A;  3I3C A;  3CCQ A;  2G5D A;  1WOC A;  3FHW A;  4A3J H;  4DK6 C;  5ELC A;  3SVM A;  3T1H L;  3HOU B;  1CKN A;  3ER0 A;  1EU4 A;  1E7Z A;  3KF6 A;  3Q23 A;  1EL0 A;  3HOV B;  4JC0 A;  2YTX A;  3V96 A;  1N32 L;  3K7U C;  2KA7 A;  2MPM A;  2PZU A;  4RHS A;  3GTP H;  3CW2 C;  3J80 E;  3J81 L;  2UUC Q;  2Z1C A;  4MHE A;  4LF4 L;  2NBF A;  1LTG D;  3K0Y A;  1SMX A;  3CME A;  3T56 B;  2PMZ E;  1PH9 A;  5EQ0 A;  1RL2 A;  1BBX C;  1FNV A;  3CAM A;  4YWM A;  2RDH A;  4LUO A;  3A8J E;  3NXW A;  1GUT A;  2DJG C;  5I2X A;  1A2U A;  1SRU A;  2EJM A;  2LY7 A;  4CKC A;  4OGQ C;  3BYY B;  4DR3 L;  1S5F D;  5LMN W;  2O2L D;  3D3R A;  1QZG A;  3R93 A;  3STB D;  3BG3 A;  4A93 B;  3CPF A;  4RKL A;  5JEA G;  4JI0 Q;  1EY5 A;  2F0D A;  5IYB G;  3R2I A;  1QOH A;  1JB7 A;  1D5M C;  3SXH A;  2F4V L;  2K14 A;  3J81 E;  1O7Z A;  1TWF B;  1F77 A;  5IGB A;  4U67 3;  1Y1W G;  3L9A X;  3ERQ A;  2EYH A;  2BH2 A;  1CUK A;  4RA8 A;  1B53 A;  2HIV A;  3RUZ A;  2SEB D;  3HOV H;  4APV A;  4DR4 Q;  4ZRZ A;  1BQQ T;  1IZ6 A;  2F0J A;  2QCP X;  3RZO B;  3GTO B;  4G7H C;  1F2Z A;  3M85 A;  1D7Q A;  1MKH A;  1JOR A;  3HZX A;  2A68 D;  5CV5 A;  2EY5 A;  3A74 A;  3A7L A;  4GKK L;  1HFN A;  1PFS A;  1GUN A;  4YCW A;  2NVX B;  1CSQ A;  1PFN A;  1XJV A;  3HOX G;  4DV1 L;  3I4M G;  1SJH D;  1PH1 A;  1I5F A;  2VB3 X;  5ELF A;  4DK1 A;  3E9I A;  4PMC A;  4LF9 L;  4A93 H;  2XTI A;  4EGV A;  4I65 A;  1I94 Q;  2JA5 B;  4Y52 H;  1Y14 B;  1OXS C;  1AH9 A;  1NMG A;  3TRE A;  3BZD B;  1TWF H;  1I4R A;  1ML0 D;  3T13 A;  4IPH A;  4RG1 A;  3WWV A;  1N36 L;  1JB3 A;  4XT3 B;  1XWE A;  1B3A A;  1HTL D;  4A3M G;  1A3V A;  1A8V A;  2E2H H;  4BS9 A;  4FP5 D;  1RHP A;  4FXG C;  1PYW D;  2VQE Q;  3SK6 A;  1JE5 A;  3RN5 A;  1KDA A;  4RWS C;  3BDL A;  2F0I A;  4G7O C;  1DD2 A;  1Y69 U;  4QIW E;  4LF8 Q;  4TVA B;  3RZO H;  5K36 G;  4I7Z C;  3GTO H;  1ENA A;  2UXB Q;  2Z4H A;  2MGS A;  3PF5 A;  1QCB D;  2M2L A;  3H91 A;  2Z4I A;  2N8N A;  1A62 A;  1KHI A;  2NVX H;  2ATW A;  3NWS A;  4JBK A;  3NTH A;  4FNF A;  3TME A;  1HTP A;  4CBV A;  1HQM C;  1FNW A;  1WCM G;  1TWG B;  2AQ1 B;  4J6H A;  5D65 A;  4XTC S;  4LNQ A;  2XIW A;  4LUV A;  4ZUI A;  3ZJY C;  3K5L A;  4V19 0;  1YIJ A;  3RR5 A;  1PH5 A;  1K28 A;  2PPB C;  3SHL A;  1S40 A;  1RF2 D;  2A69 C;  1MSG A;  2WKD A;  2JA5 H;  5HGT A;  1O7Y A;  1NSN S;  2JA6 B;  4P71 A;  3CD6 A;  2HCI A;  1O80 A;  3OTO L;  5DM6 3;  1QUQ B;  4O2D A;  1NNX A;  5IIF A;  1YI2 A;  2UUB L;  4G57 A;  4K6D A;  3TS0 A;  4ME5 A;  1EUJ A;  3R8B A;  2K5V A;  1P8L A;  2PW7 A;  4DV2 Q;  2MJ8 A;  5EPK A;  1D1I A;  1V9P A;  1C4Q A;  4LF7 L;  3SDZ A;  3NEL A;  2UU9 L;  2HHH L;  5CBA E;  3GD7 A;  1Y1V G;  1Q7Y C;  4B3S Q;  3D6W A;  3S2D B;  4QY7 A;  4LW1 A;  3PUX A;  3EA6 A;  1XMQ Q;  3I2Z A;  5CGK A;  1BUV T;  1SYD A;  1KD1 C;  2F0E A;  3AU7 A;  5LHY 1;  5M3M H;  5JJL A;  2KHJ A;  1BKB A;  3G4S A;  4OL7 A;  4GLX A;  1PLF A;  1TWG H;  4N9P A;  4PMB A;  2F0F A;  3I90 A;  4A75 A;  2QDL A;  3IFD A;  3T1H Q;  1X56 A;  2A5H A;  3J7A V;  4KKU A;  4POG A;  1K8A C;  2BA0 A;  3RLO A;  3KUP A;  1J9O A;  5A2Q E;  3HP3 A;  3CCV A;  4QIW B;  2JA6 H;  1PZJ D;  5BR8 L;  5A35 A;  1XYI A;  3N6R A;  4KD4 A;  5IYC H;  1C8C A;  1QUQ A;  4LAA A;  5AJ3 L;  1E1T A;  4X3U A;  4DU9 A;  1EQT A;  1NTG A;  3DWP A;  4LF4 Q;  2PO4 A;  3PUV A;  3PGZ A;  3Q6S A;  4EQP A;  4OIJ A;  2K5W A;  4GN3 B;  4JBJ A;  5ELO A;  5G3L F;  1UEB A;  3H94 A;  4K14 A;  1XNQ Q;  4AYB E;  1EY0 A;  2I5H A;  3JAM L;  3S2D H;  1BCP C;  1A2T A;  2OWO A;  4DR3 Q;  1EOV A;  3OIQ A;  2IHE A;  4IN3 A;  1CZW A;  1D1K A;  5EBD A;  4UAI A;  3NTI A;  3CCS A;  4ZAI A;  1QZH A;  1YNX A;  1ZEQ X;  2WB1 G;  4DA2 A;  1BF4 A;  3PO3 B;  2K6A A;  1FJG L;  1VS0 A;  3KJP A;  2CFM A;  4DV6 L;  1H9J A;  4QJF A;  1EZ8 A;  3F1Z A;  1DOK A;  2F4V Q;  1F2M A;  1CTM A;  1EY7 A;  5T1I A;  1E2V A;  1L0X B;  3CPW A;  4Q5V A;  3EQL C;  5JAV A;  1S5E D;  4XQJ A;  3H0G B;  3I4N B;  1XPU A;  5COY A;  1XTC D;  1I4H A;  1LT5 D;  5JVG 3;  1H9S B;  4ZUJ A;  3A0J A;  5KEE A;  2HDL A;  1K3R A;  2C9O A;  2XWB B;  1PH6 A;  4U68 A;  3PV0 A;  1HNZ L;  2R93 G;  2AUJ D;  1TS5 A;  1Z9F A;  4DR2 L;  2A69 D;  5C0X G;  5FLM G;  1YNN C;  5ELD A;  2IWH A;  1K83 B;  4DXF A;  2Z6K C;  1JCK B;  1BCP B;  2I5L X;  1GVP A;  1KC8 C;  2E5L Q;  1MGS A;  1HZA A;  2ES2 A;  2R7Z B;  4A3E H;  4AH6 A;  5E4W C;  3TN2 A;  1JC7 A;  4DV5 Q;  4H13 C;  4QF4 A;  5C6A A;  4GKK Q;  3W1G A;  3HOZ G;  3LNN A;  1IYV A;  2LXK A;  4DUZ L;  4YHH Q;  3OSO A;  4GN4 B;  1WTP A;  3LX0 A;  4NMZ A;  2B3G A;  1EZ6 A;  2F0M A;  4DV1 Q;  2A74 C;  1K0R A;  4CJ2 C;  1R4P B;  3PUZ A;  4A3K B;  1OXX K;  5D3D A;  3NBI A;  2CQO A;  4LF9 Q;  3PO3 H;  3BZK A;  3CCU A;  4WJ4 A;  1IBK Q;  1LO5 D;  2NVT B;  1N36 Q;  3BVZ A;  3S14 B;  3H0G H;  3I4N H;  2JA8 G;  5C44 G;  3NWT A;  1T5X D;  3S1R B;  2VW9 A;  1J8I A;  1I6H B;  2B2T C;  2UUC L;  3TP6 A;  1H9S A;  4OWX B;  1ASY A;  4OO1 H;  3U50 C;  5IY0 A;  5J39 A;  2F0O A;  2E2D C;  2F0G A;  2WB1 E;  4DR1 L;  4A3B B;  4AYB B;  1XMO Q;  3CCJ A;  1CK1 A;  1B3Q A;  2RDF A;  1K73 C;  2OTL A;  2HQE A;  1OO9 B;  1B7Y B;  4DV3 Q;  2D5D A;  1K83 H;  3AQQ A;  3HOW B;  2F0P A;  1VQ7 A;  2R7Z H;  1PRT F;  2YYZ A;  4K8J A;  3QOL A;  1WTQ A;  4L5Q A;  5KNB A;  2KEN A;  5IYD G;  4JI0 L;  4PNY A;  1SND A;  5E3F A;  3S17 B;  2DGY A;  5E7N A;  1VQM A;  3BS1 A;  4A3K H;  3HEJ A;  2WKC A;  3JAM i;  3GQB A;  1Q82 C;  4DK0 A;  1I4G A;  3I91 A;  4WJW A;  1CZG A;  1BCP D;  3PCO B;  1SRO A;  5AFW A;  2PI2 E;  4FF1 A;  2DNC A;  2NVT H;  1R4Q B;  4C3I B;  1CT1 D;  1XTD A;  3L3O C;  1II3 A;  3OTO Q;  3CRK C;  3HOU G;  3S1R H;  1LAB A;  2JA7 B;  2Z9H A;  3TDQ A;  1I6H H;  2UUB Q;  5M5Y B;  1Q1B A;  3GO5 A;  2DJF C;  3MA2 B;  4CDD C;  1LTA D;  2EYM A;  1JIC A;  4N8X 1;  1J5E Q;  3A8I E;  4HR7 B;  4A3B H;  4HMI A;  3OW2 A;  1DOL A;  4LF7 Q;  1X3E A;  3EJI A;  1H9M A;  4XXE A;  2RDG A;  1B8A A;  1SBB B;  2UU9 Q;  3FRP B;  1GM5 A;  3UI2 A;  1U5K A;  3O13 A;  2SNS A;  3KDF B;  5JOB A;  3WOE A;  1B1Z A;  3HOW H;  3LGJ A;  2AMC B;  4UDU C;  5EKL A;  5FK9 C;  1PH3 A;  2EJF C;  4KY6 A;  2A1A A;  1PH8 A;  4KV6 A;  3VDY A;  3IL8 A;  2MUY A;  2H1E A;  2EYO A;  3S17 H;  1EFW A;  4IO9 A;  4A3I B;  4MNO A;  4OWW B;  2QKI C;  2I5M X;  3RLF A;  3FKI B;  4DV7 Q;  2B2T A;  4A93 G;  2P5Z X;  5CV6 A;  3H3V C;  5I9P A;  1UUP A;  2B2U A;  3A55 A;  1S72 A;  4TQU S;  4HED A;  1BXT A;  2IL8 A;  2VQE L;  2FMC A;  5BR8 Q;  4C3I H;  4DR7 L;  5KRU A;  4ZKC B;  5M3F G;  2JA7 H;  5J3B A;  2UXD L;  2JK8 A;  1HR0 W;  5M5Y H;  1W6K A;  1R9T B;  4LF8 L;  1DJR D;  1VF5 C;  3M7N A;  3RZD B;  4DV4 Q;  1EIY B;  3G71 A;  1HZ9 A;  2PYK A;  2E75 C;  1HH2 P;  3PIP A;  1IL2 A;  4IUP A;  1VQ8 A;  1LYL A;  3W5O A;  1XXG A;  3B6Y A;  4JYA L;  1SE2 A;  4XIG S;  2MFI A;  3S24 A;  2WAQ B;  3KDF A;  5IGD A;  1CKO A;  1G29 1;  2ZM6 L;  1XPO A;  1FGB D;  2AQ3 B;  3I55 A;  1G51 A;  1AZQ A;  1C48 A;  3HKZ B;  2X69 A;  3M4Y A;  2F0S A;  4AQY L;  3DLL A;  3MEH A;  2VNU D;  1OXV A;  4DF7 A;  3KF6 B;  1FJG Q;  5CR3 A;  2YV5 A;  1DGS A;  1X32 A;  3M4O B;  1FVI A;  4A3I H;  2JXM B;  2RF4 A;  4FF4 A;  4WFN 3;  3ERS X;  1W6J A;  4X3K A;  4NPS A;  1VQB A;  1TWC B;  5JPM C;  2EYJ A;  1LUZ A;  2H4O A;  2CVR A;  1HNZ Q;  1JE4 A;  1VQ6 A;  1G2T A;  1O7I A;  2G9D A;  4JW0 A;  1ENF A;  1KRT A;  2PNH A;  1VQE A;  1PA6 A;  1GUG A;  1R9T H;  2MQH A;  2ZXR A;  3D0F A;  3H3V I;  3RZD H;  4B9W A;  5C3E B;  3PIP 3;  4BWG B;  1E3P A;  4HTH A;  1LTS D;  2VXW A;  4P73 A;  1V1Q A;  4PV1 C;  1L2F A;  3SK8 A;  4A3G B;  4J1M A;  2B39 A;  1IYJ B;  3GV3 A;  2QDB A;  3D8G A;  4DUZ Q;  1A3T A;  4X3S A;  3UDG A;  4CKB A;  3ULL A;  4QB4 A;  1PYS B;  2PI2 A;  3MWY W;  2EY6 A;  3RD4 A;  5GAG C;  3H3V H;  1CHP D;  2K1B A;  3K8A A;  4HJ9 A;  2KCT A;  3C1F A;  3M4O H;  3U9S A;  4A3D G;  2AUK A;  4G7Z C;  1KDB A;  2VY3 A;  4ABN A;  4R8I A;  2V4D A;  5ISR A;  4GOP C;  1VQ9 A;  2KHI A;  2CQA A;  1TWC H;  4HMJ A;  1C9O A;  3MFY A;  1HXY D;  1IL8 A;  2JA6 G;  1J6Q A;  4DR1 Q;  4MN3 A;  1TXY A;  1UWV A;  5IYC G;  1MD2 D;  3KBX A;  3HGB A;  2CH4 W;  2ICE C;  1GUO A;  3FVQ A;  5JEA J;  3CKI B;  4LMQ D;  2EZV A;  1O7L A;  5IP7 H;  4C3J G;  2XWJ B;  1GO3 E;  1M8A A;  5GAH C;  1N9W A;  1XNQ L;  5C3E H;  4DN4 M;  4JI1 L;  4FF2 A;  5FO9 B;  1Z7T A;  3J7Z C;  2HUG A;  2L11 A;  4A3G H;  4GS3 A;  3MHB A;  4HCE A;  1PDQ A;  3VA5 A;  4BBS B;  4JI5 L;  1SJE D;  2NTS A;  1KLG D;  3QO2 A;  4NKL A;  2ZXO A;  1ICF B;  1X3G A;  4C1N K;  1XNR L;  1STE A;  2K7V A;  3NSW A;  4JBM A;  4GOP B;  3FPP A;  3F2U A;  2E2H B;  4X64 L;  1PZI D;  4LUZ A;  1AEX A;  4IPD A;  4BBR B;  1BVS A;  3Q24 A;  5GAD C;  2JE6 I;  4KHZ A;  5EKI A;  5C3X A;  4ZK9 B;  2LKV A;  1VQP A;  1GD7 A;  3VA7 A;  3K7A B;  1K0S A;  2N49 A;  4POF A;  1SR3 A;  2KOL A;  2F0T A;  4ME3 A;  4GKJ L;  1E2W A;  2BCO A;  4KK7 A;  2E5L L;  2F0H A;  2D9U A;  3D4D A;  1FYC A;  1WTX A;  1PVO A;  4EVO A;  1S5C D;  4DV5 L;  1I4P A;  4R4Q A;  1JJC B;  4BXX H;  4HJ5 A;  1VF7 A;  2K5Q A;  2LFN A;  4YHH L;  2JSO A;  3CC2 A;  2NN6 G;  2KEC A;  2SDF A;  3J7A 5;  3BZC A;  2VS1 A;  1PTO B;  3S1Q B;  1VQJ A;  1TS4 A;  4JI2 Q;  1SLJ A;  2B29 A;  2N78 A;  2E76 C;  3PO2 B;  2MNA A;  4BBS H;  1PYB A;  2O5J C;  2F0V A;  2ZJQ A;  3KLR A;  3DUZ A;  1IBK L;  4UY8 C;  3NUC A;  2GVA A;  1JOQ A;  3OWF A;  4P74 A;  2VB2 X;  1AE2 A;  2PMZ B;  1STY A;  3EBE A;  4DGZ A;  3K5O A;  4GOP A;  1ESF A;  4CHT B;  3S1N B;  1YJN A;  2Z8L A;  3PO3 G;  4BBR H;  3PUW A;  2CCZ A;  3DM3 A;  1RDP D;  2G9H D;  2KJX A;  3GV6 A;  2F1M A;  4TRD A;  1S5D D;  1XMO L;  4DR7 Q;  4HAE A;  3S2H B;  3U4Z A;  1LTT D;  3KLS X;  3K7A H;  2JN4 A;  1HUN A;  1RIP A;  4DV3 L;  1PV4 A;  2UXD Q;  4JI7 L;  3NQI A;  5LMN L;  1YIT A;  4OO1 G;  4IOC A;  4RCO A;  3NP8 A;  4TKO B;  1PTO F;  1EU3 A;  1QNU A;  5F2D A;  5FJ8 H;  2R92 B;  4PZ7 A;  3UDX A;  3DXJ C;  4BY1 G;  2BDO A;  1L0Y B;  4JYA Q;  1Q3L A;  3D6C A;  5M3M B;  2IX1 A;  1TVX A;  2B63 B;  2ZM6 Q;  2VUM G;  4ULL A;  2L15 A;  2Y0S G;  4RFB A;  1QB5 D;  1I6V C;  1X55 A;  3E5S A;  2R7Z G;  1PTO H;  3S1Q H;  4UPA A;  1VMP A;  5IGG A;  4DV0 L;  5KGU A;  2OQ0 A;  1EQQ A;  4AQY Q;  3PO2 H;  4KHV A;  3F2C A;  1AN8 A;  1SYE A;  3QB3 A;  4A4I A;  5ELB A;  4ALP A;  4F7X A;  3TP7 A;  3FDT A;  4YCV A;  1V8Q A;  2Z0S A;  1X65 A;  4B3R L;  1QVC A;  3QWN A;  3ZYY X;  3S1N H;  2NWG A;  2O4X A;  4HIM A;  1H9R A;  1PH7 A;  1J5E L;  1L0W A;  2PW5 A;  3SE0 A;  4H02 A;  1PTO D;  5GAE C;  4R4I A;  1IW7 C;  3S2H H;  4A3L H;  5HGQ A;  3MEF A;  3NK9 A;  4B3T L;  4HJ7 A;  4OHJ A;  4QCL A;  2J7Z A;  3FEW X;  4P2C B;  5I2Y A;  5IGF A;  3DEP A;  1LT3 D;  4BY7 G;  4DFA A;  4RMF A;  4GN5 A;  4IFD I;  2F4I A;  1TWH B;  2R92 H;  4JI3 L;  1EY9 A;  1JWM D;  4DNR B;  2MP1 A;  2B63 H;  1KNA A;  4JK1 C;  1YEZ A;  3VYU A;  5IE8 A;  3HOW G;  4EQ5 A;  1L1O B;  1P16 A;  2IPK D;  4LFC L;  4IJH A;  2F0U A;  3MFG A;  4DV7 L;  1Z47 A;  4GLA C;  1LT6 D;  2QIL A;  3PMF A;  1NR4 A;  3KLS A;  2FJ2 A;  3CF5 A;  2NZ1 D;  3CQZ B;  4IFD H;  1STH A;  4HCS A;  1HR0 Q;  2CW0 C;  3JAM c;  5KYL A;  3U9O A;  3TBI B;  3G48 A;  3IFT A;  4KKT A;  4B3M L;  3K5M A;  2A19 A;  1IXR A;  1OXU A;  1EIH A;  3PQI A;  4JCV E;  4DV4 L;  1HRJ A;  1CQV A;  1WYD A;  1VQI A;  4C3I G;  4A3E B;  2K03 A;  5C4Z A;  1IBM Q;  2J4X A;  2K5D A;  1UE6 A;  2B2W C;  1EWC A;  3M4P A;  2B2V C;  4IUR A;  4N9T A;  4RGT A;  5IP9 H;  1G91 A;  3TRZ A;  1TS2 A;  3MTS A;  4AIM A;  3TSS A;  4JI1 Q;  2TMP A;  2L1B A;  3CCL A;  1X54 A;  5KYI A;  1TWH H;  5GRO A;  1WTO A;  1KNE A;  2R61 A;  1BBW A;  4DR6 L;  3NEM A;  1QVG A;  4IOA A;  3WDN A;  3KYH C;  4JI5 Q;  1BR9 A;  4R9W A;  1K8M A;  2I46 A;  1ENC A;  3GDE A;  3P20 A;  1XNR Q;  1L1O A;  5IYB H;  5C3W A;  1PRT C;  5C0X J;  5EPL A;  1WTR A;  3W2D A;  1Y1W H;  4X64 Q;  2CHB D;  1ASZ A;  1SDF A;  3OOC A;  4QUC A;  2AWO A;  3A54 A;  3CQZ H;  1EEF D;  1KLU D;  4A3M B;  2GA4 B;  4A3I G;  3KLW A;  1D6E C;  3E6Z X;  4NP5 A;  1BBU A;  2F3I A;  3FKI G;  4L6T B;  5KND A;  3JAM E;  1KRS A;  1PFM A;  1TU2 B;  1WTW A;  1AZP A;  5G3L D;  1H9K A;  4GKJ Q;  1U9R A;  3T4A C;  2HDM A;  1HNX Q;  4JVZ A;  2IY5 B;  1YNJ C;  2QEX A;  2I0Q A;  1TT2 A;  3K80 C;  1GUW A;  5C4X B;  1EFI D;  5J1Z A;  1LTL A; 
#chains in the Genus database with same CATH homology
 4LUO A;  1S72 A;  4TQU S;  5DLQ E;  1SRU A;  1VQC A;  4A3C G;  2FXQ A;  2VQE L;  5BR8 Q;  4DK3 C;  4C3I H;  4PMW A;  1VQ5 A;  4LF6 L;  4DR7 L;  4O0A A;  4HIK A;  4DR3 L;  2IT1 A;  5LMN W;  2PQA B;  2WAQ G;  1QZG A;  5M3F G;  3STB D;  5J3B A;  2JA7 H;  2JK8 A;  2HQL A;  2UXD L;  1HR0 W;  5M5Y H;  4C3H H;  4YY3 Q;  3AFP A;  3CPF A;  1M1K C;  3HFZ B;  5JEA G;  4JI0 Q;  4LF8 L;  3HOY G;  3PSI A;  5IYB G;  4AYB G;  3M7N A;  4A3B G;  4DV4 Q;  1JB7 A;  1VCI A;  5IT9 c;  1EIY B;  3HKZ G;  2K14 A;  1HZ9 A;  3G71 A;  2F4V L;  4LFA L;  4DNI A;  2OTJ A;  1HH2 P;  3PIP A;  4A3J G;  1IL2 A;  1NJI C;  1VQ8 A;  1LYL A;  2YTY A;  3W5O A;  1Y1W G;  3B6Y A;  2LSS A;  4JYA L;  4X62 Q;  4X65 L;  2UXC Q;  2BH2 A;  4XIG S;  2MFI A;  3S24 A;  4DUY Q;  1Q86 C;  1CUK A;  3KDF A;  2QGQ A;  1CKO A;  1G29 1;  5LMU L;  4IFD G;  2ZM6 L;  1XPO A;  4A3M H;  3I55 A;  2HIV A;  1M90 C;  1G51 A;  1UE1 A;  3HOV H;  3UE0 A;  3F2B A;  4APV A;  3F2D A;  2MO1 A;  2A8V A;  1Q12 A;  4DR5 Q;  1X6O A;  4JI7 Q;  5LMN Q;  4AQY L;  3UDF A;  2DUD A;  4KHP Q;  4DR4 Q;  3DLL A;  2UUA Q;  2VNU D;  2R7F A;  1OXV A;  1IZ6 A;  1B70 B;  2ALY B;  3KF6 B;  1SE8 A;  3KJO A;  1FJG Q;  2YV5 A;  1DGS A;  4JI8 L;  3GTL H;  2Y0S E;  1FVI A;  4A3I H;  2ZTE A;  2YU9 H;  4HJA A;  1VQK A;  2RF4 A;  3CXC A;  1N33 Q;  3M85 A;  5C4X H;  5GQO A;  4A3D H;  1D7Q A;  3ERS X;  5IP7 G;  2AKW B;  1N34 L;  1MKH A;  2VQF Q;  4LF5 Q;  3A74 A;  4GKK L;  5IWA L;  4NPS A;  1PFS A;  4YCW A;  1HNW L;  1VQB A;  5C3E G;  4DAM A;  1CSQ A;  4J15 A;  1XJV A;  3HOX G;  1LUZ A;  1HNZ Q;  4DV1 L;  1VQ6 A;  3I4M G;  3J81 j;  2JA7 G;  3S16 H;  4DV0 Q;  1O7I A;  1PH1 A;  3M4Q A;  1I5F A;  2PQA A;  1KRT A;  1N32 Q;  3E9I A;  2PNH A;  1VQE A;  1UE7 A;  4EX5 A;  1PA6 A;  1R9T H;  1K8G A;  1YVC A;  4LF9 L;  4JOI C;  2XTI A;  4A93 H;  2MQH A;  4NXM Q;  1EQR A;  3D0F A;  1UE5 A;  1I94 Q;  4YWK A;  3H3V I;  3RZD H;  3AEV A;  4C3J H;  4Y52 H;  1Y14 B;  1OXS C;  2EQS A;  1AH9 A;  1NMG A;  1E3P A;  4PZ8 A;  3TRE A;  5FLX c;  1TWF H;  3WWV A;  1N36 L;  4B3R Q;  4IPH A;  4P73 A;  1V1Q A;  1WJJ A;  4RG1 A;  2ASB A;  1YJ9 A;  3S15 H;  1L2F A;  3W1B A;  3FP9 A;  4A3M G;  1A8V A;  1IYJ B;  2E2H H;  4DKA C;  4DUZ Q;  3HOY H;  3HOV G;  3HKS A;  3UDG A;  3ULL A;  2VQE Q;  1PYS B;  2PI2 A;  1E22 A;  1JE5 A;  3RN5 A;  1VQD A;  1I50 H;  1CKM A;  1VQH A;  4OON A;  5GAG C;  4B3T Q;  3H3V H;  2R7D A;  3K8A A;  3PUY A;  2KCT A;  4HJ9 A;  4QIW E;  4LF8 Q;  4TVA B;  3RZO H;  5K36 G;  2ZTD A;  3M4O H;  1Y1V H;  3GTO H;  2UXB Q;  1YJW A;  4A3D G;  2VY3 A;  5ELN A;  4DAY B;  4JI3 Q;  3PF5 A;  4JI2 L;  3GTM H;  1TWA H;  2V1C C;  3CCM A;  2CKZ B;  2EIF A;  1MJE A;  2N8N A;  1A62 A;  4GOP C;  2NN6 I;  2KHI A;  1GKH A;  1VQ9 A;  1A0I A;  1KHI A;  1YHQ A;  2NVX H;  1TWC H;  2ATW A;  1C9O A;  4JBK A;  1SFO H;  4OX9 L;  4PZ6 A;  3BJU A;  2CWA A;  2JA6 G;  1WCM G;  1J6Q A;  4DR1 Q;  1JJ2 A;  4NB3 A;  1TXY A;  4IOA A;  2RHQ B;  1UWV A;  2ZTC A;  4XTC S;  5IYC G;  4LFC Q;  4LNQ A;  4LUV A;  3ZJY C;  2BA1 A;  1KIX A;  5JEA J;  2E2I H;  1NY4 A;  5IP7 H;  3GTQ H;  3CP0 A;  3D31 A;  1YIJ A;  3CC4 A;  3RR5 A;  1PH5 A;  1VQL A;  4BBS G;  4X66 L;  5C4J H;  2Q2U A;  1S40 A;  4JI4 L;  1GO3 E;  3L2P A;  5GAH C;  1N9W A;  3OYY A;  1XNQ L;  3KFU A;  5C3E H;  2JA5 H;  4L5R C;  4JI1 L;  3K0X A;  4A93 G;  4JG2 A;  3HOX H;  4P71 A;  3CD6 A;  4K0K L;  5EAY A;  3J7Z C;  2F52 A;  2KBN A;  2N3S A;  4B3M Q;  3I4M H;  3OTO L;  2Q2H A;  4QQB X;  4KLK A;  1W3S A;  4IPC A;  1QUQ B;  4JV5 L;  1IBL L;  4O2D A;  4A3G H;  4GS3 A;  1YI2 A;  1N34 Q;  1YZ6 A;  2UUB L;  2ID0 A;  4JI5 L;  3TEH B;  1PH4 A;  1Q8K A;  1N8R C;  1LM0 A;  3KF8 B;  3TS0 A;  1EUJ A;  2K5V A;  1P8L A;  2OCE A;  3IRB A;  1X3G A;  2VL6 A;  5M5X H;  4QGU A;  2WFW A;  4DV2 Q;  4OWT B;  1XNR L;  4JBM A;  1KAW A;  1V9P A;  4OO1 I;  4LF7 L;  1WFQ A;  4GOP B;  3NEL A;  2UU9 L;  4X64 L;  2HHH L;  3GD7 A;  1Y1V G;  4IPD A;  4LUZ A;  4HJ8 A;  1Q7Y C;  4B3S Q;  1BVS A;  3I56 A;  2MO0 A;  2JE6 I;  5GAD C;  2D0P A;  4KHZ A;  4QY7 A;  4LW1 A;  3JC6 6;  3PUX A;  1VQP A;  1XMQ Q;  1GD7 A;  4DR6 Q;  3I2Z A;  2N49 A;  3EIV A;  3EN2 A;  3ULJ A;  4POF A;  1SR3 A;  1KD1 C;  4JOI A;  4ME3 A;  5M3M H;  5JJL A;  2KHJ A;  4GKJ L;  1BKB A;  3G4S A;  3T1Y Q;  4GLX A;  3F8T A;  2LXJ A;  3U4V A;  2E5L L;  4LFB Q;  1TWG H;  3U58 A;  1K9M C;  1PVO A;  4DV5 L;  1E24 A;  4YCU A;  4A75 A;  4R4Q A;  4NXN L;  5H1S E;  3T1H Q;  1JJC B;  4BY1 H;  4HJ5 A;  2JA5 G;  4BXX H;  1X56 A;  4YHH L;  1YBY A;  4POG A;  5JJK A;  1K8A C;  2BA0 A;  3RLO A;  2NN6 G;  3CCV A;  3CC2 A;  2VUM H;  1VQ4 A;  2JA6 H;  3J7A 5;  5BR8 L;  1WCM H;  3BZC A;  2VS1 A;  4KI0 A;  1VQJ A;  4A3G G;  1EIF A;  4BA1 I;  5IYC H;  4JI2 Q;  2R93 H;  1QUQ A;  2RHS B;  2B29 A;  1SLJ A;  2N78 A;  4UP9 A;  5AJ3 L;  2Q2T A;  1E1T A;  2MNA A;  2JEB I;  4BBS H;  1PYB A;  1NTG A;  2NZO A;  4YY3 L;  1QVF A;  4OXP A;  1KL9 A;  2ZJQ A;  1OTC A;  4LF4 Q;  5FLM H;  1IBK L;  4UY8 C;  1KQS A;  3PUV A;  1MIU A;  2GVA A;  3PGZ A;  4P74 A;  4A3L G;  1AE2 A;  3EBE A;  4GN3 B;  4GOP A;  3A5U A;  2K4K A;  4X62 L;  4JBJ A;  1VQA A;  2WAQ E;  2UXC L;  2H5X A;  1NBW A;  5ELO A;  1YJN A;  3PO3 G;  1UEB A;  4X66 Q;  4BBR H;  3PUW A;  2CCZ A;  3PIO A;  3DM3 A;  4JI4 Q;  3HOZ H;  3S1M H;  1XNQ Q;  1AE3 A;  2I5H A;  4AYB E;  5M5W H;  1XMO L;  4LF6 Q;  3S2D H;  3HKZ E;  2JEA I;  2R92 G;  4DR7 Q;  4GLV B;  4DR3 Q;  2OWO A;  4Y7N H;  3U4Z A;  2QA4 A;  1E1O A;  3KOJ A;  5M3M G;  1EOV A;  2E2J H;  1D8L A;  3K7A H;  2IHE A;  2KCM A;  1RIP A;  4DV3 L;  4DR5 L;  1FGU A;  2XGT A;  1HJP A;  4JBW A;  2E8G A;  5LMN L;  1YIT A;  1PV4 A;  4JI7 L;  3S14 H;  4DR4 L;  4OO1 G;  3CCS A;  2AWN A;  4IOC A;  1YNX A;  2WB1 G;  2D62 A;  1QZH A;  1HR0 L;  3I4O A;  1FJG L;  1VS0 A;  3KJP A;  2CFM A;  4DV6 L;  4QJF A;  2F4V Q;  2Z6K A;  3F1Z A;  1PH2 A;  4LFA Q;  4DPG A;  3CPW A;  4BY7 H;  1G6P A;  5FJ8 H;  4PZ7 A;  3UDX A;  4BY1 G;  1N33 L;  4BXX G;  4JYA Q;  4X65 Q;  1XPU A;  4LF5 L;  4HID A;  2VQF L;  2IX1 A;  1JMC A;  2JA8 H;  1Q81 C;  5C44 H;  4P72 A;  3UE1 A;  2ZM6 Q;  5LMU Q;  2HHH Q;  3A0J A;  2CWP A;  2VUM G;  2L15 A;  1K3R A;  2Y0S G;  4R4C A;  4A76 A;  1X55 A;  1PH6 A;  3SGI A;  2R7Z G;  4GNX C;  3MXN B;  3PV0 A;  1HNZ L;  1IBM L;  2R93 G;  3S1Q H;  1Z9F A;  4DR2 L;  4UPA A;  1Q1E A;  4DV0 L;  2JQO A;  1NMF A;  2OQ0 A;  3GTJ H;  1XPR A;  1EQQ A;  4AQY Q;  1VQO A;  3PO2 H;  2WP8 J;  4P75 A;  3F2C A;  3L0O A;  5C0X G;  5FLM G;  4NXM L;  4ALP A;  4UP8 A;  4A4I A;  1VQN A;  4JI8 Q;  1I94 L;  3RN2 A;  2Z6K C;  2K75 A;  2I5L X;  1GVP A;  1KC8 C;  4MZ9 A;  2E5L Q;  1HZA A;  2ES2 A;  1X3F A;  3ULP A;  2JJQ A;  2Z0S A;  4YCV A;  1C0A A;  4A3E H;  3ICE A;  2HT1 A;  1X65 A;  4AH6 A;  1OXT A;  4B3R L;  4JI6 L;  1I3Q H;  1QVC A;  5IP9 G;  1EYG A;  4DV5 Q;  1C7Y A;  4PG3 A;  4BBR G;  4GKK Q;  5IWA Q;  3S1N H;  1HNW Q;  3W1G A;  4HIM A;  3HOZ G;  2LXK A;  3Q8D A;  1L0W A;  2EXD A;  4DUZ L;  4YHH Q;  1PH7 A;  4GN4 B;  1J5E L;  5IYD H;  4H02 A;  1H95 A;  2B3G A;  5GAE C;  4DV1 Q;  4R4I A;  1K0R A;  3RLN A;  3S2H H;  4A3L H;  3PUZ A;  1T9H A;  4FDB A;  5HGQ A;  2ZJP A;  1OXX K;  4JV5 Q;  3MEF A;  4A3F G;  5AJ3 Q;  4HJ7 A;  4B3T L;  2CQO A;  4LF9 Q;  2GN5 A;  2GVB A;  1JT8 A;  3NBH B;  3I7F A;  3STB C;  4IPG A;  2NVQ H;  3PO3 H;  1HZC A;  3BZK A;  3CCU A;  4WJ4 A;  4BY7 G;  5FJ8 G;  4GNX B;  1YHA A;  1IBK Q;  4QL5 A;  4RMF A;  4GN5 A;  4IFD I;  2UXB L;  1N36 Q;  2R92 H;  4JI3 L;  4MTN A;  3H0G H;  3I4N H;  2JA8 G;  5C44 G;  2VW9 A;  1JJG A;  1SN8 A;  2UUC L;  2IX0 A;  4R4O A;  4OWX B;  1ASY A;  2B63 H;  3HOU H;  3BU2 A;  3U50 C;  1HNX L;  5IY0 A;  1PHJ A;  1YEZ A;  5IE8 A;  3HOW G;  4X6A H;  2WB1 E;  1Q46 A;  3TQY A;  4EQ5 A;  4DR1 L;  5C0X I;  1L1O B;  1P16 A;  2K52 A;  1XMO Q;  3PO2 G;  4LFC L;  4IJH A;  3GTK H;  1S3O A;  3CCJ A;  4DV7 L;  1Z47 A;  2AHO B;  3E0E A;  4GLA C;  3UDI A;  1K73 C;  2OTL A;  2NVY H;  1B7Y B;  4DV3 Q;  1CSP A;  3CF5 A;  1CKN B;  4L5T A;  4UP7 A;  2IHF A;  1HR0 Q;  1K83 H;  3JAM c;  2OQK A;  3AQQ A;  3E9H A;  4YWL A;  3H15 A;  4DV6 Q;  4A3E G;  1VQ7 A;  3G48 A;  2R7Z H;  2YYZ A;  3J80 c;  5JJI A;  4B3M L;  4L5Q A;  4HIO A;  2KEN A;  2A19 A;  1IXR A;  3FKI H;  5IYD G;  2C35 B;  2ZJR A;  1OXU A;  4JI0 L;  3CCR A;  4JCV E;  3G6E A;  4DV4 L;  4OX9 Q;  2D0O A;  1WYD A;  1VQI A;  4BA2 I;  2DGY A;  1VQF A;  3CMA A;  4DV2 L;  1V43 A;  1IBM Q;  3RNU A;  1KXL A;  5E7N A;  4R1J A;  1WI5 A;  1VQG A;  4DR2 Q;  4A3K H;  1VQM A;  3GTG H;  3TS2 A;  1UE6 A;  3JAM i;  4DUY L;  2HIX A;  5IP9 H;  1NE3 A;  1EWI A;  3M4P A;  1Q82 C;  2VZA A;  4L5S A;  3TRZ A;  3J80 i;  4LWC A;  3PF4 A;  3PCO B;  2BH8 A;  1SRO A;  1HZB A;  3M9B A;  2R6G A;  4JI1 Q;  4AIM A;  1X9N A;  4GNX A;  4B3S L;  2PI2 E;  2RCN A;  3CC7 A;  3H0G G;  2NVT H;  3L7Z C;  3CCL A;  1X54 A;  2K50 A;  1XTD A;  3I4N G;  1TWH H;  4A3C H;  5GRO A;  4K0K Q;  3OTO Q;  4IFD J;  4R4T A;  1BBW A;  1XMQ L;  3NEM A;  1QVG A;  1IBL Q;  2B63 G;  3S1R H;  1W2B A;  4JI6 Q;  3HOU G;  4DR6 L;  4KHP L;  1I6H H;  2UUA L;  2UUB Q;  1A63 A;  4A3F H;  3KYH C;  1Q1B A;  4JI5 Q;  3GO5 A;  3J81 c;  5M3F H;  3T1Y L;  1J5E Q;  5HY6 A;  2JA9 A;  4IJL A;  3AFQ A;  3GDE A;  1XNR Q;  4LFB L;  1L1O A;  5IYB H;  4A3B H;  3CCQ A;  5C0X J;  2K5N A;  3OW2 A;  4LF7 Q;  1WOC A;  1X3E A;  1MJC A;  3FHW A;  2UU9 Q;  3M3Y H;  1B8A A;  4A3J H;  4DK6 C;  2K5H A;  1GM5 A;  1Y1W H;  1U5K A;  4X64 Q;  3T1H L;  1ASZ A;  1CKN A;  3KDF B;  1FL0 A;  2AWO A;  3CQZ H;  1U0L A;  3ER0 A;  1E7Z A;  3KF6 A;  4A3I G;  3KLW A;  3HOW H;  3LGJ A;  2AMC B;  2NZH A;  4JC0 A;  1BBU A;  2UXD Q;  2YTX A;  3J81 i;  5C4X G;  2F3I A;  3FKI G;  1N32 L;  1PH3 A;  1KRS A;  3K7U C;  2A1A A;  2Q2I A;  1PH8 A;  3GTP H;  4GKJ Q;  3CW2 C;  2UUC Q;  3VDY A;  4WJ3 M;  1HNX Q;  3K81 C;  4LF4 L;  1EFW A;  4IO9 A;  3S17 H;  2IY5 B;  2QEX A;  3CCE A;  3AYH B;  2I0Q A;  1L1O C;  4A3K G;  3A5Z B;  3K80 C;  1YHB A;  2YTV A;  4MNO A;  1SMX A;  3CME A;  1PH9 A;  2PMZ E;  4OWW B;  2I5M X;  3RLF A;  1RL2 A;  3NEN A;  4DV7 Q;  4NXN Q;  4C2M H;  3CAM A;  4YWM A;  1LTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...