3WWVA

C-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
64
structure length
64
Chain Sequence
RTGKEEMIGLIGTVVEELNPEGMIKVRGELWKARSKFNGKIEKGEKVRVVDMDGLTLIVVRERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords Stomatin operon partner protein
publication title Crystal structure of the stomatin operon partner protein from Pyrococcus horikoshii indicates the formation of a multimeric assembly
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
total genus 17
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2014-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3wwvA00
4R4OA 1ASYA 2EIFA 3TS0A 3HOUH 1VQKA 1PH7A 2Y0SE 2KHJA 2L15A 2A1AA 3PO2G 3J7A5 1X55A 1J5EL 2Q2IA 1GO3E 2LXJA 1OXUA 3L0OA 3HOXH 3CF5A 4DR6L 2IT1A 5LMNQ 1HR0W 4GKJL 5AJ3Q 5IYBG 1IBKL 1YVCA 3HFZB 4B3ML 4BY7G 1E7ZA 3M3YH 4DV2Q 4HJAA 4L5QA 4DNIA 2F4VQ 1LYLA 2ZJPA 2HQLA 5GAGC 5M5WH 1W2BA 1JT8A 3M7NA 1VQIA 1SN8A 1UE6A 3TEHB 3D0FA 2Q2UA 1P8LA 4LF7L 1EIYB 3HOWG 1BVSA 3GD7A 4HIMA 1ASZA 3F2BA 3OTOL 3S2HH 1V43A 2Z6KA 3FHWA 1SLJA 4BBRG 3DLLA 4IO9A 3CCVA 1KHIA 4C3JH 4DR1L 2CFMA 5IYDG 5LMNW 1N36Q 1OXSC 4JI6L 2IX1A 4P75A 1FVIA 1UE1A 3RLFA 1VQ7A 1VQ6A 3BU2A 1VQMA 1IZ6A 1YI2A 4A3LG 4A3FH 2A8VA 3H0GH 3VDYA 1CKNB 2JA8G 2VZAA 5IYDH 4IOCA 1UE5A 2RCNA 4AIMA 1FJGQ 3PCOB 4WJ4A 4NXNQ 4B3TL 2VNUD 3KDFB 4A3JG 4UY8C 4IOAA 3MXNB 4IPDA 2HT1A 4X64L 4LF6Q 1WJJA 1IBMQ 3M4OH 2JQOA 2WAQE 2VS1A 4P72A 2N49A 3EBEA 1WYDA 4LF4L 4JI8Q 4OXPA 3HOZG 1B8AA 4A3JH 4LNQA 4MZ9A 1T9HA 1QZHA 4JI2L 4UP9A 4GOPB 5FJ8H 2JEAI 3CQZH 3M9BA 2ASBA 3I4NG 2IY5B 3IRBA 3B6YA 4DV7Q 1Q7YC 4LUVA 3HOZH 2KBNA 1CKNA 4IPCA 3PF5A 4JI5Q 4AQYQ 4A3DH 2ZTEA 2E2JH 4HIOA 2C35B 1SMXA 4DV0Q 4DK6C 1VQPA 4LFAQ 2BH8A 5GQOA 4DAYB 1SFOH 1VQBA 5JEAJ 1KD1C 3I4NH 3KDFA 2MO1A 1E1OA 2YV5A 4JI4Q 1TXYA 5C0XG 1VQFA 5BR8L 3ULLA 1X9NA 5FLMG 4AH6A 4QJFA 4JI0L 4NXML 3Q8DA 4HIKA 4J15A 1JB7A 3GTPH 3RR5A 2VY3A 1PA6A 4A3MG 2UXCL 2A19A 3U4VA 4GNXC 2WP8J 2K14A 2BH2A 4B3RL 2R6GA 4GOPA 1G291 1VQNA 4JBKA 4X62Q 1FGUA 1Q1BA 4YWLA 5IYCG 3GTJH 4JI7Q 4PZ7A 4JBJA 1KAWA 2JA7G 4JV5L 2K52A 4A3MH 1EQQA 4RG1A 4IJLA 3PUXA 2CWPA 4DV6L 2I5MX 1YEZA 3A0JA 2PI2E 5IYCH 1G51A 4YHHQ 3A5UA 2E5LL 5C4JH 3NENA 4GLXA 2Y0SG 1K73C 5ELOA 4DUYQ 2NVQH 3T1YL 3RZDH 2PMZE 4DR7Q 3CC2A 4NXNL 4IJHA 1E24A 1NY4A 2UXDL 1D7QA 2AMCB 4LF9L 1I94L 1JJGA 1WI5A 1G6PA 2F52A 1KRSA 4R4TA 2UU9Q 3HKSA 3GTGH 3CCLA 4L5RC 2BA1A 2ZJRA 1HR0L 3S17H 4GKKQ 1N32Q 5C4XH 3CCEA 1WCMH 4A76A 2GN5A 1VQ8A 2E8GA 4HJ7A 2GVAA 4OWXB 5C0XI 3U58A 3E9HA 3M4PA 1RIPA 2PQAB 2YTYA 4YCUA 1C7YA 1IL2A 4BY7H 1GKHA 4DV7L 4RMFA 2UXBL 1YBYA 2ID0A 1C9OA 3PO3H 1SROA 4A93H 3PSIA 4A3CH 4LFAL 5J3BA 4BA2I 3K8AA 2Q2HA 5IP7H 2VQEQ 1L0WA 2JA9A 1YHBA 1PH6A 3PIOA 2I5HA 1XMOL 3I4MH 4LF5L 3KFUA 4C3HH 4DKAC 3G6EA 3M4QA 4WJ3M 2OCEA 1YHQA 2N78A 4P71A 2N3SA 3CMAA 1VQJA 3HOYG 2Q2TA 2WAQG 1HNZQ 3H3VI 1VQ9A 2PQAA 4R4CA 4DV5Q 1KIXA 2IHFA 2DUDA 1XMQQ 3UDFA 1Y1WG 1HNXL 4OX9Q 1LTLA 3I7FA 1XNRQ 1PYBA 1XPOA 1WOCA 1Y1VG 3HOYH 3FKIG 4JI3Q 1PFSA 1XPRA 4JCVE 1QVGA 1Y1WH 2AHOB 3DM3A 3A74A 3KJPA 3S2DH 1I5FA 2PI2A 3CPWA 1OTCA 3PO2H 4DR5L 1Q86C 3NELA 1E3PA 3S16H 3FKIH 3F2DA 4A3EG 1YJ9A 3RLOA 5FLXc 1EQRA 1N33Q 4DR3L 5IYBH 1HH2P 1NBWA 1VQHA 1Y14B 1SRUA 2GVBA 2CCZA 4P74A 1CSQA 1A62A 2RHQB 3CCJA 4GKKL 1N32L 2NZHA 4X66L 4DUZQ 4A3EH 1EIFA 2R93G 2R7DA 2JA6G 1KRTA 1W3SA 3KF6B 4O2DA 3TQYA 4B3SL 3HOWH 2H5XA 3E9IA 2NVXH 4Y52H 2HHHL 3BZCA 2UUAQ 5ELNA 4BBRH 5M3FG 3HKZE 2B29A 2WB1E 4HJ9A 3BZKA 4KHZA 4YWKA 4DV4L 1X3FA 1PH5A 3CAMA 3JC66 1YHAA 1YZ6A 3SGIA 2I0QA 2D0OA 1N34Q 4JI1L 3K0XA 4A4IA 1K8AC 2MFIA 3NEMA 4ME3A 4A3LH 2CQOA 5M3FH 4HIDA 4XIGS 5C0XJ 1NMGA 1XNQL 4DR4L 5LMUQ 1TWAH 4AYBE 2UUCQ 3S15H 5JJIA 3CC4A 4LFCL 3T1HQ 3KF6A 4LUZA 4OONA 2B63G 5IWAQ 2R92G 4L5SA 3TS2A 3NBHB 1J6QA 1XMQL 1D8LA 4QY7A 4LF8Q 3AFQA 1K8GA 5IE8A 3J80i 4GNXB 1M1KC 3J81j 2B63H 3CCSA 4BA1I 2R92H 1VQAA 4A75A 4YY3Q 4UPAA 5M5YH 4JC0A 5LMNL 5AJ3L 1HZCA 2VQFQ 2OTLA 3I56A 4BBSH 2ALYB 2JEBI 3H15A 4DV2L 1R9TH 5GADC 3M85A 2F4VL 1MKHA 4PMWA 4IPGA 4KLKA 2ZM6Q 4QQBX 1LM0A 1I50H 2MQHA 5FLMH 4A3BG 3TRZA 2D0PA 1M90C 1FL0A 2YTVA 4JOIC 1EOVA 1VQOA 2JA5G 4IFDG 4K0KQ 2NVYH 3RN2A 3ERSX 3S24A 1O7IA 3UDGA 2RHSB 2CWAA 4GNXA 1N36L 4A3BH 3PV0A 2ZTDA 1HJPA 2XGTA 1QZGA 4H02A 3TREA 2KCTA 4JBWA 2JA7H 4LFBQ 3RZOH 4DV1Q 4JYAQ 1IXRA 3CCQA 2UUBQ 3PUZA 1AE3A 1FJGL 2V1CC 4BY1G 1X6OA 1KL9A 1QVCA 1HZ9A 3H3VH 1CUKA 2I5LX 3UDXA 5C44G 3G71A 4NB3A 1IBML 4LF6L 4A3IG 1JJ2A 4JI8L 3UE0A 3S1QH 1X56A 1J5EQ 4DR6Q 2PNHA 4GS3A 1NMFA 1VQEA 1SE8A 1VCIA 3K7UC 3UE1A 5C44H 4PZ6A 3CCMA 3J80c 1JMCA 1IBKQ 4GKJQ 2JJQA 4B3MQ 4YCWA 3S1MH 1XJVA 1JJCB 2NZOA 1N9WA 4JI5L 4C2MH 1RL2A 4AQYL 4LF8L 4DV0L 4GN5A 1UEBA 1X3GA 1X54A 2XTIA 4LF7Q 4LWCA 3STBD 1LUZA 4JI4L 1PH1A 3PUWA 1B7YB 2WB1G 4R4QA 3K7AH 1Q12A 4TVAB 4BBSG 4IFDI 1VQGA 3LGJA 3WWVA 4DR1Q 1SR3A 2FXQA 4UP7A 5DLQE 3L2PA 2ES2A 5IY0A 2K5NA 4QGUA 1A8VA 1UWVA 1YIJA 1JE5A 5C3EG 4X6AH 1TWCH 3K81C 4IPHA 4X62L 1MIUA 3AEVA 4JI7L 3RNUA 3J81i 3FP9A 1CKMA 1PHJA 1HZBA 3S1NH 1PVOA 3E0EA 4B3TQ 1AE2A 4HJ5A 3KJOA 1V9PA 2R7ZG 3I4OA 1K9MC 4O0AA 4X64Q 4YHHL 3HOVG 3KF8B 1I6HH 4DPGA 2VL6A 4LF4Q 4POGA 1Y1VH 4DUYL 2E2HH 5K36G 1GVPA 1U0LA 3HOUG 5E7NA 3CCRA 3ULJA 4DR7L 4JI2Q 3HOVH 1Q82C 3HOXG 1U5KA 4X65Q 2UU9L 3GDEA 2IX0A 1NJIC 5GAHC 3EN2A 4POFA 4OWWB 4LFBL 2K4KA 1X65A 1OXVA 3K80C 2AWNA 4MTNA 1K3RA 2AKWB 3JAMi 1KQSA 5BR8Q 1C0AA 1I3QH 1Q81C 4KI0A 1E1TA 1GM5A 2Z6KC 4JI0Q 4NXMQ 1BBUA 2R93H 2JA6H 1NE3A 1TWGH 1TWHH 2HIXA 2UXCQ 2KCMA 3AQQA 1V1QA 4BXXG 4B3RQ 1P16A 1AH9A 3KOJA 4JG2A 3GTMH 2VQEL 1HZAA 2WFWA 5JJKA 5JJLA 3PGZA 3PUVA 3J7ZC 4JV5Q 1A63A 4A3FG 1Q1EA 3H0GG 1S3OA 4BXXH 3J81c 4C3IH 4DV6Q 4KHPQ 1K0RA 4PZ8A 5GAEC 2E5LQ 1HNWQ 1HNZL 2QA4A 4DV5L 3OW2A 1IBLQ 1B70B 2NN6G 4OX9L 3A5ZB 1MJCA 3CCUA 1VQLA 2HIVA 1XNRL 4EX5A 1L1OB 4MNOA 3T1YQ 1WFQA 4GN4B 4IFDJ 2QEXA 2F3IA 4LUOA 1S72A 2UXDQ 2MNAA 4LF9Q 4JI3L 1I94Q 1VQ5A 2OTJA 1S40A 1UE7A 3S1RH 4QIWE 5FJ8G 1CKOA 2CKZB 2N8NA 2OQKA 2YTXA 3OYYA 2K75A 1HR0Q 3KLWA 3W1GA 5GROA 1L1OC 5IP9G 1TWFH 4A3DG 1YNXA 1OXXK 1N33L 1Z47A 2R7FA 4L5TA 2E2IH 1VQ4A 4R1JA 4X65L 2UXBQ 5IP9H 1QUQB 3JAMc 3I2ZA 1E22A 3CP0A 4DUZL 1L1OA 4APVA 3F2CA 4UP8A 4GOPC 3AYHB 4GLVB 4XTCS 3RN5A 3CW2C 4DK3C 4DR2Q 1KC8C 3RLNA 2ZTCA 1XMOQ 3L7ZC 1YJWA 2JA5H 2UUAL 1VQDA 4LF5Q 4JOIA 2D62A 4DV3Q 2AWOA 1PV4A 2LXKA 3MEFA 4ALPA 1YITA 3GTOH 1N34L 3F1ZA 3PIPA 3CMEA 3AFPA 2YYZA 1PH9A 2NN6I 3PF4A 4A3GG 1A0IA 4P73A 1BKBA 1BBWA 1HNXQ 3G4SA 2YU9H 3GTLH 1CSPA 1QUQA 5LMUL 4JBMA 3STBC 2UUCL 4BY1H 5JEAG 1PH3A 3UDIA 5M5XH 2K50A 4KHPL 1Q46A 1N8RC 4A3GH 3T1HL 2KHIA 2KENA 2NVTH 1H95A 5HY6A 5IWAL 4R4IA 1EYGA 4OO1G 2BA0A 4A3IH 2B3GA 1HNWL 2EXDA 4GN3B 1IBLL 2VUMG 1PYSB 4DR5Q 4A3KG 4PG3A 2ZJQA 5H1SE 3ULPA 1EFWA 2LSSA 1Q8KA 5C4XG 1KXLA 3F8TA 1YJNA 4DR3Q 1WCMG 1NTGA 1EUJA 2QGQA 2EQSA 2MO0A 3W1BA 4YY3L 3HKZG 1Z9FA 2DGYA 2RF4A 4A3KH 3OTOQ 2VQFL 2ATWA 2VUMH 3GTQH 1K83H 3CPFA 5HGQA 4YWMA 4GLAC 4OWTB 4X66Q 1PH4A 1VQCA 3CD6A 3CC7A 2JE6I 1PH8A 3PO3G 3S14H 4B3SQ 2ZM6L 4A3CG 4A93G 2OQ0A 5EAYA 2K5VA 3ZJYC 1XPUA 1QVFA 2HHHQ 3BJUA 1DGSA 1L2FA 2Z0SA 3ER0A 5IT9c 5IP7G 1X3EA 1GD7A 3I55A 4JI6Q 4DAMA 1PH2A 3EIVA 4AYBG 3G48A 3U50C 3U4ZA 4DV4Q 3I4MG 4K0KL 1VS0A 4FDBA 4JI1Q 4EQ5A 2JK8A 5C3EH 2JA8H 4NPSA 1XTDA 3GO5A 4QL5A 3PUYA 4DR2L 3W5OA 2K5HA 4HJ8A 1XNQQ 1EWIA 2IHEA 5M3MG 4DV1L 1MJEA 4DR4Q 2OWOA 2UUBL 1OXTA 1IYJB 4DV3L 4JYAL 3KYHC 3CXCA 2VW9A 4YCVA 2R7ZH 3D31A 4LFCQ 4LW1A 4TQUS 4Y7NH 3ICEA 3GTKH 4OO1I 5M3MH
chains in the Genus database with same CATH superfamily
4PV1C 1GUOA 2KQ3A 4R4OA 2EIFA 1RCVD 1PFMA 1EZ8A 5CV4A 3VR2A 1LTBD 5FLXE 1TU2B 3CF5A 2D9UA 5M5YB 1UEAB 2IT1A 5AJ3Q 1IBKL 1YVCA 4B3ML 3L9AX 1R9TB 3KK7A 3D4WA 1QWYA 3DEPA 2ZJPA 1CZWA 1KLUD 4DFAA 1VQIA 1ESRA 3NWTA 4LF7L 1SNCA 4N9TA 4HIMA 1SYDA 1V43A 2Z6KA 1KHIA 3MXGA 2K05A 3PMFA 4L6TB 1N36Q 4A3BB 1OXSC 1FVIA 3SEBA 1BQQT 1IZ6A 2K5QA 3SR1A 4A3FH 4A3LG 3NXWA 2LFNA 1CFMA 2VZAA 3HS0C 2P5ZX 1UE5A 4WJ4A 3T4AC 2VNUD 4A3JG 2Y0SB 3A55A 5IGFA 2HT1A 1IBMQ 3E6ZX 1E2ZA 2VS1A 4IUUA 3S1QB 2K03A 3BG3A 4A3JH 5J22A 1QZHA 3I4NG 2ASBA 5CV6A 1Q7YC 3K5LA 2B8FA 1EIHA 3K0YA 3MEHA 2E2JH 1AH9A 1RD9D 1SMXA 3N6RA 4DK6C 1VQPA 1JWUD 4DAYB 3GTMH 3I4NH 1JCKB 3KDFA 2MO1A 1E1OA 4JI4Q 2EYHA 1X9NA 1LO5D 4AH6A 3Q8DA 3OMCA 4JK1C 3RR5A 1TS2A 1ET6A 2UXCL 4GNXC 1WD1A 3R3OA 4X62Q 3P7JA 1Q1BA 4JBJA 4X3TA 1RJTA 2JA7G 1SAPA 2L11A 4RG1A 2WAQB 1J8IA 1YEZA 3A0JA 2PW7A 2G9DA 3RD4A 5DM63 1HA5A 5ELOA 2Z8LA 4DR7Q 4NXNL 2AMCB 2F52A 1QCBD 4GKKQ 1D6EC 4DK0A 1HR0L 1N32Q 2EYFA 4H13C 1WCMH 2E8GA 5JPMC 5C0XI 3KLSX 2RQXA 5I9PA 1FD7D 2R93B 5C6AA 4RMFA 2KHSA 3VA7A 2JA6B 1TWGB 1TWHB 1C9OA 4JW0A 4G4KA 3QR8A 2JYOA 4LFAL 5J3BA 1B3QA 1L0YB 5FO9B 2KVMA 4Z9CB 1SYBA 3G6EA 5ISRA 2N78A 4P71A 4QCLA 1C8CA 1B53A 3H3VI 2PMZB 2PQAA 4R4CA 1ZYRD 4DV5Q 1KIXA 1AN8A 2DUDA 2EYOA 3K5OA 1F77A 1XMQQ 5C4ZA 2RKSA 3I7FA 1PYBA 3Q22A 5CYUA 4IURA 1PFSA 2SDFA 3I91A 1GXDC 3PO2H 1IW7C 1Q86C 1KAAA 5FLXc 4FXGC 1EQRA 2EYJA 3TZUA 4EQOA 1N33Q 5IYBH 2PO4A 1HTPA 1VQHA 1CSQA 2NVYB 3CRKC 3OSOA 4O2DA 3TQYA 1F2LA 4B3SL 3HOWH 3I90A 1NCVA 2Z9HA 5D65A 3VA5A 1SNPA 2B29A 3D6WA 1X3FA 1JR0D 1PZKD 2AQ1B 4JI1L 2L4NA 2L0CA 2YU9B 1A3TA 1NMGA 1XNQL 4BY1B 3S15H 4KTAA 5M5XB 5JJIA 1DOKA 1DYQA 2NVTB 2EJGC 2HDLA 1RF2D 4HMIA 3ERQA 2GA4B 3I73A 1TS3A 4QY7A 5CORA 5EJWA 1M1KC 1F9QA 3NQIA 4UPAA 4FXDA 1K83B 5AJ3L 1B3AA 2B2TC 3OPOA 3H15A 1B9MA 2Q8IB 3NBIA 4IPGA 2HDMA 4BBSB 3DWQA 2CQAA 5FLMH 4ZCKA 1M90C 1O80A 1FL0A 2Z4HA 1VQOA 4R8IA 1WTVA 3VYTA 3FEWX 4GNXA 1N36L 4AYBB 1SYFA 3MTSA 4JBWA 2RDGA 1Y8NB 3PUZA 3OIQA 1YNND 3J80E 2M9VA 3UDXA 1IBML 4OELB 2G5DA 2VXWA 3OMGA 4OIKA 4DR6Q 1VQEA 3UE1A 3K7UC 3CCMA 4GKJQ 3QB3A 4RFBA 1HQMC 3S1MH 1JJCB 3FDTA 4RH6A 5HURA 1RL2A 1WTOA 4GN5A 1UEBA 3IL8A 5JAVA 4ODGA 2M2LA 4JI4L 1B7YB 2WB1G 3CHBD 1Q12A 2E2DC 4TVAB 4IFDI 1VQGA 2A74C 2KA7A 5IY0A 1A8VA 1YIJA 4A3FB 4X62L 3C2PA 1HZBA 2SNMA 2F0HA 1LT5D 4B3TQ 1X3PA 3I4OA 3HOVG 2O4XA 4O0AA 5I6WA 2RVLA 4H7BA 4X3KA 3GQBA 2HUGA 4A3JB 3DMUA 2XN9C 1U0LA 3HOUG 5A2QL 3CCRA 4DR7L 4JI2Q 4K8IA 3HOVH 5KYIA 1SYGA 1PRTF 2B2YC 3I70A 3I72A 1GUGA 3T51B 2E2JB 4ILWA 3GTMB 1PRTD 4POFA 4NKLA 4PNYA 3I4NB 3DXJC 1SYCA 5LL6S 1X65A 3K80C 2AKWB 1FNUA 4KJOA 1KQSA 5BR8Q 5KYLA 1B50A 1G8ZD 1GM5A 1BBUA 1PTOH 2VB2X 2KCMA 4BXXG 2MJ8A 4DA2A 5JJKA 5JJLA 3VR6A 2F3WA 4BXXH 4DV6Q 4KHPQ 1DONA 1U4LA 3BYYB 5GAEC 1EY8A 4DV5L 3KLSA 4NMZA 4EX5A 4MNOA 3T1YQ 4GN4B 2QEXA 2F3IA 1S72A 2UXDQ 2MNAA 4LF9Q 3BS1A 1DD2A 3R2IA 1S40A 2YTXA 2ICIA 3OYYA 2WIIB 3KLWA 1WCMB 3W1GA 1DCZA 5GROA 1N33L 1EY4A 4B9WA 2R7FA 3EVQA 4C1NI 4XXEA 2NYZD 2DY7A 3JAMc 4UAIA 2F03A 2JA8B 3ND9A 3AYHB 1JORA 1NUCA 4DK3C 2K01A 1B44D 3RLNA 2ZTCA 4XT3B 1ONLA 2RCFA 2JA5H 4LF5Q 2D62A 4DV3Q 2H1EA 1A3UA 4ALPA 4CKBA 1HTLD 4RAUC 2YYZA 2NN6I 3PF4A 4A3GG 4HMJA 3G4SA 1II3A 4DGZA 1CSPA 1QUQA 3TP8A 2CVRA 4QIWB 3STBC 3F2UA 4I7ZC 5JEAG 3UDIA 1IKLA 1N8RC 4A3GH 1CTMA 4OIJA 5HY6A 3SE0A 1HNWL 3AB9A 3PO2B 1IBLL 2VUMG 1PYSB 4DR5Q 2ZJQA 2A6EC 1WTWA 3OWFA 1EFWA 1M4VA 2PQEA 2LSSA 3K57A 5C4XG 3LX0A 3F8TA 1EUJA 2EQSA 2F0UA 4EQNA 3HKZG 2VUMH 2PZWA 4BY7G 2Z1CA 4OWTB 4X66Q 1SNQA 5E3FA 4EVOA 3HOWB 3PO3G 1BR9A 4A93G 4A3CG 5KNDA 5EAYA 1EQVA 4HCEA 1T5XD 5IP7G 1GD7A 1KABA 3G48A 4RGOS 1D1IA 4EQ5A 1ZEQX 5D3IB 4ZYSA 4C3HG 3TP5A 5C3EH 3PUYA 3MZ5A 4DR2L 3W5OA 2FFKB 1EWIA 4DR4Q 2PZTA 3S15B 3DM1A 3OW7A 3U9OA 3V05A 2R7ZH 4LFCQ 1EY9A 3ICEA 1LT3D 4HCSA 4OHJA 2G9HD 4RHRA 3TS0A 1Q3LA 1PTOF 2D5DA 1VQKA 2Y0SE 3C46A 2L15A 1CA5A 1PTOD 4DR6L 3L0OA 1OXUA 2RBMA 5L37A 5EBDA 4GKJL 3HFZB 1E7ZA 3M3YH 3CU7A 4HJAA 4L5QA 4DNIA 2HQLA 5GAGC 1W2BA 1SMYD 3M7NA 3TEHB 3D0FA 1P8LA 2QDLA 4HN7A 1EIYB 3W3AA 2WV6D 1ASZA 1HQRD 3S2HH 2B2VA 1DOMA 1GUNA 5IYDG 2ZT9C 1H9JA 4P75A 1VQ6A 3VDYA 1CKNB 3OHXC 5E4WC 1EIGA 1Y8OB 5IYDH 4AIMA 3HZXA 3PCOB 4NXNQ 4B3TL 4UY8C 3P75A 1KTKA 3RUZA 4IPDA 2N88A 5EPLA 2WAQE 1CK1A 5BN4A 2N49A 3K58A 4LNQA 2K04A 2QW7A 4MZ9A 4JI2L 4UP9A 4GOPB 5FJ8H 2JEAI 3M9BA 3TP6A 3H3VC 1IKMA 5CMDA 3S1MB 2IY5B 4KD4A 3ITPA 3J81L 1EYDA 2PW5A 2KBNA 4IPCA 4K6DA 3PF5A 4AQYQ 2F1MA 2ZTEA 1HFGA 4DV0Q 4LFAQ 1KD1C 4XYOA 3LWUA 1TXYA 5C0XG 1VQFA 5BR8L 4QJFA 4J15A 4M1UB 3D3RA 1JB7A 3GTPH 4LAAA 2VY3A 2A19A 2KCNA 1NAPA 1G291 4R9WA 4FF4A 4ME5A 2L55A 5IYCG 3GTJH 4JI7Q 1SSOA 2K52A 2CWPA 1SE2A 4DV6L 3J7AV 2F0TA 2I5MX 4DAYA 2PI2E 5IYCH 4WORA 3A5UA 5C4JH 4GLXA 3GV3A 3VR4A 4DUYQ 1STHA 3T1YL 3TZDA 5C3WA 3RZDH 3HOVB 2PMZE 1D7QA 4ZUJA 1E24A 2UXDL 4KN4C 3EJIA 5HGTA 4LF9L 4G7OC 1LLRD 1JJGA 1TY0A 1WI5A 3GTGH 3HKSA 4L5RC 1BO0A 1EFID 1PFNA 3R8BA 1YNJC 2H4OA 4KY7A 1VQ8A 3NQTA 4BS9A 2LS01 2YTYA 4MN3A 1EY5A 1GKHA 1PTOB 2MHVA 2ID0A 2XVSA 1SROA 3K8AA 2Q2HA 2VQEQ 4FXKC 2BCOA 2PYKA 3I4MH 4LF5L 3M4QA 2RSOA 5C5LA 3HG9A 2A6ED 1VQJA 2EY2A 2K32A 2ZXRA 2IHFA 3UDFA 1Y1WG 1XPOA 5IT9L 1Y1VG 4JI3Q 4N9PA 4K8JA 1D5MC 1Y1WH 3DM3A 3KJPA 2PI2A 2LKVA 3CPWA 4DR5L 1E3PA 2K6AA 1UNSA 3F2DA 4A3EG 2EJFC 3BDLA 3D8GA 1Y14B 4K5WA 4CJ2C 2CCZA 3DWAA 2RHQB 1A62A 1VDZA 4X66L 4A3EH 1EIFA 3QO2A 4TRDA 1W3SA 2NWGA 4CJ0B 5DM73 2H5XA 2JA5B 2UUAQ 5ELNA 4KHZA 1Q8IA 2BDOA 3JC66 2QEJC 3EA6A 3K0XA 1K8AC 4FYDA 1H9SB 4A3LH 4JVZA 3TMEA 4CKEA 4DR4L 5LMUQ 4AYBE 2UUCQ 1S5ED 4A3GB 4LFCL 1ILPA 1JWMD 3TS2A 5EQ0A 3PIO3 1D8LA 2K28A 4KKUA 3J81j 1VQAA 2A68C 4MIUA 2VUMB 1HZCA 2ALYB 2JEBI 5GADC 3QJYA 3M85A 3K5NA 2EJMA 3M7GA 3HKZB 4KLKA 1G6ZA 3DEOA 4KY6A 2KECA 4QQBX 1TQOA 2MQHA 2QF7A 3TRZA 3SVMA 4RA8A 4IFDG 4K0KQ 1LTTD 3RN2A 3ERSX 5C3EB 1MSGA 3UDGA 5IGCA 2EZVA 1UAPA 2RHSB 2CWAA 2DJFC 2XGTA 2LMCB 2JA7H 4LFBQ 3A7AB 3RZOH 1RTOA 4DV1Q 1IXRA 4MTKA 3CCQA 2UUBQ 2R7ZB 1D5XC 2V1CC 2SOBA 1I4QA 2TMPA 5C44G 3G71A 1K8OA 4A3IG 1EYAA 1X56A 2PNHA 1NMFA 5LHY1 5C44H 1JICA 2PNRC 4PZ6A 1ENAA 2JJQA 3NHHA 3M3YB 4K2KA 3SDZA 1SYEA 2NZOA 4C2MH 4AQYL 4DV0L 1IYUA 2XTIA 1QG7A 2CH4A 4LWCA 1B2TA 1PH1A 3S2HB 1IYVA 3FVQA 5CV8A 1SBBB 1SR3A 3L2PA 4QGUA 2K5NA 3Q0AA 1ICWA 1TWCH 1HUMA 1JOKA 4JI7L 3J81i 1U9RA 1LTID 1ZXTA 1S5DD 3URYA 3KJOA 1A15A 2KJXA 2A69C 4ZKBB 5AFWA 2PZUA 1K9MC 4X64Q 3KF8B 3AU7A 2VL6A 1SNDA 4POGA 4DUYL 5K36G 5E7NA 4ID6A 3BYTB 3T13A 2F0DA 1Q82C 3HOXG 2EOTA 2IX0A 1NJIC 5EKIA 3EN2A 4OWWB 3I4LA 2E76C 1CHQD 1C0AA 1PMRA 3V2TA 1Q81C 4NXMQ 3GTPB 1NE3A 3SK4A 2K33A 1BCPC 1WTQA 3AQQA 4B3RQ 1P16A 4C3JG 3GTJB 2VQEL 4JV5Q 1A63A 1KNEA 3H0GG 2HD3A 1I4GA 1O7ZA 3K5MA 1EEID 5C4JB 1HNWQ 5BN3A 4L63B 3A56A 1IBLQ 1B70B 2NN6G 3A5ZB 3CCUA 2NB0A 3RZDB 1L1OB 1ILQA 1WFQA 4LUOA 3SHLA 3TDQA 4JI3L 1VQ5A 3GTGB 1LTGD 3EFXD 3KUPA 3S1RH 4QIWE 1CKOA 2N8NA 1EU3A 3JAME 5IP9G 4A3DG 1Z47A 5IGBA 4L5TA 1LTAD 4R1JA 5IP9H 4DNTB 4APVA 3A8JE 5EGTA 1JOQA 4UP8A 4GOPC 5F2DA 4GLVB 5A35A 1HPCA 4XTCS 4DR2Q 4V190 1KC8C 3I4MB 2EY5A 4WJWA 1XMOQ 2UUAL 2C5CA 2WKDA 3MEFA 3TN2A 3IAYA 1PXUA 3PIPA 3FPPA 3AFPA 1PYWD 3BZDB 1BBWA 1PZJD 5LMUL 4JBMA 1STBA 3TBIB 2Q8RE 2UUCL 5G3LF 3SK5A 1Y1WB 2KHIA 4KJNA 1BNZA 4FP5D 5G3LD 2NZ1D 2B3GA 3NP8A 4G57A 4KN7C 2F0NA 4PG3A 1QILA 1WTHA 3ULPA 3BDCA 1KXLA 2NBFA 1V8QA 1ZKOA 5C5MA 2QGQA 3GV6A 1FGBD 2DGYA 2ATWA 2IWHA 4A3EB 3FPUB 3GTQH 2CW0C 1GUWA 3MFGA 5CV7A 2HQEA 1STYA 3H09A 2K5VA 3ZJYC 1K0SA 4G7ZC 5KRUA 2Z0SA 4JI6Q 1RDPD 3VR5A 4DAMA 1KNAA 1PH2A 3A8IE 5CGKA 3J80L 1PLFA 1VS0A 4K0KL 4FDBA 2JK8A 1PFBA 5CR3A 4NPSA 1QOHA 3GO5A 4N8X1 4X3UA 4HJ8A 4LFBL 2IHEA 5M3MG 4DV1L 1JB3A 2UUBL 1IYJB 3KYHC 3C1EA 2AQ3B 4HSPA 1D1KA 4RKBA 4YCVA 3D31A 4Y7NH 4RHSA 3GTKH 5M3MH 1ASYA 4KY5A 4CDFC 3HOUH 2KHJA 1EOTA 1X55A 2Q2IA 1CQFA 1GO3E 1CA6A 4QUCA 4CBVA 1HR0W 1SNOA 1ML0D 1S5BD 4DV2Q 2B2VC 2F4VQ 2LY7A 2IPKD 3D6CA 5M5WH 1JT8A 1SN8A 1UE6A 2Q2UA 3W2DA 1JWSD 2A69D 1GHJA 3FHWA 4BBRG 3DLLA 1FNVA 3I8ZA 4IO9A 2I46A 3CCVA 4B9XA 2SNSA 4U68A 5JVG3 1IW7D 2IX1A 1UE1A 2JA7B 3RZOB 2RDFA 1VQMA 1BDOA 1KDAA 5TSSA 1YI2A 1V1PB 3Q24A 4WFN3 4IOCA 2RCNA 4DAVA 1FJGQ 5CBEE 4IOAA 3MXNB 4X64L 1LTSD 1WJJA 4LF6Q 3M4OH 1SE4A 5NUCA 1I6VC 4IZ8A 1WYDA 4OXPA 2FHTA 4WRDA 5C44B 3MAQA 1WD0A 1Z6HA 1CZGA 4RWSC 4RGMA 2NTSA 2NTTA 1CKNA 2F0MA 3G6JB 3WOEA 2C35B 3L3OC 2BH8A 5GQOA 1TS4A 4HSVA 2YV5A 4LK1C 2EYPA 4NXML 4HIKA 3GP7A 1PA6A 4A3MG 1H9KA 5CV5A 1X3QA 2WP8J 2K14A 2BH2A 5FO7B 4B3RL 1PDQA 1TWCB 2R6GA 4NDXA 4GOPA 5EKLA 1FGUA 4YWLA 4IN3A 5E4XA 1KAWA 4JV5L 4A3MH 2B2WA 3J7AF 3T16A 4IJLA 1HFNA 2K1BA 3OWEB 1E0BA 1ICFB 4EGVA 3NENA 4B08A 4DU9A 2Y0SG 3ND8A 1K73C 4DXFA 5JEAH 3NSWA 3CC2A 4IJHA 1NY4A 1G6PA 2F0SA 1K3BC 1KRSA 4R4TA 2UU9Q 3CCLA 1DXMA 2BA1A 2ZJRA 4ABNA 5C4XH 4CDEC 1TR5A 1MI2A 3DHQA 3HGBA 4OWXB 4KK7A 3M4PA 1PRTB 1RIPA 4I65A 4YCUA 1C7YA 1IL2A 4BY7H 4DV7L 5I2YA 3PO3H 1GUTA 4A93H 4A3CH 2DY8A 1STNA 4ZRZA 5IP7H 1L0WA 2JA9A 1YHBA 3PIOA 1XXGA 2I5HA 1XMOL 4F7XA 4IUVA 4C3HH 2ZXPA 2OCEA 5I6YA 1YHQA 1V1OA 3CMAA 2N3SA 1EL0A 3HOYG 1H9RA 2WAQG 2Q2TA 3RMHA 1F9SA 2R61A 1XNRQ 3KBXA 5ELCA 1WOCA 2M00A 1ESFA 5ELFA 3HOYH 3FKIG 3S1RB 3LNNA 4JCVE 1QVGA 2AHOB 1U4MA 3ONAB 3A74A 5FKAC 2K7VA 1I5FA 2TSSA 3NELA 3BDOA 3FKIH 2V4DA 3RLOA 2KEEA 5EBCA 4R8NA 2EY6A 1SRUA 3I3CA 2GVBA 4FF2A 2NZHA 4DUZQ 2R93G 2JA6G 3AMUA 4HR7B 3KF6B 2HCCA 3E9IA 5C4HA 1AZPA 4JI6L 1EQTA 5M3FG 3HKZE 3BZKA 3NE5B 5IGDA 1U4RA 3SGIA 1YHAA 3E5SA 3J81E 2D0OA 1N34Q 1E2VA 2MFIA 3NEMA 4ME3A 5M3FH 1EWHA 1TWAH 3O13A 3OIPA 3D4DA 2IX3A 1NR4A 2B63G 2R92G 3NBHB 2R3ZA 1J6QA 2RSNA 2XRSD 5KGUA 2XNAC 1QB5D 3IFTA 3AFQA 3UI2A 5IE8A 1D5ZC 3J80i 1K8GA 2B63H 3CCSA 3C1FA 4BA1I 2R92H 4A75A 1H9SA 4YY3Q 1QE6A 2F0WA 4JC0A 3GTQB 4DV2L 4OGQC 2F4VL 3S9WA 2Q8TA 4PMWA 2WB1B 1EY6A 5C0XH 1LM0A 1I50H 4JOIC 1EOVA 1EYCA 1K28A 2NVYH 1O7IA 2L5TA 5ELDA 4TKOB 2BE5C 3PV0A 1QZGA 4H02A 2KCTA 4YIJA 4H44C 3A54A 4N8FA 1AE3A 2DN8A 4Y7NB 1FJGL 3GTKB 1I4XA 4BY1G 5M3MB 1KL9A 1HZ9A 5IOCA 3H3VH 1CUKA 2I5LX 3OOCA 4LF6L 3HOUB 4RGTA 3NK9A 1J5EQ 1ET9A 2F0OA 5LMNW 1SE8A 3P20A 1CM9A 4YCWA 1O78A 2FMMA 1DOLA 1JC7A 3MXPA 1TKWB 4LF8L 1ZYRC 5DEHA 1TY2A 3STBD 1LUZA 3K7AH 2KOLA 4BBSG 5BN5A 3VYSA 5LL6X 2QCPX 1A2UA 4UHVA 4DR1Q 2OT2A 4UP7A 4CKCA 1ENCA 1G2SA 1UWVA 4X6AH 4IPHA 4ULLA 1IL8A 3FP9A 4RCOA 3S1NH 3K59A 5KEEA 3E0EA 4FVMA 3M4OB 5ELEA 1I6HH 1JQYD 4DPGA 1HUNA 3E3XA 1TT2A 4LF4Q 1Y1VH 2E2HH 1GUSA 5EPKA 4X3SA 5IODA 2EXZA 4K2LA 4FO2A 2UU9L 2WKCA 3GDEA 1X32A 5EKKA 2K4KA 2MPMA 1OXVA 4MTNA 1T5EA 2MP1A 4HEDA 3KF8A 3NTKA 1I3QH 1QNKA 4JI0Q 2B8GA 1Z7TA 2D2CC 1V1QA 4C3IG 4JG2A 2WFWA 4CDCC 1G2TA 4BWGB 4E6IA 4A3MB 3U9SA 5FLXL 3J7ZC 4A3FG 1Q1EA 2F4IA 1S3OA 3J81c 4C3IH 4O1NA 1K0RA 4DXGA 2JP1A 4PZ8A 2E5LQ 1B4OA 2QA4A 1MJCA 4G7HC 1XNRL 3NWSA 1XTCD 4KMUC 1I94Q 2SEBD 5FK9C 1FYCA 2CKZB 2OQKA 2K75A 5C4XB 1AZQA 3H6MA 1TWFH 2RA4A 4BY7B 5D14A 2BOSA 5IIFA 1Y8PB 2E2IH 1BUVT 1VQ4A 4X65L 4IUQA 2UXBQ 2EE1A 3PO3B 2XRQD 4A93B 1YNNC 3CP0A 4OL7A 1L1OA 1I4PA 4DUZL 1AFPA 3F2CA 1EY0A 1WTRA 4FF1A 1U4PA 3MC0B 1DZ1A 3L7ZC 4IFDH 1VQDA 4C3HB 4JOIA 2B2UA 1YITA 3GTOH 4L8JA 1N34L 3F1ZA 3CMEA 1CI3M 4F88A 1KLGD 2FJ2A 1PH9A 5DAUA 1NSNS 1A0IA 5I2XA 1BKBA 3MFYA 1HNXQ 3GTLH 1SDFA 3HP3A 2QDBA 1HA6A 3HOYB 4P2CB 1DM0B 1Q46A 4HTHA 2KENA 4R4IA 1RODA 2BA0A 4A3IH 4LJZC 3FKIB 4A3KG 4QB4A 1XX8A 1Q8KA 1MGSA 4DR3Q 1JOOA 1WCMG 3N52A 5ELBA 3X3MA 4YY3L 4A3KH 2A5HA 2BE5D 3C3LA 4GLAC 2J4XA 5IGGA 1VQCA 3CC7A 2JE6I 1PH8A 3S14H 3MHBA 2OQ0A 1HRJA 1PZID 1QVFA 1XPUA 2HHHQ 3BJUA 1EWCA 3ER0A 5IT9c 2JA8G 1F9PA 3I55A 1X3EA 1ENFA 3U50C 3U4ZA 4DV4Q 3MWYW 4FNFA 5M3FB 2JA8H 1YNJD 1XTDA 1PRTC 2A6HC 4QL5A 1O7YA 2K5HA 1TWAB 1MJEA 3KBGA 2OWOA 3FMCA 3QIAA 5KNCA 4LW1A 1CT1D 4OO1I 1R4QB 2DNEA 5J1ZA 1O7LA 5C3XA 5K36H 1PH7A 4K6LA 2B63B 5T1GA 2R92B 2A1AA 3PO2G 1S5CD 3J7A5 1J5EL 2J0TD 2LXJA 3HOXH 2JXMB 5LMNQ 5IYBG 2EDGA 1LYLA 1JE4A 1EU4A 1I50B 1G91A 2PCFB 3HOWG 1BVSA 3GD7A 3F2BA 3OTOL 1SLJA 4KHVA 4C3JH 4DR1L 4GZYC 1RHPA 2CFMA 3R2TA 1VQ7A 3RLFA 5JPNC 3BU2A 1K8MA 2A8VA 3H0GH 3MA2B 1XWEA 1WVLA 1VMCA 4XQJA 2PPBC 2I07B 3KDFB 4Q5VA 1IHZA 1A3VA 2NN6H 3Q6SA 5COYA 5T1IA 2JQOA 2AQ2B 4P72A 1L0XB 3MXUA 2F0EA 4ZUIA 3EBEA 4LF4L 1F2MA 4JI8Q 3HOZG 1B8AA 2CHBD 4HAEA 3G7LA 2VB3X 1T9HA 2E75C 4ZQ3A 3SK6A 1F9RA 3CQZH 3IRBA 3B6YA 4XDXA 4DV7Q 4LUVA 3HOZH 4JI5Q 4A3DH 3ZYYX 1V1PA 4TSSA 4HIOA 1SFOH 1VQBA 5JEAJ 2EYLA 3KLRA 3QWNA 3K7AB 3MXNA 3ULLA 2AUKA 5FLMG 1B1ZA 4JI0L 2B2WC 2K5WA 1DJRD 3DUZA 2E74C 3T53B 3U4VA 5J39A 2RDHA 3NUCA 1VQNA 4JBKA 1XYIA 3WDNA 3S1NB 2A68D 4PZ7A 2OF1A 4ZK9B 3K6OA 1NR2A 1EQQA 5I4DA 3PUXA 1BF4A 1I6HB 1D2BA 3JAML 1G51A 4YHHQ 3T56B 2E5LL 1EY7A 1Y1VB 4U673 3A8KE 4K5VA 4FF3A 2E2HB 2NVQH 1SE3A 2F3VA 1MHWC 1I94L 2F0JA 4LMQD 3M4YA 1AW7A 3S17H 2HCIA 2ZXOA 3CCEA 4A76A 2GN5A 3J7YW 4HJ7A 2IJ0A 2GVAA 3LWEA 3U58A 4NW2A 3E9HA 1I3QB 2PQAB 5A2QE 2Z4IA 4IUTA 2UXBL 1YBYA 4KV6A 2AUJD 4RCNA 3PSIA 1HXYD 4DK1A 2CH4W 4BA2I 2DJGC 5D3DA 1PH6A 1PTOC 1EZ6A 3KFUA 1W6KA 1TVXA 4C3IB 2KEDA 4DKAC 4IUPA 4WJ3M 4OEMB 1STGA 4KKSA 3Q23A 1HNZQ 1VQ9A 1SMYC 4OX9Q 1HNXL 1LTLA 4XQQA 2EY1A 2F0KA 1QNUA 1XPRA 1H9MA 2L1BA 4QUFA 3S2DH 1OTCA 1TWFB 3S16H 4M8AA 1YJ9A 4DR3L 2E2IB 4IALA 1HH2P 1NBWA 4J8QA 4P74A 3CCJA 4GKKL 2F0QA 1N32L 2A6HD 2MGSA 2R7DA 4J1MA 1KRTA 1NNXA 4DF7A 2NVXH 4Y52H 1LACA 2HHHL 3BZCA 1E2WA 2JSOA 4BBRH 5JJZA 4HJ9A 2B39A 2WB1E 3HEJA 4YWKA 4DN4M 4DV4L 1PH5A 2J7ZA 3CAMA 2L9HA 1YZ6A 2I0QA 3GTOB 3E0JA 2WACA 4A4IA 2CQOA 1C4QA 4HIDA 3GTLB 3BVGA 4UDUC 4XIGS 5C0XJ 5IGEA 1STEA 4EQPA 5M9OA 1BCPF 3CC4A 3T1HQ 3KF6A 4LUZA 1SNMA 4OONA 4A3IB 5IWAQ 4L5SA 1BCPD 1R4PB 1XMQL 1M8AA 4C2MB 2F0FA 2IL8A 1B9NA 4LF8Q 4GNXB 2KUMA 2Z6BA 5M5YH 4A3KB 5LMNL 2EYMA 1A2TA 1VMPA 2VQFQ 2KCCA 2OTLA 2NUCA 3I56A 1F2ZA 1R9TH 3S14B 1MKHA 1VF5C 1SJED 2ZM6Q 4JPBW 5KIXA 4PMCA 1EEFD 3NPPA 2QILA 4A3BG 2D0PA 1BBXC 4H0LC 2YTVA 3NBHA 1C48A 4I7AA 2B2TA 3FRPB 2JA5G 4RGNA 3S24A 2O2LD 3V96A 4A3BH 2ZTDA 1HJPA 3TREA 4JYAQ 3X3NA 4CJ1B 4XYQA 1J9OA 1X6OA 1F2YA 1QVCA 1RTNA 1WTXA 4NB3A 2OEOA 2XWJB 1JJ2A 3QG1A 4JI8L 3UE0A 3S1QH 3HOXB 4PMBA 2N55A 4GS3A 1JMCA 1VCIA 3MVVA 3J80c 1IBKQ 4B3MQ 1GOZA 2ENBA 2XSCA 3D4RA 1XJVA 4JI5L 4CDDC 1N9WA 1S5FD 1MD2D 2XWBB 3A7LA 1X3GA 5EPJA 1GJXA 1X54A 4LF7Q 1Q90A 3PUWA 1QJOA 4R4QA 1WTPA 4XT1B 3IKJA 4C56C 1UUPA 4DAPA 4C3JB 3LGJA 3WWVA 2FXQA 5DLQE 2ES2A 4CHTB 1LT4D 1JE5A 5C3EG 3H0GB 3K81C 1MIUA 3AEVA 3RNUA 1Y69U 1PHJA 1CKMA 1PVOA 2WINB 3CKIB 1AE2A 4HJ5A 2CW0D 4Q0FA 1V9PA 2R7ZG 4IQZA 1MSHA 4YHHL 5K5PA 2EVBA 2EPBA 3NTIA 2X69A 5I9OA 1MBYA 1GVPA 1KDBA 3ULJA 3CQZB 1HCZA 1TIID 1U5KA 5KNBA 3HOZB 4X65Q 5DNFA 4A3DB 4QMGA 4NP5A 5GAHC 1SFOB 1BCPB 4V0BA 3PIP3 2IW3A 2AWNA 3QOLA 4ZAIA 1K3RA 3JAMi 2B2YA 4F8MA 4S3SA 4KI0A 1E1TA 2R93H 2Z6KC 3SXHA 1I4RA 2C9OA 2FINB 1TWGH 1TWHH 2HIXA 3P1HA 4K14A 2JA6H 2UXCQ 5FOBB 2ICEC 2OXPA 3KOJA 3R93A 2DNCA 1HZAA 3PGZA 2F0VA 3PUVA 1GHKA 4C1NK 1AEXA 1LT6D 1SXTA 5CBAE 3WOFA 1CHPD 2JN4A 4J6HA 1HNZL 4XQNA 3OW2A 4RKLA 1STAA 4OX9L 2NVQB 1VQLA 2HIVA 4IFDJ 1KDCA 5CC4A 3TP7A 4KKTA 2O5IC 1W6JA 2OTJA 1UE7A 3S17B 5FJ8G 1HR0Q 1L1OC 4CGYB 3NTHA 1YNXA 1OXXK 2F0GA 3QOJA 1BXTA 4ZKCB 3PQIA 1QUQB 2B2UC 3I2ZA 1HHVA 1E22A 1A6XA 2F0IA 4K5XA 2F0LA 3EROA 3SK8A 3BVMA 2X6LA 1TS5A 2X6GA 3RN5A 3CW2C 4MHEA 2MUYA 1RKNA 1BOSA 3CRLC 1YJWA 1AP0A 2AWOA 1PV4A 1VF7A 2LXKA 3IFDA 3HRZC 2F0PA 2XIWA 1FNWA 1CQVA 4ZLTF 3VR3A 3EQLC 4P73A 2YU9H 1SEBD 4BY1H 2L12A 1LABA 1PH3A 4KHPL 5M5XH 2K50A 2A73B 5CV9A 3T1HL 3VYRA 2NVTH 1H95A 5IWAL 1EYGA 4OO1G 3H91A 3S2DB 4QF4A 2EXDA 5JOBA 4GN3B 4O42A 3S16B 5M5WB 2K5DA 4DNRB 5H1SE 2QKIC 2O5JC 4PQXA 1YJNA 1I4HA 2FMCA 1NTGA 4OO1H 2MO0A 3W1BA 5IT9E 3H94A 1Z9FA 2RF4A 4IUNA 5E1FA 3OTOQ 2VQFL 1K83H 3CPFA 5HGQA 4YWMA 1PH4A 2BDNA 3CD6A 5FO8B 2NVXB 4B3SQ 2ZM6L 1LV9A 3TSSA 1S4ZA 4BBSH 1DGSA 1L2FA 4BBRB 4KD3A 3EIVA 4AYBG 3I4MG 4JI1Q 5JVH3 1OO9B 3VYUA 1XNQQ 1FR3A 3BVZA 4JYAL 1OXTA 1SJHD 4DV3L 3CXCA 2VW9A 3DWPA 1LTRD 4TQUS 4F87A
chains in the Genus database with same CATH topology
4R4OA 1ASYA 2EIFA 3TS0A 3HOUH 1VQKA 1PH7A 2Y0SE 2KHJA 2L15A 2A1AA 3PO2G 3J7A5 1X55A 1J5EL 2Q2IA 1GO3E 2LXJA 1OXUA 3L0OA 3HOXH 3CF5A 4DR6L 2IT1A 5LMNQ 1HR0W 4GKJL 5AJ3Q 5IYBG 1IBKL 1YVCA 3HFZB 4B3ML 4BY7G 1E7ZA 3M3YH 4DV2Q 4HJAA 4L5QA 4DNIA 2F4VQ 1LYLA 2ZJPA 2HQLA 5GAGC 5M5WH 1W2BA 1JT8A 3M7NA 1VQIA 1SN8A 1UE6A 3TEHB 3D0FA 2Q2UA 1P8LA 4LF7L 1EIYB 3HOWG 1BVSA 3GD7A 4HIMA 1ASZA 3F2BA 3OTOL 3S2HH 1V43A 2Z6KA 3FHWA 1SLJA 4BBRG 3DLLA 4IO9A 3CCVA 1KHIA 4C3JH 4DR1L 2CFMA 5IYDG 5LMNW 1N36Q 1OXSC 4JI6L 2IX1A 4P75A 1FVIA 1UE1A 3RLFA 1VQ7A 1VQ6A 3BU2A 1VQMA 1IZ6A 1YI2A 4A3LG 4A3FH 2A8VA 3H0GH 3VDYA 1CKNB 2JA8G 2VZAA 5IYDH 4IOCA 1UE5A 2RCNA 4AIMA 1FJGQ 3PCOB 4WJ4A 4NXNQ 4B3TL 2VNUD 3KDFB 4A3JG 4UY8C 4IOAA 3MXNB 4IPDA 2HT1A 4X64L 4LF6Q 1WJJA 1IBMQ 3M4OH 2JQOA 2WAQE 2VS1A 4P72A 2N49A 3EBEA 1WYDA 4LF4L 4JI8Q 4OXPA 3HOZG 1B8AA 4A3JH 4LNQA 4MZ9A 1T9HA 1QZHA 4JI2L 4UP9A 4GOPB 5FJ8H 2JEAI 3CQZH 3M9BA 2ASBA 3I4NG 2IY5B 3IRBA 3B6YA 4DV7Q 1Q7YC 4LUVA 3HOZH 2KBNA 1CKNA 4IPCA 3PF5A 4JI5Q 4AQYQ 4A3DH 2ZTEA 2E2JH 4HIOA 2C35B 1SMXA 4DV0Q 4DK6C 1VQPA 4LFAQ 2BH8A 5GQOA 4DAYB 1SFOH 1VQBA 5JEAJ 1KD1C 3I4NH 3KDFA 2MO1A 1E1OA 2YV5A 4JI4Q 1TXYA 5C0XG 1VQFA 5BR8L 3ULLA 1X9NA 5FLMG 4AH6A 4QJFA 4JI0L 4NXML 3Q8DA 4HIKA 4J15A 1JB7A 3GTPH 3RR5A 2VY3A 1PA6A 4A3MG 2UXCL 2A19A 3U4VA 4GNXC 2WP8J 2K14A 2BH2A 4B3RL 2R6GA 4GOPA 1G291 1VQNA 4JBKA 4X62Q 1FGUA 1Q1BA 4YWLA 5IYCG 3GTJH 4JI7Q 4PZ7A 4JBJA 1KAWA 2JA7G 4JV5L 2K52A 4A3MH 1EQQA 4RG1A 4IJLA 3PUXA 2CWPA 4DV6L 2I5MX 1YEZA 3A0JA 2PI2E 5IYCH 1G51A 4YHHQ 3A5UA 2E5LL 5C4JH 3NENA 4GLXA 2Y0SG 1K73C 5ELOA 4DUYQ 2NVQH 3T1YL 3RZDH 2PMZE 4DR7Q 3CC2A 4NXNL 4IJHA 1E24A 1NY4A 2UXDL 1D7QA 2AMCB 4LF9L 1I94L 1JJGA 1WI5A 1G6PA 2F52A 1KRSA 4R4TA 2UU9Q 3HKSA 3GTGH 3CCLA 4L5RC 2BA1A 2ZJRA 1HR0L 3S17H 4GKKQ 1N32Q 5C4XH 3CCEA 1WCMH 4A76A 2GN5A 1VQ8A 2E8GA 4HJ7A 2GVAA 4OWXB 5C0XI 3U58A 3E9HA 3M4PA 1RIPA 2PQAB 2YTYA 4YCUA 1C7YA 1IL2A 4BY7H 1GKHA 4DV7L 4RMFA 2UXBL 1YBYA 2ID0A 1C9OA 3PO3H 1SROA 4A93H 3PSIA 4A3CH 4LFAL 5J3BA 4BA2I 3K8AA 2Q2HA 5IP7H 2VQEQ 1L0WA 2JA9A 1YHBA 1PH6A 3PIOA 2I5HA 1XMOL 3I4MH 4LF5L 3KFUA 4C3HH 4DKAC 3G6EA 3M4QA 4WJ3M 2OCEA 1YHQA 2N78A 4P71A 2N3SA 3CMAA 1VQJA 3HOYG 2Q2TA 2WAQG 1HNZQ 3H3VI 1VQ9A 2PQAA 4R4CA 4DV5Q 1KIXA 2IHFA 2DUDA 1XMQQ 3UDFA 1Y1WG 1HNXL 4OX9Q 1LTLA 3I7FA 1XNRQ 1PYBA 1XPOA 1WOCA 1Y1VG 3HOYH 3FKIG 4JI3Q 1PFSA 1XPRA 4JCVE 1QVGA 1Y1WH 2AHOB 3DM3A 3A74A 3KJPA 3S2DH 1I5FA 2PI2A 3CPWA 1OTCA 3PO2H 4DR5L 1Q86C 3NELA 1E3PA 3S16H 3FKIH 3F2DA 4A3EG 1YJ9A 3RLOA 5FLXc 1EQRA 1N33Q 4DR3L 5IYBH 1HH2P 1NBWA 1VQHA 1Y14B 1SRUA 2GVBA 2CCZA 4P74A 1CSQA 1A62A 2RHQB 3CCJA 4GKKL 1N32L 2NZHA 4X66L 4DUZQ 4A3EH 1EIFA 2R93G 2R7DA 2JA6G 1KRTA 1W3SA 3KF6B 4O2DA 3TQYA 4B3SL 3HOWH 2H5XA 3E9IA 2NVXH 4Y52H 2HHHL 3BZCA 2UUAQ 5ELNA 4BBRH 5M3FG 3HKZE 2B29A 2WB1E 4HJ9A 3BZKA 4KHZA 4YWKA 4DV4L 1X3FA 1PH5A 3CAMA 3JC66 1YHAA 1YZ6A 3SGIA 2I0QA 2D0OA 1N34Q 4JI1L 3K0XA 4A4IA 1K8AC 2MFIA 3NEMA 4ME3A 4A3LH 2CQOA 5M3FH 4HIDA 4XIGS 5C0XJ 1NMGA 1XNQL 4DR4L 5LMUQ 1TWAH 4AYBE 2UUCQ 3S15H 5JJIA 3CC4A 4LFCL 3T1HQ 3KF6A 4LUZA 4OONA 2B63G 5IWAQ 2R92G 4L5SA 3TS2A 3NBHB 1J6QA 1XMQL 1D8LA 4QY7A 4LF8Q 3AFQA 1K8GA 5IE8A 3J80i 4GNXB 1M1KC 3J81j 2B63H 3CCSA 4BA1I 2R92H 1VQAA 4A75A 4YY3Q 4UPAA 5M5YH 4JC0A 5LMNL 5AJ3L 1HZCA 2VQFQ 2OTLA 3I56A 4BBSH 2ALYB 2JEBI 3H15A 4DV2L 1R9TH 5GADC 3M85A 2F4VL 1MKHA 4PMWA 4IPGA 4KLKA 2ZM6Q 4QQBX 1LM0A 1I50H 2MQHA 5FLMH 4A3BG 3TRZA 2D0PA 1M90C 1FL0A 2YTVA 4JOIC 1EOVA 1VQOA 2JA5G 4IFDG 4K0KQ 2NVYH 3RN2A 3ERSX 3S24A 1O7IA 3UDGA 2RHSB 2CWAA 4GNXA 1N36L 4A3BH 3PV0A 2ZTDA 1HJPA 2XGTA 1QZGA 4H02A 3TREA 2KCTA 4JBWA 2JA7H 4LFBQ 3RZOH 4DV1Q 4JYAQ 1IXRA 3CCQA 2UUBQ 3PUZA 1AE3A 1FJGL 2V1CC 4BY1G 1X6OA 1KL9A 1QVCA 1HZ9A 3H3VH 1CUKA 2I5LX 3UDXA 5C44G 3G71A 4NB3A 1IBML 4LF6L 4A3IG 1JJ2A 4JI8L 3UE0A 3S1QH 1X56A 1J5EQ 4DR6Q 2PNHA 4GS3A 1NMFA 1VQEA 1SE8A 1VCIA 3K7UC 3UE1A 5C44H 4PZ6A 3CCMA 3J80c 1JMCA 1IBKQ 4GKJQ 2JJQA 4B3MQ 4YCWA 3S1MH 1XJVA 1JJCB 2NZOA 1N9WA 4JI5L 4C2MH 1RL2A 4AQYL 4LF8L 4DV0L 4GN5A 1UEBA 1X3GA 1X54A 2XTIA 4LF7Q 4LWCA 3STBD 1LUZA 4JI4L 1PH1A 3PUWA 1B7YB 2WB1G 4R4QA 3K7AH 1Q12A 4TVAB 4BBSG 4IFDI 1VQGA 3LGJA 3WWVA 4DR1Q 1SR3A 2FXQA 4UP7A 5DLQE 3L2PA 2ES2A 5IY0A 2K5NA 4QGUA 1A8VA 1UWVA 1YIJA 1JE5A 5C3EG 4X6AH 1TWCH 3K81C 4IPHA 4X62L 1MIUA 3AEVA 4JI7L 3RNUA 3J81i 3FP9A 1CKMA 1PHJA 1HZBA 3S1NH 1PVOA 3E0EA 4B3TQ 1AE2A 4HJ5A 3KJOA 1V9PA 2R7ZG 3I4OA 1K9MC 4O0AA 4X64Q 4YHHL 3HOVG 3KF8B 1I6HH 4DPGA 2VL6A 4LF4Q 4POGA 1Y1VH 4DUYL 2E2HH 5K36G 1GVPA 1U0LA 3HOUG 5E7NA 3CCRA 3ULJA 4DR7L 4JI2Q 3HOVH 1Q82C 3HOXG 1U5KA 4X65Q 2UU9L 3GDEA 2IX0A 1NJIC 5GAHC 3EN2A 4POFA 4OWWB 4LFBL 2K4KA 1X65A 1OXVA 3K80C 2AWNA 4MTNA 1K3RA 2AKWB 3JAMi 1KQSA 5BR8Q 1C0AA 1I3QH 1Q81C 4KI0A 1E1TA 1GM5A 2Z6KC 4JI0Q 4NXMQ 1BBUA 2R93H 2JA6H 1NE3A 1TWGH 1TWHH 2HIXA 2UXCQ 2KCMA 3AQQA 1V1QA 4BXXG 4B3RQ 1P16A 1AH9A 3KOJA 4JG2A 3GTMH 2VQEL 1HZAA 2WFWA 5JJKA 5JJLA 3PGZA 3PUVA 3J7ZC 4JV5Q 1A63A 4A3FG 1Q1EA 3H0GG 1S3OA 4BXXH 3J81c 4C3IH 4DV6Q 4KHPQ 1K0RA 4PZ8A 5GAEC 2E5LQ 1HNWQ 1HNZL 2QA4A 4DV5L 3OW2A 1IBLQ 1B70B 2NN6G 4OX9L 3A5ZB 1MJCA 3CCUA 1VQLA 2HIVA 1XNRL 4EX5A 1L1OB 4MNOA 3T1YQ 1WFQA 4GN4B 4IFDJ 2QEXA 2F3IA 4LUOA 1S72A 2UXDQ 2MNAA 4LF9Q 4JI3L 1I94Q 1VQ5A 2OTJA 1S40A 1UE7A 3S1RH 4QIWE 5FJ8G 1CKOA 2CKZB 2N8NA 2OQKA 2YTXA 3OYYA 2K75A 1HR0Q 3KLWA 3W1GA 5GROA 1L1OC 5IP9G 1TWFH 4A3DG 1YNXA 1OXXK 1N33L 1Z47A 2R7FA 4L5TA 2E2IH 1VQ4A 4R1JA 4X65L 2UXBQ 5IP9H 1QUQB 3JAMc 3I2ZA 1E22A 3CP0A 4DUZL 1L1OA 4APVA 3F2CA 4UP8A 4GOPC 3AYHB 4GLVB 4XTCS 3RN5A 3CW2C 4DK3C 4DR2Q 1KC8C 3RLNA 2ZTCA 1XMOQ 3L7ZC 1YJWA 2JA5H 2UUAL 1VQDA 4LF5Q 4JOIA 2D62A 4DV3Q 2AWOA 1PV4A 2LXKA 3MEFA 4ALPA 1YITA 3GTOH 1N34L 3F1ZA 3PIPA 3CMEA 3AFPA 2YYZA 1PH9A 2NN6I 3PF4A 4A3GG 1A0IA 4P73A 1BKBA 1BBWA 1HNXQ 3G4SA 2YU9H 3GTLH 1CSPA 1QUQA 5LMUL 4JBMA 3STBC 2UUCL 4BY1H 5JEAG 1PH3A 3UDIA 5M5XH 2K50A 4KHPL 1Q46A 1N8RC 4A3GH 3T1HL 2KHIA 2KENA 2NVTH 1H95A 5HY6A 5IWAL 4R4IA 1EYGA 4OO1G 2BA0A 4A3IH 2B3GA 1HNWL 2EXDA 4GN3B 1IBLL 2VUMG 1PYSB 4DR5Q 4A3KG 4PG3A 2ZJQA 5H1SE 3ULPA 1EFWA 2LSSA 1Q8KA 5C4XG 1KXLA 3F8TA 1YJNA 4DR3Q 1WCMG 1NTGA 1EUJA 2QGQA 2EQSA 2MO0A 3W1BA 4YY3L 3HKZG 1Z9FA 2DGYA 2RF4A 4A3KH 3OTOQ 2VQFL 2ATWA 2VUMH 3GTQH 1K83H 3CPFA 5HGQA 4YWMA 4GLAC 4OWTB 4X66Q 1PH4A 1VQCA 3CD6A 3CC7A 2JE6I 1PH8A 3PO3G 3S14H 4B3SQ 2ZM6L 4A3CG 4A93G 2OQ0A 5EAYA 2K5VA 3ZJYC 1XPUA 1QVFA 2HHHQ 3BJUA 1DGSA 1L2FA 2Z0SA 3ER0A 5IT9c 5IP7G 1X3EA 1GD7A 3I55A 4JI6Q 4DAMA 1PH2A 3EIVA 4AYBG 3G48A 3U50C 3U4ZA 4DV4Q 3I4MG 4K0KL 1VS0A 4FDBA 4JI1Q 4EQ5A 2JK8A 5C3EH 2JA8H 4NPSA 1XTDA 3GO5A 4QL5A 3PUYA 4DR2L 3W5OA 2K5HA 4HJ8A 1XNQQ 1EWIA 2IHEA 5M3MG 4DV1L 1MJEA 4DR4Q 2OWOA 2UUBL 1OXTA 1IYJB 4DV3L 4JYAL 3KYHC 3CXCA 2VW9A 4YCVA 2R7ZH 3D31A 4LFCQ 4LW1A 4TQUS 4Y7NH 3ICEA 3GTKH 4OO1I 5M3MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4O A;  1ASY A;  2EIF A;  3TS0 A;  3HOU H;  1VQK A;  1PH7 A;  2Y0S E;  2KHJ A;  2L15 A;  2A1A A;  3PO2 G;  3J7A 5;  1X55 A;  1J5E L;  2Q2I A;  1GO3 E;  2LXJ A;  1OXU A;  3L0O A;  3HOX H;  3CF5 A;  4DR6 L;  2IT1 A;  5LMN Q;  1HR0 W;  4GKJ L;  5AJ3 Q;  5IYB G;  1IBK L;  1YVC A;  3HFZ B;  4B3M L;  4BY7 G;  1E7Z A;  3M3Y H;  4DV2 Q;  4HJA A;  4L5Q A;  4DNI A;  2F4V Q;  1LYL A;  2ZJP A;  2HQL A;  5GAG C;  5M5W H;  1W2B A;  1JT8 A;  3M7N A;  1VQI A;  1SN8 A;  1UE6 A;  3TEH B;  3D0F A;  2Q2U A;  1P8L A;  4LF7 L;  1EIY B;  3HOW G;  1BVS A;  3GD7 A;  4HIM A;  1ASZ A;  3F2B A;  3OTO L;  3S2H H;  1V43 A;  2Z6K A;  3FHW A;  1SLJ A;  4BBR G;  3DLL A;  4IO9 A;  3CCV A;  1KHI A;  4C3J H;  4DR1 L;  2CFM A;  5IYD G;  5LMN W;  1N36 Q;  1OXS C;  4JI6 L;  2IX1 A;  4P75 A;  1FVI A;  1UE1 A;  3RLF A;  1VQ7 A;  1VQ6 A;  3BU2 A;  1VQM A;  1IZ6 A;  1YI2 A;  4A3L G;  4A3F H;  2A8V A;  3H0G H;  3VDY A;  1CKN B;  2JA8 G;  2VZA A;  5IYD H;  4IOC A;  1UE5 A;  2RCN A;  4AIM A;  1FJG Q;  3PCO B;  4WJ4 A;  4NXN Q;  4B3T L;  2VNU D;  3KDF B;  4A3J G;  4UY8 C;  4IOA A;  3MXN B;  4IPD A;  2HT1 A;  4X64 L;  4LF6 Q;  1WJJ A;  1IBM Q;  3M4O H;  2JQO A;  2WAQ E;  2VS1 A;  4P72 A;  2N49 A;  3EBE A;  1WYD A;  4LF4 L;  4JI8 Q;  4OXP A;  3HOZ G;  1B8A A;  4A3J H;  4LNQ A;  4MZ9 A;  1T9H A;  1QZH A;  4JI2 L;  4UP9 A;  4GOP B;  5FJ8 H;  2JEA I;  3CQZ H;  3M9B A;  2ASB A;  3I4N G;  2IY5 B;  3IRB A;  3B6Y A;  4DV7 Q;  1Q7Y C;  4LUV A;  3HOZ H;  2KBN A;  1CKN A;  4IPC A;  3PF5 A;  4JI5 Q;  4AQY Q;  4A3D H;  2ZTE A;  2E2J H;  4HIO A;  2C35 B;  1SMX A;  4DV0 Q;  4DK6 C;  1VQP A;  4LFA Q;  2BH8 A;  5GQO A;  4DAY B;  1SFO H;  1VQB A;  5JEA J;  1KD1 C;  3I4N H;  3KDF A;  2MO1 A;  1E1O A;  2YV5 A;  4JI4 Q;  1TXY A;  5C0X G;  1VQF A;  5BR8 L;  3ULL A;  1X9N A;  5FLM G;  4AH6 A;  4QJF A;  4JI0 L;  4NXM L;  3Q8D A;  4HIK A;  4J15 A;  1JB7 A;  3GTP H;  3RR5 A;  2VY3 A;  1PA6 A;  4A3M G;  2UXC L;  2A19 A;  3U4V A;  4GNX C;  2WP8 J;  2K14 A;  2BH2 A;  4B3R L;  2R6G A;  4GOP A;  1G29 1;  1VQN A;  4JBK A;  4X62 Q;  1FGU A;  1Q1B A;  4YWL A;  5IYC G;  3GTJ H;  4JI7 Q;  4PZ7 A;  4JBJ A;  1KAW A;  2JA7 G;  4JV5 L;  2K52 A;  4A3M H;  1EQQ A;  4RG1 A;  4IJL A;  3PUX A;  2CWP A;  4DV6 L;  2I5M X;  1YEZ A;  3A0J A;  2PI2 E;  5IYC H;  1G51 A;  4YHH Q;  3A5U A;  2E5L L;  5C4J H;  3NEN A;  4GLX A;  2Y0S G;  1K73 C;  5ELO A;  4DUY Q;  2NVQ H;  3T1Y L;  3RZD H;  2PMZ E;  4DR7 Q;  3CC2 A;  4NXN L;  4IJH A;  1E24 A;  1NY4 A;  2UXD L;  1D7Q A;  2AMC B;  4LF9 L;  1I94 L;  1JJG A;  1WI5 A;  1G6P A;  2F52 A;  1KRS A;  4R4T A;  2UU9 Q;  3HKS A;  3GTG H;  3CCL A;  4L5R C;  2BA1 A;  2ZJR A;  1HR0 L;  3S17 H;  4GKK Q;  1N32 Q;  5C4X H;  3CCE A;  1WCM H;  4A76 A;  2GN5 A;  1VQ8 A;  2E8G A;  4HJ7 A;  2GVA A;  4OWX B;  5C0X I;  3U58 A;  3E9H A;  3M4P A;  1RIP A;  2PQA B;  2YTY A;  4YCU A;  1C7Y A;  1IL2 A;  4BY7 H;  1GKH A;  4DV7 L;  4RMF A;  2UXB L;  1YBY A;  2ID0 A;  1C9O A;  3PO3 H;  1SRO A;  4A93 H;  3PSI A;  4A3C H;  4LFA L;  5J3B A;  4BA2 I;  3K8A A;  2Q2H A;  5IP7 H;  2VQE Q;  1L0W A;  2JA9 A;  1YHB A;  1PH6 A;  3PIO A;  2I5H A;  1XMO L;  3I4M H;  4LF5 L;  3KFU A;  4C3H H;  4DKA C;  3G6E A;  3M4Q A;  4WJ3 M;  2OCE A;  1YHQ A;  2N78 A;  4P71 A;  2N3S A;  3CMA A;  1VQJ A;  3HOY G;  2Q2T A;  2WAQ G;  1HNZ Q;  3H3V I;  1VQ9 A;  2PQA A;  4R4C A;  4DV5 Q;  1KIX A;  2IHF A;  2DUD A;  1XMQ Q;  3UDF A;  1Y1W G;  1HNX L;  4OX9 Q;  1LTL A;  3I7F A;  1XNR Q;  1PYB A;  1XPO A;  1WOC A;  1Y1V G;  3HOY H;  3FKI G;  4JI3 Q;  1PFS A;  1XPR A;  4JCV E;  1QVG A;  1Y1W H;  2AHO B;  3DM3 A;  3A74 A;  3KJP A;  3S2D H;  1I5F A;  2PI2 A;  3CPW A;  1OTC A;  3PO2 H;  4DR5 L;  1Q86 C;  3NEL A;  1E3P A;  3S16 H;  3FKI H;  3F2D A;  4A3E G;  1YJ9 A;  3RLO A;  5FLX c;  1EQR A;  1N33 Q;  4DR3 L;  5IYB H;  1HH2 P;  1NBW A;  1VQH A;  1Y14 B;  1SRU A;  2GVB A;  2CCZ A;  4P74 A;  1CSQ A;  1A62 A;  2RHQ B;  3CCJ A;  4GKK L;  1N32 L;  2NZH A;  4X66 L;  4DUZ Q;  4A3E H;  1EIF A;  2R93 G;  2R7D A;  2JA6 G;  1KRT A;  1W3S A;  3KF6 B;  4O2D A;  3TQY A;  4B3S L;  3HOW H;  2H5X A;  3E9I A;  2NVX H;  4Y52 H;  2HHH L;  3BZC A;  2UUA Q;  5ELN A;  4BBR H;  5M3F G;  3HKZ E;  2B29 A;  2WB1 E;  4HJ9 A;  3BZK A;  4KHZ A;  4YWK A;  4DV4 L;  1X3F A;  1PH5 A;  3CAM A;  3JC6 6;  1YHA A;  1YZ6 A;  3SGI A;  2I0Q A;  2D0O A;  1N34 Q;  4JI1 L;  3K0X A;  4A4I A;  1K8A C;  2MFI A;  3NEM A;  4ME3 A;  4A3L H;  2CQO A;  5M3F H;  4HID A;  4XIG S;  5C0X J;  1NMG A;  1XNQ L;  4DR4 L;  5LMU Q;  1TWA H;  4AYB E;  2UUC Q;  3S15 H;  5JJI A;  3CC4 A;  4LFC L;  3T1H Q;  3KF6 A;  4LUZ A;  4OON A;  2B63 G;  5IWA Q;  2R92 G;  4L5S A;  3TS2 A;  3NBH B;  1J6Q A;  1XMQ L;  1D8L A;  4QY7 A;  4LF8 Q;  3AFQ A;  1K8G A;  5IE8 A;  3J80 i;  4GNX B;  1M1K C;  3J81 j;  2B63 H;  3CCS A;  4BA1 I;  2R92 H;  1VQA A;  4A75 A;  4YY3 Q;  4UPA A;  5M5Y H;  4JC0 A;  5LMN L;  5AJ3 L;  1HZC A;  2VQF Q;  2OTL A;  3I56 A;  4BBS H;  2ALY B;  2JEB I;  3H15 A;  4DV2 L;  1R9T H;  5GAD C;  3M85 A;  2F4V L;  1MKH A;  4PMW A;  4IPG A;  4KLK A;  2ZM6 Q;  4QQB X;  1LM0 A;  1I50 H;  2MQH A;  5FLM H;  4A3B G;  3TRZ A;  2D0P A;  1M90 C;  1FL0 A;  2YTV A;  4JOI C;  1EOV A;  1VQO A;  2JA5 G;  4IFD G;  4K0K Q;  2NVY H;  3RN2 A;  3ERS X;  3S24 A;  1O7I A;  3UDG A;  2RHS B;  2CWA A;  4GNX A;  1N36 L;  4A3B H;  3PV0 A;  2ZTD A;  1HJP A;  2XGT A;  1QZG A;  4H02 A;  3TRE A;  2KCT A;  4JBW A;  2JA7 H;  4LFB Q;  3RZO H;  4DV1 Q;  4JYA Q;  1IXR A;  3CCQ A;  2UUB Q;  3PUZ A;  1AE3 A;  1FJG L;  2V1C C;  4BY1 G;  1X6O A;  1KL9 A;  1QVC A;  1HZ9 A;  3H3V H;  1CUK A;  2I5L X;  3UDX A;  5C44 G;  3G71 A;  4NB3 A;  1IBM L;  4LF6 L;  4A3I G;  1JJ2 A;  4JI8 L;  3UE0 A;  3S1Q H;  1X56 A;  1J5E Q;  4DR6 Q;  2PNH A;  4GS3 A;  1NMF A;  1VQE A;  1SE8 A;  1VCI A;  3K7U C;  3UE1 A;  5C44 H;  4PZ6 A;  3CCM A;  3J80 c;  1JMC A;  1IBK Q;  4GKJ Q;  2JJQ A;  4B3M Q;  4YCW A;  3S1M H;  1XJV A;  1JJC B;  2NZO A;  1N9W A;  4JI5 L;  4C2M H;  1RL2 A;  4AQY L;  4LF8 L;  4DV0 L;  4GN5 A;  1UEB A;  1X3G A;  1X54 A;  2XTI A;  4LF7 Q;  4LWC A;  3STB D;  1LUZ A;  4JI4 L;  1PH1 A;  3PUW A;  1B7Y B;  2WB1 G;  4R4Q A;  3K7A H;  1Q12 A;  4TVA B;  4BBS G;  4IFD I;  1VQG A;  3LGJ A;  3WWV A;  4DR1 Q;  1SR3 A;  2FXQ A;  4UP7 A;  5DLQ E;  3L2P A;  2ES2 A;  5IY0 A;  2K5N A;  4QGU A;  1A8V A;  1UWV A;  1YIJ A;  1JE5 A;  5C3E G;  4X6A H;  1TWC H;  3K81 C;  4IPH A;  4X62 L;  1MIU A;  3AEV A;  4JI7 L;  3RNU A;  3J81 i;  3FP9 A;  1CKM A;  1PHJ A;  1HZB A;  3S1N H;  1PVO A;  3E0E A;  4B3T Q;  1AE2 A;  4HJ5 A;  3KJO A;  1V9P A;  2R7Z G;  3I4O A;  1K9M C;  4O0A A;  4X64 Q;  4YHH L;  3HOV G;  3KF8 B;  1I6H H;  4DPG A;  2VL6 A;  4LF4 Q;  4POG A;  1Y1V H;  4DUY L;  2E2H H;  5K36 G;  1GVP A;  1U0L A;  3HOU G;  5E7N A;  3CCR A;  3ULJ A;  4DR7 L;  4JI2 Q;  3HOV H;  1Q82 C;  3HOX G;  1U5K A;  4X65 Q;  2UU9 L;  3GDE A;  2IX0 A;  1NJI C;  5GAH C;  3EN2 A;  4POF A;  4OWW B;  4LFB L;  2K4K A;  1X65 A;  1OXV A;  3K80 C;  2AWN A;  4MTN A;  1K3R A;  2AKW B;  3JAM i;  1KQS A;  5BR8 Q;  1C0A A;  1I3Q H;  1Q81 C;  4KI0 A;  1E1T A;  1GM5 A;  2Z6K C;  4JI0 Q;  4NXM Q;  1BBU A;  2R93 H;  2JA6 H;  1NE3 A;  1TWG H;  1TWH H;  2HIX A;  2UXC Q;  2KCM A;  3AQQ A;  1V1Q A;  4BXX G;  4B3R Q;  1P16 A;  1AH9 A;  3KOJ A;  4JG2 A;  3GTM H;  2VQE L;  1HZA A;  2WFW A;  5JJK A;  5JJL A;  3PGZ A;  3PUV A;  3J7Z C;  4JV5 Q;  1A63 A;  4A3F G;  1Q1E A;  3H0G G;  1S3O A;  4BXX H;  3J81 c;  4C3I H;  4DV6 Q;  4KHP Q;  1K0R A;  4PZ8 A;  5GAE C;  2E5L Q;  1HNW Q;  1HNZ L;  2QA4 A;  4DV5 L;  3OW2 A;  1IBL Q;  1B70 B;  2NN6 G;  4OX9 L;  3A5Z B;  1MJC A;  3CCU A;  1VQL A;  2HIV A;  1XNR L;  4EX5 A;  1L1O B;  4MNO A;  3T1Y Q;  1WFQ A;  4GN4 B;  4IFD J;  2QEX A;  2F3I A;  4LUO A;  1S72 A;  2UXD Q;  2MNA A;  4LF9 Q;  4JI3 L;  1I94 Q;  1VQ5 A;  2OTJ A;  1S40 A;  1UE7 A;  3S1R H;  4QIW E;  5FJ8 G;  1CKO A;  2CKZ B;  2N8N A;  2OQK A;  2YTX A;  3OYY A;  2K75 A;  1HR0 Q;  3KLW A;  3W1G A;  5GRO A;  1L1O C;  5IP9 G;  1TWF H;  4A3D G;  1YNX A;  1OXX K;  1N33 L;  1Z47 A;  2R7F A;  4L5T A;  2E2I H;  1VQ4 A;  4R1J A;  4X65 L;  2UXB Q;  5IP9 H;  1QUQ B;  3JAM c;  3I2Z A;  1E22 A;  3CP0 A;  4DUZ L;  1L1O A;  4APV A;  3F2C A;  4UP8 A;  4GOP C;  3AYH B;  4GLV B;  4XTC S;  3RN5 A;  3CW2 C;  4DK3 C;  4DR2 Q;  1KC8 C;  3RLN A;  2ZTC A;  1XMO Q;  3L7Z C;  1YJW A;  2JA5 H;  2UUA L;  1VQD A;  4LF5 Q;  4JOI A;  2D62 A;  4DV3 Q;  2AWO A;  1PV4 A;  2LXK A;  3MEF A;  4ALP A;  1YIT A;  3GTO H;  1N34 L;  3F1Z A;  3PIP A;  3CME A;  3AFP A;  2YYZ A;  1PH9 A;  2NN6 I;  3PF4 A;  4A3G G;  1A0I A;  4P73 A;  1BKB A;  1BBW A;  1HNX Q;  3G4S A;  2YU9 H;  3GTL H;  1CSP A;  1QUQ A;  5LMU L;  4JBM A;  3STB C;  2UUC L;  4BY1 H;  5JEA G;  1PH3 A;  3UDI A;  5M5X H;  2K50 A;  4KHP L;  1Q46 A;  1N8R C;  4A3G H;  3T1H L;  2KHI A;  2KEN A;  2NVT H;  1H95 A;  5HY6 A;  5IWA L;  4R4I A;  1EYG A;  4OO1 G;  2BA0 A;  4A3I H;  2B3G A;  1HNW L;  2EXD A;  4GN3 B;  1IBL L;  2VUM G;  1PYS B;  4DR5 Q;  4A3K G;  4PG3 A;  2ZJQ A;  5H1S E;  3ULP A;  1EFW A;  2LSS A;  1Q8K A;  5C4X G;  1KXL A;  3F8T A;  1YJN A;  4DR3 Q;  1WCM G;  1NTG A;  1EUJ A;  2QGQ A;  2EQS A;  2MO0 A;  3W1B A;  4YY3 L;  3HKZ G;  1Z9F A;  2DGY A;  2RF4 A;  4A3K H;  3OTO Q;  2VQF L;  2ATW A;  2VUM H;  3GTQ H;  1K83 H;  3CPF A;  5HGQ A;  4YWM A;  4GLA C;  4OWT B;  4X66 Q;  1PH4 A;  1VQC A;  3CD6 A;  3CC7 A;  2JE6 I;  1PH8 A;  3PO3 G;  3S14 H;  4B3S Q;  2ZM6 L;  4A3C G;  4A93 G;  2OQ0 A;  5EAY A;  2K5V A;  3ZJY C;  1XPU A;  1QVF A;  2HHH Q;  3BJU A;  1DGS A;  1L2F A;  2Z0S A;  3ER0 A;  5IT9 c;  5IP7 G;  1X3E A;  1GD7 A;  3I55 A;  4JI6 Q;  4DAM A;  1PH2 A;  3EIV A;  4AYB G;  3G48 A;  3U50 C;  3U4Z A;  4DV4 Q;  3I4M G;  4K0K L;  1VS0 A;  4FDB A;  4JI1 Q;  4EQ5 A;  2JK8 A;  5C3E H;  2JA8 H;  4NPS A;  1XTD A;  3GO5 A;  4QL5 A;  3PUY A;  4DR2 L;  3W5O A;  2K5H A;  4HJ8 A;  1XNQ Q;  1EWI A;  2IHE A;  5M3M G;  4DV1 L;  1MJE A;  4DR4 Q;  2OWO A;  2UUB L;  1OXT A;  1IYJ B;  4DV3 L;  4JYA L;  3KYH C;  3CXC A;  2VW9 A;  4YCV A;  2R7Z H;  3D31 A;  4LFC Q;  4LW1 A;  4TQU S;  4Y7N H;  3ICE A;  3GTK H;  4OO1 I;  5M3M H; 
#chains in the Genus database with same CATH topology
 4PV1 C;  1GUO A;  2KQ3 A;  4R4O A;  2EIF A;  1RCV D;  1PFM A;  1EZ8 A;  5CV4 A;  3VR2 A;  1LTB D;  5FLX E;  1TU2 B;  3CF5 A;  2D9U A;  5M5Y B;  1UEA B;  2IT1 A;  5AJ3 Q;  1IBK L;  1YVC A;  4B3M L;  3L9A X;  1R9T B;  3KK7 A;  3D4W A;  1QWY A;  3DEP A;  2ZJP A;  1CZW A;  1KLU D;  4DFA A;  1VQI A;  1ESR A;  3NWT A;  4LF7 L;  1SNC A;  4N9T A;  4HIM A;  1SYD A;  1V43 A;  2Z6K A;  1KHI A;  3MXG A;  2K05 A;  3PMF A;  4L6T B;  1N36 Q;  4A3B B;  1OXS C;  1FVI A;  3SEB A;  1BQQ T;  1IZ6 A;  2K5Q A;  3SR1 A;  4A3F H;  4A3L G;  3NXW A;  2LFN A;  1CFM A;  2VZA A;  3HS0 C;  2P5Z X;  1UE5 A;  4WJ4 A;  3T4A C;  2VNU D;  4A3J G;  2Y0S B;  3A55 A;  5IGF A;  2HT1 A;  1IBM Q;  3E6Z X;  1E2Z A;  2VS1 A;  4IUU A;  3S1Q B;  2K03 A;  3BG3 A;  4A3J H;  5J22 A;  1QZH A;  3I4N G;  2ASB A;  5CV6 A;  1Q7Y C;  3K5L A;  2B8F A;  1EIH A;  3K0Y A;  3MEH A;  2E2J H;  1AH9 A;  1RD9 D;  1SMX A;  3N6R A;  4DK6 C;  1VQP A;  1JWU D;  4DAY B;  3GTM H;  3I4N H;  1JCK B;  3KDF A;  2MO1 A;  1E1O A;  4JI4 Q;  2EYH A;  1X9N A;  1LO5 D;  4AH6 A;  3Q8D A;  3OMC A;  4JK1 C;  3RR5 A;  1TS2 A;  1ET6 A;  2UXC L;  4GNX C;  1WD1 A;  3R3O A;  4X62 Q;  3P7J A;  1Q1B A;  4JBJ A;  4X3T A;  1RJT A;  2JA7 G;  1SAP A;  2L11 A;  4RG1 A;  2WAQ B;  1J8I A;  1YEZ A;  3A0J A;  2PW7 A;  2G9D A;  3RD4 A;  5DM6 3;  1HA5 A;  5ELO A;  2Z8L A;  4DR7 Q;  4NXN L;  2AMC B;  2F52 A;  1QCB D;  4GKK Q;  1D6E C;  4DK0 A;  1HR0 L;  1N32 Q;  2EYF A;  4H13 C;  1WCM H;  2E8G A;  5JPM C;  5C0X I;  3KLS X;  2RQX A;  5I9P A;  1FD7 D;  2R93 B;  5C6A A;  4RMF A;  2KHS A;  3VA7 A;  2JA6 B;  1TWG B;  1TWH B;  1C9O A;  4JW0 A;  4G4K A;  3QR8 A;  2JYO A;  4LFA L;  5J3B A;  1B3Q A;  1L0Y B;  5FO9 B;  2KVM A;  4Z9C B;  1SYB A;  3G6E A;  5ISR A;  2N78 A;  4P71 A;  4QCL A;  1C8C A;  1B53 A;  3H3V I;  2PMZ B;  2PQA A;  4R4C A;  1ZYR D;  4DV5 Q;  1KIX A;  1AN8 A;  2DUD A;  2EYO A;  3K5O A;  1F77 A;  1XMQ Q;  5C4Z A;  2RKS A;  3I7F A;  1PYB A;  3Q22 A;  5CYU A;  4IUR A;  1PFS A;  2SDF A;  3I91 A;  1GXD C;  3PO2 H;  1IW7 C;  1Q86 C;  1KAA A;  5FLX c;  4FXG C;  1EQR A;  2EYJ A;  3TZU A;  4EQO A;  1N33 Q;  5IYB H;  2PO4 A;  1HTP A;  1VQH A;  1CSQ A;  2NVY B;  3CRK C;  3OSO A;  4O2D A;  3TQY A;  1F2L A;  4B3S L;  3HOW H;  3I90 A;  1NCV A;  2Z9H A;  5D65 A;  3VA5 A;  1SNP A;  2B29 A;  3D6W A;  1X3F A;  1JR0 D;  1PZK D;  2AQ1 B;  4JI1 L;  2L4N A;  2L0C A;  2YU9 B;  1A3T A;  1NMG A;  1XNQ L;  4BY1 B;  3S15 H;  4KTA A;  5M5X B;  5JJI A;  1DOK A;  1DYQ A;  2NVT B;  2EJG C;  2HDL A;  1RF2 D;  4HMI A;  3ERQ A;  2GA4 B;  3I73 A;  1TS3 A;  4QY7 A;  5COR A;  5EJW A;  1M1K C;  1F9Q A;  3NQI A;  4UPA A;  4FXD A;  1K83 B;  5AJ3 L;  1B3A A;  2B2T C;  3OPO A;  3H15 A;  1B9M A;  2Q8I B;  3NBI A;  4IPG A;  2HDM A;  4BBS B;  3DWQ A;  2CQA A;  5FLM H;  4ZCK A;  1M90 C;  1O80 A;  1FL0 A;  2Z4H A;  1VQO A;  4R8I A;  1WTV A;  3VYT A;  3FEW X;  4GNX A;  1N36 L;  4AYB B;  1SYF A;  3MTS A;  4JBW A;  2RDG A;  1Y8N B;  3PUZ A;  3OIQ A;  1YNN D;  3J80 E;  2M9V A;  3UDX A;  1IBM L;  4OEL B;  2G5D A;  2VXW A;  3OMG A;  4OIK A;  4DR6 Q;  1VQE A;  3UE1 A;  3K7U C;  3CCM A;  4GKJ Q;  3QB3 A;  4RFB A;  1HQM C;  3S1M H;  1JJC B;  3FDT A;  4RH6 A;  5HUR A;  1RL2 A;  1WTO A;  4GN5 A;  1UEB A;  3IL8 A;  5JAV A;  4ODG A;  2M2L A;  4JI4 L;  1B7Y B;  2WB1 G;  3CHB D;  1Q12 A;  2E2D C;  4TVA B;  4IFD I;  1VQG A;  2A74 C;  2KA7 A;  5IY0 A;  1A8V A;  1YIJ A;  4A3F B;  4X62 L;  3C2P A;  1HZB A;  2SNM A;  2F0H A;  1LT5 D;  4B3T Q;  1X3P A;  3I4O A;  3HOV G;  2O4X A;  4O0A A;  5I6W A;  2RVL A;  4H7B A;  4X3K A;  3GQB A;  2HUG A;  4A3J B;  3DMU A;  2XN9 C;  1U0L A;  3HOU G;  5A2Q L;  3CCR A;  4DR7 L;  4JI2 Q;  4K8I A;  3HOV H;  5KYI A;  1SYG A;  1PRT F;  2B2Y C;  3I70 A;  3I72 A;  1GUG A;  3T51 B;  2E2J B;  4ILW A;  3GTM B;  1PRT D;  4POF A;  4NKL A;  4PNY A;  3I4N B;  3DXJ C;  1SYC A;  5LL6 S;  1X65 A;  3K80 C;  2AKW B;  1FNU A;  4KJO A;  1KQS A;  5BR8 Q;  5KYL A;  1B50 A;  1G8Z D;  1GM5 A;  1BBU A;  1PTO H;  2VB2 X;  2KCM A;  4BXX G;  2MJ8 A;  4DA2 A;  5JJK A;  5JJL A;  3VR6 A;  2F3W A;  4BXX H;  4DV6 Q;  4KHP Q;  1DON A;  1U4L A;  3BYY B;  5GAE C;  1EY8 A;  4DV5 L;  3KLS A;  4NMZ A;  4EX5 A;  4MNO A;  3T1Y Q;  4GN4 B;  2QEX A;  2F3I A;  1S72 A;  2UXD Q;  2MNA A;  4LF9 Q;  3BS1 A;  1DD2 A;  3R2I A;  1S40 A;  2YTX A;  2ICI A;  3OYY A;  2WII B;  3KLW A;  1WCM B;  3W1G A;  1DCZ A;  5GRO A;  1N33 L;  1EY4 A;  4B9W A;  2R7F A;  3EVQ A;  4C1N I;  4XXE A;  2NYZ D;  2DY7 A;  3JAM c;  4UAI A;  2F03 A;  2JA8 B;  3ND9 A;  3AYH B;  1JOR A;  1NUC A;  4DK3 C;  2K01 A;  1B44 D;  3RLN A;  2ZTC A;  4XT3 B;  1ONL A;  2RCF A;  2JA5 H;  4LF5 Q;  2D62 A;  4DV3 Q;  2H1E A;  1A3U A;  4ALP A;  4CKB A;  1HTL D;  4RAU C;  2YYZ A;  2NN6 I;  3PF4 A;  4A3G G;  4HMJ A;  3G4S A;  1II3 A;  4DGZ A;  1CSP A;  1QUQ A;  3TP8 A;  2CVR A;  4QIW B;  3STB C;  3F2U A;  4I7Z C;  5JEA G;  3UDI A;  1IKL A;  1N8R C;  4A3G H;  1CTM A;  4OIJ A;  5HY6 A;  3SE0 A;  1HNW L;  3AB9 A;  3PO2 B;  1IBL L;  2VUM G;  1PYS B;  4DR5 Q;  2ZJQ A;  2A6E C;  1WTW A;  3OWF A;  1EFW A;  1M4V A;  2PQE A;  2LSS A;  3K57 A;  5C4X G;  3LX0 A;  3F8T A;  1EUJ A;  2EQS A;  2F0U A;  4EQN A;  3HKZ G;  2VUM H;  2PZW A;  4BY7 G;  2Z1C A;  4OWT B;  4X66 Q;  1SNQ A;  5E3F A;  4EVO A;  3HOW B;  3PO3 G;  1BR9 A;  4A93 G;  4A3C G;  5KND A;  5EAY A;  1EQV A;  4HCE A;  1T5X D;  5IP7 G;  1GD7 A;  1KAB A;  3G48 A;  4RGO S;  1D1I A;  4EQ5 A;  1ZEQ X;  5D3I B;  4ZYS A;  4C3H G;  3TP5 A;  5C3E H;  3PUY A;  3MZ5 A;  4DR2 L;  3W5O A;  2FFK B;  1EWI A;  4DR4 Q;  2PZT A;  3S15 B;  3DM1 A;  3OW7 A;  3U9O A;  3V05 A;  2R7Z H;  4LFC Q;  1EY9 A;  3ICE A;  1LT3 D;  4HCS A;  4OHJ A;  2G9H D;  4RHR A;  3TS0 A;  1Q3L A;  1PTO F;  2D5D A;  1VQK A;  2Y0S E;  3C46 A;  2L15 A;  1CA5 A;  1PTO D;  4DR6 L;  3L0O A;  1OXU A;  2RBM A;  5L37 A;  5EBD A;  4GKJ L;  3HFZ B;  1E7Z A;  3M3Y H;  3CU7 A;  4HJA A;  4L5Q A;  4DNI A;  2HQL A;  5GAG C;  1W2B A;  1SMY D;  3M7N A;  3TEH B;  3D0F A;  1P8L A;  2QDL A;  4HN7 A;  1EIY B;  3W3A A;  2WV6 D;  1ASZ A;  1HQR D;  3S2H H;  2B2V A;  1DOM A;  1GUN A;  5IYD G;  2ZT9 C;  1H9J A;  4P75 A;  1VQ6 A;  3VDY A;  1CKN B;  3OHX C;  5E4W C;  1EIG A;  1Y8O B;  5IYD H;  4AIM A;  3HZX A;  3PCO B;  4NXN Q;  4B3T L;  4UY8 C;  3P75 A;  1KTK A;  3RUZ A;  4IPD A;  2N88 A;  5EPL A;  2WAQ E;  1CK1 A;  5BN4 A;  2N49 A;  3K58 A;  4LNQ A;  2K04 A;  2QW7 A;  4MZ9 A;  4JI2 L;  4UP9 A;  4GOP B;  5FJ8 H;  2JEA I;  3M9B A;  3TP6 A;  3H3V C;  1IKM A;  5CMD A;  3S1M B;  2IY5 B;  4KD4 A;  3ITP A;  3J81 L;  1EYD A;  2PW5 A;  2KBN A;  4IPC A;  4K6D A;  3PF5 A;  4AQY Q;  2F1M A;  2ZTE A;  1HFG A;  4DV0 Q;  4LFA Q;  1KD1 C;  4XYO A;  3LWU A;  1TXY A;  5C0X G;  1VQF A;  5BR8 L;  4QJF A;  4J15 A;  4M1U B;  3D3R A;  1JB7 A;  3GTP H;  4LAA A;  2VY3 A;  2A19 A;  2KCN A;  1NAP A;  1G29 1;  4R9W A;  4FF4 A;  4ME5 A;  2L55 A;  5IYC G;  3GTJ H;  4JI7 Q;  1SSO A;  2K52 A;  2CWP A;  1SE2 A;  4DV6 L;  3J7A V;  2F0T A;  2I5M X;  4DAY A;  2PI2 E;  5IYC H;  4WOR A;  3A5U A;  5C4J H;  4GLX A;  3GV3 A;  3VR4 A;  4DUY Q;  1STH A;  3T1Y L;  3TZD A;  5C3W A;  3RZD H;  3HOV B;  2PMZ E;  1D7Q A;  4ZUJ A;  1E24 A;  2UXD L;  4KN4 C;  3EJI A;  5HGT A;  4LF9 L;  4G7O C;  1LLR D;  1JJG A;  1TY0 A;  1WI5 A;  3GTG H;  3HKS A;  4L5R C;  1BO0 A;  1EFI D;  1PFN A;  3R8B A;  1YNJ C;  2H4O A;  4KY7 A;  1VQ8 A;  3NQT A;  4BS9 A;  2LS0 1;  2YTY A;  4MN3 A;  1EY5 A;  1GKH A;  1PTO B;  2MHV A;  2ID0 A;  2XVS A;  1SRO A;  3K8A A;  2Q2H A;  2VQE Q;  4FXK C;  2BCO A;  2PYK A;  3I4M H;  4LF5 L;  3M4Q A;  2RSO A;  5C5L A;  3HG9 A;  2A6E D;  1VQJ A;  2EY2 A;  2K32 A;  2ZXR A;  2IHF A;  3UDF A;  1Y1W G;  1XPO A;  5IT9 L;  1Y1V G;  4JI3 Q;  4N9P A;  4K8J A;  1D5M C;  1Y1W H;  3DM3 A;  3KJP A;  2PI2 A;  2LKV A;  3CPW A;  4DR5 L;  1E3P A;  2K6A A;  1UNS A;  3F2D A;  4A3E G;  2EJF C;  3BDL A;  3D8G A;  1Y14 B;  4K5W A;  4CJ2 C;  2CCZ A;  3DWA A;  2RHQ B;  1A62 A;  1VDZ A;  4X66 L;  4A3E H;  1EIF A;  3QO2 A;  4TRD A;  1W3S A;  2NWG A;  4CJ0 B;  5DM7 3;  2H5X A;  2JA5 B;  2UUA Q;  5ELN A;  4KHZ A;  1Q8I A;  2BDO A;  3JC6 6;  2QEJ C;  3EA6 A;  3K0X A;  1K8A C;  4FYD A;  1H9S B;  4A3L H;  4JVZ A;  3TME A;  4CKE A;  4DR4 L;  5LMU Q;  4AYB E;  2UUC Q;  1S5E D;  4A3G B;  4LFC L;  1ILP A;  1JWM D;  3TS2 A;  5EQ0 A;  3PIO 3;  1D8L A;  2K28 A;  4KKU A;  3J81 j;  1VQA A;  2A68 C;  4MIU A;  2VUM B;  1HZC A;  2ALY B;  2JEB I;  5GAD C;  3QJY A;  3M85 A;  3K5N A;  2EJM A;  3M7G A;  3HKZ B;  4KLK A;  1G6Z A;  3DEO A;  4KY6 A;  2KEC A;  4QQB X;  1TQO A;  2MQH A;  2QF7 A;  3TRZ A;  3SVM A;  4RA8 A;  4IFD G;  4K0K Q;  1LTT D;  3RN2 A;  3ERS X;  5C3E B;  1MSG A;  3UDG A;  5IGC A;  2EZV A;  1UAP A;  2RHS B;  2CWA A;  2DJF C;  2XGT A;  2LMC B;  2JA7 H;  4LFB Q;  3A7A B;  3RZO H;  1RTO A;  4DV1 Q;  1IXR A;  4MTK A;  3CCQ A;  2UUB Q;  2R7Z B;  1D5X C;  2V1C C;  2SOB A;  1I4Q A;  2TMP A;  5C44 G;  3G71 A;  1K8O A;  4A3I G;  1EYA A;  1X56 A;  2PNH A;  1NMF A;  5LHY 1;  5C44 H;  1JIC A;  2PNR C;  4PZ6 A;  1ENA A;  2JJQ A;  3NHH A;  3M3Y B;  4K2K A;  3SDZ A;  1SYE A;  2NZO A;  4C2M H;  4AQY L;  4DV0 L;  1IYU A;  2XTI A;  1QG7 A;  2CH4 A;  4LWC A;  1B2T A;  1PH1 A;  3S2H B;  1IYV A;  3FVQ A;  5CV8 A;  1SBB B;  1SR3 A;  3L2P A;  4QGU A;  2K5N A;  3Q0A A;  1ICW A;  1TWC H;  1HUM A;  1JOK A;  4JI7 L;  3J81 i;  1U9R A;  1LTI D;  1ZXT A;  1S5D D;  3URY A;  3KJO A;  1A15 A;  2KJX A;  2A69 C;  4ZKB B;  5AFW A;  2PZU A;  1K9M C;  4X64 Q;  3KF8 B;  3AU7 A;  2VL6 A;  1SND A;  4POG A;  4DUY L;  5K36 G;  5E7N A;  4ID6 A;  3BYT B;  3T13 A;  2F0D A;  1Q82 C;  3HOX G;  2EOT A;  2IX0 A;  1NJI C;  5EKI A;  3EN2 A;  4OWW B;  3I4L A;  2E76 C;  1CHQ D;  1C0A A;  1PMR A;  3V2T A;  1Q81 C;  4NXM Q;  3GTP B;  1NE3 A;  3SK4 A;  2K33 A;  1BCP C;  1WTQ A;  3AQQ A;  4B3R Q;  1P16 A;  4C3J G;  3GTJ B;  2VQE L;  4JV5 Q;  1A63 A;  1KNE A;  3H0G G;  2HD3 A;  1I4G A;  1O7Z A;  3K5M A;  1EEI D;  5C4J B;  1HNW Q;  5BN3 A;  4L63 B;  3A56 A;  1IBL Q;  1B70 B;  2NN6 G;  3A5Z B;  3CCU A;  2NB0 A;  3RZD B;  1L1O B;  1ILQ A;  1WFQ A;  4LUO A;  3SHL A;  3TDQ A;  4JI3 L;  1VQ5 A;  3GTG B;  1LTG D;  3EFX D;  3KUP A;  3S1R H;  4QIW E;  1CKO A;  2N8N A;  1EU3 A;  3JAM E;  5IP9 G;  4A3D G;  1Z47 A;  5IGB A;  4L5T A;  1LTA D;  4R1J A;  5IP9 H;  4DNT B;  4APV A;  3A8J E;  5EGT A;  1JOQ A;  4UP8 A;  4GOP C;  5F2D A;  4GLV B;  5A35 A;  1HPC A;  4XTC S;  4DR2 Q;  4V19 0;  1KC8 C;  3I4M B;  2EY5 A;  4WJW A;  1XMO Q;  2UUA L;  2C5C A;  2WKD A;  3MEF A;  3TN2 A;  3IAY A;  1PXU A;  3PIP A;  3FPP A;  3AFP A;  1PYW D;  3BZD B;  1BBW A;  1PZJ D;  5LMU L;  4JBM A;  1STB A;  3TBI B;  2Q8R E;  2UUC L;  5G3L F;  3SK5 A;  1Y1W B;  2KHI A;  4KJN A;  1BNZ A;  4FP5 D;  5G3L D;  2NZ1 D;  2B3G A;  3NP8 A;  4G57 A;  4KN7 C;  2F0N A;  4PG3 A;  1QIL A;  1WTH A;  3ULP A;  3BDC A;  1KXL A;  2NBF A;  1V8Q A;  1ZKO A;  5C5M A;  2QGQ A;  3GV6 A;  1FGB D;  2DGY A;  2ATW A;  2IWH A;  4A3E B;  3FPU B;  3GTQ H;  2CW0 C;  1GUW A;  3MFG A;  5CV7 A;  2HQE A;  1STY A;  3H09 A;  2K5V A;  3ZJY C;  1K0S A;  4G7Z C;  5KRU A;  2Z0S A;  4JI6 Q;  1RDP D;  3VR5 A;  4DAM A;  1KNA A;  1PH2 A;  3A8I E;  5CGK A;  3J80 L;  1PLF A;  1VS0 A;  4K0K L;  4FDB A;  2JK8 A;  1PFB A;  5CR3 A;  4NPS A;  1QOH A;  3GO5 A;  4N8X 1;  4X3U A;  4HJ8 A;  4LFB L;  2IHE A;  5M3M G;  4DV1 L;  1JB3 A;  2UUB L;  1IYJ B;  3KYH C;  3C1E A;  2AQ3 B;  4HSP A;  1D1K A;  4RKB A;  4YCV A;  3D31 A;  4Y7N H;  4RHS A;  3GTK H;  5M3M H;  1ASY A;  4KY5 A;  4CDF C;  3HOU H;  2KHJ A;  1EOT A;  1X55 A;  2Q2I A;  1CQF A;  1GO3 E;  1CA6 A;  4QUC A;  4CBV A;  1HR0 W;  1SNO A;  1ML0 D;  1S5B D;  4DV2 Q;  2B2V C;  2F4V Q;  2LY7 A;  2IPK D;  3D6C A;  5M5W H;  1JT8 A;  1SN8 A;  1UE6 A;  2Q2U A;  3W2D A;  1JWS D;  2A69 D;  1GHJ A;  3FHW A;  4BBR G;  3DLL A;  1FNV A;  3I8Z A;  4IO9 A;  2I46 A;  3CCV A;  4B9X A;  2SNS A;  4U68 A;  5JVG 3;  1IW7 D;  2IX1 A;  1UE1 A;  2JA7 B;  3RZO B;  2RDF A;  1VQM A;  1BDO A;  1KDA A;  5TSS A;  1YI2 A;  1V1P B;  3Q24 A;  4WFN 3;  4IOC A;  2RCN A;  4DAV A;  1FJG Q;  5CBE E;  4IOA A;  3MXN B;  4X64 L;  1LTS D;  1WJJ A;  4LF6 Q;  3M4O H;  1SE4 A;  5NUC A;  1I6V C;  4IZ8 A;  1WYD A;  4OXP A;  2FHT A;  4WRD A;  5C44 B;  3MAQ A;  1WD0 A;  1Z6H A;  1CZG A;  4RWS C;  4RGM A;  2NTS A;  2NTT A;  1CKN A;  2F0M A;  3G6J B;  3WOE A;  2C35 B;  3L3O C;  2BH8 A;  5GQO A;  1TS4 A;  4HSV A;  2YV5 A;  4LK1 C;  2EYP A;  4NXM L;  4HIK A;  3GP7 A;  1PA6 A;  4A3M G;  1H9K A;  5CV5 A;  1X3Q A;  2WP8 J;  2K14 A;  2BH2 A;  5FO7 B;  4B3R L;  1PDQ A;  1TWC B;  2R6G A;  4NDX A;  4GOP A;  5EKL A;  1FGU A;  4YWL A;  4IN3 A;  5E4X A;  1KAW A;  4JV5 L;  4A3M H;  2B2W A;  3J7A F;  3T16 A;  4IJL A;  1HFN A;  2K1B A;  3OWE B;  1E0B A;  1ICF B;  4EGV A;  3NEN A;  4B08 A;  4DU9 A;  2Y0S G;  3ND8 A;  1K73 C;  4DXF A;  5JEA H;  3NSW A;  3CC2 A;  4IJH A;  1NY4 A;  1G6P A;  2F0S A;  1K3B C;  1KRS A;  4R4T A;  2UU9 Q;  3CCL A;  1DXM A;  2BA1 A;  2ZJR A;  4ABN A;  5C4X H;  4CDE C;  1TR5 A;  1MI2 A;  3DHQ A;  3HGB A;  4OWX B;  4KK7 A;  3M4P A;  1PRT B;  1RIP A;  4I65 A;  4YCU A;  1C7Y A;  1IL2 A;  4BY7 H;  4DV7 L;  5I2Y A;  3PO3 H;  1GUT A;  4A93 H;  4A3C H;  2DY8 A;  1STN A;  4ZRZ A;  5IP7 H;  1L0W A;  2JA9 A;  1YHB A;  3PIO A;  1XXG A;  2I5H A;  1XMO L;  4F7X A;  4IUV A;  4C3H H;  2ZXP A;  2OCE A;  5I6Y A;  1YHQ A;  1V1O A;  3CMA A;  2N3S A;  1EL0 A;  3HOY G;  1H9R A;  2WAQ G;  2Q2T A;  3RMH A;  1F9S A;  2R61 A;  1XNR Q;  3KBX A;  5ELC A;  1WOC A;  2M00 A;  1ESF A;  5ELF A;  3HOY H;  3FKI G;  3S1R B;  3LNN A;  4JCV E;  1QVG A;  2AHO B;  1U4M A;  3ONA B;  3A74 A;  5FKA C;  2K7V A;  1I5F A;  2TSS A;  3NEL A;  3BDO A;  3FKI H;  2V4D A;  3RLO A;  2KEE A;  5EBC A;  4R8N A;  2EY6 A;  1SRU A;  3I3C A;  2GVB A;  4FF2 A;  2NZH A;  4DUZ Q;  2R93 G;  2JA6 G;  3AMU A;  4HR7 B;  3KF6 B;  2HCC A;  3E9I A;  5C4H A;  1AZP A;  4JI6 L;  1EQT A;  5M3F G;  3HKZ E;  3BZK A;  3NE5 B;  5IGD A;  1U4R A;  3SGI A;  1YHA A;  3E5S A;  3J81 E;  2D0O A;  1N34 Q;  1E2V A;  2MFI A;  3NEM A;  4ME3 A;  5M3F H;  1EWH A;  1TWA H;  3O13 A;  3OIP A;  3D4D A;  2IX3 A;  1NR4 A;  2B63 G;  2R92 G;  3NBH B;  2R3Z A;  1J6Q A;  2RSN A;  2XRS D;  5KGU A;  2XNA C;  1QB5 D;  3IFT A;  3AFQ A;  3UI2 A;  5IE8 A;  1D5Z C;  3J80 i;  1K8G A;  2B63 H;  3CCS A;  3C1F A;  4BA1 I;  2R92 H;  4A75 A;  1H9S A;  4YY3 Q;  1QE6 A;  2F0W A;  4JC0 A;  3GTQ B;  4DV2 L;  4OGQ C;  2F4V L;  3S9W A;  2Q8T A;  4PMW A;  2WB1 B;  1EY6 A;  5C0X H;  1LM0 A;  1I50 H;  4JOI C;  1EOV A;  1EYC A;  1K28 A;  2NVY H;  1O7I A;  2L5T A;  5ELD A;  4TKO B;  2BE5 C;  3PV0 A;  1QZG A;  4H02 A;  2KCT A;  4YIJ A;  4H44 C;  3A54 A;  4N8F A;  1AE3 A;  2DN8 A;  4Y7N B;  1FJG L;  3GTK B;  1I4X A;  4BY1 G;  5M3M B;  1KL9 A;  1HZ9 A;  5IOC A;  3H3V H;  1CUK A;  2I5L X;  3OOC A;  4LF6 L;  3HOU B;  4RGT A;  3NK9 A;  1J5E Q;  1ET9 A;  2F0O A;  5LMN W;  1SE8 A;  3P20 A;  1CM9 A;  4YCW A;  1O78 A;  2FMM A;  1DOL A;  1JC7 A;  3MXP A;  1TKW B;  4LF8 L;  1ZYR C;  5DEH A;  1TY2 A;  3STB D;  1LUZ A;  3K7A H;  2KOL A;  4BBS G;  5BN5 A;  3VYS A;  5LL6 X;  2QCP X;  1A2U A;  4UHV A;  4DR1 Q;  2OT2 A;  4UP7 A;  4CKC A;  1ENC A;  1G2S A;  1UWV A;  4X6A H;  4IPH A;  4ULL A;  1IL8 A;  3FP9 A;  4RCO A;  3S1N H;  3K59 A;  5KEE A;  3E0E A;  4FVM A;  3M4O B;  5ELE A;  1I6H H;  1JQY D;  4DPG A;  1HUN A;  3E3X A;  1TT2 A;  4LF4 Q;  1Y1V H;  2E2H H;  1GUS A;  5EPK A;  4X3S A;  5IOD A;  2EXZ A;  4K2L A;  4FO2 A;  2UU9 L;  2WKC A;  3GDE A;  1X32 A;  5EKK A;  2K4K A;  2MPM A;  1OXV A;  4MTN A;  1T5E A;  2MP1 A;  4HED A;  3KF8 A;  3NTK A;  1I3Q H;  1QNK A;  4JI0 Q;  2B8G A;  1Z7T A;  2D2C C;  1V1Q A;  4C3I G;  4JG2 A;  2WFW A;  4CDC C;  1G2T A;  4BWG B;  4E6I A;  4A3M B;  3U9S A;  5FLX L;  3J7Z C;  4A3F G;  1Q1E A;  2F4I A;  1S3O A;  3J81 c;  4C3I H;  4O1N A;  1K0R A;  4DXG A;  2JP1 A;  4PZ8 A;  2E5L Q;  1B4O A;  2QA4 A;  1MJC A;  4G7H C;  1XNR L;  3NWS A;  1XTC D;  4KMU C;  1I94 Q;  2SEB D;  5FK9 C;  1FYC A;  2CKZ B;  2OQK A;  2K75 A;  5C4X B;  1AZQ A;  3H6M A;  1TWF H;  2RA4 A;  4BY7 B;  5D14 A;  2BOS A;  5IIF A;  1Y8P B;  2E2I H;  1BUV T;  1VQ4 A;  4X65 L;  4IUQ A;  2UXB Q;  2EE1 A;  3PO3 B;  2XRQ D;  4A93 B;  1YNN C;  3CP0 A;  4OL7 A;  1L1O A;  1I4P A;  4DUZ L;  1AFP A;  3F2C A;  1EY0 A;  1WTR A;  4FF1 A;  1U4P A;  3MC0 B;  1DZ1 A;  3L7Z C;  4IFD H;  1VQD A;  4C3H B;  4JOI A;  2B2U A;  1YIT A;  3GTO H;  4L8J A;  1N34 L;  3F1Z A;  3CME A;  1CI3 M;  4F88 A;  1KLG D;  2FJ2 A;  1PH9 A;  5DAU A;  1NSN S;  1A0I A;  5I2X A;  1BKB A;  3MFY A;  1HNX Q;  3GTL H;  1SDF A;  3HP3 A;  2QDB A;  1HA6 A;  3HOY B;  4P2C B;  1DM0 B;  1Q46 A;  4HTH A;  2KEN A;  4R4I A;  1ROD A;  2BA0 A;  4A3I H;  4LJZ C;  3FKI B;  4A3K G;  4QB4 A;  1XX8 A;  1Q8K A;  1MGS A;  4DR3 Q;  1JOO A;  1WCM G;  3N52 A;  5ELB A;  3X3M A;  4YY3 L;  4A3K H;  2A5H A;  2BE5 D;  3C3L A;  4GLA C;  2J4X A;  5IGG A;  1VQC A;  3CC7 A;  2JE6 I;  1PH8 A;  3S14 H;  3MHB A;  2OQ0 A;  1HRJ A;  1PZI D;  1QVF A;  1XPU A;  2HHH Q;  3BJU A;  1EWC A;  3ER0 A;  5IT9 c;  2JA8 G;  1F9P A;  3I55 A;  1X3E A;  1ENF A;  3U50 C;  3U4Z A;  4DV4 Q;  3MWY W;  4FNF A;  5M3F B;  2JA8 H;  1YNJ D;  1XTD A;  1PRT C;  2A6H C;  4QL5 A;  1O7Y A;  2K5H A;  1TWA B;  1MJE A;  3KBG A;  2OWO A;  3FMC A;  3QIA A;  5KNC A;  4LW1 A;  1CT1 D;  4OO1 I;  1R4Q B;  2DNE A;  5J1Z A;  1O7L A;  5C3X A;  5K36 H;  1PH7 A;  4K6L A;  2B63 B;  5T1G A;  2R92 B;  2A1A A;  3PO2 G;  1S5C D;  3J7A 5;  1J5E L;  2J0T D;  2LXJ A;  3HOX H;  2JXM B;  5LMN Q;  5IYB G;  2EDG A;  1LYL A;  1JE4 A;  1EU4 A;  1I50 B;  1G91 A;  2PCF B;  3HOW G;  1BVS A;  3GD7 A;  3F2B A;  3OTO L;  1SLJ A;  4KHV A;  4C3J H;  4DR1 L;  4GZY C;  1RHP A;  2CFM A;  3R2T A;  1VQ7 A;  3RLF A;  5JPN C;  3BU2 A;  1K8M A;  2A8V A;  3H0G H;  3MA2 B;  1XWE A;  1WVL A;  1VMC A;  4XQJ A;  2PPB C;  2I07 B;  3KDF B;  4Q5V A;  1IHZ A;  1A3V A;  2NN6 H;  3Q6S A;  5COY A;  5T1I A;  2JQO A;  2AQ2 B;  4P72 A;  1L0X B;  3MXU A;  2F0E A;  4ZUI A;  3EBE A;  4LF4 L;  1F2M A;  4JI8 Q;  3HOZ G;  1B8A A;  2CHB D;  4HAE A;  3G7L A;  2VB3 X;  1T9H A;  2E75 C;  4ZQ3 A;  3SK6 A;  1F9R A;  3CQZ H;  3IRB A;  3B6Y A;  4XDX A;  4DV7 Q;  4LUV A;  3HOZ H;  4JI5 Q;  4A3D H;  3ZYY X;  1V1P A;  4TSS A;  4HIO A;  1SFO H;  1VQB A;  5JEA J;  2EYL A;  3KLR A;  3QWN A;  3K7A B;  3MXN A;  3ULL A;  2AUK A;  5FLM G;  1B1Z A;  4JI0 L;  2B2W C;  2K5W A;  1DJR D;  3DUZ A;  2E74 C;  3T53 B;  3U4V A;  5J39 A;  2RDH A;  3NUC A;  1VQN A;  4JBK A;  1XYI A;  3WDN A;  3S1N B;  2A68 D;  4PZ7 A;  2OF1 A;  4ZK9 B;  3K6O A;  1NR2 A;  1EQQ A;  5I4D A;  3PUX A;  1BF4 A;  1I6H B;  1D2B A;  3JAM L;  1G51 A;  4YHH Q;  3T56 B;  2E5L L;  1EY7 A;  1Y1V B;  4U67 3;  3A8K E;  4K5V A;  4FF3 A;  2E2H B;  2NVQ H;  1SE3 A;  2F3V A;  1MHW C;  1I94 L;  2F0J A;  4LMQ D;  3M4Y A;  1AW7 A;  3S17 H;  2HCI A;  2ZXO A;  3CCE A;  4A76 A;  2GN5 A;  3J7Y W;  4HJ7 A;  2IJ0 A;  2GVA A;  3LWE A;  3U58 A;  4NW2 A;  3E9H A;  1I3Q B;  2PQA B;  5A2Q E;  2Z4I A;  4IUT A;  2UXB L;  1YBY A;  4KV6 A;  2AUJ D;  4RCN A;  3PSI A;  1HXY D;  4DK1 A;  2CH4 W;  4BA2 I;  2DJG C;  5D3D A;  1PH6 A;  1PTO C;  1EZ6 A;  3KFU A;  1W6K A;  1TVX A;  4C3I B;  2KED A;  4DKA C;  4IUP A;  4WJ3 M;  4OEM B;  1STG A;  4KKS A;  3Q23 A;  1HNZ Q;  1VQ9 A;  1SMY C;  4OX9 Q;  1HNX L;  1LTL A;  4XQQ A;  2EY1 A;  2F0K A;  1QNU A;  1XPR A;  1H9M A;  2L1B A;  4QUF A;  3S2D H;  1OTC A;  1TWF B;  3S16 H;  4M8A A;  1YJ9 A;  4DR3 L;  2E2I B;  4IAL A;  1HH2 P;  1NBW A;  4J8Q A;  4P74 A;  3CCJ A;  4GKK L;  2F0Q A;  1N32 L;  2A6H D;  2MGS A;  2R7D A;  4J1M A;  1KRT A;  1NNX A;  4DF7 A;  2NVX H;  4Y52 H;  1LAC A;  2HHH L;  3BZC A;  1E2W A;  2JSO A;  4BBR H;  5JJZ A;  4HJ9 A;  2B39 A;  2WB1 E;  3HEJ A;  4YWK A;  4DN4 M;  4DV4 L;  1PH5 A;  2J7Z A;  3CAM A;  2L9H A;  1YZ6 A;  2I0Q A;  3GTO B;  3E0J A;  2WAC A;  4A4I A;  2CQO A;  1C4Q A;  4HID A;  3GTL B;  3BVG A;  4UDU C;  4XIG S;  5C0X J;  5IGE A;  1STE A;  4EQP A;  5M9O A;  1BCP F;  3CC4 A;  3T1H Q;  3KF6 A;  4LUZ A;  1SNM A;  4OON A;  4A3I B;  5IWA Q;  4L5S A;  1BCP D;  1R4P B;  1XMQ L;  1M8A A;  4C2M B;  2F0F A;  2IL8 A;  1B9N A;  4LF8 Q;  4GNX B;  2KUM A;  2Z6B A;  5M5Y H;  4A3K B;  5LMN L;  2EYM A;  1A2T A;  1VMP A;  2VQF Q;  2KCC A;  2OTL A;  2NUC A;  3I56 A;  1F2Z A;  1R9T H;  3S14 B;  1MKH A;  1VF5 C;  1SJE D;  2ZM6 Q;  4JPB W;  5KIX A;  4PMC A;  1EEF D;  3NPP A;  2QIL A;  4A3B G;  2D0P A;  1BBX C;  4H0L C;  2YTV A;  3NBH A;  1C48 A;  4I7A A;  2B2T A;  3FRP B;  2JA5 G;  4RGN A;  3S24 A;  2O2L D;  3V96 A;  4A3B H;  2ZTD A;  1HJP A;  3TRE A;  4JYA Q;  3X3N A;  4CJ1 B;  4XYQ A;  1J9O A;  1X6O A;  1F2Y A;  1QVC A;  1RTN A;  1WTX A;  4NB3 A;  2OEO A;  2XWJ B;  1JJ2 A;  3QG1 A;  4JI8 L;  3UE0 A;  3S1Q H;  3HOX B;  4PMB A;  2N55 A;  4GS3 A;  1JMC A;  1VCI A;  3MVV A;  3J80 c;  1IBK Q;  4B3M Q;  1GOZ A;  2ENB A;  2XSC A;  3D4R A;  1XJV A;  4JI5 L;  4CDD C;  1N9W A;  1S5F D;  1MD2 D;  2XWB B;  3A7L A;  1X3G A;  5EPJ A;  1GJX A;  1X54 A;  4LF7 Q;  1Q90 A;  3PUW A;  1QJO A;  4R4Q A;  1WTP A;  4XT1 B;  3IKJ A;  4C56 C;  1UUP A;  4DAP A;  4C3J B;  3LGJ A;  3WWV A;  2FXQ A;  5DLQ E;  2ES2 A;  4CHT B;  1LT4 D;  1JE5 A;  5C3E G;  3H0G B;  3K81 C;  1MIU A;  3AEV A;  3RNU A;  1Y69 U;  1PHJ A;  1CKM A;  1PVO A;  2WIN B;  3CKI B;  1AE2 A;  4HJ5 A;  2CW0 D;  4Q0F A;  1V9P A;  2R7Z G;  4IQZ A;  1MSH A;  4YHH L;  5K5P A;  2EVB A;  2EPB A;  3NTI A;  2X69 A;  5I9O A;  1MBY A;  1GVP A;  1KDB A;  3ULJ A;  3CQZ B;  1HCZ A;  1TII D;  1U5K A;  5KNB A;  3HOZ B;  4X65 Q;  5DNF A;  4A3D B;  4QMG A;  4NP5 A;  5GAH C;  1SFO B;  1BCP B;  4V0B A;  3PIP 3;  2IW3 A;  2AWN A;  3QOL A;  4ZAI A;  1K3R A;  3JAM i;  2B2Y A;  4F8M A;  4S3S A;  4KI0 A;  1E1T A;  2R93 H;  2Z6K C;  3SXH A;  1I4R A;  2C9O A;  2FIN B;  1TWG H;  1TWH H;  2HIX A;  3P1H A;  4K14 A;  2JA6 H;  2UXC Q;  5FOB B;  2ICE C;  2OXP A;  3KOJ A;  3R93 A;  2DNC A;  1HZA A;  3PGZ A;  2F0V A;  3PUV A;  1GHK A;  4C1N K;  1AEX A;  1LT6 D;  1SXT A;  5CBA E;  3WOF A;  1CHP D;  2JN4 A;  4J6H A;  1HNZ L;  4XQN A;  3OW2 A;  4RKL A;  1STA A;  4OX9 L;  2NVQ B;  1VQL A;  2HIV A;  4IFD J;  1KDC A;  5CC4 A;  3TP7 A;  4KKT A;  2O5I C;  1W6J A;  2OTJ A;  1UE7 A;  3S17 B;  5FJ8 G;  1HR0 Q;  1L1O C;  4CGY B;  3NTH A;  1YNX A;  1OXX K;  2F0G A;  3QOJ A;  1BXT A;  4ZKC B;  3PQI A;  1QUQ B;  2B2U C;  3I2Z A;  1HHV A;  1E22 A;  1A6X A;  2F0I A;  4K5X A;  2F0L A;  3ERO A;  3SK8 A;  3BVM A;  2X6L A;  1TS5 A;  2X6G A;  3RN5 A;  3CW2 C;  4MHE A;  2MUY A;  1RKN A;  1BOS A;  3CRL C;  1YJW A;  1AP0 A;  2AWO A;  1PV4 A;  1VF7 A;  2LXK A;  3IFD A;  3HRZ C;  2F0P A;  2XIW A;  1FNW A;  1CQV A;  4ZLT F;  3VR3 A;  3EQL C;  4P73 A;  2YU9 H;  1SEB D;  4BY1 H;  2L12 A;  1LAB A;  1PH3 A;  4KHP L;  5M5X H;  2K50 A;  2A73 B;  5CV9 A;  3T1H L;  3VYR A;  2NVT H;  1H95 A;  5IWA L;  1EYG A;  4OO1 G;  3H91 A;  3S2D B;  4QF4 A;  2EXD A;  5JOB A;  4GN3 B;  4O42 A;  3S16 B;  5M5W B;  2K5D A;  4DNR B;  5H1S E;  2QKI C;  2O5J C;  4PQX A;  1YJN A;  1I4H A;  2FMC A;  1NTG A;  4OO1 H;  2MO0 A;  3W1B A;  5IT9 E;  3H94 A;  1Z9F A;  2RF4 A;  4IUN A;  5E1F A;  3OTO Q;  2VQF L;  1K83 H;  3CPF A;  5HGQ A;  4YWM A;  1PH4 A;  2BDN A;  3CD6 A;  5FO8 B;  2NVX B;  4B3S Q;  2ZM6 L;  1LV9 A;  3TSS A;  1S4Z A;  4BBS H;  1DGS A;  1L2F A;  4BBR B;  4KD3 A;  3EIV A;  4AYB G;  3I4M G;  4JI1 Q;  5JVH 3;  1OO9 B;  3VYU A;  1XNQ Q;  1FR3 A;  3BVZ A;  4JYA L;  1OXT A;  1SJH D;  4DV3 L;  3CXC A;  2VW9 A;  3DWP A;  1LTR D;  4TQU S;  4F87 A; 
#chains in the Genus database with same CATH homology
 4R4O A;  1ASY A;  2EIF A;  3TS0 A;  3HOU H;  1VQK A;  1PH7 A;  2Y0S E;  2KHJ A;  2L15 A;  2A1A A;  3PO2 G;  3J7A 5;  1X55 A;  1J5E L;  2Q2I A;  1GO3 E;  2LXJ A;  1OXU A;  3L0O A;  3HOX H;  3CF5 A;  4DR6 L;  2IT1 A;  5LMN Q;  1HR0 W;  4GKJ L;  5AJ3 Q;  5IYB G;  1IBK L;  1YVC A;  3HFZ B;  4B3M L;  4BY7 G;  1E7Z A;  3M3Y H;  4DV2 Q;  4HJA A;  4L5Q A;  4DNI A;  2F4V Q;  1LYL A;  2ZJP A;  2HQL A;  5GAG C;  5M5W H;  1W2B A;  1JT8 A;  3M7N A;  1VQI A;  1SN8 A;  1UE6 A;  3TEH B;  3D0F A;  2Q2U A;  1P8L A;  4LF7 L;  1EIY B;  3HOW G;  1BVS A;  3GD7 A;  4HIM A;  1ASZ A;  3F2B A;  3OTO L;  3S2H H;  1V43 A;  2Z6K A;  3FHW A;  1SLJ A;  4BBR G;  3DLL A;  4IO9 A;  3CCV A;  1KHI A;  4C3J H;  4DR1 L;  2CFM A;  5IYD G;  5LMN W;  1N36 Q;  1OXS C;  4JI6 L;  2IX1 A;  4P75 A;  1FVI A;  1UE1 A;  3RLF A;  1VQ7 A;  1VQ6 A;  3BU2 A;  1VQM A;  1IZ6 A;  1YI2 A;  4A3L G;  4A3F H;  2A8V A;  3H0G H;  3VDY A;  1CKN B;  2JA8 G;  2VZA A;  5IYD H;  4IOC A;  1UE5 A;  2RCN A;  4AIM A;  1FJG Q;  3PCO B;  4WJ4 A;  4NXN Q;  4B3T L;  2VNU D;  3KDF B;  4A3J G;  4UY8 C;  4IOA A;  3MXN B;  4IPD A;  2HT1 A;  4X64 L;  4LF6 Q;  1WJJ A;  1IBM Q;  3M4O H;  2JQO A;  2WAQ E;  2VS1 A;  4P72 A;  2N49 A;  3EBE A;  1WYD A;  4LF4 L;  4JI8 Q;  4OXP A;  3HOZ G;  1B8A A;  4A3J H;  4LNQ A;  4MZ9 A;  1T9H A;  1QZH A;  4JI2 L;  4UP9 A;  4GOP B;  5FJ8 H;  2JEA I;  3CQZ H;  3M9B A;  2ASB A;  3I4N G;  2IY5 B;  3IRB A;  3B6Y A;  4DV7 Q;  1Q7Y C;  4LUV A;  3HOZ H;  2KBN A;  1CKN A;  4IPC A;  3PF5 A;  4JI5 Q;  4AQY Q;  4A3D H;  2ZTE A;  2E2J H;  4HIO A;  2C35 B;  1SMX A;  4DV0 Q;  4DK6 C;  1VQP A;  4LFA Q;  2BH8 A;  5GQO A;  4DAY B;  1SFO H;  1VQB A;  5JEA J;  1KD1 C;  3I4N H;  3KDF A;  2MO1 A;  1E1O A;  2YV5 A;  4JI4 Q;  1TXY A;  5C0X G;  1VQF A;  5BR8 L;  3ULL A;  1X9N A;  5FLM G;  4AH6 A;  4QJF A;  4JI0 L;  4NXM L;  3Q8D A;  4HIK A;  4J15 A;  1JB7 A;  3GTP H;  3RR5 A;  2VY3 A;  1PA6 A;  4A3M G;  2UXC L;  2A19 A;  3U4V A;  4GNX C;  2WP8 J;  2K14 A;  2BH2 A;  4B3R L;  2R6G A;  4GOP A;  1G29 1;  1VQN A;  4JBK A;  4X62 Q;  1FGU A;  1Q1B A;  4YWL A;  5IYC G;  3GTJ H;  4JI7 Q;  4PZ7 A;  4JBJ A;  1KAW A;  2JA7 G;  4JV5 L;  2K52 A;  4A3M H;  1EQQ A;  4RG1 A;  4IJL A;  3PUX A;  2CWP A;  4DV6 L;  2I5M X;  1YEZ A;  3A0J A;  2PI2 E;  5IYC H;  1G51 A;  4YHH Q;  3A5U A;  2E5L L;  5C4J H;  3NEN A;  4GLX A;  2Y0S G;  1K73 C;  5ELO A;  4DUY Q;  2NVQ H;  3T1Y L;  3RZD H;  2PMZ E;  4DR7 Q;  3CC2 A;  4NXN L;  4IJH A;  1E24 A;  1NY4 A;  2UXD L;  1D7Q A;  2AMC B;  4LF9 L;  1I94 L;  1JJG A;  1WI5 A;  1G6P A;  2F52 A;  1KRS A;  4R4T A;  2UU9 Q;  3HKS A;  3GTG H;  3CCL A;  4L5R C;  2BA1 A;  2ZJR A;  1HR0 L;  3S17 H;  4GKK Q;  1N32 Q;  5C4X H;  3CCE A;  1WCM H;  4A76 A;  2GN5 A;  1VQ8 A;  2E8G A;  4HJ7 A;  2GVA A;  4OWX B;  5C0X I;  3U58 A;  3E9H A;  3M4P A;  1RIP A;  2PQA B;  2YTY A;  4YCU A;  1C7Y A;  1IL2 A;  4BY7 H;  1GKH A;  4DV7 L;  4RMF A;  2UXB L;  1YBY A;  2ID0 A;  1C9O A;  3PO3 H;  1SRO A;  4A93 H;  3PSI A;  4A3C H;  4LFA L;  5J3B A;  4BA2 I;  3K8A A;  2Q2H A;  5IP7 H;  2VQE Q;  1L0W A;  2JA9 A;  1YHB A;  1PH6 A;  3PIO A;  2I5H A;  1XMO L;  3I4M H;  4LF5 L;  3KFU A;  4C3H H;  4DKA C;  3G6E A;  3M4Q A;  4WJ3 M;  2OCE A;  1YHQ A;  2N78 A;  4P71 A;  2N3S A;  3CMA A;  1VQJ A;  3HOY G;  2Q2T A;  2WAQ G;  1HNZ Q;  3H3V I;  1VQ9 A;  2PQA A;  4R4C A;  4DV5 Q;  1KIX A;  2IHF A;  2DUD A;  1XMQ Q;  3UDF A;  1Y1W G;  1HNX L;  4OX9 Q;  1LTL A;  3I7F A;  1XNR Q;  1PYB A;  1XPO A;  1WOC A;  1Y1V G;  3HOY H;  3FKI G;  4JI3 Q;  1PFS A;  1XPR A;  4JCV E;  1QVG A;  1Y1W H;  2AHO B;  3DM3 A;  3A74 A;  3KJP A;  3S2D H;  1I5F A;  2PI2 A;  3CPW A;  1OTC A;  3PO2 H;  4DR5 L;  1Q86 C;  3NEL A;  1E3P A;  3S16 H;  3FKI H;  3F2D A;  4A3E G;  1YJ9 A;  3RLO A;  5FLX c;  1EQR A;  1N33 Q;  4DR3 L;  5IYB H;  1HH2 P;  1NBW A;  1VQH A;  1Y14 B;  1SRU A;  2GVB A;  2CCZ A;  4P74 A;  1CSQ A;  1A62 A;  2RHQ B;  3CCJ A;  4GKK L;  1N32 L;  2NZH A;  4X66 L;  4DUZ Q;  4A3E H;  1EIF A;  2R93 G;  2R7D A;  2JA6 G;  1KRT A;  1W3S A;  3KF6 B;  4O2D A;  3TQY A;  4B3S L;  3HOW H;  2H5X A;  3E9I A;  2NVX H;  4Y52 H;  2HHH L;  3BZC A;  2UUA Q;  5ELN A;  4BBR H;  5M3F G;  3HKZ E;  2B29 A;  2WB1 E;  4HJ9 A;  3BZK A;  4KHZ A;  4YWK A;  4DV4 L;  1X3F A;  1PH5 A;  3CAM A;  3JC6 6;  1YHA A;  1YZ6 A;  3SGI A;  2I0Q A;  2D0O A;  1N34 Q;  4JI1 L;  3K0X A;  4A4I A;  1K8A C;  2MFI A;  3NEM A;  4ME3 A;  4A3L H;  2CQO A;  5M3F H;  4HID A;  4XIG S;  5C0X J;  1NMG A;  1XNQ L;  4DR4 L;  5LMU Q;  1TWA H;  4AYB E;  2UUC Q;  3S15 H;  5JJI A;  3CC4 A;  4LFC L;  3T1H Q;  3KF6 A;  4LUZ A;  4OON A;  2B63 G;  5IWA Q;  2R92 G;  4L5S A;  3TS2 A;  3NBH B;  1J6Q A;  1XMQ L;  1D8L A;  4QY7 A;  4LF8 Q;  3AFQ A;  1K8G A;  5IE8 A;  3J80 i;  4GNX B;  1M1K C;  3J81 j;  2B63 H;  3CCS A;  4BA1 I;  2R92 H;  1VQA A;  4A75 A;  4YY3 Q;  4UPA A;  5M5Y H;  4JC0 A;  5LMN L;  5AJ3 L;  1HZC A;  2VQF Q;  2OTL A;  3I56 A;  4BBS H;  2ALY B;  2JEB I;  3H15 A;  4DV2 L;  1R9T H;  5GAD C;  3M85 A;  2F4V L;  1MKH A;  4PMW A;  4IPG A;  4KLK A;  2ZM6 Q;  4QQB X;  1LM0 A;  1I50 H;  2MQH A;  5FLM H;  4A3B G;  3TRZ A;  2D0P A;  1M90 C;  1FL0 A;  2YTV A;  4JOI C;  1EOV A;  1VQO A;  2JA5 G;  4IFD G;  4K0K Q;  2NVY H;  3RN2 A;  3ERS X;  3S24 A;  1O7I A;  3UDG A;  2RHS B;  2CWA A;  4GNX A;  1N36 L;  4A3B H;  3PV0 A;  2ZTD A;  1HJP A;  2XGT A;  1QZG A;  4H02 A;  3TRE A;  2KCT A;  4JBW A;  2JA7 H;  4LFB Q;  3RZO H;  4DV1 Q;  4JYA Q;  1IXR A;  3CCQ A;  2UUB Q;  3PUZ A;  1AE3 A;  1FJG L;  2V1C C;  4BY1 G;  1X6O A;  1KL9 A;  1QVC A;  1HZ9 A;  3H3V H;  1CUK A;  2I5L X;  3UDX A;  5C44 G;  3G71 A;  4NB3 A;  1IBM L;  4LF6 L;  4A3I G;  1JJ2 A;  4JI8 L;  3UE0 A;  3S1Q H;  1X56 A;  1J5E Q;  4DR6 Q;  2PNH A;  4GS3 A;  1NMF A;  1VQE A;  1SE8 A;  1VCI A;  3K7U C;  3UE1 A;  5C44 H;  4PZ6 A;  3CCM A;  3J80 c;  1JMC A;  1IBK Q;  4GKJ Q;  2JJQ A;  4B3M Q;  4YCW A;  3S1M H;  1XJV A;  1JJC B;  2NZO A;  1N9W A;  4JI5 L;  4C2M H;  1RL2 A;  4AQY L;  4LF8 L;  4DV0 L;  4GN5 A;  1UEB A;  1X3G A;  1X54 A;  2XTI A;  4LF7 Q;  4LWC A;  3STB D;  1LUZ A;  4JI4 L;  1PH1 A;  3PUW A;  1B7Y B;  2WB1 G;  4R4Q A;  3K7A H;  1Q12 A;  4TVA B;  4BBS G;  4IFD I;  1VQG A;  3LGJ A;  3WWV A;  4DR1 Q;  1SR3 A;  2FXQ A;  4UP7 A;  5DLQ E;  3L2P A;  2ES2 A;  5IY0 A;  2K5N A;  4QGU A;  1A8V A;  1UWV A;  1YIJ A;  1JE5 A;  5C3E G;  4X6A H;  1TWC H;  3K81 C;  4IPH A;  4X62 L;  1MIU A;  3AEV A;  4JI7 L;  3RNU A;  3J81 i;  3FP9 A;  1CKM A;  1PHJ A;  1HZB A;  3S1N H;  1PVO A;  3E0E A;  4B3T Q;  1AE2 A;  4HJ5 A;  3KJO A;  1V9P A;  2R7Z G;  3I4O A;  1K9M C;  4O0A A;  4X64 Q;  4YHH L;  3HOV G;  3KF8 B;  1I6H H;  4DPG A;  2VL6 A;  4LF4 Q;  4POG A;  1Y1V H;  4DUY L;  2E2H H;  5K36 G;  1GVP A;  1U0L A;  3HOU G;  5E7N A;  3CCR A;  3ULJ A;  4DR7 L;  4JI2 Q;  3HOV H;  1Q82 C;  3HOX G;  1U5K A;  4X65 Q;  2UU9 L;  3GDE A;  2IX0 A;  1NJI C;  5GAH C;  3EN2 A;  4POF A;  4OWW B;  4LFB L;  2K4K A;  1X65 A;  1OXV A;  3K80 C;  2AWN A;  4MTN A;  1K3R A;  2AKW B;  3JAM i;  1KQS A;  5BR8 Q;  1C0A A;  1I3Q H;  1Q81 C;  4KI0 A;  1E1T A;  1GM5 A;  2Z6K C;  4JI0 Q;  4NXM Q;  1BBU A;  2R93 H;  2JA6 H;  1NE3 A;  1TWG H;  1TWH H;  2HIX A;  2UXC Q;  2KCM A;  3AQQ A;  1V1Q A;  4BXX G;  4B3R Q;  1P16 A;  1AH9 A;  3KOJ A;  4JG2 A;  3GTM H;  2VQE L;  1HZA A;  2WFW A;  5JJK A;  5JJL A;  3PGZ A;  3PUV A;  3J7Z C;  4JV5 Q;  1A63 A;  4A3F G;  1Q1E A;  3H0G G;  1S3O A;  4BXX H;  3J81 c;  4C3I H;  4DV6 Q;  4KHP Q;  1K0R A;  4PZ8 A;  5GAE C;  2E5L Q;  1HNW Q;  1HNZ L;  2QA4 A;  4DV5 L;  3OW2 A;  1IBL Q;  1B70 B;  2NN6 G;  4OX9 L;  3A5Z B;  1MJC A;  3CCU A;  1VQL A;  2HIV A;  1XNR L;  4EX5 A;  1L1O B;  4MNO A;  3T1Y Q;  1WFQ A;  4GN4 B;  4IFD J;  2QEX A;  2F3I A;  4LUO A;  1S72 A;  2UXD Q;  2MNA A;  4LF9 Q;  4JI3 L;  1I94 Q;  1VQ5 A;  2OTJ A;  1S40 A;  1UE7 A;  3S1R H;  4QIW E;  5FJ8 G;  1CKO A;  2CKZ B;  2N8N A;  2OQK A;  2YTX A;  3OYY A;  2K75 A;  1HR0 Q;  3KLW A;  3W1G A;  5GRO A;  1L1O C;  5IP9 G;  1TWF H;  4A3D G;  1YNX A;  1OXX K;  1N33 L;  1Z47 A;  2R7F A;  4L5T A;  2E2I H;  1VQ4 A;  4R1J A;  4X65 L;  2UXB Q;  5IP9 H;  1QUQ B;  3JAM c;  3I2Z A;  1E22 A;  3CP0 A;  4DUZ L;  1L1O A;  4APV A;  3F2C A;  4UP8 A;  4GOP C;  3AYH B;  4GLV B;  4XTC S;  3RN5 A;  3CW2 C;  4DK3 C;  4DR2 Q;  1KC8 C;  3RLN A;  2ZTC A;  1XMO Q;  3L7Z C;  1YJW A;  2JA5 H;  2UUA L;  1VQD A;  4LF5 Q;  4JOI A;  2D62 A;  4DV3 Q;  2AWO A;  1PV4 A;  2LXK A;  3MEF A;  4ALP A;  1YIT A;  3GTO H;  1N34 L;  3F1Z A;  3PIP A;  3CME A;  3AFP A;  2YYZ A;  1PH9 A;  2NN6 I;  3PF4 A;  4A3G G;  1A0I A;  4P73 A;  1BKB A;  1BBW A;  1HNX Q;  3G4S A;  2YU9 H;  3GTL H;  1CSP A;  1QUQ A;  5LMU L;  4JBM A;  3STB C;  2UUC L;  4BY1 H;  5JEA G;  1PH3 A;  3UDI A;  5M5X H;  2K50 A;  4KHP L;  1Q46 A;  1N8R C;  4A3G H;  3T1H L;  2KHI A;  2KEN A;  2NVT H;  1H95 A;  5HY6 A;  5IWA L;  4R4I A;  1EYG A;  4OO1 G;  2BA0 A;  4A3I H;  2B3G A;  1HNW L;  2EXD A;  4GN3 B;  1IBL L;  2VUM G;  1PYS B;  4DR5 Q;  4A3K G;  4PG3 A;  2ZJQ A;  5H1S E;  3ULP A;  1EFW A;  2LSS A;  1Q8K A;  5C4X G;  1KXL A;  3F8T A;  1YJN A;  4DR3 Q;  1WCM G;  1NTG A;  1EUJ A;  2QGQ A;  2EQS A;  2MO0 A;  3W1B A;  4YY3 L;  3HKZ G;  1Z9F A;  2DGY A;  2RF4 A;  4A3K H;  3OTO Q;  2VQF L;  2ATW A;  2VUM H;  3GTQ H;  1K83 H;  3CPF A;  5HGQ A;  4YWM A;  4GLA C;  4OWT B;  4X66 Q;  1PH4 A;  1VQC A;  3CD6 A;  3CC7 A;  2JE6 I;  1PH8 A;  3PO3 G;  3S14 H;  4B3S Q;  2ZM6 L;  4A3C G;  4A93 G;  2OQ0 A;  5EAY A;  2K5V A;  3ZJY C;  1XPU A;  1QVF A;  2HHH Q;  3BJU A;  1DGS A;  1L2F A;  2Z0S A;  3ER0 A;  5IT9 c;  5IP7 G;  1X3E A;  1GD7 A;  3I55 A;  4JI6 Q;  4DAM A;  1PH2 A;  3EIV A;  4AYB G;  3G48 A;  3U50 C;  3U4Z A;  4DV4 Q;  3I4M G;  4K0K L;  1VS0 A;  4FDB A;  4JI1 Q;  4EQ5 A;  2JK8 A;  5C3E H;  2JA8 H;  4NPS A;  1XTD A;  3GO5 A;  4QL5 A;  3PUY A;  4DR2 L;  3W5O A;  2K5H A;  4HJ8 A;  1XNQ Q;  1EWI A;  2IHE A;  5M3M G;  4DV1 L;  1MJE A;  4DR4 Q;  2OWO A;  2UUB L;  1OXT A;  1IYJ B;  4DV3 L;  4JYA L;  3KYH C;  3CXC A;  2VW9 A;  4YCV A;  2R7Z H;  3D31 A;  4LFC Q;  4LW1 A;  4TQU S;  4Y7N H;  3ICE A;  3GTK H;  4OO1 I;  5M3M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...