1SROA

S1 rna binding domain, nmr, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
76
structure length
76
Chain Sequence
AEIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the S1 RNA binding domain: a member of an ancient nucleic acid-binding fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags S1 rna-binding domain
molecule keywords PNPASE
total genus 4
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 1996-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sroA00
4LF5Q 5M5XH 4A93H 4A93G 1X55A 2MNAA 3U50C 3J7A5 1RIPA 4UP9A 4DV7Q 4A3JG 1HNZQ 3M4OH 1NMGA 3DLLA 4OWWB 3HFZB 2E2HH 3PGZA 2ZTCA 5IE8A 3RN5A 4JBKA 2JA8H 4R4TA 4PZ8A 1SLJA 3M4QA 5FJ8H 4DR2Q 1FJGL 3T1YQ 3TEHB 4EQ5A 4NXML 2F4VQ 4DAMA 4GOPA 1E22A 1GD7A 2A1AA 4LFAQ 5GAEC 4A3FH 1G6PA 4IOAA 1N32Q 3HOWG 2UUAQ 3PO2G 2R93G 3TS0A 3S1MH 5C44G 4IPCA 2JA6G 1HNXL 5LMUQ 4UPAA 1I3QH 2KHJA 1AE3A 5GAHC 3PO3G 4JYAQ 2VQEQ 1XJVA 1Z9FA 1EQRA 4BA2I 4HIKA 3E9HA 2VW9A 1N34Q 1HR0W 3CCJA 2PQAA 2E2IH 3W1GA 5JEAG 4TQUS 2A8VA 2N78A 4JI8L 2NVTH 4LF8Q 3ICEA 3PV0A 3H15A 3UE0A 2NVQH 1I50H 1A0IA 2JA5G 4KHPL 2VNUD 4DR6Q 1PH9A 1VQAA 4DV3Q 4P74A 4LF9Q 4K0KQ 1X3FA 2NVYH 4A3GG 2ATWA 3HOYH 2CKZB 2OQKA 2ZTDA 1IBKQ 1K73C 3I55A 2ZM6L 4X6AH 1HJPA 1YBYA 4DV6Q 4LFBQ 1BBUA 3S1NH 5M3MH 1U0LA 4L5RC 4NXMQ 2WAQE 1QVGA 2UUBQ 1UE6A 1PH3A 2Q2UA 3HOUG 1Q1BA 4QL5A 2Z0SA 4Y7NH 3GD7A 4JI2Q 5GADC 3PIOA 4IFDI 4BBRH 4GKKQ 5GROA 4J15A 4JC0A 1PH4A 2I0QA 3MEFA 1SN8A 1SE8A 4JBMA 2AWNA 4JV5L 1XNQQ 4B3TL 2UUCL 1GVPA 4A3IG 1JJ2A 5C0XI 4LF7Q 3H3VI 2KENA 3T1HQ 4GKJL 3CCSA 4LF5L 2BA0A 4C3HH 4YCUA 4X65Q 2K52A 4HIOA 4YY3Q 3RR5A 1P16A 1EUJA 3M9BA 5IYBH 4HIDA 1VQ7A 4JI0L 2EXDA 3HOZH 2NZOA 4FDBA 5EAYA 1IZ6A 4QGUA 3OTOL 2JA7H 1FJGQ 2JA7G 1YHBA 4AQYQ 3I4NH 3KF6A 4B3MQ 3CPWA 4XIGS 4LF4Q 1Y1VG 2UUBL 2N49A 2UUAL 3S1QH 2N8NA 1WOCA 3UDIA 2Y0SG 4DUZQ 3HOVG 1HNWL 3S16H 4OO1G 4BBSH 5ELOA 1VQBA 3CCMA 4JYAL 4A3KG 1WI5A 3STBC 2CFMA 1N33Q 5C4XG 4JG2A 3UDGA 1DGSA 4AH6A 3F1ZA 3FKIH 3CCUA 1LTLA 4BY7H 1JJGA 4DR4Q 3STBD 3OW2A 1PH2A 4DV0Q 2D0OA 3CPFA 3K7UC 1YITA 1UE7A 1SMXA 4QY7A 2VQEL 3CD6A 3PF5A 3D0FA 3EN2A 4GOPB 3ZJYC 4LNQA 1OXVA 4DR7Q 4JI4Q 2F52A 3A74A 4R4QA 2B63H 4YHHL 1OXSC 2UU9Q 1YJNA 2KBNA 4A3MH 4JI3Q 2DGYA 3TREA 3S1RH 1EWIA 4X62L 5GQOA 2R92H 2LXKA 4A4IA 4WJ3M 4DUZL 3DM3A 2YYZA 1Q7YC 3CC7A 2R6GA 1VS0A 1Y14B 2HIVA 4DV4L 1W2BA 5K36G 1KXLA 1HNXQ 2E5LL 4A3DH 2LXJA 1J6QA 1MIUA 3T1HL 1XNRL 3PO3H 3KF6B 2PI2E 3J80i 4X65L 4GNXA 2B63G 1K3RA 3AYHB 1D8LA 1FGUA 5IYDH 1W3SA 3HOXH 1OTCA 2OTLA 1VQ4A 4LF8L 4POGA 2R93H 1AE2A 4DV0L 1HZCA 3HOWH 3KLWA 4O0AA 1N34L 3HOXG 4GOPC 3GTMH 1YVCA 2V1CC 4LF9L 3Q8DA 4K0KL 3LGJA 4GS3A 1GO3E 1PA6A 1T9HA 2B29A 4A3EG 4MNOA 1CKMA 3SGIA 1JJCB 3GTOH 3L2PA 5C0XG 2WAQG 3A5ZB 3RLFA 5M3FG 4A3MG 4DV6L 4DUYL 4LUZA 5IYCH 1XMOQ 1IL2A 4JI3L 4RMFA 2OQ0A 2Y0SE 3TRZA 1QVFA 5LMNW 4NXNL 4JI5Q 1HZAA 2OCEA 2C35B 4YCVA 1CKNA 4LF6L 2VZAA 3BU2A 3S2HH 2CWAA 2D62A 4AQYL 2VS1A 2VUMH 2YTYA 1GKHA 4P75A 2NN6G 1KC8C 3M7NA 4DV5L 2R7ZG 4LUOA 2K75A 1S72A 1A63A 3K80C 4IPDA 1C0AA 1KRTA 4APVA 1SFOH 4JI7L 1HNWQ 4JI1L 4P71A 1YI2A 2B3GA 1WJJA 2F3IA 3K81C 5IYBG 1I5FA 1RL2A 1M1KC 5IT9c 1XMQL 1Q81C 1PH5A 4GKJQ 2R7DA 3I4MG 1L1OA 4BY1H 4DR5Q 1R9TH 5C4XH 1K9MC 1NTGA 1B8AA 4JI8Q 3S14H 2JQOA 3KF8B 4LUVA 2PQAB 3GDEA 4DPGA 1AH9A 3U4VA 3D31A 3I4OA 4BA1I 2UXDL 3HOVH 2WP8J 1TWAH 4DV1Q 4X64L 1P8LA 1SROA 4DKAC 4DR7L 3A5UA 3HKSA 1K8AC 1VQ5A 3UDXA 2I5MX 1Q46A 4LFBL 4IPHA 1KHIA 1YHQA 4X66L 4Y52H 2IHEA 3I56A 1HZBA 3ULPA 1Q8KA 1TWCH 4JCVE 1VQCA 4A76A 3HOZG 4B3RL 3JC66 2QEXA 1IBLL 3AFPA 3ER0A 3KJOA 2VUMG 4DV4Q 2K5HA 1U5KA 2IHFA 4BY1G 1M90C 1ASYA 3HKZE 1JE5A 1WFQA 1QZHA 4A3EH 2UUCQ 5AJ3Q 1OXXK 3L0OA 5FLMH 4MTNA 4DR4L 1E1OA 2JK8A 4JBJA 4A3IH 4JOIA 4C3IH 3RN2A 4QIWE 2K5NA 4BBRG 1H95A 3PIPA 5IP7G 4GLAC 5BR8Q 1Q82C 1WYDA 1YZ6A 1QVCA 1UEBA 4KHZA 1PVOA 1TWHH 3FHWA 4TVAB 1L0WA 1PHJA 1X3GA 1PH6A 1YNXA 1JT8A 5JJIA 2R92G 5IYCG 1CUKA 2H5XA 1LM0A 1S3OA 1MJCA 2MO1A 4UP8A 4AYBG 3J7ZC 5H1SE 4DR3Q 5M5YH 2VQFL 4HJ7A 1PH7A 1XNQL 1IYJB 2Z6KA 3TS2A 5ELNA 1PFSA 2EQSA 1VCIA 4DK6C 1CSPA 1XPRA 1J5EL 1N33L 3S17H 2YV5A 5LMUL 2YU9H 4YCWA 1KRSA 3RLOA 2IY5B 4QJFA 2PNHA 2PI2A 3CAMA 2YTXA 1YEZA 4PG3A 1HNZL 3FKIG 2ZJRA 4JI0Q 1LYLA 1VQKA 4A3DG 2ID0A 1VQHA 3S2DH 3PO2H 1K0RA 1N36L 1XPUA 1IBMQ 4HIMA 4A3FG 2Q2IA 4JI4L 4QQBX 3PUZA 5FLMG 1E1TA 3J81j 4DV3L 4LF6Q 3A0JA 3G71A 4P73A 3ULLA 4LW1A 3NEMA 1QUQA 2JEBI 1VQLA 3CF5A 2ZTEA 1B70B 1EOVA 5DLQE 2ZM6Q 3H3VH 1EQQA 4WJ4A 2E2JH 3CC2A 2UXBL 4YWMA 2VL6A 4GN4B 1PV4A 4JI2L 1K8GA 2RHSB 4MZ9A 1Y1VH 2WB1E 5E7NA 3AFQA 4JI7Q 2WFWA 4DV2L 3I7FA 4DR5L 5LMNQ 1JMCA 3KDFA 4BY7G 1XMQQ 1PH8A 4DAYB 2R7FA 2Q2TA 3GTGH 1Y1WG 4GLXA 3VDYA 4A3KH 2YTVA 2OTJA 1OXTA 1NE3A 4B3SL 4DNIA 1N36Q 4YY3L 3CW2C 3WWVA 1I94Q 2CCZA 4JI6L 1I6HH 1MJEA 4OONA 2AMCB 4X66Q 2K50A 5GAGC 1GM5A 3I4NG 4A3BG 4JI5L 4EX5A 5IP9H 3CCVA 4NXNQ 5M3MG 4DR1L 2D0PA 3E0EA 1UWVA 2BH8A 2R7ZH 2AKWB 1X56A 2UXBQ 3M3YH 4JBWA 4BXXH 2E8GA 1Q12A 5C3EH 2I5HA 1V43A 4PZ7A 3PUVA 4C2MH 3BZKA 4A75A 3GTKH 5AJ3L 1N8RC 4ME3A 2AWOA 3CMEA 3KDFB 4OO1I 3NENA 4OX9Q 2ZJQA 3F2CA 1FVIA 1PYSB 1VQEA 1V9PA 3F8TA 3L7ZC 2XGTA 3PUYA 5IY0A 4OWXB 1VQPA 1QZGA 1XTDA 3AQQA 4A3LG 4LFCQ 2JJQA 3HOYG 1WCMG 1C9OA 2HHHQ 5IWAQ 3G48A 2HIXA 4OWTB 5M3FH 3RZOH 5FLXc 5IP9G 5C4JH 1L1OB 5HY6A 3OTOQ 1X3EA 1VQ9A 2A19A 3G6EA 3CP0A 3F2BA 4LF4L 3ULJA 2LSSA 4AYBE 4IJHA 4R1JA 4IJLA 4DV1L 1IBML 1YJWA 5IYDG 2QA4A 1EIYB 3GTQH 5M5WH 1E7ZA 3BZCA 2GVAA 4JOIC 1C7YA 2FXQA 1A62A 1BVSA 5C44H 2N3SA 4DV5Q 1E24A 4X62Q 3HKZG 1CKNB 1E3PA 1L1OC 4IFDJ 4RG1A 3J81c 3M85A 3FP9A 4B3RQ 5C0XJ 1NBWA 1J5EQ 1EYGA 2I5LX 2CQOA 3UE1A 5JJLA 3CXCA 3NELA 5FJ8G 2K5VA 2RCNA 3U4ZA 4DK3C 1NMFA 4NPSA 2BA1A 3JAMc 3KFUA 2HQLA 1VQJA 2WB1G 5HGQA 3KJPA 1I94L 2HHHL 4JI6Q 4L5SA 2JA6H 4A3CH 1CSQA 3CCLA 3F2DA 2CWPA 4PZ6A 1KIXA 1ASZA 1VQFA 3B6YA 3E9IA 1HR0Q 2JE6I 3BJUA 5BR8L 4DV7L 4C3JH 3GO5A 1L2FA 4DR2L 2EIFA 4B3ML 3H0GH 2E5LQ 1BKBA 3EBEA 3ERSX 4A3CG 2Q2HA 2ALYB 4HJAA 1VQOA 4BBSG 1VQDA 3KOJA 3NBHB 1VQGA 1SR3A 2HT1A 3PF4A 1TWGH 1TXYA 4HJ9A 4LFAL 2AHOB 1K83H 3RZDH 1Q86C 2KCTA 1X54A 2UXCQ 4POFA 1XPOA 3S24A 5IWAL 3PUWA 4OXPA 4L5TA 4KI0A 1FL0A 2KHIA 4JI1Q 4B3SQ 1YIJA 4R4IA 1WCMH 3CCEA 4HJ5A 4DUYQ 1XMOL 4DR6L 3U58A 4GLVB 1KD1C 2RF4A 3JAMi 2MQHA 3W5OA 1YJ9A 3GTLH 1EIFA 1IBKL 5IP7H 3CC4A 5JJKA 1Q1EA 2UU9L 4BXXG 5JEAJ 2UXDQ 2GN5A 1O7IA 2Z6KC 4KLKA 3CCRA 1NJIC 5J3BA 2QGQA 3CMAA 2ZJPA 2ES2A 1N32L 4NB3A 1G291 2BH2A 2ASBA 4HJ8A 4DR3L 3KYHC 1KAWA 2VQFQ 3MXNB 4PMWA 1D7QA 1OXUA 2JEAI 3HOUH 4JV5Q 1NY4A 1QUQB 2F4VL 2JA9A 3I2ZA 1UE1A 1HZ9A 3K7AH 4GN5A 1XNRQ 2L15A 4XTCS 1PYBA 4LF7L 4OX9L 2KCMA 2XTIA 3K8AA 5C3EG 1MKHA 4B3TQ 4A3LH 1VQNA 3K0XA 5LMNL 3UDFA 4A3GH 2NN6I 4LFCL 4UY8C 1JB7A 2K4KA 4GNXC 3EIVA 3GTPH 2JA5H 1X65A 4IPGA 1A8VA 4A3BH 4X64Q 4UP7A 1X6OA 1BBWA 3PUXA 4YHHQ 4R4CA 3TQYA 3RNUA 1G51A 1V1QA 2GVBA 4IFDG 3RLNA 3CQZH 4KHPQ 4LWCA 1EFWA 2K14A 3W1BA 3M4PA 4O2DA 1N9WA 3IRBA 1VQIA 2NZHA 3CCQA 4L5QA 4YWLA 1Z47A 3J81i 3H0GG 4AIMA 1HR0L 4P72A 4GKKL 4R4OA 3G4SA 1Y1WH 1IBLQ 2NVXH 3T1YL 2IX1A 2RHQB 1YHAA 1B7YB 2OWOA 3I4MH 4DR1Q 4YWKA 4GN3B 3S15H 3PCOB 2UXCL 2PMZE 2MO0A 4ALPA 4H02A 1PH1A 1S40A 1CKOA 1X9NA 2IT1A 4DV2Q 4IO9A 1VQ6A 3AEVA 3OYYA 2JA8G 1SRUA 2DUDA 1KL9A 3PSIA 2IX0A 4GNXB 1TWFH 1KQSA 3GTJH 1IXRA 4A3JH 2VY3A 1LUZA 1HH2P 3J80c 4IOCA 1VQ8A 1UE5A 2MFIA 1VQMA
chains in the Genus database with same CATH superfamily
5M5XH 4XT3B 3OPOA 1KLUD 2MNAA 1QOHA 4UP9A 4A3JG 3RD4A 3HFZB 2E2HH 4JBKA 1KDAA 1TWGB 3M4QA 5FJ8H 4EQ5A 5C3EB 1NR2A 1KLGD 4RA8A 3FDTA 2F4VQ 2A1AA 4LFAQ 4A3FH 4IOAA 1VF5C 3HOWG 2WKCA 2UUAQ 3PO2G 3TS0A 5C44G 4IPCA 4FF1A 1JE4A 1C8CA 1STEA 3PO3G 2F0HA 2VQEQ 3E9HA 2VW9A 2EYHA 2NVTH 2EYLA 5JEAG 1JQYD 2KCCA 3UE0A 2NVQH 1B50A 4UHVA 1BXTA 2RDFA 1BNZA 3BG3A 4LF9Q 1X3FA 5CR3A 1B9NA 1UAPA 1EU3A 2ZTDA 3V2TA 3TZUA 3I55A 4X6AH 4RH6A 4DV6Q 1BBUA 1V1PA 3S1MB 4QIWB 5ELFA 3T13A 1PH3A 3HOUG 4QL5A 1EY5A 3GD7A 5GADC 4Y7NH 5JAVA 5CV4A 4BBRH 3X3NA 2JSOA 2I0QA 3H94A 1SN8A 3J80E 1XXGA 2E2HB 1PMRA 4CJ0B 1HXYD 2A69D 3GTLB 4GKJL 2B8FA 3KUPA 4OIKA 5FLXL 4JW0A 1B3QA 2PW5A 2M2LA 1B3AA 5M3FB 4HIDA 5C5MA 2EXDA 4FDBA 4QGUA 3OTOL 2JA7H 2EVBA 1YHBA 4KJOA 2WB1B 3RZDB 3I4NH 4B3MQ 3NE5B 4XIGS 2NBFA 3MXNA 2E75C 1U4PA 3UDIA 4CDFC 4C3IB 1H9SB 3S16H 1UUPA 4BBSH 1VDZA 1F9QA 4JYAL 1Z6HA 4C3JB 5CV7A 5C4XG 1D1IA 1STYA 1DGSA 4AH6A 3FKIH 1LTLA 2Z9HA 4DR4Q 3HRZC 2BDNA 3P1HA 1VF7A 4DV0Q 1SMXA 2Q8TA 1B44D 3D0FA 3MEHA 5D3IB 1AEXA 3SDZA 4OL7A 3K57A 4DR7Q 4HSVA 4JI4Q 2F52A 2F0FA 4OIJA 5DM63 4A3MB 4JI3Q 1GXDC 1LT6D 2DGYA 3TREA 3PIP3 3S1RH 4LJZC 1K28A 2F0MA 5ELEA 2JXMB 2YYZA 1VS0A 4DV4L 5K36G 2B2YC 3S9WA 3A56A 5C0XH 1J6QA 4PMBA 3G6JB 3T1HL 1HTPA 3DEPA 4GNXA 1K3RA 1D8LA 3MA2B 4FNFA 4QUFA 5D65A 4POGA 2R93H 1AE2A 4DV0L 1HZCA 3HOWH 1R4PB 2XN9C 1N34L 1I4RA 4QMGA 2EYJA 2M00A 3GTMH 4LF9L 3PIO3 4GS3A 1PA6A 3L2PA 4A3MG 1JICA 3RLFA 3DM1A 4DV6L 4PV1C 2JP1A 1HQMC 4JI3L 1K3BC 4ZRZA 2Y0SE 1EWCA 3QIAA 4RAUC 1QVFA 4RGOS 1SDFA 2KECA 4NXNL 2C35B 4LF6L 2D62A 2EYFA 4AQYL 1ICFB 2VUMH 1TVXA 4DV5L 3SEBA 1ONLA 2K75A 4EQPA 1SNOA 4RCOA 4C1NI 2DY7A 2R93B 3W2DA 4APVA 1SFOH 4JI7L 1GHJA 5LL6S 1S4ZA 2B3GA 1WJJA 2F3IA 1I6VC 1RCVD 3VYUA 1I6HB 3R93A 2R7DA 5FO7B 1L1OA 4BBRB 4BY1H 3S15B 4DR5Q 1LTID 2KJXA 2PQAB 1QB5D 4KKTA 3D31A 4OO1H 3I4OA 3HOVH 1SNDA 1P8LA 2F3VA 1Q46A 4RKBA 4LFBL 4X66L 2H1EA 3I56A 1EFID 1HZBA 3R8BA 1CQFA 1Q8KA 1TWCH 4JCVE 4A76A 4B3RL 2F1MA 2QEXA 2K5HA 1U5KA 4BY1G 4CHTB 4K2LA 4A3EH 5FLMH 2K32A 1E1OA 3IKJA 1PRTB 1BCPD 2K5NA 2CW0D 3J81E 5IP7G 1Q82C 2XVSA 4KHZA 3URYA 1PVOA 3FHWA 4Q0FA 1X3GA 1FYCA 1NCVA 5JJIA 5M5XB 1ICWA 3J7YW 5KYIA 2HCIA 4HJ7A 1PH7A 1SJHD 1VCIA 3VR4A 4K5XA 3S17H 3DMUA 5CV6A 5LMUL 2K04A 1KRSA 3RLOA 2IY5B 3A8JE 3CAMA 2PI2A 1HNZL 1LYLA 1VQKA 1C4QA 3GTGB 3S2DH 3H0GB 3MZ5A 1XPUA 3CHBD 4N9TA 5FLMG 1E1TA 3HOXB 4LF6Q 1J8IA 4DU9A 4HAEA 2ZTEA 1SNCA 1NSNS 1E2WA 1WTHA 2ZM6Q 3H3VH 4A3DB 1TWCB 3ITPA 2HUGA 1SEBD 3HG9A 2UXBL 2LY7A 3P20A 2VL6A 3VA7A 1AW7A 1FNWA 4MZ9A 5E7NA 4L6TB 2K01A 2WFWA 1EY7A 4DR5L 1JMCA 1A3VA 3P7JA 1XMQQ 1BF4A 3GTGH 1QNKA 2OTJA 2SDFA 2K03A 2F0JA 3EA6A 2EY2A 3WWVA 2CCZA 2IL8A 1KNEA 1U4RA 4X66Q 1PTOD 2KUMA 4A3BG 2AQ2B 4FF2A 3L9AX 4JI5L 3CCVA 4G7ZC 4DXFA 5M3MG 3JAML 2D0PA 1X56A 2UXBQ 1LLRD 3EVQA 1BR9A 3GTJB 1TQOA 1N8RC 2A6ED 4H13C 3S17B 3NTHA 3NENA 3HKZB 1PYSB 1LT4D 1LTTD 1V9PA 3F8TA 3LNNA 4A3LG 4V0BA 4ODGA 3AQQA 4KTAA 1HFGA 1SYCA 3RZOH 1BOSA 5IP9G 3AU7A 1VQ9A 4C3HB 2FMMA 5FOBB 4FXDA 3CP0A 3VYTA 1D6EC 1BCPB 4KD4A 5KNDA 4R1JA 4DV1L 2QA4A 1EIYB 3GTQH 4ZKBB 1PXUA 2NZ1D 3NHHA 2FXQA 1CT1D 5CMDA 1SMYD 4OEMB 1E3PA 4IFDJ 3J81c 3M85A 3FP9A 1EYGA 3J7AF 4FVMA 4O42A 1DOMA 3U4ZA 4RFBA 1Y8NB 2TSSA 1AN8A 2HQLA 1VQJA 1T5EA 1MSGA 1I94L 1S5DD 2V4DA 1CSQA 2F3WA 1PLFA 2B2TA 2CWPA 5T1IA 3F2DA 4PZ6A 3GV3A 4EQOA 2HD3A 4IUPA 1D5XC 4MTKA 4HMJA 5JJZA 1I3QB 5BR8L 4DV7L 3GO5A 4XQJA 1S5BD 1U4MA 3NUCA 3H0GH 2K1BA 3ERSX 1IKMA 4KY6A 4HJAA 1VQDA 1LTRD 3OWEB 1SR3A 3PF4A 1TWGH 2CHBD 1CM9A 1PZJD 4KV6A 4KI0A 3A8IE 3MXPA 4R4IA 1WCMH 2MGSA 3FVQA 5M5YB 4HJ5A 3A55A 4ZKCB 1YJ9A 3C46A 1IBKL 5JJKA 4RWSC 2UU9L 1NJIC 2A68C 2ES2A 1XX8A 4HJ8A 1KAWA 2VQFQ 4C56C 3IL8A 1OXUA 1QUQB 2F4VL 2OEOA 1UE1A 3I2ZA 4GN5A 1X32A 4XTCS 2KCMA 4EVOA 3K8AA 5C3EG 3NTKA 2B2YA 1VQNA 4A3LH 5G3LF 2M9VA 5TSSA 2NN6I 5AFWA 2A68D 1JB7A 4GNXC 3GTPH 3NK9A 4A3BH 5I2YA 4UP7A 3R3OA 1V1QA 2GVBA 4XT1B 4YIJA 4IFDG 3RLNA 1TU2B 5DNFA 2NZHA 2F0PA 3CCQA 5KNBA 4L5QA 4YWLA 3H0GG 4P72A 3T1YL 3E0JA 3HS0C 3I4MH 4HTHA 4DR1Q 2UXCL 4GN3B 1I4QA 3PCOB 2MO0A 2Z6BA 1CKOA 1I4XA 3PMFA 2L4NA 5I9PA 1VQ6A 4HSPA 3DHQA 5LHY1 4GNXB 3GTJH 5EPKA 4IUUA 4WORA 4IOCA 4PNYA 1PTOH 2MFIA 2A6HC 4PQXA 5BN3A 4A93G 1A6XA 3IFDA 1X55A 4A3JB 2EPBA 1H9JA 4DV7Q 3TZDA 3DLLA 4OWWB 3PGZA 5IE8A 4ULLA 5CORA 2JA8H 4PZ8A 3OMCA 3T1YQ 4NXML 3CRLC 1STBA 1E22A 4B08A 5GAEC 1G6PA 5JVG3 1LV9A 5EGTA 1PFMA 3S1MH 2A5HA 4K8JA 2JA6G 4UPAA 1EWHA 2EJGC 4JYAQ 1XJVA 1Z9FA 4HIKA 1HR0W 3T56B 3W1GA 2E2JB 4FP5D 2F0VA 2NVQB 1I50H 2JA5G 1TS3A 1PH9A 1EL0A 4DNRB 3FPUB 3QB3A 1MHWC 2NVYH 4A3GG 2CKZB 5DEHA 1MSHA 1HJPA 1RD9D 4LFBQ 2QDBA 3F2UA 2Z1CA 5M3MH 4KK7A 2XWJB 1A3TA 4NXMQ 1UE6A 1SBBB 5IGBA 1Q1BA 2Z0SA 1I4PA 1YNJC 4J15A 3MEFA 4JV5L 3Q22A 4LAAA 1XNQQ 2PZUA 4QUCA 1Y69U 2GA4B 4LF7Q 3T1HQ 2BA0A 4ABNA 4C3HH 5L37A 3M9BA 3RZOB 5IYBH 1STHA 4CJ2C 1HFNA 2NZOA 1FJGQ 4AQYQ 1UNSA 5KIXA 1GUNA 3KF6A 3VR2A 3LWEA 3CPWA 4LF4Q 1WD1A 1Y1VG 2EXZA 3S1QH 2EY6A 2Y0SG 4I7ZC 1LTBD 4A3IB 4OO1G 2NVXB 1VQBA 3HZXA 1QWYA 1DYQA 1G6ZA 5IGEA 2MHVA 3KLSX 3MXGA 4JG2A 5CV5A 3UDGA 2MUYA 1JJGA 1PH2A 3BDOA 4QY7A 3PF5A 1EYDA 4TSSA 1H9KA 3AB9A 3OW7A 3P75A 2DNCA 1WTWA 1EYAA 1YJNA 2KBNA 3MTSA 2A73B 3CRKC 2QEJC 1GUGA 2JYOA 4XDXA 4A4IA 5HURA 5IT9L 3BVMA 3DM3A 3CC7A 5K5PA 2L55A 2E5LL 4A3DH 1XNRL 2F0WA 1Q8IA 3J80i 4X65L 3I3CA 1ILPA 3AYHB 1FGUA 4RKLA 1VMCA 3HOXH 1HPCA 3HOVB 5C3XA 5E1FA 4BBSB 2B29A 4A3EG 3D3RA 1CKMA 4MNOA 1R9TB 3GTOH 5M3FG 5C0XG 2ZXPA 1PRTF 4LUZA 5IYCH 4R8IA 4DUYL 1XMOQ 4L63B 2EDGA 2OQ0A 2CVRA 4FYDA 1SFOB 2D5DA 4JI5Q 4EGVA 3S2HH 1ZKOA 2VS1A 1JR0D 3H91A 2NN6G 1KC8C 3M7NA 4O1NA 2L9HA 1SAPA 1S72A 1A63A 1AFPA 1KRTA 2RDHA 5HGTA 2G5DA 4P71A 1CZGA 1I5FA 1LTSD 4KY5A 3TP7A 1BQQT 5C4XH 2PO4A 1K9MC 1NTGA 4KKUA 5EPJA 1WTXA 4DPGA 1AH9A 4KHVA 4IN3A 2UXDL 1TWAH 4DV1Q 4X64L 1DCZA 2PCFB 1SROA 4CDDC 2A74C 2F4IA 3N6RA 2EYOA 4IPHA 1KHIA 2B2TC 1YHQA 5COYA 5IGGA 3ND9A 5EBDA 3ULPA 2DJGC 1ESFA 3JC66 3D6WA 1SJED 1IBLL 3IAYA 3OSOA 2VUMG 1M90C 4OHJA 1JE5A 5KGUA 1QZHA 2UUCQ 3I4LA 4MTNA 1PRTC 2JK8A 3H6MA 2JN4A 1TY2A 2QKIC 2WAQB 3S1QB 2SEBD 3FKIB 5BR8Q 3TMEA 4FF4A 1L0WA 4C2MB 1PH6A 1STNA 1YNXA 2FINB 5EKKA 3I72A 2XRSD 2XWBB 2H5XA 4UP8A 1MJCA 2MO1A 4AYBG 2VUMB 4DR3Q 3C3LA 3TS2A 5ELNA 1S5ED 4DK6C 1CSPA 1XPRA 3I8ZA 2YV5A 1EIHA 2YU9H 1SYEA 2PNHA 3M3YB 1YEZA 4L8JA 1AZQA 2ZJRA 4JI0Q 1VQHA 2A6HD 1O7ZA 1GJXA 2Q2IA 3J81j 1W6JA 5EKIA 2RDGA 3G71A 3I90A 1GUWA 5DLQE 1B70B 3GTPB 3K6OA 4A3KB 2O2LD 3CC2A 2H4OA 1PV4A 3BVZA 4IFDH 1Y1VB 3I7FA 2DNEA 2J7ZA 2F0SA 5D14A 5J1ZA 1U9RA 1Y1WG 4GLXA 3NSWA 4PMCA 4A3KH 3NBIA 1OXTA 4DNIA 1RHPA 1I94Q 3M4YA 2E2IB 1MJEA 1DOLA 4BY7B 2L5TA 2IJ0A 2AMCB 4ME5A 5JVH3 4HMIA 3NBHA 1BDOA 4XXEA 4DR1L 4S3SA 3E0EA 4FF3A 5EBCA 4BXXH 4JBWA 2QF7A 2A6EC 1V43A 4PZ7A 4C2MH 3BZKA 4DN4M 3GTKH 2IPKD 1ZXTA 2ZJQA 3F2CA 1VQEA 2EY5A 1TR5A 3PUYA 5IY0A 1XTDA 3CU7A 3HOYG 1WCMG 2HHHQ 1JWMD 2HIXA 1H9SA 5C4JH 4RGNA 1X3EA 1CTMA 5JPMC 3G6EA 3F2BA 4A3EB 3ULJA 2LSSA 1LABA 1MD2D 1D2BA 5M5WH 1E7ZA 1LACA 1GUTA 5C44H 1DJRD 1E24A 3C1EA 2Z4HA 1CKNB 1Y8PB 2XRQD 1SYBA 2BOSA 2BE5C 5JJLA 2VXWA 1SYDA 2PZWA 4NKLA 4NMZA 5BN5A 2BA1A 5CBEE 1Z7TA 2C5CA 2HHHL 5HGQA 4JI6Q 2PNRC 1WTPA 3CCLA 4IZ8A 3DXJC 4DK1A 1VQFA 3B6YA 4ZLTF 3E9IA 2VB3X 3OOCA 2EZVA 3EFXD 1Y8OB 3NPPA 3WOFA 4KMUC 4B3ML 3S16B 1VQOA 2ALYB 5FKAC 1WCMB 3NBHB 1VQGA 2HT1A 3MFYA 2F0KA 4G4KA 4JVZA 2UXCQ 5C4HA 2MJ8A 3S24A 3PUWA 1PYWD 2C9OA 3BDCA 1JCKB 5IIFA 5FK9C 4IUQA 3CCEA 3U58A 4DK0A 2MQHA 5NUCA 2PW7A 1EIFA 4C3HG 2HDLA 5IP7H 4KKSA 3CC4A 5BN4A 5JEAJ 4LK1C 2Z6KC 4KLKA 2QGQA 1ET9A 4N9PA 3A8KE 2BH2A 1EZ8A 1JOKA 2JA6B 1Y1WB 3D4DA 4PMWA 1EY6A 3FEWX 3S1RB 3K7AH 2L15A 1PYBA 2X6GA 4OX9L 5LMNL 3UDFA 4LFCL 1WD0A 2JA5H 3PUXA 1BBWA 4I65A 3TQYA 4FXGC 1IYUA 1JWUD 2L1BA 3CQZH 1CK1A 4DF7A 3M4PA 3IRBA 1VQIA 3J81i 2N88A 2MP1A 2ICIA 1HR0L 2NVXH 2E2DC 1B7YB 3QWNA 4JPBW 1CHQD 2AUKA 4ALPA 4H02A 1K8OA 1L0YB 1S40A 4U68A 2IT1A 4DV2Q 3AEVA 3PSIA 3NXWA 1IXRA 1HUMA 1LUZA 1HH2P 3BZDB 1SE2A 1VQMA 4A93H 3VR3A 2OF1A 3U50C 3J7A5 4H0LC 1RIPA 1HNZQ 3M4OH 1NMGA 1SLJA 4DR2Q 1FJGL 3TEHB 4GOPA 1GD7A 1S5CD 2F0LA 4K5WA 3SK6A 2R93G 1LTGD 1LT3D 1SSOA 4ZQ3A 1I3QH 1AE3A 5GAHC 1WTOA 1EQRA 1A2TA 1N34Q 2E2IH 2A8VA 5K36H 3OHXC 2N78A 2KQ3A 3H15A 3W3AA 1A0IA 3K5MA 4KHPL 4DR6Q 1VQAA 1VMPA 3L3OC 4DV3Q 4P74A 5KNCA 4K0KQ 1Q90A 2Z8LA 2ATWA 2Q8IB 3HOYH 3FPPA 2F03A 1FR3A 3SR1A 2WAQE 1QVGA 2UUBQ 2Q2UA 1JC7A 1QJOA 2LKVA 4IFDI 4JI2Q 3PIOA 5GROA 1PH4A 1SE4A 1RKNA 4I7AA 2AWNA 1SYGA 2JA8B 3KBGA 1HRJA 2UUCL 1GVPA 4UAIA 3C1FA 3CCSA 4LF5L 1I4GA 4X65Q 4BS9A 2J0TD 4YY3Q 2DN8A 1ZYRD 1BCPF 5C6AA 3HOZH 1TWHB 3TSSA 2JA7G 3Q24A 3SHLA 4XYQA 2UUBL 1GOZA 2N49A 2K7VA 1WOCA 3Q23A 4BWGB 5ELBA 4DUZQ 4C1NK 4KJNA 5ELOA 1O7LA 2N55A 2F0QA 4RGMA 1RF2D 2R61A 4MHEA 5F2DA 3STBD 3OW2A 1D5ZC 2D0OA 3K7UC 1YITA 1UE7A 2DJFC 3ZJYC 4LNQA 1OXVA 3A74A 1TY0A 4R4QA 5A2QL 4ZCKA 1OXSC 1HA6A 1R4QB 1WTVA 4X62L 4WJ3M 3ERQA 4DUZL 1I50B 1Y14B 5JEAH 3V96A 2QCPX 4IUTA 1MIUA 3PO3H 3KF6B 2PI2E 1S5FD 3IFTA 5IYDH 1E0BA 3TBIB 1HTLD 1W3SA 3BDLA 1OTCA 1VQ4A 4C3IG 3KLWA 4O0AA 4MIUA 2B8GA 3HOXG 4GOPC 1SMYC 1M4VA 1YVCA 2V1CC 3Q8DA 4HCSA 3LGJA 4K0KL 1GO3E 1T9HA 1SNPA 4G7HC 3KK7A 1G8ZD 4R9WA 4F8MA 1UEAB 1IL2A 4ZYSA 1PTOF 3TRZA 1Q3LA 3DEOA 4YCVA 1CKNA 3BU2A 2CWAA 3H3VC 2HCCA 1GKHA 4CGYB 2R7ZG 4LUOA 1F77A 3J81L 2EY1A 1HNWQ 4JI1L 2WINB 1YI2A 3K81C 1Q81C 1XMQL 4GKJQ 1PH5A 1D1KA 3VYSA 4JI8Q 1B8AA 1TS5A 2F0OA 2JQOA 1KTKA 3S1NB 3R2TA 2EJMA 1DM0B 1EQVA 3A5UA 1K8AC 3UDXA 2EOTA 2I5MX 1ZYRC 1KABA 4IURA 1STGA 2RBMA 2JA5B 1QILA 2ZXRA 1YNNC 1VQCA 2WKDA 1WVLA 3ER0A 3KJOA 4WJWA 1O7YA 5AJ3Q 1OXXK 3L0OA 1SYFA 4DR4L 1KNAA 4JBJA 4A3IH 4J1MA 4CKEA 1CA6A 4H44C 1G2TA 1XTCD 5ELDA 2L11A 3SK4A 2F0EA 5EQ0A 1YZ6A 1UEBA 4HCEA 2B2UA 4TVAB 1II3A 2R92G 3VR5A 1CUKA 4A93B 3KF8A 1S3OA 5M5YH 2QDLA 2VQFL 1ZEQX 1IYJB 2Z6KA 3UI2A 2RKSA 4TRDA 1LTAD 2WACA 4CJ1B 1N33L 4YCWA 1E2VA 4EQNA 4OELB 3VYRA 4QJFA 4PG3A 1BUVT 2YTXA 3I70A 4Q5VA 1K0SA 3DWPA 1F9SA 5EKLA 4P2CB 4GZYC 4ILWA 4FO2A 3PUZA 1JB3A 3BS1A 4P73A 5T1GA 3ULLA 3TP5A 3NEMA 1QUQA 2JEBI 1VQLA 4CBVA 3CF5A 1EOVA 5JPNC 4WFN3 4WJ4A 3NTIA 2E2JH 1F2ZA 1EEFD 3QOLA 4YWMA 1G2SA 1ILQA 4JI7Q 1Y1VH 2F0TA 5LMNQ 4CDCC 3KDFA 1ENCA 2B2VA 4DAYB 2Q2TA 4F88A 2YTVA 1NE3A 2QW7A 4DGZA 3CW2C 1V1OA 4JI6L 3TP6A 3SE0A 1I6HH 4OONA 1TT2A 1KAAA 1GM5A 5GAGC 3MVVA 3I4NG 4K2KA 1TS2A 3O13A 4EX5A 1DOKA 2G9HD 2PQEA 1MGSA 2R7ZH 2A69C 1HQRD 2PYKA 1Q12A 5C3EH 1HCZA 3PUVA 4DAYA 4DAPA 5AJ3L 4ME3A 2AWOA 3CMEA 3KDFB 1M8AA 3L7ZC 2XGTA 1B4OA 4ZAIA 3HOZB 2G9DA 2Y0SB 2JJQA 2XSCA 1C9OA 4OWTB 4J6HA 1PTOB 3K5LA 4ZK9B 3OTOQ 3SK8A 1BBXC 3FRPB 4AYBE 1O78A 4IJLA 4DNTB 1IBML 1YJWA 5IYDG 3PO3B 3NQIA 2LFNA 1BCPC 2R3ZA 2GVAA 2B2WC 1C7YA 4N8FA 1A62A 1BVSA 4DV5Q 2N3SA 4NP5A 2KEDA 4C3JG 4E6IA 2BE5D 2PMZB 4RG1A 2R92B 3K58A 2EYPA 3EROA 1NBWA 5M3MB 5C0XJ 1QNUA 3CXCA 3NELA 2I46A 2NYZD 1EEID 3V05A 1EY4A 4DK3C 1NMFA 3H09A 4NPSA 2CH4W 3JAMc 3KFUA 4F7XA 2WB1G 4L5SA 5CC4A 1ENFA 4ZUIA 1E2ZA 2QILA 3RUZA 3JAME 3K5OA 5M5WB 1DZ1A 1KIXA 1ASZA 2KHSA 1HR0Q 2JE6I 1L2FA 4QB4A 2EIFA 4G57A 1BKBA 3EBEA 1V8QA 1QE6A 1MBYA 4BBSG 3KOJA 5C4XB 1IL8A 4HR7B 2OT2A 4G7OC 3LX0A 1TXYA 2YU9B 2AHOB 1K83H 2SNSA 1Q86C 2KCTA 4RHRA 2ZXOA 4WRDA 4POFA 1XPOA 5IWAL 5G3LD 2KHIA 4X3UA 1YIJA 2BDOA 1EY8A 4GLVB 1KD1C 2RF4A 3BYTB 1PDQA 1TKWB 2E74C 1MI2A 4BXXG 3Q0AA 2UXDQ 2GN5A 1O7IA 3CCRA 2ZJPA 4NB3A 1G291 5M9OA 3Q6SA 4XQQA 2ASBA 3KYHC 4NDXA 2J4XA 1D7QA 4LMQD 3HOUH 2JEAI 4JV5Q 2SNMA 3HOWB 1HZ9A 3KLSA 1XNRQ 2X6LA 1A15A 3HEJA 4LF7L 1MKHA 4B3TQ 3K0XA 4X3TA 1EIGA 4UY8C 5C4ZA 3GP7A 1X6OA 3RNUA 4R8NA 5FO8B 4ID6A 4KHPQ 4LWCA 2K14A 3NQTA 3TN2A 4DA2A 1Z47A 2IX1A 1O80A 1A2UA 1YHAA 4RGTA 1DD2A 3MWYW 4YWKA 2EJFC 3A7AB 3DWQA 1PH1A 1X9NA 2XNAC 4IO9A 3OYYA 2K05A 4IQZA 1PZID 1SRUA 1RDPD 2DUDA 3GTKB 1KL9A 2IX0A 1KQSA 2B2WA 4A3JH 5DAUA 1HUNA 1VQ8A 3RN2A 4LF5Q 3OIPA 3DWAA 2EE1A 2ZTCA 3RN5A 3NWTA 4R4TA 3CKIB 2FHTA 5CV9A 3T51B 1IYVA 4MN3A 4DAMA 3A7LA 1N32Q 1RTNA 3HP3A 1ESRA 1HNXL 5LMUQ 2KHJA 1WTQA 4Z9CB 4B9XA 1LO5D 4BA2I 3CCJA 2PQAA 2RCFA 1YNJD 4TQUS 4JI8L 1SXTA 4LF8Q 3PV0A 3ICEA 3U9OA 3R2IA 4RCNA 1C48A 5IOCA 2VNUD 5C3WA 3DUZA 1W6KA 3OIQA 2OQKA 1IBKQ 1K73C 2ZM6L 2ENBA 1YBYA 1FD7D 3S1NH 2NVYB 1U0LA 2O4XA 4L5RC 1EQTA 2FFKB 2PZTA 4RHSA 2DY8A 1CA5A 4GKKQ 4JC0A 4JBMA 2NVTB 1SE8A 2B2UC 4B3TL 1IW7D 2L12A 5KEEA 4A3IG 1JJ2A 4FXKC 5C0XI 3H3VI 2KENA 4YCUA 3RMHA 3TDQA 2K52A 4HIOA 4NW2A 4XYOA 3RR5A 1P16A 2KOLA 1EUJA 5LL6X 2HDMA 1VQ7A 4JI0L 3X3MA 3ZYYX 5EAYA 1IZ6A 3VA5A 3QR8A 1F2MA 4V190 5A2QE 5IODA 2NN6H 2UUAL 3SK5A 2N8NA 3D4RA 3I4MB 3HOVG 1HNWL 2K5WA 3WOEA 3GTMB 1T5XD 5I6WA 3CCMA 4A3KG 1TWFB 1WI5A 3STBC 4CKCA 1X3QA 2CFMA 4KN4C 2L0CA 1N33Q 2AUJD 4X3KA 3WDNA 3F1ZA 3CCUA 4BY7H 3I73A 3CPFA 1L0XB 5A35A 2VQEL 3CD6A 3EN2A 4GOPB 4A3GB 2B63H 4YHHL 3LWUA 2B2VC 2UU9Q 5KYLA 4A3MH 1F2LA 4QF4A 3HOYB 1EWIA 3J80L 1B9MA 5GQOA 2R92H 2LXKA 2RVLA 4M8AA 2FJ2A 1Q7YC 3D6CA 2R6GA 1GUOA 2HIVA 3N52A 1W2BA 1KXLA 2X69A 4F87A 1HNXQ 3MC0B 2LXJA 1NNXA 5IGCA 4ZUJA 2B63G 1PZKD 5E4WC 2OTLA 4LF8L 3K7AB 4KN7C 1B53A 5C4JB 4A3FB 1PFNA 3SGIA 1JJCB 4XQNA 2AQ3B 2WAQG 3A5ZB 1RTOA 2IX3A 1CQVA 3A54A 4U673 2RSNA 4RMFA 5I9OA 1TS4A 5DM73 3C2PA 5FLXE 5LMNW 2F0GA 3M4OB 1HZAA 2OCEA 1G91A 2VZAA 1JOOA 2YTYA 4P75A 2IWHA 3T53B 2RQXA 2NB0A 3BYYB 3S2HB 1HA5A 4AYBB 3K80C 4IPDA 1C0AA 1BO0A 4DFAA 2E76C 2KVMA 4DAVA 1M1KC 5IYBG 1RL2A 3I91A 5IT9c 3I4MG 5KRUA 1K8MA 1R9TH 3GTOB 3S14H 5IT9E 3KF8B 3HGBA 4LUVA 2F0IA 5EPLA 3GDEA 3QOJA 3U4VA 4BA1I 1AZPA 2WP8J 1PRTD 4DKAC 4DR7L 3HKSA 1VQ5A 1EY9A 5IGFA 2RA4A 3K59A 4Y52H 2IHEA 4KD3A 2IW3A 5C44B 3HOZG 1GUSA 3GTQB 2ICEC 1DXMA 3AFPA 5EJWA 1CFMA 4DV4Q 2IHFA 1ASYA 3HKZE 1WFQA 2NTTA 2RSOA 3PO2B 1RODA 2B39A 1PTOC 4JOIA 4C3IH 1PFBA 1H9MA 1F9RA 4QIWE 4IALA 4KY7A 1B2TA 4N8X1 4BBRG 1H95A 5I2XA 3EJIA 3I4NB 3PIPA 4GLAC 2CW0C 1WYDA 1QVCA 2SOBA 3AMUA 1TWHH 4UDUC 1PHJA 3FMCA 5IYCG 5IGDA 4K6DA 2R7ZB 1LM0A 2HQEA 3KLRA 4M1UB 3J7ZC 5H1SE 2F0DA 1F9PA 1XNQL 5E4XA 1PFSA 1X3PA 2EQSA 1FNVA 1J5EL 3MAQA 1K83B 4K8IA 4H7BA 3FKIG 4A3DG 4K5VA 2ID0A 2CH4A 3PO2H 1K0RA 1N36L 1IBMQ 4HIMA 4A3FG 1WTRA 4QQBX 4JI4L 4TKOB 1NAPA 4DV3L 1EYCA 3A0JA 5ISRA 4LW1A 3K0YA 1AP0A 1EQQA 2BCOA 2D2CC 1JWSD 2K28A 4GN4B 4QCLA 4JI2L 1K8GA 2RHSB 2WB1E 3AFQA 1TWAB 4DV2L 4HEDA 3SXHA 4BY7G 3K5NA 1PH8A 2F0UA 2R7FA 3QG1A 3VDYA 3S14B 1JORA 4B3SL 2I07B 2LS01 1N36Q 4YY3L 3U9SA 3E5SA 1CHPD 2EYMA 2K5DA 4OGQC 2K50A 1SE3A 2O5IC 2MPMA 1D5MC 2NTSA 1XWEA 3OWFA 5IP9H 4IUVA 4NXNQ 3S2DB 1RJTA 1UWVA 2FMCA 2BH8A 2AKWB 3M3YH 2E8GA 2I5HA 1KDBA 4A75A 4OO1I 3T4AC 2Z4IA 4OX9Q 1FVIA 2JA7B 3PQIA 5CYUA 1CZWA 1VQPA 4OWXB 1QZGA 5J22A 4LFCQ 3E6ZX 1FNUA 3TP8A 3G48A 5IWAQ 5M3FH 5FLXc 1FGBD 1L1OB 5HY6A 2A19A 4HN7A 3KBXA 4LF4L 1JOQA 1ET6A 1XYIA 4IJHA 3CQZB 1EOTA 3EQLC 3BZCA 2O5JC 4JOIC 4K6LA 4Y7NB 5CGKA 1GHKA 4X62Q 2XIWA 3HKZG 1L1OC 2F0NA 2KCNA 1TIID 2D9UA 4B3RQ 1J5EQ 2I5LX 2CQOA 2KA7A 3UE1A 5FJ8G 2K5VA 1CI3M 1SNMA 2RCNA 4DXGA 2WV6D 3QJYA 3HOUB 3GV6A 3KJPA 4A3CH 2JA6H 4A3BB 4IUNA 1STAA 5I4DA 1NR4A 1IHZA 1SNQA 2NWGA 5J39A 3BJUA 4C3JH 5CBAE 4DR2L 3ND8A 1J9OA 3E3XA 1IKLA 2ZT9C 2E5LQ 1U4LA 3M7GA 1ML0D 4CKBA 4A3CG 2Q2HA 1IW7C 3NWSA 4CDEC 5JOBA 2K5QA 4HJ9A 2Q8RE 3OMGA 4LFAL 3MHBA 3RZDH 1NUCA 1X54A 2OXPA 3NP8A 4OXPA 4L5TA 5E3FA 4J8QA 1EY0A 1FL0A 4JI1Q 4B3SQ 5CV8A 4DUYQ 1XMOL 4DR6L 3JAMi 1KDCA 3W5OA 2K6AA 4K14A 3VR6A 3GTLH 3GQBA 5D3DA 2AQ1B 3ONAB 1Q1EA 4B9WA 1DONA 2LMCB 5J3BA 3CMAA 1N32L 2NUCA 5ELCA 4DR3L 3SVMA 1HHVA 5FO9B 3MXNB 2PPBC 1NY4A 2JA9A 3D4WA 1I4HA 2P5ZX 2XTIA 2K33A 4A3GH 3D8GA 3T16A 2K4KA 3EIVA 1X65A 4IPGA 1A8VA 4X64Q 4YHHQ 1EU4A 1H9RA 4R4CA 1G51A 2CQAA 1F2YA 2KEEA 3G7LA 1ENAA 1EFWA 3W1BA 4O2DA 1A3UA 1N9WA 1OO9B 3J7AV 1QG7A 2B63B 4AIMA 4GKKL 4R4OA 3G4SA 1Y1WH 1IBLQ 2TMPA 2RHQB 2OWOA 1LT5D 4BY1B 3S15H 2PMZE 1V1PB 4X3SA 2WIIB 1EZ6A 3MXUA 3MFGA 2JA8G 5I6YA 2VB2X 4JK1C 1QCBD 1TWFH 3QO2A 3BVGA 2VY3A 1B1ZA 1YNND 3J80c 1UE5A 1JT8A 5C5LA
chains in the Genus database with same CATH topology
4LF5Q 5M5XH 4A93H 4A93G 1X55A 2MNAA 3U50C 3J7A5 1RIPA 4UP9A 4DV7Q 4A3JG 1HNZQ 3M4OH 1NMGA 3DLLA 4OWWB 3HFZB 2E2HH 3PGZA 2ZTCA 5IE8A 3RN5A 4JBKA 2JA8H 4R4TA 4PZ8A 1SLJA 3M4QA 5FJ8H 4DR2Q 1FJGL 3T1YQ 3TEHB 4EQ5A 4NXML 2F4VQ 4DAMA 4GOPA 1E22A 1GD7A 2A1AA 4LFAQ 5GAEC 4A3FH 1G6PA 4IOAA 1N32Q 3HOWG 2UUAQ 3PO2G 2R93G 3TS0A 3S1MH 5C44G 4IPCA 2JA6G 1HNXL 5LMUQ 4UPAA 1I3QH 2KHJA 1AE3A 5GAHC 3PO3G 4JYAQ 2VQEQ 1XJVA 1Z9FA 1EQRA 4BA2I 4HIKA 3E9HA 2VW9A 1N34Q 1HR0W 3CCJA 2PQAA 2E2IH 3W1GA 5JEAG 4TQUS 2A8VA 2N78A 4JI8L 2NVTH 4LF8Q 3ICEA 3PV0A 3H15A 3UE0A 2NVQH 1I50H 1A0IA 2JA5G 4KHPL 2VNUD 4DR6Q 1PH9A 1VQAA 4DV3Q 4P74A 4LF9Q 4K0KQ 1X3FA 2NVYH 4A3GG 2ATWA 3HOYH 2CKZB 2OQKA 2ZTDA 1IBKQ 1K73C 3I55A 2ZM6L 4X6AH 1HJPA 1YBYA 4DV6Q 4LFBQ 1BBUA 3S1NH 5M3MH 1U0LA 4L5RC 4NXMQ 2WAQE 1QVGA 2UUBQ 1UE6A 1PH3A 2Q2UA 3HOUG 1Q1BA 4QL5A 2Z0SA 4Y7NH 3GD7A 4JI2Q 5GADC 3PIOA 4IFDI 4BBRH 4GKKQ 5GROA 4J15A 4JC0A 1PH4A 2I0QA 3MEFA 1SN8A 1SE8A 4JBMA 2AWNA 4JV5L 1XNQQ 4B3TL 2UUCL 1GVPA 4A3IG 1JJ2A 5C0XI 4LF7Q 3H3VI 2KENA 3T1HQ 4GKJL 3CCSA 4LF5L 2BA0A 4C3HH 4YCUA 4X65Q 2K52A 4HIOA 4YY3Q 3RR5A 1P16A 1EUJA 3M9BA 5IYBH 4HIDA 1VQ7A 4JI0L 2EXDA 3HOZH 2NZOA 4FDBA 5EAYA 1IZ6A 4QGUA 3OTOL 2JA7H 1FJGQ 2JA7G 1YHBA 4AQYQ 3I4NH 3KF6A 4B3MQ 3CPWA 4XIGS 4LF4Q 1Y1VG 2UUBL 2N49A 2UUAL 3S1QH 2N8NA 1WOCA 3UDIA 2Y0SG 4DUZQ 3HOVG 1HNWL 3S16H 4OO1G 4BBSH 5ELOA 1VQBA 3CCMA 4JYAL 4A3KG 1WI5A 3STBC 2CFMA 1N33Q 5C4XG 4JG2A 3UDGA 1DGSA 4AH6A 3F1ZA 3FKIH 3CCUA 1LTLA 4BY7H 1JJGA 4DR4Q 3STBD 3OW2A 1PH2A 4DV0Q 2D0OA 3CPFA 3K7UC 1YITA 1UE7A 1SMXA 4QY7A 2VQEL 3CD6A 3PF5A 3D0FA 3EN2A 4GOPB 3ZJYC 4LNQA 1OXVA 4DR7Q 4JI4Q 2F52A 3A74A 4R4QA 2B63H 4YHHL 1OXSC 2UU9Q 1YJNA 2KBNA 4A3MH 4JI3Q 2DGYA 3TREA 3S1RH 1EWIA 4X62L 5GQOA 2R92H 2LXKA 4A4IA 4WJ3M 4DUZL 3DM3A 2YYZA 1Q7YC 3CC7A 2R6GA 1VS0A 1Y14B 2HIVA 4DV4L 1W2BA 5K36G 1KXLA 1HNXQ 2E5LL 4A3DH 2LXJA 1J6QA 1MIUA 3T1HL 1XNRL 3PO3H 3KF6B 2PI2E 3J80i 4X65L 4GNXA 2B63G 1K3RA 3AYHB 1D8LA 1FGUA 5IYDH 1W3SA 3HOXH 1OTCA 2OTLA 1VQ4A 4LF8L 4POGA 2R93H 1AE2A 4DV0L 1HZCA 3HOWH 3KLWA 4O0AA 1N34L 3HOXG 4GOPC 3GTMH 1YVCA 2V1CC 4LF9L 3Q8DA 4K0KL 3LGJA 4GS3A 1GO3E 1PA6A 1T9HA 2B29A 4A3EG 4MNOA 1CKMA 3SGIA 1JJCB 3GTOH 3L2PA 5C0XG 2WAQG 3A5ZB 3RLFA 5M3FG 4A3MG 4DV6L 4DUYL 4LUZA 5IYCH 1XMOQ 1IL2A 4JI3L 4RMFA 2OQ0A 2Y0SE 3TRZA 1QVFA 5LMNW 4NXNL 4JI5Q 1HZAA 2OCEA 2C35B 4YCVA 1CKNA 4LF6L 2VZAA 3BU2A 3S2HH 2CWAA 2D62A 4AQYL 2VS1A 2VUMH 2YTYA 1GKHA 4P75A 2NN6G 1KC8C 3M7NA 4DV5L 2R7ZG 4LUOA 2K75A 1S72A 1A63A 3K80C 4IPDA 1C0AA 1KRTA 4APVA 1SFOH 4JI7L 1HNWQ 4JI1L 4P71A 1YI2A 2B3GA 1WJJA 2F3IA 3K81C 5IYBG 1I5FA 1RL2A 1M1KC 5IT9c 1XMQL 1Q81C 1PH5A 4GKJQ 2R7DA 3I4MG 1L1OA 4BY1H 4DR5Q 1R9TH 5C4XH 1K9MC 1NTGA 1B8AA 4JI8Q 3S14H 2JQOA 3KF8B 4LUVA 2PQAB 3GDEA 4DPGA 1AH9A 3U4VA 3D31A 3I4OA 4BA1I 2UXDL 3HOVH 2WP8J 1TWAH 4DV1Q 4X64L 1P8LA 1SROA 4DKAC 4DR7L 3A5UA 3HKSA 1K8AC 1VQ5A 3UDXA 2I5MX 1Q46A 4LFBL 4IPHA 1KHIA 1YHQA 4X66L 4Y52H 2IHEA 3I56A 1HZBA 3ULPA 1Q8KA 1TWCH 4JCVE 1VQCA 4A76A 3HOZG 4B3RL 3JC66 2QEXA 1IBLL 3AFPA 3ER0A 3KJOA 2VUMG 4DV4Q 2K5HA 1U5KA 2IHFA 4BY1G 1M90C 1ASYA 3HKZE 1JE5A 1WFQA 1QZHA 4A3EH 2UUCQ 5AJ3Q 1OXXK 3L0OA 5FLMH 4MTNA 4DR4L 1E1OA 2JK8A 4JBJA 4A3IH 4JOIA 4C3IH 3RN2A 4QIWE 2K5NA 4BBRG 1H95A 3PIPA 5IP7G 4GLAC 5BR8Q 1Q82C 1WYDA 1YZ6A 1QVCA 1UEBA 4KHZA 1PVOA 1TWHH 3FHWA 4TVAB 1L0WA 1PHJA 1X3GA 1PH6A 1YNXA 1JT8A 5JJIA 2R92G 5IYCG 1CUKA 2H5XA 1LM0A 1S3OA 1MJCA 2MO1A 4UP8A 4AYBG 3J7ZC 5H1SE 4DR3Q 5M5YH 2VQFL 4HJ7A 1PH7A 1XNQL 1IYJB 2Z6KA 3TS2A 5ELNA 1PFSA 2EQSA 1VCIA 4DK6C 1CSPA 1XPRA 1J5EL 1N33L 3S17H 2YV5A 5LMUL 2YU9H 4YCWA 1KRSA 3RLOA 2IY5B 4QJFA 2PNHA 2PI2A 3CAMA 2YTXA 1YEZA 4PG3A 1HNZL 3FKIG 2ZJRA 4JI0Q 1LYLA 1VQKA 4A3DG 2ID0A 1VQHA 3S2DH 3PO2H 1K0RA 1N36L 1XPUA 1IBMQ 4HIMA 4A3FG 2Q2IA 4JI4L 4QQBX 3PUZA 5FLMG 1E1TA 3J81j 4DV3L 4LF6Q 3A0JA 3G71A 4P73A 3ULLA 4LW1A 3NEMA 1QUQA 2JEBI 1VQLA 3CF5A 2ZTEA 1B70B 1EOVA 5DLQE 2ZM6Q 3H3VH 1EQQA 4WJ4A 2E2JH 3CC2A 2UXBL 4YWMA 2VL6A 4GN4B 1PV4A 4JI2L 1K8GA 2RHSB 4MZ9A 1Y1VH 2WB1E 5E7NA 3AFQA 4JI7Q 2WFWA 4DV2L 3I7FA 4DR5L 5LMNQ 1JMCA 3KDFA 4BY7G 1XMQQ 1PH8A 4DAYB 2R7FA 2Q2TA 3GTGH 1Y1WG 4GLXA 3VDYA 4A3KH 2YTVA 2OTJA 1OXTA 1NE3A 4B3SL 4DNIA 1N36Q 4YY3L 3CW2C 3WWVA 1I94Q 2CCZA 4JI6L 1I6HH 1MJEA 4OONA 2AMCB 4X66Q 2K50A 5GAGC 1GM5A 3I4NG 4A3BG 4JI5L 4EX5A 5IP9H 3CCVA 4NXNQ 5M3MG 4DR1L 2D0PA 3E0EA 1UWVA 2BH8A 2R7ZH 2AKWB 1X56A 2UXBQ 3M3YH 4JBWA 4BXXH 2E8GA 1Q12A 5C3EH 2I5HA 1V43A 4PZ7A 3PUVA 4C2MH 3BZKA 4A75A 3GTKH 5AJ3L 1N8RC 4ME3A 2AWOA 3CMEA 3KDFB 4OO1I 3NENA 4OX9Q 2ZJQA 3F2CA 1FVIA 1PYSB 1VQEA 1V9PA 3F8TA 3L7ZC 2XGTA 3PUYA 5IY0A 4OWXB 1VQPA 1QZGA 1XTDA 3AQQA 4A3LG 4LFCQ 2JJQA 3HOYG 1WCMG 1C9OA 2HHHQ 5IWAQ 3G48A 2HIXA 4OWTB 5M3FH 3RZOH 5FLXc 5IP9G 5C4JH 1L1OB 5HY6A 3OTOQ 1X3EA 1VQ9A 2A19A 3G6EA 3CP0A 3F2BA 4LF4L 3ULJA 2LSSA 4AYBE 4IJHA 4R1JA 4IJLA 4DV1L 1IBML 1YJWA 5IYDG 2QA4A 1EIYB 3GTQH 5M5WH 1E7ZA 3BZCA 2GVAA 4JOIC 1C7YA 2FXQA 1A62A 1BVSA 5C44H 2N3SA 4DV5Q 1E24A 4X62Q 3HKZG 1CKNB 1E3PA 1L1OC 4IFDJ 4RG1A 3J81c 3M85A 3FP9A 4B3RQ 5C0XJ 1NBWA 1J5EQ 1EYGA 2I5LX 2CQOA 3UE1A 5JJLA 3CXCA 3NELA 5FJ8G 2K5VA 2RCNA 3U4ZA 4DK3C 1NMFA 4NPSA 2BA1A 3JAMc 3KFUA 2HQLA 1VQJA 2WB1G 5HGQA 3KJPA 1I94L 2HHHL 4JI6Q 4L5SA 2JA6H 4A3CH 1CSQA 3CCLA 3F2DA 2CWPA 4PZ6A 1KIXA 1ASZA 1VQFA 3B6YA 3E9IA 1HR0Q 2JE6I 3BJUA 5BR8L 4DV7L 4C3JH 3GO5A 1L2FA 4DR2L 2EIFA 4B3ML 3H0GH 2E5LQ 1BKBA 3EBEA 3ERSX 4A3CG 2Q2HA 2ALYB 4HJAA 1VQOA 4BBSG 1VQDA 3KOJA 3NBHB 1VQGA 1SR3A 2HT1A 3PF4A 1TWGH 1TXYA 4HJ9A 4LFAL 2AHOB 1K83H 3RZDH 1Q86C 2KCTA 1X54A 2UXCQ 4POFA 1XPOA 3S24A 5IWAL 3PUWA 4OXPA 4L5TA 4KI0A 1FL0A 2KHIA 4JI1Q 4B3SQ 1YIJA 4R4IA 1WCMH 3CCEA 4HJ5A 4DUYQ 1XMOL 4DR6L 3U58A 4GLVB 1KD1C 2RF4A 3JAMi 2MQHA 3W5OA 1YJ9A 3GTLH 1EIFA 1IBKL 5IP7H 3CC4A 5JJKA 1Q1EA 2UU9L 4BXXG 5JEAJ 2UXDQ 2GN5A 1O7IA 2Z6KC 4KLKA 3CCRA 1NJIC 5J3BA 2QGQA 3CMAA 2ZJPA 2ES2A 1N32L 4NB3A 1G291 2BH2A 2ASBA 4HJ8A 4DR3L 3KYHC 1KAWA 2VQFQ 3MXNB 4PMWA 1D7QA 1OXUA 2JEAI 3HOUH 4JV5Q 1NY4A 1QUQB 2F4VL 2JA9A 3I2ZA 1UE1A 1HZ9A 3K7AH 4GN5A 1XNRQ 2L15A 4XTCS 1PYBA 4LF7L 4OX9L 2KCMA 2XTIA 3K8AA 5C3EG 1MKHA 4B3TQ 4A3LH 1VQNA 3K0XA 5LMNL 3UDFA 4A3GH 2NN6I 4LFCL 4UY8C 1JB7A 2K4KA 4GNXC 3EIVA 3GTPH 2JA5H 1X65A 4IPGA 1A8VA 4A3BH 4X64Q 4UP7A 1X6OA 1BBWA 3PUXA 4YHHQ 4R4CA 3TQYA 3RNUA 1G51A 1V1QA 2GVBA 4IFDG 3RLNA 3CQZH 4KHPQ 4LWCA 1EFWA 2K14A 3W1BA 3M4PA 4O2DA 1N9WA 3IRBA 1VQIA 2NZHA 3CCQA 4L5QA 4YWLA 1Z47A 3J81i 3H0GG 4AIMA 1HR0L 4P72A 4GKKL 4R4OA 3G4SA 1Y1WH 1IBLQ 2NVXH 3T1YL 2IX1A 2RHQB 1YHAA 1B7YB 2OWOA 3I4MH 4DR1Q 4YWKA 4GN3B 3S15H 3PCOB 2UXCL 2PMZE 2MO0A 4ALPA 4H02A 1PH1A 1S40A 1CKOA 1X9NA 2IT1A 4DV2Q 4IO9A 1VQ6A 3AEVA 3OYYA 2JA8G 1SRUA 2DUDA 1KL9A 3PSIA 2IX0A 4GNXB 1TWFH 1KQSA 3GTJH 1IXRA 4A3JH 2VY3A 1LUZA 1HH2P 3J80c 4IOCA 1VQ8A 1UE5A 2MFIA 1VQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 Q;  5M5X H;  4A93 H;  4A93 G;  1X55 A;  2MNA A;  3U50 C;  3J7A 5;  1RIP A;  4UP9 A;  4DV7 Q;  4A3J G;  1HNZ Q;  3M4O H;  1NMG A;  3DLL A;  4OWW B;  3HFZ B;  2E2H H;  3PGZ A;  2ZTC A;  5IE8 A;  3RN5 A;  4JBK A;  2JA8 H;  4R4T A;  4PZ8 A;  1SLJ A;  3M4Q A;  5FJ8 H;  4DR2 Q;  1FJG L;  3T1Y Q;  3TEH B;  4EQ5 A;  4NXM L;  2F4V Q;  4DAM A;  4GOP A;  1E22 A;  1GD7 A;  2A1A A;  4LFA Q;  5GAE C;  4A3F H;  1G6P A;  4IOA A;  1N32 Q;  3HOW G;  2UUA Q;  3PO2 G;  2R93 G;  3TS0 A;  3S1M H;  5C44 G;  4IPC A;  2JA6 G;  1HNX L;  5LMU Q;  4UPA A;  1I3Q H;  2KHJ A;  1AE3 A;  5GAH C;  3PO3 G;  4JYA Q;  2VQE Q;  1XJV A;  1Z9F A;  1EQR A;  4BA2 I;  4HIK A;  3E9H A;  2VW9 A;  1N34 Q;  1HR0 W;  3CCJ A;  2PQA A;  2E2I H;  3W1G A;  5JEA G;  4TQU S;  2A8V A;  2N78 A;  4JI8 L;  2NVT H;  4LF8 Q;  3ICE A;  3PV0 A;  3H15 A;  3UE0 A;  2NVQ H;  1I50 H;  1A0I A;  2JA5 G;  4KHP L;  2VNU D;  4DR6 Q;  1PH9 A;  1VQA A;  4DV3 Q;  4P74 A;  4LF9 Q;  4K0K Q;  1X3F A;  2NVY H;  4A3G G;  2ATW A;  3HOY H;  2CKZ B;  2OQK A;  2ZTD A;  1IBK Q;  1K73 C;  3I55 A;  2ZM6 L;  4X6A H;  1HJP A;  1YBY A;  4DV6 Q;  4LFB Q;  1BBU A;  3S1N H;  5M3M H;  1U0L A;  4L5R C;  4NXM Q;  2WAQ E;  1QVG A;  2UUB Q;  1UE6 A;  1PH3 A;  2Q2U A;  3HOU G;  1Q1B A;  4QL5 A;  2Z0S A;  4Y7N H;  3GD7 A;  4JI2 Q;  5GAD C;  3PIO A;  4IFD I;  4BBR H;  4GKK Q;  5GRO A;  4J15 A;  4JC0 A;  1PH4 A;  2I0Q A;  3MEF A;  1SN8 A;  1SE8 A;  4JBM A;  2AWN A;  4JV5 L;  1XNQ Q;  4B3T L;  2UUC L;  1GVP A;  4A3I G;  1JJ2 A;  5C0X I;  4LF7 Q;  3H3V I;  2KEN A;  3T1H Q;  4GKJ L;  3CCS A;  4LF5 L;  2BA0 A;  4C3H H;  4YCU A;  4X65 Q;  2K52 A;  4HIO A;  4YY3 Q;  3RR5 A;  1P16 A;  1EUJ A;  3M9B A;  5IYB H;  4HID A;  1VQ7 A;  4JI0 L;  2EXD A;  3HOZ H;  2NZO A;  4FDB A;  5EAY A;  1IZ6 A;  4QGU A;  3OTO L;  2JA7 H;  1FJG Q;  2JA7 G;  1YHB A;  4AQY Q;  3I4N H;  3KF6 A;  4B3M Q;  3CPW A;  4XIG S;  4LF4 Q;  1Y1V G;  2UUB L;  2N49 A;  2UUA L;  3S1Q H;  2N8N A;  1WOC A;  3UDI A;  2Y0S G;  4DUZ Q;  3HOV G;  1HNW L;  3S16 H;  4OO1 G;  4BBS H;  5ELO A;  1VQB A;  3CCM A;  4JYA L;  4A3K G;  1WI5 A;  3STB C;  2CFM A;  1N33 Q;  5C4X G;  4JG2 A;  3UDG A;  1DGS A;  4AH6 A;  3F1Z A;  3FKI H;  3CCU A;  1LTL A;  4BY7 H;  1JJG A;  4DR4 Q;  3STB D;  3OW2 A;  1PH2 A;  4DV0 Q;  2D0O A;  3CPF A;  3K7U C;  1YIT A;  1UE7 A;  1SMX A;  4QY7 A;  2VQE L;  3CD6 A;  3PF5 A;  3D0F A;  3EN2 A;  4GOP B;  3ZJY C;  4LNQ A;  1OXV A;  4DR7 Q;  4JI4 Q;  2F52 A;  3A74 A;  4R4Q A;  2B63 H;  4YHH L;  1OXS C;  2UU9 Q;  1YJN A;  2KBN A;  4A3M H;  4JI3 Q;  2DGY A;  3TRE A;  3S1R H;  1EWI A;  4X62 L;  5GQO A;  2R92 H;  2LXK A;  4A4I A;  4WJ3 M;  4DUZ L;  3DM3 A;  2YYZ A;  1Q7Y C;  3CC7 A;  2R6G A;  1VS0 A;  1Y14 B;  2HIV A;  4DV4 L;  1W2B A;  5K36 G;  1KXL A;  1HNX Q;  2E5L L;  4A3D H;  2LXJ A;  1J6Q A;  1MIU A;  3T1H L;  1XNR L;  3PO3 H;  3KF6 B;  2PI2 E;  3J80 i;  4X65 L;  4GNX A;  2B63 G;  1K3R A;  3AYH B;  1D8L A;  1FGU A;  5IYD H;  1W3S A;  3HOX H;  1OTC A;  2OTL A;  1VQ4 A;  4LF8 L;  4POG A;  2R93 H;  1AE2 A;  4DV0 L;  1HZC A;  3HOW H;  3KLW A;  4O0A A;  1N34 L;  3HOX G;  4GOP C;  3GTM H;  1YVC A;  2V1C C;  4LF9 L;  3Q8D A;  4K0K L;  3LGJ A;  4GS3 A;  1GO3 E;  1PA6 A;  1T9H A;  2B29 A;  4A3E G;  4MNO A;  1CKM A;  3SGI A;  1JJC B;  3GTO H;  3L2P A;  5C0X G;  2WAQ G;  3A5Z B;  3RLF A;  5M3F G;  4A3M G;  4DV6 L;  4DUY L;  4LUZ A;  5IYC H;  1XMO Q;  1IL2 A;  4JI3 L;  4RMF A;  2OQ0 A;  2Y0S E;  3TRZ A;  1QVF A;  5LMN W;  4NXN L;  4JI5 Q;  1HZA A;  2OCE A;  2C35 B;  4YCV A;  1CKN A;  4LF6 L;  2VZA A;  3BU2 A;  3S2H H;  2CWA A;  2D62 A;  4AQY L;  2VS1 A;  2VUM H;  2YTY A;  1GKH A;  4P75 A;  2NN6 G;  1KC8 C;  3M7N A;  4DV5 L;  2R7Z G;  4LUO A;  2K75 A;  1S72 A;  1A63 A;  3K80 C;  4IPD A;  1C0A A;  1KRT A;  4APV A;  1SFO H;  4JI7 L;  1HNW Q;  4JI1 L;  4P71 A;  1YI2 A;  2B3G A;  1WJJ A;  2F3I A;  3K81 C;  5IYB G;  1I5F A;  1RL2 A;  1M1K C;  5IT9 c;  1XMQ L;  1Q81 C;  1PH5 A;  4GKJ Q;  2R7D A;  3I4M G;  1L1O A;  4BY1 H;  4DR5 Q;  1R9T H;  5C4X H;  1K9M C;  1NTG A;  1B8A A;  4JI8 Q;  3S14 H;  2JQO A;  3KF8 B;  4LUV A;  2PQA B;  3GDE A;  4DPG A;  1AH9 A;  3U4V A;  3D31 A;  3I4O A;  4BA1 I;  2UXD L;  3HOV H;  2WP8 J;  1TWA H;  4DV1 Q;  4X64 L;  1P8L A;  1SRO A;  4DKA C;  4DR7 L;  3A5U A;  3HKS A;  1K8A C;  1VQ5 A;  3UDX A;  2I5M X;  1Q46 A;  4LFB L;  4IPH A;  1KHI A;  1YHQ A;  4X66 L;  4Y52 H;  2IHE A;  3I56 A;  1HZB A;  3ULP A;  1Q8K A;  1TWC H;  4JCV E;  1VQC A;  4A76 A;  3HOZ G;  4B3R L;  3JC6 6;  2QEX A;  1IBL L;  3AFP A;  3ER0 A;  3KJO A;  2VUM G;  4DV4 Q;  2K5H A;  1U5K A;  2IHF A;  4BY1 G;  1M90 C;  1ASY A;  3HKZ E;  1JE5 A;  1WFQ A;  1QZH A;  4A3E H;  2UUC Q;  5AJ3 Q;  1OXX K;  3L0O A;  5FLM H;  4MTN A;  4DR4 L;  1E1O A;  2JK8 A;  4JBJ A;  4A3I H;  4JOI A;  4C3I H;  3RN2 A;  4QIW E;  2K5N A;  4BBR G;  1H95 A;  3PIP A;  5IP7 G;  4GLA C;  5BR8 Q;  1Q82 C;  1WYD A;  1YZ6 A;  1QVC A;  1UEB A;  4KHZ A;  1PVO A;  1TWH H;  3FHW A;  4TVA B;  1L0W A;  1PHJ A;  1X3G A;  1PH6 A;  1YNX A;  1JT8 A;  5JJI A;  2R92 G;  5IYC G;  1CUK A;  2H5X A;  1LM0 A;  1S3O A;  1MJC A;  2MO1 A;  4UP8 A;  4AYB G;  3J7Z C;  5H1S E;  4DR3 Q;  5M5Y H;  2VQF L;  4HJ7 A;  1PH7 A;  1XNQ L;  1IYJ B;  2Z6K A;  3TS2 A;  5ELN A;  1PFS A;  2EQS A;  1VCI A;  4DK6 C;  1CSP A;  1XPR A;  1J5E L;  1N33 L;  3S17 H;  2YV5 A;  5LMU L;  2YU9 H;  4YCW A;  1KRS A;  3RLO A;  2IY5 B;  4QJF A;  2PNH A;  2PI2 A;  3CAM A;  2YTX A;  1YEZ A;  4PG3 A;  1HNZ L;  3FKI G;  2ZJR A;  4JI0 Q;  1LYL A;  1VQK A;  4A3D G;  2ID0 A;  1VQH A;  3S2D H;  3PO2 H;  1K0R A;  1N36 L;  1XPU A;  1IBM Q;  4HIM A;  4A3F G;  2Q2I A;  4JI4 L;  4QQB X;  3PUZ A;  5FLM G;  1E1T A;  3J81 j;  4DV3 L;  4LF6 Q;  3A0J A;  3G71 A;  4P73 A;  3ULL A;  4LW1 A;  3NEM A;  1QUQ A;  2JEB I;  1VQL A;  3CF5 A;  2ZTE A;  1B70 B;  1EOV A;  5DLQ E;  2ZM6 Q;  3H3V H;  1EQQ A;  4WJ4 A;  2E2J H;  3CC2 A;  2UXB L;  4YWM A;  2VL6 A;  4GN4 B;  1PV4 A;  4JI2 L;  1K8G A;  2RHS B;  4MZ9 A;  1Y1V H;  2WB1 E;  5E7N A;  3AFQ A;  4JI7 Q;  2WFW A;  4DV2 L;  3I7F A;  4DR5 L;  5LMN Q;  1JMC A;  3KDF A;  4BY7 G;  1XMQ Q;  1PH8 A;  4DAY B;  2R7F A;  2Q2T A;  3GTG H;  1Y1W G;  4GLX A;  3VDY A;  4A3K H;  2YTV A;  2OTJ A;  1OXT A;  1NE3 A;  4B3S L;  4DNI A;  1N36 Q;  4YY3 L;  3CW2 C;  3WWV A;  1I94 Q;  2CCZ A;  4JI6 L;  1I6H H;  1MJE A;  4OON A;  2AMC B;  4X66 Q;  2K50 A;  5GAG C;  1GM5 A;  3I4N G;  4A3B G;  4JI5 L;  4EX5 A;  5IP9 H;  3CCV A;  4NXN Q;  5M3M G;  4DR1 L;  2D0P A;  3E0E A;  1UWV A;  2BH8 A;  2R7Z H;  2AKW B;  1X56 A;  2UXB Q;  3M3Y H;  4JBW A;  4BXX H;  2E8G A;  1Q12 A;  5C3E H;  2I5H A;  1V43 A;  4PZ7 A;  3PUV A;  4C2M H;  3BZK A;  4A75 A;  3GTK H;  5AJ3 L;  1N8R C;  4ME3 A;  2AWO A;  3CME A;  3KDF B;  4OO1 I;  3NEN A;  4OX9 Q;  2ZJQ A;  3F2C A;  1FVI A;  1PYS B;  1VQE A;  1V9P A;  3F8T A;  3L7Z C;  2XGT A;  3PUY A;  5IY0 A;  4OWX B;  1VQP A;  1QZG A;  1XTD A;  3AQQ A;  4A3L G;  4LFC Q;  2JJQ A;  3HOY G;  1WCM G;  1C9O A;  2HHH Q;  5IWA Q;  3G48 A;  2HIX A;  4OWT B;  5M3F H;  3RZO H;  5FLX c;  5IP9 G;  5C4J H;  1L1O B;  5HY6 A;  3OTO Q;  1X3E A;  1VQ9 A;  2A19 A;  3G6E A;  3CP0 A;  3F2B A;  4LF4 L;  3ULJ A;  2LSS A;  4AYB E;  4IJH A;  4R1J A;  4IJL A;  4DV1 L;  1IBM L;  1YJW A;  5IYD G;  2QA4 A;  1EIY B;  3GTQ H;  5M5W H;  1E7Z A;  3BZC A;  2GVA A;  4JOI C;  1C7Y A;  2FXQ A;  1A62 A;  1BVS A;  5C44 H;  2N3S A;  4DV5 Q;  1E24 A;  4X62 Q;  3HKZ G;  1CKN B;  1E3P A;  1L1O C;  4IFD J;  4RG1 A;  3J81 c;  3M85 A;  3FP9 A;  4B3R Q;  5C0X J;  1NBW A;  1J5E Q;  1EYG A;  2I5L X;  2CQO A;  3UE1 A;  5JJL A;  3CXC A;  3NEL A;  5FJ8 G;  2K5V A;  2RCN A;  3U4Z A;  4DK3 C;  1NMF A;  4NPS A;  2BA1 A;  3JAM c;  3KFU A;  2HQL A;  1VQJ A;  2WB1 G;  5HGQ A;  3KJP A;  1I94 L;  2HHH L;  4JI6 Q;  4L5S A;  2JA6 H;  4A3C H;  1CSQ A;  3CCL A;  3F2D A;  2CWP A;  4PZ6 A;  1KIX A;  1ASZ A;  1VQF A;  3B6Y A;  3E9I A;  1HR0 Q;  2JE6 I;  3BJU A;  5BR8 L;  4DV7 L;  4C3J H;  3GO5 A;  1L2F A;  4DR2 L;  2EIF A;  4B3M L;  3H0G H;  2E5L Q;  1BKB A;  3EBE A;  3ERS X;  4A3C G;  2Q2H A;  2ALY B;  4HJA A;  1VQO A;  4BBS G;  1VQD A;  3KOJ A;  3NBH B;  1VQG A;  1SR3 A;  2HT1 A;  3PF4 A;  1TWG H;  1TXY A;  4HJ9 A;  4LFA L;  2AHO B;  1K83 H;  3RZD H;  1Q86 C;  2KCT A;  1X54 A;  2UXC Q;  4POF A;  1XPO A;  3S24 A;  5IWA L;  3PUW A;  4OXP A;  4L5T A;  4KI0 A;  1FL0 A;  2KHI A;  4JI1 Q;  4B3S Q;  1YIJ A;  4R4I A;  1WCM H;  3CCE A;  4HJ5 A;  4DUY Q;  1XMO L;  4DR6 L;  3U58 A;  4GLV B;  1KD1 C;  2RF4 A;  3JAM i;  2MQH A;  3W5O A;  1YJ9 A;  3GTL H;  1EIF A;  1IBK L;  5IP7 H;  3CC4 A;  5JJK A;  1Q1E A;  2UU9 L;  4BXX G;  5JEA J;  2UXD Q;  2GN5 A;  1O7I A;  2Z6K C;  4KLK A;  3CCR A;  1NJI C;  5J3B A;  2QGQ A;  3CMA A;  2ZJP A;  2ES2 A;  1N32 L;  4NB3 A;  1G29 1;  2BH2 A;  2ASB A;  4HJ8 A;  4DR3 L;  3KYH C;  1KAW A;  2VQF Q;  3MXN B;  4PMW A;  1D7Q A;  1OXU A;  2JEA I;  3HOU H;  4JV5 Q;  1NY4 A;  1QUQ B;  2F4V L;  2JA9 A;  3I2Z A;  1UE1 A;  1HZ9 A;  3K7A H;  4GN5 A;  1XNR Q;  2L15 A;  4XTC S;  1PYB A;  4LF7 L;  4OX9 L;  2KCM A;  2XTI A;  3K8A A;  5C3E G;  1MKH A;  4B3T Q;  4A3L H;  1VQN A;  3K0X A;  5LMN L;  3UDF A;  4A3G H;  2NN6 I;  4LFC L;  4UY8 C;  1JB7 A;  2K4K A;  4GNX C;  3EIV A;  3GTP H;  2JA5 H;  1X65 A;  4IPG A;  1A8V A;  4A3B H;  4X64 Q;  4UP7 A;  1X6O A;  1BBW A;  3PUX A;  4YHH Q;  4R4C A;  3TQY A;  3RNU A;  1G51 A;  1V1Q A;  2GVB A;  4IFD G;  3RLN A;  3CQZ H;  4KHP Q;  4LWC A;  1EFW A;  2K14 A;  3W1B A;  3M4P A;  4O2D A;  1N9W A;  3IRB A;  1VQI A;  2NZH A;  3CCQ A;  4L5Q A;  4YWL A;  1Z47 A;  3J81 i;  3H0G G;  4AIM A;  1HR0 L;  4P72 A;  4GKK L;  4R4O A;  3G4S A;  1Y1W H;  1IBL Q;  2NVX H;  3T1Y L;  2IX1 A;  2RHQ B;  1YHA A;  1B7Y B;  2OWO A;  3I4M H;  4DR1 Q;  4YWK A;  4GN3 B;  3S15 H;  3PCO B;  2UXC L;  2PMZ E;  2MO0 A;  4ALP A;  4H02 A;  1PH1 A;  1S40 A;  1CKO A;  1X9N A;  2IT1 A;  4DV2 Q;  4IO9 A;  1VQ6 A;  3AEV A;  3OYY A;  2JA8 G;  1SRU A;  2DUD A;  1KL9 A;  3PSI A;  2IX0 A;  4GNX B;  1TWF H;  1KQS A;  3GTJ H;  1IXR A;  4A3J H;  2VY3 A;  1LUZ A;  1HH2 P;  3J80 c;  4IOC A;  1VQ8 A;  1UE5 A;  2MFI A;  1VQM A; 
#chains in the Genus database with same CATH topology
 5M5X H;  4XT3 B;  3OPO A;  1KLU D;  2MNA A;  1QOH A;  4UP9 A;  4A3J G;  3RD4 A;  3HFZ B;  2E2H H;  4JBK A;  1KDA A;  1TWG B;  3M4Q A;  5FJ8 H;  4EQ5 A;  5C3E B;  1NR2 A;  1KLG D;  4RA8 A;  3FDT A;  2F4V Q;  2A1A A;  4LFA Q;  4A3F H;  4IOA A;  1VF5 C;  3HOW G;  2WKC A;  2UUA Q;  3PO2 G;  3TS0 A;  5C44 G;  4IPC A;  4FF1 A;  1JE4 A;  1C8C A;  1STE A;  3PO3 G;  2F0H A;  2VQE Q;  3E9H A;  2VW9 A;  2EYH A;  2NVT H;  2EYL A;  5JEA G;  1JQY D;  2KCC A;  3UE0 A;  2NVQ H;  1B50 A;  4UHV A;  1BXT A;  2RDF A;  1BNZ A;  3BG3 A;  4LF9 Q;  1X3F A;  5CR3 A;  1B9N A;  1UAP A;  1EU3 A;  2ZTD A;  3V2T A;  3TZU A;  3I55 A;  4X6A H;  4RH6 A;  4DV6 Q;  1BBU A;  1V1P A;  3S1M B;  4QIW B;  5ELF A;  3T13 A;  1PH3 A;  3HOU G;  4QL5 A;  1EY5 A;  3GD7 A;  5GAD C;  4Y7N H;  5JAV A;  5CV4 A;  4BBR H;  3X3N A;  2JSO A;  2I0Q A;  3H94 A;  1SN8 A;  3J80 E;  1XXG A;  2E2H B;  1PMR A;  4CJ0 B;  1HXY D;  2A69 D;  3GTL B;  4GKJ L;  2B8F A;  3KUP A;  4OIK A;  5FLX L;  4JW0 A;  1B3Q A;  2PW5 A;  2M2L A;  1B3A A;  5M3F B;  4HID A;  5C5M A;  2EXD A;  4FDB A;  4QGU A;  3OTO L;  2JA7 H;  2EVB A;  1YHB A;  4KJO A;  2WB1 B;  3RZD B;  3I4N H;  4B3M Q;  3NE5 B;  4XIG S;  2NBF A;  3MXN A;  2E75 C;  1U4P A;  3UDI A;  4CDF C;  4C3I B;  1H9S B;  3S16 H;  1UUP A;  4BBS H;  1VDZ A;  1F9Q A;  4JYA L;  1Z6H A;  4C3J B;  5CV7 A;  5C4X G;  1D1I A;  1STY A;  1DGS A;  4AH6 A;  3FKI H;  1LTL A;  2Z9H A;  4DR4 Q;  3HRZ C;  2BDN A;  3P1H A;  1VF7 A;  4DV0 Q;  1SMX A;  2Q8T A;  1B44 D;  3D0F A;  3MEH A;  5D3I B;  1AEX A;  3SDZ A;  4OL7 A;  3K57 A;  4DR7 Q;  4HSV A;  4JI4 Q;  2F52 A;  2F0F A;  4OIJ A;  5DM6 3;  4A3M B;  4JI3 Q;  1GXD C;  1LT6 D;  2DGY A;  3TRE A;  3PIP 3;  3S1R H;  4LJZ C;  1K28 A;  2F0M A;  5ELE A;  2JXM B;  2YYZ A;  1VS0 A;  4DV4 L;  5K36 G;  2B2Y C;  3S9W A;  3A56 A;  5C0X H;  1J6Q A;  4PMB A;  3G6J B;  3T1H L;  1HTP A;  3DEP A;  4GNX A;  1K3R A;  1D8L A;  3MA2 B;  4FNF A;  4QUF A;  5D65 A;  4POG A;  2R93 H;  1AE2 A;  4DV0 L;  1HZC A;  3HOW H;  1R4P B;  2XN9 C;  1N34 L;  1I4R A;  4QMG A;  2EYJ A;  2M00 A;  3GTM H;  4LF9 L;  3PIO 3;  4GS3 A;  1PA6 A;  3L2P A;  4A3M G;  1JIC A;  3RLF A;  3DM1 A;  4DV6 L;  4PV1 C;  2JP1 A;  1HQM C;  4JI3 L;  1K3B C;  4ZRZ A;  2Y0S E;  1EWC A;  3QIA A;  4RAU C;  1QVF A;  4RGO S;  1SDF A;  2KEC A;  4NXN L;  2C35 B;  4LF6 L;  2D62 A;  2EYF A;  4AQY L;  1ICF B;  2VUM H;  1TVX A;  4DV5 L;  3SEB A;  1ONL A;  2K75 A;  4EQP A;  1SNO A;  4RCO A;  4C1N I;  2DY7 A;  2R93 B;  3W2D A;  4APV A;  1SFO H;  4JI7 L;  1GHJ A;  5LL6 S;  1S4Z A;  2B3G A;  1WJJ A;  2F3I A;  1I6V C;  1RCV D;  3VYU A;  1I6H B;  3R93 A;  2R7D A;  5FO7 B;  1L1O A;  4BBR B;  4BY1 H;  3S15 B;  4DR5 Q;  1LTI D;  2KJX A;  2PQA B;  1QB5 D;  4KKT A;  3D31 A;  4OO1 H;  3I4O A;  3HOV H;  1SND A;  1P8L A;  2F3V A;  1Q46 A;  4RKB A;  4LFB L;  4X66 L;  2H1E A;  3I56 A;  1EFI D;  1HZB A;  3R8B A;  1CQF A;  1Q8K A;  1TWC H;  4JCV E;  4A76 A;  4B3R L;  2F1M A;  2QEX A;  2K5H A;  1U5K A;  4BY1 G;  4CHT B;  4K2L A;  4A3E H;  5FLM H;  2K32 A;  1E1O A;  3IKJ A;  1PRT B;  1BCP D;  2K5N A;  2CW0 D;  3J81 E;  5IP7 G;  1Q82 C;  2XVS A;  4KHZ A;  3URY A;  1PVO A;  3FHW A;  4Q0F A;  1X3G A;  1FYC A;  1NCV A;  5JJI A;  5M5X B;  1ICW A;  3J7Y W;  5KYI A;  2HCI A;  4HJ7 A;  1PH7 A;  1SJH D;  1VCI A;  3VR4 A;  4K5X A;  3S17 H;  3DMU A;  5CV6 A;  5LMU L;  2K04 A;  1KRS A;  3RLO A;  2IY5 B;  3A8J E;  3CAM A;  2PI2 A;  1HNZ L;  1LYL A;  1VQK A;  1C4Q A;  3GTG B;  3S2D H;  3H0G B;  3MZ5 A;  1XPU A;  3CHB D;  4N9T A;  5FLM G;  1E1T A;  3HOX B;  4LF6 Q;  1J8I A;  4DU9 A;  4HAE A;  2ZTE A;  1SNC A;  1NSN S;  1E2W A;  1WTH A;  2ZM6 Q;  3H3V H;  4A3D B;  1TWC B;  3ITP A;  2HUG A;  1SEB D;  3HG9 A;  2UXB L;  2LY7 A;  3P20 A;  2VL6 A;  3VA7 A;  1AW7 A;  1FNW A;  4MZ9 A;  5E7N A;  4L6T B;  2K01 A;  2WFW A;  1EY7 A;  4DR5 L;  1JMC A;  1A3V A;  3P7J A;  1XMQ Q;  1BF4 A;  3GTG H;  1QNK A;  2OTJ A;  2SDF A;  2K03 A;  2F0J A;  3EA6 A;  2EY2 A;  3WWV A;  2CCZ A;  2IL8 A;  1KNE A;  1U4R A;  4X66 Q;  1PTO D;  2KUM A;  4A3B G;  2AQ2 B;  4FF2 A;  3L9A X;  4JI5 L;  3CCV A;  4G7Z C;  4DXF A;  5M3M G;  3JAM L;  2D0P A;  1X56 A;  2UXB Q;  1LLR D;  3EVQ A;  1BR9 A;  3GTJ B;  1TQO A;  1N8R C;  2A6E D;  4H13 C;  3S17 B;  3NTH A;  3NEN A;  3HKZ B;  1PYS B;  1LT4 D;  1LTT D;  1V9P A;  3F8T A;  3LNN A;  4A3L G;  4V0B A;  4ODG A;  3AQQ A;  4KTA A;  1HFG A;  1SYC A;  3RZO H;  1BOS A;  5IP9 G;  3AU7 A;  1VQ9 A;  4C3H B;  2FMM A;  5FOB B;  4FXD A;  3CP0 A;  3VYT A;  1D6E C;  1BCP B;  4KD4 A;  5KND A;  4R1J A;  4DV1 L;  2QA4 A;  1EIY B;  3GTQ H;  4ZKB B;  1PXU A;  2NZ1 D;  3NHH A;  2FXQ A;  1CT1 D;  5CMD A;  1SMY D;  4OEM B;  1E3P A;  4IFD J;  3J81 c;  3M85 A;  3FP9 A;  1EYG A;  3J7A F;  4FVM A;  4O42 A;  1DOM A;  3U4Z A;  4RFB A;  1Y8N B;  2TSS A;  1AN8 A;  2HQL A;  1VQJ A;  1T5E A;  1MSG A;  1I94 L;  1S5D D;  2V4D A;  1CSQ A;  2F3W A;  1PLF A;  2B2T A;  2CWP A;  5T1I A;  3F2D A;  4PZ6 A;  3GV3 A;  4EQO A;  2HD3 A;  4IUP A;  1D5X C;  4MTK A;  4HMJ A;  5JJZ A;  1I3Q B;  5BR8 L;  4DV7 L;  3GO5 A;  4XQJ A;  1S5B D;  1U4M A;  3NUC A;  3H0G H;  2K1B A;  3ERS X;  1IKM A;  4KY6 A;  4HJA A;  1VQD A;  1LTR D;  3OWE B;  1SR3 A;  3PF4 A;  1TWG H;  2CHB D;  1CM9 A;  1PZJ D;  4KV6 A;  4KI0 A;  3A8I E;  3MXP A;  4R4I A;  1WCM H;  2MGS A;  3FVQ A;  5M5Y B;  4HJ5 A;  3A55 A;  4ZKC B;  1YJ9 A;  3C46 A;  1IBK L;  5JJK A;  4RWS C;  2UU9 L;  1NJI C;  2A68 C;  2ES2 A;  1XX8 A;  4HJ8 A;  1KAW A;  2VQF Q;  4C56 C;  3IL8 A;  1OXU A;  1QUQ B;  2F4V L;  2OEO A;  1UE1 A;  3I2Z A;  4GN5 A;  1X32 A;  4XTC S;  2KCM A;  4EVO A;  3K8A A;  5C3E G;  3NTK A;  2B2Y A;  1VQN A;  4A3L H;  5G3L F;  2M9V A;  5TSS A;  2NN6 I;  5AFW A;  2A68 D;  1JB7 A;  4GNX C;  3GTP H;  3NK9 A;  4A3B H;  5I2Y A;  4UP7 A;  3R3O A;  1V1Q A;  2GVB A;  4XT1 B;  4YIJ A;  4IFD G;  3RLN A;  1TU2 B;  5DNF A;  2NZH A;  2F0P A;  3CCQ A;  5KNB A;  4L5Q A;  4YWL A;  3H0G G;  4P72 A;  3T1Y L;  3E0J A;  3HS0 C;  3I4M H;  4HTH A;  4DR1 Q;  2UXC L;  4GN3 B;  1I4Q A;  3PCO B;  2MO0 A;  2Z6B A;  1CKO A;  1I4X A;  3PMF A;  2L4N A;  5I9P A;  1VQ6 A;  4HSP A;  3DHQ A;  5LHY 1;  4GNX B;  3GTJ H;  5EPK A;  4IUU A;  4WOR A;  4IOC A;  4PNY A;  1PTO H;  2MFI A;  2A6H C;  4PQX A;  5BN3 A;  4A93 G;  1A6X A;  3IFD A;  1X55 A;  4A3J B;  2EPB A;  1H9J A;  4DV7 Q;  3TZD A;  3DLL A;  4OWW B;  3PGZ A;  5IE8 A;  4ULL A;  5COR A;  2JA8 H;  4PZ8 A;  3OMC A;  3T1Y Q;  4NXM L;  3CRL C;  1STB A;  1E22 A;  4B08 A;  5GAE C;  1G6P A;  5JVG 3;  1LV9 A;  5EGT A;  1PFM A;  3S1M H;  2A5H A;  4K8J A;  2JA6 G;  4UPA A;  1EWH A;  2EJG C;  4JYA Q;  1XJV A;  1Z9F A;  4HIK A;  1HR0 W;  3T56 B;  3W1G A;  2E2J B;  4FP5 D;  2F0V A;  2NVQ B;  1I50 H;  2JA5 G;  1TS3 A;  1PH9 A;  1EL0 A;  4DNR B;  3FPU B;  3QB3 A;  1MHW C;  2NVY H;  4A3G G;  2CKZ B;  5DEH A;  1MSH A;  1HJP A;  1RD9 D;  4LFB Q;  2QDB A;  3F2U A;  2Z1C A;  5M3M H;  4KK7 A;  2XWJ B;  1A3T A;  4NXM Q;  1UE6 A;  1SBB B;  5IGB A;  1Q1B A;  2Z0S A;  1I4P A;  1YNJ C;  4J15 A;  3MEF A;  4JV5 L;  3Q22 A;  4LAA A;  1XNQ Q;  2PZU A;  4QUC A;  1Y69 U;  2GA4 B;  4LF7 Q;  3T1H Q;  2BA0 A;  4ABN A;  4C3H H;  5L37 A;  3M9B A;  3RZO B;  5IYB H;  1STH A;  4CJ2 C;  1HFN A;  2NZO A;  1FJG Q;  4AQY Q;  1UNS A;  5KIX A;  1GUN A;  3KF6 A;  3VR2 A;  3LWE A;  3CPW A;  4LF4 Q;  1WD1 A;  1Y1V G;  2EXZ A;  3S1Q H;  2EY6 A;  2Y0S G;  4I7Z C;  1LTB D;  4A3I B;  4OO1 G;  2NVX B;  1VQB A;  3HZX A;  1QWY A;  1DYQ A;  1G6Z A;  5IGE A;  2MHV A;  3KLS X;  3MXG A;  4JG2 A;  5CV5 A;  3UDG A;  2MUY A;  1JJG A;  1PH2 A;  3BDO A;  4QY7 A;  3PF5 A;  1EYD A;  4TSS A;  1H9K A;  3AB9 A;  3OW7 A;  3P75 A;  2DNC A;  1WTW A;  1EYA A;  1YJN A;  2KBN A;  3MTS A;  2A73 B;  3CRK C;  2QEJ C;  1GUG A;  2JYO A;  4XDX A;  4A4I A;  5HUR A;  5IT9 L;  3BVM A;  3DM3 A;  3CC7 A;  5K5P A;  2L55 A;  2E5L L;  4A3D H;  1XNR L;  2F0W A;  1Q8I A;  3J80 i;  4X65 L;  3I3C A;  1ILP A;  3AYH B;  1FGU A;  4RKL A;  1VMC A;  3HOX H;  1HPC A;  3HOV B;  5C3X A;  5E1F A;  4BBS B;  2B29 A;  4A3E G;  3D3R A;  1CKM A;  4MNO A;  1R9T B;  3GTO H;  5M3F G;  5C0X G;  2ZXP A;  1PRT F;  4LUZ A;  5IYC H;  4R8I A;  4DUY L;  1XMO Q;  4L63 B;  2EDG A;  2OQ0 A;  2CVR A;  4FYD A;  1SFO B;  2D5D A;  4JI5 Q;  4EGV A;  3S2H H;  1ZKO A;  2VS1 A;  1JR0 D;  3H91 A;  2NN6 G;  1KC8 C;  3M7N A;  4O1N A;  2L9H A;  1SAP A;  1S72 A;  1A63 A;  1AFP A;  1KRT A;  2RDH A;  5HGT A;  2G5D A;  4P71 A;  1CZG A;  1I5F A;  1LTS D;  4KY5 A;  3TP7 A;  1BQQ T;  5C4X H;  2PO4 A;  1K9M C;  1NTG A;  4KKU A;  5EPJ A;  1WTX A;  4DPG A;  1AH9 A;  4KHV A;  4IN3 A;  2UXD L;  1TWA H;  4DV1 Q;  4X64 L;  1DCZ A;  2PCF B;  1SRO A;  4CDD C;  2A74 C;  2F4I A;  3N6R A;  2EYO A;  4IPH A;  1KHI A;  2B2T C;  1YHQ A;  5COY A;  5IGG A;  3ND9 A;  5EBD A;  3ULP A;  2DJG C;  1ESF A;  3JC6 6;  3D6W A;  1SJE D;  1IBL L;  3IAY A;  3OSO A;  2VUM G;  1M90 C;  4OHJ A;  1JE5 A;  5KGU A;  1QZH A;  2UUC Q;  3I4L A;  4MTN A;  1PRT C;  2JK8 A;  3H6M A;  2JN4 A;  1TY2 A;  2QKI C;  2WAQ B;  3S1Q B;  2SEB D;  3FKI B;  5BR8 Q;  3TME A;  4FF4 A;  1L0W A;  4C2M B;  1PH6 A;  1STN A;  1YNX A;  2FIN B;  5EKK A;  3I72 A;  2XRS D;  2XWB B;  2H5X A;  4UP8 A;  1MJC A;  2MO1 A;  4AYB G;  2VUM B;  4DR3 Q;  3C3L A;  3TS2 A;  5ELN A;  1S5E D;  4DK6 C;  1CSP A;  1XPR A;  3I8Z A;  2YV5 A;  1EIH A;  2YU9 H;  1SYE A;  2PNH A;  3M3Y B;  1YEZ A;  4L8J A;  1AZQ A;  2ZJR A;  4JI0 Q;  1VQH A;  2A6H D;  1O7Z A;  1GJX A;  2Q2I A;  3J81 j;  1W6J A;  5EKI A;  2RDG A;  3G71 A;  3I90 A;  1GUW A;  5DLQ E;  1B70 B;  3GTP B;  3K6O A;  4A3K B;  2O2L D;  3CC2 A;  2H4O A;  1PV4 A;  3BVZ A;  4IFD H;  1Y1V B;  3I7F A;  2DNE A;  2J7Z A;  2F0S A;  5D14 A;  5J1Z A;  1U9R A;  1Y1W G;  4GLX A;  3NSW A;  4PMC A;  4A3K H;  3NBI A;  1OXT A;  4DNI A;  1RHP A;  1I94 Q;  3M4Y A;  2E2I B;  1MJE A;  1DOL A;  4BY7 B;  2L5T A;  2IJ0 A;  2AMC B;  4ME5 A;  5JVH 3;  4HMI A;  3NBH A;  1BDO A;  4XXE A;  4DR1 L;  4S3S A;  3E0E A;  4FF3 A;  5EBC A;  4BXX H;  4JBW A;  2QF7 A;  2A6E C;  1V43 A;  4PZ7 A;  4C2M H;  3BZK A;  4DN4 M;  3GTK H;  2IPK D;  1ZXT A;  2ZJQ A;  3F2C A;  1VQE A;  2EY5 A;  1TR5 A;  3PUY A;  5IY0 A;  1XTD A;  3CU7 A;  3HOY G;  1WCM G;  2HHH Q;  1JWM D;  2HIX A;  1H9S A;  5C4J H;  4RGN A;  1X3E A;  1CTM A;  5JPM C;  3G6E A;  3F2B A;  4A3E B;  3ULJ A;  2LSS A;  1LAB A;  1MD2 D;  1D2B A;  5M5W H;  1E7Z A;  1LAC A;  1GUT A;  5C44 H;  1DJR D;  1E24 A;  3C1E A;  2Z4H A;  1CKN B;  1Y8P B;  2XRQ D;  1SYB A;  2BOS A;  2BE5 C;  5JJL A;  2VXW A;  1SYD A;  2PZW A;  4NKL A;  4NMZ A;  5BN5 A;  2BA1 A;  5CBE E;  1Z7T A;  2C5C A;  2HHH L;  5HGQ A;  4JI6 Q;  2PNR C;  1WTP A;  3CCL A;  4IZ8 A;  3DXJ C;  4DK1 A;  1VQF A;  3B6Y A;  4ZLT F;  3E9I A;  2VB3 X;  3OOC A;  2EZV A;  3EFX D;  1Y8O B;  3NPP A;  3WOF A;  4KMU C;  4B3M L;  3S16 B;  1VQO A;  2ALY B;  5FKA C;  1WCM B;  3NBH B;  1VQG A;  2HT1 A;  3MFY A;  2F0K A;  4G4K A;  4JVZ A;  2UXC Q;  5C4H A;  2MJ8 A;  3S24 A;  3PUW A;  1PYW D;  2C9O A;  3BDC A;  1JCK B;  5IIF A;  5FK9 C;  4IUQ A;  3CCE A;  3U58 A;  4DK0 A;  2MQH A;  5NUC A;  2PW7 A;  1EIF A;  4C3H G;  2HDL A;  5IP7 H;  4KKS A;  3CC4 A;  5BN4 A;  5JEA J;  4LK1 C;  2Z6K C;  4KLK A;  2QGQ A;  1ET9 A;  4N9P A;  3A8K E;  2BH2 A;  1EZ8 A;  1JOK A;  2JA6 B;  1Y1W B;  3D4D A;  4PMW A;  1EY6 A;  3FEW X;  3S1R B;  3K7A H;  2L15 A;  1PYB A;  2X6G A;  4OX9 L;  5LMN L;  3UDF A;  4LFC L;  1WD0 A;  2JA5 H;  3PUX A;  1BBW A;  4I65 A;  3TQY A;  4FXG C;  1IYU A;  1JWU D;  2L1B A;  3CQZ H;  1CK1 A;  4DF7 A;  3M4P A;  3IRB A;  1VQI A;  3J81 i;  2N88 A;  2MP1 A;  2ICI A;  1HR0 L;  2NVX H;  2E2D C;  1B7Y B;  3QWN A;  4JPB W;  1CHQ D;  2AUK A;  4ALP A;  4H02 A;  1K8O A;  1L0Y B;  1S40 A;  4U68 A;  2IT1 A;  4DV2 Q;  3AEV A;  3PSI A;  3NXW A;  1IXR A;  1HUM A;  1LUZ A;  1HH2 P;  3BZD B;  1SE2 A;  1VQM A;  4A93 H;  3VR3 A;  2OF1 A;  3U50 C;  3J7A 5;  4H0L C;  1RIP A;  1HNZ Q;  3M4O H;  1NMG A;  1SLJ A;  4DR2 Q;  1FJG L;  3TEH B;  4GOP A;  1GD7 A;  1S5C D;  2F0L A;  4K5W A;  3SK6 A;  2R93 G;  1LTG D;  1LT3 D;  1SSO A;  4ZQ3 A;  1I3Q H;  1AE3 A;  5GAH C;  1WTO A;  1EQR A;  1A2T A;  1N34 Q;  2E2I H;  2A8V A;  5K36 H;  3OHX C;  2N78 A;  2KQ3 A;  3H15 A;  3W3A A;  1A0I A;  3K5M A;  4KHP L;  4DR6 Q;  1VQA A;  1VMP A;  3L3O C;  4DV3 Q;  4P74 A;  5KNC A;  4K0K Q;  1Q90 A;  2Z8L A;  2ATW A;  2Q8I B;  3HOY H;  3FPP A;  2F03 A;  1FR3 A;  3SR1 A;  2WAQ E;  1QVG A;  2UUB Q;  2Q2U A;  1JC7 A;  1QJO A;  2LKV A;  4IFD I;  4JI2 Q;  3PIO A;  5GRO A;  1PH4 A;  1SE4 A;  1RKN A;  4I7A A;  2AWN A;  1SYG A;  2JA8 B;  3KBG A;  1HRJ A;  2UUC L;  1GVP A;  4UAI A;  3C1F A;  3CCS A;  4LF5 L;  1I4G A;  4X65 Q;  4BS9 A;  2J0T D;  4YY3 Q;  2DN8 A;  1ZYR D;  1BCP F;  5C6A A;  3HOZ H;  1TWH B;  3TSS A;  2JA7 G;  3Q24 A;  3SHL A;  4XYQ A;  2UUB L;  1GOZ A;  2N49 A;  2K7V A;  1WOC A;  3Q23 A;  4BWG B;  5ELB A;  4DUZ Q;  4C1N K;  4KJN A;  5ELO A;  1O7L A;  2N55 A;  2F0Q A;  4RGM A;  1RF2 D;  2R61 A;  4MHE A;  5F2D A;  3STB D;  3OW2 A;  1D5Z C;  2D0O A;  3K7U C;  1YIT A;  1UE7 A;  2DJF C;  3ZJY C;  4LNQ A;  1OXV A;  3A74 A;  1TY0 A;  4R4Q A;  5A2Q L;  4ZCK A;  1OXS C;  1HA6 A;  1R4Q B;  1WTV A;  4X62 L;  4WJ3 M;  3ERQ A;  4DUZ L;  1I50 B;  1Y14 B;  5JEA H;  3V96 A;  2QCP X;  4IUT A;  1MIU A;  3PO3 H;  3KF6 B;  2PI2 E;  1S5F D;  3IFT A;  5IYD H;  1E0B A;  3TBI B;  1HTL D;  1W3S A;  3BDL A;  1OTC A;  1VQ4 A;  4C3I G;  3KLW A;  4O0A A;  4MIU A;  2B8G A;  3HOX G;  4GOP C;  1SMY C;  1M4V A;  1YVC A;  2V1C C;  3Q8D A;  4HCS A;  3LGJ A;  4K0K L;  1GO3 E;  1T9H A;  1SNP A;  4G7H C;  3KK7 A;  1G8Z D;  4R9W A;  4F8M A;  1UEA B;  1IL2 A;  4ZYS A;  1PTO F;  3TRZ A;  1Q3L A;  3DEO A;  4YCV A;  1CKN A;  3BU2 A;  2CWA A;  3H3V C;  2HCC A;  1GKH A;  4CGY B;  2R7Z G;  4LUO A;  1F77 A;  3J81 L;  2EY1 A;  1HNW Q;  4JI1 L;  2WIN B;  1YI2 A;  3K81 C;  1Q81 C;  1XMQ L;  4GKJ Q;  1PH5 A;  1D1K A;  3VYS A;  4JI8 Q;  1B8A A;  1TS5 A;  2F0O A;  2JQO A;  1KTK A;  3S1N B;  3R2T A;  2EJM A;  1DM0 B;  1EQV A;  3A5U A;  1K8A C;  3UDX A;  2EOT A;  2I5M X;  1ZYR C;  1KAB A;  4IUR A;  1STG A;  2RBM A;  2JA5 B;  1QIL A;  2ZXR A;  1YNN C;  1VQC A;  2WKD A;  1WVL A;  3ER0 A;  3KJO A;  4WJW A;  1O7Y A;  5AJ3 Q;  1OXX K;  3L0O A;  1SYF A;  4DR4 L;  1KNA A;  4JBJ A;  4A3I H;  4J1M A;  4CKE A;  1CA6 A;  4H44 C;  1G2T A;  1XTC D;  5ELD A;  2L11 A;  3SK4 A;  2F0E A;  5EQ0 A;  1YZ6 A;  1UEB A;  4HCE A;  2B2U A;  4TVA B;  1II3 A;  2R92 G;  3VR5 A;  1CUK A;  4A93 B;  3KF8 A;  1S3O A;  5M5Y H;  2QDL A;  2VQF L;  1ZEQ X;  1IYJ B;  2Z6K A;  3UI2 A;  2RKS A;  4TRD A;  1LTA D;  2WAC A;  4CJ1 B;  1N33 L;  4YCW A;  1E2V A;  4EQN A;  4OEL B;  3VYR A;  4QJF A;  4PG3 A;  1BUV T;  2YTX A;  3I70 A;  4Q5V A;  1K0S A;  3DWP A;  1F9S A;  5EKL A;  4P2C B;  4GZY C;  4ILW A;  4FO2 A;  3PUZ A;  1JB3 A;  3BS1 A;  4P73 A;  5T1G A;  3ULL A;  3TP5 A;  3NEM A;  1QUQ A;  2JEB I;  1VQL A;  4CBV A;  3CF5 A;  1EOV A;  5JPN C;  4WFN 3;  4WJ4 A;  3NTI A;  2E2J H;  1F2Z A;  1EEF D;  3QOL A;  4YWM A;  1G2S A;  1ILQ A;  4JI7 Q;  1Y1V H;  2F0T A;  5LMN Q;  4CDC C;  3KDF A;  1ENC A;  2B2V A;  4DAY B;  2Q2T A;  4F88 A;  2YTV A;  1NE3 A;  2QW7 A;  4DGZ A;  3CW2 C;  1V1O A;  4JI6 L;  3TP6 A;  3SE0 A;  1I6H H;  4OON A;  1TT2 A;  1KAA A;  1GM5 A;  5GAG C;  3MVV A;  3I4N G;  4K2K A;  1TS2 A;  3O13 A;  4EX5 A;  1DOK A;  2G9H D;  2PQE A;  1MGS A;  2R7Z H;  2A69 C;  1HQR D;  2PYK A;  1Q12 A;  5C3E H;  1HCZ A;  3PUV A;  4DAY A;  4DAP A;  5AJ3 L;  4ME3 A;  2AWO A;  3CME A;  3KDF B;  1M8A A;  3L7Z C;  2XGT A;  1B4O A;  4ZAI A;  3HOZ B;  2G9D A;  2Y0S B;  2JJQ A;  2XSC A;  1C9O A;  4OWT B;  4J6H A;  1PTO B;  3K5L A;  4ZK9 B;  3OTO Q;  3SK8 A;  1BBX C;  3FRP B;  4AYB E;  1O78 A;  4IJL A;  4DNT B;  1IBM L;  1YJW A;  5IYD G;  3PO3 B;  3NQI A;  2LFN A;  1BCP C;  2R3Z A;  2GVA A;  2B2W C;  1C7Y A;  4N8F A;  1A62 A;  1BVS A;  4DV5 Q;  2N3S A;  4NP5 A;  2KED A;  4C3J G;  4E6I A;  2BE5 D;  2PMZ B;  4RG1 A;  2R92 B;  3K58 A;  2EYP A;  3ERO A;  1NBW A;  5M3M B;  5C0X J;  1QNU A;  3CXC A;  3NEL A;  2I46 A;  2NYZ D;  1EEI D;  3V05 A;  1EY4 A;  4DK3 C;  1NMF A;  3H09 A;  4NPS A;  2CH4 W;  3JAM c;  3KFU A;  4F7X A;  2WB1 G;  4L5S A;  5CC4 A;  1ENF A;  4ZUI A;  1E2Z A;  2QIL A;  3RUZ A;  3JAM E;  3K5O A;  5M5W B;  1DZ1 A;  1KIX A;  1ASZ A;  2KHS A;  1HR0 Q;  2JE6 I;  1L2F A;  4QB4 A;  2EIF A;  4G57 A;  1BKB A;  3EBE A;  1V8Q A;  1QE6 A;  1MBY A;  4BBS G;  3KOJ A;  5C4X B;  1IL8 A;  4HR7 B;  2OT2 A;  4G7O C;  3LX0 A;  1TXY A;  2YU9 B;  2AHO B;  1K83 H;  2SNS A;  1Q86 C;  2KCT A;  4RHR A;  2ZXO A;  4WRD A;  4POF A;  1XPO A;  5IWA L;  5G3L D;  2KHI A;  4X3U A;  1YIJ A;  2BDO A;  1EY8 A;  4GLV B;  1KD1 C;  2RF4 A;  3BYT B;  1PDQ A;  1TKW B;  2E74 C;  1MI2 A;  4BXX G;  3Q0A A;  2UXD Q;  2GN5 A;  1O7I A;  3CCR A;  2ZJP A;  4NB3 A;  1G29 1;  5M9O A;  3Q6S A;  4XQQ A;  2ASB A;  3KYH C;  4NDX A;  2J4X A;  1D7Q A;  4LMQ D;  3HOU H;  2JEA I;  4JV5 Q;  2SNM A;  3HOW B;  1HZ9 A;  3KLS A;  1XNR Q;  2X6L A;  1A15 A;  3HEJ A;  4LF7 L;  1MKH A;  4B3T Q;  3K0X A;  4X3T A;  1EIG A;  4UY8 C;  5C4Z A;  3GP7 A;  1X6O A;  3RNU A;  4R8N A;  5FO8 B;  4ID6 A;  4KHP Q;  4LWC A;  2K14 A;  3NQT A;  3TN2 A;  4DA2 A;  1Z47 A;  2IX1 A;  1O80 A;  1A2U A;  1YHA A;  4RGT A;  1DD2 A;  3MWY W;  4YWK A;  2EJF C;  3A7A B;  3DWQ A;  1PH1 A;  1X9N A;  2XNA C;  4IO9 A;  3OYY A;  2K05 A;  4IQZ A;  1PZI D;  1SRU A;  1RDP D;  2DUD A;  3GTK B;  1KL9 A;  2IX0 A;  1KQS A;  2B2W A;  4A3J H;  5DAU A;  1HUN A;  1VQ8 A;  3RN2 A;  4LF5 Q;  3OIP A;  3DWA A;  2EE1 A;  2ZTC A;  3RN5 A;  3NWT A;  4R4T A;  3CKI B;  2FHT A;  5CV9 A;  3T51 B;  1IYV A;  4MN3 A;  4DAM A;  3A7L A;  1N32 Q;  1RTN A;  3HP3 A;  1ESR A;  1HNX L;  5LMU Q;  2KHJ A;  1WTQ A;  4Z9C B;  4B9X A;  1LO5 D;  4BA2 I;  3CCJ A;  2PQA A;  2RCF A;  1YNJ D;  4TQU S;  4JI8 L;  1SXT A;  4LF8 Q;  3PV0 A;  3ICE A;  3U9O A;  3R2I A;  4RCN A;  1C48 A;  5IOC A;  2VNU D;  5C3W A;  3DUZ A;  1W6K A;  3OIQ A;  2OQK A;  1IBK Q;  1K73 C;  2ZM6 L;  2ENB A;  1YBY A;  1FD7 D;  3S1N H;  2NVY B;  1U0L A;  2O4X A;  4L5R C;  1EQT A;  2FFK B;  2PZT A;  4RHS A;  2DY8 A;  1CA5 A;  4GKK Q;  4JC0 A;  4JBM A;  2NVT B;  1SE8 A;  2B2U C;  4B3T L;  1IW7 D;  2L12 A;  5KEE A;  4A3I G;  1JJ2 A;  4FXK C;  5C0X I;  3H3V I;  2KEN A;  4YCU A;  3RMH A;  3TDQ A;  2K52 A;  4HIO A;  4NW2 A;  4XYO A;  3RR5 A;  1P16 A;  2KOL A;  1EUJ A;  5LL6 X;  2HDM A;  1VQ7 A;  4JI0 L;  3X3M A;  3ZYY X;  5EAY A;  1IZ6 A;  3VA5 A;  3QR8 A;  1F2M A;  4V19 0;  5A2Q E;  5IOD A;  2NN6 H;  2UUA L;  3SK5 A;  2N8N A;  3D4R A;  3I4M B;  3HOV G;  1HNW L;  2K5W A;  3WOE A;  3GTM B;  1T5X D;  5I6W A;  3CCM A;  4A3K G;  1TWF B;  1WI5 A;  3STB C;  4CKC A;  1X3Q A;  2CFM A;  4KN4 C;  2L0C A;  1N33 Q;  2AUJ D;  4X3K A;  3WDN A;  3F1Z A;  3CCU A;  4BY7 H;  3I73 A;  3CPF A;  1L0X B;  5A35 A;  2VQE L;  3CD6 A;  3EN2 A;  4GOP B;  4A3G B;  2B63 H;  4YHH L;  3LWU A;  2B2V C;  2UU9 Q;  5KYL A;  4A3M H;  1F2L A;  4QF4 A;  3HOY B;  1EWI A;  3J80 L;  1B9M A;  5GQO A;  2R92 H;  2LXK A;  2RVL A;  4M8A A;  2FJ2 A;  1Q7Y C;  3D6C A;  2R6G A;  1GUO A;  2HIV A;  3N52 A;  1W2B A;  1KXL A;  2X69 A;  4F87 A;  1HNX Q;  3MC0 B;  2LXJ A;  1NNX A;  5IGC A;  4ZUJ A;  2B63 G;  1PZK D;  5E4W C;  2OTL A;  4LF8 L;  3K7A B;  4KN7 C;  1B53 A;  5C4J B;  4A3F B;  1PFN A;  3SGI A;  1JJC B;  4XQN A;  2AQ3 B;  2WAQ G;  3A5Z B;  1RTO A;  2IX3 A;  1CQV A;  3A54 A;  4U67 3;  2RSN A;  4RMF A;  5I9O A;  1TS4 A;  5DM7 3;  3C2P A;  5FLX E;  5LMN W;  2F0G A;  3M4O B;  1HZA A;  2OCE A;  1G91 A;  2VZA A;  1JOO A;  2YTY A;  4P75 A;  2IWH A;  3T53 B;  2RQX A;  2NB0 A;  3BYY B;  3S2H B;  1HA5 A;  4AYB B;  3K80 C;  4IPD A;  1C0A A;  1BO0 A;  4DFA A;  2E76 C;  2KVM A;  4DAV A;  1M1K C;  5IYB G;  1RL2 A;  3I91 A;  5IT9 c;  3I4M G;  5KRU A;  1K8M A;  1R9T H;  3GTO B;  3S14 H;  5IT9 E;  3KF8 B;  3HGB A;  4LUV A;  2F0I A;  5EPL A;  3GDE A;  3QOJ A;  3U4V A;  4BA1 I;  1AZP A;  2WP8 J;  1PRT D;  4DKA C;  4DR7 L;  3HKS A;  1VQ5 A;  1EY9 A;  5IGF A;  2RA4 A;  3K59 A;  4Y52 H;  2IHE A;  4KD3 A;  2IW3 A;  5C44 B;  3HOZ G;  1GUS A;  3GTQ B;  2ICE C;  1DXM A;  3AFP A;  5EJW A;  1CFM A;  4DV4 Q;  2IHF A;  1ASY A;  3HKZ E;  1WFQ A;  2NTT A;  2RSO A;  3PO2 B;  1ROD A;  2B39 A;  1PTO C;  4JOI A;  4C3I H;  1PFB A;  1H9M A;  1F9R A;  4QIW E;  4IAL A;  4KY7 A;  1B2T A;  4N8X 1;  4BBR G;  1H95 A;  5I2X A;  3EJI A;  3I4N B;  3PIP A;  4GLA C;  2CW0 C;  1WYD A;  1QVC A;  2SOB A;  3AMU A;  1TWH H;  4UDU C;  1PHJ A;  3FMC A;  5IYC G;  5IGD A;  4K6D A;  2R7Z B;  1LM0 A;  2HQE A;  3KLR A;  4M1U B;  3J7Z C;  5H1S E;  2F0D A;  1F9P A;  1XNQ L;  5E4X A;  1PFS A;  1X3P A;  2EQS A;  1FNV A;  1J5E L;  3MAQ A;  1K83 B;  4K8I A;  4H7B A;  3FKI G;  4A3D G;  4K5V A;  2ID0 A;  2CH4 A;  3PO2 H;  1K0R A;  1N36 L;  1IBM Q;  4HIM A;  4A3F G;  1WTR A;  4QQB X;  4JI4 L;  4TKO B;  1NAP A;  4DV3 L;  1EYC A;  3A0J A;  5ISR A;  4LW1 A;  3K0Y A;  1AP0 A;  1EQQ A;  2BCO A;  2D2C C;  1JWS D;  2K28 A;  4GN4 B;  4QCL A;  4JI2 L;  1K8G A;  2RHS B;  2WB1 E;  3AFQ A;  1TWA B;  4DV2 L;  4HED A;  3SXH A;  4BY7 G;  3K5N A;  1PH8 A;  2F0U A;  2R7F A;  3QG1 A;  3VDY A;  3S14 B;  1JOR A;  4B3S L;  2I07 B;  2LS0 1;  1N36 Q;  4YY3 L;  3U9S A;  3E5S A;  1CHP D;  2EYM A;  2K5D A;  4OGQ C;  2K50 A;  1SE3 A;  2O5I C;  2MPM A;  1D5M C;  2NTS A;  1XWE A;  3OWF A;  5IP9 H;  4IUV A;  4NXN Q;  3S2D B;  1RJT A;  1UWV A;  2FMC A;  2BH8 A;  2AKW B;  3M3Y H;  2E8G A;  2I5H A;  1KDB A;  4A75 A;  4OO1 I;  3T4A C;  2Z4I A;  4OX9 Q;  1FVI A;  2JA7 B;  3PQI A;  5CYU A;  1CZW A;  1VQP A;  4OWX B;  1QZG A;  5J22 A;  4LFC Q;  3E6Z X;  1FNU A;  3TP8 A;  3G48 A;  5IWA Q;  5M3F H;  5FLX c;  1FGB D;  1L1O B;  5HY6 A;  2A19 A;  4HN7 A;  3KBX A;  4LF4 L;  1JOQ A;  1ET6 A;  1XYI A;  4IJH A;  3CQZ B;  1EOT A;  3EQL C;  3BZC A;  2O5J C;  4JOI C;  4K6L A;  4Y7N B;  5CGK A;  1GHK A;  4X62 Q;  2XIW A;  3HKZ G;  1L1O C;  2F0N A;  2KCN A;  1TII D;  2D9U A;  4B3R Q;  1J5E Q;  2I5L X;  2CQO A;  2KA7 A;  3UE1 A;  5FJ8 G;  2K5V A;  1CI3 M;  1SNM A;  2RCN A;  4DXG A;  2WV6 D;  3QJY A;  3HOU B;  3GV6 A;  3KJP A;  4A3C H;  2JA6 H;  4A3B B;  4IUN A;  1STA A;  5I4D A;  1NR4 A;  1IHZ A;  1SNQ A;  2NWG A;  5J39 A;  3BJU A;  4C3J H;  5CBA E;  4DR2 L;  3ND8 A;  1J9O A;  3E3X A;  1IKL A;  2ZT9 C;  2E5L Q;  1U4L A;  3M7G A;  1ML0 D;  4CKB A;  4A3C G;  2Q2H A;  1IW7 C;  3NWS A;  4CDE C;  5JOB A;  2K5Q A;  4HJ9 A;  2Q8R E;  3OMG A;  4LFA L;  3MHB A;  3RZD H;  1NUC A;  1X54 A;  2OXP A;  3NP8 A;  4OXP A;  4L5T A;  5E3F A;  4J8Q A;  1EY0 A;  1FL0 A;  4JI1 Q;  4B3S Q;  5CV8 A;  4DUY Q;  1XMO L;  4DR6 L;  3JAM i;  1KDC A;  3W5O A;  2K6A A;  4K14 A;  3VR6 A;  3GTL H;  3GQB A;  5D3D A;  2AQ1 B;  3ONA B;  1Q1E A;  4B9W A;  1DON A;  2LMC B;  5J3B A;  3CMA A;  1N32 L;  2NUC A;  5ELC A;  4DR3 L;  3SVM A;  1HHV A;  5FO9 B;  3MXN B;  2PPB C;  1NY4 A;  2JA9 A;  3D4W A;  1I4H A;  2P5Z X;  2XTI A;  2K33 A;  4A3G H;  3D8G A;  3T16 A;  2K4K A;  3EIV A;  1X65 A;  4IPG A;  1A8V A;  4X64 Q;  4YHH Q;  1EU4 A;  1H9R A;  4R4C A;  1G51 A;  2CQA A;  1F2Y A;  2KEE A;  3G7L A;  1ENA A;  1EFW A;  3W1B A;  4O2D A;  1A3U A;  1N9W A;  1OO9 B;  3J7A V;  1QG7 A;  2B63 B;  4AIM A;  4GKK L;  4R4O A;  3G4S A;  1Y1W H;  1IBL Q;  2TMP A;  2RHQ B;  2OWO A;  1LT5 D;  4BY1 B;  3S15 H;  2PMZ E;  1V1P B;  4X3S A;  2WII B;  1EZ6 A;  3MXU A;  3MFG A;  2JA8 G;  5I6Y A;  2VB2 X;  4JK1 C;  1QCB D;  1TWF H;  3QO2 A;  3BVG A;  2VY3 A;  1B1Z A;  1YNN D;  3J80 c;  1UE5 A;  1JT8 A;  5C5L A; 
#chains in the Genus database with same CATH homology
 4LF5 Q;  5M5X H;  4A93 H;  4A93 G;  1X55 A;  2MNA A;  3U50 C;  3J7A 5;  1RIP A;  4UP9 A;  4DV7 Q;  4A3J G;  1HNZ Q;  3M4O H;  1NMG A;  3DLL A;  4OWW B;  3HFZ B;  2E2H H;  3PGZ A;  2ZTC A;  5IE8 A;  3RN5 A;  4JBK A;  2JA8 H;  4R4T A;  4PZ8 A;  1SLJ A;  3M4Q A;  5FJ8 H;  4DR2 Q;  1FJG L;  3T1Y Q;  3TEH B;  4EQ5 A;  4NXM L;  2F4V Q;  4DAM A;  4GOP A;  1E22 A;  1GD7 A;  2A1A A;  4LFA Q;  5GAE C;  4A3F H;  1G6P A;  4IOA A;  1N32 Q;  3HOW G;  2UUA Q;  3PO2 G;  2R93 G;  3TS0 A;  3S1M H;  5C44 G;  4IPC A;  2JA6 G;  1HNX L;  5LMU Q;  4UPA A;  1I3Q H;  2KHJ A;  1AE3 A;  5GAH C;  3PO3 G;  4JYA Q;  2VQE Q;  1XJV A;  1Z9F A;  1EQR A;  4BA2 I;  4HIK A;  3E9H A;  2VW9 A;  1N34 Q;  1HR0 W;  3CCJ A;  2PQA A;  2E2I H;  3W1G A;  5JEA G;  4TQU S;  2A8V A;  2N78 A;  4JI8 L;  2NVT H;  4LF8 Q;  3ICE A;  3PV0 A;  3H15 A;  3UE0 A;  2NVQ H;  1I50 H;  1A0I A;  2JA5 G;  4KHP L;  2VNU D;  4DR6 Q;  1PH9 A;  1VQA A;  4DV3 Q;  4P74 A;  4LF9 Q;  4K0K Q;  1X3F A;  2NVY H;  4A3G G;  2ATW A;  3HOY H;  2CKZ B;  2OQK A;  2ZTD A;  1IBK Q;  1K73 C;  3I55 A;  2ZM6 L;  4X6A H;  1HJP A;  1YBY A;  4DV6 Q;  4LFB Q;  1BBU A;  3S1N H;  5M3M H;  1U0L A;  4L5R C;  4NXM Q;  2WAQ E;  1QVG A;  2UUB Q;  1UE6 A;  1PH3 A;  2Q2U A;  3HOU G;  1Q1B A;  4QL5 A;  2Z0S A;  4Y7N H;  3GD7 A;  4JI2 Q;  5GAD C;  3PIO A;  4IFD I;  4BBR H;  4GKK Q;  5GRO A;  4J15 A;  4JC0 A;  1PH4 A;  2I0Q A;  3MEF A;  1SN8 A;  1SE8 A;  4JBM A;  2AWN A;  4JV5 L;  1XNQ Q;  4B3T L;  2UUC L;  1GVP A;  4A3I G;  1JJ2 A;  5C0X I;  4LF7 Q;  3H3V I;  2KEN A;  3T1H Q;  4GKJ L;  3CCS A;  4LF5 L;  2BA0 A;  4C3H H;  4YCU A;  4X65 Q;  2K52 A;  4HIO A;  4YY3 Q;  3RR5 A;  1P16 A;  1EUJ A;  3M9B A;  5IYB H;  4HID A;  1VQ7 A;  4JI0 L;  2EXD A;  3HOZ H;  2NZO A;  4FDB A;  5EAY A;  1IZ6 A;  4QGU A;  3OTO L;  2JA7 H;  1FJG Q;  2JA7 G;  1YHB A;  4AQY Q;  3I4N H;  3KF6 A;  4B3M Q;  3CPW A;  4XIG S;  4LF4 Q;  1Y1V G;  2UUB L;  2N49 A;  2UUA L;  3S1Q H;  2N8N A;  1WOC A;  3UDI A;  2Y0S G;  4DUZ Q;  3HOV G;  1HNW L;  3S16 H;  4OO1 G;  4BBS H;  5ELO A;  1VQB A;  3CCM A;  4JYA L;  4A3K G;  1WI5 A;  3STB C;  2CFM A;  1N33 Q;  5C4X G;  4JG2 A;  3UDG A;  1DGS A;  4AH6 A;  3F1Z A;  3FKI H;  3CCU A;  1LTL A;  4BY7 H;  1JJG A;  4DR4 Q;  3STB D;  3OW2 A;  1PH2 A;  4DV0 Q;  2D0O A;  3CPF A;  3K7U C;  1YIT A;  1UE7 A;  1SMX A;  4QY7 A;  2VQE L;  3CD6 A;  3PF5 A;  3D0F A;  3EN2 A;  4GOP B;  3ZJY C;  4LNQ A;  1OXV A;  4DR7 Q;  4JI4 Q;  2F52 A;  3A74 A;  4R4Q A;  2B63 H;  4YHH L;  1OXS C;  2UU9 Q;  1YJN A;  2KBN A;  4A3M H;  4JI3 Q;  2DGY A;  3TRE A;  3S1R H;  1EWI A;  4X62 L;  5GQO A;  2R92 H;  2LXK A;  4A4I A;  4WJ3 M;  4DUZ L;  3DM3 A;  2YYZ A;  1Q7Y C;  3CC7 A;  2R6G A;  1VS0 A;  1Y14 B;  2HIV A;  4DV4 L;  1W2B A;  5K36 G;  1KXL A;  1HNX Q;  2E5L L;  4A3D H;  2LXJ A;  1J6Q A;  1MIU A;  3T1H L;  1XNR L;  3PO3 H;  3KF6 B;  2PI2 E;  3J80 i;  4X65 L;  4GNX A;  2B63 G;  1K3R A;  3AYH B;  1D8L A;  1FGU A;  5IYD H;  1W3S A;  3HOX H;  1OTC A;  2OTL A;  1VQ4 A;  4LF8 L;  4POG A;  2R93 H;  1AE2 A;  4DV0 L;  1HZC A;  3HOW H;  3KLW A;  4O0A A;  1N34 L;  3HOX G;  4GOP C;  3GTM H;  1YVC A;  2V1C C;  4LF9 L;  3Q8D A;  4K0K L;  3LGJ A;  4GS3 A;  1GO3 E;  1PA6 A;  1T9H A;  2B29 A;  4A3E G;  4MNO A;  1CKM A;  3SGI A;  1JJC B;  3GTO H;  3L2P A;  5C0X G;  2WAQ G;  3A5Z B;  3RLF A;  5M3F G;  4A3M G;  4DV6 L;  4DUY L;  4LUZ A;  5IYC H;  1XMO Q;  1IL2 A;  4JI3 L;  4RMF A;  2OQ0 A;  2Y0S E;  3TRZ A;  1QVF A;  5LMN W;  4NXN L;  4JI5 Q;  1HZA A;  2OCE A;  2C35 B;  4YCV A;  1CKN A;  4LF6 L;  2VZA A;  3BU2 A;  3S2H H;  2CWA A;  2D62 A;  4AQY L;  2VS1 A;  2VUM H;  2YTY A;  1GKH A;  4P75 A;  2NN6 G;  1KC8 C;  3M7N A;  4DV5 L;  2R7Z G;  4LUO A;  2K75 A;  1S72 A;  1A63 A;  3K80 C;  4IPD A;  1C0A A;  1KRT A;  4APV A;  1SFO H;  4JI7 L;  1HNW Q;  4JI1 L;  4P71 A;  1YI2 A;  2B3G A;  1WJJ A;  2F3I A;  3K81 C;  5IYB G;  1I5F A;  1RL2 A;  1M1K C;  5IT9 c;  1XMQ L;  1Q81 C;  1PH5 A;  4GKJ Q;  2R7D A;  3I4M G;  1L1O A;  4BY1 H;  4DR5 Q;  1R9T H;  5C4X H;  1K9M C;  1NTG A;  1B8A A;  4JI8 Q;  3S14 H;  2JQO A;  3KF8 B;  4LUV A;  2PQA B;  3GDE A;  4DPG A;  1AH9 A;  3U4V A;  3D31 A;  3I4O A;  4BA1 I;  2UXD L;  3HOV H;  2WP8 J;  1TWA H;  4DV1 Q;  4X64 L;  1P8L A;  1SRO A;  4DKA C;  4DR7 L;  3A5U A;  3HKS A;  1K8A C;  1VQ5 A;  3UDX A;  2I5M X;  1Q46 A;  4LFB L;  4IPH A;  1KHI A;  1YHQ A;  4X66 L;  4Y52 H;  2IHE A;  3I56 A;  1HZB A;  3ULP A;  1Q8K A;  1TWC H;  4JCV E;  1VQC A;  4A76 A;  3HOZ G;  4B3R L;  3JC6 6;  2QEX A;  1IBL L;  3AFP A;  3ER0 A;  3KJO A;  2VUM G;  4DV4 Q;  2K5H A;  1U5K A;  2IHF A;  4BY1 G;  1M90 C;  1ASY A;  3HKZ E;  1JE5 A;  1WFQ A;  1QZH A;  4A3E H;  2UUC Q;  5AJ3 Q;  1OXX K;  3L0O A;  5FLM H;  4MTN A;  4DR4 L;  1E1O A;  2JK8 A;  4JBJ A;  4A3I H;  4JOI A;  4C3I H;  3RN2 A;  4QIW E;  2K5N A;  4BBR G;  1H95 A;  3PIP A;  5IP7 G;  4GLA C;  5BR8 Q;  1Q82 C;  1WYD A;  1YZ6 A;  1QVC A;  1UEB A;  4KHZ A;  1PVO A;  1TWH H;  3FHW A;  4TVA B;  1L0W A;  1PHJ A;  1X3G A;  1PH6 A;  1YNX A;  1JT8 A;  5JJI A;  2R92 G;  5IYC G;  1CUK A;  2H5X A;  1LM0 A;  1S3O A;  1MJC A;  2MO1 A;  4UP8 A;  4AYB G;  3J7Z C;  5H1S E;  4DR3 Q;  5M5Y H;  2VQF L;  4HJ7 A;  1PH7 A;  1XNQ L;  1IYJ B;  2Z6K A;  3TS2 A;  5ELN A;  1PFS A;  2EQS A;  1VCI A;  4DK6 C;  1CSP A;  1XPR A;  1J5E L;  1N33 L;  3S17 H;  2YV5 A;  5LMU L;  2YU9 H;  4YCW A;  1KRS A;  3RLO A;  2IY5 B;  4QJF A;  2PNH A;  2PI2 A;  3CAM A;  2YTX A;  1YEZ A;  4PG3 A;  1HNZ L;  3FKI G;  2ZJR A;  4JI0 Q;  1LYL A;  1VQK A;  4A3D G;  2ID0 A;  1VQH A;  3S2D H;  3PO2 H;  1K0R A;  1N36 L;  1XPU A;  1IBM Q;  4HIM A;  4A3F G;  2Q2I A;  4JI4 L;  4QQB X;  3PUZ A;  5FLM G;  1E1T A;  3J81 j;  4DV3 L;  4LF6 Q;  3A0J A;  3G71 A;  4P73 A;  3ULL A;  4LW1 A;  3NEM A;  1QUQ A;  2JEB I;  1VQL A;  3CF5 A;  2ZTE A;  1B70 B;  1EOV A;  5DLQ E;  2ZM6 Q;  3H3V H;  1EQQ A;  4WJ4 A;  2E2J H;  3CC2 A;  2UXB L;  4YWM A;  2VL6 A;  4GN4 B;  1PV4 A;  4JI2 L;  1K8G A;  2RHS B;  4MZ9 A;  1Y1V H;  2WB1 E;  5E7N A;  3AFQ A;  4JI7 Q;  2WFW A;  4DV2 L;  3I7F A;  4DR5 L;  5LMN Q;  1JMC A;  3KDF A;  4BY7 G;  1XMQ Q;  1PH8 A;  4DAY B;  2R7F A;  2Q2T A;  3GTG H;  1Y1W G;  4GLX A;  3VDY A;  4A3K H;  2YTV A;  2OTJ A;  1OXT A;  1NE3 A;  4B3S L;  4DNI A;  1N36 Q;  4YY3 L;  3CW2 C;  3WWV A;  1I94 Q;  2CCZ A;  4JI6 L;  1I6H H;  1MJE A;  4OON A;  2AMC B;  4X66 Q;  2K50 A;  5GAG C;  1GM5 A;  3I4N G;  4A3B G;  4JI5 L;  4EX5 A;  5IP9 H;  3CCV A;  4NXN Q;  5M3M G;  4DR1 L;  2D0P A;  3E0E A;  1UWV A;  2BH8 A;  2R7Z H;  2AKW B;  1X56 A;  2UXB Q;  3M3Y H;  4JBW A;  4BXX H;  2E8G A;  1Q12 A;  5C3E H;  2I5H A;  1V43 A;  4PZ7 A;  3PUV A;  4C2M H;  3BZK A;  4A75 A;  3GTK H;  5AJ3 L;  1N8R C;  4ME3 A;  2AWO A;  3CME A;  3KDF B;  4OO1 I;  3NEN A;  4OX9 Q;  2ZJQ A;  3F2C A;  1FVI A;  1PYS B;  1VQE A;  1V9P A;  3F8T A;  3L7Z C;  2XGT A;  3PUY A;  5IY0 A;  4OWX B;  1VQP A;  1QZG A;  1XTD A;  3AQQ A;  4A3L G;  4LFC Q;  2JJQ A;  3HOY G;  1WCM G;  1C9O A;  2HHH Q;  5IWA Q;  3G48 A;  2HIX A;  4OWT B;  5M3F H;  3RZO H;  5FLX c;  5IP9 G;  5C4J H;  1L1O B;  5HY6 A;  3OTO Q;  1X3E A;  1VQ9 A;  2A19 A;  3G6E A;  3CP0 A;  3F2B A;  4LF4 L;  3ULJ A;  2LSS A;  4AYB E;  4IJH A;  4R1J A;  4IJL A;  4DV1 L;  1IBM L;  1YJW A;  5IYD G;  2QA4 A;  1EIY B;  3GTQ H;  5M5W H;  1E7Z A;  3BZC A;  2GVA A;  4JOI C;  1C7Y A;  2FXQ A;  1A62 A;  1BVS A;  5C44 H;  2N3S A;  4DV5 Q;  1E24 A;  4X62 Q;  3HKZ G;  1CKN B;  1E3P A;  1L1O C;  4IFD J;  4RG1 A;  3J81 c;  3M85 A;  3FP9 A;  4B3R Q;  5C0X J;  1NBW A;  1J5E Q;  1EYG A;  2I5L X;  2CQO A;  3UE1 A;  5JJL A;  3CXC A;  3NEL A;  5FJ8 G;  2K5V A;  2RCN A;  3U4Z A;  4DK3 C;  1NMF A;  4NPS A;  2BA1 A;  3JAM c;  3KFU A;  2HQL A;  1VQJ A;  2WB1 G;  5HGQ A;  3KJP A;  1I94 L;  2HHH L;  4JI6 Q;  4L5S A;  2JA6 H;  4A3C H;  1CSQ A;  3CCL A;  3F2D A;  2CWP A;  4PZ6 A;  1KIX A;  1ASZ A;  1VQF A;  3B6Y A;  3E9I A;  1HR0 Q;  2JE6 I;  3BJU A;  5BR8 L;  4DV7 L;  4C3J H;  3GO5 A;  1L2F A;  4DR2 L;  2EIF A;  4B3M L;  3H0G H;  2E5L Q;  1BKB A;  3EBE A;  3ERS X;  4A3C G;  2Q2H A;  2ALY B;  4HJA A;  1VQO A;  4BBS G;  1VQD A;  3KOJ A;  3NBH B;  1VQG A;  1SR3 A;  2HT1 A;  3PF4 A;  1TWG H;  1TXY A;  4HJ9 A;  4LFA L;  2AHO B;  1K83 H;  3RZD H;  1Q86 C;  2KCT A;  1X54 A;  2UXC Q;  4POF A;  1XPO A;  3S24 A;  5IWA L;  3PUW A;  4OXP A;  4L5T A;  4KI0 A;  1FL0 A;  2KHI A;  4JI1 Q;  4B3S Q;  1YIJ A;  4R4I A;  1WCM H;  3CCE A;  4HJ5 A;  4DUY Q;  1XMO L;  4DR6 L;  3U58 A;  4GLV B;  1KD1 C;  2RF4 A;  3JAM i;  2MQH A;  3W5O A;  1YJ9 A;  3GTL H;  1EIF A;  1IBK L;  5IP7 H;  3CC4 A;  5JJK A;  1Q1E A;  2UU9 L;  4BXX G;  5JEA J;  2UXD Q;  2GN5 A;  1O7I A;  2Z6K C;  4KLK A;  3CCR A;  1NJI C;  5J3B A;  2QGQ A;  3CMA A;  2ZJP A;  2ES2 A;  1N32 L;  4NB3 A;  1G29 1;  2BH2 A;  2ASB A;  4HJ8 A;  4DR3 L;  3KYH C;  1KAW A;  2VQF Q;  3MXN B;  4PMW A;  1D7Q A;  1OXU A;  2JEA I;  3HOU H;  4JV5 Q;  1NY4 A;  1QUQ B;  2F4V L;  2JA9 A;  3I2Z A;  1UE1 A;  1HZ9 A;  3K7A H;  4GN5 A;  1XNR Q;  2L15 A;  4XTC S;  1PYB A;  4LF7 L;  4OX9 L;  2KCM A;  2XTI A;  3K8A A;  5C3E G;  1MKH A;  4B3T Q;  4A3L H;  1VQN A;  3K0X A;  5LMN L;  3UDF A;  4A3G H;  2NN6 I;  4LFC L;  4UY8 C;  1JB7 A;  2K4K A;  4GNX C;  3EIV A;  3GTP H;  2JA5 H;  1X65 A;  4IPG A;  1A8V A;  4A3B H;  4X64 Q;  4UP7 A;  1X6O A;  1BBW A;  3PUX A;  4YHH Q;  4R4C A;  3TQY A;  3RNU A;  1G51 A;  1V1Q A;  2GVB A;  4IFD G;  3RLN A;  3CQZ H;  4KHP Q;  4LWC A;  1EFW A;  2K14 A;  3W1B A;  3M4P A;  4O2D A;  1N9W A;  3IRB A;  1VQI A;  2NZH A;  3CCQ A;  4L5Q A;  4YWL A;  1Z47 A;  3J81 i;  3H0G G;  4AIM A;  1HR0 L;  4P72 A;  4GKK L;  4R4O A;  3G4S A;  1Y1W H;  1IBL Q;  2NVX H;  3T1Y L;  2IX1 A;  2RHQ B;  1YHA A;  1B7Y B;  2OWO A;  3I4M H;  4DR1 Q;  4YWK A;  4GN3 B;  3S15 H;  3PCO B;  2UXC L;  2PMZ E;  2MO0 A;  4ALP A;  4H02 A;  1PH1 A;  1S40 A;  1CKO A;  1X9N A;  2IT1 A;  4DV2 Q;  4IO9 A;  1VQ6 A;  3AEV A;  3OYY A;  2JA8 G;  1SRU A;  2DUD A;  1KL9 A;  3PSI A;  2IX0 A;  4GNX B;  1TWF H;  1KQS A;  3GTJ H;  1IXR A;  4A3J H;  2VY3 A;  1LUZ A;  1HH2 P;  3J80 c;  4IOC A;  1VQ8 A;  1UE5 A;  2MFI A;  1VQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...