1SROA

S1 rna binding domain, nmr, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
76
structure length
76
Chain Sequence
AEIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PNPASE
publication title The solution structure of the S1 RNA binding domain: a member of an ancient nucleic acid-binding fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags S1 rna-binding domain
total genus 4
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 1996-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sroA00
1NE3A 1TWFH 2ALYB 1O7IA 4TQUS 1JB7A 3J7A5 1YHBA 4PZ6A 2R6GA 1JJ2A 1CSQA 1BBUA 1UE1A 2OQKA 3IRBA 2VQFQ 3J80c 4C2MH 4A3KH 1N34L 1WI5A 4GNXB 2PQAB 4QL5A 2EIFA 4A76A 1FJGQ 3JC66 5C3EH 1PH4A 2RHQB 4LFAQ 3CCEA 4A3IG 2Q2UA 1VQLA 2JQOA 1Q8KA 4UPAA 5M3FH 3HOWG 4B3SQ 4PMWA 5M3MH 4JBWA 3KJPA 1HR0W 4JCVE 3HOXG 4DR6L 1OXSC 2K52A 1Z9FA 2CQOA 2Q2HA 5C44H 5M5WH 3PIOA 1MJEA 1E24A 2HIXA 1L1OC 5GADC 2E2JH 2N78A 2IY5B 3HOYG 4B3TQ 4DR7Q 4X65L 2K75A 4IPCA 1KD1C 3CF5A 4YWLA 2IX1A 3F1ZA 1M90C 3FP9A 5FJ8H 2ZTDA 4BY1G 2VS1A 1G6PA 1VCIA 1NMFA 2BH8A 4DV7L 2CWPA 1VS0A 1K8AC 1WCMH 1AE2A 5M5XH 4A3GH 5GAHC 5GAGC 1DGSA 2VQEL 1XNQL 1FVIA 3U4VA 1B7YB 3GTLH 4NB3A 3L2PA 3DM3A 2ZM6Q 2JK8A 1NTGA 3DLLA 1XPOA 2MFIA 4DR4L 3PO3H 1L1OA 1GKHA 3ULPA 2VY3A 3RZDH 4JI5Q 1JJGA 1B8AA 3WWVA 2N8NA 4LF7Q 3RN2A 4LF8Q 2R7FA 3PUYA 1YI2A 4HJ5A 1LUZA 1YVCA 2K4KA 3SGIA 4DKAC 3RN5A 1KC8C 2UU9L 4A3BG 5DLQE 4GKKL 4IFDG 4JI8Q 2NN6G 1X3EA 5IP9H 3GTKH 4OONA 3I4OA 4LF9Q 3PO2H 1WJJA 5JJLA 3U58A 3PCOB 1SFOH 2GVBA 2ASBA 4DUYL 1N33L 4OWXB 3I56A 2NZOA 4X65Q 1VQEA 1X3GA 3BZCA 3KJOA 5E7NA 1UEBA 1Y1WG 1BVSA 5C0XJ 4IFDI 4GKJQ 5C0XG 3E0EA 4XTCS 2NN6I 3M4OH 3GTOH 4B3RL 4KHPL 2D62A 4DV1L 1NJIC 2AWNA 2AWOA 2F52A 1N8RC 3H3VI 4AH6A 4BBSG 3KF6A 3CP0A 1OXXK 2CWAA 1NY4A 1UE5A 4X66L 5FLMH 1I5FA 2R7ZG 3KYHC 2AMCB 4GNXC 1E1OA 2NVQH 3K7UC 4O0AA 3FKIG 3TEHB 3CCVA 3F2CA 4DK6C 1CSPA 3UDFA 4DR1L 5LMNL 4P75A 4JV5L 1OTCA 4MNOA 2UU9Q 1IXRA 2Q2TA 3CQZH 4JI3L 2K5NA 3UDIA 1V9PA 1RL2A 4A3KG 4KHZA 3BZKA 1PH9A 1VQKA 4LF4Q 4A3EH 4DUYQ 5C3EG 3K8AA 2VQFL 2IX0A 1N33Q 3HOZH 3TQYA 1SROA 2ID0A 3BU2A 4DUZL 4L5RC 5M3FG 1FJGL 2F3IA 5IT9c 1XPRA 5M3MG 4B3RQ 3H0GG 4Y52H 4RMFA 4LFAL 4DV1Q 3TRZA 2K5HA 2N3SA 4QY7A 3W5OA 4GNXA 1PA6A 3NBHB 5C44G 4R1JA 3RNUA 1NMGA 1PV4A 2NVXH 2MQHA 2DGYA 3ULJA 1KRTA 2KBNA 4WJ4A 3RLNA 4JBKA 4OXPA 3S17H 4X66Q 3CCQA 1SMXA 3CCMA 4YY3L 1D8LA 1TWGH 2XTIA 1KL9A 1YEZA 2LXKA 5FJ8G 3D31A 4DR1Q 5LMNQ 4DR7L 4JV5Q 5C4JH 2JA6H 3M4QA 1LM0A 1SE8A 3CCJA 1QVFA 4NXNL 4JI3Q 3F2DA 3OW2A 1WCMG 4JI0Q 4A3GG 5IYDH 1K3RA 4HIKA 1X6OA 3S2DH 4IPGA 2ATWA 3ER0A 1K8GA 1EQRA 1E3PA 4JI4L 5K36G 4BXXH 1VQJA 1Q7YC 4YCWA 2K5VA 1YZ6A 1YIJA 4DUZQ 4NXML 3OTOQ 3PO3G 4JOIC 4OO1G 2A1AA 1PH8A 4JYAL 2BA0A 1VQBA 2VZAA 3OYYA 3I55A 4JI6Q 2ZM6L 1QUQB 3A74A 3NENA 1FL0A 1XJVA 5IP9G 4JI5L 1EWIA 4XIGS 2YTXA 2UXDL 4X62L 4DR5L 1I50H 1OXVA 4LF8L 4LF7L 1XPUA 4AQYQ 2JA7H 3PO2G 1OXUA 4JBJA 1PH2A 4OO1I 1AH9A 1VQ8A 2UUCL 4JI8L 4YY3Q 5LMUL 4DV2L 4A3MH 1X3FA 2H5XA 1XNRL 4LF9L 3F2BA 3TS2A 2PI2A 3HKSA 4AYBE 2MO1A 3CC7A 3RZOH 1CKOA 2HQLA 3CW2C 4A3JG 1E1TA 1YHAA 4YCVA 3PUXA 1Q81C 1IZ6A 1VQ7A 4GKJL 2YTYA 1M1KC 1KHIA 5IE8A 4NXNQ 1Q12A 1GM5A 4JOIA 4RG1A 2JJQA 4LFBQ 1IBLL 1PH5A 1PYSB 2WB1E 5FLMG 1HR0Q 4OX9Q 4JI4Q 4DNIA 2OTJA 1K83H 3STBD 1X55A 1N9WA 4L5TA 1VQCA 2UUBL 2QA4A 1TWAH 4HJ9A 2JEAI 1D7QA 3S15H 2KENA 4NXMQ 2HT1A 1H95A 4JYAQ 2IT1A 4LF6L 1HNZQ 3GD7A 3T1YL 4MTNA 2C35B 2VL6A 3PGZA 4GN4B 4QGUA 4P73A 3I4MH 4BA2I 3S1NH 2B63H 2UXDQ 4X62Q 4DR5Q 4IPHA 3D0FA 4A3EG 3I2ZA 3I4NH 3I7FA 1V1QA 4JI1Q 3CMEA 2UUCQ 5LMUQ 3HOZG 4DV2Q 2KCTA 1U0LA 1XNRQ 1W2BA 3CCUA 1X54A 3HKZE 1KQSA 3K7AH 4LF4L 4QQBX 4PG3A 1EOVA 4BBRH 5JJKA 4BY7H 3CAMA 4LUVA 4HJAA 2ZJQA 3VDYA 4P71A 3EBEA 2RF4A 1S3OA 4A3CH 4UP9A 3AFPA 1IBLQ 4WJ3M 5C4XH 4AYBG 2NVYH 4R4IA 2PI2E 2KHJA 4MZ9A 3STBC 4X64L 4A3IH 1XMOQ 1KXLA 2R93H 2UUBQ 2UUAL 2R92H 4YHHL 3KLWA 4LWCA 5C0XI 5IWAL 1A63A 3KDFB 3HOXH 1YJ9A 4A3LH 4LF6Q 2JA6G 1MJCA 3T1HL 3T1YQ 2VW9A 2OQ0A 4DV3L 1VQMA 3HFZB 4ALPA 3CD6A 2IHEA 4BA1I 2JA8H 2E5LL 3HOVH 5IYDG 4KLKA 1YJWA 1S72A 2ES2A 1U5KA 4R4CA 2JA5H 4BXXG 4B3ML 2I5LX 1C9OA 1SN8A 5GROA 1K73C 4JI0L 1Z47A 3S1RH 3CCRA 3CC2A 4YWMA 3K81C 5ELNA 1GO3E 3CPFA 1I6HH 1N32Q 3EIVA 1VQAA 4GS3A 3OTOL 3CCSA 3S1MH 1SLJA 5HY6A 2GN5A 2EXDA 1FGUA 1PH3A 2AHOB 2A8VA 2JA7G 4H02A 2GVAA 3NEMA 4JBMA 2A19A 3M9BA 2YTVA 4J15A 1P8LA 2K14A 1YBYA 4JI6L 3J81c 4X64Q 3GTGH 4ME3A 4POFA 4HJ8A 1VQIA 2UUAQ 4A3FH 4YHHQ 3L7ZC 4A4IA 4AQYL 1HZ9A 1QUQA 5IWAQ 3CXCA 1XTDA 3G71A 4LFCQ 3JAMi 3M7NA 4GN3B 4L5QA 3T1HQ 4PZ7A 1HNXL 4DV3Q 1V43A 1X65A 4FDBA 1Q86C 4UP8A 4EX5A 3G6EA 4LNQA 3KFUA 2E5LQ 4QJFA 1QZHA 1YHQA 5LMNW 1VQ6A 1KIXA 1JMCA 3ICEA 1ASZA 2CCZA 1Y1VH 4JC0A 4R4TA 3G4SA 1N36Q 1VQ9A 4B3MQ 3GO5A 1C0AA 4DV6L 1T9HA 4LFBL 4LW1A 1KAWA 5IY0A 1JT8A 1HR0L 4POGA 3TREA 2YYZA 5IYBH 5JEAJ 4OX9L 2JEBI 3PUWA 2K50A 4GLAC 3UE0A 4DV4L 5IYCH 2UXCL 1I94Q 4GOPA 3I4MG 1EIFA 3B6YA 4BBSH 4JI2L 2VNUD 2AKWB 4AIMA 2B63G 4Y7NH 4QIWE 1SRUA 1HNZL 1HNWL 1QVGA 3A5UA 3I4NG 1OXTA 3LGJA 4YWKA 1J5EL 3Q8DA 3HOUH 1IBKQ 1B70B 2E2IH 1AE3A 1W3SA 3M4PA 3AQQA 2KCMA 4IPDA 3M85A 1VQNA 3PF4A 2UXBQ 1K0RA 4JI1L 4DPGA 4LUZA 3W1BA 5IP7H 4IOCA 4DV5L 4IOAA 4BBRG 2NZHA 3A5ZB 4L5SA 1UE7A 2F4VL 4BY7G 1HZCA 4A3DH 1HNXQ 4HIOA 2E2HH 1BBWA 4DV0L 4P74A 4K0KL 3RLOA 3PUZA 3TS0A 4A3CG 5GQOA 2Y0SE 3UDXA 2VUMH 3ULLA 5C4XG 1IBMQ 3AFQA 5H1SE 4UY8C 2WAQE 1YJNA 3A0JA 2R92G 2R93G 4JG2A 4DV6Q 3GTJH 1PVOA 1IYJB 4C3IH 4GOPB 3MEFA 4C3JH 1HJPA 1PH7A 4APVA 3J81i 3H0GH 4A75A 3CC4A 2L15A 4DV4Q 1XMOL 4A3LG 2UXCQ 3E9IA 1PYBA 2Q2IA 2B29A 3KOJA 4JI2Q 4O2DA 3GTQH 2JA8G 1LYLA 3J81j 5ELOA 3HOVG 1X56A 4A93H 2R7DA 3F8TA 2JA5G 2D0PA 1HNWQ 1CKNB 1LTLA 1C7YA 1J5EQ 4PZ8A 2ZTCA 3K0XA 3KDFA 2EQSA 1VQOA 1XMQQ 4DR2Q 4DR3Q 2HHHL 4LF5L 1BKBA 2LXJA 3PSIA 2OWOA 2PMZE 3S24A 1L0WA 2ZJPA 1VQFA 4DV5Q 3K80C 3JAMc 3PF5A 3MXNB 2F4VQ 2PNHA 2V1CC 1QVCA 4DV0Q 1A8VA 4K0KQ 2I0QA 1KRSA 1N34Q 2RCNA 1P16A 1Q82C 3H15A 1G51A 1N32L 4HIDA 2E8GA 3E9HA 2MO0A 1NBWA 2YV5A 4GLXA 2ZTEA 2BA1A 1CKMA 4A3FG 5BR8L 1YNXA 1JE5A 1TWHH 4JI7L 4R4OA 4LUOA 1EFWA 2FXQA 4GLVB 4DR6Q 4IFDJ 3S14H 1A0IA 1E22A 1WYDA 1VQGA 1A62A 1HZAA 2Y0SG 4R4QA 5JJIA 2DUDA 3HOWH 2RHSB 1VQ4A 2WAQG 1Q46A 5M5YH 4OWWB 4LFCL 2JE6I 1VQPA 1IL2A 3L0OA 1Y1VG 2WB1G 1RIPA 3J80i 2HHHQ 1HZBA 1VQHA 2MNAA 4YCUA 3AYHB 4LF5Q 1Y14B 1GD7A 3AEVA 4IJHA 2NVTH 5IYBG 1UWVA 3HOYH 4A3JH 3NELA 1N36L 5IYCG 1TXYA 3W1GA 2HIVA 1GVPA 4DV7Q 2YU9H 2N49A 2I5MX 2KHIA 1Q1BA 5AJ3L 2OCEA 4BY1H 5FLXc 1WOCA 3PV0A 1G291 4KI0A 1I94L 1Q1EA 2VQEQ 1XNQQ 3HOUG 1L1OB 1CUKA 3CPWA 1PHJA 1JJCB 1L2FA 2WFWA 3KF8B 4C3HH 1ASYA 5J3BA 4DR4Q 2QGQA 5BR8Q 3RLFA 4JI7Q 3HKZG 1WFQA 2CKZB 2B3GA 5IP7G 1S40A 4GOPC 3FHWA 4DAYB 1IBKL 1MKHA 4A3MG 4A3DG 1EQQA 2LSSA 2XGTA 4GKKQ 3UE1A 3BJUA 3UDGA 2UXBL 3GTPH 1X9NA 1EYGA 2BH2A 2VUMG 3S2HH 3U50C 4EQ5A 4OWTB 4A3BH 1E7ZA 1QZGA 4IO9A 1VQDA 2Z6KC 2I5HA 4HIMA 4HJ7A 5GAEC 4DK3C 4KHPQ 4X6AH 3H3VH 1IBML 3S1QH 1I3QH 3J7ZC 3KF6B 3GDEA 4GN5A 4IJLA 1SR3A 3EN2A 1J6QA 1TWCH 1Y1WH 1K9MC 2PQAA 1EUJA 1PFSA 3G48A 5HGQA 1PH6A 3S16H 4UP7A 4B3SL 3PIPA 3GTMH 1YITA 3RR5A 5JEAG 5AJ3Q 1R9TH 3CCLA 1HH2P 2CFMA 1EIYB 3M3YH 1UE6A 4A93G 4NPSA 2WP8J 1PH1A 2OTLA 4P72A 3PUVA 4DAMA 4TVAB 4B3TL 2Z0SA 3ZJYC 1VQ5A 2R7ZH 1XMQL 3ERSX 2ZJRA 4DR2L 3U4ZA 3CMAA 4DR3L 1MIUA 2Z6KA 3FKIH 1CKNA 2D0OA 2IHFA 5EAYA 2JA9A 2QEXA
chains in the Genus database with same CATH superfamily
1NE3A 1TWFH 3J7A5 1YHBA 5FO7B 2R6GA 3SK8A 3GTGB 5IGBA 1UE1A 2XWJB 3IRBA 2VQFQ 2MHVA 4A3FB 1N34L 2K5DA 3MXNA 4AYBB 2PQAB 2WKCA 4NP5A 3JC66 5IGEA 1PH4A 4HN7A 2RHQB 4YIJA 2F0DA 1Q8KA 1X3QA 1PFNA 4TRDA 3SEBA 5M3FH 2J0TD 2NZ1D 1HR0W 4JBWA 4RWSC 3HOXG 2E74C 1Y1VB 4HSPA 1EEFD 1E24A 1L1OC 2DJFC 1KABA 4NKLA 2E2JH 2N78A 2IY5B 3HOYG 3DWQA 2F0QA 2CHBD 3N6RA 2RVLA 1KD1C 3CF5A 4YWLA 1M90C 5FJ8H 1DXMA 3K6OA 1NAPA 1NMFA 2BH8A 2CWPA 1VS0A 1K8AC 4C3HG 1WCMH 5M5XH 1HRJA 3D4DA 3U4VA 1M4VA 4A3MB 3EROA 4RHRA 3DLLA 2RCFA 2EY1A 4ID6A 1SNCA 2R7FA 3T51B 1YI2A 3SGIA 2K4KA 2UU9L 1E2ZA 4EVOA 3C46A 1E2WA 3PO2H 1G6ZA 1K83B 4HTHA 4DUYL 2K05A 2EYLA 4IFDI 1MI2A 4BS9A 4G7HC 3FEWX 4XTCS 1MBYA 3G7LA 4FP5D 1NJIC 1STAA 4AH6A 1I4GA 4BBSG 3KF6A 2KA7A 2B8FA 1LV9A 3ZYYX 5CBAE 2XSCA 4N8X1 1OXXK 4X66L 4CJ1B 2E76C 2K7VA 3KYHC 3V2TA 3K7UC 4O0AA 1BF4A 3K59A 4R8NA 2F0SA 3NWSA 1DZ1A 1A2TA 4DR1L 1SYGA 1H9SA 1LTTD 2L4NA 3LWUA 3VYSA 4ME5A 4C1NK 2UU9Q 3E0JA 2P5ZX 3CQZH 3I90A 1EY0A 3UI2A 4KHZA 4DFAA 3R8BA 4LF4Q 3T13A 4G7ZC 4DUYQ 4RGMA 4FVMA 3VR3A 3GP7A 5M3FG 1SE4A 5IT9c 1SNMA 3H0GG 4LFAL 3TRZA 4QY7A 4GNXA 1WTHA 2F0TA 2JA8B 3RNUA 1PV4A 3IFDA 1KDCA 1KRTA 4WJ4A 1H9MA 4X66Q 1AZQA 3CCMA 1H9SB 2LXKA 3U9OA 3URYA 1YNJD 5FJ8G 2B39A 4DR1Q 3MXUA 1I6HB 3K5MA 2CW0D 1DM0B 1DOLA 1SE8A 3RUZA 4X3SA 4NXNL 3F2DA 5LHY1 1WCMG 2MPMA 2EYHA 4HIKA 1E3PA 3NE5B 1Q7YC 4YCWA 4NXML 3EVQA 3TP7A 4L6TB 4FXGC 4JYAL 2BA0A 3S2HB 1Y69U 4A3BB 3NENA 1FL0A 3ONAB 1MSGA 4LF7L 1I50H 1OXVA 4LF8L 1XPUA 3PO2G 1PH2A 3SVMA 4JI8L 4A3MH 1X3FA 4LF9L 3EA6A 5ELFA 3CC7A 2MO1A 4IUVA 1YHAA 5I6YA 2B2WA 4C1NI 1GOZA 3PUXA 1IZ6A 5EKLA 5IE8A 4NXNQ 1Q12A 3ND8A 1GM5A 3X3MA 4RG1A 4LFBQ 4JPBW 4ABNA 3D3RA 2WB1E 4OELB 1K83H 1N9WA 1HCZA 3W3AA 1F2MA 1PRTB 4NXMQ 4JYAQ 1HQMC 2B2UA 4LF6L 3J7AF 2X69A 1UUPA 4PMCA 3GD7A 4BA2I 1H9KA 3NSWA 2VUMB 3OIPA 5C3EB 3I7FA 3CMEA 5E1FA 3CHBD 3T56B 1X54A 5CV5A 1CHQD 1STGA 4QQBX 1PFBA 2B2VC 5KNDA 1GUGA 1STYA 4RCOA 4HJAA 2DNCA 4M8AA 1S3OA 5F2DA 3H6MA 4UP9A 3AFPA 1RJTA 2NWGA 4AYBG 1C48A 4X64L 4KJOA 5EPKA 4A3LH 4LF6Q 1R4PB 3LNNA 5CORA 2WIIB 1VQMA 1RTOA 4BA1I 2JA8H 3BS1A 1U5KA 3OMCA 5CC4A 4B3ML 2F0MA 2X6GA 1ET9A 3H3VC 3DM1A 4JI0L 1F2YA 2PZWA 3S14B 2M2LA 4PNYA 3A8IE 1I6HH 2HCCA 1FGBD 4GS3A 5M5YB 1SLJA 2GVAA 2BDOA 2YTVA 4J15A 1P8LA 3MZ5A 3MHBA 4X64Q 4RA8A 1NUCA 4HJ8A 1DCZA 3L7ZC 4A4IA 1QUQA 4A3JB 4GZYC 1PRTC 2AUJD 3M7NA 4RCNA 1FNWA 5CV9A 4KD4A 4BY1B 3NXWA 5E3FA 3TSSA 1YHQA 4JC0A 1ENCA 1SNQA 3FRPB 4B3MQ 3P7JA 4Q5VA 1I4RA 1T9HA 3OHXC 1FNUA 2JEBI 1IW7C 4GLAC 1FD7D 2UXCL 4LK1C 4CDEC 3WDNA 3B6YA 1J8IA 1NSNS 3TP5A 1JE4A 3MA2B 1HNZL 3A5UA 1RDPD 2HCIA 4ZAIA 1IBKQ 3QIAA 1Y8NB 1VQNA 1BCPD 1QNKA 4JI1L 4DPGA 1TWCB 5IP7H 1Y1WB 1I4QA 1UE7A 4B08A 4DV0L 2F0IA 5K5PA 3MFGA 2O4XA 5GQOA 2Y0SE 2VUMH 4KY5A 1IBMQ 5H1SE 2EYMA 4FYDA 1BUVT 1ZYRD 3T4AC 2PMZB 1PH7A 3MEFA 1V1PB 2R7ZB 3J81i 2L15A 1XMOL 4A3LG 2UXCQ 5BN5A 4IUPA 5CGKA 4KN4C 2JA8G 1LYLA 3A8KE 5ELOA 5L37A 1LTRD 1WVLA 3BVGA 3KDFA 3P20A 1XMQQ 1Y8OB 1ILQA 1SDFA 1VMPA 5NUCA 3K5OA 3LX0A 1VQFA 2WINB 4DV0Q 1QILA 1U4MA 4KMUC 5C44B 1N32L 1BNZA 2YV5A 4DN4M 2EVBA 4JI7L 4DR6Q 4IFDJ 3S14H 1WYDA 1A62A 4R4QA 2ENBA 5M5YH 2K04A 4OL7A 3L0OA 1RIPA 4B9XA 3A8JE 3I8ZA 5IODA 2MNAA 1Y14B 2OEOA 4F88A 1D5XC 3NK9A 4A3JH 3WOEA 2ICIA 1KNEA 4CKEA 3PO3B 1X3PA 1GVPA 1MSHA 1AFPA 3A7AB 1GHKA 4HSVA 2BE5C 5AJ3L 4KN7C 4BY1H 3FPPA 1G291 1IHZA 5I2XA 1I94L 3FDTA 1JJCB 1L2FA 2WFWA 4V0BA 1F9QA 5IIFA 5CR3A 4JI7Q 4EQOA 1WFQA 2B2YC 2CKZB 5IP7G 2QW7A 1S40A 1MKHA 3Q0AA 2LSSA 3BJUA 3UDGA 1BQQT 2VUMG 3U50C 1QZGA 4ZQ3A 2K28A 4DK3C 1EY6A 1TWCH 1Y1WH 1D1KA 1EUJA 2RSOA 4ZCKA 5HGQA 2QDBA 3BVZA 2F0JA 5AJ3Q 3CCLA 1EIYB 2ZT9C 4NPSA 1KDBA 2WP8J 2OTLA 4ZUIA 1XTCD 1K0SA 4MIUA 4DU9A 2F3WA 4TVAB 2H4OA 2C9OA 2R7ZH 1FR3A 3ERSX 3P1HA 4DR2L 1VDZA 2D5DA 1MIUA 2A68D 2Z6KA 1TY2A 3H94A 2D0OA 2F3VA 5EAYA 4PV1C 3KLSA 5ELDA 1IYUA 2KJXA 2A74C 3PMFA 1BBUA 2SDFA 2F0LA 1IYVA 3NQTA 4C2MH 1ESFA 2A69D 2EIFA 4A76A 1S4ZA 1O7ZA 2F0HA 4A3IG 2Q2UA 2ZXOA 1RD9D 2NYZD 1VQLA 3NTHA 3A56A 4KTAA 1NNXA 1STHA 4CGYB 5M3MH 3KJPA 5C4JB 2JA6B 3OPOA 3SR1A 2Q2HA 2F1MA 4K2KA 5C44H 1HUNA 5JAVA 1MJEA 2HIXA 1EZ6A 5GADC 2F0VA 3MVVA 4DR7Q 4X65L 1W6JA 2Q8TA 4IPCA 4Z9CB 1ET6A 2IX1A 3FP9A 4BY1G 3C1EA 1B3AA 2EJFC 5I6WA 1VCIA 4DV7L 1YNNC 4QB4A 5GAHC 1B9MA 2J4XA 1DGSA 2VQEL 1ICWA 1FVIA 3CRLC 1XNQL 2KOLA 1D2BA 1RODA 3DM3A 1NTGA 1QCBD 3PO3H 3RZOB 1L1OA 3ULPA 4JI5Q 4OO1H 3KF8A 1JOKA 1B8AA 1ONLA 2K01A 2VB2X 1KC8C 2LKVA 3MC0B 5IP9H 1X3EA 3VYRA 4OONA 1TS3A 1WD1A 1D5MC 1WJJA 2FMMA 2ASBA 1N33L 3KJOA 4X65Q 3BZCA 1UEBA 1Y1WG 2SNMA 4GKJQ 4CJ0B 2Z9HA 3GTOH 4KHPL 2RA4A 4XT3B 2D62A 2IJ0A 3SK5A 5IGGA 2F52A 1G2SA 3S1NB 2Z8LA 5I9OA 3CP0A 3MXPA 3I4NB 2NUCA 3NBHA 5FLMH 1EYDA 3HS0C 2R7ZG 4JW0A 2R3ZA 1CSPA 1U4LA 3UDFA 2EYFA 5LMNL 4IUNA 4QF4A 4JI3L 1V9PA 1EEID 5KNBA 3BZKA 3O13A 1EL0A 3P75A 1N33Q 5EPLA 4IUTA 2VQFL 2M9VA 5KYLA 1Y8PB 2ID0A 2F3IA 1XPRA 1ZKOA 3TZUA 5M3MG 3J80E 1PA6A 3W5OA 3NBHB 5C44G 4R1JA 2DGYA 2JA5B 4JBKA 4OXPA 3S17H 4K8IA 3CCQA 4YY3L 2XTIA 4UAIA 3MAQA 1YEZA 3EJIA 1PMRA 4HEDA 5LMNQ 5C4JH 2JA6H 3M4QA 5D3IB 2PZTA 4JI3Q 2D2CC 1ML0D 2K32A 5IYDH 1SAPA 2B8GA 4IPGA 2ATWA 3R3OA 4BXXH 1RCVD 1VQJA 5I9PA 1YIJA 4TSSA 3OTOQ 3PO3G 2GA4B 4OO1G 2A1AA 1VQBA 2VZAA 2MGSA 3I55A 4JI6Q 2JN4A 4OIKA 2EDGA 2WAQB 3A54A 4K5WA 5IP9G 4XIGS 4X62L 4DR5L 4JBJA 1VQ8A 2UUCL 3OW7A 1TS2A 4YY3Q 4CBVA 5LMUL 1EQTA 1XNRL 2DN8A 2LMCB 2PI2A 3RZOH 2YTYA 5ISRA 1KHIA 2L12A 3IL8A 2XRSD 2OXPA 1PH5A 3HOUB 3WOFA 1PYSB 1EIGA 5FLMG 4FXKC 2OTJA 3STBD 1X55A 2N55A 5FO8B 1EFID 5ELCA 1II3A 2BOSA 1D7QA 2KENA 3HKZB 5JPMC 1H95A 2K03A 1O7YA 5C5LA 1QWYA 2C35B 1JICA 4FF4A 2E2DC 2F0WA 2F0EA 3S1NH 4X62Q 4MTKA 4DR5Q 3FVQA 3I4NH 2KCCA 2UUCQ 4RKLA 2B2TA 5LMUQ 3GTJB 1R4QB 1XNRQ 1PTOD 4NW2A 4LF4L 1TT2A 2Z4IA 3HEJA 1QNUA 4PG3A 4BBRH 5JJKA 3GTQB 3CAMA 4LUVA 2ZJQA 1CZGA 3VDYA 1CQVA 4P71A 2RF4A 3T16A 5C4XH 4MZ9A 1KXLA 2RDFA 2R93H 3HRZC 1EY4A 2UUAL 2PPBC 5C0XI 2XN9C 2C5CA 1A63A 3R93A 3IFTA 2JA6G 2VW9A 4DV3L 2A6HD 3HFZB 4HR7B 2WV6D 3OWEB 3HOVH 5IYDG 1YJWA 1S72A 2B2VA 2JA5H 4BXXG 1W6KA 2I5LX 5HGTA 1K73C 1B9NA 1TWHB 3RZDB 3CCRA 3NTKA 3HOWB 4CKCA 3CCSA 1B1ZA 1FGUA 2AHOB 5BN4A 4H02A 3NEMA 2A19A 3M9BA 1SXTA 2K14A 4N9PA 3GTGH 4ME3A 1KNAA 1LTSD 4POFA 1VQIA 2UUAQ 2EYPA 4A3FH 2QEJC 3BYTB 1HZ9A 2OF1A 5DM73 2HQEA 4LMQD 2IX3A 4L5QA 2YU9B 1KDAA 4DV3Q 1B2TA 1V43A 2FFKB 1DOMA 4UP8A 3G6EA 1Q86C 4LNQA 3DUZA 4QJFA 1VQ6A 1ZEQX 5LMNW 1JMCA 2AQ3B 4IUUA 3J80L 1SYCA 2CCZA 1Y1VH 3G4SA 1N36Q 2A6EC 1PXUA 3GO5A 3K5NA 1C0AA 4IUQA 1CA5A 4LFBL 4POGA 3TREA 5IYBH 1F9RA 4ZKCB 3I73A 1EQVA 4GOPA 3GTPB 4AIMA 2M00A 1TY0A 4HMIA 4QIWE 5IGFA 1D1IA 1HNWL 3I4NG 3HOZB 5D65A 2PW7A 4YWKA 1J5EL 3HOUH 1B70B 2EY6A 4KD3A 4CDCC 2KCMA 1AP0A 4KHVA 3M85A 1A2UA 4DK1A 4LUZA 1ENFA 4DV5L 4IOAA 4BBRG 3S16B 2JSOA 4HIOA 1BBWA 4K0KL 1S5ED 3TS0A 4KK7A 1TWGB 5C4XG 2B2TC 4FO2A 1ENAA 5I2YA 4UY8C 1YJNA 3E6ZX 3OWFA 2R93G 4JG2A 2O5JC 3GTJH 4O42A 4GOPB 1ZXTA 1HJPA 1I4PA 4APVA 2JXMB 3CC4A 5FOBB 1RTNA 3FKIB 1NR2A 1PYBA 1PZJD 2B29A 4O2DA 3GTQH 3J81j 3S2DB 1NCVA 5EQ0A 5JEAH 3HOVG 2JA5G 1HNWQ 1CKNB 1LTLA 1C7YA 1J5EQ 4N8FA 3K0XA 4A3KB 2EQSA 2HHHL 5FK9C 4DR3Q 4LF5L 2PMZE 2RQXA 2F0OA 1STBA 2RDGA 3K80C 4DV5Q 1CQFA 2PW5A 3PF5A 2QF7A 1QVCA 3SDZA 1A8VA 4K0KQ 2JA7B 1E2VA 2RCNA 4ZK9B 2EYJA 1LO5D 5CBEE 5M5WB 4GLXA 5J39A 2ZTEA 2BA1A 4A3FG 4K6DA 1JOQA 1SEBD 1TWHH 4R4OA 4U68A 4FF3A 1EFWA 1B4OA 3C1FA 1SSOA 2D9UA 3OOCA 3I70A 2CH4W 5KYIA 5JJIA 2DUDA 3J81E 5JVG3 1PZID 3HOWH 2RHSB 1VQ4A 2WAQG 4OWWB 2DY8A 1VQPA 1IL2A 2JP1A 1STNA 1HPCA 1Y1VG 3MFYA 4A3GB 2HHHQ 1VQHA 1HA6A 4LF5Q 2MUYA 1EU4A 3N52A 5LL6S 1BOSA 1F2LA 3VYTA 5IYBG 1UWVA 4QUFA 1EWHA 2R61A 2KEDA 2MJ8A 1DYQA 4EQPA 2YU9H 2I5MX 4R9WA 2OCEA 2VXWA 4G57A 3PV0A 4KI0A 3TBIB 1Q1EA 3HOUG 1GUTA 1ASYA 5J3BA 3A55A 1CFMA 1BBXC 4DR4Q 1QJOA 3RLFA 2EPBA 2RBMA 3HKZG 3VR5A 1IBKL 4GOPC 4A3MG 2KECA 3TMEA 2XGTA 1EQQA 4GKKQ 4K14A 3QWNA 2FMCA 3GTPH 2EJGC 1X9NA 1AEXA 3DMUA 2NVYB 3S2HH 4OWTB 4A3BH 1E7ZA 4IO9A 2NN6H 2NTTA 4HIMA 2BDNA 4HJ7A 4IURA 4R8IA 4X6AH 1LACA 2PCFB 4M1UB 1IBML 3H3VH 2RSNA 4IJLA 1PH6A 2L1BA 3S16H 4UP7A 3DWAA 3RR5A 5JEAG 1EIHA 2CFMA 1MD2D 2B2YA 2X6LA 1V1PA 1PH1A 1Z6HA 4A3EB 2SEBD 1MHWC 2Z0SA 3ZJYC 1CHPD 1XMQL 5CMDA 2ZJRA 3S1MB 2KUMA 1JCKB 3FKIH 5G3LF 2QEXA 1B53A 3TP8A 1UAPA 4TQUS 1JB7A 1JJ2A 4PQXA 1CSQA 2OQKA 3J80c 5CYUA 2Z1CA 3JAME 4A3KH 1WI5A 2XIWA 4XT1B 1FJGQ 1XXGA 2IPKD 5C3EH 3DXJC 4L63B 1HFNA 4UPAA 3HOWG 4V190 1TS4A 4JCVE 1TKWB 4DR6L 2L11A 4DA2A 2PQEA 3I4LA 1Z9FA 2CQOA 5M5WH 3NPPA 1CZWA 4WORA 2K75A 3I3CA 4U673 3F1ZA 3TDQA 4Y7NB 5BN3A 2RDHA 4CHTB 1E0BA 2QILA 4A3GH 2L9HA 3CRKC 4OHJA 4ZUJA 4A3DB 1GUSA 1B7YB 1G2TA 1BDOA 2ZXPA 4NB3A 3L2PA 2ZM6Q 1XPOA 2MFIA 1GKHA 1JJGA 4PMBA 3WWVA 3RN2A 3IKJA 3PUYA 1M8AA 2SNSA 4HJ5A 1LUZA 4DKAC 3RN5A 4A3BG 2NN6G 3H91A 1SYEA 4C3JB 1S5FD 4RHSA 2G5DA 2PO4A 3J7YW 3U58A 5JJLA 4KKSA 3PCOB 1Q8IA 2GVBA 5EBDA 1EWCA 4OWXB 3KUPA 1VQEA 1X3GA 4MHEA 3S15B 1BVSA 5C0XJ 3NHHA 4B3RL 4A93B 1TQOA 1B44D 4DV1L 1EZ8A 3I4MB 2AWNA 2AWOA 5C3WA 1A3TA 1PRTF 3HG9A 1ESRA 2O5IC 3J81L 1LTGD 2AMCB 3FKIG 3K7AB 3TEHB 1A3UA 3TN2A 3K58A 2N88A 2G9DA 2L5TA 3C3LA 1OTCA 4MNOA 4XDXA 2Q2TA 2K5NA 4ILWA 1RL2A 1U9RA 4A3KG 4ZYSA 1VQKA 1PH9A 4A3EH 5C3EG 2IX0A 2F0GA 1EU3A 1A6XA 3BU2A 4DUZL 4L5RC 3HOXB 4B3RQ 4Y52H 1S5CD 4DV1Q 2K5HA 2N3SA 2FJ2A 3BDOA 3M4YA 1HTPA 2JYOA 3ULJA 3R2IA 3HOYB 2I07B 3I91A 3NQIA 5CV6A 1SMXA 5CV4A 3DHQA 1HUMA 5EKKA 3MTSA 2RKSA 5EPJA 4DR7L 2DJGC 1B50A 4A3GG 1K3RA 2F0NA 1X6OA 3ER0A 1K8GA 2XNAC 3T53B 2K5VA 1YZ6A 4KY7A 4DUZQ 4JOIC 1PH8A 2H1EA 1FYCA 3MEHA 2Y0SB 1EY5A 3SXHA 4I65A 5DNFA 4JI5L 1Q90A 2YTXA 5IOCA 2UXDL 5C6AA 4AQYQ 2OT2A 2KCNA 1I3QB 4OO1I 3KLSX 5A35A 1AH9A 1SBBB 4OEMB 4P2CB 3F2BA 4AYBE 3SK6A 1R9TB 1YNJC 4J1MA 1CKOA 3JAML 4A3JG 5E4XA 1WTOA 4BBSB 1BXTA 2CW0C 4GKJL 3I72A 2HDLA 2JJQA 1WTXA 1V1OA 3OSOA 1HR0Q 4OX9Q 4DNIA 2E2IB 4QUCA 4L5TA 2UUBL 3S15H 2HT1A 4F87A 1LT6D 2E75C 3T1YL 4QGUA 4GN4B 3PGZA 4CDFC 3I4MH 1XWEA 2UXDQ 1VF5C 1F2ZA 3SK4A 3F2UA 3D0FA 4A3EG 3I2ZA 1SNOA 4X3KA 5TSSA 4C3IB 3DWPA 5M3FB 1W2BA 3CCUA 2F0PA 3H0GB 3HKZE 3K7AH 3VA5A 1EOVA 4RGNA 1GUOA 3AU7A 4H44C 1SE2A 4WFN3 1GUWA 3AB9A 4LJZC 4WRDA 4R4IA 4UHVA 2KHJA 2PI2E 3QOLA 2UUBQ 4YHHL 3KLWA 1WTRA 5IWAL 1YJ9A 1PRTD 3HOXH 1MJCA 3T1HL 3T1YQ 2OQ0A 1WCMB 1LT5D 4ALPA 3NWTA 2NBFA 3CD6A 2IHEA 4RGOS 2ES2A 4I7ZC 3Q24A 4X3UA 1IKMA 5GROA 3E3XA 4G4KA 2I46A 1HTLD 1Z47A 1JQYD 2DNEA 3CC2A 1IW7D 4YWMA 4B9WA 4CJ2C 4BWGB 3BVMA 1VQAA 3OTOL 1G91A 2A8VA 2EXDA 3PO2B 2ZXRA 4JBMA 4JI6L 1YBYA 3J81c 5CV8A 4K8JA 1AW7A 1BCPB 1O80A 3A7LA 4YHHQ 5IWAQ 3CXCA 4CKBA 3G71A 4LFCQ 3T1HQ 4PZ7A 2HD3A 1HNXL 4FDBA 4EX5A 4X3TA 2G9HD 2SOBA 1WTVA 3ICEA 4R4TA 4J8QA 4OIJA 4FXDA 4LW1A 1JT8A 3BG3A 3Q22A 1T5EA 2YYZA 4DV4L 3UE0A 1QG7A 4NMZA 3FPUB 3I4MG 3CQZB 1EIFA 4BBSH 4JI2L 2VNUD 4RKBA 4ZLTF 1SRUA 3TZDA 1QVGA 2IWHA 3LGJA 3Q8DA 1I6VC 2E2IH 1AE3A 1C4QA 1JWUD 4IPDA 3PF4A 1HFGA 2UXBQ 4IOCA 4XYOA 4L5SA 2NZHA 3DEOA 1HNXQ 1PZKD 4P74A 4HMJA 5COYA 5AFWA 3PQIA 3ULLA 3AFQA 3U9SA 1K3BC 1PVOA 4C3IH 3H0GH 3VR4A 4A75A 4DV4Q 5C4ZA 4H13C 1LTBD 2F0KA 1VF7A 4JI2Q 2F03A 2D0PA 2HDMA 4ZRZA 4PZ8A 4XYQA 1VQOA 3HP3A 2OWOA 2KQ3A 1BCPC 2AUKA 1L0WA 1I4HA 2Z6BA 1U4PA 2K6AA 3JAMc 3MXNB 2PNHA 2V1CC 1I50B 2I0QA 2BE5D 4KJNA 1N34Q 1P16A 3H15A 4HIDA 2E8GA 2MO0A 1NBWA 2FHTA 1ZYRC 3GQBA 4LUOA 2FXQA 3ERQA 1D6EC 1E22A 2Y0SG 1GXDC 3MWYW 1CM9A 4CDDC 2XWBB 3K0YA 4DNRB 3VR2A 1XYIA 2EJMA 3J80i 1HZBA 4YCUA 2K5WA 1GD7A 3AEVA 2PNRC 4IJHA 4WJWA 2PYKA 2J7ZA 5HURA 3GTLB 1N36L 1TXYA 3W1GA 2HIVA 1TIID 4RFBA 1U4RA 2N49A 1TU2B 2WACA 4EGVA 2KHIA 2EOTA 2EZVA 5FO9B 3GTKB 3BZDB 5DM63 1SFOB 3FHWA 2QCPX 3NP8A 3M4OB 3UE1A 1DD2A 2IW3A 1EYGA 1UNSA 4DK0A 2BH2A 4IFDH 4HCSA 2I5HA 5EKIA 3R2TA 4C3IG 5GAEC 1H9RA 3J7ZC 3KF6B 5M9OA 2NVQB 1SR3A 3EN2A 1J6QA 3V05A 3NTIA 2VB3X 3G48A 5C0XH 3Q6SA 4B3SL 4F7XA 3PIPA 1A15A 1UE6A 1CTMA 1S5BD 2L55A 4N9TA 3GV3A 1LTAD 1SE3A 1JOOA 4B3TL 1VQ5A 4DR3L 1CKNA 1RKNA 2JA9A 1I4XA 3W2DA 3BDCA 4KY6A 2ALYB 1O7IA 4IQZA 4PZ6A 2Z4HA 2O2LD 2NVXB 2F0UA 5IGCA 1YNND 4RH6A 4GNXB 1SJHD 4QL5A 2TMPA 4LFAQ 4DXGA 4E6IA 3CCEA 3G6JB 2JQOA 1BCPF 1AN8A 3EFXD 4B3SQ 4PMWA 1J9OA 2XRQD 1OXSC 2K52A 4EQNA 4DF7A 1K8OA 1IL8A 3GV6A 3PIOA 4L8JA 1NR4A 4B3TQ 3KLRA 2A68C 5T1GA 3QB3A 2ZTDA 1MGSA 1SMYD 2VS1A 4J6HA 3BDLA 3K57A 4IZ8A 1G6PA 3PIP3 3RD4A 1JR0D 1AE2A 5GAGC 2K1BA 1JWMD 2A69C 5K36H 1VMCA 2KEEA 5FLXE 3GTLH 4DR4L 2JK8A 4MN3A 3RZDH 2VY3A 3ND9A 2N8NA 4LF7Q 4LF8Q 1YVCA 3J7AV 4K5XA 2A5HA 4IFDG 4GKKL 5DLQE 4JI8Q 3GTKH 5JPNC 3V96A 3ITPA 3I4OA 4LF9Q 1F77A 1SFOH 1DJRD 1DOKA 3MXGA 3I56A 2NZOA 1TWAB 5E7NA 2EY2A 5C0XG 3E0EA 3C2PA 2NN6I 3M4OH 1PYWD 1N8RC 3H3VI 3M7GA 2B63B 4KKUA 2DY7A 2CWAA 1KAAA 1NY4A 1GUNA 1UE5A 1I5FA 4TKOB 3PIO3 2LY7A 4GNXC 1E1OA 1STEA 2HUGA 2NVQH 3CCVA 2KVMA 3F2CA 4DK6C 1IKLA 4JV5L 4P75A 4BY7B 1IXRA 5J1ZA 3UDIA 4DNTB 3D6WA 4A3IB 3K8AA 1PLFA 2R92B 3HOZH 3TQYA 1KTKA 1EY8A 1SROA 5DAUA 5C4HA 1F9SA 4C56C 1FJGL 3TP6A 4XQJA 4RMFA 4I7AA 4IN3A 3AMUA 4QCLA 1EY9A 1NMGA 1PDQA 2NVXH 2MQHA 1SNPA 2KBNA 3RLNA 3E5SA 2V4DA 1D8LA 1TWGH 1KL9A 3S1RB 2EY5A 3BYYB 1O7LA 5A2QE 3FMCA 3D31A 2KHSA 4Q0FA 4QIWB 4JV5Q 3CU7A 3VA7A 2FINB 1LM0A 3CCJA 1BO0A 1QVFA 3OW2A 4JI0Q 3QG1A 3DEPA 3S2DH 5K36G 4JI4L 1EQRA 2WKDA 2B2WC 5JJZA 1LT4D 4ODGA 3OYYA 4DXFA 2ZM6L 4K6LA 1QUQB 3A74A 1CK1A 1XJVA 1L0YB 1EWIA 2XVSA 3LWEA 2JA7H 2WB1B 1OXUA 1WTQA 2AQ1B 2B2UC 5EBCA 3KBXA 1PTOB 4DV2L 2H5XA 3TS2A 3HKSA 2HQLA 3CW2C 1E1TA 4YCVA 1Q81C 1VQ7A 1M1KC 4JOIA 1IBLL 4JI4Q 4JVZA 1VQCA 1A3VA 3RMHA 2QA4A 1TWAH 2TSSA 4HJ9A 2JEAI 3VYUA 3Q23A 2IT1A 1QB5D 1HNZQ 3CKIB 5KIXA 2E2HB 4MTNA 2VL6A 4P73A 1H9JA 4ULLA 4C2MB 2B63H 4S3SA 4IPHA 1OO9B 4JI1Q 1V1QA 3HOZG 4DV2Q 2Q8RE 2KCTA 1U0LA 5M3MB 1KQSA 1EYAA 4DAPA 4BY7H 1JWSD 5FLXL 4A3CH 3EBEA 1Z7TA 1WTWA 1IBLQ 4WJ3M 5IT9E 2NVYH 1LABA 1XMOQ 3STBC 4A3IH 1AZPA 4HAEA 4DAVA 2R92H 1HA5A 4LWCA 1PFMA 5KEEA 2K33A 1LTID 3KDFB 1EYCA 2Q8IB 1ICFB 3QR8A 3HZXA 2E5LL 4KLKA 1KLUD 4R4CA 5D14A 4FNFA 2A6ED 1CT1D 1C9OA 1F9PA 1SN8A 3QJYA 4H7BA 2A73B 1PTOC 1XX8A 1TR5A 1SYBA 1O78A 2F0FA 3S1RH 3K81C 1QE6A 4G7OC 5ELNA 4QMGA 1GO3E 3NBIA 3CPFA 1N32Q 5LL6X 3EIVA 3S1MH 5HY6A 2GN5A 1PH3A 2CQAA 3D4WA 3OIQA 2JA7G 1HHVA 3QOJA 1X32A 1UEAB 5C5MA 2NVTB 4AQYL 3GTOB 1XTDA 5C3XA 3JAMi 4GN3B 3EQLC 1X65A 2A6HC 3KFUA 2E5LQ 1QZHA 1KIXA 4C3HB 5EJWA 1ASZA 3D8GA 1VQ9A 1PTOH 4DV6L 1S5DD 1KAWA 5IY0A 1HR0L 1ILPA 5JEAJ 1C8CA 4OX9L 3PUWA 2K50A 5G3LD 5IYCH 2CVRA 1EY7A 1I94Q 1L0XB 1T5XD 1SJED 2AKWB 2B63G 4Y7NH 4K5VA 1LLRD 5A2QL 1OXTA 2IL8A 4H0LC 3HGBA 3KK7A 3S9WA 1W3SA 3M4PA 3AQQA 1TVXA 3S1QB 1K0RA 3W1BA 1Q3LA 3L3OC 4A3DH 3A5ZB 2F4VL 3GTMB 1HZCA 5T1IA 2ICEC 4BY7G 2E2HH 3M3YB 3RLOA 3PUZA 4A3CG 3S17B 1HXYD 3UDXA 3H09A 1KLGD 1EOTA 1D5ZC 1V8QA 2WAQE 1GJXA 3A0JA 2R92G 4DV6Q 1IYJB 5KRUA 1K28A 4LAAA 2EYOA 4NDXA 4C3JH 3NUCA 3QO2A 4FF2A 3E9IA 1SYDA 2Q2IA 1TWFB 3KOJA 1X56A 4A93H 2R7DA 3F8TA 1WD0A 4KV6A 1JC7A 1LT3D 1SNDA 3SHLA 2ZTCA 4DR2Q 5ELBA 2EE1A 1BKBA 2LXJA 3PSIA 1JB3A 1CA6A 3S24A 3D4RA 2F4IA 2ZJPA 2EXZA 5DEHA 2L0CA 4F8MA 2F4VQ 2BCOA 5J22A 1KRSA 1Q82C 1G51A 3E9HA 5EGTA 1B3QA 1CKMA 2E2JB 5BR8L 1GHJA 5KGUA 5D3DA 1YNXA 1JE5A 1DONA 4FF1A 1JORA 4GLVB 1QOHA 1PTOF 1A0IA 1VQGA 1HZAA 3K5LA 1Q46A 5E4WC 4DAYA 4LFCL 2JE6I 4K2LA 4DGZA 2WB1G 1CI3M 5M5XB 2QDLA 3AYHB 4RGTA 2NVTH 1TS5A 3HOYH 3NELA 5IYCG 1SMYC 4O1NA 5IT9L 3VR6A 4DV7Q 1SYFA 1Q1BA 1RHPA 5FLXc 1WOCA 5I4DA 2VQEQ 1XNQQ 5JOBA 5JVH3 1L1OB 1CUKA 3CPWA 1PHJA 3KF8B 3X3NA 4C3HH 2K5QA 2QGQA 1FNVA 2NB0A 5BR8Q 2MP1A 4BBRB 2B3GA 4DAYB 4A3DG 3KBGA 4JK1C 5ELEA 5FKAC 1HQRD 4ZKBB 2UXBL 1WTPA 5C4XB 4RAUC 4XQNA 3D6CA 4EQ5A 2NTSA 2LS01 4HCEA 4KKTA 2R93B 1G8ZD 1VQDA 2Z6KC 2QKIC 2CH4A 3IAYA 4C3JG 4KHPQ 3S1QH 1I3QH 3GDEA 4GN5A 1K9MC 4XQQA 2PQAA 1PFSA 3GTMH 3HOVB 1K8MA 1YITA 5KNCA 1R9TH 3M3YH 1HH2P 4OGQC 4A93G 3SE0A 2LFNA 4P72A 3PUVA 4XXEA 2AQ2B 5IGDA 4DAMA 5CV7A 1RF2D 1BR9A 4IALA 4UDUC 3U4ZA 3CMAA 2IHFA 3OMGA 2PZUA 3L9AX
chains in the Genus database with same CATH topology
1NE3A 1TWFH 2ALYB 1O7IA 4TQUS 1JB7A 3J7A5 1YHBA 4PZ6A 2R6GA 1JJ2A 1CSQA 1BBUA 1UE1A 2OQKA 3IRBA 2VQFQ 3J80c 4C2MH 4A3KH 1N34L 1WI5A 4GNXB 2PQAB 4QL5A 2EIFA 4A76A 1FJGQ 3JC66 5C3EH 1PH4A 2RHQB 4LFAQ 3CCEA 4A3IG 2Q2UA 1VQLA 2JQOA 1Q8KA 4UPAA 5M3FH 3HOWG 4B3SQ 4PMWA 5M3MH 4JBWA 3KJPA 1HR0W 4JCVE 3HOXG 4DR6L 1OXSC 2K52A 1Z9FA 2CQOA 2Q2HA 5C44H 5M5WH 3PIOA 1MJEA 1E24A 2HIXA 1L1OC 5GADC 2E2JH 2N78A 2IY5B 3HOYG 4B3TQ 4DR7Q 4X65L 2K75A 4IPCA 1KD1C 3CF5A 4YWLA 2IX1A 3F1ZA 1M90C 3FP9A 5FJ8H 2ZTDA 4BY1G 2VS1A 1G6PA 1VCIA 1NMFA 2BH8A 4DV7L 2CWPA 1VS0A 1K8AC 1WCMH 1AE2A 5M5XH 4A3GH 5GAHC 5GAGC 1DGSA 2VQEL 1XNQL 1FVIA 3U4VA 1B7YB 3GTLH 4NB3A 3L2PA 3DM3A 2ZM6Q 2JK8A 1NTGA 3DLLA 1XPOA 2MFIA 4DR4L 3PO3H 1L1OA 1GKHA 3ULPA 2VY3A 3RZDH 4JI5Q 1JJGA 1B8AA 3WWVA 2N8NA 4LF7Q 3RN2A 4LF8Q 2R7FA 3PUYA 1YI2A 4HJ5A 1LUZA 1YVCA 2K4KA 3SGIA 4DKAC 3RN5A 1KC8C 2UU9L 4A3BG 5DLQE 4GKKL 4IFDG 4JI8Q 2NN6G 1X3EA 5IP9H 3GTKH 4OONA 3I4OA 4LF9Q 3PO2H 1WJJA 5JJLA 3U58A 3PCOB 1SFOH 2GVBA 2ASBA 4DUYL 1N33L 4OWXB 3I56A 2NZOA 4X65Q 1VQEA 1X3GA 3BZCA 3KJOA 5E7NA 1UEBA 1Y1WG 1BVSA 5C0XJ 4IFDI 4GKJQ 5C0XG 3E0EA 4XTCS 2NN6I 3M4OH 3GTOH 4B3RL 4KHPL 2D62A 4DV1L 1NJIC 2AWNA 2AWOA 2F52A 1N8RC 3H3VI 4AH6A 4BBSG 3KF6A 3CP0A 1OXXK 2CWAA 1NY4A 1UE5A 4X66L 5FLMH 1I5FA 2R7ZG 3KYHC 2AMCB 4GNXC 1E1OA 2NVQH 3K7UC 4O0AA 3FKIG 3TEHB 3CCVA 3F2CA 4DK6C 1CSPA 3UDFA 4DR1L 5LMNL 4P75A 4JV5L 1OTCA 4MNOA 2UU9Q 1IXRA 2Q2TA 3CQZH 4JI3L 2K5NA 3UDIA 1V9PA 1RL2A 4A3KG 4KHZA 3BZKA 1PH9A 1VQKA 4LF4Q 4A3EH 4DUYQ 5C3EG 3K8AA 2VQFL 2IX0A 1N33Q 3HOZH 3TQYA 1SROA 2ID0A 3BU2A 4DUZL 4L5RC 5M3FG 1FJGL 2F3IA 5IT9c 1XPRA 5M3MG 4B3RQ 3H0GG 4Y52H 4RMFA 4LFAL 4DV1Q 3TRZA 2K5HA 2N3SA 4QY7A 3W5OA 4GNXA 1PA6A 3NBHB 5C44G 4R1JA 3RNUA 1NMGA 1PV4A 2NVXH 2MQHA 2DGYA 3ULJA 1KRTA 2KBNA 4WJ4A 3RLNA 4JBKA 4OXPA 3S17H 4X66Q 3CCQA 1SMXA 3CCMA 4YY3L 1D8LA 1TWGH 2XTIA 1KL9A 1YEZA 2LXKA 5FJ8G 3D31A 4DR1Q 5LMNQ 4DR7L 4JV5Q 5C4JH 2JA6H 3M4QA 1LM0A 1SE8A 3CCJA 1QVFA 4NXNL 4JI3Q 3F2DA 3OW2A 1WCMG 4JI0Q 4A3GG 5IYDH 1K3RA 4HIKA 1X6OA 3S2DH 4IPGA 2ATWA 3ER0A 1K8GA 1EQRA 1E3PA 4JI4L 5K36G 4BXXH 1VQJA 1Q7YC 4YCWA 2K5VA 1YZ6A 1YIJA 4DUZQ 4NXML 3OTOQ 3PO3G 4JOIC 4OO1G 2A1AA 1PH8A 4JYAL 2BA0A 1VQBA 2VZAA 3OYYA 3I55A 4JI6Q 2ZM6L 1QUQB 3A74A 3NENA 1FL0A 1XJVA 5IP9G 4JI5L 1EWIA 4XIGS 2YTXA 2UXDL 4X62L 4DR5L 1I50H 1OXVA 4LF8L 4LF7L 1XPUA 4AQYQ 2JA7H 3PO2G 1OXUA 4JBJA 1PH2A 4OO1I 1AH9A 1VQ8A 2UUCL 4JI8L 4YY3Q 5LMUL 4DV2L 4A3MH 1X3FA 2H5XA 1XNRL 4LF9L 3F2BA 3TS2A 2PI2A 3HKSA 4AYBE 2MO1A 3CC7A 3RZOH 1CKOA 2HQLA 3CW2C 4A3JG 1E1TA 1YHAA 4YCVA 3PUXA 1Q81C 1IZ6A 1VQ7A 4GKJL 2YTYA 1M1KC 1KHIA 5IE8A 4NXNQ 1Q12A 1GM5A 4JOIA 4RG1A 2JJQA 4LFBQ 1IBLL 1PH5A 1PYSB 2WB1E 5FLMG 1HR0Q 4OX9Q 4JI4Q 4DNIA 2OTJA 1K83H 3STBD 1X55A 1N9WA 4L5TA 1VQCA 2UUBL 2QA4A 1TWAH 4HJ9A 2JEAI 1D7QA 3S15H 2KENA 4NXMQ 2HT1A 1H95A 4JYAQ 2IT1A 4LF6L 1HNZQ 3GD7A 3T1YL 4MTNA 2C35B 2VL6A 3PGZA 4GN4B 4QGUA 4P73A 3I4MH 4BA2I 3S1NH 2B63H 2UXDQ 4X62Q 4DR5Q 4IPHA 3D0FA 4A3EG 3I2ZA 3I4NH 3I7FA 1V1QA 4JI1Q 3CMEA 2UUCQ 5LMUQ 3HOZG 4DV2Q 2KCTA 1U0LA 1XNRQ 1W2BA 3CCUA 1X54A 3HKZE 1KQSA 3K7AH 4LF4L 4QQBX 4PG3A 1EOVA 4BBRH 5JJKA 4BY7H 3CAMA 4LUVA 4HJAA 2ZJQA 3VDYA 4P71A 3EBEA 2RF4A 1S3OA 4A3CH 4UP9A 3AFPA 1IBLQ 4WJ3M 5C4XH 4AYBG 2NVYH 4R4IA 2PI2E 2KHJA 4MZ9A 3STBC 4X64L 4A3IH 1XMOQ 1KXLA 2R93H 2UUBQ 2UUAL 2R92H 4YHHL 3KLWA 4LWCA 5C0XI 5IWAL 1A63A 3KDFB 3HOXH 1YJ9A 4A3LH 4LF6Q 2JA6G 1MJCA 3T1HL 3T1YQ 2VW9A 2OQ0A 4DV3L 1VQMA 3HFZB 4ALPA 3CD6A 2IHEA 4BA1I 2JA8H 2E5LL 3HOVH 5IYDG 4KLKA 1YJWA 1S72A 2ES2A 1U5KA 4R4CA 2JA5H 4BXXG 4B3ML 2I5LX 1C9OA 1SN8A 5GROA 1K73C 4JI0L 1Z47A 3S1RH 3CCRA 3CC2A 4YWMA 3K81C 5ELNA 1GO3E 3CPFA 1I6HH 1N32Q 3EIVA 1VQAA 4GS3A 3OTOL 3CCSA 3S1MH 1SLJA 5HY6A 2GN5A 2EXDA 1FGUA 1PH3A 2AHOB 2A8VA 2JA7G 4H02A 2GVAA 3NEMA 4JBMA 2A19A 3M9BA 2YTVA 4J15A 1P8LA 2K14A 1YBYA 4JI6L 3J81c 4X64Q 3GTGH 4ME3A 4POFA 4HJ8A 1VQIA 2UUAQ 4A3FH 4YHHQ 3L7ZC 4A4IA 4AQYL 1HZ9A 1QUQA 5IWAQ 3CXCA 1XTDA 3G71A 4LFCQ 3JAMi 3M7NA 4GN3B 4L5QA 3T1HQ 4PZ7A 1HNXL 4DV3Q 1V43A 1X65A 4FDBA 1Q86C 4UP8A 4EX5A 3G6EA 4LNQA 3KFUA 2E5LQ 4QJFA 1QZHA 1YHQA 5LMNW 1VQ6A 1KIXA 1JMCA 3ICEA 1ASZA 2CCZA 1Y1VH 4JC0A 4R4TA 3G4SA 1N36Q 1VQ9A 4B3MQ 3GO5A 1C0AA 4DV6L 1T9HA 4LFBL 4LW1A 1KAWA 5IY0A 1JT8A 1HR0L 4POGA 3TREA 2YYZA 5IYBH 5JEAJ 4OX9L 2JEBI 3PUWA 2K50A 4GLAC 3UE0A 4DV4L 5IYCH 2UXCL 1I94Q 4GOPA 3I4MG 1EIFA 3B6YA 4BBSH 4JI2L 2VNUD 2AKWB 4AIMA 2B63G 4Y7NH 4QIWE 1SRUA 1HNZL 1HNWL 1QVGA 3A5UA 3I4NG 1OXTA 3LGJA 4YWKA 1J5EL 3Q8DA 3HOUH 1IBKQ 1B70B 2E2IH 1AE3A 1W3SA 3M4PA 3AQQA 2KCMA 4IPDA 3M85A 1VQNA 3PF4A 2UXBQ 1K0RA 4JI1L 4DPGA 4LUZA 3W1BA 5IP7H 4IOCA 4DV5L 4IOAA 4BBRG 2NZHA 3A5ZB 4L5SA 1UE7A 2F4VL 4BY7G 1HZCA 4A3DH 1HNXQ 4HIOA 2E2HH 1BBWA 4DV0L 4P74A 4K0KL 3RLOA 3PUZA 3TS0A 4A3CG 5GQOA 2Y0SE 3UDXA 2VUMH 3ULLA 5C4XG 1IBMQ 3AFQA 5H1SE 4UY8C 2WAQE 1YJNA 3A0JA 2R92G 2R93G 4JG2A 4DV6Q 3GTJH 1PVOA 1IYJB 4C3IH 4GOPB 3MEFA 4C3JH 1HJPA 1PH7A 4APVA 3J81i 3H0GH 4A75A 3CC4A 2L15A 4DV4Q 1XMOL 4A3LG 2UXCQ 3E9IA 1PYBA 2Q2IA 2B29A 3KOJA 4JI2Q 4O2DA 3GTQH 2JA8G 1LYLA 3J81j 5ELOA 3HOVG 1X56A 4A93H 2R7DA 3F8TA 2JA5G 2D0PA 1HNWQ 1CKNB 1LTLA 1C7YA 1J5EQ 4PZ8A 2ZTCA 3K0XA 3KDFA 2EQSA 1VQOA 1XMQQ 4DR2Q 4DR3Q 2HHHL 4LF5L 1BKBA 2LXJA 3PSIA 2OWOA 2PMZE 3S24A 1L0WA 2ZJPA 1VQFA 4DV5Q 3K80C 3JAMc 3PF5A 3MXNB 2F4VQ 2PNHA 2V1CC 1QVCA 4DV0Q 1A8VA 4K0KQ 2I0QA 1KRSA 1N34Q 2RCNA 1P16A 1Q82C 3H15A 1G51A 1N32L 4HIDA 2E8GA 3E9HA 2MO0A 1NBWA 2YV5A 4GLXA 2ZTEA 2BA1A 1CKMA 4A3FG 5BR8L 1YNXA 1JE5A 1TWHH 4JI7L 4R4OA 4LUOA 1EFWA 2FXQA 4GLVB 4DR6Q 4IFDJ 3S14H 1A0IA 1E22A 1WYDA 1VQGA 1A62A 1HZAA 2Y0SG 4R4QA 5JJIA 2DUDA 3HOWH 2RHSB 1VQ4A 2WAQG 1Q46A 5M5YH 4OWWB 4LFCL 2JE6I 1VQPA 1IL2A 3L0OA 1Y1VG 2WB1G 1RIPA 3J80i 2HHHQ 1HZBA 1VQHA 2MNAA 4YCUA 3AYHB 4LF5Q 1Y14B 1GD7A 3AEVA 4IJHA 2NVTH 5IYBG 1UWVA 3HOYH 4A3JH 3NELA 1N36L 5IYCG 1TXYA 3W1GA 2HIVA 1GVPA 4DV7Q 2YU9H 2N49A 2I5MX 2KHIA 1Q1BA 5AJ3L 2OCEA 4BY1H 5FLXc 1WOCA 3PV0A 1G291 4KI0A 1I94L 1Q1EA 2VQEQ 1XNQQ 3HOUG 1L1OB 1CUKA 3CPWA 1PHJA 1JJCB 1L2FA 2WFWA 3KF8B 4C3HH 1ASYA 5J3BA 4DR4Q 2QGQA 5BR8Q 3RLFA 4JI7Q 3HKZG 1WFQA 2CKZB 2B3GA 5IP7G 1S40A 4GOPC 3FHWA 4DAYB 1IBKL 1MKHA 4A3MG 4A3DG 1EQQA 2LSSA 2XGTA 4GKKQ 3UE1A 3BJUA 3UDGA 2UXBL 3GTPH 1X9NA 1EYGA 2BH2A 2VUMG 3S2HH 3U50C 4EQ5A 4OWTB 4A3BH 1E7ZA 1QZGA 4IO9A 1VQDA 2Z6KC 2I5HA 4HIMA 4HJ7A 5GAEC 4DK3C 4KHPQ 4X6AH 3H3VH 1IBML 3S1QH 1I3QH 3J7ZC 3KF6B 3GDEA 4GN5A 4IJLA 1SR3A 3EN2A 1J6QA 1TWCH 1Y1WH 1K9MC 2PQAA 1EUJA 1PFSA 3G48A 5HGQA 1PH6A 3S16H 4UP7A 4B3SL 3PIPA 3GTMH 1YITA 3RR5A 5JEAG 5AJ3Q 1R9TH 3CCLA 1HH2P 2CFMA 1EIYB 3M3YH 1UE6A 4A93G 4NPSA 2WP8J 1PH1A 2OTLA 4P72A 3PUVA 4DAMA 4TVAB 4B3TL 2Z0SA 3ZJYC 1VQ5A 2R7ZH 1XMQL 3ERSX 2ZJRA 4DR2L 3U4ZA 3CMAA 4DR3L 1MIUA 2Z6KA 3FKIH 1CKNA 2D0OA 2IHFA 5EAYA 2JA9A 2QEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NE3 A;  1TWF H;  2ALY B;  1O7I A;  4TQU S;  1JB7 A;  3J7A 5;  1YHB A;  4PZ6 A;  2R6G A;  1JJ2 A;  1CSQ A;  1BBU A;  1UE1 A;  2OQK A;  3IRB A;  2VQF Q;  3J80 c;  4C2M H;  4A3K H;  1N34 L;  1WI5 A;  4GNX B;  2PQA B;  4QL5 A;  2EIF A;  4A76 A;  1FJG Q;  3JC6 6;  5C3E H;  1PH4 A;  2RHQ B;  4LFA Q;  3CCE A;  4A3I G;  2Q2U A;  1VQL A;  2JQO A;  1Q8K A;  4UPA A;  5M3F H;  3HOW G;  4B3S Q;  4PMW A;  5M3M H;  4JBW A;  3KJP A;  1HR0 W;  4JCV E;  3HOX G;  4DR6 L;  1OXS C;  2K52 A;  1Z9F A;  2CQO A;  2Q2H A;  5C44 H;  5M5W H;  3PIO A;  1MJE A;  1E24 A;  2HIX A;  1L1O C;  5GAD C;  2E2J H;  2N78 A;  2IY5 B;  3HOY G;  4B3T Q;  4DR7 Q;  4X65 L;  2K75 A;  4IPC A;  1KD1 C;  3CF5 A;  4YWL A;  2IX1 A;  3F1Z A;  1M90 C;  3FP9 A;  5FJ8 H;  2ZTD A;  4BY1 G;  2VS1 A;  1G6P A;  1VCI A;  1NMF A;  2BH8 A;  4DV7 L;  2CWP A;  1VS0 A;  1K8A C;  1WCM H;  1AE2 A;  5M5X H;  4A3G H;  5GAH C;  5GAG C;  1DGS A;  2VQE L;  1XNQ L;  1FVI A;  3U4V A;  1B7Y B;  3GTL H;  4NB3 A;  3L2P A;  3DM3 A;  2ZM6 Q;  2JK8 A;  1NTG A;  3DLL A;  1XPO A;  2MFI A;  4DR4 L;  3PO3 H;  1L1O A;  1GKH A;  3ULP A;  2VY3 A;  3RZD H;  4JI5 Q;  1JJG A;  1B8A A;  3WWV A;  2N8N A;  4LF7 Q;  3RN2 A;  4LF8 Q;  2R7F A;  3PUY A;  1YI2 A;  4HJ5 A;  1LUZ A;  1YVC A;  2K4K A;  3SGI A;  4DKA C;  3RN5 A;  1KC8 C;  2UU9 L;  4A3B G;  5DLQ E;  4GKK L;  4IFD G;  4JI8 Q;  2NN6 G;  1X3E A;  5IP9 H;  3GTK H;  4OON A;  3I4O A;  4LF9 Q;  3PO2 H;  1WJJ A;  5JJL A;  3U58 A;  3PCO B;  1SFO H;  2GVB A;  2ASB A;  4DUY L;  1N33 L;  4OWX B;  3I56 A;  2NZO A;  4X65 Q;  1VQE A;  1X3G A;  3BZC A;  3KJO A;  5E7N A;  1UEB A;  1Y1W G;  1BVS A;  5C0X J;  4IFD I;  4GKJ Q;  5C0X G;  3E0E A;  4XTC S;  2NN6 I;  3M4O H;  3GTO H;  4B3R L;  4KHP L;  2D62 A;  4DV1 L;  1NJI C;  2AWN A;  2AWO A;  2F52 A;  1N8R C;  3H3V I;  4AH6 A;  4BBS G;  3KF6 A;  3CP0 A;  1OXX K;  2CWA A;  1NY4 A;  1UE5 A;  4X66 L;  5FLM H;  1I5F A;  2R7Z G;  3KYH C;  2AMC B;  4GNX C;  1E1O A;  2NVQ H;  3K7U C;  4O0A A;  3FKI G;  3TEH B;  3CCV A;  3F2C A;  4DK6 C;  1CSP A;  3UDF A;  4DR1 L;  5LMN L;  4P75 A;  4JV5 L;  1OTC A;  4MNO A;  2UU9 Q;  1IXR A;  2Q2T A;  3CQZ H;  4JI3 L;  2K5N A;  3UDI A;  1V9P A;  1RL2 A;  4A3K G;  4KHZ A;  3BZK A;  1PH9 A;  1VQK A;  4LF4 Q;  4A3E H;  4DUY Q;  5C3E G;  3K8A A;  2VQF L;  2IX0 A;  1N33 Q;  3HOZ H;  3TQY A;  1SRO A;  2ID0 A;  3BU2 A;  4DUZ L;  4L5R C;  5M3F G;  1FJG L;  2F3I A;  5IT9 c;  1XPR A;  5M3M G;  4B3R Q;  3H0G G;  4Y52 H;  4RMF A;  4LFA L;  4DV1 Q;  3TRZ A;  2K5H A;  2N3S A;  4QY7 A;  3W5O A;  4GNX A;  1PA6 A;  3NBH B;  5C44 G;  4R1J A;  3RNU A;  1NMG A;  1PV4 A;  2NVX H;  2MQH A;  2DGY A;  3ULJ A;  1KRT A;  2KBN A;  4WJ4 A;  3RLN A;  4JBK A;  4OXP A;  3S17 H;  4X66 Q;  3CCQ A;  1SMX A;  3CCM A;  4YY3 L;  1D8L A;  1TWG H;  2XTI A;  1KL9 A;  1YEZ A;  2LXK A;  5FJ8 G;  3D31 A;  4DR1 Q;  5LMN Q;  4DR7 L;  4JV5 Q;  5C4J H;  2JA6 H;  3M4Q A;  1LM0 A;  1SE8 A;  3CCJ A;  1QVF A;  4NXN L;  4JI3 Q;  3F2D A;  3OW2 A;  1WCM G;  4JI0 Q;  4A3G G;  5IYD H;  1K3R A;  4HIK A;  1X6O A;  3S2D H;  4IPG A;  2ATW A;  3ER0 A;  1K8G A;  1EQR A;  1E3P A;  4JI4 L;  5K36 G;  4BXX H;  1VQJ A;  1Q7Y C;  4YCW A;  2K5V A;  1YZ6 A;  1YIJ A;  4DUZ Q;  4NXM L;  3OTO Q;  3PO3 G;  4JOI C;  4OO1 G;  2A1A A;  1PH8 A;  4JYA L;  2BA0 A;  1VQB A;  2VZA A;  3OYY A;  3I55 A;  4JI6 Q;  2ZM6 L;  1QUQ B;  3A74 A;  3NEN A;  1FL0 A;  1XJV A;  5IP9 G;  4JI5 L;  1EWI A;  4XIG S;  2YTX A;  2UXD L;  4X62 L;  4DR5 L;  1I50 H;  1OXV A;  4LF8 L;  4LF7 L;  1XPU A;  4AQY Q;  2JA7 H;  3PO2 G;  1OXU A;  4JBJ A;  1PH2 A;  4OO1 I;  1AH9 A;  1VQ8 A;  2UUC L;  4JI8 L;  4YY3 Q;  5LMU L;  4DV2 L;  4A3M H;  1X3F A;  2H5X A;  1XNR L;  4LF9 L;  3F2B A;  3TS2 A;  2PI2 A;  3HKS A;  4AYB E;  2MO1 A;  3CC7 A;  3RZO H;  1CKO A;  2HQL A;  3CW2 C;  4A3J G;  1E1T A;  1YHA A;  4YCV A;  3PUX A;  1Q81 C;  1IZ6 A;  1VQ7 A;  4GKJ L;  2YTY A;  1M1K C;  1KHI A;  5IE8 A;  4NXN Q;  1Q12 A;  1GM5 A;  4JOI A;  4RG1 A;  2JJQ A;  4LFB Q;  1IBL L;  1PH5 A;  1PYS B;  2WB1 E;  5FLM G;  1HR0 Q;  4OX9 Q;  4JI4 Q;  4DNI A;  2OTJ A;  1K83 H;  3STB D;  1X55 A;  1N9W A;  4L5T A;  1VQC A;  2UUB L;  2QA4 A;  1TWA H;  4HJ9 A;  2JEA I;  1D7Q A;  3S15 H;  2KEN A;  4NXM Q;  2HT1 A;  1H95 A;  4JYA Q;  2IT1 A;  4LF6 L;  1HNZ Q;  3GD7 A;  3T1Y L;  4MTN A;  2C35 B;  2VL6 A;  3PGZ A;  4GN4 B;  4QGU A;  4P73 A;  3I4M H;  4BA2 I;  3S1N H;  2B63 H;  2UXD Q;  4X62 Q;  4DR5 Q;  4IPH A;  3D0F A;  4A3E G;  3I2Z A;  3I4N H;  3I7F A;  1V1Q A;  4JI1 Q;  3CME A;  2UUC Q;  5LMU Q;  3HOZ G;  4DV2 Q;  2KCT A;  1U0L A;  1XNR Q;  1W2B A;  3CCU A;  1X54 A;  3HKZ E;  1KQS A;  3K7A H;  4LF4 L;  4QQB X;  4PG3 A;  1EOV A;  4BBR H;  5JJK A;  4BY7 H;  3CAM A;  4LUV A;  4HJA A;  2ZJQ A;  3VDY A;  4P71 A;  3EBE A;  2RF4 A;  1S3O A;  4A3C H;  4UP9 A;  3AFP A;  1IBL Q;  4WJ3 M;  5C4X H;  4AYB G;  2NVY H;  4R4I A;  2PI2 E;  2KHJ A;  4MZ9 A;  3STB C;  4X64 L;  4A3I H;  1XMO Q;  1KXL A;  2R93 H;  2UUB Q;  2UUA L;  2R92 H;  4YHH L;  3KLW A;  4LWC A;  5C0X I;  5IWA L;  1A63 A;  3KDF B;  3HOX H;  1YJ9 A;  4A3L H;  4LF6 Q;  2JA6 G;  1MJC A;  3T1H L;  3T1Y Q;  2VW9 A;  2OQ0 A;  4DV3 L;  1VQM A;  3HFZ B;  4ALP A;  3CD6 A;  2IHE A;  4BA1 I;  2JA8 H;  2E5L L;  3HOV H;  5IYD G;  4KLK A;  1YJW A;  1S72 A;  2ES2 A;  1U5K A;  4R4C A;  2JA5 H;  4BXX G;  4B3M L;  2I5L X;  1C9O A;  1SN8 A;  5GRO A;  1K73 C;  4JI0 L;  1Z47 A;  3S1R H;  3CCR A;  3CC2 A;  4YWM A;  3K81 C;  5ELN A;  1GO3 E;  3CPF A;  1I6H H;  1N32 Q;  3EIV A;  1VQA A;  4GS3 A;  3OTO L;  3CCS A;  3S1M H;  1SLJ A;  5HY6 A;  2GN5 A;  2EXD A;  1FGU A;  1PH3 A;  2AHO B;  2A8V A;  2JA7 G;  4H02 A;  2GVA A;  3NEM A;  4JBM A;  2A19 A;  3M9B A;  2YTV A;  4J15 A;  1P8L A;  2K14 A;  1YBY A;  4JI6 L;  3J81 c;  4X64 Q;  3GTG H;  4ME3 A;  4POF A;  4HJ8 A;  1VQI A;  2UUA Q;  4A3F H;  4YHH Q;  3L7Z C;  4A4I A;  4AQY L;  1HZ9 A;  1QUQ A;  5IWA Q;  3CXC A;  1XTD A;  3G71 A;  4LFC Q;  3JAM i;  3M7N A;  4GN3 B;  4L5Q A;  3T1H Q;  4PZ7 A;  1HNX L;  4DV3 Q;  1V43 A;  1X65 A;  4FDB A;  1Q86 C;  4UP8 A;  4EX5 A;  3G6E A;  4LNQ A;  3KFU A;  2E5L Q;  4QJF A;  1QZH A;  1YHQ A;  5LMN W;  1VQ6 A;  1KIX A;  1JMC A;  3ICE A;  1ASZ A;  2CCZ A;  1Y1V H;  4JC0 A;  4R4T A;  3G4S A;  1N36 Q;  1VQ9 A;  4B3M Q;  3GO5 A;  1C0A A;  4DV6 L;  1T9H A;  4LFB L;  4LW1 A;  1KAW A;  5IY0 A;  1JT8 A;  1HR0 L;  4POG A;  3TRE A;  2YYZ A;  5IYB H;  5JEA J;  4OX9 L;  2JEB I;  3PUW A;  2K50 A;  4GLA C;  3UE0 A;  4DV4 L;  5IYC H;  2UXC L;  1I94 Q;  4GOP A;  3I4M G;  1EIF A;  3B6Y A;  4BBS H;  4JI2 L;  2VNU D;  2AKW B;  4AIM A;  2B63 G;  4Y7N H;  4QIW E;  1SRU A;  1HNZ L;  1HNW L;  1QVG A;  3A5U A;  3I4N G;  1OXT A;  3LGJ A;  4YWK A;  1J5E L;  3Q8D A;  3HOU H;  1IBK Q;  1B70 B;  2E2I H;  1AE3 A;  1W3S A;  3M4P A;  3AQQ A;  2KCM A;  4IPD A;  3M85 A;  1VQN A;  3PF4 A;  2UXB Q;  1K0R A;  4JI1 L;  4DPG A;  4LUZ A;  3W1B A;  5IP7 H;  4IOC A;  4DV5 L;  4IOA A;  4BBR G;  2NZH A;  3A5Z B;  4L5S A;  1UE7 A;  2F4V L;  4BY7 G;  1HZC A;  4A3D H;  1HNX Q;  4HIO A;  2E2H H;  1BBW A;  4DV0 L;  4P74 A;  4K0K L;  3RLO A;  3PUZ A;  3TS0 A;  4A3C G;  5GQO A;  2Y0S E;  3UDX A;  2VUM H;  3ULL A;  5C4X G;  1IBM Q;  3AFQ A;  5H1S E;  4UY8 C;  2WAQ E;  1YJN A;  3A0J A;  2R92 G;  2R93 G;  4JG2 A;  4DV6 Q;  3GTJ H;  1PVO A;  1IYJ B;  4C3I H;  4GOP B;  3MEF A;  4C3J H;  1HJP A;  1PH7 A;  4APV A;  3J81 i;  3H0G H;  4A75 A;  3CC4 A;  2L15 A;  4DV4 Q;  1XMO L;  4A3L G;  2UXC Q;  3E9I A;  1PYB A;  2Q2I A;  2B29 A;  3KOJ A;  4JI2 Q;  4O2D A;  3GTQ H;  2JA8 G;  1LYL A;  3J81 j;  5ELO A;  3HOV G;  1X56 A;  4A93 H;  2R7D A;  3F8T A;  2JA5 G;  2D0P A;  1HNW Q;  1CKN B;  1LTL A;  1C7Y A;  1J5E Q;  4PZ8 A;  2ZTC A;  3K0X A;  3KDF A;  2EQS A;  1VQO A;  1XMQ Q;  4DR2 Q;  4DR3 Q;  2HHH L;  4LF5 L;  1BKB A;  2LXJ A;  3PSI A;  2OWO A;  2PMZ E;  3S24 A;  1L0W A;  2ZJP A;  1VQF A;  4DV5 Q;  3K80 C;  3JAM c;  3PF5 A;  3MXN B;  2F4V Q;  2PNH A;  2V1C C;  1QVC A;  4DV0 Q;  1A8V A;  4K0K Q;  2I0Q A;  1KRS A;  1N34 Q;  2RCN A;  1P16 A;  1Q82 C;  3H15 A;  1G51 A;  1N32 L;  4HID A;  2E8G A;  3E9H A;  2MO0 A;  1NBW A;  2YV5 A;  4GLX A;  2ZTE A;  2BA1 A;  1CKM A;  4A3F G;  5BR8 L;  1YNX A;  1JE5 A;  1TWH H;  4JI7 L;  4R4O A;  4LUO A;  1EFW A;  2FXQ A;  4GLV B;  4DR6 Q;  4IFD J;  3S14 H;  1A0I A;  1E22 A;  1WYD A;  1VQG A;  1A62 A;  1HZA A;  2Y0S G;  4R4Q A;  5JJI A;  2DUD A;  3HOW H;  2RHS B;  1VQ4 A;  2WAQ G;  1Q46 A;  5M5Y H;  4OWW B;  4LFC L;  2JE6 I;  1VQP A;  1IL2 A;  3L0O A;  1Y1V G;  2WB1 G;  1RIP A;  3J80 i;  2HHH Q;  1HZB A;  1VQH A;  2MNA A;  4YCU A;  3AYH B;  4LF5 Q;  1Y14 B;  1GD7 A;  3AEV A;  4IJH A;  2NVT H;  5IYB G;  1UWV A;  3HOY H;  4A3J H;  3NEL A;  1N36 L;  5IYC G;  1TXY A;  3W1G A;  2HIV A;  1GVP A;  4DV7 Q;  2YU9 H;  2N49 A;  2I5M X;  2KHI A;  1Q1B A;  5AJ3 L;  2OCE A;  4BY1 H;  5FLX c;  1WOC A;  3PV0 A;  1G29 1;  4KI0 A;  1I94 L;  1Q1E A;  2VQE Q;  1XNQ Q;  3HOU G;  1L1O B;  1CUK A;  3CPW A;  1PHJ A;  1JJC B;  1L2F A;  2WFW A;  3KF8 B;  4C3H H;  1ASY A;  5J3B A;  4DR4 Q;  2QGQ A;  5BR8 Q;  3RLF A;  4JI7 Q;  3HKZ G;  1WFQ A;  2CKZ B;  2B3G A;  5IP7 G;  1S40 A;  4GOP C;  3FHW A;  4DAY B;  1IBK L;  1MKH A;  4A3M G;  4A3D G;  1EQQ A;  2LSS A;  2XGT A;  4GKK Q;  3UE1 A;  3BJU A;  3UDG A;  2UXB L;  3GTP H;  1X9N A;  1EYG A;  2BH2 A;  2VUM G;  3S2H H;  3U50 C;  4EQ5 A;  4OWT B;  4A3B H;  1E7Z A;  1QZG A;  4IO9 A;  1VQD A;  2Z6K C;  2I5H A;  4HIM A;  4HJ7 A;  5GAE C;  4DK3 C;  4KHP Q;  4X6A H;  3H3V H;  1IBM L;  3S1Q H;  1I3Q H;  3J7Z C;  3KF6 B;  3GDE A;  4GN5 A;  4IJL A;  1SR3 A;  3EN2 A;  1J6Q A;  1TWC H;  1Y1W H;  1K9M C;  2PQA A;  1EUJ A;  1PFS A;  3G48 A;  5HGQ A;  1PH6 A;  3S16 H;  4UP7 A;  4B3S L;  3PIP A;  3GTM H;  1YIT A;  3RR5 A;  5JEA G;  5AJ3 Q;  1R9T H;  3CCL A;  1HH2 P;  2CFM A;  1EIY B;  3M3Y H;  1UE6 A;  4A93 G;  4NPS A;  2WP8 J;  1PH1 A;  2OTL A;  4P72 A;  3PUV A;  4DAM A;  4TVA B;  4B3T L;  2Z0S A;  3ZJY C;  1VQ5 A;  2R7Z H;  1XMQ L;  3ERS X;  2ZJR A;  4DR2 L;  3U4Z A;  3CMA A;  4DR3 L;  1MIU A;  2Z6K A;  3FKI H;  1CKN A;  2D0O A;  2IHF A;  5EAY A;  2JA9 A;  2QEX A; 
#chains in the Genus database with same CATH topology
 1NE3 A;  1TWF H;  3J7A 5;  1YHB A;  5FO7 B;  2R6G A;  3SK8 A;  3GTG B;  5IGB A;  1UE1 A;  2XWJ B;  3IRB A;  2VQF Q;  2MHV A;  4A3F B;  1N34 L;  2K5D A;  3MXN A;  4AYB B;  2PQA B;  2WKC A;  4NP5 A;  3JC6 6;  5IGE A;  1PH4 A;  4HN7 A;  2RHQ B;  4YIJ A;  2F0D A;  1Q8K A;  1X3Q A;  1PFN A;  4TRD A;  3SEB A;  5M3F H;  2J0T D;  2NZ1 D;  1HR0 W;  4JBW A;  4RWS C;  3HOX G;  2E74 C;  1Y1V B;  4HSP A;  1EEF D;  1E24 A;  1L1O C;  2DJF C;  1KAB A;  4NKL A;  2E2J H;  2N78 A;  2IY5 B;  3HOY G;  3DWQ A;  2F0Q A;  2CHB D;  3N6R A;  2RVL A;  1KD1 C;  3CF5 A;  4YWL A;  1M90 C;  5FJ8 H;  1DXM A;  3K6O A;  1NAP A;  1NMF A;  2BH8 A;  2CWP A;  1VS0 A;  1K8A C;  4C3H G;  1WCM H;  5M5X H;  1HRJ A;  3D4D A;  3U4V A;  1M4V A;  4A3M B;  3ERO A;  4RHR A;  3DLL A;  2RCF A;  2EY1 A;  4ID6 A;  1SNC A;  2R7F A;  3T51 B;  1YI2 A;  3SGI A;  2K4K A;  2UU9 L;  1E2Z A;  4EVO A;  3C46 A;  1E2W A;  3PO2 H;  1G6Z A;  1K83 B;  4HTH A;  4DUY L;  2K05 A;  2EYL A;  4IFD I;  1MI2 A;  4BS9 A;  4G7H C;  3FEW X;  4XTC S;  1MBY A;  3G7L A;  4FP5 D;  1NJI C;  1STA A;  4AH6 A;  1I4G A;  4BBS G;  3KF6 A;  2KA7 A;  2B8F A;  1LV9 A;  3ZYY X;  5CBA E;  2XSC A;  4N8X 1;  1OXX K;  4X66 L;  4CJ1 B;  2E76 C;  2K7V A;  3KYH C;  3V2T A;  3K7U C;  4O0A A;  1BF4 A;  3K59 A;  4R8N A;  2F0S A;  3NWS A;  1DZ1 A;  1A2T A;  4DR1 L;  1SYG A;  1H9S A;  1LTT D;  2L4N A;  3LWU A;  3VYS A;  4ME5 A;  4C1N K;  2UU9 Q;  3E0J A;  2P5Z X;  3CQZ H;  3I90 A;  1EY0 A;  3UI2 A;  4KHZ A;  4DFA A;  3R8B A;  4LF4 Q;  3T13 A;  4G7Z C;  4DUY Q;  4RGM A;  4FVM A;  3VR3 A;  3GP7 A;  5M3F G;  1SE4 A;  5IT9 c;  1SNM A;  3H0G G;  4LFA L;  3TRZ A;  4QY7 A;  4GNX A;  1WTH A;  2F0T A;  2JA8 B;  3RNU A;  1PV4 A;  3IFD A;  1KDC A;  1KRT A;  4WJ4 A;  1H9M A;  4X66 Q;  1AZQ A;  3CCM A;  1H9S B;  2LXK A;  3U9O A;  3URY A;  1YNJ D;  5FJ8 G;  2B39 A;  4DR1 Q;  3MXU A;  1I6H B;  3K5M A;  2CW0 D;  1DM0 B;  1DOL A;  1SE8 A;  3RUZ A;  4X3S A;  4NXN L;  3F2D A;  5LHY 1;  1WCM G;  2MPM A;  2EYH A;  4HIK A;  1E3P A;  3NE5 B;  1Q7Y C;  4YCW A;  4NXM L;  3EVQ A;  3TP7 A;  4L6T B;  4FXG C;  4JYA L;  2BA0 A;  3S2H B;  1Y69 U;  4A3B B;  3NEN A;  1FL0 A;  3ONA B;  1MSG A;  4LF7 L;  1I50 H;  1OXV A;  4LF8 L;  1XPU A;  3PO2 G;  1PH2 A;  3SVM A;  4JI8 L;  4A3M H;  1X3F A;  4LF9 L;  3EA6 A;  5ELF A;  3CC7 A;  2MO1 A;  4IUV A;  1YHA A;  5I6Y A;  2B2W A;  4C1N I;  1GOZ A;  3PUX A;  1IZ6 A;  5EKL A;  5IE8 A;  4NXN Q;  1Q12 A;  3ND8 A;  1GM5 A;  3X3M A;  4RG1 A;  4LFB Q;  4JPB W;  4ABN A;  3D3R A;  2WB1 E;  4OEL B;  1K83 H;  1N9W A;  1HCZ A;  3W3A A;  1F2M A;  1PRT B;  4NXM Q;  4JYA Q;  1HQM C;  2B2U A;  4LF6 L;  3J7A F;  2X69 A;  1UUP A;  4PMC A;  3GD7 A;  4BA2 I;  1H9K A;  3NSW A;  2VUM B;  3OIP A;  5C3E B;  3I7F A;  3CME A;  5E1F A;  3CHB D;  3T56 B;  1X54 A;  5CV5 A;  1CHQ D;  1STG A;  4QQB X;  1PFB A;  2B2V C;  5KND A;  1GUG A;  1STY A;  4RCO A;  4HJA A;  2DNC A;  4M8A A;  1S3O A;  5F2D A;  3H6M A;  4UP9 A;  3AFP A;  1RJT A;  2NWG A;  4AYB G;  1C48 A;  4X64 L;  4KJO A;  5EPK A;  4A3L H;  4LF6 Q;  1R4P B;  3LNN A;  5COR A;  2WII B;  1VQM A;  1RTO A;  4BA1 I;  2JA8 H;  3BS1 A;  1U5K A;  3OMC A;  5CC4 A;  4B3M L;  2F0M A;  2X6G A;  1ET9 A;  3H3V C;  3DM1 A;  4JI0 L;  1F2Y A;  2PZW A;  3S14 B;  2M2L A;  4PNY A;  3A8I E;  1I6H H;  2HCC A;  1FGB D;  4GS3 A;  5M5Y B;  1SLJ A;  2GVA A;  2BDO A;  2YTV A;  4J15 A;  1P8L A;  3MZ5 A;  3MHB A;  4X64 Q;  4RA8 A;  1NUC A;  4HJ8 A;  1DCZ A;  3L7Z C;  4A4I A;  1QUQ A;  4A3J B;  4GZY C;  1PRT C;  2AUJ D;  3M7N A;  4RCN A;  1FNW A;  5CV9 A;  4KD4 A;  4BY1 B;  3NXW A;  5E3F A;  3TSS A;  1YHQ A;  4JC0 A;  1ENC A;  1SNQ A;  3FRP B;  4B3M Q;  3P7J A;  4Q5V A;  1I4R A;  1T9H A;  3OHX C;  1FNU A;  2JEB I;  1IW7 C;  4GLA C;  1FD7 D;  2UXC L;  4LK1 C;  4CDE C;  3WDN A;  3B6Y A;  1J8I A;  1NSN S;  3TP5 A;  1JE4 A;  3MA2 B;  1HNZ L;  3A5U A;  1RDP D;  2HCI A;  4ZAI A;  1IBK Q;  3QIA A;  1Y8N B;  1VQN A;  1BCP D;  1QNK A;  4JI1 L;  4DPG A;  1TWC B;  5IP7 H;  1Y1W B;  1I4Q A;  1UE7 A;  4B08 A;  4DV0 L;  2F0I A;  5K5P A;  3MFG A;  2O4X A;  5GQO A;  2Y0S E;  2VUM H;  4KY5 A;  1IBM Q;  5H1S E;  2EYM A;  4FYD A;  1BUV T;  1ZYR D;  3T4A C;  2PMZ B;  1PH7 A;  3MEF A;  1V1P B;  2R7Z B;  3J81 i;  2L15 A;  1XMO L;  4A3L G;  2UXC Q;  5BN5 A;  4IUP A;  5CGK A;  4KN4 C;  2JA8 G;  1LYL A;  3A8K E;  5ELO A;  5L37 A;  1LTR D;  1WVL A;  3BVG A;  3KDF A;  3P20 A;  1XMQ Q;  1Y8O B;  1ILQ A;  1SDF A;  1VMP A;  5NUC A;  3K5O A;  3LX0 A;  1VQF A;  2WIN B;  4DV0 Q;  1QIL A;  1U4M A;  4KMU C;  5C44 B;  1N32 L;  1BNZ A;  2YV5 A;  4DN4 M;  2EVB A;  4JI7 L;  4DR6 Q;  4IFD J;  3S14 H;  1WYD A;  1A62 A;  4R4Q A;  2ENB A;  5M5Y H;  2K04 A;  4OL7 A;  3L0O A;  1RIP A;  4B9X A;  3A8J E;  3I8Z A;  5IOD A;  2MNA A;  1Y14 B;  2OEO A;  4F88 A;  1D5X C;  3NK9 A;  4A3J H;  3WOE A;  2ICI A;  1KNE A;  4CKE A;  3PO3 B;  1X3P A;  1GVP A;  1MSH A;  1AFP A;  3A7A B;  1GHK A;  4HSV A;  2BE5 C;  5AJ3 L;  4KN7 C;  4BY1 H;  3FPP A;  1G29 1;  1IHZ A;  5I2X A;  1I94 L;  3FDT A;  1JJC B;  1L2F A;  2WFW A;  4V0B A;  1F9Q A;  5IIF A;  5CR3 A;  4JI7 Q;  4EQO A;  1WFQ A;  2B2Y C;  2CKZ B;  5IP7 G;  2QW7 A;  1S40 A;  1MKH A;  3Q0A A;  2LSS A;  3BJU A;  3UDG A;  1BQQ T;  2VUM G;  3U50 C;  1QZG A;  4ZQ3 A;  2K28 A;  4DK3 C;  1EY6 A;  1TWC H;  1Y1W H;  1D1K A;  1EUJ A;  2RSO A;  4ZCK A;  5HGQ A;  2QDB A;  3BVZ A;  2F0J A;  5AJ3 Q;  3CCL A;  1EIY B;  2ZT9 C;  4NPS A;  1KDB A;  2WP8 J;  2OTL A;  4ZUI A;  1XTC D;  1K0S A;  4MIU A;  4DU9 A;  2F3W A;  4TVA B;  2H4O A;  2C9O A;  2R7Z H;  1FR3 A;  3ERS X;  3P1H A;  4DR2 L;  1VDZ A;  2D5D A;  1MIU A;  2A68 D;  2Z6K A;  1TY2 A;  3H94 A;  2D0O A;  2F3V A;  5EAY A;  4PV1 C;  3KLS A;  5ELD A;  1IYU A;  2KJX A;  2A74 C;  3PMF A;  1BBU A;  2SDF A;  2F0L A;  1IYV A;  3NQT A;  4C2M H;  1ESF A;  2A69 D;  2EIF A;  4A76 A;  1S4Z A;  1O7Z A;  2F0H A;  4A3I G;  2Q2U A;  2ZXO A;  1RD9 D;  2NYZ D;  1VQL A;  3NTH A;  3A56 A;  4KTA A;  1NNX A;  1STH A;  4CGY B;  5M3M H;  3KJP A;  5C4J B;  2JA6 B;  3OPO A;  3SR1 A;  2Q2H A;  2F1M A;  4K2K A;  5C44 H;  1HUN A;  5JAV A;  1MJE A;  2HIX A;  1EZ6 A;  5GAD C;  2F0V A;  3MVV A;  4DR7 Q;  4X65 L;  1W6J A;  2Q8T A;  4IPC A;  4Z9C B;  1ET6 A;  2IX1 A;  3FP9 A;  4BY1 G;  3C1E A;  1B3A A;  2EJF C;  5I6W A;  1VCI A;  4DV7 L;  1YNN C;  4QB4 A;  5GAH C;  1B9M A;  2J4X A;  1DGS A;  2VQE L;  1ICW A;  1FVI A;  3CRL C;  1XNQ L;  2KOL A;  1D2B A;  1ROD A;  3DM3 A;  1NTG A;  1QCB D;  3PO3 H;  3RZO B;  1L1O A;  3ULP A;  4JI5 Q;  4OO1 H;  3KF8 A;  1JOK A;  1B8A A;  1ONL A;  2K01 A;  2VB2 X;  1KC8 C;  2LKV A;  3MC0 B;  5IP9 H;  1X3E A;  3VYR A;  4OON A;  1TS3 A;  1WD1 A;  1D5M C;  1WJJ A;  2FMM A;  2ASB A;  1N33 L;  3KJO A;  4X65 Q;  3BZC A;  1UEB A;  1Y1W G;  2SNM A;  4GKJ Q;  4CJ0 B;  2Z9H A;  3GTO H;  4KHP L;  2RA4 A;  4XT3 B;  2D62 A;  2IJ0 A;  3SK5 A;  5IGG A;  2F52 A;  1G2S A;  3S1N B;  2Z8L A;  5I9O A;  3CP0 A;  3MXP A;  3I4N B;  2NUC A;  3NBH A;  5FLM H;  1EYD A;  3HS0 C;  2R7Z G;  4JW0 A;  2R3Z A;  1CSP A;  1U4L A;  3UDF A;  2EYF A;  5LMN L;  4IUN A;  4QF4 A;  4JI3 L;  1V9P A;  1EEI D;  5KNB A;  3BZK A;  3O13 A;  1EL0 A;  3P75 A;  1N33 Q;  5EPL A;  4IUT A;  2VQF L;  2M9V A;  5KYL A;  1Y8P B;  2ID0 A;  2F3I A;  1XPR A;  1ZKO A;  3TZU A;  5M3M G;  3J80 E;  1PA6 A;  3W5O A;  3NBH B;  5C44 G;  4R1J A;  2DGY A;  2JA5 B;  4JBK A;  4OXP A;  3S17 H;  4K8I A;  3CCQ A;  4YY3 L;  2XTI A;  4UAI A;  3MAQ A;  1YEZ A;  3EJI A;  1PMR A;  4HED A;  5LMN Q;  5C4J H;  2JA6 H;  3M4Q A;  5D3I B;  2PZT A;  4JI3 Q;  2D2C C;  1ML0 D;  2K32 A;  5IYD H;  1SAP A;  2B8G A;  4IPG A;  2ATW A;  3R3O A;  4BXX H;  1RCV D;  1VQJ A;  5I9P A;  1YIJ A;  4TSS A;  3OTO Q;  3PO3 G;  2GA4 B;  4OO1 G;  2A1A A;  1VQB A;  2VZA A;  2MGS A;  3I55 A;  4JI6 Q;  2JN4 A;  4OIK A;  2EDG A;  2WAQ B;  3A54 A;  4K5W A;  5IP9 G;  4XIG S;  4X62 L;  4DR5 L;  4JBJ A;  1VQ8 A;  2UUC L;  3OW7 A;  1TS2 A;  4YY3 Q;  4CBV A;  5LMU L;  1EQT A;  1XNR L;  2DN8 A;  2LMC B;  2PI2 A;  3RZO H;  2YTY A;  5ISR A;  1KHI A;  2L12 A;  3IL8 A;  2XRS D;  2OXP A;  1PH5 A;  3HOU B;  3WOF A;  1PYS B;  1EIG A;  5FLM G;  4FXK C;  2OTJ A;  3STB D;  1X55 A;  2N55 A;  5FO8 B;  1EFI D;  5ELC A;  1II3 A;  2BOS A;  1D7Q A;  2KEN A;  3HKZ B;  5JPM C;  1H95 A;  2K03 A;  1O7Y A;  5C5L A;  1QWY A;  2C35 B;  1JIC A;  4FF4 A;  2E2D C;  2F0W A;  2F0E A;  3S1N H;  4X62 Q;  4MTK A;  4DR5 Q;  3FVQ A;  3I4N H;  2KCC A;  2UUC Q;  4RKL A;  2B2T A;  5LMU Q;  3GTJ B;  1R4Q B;  1XNR Q;  1PTO D;  4NW2 A;  4LF4 L;  1TT2 A;  2Z4I A;  3HEJ A;  1QNU A;  4PG3 A;  4BBR H;  5JJK A;  3GTQ B;  3CAM A;  4LUV A;  2ZJQ A;  1CZG A;  3VDY A;  1CQV A;  4P71 A;  2RF4 A;  3T16 A;  5C4X H;  4MZ9 A;  1KXL A;  2RDF A;  2R93 H;  3HRZ C;  1EY4 A;  2UUA L;  2PPB C;  5C0X I;  2XN9 C;  2C5C A;  1A63 A;  3R93 A;  3IFT A;  2JA6 G;  2VW9 A;  4DV3 L;  2A6H D;  3HFZ B;  4HR7 B;  2WV6 D;  3OWE B;  3HOV H;  5IYD G;  1YJW A;  1S72 A;  2B2V A;  2JA5 H;  4BXX G;  1W6K A;  2I5L X;  5HGT A;  1K73 C;  1B9N A;  1TWH B;  3RZD B;  3CCR A;  3NTK A;  3HOW B;  4CKC A;  3CCS A;  1B1Z A;  1FGU A;  2AHO B;  5BN4 A;  4H02 A;  3NEM A;  2A19 A;  3M9B A;  1SXT A;  2K14 A;  4N9P A;  3GTG H;  4ME3 A;  1KNA A;  1LTS D;  4POF A;  1VQI A;  2UUA Q;  2EYP A;  4A3F H;  2QEJ C;  3BYT B;  1HZ9 A;  2OF1 A;  5DM7 3;  2HQE A;  4LMQ D;  2IX3 A;  4L5Q A;  2YU9 B;  1KDA A;  4DV3 Q;  1B2T A;  1V43 A;  2FFK B;  1DOM A;  4UP8 A;  3G6E A;  1Q86 C;  4LNQ A;  3DUZ A;  4QJF A;  1VQ6 A;  1ZEQ X;  5LMN W;  1JMC A;  2AQ3 B;  4IUU A;  3J80 L;  1SYC A;  2CCZ A;  1Y1V H;  3G4S A;  1N36 Q;  2A6E C;  1PXU A;  3GO5 A;  3K5N A;  1C0A A;  4IUQ A;  1CA5 A;  4LFB L;  4POG A;  3TRE A;  5IYB H;  1F9R A;  4ZKC B;  3I73 A;  1EQV A;  4GOP A;  3GTP B;  4AIM A;  2M00 A;  1TY0 A;  4HMI A;  4QIW E;  5IGF A;  1D1I A;  1HNW L;  3I4N G;  3HOZ B;  5D65 A;  2PW7 A;  4YWK A;  1J5E L;  3HOU H;  1B70 B;  2EY6 A;  4KD3 A;  4CDC C;  2KCM A;  1AP0 A;  4KHV A;  3M85 A;  1A2U A;  4DK1 A;  4LUZ A;  1ENF A;  4DV5 L;  4IOA A;  4BBR G;  3S16 B;  2JSO A;  4HIO A;  1BBW A;  4K0K L;  1S5E D;  3TS0 A;  4KK7 A;  1TWG B;  5C4X G;  2B2T C;  4FO2 A;  1ENA A;  5I2Y A;  4UY8 C;  1YJN A;  3E6Z X;  3OWF A;  2R93 G;  4JG2 A;  2O5J C;  3GTJ H;  4O42 A;  4GOP B;  1ZXT A;  1HJP A;  1I4P A;  4APV A;  2JXM B;  3CC4 A;  5FOB B;  1RTN A;  3FKI B;  1NR2 A;  1PYB A;  1PZJ D;  2B29 A;  4O2D A;  3GTQ H;  3J81 j;  3S2D B;  1NCV A;  5EQ0 A;  5JEA H;  3HOV G;  2JA5 G;  1HNW Q;  1CKN B;  1LTL A;  1C7Y A;  1J5E Q;  4N8F A;  3K0X A;  4A3K B;  2EQS A;  2HHH L;  5FK9 C;  4DR3 Q;  4LF5 L;  2PMZ E;  2RQX A;  2F0O A;  1STB A;  2RDG A;  3K80 C;  4DV5 Q;  1CQF A;  2PW5 A;  3PF5 A;  2QF7 A;  1QVC A;  3SDZ A;  1A8V A;  4K0K Q;  2JA7 B;  1E2V A;  2RCN A;  4ZK9 B;  2EYJ A;  1LO5 D;  5CBE E;  5M5W B;  4GLX A;  5J39 A;  2ZTE A;  2BA1 A;  4A3F G;  4K6D A;  1JOQ A;  1SEB D;  1TWH H;  4R4O A;  4U68 A;  4FF3 A;  1EFW A;  1B4O A;  3C1F A;  1SSO A;  2D9U A;  3OOC A;  3I70 A;  2CH4 W;  5KYI A;  5JJI A;  2DUD A;  3J81 E;  5JVG 3;  1PZI D;  3HOW H;  2RHS B;  1VQ4 A;  2WAQ G;  4OWW B;  2DY8 A;  1VQP A;  1IL2 A;  2JP1 A;  1STN A;  1HPC A;  1Y1V G;  3MFY A;  4A3G B;  2HHH Q;  1VQH A;  1HA6 A;  4LF5 Q;  2MUY A;  1EU4 A;  3N52 A;  5LL6 S;  1BOS A;  1F2L A;  3VYT A;  5IYB G;  1UWV A;  4QUF A;  1EWH A;  2R61 A;  2KED A;  2MJ8 A;  1DYQ A;  4EQP A;  2YU9 H;  2I5M X;  4R9W A;  2OCE A;  2VXW A;  4G57 A;  3PV0 A;  4KI0 A;  3TBI B;  1Q1E A;  3HOU G;  1GUT A;  1ASY A;  5J3B A;  3A55 A;  1CFM A;  1BBX C;  4DR4 Q;  1QJO A;  3RLF A;  2EPB A;  2RBM A;  3HKZ G;  3VR5 A;  1IBK L;  4GOP C;  4A3M G;  2KEC A;  3TME A;  2XGT A;  1EQQ A;  4GKK Q;  4K14 A;  3QWN A;  2FMC A;  3GTP H;  2EJG C;  1X9N A;  1AEX A;  3DMU A;  2NVY B;  3S2H H;  4OWT B;  4A3B H;  1E7Z A;  4IO9 A;  2NN6 H;  2NTT A;  4HIM A;  2BDN A;  4HJ7 A;  4IUR A;  4R8I A;  4X6A H;  1LAC A;  2PCF B;  4M1U B;  1IBM L;  3H3V H;  2RSN A;  4IJL A;  1PH6 A;  2L1B A;  3S16 H;  4UP7 A;  3DWA A;  3RR5 A;  5JEA G;  1EIH A;  2CFM A;  1MD2 D;  2B2Y A;  2X6L A;  1V1P A;  1PH1 A;  1Z6H A;  4A3E B;  2SEB D;  1MHW C;  2Z0S A;  3ZJY C;  1CHP D;  1XMQ L;  5CMD A;  2ZJR A;  3S1M B;  2KUM A;  1JCK B;  3FKI H;  5G3L F;  2QEX A;  1B53 A;  3TP8 A;  1UAP A;  4TQU S;  1JB7 A;  1JJ2 A;  4PQX A;  1CSQ A;  2OQK A;  3J80 c;  5CYU A;  2Z1C A;  3JAM E;  4A3K H;  1WI5 A;  2XIW A;  4XT1 B;  1FJG Q;  1XXG A;  2IPK D;  5C3E H;  3DXJ C;  4L63 B;  1HFN A;  4UPA A;  3HOW G;  4V19 0;  1TS4 A;  4JCV E;  1TKW B;  4DR6 L;  2L11 A;  4DA2 A;  2PQE A;  3I4L A;  1Z9F A;  2CQO A;  5M5W H;  3NPP A;  1CZW A;  4WOR A;  2K75 A;  3I3C A;  4U67 3;  3F1Z A;  3TDQ A;  4Y7N B;  5BN3 A;  2RDH A;  4CHT B;  1E0B A;  2QIL A;  4A3G H;  2L9H A;  3CRK C;  4OHJ A;  4ZUJ A;  4A3D B;  1GUS A;  1B7Y B;  1G2T A;  1BDO A;  2ZXP A;  4NB3 A;  3L2P A;  2ZM6 Q;  1XPO A;  2MFI A;  1GKH A;  1JJG A;  4PMB A;  3WWV A;  3RN2 A;  3IKJ A;  3PUY A;  1M8A A;  2SNS A;  4HJ5 A;  1LUZ A;  4DKA C;  3RN5 A;  4A3B G;  2NN6 G;  3H91 A;  1SYE A;  4C3J B;  1S5F D;  4RHS A;  2G5D A;  2PO4 A;  3J7Y W;  3U58 A;  5JJL A;  4KKS A;  3PCO B;  1Q8I A;  2GVB A;  5EBD A;  1EWC A;  4OWX B;  3KUP A;  1VQE A;  1X3G A;  4MHE A;  3S15 B;  1BVS A;  5C0X J;  3NHH A;  4B3R L;  4A93 B;  1TQO A;  1B44 D;  4DV1 L;  1EZ8 A;  3I4M B;  2AWN A;  2AWO A;  5C3W A;  1A3T A;  1PRT F;  3HG9 A;  1ESR A;  2O5I C;  3J81 L;  1LTG D;  2AMC B;  3FKI G;  3K7A B;  3TEH B;  1A3U A;  3TN2 A;  3K58 A;  2N88 A;  2G9D A;  2L5T A;  3C3L A;  1OTC A;  4MNO A;  4XDX A;  2Q2T A;  2K5N A;  4ILW A;  1RL2 A;  1U9R A;  4A3K G;  4ZYS A;  1VQK A;  1PH9 A;  4A3E H;  5C3E G;  2IX0 A;  2F0G A;  1EU3 A;  1A6X A;  3BU2 A;  4DUZ L;  4L5R C;  3HOX B;  4B3R Q;  4Y52 H;  1S5C D;  4DV1 Q;  2K5H A;  2N3S A;  2FJ2 A;  3BDO A;  3M4Y A;  1HTP A;  2JYO A;  3ULJ A;  3R2I A;  3HOY B;  2I07 B;  3I91 A;  3NQI A;  5CV6 A;  1SMX A;  5CV4 A;  3DHQ A;  1HUM A;  5EKK A;  3MTS A;  2RKS A;  5EPJ A;  4DR7 L;  2DJG C;  1B50 A;  4A3G G;  1K3R A;  2F0N A;  1X6O A;  3ER0 A;  1K8G A;  2XNA C;  3T53 B;  2K5V A;  1YZ6 A;  4KY7 A;  4DUZ Q;  4JOI C;  1PH8 A;  2H1E A;  1FYC A;  3MEH A;  2Y0S B;  1EY5 A;  3SXH A;  4I65 A;  5DNF A;  4JI5 L;  1Q90 A;  2YTX A;  5IOC A;  2UXD L;  5C6A A;  4AQY Q;  2OT2 A;  2KCN A;  1I3Q B;  4OO1 I;  3KLS X;  5A35 A;  1AH9 A;  1SBB B;  4OEM B;  4P2C B;  3F2B A;  4AYB E;  3SK6 A;  1R9T B;  1YNJ C;  4J1M A;  1CKO A;  3JAM L;  4A3J G;  5E4X A;  1WTO A;  4BBS B;  1BXT A;  2CW0 C;  4GKJ L;  3I72 A;  2HDL A;  2JJQ A;  1WTX A;  1V1O A;  3OSO A;  1HR0 Q;  4OX9 Q;  4DNI A;  2E2I B;  4QUC A;  4L5T A;  2UUB L;  3S15 H;  2HT1 A;  4F87 A;  1LT6 D;  2E75 C;  3T1Y L;  4QGU A;  4GN4 B;  3PGZ A;  4CDF C;  3I4M H;  1XWE A;  2UXD Q;  1VF5 C;  1F2Z A;  3SK4 A;  3F2U A;  3D0F A;  4A3E G;  3I2Z A;  1SNO A;  4X3K A;  5TSS A;  4C3I B;  3DWP A;  5M3F B;  1W2B A;  3CCU A;  2F0P A;  3H0G B;  3HKZ E;  3K7A H;  3VA5 A;  1EOV A;  4RGN A;  1GUO A;  3AU7 A;  4H44 C;  1SE2 A;  4WFN 3;  1GUW A;  3AB9 A;  4LJZ C;  4WRD A;  4R4I A;  4UHV A;  2KHJ A;  2PI2 E;  3QOL A;  2UUB Q;  4YHH L;  3KLW A;  1WTR A;  5IWA L;  1YJ9 A;  1PRT D;  3HOX H;  1MJC A;  3T1H L;  3T1Y Q;  2OQ0 A;  1WCM B;  1LT5 D;  4ALP A;  3NWT A;  2NBF A;  3CD6 A;  2IHE A;  4RGO S;  2ES2 A;  4I7Z C;  3Q24 A;  4X3U A;  1IKM A;  5GRO A;  3E3X A;  4G4K A;  2I46 A;  1HTL D;  1Z47 A;  1JQY D;  2DNE A;  3CC2 A;  1IW7 D;  4YWM A;  4B9W A;  4CJ2 C;  4BWG B;  3BVM A;  1VQA A;  3OTO L;  1G91 A;  2A8V A;  2EXD A;  3PO2 B;  2ZXR A;  4JBM A;  4JI6 L;  1YBY A;  3J81 c;  5CV8 A;  4K8J A;  1AW7 A;  1BCP B;  1O80 A;  3A7L A;  4YHH Q;  5IWA Q;  3CXC A;  4CKB A;  3G71 A;  4LFC Q;  3T1H Q;  4PZ7 A;  2HD3 A;  1HNX L;  4FDB A;  4EX5 A;  4X3T A;  2G9H D;  2SOB A;  1WTV A;  3ICE A;  4R4T A;  4J8Q A;  4OIJ A;  4FXD A;  4LW1 A;  1JT8 A;  3BG3 A;  3Q22 A;  1T5E A;  2YYZ A;  4DV4 L;  3UE0 A;  1QG7 A;  4NMZ A;  3FPU B;  3I4M G;  3CQZ B;  1EIF A;  4BBS H;  4JI2 L;  2VNU D;  4RKB A;  4ZLT F;  1SRU A;  3TZD A;  1QVG A;  2IWH A;  3LGJ A;  3Q8D A;  1I6V C;  2E2I H;  1AE3 A;  1C4Q A;  1JWU D;  4IPD A;  3PF4 A;  1HFG A;  2UXB Q;  4IOC A;  4XYO A;  4L5S A;  2NZH A;  3DEO A;  1HNX Q;  1PZK D;  4P74 A;  4HMJ A;  5COY A;  5AFW A;  3PQI A;  3ULL A;  3AFQ A;  3U9S A;  1K3B C;  1PVO A;  4C3I H;  3H0G H;  3VR4 A;  4A75 A;  4DV4 Q;  5C4Z A;  4H13 C;  1LTB D;  2F0K A;  1VF7 A;  4JI2 Q;  2F03 A;  2D0P A;  2HDM A;  4ZRZ A;  4PZ8 A;  4XYQ A;  1VQO A;  3HP3 A;  2OWO A;  2KQ3 A;  1BCP C;  2AUK A;  1L0W A;  1I4H A;  2Z6B A;  1U4P A;  2K6A A;  3JAM c;  3MXN B;  2PNH A;  2V1C C;  1I50 B;  2I0Q A;  2BE5 D;  4KJN A;  1N34 Q;  1P16 A;  3H15 A;  4HID A;  2E8G A;  2MO0 A;  1NBW A;  2FHT A;  1ZYR C;  3GQB A;  4LUO A;  2FXQ A;  3ERQ A;  1D6E C;  1E22 A;  2Y0S G;  1GXD C;  3MWY W;  1CM9 A;  4CDD C;  2XWB B;  3K0Y A;  4DNR B;  3VR2 A;  1XYI A;  2EJM A;  3J80 i;  1HZB A;  4YCU A;  2K5W A;  1GD7 A;  3AEV A;  2PNR C;  4IJH A;  4WJW A;  2PYK A;  2J7Z A;  5HUR A;  3GTL B;  1N36 L;  1TXY A;  3W1G A;  2HIV A;  1TII D;  4RFB A;  1U4R A;  2N49 A;  1TU2 B;  2WAC A;  4EGV A;  2KHI A;  2EOT A;  2EZV A;  5FO9 B;  3GTK B;  3BZD B;  5DM6 3;  1SFO B;  3FHW A;  2QCP X;  3NP8 A;  3M4O B;  3UE1 A;  1DD2 A;  2IW3 A;  1EYG A;  1UNS A;  4DK0 A;  2BH2 A;  4IFD H;  4HCS A;  2I5H A;  5EKI A;  3R2T A;  4C3I G;  5GAE C;  1H9R A;  3J7Z C;  3KF6 B;  5M9O A;  2NVQ B;  1SR3 A;  3EN2 A;  1J6Q A;  3V05 A;  3NTI A;  2VB3 X;  3G48 A;  5C0X H;  3Q6S A;  4B3S L;  4F7X A;  3PIP A;  1A15 A;  1UE6 A;  1CTM A;  1S5B D;  2L55 A;  4N9T A;  3GV3 A;  1LTA D;  1SE3 A;  1JOO A;  4B3T L;  1VQ5 A;  4DR3 L;  1CKN A;  1RKN A;  2JA9 A;  1I4X A;  3W2D A;  3BDC A;  4KY6 A;  2ALY B;  1O7I A;  4IQZ A;  4PZ6 A;  2Z4H A;  2O2L D;  2NVX B;  2F0U A;  5IGC A;  1YNN D;  4RH6 A;  4GNX B;  1SJH D;  4QL5 A;  2TMP A;  4LFA Q;  4DXG A;  4E6I A;  3CCE A;  3G6J B;  2JQO A;  1BCP F;  1AN8 A;  3EFX D;  4B3S Q;  4PMW A;  1J9O A;  2XRQ D;  1OXS C;  2K52 A;  4EQN A;  4DF7 A;  1K8O A;  1IL8 A;  3GV6 A;  3PIO A;  4L8J A;  1NR4 A;  4B3T Q;  3KLR A;  2A68 C;  5T1G A;  3QB3 A;  2ZTD A;  1MGS A;  1SMY D;  2VS1 A;  4J6H A;  3BDL A;  3K57 A;  4IZ8 A;  1G6P A;  3PIP 3;  3RD4 A;  1JR0 D;  1AE2 A;  5GAG C;  2K1B A;  1JWM D;  2A69 C;  5K36 H;  1VMC A;  2KEE A;  5FLX E;  3GTL H;  4DR4 L;  2JK8 A;  4MN3 A;  3RZD H;  2VY3 A;  3ND9 A;  2N8N A;  4LF7 Q;  4LF8 Q;  1YVC A;  3J7A V;  4K5X A;  2A5H A;  4IFD G;  4GKK L;  5DLQ E;  4JI8 Q;  3GTK H;  5JPN C;  3V96 A;  3ITP A;  3I4O A;  4LF9 Q;  1F77 A;  1SFO H;  1DJR D;  1DOK A;  3MXG A;  3I56 A;  2NZO A;  1TWA B;  5E7N A;  2EY2 A;  5C0X G;  3E0E A;  3C2P A;  2NN6 I;  3M4O H;  1PYW D;  1N8R C;  3H3V I;  3M7G A;  2B63 B;  4KKU A;  2DY7 A;  2CWA A;  1KAA A;  1NY4 A;  1GUN A;  1UE5 A;  1I5F A;  4TKO B;  3PIO 3;  2LY7 A;  4GNX C;  1E1O A;  1STE A;  2HUG A;  2NVQ H;  3CCV A;  2KVM A;  3F2C A;  4DK6 C;  1IKL A;  4JV5 L;  4P75 A;  4BY7 B;  1IXR A;  5J1Z A;  3UDI A;  4DNT B;  3D6W A;  4A3I B;  3K8A A;  1PLF A;  2R92 B;  3HOZ H;  3TQY A;  1KTK A;  1EY8 A;  1SRO A;  5DAU A;  5C4H A;  1F9S A;  4C56 C;  1FJG L;  3TP6 A;  4XQJ A;  4RMF A;  4I7A A;  4IN3 A;  3AMU A;  4QCL A;  1EY9 A;  1NMG A;  1PDQ A;  2NVX H;  2MQH A;  1SNP A;  2KBN A;  3RLN A;  3E5S A;  2V4D A;  1D8L A;  1TWG H;  1KL9 A;  3S1R B;  2EY5 A;  3BYY B;  1O7L A;  5A2Q E;  3FMC A;  3D31 A;  2KHS A;  4Q0F A;  4QIW B;  4JV5 Q;  3CU7 A;  3VA7 A;  2FIN B;  1LM0 A;  3CCJ A;  1BO0 A;  1QVF A;  3OW2 A;  4JI0 Q;  3QG1 A;  3DEP A;  3S2D H;  5K36 G;  4JI4 L;  1EQR A;  2WKD A;  2B2W C;  5JJZ A;  1LT4 D;  4ODG A;  3OYY A;  4DXF A;  2ZM6 L;  4K6L A;  1QUQ B;  3A74 A;  1CK1 A;  1XJV A;  1L0Y B;  1EWI A;  2XVS A;  3LWE A;  2JA7 H;  2WB1 B;  1OXU A;  1WTQ A;  2AQ1 B;  2B2U C;  5EBC A;  3KBX A;  1PTO B;  4DV2 L;  2H5X A;  3TS2 A;  3HKS A;  2HQL A;  3CW2 C;  1E1T A;  4YCV A;  1Q81 C;  1VQ7 A;  1M1K C;  4JOI A;  1IBL L;  4JI4 Q;  4JVZ A;  1VQC A;  1A3V A;  3RMH A;  2QA4 A;  1TWA H;  2TSS A;  4HJ9 A;  2JEA I;  3VYU A;  3Q23 A;  2IT1 A;  1QB5 D;  1HNZ Q;  3CKI B;  5KIX A;  2E2H B;  4MTN A;  2VL6 A;  4P73 A;  1H9J A;  4ULL A;  4C2M B;  2B63 H;  4S3S A;  4IPH A;  1OO9 B;  4JI1 Q;  1V1Q A;  3HOZ G;  4DV2 Q;  2Q8R E;  2KCT A;  1U0L A;  5M3M B;  1KQS A;  1EYA A;  4DAP A;  4BY7 H;  1JWS D;  5FLX L;  4A3C H;  3EBE A;  1Z7T A;  1WTW A;  1IBL Q;  4WJ3 M;  5IT9 E;  2NVY H;  1LAB A;  1XMO Q;  3STB C;  4A3I H;  1AZP A;  4HAE A;  4DAV A;  2R92 H;  1HA5 A;  4LWC A;  1PFM A;  5KEE A;  2K33 A;  1LTI D;  3KDF B;  1EYC A;  2Q8I B;  1ICF B;  3QR8 A;  3HZX A;  2E5L L;  4KLK A;  1KLU D;  4R4C A;  5D14 A;  4FNF A;  2A6E D;  1CT1 D;  1C9O A;  1F9P A;  1SN8 A;  3QJY A;  4H7B A;  2A73 B;  1PTO C;  1XX8 A;  1TR5 A;  1SYB A;  1O78 A;  2F0F A;  3S1R H;  3K81 C;  1QE6 A;  4G7O C;  5ELN A;  4QMG A;  1GO3 E;  3NBI A;  3CPF A;  1N32 Q;  5LL6 X;  3EIV A;  3S1M H;  5HY6 A;  2GN5 A;  1PH3 A;  2CQA A;  3D4W A;  3OIQ A;  2JA7 G;  1HHV A;  3QOJ A;  1X32 A;  1UEA B;  5C5M A;  2NVT B;  4AQY L;  3GTO B;  1XTD A;  5C3X A;  3JAM i;  4GN3 B;  3EQL C;  1X65 A;  2A6H C;  3KFU A;  2E5L Q;  1QZH A;  1KIX A;  4C3H B;  5EJW A;  1ASZ A;  3D8G A;  1VQ9 A;  1PTO H;  4DV6 L;  1S5D D;  1KAW A;  5IY0 A;  1HR0 L;  1ILP A;  5JEA J;  1C8C A;  4OX9 L;  3PUW A;  2K50 A;  5G3L D;  5IYC H;  2CVR A;  1EY7 A;  1I94 Q;  1L0X B;  1T5X D;  1SJE D;  2AKW B;  2B63 G;  4Y7N H;  4K5V A;  1LLR D;  5A2Q L;  1OXT A;  2IL8 A;  4H0L C;  3HGB A;  3KK7 A;  3S9W A;  1W3S A;  3M4P A;  3AQQ A;  1TVX A;  3S1Q B;  1K0R A;  3W1B A;  1Q3L A;  3L3O C;  4A3D H;  3A5Z B;  2F4V L;  3GTM B;  1HZC A;  5T1I A;  2ICE C;  4BY7 G;  2E2H H;  3M3Y B;  3RLO A;  3PUZ A;  4A3C G;  3S17 B;  1HXY D;  3UDX A;  3H09 A;  1KLG D;  1EOT A;  1D5Z C;  1V8Q A;  2WAQ E;  1GJX A;  3A0J A;  2R92 G;  4DV6 Q;  1IYJ B;  5KRU A;  1K28 A;  4LAA A;  2EYO A;  4NDX A;  4C3J H;  3NUC A;  3QO2 A;  4FF2 A;  3E9I A;  1SYD A;  2Q2I A;  1TWF B;  3KOJ A;  1X56 A;  4A93 H;  2R7D A;  3F8T A;  1WD0 A;  4KV6 A;  1JC7 A;  1LT3 D;  1SND A;  3SHL A;  2ZTC A;  4DR2 Q;  5ELB A;  2EE1 A;  1BKB A;  2LXJ A;  3PSI A;  1JB3 A;  1CA6 A;  3S24 A;  3D4R A;  2F4I A;  2ZJP A;  2EXZ A;  5DEH A;  2L0C A;  4F8M A;  2F4V Q;  2BCO A;  5J22 A;  1KRS A;  1Q82 C;  1G51 A;  3E9H A;  5EGT A;  1B3Q A;  1CKM A;  2E2J B;  5BR8 L;  1GHJ A;  5KGU A;  5D3D A;  1YNX A;  1JE5 A;  1DON A;  4FF1 A;  1JOR A;  4GLV B;  1QOH A;  1PTO F;  1A0I A;  1VQG A;  1HZA A;  3K5L A;  1Q46 A;  5E4W C;  4DAY A;  4LFC L;  2JE6 I;  4K2L A;  4DGZ A;  2WB1 G;  1CI3 M;  5M5X B;  2QDL A;  3AYH B;  4RGT A;  2NVT H;  1TS5 A;  3HOY H;  3NEL A;  5IYC G;  1SMY C;  4O1N A;  5IT9 L;  3VR6 A;  4DV7 Q;  1SYF A;  1Q1B A;  1RHP A;  5FLX c;  1WOC A;  5I4D A;  2VQE Q;  1XNQ Q;  5JOB A;  5JVH 3;  1L1O B;  1CUK A;  3CPW A;  1PHJ A;  3KF8 B;  3X3N A;  4C3H H;  2K5Q A;  2QGQ A;  1FNV A;  2NB0 A;  5BR8 Q;  2MP1 A;  4BBR B;  2B3G A;  4DAY B;  4A3D G;  3KBG A;  4JK1 C;  5ELE A;  5FKA C;  1HQR D;  4ZKB B;  2UXB L;  1WTP A;  5C4X B;  4RAU C;  4XQN A;  3D6C A;  4EQ5 A;  2NTS A;  2LS0 1;  4HCE A;  4KKT A;  2R93 B;  1G8Z D;  1VQD A;  2Z6K C;  2QKI C;  2CH4 A;  3IAY A;  4C3J G;  4KHP Q;  3S1Q H;  1I3Q H;  3GDE A;  4GN5 A;  1K9M C;  4XQQ A;  2PQA A;  1PFS A;  3GTM H;  3HOV B;  1K8M A;  1YIT A;  5KNC A;  1R9T H;  3M3Y H;  1HH2 P;  4OGQ C;  4A93 G;  3SE0 A;  2LFN A;  4P72 A;  3PUV A;  4XXE A;  2AQ2 B;  5IGD A;  4DAM A;  5CV7 A;  1RF2 D;  1BR9 A;  4IAL A;  4UDU C;  3U4Z A;  3CMA A;  2IHF A;  3OMG A;  2PZU A;  3L9A X; 
#chains in the Genus database with same CATH homology
 1NE3 A;  1TWF H;  2ALY B;  1O7I A;  4TQU S;  1JB7 A;  3J7A 5;  1YHB A;  4PZ6 A;  2R6G A;  1JJ2 A;  1CSQ A;  1BBU A;  1UE1 A;  2OQK A;  3IRB A;  2VQF Q;  3J80 c;  4C2M H;  4A3K H;  1N34 L;  1WI5 A;  4GNX B;  2PQA B;  4QL5 A;  2EIF A;  4A76 A;  1FJG Q;  3JC6 6;  5C3E H;  1PH4 A;  2RHQ B;  4LFA Q;  3CCE A;  4A3I G;  2Q2U A;  1VQL A;  2JQO A;  1Q8K A;  4UPA A;  5M3F H;  3HOW G;  4B3S Q;  4PMW A;  5M3M H;  4JBW A;  3KJP A;  1HR0 W;  4JCV E;  3HOX G;  4DR6 L;  1OXS C;  2K52 A;  1Z9F A;  2CQO A;  2Q2H A;  5C44 H;  5M5W H;  3PIO A;  1MJE A;  1E24 A;  2HIX A;  1L1O C;  5GAD C;  2E2J H;  2N78 A;  2IY5 B;  3HOY G;  4B3T Q;  4DR7 Q;  4X65 L;  2K75 A;  4IPC A;  1KD1 C;  3CF5 A;  4YWL A;  2IX1 A;  3F1Z A;  1M90 C;  3FP9 A;  5FJ8 H;  2ZTD A;  4BY1 G;  2VS1 A;  1G6P A;  1VCI A;  1NMF A;  2BH8 A;  4DV7 L;  2CWP A;  1VS0 A;  1K8A C;  1WCM H;  1AE2 A;  5M5X H;  4A3G H;  5GAH C;  5GAG C;  1DGS A;  2VQE L;  1XNQ L;  1FVI A;  3U4V A;  1B7Y B;  3GTL H;  4NB3 A;  3L2P A;  3DM3 A;  2ZM6 Q;  2JK8 A;  1NTG A;  3DLL A;  1XPO A;  2MFI A;  4DR4 L;  3PO3 H;  1L1O A;  1GKH A;  3ULP A;  2VY3 A;  3RZD H;  4JI5 Q;  1JJG A;  1B8A A;  3WWV A;  2N8N A;  4LF7 Q;  3RN2 A;  4LF8 Q;  2R7F A;  3PUY A;  1YI2 A;  4HJ5 A;  1LUZ A;  1YVC A;  2K4K A;  3SGI A;  4DKA C;  3RN5 A;  1KC8 C;  2UU9 L;  4A3B G;  5DLQ E;  4GKK L;  4IFD G;  4JI8 Q;  2NN6 G;  1X3E A;  5IP9 H;  3GTK H;  4OON A;  3I4O A;  4LF9 Q;  3PO2 H;  1WJJ A;  5JJL A;  3U58 A;  3PCO B;  1SFO H;  2GVB A;  2ASB A;  4DUY L;  1N33 L;  4OWX B;  3I56 A;  2NZO A;  4X65 Q;  1VQE A;  1X3G A;  3BZC A;  3KJO A;  5E7N A;  1UEB A;  1Y1W G;  1BVS A;  5C0X J;  4IFD I;  4GKJ Q;  5C0X G;  3E0E A;  4XTC S;  2NN6 I;  3M4O H;  3GTO H;  4B3R L;  4KHP L;  2D62 A;  4DV1 L;  1NJI C;  2AWN A;  2AWO A;  2F52 A;  1N8R C;  3H3V I;  4AH6 A;  4BBS G;  3KF6 A;  3CP0 A;  1OXX K;  2CWA A;  1NY4 A;  1UE5 A;  4X66 L;  5FLM H;  1I5F A;  2R7Z G;  3KYH C;  2AMC B;  4GNX C;  1E1O A;  2NVQ H;  3K7U C;  4O0A A;  3FKI G;  3TEH B;  3CCV A;  3F2C A;  4DK6 C;  1CSP A;  3UDF A;  4DR1 L;  5LMN L;  4P75 A;  4JV5 L;  1OTC A;  4MNO A;  2UU9 Q;  1IXR A;  2Q2T A;  3CQZ H;  4JI3 L;  2K5N A;  3UDI A;  1V9P A;  1RL2 A;  4A3K G;  4KHZ A;  3BZK A;  1PH9 A;  1VQK A;  4LF4 Q;  4A3E H;  4DUY Q;  5C3E G;  3K8A A;  2VQF L;  2IX0 A;  1N33 Q;  3HOZ H;  3TQY A;  1SRO A;  2ID0 A;  3BU2 A;  4DUZ L;  4L5R C;  5M3F G;  1FJG L;  2F3I A;  5IT9 c;  1XPR A;  5M3M G;  4B3R Q;  3H0G G;  4Y52 H;  4RMF A;  4LFA L;  4DV1 Q;  3TRZ A;  2K5H A;  2N3S A;  4QY7 A;  3W5O A;  4GNX A;  1PA6 A;  3NBH B;  5C44 G;  4R1J A;  3RNU A;  1NMG A;  1PV4 A;  2NVX H;  2MQH A;  2DGY A;  3ULJ A;  1KRT A;  2KBN A;  4WJ4 A;  3RLN A;  4JBK A;  4OXP A;  3S17 H;  4X66 Q;  3CCQ A;  1SMX A;  3CCM A;  4YY3 L;  1D8L A;  1TWG H;  2XTI A;  1KL9 A;  1YEZ A;  2LXK A;  5FJ8 G;  3D31 A;  4DR1 Q;  5LMN Q;  4DR7 L;  4JV5 Q;  5C4J H;  2JA6 H;  3M4Q A;  1LM0 A;  1SE8 A;  3CCJ A;  1QVF A;  4NXN L;  4JI3 Q;  3F2D A;  3OW2 A;  1WCM G;  4JI0 Q;  4A3G G;  5IYD H;  1K3R A;  4HIK A;  1X6O A;  3S2D H;  4IPG A;  2ATW A;  3ER0 A;  1K8G A;  1EQR A;  1E3P A;  4JI4 L;  5K36 G;  4BXX H;  1VQJ A;  1Q7Y C;  4YCW A;  2K5V A;  1YZ6 A;  1YIJ A;  4DUZ Q;  4NXM L;  3OTO Q;  3PO3 G;  4JOI C;  4OO1 G;  2A1A A;  1PH8 A;  4JYA L;  2BA0 A;  1VQB A;  2VZA A;  3OYY A;  3I55 A;  4JI6 Q;  2ZM6 L;  1QUQ B;  3A74 A;  3NEN A;  1FL0 A;  1XJV A;  5IP9 G;  4JI5 L;  1EWI A;  4XIG S;  2YTX A;  2UXD L;  4X62 L;  4DR5 L;  1I50 H;  1OXV A;  4LF8 L;  4LF7 L;  1XPU A;  4AQY Q;  2JA7 H;  3PO2 G;  1OXU A;  4JBJ A;  1PH2 A;  4OO1 I;  1AH9 A;  1VQ8 A;  2UUC L;  4JI8 L;  4YY3 Q;  5LMU L;  4DV2 L;  4A3M H;  1X3F A;  2H5X A;  1XNR L;  4LF9 L;  3F2B A;  3TS2 A;  2PI2 A;  3HKS A;  4AYB E;  2MO1 A;  3CC7 A;  3RZO H;  1CKO A;  2HQL A;  3CW2 C;  4A3J G;  1E1T A;  1YHA A;  4YCV A;  3PUX A;  1Q81 C;  1IZ6 A;  1VQ7 A;  4GKJ L;  2YTY A;  1M1K C;  1KHI A;  5IE8 A;  4NXN Q;  1Q12 A;  1GM5 A;  4JOI A;  4RG1 A;  2JJQ A;  4LFB Q;  1IBL L;  1PH5 A;  1PYS B;  2WB1 E;  5FLM G;  1HR0 Q;  4OX9 Q;  4JI4 Q;  4DNI A;  2OTJ A;  1K83 H;  3STB D;  1X55 A;  1N9W A;  4L5T A;  1VQC A;  2UUB L;  2QA4 A;  1TWA H;  4HJ9 A;  2JEA I;  1D7Q A;  3S15 H;  2KEN A;  4NXM Q;  2HT1 A;  1H95 A;  4JYA Q;  2IT1 A;  4LF6 L;  1HNZ Q;  3GD7 A;  3T1Y L;  4MTN A;  2C35 B;  2VL6 A;  3PGZ A;  4GN4 B;  4QGU A;  4P73 A;  3I4M H;  4BA2 I;  3S1N H;  2B63 H;  2UXD Q;  4X62 Q;  4DR5 Q;  4IPH A;  3D0F A;  4A3E G;  3I2Z A;  3I4N H;  3I7F A;  1V1Q A;  4JI1 Q;  3CME A;  2UUC Q;  5LMU Q;  3HOZ G;  4DV2 Q;  2KCT A;  1U0L A;  1XNR Q;  1W2B A;  3CCU A;  1X54 A;  3HKZ E;  1KQS A;  3K7A H;  4LF4 L;  4QQB X;  4PG3 A;  1EOV A;  4BBR H;  5JJK A;  4BY7 H;  3CAM A;  4LUV A;  4HJA A;  2ZJQ A;  3VDY A;  4P71 A;  3EBE A;  2RF4 A;  1S3O A;  4A3C H;  4UP9 A;  3AFP A;  1IBL Q;  4WJ3 M;  5C4X H;  4AYB G;  2NVY H;  4R4I A;  2PI2 E;  2KHJ A;  4MZ9 A;  3STB C;  4X64 L;  4A3I H;  1XMO Q;  1KXL A;  2R93 H;  2UUB Q;  2UUA L;  2R92 H;  4YHH L;  3KLW A;  4LWC A;  5C0X I;  5IWA L;  1A63 A;  3KDF B;  3HOX H;  1YJ9 A;  4A3L H;  4LF6 Q;  2JA6 G;  1MJC A;  3T1H L;  3T1Y Q;  2VW9 A;  2OQ0 A;  4DV3 L;  1VQM A;  3HFZ B;  4ALP A;  3CD6 A;  2IHE A;  4BA1 I;  2JA8 H;  2E5L L;  3HOV H;  5IYD G;  4KLK A;  1YJW A;  1S72 A;  2ES2 A;  1U5K A;  4R4C A;  2JA5 H;  4BXX G;  4B3M L;  2I5L X;  1C9O A;  1SN8 A;  5GRO A;  1K73 C;  4JI0 L;  1Z47 A;  3S1R H;  3CCR A;  3CC2 A;  4YWM A;  3K81 C;  5ELN A;  1GO3 E;  3CPF A;  1I6H H;  1N32 Q;  3EIV A;  1VQA A;  4GS3 A;  3OTO L;  3CCS A;  3S1M H;  1SLJ A;  5HY6 A;  2GN5 A;  2EXD A;  1FGU A;  1PH3 A;  2AHO B;  2A8V A;  2JA7 G;  4H02 A;  2GVA A;  3NEM A;  4JBM A;  2A19 A;  3M9B A;  2YTV A;  4J15 A;  1P8L A;  2K14 A;  1YBY A;  4JI6 L;  3J81 c;  4X64 Q;  3GTG H;  4ME3 A;  4POF A;  4HJ8 A;  1VQI A;  2UUA Q;  4A3F H;  4YHH Q;  3L7Z C;  4A4I A;  4AQY L;  1HZ9 A;  1QUQ A;  5IWA Q;  3CXC A;  1XTD A;  3G71 A;  4LFC Q;  3JAM i;  3M7N A;  4GN3 B;  4L5Q A;  3T1H Q;  4PZ7 A;  1HNX L;  4DV3 Q;  1V43 A;  1X65 A;  4FDB A;  1Q86 C;  4UP8 A;  4EX5 A;  3G6E A;  4LNQ A;  3KFU A;  2E5L Q;  4QJF A;  1QZH A;  1YHQ A;  5LMN W;  1VQ6 A;  1KIX A;  1JMC A;  3ICE A;  1ASZ A;  2CCZ A;  1Y1V H;  4JC0 A;  4R4T A;  3G4S A;  1N36 Q;  1VQ9 A;  4B3M Q;  3GO5 A;  1C0A A;  4DV6 L;  1T9H A;  4LFB L;  4LW1 A;  1KAW A;  5IY0 A;  1JT8 A;  1HR0 L;  4POG A;  3TRE A;  2YYZ A;  5IYB H;  5JEA J;  4OX9 L;  2JEB I;  3PUW A;  2K50 A;  4GLA C;  3UE0 A;  4DV4 L;  5IYC H;  2UXC L;  1I94 Q;  4GOP A;  3I4M G;  1EIF A;  3B6Y A;  4BBS H;  4JI2 L;  2VNU D;  2AKW B;  4AIM A;  2B63 G;  4Y7N H;  4QIW E;  1SRU A;  1HNZ L;  1HNW L;  1QVG A;  3A5U A;  3I4N G;  1OXT A;  3LGJ A;  4YWK A;  1J5E L;  3Q8D A;  3HOU H;  1IBK Q;  1B70 B;  2E2I H;  1AE3 A;  1W3S A;  3M4P A;  3AQQ A;  2KCM A;  4IPD A;  3M85 A;  1VQN A;  3PF4 A;  2UXB Q;  1K0R A;  4JI1 L;  4DPG A;  4LUZ A;  3W1B A;  5IP7 H;  4IOC A;  4DV5 L;  4IOA A;  4BBR G;  2NZH A;  3A5Z B;  4L5S A;  1UE7 A;  2F4V L;  4BY7 G;  1HZC A;  4A3D H;  1HNX Q;  4HIO A;  2E2H H;  1BBW A;  4DV0 L;  4P74 A;  4K0K L;  3RLO A;  3PUZ A;  3TS0 A;  4A3C G;  5GQO A;  2Y0S E;  3UDX A;  2VUM H;  3ULL A;  5C4X G;  1IBM Q;  3AFQ A;  5H1S E;  4UY8 C;  2WAQ E;  1YJN A;  3A0J A;  2R92 G;  2R93 G;  4JG2 A;  4DV6 Q;  3GTJ H;  1PVO A;  1IYJ B;  4C3I H;  4GOP B;  3MEF A;  4C3J H;  1HJP A;  1PH7 A;  4APV A;  3J81 i;  3H0G H;  4A75 A;  3CC4 A;  2L15 A;  4DV4 Q;  1XMO L;  4A3L G;  2UXC Q;  3E9I A;  1PYB A;  2Q2I A;  2B29 A;  3KOJ A;  4JI2 Q;  4O2D A;  3GTQ H;  2JA8 G;  1LYL A;  3J81 j;  5ELO A;  3HOV G;  1X56 A;  4A93 H;  2R7D A;  3F8T A;  2JA5 G;  2D0P A;  1HNW Q;  1CKN B;  1LTL A;  1C7Y A;  1J5E Q;  4PZ8 A;  2ZTC A;  3K0X A;  3KDF A;  2EQS A;  1VQO A;  1XMQ Q;  4DR2 Q;  4DR3 Q;  2HHH L;  4LF5 L;  1BKB A;  2LXJ A;  3PSI A;  2OWO A;  2PMZ E;  3S24 A;  1L0W A;  2ZJP A;  1VQF A;  4DV5 Q;  3K80 C;  3JAM c;  3PF5 A;  3MXN B;  2F4V Q;  2PNH A;  2V1C C;  1QVC A;  4DV0 Q;  1A8V A;  4K0K Q;  2I0Q A;  1KRS A;  1N34 Q;  2RCN A;  1P16 A;  1Q82 C;  3H15 A;  1G51 A;  1N32 L;  4HID A;  2E8G A;  3E9H A;  2MO0 A;  1NBW A;  2YV5 A;  4GLX A;  2ZTE A;  2BA1 A;  1CKM A;  4A3F G;  5BR8 L;  1YNX A;  1JE5 A;  1TWH H;  4JI7 L;  4R4O A;  4LUO A;  1EFW A;  2FXQ A;  4GLV B;  4DR6 Q;  4IFD J;  3S14 H;  1A0I A;  1E22 A;  1WYD A;  1VQG A;  1A62 A;  1HZA A;  2Y0S G;  4R4Q A;  5JJI A;  2DUD A;  3HOW H;  2RHS B;  1VQ4 A;  2WAQ G;  1Q46 A;  5M5Y H;  4OWW B;  4LFC L;  2JE6 I;  1VQP A;  1IL2 A;  3L0O A;  1Y1V G;  2WB1 G;  1RIP A;  3J80 i;  2HHH Q;  1HZB A;  1VQH A;  2MNA A;  4YCU A;  3AYH B;  4LF5 Q;  1Y14 B;  1GD7 A;  3AEV A;  4IJH A;  2NVT H;  5IYB G;  1UWV A;  3HOY H;  4A3J H;  3NEL A;  1N36 L;  5IYC G;  1TXY A;  3W1G A;  2HIV A;  1GVP A;  4DV7 Q;  2YU9 H;  2N49 A;  2I5M X;  2KHI A;  1Q1B A;  5AJ3 L;  2OCE A;  4BY1 H;  5FLX c;  1WOC A;  3PV0 A;  1G29 1;  4KI0 A;  1I94 L;  1Q1E A;  2VQE Q;  1XNQ Q;  3HOU G;  1L1O B;  1CUK A;  3CPW A;  1PHJ A;  1JJC B;  1L2F A;  2WFW A;  3KF8 B;  4C3H H;  1ASY A;  5J3B A;  4DR4 Q;  2QGQ A;  5BR8 Q;  3RLF A;  4JI7 Q;  3HKZ G;  1WFQ A;  2CKZ B;  2B3G A;  5IP7 G;  1S40 A;  4GOP C;  3FHW A;  4DAY B;  1IBK L;  1MKH A;  4A3M G;  4A3D G;  1EQQ A;  2LSS A;  2XGT A;  4GKK Q;  3UE1 A;  3BJU A;  3UDG A;  2UXB L;  3GTP H;  1X9N A;  1EYG A;  2BH2 A;  2VUM G;  3S2H H;  3U50 C;  4EQ5 A;  4OWT B;  4A3B H;  1E7Z A;  1QZG A;  4IO9 A;  1VQD A;  2Z6K C;  2I5H A;  4HIM A;  4HJ7 A;  5GAE C;  4DK3 C;  4KHP Q;  4X6A H;  3H3V H;  1IBM L;  3S1Q H;  1I3Q H;  3J7Z C;  3KF6 B;  3GDE A;  4GN5 A;  4IJL A;  1SR3 A;  3EN2 A;  1J6Q A;  1TWC H;  1Y1W H;  1K9M C;  2PQA A;  1EUJ A;  1PFS A;  3G48 A;  5HGQ A;  1PH6 A;  3S16 H;  4UP7 A;  4B3S L;  3PIP A;  3GTM H;  1YIT A;  3RR5 A;  5JEA G;  5AJ3 Q;  1R9T H;  3CCL A;  1HH2 P;  2CFM A;  1EIY B;  3M3Y H;  1UE6 A;  4A93 G;  4NPS A;  2WP8 J;  1PH1 A;  2OTL A;  4P72 A;  3PUV A;  4DAM A;  4TVA B;  4B3T L;  2Z0S A;  3ZJY C;  1VQ5 A;  2R7Z H;  1XMQ L;  3ERS X;  2ZJR A;  4DR2 L;  3U4Z A;  3CMA A;  4DR3 L;  1MIU A;  2Z6K A;  3FKI H;  1CKN A;  2D0O A;  2IHF A;  5EAY A;  2JA9 A;  2QEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...