1SROA

S1 rna binding domain, nmr, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
76
structure length
76
Chain Sequence
AEIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags S1 rna-binding domain
molecule keywords PNPASE
publication title The solution structure of the S1 RNA binding domain: a member of an ancient nucleic acid-binding fold.
pubmed doi rcsb
source organism Escherichia coli
total genus 4
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 1996-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sroA00
1VQBA 4JI6L 4DR1Q 5IP9G 3HOZG 5GAGC 2E5LL 1XPUA 1QUQA 3I56A 4A3MG 1O7IA 1IBLQ 4B3MQ 4A93G 1VQFA 2ZJPA 3TQYA 1T9HA 4DR2L 3A0JA 1YJNA 4A3FH 1HNXL 3PV0A 4TQUS 3UE1A 3CMAA 2MNAA 2AWNA 3HFZB 4GKJL 2BA1A 5IP7G 1YJ9A 4IPGA 2VW9A 1HNWQ 3CQZH 3RLOA 1YJWA 1QVGA 3K81C 3PO2H 1LYLA 1S72A 1XMQQ 3F1ZA 5EAYA 3S1RH 3DM3A 1IBKL 1PA6A 4A3DG 5FJ8G 3CCEA 4NXMQ 4JBMA 1I50H 3L0OA 4JG2A 4A3KG 3HKSA 5LMNQ 1PH6A 4POGA 3HOUG 4JYAL 3HOZH 4DV2L 5H1SE 1E1OA 4HJ8A 1HH2P 1EIYB 3M7NA 4A93H 2R93G 4A3GG 3MEFA 4BXXG 1V1QA 2N3SA 2UUBQ 2Q2HA 1CKOA 2IHEA 3GDEA 4IO9A 2JA9A 1PH2A 4B3SQ 1X9NA 3GTMH 1A62A 4YWKA 4DUYQ 1UE5A 5C3EG 1PYSB 2UXCL 4A3JG 1J5EQ 2YV5A 3PUZA 5IYDH 1TWCH 5DLQE 1WJJA 3D31A 2K50A 1BKBA 1Q82C 3CD6A 3GTQH 1L2FA 4JI8L 2RF4A 5M5YH 3I4OA 4A3BG 3B6YA 1TXYA 4J15A 1XNQQ 3J80i 1N9WA 4LF6Q 4DV1Q 1B70B 1X6OA 3M4QA 4X66Q 2CKZB 2EIFA 3F8TA 3W1BA 3RLFA 2R93H 3K80C 4KHPL 2HIXA 4ALPA 4OWXB 1K8GA 1NJIC 2WAQG 3KJPA 1BVSA 3ERSX 4LFCQ 3A5UA 1L1OB 1XTDA 4P73A 2ES2A 1X65A 2VQFL 5C3EH 5C0XI 3PUXA 2FXQA 2KHIA 5C0XG 4DV0Q 5M3MG 1XPOA 1KRSA 4BY7G 2JK8A 3WWVA 1JJCB 2F3IA 3F2CA 2K5HA 1SR3A 3KOJA 4LF5Q 3CAMA 3HOVG 3HOWG 1PHJA 5JEAG 1WCMH 4LF8L 4JC0A 2QA4A 4A3BH 4GKKQ 4YCVA 1G291 5BR8L 3J81i 4QQBX 3S24A 4DUZL 1SE8A 4K0KL 1VQKA 1VQ6A 4GN3B 1EQRA 3GTOH 1K8AC 3STBC 4JI1Q 3L7ZC 5IWAQ 1VQ5A 3CC2A 4P71A 5M5XH 2VQEQ 2OQKA 1JE5A 1MJEA 4JI6Q 4L5SA 2E5LQ 1J6QA 1E22A 3D0FA 2OWOA 2B63G 1KAWA 5GQOA 4DR2Q 3RN5A 4R4CA 2NVQH 1HNXQ 4LF9L 3AYHB 2VUMG 1X56A 1OTCA 4QJFA 5M3MH 1X3EA 4GKJQ 1KIXA 4QIWE 2OTLA 2JA5G 1PH5A 3EIVA 2UU9Q 3STBD 1I94L 3UDIA 1K0RA 4RMFA 1EYGA 3A5ZB 2OTJA 3M9BA 4P74A 3G6EA 4X65Q 4LWCA 2ZTCA 3KJOA 1IBKQ 5LMUL 3CXCA 4QGUA 1V43A 2QGQA 4UP9A 1SROA 1W2BA 1Q7YC 1L1OC 2RCNA 3CPFA 4JI4L 1VQ9A 3RN2A 3S16H 4JYAQ 2B29A 1HZBA 1NBWA 3NEMA 3GTJH 4DV2Q 2YU9H 4BBSG 1I6HH 2B63H 1V9PA 3BU2A 1VQLA 1CKNA 1QZHA 3GTPH 1G6PA 3OW2A 1B8AA 4DAMA 3NBHB 4DR7L 4YHHL 2VUMH 1KL9A 4UP8A 4HJAA 3TS2A 1TWHH 1UEBA 3ULJA 2JA5H 4HIOA 3PO2G 5IY0A 3HKZE 3CCQA 5LMNW 2HHHL 1DGSA 2WFWA 3EN2A 2E2HH 3A74A 4GOPB 4JV5Q 4XTCS 1AH9A 2HIVA 4JI8Q 1Q12A 4A3IG 3KF8B 1CKMA 1IBML 4X62L 1IXRA 2I5LX 2HT1A 2NVTH 3LGJA 4UP7A 1L0WA 3S15H 4BBSH 4X6AH 3PUWA 1HZCA 3JAMi 4KHPQ 4GNXA 3Q8DA 1OXSC 4GN5A 4IJLA 1BBUA 2NVXH 1SRUA 1UE6A 1L1OA 3GO5A 4JOIC 5GAHC 2JA8G 1Y1VG 1YI2A 1EUJA 1SN8A 1IL2A 4LW1A 4WJ3M 3JC66 2VY3A 2HQLA 5IYBG 5IYDG 4EX5A 2VQFQ 1ASYA 2UUCL 4LF4L 3PIPA 1GM5A 3E0EA 4L5RC 1PH9A 2VS1A 4JBWA 3BJUA 4NPSA 4DV6L 1U5KA 3PUYA 1OXVA 2R6GA 4A3IH 1SFOH 2UXBL 2UXDL 1M90C 4LF8Q 5C4XG 4IOAA 3OTOQ 1I5FA 5BR8Q 4B3TQ 1FVIA 1WOCA 3AFQA 4DUZQ 4A76A 4K0KQ 1A0IA 1N32L 3UE0A 1CKNB 1C0AA 2WB1G 2XGTA 4C3IH 1PFSA 2Z6KA 3ULLA 2JEAI 2JA8H 3ULPA 1Y1VH 2PI2A 4R1JA 2CCZA 4GOPC 1YHAA 3GTKH 3MXNB 4LF9Q 5IYBH 3PUVA 4A3LG 4PG3A 2CFMA 4BA1I 2JE6I 3UDXA 3GTGH 1I94Q 3I4NG 1VQIA 1WCMG 4JOIA 3SGIA 1NY4A 2EQSA 2K5VA 2ZM6L 4IPCA 1OXUA 1QVFA 2OQ0A 2AHOB 2VNUD 1JT8A 5C4XH 2NN6I 4JI5L 2Q2UA 2NN6G 1VCIA 2KENA 3K0XA 5LMUQ 1VQCA 4APVA 4P75A 5FLMH 1LUZA 4Y7NH 4MTNA 1MIUA 4NXNL 3E9HA 2B3GA 2GVBA 1CSPA 4C3HH 4GNXB 5IE8A 4PMWA 2Q2IA 1CSQA 2YTYA 1UE7A 1OXTA 1UE1A 2ID0A 1OXXK 1PH7A 1A63A 3GTLH 1KC8C 1JB7A 1NE3A 5M5WH 4PZ7A 2QEXA 1B7YB 4JBKA 1KD1C 4DR6L 4A3LH 2N49A 4YHHQ 3S2DH 2WP8J 4DR7Q 5IT9c 4DV3L 4DV7L 3PF4A 4TVAB 4JI2L 1D7QA 3S1MH 3J7A5 1NMGA 5K36G 3J80c 3I4NH 2E8GA 2HHHQ 2WAQE 3U4ZA 4GOPA 4BY1G 4DV5L 1VQAA 1D8LA 2CQOA 1K73C 3BZCA 3J7ZC 3W5OA 1C9OA 1E7ZA 1AE3A 3RLNA 3HOYH 3OYYA 1X3GA 2PI2E 1IBMQ 3RZOH 4X62Q 3G4SA 4JI3L 1Z9FA 1H95A 1QVCA 1HNZL 2XTIA 1VQ4A 1YIJA 1UWVA 4BBRG 1VQGA 5GAEC 3KYHC 5GADC 2JEBI 4NXML 3M4OH 1FJGL 1RIPA 1VS0A 2IY5B 1HR0L 1E1TA 4A75A 2VL6A 4AYBG 5ELOA 3S2HH 1PH4A 1A8VA 2UUCQ 3H0GG 3ICEA 3J81c 4LF4Q 1NMFA 3I55A 4HJ9A 1VQHA 1LM0A 5C44H 4BY1H 4LFAL 4GLXA 4GNXC 2A8VA 4IPHA 4DR3L 4GS3A 4DV6Q 2A1AA 2JQOA 4MZ9A 2UXBQ 1W3SA 1P16A 2UXDQ 3T1HL 4KI0A 2LSSA 2F4VL 4JCVE 1P8LA 2IHFA 1XMOL 5C4JH 1FL0A 1N32Q 1SLJA 1EWIA 5J3BA 4YWMA 1RL2A 4BBRH 3M85A 1WFQA 4EQ5A 1YEZA 2NZHA 2AKWB 3HOXH 3U50C 1YHBA 2V1CC 2YTVA 4IOCA 2UXCQ 5HGQA 4WJ4A 3H0GH 4JI0L 1YVCA 1VQPA 1KXLA 3S17H 4BA2I 3NENA 4O0AA 3PF5A 1S40A 1N34L 4R4OA 3RR5A 4DKAC 2N8NA 4DAYB 2ZM6Q 2R7FA 2Z6KC 1VQ7A 1G51A 2Y0SG 3GD7A 4POFA 4OONA 4JI5Q 4OX9L 1WI5A 1Y1WG 1Z47A 1PV4A 4DV0L 1Q8KA 1HJPA 2ZTEA 1VQDA 2LXJA 3M4PA 4GLAC 4R4QA 4LF7L 3RZDH 3S1NH 5JJLA 3CW2C 1X3FA 1K9MC 4GKKL 1N36L 4P72A 4A4IA 1Q1BA 2MO0A 1XJVA 4AH6A 4X64L 3CCLA 3KF6A 4PZ6A 4IFDJ 1YZ6A 1BBWA 4DR6Q 3W1GA 2R7DA 3ER0A 4DV3Q 1GD7A 1Q46A 5IWAL 4DV7Q 2VQEL 4JI2Q 2ASBA 3G71A 1HZAA 3PO3G 1GO3E 1U0LA 4RG1A 3CCVA 5ELNA 4L5QA 4HJ5A 1VQJA 2LXKA 1PH3A 5AJ3L 4DK6C 3TREA 2UUAL 4DV5Q 3IRBA 3JAMc 1Y1WH 1R9TH 5FLMG 2R7ZG 4HIMA 2VZAA 2BA0A 2ZTDA 2UU9L 3EBEA 1N33L 1GVPA 1N8RC 1TWFH 3BZKA 3PIOA 4JI3Q 2IX1A 4KLKA 2MO1A 2JA7H 2I5HA 5GROA 1ASZA 1HNZQ 1KHIA 4OO1I 2JA6H 4X65L 5E7NA 4DV4L 4OO1G 1PVOA 4AQYL 4JI7L 2IX0A 1X55A 2K75A 4DR4L 1GKHA 2H5XA 3CCJA 2E2JH 1XNRL 1FJGQ 2A19A 3CCUA 1PH1A 3E9IA 1HR0Q 3AQQA 3KFUA 4B3RL 2MFIA 1CUKA 5IP9H 2WB1E 2K4KA 4YY3L 3T1YL 2I0QA 4DR5L 4A3MH 3PO3H 3KDFA 3UDGA 4C2MH 1QZGA 3M3YH 4LFAQ 5IYCG 2KBNA 1FGUA 3PSIA 4DR3Q 3RNUA 4OWWB 2GN5A 2R7ZH 3HOYG 1PYBA 4UPAA 3TS0A 4JI4Q 3TRZA 5IP7H 5JJKA 4H02A 3CCMA 4LFBL 3T1HQ 4LUZA 4MNOA 2AMCB 3CP0A 3PGZA 1E24A 2F4VQ 2PQAA 2NVYH 3H3VH 1XMOQ 1JMCA 4XIGS 2DUDA 3CPWA 4HJ7A 4JV5L 3KF6B 4A3CG 2NZOA 3CC4A 1YBYA 5FJ8H 1VQNA 4A3DH 1K83H 5M3FG 4A3EG 4DR1L 4A3KH 2KHJA 4NB3A 3HOUH 4KHZA 1IBLL 4B3ML 2CWAA 2GVAA 1QUQB 2I5MX 2PNHA 1EOVA 1LTLA 5C44G 4ME3A 3PCOB 4JI0Q 4UY8C 3K8AA 4BXXH 4A3GH 1YITA 3ZJYC 3CCSA 5IYCH 1N34Q 3F2DA 3KLWA 1Q86C 2EXDA 3L2PA 2K14A 1SMXA 2Z0SA 2L15A 2ZJRA 1HNWL 1I3QH 5JJIA 4C3JH 4OX9Q 4A3JH 5C0XJ 1XMQL 4O2DA 1KQSA 4LF7Q 1MKHA 4R4IA 4A3CH 1Y14B 3K7AH 3J81j 1VQEA 3HOXG 3DLLA 5JEAJ 1N36Q 4GLVB 5LMNL 5M3FH 3OTOL 4A3EH 2C35B 2BH2A 2R92G 4X64Q 4B3TL 3AEVA 3FHWA 3G48A 3VDYA 3I4MG 4GN4B 2YTXA 3KDFB 2MQHA 1KRTA 4DK3C 1M1KC 2Q2TA 2UUBL 1VQOA 1YNXA 3AFPA 3F2BA 1HZ9A 4B3SL 1Q1EA 3I2ZA 1TWGH 4DUYL 5AJ3Q 2UUAQ 2E2IH 4AYBE 3TEHB 1J5EL 3CCRA 3S14H 3CMEA 2PQAB 2JJQA 2PMZE 3H15A 1C7YA 1MJCA 4BY7H 2IT1A 3I7FA 1X54A 2K52A 2KCMA 1N33Q 4YWLA 4OWTB 4AIMA 4DPGA 1PH8A 1TWAH 1XNQL 3H3VI 3HOVH 3HOWH 4LF6L 4R4TA 2F52A 4DV1L 2D0PA 2ATWA 2CWPA 2R92H 4DV4Q 4X66L 2ALYB 1AE2A 4AQYQ 3U4VA 2AWOA 1EIFA 1EQQA 3FKIG 4IPDA 2RHQB 4JI7Q 3I4MH 4DR4Q 2OCEA 1XNRQ 1IZ6A 3K7UC 4B3RQ 2ZJQA 3HKZG 2BH8A 1K3RA 4QY7A 4HIKA 1S3OA 4YCWA 2D0OA 4LUVA 1IYJB 4YY3Q 4LFCL 3T1YQ 3UDFA 4DR5Q 3U58A 4JBJA 4DNIA 4A3FG 4FDBA 1VQ8A 3CC7A 5FLXc 1XPRA 1EFWA 1JJ2A 4Y52H 1E3PA 3NELA 4LUOA 4YCUA 4L5TA 2KCTA 4NXNQ 2K5NA 1NTGA 4LFBQ 2YYZA 2JA7G 4LF5L 4QL5A 4PZ8A 2RHSB 4IJHA 3CF5A 1HR0W 2N78A 2JA6G 1YHQA 4IFDI 2Y0SE 3FP9A 1VQMA 4IFDG 2DGYA 4LNQA 1JJGA 5HY6A 4OXPA 4JI1L 3FKIH 4HIDA 3S1QH 1Q81C 1WYDA 2D62A
chains in the Genus database with same CATH superfamily
2MGSA 1VQBA 4DR1Q 5IP9G 5GAGC 4B3MQ 2RQXA 4M8AA 1VQFA 3K59A 3EFXD 4A3FH 1JOKA 3HEJA 3UE1A 4KD4A 4H44C 2R61A 4X3UA 3CQZB 2MNAA 4H7BA 4RAUC 2BA1A 5IP7G 5LHY1 4NMZA 2F0TA 3JAML 3K81C 2ZXRA 1XMQQ 3NSWA 1JQYD 3OMCA 4A3DG 3CCEA 4JK1C 3HKSA 5KYIA 4POGA 3K5NA 4JYAL 3TP5A 4HJ8A 1HH2P 4F88A 2IHEA 4F8MA 1PH2A 3V2TA 2KEDA 5D65A 2QF7A 5EQ0A 3TZDA 4A3DB 1SNPA 2K50A 4PMCA 1CQVA 5M5YH 3I4OA 1XNQQ 1N9WA 4LF6Q 1B70B 1I4XA 3AMUA 2EIFA 3W1BA 4V190 1UEAB 5KEEA 1IYUA 4G57A 2X6LA 4OWXB 1EWHA 2SEBD 2WAQG 1BVSA 2WIIB 3P1HA 2F0SA 5C3EH 3PUXA 2FXQA 1BCPF 1KRSA 4WJWA 3F2CA 4ZAIA 3I3CA 3QOLA 4DNRB 4GKKQ 2QA4A 2F0KA 3S24A 5L37A 2SOBA 1VQ6A 1O7ZA 3PIO3 2L1BA 2F03A 2B2VA 4MIUA 3HZXA 3AU7A 2OQKA 1JE5A 1KNEA 4U673 4RKBA 2E5LQ 1O7YA 3S14B 1E22A 2EY2A 3D0FA 3RN5A 1HHVA 1HNXQ 4ILWA 2VUMG 1OTCA 1TWAB 4QJFA 1X3EA 4X3KA 2OTLA 4UDUC 3STBD 5ELEA 1X32A 5K36H 1KTKA 1K0RA 1EYGA 5EGTA 5JEAH 2R3ZA 2OTJA 4X65Q 4WORA 1SEBD 1EIGA 5BN4A 1Q7YC 2XIWA 4JI4L 1VDZA 1HA6A 5I2YA 1WVLA 2B29A 1GHJA 4DV2Q 1I6HH 1V9PA 1VQLA 3VA5A 4YHHL 3SDZA 4QUCA 4OIKA 3ULJA 4HIOA 2TSSA 3HKZE 2JYOA 4K2KA 2HHHL 3ONAB 2E2HH 3A74A 4PV1C 4GOPB 4XTCS 3RD4A 2HIVA 3NE5B 1Q12A 3KF8B 5JJZA 4A3FB 2I5LX 2HT1A 2A6HD 1L0WA 4X6AH 3PUWA 3Q8DA 4IJLA 1S5DD 4ZUIA 1DZ1A 4WJ3M 2VQFQ 1HTLD 3MHBA 1SFOB 2MPMA 1XXGA 1PH9A 2VS1A 3BJUA 1EZ8A 4NPSA 2K03A 3PUYA 2UXBL 1BNZA 4LF8Q 4IOAA 1PLFA 2EYLA 4IUPA 1ET6A 1OO9B 2L11A 3AFQA 3BYTB 3I70A 1A0IA 2PW5A 1N32L 4KTAA 2QEJC 2KVMA 1Y1VH 1TT2A 3K6OA 2CHBD 4WRDA 5IGGA 1YHAA 4GOPC 4LF9Q 4TRDA 5M5YB 4PG3A 3DEPA 2CFMA 2G5DA 1BO0A 5CMDA 1EWCA 2JE6I 2RA4A 3GTGH 1NUCA 1VQIA 1Z6HA 3SGIA 1NY4A 1MHWC 1OXUA 2VNUD 2OQ0A 5C4XH 4TKOB 2PYKA 3KBGA 4DXGA 5FLMH 3EJIA 1MIUA 1RCVD 1S5CD 5C3EB 2QKIC 1WD1A 2FHTA 1NSNS 2WKDA 1R4PB 1NE3A 2B2UA 1U4MA 2B2TA 2K5DA 1LTBD 4DR7Q 3S2DH 4JI2L 1JE4A 2KJXA 5K36G 3J80c 1BCPD 2N88A 4BY1G 2RCFA 2CQOA 1K73C 1IKMA 3J7ZC 4B9XA 4R8NA 4QB4A 2ICEC 1X3GA 1IBMQ 3NTKA 1H95A 4RFBA 4HMIA 1V1PB 1HNZL 2XSCA 1TS2A 3MXPA 2IY5B 4FP5D 3X3NA 2F0GA 1D6EC 3S2HH 1PH4A 3H0GG 2BDOA 3LNNA 4LF4Q 1U4RA 3I55A 3F2UA 4EQOA 1H9KA 4GS3A 2E74C 2A1AA 4DV6Q 1I6HB 2PZWA 3LWUA 2IJ0A 2F4VL 4JCVE 2F4IA 2CW0D 3TN2A 4BBRH 2K5QA 4EQ5A 5I6YA 5KNCA 2NZHA 3U50C 2E2HB 2V1CC 2UXCQ 1Q90A 1F9PA 1MD2D 1F2YA 4DF7A 2KUMA 2D5DA 4BA2I 5CORA 1CA6A 3VR6A 2Z6KC 1HQMC 4HMJA 1WI5A 2FINB 1Y1WG 1PV4A 4K6DA 1Q8KA 1K8OA 2IL8A 1IKLA 5CV8A 5JJLA 1GUWA 1GUNA 3CW2C 1X3FA 4GKKL 1N36L 1XJVA 4AH6A 4CKCA 3CCLA 4IFDJ 4LMQD 1YZ6A 4YIJA 1BBWA 4DR6Q 1A3TA 2R7DA 3ER0A 4DV3Q 1GD7A 4DV7Q 3MFYA 1ZKOA 5KIXA 1RJTA 3CCVA 4L5QA 1VQJA 1PH3A 1LO5D 5AJ3L 4DK6C 3TREA 5I6WA 2UUAL 1PXUA 4FF4A 3TDQA 1FNVA 3JAMc 5FLMG 1S5FD 2VZAA 2ZTDA 1Y1VB 3EBEA 3OMGA 2IX1A 1TWFH 3PIOA 2MO1A 1K28A 2XWBB 4OO1I 4X65L 1PVOA 2B2WA 4QF4A 3GTGB 4IFDH 1X55A 2K75A 1XNRL 1FJGQ 5C4XB 3TSSA 3KFUA 1CUKA 4I7AA 1F9RA 3NUCA 1ENFA 3PSIA 5JJKA 4H02A 4LFBL 4MNOA 3CP0A 1E24A 1DOMA 3R3OA 3T16A 3S2DB 1I4QA 4CKBA 3CPWA 4RGMA 3KF6B 1YBYA 5M3FG 2JP1A 3MA2B 3HOUH 4IUTA 2GVAA 1TY2A 2PNHA 1LTLA 4JI0Q 3M4YA 4ME3A 3PCOB 4UY8C 1ZXTA 1YITA 3F2DA 4RGNA 3KLWA 3G7LA 1Q86C 1MI2A 2ZT9C 1SMXA 2ZJRA 2LS01 1HNWL 1I3QH 2EDGA 4OX9Q 5JJIA 3L9AX 5C0XJ 2E2DC 2K5WA 1LABA 4K14A 3S2HB 3J81j 3DLLA 2DJGC 1HFGA 1G6ZA 1S5ED 3AEVA 3VDYA 1ESRA 3SR1A 2F3WA 4Z9CB 4LJZC 3OIPA 4KJOA 1YNXA 1PFMA 3AFPA 1HZ9A 4B3SL 2EYFA 1EU3A 4BBRB 4AYBE 3TEHB 1EY6A 3CCRA 2PQAB 1NR2A 1PZJD 5C0XH 1C7YA 5KRUA 2IT1A 1PZKD 5JVG3 4ZKCB 2KCMA 1LT5D 2NTSA 3GP7A 3KLSA 4DPGA 4Q0FA 1EY8A 1L0XB 2EJMA 2D0PA 2R92H 4JI7Q 1EQQA 4IPDA 4B3RQ 3M3YH 3T1YQ 2D0OA 2QW7A 4LFCL 3UDFA 5JPNC 5G3LD 4ULLA 1EFWA 5E4XA 2ICIA 2K5NA 2Q8TA 4FVMA 1B4OA 1TQOA 3CF5A 1B44D 2N78A 1YHQA 3BG3A 3FP9A 3IFDA 1GHKA 1VQMA 2I46A 4IFDG 4IUVA 2QDBA 1CFMA 1BBXC 3I90A 4HIDA 3FKIH 3HOZG 1IYVA 1QUQA 4NW2A 4A93G 1O7IA 1QE6A 3DMUA 1L0YB 4DR2L 4S3SA 4DA2A 1B3AA 3PV0A 4TQUS 3DWQA 1TWFB 4GKJL 4N9TA 4XT3B 1YJ9A 1A15A 1QNUA 4KN4C 3CQZH 3RLOA 1YJWA 3HRZC 2K01A 4HAEA 1S72A 3F1ZA 5DAUA 2Z4HA 2H1EA 2KOLA 4DAVA 2M2LA 5CR3A 1II3A 1LTRD 5C3WA 3A8JE 4FXKC 5LMNQ 3HOUG 4DAPA 4K8JA 5LL6S 4CJ1B 5H1SE 2Q8RE 3M7NA 2R93G 2EPBA 3MEFA 2N3SA 3V05A 3GDEA 3O13A 2JA9A 4IO9A 4KV6A 4MHEA 2Z1CA 4DUYQ 1UE5A 1YNND 1PYSB 2UXCL 1G91A 3PUZA 1TWCH 1D2BA 5DLQE 4ZCKA 3GTQH 4OIJA 3HOUB 1EQVA 3A7LA 5E4WC 3G6JB 1ICFB 1K3BC 1H9SB 5I4DA 3B6YA 1TXYA 4A3BG 3ND9A 3AB9A 2D2CC 2B2YC 4EGVA 3R8BA 4X66Q 3F8TA 1SYBA 5CV7A 2HIXA 3PQIA 4BS9A 1I3QB 1NJIC 2KHSA 5IGFA 4KY7A 5COYA 3A5UA 5BN3A 2F3VA 4P73A 2ES2A 1T5EA 2MUYA 1AZPA 3Q6SA 4DV0Q 2KEEA 5C0XG 1U9RA 3MVVA 2F3IA 4DN4M 1KDAA 2EYMA 3URYA 4JC0A 2EY5A 3I72A 4YCVA 1W6JA 4DUZL 2AQ2B 3KF8A 4HCEA 1K8AC 3STBC 1VQ5A 3CC2A 5M5XH 5CGKA 2NVQB 1MJEA 4M1UB 4JI6Q 1SJHD 2B63G 5GQOA 4R4CA 1UNSA 4G7OC 2PZUA 1ILPA 4XQNA 1CT1D 1HCZA 1A2UA 2JA5G 1I94L 2R92B 3UDIA 2L12A 3M9BA 4P74A 1LACA 5IGDA 1IBKQ 5LMUL 4QGUA 1V43A 2QGQA 1W2BA 3RMHA 1VQ9A 3RN2A 3S16H 2OT2A 1HZBA 1DJRD 1PTOF 2VUMH 1KL9A 4HJAA 1UEBA 5IY0A 4RHRA 2MHVA 1DGSA 3FKIB 1TIID 1SAPA 4JV5Q 1AH9A 4WFN3 4JI8Q 3W2DA 2PPBC 3MXUA 1G8ZD 2RKSA 5I2XA 3D3RA 4KHPQ 1BR9A 3I91A 4GN5A 2NVXH 2JA8G 1L1OA 1A3UA 4JOIC 4C1NI 5GAHC 1S5BD 3JC66 1BCPB 5IYBG 2VB2X 3A8KE 1GM5A 4CDCC 4KKUA 1X3QA 2R6GA 1SFOH 3OTOQ 1I5FA 5BR8Q 2PW7A 1FVIA 4K0KQ 4A76A 4I7ZC 1AEXA 1EY7A 1SDFA 1CKNB 4CDEC 1KLUD 2WB1G 1K0SA 1TWCB 2Z6KA 3ULLA 4G7HC 3GTQB 2PI2A 4R1JA 3OPOA 2AUKA 2PZTA 4A3LG 4BA1I 1XYIA 3VR2A 3I4NG 1YNJC 1ML0D 1SNMA 2AHOB 1IL8A 2FMMA 2M00A 3K0XA 2WB1B 1DYQA 2CH4W 4PMWA 1U4PA 1CSQA 1BCPC 2YTYA 1CHPD 1UE1A 2ID0A 3OWEB 4KMUC 5DNFA 3TP6A 3MC0B 4L63B 5J22A 5M5WH 2EJFC 1SSOA 1B7YB 3NBHA 4JBKA 1M8AA 1KD1C 5EPJA 2F0WA 4ME5A 3PF4A 2LFNA 3MTSA 1EYAA 3J7A5 1Y8PB 4KK7A 2E8GA 3E0JA 3U4ZA 3IL8A 1MGSA 2FMCA 5M5XB 5EBCA 4DV5L 1C8CA 2F0FA 5ELDA 3W5OA 4KD3A 4HSVA 1E7ZA 3QG1A 2WAQB 3HOYH 3OYYA 2PI2E 3RZOH 4X62Q 2CVRA 2JXMB 3BVMA 3OSOA 2RDGA 2XTIA 1VQ4A 1YIJA 1UWVA 3TMEA 5GAEC 3K5OA 4CKEA 2JEBI 3BZDB 1RIPA 5CBAE 2VL6A 3E6ZX 1A8VA 2CW0C 5KNBA 5M9OA 1CA5A 2UUCQ 1VQHA 2K04A 1LM0A 4BY1H 4LFAL 4GLXA 3S16B 4DR3L 2JQOA 4HN7A 4OEMB 2UXDQ 4B9WA 3P7JA 2VUMB 2Z6BA 3J81E 1XMOL 1EWIA 5J3BA 1I4HA 4YWMA 1WFQA 2AKWB 1GUGA 3HOXH 4F87A 5FO8B 2YTVA 4IOCA 3Q24A 4WJ4A 1PTOD 4FXDA 3H0GH 3S17H 2QDLA 1S40A 1N34L 3RR5A 4DKAC 4DAYB 1VMPA 2ZM6Q 2Y0SG 2L5TA 3R2TA 4POFA 3VR4A 4JI5Q 3LX0A 2NVXB 1Z7TA 4DV0L 2ZTEA 4GLAC 1V8QA 4R4QA 5IODA 4LF7L 1C4QA 1K9MC 4P72A 2C5CA 4P2CB 3HG9A 1DONA 3KF6A 2DNEA 3VYUA 3G71A 3PO3G 1B9MA 4IQZA 4HJ5A 2LXKA 1QJOA 1SYDA 1Y8NB 3IRBA 1Y1WH 3WOFA 1R9TH 2R7ZG 1KABA 2B8FA 3J7YW 3V96A 2MJ8A 3RUZA 1HUMA 2E76C 4JI3Q 4KLKA 3VYSA 2JA6H 4DV4L 4AQYL 2PCFB 1GUSA 2WKCA 3T51B 3DXJC 3CCJA 1PH1A 3E9IA 1HR0Q 2KECA 4RWSC 3DWPA 4FXGC 1EOTA 4C2MH 5C5LA 4OWWB 3HOYG 1LTAD 2GN5A 4ZLTF 4NDXA 4UPAA 1TKWB 3TRZA 5CV4A 3CCMA 5M5WB 3T1HQ 4C3JG 4E6IA 3SVMA 4IURA 3U9SA 2PQAA 1YNJD 5C3XA 1JMCA 4JV5L 4A3CG 2NZOA 3CC4A 1VQNA 1K83H 4HEDA 4DR1L 2KHJA 4B3ML 5IT9L 1I4PA 1HPCA 1CZWA 2K28A 1EOVA 3HOYB 2F0JA 1IW7D 3HS0C 3T4AC 4A3GH 2ENBA 3RZOB 5CC4A 1O80A 3PIP3 3I4LA 1STNA 1JC7A 2GA4B 3D8GA 4DNTB 1XMQL 5T1GA 2O2LD 3W3AA 3HOXG 3NTHA 1STGA 2BOSA 5M3FH 3OTOL 4BY1B 1HTPA 1WD0A 4X64Q 1A3VA 3I4MG 2A6ED 4DK3C 3H3VC 2F1MA 1AFPA 4CJ2C 1TWGH 2B2YA 2F0UA 2E2IH 3NTIA 1UAPA 2Z4IA 3SK6A 2PMZE 3H15A 3HOXB 1CI3M 1KDCA 3I7FA 1X54A 1N33Q 4YWLA 4AIMA 3H0GB 1RKNA 1XNQL 3HOVH 3S17B 4LF6L 2AQ1B 2DNCA 2KQ3A 1PMRA 2K7VA 4XYOA 4B08A 4DR4Q 2EY6A 2OCEA 1IZ6A 5EKKA 4ZYSA 3HKZG 4HIKA 4LUVA 4YY3Q 1IYJB 3U58A 4DR5Q 4DNIA 4FDBA 3CC7A 1H9MA 4Y52H 1E3PA 4LUOA 2HDMA 2RSNA 4YCUA 4L5TA 1BQQT 1NTGA 1SNOA 4XT1B 3H6MA 2RHSB 1JORA 2JA6G 1R4QB 4IFDI 1DXMA 2DGYA 4LNQA 3HKZB 1JWUD 4DK0A 4IUQA 1WYDA 4L6TB 3PMFA 3K5LA 3VR5A 3BS1A 2E5LL 2K1BA 3I56A 1Y1WB 1R9TB 1IBLQ 3TQYA 3A0JA 1HNXL 3CMAA 1EZ6A 3HP3A 1FD7D 1DD2A 2VW9A 5JOBA 2JA6B 4L8JA 1LT3D 3MAQA 1EYCA 5A2QE 2RDHA 4V0BA 3L0OA 4JG2A 1YNNC 2L9HA 4C2MB 4BWGB 3MZ5A 3HOZH 4DV2L 5C4ZA 1E1OA 3OW7A 1EIYB 4A93H 3IFTA 2HDLA 3DEOA 5AFWA 4A3GG 2UUBQ 2Q2HA 1MSGA 3BYYB 1X9NA 3GTMH 1J5EQ 2YV5A 5IYDH 1WJJA 1BKBA 1K83B 1Q82C 3GV6A 2B2VC 3SHLA 1I6VC 2RF4A 1C48A 1RF2D 2JSOA 4DV1Q 4A3GB 3D6CA 1X6OA 4KHVA 3M4QA 2CKZB 1ICWA 3D4DA 2R93H 5EKLA 1K8GA 4LK1C 1EEFD 3NHHA 3Q0AA 1BUVT 1X65A 3CHBD 2VQFL 3EA6A 3ITPA 5C0XI 2KHIA 1XPOA 5M3MG 1JWSD 1PTOH 2JK8A 5M3FB 2FJ2A 3WWVA 2K5HA 5J39A 2EJGC 1AZQA 2LMCB 3KOJA 4LF5Q 3HOVG 1PHJA 4A3BH 1WCMH 2C9OA 3WOEA 4R8IA 4LF8L 2K32A 5T1IA 3J81i 2NN6H 1VQKA 1EQRA 3GTOH 1Y8OB 4CDDC 1E0BA 2A68C 1TWGB 5NUCA 3N52A 4JI1Q 5IWAQ 4P71A 2VQEQ 1RDPD 2E2IB 2EOTA 4L5SA 2OWOA 1KAWA 2ZXOA 2NVQH 4LF9L 3AYHB 1X56A 3QJYA 3HOVB 3C2PA 4HSPA 4QIWE 2UU9Q 1FR3A 1IHZA 2X6GA 2J4XA 2BE5D 5C6AA 1J8IA 1LLRD 3CU7A 4RMFA 3A5ZB 1LTGD 2SDFA 3G6EA 3SK5A 4LWCA 3K58A 5ELBA 2RCNA 3GTPB 4JYAQ 1NBWA 5DM63 4BBSG 2B63H 2HD3A 3BU2A 1CKNA 3H94A 1QZHA 3OW2A 1B8AA 3M7GA 4DAMA 4DR7L 5KYLA 4OELB 5FLXL 2JA5H 3D4RA 5LMNW 2L4NA 2DJFC 2WFWA 1Y69U 2F0IA 4DFAA 1JWMD 4A3IG 1IBML 1Q3LA 3ZYYX 1OXSC 3MEHA 1BBUA 1JICA 1UE6A 4EQPA 1SN8A 1IL2A 4LW1A 5IYDG 2HQLA 5E3FA 4EX5A 1ASYA 4LF4L 2PQEA 4CBVA 3PIPA 3P75A 2BDNA 2B39A 4K6LA 4JBWA 4XXEA 3HOZB 4DV6L 1S4ZA 4A93B 1GXDC 1WOCA 1JOOA 1QILA 1F2MA 2B2TC 3GTMB 1ET9A 3QOJA 1WTPA 4PQXA 3UE0A 2A69D 4C3IH 1PFSA 2JEAI 2JA8H 2CCZA 3GTKH 1QG7A 3MXNB 5IYBH 3PUVA 1QCBD 2IX3A 5TSSA 3KBXA 4G7ZC 1WCMG 2R93B 1JT8A 1RTOA 2Q2UA 2NN6G 1GUTA 1VQCA 4P75A 4N8FA 4GZYC 4MTNA 4C3HH 3E9HA 2GVBA 1CSPA 4GNXB 5IE8A 2Q2IA 1UE7A 1A63A 3GTLH 1KC8C 1PTOB 1JB7A 4PZ7A 1LT4D 1Q8IA 1EU4A 4DR6L 4A3LH 2N49A 4YHHQ 4A3BB 1WCMB 5IT9c 4DV3L 4DV7L 3S1MH 2NYZD 4FYDA 1TU2B 2L55A 3I4NH 2HHHQ 5CV6A 3GTOB 2WAQE 4EQNA 4GOPA 2HCCA 1D8LA 3BZCA 1C9OA 5FK9C 4DAYA 3GQBA 1ZYRD 3NPPA 1HUNA 3G4SA 3J80E 1QVCA 2XVSA 2NB0A 1SNQA 1VQGA 4JPBW 3KYHC 5GADC 5CV5A 2F0DA 3M4OH 1FJGL 2A68D 4AYBG 4EVOA 5C4HA 1TS5A 3ICEA 3N6RA 2HUGA 3GV3A 1EYDA 1NMFA 2EYOA 3U9OA 4GNXC 4ZK9B 4IPHA 2A8VA 5J1ZA 2A5HA 2F0PA 1SMYD 2Z9HA 2UXBQ 2B63B 2EXZA 1W3SA 1LV9A 1P16A 1PTOC 2AUJD 5EJWA 2OXPA 3OOCA 1P8LA 1JCKB 1FL0A 3R2IA 1N32Q 1KLGD 2JA5B 1RL2A 3WDNA 3NWSA 2EYJA 2V4DA 4H13C 5FO9B 5HGQA 2A73B 2NZ1D 4JI0L 1YVCA 3NENA 3A56A 3PF5A 5E1FA 1SJED 4R4OA 2N8NA 2R7FA 1STEA 1G51A 4ODGA 1B53A 3GD7A 4OX9L 1Z47A 2B2WC 1HJPA 2I07B 1ESFA 5ISRA 4C3IG 1BOSA 1PRTF 1SNCA 5IGEA 3OWFA 4ID6A 2XWJB 4IN3A 1Q1BA 4A4IA 1LTSD 1VMCA 1ILQA 1F2LA 4PZ6A 3BVZA 2BCOA 4RCOA 3W1GA 1G2SA 1Q46A 4UHVA 5IWAL 2ASBA 2VQEL 4JI2Q 4JW0A 3CKIB 1HQRD 4RKLA 4RG1A 2O4XA 4CJ0B 5ELNA 2N55A 1ONLA 3EROA 4C3IB 4HIMA 4C3HG 2BA0A 2JA8B 1KNAA 2NWGA 4FNFA 5HURA 2UU9L 2HCIA 3GTKB 5BN5A 3H3VI 2JA7H 1V1PA 1HRJA 2I5HA 5LL6X 3MWYW 1HNZQ 4JI7L 3JAME 4KKTA 2E2JH 4X3TA 3CCUA 4B3RL 3AQQA 2MFIA 3T1YL 1I4RA 2K4KA 3PO3H 2I0QA 4A3MH 3HGBA 1NNXA 4C3HB 3UDGA 1QZGA 4FO2A 5IYCG 1FGUA 2R7ZH 3GTLB 1PYBA 1DOLA 1QWYA 3TS0A 3C3LA 1IW7C 2F4VQ 3P20A 2NVYH 3H3VH 1CK1A 2DUDA 5A35A 3S1MB 4HJ7A 4CHTB 3I4NB 3NWTA 5FJ8H 5ELCA 3DUZA 4A3EG 4A3KH 3NBIA 3DM1A 1D1IA 3EQLC 2CWAA 1QUQB 2I5MX 3J7AF 3K8AA 4BXXH 2K6AA 3ZJYC 5DM73 4K5XA 2EXDA 3KLRA 3L2PA 2K14A 2Z0SA 1B50A 1FGBD 2A6EC 4HR7B 4C3JH 4HTHA 4A3JH 4KKSA 4DXFA 3M4OB 2IW3A 3R93A 2IPKD 1FNWA 1MKHA 4A3EB 1STYA 1CHQD 4R4IA 3K7AH 4A3CH 1VQEA 1W6KA 5JEAJ 1N36Q 5LMNL 2C35B 2BH2A 1GUOA 2O5JC 3KUPA 3FHWA 3G48A 4GN4B 2WINB 2YTXA 3KDFB 3VA7A 2LY7A 1M1KC 1DM0B 1VQOA 1QB5D 3F2BA 3TBIB 2EZVA 3J81L 1NR4A 1E2WA 1Q1EA 1FYCA 3H91A 4DUYL 4QCLA 5AJ3Q 2UUAQ 4I65A 5KGUA 5IIFA 3CMEA 2JJQA 1EFID 1MJCA 1WTHA 4BY7H 2Q8IB 4OWTB 1PH8A 2NUCA 3VR3A 3HOWH 4QMGA 2EYPA 2ATWA 2CWPA 1EIHA 3SK8A 4X66L 4KJNA 1AE2A 3U4VA 2FFKB 2RHQB 3I4MH 1EY0A 2RSOA 1XNRQ 4XQQA 1K3RA 3ERQA 1S3OA 4YCWA 3K5MA 1EQTA 3QWNA 4A3FG 2OEOA 1VQ8A 5FLXc 1BXTA 1T5XD 4ZQ3A 4NXNQ 2RBMA 4LFBQ 2JA7G 1HR0W 1PRTD 3S1QH 1WTXA 1SNDA 4LAAA 1Q81C 2Y0SB 2D62A 3UI2A 5JVH3 1EL0A 3VYTA 4JI6L 4RA8A 1XPUA 4A3MG 2ZJPA 1T9HA 4HCSA 1YJNA 2J0TD 3I8ZA 2JA7B 2AWNA 3HFZB 2RDFA 4IPGA 5F2DA 5HGTA 1WTVA 1UUPA 3PO2H 1QVGA 1HNWQ 3SK4A 4O1NA 5EPKA 1LYLA 2E2JB 1SYGA 1WTWA 5EAYA 3S1RH 3DM3A 1IBKL 1PA6A 2PNRC 3PO3B 5FJ8G 4A3MB 4JBMA 1I50H 4NXMQ 1EY4A 4A3KG 1PH6A 1D5ZC 2AQ3B 1AW7A 1X3PA 2R7ZB 4X3SA 4BXXG 1V1QA 1CKOA 1J9OA 1GJXA 2NVYB 5EPLA 4B3SQ 2F0MA 4TSSA 1A62A 4YWKA 3J7AV 3LWEA 5C3EG 4A3JG 3SEBA 1D5MC 3D31A 1E2VA 3CD6A 4A3KB 3OIQA 1L2FA 1WTRA 4ZUJA 4JI8L 1DCZA 2K05A 4J15A 1JB3A 3J80i 2XRQD 2XRSD 4NKLA 5FOBB 3RLFA 1O78A 3K80C 4KN7C 4KHPL 4ALPA 1PFNA 4C3JB 3A8IE 4A3JB 3KJPA 1AN8A 3ERSX 4LFCQ 1L1OB 1XTDA 2G9HD 2F0NA 2KCCA 3K7AB 1BDOA 5FKAC 2G9DA 4BY7G 4G4KA 1SBBB 1JJCB 3FMCA 1SR3A 3CAMA 3HOWG 5JEAG 3E3XA 1RTNA 1G291 5BR8L 4QQBX 1PDQA 3QIAA 3NXWA 1SE8A 4C1NK 4K0KL 3IKJA 4GN3B 3L7ZC 2BE5C 5IT9E 4DK1A 2TMPA 1J6QA 4DR2Q 4BY7B 1MSHA 3DHQA 4XQJA 3VYRA 1B3QA 3T53B 1LTTD 3BDOA 5M3MH 3HOWB 4GKJQ 1KIXA 1HFNA 1PH5A 3EIVA 5CBEE 2F0LA 1MBYA 1ENAA 2L0CA 2NTTA 4JVZA 2Z8LA 3I4MB 2XN9C 4MN3A 4RCNA 2ZTCA 3KJOA 1TS4A 4OGQC 3CXCA 5KNDA 2MP1A 4UP9A 1SROA 1L1OC 3CPFA 5CV9A 1D5XC 3TP7A 3Q22A 1CTMA 3NEMA 3GTJH 4IALA 2YU9H 1G6PA 3GTPH 1TVXA 3NBHB 2NBFA 2LKVA 3NP8A 4UP8A 5EBDA 3TS2A 1TWHH 3PO2G 3MXNA 3CCQA 1VF7A 3S1QB 2CH4A 4XDXA 3EN2A 1AP0A 5G3LF 1U4LA 3QB3A 1PFBA 3QR8A 1H9SA 1B2TA 4O42A 1CKMA 4X62L 1IXRA 2NVTH 3ND8A 2D9UA 3LGJA 4UP7A 3S15H 4FF2A 4BBSH 1HZCA 3JAMi 4GNXA 3PO2B 1SRUA 3C46A 3GO5A 1KAAA 4MTKA 1Y1VG 3S1RB 1YI2A 1EUJA 5A2QL 2VY3A 2F0EA 2UUCL 1STHA 1I50B 2A69C 3FEWX 3E0EA 1U5KA 1OXVA 4A3IH 1LTID 1M90C 2UXDL 5C4XG 4B3TQ 3E5SA 4DUZQ 1XTCD 1FNUA 4RGOS 2A74C 4CDFC 2X69A 1C0AA 4IZ8A 1SYFA 4KY6A 3NQIA 2XGTA 4UAIA 1F77A 3BVGA 3ULPA 3SE0A 1SYCA 1WTQA 3EVQA 3OHXC 1DOKA 3UDXA 3MFGA 1TS3A 1I94Q 4JOIA 1QVFA 1GOZA 2ZM6L 2EQSA 2EE1A 2K5VA 4IPCA 2IWHA 2NN6I 4JI5L 1VCIA 2M9VA 2EY1A 2KENA 4PNYA 2WACA 5LMUQ 4APVA 4Y7NH 1LUZA 2CQAA 4NXNL 3IAYA 3S9WA 2B3GA 1D1KA 4DGZA 1OXTA 3FRPB 1OXXK 1PH7A 4FF1A 4K2LA 4J6HA 4RHSA 1TR5A 2QEXA 3CRLC 2F0OA 4OO1H 3BDLA 1ZYRC 2WP8J 2F0HA 1RODA 4TVAB 1D7QA 1NMGA 2P5ZX 3A54A 4QUFA 3L3OC 1VQAA 2E75C 1B9NA 1CQFA 1AE3A 1I4GA 3RLNA 1H9RA 1CM9A 4JI3L 2DN8A 1Z9FA 3C1EA 3SXHA 5M3MB 2SNMA 3I73A 3H09A 1SMYC 4BBRG 1SE3A 4NXML 1VS0A 1HR0L 1E1TA 4A75A 1EEID 5ELOA 5JPMC 1SYEA 1B1ZA 3J81c 4RH6A 4HJ9A 5C44H 4R9WA 2SNSA 2PO4A 2KA7A 4DU9A 3GTJB 2YU9B 4MZ9A 3T1HL 1A2TA 5ELFA 4KI0A 2LSSA 2WV6D 2IHFA 5C4JH 1O7LA 1TWHB 1SLJA 3M85A 3X3MA 1YEZA 2B8GA 2DY7A 2PMZB 1YHBA 1VQPA 1KXLA 4ZRZA 4O0AA 2NVTB 5I9OA 1PZID 1NCVA 3S15B 4BBSB 1VQ7A 1E2ZA 2QILA 4ZKBB 4OONA 4RGTA 3MXGA 1VQDA 2LXJA 2F0VA 1NAPA 3M4PA 3T13A 3RZDH 2JN4A 3S1NH 2ZXPA 1F2ZA 2MO0A 4X64L 1QNKA 5FLXE 4A3IB 3D4WA 4OHJA 5IGCA 1HZAA 1GO3E 1U0LA 3FVQA 2VB3X 5IOCA 4DV5Q 2B2UC 2HQEA 1XX8A 3C1FA 5D14A 3A55A 2K33A 1N33L 1GVPA 1N8RC 3BZKA 4FF3A 4H0LC 2RVLA 4OL7A 5GROA 1ASZA 1VF5C 2O5IC 1KHIA 5E7NA 4OO1G 4XYQA 1RHPA 3BDCA 5CYUA 2IX0A 4U68A 4DR4L 1GKHA 2H5XA 1F9SA 4PMBA 2A19A 5IP9H 2WB1E 1STBA 4YY3L 2DY8A 4DR5L 4Y7NB 3Q23A 3KDFA 1KDBA 4IUUA 4LFAQ 2KBNA 3NK9A 4DR3Q 3RNUA 4JI4Q 5IP7H 1ENCA 4J8QA 4LUZA 2AMCB 3PGZA 4KY5A 1XMOQ 4N9PA 4XIGS 1ZEQX 5I9PA 4IUNA 5DEHA 4A3DH 2J7ZA 3DWAA 4NB3A 4KHZA 1IBLL 5C44G 2OF1A 2H4OA 1V1OA 5C5MA 1STAA 5IYCH 3J80L 3CCSA 3K0YA 1N34Q 4N8X1 1JR0D 2L15A 3QO2A 4Q5VA 4J1MA 3FPPA 4O2DA 1KQSA 1PRTB 1G2TA 4LF7Q 4C56C 1RD9D 1Y14B 2XNAC 4GLVB 2VXWA 3FPUB 5C44B 1WTOA 1HXYD 4A3EH 3CRKC 2R92G 4B3TL 3TZUA 1BF4A 2MQHA 1CZGA 5D3DA 1KRTA 4F7XA 2Q2TA 1SE4A 2UUBL 5JAVA 5EKIA 5C4JB 3I2ZA 3K57A 2F0QA 1SXTA 1J5EL 3S14H 3T56B 3A7AB 4ABNA 1SE2A 5K5PA 3FDTA 4AYBB 2K52A 4CGYB 1JOQA 2EVBA 1TWAH 3KLSX 4K5WA 2F52A 4R4TA 4DV1L 1A6XA 4QIWB 4DV4Q 2ALYB 4AQYQ 2AWOA 1EIFA 3FKIG 3M3YB 3K7UC 1EY9A 1K8MA 2ZJQA 2BH8A 4QY7A 1TY0A 2EYHA 2QCPX 4JBJA 4K8IA 1F9QA 1PRTC 2KCNA 3RZDB 3S1NB 3D6WA 1XPRA 1JJ2A 3NELA 4NP5A 3TP8A 2KCTA 4K5VA 1EY5A 1XWEA 2A6HC 2YYZA 4LF5L 4QL5A 4PZ8A 5D3IB 4IJHA 1HA5A 1H9JA 2Y0SE 1LT6D 3NQTA 5FO7B 1JJGA 1M4VA 1QOHA 4OXPA 5HY6A 4JI1L 3KK7A 5IGBA 4L5RC 1PYWD
chains in the Genus database with same CATH topology
1VQBA 4JI6L 4DR1Q 5IP9G 3HOZG 5GAGC 2E5LL 1XPUA 1QUQA 3I56A 4A3MG 1O7IA 1IBLQ 4B3MQ 4A93G 1VQFA 2ZJPA 3TQYA 1T9HA 4DR2L 3A0JA 1YJNA 4A3FH 1HNXL 3PV0A 4TQUS 3UE1A 3CMAA 2MNAA 2AWNA 3HFZB 4GKJL 2BA1A 5IP7G 1YJ9A 4IPGA 2VW9A 1HNWQ 3CQZH 3RLOA 1YJWA 1QVGA 3K81C 3PO2H 1LYLA 1S72A 1XMQQ 3F1ZA 5EAYA 3S1RH 3DM3A 1IBKL 1PA6A 4A3DG 5FJ8G 3CCEA 4NXMQ 4JBMA 1I50H 3L0OA 4JG2A 4A3KG 3HKSA 5LMNQ 1PH6A 4POGA 3HOUG 4JYAL 3HOZH 4DV2L 5H1SE 1E1OA 4HJ8A 1HH2P 1EIYB 3M7NA 4A93H 2R93G 4A3GG 3MEFA 4BXXG 1V1QA 2N3SA 2UUBQ 2Q2HA 1CKOA 2IHEA 3GDEA 4IO9A 2JA9A 1PH2A 4B3SQ 1X9NA 3GTMH 1A62A 4YWKA 4DUYQ 1UE5A 5C3EG 1PYSB 2UXCL 4A3JG 1J5EQ 2YV5A 3PUZA 5IYDH 1TWCH 5DLQE 1WJJA 3D31A 2K50A 1BKBA 1Q82C 3CD6A 3GTQH 1L2FA 4JI8L 2RF4A 5M5YH 3I4OA 4A3BG 3B6YA 1TXYA 4J15A 1XNQQ 3J80i 1N9WA 4LF6Q 4DV1Q 1B70B 1X6OA 3M4QA 4X66Q 2CKZB 2EIFA 3F8TA 3W1BA 3RLFA 2R93H 3K80C 4KHPL 2HIXA 4ALPA 4OWXB 1K8GA 1NJIC 2WAQG 3KJPA 1BVSA 3ERSX 4LFCQ 3A5UA 1L1OB 1XTDA 4P73A 2ES2A 1X65A 2VQFL 5C3EH 5C0XI 3PUXA 2FXQA 2KHIA 5C0XG 4DV0Q 5M3MG 1XPOA 1KRSA 4BY7G 2JK8A 3WWVA 1JJCB 2F3IA 3F2CA 2K5HA 1SR3A 3KOJA 4LF5Q 3CAMA 3HOVG 3HOWG 1PHJA 5JEAG 1WCMH 4LF8L 4JC0A 2QA4A 4A3BH 4GKKQ 4YCVA 1G291 5BR8L 3J81i 4QQBX 3S24A 4DUZL 1SE8A 4K0KL 1VQKA 1VQ6A 4GN3B 1EQRA 3GTOH 1K8AC 3STBC 4JI1Q 3L7ZC 5IWAQ 1VQ5A 3CC2A 4P71A 5M5XH 2VQEQ 2OQKA 1JE5A 1MJEA 4JI6Q 4L5SA 2E5LQ 1J6QA 1E22A 3D0FA 2OWOA 2B63G 1KAWA 5GQOA 4DR2Q 3RN5A 4R4CA 2NVQH 1HNXQ 4LF9L 3AYHB 2VUMG 1X56A 1OTCA 4QJFA 5M3MH 1X3EA 4GKJQ 1KIXA 4QIWE 2OTLA 2JA5G 1PH5A 3EIVA 2UU9Q 3STBD 1I94L 3UDIA 1K0RA 4RMFA 1EYGA 3A5ZB 2OTJA 3M9BA 4P74A 3G6EA 4X65Q 4LWCA 2ZTCA 3KJOA 1IBKQ 5LMUL 3CXCA 4QGUA 1V43A 2QGQA 4UP9A 1SROA 1W2BA 1Q7YC 1L1OC 2RCNA 3CPFA 4JI4L 1VQ9A 3RN2A 3S16H 4JYAQ 2B29A 1HZBA 1NBWA 3NEMA 3GTJH 4DV2Q 2YU9H 4BBSG 1I6HH 2B63H 1V9PA 3BU2A 1VQLA 1CKNA 1QZHA 3GTPH 1G6PA 3OW2A 1B8AA 4DAMA 3NBHB 4DR7L 4YHHL 2VUMH 1KL9A 4UP8A 4HJAA 3TS2A 1TWHH 1UEBA 3ULJA 2JA5H 4HIOA 3PO2G 5IY0A 3HKZE 3CCQA 5LMNW 2HHHL 1DGSA 2WFWA 3EN2A 2E2HH 3A74A 4GOPB 4JV5Q 4XTCS 1AH9A 2HIVA 4JI8Q 1Q12A 4A3IG 3KF8B 1CKMA 1IBML 4X62L 1IXRA 2I5LX 2HT1A 2NVTH 3LGJA 4UP7A 1L0WA 3S15H 4BBSH 4X6AH 3PUWA 1HZCA 3JAMi 4KHPQ 4GNXA 3Q8DA 1OXSC 4GN5A 4IJLA 1BBUA 2NVXH 1SRUA 1UE6A 1L1OA 3GO5A 4JOIC 5GAHC 2JA8G 1Y1VG 1YI2A 1EUJA 1SN8A 1IL2A 4LW1A 4WJ3M 3JC66 2VY3A 2HQLA 5IYBG 5IYDG 4EX5A 2VQFQ 1ASYA 2UUCL 4LF4L 3PIPA 1GM5A 3E0EA 4L5RC 1PH9A 2VS1A 4JBWA 3BJUA 4NPSA 4DV6L 1U5KA 3PUYA 1OXVA 2R6GA 4A3IH 1SFOH 2UXBL 2UXDL 1M90C 4LF8Q 5C4XG 4IOAA 3OTOQ 1I5FA 5BR8Q 4B3TQ 1FVIA 1WOCA 3AFQA 4DUZQ 4A76A 4K0KQ 1A0IA 1N32L 3UE0A 1CKNB 1C0AA 2WB1G 2XGTA 4C3IH 1PFSA 2Z6KA 3ULLA 2JEAI 2JA8H 3ULPA 1Y1VH 2PI2A 4R1JA 2CCZA 4GOPC 1YHAA 3GTKH 3MXNB 4LF9Q 5IYBH 3PUVA 4A3LG 4PG3A 2CFMA 4BA1I 2JE6I 3UDXA 3GTGH 1I94Q 3I4NG 1VQIA 1WCMG 4JOIA 3SGIA 1NY4A 2EQSA 2K5VA 2ZM6L 4IPCA 1OXUA 1QVFA 2OQ0A 2AHOB 2VNUD 1JT8A 5C4XH 2NN6I 4JI5L 2Q2UA 2NN6G 1VCIA 2KENA 3K0XA 5LMUQ 1VQCA 4APVA 4P75A 5FLMH 1LUZA 4Y7NH 4MTNA 1MIUA 4NXNL 3E9HA 2B3GA 2GVBA 1CSPA 4C3HH 4GNXB 5IE8A 4PMWA 2Q2IA 1CSQA 2YTYA 1UE7A 1OXTA 1UE1A 2ID0A 1OXXK 1PH7A 1A63A 3GTLH 1KC8C 1JB7A 1NE3A 5M5WH 4PZ7A 2QEXA 1B7YB 4JBKA 1KD1C 4DR6L 4A3LH 2N49A 4YHHQ 3S2DH 2WP8J 4DR7Q 5IT9c 4DV3L 4DV7L 3PF4A 4TVAB 4JI2L 1D7QA 3S1MH 3J7A5 1NMGA 5K36G 3J80c 3I4NH 2E8GA 2HHHQ 2WAQE 3U4ZA 4GOPA 4BY1G 4DV5L 1VQAA 1D8LA 2CQOA 1K73C 3BZCA 3J7ZC 3W5OA 1C9OA 1E7ZA 1AE3A 3RLNA 3HOYH 3OYYA 1X3GA 2PI2E 1IBMQ 3RZOH 4X62Q 3G4SA 4JI3L 1Z9FA 1H95A 1QVCA 1HNZL 2XTIA 1VQ4A 1YIJA 1UWVA 4BBRG 1VQGA 5GAEC 3KYHC 5GADC 2JEBI 4NXML 3M4OH 1FJGL 1RIPA 1VS0A 2IY5B 1HR0L 1E1TA 4A75A 2VL6A 4AYBG 5ELOA 3S2HH 1PH4A 1A8VA 2UUCQ 3H0GG 3ICEA 3J81c 4LF4Q 1NMFA 3I55A 4HJ9A 1VQHA 1LM0A 5C44H 4BY1H 4LFAL 4GLXA 4GNXC 2A8VA 4IPHA 4DR3L 4GS3A 4DV6Q 2A1AA 2JQOA 4MZ9A 2UXBQ 1W3SA 1P16A 2UXDQ 3T1HL 4KI0A 2LSSA 2F4VL 4JCVE 1P8LA 2IHFA 1XMOL 5C4JH 1FL0A 1N32Q 1SLJA 1EWIA 5J3BA 4YWMA 1RL2A 4BBRH 3M85A 1WFQA 4EQ5A 1YEZA 2NZHA 2AKWB 3HOXH 3U50C 1YHBA 2V1CC 2YTVA 4IOCA 2UXCQ 5HGQA 4WJ4A 3H0GH 4JI0L 1YVCA 1VQPA 1KXLA 3S17H 4BA2I 3NENA 4O0AA 3PF5A 1S40A 1N34L 4R4OA 3RR5A 4DKAC 2N8NA 4DAYB 2ZM6Q 2R7FA 2Z6KC 1VQ7A 1G51A 2Y0SG 3GD7A 4POFA 4OONA 4JI5Q 4OX9L 1WI5A 1Y1WG 1Z47A 1PV4A 4DV0L 1Q8KA 1HJPA 2ZTEA 1VQDA 2LXJA 3M4PA 4GLAC 4R4QA 4LF7L 3RZDH 3S1NH 5JJLA 3CW2C 1X3FA 1K9MC 4GKKL 1N36L 4P72A 4A4IA 1Q1BA 2MO0A 1XJVA 4AH6A 4X64L 3CCLA 3KF6A 4PZ6A 4IFDJ 1YZ6A 1BBWA 4DR6Q 3W1GA 2R7DA 3ER0A 4DV3Q 1GD7A 1Q46A 5IWAL 4DV7Q 2VQEL 4JI2Q 2ASBA 3G71A 1HZAA 3PO3G 1GO3E 1U0LA 4RG1A 3CCVA 5ELNA 4L5QA 4HJ5A 1VQJA 2LXKA 1PH3A 5AJ3L 4DK6C 3TREA 2UUAL 4DV5Q 3IRBA 3JAMc 1Y1WH 1R9TH 5FLMG 2R7ZG 4HIMA 2VZAA 2BA0A 2ZTDA 2UU9L 3EBEA 1N33L 1GVPA 1N8RC 1TWFH 3BZKA 3PIOA 4JI3Q 2IX1A 4KLKA 2MO1A 2JA7H 2I5HA 5GROA 1ASZA 1HNZQ 1KHIA 4OO1I 2JA6H 4X65L 5E7NA 4DV4L 4OO1G 1PVOA 4AQYL 4JI7L 2IX0A 1X55A 2K75A 4DR4L 1GKHA 2H5XA 3CCJA 2E2JH 1XNRL 1FJGQ 2A19A 3CCUA 1PH1A 3E9IA 1HR0Q 3AQQA 3KFUA 4B3RL 2MFIA 1CUKA 5IP9H 2WB1E 2K4KA 4YY3L 3T1YL 2I0QA 4DR5L 4A3MH 3PO3H 3KDFA 3UDGA 4C2MH 1QZGA 3M3YH 4LFAQ 5IYCG 2KBNA 1FGUA 3PSIA 4DR3Q 3RNUA 4OWWB 2GN5A 2R7ZH 3HOYG 1PYBA 4UPAA 3TS0A 4JI4Q 3TRZA 5IP7H 5JJKA 4H02A 3CCMA 4LFBL 3T1HQ 4LUZA 4MNOA 2AMCB 3CP0A 3PGZA 1E24A 2F4VQ 2PQAA 2NVYH 3H3VH 1XMOQ 1JMCA 4XIGS 2DUDA 3CPWA 4HJ7A 4JV5L 3KF6B 4A3CG 2NZOA 3CC4A 1YBYA 5FJ8H 1VQNA 4A3DH 1K83H 5M3FG 4A3EG 4DR1L 4A3KH 2KHJA 4NB3A 3HOUH 4KHZA 1IBLL 4B3ML 2CWAA 2GVAA 1QUQB 2I5MX 2PNHA 1EOVA 1LTLA 5C44G 4ME3A 3PCOB 4JI0Q 4UY8C 3K8AA 4BXXH 4A3GH 1YITA 3ZJYC 3CCSA 5IYCH 1N34Q 3F2DA 3KLWA 1Q86C 2EXDA 3L2PA 2K14A 1SMXA 2Z0SA 2L15A 2ZJRA 1HNWL 1I3QH 5JJIA 4C3JH 4OX9Q 4A3JH 5C0XJ 1XMQL 4O2DA 1KQSA 4LF7Q 1MKHA 4R4IA 4A3CH 1Y14B 3K7AH 3J81j 1VQEA 3HOXG 3DLLA 5JEAJ 1N36Q 4GLVB 5LMNL 5M3FH 3OTOL 4A3EH 2C35B 2BH2A 2R92G 4X64Q 4B3TL 3AEVA 3FHWA 3G48A 3VDYA 3I4MG 4GN4B 2YTXA 3KDFB 2MQHA 1KRTA 4DK3C 1M1KC 2Q2TA 2UUBL 1VQOA 1YNXA 3AFPA 3F2BA 1HZ9A 4B3SL 1Q1EA 3I2ZA 1TWGH 4DUYL 5AJ3Q 2UUAQ 2E2IH 4AYBE 3TEHB 1J5EL 3CCRA 3S14H 3CMEA 2PQAB 2JJQA 2PMZE 3H15A 1C7YA 1MJCA 4BY7H 2IT1A 3I7FA 1X54A 2K52A 2KCMA 1N33Q 4YWLA 4OWTB 4AIMA 4DPGA 1PH8A 1TWAH 1XNQL 3H3VI 3HOVH 3HOWH 4LF6L 4R4TA 2F52A 4DV1L 2D0PA 2ATWA 2CWPA 2R92H 4DV4Q 4X66L 2ALYB 1AE2A 4AQYQ 3U4VA 2AWOA 1EIFA 1EQQA 3FKIG 4IPDA 2RHQB 4JI7Q 3I4MH 4DR4Q 2OCEA 1XNRQ 1IZ6A 3K7UC 4B3RQ 2ZJQA 3HKZG 2BH8A 1K3RA 4QY7A 4HIKA 1S3OA 4YCWA 2D0OA 4LUVA 1IYJB 4YY3Q 4LFCL 3T1YQ 3UDFA 4DR5Q 3U58A 4JBJA 4DNIA 4A3FG 4FDBA 1VQ8A 3CC7A 5FLXc 1XPRA 1EFWA 1JJ2A 4Y52H 1E3PA 3NELA 4LUOA 4YCUA 4L5TA 2KCTA 4NXNQ 2K5NA 1NTGA 4LFBQ 2YYZA 2JA7G 4LF5L 4QL5A 4PZ8A 2RHSB 4IJHA 3CF5A 1HR0W 2N78A 2JA6G 1YHQA 4IFDI 2Y0SE 3FP9A 1VQMA 4IFDG 2DGYA 4LNQA 1JJGA 5HY6A 4OXPA 4JI1L 3FKIH 4HIDA 3S1QH 1Q81C 1WYDA 2D62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQB A;  4JI6 L;  4DR1 Q;  5IP9 G;  3HOZ G;  5GAG C;  2E5L L;  1XPU A;  1QUQ A;  3I56 A;  4A3M G;  1O7I A;  1IBL Q;  4B3M Q;  4A93 G;  1VQF A;  2ZJP A;  3TQY A;  1T9H A;  4DR2 L;  3A0J A;  1YJN A;  4A3F H;  1HNX L;  3PV0 A;  4TQU S;  3UE1 A;  3CMA A;  2MNA A;  2AWN A;  3HFZ B;  4GKJ L;  2BA1 A;  5IP7 G;  1YJ9 A;  4IPG A;  2VW9 A;  1HNW Q;  3CQZ H;  3RLO A;  1YJW A;  1QVG A;  3K81 C;  3PO2 H;  1LYL A;  1S72 A;  1XMQ Q;  3F1Z A;  5EAY A;  3S1R H;  3DM3 A;  1IBK L;  1PA6 A;  4A3D G;  5FJ8 G;  3CCE A;  4NXM Q;  4JBM A;  1I50 H;  3L0O A;  4JG2 A;  4A3K G;  3HKS A;  5LMN Q;  1PH6 A;  4POG A;  3HOU G;  4JYA L;  3HOZ H;  4DV2 L;  5H1S E;  1E1O A;  4HJ8 A;  1HH2 P;  1EIY B;  3M7N A;  4A93 H;  2R93 G;  4A3G G;  3MEF A;  4BXX G;  1V1Q A;  2N3S A;  2UUB Q;  2Q2H A;  1CKO A;  2IHE A;  3GDE A;  4IO9 A;  2JA9 A;  1PH2 A;  4B3S Q;  1X9N A;  3GTM H;  1A62 A;  4YWK A;  4DUY Q;  1UE5 A;  5C3E G;  1PYS B;  2UXC L;  4A3J G;  1J5E Q;  2YV5 A;  3PUZ A;  5IYD H;  1TWC H;  5DLQ E;  1WJJ A;  3D31 A;  2K50 A;  1BKB A;  1Q82 C;  3CD6 A;  3GTQ H;  1L2F A;  4JI8 L;  2RF4 A;  5M5Y H;  3I4O A;  4A3B G;  3B6Y A;  1TXY A;  4J15 A;  1XNQ Q;  3J80 i;  1N9W A;  4LF6 Q;  4DV1 Q;  1B70 B;  1X6O A;  3M4Q A;  4X66 Q;  2CKZ B;  2EIF A;  3F8T A;  3W1B A;  3RLF A;  2R93 H;  3K80 C;  4KHP L;  2HIX A;  4ALP A;  4OWX B;  1K8G A;  1NJI C;  2WAQ G;  3KJP A;  1BVS A;  3ERS X;  4LFC Q;  3A5U A;  1L1O B;  1XTD A;  4P73 A;  2ES2 A;  1X65 A;  2VQF L;  5C3E H;  5C0X I;  3PUX A;  2FXQ A;  2KHI A;  5C0X G;  4DV0 Q;  5M3M G;  1XPO A;  1KRS A;  4BY7 G;  2JK8 A;  3WWV A;  1JJC B;  2F3I A;  3F2C A;  2K5H A;  1SR3 A;  3KOJ A;  4LF5 Q;  3CAM A;  3HOV G;  3HOW G;  1PHJ A;  5JEA G;  1WCM H;  4LF8 L;  4JC0 A;  2QA4 A;  4A3B H;  4GKK Q;  4YCV A;  1G29 1;  5BR8 L;  3J81 i;  4QQB X;  3S24 A;  4DUZ L;  1SE8 A;  4K0K L;  1VQK A;  1VQ6 A;  4GN3 B;  1EQR A;  3GTO H;  1K8A C;  3STB C;  4JI1 Q;  3L7Z C;  5IWA Q;  1VQ5 A;  3CC2 A;  4P71 A;  5M5X H;  2VQE Q;  2OQK A;  1JE5 A;  1MJE A;  4JI6 Q;  4L5S A;  2E5L Q;  1J6Q A;  1E22 A;  3D0F A;  2OWO A;  2B63 G;  1KAW A;  5GQO A;  4DR2 Q;  3RN5 A;  4R4C A;  2NVQ H;  1HNX Q;  4LF9 L;  3AYH B;  2VUM G;  1X56 A;  1OTC A;  4QJF A;  5M3M H;  1X3E A;  4GKJ Q;  1KIX A;  4QIW E;  2OTL A;  2JA5 G;  1PH5 A;  3EIV A;  2UU9 Q;  3STB D;  1I94 L;  3UDI A;  1K0R A;  4RMF A;  1EYG A;  3A5Z B;  2OTJ A;  3M9B A;  4P74 A;  3G6E A;  4X65 Q;  4LWC A;  2ZTC A;  3KJO A;  1IBK Q;  5LMU L;  3CXC A;  4QGU A;  1V43 A;  2QGQ A;  4UP9 A;  1SRO A;  1W2B A;  1Q7Y C;  1L1O C;  2RCN A;  3CPF A;  4JI4 L;  1VQ9 A;  3RN2 A;  3S16 H;  4JYA Q;  2B29 A;  1HZB A;  1NBW A;  3NEM A;  3GTJ H;  4DV2 Q;  2YU9 H;  4BBS G;  1I6H H;  2B63 H;  1V9P A;  3BU2 A;  1VQL A;  1CKN A;  1QZH A;  3GTP H;  1G6P A;  3OW2 A;  1B8A A;  4DAM A;  3NBH B;  4DR7 L;  4YHH L;  2VUM H;  1KL9 A;  4UP8 A;  4HJA A;  3TS2 A;  1TWH H;  1UEB A;  3ULJ A;  2JA5 H;  4HIO A;  3PO2 G;  5IY0 A;  3HKZ E;  3CCQ A;  5LMN W;  2HHH L;  1DGS A;  2WFW A;  3EN2 A;  2E2H H;  3A74 A;  4GOP B;  4JV5 Q;  4XTC S;  1AH9 A;  2HIV A;  4JI8 Q;  1Q12 A;  4A3I G;  3KF8 B;  1CKM A;  1IBM L;  4X62 L;  1IXR A;  2I5L X;  2HT1 A;  2NVT H;  3LGJ A;  4UP7 A;  1L0W A;  3S15 H;  4BBS H;  4X6A H;  3PUW A;  1HZC A;  3JAM i;  4KHP Q;  4GNX A;  3Q8D A;  1OXS C;  4GN5 A;  4IJL A;  1BBU A;  2NVX H;  1SRU A;  1UE6 A;  1L1O A;  3GO5 A;  4JOI C;  5GAH C;  2JA8 G;  1Y1V G;  1YI2 A;  1EUJ A;  1SN8 A;  1IL2 A;  4LW1 A;  4WJ3 M;  3JC6 6;  2VY3 A;  2HQL A;  5IYB G;  5IYD G;  4EX5 A;  2VQF Q;  1ASY A;  2UUC L;  4LF4 L;  3PIP A;  1GM5 A;  3E0E A;  4L5R C;  1PH9 A;  2VS1 A;  4JBW A;  3BJU A;  4NPS A;  4DV6 L;  1U5K A;  3PUY A;  1OXV A;  2R6G A;  4A3I H;  1SFO H;  2UXB L;  2UXD L;  1M90 C;  4LF8 Q;  5C4X G;  4IOA A;  3OTO Q;  1I5F A;  5BR8 Q;  4B3T Q;  1FVI A;  1WOC A;  3AFQ A;  4DUZ Q;  4A76 A;  4K0K Q;  1A0I A;  1N32 L;  3UE0 A;  1CKN B;  1C0A A;  2WB1 G;  2XGT A;  4C3I H;  1PFS A;  2Z6K A;  3ULL A;  2JEA I;  2JA8 H;  3ULP A;  1Y1V H;  2PI2 A;  4R1J A;  2CCZ A;  4GOP C;  1YHA A;  3GTK H;  3MXN B;  4LF9 Q;  5IYB H;  3PUV A;  4A3L G;  4PG3 A;  2CFM A;  4BA1 I;  2JE6 I;  3UDX A;  3GTG H;  1I94 Q;  3I4N G;  1VQI A;  1WCM G;  4JOI A;  3SGI A;  1NY4 A;  2EQS A;  2K5V A;  2ZM6 L;  4IPC A;  1OXU A;  1QVF A;  2OQ0 A;  2AHO B;  2VNU D;  1JT8 A;  5C4X H;  2NN6 I;  4JI5 L;  2Q2U A;  2NN6 G;  1VCI A;  2KEN A;  3K0X A;  5LMU Q;  1VQC A;  4APV A;  4P75 A;  5FLM H;  1LUZ A;  4Y7N H;  4MTN A;  1MIU A;  4NXN L;  3E9H A;  2B3G A;  2GVB A;  1CSP A;  4C3H H;  4GNX B;  5IE8 A;  4PMW A;  2Q2I A;  1CSQ A;  2YTY A;  1UE7 A;  1OXT A;  1UE1 A;  2ID0 A;  1OXX K;  1PH7 A;  1A63 A;  3GTL H;  1KC8 C;  1JB7 A;  1NE3 A;  5M5W H;  4PZ7 A;  2QEX A;  1B7Y B;  4JBK A;  1KD1 C;  4DR6 L;  4A3L H;  2N49 A;  4YHH Q;  3S2D H;  2WP8 J;  4DR7 Q;  5IT9 c;  4DV3 L;  4DV7 L;  3PF4 A;  4TVA B;  4JI2 L;  1D7Q A;  3S1M H;  3J7A 5;  1NMG A;  5K36 G;  3J80 c;  3I4N H;  2E8G A;  2HHH Q;  2WAQ E;  3U4Z A;  4GOP A;  4BY1 G;  4DV5 L;  1VQA A;  1D8L A;  2CQO A;  1K73 C;  3BZC A;  3J7Z C;  3W5O A;  1C9O A;  1E7Z A;  1AE3 A;  3RLN A;  3HOY H;  3OYY A;  1X3G A;  2PI2 E;  1IBM Q;  3RZO H;  4X62 Q;  3G4S A;  4JI3 L;  1Z9F A;  1H95 A;  1QVC A;  1HNZ L;  2XTI A;  1VQ4 A;  1YIJ A;  1UWV A;  4BBR G;  1VQG A;  5GAE C;  3KYH C;  5GAD C;  2JEB I;  4NXM L;  3M4O H;  1FJG L;  1RIP A;  1VS0 A;  2IY5 B;  1HR0 L;  1E1T A;  4A75 A;  2VL6 A;  4AYB G;  5ELO A;  3S2H H;  1PH4 A;  1A8V A;  2UUC Q;  3H0G G;  3ICE A;  3J81 c;  4LF4 Q;  1NMF A;  3I55 A;  4HJ9 A;  1VQH A;  1LM0 A;  5C44 H;  4BY1 H;  4LFA L;  4GLX A;  4GNX C;  2A8V A;  4IPH A;  4DR3 L;  4GS3 A;  4DV6 Q;  2A1A A;  2JQO A;  4MZ9 A;  2UXB Q;  1W3S A;  1P16 A;  2UXD Q;  3T1H L;  4KI0 A;  2LSS A;  2F4V L;  4JCV E;  1P8L A;  2IHF A;  1XMO L;  5C4J H;  1FL0 A;  1N32 Q;  1SLJ A;  1EWI A;  5J3B A;  4YWM A;  1RL2 A;  4BBR H;  3M85 A;  1WFQ A;  4EQ5 A;  1YEZ A;  2NZH A;  2AKW B;  3HOX H;  3U50 C;  1YHB A;  2V1C C;  2YTV A;  4IOC A;  2UXC Q;  5HGQ A;  4WJ4 A;  3H0G H;  4JI0 L;  1YVC A;  1VQP A;  1KXL A;  3S17 H;  4BA2 I;  3NEN A;  4O0A A;  3PF5 A;  1S40 A;  1N34 L;  4R4O A;  3RR5 A;  4DKA C;  2N8N A;  4DAY B;  2ZM6 Q;  2R7F A;  2Z6K C;  1VQ7 A;  1G51 A;  2Y0S G;  3GD7 A;  4POF A;  4OON A;  4JI5 Q;  4OX9 L;  1WI5 A;  1Y1W G;  1Z47 A;  1PV4 A;  4DV0 L;  1Q8K A;  1HJP A;  2ZTE A;  1VQD A;  2LXJ A;  3M4P A;  4GLA C;  4R4Q A;  4LF7 L;  3RZD H;  3S1N H;  5JJL A;  3CW2 C;  1X3F A;  1K9M C;  4GKK L;  1N36 L;  4P72 A;  4A4I A;  1Q1B A;  2MO0 A;  1XJV A;  4AH6 A;  4X64 L;  3CCL A;  3KF6 A;  4PZ6 A;  4IFD J;  1YZ6 A;  1BBW A;  4DR6 Q;  3W1G A;  2R7D A;  3ER0 A;  4DV3 Q;  1GD7 A;  1Q46 A;  5IWA L;  4DV7 Q;  2VQE L;  4JI2 Q;  2ASB A;  3G71 A;  1HZA A;  3PO3 G;  1GO3 E;  1U0L A;  4RG1 A;  3CCV A;  5ELN A;  4L5Q A;  4HJ5 A;  1VQJ A;  2LXK A;  1PH3 A;  5AJ3 L;  4DK6 C;  3TRE A;  2UUA L;  4DV5 Q;  3IRB A;  3JAM c;  1Y1W H;  1R9T H;  5FLM G;  2R7Z G;  4HIM A;  2VZA A;  2BA0 A;  2ZTD A;  2UU9 L;  3EBE A;  1N33 L;  1GVP A;  1N8R C;  1TWF H;  3BZK A;  3PIO A;  4JI3 Q;  2IX1 A;  4KLK A;  2MO1 A;  2JA7 H;  2I5H A;  5GRO A;  1ASZ A;  1HNZ Q;  1KHI A;  4OO1 I;  2JA6 H;  4X65 L;  5E7N A;  4DV4 L;  4OO1 G;  1PVO A;  4AQY L;  4JI7 L;  2IX0 A;  1X55 A;  2K75 A;  4DR4 L;  1GKH A;  2H5X A;  3CCJ A;  2E2J H;  1XNR L;  1FJG Q;  2A19 A;  3CCU A;  1PH1 A;  3E9I A;  1HR0 Q;  3AQQ A;  3KFU A;  4B3R L;  2MFI A;  1CUK A;  5IP9 H;  2WB1 E;  2K4K A;  4YY3 L;  3T1Y L;  2I0Q A;  4DR5 L;  4A3M H;  3PO3 H;  3KDF A;  3UDG A;  4C2M H;  1QZG A;  3M3Y H;  4LFA Q;  5IYC G;  2KBN A;  1FGU A;  3PSI A;  4DR3 Q;  3RNU A;  4OWW B;  2GN5 A;  2R7Z H;  3HOY G;  1PYB A;  4UPA A;  3TS0 A;  4JI4 Q;  3TRZ A;  5IP7 H;  5JJK A;  4H02 A;  3CCM A;  4LFB L;  3T1H Q;  4LUZ A;  4MNO A;  2AMC B;  3CP0 A;  3PGZ A;  1E24 A;  2F4V Q;  2PQA A;  2NVY H;  3H3V H;  1XMO Q;  1JMC A;  4XIG S;  2DUD A;  3CPW A;  4HJ7 A;  4JV5 L;  3KF6 B;  4A3C G;  2NZO A;  3CC4 A;  1YBY A;  5FJ8 H;  1VQN A;  4A3D H;  1K83 H;  5M3F G;  4A3E G;  4DR1 L;  4A3K H;  2KHJ A;  4NB3 A;  3HOU H;  4KHZ A;  1IBL L;  4B3M L;  2CWA A;  2GVA A;  1QUQ B;  2I5M X;  2PNH A;  1EOV A;  1LTL A;  5C44 G;  4ME3 A;  3PCO B;  4JI0 Q;  4UY8 C;  3K8A A;  4BXX H;  4A3G H;  1YIT A;  3ZJY C;  3CCS A;  5IYC H;  1N34 Q;  3F2D A;  3KLW A;  1Q86 C;  2EXD A;  3L2P A;  2K14 A;  1SMX A;  2Z0S A;  2L15 A;  2ZJR A;  1HNW L;  1I3Q H;  5JJI A;  4C3J H;  4OX9 Q;  4A3J H;  5C0X J;  1XMQ L;  4O2D A;  1KQS A;  4LF7 Q;  1MKH A;  4R4I A;  4A3C H;  1Y14 B;  3K7A H;  3J81 j;  1VQE A;  3HOX G;  3DLL A;  5JEA J;  1N36 Q;  4GLV B;  5LMN L;  5M3F H;  3OTO L;  4A3E H;  2C35 B;  2BH2 A;  2R92 G;  4X64 Q;  4B3T L;  3AEV A;  3FHW A;  3G48 A;  3VDY A;  3I4M G;  4GN4 B;  2YTX A;  3KDF B;  2MQH A;  1KRT A;  4DK3 C;  1M1K C;  2Q2T A;  2UUB L;  1VQO A;  1YNX A;  3AFP A;  3F2B A;  1HZ9 A;  4B3S L;  1Q1E A;  3I2Z A;  1TWG H;  4DUY L;  5AJ3 Q;  2UUA Q;  2E2I H;  4AYB E;  3TEH B;  1J5E L;  3CCR A;  3S14 H;  3CME A;  2PQA B;  2JJQ A;  2PMZ E;  3H15 A;  1C7Y A;  1MJC A;  4BY7 H;  2IT1 A;  3I7F A;  1X54 A;  2K52 A;  2KCM A;  1N33 Q;  4YWL A;  4OWT B;  4AIM A;  4DPG A;  1PH8 A;  1TWA H;  1XNQ L;  3H3V I;  3HOV H;  3HOW H;  4LF6 L;  4R4T A;  2F52 A;  4DV1 L;  2D0P A;  2ATW A;  2CWP A;  2R92 H;  4DV4 Q;  4X66 L;  2ALY B;  1AE2 A;  4AQY Q;  3U4V A;  2AWO A;  1EIF A;  1EQQ A;  3FKI G;  4IPD A;  2RHQ B;  4JI7 Q;  3I4M H;  4DR4 Q;  2OCE A;  1XNR Q;  1IZ6 A;  3K7U C;  4B3R Q;  2ZJQ A;  3HKZ G;  2BH8 A;  1K3R A;  4QY7 A;  4HIK A;  1S3O A;  4YCW A;  2D0O A;  4LUV A;  1IYJ B;  4YY3 Q;  4LFC L;  3T1Y Q;  3UDF A;  4DR5 Q;  3U58 A;  4JBJ A;  4DNI A;  4A3F G;  4FDB A;  1VQ8 A;  3CC7 A;  5FLX c;  1XPR A;  1EFW A;  1JJ2 A;  4Y52 H;  1E3P A;  3NEL A;  4LUO A;  4YCU A;  4L5T A;  2KCT A;  4NXN Q;  2K5N A;  1NTG A;  4LFB Q;  2YYZ A;  2JA7 G;  4LF5 L;  4QL5 A;  4PZ8 A;  2RHS B;  4IJH A;  3CF5 A;  1HR0 W;  2N78 A;  2JA6 G;  1YHQ A;  4IFD I;  2Y0S E;  3FP9 A;  1VQM A;  4IFD G;  2DGY A;  4LNQ A;  1JJG A;  5HY6 A;  4OXP A;  4JI1 L;  3FKI H;  4HID A;  3S1Q H;  1Q81 C;  1WYD A;  2D62 A; 
#chains in the Genus database with same CATH topology
 2MGS A;  1VQB A;  4DR1 Q;  5IP9 G;  5GAG C;  4B3M Q;  2RQX A;  4M8A A;  1VQF A;  3K59 A;  3EFX D;  4A3F H;  1JOK A;  3HEJ A;  3UE1 A;  4KD4 A;  4H44 C;  2R61 A;  4X3U A;  3CQZ B;  2MNA A;  4H7B A;  4RAU C;  2BA1 A;  5IP7 G;  5LHY 1;  4NMZ A;  2F0T A;  3JAM L;  3K81 C;  2ZXR A;  1XMQ Q;  3NSW A;  1JQY D;  3OMC A;  4A3D G;  3CCE A;  4JK1 C;  3HKS A;  5KYI A;  4POG A;  3K5N A;  4JYA L;  3TP5 A;  4HJ8 A;  1HH2 P;  4F88 A;  2IHE A;  4F8M A;  1PH2 A;  3V2T A;  2KED A;  5D65 A;  2QF7 A;  5EQ0 A;  3TZD A;  4A3D B;  1SNP A;  2K50 A;  4PMC A;  1CQV A;  5M5Y H;  3I4O A;  1XNQ Q;  1N9W A;  4LF6 Q;  1B70 B;  1I4X A;  3AMU A;  2EIF A;  3W1B A;  4V19 0;  1UEA B;  5KEE A;  1IYU A;  4G57 A;  2X6L A;  4OWX B;  1EWH A;  2SEB D;  2WAQ G;  1BVS A;  2WII B;  3P1H A;  2F0S A;  5C3E H;  3PUX A;  2FXQ A;  1BCP F;  1KRS A;  4WJW A;  3F2C A;  4ZAI A;  3I3C A;  3QOL A;  4DNR B;  4GKK Q;  2QA4 A;  2F0K A;  3S24 A;  5L37 A;  2SOB A;  1VQ6 A;  1O7Z A;  3PIO 3;  2L1B A;  2F03 A;  2B2V A;  4MIU A;  3HZX A;  3AU7 A;  2OQK A;  1JE5 A;  1KNE A;  4U67 3;  4RKB A;  2E5L Q;  1O7Y A;  3S14 B;  1E22 A;  2EY2 A;  3D0F A;  3RN5 A;  1HHV A;  1HNX Q;  4ILW A;  2VUM G;  1OTC A;  1TWA B;  4QJF A;  1X3E A;  4X3K A;  2OTL A;  4UDU C;  3STB D;  5ELE A;  1X32 A;  5K36 H;  1KTK A;  1K0R A;  1EYG A;  5EGT A;  5JEA H;  2R3Z A;  2OTJ A;  4X65 Q;  4WOR A;  1SEB D;  1EIG A;  5BN4 A;  1Q7Y C;  2XIW A;  4JI4 L;  1VDZ A;  1HA6 A;  5I2Y A;  1WVL A;  2B29 A;  1GHJ A;  4DV2 Q;  1I6H H;  1V9P A;  1VQL A;  3VA5 A;  4YHH L;  3SDZ A;  4QUC A;  4OIK A;  3ULJ A;  4HIO A;  2TSS A;  3HKZ E;  2JYO A;  4K2K A;  2HHH L;  3ONA B;  2E2H H;  3A74 A;  4PV1 C;  4GOP B;  4XTC S;  3RD4 A;  2HIV A;  3NE5 B;  1Q12 A;  3KF8 B;  5JJZ A;  4A3F B;  2I5L X;  2HT1 A;  2A6H D;  1L0W A;  4X6A H;  3PUW A;  3Q8D A;  4IJL A;  1S5D D;  4ZUI A;  1DZ1 A;  4WJ3 M;  2VQF Q;  1HTL D;  3MHB A;  1SFO B;  2MPM A;  1XXG A;  1PH9 A;  2VS1 A;  3BJU A;  1EZ8 A;  4NPS A;  2K03 A;  3PUY A;  2UXB L;  1BNZ A;  4LF8 Q;  4IOA A;  1PLF A;  2EYL A;  4IUP A;  1ET6 A;  1OO9 B;  2L11 A;  3AFQ A;  3BYT B;  3I70 A;  1A0I A;  2PW5 A;  1N32 L;  4KTA A;  2QEJ C;  2KVM A;  1Y1V H;  1TT2 A;  3K6O A;  2CHB D;  4WRD A;  5IGG A;  1YHA A;  4GOP C;  4LF9 Q;  4TRD A;  5M5Y B;  4PG3 A;  3DEP A;  2CFM A;  2G5D A;  1BO0 A;  5CMD A;  1EWC A;  2JE6 I;  2RA4 A;  3GTG H;  1NUC A;  1VQI A;  1Z6H A;  3SGI A;  1NY4 A;  1MHW C;  1OXU A;  2VNU D;  2OQ0 A;  5C4X H;  4TKO B;  2PYK A;  3KBG A;  4DXG A;  5FLM H;  3EJI A;  1MIU A;  1RCV D;  1S5C D;  5C3E B;  2QKI C;  1WD1 A;  2FHT A;  1NSN S;  2WKD A;  1R4P B;  1NE3 A;  2B2U A;  1U4M A;  2B2T A;  2K5D A;  1LTB D;  4DR7 Q;  3S2D H;  4JI2 L;  1JE4 A;  2KJX A;  5K36 G;  3J80 c;  1BCP D;  2N88 A;  4BY1 G;  2RCF A;  2CQO A;  1K73 C;  1IKM A;  3J7Z C;  4B9X A;  4R8N A;  4QB4 A;  2ICE C;  1X3G A;  1IBM Q;  3NTK A;  1H95 A;  4RFB A;  4HMI A;  1V1P B;  1HNZ L;  2XSC A;  1TS2 A;  3MXP A;  2IY5 B;  4FP5 D;  3X3N A;  2F0G A;  1D6E C;  3S2H H;  1PH4 A;  3H0G G;  2BDO A;  3LNN A;  4LF4 Q;  1U4R A;  3I55 A;  3F2U A;  4EQO A;  1H9K A;  4GS3 A;  2E74 C;  2A1A A;  4DV6 Q;  1I6H B;  2PZW A;  3LWU A;  2IJ0 A;  2F4V L;  4JCV E;  2F4I A;  2CW0 D;  3TN2 A;  4BBR H;  2K5Q A;  4EQ5 A;  5I6Y A;  5KNC A;  2NZH A;  3U50 C;  2E2H B;  2V1C C;  2UXC Q;  1Q90 A;  1F9P A;  1MD2 D;  1F2Y A;  4DF7 A;  2KUM A;  2D5D A;  4BA2 I;  5COR A;  1CA6 A;  3VR6 A;  2Z6K C;  1HQM C;  4HMJ A;  1WI5 A;  2FIN B;  1Y1W G;  1PV4 A;  4K6D A;  1Q8K A;  1K8O A;  2IL8 A;  1IKL A;  5CV8 A;  5JJL A;  1GUW A;  1GUN A;  3CW2 C;  1X3F A;  4GKK L;  1N36 L;  1XJV A;  4AH6 A;  4CKC A;  3CCL A;  4IFD J;  4LMQ D;  1YZ6 A;  4YIJ A;  1BBW A;  4DR6 Q;  1A3T A;  2R7D A;  3ER0 A;  4DV3 Q;  1GD7 A;  4DV7 Q;  3MFY A;  1ZKO A;  5KIX A;  1RJT A;  3CCV A;  4L5Q A;  1VQJ A;  1PH3 A;  1LO5 D;  5AJ3 L;  4DK6 C;  3TRE A;  5I6W A;  2UUA L;  1PXU A;  4FF4 A;  3TDQ A;  1FNV A;  3JAM c;  5FLM G;  1S5F D;  2VZA A;  2ZTD A;  1Y1V B;  3EBE A;  3OMG A;  2IX1 A;  1TWF H;  3PIO A;  2MO1 A;  1K28 A;  2XWB B;  4OO1 I;  4X65 L;  1PVO A;  2B2W A;  4QF4 A;  3GTG B;  4IFD H;  1X55 A;  2K75 A;  1XNR L;  1FJG Q;  5C4X B;  3TSS A;  3KFU A;  1CUK A;  4I7A A;  1F9R A;  3NUC A;  1ENF A;  3PSI A;  5JJK A;  4H02 A;  4LFB L;  4MNO A;  3CP0 A;  1E24 A;  1DOM A;  3R3O A;  3T16 A;  3S2D B;  1I4Q A;  4CKB A;  3CPW A;  4RGM A;  3KF6 B;  1YBY A;  5M3F G;  2JP1 A;  3MA2 B;  3HOU H;  4IUT A;  2GVA A;  1TY2 A;  2PNH A;  1LTL A;  4JI0 Q;  3M4Y A;  4ME3 A;  3PCO B;  4UY8 C;  1ZXT A;  1YIT A;  3F2D A;  4RGN A;  3KLW A;  3G7L A;  1Q86 C;  1MI2 A;  2ZT9 C;  1SMX A;  2ZJR A;  2LS0 1;  1HNW L;  1I3Q H;  2EDG A;  4OX9 Q;  5JJI A;  3L9A X;  5C0X J;  2E2D C;  2K5W A;  1LAB A;  4K14 A;  3S2H B;  3J81 j;  3DLL A;  2DJG C;  1HFG A;  1G6Z A;  1S5E D;  3AEV A;  3VDY A;  1ESR A;  3SR1 A;  2F3W A;  4Z9C B;  4LJZ C;  3OIP A;  4KJO A;  1YNX A;  1PFM A;  3AFP A;  1HZ9 A;  4B3S L;  2EYF A;  1EU3 A;  4BBR B;  4AYB E;  3TEH B;  1EY6 A;  3CCR A;  2PQA B;  1NR2 A;  1PZJ D;  5C0X H;  1C7Y A;  5KRU A;  2IT1 A;  1PZK D;  5JVG 3;  4ZKC B;  2KCM A;  1LT5 D;  2NTS A;  3GP7 A;  3KLS A;  4DPG A;  4Q0F A;  1EY8 A;  1L0X B;  2EJM A;  2D0P A;  2R92 H;  4JI7 Q;  1EQQ A;  4IPD A;  4B3R Q;  3M3Y H;  3T1Y Q;  2D0O A;  2QW7 A;  4LFC L;  3UDF A;  5JPN C;  5G3L D;  4ULL A;  1EFW A;  5E4X A;  2ICI A;  2K5N A;  2Q8T A;  4FVM A;  1B4O A;  1TQO A;  3CF5 A;  1B44 D;  2N78 A;  1YHQ A;  3BG3 A;  3FP9 A;  3IFD A;  1GHK A;  1VQM A;  2I46 A;  4IFD G;  4IUV A;  2QDB A;  1CFM A;  1BBX C;  3I90 A;  4HID A;  3FKI H;  3HOZ G;  1IYV A;  1QUQ A;  4NW2 A;  4A93 G;  1O7I A;  1QE6 A;  3DMU A;  1L0Y B;  4DR2 L;  4S3S A;  4DA2 A;  1B3A A;  3PV0 A;  4TQU S;  3DWQ A;  1TWF B;  4GKJ L;  4N9T A;  4XT3 B;  1YJ9 A;  1A15 A;  1QNU A;  4KN4 C;  3CQZ H;  3RLO A;  1YJW A;  3HRZ C;  2K01 A;  4HAE A;  1S72 A;  3F1Z A;  5DAU A;  2Z4H A;  2H1E A;  2KOL A;  4DAV A;  2M2L A;  5CR3 A;  1II3 A;  1LTR D;  5C3W A;  3A8J E;  4FXK C;  5LMN Q;  3HOU G;  4DAP A;  4K8J A;  5LL6 S;  4CJ1 B;  5H1S E;  2Q8R E;  3M7N A;  2R93 G;  2EPB A;  3MEF A;  2N3S A;  3V05 A;  3GDE A;  3O13 A;  2JA9 A;  4IO9 A;  4KV6 A;  4MHE A;  2Z1C A;  4DUY Q;  1UE5 A;  1YNN D;  1PYS B;  2UXC L;  1G91 A;  3PUZ A;  1TWC H;  1D2B A;  5DLQ E;  4ZCK A;  3GTQ H;  4OIJ A;  3HOU B;  1EQV A;  3A7L A;  5E4W C;  3G6J B;  1ICF B;  1K3B C;  1H9S B;  5I4D A;  3B6Y A;  1TXY A;  4A3B G;  3ND9 A;  3AB9 A;  2D2C C;  2B2Y C;  4EGV A;  3R8B A;  4X66 Q;  3F8T A;  1SYB A;  5CV7 A;  2HIX A;  3PQI A;  4BS9 A;  1I3Q B;  1NJI C;  2KHS A;  5IGF A;  4KY7 A;  5COY A;  3A5U A;  5BN3 A;  2F3V A;  4P73 A;  2ES2 A;  1T5E A;  2MUY A;  1AZP A;  3Q6S A;  4DV0 Q;  2KEE A;  5C0X G;  1U9R A;  3MVV A;  2F3I A;  4DN4 M;  1KDA A;  2EYM A;  3URY A;  4JC0 A;  2EY5 A;  3I72 A;  4YCV A;  1W6J A;  4DUZ L;  2AQ2 B;  3KF8 A;  4HCE A;  1K8A C;  3STB C;  1VQ5 A;  3CC2 A;  5M5X H;  5CGK A;  2NVQ B;  1MJE A;  4M1U B;  4JI6 Q;  1SJH D;  2B63 G;  5GQO A;  4R4C A;  1UNS A;  4G7O C;  2PZU A;  1ILP A;  4XQN A;  1CT1 D;  1HCZ A;  1A2U A;  2JA5 G;  1I94 L;  2R92 B;  3UDI A;  2L12 A;  3M9B A;  4P74 A;  1LAC A;  5IGD A;  1IBK Q;  5LMU L;  4QGU A;  1V43 A;  2QGQ A;  1W2B A;  3RMH A;  1VQ9 A;  3RN2 A;  3S16 H;  2OT2 A;  1HZB A;  1DJR D;  1PTO F;  2VUM H;  1KL9 A;  4HJA A;  1UEB A;  5IY0 A;  4RHR A;  2MHV A;  1DGS A;  3FKI B;  1TII D;  1SAP A;  4JV5 Q;  1AH9 A;  4WFN 3;  4JI8 Q;  3W2D A;  2PPB C;  3MXU A;  1G8Z D;  2RKS A;  5I2X A;  3D3R A;  4KHP Q;  1BR9 A;  3I91 A;  4GN5 A;  2NVX H;  2JA8 G;  1L1O A;  1A3U A;  4JOI C;  4C1N I;  5GAH C;  1S5B D;  3JC6 6;  1BCP B;  5IYB G;  2VB2 X;  3A8K E;  1GM5 A;  4CDC C;  4KKU A;  1X3Q A;  2R6G A;  1SFO H;  3OTO Q;  1I5F A;  5BR8 Q;  2PW7 A;  1FVI A;  4K0K Q;  4A76 A;  4I7Z C;  1AEX A;  1EY7 A;  1SDF A;  1CKN B;  4CDE C;  1KLU D;  2WB1 G;  1K0S A;  1TWC B;  2Z6K A;  3ULL A;  4G7H C;  3GTQ B;  2PI2 A;  4R1J A;  3OPO A;  2AUK A;  2PZT A;  4A3L G;  4BA1 I;  1XYI A;  3VR2 A;  3I4N G;  1YNJ C;  1ML0 D;  1SNM A;  2AHO B;  1IL8 A;  2FMM A;  2M00 A;  3K0X A;  2WB1 B;  1DYQ A;  2CH4 W;  4PMW A;  1U4P A;  1CSQ A;  1BCP C;  2YTY A;  1CHP D;  1UE1 A;  2ID0 A;  3OWE B;  4KMU C;  5DNF A;  3TP6 A;  3MC0 B;  4L63 B;  5J22 A;  5M5W H;  2EJF C;  1SSO A;  1B7Y B;  3NBH A;  4JBK A;  1M8A A;  1KD1 C;  5EPJ A;  2F0W A;  4ME5 A;  3PF4 A;  2LFN A;  3MTS A;  1EYA A;  3J7A 5;  1Y8P B;  4KK7 A;  2E8G A;  3E0J A;  3U4Z A;  3IL8 A;  1MGS A;  2FMC A;  5M5X B;  5EBC A;  4DV5 L;  1C8C A;  2F0F A;  5ELD A;  3W5O A;  4KD3 A;  4HSV A;  1E7Z A;  3QG1 A;  2WAQ B;  3HOY H;  3OYY A;  2PI2 E;  3RZO H;  4X62 Q;  2CVR A;  2JXM B;  3BVM A;  3OSO A;  2RDG A;  2XTI A;  1VQ4 A;  1YIJ A;  1UWV A;  3TME A;  5GAE C;  3K5O A;  4CKE A;  2JEB I;  3BZD B;  1RIP A;  5CBA E;  2VL6 A;  3E6Z X;  1A8V A;  2CW0 C;  5KNB A;  5M9O A;  1CA5 A;  2UUC Q;  1VQH A;  2K04 A;  1LM0 A;  4BY1 H;  4LFA L;  4GLX A;  3S16 B;  4DR3 L;  2JQO A;  4HN7 A;  4OEM B;  2UXD Q;  4B9W A;  3P7J A;  2VUM B;  2Z6B A;  3J81 E;  1XMO L;  1EWI A;  5J3B A;  1I4H A;  4YWM A;  1WFQ A;  2AKW B;  1GUG A;  3HOX H;  4F87 A;  5FO8 B;  2YTV A;  4IOC A;  3Q24 A;  4WJ4 A;  1PTO D;  4FXD A;  3H0G H;  3S17 H;  2QDL A;  1S40 A;  1N34 L;  3RR5 A;  4DKA C;  4DAY B;  1VMP A;  2ZM6 Q;  2Y0S G;  2L5T A;  3R2T A;  4POF A;  3VR4 A;  4JI5 Q;  3LX0 A;  2NVX B;  1Z7T A;  4DV0 L;  2ZTE A;  4GLA C;  1V8Q A;  4R4Q A;  5IOD A;  4LF7 L;  1C4Q A;  1K9M C;  4P72 A;  2C5C A;  4P2C B;  3HG9 A;  1DON A;  3KF6 A;  2DNE A;  3VYU A;  3G71 A;  3PO3 G;  1B9M A;  4IQZ A;  4HJ5 A;  2LXK A;  1QJO A;  1SYD A;  1Y8N B;  3IRB A;  1Y1W H;  3WOF A;  1R9T H;  2R7Z G;  1KAB A;  2B8F A;  3J7Y W;  3V96 A;  2MJ8 A;  3RUZ A;  1HUM A;  2E76 C;  4JI3 Q;  4KLK A;  3VYS A;  2JA6 H;  4DV4 L;  4AQY L;  2PCF B;  1GUS A;  2WKC A;  3T51 B;  3DXJ C;  3CCJ A;  1PH1 A;  3E9I A;  1HR0 Q;  2KEC A;  4RWS C;  3DWP A;  4FXG C;  1EOT A;  4C2M H;  5C5L A;  4OWW B;  3HOY G;  1LTA D;  2GN5 A;  4ZLT F;  4NDX A;  4UPA A;  1TKW B;  3TRZ A;  5CV4 A;  3CCM A;  5M5W B;  3T1H Q;  4C3J G;  4E6I A;  3SVM A;  4IUR A;  3U9S A;  2PQA A;  1YNJ D;  5C3X A;  1JMC A;  4JV5 L;  4A3C G;  2NZO A;  3CC4 A;  1VQN A;  1K83 H;  4HED A;  4DR1 L;  2KHJ A;  4B3M L;  5IT9 L;  1I4P A;  1HPC A;  1CZW A;  2K28 A;  1EOV A;  3HOY B;  2F0J A;  1IW7 D;  3HS0 C;  3T4A C;  4A3G H;  2ENB A;  3RZO B;  5CC4 A;  1O80 A;  3PIP 3;  3I4L A;  1STN A;  1JC7 A;  2GA4 B;  3D8G A;  4DNT B;  1XMQ L;  5T1G A;  2O2L D;  3W3A A;  3HOX G;  3NTH A;  1STG A;  2BOS A;  5M3F H;  3OTO L;  4BY1 B;  1HTP A;  1WD0 A;  4X64 Q;  1A3V A;  3I4M G;  2A6E D;  4DK3 C;  3H3V C;  2F1M A;  1AFP A;  4CJ2 C;  1TWG H;  2B2Y A;  2F0U A;  2E2I H;  3NTI A;  1UAP A;  2Z4I A;  3SK6 A;  2PMZ E;  3H15 A;  3HOX B;  1CI3 M;  1KDC A;  3I7F A;  1X54 A;  1N33 Q;  4YWL A;  4AIM A;  3H0G B;  1RKN A;  1XNQ L;  3HOV H;  3S17 B;  4LF6 L;  2AQ1 B;  2DNC A;  2KQ3 A;  1PMR A;  2K7V A;  4XYO A;  4B08 A;  4DR4 Q;  2EY6 A;  2OCE A;  1IZ6 A;  5EKK A;  4ZYS A;  3HKZ G;  4HIK A;  4LUV A;  4YY3 Q;  1IYJ B;  3U58 A;  4DR5 Q;  4DNI A;  4FDB A;  3CC7 A;  1H9M A;  4Y52 H;  1E3P A;  4LUO A;  2HDM A;  2RSN A;  4YCU A;  4L5T A;  1BQQ T;  1NTG A;  1SNO A;  4XT1 B;  3H6M A;  2RHS B;  1JOR A;  2JA6 G;  1R4Q B;  4IFD I;  1DXM A;  2DGY A;  4LNQ A;  3HKZ B;  1JWU D;  4DK0 A;  4IUQ A;  1WYD A;  4L6T B;  3PMF A;  3K5L A;  3VR5 A;  3BS1 A;  2E5L L;  2K1B A;  3I56 A;  1Y1W B;  1R9T B;  1IBL Q;  3TQY A;  3A0J A;  1HNX L;  3CMA A;  1EZ6 A;  3HP3 A;  1FD7 D;  1DD2 A;  2VW9 A;  5JOB A;  2JA6 B;  4L8J A;  1LT3 D;  3MAQ A;  1EYC A;  5A2Q E;  2RDH A;  4V0B A;  3L0O A;  4JG2 A;  1YNN C;  2L9H A;  4C2M B;  4BWG B;  3MZ5 A;  3HOZ H;  4DV2 L;  5C4Z A;  1E1O A;  3OW7 A;  1EIY B;  4A93 H;  3IFT A;  2HDL A;  3DEO A;  5AFW A;  4A3G G;  2UUB Q;  2Q2H A;  1MSG A;  3BYY B;  1X9N A;  3GTM H;  1J5E Q;  2YV5 A;  5IYD H;  1WJJ A;  1BKB A;  1K83 B;  1Q82 C;  3GV6 A;  2B2V C;  3SHL A;  1I6V C;  2RF4 A;  1C48 A;  1RF2 D;  2JSO A;  4DV1 Q;  4A3G B;  3D6C A;  1X6O A;  4KHV A;  3M4Q A;  2CKZ B;  1ICW A;  3D4D A;  2R93 H;  5EKL A;  1K8G A;  4LK1 C;  1EEF D;  3NHH A;  3Q0A A;  1BUV T;  1X65 A;  3CHB D;  2VQF L;  3EA6 A;  3ITP A;  5C0X I;  2KHI A;  1XPO A;  5M3M G;  1JWS D;  1PTO H;  2JK8 A;  5M3F B;  2FJ2 A;  3WWV A;  2K5H A;  5J39 A;  2EJG C;  1AZQ A;  2LMC B;  3KOJ A;  4LF5 Q;  3HOV G;  1PHJ A;  4A3B H;  1WCM H;  2C9O A;  3WOE A;  4R8I A;  4LF8 L;  2K32 A;  5T1I A;  3J81 i;  2NN6 H;  1VQK A;  1EQR A;  3GTO H;  1Y8O B;  4CDD C;  1E0B A;  2A68 C;  1TWG B;  5NUC A;  3N52 A;  4JI1 Q;  5IWA Q;  4P71 A;  2VQE Q;  1RDP D;  2E2I B;  2EOT A;  4L5S A;  2OWO A;  1KAW A;  2ZXO A;  2NVQ H;  4LF9 L;  3AYH B;  1X56 A;  3QJY A;  3HOV B;  3C2P A;  4HSP A;  4QIW E;  2UU9 Q;  1FR3 A;  1IHZ A;  2X6G A;  2J4X A;  2BE5 D;  5C6A A;  1J8I A;  1LLR D;  3CU7 A;  4RMF A;  3A5Z B;  1LTG D;  2SDF A;  3G6E A;  3SK5 A;  4LWC A;  3K58 A;  5ELB A;  2RCN A;  3GTP B;  4JYA Q;  1NBW A;  5DM6 3;  4BBS G;  2B63 H;  2HD3 A;  3BU2 A;  1CKN A;  3H94 A;  1QZH A;  3OW2 A;  1B8A A;  3M7G A;  4DAM A;  4DR7 L;  5KYL A;  4OEL B;  5FLX L;  2JA5 H;  3D4R A;  5LMN W;  2L4N A;  2DJF C;  2WFW A;  1Y69 U;  2F0I A;  4DFA A;  1JWM D;  4A3I G;  1IBM L;  1Q3L A;  3ZYY X;  1OXS C;  3MEH A;  1BBU A;  1JIC A;  1UE6 A;  4EQP A;  1SN8 A;  1IL2 A;  4LW1 A;  5IYD G;  2HQL A;  5E3F A;  4EX5 A;  1ASY A;  4LF4 L;  2PQE A;  4CBV A;  3PIP A;  3P75 A;  2BDN A;  2B39 A;  4K6L A;  4JBW A;  4XXE A;  3HOZ B;  4DV6 L;  1S4Z A;  4A93 B;  1GXD C;  1WOC A;  1JOO A;  1QIL A;  1F2M A;  2B2T C;  3GTM B;  1ET9 A;  3QOJ A;  1WTP A;  4PQX A;  3UE0 A;  2A69 D;  4C3I H;  1PFS A;  2JEA I;  2JA8 H;  2CCZ A;  3GTK H;  1QG7 A;  3MXN B;  5IYB H;  3PUV A;  1QCB D;  2IX3 A;  5TSS A;  3KBX A;  4G7Z C;  1WCM G;  2R93 B;  1JT8 A;  1RTO A;  2Q2U A;  2NN6 G;  1GUT A;  1VQC A;  4P75 A;  4N8F A;  4GZY C;  4MTN A;  4C3H H;  3E9H A;  2GVB A;  1CSP A;  4GNX B;  5IE8 A;  2Q2I A;  1UE7 A;  1A63 A;  3GTL H;  1KC8 C;  1PTO B;  1JB7 A;  4PZ7 A;  1LT4 D;  1Q8I A;  1EU4 A;  4DR6 L;  4A3L H;  2N49 A;  4YHH Q;  4A3B B;  1WCM B;  5IT9 c;  4DV3 L;  4DV7 L;  3S1M H;  2NYZ D;  4FYD A;  1TU2 B;  2L55 A;  3I4N H;  2HHH Q;  5CV6 A;  3GTO B;  2WAQ E;  4EQN A;  4GOP A;  2HCC A;  1D8L A;  3BZC A;  1C9O A;  5FK9 C;  4DAY A;  3GQB A;  1ZYR D;  3NPP A;  1HUN A;  3G4S A;  3J80 E;  1QVC A;  2XVS A;  2NB0 A;  1SNQ A;  1VQG A;  4JPB W;  3KYH C;  5GAD C;  5CV5 A;  2F0D A;  3M4O H;  1FJG L;  2A68 D;  4AYB G;  4EVO A;  5C4H A;  1TS5 A;  3ICE A;  3N6R A;  2HUG A;  3GV3 A;  1EYD A;  1NMF A;  2EYO A;  3U9O A;  4GNX C;  4ZK9 B;  4IPH A;  2A8V A;  5J1Z A;  2A5H A;  2F0P A;  1SMY D;  2Z9H A;  2UXB Q;  2B63 B;  2EXZ A;  1W3S A;  1LV9 A;  1P16 A;  1PTO C;  2AUJ D;  5EJW A;  2OXP A;  3OOC A;  1P8L A;  1JCK B;  1FL0 A;  3R2I A;  1N32 Q;  1KLG D;  2JA5 B;  1RL2 A;  3WDN A;  3NWS A;  2EYJ A;  2V4D A;  4H13 C;  5FO9 B;  5HGQ A;  2A73 B;  2NZ1 D;  4JI0 L;  1YVC A;  3NEN A;  3A56 A;  3PF5 A;  5E1F A;  1SJE D;  4R4O A;  2N8N A;  2R7F A;  1STE A;  1G51 A;  4ODG A;  1B53 A;  3GD7 A;  4OX9 L;  1Z47 A;  2B2W C;  1HJP A;  2I07 B;  1ESF A;  5ISR A;  4C3I G;  1BOS A;  1PRT F;  1SNC A;  5IGE A;  3OWF A;  4ID6 A;  2XWJ B;  4IN3 A;  1Q1B A;  4A4I A;  1LTS D;  1VMC A;  1ILQ A;  1F2L A;  4PZ6 A;  3BVZ A;  2BCO A;  4RCO A;  3W1G A;  1G2S A;  1Q46 A;  4UHV A;  5IWA L;  2ASB A;  2VQE L;  4JI2 Q;  4JW0 A;  3CKI B;  1HQR D;  4RKL A;  4RG1 A;  2O4X A;  4CJ0 B;  5ELN A;  2N55 A;  1ONL A;  3ERO A;  4C3I B;  4HIM A;  4C3H G;  2BA0 A;  2JA8 B;  1KNA A;  2NWG A;  4FNF A;  5HUR A;  2UU9 L;  2HCI A;  3GTK B;  5BN5 A;  3H3V I;  2JA7 H;  1V1P A;  1HRJ A;  2I5H A;  5LL6 X;  3MWY W;  1HNZ Q;  4JI7 L;  3JAM E;  4KKT A;  2E2J H;  4X3T A;  3CCU A;  4B3R L;  3AQQ A;  2MFI A;  3T1Y L;  1I4R A;  2K4K A;  3PO3 H;  2I0Q A;  4A3M H;  3HGB A;  1NNX A;  4C3H B;  3UDG A;  1QZG A;  4FO2 A;  5IYC G;  1FGU A;  2R7Z H;  3GTL B;  1PYB A;  1DOL A;  1QWY A;  3TS0 A;  3C3L A;  1IW7 C;  2F4V Q;  3P20 A;  2NVY H;  3H3V H;  1CK1 A;  2DUD A;  5A35 A;  3S1M B;  4HJ7 A;  4CHT B;  3I4N B;  3NWT A;  5FJ8 H;  5ELC A;  3DUZ A;  4A3E G;  4A3K H;  3NBI A;  3DM1 A;  1D1I A;  3EQL C;  2CWA A;  1QUQ B;  2I5M X;  3J7A F;  3K8A A;  4BXX H;  2K6A A;  3ZJY C;  5DM7 3;  4K5X A;  2EXD A;  3KLR A;  3L2P A;  2K14 A;  2Z0S A;  1B50 A;  1FGB D;  2A6E C;  4HR7 B;  4C3J H;  4HTH A;  4A3J H;  4KKS A;  4DXF A;  3M4O B;  2IW3 A;  3R93 A;  2IPK D;  1FNW A;  1MKH A;  4A3E B;  1STY A;  1CHQ D;  4R4I A;  3K7A H;  4A3C H;  1VQE A;  1W6K A;  5JEA J;  1N36 Q;  5LMN L;  2C35 B;  2BH2 A;  1GUO A;  2O5J C;  3KUP A;  3FHW A;  3G48 A;  4GN4 B;  2WIN B;  2YTX A;  3KDF B;  3VA7 A;  2LY7 A;  1M1K C;  1DM0 B;  1VQO A;  1QB5 D;  3F2B A;  3TBI B;  2EZV A;  3J81 L;  1NR4 A;  1E2W A;  1Q1E A;  1FYC A;  3H91 A;  4DUY L;  4QCL A;  5AJ3 Q;  2UUA Q;  4I65 A;  5KGU A;  5IIF A;  3CME A;  2JJQ A;  1EFI D;  1MJC A;  1WTH A;  4BY7 H;  2Q8I B;  4OWT B;  1PH8 A;  2NUC A;  3VR3 A;  3HOW H;  4QMG A;  2EYP A;  2ATW A;  2CWP A;  1EIH A;  3SK8 A;  4X66 L;  4KJN A;  1AE2 A;  3U4V A;  2FFK B;  2RHQ B;  3I4M H;  1EY0 A;  2RSO A;  1XNR Q;  4XQQ A;  1K3R A;  3ERQ A;  1S3O A;  4YCW A;  3K5M A;  1EQT A;  3QWN A;  4A3F G;  2OEO A;  1VQ8 A;  5FLX c;  1BXT A;  1T5X D;  4ZQ3 A;  4NXN Q;  2RBM A;  4LFB Q;  2JA7 G;  1HR0 W;  1PRT D;  3S1Q H;  1WTX A;  1SND A;  4LAA A;  1Q81 C;  2Y0S B;  2D62 A;  3UI2 A;  5JVH 3;  1EL0 A;  3VYT A;  4JI6 L;  4RA8 A;  1XPU A;  4A3M G;  2ZJP A;  1T9H A;  4HCS A;  1YJN A;  2J0T D;  3I8Z A;  2JA7 B;  2AWN A;  3HFZ B;  2RDF A;  4IPG A;  5F2D A;  5HGT A;  1WTV A;  1UUP A;  3PO2 H;  1QVG A;  1HNW Q;  3SK4 A;  4O1N A;  5EPK A;  1LYL A;  2E2J B;  1SYG A;  1WTW A;  5EAY A;  3S1R H;  3DM3 A;  1IBK L;  1PA6 A;  2PNR C;  3PO3 B;  5FJ8 G;  4A3M B;  4JBM A;  1I50 H;  4NXM Q;  1EY4 A;  4A3K G;  1PH6 A;  1D5Z C;  2AQ3 B;  1AW7 A;  1X3P A;  2R7Z B;  4X3S A;  4BXX G;  1V1Q A;  1CKO A;  1J9O A;  1GJX A;  2NVY B;  5EPL A;  4B3S Q;  2F0M A;  4TSS A;  1A62 A;  4YWK A;  3J7A V;  3LWE A;  5C3E G;  4A3J G;  3SEB A;  1D5M C;  3D31 A;  1E2V A;  3CD6 A;  4A3K B;  3OIQ A;  1L2F A;  1WTR A;  4ZUJ A;  4JI8 L;  1DCZ A;  2K05 A;  4J15 A;  1JB3 A;  3J80 i;  2XRQ D;  2XRS D;  4NKL A;  5FOB B;  3RLF A;  1O78 A;  3K80 C;  4KN7 C;  4KHP L;  4ALP A;  1PFN A;  4C3J B;  3A8I E;  4A3J B;  3KJP A;  1AN8 A;  3ERS X;  4LFC Q;  1L1O B;  1XTD A;  2G9H D;  2F0N A;  2KCC A;  3K7A B;  1BDO A;  5FKA C;  2G9D A;  4BY7 G;  4G4K A;  1SBB B;  1JJC B;  3FMC A;  1SR3 A;  3CAM A;  3HOW G;  5JEA G;  3E3X A;  1RTN A;  1G29 1;  5BR8 L;  4QQB X;  1PDQ A;  3QIA A;  3NXW A;  1SE8 A;  4C1N K;  4K0K L;  3IKJ A;  4GN3 B;  3L7Z C;  2BE5 C;  5IT9 E;  4DK1 A;  2TMP A;  1J6Q A;  4DR2 Q;  4BY7 B;  1MSH A;  3DHQ A;  4XQJ A;  3VYR A;  1B3Q A;  3T53 B;  1LTT D;  3BDO A;  5M3M H;  3HOW B;  4GKJ Q;  1KIX A;  1HFN A;  1PH5 A;  3EIV A;  5CBE E;  2F0L A;  1MBY A;  1ENA A;  2L0C A;  2NTT A;  4JVZ A;  2Z8L A;  3I4M B;  2XN9 C;  4MN3 A;  4RCN A;  2ZTC A;  3KJO A;  1TS4 A;  4OGQ C;  3CXC A;  5KND A;  2MP1 A;  4UP9 A;  1SRO A;  1L1O C;  3CPF A;  5CV9 A;  1D5X C;  3TP7 A;  3Q22 A;  1CTM A;  3NEM A;  3GTJ H;  4IAL A;  2YU9 H;  1G6P A;  3GTP H;  1TVX A;  3NBH B;  2NBF A;  2LKV A;  3NP8 A;  4UP8 A;  5EBD A;  3TS2 A;  1TWH H;  3PO2 G;  3MXN A;  3CCQ A;  1VF7 A;  3S1Q B;  2CH4 A;  4XDX A;  3EN2 A;  1AP0 A;  5G3L F;  1U4L A;  3QB3 A;  1PFB A;  3QR8 A;  1H9S A;  1B2T A;  4O42 A;  1CKM A;  4X62 L;  1IXR A;  2NVT H;  3ND8 A;  2D9U A;  3LGJ A;  4UP7 A;  3S15 H;  4FF2 A;  4BBS H;  1HZC A;  3JAM i;  4GNX A;  3PO2 B;  1SRU A;  3C46 A;  3GO5 A;  1KAA A;  4MTK A;  1Y1V G;  3S1R B;  1YI2 A;  1EUJ A;  5A2Q L;  2VY3 A;  2F0E A;  2UUC L;  1STH A;  1I50 B;  2A69 C;  3FEW X;  3E0E A;  1U5K A;  1OXV A;  4A3I H;  1LTI D;  1M90 C;  2UXD L;  5C4X G;  4B3T Q;  3E5S A;  4DUZ Q;  1XTC D;  1FNU A;  4RGO S;  2A74 C;  4CDF C;  2X69 A;  1C0A A;  4IZ8 A;  1SYF A;  4KY6 A;  3NQI A;  2XGT A;  4UAI A;  1F77 A;  3BVG A;  3ULP A;  3SE0 A;  1SYC A;  1WTQ A;  3EVQ A;  3OHX C;  1DOK A;  3UDX A;  3MFG A;  1TS3 A;  1I94 Q;  4JOI A;  1QVF A;  1GOZ A;  2ZM6 L;  2EQS A;  2EE1 A;  2K5V A;  4IPC A;  2IWH A;  2NN6 I;  4JI5 L;  1VCI A;  2M9V A;  2EY1 A;  2KEN A;  4PNY A;  2WAC A;  5LMU Q;  4APV A;  4Y7N H;  1LUZ A;  2CQA A;  4NXN L;  3IAY A;  3S9W A;  2B3G A;  1D1K A;  4DGZ A;  1OXT A;  3FRP B;  1OXX K;  1PH7 A;  4FF1 A;  4K2L A;  4J6H A;  4RHS A;  1TR5 A;  2QEX A;  3CRL C;  2F0O A;  4OO1 H;  3BDL A;  1ZYR C;  2WP8 J;  2F0H A;  1ROD A;  4TVA B;  1D7Q A;  1NMG A;  2P5Z X;  3A54 A;  4QUF A;  3L3O C;  1VQA A;  2E75 C;  1B9N A;  1CQF A;  1AE3 A;  1I4G A;  3RLN A;  1H9R A;  1CM9 A;  4JI3 L;  2DN8 A;  1Z9F A;  3C1E A;  3SXH A;  5M3M B;  2SNM A;  3I73 A;  3H09 A;  1SMY C;  4BBR G;  1SE3 A;  4NXM L;  1VS0 A;  1HR0 L;  1E1T A;  4A75 A;  1EEI D;  5ELO A;  5JPM C;  1SYE A;  1B1Z A;  3J81 c;  4RH6 A;  4HJ9 A;  5C44 H;  4R9W A;  2SNS A;  2PO4 A;  2KA7 A;  4DU9 A;  3GTJ B;  2YU9 B;  4MZ9 A;  3T1H L;  1A2T A;  5ELF A;  4KI0 A;  2LSS A;  2WV6 D;  2IHF A;  5C4J H;  1O7L A;  1TWH B;  1SLJ A;  3M85 A;  3X3M A;  1YEZ A;  2B8G A;  2DY7 A;  2PMZ B;  1YHB A;  1VQP A;  1KXL A;  4ZRZ A;  4O0A A;  2NVT B;  5I9O A;  1PZI D;  1NCV A;  3S15 B;  4BBS B;  1VQ7 A;  1E2Z A;  2QIL A;  4ZKB B;  4OON A;  4RGT A;  3MXG A;  1VQD A;  2LXJ A;  2F0V A;  1NAP A;  3M4P A;  3T13 A;  3RZD H;  2JN4 A;  3S1N H;  2ZXP A;  1F2Z A;  2MO0 A;  4X64 L;  1QNK A;  5FLX E;  4A3I B;  3D4W A;  4OHJ A;  5IGC A;  1HZA A;  1GO3 E;  1U0L A;  3FVQ A;  2VB3 X;  5IOC A;  4DV5 Q;  2B2U C;  2HQE A;  1XX8 A;  3C1F A;  5D14 A;  3A55 A;  2K33 A;  1N33 L;  1GVP A;  1N8R C;  3BZK A;  4FF3 A;  4H0L C;  2RVL A;  4OL7 A;  5GRO A;  1ASZ A;  1VF5 C;  2O5I C;  1KHI A;  5E7N A;  4OO1 G;  4XYQ A;  1RHP A;  3BDC A;  5CYU A;  2IX0 A;  4U68 A;  4DR4 L;  1GKH A;  2H5X A;  1F9S A;  4PMB A;  2A19 A;  5IP9 H;  2WB1 E;  1STB A;  4YY3 L;  2DY8 A;  4DR5 L;  4Y7N B;  3Q23 A;  3KDF A;  1KDB A;  4IUU A;  4LFA Q;  2KBN A;  3NK9 A;  4DR3 Q;  3RNU A;  4JI4 Q;  5IP7 H;  1ENC A;  4J8Q A;  4LUZ A;  2AMC B;  3PGZ A;  4KY5 A;  1XMO Q;  4N9P A;  4XIG S;  1ZEQ X;  5I9P A;  4IUN A;  5DEH A;  4A3D H;  2J7Z A;  3DWA A;  4NB3 A;  4KHZ A;  1IBL L;  5C44 G;  2OF1 A;  2H4O A;  1V1O A;  5C5M A;  1STA A;  5IYC H;  3J80 L;  3CCS A;  3K0Y A;  1N34 Q;  4N8X 1;  1JR0 D;  2L15 A;  3QO2 A;  4Q5V A;  4J1M A;  3FPP A;  4O2D A;  1KQS A;  1PRT B;  1G2T A;  4LF7 Q;  4C56 C;  1RD9 D;  1Y14 B;  2XNA C;  4GLV B;  2VXW A;  3FPU B;  5C44 B;  1WTO A;  1HXY D;  4A3E H;  3CRK C;  2R92 G;  4B3T L;  3TZU A;  1BF4 A;  2MQH A;  1CZG A;  5D3D A;  1KRT A;  4F7X A;  2Q2T A;  1SE4 A;  2UUB L;  5JAV A;  5EKI A;  5C4J B;  3I2Z A;  3K57 A;  2F0Q A;  1SXT A;  1J5E L;  3S14 H;  3T56 B;  3A7A B;  4ABN A;  1SE2 A;  5K5P A;  3FDT A;  4AYB B;  2K52 A;  4CGY B;  1JOQ A;  2EVB A;  1TWA H;  3KLS X;  4K5W A;  2F52 A;  4R4T A;  4DV1 L;  1A6X A;  4QIW B;  4DV4 Q;  2ALY B;  4AQY Q;  2AWO A;  1EIF A;  3FKI G;  3M3Y B;  3K7U C;  1EY9 A;  1K8M A;  2ZJQ A;  2BH8 A;  4QY7 A;  1TY0 A;  2EYH A;  2QCP X;  4JBJ A;  4K8I A;  1F9Q A;  1PRT C;  2KCN A;  3RZD B;  3S1N B;  3D6W A;  1XPR A;  1JJ2 A;  3NEL A;  4NP5 A;  3TP8 A;  2KCT A;  4K5V A;  1EY5 A;  1XWE A;  2A6H C;  2YYZ A;  4LF5 L;  4QL5 A;  4PZ8 A;  5D3I B;  4IJH A;  1HA5 A;  1H9J A;  2Y0S E;  1LT6 D;  3NQT A;  5FO7 B;  1JJG A;  1M4V A;  1QOH A;  4OXP A;  5HY6 A;  4JI1 L;  3KK7 A;  5IGB A;  4L5R C;  1PYW D; 
#chains in the Genus database with same CATH homology
 1VQB A;  4JI6 L;  4DR1 Q;  5IP9 G;  3HOZ G;  5GAG C;  2E5L L;  1XPU A;  1QUQ A;  3I56 A;  4A3M G;  1O7I A;  1IBL Q;  4B3M Q;  4A93 G;  1VQF A;  2ZJP A;  3TQY A;  1T9H A;  4DR2 L;  3A0J A;  1YJN A;  4A3F H;  1HNX L;  3PV0 A;  4TQU S;  3UE1 A;  3CMA A;  2MNA A;  2AWN A;  3HFZ B;  4GKJ L;  2BA1 A;  5IP7 G;  1YJ9 A;  4IPG A;  2VW9 A;  1HNW Q;  3CQZ H;  3RLO A;  1YJW A;  1QVG A;  3K81 C;  3PO2 H;  1LYL A;  1S72 A;  1XMQ Q;  3F1Z A;  5EAY A;  3S1R H;  3DM3 A;  1IBK L;  1PA6 A;  4A3D G;  5FJ8 G;  3CCE A;  4NXM Q;  4JBM A;  1I50 H;  3L0O A;  4JG2 A;  4A3K G;  3HKS A;  5LMN Q;  1PH6 A;  4POG A;  3HOU G;  4JYA L;  3HOZ H;  4DV2 L;  5H1S E;  1E1O A;  4HJ8 A;  1HH2 P;  1EIY B;  3M7N A;  4A93 H;  2R93 G;  4A3G G;  3MEF A;  4BXX G;  1V1Q A;  2N3S A;  2UUB Q;  2Q2H A;  1CKO A;  2IHE A;  3GDE A;  4IO9 A;  2JA9 A;  1PH2 A;  4B3S Q;  1X9N A;  3GTM H;  1A62 A;  4YWK A;  4DUY Q;  1UE5 A;  5C3E G;  1PYS B;  2UXC L;  4A3J G;  1J5E Q;  2YV5 A;  3PUZ A;  5IYD H;  1TWC H;  5DLQ E;  1WJJ A;  3D31 A;  2K50 A;  1BKB A;  1Q82 C;  3CD6 A;  3GTQ H;  1L2F A;  4JI8 L;  2RF4 A;  5M5Y H;  3I4O A;  4A3B G;  3B6Y A;  1TXY A;  4J15 A;  1XNQ Q;  3J80 i;  1N9W A;  4LF6 Q;  4DV1 Q;  1B70 B;  1X6O A;  3M4Q A;  4X66 Q;  2CKZ B;  2EIF A;  3F8T A;  3W1B A;  3RLF A;  2R93 H;  3K80 C;  4KHP L;  2HIX A;  4ALP A;  4OWX B;  1K8G A;  1NJI C;  2WAQ G;  3KJP A;  1BVS A;  3ERS X;  4LFC Q;  3A5U A;  1L1O B;  1XTD A;  4P73 A;  2ES2 A;  1X65 A;  2VQF L;  5C3E H;  5C0X I;  3PUX A;  2FXQ A;  2KHI A;  5C0X G;  4DV0 Q;  5M3M G;  1XPO A;  1KRS A;  4BY7 G;  2JK8 A;  3WWV A;  1JJC B;  2F3I A;  3F2C A;  2K5H A;  1SR3 A;  3KOJ A;  4LF5 Q;  3CAM A;  3HOV G;  3HOW G;  1PHJ A;  5JEA G;  1WCM H;  4LF8 L;  4JC0 A;  2QA4 A;  4A3B H;  4GKK Q;  4YCV A;  1G29 1;  5BR8 L;  3J81 i;  4QQB X;  3S24 A;  4DUZ L;  1SE8 A;  4K0K L;  1VQK A;  1VQ6 A;  4GN3 B;  1EQR A;  3GTO H;  1K8A C;  3STB C;  4JI1 Q;  3L7Z C;  5IWA Q;  1VQ5 A;  3CC2 A;  4P71 A;  5M5X H;  2VQE Q;  2OQK A;  1JE5 A;  1MJE A;  4JI6 Q;  4L5S A;  2E5L Q;  1J6Q A;  1E22 A;  3D0F A;  2OWO A;  2B63 G;  1KAW A;  5GQO A;  4DR2 Q;  3RN5 A;  4R4C A;  2NVQ H;  1HNX Q;  4LF9 L;  3AYH B;  2VUM G;  1X56 A;  1OTC A;  4QJF A;  5M3M H;  1X3E A;  4GKJ Q;  1KIX A;  4QIW E;  2OTL A;  2JA5 G;  1PH5 A;  3EIV A;  2UU9 Q;  3STB D;  1I94 L;  3UDI A;  1K0R A;  4RMF A;  1EYG A;  3A5Z B;  2OTJ A;  3M9B A;  4P74 A;  3G6E A;  4X65 Q;  4LWC A;  2ZTC A;  3KJO A;  1IBK Q;  5LMU L;  3CXC A;  4QGU A;  1V43 A;  2QGQ A;  4UP9 A;  1SRO A;  1W2B A;  1Q7Y C;  1L1O C;  2RCN A;  3CPF A;  4JI4 L;  1VQ9 A;  3RN2 A;  3S16 H;  4JYA Q;  2B29 A;  1HZB A;  1NBW A;  3NEM A;  3GTJ H;  4DV2 Q;  2YU9 H;  4BBS G;  1I6H H;  2B63 H;  1V9P A;  3BU2 A;  1VQL A;  1CKN A;  1QZH A;  3GTP H;  1G6P A;  3OW2 A;  1B8A A;  4DAM A;  3NBH B;  4DR7 L;  4YHH L;  2VUM H;  1KL9 A;  4UP8 A;  4HJA A;  3TS2 A;  1TWH H;  1UEB A;  3ULJ A;  2JA5 H;  4HIO A;  3PO2 G;  5IY0 A;  3HKZ E;  3CCQ A;  5LMN W;  2HHH L;  1DGS A;  2WFW A;  3EN2 A;  2E2H H;  3A74 A;  4GOP B;  4JV5 Q;  4XTC S;  1AH9 A;  2HIV A;  4JI8 Q;  1Q12 A;  4A3I G;  3KF8 B;  1CKM A;  1IBM L;  4X62 L;  1IXR A;  2I5L X;  2HT1 A;  2NVT H;  3LGJ A;  4UP7 A;  1L0W A;  3S15 H;  4BBS H;  4X6A H;  3PUW A;  1HZC A;  3JAM i;  4KHP Q;  4GNX A;  3Q8D A;  1OXS C;  4GN5 A;  4IJL A;  1BBU A;  2NVX H;  1SRU A;  1UE6 A;  1L1O A;  3GO5 A;  4JOI C;  5GAH C;  2JA8 G;  1Y1V G;  1YI2 A;  1EUJ A;  1SN8 A;  1IL2 A;  4LW1 A;  4WJ3 M;  3JC6 6;  2VY3 A;  2HQL A;  5IYB G;  5IYD G;  4EX5 A;  2VQF Q;  1ASY A;  2UUC L;  4LF4 L;  3PIP A;  1GM5 A;  3E0E A;  4L5R C;  1PH9 A;  2VS1 A;  4JBW A;  3BJU A;  4NPS A;  4DV6 L;  1U5K A;  3PUY A;  1OXV A;  2R6G A;  4A3I H;  1SFO H;  2UXB L;  2UXD L;  1M90 C;  4LF8 Q;  5C4X G;  4IOA A;  3OTO Q;  1I5F A;  5BR8 Q;  4B3T Q;  1FVI A;  1WOC A;  3AFQ A;  4DUZ Q;  4A76 A;  4K0K Q;  1A0I A;  1N32 L;  3UE0 A;  1CKN B;  1C0A A;  2WB1 G;  2XGT A;  4C3I H;  1PFS A;  2Z6K A;  3ULL A;  2JEA I;  2JA8 H;  3ULP A;  1Y1V H;  2PI2 A;  4R1J A;  2CCZ A;  4GOP C;  1YHA A;  3GTK H;  3MXN B;  4LF9 Q;  5IYB H;  3PUV A;  4A3L G;  4PG3 A;  2CFM A;  4BA1 I;  2JE6 I;  3UDX A;  3GTG H;  1I94 Q;  3I4N G;  1VQI A;  1WCM G;  4JOI A;  3SGI A;  1NY4 A;  2EQS A;  2K5V A;  2ZM6 L;  4IPC A;  1OXU A;  1QVF A;  2OQ0 A;  2AHO B;  2VNU D;  1JT8 A;  5C4X H;  2NN6 I;  4JI5 L;  2Q2U A;  2NN6 G;  1VCI A;  2KEN A;  3K0X A;  5LMU Q;  1VQC A;  4APV A;  4P75 A;  5FLM H;  1LUZ A;  4Y7N H;  4MTN A;  1MIU A;  4NXN L;  3E9H A;  2B3G A;  2GVB A;  1CSP A;  4C3H H;  4GNX B;  5IE8 A;  4PMW A;  2Q2I A;  1CSQ A;  2YTY A;  1UE7 A;  1OXT A;  1UE1 A;  2ID0 A;  1OXX K;  1PH7 A;  1A63 A;  3GTL H;  1KC8 C;  1JB7 A;  1NE3 A;  5M5W H;  4PZ7 A;  2QEX A;  1B7Y B;  4JBK A;  1KD1 C;  4DR6 L;  4A3L H;  2N49 A;  4YHH Q;  3S2D H;  2WP8 J;  4DR7 Q;  5IT9 c;  4DV3 L;  4DV7 L;  3PF4 A;  4TVA B;  4JI2 L;  1D7Q A;  3S1M H;  3J7A 5;  1NMG A;  5K36 G;  3J80 c;  3I4N H;  2E8G A;  2HHH Q;  2WAQ E;  3U4Z A;  4GOP A;  4BY1 G;  4DV5 L;  1VQA A;  1D8L A;  2CQO A;  1K73 C;  3BZC A;  3J7Z C;  3W5O A;  1C9O A;  1E7Z A;  1AE3 A;  3RLN A;  3HOY H;  3OYY A;  1X3G A;  2PI2 E;  1IBM Q;  3RZO H;  4X62 Q;  3G4S A;  4JI3 L;  1Z9F A;  1H95 A;  1QVC A;  1HNZ L;  2XTI A;  1VQ4 A;  1YIJ A;  1UWV A;  4BBR G;  1VQG A;  5GAE C;  3KYH C;  5GAD C;  2JEB I;  4NXM L;  3M4O H;  1FJG L;  1RIP A;  1VS0 A;  2IY5 B;  1HR0 L;  1E1T A;  4A75 A;  2VL6 A;  4AYB G;  5ELO A;  3S2H H;  1PH4 A;  1A8V A;  2UUC Q;  3H0G G;  3ICE A;  3J81 c;  4LF4 Q;  1NMF A;  3I55 A;  4HJ9 A;  1VQH A;  1LM0 A;  5C44 H;  4BY1 H;  4LFA L;  4GLX A;  4GNX C;  2A8V A;  4IPH A;  4DR3 L;  4GS3 A;  4DV6 Q;  2A1A A;  2JQO A;  4MZ9 A;  2UXB Q;  1W3S A;  1P16 A;  2UXD Q;  3T1H L;  4KI0 A;  2LSS A;  2F4V L;  4JCV E;  1P8L A;  2IHF A;  1XMO L;  5C4J H;  1FL0 A;  1N32 Q;  1SLJ A;  1EWI A;  5J3B A;  4YWM A;  1RL2 A;  4BBR H;  3M85 A;  1WFQ A;  4EQ5 A;  1YEZ A;  2NZH A;  2AKW B;  3HOX H;  3U50 C;  1YHB A;  2V1C C;  2YTV A;  4IOC A;  2UXC Q;  5HGQ A;  4WJ4 A;  3H0G H;  4JI0 L;  1YVC A;  1VQP A;  1KXL A;  3S17 H;  4BA2 I;  3NEN A;  4O0A A;  3PF5 A;  1S40 A;  1N34 L;  4R4O A;  3RR5 A;  4DKA C;  2N8N A;  4DAY B;  2ZM6 Q;  2R7F A;  2Z6K C;  1VQ7 A;  1G51 A;  2Y0S G;  3GD7 A;  4POF A;  4OON A;  4JI5 Q;  4OX9 L;  1WI5 A;  1Y1W G;  1Z47 A;  1PV4 A;  4DV0 L;  1Q8K A;  1HJP A;  2ZTE A;  1VQD A;  2LXJ A;  3M4P A;  4GLA C;  4R4Q A;  4LF7 L;  3RZD H;  3S1N H;  5JJL A;  3CW2 C;  1X3F A;  1K9M C;  4GKK L;  1N36 L;  4P72 A;  4A4I A;  1Q1B A;  2MO0 A;  1XJV A;  4AH6 A;  4X64 L;  3CCL A;  3KF6 A;  4PZ6 A;  4IFD J;  1YZ6 A;  1BBW A;  4DR6 Q;  3W1G A;  2R7D A;  3ER0 A;  4DV3 Q;  1GD7 A;  1Q46 A;  5IWA L;  4DV7 Q;  2VQE L;  4JI2 Q;  2ASB A;  3G71 A;  1HZA A;  3PO3 G;  1GO3 E;  1U0L A;  4RG1 A;  3CCV A;  5ELN A;  4L5Q A;  4HJ5 A;  1VQJ A;  2LXK A;  1PH3 A;  5AJ3 L;  4DK6 C;  3TRE A;  2UUA L;  4DV5 Q;  3IRB A;  3JAM c;  1Y1W H;  1R9T H;  5FLM G;  2R7Z G;  4HIM A;  2VZA A;  2BA0 A;  2ZTD A;  2UU9 L;  3EBE A;  1N33 L;  1GVP A;  1N8R C;  1TWF H;  3BZK A;  3PIO A;  4JI3 Q;  2IX1 A;  4KLK A;  2MO1 A;  2JA7 H;  2I5H A;  5GRO A;  1ASZ A;  1HNZ Q;  1KHI A;  4OO1 I;  2JA6 H;  4X65 L;  5E7N A;  4DV4 L;  4OO1 G;  1PVO A;  4AQY L;  4JI7 L;  2IX0 A;  1X55 A;  2K75 A;  4DR4 L;  1GKH A;  2H5X A;  3CCJ A;  2E2J H;  1XNR L;  1FJG Q;  2A19 A;  3CCU A;  1PH1 A;  3E9I A;  1HR0 Q;  3AQQ A;  3KFU A;  4B3R L;  2MFI A;  1CUK A;  5IP9 H;  2WB1 E;  2K4K A;  4YY3 L;  3T1Y L;  2I0Q A;  4DR5 L;  4A3M H;  3PO3 H;  3KDF A;  3UDG A;  4C2M H;  1QZG A;  3M3Y H;  4LFA Q;  5IYC G;  2KBN A;  1FGU A;  3PSI A;  4DR3 Q;  3RNU A;  4OWW B;  2GN5 A;  2R7Z H;  3HOY G;  1PYB A;  4UPA A;  3TS0 A;  4JI4 Q;  3TRZ A;  5IP7 H;  5JJK A;  4H02 A;  3CCM A;  4LFB L;  3T1H Q;  4LUZ A;  4MNO A;  2AMC B;  3CP0 A;  3PGZ A;  1E24 A;  2F4V Q;  2PQA A;  2NVY H;  3H3V H;  1XMO Q;  1JMC A;  4XIG S;  2DUD A;  3CPW A;  4HJ7 A;  4JV5 L;  3KF6 B;  4A3C G;  2NZO A;  3CC4 A;  1YBY A;  5FJ8 H;  1VQN A;  4A3D H;  1K83 H;  5M3F G;  4A3E G;  4DR1 L;  4A3K H;  2KHJ A;  4NB3 A;  3HOU H;  4KHZ A;  1IBL L;  4B3M L;  2CWA A;  2GVA A;  1QUQ B;  2I5M X;  2PNH A;  1EOV A;  1LTL A;  5C44 G;  4ME3 A;  3PCO B;  4JI0 Q;  4UY8 C;  3K8A A;  4BXX H;  4A3G H;  1YIT A;  3ZJY C;  3CCS A;  5IYC H;  1N34 Q;  3F2D A;  3KLW A;  1Q86 C;  2EXD A;  3L2P A;  2K14 A;  1SMX A;  2Z0S A;  2L15 A;  2ZJR A;  1HNW L;  1I3Q H;  5JJI A;  4C3J H;  4OX9 Q;  4A3J H;  5C0X J;  1XMQ L;  4O2D A;  1KQS A;  4LF7 Q;  1MKH A;  4R4I A;  4A3C H;  1Y14 B;  3K7A H;  3J81 j;  1VQE A;  3HOX G;  3DLL A;  5JEA J;  1N36 Q;  4GLV B;  5LMN L;  5M3F H;  3OTO L;  4A3E H;  2C35 B;  2BH2 A;  2R92 G;  4X64 Q;  4B3T L;  3AEV A;  3FHW A;  3G48 A;  3VDY A;  3I4M G;  4GN4 B;  2YTX A;  3KDF B;  2MQH A;  1KRT A;  4DK3 C;  1M1K C;  2Q2T A;  2UUB L;  1VQO A;  1YNX A;  3AFP A;  3F2B A;  1HZ9 A;  4B3S L;  1Q1E A;  3I2Z A;  1TWG H;  4DUY L;  5AJ3 Q;  2UUA Q;  2E2I H;  4AYB E;  3TEH B;  1J5E L;  3CCR A;  3S14 H;  3CME A;  2PQA B;  2JJQ A;  2PMZ E;  3H15 A;  1C7Y A;  1MJC A;  4BY7 H;  2IT1 A;  3I7F A;  1X54 A;  2K52 A;  2KCM A;  1N33 Q;  4YWL A;  4OWT B;  4AIM A;  4DPG A;  1PH8 A;  1TWA H;  1XNQ L;  3H3V I;  3HOV H;  3HOW H;  4LF6 L;  4R4T A;  2F52 A;  4DV1 L;  2D0P A;  2ATW A;  2CWP A;  2R92 H;  4DV4 Q;  4X66 L;  2ALY B;  1AE2 A;  4AQY Q;  3U4V A;  2AWO A;  1EIF A;  1EQQ A;  3FKI G;  4IPD A;  2RHQ B;  4JI7 Q;  3I4M H;  4DR4 Q;  2OCE A;  1XNR Q;  1IZ6 A;  3K7U C;  4B3R Q;  2ZJQ A;  3HKZ G;  2BH8 A;  1K3R A;  4QY7 A;  4HIK A;  1S3O A;  4YCW A;  2D0O A;  4LUV A;  1IYJ B;  4YY3 Q;  4LFC L;  3T1Y Q;  3UDF A;  4DR5 Q;  3U58 A;  4JBJ A;  4DNI A;  4A3F G;  4FDB A;  1VQ8 A;  3CC7 A;  5FLX c;  1XPR A;  1EFW A;  1JJ2 A;  4Y52 H;  1E3P A;  3NEL A;  4LUO A;  4YCU A;  4L5T A;  2KCT A;  4NXN Q;  2K5N A;  1NTG A;  4LFB Q;  2YYZ A;  2JA7 G;  4LF5 L;  4QL5 A;  4PZ8 A;  2RHS B;  4IJH A;  3CF5 A;  1HR0 W;  2N78 A;  2JA6 G;  1YHQ A;  4IFD I;  2Y0S E;  3FP9 A;  1VQM A;  4IFD G;  2DGY A;  4LNQ A;  1JJG A;  5HY6 A;  4OXP A;  4JI1 L;  3FKI H;  4HID A;  3S1Q H;  1Q81 C;  1WYD A;  2D62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...