1SROA

S1 rna binding domain, nmr, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
76
structure length
76
Chain Sequence
b'AEIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PNPASE
publication title The solution structure of the S1 RNA binding domain: a member of an ancient nucleic acid-binding fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags S1 rna-binding domain
total genus 4
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.8: Polyribonucleotide nucleotidyltransferase.
pdb deposition date 1996-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1sroA00
4LF6L 1X9NA 3NBHB 3RLOA 3U4VA 3WWVA 4LF7Q 1Q46A 2QA4A 4A3KH 3GTKH 4OWTB 1KIXA 1E1TA 3HOWG 5IYCG 3M85A 4NB3A 1FL0A 4JI3L 3CQZH 4LW1A 3M3YH 2UU9Q 3TREA 4DV5L 1B7YB 4DUZQ 4DK6C 2UUCL 1W3SA 4X64Q 2HIXA 3MEFA 1XJVA 2F52A 1L2FA 2AMCB 2JEBI 2VQEQ 4TQUS 4JI7L 1SROA 4LNQA 1K83H 3EBEA 1VQHA 4GLAC 4O0AA 1WCMH 4OX9L 2JJQA 3DM3A 2AWOA 3E0EA 4X65Q 1I94Q 1X54A 3TEHB 2EQSA 4DUYL 3KF8B 2WAQE 4A75A 3U58A 2PQAA 1EYGA 4B3TL 2RHQB 5GAGC 4X62Q 4AQYQ 3AFPA 4KHZA 1AE2A 2JA6G 3TS0A 4GKJL 3J7ZC 4GOPC 2K75A 2UUBQ 1L1OA 4JOIC 1S72A 3CP0A 1PA6A 1HR0Q 1XNRL 3HOZG 2VQFL 4GN5A 2K14A 4DAMA 1X56A 1OXTA 1Z9FA 3H0GG 2EXDA 3UE1A 4R4QA 5M3MG 2C35B 1PH9A 1UEBA 1SRUA 5IT9c 3M4OH 5M3FG 3ULPA 5AJ3L 2JA7G 2R93G 3ER0A 3G6EA 2IX1A 1C0AA 2IX0A 1N8RC 2OQKA 4JBWA 3F8TA 1VQDA 1G291 1EQRA 2UXDQ 1N33L 1YI2A 3KLWA 1YIJA 3K81C 2E2IH 1KL9A 3W1GA 4OO1I 4A3FG 2NZHA 4L5QA 2UUAL 1V1QA 1I3QH 1N9WA 1PH5A 2VUMH 1VQKA 4IPDA 5IYBG 3GTQH 1J5EQ 2YTVA 1PH6A 2Z0SA 3D31A 3ERSX 1PH3A 1E3PA 4P74A 1Y1WG 1XNQQ 1GKHA 3JC66 4AYBE 3RN2A 3HOUH 4LF4L 1A63A 1I50H 4A93G 2BA1A 3T1YQ 2KCTA 1B70B 2D62A 3GTLH 4JI0L 4GOPB 5JEAG 1NMFA 3VDYA 3S24A 1HNXL 4JI4L 3FHWA 4A3DH 3I4NG 3PSIA 4DR5Q 3PF5A 1A62A 3CPWA 4JYAQ 2LSSA 3S1MH 4BBSH 3HOYH 2AKWB 3GTPH 1YHBA 2OWOA 3CCVA 1KRTA 4A3IG 4A3LH 4DV1L 4UPAA 3PGZA 3ULJA 1Q7YC 2Q2IA 2WP8J 1AH9A 4K0KQ 3E9HA 1XMQL 3RZDH 1YVCA 4YCWA 2K5NA 3E9IA 3T1HL 1ASYA 4JI6L 2R7ZG 2E2JH 4GLXA 3FKIG 3G48A 1UE7A 3AYHB 5C4XG 3BZKA 2YTYA 2VL6A 3HOVG 1D7QA 4GNXA 4DR2L 1O7IA 4UP8A 4X66Q 3PF4A 2NN6G 4HJ9A 3A5ZB 2CWPA 2VW9A 3K7UC 2XTIA 1CUKA 4NXNL 3TQYA 3CCUA 4A3CH 4LWCA 4DNIA 4WJ4A 2ZM6L 4LF8Q 4LF9Q 1NE3A 3UDFA 3A0JA 1D8LA 5M5WH 3GTGH 3J81c 3HOXG 4GN4B 1PH2A 1PH4A 1X65A 1KQSA 2F4VL 4JV5Q 1AE3A 3OYYA 5E7NA 2D0OA 1GM5A 4B3SQ 2NVTH 4BY7G 4A3CG 4DV6Q 1K0RA 1J6QA 4L5TA 1Q82C 4B3ML 1TWAH 4BXXG 2VS1A 1MIUA 1HZ9A 2DUDA 2OQ0A 3OTOQ 1GD7A 1YHAA 2PI2A 4P71A 1K73C 1FJGQ 1XTDA 4UP9A 4YHHL 4PZ8A 4HIDA 1EWIA 2KENA 1NTGA 1YHQA 2CCZA 1KXLA 4JCVE 4JI1Q 1B8AA 2WB1G 2B3GA 2ES2A 2AHOB 2NN6I 1PYSB 3CCEA 4BY1H 3CCQA 2YTXA 2R92G 2GVBA 3U50C 1M90C 2B63G 1V43A 3K80C 4TVAB 3H3VH 1Q1EA 4YCVA 3CD6A 4Y52H 5IYDG 1IBLQ 2JA5H 2K5HA 1PVOA 3PO3H 3IRBA 2BH8A 4HJ8A 4A3BH 1HNWQ 2KBNA 4JI8L 3J80c 2JA9A 2ZTEA 4A3JH 2OTLA 4JI5Q 5LMUQ 2FXQA 2A8VA 1JE5A 2R7FA 1H95A 1RIPA 1N36Q 4LFAL 1E7ZA 1CKNA 4PZ7A 5IWAL 3RN5A 4KLKA 2HHHQ 3RZOH 3UE0A 5IP7G 4C2MH 4GKJQ 4DR6Q 2E5LL 4IPHA 3I56A 2VY3A 4KHPL 2WFWA 1TWGH 1X3EA 4OWWB 3JAMi 3K0XA 4XIGS 3RNUA 2ASBA 4DR1L 4HJ7A 1K8GA 4IFDG 3MXNB 1CSPA 1KD1C 3PO2H 2JA8H 1HR0W 3CXCA 3TS2A 3STBD 4QL5A 4LFBL 5GQOA 2Z6KC 3I4MG 2ALYB 3CCMA 4BBRH 1BVSA 2Z6KA 2PNHA 4HJAA 2Q2HA 4GOPA 1WOCA 2PMZE 1SFOH 4A3EH 4DR7Q 3DLLA 4JOIA 5JJLA 3CMAA 4DV7Q 1Q12A 1PH8A 3M9BA 4LF7L 1P8LA 1OXVA 1HZCA 5BR8L 2CQOA 4OONA 4LF5Q 2N3SA 1Q1BA 5FLMH 3KF6B 4DV4Q 2UU9L 2UXCQ 1UWVA 4IFDI 3STBC 3S2DH 5FJ8H 1ASZA 1IYJB 2NVQH 1EFWA 2K52A 1VQFA 4A3MH 4X64L 4DR3Q 1N32Q 5JJKA 4A3KG 2I5HA 1HJPA 1PHJA 2ZTCA 4R4OA 4R4TA 2N49A 1U0LA 1WJJA 3KJOA 1W2BA 2LXJA 1K9MC 1OXXK 2IHFA 4X65L 1I94L 2IY5B 4LF4Q 2HT1A 1U5KA 4AIMA 3RLNA 3CC7A 1YJ9A 4X62L 4AQYL 4EQ5A 5GAEC 4YY3Q 1WCMG 3PUZA 1MJCA 4KI0A 4PG3A 1IZ6A 4DR4Q 1YZ6A 2E2HH 2Q2TA 4JI4Q 2UUBL 5GROA 2CWAA 2E8GA 2WAQG 4DV3Q 3S1RH 4IOAA 2I5MX 3I2ZA 2HIVA 4GLVB 1S40A 3NENA 1LM0A 1NY4A 5FLXc 2QGQA 1EIYB 1V9PA 3UDXA 4YWKA 3G71A 5IE8A 4UP7A 1VQNA 1IBKQ 4EX5A 4NXML 4B3RL 4PMWA 1S3OA 4JBJA 5C3EH 1KC8C 3T1HQ 2NVYH 4JI6Q 3ZJYC 1JJCB 2RHSB 3L2PA 1EIFA 3G4SA 1HNZQ 3LGJA 1VCIA 5LMNW 3S16H 4A3GH 4DR2Q 1Y1VH 2MO0A 1JJGA 2UXBL 2ZJRA 2PI2E 1YITA 1X3FA 3RR5A 3ICEA 1VQMA 4GKKL 2I5LX 2R6GA 5LMNQ 2I0QA 1SLJA 1UE6A 1SE8A 1L1OB 1E1OA 2Q2UA 1HZBA 2QEXA 1J5EL 1Z47A 3OW2A 4JI2L 1VS0A 1VQEA 5IP9H 1NJIC 1IBML 3M4QA 4LUZA 4C3JH 1N34L 1XNQL 1Y14B 5C44H 2EIFA 3KJPA 4UY8C 1I6HH 1LYLA 2B29A 2VUMG 1Q8KA 4QQBX 1X6OA 2MFIA 4GS3A 1XMOQ 2MO1A 5C4JH 3T1YL 1VQLA 2F3IA 2KCMA 4DV0Q 1SN8A 3PIOA 3GDEA 3CF5A 3HOWH 3HOUG 2NZOA 5IYCH 2OTJA 4DR5L 4JC0A 4JYAL 1C9OA 4YWLA 4DV2L 4A4IA 2V1CC 4LF6Q 3U4ZA 2L15A 4POFA 4R4IA 3A5UA 1QUQB 2AWNA 4LFCL 4DAYB 2CKZB 3PV0A 4A3DG 5JEAJ 4HIOA 3SGIA 4JI3Q 1X55A 4BA1I 1R9TH 1BBUA 4K0KL 4DV5Q 3HKZG 4BBSG 1BKBA 3HOYG 1LUZA 2UUCQ 1WYDA 2CFMA 3A74A 1PYBA 1YBYA 3KF6A 3M4PA 4LUOA 4MNOA 4LFAQ 4C3HH 3I55A 3F2CA 1VQ9A 3TRZA 4A3LG 5ELNA 3CW2C 4ME3A 4JI7Q 1G51A 5C0XJ 3EN2A 3NELA 2JA6H 4OX9Q 4X66L 4WJ3M 1XPRA 1FVIA 3GTJH 4DR1Q 3S2HH 4AH6A 1TWHH 2KHIA 5K36G 3CAMA 1JJ2A 3Q8DA 4DUYQ 1E22A 4LF8L 1TWCH 2IHEA 4LF9L 4MTNA 4B3TQ 1XPUA 3HOZH 1HZAA 4LUVA 2N8NA 3H0GH 3L0OA 5M3MH 1VQCA 4JV5L 1G6PA 3M7NA 3S14H 4B3SL 1QVGA 2Y0SG 4DV6L 5M3FH 3KFUA 4DKAC 2ZTDA 1PV4A 3H15A 4IJHA 1QVFA 2JA7H 1XNRQ 2R93H 2GN5A 3GD7A 4DK3C 3OTOL 3NEMA 2VQFQ 1FJGL 3AQQA 4JI2Q 4APVA 4JI0Q 4POGA 1OXSC 4P75A 4L5RC 1OXUA 5BR8Q 4HIMA 4IPGA 1PH1A 5JJIA 2N78A 4JI1L 4P72A 1MJEA 5AJ3Q 2JEAI 2JK8A 1K8AC 3KDFB 3L7ZC 4A76A 5HGQA 2H5XA 1PH7A 4A3FH 4GNXB 2IT1A 1TXYA 3GTMH 1KHIA 4YCUA 1WFQA 4HJ5A 1IBLL 3JAMc 5IYBH 1HNWL 1N33Q 4BY1G 1QZHA 2JQOA 1CKMA 3PUVA 1EUJA 4JI5L 5LMUL 2LXKA 4DUZL 1Y1WH 4JBMA 2UUAQ 1N36L 1KRSA 2HHHL 1LTLA 2JA5G 1VQ6A 4X6AH 3PO3G 1RL2A 2YU9H 1VQOA 4A3BG 4A93H 1L1OC 2VQEL 4DR6L 4IFDJ 5M5YH 1PFSA 1NMGA 4OO1G 4A3JG 1DGSA 1X3GA 1VQ4A 2NVXH 1A8VA 4IPCA 5DLQE 3I4NH 2KHJA 1YJNA 4JBKA 1E24A 2YV5A 4FDBA 4OXPA 4QGUA 3BZCA 1VQBA 5EAYA 4B3RQ 4NXMQ 1SR3A 5IY0A 4YWMA 3PIPA 4A3IH 3BU2A 1HNXQ 1Q86C 1IL2A 3I7FA 3CCLA 3PO2G 3CCRA 3S17H 1SMXA 2JA8G 1HR0L 3AEVA 4QJFA 4DR7L 3PUWA 4QY7A 3H3VI 3CMEA 1M1KC 4OWXB 4DV7L 1VQAA 1QVCA 4BBRG 3UDGA 5M5XH 2R7ZH 2DGYA 3S15H 2MNAA 4DV1Q 3FKIH 5C4XH 2UXBQ 4LF5L 2K4KA 3HOVH 1QUQA 4Y7NH 2R7DA 4DV4L 1CKNB 1HH2P 1L0WA 4A3EG 2GVAA 5H1SE 1XMQQ 1UE1A 4GKKQ 3GTOH 1VQ7A 2ZJPA 4DR3L 1OTCA 1YNXA 2ZJQA 4NPSA 4P73A 2UXCL 1N32L 1TWFH 2YYZA 1YJWA 3B6YA 2MQHA 2A19A 4IOCA 1Q81C 5FLMG 2UXDL 3HOXH 3BJUA 1IBMQ 1N34Q 2PQAB 3KYHC 1GVPA 5FJ8G 2RCNA 5GAHC 1VQPA 4L5SA 2VZAA 4A3MG 4BY7H 4NXNQ 4BXXH 1JT8A 2K50A 2ZM6Q 4R4CA 3CCSA 5GADC 1WI5A 4YY3L 4ALPA 2F4VQ 4DR4L 4RMFA 4DPGA 4B3MQ 2WB1E 4XTCS 3F1ZA 4DV3L 2BA0A 4IJLA 3HKZE 4DV2Q 1A0IA 2BH2A 2R92H 4PZ6A 4YHHQ 2ATWA 4LFCQ 3S1NH 3HFZB 2B63H 3UDIA 5C0XG 1VQJA 3CCJA 1EQQA 3J81i 3J7A5 5IYDH 1IBKL 3F2BA 4AYBG 2A1AA 1P16A 2K5VA 5J3BA 3KOJA 3PUYA 1MKHA 3EIVA 5ELOA 3F2DA 1VQ5A 3FP9A 4JG2A 1EOVA 3KDFA 4QIWE 4GNXC 4HIKA 1HNZL 1IXRA 1BBWA 1FGUA 5IP7H 5C3EG 4R1JA 1XPOA 1YEZA 1JB7A 2Y0SE 2JE6I 4JI8Q 2ID0A 1VQ8A 3J81j 5LMNL 4RG1A 3ULLA 5IWAQ 3D0FA 4A3GG 3I4OA 1Y1VG 3PUXA 1JMCA 3HKSA 2E5LQ 3RLFA 5C0XI 3CPFA 3GO5A 4KHPQ 2OCEA 1KAWA 4IO9A 1T9HA 3I4MH 3AFQA 3W1BA 4H02A 1UE5A 3K8AA 4BA2I 4J15A 2HQLA 3S1QH 4GN3B 3J80i 1NBWA 1C7YA 3K7AH 1GO3E 1XMOL 2VNUD 4LFBQ 3CC4A 3PCOB 5IP9G 2D0PA 5HY6A 4O2DA 4DV0L 4MZ9A 1K3RA 3W5OA 5C44G 1VQGA 3CC2A 4C3IH 1VQIA 1CKOA 2XGTA 1CSQA 1QZGA 2RF4A 1I5FA
chains in the Genus database with same CATH superfamily
3NBHB 2QA4A 2L9HA 3HOWG 4OWTB 3A8JE 1KIXA 4A3IB 1FL0A 1CQVA 3EVQA 2UU9Q 3LX0A 4DV5L 2RKSA 5ELEA 2OXPA 1W3SA 4N8FA 1V1PA 5EGTA 5M5XB 4MHEA 1CZWA 2F0WA 2F52A 1D1IA 3J7YW 3HP3A 1LO5D 3E0EA 2FFKB 4G4KA 4C3HG 2DNCA 3KF8B 2WAQE 1EYGA 2RHQB 3CHBD 1YNJC 4X3UA 3WOFA 3TS0A 3HOXB 2SNSA 5I2XA 1PFNA 1BCPB 3J7ZC 2K75A 1L1OA 1NSNS 2HCCA 3CP0A 1PA6A 1HR0Q 3RUZA 3K59A 4GN5A 4JI2L 1Z9FA 3H6MA 3UE1A 4JI0L 4PQXA 4R4QA 5HGTA 1UEBA 1S5BD 2M9VA 5M3FG 2R93G 1PRTB 3ER0A 1BCPF 1H9MA 1JWSD 3BVGA 2IX1A 3F8TA 4M1UB 3SEBA 3S1NB 3TN2A 2KCNA 3VA5A 2F0UA 3ITPA 3VR6A 1N33L 3A7LA 3K81C 2B8FA 1PRTF 1NR2A 1E2WA 1FR3A 4L5QA 3BDCA 2UUAL 1KLGD 2MJ8A 1PH5A 2VUMH 3F2UA 2YTVA 1PH6A 2Z0SA 3ERSX 3K58A 3TP5A 1I50H 1PYWD 4QUFA 3T1YQ 1B70B 2D62A 4ODGA 3GTLH 3J81L 4B9WA 4R8NA 3CPWA 1WTPA 3S1MH 1TQOA 4BBSH 3HOYH 1WTQA 2B2VA 1KABA 5CC4A 5JAVA 3CCVA 1GUGA 4A3LH 4OL7A 4UPAA 4DV1L 1Q7YC 2WP8J 1O7YA 3J7AV 3E3XA 2EYLA 1QILA 1G91A 2DY8A 1ICFB 3NTIA 3G7LA 4WFN3 3G48A 3BZKA 2YTYA 2VL6A 3HOVG 2MHVA 2AQ2B 5D3DA 4UP8A 3A54A 3BYTB 3C2PA 3A5ZB 3PIO3 3K7UC 1LTID 1CUKA 1UEAB 1UNSA 2H1EA 1A6XA 1NE3A 3K0YA 1EZ6A 2DJGC 1X65A 4BWGB 1AE3A 1SYDA 3IKJA 2J7ZA 4BY7G 2CHBD 4BXXG 4C1NK 2F3VA 1EOTA 2VS1A 2Q8RE 1HZ9A 3MA2B 3OTOQ 1K73C 4P71A 1MBYA 1BR9A 4PMBA 2KENA 1NTGA 1KXLA 2NB0A 2WB1G 5CORA 4ZUIA 3Q6SA 4BY1H 2R92G 2NTSA 2IW3A 3P7JA 3K80C 3H3VH 1EL0A 1JQYD 1RHPA 5IYDG 2JA5H 2K5HA 1PVOA 2K5QA 2AQ3B 1WTVA 4OO1H 1VF7A 1VMCA 5KNDA 1BBXC 1E7ZA 4K5XA 4UDUC 5IWAL 2HHHQ 4KLKA 3RZOH 5CV4A 1STAA 2E5LL 4IPHA 3I56A 2B39A 1TWGH 4HJ7A 1PZID 1HR0W 3CXCA 3STBD 4LFBL 2Z6KC 3I4MG 4IALA 2Q8IB 5IGDA 4ZK9B 3HOUB 4GOPA 3DLLA 4KY7A 1Q12A 4DV7Q 1A3TA 4C1NI 2CH4W 2Z9HA 5ELFA 5FLXL 2N3SA 1Q1BA 3KF6B 4DV4Q 2UXCQ 2NVYB 4IFDI 4K2KA 1IYJB 2K52A 1VQFA 4A3MH 4X64L 4DR3Q 3GTPB 1N32Q 4A3KG 2I5HA 2A73B 1PHJA 3FRPB 1BF4A 3KJOA 2CW0C 4RKLA 1HA5A 1EY8A 3DEOA 4X65L 1I94L 2IY5B 1U5KA 1YNND 1YJ9A 4YY3Q 1ICWA 1WCMG 4PG3A 4QMGA 4DR4Q 2E2HH 2Q2TA 4JI4Q 2EE1A 4I7AA 5GROA 3J7AF 2HIVA 3NENA 1Y69U 3I70A 3UDXA 2NVTB 4BS9A 4B3RL 4RCNA 4ID6A 4PMWA 4JBJA 3OIQA 1MSGA 2NVYH 5JPNC 1DOMA 1BDOA 5ELDA 3L2PA 3S16H 3EROA 1Y1VH 2B2TC 2Z1CA 3HS0C 4DR2Q 2UXBL 2JSOA 2PI2E 1RDPD 1X3FA 1TT2A 2X6GA 1DM0B 2FHTA 3KUPA 1CZGA 5D3IB 5J1ZA 4GKKL 1Z7TA 4HCEA 1SLJA 1UE6A 1HZBA 2QEXA 1J5EL 3OW2A 3PO3B 3M4QA 2F0KA 4LK1C 4A3JB 1Y14B 2PO4A 2EIFA 2IPKD 2LY7A 1I6HH 1LYLA 2B29A 3MFYA 4XQJA 1X6OA 4GS3A 1XMOQ 3NBIA 3E6ZX 2KCMA 3FPUB 4DV0Q 3PIOA 3GDEA 2OTJA 2NZOA 2EYPA 2K01A 1QCBD 3PO2B 1X3QA 1C48A 3FDTA 3EJIA 4A4IA 2HDMA 4IUTA 3OW7A 2L15A 4R4IA 4DAYB 4HIOA 3SK6A 2HDLA 4DV5Q 5CR3A 3I8ZA 2QKIC 5E3FA 4CHTB 4LUOA 3F2CA 5IGBA 1ENFA 5IODA 5ELNA 1BOSA 2QDLA 1QG7A 1F2ZA 1FVIA 3ERQA 4DR1Q 4AH6A 2NVQB 2B8GA 1JOOA 2A69C 3Q8DA 1JJ2A 1TWCH 1XPUA 2XRQD 2N8NA 1PTOC 1PFMA 1QVGA 3KFUA 4KY6A 1UUPA 3FMCA 3GD7A 4DK3C 1FJGL 3AQQA 4JI2Q 4JI0Q 3D6WA 1OXUA 1IW7C 3EFXD 3DUZA 4P72A 1MJEA 1K8AC 1Q8IA 3S1RB 4A76A 4IUPA 1RKNA 1WTOA 1CI3M 1EY6A 4GNXB 4EQNA 4RKBA 2JYOA 1CM9A 1IBLL 5FK9C 1WFQA 5IYBH 1N33Q 1RTNA 1QZHA 3NTHA 4IUUA 4F7XA 4JBMA 5LMUL 1LACA 4RHSA 2UUAQ 1N36L 4QUCA 1I6VC 2DJFC 4X6AH 4A3GB 1JWMD 4TKOB 2YU9H 4DR6L 1L1OC 1DGSA 3TMEA 3PIP3 4IPCA 1QNKA 4JBKA 1YJNA 1PTOB 2E74C 2X69A 4FDBA 4QGUA 1U4PA 2A68D 4OEMB 4C3JB 3BU2A 1IL2A 5KNBA 3S9WA 1HR0L 1D1KA 2JA8G 3AEVA 4KMUC 1M1KC 4HMJA 1KDBA 2R7ZH 2DGYA 4DV1Q 5C4XH 4JVZA 4LF5L 1D5XC 2H4OA 3I90A 2R7DA 4A3EG 1L0WA 1V1PB 1UE1A 2KCCA 1VQ7A 3AMUA 5EKKA 5LL6X 4P73A 4IOCA 4NW2A 1LTAD 5FLMG 3PMFA 4K14A 3QB3A 4A3CH 5GAHC 2K05A 2WKCA 3X3MA 2K1BA 4R4CA 4CKBA 4HAEA 3VR4A 2JA6B 5L37A 3GTJB 2DN8A 3S2HB 1I4PA 1TWHB 3RD4A 3Q24A 4FVMA 4DV2Q 2B2VC 1TVXA 1DOLA 4FP5D 1F2MA 2ATWA 4LFCQ 3HFZB 2B63H 5CV9A 1VQJA 3CCJA 1HA6A 3SHLA 1EQQA 1JCKB 1SXTA 2JA7B 4AYBG 3MXPA 1PXUA 3QO2A 4JW0A 2ICIA 1HNZL 3I73A 4KHVA 1GOZA 2Z4IA 5C3EG 1JB7A 4A3FB 4IFDH 1JB3A 1ESRA 5IWAQ 2XVSA 3PUXA 3HKSA 1AP0A 2E5LQ 5K5PA 5C0XI 2F0QA 1KAWA 1WTHA 2RSOA 2F0SA 3BZDB 3BYYB 3ND8A 3K8AA 4EVOA 1VF5C 3S1QH 4FF3A 2BE5C 1SMYC 4LFBQ 5IP9G 2V4DA 5M5YB 1SNMA 2D0PA 2I07B 4O2DA 4NMZA 5C44G 2NVXB 1VQGA 4C3IH 3I4NB 4CBVA 2RF4A 4OELB 1Q46A 1E1TA 5IYCG 3M85A 3CQZH 3M3YH 2EYMA 3TREA 3IFTA 4DUZQ 4DK6C 3V96A 4X64Q 2HIXA 4P2CB 3S15B 4JI7L 3FKIB 1SROA 1K83H 3EBEA 4RHRA 1VQHA 4GLAC 4O0AA 4ZLTF 4OX9L 2FJ2A 3MZ5A 4X65Q 3GTOB 3DMUA 1I94Q 1X54A 3SDZA 2EQSA 4E6IA 4DUYL 4B3TL 2Z6BA 2EPBA 4HR7B 1H9SB 4GOPC 3T53B 5CV5A 3HOZG 1TS4A 2XN9C 1CK1A 2EJGC 3H0GG 2EXDA 5M3MG 1SRUA 3ULPA 5AJ3L 3U9OA 3VR3A 5JVH3 5EKIA 1WTRA 1N8RC 1C0AA 2OQKA 5FLXE 3OOCA 2RVLA 1EQRA 4J1MA 2PNRC 4OO1I 2NZHA 1GHKA 1N9WA 1SYGA 1X3PA 2LS01 3FPPA 1J5EQ 1X32A 3D31A 3SK5A 4IUQA 1Y1WG 2L1BA 1GKHA 3JC66 4AYBE 3TP7A 3SK4A 4A93G 2KCTA 5JOBA 3E5SA 5T1IA 4GOPB 5JEAG 1EIHA 1HNXL 4JI4L 4A3DH 1SYCA 2FMCA 2K6AA 1A62A 3K6OA 1A2UA 3K7AB 4RAUC 5IOCA 4G7OC 1KRTA 4A3IG 3GP7A 2Q2IA 2HQEA 1RF2D 4CDDC 2RDGA 3RZDH 1YVCA 4YCWA 2K5NA 3E9IA 1ASYA 3ONAB 2OF1A 5KIXA 1IKLA 4GNXA 4DR2L 1O7IA 4XDXA 4HJ9A 2CWPA 2PZUA 3CCUA 4WJ4A 4LWCA 2GA4B 4YIJA 2OT2A 3UDFA 1D5ZC 1D8LA 5M5WH 3J81c 3HOXG 1PH2A 3D8GA 3IL8A 1PH4A 5COYA 1GM5A 3T51B 5BN5A 1BCPC 3BVMA 4C56C 1TWAH 1AFPA 1MIUA 2WAQB 2OQ0A 4K2LA 1FJGQ 1SE2A 1HXYD 4UP9A 4YHHL 2F0NA 4PZ8A 4FXDA 1CHQD 1TR5A 3BS1A 1EWIA 2CCZA 4JCVE 1B8AA 5JPMC 3BG3A 2B2WA 4KV6A 4EQOA 2ES2A 2AHOB 4FF4A 3CCQA 2ZT9C 3GV3A 4IUVA 3NXWA 4MIUA 4RGTA 4YCVA 1TS5A 4RCOA 1IBLQ 4KKTA 3R2TA 2BH8A 1EEID 3NQTA 3OSOA 2OTLA 5LMUQ 3NP8A 2R7FA 4RH6A 5TSSA 1RIPA 3IFDA 5CMDA 1N36Q 4FF2A 4KD3A 1Y8PB 3KLSX 3JAME 4IURA 3V05A 4C2MH 1F2LA 4DR6Q 1GHJA 4NDXA 1X3EA 4OWWB 4XIGS 4DR1L 1K8GA 1WD0A 3TS2A 1A3UA 2VUMB 4BBRH 3QR8A 5EBCA 2C9OA 4HJAA 2PMZE 1SFOH 1I50B 2Z4HA 3I3CA 1PZJD 1PH8A 3GTLB 4LF7L 1HZCA 2CQOA 4LF5Q 1IYVA 1DCZA 3K5OA 4EGVA 3STBC 5FJ8H 1ASZA 3S1MB 4BBSB 3HOYB 2IJ0A 3H3VC 2J0TD 5DM73 2O4XA 1TIID 2ZTCA 4R4TA 2F0EA 2N49A 1U0LA 3NSWA 4DK0A 5EJWA 2NZ1D 4CJ0B 4N9PA 1K9MC 2G5DA 1OXXK 2IHFA 5FO9B 2F0VA 2R3ZA 4LF4Q 2HT1A 4RWSC 3CC7A 4X62L 2EDGA 4AQYL 4KN4C 4X3SA 1E0BA 3PUZA 4KI0A 3NWTA 5C0XH 2UUBL 2KA7A 4HEDA 5DAUA 1EU3A 1LM0A 5FLXc 1STBA 3HZXA 1VQNA 1F9SA 5KYIA 1YNNC 1S3OA 4NKLA 5FOBB 1KC8C 1TY0A 3T1HQ 4H7BA 1TKWB 4RGOS 4R9WA 1JJCB 2RHSB 3W2DA 1HNZQ 3MFGA 3LGJA 1VCIA 1MI2A 1JJGA 2MO0A 4GZYC 1SE4A 2K7VA 3P1HA 4BY1B 1KNEA 2F4IA 3RR5A 3ICEA 2KHSA 4C3HB 5C4HA 3VYTA 3MXGA 2WV6D 4ZUJA 1D5MC 1SE8A 2JA5B 5FKAC 1VS0A 1VQEA 1FGBD 1XNQL 2ZXOA 2QDBA 4S3SA 2EY1A 1Q8KA 3RZOB 2MFIA 1AEXA 3MXUA 1G2TA 4EQPA 1TWGB 3R3OA 3HOWH 3HOUG 1NCVA 4JC0A 1H9SA 2B2UC 4DV2L 2PZWA 2V1CC 4POFA 1W6KA 3A5UA 2AWNA 4LFCL 1BXTA 2BDNA 4CDFC 4PNYA 3SGIA 1SDFA 2IWHA 4K0KL 5AFWA 3NPPA 1BKBA 1MHWC 1LV9A 1Z6HA 3M4PA 4LFAQ 4MNOA 4F88A 4C3HH 1I4QA 5CV6A 1A2TA 2DY7A 4JI7Q 4QCLA 1SJHD 1ZKOA 4OX9Q 4X66L 2KEEA 1I4GA 1XPRA 2L12A 1SSOA 2KHIA 5K36G 1F77A 4A3MB 4DUYQ 4LF8L 2IHEA 2SNMA 4LF9L 4B3TQ 1K8MA 3QJYA 4H44C 1G6PA 4JV5L 1KNAA 3M7NA 2RBMA 1AZPA 5M3FH 2XNAC 1PV4A 2NBFA 3H15A 2N88A 4IJHA 1MD2D 2R93H 2GN5A 4PMCA 1G6ZA 1OXSC 1TU2B 1B2TA 3SXHA 5BR8Q 2N78A 4K5VA 4JI1L 2E2HB 5AJ3Q 2JEAI 4O42A 3L7ZC 3C1FA 1EYDA 1PH7A 3D4DA 2IT1A 2EZVA 1EY7A 1KHIA 4HJ5A 3JAMc 3TBIB 3H94A 2JQOA 1QWYA 3MHBA 3PUVA 1EU4A 4JI5L 2F1MA 3QOLA 4DUZL 2VB3X 4L6TB 4DNRB 2F0JA 1KRSA 1LTGD 3S16B 3PO3G 1RL2A 1Y1VB 1VQOA 4A3BG 4A3JG 1X3GA 4L63B 2B2YC 1A8VA 1J9OA 5DLQE 2KHJA 1ENCA 3A7AB 3GV6A 3Q23A 4OXPA 3BZCA 2EYOA 4NXMQ 1GUSA 1I4RA 4UAIA 1HNXQ 2TMPA 4IFDJ 3I7FA 3PO2G 3S17H 1SMXA 1I6HB 3PUWA 4QY7A 5JJZA 3CMEA 4OWXB 2KJXA 3HOVH 4OHJA 4Y7NH 1DONA 1CKNB 1JICA 3CRLC 2ZJPA 1ZEQX 4NPSA 1NR4A 1TWFH 3B6YA 4Q0FA 3HGBA 1LTTD 3BJUA 1N34Q 1I4XA 3KK7A 2RCNA 4BY7H 2VZAA 3C3LA 4V190 3NTKA 4BXXH 1QOHA 1S5DD 4J8QA 2AQ1B 4K6LA 5LHY1 3C46A 3I4MB 2WB1E 4XTCS 4DV3L 2BA0A 1TWCB 2BH2A 2G9HD 2R92H 4PZ6A 4YHHQ 1ZYRD 3MEHA 4KY5A 1B1ZA 1EFID 5LL6S 3J81i 1B44D 5IYDH 1I4HA 3PUYA 1MKHA 3EIVA 5ELOA 1VQ5A 3FP9A 1ZXTA 3KDFA 1Q3LA 4ZQ3A 4GNXC 1JR0D 5KGUA 2F0OA 3CKIB 1BBWA 1STYA 4R1JA 1JOKA 2EJFC 3QWNA 2ID0A 1VQ8A 3J81j 3HEJA 1WTXA 4RG1A 3K5MA 4A3GG 2L5TA 1JMCA 5C5MA 2EXZA 3GO5A 4IO9A 3I4MH 3AFQA 3P75A 3CRKC 3W1BA 3JAML 1F9RA 1BNZA 1TS3A 2CH4A 4GN3B 1GO3E 2YU9B 3PCOB 2B2WC 4DAVA 4C3JG 5HY6A 1WTWA 1K3RA 2PZTA 3CCRA 1QZGA 2EYFA 5D65A 1X9NA 3RLOA 3M4OB 4IN3A 3WWVA 4RGNA 4LF7Q 4A3KH 1QJOA 3GTKH 4NB3A 4ZYSA 3LNNA 1EY0A 2ENBA 2UUCL 1STHA 3MEFA 2R7ZB 1L2FA 2JEBI 2VQEQ 2EY5A 4TQUS 3K5LA 5C4XB 4LNQA 1WCMH 3O13A 1DZ1A 3DM3A 5E4WC 1SBBB 4A75A 3DXJC 4X62Q 3AU7A 2NYZD 4AQYQ 2HCIA 4KHZA 4XT3B 2JA6G 1L0XB 2IL8A 1XX8A 2UUBQ 1S72A 3H09A 1KLUD 2VQFL 2K14A 2N55A 4DAMA 2C35B 3M4OH 4F8MA 2JA7G 3QOJA 2IX0A 4JBWA 3MVVA 4OIJA 4M8AA 1G291 3OMCA 2B63B 1O7LA 2A6HD 2UXDQ 1LT3D 4HMIA 1YI2A 1YIJA 2E2IH 1KL9A 4A3FG 3HRZC 3SVMA 4ZKCB 1I3QH 4IPDA 3GTQH 2K04A 4R8IA 1E2VA 1PH3A 1E3PA 3P20A 5EBDA 1XNQQ 2VXWA 4XQNA 4RA8A 3RN2A 4LF4L 3R8BA 1A63A 4DAPA 1JOQA 4KJNA 1NMFA 3VDYA 3R2IA 3WDNA 3I4NG 3PF5A 3S1QB 3QIAA 3L3OC 5I6WA 4LMQD 1LLRD 4DA2A 1YHBA 3ND9A 2OWOA 3GQBA 2QILA 4K0KQ 1L0YB 4C3IB 3E9HA 4K8IA 3D6CA 2BCOA 3FVQA 5NUCA 1OO9B 4DFAA 3T1HL 1GXDC 1QB5D 2E2JH 1B4OA 1JE4A 3FKIG 1D7QA 3N52A 3CQZB 3M3YB 4X66Q 2NN6G 4NXNL 3TQYA 3DWAA 2LKVA 4DNIA 2ZM6L 4LF8Q 4LF9Q 5KYLA 1PMRA 2ZXPA 3GTGH 4GN4B 1K83B 4JV5Q 4KKUA 3OYYA 5E7NA 2D0OA 1K0RA 4L5TA 3NQIA 4UHVA 2DUDA 1GD7A 2PI2A 4CDCC 4G57A 1T5EA 2EOTA 1K3BC 4JPBW 1DD2A 4HIDA 1HRJA 1PFBA 2KEDA 1QNUA 1AN8A 1EWCA 4G7HC 1YHQA 4JI1Q 3N6RA 1S5ED 1AZQA 3CCEA 2YTXA 3TDQA 1H9JA 3OIPA 3DHQA 4RGMA 1NNXA 4HJ8A 1IW7D 3A56A 5BN4A 1Y8NB 4JI8L 2JA9A 4JI5Q 2FXQA 4IQZA 2A8VA 1JE5A 3NK9A 1H95A 2A6ED 4LFAL 1CKNA 2BDOA 5IP7G 4GKJQ 1K8OA 4KHPL 2WFWA 2JN4A 3K0XA 3JAMi 3RNUA 2ASBA 1CSPA 1KD1C 2JA8H 4CJ1B 5J22A 1WD1A 2E76C 4WORA 2L55A 2F0LA 1BVSA 4HTHA 2Z6KA 1C4QA 2PNHA 4FXGC 1E2ZA 2EVBA 1CFMA 5I4DA 1H9KA 4A3EH 4JOIA 2PPBC 4FNFA 4KD4A 2LMCB 3M9BA 4MN3A 5BR8L 3T16A 1SAPA 4OONA 1U4RA 4A3DB 5FLMH 3S2DH 3HKZB 2L4NA 2SOBA 1EFWA 1BO0A 1HJPA 3KLRA 2SEBD 1WVLA 2LXJA 3RZDB 1SYBA 5KEEA 4AIMA 3RLNA 4QIWB 2K28A 5E4XA 1EY5A 4EQ5A 1MJCA 2OEOA 2Y0SB 2D5DA 2E8GA 2WAQG 4DV3Q 4IOAA 3I2ZA 3U9SA 4DGZA 1S40A 5M5WB 2QGQA 1EIYB 3MC0B 1V9PA 3NHHA 4YWKA 1GJXA 5IE8A 4UP7A 4NXML 1TWAB 5C3EH 1RODA 4JI6Q 4O1NA 3G4SA 1LT6D 1Q90A 5LMNW 2ZJRA 1II3A 3AB9A 3TP8A 2B2TA 3M4YA 2M2LA 3M7GA 3R93A 1O80A 1VQMA 1EQVA 2R6GA 2I0QA 2PCFB 2Q2UA 1E1OA 2TSSA 2L0CA 1Z47A 1XWEA 3HG9A 1JWUD 1FNUA 5A2QL 5IP9H 5J39A 1N34L 1RJTA 2RQXA 2F0PA 5C44H 1DJRD 2VUMG 4QQBX 2XWJB 1VQLA 5M3MB 2MO1A 3MXNA 4C2MB 1ESFA 1SN8A 5IYCH 4DR5L 4JYAL 2J4XA 1SNDA 2HUGA 2CKZB 4BBRB 3KLSA 1TY2A 1X55A 4BA1I 1R9TH 1CQFA 1SFOB 4G7ZC 3ZYYX 4BBSG 3HOYG 3Q22A 1LUZA 2UUCQ 2CFMA 3A74A 1PYBA 5CYUA 2RSNA 4JK1C 3I55A 1VQ9A 3TZDA 3TRZA 4A3LG 3CW2C 4ME3A 2O5IC 4ILWA 4WJ3M 5CBAE 2KVMA 3CAMA 1ML0D 3EA6A 3BVZA 3HOZH 4MTNA 1HZAA 5KNCA 3H0GH 5M3MH 1QE6A 1VQCA 2F0FA 5C3XA 1R4PB 4B3SL 3S14H 4DV6L 4DKAC 2XWBB 5KRUA 1VMPA 2RCFA 2E2DC 2VQFQ 4B08A 4APVA 4L5RC 3E0JA 4OIKA 4IPGA 5JJIA 2WKDA 3KDFB 4CDEC 2H5XA 4H0LC 1TXYA 5IT9E 3GTMH 5C5LA 3VR2A 4KKSA 1HNWL 4BY1G 1CKMA 2IX3A 1EUJA 1Y1WH 2LXKA 1HFGA 2JA5G 1VQ6A 4A93H 4CGYB 1VDZA 2VQEL 1STEA 1NMGA 4OO1G 5JEAH 2EY2A 2PW7A 1AW7A 5FO8B 5C3WA 4KK7A 4IUNA 2F03A 2D2CC 2LFNA 1EZ8A 2WIIB 2YV5A 3L9AX 5EAYA 2O5JC 4ABNA 1GUNA 5IY0A 4A3IH 3DWPA 3CCLA 1SEBD 1V1OA 2CQAA 3D4WA 4N9TA 2E75C 3A8KE 4QJFA 4DR7L 2AUJD 4XT1B 5M5XH 1XTCD 2MNAA 4X3KA 3HOWB 3LWEA 1QUQA 1HH2P 2GVAA 2BOSA 1YNXA 2ZJQA 4DK1A 1YJWA 2JXMB 2A19A 1HTLD 2MQHA 2UXDL 4WJWA 3HOXH 4I65A 1IBMQ 4DNTB 2A5HA 1GVPA 1STGA 1VQPA 4A3MG 4NXNQ 2Z8LA 2K50A 4QB4A 3H91A 2ZM6Q 5GADC 1WI5A 4ALPA 2MPMA 3WOEA 4U673 1K0SA 4RMFA 4DPGA 5CV8A 1LTSD 3F1ZA 4IJLA 4HSVA 1SYFA 4IZ8A 1U4MA 3S1NH 5IGFA 2D9UA 5M3FB 3J7A5 1IBKL 5CBEE 2K33A 3F2BA 2R93B 2A1AA 1P16A 2K5VA 3KOJA 3F2DA 5EPJA 4XYOA 1BCPD 1EOVA 4HIKA 1IXRA 1FGUA 3OHXC 1ENAA 1NUCA 1YEZA 2NTTA 2JE6I 4JI8Q 5JVG3 1XPOA 4MTKA 1ZYRC 1PRTD 5LMNL 3ULLA 3D0FA 1Y1VG 2F0TA 1SNOA 2PQEA 2ZXRA 2RDHA 4KHPQ 3DWQA 3J80E 1HUNA 4H02A 1UE5A 4BA2I 4J15A 1W6JA 2KUMA 2VNUD 3CC4A 3SK8A 4MZ9A 2FINB 3W5OA 1CTMA 1VQIA 1IL8A 2F0DA 1D2BA 1CSQA 1I5FA 5ELBA 4LF6L 3QG1A 3U4VA 4JI3L 4LW1A 4PV1C 3S17B 1YNJD 1B7YB 1HQMC 1LT4D 1XJVA 2AMCB 3HOVB 4Y7NB 3SE0A 4Q5VA 2JJQA 5HURA 1HTPA 2AWOA 4QF4A 4L8JA 4ZRZA 4N8X1 3TEHB 3U58A 1T5XD 2PQAA 2RA4A 1TWFB 5GAGC 1UAPA 3VYUA 1O78A 3AFPA 4DU9A 1AE2A 4GKJL 1SNPA 4BY7B 5EKLA 4JOIC 1XNRL 4LAAA 2EYHA 1BQQT 1X56A 1OXTA 1PH9A 1DOKA 5IT9c 3OPOA 2QW7A 5M9OA 2L11A 2WB1B 3G6EA 1KDAA 4HCSA 1VQDA 2R92B 5E1FA 1DYQA 5EPKA 4CKEA 3KLWA 3G6JB 3W1GA 3C1EA 1F9QA 1V1QA 5CGKA 2A68C 1VQKA 5IYBG 3NWSA 4ZAIA 1IHZA 2G9DA 2KQ3A 4P74A 3HOUH 2A6HC 2BA1A 1HUMA 3LWUA 2CVRA 3S24A 3FHWA 3PSIA 3TSSA 1SYEA 1FD7D 4DR5Q 4JYAQ 1ILQA 2LSSA 2AKWB 1B9NA 3GTPH 1EIGA 4K6DA 1M4VA 3I4LA 2KECA 2F0MA 1XXGA 3PGZA 3ULJA 3NBHA 1AH9A 2WINB 1U9RA 1XMQL 1HQRD 4JI6L 5K36H 1ET6A 2R7ZG 4A3KB 4GLXA 3GTKB 2VB2X 5C4XG 2QF7A 1UE7A 3AYHB 5ISRA 1BUVT 4A3BB 1LTBD 5CV7A 3PF4A 5FO7B 4XYQA 2VW9A 2XTIA 1EY4A 2HD3A 5IIFA 5A2QE 3A0JA 5DNFA 1KQSA 2F4VL 3KF8A 4A3CG 1WCMB 1A3VA 4B3SQ 2NVTH 1D6EC 4DV6Q 1J6QA 1Q82C 4B3ML 1MGSA 1R4QB 1YHAA 1XTDA 4CJ2C 1CA5A 1B3QA 2B3GA 1SE3A 2NN6I 1PYSB 1EYAA 2GVBA 4FYDA 3Q0AA 4KN7C 3U50C 3VA7A 1M90C 1V43A 4TVAB 2B63G 1Q1EA 1B50A 3CD6A 4Y52H 3PO3H 3IRBA 1HNWQ 4A3BH 2Q8TA 2KBNA 5IT9L 3J80c 2ZTEA 4A3JH 3A55A 1JC7A 1MSHA 4Z9CB 4DXGA 4PZ7A 3RN5A 2EJMA 3UE0A 2VY3A 2E2IB 5D14A 4IFDG 3MXNB 3NUCA 3PO2H 1I3QB 3GTQB 1FNWA 4QL5A 1O7ZA 5GQOA 1CHPD 2WACA 2ALYB 3CCMA 4TSSA 2K03A 2A6EC 4U68A 2Q2HA 2DNEA 1WOCA 4XXEA 5A35A 2CW0D 4DR7Q 2M00A 5JJLA 3CMAA 1P8LA 1OXVA 3PQIA 4C3IG 2UU9L 1UWVA 2F0IA 2NVQH 3OWFA 5JJKA 3VYSA 1PLFA 1XYIA 5C6AA 4R4OA 4X3TA 3MTSA 1WJJA 3VYRA 1W2BA 1F2YA 2K5DA 1CA6A 2E2JB 4WRDA 1FYCA 1LT5D 5GAEC 5I2YA 1IZ6A 1YZ6A 1EEFD 5IGGA 4XQQA 2CWAA 3S1RH 2I5MX 4GLVB 5C4JB 3GTGB 1NY4A 1DXMA 3OMGA 1PTOF 1SNCA 3G71A 3A8IE 1ILPA 1IBKQ 4EX5A 1STNA 2QEJC 1LABA 5ELCA 1V8QA 3ZJYC 1EIFA 5T1GA 3DEPA 5F2DA 4A3GH 1IYUA 1EWHA 1YITA 3OWEB 1HHVA 2MUYA 2I5LX 5LMNQ 1HPCA 1L1OB 3NE5B 1PTOH 1NJIC 3W3AA 1TS2A 1IBML 4LUZA 4C3JH 2QCPX 3KJPA 4UY8C 3J80L 3J81E 5C4JH 3T1YL 2F3IA 5EQ0A 4FO2A 3TP6A 3CF5A 1HFNA 1C9OA 2JA8B 4YWLA 4LF6Q 1SNQA 3U4ZA 2B2UA 3DM1A 3RMHA 2A69D 1QUQB 1PDQA 3PV0A 3BDLA 1GUOA 4A3DG 5JEAJ 4JI3Q 4V0BA 1H9RA 1BBUA 1PTOD 3HKZG 4A3EB 1WYDA 4B9XA 1YBYA 3KF6A 2O2LD 3I72A 1G51A 5C0XJ 3EN2A 2ICEC 3NELA 4K5WA 2F0GA 2JA6H 3GTJH 1KTKA 2XRSD 4FF1A 3S2HH 3S2DB 2SDFA 1TWHH 1J8IA 1E22A 4I7ZC 3K5NA 4LUVA 1B53A 3L0OA 2R61A 3V2TA 3X3NA 1K28A 2I46A 2Y0SG 3MWYW 2ZTDA 2JP1A 2JA7H 1QVFA 1XNRQ 2NWGA 3KBGA 3OTOL 3NEMA 2F3WA 4POGA 3MAQA 4P75A 2XSCA 5IGEA 4HIMA 1PH1A 3CU7A 4K8JA 2JK8A 4ME5A 4AYBB 5HGQA 3KBXA 4A3FH 1KAAA 5I9OA 1U4LA 4YCUA 3T13A 1C8CA 5C3EB 3K57A 4ULLA 1IKMA 1KDCA 4KTAA 2MGSA 1B3AA 2HHHL 1LTLA 2EYJA 4OGQC 4TRDA 5M5YH 1PFSA 1RTOA 1Y8OB 5I9PA 1VQ4A 2NVXH 2XIWA 1HCZA 3I4NH 2B2YA 5I6YA 1S5CD 1CT1D 1E24A 1G8ZD 4DN4M 5DEHA 1VQBA 3T56B 4B3RQ 2F0HA 1SR3A 4YWMA 3PIPA 1G2SA 5G3LF 1Q86C 5C44B 3D3RA 2PW5A 3H3VI 3UI2A 2MP1A 4DV7L 1VQAA 1QVCA 1LTRD 4BBRG 4NP5A 3UDGA 4FXKC 3EQLC 3S15H 1M8AA 3FKIH 2UXBQ 2K4KA 4DV4L 2UXCL 4DAYA 1ONLA 1XMQQ 5H1SE 2NN6H 4GKKQ 5C4ZA 3GTOH 4CKCA 1OTCA 4DR3L 1N32L 2NUCA 2YYZA 2RDFA 3VR5A 2EY6A 1F9PA 2K32A 1Q81C 5EPLA 1R9TB 3IAYA 2K5WA 2AUKA 2PQAB 3KYHC 5IGCA 5FJ8G 4L5SA 1JT8A 1EYCA 4ZCKA 3CCSA 3T4AC 4YY3L 1EQTA 2F4VQ 2A74C 1JORA 4DR4L 4B3MQ 1S4ZA 1A15A 3HKZE 3HOZB 1A0IA 3H0GB 1GUWA 3UDIA 5C0XG 1B9MA 3S14B 2X6LA 1S5FD 4J6HA 5J3BA 4KJOA 3URYA 2PYKA 4JG2A 5G3LD 4QIWE 3BDOA 3FEWX 4DXFA 2KOLA 2BE5D 4DF7A 1NAPA 1SMYD 5IP7H 3D4RA 1SJED 1ET9A 4HN7A 2Y0SE 2C5CA 5DM63 2PMZB 4F87A 4ZKBB 3GTMB 3I4OA 5BN3A 1EY9A 3RLFA 3CPFA 2OCEA 1T9HA 2FMMA 1Y1WB 1RCVD 4H13C 2HQLA 3J80i 4RFBA 4HSPA 1NBWA 1C7YA 3K7AH 3TZUA 1XMOL 4A93B 1PZKD 4DV0L 3SR1A 1RD9D 3I91A 1PRTC 3CC2A 1GUTA 1CKOA 1FNVA 2XGTA 2P5ZX 4LJZC
chains in the Genus database with same CATH topology
4LF6L 1X9NA 3NBHB 3RLOA 3U4VA 3WWVA 4LF7Q 1Q46A 2QA4A 4A3KH 3GTKH 4OWTB 1KIXA 1E1TA 3HOWG 5IYCG 3M85A 4NB3A 1FL0A 4JI3L 3CQZH 4LW1A 3M3YH 2UU9Q 3TREA 4DV5L 1B7YB 4DUZQ 4DK6C 2UUCL 1W3SA 4X64Q 2HIXA 3MEFA 1XJVA 2F52A 1L2FA 2AMCB 2JEBI 2VQEQ 4TQUS 4JI7L 1SROA 4LNQA 1K83H 3EBEA 1VQHA 4GLAC 4O0AA 1WCMH 4OX9L 2JJQA 3DM3A 2AWOA 3E0EA 4X65Q 1I94Q 1X54A 3TEHB 2EQSA 4DUYL 3KF8B 2WAQE 4A75A 3U58A 2PQAA 1EYGA 4B3TL 2RHQB 5GAGC 4X62Q 4AQYQ 3AFPA 4KHZA 1AE2A 2JA6G 3TS0A 4GKJL 3J7ZC 4GOPC 2K75A 2UUBQ 1L1OA 4JOIC 1S72A 3CP0A 1PA6A 1HR0Q 1XNRL 3HOZG 2VQFL 4GN5A 2K14A 4DAMA 1X56A 1OXTA 1Z9FA 3H0GG 2EXDA 3UE1A 4R4QA 5M3MG 2C35B 1PH9A 1UEBA 1SRUA 5IT9c 3M4OH 5M3FG 3ULPA 5AJ3L 2JA7G 2R93G 3ER0A 3G6EA 2IX1A 1C0AA 2IX0A 1N8RC 2OQKA 4JBWA 3F8TA 1VQDA 1G291 1EQRA 2UXDQ 1N33L 1YI2A 3KLWA 1YIJA 3K81C 2E2IH 1KL9A 3W1GA 4OO1I 4A3FG 2NZHA 4L5QA 2UUAL 1V1QA 1I3QH 1N9WA 1PH5A 2VUMH 1VQKA 4IPDA 5IYBG 3GTQH 1J5EQ 2YTVA 1PH6A 2Z0SA 3D31A 3ERSX 1PH3A 1E3PA 4P74A 1Y1WG 1XNQQ 1GKHA 3JC66 4AYBE 3RN2A 3HOUH 4LF4L 1A63A 1I50H 4A93G 2BA1A 3T1YQ 2KCTA 1B70B 2D62A 3GTLH 4JI0L 4GOPB 5JEAG 1NMFA 3VDYA 3S24A 1HNXL 4JI4L 3FHWA 4A3DH 3I4NG 3PSIA 4DR5Q 3PF5A 1A62A 3CPWA 4JYAQ 2LSSA 3S1MH 4BBSH 3HOYH 2AKWB 3GTPH 1YHBA 2OWOA 3CCVA 1KRTA 4A3IG 4A3LH 4DV1L 4UPAA 3PGZA 3ULJA 1Q7YC 2Q2IA 2WP8J 1AH9A 4K0KQ 3E9HA 1XMQL 3RZDH 1YVCA 4YCWA 2K5NA 3E9IA 3T1HL 1ASYA 4JI6L 2R7ZG 2E2JH 4GLXA 3FKIG 3G48A 1UE7A 3AYHB 5C4XG 3BZKA 2YTYA 2VL6A 3HOVG 1D7QA 4GNXA 4DR2L 1O7IA 4UP8A 4X66Q 3PF4A 2NN6G 4HJ9A 3A5ZB 2CWPA 2VW9A 3K7UC 2XTIA 1CUKA 4NXNL 3TQYA 3CCUA 4A3CH 4LWCA 4DNIA 4WJ4A 2ZM6L 4LF8Q 4LF9Q 1NE3A 3UDFA 3A0JA 1D8LA 5M5WH 3GTGH 3J81c 3HOXG 4GN4B 1PH2A 1PH4A 1X65A 1KQSA 2F4VL 4JV5Q 1AE3A 3OYYA 5E7NA 2D0OA 1GM5A 4B3SQ 2NVTH 4BY7G 4A3CG 4DV6Q 1K0RA 1J6QA 4L5TA 1Q82C 4B3ML 1TWAH 4BXXG 2VS1A 1MIUA 1HZ9A 2DUDA 2OQ0A 3OTOQ 1GD7A 1YHAA 2PI2A 4P71A 1K73C 1FJGQ 1XTDA 4UP9A 4YHHL 4PZ8A 4HIDA 1EWIA 2KENA 1NTGA 1YHQA 2CCZA 1KXLA 4JCVE 4JI1Q 1B8AA 2WB1G 2B3GA 2ES2A 2AHOB 2NN6I 1PYSB 3CCEA 4BY1H 3CCQA 2YTXA 2R92G 2GVBA 3U50C 1M90C 2B63G 1V43A 3K80C 4TVAB 3H3VH 1Q1EA 4YCVA 3CD6A 4Y52H 5IYDG 1IBLQ 2JA5H 2K5HA 1PVOA 3PO3H 3IRBA 2BH8A 4HJ8A 4A3BH 1HNWQ 2KBNA 4JI8L 3J80c 2JA9A 2ZTEA 4A3JH 2OTLA 4JI5Q 5LMUQ 2FXQA 2A8VA 1JE5A 2R7FA 1H95A 1RIPA 1N36Q 4LFAL 1E7ZA 1CKNA 4PZ7A 5IWAL 3RN5A 4KLKA 2HHHQ 3RZOH 3UE0A 5IP7G 4C2MH 4GKJQ 4DR6Q 2E5LL 4IPHA 3I56A 2VY3A 4KHPL 2WFWA 1TWGH 1X3EA 4OWWB 3JAMi 3K0XA 4XIGS 3RNUA 2ASBA 4DR1L 4HJ7A 1K8GA 4IFDG 3MXNB 1CSPA 1KD1C 3PO2H 2JA8H 1HR0W 3CXCA 3TS2A 3STBD 4QL5A 4LFBL 5GQOA 2Z6KC 3I4MG 2ALYB 3CCMA 4BBRH 1BVSA 2Z6KA 2PNHA 4HJAA 2Q2HA 4GOPA 1WOCA 2PMZE 1SFOH 4A3EH 4DR7Q 3DLLA 4JOIA 5JJLA 3CMAA 4DV7Q 1Q12A 1PH8A 3M9BA 4LF7L 1P8LA 1OXVA 1HZCA 5BR8L 2CQOA 4OONA 4LF5Q 2N3SA 1Q1BA 5FLMH 3KF6B 4DV4Q 2UU9L 2UXCQ 1UWVA 4IFDI 3STBC 3S2DH 5FJ8H 1ASZA 1IYJB 2NVQH 1EFWA 2K52A 1VQFA 4A3MH 4X64L 4DR3Q 1N32Q 5JJKA 4A3KG 2I5HA 1HJPA 1PHJA 2ZTCA 4R4OA 4R4TA 2N49A 1U0LA 1WJJA 3KJOA 1W2BA 2LXJA 1K9MC 1OXXK 2IHFA 4X65L 1I94L 2IY5B 4LF4Q 2HT1A 1U5KA 4AIMA 3RLNA 3CC7A 1YJ9A 4X62L 4AQYL 4EQ5A 5GAEC 4YY3Q 1WCMG 3PUZA 1MJCA 4KI0A 4PG3A 1IZ6A 4DR4Q 1YZ6A 2E2HH 2Q2TA 4JI4Q 2UUBL 5GROA 2CWAA 2E8GA 2WAQG 4DV3Q 3S1RH 4IOAA 2I5MX 3I2ZA 2HIVA 4GLVB 1S40A 3NENA 1LM0A 1NY4A 5FLXc 2QGQA 1EIYB 1V9PA 3UDXA 4YWKA 3G71A 5IE8A 4UP7A 1VQNA 1IBKQ 4EX5A 4NXML 4B3RL 4PMWA 1S3OA 4JBJA 5C3EH 1KC8C 3T1HQ 2NVYH 4JI6Q 3ZJYC 1JJCB 2RHSB 3L2PA 1EIFA 3G4SA 1HNZQ 3LGJA 1VCIA 5LMNW 3S16H 4A3GH 4DR2Q 1Y1VH 2MO0A 1JJGA 2UXBL 2ZJRA 2PI2E 1YITA 1X3FA 3RR5A 3ICEA 1VQMA 4GKKL 2I5LX 2R6GA 5LMNQ 2I0QA 1SLJA 1UE6A 1SE8A 1L1OB 1E1OA 2Q2UA 1HZBA 2QEXA 1J5EL 1Z47A 3OW2A 4JI2L 1VS0A 1VQEA 5IP9H 1NJIC 1IBML 3M4QA 4LUZA 4C3JH 1N34L 1XNQL 1Y14B 5C44H 2EIFA 3KJPA 4UY8C 1I6HH 1LYLA 2B29A 2VUMG 1Q8KA 4QQBX 1X6OA 2MFIA 4GS3A 1XMOQ 2MO1A 5C4JH 3T1YL 1VQLA 2F3IA 2KCMA 4DV0Q 1SN8A 3PIOA 3GDEA 3CF5A 3HOWH 3HOUG 2NZOA 5IYCH 2OTJA 4DR5L 4JC0A 4JYAL 1C9OA 4YWLA 4DV2L 4A4IA 2V1CC 4LF6Q 3U4ZA 2L15A 4POFA 4R4IA 3A5UA 1QUQB 2AWNA 4LFCL 4DAYB 2CKZB 3PV0A 4A3DG 5JEAJ 4HIOA 3SGIA 4JI3Q 1X55A 4BA1I 1R9TH 1BBUA 4K0KL 4DV5Q 3HKZG 4BBSG 1BKBA 3HOYG 1LUZA 2UUCQ 1WYDA 2CFMA 3A74A 1PYBA 1YBYA 3KF6A 3M4PA 4LUOA 4MNOA 4LFAQ 4C3HH 3I55A 3F2CA 1VQ9A 3TRZA 4A3LG 5ELNA 3CW2C 4ME3A 4JI7Q 1G51A 5C0XJ 3EN2A 3NELA 2JA6H 4OX9Q 4X66L 4WJ3M 1XPRA 1FVIA 3GTJH 4DR1Q 3S2HH 4AH6A 1TWHH 2KHIA 5K36G 3CAMA 1JJ2A 3Q8DA 4DUYQ 1E22A 4LF8L 1TWCH 2IHEA 4LF9L 4MTNA 4B3TQ 1XPUA 3HOZH 1HZAA 4LUVA 2N8NA 3H0GH 3L0OA 5M3MH 1VQCA 4JV5L 1G6PA 3M7NA 3S14H 4B3SL 1QVGA 2Y0SG 4DV6L 5M3FH 3KFUA 4DKAC 2ZTDA 1PV4A 3H15A 4IJHA 1QVFA 2JA7H 1XNRQ 2R93H 2GN5A 3GD7A 4DK3C 3OTOL 3NEMA 2VQFQ 1FJGL 3AQQA 4JI2Q 4APVA 4JI0Q 4POGA 1OXSC 4P75A 4L5RC 1OXUA 5BR8Q 4HIMA 4IPGA 1PH1A 5JJIA 2N78A 4JI1L 4P72A 1MJEA 5AJ3Q 2JEAI 2JK8A 1K8AC 3KDFB 3L7ZC 4A76A 5HGQA 2H5XA 1PH7A 4A3FH 4GNXB 2IT1A 1TXYA 3GTMH 1KHIA 4YCUA 1WFQA 4HJ5A 1IBLL 3JAMc 5IYBH 1HNWL 1N33Q 4BY1G 1QZHA 2JQOA 1CKMA 3PUVA 1EUJA 4JI5L 5LMUL 2LXKA 4DUZL 1Y1WH 4JBMA 2UUAQ 1N36L 1KRSA 2HHHL 1LTLA 2JA5G 1VQ6A 4X6AH 3PO3G 1RL2A 2YU9H 1VQOA 4A3BG 4A93H 1L1OC 2VQEL 4DR6L 4IFDJ 5M5YH 1PFSA 1NMGA 4OO1G 4A3JG 1DGSA 1X3GA 1VQ4A 2NVXH 1A8VA 4IPCA 5DLQE 3I4NH 2KHJA 1YJNA 4JBKA 1E24A 2YV5A 4FDBA 4OXPA 4QGUA 3BZCA 1VQBA 5EAYA 4B3RQ 4NXMQ 1SR3A 5IY0A 4YWMA 3PIPA 4A3IH 3BU2A 1HNXQ 1Q86C 1IL2A 3I7FA 3CCLA 3PO2G 3CCRA 3S17H 1SMXA 2JA8G 1HR0L 3AEVA 4QJFA 4DR7L 3PUWA 4QY7A 3H3VI 3CMEA 1M1KC 4OWXB 4DV7L 1VQAA 1QVCA 4BBRG 3UDGA 5M5XH 2R7ZH 2DGYA 3S15H 2MNAA 4DV1Q 3FKIH 5C4XH 2UXBQ 4LF5L 2K4KA 3HOVH 1QUQA 4Y7NH 2R7DA 4DV4L 1CKNB 1HH2P 1L0WA 4A3EG 2GVAA 5H1SE 1XMQQ 1UE1A 4GKKQ 3GTOH 1VQ7A 2ZJPA 4DR3L 1OTCA 1YNXA 2ZJQA 4NPSA 4P73A 2UXCL 1N32L 1TWFH 2YYZA 1YJWA 3B6YA 2MQHA 2A19A 4IOCA 1Q81C 5FLMG 2UXDL 3HOXH 3BJUA 1IBMQ 1N34Q 2PQAB 3KYHC 1GVPA 5FJ8G 2RCNA 5GAHC 1VQPA 4L5SA 2VZAA 4A3MG 4BY7H 4NXNQ 4BXXH 1JT8A 2K50A 2ZM6Q 4R4CA 3CCSA 5GADC 1WI5A 4YY3L 4ALPA 2F4VQ 4DR4L 4RMFA 4DPGA 4B3MQ 2WB1E 4XTCS 3F1ZA 4DV3L 2BA0A 4IJLA 3HKZE 4DV2Q 1A0IA 2BH2A 2R92H 4PZ6A 4YHHQ 2ATWA 4LFCQ 3S1NH 3HFZB 2B63H 3UDIA 5C0XG 1VQJA 3CCJA 1EQQA 3J81i 3J7A5 5IYDH 1IBKL 3F2BA 4AYBG 2A1AA 1P16A 2K5VA 5J3BA 3KOJA 3PUYA 1MKHA 3EIVA 5ELOA 3F2DA 1VQ5A 3FP9A 4JG2A 1EOVA 3KDFA 4QIWE 4GNXC 4HIKA 1HNZL 1IXRA 1BBWA 1FGUA 5IP7H 5C3EG 4R1JA 1XPOA 1YEZA 1JB7A 2Y0SE 2JE6I 4JI8Q 2ID0A 1VQ8A 3J81j 5LMNL 4RG1A 3ULLA 5IWAQ 3D0FA 4A3GG 3I4OA 1Y1VG 3PUXA 1JMCA 3HKSA 2E5LQ 3RLFA 5C0XI 3CPFA 3GO5A 4KHPQ 2OCEA 1KAWA 4IO9A 1T9HA 3I4MH 3AFQA 3W1BA 4H02A 1UE5A 3K8AA 4BA2I 4J15A 2HQLA 3S1QH 4GN3B 3J80i 1NBWA 1C7YA 3K7AH 1GO3E 1XMOL 2VNUD 4LFBQ 3CC4A 3PCOB 5IP9G 2D0PA 5HY6A 4O2DA 4DV0L 4MZ9A 1K3RA 3W5OA 5C44G 1VQGA 3CC2A 4C3IH 1VQIA 1CKOA 2XGTA 1CSQA 1QZGA 2RF4A 1I5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 L;  1X9N A;  3NBH B;  3RLO A;  3U4V A;  3WWV A;  4LF7 Q;  1Q46 A;  2QA4 A;  4A3K H;  3GTK H;  4OWT B;  1KIX A;  1E1T A;  3HOW G;  5IYC G;  3M85 A;  4NB3 A;  1FL0 A;  4JI3 L;  3CQZ H;  4LW1 A;  3M3Y H;  2UU9 Q;  3TRE A;  4DV5 L;  1B7Y B;  4DUZ Q;  4DK6 C;  2UUC L;  1W3S A;  4X64 Q;  2HIX A;  3MEF A;  1XJV A;  2F52 A;  1L2F A;  2AMC B;  2JEB I;  2VQE Q;  4TQU S;  4JI7 L;  1SRO A;  4LNQ A;  1K83 H;  3EBE A;  1VQH A;  4GLA C;  4O0A A;  1WCM H;  4OX9 L;  2JJQ A;  3DM3 A;  2AWO A;  3E0E A;  4X65 Q;  1I94 Q;  1X54 A;  3TEH B;  2EQS A;  4DUY L;  3KF8 B;  2WAQ E;  4A75 A;  3U58 A;  2PQA A;  1EYG A;  4B3T L;  2RHQ B;  5GAG C;  4X62 Q;  4AQY Q;  3AFP A;  4KHZ A;  1AE2 A;  2JA6 G;  3TS0 A;  4GKJ L;  3J7Z C;  4GOP C;  2K75 A;  2UUB Q;  1L1O A;  4JOI C;  1S72 A;  3CP0 A;  1PA6 A;  1HR0 Q;  1XNR L;  3HOZ G;  2VQF L;  4GN5 A;  2K14 A;  4DAM A;  1X56 A;  1OXT A;  1Z9F A;  3H0G G;  2EXD A;  3UE1 A;  4R4Q A;  5M3M G;  2C35 B;  1PH9 A;  1UEB A;  1SRU A;  5IT9 c;  3M4O H;  5M3F G;  3ULP A;  5AJ3 L;  2JA7 G;  2R93 G;  3ER0 A;  3G6E A;  2IX1 A;  1C0A A;  2IX0 A;  1N8R C;  2OQK A;  4JBW A;  3F8T A;  1VQD A;  1G29 1;  1EQR A;  2UXD Q;  1N33 L;  1YI2 A;  3KLW A;  1YIJ A;  3K81 C;  2E2I H;  1KL9 A;  3W1G A;  4OO1 I;  4A3F G;  2NZH A;  4L5Q A;  2UUA L;  1V1Q A;  1I3Q H;  1N9W A;  1PH5 A;  2VUM H;  1VQK A;  4IPD A;  5IYB G;  3GTQ H;  1J5E Q;  2YTV A;  1PH6 A;  2Z0S A;  3D31 A;  3ERS X;  1PH3 A;  1E3P A;  4P74 A;  1Y1W G;  1XNQ Q;  1GKH A;  3JC6 6;  4AYB E;  3RN2 A;  3HOU H;  4LF4 L;  1A63 A;  1I50 H;  4A93 G;  2BA1 A;  3T1Y Q;  2KCT A;  1B70 B;  2D62 A;  3GTL H;  4JI0 L;  4GOP B;  5JEA G;  1NMF A;  3VDY A;  3S24 A;  1HNX L;  4JI4 L;  3FHW A;  4A3D H;  3I4N G;  3PSI A;  4DR5 Q;  3PF5 A;  1A62 A;  3CPW A;  4JYA Q;  2LSS A;  3S1M H;  4BBS H;  3HOY H;  2AKW B;  3GTP H;  1YHB A;  2OWO A;  3CCV A;  1KRT A;  4A3I G;  4A3L H;  4DV1 L;  4UPA A;  3PGZ A;  3ULJ A;  1Q7Y C;  2Q2I A;  2WP8 J;  1AH9 A;  4K0K Q;  3E9H A;  1XMQ L;  3RZD H;  1YVC A;  4YCW A;  2K5N A;  3E9I A;  3T1H L;  1ASY A;  4JI6 L;  2R7Z G;  2E2J H;  4GLX A;  3FKI G;  3G48 A;  1UE7 A;  3AYH B;  5C4X G;  3BZK A;  2YTY A;  2VL6 A;  3HOV G;  1D7Q A;  4GNX A;  4DR2 L;  1O7I A;  4UP8 A;  4X66 Q;  3PF4 A;  2NN6 G;  4HJ9 A;  3A5Z B;  2CWP A;  2VW9 A;  3K7U C;  2XTI A;  1CUK A;  4NXN L;  3TQY A;  3CCU A;  4A3C H;  4LWC A;  4DNI A;  4WJ4 A;  2ZM6 L;  4LF8 Q;  4LF9 Q;  1NE3 A;  3UDF A;  3A0J A;  1D8L A;  5M5W H;  3GTG H;  3J81 c;  3HOX G;  4GN4 B;  1PH2 A;  1PH4 A;  1X65 A;  1KQS A;  2F4V L;  4JV5 Q;  1AE3 A;  3OYY A;  5E7N A;  2D0O A;  1GM5 A;  4B3S Q;  2NVT H;  4BY7 G;  4A3C G;  4DV6 Q;  1K0R A;  1J6Q A;  4L5T A;  1Q82 C;  4B3M L;  1TWA H;  4BXX G;  2VS1 A;  1MIU A;  1HZ9 A;  2DUD A;  2OQ0 A;  3OTO Q;  1GD7 A;  1YHA A;  2PI2 A;  4P71 A;  1K73 C;  1FJG Q;  1XTD A;  4UP9 A;  4YHH L;  4PZ8 A;  4HID A;  1EWI A;  2KEN A;  1NTG A;  1YHQ A;  2CCZ A;  1KXL A;  4JCV E;  4JI1 Q;  1B8A A;  2WB1 G;  2B3G A;  2ES2 A;  2AHO B;  2NN6 I;  1PYS B;  3CCE A;  4BY1 H;  3CCQ A;  2YTX A;  2R92 G;  2GVB A;  3U50 C;  1M90 C;  2B63 G;  1V43 A;  3K80 C;  4TVA B;  3H3V H;  1Q1E A;  4YCV A;  3CD6 A;  4Y52 H;  5IYD G;  1IBL Q;  2JA5 H;  2K5H A;  1PVO A;  3PO3 H;  3IRB A;  2BH8 A;  4HJ8 A;  4A3B H;  1HNW Q;  2KBN A;  4JI8 L;  3J80 c;  2JA9 A;  2ZTE A;  4A3J H;  2OTL A;  4JI5 Q;  5LMU Q;  2FXQ A;  2A8V A;  1JE5 A;  2R7F A;  1H95 A;  1RIP A;  1N36 Q;  4LFA L;  1E7Z A;  1CKN A;  4PZ7 A;  5IWA L;  3RN5 A;  4KLK A;  2HHH Q;  3RZO H;  3UE0 A;  5IP7 G;  4C2M H;  4GKJ Q;  4DR6 Q;  2E5L L;  4IPH A;  3I56 A;  2VY3 A;  4KHP L;  2WFW A;  1TWG H;  1X3E A;  4OWW B;  3JAM i;  3K0X A;  4XIG S;  3RNU A;  2ASB A;  4DR1 L;  4HJ7 A;  1K8G A;  4IFD G;  3MXN B;  1CSP A;  1KD1 C;  3PO2 H;  2JA8 H;  1HR0 W;  3CXC A;  3TS2 A;  3STB D;  4QL5 A;  4LFB L;  5GQO A;  2Z6K C;  3I4M G;  2ALY B;  3CCM A;  4BBR H;  1BVS A;  2Z6K A;  2PNH A;  4HJA A;  2Q2H A;  4GOP A;  1WOC A;  2PMZ E;  1SFO H;  4A3E H;  4DR7 Q;  3DLL A;  4JOI A;  5JJL A;  3CMA A;  4DV7 Q;  1Q12 A;  1PH8 A;  3M9B A;  4LF7 L;  1P8L A;  1OXV A;  1HZC A;  5BR8 L;  2CQO A;  4OON A;  4LF5 Q;  2N3S A;  1Q1B A;  5FLM H;  3KF6 B;  4DV4 Q;  2UU9 L;  2UXC Q;  1UWV A;  4IFD I;  3STB C;  3S2D H;  5FJ8 H;  1ASZ A;  1IYJ B;  2NVQ H;  1EFW A;  2K52 A;  1VQF A;  4A3M H;  4X64 L;  4DR3 Q;  1N32 Q;  5JJK A;  4A3K G;  2I5H A;  1HJP A;  1PHJ A;  2ZTC A;  4R4O A;  4R4T A;  2N49 A;  1U0L A;  1WJJ A;  3KJO A;  1W2B A;  2LXJ A;  1K9M C;  1OXX K;  2IHF A;  4X65 L;  1I94 L;  2IY5 B;  4LF4 Q;  2HT1 A;  1U5K A;  4AIM A;  3RLN A;  3CC7 A;  1YJ9 A;  4X62 L;  4AQY L;  4EQ5 A;  5GAE C;  4YY3 Q;  1WCM G;  3PUZ A;  1MJC A;  4KI0 A;  4PG3 A;  1IZ6 A;  4DR4 Q;  1YZ6 A;  2E2H H;  2Q2T A;  4JI4 Q;  2UUB L;  5GRO A;  2CWA A;  2E8G A;  2WAQ G;  4DV3 Q;  3S1R H;  4IOA A;  2I5M X;  3I2Z A;  2HIV A;  4GLV B;  1S40 A;  3NEN A;  1LM0 A;  1NY4 A;  5FLX c;  2QGQ A;  1EIY B;  1V9P A;  3UDX A;  4YWK A;  3G71 A;  5IE8 A;  4UP7 A;  1VQN A;  1IBK Q;  4EX5 A;  4NXM L;  4B3R L;  4PMW A;  1S3O A;  4JBJ A;  5C3E H;  1KC8 C;  3T1H Q;  2NVY H;  4JI6 Q;  3ZJY C;  1JJC B;  2RHS B;  3L2P A;  1EIF A;  3G4S A;  1HNZ Q;  3LGJ A;  1VCI A;  5LMN W;  3S16 H;  4A3G H;  4DR2 Q;  1Y1V H;  2MO0 A;  1JJG A;  2UXB L;  2ZJR A;  2PI2 E;  1YIT A;  1X3F A;  3RR5 A;  3ICE A;  1VQM A;  4GKK L;  2I5L X;  2R6G A;  5LMN Q;  2I0Q A;  1SLJ A;  1UE6 A;  1SE8 A;  1L1O B;  1E1O A;  2Q2U A;  1HZB A;  2QEX A;  1J5E L;  1Z47 A;  3OW2 A;  4JI2 L;  1VS0 A;  1VQE A;  5IP9 H;  1NJI C;  1IBM L;  3M4Q A;  4LUZ A;  4C3J H;  1N34 L;  1XNQ L;  1Y14 B;  5C44 H;  2EIF A;  3KJP A;  4UY8 C;  1I6H H;  1LYL A;  2B29 A;  2VUM G;  1Q8K A;  4QQB X;  1X6O A;  2MFI A;  4GS3 A;  1XMO Q;  2MO1 A;  5C4J H;  3T1Y L;  1VQL A;  2F3I A;  2KCM A;  4DV0 Q;  1SN8 A;  3PIO A;  3GDE A;  3CF5 A;  3HOW H;  3HOU G;  2NZO A;  5IYC H;  2OTJ A;  4DR5 L;  4JC0 A;  4JYA L;  1C9O A;  4YWL A;  4DV2 L;  4A4I A;  2V1C C;  4LF6 Q;  3U4Z A;  2L15 A;  4POF A;  4R4I A;  3A5U A;  1QUQ B;  2AWN A;  4LFC L;  4DAY B;  2CKZ B;  3PV0 A;  4A3D G;  5JEA J;  4HIO A;  3SGI A;  4JI3 Q;  1X55 A;  4BA1 I;  1R9T H;  1BBU A;  4K0K L;  4DV5 Q;  3HKZ G;  4BBS G;  1BKB A;  3HOY G;  1LUZ A;  2UUC Q;  1WYD A;  2CFM A;  3A74 A;  1PYB A;  1YBY A;  3KF6 A;  3M4P A;  4LUO A;  4MNO A;  4LFA Q;  4C3H H;  3I55 A;  3F2C A;  1VQ9 A;  3TRZ A;  4A3L G;  5ELN A;  3CW2 C;  4ME3 A;  4JI7 Q;  1G51 A;  5C0X J;  3EN2 A;  3NEL A;  2JA6 H;  4OX9 Q;  4X66 L;  4WJ3 M;  1XPR A;  1FVI A;  3GTJ H;  4DR1 Q;  3S2H H;  4AH6 A;  1TWH H;  2KHI A;  5K36 G;  3CAM A;  1JJ2 A;  3Q8D A;  4DUY Q;  1E22 A;  4LF8 L;  1TWC H;  2IHE A;  4LF9 L;  4MTN A;  4B3T Q;  1XPU A;  3HOZ H;  1HZA A;  4LUV A;  2N8N A;  3H0G H;  3L0O A;  5M3M H;  1VQC A;  4JV5 L;  1G6P A;  3M7N A;  3S14 H;  4B3S L;  1QVG A;  2Y0S G;  4DV6 L;  5M3F H;  3KFU A;  4DKA C;  2ZTD A;  1PV4 A;  3H15 A;  4IJH A;  1QVF A;  2JA7 H;  1XNR Q;  2R93 H;  2GN5 A;  3GD7 A;  4DK3 C;  3OTO L;  3NEM A;  2VQF Q;  1FJG L;  3AQQ A;  4JI2 Q;  4APV A;  4JI0 Q;  4POG A;  1OXS C;  4P75 A;  4L5R C;  1OXU A;  5BR8 Q;  4HIM A;  4IPG A;  1PH1 A;  5JJI A;  2N78 A;  4JI1 L;  4P72 A;  1MJE A;  5AJ3 Q;  2JEA I;  2JK8 A;  1K8A C;  3KDF B;  3L7Z C;  4A76 A;  5HGQ A;  2H5X A;  1PH7 A;  4A3F H;  4GNX B;  2IT1 A;  1TXY A;  3GTM H;  1KHI A;  4YCU A;  1WFQ A;  4HJ5 A;  1IBL L;  3JAM c;  5IYB H;  1HNW L;  1N33 Q;  4BY1 G;  1QZH A;  2JQO A;  1CKM A;  3PUV A;  1EUJ A;  4JI5 L;  5LMU L;  2LXK A;  4DUZ L;  1Y1W H;  4JBM A;  2UUA Q;  1N36 L;  1KRS A;  2HHH L;  1LTL A;  2JA5 G;  1VQ6 A;  4X6A H;  3PO3 G;  1RL2 A;  2YU9 H;  1VQO A;  4A3B G;  4A93 H;  1L1O C;  2VQE L;  4DR6 L;  4IFD J;  5M5Y H;  1PFS A;  1NMG A;  4OO1 G;  4A3J G;  1DGS A;  1X3G A;  1VQ4 A;  2NVX H;  1A8V A;  4IPC A;  5DLQ E;  3I4N H;  2KHJ A;  1YJN A;  4JBK A;  1E24 A;  2YV5 A;  4FDB A;  4OXP A;  4QGU A;  3BZC A;  1VQB A;  5EAY A;  4B3R Q;  4NXM Q;  1SR3 A;  5IY0 A;  4YWM A;  3PIP A;  4A3I H;  3BU2 A;  1HNX Q;  1Q86 C;  1IL2 A;  3I7F A;  3CCL A;  3PO2 G;  3CCR A;  3S17 H;  1SMX A;  2JA8 G;  1HR0 L;  3AEV A;  4QJF A;  4DR7 L;  3PUW A;  4QY7 A;  3H3V I;  3CME A;  1M1K C;  4OWX B;  4DV7 L;  1VQA A;  1QVC A;  4BBR G;  3UDG A;  5M5X H;  2R7Z H;  2DGY A;  3S15 H;  2MNA A;  4DV1 Q;  3FKI H;  5C4X H;  2UXB Q;  4LF5 L;  2K4K A;  3HOV H;  1QUQ A;  4Y7N H;  2R7D A;  4DV4 L;  1CKN B;  1HH2 P;  1L0W A;  4A3E G;  2GVA A;  5H1S E;  1XMQ Q;  1UE1 A;  4GKK Q;  3GTO H;  1VQ7 A;  2ZJP A;  4DR3 L;  1OTC A;  1YNX A;  2ZJQ A;  4NPS A;  4P73 A;  2UXC L;  1N32 L;  1TWF H;  2YYZ A;  1YJW A;  3B6Y A;  2MQH A;  2A19 A;  4IOC A;  1Q81 C;  5FLM G;  2UXD L;  3HOX H;  3BJU A;  1IBM Q;  1N34 Q;  2PQA B;  3KYH C;  1GVP A;  5FJ8 G;  2RCN A;  5GAH C;  1VQP A;  4L5S A;  2VZA A;  4A3M G;  4BY7 H;  4NXN Q;  4BXX H;  1JT8 A;  2K50 A;  2ZM6 Q;  4R4C A;  3CCS A;  5GAD C;  1WI5 A;  4YY3 L;  4ALP A;  2F4V Q;  4DR4 L;  4RMF A;  4DPG A;  4B3M Q;  2WB1 E;  4XTC S;  3F1Z A;  4DV3 L;  2BA0 A;  4IJL A;  3HKZ E;  4DV2 Q;  1A0I A;  2BH2 A;  2R92 H;  4PZ6 A;  4YHH Q;  2ATW A;  4LFC Q;  3S1N H;  3HFZ B;  2B63 H;  3UDI A;  5C0X G;  1VQJ A;  3CCJ A;  1EQQ A;  3J81 i;  3J7A 5;  5IYD H;  1IBK L;  3F2B A;  4AYB G;  2A1A A;  1P16 A;  2K5V A;  5J3B A;  3KOJ A;  3PUY A;  1MKH A;  3EIV A;  5ELO A;  3F2D A;  1VQ5 A;  3FP9 A;  4JG2 A;  1EOV A;  3KDF A;  4QIW E;  4GNX C;  4HIK A;  1HNZ L;  1IXR A;  1BBW A;  1FGU A;  5IP7 H;  5C3E G;  4R1J A;  1XPO A;  1YEZ A;  1JB7 A;  2Y0S E;  2JE6 I;  4JI8 Q;  2ID0 A;  1VQ8 A;  3J81 j;  5LMN L;  4RG1 A;  3ULL A;  5IWA Q;  3D0F A;  4A3G G;  3I4O A;  1Y1V G;  3PUX A;  1JMC A;  3HKS A;  2E5L Q;  3RLF A;  5C0X I;  3CPF A;  3GO5 A;  4KHP Q;  2OCE A;  1KAW A;  4IO9 A;  1T9H A;  3I4M H;  3AFQ A;  3W1B A;  4H02 A;  1UE5 A;  3K8A A;  4BA2 I;  4J15 A;  2HQL A;  3S1Q H;  4GN3 B;  3J80 i;  1NBW A;  1C7Y A;  3K7A H;  1GO3 E;  1XMO L;  2VNU D;  4LFB Q;  3CC4 A;  3PCO B;  5IP9 G;  2D0P A;  5HY6 A;  4O2D A;  4DV0 L;  4MZ9 A;  1K3R A;  3W5O A;  5C44 G;  1VQG A;  3CC2 A;  4C3I H;  1VQI A;  1CKO A;  2XGT A;  1CSQ A;  1QZG A;  2RF4 A;  1I5F A; 
#chains in the Genus database with same CATH topology
 3NBH B;  2QA4 A;  2L9H A;  3HOW G;  4OWT B;  3A8J E;  1KIX A;  4A3I B;  1FL0 A;  1CQV A;  3EVQ A;  2UU9 Q;  3LX0 A;  4DV5 L;  2RKS A;  5ELE A;  2OXP A;  1W3S A;  4N8F A;  1V1P A;  5EGT A;  5M5X B;  4MHE A;  1CZW A;  2F0W A;  2F52 A;  1D1I A;  3J7Y W;  3HP3 A;  1LO5 D;  3E0E A;  2FFK B;  4G4K A;  4C3H G;  2DNC A;  3KF8 B;  2WAQ E;  1EYG A;  2RHQ B;  3CHB D;  1YNJ C;  4X3U A;  3WOF A;  3TS0 A;  3HOX B;  2SNS A;  5I2X A;  1PFN A;  1BCP B;  3J7Z C;  2K75 A;  1L1O A;  1NSN S;  2HCC A;  3CP0 A;  1PA6 A;  1HR0 Q;  3RUZ A;  3K59 A;  4GN5 A;  4JI2 L;  1Z9F A;  3H6M A;  3UE1 A;  4JI0 L;  4PQX A;  4R4Q A;  5HGT A;  1UEB A;  1S5B D;  2M9V A;  5M3F G;  2R93 G;  1PRT B;  3ER0 A;  1BCP F;  1H9M A;  1JWS D;  3BVG A;  2IX1 A;  3F8T A;  4M1U B;  3SEB A;  3S1N B;  3TN2 A;  2KCN A;  3VA5 A;  2F0U A;  3ITP A;  3VR6 A;  1N33 L;  3A7L A;  3K81 C;  2B8F A;  1PRT F;  1NR2 A;  1E2W A;  1FR3 A;  4L5Q A;  3BDC A;  2UUA L;  1KLG D;  2MJ8 A;  1PH5 A;  2VUM H;  3F2U A;  2YTV A;  1PH6 A;  2Z0S A;  3ERS X;  3K58 A;  3TP5 A;  1I50 H;  1PYW D;  4QUF A;  3T1Y Q;  1B70 B;  2D62 A;  4ODG A;  3GTL H;  3J81 L;  4B9W A;  4R8N A;  3CPW A;  1WTP A;  3S1M H;  1TQO A;  4BBS H;  3HOY H;  1WTQ A;  2B2V A;  1KAB A;  5CC4 A;  5JAV A;  3CCV A;  1GUG A;  4A3L H;  4OL7 A;  4UPA A;  4DV1 L;  1Q7Y C;  2WP8 J;  1O7Y A;  3J7A V;  3E3X A;  2EYL A;  1QIL A;  1G91 A;  2DY8 A;  1ICF B;  3NTI A;  3G7L A;  4WFN 3;  3G48 A;  3BZK A;  2YTY A;  2VL6 A;  3HOV G;  2MHV A;  2AQ2 B;  5D3D A;  4UP8 A;  3A54 A;  3BYT B;  3C2P A;  3A5Z B;  3PIO 3;  3K7U C;  1LTI D;  1CUK A;  1UEA B;  1UNS A;  2H1E A;  1A6X A;  1NE3 A;  3K0Y A;  1EZ6 A;  2DJG C;  1X65 A;  4BWG B;  1AE3 A;  1SYD A;  3IKJ A;  2J7Z A;  4BY7 G;  2CHB D;  4BXX G;  4C1N K;  2F3V A;  1EOT A;  2VS1 A;  2Q8R E;  1HZ9 A;  3MA2 B;  3OTO Q;  1K73 C;  4P71 A;  1MBY A;  1BR9 A;  4PMB A;  2KEN A;  1NTG A;  1KXL A;  2NB0 A;  2WB1 G;  5COR A;  4ZUI A;  3Q6S A;  4BY1 H;  2R92 G;  2NTS A;  2IW3 A;  3P7J A;  3K80 C;  3H3V H;  1EL0 A;  1JQY D;  1RHP A;  5IYD G;  2JA5 H;  2K5H A;  1PVO A;  2K5Q A;  2AQ3 B;  1WTV A;  4OO1 H;  1VF7 A;  1VMC A;  5KND A;  1BBX C;  1E7Z A;  4K5X A;  4UDU C;  5IWA L;  2HHH Q;  4KLK A;  3RZO H;  5CV4 A;  1STA A;  2E5L L;  4IPH A;  3I56 A;  2B39 A;  1TWG H;  4HJ7 A;  1PZI D;  1HR0 W;  3CXC A;  3STB D;  4LFB L;  2Z6K C;  3I4M G;  4IAL A;  2Q8I B;  5IGD A;  4ZK9 B;  3HOU B;  4GOP A;  3DLL A;  4KY7 A;  1Q12 A;  4DV7 Q;  1A3T A;  4C1N I;  2CH4 W;  2Z9H A;  5ELF A;  5FLX L;  2N3S A;  1Q1B A;  3KF6 B;  4DV4 Q;  2UXC Q;  2NVY B;  4IFD I;  4K2K A;  1IYJ B;  2K52 A;  1VQF A;  4A3M H;  4X64 L;  4DR3 Q;  3GTP B;  1N32 Q;  4A3K G;  2I5H A;  2A73 B;  1PHJ A;  3FRP B;  1BF4 A;  3KJO A;  2CW0 C;  4RKL A;  1HA5 A;  1EY8 A;  3DEO A;  4X65 L;  1I94 L;  2IY5 B;  1U5K A;  1YNN D;  1YJ9 A;  4YY3 Q;  1ICW A;  1WCM G;  4PG3 A;  4QMG A;  4DR4 Q;  2E2H H;  2Q2T A;  4JI4 Q;  2EE1 A;  4I7A A;  5GRO A;  3J7A F;  2HIV A;  3NEN A;  1Y69 U;  3I70 A;  3UDX A;  2NVT B;  4BS9 A;  4B3R L;  4RCN A;  4ID6 A;  4PMW A;  4JBJ A;  3OIQ A;  1MSG A;  2NVY H;  5JPN C;  1DOM A;  1BDO A;  5ELD A;  3L2P A;  3S16 H;  3ERO A;  1Y1V H;  2B2T C;  2Z1C A;  3HS0 C;  4DR2 Q;  2UXB L;  2JSO A;  2PI2 E;  1RDP D;  1X3F A;  1TT2 A;  2X6G A;  1DM0 B;  2FHT A;  3KUP A;  1CZG A;  5D3I B;  5J1Z A;  4GKK L;  1Z7T A;  4HCE A;  1SLJ A;  1UE6 A;  1HZB A;  2QEX A;  1J5E L;  3OW2 A;  3PO3 B;  3M4Q A;  2F0K A;  4LK1 C;  4A3J B;  1Y14 B;  2PO4 A;  2EIF A;  2IPK D;  2LY7 A;  1I6H H;  1LYL A;  2B29 A;  3MFY A;  4XQJ A;  1X6O A;  4GS3 A;  1XMO Q;  3NBI A;  3E6Z X;  2KCM A;  3FPU B;  4DV0 Q;  3PIO A;  3GDE A;  2OTJ A;  2NZO A;  2EYP A;  2K01 A;  1QCB D;  3PO2 B;  1X3Q A;  1C48 A;  3FDT A;  3EJI A;  4A4I A;  2HDM A;  4IUT A;  3OW7 A;  2L15 A;  4R4I A;  4DAY B;  4HIO A;  3SK6 A;  2HDL A;  4DV5 Q;  5CR3 A;  3I8Z A;  2QKI C;  5E3F A;  4CHT B;  4LUO A;  3F2C A;  5IGB A;  1ENF A;  5IOD A;  5ELN A;  1BOS A;  2QDL A;  1QG7 A;  1F2Z A;  1FVI A;  3ERQ A;  4DR1 Q;  4AH6 A;  2NVQ B;  2B8G A;  1JOO A;  2A69 C;  3Q8D A;  1JJ2 A;  1TWC H;  1XPU A;  2XRQ D;  2N8N A;  1PTO C;  1PFM A;  1QVG A;  3KFU A;  4KY6 A;  1UUP A;  3FMC A;  3GD7 A;  4DK3 C;  1FJG L;  3AQQ A;  4JI2 Q;  4JI0 Q;  3D6W A;  1OXU A;  1IW7 C;  3EFX D;  3DUZ A;  4P72 A;  1MJE A;  1K8A C;  1Q8I A;  3S1R B;  4A76 A;  4IUP A;  1RKN A;  1WTO A;  1CI3 M;  1EY6 A;  4GNX B;  4EQN A;  4RKB A;  2JYO A;  1CM9 A;  1IBL L;  5FK9 C;  1WFQ A;  5IYB H;  1N33 Q;  1RTN A;  1QZH A;  3NTH A;  4IUU A;  4F7X A;  4JBM A;  5LMU L;  1LAC A;  4RHS A;  2UUA Q;  1N36 L;  4QUC A;  1I6V C;  2DJF C;  4X6A H;  4A3G B;  1JWM D;  4TKO B;  2YU9 H;  4DR6 L;  1L1O C;  1DGS A;  3TME A;  3PIP 3;  4IPC A;  1QNK A;  4JBK A;  1YJN A;  1PTO B;  2E74 C;  2X69 A;  4FDB A;  4QGU A;  1U4P A;  2A68 D;  4OEM B;  4C3J B;  3BU2 A;  1IL2 A;  5KNB A;  3S9W A;  1HR0 L;  1D1K A;  2JA8 G;  3AEV A;  4KMU C;  1M1K C;  4HMJ A;  1KDB A;  2R7Z H;  2DGY A;  4DV1 Q;  5C4X H;  4JVZ A;  4LF5 L;  1D5X C;  2H4O A;  3I90 A;  2R7D A;  4A3E G;  1L0W A;  1V1P B;  1UE1 A;  2KCC A;  1VQ7 A;  3AMU A;  5EKK A;  5LL6 X;  4P73 A;  4IOC A;  4NW2 A;  1LTA D;  5FLM G;  3PMF A;  4K14 A;  3QB3 A;  4A3C H;  5GAH C;  2K05 A;  2WKC A;  3X3M A;  2K1B A;  4R4C A;  4CKB A;  4HAE A;  3VR4 A;  2JA6 B;  5L37 A;  3GTJ B;  2DN8 A;  3S2H B;  1I4P A;  1TWH B;  3RD4 A;  3Q24 A;  4FVM A;  4DV2 Q;  2B2V C;  1TVX A;  1DOL A;  4FP5 D;  1F2M A;  2ATW A;  4LFC Q;  3HFZ B;  2B63 H;  5CV9 A;  1VQJ A;  3CCJ A;  1HA6 A;  3SHL A;  1EQQ A;  1JCK B;  1SXT A;  2JA7 B;  4AYB G;  3MXP A;  1PXU A;  3QO2 A;  4JW0 A;  2ICI A;  1HNZ L;  3I73 A;  4KHV A;  1GOZ A;  2Z4I A;  5C3E G;  1JB7 A;  4A3F B;  4IFD H;  1JB3 A;  1ESR A;  5IWA Q;  2XVS A;  3PUX A;  3HKS A;  1AP0 A;  2E5L Q;  5K5P A;  5C0X I;  2F0Q A;  1KAW A;  1WTH A;  2RSO A;  2F0S A;  3BZD B;  3BYY B;  3ND8 A;  3K8A A;  4EVO A;  1VF5 C;  3S1Q H;  4FF3 A;  2BE5 C;  1SMY C;  4LFB Q;  5IP9 G;  2V4D A;  5M5Y B;  1SNM A;  2D0P A;  2I07 B;  4O2D A;  4NMZ A;  5C44 G;  2NVX B;  1VQG A;  4C3I H;  3I4N B;  4CBV A;  2RF4 A;  4OEL B;  1Q46 A;  1E1T A;  5IYC G;  3M85 A;  3CQZ H;  3M3Y H;  2EYM A;  3TRE A;  3IFT A;  4DUZ Q;  4DK6 C;  3V96 A;  4X64 Q;  2HIX A;  4P2C B;  3S15 B;  4JI7 L;  3FKI B;  1SRO A;  1K83 H;  3EBE A;  4RHR A;  1VQH A;  4GLA C;  4O0A A;  4ZLT F;  4OX9 L;  2FJ2 A;  3MZ5 A;  4X65 Q;  3GTO B;  3DMU A;  1I94 Q;  1X54 A;  3SDZ A;  2EQS A;  4E6I A;  4DUY L;  4B3T L;  2Z6B A;  2EPB A;  4HR7 B;  1H9S B;  4GOP C;  3T53 B;  5CV5 A;  3HOZ G;  1TS4 A;  2XN9 C;  1CK1 A;  2EJG C;  3H0G G;  2EXD A;  5M3M G;  1SRU A;  3ULP A;  5AJ3 L;  3U9O A;  3VR3 A;  5JVH 3;  5EKI A;  1WTR A;  1N8R C;  1C0A A;  2OQK A;  5FLX E;  3OOC A;  2RVL A;  1EQR A;  4J1M A;  2PNR C;  4OO1 I;  2NZH A;  1GHK A;  1N9W A;  1SYG A;  1X3P A;  2LS0 1;  3FPP A;  1J5E Q;  1X32 A;  3D31 A;  3SK5 A;  4IUQ A;  1Y1W G;  2L1B A;  1GKH A;  3JC6 6;  4AYB E;  3TP7 A;  3SK4 A;  4A93 G;  2KCT A;  5JOB A;  3E5S A;  5T1I A;  4GOP B;  5JEA G;  1EIH A;  1HNX L;  4JI4 L;  4A3D H;  1SYC A;  2FMC A;  2K6A A;  1A62 A;  3K6O A;  1A2U A;  3K7A B;  4RAU C;  5IOC A;  4G7O C;  1KRT A;  4A3I G;  3GP7 A;  2Q2I A;  2HQE A;  1RF2 D;  4CDD C;  2RDG A;  3RZD H;  1YVC A;  4YCW A;  2K5N A;  3E9I A;  1ASY A;  3ONA B;  2OF1 A;  5KIX A;  1IKL A;  4GNX A;  4DR2 L;  1O7I A;  4XDX A;  4HJ9 A;  2CWP A;  2PZU A;  3CCU A;  4WJ4 A;  4LWC A;  2GA4 B;  4YIJ A;  2OT2 A;  3UDF A;  1D5Z C;  1D8L A;  5M5W H;  3J81 c;  3HOX G;  1PH2 A;  3D8G A;  3IL8 A;  1PH4 A;  5COY A;  1GM5 A;  3T51 B;  5BN5 A;  1BCP C;  3BVM A;  4C56 C;  1TWA H;  1AFP A;  1MIU A;  2WAQ B;  2OQ0 A;  4K2L A;  1FJG Q;  1SE2 A;  1HXY D;  4UP9 A;  4YHH L;  2F0N A;  4PZ8 A;  4FXD A;  1CHQ D;  1TR5 A;  3BS1 A;  1EWI A;  2CCZ A;  4JCV E;  1B8A A;  5JPM C;  3BG3 A;  2B2W A;  4KV6 A;  4EQO A;  2ES2 A;  2AHO B;  4FF4 A;  3CCQ A;  2ZT9 C;  3GV3 A;  4IUV A;  3NXW A;  4MIU A;  4RGT A;  4YCV A;  1TS5 A;  4RCO A;  1IBL Q;  4KKT A;  3R2T A;  2BH8 A;  1EEI D;  3NQT A;  3OSO A;  2OTL A;  5LMU Q;  3NP8 A;  2R7F A;  4RH6 A;  5TSS A;  1RIP A;  3IFD A;  5CMD A;  1N36 Q;  4FF2 A;  4KD3 A;  1Y8P B;  3KLS X;  3JAM E;  4IUR A;  3V05 A;  4C2M H;  1F2L A;  4DR6 Q;  1GHJ A;  4NDX A;  1X3E A;  4OWW B;  4XIG S;  4DR1 L;  1K8G A;  1WD0 A;  3TS2 A;  1A3U A;  2VUM B;  4BBR H;  3QR8 A;  5EBC A;  2C9O A;  4HJA A;  2PMZ E;  1SFO H;  1I50 B;  2Z4H A;  3I3C A;  1PZJ D;  1PH8 A;  3GTL B;  4LF7 L;  1HZC A;  2CQO A;  4LF5 Q;  1IYV A;  1DCZ A;  3K5O A;  4EGV A;  3STB C;  5FJ8 H;  1ASZ A;  3S1M B;  4BBS B;  3HOY B;  2IJ0 A;  3H3V C;  2J0T D;  5DM7 3;  2O4X A;  1TII D;  2ZTC A;  4R4T A;  2F0E A;  2N49 A;  1U0L A;  3NSW A;  4DK0 A;  5EJW A;  2NZ1 D;  4CJ0 B;  4N9P A;  1K9M C;  2G5D A;  1OXX K;  2IHF A;  5FO9 B;  2F0V A;  2R3Z A;  4LF4 Q;  2HT1 A;  4RWS C;  3CC7 A;  4X62 L;  2EDG A;  4AQY L;  4KN4 C;  4X3S A;  1E0B A;  3PUZ A;  4KI0 A;  3NWT A;  5C0X H;  2UUB L;  2KA7 A;  4HED A;  5DAU A;  1EU3 A;  1LM0 A;  5FLX c;  1STB A;  3HZX A;  1VQN A;  1F9S A;  5KYI A;  1YNN C;  1S3O A;  4NKL A;  5FOB B;  1KC8 C;  1TY0 A;  3T1H Q;  4H7B A;  1TKW B;  4RGO S;  4R9W A;  1JJC B;  2RHS B;  3W2D A;  1HNZ Q;  3MFG A;  3LGJ A;  1VCI A;  1MI2 A;  1JJG A;  2MO0 A;  4GZY C;  1SE4 A;  2K7V A;  3P1H A;  4BY1 B;  1KNE A;  2F4I A;  3RR5 A;  3ICE A;  2KHS A;  4C3H B;  5C4H A;  3VYT A;  3MXG A;  2WV6 D;  4ZUJ A;  1D5M C;  1SE8 A;  2JA5 B;  5FKA C;  1VS0 A;  1VQE A;  1FGB D;  1XNQ L;  2ZXO A;  2QDB A;  4S3S A;  2EY1 A;  1Q8K A;  3RZO B;  2MFI A;  1AEX A;  3MXU A;  1G2T A;  4EQP A;  1TWG B;  3R3O A;  3HOW H;  3HOU G;  1NCV A;  4JC0 A;  1H9S A;  2B2U C;  4DV2 L;  2PZW A;  2V1C C;  4POF A;  1W6K A;  3A5U A;  2AWN A;  4LFC L;  1BXT A;  2BDN A;  4CDF C;  4PNY A;  3SGI A;  1SDF A;  2IWH A;  4K0K L;  5AFW A;  3NPP A;  1BKB A;  1MHW C;  1LV9 A;  1Z6H A;  3M4P A;  4LFA Q;  4MNO A;  4F88 A;  4C3H H;  1I4Q A;  5CV6 A;  1A2T A;  2DY7 A;  4JI7 Q;  4QCL A;  1SJH D;  1ZKO A;  4OX9 Q;  4X66 L;  2KEE A;  1I4G A;  1XPR A;  2L12 A;  1SSO A;  2KHI A;  5K36 G;  1F77 A;  4A3M B;  4DUY Q;  4LF8 L;  2IHE A;  2SNM A;  4LF9 L;  4B3T Q;  1K8M A;  3QJY A;  4H44 C;  1G6P A;  4JV5 L;  1KNA A;  3M7N A;  2RBM A;  1AZP A;  5M3F H;  2XNA C;  1PV4 A;  2NBF A;  3H15 A;  2N88 A;  4IJH A;  1MD2 D;  2R93 H;  2GN5 A;  4PMC A;  1G6Z A;  1OXS C;  1TU2 B;  1B2T A;  3SXH A;  5BR8 Q;  2N78 A;  4K5V A;  4JI1 L;  2E2H B;  5AJ3 Q;  2JEA I;  4O42 A;  3L7Z C;  3C1F A;  1EYD A;  1PH7 A;  3D4D A;  2IT1 A;  2EZV A;  1EY7 A;  1KHI A;  4HJ5 A;  3JAM c;  3TBI B;  3H94 A;  2JQO A;  1QWY A;  3MHB A;  3PUV A;  1EU4 A;  4JI5 L;  2F1M A;  3QOL A;  4DUZ L;  2VB3 X;  4L6T B;  4DNR B;  2F0J A;  1KRS A;  1LTG D;  3S16 B;  3PO3 G;  1RL2 A;  1Y1V B;  1VQO A;  4A3B G;  4A3J G;  1X3G A;  4L63 B;  2B2Y C;  1A8V A;  1J9O A;  5DLQ E;  2KHJ A;  1ENC A;  3A7A B;  3GV6 A;  3Q23 A;  4OXP A;  3BZC A;  2EYO A;  4NXM Q;  1GUS A;  1I4R A;  4UAI A;  1HNX Q;  2TMP A;  4IFD J;  3I7F A;  3PO2 G;  3S17 H;  1SMX A;  1I6H B;  3PUW A;  4QY7 A;  5JJZ A;  3CME A;  4OWX B;  2KJX A;  3HOV H;  4OHJ A;  4Y7N H;  1DON A;  1CKN B;  1JIC A;  3CRL C;  2ZJP A;  1ZEQ X;  4NPS A;  1NR4 A;  1TWF H;  3B6Y A;  4Q0F A;  3HGB A;  1LTT D;  3BJU A;  1N34 Q;  1I4X A;  3KK7 A;  2RCN A;  4BY7 H;  2VZA A;  3C3L A;  4V19 0;  3NTK A;  4BXX H;  1QOH A;  1S5D D;  4J8Q A;  2AQ1 B;  4K6L A;  5LHY 1;  3C46 A;  3I4M B;  2WB1 E;  4XTC S;  4DV3 L;  2BA0 A;  1TWC B;  2BH2 A;  2G9H D;  2R92 H;  4PZ6 A;  4YHH Q;  1ZYR D;  3MEH A;  4KY5 A;  1B1Z A;  1EFI D;  5LL6 S;  3J81 i;  1B44 D;  5IYD H;  1I4H A;  3PUY A;  1MKH A;  3EIV A;  5ELO A;  1VQ5 A;  3FP9 A;  1ZXT A;  3KDF A;  1Q3L A;  4ZQ3 A;  4GNX C;  1JR0 D;  5KGU A;  2F0O A;  3CKI B;  1BBW A;  1STY A;  4R1J A;  1JOK A;  2EJF C;  3QWN A;  2ID0 A;  1VQ8 A;  3J81 j;  3HEJ A;  1WTX A;  4RG1 A;  3K5M A;  4A3G G;  2L5T A;  1JMC A;  5C5M A;  2EXZ A;  3GO5 A;  4IO9 A;  3I4M H;  3AFQ A;  3P75 A;  3CRK C;  3W1B A;  3JAM L;  1F9R A;  1BNZ A;  1TS3 A;  2CH4 A;  4GN3 B;  1GO3 E;  2YU9 B;  3PCO B;  2B2W C;  4DAV A;  4C3J G;  5HY6 A;  1WTW A;  1K3R A;  2PZT A;  3CCR A;  1QZG A;  2EYF A;  5D65 A;  1X9N A;  3RLO A;  3M4O B;  4IN3 A;  3WWV A;  4RGN A;  4LF7 Q;  4A3K H;  1QJO A;  3GTK H;  4NB3 A;  4ZYS A;  3LNN A;  1EY0 A;  2ENB A;  2UUC L;  1STH A;  3MEF A;  2R7Z B;  1L2F A;  2JEB I;  2VQE Q;  2EY5 A;  4TQU S;  3K5L A;  5C4X B;  4LNQ A;  1WCM H;  3O13 A;  1DZ1 A;  3DM3 A;  5E4W C;  1SBB B;  4A75 A;  3DXJ C;  4X62 Q;  3AU7 A;  2NYZ D;  4AQY Q;  2HCI A;  4KHZ A;  4XT3 B;  2JA6 G;  1L0X B;  2IL8 A;  1XX8 A;  2UUB Q;  1S72 A;  3H09 A;  1KLU D;  2VQF L;  2K14 A;  2N55 A;  4DAM A;  2C35 B;  3M4O H;  4F8M A;  2JA7 G;  3QOJ A;  2IX0 A;  4JBW A;  3MVV A;  4OIJ A;  4M8A A;  1G29 1;  3OMC A;  2B63 B;  1O7L A;  2A6H D;  2UXD Q;  1LT3 D;  4HMI A;  1YI2 A;  1YIJ A;  2E2I H;  1KL9 A;  4A3F G;  3HRZ C;  3SVM A;  4ZKC B;  1I3Q H;  4IPD A;  3GTQ H;  2K04 A;  4R8I A;  1E2V A;  1PH3 A;  1E3P A;  3P20 A;  5EBD A;  1XNQ Q;  2VXW A;  4XQN A;  4RA8 A;  3RN2 A;  4LF4 L;  3R8B A;  1A63 A;  4DAP A;  1JOQ A;  4KJN A;  1NMF A;  3VDY A;  3R2I A;  3WDN A;  3I4N G;  3PF5 A;  3S1Q B;  3QIA A;  3L3O C;  5I6W A;  4LMQ D;  1LLR D;  4DA2 A;  1YHB A;  3ND9 A;  2OWO A;  3GQB A;  2QIL A;  4K0K Q;  1L0Y B;  4C3I B;  3E9H A;  4K8I A;  3D6C A;  2BCO A;  3FVQ A;  5NUC A;  1OO9 B;  4DFA A;  3T1H L;  1GXD C;  1QB5 D;  2E2J H;  1B4O A;  1JE4 A;  3FKI G;  1D7Q A;  3N52 A;  3CQZ B;  3M3Y B;  4X66 Q;  2NN6 G;  4NXN L;  3TQY A;  3DWA A;  2LKV A;  4DNI A;  2ZM6 L;  4LF8 Q;  4LF9 Q;  5KYL A;  1PMR A;  2ZXP A;  3GTG H;  4GN4 B;  1K83 B;  4JV5 Q;  4KKU A;  3OYY A;  5E7N A;  2D0O A;  1K0R A;  4L5T A;  3NQI A;  4UHV A;  2DUD A;  1GD7 A;  2PI2 A;  4CDC C;  4G57 A;  1T5E A;  2EOT A;  1K3B C;  4JPB W;  1DD2 A;  4HID A;  1HRJ A;  1PFB A;  2KED A;  1QNU A;  1AN8 A;  1EWC A;  4G7H C;  1YHQ A;  4JI1 Q;  3N6R A;  1S5E D;  1AZQ A;  3CCE A;  2YTX A;  3TDQ A;  1H9J A;  3OIP A;  3DHQ A;  4RGM A;  1NNX A;  4HJ8 A;  1IW7 D;  3A56 A;  5BN4 A;  1Y8N B;  4JI8 L;  2JA9 A;  4JI5 Q;  2FXQ A;  4IQZ A;  2A8V A;  1JE5 A;  3NK9 A;  1H95 A;  2A6E D;  4LFA L;  1CKN A;  2BDO A;  5IP7 G;  4GKJ Q;  1K8O A;  4KHP L;  2WFW A;  2JN4 A;  3K0X A;  3JAM i;  3RNU A;  2ASB A;  1CSP A;  1KD1 C;  2JA8 H;  4CJ1 B;  5J22 A;  1WD1 A;  2E76 C;  4WOR A;  2L55 A;  2F0L A;  1BVS A;  4HTH A;  2Z6K A;  1C4Q A;  2PNH A;  4FXG C;  1E2Z A;  2EVB A;  1CFM A;  5I4D A;  1H9K A;  4A3E H;  4JOI A;  2PPB C;  4FNF A;  4KD4 A;  2LMC B;  3M9B A;  4MN3 A;  5BR8 L;  3T16 A;  1SAP A;  4OON A;  1U4R A;  4A3D B;  5FLM H;  3S2D H;  3HKZ B;  2L4N A;  2SOB A;  1EFW A;  1BO0 A;  1HJP A;  3KLR A;  2SEB D;  1WVL A;  2LXJ A;  3RZD B;  1SYB A;  5KEE A;  4AIM A;  3RLN A;  4QIW B;  2K28 A;  5E4X A;  1EY5 A;  4EQ5 A;  1MJC A;  2OEO A;  2Y0S B;  2D5D A;  2E8G A;  2WAQ G;  4DV3 Q;  4IOA A;  3I2Z A;  3U9S A;  4DGZ A;  1S40 A;  5M5W B;  2QGQ A;  1EIY B;  3MC0 B;  1V9P A;  3NHH A;  4YWK A;  1GJX A;  5IE8 A;  4UP7 A;  4NXM L;  1TWA B;  5C3E H;  1ROD A;  4JI6 Q;  4O1N A;  3G4S A;  1LT6 D;  1Q90 A;  5LMN W;  2ZJR A;  1II3 A;  3AB9 A;  3TP8 A;  2B2T A;  3M4Y A;  2M2L A;  3M7G A;  3R93 A;  1O80 A;  1VQM A;  1EQV A;  2R6G A;  2I0Q A;  2PCF B;  2Q2U A;  1E1O A;  2TSS A;  2L0C A;  1Z47 A;  1XWE A;  3HG9 A;  1JWU D;  1FNU A;  5A2Q L;  5IP9 H;  5J39 A;  1N34 L;  1RJT A;  2RQX A;  2F0P A;  5C44 H;  1DJR D;  2VUM G;  4QQB X;  2XWJ B;  1VQL A;  5M3M B;  2MO1 A;  3MXN A;  4C2M B;  1ESF A;  1SN8 A;  5IYC H;  4DR5 L;  4JYA L;  2J4X A;  1SND A;  2HUG A;  2CKZ B;  4BBR B;  3KLS A;  1TY2 A;  1X55 A;  4BA1 I;  1R9T H;  1CQF A;  1SFO B;  4G7Z C;  3ZYY X;  4BBS G;  3HOY G;  3Q22 A;  1LUZ A;  2UUC Q;  2CFM A;  3A74 A;  1PYB A;  5CYU A;  2RSN A;  4JK1 C;  3I55 A;  1VQ9 A;  3TZD A;  3TRZ A;  4A3L G;  3CW2 C;  4ME3 A;  2O5I C;  4ILW A;  4WJ3 M;  5CBA E;  2KVM A;  3CAM A;  1ML0 D;  3EA6 A;  3BVZ A;  3HOZ H;  4MTN A;  1HZA A;  5KNC A;  3H0G H;  5M3M H;  1QE6 A;  1VQC A;  2F0F A;  5C3X A;  1R4P B;  4B3S L;  3S14 H;  4DV6 L;  4DKA C;  2XWB B;  5KRU A;  1VMP A;  2RCF A;  2E2D C;  2VQF Q;  4B08 A;  4APV A;  4L5R C;  3E0J A;  4OIK A;  4IPG A;  5JJI A;  2WKD A;  3KDF B;  4CDE C;  2H5X A;  4H0L C;  1TXY A;  5IT9 E;  3GTM H;  5C5L A;  3VR2 A;  4KKS A;  1HNW L;  4BY1 G;  1CKM A;  2IX3 A;  1EUJ A;  1Y1W H;  2LXK A;  1HFG A;  2JA5 G;  1VQ6 A;  4A93 H;  4CGY B;  1VDZ A;  2VQE L;  1STE A;  1NMG A;  4OO1 G;  5JEA H;  2EY2 A;  2PW7 A;  1AW7 A;  5FO8 B;  5C3W A;  4KK7 A;  4IUN A;  2F03 A;  2D2C C;  2LFN A;  1EZ8 A;  2WII B;  2YV5 A;  3L9A X;  5EAY A;  2O5J C;  4ABN A;  1GUN A;  5IY0 A;  4A3I H;  3DWP A;  3CCL A;  1SEB D;  1V1O A;  2CQA A;  3D4W A;  4N9T A;  2E75 C;  3A8K E;  4QJF A;  4DR7 L;  2AUJ D;  4XT1 B;  5M5X H;  1XTC D;  2MNA A;  4X3K A;  3HOW B;  3LWE A;  1QUQ A;  1HH2 P;  2GVA A;  2BOS A;  1YNX A;  2ZJQ A;  4DK1 A;  1YJW A;  2JXM B;  2A19 A;  1HTL D;  2MQH A;  2UXD L;  4WJW A;  3HOX H;  4I65 A;  1IBM Q;  4DNT B;  2A5H A;  1GVP A;  1STG A;  1VQP A;  4A3M G;  4NXN Q;  2Z8L A;  2K50 A;  4QB4 A;  3H91 A;  2ZM6 Q;  5GAD C;  1WI5 A;  4ALP A;  2MPM A;  3WOE A;  4U67 3;  1K0S A;  4RMF A;  4DPG A;  5CV8 A;  1LTS D;  3F1Z A;  4IJL A;  4HSV A;  1SYF A;  4IZ8 A;  1U4M A;  3S1N H;  5IGF A;  2D9U A;  5M3F B;  3J7A 5;  1IBK L;  5CBE E;  2K33 A;  3F2B A;  2R93 B;  2A1A A;  1P16 A;  2K5V A;  3KOJ A;  3F2D A;  5EPJ A;  4XYO A;  1BCP D;  1EOV A;  4HIK A;  1IXR A;  1FGU A;  3OHX C;  1ENA A;  1NUC A;  1YEZ A;  2NTT A;  2JE6 I;  4JI8 Q;  5JVG 3;  1XPO A;  4MTK A;  1ZYR C;  1PRT D;  5LMN L;  3ULL A;  3D0F A;  1Y1V G;  2F0T A;  1SNO A;  2PQE A;  2ZXR A;  2RDH A;  4KHP Q;  3DWQ A;  3J80 E;  1HUN A;  4H02 A;  1UE5 A;  4BA2 I;  4J15 A;  1W6J A;  2KUM A;  2VNU D;  3CC4 A;  3SK8 A;  4MZ9 A;  2FIN B;  3W5O A;  1CTM A;  1VQI A;  1IL8 A;  2F0D A;  1D2B A;  1CSQ A;  1I5F A;  5ELB A;  4LF6 L;  3QG1 A;  3U4V A;  4JI3 L;  4LW1 A;  4PV1 C;  3S17 B;  1YNJ D;  1B7Y B;  1HQM C;  1LT4 D;  1XJV A;  2AMC B;  3HOV B;  4Y7N B;  3SE0 A;  4Q5V A;  2JJQ A;  5HUR A;  1HTP A;  2AWO A;  4QF4 A;  4L8J A;  4ZRZ A;  4N8X 1;  3TEH B;  3U58 A;  1T5X D;  2PQA A;  2RA4 A;  1TWF B;  5GAG C;  1UAP A;  3VYU A;  1O78 A;  3AFP A;  4DU9 A;  1AE2 A;  4GKJ L;  1SNP A;  4BY7 B;  5EKL A;  4JOI C;  1XNR L;  4LAA A;  2EYH A;  1BQQ T;  1X56 A;  1OXT A;  1PH9 A;  1DOK A;  5IT9 c;  3OPO A;  2QW7 A;  5M9O A;  2L11 A;  2WB1 B;  3G6E A;  1KDA A;  4HCS A;  1VQD A;  2R92 B;  5E1F A;  1DYQ A;  5EPK A;  4CKE A;  3KLW A;  3G6J B;  3W1G A;  3C1E A;  1F9Q A;  1V1Q A;  5CGK A;  2A68 C;  1VQK A;  5IYB G;  3NWS A;  4ZAI A;  1IHZ A;  2G9D A;  2KQ3 A;  4P74 A;  3HOU H;  2A6H C;  2BA1 A;  1HUM A;  3LWU A;  2CVR A;  3S24 A;  3FHW A;  3PSI A;  3TSS A;  1SYE A;  1FD7 D;  4DR5 Q;  4JYA Q;  1ILQ A;  2LSS A;  2AKW B;  1B9N A;  3GTP H;  1EIG A;  4K6D A;  1M4V A;  3I4L A;  2KEC A;  2F0M A;  1XXG A;  3PGZ A;  3ULJ A;  3NBH A;  1AH9 A;  2WIN B;  1U9R A;  1XMQ L;  1HQR D;  4JI6 L;  5K36 H;  1ET6 A;  2R7Z G;  4A3K B;  4GLX A;  3GTK B;  2VB2 X;  5C4X G;  2QF7 A;  1UE7 A;  3AYH B;  5ISR A;  1BUV T;  4A3B B;  1LTB D;  5CV7 A;  3PF4 A;  5FO7 B;  4XYQ A;  2VW9 A;  2XTI A;  1EY4 A;  2HD3 A;  5IIF A;  5A2Q E;  3A0J A;  5DNF A;  1KQS A;  2F4V L;  3KF8 A;  4A3C G;  1WCM B;  1A3V A;  4B3S Q;  2NVT H;  1D6E C;  4DV6 Q;  1J6Q A;  1Q82 C;  4B3M L;  1MGS A;  1R4Q B;  1YHA A;  1XTD A;  4CJ2 C;  1CA5 A;  1B3Q A;  2B3G A;  1SE3 A;  2NN6 I;  1PYS B;  1EYA A;  2GVB A;  4FYD A;  3Q0A A;  4KN7 C;  3U50 C;  3VA7 A;  1M90 C;  1V43 A;  4TVA B;  2B63 G;  1Q1E A;  1B50 A;  3CD6 A;  4Y52 H;  3PO3 H;  3IRB A;  1HNW Q;  4A3B H;  2Q8T A;  2KBN A;  5IT9 L;  3J80 c;  2ZTE A;  4A3J H;  3A55 A;  1JC7 A;  1MSH A;  4Z9C B;  4DXG A;  4PZ7 A;  3RN5 A;  2EJM A;  3UE0 A;  2VY3 A;  2E2I B;  5D14 A;  4IFD G;  3MXN B;  3NUC A;  3PO2 H;  1I3Q B;  3GTQ B;  1FNW A;  4QL5 A;  1O7Z A;  5GQO A;  1CHP D;  2WAC A;  2ALY B;  3CCM A;  4TSS A;  2K03 A;  2A6E C;  4U68 A;  2Q2H A;  2DNE A;  1WOC A;  4XXE A;  5A35 A;  2CW0 D;  4DR7 Q;  2M00 A;  5JJL A;  3CMA A;  1P8L A;  1OXV A;  3PQI A;  4C3I G;  2UU9 L;  1UWV A;  2F0I A;  2NVQ H;  3OWF A;  5JJK A;  3VYS A;  1PLF A;  1XYI A;  5C6A A;  4R4O A;  4X3T A;  3MTS A;  1WJJ A;  3VYR A;  1W2B A;  1F2Y A;  2K5D A;  1CA6 A;  2E2J B;  4WRD A;  1FYC A;  1LT5 D;  5GAE C;  5I2Y A;  1IZ6 A;  1YZ6 A;  1EEF D;  5IGG A;  4XQQ A;  2CWA A;  3S1R H;  2I5M X;  4GLV B;  5C4J B;  3GTG B;  1NY4 A;  1DXM A;  3OMG A;  1PTO F;  1SNC A;  3G71 A;  3A8I E;  1ILP A;  1IBK Q;  4EX5 A;  1STN A;  2QEJ C;  1LAB A;  5ELC A;  1V8Q A;  3ZJY C;  1EIF A;  5T1G A;  3DEP A;  5F2D A;  4A3G H;  1IYU A;  1EWH A;  1YIT A;  3OWE B;  1HHV A;  2MUY A;  2I5L X;  5LMN Q;  1HPC A;  1L1O B;  3NE5 B;  1PTO H;  1NJI C;  3W3A A;  1TS2 A;  1IBM L;  4LUZ A;  4C3J H;  2QCP X;  3KJP A;  4UY8 C;  3J80 L;  3J81 E;  5C4J H;  3T1Y L;  2F3I A;  5EQ0 A;  4FO2 A;  3TP6 A;  3CF5 A;  1HFN A;  1C9O A;  2JA8 B;  4YWL A;  4LF6 Q;  1SNQ A;  3U4Z A;  2B2U A;  3DM1 A;  3RMH A;  2A69 D;  1QUQ B;  1PDQ A;  3PV0 A;  3BDL A;  1GUO A;  4A3D G;  5JEA J;  4JI3 Q;  4V0B A;  1H9R A;  1BBU A;  1PTO D;  3HKZ G;  4A3E B;  1WYD A;  4B9X A;  1YBY A;  3KF6 A;  2O2L D;  3I72 A;  1G51 A;  5C0X J;  3EN2 A;  2ICE C;  3NEL A;  4K5W A;  2F0G A;  2JA6 H;  3GTJ H;  1KTK A;  2XRS D;  4FF1 A;  3S2H H;  3S2D B;  2SDF A;  1TWH H;  1J8I A;  1E22 A;  4I7Z C;  3K5N A;  4LUV A;  1B53 A;  3L0O A;  2R61 A;  3V2T A;  3X3N A;  1K28 A;  2I46 A;  2Y0S G;  3MWY W;  2ZTD A;  2JP1 A;  2JA7 H;  1QVF A;  1XNR Q;  2NWG A;  3KBG A;  3OTO L;  3NEM A;  2F3W A;  4POG A;  3MAQ A;  4P75 A;  2XSC A;  5IGE A;  4HIM A;  1PH1 A;  3CU7 A;  4K8J A;  2JK8 A;  4ME5 A;  4AYB B;  5HGQ A;  3KBX A;  4A3F H;  1KAA A;  5I9O A;  1U4L A;  4YCU A;  3T13 A;  1C8C A;  5C3E B;  3K57 A;  4ULL A;  1IKM A;  1KDC A;  4KTA A;  2MGS A;  1B3A A;  2HHH L;  1LTL A;  2EYJ A;  4OGQ C;  4TRD A;  5M5Y H;  1PFS A;  1RTO A;  1Y8O B;  5I9P A;  1VQ4 A;  2NVX H;  2XIW A;  1HCZ A;  3I4N H;  2B2Y A;  5I6Y A;  1S5C D;  1CT1 D;  1E24 A;  1G8Z D;  4DN4 M;  5DEH A;  1VQB A;  3T56 B;  4B3R Q;  2F0H A;  1SR3 A;  4YWM A;  3PIP A;  1G2S A;  5G3L F;  1Q86 C;  5C44 B;  3D3R A;  2PW5 A;  3H3V I;  3UI2 A;  2MP1 A;  4DV7 L;  1VQA A;  1QVC A;  1LTR D;  4BBR G;  4NP5 A;  3UDG A;  4FXK C;  3EQL C;  3S15 H;  1M8A A;  3FKI H;  2UXB Q;  2K4K A;  4DV4 L;  2UXC L;  4DAY A;  1ONL A;  1XMQ Q;  5H1S E;  2NN6 H;  4GKK Q;  5C4Z A;  3GTO H;  4CKC A;  1OTC A;  4DR3 L;  1N32 L;  2NUC A;  2YYZ A;  2RDF A;  3VR5 A;  2EY6 A;  1F9P A;  2K32 A;  1Q81 C;  5EPL A;  1R9T B;  3IAY A;  2K5W A;  2AUK A;  2PQA B;  3KYH C;  5IGC A;  5FJ8 G;  4L5S A;  1JT8 A;  1EYC A;  4ZCK A;  3CCS A;  3T4A C;  4YY3 L;  1EQT A;  2F4V Q;  2A74 C;  1JOR A;  4DR4 L;  4B3M Q;  1S4Z A;  1A15 A;  3HKZ E;  3HOZ B;  1A0I A;  3H0G B;  1GUW A;  3UDI A;  5C0X G;  1B9M A;  3S14 B;  2X6L A;  1S5F D;  4J6H A;  5J3B A;  4KJO A;  3URY A;  2PYK A;  4JG2 A;  5G3L D;  4QIW E;  3BDO A;  3FEW X;  4DXF A;  2KOL A;  2BE5 D;  4DF7 A;  1NAP A;  1SMY D;  5IP7 H;  3D4R A;  1SJE D;  1ET9 A;  4HN7 A;  2Y0S E;  2C5C A;  5DM6 3;  2PMZ B;  4F87 A;  4ZKB B;  3GTM B;  3I4O A;  5BN3 A;  1EY9 A;  3RLF A;  3CPF A;  2OCE A;  1T9H A;  2FMM A;  1Y1W B;  1RCV D;  4H13 C;  2HQL A;  3J80 i;  4RFB A;  4HSP A;  1NBW A;  1C7Y A;  3K7A H;  3TZU A;  1XMO L;  4A93 B;  1PZK D;  4DV0 L;  3SR1 A;  1RD9 D;  3I91 A;  1PRT C;  3CC2 A;  1GUT A;  1CKO A;  1FNV A;  2XGT A;  2P5Z X;  4LJZ C; 
#chains in the Genus database with same CATH homology
 4LF6 L;  1X9N A;  3NBH B;  3RLO A;  3U4V A;  3WWV A;  4LF7 Q;  1Q46 A;  2QA4 A;  4A3K H;  3GTK H;  4OWT B;  1KIX A;  1E1T A;  3HOW G;  5IYC G;  3M85 A;  4NB3 A;  1FL0 A;  4JI3 L;  3CQZ H;  4LW1 A;  3M3Y H;  2UU9 Q;  3TRE A;  4DV5 L;  1B7Y B;  4DUZ Q;  4DK6 C;  2UUC L;  1W3S A;  4X64 Q;  2HIX A;  3MEF A;  1XJV A;  2F52 A;  1L2F A;  2AMC B;  2JEB I;  2VQE Q;  4TQU S;  4JI7 L;  1SRO A;  4LNQ A;  1K83 H;  3EBE A;  1VQH A;  4GLA C;  4O0A A;  1WCM H;  4OX9 L;  2JJQ A;  3DM3 A;  2AWO A;  3E0E A;  4X65 Q;  1I94 Q;  1X54 A;  3TEH B;  2EQS A;  4DUY L;  3KF8 B;  2WAQ E;  4A75 A;  3U58 A;  2PQA A;  1EYG A;  4B3T L;  2RHQ B;  5GAG C;  4X62 Q;  4AQY Q;  3AFP A;  4KHZ A;  1AE2 A;  2JA6 G;  3TS0 A;  4GKJ L;  3J7Z C;  4GOP C;  2K75 A;  2UUB Q;  1L1O A;  4JOI C;  1S72 A;  3CP0 A;  1PA6 A;  1HR0 Q;  1XNR L;  3HOZ G;  2VQF L;  4GN5 A;  2K14 A;  4DAM A;  1X56 A;  1OXT A;  1Z9F A;  3H0G G;  2EXD A;  3UE1 A;  4R4Q A;  5M3M G;  2C35 B;  1PH9 A;  1UEB A;  1SRU A;  5IT9 c;  3M4O H;  5M3F G;  3ULP A;  5AJ3 L;  2JA7 G;  2R93 G;  3ER0 A;  3G6E A;  2IX1 A;  1C0A A;  2IX0 A;  1N8R C;  2OQK A;  4JBW A;  3F8T A;  1VQD A;  1G29 1;  1EQR A;  2UXD Q;  1N33 L;  1YI2 A;  3KLW A;  1YIJ A;  3K81 C;  2E2I H;  1KL9 A;  3W1G A;  4OO1 I;  4A3F G;  2NZH A;  4L5Q A;  2UUA L;  1V1Q A;  1I3Q H;  1N9W A;  1PH5 A;  2VUM H;  1VQK A;  4IPD A;  5IYB G;  3GTQ H;  1J5E Q;  2YTV A;  1PH6 A;  2Z0S A;  3D31 A;  3ERS X;  1PH3 A;  1E3P A;  4P74 A;  1Y1W G;  1XNQ Q;  1GKH A;  3JC6 6;  4AYB E;  3RN2 A;  3HOU H;  4LF4 L;  1A63 A;  1I50 H;  4A93 G;  2BA1 A;  3T1Y Q;  2KCT A;  1B70 B;  2D62 A;  3GTL H;  4JI0 L;  4GOP B;  5JEA G;  1NMF A;  3VDY A;  3S24 A;  1HNX L;  4JI4 L;  3FHW A;  4A3D H;  3I4N G;  3PSI A;  4DR5 Q;  3PF5 A;  1A62 A;  3CPW A;  4JYA Q;  2LSS A;  3S1M H;  4BBS H;  3HOY H;  2AKW B;  3GTP H;  1YHB A;  2OWO A;  3CCV A;  1KRT A;  4A3I G;  4A3L H;  4DV1 L;  4UPA A;  3PGZ A;  3ULJ A;  1Q7Y C;  2Q2I A;  2WP8 J;  1AH9 A;  4K0K Q;  3E9H A;  1XMQ L;  3RZD H;  1YVC A;  4YCW A;  2K5N A;  3E9I A;  3T1H L;  1ASY A;  4JI6 L;  2R7Z G;  2E2J H;  4GLX A;  3FKI G;  3G48 A;  1UE7 A;  3AYH B;  5C4X G;  3BZK A;  2YTY A;  2VL6 A;  3HOV G;  1D7Q A;  4GNX A;  4DR2 L;  1O7I A;  4UP8 A;  4X66 Q;  3PF4 A;  2NN6 G;  4HJ9 A;  3A5Z B;  2CWP A;  2VW9 A;  3K7U C;  2XTI A;  1CUK A;  4NXN L;  3TQY A;  3CCU A;  4A3C H;  4LWC A;  4DNI A;  4WJ4 A;  2ZM6 L;  4LF8 Q;  4LF9 Q;  1NE3 A;  3UDF A;  3A0J A;  1D8L A;  5M5W H;  3GTG H;  3J81 c;  3HOX G;  4GN4 B;  1PH2 A;  1PH4 A;  1X65 A;  1KQS A;  2F4V L;  4JV5 Q;  1AE3 A;  3OYY A;  5E7N A;  2D0O A;  1GM5 A;  4B3S Q;  2NVT H;  4BY7 G;  4A3C G;  4DV6 Q;  1K0R A;  1J6Q A;  4L5T A;  1Q82 C;  4B3M L;  1TWA H;  4BXX G;  2VS1 A;  1MIU A;  1HZ9 A;  2DUD A;  2OQ0 A;  3OTO Q;  1GD7 A;  1YHA A;  2PI2 A;  4P71 A;  1K73 C;  1FJG Q;  1XTD A;  4UP9 A;  4YHH L;  4PZ8 A;  4HID A;  1EWI A;  2KEN A;  1NTG A;  1YHQ A;  2CCZ A;  1KXL A;  4JCV E;  4JI1 Q;  1B8A A;  2WB1 G;  2B3G A;  2ES2 A;  2AHO B;  2NN6 I;  1PYS B;  3CCE A;  4BY1 H;  3CCQ A;  2YTX A;  2R92 G;  2GVB A;  3U50 C;  1M90 C;  2B63 G;  1V43 A;  3K80 C;  4TVA B;  3H3V H;  1Q1E A;  4YCV A;  3CD6 A;  4Y52 H;  5IYD G;  1IBL Q;  2JA5 H;  2K5H A;  1PVO A;  3PO3 H;  3IRB A;  2BH8 A;  4HJ8 A;  4A3B H;  1HNW Q;  2KBN A;  4JI8 L;  3J80 c;  2JA9 A;  2ZTE A;  4A3J H;  2OTL A;  4JI5 Q;  5LMU Q;  2FXQ A;  2A8V A;  1JE5 A;  2R7F A;  1H95 A;  1RIP A;  1N36 Q;  4LFA L;  1E7Z A;  1CKN A;  4PZ7 A;  5IWA L;  3RN5 A;  4KLK A;  2HHH Q;  3RZO H;  3UE0 A;  5IP7 G;  4C2M H;  4GKJ Q;  4DR6 Q;  2E5L L;  4IPH A;  3I56 A;  2VY3 A;  4KHP L;  2WFW A;  1TWG H;  1X3E A;  4OWW B;  3JAM i;  3K0X A;  4XIG S;  3RNU A;  2ASB A;  4DR1 L;  4HJ7 A;  1K8G A;  4IFD G;  3MXN B;  1CSP A;  1KD1 C;  3PO2 H;  2JA8 H;  1HR0 W;  3CXC A;  3TS2 A;  3STB D;  4QL5 A;  4LFB L;  5GQO A;  2Z6K C;  3I4M G;  2ALY B;  3CCM A;  4BBR H;  1BVS A;  2Z6K A;  2PNH A;  4HJA A;  2Q2H A;  4GOP A;  1WOC A;  2PMZ E;  1SFO H;  4A3E H;  4DR7 Q;  3DLL A;  4JOI A;  5JJL A;  3CMA A;  4DV7 Q;  1Q12 A;  1PH8 A;  3M9B A;  4LF7 L;  1P8L A;  1OXV A;  1HZC A;  5BR8 L;  2CQO A;  4OON A;  4LF5 Q;  2N3S A;  1Q1B A;  5FLM H;  3KF6 B;  4DV4 Q;  2UU9 L;  2UXC Q;  1UWV A;  4IFD I;  3STB C;  3S2D H;  5FJ8 H;  1ASZ A;  1IYJ B;  2NVQ H;  1EFW A;  2K52 A;  1VQF A;  4A3M H;  4X64 L;  4DR3 Q;  1N32 Q;  5JJK A;  4A3K G;  2I5H A;  1HJP A;  1PHJ A;  2ZTC A;  4R4O A;  4R4T A;  2N49 A;  1U0L A;  1WJJ A;  3KJO A;  1W2B A;  2LXJ A;  1K9M C;  1OXX K;  2IHF A;  4X65 L;  1I94 L;  2IY5 B;  4LF4 Q;  2HT1 A;  1U5K A;  4AIM A;  3RLN A;  3CC7 A;  1YJ9 A;  4X62 L;  4AQY L;  4EQ5 A;  5GAE C;  4YY3 Q;  1WCM G;  3PUZ A;  1MJC A;  4KI0 A;  4PG3 A;  1IZ6 A;  4DR4 Q;  1YZ6 A;  2E2H H;  2Q2T A;  4JI4 Q;  2UUB L;  5GRO A;  2CWA A;  2E8G A;  2WAQ G;  4DV3 Q;  3S1R H;  4IOA A;  2I5M X;  3I2Z A;  2HIV A;  4GLV B;  1S40 A;  3NEN A;  1LM0 A;  1NY4 A;  5FLX c;  2QGQ A;  1EIY B;  1V9P A;  3UDX A;  4YWK A;  3G71 A;  5IE8 A;  4UP7 A;  1VQN A;  1IBK Q;  4EX5 A;  4NXM L;  4B3R L;  4PMW A;  1S3O A;  4JBJ A;  5C3E H;  1KC8 C;  3T1H Q;  2NVY H;  4JI6 Q;  3ZJY C;  1JJC B;  2RHS B;  3L2P A;  1EIF A;  3G4S A;  1HNZ Q;  3LGJ A;  1VCI A;  5LMN W;  3S16 H;  4A3G H;  4DR2 Q;  1Y1V H;  2MO0 A;  1JJG A;  2UXB L;  2ZJR A;  2PI2 E;  1YIT A;  1X3F A;  3RR5 A;  3ICE A;  1VQM A;  4GKK L;  2I5L X;  2R6G A;  5LMN Q;  2I0Q A;  1SLJ A;  1UE6 A;  1SE8 A;  1L1O B;  1E1O A;  2Q2U A;  1HZB A;  2QEX A;  1J5E L;  1Z47 A;  3OW2 A;  4JI2 L;  1VS0 A;  1VQE A;  5IP9 H;  1NJI C;  1IBM L;  3M4Q A;  4LUZ A;  4C3J H;  1N34 L;  1XNQ L;  1Y14 B;  5C44 H;  2EIF A;  3KJP A;  4UY8 C;  1I6H H;  1LYL A;  2B29 A;  2VUM G;  1Q8K A;  4QQB X;  1X6O A;  2MFI A;  4GS3 A;  1XMO Q;  2MO1 A;  5C4J H;  3T1Y L;  1VQL A;  2F3I A;  2KCM A;  4DV0 Q;  1SN8 A;  3PIO A;  3GDE A;  3CF5 A;  3HOW H;  3HOU G;  2NZO A;  5IYC H;  2OTJ A;  4DR5 L;  4JC0 A;  4JYA L;  1C9O A;  4YWL A;  4DV2 L;  4A4I A;  2V1C C;  4LF6 Q;  3U4Z A;  2L15 A;  4POF A;  4R4I A;  3A5U A;  1QUQ B;  2AWN A;  4LFC L;  4DAY B;  2CKZ B;  3PV0 A;  4A3D G;  5JEA J;  4HIO A;  3SGI A;  4JI3 Q;  1X55 A;  4BA1 I;  1R9T H;  1BBU A;  4K0K L;  4DV5 Q;  3HKZ G;  4BBS G;  1BKB A;  3HOY G;  1LUZ A;  2UUC Q;  1WYD A;  2CFM A;  3A74 A;  1PYB A;  1YBY A;  3KF6 A;  3M4P A;  4LUO A;  4MNO A;  4LFA Q;  4C3H H;  3I55 A;  3F2C A;  1VQ9 A;  3TRZ A;  4A3L G;  5ELN A;  3CW2 C;  4ME3 A;  4JI7 Q;  1G51 A;  5C0X J;  3EN2 A;  3NEL A;  2JA6 H;  4OX9 Q;  4X66 L;  4WJ3 M;  1XPR A;  1FVI A;  3GTJ H;  4DR1 Q;  3S2H H;  4AH6 A;  1TWH H;  2KHI A;  5K36 G;  3CAM A;  1JJ2 A;  3Q8D A;  4DUY Q;  1E22 A;  4LF8 L;  1TWC H;  2IHE A;  4LF9 L;  4MTN A;  4B3T Q;  1XPU A;  3HOZ H;  1HZA A;  4LUV A;  2N8N A;  3H0G H;  3L0O A;  5M3M H;  1VQC A;  4JV5 L;  1G6P A;  3M7N A;  3S14 H;  4B3S L;  1QVG A;  2Y0S G;  4DV6 L;  5M3F H;  3KFU A;  4DKA C;  2ZTD A;  1PV4 A;  3H15 A;  4IJH A;  1QVF A;  2JA7 H;  1XNR Q;  2R93 H;  2GN5 A;  3GD7 A;  4DK3 C;  3OTO L;  3NEM A;  2VQF Q;  1FJG L;  3AQQ A;  4JI2 Q;  4APV A;  4JI0 Q;  4POG A;  1OXS C;  4P75 A;  4L5R C;  1OXU A;  5BR8 Q;  4HIM A;  4IPG A;  1PH1 A;  5JJI A;  2N78 A;  4JI1 L;  4P72 A;  1MJE A;  5AJ3 Q;  2JEA I;  2JK8 A;  1K8A C;  3KDF B;  3L7Z C;  4A76 A;  5HGQ A;  2H5X A;  1PH7 A;  4A3F H;  4GNX B;  2IT1 A;  1TXY A;  3GTM H;  1KHI A;  4YCU A;  1WFQ A;  4HJ5 A;  1IBL L;  3JAM c;  5IYB H;  1HNW L;  1N33 Q;  4BY1 G;  1QZH A;  2JQO A;  1CKM A;  3PUV A;  1EUJ A;  4JI5 L;  5LMU L;  2LXK A;  4DUZ L;  1Y1W H;  4JBM A;  2UUA Q;  1N36 L;  1KRS A;  2HHH L;  1LTL A;  2JA5 G;  1VQ6 A;  4X6A H;  3PO3 G;  1RL2 A;  2YU9 H;  1VQO A;  4A3B G;  4A93 H;  1L1O C;  2VQE L;  4DR6 L;  4IFD J;  5M5Y H;  1PFS A;  1NMG A;  4OO1 G;  4A3J G;  1DGS A;  1X3G A;  1VQ4 A;  2NVX H;  1A8V A;  4IPC A;  5DLQ E;  3I4N H;  2KHJ A;  1YJN A;  4JBK A;  1E24 A;  2YV5 A;  4FDB A;  4OXP A;  4QGU A;  3BZC A;  1VQB A;  5EAY A;  4B3R Q;  4NXM Q;  1SR3 A;  5IY0 A;  4YWM A;  3PIP A;  4A3I H;  3BU2 A;  1HNX Q;  1Q86 C;  1IL2 A;  3I7F A;  3CCL A;  3PO2 G;  3CCR A;  3S17 H;  1SMX A;  2JA8 G;  1HR0 L;  3AEV A;  4QJF A;  4DR7 L;  3PUW A;  4QY7 A;  3H3V I;  3CME A;  1M1K C;  4OWX B;  4DV7 L;  1VQA A;  1QVC A;  4BBR G;  3UDG A;  5M5X H;  2R7Z H;  2DGY A;  3S15 H;  2MNA A;  4DV1 Q;  3FKI H;  5C4X H;  2UXB Q;  4LF5 L;  2K4K A;  3HOV H;  1QUQ A;  4Y7N H;  2R7D A;  4DV4 L;  1CKN B;  1HH2 P;  1L0W A;  4A3E G;  2GVA A;  5H1S E;  1XMQ Q;  1UE1 A;  4GKK Q;  3GTO H;  1VQ7 A;  2ZJP A;  4DR3 L;  1OTC A;  1YNX A;  2ZJQ A;  4NPS A;  4P73 A;  2UXC L;  1N32 L;  1TWF H;  2YYZ A;  1YJW A;  3B6Y A;  2MQH A;  2A19 A;  4IOC A;  1Q81 C;  5FLM G;  2UXD L;  3HOX H;  3BJU A;  1IBM Q;  1N34 Q;  2PQA B;  3KYH C;  1GVP A;  5FJ8 G;  2RCN A;  5GAH C;  1VQP A;  4L5S A;  2VZA A;  4A3M G;  4BY7 H;  4NXN Q;  4BXX H;  1JT8 A;  2K50 A;  2ZM6 Q;  4R4C A;  3CCS A;  5GAD C;  1WI5 A;  4YY3 L;  4ALP A;  2F4V Q;  4DR4 L;  4RMF A;  4DPG A;  4B3M Q;  2WB1 E;  4XTC S;  3F1Z A;  4DV3 L;  2BA0 A;  4IJL A;  3HKZ E;  4DV2 Q;  1A0I A;  2BH2 A;  2R92 H;  4PZ6 A;  4YHH Q;  2ATW A;  4LFC Q;  3S1N H;  3HFZ B;  2B63 H;  3UDI A;  5C0X G;  1VQJ A;  3CCJ A;  1EQQ A;  3J81 i;  3J7A 5;  5IYD H;  1IBK L;  3F2B A;  4AYB G;  2A1A A;  1P16 A;  2K5V A;  5J3B A;  3KOJ A;  3PUY A;  1MKH A;  3EIV A;  5ELO A;  3F2D A;  1VQ5 A;  3FP9 A;  4JG2 A;  1EOV A;  3KDF A;  4QIW E;  4GNX C;  4HIK A;  1HNZ L;  1IXR A;  1BBW A;  1FGU A;  5IP7 H;  5C3E G;  4R1J A;  1XPO A;  1YEZ A;  1JB7 A;  2Y0S E;  2JE6 I;  4JI8 Q;  2ID0 A;  1VQ8 A;  3J81 j;  5LMN L;  4RG1 A;  3ULL A;  5IWA Q;  3D0F A;  4A3G G;  3I4O A;  1Y1V G;  3PUX A;  1JMC A;  3HKS A;  2E5L Q;  3RLF A;  5C0X I;  3CPF A;  3GO5 A;  4KHP Q;  2OCE A;  1KAW A;  4IO9 A;  1T9H A;  3I4M H;  3AFQ A;  3W1B A;  4H02 A;  1UE5 A;  3K8A A;  4BA2 I;  4J15 A;  2HQL A;  3S1Q H;  4GN3 B;  3J80 i;  1NBW A;  1C7Y A;  3K7A H;  1GO3 E;  1XMO L;  2VNU D;  4LFB Q;  3CC4 A;  3PCO B;  5IP9 G;  2D0P A;  5HY6 A;  4O2D A;  4DV0 L;  4MZ9 A;  1K3R A;  3W5O A;  5C44 G;  1VQG A;  3CC2 A;  4C3I H;  1VQI A;  1CKO A;  2XGT A;  1CSQ A;  1QZG A;  2RF4 A;  1I5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...