3I90A

Crystal structure of human chromobox homolog 6 (cbx6) with h3k27 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
50
structure length
50
Chain Sequence
RVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Chromobox protein homolog 6
total genus 10
structure length 50
sequence length 50
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i90A00
2X6LA 3H91A 1PFBA 1X3PA 2B2UA 1WVLA 2EPBA 2KECA 4CJ2C 1DOLA 4X3SA 3R93A 1WTXA 1HFGA 2FJ2A 1RHPA 1B3AA 2NZ1D 3ONAB 2XIWA 2FINB 4X3KA 1G2TA 1U4MA 1DZ1A 2JP1A 1MI2A 4LMQD 5EPKA 5T1GA 2L11A 1J8IA 2RSOA 2B2WC 1E0BA 1EOTA 2HUGA 2MP1A 2K1BA 2L1BA 3I90A 1NCVA 3KBXA 4IUQA 4X3UA 2K28A 5CMDA 1CA6A 3FPUB 4ZAIA 1VMCA 4U68A 5D65A 3TZDA 1G91A 1KNAA 5E4XA 2KEDA 1XX8A 2K05A 1SDFA 1EIHA 3N52A 2HDLA 1ILQA 2KUMA 5CBEE 2CVRA 1PFNA 3MTSA 2B2VC 3DM1A 2Q8TA 1IKMA 1DOKA 1MSGA 1LV9A 1RTNA 3TN2A 4R8IA 2HCIA 1Q3LA 1QNKA 2HDMA 1WTVA 1SSOA 2MPMA 5EJWA 1G6ZA 1S4ZA 4O42A 1NAPA 1MGSA 2RA4A 2DY8A 1CM9A 3F2UA 3QO2A 4OIKA 5EQ0A 1HHVA 2H1EA 5JJZA 1IKLA 3I8ZA 4UAIA 4ZKCB 1WTPA 1WD1A 2Q8RE 2IL8A 1C8CA 1PFMA 1WTWA 4ZKBB 3DEOA 4DN4M 4NW2A 1EQTA 1F9SA 2B2YA 2D9UA 1B50A 3GV3A 2B2TC 4RA8A 1AZPA 1WTQA 1PDQA 1RJTA 1JE4A 4RAUC 3I91A 1U4LA 1O7ZA 3LWEA 1ML0D 2B2UC 5E4WC 4IURA 4MHEA 1RODA 1F2LA 1JICA 2RVLA 3Q6SA 1NR4A 1VMPA 1PLFA 3HP3A 2EE1A 1O80A 2KOLA 4QUCA 4R9WA 4X3TA 5EKIA 1J9OA 1XYIA 1AZQA 1IL8A 2MGSA 4IUPA 4XT1B 5AFWA 1HA6A 1X32A 5DNFA 2HCCA 1QE6A 1U4PA 2NYZD 2JYOA 2VXWA 3P7JA 1WTOA 4IUTA 2K04A 1NR2A 1B2TA 2B2WA 2SDFA 1A15A 1RTOA 5COYA 2FFKB 2L4NA 2L9HA 1EIGA 1BO0A 4HSVA 1BF4A 1HUMA 2K01A 2KEEA 2N55A 4ZLTF 1HFNA 1DOMA 1TVXA 4XDXA 3GV6A 1SAPA 3D6WA 3SVMA 2N88A 4HCSA 2B2VA 1DONA 3G7LA 1M8AA 4HEDA 1WD0A 5EPLA 2BDNA 1ILPA 5EPJA 2FMMA 2KVMA 2R3ZA 3IL8A 5T1IA 1O7YA 4QUFA 2L12A 1EL0A 1MSHA 1BBXC 2MJ8A 5D14A 3I3CA 1ICWA 4IUUA 2K03A 4ZK9B 3MWYW 5CBAE 1HUNA 1CA5A 1B4OA 4OIJA 1F9QA 1X3QA 2RSNA 1HRJA 1QG7A 1GUWA 1F9RA 4HAEA 4RWSC 1ESRA 4CJ1B 1WTRA 1B53A 1U4RA 2DY7A 2J7ZA 4CJ0B 2B2YC 4MN3A 1KNEA 1G2SA 1ZXTA 2X69A 3KUPA 2B2TA 2X6GA 2FHTA 1BNZA 1F9PA 3FDTA 4XT3B 3DEPA 2EOTA 2NWGA 4IUVA 5CORA 1AP0A 3IFDA 2M2LA 3UI2A
chains in the Genus database with same CATH superfamily
2R6GA 1YHAA 2VQFL 4CKCA 4X3SA 1TWAB 3OIPA 3D0FA 3K0XA 3M4QA 4DV2L 5JPMC 2Z6KC 2BE5C 4HJ8A 4DV0L 1AE2A 1I4XA 5EBCA 4HIDA 1RKNA 5TSSA 4IPCA 5K5PA 1JJ2A 1GUTA 2F0DA 1NMFA 2KHJA 5EBDA 2Q2TA 4UP7A 2JEBI 5C3EB 4AIMA 4QIWB 1SMXA 4R8NA 4JV5L 4H44C 2NVTH 5A35A 3DWPA 4OL7A 5C5MA 3KLWA 4DV1Q 1NAPA 1Q86C 1U9RA 3BDLA 3K80C 4B08A 2Z9HA 5JJZA 4KN7C 4RKLA 3NXWA 4LUVA 1PH4A 2B2YA 1CZGA 2WKDA 1E3PA 3ZJYC 2MNAA 2B2TC 4DV1L 2DN8A 1ESFA 2E2IB 5FKAC 3BU2A 1STHA 4BWGB 5IYCH 4RGNA 1QUQB 4NXNL 1BOSA 3CW2C 2LXJA 2EDGA 4G7HC 3NBHA 1Y1VB 1I3QH 2HQEA 1HA5A 1XXGA 1BVSA 3I72A 2JA6H 4IUTA 3V2TA 4A3EB 2VNUD 3SK6A 5HY6A 4A3DB 3A0JA 4IZ8A 3BVGA 4KN4C 1IW7D 1JR0D 3D6WA 4HCSA 1SBBB 2Q2UA 3NHHA 1WD0A 4Q0FA 5EGTA 3S2HB 4XQNA 5EPJA 2KVMA 3G6JB 3OTOL 2JA8B 3DWQA 3MWYW 2E76C 5C0XJ 3I4OA 1QG7A 3I4NB 1LO5D 4BBRG 4RWSC 2B39A 3F2CA 2B2YC 1ZYRD 3TZUA 1PZJD 2B2TA 2KCMA 2UXCQ 3S14B 1VQ6A 3DEPA 4IUVA 3ERSX 2PNRC 1LT5D 2WFWA 2NZOA 4F87A 3HOWH 1MBYA 2EPBA 4I7ZC 1DOLA 4FXGC 5ELCA 3WOEA 3HOYG 1VCIA 1B44D 3TP5A 1SNOA 1SYDA 2FINB 1MHWC 3MEHA 1YVCA 4YY3L 2JA7G 5FLXL 1C9OA 1VQBA 4GNXA 2JA5B 4OX9L 4A93G 1EOTA 2JJQA 2JQOA 4POGA 1D1IA 5C4HA 2C5CA 3NP8A 4PZ7A 1PXUA 3TN2A 1XPOA 2HCIA 2WKCA 3ZYYX 1QOHA 1Z7TA 5EJWA 5M5XB 3HOXB 4XYQA 2EYOA 1MGSA 2ALYB 4B3MQ 4JYAQ 2VY3A 3T1HQ 3W3AA 1SFOB 3SXHA 4DA2A 3ULJA 4P73A 3HOVB 2ZJPA 3QWNA 4RGMA 1L1OA 1K3RA 4DR1Q 3I4NH 1YNJC 4A4IA 4JI0L 1DM0B 3OHXC 3TBIB 1F2LA 4DR2L 4O1NA 5EKIA 1PVOA 2F0FA 4A3LG 4LWCA 3SK8A 3U50C 5JAVA 5M3MB 2DUDA 3W5OA 1JB7A 4A3MG 1KRSA 2SNMA 3AFPA 2K04A 2OWOA 2B2WA 4RG1A 4DV0Q 4RH6A 1KL9A 2E2JH 1T5EA 1EIGA 4ALPA 1QVFA 2WV6D 4IJLA 3N6RA 3BYYB 3WWVA 1KC8C 4X64L 2JA7H 3J7AV 2ATWA 3KLSX 4OWXB 1MJEA 1MSHA 5A2QE 2OTLA 4N9TA 1ICWA 2K03A 4B3SQ 1HUNA 2MHVA 2UXDL 1RL2A 4JC0A 5D3IB 4EQ5A 2K5DA 1WFQA 3TRZA 4GKJL 2J7ZA 1VQJA 1EY0A 2K5QA 3DUZA 2WAQG 1XNRL 4XT3B 1TKWB 3NWSA 5CORA 4BY1B 1AP0A 1GUNA 2JK8A 2VQEL 4HN7A 1GJXA 3DMUA 1VQPA 1MIUA 4LF8L 4A93B 2MQHA 4PMCA 2HT1A 4QIWE 4DV5L 2YV5A 3WDNA 1IBML 1VQLA 3R8BA 4BBSH 1D5MC 2PZUA 1S40A 3QG1A 4LF9L 1CI3M 3H6MA 4DV7Q 5KEEA 1BXTA 1X3FA 1HNWL 5J3BA 1EYAA 2LFNA 1I5FA 2ZJRA 1CQFA 1EU3A 3ER0A 1L0XB 4OO1G 5M3MH 2AQ3B 4MTKA 4EGVA 3URYA 1YHQA 2F4VL 4XXEA 3CCQA 4JBMA 5JJIA 2KCCA 4LFAL 4JI3Q 4E6IA 5CGKA 2IPKD 4F8MA 5IGDA 1TY0A 2B63H 3I4NG 1I4RA 3KLRA 1TS3A 3Q8DA 3E6ZX 1R9TH 1K8OA 1E24A 4JCVE 2R92H 2OXPA 1Y14B 1EQTA 4YHHL 3RN2A 4A3JG 1HNXQ 3BDCA 4LFAQ 3K59A 3K5MA 1JE4A 3I91A 1U4LA 2AUKA 3CCLA 1O7ZA 1XNQQ 4IURA 2ENBA 3KJOA 1VQ7A 4OX9Q 1N34Q 3ICEA 1DXMA 1VMPA 4ZUIA 3RN5A 2Z6KA 3UE0A 2XVSA 4G4KA 5KNCA 3MEFA 5FO9B 3S9WA 1X32A 3GTMB 1TIID 2XWBB 3HKZG 1HQRD 4X6AH 2NYZD 2JYOA 1WYDA 1K0RA 4WJ4A 1B2TA 4A3FB 1H9JA 4DV5Q 2CKZB 2L9HA 1HUMA 4LF5Q 1EY4A 2VS1A 3QIAA 5IT9E 1LT3D 2TMPA 1QNUA 3G7LA 5KGUA 1UE6A 3SK5A 3CRLC 1RIPA 1EL0A 2L12A 3PIP3 3GTJB 1PTOD 1A63A 3CHBD 1YNNC 3PSIA 4HIMA 1NE3A 1TQOA 4FDBA 2F4VQ 4YCVA 3LNNA 1ESRA 2UXBQ 2ZTEA 3P1HA 4MN3A 1KNEA 1X3GA 2X69A 5LMNL 3FDTA 3FKIG 1Y1VH 1YNJD 4J8QA 5JEAH 2QKIC 1PH6A 3ULLA 5JVG3 1PFBA 2F0TA 3S2HH 4DR3Q 3PV0A 1SJHD 1UE1A 3R93A 1JOKA 3J7ZC 3J80L 3A8KE 5FLXE 2QEJC 2XIWA 4K14A 4LFCL 1VQ4A 3RD4A 3GD7A 4CKBA 4UY8C 1JE5A 4L5QA 5E1FA 2I5MX 3K57A 4OONA 4N9PA 4L8JA 3P20A 3FPUB 4A3IB 4H7BA 3S17H 3LWUA 1I50H 1UAPA 2CVRA 4DAMA 3MTSA 2RHSB 1TR5A 3D8GA 2F0SA 2C35B 5ELDA 3CC7A 4GKKL 2P5ZX 3TDQA 1QCBD 2WACA 3GTGB 2WAQE 5LMUL 2EYHA 2UU9Q 1WOCA 4K5VA 2YU9B 3E9IA 4ZKCB 1LABA 1VQDA 1SEBD 1T5XD 2DNEA 1KLUD 2F0UA 2K32A 3O13A 4RAUC 4F88A 5IGBA 2G9DA 1ML0D 3MFGA 4M1UB 4RFBA 3KDFA 3HOUG 2E2DC 3L9AX 1GHJA 3HS0C 4AH6A 2A69C 4X66Q 2EJFC 4C3HH 3Q0AA 1IBLQ 3VA5A 5FLMG 3RLOA 5GROA 1IYJB 5JEAG 4A76A 4DUYQ 2HIXA 2R7ZH 3S1RH 1CKMA 3F1ZA 3OOCA 1S5FD 4JI3L 3TSSA 2BH2A 4G7ZC 4IFDI 4EVOA 1SYBA 3E0EA 4XDXA 5LMNQ 5DLQE 2EYLA 3NSWA 3L3OC 4IO9A 1G8ZD 1STYA 4IQZA 1O7YA 4GOPC 3D4DA 3I3CA 4JVZA 1ZEQX 3PO3H 2PMZB 1BBUA 2N8NA 2RSNA 1VQOA 1HRJA 2E2IH 3NWTA 3HOZB 2BOSA 3I4MB 1U4RA 3R2TA 3TP6A 4JI8Q 3C1EA 1TWCH 4JI7L 2JEAI 2UU9L 1CK1A 2ICIA 1NY4A 2I46A 4IPGA 4RGTA 4DFAA 4OWWB 4TRDA 2BDOA 2FJ2A 1A0IA 4H0LC 1DD2A 3ONAB 1VF5C 1V8QA 4UDUC 3FEWX 4PMBA 1EY5A 2RQXA 3STBC 3HOZH 3ND8A 1JMCA 5ELFA 1F2YA 2ZXOA 5I9PA 4K8IA 4BY7H 1CSPA 2EY1A 1YJ9A 3I4LA 1HNZQ 4OGQC 1VQCA 4ODGA 2K5NA 4A3KB 3KK7A 3NE5B 4XQQA 3DM1A 2NVYB 5HURA 4R8IA 4MNOA 4B3SL 1Q3LA 1SROA 3C2PA 1AH9A 2O5IC 2E8GA 3ERQA 3QO2A 2R92G 4DV3Q 5JJKA 1XTCD 4DKAC 2JA8G 2ICEC 1Y8PB 1YJWA 4B9XA 4DK1A 3EFXD 4BY7B 3UDGA 1Q12A 4CKEA 3JAMc 4JI2Q 1KRTA 4A3KH 3E3XA 5I6YA 3SK4A 3S17B 1E2VA 1Q46A 3LWEA 3IAYA 1CZWA 4L5RC 1X6OA 1VQ5A 5IWAL 5M3FG 1RODA 1FD7D 4Y52H 1PLFA 2EE1A 3PUXA 3IFTA 4J1MA 1JCKB 1SRUA 1BCPC 4NDXA 5DNFA 2B63G 3M7GA 3I73A 4JBWA 1U4PA 1ASZA 3PIO3 2F0IA 5ELEA 2CH4A 3BDOA 2FFKB 2PI2A 1EYGA 3BJUA 3S1NH 4KI0A 1YJNA 3HGBA 1PZKD 3E9HA 1SAPA 1RF2D 5HGQA 1TXYA 2RKSA 3NBHB 4I65A 1XMQL 1C4QA 3C46A 3OYYA 5FO8B 4KD3A 3FRPB 2QEXA 1D5XC 5IT9L 1LLRD 5M5YH 4GKKQ 1UE7A 2Q8IB 1VQKA 4R4IA 2F0GA 1I6VC 2ZXPA 3D6CA 4KV6A 4GNXB 1OXXK 3MHBA 4GN3B 1CTMA 1IBLL 4JI5L 2NN6G 5I2XA 2F0PA 5ELNA 5IGGA 1SNDA 4BS9A 1WVLA 1O7IA 2KECA 3CCJA 3M3YH 4DGZA 2RHQB 1S3OA 4XQJA 3GTJH 1SE8A 5IGEA 4JI2L 1BUVT 3H09A 3PO3B 3M4OH 4JI5Q 1OXTA 1O7LA 5IWAQ 5E3FA 1JJGA 2QILA 1R4QB 1K3BC 4NXNQ 4G7OC 2IHEA 1Q1EA 4QB4A 2K28A 1KAWA 1JOOA 3SR1A 3GTPH 5FJ8H 1BQQT 2JE6I 1N8RC 3HKZB 1EIHA 1O78A 1S5ED 2B2VC 2A68D 3CD6A 4NPSA 3EBEA 4C3IB 3NTKA 2HDMA 1J5EQ 3GTOH 3HOUB 2SOBA 4QL5A 4HMJA 5KYIA 1VQEA 3H94A 4B3RL 4UAIA 1WTPA 2Q8RE 1PH7A 4CGYB 2E5LQ 3HKSA 4GS3A 3I4MG 3OTOQ 1B50A 1PHJA 2A73B 1PH9A 1EY6A 2QDLA 1E1TA 4AYBB 2H4OA 5K36G 1IL8A 1SNQA 2GA4B 1N32L 1EIYB 4FVMA 3AU7A 2HHHL 1A8VA 1EWHA 1HZBA 3JC66 3HOVH 1K83B 2Z6BA 5GAEC 1LYLA 3Q22A 2I5LX 3CAMA 5FLXc 1IL2A 4DAYA 2EXDA 1EY8A 1JQYD 5JJLA 1DONA 3L2PA 4FXKC 4ID6A 1QJOA 3PUYA 4HMIA 1SYFA 1SR3A 2J0TD 1NSNS 3S2DB 3CC2A 2CQAA 5AJ3Q 4BXXH 4ZK9B 4LF4Q 5KNDA 1LT4D 2RDFA 4JI4Q 2DJFC 4CJ1B 1KXLA 1GUOA 1B53A 2DY7A 2KHIA 5JOBA 1ZXTA 2HHHQ 1F9PA 1ASYA 3F2DA 4FO2A 4JV5Q 3IFDA 1KD1C 4YWKA 3PIPA 5BN4A 1ICFB 1SNPA 1S5CD 3S1MB 1PV4A 3J80i 1STGA 1OXVA 2YTXA 5M5YB 1HNZL 1DZ1A 4LMQD 2QF7A 3NK9A 4DUYL 3GQBA 4KKSA 2F0OA 5I9OA 2XTIA 1JORA 4DNTB 5C0XG 3K8AA 1AW7A 5BN5A 2F0HA 5E4XA 3BZCA 5CV5A 3SGIA 3W2DA 4BA1I 2Q2HA 1ET9A 2E2HH 1MSGA 1LV9A 2B3GA 1EU4A 5C44G 3I4MH 2O4XA 2N3SA 2F0EA 4DK3C 4LF4L 4LUZA 4MTNA 4FF2A 5CV9A 2BA0A 5IP7G 1VQMA 5J1ZA 3NEMA 5CC4A 1Q82C 2ZT9C 4L5SA 1FJGQ 2IL8A 2L5TA 5IYDG 2YYZA 1ENAA 2IWHA 3T51B 4CBVA 3MZ5A 4CHTB 4PNYA 1HQMC 4KHZA 2K50A 2KQ3A 2E2HB 3S15H 3VR5A 3HOXG 4HTHA 1XJVA 1S72A 2E2JB 1EQQA 4K6DA 2BA1A 3CRKC 1XYIA 3T56B 4L6TB 3AFQA 1GUSA 3EIVA 3EJIA 4IUPA 3SE0A 3CCRA 3BS1A 2Z4HA 3TS2A 2PNHA 4GNXC 3VR4A 4LAAA 3MFYA 2EVBA 3K0YA 4DF7A 4A3DG 1CHPD 2JA5G 2B29A 5IP9H 4IFDG 2NTSA 1ZYRC 2A68C 1DOMA 3X3MA 1JWMD 1UE5A 2K75A 3PQIA 3PUZA 4JYAL 4WORA 1UUPA 2HIVA 3JAMi 2K6AA 2WB1B 4QUFA 3NPPA 4ZCKA 3KOJA 2O2LD 3OWEB 5CBAE 2G5DA 3H0GG 1QVGA 2KJXA 4DXFA 2CHBD 5DAUA 2F0KA 4DR6L 2F0LA 3S1NB 2EJMA 1HZ9A 3PF5A 2FHTA 2OQ0A 1LTBD 4C3HB 1L1OC 1LTRD 1PA6A 1JT8A 2B2UA 5IGCA 1W6KA 4GOPB 1K8MA 3I2ZA 2AUJD 2PQAA 1RHPA 5D3DA 4A3EH 4IFDJ 1PFSA 2KHSA 1WCMH 2AQ2B 1U4MA 2NTTA 2Y0SG 2IX1A 3S15B 1KTKA 2JA9A 3A7AB 1C0AA 1D8LA 1XNQL 5DM63 3I90A 5M5XH 3HOXH 1M4VA 5CMDA 3CF5A 2A5HA 1G91A 4YHHQ 1HNXL 1DJRD 4K6LA 2NN6H 1QZGA 4QJFA 4OXPA 3FMCA 1RTNA 4RCNA 1QNKA 4K5XA 1BKBA 5I6WA 3K7AH 3EROA 3RLFA 1F77A 4DR6Q 3EVQA 5EQ0A 3MXNB 3T53B 3CCMA 2LY7A 4FNFA 4ZKBB 4LK1C 5KYLA 3GTMH 5LMNW 1MJCA 3KFUA 2B2UC 4G57A 1Z6HA 3TMEA 2XSCA 2JA5H 1VQAA 3A5ZB 2QCPX 3TP8A 2VL6A 1PRTB 3Q23A 3MC0B 4IUNA 4A3BB 4KJNA 2R92B 2R7DA 5E7NA 5M9OA 1B9NA 5IYBG 3KF8A 5G3LD 3GTQB 4A3MB 1PMRA 1TS2A 3VDYA 5I2YA 1M8AA 2VUMB 2K5WA 1BCPB 4HCEA 3M3YB 3V96A 1EYCA 4FYDA 2VZAA 5K36H 1I4HA 2PZWA 2PQAB 2ZJQA 4A3BH 1TT2A 1CA5A 4LFBL 1F9QA 4A3FH 1SLJA 3K5LA 2UUAL 4OEMB 4LF5L 4CJ0B 1LTSD 2V1CC 2OF1A 4OO1H 3LGJA 4LUOA 5JEAJ 3A56A 1I6HH 2X6LA 3H91A 1CFMA 1CKNB 3AYHB 4IN3A 1GHKA 3S2DH 4ZYSA 1YBYA 3K5OA 4M8AA 2F0VA 4DV6Q 3S16H 1EWCA 1KDCA 2OCEA 4JI1L 3HOZG 5C0XH 1L0YB 1G51A 5C4ZA 1TWHB 1SNCA 5F2DA 4B3ML 4ME3A 2RCFA 4C1NK 1CA6A 2NVQH 3RNUA 4A3EG 1GVPA 4BBRH 1WJJA 4A3KG 2I0QA 3W1BA 2K05A 3C3LA 1FR3A 4JG2A 3VYSA 1CUKA 4FP5D 1FNVA 1DOKA 2H5XA 4DU9A 1Y1VG 3AEVA 2BE5D 4GZYC 1G6ZA 4JW0A 2HD3A 4RMFA 5IGFA 2H1EA 4GKJQ 2K5HA 3KYHC 3J7AF 2XWJB 3V05A 3Q24A 3FP9A 4LNQA 1WTQA 4MIUA 4JOIA 5NUCA 1FGBD 4BXXG 2KCNA 4DV2Q 5IYBH 1KQSA 2PPBC 3HP3A 1IBMQ 5G3LF 1JWSD 1STNA 2MGSA 1EY9A 2Z1CA 3AQQA 2AWNA 1JJCB 2NZHA 3PMFA 4TKOB 4WJ3M 3GTKB 1OXSC 1K9MC 1L1OB 4C56C 3T1YQ 1BF4A 2KEEA 3MXGA 5C3WA 1BCPF 5BR8Q 1XNRQ 1X65A 1KABA 4KKUA 3RR5A 3PIOA 5GQOA 2F3VA 3SEBA 3J81E 4CDDC 2NVQB 2FMMA 1WI5A 1HZAA 3M9BA 1Y8OB 4AQYL 2E74C 3G71A 5I4DA 5ISRA 1F9RA 3ULPA 1YHBA 1M90C 1EY7A 4K5WA 2RCNA 3U9OA 3SVMA 4PZ6A 5LHY1 2VUMH 4CJ2C 2OEOA 1NJIC 1WTXA 4DR7Q 1EFID 4HJ5A 1E7ZA 2M9VA 1IZ6A 1GD7A 3BVZA 5C0XI 3CC4A 2F3IA 1L0WA 1D5ZC 1J8IA 2B2WC 4EX5A 3CCSA 1KIXA 1TWCB 2PO4A 3K7AB 1K73C 2EY2A 1VMCA 5D65A 3D4RA 4BBSB 1T9HA 2HDLA 2Q8TA 3QR8A 4LFBQ 3MA2B 3BG3A 4EQOA 2QW7A 1XPUA 3CP0A 1R4PB 3U4ZA 1PRTD 4A3GG 4KKTA 2KA7A 2F3WA 4Y7NB 4KTAA 1PFMA 4R1JA 2HQLA 4JBKA 3ITPA 4LFCQ 1I3QB 3C1FA 1UWVA 4RA8A 4CDEC 1HR0L 2O5JC 1WCMB 1STAA 2IW3A 5HGTA 3MAQA 5KIXA 1CHQD 3FKIB 2NN6I 1FNUA 4YWLA 2F0QA 1Y8NB 4H13C 1O80A 4ILWA 4OHJA 3GTQH 1HR0Q 4EQNA 2XGTA 1IYUA 2HCCA 5GAHC 2A6ED 1E2WA 5BN3A 1UNSA 1UEAB 1V1PB 3DM3A 4NB3A 3J81i 3G48A 4ZLTF 3QJYA 2RDGA 1KHIA 1WCMG 2N88A 2YU9H 1P16A 5EPLA 1OTCA 4JI6Q 2KBNA 3S14H 4AYBE 4Q5VA 3J7YW 1PH8A 2XNAC 2Y0SE 3GTLB 4CDCC 4K8JA 5M3FH 1X3QA 4K0KQ 3M85A 3VYTA 2ID0A 1CSQA 3BZKA 3GTKH 3OSOA 1Q8IA 1HH2P 3J81c 4OWTB 1H9KA 1K8GA 2NBFA 3NQTA 1SNMA 2QA4A 4B3TL 2M2LA 1I94L 3D31A 1PH5A 2F0NA 3JAML 1QVCA 2WAQB 3NQIA 4LJZC 1EIFA 1BDOA 3I7FA 3GTPB 3DWAA 2MUYA 1D2BA 5JVH3 2BCOA 3FKIH 3GDEA 4MZ9A 2AQ1B 1D7QA 3CMEA 1TWAH 2L1BA 1Q8KA 3PO2H 1EUJA 1A3VA 4AQYQ 1Y1WH 2E5LL 4BY7G 1GM5A 1V9PA 2LKVA 4B9WA 3N52A 1NBWA 3OMCA 5GADC 1VQ8A 1U0LA 2UXBL 4KMUC 5BR8L 3RZDH 4RHRA 3VYRA 5C44B 2UXCL 1S4ZA 1FL0A 3RZOH 4X62Q 1TWHH 1U5KA 2UUAQ 2WIIB 3LX0A 1V1PA 1WD1A 1EFWA 2UUBQ 3DEOA 1Y1WB 3A74A 4ABNA 1VQFA 5IYDH 2LS01 3GO5A 4LF7L 1AN8A 2L55A 3RZDB 2Z8LA 2EXZA 4JI1Q 4X3TA 2RDHA 4O0AA 4AYBG 5J39A 2EIFA 1E22A 1K0SA 3HFZB 1NNXA 2R93H 1CT1D 3VR6A 1YNND 2A6EC 1TWGB 1WTOA 3NTHA 4Y7NH 4DR5L 3WOFA 5IP9G 4IFDH 4NP5A 1I4QA 4JBJA 1EYDA 4JI4L 4TVAB 4HSVA 4N8X1 3OW2A 4LF8Q 4HSPA 1A2UA 4JI8L 1QUQA 1HTPA 2A6HD 3NENA 1FNWA 4OELB 1VQ9A 2LSSA 4B3RQ 1PRTC 4GLAC 4C3IG 3K6OA 1FVIA 1QILA 4C1NI 5M3MG 2UUCQ 1LM0A 1GUWA 4FXDA 3MXUA 1K83H 3S1MH 3E5SA 3H3VC 2F03A 3G4SA 1E2ZA 4P2CB 3RZOB 2EYMA 2NWGA 3I56A 4X64Q 1PTOF 5FJ8G 4DK6C 1SN8A 4QY7A 1C7YA 2D5DA 1PH3A 1RD9D 1A2TA 3JAME 2EY5A 1XPRA 1G2TA 2JP1A 2JN4A 5EPKA 2FXQA 3VYUA 4IPDA 1EOVA 3A8JE 1SYGA 1VQNA 4C2MB 1OO9B 3TZDA 2KEDA 1Q1BA 1X55A 3OPOA 1SDFA 3HOWG 4ME5A 1H95A 1WTHA 1HXYD 1H9SB 2XRQD 3T13A 3D3RA 1ZKOA 1WTVA 2WP8J 1JOQA 2RA4A 1N36Q 4OIKA 4CDFC 2PCFB 2A19A 1IKLA 2OT2A 4A3IG 3A8IE 3PO2B 4DN4M 2R61A 3D4WA 4NW2A 1YITA 3K81C 4A75A 1KLGD 1H9RA 3S16B 4PZ8A 2A1AA 5C4XG 1X54A 1BR9A 4EQPA 4Z9CB 4POFA 4BY1G 4A3JB 3UDFA 3Q6SA 1LTAD 1NR4A 4R9WA 2K14A 2RF4A 2JXMB 3GP7A 1N9WA 5AFWA 4DPGA 1IHZA 3NELA 3H3VH 5ELBA 4P72A 4A3BG 3IRBA 3DXJC 2VXWA 3J80c 2A74C 4XIGS 3QOLA 2NB0A 4A3CG 4LW1A 5COYA 4C3IH 4KJOA 2N55A 1GO3E 3NUCA 5C3EG 1B1ZA 4PV1C 1HJPA 2IY5B 1TVXA 2XRSD 2GVAA 1DYQA 1IXRA 1HCZA 4L5TA 3KF6B 2A69D 2AKWB 2JSOA 1VF7A 4DNRB 3IL8A 4GLVB 4WFN3 4A3GB 1V1QA 2KCTA 3TP7A 4RHSA 2QGQA 1HNWQ 2QDBA 1HZCA 1NTGA 1VDZA 5A2QL 1ENFA 1A3UA 5IY0A 4PG3A 3M4PA 1EEID 4IOCA 1SE3A 1N36L 4WJWA 2EOTA 4R4QA 2I07B 1SMYC 2IX3A 3A7LA 1LACA 2M00A 4K2KA 5M5WH 2C9OA 2J4XA 4FF1A 3MXPA 4DR5Q 4DUZQ 1EWIA 2NVTB 4A3IH 2A8VA 1W2BA 3KBGA 1XMOL 2PMZE 1IYVA 4ZUJA 1ENCA 2L11A 4O2DA 1EZ8A 4R4OA 1FYCA 5C4XH 2WB1E 4GLXA 5IODA 4NXML 1F2MA 1TY2A 5C4JB 1PYBA 2A6HC 1EQRA 2DJGC 4ZAIA 3B6YA 5CBEE 4C3HG 2F0JA 1IKMA 4L63B 4P75A 3F2BA 4P71A 1SXTA 4DAPA 3J81L 1JB3A 3A55A 3OW7A 1Q7YC 4DV4Q 4O42A 3STBD 4DR4Q 1RDPD 2ZTDA 1GXDC 1GOZA 3OIQA 1KAAA 2NUCA 3EQLC 1AEXA 3PO2G 1F9SA 4HJ9A 3RMHA 4A3DH 1MD2D 3PUVA 3HOYB 1QWYA 4RGOS 4S3SA 4YCWA 1S5DD 1PTOH 3HOVG 3UDIA 2R7ZG 2K4KA 2R93G 4UHVA 2JA6G 2GVBA 1A6XA 5KNBA 3P7JA 4NXMQ 2VQEQ 1NR2A 1H9MA 1W6JA 3J81j 1N34L 2NVXB 1YEZA 2CWPA 1RTOA 3U9SA 1GUGA 2K7VA 3PF4A 2AHOB 2Q2IA 4WRDA 2K01A 4IPHA 3TREA 3S1QB 1XTDA 3T1HL 4KY5A 4HEDA 5IT9c 1BBWA 1XWEA 1NMGA 5C4JH 4DV4L 2R3ZA 3KLSA 5T1IA 2B8FA 1I4GA 4X62L 1I6HB 2IJ0A 3S24A 1TWGH 4OIJA 5C3EH 1TWFB 1ET6A 3TEHB 1E1OA 4HAEA 3M4YA 2EY6A 1WTRA 4YWMA 2K5VA 1N33Q 1LUZA 4LF9Q 2X6GA 1BNZA 2VUMG 1SMYD 1PYSB 5EKLA 4TQUS 2D62A 5LL6S 1II3A 1VQGA 1X3PA 2CCZA 3PO3G 4QF4A 2G9HD 1HFGA 4C2MH 1L2FA 1PTOC 2D2CC 1CKOA 1B3AA 3H15A 5IIFA 4BBRB 3HOYH 3OMGA 2EJGC 4DR2Q 1MI2A 4X65Q 1VS0A 5CV7A 2PZTA 2RSOA 4DR4L 3ND9A 3UE1A 2L15A 3TS0A 3J80E 2K1BA 5AJ3L 4UPAA 3VA7A 4U68A 4DXGA 4YIJA 1PRTF 4A93H 4KY6A 5FK9C 5M5WB 3GTLH 1PFNA 4R4TA 1W3SA 5CV8A 3S1RB 1VQIA 2PYKA 3CKIB 2UUCL 3TQYA 1CKNA 2YTVA 1SSOA 4IALA 3PUWA 3T1YL 4DNIA 3S1QH 1YZ6A 3CQZB 2ZM6Q 2IT1A 1SE2A 1LTTD 5C4XB 1N33L 3CU7A 1PH2A 3K58A 1WTWA 5EKKA 4HIOA 4IOAA 2D9UA 1A3TA 4JK1C 1B3QA 3PGZA 1AZPA 1RJTA 1HR0W 3F8TA 4YCUA 2LMCB 5IP7H 2B63B 4LF6L 3OWFA 2RVLA 1X9NA 2KOLA 1AZQA 5LL6X 4XYOA 1J9OA 4A3MH 2PI2E 4P74A 2PW7A 4DUZL 5CYUA 2BH8A 4APVA 3HOWB 4A3GH 5DM73 1KDBA 1Z47A 2SEBD 1KDAA 2EYFA 1BO0A 3FPPA 5H1SE 4DV3L 2EZVA 4C3JG 1J6QA 2UUBL 4RKBA 1B8AA 4DR3L 1IBKQ 1F2ZA 3KDFB 1BBXC 3NTIA 5IYCG 5DEHA 5FO7B 2VB2X 3U58A 3CCUA 1HPCA 2XN9C 4X65L 4UP9A 3IKJA 4J15A 2L0CA 2SNSA 4KK7A 4A3FG 3PCOB 3KUPA 4J6HA 4DV6L 1J5EL 3CQZH 4I7AA 2CW0D 1LTLA 4PMWA 2Z4IA 3H0GH 3EA6A 1A62A 1Q81C 1I50B 1LTGD 2TSSA 1G6PA 2ZTCA 3A54A 5GAGC 5C3XA 1CQVA 3MVVA 2Y0SB 3HEJA 1TS4A 3R2IA 4BBSG 1R9TB 1SE4A 4DR1L 1Q90A 1D6EC 4IUQA 2K33A 1NCVA 2D0PA 3HOUH 2VW9A 2N49A 1UEBA 1KNAA 2V4DA 1XX8A 4IJHA 1YIJA 1PZID 2KUMA 5IOCA 4C3JB 4DR7L 1SYCA 4BA2I 5KRUA 1PYWD 3G6EA 2CQOA 4LF6Q 2D0OA 4K0KL 4GOPA 5J22A 1I4PA 1LTID 2UXDQ 4HJ7A 2AMCB 3HKZE 4GN4B 1TS5A 1CM9A 4UP8A 1HHVA 4JI6L 3I8ZA 1B9MA 1IBKL 4NMZA 1X56A 1OXUA 1HTLD 1Y1WG 3GV3A 3HZXA 3P75A 1PDQA 2DNCA 2I5HA 1P8LA 3KF8B 2PQEA 3KF6A 5E4WC 1STBA 1C48A 4MHEA 5CR3A 3RUZA 1JICA 4DAYB 1XMOQ 1DCZA 4QMGA 4FF4A 4QUCA 3I70A 3M7NA 3UDXA 4PQXA 4XT1B 1I94Q 4U673 1HA6A 3SDZA 4B3TQ 2CH4W 3K7UC 2JA8H 3SHLA 4LF7Q 2VQFQ 3AB9A 3CPFA 3CXCA 2SDFA 1TWFH 1A15A 1G291 1JC7A 3HG9A 3MXNA 2MO0A 2LXKA 2GN5A 3M4OB 5M3FB 1STEA 1HFNA 1RCVD 4QQBX 5LMUQ 3DLLA 1PTOB 2MO1A 2E75C 1S5BD 4DAVA 2EQSA 2MFIA 2BDNA 1BCPD 1QB5D 1X3EA 5C5LA 4N8FA 3E0JA 2MJ8A 4IUUA 4HJAA 3KJPA 1B4OA 4C3JH 1MKHA 2NVXH 4FF3A 4A3LH 4HIKA 3I55A 1N32Q 4KLKA 3VR2A 1G2SA 5ELOA 1EQVA 2N78A 1H9SA 3UI2A 1VQHA 1SYEA 2F0WA 3L7ZC 2JA7B 4H02A 4ZRZA 2NVYH 3HRZC 3VR3A 5C6AA 2NZ1D 4JI0Q 4X3KA 3BVMA 3T16A 2F52A 3CMAA 4JPBW 4V0BA 1JWUD 5T1GA 3H3VI 5C44H 1E0BA 3A5UA 2EYJA 2F4IA 4OO1I 2HUGA 2MP1A 1SFOH 3KBXA 2B8GA 4F7XA 4X3UA 4R4CA 3AMUA 5FOBB 2EYPA 1D1KA 4XTCS 3T4AC 2IHFA 2DGYA 1K8AC 1ILQA 3FHWA 4KHVA 3CPWA 4KHPL 5CV6A 1EZ6A 1ONLA 2KENA 2WINB 4JI7Q 5EAYA 3CCVA 1AE3A 2MPMA 1EEFD 3QB3A 2DY8A 3F2UA 1V1OA 4KHPQ 2JA6B 1C8CA 1XMQQ 4A3CH 2R93B 4QCLA 4HR7B 2IX0A 2CW0C 2K52A 4X66L 2R7ZB 3GTOB 1TU2B 1V43A 1PH1A 3NBIA 4V190 2YTYA 1LT6D 3L0OA 2ASBA 4DV7L 2OQKA 5JPNC 3BYTB 3BZDB 2Z0SA 1B70B 2ZXRA 3FVQA 3CCEA 3K5NA 1QZHA 3DHQA 3U4VA 5IE8A 4BY1H 1B7YB 4NKLA 2R7FA 1QE6A 2CFMA 4KD4A 1YNXA 2PW5A 1SJED 4RCOA 4TSSA 2AWOA 4ZQ3A 2L4NA 4DK0A 4YY3Q 1NUCA 1K28A 4GN5A 1YI2A 3GV6A 1FJGL 3J7A5 1GKHA 1IW7C 4A3JH 2B2VA 1ILPA 1Y69U 3X3NA 2ZM6L 3R3OA 4K2LA 5CV4A 5D14A 3H0GB 5FLMH 2F1MA 1M1KC 3W1GA 4ULLA 1FGUA 2F0MA 2RBMA 2CWAA 2OTJA 2WB1G 1DGSA 5L37A 2ES2A 2FMCA 4QGUA 3GTGH 3RLNA 1AFPA 2VB3X 1Z9FA 4JOIC 4KY7A 3EN2A 3QOJA
chains in the Genus database with same CATH topology
2R6GA 4CKCA 4X3SA 1TWAB 3OIPA 5JPMC 2BE5C 1I4XA 5EBCA 1RKNA 5TSSA 5K5PA 1GUTA 2F0DA 5EBDA 2JEBI 5C3EB 4QIWB 4R8NA 4H44C 5A35A 3DWPA 4OL7A 5C5MA 1NAPA 1U9RA 3BDLA 4B08A 5JJZA 4KN7C 4RKLA 3NXWA 2B2YA 1CZGA 2WKDA 2B2TC 2DN8A 1ESFA 2E2IB 5FKAC 1STHA 4BWGB 4RGNA 1BOSA 2EDGA 4G7HC 3NBHA 1Y1VB 2HQEA 1HA5A 1XXGA 3I72A 4IUTA 3V2TA 4A3EB 2VNUD 3SK6A 4A3DB 4IZ8A 3BVGA 4KN4C 1IW7D 1JR0D 3D6WA 4HCSA 1SBBB 3NHHA 1WD0A 4Q0FA 5EGTA 3S2HB 4XQNA 5EPJA 2KVMA 3G6JB 2JA8B 3DWQA 3MWYW 2E76C 5C0XJ 1QG7A 3I4NB 1LO5D 4RWSC 2B39A 2B2YC 1ZYRD 3TZUA 1PZJD 2B2TA 3S14B 3DEPA 4IUVA 2PNRC 1LT5D 4F87A 1MBYA 2EPBA 4I7ZC 1DOLA 4FXGC 5ELCA 3WOEA 1VCIA 1B44D 3TP5A 1SNOA 1SYDA 2FINB 3MEHA 5FLXL 2JA5B 1EOTA 1D1IA 5C4HA 2C5CA 3NP8A 1PXUA 3TN2A 2HCIA 2WKCA 3ZYYX 1QOHA 1Z7TA 5EJWA 5M5XB 3HOXB 4XYQA 2EYOA 1MGSA 3W3AA 1SFOB 3SXHA 4DA2A 3HOVB 3QWNA 4RGMA 1YNJC 1DM0B 3OHXC 3TBIB 1F2LA 4O1NA 5EKIA 2F0FA 3SK8A 5JAVA 5M3MB 2SNMA 2K04A 2B2WA 4RH6A 1T5EA 1EIGA 2WV6D 3N6RA 3BYYB 3J7AV 3KLSX 1MSHA 5A2QE 4N9TA 1ICWA 2K03A 1HUNA 2MHVA 5D3IB 2K5DA 2J7ZA 2K5QA 1EY0A 3DUZA 4XT3B 1TKWB 3NWSA 5CORA 4BY1B 1AP0A 1GUNA 4HN7A 1GJXA 3DMUA 4A93B 4PMCA 3WDNA 3R8BA 1D5MC 2PZUA 3QG1A 1CI3M 3H6MA 5KEEA 1BXTA 1EYAA 2LFNA 1CQFA 1EU3A 1L0XB 4OO1G 2AQ3B 4EGVA 3URYA 4XXEA 2KCCA 4E6IA 5CGKA 2IPKD 4F8MA 5IGDA 1TY0A 1I4RA 3KLRA 1TS3A 3E6ZX 1K8OA 2OXPA 1EQTA 3BDCA 3K59A 3K5MA 1JE4A 3I91A 1U4LA 2AUKA 1O7ZA 4IURA 2ENBA 1DXMA 1VMPA 4ZUIA 5KNCA 2XVSA 4G4KA 3S9WA 5FO9B 1X32A 3GTMB 1TIID 2XWBB 1HQRD 2NYZD 2JYOA 1B2TA 4A3FB 1H9JA 2L9HA 1HUMA 1EY4A 3QIAA 5IT9E 1LT3D 2TMPA 1QNUA 3G7LA 5KGUA 3SK5A 3CRLC 1EL0A 2L12A 3PIP3 3GTJB 1PTOD 3CHBD 1YNNC 1TQOA 3LNNA 1ESRA 3P1HA 4MN3A 1KNEA 2X69A 3FDTA 1YNJD 4J8QA 5JEAH 2QKIC 5JVG3 1PFBA 2F0TA 3PV0A 1SJHD 3R93A 1JOKA 3J80L 3A8KE 5FLXE 2QEJC 2XIWA 4K14A 3RD4A 3GD7A 4CKBA 5E1FA 3K57A 4N9PA 4L8JA 3P20A 3FPUB 4A3IB 4H7BA 3LWUA 1UAPA 2CVRA 3MTSA 1TR5A 3D8GA 2F0SA 5ELDA 3TDQA 1QCBD 2WACA 3GTGB 2EYHA 4K5VA 2YU9B 4ZKCB 1LABA 1SEBD 1T5XD 2DNEA 1KLUD 2F0UA 2K32A 3O13A 4RAUC 4F88A 5IGBA 2G9DA 1ML0D 3MFGA 4M1UB 4RFBA 2E2DC 3L9AX 1GHJA 3HS0C 2A69C 2EJFC 3Q0AA 3VA5A 5JEAG 3OOCA 1S5FD 3TSSA 4G7ZC 4IFDI 4EVOA 1SYBA 4XDXA 2EYLA 3NSWA 3L3OC 1G8ZD 1STYA 4IQZA 1O7YA 3D4DA 3I3CA 1ZEQX 2PMZB 2RSNA 1HRJA 3NWTA 3HOZB 2BOSA 3I4MB 1U4RA 3R2TA 3TP6A 3C1EA 2JEAI 1CK1A 2ICIA 2I46A 4RGTA 4DFAA 4TRDA 2BDOA 2FJ2A 4H0LC 1DD2A 3ONAB 1VF5C 1V8QA 4UDUC 3FEWX 4PMBA 1EY5A 2RQXA 3ND8A 5ELFA 1F2YA 2ZXOA 5I9PA 4K8IA 2EY1A 3I4LA 4OGQC 4ODGA 4A3KB 3KK7A 3NE5B 4XQQA 3DM1A 2NVYB 5HURA 4R8IA 1Q3LA 3C2PA 2O5IC 3ERQA 3QO2A 1XTCD 2ICEC 1Y8PB 4B9XA 4DK1A 3EFXD 4BY7B 1Q12A 4CKEA 5I6YA 3SK4A 3S17B 1E2VA 3LWEA 3IAYA 1CZWA 1RODA 1FD7D 1PLFA 2EE1A 3PUXA 3IFTA 4J1MA 1JCKB 4NDXA 1BCPC 5DNFA 3M7GA 3I73A 4JBWA 1U4PA 3PIO3 2F0IA 5ELEA 3BDOA 2FFKB 4KI0A 3HGBA 1PZKD 1SAPA 1RF2D 2RKSA 4I65A 1C4QA 3C46A 5FO8B 4KD3A 3FRPB 1D5XC 5IT9L 1LLRD 2Q8IB 2F0GA 1I6VC 2ZXPA 3D6CA 4KV6A 1OXXK 3MHBA 1CTMA 2NN6G 5I2XA 2F0PA 5IGGA 1SNDA 4BS9A 1WVLA 2KECA 4DGZA 4XQJA 5IGEA 1BUVT 3H09A 3PO3B 1OXTA 1O7LA 5E3FA 2QILA 1R4QB 4G7OC 1Q1EA 4QB4A 2K28A 1JOOA 3SR1A 1BQQT 2JE6I 3HKZB 1EIHA 1O78A 1S5ED 2B2VC 2A68D 4C3IB 3NTKA 2HDMA 3HOUB 2SOBA 4HMJA 5KYIA 3H94A 4UAIA 1WTPA 2Q8RE 4CGYB 1B50A 2A73B 1EY6A 4AYBB 2H4OA 5K36G 1IL8A 1SNQA 2GA4B 4FVMA 3AU7A 1EWHA 1K83B 3Q22A 4DAYA 1EY8A 1JQYD 1DONA 4FXKC 4ID6A 1QJOA 3PUYA 4HMIA 1SYFA 2J0TD 1NSNS 3S2DB 2CQAA 4ZK9B 5KNDA 1LT4D 2RDFA 4CJ1B 1GUOA 1B53A 2DY7A 5JOBA 1ZXTA 1F9PA 4FO2A 3IFDA 5BN4A 1SNPA 1S5CD 3S1MB 1STGA 1OXVA 5M5YB 1DZ1A 4LMQD 2QF7A 3NK9A 3GQBA 4KKSA 2F0OA 5I9OA 1JORA 4DNTB 5C0XG 1AW7A 5BN5A 2F0HA 5E4XA 5CV5A 3W2DA 4BA1I 1ET9A 1MSGA 1LV9A 1EU4A 2O4XA 2F0EA 4FF2A 5CV9A 2BA0A 5J1ZA 5CC4A 2ZT9C 2IL8A 2L5TA 2YYZA 1ENAA 2IWHA 3T51B 4CBVA 3MZ5A 4CHTB 4PNYA 1HQMC 4KHZA 2KQ3A 2E2HB 3VR5A 4HTHA 2E2JB 4K6DA 2BA1A 3CRKC 1XYIA 3T56B 4L6TB 1GUSA 3EJIA 4IUPA 3SE0A 3BS1A 2Z4HA 3VR4A 4LAAA 3MFYA 2EVBA 3K0YA 4DF7A 1CHPD 4IFDG 2NTSA 1ZYRC 2A68C 1DOMA 3X3MA 1JWMD 3PUZA 4WORA 1UUPA 2K6AA 2WB1B 4QUFA 3NPPA 2O2LD 3OWEB 5CBAE 2KJXA 4DXFA 2CHBD 5DAUA 2F0KA 2F0LA 3S1NB 2EJMA 2FHTA 1LTBD 4C3HB 1LTRD 2B2UA 5IGCA 1W6KA 1K8MA 2AUJD 1RHPA 5D3DA 4IFDJ 2KHSA 2AQ2B 1U4MA 2NTTA 2IX1A 3S15B 1KTKA 3A7AB 5DM63 3I90A 1M4VA 5CMDA 2A5HA 1G91A 1DJRD 4K6LA 2NN6H 3FMCA 1RTNA 4RCNA 1QNKA 4K5XA 5I6WA 3EROA 3RLFA 1F77A 3EVQA 5EQ0A 3T53B 2LY7A 4FNFA 4ZKBB 4LK1C 5KYLA 2B2UC 4G57A 1Z6HA 3TMEA 2XSCA 2QCPX 3TP8A 1PRTB 3Q23A 3MC0B 4IUNA 4A3BB 4KJNA 2R92B 5M9OA 1B9NA 3KF8A 5G3LD 3GTQB 4A3MB 1TS2A 1PMRA 5I2YA 1M8AA 2VUMB 2K5WA 1BCPB 4HCEA 3M3YB 3V96A 1EYCA 4FYDA 5K36H 1I4HA 2PZWA 1TT2A 1CA5A 1F9QA 3K5LA 4CJ0B 1LTSD 2OF1A 4OO1H 5JEAJ 3A56A 2X6LA 3H91A 1CFMA 4IN3A 1GHKA 4ZYSA 3K5OA 4M8AA 2F0VA 1EWCA 1KDCA 5C0XH 1L0YB 5C4ZA 1TWHB 1SNCA 5F2DA 4C1NK 1CA6A 3C3LA 2K05A 1FR3A 3VYSA 4FP5D 1FNVA 1DOKA 4DU9A 2BE5D 4GZYC 1G6ZA 5IGFA 2H1EA 3J7AF 2XWJB 3V05A 3Q24A 1WTQA 4MIUA 5NUCA 1FGBD 2KCNA 2PPBC 3HP3A 5G3LF 1JWSD 1STNA 2MGSA 1EY9A 2Z1CA 2AWNA 3PMFA 4TKOB 3GTKB 1OXSC 4C56C 1BF4A 2KEEA 3MXGA 5C3WA 1BCPF 4KKUA 1KABA 2F3VA 3SEBA 3J81E 2NVQB 2FMMA 1Y8OB 2E74C 5I4DA 5ISRA 1F9RA 1EY7A 4K5WA 3U9OA 3SVMA 5LHY1 4CJ2C 2OEOA 1WTXA 1EFID 2M9VA 3BVZA 5C0XI 1D5ZC 1J8IA 2B2WC 1TWCB 2PO4A 3K7AB 2EY2A 1VMCA 5D65A 3D4RA 4BBSB 2HDLA 2Q8TA 3MA2B 3BG3A 4EQOA 1R4PB 1PRTD 4KKTA 2KA7A 2F3WA 4Y7NB 4KTAA 1PFMA 3ITPA 1I3QB 3C1FA 4RA8A 2O5JC 1WCMB 1STAA 2IW3A 5HGTA 3MAQA 5KIXA 1CHQD 3FKIB 2NN6I 1FNUA 2F0QA 1Y8NB 4H13C 1O80A 4ILWA 4OHJA 4EQNA 1IYUA 2HCCA 2A6ED 1E2WA 5BN3A 1UNSA 1UEAB 1V1PB 4ZLTF 3QJYA 2RDGA 2N88A 5EPLA 4Q5VA 3J7YW 2XNAC 3GTLB 4K8JA 1X3QA 3M85A 3VYTA 2ID0A 3OSOA 1Q8IA 1H9KA 2NBFA 3NQTA 1SNMA 2M2LA 3D31A 2F0NA 3JAML 2WAQB 3NQIA 4LJZC 1BDOA 3GTPB 3DWAA 2MUYA 1D2BA 5JVH3 2BCOA 2AQ1B 2L1BA 1A3VA 2LKVA 4B9WA 3N52A 3OMCA 4KMUC 4RHRA 3VYRA 5C44B 1S4ZA 2WIIB 3LX0A 1V1PA 1WD1A 3DEOA 1Y1WB 4ABNA 2LS01 3GO5A 1AN8A 2L55A 3RZDB 2Z8LA 2EXZA 4X3TA 2RDHA 5J39A 1CT1D 3VR6A 1YNND 2A6EC 1TWGB 1WTOA 3NTHA 3WOFA 4IFDH 4NP5A 1I4QA 1EYDA 4HSVA 4HSPA 1A2UA 1HTPA 2A6HD 1FNWA 1PRTC 4C3IG 3K6OA 1QILA 4C1NI 1GUWA 4FXDA 3MXUA 3E5SA 3H3VC 2F03A 1E2ZA 4P2CB 3RZOB 2EYMA 2NWGA 1PTOF 2D5DA 1RD9D 1A2TA 3JAME 2EY5A 1G2TA 2JP1A 5EPKA 3VYUA 3A8JE 1SYGA 4C2MB 1OO9B 3TZDA 2KEDA 1Q1BA 3OPOA 1SDFA 4ME5A 1HXYD 1H9SB 2XRQD 3T13A 3D3RA 1ZKOA 1WTVA 2WP8J 1JOQA 2RA4A 4OIKA 2PCFB 1IKLA 2OT2A 3A8IE 3PO2B 4DN4M 2R61A 3D4WA 4NW2A 1KLGD 1H9RA 3S16B 1BR9A 4EQPA 4Z9CB 4A3JB 3Q6SA 1LTAD 1NR4A 4R9WA 2JXMB 3GP7A 5AFWA 1IHZA 5ELBA 3DXJC 2VXWA 2A74C 4XIGS 3QOLA 2NB0A 5COYA 4KJOA 2N55A 3NUCA 1B1ZA 4PV1C 1TVXA 2XRSD 1DYQA 1HCZA 2A69D 2JSOA 1VF7A 4DNRB 3IL8A 4WFN3 4A3GB 3TP7A 4RHSA 2QDBA 1VDZA 5A2QL 1ENFA 1A3UA 1EEID 1SE3A 4WJWA 2EOTA 2I07B 1SMYC 2IX3A 3A7LA 1LACA 2M00A 4K2KA 2C9OA 2J4XA 4FF1A 3MXPA 2NVTB 3KBGA 1IYVA 4ZUJA 1ENCA 2L11A 1EZ8A 1FYCA 5IODA 1F2MA 1TY2A 5C4JB 2A6HC 4ZAIA 5CBEE 4C3HG 2F0JA 1IKMA 4L63B 1SXTA 4DAPA 3J81L 1JB3A 3A55A 3OW7A 4O42A 1RDPD 1GXDC 1GOZA 3OIQA 1KAAA 2NUCA 3EQLC 1AEXA 1F9SA 3RMHA 1MD2D 3PUVA 3HOYB 1QWYA 4RGOS 4S3SA 1S5DD 1PTOH 1A6XA 5KNBA 3P7JA 1NR2A 1H9MA 1W6JA 2NVXB 1RTOA 3U9SA 1GUGA 2K7VA 4WRDA 2K01A 3S1QB 4KY5A 4HEDA 1XWEA 2R3ZA 3KLSA 5T1IA 2B8FA 1I4GA 1I6HB 2IJ0A 4OIJA 1TWFB 1ET6A 4HAEA 3M4YA 2EY6A 1WTRA 2X6GA 1BNZA 1SMYD 5EKLA 4TQUS 2D62A 5LL6S 1II3A 1X3PA 4QF4A 2G9HD 1HFGA 1PTOC 2D2CC 1B3AA 5IIFA 4BBRB 3OMGA 2EJGC 1MI2A 5CV7A 2PZTA 2RSOA 3ND9A 3J80E 2K1BA 3VA7A 4U68A 4DXGA 4YIJA 1PRTF 4KY6A 5FK9C 5M5WB 1PFNA 5CV8A 3S1RB 2PYKA 3CKIB 1SSOA 4IALA 3PUWA 3CQZB 2IT1A 1SE2A 1LTTD 5C4XB 3CU7A 3K58A 1WTWA 5EKKA 2D9UA 1A3TA 4JK1C 1AZPA 1RJTA 2LMCB 2B63B 3OWFA 2RVLA 2KOLA 1AZQA 5LL6X 4XYOA 1J9OA 2PW7A 5CYUA 3HOWB 5DM73 1KDBA 1Z47A 2SEBD 1KDAA 2EYFA 1BO0A 3FPPA 2EZVA 4C3JG 4RKBA 1F2ZA 1BBXC 3NTIA 5DEHA 5FO7B 2VB2X 1HPCA 2XN9C 3IKJA 2L0CA 2SNSA 4KK7A 3KUPA 4J6HA 2CW0D 4PMWA 2Z4IA 3EA6A 1I50B 1LTGD 2TSSA 3A54A 5C3XA 1CQVA 3MVVA 2Y0SB 3HEJA 1TS4A 3R2IA 1R9TB 1SE4A 1Q90A 1D6EC 4IUQA 2K33A 1NCVA 1KNAA 2V4DA 1XX8A 1PZID 2KUMA 5IOCA 4C3JB 1SYCA 4BA2I 5KRUA 1PYWD 5J22A 1I4PA 1LTID 1TS5A 1CM9A 1HHVA 3I8ZA 1B9MA 4NMZA 1OXUA 1HTLD 3GV3A 3HZXA 3P75A 1PDQA 2DNCA 2PQEA 5E4WC 1STBA 1C48A 4MHEA 5CR3A 3RUZA 1JICA 1DCZA 4QMGA 4FF4A 4QUCA 3I70A 3M7NA 4PQXA 4XT1B 4U673 1HA6A 3SDZA 3SHLA 3AB9A 2SDFA 1A15A 1G291 1JC7A 3HG9A 3MXNA 3M4OB 5M3FB 1STEA 1HFNA 1RCVD 1PTOB 2E75C 1S5BD 4DAVA 2BDNA 1BCPD 1QB5D 5C5LA 3E0JA 2MJ8A 4IUUA 1B4OA 4FF3A 3VR2A 1G2SA 1EQVA 1H9SA 3UI2A 1SYEA 2F0WA 3L7ZC 2JA7B 4ZRZA 3HRZC 5C6AA 3VR3A 2NZ1D 4X3KA 3BVMA 3T16A 4V0BA 1JWUD 5T1GA 1E0BA 2EYJA 2F4IA 4OO1I 2HUGA 2MP1A 3KBXA 2B8GA 4F7XA 4X3UA 3AMUA 5FOBB 2EYPA 1D1KA 4XTCS 3T4AC 1ILQA 4KHVA 5CV6A 1EZ6A 1ONLA 2WINB 2MPMA 1EEFD 3QB3A 2DY8A 3F2UA 1V1OA 2JA6B 1C8CA 2R93B 4QCLA 4HR7B 2IX0A 2CW0C 2R7ZB 3GTOB 1TU2B 1V43A 3NBIA 4V190 1LT6D 5JPNC 3BYTB 3BZDB 3FVQA 2ZXRA 3K5NA 3DHQA 4NKLA 1QE6A 4KD4A 2PW5A 1SJED 4RCOA 4TSSA 2AWOA 4ZQ3A 2L4NA 4DK0A 1NUCA 3GV6A 1IW7C 2B2VA 1ILPA 1Y69U 3X3NA 3R3OA 4K2LA 5CV4A 5D14A 3H0GB 2F1MA 4ULLA 2F0MA 2RBMA 2FMCA 1AFPA 2VB3X 4KY7A 3QOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6L A;  3H91 A;  1PFB A;  1X3P A;  2B2U A;  1WVL A;  2EPB A;  2KEC A;  4CJ2 C;  1DOL A;  4X3S A;  3R93 A;  1WTX A;  1HFG A;  2FJ2 A;  1RHP A;  1B3A A;  2NZ1 D;  3ONA B;  2XIW A;  2FIN B;  4X3K A;  1G2T A;  1U4M A;  1DZ1 A;  2JP1 A;  1MI2 A;  4LMQ D;  5EPK A;  5T1G A;  2L11 A;  1J8I A;  2RSO A;  2B2W C;  1E0B A;  1EOT A;  2HUG A;  2MP1 A;  2K1B A;  2L1B A;  3I90 A;  1NCV A;  3KBX A;  4IUQ A;  4X3U A;  2K28 A;  5CMD A;  1CA6 A;  3FPU B;  4ZAI A;  1VMC A;  4U68 A;  5D65 A;  3TZD A;  1G91 A;  1KNA A;  5E4X A;  2KED A;  1XX8 A;  2K05 A;  1SDF A;  1EIH A;  3N52 A;  2HDL A;  1ILQ A;  2KUM A;  5CBE E;  2CVR A;  1PFN A;  3MTS A;  2B2V C;  3DM1 A;  2Q8T A;  1IKM A;  1DOK A;  1MSG A;  1LV9 A;  1RTN A;  3TN2 A;  4R8I A;  2HCI A;  1Q3L A;  1QNK A;  2HDM A;  1WTV A;  1SSO A;  2MPM A;  5EJW A;  1G6Z A;  1S4Z A;  4O42 A;  1NAP A;  1MGS A;  2RA4 A;  2DY8 A;  1CM9 A;  3F2U A;  3QO2 A;  4OIK A;  5EQ0 A;  1HHV A;  2H1E A;  5JJZ A;  1IKL A;  3I8Z A;  4UAI A;  4ZKC B;  1WTP A;  1WD1 A;  2Q8R E;  2IL8 A;  1C8C A;  1PFM A;  1WTW A;  4ZKB B;  3DEO A;  4DN4 M;  4NW2 A;  1EQT A;  1F9S A;  2B2Y A;  2D9U A;  1B50 A;  3GV3 A;  2B2T C;  4RA8 A;  1AZP A;  1WTQ A;  1PDQ A;  1RJT A;  1JE4 A;  4RAU C;  3I91 A;  1U4L A;  1O7Z A;  3LWE A;  1ML0 D;  2B2U C;  5E4W C;  4IUR A;  4MHE A;  1ROD A;  1F2L A;  1JIC A;  2RVL A;  3Q6S A;  1NR4 A;  1VMP A;  1PLF A;  3HP3 A;  2EE1 A;  1O80 A;  2KOL A;  4QUC A;  4R9W A;  4X3T A;  5EKI A;  1J9O A;  1XYI A;  1AZQ A;  1IL8 A;  2MGS A;  4IUP A;  4XT1 B;  5AFW A;  1HA6 A;  1X32 A;  5DNF A;  2HCC A;  1QE6 A;  1U4P A;  2NYZ D;  2JYO A;  2VXW A;  3P7J A;  1WTO A;  4IUT A;  2K04 A;  1NR2 A;  1B2T A;  2B2W A;  2SDF A;  1A15 A;  1RTO A;  5COY A;  2FFK B;  2L4N A;  2L9H A;  1EIG A;  1BO0 A;  4HSV A;  1BF4 A;  1HUM A;  2K01 A;  2KEE A;  2N55 A;  4ZLT F;  1HFN A;  1DOM A;  1TVX A;  4XDX A;  3GV6 A;  1SAP A;  3D6W A;  3SVM A;  2N88 A;  4HCS A;  2B2V A;  1DON A;  3G7L A;  1M8A A;  4HED A;  1WD0 A;  5EPL A;  2BDN A;  1ILP A;  5EPJ A;  2FMM A;  2KVM A;  2R3Z A;  3IL8 A;  5T1I A;  1O7Y A;  4QUF A;  2L12 A;  1EL0 A;  1MSH A;  1BBX C;  2MJ8 A;  5D14 A;  3I3C A;  1ICW A;  4IUU A;  2K03 A;  4ZK9 B;  3MWY W;  5CBA E;  1HUN A;  1CA5 A;  1B4O A;  4OIJ A;  1F9Q A;  1X3Q A;  2RSN A;  1HRJ A;  1QG7 A;  1GUW A;  1F9R A;  4HAE A;  4RWS C;  1ESR A;  4CJ1 B;  1WTR A;  1B53 A;  1U4R A;  2DY7 A;  2J7Z A;  4CJ0 B;  2B2Y C;  4MN3 A;  1KNE A;  1G2S A;  1ZXT A;  2X69 A;  3KUP A;  2B2T A;  2X6G A;  2FHT A;  1BNZ A;  1F9P A;  3FDT A;  4XT3 B;  3DEP A;  2EOT A;  2NWG A;  4IUV A;  5COR A;  1AP0 A;  3IFD A;  2M2L A;  3UI2 A; 
#chains in the Genus database with same CATH topology
 2R6G A;  1YHA A;  2VQF L;  4CKC A;  4X3S A;  1TWA B;  3OIP A;  3D0F A;  3K0X A;  3M4Q A;  4DV2 L;  5JPM C;  2Z6K C;  2BE5 C;  4HJ8 A;  4DV0 L;  1AE2 A;  1I4X A;  5EBC A;  4HID A;  1RKN A;  5TSS A;  4IPC A;  5K5P A;  1JJ2 A;  1GUT A;  2F0D A;  1NMF A;  2KHJ A;  5EBD A;  2Q2T A;  4UP7 A;  2JEB I;  5C3E B;  4AIM A;  4QIW B;  1SMX A;  4R8N A;  4JV5 L;  4H44 C;  2NVT H;  5A35 A;  3DWP A;  4OL7 A;  5C5M A;  3KLW A;  4DV1 Q;  1NAP A;  1Q86 C;  1U9R A;  3BDL A;  3K80 C;  4B08 A;  2Z9H A;  5JJZ A;  4KN7 C;  4RKL A;  3NXW A;  4LUV A;  1PH4 A;  2B2Y A;  1CZG A;  2WKD A;  1E3P A;  3ZJY C;  2MNA A;  2B2T C;  4DV1 L;  2DN8 A;  1ESF A;  2E2I B;  5FKA C;  3BU2 A;  1STH A;  4BWG B;  5IYC H;  4RGN A;  1QUQ B;  4NXN L;  1BOS A;  3CW2 C;  2LXJ A;  2EDG A;  4G7H C;  3NBH A;  1Y1V B;  1I3Q H;  2HQE A;  1HA5 A;  1XXG A;  1BVS A;  3I72 A;  2JA6 H;  4IUT A;  3V2T A;  4A3E B;  2VNU D;  3SK6 A;  5HY6 A;  4A3D B;  3A0J A;  4IZ8 A;  3BVG A;  4KN4 C;  1IW7 D;  1JR0 D;  3D6W A;  4HCS A;  1SBB B;  2Q2U A;  3NHH A;  1WD0 A;  4Q0F A;  5EGT A;  3S2H B;  4XQN A;  5EPJ A;  2KVM A;  3G6J B;  3OTO L;  2JA8 B;  3DWQ A;  3MWY W;  2E76 C;  5C0X J;  3I4O A;  1QG7 A;  3I4N B;  1LO5 D;  4BBR G;  4RWS C;  2B39 A;  3F2C A;  2B2Y C;  1ZYR D;  3TZU A;  1PZJ D;  2B2T A;  2KCM A;  2UXC Q;  3S14 B;  1VQ6 A;  3DEP A;  4IUV A;  3ERS X;  2PNR C;  1LT5 D;  2WFW A;  2NZO A;  4F87 A;  3HOW H;  1MBY A;  2EPB A;  4I7Z C;  1DOL A;  4FXG C;  5ELC A;  3WOE A;  3HOY G;  1VCI A;  1B44 D;  3TP5 A;  1SNO A;  1SYD A;  2FIN B;  1MHW C;  3MEH A;  1YVC A;  4YY3 L;  2JA7 G;  5FLX L;  1C9O A;  1VQB A;  4GNX A;  2JA5 B;  4OX9 L;  4A93 G;  1EOT A;  2JJQ A;  2JQO A;  4POG A;  1D1I A;  5C4H A;  2C5C A;  3NP8 A;  4PZ7 A;  1PXU A;  3TN2 A;  1XPO A;  2HCI A;  2WKC A;  3ZYY X;  1QOH A;  1Z7T A;  5EJW A;  5M5X B;  3HOX B;  4XYQ A;  2EYO A;  1MGS A;  2ALY B;  4B3M Q;  4JYA Q;  2VY3 A;  3T1H Q;  3W3A A;  1SFO B;  3SXH A;  4DA2 A;  3ULJ A;  4P73 A;  3HOV B;  2ZJP A;  3QWN A;  4RGM A;  1L1O A;  1K3R A;  4DR1 Q;  3I4N H;  1YNJ C;  4A4I A;  4JI0 L;  1DM0 B;  3OHX C;  3TBI B;  1F2L A;  4DR2 L;  4O1N A;  5EKI A;  1PVO A;  2F0F A;  4A3L G;  4LWC A;  3SK8 A;  3U50 C;  5JAV A;  5M3M B;  2DUD A;  3W5O A;  1JB7 A;  4A3M G;  1KRS A;  2SNM A;  3AFP A;  2K04 A;  2OWO A;  2B2W A;  4RG1 A;  4DV0 Q;  4RH6 A;  1KL9 A;  2E2J H;  1T5E A;  1EIG A;  4ALP A;  1QVF A;  2WV6 D;  4IJL A;  3N6R A;  3BYY B;  3WWV A;  1KC8 C;  4X64 L;  2JA7 H;  3J7A V;  2ATW A;  3KLS X;  4OWX B;  1MJE A;  1MSH A;  5A2Q E;  2OTL A;  4N9T A;  1ICW A;  2K03 A;  4B3S Q;  1HUN A;  2MHV A;  2UXD L;  1RL2 A;  4JC0 A;  5D3I B;  4EQ5 A;  2K5D A;  1WFQ A;  3TRZ A;  4GKJ L;  2J7Z A;  1VQJ A;  1EY0 A;  2K5Q A;  3DUZ A;  2WAQ G;  1XNR L;  4XT3 B;  1TKW B;  3NWS A;  5COR A;  4BY1 B;  1AP0 A;  1GUN A;  2JK8 A;  2VQE L;  4HN7 A;  1GJX A;  3DMU A;  1VQP A;  1MIU A;  4LF8 L;  4A93 B;  2MQH A;  4PMC A;  2HT1 A;  4QIW E;  4DV5 L;  2YV5 A;  3WDN A;  1IBM L;  1VQL A;  3R8B A;  4BBS H;  1D5M C;  2PZU A;  1S40 A;  3QG1 A;  4LF9 L;  1CI3 M;  3H6M A;  4DV7 Q;  5KEE A;  1BXT A;  1X3F A;  1HNW L;  5J3B A;  1EYA A;  2LFN A;  1I5F A;  2ZJR A;  1CQF A;  1EU3 A;  3ER0 A;  1L0X B;  4OO1 G;  5M3M H;  2AQ3 B;  4MTK A;  4EGV A;  3URY A;  1YHQ A;  2F4V L;  4XXE A;  3CCQ A;  4JBM A;  5JJI A;  2KCC A;  4LFA L;  4JI3 Q;  4E6I A;  5CGK A;  2IPK D;  4F8M A;  5IGD A;  1TY0 A;  2B63 H;  3I4N G;  1I4R A;  3KLR A;  1TS3 A;  3Q8D A;  3E6Z X;  1R9T H;  1K8O A;  1E24 A;  4JCV E;  2R92 H;  2OXP A;  1Y14 B;  1EQT A;  4YHH L;  3RN2 A;  4A3J G;  1HNX Q;  3BDC A;  4LFA Q;  3K59 A;  3K5M A;  1JE4 A;  3I91 A;  1U4L A;  2AUK A;  3CCL A;  1O7Z A;  1XNQ Q;  4IUR A;  2ENB A;  3KJO A;  1VQ7 A;  4OX9 Q;  1N34 Q;  3ICE A;  1DXM A;  1VMP A;  4ZUI A;  3RN5 A;  2Z6K A;  3UE0 A;  2XVS A;  4G4K A;  5KNC A;  3MEF A;  5FO9 B;  3S9W A;  1X32 A;  3GTM B;  1TII D;  2XWB B;  3HKZ G;  1HQR D;  4X6A H;  2NYZ D;  2JYO A;  1WYD A;  1K0R A;  4WJ4 A;  1B2T A;  4A3F B;  1H9J A;  4DV5 Q;  2CKZ B;  2L9H A;  1HUM A;  4LF5 Q;  1EY4 A;  2VS1 A;  3QIA A;  5IT9 E;  1LT3 D;  2TMP A;  1QNU A;  3G7L A;  5KGU A;  1UE6 A;  3SK5 A;  3CRL C;  1RIP A;  1EL0 A;  2L12 A;  3PIP 3;  3GTJ B;  1PTO D;  1A63 A;  3CHB D;  1YNN C;  3PSI A;  4HIM A;  1NE3 A;  1TQO A;  4FDB A;  2F4V Q;  4YCV A;  3LNN A;  1ESR A;  2UXB Q;  2ZTE A;  3P1H A;  4MN3 A;  1KNE A;  1X3G A;  2X69 A;  5LMN L;  3FDT A;  3FKI G;  1Y1V H;  1YNJ D;  4J8Q A;  5JEA H;  2QKI C;  1PH6 A;  3ULL A;  5JVG 3;  1PFB A;  2F0T A;  3S2H H;  4DR3 Q;  3PV0 A;  1SJH D;  1UE1 A;  3R93 A;  1JOK A;  3J7Z C;  3J80 L;  3A8K E;  5FLX E;  2QEJ C;  2XIW A;  4K14 A;  4LFC L;  1VQ4 A;  3RD4 A;  3GD7 A;  4CKB A;  4UY8 C;  1JE5 A;  4L5Q A;  5E1F A;  2I5M X;  3K57 A;  4OON A;  4N9P A;  4L8J A;  3P20 A;  3FPU B;  4A3I B;  4H7B A;  3S17 H;  3LWU A;  1I50 H;  1UAP A;  2CVR A;  4DAM A;  3MTS A;  2RHS B;  1TR5 A;  3D8G A;  2F0S A;  2C35 B;  5ELD A;  3CC7 A;  4GKK L;  2P5Z X;  3TDQ A;  1QCB D;  2WAC A;  3GTG B;  2WAQ E;  5LMU L;  2EYH A;  2UU9 Q;  1WOC A;  4K5V A;  2YU9 B;  3E9I A;  4ZKC B;  1LAB A;  1VQD A;  1SEB D;  1T5X D;  2DNE A;  1KLU D;  2F0U A;  2K32 A;  3O13 A;  4RAU C;  4F88 A;  5IGB A;  2G9D A;  1ML0 D;  3MFG A;  4M1U B;  4RFB A;  3KDF A;  3HOU G;  2E2D C;  3L9A X;  1GHJ A;  3HS0 C;  4AH6 A;  2A69 C;  4X66 Q;  2EJF C;  4C3H H;  3Q0A A;  1IBL Q;  3VA5 A;  5FLM G;  3RLO A;  5GRO A;  1IYJ B;  5JEA G;  4A76 A;  4DUY Q;  2HIX A;  2R7Z H;  3S1R H;  1CKM A;  3F1Z A;  3OOC A;  1S5F D;  4JI3 L;  3TSS A;  2BH2 A;  4G7Z C;  4IFD I;  4EVO A;  1SYB A;  3E0E A;  4XDX A;  5LMN Q;  5DLQ E;  2EYL A;  3NSW A;  3L3O C;  4IO9 A;  1G8Z D;  1STY A;  4IQZ A;  1O7Y A;  4GOP C;  3D4D A;  3I3C A;  4JVZ A;  1ZEQ X;  3PO3 H;  2PMZ B;  1BBU A;  2N8N A;  2RSN A;  1VQO A;  1HRJ A;  2E2I H;  3NWT A;  3HOZ B;  2BOS A;  3I4M B;  1U4R A;  3R2T A;  3TP6 A;  4JI8 Q;  3C1E A;  1TWC H;  4JI7 L;  2JEA I;  2UU9 L;  1CK1 A;  2ICI A;  1NY4 A;  2I46 A;  4IPG A;  4RGT A;  4DFA A;  4OWW B;  4TRD A;  2BDO A;  2FJ2 A;  1A0I A;  4H0L C;  1DD2 A;  3ONA B;  1VF5 C;  1V8Q A;  4UDU C;  3FEW X;  4PMB A;  1EY5 A;  2RQX A;  3STB C;  3HOZ H;  3ND8 A;  1JMC A;  5ELF A;  1F2Y A;  2ZXO A;  5I9P A;  4K8I A;  4BY7 H;  1CSP A;  2EY1 A;  1YJ9 A;  3I4L A;  1HNZ Q;  4OGQ C;  1VQC A;  4ODG A;  2K5N A;  4A3K B;  3KK7 A;  3NE5 B;  4XQQ A;  3DM1 A;  2NVY B;  5HUR A;  4R8I A;  4MNO A;  4B3S L;  1Q3L A;  1SRO A;  3C2P A;  1AH9 A;  2O5I C;  2E8G A;  3ERQ A;  3QO2 A;  2R92 G;  4DV3 Q;  5JJK A;  1XTC D;  4DKA C;  2JA8 G;  2ICE C;  1Y8P B;  1YJW A;  4B9X A;  4DK1 A;  3EFX D;  4BY7 B;  3UDG A;  1Q12 A;  4CKE A;  3JAM c;  4JI2 Q;  1KRT A;  4A3K H;  3E3X A;  5I6Y A;  3SK4 A;  3S17 B;  1E2V A;  1Q46 A;  3LWE A;  3IAY A;  1CZW A;  4L5R C;  1X6O A;  1VQ5 A;  5IWA L;  5M3F G;  1ROD A;  1FD7 D;  4Y52 H;  1PLF A;  2EE1 A;  3PUX A;  3IFT A;  4J1M A;  1JCK B;  1SRU A;  1BCP C;  4NDX A;  5DNF A;  2B63 G;  3M7G A;  3I73 A;  4JBW A;  1U4P A;  1ASZ A;  3PIO 3;  2F0I A;  5ELE A;  2CH4 A;  3BDO A;  2FFK B;  2PI2 A;  1EYG A;  3BJU A;  3S1N H;  4KI0 A;  1YJN A;  3HGB A;  1PZK D;  3E9H A;  1SAP A;  1RF2 D;  5HGQ A;  1TXY A;  2RKS A;  3NBH B;  4I65 A;  1XMQ L;  1C4Q A;  3C46 A;  3OYY A;  5FO8 B;  4KD3 A;  3FRP B;  2QEX A;  1D5X C;  5IT9 L;  1LLR D;  5M5Y H;  4GKK Q;  1UE7 A;  2Q8I B;  1VQK A;  4R4I A;  2F0G A;  1I6V C;  2ZXP A;  3D6C A;  4KV6 A;  4GNX B;  1OXX K;  3MHB A;  4GN3 B;  1CTM A;  1IBL L;  4JI5 L;  2NN6 G;  5I2X A;  2F0P A;  5ELN A;  5IGG A;  1SND A;  4BS9 A;  1WVL A;  1O7I A;  2KEC A;  3CCJ A;  3M3Y H;  4DGZ A;  2RHQ B;  1S3O A;  4XQJ A;  3GTJ H;  1SE8 A;  5IGE A;  4JI2 L;  1BUV T;  3H09 A;  3PO3 B;  3M4O H;  4JI5 Q;  1OXT A;  1O7L A;  5IWA Q;  5E3F A;  1JJG A;  2QIL A;  1R4Q B;  1K3B C;  4NXN Q;  4G7O C;  2IHE A;  1Q1E A;  4QB4 A;  2K28 A;  1KAW A;  1JOO A;  3SR1 A;  3GTP H;  5FJ8 H;  1BQQ T;  2JE6 I;  1N8R C;  3HKZ B;  1EIH A;  1O78 A;  1S5E D;  2B2V C;  2A68 D;  3CD6 A;  4NPS A;  3EBE A;  4C3I B;  3NTK A;  2HDM A;  1J5E Q;  3GTO H;  3HOU B;  2SOB A;  4QL5 A;  4HMJ A;  5KYI A;  1VQE A;  3H94 A;  4B3R L;  4UAI A;  1WTP A;  2Q8R E;  1PH7 A;  4CGY B;  2E5L Q;  3HKS A;  4GS3 A;  3I4M G;  3OTO Q;  1B50 A;  1PHJ A;  2A73 B;  1PH9 A;  1EY6 A;  2QDL A;  1E1T A;  4AYB B;  2H4O A;  5K36 G;  1IL8 A;  1SNQ A;  2GA4 B;  1N32 L;  1EIY B;  4FVM A;  3AU7 A;  2HHH L;  1A8V A;  1EWH A;  1HZB A;  3JC6 6;  3HOV H;  1K83 B;  2Z6B A;  5GAE C;  1LYL A;  3Q22 A;  2I5L X;  3CAM A;  5FLX c;  1IL2 A;  4DAY A;  2EXD A;  1EY8 A;  1JQY D;  5JJL A;  1DON A;  3L2P A;  4FXK C;  4ID6 A;  1QJO A;  3PUY A;  4HMI A;  1SYF A;  1SR3 A;  2J0T D;  1NSN S;  3S2D B;  3CC2 A;  2CQA A;  5AJ3 Q;  4BXX H;  4ZK9 B;  4LF4 Q;  5KND A;  1LT4 D;  2RDF A;  4JI4 Q;  2DJF C;  4CJ1 B;  1KXL A;  1GUO A;  1B53 A;  2DY7 A;  2KHI A;  5JOB A;  1ZXT A;  2HHH Q;  1F9P A;  1ASY A;  3F2D A;  4FO2 A;  4JV5 Q;  3IFD A;  1KD1 C;  4YWK A;  3PIP A;  5BN4 A;  1ICF B;  1SNP A;  1S5C D;  3S1M B;  1PV4 A;  3J80 i;  1STG A;  1OXV A;  2YTX A;  5M5Y B;  1HNZ L;  1DZ1 A;  4LMQ D;  2QF7 A;  3NK9 A;  4DUY L;  3GQB A;  4KKS A;  2F0O A;  5I9O A;  2XTI A;  1JOR A;  4DNT B;  5C0X G;  3K8A A;  1AW7 A;  5BN5 A;  2F0H A;  5E4X A;  3BZC A;  5CV5 A;  3SGI A;  3W2D A;  4BA1 I;  2Q2H A;  1ET9 A;  2E2H H;  1MSG A;  1LV9 A;  2B3G A;  1EU4 A;  5C44 G;  3I4M H;  2O4X A;  2N3S A;  2F0E A;  4DK3 C;  4LF4 L;  4LUZ A;  4MTN A;  4FF2 A;  5CV9 A;  2BA0 A;  5IP7 G;  1VQM A;  5J1Z A;  3NEM A;  5CC4 A;  1Q82 C;  2ZT9 C;  4L5S A;  1FJG Q;  2IL8 A;  2L5T A;  5IYD G;  2YYZ A;  1ENA A;  2IWH A;  3T51 B;  4CBV A;  3MZ5 A;  4CHT B;  4PNY A;  1HQM C;  4KHZ A;  2K50 A;  2KQ3 A;  2E2H B;  3S15 H;  3VR5 A;  3HOX G;  4HTH A;  1XJV A;  1S72 A;  2E2J B;  1EQQ A;  4K6D A;  2BA1 A;  3CRK C;  1XYI A;  3T56 B;  4L6T B;  3AFQ A;  1GUS A;  3EIV A;  3EJI A;  4IUP A;  3SE0 A;  3CCR A;  3BS1 A;  2Z4H A;  3TS2 A;  2PNH A;  4GNX C;  3VR4 A;  4LAA A;  3MFY A;  2EVB A;  3K0Y A;  4DF7 A;  4A3D G;  1CHP D;  2JA5 G;  2B29 A;  5IP9 H;  4IFD G;  2NTS A;  1ZYR C;  2A68 C;  1DOM A;  3X3M A;  1JWM D;  1UE5 A;  2K75 A;  3PQI A;  3PUZ A;  4JYA L;  4WOR A;  1UUP A;  2HIV A;  3JAM i;  2K6A A;  2WB1 B;  4QUF A;  3NPP A;  4ZCK A;  3KOJ A;  2O2L D;  3OWE B;  5CBA E;  2G5D A;  3H0G G;  1QVG A;  2KJX A;  4DXF A;  2CHB D;  5DAU A;  2F0K A;  4DR6 L;  2F0L A;  3S1N B;  2EJM A;  1HZ9 A;  3PF5 A;  2FHT A;  2OQ0 A;  1LTB D;  4C3H B;  1L1O C;  1LTR D;  1PA6 A;  1JT8 A;  2B2U A;  5IGC A;  1W6K A;  4GOP B;  1K8M A;  3I2Z A;  2AUJ D;  2PQA A;  1RHP A;  5D3D A;  4A3E H;  4IFD J;  1PFS A;  2KHS A;  1WCM H;  2AQ2 B;  1U4M A;  2NTT A;  2Y0S G;  2IX1 A;  3S15 B;  1KTK A;  2JA9 A;  3A7A B;  1C0A A;  1D8L A;  1XNQ L;  5DM6 3;  3I90 A;  5M5X H;  3HOX H;  1M4V A;  5CMD A;  3CF5 A;  2A5H A;  1G91 A;  4YHH Q;  1HNX L;  1DJR D;  4K6L A;  2NN6 H;  1QZG A;  4QJF A;  4OXP A;  3FMC A;  1RTN A;  4RCN A;  1QNK A;  4K5X A;  1BKB A;  5I6W A;  3K7A H;  3ERO A;  3RLF A;  1F77 A;  4DR6 Q;  3EVQ A;  5EQ0 A;  3MXN B;  3T53 B;  3CCM A;  2LY7 A;  4FNF A;  4ZKB B;  4LK1 C;  5KYL A;  3GTM H;  5LMN W;  1MJC A;  3KFU A;  2B2U C;  4G57 A;  1Z6H A;  3TME A;  2XSC A;  2JA5 H;  1VQA A;  3A5Z B;  2QCP X;  3TP8 A;  2VL6 A;  1PRT B;  3Q23 A;  3MC0 B;  4IUN A;  4A3B B;  4KJN A;  2R92 B;  2R7D A;  5E7N A;  5M9O A;  1B9N A;  5IYB G;  3KF8 A;  5G3L D;  3GTQ B;  4A3M B;  1PMR A;  1TS2 A;  3VDY A;  5I2Y A;  1M8A A;  2VUM B;  2K5W A;  1BCP B;  4HCE A;  3M3Y B;  3V96 A;  1EYC A;  4FYD A;  2VZA A;  5K36 H;  1I4H A;  2PZW A;  2PQA B;  2ZJQ A;  4A3B H;  1TT2 A;  1CA5 A;  4LFB L;  1F9Q A;  4A3F H;  1SLJ A;  3K5L A;  2UUA L;  4OEM B;  4LF5 L;  4CJ0 B;  1LTS D;  2V1C C;  2OF1 A;  4OO1 H;  3LGJ A;  4LUO A;  5JEA J;  3A56 A;  1I6H H;  2X6L A;  3H91 A;  1CFM A;  1CKN B;  3AYH B;  4IN3 A;  1GHK A;  3S2D H;  4ZYS A;  1YBY A;  3K5O A;  4M8A A;  2F0V A;  4DV6 Q;  3S16 H;  1EWC A;  1KDC A;  2OCE A;  4JI1 L;  3HOZ G;  5C0X H;  1L0Y B;  1G51 A;  5C4Z A;  1TWH B;  1SNC A;  5F2D A;  4B3M L;  4ME3 A;  2RCF A;  4C1N K;  1CA6 A;  2NVQ H;  3RNU A;  4A3E G;  1GVP A;  4BBR H;  1WJJ A;  4A3K G;  2I0Q A;  3W1B A;  2K05 A;  3C3L A;  1FR3 A;  4JG2 A;  3VYS A;  1CUK A;  4FP5 D;  1FNV A;  1DOK A;  2H5X A;  4DU9 A;  1Y1V G;  3AEV A;  2BE5 D;  4GZY C;  1G6Z A;  4JW0 A;  2HD3 A;  4RMF A;  5IGF A;  2H1E A;  4GKJ Q;  2K5H A;  3KYH C;  3J7A F;  2XWJ B;  3V05 A;  3Q24 A;  3FP9 A;  4LNQ A;  1WTQ A;  4MIU A;  4JOI A;  5NUC A;  1FGB D;  4BXX G;  2KCN A;  4DV2 Q;  5IYB H;  1KQS A;  2PPB C;  3HP3 A;  1IBM Q;  5G3L F;  1JWS D;  1STN A;  2MGS A;  1EY9 A;  2Z1C A;  3AQQ A;  2AWN A;  1JJC B;  2NZH A;  3PMF A;  4TKO B;  4WJ3 M;  3GTK B;  1OXS C;  1K9M C;  1L1O B;  4C56 C;  3T1Y Q;  1BF4 A;  2KEE A;  3MXG A;  5C3W A;  1BCP F;  5BR8 Q;  1XNR Q;  1X65 A;  1KAB A;  4KKU A;  3RR5 A;  3PIO A;  5GQO A;  2F3V A;  3SEB A;  3J81 E;  4CDD C;  2NVQ B;  2FMM A;  1WI5 A;  1HZA A;  3M9B A;  1Y8O B;  4AQY L;  2E74 C;  3G71 A;  5I4D A;  5ISR A;  1F9R A;  3ULP A;  1YHB A;  1M90 C;  1EY7 A;  4K5W A;  2RCN A;  3U9O A;  3SVM A;  4PZ6 A;  5LHY 1;  2VUM H;  4CJ2 C;  2OEO A;  1NJI C;  1WTX A;  4DR7 Q;  1EFI D;  4HJ5 A;  1E7Z A;  2M9V A;  1IZ6 A;  1GD7 A;  3BVZ A;  5C0X I;  3CC4 A;  2F3I A;  1L0W A;  1D5Z C;  1J8I A;  2B2W C;  4EX5 A;  3CCS A;  1KIX A;  1TWC B;  2PO4 A;  3K7A B;  1K73 C;  2EY2 A;  1VMC A;  5D65 A;  3D4R A;  4BBS B;  1T9H A;  2HDL A;  2Q8T A;  3QR8 A;  4LFB Q;  3MA2 B;  3BG3 A;  4EQO A;  2QW7 A;  1XPU A;  3CP0 A;  1R4P B;  3U4Z A;  1PRT D;  4A3G G;  4KKT A;  2KA7 A;  2F3W A;  4Y7N B;  4KTA A;  1PFM A;  4R1J A;  2HQL A;  4JBK A;  3ITP A;  4LFC Q;  1I3Q B;  3C1F A;  1UWV A;  4RA8 A;  4CDE C;  1HR0 L;  2O5J C;  1WCM B;  1STA A;  2IW3 A;  5HGT A;  3MAQ A;  5KIX A;  1CHQ D;  3FKI B;  2NN6 I;  1FNU A;  4YWL A;  2F0Q A;  1Y8N B;  4H13 C;  1O80 A;  4ILW A;  4OHJ A;  3GTQ H;  1HR0 Q;  4EQN A;  2XGT A;  1IYU A;  2HCC A;  5GAH C;  2A6E D;  1E2W A;  5BN3 A;  1UNS A;  1UEA B;  1V1P B;  3DM3 A;  4NB3 A;  3J81 i;  3G48 A;  4ZLT F;  3QJY A;  2RDG A;  1KHI A;  1WCM G;  2N88 A;  2YU9 H;  1P16 A;  5EPL A;  1OTC A;  4JI6 Q;  2KBN A;  3S14 H;  4AYB E;  4Q5V A;  3J7Y W;  1PH8 A;  2XNA C;  2Y0S E;  3GTL B;  4CDC C;  4K8J A;  5M3F H;  1X3Q A;  4K0K Q;  3M85 A;  3VYT A;  2ID0 A;  1CSQ A;  3BZK A;  3GTK H;  3OSO A;  1Q8I A;  1HH2 P;  3J81 c;  4OWT B;  1H9K A;  1K8G A;  2NBF A;  3NQT A;  1SNM A;  2QA4 A;  4B3T L;  2M2L A;  1I94 L;  3D31 A;  1PH5 A;  2F0N A;  3JAM L;  1QVC A;  2WAQ B;  3NQI A;  4LJZ C;  1EIF A;  1BDO A;  3I7F A;  3GTP B;  3DWA A;  2MUY A;  1D2B A;  5JVH 3;  2BCO A;  3FKI H;  3GDE A;  4MZ9 A;  2AQ1 B;  1D7Q A;  3CME A;  1TWA H;  2L1B A;  1Q8K A;  3PO2 H;  1EUJ A;  1A3V A;  4AQY Q;  1Y1W H;  2E5L L;  4BY7 G;  1GM5 A;  1V9P A;  2LKV A;  4B9W A;  3N52 A;  1NBW A;  3OMC A;  5GAD C;  1VQ8 A;  1U0L A;  2UXB L;  4KMU C;  5BR8 L;  3RZD H;  4RHR A;  3VYR A;  5C44 B;  2UXC L;  1S4Z A;  1FL0 A;  3RZO H;  4X62 Q;  1TWH H;  1U5K A;  2UUA Q;  2WII B;  3LX0 A;  1V1P A;  1WD1 A;  1EFW A;  2UUB Q;  3DEO A;  1Y1W B;  3A74 A;  4ABN A;  1VQF A;  5IYD H;  2LS0 1;  3GO5 A;  4LF7 L;  1AN8 A;  2L55 A;  3RZD B;  2Z8L A;  2EXZ A;  4JI1 Q;  4X3T A;  2RDH A;  4O0A A;  4AYB G;  5J39 A;  2EIF A;  1E22 A;  1K0S A;  3HFZ B;  1NNX A;  2R93 H;  1CT1 D;  3VR6 A;  1YNN D;  2A6E C;  1TWG B;  1WTO A;  3NTH A;  4Y7N H;  4DR5 L;  3WOF A;  5IP9 G;  4IFD H;  4NP5 A;  1I4Q A;  4JBJ A;  1EYD A;  4JI4 L;  4TVA B;  4HSV A;  4N8X 1;  3OW2 A;  4LF8 Q;  4HSP A;  1A2U A;  4JI8 L;  1QUQ A;  1HTP A;  2A6H D;  3NEN A;  1FNW A;  4OEL B;  1VQ9 A;  2LSS A;  4B3R Q;  1PRT C;  4GLA C;  4C3I G;  3K6O A;  1FVI A;  1QIL A;  4C1N I;  5M3M G;  2UUC Q;  1LM0 A;  1GUW A;  4FXD A;  3MXU A;  1K83 H;  3S1M H;  3E5S A;  3H3V C;  2F03 A;  3G4S A;  1E2Z A;  4P2C B;  3RZO B;  2EYM A;  2NWG A;  3I56 A;  4X64 Q;  1PTO F;  5FJ8 G;  4DK6 C;  1SN8 A;  4QY7 A;  1C7Y A;  2D5D A;  1PH3 A;  1RD9 D;  1A2T A;  3JAM E;  2EY5 A;  1XPR A;  1G2T A;  2JP1 A;  2JN4 A;  5EPK A;  2FXQ A;  3VYU A;  4IPD A;  1EOV A;  3A8J E;  1SYG A;  1VQN A;  4C2M B;  1OO9 B;  3TZD A;  2KED A;  1Q1B A;  1X55 A;  3OPO A;  1SDF A;  3HOW G;  4ME5 A;  1H95 A;  1WTH A;  1HXY D;  1H9S B;  2XRQ D;  3T13 A;  3D3R A;  1ZKO A;  1WTV A;  2WP8 J;  1JOQ A;  2RA4 A;  1N36 Q;  4OIK A;  4CDF C;  2PCF B;  2A19 A;  1IKL A;  2OT2 A;  4A3I G;  3A8I E;  3PO2 B;  4DN4 M;  2R61 A;  3D4W A;  4NW2 A;  1YIT A;  3K81 C;  4A75 A;  1KLG D;  1H9R A;  3S16 B;  4PZ8 A;  2A1A A;  5C4X G;  1X54 A;  1BR9 A;  4EQP A;  4Z9C B;  4POF A;  4BY1 G;  4A3J B;  3UDF A;  3Q6S A;  1LTA D;  1NR4 A;  4R9W A;  2K14 A;  2RF4 A;  2JXM B;  3GP7 A;  1N9W A;  5AFW A;  4DPG A;  1IHZ A;  3NEL A;  3H3V H;  5ELB A;  4P72 A;  4A3B G;  3IRB A;  3DXJ C;  2VXW A;  3J80 c;  2A74 C;  4XIG S;  3QOL A;  2NB0 A;  4A3C G;  4LW1 A;  5COY A;  4C3I H;  4KJO A;  2N55 A;  1GO3 E;  3NUC A;  5C3E G;  1B1Z A;  4PV1 C;  1HJP A;  2IY5 B;  1TVX A;  2XRS D;  2GVA A;  1DYQ A;  1IXR A;  1HCZ A;  4L5T A;  3KF6 B;  2A69 D;  2AKW B;  2JSO A;  1VF7 A;  4DNR B;  3IL8 A;  4GLV B;  4WFN 3;  4A3G B;  1V1Q A;  2KCT A;  3TP7 A;  4RHS A;  2QGQ A;  1HNW Q;  2QDB A;  1HZC A;  1NTG A;  1VDZ A;  5A2Q L;  1ENF A;  1A3U A;  5IY0 A;  4PG3 A;  3M4P A;  1EEI D;  4IOC A;  1SE3 A;  1N36 L;  4WJW A;  2EOT A;  4R4Q A;  2I07 B;  1SMY C;  2IX3 A;  3A7L A;  1LAC A;  2M00 A;  4K2K A;  5M5W H;  2C9O A;  2J4X A;  4FF1 A;  3MXP A;  4DR5 Q;  4DUZ Q;  1EWI A;  2NVT B;  4A3I H;  2A8V A;  1W2B A;  3KBG A;  1XMO L;  2PMZ E;  1IYV A;  4ZUJ A;  1ENC A;  2L11 A;  4O2D A;  1EZ8 A;  4R4O A;  1FYC A;  5C4X H;  2WB1 E;  4GLX A;  5IOD A;  4NXM L;  1F2M A;  1TY2 A;  5C4J B;  1PYB A;  2A6H C;  1EQR A;  2DJG C;  4ZAI A;  3B6Y A;  5CBE E;  4C3H G;  2F0J A;  1IKM A;  4L63 B;  4P75 A;  3F2B A;  4P71 A;  1SXT A;  4DAP A;  3J81 L;  1JB3 A;  3A55 A;  3OW7 A;  1Q7Y C;  4DV4 Q;  4O42 A;  3STB D;  4DR4 Q;  1RDP D;  2ZTD A;  1GXD C;  1GOZ A;  3OIQ A;  1KAA A;  2NUC A;  3EQL C;  1AEX A;  3PO2 G;  1F9S A;  4HJ9 A;  3RMH A;  4A3D H;  1MD2 D;  3PUV A;  3HOY B;  1QWY A;  4RGO S;  4S3S A;  4YCW A;  1S5D D;  1PTO H;  3HOV G;  3UDI A;  2R7Z G;  2K4K A;  2R93 G;  4UHV A;  2JA6 G;  2GVB A;  1A6X A;  5KNB A;  3P7J A;  4NXM Q;  2VQE Q;  1NR2 A;  1H9M A;  1W6J A;  3J81 j;  1N34 L;  2NVX B;  1YEZ A;  2CWP A;  1RTO A;  3U9S A;  1GUG A;  2K7V A;  3PF4 A;  2AHO B;  2Q2I A;  4WRD A;  2K01 A;  4IPH A;  3TRE A;  3S1Q B;  1XTD A;  3T1H L;  4KY5 A;  4HED A;  5IT9 c;  1BBW A;  1XWE A;  1NMG A;  5C4J H;  4DV4 L;  2R3Z A;  3KLS A;  5T1I A;  2B8F A;  1I4G A;  4X62 L;  1I6H B;  2IJ0 A;  3S24 A;  1TWG H;  4OIJ A;  5C3E H;  1TWF B;  1ET6 A;  3TEH B;  1E1O A;  4HAE A;  3M4Y A;  2EY6 A;  1WTR A;  4YWM A;  2K5V A;  1N33 Q;  1LUZ A;  4LF9 Q;  2X6G A;  1BNZ A;  2VUM G;  1SMY D;  1PYS B;  5EKL A;  4TQU S;  2D62 A;  5LL6 S;  1II3 A;  1VQG A;  1X3P A;  2CCZ A;  3PO3 G;  4QF4 A;  2G9H D;  1HFG A;  4C2M H;  1L2F A;  1PTO C;  2D2C C;  1CKO A;  1B3A A;  3H15 A;  5IIF A;  4BBR B;  3HOY H;  3OMG A;  2EJG C;  4DR2 Q;  1MI2 A;  4X65 Q;  1VS0 A;  5CV7 A;  2PZT A;  2RSO A;  4DR4 L;  3ND9 A;  3UE1 A;  2L15 A;  3TS0 A;  3J80 E;  2K1B A;  5AJ3 L;  4UPA A;  3VA7 A;  4U68 A;  4DXG A;  4YIJ A;  1PRT F;  4A93 H;  4KY6 A;  5FK9 C;  5M5W B;  3GTL H;  1PFN A;  4R4T A;  1W3S A;  5CV8 A;  3S1R B;  1VQI A;  2PYK A;  3CKI B;  2UUC L;  3TQY A;  1CKN A;  2YTV A;  1SSO A;  4IAL A;  3PUW A;  3T1Y L;  4DNI A;  3S1Q H;  1YZ6 A;  3CQZ B;  2ZM6 Q;  2IT1 A;  1SE2 A;  1LTT D;  5C4X B;  1N33 L;  3CU7 A;  1PH2 A;  3K58 A;  1WTW A;  5EKK A;  4HIO A;  4IOA A;  2D9U A;  1A3T A;  4JK1 C;  1B3Q A;  3PGZ A;  1AZP A;  1RJT A;  1HR0 W;  3F8T A;  4YCU A;  2LMC B;  5IP7 H;  2B63 B;  4LF6 L;  3OWF A;  2RVL A;  1X9N A;  2KOL A;  1AZQ A;  5LL6 X;  4XYO A;  1J9O A;  4A3M H;  2PI2 E;  4P74 A;  2PW7 A;  4DUZ L;  5CYU A;  2BH8 A;  4APV A;  3HOW B;  4A3G H;  5DM7 3;  1KDB A;  1Z47 A;  2SEB D;  1KDA A;  2EYF A;  1BO0 A;  3FPP A;  5H1S E;  4DV3 L;  2EZV A;  4C3J G;  1J6Q A;  2UUB L;  4RKB A;  1B8A A;  4DR3 L;  1IBK Q;  1F2Z A;  3KDF B;  1BBX C;  3NTI A;  5IYC G;  5DEH A;  5FO7 B;  2VB2 X;  3U58 A;  3CCU A;  1HPC A;  2XN9 C;  4X65 L;  4UP9 A;  3IKJ A;  4J15 A;  2L0C A;  2SNS A;  4KK7 A;  4A3F G;  3PCO B;  3KUP A;  4J6H A;  4DV6 L;  1J5E L;  3CQZ H;  4I7A A;  2CW0 D;  1LTL A;  4PMW A;  2Z4I A;  3H0G H;  3EA6 A;  1A62 A;  1Q81 C;  1I50 B;  1LTG D;  2TSS A;  1G6P A;  2ZTC A;  3A54 A;  5GAG C;  5C3X A;  1CQV A;  3MVV A;  2Y0S B;  3HEJ A;  1TS4 A;  3R2I A;  4BBS G;  1R9T B;  1SE4 A;  4DR1 L;  1Q90 A;  1D6E C;  4IUQ A;  2K33 A;  1NCV A;  2D0P A;  3HOU H;  2VW9 A;  2N49 A;  1UEB A;  1KNA A;  2V4D A;  1XX8 A;  4IJH A;  1YIJ A;  1PZI D;  2KUM A;  5IOC A;  4C3J B;  4DR7 L;  1SYC A;  4BA2 I;  5KRU A;  1PYW D;  3G6E A;  2CQO A;  4LF6 Q;  2D0O A;  4K0K L;  4GOP A;  5J22 A;  1I4P A;  1LTI D;  2UXD Q;  4HJ7 A;  2AMC B;  3HKZ E;  4GN4 B;  1TS5 A;  1CM9 A;  4UP8 A;  1HHV A;  4JI6 L;  3I8Z A;  1B9M A;  1IBK L;  4NMZ A;  1X56 A;  1OXU A;  1HTL D;  1Y1W G;  3GV3 A;  3HZX A;  3P75 A;  1PDQ A;  2DNC A;  2I5H A;  1P8L A;  3KF8 B;  2PQE A;  3KF6 A;  5E4W C;  1STB A;  1C48 A;  4MHE A;  5CR3 A;  3RUZ A;  1JIC A;  4DAY B;  1XMO Q;  1DCZ A;  4QMG A;  4FF4 A;  4QUC A;  3I70 A;  3M7N A;  3UDX A;  4PQX A;  4XT1 B;  1I94 Q;  4U67 3;  1HA6 A;  3SDZ A;  4B3T Q;  2CH4 W;  3K7U C;  2JA8 H;  3SHL A;  4LF7 Q;  2VQF Q;  3AB9 A;  3CPF A;  3CXC A;  2SDF A;  1TWF H;  1A15 A;  1G29 1;  1JC7 A;  3HG9 A;  3MXN A;  2MO0 A;  2LXK A;  2GN5 A;  3M4O B;  5M3F B;  1STE A;  1HFN A;  1RCV D;  4QQB X;  5LMU Q;  3DLL A;  1PTO B;  2MO1 A;  2E75 C;  1S5B D;  4DAV A;  2EQS A;  2MFI A;  2BDN A;  1BCP D;  1QB5 D;  1X3E A;  5C5L A;  4N8F A;  3E0J A;  2MJ8 A;  4IUU A;  4HJA A;  3KJP A;  1B4O A;  4C3J H;  1MKH A;  2NVX H;  4FF3 A;  4A3L H;  4HIK A;  3I55 A;  1N32 Q;  4KLK A;  3VR2 A;  1G2S A;  5ELO A;  1EQV A;  2N78 A;  1H9S A;  3UI2 A;  1VQH A;  1SYE A;  2F0W A;  3L7Z C;  2JA7 B;  4H02 A;  4ZRZ A;  2NVY H;  3HRZ C;  3VR3 A;  5C6A A;  2NZ1 D;  4JI0 Q;  4X3K A;  3BVM A;  3T16 A;  2F52 A;  3CMA A;  4JPB W;  4V0B A;  1JWU D;  5T1G A;  3H3V I;  5C44 H;  1E0B A;  3A5U A;  2EYJ A;  2F4I A;  4OO1 I;  2HUG A;  2MP1 A;  1SFO H;  3KBX A;  2B8G A;  4F7X A;  4X3U A;  4R4C A;  3AMU A;  5FOB B;  2EYP A;  1D1K A;  4XTC S;  3T4A C;  2IHF A;  2DGY A;  1K8A C;  1ILQ A;  3FHW A;  4KHV A;  3CPW A;  4KHP L;  5CV6 A;  1EZ6 A;  1ONL A;  2KEN A;  2WIN B;  4JI7 Q;  5EAY A;  3CCV A;  1AE3 A;  2MPM A;  1EEF D;  3QB3 A;  2DY8 A;  3F2U A;  1V1O A;  4KHP Q;  2JA6 B;  1C8C A;  1XMQ Q;  4A3C H;  2R93 B;  4QCL A;  4HR7 B;  2IX0 A;  2CW0 C;  2K52 A;  4X66 L;  2R7Z B;  3GTO B;  1TU2 B;  1V43 A;  1PH1 A;  3NBI A;  4V19 0;  2YTY A;  1LT6 D;  3L0O A;  2ASB A;  4DV7 L;  2OQK A;  5JPN C;  3BYT B;  3BZD B;  2Z0S A;  1B70 B;  2ZXR A;  3FVQ A;  3CCE A;  3K5N A;  1QZH A;  3DHQ A;  3U4V A;  5IE8 A;  4BY1 H;  1B7Y B;  4NKL A;  2R7F A;  1QE6 A;  2CFM A;  4KD4 A;  1YNX A;  2PW5 A;  1SJE D;  4RCO A;  4TSS A;  2AWO A;  4ZQ3 A;  2L4N A;  4DK0 A;  4YY3 Q;  1NUC A;  1K28 A;  4GN5 A;  1YI2 A;  3GV6 A;  1FJG L;  3J7A 5;  1GKH A;  1IW7 C;  4A3J H;  2B2V A;  1ILP A;  1Y69 U;  3X3N A;  2ZM6 L;  3R3O A;  4K2L A;  5CV4 A;  5D14 A;  3H0G B;  5FLM H;  2F1M A;  1M1K C;  3W1G A;  4ULL A;  1FGU A;  2F0M A;  2RBM A;  2CWA A;  2OTJ A;  2WB1 G;  1DGS A;  5L37 A;  2ES2 A;  2FMC A;  4QGU A;  3GTG H;  3RLN A;  1AFP A;  2VB3 X;  1Z9F A;  4JOI C;  4KY7 A;  3EN2 A;  3QOJ A; 
#chains in the Genus database with same CATH homology
 2R6G A;  4CKC A;  4X3S A;  1TWA B;  3OIP A;  5JPM C;  2BE5 C;  1I4X A;  5EBC A;  1RKN A;  5TSS A;  5K5P A;  1GUT A;  2F0D A;  5EBD A;  2JEB I;  5C3E B;  4QIW B;  4R8N A;  4H44 C;  5A35 A;  3DWP A;  4OL7 A;  5C5M A;  1NAP A;  1U9R A;  3BDL A;  4B08 A;  5JJZ A;  4KN7 C;  4RKL A;  3NXW A;  2B2Y A;  1CZG A;  2WKD A;  2B2T C;  2DN8 A;  1ESF A;  2E2I B;  5FKA C;  1STH A;  4BWG B;  4RGN A;  1BOS A;  2EDG A;  4G7H C;  3NBH A;  1Y1V B;  2HQE A;  1HA5 A;  1XXG A;  3I72 A;  4IUT A;  3V2T A;  4A3E B;  2VNU D;  3SK6 A;  4A3D B;  4IZ8 A;  3BVG A;  4KN4 C;  1IW7 D;  1JR0 D;  3D6W A;  4HCS A;  1SBB B;  3NHH A;  1WD0 A;  4Q0F A;  5EGT A;  3S2H B;  4XQN A;  5EPJ A;  2KVM A;  3G6J B;  2JA8 B;  3DWQ A;  3MWY W;  2E76 C;  5C0X J;  1QG7 A;  3I4N B;  1LO5 D;  4RWS C;  2B39 A;  2B2Y C;  1ZYR D;  3TZU A;  1PZJ D;  2B2T A;  3S14 B;  3DEP A;  4IUV A;  2PNR C;  1LT5 D;  4F87 A;  1MBY A;  2EPB A;  4I7Z C;  1DOL A;  4FXG C;  5ELC A;  3WOE A;  1VCI A;  1B44 D;  3TP5 A;  1SNO A;  1SYD A;  2FIN B;  3MEH A;  5FLX L;  2JA5 B;  1EOT A;  1D1I A;  5C4H A;  2C5C A;  3NP8 A;  1PXU A;  3TN2 A;  2HCI A;  2WKC A;  3ZYY X;  1QOH A;  1Z7T A;  5EJW A;  5M5X B;  3HOX B;  4XYQ A;  2EYO A;  1MGS A;  3W3A A;  1SFO B;  3SXH A;  4DA2 A;  3HOV B;  3QWN A;  4RGM A;  1YNJ C;  1DM0 B;  3OHX C;  3TBI B;  1F2L A;  4O1N A;  5EKI A;  2F0F A;  3SK8 A;  5JAV A;  5M3M B;  2SNM A;  2K04 A;  2B2W A;  4RH6 A;  1T5E A;  1EIG A;  2WV6 D;  3N6R A;  3BYY B;  3J7A V;  3KLS X;  1MSH A;  5A2Q E;  4N9T A;  1ICW A;  2K03 A;  1HUN A;  2MHV A;  5D3I B;  2K5D A;  2J7Z A;  2K5Q A;  1EY0 A;  3DUZ A;  4XT3 B;  1TKW B;  3NWS A;  5COR A;  4BY1 B;  1AP0 A;  1GUN A;  4HN7 A;  1GJX A;  3DMU A;  4A93 B;  4PMC A;  3WDN A;  3R8B A;  1D5M C;  2PZU A;  3QG1 A;  1CI3 M;  3H6M A;  5KEE A;  1BXT A;  1EYA A;  2LFN A;  1CQF A;  1EU3 A;  1L0X B;  4OO1 G;  2AQ3 B;  4EGV A;  3URY A;  4XXE A;  2KCC A;  4E6I A;  5CGK A;  2IPK D;  4F8M A;  5IGD A;  1TY0 A;  1I4R A;  3KLR A;  1TS3 A;  3E6Z X;  1K8O A;  2OXP A;  1EQT A;  3BDC A;  3K59 A;  3K5M A;  1JE4 A;  3I91 A;  1U4L A;  2AUK A;  1O7Z A;  4IUR A;  2ENB A;  1DXM A;  1VMP A;  4ZUI A;  5KNC A;  2XVS A;  4G4K A;  3S9W A;  5FO9 B;  1X32 A;  3GTM B;  1TII D;  2XWB B;  1HQR D;  2NYZ D;  2JYO A;  1B2T A;  4A3F B;  1H9J A;  2L9H A;  1HUM A;  1EY4 A;  3QIA A;  5IT9 E;  1LT3 D;  2TMP A;  1QNU A;  3G7L A;  5KGU A;  3SK5 A;  3CRL C;  1EL0 A;  2L12 A;  3PIP 3;  3GTJ B;  1PTO D;  3CHB D;  1YNN C;  1TQO A;  3LNN A;  1ESR A;  3P1H A;  4MN3 A;  1KNE A;  2X69 A;  3FDT A;  1YNJ D;  4J8Q A;  5JEA H;  2QKI C;  5JVG 3;  1PFB A;  2F0T A;  3PV0 A;  1SJH D;  3R93 A;  1JOK A;  3J80 L;  3A8K E;  5FLX E;  2QEJ C;  2XIW A;  4K14 A;  3RD4 A;  3GD7 A;  4CKB A;  5E1F A;  3K57 A;  4N9P A;  4L8J A;  3P20 A;  3FPU B;  4A3I B;  4H7B A;  3LWU A;  1UAP A;  2CVR A;  3MTS A;  1TR5 A;  3D8G A;  2F0S A;  5ELD A;  3TDQ A;  1QCB D;  2WAC A;  3GTG B;  2EYH A;  4K5V A;  2YU9 B;  4ZKC B;  1LAB A;  1SEB D;  1T5X D;  2DNE A;  1KLU D;  2F0U A;  2K32 A;  3O13 A;  4RAU C;  4F88 A;  5IGB A;  2G9D A;  1ML0 D;  3MFG A;  4M1U B;  4RFB A;  2E2D C;  3L9A X;  1GHJ A;  3HS0 C;  2A69 C;  2EJF C;  3Q0A A;  3VA5 A;  5JEA G;  3OOC A;  1S5F D;  3TSS A;  4G7Z C;  4IFD I;  4EVO A;  1SYB A;  4XDX A;  2EYL A;  3NSW A;  3L3O C;  1G8Z D;  1STY A;  4IQZ A;  1O7Y A;  3D4D A;  3I3C A;  1ZEQ X;  2PMZ B;  2RSN A;  1HRJ A;  3NWT A;  3HOZ B;  2BOS A;  3I4M B;  1U4R A;  3R2T A;  3TP6 A;  3C1E A;  2JEA I;  1CK1 A;  2ICI A;  2I46 A;  4RGT A;  4DFA A;  4TRD A;  2BDO A;  2FJ2 A;  4H0L C;  1DD2 A;  3ONA B;  1VF5 C;  1V8Q A;  4UDU C;  3FEW X;  4PMB A;  1EY5 A;  2RQX A;  3ND8 A;  5ELF A;  1F2Y A;  2ZXO A;  5I9P A;  4K8I A;  2EY1 A;  3I4L A;  4OGQ C;  4ODG A;  4A3K B;  3KK7 A;  3NE5 B;  4XQQ A;  3DM1 A;  2NVY B;  5HUR A;  4R8I A;  1Q3L A;  3C2P A;  2O5I C;  3ERQ A;  3QO2 A;  1XTC D;  2ICE C;  1Y8P B;  4B9X A;  4DK1 A;  3EFX D;  4BY7 B;  1Q12 A;  4CKE A;  5I6Y A;  3SK4 A;  3S17 B;  1E2V A;  3LWE A;  3IAY A;  1CZW A;  1ROD A;  1FD7 D;  1PLF A;  2EE1 A;  3PUX A;  3IFT A;  4J1M A;  1JCK B;  4NDX A;  1BCP C;  5DNF A;  3M7G A;  3I73 A;  4JBW A;  1U4P A;  3PIO 3;  2F0I A;  5ELE A;  3BDO A;  2FFK B;  4KI0 A;  3HGB A;  1PZK D;  1SAP A;  1RF2 D;  2RKS A;  4I65 A;  1C4Q A;  3C46 A;  5FO8 B;  4KD3 A;  3FRP B;  1D5X C;  5IT9 L;  1LLR D;  2Q8I B;  2F0G A;  1I6V C;  2ZXP A;  3D6C A;  4KV6 A;  1OXX K;  3MHB A;  1CTM A;  2NN6 G;  5I2X A;  2F0P A;  5IGG A;  1SND A;  4BS9 A;  1WVL A;  2KEC A;  4DGZ A;  4XQJ A;  5IGE A;  1BUV T;  3H09 A;  3PO3 B;  1OXT A;  1O7L A;  5E3F A;  2QIL A;  1R4Q B;  4G7O C;  1Q1E A;  4QB4 A;  2K28 A;  1JOO A;  3SR1 A;  1BQQ T;  2JE6 I;  3HKZ B;  1EIH A;  1O78 A;  1S5E D;  2B2V C;  2A68 D;  4C3I B;  3NTK A;  2HDM A;  3HOU B;  2SOB A;  4HMJ A;  5KYI A;  3H94 A;  4UAI A;  1WTP A;  2Q8R E;  4CGY B;  1B50 A;  2A73 B;  1EY6 A;  4AYB B;  2H4O A;  5K36 G;  1IL8 A;  1SNQ A;  2GA4 B;  4FVM A;  3AU7 A;  1EWH A;  1K83 B;  3Q22 A;  4DAY A;  1EY8 A;  1JQY D;  1DON A;  4FXK C;  4ID6 A;  1QJO A;  3PUY A;  4HMI A;  1SYF A;  2J0T D;  1NSN S;  3S2D B;  2CQA A;  4ZK9 B;  5KND A;  1LT4 D;  2RDF A;  4CJ1 B;  1GUO A;  1B53 A;  2DY7 A;  5JOB A;  1ZXT A;  1F9P A;  4FO2 A;  3IFD A;  5BN4 A;  1SNP A;  1S5C D;  3S1M B;  1STG A;  1OXV A;  5M5Y B;  1DZ1 A;  4LMQ D;  2QF7 A;  3NK9 A;  3GQB A;  4KKS A;  2F0O A;  5I9O A;  1JOR A;  4DNT B;  5C0X G;  1AW7 A;  5BN5 A;  2F0H A;  5E4X A;  5CV5 A;  3W2D A;  4BA1 I;  1ET9 A;  1MSG A;  1LV9 A;  1EU4 A;  2O4X A;  2F0E A;  4FF2 A;  5CV9 A;  2BA0 A;  5J1Z A;  5CC4 A;  2ZT9 C;  2IL8 A;  2L5T A;  2YYZ A;  1ENA A;  2IWH A;  3T51 B;  4CBV A;  3MZ5 A;  4CHT B;  4PNY A;  1HQM C;  4KHZ A;  2KQ3 A;  2E2H B;  3VR5 A;  4HTH A;  2E2J B;  4K6D A;  2BA1 A;  3CRK C;  1XYI A;  3T56 B;  4L6T B;  1GUS A;  3EJI A;  4IUP A;  3SE0 A;  3BS1 A;  2Z4H A;  3VR4 A;  4LAA A;  3MFY A;  2EVB A;  3K0Y A;  4DF7 A;  1CHP D;  4IFD G;  2NTS A;  1ZYR C;  2A68 C;  1DOM A;  3X3M A;  1JWM D;  3PUZ A;  4WOR A;  1UUP A;  2K6A A;  2WB1 B;  4QUF A;  3NPP A;  2O2L D;  3OWE B;  5CBA E;  2KJX A;  4DXF A;  2CHB D;  5DAU A;  2F0K A;  2F0L A;  3S1N B;  2EJM A;  2FHT A;  1LTB D;  4C3H B;  1LTR D;  2B2U A;  5IGC A;  1W6K A;  1K8M A;  2AUJ D;  1RHP A;  5D3D A;  4IFD J;  2KHS A;  2AQ2 B;  1U4M A;  2NTT A;  2IX1 A;  3S15 B;  1KTK A;  3A7A B;  5DM6 3;  3I90 A;  1M4V A;  5CMD A;  2A5H A;  1G91 A;  1DJR D;  4K6L A;  2NN6 H;  3FMC A;  1RTN A;  4RCN A;  1QNK A;  4K5X A;  5I6W A;  3ERO A;  3RLF A;  1F77 A;  3EVQ A;  5EQ0 A;  3T53 B;  2LY7 A;  4FNF A;  4ZKB B;  4LK1 C;  5KYL A;  2B2U C;  4G57 A;  1Z6H A;  3TME A;  2XSC A;  2QCP X;  3TP8 A;  1PRT B;  3Q23 A;  3MC0 B;  4IUN A;  4A3B B;  4KJN A;  2R92 B;  5M9O A;  1B9N A;  3KF8 A;  5G3L D;  3GTQ B;  4A3M B;  1TS2 A;  1PMR A;  5I2Y A;  1M8A A;  2VUM B;  2K5W A;  1BCP B;  4HCE A;  3M3Y B;  3V96 A;  1EYC A;  4FYD A;  5K36 H;  1I4H A;  2PZW A;  1TT2 A;  1CA5 A;  1F9Q A;  3K5L A;  4CJ0 B;  1LTS D;  2OF1 A;  4OO1 H;  5JEA J;  3A56 A;  2X6L A;  3H91 A;  1CFM A;  4IN3 A;  1GHK A;  4ZYS A;  3K5O A;  4M8A A;  2F0V A;  1EWC A;  1KDC A;  5C0X H;  1L0Y B;  5C4Z A;  1TWH B;  1SNC A;  5F2D A;  4C1N K;  1CA6 A;  3C3L A;  2K05 A;  1FR3 A;  3VYS A;  4FP5 D;  1FNV A;  1DOK A;  4DU9 A;  2BE5 D;  4GZY C;  1G6Z A;  5IGF A;  2H1E A;  3J7A F;  2XWJ B;  3V05 A;  3Q24 A;  1WTQ A;  4MIU A;  5NUC A;  1FGB D;  2KCN A;  2PPB C;  3HP3 A;  5G3L F;  1JWS D;  1STN A;  2MGS A;  1EY9 A;  2Z1C A;  2AWN A;  3PMF A;  4TKO B;  3GTK B;  1OXS C;  4C56 C;  1BF4 A;  2KEE A;  3MXG A;  5C3W A;  1BCP F;  4KKU A;  1KAB A;  2F3V A;  3SEB A;  3J81 E;  2NVQ B;  2FMM A;  1Y8O B;  2E74 C;  5I4D A;  5ISR A;  1F9R A;  1EY7 A;  4K5W A;  3U9O A;  3SVM A;  5LHY 1;  4CJ2 C;  2OEO A;  1WTX A;  1EFI D;  2M9V A;  3BVZ A;  5C0X I;  1D5Z C;  1J8I A;  2B2W C;  1TWC B;  2PO4 A;  3K7A B;  2EY2 A;  1VMC A;  5D65 A;  3D4R A;  4BBS B;  2HDL A;  2Q8T A;  3MA2 B;  3BG3 A;  4EQO A;  1R4P B;  1PRT D;  4KKT A;  2KA7 A;  2F3W A;  4Y7N B;  4KTA A;  1PFM A;  3ITP A;  1I3Q B;  3C1F A;  4RA8 A;  2O5J C;  1WCM B;  1STA A;  2IW3 A;  5HGT A;  3MAQ A;  5KIX A;  1CHQ D;  3FKI B;  2NN6 I;  1FNU A;  2F0Q A;  1Y8N B;  4H13 C;  1O80 A;  4ILW A;  4OHJ A;  4EQN A;  1IYU A;  2HCC A;  2A6E D;  1E2W A;  5BN3 A;  1UNS A;  1UEA B;  1V1P B;  4ZLT F;  3QJY A;  2RDG A;  2N88 A;  5EPL A;  4Q5V A;  3J7Y W;  2XNA C;  3GTL B;  4K8J A;  1X3Q A;  3M85 A;  3VYT A;  2ID0 A;  3OSO A;  1Q8I A;  1H9K A;  2NBF A;  3NQT A;  1SNM A;  2M2L A;  3D31 A;  2F0N A;  3JAM L;  2WAQ B;  3NQI A;  4LJZ C;  1BDO A;  3GTP B;  3DWA A;  2MUY A;  1D2B A;  5JVH 3;  2BCO A;  2AQ1 B;  2L1B A;  1A3V A;  2LKV A;  4B9W A;  3N52 A;  3OMC A;  4KMU C;  4RHR A;  3VYR A;  5C44 B;  1S4Z A;  2WII B;  3LX0 A;  1V1P A;  1WD1 A;  3DEO A;  1Y1W B;  4ABN A;  2LS0 1;  3GO5 A;  1AN8 A;  2L55 A;  3RZD B;  2Z8L A;  2EXZ A;  4X3T A;  2RDH A;  5J39 A;  1CT1 D;  3VR6 A;  1YNN D;  2A6E C;  1TWG B;  1WTO A;  3NTH A;  3WOF A;  4IFD H;  4NP5 A;  1I4Q A;  1EYD A;  4HSV A;  4HSP A;  1A2U A;  1HTP A;  2A6H D;  1FNW A;  1PRT C;  4C3I G;  3K6O A;  1QIL A;  4C1N I;  1GUW A;  4FXD A;  3MXU A;  3E5S A;  3H3V C;  2F03 A;  1E2Z A;  4P2C B;  3RZO B;  2EYM A;  2NWG A;  1PTO F;  2D5D A;  1RD9 D;  1A2T A;  3JAM E;  2EY5 A;  1G2T A;  2JP1 A;  5EPK A;  3VYU A;  3A8J E;  1SYG A;  4C2M B;  1OO9 B;  3TZD A;  2KED A;  1Q1B A;  3OPO A;  1SDF A;  4ME5 A;  1HXY D;  1H9S B;  2XRQ D;  3T13 A;  3D3R A;  1ZKO A;  1WTV A;  2WP8 J;  1JOQ A;  2RA4 A;  4OIK A;  2PCF B;  1IKL A;  2OT2 A;  3A8I E;  3PO2 B;  4DN4 M;  2R61 A;  3D4W A;  4NW2 A;  1KLG D;  1H9R A;  3S16 B;  1BR9 A;  4EQP A;  4Z9C B;  4A3J B;  3Q6S A;  1LTA D;  1NR4 A;  4R9W A;  2JXM B;  3GP7 A;  5AFW A;  1IHZ A;  5ELB A;  3DXJ C;  2VXW A;  2A74 C;  4XIG S;  3QOL A;  2NB0 A;  5COY A;  4KJO A;  2N55 A;  3NUC A;  1B1Z A;  4PV1 C;  1TVX A;  2XRS D;  1DYQ A;  1HCZ A;  2A69 D;  2JSO A;  1VF7 A;  4DNR B;  3IL8 A;  4WFN 3;  4A3G B;  3TP7 A;  4RHS A;  2QDB A;  1VDZ A;  5A2Q L;  1ENF A;  1A3U A;  1EEI D;  1SE3 A;  4WJW A;  2EOT A;  2I07 B;  1SMY C;  2IX3 A;  3A7L A;  1LAC A;  2M00 A;  4K2K A;  2C9O A;  2J4X A;  4FF1 A;  3MXP A;  2NVT B;  3KBG A;  1IYV A;  4ZUJ A;  1ENC A;  2L11 A;  1EZ8 A;  1FYC A;  5IOD A;  1F2M A;  1TY2 A;  5C4J B;  2A6H C;  4ZAI A;  5CBE E;  4C3H G;  2F0J A;  1IKM A;  4L63 B;  1SXT A;  4DAP A;  3J81 L;  1JB3 A;  3A55 A;  3OW7 A;  4O42 A;  1RDP D;  1GXD C;  1GOZ A;  3OIQ A;  1KAA A;  2NUC A;  3EQL C;  1AEX A;  1F9S A;  3RMH A;  1MD2 D;  3PUV A;  3HOY B;  1QWY A;  4RGO S;  4S3S A;  1S5D D;  1PTO H;  1A6X A;  5KNB A;  3P7J A;  1NR2 A;  1H9M A;  1W6J A;  2NVX B;  1RTO A;  3U9S A;  1GUG A;  2K7V A;  4WRD A;  2K01 A;  3S1Q B;  4KY5 A;  4HED A;  1XWE A;  2R3Z A;  3KLS A;  5T1I A;  2B8F A;  1I4G A;  1I6H B;  2IJ0 A;  4OIJ A;  1TWF B;  1ET6 A;  4HAE A;  3M4Y A;  2EY6 A;  1WTR A;  2X6G A;  1BNZ A;  1SMY D;  5EKL A;  4TQU S;  2D62 A;  5LL6 S;  1II3 A;  1X3P A;  4QF4 A;  2G9H D;  1HFG A;  1PTO C;  2D2C C;  1B3A A;  5IIF A;  4BBR B;  3OMG A;  2EJG C;  1MI2 A;  5CV7 A;  2PZT A;  2RSO A;  3ND9 A;  3J80 E;  2K1B A;  3VA7 A;  4U68 A;  4DXG A;  4YIJ A;  1PRT F;  4KY6 A;  5FK9 C;  5M5W B;  1PFN A;  5CV8 A;  3S1R B;  2PYK A;  3CKI B;  1SSO A;  4IAL A;  3PUW A;  3CQZ B;  2IT1 A;  1SE2 A;  1LTT D;  5C4X B;  3CU7 A;  3K58 A;  1WTW A;  5EKK A;  2D9U A;  1A3T A;  4JK1 C;  1AZP A;  1RJT A;  2LMC B;  2B63 B;  3OWF A;  2RVL A;  2KOL A;  1AZQ A;  5LL6 X;  4XYO A;  1J9O A;  2PW7 A;  5CYU A;  3HOW B;  5DM7 3;  1KDB A;  1Z47 A;  2SEB D;  1KDA A;  2EYF A;  1BO0 A;  3FPP A;  2EZV A;  4C3J G;  4RKB A;  1F2Z A;  1BBX C;  3NTI A;  5DEH A;  5FO7 B;  2VB2 X;  1HPC A;  2XN9 C;  3IKJ A;  2L0C A;  2SNS A;  4KK7 A;  3KUP A;  4J6H A;  2CW0 D;  4PMW A;  2Z4I A;  3EA6 A;  1I50 B;  1LTG D;  2TSS A;  3A54 A;  5C3X A;  1CQV A;  3MVV A;  2Y0S B;  3HEJ A;  1TS4 A;  3R2I A;  1R9T B;  1SE4 A;  1Q90 A;  1D6E C;  4IUQ A;  2K33 A;  1NCV A;  1KNA A;  2V4D A;  1XX8 A;  1PZI D;  2KUM A;  5IOC A;  4C3J B;  1SYC A;  4BA2 I;  5KRU A;  1PYW D;  5J22 A;  1I4P A;  1LTI D;  1TS5 A;  1CM9 A;  1HHV A;  3I8Z A;  1B9M A;  4NMZ A;  1OXU A;  1HTL D;  3GV3 A;  3HZX A;  3P75 A;  1PDQ A;  2DNC A;  2PQE A;  5E4W C;  1STB A;  1C48 A;  4MHE A;  5CR3 A;  3RUZ A;  1JIC A;  1DCZ A;  4QMG A;  4FF4 A;  4QUC A;  3I70 A;  3M7N A;  4PQX A;  4XT1 B;  4U67 3;  1HA6 A;  3SDZ A;  3SHL A;  3AB9 A;  2SDF A;  1A15 A;  1G29 1;  1JC7 A;  3HG9 A;  3MXN A;  3M4O B;  5M3F B;  1STE A;  1HFN A;  1RCV D;  1PTO B;  2E75 C;  1S5B D;  4DAV A;  2BDN A;  1BCP D;  1QB5 D;  5C5L A;  3E0J A;  2MJ8 A;  4IUU A;  1B4O A;  4FF3 A;  3VR2 A;  1G2S A;  1EQV A;  1H9S A;  3UI2 A;  1SYE A;  2F0W A;  3L7Z C;  2JA7 B;  4ZRZ A;  3HRZ C;  5C6A A;  3VR3 A;  2NZ1 D;  4X3K A;  3BVM A;  3T16 A;  4V0B A;  1JWU D;  5T1G A;  1E0B A;  2EYJ A;  2F4I A;  4OO1 I;  2HUG A;  2MP1 A;  3KBX A;  2B8G A;  4F7X A;  4X3U A;  3AMU A;  5FOB B;  2EYP A;  1D1K A;  4XTC S;  3T4A C;  1ILQ A;  4KHV A;  5CV6 A;  1EZ6 A;  1ONL A;  2WIN B;  2MPM A;  1EEF D;  3QB3 A;  2DY8 A;  3F2U A;  1V1O A;  2JA6 B;  1C8C A;  2R93 B;  4QCL A;  4HR7 B;  2IX0 A;  2CW0 C;  2R7Z B;  3GTO B;  1TU2 B;  1V43 A;  3NBI A;  4V19 0;  1LT6 D;  5JPN C;  3BYT B;  3BZD B;  3FVQ A;  2ZXR A;  3K5N A;  3DHQ A;  4NKL A;  1QE6 A;  4KD4 A;  2PW5 A;  1SJE D;  4RCO A;  4TSS A;  2AWO A;  4ZQ3 A;  2L4N A;  4DK0 A;  1NUC A;  3GV6 A;  1IW7 C;  2B2V A;  1ILP A;  1Y69 U;  3X3N A;  3R3O A;  4K2L A;  5CV4 A;  5D14 A;  3H0G B;  2F1M A;  4ULL A;  2F0M A;  2RBM A;  2FMC A;  1AFP A;  2VB3 X;  4KY7 A;  3QOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...