3I90A

Crystal structure of human chromobox homolog 6 (cbx6) with h3k27 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
50
structure length
50
Chain Sequence
RVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Chromobox protein homolog 6
total genus 10
structure length 50
sequence length 50
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i90A00
2M2LA 3I91A 1EQTA 4MHEA 1PFBA 2K03A 1QNKA 4HSVA 2MGSA 4ZK9B 1QE6A 1G2TA 2K1BA 2KUMA 3I8ZA 4ZLTF 5CBAE 3GV3A 1WTVA 3MTSA 4OIKA 2JYOA 2B2WC 2B2WA 1F2LA 1EOTA 4XDXA 1ESRA 4ZKBB 1J8IA 2HUGA 1U4MA 2EE1A 2NWGA 1EIGA 3Q6SA 4U68A 2B2UA 2B2UC 4RAUC 2DY7A 1SDFA 1IKMA 3I3CA 1ICWA 1DONA 1WTPA 2N88A 5D14A 1HUNA 5EPLA 1XX8A 4HCSA 2X6LA 4XT1B 1O7ZA 2IL8A 1IL8A 1Q3LA 3MWYW 5EJWA 2EOTA 2MP1A 4LMQD 1WTOA 4O42A 1U4RA 1E0BA 2EPBA 5JJZA 1HA6A 3I90A 2RSOA 4OIJA 2KECA 4X3TA 2KOLA 1G2SA 4X3SA 1HHVA 1C8CA 1G91A 1MGSA 4QUCA 3TN2A 2MPMA 2FJ2A 1JICA 1MSGA 1EIHA 3ONAB 1M8AA 2FMMA 2Q8RE 3P7JA 2VXWA 3LWEA 2N55A 1O7YA 1CA6A 5AFWA 1F9QA 5COYA 1RTNA 2HCCA 4RWSC 1SSOA 1X32A 5E4WC 2MJ8A 1AP0A 1B50A 3G7LA 4IUUA 1F9RA 2NYZD 2Q8TA 3H91A 5CBEE 1WTQA 1WD1A 1X3QA 4DN4M 5T1GA 1KNAA 2X6GA 3IL8A 3KBXA 4QUFA 1KNEA 1X3PA 4IUTA 1NR2A 4RA8A 2FINB 1HFNA 2XIWA 1XYIA 4R9WA 5CORA 1DOKA 1ILQA 1JE4A 4ZAIA 4NW2A 3DEPA 1GUWA 4CJ0B 1O80A 2H1EA 4ZKCB 1HUMA 4X3KA 4CJ1B 1BF4A 3QO2A 1ZXTA 3FPUB 1NR4A 2B2YA 1VMPA 2B2YC 5DNFA 1BBXC 3UI2A 1NAPA 5EPKA 1B4OA 2FHTA 3SVMA 1HFGA 1SAPA 2RVLA 1B3AA 3D6WA 1U4LA 1G6ZA 2J7ZA 1QG7A 1RJTA 2HDMA 2L11A 1RODA 2K04A 5EKIA 4IUVA 5EQ0A 2L9HA 3R93A 3TZDA 1B53A 1RTOA 2L12A 1IKLA 3FDTA 2HCIA 5D65A 5EPJA 3DEOA 1AZPA 1CA5A 4CJ2C 1HRJA 1BNZA 2HDLA 3HP3A 2X69A 3F2UA 4R8IA 5CMDA 2K01A 1F9SA 2FFKB 1WTWA 1WD0A 1AZQA 1ILPA 1MI2A 2D9UA 2BDNA 2KVMA 2RSNA 1EL0A 4HEDA 2KEEA 1VMCA 3DM1A 3GV6A 1J9OA 3N52A 5E4XA 4HAEA 1A15A 1PDQA 1LV9A 1WTRA 2L4NA 1WVLA 2DY8A 1RHPA 2JP1A 4X3UA 1TVXA 2B2VA 2B2VC 4XT3B 1WTXA 2RA4A 4IURA 1PFMA 1DOLA 2K05A 1F9PA 2NZ1D 4IUPA 1PFNA 1DOMA 2K28A 5T1IA 2B2TA 2B2TC 3KUPA 4IUQA 1CM9A 3IFDA 2R3ZA 1ML0D 1S4ZA 4MN3A 1PLFA 1U4PA 2CVRA 1B2TA 1NCVA 2SDFA 4UAIA 2KEDA 1MSHA 1DZ1A 2L1BA 1BO0A
chains in the Genus database with same CATH superfamily
1KABA 4K5VA 4MHEA 1E22A 2JA8B 5IGBA 4BA1I 1BCPF 3I4OA 4POGA 1IBKL 4FNFA 3WOEA 4KLKA 3FPPA 4XDXA 4C3IH 3RD4A 4NDXA 1K0RA 2D0OA 1TXYA 2VQEL 1N33Q 4K5WA 1ET9A 3J81c 3PIP3 5NUCA 2AMCB 2D0PA 3I3CA 3V2TA 5C5MA 1LT4D 1BCPB 4UHVA 5EPLA 5I2YA 2NVTH 1XMQQ 3M7GA 5CV9A 1S5DD 3RZDB 3ULJA 4DV1Q 2LXJA 1AE3A 2F0MA 3W1GA 4PG3A 1X9NA 1MGSA 4EQPA 4NB3A 3UE0A 2Q8RE 2F4VQ 3I4MG 5A2QL 3S24A 4K5XA 1LTID 1J6QA 1NUCA 4BWGB 5DAUA 3SHLA 3S2DB 1X54A 3H3VH 3E6ZX 2Q2IA 2YYZA 4DN4M 4LFBQ 4KY5A 3P75A 3HOUG 2MFIA 4DV0L 1UE5A 3R3OA 1LTBD 4G7ZC 3WDNA 2NUCA 3AU7A 2VB3X 5A35A 4DR7Q 3KYHC 3I4NB 1G51A 2F0WA 1EY5A 4V190 3H3VC 1OXXK 5CV6A 2PZWA 1BVSA 3CC2A 1RODA 4JI0L 4X64L 3L3OC 3K5MA 1IKLA 1BUVT 3SEBA 1YNXA 1QZGA 4JI7Q 2X69A 4R8IA 2SNSA 1I4PA 4UY8C 4RHRA 1J9OA 1EWIA 4Y52H 2IX3A 2I46A 3E0JA 1SE8A 3QJYA 1VQCA 1XPUA 4X3UA 3HOVH 1SLJA 2OT2A 2CWAA 2XRQD 3L0OA 2RKSA 5C44H 3L7ZC 4DU9A 3Q0AA 5KRUA 1EZ8A 4DR1Q 1BOSA 3FEWX 1PH8A 4UAIA 1DZ1A 3KF6A 3KF8A 2JXMB 1PH1A 1DD2A 1FJGQ 4BY1B 4H0LC 4IPCA 3BZCA 1LM0A 3TP8A 2AHOB 2Z6KA 1XNQL 4L63B 2F0VA 4HIOA 1PFSA 1B8AA 5BR8Q 4TSSA 3JAMc 5M3FH 3CQZB 3UDXA 1YBYA 4TKOB 4IPHA 5H1SE 4B3SL 2QILA 4UP7A 5K36H 4KV6A 4FXKC 2LS01 1IL8A 1H9KA 5GQOA 1MKHA 2C9OA 2EPBA 5JJZA 4BXXG 4RMFA 2PI2A 2KECA 2KOLA 1YNJC 4RKLA 3P20A 3EVQA 3VYSA 1E1OA 3CPFA 2FJ2A 1PXUA 1I94Q 1GOZA 1JJCB 5A2QE 1VCIA 4N8FA 1HR0L 2F0UA 1UEBA 4RWSC 1WTHA 1KAWA 4DR3L 4IUUA 2XN9C 3NTIA 3MA2B 3T13A 4C3JH 2PQEA 4BBRB 3M3YH 5K5PA 1HNZQ 1WFQA 4DXFA 5C3WA 5T1GA 3A8KE 1JORA 1QNUA 3ITPA 4A3CH 2FINB 2OF1A 4HSPA 1TWGB 2ZXOA 2VUMG 4HN7A 2MHVA 2EYFA 4CJ1B 1SR3A 3K59A 3HS0C 1NR4A 2D62A 4IPGA 1IBLL 1M4VA 1NAPA 3UI2A 2EY2A 4MZ9A 1XPRA 5L37A 3SVMA 1HFGA 1NY4A 3NK9A 3H6MA 3HOVB 1I4HA 2SNMA 3PUYA 2IPKD 4YHHL 5J1ZA 2HDLA 2K5HA 2DNEA 4CKCA 2KVMA 4YIJA 4NXNQ 2KEEA 1VQ8A 2KJXA 4GOPA 1K28A 2E74C 2RHQB 3T1HL 2DY8A 1QUQA 1BDOA 1PV4A 5KNBA 2ZJPA 4K2KA 2I5HA 1F9PA 4IUPA 4PMWA 3HOYH 2Y0SG 1TWFB 4A76A 1CQVA 3H15A 1KLUD 4FXDA 1NCVA 1SRUA 4QUFA 4HCEA 3NXWA 4E6IA 1VQJA 1QZHA 3URYA 1PFBA 1PH7A 2YTYA 3FMCA 4LFCL 2IW3A 2EVBA 5E7NA 5EAYA 3D4WA 3FKIG 5ELNA 4KKSA 3GV3A 3NE5B 4DR2L 4A3CG 1IW7C 1V1OA 3M4PA 3AFQA 4LF6L 1QOHA 1VQ9A 4ZKBB 4C3JG 1EIYB 1Q82C 2ZJQA 2NB0A 1VQNA 1I94L 4UDUC 1J5EQ 1KIXA 1HQMC 2N88A 1SMYC 4A93B 2UXDQ 5I4DA 4LK1C 1F2YA 3J81E 1NMFA 1FNWA 4HJ7A 2NVQH 1B7YB 4B9XA 1A3VA 3BG3A 2BA0A 4LJZC 1XWEA 2E2JH 4LF8L 4IFDH 5M5WB 1XMOQ 2LSSA 2N55A 1TR5A 1JCKB 5C3EG 1D1IA 1PA6A 3TDQA 5M3FG 3BVGA 4C56C 1EQRA 1NJIC 2UUAQ 3K0YA 1Y1WB 1GUSA 2GVBA 1R4PB 5E3FA 4DKAC 1YHQA 3FKIB 3D0FA 4RA8A 3BZDB 5IYBH 2NZHA 2XIWA 1XYIA 1HH2P 1AE2A 4CHTB 2K75A 3HGBA 4KI0A 3G6EA 2E2IH 3D6WA 1GJXA 1SXTA 2EYPA 5ELOA 5DM73 1QG7A 2OCEA 3N6RA 1EYGA 5IWAL 4L5TA 4ILWA 3DEOA 4IUNA 1A6XA 1G8ZD 1D5MC 4HIDA 5ELDA 2UU9L 5IGGA 3LGJA 4GNXB 1D5ZC 2BDNA 4FF3A 2Q8IB 4HJ9A 4C1NI 4CDDC 1DOLA 1Q1BA 1Q7YC 1VF5C 4H02A 1HNXQ 1DOMA 4DAVA 1CKOA 2PMZB 3E3XA 1TIID 2KA7A 4A3DB 1ASYA 4BY7H 2R7ZB 5DEHA 2VL6A 1IBKQ 2HQLA 4J8QA 1IW7D 3CQZH 1Y69U 2JA6H 2VY3A 2MGSA 3PO3H 1EFID 5JEAG 2R61A 2Z6KC 1VQAA 2EJGC 3MTSA 3AYHB 5C0XJ 3TRZA 2B2WC 2F0HA 1TWCB 2EYHA 1I50H 5M9OA 3H0GG 4C3HH 2QDLA 2KHJA 2EE1A 1EFWA 4DR3Q 2VQFL 5AJ3Q 3EIVA 1HPCA 4HJ8A 3STBD 2RCNA 4G57A 1LTRD 3G48A 4UP8A 2MNAA 5CGKA 1YIJA 1V1PB 3HOUB 4TQUS 5CR3A 3KBGA 4JBMA 2ES2A 3CKIB 1VQOA 1SMXA 2B63H 1JT8A 3I4NG 2A6HC 1ZKOA 2DJFC 2O5JC 1SYFA 1MJCA 2JSOA 5LMUQ 5CV4A 4CKEA 1C48A 2YTXA 3HOXG 4A3IH 3Q8DA 2OTJA 4QMGA 1EYCA 3BDCA 3GTMB 2KQ3A 1SNCA 1X3PA 1HFNA 1BQQT 4K2LA 1JE4A 2VZAA 4ZAIA 4JI8Q 5KGUA 4GKKQ 4ZKCB 1K73C 5FOBB 1ZXTA 1Q8KA 1BBXC 3CCQA 4B3RL 4CKBA 4DV5Q 2J7ZA 4K6DA 4OEMB 1H9SB 2L11A 2XRSD 5EKIA 2KCNA 4X62Q 1TWAH 1KD1C 3FDTA 2HCIA 4P75A 3I73A 3LX0A 2B29A 1FL0A 5D3IB 3HP3A 2PCFB 3M4QA 3A5ZB 1M1KC 4JBJA 2ZXPA 2CHBD 4I7ZC 5HURA 3D6CA 4GOPC 1QVGA 1RHPA 5LL6S 4DAYB 1E7ZA 1YI2A 4LNQA 2PYKA 3QR8A 2MO0A 4OELB 3A56A 1ML0D 3QB3A 1RD9D 1U4PA 1D6EC 3TZUA 3CMEA 1R4QB 1BO0A 2CH4A 2OEOA 5EKKA 1N33L 2IWHA 4LFCQ 1QNKA 1TWCH 1SNPA 5M5XH 1N8RC 3AFPA 3RR5A 1LUZA 2N8NA 3NQIA 4A3DG 5JAVA 2I5LX 4K0KL 4B3RQ 2QEXA 4IOAA 5D3DA 2A68C 2SOBA 3RN2A 3HOUH 2QKIC 1EIGA 1TS5A 3HKSA 2B2UA 4QCLA 1S5FD 3UDIA 1CSQA 1WTPA 2XWBB 1HCZA 3GTQB 4HJ5A 2JA7B 4YWMA 3PIO3 4XT1B 1PRTB 3GTLH 3PIOA 3PO2B 2HIXA 1RF2D 3D31A 2E75C 1HNXL 5C4HA 3OIQA 1G2SA 4YHHQ 4XQQA 1C8CA 2JEAI 1LLRD 2PW5A 2C5CA 4LFAQ 3HOWB 4C2MB 4JW0A 3H09A 1CA6A 5AFWA 2F0JA 2MO1A 2JJQA 1I4XA 4A3LG 4X62L 2NYZD 1AEXA 1WTQA 2WP8J 4ALPA 5IP9H 3KLRA 4KD4A 3HOXB 2WKDA 1KNEA 3OHXC 3CPWA 2D5DA 1B9NA 5C0XG 3NSWA 1BF4A 3FPUB 2JN4A 1JR0D 1T5XD 2XWJB 3T16A 4QIWE 4FYDA 4A3BB 3EQLC 1KL9A 2XNAC 1PTOC 1PTOB 2AQ1B 3OIPA 1B53A 2ZTCA 1N34Q 3NEMA 1STHA 4KJOA 1EZ6A 1JJGA 2WB1G 2RSNA 1EL0A 3JAML 5E4XA 4G7OC 1Y1VH 1PDQA 3IRBA 4LFAL 1GVPA 3VA5A 1ICFB 5LHY1 2MUYA 5IT9c 1HZCA 1XXGA 1SEBD 2F0KA 1QB5D 3PCOB 2EYOA 1B2TA 2SDFA 1KC8C 3U9SA 1EOTA 4AQYL 2M2LA 4XTCS 3NBIA 5IT9E 4B9WA 2Z4HA 4N8X1 2R93H 4HSVA 2CFMA 4PZ8A 3CRLC 1OXSC 1PH9A 2F0DA 4R4OA 2DGYA 2B2WA 2F0SA 2XSCA 1JWSD 1H9SA 3HKZE 3T1YQ 4Z9CB 3OWEB 5JJKA 5EKLA 2NWGA 4KMUC 4X6AH 4RAUC 2I07B 1IKMA 1ICWA 3VR4A 2QCPX 3GTPB 1WCMG 2X6LA 4C3HB 1Q3LA 1CI3M 1I6HH 4EVOA 1GHJA 4GN3B 4B3TQ 2EY1A 2F0GA 5LL6X 3MXPA 1SMYD 5FLXL 4Q5VA 3J7YW 2K6AA 4QUCA 4K14A 3HOWH 1MBYA 3HEJA 5FLMH 3MC0B 2UU9Q 1EWCA 3LWEA 4BBRH 5C3EH 3K5NA 3M3YB 4NKLA 5JPMC 3CF5A 3S1RH 2F03A 1AP0A 2NTSA 2KCCA 5CBEE 1PH3A 5C4JH 3OWFA 1GO3E 1EY8A 4IUTA 2JQOA 5IYDG 4IPDA 3BVMA 1UUPA 1TWGH 1LACA 1I3QH 3I55A 3H0GB 3BU2A 4DV2L 2F0TA 3CCEA 3C2PA 3A0JA 5EPKA 1WCMH 1K83H 2BDOA 4WFN3 2OXPA 3F1ZA 4QGUA 4CDFC 2HQEA 4KY7A 4A93G 4B08A 5M3MG 2UUBL 1L0YB 2NBFA 3J81L 5IGDA 2FFKB 1AZQA 1ILPA 3K7UC 3J81i 1Y8OB 3GV6A 2WAQB 1NTGA 2L4NA 1LABA 4L5SA 1TVXA 4X65Q 5G3LD 5C5LA 1Y1WH 2NVTB 1VQFA 1PFNA 1TS2A 4KKTA 1C7YA 5CV7A 3IFDA 3ND9A 1EU3A 4DV0Q 1X65A 2Z9HA 2CKZB 4A75A 3K0XA 4IQZA 3BVZA 2ASBA 2A68D 4J6HA 1TY2A 2KCMA 1D5XC 1J5EL 1UWVA 2E2JB 2Y0SB 3S14H 4B3TL 1TS4A 2A69D 4K8IA 4OHJA 3LNNA 4XQJA 2A1AA 1SNOA 3S1NB 3DMUA 1K8AC 4DGZA 1SYDA 3MXGA 4JK1C 4ZUJA 2B2UC 2JK8A 2N49A 3B6YA 5FO7B 3Q23A 3CU7A 2NVXH 4DV3L 1DONA 1II3A 2PW7A 3SK5A 3CW2C 5D14A 1HTLD 1XPOA 2R92B 4RFBA 4KY6A 2A5HA 4UP9A 2R92H 3L2PA 1G291 3IKJA 5LMUL 1YNND 3LWUA 4YCWA 4DV4L 2VUMH 4B3ML 3PIPA 1UAPA 4A3DH 2CCZA 1F2MA 2HHHQ 3RNUA 1AW7A 2B3GA 3EJIA 3TP7A 4APVA 2VXWA 1QCBD 4X66Q 4C3JB 5COYA 5KYLA 1KDCA 1EY9A 4ZYSA 3M85A 5EGTA 1PVOA 1A62A 2LY7A 1SFOH 3T51B 1HR0Q 5HGQA 3GD7A 4OGQC 2RHSB 1O80A 3CCLA 4B3SQ 2F3IA 4A3FB 3QO2A 4BBSG 1EY0A 3BDLA 2E2IB 1YHBA 1UE7A 2ZM6Q 2RVLA 3GTGH 1IYVA 3G71A 2F0LA 2F1MA 1STGA 2BE5C 4JOIC 1HNWQ 2YU9B 1RTOA 5DLQE 3GTOB 3CP0A 4RHSA 4IZ8A 4MTNA 2WV6D 3S2HH 4DV6Q 2A6EC 2QA4A 5C0XI 2EYMA 1TWAB 5LMNW 2KENA 1VF7A 1YITA 1V8QA 2KHSA 1L0XB 4OX9Q 5T1IA 3DUZA 5JPNC 3G6JB 3C3LA 3SR1A 1MSHA 4TVAB 1CKMA 2NN6G 1VS0A 4LF9L 1IXRA 1EQTA 3HOXH 3M4OH 4I65A 4ZK9B 1FVIA 5CBAE 3OPOA 3ULPA 4WJ4A 1W6JA 1NE3A 1L2FA 1PYWD 5CV8A 1SJHD 3BDOA 3GQBA 2B63G 3CCRA 5FJ8G 2HUGA 1LYLA 2A69C 2R7ZH 3HOZH 5JJIA 3PQIA 3SK8A 4ZRZA 3CC7A 2RBMA 3P1HA 4DR7L 1Q46A 4OWXB 3T1HQ 4JI5L 3DWAA 3BYYB 3F2BA 2D2CC 3NBHA 4ODGA 2E2DC 1AFPA 2F3WA 1TT2A 3V96A 1HR0W 4DK6C 4X3TA 1QWYA 1KXLA 3K7AB 3KLSX 5M5WH 4A3MH 4LUOA 4FVMA 4BY1H 2Q2TA 4POFA 3S2HB 4DUYL 2R6GA 4K6LA 3HOYB 5ELBA 4ME3A 2JA6G 2WB1E 1VQPA 2ATWA 2P5ZX 5EBCA 1HNWL 1XTCD 2R93B 3DHQA 1KNAA 4DR1L 5FKAC 4WJ3M 3A8IE 1BBWA 4JCVE 3IFTA 1W3SA 4NW2A 3SDZA 1PTOD 3OTOQ 4A3FH 2H1EA 4BY7B 4KN7C 1BCPC 4XYQA 1PRTD 1X3EA 4IALA 4JV5L 3VA7A 4QB4A 5TSSA 1SAPA 4PMBA 5IT9L 1U4LA 1G6ZA 2IX0A 1E24A 1LTAD 1TU2B 4JBKA 5LMNL 1F77A 2PQAB 4H7BA 2H5XA 5KEEA 1BNZA 3I70A 4FO2A 4O2DA 2ICIA 3D8GA 3WWVA 4C3IB 5IWAQ 2D9UA 2CW0D 3KLWA 3GO5A 3PO3G 4XT3B 4OONA 4IURA 4F7XA 2EY5A 1XJVA 3J7AV 2A6ED 3W5OA 5BN5A 1C4QA 2I5MX 3A7LA 4P72A 4JYAL 4IOCA 5JEAJ 4KN4C 1FYCA 2IT1A 4R8NA 1RCVD 2PO4A 4BBRG 4KD3A 3CCJA 5FLMG 5KIXA 1G2TA 4ZLTF 1AH9A 1PRTF 3KDFB 3MHBA 2IJ0A 4A3IB 2UUCL 4KTAA 1U4MA 2K5DA 1E2ZA 3A8JE 1SNQA 1IBMQ 3F2DA 1SDFA 1T5EA 3SK6A 2E76C 1UE6A 2JE6I 4A3EG 1STBA 3GTLB 2EJMA 5I9PA 4A3KH 1OTCA 5I9OA 5EJWA 1LTSD 2JA7H 3KOJA 1U4RA 1Z6HA 1NSNS 4DK3C 1D1KA 2JA7G 5IYBG 3BYTB 2ZTDA 1ENFA 4A3KG 3BZKA 2JA8H 4DK1A 2RDFA 2UUBQ 4LF8Q 5IIFA 3MXUA 2EXDA 2FMMA 3EA6A 3P7JA 1XMOL 1NNXA 5C4ZA 2EJFC 4DR4Q 5E4WC 2IX1A 3S1RB 1F9RA 1PTOF 1E2VA 2DJGC 4DAMA 3ULLA 4OWTB 5CV5A 1MJEA 4KHZA 2JA6B 2BE5D 3HOYG 2Z1CA 3JAMi 2UXDL 4O1NA 2UXBQ 1F2ZA 3VR3A 5C4XH 1KLGD 5IYCG 3QOJA 3CCUA 1I6HB 1CKNB 3VYUA 2YV5A 4KHVA 1JC7A 5C4JB 3CC4A 2K52A 4JOIA 4PQXA 3PF5A 1JWMD 2CW0C 4IJLA 3TZDA 2L9HA 1SBBB 5D65A 4A3BG 1UEAB 5BN3A 3NHHA 5ELFA 1K8OA 1CUKA 1H95A 4JI1Q 1MD2D 1WD0A 4RGMA 3NWSA 1HTPA 1JQYD 2RCFA 2OQKA 3J7ZC 5IODA 2DUDA 2B2VA 1CHQD 3RMHA 2K05A 1PZJD 1A8VA 3TEHB 3I56A 1R9TB 1L0WA 2ZTEA 3GDEA 3CCMA 2E5LL 1KDBA 4LF4Q 2Z0SA 4DV4Q 5C4XB 5E1FA 3DWQA 1OXTA 4G4KA 1STEA 1SYCA 4H13C 3MFGA 4A3JH 3T1YL 3I91A 4CGYB 2NVYH 3NTKA 4K8JA 2DN8A 2F0FA 2B39A 2M9VA 1EYAA 1EEFD 1D2BA 3C1EA 5GAHC 3CHBD 4AQYQ 3TS2A 1STAA 4YY3L 2V4DA 2VB2X 4F8MA 1D8LA 2Y0SE 2RF4A 3ER0A 4DNTB 1XX8A 1A3TA 1PTOH 4HCSA 3SGIA 1E2WA 1V43A 4A3MG 3R8BA 1O7ZA 2PZUA 3K58A 3J7AF 4HMIA 4PZ7A 1E0BA 1EQQA 2NZOA 2JA8G 5C6AA 3IAYA 1V1QA 2O4XA 1MSGA 1SN8A 2L15A 3M4YA 4NP5A 1G6PA 1O7YA 1K8GA 2EYJA 1GUTA 4DV2Q 3HOZG 1GXDC 2BA1A 1P8LA 3G7LA 2R7ZG 3U50C 5GADC 1KHIA 4AYBE 5JVH3 5EBDA 4KHPL 4BS9A 3ND8A 4AIMA 5ELCA 3HKZB 4R4CA 1GHKA 1ZEQX 1K0SA 4JBWA 2VW9A 1YEZA 4L5QA 4JI6Q 4BXXH 1I3QB 2RDGA 4I7AA 1IBML 5G3LF 4Q0FA 5BR8L 4R4QA 3EBEA 3GTKH 3NQTA 1JB7A 3GTKB 1GUNA 2AWOA 4IO9A 4R1JA 3VR6A 4LF4L 2NVQB 3ERQA 1SYBA 1DCZA 5EQ0A 3RLOA 2WAQE 1VQ7A 1ZYRD 1FJGL 3KF6B 3KF8B 4A3MB 4EQ5A 5CMDA 4AYBB 3K7AH 3PF4A 1WTWA 1FD7D 1FR3A 3NTHA 4A3GG 2EXZA 2AQ2B 3VYTA 3W1BA 2YU9H 1JOKA 3E9HA 2JA5G 4L6TB 1IZ6A 2JA9A 1K8MA 2PNRC 1DYQA 1CZGA 1JMCA 5GAEC 1SNDA 1PLFA 3EROA 4NMZA 3NENA 2QEJC 4JI2Q 3M9BA 4A3IG 4WORA 4RGNA 2TSSA 1BR9A 3I4MH 3V05A 1QE6A 4R4TA 2K1BA 3S16H 1VDZA 2K14A 4BBSB 3L9AX 3KLSA 4DA2A 4A3FG 3I4NH 4DPGA 4GZYC 3HZXA 4QF4A 1CHPD 4HMJA 2DNCA 4GKKL 1YVCA 3K8AA 2KBNA 2KHIA 1HUNA 2VUMB 4L5RC 3S1QB 4X66L 2WB1B 3K57A 2LMCB 2IHFA 1Y14B 4C3IG 1HA6A 2RSOA 4OIJA 2K7VA 3PUWA 2R92G 4DV3Q 3GP7A 4GN5A 3TS0A 1OXVA 3A54A 5FLXc 2F0EA 5J22A 2VQFQ 3X3NA 1TS3A 5CYUA 2HCCA 1SSOA 1XTDA 1K3RA 4JI1L 5FLXE 2F52A 3U4ZA 3CD6A 3E9IA 1H9JA 3NELA 3OOCA 5JJLA 3TP6A 1RKNA 2XVSA 2M00A 5CORA 1DOKA 3HFZB 1EYDA 4CJ0B 4DUZL 1STNA 4R4IA 1T9HA 3DM3A 1VMPA 1PZID 1QUQB 2G9HD 5M5YB 3GTMH 2B8FA 3QG1A 3R93A 3S16B 1AZPA 3I7FA 3PUZA 1H9MA 4CJ2C 1XNQQ 3X3MA 4DK0A 4A3EB 1I4GA 4U673 2K01A 4J1MA 2LKVA 2TMPA 3PSIA 1MI2A 2ICEC 4HEDA 1VMCA 1JOOA 2EZVA 4YWLA 1ZYRC 2JA5H 1WTRA 2O5IC 2B2VC 4A3GH 1PFMA 2CH4W 3S17B 5I6YA 2K28A 1PMRA 2SEBD 4IUQA 4Y7NB 2MQHA 1JWUD 1VQBA 2R3ZA 2WAQG 1HXYD 1Y8NB 3I4LA 4PNYA 1IYJB 1QVCA 1EU4A 1HJPA 4DR5L 3S1NH 2EY6A 2K4KA 2UUCQ 2K03A 5C4XG 3PUVA 4GNXC 4DUZQ 1EOVA 2PI2E 3TMEA 4BBSH 4PZ6A 1UNSA 2EYLA 5KNCA 2EQSA 3J80L 3RZOH 2RDHA 1UE1A 3RUZA 1BBUA 4ABNA 2F3VA 3QIAA 3C46A 3FHWA 3CCVA 4J15A 3S15H 1HA5A 3ZJYC 3S1MB 1YZ6A 4Y7NH 2UUAL 3OYYA 4WRDA 1DJRD 2EOTA 1WI5A 1PH5A 1ASZA 1N34L 2PQAA 4X64Q 3QOLA 4F87A 3FKIH 4A3EH 4F88A 1A0IA 4LW1A 4IFDI 2QGQA 3I72A 2ZJRA 2F0PA 3CRKC 3A55A 4KKUA 1B50A 4DR2Q 1TWFH 2NTTA 1WD1A 3J80E 2QW7A 2WIIB 3OMCA 4O0AA 3KBXA 3CMAA 1XNRL 3W2DA 3BS1A 1JJ2A 5M3MB 3MXNA 1LO5D 1HZ9A 4KJNA 5DNFA 5FK9C 2Z8LA 3PMFA 1ENCA 1B4OA 2HIVA 4KK7A 2V1CC 3KDFA 3TQYA 2RQXA 2HDMA 3JC66 2K5QA 1HQRD 1LT3D 5GROA 3UE1A 3A5UA 2L5TA 5CC4A 3NP8A 3OW7A 2IY5B 2R7FA 4RGOS 1H9RA 3W3AA 3K80C 4P74A 1RDPD 4YWKA 3G4SA 1Y1WG 4JI4Q 2NVXB 2Z4IA 5KNDA 4HAEA 4DFAA 4EQNA 4G7HC 2RA4A 3I2ZA 4WJWA 1A2UA 1Z47A 3S1MH 3TREA 2WINB 1EY7A 4LUVA 1E3PA 2J4XA 1U0LA 4XIGS 2AUKA 3K81C 3MFYA 1SFOB 3MAQA 2ZM6L 4LF7L 5C44B 1FNVA 1A2TA 4TRDA 4HJAA 1X6OA 5C0XH 1AN8A 5IYCH 3R2IA 4YY3Q 3DLLA 4HIMA 2QF7A 1FGBD 1X55A 4ZUIA 3PGZA 5IP9G 3ICEA 5IYDH 1STYA 2LFNA 2NVYB 4JPBW 4P71A 4DV1L 2Q2HA 5K36G 2R7DA 4GLVB 1YJ9A 1KRTA 1X3FA 1Z7TA 2A6HD 3TP5A 3FVQA 4OX9L 1JB3A 2O2LD 4O42A 3HOWG 1HZBA 3ZYYX 1VQHA 2NN6I 3UDGA 1EIHA 3AQQA 1JE5A 5I6WA 2HT1A 4JI3Q 4DV5L 3TSSA 5JOBA 4QQBX 4DAPA 1HNZL 4FP5D 1X32A 1Y8PB 3S2DH 1KTKA 2WACA 2BCOA 3HRZC 3H91A 3S17H 1X3QA 2X6GA 1O7IA 4ZQ3A 4NPSA 1VQDA 3S9WA 4FF4A 2VNUD 1EQVA 5C44G 1V9PA 4JI4L 3GTOH 4DR4L 2YTVA 1VQKA 4JI7L 2NN6H 1VQ4A 4RKBA 1WJJA 1B9MA 1ONLA 3NPPA 2CWPA 1X56A 2F4IA 2L12A 1GD7A 4JV5Q 2UXCL 2OTLA 2K5VA 1SYEA 4RH6A 3F2UA 2E5LQ 2WFWA 2E2HH 1Q12A 3N52A 1A3UA 1A15A 1MIUA 2B63B 2OQ0A 5FO9B 4JI0Q 1Y1VG 2EIFA 1VQIA 4YCUA 3T53B 4JI2L 2AUJD 3KUPA 1CM9A 4MN3A 1Q8IA 4MIUA 4ULLA 1I4RA 1FNUA 2KEDA 1DGSA 3HG9A 4IN3A 3FRPB 1PYSB 1PH6A 4DR6L 3CCSA 4IFDJ 3NBHB 1CK1A 4AH6A 1LTLA 4DR5Q 3A74A 3CAMA 1IYUA 4NXMQ 1Z9FA 3KK7A 4OO1G 4GNXA 4JYAQ 5HY6A 1PH2A 3JAME 4EX5A 4H44C 4ME5A 1WTVA 5LMNQ 1PZKD 4UPAA 2A19A 3I4MB 2N78A 4ID6A 1J8IA 1ESRA 1BKBA 1CT1D 3RLNA 1YJNA 2F0OA 4S3SA 1PYBA 3PO2G 2DY7A 2UXCQ 3RLFA 1R9TH 1WOCA 3PO2H 3GTJH 3NWTA 1TQOA 3MWYW 3GTJB 3A7AB 2Q2UA 4FF1A 4BY1G 2A8VA 3I90A 5J39A 2ID0A 3MVVA 4FDBA 3K5LA 5IE8A 5C3EB 5ELEA 2MPMA 1JICA 3ONAB 3OW2A 4OO1H 4QIWB 4DUYQ 4DV7L 1GUOA 3E5SA 3FP9A 3M7NA 1PRTC 3KJOA 3E0EA 3EFXD 2KCTA 3SE0A 1X3GA 1N36Q 3PO3B 3D4DA 1L1OC 2EDGA 3IL8A 4YCVA 4V0BA 5F2DA 3R2TA 4JI8L 5FJ8H 1Q90A 1ILQA 1LT6D 1GUWA 5JEAH 1HUMA 4X3KA 2HHHL 2AWNA 3HOZB 4LFBL 3J80c 2B2YA 2L0CA 3MXNB 3S1QH 2FHTA 3RZOB 1RIPA 2A74C 4KHPQ 3RN5A 1YNJD 2E8GA 1CKNA 4HTHA 2JEBI 4MTKA 3MEHA 2GA4B 2VS1A 1S40A 4L8JA 5EPJA 1BCPD 1LT5D 4DNIA 1ET6A 4C1NK 1QILA 2PNHA 3D3RA 1IL2A 1C0AA 3MZ5A 2AKWB 3NUCA 1FGUA 4QL5A 1SYGA 3BJUA 3J81j 4GLAC 1NMGA 3OSOA 1SJED 4CBVA 1U5KA 4LWCA 3OTOL 3TBIB 4GLXA 2ZXRA 1W6KA 3Q22A 2B2TC 4A93H 3AB9A 4GN4B 4DV7Q 1LTGD 1S4ZA 2JA5B 4LF6Q 1S3OA 2G5DA 4DV6L 1O78A 4IJHA 4HIKA 2KUMA 3GTPH 4AYBG 3U4VA 4K0KQ 2JYOA 1F2LA 3J80i 3VR2A 4DAYA 2CQAA 3AEVA 2AQ3B 1YNNC 2K50A 4U68A 4GS3A 4RCNA 4XYOA 2XGTA 1SROA 1B44D 1TWHB 1GKHA 1HZAA 4LF9Q 2IHEA 3STBC 3H94A 3PV0A 4PV1C 1XMQL 5IP7G 1B1ZA 4LMQD 4FXGC 4OXPA 1WTOA 5IGCA 1YJWA 4ZCKA 1O7LA 4X3SA 4OL7A 1HHVA 1G91A 1U9RA 1M8AA 1Q86C 2J0TD 3CXCA 3H3VI 2F4VL 2N3SA 1IHZA 4BA2I 1F9QA 1RTNA 2MJ8A 2FMCA 4MNOA 2HD3A 2VQEQ 5JVG3 1M90C 4JI5Q 1VQ6A 5M5XB 3QWNA 1N9WA 2Q8TA 3PUXA 1S5CD 1GM5A 1K83B 1KQSA 3EN2A 1C9OA 1NR2A 2C35B 4JVZA 3S15B 3H0GH 1K3BC 1KDAA 4C3HG 4LF5Q 2R93G 1TKWB 5HGTA 1VQMA 4CDEC 1E1TA 1CSPA 1ENAA 5M5YH 4GOPB 2I0QA 4A3KB 1B3AA 1B3QA 4DXGA 4N9TA 5IY0A 3DWPA 2K04A 3S14B 4HR7B 1TY0A 4BY7G 4QJFA 1EWHA 3VDYA 1HRJA 1P16A 4EQOA 3WOFA 1VQEA 2GVAA 5GAGC 2GN5A 2F0NA 1F9SA 2PMZE 2H4OA 2QDBA 3RZDH 2JP1A 4XQNA 1QVFA 1B70B 4CDCC 2BH8A 4C2MH 4N9PA 4DNRB 4A3JG 4A3GB 4LUZA 4OO1I 1WYDA 5IOCA 5M3MH 1Y1VB 3SK4A 2WKCA 4LF7Q 1MHWC 1EEID 2L1BA 5M3FB 2K5WA 3Q24A 2PZTA 1EUJA 5AJ3L 1KRSA 4JI3L 3F8TA 4RCOA 1W2BA 3HKZG 1Q1EA 3I8ZA 1V1PA 4OIKA 4RGTA 3T56B 2K5NA 1DM0B 1YHAA 3F2CA 4PMCA 1OXUA 2Z6BA 5IP7H 4A3BH 4A3LH 1SE3A 2K33A 3Q6SA 2A73B 1N32Q 2UXBL 1TWHH 1SE2A 1N36L 4OWWB 3MEFA 2LXKA 2E2HB 4M8AA 3T4AC 1S5ED 5ISRA 1NBWA 1VQGA 1A63A 2IL8A 2ENBA 1I6VC 2MP1A 3UDFA 4IFDG 2B8GA 1BXTA 2FXQA 1GUGA 3U9OA 4LF5L 5BN4A 1I5FA 4LAAA 3TN2A 4M1UB 5DM63 2ALYB 2ZT9C 4GKJQ 4A3JB 4FF2A 2K32A 1XNRQ 4EGVA 1PHJA 5I2XA 3K6OA 5KYIA 3GTGB 1D7QA 1CZWA 3U58A 1SE4A 4P73A 1L1OA 1WCMB 1I4QA 3KFUA 3DXJC 4R9WA 3GTQH 1CQFA 1JOQA 3K5OA 4X65L 1OO9B 1CTMA 3DEPA 1VQLA 3VYRA 2B2YC 2XTIA 4XXEA 1S5BD 2PPBC 1N32L 1VQ5A 4P2CB 4NXML 1QJOA 1I50B 1RJTA 2G9DA 4IUVA 4JG2A 5J3BA 1CA5A 2OWOA 4B3MQ 1EIFA 2F0QA 4JC0A 3J7A5 4A4IA 3ERSX 5C3XA 3OMGA 3VR5A 1RL2A 1EY4A 5FO8B 3HOVG 2BH2A 4QY7A 1Q81C 3D4RA 1CFMA 3DM1A 4NXNL 3KJPA 5IGEA 1S72A 1LV9A 1SNMA 1WVLA 3O13A 2F0IA 1PH4A 1WTXA 4GKJL 4JI6L 2BOSA 1DXMA 1EY6A 2NZ1D 1KAAA 2CQOA 1ESFA 4DR6Q 5IGFA 3M4OB 4RG1A 2B2TA 1K9MC 3SXHA 4DF7A 1IBLQ 2CVRA 2L55A 1LTTD 3C1FA 1L1OB 3AMUA
chains in the Genus database with same CATH topology
1KABA 4K5VA 4MHEA 2JA8B 5IGBA 4BA1I 1BCPF 4FNFA 3WOEA 3FPPA 4XDXA 3RD4A 4NDXA 4K5WA 1ET9A 3PIP3 5NUCA 3I3CA 3V2TA 5C5MA 1LT4D 1BCPB 5EPLA 5I2YA 3M7GA 5CV9A 1S5DD 3RZDB 2F0MA 1MGSA 4EQPA 2Q8RE 5A2QL 4K5XA 1LTID 1NUCA 4BWGB 5DAUA 3SHLA 3S2DB 3E6ZX 2YYZA 4DN4M 4KY5A 3P75A 3R3OA 1LTBD 4G7ZC 3WDNA 2NUCA 3AU7A 2VB3X 5A35A 3I4NB 2F0WA 1EY5A 4V190 3H3VC 1OXXK 5CV6A 2PZWA 1RODA 3L3OC 3K5MA 1IKLA 1BUVT 3SEBA 2X69A 4R8IA 2SNSA 1I4PA 4RHRA 1J9OA 2IX3A 2I46A 3E0JA 3QJYA 4X3UA 2OT2A 2XRQD 2RKSA 3L7ZC 4DU9A 3Q0AA 5KRUA 1EZ8A 1BOSA 3FEWX 4UAIA 1DZ1A 3KF8A 2JXMB 1DD2A 4BY1B 4H0LC 3TP8A 4L63B 2F0VA 4TSSA 3CQZB 4TKOB 2QILA 5K36H 4KV6A 4FXKC 2LS01 1IL8A 1H9KA 2C9OA 2EPBA 5JJZA 2KECA 2KOLA 1YNJC 4RKLA 3P20A 3EVQA 3VYSA 2FJ2A 1PXUA 1GOZA 5A2QE 1VCIA 2F0UA 4RWSC 4IUUA 2XN9C 3NTIA 3MA2B 3T13A 2PQEA 4BBRB 5K5PA 4DXFA 5C3WA 5T1GA 3A8KE 1JORA 1QNUA 3ITPA 2FINB 2OF1A 4HSPA 1TWGB 2ZXOA 4HN7A 2MHVA 2EYFA 4CJ1B 3K59A 3HS0C 1NR4A 2D62A 1M4VA 1NAPA 3UI2A 2EY2A 3SVMA 1HFGA 3NK9A 3H6MA 3HOVB 1I4HA 2SNMA 3PUYA 2IPKD 5J1ZA 2HDLA 2DNEA 4CKCA 2KVMA 4YIJA 2KEEA 2KJXA 2E74C 2DY8A 1BDOA 5KNBA 4K2KA 1F9PA 4IUPA 4PMWA 1TWFB 1CQVA 1KLUD 4FXDA 1NCVA 4QUFA 4HCEA 3NXWA 4E6IA 3URYA 1PFBA 3FMCA 2IW3A 2EVBA 3D4WA 4KKSA 3GV3A 3NE5B 1IW7C 1V1OA 1QOHA 4ZKBB 4C3JG 2NB0A 4UDUC 1HQMC 2N88A 1SMYC 4A93B 5I4DA 4LK1C 1F2YA 3J81E 1FNWA 4B9XA 1A3VA 3BG3A 2BA0A 4LJZC 1XWEA 4IFDH 5M5WB 2N55A 1TR5A 1JCKB 1D1IA 3TDQA 3BVGA 4C56C 3K0YA 1Y1WB 1GUSA 1R4PB 5E3FA 3FKIB 4RA8A 3BZDB 2XIWA 1XYIA 4CHTB 3HGBA 4KI0A 3D6WA 1GJXA 1SXTA 2EYPA 5DM73 1QG7A 3N6RA 4ILWA 3DEOA 4IUNA 1A6XA 1G8ZD 1D5MC 5ELDA 5IGGA 1D5ZC 2BDNA 4FF3A 2Q8IB 4C1NI 1DOLA 1Q1BA 1VF5C 1DOMA 4DAVA 2PMZB 1TIID 2KA7A 4A3DB 2R7ZB 5DEHA 4J8QA 1IW7D 1Y69U 2MGSA 1EFID 5JEAG 2R61A 2EJGC 3MTSA 5C0XJ 2B2WC 2F0HA 1TWCB 2EYHA 5M9OA 2EE1A 1HPCA 4G57A 1LTRD 5CGKA 1V1PB 3HOUB 4TQUS 5CR3A 3KBGA 3CKIB 2A6HC 1ZKOA 2O5JC 1SYFA 2JSOA 5CV4A 4CKEA 1C48A 4QMGA 1EYCA 3BDCA 3GTMB 2KQ3A 1SNCA 1X3PA 1HFNA 1BQQT 5KGUA 4K2LA 1JE4A 4ZAIA 4ZKCB 5FOBB 1ZXTA 1BBXC 4CKBA 2J7ZA 4K6DA 1H9SB 2L11A 2XRSD 5EKIA 2KCNA 3FDTA 2HCIA 3I73A 3LX0A 5D3IB 3HP3A 2PCFB 2ZXPA 2CHBD 4I7ZC 5HURA 3D6CA 1RHPA 5LL6S 2PYKA 3A56A 1ML0D 3QB3A 1RD9D 1U4PA 1D6EC 3TZUA 1R4QB 1BO0A 2OEOA 5EKKA 2IWHA 1QNKA 1SNPA 3NQIA 5JAVA 5D3DA 2A68C 2SOBA 2QKIC 1EIGA 1TS5A 2B2UA 4QCLA 1S5FD 1WTPA 2XWBB 1HCZA 3GTQB 2JA7B 3PIO3 4XT1B 1PRTB 3PO2B 1RF2D 3D31A 2E75C 5C4HA 3OIQA 1G2SA 4XQQA 1C8CA 2JEAI 1LLRD 2PW5A 2C5CA 3HOWB 4C2MB 3H09A 1CA6A 5AFWA 2F0JA 1I4XA 2NYZD 1AEXA 1WTQA 2WP8J 3KLRA 4KD4A 3HOXB 2WKDA 1KNEA 3OHXC 2D5DA 1B9NA 5C0XG 3NSWA 1BF4A 3FPUB 2XWJB 1JR0D 1T5XD 3T16A 4FYDA 4A3BB 3EQLC 2XNAC 1PTOC 1PTOB 2AQ1B 3OIPA 1B53A 1STHA 4KJOA 1EZ6A 2RSNA 1EL0A 3JAML 5E4XA 4G7OC 1PDQA 3VA5A 5LHY1 2MUYA 1XXGA 1SEBD 2F0KA 1QB5D 2EYOA 1B2TA 2SDFA 3U9SA 1EOTA 2M2LA 4XTCS 3NBIA 5IT9E 4B9WA 2Z4HA 4HSVA 3CRLC 1OXSC 2F0DA 2XSCA 2B2WA 2F0SA 1JWSD 1H9SA 4Z9CB 3OWEB 5EKLA 2NWGA 4KMUC 4RAUC 2I07B 1IKMA 1ICWA 3VR4A 2QCPX 3GTPB 2X6LA 4C3HB 1Q3LA 1CI3M 4EVOA 1GHJA 2EY1A 2F0GA 5LL6X 3MXPA 1SMYD 5FLXL 4Q5VA 3J7YW 2K6AA 4QUCA 4K14A 1MBYA 3HEJA 3MC0B 1EWCA 3LWEA 3M3YB 3K5NA 4NKLA 5JPMC 2F03A 1AP0A 2NTSA 2KCCA 5CBEE 3OWFA 1EY8A 4IUTA 3BVMA 1UUPA 1LACA 3H0GB 2F0TA 3C2PA 5EPKA 2BDOA 4WFN3 2OXPA 2HQEA 4KY7A 4B08A 1L0YB 2NBFA 3J81L 5IGDA 2FFKB 1AZQA 1ILPA 1Y8OB 3GV6A 2WAQB 2L4NA 1LABA 1TVXA 5G3LD 5C5LA 2NVTB 1PFNA 1TS2A 4KKTA 5CV7A 3IFDA 3ND9A 1EU3A 4IQZA 3BVZA 2A68D 4J6HA 1TY2A 1D5XC 2E2JB 2Y0SB 1TS4A 2A69D 4K8IA 4OHJA 3LNNA 4XQJA 1SNOA 3S1NB 3DMUA 4DGZA 1SYDA 3MXGA 4JK1C 4ZUJA 2B2UC 5FO7B 3Q23A 3CU7A 1DONA 1II3A 2PW7A 3SK5A 5D14A 1HTLD 2R92B 4RFBA 4KY6A 2A5HA 1G291 3IKJA 1YNND 3LWUA 1UAPA 1F2MA 1AW7A 3EJIA 3TP7A 2VXWA 1QCBD 4C3JB 5COYA 5KYLA 1KDCA 1EY9A 4ZYSA 3M85A 5EGTA 2LY7A 3T51B 3GD7A 4OGQC 1O80A 4A3FB 3QO2A 1EY0A 3BDLA 2E2IB 2RVLA 1IYVA 2F0LA 2F1MA 1STGA 2BE5C 2YU9B 1RTOA 3GTOB 4RHSA 4IZ8A 2WV6D 2A6EC 5C0XI 2EYMA 1TWAB 1VF7A 1V8QA 2KHSA 1L0XB 5T1IA 3DUZA 5JPNC 3G6JB 3C3LA 3SR1A 1MSHA 2NN6G 1EQTA 4I65A 4ZK9B 5CBAE 3OPOA 1W6JA 1PYWD 5CV8A 1SJHD 3BDOA 3GQBA 2HUGA 2A69C 3SK8A 4ZRZA 2RBMA 3P1HA 3DWAA 3BYYB 2D2CC 3NBHA 4ODGA 2E2DC 1AFPA 2F3WA 1TT2A 3V96A 4X3TA 1QWYA 3K7AB 3KLSX 4FVMA 3S2HB 2R6GA 4K6LA 3HOYB 5ELBA 5EBCA 1XTCD 2R93B 3DHQA 1KNAA 5FKAC 3A8IE 3IFTA 4NW2A 3SDZA 1PTOD 2H1EA 4BY7B 4KN7C 1BCPC 4XYQA 1PRTD 4IALA 3VA7A 4QB4A 5TSSA 1SAPA 4PMBA 5IT9L 1U4LA 1G6ZA 2IX0A 1LTAD 1TU2B 1F77A 1BNZA 4H7BA 5KEEA 3I70A 4FO2A 2ICIA 3D8GA 4C3IB 2D9UA 2CW0D 3GO5A 4XT3B 4IURA 4F7XA 2EY5A 3J7AV 2A6ED 5BN5A 1C4QA 3A7LA 5JEAJ 4KN4C 1FYCA 2IT1A 4R8NA 1RCVD 2PO4A 4KD3A 5KIXA 1G2TA 4ZLTF 1PRTF 3MHBA 2IJ0A 4A3IB 4KTAA 1U4MA 2K5DA 1E2ZA 3A8JE 1SNQA 1SDFA 1T5EA 3SK6A 2E76C 2JE6I 1STBA 3GTLB 2EJMA 5I9PA 5I9OA 5EJWA 1LTSD 1U4RA 1Z6HA 1NSNS 1D1KA 3BYTB 1ENFA 4DK1A 2RDFA 5IIFA 3MXUA 2FMMA 3EA6A 3P7JA 5C4ZA 2EJFC 5E4WC 2IX1A 3S1RB 1F9RA 1PTOF 1E2VA 5CV5A 4KHZA 2JA6B 2BE5D 2Z1CA 4O1NA 1F2ZA 3VR3A 1KLGD 3QOJA 1I6HB 3VYUA 4KHVA 1JC7A 5C4JB 4PQXA 1JWMD 2CW0C 3TZDA 2L9HA 1SBBB 5D65A 1UEAB 5BN3A 3NHHA 5ELFA 1K8OA 1MD2D 1WD0A 4RGMA 3NWSA 1HTPA 1JQYD 5IODA 2B2VA 1CHQD 3RMHA 2K05A 1PZJD 1R9TB 1KDBA 5C4XB 5E1FA 3DWQA 1OXTA 4G4KA 1SYCA 1STEA 3MFGA 4H13C 3I91A 4CGYB 3NTKA 4K8JA 2DN8A 2F0FA 2B39A 2M9VA 1EYAA 1EEFD 1D2BA 3C1EA 3CHBD 1STAA 2V4DA 2VB2X 4F8MA 4DNTB 1XX8A 1A3TA 1PTOH 4HCSA 1E2WA 1V43A 3R8BA 1O7ZA 2PZUA 3K58A 3J7AF 4HMIA 1E0BA 5C6AA 3IAYA 2O4XA 1MSGA 3M4YA 4NP5A 1O7YA 2EYJA 1GUTA 1GXDC 2BA1A 3G7LA 5JVH3 5EBDA 4BS9A 3ND8A 5ELCA 3HKZB 1GHKA 1ZEQX 4JBWA 1I3QB 2RDGA 5G3LF 4Q0FA 3NQTA 3GTKB 1GUNA 2AWOA 3VR6A 2NVQB 3ERQA 1SYBA 1DCZA 5EQ0A 1ZYRD 4A3MB 5CMDA 4AYBB 1WTWA 1FD7D 1FR3A 3NTHA 2EXZA 2AQ2B 3VYTA 1JOKA 4L6TB 1K8MA 2PNRC 1DYQA 1CZGA 1SNDA 1PLFA 3EROA 4NMZA 2QEJC 4WORA 4RGNA 2TSSA 1BR9A 3V05A 1QE6A 2K1BA 1VDZA 4BBSB 3L9AX 3KLSA 4DA2A 4GZYC 3HZXA 4QF4A 1CHPD 4HMJA 2DNCA 1HUNA 2VUMB 3S1QB 2WB1B 3K57A 2LMCB 4C3IG 1HA6A 2RSOA 4OIJA 2K7VA 3PUWA 3GP7A 1OXVA 3A54A 2F0EA 5J22A 3X3NA 1TS3A 5CYUA 2HCCA 1SSOA 5FLXE 1H9JA 3OOCA 3TP6A 1RKNA 2XVSA 2M00A 5CORA 1DOKA 1EYDA 4CJ0B 1STNA 1VMPA 1PZID 2G9HD 5M5YB 2B8FA 3QG1A 3R93A 3S16B 1AZPA 3PUZA 1H9MA 4CJ2C 3X3MA 4DK0A 4A3EB 1I4GA 4U673 2K01A 4J1MA 2LKVA 2TMPA 1MI2A 2ICEC 4HEDA 1VMCA 1JOOA 2EZVA 1ZYRC 2O5IC 1WTRA 2B2VC 1PFMA 3S17B 5I6YA 2K28A 1PMRA 2SEBD 4IUQA 4Y7NB 1JWUD 2R3ZA 1HXYD 1Y8NB 3I4LA 4PNYA 1EU4A 2EY6A 2K03A 3PUVA 3TMEA 1UNSA 2EYLA 5KNCA 3J80L 2RDHA 3RUZA 4ABNA 2F3VA 3QIAA 3C46A 1HA5A 3S1MB 4WRDA 1DJRD 2EOTA 3QOLA 4F87A 4F88A 4IFDI 3I72A 2F0PA 3CRKC 3A55A 4KKUA 1B50A 2NTTA 1WD1A 3J80E 2WIIB 3OMCA 3KBXA 3W2DA 3BS1A 5M3MB 3MXNA 1LO5D 4KJNA 5DNFA 5FK9C 2Z8LA 3PMFA 1ENCA 1B4OA 4KK7A 2RQXA 2HDMA 2K5QA 1HQRD 1LT3D 2L5TA 5CC4A 3NP8A 3OW7A 4RGOS 1H9RA 3W3AA 1RDPD 2NVXB 2Z4IA 5KNDA 4HAEA 4DFAA 4EQNA 4G7HC 2RA4A 4WJWA 1A2UA 1Z47A 2WINB 1EY7A 2J4XA 4XIGS 2AUKA 3MFYA 1SFOB 3MAQA 5C44B 1FNVA 1A2TA 4TRDA 5C0XH 1AN8A 3R2IA 2QF7A 1FGBD 4ZUIA 1STYA 2LFNA 2NVYB 5K36G 1Z7TA 2A6HD 3TP5A 3FVQA 1JB3A 2O2LD 4O42A 3ZYYX 2NN6I 1EIHA 5I6WA 3TSSA 5JOBA 4DAPA 4FP5D 1X32A 1Y8PB 1KTKA 2WACA 2BCOA 3HRZC 3H91A 1X3QA 2X6GA 4ZQ3A 3S9WA 4FF4A 2VNUD 1EQVA 2NN6H 4RKBA 1B9MA 1ONLA 3NPPA 2F4IA 2L12A 1SYEA 4RH6A 3F2UA 1Q12A 3N52A 1A3UA 1A15A 2B63B 5FO9B 3T53B 2AUJD 3KUPA 1CM9A 4MN3A 1Q8IA 4MIUA 4ULLA 1I4RA 1FNUA 2KEDA 3HG9A 4IN3A 3FRPB 4IFDJ 1CK1A 1IYUA 3KK7A 4OO1G 3JAME 1WTVA 4H44C 4ME5A 1PZKD 3I4MB 4ID6A 1J8IA 1ESRA 1CT1D 2F0OA 4S3SA 2DY7A 3RLFA 3NWTA 1TQOA 3MWYW 3GTJB 3A7AB 4FF1A 3I90A 5J39A 2ID0A 3MVVA 3K5LA 5C3EB 5ELEA 2MPMA 1JICA 3ONAB 4OO1H 4QIWB 1GUOA 3E5SA 3M7NA 1PRTC 3EFXD 3SE0A 3PO3B 3D4DA 2EDGA 3IL8A 4V0BA 5F2DA 3R2TA 1ILQA 1Q90A 1LT6D 1GUWA 5JEAH 1HUMA 4X3KA 2AWNA 3HOZB 2B2YA 2L0CA 2FHTA 3RZOB 2A74C 1YNJD 4HTHA 2JEBI 3MEHA 2GA4B 4L8JA 5EPJA 1BCPD 1LT5D 1ET6A 4C1NK 1QILA 3D3RA 3MZ5A 3NUCA 1SYGA 3OSOA 1SJED 4CBVA 3TBIB 2ZXRA 1W6KA 3Q22A 2B2TC 3AB9A 1LTGD 1S4ZA 2JA5B 1O78A 2KUMA 2JYOA 1F2LA 3VR2A 4DAYA 2CQAA 2AQ3B 1YNNC 4U68A 4RCNA 4XYOA 1B44D 1TWHB 3H94A 3PV0A 4PV1C 1B1ZA 4LMQD 4FXGC 1WTOA 5IGCA 1O7LA 4X3SA 4OL7A 1HHVA 1G91A 1U9RA 1M8AA 2J0TD 1IHZA 4BA2I 1F9QA 1RTNA 2MJ8A 2FMCA 5JVG3 5M5XB 3QWNA 2Q8TA 3PUXA 1S5CD 1K83B 1NR2A 3S15B 4C3HG 1KDAA 1TKWB 5HGTA 1ENAA 4A3KB 1B3AA 4DXGA 4N9TA 3DWPA 2K04A 3S14B 4HR7B 1TY0A 1EWHA 1HRJA 4EQOA 3WOFA 2F0NA 1F9SA 2H4OA 2QDBA 2JP1A 4XQNA 4N9PA 4DNRB 4A3GB 4OO1I 5IOCA 1Y1VB 3SK4A 2WKCA 1EEID 2L1BA 5M3FB 2K5WA 3Q24A 2PZTA 4RCOA 1Q1EA 3I8ZA 1V1PA 4OIKA 4RGTA 3T56B 1DM0B 4PMCA 1OXUA 1SE3A 2K33A 3Q6SA 2A73B 1SE2A 2E2HB 4M8AA 3T4AC 1S5ED 5ISRA 2IL8A 2ENBA 1I6VC 2MP1A 4IFDG 2B8GA 1BXTA 1GUGA 3U9OA 5BN4A 4LAAA 3TN2A 4M1UB 5DM63 2ZT9C 4A3JB 4FF2A 2K32A 4EGVA 5I2XA 3K6OA 5KYIA 3GTGB 1CZWA 1SE4A 1WCMB 1I4QA 3DXJC 4R9WA 1JOQA 1CQFA 3K5OA 1CTMA 1OO9B 3DEPA 3VYRA 2B2YC 4XXEA 1S5BD 2PPBC 4P2CB 1QJOA 1I50B 1RJTA 2G9DA 4IUVA 1CA5A 2F0QA 5C3XA 3OMGA 3VR5A 1EY4A 5FO8B 3D4RA 1CFMA 3DM1A 5IGEA 1LV9A 1SNMA 1WVLA 3O13A 2F0IA 1WTXA 2BOSA 1DXMA 1EY6A 2NZ1D 1KAAA 1ESFA 5IGFA 3M4OB 2B2TA 3SXHA 4DF7A 2CVRA 2L55A 1LTTD 3C1FA 3AMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M2L A;  3I91 A;  1EQT A;  4MHE A;  1PFB A;  2K03 A;  1QNK A;  4HSV A;  2MGS A;  4ZK9 B;  1QE6 A;  1G2T A;  2K1B A;  2KUM A;  3I8Z A;  4ZLT F;  5CBA E;  3GV3 A;  1WTV A;  3MTS A;  4OIK A;  2JYO A;  2B2W C;  2B2W A;  1F2L A;  1EOT A;  4XDX A;  1ESR A;  4ZKB B;  1J8I A;  2HUG A;  1U4M A;  2EE1 A;  2NWG A;  1EIG A;  3Q6S A;  4U68 A;  2B2U A;  2B2U C;  4RAU C;  2DY7 A;  1SDF A;  1IKM A;  3I3C A;  1ICW A;  1DON A;  1WTP A;  2N88 A;  5D14 A;  1HUN A;  5EPL A;  1XX8 A;  4HCS A;  2X6L A;  4XT1 B;  1O7Z A;  2IL8 A;  1IL8 A;  1Q3L A;  3MWY W;  5EJW A;  2EOT A;  2MP1 A;  4LMQ D;  1WTO A;  4O42 A;  1U4R A;  1E0B A;  2EPB A;  5JJZ A;  1HA6 A;  3I90 A;  2RSO A;  4OIJ A;  2KEC A;  4X3T A;  2KOL A;  1G2S A;  4X3S A;  1HHV A;  1C8C A;  1G91 A;  1MGS A;  4QUC A;  3TN2 A;  2MPM A;  2FJ2 A;  1JIC A;  1MSG A;  1EIH A;  3ONA B;  1M8A A;  2FMM A;  2Q8R E;  3P7J A;  2VXW A;  3LWE A;  2N55 A;  1O7Y A;  1CA6 A;  5AFW A;  1F9Q A;  5COY A;  1RTN A;  2HCC A;  4RWS C;  1SSO A;  1X32 A;  5E4W C;  2MJ8 A;  1AP0 A;  1B50 A;  3G7L A;  4IUU A;  1F9R A;  2NYZ D;  2Q8T A;  3H91 A;  5CBE E;  1WTQ A;  1WD1 A;  1X3Q A;  4DN4 M;  5T1G A;  1KNA A;  2X6G A;  3IL8 A;  3KBX A;  4QUF A;  1KNE A;  1X3P A;  4IUT A;  1NR2 A;  4RA8 A;  2FIN B;  1HFN A;  2XIW A;  1XYI A;  4R9W A;  5COR A;  1DOK A;  1ILQ A;  1JE4 A;  4ZAI A;  4NW2 A;  3DEP A;  1GUW A;  4CJ0 B;  1O80 A;  2H1E A;  4ZKC B;  1HUM A;  4X3K A;  4CJ1 B;  1BF4 A;  3QO2 A;  1ZXT A;  3FPU B;  1NR4 A;  2B2Y A;  1VMP A;  2B2Y C;  5DNF A;  1BBX C;  3UI2 A;  1NAP A;  5EPK A;  1B4O A;  2FHT A;  3SVM A;  1HFG A;  1SAP A;  2RVL A;  1B3A A;  3D6W A;  1U4L A;  1G6Z A;  2J7Z A;  1QG7 A;  1RJT A;  2HDM A;  2L11 A;  1ROD A;  2K04 A;  5EKI A;  4IUV A;  5EQ0 A;  2L9H A;  3R93 A;  3TZD A;  1B53 A;  1RTO A;  2L12 A;  1IKL A;  3FDT A;  2HCI A;  5D65 A;  5EPJ A;  3DEO A;  1AZP A;  1CA5 A;  4CJ2 C;  1HRJ A;  1BNZ A;  2HDL A;  3HP3 A;  2X69 A;  3F2U A;  4R8I A;  5CMD A;  2K01 A;  1F9S A;  2FFK B;  1WTW A;  1WD0 A;  1AZQ A;  1ILP A;  1MI2 A;  2D9U A;  2BDN A;  2KVM A;  2RSN A;  1EL0 A;  4HED A;  2KEE A;  1VMC A;  3DM1 A;  3GV6 A;  1J9O A;  3N52 A;  5E4X A;  4HAE A;  1A15 A;  1PDQ A;  1LV9 A;  1WTR A;  2L4N A;  1WVL A;  2DY8 A;  1RHP A;  2JP1 A;  4X3U A;  1TVX A;  2B2V A;  2B2V C;  4XT3 B;  1WTX A;  2RA4 A;  4IUR A;  1PFM A;  1DOL A;  2K05 A;  1F9P A;  2NZ1 D;  4IUP A;  1PFN A;  1DOM A;  2K28 A;  5T1I A;  2B2T A;  2B2T C;  3KUP A;  4IUQ A;  1CM9 A;  3IFD A;  2R3Z A;  1ML0 D;  1S4Z A;  4MN3 A;  1PLF A;  1U4P A;  2CVR A;  1B2T A;  1NCV A;  2SDF A;  4UAI A;  2KED A;  1MSH A;  1DZ1 A;  2L1B A;  1BO0 A; 
#chains in the Genus database with same CATH topology
 1KAB A;  4K5V A;  4MHE A;  1E22 A;  2JA8 B;  5IGB A;  4BA1 I;  1BCP F;  3I4O A;  4POG A;  1IBK L;  4FNF A;  3WOE A;  4KLK A;  3FPP A;  4XDX A;  4C3I H;  3RD4 A;  4NDX A;  1K0R A;  2D0O A;  1TXY A;  2VQE L;  1N33 Q;  4K5W A;  1ET9 A;  3J81 c;  3PIP 3;  5NUC A;  2AMC B;  2D0P A;  3I3C A;  3V2T A;  5C5M A;  1LT4 D;  1BCP B;  4UHV A;  5EPL A;  5I2Y A;  2NVT H;  1XMQ Q;  3M7G A;  5CV9 A;  1S5D D;  3RZD B;  3ULJ A;  4DV1 Q;  2LXJ A;  1AE3 A;  2F0M A;  3W1G A;  4PG3 A;  1X9N A;  1MGS A;  4EQP A;  4NB3 A;  3UE0 A;  2Q8R E;  2F4V Q;  3I4M G;  5A2Q L;  3S24 A;  4K5X A;  1LTI D;  1J6Q A;  1NUC A;  4BWG B;  5DAU A;  3SHL A;  3S2D B;  1X54 A;  3H3V H;  3E6Z X;  2Q2I A;  2YYZ A;  4DN4 M;  4LFB Q;  4KY5 A;  3P75 A;  3HOU G;  2MFI A;  4DV0 L;  1UE5 A;  3R3O A;  1LTB D;  4G7Z C;  3WDN A;  2NUC A;  3AU7 A;  2VB3 X;  5A35 A;  4DR7 Q;  3KYH C;  3I4N B;  1G51 A;  2F0W A;  1EY5 A;  4V19 0;  3H3V C;  1OXX K;  5CV6 A;  2PZW A;  1BVS A;  3CC2 A;  1ROD A;  4JI0 L;  4X64 L;  3L3O C;  3K5M A;  1IKL A;  1BUV T;  3SEB A;  1YNX A;  1QZG A;  4JI7 Q;  2X69 A;  4R8I A;  2SNS A;  1I4P A;  4UY8 C;  4RHR A;  1J9O A;  1EWI A;  4Y52 H;  2IX3 A;  2I46 A;  3E0J A;  1SE8 A;  3QJY A;  1VQC A;  1XPU A;  4X3U A;  3HOV H;  1SLJ A;  2OT2 A;  2CWA A;  2XRQ D;  3L0O A;  2RKS A;  5C44 H;  3L7Z C;  4DU9 A;  3Q0A A;  5KRU A;  1EZ8 A;  4DR1 Q;  1BOS A;  3FEW X;  1PH8 A;  4UAI A;  1DZ1 A;  3KF6 A;  3KF8 A;  2JXM B;  1PH1 A;  1DD2 A;  1FJG Q;  4BY1 B;  4H0L C;  4IPC A;  3BZC A;  1LM0 A;  3TP8 A;  2AHO B;  2Z6K A;  1XNQ L;  4L63 B;  2F0V A;  4HIO A;  1PFS A;  1B8A A;  5BR8 Q;  4TSS A;  3JAM c;  5M3F H;  3CQZ B;  3UDX A;  1YBY A;  4TKO B;  4IPH A;  5H1S E;  4B3S L;  2QIL A;  4UP7 A;  5K36 H;  4KV6 A;  4FXK C;  2LS0 1;  1IL8 A;  1H9K A;  5GQO A;  1MKH A;  2C9O A;  2EPB A;  5JJZ A;  4BXX G;  4RMF A;  2PI2 A;  2KEC A;  2KOL A;  1YNJ C;  4RKL A;  3P20 A;  3EVQ A;  3VYS A;  1E1O A;  3CPF A;  2FJ2 A;  1PXU A;  1I94 Q;  1GOZ A;  1JJC B;  5A2Q E;  1VCI A;  4N8F A;  1HR0 L;  2F0U A;  1UEB A;  4RWS C;  1WTH A;  1KAW A;  4DR3 L;  4IUU A;  2XN9 C;  3NTI A;  3MA2 B;  3T13 A;  4C3J H;  2PQE A;  4BBR B;  3M3Y H;  5K5P A;  1HNZ Q;  1WFQ A;  4DXF A;  5C3W A;  5T1G A;  3A8K E;  1JOR A;  1QNU A;  3ITP A;  4A3C H;  2FIN B;  2OF1 A;  4HSP A;  1TWG B;  2ZXO A;  2VUM G;  4HN7 A;  2MHV A;  2EYF A;  4CJ1 B;  1SR3 A;  3K59 A;  3HS0 C;  1NR4 A;  2D62 A;  4IPG A;  1IBL L;  1M4V A;  1NAP A;  3UI2 A;  2EY2 A;  4MZ9 A;  1XPR A;  5L37 A;  3SVM A;  1HFG A;  1NY4 A;  3NK9 A;  3H6M A;  3HOV B;  1I4H A;  2SNM A;  3PUY A;  2IPK D;  4YHH L;  5J1Z A;  2HDL A;  2K5H A;  2DNE A;  4CKC A;  2KVM A;  4YIJ A;  4NXN Q;  2KEE A;  1VQ8 A;  2KJX A;  4GOP A;  1K28 A;  2E74 C;  2RHQ B;  3T1H L;  2DY8 A;  1QUQ A;  1BDO A;  1PV4 A;  5KNB A;  2ZJP A;  4K2K A;  2I5H A;  1F9P A;  4IUP A;  4PMW A;  3HOY H;  2Y0S G;  1TWF B;  4A76 A;  1CQV A;  3H15 A;  1KLU D;  4FXD A;  1NCV A;  1SRU A;  4QUF A;  4HCE A;  3NXW A;  4E6I A;  1VQJ A;  1QZH A;  3URY A;  1PFB A;  1PH7 A;  2YTY A;  3FMC A;  4LFC L;  2IW3 A;  2EVB A;  5E7N A;  5EAY A;  3D4W A;  3FKI G;  5ELN A;  4KKS A;  3GV3 A;  3NE5 B;  4DR2 L;  4A3C G;  1IW7 C;  1V1O A;  3M4P A;  3AFQ A;  4LF6 L;  1QOH A;  1VQ9 A;  4ZKB B;  4C3J G;  1EIY B;  1Q82 C;  2ZJQ A;  2NB0 A;  1VQN A;  1I94 L;  4UDU C;  1J5E Q;  1KIX A;  1HQM C;  2N88 A;  1SMY C;  4A93 B;  2UXD Q;  5I4D A;  4LK1 C;  1F2Y A;  3J81 E;  1NMF A;  1FNW A;  4HJ7 A;  2NVQ H;  1B7Y B;  4B9X A;  1A3V A;  3BG3 A;  2BA0 A;  4LJZ C;  1XWE A;  2E2J H;  4LF8 L;  4IFD H;  5M5W B;  1XMO Q;  2LSS A;  2N55 A;  1TR5 A;  1JCK B;  5C3E G;  1D1I A;  1PA6 A;  3TDQ A;  5M3F G;  3BVG A;  4C56 C;  1EQR A;  1NJI C;  2UUA Q;  3K0Y A;  1Y1W B;  1GUS A;  2GVB A;  1R4P B;  5E3F A;  4DKA C;  1YHQ A;  3FKI B;  3D0F A;  4RA8 A;  3BZD B;  5IYB H;  2NZH A;  2XIW A;  1XYI A;  1HH2 P;  1AE2 A;  4CHT B;  2K75 A;  3HGB A;  4KI0 A;  3G6E A;  2E2I H;  3D6W A;  1GJX A;  1SXT A;  2EYP A;  5ELO A;  5DM7 3;  1QG7 A;  2OCE A;  3N6R A;  1EYG A;  5IWA L;  4L5T A;  4ILW A;  3DEO A;  4IUN A;  1A6X A;  1G8Z D;  1D5M C;  4HID A;  5ELD A;  2UU9 L;  5IGG A;  3LGJ A;  4GNX B;  1D5Z C;  2BDN A;  4FF3 A;  2Q8I B;  4HJ9 A;  4C1N I;  4CDD C;  1DOL A;  1Q1B A;  1Q7Y C;  1VF5 C;  4H02 A;  1HNX Q;  1DOM A;  4DAV A;  1CKO A;  2PMZ B;  3E3X A;  1TII D;  2KA7 A;  4A3D B;  1ASY A;  4BY7 H;  2R7Z B;  5DEH A;  2VL6 A;  1IBK Q;  2HQL A;  4J8Q A;  1IW7 D;  3CQZ H;  1Y69 U;  2JA6 H;  2VY3 A;  2MGS A;  3PO3 H;  1EFI D;  5JEA G;  2R61 A;  2Z6K C;  1VQA A;  2EJG C;  3MTS A;  3AYH B;  5C0X J;  3TRZ A;  2B2W C;  2F0H A;  1TWC B;  2EYH A;  1I50 H;  5M9O A;  3H0G G;  4C3H H;  2QDL A;  2KHJ A;  2EE1 A;  1EFW A;  4DR3 Q;  2VQF L;  5AJ3 Q;  3EIV A;  1HPC A;  4HJ8 A;  3STB D;  2RCN A;  4G57 A;  1LTR D;  3G48 A;  4UP8 A;  2MNA A;  5CGK A;  1YIJ A;  1V1P B;  3HOU B;  4TQU S;  5CR3 A;  3KBG A;  4JBM A;  2ES2 A;  3CKI B;  1VQO A;  1SMX A;  2B63 H;  1JT8 A;  3I4N G;  2A6H C;  1ZKO A;  2DJF C;  2O5J C;  1SYF A;  1MJC A;  2JSO A;  5LMU Q;  5CV4 A;  4CKE A;  1C48 A;  2YTX A;  3HOX G;  4A3I H;  3Q8D A;  2OTJ A;  4QMG A;  1EYC A;  3BDC A;  3GTM B;  2KQ3 A;  1SNC A;  1X3P A;  1HFN A;  1BQQ T;  4K2L A;  1JE4 A;  2VZA A;  4ZAI A;  4JI8 Q;  5KGU A;  4GKK Q;  4ZKC B;  1K73 C;  5FOB B;  1ZXT A;  1Q8K A;  1BBX C;  3CCQ A;  4B3R L;  4CKB A;  4DV5 Q;  2J7Z A;  4K6D A;  4OEM B;  1H9S B;  2L11 A;  2XRS D;  5EKI A;  2KCN A;  4X62 Q;  1TWA H;  1KD1 C;  3FDT A;  2HCI A;  4P75 A;  3I73 A;  3LX0 A;  2B29 A;  1FL0 A;  5D3I B;  3HP3 A;  2PCF B;  3M4Q A;  3A5Z B;  1M1K C;  4JBJ A;  2ZXP A;  2CHB D;  4I7Z C;  5HUR A;  3D6C A;  4GOP C;  1QVG A;  1RHP A;  5LL6 S;  4DAY B;  1E7Z A;  1YI2 A;  4LNQ A;  2PYK A;  3QR8 A;  2MO0 A;  4OEL B;  3A56 A;  1ML0 D;  3QB3 A;  1RD9 D;  1U4P A;  1D6E C;  3TZU A;  3CME A;  1R4Q B;  1BO0 A;  2CH4 A;  2OEO A;  5EKK A;  1N33 L;  2IWH A;  4LFC Q;  1QNK A;  1TWC H;  1SNP A;  5M5X H;  1N8R C;  3AFP A;  3RR5 A;  1LUZ A;  2N8N A;  3NQI A;  4A3D G;  5JAV A;  2I5L X;  4K0K L;  4B3R Q;  2QEX A;  4IOA A;  5D3D A;  2A68 C;  2SOB A;  3RN2 A;  3HOU H;  2QKI C;  1EIG A;  1TS5 A;  3HKS A;  2B2U A;  4QCL A;  1S5F D;  3UDI A;  1CSQ A;  1WTP A;  2XWB B;  1HCZ A;  3GTQ B;  4HJ5 A;  2JA7 B;  4YWM A;  3PIO 3;  4XT1 B;  1PRT B;  3GTL H;  3PIO A;  3PO2 B;  2HIX A;  1RF2 D;  3D31 A;  2E75 C;  1HNX L;  5C4H A;  3OIQ A;  1G2S A;  4YHH Q;  4XQQ A;  1C8C A;  2JEA I;  1LLR D;  2PW5 A;  2C5C A;  4LFA Q;  3HOW B;  4C2M B;  4JW0 A;  3H09 A;  1CA6 A;  5AFW A;  2F0J A;  2MO1 A;  2JJQ A;  1I4X A;  4A3L G;  4X62 L;  2NYZ D;  1AEX A;  1WTQ A;  2WP8 J;  4ALP A;  5IP9 H;  3KLR A;  4KD4 A;  3HOX B;  2WKD A;  1KNE A;  3OHX C;  3CPW A;  2D5D A;  1B9N A;  5C0X G;  3NSW A;  1BF4 A;  3FPU B;  2JN4 A;  1JR0 D;  1T5X D;  2XWJ B;  3T16 A;  4QIW E;  4FYD A;  4A3B B;  3EQL C;  1KL9 A;  2XNA C;  1PTO C;  1PTO B;  2AQ1 B;  3OIP A;  1B53 A;  2ZTC A;  1N34 Q;  3NEM A;  1STH A;  4KJO A;  1EZ6 A;  1JJG A;  2WB1 G;  2RSN A;  1EL0 A;  3JAM L;  5E4X A;  4G7O C;  1Y1V H;  1PDQ A;  3IRB A;  4LFA L;  1GVP A;  3VA5 A;  1ICF B;  5LHY 1;  2MUY A;  5IT9 c;  1HZC A;  1XXG A;  1SEB D;  2F0K A;  1QB5 D;  3PCO B;  2EYO A;  1B2T A;  2SDF A;  1KC8 C;  3U9S A;  1EOT A;  4AQY L;  2M2L A;  4XTC S;  3NBI A;  5IT9 E;  4B9W A;  2Z4H A;  4N8X 1;  2R93 H;  4HSV A;  2CFM A;  4PZ8 A;  3CRL C;  1OXS C;  1PH9 A;  2F0D A;  4R4O A;  2DGY A;  2B2W A;  2F0S A;  2XSC A;  1JWS D;  1H9S A;  3HKZ E;  3T1Y Q;  4Z9C B;  3OWE B;  5JJK A;  5EKL A;  2NWG A;  4KMU C;  4X6A H;  4RAU C;  2I07 B;  1IKM A;  1ICW A;  3VR4 A;  2QCP X;  3GTP B;  1WCM G;  2X6L A;  4C3H B;  1Q3L A;  1CI3 M;  1I6H H;  4EVO A;  1GHJ A;  4GN3 B;  4B3T Q;  2EY1 A;  2F0G A;  5LL6 X;  3MXP A;  1SMY D;  5FLX L;  4Q5V A;  3J7Y W;  2K6A A;  4QUC A;  4K14 A;  3HOW H;  1MBY A;  3HEJ A;  5FLM H;  3MC0 B;  2UU9 Q;  1EWC A;  3LWE A;  4BBR H;  5C3E H;  3K5N A;  3M3Y B;  4NKL A;  5JPM C;  3CF5 A;  3S1R H;  2F03 A;  1AP0 A;  2NTS A;  2KCC A;  5CBE E;  1PH3 A;  5C4J H;  3OWF A;  1GO3 E;  1EY8 A;  4IUT A;  2JQO A;  5IYD G;  4IPD A;  3BVM A;  1UUP A;  1TWG H;  1LAC A;  1I3Q H;  3I55 A;  3H0G B;  3BU2 A;  4DV2 L;  2F0T A;  3CCE A;  3C2P A;  3A0J A;  5EPK A;  1WCM H;  1K83 H;  2BDO A;  4WFN 3;  2OXP A;  3F1Z A;  4QGU A;  4CDF C;  2HQE A;  4KY7 A;  4A93 G;  4B08 A;  5M3M G;  2UUB L;  1L0Y B;  2NBF A;  3J81 L;  5IGD A;  2FFK B;  1AZQ A;  1ILP A;  3K7U C;  3J81 i;  1Y8O B;  3GV6 A;  2WAQ B;  1NTG A;  2L4N A;  1LAB A;  4L5S A;  1TVX A;  4X65 Q;  5G3L D;  5C5L A;  1Y1W H;  2NVT B;  1VQF A;  1PFN A;  1TS2 A;  4KKT A;  1C7Y A;  5CV7 A;  3IFD A;  3ND9 A;  1EU3 A;  4DV0 Q;  1X65 A;  2Z9H A;  2CKZ B;  4A75 A;  3K0X A;  4IQZ A;  3BVZ A;  2ASB A;  2A68 D;  4J6H A;  1TY2 A;  2KCM A;  1D5X C;  1J5E L;  1UWV A;  2E2J B;  2Y0S B;  3S14 H;  4B3T L;  1TS4 A;  2A69 D;  4K8I A;  4OHJ A;  3LNN A;  4XQJ A;  2A1A A;  1SNO A;  3S1N B;  3DMU A;  1K8A C;  4DGZ A;  1SYD A;  3MXG A;  4JK1 C;  4ZUJ A;  2B2U C;  2JK8 A;  2N49 A;  3B6Y A;  5FO7 B;  3Q23 A;  3CU7 A;  2NVX H;  4DV3 L;  1DON A;  1II3 A;  2PW7 A;  3SK5 A;  3CW2 C;  5D14 A;  1HTL D;  1XPO A;  2R92 B;  4RFB A;  4KY6 A;  2A5H A;  4UP9 A;  2R92 H;  3L2P A;  1G29 1;  3IKJ A;  5LMU L;  1YNN D;  3LWU A;  4YCW A;  4DV4 L;  2VUM H;  4B3M L;  3PIP A;  1UAP A;  4A3D H;  2CCZ A;  1F2M A;  2HHH Q;  3RNU A;  1AW7 A;  2B3G A;  3EJI A;  3TP7 A;  4APV A;  2VXW A;  1QCB D;  4X66 Q;  4C3J B;  5COY A;  5KYL A;  1KDC A;  1EY9 A;  4ZYS A;  3M85 A;  5EGT A;  1PVO A;  1A62 A;  2LY7 A;  1SFO H;  3T51 B;  1HR0 Q;  5HGQ A;  3GD7 A;  4OGQ C;  2RHS B;  1O80 A;  3CCL A;  4B3S Q;  2F3I A;  4A3F B;  3QO2 A;  4BBS G;  1EY0 A;  3BDL A;  2E2I B;  1YHB A;  1UE7 A;  2ZM6 Q;  2RVL A;  3GTG H;  1IYV A;  3G71 A;  2F0L A;  2F1M A;  1STG A;  2BE5 C;  4JOI C;  1HNW Q;  2YU9 B;  1RTO A;  5DLQ E;  3GTO B;  3CP0 A;  4RHS A;  4IZ8 A;  4MTN A;  2WV6 D;  3S2H H;  4DV6 Q;  2A6E C;  2QA4 A;  5C0X I;  2EYM A;  1TWA B;  5LMN W;  2KEN A;  1VF7 A;  1YIT A;  1V8Q A;  2KHS A;  1L0X B;  4OX9 Q;  5T1I A;  3DUZ A;  5JPN C;  3G6J B;  3C3L A;  3SR1 A;  1MSH A;  4TVA B;  1CKM A;  2NN6 G;  1VS0 A;  4LF9 L;  1IXR A;  1EQT A;  3HOX H;  3M4O H;  4I65 A;  4ZK9 B;  1FVI A;  5CBA E;  3OPO A;  3ULP A;  4WJ4 A;  1W6J A;  1NE3 A;  1L2F A;  1PYW D;  5CV8 A;  1SJH D;  3BDO A;  3GQB A;  2B63 G;  3CCR A;  5FJ8 G;  2HUG A;  1LYL A;  2A69 C;  2R7Z H;  3HOZ H;  5JJI A;  3PQI A;  3SK8 A;  4ZRZ A;  3CC7 A;  2RBM A;  3P1H A;  4DR7 L;  1Q46 A;  4OWX B;  3T1H Q;  4JI5 L;  3DWA A;  3BYY B;  3F2B A;  2D2C C;  3NBH A;  4ODG A;  2E2D C;  1AFP A;  2F3W A;  1TT2 A;  3V96 A;  1HR0 W;  4DK6 C;  4X3T A;  1QWY A;  1KXL A;  3K7A B;  3KLS X;  5M5W H;  4A3M H;  4LUO A;  4FVM A;  4BY1 H;  2Q2T A;  4POF A;  3S2H B;  4DUY L;  2R6G A;  4K6L A;  3HOY B;  5ELB A;  4ME3 A;  2JA6 G;  2WB1 E;  1VQP A;  2ATW A;  2P5Z X;  5EBC A;  1HNW L;  1XTC D;  2R93 B;  3DHQ A;  1KNA A;  4DR1 L;  5FKA C;  4WJ3 M;  3A8I E;  1BBW A;  4JCV E;  3IFT A;  1W3S A;  4NW2 A;  3SDZ A;  1PTO D;  3OTO Q;  4A3F H;  2H1E A;  4BY7 B;  4KN7 C;  1BCP C;  4XYQ A;  1PRT D;  1X3E A;  4IAL A;  4JV5 L;  3VA7 A;  4QB4 A;  5TSS A;  1SAP A;  4PMB A;  5IT9 L;  1U4L A;  1G6Z A;  2IX0 A;  1E24 A;  1LTA D;  1TU2 B;  4JBK A;  5LMN L;  1F77 A;  2PQA B;  4H7B A;  2H5X A;  5KEE A;  1BNZ A;  3I70 A;  4FO2 A;  4O2D A;  2ICI A;  3D8G A;  3WWV A;  4C3I B;  5IWA Q;  2D9U A;  2CW0 D;  3KLW A;  3GO5 A;  3PO3 G;  4XT3 B;  4OON A;  4IUR A;  4F7X A;  2EY5 A;  1XJV A;  3J7A V;  2A6E D;  3W5O A;  5BN5 A;  1C4Q A;  2I5M X;  3A7L A;  4P72 A;  4JYA L;  4IOC A;  5JEA J;  4KN4 C;  1FYC A;  2IT1 A;  4R8N A;  1RCV D;  2PO4 A;  4BBR G;  4KD3 A;  3CCJ A;  5FLM G;  5KIX A;  1G2T A;  4ZLT F;  1AH9 A;  1PRT F;  3KDF B;  3MHB A;  2IJ0 A;  4A3I B;  2UUC L;  4KTA A;  1U4M A;  2K5D A;  1E2Z A;  3A8J E;  1SNQ A;  1IBM Q;  3F2D A;  1SDF A;  1T5E A;  3SK6 A;  2E76 C;  1UE6 A;  2JE6 I;  4A3E G;  1STB A;  3GTL B;  2EJM A;  5I9P A;  4A3K H;  1OTC A;  5I9O A;  5EJW A;  1LTS D;  2JA7 H;  3KOJ A;  1U4R A;  1Z6H A;  1NSN S;  4DK3 C;  1D1K A;  2JA7 G;  5IYB G;  3BYT B;  2ZTD A;  1ENF A;  4A3K G;  3BZK A;  2JA8 H;  4DK1 A;  2RDF A;  2UUB Q;  4LF8 Q;  5IIF A;  3MXU A;  2EXD A;  2FMM A;  3EA6 A;  3P7J A;  1XMO L;  1NNX A;  5C4Z A;  2EJF C;  4DR4 Q;  5E4W C;  2IX1 A;  3S1R B;  1F9R A;  1PTO F;  1E2V A;  2DJG C;  4DAM A;  3ULL A;  4OWT B;  5CV5 A;  1MJE A;  4KHZ A;  2JA6 B;  2BE5 D;  3HOY G;  2Z1C A;  3JAM i;  2UXD L;  4O1N A;  2UXB Q;  1F2Z A;  3VR3 A;  5C4X H;  1KLG D;  5IYC G;  3QOJ A;  3CCU A;  1I6H B;  1CKN B;  3VYU A;  2YV5 A;  4KHV A;  1JC7 A;  5C4J B;  3CC4 A;  2K52 A;  4JOI A;  4PQX A;  3PF5 A;  1JWM D;  2CW0 C;  4IJL A;  3TZD A;  2L9H A;  1SBB B;  5D65 A;  4A3B G;  1UEA B;  5BN3 A;  3NHH A;  5ELF A;  1K8O A;  1CUK A;  1H95 A;  4JI1 Q;  1MD2 D;  1WD0 A;  4RGM A;  3NWS A;  1HTP A;  1JQY D;  2RCF A;  2OQK A;  3J7Z C;  5IOD A;  2DUD A;  2B2V A;  1CHQ D;  3RMH A;  2K05 A;  1PZJ D;  1A8V A;  3TEH B;  3I56 A;  1R9T B;  1L0W A;  2ZTE A;  3GDE A;  3CCM A;  2E5L L;  1KDB A;  4LF4 Q;  2Z0S A;  4DV4 Q;  5C4X B;  5E1F A;  3DWQ A;  1OXT A;  4G4K A;  1STE A;  1SYC A;  4H13 C;  3MFG A;  4A3J H;  3T1Y L;  3I91 A;  4CGY B;  2NVY H;  3NTK A;  4K8J A;  2DN8 A;  2F0F A;  2B39 A;  2M9V A;  1EYA A;  1EEF D;  1D2B A;  3C1E A;  5GAH C;  3CHB D;  4AQY Q;  3TS2 A;  1STA A;  4YY3 L;  2V4D A;  2VB2 X;  4F8M A;  1D8L A;  2Y0S E;  2RF4 A;  3ER0 A;  4DNT B;  1XX8 A;  1A3T A;  1PTO H;  4HCS A;  3SGI A;  1E2W A;  1V43 A;  4A3M G;  3R8B A;  1O7Z A;  2PZU A;  3K58 A;  3J7A F;  4HMI A;  4PZ7 A;  1E0B A;  1EQQ A;  2NZO A;  2JA8 G;  5C6A A;  3IAY A;  1V1Q A;  2O4X A;  1MSG A;  1SN8 A;  2L15 A;  3M4Y A;  4NP5 A;  1G6P A;  1O7Y A;  1K8G A;  2EYJ A;  1GUT A;  4DV2 Q;  3HOZ G;  1GXD C;  2BA1 A;  1P8L A;  3G7L A;  2R7Z G;  3U50 C;  5GAD C;  1KHI A;  4AYB E;  5JVH 3;  5EBD A;  4KHP L;  4BS9 A;  3ND8 A;  4AIM A;  5ELC A;  3HKZ B;  4R4C A;  1GHK A;  1ZEQ X;  1K0S A;  4JBW A;  2VW9 A;  1YEZ A;  4L5Q A;  4JI6 Q;  4BXX H;  1I3Q B;  2RDG A;  4I7A A;  1IBM L;  5G3L F;  4Q0F A;  5BR8 L;  4R4Q A;  3EBE A;  3GTK H;  3NQT A;  1JB7 A;  3GTK B;  1GUN A;  2AWO A;  4IO9 A;  4R1J A;  3VR6 A;  4LF4 L;  2NVQ B;  3ERQ A;  1SYB A;  1DCZ A;  5EQ0 A;  3RLO A;  2WAQ E;  1VQ7 A;  1ZYR D;  1FJG L;  3KF6 B;  3KF8 B;  4A3M B;  4EQ5 A;  5CMD A;  4AYB B;  3K7A H;  3PF4 A;  1WTW A;  1FD7 D;  1FR3 A;  3NTH A;  4A3G G;  2EXZ A;  2AQ2 B;  3VYT A;  3W1B A;  2YU9 H;  1JOK A;  3E9H A;  2JA5 G;  4L6T B;  1IZ6 A;  2JA9 A;  1K8M A;  2PNR C;  1DYQ A;  1CZG A;  1JMC A;  5GAE C;  1SND A;  1PLF A;  3ERO A;  4NMZ A;  3NEN A;  2QEJ C;  4JI2 Q;  3M9B A;  4A3I G;  4WOR A;  4RGN A;  2TSS A;  1BR9 A;  3I4M H;  3V05 A;  1QE6 A;  4R4T A;  2K1B A;  3S16 H;  1VDZ A;  2K14 A;  4BBS B;  3L9A X;  3KLS A;  4DA2 A;  4A3F G;  3I4N H;  4DPG A;  4GZY C;  3HZX A;  4QF4 A;  1CHP D;  4HMJ A;  2DNC A;  4GKK L;  1YVC A;  3K8A A;  2KBN A;  2KHI A;  1HUN A;  2VUM B;  4L5R C;  3S1Q B;  4X66 L;  2WB1 B;  3K57 A;  2LMC B;  2IHF A;  1Y14 B;  4C3I G;  1HA6 A;  2RSO A;  4OIJ A;  2K7V A;  3PUW A;  2R92 G;  4DV3 Q;  3GP7 A;  4GN5 A;  3TS0 A;  1OXV A;  3A54 A;  5FLX c;  2F0E A;  5J22 A;  2VQF Q;  3X3N A;  1TS3 A;  5CYU A;  2HCC A;  1SSO A;  1XTD A;  1K3R A;  4JI1 L;  5FLX E;  2F52 A;  3U4Z A;  3CD6 A;  3E9I A;  1H9J A;  3NEL A;  3OOC A;  5JJL A;  3TP6 A;  1RKN A;  2XVS A;  2M00 A;  5COR A;  1DOK A;  3HFZ B;  1EYD A;  4CJ0 B;  4DUZ L;  1STN A;  4R4I A;  1T9H A;  3DM3 A;  1VMP A;  1PZI D;  1QUQ B;  2G9H D;  5M5Y B;  3GTM H;  2B8F A;  3QG1 A;  3R93 A;  3S16 B;  1AZP A;  3I7F A;  3PUZ A;  1H9M A;  4CJ2 C;  1XNQ Q;  3X3M A;  4DK0 A;  4A3E B;  1I4G A;  4U67 3;  2K01 A;  4J1M A;  2LKV A;  2TMP A;  3PSI A;  1MI2 A;  2ICE C;  4HED A;  1VMC A;  1JOO A;  2EZV A;  4YWL A;  1ZYR C;  2JA5 H;  1WTR A;  2O5I C;  2B2V C;  4A3G H;  1PFM A;  2CH4 W;  3S17 B;  5I6Y A;  2K28 A;  1PMR A;  2SEB D;  4IUQ A;  4Y7N B;  2MQH A;  1JWU D;  1VQB A;  2R3Z A;  2WAQ G;  1HXY D;  1Y8N B;  3I4L A;  4PNY A;  1IYJ B;  1QVC A;  1EU4 A;  1HJP A;  4DR5 L;  3S1N H;  2EY6 A;  2K4K A;  2UUC Q;  2K03 A;  5C4X G;  3PUV A;  4GNX C;  4DUZ Q;  1EOV A;  2PI2 E;  3TME A;  4BBS H;  4PZ6 A;  1UNS A;  2EYL A;  5KNC A;  2EQS A;  3J80 L;  3RZO H;  2RDH A;  1UE1 A;  3RUZ A;  1BBU A;  4ABN A;  2F3V A;  3QIA A;  3C46 A;  3FHW A;  3CCV A;  4J15 A;  3S15 H;  1HA5 A;  3ZJY C;  3S1M B;  1YZ6 A;  4Y7N H;  2UUA L;  3OYY A;  4WRD A;  1DJR D;  2EOT A;  1WI5 A;  1PH5 A;  1ASZ A;  1N34 L;  2PQA A;  4X64 Q;  3QOL A;  4F87 A;  3FKI H;  4A3E H;  4F88 A;  1A0I A;  4LW1 A;  4IFD I;  2QGQ A;  3I72 A;  2ZJR A;  2F0P A;  3CRK C;  3A55 A;  4KKU A;  1B50 A;  4DR2 Q;  1TWF H;  2NTT A;  1WD1 A;  3J80 E;  2QW7 A;  2WII B;  3OMC A;  4O0A A;  3KBX A;  3CMA A;  1XNR L;  3W2D A;  3BS1 A;  1JJ2 A;  5M3M B;  3MXN A;  1LO5 D;  1HZ9 A;  4KJN A;  5DNF A;  5FK9 C;  2Z8L A;  3PMF A;  1ENC A;  1B4O A;  2HIV A;  4KK7 A;  2V1C C;  3KDF A;  3TQY A;  2RQX A;  2HDM A;  3JC6 6;  2K5Q A;  1HQR D;  1LT3 D;  5GRO A;  3UE1 A;  3A5U A;  2L5T A;  5CC4 A;  3NP8 A;  3OW7 A;  2IY5 B;  2R7F A;  4RGO S;  1H9R A;  3W3A A;  3K80 C;  4P74 A;  1RDP D;  4YWK A;  3G4S A;  1Y1W G;  4JI4 Q;  2NVX B;  2Z4I A;  5KND A;  4HAE A;  4DFA A;  4EQN A;  4G7H C;  2RA4 A;  3I2Z A;  4WJW A;  1A2U A;  1Z47 A;  3S1M H;  3TRE A;  2WIN B;  1EY7 A;  4LUV A;  1E3P A;  2J4X A;  1U0L A;  4XIG S;  2AUK A;  3K81 C;  3MFY A;  1SFO B;  3MAQ A;  2ZM6 L;  4LF7 L;  5C44 B;  1FNV A;  1A2T A;  4TRD A;  4HJA A;  1X6O A;  5C0X H;  1AN8 A;  5IYC H;  3R2I A;  4YY3 Q;  3DLL A;  4HIM A;  2QF7 A;  1FGB D;  1X55 A;  4ZUI A;  3PGZ A;  5IP9 G;  3ICE A;  5IYD H;  1STY A;  2LFN A;  2NVY B;  4JPB W;  4P71 A;  4DV1 L;  2Q2H A;  5K36 G;  2R7D A;  4GLV B;  1YJ9 A;  1KRT A;  1X3F A;  1Z7T A;  2A6H D;  3TP5 A;  3FVQ A;  4OX9 L;  1JB3 A;  2O2L D;  4O42 A;  3HOW G;  1HZB A;  3ZYY X;  1VQH A;  2NN6 I;  3UDG A;  1EIH A;  3AQQ A;  1JE5 A;  5I6W A;  2HT1 A;  4JI3 Q;  4DV5 L;  3TSS A;  5JOB A;  4QQB X;  4DAP A;  1HNZ L;  4FP5 D;  1X32 A;  1Y8P B;  3S2D H;  1KTK A;  2WAC A;  2BCO A;  3HRZ C;  3H91 A;  3S17 H;  1X3Q A;  2X6G A;  1O7I A;  4ZQ3 A;  4NPS A;  1VQD A;  3S9W A;  4FF4 A;  2VNU D;  1EQV A;  5C44 G;  1V9P A;  4JI4 L;  3GTO H;  4DR4 L;  2YTV A;  1VQK A;  4JI7 L;  2NN6 H;  1VQ4 A;  4RKB A;  1WJJ A;  1B9M A;  1ONL A;  3NPP A;  2CWP A;  1X56 A;  2F4I A;  2L12 A;  1GD7 A;  4JV5 Q;  2UXC L;  2OTL A;  2K5V A;  1SYE A;  4RH6 A;  3F2U A;  2E5L Q;  2WFW A;  2E2H H;  1Q12 A;  3N52 A;  1A3U A;  1A15 A;  1MIU A;  2B63 B;  2OQ0 A;  5FO9 B;  4JI0 Q;  1Y1V G;  2EIF A;  1VQI A;  4YCU A;  3T53 B;  4JI2 L;  2AUJ D;  3KUP A;  1CM9 A;  4MN3 A;  1Q8I A;  4MIU A;  4ULL A;  1I4R A;  1FNU A;  2KED A;  1DGS A;  3HG9 A;  4IN3 A;  3FRP B;  1PYS B;  1PH6 A;  4DR6 L;  3CCS A;  4IFD J;  3NBH B;  1CK1 A;  4AH6 A;  1LTL A;  4DR5 Q;  3A74 A;  3CAM A;  1IYU A;  4NXM Q;  1Z9F A;  3KK7 A;  4OO1 G;  4GNX A;  4JYA Q;  5HY6 A;  1PH2 A;  3JAM E;  4EX5 A;  4H44 C;  4ME5 A;  1WTV A;  5LMN Q;  1PZK D;  4UPA A;  2A19 A;  3I4M B;  2N78 A;  4ID6 A;  1J8I A;  1ESR A;  1BKB A;  1CT1 D;  3RLN A;  1YJN A;  2F0O A;  4S3S A;  1PYB A;  3PO2 G;  2DY7 A;  2UXC Q;  3RLF A;  1R9T H;  1WOC A;  3PO2 H;  3GTJ H;  3NWT A;  1TQO A;  3MWY W;  3GTJ B;  3A7A B;  2Q2U A;  4FF1 A;  4BY1 G;  2A8V A;  3I90 A;  5J39 A;  2ID0 A;  3MVV A;  4FDB A;  3K5L A;  5IE8 A;  5C3E B;  5ELE A;  2MPM A;  1JIC A;  3ONA B;  3OW2 A;  4OO1 H;  4QIW B;  4DUY Q;  4DV7 L;  1GUO A;  3E5S A;  3FP9 A;  3M7N A;  1PRT C;  3KJO A;  3E0E A;  3EFX D;  2KCT A;  3SE0 A;  1X3G A;  1N36 Q;  3PO3 B;  3D4D A;  1L1O C;  2EDG A;  3IL8 A;  4YCV A;  4V0B A;  5F2D A;  3R2T A;  4JI8 L;  5FJ8 H;  1Q90 A;  1ILQ A;  1LT6 D;  1GUW A;  5JEA H;  1HUM A;  4X3K A;  2HHH L;  2AWN A;  3HOZ B;  4LFB L;  3J80 c;  2B2Y A;  2L0C A;  3MXN B;  3S1Q H;  2FHT A;  3RZO B;  1RIP A;  2A74 C;  4KHP Q;  3RN5 A;  1YNJ D;  2E8G A;  1CKN A;  4HTH A;  2JEB I;  4MTK A;  3MEH A;  2GA4 B;  2VS1 A;  1S40 A;  4L8J A;  5EPJ A;  1BCP D;  1LT5 D;  4DNI A;  1ET6 A;  4C1N K;  1QIL A;  2PNH A;  3D3R A;  1IL2 A;  1C0A A;  3MZ5 A;  2AKW B;  3NUC A;  1FGU A;  4QL5 A;  1SYG A;  3BJU A;  3J81 j;  4GLA C;  1NMG A;  3OSO A;  1SJE D;  4CBV A;  1U5K A;  4LWC A;  3OTO L;  3TBI B;  4GLX A;  2ZXR A;  1W6K A;  3Q22 A;  2B2T C;  4A93 H;  3AB9 A;  4GN4 B;  4DV7 Q;  1LTG D;  1S4Z A;  2JA5 B;  4LF6 Q;  1S3O A;  2G5D A;  4DV6 L;  1O78 A;  4IJH A;  4HIK A;  2KUM A;  3GTP H;  4AYB G;  3U4V A;  4K0K Q;  2JYO A;  1F2L A;  3J80 i;  3VR2 A;  4DAY A;  2CQA A;  3AEV A;  2AQ3 B;  1YNN C;  2K50 A;  4U68 A;  4GS3 A;  4RCN A;  4XYO A;  2XGT A;  1SRO A;  1B44 D;  1TWH B;  1GKH A;  1HZA A;  4LF9 Q;  2IHE A;  3STB C;  3H94 A;  3PV0 A;  4PV1 C;  1XMQ L;  5IP7 G;  1B1Z A;  4LMQ D;  4FXG C;  4OXP A;  1WTO A;  5IGC A;  1YJW A;  4ZCK A;  1O7L A;  4X3S A;  4OL7 A;  1HHV A;  1G91 A;  1U9R A;  1M8A A;  1Q86 C;  2J0T D;  3CXC A;  3H3V I;  2F4V L;  2N3S A;  1IHZ A;  4BA2 I;  1F9Q A;  1RTN A;  2MJ8 A;  2FMC A;  4MNO A;  2HD3 A;  2VQE Q;  5JVG 3;  1M90 C;  4JI5 Q;  1VQ6 A;  5M5X B;  3QWN A;  1N9W A;  2Q8T A;  3PUX A;  1S5C D;  1GM5 A;  1K83 B;  1KQS A;  3EN2 A;  1C9O A;  1NR2 A;  2C35 B;  4JVZ A;  3S15 B;  3H0G H;  1K3B C;  1KDA A;  4C3H G;  4LF5 Q;  2R93 G;  1TKW B;  5HGT A;  1VQM A;  4CDE C;  1E1T A;  1CSP A;  1ENA A;  5M5Y H;  4GOP B;  2I0Q A;  4A3K B;  1B3A A;  1B3Q A;  4DXG A;  4N9T A;  5IY0 A;  3DWP A;  2K04 A;  3S14 B;  4HR7 B;  1TY0 A;  4BY7 G;  4QJF A;  1EWH A;  3VDY A;  1HRJ A;  1P16 A;  4EQO A;  3WOF A;  1VQE A;  2GVA A;  5GAG C;  2GN5 A;  2F0N A;  1F9S A;  2PMZ E;  2H4O A;  2QDB A;  3RZD H;  2JP1 A;  4XQN A;  1QVF A;  1B70 B;  4CDC C;  2BH8 A;  4C2M H;  4N9P A;  4DNR B;  4A3J G;  4A3G B;  4LUZ A;  4OO1 I;  1WYD A;  5IOC A;  5M3M H;  1Y1V B;  3SK4 A;  2WKC A;  4LF7 Q;  1MHW C;  1EEI D;  2L1B A;  5M3F B;  2K5W A;  3Q24 A;  2PZT A;  1EUJ A;  5AJ3 L;  1KRS A;  4JI3 L;  3F8T A;  4RCO A;  1W2B A;  3HKZ G;  1Q1E A;  3I8Z A;  1V1P A;  4OIK A;  4RGT A;  3T56 B;  2K5N A;  1DM0 B;  1YHA A;  3F2C A;  4PMC A;  1OXU A;  2Z6B A;  5IP7 H;  4A3B H;  4A3L H;  1SE3 A;  2K33 A;  3Q6S A;  2A73 B;  1N32 Q;  2UXB L;  1TWH H;  1SE2 A;  1N36 L;  4OWW B;  3MEF A;  2LXK A;  2E2H B;  4M8A A;  3T4A C;  1S5E D;  5ISR A;  1NBW A;  1VQG A;  1A63 A;  2IL8 A;  2ENB A;  1I6V C;  2MP1 A;  3UDF A;  4IFD G;  2B8G A;  1BXT A;  2FXQ A;  1GUG A;  3U9O A;  4LF5 L;  5BN4 A;  1I5F A;  4LAA A;  3TN2 A;  4M1U B;  5DM6 3;  2ALY B;  2ZT9 C;  4GKJ Q;  4A3J B;  4FF2 A;  2K32 A;  1XNR Q;  4EGV A;  1PHJ A;  5I2X A;  3K6O A;  5KYI A;  3GTG B;  1D7Q A;  1CZW A;  3U58 A;  1SE4 A;  4P73 A;  1L1O A;  1WCM B;  1I4Q A;  3KFU A;  3DXJ C;  4R9W A;  3GTQ H;  1CQF A;  1JOQ A;  3K5O A;  4X65 L;  1OO9 B;  1CTM A;  3DEP A;  1VQL A;  3VYR A;  2B2Y C;  2XTI A;  4XXE A;  1S5B D;  2PPB C;  1N32 L;  1VQ5 A;  4P2C B;  4NXM L;  1QJO A;  1I50 B;  1RJT A;  2G9D A;  4IUV A;  4JG2 A;  5J3B A;  1CA5 A;  2OWO A;  4B3M Q;  1EIF A;  2F0Q A;  4JC0 A;  3J7A 5;  4A4I A;  3ERS X;  5C3X A;  3OMG A;  3VR5 A;  1RL2 A;  1EY4 A;  5FO8 B;  3HOV G;  2BH2 A;  4QY7 A;  1Q81 C;  3D4R A;  1CFM A;  3DM1 A;  4NXN L;  3KJP A;  5IGE A;  1S72 A;  1LV9 A;  1SNM A;  1WVL A;  3O13 A;  2F0I A;  1PH4 A;  1WTX A;  4GKJ L;  4JI6 L;  2BOS A;  1DXM A;  1EY6 A;  2NZ1 D;  1KAA A;  2CQO A;  1ESF A;  4DR6 Q;  5IGF A;  3M4O B;  4RG1 A;  2B2T A;  1K9M C;  3SXH A;  4DF7 A;  1IBL Q;  2CVR A;  2L55 A;  1LTT D;  3C1F A;  1L1O B;  3AMU A; 
#chains in the Genus database with same CATH homology
 1KAB A;  4K5V A;  4MHE A;  2JA8 B;  5IGB A;  4BA1 I;  1BCP F;  4FNF A;  3WOE A;  3FPP A;  4XDX A;  3RD4 A;  4NDX A;  4K5W A;  1ET9 A;  3PIP 3;  5NUC A;  3I3C A;  3V2T A;  5C5M A;  1LT4 D;  1BCP B;  5EPL A;  5I2Y A;  3M7G A;  5CV9 A;  1S5D D;  3RZD B;  2F0M A;  1MGS A;  4EQP A;  2Q8R E;  5A2Q L;  4K5X A;  1LTI D;  1NUC A;  4BWG B;  5DAU A;  3SHL A;  3S2D B;  3E6Z X;  2YYZ A;  4DN4 M;  4KY5 A;  3P75 A;  3R3O A;  1LTB D;  4G7Z C;  3WDN A;  2NUC A;  3AU7 A;  2VB3 X;  5A35 A;  3I4N B;  2F0W A;  1EY5 A;  4V19 0;  3H3V C;  1OXX K;  5CV6 A;  2PZW A;  1ROD A;  3L3O C;  3K5M A;  1IKL A;  1BUV T;  3SEB A;  2X69 A;  4R8I A;  2SNS A;  1I4P A;  4RHR A;  1J9O A;  2IX3 A;  2I46 A;  3E0J A;  3QJY A;  4X3U A;  2OT2 A;  2XRQ D;  2RKS A;  3L7Z C;  4DU9 A;  3Q0A A;  5KRU A;  1EZ8 A;  1BOS A;  3FEW X;  4UAI A;  1DZ1 A;  3KF8 A;  2JXM B;  1DD2 A;  4BY1 B;  4H0L C;  3TP8 A;  4L63 B;  2F0V A;  4TSS A;  3CQZ B;  4TKO B;  2QIL A;  5K36 H;  4KV6 A;  4FXK C;  2LS0 1;  1IL8 A;  1H9K A;  2C9O A;  2EPB A;  5JJZ A;  2KEC A;  2KOL A;  1YNJ C;  4RKL A;  3P20 A;  3EVQ A;  3VYS A;  2FJ2 A;  1PXU A;  1GOZ A;  5A2Q E;  1VCI A;  2F0U A;  4RWS C;  4IUU A;  2XN9 C;  3NTI A;  3MA2 B;  3T13 A;  2PQE A;  4BBR B;  5K5P A;  4DXF A;  5C3W A;  5T1G A;  3A8K E;  1JOR A;  1QNU A;  3ITP A;  2FIN B;  2OF1 A;  4HSP A;  1TWG B;  2ZXO A;  4HN7 A;  2MHV A;  2EYF A;  4CJ1 B;  3K59 A;  3HS0 C;  1NR4 A;  2D62 A;  1M4V A;  1NAP A;  3UI2 A;  2EY2 A;  3SVM A;  1HFG A;  3NK9 A;  3H6M A;  3HOV B;  1I4H A;  2SNM A;  3PUY A;  2IPK D;  5J1Z A;  2HDL A;  2DNE A;  4CKC A;  2KVM A;  4YIJ A;  2KEE A;  2KJX A;  2E74 C;  2DY8 A;  1BDO A;  5KNB A;  4K2K A;  1F9P A;  4IUP A;  4PMW A;  1TWF B;  1CQV A;  1KLU D;  4FXD A;  1NCV A;  4QUF A;  4HCE A;  3NXW A;  4E6I A;  3URY A;  1PFB A;  3FMC A;  2IW3 A;  2EVB A;  3D4W A;  4KKS A;  3GV3 A;  3NE5 B;  1IW7 C;  1V1O A;  1QOH A;  4ZKB B;  4C3J G;  2NB0 A;  4UDU C;  1HQM C;  2N88 A;  1SMY C;  4A93 B;  5I4D A;  4LK1 C;  1F2Y A;  3J81 E;  1FNW A;  4B9X A;  1A3V A;  3BG3 A;  2BA0 A;  4LJZ C;  1XWE A;  4IFD H;  5M5W B;  2N55 A;  1TR5 A;  1JCK B;  1D1I A;  3TDQ A;  3BVG A;  4C56 C;  3K0Y A;  1Y1W B;  1GUS A;  1R4P B;  5E3F A;  3FKI B;  4RA8 A;  3BZD B;  2XIW A;  1XYI A;  4CHT B;  3HGB A;  4KI0 A;  3D6W A;  1GJX A;  1SXT A;  2EYP A;  5DM7 3;  1QG7 A;  3N6R A;  4ILW A;  3DEO A;  4IUN A;  1A6X A;  1G8Z D;  1D5M C;  5ELD A;  5IGG A;  1D5Z C;  2BDN A;  4FF3 A;  2Q8I B;  4C1N I;  1DOL A;  1Q1B A;  1VF5 C;  1DOM A;  4DAV A;  2PMZ B;  1TII D;  2KA7 A;  4A3D B;  2R7Z B;  5DEH A;  4J8Q A;  1IW7 D;  1Y69 U;  2MGS A;  1EFI D;  5JEA G;  2R61 A;  2EJG C;  3MTS A;  5C0X J;  2B2W C;  2F0H A;  1TWC B;  2EYH A;  5M9O A;  2EE1 A;  1HPC A;  4G57 A;  1LTR D;  5CGK A;  1V1P B;  3HOU B;  4TQU S;  5CR3 A;  3KBG A;  3CKI B;  2A6H C;  1ZKO A;  2O5J C;  1SYF A;  2JSO A;  5CV4 A;  4CKE A;  1C48 A;  4QMG A;  1EYC A;  3BDC A;  3GTM B;  2KQ3 A;  1SNC A;  1X3P A;  1HFN A;  1BQQ T;  5KGU A;  4K2L A;  1JE4 A;  4ZAI A;  4ZKC B;  5FOB B;  1ZXT A;  1BBX C;  4CKB A;  2J7Z A;  4K6D A;  1H9S B;  2L11 A;  2XRS D;  5EKI A;  2KCN A;  3FDT A;  2HCI A;  3I73 A;  3LX0 A;  5D3I B;  3HP3 A;  2PCF B;  2ZXP A;  2CHB D;  4I7Z C;  5HUR A;  3D6C A;  1RHP A;  5LL6 S;  2PYK A;  3A56 A;  1ML0 D;  3QB3 A;  1RD9 D;  1U4P A;  1D6E C;  3TZU A;  1R4Q B;  1BO0 A;  2OEO A;  5EKK A;  2IWH A;  1QNK A;  1SNP A;  3NQI A;  5JAV A;  5D3D A;  2A68 C;  2SOB A;  2QKI C;  1EIG A;  1TS5 A;  2B2U A;  4QCL A;  1S5F D;  1WTP A;  2XWB B;  1HCZ A;  3GTQ B;  2JA7 B;  3PIO 3;  4XT1 B;  1PRT B;  3PO2 B;  1RF2 D;  3D31 A;  2E75 C;  5C4H A;  3OIQ A;  1G2S A;  4XQQ A;  1C8C A;  2JEA I;  1LLR D;  2PW5 A;  2C5C A;  3HOW B;  4C2M B;  3H09 A;  1CA6 A;  5AFW A;  2F0J A;  1I4X A;  2NYZ D;  1AEX A;  1WTQ A;  2WP8 J;  3KLR A;  4KD4 A;  3HOX B;  2WKD A;  1KNE A;  3OHX C;  2D5D A;  1B9N A;  5C0X G;  3NSW A;  1BF4 A;  3FPU B;  2XWJ B;  1JR0 D;  1T5X D;  3T16 A;  4FYD A;  4A3B B;  3EQL C;  2XNA C;  1PTO C;  1PTO B;  2AQ1 B;  3OIP A;  1B53 A;  1STH A;  4KJO A;  1EZ6 A;  2RSN A;  1EL0 A;  3JAM L;  5E4X A;  4G7O C;  1PDQ A;  3VA5 A;  5LHY 1;  2MUY A;  1XXG A;  1SEB D;  2F0K A;  1QB5 D;  2EYO A;  1B2T A;  2SDF A;  3U9S A;  1EOT A;  2M2L A;  4XTC S;  3NBI A;  5IT9 E;  4B9W A;  2Z4H A;  4HSV A;  3CRL C;  1OXS C;  2F0D A;  2XSC A;  2B2W A;  2F0S A;  1JWS D;  1H9S A;  4Z9C B;  3OWE B;  5EKL A;  2NWG A;  4KMU C;  4RAU C;  2I07 B;  1IKM A;  1ICW A;  3VR4 A;  2QCP X;  3GTP B;  2X6L A;  4C3H B;  1Q3L A;  1CI3 M;  4EVO A;  1GHJ A;  2EY1 A;  2F0G A;  5LL6 X;  3MXP A;  1SMY D;  5FLX L;  4Q5V A;  3J7Y W;  2K6A A;  4QUC A;  4K14 A;  1MBY A;  3HEJ A;  3MC0 B;  1EWC A;  3LWE A;  3M3Y B;  3K5N A;  4NKL A;  5JPM C;  2F03 A;  1AP0 A;  2NTS A;  2KCC A;  5CBE E;  3OWF A;  1EY8 A;  4IUT A;  3BVM A;  1UUP A;  1LAC A;  3H0G B;  2F0T A;  3C2P A;  5EPK A;  2BDO A;  4WFN 3;  2OXP A;  2HQE A;  4KY7 A;  4B08 A;  1L0Y B;  2NBF A;  3J81 L;  5IGD A;  2FFK B;  1AZQ A;  1ILP A;  1Y8O B;  3GV6 A;  2WAQ B;  2L4N A;  1LAB A;  1TVX A;  5G3L D;  5C5L A;  2NVT B;  1PFN A;  1TS2 A;  4KKT A;  5CV7 A;  3IFD A;  3ND9 A;  1EU3 A;  4IQZ A;  3BVZ A;  2A68 D;  4J6H A;  1TY2 A;  1D5X C;  2E2J B;  2Y0S B;  1TS4 A;  2A69 D;  4K8I A;  4OHJ A;  3LNN A;  4XQJ A;  1SNO A;  3S1N B;  3DMU A;  4DGZ A;  1SYD A;  3MXG A;  4JK1 C;  4ZUJ A;  2B2U C;  5FO7 B;  3Q23 A;  3CU7 A;  1DON A;  1II3 A;  2PW7 A;  3SK5 A;  5D14 A;  1HTL D;  2R92 B;  4RFB A;  4KY6 A;  2A5H A;  1G29 1;  3IKJ A;  1YNN D;  3LWU A;  1UAP A;  1F2M A;  1AW7 A;  3EJI A;  3TP7 A;  2VXW A;  1QCB D;  4C3J B;  5COY A;  5KYL A;  1KDC A;  1EY9 A;  4ZYS A;  3M85 A;  5EGT A;  2LY7 A;  3T51 B;  3GD7 A;  4OGQ C;  1O80 A;  4A3F B;  3QO2 A;  1EY0 A;  3BDL A;  2E2I B;  2RVL A;  1IYV A;  2F0L A;  2F1M A;  1STG A;  2BE5 C;  2YU9 B;  1RTO A;  3GTO B;  4RHS A;  4IZ8 A;  2WV6 D;  2A6E C;  5C0X I;  2EYM A;  1TWA B;  1VF7 A;  1V8Q A;  2KHS A;  1L0X B;  5T1I A;  3DUZ A;  5JPN C;  3G6J B;  3C3L A;  3SR1 A;  1MSH A;  2NN6 G;  1EQT A;  4I65 A;  4ZK9 B;  5CBA E;  3OPO A;  1W6J A;  1PYW D;  5CV8 A;  1SJH D;  3BDO A;  3GQB A;  2HUG A;  2A69 C;  3SK8 A;  4ZRZ A;  2RBM A;  3P1H A;  3DWA A;  3BYY B;  2D2C C;  3NBH A;  4ODG A;  2E2D C;  1AFP A;  2F3W A;  1TT2 A;  3V96 A;  4X3T A;  1QWY A;  3K7A B;  3KLS X;  4FVM A;  3S2H B;  2R6G A;  4K6L A;  3HOY B;  5ELB A;  5EBC A;  1XTC D;  2R93 B;  3DHQ A;  1KNA A;  5FKA C;  3A8I E;  3IFT A;  4NW2 A;  3SDZ A;  1PTO D;  2H1E A;  4BY7 B;  4KN7 C;  1BCP C;  4XYQ A;  1PRT D;  4IAL A;  3VA7 A;  4QB4 A;  5TSS A;  1SAP A;  4PMB A;  5IT9 L;  1U4L A;  1G6Z A;  2IX0 A;  1LTA D;  1TU2 B;  1F77 A;  1BNZ A;  4H7B A;  5KEE A;  3I70 A;  4FO2 A;  2ICI A;  3D8G A;  4C3I B;  2D9U A;  2CW0 D;  3GO5 A;  4XT3 B;  4IUR A;  4F7X A;  2EY5 A;  3J7A V;  2A6E D;  5BN5 A;  1C4Q A;  3A7L A;  5JEA J;  4KN4 C;  1FYC A;  2IT1 A;  4R8N A;  1RCV D;  2PO4 A;  4KD3 A;  5KIX A;  1G2T A;  4ZLT F;  1PRT F;  3MHB A;  2IJ0 A;  4A3I B;  4KTA A;  1U4M A;  2K5D A;  1E2Z A;  3A8J E;  1SNQ A;  1SDF A;  1T5E A;  3SK6 A;  2E76 C;  2JE6 I;  1STB A;  3GTL B;  2EJM A;  5I9P A;  5I9O A;  5EJW A;  1LTS D;  1U4R A;  1Z6H A;  1NSN S;  1D1K A;  3BYT B;  1ENF A;  4DK1 A;  2RDF A;  5IIF A;  3MXU A;  2FMM A;  3EA6 A;  3P7J A;  5C4Z A;  2EJF C;  5E4W C;  2IX1 A;  3S1R B;  1F9R A;  1PTO F;  1E2V A;  5CV5 A;  4KHZ A;  2JA6 B;  2BE5 D;  2Z1C A;  4O1N A;  1F2Z A;  3VR3 A;  1KLG D;  3QOJ A;  1I6H B;  3VYU A;  4KHV A;  1JC7 A;  5C4J B;  4PQX A;  1JWM D;  2CW0 C;  3TZD A;  2L9H A;  1SBB B;  5D65 A;  1UEA B;  5BN3 A;  3NHH A;  5ELF A;  1K8O A;  1MD2 D;  1WD0 A;  4RGM A;  3NWS A;  1HTP A;  1JQY D;  5IOD A;  2B2V A;  1CHQ D;  3RMH A;  2K05 A;  1PZJ D;  1R9T B;  1KDB A;  5C4X B;  5E1F A;  3DWQ A;  1OXT A;  4G4K A;  1SYC A;  1STE A;  3MFG A;  4H13 C;  3I91 A;  4CGY B;  3NTK A;  4K8J A;  2DN8 A;  2F0F A;  2B39 A;  2M9V A;  1EYA A;  1EEF D;  1D2B A;  3C1E A;  3CHB D;  1STA A;  2V4D A;  2VB2 X;  4F8M A;  4DNT B;  1XX8 A;  1A3T A;  1PTO H;  4HCS A;  1E2W A;  1V43 A;  3R8B A;  1O7Z A;  2PZU A;  3K58 A;  3J7A F;  4HMI A;  1E0B A;  5C6A A;  3IAY A;  2O4X A;  1MSG A;  3M4Y A;  4NP5 A;  1O7Y A;  2EYJ A;  1GUT A;  1GXD C;  2BA1 A;  3G7L A;  5JVH 3;  5EBD A;  4BS9 A;  3ND8 A;  5ELC A;  3HKZ B;  1GHK A;  1ZEQ X;  4JBW A;  1I3Q B;  2RDG A;  5G3L F;  4Q0F A;  3NQT A;  3GTK B;  1GUN A;  2AWO A;  3VR6 A;  2NVQ B;  3ERQ A;  1SYB A;  1DCZ A;  5EQ0 A;  1ZYR D;  4A3M B;  5CMD A;  4AYB B;  1WTW A;  1FD7 D;  1FR3 A;  3NTH A;  2EXZ A;  2AQ2 B;  3VYT A;  1JOK A;  4L6T B;  1K8M A;  2PNR C;  1DYQ A;  1CZG A;  1SND A;  1PLF A;  3ERO A;  4NMZ A;  2QEJ C;  4WOR A;  4RGN A;  2TSS A;  1BR9 A;  3V05 A;  1QE6 A;  2K1B A;  1VDZ A;  4BBS B;  3L9A X;  3KLS A;  4DA2 A;  4GZY C;  3HZX A;  4QF4 A;  1CHP D;  4HMJ A;  2DNC A;  1HUN A;  2VUM B;  3S1Q B;  2WB1 B;  3K57 A;  2LMC B;  4C3I G;  1HA6 A;  2RSO A;  4OIJ A;  2K7V A;  3PUW A;  3GP7 A;  1OXV A;  3A54 A;  2F0E A;  5J22 A;  3X3N A;  1TS3 A;  5CYU A;  2HCC A;  1SSO A;  5FLX E;  1H9J A;  3OOC A;  3TP6 A;  1RKN A;  2XVS A;  2M00 A;  5COR A;  1DOK A;  1EYD A;  4CJ0 B;  1STN A;  1VMP A;  1PZI D;  2G9H D;  5M5Y B;  2B8F A;  3QG1 A;  3R93 A;  3S16 B;  1AZP A;  3PUZ A;  1H9M A;  4CJ2 C;  3X3M A;  4DK0 A;  4A3E B;  1I4G A;  4U67 3;  2K01 A;  4J1M A;  2LKV A;  2TMP A;  1MI2 A;  2ICE C;  4HED A;  1VMC A;  1JOO A;  2EZV A;  1ZYR C;  2O5I C;  1WTR A;  2B2V C;  1PFM A;  3S17 B;  5I6Y A;  2K28 A;  1PMR A;  2SEB D;  4IUQ A;  4Y7N B;  1JWU D;  2R3Z A;  1HXY D;  1Y8N B;  3I4L A;  4PNY A;  1EU4 A;  2EY6 A;  2K03 A;  3PUV A;  3TME A;  1UNS A;  2EYL A;  5KNC A;  3J80 L;  2RDH A;  3RUZ A;  4ABN A;  2F3V A;  3QIA A;  3C46 A;  1HA5 A;  3S1M B;  4WRD A;  1DJR D;  2EOT A;  3QOL A;  4F87 A;  4F88 A;  4IFD I;  3I72 A;  2F0P A;  3CRK C;  3A55 A;  4KKU A;  1B50 A;  2NTT A;  1WD1 A;  3J80 E;  2WII B;  3OMC A;  3KBX A;  3W2D A;  3BS1 A;  5M3M B;  3MXN A;  1LO5 D;  4KJN A;  5DNF A;  5FK9 C;  2Z8L A;  3PMF A;  1ENC A;  1B4O A;  4KK7 A;  2RQX A;  2HDM A;  2K5Q A;  1HQR D;  1LT3 D;  2L5T A;  5CC4 A;  3NP8 A;  3OW7 A;  4RGO S;  1H9R A;  3W3A A;  1RDP D;  2NVX B;  2Z4I A;  5KND A;  4HAE A;  4DFA A;  4EQN A;  4G7H C;  2RA4 A;  4WJW A;  1A2U A;  1Z47 A;  2WIN B;  1EY7 A;  2J4X A;  4XIG S;  2AUK A;  3MFY A;  1SFO B;  3MAQ A;  5C44 B;  1FNV A;  1A2T A;  4TRD A;  5C0X H;  1AN8 A;  3R2I A;  2QF7 A;  1FGB D;  4ZUI A;  1STY A;  2LFN A;  2NVY B;  5K36 G;  1Z7T A;  2A6H D;  3TP5 A;  3FVQ A;  1JB3 A;  2O2L D;  4O42 A;  3ZYY X;  2NN6 I;  1EIH A;  5I6W A;  3TSS A;  5JOB A;  4DAP A;  4FP5 D;  1X32 A;  1Y8P B;  1KTK A;  2WAC A;  2BCO A;  3HRZ C;  3H91 A;  1X3Q A;  2X6G A;  4ZQ3 A;  3S9W A;  4FF4 A;  2VNU D;  1EQV A;  2NN6 H;  4RKB A;  1B9M A;  1ONL A;  3NPP A;  2F4I A;  2L12 A;  1SYE A;  4RH6 A;  3F2U A;  1Q12 A;  3N52 A;  1A3U A;  1A15 A;  2B63 B;  5FO9 B;  3T53 B;  2AUJ D;  3KUP A;  1CM9 A;  4MN3 A;  1Q8I A;  4MIU A;  4ULL A;  1I4R A;  1FNU A;  2KED A;  3HG9 A;  4IN3 A;  3FRP B;  4IFD J;  1CK1 A;  1IYU A;  3KK7 A;  4OO1 G;  3JAM E;  1WTV A;  4H44 C;  4ME5 A;  1PZK D;  3I4M B;  4ID6 A;  1J8I A;  1ESR A;  1CT1 D;  2F0O A;  4S3S A;  2DY7 A;  3RLF A;  3NWT A;  1TQO A;  3MWY W;  3GTJ B;  3A7A B;  4FF1 A;  3I90 A;  5J39 A;  2ID0 A;  3MVV A;  3K5L A;  5C3E B;  5ELE A;  2MPM A;  1JIC A;  3ONA B;  4OO1 H;  4QIW B;  1GUO A;  3E5S A;  3M7N A;  1PRT C;  3EFX D;  3SE0 A;  3PO3 B;  3D4D A;  2EDG A;  3IL8 A;  4V0B A;  5F2D A;  3R2T A;  1ILQ A;  1Q90 A;  1LT6 D;  1GUW A;  5JEA H;  1HUM A;  4X3K A;  2AWN A;  3HOZ B;  2B2Y A;  2L0C A;  2FHT A;  3RZO B;  2A74 C;  1YNJ D;  4HTH A;  2JEB I;  3MEH A;  2GA4 B;  4L8J A;  5EPJ A;  1BCP D;  1LT5 D;  1ET6 A;  4C1N K;  1QIL A;  3D3R A;  3MZ5 A;  3NUC A;  1SYG A;  3OSO A;  1SJE D;  4CBV A;  3TBI B;  2ZXR A;  1W6K A;  3Q22 A;  2B2T C;  3AB9 A;  1LTG D;  1S4Z A;  2JA5 B;  1O78 A;  2KUM A;  2JYO A;  1F2L A;  3VR2 A;  4DAY A;  2CQA A;  2AQ3 B;  1YNN C;  4U68 A;  4RCN A;  4XYO A;  1B44 D;  1TWH B;  3H94 A;  3PV0 A;  4PV1 C;  1B1Z A;  4LMQ D;  4FXG C;  1WTO A;  5IGC A;  1O7L A;  4X3S A;  4OL7 A;  1HHV A;  1G91 A;  1U9R A;  1M8A A;  2J0T D;  1IHZ A;  4BA2 I;  1F9Q A;  1RTN A;  2MJ8 A;  2FMC A;  5JVG 3;  5M5X B;  3QWN A;  2Q8T A;  3PUX A;  1S5C D;  1K83 B;  1NR2 A;  3S15 B;  4C3H G;  1KDA A;  1TKW B;  5HGT A;  1ENA A;  4A3K B;  1B3A A;  4DXG A;  4N9T A;  3DWP A;  2K04 A;  3S14 B;  4HR7 B;  1TY0 A;  1EWH A;  1HRJ A;  4EQO A;  3WOF A;  2F0N A;  1F9S A;  2H4O A;  2QDB A;  2JP1 A;  4XQN A;  4N9P A;  4DNR B;  4A3G B;  4OO1 I;  5IOC A;  1Y1V B;  3SK4 A;  2WKC A;  1EEI D;  2L1B A;  5M3F B;  2K5W A;  3Q24 A;  2PZT A;  4RCO A;  1Q1E A;  3I8Z A;  1V1P A;  4OIK A;  4RGT A;  3T56 B;  1DM0 B;  4PMC A;  1OXU A;  1SE3 A;  2K33 A;  3Q6S A;  2A73 B;  1SE2 A;  2E2H B;  4M8A A;  3T4A C;  1S5E D;  5ISR A;  2IL8 A;  2ENB A;  1I6V C;  2MP1 A;  4IFD G;  2B8G A;  1BXT A;  1GUG A;  3U9O A;  5BN4 A;  4LAA A;  3TN2 A;  4M1U B;  5DM6 3;  2ZT9 C;  4A3J B;  4FF2 A;  2K32 A;  4EGV A;  5I2X A;  3K6O A;  5KYI A;  3GTG B;  1CZW A;  1SE4 A;  1WCM B;  1I4Q A;  3DXJ C;  4R9W A;  1JOQ A;  1CQF A;  3K5O A;  1CTM A;  1OO9 B;  3DEP A;  3VYR A;  2B2Y C;  4XXE A;  1S5B D;  2PPB C;  4P2C B;  1QJO A;  1I50 B;  1RJT A;  2G9D A;  4IUV A;  1CA5 A;  2F0Q A;  5C3X A;  3OMG A;  3VR5 A;  1EY4 A;  5FO8 B;  3D4R A;  1CFM A;  3DM1 A;  5IGE A;  1LV9 A;  1SNM A;  1WVL A;  3O13 A;  2F0I A;  1WTX A;  2BOS A;  1DXM A;  1EY6 A;  2NZ1 D;  1KAA A;  1ESF A;  5IGF A;  3M4O B;  2B2T A;  3SXH A;  4DF7 A;  2CVR A;  2L55 A;  1LTT D;  3C1F A;  3AMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...