3I90A

Crystal structure of human chromobox homolog 6 (cbx6) with h3k27 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
50
structure length
50
Chain Sequence
RVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Chromobox protein homolog 6
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 50
sequence length 50
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i90A00
2RSOA 1O80A 1WTVA 2N55A 1EIGA 3LWEA 3DEPA 3D6WA 4IUPA 4UAIA 5CORA 4MN3A 4QUCA 2Q8TA 4ZK9B 2B2TA 1DOKA 2X6LA 5CBEE 1U4LA 2B2WA 1F9RA 4HAEA 4XDXA 2K1BA 1ILQA 2SDFA 2B2VA 4X3SA 1WTOA 1NAPA 1F9PA 4OIJA 2RA4A 4ZLTF 5CMDA 2JYOA 4DN4M 2B2UC 5AFWA 1A15A 1BNZA 1X32A 1IKMA 1G6ZA 4RAUC 4ZKCB 3KBXA 1RODA 1CA6A 2DY8A 1F9SA 2J7ZA 1DONA 1EL0A 4RWSC 1AZPA 2M2LA 2EPBA 2NWGA 2KEDA 1J9OA 1NR4A 1SSOA 2HDLA 1ICWA 2K01A 4CJ2C 3P7JA 1B53A 4HEDA 5EKIA 1KNAA 5EJWA 2IL8A 1SDFA 2X6GA 5COYA 1HHVA 3GV6A 1HRJA 4IUTA 4LMQD 3G7LA 2EE1A 4ZAIA 2KECA 1M8AA 1PFBA 1PLFA 2KOLA 2KUMA 1G2TA 1LV9A 2MGSA 2VXWA 3IL8A 2HCIA 2BDNA 1WVLA 1U4RA 1XX8A 2NYZD 1PDQA 2RSNA 1TVXA 1DOMA 1WD1A 2B2YC 1WTXA 1CM9A 1CA5A 1ESRA 4IURA 1XYIA 2FMMA 1X3QA 4X3KA 3H91A 2XIWA 2KVMA 4CJ1B 2D9UA 1HFGA 2NZ1D 1WTQA 1QNKA 2B2VC 1BF4A 2HCCA 1IKLA 3N52A 5EPKA 5JJZA 2MJ8A 1QG7A 1ILPA 1PFNA 2K03A 1J8IA 1IL8A 1DOLA 2H1EA 1HFNA 2L12A 4U68A 5DNFA 2JP1A 1PFMA 5E4XA 1B50A 4CJ0B 2K05A 2B2UA 5T1GA 3FDTA 5EQ0A 4IUUA 1RJTA 2KEEA 1MSHA 4IUQA 4RA8A 1KNEA 2L4NA 3I8ZA 3DEOA 2X69A 1ML0D 1HUMA 1RTNA 2L11A 2L9HA 3QO2A 1EQTA 2FINB 3F2UA 1QE6A 1O7ZA 2B2TC 2K04A 5T1IA 1BO0A 1MGSA 2B2WC 4O42A 2RVLA 2R3ZA 3IFDA 3KUPA 4MHEA 4XT1B 5D65A 3HP3A 5EPLA 1JICA 5D14A 1B4OA 1C8CA 1O7YA 4R9WA 4ZKBB 1WTRA 3Q6SA 2HUGA 1DZ1A 2CVRA 1HA6A 2MP1A 2HDMA 5CBAE 2DY7A 1NCVA 4QUFA 4IUVA 1SAPA 2FHTA 1F9QA 2B2YA 1VMCA 2K28A 1B2TA 4X3TA 5E4WC 1G2SA 3DM1A 3TN2A 4R8IA 1WTPA 3R93A 3MTSA 3FPUB 3MWYW 1WD0A 1X3PA 1MSGA 2EOTA 1AZQA 1B3AA 1Q3LA 2L1BA 4XT3B 2N88A 4NW2A 1RHPA 2FJ2A 1JE4A 1EOTA 4X3UA 1WTWA 1HUNA 1BBXC 1S4ZA 1MI2A 4HCSA 1NR2A 1RTOA 1AP0A 3I3CA 1GUWA 4HSVA 3TZDA 2MPMA 1F2LA 2Q8RE 3SVMA 5EPJA 4OIKA 1E0BA 1ZXTA 1EIHA 3GV3A 3I90A 1VMPA 1U4MA 3ONAB 1U4PA 3UI2A 3I91A 2FFKB 1G91A
chains in the Genus database with same CATH superfamily
4L8JA 2NVQB 1YZ6A 1WTVA 2PNHA 4OONA 1EIGA 5CORA 1C9OA 4FF1A 4MN3A 1CHPD 4NDXA 3S16B 1NMGA 5IOCA 2KHIA 3CCQA 1ENFA 4A93H 2A6ED 3EROA 2XNAC 4PZ8A 4A3JH 1TKWB 3FMCA 4JOIC 1VQGA 4ODGA 5IP7H 4DV7L 1V1OA 3H0GH 2WKDA 1STYA 4X65L 1CQFA 4LJZC 1XMOQ 4DV4Q 4BY7G 3VYUA 4TSSA 1NTGA 5IE8A 4JI0Q 1KNAA 3LGJA 1C0AA 4BBRG 2RBMA 3KF8B 4K5WA 4FF4A 3FVQA 3PQIA 1EFID 2ZT9C 2D0PA 4A3EH 2E5LL 1LUZA 4DAYA 4QQBX 3PIP3 5M3MG 1KDCA 4R4IA 3VYSA 1N32L 2A68D 4LF5L 1KL9A 5M3FG 4BY1G 3MXGA 4YCWA 3E5SA 1E3PA 2E2IH 3T1YL 1QNKA 2B2VC 1WTQA 3N52A 2LS01 5JVG3 5M5XH 4DV0L 2A73B 2ZTCA 2IJ0A 1DOLA 3KLSX 1HFNA 5DNFA 3P75A 1YNJD 2CCZA 1FGBD 2H5XA 1KC8C 1HNWQ 2ICIA 1CKOA 2B29A 1Z47A 3M7GA 2CHBD 1L2FA 3MXUA 4YWLA 5KYLA 3C46A 2XWJB 5C5MA 4X64Q 1E2VA 1KQSA 1X65A 2DN8A 2AWNA 4A3IB 1STAA 3KUPA 1PH6A 5JOBA 5C4HA 3BG3A 4RGNA 2NN6H 4KMUC 3PIOA 3CQZH 4QUFA 5C3EH 5JAVA 2B63B 5E4WC 1I4GA 4JV5Q 3AB9A 3HOZB 3M85A 1C7YA 2K5DA 4BXXG 1RHPA 4EQ5A 4YWKA 3KJOA 4WJ3M 1S4ZA 4NPSA 1JMCA 1FD7D 4HSVA 1VF7A 3FRPB 1CT1D 2WAQB 5C3XA 2JQOA 5IP9H 3HEJA 4FYDA 1O80A 5ELDA 3TBIB 3PO3B 1W3SA 3MHBA 3S15H 1H9RA 4KHZA 4K14A 4JI8Q 2CQAA 3H09A 1U4LA 3NENA 4A3BB 3X3MA 4YWMA 4HIDA 2ENBA 3AU7A 1NMFA 2HHHL 1F9PA 1YHBA 5FO8B 4DN4M 2L55A 2K50A 1I3QH 3EN2A 3VR5A 3L2PA 3CMEA 1F9SA 3TMEA 3OTOQ 3RN5A 1FNWA 3GTMH 4ILWA 1S5ED 1JOOA 2AUJD 1PRTC 1RKNA 3KF6A 1E2WA 1DJRD 2KECA 4PQXA 2VXWA 2RDGA 3EQLC 4GN4B 3BDCA 4AQYQ 2F0KA 1XNRL 2K33A 3HOVB 3LWUA 1OXVA 4EQOA 1A2UA 3MC0B 1HFGA 1KLGD 1MKHA 4OELB 1W2BA 1UWVA 3H3VI 4X66L 4C3IG 2E2IB 4B9WA 2F3WA 2K03A 1Y1WG 4WJWA 5J3BA 1WCMH 1Y14B 4FVMA 1MJEA 3LNNA 2B8GA 4IUQA 4F8MA 1O7IA 1X56A 3I8ZA 1VQ6A 2F3IA 1T5XD 3NWSA 2MFIA 4DK0A 3I4LA 2QA4A 2JA6H 3QO2A 1D1IA 1KLUD 1A6XA 2JEBI 4JW0A 4JI3L 2QEXA 1EYCA 3CMAA 1YNXA 2B2WC 2A69D 2F0PA 2QDLA 1N34L 4ZYSA 1EYAA 3I2ZA 2UUAQ 5FO7B 1HNXL 2A1AA 1K83H 3BJUA 5G3LD 5IGEA 1PXUA 3DWPA 5C3EB 1IYJB 1JORA 1L0XB 4XYQA 2N88A 4OGQC 4P71A 4DV6L 4L5QA 4HCSA 3AFQA 3VR6A 3R3OA 3NTKA 4KI0A 1FJGL 2O5JC 3SR1A 2EYJA 4KLKA 3X3NA 1V1QA 2UXDQ 2YYZA 1QG7A 1K9MC 4IO9A 1TS3A 2N55A 2PQAB 4LFBQ 4ZK9B 3A8KE 3TSSA 1ENCA 2EY2A 5IT9L 5LMUL 2F3VA 3TDQA 1SE2A 2CKZB 1OO9B 1CKNA 1H9SB 4CBVA 1EWCA 4CDDC 1X32A 2H4OA 4RCOA 1LTBD 4B3SQ 3KBXA 4IPHA 1JWUD 1VQKA 2PO4A 1KRTA 2WB1G 4LF8Q 1I3QB 5C3WA 3A5UA 2KQ3A 4PV1C 5ISRA 3GTMB 1AEXA 2RKSA 3S14H 2IW3A 4P74A 4IUNA 2IY5B 4RGTA 3D4WA 3KYHC 4QCLA 4RKLA 3PO2H 1CTMA 2DGYA 2ZM6L 1PFBA 3GTGB 1VS0A 1TY2A 4A3GG 1EU3A 2HCIA 1K3BC 3UDGA 1BUVT 4G7ZC 1L1OB 1CA5A 1ESRA 4HIMA 5C0XJ 3RZOH 1Q82C 2JEAI 4QB4A 1A3UA 2HIXA 1X3FA 3UDXA 1U9RA 4JG2A 1LTTD 3S24A 2F0TA 1EWIA 2R7FA 2QF7A 4U68A 2BOSA 1G6PA 1SYBA 4UY8C 2XRSD 1XPUA 1YITA 4DF7A 4A93G 1RJTA 4A3JG 1QJOA 5IYBG 4G7OC 4P75A 4KN7C 4Q5VA 1CSPA 3K5NA 1I4XA 5IP7G 3H0GG 4JBMA 1IBLL 3J7A5 5IWAQ 1PH2A 4DV3L 1UEBA 2ZXRA 4PNYA 5EPLA 4S3SA 1O7LA 1JICA 3D4RA 4J1MA 4DR1L 4X6AH 2BH8A 3A0JA 1TS5A 3K7AB 3NBHB 4HJ5A 4DR7L 1SAPA 5KEEA 1RDPD 2R7ZH 2B2YA 3J7AV 3GTLH 1B3QA 1IHZA 4A3EG 1K83B 2HT1A 2EYLA 2PW5A 1PVOA 3RZDH 3SXHA 2E76C 1X3PA 3K0YA 3DHQA 3OWFA 4NW2A 4OO1H 3J80L 2PMZE 5LMNQ 1K8MA 5BN3A 2K14A 3I3CA 1TIID 1F2LA 2UXBL 4OHJA 1K8OA 2E2HB 1VDZA 3ONAB 1IYUA 4UAIA 4CDFC 2J0TD 1K3RA 1BKBA 2KCTA 3K59A 1SEBD 4HAEA 1XTDA 3PUXA 4RH6A 3B6YA 2K1BA 4ZUJA 3CD6A 3JAMc 1SNPA 1PTOH 2RA4A 2JN4A 1G291 5D3DA 1VQ4A 4A3KH 2BCOA 1MIUA 3EIVA 1I94L 2NWGA 3EA6A 1I4RA 2NN6G 2PCFB 1PH8A 1CI3M 5C3EG 4YY3L 3FKIH 3BU2A 3CXCA 3F2DA 4JI2L 3G7LA 1OTCA 5CR3A 4DNRB 3PO2B 4V190 2EJMA 2VS1A 1TVXA 3NK9A 2NVXB 2FMMA 2JA7B 1Y1VB 3OIPA 5CC4A 3RZOB 3C1FA 3TP8A 3AMUA 1SMYD 1N33Q 5IP9G 3KLWA 3A74A 5JJZA 1FL0A 3CC7A 3MEHA 1B70B 5JJLA 3T51B 5E4XA 5L37A 1W6KA 4LF6L 5T1GA 2JA9A 3CCVA 1PYSB 1PA6A 5JEAJ 4HN7A 3QR8A 3BVMA 3RUZA 4IFDH 4DV2Q 1SJED 2SOBA 4JK1C 4GKKL 1QVFA 4L6TB 3NELA 1C8CA 1YVCA 2K5QA 2HUGA 4JI4L 3I4NB 2BA0A 2CVRA 1JCKB 4JYAL 2DY7A 4QIWB 3KF8A 4C3HB 3BYYB 1A3TA 1IW7C 3K5LA 1WTHA 4A3MH 2R7ZB 1EY9A 4APVA 3GTLB 1GD7A 2EJGC 4BA1I 1HQMC 4PG3A 2JA5B 1AZQA 1B3AA 1S72A 3RZDB 4DV7Q 2DNEA 3K8AA 3MXPA 5KNBA 1SBBB 4X65Q 1PMRA 5CYUA 3CHBD 3TZDA 3CP0A 3FHWA 2Q8RE 4DA2A 1GKHA 4K2KA 1YJNA 1WCMG 2E5LQ 3NEMA 5IT9c 4NKLA 4LAAA 2JA6G 1LYLA 3D0FA 1N32Q 1PRTF 3HOUH 1LT4D 1M4VA 2EXZA 4OIJA 2XRQD 3KDFB 1PTOB 1GHJA 5KRUA 1VQHA 1XMQQ 2OQ0A 1AZPA 1F2YA 2M2LA 5C0XH 5DM73 4DR3L 4A3KB 1HR0L 4KK7A 2NVQH 3TS0A 2CFMA 4A4IA 2X6GA 1GUOA 4A3FH 3S16H 3GV6A 4IUTA 1E24A 1SN8A 1N9WA 4RG1A 2IHFA 3T1HL 2KOLA 1BOSA 1BR9A 4GOPC 1KDBA 4QIWE 4JI7Q 3AQQA 1A2TA 2RSNA 3DWQA 3MEFA 2VNUD 2F0GA 4A3CH 3CF5A 1XYIA 2KVMA 3DM3A 4OWXB 1BCPD 5FK9C 1H9MA 2HCCA 3CCJA 1ILPA 4I7AA 3QOLA 1VQ7A 3CCLA 1PFNA 3BYTB 4AYBG 1WOCA 3E9HA 3IKJA 2B2UA 4KD3A 5A35A 1DYQA 3J7ZC 3CPFA 5CGKA 1WJJA 2IT1A 4RCNA 3S9WA 2Q8IB 2M9VA 1QE6A 5T1IA 1GM5A 1EYGA 1S5BD 5BR8L 5GQOA 3TREA 1OXSC 4KHPL 3MFGA 1N36L 4C2MH 1H95A 2PNRC 2HDMA 5CBAE 2VB3X 3OW7A 2YTVA 3WWVA 2VQEL 2OQKA 3CRLC 1S5CD 2WP8J 2K4KA 4ABNA 2PW7A 1QUQB 5AJ3L 4DR6Q 1QCBD 1T5EA 3FPUB 4PMWA 2NZHA 3RLOA 2UXCQ 4O1NA 1V1PB 1BBXC 4A3IH 2K52A 2R7DA 4ZRZA 4OIKA 4CDCC 1JJ2A 2KHSA 1VQLA 3VR2A 1EIHA 2F0MA 3EJIA 1WYDA 4DNTB 2B63H 4LF9L 3HOZH 4OWTB 1U5KA 3D4DA 5CBEE 1IXRA 1PH4A 3RR5A 4YIJA 3ULPA 1IYVA 1XNRQ 2AQ3B 4YHHL 1BNZA 2EDGA 4BWGB 4DV1L 1G6ZA 2A6EC 2BA1A 2R61A 4Y7NB 1HNZL 4NP5A 3RMHA 4X66Q 2ZJQA 2AWOA 1K0SA 2V1CC 4CGYB 2R7ZG 4POFA 3TRZA 2NVTB 4A3BH 1BBWA 4A3FB 3GTKH 2MGSA 1HTPA 4OO1G 5IGFA 2I5LX 4DAMA 1BDOA 1CM9A 1JWSD 3PSIA 5KGUA 2K5WA 2R93H 3VA5A 4CJ1B 2NZ1D 3EBEA 4ZCKA 3J80E 2A68C 3HOXB 5C4XB 2ASBA 3OWEB 4IOAA 1BVSA 1IL8A 2PQAA 1VCIA 2JP1A 2XWBB 3URYA 1HZAA 4ID6A 4DUZL 4EQNA 1H9SA 4LK1C 3RLNA 1YNJC 3GTPB 4DV6Q 3TP7A 3HOVH 5FLXc 2B39A 2B2TC 3I4MB 1FJGQ 4JI5L 2EQSA 4MHEA 4DR2Q 2PZWA 1B4OA 2F0FA 1BXTA 2SNSA 3VA7A 3T16A 3U9SA 2KCNA 1OXTA 3PUWA 3FKIG 4A75A 1I4QA 3OMCA 2TMPA 4C2MB 5BN4A 4K0KQ 2ES2A 5LMUQ 3E6ZX 3SE0A 5GAGC 3L9AX 1WD0A 2SEBD 2L1BA 4DUYL 1L1OA 1B1ZA 1EEID 3F8TA 3WDNA 1CSQA 3UDIA 2CH4W 1V8QA 2LXKA 3V96A 2R92B 1IBKQ 2YU9B 3OPOA 3R8BA 3PIPA 3M4QA 4ALPA 2KHJA 5K36H 4C1NI 1II3A 4JI6L 1FYCA 2LMCB 1TS2A 2A5HA 5DAUA 1ENAA 3A56A 3ERSX 4UP8A 5I6YA 2OCEA 2QKIC 2N49A 2KA7A 1CHQD 4JPBW 5FKAC 4IFDG 1Q12A 2BH2A 1NAPA 3S17B 3W2DA 4BS9A 1ZYRD 3TEHB 1I6VC 4H44C 3DWAA 2QILA 3MXNB 1GJXA 1HTLD 3NUCA 3NBHA 1ICWA 1SROA 5HY6A 3QWNA 2R6GA 4CJ2C 3GTJB 1XNQL 2K32A 3BDLA 4GN3B 3T56B 4XQQA 4HTHA 4A3MG 3VR4A 4ULLA 4WJ4A 5JPNC 4C3JH 2KUMA 3H3VH 3HKZB 1IBML 4B3ML 2BDNA 1TWFB 1U4RA 3JAML 1IBLQ 5J22A 5M9OA 3GTKB 5LL6X 2Z6KA 4B3TL 4X3KA 1DCZA 3H91A 1QOHA 4N9PA 1W6JA 3CPWA 1TY0A 1EY4A 4LFCL 3JC66 5EPKA 2R93B 3I73A 3D6CA 3I4OA 3PMFA 4JOIA 1SRUA 3FDTA 2MO1A 3GTGH 2N78A 5M5YB 3U50C 1ML0D 3HOUG 1VQIA 1QWYA 2BE5D 1UE5A 3K58A 4H13C 2Z4HA 3SK4A 2UU9Q 4QY7A 4O42A 2UXBQ 5F2DA 2JSOA 1S5FD 1Y8OB 2F0EA 4K5XA 5E1FA 1WTRA 4K2LA 2A69C 1P8LA 4A3FG 3KBGA 1CZWA 3VDYA 2JJQA 2WAQE 5FOBB 1A8VA 2I46A 1NSNS 4IPGA 2F52A 1TT2A 2N8NA 5EBCA 3IAYA 1Q3LA 3K7UC 1N8RC 2UUCL 3STBD 5EKLA 4X3UA 1XXGA 4IN3A 1MI2A 4J15A 4NMZA 3P1HA 1PTOD 2UUBL 1E1TA 1ZXTA 1D8LA 3K7AH 1AW7A 3CCUA 2LKVA 3G48A 1PH9A 4YY3Q 1NBWA 1UUPA 4TVAB 1EIFA 4LW1A 5LL6S 1XJVA 4JI2Q 1DOKA 4RGMA 4A3DH 1EQVA 3NP8A 4HMIA 1ILQA 4JBKA 2C9OA 1BCPF 2GVBA 1ASYA 1VQMA 2RHQB 1DONA 2E2HH 2K5VA 4RWSC 5HGQA 1X3EA 2EPBA 4DV4L 1NR4A 2HDLA 3HOYB 1B44D 3P7JA 5IYCG 4GOPB 1J5EL 2P5ZX 1V43A 4LF6Q 3M4OH 1STNA 2L5TA 3CU7A 3KK7A 2CW0D 3A8IE 4IPCA 4C3JB 1S5DD 1XX8A 3HFZB 4A3IG 1QVCA 1STHA 4KHVA 1LO5D 2Q2UA 4J8QA 3U58A 4GN5A 4KD4A 2A74C 1YHAA 4MZ9A 4UDUC 2F4VQ 4IZ8A 2B63G 4B9XA 1LLRD 3KLRA 2H1EA 5GADC 3HOZG 3HZXA 1SNOA 3MA2B 4YCVA 1HNWL 5EBDA 2VB2X 4MTNA 4LFAQ 1S3OA 2VW9A 2NVXH 4X64L 3VR3A 3KDFA 2XGTA 2ID0A 4E6IA 2JA7H 1Y1VH 5KNDA 2WAQG 4JI1L 4A3LH 3ITPA 3R2TA 4JVZA 1MGSA 2CQOA 2BDOA 2G5DA 2I07B 1Q8KA 3HGBA 4K5VA 4GKJQ 1HJPA 1G8ZD 4R9WA 1DZ1A 2DJGC 3PO3G 4DKAC 3FP9A 3S1NH 1Z6HA 1Q7YC 3AFPA 3E3XA 3I72A 2FHTA 3SHLA 2VL6A 4XIGS 4A3BG 2K28A 4DV5Q 4LUZA 3E0JA 4X3TA 3NQIA 2YV5A 3MAQA 3MTSA 3J80i 1VQ8A 1SR3A 4LUOA 3NBIA 3ER0A 2Q2IA 1R9TH 1GUWA 1STEA 2MPMA 1HR0Q 4DR3Q 3I4NH 3J81j 1LT6D 4C3HH 3NWTA 1HQRD 3W5OA 5I2XA 2F1MA 1GOZA 2Y0SB 4QUCA 5HURA 4JI8L 2JA5H 2B2WA 1JJGA 1JE5A 1RL2A 4A3DB 1E2ZA 4FXGC 3HOVG 4NXMQ 1IKMA 2AHOB 2SNMA 4HJ8A 2PPBC 3S1MB 3OTOL 4HSPA 3TP6A 3K80C 1U0LA 5TSSA 1SXTA 2J4XA 5ELFA 2YTYA 1I50B 3M4YA 4TQUS 2VQFQ 4F88A 1H9KA 1MJCA 3SDZA 1HZCA 2DUDA 2PQEA 1QUQA 4G57A 1Q81C 2EE1A 3A7AB 2B3GA 1H9JA 3M4OB 1Q46A 2EYHA 1B9MA 1V1PA 1CFMA 2WKCA 3CCRA 3SK8A 3G6EA 1WTXA 2WACA 4AQYL 4GNXC 1J6QA 1TWAH 2XIWA 2JA8H 4O0AA 4NXNQ 2ATWA 2PI2A 1QZHA 2VQEQ 4L5TA 3CCSA 1J8IA 5KIXA 1SMYC 4DR5Q 2VUMH 1PFMA 4CJ0B 4UP7A 4Y52H 2NVYB 1FNVA 2MNAA 2X69A 1EY5A 2L9HA 3NQTA 2F0JA 3W1GA 3H6MA 2NUCA 1GHKA 4B3RQ 1GUTA 4R8NA 2A6HD 5I2YA 5I9PA 1WI5A 2K75A 5J1ZA 4LF9Q 3S1NB 1Q8IA 4C3JG 5A2QL 1G2SA 3DM1A 4HIKA 5ELNA 1Z9FA 3R93A 2YTXA 3Q22A 4MNOA 2EOTA 2Q2HA 4N9TA 1VF5C 2FJ2A 1BBUA 1MD2D 3QG1A 1DGSA 4DV1Q 2CWPA 5E3FA 5FLXL 3JAME 1R9TB 4IJHA 4BBSH 4LF4L 4O2DA 1YNND 3A5ZB 2UXDL 3M3YH 1VQOA 1K8AC 1G91A 3G4SA 3OSOA 1UEAB 3LWEA 4LFBL 1ET6A 2IX1A 2X6LA 5HGTA 5JVH3 1ICFB 3MVVA 1QZGA 5M5WH 1DD2A 3CCEA 3I56A 5C5LA 2HQLA 5EGTA 1TWGH 1XWEA 2J7ZA 1SSOA 1HCZA 4XTCS 3VYRA 5EKIA 2HD3A 2IL8A 3MZ5A 1HHVA 3LX0A 3W1BA 4LMQD 1HRJA 4DUZQ 1SFOH 2WIIB 1VQPA 5DEHA 4K6LA 2OT2A 4LF5Q 5I4DA 4Y7NH 1G51A 2A8VA 1HZBA 1PRTB 1VQBA 1DM0B 3T1YQ 1TWAB 1YBYA 2JA8B 4R4TA 4I7ZC 2KJXA 4IQZA 4DV0Q 4F87A 2NVTH 4BY7B 4NB3A 4JBWA 1BCPC 2L12A 2NB0A 2QEJC 1KXLA 3KLSA 4IOCA 5C6AA 4A3DG 3O13A 1E1OA 2VUMB 1JB3A 4BBRB 2F03A 2WINB 3UE1A 2E74C 3DEOA 4ZQ3A 1ESFA 1PH7A 1EQTA 1XPOA 1JC7A 1CUKA 5IWAL 3MXNA 4KKUA 1JWMD 1NJIC 3HP3A 3KOJA 5M3FB 3HOXH 5C4XH 3A54A 5G3LF 3H94A 2IHEA 3F2CA 2RCNA 5ELCA 4LWCA 2HQEA 4L63B 2M00A 4R8IA 3GTPH 4ZUIA 4K8IA 1SYFA 2EYFA 2F0UA 3I4MH 5IT9E 1NR2A 2XN9C 3P20A 2Z0SA 3Q23A 1XNQQ 4BBSB 2LY7A 3K81C 2QGQA 5JPMC 3TP5A 3M3YB 3TS2A 2E2DC 3D6WA 1EY7A 1PZJD 3KFUA 2O2LD 1JR0D 5CV4A 3PO2G 1FVIA 4M1UB 2Z1CA 1IBMQ 4B3MQ 3L0OA 1TU2B 2JA7G 1Y1VG 2HHHQ 4A3LG 5M5WB 5CMDA 2R92H 2ZXOA 2YU9H 1A15A 3CC4A 4LFCQ 1TWGB 2MHVA 1J9OA 3E9IA 2K01A 1AE2A 3ICEA 1SDFA 4WFN3 1R4PB 2RCFA 1QILA 3VYTA 4XYOA 3S17H 1GVPA 1WVLA 3GP7A 1K73C 3GD7A 3V2TA 1SFOB 1GO3E 2EJFC 2F0IA 3FPPA 1X3QA 1GXDC 2D9UA 3I4NG 5I6WA 3HKSA 1BF4A 1M90C 1IKLA 2MO0A 3GTJH 2I0QA 1LTAD 4C3HG 4R4CA 3G6JB 5LMNW 4DNIA 1KAAA 3HS0C 4QJFA 1F2ZA 4OX9L 4CKCA 2IWHA 2JA5G 1A62A 4J6HA 5EQ0A 1GUNA 4RA8A 1TWFH 1KNEA 2L4NA 4KY7A 4ME5A 2UUCQ 4A3GH 2E75C 1NE3A 1JJCB 1O78A 1RTNA 4DV2L 1ET9A 2EIFA 2FINB 4JI3Q 3FEWX 2K5NA 5JEAH 2ZXPA 5IYDH 1N34Q 1VQ9A 4IPDA 5D14A 4EVOA 4ZKBB 3Q6SA 4GOPA 1HNXQ 3ZJYC 2Z4IA 5CV9A 2CH4A 3BVZA 1E22A 1NCVA 1NNXA 4C3IB 3OIQA 3T4AC 1Y1WB 3U4ZA 4ME3A 2XVSA 5M5YH 3K5MA 4UHVA 5IYBH 4PMBA 2VZAA 2PI2E 3S1RB 3NE5B 1JE4A 1YI2A 1HUNA 3SK6A 3TQYA 2JA8G 1VQEA 4A3KG 2PYKA 1FGUA 1E0BA 1YJ9A 4H7BA 3S2HH 1EZ8A 2NBFA 3I91A 3J81L 1C4QA 2MUYA 1J5EQ 2VUMG 3BS1A 3DEPA 4K8JA 4DPGA 2L15A 4KJOA 4HMJA 1F9RA 4WRDA 1IL2A 4QMGA 1EY0A 1FNUA 1SE3A 3PIO3 1X9NA 4Q0FA 3IRBA 1EY8A 3T13A 3F1ZA 4ZKCB 1XMQL 1EL0A 4CHTB 1ZYRC 2NTSA 4PZ7A 5EJWA 2D2CC 1I5FA 3OHXC 1MHWC 4GS3A 3JAMi 2F0NA 3NTHA 4TRDA 4AIMA 1MBYA 2ZM6Q 1M8AA 1PLFA 4GNXB 1LV9A 1UAPA 2CWAA 3D8GA 4KV6A 2A19A 4JI7L 5A2QE 1HH2P 1DOMA 4POGA 4JI1Q 1LTLA 2DJFC 1PZID 5J39A 2G9HD 4KY5A 4BBSG 5ELBA 4EGVA 2ALYB 1YEZA 4I65A 3HOYH 4LNQA 2MJ8A 5FLXE 3K6OA 2WB1B 4G7HC 3DMUA 5ELEA 4RGOS 2Q2TA 3ZYYX 1KTKA 3ND8A 3NXWA 5IGGA 2AMCB 5LHY1 5CV7A 1LTGD 3CRKC 2RF4A 1EQRA 4A3GB 3GTQH 4DV3Q 1O7ZA 1DXMA 4X62L 5IIFA 2RVLA 5ELOA 3SEBA 2BE5C 4XQJA 1GUGA 3HRZC 2V4DA 1LTSD 5IY0A 4DR1Q 4JBJA 4F7XA 2MP1A 4V0BA 4A76A 4DR7Q 3DXJC 4IUVA 3SGIA 1B2TA 3GTOH 4LF7L 1TS4A 4DR6L 1RCVD 3MWYW 5GAEC 3UDFA 3WOEA 3J7AF 4DR4L 4U673 1VQ5A 1D6EC 1KIXA 4A93B 1SYCA 1VQFA 2NN6I 4A3JB 2UXCL 1I6HH 1JOQA 1NY4A 3IFTA 1CK1A 5DLQE 2KENA 1PFSA 2XSCA 3H0GB 5K5PA 3DLLA 2ZTDA 3STBC 1STGA 5C0XG 1QNUA 1SYEA 1VQNA 3GV3A 4KKSA 2QCPX 1LTID 1HXYD 1PTOC 2FFKB 3L3OC 2O5IC 3S2HB 2WV6D 4QL5A 3TZUA 4GLXA 3L7ZC 1E7ZA 3N6RA 2Q8TA 2B2TA 2E2JH 1ZEQX 4FDBA 3S2DH 1Q1EA 2QW7A 2WB1E 3Q24A 1K28A 3I7FA 4CKEA 4A3EB 1PH1A 1TR5A 2B2VA 4B08A 4DK1A 4R4OA 3OMGA 4A3CG 4PZ6A 4JCVE 4OXPA 3PF4A 4R4QA 3Q0AA 1PRTD 4DAVA 3HOXG 5C4XG 3DUZA 1BQQT 3HKZE 1EYDA 5KYIA 1I94Q 4WORA 2EVBA 2IX0A 5IGBA 1B53A 1P16A 3CW2C 4RMFA 5M5XB 1VQJA 2C5CA 1VQCA 1HA5A 1TWHH 1Y8PB 3HOWH 5C44H 1G2TA 3IL8A 4MTKA 1AE3A 3I4MG 3NPPA 3OYYA 4IJLA 2B2YC 4IURA 3S1MH 2I5MX 2CW0C 5EKKA 3PUYA 1SE8A 4TKOB 1D5ZC 1BCPB 5I9OA 1KAWA 1SJHD 1TQOA 1XMOL 1I50H 2D62A 2F0WA 4JI0L 4HIOA 1PYBA 1PZKD 1VQAA 3CQZB 2RHSB 4FO2A 3AEVA 4IFDJ 2HIVA 5C4JH 1SNDA 2AQ1B 4PMCA 4KN4C 1Z7TA 2R92G 4GKKQ 1BO0A 5CV8A 3GTQB 5D65A 3M7NA 4DR2L 4LF4Q 1NUCA 2QDBA 1SNMA 3BZDB 4JI4Q 1CZGA 1Q86C 1EZ6A 4JYAQ 1XTCD 3U9OA 4K0KL 2NVYH 1JT8A 3A7LA 2TSSA 3S15B 5GAHC 1RIPA 3GTOB 3M4PA 1MSGA 2F0HA 4DAYB 3HG9A 2F0LA 3S1QH 1PHJA 4K6DA 4EQPA 1I6HB 1EY6A 3D3RA 1IBKL 1KRSA 5EPJA 3QIAA 1PH3A 3U4VA 4Z9CB 3I55A 1LACA 2OXPA 3I70A 3J81c 2RSOA 2F0OA 3QOJA 4IUPA 2PMZB 1L0YB 3HKZG 4HJ7A 3V05A 3EFXD 2LXJA 4JV5L 2E2JB 1X54A 3S2DB 2SDFA 2XTIA 1WTOA 1OXXK 5FLMH 4QF4A 4ZLTF 1D5MC 2RDFA 5JEAG 5IYDG 1S40A 1B9NA 4C1NK 2R93G 3F2BA 4KY6A 2DY8A 1SMXA 1IZ6A 1CQVA 2OF1A 2C35B 4H0LC 1AFPA 1F2MA 4DU9A 4HEDA 3UE0A 1KD1C 3NHHA 3GQBA 2EY5A 5COYA 2EY6A 1ASZA 3T1HQ 1WCMB 5NUCA 3CCMA 1TWHB 4M8AA 2D0OA 3HOWB 4QGUA 5C44B 4OL7A 4HJAA 4AH6A 2JA6B 5IODA 3M9BA 1SYGA 2AUKA 2EZVA 5FJ8H 1YIJA 1KDAA 5FO9B 2B8FA 4DGZA 3RNUA 1SNQA 1D5XC 2RDHA 1AH9A 2PZTA 4KTAA 5H1SE 1ONLA 3J81E 4HJ9A 5C4JB 3D31A 5GROA 3PUVA 4FF2A 1I4PA 1T9HA 2L11A 2UU9L 1KABA 1JQYD 2K04A 3MFYA 1YHQA 5D3IB 2PZUA 5BR8Q 2E8GA 4KHPQ 5K36G 1O7YA 1EEFD 4UPAA 2KCMA 2K5HA 3ULJA 4C56C 1N36Q 1I4HA 4BY7H 1PV4A 2JXMB 1AN8A 1STBA 2JK8A 3KJPA 2A6HC 4EX5A 1TWCH 3KF6B 4BBRH 4AYBB 1EQQA 4RHRA 3RD4A 3TN2A 5AJ3Q 1WTPA 1EFWA 2ZTEA 4GLVB 1SE4A 2KCCA 4CDEC 4DFAA 2F0QA 1Y8NB 2G9DA 5M3MH 1Y69U 2WFWA 2Y0SE 3PF5A 1RTOA 5M3FH 3E0EA 4BY1H 3S1QB 3HOYG 1RD9D 1A3VA 1X3GA 4N8X1 5IGCA 2Z8LA 2UUAL 2F0SA 4OO1I 3S14B 1YNNC 4HR7B 1PYWD 3QJYA 1C48A 1JB7A 4X3SA 4GLAC 2IPKD 4YHHQ 5IGDA 2B2UC 5AFWA 1QB5D 1V9PA 3A8JE 4P2CB 3PUZA 4DXFA 5DM63 1RODA 1CA6A 1HNZQ 5JJKA 2IX3A 3CKIB 4MIUA 1GUSA 3CAMA 2Z9HA 4L5SA 4OX9Q 2OWOA 4P73A 1EU4A 1HZ9A 2DNCA 3J7YW 1CKMA 3C2PA 2LFNA 2KBNA 2NYZD 3ULLA 4BXXH 4AYBE 4DK3C 3RLFA 4GZYC 5EAYA 2JE6I 4B3SL 3BZCA 2NZOA 1UE1A 2F0DA 3K57A 4LF8L 2K7VA 2O4XA 2F4VL 3SK5A 3BVGA 2D5DA 2EY1A 2VY3A 3AYHB 4IUUA 3W3AA 2KEEA 4LFAL 4RFBA 1R4QB 1CKNB 2OTLA 3F2UA 1LM0A 2Z6BA 4JI5Q 3C1EA 4JC0A 1UNSA 2ICEC 2R3ZA 2ZJRA 1EUJA 1LTRD 1EOVA 2K6AA 3PGZA 4GKJL 1A63A 1K0RA 2RQXA 1IW7D 1LT5D 2Y0SG 1L0WA 3ERQA 4IFDI 4FNFA 4XQNA 1D1KA 4DV5L 3HOWG 4BA2I 5C44G 4GNXA 1TWCB 2AQ2B 3PCOB 1D7QA 4XT3B 4DUYQ 1PTOF 3R2IA 1WTWA 1EOTA 3PV0A 3K5OA 2EXDA 4FP5D 5M3MB 1AP0A 1K8GA 3C3LA 1UE6A 3SVMA 4BY1B 1VMPA 4N8FA 1A0IA 1U4PA 1B8AA 1WD1A 2ZJPA 4JI6Q 4C3IH 1FR3A 3NTIA 3BDOA 1SLJA 5C4ZA 1Y1WH 2LSSA 3FKIB 1EWHA 4RHSA 3Q8DA 4XDXA 1ZKOA 3S1RH 2I5HA 1PH5A 1LT3D 2GN5A 4NXML 2JYOA 5LMNL 4RAUC 1D2BA 4OEMB 4YCUA 4KKTA 3H3VC 4G4KA 3WOFA 4L5RC 2KEDA 4DK6C 4FXKC 4P72A 1SYDA 2VQFL 4UP9A 3GO5A 4R1JA 2NTTA 4ZAIA 3ND9A 1RF2D 2EYOA 5JJIA 2N3SA 1B7YB 5C0XI 5BN5A 2MQHA 1PDQA 5KNCA 3OW2A 1OXUA 1HPCA 4B3TQ 4X62Q 3T53B 4RKBA 2OTJA 1Q90A 4NXNL 1EIYB 1L1OC 2FXQA 3RN2A 4OWWB 4FXDA 2EYPA 1LABA 5IYCH 2F4IA 4IALA 4DXGA 1WFQA 4CKBA 4DR5L 5CV6A 1XPRA 1VQDA 2GA4B 1HR0W 4LF7Q 1B50A 2K05A 4KJNA 1F77A 4HCEA 4DR4Q 1UE7A 1MSHA 1X55A 2L0CA 4A3MB 2OEOA 5FLMG 1HUMA 1YJWA 3GDEA 3J80c 3EVQA 3H15A 3A55A 4LUVA 2FMCA 2EYMA 4XT1B 4B3RL 3IFDA 2GVAA 1JOKA 1N33L 3NSWA 4DAPA 1HA6A 3G71A 3K0XA 3BZKA 5E7NA 1F9QA 1VMCA 4H02A 4XXEA 2AKWB 3CC2A 1SNCA 1M1KC 1Q1BA 2F0VA 3HOUB 1X6OA 1KHIA 5FJ8G 5CV5A 1QVGA 3QB3A 2UUBQ 3J81i 3OOCA 3I90A 4FF3A 1TXYA 1U4MA 3UI2A 2Z6KC 3PO3H
chains in the Genus database with same CATH topology
4L8JA 2NVQB 1WTVA 1EIGA 5CORA 4FF1A 4MN3A 1CHPD 4NDXA 3S16B 5IOCA 1ENFA 2A6ED 3EROA 2XNAC 1TKWB 3FMCA 4ODGA 1V1OA 2WKDA 1STYA 1CQFA 4LJZC 3VYUA 4TSSA 1KNAA 2RBMA 4K5WA 4FF4A 3FVQA 1EFID 2ZT9C 4DAYA 3PIP3 1KDCA 3VYSA 2A68D 3MXGA 3E5SA 1WTQA 1QNKA 2B2VC 3N52A 2LS01 5JVG3 2A73B 2IJ0A 1DOLA 3KLSX 1HFNA 5DNFA 3P75A 1YNJD 1FGBD 2ICIA 1Z47A 3M7GA 2CHBD 3C46A 3MXUA 5KYLA 2XWJB 5C5MA 1E2VA 2DN8A 2AWNA 4A3IB 1STAA 3KUPA 5JOBA 5C4HA 3BG3A 4RGNA 2NN6H 4KMUC 4QUFA 5JAVA 2B63B 5E4WC 1I4GA 3AB9A 3HOZB 3M85A 2K5DA 1RHPA 1S4ZA 1FD7D 4HSVA 1VF7A 3FRPB 1CT1D 2WAQB 5C3XA 3HEJA 4FYDA 1O80A 5ELDA 3TBIB 3PO3B 3MHBA 1H9RA 4KHZA 4K14A 2CQAA 3H09A 1U4LA 4A3BB 3X3MA 2ENBA 3AU7A 1F9PA 5FO8B 4DN4M 2L55A 3VR5A 1F9SA 3TMEA 1FNWA 4ILWA 1S5ED 1JOOA 2AUJD 1PRTC 1RKNA 1E2WA 1DJRD 2KECA 4PQXA 2VXWA 2RDGA 3EQLC 3BDCA 2F0KA 2K33A 3HOVB 3LWUA 1OXVA 4EQOA 1A2UA 3MC0B 1HFGA 1KLGD 4C3IG 2E2IB 4B9WA 2F3WA 2K03A 4WJWA 4FVMA 3LNNA 2B8GA 4IUQA 4F8MA 3I8ZA 1T5XD 3NWSA 4DK0A 3I4LA 3QO2A 1D1IA 1KLUD 1A6XA 2JEBI 1EYCA 2B2WC 2A69D 2F0PA 4ZYSA 1EYAA 5FO7B 5G3LD 5IGEA 1PXUA 3DWPA 5C3EB 1JORA 1L0XB 4XYQA 2N88A 4OGQC 4HCSA 3VR6A 3R3OA 3NTKA 4KI0A 2O5JC 3SR1A 2EYJA 3X3NA 2YYZA 1QG7A 1TS3A 2N55A 4ZK9B 3A8KE 3TSSA 1ENCA 2EY2A 5IT9L 2F3VA 3TDQA 1SE2A 1OO9B 1H9SB 4CBVA 1EWCA 1X32A 2H4OA 4RCOA 1LTBD 3KBXA 1JWUD 2PO4A 1I3QB 5C3WA 2KQ3A 4PV1C 5ISRA 3GTMB 1AEXA 2RKSA 2IW3A 4IUNA 4RGTA 3D4WA 4QCLA 4RKLA 1CTMA 1PFBA 3GTGB 1TY2A 1EU3A 2HCIA 1BUVT 4G7ZC 1CA5A 1ESRA 5C0XJ 2JEAI 4QB4A 1A3UA 1U9RA 1LTTD 2F0TA 2QF7A 4U68A 2BOSA 1SYBA 2XRSD 4DF7A 1RJTA 1QJOA 4G7OC 4KN7C 4Q5VA 3K5NA 1I4XA 2ZXRA 4PNYA 5EPLA 4S3SA 1JICA 1O7LA 3D4RA 4J1MA 3K7AB 1TS5A 1SAPA 5KEEA 1RDPD 2B2YA 3J7AV 1IHZA 1K83B 2EYLA 2PW5A 3SXHA 2E76C 1X3PA 3K0YA 3DHQA 3OWFA 4NW2A 4OO1H 3J80L 1K8MA 5BN3A 3I3CA 1TIID 1F2LA 4OHJA 1K8OA 2E2HB 1VDZA 3ONAB 1IYUA 4UAIA 2J0TD 3K59A 1SEBD 4HAEA 3PUXA 4RH6A 2K1BA 4ZUJA 1SNPA 1PTOH 2RA4A 1G291 5D3DA 2BCOA 2NWGA 3EA6A 1I4RA 2NN6G 2PCFB 1CI3M 3G7LA 5CR3A 4DNRB 3PO2B 4V190 2EJMA 1TVXA 3NK9A 2NVXB 2FMMA 2JA7B 1Y1VB 3OIPA 5CC4A 3RZOB 3C1FA 3TP8A 3AMUA 1SMYD 5JJZA 3MEHA 3T51B 5E4XA 1W6KA 5T1GA 5JEAJ 4HN7A 3BVMA 3RUZA 4IFDH 1SJED 2SOBA 4JK1C 4L6TB 1C8CA 2K5QA 2HUGA 3I4NB 2BA0A 2CVRA 1JCKB 2DY7A 4QIWB 3KF8A 4C3HB 3BYYB 1A3TA 1IW7C 3K5LA 2R7ZB 1EY9A 3GTLB 2EJGC 4BA1I 1HQMC 2JA5B 1AZQA 1B3AA 3RZDB 2DNEA 3MXPA 5KNBA 1SBBB 1PMRA 5CYUA 3CHBD 3TZDA 2Q8RE 4DA2A 4K2KA 4NKLA 4LAAA 1PRTF 1LT4D 1M4VA 2EXZA 4OIJA 2XRQD 1PTOB 1GHJA 5KRUA 1AZPA 1F2YA 2M2LA 5C0XH 5DM73 4A3KB 4KK7A 2X6GA 1GUOA 3GV6A 4IUTA 2KOLA 1BOSA 1BR9A 1KDBA 1A2TA 2RSNA 3DWQA 2VNUD 2F0GA 1XYIA 2KVMA 1BCPD 5FK9C 1H9MA 2HCCA 1ILPA 3QOLA 1PFNA 3BYTB 3IKJA 2B2UA 4KD3A 5A35A 1DYQA 5CGKA 2IT1A 4RCNA 3S9WA 2Q8IB 2M9VA 1QE6A 5T1IA 1S5BD 1OXSC 3MFGA 2PNRC 2HDMA 5CBAE 2VB3X 3OW7A 3CRLC 1S5CD 2WP8J 4ABNA 2PW7A 1QCBD 1T5EA 3FPUB 4PMWA 4O1NA 1V1PB 1BBXC 4ZRZA 4OIKA 2KHSA 1EIHA 3VR2A 2F0MA 3EJIA 4DNTB 3D4DA 5CBEE 4YIJA 1IYVA 2AQ3B 1BNZA 2EDGA 4BWGB 1G6ZA 2A6EC 2BA1A 2R61A 4Y7NB 4NP5A 3RMHA 2AWOA 4CGYB 2NVTB 4A3FB 2MGSA 1HTPA 4OO1G 5IGFA 1BDOA 1CM9A 1JWSD 5KGUA 2K5WA 3VA5A 4CJ1B 2NZ1D 3J80E 2A68C 3HOXB 5C4XB 3OWEB 1IL8A 1VCIA 2JP1A 2XWBB 3URYA 4ID6A 4EQNA 1H9SA 4LK1C 1YNJC 3GTPB 3TP7A 2B39A 2B2TC 3I4MB 4MHEA 2PZWA 1B4OA 2F0FA 1BXTA 2SNSA 3VA7A 3T16A 3U9SA 2KCNA 1OXTA 3PUWA 1I4QA 3OMCA 2TMPA 4C2MB 5BN4A 3E6ZX 3SE0A 3L9AX 1WD0A 2SEBD 2L1BA 1B1ZA 1EEID 3WDNA 1V8QA 3V96A 2R92B 2YU9B 3OPOA 3R8BA 5K36H 4C1NI 1II3A 1FYCA 2LMCB 1TS2A 2A5HA 5DAUA 1ENAA 3A56A 5I6YA 2QKIC 2KA7A 1CHQD 5FKAC 4IFDG 1Q12A 1NAPA 3S17B 3W2DA 4BS9A 1ZYRD 1I6VC 4H44C 3DWAA 2QILA 1GJXA 1HTLD 3NUCA 3NBHA 1ICWA 3QWNA 2R6GA 4CJ2C 3GTJB 2K32A 3BDLA 3T56B 4XQQA 4HTHA 3VR4A 4ULLA 5JPNC 2KUMA 3HKZB 2BDNA 1TWFB 1U4RA 3JAML 5J22A 5M9OA 3GTKB 5LL6X 4X3KA 1DCZA 3H91A 1QOHA 4N9PA 1W6JA 1TY0A 1EY4A 2R93B 5EPKA 3I73A 3D6CA 3PMFA 3FDTA 5M5YB 1ML0D 1QWYA 2BE5D 3K58A 4H13C 2Z4HA 3SK4A 4O42A 5F2DA 2JSOA 1S5FD 1Y8OB 2F0EA 4K5XA 5E1FA 1WTRA 4K2LA 2A69C 3KBGA 1CZWA 5FOBB 2I46A 1NSNS 1TT2A 3IAYA 5EBCA 1Q3LA 5EKLA 4X3UA 1XXGA 4IN3A 1MI2A 4NMZA 3P1HA 1PTOD 1ZXTA 1AW7A 2LKVA 1UUPA 5LL6S 1DOKA 4RGMA 1EQVA 3NP8A 4HMIA 1ILQA 2C9OA 1BCPF 1DONA 4RWSC 2EPBA 1NR4A 2HDLA 3HOYB 1B44D 3P7JA 1V43A 1STNA 2L5TA 3CU7A 3KK7A 2CW0D 3A8IE 4C3JB 1S5DD 1XX8A 1STHA 4KHVA 1LO5D 4J8QA 4KD4A 2A74C 4UDUC 4IZ8A 4B9XA 1LLRD 3KLRA 2H1EA 3HZXA 1SNOA 3MA2B 5EBDA 2VB2X 3VR3A 2ID0A 4E6IA 5KNDA 3ITPA 3R2TA 1MGSA 2BDOA 2I07B 3HGBA 4K5VA 1G8ZD 4R9WA 1DZ1A 1Z6HA 3I72A 2FHTA 3SHLA 4XIGS 2K28A 3E0JA 4X3TA 3NQIA 3MAQA 3MTSA 3NBIA 1GUWA 1STEA 2MPMA 1LT6D 3NWTA 1HQRD 5I2XA 2F1MA 1GOZA 2Y0SB 4QUCA 5HURA 2B2WA 4A3DB 1E2ZA 4FXGC 1IKMA 2SNMA 2PPBC 3S1MB 4HSPA 3TP6A 5TSSA 1SXTA 2J4XA 5ELFA 1I50B 3M4YA 4TQUS 4F88A 1H9KA 3SDZA 2PQEA 4G57A 2EE1A 3A7AB 1H9JA 3M4OB 2EYHA 1B9MA 1V1PA 1CFMA 2WKCA 3SK8A 1WTXA 2WACA 2XIWA 1J8IA 5KIXA 1SMYC 1PFMA 4CJ0B 2NVYB 1FNVA 2X69A 1EY5A 2L9HA 3NQTA 2F0JA 3H6MA 2NUCA 1GHKA 1GUTA 4R8NA 2A6HD 5I2YA 5I9PA 5J1ZA 3S1NB 1Q8IA 4C3JG 5A2QL 1G2SA 3DM1A 3R93A 3Q22A 4N9TA 2EOTA 1VF5C 2FJ2A 3QG1A 1MD2D 5E3FA 5FLXL 3JAME 1R9TB 1YNND 1G91A 3OSOA 1UEAB 3LWEA 1ET6A 2IX1A 2X6LA 5HGTA 5JVH3 3MVVA 1DD2A 5C5LA 5EGTA 1XWEA 2J7ZA 1SSOA 1HCZA 4XTCS 3VYRA 5EKIA 2IL8A 3MZ5A 1HHVA 3LX0A 1HRJA 4LMQD 2WIIB 5DEHA 4K6LA 2OT2A 5I4DA 1PRTB 1DM0B 1TWAB 2JA8B 4I7ZC 2KJXA 4IQZA 4F87A 4BY7B 4JBWA 1BCPC 2L12A 2NB0A 2QEJC 3KLSA 5C6AA 3O13A 2VUMB 1JB3A 4BBRB 2F03A 2WINB 2E74C 3DEOA 4ZQ3A 1ESFA 1EQTA 1JC7A 3MXNA 4KKUA 1JWMD 3HP3A 5M3FB 3A54A 5G3LF 3H94A 5ELCA 2HQEA 4L63B 2M00A 4R8IA 4ZUIA 4K8IA 1SYFA 2EYFA 2F0UA 5IT9E 1NR2A 2XN9C 3P20A 3Q23A 4BBSB 2LY7A 5JPMC 3TP5A 3M3YB 2E2DC 3D6WA 1EY7A 1PZJD 2O2LD 1JR0D 5CV4A 4M1UB 2Z1CA 1TU2B 5M5WB 5CMDA 2ZXOA 1A15A 1TWGB 2MHVA 1J9OA 2K01A 1SDFA 4WFN3 1R4PB 1QILA 3VYTA 4XYOA 1WVLA 3GP7A 3GD7A 3V2TA 1SFOB 2EJFC 2F0IA 3FPPA 1X3QA 1GXDC 2D9UA 5I6WA 1BF4A 1IKLA 1LTAD 4C3HG 3G6JB 1KAAA 3HS0C 1F2ZA 4CKCA 2IWHA 4J6HA 5EQ0A 1GUNA 4RA8A 1KNEA 2L4NA 4KY7A 4ME5A 2E75C 1O78A 1RTNA 1ET9A 2FINB 3FEWX 5JEAH 2ZXPA 4EVOA 5D14A 4ZKBB 3Q6SA 2Z4IA 5CV9A 3BVZA 1NCVA 4C3IB 3OIQA 3T4AC 1Y1WB 2XVSA 3K5MA 4PMBA 3S1RB 3NE5B 1JE4A 1HUNA 3SK6A 2PYKA 1E0BA 4H7BA 1EZ8A 2NBFA 3I91A 3J81L 1C4QA 2MUYA 3BS1A 3DEPA 4K8JA 4KJOA 4HMJA 1F9RA 4WRDA 4QMGA 1EY0A 1FNUA 1SE3A 3PIO3 4Q0FA 1EY8A 3T13A 4ZKCB 1EL0A 4CHTB 1ZYRC 2NTSA 5EJWA 2D2CC 3OHXC 2F0NA 3NTHA 4TRDA 1MBYA 1M8AA 1PLFA 1LV9A 1UAPA 3D8GA 4KV6A 5A2QE 1DOMA 1PZID 5J39A 2G9HD 4KY5A 5ELBA 4EGVA 4I65A 2MJ8A 5FLXE 3K6OA 2WB1B 4G7HC 3DMUA 5ELEA 4RGOS 3ZYYX 1KTKA 3ND8A 3NXWA 5IGGA 5LHY1 5CV7A 1LTGD 3CRKC 4A3GB 1O7ZA 1DXMA 5IIFA 2RVLA 3SEBA 2BE5C 4XQJA 1GUGA 3HRZC 2V4DA 1LTSD 4F7XA 2MP1A 4V0BA 3DXJC 4IUVA 1B2TA 1TS4A 1RCVD 3MWYW 3WOEA 3J7AF 4U673 1D6EC 4A93B 1SYCA 2NN6I 4A3JB 1JOQA 3IFTA 1CK1A 2XSCA 3H0GB 5K5PA 1STGA 5C0XG 1QNUA 1SYEA 3GV3A 4KKSA 2QCPX 1LTID 1HXYD 1PTOC 2FFKB 3L3OC 2O5IC 3S2HB 2WV6D 3TZUA 3L7ZC 3N6RA 2Q8TA 2B2TA 1ZEQX 1Q1EA 3Q24A 4CKEA 4A3EB 1TR5A 2B2VA 4B08A 4DK1A 3OMGA 3Q0AA 1PRTD 4DAVA 3DUZA 1BQQT 1EYDA 5KYIA 4WORA 2EVBA 2IX0A 5IGBA 1B53A 5M5XB 2C5CA 1HA5A 1Y8PB 1G2TA 3IL8A 3NPPA 2B2YC 4IURA 2CW0C 5EKKA 3PUYA 4TKOB 1D5ZC 1BCPB 5I9OA 1TQOA 1SJHD 2D62A 2F0WA 1PZKD 3CQZB 4FO2A 4IFDJ 1SNDA 2AQ1B 4PMCA 4KN4C 1Z7TA 1BO0A 5CV8A 3GTQB 5D65A 3M7NA 1NUCA 2QDBA 1SNMA 3BZDB 1CZGA 1EZ6A 1XTCD 3U9OA 3A7LA 2TSSA 3S15B 3GTOB 1MSGA 2F0HA 3HG9A 2F0LA 4K6DA 4EQPA 1I6HB 1EY6A 3D3RA 5EPJA 3QIAA 4Z9CB 1LACA 2OXPA 3I70A 2RSOA 2F0OA 3QOJA 4IUPA 2PMZB 1L0YB 3V05A 3EFXD 2E2JB 3S2DB 2SDFA 1WTOA 1OXXK 4QF4A 4ZLTF 1D5MC 2RDFA 5JEAG 1B9NA 4C1NK 4KY6A 2DY8A 1CQVA 2OF1A 4H0LC 1AFPA 1F2MA 4DU9A 4HEDA 3NHHA 3GQBA 2EY5A 5COYA 2EY6A 1WCMB 5NUCA 1TWHB 4M8AA 3HOWB 5C44B 4OL7A 2JA6B 5IODA 1SYGA 2AUKA 2EZVA 1KDAA 5FO9B 2B8FA 4DGZA 1SNQA 1D5XC 2RDHA 2PZTA 4KTAA 1ONLA 3J81E 5C4JB 3D31A 3PUVA 4FF2A 1I4PA 2L11A 1KABA 1JQYD 2K04A 3MFYA 5D3IB 2PZUA 5K36G 1O7YA 1EEFD 4C56C 1I4HA 2JXMB 1AN8A 1STBA 2A6HC 4AYBB 4RHRA 3RD4A 3TN2A 1WTPA 1SE4A 2KCCA 4DFAA 2F0QA 1Y8NB 2G9DA 1Y69U 1RTOA 3S1QB 1RD9D 1A3VA 5IGCA 2Z8LA 2F0SA 4OO1I 3S14B 1YNNC 4HR7B 1PYWD 3QJYA 1C48A 4X3SA 2IPKD 5IGDA 5AFWA 2B2UC 1QB5D 3A8JE 4P2CB 3PUZA 4DXFA 5DM63 1RODA 1CA6A 2IX3A 3CKIB 4MIUA 1GUSA 1EU4A 2DNCA 3J7YW 3C2PA 2LFNA 2NYZD 3RLFA 4GZYC 2JE6I 2F0DA 3K57A 2K7VA 2O4XA 3SK5A 3BVGA 2D5DA 2EY1A 4IUUA 3W3AA 2KEEA 4RFBA 1R4QB 3F2UA 3C1EA 1UNSA 2ICEC 2R3ZA 1LTRD 2K6AA 2RQXA 1IW7D 1LT5D 3ERQA 4IFDI 4FNFA 4XQNA 1D1KA 4BA2I 1TWCB 2AQ2B 4XT3B 1PTOF 3R2IA 1WTWA 1EOTA 3PV0A 3K5OA 4FP5D 5M3MB 1AP0A 3C3LA 3SVMA 4BY1B 1VMPA 1U4PA 1WD1A 1FR3A 3NTIA 3BDOA 5C4ZA 3FKIB 1EWHA 4RHSA 4XDXA 1ZKOA 1LT3D 2JYOA 4RAUC 1D2BA 4KKTA 3H3VC 4G4KA 3WOFA 2KEDA 4FXKC 1SYDA 3GO5A 2NTTA 4ZAIA 3ND9A 1RF2D 2EYOA 5C0XI 5BN5A 1PDQA 5KNCA 1OXUA 1HPCA 3T53B 4RKBA 1Q90A 4FXDA 2EYPA 1LABA 2F4IA 4IALA 4DXGA 4CKBA 5CV6A 2GA4B 1B50A 2K05A 4KJNA 1F77A 4HCEA 1MSHA 2L0CA 4A3MB 2OEOA 1HUMA 3EVQA 3A55A 2FMCA 2EYMA 4XT1B 3IFDA 1JOKA 3NSWA 4DAPA 1HA6A 1F9QA 1VMCA 4XXEA 1SNCA 1Q1BA 2F0VA 3HOUB 5CV5A 3QB3A 3OOCA 3I90A 4FF3A 1U4MA 3UI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSO A;  1O80 A;  1WTV A;  2N55 A;  1EIG A;  3LWE A;  3DEP A;  3D6W A;  4IUP A;  4UAI A;  5COR A;  4MN3 A;  4QUC A;  2Q8T A;  4ZK9 B;  2B2T A;  1DOK A;  2X6L A;  5CBE E;  1U4L A;  2B2W A;  1F9R A;  4HAE A;  4XDX A;  2K1B A;  1ILQ A;  2SDF A;  2B2V A;  4X3S A;  1WTO A;  1NAP A;  1F9P A;  4OIJ A;  2RA4 A;  4ZLT F;  5CMD A;  2JYO A;  4DN4 M;  2B2U C;  5AFW A;  1A15 A;  1BNZ A;  1X32 A;  1IKM A;  1G6Z A;  4RAU C;  4ZKC B;  3KBX A;  1ROD A;  1CA6 A;  2DY8 A;  1F9S A;  2J7Z A;  1DON A;  1EL0 A;  4RWS C;  1AZP A;  2M2L A;  2EPB A;  2NWG A;  2KED A;  1J9O A;  1NR4 A;  1SSO A;  2HDL A;  1ICW A;  2K01 A;  4CJ2 C;  3P7J A;  1B53 A;  4HED A;  5EKI A;  1KNA A;  5EJW A;  2IL8 A;  1SDF A;  2X6G A;  5COY A;  1HHV A;  3GV6 A;  1HRJ A;  4IUT A;  4LMQ D;  3G7L A;  2EE1 A;  4ZAI A;  2KEC A;  1M8A A;  1PFB A;  1PLF A;  2KOL A;  2KUM A;  1G2T A;  1LV9 A;  2MGS A;  2VXW A;  3IL8 A;  2HCI A;  2BDN A;  1WVL A;  1U4R A;  1XX8 A;  2NYZ D;  1PDQ A;  2RSN A;  1TVX A;  1DOM A;  1WD1 A;  2B2Y C;  1WTX A;  1CM9 A;  1CA5 A;  1ESR A;  4IUR A;  1XYI A;  2FMM A;  1X3Q A;  4X3K A;  3H91 A;  2XIW A;  2KVM A;  4CJ1 B;  2D9U A;  1HFG A;  2NZ1 D;  1WTQ A;  1QNK A;  2B2V C;  1BF4 A;  2HCC A;  1IKL A;  3N52 A;  5EPK A;  5JJZ A;  2MJ8 A;  1QG7 A;  1ILP A;  1PFN A;  2K03 A;  1J8I A;  1IL8 A;  1DOL A;  2H1E A;  1HFN A;  2L12 A;  4U68 A;  5DNF A;  2JP1 A;  1PFM A;  5E4X A;  1B50 A;  4CJ0 B;  2K05 A;  2B2U A;  5T1G A;  3FDT A;  5EQ0 A;  4IUU A;  1RJT A;  2KEE A;  1MSH A;  4IUQ A;  4RA8 A;  1KNE A;  2L4N A;  3I8Z A;  3DEO A;  2X69 A;  1ML0 D;  1HUM A;  1RTN A;  2L11 A;  2L9H A;  3QO2 A;  1EQT A;  2FIN B;  3F2U A;  1QE6 A;  1O7Z A;  2B2T C;  2K04 A;  5T1I A;  1BO0 A;  1MGS A;  2B2W C;  4O42 A;  2RVL A;  2R3Z A;  3IFD A;  3KUP A;  4MHE A;  4XT1 B;  5D65 A;  3HP3 A;  5EPL A;  1JIC A;  5D14 A;  1B4O A;  1C8C A;  1O7Y A;  4R9W A;  4ZKB B;  1WTR A;  3Q6S A;  2HUG A;  1DZ1 A;  2CVR A;  1HA6 A;  2MP1 A;  2HDM A;  5CBA E;  2DY7 A;  1NCV A;  4QUF A;  4IUV A;  1SAP A;  2FHT A;  1F9Q A;  2B2Y A;  1VMC A;  2K28 A;  1B2T A;  4X3T A;  5E4W C;  1G2S A;  3DM1 A;  3TN2 A;  4R8I A;  1WTP A;  3R93 A;  3MTS A;  3FPU B;  3MWY W;  1WD0 A;  1X3P A;  1MSG A;  2EOT A;  1AZQ A;  1B3A A;  1Q3L A;  2L1B A;  4XT3 B;  2N88 A;  4NW2 A;  1RHP A;  2FJ2 A;  1JE4 A;  1EOT A;  4X3U A;  1WTW A;  1HUN A;  1BBX C;  1S4Z A;  1MI2 A;  4HCS A;  1NR2 A;  1RTO A;  1AP0 A;  3I3C A;  1GUW A;  4HSV A;  3TZD A;  2MPM A;  1F2L A;  2Q8R E;  3SVM A;  5EPJ A;  4OIK A;  1E0B A;  1ZXT A;  1EIH A;  3GV3 A;  3I90 A;  1VMP A;  1U4M A;  3ONA B;  1U4P A;  3UI2 A;  3I91 A;  2FFK B;  1G91 A; 
#chains in the Genus database with same CATH topology
 4L8J A;  2NVQ B;  1YZ6 A;  1WTV A;  2PNH A;  4OON A;  1EIG A;  5COR A;  1C9O A;  4FF1 A;  4MN3 A;  1CHP D;  4NDX A;  3S16 B;  1NMG A;  5IOC A;  2KHI A;  3CCQ A;  1ENF A;  4A93 H;  2A6E D;  3ERO A;  2XNA C;  4PZ8 A;  4A3J H;  1TKW B;  3FMC A;  4JOI C;  1VQG A;  4ODG A;  5IP7 H;  4DV7 L;  1V1O A;  3H0G H;  2WKD A;  1STY A;  4X65 L;  1CQF A;  4LJZ C;  1XMO Q;  4DV4 Q;  4BY7 G;  3VYU A;  4TSS A;  1NTG A;  5IE8 A;  4JI0 Q;  1KNA A;  3LGJ A;  1C0A A;  4BBR G;  2RBM A;  3KF8 B;  4K5W A;  4FF4 A;  3FVQ A;  3PQI A;  1EFI D;  2ZT9 C;  2D0P A;  4A3E H;  2E5L L;  1LUZ A;  4DAY A;  4QQB X;  3PIP 3;  5M3M G;  1KDC A;  4R4I A;  3VYS A;  1N32 L;  2A68 D;  4LF5 L;  1KL9 A;  5M3F G;  4BY1 G;  3MXG A;  4YCW A;  3E5S A;  1E3P A;  2E2I H;  3T1Y L;  1QNK A;  2B2V C;  1WTQ A;  3N52 A;  2LS0 1;  5JVG 3;  5M5X H;  4DV0 L;  2A73 B;  2ZTC A;  2IJ0 A;  1DOL A;  3KLS X;  1HFN A;  5DNF A;  3P75 A;  1YNJ D;  2CCZ A;  1FGB D;  2H5X A;  1KC8 C;  1HNW Q;  2ICI A;  1CKO A;  2B29 A;  1Z47 A;  3M7G A;  2CHB D;  1L2F A;  3MXU A;  4YWL A;  5KYL A;  3C46 A;  2XWJ B;  5C5M A;  4X64 Q;  1E2V A;  1KQS A;  1X65 A;  2DN8 A;  2AWN A;  4A3I B;  1STA A;  3KUP A;  1PH6 A;  5JOB A;  5C4H A;  3BG3 A;  4RGN A;  2NN6 H;  4KMU C;  3PIO A;  3CQZ H;  4QUF A;  5C3E H;  5JAV A;  2B63 B;  5E4W C;  1I4G A;  4JV5 Q;  3AB9 A;  3HOZ B;  3M85 A;  1C7Y A;  2K5D A;  4BXX G;  1RHP A;  4EQ5 A;  4YWK A;  3KJO A;  4WJ3 M;  1S4Z A;  4NPS A;  1JMC A;  1FD7 D;  4HSV A;  1VF7 A;  3FRP B;  1CT1 D;  2WAQ B;  5C3X A;  2JQO A;  5IP9 H;  3HEJ A;  4FYD A;  1O80 A;  5ELD A;  3TBI B;  3PO3 B;  1W3S A;  3MHB A;  3S15 H;  1H9R A;  4KHZ A;  4K14 A;  4JI8 Q;  2CQA A;  3H09 A;  1U4L A;  3NEN A;  4A3B B;  3X3M A;  4YWM A;  4HID A;  2ENB A;  3AU7 A;  1NMF A;  2HHH L;  1F9P A;  1YHB A;  5FO8 B;  4DN4 M;  2L55 A;  2K50 A;  1I3Q H;  3EN2 A;  3VR5 A;  3L2P A;  3CME A;  1F9S A;  3TME A;  3OTO Q;  3RN5 A;  1FNW A;  3GTM H;  4ILW A;  1S5E D;  1JOO A;  2AUJ D;  1PRT C;  1RKN A;  3KF6 A;  1E2W A;  1DJR D;  2KEC A;  4PQX A;  2VXW A;  2RDG A;  3EQL C;  4GN4 B;  3BDC A;  4AQY Q;  2F0K A;  1XNR L;  2K33 A;  3HOV B;  3LWU A;  1OXV A;  4EQO A;  1A2U A;  3MC0 B;  1HFG A;  1KLG D;  1MKH A;  4OEL B;  1W2B A;  1UWV A;  3H3V I;  4X66 L;  4C3I G;  2E2I B;  4B9W A;  2F3W A;  2K03 A;  1Y1W G;  4WJW A;  5J3B A;  1WCM H;  1Y14 B;  4FVM A;  1MJE A;  3LNN A;  2B8G A;  4IUQ A;  4F8M A;  1O7I A;  1X56 A;  3I8Z A;  1VQ6 A;  2F3I A;  1T5X D;  3NWS A;  2MFI A;  4DK0 A;  3I4L A;  2QA4 A;  2JA6 H;  3QO2 A;  1D1I A;  1KLU D;  1A6X A;  2JEB I;  4JW0 A;  4JI3 L;  2QEX A;  1EYC A;  3CMA A;  1YNX A;  2B2W C;  2A69 D;  2F0P A;  2QDL A;  1N34 L;  4ZYS A;  1EYA A;  3I2Z A;  2UUA Q;  5FO7 B;  1HNX L;  2A1A A;  1K83 H;  3BJU A;  5G3L D;  5IGE A;  1PXU A;  3DWP A;  5C3E B;  1IYJ B;  1JOR A;  1L0X B;  4XYQ A;  2N88 A;  4OGQ C;  4P71 A;  4DV6 L;  4L5Q A;  4HCS A;  3AFQ A;  3VR6 A;  3R3O A;  3NTK A;  4KI0 A;  1FJG L;  2O5J C;  3SR1 A;  2EYJ A;  4KLK A;  3X3N A;  1V1Q A;  2UXD Q;  2YYZ A;  1QG7 A;  1K9M C;  4IO9 A;  1TS3 A;  2N55 A;  2PQA B;  4LFB Q;  4ZK9 B;  3A8K E;  3TSS A;  1ENC A;  2EY2 A;  5IT9 L;  5LMU L;  2F3V A;  3TDQ A;  1SE2 A;  2CKZ B;  1OO9 B;  1CKN A;  1H9S B;  4CBV A;  1EWC A;  4CDD C;  1X32 A;  2H4O A;  4RCO A;  1LTB D;  4B3S Q;  3KBX A;  4IPH A;  1JWU D;  1VQK A;  2PO4 A;  1KRT A;  2WB1 G;  4LF8 Q;  1I3Q B;  5C3W A;  3A5U A;  2KQ3 A;  4PV1 C;  5ISR A;  3GTM B;  1AEX A;  2RKS A;  3S14 H;  2IW3 A;  4P74 A;  4IUN A;  2IY5 B;  4RGT A;  3D4W A;  3KYH C;  4QCL A;  4RKL A;  3PO2 H;  1CTM A;  2DGY A;  2ZM6 L;  1PFB A;  3GTG B;  1VS0 A;  1TY2 A;  4A3G G;  1EU3 A;  2HCI A;  1K3B C;  3UDG A;  1BUV T;  4G7Z C;  1L1O B;  1CA5 A;  1ESR A;  4HIM A;  5C0X J;  3RZO H;  1Q82 C;  2JEA I;  4QB4 A;  1A3U A;  2HIX A;  1X3F A;  3UDX A;  1U9R A;  4JG2 A;  1LTT D;  3S24 A;  2F0T A;  1EWI A;  2R7F A;  2QF7 A;  4U68 A;  2BOS A;  1G6P A;  1SYB A;  4UY8 C;  2XRS D;  1XPU A;  1YIT A;  4DF7 A;  4A93 G;  1RJT A;  4A3J G;  1QJO A;  5IYB G;  4G7O C;  4P75 A;  4KN7 C;  4Q5V A;  1CSP A;  3K5N A;  1I4X A;  5IP7 G;  3H0G G;  4JBM A;  1IBL L;  3J7A 5;  5IWA Q;  1PH2 A;  4DV3 L;  1UEB A;  2ZXR A;  4PNY A;  5EPL A;  4S3S A;  1O7L A;  1JIC A;  3D4R A;  4J1M A;  4DR1 L;  4X6A H;  2BH8 A;  3A0J A;  1TS5 A;  3K7A B;  3NBH B;  4HJ5 A;  4DR7 L;  1SAP A;  5KEE A;  1RDP D;  2R7Z H;  2B2Y A;  3J7A V;  3GTL H;  1B3Q A;  1IHZ A;  4A3E G;  1K83 B;  2HT1 A;  2EYL A;  2PW5 A;  1PVO A;  3RZD H;  3SXH A;  2E76 C;  1X3P A;  3K0Y A;  3DHQ A;  3OWF A;  4NW2 A;  4OO1 H;  3J80 L;  2PMZ E;  5LMN Q;  1K8M A;  5BN3 A;  2K14 A;  3I3C A;  1TII D;  1F2L A;  2UXB L;  4OHJ A;  1K8O A;  2E2H B;  1VDZ A;  3ONA B;  1IYU A;  4UAI A;  4CDF C;  2J0T D;  1K3R A;  1BKB A;  2KCT A;  3K59 A;  1SEB D;  4HAE A;  1XTD A;  3PUX A;  4RH6 A;  3B6Y A;  2K1B A;  4ZUJ A;  3CD6 A;  3JAM c;  1SNP A;  1PTO H;  2RA4 A;  2JN4 A;  1G29 1;  5D3D A;  1VQ4 A;  4A3K H;  2BCO A;  1MIU A;  3EIV A;  1I94 L;  2NWG A;  3EA6 A;  1I4R A;  2NN6 G;  2PCF B;  1PH8 A;  1CI3 M;  5C3E G;  4YY3 L;  3FKI H;  3BU2 A;  3CXC A;  3F2D A;  4JI2 L;  3G7L A;  1OTC A;  5CR3 A;  4DNR B;  3PO2 B;  4V19 0;  2EJM A;  2VS1 A;  1TVX A;  3NK9 A;  2NVX B;  2FMM A;  2JA7 B;  1Y1V B;  3OIP A;  5CC4 A;  3RZO B;  3C1F A;  3TP8 A;  3AMU A;  1SMY D;  1N33 Q;  5IP9 G;  3KLW A;  3A74 A;  5JJZ A;  1FL0 A;  3CC7 A;  3MEH A;  1B70 B;  5JJL A;  3T51 B;  5E4X A;  5L37 A;  1W6K A;  4LF6 L;  5T1G A;  2JA9 A;  3CCV A;  1PYS B;  1PA6 A;  5JEA J;  4HN7 A;  3QR8 A;  3BVM A;  3RUZ A;  4IFD H;  4DV2 Q;  1SJE D;  2SOB A;  4JK1 C;  4GKK L;  1QVF A;  4L6T B;  3NEL A;  1C8C A;  1YVC A;  2K5Q A;  2HUG A;  4JI4 L;  3I4N B;  2BA0 A;  2CVR A;  1JCK B;  4JYA L;  2DY7 A;  4QIW B;  3KF8 A;  4C3H B;  3BYY B;  1A3T A;  1IW7 C;  3K5L A;  1WTH A;  4A3M H;  2R7Z B;  1EY9 A;  4APV A;  3GTL B;  1GD7 A;  2EJG C;  4BA1 I;  1HQM C;  4PG3 A;  2JA5 B;  1AZQ A;  1B3A A;  1S72 A;  3RZD B;  4DV7 Q;  2DNE A;  3K8A A;  3MXP A;  5KNB A;  1SBB B;  4X65 Q;  1PMR A;  5CYU A;  3CHB D;  3TZD A;  3CP0 A;  3FHW A;  2Q8R E;  4DA2 A;  1GKH A;  4K2K A;  1YJN A;  1WCM G;  2E5L Q;  3NEM A;  5IT9 c;  4NKL A;  4LAA A;  2JA6 G;  1LYL A;  3D0F A;  1N32 Q;  1PRT F;  3HOU H;  1LT4 D;  1M4V A;  2EXZ A;  4OIJ A;  2XRQ D;  3KDF B;  1PTO B;  1GHJ A;  5KRU A;  1VQH A;  1XMQ Q;  2OQ0 A;  1AZP A;  1F2Y A;  2M2L A;  5C0X H;  5DM7 3;  4DR3 L;  4A3K B;  1HR0 L;  4KK7 A;  2NVQ H;  3TS0 A;  2CFM A;  4A4I A;  2X6G A;  1GUO A;  4A3F H;  3S16 H;  3GV6 A;  4IUT A;  1E24 A;  1SN8 A;  1N9W A;  4RG1 A;  2IHF A;  3T1H L;  2KOL A;  1BOS A;  1BR9 A;  4GOP C;  1KDB A;  4QIW E;  4JI7 Q;  3AQQ A;  1A2T A;  2RSN A;  3DWQ A;  3MEF A;  2VNU D;  2F0G A;  4A3C H;  3CF5 A;  1XYI A;  2KVM A;  3DM3 A;  4OWX B;  1BCP D;  5FK9 C;  1H9M A;  2HCC A;  3CCJ A;  1ILP A;  4I7A A;  3QOL A;  1VQ7 A;  3CCL A;  1PFN A;  3BYT B;  4AYB G;  1WOC A;  3E9H A;  3IKJ A;  2B2U A;  4KD3 A;  5A35 A;  1DYQ A;  3J7Z C;  3CPF A;  5CGK A;  1WJJ A;  2IT1 A;  4RCN A;  3S9W A;  2Q8I B;  2M9V A;  1QE6 A;  5T1I A;  1GM5 A;  1EYG A;  1S5B D;  5BR8 L;  5GQO A;  3TRE A;  1OXS C;  4KHP L;  3MFG A;  1N36 L;  4C2M H;  1H95 A;  2PNR C;  2HDM A;  5CBA E;  2VB3 X;  3OW7 A;  2YTV A;  3WWV A;  2VQE L;  2OQK A;  3CRL C;  1S5C D;  2WP8 J;  2K4K A;  4ABN A;  2PW7 A;  1QUQ B;  5AJ3 L;  4DR6 Q;  1QCB D;  1T5E A;  3FPU B;  4PMW A;  2NZH A;  3RLO A;  2UXC Q;  4O1N A;  1V1P B;  1BBX C;  4A3I H;  2K52 A;  2R7D A;  4ZRZ A;  4OIK A;  4CDC C;  1JJ2 A;  2KHS A;  1VQL A;  3VR2 A;  1EIH A;  2F0M A;  3EJI A;  1WYD A;  4DNT B;  2B63 H;  4LF9 L;  3HOZ H;  4OWT B;  1U5K A;  3D4D A;  5CBE E;  1IXR A;  1PH4 A;  3RR5 A;  4YIJ A;  3ULP A;  1IYV A;  1XNR Q;  2AQ3 B;  4YHH L;  1BNZ A;  2EDG A;  4BWG B;  4DV1 L;  1G6Z A;  2A6E C;  2BA1 A;  2R61 A;  4Y7N B;  1HNZ L;  4NP5 A;  3RMH A;  4X66 Q;  2ZJQ A;  2AWO A;  1K0S A;  2V1C C;  4CGY B;  2R7Z G;  4POF A;  3TRZ A;  2NVT B;  4A3B H;  1BBW A;  4A3F B;  3GTK H;  2MGS A;  1HTP A;  4OO1 G;  5IGF A;  2I5L X;  4DAM A;  1BDO A;  1CM9 A;  1JWS D;  3PSI A;  5KGU A;  2K5W A;  2R93 H;  3VA5 A;  4CJ1 B;  2NZ1 D;  3EBE A;  4ZCK A;  3J80 E;  2A68 C;  3HOX B;  5C4X B;  2ASB A;  3OWE B;  4IOA A;  1BVS A;  1IL8 A;  2PQA A;  1VCI A;  2JP1 A;  2XWB B;  3URY A;  1HZA A;  4ID6 A;  4DUZ L;  4EQN A;  1H9S A;  4LK1 C;  3RLN A;  1YNJ C;  3GTP B;  4DV6 Q;  3TP7 A;  3HOV H;  5FLX c;  2B39 A;  2B2T C;  3I4M B;  1FJG Q;  4JI5 L;  2EQS A;  4MHE A;  4DR2 Q;  2PZW A;  1B4O A;  2F0F A;  1BXT A;  2SNS A;  3VA7 A;  3T16 A;  3U9S A;  2KCN A;  1OXT A;  3PUW A;  3FKI G;  4A75 A;  1I4Q A;  3OMC A;  2TMP A;  4C2M B;  5BN4 A;  4K0K Q;  2ES2 A;  5LMU Q;  3E6Z X;  3SE0 A;  5GAG C;  3L9A X;  1WD0 A;  2SEB D;  2L1B A;  4DUY L;  1L1O A;  1B1Z A;  1EEI D;  3F8T A;  3WDN A;  1CSQ A;  3UDI A;  2CH4 W;  1V8Q A;  2LXK A;  3V96 A;  2R92 B;  1IBK Q;  2YU9 B;  3OPO A;  3R8B A;  3PIP A;  3M4Q A;  4ALP A;  2KHJ A;  5K36 H;  4C1N I;  1II3 A;  4JI6 L;  1FYC A;  2LMC B;  1TS2 A;  2A5H A;  5DAU A;  1ENA A;  3A56 A;  3ERS X;  4UP8 A;  5I6Y A;  2OCE A;  2QKI C;  2N49 A;  2KA7 A;  1CHQ D;  4JPB W;  5FKA C;  4IFD G;  1Q12 A;  2BH2 A;  1NAP A;  3S17 B;  3W2D A;  4BS9 A;  1ZYR D;  3TEH B;  1I6V C;  4H44 C;  3DWA A;  2QIL A;  3MXN B;  1GJX A;  1HTL D;  3NUC A;  3NBH A;  1ICW A;  1SRO A;  5HY6 A;  3QWN A;  2R6G A;  4CJ2 C;  3GTJ B;  1XNQ L;  2K32 A;  3BDL A;  4GN3 B;  3T56 B;  4XQQ A;  4HTH A;  4A3M G;  3VR4 A;  4ULL A;  4WJ4 A;  5JPN C;  4C3J H;  2KUM A;  3H3V H;  3HKZ B;  1IBM L;  4B3M L;  2BDN A;  1TWF B;  1U4R A;  3JAM L;  1IBL Q;  5J22 A;  5M9O A;  3GTK B;  5LL6 X;  2Z6K A;  4B3T L;  4X3K A;  1DCZ A;  3H91 A;  1QOH A;  4N9P A;  1W6J A;  3CPW A;  1TY0 A;  1EY4 A;  4LFC L;  3JC6 6;  5EPK A;  2R93 B;  3I73 A;  3D6C A;  3I4O A;  3PMF A;  4JOI A;  1SRU A;  3FDT A;  2MO1 A;  3GTG H;  2N78 A;  5M5Y B;  3U50 C;  1ML0 D;  3HOU G;  1VQI A;  1QWY A;  2BE5 D;  1UE5 A;  3K58 A;  4H13 C;  2Z4H A;  3SK4 A;  2UU9 Q;  4QY7 A;  4O42 A;  2UXB Q;  5F2D A;  2JSO A;  1S5F D;  1Y8O B;  2F0E A;  4K5X A;  5E1F A;  1WTR A;  4K2L A;  2A69 C;  1P8L A;  4A3F G;  3KBG A;  1CZW A;  3VDY A;  2JJQ A;  2WAQ E;  5FOB B;  1A8V A;  2I46 A;  1NSN S;  4IPG A;  2F52 A;  1TT2 A;  2N8N A;  5EBC A;  3IAY A;  1Q3L A;  3K7U C;  1N8R C;  2UUC L;  3STB D;  5EKL A;  4X3U A;  1XXG A;  4IN3 A;  1MI2 A;  4J15 A;  4NMZ A;  3P1H A;  1PTO D;  2UUB L;  1E1T A;  1ZXT A;  1D8L A;  3K7A H;  1AW7 A;  3CCU A;  2LKV A;  3G48 A;  1PH9 A;  4YY3 Q;  1NBW A;  1UUP A;  4TVA B;  1EIF A;  4LW1 A;  5LL6 S;  1XJV A;  4JI2 Q;  1DOK A;  4RGM A;  4A3D H;  1EQV A;  3NP8 A;  4HMI A;  1ILQ A;  4JBK A;  2C9O A;  1BCP F;  2GVB A;  1ASY A;  1VQM A;  2RHQ B;  1DON A;  2E2H H;  2K5V A;  4RWS C;  5HGQ A;  1X3E A;  2EPB A;  4DV4 L;  1NR4 A;  2HDL A;  3HOY B;  1B44 D;  3P7J A;  5IYC G;  4GOP B;  1J5E L;  2P5Z X;  1V43 A;  4LF6 Q;  3M4O H;  1STN A;  2L5T A;  3CU7 A;  3KK7 A;  2CW0 D;  3A8I E;  4IPC A;  4C3J B;  1S5D D;  1XX8 A;  3HFZ B;  4A3I G;  1QVC A;  1STH A;  4KHV A;  1LO5 D;  2Q2U A;  4J8Q A;  3U58 A;  4GN5 A;  4KD4 A;  2A74 C;  1YHA A;  4MZ9 A;  4UDU C;  2F4V Q;  4IZ8 A;  2B63 G;  4B9X A;  1LLR D;  3KLR A;  2H1E A;  5GAD C;  3HOZ G;  3HZX A;  1SNO A;  3MA2 B;  4YCV A;  1HNW L;  5EBD A;  2VB2 X;  4MTN A;  4LFA Q;  1S3O A;  2VW9 A;  2NVX H;  4X64 L;  3VR3 A;  3KDF A;  2XGT A;  2ID0 A;  4E6I A;  2JA7 H;  1Y1V H;  5KND A;  2WAQ G;  4JI1 L;  4A3L H;  3ITP A;  3R2T A;  4JVZ A;  1MGS A;  2CQO A;  2BDO A;  2G5D A;  2I07 B;  1Q8K A;  3HGB A;  4K5V A;  4GKJ Q;  1HJP A;  1G8Z D;  4R9W A;  1DZ1 A;  2DJG C;  3PO3 G;  4DKA C;  3FP9 A;  3S1N H;  1Z6H A;  1Q7Y C;  3AFP A;  3E3X A;  3I72 A;  2FHT A;  3SHL A;  2VL6 A;  4XIG S;  4A3B G;  2K28 A;  4DV5 Q;  4LUZ A;  3E0J A;  4X3T A;  3NQI A;  2YV5 A;  3MAQ A;  3MTS A;  3J80 i;  1VQ8 A;  1SR3 A;  4LUO A;  3NBI A;  3ER0 A;  2Q2I A;  1R9T H;  1GUW A;  1STE A;  2MPM A;  1HR0 Q;  4DR3 Q;  3I4N H;  3J81 j;  1LT6 D;  4C3H H;  3NWT A;  1HQR D;  3W5O A;  5I2X A;  2F1M A;  1GOZ A;  2Y0S B;  4QUC A;  5HUR A;  4JI8 L;  2JA5 H;  2B2W A;  1JJG A;  1JE5 A;  1RL2 A;  4A3D B;  1E2Z A;  4FXG C;  3HOV G;  4NXM Q;  1IKM A;  2AHO B;  2SNM A;  4HJ8 A;  2PPB C;  3S1M B;  3OTO L;  4HSP A;  3TP6 A;  3K80 C;  1U0L A;  5TSS A;  1SXT A;  2J4X A;  5ELF A;  2YTY A;  1I50 B;  3M4Y A;  4TQU S;  2VQF Q;  4F88 A;  1H9K A;  1MJC A;  3SDZ A;  1HZC A;  2DUD A;  2PQE A;  1QUQ A;  4G57 A;  1Q81 C;  2EE1 A;  3A7A B;  2B3G A;  1H9J A;  3M4O B;  1Q46 A;  2EYH A;  1B9M A;  1V1P A;  1CFM A;  2WKC A;  3CCR A;  3SK8 A;  3G6E A;  1WTX A;  2WAC A;  4AQY L;  4GNX C;  1J6Q A;  1TWA H;  2XIW A;  2JA8 H;  4O0A A;  4NXN Q;  2ATW A;  2PI2 A;  1QZH A;  2VQE Q;  4L5T A;  3CCS A;  1J8I A;  5KIX A;  1SMY C;  4DR5 Q;  2VUM H;  1PFM A;  4CJ0 B;  4UP7 A;  4Y52 H;  2NVY B;  1FNV A;  2MNA A;  2X69 A;  1EY5 A;  2L9H A;  3NQT A;  2F0J A;  3W1G A;  3H6M A;  2NUC A;  1GHK A;  4B3R Q;  1GUT A;  4R8N A;  2A6H D;  5I2Y A;  5I9P A;  1WI5 A;  2K75 A;  5J1Z A;  4LF9 Q;  3S1N B;  1Q8I A;  4C3J G;  5A2Q L;  1G2S A;  3DM1 A;  4HIK A;  5ELN A;  1Z9F A;  3R93 A;  2YTX A;  3Q22 A;  4MNO A;  2EOT A;  2Q2H A;  4N9T A;  1VF5 C;  2FJ2 A;  1BBU A;  1MD2 D;  3QG1 A;  1DGS A;  4DV1 Q;  2CWP A;  5E3F A;  5FLX L;  3JAM E;  1R9T B;  4IJH A;  4BBS H;  4LF4 L;  4O2D A;  1YNN D;  3A5Z B;  2UXD L;  3M3Y H;  1VQO A;  1K8A C;  1G91 A;  3G4S A;  3OSO A;  1UEA B;  3LWE A;  4LFB L;  1ET6 A;  2IX1 A;  2X6L A;  5HGT A;  5JVH 3;  1ICF B;  3MVV A;  1QZG A;  5M5W H;  1DD2 A;  3CCE A;  3I56 A;  5C5L A;  2HQL A;  5EGT A;  1TWG H;  1XWE A;  2J7Z A;  1SSO A;  1HCZ A;  4XTC S;  3VYR A;  5EKI A;  2HD3 A;  2IL8 A;  3MZ5 A;  1HHV A;  3LX0 A;  3W1B A;  4LMQ D;  1HRJ A;  4DUZ Q;  1SFO H;  2WII B;  1VQP A;  5DEH A;  4K6L A;  2OT2 A;  4LF5 Q;  5I4D A;  4Y7N H;  1G51 A;  2A8V A;  1HZB A;  1PRT B;  1VQB A;  1DM0 B;  3T1Y Q;  1TWA B;  1YBY A;  2JA8 B;  4R4T A;  4I7Z C;  2KJX A;  4IQZ A;  4DV0 Q;  4F87 A;  2NVT H;  4BY7 B;  4NB3 A;  4JBW A;  1BCP C;  2L12 A;  2NB0 A;  2QEJ C;  1KXL A;  3KLS A;  4IOC A;  5C6A A;  4A3D G;  3O13 A;  1E1O A;  2VUM B;  1JB3 A;  4BBR B;  2F03 A;  2WIN B;  3UE1 A;  2E74 C;  3DEO A;  4ZQ3 A;  1ESF A;  1PH7 A;  1EQT A;  1XPO A;  1JC7 A;  1CUK A;  5IWA L;  3MXN A;  4KKU A;  1JWM D;  1NJI C;  3HP3 A;  3KOJ A;  5M3F B;  3HOX H;  5C4X H;  3A54 A;  5G3L F;  3H94 A;  2IHE A;  3F2C A;  2RCN A;  5ELC A;  4LWC A;  2HQE A;  4L63 B;  2M00 A;  4R8I A;  3GTP H;  4ZUI A;  4K8I A;  1SYF A;  2EYF A;  2F0U A;  3I4M H;  5IT9 E;  1NR2 A;  2XN9 C;  3P20 A;  2Z0S A;  3Q23 A;  1XNQ Q;  4BBS B;  2LY7 A;  3K81 C;  2QGQ A;  5JPM C;  3TP5 A;  3M3Y B;  3TS2 A;  2E2D C;  3D6W A;  1EY7 A;  1PZJ D;  3KFU A;  2O2L D;  1JR0 D;  5CV4 A;  3PO2 G;  1FVI A;  4M1U B;  2Z1C A;  1IBM Q;  4B3M Q;  3L0O A;  1TU2 B;  2JA7 G;  1Y1V G;  2HHH Q;  4A3L G;  5M5W B;  5CMD A;  2R92 H;  2ZXO A;  2YU9 H;  1A15 A;  3CC4 A;  4LFC Q;  1TWG B;  2MHV A;  1J9O A;  3E9I A;  2K01 A;  1AE2 A;  3ICE A;  1SDF A;  4WFN 3;  1R4P B;  2RCF A;  1QIL A;  3VYT A;  4XYO A;  3S17 H;  1GVP A;  1WVL A;  3GP7 A;  1K73 C;  3GD7 A;  3V2T A;  1SFO B;  1GO3 E;  2EJF C;  2F0I A;  3FPP A;  1X3Q A;  1GXD C;  2D9U A;  3I4N G;  5I6W A;  3HKS A;  1BF4 A;  1M90 C;  1IKL A;  2MO0 A;  3GTJ H;  2I0Q A;  1LTA D;  4C3H G;  4R4C A;  3G6J B;  5LMN W;  4DNI A;  1KAA A;  3HS0 C;  4QJF A;  1F2Z A;  4OX9 L;  4CKC A;  2IWH A;  2JA5 G;  1A62 A;  4J6H A;  5EQ0 A;  1GUN A;  4RA8 A;  1TWF H;  1KNE A;  2L4N A;  4KY7 A;  4ME5 A;  2UUC Q;  4A3G H;  2E75 C;  1NE3 A;  1JJC B;  1O78 A;  1RTN A;  4DV2 L;  1ET9 A;  2EIF A;  2FIN B;  4JI3 Q;  3FEW X;  2K5N A;  5JEA H;  2ZXP A;  5IYD H;  1N34 Q;  1VQ9 A;  4IPD A;  5D14 A;  4EVO A;  4ZKB B;  3Q6S A;  4GOP A;  1HNX Q;  3ZJY C;  2Z4I A;  5CV9 A;  2CH4 A;  3BVZ A;  1E22 A;  1NCV A;  1NNX A;  4C3I B;  3OIQ A;  3T4A C;  1Y1W B;  3U4Z A;  4ME3 A;  2XVS A;  5M5Y H;  3K5M A;  4UHV A;  5IYB H;  4PMB A;  2VZA A;  2PI2 E;  3S1R B;  3NE5 B;  1JE4 A;  1YI2 A;  1HUN A;  3SK6 A;  3TQY A;  2JA8 G;  1VQE A;  4A3K G;  2PYK A;  1FGU A;  1E0B A;  1YJ9 A;  4H7B A;  3S2H H;  1EZ8 A;  2NBF A;  3I91 A;  3J81 L;  1C4Q A;  2MUY A;  1J5E Q;  2VUM G;  3BS1 A;  3DEP A;  4K8J A;  4DPG A;  2L15 A;  4KJO A;  4HMJ A;  1F9R A;  4WRD A;  1IL2 A;  4QMG A;  1EY0 A;  1FNU A;  1SE3 A;  3PIO 3;  1X9N A;  4Q0F A;  3IRB A;  1EY8 A;  3T13 A;  3F1Z A;  4ZKC B;  1XMQ L;  1EL0 A;  4CHT B;  1ZYR C;  2NTS A;  4PZ7 A;  5EJW A;  2D2C C;  1I5F A;  3OHX C;  1MHW C;  4GS3 A;  3JAM i;  2F0N A;  3NTH A;  4TRD A;  4AIM A;  1MBY A;  2ZM6 Q;  1M8A A;  1PLF A;  4GNX B;  1LV9 A;  1UAP A;  2CWA A;  3D8G A;  4KV6 A;  2A19 A;  4JI7 L;  5A2Q E;  1HH2 P;  1DOM A;  4POG A;  4JI1 Q;  1LTL A;  2DJF C;  1PZI D;  5J39 A;  2G9H D;  4KY5 A;  4BBS G;  5ELB A;  4EGV A;  2ALY B;  1YEZ A;  4I65 A;  3HOY H;  4LNQ A;  2MJ8 A;  5FLX E;  3K6O A;  2WB1 B;  4G7H C;  3DMU A;  5ELE A;  4RGO S;  2Q2T A;  3ZYY X;  1KTK A;  3ND8 A;  3NXW A;  5IGG A;  2AMC B;  5LHY 1;  5CV7 A;  1LTG D;  3CRK C;  2RF4 A;  1EQR A;  4A3G B;  3GTQ H;  4DV3 Q;  1O7Z A;  1DXM A;  4X62 L;  5IIF A;  2RVL A;  5ELO A;  3SEB A;  2BE5 C;  4XQJ A;  1GUG A;  3HRZ C;  2V4D A;  1LTS D;  5IY0 A;  4DR1 Q;  4JBJ A;  4F7X A;  2MP1 A;  4V0B A;  4A76 A;  4DR7 Q;  3DXJ C;  4IUV A;  3SGI A;  1B2T A;  3GTO H;  4LF7 L;  1TS4 A;  4DR6 L;  1RCV D;  3MWY W;  5GAE C;  3UDF A;  3WOE A;  3J7A F;  4DR4 L;  4U67 3;  1VQ5 A;  1D6E C;  1KIX A;  4A93 B;  1SYC A;  1VQF A;  2NN6 I;  4A3J B;  2UXC L;  1I6H H;  1JOQ A;  1NY4 A;  3IFT A;  1CK1 A;  5DLQ E;  2KEN A;  1PFS A;  2XSC A;  3H0G B;  5K5P A;  3DLL A;  2ZTD A;  3STB C;  1STG A;  5C0X G;  1QNU A;  1SYE A;  1VQN A;  3GV3 A;  4KKS A;  2QCP X;  1LTI D;  1HXY D;  1PTO C;  2FFK B;  3L3O C;  2O5I C;  3S2H B;  2WV6 D;  4QL5 A;  3TZU A;  4GLX A;  3L7Z C;  1E7Z A;  3N6R A;  2Q8T A;  2B2T A;  2E2J H;  1ZEQ X;  4FDB A;  3S2D H;  1Q1E A;  2QW7 A;  2WB1 E;  3Q24 A;  1K28 A;  3I7F A;  4CKE A;  4A3E B;  1PH1 A;  1TR5 A;  2B2V A;  4B08 A;  4DK1 A;  4R4O A;  3OMG A;  4A3C G;  4PZ6 A;  4JCV E;  4OXP A;  3PF4 A;  4R4Q A;  3Q0A A;  1PRT D;  4DAV A;  3HOX G;  5C4X G;  3DUZ A;  1BQQ T;  3HKZ E;  1EYD A;  5KYI A;  1I94 Q;  4WOR A;  2EVB A;  2IX0 A;  5IGB A;  1B53 A;  1P16 A;  3CW2 C;  4RMF A;  5M5X B;  1VQJ A;  2C5C A;  1VQC A;  1HA5 A;  1TWH H;  1Y8P B;  3HOW H;  5C44 H;  1G2T A;  3IL8 A;  4MTK A;  1AE3 A;  3I4M G;  3NPP A;  3OYY A;  4IJL A;  2B2Y C;  4IUR A;  3S1M H;  2I5M X;  2CW0 C;  5EKK A;  3PUY A;  1SE8 A;  4TKO B;  1D5Z C;  1BCP B;  5I9O A;  1KAW A;  1SJH D;  1TQO A;  1XMO L;  1I50 H;  2D62 A;  2F0W A;  4JI0 L;  4HIO A;  1PYB A;  1PZK D;  1VQA A;  3CQZ B;  2RHS B;  4FO2 A;  3AEV A;  4IFD J;  2HIV A;  5C4J H;  1SND A;  2AQ1 B;  4PMC A;  4KN4 C;  1Z7T A;  2R92 G;  4GKK Q;  1BO0 A;  5CV8 A;  3GTQ B;  5D65 A;  3M7N A;  4DR2 L;  4LF4 Q;  1NUC A;  2QDB A;  1SNM A;  3BZD B;  4JI4 Q;  1CZG A;  1Q86 C;  1EZ6 A;  4JYA Q;  1XTC D;  3U9O A;  4K0K L;  2NVY H;  1JT8 A;  3A7L A;  2TSS A;  3S15 B;  5GAH C;  1RIP A;  3GTO B;  3M4P A;  1MSG A;  2F0H A;  4DAY B;  3HG9 A;  2F0L A;  3S1Q H;  1PHJ A;  4K6D A;  4EQP A;  1I6H B;  1EY6 A;  3D3R A;  1IBK L;  1KRS A;  5EPJ A;  3QIA A;  1PH3 A;  3U4V A;  4Z9C B;  3I55 A;  1LAC A;  2OXP A;  3I70 A;  3J81 c;  2RSO A;  2F0O A;  3QOJ A;  4IUP A;  2PMZ B;  1L0Y B;  3HKZ G;  4HJ7 A;  3V05 A;  3EFX D;  2LXJ A;  4JV5 L;  2E2J B;  1X54 A;  3S2D B;  2SDF A;  2XTI A;  1WTO A;  1OXX K;  5FLM H;  4QF4 A;  4ZLT F;  1D5M C;  2RDF A;  5JEA G;  5IYD G;  1S40 A;  1B9N A;  4C1N K;  2R93 G;  3F2B A;  4KY6 A;  2DY8 A;  1SMX A;  1IZ6 A;  1CQV A;  2OF1 A;  2C35 B;  4H0L C;  1AFP A;  1F2M A;  4DU9 A;  4HED A;  3UE0 A;  1KD1 C;  3NHH A;  3GQB A;  2EY5 A;  5COY A;  2EY6 A;  1ASZ A;  3T1H Q;  1WCM B;  5NUC A;  3CCM A;  1TWH B;  4M8A A;  2D0O A;  3HOW B;  4QGU A;  5C44 B;  4OL7 A;  4HJA A;  4AH6 A;  2JA6 B;  5IOD A;  3M9B A;  1SYG A;  2AUK A;  2EZV A;  5FJ8 H;  1YIJ A;  1KDA A;  5FO9 B;  2B8F A;  4DGZ A;  3RNU A;  1SNQ A;  1D5X C;  2RDH A;  1AH9 A;  2PZT A;  4KTA A;  5H1S E;  1ONL A;  3J81 E;  4HJ9 A;  5C4J B;  3D31 A;  5GRO A;  3PUV A;  4FF2 A;  1I4P A;  1T9H A;  2L11 A;  2UU9 L;  1KAB A;  1JQY D;  2K04 A;  3MFY A;  1YHQ A;  5D3I B;  2PZU A;  5BR8 Q;  2E8G A;  4KHP Q;  5K36 G;  1O7Y A;  1EEF D;  4UPA A;  2KCM A;  2K5H A;  3ULJ A;  4C56 C;  1N36 Q;  1I4H A;  4BY7 H;  1PV4 A;  2JXM B;  1AN8 A;  1STB A;  2JK8 A;  3KJP A;  2A6H C;  4EX5 A;  1TWC H;  3KF6 B;  4BBR H;  4AYB B;  1EQQ A;  4RHR A;  3RD4 A;  3TN2 A;  5AJ3 Q;  1WTP A;  1EFW A;  2ZTE A;  4GLV B;  1SE4 A;  2KCC A;  4CDE C;  4DFA A;  2F0Q A;  1Y8N B;  2G9D A;  5M3M H;  1Y69 U;  2WFW A;  2Y0S E;  3PF5 A;  1RTO A;  5M3F H;  3E0E A;  4BY1 H;  3S1Q B;  3HOY G;  1RD9 D;  1A3V A;  1X3G A;  4N8X 1;  5IGC A;  2Z8L A;  2UUA L;  2F0S A;  4OO1 I;  3S14 B;  1YNN C;  4HR7 B;  1PYW D;  3QJY A;  1C48 A;  1JB7 A;  4X3S A;  4GLA C;  2IPK D;  4YHH Q;  5IGD A;  2B2U C;  5AFW A;  1QB5 D;  1V9P A;  3A8J E;  4P2C B;  3PUZ A;  4DXF A;  5DM6 3;  1ROD A;  1CA6 A;  1HNZ Q;  5JJK A;  2IX3 A;  3CKI B;  4MIU A;  1GUS A;  3CAM A;  2Z9H A;  4L5S A;  4OX9 Q;  2OWO A;  4P73 A;  1EU4 A;  1HZ9 A;  2DNC A;  3J7Y W;  1CKM A;  3C2P A;  2LFN A;  2KBN A;  2NYZ D;  3ULL A;  4BXX H;  4AYB E;  4DK3 C;  3RLF A;  4GZY C;  5EAY A;  2JE6 I;  4B3S L;  3BZC A;  2NZO A;  1UE1 A;  2F0D A;  3K57 A;  4LF8 L;  2K7V A;  2O4X A;  2F4V L;  3SK5 A;  3BVG A;  2D5D A;  2EY1 A;  2VY3 A;  3AYH B;  4IUU A;  3W3A A;  2KEE A;  4LFA L;  4RFB A;  1R4Q B;  1CKN B;  2OTL A;  3F2U A;  1LM0 A;  2Z6B A;  4JI5 Q;  3C1E A;  4JC0 A;  1UNS A;  2ICE C;  2R3Z A;  2ZJR A;  1EUJ A;  1LTR D;  1EOV A;  2K6A A;  3PGZ A;  4GKJ L;  1A63 A;  1K0R A;  2RQX A;  1IW7 D;  1LT5 D;  2Y0S G;  1L0W A;  3ERQ A;  4IFD I;  4FNF A;  4XQN A;  1D1K A;  4DV5 L;  3HOW G;  4BA2 I;  5C44 G;  4GNX A;  1TWC B;  2AQ2 B;  3PCO B;  1D7Q A;  4XT3 B;  4DUY Q;  1PTO F;  3R2I A;  1WTW A;  1EOT A;  3PV0 A;  3K5O A;  2EXD A;  4FP5 D;  5M3M B;  1AP0 A;  1K8G A;  3C3L A;  1UE6 A;  3SVM A;  4BY1 B;  1VMP A;  4N8F A;  1A0I A;  1U4P A;  1B8A A;  1WD1 A;  2ZJP A;  4JI6 Q;  4C3I H;  1FR3 A;  3NTI A;  3BDO A;  1SLJ A;  5C4Z A;  1Y1W H;  2LSS A;  3FKI B;  1EWH A;  4RHS A;  3Q8D A;  4XDX A;  1ZKO A;  3S1R H;  2I5H A;  1PH5 A;  1LT3 D;  2GN5 A;  4NXM L;  2JYO A;  5LMN L;  4RAU C;  1D2B A;  4OEM B;  4YCU A;  4KKT A;  3H3V C;  4G4K A;  3WOF A;  4L5R C;  2KED A;  4DK6 C;  4FXK C;  4P72 A;  1SYD A;  2VQF L;  4UP9 A;  3GO5 A;  4R1J A;  2NTT A;  4ZAI A;  3ND9 A;  1RF2 D;  2EYO A;  5JJI A;  2N3S A;  1B7Y B;  5C0X I;  5BN5 A;  2MQH A;  1PDQ A;  5KNC A;  3OW2 A;  1OXU A;  1HPC A;  4B3T Q;  4X62 Q;  3T53 B;  4RKB A;  2OTJ A;  1Q90 A;  4NXN L;  1EIY B;  1L1O C;  2FXQ A;  3RN2 A;  4OWW B;  4FXD A;  2EYP A;  1LAB A;  5IYC H;  2F4I A;  4IAL A;  4DXG A;  1WFQ A;  4CKB A;  4DR5 L;  5CV6 A;  1XPR A;  1VQD A;  2GA4 B;  1HR0 W;  4LF7 Q;  1B50 A;  2K05 A;  4KJN A;  1F77 A;  4HCE A;  4DR4 Q;  1UE7 A;  1MSH A;  1X55 A;  2L0C A;  4A3M B;  2OEO A;  5FLM G;  1HUM A;  1YJW A;  3GDE A;  3J80 c;  3EVQ A;  3H15 A;  3A55 A;  4LUV A;  2FMC A;  2EYM A;  4XT1 B;  4B3R L;  3IFD A;  2GVA A;  1JOK A;  1N33 L;  3NSW A;  4DAP A;  1HA6 A;  3G71 A;  3K0X A;  3BZK A;  5E7N A;  1F9Q A;  1VMC A;  4H02 A;  4XXE A;  2AKW B;  3CC2 A;  1SNC A;  1M1K C;  1Q1B A;  2F0V A;  3HOU B;  1X6O A;  1KHI A;  5FJ8 G;  5CV5 A;  1QVG A;  3QB3 A;  2UUB Q;  3J81 i;  3OOC A;  3I90 A;  4FF3 A;  1TXY A;  1U4M A;  3UI2 A;  2Z6K C;  3PO3 H; 
#chains in the Genus database with same CATH homology
 4L8J A;  2NVQ B;  1WTV A;  1EIG A;  5COR A;  4FF1 A;  4MN3 A;  1CHP D;  4NDX A;  3S16 B;  5IOC A;  1ENF A;  2A6E D;  3ERO A;  2XNA C;  1TKW B;  3FMC A;  4ODG A;  1V1O A;  2WKD A;  1STY A;  1CQF A;  4LJZ C;  3VYU A;  4TSS A;  1KNA A;  2RBM A;  4K5W A;  4FF4 A;  3FVQ A;  1EFI D;  2ZT9 C;  4DAY A;  3PIP 3;  1KDC A;  3VYS A;  2A68 D;  3MXG A;  3E5S A;  1WTQ A;  1QNK A;  2B2V C;  3N52 A;  2LS0 1;  5JVG 3;  2A73 B;  2IJ0 A;  1DOL A;  3KLS X;  1HFN A;  5DNF A;  3P75 A;  1YNJ D;  1FGB D;  2ICI A;  1Z47 A;  3M7G A;  2CHB D;  3C46 A;  3MXU A;  5KYL A;  2XWJ B;  5C5M A;  1E2V A;  2DN8 A;  2AWN A;  4A3I B;  1STA A;  3KUP A;  5JOB A;  5C4H A;  3BG3 A;  4RGN A;  2NN6 H;  4KMU C;  4QUF A;  5JAV A;  2B63 B;  5E4W C;  1I4G A;  3AB9 A;  3HOZ B;  3M85 A;  2K5D A;  1RHP A;  1S4Z A;  1FD7 D;  4HSV A;  1VF7 A;  3FRP B;  1CT1 D;  2WAQ B;  5C3X A;  3HEJ A;  4FYD A;  1O80 A;  5ELD A;  3TBI B;  3PO3 B;  3MHB A;  1H9R A;  4KHZ A;  4K14 A;  2CQA A;  3H09 A;  1U4L A;  4A3B B;  3X3M A;  2ENB A;  3AU7 A;  1F9P A;  5FO8 B;  4DN4 M;  2L55 A;  3VR5 A;  1F9S A;  3TME A;  1FNW A;  4ILW A;  1S5E D;  1JOO A;  2AUJ D;  1PRT C;  1RKN A;  1E2W A;  1DJR D;  2KEC A;  4PQX A;  2VXW A;  2RDG A;  3EQL C;  3BDC A;  2F0K A;  2K33 A;  3HOV B;  3LWU A;  1OXV A;  4EQO A;  1A2U A;  3MC0 B;  1HFG A;  1KLG D;  4C3I G;  2E2I B;  4B9W A;  2F3W A;  2K03 A;  4WJW A;  4FVM A;  3LNN A;  2B8G A;  4IUQ A;  4F8M A;  3I8Z A;  1T5X D;  3NWS A;  4DK0 A;  3I4L A;  3QO2 A;  1D1I A;  1KLU D;  1A6X A;  2JEB I;  1EYC A;  2B2W C;  2A69 D;  2F0P A;  4ZYS A;  1EYA A;  5FO7 B;  5G3L D;  5IGE A;  1PXU A;  3DWP A;  5C3E B;  1JOR A;  1L0X B;  4XYQ A;  2N88 A;  4OGQ C;  4HCS A;  3VR6 A;  3R3O A;  3NTK A;  4KI0 A;  2O5J C;  3SR1 A;  2EYJ A;  3X3N A;  2YYZ A;  1QG7 A;  1TS3 A;  2N55 A;  4ZK9 B;  3A8K E;  3TSS A;  1ENC A;  2EY2 A;  5IT9 L;  2F3V A;  3TDQ A;  1SE2 A;  1OO9 B;  1H9S B;  4CBV A;  1EWC A;  1X32 A;  2H4O A;  4RCO A;  1LTB D;  3KBX A;  1JWU D;  2PO4 A;  1I3Q B;  5C3W A;  2KQ3 A;  4PV1 C;  5ISR A;  3GTM B;  1AEX A;  2RKS A;  2IW3 A;  4IUN A;  4RGT A;  3D4W A;  4QCL A;  4RKL A;  1CTM A;  1PFB A;  3GTG B;  1TY2 A;  1EU3 A;  2HCI A;  1BUV T;  4G7Z C;  1CA5 A;  1ESR A;  5C0X J;  2JEA I;  4QB4 A;  1A3U A;  1U9R A;  1LTT D;  2F0T A;  2QF7 A;  4U68 A;  2BOS A;  1SYB A;  2XRS D;  4DF7 A;  1RJT A;  1QJO A;  4G7O C;  4KN7 C;  4Q5V A;  3K5N A;  1I4X A;  2ZXR A;  4PNY A;  5EPL A;  4S3S A;  1JIC A;  1O7L A;  3D4R A;  4J1M A;  3K7A B;  1TS5 A;  1SAP A;  5KEE A;  1RDP D;  2B2Y A;  3J7A V;  1IHZ A;  1K83 B;  2EYL A;  2PW5 A;  3SXH A;  2E76 C;  1X3P A;  3K0Y A;  3DHQ A;  3OWF A;  4NW2 A;  4OO1 H;  3J80 L;  1K8M A;  5BN3 A;  3I3C A;  1TII D;  1F2L A;  4OHJ A;  1K8O A;  2E2H B;  1VDZ A;  3ONA B;  1IYU A;  4UAI A;  2J0T D;  3K59 A;  1SEB D;  4HAE A;  3PUX A;  4RH6 A;  2K1B A;  4ZUJ A;  1SNP A;  1PTO H;  2RA4 A;  1G29 1;  5D3D A;  2BCO A;  2NWG A;  3EA6 A;  1I4R A;  2NN6 G;  2PCF B;  1CI3 M;  3G7L A;  5CR3 A;  4DNR B;  3PO2 B;  4V19 0;  2EJM A;  1TVX A;  3NK9 A;  2NVX B;  2FMM A;  2JA7 B;  1Y1V B;  3OIP A;  5CC4 A;  3RZO B;  3C1F A;  3TP8 A;  3AMU A;  1SMY D;  5JJZ A;  3MEH A;  3T51 B;  5E4X A;  1W6K A;  5T1G A;  5JEA J;  4HN7 A;  3BVM A;  3RUZ A;  4IFD H;  1SJE D;  2SOB A;  4JK1 C;  4L6T B;  1C8C A;  2K5Q A;  2HUG A;  3I4N B;  2BA0 A;  2CVR A;  1JCK B;  2DY7 A;  4QIW B;  3KF8 A;  4C3H B;  3BYY B;  1A3T A;  1IW7 C;  3K5L A;  2R7Z B;  1EY9 A;  3GTL B;  2EJG C;  4BA1 I;  1HQM C;  2JA5 B;  1AZQ A;  1B3A A;  3RZD B;  2DNE A;  3MXP A;  5KNB A;  1SBB B;  1PMR A;  5CYU A;  3CHB D;  3TZD A;  2Q8R E;  4DA2 A;  4K2K A;  4NKL A;  4LAA A;  1PRT F;  1LT4 D;  1M4V A;  2EXZ A;  4OIJ A;  2XRQ D;  1PTO B;  1GHJ A;  5KRU A;  1AZP A;  1F2Y A;  2M2L A;  5C0X H;  5DM7 3;  4A3K B;  4KK7 A;  2X6G A;  1GUO A;  3GV6 A;  4IUT A;  2KOL A;  1BOS A;  1BR9 A;  1KDB A;  1A2T A;  2RSN A;  3DWQ A;  2VNU D;  2F0G A;  1XYI A;  2KVM A;  1BCP D;  5FK9 C;  1H9M A;  2HCC A;  1ILP A;  3QOL A;  1PFN A;  3BYT B;  3IKJ A;  2B2U A;  4KD3 A;  5A35 A;  1DYQ A;  5CGK A;  2IT1 A;  4RCN A;  3S9W A;  2Q8I B;  2M9V A;  1QE6 A;  5T1I A;  1S5B D;  1OXS C;  3MFG A;  2PNR C;  2HDM A;  5CBA E;  2VB3 X;  3OW7 A;  3CRL C;  1S5C D;  2WP8 J;  4ABN A;  2PW7 A;  1QCB D;  1T5E A;  3FPU B;  4PMW A;  4O1N A;  1V1P B;  1BBX C;  4ZRZ A;  4OIK A;  2KHS A;  1EIH A;  3VR2 A;  2F0M A;  3EJI A;  4DNT B;  3D4D A;  5CBE E;  4YIJ A;  1IYV A;  2AQ3 B;  1BNZ A;  2EDG A;  4BWG B;  1G6Z A;  2A6E C;  2BA1 A;  2R61 A;  4Y7N B;  4NP5 A;  3RMH A;  2AWO A;  4CGY B;  2NVT B;  4A3F B;  2MGS A;  1HTP A;  4OO1 G;  5IGF A;  1BDO A;  1CM9 A;  1JWS D;  5KGU A;  2K5W A;  3VA5 A;  4CJ1 B;  2NZ1 D;  3J80 E;  2A68 C;  3HOX B;  5C4X B;  3OWE B;  1IL8 A;  1VCI A;  2JP1 A;  2XWB B;  3URY A;  4ID6 A;  4EQN A;  1H9S A;  4LK1 C;  1YNJ C;  3GTP B;  3TP7 A;  2B39 A;  2B2T C;  3I4M B;  4MHE A;  2PZW A;  1B4O A;  2F0F A;  1BXT A;  2SNS A;  3VA7 A;  3T16 A;  3U9S A;  2KCN A;  1OXT A;  3PUW A;  1I4Q A;  3OMC A;  2TMP A;  4C2M B;  5BN4 A;  3E6Z X;  3SE0 A;  3L9A X;  1WD0 A;  2SEB D;  2L1B A;  1B1Z A;  1EEI D;  3WDN A;  1V8Q A;  3V96 A;  2R92 B;  2YU9 B;  3OPO A;  3R8B A;  5K36 H;  4C1N I;  1II3 A;  1FYC A;  2LMC B;  1TS2 A;  2A5H A;  5DAU A;  1ENA A;  3A56 A;  5I6Y A;  2QKI C;  2KA7 A;  1CHQ D;  5FKA C;  4IFD G;  1Q12 A;  1NAP A;  3S17 B;  3W2D A;  4BS9 A;  1ZYR D;  1I6V C;  4H44 C;  3DWA A;  2QIL A;  1GJX A;  1HTL D;  3NUC A;  3NBH A;  1ICW A;  3QWN A;  2R6G A;  4CJ2 C;  3GTJ B;  2K32 A;  3BDL A;  3T56 B;  4XQQ A;  4HTH A;  3VR4 A;  4ULL A;  5JPN C;  2KUM A;  3HKZ B;  2BDN A;  1TWF B;  1U4R A;  3JAM L;  5J22 A;  5M9O A;  3GTK B;  5LL6 X;  4X3K A;  1DCZ A;  3H91 A;  1QOH A;  4N9P A;  1W6J A;  1TY0 A;  1EY4 A;  2R93 B;  5EPK A;  3I73 A;  3D6C A;  3PMF A;  3FDT A;  5M5Y B;  1ML0 D;  1QWY A;  2BE5 D;  3K58 A;  4H13 C;  2Z4H A;  3SK4 A;  4O42 A;  5F2D A;  2JSO A;  1S5F D;  1Y8O B;  2F0E A;  4K5X A;  5E1F A;  1WTR A;  4K2L A;  2A69 C;  3KBG A;  1CZW A;  5FOB B;  2I46 A;  1NSN S;  1TT2 A;  3IAY A;  5EBC A;  1Q3L A;  5EKL A;  4X3U A;  1XXG A;  4IN3 A;  1MI2 A;  4NMZ A;  3P1H A;  1PTO D;  1ZXT A;  1AW7 A;  2LKV A;  1UUP A;  5LL6 S;  1DOK A;  4RGM A;  1EQV A;  3NP8 A;  4HMI A;  1ILQ A;  2C9O A;  1BCP F;  1DON A;  4RWS C;  2EPB A;  1NR4 A;  2HDL A;  3HOY B;  1B44 D;  3P7J A;  1V43 A;  1STN A;  2L5T A;  3CU7 A;  3KK7 A;  2CW0 D;  3A8I E;  4C3J B;  1S5D D;  1XX8 A;  1STH A;  4KHV A;  1LO5 D;  4J8Q A;  4KD4 A;  2A74 C;  4UDU C;  4IZ8 A;  4B9X A;  1LLR D;  3KLR A;  2H1E A;  3HZX A;  1SNO A;  3MA2 B;  5EBD A;  2VB2 X;  3VR3 A;  2ID0 A;  4E6I A;  5KND A;  3ITP A;  3R2T A;  1MGS A;  2BDO A;  2I07 B;  3HGB A;  4K5V A;  1G8Z D;  4R9W A;  1DZ1 A;  1Z6H A;  3I72 A;  2FHT A;  3SHL A;  4XIG S;  2K28 A;  3E0J A;  4X3T A;  3NQI A;  3MAQ A;  3MTS A;  3NBI A;  1GUW A;  1STE A;  2MPM A;  1LT6 D;  3NWT A;  1HQR D;  5I2X A;  2F1M A;  1GOZ A;  2Y0S B;  4QUC A;  5HUR A;  2B2W A;  4A3D B;  1E2Z A;  4FXG C;  1IKM A;  2SNM A;  2PPB C;  3S1M B;  4HSP A;  3TP6 A;  5TSS A;  1SXT A;  2J4X A;  5ELF A;  1I50 B;  3M4Y A;  4TQU S;  4F88 A;  1H9K A;  3SDZ A;  2PQE A;  4G57 A;  2EE1 A;  3A7A B;  1H9J A;  3M4O B;  2EYH A;  1B9M A;  1V1P A;  1CFM A;  2WKC A;  3SK8 A;  1WTX A;  2WAC A;  2XIW A;  1J8I A;  5KIX A;  1SMY C;  1PFM A;  4CJ0 B;  2NVY B;  1FNV A;  2X69 A;  1EY5 A;  2L9H A;  3NQT A;  2F0J A;  3H6M A;  2NUC A;  1GHK A;  1GUT A;  4R8N A;  2A6H D;  5I2Y A;  5I9P A;  5J1Z A;  3S1N B;  1Q8I A;  4C3J G;  5A2Q L;  1G2S A;  3DM1 A;  3R93 A;  3Q22 A;  4N9T A;  2EOT A;  1VF5 C;  2FJ2 A;  3QG1 A;  1MD2 D;  5E3F A;  5FLX L;  3JAM E;  1R9T B;  1YNN D;  1G91 A;  3OSO A;  1UEA B;  3LWE A;  1ET6 A;  2IX1 A;  2X6L A;  5HGT A;  5JVH 3;  3MVV A;  1DD2 A;  5C5L A;  5EGT A;  1XWE A;  2J7Z A;  1SSO A;  1HCZ A;  4XTC S;  3VYR A;  5EKI A;  2IL8 A;  3MZ5 A;  1HHV A;  3LX0 A;  1HRJ A;  4LMQ D;  2WII B;  5DEH A;  4K6L A;  2OT2 A;  5I4D A;  1PRT B;  1DM0 B;  1TWA B;  2JA8 B;  4I7Z C;  2KJX A;  4IQZ A;  4F87 A;  4BY7 B;  4JBW A;  1BCP C;  2L12 A;  2NB0 A;  2QEJ C;  3KLS A;  5C6A A;  3O13 A;  2VUM B;  1JB3 A;  4BBR B;  2F03 A;  2WIN B;  2E74 C;  3DEO A;  4ZQ3 A;  1ESF A;  1EQT A;  1JC7 A;  3MXN A;  4KKU A;  1JWM D;  3HP3 A;  5M3F B;  3A54 A;  5G3L F;  3H94 A;  5ELC A;  2HQE A;  4L63 B;  2M00 A;  4R8I A;  4ZUI A;  4K8I A;  1SYF A;  2EYF A;  2F0U A;  5IT9 E;  1NR2 A;  2XN9 C;  3P20 A;  3Q23 A;  4BBS B;  2LY7 A;  5JPM C;  3TP5 A;  3M3Y B;  2E2D C;  3D6W A;  1EY7 A;  1PZJ D;  2O2L D;  1JR0 D;  5CV4 A;  4M1U B;  2Z1C A;  1TU2 B;  5M5W B;  5CMD A;  2ZXO A;  1A15 A;  1TWG B;  2MHV A;  1J9O A;  2K01 A;  1SDF A;  4WFN 3;  1R4P B;  1QIL A;  3VYT A;  4XYO A;  1WVL A;  3GP7 A;  3GD7 A;  3V2T A;  1SFO B;  2EJF C;  2F0I A;  3FPP A;  1X3Q A;  1GXD C;  2D9U A;  5I6W A;  1BF4 A;  1IKL A;  1LTA D;  4C3H G;  3G6J B;  1KAA A;  3HS0 C;  1F2Z A;  4CKC A;  2IWH A;  4J6H A;  5EQ0 A;  1GUN A;  4RA8 A;  1KNE A;  2L4N A;  4KY7 A;  4ME5 A;  2E75 C;  1O78 A;  1RTN A;  1ET9 A;  2FIN B;  3FEW X;  5JEA H;  2ZXP A;  4EVO A;  5D14 A;  4ZKB B;  3Q6S A;  2Z4I A;  5CV9 A;  3BVZ A;  1NCV A;  4C3I B;  3OIQ A;  3T4A C;  1Y1W B;  2XVS A;  3K5M A;  4PMB A;  3S1R B;  3NE5 B;  1JE4 A;  1HUN A;  3SK6 A;  2PYK A;  1E0B A;  4H7B A;  1EZ8 A;  2NBF A;  3I91 A;  3J81 L;  1C4Q A;  2MUY A;  3BS1 A;  3DEP A;  4K8J A;  4KJO A;  4HMJ A;  1F9R A;  4WRD A;  4QMG A;  1EY0 A;  1FNU A;  1SE3 A;  3PIO 3;  4Q0F A;  1EY8 A;  3T13 A;  4ZKC B;  1EL0 A;  4CHT B;  1ZYR C;  2NTS A;  5EJW A;  2D2C C;  3OHX C;  2F0N A;  3NTH A;  4TRD A;  1MBY A;  1M8A A;  1PLF A;  1LV9 A;  1UAP A;  3D8G A;  4KV6 A;  5A2Q E;  1DOM A;  1PZI D;  5J39 A;  2G9H D;  4KY5 A;  5ELB A;  4EGV A;  4I65 A;  2MJ8 A;  5FLX E;  3K6O A;  2WB1 B;  4G7H C;  3DMU A;  5ELE A;  4RGO S;  3ZYY X;  1KTK A;  3ND8 A;  3NXW A;  5IGG A;  5LHY 1;  5CV7 A;  1LTG D;  3CRK C;  4A3G B;  1O7Z A;  1DXM A;  5IIF A;  2RVL A;  3SEB A;  2BE5 C;  4XQJ A;  1GUG A;  3HRZ C;  2V4D A;  1LTS D;  4F7X A;  2MP1 A;  4V0B A;  3DXJ C;  4IUV A;  1B2T A;  1TS4 A;  1RCV D;  3MWY W;  3WOE A;  3J7A F;  4U67 3;  1D6E C;  4A93 B;  1SYC A;  2NN6 I;  4A3J B;  1JOQ A;  3IFT A;  1CK1 A;  2XSC A;  3H0G B;  5K5P A;  1STG A;  5C0X G;  1QNU A;  1SYE A;  3GV3 A;  4KKS A;  2QCP X;  1LTI D;  1HXY D;  1PTO C;  2FFK B;  3L3O C;  2O5I C;  3S2H B;  2WV6 D;  3TZU A;  3L7Z C;  3N6R A;  2Q8T A;  2B2T A;  1ZEQ X;  1Q1E A;  3Q24 A;  4CKE A;  4A3E B;  1TR5 A;  2B2V A;  4B08 A;  4DK1 A;  3OMG A;  3Q0A A;  1PRT D;  4DAV A;  3DUZ A;  1BQQ T;  1EYD A;  5KYI A;  4WOR A;  2EVB A;  2IX0 A;  5IGB A;  1B53 A;  5M5X B;  2C5C A;  1HA5 A;  1Y8P B;  1G2T A;  3IL8 A;  3NPP A;  2B2Y C;  4IUR A;  2CW0 C;  5EKK A;  3PUY A;  4TKO B;  1D5Z C;  1BCP B;  5I9O A;  1TQO A;  1SJH D;  2D62 A;  2F0W A;  1PZK D;  3CQZ B;  4FO2 A;  4IFD J;  1SND A;  2AQ1 B;  4PMC A;  4KN4 C;  1Z7T A;  1BO0 A;  5CV8 A;  3GTQ B;  5D65 A;  3M7N A;  1NUC A;  2QDB A;  1SNM A;  3BZD B;  1CZG A;  1EZ6 A;  1XTC D;  3U9O A;  3A7L A;  2TSS A;  3S15 B;  3GTO B;  1MSG A;  2F0H A;  3HG9 A;  2F0L A;  4K6D A;  4EQP A;  1I6H B;  1EY6 A;  3D3R A;  5EPJ A;  3QIA A;  4Z9C B;  1LAC A;  2OXP A;  3I70 A;  2RSO A;  2F0O A;  3QOJ A;  4IUP A;  2PMZ B;  1L0Y B;  3V05 A;  3EFX D;  2E2J B;  3S2D B;  2SDF A;  1WTO A;  1OXX K;  4QF4 A;  4ZLT F;  1D5M C;  2RDF A;  5JEA G;  1B9N A;  4C1N K;  4KY6 A;  2DY8 A;  1CQV A;  2OF1 A;  4H0L C;  1AFP A;  1F2M A;  4DU9 A;  4HED A;  3NHH A;  3GQB A;  2EY5 A;  5COY A;  2EY6 A;  1WCM B;  5NUC A;  1TWH B;  4M8A A;  3HOW B;  5C44 B;  4OL7 A;  2JA6 B;  5IOD A;  1SYG A;  2AUK A;  2EZV A;  1KDA A;  5FO9 B;  2B8F A;  4DGZ A;  1SNQ A;  1D5X C;  2RDH A;  2PZT A;  4KTA A;  1ONL A;  3J81 E;  5C4J B;  3D31 A;  3PUV A;  4FF2 A;  1I4P A;  2L11 A;  1KAB A;  1JQY D;  2K04 A;  3MFY A;  5D3I B;  2PZU A;  5K36 G;  1O7Y A;  1EEF D;  4C56 C;  1I4H A;  2JXM B;  1AN8 A;  1STB A;  2A6H C;  4AYB B;  4RHR A;  3RD4 A;  3TN2 A;  1WTP A;  1SE4 A;  2KCC A;  4DFA A;  2F0Q A;  1Y8N B;  2G9D A;  1Y69 U;  1RTO A;  3S1Q B;  1RD9 D;  1A3V A;  5IGC A;  2Z8L A;  2F0S A;  4OO1 I;  3S14 B;  1YNN C;  4HR7 B;  1PYW D;  3QJY A;  1C48 A;  4X3S A;  2IPK D;  5IGD A;  5AFW A;  2B2U C;  1QB5 D;  3A8J E;  4P2C B;  3PUZ A;  4DXF A;  5DM6 3;  1ROD A;  1CA6 A;  2IX3 A;  3CKI B;  4MIU A;  1GUS A;  1EU4 A;  2DNC A;  3J7Y W;  3C2P A;  2LFN A;  2NYZ D;  3RLF A;  4GZY C;  2JE6 I;  2F0D A;  3K57 A;  2K7V A;  2O4X A;  3SK5 A;  3BVG A;  2D5D A;  2EY1 A;  4IUU A;  3W3A A;  2KEE A;  4RFB A;  1R4Q B;  3F2U A;  3C1E A;  1UNS A;  2ICE C;  2R3Z A;  1LTR D;  2K6A A;  2RQX A;  1IW7 D;  1LT5 D;  3ERQ A;  4IFD I;  4FNF A;  4XQN A;  1D1K A;  4BA2 I;  1TWC B;  2AQ2 B;  4XT3 B;  1PTO F;  3R2I A;  1WTW A;  1EOT A;  3PV0 A;  3K5O A;  4FP5 D;  5M3M B;  1AP0 A;  3C3L A;  3SVM A;  4BY1 B;  1VMP A;  1U4P A;  1WD1 A;  1FR3 A;  3NTI A;  3BDO A;  5C4Z A;  3FKI B;  1EWH A;  4RHS A;  4XDX A;  1ZKO A;  1LT3 D;  2JYO A;  4RAU C;  1D2B A;  4KKT A;  3H3V C;  4G4K A;  3WOF A;  2KED A;  4FXK C;  1SYD A;  3GO5 A;  2NTT A;  4ZAI A;  3ND9 A;  1RF2 D;  2EYO A;  5C0X I;  5BN5 A;  1PDQ A;  5KNC A;  1OXU A;  1HPC A;  3T53 B;  4RKB A;  1Q90 A;  4FXD A;  2EYP A;  1LAB A;  2F4I A;  4IAL A;  4DXG A;  4CKB A;  5CV6 A;  2GA4 B;  1B50 A;  2K05 A;  4KJN A;  1F77 A;  4HCE A;  1MSH A;  2L0C A;  4A3M B;  2OEO A;  1HUM A;  3EVQ A;  3A55 A;  2FMC A;  2EYM A;  4XT1 B;  3IFD A;  1JOK A;  3NSW A;  4DAP A;  1HA6 A;  1F9Q A;  1VMC A;  4XXE A;  1SNC A;  1Q1B A;  2F0V A;  3HOU B;  5CV5 A;  3QB3 A;  3OOC A;  3I90 A;  4FF3 A;  1U4M A;  3UI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...