3I90A

Crystal structure of human chromobox homolog 6 (cbx6) with h3k27 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
50
structure length
50
Chain Sequence
RVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 6
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 10
structure length 50
sequence length 50
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i90A00
4ZKBB 1G2SA 2K28A 2HCIA 1BO0A 1EOTA 2X6GA 3IL8A 2B2YC 2KUMA 2BDNA 4QUFA 1WTRA 1KNEA 1ILPA 1IKMA 2RSNA 1NR2A 5CBAE 1SAPA 1VMCA 4CJ1B 4HCSA 1X3QA 1O7YA 1JE4A 2EE1A 2MGSA 1AZQA 5E4XA 1ML0D 1WTVA 1MGSA 1XYIA 2NZ1D 1AZPA 1F9PA 1O80A 1ICWA 1WTXA 1PFBA 2L9HA 2KEDA 3GV6A 3MTSA 1NAPA 1O7ZA 3F2UA 4HSVA 3TN2A 3TZDA 1RHPA 1B53A 4IURA 2H1EA 5D65A 1PFNA 1EIHA 2X6LA 1U4MA 1ZXTA 3DEOA 2RA4A 4XDXA 1BF4A 5CBEE 2K05A 2KVMA 2B2TC 3I8ZA 2HCCA 1DZ1A 3GV3A 1WTPA 3H91A 2B2YA 1EIGA 1X32A 1A15A 1DOKA 1F9QA 1HUMA 3KUPA 1VMPA 1HHVA 2HDMA 1SSOA 2X69A 3FDTA 3G7LA 3ONAB 4U68A 5COYA 5T1GA 1GUWA 1HFNA 4DN4M 3QO2A 4RAUC 3I3CA 1SDFA 1ILQA 2HUGA 2L11A 3DEPA 1RODA 2FFKB 5EPJA 1U4RA 2B2VC 1E0BA 1M8AA 2K03A 3DM1A 5CMDA 1MI2A 1WD0A 1B4OA 2B2UC 5CORA 2Q8TA 5EKIA 1DONA 3KBXA 5D14A 1CA5A 1B3AA 1HA6A 2DY7A 4QUCA 1WTOA 1MSHA 4HAEA 2JP1A 3LWEA 4X3SA 5DNFA 2B2TA 2EPBA 2N55A 5E4WC 1RTOA 4ZK9B 3N52A 4CJ0B 3I91A 3P7JA 4ZAIA 1WD1A 1HUNA 5EPKA 2B2WC 1B50A 2EOTA 1S4ZA 4X3TA 1DOLA 1JICA 2FJ2A 5EJWA 4ZLTF 4HEDA 4O42A 5EPLA 2HDLA 3UI2A 1G91A 2CVRA 1KNAA 3Q6SA 2L1BA 3FPUB 2B2VA 2VXWA 2NWGA 1NCVA 1DOMA 2K1BA 4XT3B 4R9WA 2B2UA 4MN3A 4MHEA 3HP3A 1CM9A 2MPMA 4X3KA 2IL8A 4CJ2C 1F2LA 4OIKA 1RJTA 4NW2A 5EQ0A 4ZKCB 4R8IA 3R93A 2FINB 2NYZD 1HFGA 4UAIA 1C8CA 2J7ZA 1NR4A 4IUUA 4IUVA 1WTQA 1HRJA 2D9UA 2FHTA 4LMQD 1EQTA 4IUTA 1G2TA 2B2WA 2XIWA 1QNKA 3IFDA 1Q3LA 1CA6A 2MJ8A 4RWSC 2SDFA 1XX8A 3MWYW 1ESRA 1F9SA 2JYOA 1QG7A 2K04A 2Q8RE 3D6WA 1F9RA 4IUQA 1J9OA 2KEEA 1RTNA 4RA8A 1EL0A 1LV9A 3I90A 2KOLA 1J8IA 2R3ZA 2RSOA 2KECA 1IKLA 1BBXC 1WTWA 2DY8A 2M2LA 1BNZA 1IL8A 2K01A 1AP0A 5JJZA 2MP1A 1G6ZA 1TVXA 1U4LA 5AFWA 1PFMA 1QE6A 2RVLA 2N88A 1WVLA 4X3UA 5T1IA 4IUPA 1U4PA 1PLFA 1X3PA 1MSGA 2L4NA 4OIJA 2L12A 4XT1B 3SVMA 1B2TA 2FMMA 1PDQA
chains in the Genus database with same CATH superfamily
1G2SA 2ENBA 2X6GA 2KUMA 1PTOB 1SNOA 4QUFA 2QEXA 5CV7A 3M9BA 3W5OA 2NVXB 4JW0A 3A55A 1Y8OB 4CJ1B 2JA8G 2F0WA 3M4QA 4A3KB 4FF2A 4XQJA 4JI8L 2L0CA 1HXYD 1WTXA 1D8LA 3CCVA 4JK1C 5M3FH 4QQBX 3HOZH 2OQ0A 1HJPA 2EY5A 2NN6I 3NXWA 4C3IH 1UNSA 1HR0W 3S14B 1HHVA 1YBYA 5COYA 5IWAL 1GUWA 4POGA 4DN4M 2L11A 2NTTA 3MA2B 4L8JA 1E0BA 2F0EA 3SHLA 1Q82C 3PO3B 5EKIA 5D14A 4DR2Q 4Y7NH 1ZEQX 4HAEA 3BDLA 2E76C 5J3BA 4HIDA 4KV6A 3I4OA 1HUNA 4A93G 4RCNA 5EJWA 2LMCB 4KJNA 4UPAA 4A3FH 4O42A 2OQKA 3AFQA 4BBRB 1O7LA 4CDFC 3VYTA 1D6EC 4N8FA 3RR5A 4FF3A 5M3FB 1UWVA 3PIOA 3NHHA 1BR9A 4K2KA 4CJ2C 4X6AH 1YJ9A 1UE6A 4R4QA 1VDZA 4R8IA 3NTKA 3WWVA 3S1QH 4OO1G 2F0OA 3ZYYX 1I6VC 4DR7L 4DR5L 1NR4A 2VS1A 4A76A 1IBLL 2HHHQ 4LMQD 1EFID 4C3IB 3S1NB 2PMZE 3BVMA 1TU2B 2AWOA 4RH6A 1F9RA 3KJPA 4LF7L 4JBMA 3CC2A 4KHVA 2JA8H 1IKLA 1SR3A 1PH4A 1X6OA 1OXTA 1S72A 5CR3A 4HMJA 4DV6Q 1A62A 4JOIA 3M85A 1VQ5A 1HNXQ 3HOWB 5ISRA 3I70A 2L4NA 2I5LX 1SMYC 4YIJA 3DHQA 1IYUA 1EOTA 1H9RA 2WINB 2P5ZX 2CH4W 3EIVA 3KF8B 2ASBA 3V2TA 1SYFA 3V05A 1NR2A 4RGMA 3S15B 5IYCG 3L7ZC 1HQRD 4K5VA 3OWFA 1B3QA 1K8AC 4KI0A 1ML0D 2JSOA 1NBWA 4A3DG 1O78A 3CF5A 5EKLA 3DMUA 2L9HA 3DM3A 3K7UC 4HIKA 4DUYQ 1PVOA 4G7HC 4JI5L 2O2LD 1XPOA 2Q2TA 2K5DA 3ICEA 2MO1A 3NTIA 2OTLA 2Z6KC 1FNUA 2EJFC 2HCCA 2PPBC 1VQIA 3GV3A 4Y52H 2O5IC 2AQ3B 2F0KA 3FKIH 4A93H 3HZXA 3TSSA 4DFAA 2JA8B 2UXBQ 2EYJA 4KY6A 4TKOB 2ZXPA 2ZTCA 1I50H 4H7BA 4ZCKA 1JWMD 3TBIB 1KHIA 1AE3A 1B4OA 3W2DA 1U9RA 2WV6D 4PV1C 1B70B 4KY5A 2E5LQ 3S2HH 1SMYD 2WIIB 4DV5Q 3N52A 4R4CA 3P7JA 1TS4A 1FGUA 1OXUA 3H3VC 2EJGC 2AUKA 4H44C 5C3EG 5M5WB 3GTMH 1GO3E 2I0QA 1FD7D 4NXML 2RQXA 2LSSA 1VQ6A 1JOOA 2JA7G 4RCOA 4CHTB 4XT3B 3JAME 3D4RA 2JEBI 4P2CB 2PO4A 1X3FA 3K0XA 3MZ5A 4IUUA 1SNQA 4IJHA 3WDNA 3S1RH 3FKIB 1LT6D 3X3MA 3MXGA 1N33Q 1W3SA 3CCJA 4JYAL 5IT9L 1Z47A 2QCPX 4LF8L 5FJ8G 2YV5A 4IUQA 1YEZA 5IYCH 4DR1L 2A68C 3K59A 1BBXC 3P20A 5LMUQ 4R4IA 3GQBA 2M2LA 4A3MH 4A3DH 5IYDG 1P16A 5C3XA 1IBKL 1EY6A 4WJ4A 2KCTA 4DAYA 4EX5A 3DWPA 4DV4Q 2B39A 1I94Q 2N49A 3QIAA 1JMCA 4H02A 3LNNA 3AEVA 1IL2A 1ONLA 1TKWB 3A8KE 4IOCA 4XT1B 3SVMA 1FNWA 1EIYB 4KN4C 4TQUS 1STBA 1SE3A 3G4SA 1VQCA 1NMGA 1VQ4A 3UDFA 5CBAE 2KJXA 1Y1WH 4KLKA 5E4XA 1TQOA 1CKNA 2O4XA 4FVMA 3S1MB 5HGQA 3IAYA 2YTYA 1B53A 2F0FA 3CQZB 2EYFA 2F4VL 1ASYA 2UUBQ 2R61A 2R93G 1U4MA 4GLXA 1HNWQ 1PRTC 3S1RB 4IFDJ 2Z1CA 3KLRA 5FLXc 2F0MA 4APVA 3NQIA 2J4XA 1UEBA 3KUPA 5C3EH 3SE0A 1JB7A 2K5WA 2DN8A 1BVSA 1YJNA 3HKZG 4A3MB 5IGFA 4A3DB 4KMUC 1W2BA 1N32Q 4S3SA 1I3QH 2K50A 1Z6HA 2JA7H 4PMWA 1HR0Q 4YY3L 2NUCA 5IOCA 3WOFA 2DY7A 3I4NG 1EOVA 2Z6KA 3F8TA 2ZM6Q 4FXGC 2WP8J 1JC7A 4AH6A 1KIXA 4HR7B 2OTJA 1S4ZA 1KAWA 1JJGA 4G7ZC 4ZLTF 5FJ8H 2XWJB 2EY2A 1Y1WB 1OO9B 3K5LA 2KQ3A 2B8GA 2K5VA 5IYDH 4JC0A 2KHJA 3HOYG 4F87A 3PO2B 4JG2A 1YHQA 1YIJA 3I7FA 2IL8A 4DAYB 1G51A 4NW2A 1LACA 2F3WA 3QG1A 4HJ5A 4HJ8A 4JI4Q 1PRTD 4LF9Q 3A7LA 4L63B 5C5MA 4LF6Q 4NMZA 2A6ED 1PYWD 3NPPA 4P73A 1BQQT 5C3EB 3IFDA 2JE6I 4DUZQ 1EY5A 2MJ8A 4DGZA 1XMQL 4K0KL 4AYBE 1ET9A 1ESRA 2BOSA 3SR1A 5J1ZA 2JEAI 4XYOA 1I3QB 2WB1E 4R1JA 4QF4A 4LF5Q 1YJWA 2MP1A 4K6DA 1GD7A 1U4LA 2E2JH 3GTQB 3PIP3 4PG3A 4JV5L 5T1IA 1V1PA 2R93H 4HJ7A 1A0IA 3TQYA 3T1HQ 4CKCA 4G57A 5LMNL 2F0VA 3AYHB 1N34L 1KQSA 4IPGA 3OIQA 2Y0SE 1UE1A 3H3VH 4F88A 4X62L 2E2IB 4N9TA 4NP5A 1U5KA 2PQAA 1VMCA 2F0UA 4DV3Q 4GOPC 1GOZA 1LUZA 1CQVA 3T1YQ 2CFMA 3KDFA 1JCKB 1PFBA 2KCCA 1JOQA 4A3BH 2RCNA 1NJIC 3I4NH 2JK8A 3QB3A 2RA4A 3I56A 4EGVA 1WOCA 3J81j 1Q7YC 1PH1A 1I6HH 2JA5G 1K0RA 4GN4B 4LFBQ 3EJIA 3HOUB 3I3CA 2DJGC 1Y14B 5EPJA 3J81E 2E2JB 3VR6A 3HOYH 1S5DD 2WAQE 4O2DA 4NXNQ 1C0AA 1IYVA 1GUTA 4CKBA 4OX9L 4QIWE 3FP9A 2VB3X 3EN2A 1KDAA 1B9MA 2BCOA 3QOLA 2N55A 1RTOA 5ELBA 1X54A 3K57A 2FJ2A 4UY8C 2K7VA 4C3HB 2HDLA 3UI2A 5TSSA 3CRLC 1QWYA 2GN5A 1AH9A 2NWGA 1PH9A 4A3BB 1CM9A 3A54A 1N36L 3H09A 4X65L 4DNTB 1JQYD 2IWHA 3S2DH 3C2PA 5GQOA 2UXCL 1M1KC 4IUVA 1VQOA 3RZOH 4KKSA 2G9DA 2F0NA 1YITA 1PZID 2XVSA 5C0XI 3I90A 2KA7A 2Z4HA 2KECA 2MO0A 1WTWA 4UP7A 5KNCA 1EWCA 3HOYB 1AP0A 1MKHA 1TWGB 2NZHA 1BXTA 3FMCA 3NK9A 3T16A 3L2PA 3J7AF 2EYHA 2N3SA 1J5EQ 2VUMB 4DK0A 1KDBA 4I65A 1L0YB 2H5XA 1LTSD 2Z9HA 4A4IA 3EQLC 3D6CA 4A3EG 2L12A 1II3A 4ZKBB 2AQ1B 1CHPD 1OXSC 1SNMA 1K8GA 2GA4B 1SNDA 5JPMC 1XNRL 5ELEA 1XPUA 2ZTDA 2JA5H 2Z0SA 1X3QA 2R7FA 4CDDC 2EQSA 3K5MA 2YU9H 1KXLA 1C4QA 3P1HA 1TS3A 5K36G 1NAPA 5I9OA 3G6JB 2H1EA 3S2DB 1RCVD 1PRTB 3I8ZA 3UE0A 3L0OA 1E3PA 4YHHL 3DWQA 1SE4A 4DR2L 1CZWA 1F9QA 2RCFA 4UP8A 5BN4A 3CD6A 3M7GA 3CCSA 1YNXA 3KJOA 3M4OH 4IOAA 5BR8Q 1HFNA 1G6PA 4GOPA 1BOSA 2CWPA 3PQIA 5HY6A 3S24A 2QDLA 2PZWA 1K83H 2L15A 2K03A 1H9JA 5L37A 4IFDG 3M3YB 3E9HA 3HOVB 2JA6B 3GTJB 1TXYA 1UE5A 3ND9A 4BBSB 1B50A 2JA5B 4X3TA 4C1NI 1UAPA 2HHHL 2BDOA 1KNAA 1NY4A 5IE8A 4IPCA 4DAMA 4I7AA 4JBJA 3OOCA 4X3KA 1XPRA 5EQ0A 3AB9A 2VQFQ 3I4LA 4JI6L 4UAIA 3CC4A 1C8CA 1BCPF 4DV6L 1KLGD 3J80c 2C35B 2O5JC 1E22A 3CCEA 1LTTD 4DA2A 1HNXL 1QG7A 2Q8RE 4IJLA 3NTHA 1W6JA 1N9WA 2KOLA 4DV7Q 4B3TQ 5A35A 2M00A 4A3IB 2QKIC 5I2YA 1HQMC 2Q2HA 2CH4A 4LW1A 2LFNA 2UUAQ 5K36H 4DK6C 4JI7Q 5C4XG 3EA6A 3P75A 2I5MX 5D3DA 5CYUA 2F0IA 4LK1C 3FPPA 4UP9A 2QDBA 4B3MQ 1GHJA 3S17H 2PW5A 1VF7A 5EBCA 5IGCA 1CSPA 3IL8A 2B2YC 1PH6A 1HZ9A 3NELA 4KN7C 4WORA 2PQEA 2C9OA 4FO2A 1JJ2A 4CGYB 3SK8A 4GOPB 4PZ8A 4X64L 3EVQA 1CT1D 3K81C 2R7ZG 4GNXC 2M9VA 1GUGA 5IY0A 1VQHA 2XRQD 4IFDH 3F2UA 1V1OA 5IODA 3CCRA 1JORA 1D1KA 3R3OA 1TS5A 4IURA 4CBVA 1ZXTA 4XDXA 4GKKQ 2Z4IA 1D5ZC 2ZTEA 2KVMA 4LFCQ 4A3GG 3OTOL 3KF6B 5FLXL 1EIGA 1X3GA 3BS1A 4JI3Q 3NUCA 2E5LL 1SSOA 4DKAC 4IN3A 4LF4Q 2R92G 4IPHA 3KFUA 4I7ZC 2FFKB 2QW7A 4A3CG 1XMOQ 3HG9A 4WJWA 3VYSA 1A3TA 1DONA 1TWFB 2Q8IB 2RDFA 2PNHA 3NSWA 4DR3Q 3S17B 3KLWA 3MVVA 4ME3A 3LX0A 1I5FA 4E6IA 2LKVA 4C3JG 1LT4D 1BDOA 1G91A 1CKOA 3FPUB 1N33L 1GHKA 1D2BA 2MPMA 2AQ2B 5LMUL 3VR4A 5C4XH 2FINB 1JR0D 1VQBA 5FLMG 4OL7A 3U4VA 4C56C 1VQMA 3W3AA 3BZDB 2KCNA 1D5XC 4DV4L 5KYLA 3JAMi 1VQDA 3A7AB 3Q24A 4Q5VA 3D6WA 2IY5B 4H13C 4KJOA 1VF5C 2Q2UA 1RIPA 3RZDH 4QCLA 3TS0A 2JXMB 2R7ZH 1A2TA 2BA1A 2NVYH 4L6TB 3S16H 5GAHC 3HOZB 4DV0L 3K6OA 2JN4A 2A69C 2F52A 2NZOA 4U673 2UUBL 2B3GA 1HNWL 5CGKA 3B6YA 2R92H 1JE4A 2JA9A 2CCZA 4R4OA 4A3CH 1G8ZD 3F2BA 3T56B 4CDEC 4YWKA 5C4XB 1O7ZA 1AE2A 1K8OA 1SE2A 3NENA 1PFNA 4Y7NB 1N32L 5EGTA 1BCPC 3X3NA 4OGQC 1M90C 2K05A 1IHZA 1HR0L 1STEA 5BN3A 5JJIA 2IX0A 4BS9A 2B2YA 1Q12A 1VMPA 4DPGA 3L3OC 4A3FB 3ONAB 1LTID 4MIUA 2ZM6L 5M5YH 1BKBA 4KHPQ 1J6QA 3C46A 1SDFA 3HFZB 1PH5A 2Z8LA 2R7ZB 3DM1A 4B3SQ 4GNXA 1WCMG 4EQOA 3CXCA 2UUCL 4FNFA 3S16B 1QUQA 1A8VA 3S1QB 2EY6A 2ATWA 3OYYA 3GDEA 4UDUC 2B29A 4BY7G 5FLMH 1TR5A 4IZ8A 1XNQQ 5JOBA 3OMCA 2YYZA 2A69D 4ZRZA 4LF9L 4EQNA 4EQPA 2R92B 4L5QA 4LF6L 1Y8NB 1G291 2NBFA 3Q6SA 3ITPA 4DUZL 1JJCB 2JQOA 1I4HA 2F4IA 2WB1G 3J80E 4LFAQ 4LF5L 4OO1H 2F0PA 1I4QA 5J39A 3J81c 3I2ZA 1AFPA 3CMEA 1DCZA 3D4WA 1RD9D 4K5WA 3W1GA 2K32A 1CTMA 4KKTA 1IXRA 5E1FA 5CC4A 5M5YB 3T1HL 3GTOH 2KEEA 4HIOA 2Y0SG 1B8AA 1SJHD 4HJ9A 4A3JG 3CRKC 1WVLA 5CV8A 1CQFA 2WFWA 2VZAA 2XWBB 3T1YL 1TWCH 4RG1A 1EUJA 1VQ8A 3J7A5 4KHZA 4PMCA 5GAGC 2MNAA 3AU7A 2DNCA 3CMAA 4A93B 3UE1A 2BDNA 5IGDA 1WTRA 4IPDA 1MJEA 5FOBB 1PA6A 1X9NA 3BVZA 3H0GG 1O7YA 1EQQA 1W6KA 4F8MA 1I50B 1AZQA 4EVOA 3CKIB 4JI1Q 1JWSD 1OXVA 3GV6A 3OMGA 4MNOA 4LFBL 1QUQB 1DXMA 3TZDA 1E7ZA 3S2HB 1M4VA 2WAQG 4OONA 5KIXA 2ID0A 4IALA 4AQYQ 2EY1A 2G9HD 1QILA 4OELB 1EFWA 4MTKA 4ZUJA 1STNA 4O1NA 1PTOF 1L0XB 3GTOB 3GTMB 3GTGH 1H9MA 2XSCA 3ULJA 5T1GA 2UXDQ 1Q8IA 1VQJA 1L0WA 5C3WA 4OXPA 1JWUD 2F0LA 1U4RA 4YCWA 1EU4A 1QZHA 2MFIA 2B2UC 3PIPA 4ME5A 1KDCA 1VQPA 1CA5A 1HA6A 1SYGA 2YTXA 4FF1A 1KAAA 1SN8A 3LWEA 2RHSB 1WD1A 3J81i 4B9XA 2LY7A 2WACA 1VCIA 3QJYA 3I55A 1Q81C 4KKUA 2A68D 3K80C 5LHY1 1V8QA 1EY4A 1L1OC 1TT2A 4DR7Q 2ZXOA 4A3JH 4MN3A 1GUSA 4MHEA 1C48A 2E75C 3HP3A 3V96A 3OW7A 3T13A 3A5ZB 3HKSA 1KC8C 1LO5D 2F1MA 4LF7Q 4K8IA 2MQHA 4K8JA 1DGSA 4C1NK 2D9UA 5FO8B 2CWAA 1ENCA 5DEHA 4ALPA 3T53B 4BXXG 1YZ6A 2OWOA 3GTGB 1AW7A 4RWSC 3MWYW 4K2LA 4BY1G 3CC7A 3MHBA 1XJVA 2F3IA 1LTLA 1RTNA 1YNNC 1EL0A 4PMBA 3H0GH 3VR3A 1XWEA 2K5QA 1HNZL 3TS2A 2D5DA 1SFOH 3RN5A 3OWEB 4RFBA 4V190 2XGTA 4X3UA 5IIFA 2N78A 1HZCA 4KK7A 1EQRA 1KL9A 2VL6A 2D62A 4ODGA 4GN3B 4G7OC 2RKSA 4DXGA 3PUYA 3E0JA 3JAML 4DR4L 2K75A 4HSPA 1CUKA 5IGGA 5ELFA 5F2DA 5E7NA 4JBKA 1PH7A 4HN7A 2JA7B 5KEEA 5C5LA 2K5NA 1MGSA 1AZPA 3ER0A 1CKNB 5JJLA 3ERQA 5BR8L 2HT1A 1SYDA 1EIHA 3DEOA 1Q90A 4FP5D 4NB3A 3K5OA 1IW7C 1EIFA 1PYSB 1E2WA 2A19A 1H9KA 2HIXA 4N8X1 4HCEA 1YNND 2X69A 3MXPA 1Q1EA 1FL0A 4A75A 2UU9Q 1NUCA 4POFA 1Q8KA 4FXDA 4N9PA 1SFOB 3U58A 4ZYSA 3GO5A 1GJXA 1M8AA 2TMPA 1EYAA 2K5HA 4QJFA 1XTDA 3KBXA 2KCMA 5H1SE 1PZKD 1STHA 2IHEA 2A8VA 5M9OA 4ZQ3A 4XQNA 1V43A 5A2QE 3K58A 3VR2A 2HQLA 5DLQE 4A3LG 4BXXH 2BH2A 2VQFL 1Z9FA 4J8QA 4WRDA 4BY1H 3WOEA 3A5UA 3FHWA 1MHWC 2EYMA 4LUOA 1CK1A 2VXWA 2ES2A 1LTGD 2A73B 4R8NA 2B2UA 3VYRA 4JYAQ 2I46A 4DV7L 2AUJD 4KY7A 2R93B 2A74C 3ULLA 2K6AA 4DR1Q 1SROA 3NQTA 4DNIA 2UUAL 1WTQA 1K73C 1YHBA 1PTOC 1Q3LA 4OWXB 3M4PA 1TWAH 2JYOA 4HJAA 1N8RC 1KLUD 1SNCA 2F0SA 1S5FD 3HKZB 1QVCA 4B3ML 1L1OA 1IL8A 2AKWB 3PUWA 1PFMA 3MXNA 1VQKA 3CCUA 4DV1Q 5JJKA 4JPBW 3I4NB 1V1PB 4OIJA 3TREA 2NN6G 1K3BC 1A63A 1NNXA 2GVAA 4BY1B 3CPWA 5HURA 1KABA 3K7AH 1I6HB 1IKMA 4MTNA 3NP8A 2EYLA 1HZAA 5C44G 4PNYA 2PQAB 3HGBA 1WTVA 3RD4A 1IBMQ 1L2FA 2NZ1D 2B8FA 1AN8A 3TP5A 1D1IA 3KDFB 3CCMA 3TP7A 1WTHA 5FK9C 4L5SA 4LF4L 4LWCA 2X6LA 5KNBA 4UHVA 4XXEA 1WI5A 1XMOL 1BF4A 1SNPA 1DZ1A 1DM0B 4XYQA 4A3LH 1TWAB 2EXZA 2EZVA 2VQEQ 4QGUA 4YY3Q 4DR3L 2HDMA 3NBIA 3FDTA 5G3LF 2E2DC 2I5HA 2OF1A 3F1ZA 3CU7A 1EZ8A 1E2ZA 4YCVA 2K14A 3BJUA 1XXGA 4NKLA 2RBMA 4IQZA 1WD0A 1JB3A 3UDIA 3DXJC 3BYTB 4J15A 1SLJA 2PW7A 2KBNA 2ZJPA 3HOWG 3RZOB 2NB0A 4CJ0B 5IT9c 3GTPH 1NTGA 1TIID 3SK4A 2PI2E 1KRSA 2CVRA 3DLLA 3MEHA 1UE7A 5KNDA 5M3MG 4A3KG 2SNMA 4FXKC 1C7YA 3SXHA 5GAEC 1QCBD 4JVZA 2RHQB 1H9SA 1U0LA 1Q46A 1LLRD 2Q2IA 4DF7A 3D3RA 2NN6H 1HTLD 2VNUD 1Y8PB 2FHTA 1EQTA 1F2YA 5I6WA 1XX8A 1PH2A 2ALYB 1LV9A 5C44H 5J22A 2YU9B 2NVTH 1G6ZA 4K14A 1N34Q 2IPKD 3KYHC 3PO3G 2A1AA 1A3VA 3U4ZA 3K0YA 1YVCA 3PUXA 4A3EH 3URYA 3GTPB 4QY7A 1BO0A 1VQ7A 1SXTA 1CI3M 2EYPA 2PZTA 3M4OB 3MEFA 3OPOA 2SEBD 1ZYRC 1CKMA 2IT1A 3MXUA 1K83B 1K9MC 4BBRG 1EQVA 3MC0B 3BG3A 3PMFA 3U9OA 4B3RQ 3GD7A 4L5RC 5M3FG 3TN2A 1RHPA 4B3SL 2AHOB 3UDXA 2D0PA 2FXQA 1X55A 4DUYL 1A15A 1HUMA 1XNQL 1ICFB 4P75A 4LUVA 1BBUA 3BYYB 5C0XJ 2HUGA 4O0AA 1RODA 5M3MH 2B2VC 4A3KH 1MI2A 2KENA 3A8JE 1SE8A 2FMCA 2UXBL 3G71A 4A3EB 1MSHA 5JVG3 5DAUA 4Q0FA 5EBDA 1LTRD 3I73A 1K3RA 4LFAL 2HD3A 2R6GA 2B2WC 1EY7A 3RNUA 3S14H 1N36Q 3LWUA 5GROA 4X65Q 1X3EA 1D7QA 4DV5L 3L9AX 1PZJD 2HIVA 2LS01 3R8BA 1GXDC 4QMGA 1EWHA 4JI2Q 4FYDA 3PO3H 4OIKA 1YI2A 3FRPB 1NMFA 2KHSA 3EFXD 4J6HA 5I4DA 1FJGQ 3QWNA 1LYLA 1PH8A 1TS2A 3PV0A 4IUTA 1UEAB 1ENAA 2DUDA 1CFMA 3T51B 4K6LA 1EEFD 3J80i 3HEJA 3PF5A 3CP0A 1J8IA 2R3ZA 2RSOA 5M3MB 2KHIA 1BNZA 2HQEA 2K01A 4P74A 4BBRH 5JJZA 2YTVA 1K0SA 3OW2A 1PV4A 3FEWX 2N88A 4LAAA 3SGIA 4XIGS 2NTSA 3M4YA 4IUPA 1XNRQ 1VQFA 1PLFA 2CHBD 1SRUA 1B1ZA 2MHVA 5I6YA 1CSQA 1CZGA 4JI1L 4JI0Q 4QL5A 3KF8A 2K28A 2V4DA 5LL6S 3S1NH 1I94L 4GN5A 2K52A 3C1EA 1SAPA 2BH8A 5ELNA 2PMZB 4AQYL 2EE1A 1XYIA 3D0FA 3J7YW 1EY8A 4RGOS 4X66Q 4YHHQ 1JOKA 2E74C 5ELOA 2UXDL 3TZUA 2ZXRA 2I07B 4XTCS 5D65A 1MIUA 5CBEE 1TY2A 4RGTA 1K28A 4DV2Q 2XNAC 4A3GH 3H91A 3FKIG 5HGTA 1D5MC 5G3LD 3HOXG 3KLSA 1UUPA 4U68A 4R4TA 3S15H 2QILA 5I9PA 1ILQA 1FVIA 3C3LA 2CW0C 2EYOA 1RF2D 4GS3A 4JCVE 3Q22A 1X65A 3E0EA 1IYJB 1F2MA 1V1QA 2F0GA 5IT9E 4HTHA 1FYCA 3G48A 1PRTF 1I4PA 4X3SA 1T5EA 4K5XA 3I91A 1A6XA 4GLVB 4C3JH 4JI6Q 1GUOA 3PCOB 3TMEA 3TDQA 3RZDB 2L1BA 2B2VA 1B9NA 4ULLA 5KGUA 2NVYB 4TVAB 1T5XD 2OXPA 1F77A 2DGYA 3SEBA 2DJFC 1ESFA 4IFDI 2IX3A 1VQNA 4A3GB 2ICEC 3SK5A 4B9WA 2B2WA 1LABA 2WKDA 4DR6Q 3K8AA 1CA6A 2RDHA 1DD2A 5M5WH 1TWHH 4JI4L 1KRTA 5CV4A 1STYA 2VY3A 4A3MG 2CW0D 4AYBG 1S40A 1T9HA 2F03A 1IZ6A 3OSOA 1BCPD 4GKJQ 2CKZB 3PSIA 5C4JH 3ND8A 2FMMA 3A74A 5AJ3Q 5CV6A 4X64Q 2HCIA 1BUVT 2D2CC 4YCUA 4C3JB 2NVQH 3HOXH 1HCZA 2F0TA 2F3VA 3A56A 4IUNA 1Y1WG 3KOJA 1AEXA 5JEAG 2ZJRA 3OTOQ 4RHSA 3GTKH 3PIO3 2KEDA 3PO2G 3MAQA 2UU9L 1H95A 4CKEA 3J7ZC 4DV3L 4OHJA 3ERSX 2B2TC 1WYDA 1X32A 2IW3A 3GP7A 1TWHB 4JI8Q 3MFGA 1EYCA 3G7LA 4ABNA 2EDGA 3CCQA 2MUYA 3N6RA 3NWSA 1GUNA 1EWIA 1WCMH 2CQOA 5CORA 3STBC 1KTKA 4GNXB 3S1MH 4NPSA 3CQZH 5C4JB 2XN9C 5CV9A 3EROA 1S5BD 2JP1A 5IWAQ 4BY7H 1EY9A 3R2IA 4ZK9B 4ID6A 5CV5A 4NXNL 2EJMA 2NVQB 3HOXB 3RUZA 5C0XG 4M1UB 3DWAA 1LT3D 5EPLA 3VR5A 1R4QB 2L5TA 1SYBA 1RDPD 1YHAA 3GTLH 3GTKB 3QR8A 4B08A 4DK1A 1S3OA 3D4DA 4ZKCB 1ZKOA 1RJTA 1HFGA 1PMRA 1TWCB 4IO9A 4FDBA 1EU3A 3PUZA 1SYEA 2AMCB 1QNKA 2A6HC 4DV1L 4BA1I 2OCEA 5M5XH 1QVFA 1I4RA 1F9SA 5IP7G 4FF4A 1Q1BA 2IHFA 4DV0Q 2DY8A 3HOUG 5GADC 5JEAH 2V1CC 1EYGA 1WCMB 4DR5Q 1IBLQ 3STBD 1S5CD 2RVLA 3KBGA 3T4AC 3PO2H 1X3PA 2F0HA 4BY7B 2EIFA 1IBML 2A6EC 1J5EL 3CPFA 2BE5C 3J80L 3TP8A 4OWTB 5LMNW 1GVPA 1A3UA 1KNEA 3G6EA 2RSNA 4C3HG 4HCSA 4AYBB 3GTLB 3RMHA 1MJCA 2VQEL 2AWNA 2WB1B 1F9PA 3CW2C 3F2DA 3GTQH 2VB2X 3RLOA 4A3BG 3VA5A 3Q8DA 3O13A 5FO9B 2QGQA 1DJRD 1PFSA 3A0JA 4OO1I 2A6HD 1WTPA 3SDZA 5M5XB 1QOHA 3IRBA 1B7YB 5C0XH 2UUCQ 2E2IH 1E1OA 2Y0SB 4JI5Q 4A3JB 2DNEA 3CAMA 1MD2D 4EQ5A 5IGEA 2VUMG 1ENFA 1E1TA 2H4OA 5ELCA 1B3AA 1VQEA 4WFN3 4KTAA 5DNFA 1BCPB 1NSNS 1STAA 2B2TA 3VA7A 2K4KA 2BE5D 3AFPA 4ZUIA 5I2XA 3VYUA 2EOTA 1ASZA 2B63G 3M7NA 1HPCA 3OIPA 1JICA 4RKLA 5LL6X 1PYBA 5IP7H 1GKHA 3H0GB 3RN2A 1BBWA 2JJQA 3HOUH 1HTPA 3E3XA 1DOMA 5JPNC 4HMIA 2K33A 2IX1A 2WAQB 1Y69U 3H6MA 1OXXK 2J7ZA 4QIWB 5C6AA 2XTIA 4NXMQ 4P72A 1Q86C 1V9PA 5EKKA 1SBBB 3LGJA 4C3HH 1LT5D 1LTAD 2PI2A 3DUZA 4ILWA 4C2MH 3RLFA 4NDXA 4GZYC 3ULPA 3NEMA 1A2UA 4YWLA 4KD4A 1DYQA 1U4PA 1GM5A 4QB4A 4B3TL 2C5CA 5BN5A 2E2HH 1WFQA 4LF8Q 5KRUA 1B2TA 1RL2A 1IW7D 4B3RL 1HH2P 3AMUA 3HOVG 2JA6G 4BBSG 4F7XA 4JI7L 4RHRA 2ZJQA 1ILPA 4M8AA 1IBKQ 1QJOA 1EZ6A 1RKNA 4DAPA 1CHQD 4HIMA 4DAVA 3AQQA 2J0TD 2F0QA 4PZ7A 1SEBD 1TWGH 3CCLA 1O80A 1ICWA 4OEMB 3VDYA 5C4ZA 1S5ED 2VUMH 3TP6A 3MTSA 1PXUA 1ET6A 1YNJC 5DM73 1JE5A 4G4KA 4J1MA 3FVQA 1VQGA 2PZUA 3PF4A 5EAYA 3MFYA 5K5PA 2VW9A 2B63H 3I4MG 2LXJA 3I72A 3KLSX 4GKKL 5FO7B 4LFCL 4C2MB 2F4VQ 4A3IG 1C9OA 2A5HA 4L5TA 4PZ6A 3NBHA 4OWWB 2SNSA 5NUCA 4JI3L 2Q8TA 1TY0A 2G5DA 2E2HB 4AIMA 4JBWA 5ELDA 1Y1VG 1WTOA 2WKCA 3C1FA 1PHJA 4BWGB 5FKAC 3BDOA 4JI2L 1PTOD 3HKZE 2RF4A 1FJGL 3A8IE 5JVH3 4HEDA 4RMFA 4H0LC 2D0OA 2N8NA 1E24A 4LUZA 1QVGA 3QOJA 2R7DA 3JC66 2K1BA 4R9WA 1YNJD 2QF7A 3M3YH 5D3IB 2E8GA 4LJZC 4XQQA 3HOVH 2JA6H 1HNZQ 2B63B 3GTJH 1VQLA 3U9SA 2XIWA 4BBSH 1PH3A 3K7AB 2SDFA 4DU9A 1FNVA 2K04A 3E6ZX 3W1BA 1J9OA 4KD3A 4RA8A 4JI0L 4BA2I 3PGZA 5A2QL 4DK3C 5DM63 3D31A 3H3VI 2EVBA 1QNUA 1L1OB 5AFWA 1QE6A 5FLXE 5IP9G 1SMXA 1VS0A 3MXNB 4DR4Q 1LTBD 1MSGA 1XMQQ 4K0KQ 5C4HA 1O7IA 1VQAA 3NWTA 1EEID 1PDQA 5IYBG 2ZT9C 2PYKA 3E5SA 4X66L 3J81L 3UDGA 4YWMA 1X56A 3I4MH 2EXDA 2XRSD 3BZCA 4JV5Q 3D8GA 3S9WA 2PNRC 1R9TH 2MGSA 4DV2L 4A3IH 2OEOA 4GLAC 3TEHB 3PUVA 3R2TA 3F2CA 5LMNQ 3NBHB 3BZKA 3HS0C 4HSVA 3BDCA 1Y1VH 2Z6BA 3EBEA 5JEAJ 1HZBA 4X62Q 1OTCA 3KF6A 1FGBD 3NE5B 2F0DA 1LM0A 1DOKA 3U50C 3TRZA 1VQ9A 1F2ZA 1QZGA 3QO2A 4P71A 4RAUC 4TRDA 2QEJC 3DEPA 3BU2A 4RKBA 4V0BA 5CMDA 1WJJA 3KK7A 5JAVA 4LNQA 1JT8A 5E3FA 4Z9CB 1EYDA 2OT2A 2QA4A 3H94A 3HRZC 3RLNA 4KHPL 3K5NA 3ZJYC 4QUCA 3HOZG 2RDGA 2EPBA 5E4WC 1XTCD 1MBYA 3Q0AA 1K8MA 3E9IA 3HOWH 4ZAIA 3I4MB 2CQAA 5EPKA 4C3IG 1DOLA 3CHBD 1PTOH 2L55A 1R9TB 2PCFB 5C44B 3H15A 1P8LA 4OX9Q 4DXFA 2NVXH 2NVTB 1Z7TA 4DR6L 1NCVA 4WJ3M 5IP9H 4CDCC 1QB5D 4JOIC 4DNRB 1F2LA 1Y1VB 1B44D 1I4XA 1TWFH 3R93A 2NYZD 2BA0A 1H9SB 3Q23A 4RGNA 1HA5A 5IYBH 1NE3A 1E2VA 3JAMc 3OHXC 1G2TA 1HRJA 5KYIA 1FR3A 1STGA 4MZ9A 1SJED 4A3FG 4GKJL 2LXKA 2SOBA 3J7AV 1KD1C 1ZYRD 5AJ3L 3IFTA 3SK6A 1SYCA 2IJ0A 1TVXA 5IGBA 2UXCQ 3BVGA 1R4PB 2TSSA 2GVBA 1I4GA 4PQXA 3IKJA 1EY0A 2F0JA 4TSSA 2ICIA
chains in the Genus database with same CATH topology
1G2SA 2ENBA 2X6GA 2KUMA 1PTOB 1SNOA 4QUFA 5CV7A 2NVXB 3A55A 1Y8OB 4CJ1B 2F0WA 4A3KB 4FF2A 4XQJA 2L0CA 1HXYD 1WTXA 4JK1C 2EY5A 2NN6I 3NXWA 1HHVA 1UNSA 3S14B 5COYA 1GUWA 4DN4M 2L11A 2NTTA 3MA2B 4L8JA 1E0BA 2F0EA 3SHLA 3PO3B 5EKIA 5D14A 1ZEQX 4HAEA 3BDLA 2E76C 4KV6A 1HUNA 4RCNA 5EJWA 2LMCB 4KJNA 4O42A 4BBRB 1O7LA 3VYTA 1D6EC 4FF3A 5M3FB 3NHHA 1BR9A 4K2KA 4CJ2C 4OO1G 1VDZA 4R8IA 3NTKA 2F0OA 3ZYYX 1I6VC 1NR4A 4LMQD 1EFID 4C3IB 3S1NB 3BVMA 1TU2B 2AWOA 4RH6A 1F9RA 4KHVA 1IKLA 1OXTA 5CR3A 4HMJA 3M85A 3HOWB 5ISRA 3I70A 2L4NA 4YIJA 1SMYC 3DHQA 1IYUA 1EOTA 1H9RA 2WINB 3V2TA 1SYFA 3V05A 1NR2A 4RGMA 3S15B 3L7ZC 1HQRD 4K5VA 3OWFA 4KI0A 1ML0D 2JSOA 1O78A 5EKLA 3DMUA 2L9HA 4G7HC 2O2LD 2K5DA 3NTIA 1FNUA 2EJFC 2HCCA 2PPBC 3GV3A 2O5IC 2AQ3B 2F0KA 3HZXA 3TSSA 4DFAA 2JA8B 2EYJA 4KY6A 4TKOB 2ZXPA 4H7BA 1JWMD 3TBIB 3W2DA 1B4OA 1U9RA 2WV6D 4PV1C 4KY5A 1SMYD 2WIIB 3N52A 3P7JA 1TS4A 1OXUA 3H3VC 2EJGC 2AUKA 4H44C 5M5WB 1FD7D 2RQXA 1JOOA 4RCOA 4CHTB 4XT3B 3JAME 3D4RA 2JEBI 4P2CB 2PO4A 3MZ5A 4IUUA 1SNQA 3WDNA 3FKIB 1LT6D 3X3MA 3MXGA 5IT9L 1Z47A 2QCPX 4IUQA 2A68C 3K59A 1BBXC 3P20A 3GQBA 2M2LA 5C3XA 1EY6A 4DAYA 3DWPA 2B39A 3QIAA 3LNNA 1ONLA 1TKWB 3A8KE 4XT1B 3SVMA 1FNWA 4KN4C 4TQUS 1STBA 1SE3A 5CBAE 2KJXA 5E4XA 1TQOA 2O4XA 4FVMA 3S1MB 3IAYA 1B53A 2F0FA 3CQZB 2EYFA 2R61A 1U4MA 1PRTC 3S1RB 4IFDJ 2Z1CA 3KLRA 2F0MA 3NQIA 2J4XA 3KUPA 3SE0A 2K5WA 2DN8A 4A3MB 5IGFA 4A3DB 4KMUC 4S3SA 1Z6HA 4PMWA 2NUCA 5IOCA 3WOFA 2DY7A 4FXGC 2WP8J 1JC7A 4HR7B 1S4ZA 4G7ZC 4ZLTF 2XWJB 2EY2A 1Y1WB 1OO9B 3K5LA 2KQ3A 2B8GA 4F87A 3PO2B 2IL8A 4NW2A 1LACA 2F3WA 3QG1A 1PRTD 3A7LA 4L63B 5C5MA 4NMZA 2A6ED 1PYWD 3NPPA 1BQQT 5C3EB 3IFDA 2JE6I 1EY5A 2MJ8A 4DGZA 1ET9A 1ESRA 2BOSA 3SR1A 5J1ZA 2JEAI 4XYOA 1I3QB 4QF4A 2MP1A 4K6DA 1U4LA 3GTQB 3PIP3 5T1IA 1V1PA 4CKCA 4G57A 2F0VA 3OIQA 4F88A 2E2IB 4N9TA 4NP5A 1VMCA 2F0UA 1GOZA 1CQVA 1JCKB 1PFBA 2KCCA 1JOQA 3QB3A 2RA4A 4EGVA 3EJIA 3HOUB 3I3CA 5EPJA 3J81E 2E2JB 3VR6A 1S5DD 1IYVA 1GUTA 4CKBA 2VB3X 1KDAA 1B9MA 2BCOA 3QOLA 2N55A 1RTOA 5ELBA 3K57A 2FJ2A 2K7VA 4C3HB 2HDLA 3UI2A 5TSSA 3CRLC 1QWYA 2NWGA 4A3BB 1CM9A 3A54A 3H09A 4DNTB 1JQYD 2IWHA 3C2PA 4IUVA 4KKSA 2G9DA 2F0NA 1PZID 2XVSA 5C0XI 3I90A 2KA7A 2Z4HA 2KECA 1WTWA 5KNCA 3HOYB 1EWCA 1AP0A 1TWGB 3FMCA 1BXTA 3NK9A 3T16A 3J7AF 2EYHA 2VUMB 4DK0A 1KDBA 4I65A 1L0YB 1LTSD 3EQLC 3D6CA 2L12A 1II3A 4ZKBB 2AQ1B 1CHPD 1OXSC 1SNMA 2GA4B 1SNDA 5JPMC 5ELEA 1X3QA 3K5MA 1C4QA 3P1HA 1TS3A 5K36G 1NAPA 5I9OA 3G6JB 2H1EA 3S2DB 1RCVD 1PRTB 3I8ZA 3DWQA 1SE4A 1CZWA 1F9QA 5BN4A 3M7GA 1HFNA 1BOSA 2PZWA 2K03A 1H9JA 4IFDG 3M3YB 3HOVB 2JA6B 3GTJB 4BBSB 3ND9A 1B50A 2JA5B 4X3TA 4C1NI 1UAPA 2BDOA 1KNAA 3OOCA 4X3KA 5EQ0A 3AB9A 3I4LA 4UAIA 1C8CA 1BCPF 1KLGD 2O5JC 1LTTD 4DA2A 1QG7A 2Q8RE 3NTHA 1W6JA 2KOLA 5A35A 2M00A 4A3IB 2QKIC 5I2YA 1HQMC 2LFNA 5K36H 3EA6A 3P75A 5D3DA 5CYUA 2F0IA 4LK1C 3FPPA 2QDBA 1GHJA 2PW5A 1VF7A 5EBCA 5IGCA 3IL8A 2B2YC 4KN7C 4WORA 2PQEA 2C9OA 4FO2A 4CGYB 3SK8A 3EVQA 1CT1D 2M9VA 1GUGA 2XRQD 4IFDH 3F2UA 1V1OA 5IODA 1JORA 1D1KA 3R3OA 1TS5A 4IURA 4CBVA 1ZXTA 4XDXA 2Z4IA 1D5ZC 2KVMA 5FLXL 1EIGA 3BS1A 3NUCA 1SSOA 4IN3A 4I7ZC 2FFKB 3HG9A 4WJWA 3VYSA 1A3TA 1DONA 1TWFB 2Q8IB 2RDFA 3NSWA 3S17B 3MVVA 3LX0A 4E6IA 2LKVA 4C3JG 1LT4D 1BDOA 1G91A 3FPUB 1GHKA 1D2BA 2MPMA 2AQ2B 3VR4A 2FINB 1JR0D 4OL7A 4C56C 3W3AA 3BZDB 2KCNA 1D5XC 5KYLA 3A7AB 3Q24A 4Q5VA 3D6WA 4H13C 4KJOA 1VF5C 4QCLA 2JXMB 1A2TA 2BA1A 4L6TB 3HOZB 3K6OA 2A69C 4U673 5CGKA 1JE4A 1G8ZD 3T56B 5C4XB 1O7ZA 1K8OA 1SE2A 4Y7NB 1PFNA 5EGTA 1BCPC 3X3NA 4OGQC 2K05A 1IHZA 1STEA 5BN3A 2IX0A 4BS9A 2B2YA 1Q12A 1VMPA 4A3FB 3L3OC 3ONAB 1LTID 4MIUA 3C46A 1SDFA 2R7ZB 2Z8LA 3DM1A 4EQOA 4FNFA 3S16B 3S1QB 2EY6A 4UDUC 1TR5A 4IZ8A 5JOBA 3OMCA 2YYZA 2A69D 4ZRZA 4EQNA 4EQPA 2R92B 1Y8NB 1G291 2NBFA 3Q6SA 3ITPA 1I4HA 2F4IA 3J80E 4OO1H 2F0PA 1I4QA 5J39A 1AFPA 1DCZA 3D4WA 1RD9D 4K5WA 2K32A 1CTMA 4KKTA 5E1FA 5CC4A 5M5YB 2KEEA 1SJHD 3CRKC 1WVLA 5CV8A 1CQFA 2XWBB 4KHZA 4PMCA 3AU7A 2DNCA 4A93B 2BDNA 5IGDA 1WTRA 5FOBB 3BVZA 1O7YA 1W6KA 4F8MA 1I50B 1AZQA 4EVOA 3CKIB 1JWSD 1OXVA 3GV6A 3OMGA 1DXMA 3TZDA 3S2HB 1M4VA 5KIXA 2ID0A 4IALA 2EY1A 2G9HD 1QILA 4ZUJA 1STNA 4O1NA 1PTOF 1L0XB 3GTOB 3GTMB 1H9MA 2XSCA 5T1GA 1Q8IA 5C3WA 1JWUD 2F0LA 1U4RA 1EU4A 2B2UC 4ME5A 1KDCA 1CA5A 1HA6A 1SYGA 4FF1A 1KAAA 3LWEA 1WD1A 4B9XA 2LY7A 2WACA 1VCIA 3QJYA 4KKUA 2A68D 5LHY1 1V8QA 1EY4A 1TT2A 2ZXOA 4MN3A 1GUSA 4MHEA 1C48A 2E75C 3HP3A 3V96A 3OW7A 3T13A 1LO5D 2F1MA 4K8IA 4K8JA 4C1NK 5FO8B 2D9UA 1ENCA 5DEHA 3T53B 3GTGB 1AW7A 4RWSC 3MWYW 4K2LA 3MHBA 1RTNA 1YNNC 1EL0A 4PMBA 3VR3A 1XWEA 2K5QA 2D5DA 3OWEB 4RFBA 4V190 4X3UA 5IIFA 4KK7A 2D62A 4ODGA 4G7OC 2RKSA 4DXGA 3PUYA 3E0JA 3JAML 4HSPA 5IGGA 5ELFA 5F2DA 4HN7A 2JA7B 5KEEA 5C5LA 1MGSA 1AZPA 3ERQA 1SYDA 1EIHA 3DEOA 1Q90A 4FP5D 3K5OA 1IW7C 1E2WA 1H9KA 4HCEA 1YNND 2X69A 3MXPA 1Q1EA 1NUCA 4FXDA 4N9PA 1SFOB 4ZYSA 3GO5A 1GJXA 1M8AA 2TMPA 1EYAA 3KBXA 1PZKD 1STHA 5M9OA 4ZQ3A 4XQNA 1V43A 5A2QE 3K58A 3VR2A 4J8QA 4WRDA 3WOEA 2EYMA 1CK1A 2VXWA 1LTGD 2A73B 4R8NA 2B2UA 3VYRA 2I46A 2AUJD 4KY7A 2R93B 2A74C 2K6AA 3NQTA 1WTQA 1PTOC 1Q3LA 2JYOA 1KLUD 1SNCA 2F0SA 1S5FD 3HKZB 1IL8A 3PUWA 1PFMA 3MXNA 3I4NB 1V1PB 4OIJA 2NN6G 4BY1B 5HURA 1KABA 1I6HB 1IKMA 3NP8A 2EYLA 4PNYA 3HGBA 1WTVA 3RD4A 2NZ1D 2B8FA 1AN8A 3TP5A 1D1IA 3TP7A 5FK9C 2X6LA 5KNBA 4XXEA 1BF4A 1SNPA 1DZ1A 1DM0B 4XYQA 1TWAB 2EXZA 2EZVA 2HDMA 3NBIA 3FDTA 5G3LF 2E2DC 2OF1A 3CU7A 1EZ8A 1E2ZA 1XXGA 4NKLA 2RBMA 4IQZA 1WD0A 1JB3A 3DXJC 3BYTB 2PW7A 3RZOB 2NB0A 4CJ0B 1TIID 3SK4A 2CVRA 3MEHA 5KNDA 2SNMA 4FXKC 3SXHA 1QCBD 1H9SA 1LLRD 4DF7A 3D3RA 2NN6H 1HTLD 2VNUD 1Y8PB 2FHTA 1EQTA 1F2YA 5I6WA 1XX8A 1LV9A 5J22A 2YU9B 1G6ZA 4K14A 2IPKD 1A3VA 3K0YA 3PUXA 3URYA 3GTPB 1BO0A 1SXTA 1CI3M 2EYPA 2PZTA 3M4OB 3OPOA 2SEBD 1ZYRC 2IT1A 3MXUA 1K83B 1EQVA 3MC0B 3BG3A 3PMFA 3U9OA 3GD7A 3TN2A 1RHPA 1A15A 1HUMA 3BYYB 5C0XJ 2HUGA 1RODA 2B2VC 1MI2A 3A8JE 2FMCA 4A3EB 1MSHA 5JVG3 5DAUA 4Q0FA 5EBDA 1LTRD 3I73A 2R6GA 2B2WC 1EY7A 3LWUA 3L9AX 1PZJD 2LS01 3R8BA 1GXDC 4QMGA 1EWHA 4FYDA 4OIKA 3FRPB 4J6HA 2KHSA 3EFXD 5I4DA 3QWNA 1TS2A 3PV0A 4IUTA 1UEAB 1ENAA 1CFMA 3T51B 4K6LA 1EEFD 3HEJA 1J8IA 2R3ZA 2RSOA 5M3MB 1BNZA 2HQEA 2K01A 5JJZA 3FEWX 2N88A 4LAAA 4XIGS 2NTSA 3M4YA 4IUPA 2CHBD 1PLFA 1B1ZA 2MHVA 5I6YA 1CZGA 3KF8A 2K28A 2V4DA 5LL6S 3C1EA 1SAPA 2PMZB 2EE1A 1XYIA 3J7YW 1EY8A 4RGOS 1JOKA 2E74C 3TZUA 2ZXRA 2I07B 4XTCS 5D65A 5CBEE 1TY2A 4RGTA 2XNAC 3H91A 5HGTA 1D5MC 5G3LD 3KLSA 1UUPA 4U68A 2QILA 5I9PA 1ILQA 3C3LA 2CW0C 2EYOA 1RF2D 3Q22A 5IT9E 1F2MA 2F0GA 4HTHA 1FYCA 1PRTF 1I4PA 4X3SA 1T5EA 4K5XA 3I91A 1A6XA 1GUOA 3TMEA 3TDQA 3RZDB 2L1BA 2B2VA 1B9NA 4ULLA 5KGUA 2NVYB 1T5XD 2OXPA 1F77A 3SEBA 1ESFA 4IFDI 2IX3A 4A3GB 2ICEC 3SK5A 4B9WA 2B2WA 1LABA 2WKDA 1CA6A 2RDHA 1DD2A 5CV4A 1STYA 2CW0D 2F03A 3OSOA 1BCPD 3ND8A 2FMMA 5CV6A 2HCIA 1BUVT 2D2CC 4C3JB 1HCZA 2F0TA 2F3VA 3A56A 4IUNA 1AEXA 5JEAG 4RHSA 3PIO3 2KEDA 3MAQA 4CKEA 4OHJA 2B2TC 1X32A 2IW3A 3GP7A 1TWHB 3MFGA 1EYCA 3G7LA 4ABNA 2EDGA 2MUYA 3N6RA 3NWSA 1GUNA 5CORA 1KTKA 5C4JB 2XN9C 5CV9A 3EROA 1S5BD 2JP1A 1EY9A 3R2IA 4ZK9B 4ID6A 5CV5A 2EJMA 2NVQB 3HOXB 3RUZA 5C0XG 4M1UB 3DWAA 1LT3D 5EPLA 3VR5A 1R4QB 2L5TA 1SYBA 1RDPD 3GTKB 4B08A 4DK1A 3D4DA 4ZKCB 1ZKOA 1RJTA 1HFGA 1PMRA 1TWCB 1EU3A 3PUZA 1SYEA 1QNKA 2A6HC 4BA1I 1I4RA 1F9SA 4FF4A 1Q1BA 2DY8A 5JEAH 1WCMB 1S5CD 2RVLA 3KBGA 3T4AC 1X3PA 2F0HA 4BY7B 2A6EC 2BE5C 3J80L 3TP8A 1A3UA 1KNEA 2RSNA 4C3HG 4HCSA 4AYBB 3GTLB 3RMHA 2AWNA 2WB1B 1F9PA 2VB2X 3VA5A 5FO9B 3O13A 1DJRD 4OO1I 2A6HD 1WTPA 3SDZA 5M5XB 1QOHA 5C0XH 2Y0SB 4A3JB 2DNEA 1MD2D 5IGEA 1ENFA 2H4OA 5ELCA 1B3AA 4WFN3 4KTAA 5DNFA 1BCPB 1NSNS 1STAA 2B2TA 3VA7A 2BE5D 4ZUIA 5I2XA 3VYUA 2EOTA 3M7NA 1HPCA 3OIPA 1JICA 4RKLA 5LL6X 3H0GB 1HTPA 1DOMA 5JPNC 4HMIA 2K33A 2IX1A 2WAQB 1Y69U 3H6MA 1OXXK 2J7ZA 4QIWB 5C6AA 5EKKA 1SBBB 1LT5D 1LTAD 3DUZA 4ILWA 3RLFA 4NDXA 4GZYC 1A2UA 4KD4A 1DYQA 1U4PA 4QB4A 2C5CA 5BN5A 5KRUA 1B2TA 1IW7D 3AMUA 4F7XA 4RHRA 1ILPA 4M8AA 1QJOA 1EZ6A 1RKNA 4DAPA 1CHQD 4DAVA 2J0TD 2F0QA 1SEBD 1O80A 1ICWA 5C4ZA 1S5ED 3TP6A 3MTSA 1PXUA 1ET6A 1YNJC 5DM73 4G4KA 4J1MA 3FVQA 2PZUA 3MFYA 5K5PA 3I72A 3KLSX 5FO7B 4C2MB 2A5HA 3NBHA 2SNSA 5NUCA 2Q8TA 1TY0A 2E2HB 4JBWA 5ELDA 1WTOA 2WKCA 3C1FA 4BWGB 5FKAC 3BDOA 1PTOD 3A8IE 5JVH3 4HEDA 4H0LC 3QOJA 2K1BA 4R9WA 1YNJD 2QF7A 5D3IB 4LJZC 4XQQA 2B63B 3U9SA 2XIWA 3K7AB 2SDFA 4DU9A 1FNVA 2K04A 3E6ZX 1J9OA 4KD3A 4RA8A 4BA2I 5A2QL 5DM63 3D31A 2EVBA 1QNUA 5AFWA 1QE6A 5FLXE 1LTBD 1MSGA 5C4HA 3NWTA 1EEID 1PDQA 2ZT9C 2PYKA 3E5SA 3J81L 2XRSD 3D8GA 3S9WA 2PNRC 2MGSA 2OEOA 3PUVA 3R2TA 3HS0C 4HSVA 3BDCA 5JEAJ 1FGBD 3NE5B 2F0DA 1DOKA 1F2ZA 3QO2A 4RAUC 4TRDA 2QEJC 3DEPA 4RKBA 5JAVA 4V0BA 5CMDA 3KK7A 5E3FA 4Z9CB 1EYDA 2OT2A 3H94A 3HRZC 3K5NA 4QUCA 2RDGA 2EPBA 5E4WC 1XTCD 1MBYA 3Q0AA 1K8MA 3I4MB 4ZAIA 2CQAA 5EPKA 4C3IG 1DOLA 3CHBD 1PTOH 2L55A 1R9TB 2PCFB 5C44B 4DXFA 2NVTB 1Z7TA 1NCVA 1QB5D 4DNRB 1F2LA 1Y1VB 1B44D 1I4XA 3R93A 2NYZD 2BA0A 1H9SB 3Q23A 4RGNA 1HA5A 1E2VA 3OHXC 1G2TA 1HRJA 5KYIA 1FR3A 1STGA 1SJED 2SOBA 3J7AV 1ZYRD 3IFTA 3SK6A 1SYCA 2IJ0A 1TVXA 5IGBA 3BVGA 1R4PB 2TSSA 1I4GA 4PQXA 3IKJA 1EY0A 2F0JA 4TSSA 2ICIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKB B;  1G2S A;  2K28 A;  2HCI A;  1BO0 A;  1EOT A;  2X6G A;  3IL8 A;  2B2Y C;  2KUM A;  2BDN A;  4QUF A;  1WTR A;  1KNE A;  1ILP A;  1IKM A;  2RSN A;  1NR2 A;  5CBA E;  1SAP A;  1VMC A;  4CJ1 B;  4HCS A;  1X3Q A;  1O7Y A;  1JE4 A;  2EE1 A;  2MGS A;  1AZQ A;  5E4X A;  1ML0 D;  1WTV A;  1MGS A;  1XYI A;  2NZ1 D;  1AZP A;  1F9P A;  1O80 A;  1ICW A;  1WTX A;  1PFB A;  2L9H A;  2KED A;  3GV6 A;  3MTS A;  1NAP A;  1O7Z A;  3F2U A;  4HSV A;  3TN2 A;  3TZD A;  1RHP A;  1B53 A;  4IUR A;  2H1E A;  5D65 A;  1PFN A;  1EIH A;  2X6L A;  1U4M A;  1ZXT A;  3DEO A;  2RA4 A;  4XDX A;  1BF4 A;  5CBE E;  2K05 A;  2KVM A;  2B2T C;  3I8Z A;  2HCC A;  1DZ1 A;  3GV3 A;  1WTP A;  3H91 A;  2B2Y A;  1EIG A;  1X32 A;  1A15 A;  1DOK A;  1F9Q A;  1HUM A;  3KUP A;  1VMP A;  1HHV A;  2HDM A;  1SSO A;  2X69 A;  3FDT A;  3G7L A;  3ONA B;  4U68 A;  5COY A;  5T1G A;  1GUW A;  1HFN A;  4DN4 M;  3QO2 A;  4RAU C;  3I3C A;  1SDF A;  1ILQ A;  2HUG A;  2L11 A;  3DEP A;  1ROD A;  2FFK B;  5EPJ A;  1U4R A;  2B2V C;  1E0B A;  1M8A A;  2K03 A;  3DM1 A;  5CMD A;  1MI2 A;  1WD0 A;  1B4O A;  2B2U C;  5COR A;  2Q8T A;  5EKI A;  1DON A;  3KBX A;  5D14 A;  1CA5 A;  1B3A A;  1HA6 A;  2DY7 A;  4QUC A;  1WTO A;  1MSH A;  4HAE A;  2JP1 A;  3LWE A;  4X3S A;  5DNF A;  2B2T A;  2EPB A;  2N55 A;  5E4W C;  1RTO A;  4ZK9 B;  3N52 A;  4CJ0 B;  3I91 A;  3P7J A;  4ZAI A;  1WD1 A;  1HUN A;  5EPK A;  2B2W C;  1B50 A;  2EOT A;  1S4Z A;  4X3T A;  1DOL A;  1JIC A;  2FJ2 A;  5EJW A;  4ZLT F;  4HED A;  4O42 A;  5EPL A;  2HDL A;  3UI2 A;  1G91 A;  2CVR A;  1KNA A;  3Q6S A;  2L1B A;  3FPU B;  2B2V A;  2VXW A;  2NWG A;  1NCV A;  1DOM A;  2K1B A;  4XT3 B;  4R9W A;  2B2U A;  4MN3 A;  4MHE A;  3HP3 A;  1CM9 A;  2MPM A;  4X3K A;  2IL8 A;  4CJ2 C;  1F2L A;  4OIK A;  1RJT A;  4NW2 A;  5EQ0 A;  4ZKC B;  4R8I A;  3R93 A;  2FIN B;  2NYZ D;  1HFG A;  4UAI A;  1C8C A;  2J7Z A;  1NR4 A;  4IUU A;  4IUV A;  1WTQ A;  1HRJ A;  2D9U A;  2FHT A;  4LMQ D;  1EQT A;  4IUT A;  1G2T A;  2B2W A;  2XIW A;  1QNK A;  3IFD A;  1Q3L A;  1CA6 A;  2MJ8 A;  4RWS C;  2SDF A;  1XX8 A;  3MWY W;  1ESR A;  1F9S A;  2JYO A;  1QG7 A;  2K04 A;  2Q8R E;  3D6W A;  1F9R A;  4IUQ A;  1J9O A;  2KEE A;  1RTN A;  4RA8 A;  1EL0 A;  1LV9 A;  3I90 A;  2KOL A;  1J8I A;  2R3Z A;  2RSO A;  2KEC A;  1IKL A;  1BBX C;  1WTW A;  2DY8 A;  2M2L A;  1BNZ A;  1IL8 A;  2K01 A;  1AP0 A;  5JJZ A;  2MP1 A;  1G6Z A;  1TVX A;  1U4L A;  5AFW A;  1PFM A;  1QE6 A;  2RVL A;  2N88 A;  1WVL A;  4X3U A;  5T1I A;  4IUP A;  1U4P A;  1PLF A;  1X3P A;  1MSG A;  2L4N A;  4OIJ A;  2L12 A;  4XT1 B;  3SVM A;  1B2T A;  2FMM A;  1PDQ A; 
#chains in the Genus database with same CATH topology
 1G2S A;  2ENB A;  2X6G A;  2KUM A;  1PTO B;  1SNO A;  4QUF A;  2QEX A;  5CV7 A;  3M9B A;  3W5O A;  2NVX B;  4JW0 A;  3A55 A;  1Y8O B;  4CJ1 B;  2JA8 G;  2F0W A;  3M4Q A;  4A3K B;  4FF2 A;  4XQJ A;  4JI8 L;  2L0C A;  1HXY D;  1WTX A;  1D8L A;  3CCV A;  4JK1 C;  5M3F H;  4QQB X;  3HOZ H;  2OQ0 A;  1HJP A;  2EY5 A;  2NN6 I;  3NXW A;  4C3I H;  1UNS A;  1HR0 W;  3S14 B;  1HHV A;  1YBY A;  5COY A;  5IWA L;  1GUW A;  4POG A;  4DN4 M;  2L11 A;  2NTT A;  3MA2 B;  4L8J A;  1E0B A;  2F0E A;  3SHL A;  1Q82 C;  3PO3 B;  5EKI A;  5D14 A;  4DR2 Q;  4Y7N H;  1ZEQ X;  4HAE A;  3BDL A;  2E76 C;  5J3B A;  4HID A;  4KV6 A;  3I4O A;  1HUN A;  4A93 G;  4RCN A;  5EJW A;  2LMC B;  4KJN A;  4UPA A;  4A3F H;  4O42 A;  2OQK A;  3AFQ A;  4BBR B;  1O7L A;  4CDF C;  3VYT A;  1D6E C;  4N8F A;  3RR5 A;  4FF3 A;  5M3F B;  1UWV A;  3PIO A;  3NHH A;  1BR9 A;  4K2K A;  4CJ2 C;  4X6A H;  1YJ9 A;  1UE6 A;  4R4Q A;  1VDZ A;  4R8I A;  3NTK A;  3WWV A;  3S1Q H;  4OO1 G;  2F0O A;  3ZYY X;  1I6V C;  4DR7 L;  4DR5 L;  1NR4 A;  2VS1 A;  4A76 A;  1IBL L;  2HHH Q;  4LMQ D;  1EFI D;  4C3I B;  3S1N B;  2PMZ E;  3BVM A;  1TU2 B;  2AWO A;  4RH6 A;  1F9R A;  3KJP A;  4LF7 L;  4JBM A;  3CC2 A;  4KHV A;  2JA8 H;  1IKL A;  1SR3 A;  1PH4 A;  1X6O A;  1OXT A;  1S72 A;  5CR3 A;  4HMJ A;  4DV6 Q;  1A62 A;  4JOI A;  3M85 A;  1VQ5 A;  1HNX Q;  3HOW B;  5ISR A;  3I70 A;  2L4N A;  2I5L X;  1SMY C;  4YIJ A;  3DHQ A;  1IYU A;  1EOT A;  1H9R A;  2WIN B;  2P5Z X;  2CH4 W;  3EIV A;  3KF8 B;  2ASB A;  3V2T A;  1SYF A;  3V05 A;  1NR2 A;  4RGM A;  3S15 B;  5IYC G;  3L7Z C;  1HQR D;  4K5V A;  3OWF A;  1B3Q A;  1K8A C;  4KI0 A;  1ML0 D;  2JSO A;  1NBW A;  4A3D G;  1O78 A;  3CF5 A;  5EKL A;  3DMU A;  2L9H A;  3DM3 A;  3K7U C;  4HIK A;  4DUY Q;  1PVO A;  4G7H C;  4JI5 L;  2O2L D;  1XPO A;  2Q2T A;  2K5D A;  3ICE A;  2MO1 A;  3NTI A;  2OTL A;  2Z6K C;  1FNU A;  2EJF C;  2HCC A;  2PPB C;  1VQI A;  3GV3 A;  4Y52 H;  2O5I C;  2AQ3 B;  2F0K A;  3FKI H;  4A93 H;  3HZX A;  3TSS A;  4DFA A;  2JA8 B;  2UXB Q;  2EYJ A;  4KY6 A;  4TKO B;  2ZXP A;  2ZTC A;  1I50 H;  4H7B A;  4ZCK A;  1JWM D;  3TBI B;  1KHI A;  1AE3 A;  1B4O A;  3W2D A;  1U9R A;  2WV6 D;  4PV1 C;  1B70 B;  4KY5 A;  2E5L Q;  3S2H H;  1SMY D;  2WII B;  4DV5 Q;  3N52 A;  4R4C A;  3P7J A;  1TS4 A;  1FGU A;  1OXU A;  3H3V C;  2EJG C;  2AUK A;  4H44 C;  5C3E G;  5M5W B;  3GTM H;  1GO3 E;  2I0Q A;  1FD7 D;  4NXM L;  2RQX A;  2LSS A;  1VQ6 A;  1JOO A;  2JA7 G;  4RCO A;  4CHT B;  4XT3 B;  3JAM E;  3D4R A;  2JEB I;  4P2C B;  2PO4 A;  1X3F A;  3K0X A;  3MZ5 A;  4IUU A;  1SNQ A;  4IJH A;  3WDN A;  3S1R H;  3FKI B;  1LT6 D;  3X3M A;  3MXG A;  1N33 Q;  1W3S A;  3CCJ A;  4JYA L;  5IT9 L;  1Z47 A;  2QCP X;  4LF8 L;  5FJ8 G;  2YV5 A;  4IUQ A;  1YEZ A;  5IYC H;  4DR1 L;  2A68 C;  3K59 A;  1BBX C;  3P20 A;  5LMU Q;  4R4I A;  3GQB A;  2M2L A;  4A3M H;  4A3D H;  5IYD G;  1P16 A;  5C3X A;  1IBK L;  1EY6 A;  4WJ4 A;  2KCT A;  4DAY A;  4EX5 A;  3DWP A;  4DV4 Q;  2B39 A;  1I94 Q;  2N49 A;  3QIA A;  1JMC A;  4H02 A;  3LNN A;  3AEV A;  1IL2 A;  1ONL A;  1TKW B;  3A8K E;  4IOC A;  4XT1 B;  3SVM A;  1FNW A;  1EIY B;  4KN4 C;  4TQU S;  1STB A;  1SE3 A;  3G4S A;  1VQC A;  1NMG A;  1VQ4 A;  3UDF A;  5CBA E;  2KJX A;  1Y1W H;  4KLK A;  5E4X A;  1TQO A;  1CKN A;  2O4X A;  4FVM A;  3S1M B;  5HGQ A;  3IAY A;  2YTY A;  1B53 A;  2F0F A;  3CQZ B;  2EYF A;  2F4V L;  1ASY A;  2UUB Q;  2R61 A;  2R93 G;  1U4M A;  4GLX A;  1HNW Q;  1PRT C;  3S1R B;  4IFD J;  2Z1C A;  3KLR A;  5FLX c;  2F0M A;  4APV A;  3NQI A;  2J4X A;  1UEB A;  3KUP A;  5C3E H;  3SE0 A;  1JB7 A;  2K5W A;  2DN8 A;  1BVS A;  1YJN A;  3HKZ G;  4A3M B;  5IGF A;  4A3D B;  4KMU C;  1W2B A;  1N32 Q;  4S3S A;  1I3Q H;  2K50 A;  1Z6H A;  2JA7 H;  4PMW A;  1HR0 Q;  4YY3 L;  2NUC A;  5IOC A;  3WOF A;  2DY7 A;  3I4N G;  1EOV A;  2Z6K A;  3F8T A;  2ZM6 Q;  4FXG C;  2WP8 J;  1JC7 A;  4AH6 A;  1KIX A;  4HR7 B;  2OTJ A;  1S4Z A;  1KAW A;  1JJG A;  4G7Z C;  4ZLT F;  5FJ8 H;  2XWJ B;  2EY2 A;  1Y1W B;  1OO9 B;  3K5L A;  2KQ3 A;  2B8G A;  2K5V A;  5IYD H;  4JC0 A;  2KHJ A;  3HOY G;  4F87 A;  3PO2 B;  4JG2 A;  1YHQ A;  1YIJ A;  3I7F A;  2IL8 A;  4DAY B;  1G51 A;  4NW2 A;  1LAC A;  2F3W A;  3QG1 A;  4HJ5 A;  4HJ8 A;  4JI4 Q;  1PRT D;  4LF9 Q;  3A7L A;  4L63 B;  5C5M A;  4LF6 Q;  4NMZ A;  2A6E D;  1PYW D;  3NPP A;  4P73 A;  1BQQ T;  5C3E B;  3IFD A;  2JE6 I;  4DUZ Q;  1EY5 A;  2MJ8 A;  4DGZ A;  1XMQ L;  4K0K L;  4AYB E;  1ET9 A;  1ESR A;  2BOS A;  3SR1 A;  5J1Z A;  2JEA I;  4XYO A;  1I3Q B;  2WB1 E;  4R1J A;  4QF4 A;  4LF5 Q;  1YJW A;  2MP1 A;  4K6D A;  1GD7 A;  1U4L A;  2E2J H;  3GTQ B;  3PIP 3;  4PG3 A;  4JV5 L;  5T1I A;  1V1P A;  2R93 H;  4HJ7 A;  1A0I A;  3TQY A;  3T1H Q;  4CKC A;  4G57 A;  5LMN L;  2F0V A;  3AYH B;  1N34 L;  1KQS A;  4IPG A;  3OIQ A;  2Y0S E;  1UE1 A;  3H3V H;  4F88 A;  4X62 L;  2E2I B;  4N9T A;  4NP5 A;  1U5K A;  2PQA A;  1VMC A;  2F0U A;  4DV3 Q;  4GOP C;  1GOZ A;  1LUZ A;  1CQV A;  3T1Y Q;  2CFM A;  3KDF A;  1JCK B;  1PFB A;  2KCC A;  1JOQ A;  4A3B H;  2RCN A;  1NJI C;  3I4N H;  2JK8 A;  3QB3 A;  2RA4 A;  3I56 A;  4EGV A;  1WOC A;  3J81 j;  1Q7Y C;  1PH1 A;  1I6H H;  2JA5 G;  1K0R A;  4GN4 B;  4LFB Q;  3EJI A;  3HOU B;  3I3C A;  2DJG C;  1Y14 B;  5EPJ A;  3J81 E;  2E2J B;  3VR6 A;  3HOY H;  1S5D D;  2WAQ E;  4O2D A;  4NXN Q;  1C0A A;  1IYV A;  1GUT A;  4CKB A;  4OX9 L;  4QIW E;  3FP9 A;  2VB3 X;  3EN2 A;  1KDA A;  1B9M A;  2BCO A;  3QOL A;  2N55 A;  1RTO A;  5ELB A;  1X54 A;  3K57 A;  2FJ2 A;  4UY8 C;  2K7V A;  4C3H B;  2HDL A;  3UI2 A;  5TSS A;  3CRL C;  1QWY A;  2GN5 A;  1AH9 A;  2NWG A;  1PH9 A;  4A3B B;  1CM9 A;  3A54 A;  1N36 L;  3H09 A;  4X65 L;  4DNT B;  1JQY D;  2IWH A;  3S2D H;  3C2P A;  5GQO A;  2UXC L;  1M1K C;  4IUV A;  1VQO A;  3RZO H;  4KKS A;  2G9D A;  2F0N A;  1YIT A;  1PZI D;  2XVS A;  5C0X I;  3I90 A;  2KA7 A;  2Z4H A;  2KEC A;  2MO0 A;  1WTW A;  4UP7 A;  5KNC A;  1EWC A;  3HOY B;  1AP0 A;  1MKH A;  1TWG B;  2NZH A;  1BXT A;  3FMC A;  3NK9 A;  3T16 A;  3L2P A;  3J7A F;  2EYH A;  2N3S A;  1J5E Q;  2VUM B;  4DK0 A;  1KDB A;  4I65 A;  1L0Y B;  2H5X A;  1LTS D;  2Z9H A;  4A4I A;  3EQL C;  3D6C A;  4A3E G;  2L12 A;  1II3 A;  4ZKB B;  2AQ1 B;  1CHP D;  1OXS C;  1SNM A;  1K8G A;  2GA4 B;  1SND A;  5JPM C;  1XNR L;  5ELE A;  1XPU A;  2ZTD A;  2JA5 H;  2Z0S A;  1X3Q A;  2R7F A;  4CDD C;  2EQS A;  3K5M A;  2YU9 H;  1KXL A;  1C4Q A;  3P1H A;  1TS3 A;  5K36 G;  1NAP A;  5I9O A;  3G6J B;  2H1E A;  3S2D B;  1RCV D;  1PRT B;  3I8Z A;  3UE0 A;  3L0O A;  1E3P A;  4YHH L;  3DWQ A;  1SE4 A;  4DR2 L;  1CZW A;  1F9Q A;  2RCF A;  4UP8 A;  5BN4 A;  3CD6 A;  3M7G A;  3CCS A;  1YNX A;  3KJO A;  3M4O H;  4IOA A;  5BR8 Q;  1HFN A;  1G6P A;  4GOP A;  1BOS A;  2CWP A;  3PQI A;  5HY6 A;  3S24 A;  2QDL A;  2PZW A;  1K83 H;  2L15 A;  2K03 A;  1H9J A;  5L37 A;  4IFD G;  3M3Y B;  3E9H A;  3HOV B;  2JA6 B;  3GTJ B;  1TXY A;  1UE5 A;  3ND9 A;  4BBS B;  1B50 A;  2JA5 B;  4X3T A;  4C1N I;  1UAP A;  2HHH L;  2BDO A;  1KNA A;  1NY4 A;  5IE8 A;  4IPC A;  4DAM A;  4I7A A;  4JBJ A;  3OOC A;  4X3K A;  1XPR A;  5EQ0 A;  3AB9 A;  2VQF Q;  3I4L A;  4JI6 L;  4UAI A;  3CC4 A;  1C8C A;  1BCP F;  4DV6 L;  1KLG D;  3J80 c;  2C35 B;  2O5J C;  1E22 A;  3CCE A;  1LTT D;  4DA2 A;  1HNX L;  1QG7 A;  2Q8R E;  4IJL A;  3NTH A;  1W6J A;  1N9W A;  2KOL A;  4DV7 Q;  4B3T Q;  5A35 A;  2M00 A;  4A3I B;  2QKI C;  5I2Y A;  1HQM C;  2Q2H A;  2CH4 A;  4LW1 A;  2LFN A;  2UUA Q;  5K36 H;  4DK6 C;  4JI7 Q;  5C4X G;  3EA6 A;  3P75 A;  2I5M X;  5D3D A;  5CYU A;  2F0I A;  4LK1 C;  3FPP A;  4UP9 A;  2QDB A;  4B3M Q;  1GHJ A;  3S17 H;  2PW5 A;  1VF7 A;  5EBC A;  5IGC A;  1CSP A;  3IL8 A;  2B2Y C;  1PH6 A;  1HZ9 A;  3NEL A;  4KN7 C;  4WOR A;  2PQE A;  2C9O A;  4FO2 A;  1JJ2 A;  4CGY B;  3SK8 A;  4GOP B;  4PZ8 A;  4X64 L;  3EVQ A;  1CT1 D;  3K81 C;  2R7Z G;  4GNX C;  2M9V A;  1GUG A;  5IY0 A;  1VQH A;  2XRQ D;  4IFD H;  3F2U A;  1V1O A;  5IOD A;  3CCR A;  1JOR A;  1D1K A;  3R3O A;  1TS5 A;  4IUR A;  4CBV A;  1ZXT A;  4XDX A;  4GKK Q;  2Z4I A;  1D5Z C;  2ZTE A;  2KVM A;  4LFC Q;  4A3G G;  3OTO L;  3KF6 B;  5FLX L;  1EIG A;  1X3G A;  3BS1 A;  4JI3 Q;  3NUC A;  2E5L L;  1SSO A;  4DKA C;  4IN3 A;  4LF4 Q;  2R92 G;  4IPH A;  3KFU A;  4I7Z C;  2FFK B;  2QW7 A;  4A3C G;  1XMO Q;  3HG9 A;  4WJW A;  3VYS A;  1A3T A;  1DON A;  1TWF B;  2Q8I B;  2RDF A;  2PNH A;  3NSW A;  4DR3 Q;  3S17 B;  3KLW A;  3MVV A;  4ME3 A;  3LX0 A;  1I5F A;  4E6I A;  2LKV A;  4C3J G;  1LT4 D;  1BDO A;  1G91 A;  1CKO A;  3FPU B;  1N33 L;  1GHK A;  1D2B A;  2MPM A;  2AQ2 B;  5LMU L;  3VR4 A;  5C4X H;  2FIN B;  1JR0 D;  1VQB A;  5FLM G;  4OL7 A;  3U4V A;  4C56 C;  1VQM A;  3W3A A;  3BZD B;  2KCN A;  1D5X C;  4DV4 L;  5KYL A;  3JAM i;  1VQD A;  3A7A B;  3Q24 A;  4Q5V A;  3D6W A;  2IY5 B;  4H13 C;  4KJO A;  1VF5 C;  2Q2U A;  1RIP A;  3RZD H;  4QCL A;  3TS0 A;  2JXM B;  2R7Z H;  1A2T A;  2BA1 A;  2NVY H;  4L6T B;  3S16 H;  5GAH C;  3HOZ B;  4DV0 L;  3K6O A;  2JN4 A;  2A69 C;  2F52 A;  2NZO A;  4U67 3;  2UUB L;  2B3G A;  1HNW L;  5CGK A;  3B6Y A;  2R92 H;  1JE4 A;  2JA9 A;  2CCZ A;  4R4O A;  4A3C H;  1G8Z D;  3F2B A;  3T56 B;  4CDE C;  4YWK A;  5C4X B;  1O7Z A;  1AE2 A;  1K8O A;  1SE2 A;  3NEN A;  1PFN A;  4Y7N B;  1N32 L;  5EGT A;  1BCP C;  3X3N A;  4OGQ C;  1M90 C;  2K05 A;  1IHZ A;  1HR0 L;  1STE A;  5BN3 A;  5JJI A;  2IX0 A;  4BS9 A;  2B2Y A;  1Q12 A;  1VMP A;  4DPG A;  3L3O C;  4A3F B;  3ONA B;  1LTI D;  4MIU A;  2ZM6 L;  5M5Y H;  1BKB A;  4KHP Q;  1J6Q A;  3C46 A;  1SDF A;  3HFZ B;  1PH5 A;  2Z8L A;  2R7Z B;  3DM1 A;  4B3S Q;  4GNX A;  1WCM G;  4EQO A;  3CXC A;  2UUC L;  4FNF A;  3S16 B;  1QUQ A;  1A8V A;  3S1Q B;  2EY6 A;  2ATW A;  3OYY A;  3GDE A;  4UDU C;  2B29 A;  4BY7 G;  5FLM H;  1TR5 A;  4IZ8 A;  1XNQ Q;  5JOB A;  3OMC A;  2YYZ A;  2A69 D;  4ZRZ A;  4LF9 L;  4EQN A;  4EQP A;  2R92 B;  4L5Q A;  4LF6 L;  1Y8N B;  1G29 1;  2NBF A;  3Q6S A;  3ITP A;  4DUZ L;  1JJC B;  2JQO A;  1I4H A;  2F4I A;  2WB1 G;  3J80 E;  4LFA Q;  4LF5 L;  4OO1 H;  2F0P A;  1I4Q A;  5J39 A;  3J81 c;  3I2Z A;  1AFP A;  3CME A;  1DCZ A;  3D4W A;  1RD9 D;  4K5W A;  3W1G A;  2K32 A;  1CTM A;  4KKT A;  1IXR A;  5E1F A;  5CC4 A;  5M5Y B;  3T1H L;  3GTO H;  2KEE A;  4HIO A;  2Y0S G;  1B8A A;  1SJH D;  4HJ9 A;  4A3J G;  3CRK C;  1WVL A;  5CV8 A;  1CQF A;  2WFW A;  2VZA A;  2XWB B;  3T1Y L;  1TWC H;  4RG1 A;  1EUJ A;  1VQ8 A;  3J7A 5;  4KHZ A;  4PMC A;  5GAG C;  2MNA A;  3AU7 A;  2DNC A;  3CMA A;  4A93 B;  3UE1 A;  2BDN A;  5IGD A;  1WTR A;  4IPD A;  1MJE A;  5FOB B;  1PA6 A;  1X9N A;  3BVZ A;  3H0G G;  1O7Y A;  1EQQ A;  1W6K A;  4F8M A;  1I50 B;  1AZQ A;  4EVO A;  3CKI B;  4JI1 Q;  1JWS D;  1OXV A;  3GV6 A;  3OMG A;  4MNO A;  4LFB L;  1QUQ B;  1DXM A;  3TZD A;  1E7Z A;  3S2H B;  1M4V A;  2WAQ G;  4OON A;  5KIX A;  2ID0 A;  4IAL A;  4AQY Q;  2EY1 A;  2G9H D;  1QIL A;  4OEL B;  1EFW A;  4MTK A;  4ZUJ A;  1STN A;  4O1N A;  1PTO F;  1L0X B;  3GTO B;  3GTM B;  3GTG H;  1H9M A;  2XSC A;  3ULJ A;  5T1G A;  2UXD Q;  1Q8I A;  1VQJ A;  1L0W A;  5C3W A;  4OXP A;  1JWU D;  2F0L A;  1U4R A;  4YCW A;  1EU4 A;  1QZH A;  2MFI A;  2B2U C;  3PIP A;  4ME5 A;  1KDC A;  1VQP A;  1CA5 A;  1HA6 A;  1SYG A;  2YTX A;  4FF1 A;  1KAA A;  1SN8 A;  3LWE A;  2RHS B;  1WD1 A;  3J81 i;  4B9X A;  2LY7 A;  2WAC A;  1VCI A;  3QJY A;  3I55 A;  1Q81 C;  4KKU A;  2A68 D;  3K80 C;  5LHY 1;  1V8Q A;  1EY4 A;  1L1O C;  1TT2 A;  4DR7 Q;  2ZXO A;  4A3J H;  4MN3 A;  1GUS A;  4MHE A;  1C48 A;  2E75 C;  3HP3 A;  3V96 A;  3OW7 A;  3T13 A;  3A5Z B;  3HKS A;  1KC8 C;  1LO5 D;  2F1M A;  4LF7 Q;  4K8I A;  2MQH A;  4K8J A;  1DGS A;  4C1N K;  2D9U A;  5FO8 B;  2CWA A;  1ENC A;  5DEH A;  4ALP A;  3T53 B;  4BXX G;  1YZ6 A;  2OWO A;  3GTG B;  1AW7 A;  4RWS C;  3MWY W;  4K2L A;  4BY1 G;  3CC7 A;  3MHB A;  1XJV A;  2F3I A;  1LTL A;  1RTN A;  1YNN C;  1EL0 A;  4PMB A;  3H0G H;  3VR3 A;  1XWE A;  2K5Q A;  1HNZ L;  3TS2 A;  2D5D A;  1SFO H;  3RN5 A;  3OWE B;  4RFB A;  4V19 0;  2XGT A;  4X3U A;  5IIF A;  2N78 A;  1HZC A;  4KK7 A;  1EQR A;  1KL9 A;  2VL6 A;  2D62 A;  4ODG A;  4GN3 B;  4G7O C;  2RKS A;  4DXG A;  3PUY A;  3E0J A;  3JAM L;  4DR4 L;  2K75 A;  4HSP A;  1CUK A;  5IGG A;  5ELF A;  5F2D A;  5E7N A;  4JBK A;  1PH7 A;  4HN7 A;  2JA7 B;  5KEE A;  5C5L A;  2K5N A;  1MGS A;  1AZP A;  3ER0 A;  1CKN B;  5JJL A;  3ERQ A;  5BR8 L;  2HT1 A;  1SYD A;  1EIH A;  3DEO A;  1Q90 A;  4FP5 D;  4NB3 A;  3K5O A;  1IW7 C;  1EIF A;  1PYS B;  1E2W A;  2A19 A;  1H9K A;  2HIX A;  4N8X 1;  4HCE A;  1YNN D;  2X69 A;  3MXP A;  1Q1E A;  1FL0 A;  4A75 A;  2UU9 Q;  1NUC A;  4POF A;  1Q8K A;  4FXD A;  4N9P A;  1SFO B;  3U58 A;  4ZYS A;  3GO5 A;  1GJX A;  1M8A A;  2TMP A;  1EYA A;  2K5H A;  4QJF A;  1XTD A;  3KBX A;  2KCM A;  5H1S E;  1PZK D;  1STH A;  2IHE A;  2A8V A;  5M9O A;  4ZQ3 A;  4XQN A;  1V43 A;  5A2Q E;  3K58 A;  3VR2 A;  2HQL A;  5DLQ E;  4A3L G;  4BXX H;  2BH2 A;  2VQF L;  1Z9F A;  4J8Q A;  4WRD A;  4BY1 H;  3WOE A;  3A5U A;  3FHW A;  1MHW C;  2EYM A;  4LUO A;  1CK1 A;  2VXW A;  2ES2 A;  1LTG D;  2A73 B;  4R8N A;  2B2U A;  3VYR A;  4JYA Q;  2I46 A;  4DV7 L;  2AUJ D;  4KY7 A;  2R93 B;  2A74 C;  3ULL A;  2K6A A;  4DR1 Q;  1SRO A;  3NQT A;  4DNI A;  2UUA L;  1WTQ A;  1K73 C;  1YHB A;  1PTO C;  1Q3L A;  4OWX B;  3M4P A;  1TWA H;  2JYO A;  4HJA A;  1N8R C;  1KLU D;  1SNC A;  2F0S A;  1S5F D;  3HKZ B;  1QVC A;  4B3M L;  1L1O A;  1IL8 A;  2AKW B;  3PUW A;  1PFM A;  3MXN A;  1VQK A;  3CCU A;  4DV1 Q;  5JJK A;  4JPB W;  3I4N B;  1V1P B;  4OIJ A;  3TRE A;  2NN6 G;  1K3B C;  1A63 A;  1NNX A;  2GVA A;  4BY1 B;  3CPW A;  5HUR A;  1KAB A;  3K7A H;  1I6H B;  1IKM A;  4MTN A;  3NP8 A;  2EYL A;  1HZA A;  5C44 G;  4PNY A;  2PQA B;  3HGB A;  1WTV A;  3RD4 A;  1IBM Q;  1L2F A;  2NZ1 D;  2B8F A;  1AN8 A;  3TP5 A;  1D1I A;  3KDF B;  3CCM A;  3TP7 A;  1WTH A;  5FK9 C;  4L5S A;  4LF4 L;  4LWC A;  2X6L A;  5KNB A;  4UHV A;  4XXE A;  1WI5 A;  1XMO L;  1BF4 A;  1SNP A;  1DZ1 A;  1DM0 B;  4XYQ A;  4A3L H;  1TWA B;  2EXZ A;  2EZV A;  2VQE Q;  4QGU A;  4YY3 Q;  4DR3 L;  2HDM A;  3NBI A;  3FDT A;  5G3L F;  2E2D C;  2I5H A;  2OF1 A;  3F1Z A;  3CU7 A;  1EZ8 A;  1E2Z A;  4YCV A;  2K14 A;  3BJU A;  1XXG A;  4NKL A;  2RBM A;  4IQZ A;  1WD0 A;  1JB3 A;  3UDI A;  3DXJ C;  3BYT B;  4J15 A;  1SLJ A;  2PW7 A;  2KBN A;  2ZJP A;  3HOW G;  3RZO B;  2NB0 A;  4CJ0 B;  5IT9 c;  3GTP H;  1NTG A;  1TII D;  3SK4 A;  2PI2 E;  1KRS A;  2CVR A;  3DLL A;  3MEH A;  1UE7 A;  5KND A;  5M3M G;  4A3K G;  2SNM A;  4FXK C;  1C7Y A;  3SXH A;  5GAE C;  1QCB D;  4JVZ A;  2RHQ B;  1H9S A;  1U0L A;  1Q46 A;  1LLR D;  2Q2I A;  4DF7 A;  3D3R A;  2NN6 H;  1HTL D;  2VNU D;  1Y8P B;  2FHT A;  1EQT A;  1F2Y A;  5I6W A;  1XX8 A;  1PH2 A;  2ALY B;  1LV9 A;  5C44 H;  5J22 A;  2YU9 B;  2NVT H;  1G6Z A;  4K14 A;  1N34 Q;  2IPK D;  3KYH C;  3PO3 G;  2A1A A;  1A3V A;  3U4Z A;  3K0Y A;  1YVC A;  3PUX A;  4A3E H;  3URY A;  3GTP B;  4QY7 A;  1BO0 A;  1VQ7 A;  1SXT A;  1CI3 M;  2EYP A;  2PZT A;  3M4O B;  3MEF A;  3OPO A;  2SEB D;  1ZYR C;  1CKM A;  2IT1 A;  3MXU A;  1K83 B;  1K9M C;  4BBR G;  1EQV A;  3MC0 B;  3BG3 A;  3PMF A;  3U9O A;  4B3R Q;  3GD7 A;  4L5R C;  5M3F G;  3TN2 A;  1RHP A;  4B3S L;  2AHO B;  3UDX A;  2D0P A;  2FXQ A;  1X55 A;  4DUY L;  1A15 A;  1HUM A;  1XNQ L;  1ICF B;  4P75 A;  4LUV A;  1BBU A;  3BYY B;  5C0X J;  2HUG A;  4O0A A;  1ROD A;  5M3M H;  2B2V C;  4A3K H;  1MI2 A;  2KEN A;  3A8J E;  1SE8 A;  2FMC A;  2UXB L;  3G71 A;  4A3E B;  1MSH A;  5JVG 3;  5DAU A;  4Q0F A;  5EBD A;  1LTR D;  3I73 A;  1K3R A;  4LFA L;  2HD3 A;  2R6G A;  2B2W C;  1EY7 A;  3RNU A;  3S14 H;  1N36 Q;  3LWU A;  5GRO A;  4X65 Q;  1X3E A;  1D7Q A;  4DV5 L;  3L9A X;  1PZJ D;  2HIV A;  2LS0 1;  3R8B A;  1GXD C;  4QMG A;  1EWH A;  4JI2 Q;  4FYD A;  3PO3 H;  4OIK A;  1YI2 A;  3FRP B;  1NMF A;  2KHS A;  3EFX D;  4J6H A;  5I4D A;  1FJG Q;  3QWN A;  1LYL A;  1PH8 A;  1TS2 A;  3PV0 A;  4IUT A;  1UEA B;  1ENA A;  2DUD A;  1CFM A;  3T51 B;  4K6L A;  1EEF D;  3J80 i;  3HEJ A;  3PF5 A;  3CP0 A;  1J8I A;  2R3Z A;  2RSO A;  5M3M B;  2KHI A;  1BNZ A;  2HQE A;  2K01 A;  4P74 A;  4BBR H;  5JJZ A;  2YTV A;  1K0S A;  3OW2 A;  1PV4 A;  3FEW X;  2N88 A;  4LAA A;  3SGI A;  4XIG S;  2NTS A;  3M4Y A;  4IUP A;  1XNR Q;  1VQF A;  1PLF A;  2CHB D;  1SRU A;  1B1Z A;  2MHV A;  5I6Y A;  1CSQ A;  1CZG A;  4JI1 L;  4JI0 Q;  4QL5 A;  3KF8 A;  2K28 A;  2V4D A;  5LL6 S;  3S1N H;  1I94 L;  4GN5 A;  2K52 A;  3C1E A;  1SAP A;  2BH8 A;  5ELN A;  2PMZ B;  4AQY L;  2EE1 A;  1XYI A;  3D0F A;  3J7Y W;  1EY8 A;  4RGO S;  4X66 Q;  4YHH Q;  1JOK A;  2E74 C;  5ELO A;  2UXD L;  3TZU A;  2ZXR A;  2I07 B;  4XTC S;  5D65 A;  1MIU A;  5CBE E;  1TY2 A;  4RGT A;  1K28 A;  4DV2 Q;  2XNA C;  4A3G H;  3H91 A;  3FKI G;  5HGT A;  1D5M C;  5G3L D;  3HOX G;  3KLS A;  1UUP A;  4U68 A;  4R4T A;  3S15 H;  2QIL A;  5I9P A;  1ILQ A;  1FVI A;  3C3L A;  2CW0 C;  2EYO A;  1RF2 D;  4GS3 A;  4JCV E;  3Q22 A;  1X65 A;  3E0E A;  1IYJ B;  1F2M A;  1V1Q A;  2F0G A;  5IT9 E;  4HTH A;  1FYC A;  3G48 A;  1PRT F;  1I4P A;  4X3S A;  1T5E A;  4K5X A;  3I91 A;  1A6X A;  4GLV B;  4C3J H;  4JI6 Q;  1GUO A;  3PCO B;  3TME A;  3TDQ A;  3RZD B;  2L1B A;  2B2V A;  1B9N A;  4ULL A;  5KGU A;  2NVY B;  4TVA B;  1T5X D;  2OXP A;  1F77 A;  2DGY A;  3SEB A;  2DJF C;  1ESF A;  4IFD I;  2IX3 A;  1VQN A;  4A3G B;  2ICE C;  3SK5 A;  4B9W A;  2B2W A;  1LAB A;  2WKD A;  4DR6 Q;  3K8A A;  1CA6 A;  2RDH A;  1DD2 A;  5M5W H;  1TWH H;  4JI4 L;  1KRT A;  5CV4 A;  1STY A;  2VY3 A;  4A3M G;  2CW0 D;  4AYB G;  1S40 A;  1T9H A;  2F03 A;  1IZ6 A;  3OSO A;  1BCP D;  4GKJ Q;  2CKZ B;  3PSI A;  5C4J H;  3ND8 A;  2FMM A;  3A74 A;  5AJ3 Q;  5CV6 A;  4X64 Q;  2HCI A;  1BUV T;  2D2C C;  4YCU A;  4C3J B;  2NVQ H;  3HOX H;  1HCZ A;  2F0T A;  2F3V A;  3A56 A;  4IUN A;  1Y1W G;  3KOJ A;  1AEX A;  5JEA G;  2ZJR A;  3OTO Q;  4RHS A;  3GTK H;  3PIO 3;  2KED A;  3PO2 G;  3MAQ A;  2UU9 L;  1H95 A;  4CKE A;  3J7Z C;  4DV3 L;  4OHJ A;  3ERS X;  2B2T C;  1WYD A;  1X32 A;  2IW3 A;  3GP7 A;  1TWH B;  4JI8 Q;  3MFG A;  1EYC A;  3G7L A;  4ABN A;  2EDG A;  3CCQ A;  2MUY A;  3N6R A;  3NWS A;  1GUN A;  1EWI A;  1WCM H;  2CQO A;  5COR A;  3STB C;  1KTK A;  4GNX B;  3S1M H;  4NPS A;  3CQZ H;  5C4J B;  2XN9 C;  5CV9 A;  3ERO A;  1S5B D;  2JP1 A;  5IWA Q;  4BY7 H;  1EY9 A;  3R2I A;  4ZK9 B;  4ID6 A;  5CV5 A;  4NXN L;  2EJM A;  2NVQ B;  3HOX B;  3RUZ A;  5C0X G;  4M1U B;  3DWA A;  1LT3 D;  5EPL A;  3VR5 A;  1R4Q B;  2L5T A;  1SYB A;  1RDP D;  1YHA A;  3GTL H;  3GTK B;  3QR8 A;  4B08 A;  4DK1 A;  1S3O A;  3D4D A;  4ZKC B;  1ZKO A;  1RJT A;  1HFG A;  1PMR A;  1TWC B;  4IO9 A;  4FDB A;  1EU3 A;  3PUZ A;  1SYE A;  2AMC B;  1QNK A;  2A6H C;  4DV1 L;  4BA1 I;  2OCE A;  5M5X H;  1QVF A;  1I4R A;  1F9S A;  5IP7 G;  4FF4 A;  1Q1B A;  2IHF A;  4DV0 Q;  2DY8 A;  3HOU G;  5GAD C;  5JEA H;  2V1C C;  1EYG A;  1WCM B;  4DR5 Q;  1IBL Q;  3STB D;  1S5C D;  2RVL A;  3KBG A;  3T4A C;  3PO2 H;  1X3P A;  2F0H A;  4BY7 B;  2EIF A;  1IBM L;  2A6E C;  1J5E L;  3CPF A;  2BE5 C;  3J80 L;  3TP8 A;  4OWT B;  5LMN W;  1GVP A;  1A3U A;  1KNE A;  3G6E A;  2RSN A;  4C3H G;  4HCS A;  4AYB B;  3GTL B;  3RMH A;  1MJC A;  2VQE L;  2AWN A;  2WB1 B;  1F9P A;  3CW2 C;  3F2D A;  3GTQ H;  2VB2 X;  3RLO A;  4A3B G;  3VA5 A;  3Q8D A;  3O13 A;  5FO9 B;  2QGQ A;  1DJR D;  1PFS A;  3A0J A;  4OO1 I;  2A6H D;  1WTP A;  3SDZ A;  5M5X B;  1QOH A;  3IRB A;  1B7Y B;  5C0X H;  2UUC Q;  2E2I H;  1E1O A;  2Y0S B;  4JI5 Q;  4A3J B;  2DNE A;  3CAM A;  1MD2 D;  4EQ5 A;  5IGE A;  2VUM G;  1ENF A;  1E1T A;  2H4O A;  5ELC A;  1B3A A;  1VQE A;  4WFN 3;  4KTA A;  5DNF A;  1BCP B;  1NSN S;  1STA A;  2B2T A;  3VA7 A;  2K4K A;  2BE5 D;  3AFP A;  4ZUI A;  5I2X A;  3VYU A;  2EOT A;  1ASZ A;  2B63 G;  3M7N A;  1HPC A;  3OIP A;  1JIC A;  4RKL A;  5LL6 X;  1PYB A;  5IP7 H;  1GKH A;  3H0G B;  3RN2 A;  1BBW A;  2JJQ A;  3HOU H;  1HTP A;  3E3X A;  1DOM A;  5JPN C;  4HMI A;  2K33 A;  2IX1 A;  2WAQ B;  1Y69 U;  3H6M A;  1OXX K;  2J7Z A;  4QIW B;  5C6A A;  2XTI A;  4NXM Q;  4P72 A;  1Q86 C;  1V9P A;  5EKK A;  1SBB B;  3LGJ A;  4C3H H;  1LT5 D;  1LTA D;  2PI2 A;  3DUZ A;  4ILW A;  4C2M H;  3RLF A;  4NDX A;  4GZY C;  3ULP A;  3NEM A;  1A2U A;  4YWL A;  4KD4 A;  1DYQ A;  1U4P A;  1GM5 A;  4QB4 A;  4B3T L;  2C5C A;  5BN5 A;  2E2H H;  1WFQ A;  4LF8 Q;  5KRU A;  1B2T A;  1RL2 A;  1IW7 D;  4B3R L;  1HH2 P;  3AMU A;  3HOV G;  2JA6 G;  4BBS G;  4F7X A;  4JI7 L;  4RHR A;  2ZJQ A;  1ILP A;  4M8A A;  1IBK Q;  1QJO A;  1EZ6 A;  1RKN A;  4DAP A;  1CHQ D;  4HIM A;  4DAV A;  3AQQ A;  2J0T D;  2F0Q A;  4PZ7 A;  1SEB D;  1TWG H;  3CCL A;  1O80 A;  1ICW A;  4OEM B;  3VDY A;  5C4Z A;  1S5E D;  2VUM H;  3TP6 A;  3MTS A;  1PXU A;  1ET6 A;  1YNJ C;  5DM7 3;  1JE5 A;  4G4K A;  4J1M A;  3FVQ A;  1VQG A;  2PZU A;  3PF4 A;  5EAY A;  3MFY A;  5K5P A;  2VW9 A;  2B63 H;  3I4M G;  2LXJ A;  3I72 A;  3KLS X;  4GKK L;  5FO7 B;  4LFC L;  4C2M B;  2F4V Q;  4A3I G;  1C9O A;  2A5H A;  4L5T A;  4PZ6 A;  3NBH A;  4OWW B;  2SNS A;  5NUC A;  4JI3 L;  2Q8T A;  1TY0 A;  2G5D A;  2E2H B;  4AIM A;  4JBW A;  5ELD A;  1Y1V G;  1WTO A;  2WKC A;  3C1F A;  1PHJ A;  4BWG B;  5FKA C;  3BDO A;  4JI2 L;  1PTO D;  3HKZ E;  2RF4 A;  1FJG L;  3A8I E;  5JVH 3;  4HED A;  4RMF A;  4H0L C;  2D0O A;  2N8N A;  1E24 A;  4LUZ A;  1QVG A;  3QOJ A;  2R7D A;  3JC6 6;  2K1B A;  4R9W A;  1YNJ D;  2QF7 A;  3M3Y H;  5D3I B;  2E8G A;  4LJZ C;  4XQQ A;  3HOV H;  2JA6 H;  1HNZ Q;  2B63 B;  3GTJ H;  1VQL A;  3U9S A;  2XIW A;  4BBS H;  1PH3 A;  3K7A B;  2SDF A;  4DU9 A;  1FNV A;  2K04 A;  3E6Z X;  3W1B A;  1J9O A;  4KD3 A;  4RA8 A;  4JI0 L;  4BA2 I;  3PGZ A;  5A2Q L;  4DK3 C;  5DM6 3;  3D31 A;  3H3V I;  2EVB A;  1QNU A;  1L1O B;  5AFW A;  1QE6 A;  5FLX E;  5IP9 G;  1SMX A;  1VS0 A;  3MXN B;  4DR4 Q;  1LTB D;  1MSG A;  1XMQ Q;  4K0K Q;  5C4H A;  1O7I A;  1VQA A;  3NWT A;  1EEI D;  1PDQ A;  5IYB G;  2ZT9 C;  2PYK A;  3E5S A;  4X66 L;  3J81 L;  3UDG A;  4YWM A;  1X56 A;  3I4M H;  2EXD A;  2XRS D;  3BZC A;  4JV5 Q;  3D8G A;  3S9W A;  2PNR C;  1R9T H;  2MGS A;  4DV2 L;  4A3I H;  2OEO A;  4GLA C;  3TEH B;  3PUV A;  3R2T A;  3F2C A;  5LMN Q;  3NBH B;  3BZK A;  3HS0 C;  4HSV A;  3BDC A;  1Y1V H;  2Z6B A;  3EBE A;  5JEA J;  1HZB A;  4X62 Q;  1OTC A;  3KF6 A;  1FGB D;  3NE5 B;  2F0D A;  1LM0 A;  1DOK A;  3U50 C;  3TRZ A;  1VQ9 A;  1F2Z A;  1QZG A;  3QO2 A;  4P71 A;  4RAU C;  4TRD A;  2QEJ C;  3DEP A;  3BU2 A;  4RKB A;  4V0B A;  5CMD A;  1WJJ A;  3KK7 A;  5JAV A;  4LNQ A;  1JT8 A;  5E3F A;  4Z9C B;  1EYD A;  2OT2 A;  2QA4 A;  3H94 A;  3HRZ C;  3RLN A;  4KHP L;  3K5N A;  3ZJY C;  4QUC A;  3HOZ G;  2RDG A;  2EPB A;  5E4W C;  1XTC D;  1MBY A;  3Q0A A;  1K8M A;  3E9I A;  3HOW H;  4ZAI A;  3I4M B;  2CQA A;  5EPK A;  4C3I G;  1DOL A;  3CHB D;  1PTO H;  2L55 A;  1R9T B;  2PCF B;  5C44 B;  3H15 A;  1P8L A;  4OX9 Q;  4DXF A;  2NVX H;  2NVT B;  1Z7T A;  4DR6 L;  1NCV A;  4WJ3 M;  5IP9 H;  4CDC C;  1QB5 D;  4JOI C;  4DNR B;  1F2L A;  1Y1V B;  1B44 D;  1I4X A;  1TWF H;  3R93 A;  2NYZ D;  2BA0 A;  1H9S B;  3Q23 A;  4RGN A;  1HA5 A;  5IYB H;  1NE3 A;  1E2V A;  3JAM c;  3OHX C;  1G2T A;  1HRJ A;  5KYI A;  1FR3 A;  1STG A;  4MZ9 A;  1SJE D;  4A3F G;  4GKJ L;  2LXK A;  2SOB A;  3J7A V;  1KD1 C;  1ZYR D;  5AJ3 L;  3IFT A;  3SK6 A;  1SYC A;  2IJ0 A;  1TVX A;  5IGB A;  2UXC Q;  3BVG A;  1R4P B;  2TSS A;  2GVB A;  1I4G A;  4PQX A;  3IKJ A;  1EY0 A;  2F0J A;  4TSS A;  2ICI A; 
#chains in the Genus database with same CATH homology
 1G2S A;  2ENB A;  2X6G A;  2KUM A;  1PTO B;  1SNO A;  4QUF A;  5CV7 A;  2NVX B;  3A55 A;  1Y8O B;  4CJ1 B;  2F0W A;  4A3K B;  4FF2 A;  4XQJ A;  2L0C A;  1HXY D;  1WTX A;  4JK1 C;  2EY5 A;  2NN6 I;  3NXW A;  1HHV A;  1UNS A;  3S14 B;  5COY A;  1GUW A;  4DN4 M;  2L11 A;  2NTT A;  3MA2 B;  4L8J A;  1E0B A;  2F0E A;  3SHL A;  3PO3 B;  5EKI A;  5D14 A;  1ZEQ X;  4HAE A;  3BDL A;  2E76 C;  4KV6 A;  1HUN A;  4RCN A;  5EJW A;  2LMC B;  4KJN A;  4O42 A;  4BBR B;  1O7L A;  3VYT A;  1D6E C;  4FF3 A;  5M3F B;  3NHH A;  1BR9 A;  4K2K A;  4CJ2 C;  4OO1 G;  1VDZ A;  4R8I A;  3NTK A;  2F0O A;  3ZYY X;  1I6V C;  1NR4 A;  4LMQ D;  1EFI D;  4C3I B;  3S1N B;  3BVM A;  1TU2 B;  2AWO A;  4RH6 A;  1F9R A;  4KHV A;  1IKL A;  1OXT A;  5CR3 A;  4HMJ A;  3M85 A;  3HOW B;  5ISR A;  3I70 A;  2L4N A;  4YIJ A;  1SMY C;  3DHQ A;  1IYU A;  1EOT A;  1H9R A;  2WIN B;  3V2T A;  1SYF A;  3V05 A;  1NR2 A;  4RGM A;  3S15 B;  3L7Z C;  1HQR D;  4K5V A;  3OWF A;  4KI0 A;  1ML0 D;  2JSO A;  1O78 A;  5EKL A;  3DMU A;  2L9H A;  4G7H C;  2O2L D;  2K5D A;  3NTI A;  1FNU A;  2EJF C;  2HCC A;  2PPB C;  3GV3 A;  2O5I C;  2AQ3 B;  2F0K A;  3HZX A;  3TSS A;  4DFA A;  2JA8 B;  2EYJ A;  4KY6 A;  4TKO B;  2ZXP A;  4H7B A;  1JWM D;  3TBI B;  3W2D A;  1B4O A;  1U9R A;  2WV6 D;  4PV1 C;  4KY5 A;  1SMY D;  2WII B;  3N52 A;  3P7J A;  1TS4 A;  1OXU A;  3H3V C;  2EJG C;  2AUK A;  4H44 C;  5M5W B;  1FD7 D;  2RQX A;  1JOO A;  4RCO A;  4CHT B;  4XT3 B;  3JAM E;  3D4R A;  2JEB I;  4P2C B;  2PO4 A;  3MZ5 A;  4IUU A;  1SNQ A;  3WDN A;  3FKI B;  1LT6 D;  3X3M A;  3MXG A;  5IT9 L;  1Z47 A;  2QCP X;  4IUQ A;  2A68 C;  3K59 A;  1BBX C;  3P20 A;  3GQB A;  2M2L A;  5C3X A;  1EY6 A;  4DAY A;  3DWP A;  2B39 A;  3QIA A;  3LNN A;  1ONL A;  1TKW B;  3A8K E;  4XT1 B;  3SVM A;  1FNW A;  4KN4 C;  4TQU S;  1STB A;  1SE3 A;  5CBA E;  2KJX A;  5E4X A;  1TQO A;  2O4X A;  4FVM A;  3S1M B;  3IAY A;  1B53 A;  2F0F A;  3CQZ B;  2EYF A;  2R61 A;  1U4M A;  1PRT C;  3S1R B;  4IFD J;  2Z1C A;  3KLR A;  2F0M A;  3NQI A;  2J4X A;  3KUP A;  3SE0 A;  2K5W A;  2DN8 A;  4A3M B;  5IGF A;  4A3D B;  4KMU C;  4S3S A;  1Z6H A;  4PMW A;  2NUC A;  5IOC A;  3WOF A;  2DY7 A;  4FXG C;  2WP8 J;  1JC7 A;  4HR7 B;  1S4Z A;  4G7Z C;  4ZLT F;  2XWJ B;  2EY2 A;  1Y1W B;  1OO9 B;  3K5L A;  2KQ3 A;  2B8G A;  4F87 A;  3PO2 B;  2IL8 A;  4NW2 A;  1LAC A;  2F3W A;  3QG1 A;  1PRT D;  3A7L A;  4L63 B;  5C5M A;  4NMZ A;  2A6E D;  1PYW D;  3NPP A;  1BQQ T;  5C3E B;  3IFD A;  2JE6 I;  1EY5 A;  2MJ8 A;  4DGZ A;  1ET9 A;  1ESR A;  2BOS A;  3SR1 A;  5J1Z A;  2JEA I;  4XYO A;  1I3Q B;  4QF4 A;  2MP1 A;  4K6D A;  1U4L A;  3GTQ B;  3PIP 3;  5T1I A;  1V1P A;  4CKC A;  4G57 A;  2F0V A;  3OIQ A;  4F88 A;  2E2I B;  4N9T A;  4NP5 A;  1VMC A;  2F0U A;  1GOZ A;  1CQV A;  1JCK B;  1PFB A;  2KCC A;  1JOQ A;  3QB3 A;  2RA4 A;  4EGV A;  3EJI A;  3HOU B;  3I3C A;  5EPJ A;  3J81 E;  2E2J B;  3VR6 A;  1S5D D;  1IYV A;  1GUT A;  4CKB A;  2VB3 X;  1KDA A;  1B9M A;  2BCO A;  3QOL A;  2N55 A;  1RTO A;  5ELB A;  3K57 A;  2FJ2 A;  2K7V A;  4C3H B;  2HDL A;  3UI2 A;  5TSS A;  3CRL C;  1QWY A;  2NWG A;  4A3B B;  1CM9 A;  3A54 A;  3H09 A;  4DNT B;  1JQY D;  2IWH A;  3C2P A;  4IUV A;  4KKS A;  2G9D A;  2F0N A;  1PZI D;  2XVS A;  5C0X I;  3I90 A;  2KA7 A;  2Z4H A;  2KEC A;  1WTW A;  5KNC A;  3HOY B;  1EWC A;  1AP0 A;  1TWG B;  3FMC A;  1BXT A;  3NK9 A;  3T16 A;  3J7A F;  2EYH A;  2VUM B;  4DK0 A;  1KDB A;  4I65 A;  1L0Y B;  1LTS D;  3EQL C;  3D6C A;  2L12 A;  1II3 A;  4ZKB B;  2AQ1 B;  1CHP D;  1OXS C;  1SNM A;  2GA4 B;  1SND A;  5JPM C;  5ELE A;  1X3Q A;  3K5M A;  1C4Q A;  3P1H A;  1TS3 A;  5K36 G;  1NAP A;  5I9O A;  3G6J B;  2H1E A;  3S2D B;  1RCV D;  1PRT B;  3I8Z A;  3DWQ A;  1SE4 A;  1CZW A;  1F9Q A;  5BN4 A;  3M7G A;  1HFN A;  1BOS A;  2PZW A;  2K03 A;  1H9J A;  4IFD G;  3M3Y B;  3HOV B;  2JA6 B;  3GTJ B;  4BBS B;  3ND9 A;  1B50 A;  2JA5 B;  4X3T A;  4C1N I;  1UAP A;  2BDO A;  1KNA A;  3OOC A;  4X3K A;  5EQ0 A;  3AB9 A;  3I4L A;  4UAI A;  1C8C A;  1BCP F;  1KLG D;  2O5J C;  1LTT D;  4DA2 A;  1QG7 A;  2Q8R E;  3NTH A;  1W6J A;  2KOL A;  5A35 A;  2M00 A;  4A3I B;  2QKI C;  5I2Y A;  1HQM C;  2LFN A;  5K36 H;  3EA6 A;  3P75 A;  5D3D A;  5CYU A;  2F0I A;  4LK1 C;  3FPP A;  2QDB A;  1GHJ A;  2PW5 A;  1VF7 A;  5EBC A;  5IGC A;  3IL8 A;  2B2Y C;  4KN7 C;  4WOR A;  2PQE A;  2C9O A;  4FO2 A;  4CGY B;  3SK8 A;  3EVQ A;  1CT1 D;  2M9V A;  1GUG A;  2XRQ D;  4IFD H;  3F2U A;  1V1O A;  5IOD A;  1JOR A;  1D1K A;  3R3O A;  1TS5 A;  4IUR A;  4CBV A;  1ZXT A;  4XDX A;  2Z4I A;  1D5Z C;  2KVM A;  5FLX L;  1EIG A;  3BS1 A;  3NUC A;  1SSO A;  4IN3 A;  4I7Z C;  2FFK B;  3HG9 A;  4WJW A;  3VYS A;  1A3T A;  1DON A;  1TWF B;  2Q8I B;  2RDF A;  3NSW A;  3S17 B;  3MVV A;  3LX0 A;  4E6I A;  2LKV A;  4C3J G;  1LT4 D;  1BDO A;  1G91 A;  3FPU B;  1GHK A;  1D2B A;  2MPM A;  2AQ2 B;  3VR4 A;  2FIN B;  1JR0 D;  4OL7 A;  4C56 C;  3W3A A;  3BZD B;  2KCN A;  1D5X C;  5KYL A;  3A7A B;  3Q24 A;  4Q5V A;  3D6W A;  4H13 C;  4KJO A;  1VF5 C;  4QCL A;  2JXM B;  1A2T A;  2BA1 A;  4L6T B;  3HOZ B;  3K6O A;  2A69 C;  4U67 3;  5CGK A;  1JE4 A;  1G8Z D;  3T56 B;  5C4X B;  1O7Z A;  1K8O A;  1SE2 A;  4Y7N B;  1PFN A;  5EGT A;  1BCP C;  3X3N A;  4OGQ C;  2K05 A;  1IHZ A;  1STE A;  5BN3 A;  2IX0 A;  4BS9 A;  2B2Y A;  1Q12 A;  1VMP A;  4A3F B;  3L3O C;  3ONA B;  1LTI D;  4MIU A;  3C46 A;  1SDF A;  2R7Z B;  2Z8L A;  3DM1 A;  4EQO A;  4FNF A;  3S16 B;  3S1Q B;  2EY6 A;  4UDU C;  1TR5 A;  4IZ8 A;  5JOB A;  3OMC A;  2YYZ A;  2A69 D;  4ZRZ A;  4EQN A;  4EQP A;  2R92 B;  1Y8N B;  1G29 1;  2NBF A;  3Q6S A;  3ITP A;  1I4H A;  2F4I A;  3J80 E;  4OO1 H;  2F0P A;  1I4Q A;  5J39 A;  1AFP A;  1DCZ A;  3D4W A;  1RD9 D;  4K5W A;  2K32 A;  1CTM A;  4KKT A;  5E1F A;  5CC4 A;  5M5Y B;  2KEE A;  1SJH D;  3CRK C;  1WVL A;  5CV8 A;  1CQF A;  2XWB B;  4KHZ A;  4PMC A;  3AU7 A;  2DNC A;  4A93 B;  2BDN A;  5IGD A;  1WTR A;  5FOB B;  3BVZ A;  1O7Y A;  1W6K A;  4F8M A;  1I50 B;  1AZQ A;  4EVO A;  3CKI B;  1JWS D;  1OXV A;  3GV6 A;  3OMG A;  1DXM A;  3TZD A;  3S2H B;  1M4V A;  5KIX A;  2ID0 A;  4IAL A;  2EY1 A;  2G9H D;  1QIL A;  4ZUJ A;  1STN A;  4O1N A;  1PTO F;  1L0X B;  3GTO B;  3GTM B;  1H9M A;  2XSC A;  5T1G A;  1Q8I A;  5C3W A;  1JWU D;  2F0L A;  1U4R A;  1EU4 A;  2B2U C;  4ME5 A;  1KDC A;  1CA5 A;  1HA6 A;  1SYG A;  4FF1 A;  1KAA A;  3LWE A;  1WD1 A;  4B9X A;  2LY7 A;  2WAC A;  1VCI A;  3QJY A;  4KKU A;  2A68 D;  5LHY 1;  1V8Q A;  1EY4 A;  1TT2 A;  2ZXO A;  4MN3 A;  1GUS A;  4MHE A;  1C48 A;  2E75 C;  3HP3 A;  3V96 A;  3OW7 A;  3T13 A;  1LO5 D;  2F1M A;  4K8I A;  4K8J A;  4C1N K;  5FO8 B;  2D9U A;  1ENC A;  5DEH A;  3T53 B;  3GTG B;  1AW7 A;  4RWS C;  3MWY W;  4K2L A;  3MHB A;  1RTN A;  1YNN C;  1EL0 A;  4PMB A;  3VR3 A;  1XWE A;  2K5Q A;  2D5D A;  3OWE B;  4RFB A;  4V19 0;  4X3U A;  5IIF A;  4KK7 A;  2D62 A;  4ODG A;  4G7O C;  2RKS A;  4DXG A;  3PUY A;  3E0J A;  3JAM L;  4HSP A;  5IGG A;  5ELF A;  5F2D A;  4HN7 A;  2JA7 B;  5KEE A;  5C5L A;  1MGS A;  1AZP A;  3ERQ A;  1SYD A;  1EIH A;  3DEO A;  1Q90 A;  4FP5 D;  3K5O A;  1IW7 C;  1E2W A;  1H9K A;  4HCE A;  1YNN D;  2X69 A;  3MXP A;  1Q1E A;  1NUC A;  4FXD A;  4N9P A;  1SFO B;  4ZYS A;  3GO5 A;  1GJX A;  1M8A A;  2TMP A;  1EYA A;  3KBX A;  1PZK D;  1STH A;  5M9O A;  4ZQ3 A;  4XQN A;  1V43 A;  5A2Q E;  3K58 A;  3VR2 A;  4J8Q A;  4WRD A;  3WOE A;  2EYM A;  1CK1 A;  2VXW A;  1LTG D;  2A73 B;  4R8N A;  2B2U A;  3VYR A;  2I46 A;  2AUJ D;  4KY7 A;  2R93 B;  2A74 C;  2K6A A;  3NQT A;  1WTQ A;  1PTO C;  1Q3L A;  2JYO A;  1KLU D;  1SNC A;  2F0S A;  1S5F D;  3HKZ B;  1IL8 A;  3PUW A;  1PFM A;  3MXN A;  3I4N B;  1V1P B;  4OIJ A;  2NN6 G;  4BY1 B;  5HUR A;  1KAB A;  1I6H B;  1IKM A;  3NP8 A;  2EYL A;  4PNY A;  3HGB A;  1WTV A;  3RD4 A;  2NZ1 D;  2B8F A;  1AN8 A;  3TP5 A;  1D1I A;  3TP7 A;  5FK9 C;  2X6L A;  5KNB A;  4XXE A;  1BF4 A;  1SNP A;  1DZ1 A;  1DM0 B;  4XYQ A;  1TWA B;  2EXZ A;  2EZV A;  2HDM A;  3NBI A;  3FDT A;  5G3L F;  2E2D C;  2OF1 A;  3CU7 A;  1EZ8 A;  1E2Z A;  1XXG A;  4NKL A;  2RBM A;  4IQZ A;  1WD0 A;  1JB3 A;  3DXJ C;  3BYT B;  2PW7 A;  3RZO B;  2NB0 A;  4CJ0 B;  1TII D;  3SK4 A;  2CVR A;  3MEH A;  5KND A;  2SNM A;  4FXK C;  3SXH A;  1QCB D;  1H9S A;  1LLR D;  4DF7 A;  3D3R A;  2NN6 H;  1HTL D;  2VNU D;  1Y8P B;  2FHT A;  1EQT A;  1F2Y A;  5I6W A;  1XX8 A;  1LV9 A;  5J22 A;  2YU9 B;  1G6Z A;  4K14 A;  2IPK D;  1A3V A;  3K0Y A;  3PUX A;  3URY A;  3GTP B;  1BO0 A;  1SXT A;  1CI3 M;  2EYP A;  2PZT A;  3M4O B;  3OPO A;  2SEB D;  1ZYR C;  2IT1 A;  3MXU A;  1K83 B;  1EQV A;  3MC0 B;  3BG3 A;  3PMF A;  3U9O A;  3GD7 A;  3TN2 A;  1RHP A;  1A15 A;  1HUM A;  3BYY B;  5C0X J;  2HUG A;  1ROD A;  2B2V C;  1MI2 A;  3A8J E;  2FMC A;  4A3E B;  1MSH A;  5JVG 3;  5DAU A;  4Q0F A;  5EBD A;  1LTR D;  3I73 A;  2R6G A;  2B2W C;  1EY7 A;  3LWU A;  3L9A X;  1PZJ D;  2LS0 1;  3R8B A;  1GXD C;  4QMG A;  1EWH A;  4FYD A;  4OIK A;  3FRP B;  4J6H A;  2KHS A;  3EFX D;  5I4D A;  3QWN A;  1TS2 A;  3PV0 A;  4IUT A;  1UEA B;  1ENA A;  1CFM A;  3T51 B;  4K6L A;  1EEF D;  3HEJ A;  1J8I A;  2R3Z A;  2RSO A;  5M3M B;  1BNZ A;  2HQE A;  2K01 A;  5JJZ A;  3FEW X;  2N88 A;  4LAA A;  4XIG S;  2NTS A;  3M4Y A;  4IUP A;  2CHB D;  1PLF A;  1B1Z A;  2MHV A;  5I6Y A;  1CZG A;  3KF8 A;  2K28 A;  2V4D A;  5LL6 S;  3C1E A;  1SAP A;  2PMZ B;  2EE1 A;  1XYI A;  3J7Y W;  1EY8 A;  4RGO S;  1JOK A;  2E74 C;  3TZU A;  2ZXR A;  2I07 B;  4XTC S;  5D65 A;  5CBE E;  1TY2 A;  4RGT A;  2XNA C;  3H91 A;  5HGT A;  1D5M C;  5G3L D;  3KLS A;  1UUP A;  4U68 A;  2QIL A;  5I9P A;  1ILQ A;  3C3L A;  2CW0 C;  2EYO A;  1RF2 D;  3Q22 A;  5IT9 E;  1F2M A;  2F0G A;  4HTH A;  1FYC A;  1PRT F;  1I4P A;  4X3S A;  1T5E A;  4K5X A;  3I91 A;  1A6X A;  1GUO A;  3TME A;  3TDQ A;  3RZD B;  2L1B A;  2B2V A;  1B9N A;  4ULL A;  5KGU A;  2NVY B;  1T5X D;  2OXP A;  1F77 A;  3SEB A;  1ESF A;  4IFD I;  2IX3 A;  4A3G B;  2ICE C;  3SK5 A;  4B9W A;  2B2W A;  1LAB A;  2WKD A;  1CA6 A;  2RDH A;  1DD2 A;  5CV4 A;  1STY A;  2CW0 D;  2F03 A;  3OSO A;  1BCP D;  3ND8 A;  2FMM A;  5CV6 A;  2HCI A;  1BUV T;  2D2C C;  4C3J B;  1HCZ A;  2F0T A;  2F3V A;  3A56 A;  4IUN A;  1AEX A;  5JEA G;  4RHS A;  3PIO 3;  2KED A;  3MAQ A;  4CKE A;  4OHJ A;  2B2T C;  1X32 A;  2IW3 A;  3GP7 A;  1TWH B;  3MFG A;  1EYC A;  3G7L A;  4ABN A;  2EDG A;  2MUY A;  3N6R A;  3NWS A;  1GUN A;  5COR A;  1KTK A;  5C4J B;  2XN9 C;  5CV9 A;  3ERO A;  1S5B D;  2JP1 A;  1EY9 A;  3R2I A;  4ZK9 B;  4ID6 A;  5CV5 A;  2EJM A;  2NVQ B;  3HOX B;  3RUZ A;  5C0X G;  4M1U B;  3DWA A;  1LT3 D;  5EPL A;  3VR5 A;  1R4Q B;  2L5T A;  1SYB A;  1RDP D;  3GTK B;  4B08 A;  4DK1 A;  3D4D A;  4ZKC B;  1ZKO A;  1RJT A;  1HFG A;  1PMR A;  1TWC B;  1EU3 A;  3PUZ A;  1SYE A;  1QNK A;  2A6H C;  4BA1 I;  1I4R A;  1F9S A;  4FF4 A;  1Q1B A;  2DY8 A;  5JEA H;  1WCM B;  1S5C D;  2RVL A;  3KBG A;  3T4A C;  1X3P A;  2F0H A;  4BY7 B;  2A6E C;  2BE5 C;  3J80 L;  3TP8 A;  1A3U A;  1KNE A;  2RSN A;  4C3H G;  4HCS A;  4AYB B;  3GTL B;  3RMH A;  2AWN A;  2WB1 B;  1F9P A;  2VB2 X;  3VA5 A;  5FO9 B;  3O13 A;  1DJR D;  4OO1 I;  2A6H D;  1WTP A;  3SDZ A;  5M5X B;  1QOH A;  5C0X H;  2Y0S B;  4A3J B;  2DNE A;  1MD2 D;  5IGE A;  1ENF A;  2H4O A;  5ELC A;  1B3A A;  4WFN 3;  4KTA A;  5DNF A;  1BCP B;  1NSN S;  1STA A;  2B2T A;  3VA7 A;  2BE5 D;  4ZUI A;  5I2X A;  3VYU A;  2EOT A;  3M7N A;  1HPC A;  3OIP A;  1JIC A;  4RKL A;  5LL6 X;  3H0G B;  1HTP A;  1DOM A;  5JPN C;  4HMI A;  2K33 A;  2IX1 A;  2WAQ B;  1Y69 U;  3H6M A;  1OXX K;  2J7Z A;  4QIW B;  5C6A A;  5EKK A;  1SBB B;  1LT5 D;  1LTA D;  3DUZ A;  4ILW A;  3RLF A;  4NDX A;  4GZY C;  1A2U A;  4KD4 A;  1DYQ A;  1U4P A;  4QB4 A;  2C5C A;  5BN5 A;  5KRU A;  1B2T A;  1IW7 D;  3AMU A;  4F7X A;  4RHR A;  1ILP A;  4M8A A;  1QJO A;  1EZ6 A;  1RKN A;  4DAP A;  1CHQ D;  4DAV A;  2J0T D;  2F0Q A;  1SEB D;  1O80 A;  1ICW A;  5C4Z A;  1S5E D;  3TP6 A;  3MTS A;  1PXU A;  1ET6 A;  1YNJ C;  5DM7 3;  4G4K A;  4J1M A;  3FVQ A;  2PZU A;  3MFY A;  5K5P A;  3I72 A;  3KLS X;  5FO7 B;  4C2M B;  2A5H A;  3NBH A;  2SNS A;  5NUC A;  2Q8T A;  1TY0 A;  2E2H B;  4JBW A;  5ELD A;  1WTO A;  2WKC A;  3C1F A;  4BWG B;  5FKA C;  3BDO A;  1PTO D;  3A8I E;  5JVH 3;  4HED A;  4H0L C;  3QOJ A;  2K1B A;  4R9W A;  1YNJ D;  2QF7 A;  5D3I B;  4LJZ C;  4XQQ A;  2B63 B;  3U9S A;  2XIW A;  3K7A B;  2SDF A;  4DU9 A;  1FNV A;  2K04 A;  3E6Z X;  1J9O A;  4KD3 A;  4RA8 A;  4BA2 I;  5A2Q L;  5DM6 3;  3D31 A;  2EVB A;  1QNU A;  5AFW A;  1QE6 A;  5FLX E;  1LTB D;  1MSG A;  5C4H A;  3NWT A;  1EEI D;  1PDQ A;  2ZT9 C;  2PYK A;  3E5S A;  3J81 L;  2XRS D;  3D8G A;  3S9W A;  2PNR C;  2MGS A;  2OEO A;  3PUV A;  3R2T A;  3HS0 C;  4HSV A;  3BDC A;  5JEA J;  1FGB D;  3NE5 B;  2F0D A;  1DOK A;  1F2Z A;  3QO2 A;  4RAU C;  4TRD A;  2QEJ C;  3DEP A;  4RKB A;  5JAV A;  4V0B A;  5CMD A;  3KK7 A;  5E3F A;  4Z9C B;  1EYD A;  2OT2 A;  3H94 A;  3HRZ C;  3K5N A;  4QUC A;  2RDG A;  2EPB A;  5E4W C;  1XTC D;  1MBY A;  3Q0A A;  1K8M A;  3I4M B;  4ZAI A;  2CQA A;  5EPK A;  4C3I G;  1DOL A;  3CHB D;  1PTO H;  2L55 A;  1R9T B;  2PCF B;  5C44 B;  4DXF A;  2NVT B;  1Z7T A;  1NCV A;  1QB5 D;  4DNR B;  1F2L A;  1Y1V B;  1B44 D;  1I4X A;  3R93 A;  2NYZ D;  2BA0 A;  1H9S B;  3Q23 A;  4RGN A;  1HA5 A;  1E2V A;  3OHX C;  1G2T A;  1HRJ A;  5KYI A;  1FR3 A;  1STG A;  1SJE D;  2SOB A;  3J7A V;  1ZYR D;  3IFT A;  3SK6 A;  1SYC A;  2IJ0 A;  1TVX A;  5IGB A;  3BVG A;  1R4P B;  2TSS A;  1I4G A;  4PQX A;  3IKJ A;  1EY0 A;  2F0J A;  4TSS A;  2ICI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...