1JQYD

Heat-labile enterotoxin b-pentamer with ligand bmsc-0010
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords HEAT-LABILE ENTEROTOXIN B CHAIN
publication title Anchor-based design of improved cholera toxin and E. coli heat-labile enterotoxin receptor binding antagonists that display multiple binding modes.
pubmed doi rcsb
source organism Escherichia coli
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, L, M, N, O, P, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jqyD00
1S5BD 1SBBB 1PTOD 4L6TB 5FK9C 1PRTB 1G8ZD 4L63B 4TSSA 1LTTD 1PZID 2O2LD 1S5CD 1CK1A 3MFGA 2IPKD 1JR0D 1LT6D 1KLGD 2XRSD 1V1PA 4RGNA 2QEJC 3BZDB 1SE4A 2TSSA 1LTBD 4DXFA 1CQVA 5TSSA 1D5ZC 1FNWA 5ELDA 3BVZA 3SEBA 1SJHD 3EFXD 1RCVD 2RDHA 1RF2D 5I4DA 4RH6A 2XRQD 1TY0A 3GP7A 2G9HD 1CHPD 1GOZA 1I4QA 1L0XB 1EEFD 1PTOB 3BVMA 1LO5D 2XNAC 1XXGA 1LT3D 2CHBD 3BYTB 1PZJD 1EFID 1DYQA 2SEBD 3O13A 1BCPF 1SE2A 4BWGB 1F77A 1D5XC 1HXYD 4UDUC 1D5MC 1RDPD 3R2TA 1FGBD 3MC0B 1LLRD 1AN8A 4OHJA 1FD7D 1AW7A 1JWMD 1QILA 1V1OA 1S5FD 1LTGD 1I4PA 1SXTA 3CHBD 5ELFA 1I4GA 1DJRD 3OWEB 4O1NA 1I4HA 4RGTA 1JWUD 2AQ1B 2J4XA 2WV6D 4Z9CB 1PTOH 1RD9D 2ICIA 1M4VA 2RDGA 1LTAD 3BYYB 4RHSA 1JQYD 1HQRD 2R61A 1MD2D 1EU4A 1LTRD 3DWPA 1LT4D 3EA6A 1PTOF 1LT5D 1FNVA 1BXTA 1D6EC 1HA5A 1PRTF 2XN9C 3URYA 4RHRA 4ZYSA 2NTTA 4K6LA 5ELBA 1TY2A 4RCOA 1TS2A 1PZKD 1B1ZA 3DWAA 1LTSD 2NTSA 4RGMA 2Z8LA 1S5DD 3KLSX 2IJ0A 1L0YB 4DXGA 1BCPC 1JCKB 1I4RA 1KLUD 1I4XA 3W2DA 1EWCA 3BVGA 1ET6A 1HTLD 1KTKA 2QILA 2AQ2B 3R2IA 3R8BA 1B44D 1SJED 1V1PB 1CHQD 1EU3A 1SE3A 5ELEA 5FKAC 5D3DA 1PRTD 1BCPB 1XTCD 1T5XD 1S5ED 1FNUA 1BCPD 1JWSD 1TS3A 1ET9A 4C56C 1STEA 1LTID 3DWQA 5D3IB 1PTOC 3TSSA 1EEID 4RGOS 1CT1D 1TS4A 1UUPA 3V05A 1PRTC 1SEBD 1ESFA 2AQ3B 5ELCA 1PYWD 4RFBA 1UNSA 1ENFA 1TS5A
chains in the Genus database with same CATH superfamily
2IHFA 4DNIA 1VQLA 1NR4A 1A3UA 1VQ9A 2YYZA 3S15H 4HEDA 5M5XH 3TS0A 2F0IA 2IPKD 2CWPA 3D8GA 1Y1WG 3VDYA 3L0OA 2KA7A 2MQHA 1WYDA 2IHEA 3SEBA 1H9MA 4DR3Q 5ELNA 5J1ZA 5IE8A 1AEXA 4KI0A 3HOYH 1II3A 3DLLA 2E2DC 2CW0D 1LT3D 1PFNA 1VQOA 4KLKA 2OCEA 2ATWA 1DYQA 4NXMQ 1BCPF 4X66L 2F03A 2ID0A 5FLMH 3H94A 5IGBA 4DFAA 4IZ8A 4GNXA 4K0KL 3HOXH 4FDBA 1J5EL 1AH9A 1A3TA 4R4IA 3ULLA 2R7ZG 2CFMA 1K83B 3GD7A 4LMQD 4UHVA 3BDLA 1GUGA 3ERSX 3TZUA 1M4VA 2SDFA 1LTAD 4DK0A 1Q3LA 3MXPA 1X3QA 3MTSA 1GUSA 2HDMA 3FEWX 4KKUA 3ZYYX 1A2UA 3EQLC 5FO8B 3D6CA 1AE3A 1TIID 2A73B 4QL5A 4PG3A 4FXKC 3TMEA 1Y1VH 3MZ5A 1M1KC 3HP3A 1B50A 4C3JH 1DOKA 3K8AA 4HJ7A 4BBRG 2A1AA 3CC2A 1JJGA 3I90A 4KV6A 5FLMG 1JCKB 1KLUD 1PDQA 4JW0A 5IP7G 1YHAA 4YCUA 3HOXG 1SNQA 2KCMA 4QMGA 3T1YL 1FL0A 2EJFC 1D8LA 2TMPA 2SOBA 4G57A 2IX3A 5FKAC 1PH8A 5D3DA 2DNEA 4GKJL 5BR8L 4JI3L 3CKIB 1K8GA 3QOJA 1EZ6A 5EPLA 3K7AH 1HH2P 4FXDA 1QVFA 5KEEA 1RKNA 3PO3G 1Y1VG 3KBXA 2FINB 2L1BA 4R4QA 3H3VI 2PNHA 1EYDA 1HZ9A 3AYHB 3NUCA 1E1OA 4DV4Q 2AQ3B 2E8GA 4L5SA 4GN4B 1UNSA 3TQYA 3UE1A 3OIPA 5I9OA 3HRZC 5K36G 1PRTB 2BCOA 2A6ED 3OTOL 1PH7A 4DAVA 2O2LD 1CFMA 1KDBA 1TXYA 4H02A 2B63H 4DR6L 1NR2A 3U50C 4RCNA 3K5LA 2CW0C 3PUXA 3FVQA 4BY7B 1HTPA 4NXNL 4JI4Q 2KENA 4IUPA 1D5ZC 1XJVA 5C0XH 1H9JA 1U5KA 4UP8A 3PUWA 5M3MH 3G6JB 3K5OA 3I4LA 4B3RQ 1PTOB 4V190 4R9WA 3MXGA 5H1SE 1IYVA 3PGZA 3VR5A 2UXDQ 2PQAA 1HHVA 2EDGA 3O13A 1OXSC 1FGBD 2BA1A 4A3FB 4EVOA 3RN5A 2F0QA 1IBKL 2B63G 3I7FA 2WB1G 1Q8IA 1LUZA 3S17H 1A63A 1V1QA 2CQAA 4LNQA 5BN5A 2ZTDA 1VF7A 1D1KA 3J7A5 2NZOA 3K5MA 3GV6A 3BYYB 4RHSA 4IQZA 5C4HA 4X62Q 3NTHA 1N36L 1VQCA 1LTRD 3U4VA 3OSOA 1PTOF 3PO2B 1PYSB 1OXVA 3G48A 5M5WB 3RZDH 5IP9H 4CJ1B 4G7OC 1STHA 1PZKD 1DONA 3MXNA 4M8AA 2RSNA 1Z7TA 3KLSX 5HY6A 4GKKL 1WTRA 1NMGA 4DR7L 1QOHA 1V43A 4O0AA 1KDAA 4DUYQ 4YWLA 1HTLD 1K8MA 3CRLC 3HOYB 4IFDH 3AU7A 3EN2A 2I46A 2IT1A 4LUOA 1NY4A 5ELEA 3C2PA 1NUCA 3KYHC 4NW2A 1FR3A 4XDXA 5GAGC 1SRUA 1O7IA 3NWTA 4AYBE 1R9TH 4RWSC 1L0WA 1ET9A 2MUYA 4FF2A 3NE5B 3J7AF 1SAPA 3OHXC 5IP9G 4LFAQ 2BA0A 2A6EC 4K2LA 1XYIA 1EY8A 1SYEA 3TP5A 3ERQA 2XVSA 2FJ2A 3FDTA 4DV1Q 1B3AA 4YY3Q 3J7ZC 4YWKA 4YCWA 1ESFA 3E0EA 1C0AA 2HUGA 1E3PA 5LL6X 2VB3X 3ITPA 1PHJA 3HOVH 4HR7B 2VW9A 3K57A 4JV5Q 2GN5A 2QCPX 1ML0D 2Q2HA 2H1EA 2NVXH 4QB4A 5EKKA 1F9PA 1H95A 4CDCC 5E4XA 3S1NB 5DEHA 4A3BB 2E2JH 5KYLA 1F2YA 3MXUA 1WTXA 1SNMA 2QKIC 4DR2Q 4ZQ3A 2Z6BA 5E3FA 2E2HH 1I4QA 1XNRL 2UUAQ 4LWCA 2AWOA 1BQQT 2K01A 2R92H 5KIXA 4V0BA 3M4YA 1HZAA 3QWNA 1HJPA 2SEBD 1OXXK 4J15A 4NKLA 3K7AB 5C44G 4LF4L 3UDIA 4BBSH 3GTJH 2EYFA 2ZXRA 3UDXA 1Q81C 4GOPB 4A3KH 3DEPA 3EROA 3PF5A 3BJUA 1E24A 3P1HA 1IBLL 3ER0A 3C46A 1JQYD 3NK9A 1YIJA 1C9OA 4CBVA 1HR0Q 1L1OC 1X3GA 1RTOA 1KRSA 4OIJA 1EIFA 4X3SA 4ID6A 2D5DA 1UEAB 3KLRA 4ZAIA 5CORA 4ZKCB 2NWGA 1IBMQ 4IOCA 2WAQB 3A8JE 2B2UC 4P73A 1BVSA 3CW2C 5JVH3 2B2VC 2EOTA 2D0OA 2QW7A 3HOWG 3CU7A 4BS9A 4DV6L 1HNXQ 5M3MB 4FNFA 2EYPA 2K7VA 4NDXA 4ME5A 2UU9L 4RA8A 4JPBW 3G71A 4HIDA 4A3EB 2PMZB 4OWTB 3I55A 1BCPD 4LF6L 2YTYA 4C1NI 4HN7A 1Q12A 1R4QB 1PYBA 5CV5A 4LF7L 4WFN3 1MJCA 4DNTB 2K5QA 1F9RA 4GLXA 1F2MA 3KFUA 2F0WA 1ENFA 2EY2A 1S5BD 1WOCA 1PH4A 2ZJQA 1G8ZD 3H15A 5KNBA 3NENA 4WJWA 3B6YA 5IYDG 3FKIB 2PW5A 1YBYA 4QY7A 1JR0D 1DGSA 4HIKA 3KF8B 2VQEL 3AFQA 3G7LA 5DM63 2UXBL 2F3IA 5C3EH 4QF4A 4CJ2C 3R3OA 3PUYA 4A3LH 4DV3Q 1WTWA 4DR4Q 1AFPA 1SLJA 2MGSA 4PMBA 4XYQA 3BVMA 1G2SA 2VB2X 4LFCL 1L1OA 3SE0A 4FF3A 3VYUA 1UEBA 4XYOA 4LF9L 1BBXC 5JAVA 2NVTH 1AN8A 1SXTA 2LXKA 2ES2A 2B2UA 5ELOA 4JI1Q 2RBMA 2B2VA 4DK6C 2Y0SB 3PCOB 4P2CB 5M5YH 4L5RC 1TR5A 4AQYQ 2F52A 5FO7B 3CXCA 1XWEA 2EYMA 4J1MA 1Q1BA 4B3TQ 1Q82C 1SMXA 4EGVA 2JA5G 4A3DH 3KDFA 4WJ4A 4K6LA 5IYBG 4AIMA 3M9BA 1XMQQ 2A74C 1EQVA 4JI6L 3GTGH 3MHBA 1VCIA 1HA6A 1L0YB 1HCZA 4JC0A 3I56A 3AEVA 4JYAL 2E2JB 1BCPC 1GD7A 1SR3A 3GDEA 3CPWA 2PI2E 1WJJA 4PZ7A 3R8BA 2MFIA 3I4NG 1WVLA 5FOBB 1ZEQX 1SE3A 4CKEA 3BS1A 3QJYA 5EPKA 1GXDC 2R92B 1PRTD 2UUCL 1XTCD 1MIUA 1S5ED 5LMNQ 2FHTA 5I2YA 3NEMA 1EFWA 1MSHA 4ZUJA 4S3SA 3ICEA 4QUCA 2F0HA 3GTMH 2G5DA 3DWQA 1EEID 5AJ3L 4EQPA 1UUPA 2JXMB 2OF1A 1BNZA 1K73C 5C0XJ 5IODA 4IOAA 2UUBQ 1JE4A 1AZPA 1NCVA 1I3QH 4HJ9A 3VA5A 5LL6S 5M3FG 1PTOD 2YU9H 1VQIA 1LTLA 4JVZA 4POFA 1U4RA 1PZID 2B2WC 4ODGA 3GTQH 4OX9Q 2FFKB 3QG1A 1DOMA 1LYLA 3RMHA 4RGNA 3CC7A 3MAQA 3CPFA 1PH1A 1VMCA 4LF5Q 4OONA 1BDOA 2BDNA 4A3GH 3MEHA 1QVCA 5GADC 1HNZL 1RF2D 3WOFA 2RCNA 3BZKA 4C3IH 2CKZB 2K5VA 3EBEA 1X3PA 2RDFA 4DV2L 4TKOB 2K5WA 4IPCA 3E5SA 5LMUL 2R93H 4KK7A 2M00A 1D5MC 4JG2A 1LLRD 1RODA 1XPRA 3H6MA 1FD7D 3BDCA 1EWIA 3TEHB 1IYJB 3CHBD 3S2HB 4YIJA 2RHQB 4ZK9B 1W3SA 4DV0L 2PCFB 1LACA 4DNRB 4OGQC 1E2VA 2A69D 3S24A 4KHPQ 5T1GA 1CSQA 3TP7A 5IGGA 4IFDJ 1FNVA 3VR6A 1RJTA 5FLXc 1IYUA 2D62A 3F8TA 4F7XA 3S16H 4LF8Q 1QNUA 2HHHQ 5FO9B 2F1MA 4A3MB 1TWHB 4K14A 4CKCA 4C3HB 1K3RA 3W2DA 4N9TA 3UI2A 1BUVT 2NBFA 2Z0SA 5IT9c 1EIYB 3GQBA 3K5NA 2WACA 1YJWA 1SJED 3RUZA 3K7UC 1SNCA 1D2BA 1SSOA 1EY4A 1UAPA 2B2WA 4ZKBB 4JI5L 2KQ3A 2B8FA 3I4MG 1L2FA 1ESRA 1KAAA 3OW7A 4RKLA 4HJAA 1PTOC 4DGZA 1IL8A 5HGQA 2QGQA 2F0VA 2MHVA 3SXHA 2O4XA 3SVMA 1JE5A 4K5VA 1JJCB 3CCUA 4DPGA 1XTDA 4RCOA 2Z6KA 2NVYB 1TWFH 1JMCA 3QOLA 3M7GA 1U9RA 4OL7A 1J6QA 3IL8A 1I94L 3PUVA 2A5HA 3P75A 2K5DA 4A3DB 1JOKA 3S1MB 2F0GA 3H3VH 2O5JC 2X6LA 2AKWB 2EQSA 4DR6Q 1B2TA 4GZYC 1G291 3BZDB 4KD3A 3GTGB 4BY1B 1TWCH 1G91A 3TDQA 1GHKA 3PIP3 2XIWA 3G6EA 1WD1A 1VDZA 4MHEA 1LO5D 4JBKA 2K1BA 2DJFC 1IL2A 2VUMH 4FYDA 1NAPA 4PMWA 1EYCA 4JBJA 4AYBB 1GKHA 1TU2B 2A69C 1DCZA 2K05A 4FVMA 3J81L 4K2KA 2R7ZH 1JWMD 4LAAA 1AE2A 1S3OA 2EYOA 3K81C 3T53B 2ZJRA 3T13A 3IFTA 1X3EA 1KL9A 1VQHA 3X3NA 1XMOL 2WV6D 4Z9CB 5C5LA 2JA6H 1N32L 2NUCA 4LUVA 3J81c 5J22A 2NVQH 4HCSA 4X64L 1K8AC 2FMCA 2YU9B 2KJXA 3OPOA 5C4XB 3FP9A 4K6DA 2IW3A 2XN9C 4O2DA 4JI8L 1ZYRD 3T1HL 1NTGA 1EQRA 5CR3A 4A93B 4BBRH 2F4VQ 5CV4A 2VUMG 5C4JB 4OXPA 4A3FG 1BF4A 4KMUC 5IP7H 2CWAA 2JA8B 5KGUA 1CSPA 1BO0A 1ONLA 1CKOA 2EE1A 2KCTA 1STAA 2EYLA 3HKZG 3P20A 3X3MA 2WKDA 1V1PB 2QF7A 3RZOH 4LUZA 3PUZA 3U9SA 3WWVA 1PH9A 4XQNA 3TP8A 2JA6G 4CHTB 5JEAG 4R8IA 3I72A 1K0RA 2JQOA 2KHSA 3PO3H 4DV7L 4H0LC 4OWXB 4DUZL 5D3IB 1PMRA 2F0NA 3E9IA 2F3VA 2RQXA 2PPBC 5CV6A 3SK6A 4NP5A 4IPGA 1HNWQ 3SDZA 1E7ZA 4WORA 5K36H 2DGYA 4FP5D 3CCQA 2B8GA 4A3JB 3M4QA 1B70B 4LFBL 1FVIA 2R7DA 3CCLA 1W6JA 3M4OH 4GOPC 3S16B 1Q90A 1KLGD 1I6VC 1NNXA 1X6OA 3MVVA 1T5EA 1YHBA 5TSSA 2MJ8A 1FNWA 2EJMA 2JEBI 3BVZA 3L7ZC 4DK1A 1U4PA 3M3YB 1UE1A 1EY9A 4A3IB 4U68A 5IWAQ 3GP7A 4JI2L 2K03A 3TREA 4J6HA 2CHBD 4DR5L 3KK7A 4HAEA 1M8AA 2ALYB 2WKCA 4JCVE 3S2DB 1SE2A 4ME3A 1CA6A 1I5FA 1WCMG 2IL8A 3BZCA 3W1GA 1Z6HA 3OW2A 4OWWB 2K28A 1B9MA 5JJKA 2L55A 4HSVA 1EY5A 1I4HA 1NE3A 1ZYRC 3A54A 2OWOA 1KIXA 3VR4A 1RD9D 3CCRA 4DR1Q 4EQOA 1HQRD 1SMYD 2UXCL 4KJOA 3ULJA 1PRTF 1VQKA 2V4DA 1Y1WB 2NTTA 4HMJA 1B1ZA 4YHHL 4XQQA 1STYA 1S5DD 1HFNA 4B3MQ 3OOCA 3TN2A 1M90C 5CV7A 1TWGB 5J3BA 4POGA 2X69A 4PMCA 4K8IA 1EL0A 1DM0B 4G7ZC 1CHQD 1EU3A 2BE5D 5EGTA 1JC7A 3RLNA 4FF1A 4GOPA 1U0LA 1R4PB 1T5XD 4Y52H 1Y14B 4B3SL 3VR2A 5IGFA 1HFGA 1JORA 3S15B 5M5XB 3RD4A 5ISRA 1O78A 4DR3L 1S72A 1GUNA 2R7ZB 1TS4A 4R8NA 1HPCA 1KAWA 4X3KA 4ALPA 3NBHA 2PZWA 3F2CA 4NXML 2J7ZA 5FK9C 3KLWA 2PYKA 3SK5A 3CCMA 2NVQB 3F2UA 1LTTD 1S5CD 1Q1EA 4RG1A 4G4KA 4A3EG 4JI7Q 5EKIA 1X9NA 1GUOA 2M2LA 4Q0FA 5DAUA 2QA4A 1SE4A 1E22A 3NTKA 1VQMA 1HQMC 1QG7A 2VY3A 4ZCKA 3HOXB 2WFWA 2XWBB 3EFXD 2D9UA 4RH6A 2XRQD 1MJEA 3H91A 5GROA 3J81j 1EY7A 5M9OA 3TBIB 1GM5A 1A8VA 2B2YC 1ENCA 4DAYB 3CAMA 3WDNA 5C44H 2RHSB 1D5XC 1A15A 2P5ZX 4JBWA 4X65Q 4B08A 1W2BA 2NN6I 3FKIG 1Y1VB 4KHVA 2F0JA 3PIO3 3K58A 1HUMA 3FRPB 1SMYC 1I50H 3OMCA 4C3JB 2MNAA 1I4GA 3OWEB 4M1UB 1B3QA 5CYUA 1IW7D 3KF8A 4QGUA 1YVCA 2PO4A 1PH3A 2RF4A 3J81i 4QCLA 2LY7A 1N34Q 1BXTA 2D2CC 5JPMC 2WINB 3U9OA 1JT8A 4C2MH 2VQFQ 1SFOH 5BN4A 2BE5C 2BOSA 4DV4L 2L15A 3HOWH 2EVBA 4A3CH 2V1CC 2WP8J 1N33Q 3WOEA 2K04A 5BN3A 2QILA 3CP0A 2AQ2B 3HS0C 3H09A 5A2QL 5AFWA 1KRTA 2ASBA 3RN2A 1CUKA 1QUQB 4R4OA 4JI4L 2AUKA 3DM1A 3A8IE 5DNFA 4U673 2B63B 2C35B 4L8JA 3CD6A 2PZUA 4ULLA 4IPDA 1YJ9A 3JAML 4B3RL 3SK4A 4MN3A 3H0GH 1PYWD 1OXUA 4A3CG 3MXNB 3GTPH 2B29A 3JAMc 2B2YA 5KNDA 5IYDH 4L63B 3D4DA 1MGSA 4ZRZA 1CK1A 2HIVA 3S1QH 4R1JA 2F3WA 2R6GA 5FLXE 1ZXTA 5T1IA 1MKHA 3NBIA 5EKLA 4KKTA 3S17B 4X62L 2GVBA 2N49A 2HCCA 2JJQA 5I4DA 3EJIA 1E2WA 2OEOA 1F9QA 5EQ0A 1JB7A 1QVGA 2K75A 2B39A 2ZT9C 3CRKC 1XXGA 3H0GG 4IO9A 3GTKH 3A8KE 1PZJD 2YTVA 5IT9E 1NBWA 2DY7A 2N3SA 1H9SB 2CH4W 2L5TA 1IW7C 3RZDB 4J8QA 2JK8A 2OTJA 1BR9A 1OO9B 2DY8A 1K28A 3RNUA 1V1OA 1P16A 4DUYL 1I4PA 1IHZA 2K32A 2G9DA 4QUFA 3KOJA 4RGTA 1D1IA 3HG9A 2E5LQ 4KKSA 3IKJA 2R61A 1SE8A 2JA5H 1LT5D 3IRBA 1EOVA 4ZYSA 5IYBH 2EXZA 4LFAL 1XNQQ 5IOCA 4DV5L 2A19A 3S1RH 4TVAB 2AHOB 3T56B 2PZTA 1R9TB 1BBWA 1YHQA 2L9HA 2DJGC 3N6RA 3W5OA 4DXGA 1TVXA 4JI0Q 3J7AV 3HKZE 1C48A 3I4NH 3KF6B 3A7LA 2LS01 2F0EA 3KBGA 2C9OA 3HOZG 2K33A 3NSWA 2Z1CA 4JV5L 1SN8A 1VF5C 4EX5A 1X3FA 3HOUH 3HOVB 3GTOH 2EPBA 4XT1B 2JA7H 4DK3C 3DHQA 1JB3A 5I2XA 2NVXB 3V96A 3SHLA 4DR2L 2LFNA 1I50B 3E3XA 1BOSA 4X3TA 1ILQA 2UUAL 4A75A 1SNDA 5IGDA 4C3HG 4H13C 1VQJA 2FXQA 5M3FH 1WFQA 4UY8C 1VQ5A 1RIPA 1DZ1A 1HZCA 3EIVA 2ZM6L 1H9RA 2I0QA 3G4SA 2E2HB 3W1BA 2ZJPA 1I6HH 4RKBA 3K0YA 1QWYA 1TWAH 3GO5A 4GN5A 1LT6D 2OXPA 3HOUG 1HUNA 2OQKA 1GO3E 1O7LA 2JA7G 1LV9A 4BBSB 5K5PA 3GTJB 4RMFA 1N8RC 3U58A 1B8AA 2A68D 2RCFA 1FJGQ 4IUTA 3HOWB 3FHWA 4TRDA 2F0UA 1E1TA 5I6WA 2G9HD 3I2ZA 3J80L 4A3KB 1HR0L 2JEAI 3NPPA 4IUUA 4YCVA 4OO1G 1B53A 4JK1C 5COYA 3BYTB 2JN4A 1KXLA 4N8FA 4NMZA 4BWGB 3T51B 4K5WA 3J80c 1IBML 1GUTA 4OHJA 1QILA 3R93A 2JP1A 5EBDA 3A74A 3NTIA 3CF5A 2ZXOA 5EJWA 1HNXL 3J7YW 3F1ZA 1TKWB 3I8ZA 5E7NA 3A0JA 3EA6A 2JA9A 2Z6KC 1HA5A 3ND9A 2VNUD 1EY0A 1S40A 2WIIB 4O42A 2L11A 3S1QB 5CV9A 2WB1E 4KD4A 4X66Q 4RGMA 1K83H 3GV3A 4UAIA 2IJ0A 2E76C 4E6IA 4LW1A 2Q2TA 3L2PA 2XWJB 3VA7A 1PH6A 4K0KQ 1VQFA 1J5EQ 2HQEA 2SNSA 3I4MH 3OYYA 4X3UA 1C4QA 3Q23A 2B2TC 4K8JA 2VZAA 4L5TA 1SYGA 5C4XG 1B7YB 1JWSD 1OXTA 1G51A 1ASZA 1WD0A 4A93G 5CBEE 4MTKA 1A62A 2K4KA 3DM3A 4DV3L 1PRTC 2NZHA 5KNCA 5FJ8G 4DR4L 4BXXG 3ULPA 5C3EB 2EZVA 3KDFB 1KC8C 3K0XA 2RA4A 4RFBA 1T9HA 4OO1I 3C1FA 3C3LA 4QQBX 4ABNA 3JAMi 2A68C 3PSIA 2YTXA 3NHHA 3T1YQ 4IN3A 4K5XA 3TZDA 3PF4A 2I5LX 2HCIA 3AQQA 1V1PA 4C1NK 4QJFA 4JI1L 4HSPA 5BR8Q 4JI3Q 4GKJQ 2NVTB 4AQYL 2K5NA 1SJHD 3Q24A 1JJ2A 1RHPA 1MSGA 4B3TL 3D31A 5M5YB 3DMUA 2F0SA 1L0XB 2R3ZA 2Q2IA 4A3JG 1SYDA 3KLSA 1EFID 2C5CA 3PMFA 3C1EA 1XMQL 1EQTA 3GTOB 1MHWC 3A55A 1CKMA 4DR5Q 4BY7H 1E2ZA 3OTOQ 4MTNA 1STBA 4RAUC 3P7JA 2BH8A 4NXNQ 1QJOA 5EPJA 1PFSA 2VS1A 1PTOH 2ICIA 5M3FB 4A3IG 3AB9A 2F0PA 1EIGA 1K3BC 4HTHA 5LMNL 2B2TA 1WTPA 4IUNA 4IUVA 2KECA 1QZHA 1I6HB 5JJLA 1KQSA 3QR8A 1IXRA 4A3FH 1SYFA 2ZTEA 1IKLA 3T16A 2QDLA 3GTMB 4BY7G 2HQLA 2UUBL 5E1FA 1IBKQ 1GHJA 1TT2A 4F8MA 1ET6A 1KTKA 1XPOA 1AZQA 1IZ6A 3CMEA 5M5WH 3K59A 1PXUA 5JEAH 4OX9L 1I3QB 1IKMA 3QB3A 1MBYA 1BCPB 4N8X1 1Q46A 4DF7A 1N36Q 3SK8A 3LWUA 4LF5L 1K0SA 3GTQB 4HJ8A 4OIKA 5I6YA 4HIMA 4RGOS 4QIWE 4B3SQ 3UDFA 1JOQA 1PFBA 1SEBD 4DAPA 4A3GB 4GKKQ 5JJZA 2L0CA 5HURA 4DR7Q 3T4AC 1Y8OB 2KOLA 4C3IB 1YNXA 2EY6A 4DKAC 4BA2I 1Q7YC 3PO2G 2MO1A 3CCSA 5IIFA 1ASYA 2AMCB 1KNEA 1F9SA 2R93B 2KBNA 4IPHA 2XRSD 4IUQA 4R4TA 1WTOA 1EZ8A 2J0TD 2OT2A 2KUMA 4NB3A 2N88A 4KHPL 4HIOA 2Q8RE 3ONAB 4MNOA 1UE6A 3DUZA 1QE6A 1CHPD 4H44C 1DD2A 4LJZC 2BH2A 3HFZB 4LF8L 3HOYG 3I4MB 2HHHL 5NUCA 1WCMH 4P75A 5JJIA 1B9NA 3S1NH 4A3BH 3R2TA 2RKSA 2LSSA 3J80i 2EY1A 1CA5A 1BKBA 4CGYB 3MWYW 1CKNB 1CI3M 4KN7C 4OELB 1F2ZA 4O1NA 5A2QE 3BG3A 3PQIA 1S4ZA 1C7YA 2OQ0A 3D6WA 2XTIA 3K6OA 1XX8A 1QCBD 1G2TA 1D6EC 5CBAE 2NN6H 1XNRQ 1DXMA 5IYCH 2PI2A 2X6GA 2LXJA 3HKSA 2GVAA 4A4IA 4FXGC 4XXEA 3JAME 3EVQA 1TY2A 1TS2A 2A6HD 4XQJA 1LTSD 1QNKA 2L4NA 4NPSA 2ENBA 2M9VA 4DAYA 4A3BG 4C3JG 3A5UA 1BBUA 1I4XA 3MEFA 4LF4Q 4ZLTF 2JYOA 2ZTCA 3CCEA 4G7HC 1N9WA 4IJLA 1YZ6A 1VQ6A 1NJIC 1TWFB 2B3GA 1IBLQ 5DM73 1FNUA 3S9WA 1PH5A 1A2TA 1EYAA 2NN6G 2HD3A 5IYCG 2SNMA 2DUDA 3V05A 4IJHA 1UWVA 3Q8DA 1VS0A 2HIXA 2KCNA 1TWCB 3M7NA 4F88A 1EIHA 4KN4C 2F0KA 2HDLA 4PZ6A 1GUWA 1A3VA 4CDEC 4A3EH 4GNXB 1Z9FA 3NP8A 4DV6Q 3RLFA 4B9WA 3NQTA 2N78A 3MFYA 2UU9Q 2VUMB 3MFGA 1VQPA 4WJ3M 5EAYA 5J39A 1W6KA 2Q8IB 4AH6A 2E75C 4LF6Q 2TSSA 4GN3B 1QUQA 3HKZB 3Q0AA 3GTLH 2WAQG 2XGTA 4LF7Q 3FPPA 4UPAA 4XIGS 1CZWA 5C0XG 1YEZA 3RLOA 2I07B 2JA6B 3L9AX 5M3MG 1WTVA 2F4VL 4PV1C 3FKIH 3F2DA 4KY5A 2FMMA 4DAMA 1F77A 1PLFA 3CCJA 1EY6A 3MC0B 1NMFA 4BBRB 5L37A 5G3LF 3LNNA 3RR5A 4HJ5A 3I4OA 2VQEQ 4CDDC 2F0DA 2UXBQ 5I9PA 2LKVA 2A6HC 5D65A 2MPMA 3LX0A 2F0MA 1EU4A 2Q8TA 3I91A 1G6ZA 3RZOB 3FPUB 2IWHA 5CGKA 5EBCA 5CMDA 4RHRA 4LFCQ 1VQAA 3BU2A 2Q2UA 4P74A 1PVOA 3PO3B 3BDOA 3DWAA 4Q5VA 4DV5Q 1HNWL 3CCVA 2Z8LA 4LF9Q 1H9SA 1YJNA 1KNAA 3CQZH 1EWCA 5E4WC 1U4MA 2ICEC 3V2TA 3R2IA 1LM0A 2ZXPA 4APVA 1B44D 3I73A 3PIPA 1SNPA 2N55A 1SYCA 4IFDG 1VQDA 3AFPA 2KVMA 1WCMB 3L3OC 1SDFA 1KD1C 3M4OB 2MO0A 1TS3A 1STEA 2LMCB 1LTID 2MP1A 1KHIA 5JOBA 5IWAL 3J80E 2F0LA 1YNJD 2Z4IA 2IX0A 1VQ7A 2PQAB 4JI6Q 3I70A 2N8NA 5C0XI 4JYAQ 2Y0SG 3D3RA 1E0BA 2I5HA 4C56C 4EQNA 4IALA 1VMPA 4L6TB 3OMGA 2AWNA 2F0OA 4TSSA 2ZM6Q 4GS3A 1KDCA 3KF6A 3HOVG 1EWHA 2F0FA 2UUCQ 3HEJA 1X32A 3KUPA 3Q6SA 1H9KA 2WB1B 4R4CA 1A6XA 1LTBD 3S14H 3ND8A 4HMIA 4DR1L 4H7BA 1CTMA 2RDHA 5AJ3Q 1O7ZA 2DN8A 4KTAA 1Q86C 2UXDL 3MA2B 2K52A 5C3WA 1LABA 3NBHB 2EIFA 2R92G 4B3ML 1JOOA 1J9OA 2D0PA 3VR3A 2KEEA 1ENAA 3KJPA 1S5FD 2EYJA 1DJRD 1FYCA 4BBSG 2Z4HA 1JWUD 2AQ1B 2K14A 2QEXA 4EQ5A 4A3KG 1HNZQ 1UE5A 1MD2D 3DXJC 1XPUA 1LT4D 3VYTA 1PA6A 3I3CA 4FO2A 5JEAJ 4IFDI 3HZXA 1DOLA 3ZJYC 4DV2Q 5GAEC 1B4OA 1KABA 5LMUQ 3S2HH 2F0TA 1I4RA 4KHZA 4KJNA 3HOZH 4B9XA 3GTLB 1HR0W 4DV0Q 3D0FA 2E2IH 4X6AH 4JI7L 2K50A 4CJ0B 1YNJC 1SNOA 2XSCA 3TS2A 4A3MH 1TWHH 2F4IA 1VQBA 2OTLA 5GAHC 4DV1L 5JVG3 4YY3L 2IX1A 4C3HH 3VYSA 3F2BA 1A0IA 1VQGA 1HZBA 3SR1A 4UP7A 3FMCA 1MI2A 2E74C 5KYIA 1GJXA 4JBMA 1SBBB 4MZ9A 4YWMA 4Y7NH 4JOIC 1WI5A 1JICA 4X65L 3QO2A 4PQXA 1ICWA 3LWEA 1EYGA 1VQNA 5C44B 1P8LA 4JI5Q 4BA1I 2CCZA 4DXFA 3IAYA 2KHJA 4A3MG 4I65A 5ELDA 1WTHA 3CQZB 4OO1H 3OIQA 1VQEA 5C3EG 1YI2A 1N34L 2NVYH 2GA4B 2O5IC 4A3LG 5KRUA 2XNAC 1C8CA 2VQFL 1K8OA 1UE7A 2NZ1D 5D14A 3S1MH 4DN4M 3J81E 1V8QA 2CVRA 1HXYD 2JSOA 4DU9A 4C2MB 1RDPD 1ICFB 3Q22A 3CC4A 1YNND 3JC66 2EY5A 1SFOB 4QIWB 1I94Q 4BY1H 3STBD 5C6AA 1N33L 1LTGD 2VL6A 1WTQA 5ELFA 1O80A 4P71A 3E6ZX 1K9MC 4ILWA 3M85A 2RDGA 2EYHA 5CV8A 1F2LA 1RL2A 5IGEA 5LHY1 3VYRA 1X65A 1YITA 3U4ZA 1V9PA 2IY5B 4I7ZC 4A3DG 5CC4A 3A5ZB 5C4ZA 3K80C 1ZKOA 3S14B 3NELA 4LK1C 4BY1G 3PV0A 5IGCA 4IURA 2NYZD 3H0GB 3AMUA 2RSOA 2RVLA 4JOIA 5C4XH 1QB5D 1XMOQ 3GTPB 1X54A 3E0JA 1N32Q 4I7AA 1PV4A 4A93H 2R7FA 4X64Q 1D7QA 5C4JH 1STNA 4AYBG 5FJ8H 4A76A 4HCEA 4BXXH 4JI8Q 3T1HQ 2JA8H 5G3LD 4N9PA 4CDFC 1L1OB 3PIOA 2PNRC 3M4PA 2HT1A 5ELCA 1EQQA 1TS5A 2DNCA 5LMNW 3D4WA 1X56A 3UDGA 1PFMA 3A56A 1HRJA 3GTKB 4GLVB 1X55A 3OWFA 2QDBA 3UE0A 4P72A 5C5MA 4UP9A 2QEJC 2I5MX 4DV7Q 1CQVA 5FLXL 1Y8PB 4OEMB 2E5LL 1NSNS 2WAQE 4KY6A 4DUZQ 1STGA 1RCVD 1J8IA 4XTCS 2JA8G 3HOZB 4A3JH 1TY0A 1YNNC 1GOZA 4PNYA 4A3GG 3STBC 1EEFD 1EUJA 4TQUS 1VQ4A 4MIUA 2E2IB 1CQFA 4C3IG 3QIAA 1Y69U 1XNQL 2EJGC 1CM9A 2YV5A 3IFDA 4XT3B 2JA5B 2PMZE 3N52A 5IT9L 5DLQE 4LFBQ 2PW7A 4UDUC 1RTNA 2CH4A 1VQ8A 3SGIA 2H4OA 2Z9HA 1Z47A 4F87A 4JI0L 3NWSA 2R93G 3TP6A 3S1RB 4FF4A 1AW7A 1OTCA 1G6PA 2PQEA 2K6AA 2VXWA 3M3YH 3TRZA 4A3IH 5JPNC 1U4LA 4L5QA 2J4XA 1Y8NB 2L12A 4CKBA 3I4NB 2KHIA 3H3VC 3DWPA 1O7YA 4JI2Q 3A7AB 4Y7NB 2A8VA 3S2DH 3URYA 3HOUB 5IY0A 5ELBA 2JA7B 3KJOA 2EXDA 2NB0A 2NTSA 1CZGA 2KCCA 4GLAC 4GNXC 1SROA 2AUJD 5C3XA 3BVGA 1Q8KA 1TQOA 2JE6I 5GQOA 1CKNA 1GVPA 2K5HA 1Y1WH 3NXWA 3NQIA 4DA2A 2CQOA 4KY7A 5HGTA 1QZGA 3DEOA 2UXCQ 1TWAB 4WRDA 1FJGL 3W3AA 1EOTA 3TSSA 1SYBA 1CT1D 1ILPA 3CMAA 5A35A 4PZ8A 1TWGH 2H5XA 1FGUA 2KEDA 2BDOA 1AP0A 3LGJA 4YHHQ 3E9HA 4ZUIA 2Y0SE 3HGBA 5F2DA 1PH2A 3D4RA 3PO2H
chains in the Genus database with same CATH topology
1NR4A 1A3UA 2YYZA 4HEDA 2F0IA 2IPKD 3D8GA 2KA7A 3SEBA 1H9MA 5J1ZA 1AEXA 4KI0A 1II3A 2E2DC 2CW0D 1LT3D 1PFNA 1DYQA 1BCPF 2F03A 2ID0A 3H94A 5IGBA 4DFAA 4IZ8A 1A3TA 1K83B 3GD7A 4LMQD 3BDLA 1GUGA 3TZUA 1M4VA 2SDFA 1LTAD 4DK0A 1Q3LA 3MXPA 1X3QA 3MTSA 1GUSA 2HDMA 3FEWX 4KKUA 3ZYYX 1A2UA 3EQLC 5FO8B 3D6CA 1TIID 2A73B 4FXKC 3TMEA 3MZ5A 3HP3A 1B50A 1DOKA 3I90A 4KV6A 1JCKB 1KLUD 1PDQA 1SNQA 4QMGA 2EJFC 2TMPA 2SOBA 4G57A 2IX3A 5FKAC 5D3DA 2DNEA 3CKIB 3QOJA 1EZ6A 5EPLA 4FXDA 5KEEA 1RKNA 2FINB 3KBXA 2L1BA 1EYDA 3NUCA 2AQ3B 1UNSA 3OIPA 5I9OA 3HRZC 5K36G 1PRTB 2BCOA 2A6ED 4DAVA 2O2LD 1CFMA 1KDBA 1NR2A 4RCNA 3K5LA 2CW0C 3PUXA 3FVQA 4BY7B 1HTPA 4IUPA 1D5ZC 5C0XH 1H9JA 3PUWA 3G6JB 3K5OA 3I4LA 1PTOB 4V190 4R9WA 3MXGA 1IYVA 3VR5A 1HHVA 2EDGA 3O13A 1OXSC 1FGBD 2BA1A 4A3FB 4EVOA 2F0QA 1Q8IA 2CQAA 5BN5A 1VF7A 1D1KA 3K5MA 3GV6A 3BYYB 4RHSA 4IQZA 5C4HA 3NTHA 1LTRD 3OSOA 1PTOF 3PO2B 1OXVA 5M5WB 4CJ1B 4G7OC 1STHA 1PZKD 1DONA 3MXNA 4M8AA 2RSNA 1Z7TA 3KLSX 1WTRA 1QOHA 1V43A 1KDAA 1HTLD 1K8MA 3CRLC 3HOYB 4IFDH 3AU7A 2I46A 2IT1A 5ELEA 3C2PA 1NUCA 4NW2A 1FR3A 4XDXA 3NWTA 4RWSC 1ET9A 2MUYA 4FF2A 3NE5B 3J7AF 1SAPA 3OHXC 2BA0A 2A6EC 4K2LA 1XYIA 1EY8A 1SYEA 3TP5A 3ERQA 2XVSA 2FJ2A 3FDTA 1B3AA 1ESFA 2HUGA 5LL6X 2VB3X 3ITPA 4HR7B 3K57A 2QCPX 1ML0D 2H1EA 4QB4A 5EKKA 1F9PA 5E4XA 3S1NB 5DEHA 4A3BB 5KYLA 1F2YA 3MXUA 1WTXA 1SNMA 2QKIC 4ZQ3A 5E3FA 1I4QA 2AWOA 1BQQT 2K01A 5KIXA 4V0BA 3M4YA 3QWNA 2SEBD 1OXXK 4NKLA 3K7AB 2EYFA 2ZXRA 3DEPA 3EROA 3P1HA 3C46A 1JQYD 3NK9A 4CBVA 1RTOA 4OIJA 4X3SA 4ID6A 2D5DA 1UEAB 3KLRA 4ZAIA 5CORA 4ZKCB 2NWGA 2WAQB 3A8JE 2B2UC 5JVH3 2B2VC 2EOTA 3CU7A 4BS9A 5M3MB 4FNFA 2EYPA 2K7VA 4NDXA 4ME5A 4RA8A 4A3EB 2PMZB 1BCPD 4C1NI 4HN7A 1Q12A 1R4QB 5CV5A 4WFN3 4DNTB 2K5QA 1F9RA 1F2MA 2F0WA 1ENFA 2EY2A 1S5BD 1G8ZD 5KNBA 4WJWA 3FKIB 2PW5A 1JR0D 3G7LA 5DM63 4QF4A 4CJ2C 3R3OA 3PUYA 1WTWA 1AFPA 2MGSA 4PMBA 4XYQA 3BVMA 1G2SA 2VB2X 3SE0A 4FF3A 3VYUA 4XYOA 1BBXC 5JAVA 1AN8A 1SXTA 2B2UA 2RBMA 2B2VA 2Y0SB 4P2CB 1TR5A 5FO7B 1XWEA 2EYMA 4J1MA 1Q1BA 4EGVA 4K6LA 2A74C 1EQVA 3MHBA 1VCIA 1HA6A 1L0YB 1HCZA 2E2JB 1BCPC 3R8BA 1WVLA 5FOBB 1ZEQX 1SE3A 4CKEA 3BS1A 3QJYA 5EPKA 1GXDC 2R92B 1PRTD 1XTCD 1S5ED 2FHTA 5I2YA 1MSHA 4ZUJA 4S3SA 4QUCA 2F0HA 3DWQA 1EEID 4EQPA 1UUPA 2JXMB 2OF1A 1BNZA 5C0XJ 5IODA 1JE4A 1AZPA 1NCVA 3VA5A 5LL6S 1PTOD 1U4RA 1PZID 2B2WC 4ODGA 2FFKB 3QG1A 1DOMA 3RMHA 4RGNA 3MAQA 1VMCA 1BDOA 2BDNA 3MEHA 1RF2D 3WOFA 1X3PA 2RDFA 4TKOB 2K5WA 3E5SA 4KK7A 2M00A 1D5MC 1LLRD 1RODA 3H6MA 1FD7D 3BDCA 3CHBD 3S2HB 4YIJA 4ZK9B 2PCFB 1LACA 4DNRB 4OGQC 1E2VA 2A69D 5T1GA 3TP7A 5IGGA 4IFDJ 1FNVA 3VR6A 1RJTA 1IYUA 2D62A 4F7XA 1QNUA 5FO9B 2F1MA 4A3MB 1TWHB 4K14A 4CKCA 4C3HB 3W2DA 4N9TA 3UI2A 1BUVT 2NBFA 3GQBA 3K5NA 2WACA 1SJED 3RUZA 1SNCA 1D2BA 1SSOA 1EY4A 1UAPA 2B2WA 4ZKBB 2KQ3A 2B8FA 1ESRA 1KAAA 3OW7A 4RKLA 1PTOC 4DGZA 1IL8A 2F0VA 2MHVA 3SXHA 2O4XA 3SVMA 4K5VA 4RCOA 2NVYB 3QOLA 3M7GA 1U9RA 4OL7A 3IL8A 3PUVA 2A5HA 3P75A 2K5DA 4A3DB 1JOKA 3S1MB 2F0GA 2O5JC 2X6LA 1B2TA 4GZYC 1G291 3BZDB 4KD3A 3GTGB 4BY1B 1G91A 3TDQA 1GHKA 3PIP3 2XIWA 1WD1A 1VDZA 4MHEA 1LO5D 2K1BA 4FYDA 1NAPA 4PMWA 1EYCA 4AYBB 1TU2B 2A69C 1DCZA 2K05A 4FVMA 3J81L 4K2KA 1JWMD 4LAAA 2EYOA 3T53B 3T13A 3IFTA 3X3NA 2WV6D 4Z9CB 5C5LA 2NUCA 5J22A 4HCSA 2FMCA 2YU9B 2KJXA 3OPOA 5C4XB 4K6DA 2IW3A 2XN9C 1ZYRD 5CR3A 4A93B 5CV4A 5C4JB 1BF4A 4KMUC 2JA8B 5KGUA 1BO0A 1ONLA 2EE1A 1STAA 2EYLA 3P20A 3X3MA 2WKDA 1V1PB 2QF7A 3PUZA 3U9SA 4XQNA 3TP8A 4CHTB 5JEAG 4R8IA 3I72A 2KHSA 4H0LC 5D3IB 1PMRA 2F0NA 2F3VA 2RQXA 2PPBC 5CV6A 3SK6A 4NP5A 3SDZA 4WORA 5K36H 4FP5D 2B8GA 4A3JB 1W6JA 3S16B 1Q90A 1KLGD 1I6VC 3MVVA 1T5EA 5TSSA 2MJ8A 1FNWA 2EJMA 2JEBI 3BVZA 3L7ZC 4DK1A 1U4PA 3M3YB 1EY9A 4A3IB 4U68A 3GP7A 2K03A 4J6HA 2CHBD 3KK7A 4HAEA 1M8AA 2WKCA 3S2DB 1SE2A 1CA6A 2IL8A 1Z6HA 2K28A 1B9MA 2L55A 4HSVA 1EY5A 1I4HA 1ZYRC 3A54A 3VR4A 1RD9D 4EQOA 1HQRD 1SMYD 4KJOA 1PRTF 2V4DA 1Y1WB 2NTTA 4HMJA 1B1ZA 4XQQA 1STYA 1S5DD 1HFNA 3OOCA 3TN2A 5CV7A 1TWGB 2X69A 4PMCA 4K8IA 1EL0A 1DM0B 4G7ZC 1CHQD 1EU3A 2BE5D 5EGTA 1JC7A 4FF1A 1R4PB 1T5XD 3VR2A 5IGFA 1HFGA 1JORA 3S15B 5M5XB 3RD4A 5ISRA 1O78A 1GUNA 2R7ZB 1TS4A 4R8NA 1HPCA 4X3KA 3NBHA 2PZWA 2J7ZA 5FK9C 3SK5A 2PYKA 2NVQB 3F2UA 1LTTD 1S5CD 1Q1EA 4G4KA 5EKIA 1GUOA 2M2LA 4Q0FA 5DAUA 1SE4A 3NTKA 1HQMC 1QG7A 3HOXB 2XWBB 3EFXD 2D9UA 4RH6A 2XRQD 3H91A 1EY7A 5M9OA 3TBIB 2B2YC 1ENCA 3WDNA 1D5XC 1A15A 4JBWA 4B08A 2NN6I 4KHVA 1Y1VB 2F0JA 3PIO3 3K58A 1HUMA 3FRPB 1SMYC 3OMCA 4C3JB 1I4GA 3OWEB 4M1UB 5CYUA 1IW7D 3KF8A 2PO4A 4QCLA 2LY7A 1BXTA 2D2CC 5JPMC 2WINB 3U9OA 5BN4A 2BE5C 2BOSA 2EVBA 2WP8J 3WOEA 2K04A 5BN3A 2QILA 2AQ2B 3HS0C 3H09A 5A2QL 5AFWA 2AUKA 3DM1A 3A8IE 5DNFA 4U673 2B63B 4L8JA 2PZUA 4ULLA 3JAML 3SK4A 4MN3A 1PYWD 1OXUA 2B2YA 5KNDA 4L63B 3D4DA 1MGSA 4ZRZA 1CK1A 2F3WA 2R6GA 5FLXE 1ZXTA 5T1IA 3NBIA 5EKLA 4KKTA 3S17B 2HCCA 5I4DA 3EJIA 1E2WA 2OEOA 1F9QA 5EQ0A 2ZT9C 2B39A 3CRKC 1XXGA 3A8KE 1PZJD 5IT9E 2DY7A 1H9SB 2L5TA 1IW7C 3RZDB 4J8QA 1BR9A 1OO9B 2DY8A 1V1OA 1I4PA 1IHZA 2K32A 2G9DA 4QUFA 4RGTA 1D1IA 3HG9A 4KKSA 3IKJA 2R61A 1LT5D 4ZYSA 2EXZA 5IOCA 3T56B 2PZTA 1R9TB 2L9HA 3N6RA 4DXGA 1TVXA 3J7AV 1C48A 3A7LA 2LS01 2F0EA 3KBGA 2C9OA 2K33A 3NSWA 2Z1CA 1VF5C 3HOVB 2EPBA 4XT1B 3DHQA 1JB3A 5I2XA 2NVXB 3V96A 3SHLA 2LFNA 1I50B 1BOSA 4X3TA 1ILQA 1SNDA 5IGDA 4C3HG 4H13C 1DZ1A 1H9RA 2E2HB 4RKBA 3K0YA 1QWYA 3GO5A 1LT6D 2OXPA 1HUNA 1O7LA 1LV9A 4BBSB 5K5PA 3GTJB 2A68D 3HOWB 4IUTA 4TRDA 2F0UA 5I6WA 3J80L 2G9HD 4A3KB 2JEAI 3NPPA 4IUUA 4OO1G 1B53A 4JK1C 5COYA 3BYTB 4NMZA 4BWGB 3T51B 4K5WA 1GUTA 4OHJA 1QILA 3R93A 2JP1A 5EBDA 3NTIA 2ZXOA 5EJWA 3J7YW 1TKWB 3I8ZA 3EA6A 1HA5A 3ND9A 2VNUD 1EY0A 2WIIB 4O42A 2L11A 3S1QB 5CV9A 4KD4A 4RGMA 3GV3A 4UAIA 2IJ0A 2E76C 4E6IA 2XWJB 3VA7A 2HQEA 2SNSA 4X3UA 3Q23A 1C4QA 2B2TC 4K8JA 1SYGA 1JWSD 1OXTA 1WD0A 5CBEE 1PRTC 5KNCA 5C3EB 2EZVA 2RA4A 4RFBA 4OO1I 3C1FA 3C3LA 4ABNA 2A68C 3NHHA 4IN3A 4K5XA 3TZDA 4C1NK 2HCIA 1V1PA 4HSPA 2NVTB 1SJHD 3Q24A 1RHPA 1MSGA 3D31A 5M5YB 3DMUA 2F0SA 1L0XB 2R3ZA 1SYDA 3KLSA 1EFID 2C5CA 3PMFA 3C1EA 1EQTA 3GTOB 3A55A 1E2ZA 1STBA 4RAUC 3P7JA 1QJOA 5EPJA 1PTOH 2ICIA 5M3FB 3AB9A 2F0PA 1EIGA 4HTHA 2B2TA 1WTPA 4IUNA 4IUVA 2KECA 1I6HB 1SYFA 1IKLA 3T16A 3GTMB 5E1FA 1GHJA 1TT2A 4F8MA 1ET6A 1KTKA 1AZQA 3K59A 1PXUA 5JEAH 1I3QB 1IKMA 3QB3A 1MBYA 1BCPB 4DF7A 3SK8A 3LWUA 3GTQB 4OIKA 5I6YA 4RGOS 1JOQA 1PFBA 1SEBD 4DAPA 4A3GB 5JJZA 2L0CA 5HURA 3T4AC 1Y8OB 2KOLA 4C3IB 2EY6A 4BA2I 5IIFA 1KNEA 1F9SA 2R93B 2XRSD 4IUQA 1WTOA 1EZ8A 2J0TD 2OT2A 2KUMA 2N88A 2Q8RE 3ONAB 3DUZA 1QE6A 1CHPD 4H44C 1DD2A 4LJZC 3I4MB 5NUCA 1B9NA 3R2TA 2RKSA 2EY1A 1CA5A 4CGYB 3MWYW 1CI3M 4KN7C 1F2ZA 4O1NA 5A2QE 3BG3A 1S4ZA 3D6WA 3K6OA 1XX8A 1QCBD 1G2TA 1D6EC 5CBAE 2NN6H 1DXMA 2X6GA 4FXGC 4XXEA 3JAME 3EVQA 1TY2A 1TS2A 2A6HD 4XQJA 1LTSD 1QNKA 2L4NA 2ENBA 2M9VA 4DAYA 4C3JG 1I4XA 4ZLTF 2JYOA 4G7HC 1TWFB 5DM73 1FNUA 3S9WA 1A2TA 1EYAA 2NN6G 2SNMA 3V05A 2KCNA 1TWCB 3M7NA 4F88A 1EIHA 4KN4C 2F0KA 2HDLA 1GUWA 1A3VA 3NP8A 3RLFA 4B9WA 3NQTA 3MFYA 2VUMB 3MFGA 5J39A 1W6KA 2Q8IB 2E75C 2TSSA 3HKZB 3Q0AA 3FPPA 4XIGS 5C0XG 1CZWA 2I07B 2JA6B 3L9AX 1WTVA 4PV1C 4KY5A 2FMMA 1F77A 1PLFA 1EY6A 3MC0B 4BBRB 5G3LF 3LNNA 2F0DA 5I9PA 2LKVA 2A6HC 5D65A 2MPMA 3LX0A 2F0MA 1EU4A 2Q8TA 3I91A 1G6ZA 3RZOB 3FPUB 2IWHA 5CGKA 5EBCA 5CMDA 4RHRA 3PO3B 3BDOA 3DWAA 4Q5VA 2Z8LA 1H9SA 1KNAA 1EWCA 5E4WC 1U4MA 2ICEC 3V2TA 3R2IA 2ZXPA 1B44D 3I73A 1SNPA 2N55A 1SYCA 4IFDG 2KVMA 1WCMB 3L3OC 1SDFA 3M4OB 1TS3A 1STEA 2LMCB 1LTID 2MP1A 5JOBA 3J80E 2F0LA 1YNJD 2Z4IA 2IX0A 3I70A 5C0XI 3D3RA 1E0BA 4C56C 4EQNA 4IALA 1VMPA 4L6TB 3OMGA 2AWNA 2F0OA 4TSSA 1KDCA 1EWHA 2F0FA 3HEJA 1X32A 3KUPA 3Q6SA 1H9KA 2WB1B 1A6XA 1LTBD 3ND8A 4HMIA 4H7BA 1CTMA 2RDHA 1O7ZA 2DN8A 4KTAA 3MA2B 5C3WA 1LABA 1JOOA 1J9OA 3VR3A 2KEEA 1ENAA 1S5FD 2EYJA 1DJRD 1FYCA 2Z4HA 1JWUD 2AQ1B 3DXJC 1MD2D 1LT4D 3VYTA 3I3CA 4FO2A 5JEAJ 4IFDI 3HZXA 1DOLA 1B4OA 1KABA 2F0TA 1I4RA 4KHZA 4KJNA 4B9XA 3GTLB 4CJ0B 1YNJC 1SNOA 2XSCA 2F4IA 5JVG3 2IX1A 3VYSA 3SR1A 3FMCA 1MI2A 2E74C 5KYIA 1GJXA 1SBBB 1JICA 3QO2A 4PQXA 1ICWA 3LWEA 5C44B 4BA1I 3IAYA 4DXFA 4I65A 5ELDA 3CQZB 4OO1H 3OIQA 2GA4B 2O5IC 5KRUA 2XNAC 1C8CA 1K8OA 2NZ1D 5D14A 4DN4M 3J81E 1V8QA 2CVRA 1HXYD 2JSOA 4DU9A 4C2MB 1RDPD 3Q22A 1YNND 2EY5A 1SFOB 4QIWB 5C6AA 1LTGD 1WTQA 5ELFA 1O80A 3E6ZX 4ILWA 3M85A 2RDGA 2EYHA 5CV8A 1F2LA 5IGEA 5LHY1 3VYRA 4I7ZC 5CC4A 5C4ZA 1ZKOA 3S14B 4LK1C 3PV0A 5IGCA 4IURA 2NYZD 3H0GB 3AMUA 2RSOA 2RVLA 1QB5D 3GTPB 3E0JA 1STNA 4HCEA 5G3LD 4N9PA 2PNRC 5ELCA 1TS5A 2DNCA 3D4WA 1PFMA 3A56A 1HRJA 3GTKB 3OWFA 2QDBA 5C5MA 2QEJC 1CQVA 5FLXL 1Y8PB 1NSNS 4KY6A 1STGA 1RCVD 1J8IA 4XTCS 3HOZB 1TY0A 1YNNC 1GOZA 4PNYA 1EEFD 4TQUS 4MIUA 2E2IB 1CQFA 4C3IG 3QIAA 1Y69U 2EJGC 1CM9A 3IFDA 4XT3B 2JA5B 3N52A 5IT9L 2PW7A 4UDUC 1RTNA 2H4OA 1Z47A 4F87A 3NWSA 3TP6A 3S1RB 4FF4A 1AW7A 2PQEA 2K6AA 2VXWA 5JPNC 1U4LA 2J4XA 1Y8NB 2L12A 4CKBA 3I4NB 3H3VC 3DWPA 1O7YA 3A7AB 4Y7NB 3URYA 3HOUB 5ELBA 2JA7B 2NB0A 2NTSA 1CZGA 2KCCA 2AUJD 5C3XA 3BVGA 1TQOA 2JE6I 3NXWA 3NQIA 4DA2A 4KY7A 5HGTA 3DEOA 1TWAB 4WRDA 3W3AA 1EOTA 3TSSA 1SYBA 1CT1D 1ILPA 5A35A 2KEDA 2BDOA 1AP0A 4ZUIA 3HGBA 5F2DA 3D4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5B D;  1SBB B;  1PTO D;  4L6T B;  5FK9 C;  1PRT B;  1G8Z D;  4L63 B;  4TSS A;  1LTT D;  1PZI D;  2O2L D;  1S5C D;  1CK1 A;  3MFG A;  2IPK D;  1JR0 D;  1LT6 D;  1KLG D;  2XRS D;  1V1P A;  4RGN A;  2QEJ C;  3BZD B;  1SE4 A;  2TSS A;  1LTB D;  4DXF A;  1CQV A;  5TSS A;  1D5Z C;  1FNW A;  5ELD A;  3BVZ A;  3SEB A;  1SJH D;  3EFX D;  1RCV D;  2RDH A;  1RF2 D;  5I4D A;  4RH6 A;  2XRQ D;  1TY0 A;  3GP7 A;  2G9H D;  1CHP D;  1GOZ A;  1I4Q A;  1L0X B;  1EEF D;  1PTO B;  3BVM A;  1LO5 D;  2XNA C;  1XXG A;  1LT3 D;  2CHB D;  3BYT B;  1PZJ D;  1EFI D;  1DYQ A;  2SEB D;  3O13 A;  1BCP F;  1SE2 A;  4BWG B;  1F77 A;  1D5X C;  1HXY D;  4UDU C;  1D5M C;  1RDP D;  3R2T A;  1FGB D;  3MC0 B;  1LLR D;  1AN8 A;  4OHJ A;  1FD7 D;  1AW7 A;  1JWM D;  1QIL A;  1V1O A;  1S5F D;  1LTG D;  1I4P A;  1SXT A;  3CHB D;  5ELF A;  1I4G A;  1DJR D;  3OWE B;  4O1N A;  1I4H A;  4RGT A;  1JWU D;  2AQ1 B;  2J4X A;  2WV6 D;  4Z9C B;  1PTO H;  1RD9 D;  2ICI A;  1M4V A;  2RDG A;  1LTA D;  3BYY B;  4RHS A;  1JQY D;  1HQR D;  2R61 A;  1MD2 D;  1EU4 A;  1LTR D;  3DWP A;  1LT4 D;  3EA6 A;  1PTO F;  1LT5 D;  1FNV A;  1BXT A;  1D6E C;  1HA5 A;  1PRT F;  2XN9 C;  3URY A;  4RHR A;  4ZYS A;  2NTT A;  4K6L A;  5ELB A;  1TY2 A;  4RCO A;  1TS2 A;  1PZK D;  1B1Z A;  3DWA A;  1LTS D;  2NTS A;  4RGM A;  2Z8L A;  1S5D D;  3KLS X;  2IJ0 A;  1L0Y B;  4DXG A;  1BCP C;  1JCK B;  1I4R A;  1KLU D;  1I4X A;  3W2D A;  1EWC A;  3BVG A;  1ET6 A;  1HTL D;  1KTK A;  2QIL A;  2AQ2 B;  3R2I A;  3R8B A;  1B44 D;  1SJE D;  1V1P B;  1CHQ D;  1EU3 A;  1SE3 A;  5ELE A;  5FKA C;  5D3D A;  1PRT D;  1BCP B;  1XTC D;  1T5X D;  1S5E D;  1FNU A;  1BCP D;  1JWS D;  1TS3 A;  1ET9 A;  4C56 C;  1STE A;  1LTI D;  3DWQ A;  5D3I B;  1PTO C;  3TSS A;  1EEI D;  4RGO S;  1CT1 D;  1TS4 A;  1UUP A;  3V05 A;  1PRT C;  1SEB D;  1ESF A;  2AQ3 B;  5ELC A;  1PYW D;  4RFB A;  1UNS A;  1ENF A;  1TS5 A; 
#chains in the Genus database with same CATH topology
 2IHF A;  4DNI A;  1VQL A;  1NR4 A;  1A3U A;  1VQ9 A;  2YYZ A;  3S15 H;  4HED A;  5M5X H;  3TS0 A;  2F0I A;  2IPK D;  2CWP A;  3D8G A;  1Y1W G;  3VDY A;  3L0O A;  2KA7 A;  2MQH A;  1WYD A;  2IHE A;  3SEB A;  1H9M A;  4DR3 Q;  5ELN A;  5J1Z A;  5IE8 A;  1AEX A;  4KI0 A;  3HOY H;  1II3 A;  3DLL A;  2E2D C;  2CW0 D;  1LT3 D;  1PFN A;  1VQO A;  4KLK A;  2OCE A;  2ATW A;  1DYQ A;  4NXM Q;  1BCP F;  4X66 L;  2F03 A;  2ID0 A;  5FLM H;  3H94 A;  5IGB A;  4DFA A;  4IZ8 A;  4GNX A;  4K0K L;  3HOX H;  4FDB A;  1J5E L;  1AH9 A;  1A3T A;  4R4I A;  3ULL A;  2R7Z G;  2CFM A;  1K83 B;  3GD7 A;  4LMQ D;  4UHV A;  3BDL A;  1GUG A;  3ERS X;  3TZU A;  1M4V A;  2SDF A;  1LTA D;  4DK0 A;  1Q3L A;  3MXP A;  1X3Q A;  3MTS A;  1GUS A;  2HDM A;  3FEW X;  4KKU A;  3ZYY X;  1A2U A;  3EQL C;  5FO8 B;  3D6C A;  1AE3 A;  1TII D;  2A73 B;  4QL5 A;  4PG3 A;  4FXK C;  3TME A;  1Y1V H;  3MZ5 A;  1M1K C;  3HP3 A;  1B50 A;  4C3J H;  1DOK A;  3K8A A;  4HJ7 A;  4BBR G;  2A1A A;  3CC2 A;  1JJG A;  3I90 A;  4KV6 A;  5FLM G;  1JCK B;  1KLU D;  1PDQ A;  4JW0 A;  5IP7 G;  1YHA A;  4YCU A;  3HOX G;  1SNQ A;  2KCM A;  4QMG A;  3T1Y L;  1FL0 A;  2EJF C;  1D8L A;  2TMP A;  2SOB A;  4G57 A;  2IX3 A;  5FKA C;  1PH8 A;  5D3D A;  2DNE A;  4GKJ L;  5BR8 L;  4JI3 L;  3CKI B;  1K8G A;  3QOJ A;  1EZ6 A;  5EPL A;  3K7A H;  1HH2 P;  4FXD A;  1QVF A;  5KEE A;  1RKN A;  3PO3 G;  1Y1V G;  3KBX A;  2FIN B;  2L1B A;  4R4Q A;  3H3V I;  2PNH A;  1EYD A;  1HZ9 A;  3AYH B;  3NUC A;  1E1O A;  4DV4 Q;  2AQ3 B;  2E8G A;  4L5S A;  4GN4 B;  1UNS A;  3TQY A;  3UE1 A;  3OIP A;  5I9O A;  3HRZ C;  5K36 G;  1PRT B;  2BCO A;  2A6E D;  3OTO L;  1PH7 A;  4DAV A;  2O2L D;  1CFM A;  1KDB A;  1TXY A;  4H02 A;  2B63 H;  4DR6 L;  1NR2 A;  3U50 C;  4RCN A;  3K5L A;  2CW0 C;  3PUX A;  3FVQ A;  4BY7 B;  1HTP A;  4NXN L;  4JI4 Q;  2KEN A;  4IUP A;  1D5Z C;  1XJV A;  5C0X H;  1H9J A;  1U5K A;  4UP8 A;  3PUW A;  5M3M H;  3G6J B;  3K5O A;  3I4L A;  4B3R Q;  1PTO B;  4V19 0;  4R9W A;  3MXG A;  5H1S E;  1IYV A;  3PGZ A;  3VR5 A;  2UXD Q;  2PQA A;  1HHV A;  2EDG A;  3O13 A;  1OXS C;  1FGB D;  2BA1 A;  4A3F B;  4EVO A;  3RN5 A;  2F0Q A;  1IBK L;  2B63 G;  3I7F A;  2WB1 G;  1Q8I A;  1LUZ A;  3S17 H;  1A63 A;  1V1Q A;  2CQA A;  4LNQ A;  5BN5 A;  2ZTD A;  1VF7 A;  1D1K A;  3J7A 5;  2NZO A;  3K5M A;  3GV6 A;  3BYY B;  4RHS A;  4IQZ A;  5C4H A;  4X62 Q;  3NTH A;  1N36 L;  1VQC A;  1LTR D;  3U4V A;  3OSO A;  1PTO F;  3PO2 B;  1PYS B;  1OXV A;  3G48 A;  5M5W B;  3RZD H;  5IP9 H;  4CJ1 B;  4G7O C;  1STH A;  1PZK D;  1DON A;  3MXN A;  4M8A A;  2RSN A;  1Z7T A;  3KLS X;  5HY6 A;  4GKK L;  1WTR A;  1NMG A;  4DR7 L;  1QOH A;  1V43 A;  4O0A A;  1KDA A;  4DUY Q;  4YWL A;  1HTL D;  1K8M A;  3CRL C;  3HOY B;  4IFD H;  3AU7 A;  3EN2 A;  2I46 A;  2IT1 A;  4LUO A;  1NY4 A;  5ELE A;  3C2P A;  1NUC A;  3KYH C;  4NW2 A;  1FR3 A;  4XDX A;  5GAG C;  1SRU A;  1O7I A;  3NWT A;  4AYB E;  1R9T H;  4RWS C;  1L0W A;  1ET9 A;  2MUY A;  4FF2 A;  3NE5 B;  3J7A F;  1SAP A;  3OHX C;  5IP9 G;  4LFA Q;  2BA0 A;  2A6E C;  4K2L A;  1XYI A;  1EY8 A;  1SYE A;  3TP5 A;  3ERQ A;  2XVS A;  2FJ2 A;  3FDT A;  4DV1 Q;  1B3A A;  4YY3 Q;  3J7Z C;  4YWK A;  4YCW A;  1ESF A;  3E0E A;  1C0A A;  2HUG A;  1E3P A;  5LL6 X;  2VB3 X;  3ITP A;  1PHJ A;  3HOV H;  4HR7 B;  2VW9 A;  3K57 A;  4JV5 Q;  2GN5 A;  2QCP X;  1ML0 D;  2Q2H A;  2H1E A;  2NVX H;  4QB4 A;  5EKK A;  1F9P A;  1H95 A;  4CDC C;  5E4X A;  3S1N B;  5DEH A;  4A3B B;  2E2J H;  5KYL A;  1F2Y A;  3MXU A;  1WTX A;  1SNM A;  2QKI C;  4DR2 Q;  4ZQ3 A;  2Z6B A;  5E3F A;  2E2H H;  1I4Q A;  1XNR L;  2UUA Q;  4LWC A;  2AWO A;  1BQQ T;  2K01 A;  2R92 H;  5KIX A;  4V0B A;  3M4Y A;  1HZA A;  3QWN A;  1HJP A;  2SEB D;  1OXX K;  4J15 A;  4NKL A;  3K7A B;  5C44 G;  4LF4 L;  3UDI A;  4BBS H;  3GTJ H;  2EYF A;  2ZXR A;  3UDX A;  1Q81 C;  4GOP B;  4A3K H;  3DEP A;  3ERO A;  3PF5 A;  3BJU A;  1E24 A;  3P1H A;  1IBL L;  3ER0 A;  3C46 A;  1JQY D;  3NK9 A;  1YIJ A;  1C9O A;  4CBV A;  1HR0 Q;  1L1O C;  1X3G A;  1RTO A;  1KRS A;  4OIJ A;  1EIF A;  4X3S A;  4ID6 A;  2D5D A;  1UEA B;  3KLR A;  4ZAI A;  5COR A;  4ZKC B;  2NWG A;  1IBM Q;  4IOC A;  2WAQ B;  3A8J E;  2B2U C;  4P73 A;  1BVS A;  3CW2 C;  5JVH 3;  2B2V C;  2EOT A;  2D0O A;  2QW7 A;  3HOW G;  3CU7 A;  4BS9 A;  4DV6 L;  1HNX Q;  5M3M B;  4FNF A;  2EYP A;  2K7V A;  4NDX A;  4ME5 A;  2UU9 L;  4RA8 A;  4JPB W;  3G71 A;  4HID A;  4A3E B;  2PMZ B;  4OWT B;  3I55 A;  1BCP D;  4LF6 L;  2YTY A;  4C1N I;  4HN7 A;  1Q12 A;  1R4Q B;  1PYB A;  5CV5 A;  4LF7 L;  4WFN 3;  1MJC A;  4DNT B;  2K5Q A;  1F9R A;  4GLX A;  1F2M A;  3KFU A;  2F0W A;  1ENF A;  2EY2 A;  1S5B D;  1WOC A;  1PH4 A;  2ZJQ A;  1G8Z D;  3H15 A;  5KNB A;  3NEN A;  4WJW A;  3B6Y A;  5IYD G;  3FKI B;  2PW5 A;  1YBY A;  4QY7 A;  1JR0 D;  1DGS A;  4HIK A;  3KF8 B;  2VQE L;  3AFQ A;  3G7L A;  5DM6 3;  2UXB L;  2F3I A;  5C3E H;  4QF4 A;  4CJ2 C;  3R3O A;  3PUY A;  4A3L H;  4DV3 Q;  1WTW A;  4DR4 Q;  1AFP A;  1SLJ A;  2MGS A;  4PMB A;  4XYQ A;  3BVM A;  1G2S A;  2VB2 X;  4LFC L;  1L1O A;  3SE0 A;  4FF3 A;  3VYU A;  1UEB A;  4XYO A;  4LF9 L;  1BBX C;  5JAV A;  2NVT H;  1AN8 A;  1SXT A;  2LXK A;  2ES2 A;  2B2U A;  5ELO A;  4JI1 Q;  2RBM A;  2B2V A;  4DK6 C;  2Y0S B;  3PCO B;  4P2C B;  5M5Y H;  4L5R C;  1TR5 A;  4AQY Q;  2F52 A;  5FO7 B;  3CXC A;  1XWE A;  2EYM A;  4J1M A;  1Q1B A;  4B3T Q;  1Q82 C;  1SMX A;  4EGV A;  2JA5 G;  4A3D H;  3KDF A;  4WJ4 A;  4K6L A;  5IYB G;  4AIM A;  3M9B A;  1XMQ Q;  2A74 C;  1EQV A;  4JI6 L;  3GTG H;  3MHB A;  1VCI A;  1HA6 A;  1L0Y B;  1HCZ A;  4JC0 A;  3I56 A;  3AEV A;  4JYA L;  2E2J B;  1BCP C;  1GD7 A;  1SR3 A;  3GDE A;  3CPW A;  2PI2 E;  1WJJ A;  4PZ7 A;  3R8B A;  2MFI A;  3I4N G;  1WVL A;  5FOB B;  1ZEQ X;  1SE3 A;  4CKE A;  3BS1 A;  3QJY A;  5EPK A;  1GXD C;  2R92 B;  1PRT D;  2UUC L;  1XTC D;  1MIU A;  1S5E D;  5LMN Q;  2FHT A;  5I2Y A;  3NEM A;  1EFW A;  1MSH A;  4ZUJ A;  4S3S A;  3ICE A;  4QUC A;  2F0H A;  3GTM H;  2G5D A;  3DWQ A;  1EEI D;  5AJ3 L;  4EQP A;  1UUP A;  2JXM B;  2OF1 A;  1BNZ A;  1K73 C;  5C0X J;  5IOD A;  4IOA A;  2UUB Q;  1JE4 A;  1AZP A;  1NCV A;  1I3Q H;  4HJ9 A;  3VA5 A;  5LL6 S;  5M3F G;  1PTO D;  2YU9 H;  1VQI A;  1LTL A;  4JVZ A;  4POF A;  1U4R A;  1PZI D;  2B2W C;  4ODG A;  3GTQ H;  4OX9 Q;  2FFK B;  3QG1 A;  1DOM A;  1LYL A;  3RMH A;  4RGN A;  3CC7 A;  3MAQ A;  3CPF A;  1PH1 A;  1VMC A;  4LF5 Q;  4OON A;  1BDO A;  2BDN A;  4A3G H;  3MEH A;  1QVC A;  5GAD C;  1HNZ L;  1RF2 D;  3WOF A;  2RCN A;  3BZK A;  4C3I H;  2CKZ B;  2K5V A;  3EBE A;  1X3P A;  2RDF A;  4DV2 L;  4TKO B;  2K5W A;  4IPC A;  3E5S A;  5LMU L;  2R93 H;  4KK7 A;  2M00 A;  1D5M C;  4JG2 A;  1LLR D;  1ROD A;  1XPR A;  3H6M A;  1FD7 D;  3BDC A;  1EWI A;  3TEH B;  1IYJ B;  3CHB D;  3S2H B;  4YIJ A;  2RHQ B;  4ZK9 B;  1W3S A;  4DV0 L;  2PCF B;  1LAC A;  4DNR B;  4OGQ C;  1E2V A;  2A69 D;  3S24 A;  4KHP Q;  5T1G A;  1CSQ A;  3TP7 A;  5IGG A;  4IFD J;  1FNV A;  3VR6 A;  1RJT A;  5FLX c;  1IYU A;  2D62 A;  3F8T A;  4F7X A;  3S16 H;  4LF8 Q;  1QNU A;  2HHH Q;  5FO9 B;  2F1M A;  4A3M B;  1TWH B;  4K14 A;  4CKC A;  4C3H B;  1K3R A;  3W2D A;  4N9T A;  3UI2 A;  1BUV T;  2NBF A;  2Z0S A;  5IT9 c;  1EIY B;  3GQB A;  3K5N A;  2WAC A;  1YJW A;  1SJE D;  3RUZ A;  3K7U C;  1SNC A;  1D2B A;  1SSO A;  1EY4 A;  1UAP A;  2B2W A;  4ZKB B;  4JI5 L;  2KQ3 A;  2B8F A;  3I4M G;  1L2F A;  1ESR A;  1KAA A;  3OW7 A;  4RKL A;  4HJA A;  1PTO C;  4DGZ A;  1IL8 A;  5HGQ A;  2QGQ A;  2F0V A;  2MHV A;  3SXH A;  2O4X A;  3SVM A;  1JE5 A;  4K5V A;  1JJC B;  3CCU A;  4DPG A;  1XTD A;  4RCO A;  2Z6K A;  2NVY B;  1TWF H;  1JMC A;  3QOL A;  3M7G A;  1U9R A;  4OL7 A;  1J6Q A;  3IL8 A;  1I94 L;  3PUV A;  2A5H A;  3P75 A;  2K5D A;  4A3D B;  1JOK A;  3S1M B;  2F0G A;  3H3V H;  2O5J C;  2X6L A;  2AKW B;  2EQS A;  4DR6 Q;  1B2T A;  4GZY C;  1G29 1;  3BZD B;  4KD3 A;  3GTG B;  4BY1 B;  1TWC H;  1G91 A;  3TDQ A;  1GHK A;  3PIP 3;  2XIW A;  3G6E A;  1WD1 A;  1VDZ A;  4MHE A;  1LO5 D;  4JBK A;  2K1B A;  2DJF C;  1IL2 A;  2VUM H;  4FYD A;  1NAP A;  4PMW A;  1EYC A;  4JBJ A;  4AYB B;  1GKH A;  1TU2 B;  2A69 C;  1DCZ A;  2K05 A;  4FVM A;  3J81 L;  4K2K A;  2R7Z H;  1JWM D;  4LAA A;  1AE2 A;  1S3O A;  2EYO A;  3K81 C;  3T53 B;  2ZJR A;  3T13 A;  3IFT A;  1X3E A;  1KL9 A;  1VQH A;  3X3N A;  1XMO L;  2WV6 D;  4Z9C B;  5C5L A;  2JA6 H;  1N32 L;  2NUC A;  4LUV A;  3J81 c;  5J22 A;  2NVQ H;  4HCS A;  4X64 L;  1K8A C;  2FMC A;  2YU9 B;  2KJX A;  3OPO A;  5C4X B;  3FP9 A;  4K6D A;  2IW3 A;  2XN9 C;  4O2D A;  4JI8 L;  1ZYR D;  3T1H L;  1NTG A;  1EQR A;  5CR3 A;  4A93 B;  4BBR H;  2F4V Q;  5CV4 A;  2VUM G;  5C4J B;  4OXP A;  4A3F G;  1BF4 A;  4KMU C;  5IP7 H;  2CWA A;  2JA8 B;  5KGU A;  1CSP A;  1BO0 A;  1ONL A;  1CKO A;  2EE1 A;  2KCT A;  1STA A;  2EYL A;  3HKZ G;  3P20 A;  3X3M A;  2WKD A;  1V1P B;  2QF7 A;  3RZO H;  4LUZ A;  3PUZ A;  3U9S A;  3WWV A;  1PH9 A;  4XQN A;  3TP8 A;  2JA6 G;  4CHT B;  5JEA G;  4R8I A;  3I72 A;  1K0R A;  2JQO A;  2KHS A;  3PO3 H;  4DV7 L;  4H0L C;  4OWX B;  4DUZ L;  5D3I B;  1PMR A;  2F0N A;  3E9I A;  2F3V A;  2RQX A;  2PPB C;  5CV6 A;  3SK6 A;  4NP5 A;  4IPG A;  1HNW Q;  3SDZ A;  1E7Z A;  4WOR A;  5K36 H;  2DGY A;  4FP5 D;  3CCQ A;  2B8G A;  4A3J B;  3M4Q A;  1B70 B;  4LFB L;  1FVI A;  2R7D A;  3CCL A;  1W6J A;  3M4O H;  4GOP C;  3S16 B;  1Q90 A;  1KLG D;  1I6V C;  1NNX A;  1X6O A;  3MVV A;  1T5E A;  1YHB A;  5TSS A;  2MJ8 A;  1FNW A;  2EJM A;  2JEB I;  3BVZ A;  3L7Z C;  4DK1 A;  1U4P A;  3M3Y B;  1UE1 A;  1EY9 A;  4A3I B;  4U68 A;  5IWA Q;  3GP7 A;  4JI2 L;  2K03 A;  3TRE A;  4J6H A;  2CHB D;  4DR5 L;  3KK7 A;  4HAE A;  1M8A A;  2ALY B;  2WKC A;  4JCV E;  3S2D B;  1SE2 A;  4ME3 A;  1CA6 A;  1I5F A;  1WCM G;  2IL8 A;  3BZC A;  3W1G A;  1Z6H A;  3OW2 A;  4OWW B;  2K28 A;  1B9M A;  5JJK A;  2L55 A;  4HSV A;  1EY5 A;  1I4H A;  1NE3 A;  1ZYR C;  3A54 A;  2OWO A;  1KIX A;  3VR4 A;  1RD9 D;  3CCR A;  4DR1 Q;  4EQO A;  1HQR D;  1SMY D;  2UXC L;  4KJO A;  3ULJ A;  1PRT F;  1VQK A;  2V4D A;  1Y1W B;  2NTT A;  4HMJ A;  1B1Z A;  4YHH L;  4XQQ A;  1STY A;  1S5D D;  1HFN A;  4B3M Q;  3OOC A;  3TN2 A;  1M90 C;  5CV7 A;  1TWG B;  5J3B A;  4POG A;  2X69 A;  4PMC A;  4K8I A;  1EL0 A;  1DM0 B;  4G7Z C;  1CHQ D;  1EU3 A;  2BE5 D;  5EGT A;  1JC7 A;  3RLN A;  4FF1 A;  4GOP A;  1U0L A;  1R4P B;  1T5X D;  4Y52 H;  1Y14 B;  4B3S L;  3VR2 A;  5IGF A;  1HFG A;  1JOR A;  3S15 B;  5M5X B;  3RD4 A;  5ISR A;  1O78 A;  4DR3 L;  1S72 A;  1GUN A;  2R7Z B;  1TS4 A;  4R8N A;  1HPC A;  1KAW A;  4X3K A;  4ALP A;  3NBH A;  2PZW A;  3F2C A;  4NXM L;  2J7Z A;  5FK9 C;  3KLW A;  2PYK A;  3SK5 A;  3CCM A;  2NVQ B;  3F2U A;  1LTT D;  1S5C D;  1Q1E A;  4RG1 A;  4G4K A;  4A3E G;  4JI7 Q;  5EKI A;  1X9N A;  1GUO A;  2M2L A;  4Q0F A;  5DAU A;  2QA4 A;  1SE4 A;  1E22 A;  3NTK A;  1VQM A;  1HQM C;  1QG7 A;  2VY3 A;  4ZCK A;  3HOX B;  2WFW A;  2XWB B;  3EFX D;  2D9U A;  4RH6 A;  2XRQ D;  1MJE A;  3H91 A;  5GRO A;  3J81 j;  1EY7 A;  5M9O A;  3TBI B;  1GM5 A;  1A8V A;  2B2Y C;  1ENC A;  4DAY B;  3CAM A;  3WDN A;  5C44 H;  2RHS B;  1D5X C;  1A15 A;  2P5Z X;  4JBW A;  4X65 Q;  4B08 A;  1W2B A;  2NN6 I;  3FKI G;  1Y1V B;  4KHV A;  2F0J A;  3PIO 3;  3K58 A;  1HUM A;  3FRP B;  1SMY C;  1I50 H;  3OMC A;  4C3J B;  2MNA A;  1I4G A;  3OWE B;  4M1U B;  1B3Q A;  5CYU A;  1IW7 D;  3KF8 A;  4QGU A;  1YVC A;  2PO4 A;  1PH3 A;  2RF4 A;  3J81 i;  4QCL A;  2LY7 A;  1N34 Q;  1BXT A;  2D2C C;  5JPM C;  2WIN B;  3U9O A;  1JT8 A;  4C2M H;  2VQF Q;  1SFO H;  5BN4 A;  2BE5 C;  2BOS A;  4DV4 L;  2L15 A;  3HOW H;  2EVB A;  4A3C H;  2V1C C;  2WP8 J;  1N33 Q;  3WOE A;  2K04 A;  5BN3 A;  2QIL A;  3CP0 A;  2AQ2 B;  3HS0 C;  3H09 A;  5A2Q L;  5AFW A;  1KRT A;  2ASB A;  3RN2 A;  1CUK A;  1QUQ B;  4R4O A;  4JI4 L;  2AUK A;  3DM1 A;  3A8I E;  5DNF A;  4U67 3;  2B63 B;  2C35 B;  4L8J A;  3CD6 A;  2PZU A;  4ULL A;  4IPD A;  1YJ9 A;  3JAM L;  4B3R L;  3SK4 A;  4MN3 A;  3H0G H;  1PYW D;  1OXU A;  4A3C G;  3MXN B;  3GTP H;  2B29 A;  3JAM c;  2B2Y A;  5KND A;  5IYD H;  4L63 B;  3D4D A;  1MGS A;  4ZRZ A;  1CK1 A;  2HIV A;  3S1Q H;  4R1J A;  2F3W A;  2R6G A;  5FLX E;  1ZXT A;  5T1I A;  1MKH A;  3NBI A;  5EKL A;  4KKT A;  3S17 B;  4X62 L;  2GVB A;  2N49 A;  2HCC A;  2JJQ A;  5I4D A;  3EJI A;  1E2W A;  2OEO A;  1F9Q A;  5EQ0 A;  1JB7 A;  1QVG A;  2K75 A;  2B39 A;  2ZT9 C;  3CRK C;  1XXG A;  3H0G G;  4IO9 A;  3GTK H;  3A8K E;  1PZJ D;  2YTV A;  5IT9 E;  1NBW A;  2DY7 A;  2N3S A;  1H9S B;  2CH4 W;  2L5T A;  1IW7 C;  3RZD B;  4J8Q A;  2JK8 A;  2OTJ A;  1BR9 A;  1OO9 B;  2DY8 A;  1K28 A;  3RNU A;  1V1O A;  1P16 A;  4DUY L;  1I4P A;  1IHZ A;  2K32 A;  2G9D A;  4QUF A;  3KOJ A;  4RGT A;  1D1I A;  3HG9 A;  2E5L Q;  4KKS A;  3IKJ A;  2R61 A;  1SE8 A;  2JA5 H;  1LT5 D;  3IRB A;  1EOV A;  4ZYS A;  5IYB H;  2EXZ A;  4LFA L;  1XNQ Q;  5IOC A;  4DV5 L;  2A19 A;  3S1R H;  4TVA B;  2AHO B;  3T56 B;  2PZT A;  1R9T B;  1BBW A;  1YHQ A;  2L9H A;  2DJG C;  3N6R A;  3W5O A;  4DXG A;  1TVX A;  4JI0 Q;  3J7A V;  3HKZ E;  1C48 A;  3I4N H;  3KF6 B;  3A7L A;  2LS0 1;  2F0E A;  3KBG A;  2C9O A;  3HOZ G;  2K33 A;  3NSW A;  2Z1C A;  4JV5 L;  1SN8 A;  1VF5 C;  4EX5 A;  1X3F A;  3HOU H;  3HOV B;  3GTO H;  2EPB A;  4XT1 B;  2JA7 H;  4DK3 C;  3DHQ A;  1JB3 A;  5I2X A;  2NVX B;  3V96 A;  3SHL A;  4DR2 L;  2LFN A;  1I50 B;  3E3X A;  1BOS A;  4X3T A;  1ILQ A;  2UUA L;  4A75 A;  1SND A;  5IGD A;  4C3H G;  4H13 C;  1VQJ A;  2FXQ A;  5M3F H;  1WFQ A;  4UY8 C;  1VQ5 A;  1RIP A;  1DZ1 A;  1HZC A;  3EIV A;  2ZM6 L;  1H9R A;  2I0Q A;  3G4S A;  2E2H B;  3W1B A;  2ZJP A;  1I6H H;  4RKB A;  3K0Y A;  1QWY A;  1TWA H;  3GO5 A;  4GN5 A;  1LT6 D;  2OXP A;  3HOU G;  1HUN A;  2OQK A;  1GO3 E;  1O7L A;  2JA7 G;  1LV9 A;  4BBS B;  5K5P A;  3GTJ B;  4RMF A;  1N8R C;  3U58 A;  1B8A A;  2A68 D;  2RCF A;  1FJG Q;  4IUT A;  3HOW B;  3FHW A;  4TRD A;  2F0U A;  1E1T A;  5I6W A;  2G9H D;  3I2Z A;  3J80 L;  4A3K B;  1HR0 L;  2JEA I;  3NPP A;  4IUU A;  4YCV A;  4OO1 G;  1B53 A;  4JK1 C;  5COY A;  3BYT B;  2JN4 A;  1KXL A;  4N8F A;  4NMZ A;  4BWG B;  3T51 B;  4K5W A;  3J80 c;  1IBM L;  1GUT A;  4OHJ A;  1QIL A;  3R93 A;  2JP1 A;  5EBD A;  3A74 A;  3NTI A;  3CF5 A;  2ZXO A;  5EJW A;  1HNX L;  3J7Y W;  3F1Z A;  1TKW B;  3I8Z A;  5E7N A;  3A0J A;  3EA6 A;  2JA9 A;  2Z6K C;  1HA5 A;  3ND9 A;  2VNU D;  1EY0 A;  1S40 A;  2WII B;  4O42 A;  2L11 A;  3S1Q B;  5CV9 A;  2WB1 E;  4KD4 A;  4X66 Q;  4RGM A;  1K83 H;  3GV3 A;  4UAI A;  2IJ0 A;  2E76 C;  4E6I A;  4LW1 A;  2Q2T A;  3L2P A;  2XWJ B;  3VA7 A;  1PH6 A;  4K0K Q;  1VQF A;  1J5E Q;  2HQE A;  2SNS A;  3I4M H;  3OYY A;  4X3U A;  1C4Q A;  3Q23 A;  2B2T C;  4K8J A;  2VZA A;  4L5T A;  1SYG A;  5C4X G;  1B7Y B;  1JWS D;  1OXT A;  1G51 A;  1ASZ A;  1WD0 A;  4A93 G;  5CBE E;  4MTK A;  1A62 A;  2K4K A;  3DM3 A;  4DV3 L;  1PRT C;  2NZH A;  5KNC A;  5FJ8 G;  4DR4 L;  4BXX G;  3ULP A;  5C3E B;  2EZV A;  3KDF B;  1KC8 C;  3K0X A;  2RA4 A;  4RFB A;  1T9H A;  4OO1 I;  3C1F A;  3C3L A;  4QQB X;  4ABN A;  3JAM i;  2A68 C;  3PSI A;  2YTX A;  3NHH A;  3T1Y Q;  4IN3 A;  4K5X A;  3TZD A;  3PF4 A;  2I5L X;  2HCI A;  3AQQ A;  1V1P A;  4C1N K;  4QJF A;  4JI1 L;  4HSP A;  5BR8 Q;  4JI3 Q;  4GKJ Q;  2NVT B;  4AQY L;  2K5N A;  1SJH D;  3Q24 A;  1JJ2 A;  1RHP A;  1MSG A;  4B3T L;  3D31 A;  5M5Y B;  3DMU A;  2F0S A;  1L0X B;  2R3Z A;  2Q2I A;  4A3J G;  1SYD A;  3KLS A;  1EFI D;  2C5C A;  3PMF A;  3C1E A;  1XMQ L;  1EQT A;  3GTO B;  1MHW C;  3A55 A;  1CKM A;  4DR5 Q;  4BY7 H;  1E2Z A;  3OTO Q;  4MTN A;  1STB A;  4RAU C;  3P7J A;  2BH8 A;  4NXN Q;  1QJO A;  5EPJ A;  1PFS A;  2VS1 A;  1PTO H;  2ICI A;  5M3F B;  4A3I G;  3AB9 A;  2F0P A;  1EIG A;  1K3B C;  4HTH A;  5LMN L;  2B2T A;  1WTP A;  4IUN A;  4IUV A;  2KEC A;  1QZH A;  1I6H B;  5JJL A;  1KQS A;  3QR8 A;  1IXR A;  4A3F H;  1SYF A;  2ZTE A;  1IKL A;  3T16 A;  2QDL A;  3GTM B;  4BY7 G;  2HQL A;  2UUB L;  5E1F A;  1IBK Q;  1GHJ A;  1TT2 A;  4F8M A;  1ET6 A;  1KTK A;  1XPO A;  1AZQ A;  1IZ6 A;  3CME A;  5M5W H;  3K59 A;  1PXU A;  5JEA H;  4OX9 L;  1I3Q B;  1IKM A;  3QB3 A;  1MBY A;  1BCP B;  4N8X 1;  1Q46 A;  4DF7 A;  1N36 Q;  3SK8 A;  3LWU A;  4LF5 L;  1K0S A;  3GTQ B;  4HJ8 A;  4OIK A;  5I6Y A;  4HIM A;  4RGO S;  4QIW E;  4B3S Q;  3UDF A;  1JOQ A;  1PFB A;  1SEB D;  4DAP A;  4A3G B;  4GKK Q;  5JJZ A;  2L0C A;  5HUR A;  4DR7 Q;  3T4A C;  1Y8O B;  2KOL A;  4C3I B;  1YNX A;  2EY6 A;  4DKA C;  4BA2 I;  1Q7Y C;  3PO2 G;  2MO1 A;  3CCS A;  5IIF A;  1ASY A;  2AMC B;  1KNE A;  1F9S A;  2R93 B;  2KBN A;  4IPH A;  2XRS D;  4IUQ A;  4R4T A;  1WTO A;  1EZ8 A;  2J0T D;  2OT2 A;  2KUM A;  4NB3 A;  2N88 A;  4KHP L;  4HIO A;  2Q8R E;  3ONA B;  4MNO A;  1UE6 A;  3DUZ A;  1QE6 A;  1CHP D;  4H44 C;  1DD2 A;  4LJZ C;  2BH2 A;  3HFZ B;  4LF8 L;  3HOY G;  3I4M B;  2HHH L;  5NUC A;  1WCM H;  4P75 A;  5JJI A;  1B9N A;  3S1N H;  4A3B H;  3R2T A;  2RKS A;  2LSS A;  3J80 i;  2EY1 A;  1CA5 A;  1BKB A;  4CGY B;  3MWY W;  1CKN B;  1CI3 M;  4KN7 C;  4OEL B;  1F2Z A;  4O1N A;  5A2Q E;  3BG3 A;  3PQI A;  1S4Z A;  1C7Y A;  2OQ0 A;  3D6W A;  2XTI A;  3K6O A;  1XX8 A;  1QCB D;  1G2T A;  1D6E C;  5CBA E;  2NN6 H;  1XNR Q;  1DXM A;  5IYC H;  2PI2 A;  2X6G A;  2LXJ A;  3HKS A;  2GVA A;  4A4I A;  4FXG C;  4XXE A;  3JAM E;  3EVQ A;  1TY2 A;  1TS2 A;  2A6H D;  4XQJ A;  1LTS D;  1QNK A;  2L4N A;  4NPS A;  2ENB A;  2M9V A;  4DAY A;  4A3B G;  4C3J G;  3A5U A;  1BBU A;  1I4X A;  3MEF A;  4LF4 Q;  4ZLT F;  2JYO A;  2ZTC A;  3CCE A;  4G7H C;  1N9W A;  4IJL A;  1YZ6 A;  1VQ6 A;  1NJI C;  1TWF B;  2B3G A;  1IBL Q;  5DM7 3;  1FNU A;  3S9W A;  1PH5 A;  1A2T A;  1EYA A;  2NN6 G;  2HD3 A;  5IYC G;  2SNM A;  2DUD A;  3V05 A;  4IJH A;  1UWV A;  3Q8D A;  1VS0 A;  2HIX A;  2KCN A;  1TWC B;  3M7N A;  4F88 A;  1EIH A;  4KN4 C;  2F0K A;  2HDL A;  4PZ6 A;  1GUW A;  1A3V A;  4CDE C;  4A3E H;  4GNX B;  1Z9F A;  3NP8 A;  4DV6 Q;  3RLF A;  4B9W A;  3NQT A;  2N78 A;  3MFY A;  2UU9 Q;  2VUM B;  3MFG A;  1VQP A;  4WJ3 M;  5EAY A;  5J39 A;  1W6K A;  2Q8I B;  4AH6 A;  2E75 C;  4LF6 Q;  2TSS A;  4GN3 B;  1QUQ A;  3HKZ B;  3Q0A A;  3GTL H;  2WAQ G;  2XGT A;  4LF7 Q;  3FPP A;  4UPA A;  4XIG S;  1CZW A;  5C0X G;  1YEZ A;  3RLO A;  2I07 B;  2JA6 B;  3L9A X;  5M3M G;  1WTV A;  2F4V L;  4PV1 C;  3FKI H;  3F2D A;  4KY5 A;  2FMM A;  4DAM A;  1F77 A;  1PLF A;  3CCJ A;  1EY6 A;  3MC0 B;  1NMF A;  4BBR B;  5L37 A;  5G3L F;  3LNN A;  3RR5 A;  4HJ5 A;  3I4O A;  2VQE Q;  4CDD C;  2F0D A;  2UXB Q;  5I9P A;  2LKV A;  2A6H C;  5D65 A;  2MPM A;  3LX0 A;  2F0M A;  1EU4 A;  2Q8T A;  3I91 A;  1G6Z A;  3RZO B;  3FPU B;  2IWH A;  5CGK A;  5EBC A;  5CMD A;  4RHR A;  4LFC Q;  1VQA A;  3BU2 A;  2Q2U A;  4P74 A;  1PVO A;  3PO3 B;  3BDO A;  3DWA A;  4Q5V A;  4DV5 Q;  1HNW L;  3CCV A;  2Z8L A;  4LF9 Q;  1H9S A;  1YJN A;  1KNA A;  3CQZ H;  1EWC A;  5E4W C;  1U4M A;  2ICE C;  3V2T A;  3R2I A;  1LM0 A;  2ZXP A;  4APV A;  1B44 D;  3I73 A;  3PIP A;  1SNP A;  2N55 A;  1SYC A;  4IFD G;  1VQD A;  3AFP A;  2KVM A;  1WCM B;  3L3O C;  1SDF A;  1KD1 C;  3M4O B;  2MO0 A;  1TS3 A;  1STE A;  2LMC B;  1LTI D;  2MP1 A;  1KHI A;  5JOB A;  5IWA L;  3J80 E;  2F0L A;  1YNJ D;  2Z4I A;  2IX0 A;  1VQ7 A;  2PQA B;  4JI6 Q;  3I70 A;  2N8N A;  5C0X I;  4JYA Q;  2Y0S G;  3D3R A;  1E0B A;  2I5H A;  4C56 C;  4EQN A;  4IAL A;  1VMP A;  4L6T B;  3OMG A;  2AWN A;  2F0O A;  4TSS A;  2ZM6 Q;  4GS3 A;  1KDC A;  3KF6 A;  3HOV G;  1EWH A;  2F0F A;  2UUC Q;  3HEJ A;  1X32 A;  3KUP A;  3Q6S A;  1H9K A;  2WB1 B;  4R4C A;  1A6X A;  1LTB D;  3S14 H;  3ND8 A;  4HMI A;  4DR1 L;  4H7B A;  1CTM A;  2RDH A;  5AJ3 Q;  1O7Z A;  2DN8 A;  4KTA A;  1Q86 C;  2UXD L;  3MA2 B;  2K52 A;  5C3W A;  1LAB A;  3NBH B;  2EIF A;  2R92 G;  4B3M L;  1JOO A;  1J9O A;  2D0P A;  3VR3 A;  2KEE A;  1ENA A;  3KJP A;  1S5F D;  2EYJ A;  1DJR D;  1FYC A;  4BBS G;  2Z4H A;  1JWU D;  2AQ1 B;  2K14 A;  2QEX A;  4EQ5 A;  4A3K G;  1HNZ Q;  1UE5 A;  1MD2 D;  3DXJ C;  1XPU A;  1LT4 D;  3VYT A;  1PA6 A;  3I3C A;  4FO2 A;  5JEA J;  4IFD I;  3HZX A;  1DOL A;  3ZJY C;  4DV2 Q;  5GAE C;  1B4O A;  1KAB A;  5LMU Q;  3S2H H;  2F0T A;  1I4R A;  4KHZ A;  4KJN A;  3HOZ H;  4B9X A;  3GTL B;  1HR0 W;  4DV0 Q;  3D0F A;  2E2I H;  4X6A H;  4JI7 L;  2K50 A;  4CJ0 B;  1YNJ C;  1SNO A;  2XSC A;  3TS2 A;  4A3M H;  1TWH H;  2F4I A;  1VQB A;  2OTL A;  5GAH C;  4DV1 L;  5JVG 3;  4YY3 L;  2IX1 A;  4C3H H;  3VYS A;  3F2B A;  1A0I A;  1VQG A;  1HZB A;  3SR1 A;  4UP7 A;  3FMC A;  1MI2 A;  2E74 C;  5KYI A;  1GJX A;  4JBM A;  1SBB B;  4MZ9 A;  4YWM A;  4Y7N H;  4JOI C;  1WI5 A;  1JIC A;  4X65 L;  3QO2 A;  4PQX A;  1ICW A;  3LWE A;  1EYG A;  1VQN A;  5C44 B;  1P8L A;  4JI5 Q;  4BA1 I;  2CCZ A;  4DXF A;  3IAY A;  2KHJ A;  4A3M G;  4I65 A;  5ELD A;  1WTH A;  3CQZ B;  4OO1 H;  3OIQ A;  1VQE A;  5C3E G;  1YI2 A;  1N34 L;  2NVY H;  2GA4 B;  2O5I C;  4A3L G;  5KRU A;  2XNA C;  1C8C A;  2VQF L;  1K8O A;  1UE7 A;  2NZ1 D;  5D14 A;  3S1M H;  4DN4 M;  3J81 E;  1V8Q A;  2CVR A;  1HXY D;  2JSO A;  4DU9 A;  4C2M B;  1RDP D;  1ICF B;  3Q22 A;  3CC4 A;  1YNN D;  3JC6 6;  2EY5 A;  1SFO B;  4QIW B;  1I94 Q;  4BY1 H;  3STB D;  5C6A A;  1N33 L;  1LTG D;  2VL6 A;  1WTQ A;  5ELF A;  1O80 A;  4P71 A;  3E6Z X;  1K9M C;  4ILW A;  3M85 A;  2RDG A;  2EYH A;  5CV8 A;  1F2L A;  1RL2 A;  5IGE A;  5LHY 1;  3VYR A;  1X65 A;  1YIT A;  3U4Z A;  1V9P A;  2IY5 B;  4I7Z C;  4A3D G;  5CC4 A;  3A5Z B;  5C4Z A;  3K80 C;  1ZKO A;  3S14 B;  3NEL A;  4LK1 C;  4BY1 G;  3PV0 A;  5IGC A;  4IUR A;  2NYZ D;  3H0G B;  3AMU A;  2RSO A;  2RVL A;  4JOI A;  5C4X H;  1QB5 D;  1XMO Q;  3GTP B;  1X54 A;  3E0J A;  1N32 Q;  4I7A A;  1PV4 A;  4A93 H;  2R7F A;  4X64 Q;  1D7Q A;  5C4J H;  1STN A;  4AYB G;  5FJ8 H;  4A76 A;  4HCE A;  4BXX H;  4JI8 Q;  3T1H Q;  2JA8 H;  5G3L D;  4N9P A;  4CDF C;  1L1O B;  3PIO A;  2PNR C;  3M4P A;  2HT1 A;  5ELC A;  1EQQ A;  1TS5 A;  2DNC A;  5LMN W;  3D4W A;  1X56 A;  3UDG A;  1PFM A;  3A56 A;  1HRJ A;  3GTK B;  4GLV B;  1X55 A;  3OWF A;  2QDB A;  3UE0 A;  4P72 A;  5C5M A;  4UP9 A;  2QEJ C;  2I5M X;  4DV7 Q;  1CQV A;  5FLX L;  1Y8P B;  4OEM B;  2E5L L;  1NSN S;  2WAQ E;  4KY6 A;  4DUZ Q;  1STG A;  1RCV D;  1J8I A;  4XTC S;  2JA8 G;  3HOZ B;  4A3J H;  1TY0 A;  1YNN C;  1GOZ A;  4PNY A;  4A3G G;  3STB C;  1EEF D;  1EUJ A;  4TQU S;  1VQ4 A;  4MIU A;  2E2I B;  1CQF A;  4C3I G;  3QIA A;  1Y69 U;  1XNQ L;  2EJG C;  1CM9 A;  2YV5 A;  3IFD A;  4XT3 B;  2JA5 B;  2PMZ E;  3N52 A;  5IT9 L;  5DLQ E;  4LFB Q;  2PW7 A;  4UDU C;  1RTN A;  2CH4 A;  1VQ8 A;  3SGI A;  2H4O A;  2Z9H A;  1Z47 A;  4F87 A;  4JI0 L;  3NWS A;  2R93 G;  3TP6 A;  3S1R B;  4FF4 A;  1AW7 A;  1OTC A;  1G6P A;  2PQE A;  2K6A A;  2VXW A;  3M3Y H;  3TRZ A;  4A3I H;  5JPN C;  1U4L A;  4L5Q A;  2J4X A;  1Y8N B;  2L12 A;  4CKB A;  3I4N B;  2KHI A;  3H3V C;  3DWP A;  1O7Y A;  4JI2 Q;  3A7A B;  4Y7N B;  2A8V A;  3S2D H;  3URY A;  3HOU B;  5IY0 A;  5ELB A;  2JA7 B;  3KJO A;  2EXD A;  2NB0 A;  2NTS A;  1CZG A;  2KCC A;  4GLA C;  4GNX C;  1SRO A;  2AUJ D;  5C3X A;  3BVG A;  1Q8K A;  1TQO A;  2JE6 I;  5GQO A;  1CKN A;  1GVP A;  2K5H A;  1Y1W H;  3NXW A;  3NQI A;  4DA2 A;  2CQO A;  4KY7 A;  5HGT A;  1QZG A;  3DEO A;  2UXC Q;  1TWA B;  4WRD A;  1FJG L;  3W3A A;  1EOT A;  3TSS A;  1SYB A;  1CT1 D;  1ILP A;  3CMA A;  5A35 A;  4PZ8 A;  1TWG H;  2H5X A;  1FGU A;  2KED A;  2BDO A;  1AP0 A;  3LGJ A;  4YHH Q;  3E9H A;  4ZUI A;  2Y0S E;  3HGB A;  5F2D A;  1PH2 A;  3D4R A;  3PO2 H; 
#chains in the Genus database with same CATH homology
 1NR4 A;  1A3U A;  2YYZ A;  4HED A;  2F0I A;  2IPK D;  3D8G A;  2KA7 A;  3SEB A;  1H9M A;  5J1Z A;  1AEX A;  4KI0 A;  1II3 A;  2E2D C;  2CW0 D;  1LT3 D;  1PFN A;  1DYQ A;  1BCP F;  2F03 A;  2ID0 A;  3H94 A;  5IGB A;  4DFA A;  4IZ8 A;  1A3T A;  1K83 B;  3GD7 A;  4LMQ D;  3BDL A;  1GUG A;  3TZU A;  1M4V A;  2SDF A;  1LTA D;  4DK0 A;  1Q3L A;  3MXP A;  1X3Q A;  3MTS A;  1GUS A;  2HDM A;  3FEW X;  4KKU A;  3ZYY X;  1A2U A;  3EQL C;  5FO8 B;  3D6C A;  1TII D;  2A73 B;  4FXK C;  3TME A;  3MZ5 A;  3HP3 A;  1B50 A;  1DOK A;  3I90 A;  4KV6 A;  1JCK B;  1KLU D;  1PDQ A;  1SNQ A;  4QMG A;  2EJF C;  2TMP A;  2SOB A;  4G57 A;  2IX3 A;  5FKA C;  5D3D A;  2DNE A;  3CKI B;  3QOJ A;  1EZ6 A;  5EPL A;  4FXD A;  5KEE A;  1RKN A;  2FIN B;  3KBX A;  2L1B A;  1EYD A;  3NUC A;  2AQ3 B;  1UNS A;  3OIP A;  5I9O A;  3HRZ C;  5K36 G;  1PRT B;  2BCO A;  2A6E D;  4DAV A;  2O2L D;  1CFM A;  1KDB A;  1NR2 A;  4RCN A;  3K5L A;  2CW0 C;  3PUX A;  3FVQ A;  4BY7 B;  1HTP A;  4IUP A;  1D5Z C;  5C0X H;  1H9J A;  3PUW A;  3G6J B;  3K5O A;  3I4L A;  1PTO B;  4V19 0;  4R9W A;  3MXG A;  1IYV A;  3VR5 A;  1HHV A;  2EDG A;  3O13 A;  1OXS C;  1FGB D;  2BA1 A;  4A3F B;  4EVO A;  2F0Q A;  1Q8I A;  2CQA A;  5BN5 A;  1VF7 A;  1D1K A;  3K5M A;  3GV6 A;  3BYY B;  4RHS A;  4IQZ A;  5C4H A;  3NTH A;  1LTR D;  3OSO A;  1PTO F;  3PO2 B;  1OXV A;  5M5W B;  4CJ1 B;  4G7O C;  1STH A;  1PZK D;  1DON A;  3MXN A;  4M8A A;  2RSN A;  1Z7T A;  3KLS X;  1WTR A;  1QOH A;  1V43 A;  1KDA A;  1HTL D;  1K8M A;  3CRL C;  3HOY B;  4IFD H;  3AU7 A;  2I46 A;  2IT1 A;  5ELE A;  3C2P A;  1NUC A;  4NW2 A;  1FR3 A;  4XDX A;  3NWT A;  4RWS C;  1ET9 A;  2MUY A;  4FF2 A;  3NE5 B;  3J7A F;  1SAP A;  3OHX C;  2BA0 A;  2A6E C;  4K2L A;  1XYI A;  1EY8 A;  1SYE A;  3TP5 A;  3ERQ A;  2XVS A;  2FJ2 A;  3FDT A;  1B3A A;  1ESF A;  2HUG A;  5LL6 X;  2VB3 X;  3ITP A;  4HR7 B;  3K57 A;  2QCP X;  1ML0 D;  2H1E A;  4QB4 A;  5EKK A;  1F9P A;  5E4X A;  3S1N B;  5DEH A;  4A3B B;  5KYL A;  1F2Y A;  3MXU A;  1WTX A;  1SNM A;  2QKI C;  4ZQ3 A;  5E3F A;  1I4Q A;  2AWO A;  1BQQ T;  2K01 A;  5KIX A;  4V0B A;  3M4Y A;  3QWN A;  2SEB D;  1OXX K;  4NKL A;  3K7A B;  2EYF A;  2ZXR A;  3DEP A;  3ERO A;  3P1H A;  3C46 A;  1JQY D;  3NK9 A;  4CBV A;  1RTO A;  4OIJ A;  4X3S A;  4ID6 A;  2D5D A;  1UEA B;  3KLR A;  4ZAI A;  5COR A;  4ZKC B;  2NWG A;  2WAQ B;  3A8J E;  2B2U C;  5JVH 3;  2B2V C;  2EOT A;  3CU7 A;  4BS9 A;  5M3M B;  4FNF A;  2EYP A;  2K7V A;  4NDX A;  4ME5 A;  4RA8 A;  4A3E B;  2PMZ B;  1BCP D;  4C1N I;  4HN7 A;  1Q12 A;  1R4Q B;  5CV5 A;  4WFN 3;  4DNT B;  2K5Q A;  1F9R A;  1F2M A;  2F0W A;  1ENF A;  2EY2 A;  1S5B D;  1G8Z D;  5KNB A;  4WJW A;  3FKI B;  2PW5 A;  1JR0 D;  3G7L A;  5DM6 3;  4QF4 A;  4CJ2 C;  3R3O A;  3PUY A;  1WTW A;  1AFP A;  2MGS A;  4PMB A;  4XYQ A;  3BVM A;  1G2S A;  2VB2 X;  3SE0 A;  4FF3 A;  3VYU A;  4XYO A;  1BBX C;  5JAV A;  1AN8 A;  1SXT A;  2B2U A;  2RBM A;  2B2V A;  2Y0S B;  4P2C B;  1TR5 A;  5FO7 B;  1XWE A;  2EYM A;  4J1M A;  1Q1B A;  4EGV A;  4K6L A;  2A74 C;  1EQV A;  3MHB A;  1VCI A;  1HA6 A;  1L0Y B;  1HCZ A;  2E2J B;  1BCP C;  3R8B A;  1WVL A;  5FOB B;  1ZEQ X;  1SE3 A;  4CKE A;  3BS1 A;  3QJY A;  5EPK A;  1GXD C;  2R92 B;  1PRT D;  1XTC D;  1S5E D;  2FHT A;  5I2Y A;  1MSH A;  4ZUJ A;  4S3S A;  4QUC A;  2F0H A;  3DWQ A;  1EEI D;  4EQP A;  1UUP A;  2JXM B;  2OF1 A;  1BNZ A;  5C0X J;  5IOD A;  1JE4 A;  1AZP A;  1NCV A;  3VA5 A;  5LL6 S;  1PTO D;  1U4R A;  1PZI D;  2B2W C;  4ODG A;  2FFK B;  3QG1 A;  1DOM A;  3RMH A;  4RGN A;  3MAQ A;  1VMC A;  1BDO A;  2BDN A;  3MEH A;  1RF2 D;  3WOF A;  1X3P A;  2RDF A;  4TKO B;  2K5W A;  3E5S A;  4KK7 A;  2M00 A;  1D5M C;  1LLR D;  1ROD A;  3H6M A;  1FD7 D;  3BDC A;  3CHB D;  3S2H B;  4YIJ A;  4ZK9 B;  2PCF B;  1LAC A;  4DNR B;  4OGQ C;  1E2V A;  2A69 D;  5T1G A;  3TP7 A;  5IGG A;  4IFD J;  1FNV A;  3VR6 A;  1RJT A;  1IYU A;  2D62 A;  4F7X A;  1QNU A;  5FO9 B;  2F1M A;  4A3M B;  1TWH B;  4K14 A;  4CKC A;  4C3H B;  3W2D A;  4N9T A;  3UI2 A;  1BUV T;  2NBF A;  3GQB A;  3K5N A;  2WAC A;  1SJE D;  3RUZ A;  1SNC A;  1D2B A;  1SSO A;  1EY4 A;  1UAP A;  2B2W A;  4ZKB B;  2KQ3 A;  2B8F A;  1ESR A;  1KAA A;  3OW7 A;  4RKL A;  1PTO C;  4DGZ A;  1IL8 A;  2F0V A;  2MHV A;  3SXH A;  2O4X A;  3SVM A;  4K5V A;  4RCO A;  2NVY B;  3QOL A;  3M7G A;  1U9R A;  4OL7 A;  3IL8 A;  3PUV A;  2A5H A;  3P75 A;  2K5D A;  4A3D B;  1JOK A;  3S1M B;  2F0G A;  2O5J C;  2X6L A;  1B2T A;  4GZY C;  1G29 1;  3BZD B;  4KD3 A;  3GTG B;  4BY1 B;  1G91 A;  3TDQ A;  1GHK A;  3PIP 3;  2XIW A;  1WD1 A;  1VDZ A;  4MHE A;  1LO5 D;  2K1B A;  4FYD A;  1NAP A;  4PMW A;  1EYC A;  4AYB B;  1TU2 B;  2A69 C;  1DCZ A;  2K05 A;  4FVM A;  3J81 L;  4K2K A;  1JWM D;  4LAA A;  2EYO A;  3T53 B;  3T13 A;  3IFT A;  3X3N A;  2WV6 D;  4Z9C B;  5C5L A;  2NUC A;  5J22 A;  4HCS A;  2FMC A;  2YU9 B;  2KJX A;  3OPO A;  5C4X B;  4K6D A;  2IW3 A;  2XN9 C;  1ZYR D;  5CR3 A;  4A93 B;  5CV4 A;  5C4J B;  1BF4 A;  4KMU C;  2JA8 B;  5KGU A;  1BO0 A;  1ONL A;  2EE1 A;  1STA A;  2EYL A;  3P20 A;  3X3M A;  2WKD A;  1V1P B;  2QF7 A;  3PUZ A;  3U9S A;  4XQN A;  3TP8 A;  4CHT B;  5JEA G;  4R8I A;  3I72 A;  2KHS A;  4H0L C;  5D3I B;  1PMR A;  2F0N A;  2F3V A;  2RQX A;  2PPB C;  5CV6 A;  3SK6 A;  4NP5 A;  3SDZ A;  4WOR A;  5K36 H;  4FP5 D;  2B8G A;  4A3J B;  1W6J A;  3S16 B;  1Q90 A;  1KLG D;  1I6V C;  3MVV A;  1T5E A;  5TSS A;  2MJ8 A;  1FNW A;  2EJM A;  2JEB I;  3BVZ A;  3L7Z C;  4DK1 A;  1U4P A;  3M3Y B;  1EY9 A;  4A3I B;  4U68 A;  3GP7 A;  2K03 A;  4J6H A;  2CHB D;  3KK7 A;  4HAE A;  1M8A A;  2WKC A;  3S2D B;  1SE2 A;  1CA6 A;  2IL8 A;  1Z6H A;  2K28 A;  1B9M A;  2L55 A;  4HSV A;  1EY5 A;  1I4H A;  1ZYR C;  3A54 A;  3VR4 A;  1RD9 D;  4EQO A;  1HQR D;  1SMY D;  4KJO A;  1PRT F;  2V4D A;  1Y1W B;  2NTT A;  4HMJ A;  1B1Z A;  4XQQ A;  1STY A;  1S5D D;  1HFN A;  3OOC A;  3TN2 A;  5CV7 A;  1TWG B;  2X69 A;  4PMC A;  4K8I A;  1EL0 A;  1DM0 B;  4G7Z C;  1CHQ D;  1EU3 A;  2BE5 D;  5EGT A;  1JC7 A;  4FF1 A;  1R4P B;  1T5X D;  3VR2 A;  5IGF A;  1HFG A;  1JOR A;  3S15 B;  5M5X B;  3RD4 A;  5ISR A;  1O78 A;  1GUN A;  2R7Z B;  1TS4 A;  4R8N A;  1HPC A;  4X3K A;  3NBH A;  2PZW A;  2J7Z A;  5FK9 C;  3SK5 A;  2PYK A;  2NVQ B;  3F2U A;  1LTT D;  1S5C D;  1Q1E A;  4G4K A;  5EKI A;  1GUO A;  2M2L A;  4Q0F A;  5DAU A;  1SE4 A;  3NTK A;  1HQM C;  1QG7 A;  3HOX B;  2XWB B;  3EFX D;  2D9U A;  4RH6 A;  2XRQ D;  3H91 A;  1EY7 A;  5M9O A;  3TBI B;  2B2Y C;  1ENC A;  3WDN A;  1D5X C;  1A15 A;  4JBW A;  4B08 A;  2NN6 I;  4KHV A;  1Y1V B;  2F0J A;  3PIO 3;  3K58 A;  1HUM A;  3FRP B;  1SMY C;  3OMC A;  4C3J B;  1I4G A;  3OWE B;  4M1U B;  5CYU A;  1IW7 D;  3KF8 A;  2PO4 A;  4QCL A;  2LY7 A;  1BXT A;  2D2C C;  5JPM C;  2WIN B;  3U9O A;  5BN4 A;  2BE5 C;  2BOS A;  2EVB A;  2WP8 J;  3WOE A;  2K04 A;  5BN3 A;  2QIL A;  2AQ2 B;  3HS0 C;  3H09 A;  5A2Q L;  5AFW A;  2AUK A;  3DM1 A;  3A8I E;  5DNF A;  4U67 3;  2B63 B;  4L8J A;  2PZU A;  4ULL A;  3JAM L;  3SK4 A;  4MN3 A;  1PYW D;  1OXU A;  2B2Y A;  5KND A;  4L63 B;  3D4D A;  1MGS A;  4ZRZ A;  1CK1 A;  2F3W A;  2R6G A;  5FLX E;  1ZXT A;  5T1I A;  3NBI A;  5EKL A;  4KKT A;  3S17 B;  2HCC A;  5I4D A;  3EJI A;  1E2W A;  2OEO A;  1F9Q A;  5EQ0 A;  2ZT9 C;  2B39 A;  3CRK C;  1XXG A;  3A8K E;  1PZJ D;  5IT9 E;  2DY7 A;  1H9S B;  2L5T A;  1IW7 C;  3RZD B;  4J8Q A;  1BR9 A;  1OO9 B;  2DY8 A;  1V1O A;  1I4P A;  1IHZ A;  2K32 A;  2G9D A;  4QUF A;  4RGT A;  1D1I A;  3HG9 A;  4KKS A;  3IKJ A;  2R61 A;  1LT5 D;  4ZYS A;  2EXZ A;  5IOC A;  3T56 B;  2PZT A;  1R9T B;  2L9H A;  3N6R A;  4DXG A;  1TVX A;  3J7A V;  1C48 A;  3A7L A;  2LS0 1;  2F0E A;  3KBG A;  2C9O A;  2K33 A;  3NSW A;  2Z1C A;  1VF5 C;  3HOV B;  2EPB A;  4XT1 B;  3DHQ A;  1JB3 A;  5I2X A;  2NVX B;  3V96 A;  3SHL A;  2LFN A;  1I50 B;  1BOS A;  4X3T A;  1ILQ A;  1SND A;  5IGD A;  4C3H G;  4H13 C;  1DZ1 A;  1H9R A;  2E2H B;  4RKB A;  3K0Y A;  1QWY A;  3GO5 A;  1LT6 D;  2OXP A;  1HUN A;  1O7L A;  1LV9 A;  4BBS B;  5K5P A;  3GTJ B;  2A68 D;  3HOW B;  4IUT A;  4TRD A;  2F0U A;  5I6W A;  3J80 L;  2G9H D;  4A3K B;  2JEA I;  3NPP A;  4IUU A;  4OO1 G;  1B53 A;  4JK1 C;  5COY A;  3BYT B;  4NMZ A;  4BWG B;  3T51 B;  4K5W A;  1GUT A;  4OHJ A;  1QIL A;  3R93 A;  2JP1 A;  5EBD A;  3NTI A;  2ZXO A;  5EJW A;  3J7Y W;  1TKW B;  3I8Z A;  3EA6 A;  1HA5 A;  3ND9 A;  2VNU D;  1EY0 A;  2WII B;  4O42 A;  2L11 A;  3S1Q B;  5CV9 A;  4KD4 A;  4RGM A;  3GV3 A;  4UAI A;  2IJ0 A;  2E76 C;  4E6I A;  2XWJ B;  3VA7 A;  2HQE A;  2SNS A;  4X3U A;  3Q23 A;  1C4Q A;  2B2T C;  4K8J A;  1SYG A;  1JWS D;  1OXT A;  1WD0 A;  5CBE E;  1PRT C;  5KNC A;  5C3E B;  2EZV A;  2RA4 A;  4RFB A;  4OO1 I;  3C1F A;  3C3L A;  4ABN A;  2A68 C;  3NHH A;  4IN3 A;  4K5X A;  3TZD A;  4C1N K;  2HCI A;  1V1P A;  4HSP A;  2NVT B;  1SJH D;  3Q24 A;  1RHP A;  1MSG A;  3D31 A;  5M5Y B;  3DMU A;  2F0S A;  1L0X B;  2R3Z A;  1SYD A;  3KLS A;  1EFI D;  2C5C A;  3PMF A;  3C1E A;  1EQT A;  3GTO B;  3A55 A;  1E2Z A;  1STB A;  4RAU C;  3P7J A;  1QJO A;  5EPJ A;  1PTO H;  2ICI A;  5M3F B;  3AB9 A;  2F0P A;  1EIG A;  4HTH A;  2B2T A;  1WTP A;  4IUN A;  4IUV A;  2KEC A;  1I6H B;  1SYF A;  1IKL A;  3T16 A;  3GTM B;  5E1F A;  1GHJ A;  1TT2 A;  4F8M A;  1ET6 A;  1KTK A;  1AZQ A;  3K59 A;  1PXU A;  5JEA H;  1I3Q B;  1IKM A;  3QB3 A;  1MBY A;  1BCP B;  4DF7 A;  3SK8 A;  3LWU A;  3GTQ B;  4OIK A;  5I6Y A;  4RGO S;  1JOQ A;  1PFB A;  1SEB D;  4DAP A;  4A3G B;  5JJZ A;  2L0C A;  5HUR A;  3T4A C;  1Y8O B;  2KOL A;  4C3I B;  2EY6 A;  4BA2 I;  5IIF A;  1KNE A;  1F9S A;  2R93 B;  2XRS D;  4IUQ A;  1WTO A;  1EZ8 A;  2J0T D;  2OT2 A;  2KUM A;  2N88 A;  2Q8R E;  3ONA B;  3DUZ A;  1QE6 A;  1CHP D;  4H44 C;  1DD2 A;  4LJZ C;  3I4M B;  5NUC A;  1B9N A;  3R2T A;  2RKS A;  2EY1 A;  1CA5 A;  4CGY B;  3MWY W;  1CI3 M;  4KN7 C;  1F2Z A;  4O1N A;  5A2Q E;  3BG3 A;  1S4Z A;  3D6W A;  3K6O A;  1XX8 A;  1QCB D;  1G2T A;  1D6E C;  5CBA E;  2NN6 H;  1DXM A;  2X6G A;  4FXG C;  4XXE A;  3JAM E;  3EVQ A;  1TY2 A;  1TS2 A;  2A6H D;  4XQJ A;  1LTS D;  1QNK A;  2L4N A;  2ENB A;  2M9V A;  4DAY A;  4C3J G;  1I4X A;  4ZLT F;  2JYO A;  4G7H C;  1TWF B;  5DM7 3;  1FNU A;  3S9W A;  1A2T A;  1EYA A;  2NN6 G;  2SNM A;  3V05 A;  2KCN A;  1TWC B;  3M7N A;  4F88 A;  1EIH A;  4KN4 C;  2F0K A;  2HDL A;  1GUW A;  1A3V A;  3NP8 A;  3RLF A;  4B9W A;  3NQT A;  3MFY A;  2VUM B;  3MFG A;  5J39 A;  1W6K A;  2Q8I B;  2E75 C;  2TSS A;  3HKZ B;  3Q0A A;  3FPP A;  4XIG S;  5C0X G;  1CZW A;  2I07 B;  2JA6 B;  3L9A X;  1WTV A;  4PV1 C;  4KY5 A;  2FMM A;  1F77 A;  1PLF A;  1EY6 A;  3MC0 B;  4BBR B;  5G3L F;  3LNN A;  2F0D A;  5I9P A;  2LKV A;  2A6H C;  5D65 A;  2MPM A;  3LX0 A;  2F0M A;  1EU4 A;  2Q8T A;  3I91 A;  1G6Z A;  3RZO B;  3FPU B;  2IWH A;  5CGK A;  5EBC A;  5CMD A;  4RHR A;  3PO3 B;  3BDO A;  3DWA A;  4Q5V A;  2Z8L A;  1H9S A;  1KNA A;  1EWC A;  5E4W C;  1U4M A;  2ICE C;  3V2T A;  3R2I A;  2ZXP A;  1B44 D;  3I73 A;  1SNP A;  2N55 A;  1SYC A;  4IFD G;  2KVM A;  1WCM B;  3L3O C;  1SDF A;  3M4O B;  1TS3 A;  1STE A;  2LMC B;  1LTI D;  2MP1 A;  5JOB A;  3J80 E;  2F0L A;  1YNJ D;  2Z4I A;  2IX0 A;  3I70 A;  5C0X I;  3D3R A;  1E0B A;  4C56 C;  4EQN A;  4IAL A;  1VMP A;  4L6T B;  3OMG A;  2AWN A;  2F0O A;  4TSS A;  1KDC A;  1EWH A;  2F0F A;  3HEJ A;  1X32 A;  3KUP A;  3Q6S A;  1H9K A;  2WB1 B;  1A6X A;  1LTB D;  3ND8 A;  4HMI A;  4H7B A;  1CTM A;  2RDH A;  1O7Z A;  2DN8 A;  4KTA A;  3MA2 B;  5C3W A;  1LAB A;  1JOO A;  1J9O A;  3VR3 A;  2KEE A;  1ENA A;  1S5F D;  2EYJ A;  1DJR D;  1FYC A;  2Z4H A;  1JWU D;  2AQ1 B;  3DXJ C;  1MD2 D;  1LT4 D;  3VYT A;  3I3C A;  4FO2 A;  5JEA J;  4IFD I;  3HZX A;  1DOL A;  1B4O A;  1KAB A;  2F0T A;  1I4R A;  4KHZ A;  4KJN A;  4B9X A;  3GTL B;  4CJ0 B;  1YNJ C;  1SNO A;  2XSC A;  2F4I A;  5JVG 3;  2IX1 A;  3VYS A;  3SR1 A;  3FMC A;  1MI2 A;  2E74 C;  5KYI A;  1GJX A;  1SBB B;  1JIC A;  3QO2 A;  4PQX A;  1ICW A;  3LWE A;  5C44 B;  4BA1 I;  3IAY A;  4DXF A;  4I65 A;  5ELD A;  3CQZ B;  4OO1 H;  3OIQ A;  2GA4 B;  2O5I C;  5KRU A;  2XNA C;  1C8C A;  1K8O A;  2NZ1 D;  5D14 A;  4DN4 M;  3J81 E;  1V8Q A;  2CVR A;  1HXY D;  2JSO A;  4DU9 A;  4C2M B;  1RDP D;  3Q22 A;  1YNN D;  2EY5 A;  1SFO B;  4QIW B;  5C6A A;  1LTG D;  1WTQ A;  5ELF A;  1O80 A;  3E6Z X;  4ILW A;  3M85 A;  2RDG A;  2EYH A;  5CV8 A;  1F2L A;  5IGE A;  5LHY 1;  3VYR A;  4I7Z C;  5CC4 A;  5C4Z A;  1ZKO A;  3S14 B;  4LK1 C;  3PV0 A;  5IGC A;  4IUR A;  2NYZ D;  3H0G B;  3AMU A;  2RSO A;  2RVL A;  1QB5 D;  3GTP B;  3E0J A;  1STN A;  4HCE A;  5G3L D;  4N9P A;  2PNR C;  5ELC A;  1TS5 A;  2DNC A;  3D4W A;  1PFM A;  3A56 A;  1HRJ A;  3GTK B;  3OWF A;  2QDB A;  5C5M A;  2QEJ C;  1CQV A;  5FLX L;  1Y8P B;  1NSN S;  4KY6 A;  1STG A;  1RCV D;  1J8I A;  4XTC S;  3HOZ B;  1TY0 A;  1YNN C;  1GOZ A;  4PNY A;  1EEF D;  4TQU S;  4MIU A;  2E2I B;  1CQF A;  4C3I G;  3QIA A;  1Y69 U;  2EJG C;  1CM9 A;  3IFD A;  4XT3 B;  2JA5 B;  3N52 A;  5IT9 L;  2PW7 A;  4UDU C;  1RTN A;  2H4O A;  1Z47 A;  4F87 A;  3NWS A;  3TP6 A;  3S1R B;  4FF4 A;  1AW7 A;  2PQE A;  2K6A A;  2VXW A;  5JPN C;  1U4L A;  2J4X A;  1Y8N B;  2L12 A;  4CKB A;  3I4N B;  3H3V C;  3DWP A;  1O7Y A;  3A7A B;  4Y7N B;  3URY A;  3HOU B;  5ELB A;  2JA7 B;  2NB0 A;  2NTS A;  1CZG A;  2KCC A;  2AUJ D;  5C3X A;  3BVG A;  1TQO A;  2JE6 I;  3NXW A;  3NQI A;  4DA2 A;  4KY7 A;  5HGT A;  3DEO A;  1TWA B;  4WRD A;  3W3A A;  1EOT A;  3TSS A;  1SYB A;  1CT1 D;  1ILP A;  5A35 A;  2KED A;  2BDO A;  1AP0 A;  4ZUI A;  3HGB A;  5F2D A;  3D4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...