1JQYD

Heat-labile enterotoxin b-pentamer with ligand bmsc-0010
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN B CHAIN
publication title Anchor-based design of improved cholera toxin and E. coli heat-labile enterotoxin receptor binding antagonists that display multiple binding modes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, L, M, N, O, P, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jqyD00
1AW7A 1CHPD 1FNVA 2QILA 4L6TB 4RGNA 1CT1D 2AQ3B 3W2DA 3DWQA 1BCPF 1ET9A 2IJ0A 2CHBD 1D5ZC 2XRQD 3DWPA 1L0XB 3URYA 1SJHD 1PZKD 2G9HD 2RDGA 1LTBD 1S5ED 1KLGD 2WV6D 1SE2A 1TY0A 5D3IB 4RCOA 3KLSX 1ESFA 1JWSD 1HA5A 1JWUD 1JWMD 1PTOC 2AQ1B 1LTID 4RHSA 1BCPB 1RF2D 1UNSA 3V05A 1I4PA 1GOZA 1AN8A 1FGBD 1PYWD 5ELBA 3TSSA 2XN9C 4RH6A 1ENFA 3DWAA 3BYTB 5FK9C 1D5MC 1CK1A 1ET6A 1TS5A 1EU3A 1TY2A 1S5FD 3R8BA 1EU4A 1STEA 1LTGD 3R2IA 2O2LD 1LTAD 1XTCD 3EA6A 3R2TA 4RFBA 1FNUA 3BVZA 3SEBA 1CQVA 1PTOD 1PRTB 4Z9CB 2Z8LA 1QILA 1D5XC 1CHQD 1SE3A 1EFID 1L0YB 1S5DD 1PZJD 3O13A 1RDPD 2NTSA 4RGTA 1FD7D 1LTRD 1V1PB 2ICIA 2J4XA 1FNWA 2AQ2B 3BZDB 4TSSA 1JCKB 3MFGA 2XNAC 1T5XD 4O1NA 1SE4A 4BWGB 1BXTA 1I4GA 5D3DA 1I4XA 2NTTA 4C56C 1HTLD 1HQRD 1SBBB 1LLRD 1V1PA 1S5CD 1EWCA 1HXYD 1PRTC 1SJED 1TS3A 1EEFD 1LTSD 2SEBD 1DJRD 1I4HA 1RCVD 1KTKA 5TSSA 1F77A 1B44D 3BVMA 3EFXD 1KLUD 1I4QA 1EEID 1LT6D 1DYQA 1MD2D 1BCPC 1PTOH 1I4RA 4L63B 5ELDA 2QEJC 5ELCA 4DXGA 3OWEB 5ELEA 2XRSD 1LT4D 3BVGA 1V1OA 1PZID 1JQYD 1PTOF 2R61A 2TSSA 1UUPA 2IPKD 4RGOS 4UDUC 4DXFA 4OHJA 1PRTD 4K6LA 1XXGA 3GP7A 1SEBD 1M4VA 4RGMA 3CHBD 4ZYSA 1JR0D 1D6EC 2RDHA 1TS2A 5ELFA 1G8ZD 1BCPD 1RD9D 1S5BD 5I4DA 1LTTD 1LT5D 1PTOB 1LT3D 5FKAC 1LO5D 1SXTA 1PRTF 1TS4A 3MC0B 3BYYB 1B1ZA 4RHRA
chains in the Genus database with same CATH superfamily
1AW7A 2JA6G 3D4RA 4F7XA 4IFDH 1KXLA 3E5SA 1HFGA 4O0AA 2DNCA 1PHJA 2I46A 1EOVA 3DWPA 2UXCQ 2F0FA 3JAME 4A3BB 4KHVA 1B8AA 1M8AA 1R4QB 3MEHA 3VDYA 1SE2A 2B39A 2R93H 1TY0A 2KA7A 1JWUD 1A3TA 1NY4A 2Z4IA 4FVMA 2VL6A 3G7LA 1VF5C 4OO1I 4A3LH 1NNXA 1ENAA 4Y7NH 4A3DG 1KC8C 2JA5G 2E2JB 4B3TQ 1BKBA 4N8FA 2OXPA 4JW0A 1E1OA 3VYUA 4XQJA 3FKIH 1S5FD 2ZXPA 1PV4A 2E5LL 2JA6B 2JEBI 3TZUA 4UY8C 4MZ9A 4DAYB 3GTQB 3I3CA 1S5DD 4DR4Q 2PW7A 3CCRA 2KHJA 3AB9A 3SXHA 4LW1A 1WOCA 4FF4A 4R4IA 1YJNA 1J6QA 2JA5B 1ENCA 1IBLQ 2AMCB 3AYHB 1K3RA 4R4CA 5BR8L 4A3FG 4N9TA 1AP0A 3A8IE 1LTSD 3H0GB 2PQAB 3NK9A 5FJ8H 4AYBE 4QF4A 1TWFB 3I4NH 4I7ZC 4WJWA 1KTKA 5TSSA 1D7QA 3CQZB 1I6HB 4KHZA 2CW0D 1I4RA 2AWOA 3Q6SA 2QEJC 1HPCA 3UDFA 4KHPQ 3HKZE 2A74C 1I6VC 5C3EG 5IGCA 4YWLA 1WI5A 4RGMA 3M4PA 4IZ8A 3J80E 4DR6L 1BNZA 4C3JG 2MHVA 2RDHA 2N3SA 1H95A 4HIMA 2R7ZG 4EVOA 3NHHA 5IE8A 4XYQA 3M85A 2Q8TA 4A3IB 1JJ2A 1IBKL 1LO5D 1XNQL 1SXTA 1PRTF 1SMYC 2BOSA 2K33A 4PG3A 3T1YL 5IYBG 1B1ZA 4XDXA 3Q22A 3TQYA 3I91A 2F0DA 4BBSH 1ET9A 2EPBA 1RKNA 1UAPA 2RCFA 2IJ0A 4DK0A 3N52A 2EY2A 3PO2B 4R4QA 1RL2A 4B3SL 2VUMH 2I0QA 2F03A 3A54A 4IUQA 3G6JB 1ESFA 4RCOA 5F2DA 4GLXA 2CH4W 2DN8A 2AQ1B 2F0EA 5LMNQ 4JI4L 1RF2D 1Q12A 5LMUQ 4X65L 4LF5L 3TSSA 3ZYYX 1KD1C 1HTPA 1K0SA 1ENFA 3S2HH 3E9HA 3TREA 4K0KQ 4X6AH 5E3FA 1EU4A 1B2TA 3SR1A 1Q82C 4DR1Q 2R93B 2N78A 5JEAH 3HOYH 4FNFA 1YJ9A 1BDOA 1RIPA 1OXTA 1HZCA 1EFID 4ZCKA 4AQYQ 3PO3B 4YCWA 4CDDC 3I4LA 4Y7NB 2J4XA 2CKZB 2MNAA 3U4ZA 2NZOA 2D5DA 3J81c 1GXDC 4JG2A 3BZCA 2I07B 2QA4A 5FJ8G 3FKIB 2B2VA 1E3PA 5T1IA 3I4NG 2CWPA 2EVBA 1BF4A 4R1JA 1YNXA 1TWHH 1Q1EA 1L1OB 1PMRA 2R3ZA 2R92H 4B3MQ 2N49A 1S72A 1HNXL 1V1QA 1WTXA 2VQEL 4JYAQ 1JB3A 4UP7A 4JI7L 4K8IA 3P20A 2OT2A 4DR3L 4XT3B 5C4JH 1G91A 2NZHA 4ABNA 4PNYA 4A3JH 4NKLA 1L0WA 4IURA 5IYCH 1FVIA 2NYZD 2MUYA 4OHJA 1XXGA 2L11A 5C4XH 4LFAL 4JBJA 2VQFQ 1CSQA 5FLXE 4DV1L 1QCBD 1JOKA 2RQXA 4C1NI 2BDNA 4LJZC 1BBXC 3RZDH 4DV2L 1HZ9A 3EVQA 2KVMA 4OWXB 4BBSG 4BBRH 4QUFA 1QZGA 1S3OA 1Q7YC 3HOZH 3NEMA 3KDFB 2KCMA 2HQLA 2QILA 4S3SA 1ONLA 3CCVA 4LF8L 1CT1D 3DWQA 2K75A 2SDFA 2PZTA 1VQKA 2XSCA 4DV5L 4DK1A 2Z4HA 2ENBA 1ZYRC 1N36L 2B29A 3FP9A 3AFQA 3BDCA 4KN7C 5E1FA 3QB3A 3PF5A 2RKSA 4X3SA 1PA6A 4PZ8A 2B2TA 1EYCA 3C46A 4P71A 4BA2I 2EDGA 1I4PA 4NB3A 3I4OA 4KY5A 5EBDA 3HOYG 3M7NA 4BBSB 1ICFB 2NB0A 5FK9C 2PZWA 5E7NA 3T1HQ 5K36G 1WTQA 4NP5A 5L37A 2MQHA 2HD3A 2K32A 5AJ3Q 3I70A 2VUMB 4CKBA 4CJ0B 2UXCL 3EA6A 2EE1A 3OSOA 5AFWA 1PTOD 3Q0AA 5CV4A 1SMXA 2JJQA 1GJXA 3PIPA 2ZXOA 4DV3Q 2LXKA 1FGUA 5CGKA 1V1PB 5C44H 2B8GA 5M5WB 3CAMA 3TS2A 4YHHQ 3UE1A 2DGYA 3H94A 1IYJB 5NUCA 2EZVA 3S17H 2A69D 3S2HB 5JPMC 4HIKA 1VQEA 4B3TL 3E6ZX 4ZQ3A 3CC4A 4H13C 3PIP3 1BXTA 4Q5VA 2WKCA 1STBA 1XYIA 1LLRD 1JT8A 1VQ4A 3DEPA 4PZ7A 4CHTB 5IYCG 4EQPA 1QUQB 2KEDA 3KJPA 2HIXA 2IX3A 4XQNA 4AIMA 3BVMA 3EFXD 4PV1C 4DR4L 4EQ5A 3TP5A 3J81L 1MD2D 2WB1G 5ELCA 1ILQA 3SK5A 3OWEB 4DR2Q 5A2QE 2LFNA 1ZXTA 1TWHB 4RGOS 3HOZG 2K5DA 1BVSA 5KNCA 4QGUA 3G6EA 4KD4A 4KD3A 4DAMA 1V43A 1IBLL 2R92B 4HCSA 4DV0Q 4KY6A 1HRJA 2DY8A 2L4NA 1U4MA 4L5SA 3FRPB 2EY5A 3D6CA 1Z9FA 5C4JB 1E24A 2L9HA 3K7AH 4A3JB 5GAGC 4JI8Q 1PH3A 4KHPL 4HEDA 5C4XB 4HMIA 1DXMA 2PMZB 1GHKA 3BS1A 3GTLH 3IFDA 1IHZA 2QF7A 3RZDB 4MTKA 1LYLA 4ZRZA 5GAHC 4BBRB 1L1OC 1Q8IA 5BN5A 1TQOA 2BE5D 5CC4A 1GUWA 3HOZB 1CFMA 2OQ0A 2NN6H 2ZTEA 1DCZA 3KFUA 2FINB 1YNJD 3S1RH 1PH9A 4QMGA 4RH6A 1ET6A 3D31A 4LFBQ 1B53A 4YIJA 4A3MB 5C44G 3PIOA 4HJ9A 1CTMA 3RUZA 1Q46A 2JA7G 4DV7Q 2HUGA 3K0XA 3CMEA 4Z9CB 3EROA 1TIID 4GLAC 4CBVA 2G5DA 1GUSA 3K57A 5J1ZA 1EY4A 5KYIA 1STNA 3PIO3 1QWYA 2IX1A 1B50A 4ID6A 2B2UA 5LMNL 5J3BA 5EKKA 2EY6A 3S24A 5LMUL 4A75A 1KQSA 2UUAQ 4EQNA 1DOKA 1LM0A 3KF8A 3DM3A 1E2ZA 3CCEA 1PYSB 1E22A 3TRZA 4UPAA 3PCOB 1NUCA 1STHA 4K0KL 1EQTA 3M3YH 1X9NA 3PUYA 3GTMH 1HTLD 1Z47A 3W1BA 3WOFA 2PNHA 4DR1L 1S5CD 1PRTC 3K58A 1S40A 1TS3A 2L0CA 5C44B 2XWJB 5GAEC 3P75A 2Q2TA 5M3FH 2F0KA 1I4HA 4DFAA 1KRSA 5IIFA 4AQYL 1IXRA 3V2TA 1G6PA 3NP8A 2L1BA 1WJJA 1X32A 4DXGA 3J7A5 3S1NH 4JI0Q 4QUCA 2XRSD 4U68A 1JQYD 2EY1A 2R61A 3CF5A 5G3LD 4DXFA 1EOTA 1GUGA 1PFBA 2HCIA 1KNAA 2X6GA 4Q0FA 4FXKC 1C8CA 4C3IB 4KY7A 1S4ZA 5I6YA 1IL2A 5I9PA 4A93H 4B3ML 1G2SA 2IWHA 4JYAL 2UXBQ 4OIJA 2VW9A 1EQRA 4PMCA 1K8GA 3ERQA 3OW7A 5FLMH 2QW7A 4QB4A 2NN6G 5LL6X 3I4MH 1SFOB 2WAQE 3URYA 2VQFL 1Y69U 4LFCQ 3HOVH 2Y0SE 3OPOA 1VMPA 3M9BA 3RN2A 3GTKH 1KL9A 2KOLA 4K2KA 3RZOH 4UP8A 5CBEE 4HIDA 3MXNB 3JAML 3K7AB 1EZ6A 4DV6Q 1WTOA 4ZKBB 1EIYB 1FGBD 2QCPX 3D6WA 4R9WA 2HDLA 3GTLB 3W5OA 1EU3A 1FYCA 4FXGC 3U9SA 5HGTA 1PH4A 2NZ1D 2QDBA 3J7ZC 1H9SB 4LWCA 2RHQB 1QILA 5IGDA 3Q8DA 2E2HH 3HOUG 1STAA 4OXPA 1I5FA 1TU2B 3MHBA 4ZAIA 2XVSA 2BA0A 3S1RB 1CZGA 4HJ8A 1SDFA 1HR0Q 3MFGA 4BY7G 3KF6B 1FL0A 3BG3A 2FXQA 3HOWG 2JA9A 1UEAB 2CW0C 3T1HL 2K14A 3J7AV 4FYDA 2K01A 2MO1A 1JJCB 5DEHA 5AJ3L 2F0MA 1QB5D 2F0HA 3S1MH 4A3DH 2R7DA 4DGZA 4BA1I 4DV3L 3A55A 2K5QA 3KUPA 3CCLA 2UUCQ 5FLXc 4YHHL 4DA2A 5K5PA 1TR5A 4CKCA 4KKTA 4XXEA 4A93G 3R3OA 3F2UA 3IFTA 4TVAB 4NXMQ 4L8JA 1E0BA 5IWAQ 3S2DH 3CW2C 1FR3A 3OTOQ 1D6EC 3M7GA 3VYSA 4K8JA 4DNRB 1O7ZA 5M3FB 1BCPD 2J7ZA 1D8LA 2HQEA 5G3LF 3J80L 3MC0B 1HQMC 3NTHA 3S1NB 2JE6I 4KKSA 3K7UC 3CD6A 2R6GA 2E74C 2WFWA 4JOIC 1BQQT 3KLSA 2A6HD 5I2YA 4A3FH 3MAQA 4B9XA 4EGVA 2C9OA 2XWBB 3K5LA 2XRQD 3CCSA 5C4ZA 4MN3A 4A93B 1W3SA 4IFDI 1NR4A 4DV0L 4RG1A 5D3IB 1YI2A 5C3EH 2E8GA 2B63H 2BA1A 3ERSX 2UU9L 2EXDA 5C0XJ 3RLOA 2A1AA 3TS0A 2YTYA 4IUVA 4JI8L 1LV9A 5EJWA 4C3JH 2IT1A 3I4MB 2R7ZH 4DNIA 5BN4A 2B2WC 4POFA 3HOVB 3W1GA 3I90A 1SYEA 1PDQA 1UE1A 3GTKB 2F0NA 3A5UA 1QNUA 3J7AF 3RZOB 5GADC 4G7ZC 2QGQA 5IYBH 3U50C 4OGQC 2D0PA 2Z6KA 1X54A 3HG9A 1NAPA 5DM73 1FNWA 1TVXA 3KBGA 1TKWB 4P72A 4U673 1CA6A 5IOCA 3OOCA 3ULJA 1QNKA 4ODGA 4WFN3 4DAYA 4LFBL 4MTNA 4IPHA 1XPOA 2EQSA 3A74A 3T13A 2XTIA 1HNZQ 2E2HB 4DV7L 1MSHA 1AZPA 5JJLA 4NMZA 3CKIB 1KABA 1D2BA 4RWSC 3I55A 1F77A 1YJWA 1I4QA 5IT9c 1EEID 1WFQA 1CQFA 1KNEA 1ICWA 3S14H 2HIVA 4QIWE 2OWOA 4DN4M 3X3MA 5DLQE 3F2DA 3K80C 1PH5A 1K8MA 1KDBA 1X6OA 1KIXA 3S1MB 4A3DB 5CV7A 5CBAE 4V190 2PZUA 3BU2A 2RBMA 4F88A 4DAPA 5FLXL 1LTTD 1Y1WG 2FFKB 2UXDQ 4LF9Q 5J39A 4RHRA 2NVXH 3CRKC 1H9MA 2F0GA 1XTDA 4JI0L 1A0IA 2A68D 3C1EA 4ZUIA 3LGJA 2B63G 1BCPF 4JBMA 3S2DB 2K6AA 1IKMA 2CHBD 3VR6A 3RMHA 1F2MA 4BXXH 4ZKCB 1LTBD 1P16A 3NWSA 4CKEA 3KOJA 2PO4A 3GD7A 4R4TA 1JWSD 4XTCS 3T16A 2KENA 3CMAA 2F0JA 4HSPA 2HDMA 2IHFA 3D3RA 1PTOC 4XT1B 1DZ1A 2UXBL 2NWGA 1UNSA 3V05A 1RJTA 1GOZA 3M4QA 2J0TD 1VQ7A 4A3FB 4X3TA 1IBML 2MO0A 2XN9C 2F3VA 4F87A 3S15H 5HGQA 4DNTB 4C3HH 2A69C 1AZQA 5JJZA 3R8BA 1SYDA 3KJOA 1VQ6A 4LFCL 2B2YC 2BH8A 3A0JA 5CV8A 1MIUA 5C3EB 1L0YB 3QG1A 1PFSA 4KTAA 1NTGA 1MBYA 2F0UA 4DK3C 4DV6L 4C3JB 1ZEQX 2R7ZB 1I4GA 4GS3A 4UP9A 3K5NA 1AH9A 2SOBA 2A19A 2DNEA 1XMOQ 2I5HA 3GTPH 1HXYD 1NBWA 4IJLA 4IUUA 2HHHL 4OL7A 5K36H 4JCVE 3TDQA 5JPNC 2E2IH 4N9PA 3K6OA 3QR8A 3D0FA 1HR0L 4ULLA 1DD2A 5LMNW 1W2BA 2IX0A 3CHBD 3H15A 1MJEA 5A2QL 1DM0B 2WAQG 5IGGA 2B8FA 2EYOA 3PQIA 3S14B 2UUCL 2BE5C 5H1SE 4BXXG 2Q2HA 4B08A 2NVQH 1HA6A 1FNVA 1CSPA 1EY0A 2EJGC 3I2ZA 4LF6Q 1KDAA 3MZ5A 1HZAA 4NXML 1YNJC 3DHQA 4CDCC 5IWAL 2PQEA 1IKLA 1S5ED 3OTOL 1HUMA 3C1FA 3VYTA 3I4NB 3KDFA 2IW3A 1J5EQ 3FDTA 1EUJA 4YWKA 1OXXK 1CKOA 2VXWA 1AE2A 5ELNA 4C3HG 2CVRA 3OYYA 1BCPB 1VQFA 2NVXB 1U0LA 2UUBQ 1A3VA 5KNDA 4O2DA 3CCUA 5C0XH 5D65A 4GOPA 1CM9A 2RHSB 5D14A 3U58A 3A56A 1SR3A 3R2TA 4RKBA 1OO9B 1PRTB 3A8KE 3RD4A 1JB7A 2KQ3A 3E0JA 1B4OA 4PZ6A 2VS1A 3NQTA 3BZDB 1FJGQ 2V4DA 4LAAA 2E75C 4MIUA 1STYA 3EIVA 4I7AA 1Q90A 2KHIA 3S15B 3LX0A 2L55A 4TQUS 4HJ5A 2SNMA 4J1MA 1WTHA 1CKNB 1V1PA 3QOLA 1NJIC 4PQXA 1EEFD 1Y14B 5JVG3 1RCVD 2C35B 5IYDG 1SNQA 1LTLA 1DYQA 1B70B 2FMCA 3SVMA 1E1TA 4L63B 3VYRA 1QG7A 2JA7H 3BVGA 2ALYB 1EY9A 1SNDA 2EYFA 1N32Q 4GKJQ 1QUQA 2A6ED 3HP3A 3GTPB 3HOYB 4KJOA 1HNZL 1C9OA 2ZM6Q 3AQQA 3VA5A 2HT1A 3CPWA 1A15A 1V9PA 3KLWA 2ZJPA 2RA4A 4A3CH 3NBHA 1XNRQ 4BY1G 2E2IB 2QKIC 1X3FA 4CJ2C 4L5RC 1O80A 2Q8IB 5IT9E 1VQDA 4KJNA 1WCMG 4JVZA 5C0XG 2RSNA 3RNUA 2LXJA 1PH2A 2UXDL 2NVQB 2O4XA 3Q23A 3FHWA 1GM5A 3D4WA 5JVH3 1XWEA 3GV6A 5A35A 3NTKA 1EYGA 2K03A 1B9NA 3AEVA 5JAVA 4A3KH 2CWAA 2NN6I 3KBXA 1QVGA 4J6HA 3HKSA 4OEMB 4DKAC 3STBD 1LTGD 2WB1B 1Q1BA 3QJYA 5C3WA 1W6JA 2JEAI 2RDFA 1AFPA 4IUPA 2Z8LA 3HFZB 2BDOA 4G7HC 1SE3A 4JI5Q 1RTNA 2OEOA 3JC66 1EY8A 1KAAA 2AQ2B 3K81C 3WOEA 3CP0A 1C0AA 2PCFB 1X3EA 1J9OA 2LKVA 2XNAC 1X65A 3SK4A 1R9TH 1SNPA 1SNCA 1YNND 2EJFC 4PMWA 3ER0A 5EPJA 1CKMA 1SN8A 3TN2A 3TP6A 1F9QA 1B7YB 1SSOA 4KK7A 1LUZA 1I50H 4IFDJ 1EWIA 1NE3A 5E4XA 3OIPA 4JI1Q 3OW2A 2GA4B 1BCPC 1PTOH 2F0WA 1TWAH 2JSOA 3UDXA 2CFMA 4MHEA 4AYBG 1PTOF 4A3CG 3HOUH 4ALPA 4UDUC 4C2MH 3NQIA 4X62Q 1JE5A 5EKIA 2A6HC 3HKZG 5CORA 2KEEA 5CV5A 2YV5A 1F2YA 2PNRC 5ELFA 1XMOL 1IYVA 3CU7A 1RD9D 4GNXA 4BY7H 1LT5D 4JI3Q 3HOWH 4JI6Q 3Q24A 1GO3E 1SROA 2JA7B 2B2WA 4I65A 1B3AA 1MGSA 3S17B 5IGEA 2O5IC 4A3EG 2YTVA 2G9DA 1XPUA 4G7OC 1KAWA 3CCMA 2A8VA 1WD0A 4V0BA 3TEHB 1KHIA 4JBWA 3K0YA 3G71A 2G9HD 1SLJA 2CCZA 4R8IA 2AKWB 4AYBB 5JJKA 2ZTDA 2K5WA 1TT2A 5EPKA 5FO7B 1U4RA 3KYHC 3GO5A 4A3KG 3OMCA 1T5EA 3L3OC 1LTID 2N55A 3H3VH 2TMPA 1U5KA 4X3UA 2B2TC 2MPMA 1SYBA 1CK1A 4KV6A 4LF6L 2EIFA 4WJ4A 3MXNA 1AE3A 2O2LD 1LTAD 3A5ZB 1HFNA 1B9MA 4P73A 4X64Q 1GKHA 1GVPA 2YU9H 1D5XC 2F4VQ 2H5XA 5IGBA 4NW2A 1PH6A 1J5EL 2EYJA 5M5XH 4HIOA 3T1YQ 3P7JA 2K7VA 1GUNA 1TWCH 2K5HA 5I6WA 3MA2B 2UUBL 1P8LA 2K5NA 3I8ZA 3NPPA 3PV0A 4A3KB 3WWVA 2ES2A 1JE4A 1VF7A 4HTHA 4BWGB 1H9JA 3W3AA 4QJFA 2K04A 5C4HA 1EL0A 1I4XA 2LS01 2PI2E 1YBYA 1OXVA 2QEXA 1HQRD 4J15A 4PMBA 2L12A 3ZJYC 1SJED 2K28A 1Q81C 1J8IA 3X3NA 1DJRD 1STGA 1B44D 3PUXA 1KLUD 2SNSA 4HJ7A 4YCVA 4DR7Q 1QVCA 1MKHA 3CPFA 1R9TB 2X69A 2RCNA 1QJOA 1UEBA 3HGBA 4HAEA 1GD7A 3RLNA 4X66Q 3WDNA 2XIWA 1F2ZA 2A68C 2F0PA 1VQJA 4CDEC 2L15A 3OHXC 2K4KA 2F0IA 1U4LA 1WTWA 2OCEA 1VQAA 3QO2A 4H7BA 3GTQH 5E4WC 3D8GA 1BR9A 4YCUA 1PTOB 5C5LA 1TWAB 3I72A 3S9WA 1DGSA 3RN5A 1Y8NB 4QCLA 4DF7A 5JEAJ 3HOUB 1CI3M 3MXPA 4C2MB 1D1KA 3FVQA 2AQ3B 3W2DA 1QVFA 1X55A 3M3YB 3GTMB 3EJIA 1A2UA 1VDZA 1N32L 1DONA 3J81i 4GKJL 1SYFA 2F3IA 2VB2X 3BJUA 4N8X1 1KLGD 4KI0A 4BY7B 2ZM6L 1O7YA 3QIAA 2DJGC 3TMEA 2D9UA 3HOWB 1MSGA 3SDZA 1K8OA 1DOLA 1EFWA 1XNRL 4DR3Q 5JJIA 3NE5B 1K3BC 2F0SA 3CRLC 1SAPA 3BDLA 3HOXH 2C5CA 2MP1A 2JXMB 4B9WA 5IODA 1VMCA 3BYTB 1Z6HA 3CCJA 4DR2L 1EY6A 1HH2P 1YHBA 5HY6A 2F0OA 1Y1WH 4H44C 2OQKA 4XQQA 4A4IA 1SNMA 3P1HA 4DV2Q 1FNUA 3HS0C 1SRUA 3U4VA 2ICIA 3BDOA 5FO9B 1K83H 1JCKB 4P74A 4JC0A 2K5VA 1I94Q 5COYA 5IY0A 4LK1C 2B2UC 3LWUA 1VQGA 2PMZE 2Z6BA 2YU9B 5KGUA 5EKLA 4NPSA 1QE6A 3A7AB 5M5XB 5JOBA 3M4YA 2L5TA 1K28A 2FHTA 4JI5L 1TWCB 1QZHA 1LT6D 5IP9H 1IZ6A 1CA5A 4WJ3M 4G57A 1TWGH 4IUNA 1L2FA 1WD1A 2LMCB 4GKKQ 4OX9Q 1UE5A 3D4DA 1A6XA 1Q3LA 4BS9A 1JICA 1VQNA 3SE0A 2YYZA 2WKDA 1LT3D 3UE0A 3A7LA 3PO3H 4RKLA 4JI1L 2ID0A 3VA7A 4GN4B 3I56A 2NVTH 3G48A 2UUAL 2AWNA 5M3MH 3H0GG 3NELA 1IW7D 1YVCA 3R93A 5KIXA 4X62L 2K50A 1VQLA 1L0XB 3EBEA 2X6LA 2PQAA 3PSIA 4CGYB 2F0VA 4OO1H 5FOBB 1SNOA 3HOXG 4L5TA 3SK6A 1VQPA 5BN3A 1G6ZA 2NVYH 3FPPA 1W6KA 4IOAA 1PH7A 4LMQD 2EYHA 3ULLA 4JPBW 4JI3L 4JI6L 4LNQA 4DUZQ 5DM63 1I3QH 2WACA 1D5MC 2F1MA 1YHQA 4A3IG 1O7IA 4HN7A 3CCQA 3RR5A 1HZBA 1XTCD 4HCEA 1SYCA 3SEBA 1EQQA 2KJXA 2GN5A 4JBKA 3L7ZC 3K59A 5GROA 3M4OH 1JOQA 3BZKA 1PYBA 1LTRD 4ME3A 5EPLA 3K8AA 3PO2G 3HOXB 2KBNA 3F2CA 1EZ8A 1VQBA 1Y1WB 1B3QA 3JAMi 5IP9G 1SBBB 2OTJA 2JK8A 1BUVT 4IFDG 4X64L 4L5QA 2A6EC 2F4VL 2B63B 2SEBD 2H1EA 4KLKA 2FMMA 4KKUA 1K83B 1N8RC 2KCNA 2M2LA 1LACA 5CV6A 1JOOA 2BH2A 3OIQA 2JYOA 3ITPA 3PGZA 2R93G 3VR5A 4APVA 2CQOA 3F1ZA 1ML0D 4K6DA 1VQIA 3UI2A 4M8AA 4IPGA 3PO3G 4K6LA 4A3LG 3C2PA 1UE7A 1G2TA 1RODA 1YIJA 4LF7Q 1JR0D 1NMGA 2ZXRA 1G8ZD 5M3MG 4XIGS 5HURA 3FKIG 5CR3A 2JN4A 3K5MA 1VQ8A 3H3VC 5M5WH 4DR7L 4OO1G 2H4OA 2VB3X 1TWGB 1CHPD 1OXUA 4K5XA 4OWWB 4L6TB 2EYPA 4K2LA 1SE8A 2Z9HA 1L1OA 1OXSC 5C5MA 2RSOA 1IYUA 4IOCA 1UE6A 1SYGA 1M90C 4X66L 5IYDH 2AHOB 4NXNQ 4GN5A 1PH1A 2D62A 2WV6D 1N34Q 3STBC 3KLSX 2AUKA 5IT9L 2DJFC 4H0LC 4RA8A 3QWNA 2Y0SG 3FPUB 4FDBA 4DR5Q 4IUTA 2NVTB 1AN8A 1F2LA 4WRDA 5ELBA 5M3MB 5EAYA 1PFMA 3AFPA 3DWAA 3T56B 4ZK9B 2A73B 3B6YA 3J80i 1NSNS 1STEA 2R7FA 4BY1H 3HRZC 3PUVA 1K73C 2NVYB 5IGFA 3J7YW 1YNNC 3NWTA 1CHQD 5C0XI 4DUYQ 3E3XA 1Y8OB 3NENA 4F8MA 1RDPD 3PF4A 2PI2A 2Z6KC 1Q8KA 3ONAB 1MHWC 3GDEA 1I3QB 2Q8RE 2WIIB 1M1KC 3IKJA 3NSWA 5EGTA 2RVLA 1U4PA 1II3A 1C4QA 1T5XD 2WAQB 1KRTA 1WCMH 4DU9A 1YEZA 1GUOA 2Y0SB 4ZLTF 4JI2Q 3LWEA 1G291 3S1QH 2F52A 3L0OA 3M4OB 2CH4A 4HR7B 5LHY1 4K5VA 1XMQQ 4HJAA 1XJVA 4IPDA 4CDFC 4ZUJA 1OTCA 3GTJH 1RTOA 4DAVA 4R4OA 1YHAA 4DR6Q 4DV4Q 2VUMG 5ELDA 1JORA 1CKNA 1I94L 3H09A 4FF3A 3TZDA 4C3HB 4TKOB 2KUMA 4A3MH 3AU7A 4RCNA 4H02A 2ASBA 1WYDA 3F8TA 4GOPB 1H9RA 1R4PB 1Y8PB 5LL6S 1AEXA 3UDIA 2GVBA 2A5HA 3TP8A 3GTOH 4KN4C 4Y52H 3ND8A 5FKAC 4JK1C 1HCZA 1TS4A 1EY7A 5JEAG 1CZWA 1EIHA 3L2PA 5FO8B 4JV5Q 2DUDA 3DXJC 2K52A 4NDXA 1EIFA 4TRDA 3C3LA 2JP1A 2YTXA 1G51A 2F0QA 1D5ZC 2NBFA 1EIGA 3MXGA 4GKKL 1SJHD 4OX9L 1VQ5A 1WVLA 2M00A 1SMYD 1A2TA 3T4AC 1HNWQ 3ULPA 3HZXA 4HMJA 1U9RA 3MVVA 3TBIB 3J81j 3DM1A 5KRUA 2R92G 2ATWA 5T1GA 2D2CC 1A63A 1BOSA 1NCVA 3HEJA 1V8QA 1TY2A 5C3XA 4YY3Q 1N33Q 2I5MX 3R2IA 2I5LX 3H91A 3BVZA 4A3JG 4C3IH 4A3EH 1EYAA 2MJ8A 2F0TA 5C4XG 4RGTA 1T9HA 1PZJD 3O13A 3IRBA 1FD7D 1Z7TA 1ESRA 1A62A 4OONA 2PPBC 3ICEA 1BBUA 4LF9L 3NBHB 3KLRA 2EOTA 4BBRG 4DUZL 1SE4A 1JC7A 2ICEC 2N8NA 4BY1B 2NTTA 4B3RQ 3CC2A 1SFOH 2AUJD 2XGTA 3UDGA 5I2XA 1VQHA 3GV3A 3U9OA 1EWHA 3IL8A 2UU9Q 4LF4Q 2F0LA 1RHPA 3ND9A 4A3MG 2E2DC 3JAMc 2LSSA 4LUVA 5IP7H 1WCMB 1LT4D 2WP8J 5EBCA 1KDCA 1Y1VH 2IY5B 5I4DA 1UUPA 3S1QB 1SEBD 4IPCA 4FXDA 2BCOA 4P2CB 3VR3A 3FEWX 2Z1CA 3MEFA 2QDLA 1WTVA 2B2VC 1CUKA 3DEOA 3GTJB 2F4IA 4IO9A 3FMCA 4CJ1B 3MFYA 4JOIA 3BYYB 4FO2A 1BBWA 2NUCA 1YITA 1C7YA 5I9OA 1XPRA 1EYDA 1PFNA 2DY7A 3DMUA 4FF1A 1HHVA 3E0EA 1ASZA 2EYMA 2OTLA 2E5LQ 3QOJA 1K8AC 3GQBA 4LF7L 2JA8H 4M1UB 3GTOB 1NR2A 2IL8A 1JWMD 3LNNA 1VQMA 1X3QA 2CQAA 4KMUC 4QIWB 1X3PA 4AH6A 4ILWA 3GTGH 4C3IG 1F9RA 1PYWD 1F9PA 4P75A 1K9MC 5M5YH 3DUZA 4IALA 1F9SA 1TS5A 1ZYRD 4YWMA 3H3VI 4GZYC 3NTIA 3KF8B 3L9AX 4IJHA 1NMFA 3S16H 4NXNL 1O7LA 5BR8Q 1ASYA 4DK6C 4GOPC 1N34L 2B3GA 1C48A 1X3GA 1E2VA 2NTSA 3I73A 4RAUC 1WTPA 2Z0SA 3J80c 1VQOA 3HKZB 4TSSA 5DAUA 2RF4A 4GNXB 3MXUA 4DR5L 5GQOA 5KYLA 4OELB 3PMFA 4QQBX 4O1NA 3G4SA 1A3UA 4QY7A 5D3DA 5DNFA 2KCTA 4ME5A 1HJPA 2OF1A 3T51B 4C1NK 5IP7G 4HSVA 4A3EB 1BO0A 1EQVA 2GVAA 1VCIA 3J81E 1EWCA 4OIKA 1PH8A 4GLVB 1Y1VG 4WORA 4DUYL 1H9KA 1IBKQ 1XNQQ 2KHSA 2ZJQA 1IBMQ 3CXCA 4A3GH 2EXZA 4DPGA 2KECA 1O78A 1H9SA 1VQCA 1PZID 3CC7A 1LABA 2TSSA 2IPKD 2IHEA 1JJGA 3RLFA 3E9IA 3AMUA 1PXUA 3GP7A 1PLFA 5KEEA 5J22A 4JI2L 4J8QA 4UHVA 4EX5A 4B3SQ 3F2BA 1IW7C 1TS2A 5CV9A 4A3BH 3NXWA 1XMQL 2PYKA 3PUZA 2D0OA 4XYOA 2VNUD 3V96A 5CMDA 1D1IA 2M9VA 4O42A 1ILPA 2VY3A 3KF6A 4JI4Q 4OWTB 4X65Q 3SHLA 3A8JE 3K5OA 4DV4L 4LF5Q 2JA8G 2KCCA 3EN2A 1FJGL 4IQZA 4FF2A 1XX8A 1Y1VB 4RGNA 2E2JH 3VR4A 3SK8A 3OMGA 1MI2A 2K05A 3T53B 3TP7A 1PZKD 2RDGA 1N9WA 3OWFA 4K14A 1I50B 2JA6H 2MFIA 2Q2UA 1HA5A 2HHHQ 1YZ6A 4GN3B 1VQ9A 2EYLA 2V1CC 4RHSA 2HCCA 1UWVA 3EQLC 4UAIA 4QL5A 2ZJRA 4A76A 4JV5L 5M3FG 2B2YA 1QOHA 3H6MA 1GUTA 1WTRA 1MJCA 3VR2A 2P5ZX 2JA8B 1K0RA 1ZKOA 4EQOA 4RFBA 4R8NA 1CQVA 2JA5H 2ZT9C 1HR0W 1VS0A 1HNXQ 4X3KA 5EQ0A 2VQEQ 4C56C 4JI7Q 1HNWL 2F3WA 3MWYW 2N88A 5M9OA 3H0GH 2PW5A 3GTGB 2FJ2A 2LY7A 2WINB 1TWFH 4LUZA 1A8VA 5M5YB 4POGA 2JQOA 3CQZH 1I6HH 1GHJA 1JMCA 1E7ZA 4G4KA 4LFAQ 1E2WA 3MTSA 1TXYA 3S16B 4DV1Q 4YY3L 1N33L 1EY5A 2EJMA 4A3GG 3KK7A 5FLMG 5ISRA 3SGIA 3I4MG 1PVOA 2MGSA 4FP5D 5ELOA 3HOVG 5CYUA 3DLLA 1DOMA 4A3IH 3I7FA 3IAYA 4A3BG 4MNOA 1HUNA 5ELEA 2K1BA 4LF8Q 1V1OA 5C6AA 3NUCA 3NBIA 1PRTD 4DV5Q 3N6RA 1M4VA 4B3RL 1X56A 4E6IA 2Q2IA 4ZYSA 4LUOA 5KNBA 1N36Q 2ZTCA 3PO2H 2WB1E 4K5WA 4RMFA 3PUWA 1S5BD 1Q86C 2O5JC 1IL8A 4LF4L 2VZAA 4A3GB 2E76C 4GNXC 4IN3A
chains in the Genus database with same CATH topology
1AW7A 3D4RA 4F7XA 4IFDH 3E5SA 1HFGA 2DNCA 2I46A 3DWPA 2F0FA 3JAME 4A3BB 4KHVA 1M8AA 1R4QB 3MEHA 1SE2A 2B39A 1TY0A 2KA7A 1JWUD 1A3TA 2Z4IA 4FVMA 3G7LA 1VF5C 4OO1I 1ENAA 2E2JB 2OXPA 3VYUA 4XQJA 1S5FD 2ZXPA 2JA6B 2JEBI 3TZUA 3GTQB 3I3CA 1S5DD 2PW7A 3AB9A 3SXHA 4FF4A 2JA5B 1ENCA 4N9TA 1AP0A 3A8IE 1LTSD 3H0GB 3NK9A 4QF4A 1TWFB 4I7ZC 4WJWA 1KTKA 5TSSA 3CQZB 1I6HB 4KHZA 2CW0D 1I4RA 2AWOA 3Q6SA 2QEJC 1HPCA 2A74C 1I6VC 5IGCA 4RGMA 4IZ8A 3J80E 1BNZA 4C3JG 2MHVA 2RDHA 4EVOA 3NHHA 4XYQA 3M85A 2Q8TA 4A3IB 1LO5D 1SXTA 1PRTF 1SMYC 2BOSA 2K33A 1B1ZA 4XDXA 3Q22A 3I91A 2F0DA 1ET9A 2EPBA 1RKNA 1UAPA 2IJ0A 4DK0A 3N52A 2EY2A 3PO2B 2F03A 3A54A 4IUQA 3G6JB 1ESFA 4RCOA 5F2DA 2DN8A 2AQ1B 2F0EA 1RF2D 1Q12A 3TSSA 3ZYYX 1HTPA 1ENFA 5E3FA 1EU4A 1B2TA 3SR1A 2R93B 5JEAH 4FNFA 1BDOA 1OXTA 1EFID 3PO3B 3I4LA 4Y7NB 2J4XA 2D5DA 1GXDC 2I07B 3FKIB 2B2VA 5T1IA 2EVBA 1BF4A 1Q1EA 1PMRA 2R3ZA 1WTXA 1JB3A 4K8IA 3P20A 2OT2A 4XT3B 1G91A 4ABNA 4PNYA 4NKLA 4IURA 2NYZD 2MUYA 4OHJA 1XXGA 2L11A 5FLXE 1QCBD 1JOKA 2RQXA 4C1NI 2BDNA 4LJZC 1BBXC 3EVQA 2KVMA 4QUFA 2QILA 4S3SA 1ONLA 1CT1D 3DWQA 2SDFA 2PZTA 2XSCA 4DK1A 2Z4HA 2ENBA 1ZYRC 5E1FA 3BDCA 4KN7C 3QB3A 2RKSA 4X3SA 2B2TA 1EYCA 3C46A 4BA2I 2EDGA 1I4PA 4KY5A 5EBDA 3M7NA 4BBSB 2NB0A 5FK9C 2PZWA 5K36G 1WTQA 4NP5A 2K32A 3I70A 2VUMB 4CKBA 4CJ0B 3EA6A 2EE1A 3OSOA 5AFWA 1PTOD 3Q0AA 5CV4A 1GJXA 2ZXOA 5CGKA 1V1PB 2B8GA 5M5WB 3H94A 5NUCA 2EZVA 2A69D 3S2HB 5JPMC 3E6ZX 4ZQ3A 4H13C 3PIP3 1BXTA 4Q5VA 2WKCA 1STBA 1XYIA 1LLRD 3DEPA 4CHTB 4EQPA 2KEDA 2IX3A 4XQNA 3BVMA 3EFXD 4PV1C 3TP5A 3J81L 1MD2D 5ELCA 1ILQA 3SK5A 3OWEB 5A2QE 2LFNA 1ZXTA 1TWHB 4RGOS 2K5DA 5KNCA 4KD4A 4KD3A 1V43A 2R92B 4HCSA 4KY6A 1HRJA 2DY8A 2L4NA 1U4MA 3FRPB 2EY5A 3D6CA 5C4JB 2L9HA 4A3JB 4HEDA 5C4XB 4HMIA 1DXMA 2PMZB 1GHKA 3BS1A 1IHZA 3IFDA 2QF7A 3RZDB 4ZRZA 4BBRB 1Q8IA 5BN5A 1TQOA 2BE5D 5CC4A 1GUWA 3HOZB 1CFMA 2NN6H 1DCZA 2FINB 1YNJD 4QMGA 4RH6A 1ET6A 3D31A 1B53A 4YIJA 4A3MB 1CTMA 3RUZA 2HUGA 4Z9CB 3EROA 1TIID 4CBVA 1GUSA 3K57A 5J1ZA 1EY4A 5KYIA 1STNA 3PIO3 1QWYA 2IX1A 1B50A 4ID6A 2B2UA 5EKKA 2EY6A 4EQNA 1DOKA 3KF8A 1E2ZA 1NUCA 1STHA 1EQTA 3PUYA 1HTLD 1Z47A 3WOFA 1S5CD 1PRTC 3K58A 1TS3A 2L0CA 5C44B 2XWJB 3P75A 2F0KA 1I4HA 4DFAA 5IIFA 3V2TA 3NP8A 2L1BA 1X32A 4DXGA 4QUCA 2XRSD 4U68A 1JQYD 2EY1A 2R61A 5G3LD 4DXFA 1EOTA 1GUGA 1PFBA 2HCIA 1KNAA 2X6GA 4Q0FA 4FXKC 1C8CA 4C3IB 4KY7A 1S4ZA 5I6YA 5I9PA 1G2SA 2IWHA 4OIJA 4PMCA 3ERQA 3OW7A 4QB4A 2NN6G 5LL6X 1SFOB 3URYA 1Y69U 3OPOA 1VMPA 2KOLA 4K2KA 5CBEE 3JAML 3K7AB 1EZ6A 1WTOA 4ZKBB 1FGBD 2QCPX 3D6WA 4R9WA 2HDLA 3GTLB 1EU3A 1FYCA 4FXGC 3U9SA 5HGTA 2NZ1D 2QDBA 1H9SB 1QILA 5IGDA 1STAA 1TU2B 3MHBA 4ZAIA 2XVSA 2BA0A 3S1RB 1CZGA 1SDFA 3MFGA 3BG3A 1UEAB 2CW0C 3J7AV 4FYDA 2K01A 5DEHA 2F0MA 1QB5D 2F0HA 4DGZA 4BA1I 3A55A 2K5QA 3KUPA 4DA2A 5K5PA 1TR5A 4CKCA 4KKTA 4XXEA 3R3OA 3F2UA 3IFTA 4L8JA 1E0BA 1FR3A 1D6EC 3M7GA 3VYSA 4K8JA 4DNRB 1O7ZA 5M3FB 1BCPD 2J7ZA 2HQEA 5G3LF 3J80L 3MC0B 1HQMC 3NTHA 3S1NB 2JE6I 4KKSA 2R6GA 2E74C 1BQQT 3KLSA 2A6HD 5I2YA 3MAQA 4B9XA 4EGVA 2C9OA 2XWBB 3K5LA 2XRQD 5C4ZA 4MN3A 4A93B 4IFDI 1NR4A 5D3IB 2BA1A 5C0XJ 4IUVA 1LV9A 5EJWA 2IT1A 3I4MB 5BN4A 2B2WC 3HOVB 3I90A 1SYEA 1PDQA 3GTKB 2F0NA 1QNUA 3J7AF 3RZOB 4G7ZC 4OGQC 3HG9A 1NAPA 5DM73 1FNWA 1TVXA 3KBGA 1TKWB 4U673 1CA6A 5IOCA 3OOCA 1QNKA 4ODGA 4WFN3 4DAYA 3T13A 2E2HB 1MSHA 1AZPA 4NMZA 3CKIB 1KABA 1D2BA 4RWSC 1F77A 1I4QA 1EEID 1CQFA 1KNEA 1ICWA 4DN4M 3X3MA 1K8MA 1KDBA 3S1MB 4A3DB 5CV7A 5CBAE 4V190 2PZUA 2RBMA 4F88A 4DAPA 5FLXL 1LTTD 2FFKB 5J39A 4RHRA 3CRKC 1H9MA 2F0GA 3C1EA 2A68D 4ZUIA 1BCPF 3S2DB 2K6AA 1IKMA 2CHBD 3VR6A 3RMHA 1F2MA 4ZKCB 1LTBD 3NWSA 4CKEA 2PO4A 3GD7A 3T16A 1JWSD 4XTCS 2F0JA 4HSPA 2HDMA 3D3RA 1DZ1A 1PTOC 4XT1B 2NWGA 1UNSA 3V05A 1RJTA 1GOZA 2J0TD 4A3FB 4X3TA 2XN9C 2F3VA 4F87A 4DNTB 1AZQA 2A69C 5JJZA 3R8BA 1SYDA 2B2YC 5CV8A 5C3EB 1L0YB 3QG1A 4KTAA 1MBYA 2F0UA 4C3JB 1ZEQX 2R7ZB 1I4GA 3K5NA 2SOBA 2DNEA 1HXYD 4IUUA 4OL7A 5K36H 3TDQA 5JPNC 4N9PA 3K6OA 4ULLA 1DD2A 2IX0A 3CHBD 5A2QL 1DM0B 5IGGA 2B8FA 2EYOA 3S14B 2BE5C 4B08A 1HA6A 1FNVA 1EY0A 2EJGC 1KDAA 3MZ5A 1YNJC 3DHQA 2PQEA 1IKLA 1S5ED 1HUMA 3C1FA 3VYTA 3I4NB 2IW3A 3FDTA 1OXXK 2VXWA 4C3HG 2CVRA 1BCPB 2NVXB 1A3VA 5KNDA 5C0XH 5D65A 1CM9A 5D14A 3A56A 3R2TA 4RKBA 1OO9B 1PRTB 3A8KE 3RD4A 2KQ3A 3E0JA 1B4OA 3NQTA 3BZDB 2V4DA 4LAAA 2E75C 4MIUA 1STYA 1Q90A 3S15B 3LX0A 2L55A 4TQUS 2SNMA 4J1MA 1V1PA 3QOLA 4PQXA 1EEFD 5JVG3 1RCVD 1SNQA 1DYQA 2FMCA 3SVMA 4L63B 3VYRA 1QG7A 3BVGA 1EY9A 1SNDA 2EYFA 2A6ED 3HP3A 3GTPB 3HOYB 4KJOA 3VA5A 1A15A 2RA4A 3NBHA 2E2IB 2QKIC 4CJ2C 1O80A 2Q8IB 5IT9E 4KJNA 5C0XG 2RSNA 2NVQB 2O4XA 3Q23A 3D4WA 5JVH3 1XWEA 3GV6A 5A35A 3NTKA 2K03A 1B9NA 5JAVA 2NN6I 3KBXA 4J6HA 1LTGD 2WB1B 1Q1BA 3QJYA 5C3WA 1W6JA 2JEAI 2RDFA 1AFPA 4IUPA 2Z8LA 2BDOA 4G7HC 1SE3A 1RTNA 2OEOA 1EY8A 1KAAA 2AQ2B 3WOEA 2PCFB 2LKVA 1J9OA 2XNAC 3SK4A 1SNPA 1SNCA 1YNND 2EJFC 4PMWA 5EPJA 3TN2A 3TP6A 1F9QA 1SSOA 4KK7A 4IFDJ 5E4XA 3OIPA 2GA4B 1BCPC 1PTOH 2F0WA 2JSOA 4MHEA 1PTOF 4UDUC 3NQIA 5EKIA 2A6HC 5CORA 2KEEA 5CV5A 1F2YA 2PNRC 5ELFA 1IYVA 3CU7A 1RD9D 1LT5D 3Q24A 2JA7B 2B2WA 4I65A 1B3AA 1MGSA 3S17B 5IGEA 2O5IC 2G9DA 4G7OC 1WD0A 4V0BA 4JBWA 3K0YA 2G9HD 4R8IA 4AYBB 2K5WA 1TT2A 5EPKA 5FO7B 1U4RA 3GO5A 3OMCA 1T5EA 3L3OC 1LTID 2N55A 2TMPA 4X3UA 2B2TC 2MPMA 1SYBA 1CK1A 4KV6A 3MXNA 2O2LD 1LTAD 1HFNA 1B9MA 1D5XC 5IGBA 4NW2A 2EYJA 3P7JA 2K7VA 1GUNA 5I6WA 3MA2B 3I8ZA 3NPPA 3PV0A 4A3KB 1JE4A 1VF7A 4HTHA 4BWGB 1H9JA 3W3AA 2K04A 5C4HA 1EL0A 1I4XA 2LS01 1OXVA 1HQRD 4PMBA 2L12A 1SJED 2K28A 1J8IA 3X3NA 1DJRD 1STGA 1B44D 3PUXA 1KLUD 2SNSA 1R9TB 2X69A 1QJOA 3HGBA 4HAEA 3WDNA 2XIWA 1F2ZA 2A68C 2F0PA 3OHXC 2F0IA 1U4LA 1WTWA 3QO2A 4H7BA 5E4WC 3D8GA 1BR9A 1PTOB 5C5LA 1TWAB 3I72A 3S9WA 1Y8NB 4QCLA 4DF7A 5JEAJ 3HOUB 1CI3M 4C2MB 3MXPA 1D1KA 3FVQA 2AQ3B 3W2DA 3M3YB 3GTMB 3EJIA 1A2UA 1VDZA 1DONA 1SYFA 2VB2X 1KLGD 4KI0A 4BY7B 1O7YA 3QIAA 3TMEA 2D9UA 3HOWB 1MSGA 3SDZA 1K8OA 1DOLA 3NE5B 2F0SA 3CRLC 1SAPA 3BDLA 5IODA 2C5CA 2MP1A 2JXMB 4B9WA 1VMCA 3BYTB 1Z6HA 1EY6A 2F0OA 4H44C 4XQQA 1SNMA 3P1HA 1FNUA 3HS0C 2ICIA 3BDOA 5FO9B 1JCKB 5COYA 4LK1C 2B2UC 3LWUA 2YU9B 5KGUA 5EKLA 1QE6A 3A7AB 5M5XB 5JOBA 3M4YA 2L5TA 2FHTA 1TWCB 1LT6D 1CA5A 4G57A 4IUNA 1WD1A 2LMCB 3D4DA 1A6XA 1Q3LA 4BS9A 1JICA 3SE0A 2YYZA 2WKDA 1LT3D 3A7LA 4RKLA 2ID0A 3VA7A 2AWNA 1IW7D 5KIXA 3R93A 1L0XB 2X6LA 4CGYB 2F0VA 4OO1H 5FOBB 1SNOA 3SK6A 5BN3A 1G6ZA 3FPPA 1W6KA 4LMQD 2EYHA 5DM63 2WACA 1D5MC 2F1MA 4HN7A 1XTCD 4HCEA 1SYCA 3SEBA 2KJXA 3L7ZC 3K59A 1JOQA 1LTRD 5EPLA 3HOXB 1EZ8A 1Y1WB 1SBBB 1BUVT 4IFDG 2A6EC 2B63B 2SEBD 2H1EA 2FMMA 4KKUA 1K83B 2KCNA 2M2LA 1LACA 5CV6A 1JOOA 3OIQA 2JYOA 3ITPA 3VR5A 1ML0D 4K6DA 3UI2A 4M8AA 4K6LA 3C2PA 1G2TA 1RODA 1JR0D 2ZXRA 1G8ZD 4XIGS 5HURA 5CR3A 3K5MA 3H3VC 4OO1G 2H4OA 2VB3X 1TWGB 1CHPD 1OXUA 4K5XA 4L6TB 2EYPA 4K2LA 5C5MA 1OXSC 2RSOA 1IYUA 1SYGA 2D62A 2WV6D 3KLSX 2AUKA 5IT9L 4H0LC 4RA8A 3QWNA 3FPUB 4IUTA 2NVTB 1AN8A 1F2LA 4WRDA 5ELBA 5M3MB 1PFMA 3DWAA 3T56B 4ZK9B 2A73B 1NSNS 1STEA 3HRZC 3PUVA 2NVYB 5IGFA 3J7YW 1YNNC 3NWTA 1CHQD 5C0XI 1Y8OB 4F8MA 1RDPD 3ONAB 1I3QB 2Q8RE 2WIIB 3IKJA 3NSWA 5EGTA 2RVLA 1U4PA 1II3A 1C4QA 1T5XD 2WAQB 4DU9A 1GUOA 2Y0SB 4ZLTF 3LWEA 1G291 3M4OB 4HR7B 5LHY1 4K5VA 4ZUJA 1RTOA 4DAVA 5ELDA 1JORA 3H09A 4FF3A 3TZDA 4C3HB 4TKOB 2KUMA 3AU7A 4RCNA 1H9RA 1R4PB 1Y8PB 5LL6S 1AEXA 2A5HA 3TP8A 4KN4C 3ND8A 5FKAC 4JK1C 1HCZA 1TS4A 1EY7A 5JEAG 1CZWA 1EIHA 5FO8B 3DXJC 4NDXA 4TRDA 3C3LA 2JP1A 2F0QA 1D5ZC 2NBFA 1EIGA 3MXGA 1SJHD 1WVLA 2M00A 1SMYD 1A2TA 3T4AC 3HZXA 4HMJA 1U9RA 3MVVA 3TBIB 3DM1A 5KRUA 5T1GA 2D2CC 1BOSA 1NCVA 3HEJA 1V8QA 1TY2A 5C3XA 3R2IA 3H91A 3BVZA 1EYAA 2MJ8A 2F0TA 4RGTA 3O13A 1PZJD 1FD7D 1Z7TA 1ESRA 2PPBC 3KLRA 2EOTA 1SE4A 1JC7A 2ICEC 4BY1B 2NTTA 2AUJD 5I2XA 3GV3A 3U9OA 1EWHA 3IL8A 2F0LA 1RHPA 3ND9A 2E2DC 1WCMB 1LT4D 2WP8J 5EBCA 1KDCA 5I4DA 1UUPA 3S1QB 1SEBD 4FXDA 2BCOA 4P2CB 3VR3A 3FEWX 2Z1CA 1WTVA 2B2VC 3DEOA 3GTJB 2F4IA 3FMCA 4CJ1B 3MFYA 3BYYB 4FO2A 2NUCA 5I9OA 1EYDA 1PFNA 2DY7A 3DMUA 4FF1A 1HHVA 2EYMA 3QOJA 3GQBA 4M1UB 3GTOB 1NR2A 2IL8A 1JWMD 3LNNA 1X3QA 2CQAA 4KMUC 4QIWB 1X3PA 4ILWA 4C3IG 1F9RA 1PYWD 1F9PA 3DUZA 4IALA 1F9SA 1TS5A 1ZYRD 4GZYC 3NTIA 3L9AX 1O7LA 1C48A 1E2VA 2NTSA 3I73A 4RAUC 1WTPA 3HKZB 4TSSA 5DAUA 3MXUA 5KYLA 3PMFA 4O1NA 1A3UA 5D3DA 5DNFA 4ME5A 2OF1A 3T51B 4C1NK 4HSVA 4A3EB 1BO0A 1EQVA 1VCIA 3J81E 1EWCA 4OIKA 4WORA 1H9KA 2KHSA 2EXZA 2KECA 1O78A 1H9SA 1PZID 1LABA 2TSSA 2IPKD 3RLFA 3AMUA 1PXUA 3GP7A 1PLFA 5KEEA 5J22A 4J8QA 1IW7C 1TS2A 5CV9A 3NXWA 2PYKA 3PUZA 4XYOA 2VNUD 3V96A 5CMDA 1D1IA 2M9VA 4O42A 1ILPA 3SHLA 3A8JE 3K5OA 2KCCA 4IQZA 4FF2A 1XX8A 1Y1VB 4RGNA 3VR4A 3SK8A 3OMGA 1MI2A 2K05A 3T53B 3TP7A 1PZKD 2RDGA 3OWFA 4K14A 1I50B 1HA5A 2EYLA 4RHSA 2HCCA 3EQLC 4UAIA 2B2YA 1QOHA 3H6MA 1GUTA 1WTRA 3VR2A 2JA8B 1ZKOA 4EQOA 4RFBA 4R8NA 1CQVA 2ZT9C 4X3KA 5EQ0A 4C56C 2F3WA 3MWYW 2N88A 5M9OA 2PW5A 3GTGB 2FJ2A 2LY7A 2WINB 5M5YB 1GHJA 4G4KA 1E2WA 3MTSA 3S16B 1EY5A 2EJMA 3KK7A 5ISRA 2MGSA 4FP5D 5CYUA 1DOMA 3IAYA 1HUNA 5ELEA 2K1BA 1V1OA 5C6AA 3NUCA 3NBIA 1PRTD 3N6RA 1M4VA 4E6IA 4ZYSA 5KNBA 4K5WA 3PUWA 1S5BD 2O5JC 1IL8A 4A3GB 2E76C 4IN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AW7 A;  1CHP D;  1FNV A;  2QIL A;  4L6T B;  4RGN A;  1CT1 D;  2AQ3 B;  3W2D A;  3DWQ A;  1BCP F;  1ET9 A;  2IJ0 A;  2CHB D;  1D5Z C;  2XRQ D;  3DWP A;  1L0X B;  3URY A;  1SJH D;  1PZK D;  2G9H D;  2RDG A;  1LTB D;  1S5E D;  1KLG D;  2WV6 D;  1SE2 A;  1TY0 A;  5D3I B;  4RCO A;  3KLS X;  1ESF A;  1JWS D;  1HA5 A;  1JWU D;  1JWM D;  1PTO C;  2AQ1 B;  1LTI D;  4RHS A;  1BCP B;  1RF2 D;  1UNS A;  3V05 A;  1I4P A;  1GOZ A;  1AN8 A;  1FGB D;  1PYW D;  5ELB A;  3TSS A;  2XN9 C;  4RH6 A;  1ENF A;  3DWA A;  3BYT B;  5FK9 C;  1D5M C;  1CK1 A;  1ET6 A;  1TS5 A;  1EU3 A;  1TY2 A;  1S5F D;  3R8B A;  1EU4 A;  1STE A;  1LTG D;  3R2I A;  2O2L D;  1LTA D;  1XTC D;  3EA6 A;  3R2T A;  4RFB A;  1FNU A;  3BVZ A;  3SEB A;  1CQV A;  1PTO D;  1PRT B;  4Z9C B;  2Z8L A;  1QIL A;  1D5X C;  1CHQ D;  1SE3 A;  1EFI D;  1L0Y B;  1S5D D;  1PZJ D;  3O13 A;  1RDP D;  2NTS A;  4RGT A;  1FD7 D;  1LTR D;  1V1P B;  2ICI A;  2J4X A;  1FNW A;  2AQ2 B;  3BZD B;  4TSS A;  1JCK B;  3MFG A;  2XNA C;  1T5X D;  4O1N A;  1SE4 A;  4BWG B;  1BXT A;  1I4G A;  5D3D A;  1I4X A;  2NTT A;  4C56 C;  1HTL D;  1HQR D;  1SBB B;  1LLR D;  1V1P A;  1S5C D;  1EWC A;  1HXY D;  1PRT C;  1SJE D;  1TS3 A;  1EEF D;  1LTS D;  2SEB D;  1DJR D;  1I4H A;  1RCV D;  1KTK A;  5TSS A;  1F77 A;  1B44 D;  3BVM A;  3EFX D;  1KLU D;  1I4Q A;  1EEI D;  1LT6 D;  1DYQ A;  1MD2 D;  1BCP C;  1PTO H;  1I4R A;  4L63 B;  5ELD A;  2QEJ C;  5ELC A;  4DXG A;  3OWE B;  5ELE A;  2XRS D;  1LT4 D;  3BVG A;  1V1O A;  1PZI D;  1JQY D;  1PTO F;  2R61 A;  2TSS A;  1UUP A;  2IPK D;  4RGO S;  4UDU C;  4DXF A;  4OHJ A;  1PRT D;  4K6L A;  1XXG A;  3GP7 A;  1SEB D;  1M4V A;  4RGM A;  3CHB D;  4ZYS A;  1JR0 D;  1D6E C;  2RDH A;  1TS2 A;  5ELF A;  1G8Z D;  1BCP D;  1RD9 D;  1S5B D;  5I4D A;  1LTT D;  1LT5 D;  1PTO B;  1LT3 D;  5FKA C;  1LO5 D;  1SXT A;  1PRT F;  1TS4 A;  3MC0 B;  3BYY B;  1B1Z A;  4RHR A; 
#chains in the Genus database with same CATH topology
 1AW7 A;  2JA6 G;  3D4R A;  4F7X A;  4IFD H;  1KXL A;  3E5S A;  1HFG A;  4O0A A;  2DNC A;  1PHJ A;  2I46 A;  1EOV A;  3DWP A;  2UXC Q;  2F0F A;  3JAM E;  4A3B B;  4KHV A;  1B8A A;  1M8A A;  1R4Q B;  3MEH A;  3VDY A;  1SE2 A;  2B39 A;  2R93 H;  1TY0 A;  2KA7 A;  1JWU D;  1A3T A;  1NY4 A;  2Z4I A;  4FVM A;  2VL6 A;  3G7L A;  1VF5 C;  4OO1 I;  4A3L H;  1NNX A;  1ENA A;  4Y7N H;  4A3D G;  1KC8 C;  2JA5 G;  2E2J B;  4B3T Q;  1BKB A;  4N8F A;  2OXP A;  4JW0 A;  1E1O A;  3VYU A;  4XQJ A;  3FKI H;  1S5F D;  2ZXP A;  1PV4 A;  2E5L L;  2JA6 B;  2JEB I;  3TZU A;  4UY8 C;  4MZ9 A;  4DAY B;  3GTQ B;  3I3C A;  1S5D D;  4DR4 Q;  2PW7 A;  3CCR A;  2KHJ A;  3AB9 A;  3SXH A;  4LW1 A;  1WOC A;  4FF4 A;  4R4I A;  1YJN A;  1J6Q A;  2JA5 B;  1ENC A;  1IBL Q;  2AMC B;  3AYH B;  1K3R A;  4R4C A;  5BR8 L;  4A3F G;  4N9T A;  1AP0 A;  3A8I E;  1LTS D;  3H0G B;  2PQA B;  3NK9 A;  5FJ8 H;  4AYB E;  4QF4 A;  1TWF B;  3I4N H;  4I7Z C;  4WJW A;  1KTK A;  5TSS A;  1D7Q A;  3CQZ B;  1I6H B;  4KHZ A;  2CW0 D;  1I4R A;  2AWO A;  3Q6S A;  2QEJ C;  1HPC A;  3UDF A;  4KHP Q;  3HKZ E;  2A74 C;  1I6V C;  5C3E G;  5IGC A;  4YWL A;  1WI5 A;  4RGM A;  3M4P A;  4IZ8 A;  3J80 E;  4DR6 L;  1BNZ A;  4C3J G;  2MHV A;  2RDH A;  2N3S A;  1H95 A;  4HIM A;  2R7Z G;  4EVO A;  3NHH A;  5IE8 A;  4XYQ A;  3M85 A;  2Q8T A;  4A3I B;  1JJ2 A;  1IBK L;  1LO5 D;  1XNQ L;  1SXT A;  1PRT F;  1SMY C;  2BOS A;  2K33 A;  4PG3 A;  3T1Y L;  5IYB G;  1B1Z A;  4XDX A;  3Q22 A;  3TQY A;  3I91 A;  2F0D A;  4BBS H;  1ET9 A;  2EPB A;  1RKN A;  1UAP A;  2RCF A;  2IJ0 A;  4DK0 A;  3N52 A;  2EY2 A;  3PO2 B;  4R4Q A;  1RL2 A;  4B3S L;  2VUM H;  2I0Q A;  2F03 A;  3A54 A;  4IUQ A;  3G6J B;  1ESF A;  4RCO A;  5F2D A;  4GLX A;  2CH4 W;  2DN8 A;  2AQ1 B;  2F0E A;  5LMN Q;  4JI4 L;  1RF2 D;  1Q12 A;  5LMU Q;  4X65 L;  4LF5 L;  3TSS A;  3ZYY X;  1KD1 C;  1HTP A;  1K0S A;  1ENF A;  3S2H H;  3E9H A;  3TRE A;  4K0K Q;  4X6A H;  5E3F A;  1EU4 A;  1B2T A;  3SR1 A;  1Q82 C;  4DR1 Q;  2R93 B;  2N78 A;  5JEA H;  3HOY H;  4FNF A;  1YJ9 A;  1BDO A;  1RIP A;  1OXT A;  1HZC A;  1EFI D;  4ZCK A;  4AQY Q;  3PO3 B;  4YCW A;  4CDD C;  3I4L A;  4Y7N B;  2J4X A;  2CKZ B;  2MNA A;  3U4Z A;  2NZO A;  2D5D A;  3J81 c;  1GXD C;  4JG2 A;  3BZC A;  2I07 B;  2QA4 A;  5FJ8 G;  3FKI B;  2B2V A;  1E3P A;  5T1I A;  3I4N G;  2CWP A;  2EVB A;  1BF4 A;  4R1J A;  1YNX A;  1TWH H;  1Q1E A;  1L1O B;  1PMR A;  2R3Z A;  2R92 H;  4B3M Q;  2N49 A;  1S72 A;  1HNX L;  1V1Q A;  1WTX A;  2VQE L;  4JYA Q;  1JB3 A;  4UP7 A;  4JI7 L;  4K8I A;  3P20 A;  2OT2 A;  4DR3 L;  4XT3 B;  5C4J H;  1G91 A;  2NZH A;  4ABN A;  4PNY A;  4A3J H;  4NKL A;  1L0W A;  4IUR A;  5IYC H;  1FVI A;  2NYZ D;  2MUY A;  4OHJ A;  1XXG A;  2L11 A;  5C4X H;  4LFA L;  4JBJ A;  2VQF Q;  1CSQ A;  5FLX E;  4DV1 L;  1QCB D;  1JOK A;  2RQX A;  4C1N I;  2BDN A;  4LJZ C;  1BBX C;  3RZD H;  4DV2 L;  1HZ9 A;  3EVQ A;  2KVM A;  4OWX B;  4BBS G;  4BBR H;  4QUF A;  1QZG A;  1S3O A;  1Q7Y C;  3HOZ H;  3NEM A;  3KDF B;  2KCM A;  2HQL A;  2QIL A;  4S3S A;  1ONL A;  3CCV A;  4LF8 L;  1CT1 D;  3DWQ A;  2K75 A;  2SDF A;  2PZT A;  1VQK A;  2XSC A;  4DV5 L;  4DK1 A;  2Z4H A;  2ENB A;  1ZYR C;  1N36 L;  2B29 A;  3FP9 A;  3AFQ A;  3BDC A;  4KN7 C;  5E1F A;  3QB3 A;  3PF5 A;  2RKS A;  4X3S A;  1PA6 A;  4PZ8 A;  2B2T A;  1EYC A;  3C46 A;  4P71 A;  4BA2 I;  2EDG A;  1I4P A;  4NB3 A;  3I4O A;  4KY5 A;  5EBD A;  3HOY G;  3M7N A;  4BBS B;  1ICF B;  2NB0 A;  5FK9 C;  2PZW A;  5E7N A;  3T1H Q;  5K36 G;  1WTQ A;  4NP5 A;  5L37 A;  2MQH A;  2HD3 A;  2K32 A;  5AJ3 Q;  3I70 A;  2VUM B;  4CKB A;  4CJ0 B;  2UXC L;  3EA6 A;  2EE1 A;  3OSO A;  5AFW A;  1PTO D;  3Q0A A;  5CV4 A;  1SMX A;  2JJQ A;  1GJX A;  3PIP A;  2ZXO A;  4DV3 Q;  2LXK A;  1FGU A;  5CGK A;  1V1P B;  5C44 H;  2B8G A;  5M5W B;  3CAM A;  3TS2 A;  4YHH Q;  3UE1 A;  2DGY A;  3H94 A;  1IYJ B;  5NUC A;  2EZV A;  3S17 H;  2A69 D;  3S2H B;  5JPM C;  4HIK A;  1VQE A;  4B3T L;  3E6Z X;  4ZQ3 A;  3CC4 A;  4H13 C;  3PIP 3;  1BXT A;  4Q5V A;  2WKC A;  1STB A;  1XYI A;  1LLR D;  1JT8 A;  1VQ4 A;  3DEP A;  4PZ7 A;  4CHT B;  5IYC G;  4EQP A;  1QUQ B;  2KED A;  3KJP A;  2HIX A;  2IX3 A;  4XQN A;  4AIM A;  3BVM A;  3EFX D;  4PV1 C;  4DR4 L;  4EQ5 A;  3TP5 A;  3J81 L;  1MD2 D;  2WB1 G;  5ELC A;  1ILQ A;  3SK5 A;  3OWE B;  4DR2 Q;  5A2Q E;  2LFN A;  1ZXT A;  1TWH B;  4RGO S;  3HOZ G;  2K5D A;  1BVS A;  5KNC A;  4QGU A;  3G6E A;  4KD4 A;  4KD3 A;  4DAM A;  1V43 A;  1IBL L;  2R92 B;  4HCS A;  4DV0 Q;  4KY6 A;  1HRJ A;  2DY8 A;  2L4N A;  1U4M A;  4L5S A;  3FRP B;  2EY5 A;  3D6C A;  1Z9F A;  5C4J B;  1E24 A;  2L9H A;  3K7A H;  4A3J B;  5GAG C;  4JI8 Q;  1PH3 A;  4KHP L;  4HED A;  5C4X B;  4HMI A;  1DXM A;  2PMZ B;  1GHK A;  3BS1 A;  3GTL H;  3IFD A;  1IHZ A;  2QF7 A;  3RZD B;  4MTK A;  1LYL A;  4ZRZ A;  5GAH C;  4BBR B;  1L1O C;  1Q8I A;  5BN5 A;  1TQO A;  2BE5 D;  5CC4 A;  1GUW A;  3HOZ B;  1CFM A;  2OQ0 A;  2NN6 H;  2ZTE A;  1DCZ A;  3KFU A;  2FIN B;  1YNJ D;  3S1R H;  1PH9 A;  4QMG A;  4RH6 A;  1ET6 A;  3D31 A;  4LFB Q;  1B53 A;  4YIJ A;  4A3M B;  5C44 G;  3PIO A;  4HJ9 A;  1CTM A;  3RUZ A;  1Q46 A;  2JA7 G;  4DV7 Q;  2HUG A;  3K0X A;  3CME A;  4Z9C B;  3ERO A;  1TII D;  4GLA C;  4CBV A;  2G5D A;  1GUS A;  3K57 A;  5J1Z A;  1EY4 A;  5KYI A;  1STN A;  3PIO 3;  1QWY A;  2IX1 A;  1B50 A;  4ID6 A;  2B2U A;  5LMN L;  5J3B A;  5EKK A;  2EY6 A;  3S24 A;  5LMU L;  4A75 A;  1KQS A;  2UUA Q;  4EQN A;  1DOK A;  1LM0 A;  3KF8 A;  3DM3 A;  1E2Z A;  3CCE A;  1PYS B;  1E22 A;  3TRZ A;  4UPA A;  3PCO B;  1NUC A;  1STH A;  4K0K L;  1EQT A;  3M3Y H;  1X9N A;  3PUY A;  3GTM H;  1HTL D;  1Z47 A;  3W1B A;  3WOF A;  2PNH A;  4DR1 L;  1S5C D;  1PRT C;  3K58 A;  1S40 A;  1TS3 A;  2L0C A;  5C44 B;  2XWJ B;  5GAE C;  3P75 A;  2Q2T A;  5M3F H;  2F0K A;  1I4H A;  4DFA A;  1KRS A;  5IIF A;  4AQY L;  1IXR A;  3V2T A;  1G6P A;  3NP8 A;  2L1B A;  1WJJ A;  1X32 A;  4DXG A;  3J7A 5;  3S1N H;  4JI0 Q;  4QUC A;  2XRS D;  4U68 A;  1JQY D;  2EY1 A;  2R61 A;  3CF5 A;  5G3L D;  4DXF A;  1EOT A;  1GUG A;  1PFB A;  2HCI A;  1KNA A;  2X6G A;  4Q0F A;  4FXK C;  1C8C A;  4C3I B;  4KY7 A;  1S4Z A;  5I6Y A;  1IL2 A;  5I9P A;  4A93 H;  4B3M L;  1G2S A;  2IWH A;  4JYA L;  2UXB Q;  4OIJ A;  2VW9 A;  1EQR A;  4PMC A;  1K8G A;  3ERQ A;  3OW7 A;  5FLM H;  2QW7 A;  4QB4 A;  2NN6 G;  5LL6 X;  3I4M H;  1SFO B;  2WAQ E;  3URY A;  2VQF L;  1Y69 U;  4LFC Q;  3HOV H;  2Y0S E;  3OPO A;  1VMP A;  3M9B A;  3RN2 A;  3GTK H;  1KL9 A;  2KOL A;  4K2K A;  3RZO H;  4UP8 A;  5CBE E;  4HID A;  3MXN B;  3JAM L;  3K7A B;  1EZ6 A;  4DV6 Q;  1WTO A;  4ZKB B;  1EIY B;  1FGB D;  2QCP X;  3D6W A;  4R9W A;  2HDL A;  3GTL B;  3W5O A;  1EU3 A;  1FYC A;  4FXG C;  3U9S A;  5HGT A;  1PH4 A;  2NZ1 D;  2QDB A;  3J7Z C;  1H9S B;  4LWC A;  2RHQ B;  1QIL A;  5IGD A;  3Q8D A;  2E2H H;  3HOU G;  1STA A;  4OXP A;  1I5F A;  1TU2 B;  3MHB A;  4ZAI A;  2XVS A;  2BA0 A;  3S1R B;  1CZG A;  4HJ8 A;  1SDF A;  1HR0 Q;  3MFG A;  4BY7 G;  3KF6 B;  1FL0 A;  3BG3 A;  2FXQ A;  3HOW G;  2JA9 A;  1UEA B;  2CW0 C;  3T1H L;  2K14 A;  3J7A V;  4FYD A;  2K01 A;  2MO1 A;  1JJC B;  5DEH A;  5AJ3 L;  2F0M A;  1QB5 D;  2F0H A;  3S1M H;  4A3D H;  2R7D A;  4DGZ A;  4BA1 I;  4DV3 L;  3A55 A;  2K5Q A;  3KUP A;  3CCL A;  2UUC Q;  5FLX c;  4YHH L;  4DA2 A;  5K5P A;  1TR5 A;  4CKC A;  4KKT A;  4XXE A;  4A93 G;  3R3O A;  3F2U A;  3IFT A;  4TVA B;  4NXM Q;  4L8J A;  1E0B A;  5IWA Q;  3S2D H;  3CW2 C;  1FR3 A;  3OTO Q;  1D6E C;  3M7G A;  3VYS A;  4K8J A;  4DNR B;  1O7Z A;  5M3F B;  1BCP D;  2J7Z A;  1D8L A;  2HQE A;  5G3L F;  3J80 L;  3MC0 B;  1HQM C;  3NTH A;  3S1N B;  2JE6 I;  4KKS A;  3K7U C;  3CD6 A;  2R6G A;  2E74 C;  2WFW A;  4JOI C;  1BQQ T;  3KLS A;  2A6H D;  5I2Y A;  4A3F H;  3MAQ A;  4B9X A;  4EGV A;  2C9O A;  2XWB B;  3K5L A;  2XRQ D;  3CCS A;  5C4Z A;  4MN3 A;  4A93 B;  1W3S A;  4IFD I;  1NR4 A;  4DV0 L;  4RG1 A;  5D3I B;  1YI2 A;  5C3E H;  2E8G A;  2B63 H;  2BA1 A;  3ERS X;  2UU9 L;  2EXD A;  5C0X J;  3RLO A;  2A1A A;  3TS0 A;  2YTY A;  4IUV A;  4JI8 L;  1LV9 A;  5EJW A;  4C3J H;  2IT1 A;  3I4M B;  2R7Z H;  4DNI A;  5BN4 A;  2B2W C;  4POF A;  3HOV B;  3W1G A;  3I90 A;  1SYE A;  1PDQ A;  1UE1 A;  3GTK B;  2F0N A;  3A5U A;  1QNU A;  3J7A F;  3RZO B;  5GAD C;  4G7Z C;  2QGQ A;  5IYB H;  3U50 C;  4OGQ C;  2D0P A;  2Z6K A;  1X54 A;  3HG9 A;  1NAP A;  5DM7 3;  1FNW A;  1TVX A;  3KBG A;  1TKW B;  4P72 A;  4U67 3;  1CA6 A;  5IOC A;  3OOC A;  3ULJ A;  1QNK A;  4ODG A;  4WFN 3;  4DAY A;  4LFB L;  4MTN A;  4IPH A;  1XPO A;  2EQS A;  3A74 A;  3T13 A;  2XTI A;  1HNZ Q;  2E2H B;  4DV7 L;  1MSH A;  1AZP A;  5JJL A;  4NMZ A;  3CKI B;  1KAB A;  1D2B A;  4RWS C;  3I55 A;  1F77 A;  1YJW A;  1I4Q A;  5IT9 c;  1EEI D;  1WFQ A;  1CQF A;  1KNE A;  1ICW A;  3S14 H;  2HIV A;  4QIW E;  2OWO A;  4DN4 M;  3X3M A;  5DLQ E;  3F2D A;  3K80 C;  1PH5 A;  1K8M A;  1KDB A;  1X6O A;  1KIX A;  3S1M B;  4A3D B;  5CV7 A;  5CBA E;  4V19 0;  2PZU A;  3BU2 A;  2RBM A;  4F88 A;  4DAP A;  5FLX L;  1LTT D;  1Y1W G;  2FFK B;  2UXD Q;  4LF9 Q;  5J39 A;  4RHR A;  2NVX H;  3CRK C;  1H9M A;  2F0G A;  1XTD A;  4JI0 L;  1A0I A;  2A68 D;  3C1E A;  4ZUI A;  3LGJ A;  2B63 G;  1BCP F;  4JBM A;  3S2D B;  2K6A A;  1IKM A;  2CHB D;  3VR6 A;  3RMH A;  1F2M A;  4BXX H;  4ZKC B;  1LTB D;  1P16 A;  3NWS A;  4CKE A;  3KOJ A;  2PO4 A;  3GD7 A;  4R4T A;  1JWS D;  4XTC S;  3T16 A;  2KEN A;  3CMA A;  2F0J A;  4HSP A;  2HDM A;  2IHF A;  3D3R A;  1PTO C;  4XT1 B;  1DZ1 A;  2UXB L;  2NWG A;  1UNS A;  3V05 A;  1RJT A;  1GOZ A;  3M4Q A;  2J0T D;  1VQ7 A;  4A3F B;  4X3T A;  1IBM L;  2MO0 A;  2XN9 C;  2F3V A;  4F87 A;  3S15 H;  5HGQ A;  4DNT B;  4C3H H;  2A69 C;  1AZQ A;  5JJZ A;  3R8B A;  1SYD A;  3KJO A;  1VQ6 A;  4LFC L;  2B2Y C;  2BH8 A;  3A0J A;  5CV8 A;  1MIU A;  5C3E B;  1L0Y B;  3QG1 A;  1PFS A;  4KTA A;  1NTG A;  1MBY A;  2F0U A;  4DK3 C;  4DV6 L;  4C3J B;  1ZEQ X;  2R7Z B;  1I4G A;  4GS3 A;  4UP9 A;  3K5N A;  1AH9 A;  2SOB A;  2A19 A;  2DNE A;  1XMO Q;  2I5H A;  3GTP H;  1HXY D;  1NBW A;  4IJL A;  4IUU A;  2HHH L;  4OL7 A;  5K36 H;  4JCV E;  3TDQ A;  5JPN C;  2E2I H;  4N9P A;  3K6O A;  3QR8 A;  3D0F A;  1HR0 L;  4ULL A;  1DD2 A;  5LMN W;  1W2B A;  2IX0 A;  3CHB D;  3H15 A;  1MJE A;  5A2Q L;  1DM0 B;  2WAQ G;  5IGG A;  2B8F A;  2EYO A;  3PQI A;  3S14 B;  2UUC L;  2BE5 C;  5H1S E;  4BXX G;  2Q2H A;  4B08 A;  2NVQ H;  1HA6 A;  1FNV A;  1CSP A;  1EY0 A;  2EJG C;  3I2Z A;  4LF6 Q;  1KDA A;  3MZ5 A;  1HZA A;  4NXM L;  1YNJ C;  3DHQ A;  4CDC C;  5IWA L;  2PQE A;  1IKL A;  1S5E D;  3OTO L;  1HUM A;  3C1F A;  3VYT A;  3I4N B;  3KDF A;  2IW3 A;  1J5E Q;  3FDT A;  1EUJ A;  4YWK A;  1OXX K;  1CKO A;  2VXW A;  1AE2 A;  5ELN A;  4C3H G;  2CVR A;  3OYY A;  1BCP B;  1VQF A;  2NVX B;  1U0L A;  2UUB Q;  1A3V A;  5KND A;  4O2D A;  3CCU A;  5C0X H;  5D65 A;  4GOP A;  1CM9 A;  2RHS B;  5D14 A;  3U58 A;  3A56 A;  1SR3 A;  3R2T A;  4RKB A;  1OO9 B;  1PRT B;  3A8K E;  3RD4 A;  1JB7 A;  2KQ3 A;  3E0J A;  1B4O A;  4PZ6 A;  2VS1 A;  3NQT A;  3BZD B;  1FJG Q;  2V4D A;  4LAA A;  2E75 C;  4MIU A;  1STY A;  3EIV A;  4I7A A;  1Q90 A;  2KHI A;  3S15 B;  3LX0 A;  2L55 A;  4TQU S;  4HJ5 A;  2SNM A;  4J1M A;  1WTH A;  1CKN B;  1V1P A;  3QOL A;  1NJI C;  4PQX A;  1EEF D;  1Y14 B;  5JVG 3;  1RCV D;  2C35 B;  5IYD G;  1SNQ A;  1LTL A;  1DYQ A;  1B70 B;  2FMC A;  3SVM A;  1E1T A;  4L63 B;  3VYR A;  1QG7 A;  2JA7 H;  3BVG A;  2ALY B;  1EY9 A;  1SND A;  2EYF A;  1N32 Q;  4GKJ Q;  1QUQ A;  2A6E D;  3HP3 A;  3GTP B;  3HOY B;  4KJO A;  1HNZ L;  1C9O A;  2ZM6 Q;  3AQQ A;  3VA5 A;  2HT1 A;  3CPW A;  1A15 A;  1V9P A;  3KLW A;  2ZJP A;  2RA4 A;  4A3C H;  3NBH A;  1XNR Q;  4BY1 G;  2E2I B;  2QKI C;  1X3F A;  4CJ2 C;  4L5R C;  1O80 A;  2Q8I B;  5IT9 E;  1VQD A;  4KJN A;  1WCM G;  4JVZ A;  5C0X G;  2RSN A;  3RNU A;  2LXJ A;  1PH2 A;  2UXD L;  2NVQ B;  2O4X A;  3Q23 A;  3FHW A;  1GM5 A;  3D4W A;  5JVH 3;  1XWE A;  3GV6 A;  5A35 A;  3NTK A;  1EYG A;  2K03 A;  1B9N A;  3AEV A;  5JAV A;  4A3K H;  2CWA A;  2NN6 I;  3KBX A;  1QVG A;  4J6H A;  3HKS A;  4OEM B;  4DKA C;  3STB D;  1LTG D;  2WB1 B;  1Q1B A;  3QJY A;  5C3W A;  1W6J A;  2JEA I;  2RDF A;  1AFP A;  4IUP A;  2Z8L A;  3HFZ B;  2BDO A;  4G7H C;  1SE3 A;  4JI5 Q;  1RTN A;  2OEO A;  3JC6 6;  1EY8 A;  1KAA A;  2AQ2 B;  3K81 C;  3WOE A;  3CP0 A;  1C0A A;  2PCF B;  1X3E A;  1J9O A;  2LKV A;  2XNA C;  1X65 A;  3SK4 A;  1R9T H;  1SNP A;  1SNC A;  1YNN D;  2EJF C;  4PMW A;  3ER0 A;  5EPJ A;  1CKM A;  1SN8 A;  3TN2 A;  3TP6 A;  1F9Q A;  1B7Y B;  1SSO A;  4KK7 A;  1LUZ A;  1I50 H;  4IFD J;  1EWI A;  1NE3 A;  5E4X A;  3OIP A;  4JI1 Q;  3OW2 A;  2GA4 B;  1BCP C;  1PTO H;  2F0W A;  1TWA H;  2JSO A;  3UDX A;  2CFM A;  4MHE A;  4AYB G;  1PTO F;  4A3C G;  3HOU H;  4ALP A;  4UDU C;  4C2M H;  3NQI A;  4X62 Q;  1JE5 A;  5EKI A;  2A6H C;  3HKZ G;  5COR A;  2KEE A;  5CV5 A;  2YV5 A;  1F2Y A;  2PNR C;  5ELF A;  1XMO L;  1IYV A;  3CU7 A;  1RD9 D;  4GNX A;  4BY7 H;  1LT5 D;  4JI3 Q;  3HOW H;  4JI6 Q;  3Q24 A;  1GO3 E;  1SRO A;  2JA7 B;  2B2W A;  4I65 A;  1B3A A;  1MGS A;  3S17 B;  5IGE A;  2O5I C;  4A3E G;  2YTV A;  2G9D A;  1XPU A;  4G7O C;  1KAW A;  3CCM A;  2A8V A;  1WD0 A;  4V0B A;  3TEH B;  1KHI A;  4JBW A;  3K0Y A;  3G71 A;  2G9H D;  1SLJ A;  2CCZ A;  4R8I A;  2AKW B;  4AYB B;  5JJK A;  2ZTD A;  2K5W A;  1TT2 A;  5EPK A;  5FO7 B;  1U4R A;  3KYH C;  3GO5 A;  4A3K G;  3OMC A;  1T5E A;  3L3O C;  1LTI D;  2N55 A;  3H3V H;  2TMP A;  1U5K A;  4X3U A;  2B2T C;  2MPM A;  1SYB A;  1CK1 A;  4KV6 A;  4LF6 L;  2EIF A;  4WJ4 A;  3MXN A;  1AE3 A;  2O2L D;  1LTA D;  3A5Z B;  1HFN A;  1B9M A;  4P73 A;  4X64 Q;  1GKH A;  1GVP A;  2YU9 H;  1D5X C;  2F4V Q;  2H5X A;  5IGB A;  4NW2 A;  1PH6 A;  1J5E L;  2EYJ A;  5M5X H;  4HIO A;  3T1Y Q;  3P7J A;  2K7V A;  1GUN A;  1TWC H;  2K5H A;  5I6W A;  3MA2 B;  2UUB L;  1P8L A;  2K5N A;  3I8Z A;  3NPP A;  3PV0 A;  4A3K B;  3WWV A;  2ES2 A;  1JE4 A;  1VF7 A;  4HTH A;  4BWG B;  1H9J A;  3W3A A;  4QJF A;  2K04 A;  5C4H A;  1EL0 A;  1I4X A;  2LS0 1;  2PI2 E;  1YBY A;  1OXV A;  2QEX A;  1HQR D;  4J15 A;  4PMB A;  2L12 A;  3ZJY C;  1SJE D;  2K28 A;  1Q81 C;  1J8I A;  3X3N A;  1DJR D;  1STG A;  1B44 D;  3PUX A;  1KLU D;  2SNS A;  4HJ7 A;  4YCV A;  4DR7 Q;  1QVC A;  1MKH A;  3CPF A;  1R9T B;  2X69 A;  2RCN A;  1QJO A;  1UEB A;  3HGB A;  4HAE A;  1GD7 A;  3RLN A;  4X66 Q;  3WDN A;  2XIW A;  1F2Z A;  2A68 C;  2F0P A;  1VQJ A;  4CDE C;  2L15 A;  3OHX C;  2K4K A;  2F0I A;  1U4L A;  1WTW A;  2OCE A;  1VQA A;  3QO2 A;  4H7B A;  3GTQ H;  5E4W C;  3D8G A;  1BR9 A;  4YCU A;  1PTO B;  5C5L A;  1TWA B;  3I72 A;  3S9W A;  1DGS A;  3RN5 A;  1Y8N B;  4QCL A;  4DF7 A;  5JEA J;  3HOU B;  1CI3 M;  3MXP A;  4C2M B;  1D1K A;  3FVQ A;  2AQ3 B;  3W2D A;  1QVF A;  1X55 A;  3M3Y B;  3GTM B;  3EJI A;  1A2U A;  1VDZ A;  1N32 L;  1DON A;  3J81 i;  4GKJ L;  1SYF A;  2F3I A;  2VB2 X;  3BJU A;  4N8X 1;  1KLG D;  4KI0 A;  4BY7 B;  2ZM6 L;  1O7Y A;  3QIA A;  2DJG C;  3TME A;  2D9U A;  3HOW B;  1MSG A;  3SDZ A;  1K8O A;  1DOL A;  1EFW A;  1XNR L;  4DR3 Q;  5JJI A;  3NE5 B;  1K3B C;  2F0S A;  3CRL C;  1SAP A;  3BDL A;  3HOX H;  2C5C A;  2MP1 A;  2JXM B;  4B9W A;  5IOD A;  1VMC A;  3BYT B;  1Z6H A;  3CCJ A;  4DR2 L;  1EY6 A;  1HH2 P;  1YHB A;  5HY6 A;  2F0O A;  1Y1W H;  4H44 C;  2OQK A;  4XQQ A;  4A4I A;  1SNM A;  3P1H A;  4DV2 Q;  1FNU A;  3HS0 C;  1SRU A;  3U4V A;  2ICI A;  3BDO A;  5FO9 B;  1K83 H;  1JCK B;  4P74 A;  4JC0 A;  2K5V A;  1I94 Q;  5COY A;  5IY0 A;  4LK1 C;  2B2U C;  3LWU A;  1VQG A;  2PMZ E;  2Z6B A;  2YU9 B;  5KGU A;  5EKL A;  4NPS A;  1QE6 A;  3A7A B;  5M5X B;  5JOB A;  3M4Y A;  2L5T A;  1K28 A;  2FHT A;  4JI5 L;  1TWC B;  1QZH A;  1LT6 D;  5IP9 H;  1IZ6 A;  1CA5 A;  4WJ3 M;  4G57 A;  1TWG H;  4IUN A;  1L2F A;  1WD1 A;  2LMC B;  4GKK Q;  4OX9 Q;  1UE5 A;  3D4D A;  1A6X A;  1Q3L A;  4BS9 A;  1JIC A;  1VQN A;  3SE0 A;  2YYZ A;  2WKD A;  1LT3 D;  3UE0 A;  3A7L A;  3PO3 H;  4RKL A;  4JI1 L;  2ID0 A;  3VA7 A;  4GN4 B;  3I56 A;  2NVT H;  3G48 A;  2UUA L;  2AWN A;  5M3M H;  3H0G G;  3NEL A;  1IW7 D;  1YVC A;  3R93 A;  5KIX A;  4X62 L;  2K50 A;  1VQL A;  1L0X B;  3EBE A;  2X6L A;  2PQA A;  3PSI A;  4CGY B;  2F0V A;  4OO1 H;  5FOB B;  1SNO A;  3HOX G;  4L5T A;  3SK6 A;  1VQP A;  5BN3 A;  1G6Z A;  2NVY H;  3FPP A;  1W6K A;  4IOA A;  1PH7 A;  4LMQ D;  2EYH A;  3ULL A;  4JPB W;  4JI3 L;  4JI6 L;  4LNQ A;  4DUZ Q;  5DM6 3;  1I3Q H;  2WAC A;  1D5M C;  2F1M A;  1YHQ A;  4A3I G;  1O7I A;  4HN7 A;  3CCQ A;  3RR5 A;  1HZB A;  1XTC D;  4HCE A;  1SYC A;  3SEB A;  1EQQ A;  2KJX A;  2GN5 A;  4JBK A;  3L7Z C;  3K59 A;  5GRO A;  3M4O H;  1JOQ A;  3BZK A;  1PYB A;  1LTR D;  4ME3 A;  5EPL A;  3K8A A;  3PO2 G;  3HOX B;  2KBN A;  3F2C A;  1EZ8 A;  1VQB A;  1Y1W B;  1B3Q A;  3JAM i;  5IP9 G;  1SBB B;  2OTJ A;  2JK8 A;  1BUV T;  4IFD G;  4X64 L;  4L5Q A;  2A6E C;  2F4V L;  2B63 B;  2SEB D;  2H1E A;  4KLK A;  2FMM A;  4KKU A;  1K83 B;  1N8R C;  2KCN A;  2M2L A;  1LAC A;  5CV6 A;  1JOO A;  2BH2 A;  3OIQ A;  2JYO A;  3ITP A;  3PGZ A;  2R93 G;  3VR5 A;  4APV A;  2CQO A;  3F1Z A;  1ML0 D;  4K6D A;  1VQI A;  3UI2 A;  4M8A A;  4IPG A;  3PO3 G;  4K6L A;  4A3L G;  3C2P A;  1UE7 A;  1G2T A;  1ROD A;  1YIJ A;  4LF7 Q;  1JR0 D;  1NMG A;  2ZXR A;  1G8Z D;  5M3M G;  4XIG S;  5HUR A;  3FKI G;  5CR3 A;  2JN4 A;  3K5M A;  1VQ8 A;  3H3V C;  5M5W H;  4DR7 L;  4OO1 G;  2H4O A;  2VB3 X;  1TWG B;  1CHP D;  1OXU A;  4K5X A;  4OWW B;  4L6T B;  2EYP A;  4K2L A;  1SE8 A;  2Z9H A;  1L1O A;  1OXS C;  5C5M A;  2RSO A;  1IYU A;  4IOC A;  1UE6 A;  1SYG A;  1M90 C;  4X66 L;  5IYD H;  2AHO B;  4NXN Q;  4GN5 A;  1PH1 A;  2D62 A;  2WV6 D;  1N34 Q;  3STB C;  3KLS X;  2AUK A;  5IT9 L;  2DJF C;  4H0L C;  4RA8 A;  3QWN A;  2Y0S G;  3FPU B;  4FDB A;  4DR5 Q;  4IUT A;  2NVT B;  1AN8 A;  1F2L A;  4WRD A;  5ELB A;  5M3M B;  5EAY A;  1PFM A;  3AFP A;  3DWA A;  3T56 B;  4ZK9 B;  2A73 B;  3B6Y A;  3J80 i;  1NSN S;  1STE A;  2R7F A;  4BY1 H;  3HRZ C;  3PUV A;  1K73 C;  2NVY B;  5IGF A;  3J7Y W;  1YNN C;  3NWT A;  1CHQ D;  5C0X I;  4DUY Q;  3E3X A;  1Y8O B;  3NEN A;  4F8M A;  1RDP D;  3PF4 A;  2PI2 A;  2Z6K C;  1Q8K A;  3ONA B;  1MHW C;  3GDE A;  1I3Q B;  2Q8R E;  2WII B;  1M1K C;  3IKJ A;  3NSW A;  5EGT A;  2RVL A;  1U4P A;  1II3 A;  1C4Q A;  1T5X D;  2WAQ B;  1KRT A;  1WCM H;  4DU9 A;  1YEZ A;  1GUO A;  2Y0S B;  4ZLT F;  4JI2 Q;  3LWE A;  1G29 1;  3S1Q H;  2F52 A;  3L0O A;  3M4O B;  2CH4 A;  4HR7 B;  5LHY 1;  4K5V A;  1XMQ Q;  4HJA A;  1XJV A;  4IPD A;  4CDF C;  4ZUJ A;  1OTC A;  3GTJ H;  1RTO A;  4DAV A;  4R4O A;  1YHA A;  4DR6 Q;  4DV4 Q;  2VUM G;  5ELD A;  1JOR A;  1CKN A;  1I94 L;  3H09 A;  4FF3 A;  3TZD A;  4C3H B;  4TKO B;  2KUM A;  4A3M H;  3AU7 A;  4RCN A;  4H02 A;  2ASB A;  1WYD A;  3F8T A;  4GOP B;  1H9R A;  1R4P B;  1Y8P B;  5LL6 S;  1AEX A;  3UDI A;  2GVB A;  2A5H A;  3TP8 A;  3GTO H;  4KN4 C;  4Y52 H;  3ND8 A;  5FKA C;  4JK1 C;  1HCZ A;  1TS4 A;  1EY7 A;  5JEA G;  1CZW A;  1EIH A;  3L2P A;  5FO8 B;  4JV5 Q;  2DUD A;  3DXJ C;  2K52 A;  4NDX A;  1EIF A;  4TRD A;  3C3L A;  2JP1 A;  2YTX A;  1G51 A;  2F0Q A;  1D5Z C;  2NBF A;  1EIG A;  3MXG A;  4GKK L;  1SJH D;  4OX9 L;  1VQ5 A;  1WVL A;  2M00 A;  1SMY D;  1A2T A;  3T4A C;  1HNW Q;  3ULP A;  3HZX A;  4HMJ A;  1U9R A;  3MVV A;  3TBI B;  3J81 j;  3DM1 A;  5KRU A;  2R92 G;  2ATW A;  5T1G A;  2D2C C;  1A63 A;  1BOS A;  1NCV A;  3HEJ A;  1V8Q A;  1TY2 A;  5C3X A;  4YY3 Q;  1N33 Q;  2I5M X;  3R2I A;  2I5L X;  3H91 A;  3BVZ A;  4A3J G;  4C3I H;  4A3E H;  1EYA A;  2MJ8 A;  2F0T A;  5C4X G;  4RGT A;  1T9H A;  1PZJ D;  3O13 A;  3IRB A;  1FD7 D;  1Z7T A;  1ESR A;  1A62 A;  4OON A;  2PPB C;  3ICE A;  1BBU A;  4LF9 L;  3NBH B;  3KLR A;  2EOT A;  4BBR G;  4DUZ L;  1SE4 A;  1JC7 A;  2ICE C;  2N8N A;  4BY1 B;  2NTT A;  4B3R Q;  3CC2 A;  1SFO H;  2AUJ D;  2XGT A;  3UDG A;  5I2X A;  1VQH A;  3GV3 A;  3U9O A;  1EWH A;  3IL8 A;  2UU9 Q;  4LF4 Q;  2F0L A;  1RHP A;  3ND9 A;  4A3M G;  2E2D C;  3JAM c;  2LSS A;  4LUV A;  5IP7 H;  1WCM B;  1LT4 D;  2WP8 J;  5EBC A;  1KDC A;  1Y1V H;  2IY5 B;  5I4D A;  1UUP A;  3S1Q B;  1SEB D;  4IPC A;  4FXD A;  2BCO A;  4P2C B;  3VR3 A;  3FEW X;  2Z1C A;  3MEF A;  2QDL A;  1WTV A;  2B2V C;  1CUK A;  3DEO A;  3GTJ B;  2F4I A;  4IO9 A;  3FMC A;  4CJ1 B;  3MFY A;  4JOI A;  3BYY B;  4FO2 A;  1BBW A;  2NUC A;  1YIT A;  1C7Y A;  5I9O A;  1XPR A;  1EYD A;  1PFN A;  2DY7 A;  3DMU A;  4FF1 A;  1HHV A;  3E0E A;  1ASZ A;  2EYM A;  2OTL A;  2E5L Q;  3QOJ A;  1K8A C;  3GQB A;  4LF7 L;  2JA8 H;  4M1U B;  3GTO B;  1NR2 A;  2IL8 A;  1JWM D;  3LNN A;  1VQM A;  1X3Q A;  2CQA A;  4KMU C;  4QIW B;  1X3P A;  4AH6 A;  4ILW A;  3GTG H;  4C3I G;  1F9R A;  1PYW D;  1F9P A;  4P75 A;  1K9M C;  5M5Y H;  3DUZ A;  4IAL A;  1F9S A;  1TS5 A;  1ZYR D;  4YWM A;  3H3V I;  4GZY C;  3NTI A;  3KF8 B;  3L9A X;  4IJH A;  1NMF A;  3S16 H;  4NXN L;  1O7L A;  5BR8 Q;  1ASY A;  4DK6 C;  4GOP C;  1N34 L;  2B3G A;  1C48 A;  1X3G A;  1E2V A;  2NTS A;  3I73 A;  4RAU C;  1WTP A;  2Z0S A;  3J80 c;  1VQO A;  3HKZ B;  4TSS A;  5DAU A;  2RF4 A;  4GNX B;  3MXU A;  4DR5 L;  5GQO A;  5KYL A;  4OEL B;  3PMF A;  4QQB X;  4O1N A;  3G4S A;  1A3U A;  4QY7 A;  5D3D A;  5DNF A;  2KCT A;  4ME5 A;  1HJP A;  2OF1 A;  3T51 B;  4C1N K;  5IP7 G;  4HSV A;  4A3E B;  1BO0 A;  1EQV A;  2GVA A;  1VCI A;  3J81 E;  1EWC A;  4OIK A;  1PH8 A;  4GLV B;  1Y1V G;  4WOR A;  4DUY L;  1H9K A;  1IBK Q;  1XNQ Q;  2KHS A;  2ZJQ A;  1IBM Q;  3CXC A;  4A3G H;  2EXZ A;  4DPG A;  2KEC A;  1O78 A;  1H9S A;  1VQC A;  1PZI D;  3CC7 A;  1LAB A;  2TSS A;  2IPK D;  2IHE A;  1JJG A;  3RLF A;  3E9I A;  3AMU A;  1PXU A;  3GP7 A;  1PLF A;  5KEE A;  5J22 A;  4JI2 L;  4J8Q A;  4UHV A;  4EX5 A;  4B3S Q;  3F2B A;  1IW7 C;  1TS2 A;  5CV9 A;  4A3B H;  3NXW A;  1XMQ L;  2PYK A;  3PUZ A;  2D0O A;  4XYO A;  2VNU D;  3V96 A;  5CMD A;  1D1I A;  2M9V A;  4O42 A;  1ILP A;  2VY3 A;  3KF6 A;  4JI4 Q;  4OWT B;  4X65 Q;  3SHL A;  3A8J E;  3K5O A;  4DV4 L;  4LF5 Q;  2JA8 G;  2KCC A;  3EN2 A;  1FJG L;  4IQZ A;  4FF2 A;  1XX8 A;  1Y1V B;  4RGN A;  2E2J H;  3VR4 A;  3SK8 A;  3OMG A;  1MI2 A;  2K05 A;  3T53 B;  3TP7 A;  1PZK D;  2RDG A;  1N9W A;  3OWF A;  4K14 A;  1I50 B;  2JA6 H;  2MFI A;  2Q2U A;  1HA5 A;  2HHH Q;  1YZ6 A;  4GN3 B;  1VQ9 A;  2EYL A;  2V1C C;  4RHS A;  2HCC A;  1UWV A;  3EQL C;  4UAI A;  4QL5 A;  2ZJR A;  4A76 A;  4JV5 L;  5M3F G;  2B2Y A;  1QOH A;  3H6M A;  1GUT A;  1WTR A;  1MJC A;  3VR2 A;  2P5Z X;  2JA8 B;  1K0R A;  1ZKO A;  4EQO A;  4RFB A;  4R8N A;  1CQV A;  2JA5 H;  2ZT9 C;  1HR0 W;  1VS0 A;  1HNX Q;  4X3K A;  5EQ0 A;  2VQE Q;  4C56 C;  4JI7 Q;  1HNW L;  2F3W A;  3MWY W;  2N88 A;  5M9O A;  3H0G H;  2PW5 A;  3GTG B;  2FJ2 A;  2LY7 A;  2WIN B;  1TWF H;  4LUZ A;  1A8V A;  5M5Y B;  4POG A;  2JQO A;  3CQZ H;  1I6H H;  1GHJ A;  1JMC A;  1E7Z A;  4G4K A;  4LFA Q;  1E2W A;  3MTS A;  1TXY A;  3S16 B;  4DV1 Q;  4YY3 L;  1N33 L;  1EY5 A;  2EJM A;  4A3G G;  3KK7 A;  5FLM G;  5ISR A;  3SGI A;  3I4M G;  1PVO A;  2MGS A;  4FP5 D;  5ELO A;  3HOV G;  5CYU A;  3DLL A;  1DOM A;  4A3I H;  3I7F A;  3IAY A;  4A3B G;  4MNO A;  1HUN A;  5ELE A;  2K1B A;  4LF8 Q;  1V1O A;  5C6A A;  3NUC A;  3NBI A;  1PRT D;  4DV5 Q;  3N6R A;  1M4V A;  4B3R L;  1X56 A;  4E6I A;  2Q2I A;  4ZYS A;  4LUO A;  5KNB A;  1N36 Q;  2ZTC A;  3PO2 H;  2WB1 E;  4K5W A;  4RMF A;  3PUW A;  1S5B D;  1Q86 C;  2O5J C;  1IL8 A;  4LF4 L;  2VZA A;  4A3G B;  2E76 C;  4GNX C;  4IN3 A; 
#chains in the Genus database with same CATH homology
 1AW7 A;  3D4R A;  4F7X A;  4IFD H;  3E5S A;  1HFG A;  2DNC A;  2I46 A;  3DWP A;  2F0F A;  3JAM E;  4A3B B;  4KHV A;  1M8A A;  1R4Q B;  3MEH A;  1SE2 A;  2B39 A;  1TY0 A;  2KA7 A;  1JWU D;  1A3T A;  2Z4I A;  4FVM A;  3G7L A;  1VF5 C;  4OO1 I;  1ENA A;  2E2J B;  2OXP A;  3VYU A;  4XQJ A;  1S5F D;  2ZXP A;  2JA6 B;  2JEB I;  3TZU A;  3GTQ B;  3I3C A;  1S5D D;  2PW7 A;  3AB9 A;  3SXH A;  4FF4 A;  2JA5 B;  1ENC A;  4N9T A;  1AP0 A;  3A8I E;  1LTS D;  3H0G B;  3NK9 A;  4QF4 A;  1TWF B;  4I7Z C;  4WJW A;  1KTK A;  5TSS A;  3CQZ B;  1I6H B;  4KHZ A;  2CW0 D;  1I4R A;  2AWO A;  3Q6S A;  2QEJ C;  1HPC A;  2A74 C;  1I6V C;  5IGC A;  4RGM A;  4IZ8 A;  3J80 E;  1BNZ A;  4C3J G;  2MHV A;  2RDH A;  4EVO A;  3NHH A;  4XYQ A;  3M85 A;  2Q8T A;  4A3I B;  1LO5 D;  1SXT A;  1PRT F;  1SMY C;  2BOS A;  2K33 A;  1B1Z A;  4XDX A;  3Q22 A;  3I91 A;  2F0D A;  1ET9 A;  2EPB A;  1RKN A;  1UAP A;  2IJ0 A;  4DK0 A;  3N52 A;  2EY2 A;  3PO2 B;  2F03 A;  3A54 A;  4IUQ A;  3G6J B;  1ESF A;  4RCO A;  5F2D A;  2DN8 A;  2AQ1 B;  2F0E A;  1RF2 D;  1Q12 A;  3TSS A;  3ZYY X;  1HTP A;  1ENF A;  5E3F A;  1EU4 A;  1B2T A;  3SR1 A;  2R93 B;  5JEA H;  4FNF A;  1BDO A;  1OXT A;  1EFI D;  3PO3 B;  3I4L A;  4Y7N B;  2J4X A;  2D5D A;  1GXD C;  2I07 B;  3FKI B;  2B2V A;  5T1I A;  2EVB A;  1BF4 A;  1Q1E A;  1PMR A;  2R3Z A;  1WTX A;  1JB3 A;  4K8I A;  3P20 A;  2OT2 A;  4XT3 B;  1G91 A;  4ABN A;  4PNY A;  4NKL A;  4IUR A;  2NYZ D;  2MUY A;  4OHJ A;  1XXG A;  2L11 A;  5FLX E;  1QCB D;  1JOK A;  2RQX A;  4C1N I;  2BDN A;  4LJZ C;  1BBX C;  3EVQ A;  2KVM A;  4QUF A;  2QIL A;  4S3S A;  1ONL A;  1CT1 D;  3DWQ A;  2SDF A;  2PZT A;  2XSC A;  4DK1 A;  2Z4H A;  2ENB A;  1ZYR C;  5E1F A;  3BDC A;  4KN7 C;  3QB3 A;  2RKS A;  4X3S A;  2B2T A;  1EYC A;  3C46 A;  4BA2 I;  2EDG A;  1I4P A;  4KY5 A;  5EBD A;  3M7N A;  4BBS B;  2NB0 A;  5FK9 C;  2PZW A;  5K36 G;  1WTQ A;  4NP5 A;  2K32 A;  3I70 A;  2VUM B;  4CKB A;  4CJ0 B;  3EA6 A;  2EE1 A;  3OSO A;  5AFW A;  1PTO D;  3Q0A A;  5CV4 A;  1GJX A;  2ZXO A;  5CGK A;  1V1P B;  2B8G A;  5M5W B;  3H94 A;  5NUC A;  2EZV A;  2A69 D;  3S2H B;  5JPM C;  3E6Z X;  4ZQ3 A;  4H13 C;  3PIP 3;  1BXT A;  4Q5V A;  2WKC A;  1STB A;  1XYI A;  1LLR D;  3DEP A;  4CHT B;  4EQP A;  2KED A;  2IX3 A;  4XQN A;  3BVM A;  3EFX D;  4PV1 C;  3TP5 A;  3J81 L;  1MD2 D;  5ELC A;  1ILQ A;  3SK5 A;  3OWE B;  5A2Q E;  2LFN A;  1ZXT A;  1TWH B;  4RGO S;  2K5D A;  5KNC A;  4KD4 A;  4KD3 A;  1V43 A;  2R92 B;  4HCS A;  4KY6 A;  1HRJ A;  2DY8 A;  2L4N A;  1U4M A;  3FRP B;  2EY5 A;  3D6C A;  5C4J B;  2L9H A;  4A3J B;  4HED A;  5C4X B;  4HMI A;  1DXM A;  2PMZ B;  1GHK A;  3BS1 A;  1IHZ A;  3IFD A;  2QF7 A;  3RZD B;  4ZRZ A;  4BBR B;  1Q8I A;  5BN5 A;  1TQO A;  2BE5 D;  5CC4 A;  1GUW A;  3HOZ B;  1CFM A;  2NN6 H;  1DCZ A;  2FIN B;  1YNJ D;  4QMG A;  4RH6 A;  1ET6 A;  3D31 A;  1B53 A;  4YIJ A;  4A3M B;  1CTM A;  3RUZ A;  2HUG A;  4Z9C B;  3ERO A;  1TII D;  4CBV A;  1GUS A;  3K57 A;  5J1Z A;  1EY4 A;  5KYI A;  1STN A;  3PIO 3;  1QWY A;  2IX1 A;  1B50 A;  4ID6 A;  2B2U A;  5EKK A;  2EY6 A;  4EQN A;  1DOK A;  3KF8 A;  1E2Z A;  1NUC A;  1STH A;  1EQT A;  3PUY A;  1HTL D;  1Z47 A;  3WOF A;  1S5C D;  1PRT C;  3K58 A;  1TS3 A;  2L0C A;  5C44 B;  2XWJ B;  3P75 A;  2F0K A;  1I4H A;  4DFA A;  5IIF A;  3V2T A;  3NP8 A;  2L1B A;  1X32 A;  4DXG A;  4QUC A;  2XRS D;  4U68 A;  1JQY D;  2EY1 A;  2R61 A;  5G3L D;  4DXF A;  1EOT A;  1GUG A;  1PFB A;  2HCI A;  1KNA A;  2X6G A;  4Q0F A;  4FXK C;  1C8C A;  4C3I B;  4KY7 A;  1S4Z A;  5I6Y A;  5I9P A;  1G2S A;  2IWH A;  4OIJ A;  4PMC A;  3ERQ A;  3OW7 A;  4QB4 A;  2NN6 G;  5LL6 X;  1SFO B;  3URY A;  1Y69 U;  3OPO A;  1VMP A;  2KOL A;  4K2K A;  5CBE E;  3JAM L;  3K7A B;  1EZ6 A;  1WTO A;  4ZKB B;  1FGB D;  2QCP X;  3D6W A;  4R9W A;  2HDL A;  3GTL B;  1EU3 A;  1FYC A;  4FXG C;  3U9S A;  5HGT A;  2NZ1 D;  2QDB A;  1H9S B;  1QIL A;  5IGD A;  1STA A;  1TU2 B;  3MHB A;  4ZAI A;  2XVS A;  2BA0 A;  3S1R B;  1CZG A;  1SDF A;  3MFG A;  3BG3 A;  1UEA B;  2CW0 C;  3J7A V;  4FYD A;  2K01 A;  5DEH A;  2F0M A;  1QB5 D;  2F0H A;  4DGZ A;  4BA1 I;  3A55 A;  2K5Q A;  3KUP A;  4DA2 A;  5K5P A;  1TR5 A;  4CKC A;  4KKT A;  4XXE A;  3R3O A;  3F2U A;  3IFT A;  4L8J A;  1E0B A;  1FR3 A;  1D6E C;  3M7G A;  3VYS A;  4K8J A;  4DNR B;  1O7Z A;  5M3F B;  1BCP D;  2J7Z A;  2HQE A;  5G3L F;  3J80 L;  3MC0 B;  1HQM C;  3NTH A;  3S1N B;  2JE6 I;  4KKS A;  2R6G A;  2E74 C;  1BQQ T;  3KLS A;  2A6H D;  5I2Y A;  3MAQ A;  4B9X A;  4EGV A;  2C9O A;  2XWB B;  3K5L A;  2XRQ D;  5C4Z A;  4MN3 A;  4A93 B;  4IFD I;  1NR4 A;  5D3I B;  2BA1 A;  5C0X J;  4IUV A;  1LV9 A;  5EJW A;  2IT1 A;  3I4M B;  5BN4 A;  2B2W C;  3HOV B;  3I90 A;  1SYE A;  1PDQ A;  3GTK B;  2F0N A;  1QNU A;  3J7A F;  3RZO B;  4G7Z C;  4OGQ C;  3HG9 A;  1NAP A;  5DM7 3;  1FNW A;  1TVX A;  3KBG A;  1TKW B;  4U67 3;  1CA6 A;  5IOC A;  3OOC A;  1QNK A;  4ODG A;  4WFN 3;  4DAY A;  3T13 A;  2E2H B;  1MSH A;  1AZP A;  4NMZ A;  3CKI B;  1KAB A;  1D2B A;  4RWS C;  1F77 A;  1I4Q A;  1EEI D;  1CQF A;  1KNE A;  1ICW A;  4DN4 M;  3X3M A;  1K8M A;  1KDB A;  3S1M B;  4A3D B;  5CV7 A;  5CBA E;  4V19 0;  2PZU A;  2RBM A;  4F88 A;  4DAP A;  5FLX L;  1LTT D;  2FFK B;  5J39 A;  4RHR A;  3CRK C;  1H9M A;  2F0G A;  3C1E A;  2A68 D;  4ZUI A;  1BCP F;  3S2D B;  2K6A A;  1IKM A;  2CHB D;  3VR6 A;  3RMH A;  1F2M A;  4ZKC B;  1LTB D;  3NWS A;  4CKE A;  2PO4 A;  3GD7 A;  3T16 A;  1JWS D;  4XTC S;  2F0J A;  4HSP A;  2HDM A;  3D3R A;  1DZ1 A;  1PTO C;  4XT1 B;  2NWG A;  1UNS A;  3V05 A;  1RJT A;  1GOZ A;  2J0T D;  4A3F B;  4X3T A;  2XN9 C;  2F3V A;  4F87 A;  4DNT B;  1AZQ A;  2A69 C;  5JJZ A;  3R8B A;  1SYD A;  2B2Y C;  5CV8 A;  5C3E B;  1L0Y B;  3QG1 A;  4KTA A;  1MBY A;  2F0U A;  4C3J B;  1ZEQ X;  2R7Z B;  1I4G A;  3K5N A;  2SOB A;  2DNE A;  1HXY D;  4IUU A;  4OL7 A;  5K36 H;  3TDQ A;  5JPN C;  4N9P A;  3K6O A;  4ULL A;  1DD2 A;  2IX0 A;  3CHB D;  5A2Q L;  1DM0 B;  5IGG A;  2B8F A;  2EYO A;  3S14 B;  2BE5 C;  4B08 A;  1HA6 A;  1FNV A;  1EY0 A;  2EJG C;  1KDA A;  3MZ5 A;  1YNJ C;  3DHQ A;  2PQE A;  1IKL A;  1S5E D;  1HUM A;  3C1F A;  3VYT A;  3I4N B;  2IW3 A;  3FDT A;  1OXX K;  2VXW A;  4C3H G;  2CVR A;  1BCP B;  2NVX B;  1A3V A;  5KND A;  5C0X H;  5D65 A;  1CM9 A;  5D14 A;  3A56 A;  3R2T A;  4RKB A;  1OO9 B;  1PRT B;  3A8K E;  3RD4 A;  2KQ3 A;  3E0J A;  1B4O A;  3NQT A;  3BZD B;  2V4D A;  4LAA A;  2E75 C;  4MIU A;  1STY A;  1Q90 A;  3S15 B;  3LX0 A;  2L55 A;  4TQU S;  2SNM A;  4J1M A;  1V1P A;  3QOL A;  4PQX A;  1EEF D;  5JVG 3;  1RCV D;  1SNQ A;  1DYQ A;  2FMC A;  3SVM A;  4L63 B;  3VYR A;  1QG7 A;  3BVG A;  1EY9 A;  1SND A;  2EYF A;  2A6E D;  3HP3 A;  3GTP B;  3HOY B;  4KJO A;  3VA5 A;  1A15 A;  2RA4 A;  3NBH A;  2E2I B;  2QKI C;  4CJ2 C;  1O80 A;  2Q8I B;  5IT9 E;  4KJN A;  5C0X G;  2RSN A;  2NVQ B;  2O4X A;  3Q23 A;  3D4W A;  5JVH 3;  1XWE A;  3GV6 A;  5A35 A;  3NTK A;  2K03 A;  1B9N A;  5JAV A;  2NN6 I;  3KBX A;  4J6H A;  1LTG D;  2WB1 B;  1Q1B A;  3QJY A;  5C3W A;  1W6J A;  2JEA I;  2RDF A;  1AFP A;  4IUP A;  2Z8L A;  2BDO A;  4G7H C;  1SE3 A;  1RTN A;  2OEO A;  1EY8 A;  1KAA A;  2AQ2 B;  3WOE A;  2PCF B;  2LKV A;  1J9O A;  2XNA C;  3SK4 A;  1SNP A;  1SNC A;  1YNN D;  2EJF C;  4PMW A;  5EPJ A;  3TN2 A;  3TP6 A;  1F9Q A;  1SSO A;  4KK7 A;  4IFD J;  5E4X A;  3OIP A;  2GA4 B;  1BCP C;  1PTO H;  2F0W A;  2JSO A;  4MHE A;  1PTO F;  4UDU C;  3NQI A;  5EKI A;  2A6H C;  5COR A;  2KEE A;  5CV5 A;  1F2Y A;  2PNR C;  5ELF A;  1IYV A;  3CU7 A;  1RD9 D;  1LT5 D;  3Q24 A;  2JA7 B;  2B2W A;  4I65 A;  1B3A A;  1MGS A;  3S17 B;  5IGE A;  2O5I C;  2G9D A;  4G7O C;  1WD0 A;  4V0B A;  4JBW A;  3K0Y A;  2G9H D;  4R8I A;  4AYB B;  2K5W A;  1TT2 A;  5EPK A;  5FO7 B;  1U4R A;  3GO5 A;  3OMC A;  1T5E A;  3L3O C;  1LTI D;  2N55 A;  2TMP A;  4X3U A;  2B2T C;  2MPM A;  1SYB A;  1CK1 A;  4KV6 A;  3MXN A;  2O2L D;  1LTA D;  1HFN A;  1B9M A;  1D5X C;  5IGB A;  4NW2 A;  2EYJ A;  3P7J A;  2K7V A;  1GUN A;  5I6W A;  3MA2 B;  3I8Z A;  3NPP A;  3PV0 A;  4A3K B;  1JE4 A;  1VF7 A;  4HTH A;  4BWG B;  1H9J A;  3W3A A;  2K04 A;  5C4H A;  1EL0 A;  1I4X A;  2LS0 1;  1OXV A;  1HQR D;  4PMB A;  2L12 A;  1SJE D;  2K28 A;  1J8I A;  3X3N A;  1DJR D;  1STG A;  1B44 D;  3PUX A;  1KLU D;  2SNS A;  1R9T B;  2X69 A;  1QJO A;  3HGB A;  4HAE A;  3WDN A;  2XIW A;  1F2Z A;  2A68 C;  2F0P A;  3OHX C;  2F0I A;  1U4L A;  1WTW A;  3QO2 A;  4H7B A;  5E4W C;  3D8G A;  1BR9 A;  1PTO B;  5C5L A;  1TWA B;  3I72 A;  3S9W A;  1Y8N B;  4QCL A;  4DF7 A;  5JEA J;  3HOU B;  1CI3 M;  4C2M B;  3MXP A;  1D1K A;  3FVQ A;  2AQ3 B;  3W2D A;  3M3Y B;  3GTM B;  3EJI A;  1A2U A;  1VDZ A;  1DON A;  1SYF A;  2VB2 X;  1KLG D;  4KI0 A;  4BY7 B;  1O7Y A;  3QIA A;  3TME A;  2D9U A;  3HOW B;  1MSG A;  3SDZ A;  1K8O A;  1DOL A;  3NE5 B;  2F0S A;  3CRL C;  1SAP A;  3BDL A;  5IOD A;  2C5C A;  2MP1 A;  2JXM B;  4B9W A;  1VMC A;  3BYT B;  1Z6H A;  1EY6 A;  2F0O A;  4H44 C;  4XQQ A;  1SNM A;  3P1H A;  1FNU A;  3HS0 C;  2ICI A;  3BDO A;  5FO9 B;  1JCK B;  5COY A;  4LK1 C;  2B2U C;  3LWU A;  2YU9 B;  5KGU A;  5EKL A;  1QE6 A;  3A7A B;  5M5X B;  5JOB A;  3M4Y A;  2L5T A;  2FHT A;  1TWC B;  1LT6 D;  1CA5 A;  4G57 A;  4IUN A;  1WD1 A;  2LMC B;  3D4D A;  1A6X A;  1Q3L A;  4BS9 A;  1JIC A;  3SE0 A;  2YYZ A;  2WKD A;  1LT3 D;  3A7L A;  4RKL A;  2ID0 A;  3VA7 A;  2AWN A;  1IW7 D;  5KIX A;  3R93 A;  1L0X B;  2X6L A;  4CGY B;  2F0V A;  4OO1 H;  5FOB B;  1SNO A;  3SK6 A;  5BN3 A;  1G6Z A;  3FPP A;  1W6K A;  4LMQ D;  2EYH A;  5DM6 3;  2WAC A;  1D5M C;  2F1M A;  4HN7 A;  1XTC D;  4HCE A;  1SYC A;  3SEB A;  2KJX A;  3L7Z C;  3K59 A;  1JOQ A;  1LTR D;  5EPL A;  3HOX B;  1EZ8 A;  1Y1W B;  1SBB B;  1BUV T;  4IFD G;  2A6E C;  2B63 B;  2SEB D;  2H1E A;  2FMM A;  4KKU A;  1K83 B;  2KCN A;  2M2L A;  1LAC A;  5CV6 A;  1JOO A;  3OIQ A;  2JYO A;  3ITP A;  3VR5 A;  1ML0 D;  4K6D A;  3UI2 A;  4M8A A;  4K6L A;  3C2P A;  1G2T A;  1ROD A;  1JR0 D;  2ZXR A;  1G8Z D;  4XIG S;  5HUR A;  5CR3 A;  3K5M A;  3H3V C;  4OO1 G;  2H4O A;  2VB3 X;  1TWG B;  1CHP D;  1OXU A;  4K5X A;  4L6T B;  2EYP A;  4K2L A;  5C5M A;  1OXS C;  2RSO A;  1IYU A;  1SYG A;  2D62 A;  2WV6 D;  3KLS X;  2AUK A;  5IT9 L;  4H0L C;  4RA8 A;  3QWN A;  3FPU B;  4IUT A;  2NVT B;  1AN8 A;  1F2L A;  4WRD A;  5ELB A;  5M3M B;  1PFM A;  3DWA A;  3T56 B;  4ZK9 B;  2A73 B;  1NSN S;  1STE A;  3HRZ C;  3PUV A;  2NVY B;  5IGF A;  3J7Y W;  1YNN C;  3NWT A;  1CHQ D;  5C0X I;  1Y8O B;  4F8M A;  1RDP D;  3ONA B;  1I3Q B;  2Q8R E;  2WII B;  3IKJ A;  3NSW A;  5EGT A;  2RVL A;  1U4P A;  1II3 A;  1C4Q A;  1T5X D;  2WAQ B;  4DU9 A;  1GUO A;  2Y0S B;  4ZLT F;  3LWE A;  1G29 1;  3M4O B;  4HR7 B;  5LHY 1;  4K5V A;  4ZUJ A;  1RTO A;  4DAV A;  5ELD A;  1JOR A;  3H09 A;  4FF3 A;  3TZD A;  4C3H B;  4TKO B;  2KUM A;  3AU7 A;  4RCN A;  1H9R A;  1R4P B;  1Y8P B;  5LL6 S;  1AEX A;  2A5H A;  3TP8 A;  4KN4 C;  3ND8 A;  5FKA C;  4JK1 C;  1HCZ A;  1TS4 A;  1EY7 A;  5JEA G;  1CZW A;  1EIH A;  5FO8 B;  3DXJ C;  4NDX A;  4TRD A;  3C3L A;  2JP1 A;  2F0Q A;  1D5Z C;  2NBF A;  1EIG A;  3MXG A;  1SJH D;  1WVL A;  2M00 A;  1SMY D;  1A2T A;  3T4A C;  3HZX A;  4HMJ A;  1U9R A;  3MVV A;  3TBI B;  3DM1 A;  5KRU A;  5T1G A;  2D2C C;  1BOS A;  1NCV A;  3HEJ A;  1V8Q A;  1TY2 A;  5C3X A;  3R2I A;  3H91 A;  3BVZ A;  1EYA A;  2MJ8 A;  2F0T A;  4RGT A;  3O13 A;  1PZJ D;  1FD7 D;  1Z7T A;  1ESR A;  2PPB C;  3KLR A;  2EOT A;  1SE4 A;  1JC7 A;  2ICE C;  4BY1 B;  2NTT A;  2AUJ D;  5I2X A;  3GV3 A;  3U9O A;  1EWH A;  3IL8 A;  2F0L A;  1RHP A;  3ND9 A;  2E2D C;  1WCM B;  1LT4 D;  2WP8 J;  5EBC A;  1KDC A;  5I4D A;  1UUP A;  3S1Q B;  1SEB D;  4FXD A;  2BCO A;  4P2C B;  3VR3 A;  3FEW X;  2Z1C A;  1WTV A;  2B2V C;  3DEO A;  3GTJ B;  2F4I A;  3FMC A;  4CJ1 B;  3MFY A;  3BYY B;  4FO2 A;  2NUC A;  5I9O A;  1EYD A;  1PFN A;  2DY7 A;  3DMU A;  4FF1 A;  1HHV A;  2EYM A;  3QOJ A;  3GQB A;  4M1U B;  3GTO B;  1NR2 A;  2IL8 A;  1JWM D;  3LNN A;  1X3Q A;  2CQA A;  4KMU C;  4QIW B;  1X3P A;  4ILW A;  4C3I G;  1F9R A;  1PYW D;  1F9P A;  3DUZ A;  4IAL A;  1F9S A;  1TS5 A;  1ZYR D;  4GZY C;  3NTI A;  3L9A X;  1O7L A;  1C48 A;  1E2V A;  2NTS A;  3I73 A;  4RAU C;  1WTP A;  3HKZ B;  4TSS A;  5DAU A;  3MXU A;  5KYL A;  3PMF A;  4O1N A;  1A3U A;  5D3D A;  5DNF A;  4ME5 A;  2OF1 A;  3T51 B;  4C1N K;  4HSV A;  4A3E B;  1BO0 A;  1EQV A;  1VCI A;  3J81 E;  1EWC A;  4OIK A;  4WOR A;  1H9K A;  2KHS A;  2EXZ A;  2KEC A;  1O78 A;  1H9S A;  1PZI D;  1LAB A;  2TSS A;  2IPK D;  3RLF A;  3AMU A;  1PXU A;  3GP7 A;  1PLF A;  5KEE A;  5J22 A;  4J8Q A;  1IW7 C;  1TS2 A;  5CV9 A;  3NXW A;  2PYK A;  3PUZ A;  4XYO A;  2VNU D;  3V96 A;  5CMD A;  1D1I A;  2M9V A;  4O42 A;  1ILP A;  3SHL A;  3A8J E;  3K5O A;  2KCC A;  4IQZ A;  4FF2 A;  1XX8 A;  1Y1V B;  4RGN A;  3VR4 A;  3SK8 A;  3OMG A;  1MI2 A;  2K05 A;  3T53 B;  3TP7 A;  1PZK D;  2RDG A;  3OWF A;  4K14 A;  1I50 B;  1HA5 A;  2EYL A;  4RHS A;  2HCC A;  3EQL C;  4UAI A;  2B2Y A;  1QOH A;  3H6M A;  1GUT A;  1WTR A;  3VR2 A;  2JA8 B;  1ZKO A;  4EQO A;  4RFB A;  4R8N A;  1CQV A;  2ZT9 C;  4X3K A;  5EQ0 A;  4C56 C;  2F3W A;  3MWY W;  2N88 A;  5M9O A;  2PW5 A;  3GTG B;  2FJ2 A;  2LY7 A;  2WIN B;  5M5Y B;  1GHJ A;  4G4K A;  1E2W A;  3MTS A;  3S16 B;  1EY5 A;  2EJM A;  3KK7 A;  5ISR A;  2MGS A;  4FP5 D;  5CYU A;  1DOM A;  3IAY A;  1HUN A;  5ELE A;  2K1B A;  1V1O A;  5C6A A;  3NUC A;  3NBI A;  1PRT D;  3N6R A;  1M4V A;  4E6I A;  4ZYS A;  5KNB A;  4K5W A;  3PUW A;  1S5B D;  2O5J C;  1IL8 A;  4A3G B;  2E76 C;  4IN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...