1JQYD

Heat-labile enterotoxin b-pentamer with ligand bmsc-0010
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anchor-based design of improved cholera toxin and E. coli heat-labile enterotoxin receptor binding antagonists that display multiple binding modes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords HEAT-LABILE ENTEROTOXIN B CHAIN
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, L, M, N, O, P, V, W, X, Y, Z
ec nomenclature
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jqyD00
1RD9D 1S5FD 5ELCA 1D5MC 2O2LD 1JWMD 1TS5A 1ET6A 1CK1A 1BXTA 1KLGD 5ELDA 5FK9C 1G8ZD 1FNUA 1T5XD 2WV6D 1L0XB 1LT6D 1V1PB 3URYA 1SBBB 1STEA 1HTLD 5ELFA 2J4XA 1MD2D 1S5DD 1SJED 3O13A 1JWUD 1KLUD 4ZYSA 1SXTA 1CHPD 1LTGD 1TS3A 1SE3A 1V1OA 3R2TA 1EWCA 1SEBD 1TS4A 4RGTA 5D3IB 4BWGB 4RHSA 1SJHD 1PRTC 3TSSA 3DWQA 1JQYD 3MC0B 1D5ZC 1LTSD 1B1ZA 3MFGA 1KTKA 1BCPB 2ICIA 1XTCD 5FKAC 1I4QA 1I4GA 1I4RA 1PTOF 1LLRD 1CQVA 2NTTA 2Z8LA 1FNVA 1M4VA 4RHRA 1RF2D 1LTTD 1SE4A 1BCPC 1EFID 1EU3A 2AQ1B 2TSSA 4C56C 2G9HD 3BVZA 4OHJA 1V1PA 1I4HA 3W2DA 3EA6A 5ELBA 1ESFA 2R61A 4O1NA 1PTOB 1PRTD 2SEBD 3BVGA 1LT3D 1CT1D 1PYWD 4RGNA 1D6EC 2XRQD 3SEBA 1ENFA 2XNAC 1FGBD 4L6TB 1PZJD 3EFXD 1B44D 1LTAD 3R2IA 4DXFA 5D3DA 1LTRD 1UUPA 1PZID 1LT5D 4L63B 1LTID 1PTOH 3KLSX 1LT4D 1F77A 1AW7A 1I4PA 1S5ED 1HA5A 1QILA 3R8BA 3BZDB 2AQ3B 1JWSD 2CHBD 1I4XA 1JCKB 1BCPF 3GP7A 1UNSA 1HXYD 1TY0A 3V05A 1GOZA 1EU4A 4Z9CB 1D5XC 1FNWA 2XRSD 1LTBD 3BYYB 1BCPD 1TY2A 3DWPA 1AN8A 1L0YB 1PZKD 5TSSA 4RGMA 3DWAA 1XXGA 2RDHA 3BYTB 1SE2A 1RDPD 2IJ0A 3BVMA 4RCOA 2NTSA 1EEID 1DYQA 1PTOC 1S5BD 2AQ2B 2QEJC 4UDUC 4DXGA 5ELEA 1S5CD 5I4DA 1TS2A 1EEFD 1FD7D 4RGOS 1JR0D 1LO5D 1PRTF 4K6LA 2XN9C 2RDGA 1CHQD 1RCVD 4TSSA 2IPKD 1DJRD 4RFBA 3CHBD 1HQRD 1PTOD 1ET9A 1PRTB 4RH6A 2QILA 3OWEB
chains in the Genus database with same CATH superfamily
2VB3X 5EPLA 2E2HH 3G4SA 3W5OA 4DR6Q 4PMBA 5G3LD 5C4JB 1XTDA 5LL6S 2DN8A 1DOMA 1L0XB 1PMRA 1VDZA 5IP9G 1L1OB 2QW7A 5IYDG 4HJAA 2D5DA 1YNJD 4P71A 3Q23A 1N9WA 3ND9A 2TMPA 2MUYA 3IKJA 2F52A 5M5YB 1BUVT 3GTPH 2I5MX 1TS4A 3K0XA 1HRJA 3NBHB 2Z9HA 4YWKA 4A3LG 5IYDH 4KMUC 3PO2G 1ILPA 3I4LA 5E4XA 5KGUA 3TP7A 4MZ9A 1SRUA 1LV9A 2A68D 3AB9A 1XPOA 2EYJA 2D2CC 3CC4A 2EPBA 3KDFA 4LK1C 1K3RA 4GNXA 2NWGA 3T51B 2UUCL 4GN4B 2CH4W 2AKWB 3CKIB 2ZTEA 1YNJC 4KTAA 4IFDJ 2DJFC 2NVQB 4X3UA 4XQNA 3I2ZA 4DR7L 2A8VA 4O2DA 1HNZL 5EKKA 2Z6KC 2PMZB 2AUJD 3FKIB 4GKKL 2UXDQ 2ZM6L 1EY4A 2WKCA 3PF5A 1XPUA 1KC8C 2WB1B 3AU7A 4A3JB 1LTRD 4WRDA 4X66L 3PUVA 1NTGA 4DV4Q 1A2UA 4WJ4A 2KCMA 1Q12A 1HA6A 3J7AV 1HUMA 4A3GG 4FVMA 2YV5A 2B2WC 1W6JA 1I94Q 3HOXH 3CW2C 5C44B 4A3JH 5M3MG 2DJGC 3DWPA 4LF7L 1CKMA 4LF8L 2NVYB 1G91A 5FLXc 3S2HB 1STNA 4DV5L 3HRZC 1CSQA 1I3QH 2B2UA 2A6HC 2OQ0A 2OXPA 4E6IA 2L11A 4P74A 1VF7A 4HAEA 1WTPA 2R7ZG 3TZUA 4HSVA 4YWLA 3HOVH 4RH6A 4YHHL 2WAQE 1YBYA 4I7ZC 1YNND 5JPMC 1PLFA 2MGSA 3S1RB 1HH2P 1YITA 1HR0Q 4A3KH 3GTMB 2KCNA 1S3OA 4JI6Q 5HGQA 5I2YA 1FNUA 4HR7B 1HR0W 1SYGA 3D31A 1U4PA 3DM1A 3I72A 4OO1I 3EIVA 1QZGA 3E5SA 3S1RH 1KABA 1JOKA 2KEDA 2KVMA 4CJ1B 1TS3A 2UUBL 1QB5D 2WAQB 1IBLQ 1MSGA 5BN5A 3ND8A 3DUZA 2ZXPA 3J80E 1YHBA 3DWQA 4LJZC 3TP5A 4NXNL 3T16A 2LKVA 2OCEA 1B1ZA 3R3OA 1KTKA 4DV2Q 1CA6A 2R7ZH 3MAQA 5C4XB 3VYSA 1X55A 1VQPA 4A3IH 4G4KA 1ICWA 5M5XH 1TWGH 1II3A 1RF2D 1LTTD 3EBEA 3G6EA 1SE4A 3C46A 3UDXA 1G291 3M4OB 1W6KA 3P1HA 5C5LA 3TBIB 3D4RA 3ER0A 1GHJA 2R61A 1JMCA 1SMXA 2HT1A 1GUTA 2QCPX 4A3IB 3I4MG 5M5XB 3PQIA 1NSNS 3OTOL 1H9RA 1VQMA 1WTXA 1SAPA 4LF4L 1SLJA 4F8MA 3NWTA 3GTOH 4IPCA 3TMEA 1YZ6A 3KLWA 1B8AA 1B9MA 1QILA 2EYLA 5IYBH 4L5SA 3T1HL 4UAIA 3NWSA 4IN3A 4C3IH 3NSWA 4PQXA 1DM0B 5T1IA 1LTBD 1YVCA 1F2YA 2F0NA 3DM3A 1DZ1A 4ZCKA 2RDHA 1KDBA 2K4KA 1RDPD 3BVMA 4RCOA 4ZQ3A 4KN4C 2CQOA 2QEJC 2JA8H 3S1MB 2R7DA 3E6ZX 4JPBW 4C3IB 4QCLA 1EEFD 3K5OA 2KHJA 4DV7L 4K6LA 2ZJRA 2F0VA 4TSSA 4JI5Q 1MGSA 1ENCA 3HFZB 1DXMA 2B2YA 2PNRC 1MBYA 2VQFL 1HQRD 4GKJQ 3BDLA 1YNNC 4HJ8A 2FJ2A 2E2IH 3PO3G 2F0MA 3S17B 1ET6A 2A5HA 2A68C 4DU9A 1B4OA 1DONA 3KK7A 3VR6A 1Y69U 2IL8A 3E0JA 1IYUA 4Q0FA 1AE3A 2JA5G 5HY6A 4GKJL 1WD1A 4GZYC 3D0FA 2QKIC 3FEWX 1HPCA 4CKEA 5J1ZA 1LM0A 4FO2A 2HQLA 1HFNA 1JE5A 1SNMA 3J7ZC 3SR1A 1A62A 3SXHA 1HNZQ 4DV3L 5IT9L 4K5XA 2ICIA 2F0IA 1XNQQ 1VMPA 3N52A 1L0WA 1I4GA 1K0RA 4B3TL 4A3GH 3LX0A 2E5LL 1KHIA 2L4NA 3I8ZA 1X65A 2E8GA 2K1BA 3JAME 3GTPB 3D6WA 5IIFA 4LFAQ 1PHJA 1D6EC 5GQOA 1FGBD 4QL5A 4KKTA 3ZJYC 4DXFA 3FMCA 4QIWB 2B2YC 3CF5A 1JJGA 3H0GH 1Z9FA 1LT4D 3WOEA 1PH8A 4CJ0B 2OT2A 1N33L 1F9SA 3T56B 5I6YA 1PH4A 4RWSC 3SK4A 3FHWA 3L7ZC 1TWCH 2F0LA 4PZ8A 4B3SQ 2F0EA 3D8GA 1CA5A 1L0YB 3DMUA 3M9BA 3FKIH 4BBSH 2CFMA 2A1AA 1Q82C 2BDOA 1SR3A 2XSCA 5EBCA 2R6GA 4P73A 1PFMA 1IBKL 3CC7A 1TS2A 4H7BA 5BN3A 1JR0D 1OXVA 1Y1WG 1C7YA 4KJNA 1SMYD 1AZPA 3AQQA 3CRLC 2YTVA 4O42A 1PTOD 4O0AA 1J8IA 3RLOA 1DCZA 1KRTA 1JOOA 1HCZA 4G7HC 2PQAB 5E7NA 1NCVA 1JB3A 2BH2A 3PUYA 1A6XA 3KLSA 2WAQG 3KUPA 3VYRA 3BJUA 2I07B 4L8JA 4NP5A 1TWFH 2CH4A 4DKAC 1N33Q 4JI7L 3K5MA 1FL0A 1X3QA 4LFBL 2NVYH 3J81E 3RUZA 1KNEA 5AJ3Q 3C2PA 1HTLD 2K5WA 4J6HA 5K36G 2XWBB 3T53B 4JI2Q 4ZYSA 3QO2A 3HOZH 2FMMA 3RD4A 3E0EA 3R2TA 4B3RL 2Q2HA 5M3FG 2EXZA 5LMUL 3GTLB 3GO5A 2ATWA 1JQYD 3H94A 1WI5A 3FP9A 3HOVB 1VQ5A 4JI1L 1SYDA 4LUVA 2FXQA 1GHKA 3BZCA 1F9QA 1WOCA 3OSOA 4POGA 3K6OA 1XTCD 5I2XA 4OL7A 4K5WA 3QIAA 3AYHB 1CQVA 3H6MA 4ZUJA 1VQFA 2IHEA 2KJXA 2X6GA 1ESRA 2TSSA 1Q46A 3EN2A 1Z7TA 4DV3Q 1L1OC 1NUCA 5CMDA 1A3VA 1X9NA 3K57A 3BVGA 4OIJA 4JBJA 3UDFA 4RGNA 1ENFA 2XNAC 3NK9A 1SYBA 3I4OA 2L15A 3CCQA 4HIMA 4X66Q 1B9NA 1QG7A 3STBC 4RCNA 5JJLA 1B2TA 3C1FA 2MP1A 4JI0L 1GUNA 3I4NH 4FXDA 1EIGA 5IWAL 2HHHQ 2F0PA 2L0CA 2CHBD 1JCKB 2YU9B 4IPDA 2B63G 4LUZA 4IQZA 1RIPA 5E1FA 2XRSD 4K0KQ 1O78A 3KOJA 2VQEQ 3BU2A 4KHVA 1I6HH 1E24A 3A74A 4IUQA 4BY1H 4K8IA 1VQNA 2F0JA 1DYQA 4JC0A 4IURA 1AH9A 4UDUC 3U58A 1TWHH 1PH7A 1N8RC 4RGOS 1L2FA 1PRTF 1EY8A 3T1HQ 1YJNA 2KENA 5C3EB 3QOLA 2IY5B 1E2ZA 2CW0C 1W2BA 4JI1Q 1Q81C 3IFDA 3HOUB 3A5ZB 2X6LA 1S5FD 3IAYA 1GO3E 2F0OA 3NTHA 4HIDA 5KYIA 4HSPA 1V8QA 3E3XA 3UDIA 1ZYRC 3VR4A 1HHVA 4KI0A 4H0LC 4HCSA 1MD2D 2Q2TA 1K8AC 2R93B 2HDMA 3F2DA 1XWEA 1SE3A 4B9XA 4NXMQ 1H9SB 4BY1G 3VR2A 1RL2A 2K50A 5M3MH 4A3JG 4K0KL 4ZKCB 4LMQD 3HOXG 1KDCA 5IGCA 3NHHA 1SNPA 4DAVA 2B2VA 1K73C 4A3BH 1HFGA 2SDFA 4C3JH 4R9WA 2GA4B 2PZWA 2ZXOA 4HCEA 1Y1WB 3HP3A 2F0GA 3S15B 1HNXL 4IFDG 4C56C 4P2CB 5FLXE 2UUBQ 4KJOA 1HNXQ 3N6RA 4YCUA 2EY2A 1S40A 4UP7A 4A3FG 2HQEA 1G2TA 4NB3A 5IOCA 2SEBD 2XWJB 3E9HA 3T1YQ 1K3BC 4A3EG 5C4JH 2B2UC 1BQQT 3FKIG 4R8NA 1J5EL 5IGGA 3A8KE 1LTAD 4AH6A 3B6YA 3K5LA 4DV0L 4DR3Q 4QJFA 3SE0A 2F0SA 2K14A 2KUMA 1F77A 4K14A 5EGTA 5JJIA 5ELOA 1L1OA 3A7AB 2F3IA 2ZTDA 2I5HA 2Z6KA 2HIXA 3HGBA 1Y8PB 3ONAB 2ZJQA 2KEEA 4JI6L 1QVCA 1A15A 1N32L 5FOBB 1KDAA 5JJZA 2E5LQ 3MXPA 5HURA 5K36H 1GVPA 1ZXTA 2NVQH 1C48A 1HNWQ 2XN9C 3HKZB 4JW0A 4EQPA 4C2MH 1I5FA 1JT8A 4PMCA 5DNFA 1LUZA 5CV4A 1NE3A 4YY3L 1D8LA 4KKUA 4JI4L 4FXGC 1RD9D 3PO2H 5ELCA 5CORA 2PZTA 4DR5L 5FJ8G 1SYCA 4C2MB 2JSOA 2WV6D 1ZYRD 5C3XA 3LWUA 2EJMA 4KKSA 2FINB 1RODA 1SNCA 2EDGA 2D0OA 3S1QB 3MTSA 3KF6A 1STHA 3HOVG 1CTMA 2E75C 3S24A 5IP9H 1PFNA 4QIWE 1E7ZA 3O13A 5IT9c 1PH5A 4LUOA 1VQCA 1CHPD 1GKHA 1G6PA 2Q8RE 2RCNA 3A55A 5C44H 3H3VI 1QNKA 4POFA 2VW9A 4A75A 3TSSA 3S14H 1VQAA 2UUCQ 5GAHC 3S1QH 2NBFA 4IFDI 1C9OA 4AYBE 2K5NA 2B39A 4PV1C 3BDOA 4UP8A 2CWPA 1Q3LA 2K75A 2VL6A 5FO9B 3S9WA 3EROA 4CJ2C 1KNAA 3BG3A 4A76A 1GJXA 3I91A 5I6WA 1PXUA 2CVRA 1C8CA 4HTHA 2B29A 3U50C 4LFAL 4A3KB 2JE6I 4LF5Q 1KAAA 3SK5A 3HOZB 1VQGA 4LF5L 4X64Q 1PYWD 4ZKBB 1PFBA 5IE8A 4C1NK 3PUZA 5K5PA 1DGSA 3T13A 1MSHA 5E3FA 1RTOA 2AHOB 1PZID 3NTKA 1AW7A 5KEEA 1HA5A 3KF6B 1J5EQ 3GP7A 1CFMA 2JK8A 4UY8C 3BYYB 3TP8A 1VQBA 2HCCA 2K52A 3DWAA 2V4DA 2M9VA 5C4XH 1CUKA 2SNSA 2VUMG 2BA1A 4KD4A 3K81C 2LY7A 1CSPA 2BH8A 3CXCA 3AFPA 5KIXA 3CD6A 4DUZL 4DK3C 3G6JB 2E2DC 4XYOA 4KHZA 4LFCL 3TDQA 3DEPA 1IYVA 2JEBI 5AFWA 4EQNA 4OWWB 1EUJA 3GTQH 1NY4A 4A93G 1D5MC 5LMNQ 3PO3B 1OXXK 2R7FA 2Z4IA 4X3TA 5CV7A 1NJIC 1AE2A 2K05A 1I6HB 2NZHA 1LT6D 4FF4A 3K7AB 3GDEA 3EVQA 3C1EA 1SBBB 3PUXA 1R4PB 4U673 5ELFA 3CRKC 2J0TD 4DV1Q 1RKNA 2MNAA 2RF4A 2K6AA 3M85A 2EYOA 1SEBD 2SOBA 3FRPB 1F9RA 1HUNA 1BF4A 2B63B 4A93H 1GD7A 5C0XH 3HOUH 4AQYL 1LTSD 1Y1VB 1G2SA 5IGDA 3W3AA 3SK8A 1SYEA 1OXSC 2N78A 3OHXC 1TIID 2ZXRA 1CZGA 4OX9Q 2Z8LA 3S2DB 3J7YW 1YI2A 4JI7Q 3PIOA 1NR2A 2WB1G 3CCSA 1IW7C 2ICEC 2L1BA 2LMCB 4L5RC 3S17H 1Q8IA 1PTOB 4A3EH 5A2QE 3Q0AA 2PI2E 3I70A 1K0SA 1A0IA 3MWYW 5JVH3 2JXMB 2NB0A 4WORA 3TRZA 2X69A 1PZJD 3FVQA 1H9SA 4C3HH 2YTXA 4LF9Q 4A3CG 4LAAA 1K8GA 5CV9A 4B3ML 4XTCS 3NXWA 1YNXA 1LT5D 1LTID 1PTOH 4IUNA 4DR1L 4A3BB 3KLSX 4A3EB 1VQ6A 3BZDB 4RMFA 4DNRB 4A3BG 4IOAA 4YCVA 4ZUIA 5C3WA 4BXXH 1NMGA 2RCFA 3KF8B 2EYHA 4PG3A 3OIPA 3STBD 1V43A 1V9PA 2RHQB 5IYCG 1A63A 1KIXA 1PDQA 4JI5L 2BOSA 3CCMA 1S72A 1BVSA 1IKLA 3Q24A 1EEID 1TWAH 2PO4A 4DV6L 4A3GB 1N34L 1SDFA 1A2TA 3J80i 4G7OC 1EY6A 3F2UA 2E2JB 4NXML 1JICA 2UU9L 4QF4A 5A2QL 3NBIA 4MHEA 2QGQA 3SHLA 4K8JA 1GUGA 2QILA 4R4CA 2A69C 2Z6BA 3HOWG 1N32Q 5ELDA 2IW3A 1VCIA 4AQYQ 1YHQA 1TKWB 3QR8A 5FO7B 2FMCA 1BBWA 1D2BA 5M5YH 5LMUQ 4A3LH 1EWHA 1OXTA 3CPFA 4LF4Q 4KHPL 2Y0SE 5H1SE 1EOVA 1OO9B 5HGTA 3GTKB 2EYPA 5IYCH 1PRTC 4GN3B 4LFBQ 2VQEL 2DUDA 2EYFA 3K58A 2KHSA 4FF2A 4DR2Q 2V1CC 4PNYA 2D0PA 2HD3A 3GTJB 2JN4A 2UXBQ 4IZ8A 4PMWA 5LMNL 1A8VA 2F1MA 1JC7A 4DV4L 3GTKH 1EY5A 4R4TA 4NDXA 2CWAA 1M4VA 1WTQA 4JBWA 2F03A 4CDCC 1VQDA 4C3HG 1EYDA 2G9HD 3HKSA 4DAPA 3CU7A 4ID6A 2ALYB 1IZ6A 1HZCA 1SNOA 3NEMA 2ZM6Q 3KFUA 5JEAG 3D3RA 2K03A 1H9KA 1NBWA 2VUMH 2VQFQ 1O7IA 2R92H 2UXBL 4DR7Q 3OW2A 3PUWA 3JAMc 3KYHC 1VQ9A 1E22A 3CQZB 2A73B 3ICEA 3RNUA 3H09A 3I4MB 2VUMB 3CAMA 3J80L 2R92B 4MNOA 4KN7C 2A6EC 3CCRA 1HXYD 1TY0A 2R92G 5KNDA 1BBUA 3QWNA 3A54A 1BCPD 2RSNA 1HQMC 3A56A 2E74C 1XX8A 3BYTB 3GV6A 1VS0A 2K04A 1KQSA 4BY7G 1S5BD 2F4VQ 3MZ5A 5ELEA 4HJ7A 1SNDA 4FXKC 5CBAE 1GUWA 4ZAIA 5C3EG 1XNQL 4C3JG 4FYDA 2IX0A 1NR4A 4RFBA 2EY6A 3GTMH 1B3AA 1Q8KA 1WJJA 3PCOB 2DY8A 1X3GA 5AJ3L 3KJOA 2O2LD 1EQTA 1TS5A 1STAA 3K59A 2B3GA 4OO1G 4HN7A 4IPGA 1R4QB 3RZOB 2F0UA 1STEA 4EX5A 1NNXA 1Q7YC 1I50B 2NN6I 2HIVA 4OWTB 1WTVA 4BBSG 4S3SA 4DR1Q 2YYZA 1WCMB 1LACA 4OELB 4BY1B 2Z1CA 5JVG3 1IW7D 1D5ZC 1I50H 3G48A 2N8NA 1M1KC 2KBNA 3PIO3 1X3FA 3ULJA 3PO3H 3IL8A 2RKSA 2RHSB 1WTOA 1I4RA 1B7YB 4KD3A 4RHRA 4QY7A 3K7AH 5NUCA 3MEHA 1EU3A 2IHFA 1AP0A 2A19A 1I4HA 4EQOA 1XMOL 4KHPQ 4GLXA 1VQOA 5I9OA 2UXCL 3QB3A 3PV0A 2NVXB 4YCWA 1PFSA 2RDFA 4A3DG 2B63H 4A93B 4AIMA 5GAGC 1WCMG 5CGKA 2F3WA 3RLFA 3NELA 2JQOA 1BR9A 3QG1A 3CP0A 1RTNA 1VQ7A 2GVBA 2NVXH 4X62Q 4QMGA 4KV6A 1U0LA 1P16A 1X56A 3UE1A 2LXJA 1Z47A 3S2DH 4FNFA 1QUQA 4CKBA 5JEAJ 5M3MB 1GOZA 3CMAA 1KXLA 2UXCQ 2VNUD 3PGZA 5T1GA 1CZWA 2JA8B 3S1MH 1AN8A 2PCFB 4RGMA 1RHPA 3NQTA 1G6ZA 1Q1BA 4ME5A 2HHHL 1AEXA 5C0XJ 4B9WA 5JEAH 1R9TB 1Q86C 2C9OA 2K33A 1BNZA 1ZEQX 5I4DA 1M90C 4C3HB 1IL2A 5E4WC 2RDGA 1VQHA 5BN4A 1F2ZA 1EIYB 3KDFB 1QNUA 1TR5A 1JB7A 3DEOA 1IBML 4JI4Q 3S16H 1JWMD 4IJHA 2NN6G 3D6CA 5CR3A 1X32A 1G8ZD 4RG1A 5GAEC 2E2HB 2Q8TA 5EKLA 3KBXA 1F2LA 4X65Q 4X3SA 1CKOA 1ZKOA 3HOWB 4M1UB 2Z4HA 4R8IA 5EPKA 2O5JC 3NQIA 3U9SA 4R4IA 5IGFA 1B70B 3MC0B 4QUCA 2WINB 5C0XI 4JV5Q 5D14A 1UEBA 3A0JA 3TP6A 1O7LA 3HOWH 1U4LA 4OX9L 1EYAA 2AWNA 3OMGA 4DV0Q 2NTTA 1SFOH 1E1OA 4TRDA 1BCPC 1EFID 4BBRH 5EBDA 1G51A 1UE1A 3S1NH 2JP1A 4DR6L 1XMQL 2MO0A 3GD7A 5EAYA 3KJPA 4R1JA 3RR5A 4IJLA 1UE5A 2CQAA 3MHBA 4J8QA 1ML0D 4XIGS 4APVA 4DR3L 4DV5Q 1VQIA 1E2WA 1LT3D 2G9DA 1VQ4A 3A8JE 3SEBA 1PA6A 3R93A 4L6TB 3EFXD 2OF1A 3LNNA 1TU2B 5D3DA 1D1IA 4QUFA 2JA9A 4LW1A 2K5VA 1JJCB 4L63B 5M5WB 4JYAQ 1ENAA 2FHTA 4YWMA 2KQ3A 1MHWC 1H9JA 2L12A 2QEXA 1N36L 5M3FB 1EZ8A 3I55A 5ELNA 3ULPA 1TY2A 4I65A 5M5WH 2L5TA 3G71A 1YJWA 1STGA 2WFWA 4DR5Q 3KF8A 4NKLA 1O7YA 1PTOC 1VQ8A 1H9MA 5IT9E 1EIHA 4WJ3M 1SMYC 4LF6L 3FDTA 3S2HH 3MEFA 3GQBA 2IPKD 2XTIA 1DJRD 3CQZH 2M00A 1A3UA 1MJEA 1SN8A 1PRTB 2C35B 2GVAA 4DUYL 4A4IA 2Y0SG 1C4QA 1QE6A 2OEOA 4YHHQ 2P5ZX 1YEZA 2K32A 1FVIA 1MKHA 1KLGD 5IY0A 4H44C 3JAML 3J7A5 4JBMA 5J22A 2OQKA 2BE5C 1JE4A 2N88A 1C0AA 2J4XA 4EQ5A 5IP7H 1JJ2A 2L9HA 2Q8IB 4UPAA 2BCOA 2ASBA 5JJKA 4CGYB 1T5EA 2WIIB 2R3ZA 1BKBA 4C1NI 4DNIA 4RAUC 3M3YH 3OOCA 1BCPB 4TVAB 2DGYA 3NBHA 4ME3A 2OTLA 1I4QA 1N34Q 2F0FA 2WB1E 1VQKA 3GTGB 1HTPA 2NVTB 2QF7A 2N3SA 4DGZA 1N36Q 1GUOA 2R7ZB 1VQEA 5DEHA 2AQ1B 2H5XA 3I7FA 4QGUA 4GNXB 1ICFB 4P72A 3NTIA 3J7AF 1X6OA 4IUTA 3M4OH 1YHAA 3A7LA 2D62A 1PV4A 4CDFC 3UI2A 1B44D 4G7ZC 2VS1A 2PZUA 4N9PA 1PH2A 5FO8B 4MN3A 2AQ3B 2B2TC 2CW0D 2NZ1D 2H4OA 3CC2A 3K5NA 1FNWA 4XQQA 2ZTCA 2EZVA 2KOLA 1DOLA 1SE2A 4ODGA 2PPBC 4B3RQ 2MQHA 3F1ZA 2JA7H 1ONLA 3V2TA 2RA4A 5C44G 4K2LA 2ZJPA 1B3QA 1MI2A 4L5TA 5BR8L 1STBA 3CHBD 5EJWA 5ISRA 4JVZA 2E76C 3OIQA 1ET9A 2MHVA 1XNRQ 3H3VC 1LTLA 3PIP3 1SYFA 3SGIA 3CCUA 5FJ8H 1TXYA 4QB4A 2F0HA 1Y14B 1SROA 2R93H 3F2CA 1QZHA 4PZ6A 2NZOA 4HJ5A 4CKCA 2KCTA 1F9PA 2F3VA 4QQBX 1CQFA 2PW7A 3K80C 1TT2A 2VB2X 4DUZQ 2UUAQ 1IBMQ 4P75A 4BWGB 1K9MC 4BS9A 4B3SL 3P7JA 2JA7G 3FPPA 1ILQA 3TEHB 3PF4A 3S16B 1I6VC 1VF5C 2MO1A 4N8X1 3H0GG 4N9TA 2CKZB 3H3VH 4GLVB 4DAYB 5JPNC 1HZBA 2EIFA 1IYJB 1E1TA 3J81i 2EOTA 4DN4M 1U4MA 4M8AA 4U68A 2PMZE 1GM5A 2KECA 3SDZA 4H02A 4HMJA 2JEAI 1OTCA 4MIUA 1BBXC 3WOFA 5C5MA 1AZQA 3R2IA 4X64L 4I7AA 3CCJA 1WD0A 1WYDA 4F88A 2ENBA 2IWHA 2ID0A 4B08A 4A3FH 3NPPA 4KY7A 4OXPA 2EYMA 1F2MA 3TQYA 1BCPF 2I5LX 3FPUB 1SFOB 2A74C 3H0GB 2B8FA 1EU4A 5IGBA 3S1NB 1J6QA 3X3NA 1K83B 2EXDA 3RMHA 3CCLA 1PZKD 3OWFA 2K28A 2G5DA 1TWCB 2UU9Q 1EL0A 1K8MA 2NTSA 4LF6Q 1M8AA 1CKNB 1PH1A 4UHVA 4JI0Q 3F8TA 5EPJA 4DV6Q 4JK1C 3TREA 1K83H 2PW5A 2JA5B 4X6AH 3H91A 3W1BA 2ES2A 4Q5VA 2NN6H 1J9OA 1UAPA 3HOUG 4V0BA 2A69D 4OIKA 2I46A 1U4RA 5KRUA 1CK1A 1SE8A 5M3FH 1Y8OB 2AUKA 5IGEA 3RLNA 1QUQB 2K5HA 4LWCA 4DF7A 2HCIA 4DV7Q 1NAPA 1QVGA 1K8OA 5CYUA 1KD1C 3L2PA 1EY0A 2NUCA 1TWFB 4CDEC 1XMQQ 3G7LA 4HIOA 1SXTA 2EE1A 3ITPA 1XJVA 4JYAL 4NPSA 2K5DA 3LWEA 4G57A 2KCCA 2JJQA 1NMFA 1PH9A 2VZAA 4CDDC 3RN2A 2GN5A 2NYZD 3MFGA 3CMEA 5FLMG 4ILWA 3UE0A 3GTLH 1EOTA 1HR0L 3SK6A 4DR4L 2KA7A 1EQQA 5D65A 1EYCA 1LLRD 3A8IE 4R4OA 4JG2A 3EQLC 2OTJA 2Q2UA 3L9AX 1DOKA 2DNEA 1O80A 5F2DA 3J81c 3OTOQ 3BVZA 2RQXA 4OONA 1PVOA 3C3LA 4DV1L 4RKBA 3P75A 4DPGA 1ESFA 1EFWA 3E9IA 4DR4Q 4OGQC 1UE6A 3VA5A 2B8GA 5IODA 2K5QA 2F0TA 2XVSA 3DHQA 4A3DB 3L0OA 3RZOH 4JI3L 1SNQA 1AFPA 1UUPA 2BE5D 2XGTA 4GOPA 2CCZA 3T1YL 2WKDA 4FF3A 2D9UA 4NMZA 1ASYA 1VQLA 3GTGH 4XDXA 1WCMH 3I4NG 1FR3A 1JORA 1VMCA 4A3DH 2JYOA 3V05A 3L3OC 3I4NB 1D5XC 5C6AA 1YJ9A 2IX3A 4KK7A 3T4AC 2YU9H 5FLMH 1FYCA 1GUSA 2UUAL 4IO9A 3MXNA 4IUUA 1KL9A 2RSOA 1P8LA 3HZXA 1Y8NB 4DNTB 3TN2A 4XXEA 2VXWA 1E3PA 3HKZG 4EGVA 4ZK9B 2J7ZA 1TWGB 3GTQB 3VYUA 4YIJA 1TWHB 4HIKA 3K7UC 4A3MG 3M4PA 1SSOA 4A3MB 1YIJA 3IFTA 3F2BA 2LFNA 1XNRL 5COYA 3I56A 5FK9C 3U4ZA 1Q90A 4CBVA 4DR2L 3ERQA 1IL8A 2H1EA 2ZT9C 5KNCA 1V1PB 1X3PA 4KY6A 1UE7A 4K5VA 1BO0A 1D1KA 5GADC 1E2VA 3JC66 1SJED 3HOZG 1LYLA 4ALPA 2K7VA 3AMUA 4BY7H 2LSSA 3ZYYX 4WFN3 3MFYA 2B2TA 3HG9A 1T9HA 5GROA 3VR3A 5L37A 4K6DA 3DXJC 4X3KA 1STYA 1QWYA 4CHTB 3HKZE 3KBGA 4GOPC 1B50A 1D7QA 1K28A 2EY5A 2Q2IA 5A35A 4XQJA 1LABA 4H13C 5LMNW 4B3TQ 3CCVA 3RN5A 3ERSX 2XIWA 1O7ZA 1IHZA 4RA8A 3A5UA 1A3TA 3NUCA 4JI8L 3K0YA 3AFQA 1Y1WH 1V1PA 5IWAQ 2BDNA 5CV5A 3S15H 1CI3M 2HUGA 1PH3A 5C4HA 2QDBA 4AYBG 4C3IG 5JAVA 1CT1D 4R4QA 3ULLA 3OPOA 1V1QA 3HOYB 2OWOA 1FGUA 1TQOA 4ZRZA 3WDNA 1MIUA 3AEVA 4ABNA 3VA7A 2AWOA 5KYLA 1I4PA 3W1GA 4ZLTF 3RZDH 2EY1A 3Q22A 1WVLA 3MXNB 2A6HD 4Z9CB 2L55A 4IPHA 4Y52H 4IUVA 4OWXB 1EY7A 4YY3Q 1TWAB 1UWVA 2F4VL 5TSSA 5BR8Q 5G3LF 3Q8DA 1IKMA 2E2JH 4IFDH 2AQ2B 1W3SA 4AYBB 3Q6SA 3JAMi 2IT1A 4DAYA 1X54A 4BBRB 5M9OA 1U9RA 4DFAA 2VY3A 1RCVD 3MXGA 4BBRG 4GOPB 4A3FB 1EWIA 3P20A 3MVVA 4N8FA 2I0QA 2QDLA 1QJOA 1IXRA 4DUYQ 3QOJA 2R93G 2Y0SB 1BXTA 4J15A 4JV5L 1T5XD 2RVLA 4LF7Q 3PO2B 3OW7A 5DM63 1Q1EA 3BZKA 1CM9A 3I3CA 4NW2A 2HDLA 1JWUD 1KLUD 4MTNA 4XT1B 1EIFA 1LTGD 1HJPA 1PH6A 4XT3B 4DV2L 1V1OA 3GTJH 5D3IB 4RHSA 2QA4A 2JA8G 1KAWA 2JA5H 2WACA 4PZ7A 1HZAA 2EJFC 2O4XA 3SVMA 3S14B 3V96A 1DD2A 2JA6G 4BBSB 4JCVE 5FKAC 1IBKQ 3GV3A 4OEMB 4LFCQ 1PTOF 3QJYA 2LS01 2F0KA 4JBKA 3VYTA 4A3CH 5CBEE 3D4WA 5DLQE 3HOXB 2RBMA 1QVFA 4OHJA 3W2DA 3EA6A 3IRBA 5ELBA 4XYQA 3KLRA 2LXKA 1XYIA 2EQSA 2DNCA 3LGJA 4GN5A 1IBLL 2C5CA 3X3MA 4JI3Q 2IX1A 4BXXG 1I3QB 4JOIC 3J80c 3TZDA 5EQ0A 1H95A 4K2KA 3I4MH 4FF1A 3MA2B 5I9PA 2F0DA 3CCEA 3K8AA 1Y1VG 3PSIA 4DK1A 2MJ8A 1S5ED 5IYBG 4TKOB 1JWSD 4GS3A 1JOQA 5C4ZA 3CPWA 3NE5B 5C0XG 2PQEA 4IOCA 3M3YB 2B2VC 1I94L 1S4ZA 2MPMA 1XXGA 4RKLA 4F7XA 4Y7NB 3PIPA 2MFIA 2EJGC 1XPRA 4LF8Q 2NVTH 2YTYA 3M7GA 3WWVA 1S5CD 2PI2A 1WFQA 1XMOQ 1FD7D 3OMCA 1LO5D 4EVOA 1FJGL 5IP7G 2A6ED 4F87A 1MJCA 4BA1I 1CKNA 3HEJA 5JOBA 1KRSA 4FDBA 3U4VA 4Y7NH 2N49A 1EYGA 1EZ6A 4A3IG 1OXUA 3DLLA 5CV8A 3TS2A 3J81j 2Z0SA 5LHY1 5CC4A 2F0WA 5LL6X 1UEAB 3U9OA 2PQAA 1EQVA 3H15A 1VQJA 2F4IA 2F0QA 3D4DA 4JI8Q 4MTKA 3TS0A 4GKKQ 1Z6HA 3URYA 4GNXC 4B3MQ 3UDGA 1S5DD 1QOHA 2M2LA 4GLAC 4HJ9A 5C4XG 2N55A 5DAUA 1EWCA 4IUPA 4JOIA 4RGTA 3VR5A 4KY5A 2UXDL 1SJHD 1QCBD 5CV6A 3PMFA 4LF9L 4WJWA 3HS0C 1B53A 4OO1H 3J81L 4A3MH 2JA7B 3I73A 3GTOB 4A3KG 1HNWL 5EKIA 4ULLA 4X62L 1RJTA 2PNHA 5DM73 1Y1VH 1WTHA 3HOYG 1BDOA 1FNVA 2O5IC 5C3EH 2B2WA 4L5QA 4BY7B 1X3EA 2EVBA 1PRTD 2DY7A 4O1NA 1WTWA 4V190 2K01A 2XRQD 1HZ9A 4JI2L 4LNQA 5J39A 1TVXA 1E0BA 2WP8J 2KHIA 3BS1A 4HMIA 3M4QA 2JA6H 3R8BA 4UP9A 3NENA 1I4XA 1BOSA 3NP8A 4TQUS 2E2IB 1EQRA 1U5KA 1UNSA 2FFKB 4DK0A 4X65L 1PYSB 2AMCB 3M7NA 3I90A 4BA2I 1R9TH 3M4YA 4J1MA 4DAMA 3VDYA 3MXUA 1PYBA 4KLKA 2JA6B 5J3BA 2IJ0A 4DA2A 1WTRA 1GXDC 3EJIA 5FLXL 4DXGA 3HOYH 4C3JB 4FP5D 3BDCA 1CHQD 2SNMA 3OYYA 4DK6C 1FJGQ 4HEDA 1EY9A 1ASZA 5KNBA 4NXNQ 2BA0A 4IALA 3OWEB 2PYKA 3RZDB
chains in the Genus database with same CATH topology
2VB3X 5EPLA 4PMBA 5G3LD 5C4JB 5LL6S 2DN8A 1DOMA 1L0XB 1PMRA 1VDZA 2D5DA 1YNJD 3Q23A 3ND9A 2TMPA 2MUYA 3IKJA 5M5YB 1BUVT 1TS4A 1HRJA 4KMUC 1ILPA 3I4LA 5E4XA 5KGUA 3TP7A 1LV9A 2A68D 3AB9A 2EYJA 2D2CC 2EPBA 4LK1C 2NWGA 3T51B 3CKIB 1YNJC 4KTAA 4IFDJ 2NVQB 4X3UA 4XQNA 5EKKA 2PMZB 2AUJD 3FKIB 1EY4A 2WKCA 2WB1B 3AU7A 4A3JB 1LTRD 4WRDA 3PUVA 1A2UA 1Q12A 1HA6A 3J7AV 1HUMA 4FVMA 2B2WC 1W6JA 5C44B 3DWPA 2NVYB 1G91A 3S2HB 1STNA 3HRZC 2B2UA 2A6HC 2OXPA 4E6IA 2L11A 1VF7A 4HAEA 1WTPA 3TZUA 4HSVA 4RH6A 4I7ZC 1YNND 5JPMC 1PLFA 2MGSA 3S1RB 3GTMB 2KCNA 5I2YA 1FNUA 4HR7B 1SYGA 3D31A 1U4PA 3DM1A 3I72A 4OO1I 3E5SA 1KABA 1JOKA 2KEDA 2KVMA 4CJ1B 1TS3A 1QB5D 2WAQB 1MSGA 5BN5A 3ND8A 3DUZA 2ZXPA 3J80E 3DWQA 4LJZC 3TP5A 3T16A 2LKVA 1B1ZA 3R3OA 1KTKA 1CA6A 3MAQA 5C4XB 3VYSA 4G4KA 1ICWA 1II3A 1RF2D 1LTTD 1SE4A 3C46A 1G291 3M4OB 1W6KA 3P1HA 5C5LA 3TBIB 3D4RA 1GHJA 2R61A 1GUTA 2QCPX 4A3IB 5M5XB 1NSNS 1H9RA 1WTXA 1SAPA 4F8MA 3NWTA 3TMEA 1B9MA 1QILA 2EYLA 4UAIA 3NWSA 4IN3A 3NSWA 4PQXA 1DM0B 5T1IA 1LTBD 1F2YA 2F0NA 1DZ1A 2RDHA 1KDBA 1RDPD 3BVMA 4RCOA 4ZQ3A 4KN4C 2QEJC 3S1MB 3E6ZX 4C3IB 4QCLA 1EEFD 3K5OA 4K6LA 2F0VA 4TSSA 1MGSA 1ENCA 1DXMA 2B2YA 2PNRC 1MBYA 1HQRD 3BDLA 1YNNC 2FJ2A 2F0MA 3S17B 1ET6A 2A5HA 2A68C 4DU9A 1B4OA 1DONA 3KK7A 3VR6A 1Y69U 2IL8A 3E0JA 1IYUA 4Q0FA 1WD1A 4GZYC 2QKIC 3FEWX 1HPCA 4CKEA 5J1ZA 4FO2A 1HFNA 1SNMA 3SR1A 3SXHA 5IT9L 4K5XA 2ICIA 2F0IA 1VMPA 3N52A 1I4GA 3LX0A 2L4NA 3I8ZA 2K1BA 3JAME 3GTPB 3D6WA 5IIFA 1D6EC 1FGBD 4KKTA 4DXFA 3FMCA 4QIWB 2B2YC 1LT4D 3WOEA 4CJ0B 2OT2A 1F9SA 3T56B 5I6YA 4RWSC 3SK4A 3L7ZC 2F0LA 2F0EA 3D8GA 1CA5A 1L0YB 3DMUA 2BDOA 2XSCA 5EBCA 2R6GA 1PFMA 1TS2A 4H7BA 5BN3A 1JR0D 1OXVA 4KJNA 1SMYD 1AZPA 3CRLC 4O42A 1PTOD 1J8IA 1DCZA 1JOOA 1HCZA 4G7HC 1NCVA 1JB3A 3PUYA 1A6XA 3KLSA 3KUPA 3VYRA 2I07B 4L8JA 4NP5A 3K5MA 1X3QA 3J81E 3RUZA 1KNEA 3C2PA 1HTLD 2K5WA 4J6HA 5K36G 2XWBB 3T53B 4ZYSA 3QO2A 2FMMA 3RD4A 3R2TA 2EXZA 3GTLB 3GO5A 1JQYD 3H94A 3HOVB 1SYDA 1GHKA 1F9QA 3OSOA 3K6OA 1XTCD 5I2XA 4OL7A 4K5WA 3QIAA 1CQVA 3H6MA 4ZUJA 2X6GA 2KJXA 1ESRA 2TSSA 1Z7TA 1NUCA 5CMDA 1A3VA 3K57A 3BVGA 4OIJA 4RGNA 1ENFA 2XNAC 3NK9A 1SYBA 1B9NA 1QG7A 4RCNA 1B2TA 3C1FA 2MP1A 1GUNA 4FXDA 1EIGA 2F0PA 2L0CA 2CHBD 1JCKB 2YU9B 4IQZA 5E1FA 2XRSD 1O78A 4KHVA 4IUQA 4K8IA 2F0JA 1DYQA 4IURA 4UDUC 4RGOS 1PRTF 1EY8A 5C3EB 3QOLA 1E2ZA 2CW0C 3IFDA 3HOUB 2X6LA 1S5FD 3IAYA 2F0OA 3NTHA 5KYIA 4HSPA 1V8QA 1ZYRC 3VR4A 1HHVA 4KI0A 4H0LC 4HCSA 1MD2D 2R93B 2HDMA 1XWEA 1SE3A 4B9XA 1H9SB 3VR2A 4ZKCB 4LMQD 1KDCA 5IGCA 3NHHA 1SNPA 4DAVA 2B2VA 1HFGA 2SDFA 4R9WA 2GA4B 2PZWA 2ZXOA 4HCEA 1Y1WB 3HP3A 2F0GA 3S15B 4IFDG 4C56C 4P2CB 5FLXE 4KJOA 3N6RA 2EY2A 2HQEA 1G2TA 5IOCA 2SEBD 2XWJB 2B2UC 1BQQT 4R8NA 5IGGA 3A8KE 1LTAD 3K5LA 3SE0A 2F0SA 2KUMA 1F77A 4K14A 5EGTA 3A7AB 3HGBA 1Y8PB 3ONAB 2KEEA 1A15A 5FOBB 1KDAA 5JJZA 3MXPA 5HURA 5K36H 1ZXTA 1C48A 2XN9C 3HKZB 4EQPA 4PMCA 5DNFA 5CV4A 4KKUA 4FXGC 1RD9D 5ELCA 5CORA 2PZTA 1SYCA 4C2MB 5C3XA 2JSOA 2WV6D 1ZYRD 3LWUA 2EJMA 4KKSA 2FINB 1RODA 1SNCA 2EDGA 3S1QB 3MTSA 1STHA 1CTMA 2E75C 1PFNA 3O13A 1CHPD 2Q8RE 3A55A 1QNKA 3TSSA 2NBFA 4IFDI 2B39A 4PV1C 3BDOA 1Q3LA 5FO9B 3S9WA 3EROA 4CJ2C 1KNAA 3BG3A 1GJXA 3I91A 5I6WA 1PXUA 2CVRA 1C8CA 4HTHA 4A3KB 2JE6I 1KAAA 3SK5A 3HOZB 1PYWD 4ZKBB 1PFBA 4C1NK 3PUZA 5K5PA 3T13A 1MSHA 5E3FA 1RTOA 1PZID 3NTKA 1AW7A 5KEEA 1HA5A 3GP7A 1CFMA 3BYYB 3TP8A 2HCCA 3DWAA 2V4DA 2M9VA 2SNSA 2BA1A 4KD4A 2LY7A 5KIXA 3G6JB 2E2DC 4XYOA 4KHZA 3TDQA 1IYVA 3DEPA 2JEBI 5AFWA 4EQNA 1D5MC 3PO3B 1OXXK 2Z4IA 4X3TA 5CV7A 2K05A 1I6HB 1LT6D 4FF4A 3K7AB 3EVQA 3C1EA 1SBBB 3PUXA 1R4PB 4U673 5ELFA 3CRKC 2J0TD 1RKNA 2K6AA 3M85A 2EYOA 1SEBD 2SOBA 3FRPB 1F9RA 1HUNA 1BF4A 2B63B 5C0XH 1LTSD 1Y1VB 1G2SA 5IGDA 3W3AA 3SK8A 1SYEA 1OXSC 3OHXC 1TIID 2ZXRA 1CZGA 2Z8LA 3S2DB 3J7YW 1NR2A 1IW7C 2ICEC 2L1BA 2LMCB 1Q8IA 1PTOB 5A2QE 3Q0AA 3I70A 3MWYW 5JVH3 2JXMB 2NB0A 4WORA 2X69A 1PZJD 3FVQA 1H9SA 4LAAA 5CV9A 4XTCS 3NXWA 1LT5D 1LTID 1PTOH 4IUNA 4A3BB 3KLSX 4A3EB 3BZDB 4DNRB 4ZUIA 5C3WA 2EYHA 3OIPA 1V43A 1PDQA 2BOSA 1IKLA 3Q24A 1EEID 2PO4A 4A3GB 1SDFA 1A2TA 4G7OC 1EY6A 3F2UA 2E2JB 1JICA 4QF4A 5A2QL 3NBIA 4MHEA 3SHLA 4K8JA 1GUGA 2QILA 2A69C 5ELDA 2IW3A 1VCIA 1TKWB 5FO7B 2FMCA 1D2BA 1EWHA 1OXTA 1OO9B 5HGTA 3GTKB 2EYPA 1PRTC 2EYFA 3K58A 2KHSA 4FF2A 4PNYA 3GTJB 4IZ8A 4PMWA 2F1MA 1JC7A 1EY5A 4NDXA 1WTQA 1M4VA 4JBWA 2F03A 4C3HG 1EYDA 2G9HD 4DAPA 3CU7A 4ID6A 1SNOA 5JEAG 3D3RA 2K03A 1H9KA 3PUWA 3CQZB 2A73B 3H09A 3I4MB 2VUMB 3J80L 2R92B 4KN7C 2A6EC 1HXYD 1TY0A 5KNDA 3QWNA 3A54A 1BCPD 2RSNA 1HQMC 3A56A 2E74C 1XX8A 3BYTB 3GV6A 2K04A 1S5BD 3MZ5A 5ELEA 1SNDA 4FXKC 5CBAE 1GUWA 4ZAIA 4C3JG 4FYDA 2IX0A 1NR4A 4RFBA 2EY6A 1B3AA 2DY8A 2O2LD 1EQTA 1TS5A 1STAA 3K59A 4OO1G 4HN7A 1R4QB 3RZOB 2F0UA 1STEA 1I50B 2NN6I 1WTVA 4S3SA 2YYZA 1WCMB 1LACA 4BY1B 2Z1CA 5JVG3 1IW7D 1D5ZC 3PIO3 3IL8A 2RKSA 1WTOA 1I4RA 4KD3A 4RHRA 5NUCA 3MEHA 1EU3A 1AP0A 1I4HA 4EQOA 5I9OA 3QB3A 3PV0A 2NVXB 2RDFA 4A93B 5CGKA 2F3WA 3RLFA 1BR9A 3QG1A 1RTNA 4QMGA 4KV6A 1Z47A 4FNFA 4CKBA 5M3MB 5JEAJ 1GOZA 2VNUD 5T1GA 1CZWA 2JA8B 1AN8A 2PCFB 4RGMA 1RHPA 3NQTA 1G6ZA 1Q1BA 4ME5A 1AEXA 5C0XJ 4B9WA 5JEAH 1R9TB 2C9OA 2K33A 1BNZA 1ZEQX 5I4DA 4C3HB 5E4WC 2RDGA 5BN4A 1F2ZA 1QNUA 1TR5A 3DEOA 1JWMD 2NN6G 3D6CA 5CR3A 1X32A 1G8ZD 2E2HB 2Q8TA 5EKLA 3KBXA 1F2LA 4X3SA 1ZKOA 3HOWB 4M1UB 2Z4HA 4R8IA 5EPKA 2O5JC 3NQIA 3U9SA 5IGFA 3MC0B 4QUCA 2WINB 5C0XI 5D14A 3TP6A 1O7LA 1U4LA 1EYAA 2AWNA 3OMGA 2NTTA 4TRDA 1BCPC 1EFID 5EBDA 2JP1A 3GD7A 2CQAA 3MHBA 4J8QA 1ML0D 4XIGS 2G9DA 1E2WA 1LT3D 3A8JE 3SEBA 3R93A 4L6TB 3EFXD 2OF1A 3LNNA 1TU2B 5D3DA 1D1IA 4QUFA 4L63B 5M5WB 1ENAA 2FHTA 2KQ3A 1H9JA 2L12A 5M3FB 1EZ8A 1TY2A 4I65A 2L5TA 1STGA 3KF8A 4NKLA 1O7YA 1PTOC 1H9MA 5IT9E 1EIHA 1SMYC 3FDTA 3GQBA 2IPKD 1DJRD 2M00A 1A3UA 1PRTB 1C4QA 1QE6A 2OEOA 2K32A 1KLGD 4H44C 3JAML 5J22A 2BE5C 1JE4A 2N88A 2J4XA 2L9HA 2Q8IB 2BCOA 4CGYB 1T5EA 2WIIB 2R3ZA 4C1NI 4RAUC 3OOCA 1BCPB 3NBHA 1I4QA 2F0FA 3GTGB 1HTPA 2NVTB 2QF7A 4DGZA 1GUOA 2R7ZB 5DEHA 2AQ1B 3NTIA 3J7AF 4IUTA 3A7LA 2D62A 3UI2A 1B44D 4G7ZC 2PZUA 4N9PA 5FO8B 4MN3A 2AQ3B 2B2TC 2CW0D 2NZ1D 2H4OA 3K5NA 1FNWA 4XQQA 2EZVA 2KOLA 1DOLA 1SE2A 4ODGA 2PPBC 1ONLA 3V2TA 2RA4A 4K2LA 1MI2A 1STBA 3CHBD 5EJWA 5ISRA 2E76C 3OIQA 1ET9A 2MHVA 3H3VC 3PIP3 1SYFA 4QB4A 2F0HA 4CKCA 1F9PA 2F3VA 1CQFA 2PW7A 1TT2A 2VB2X 4BWGB 4BS9A 3P7JA 3FPPA 1ILQA 3S16B 1I6VC 1VF5C 4N9TA 5JPNC 2EOTA 4DN4M 1U4MA 4M8AA 4U68A 2KECA 3SDZA 4HMJA 2JEAI 4MIUA 1BBXC 3WOFA 5C5MA 1AZQA 3R2IA 1WD0A 4F88A 2ENBA 2IWHA 2ID0A 4B08A 3NPPA 4KY7A 2EYMA 1F2MA 1BCPF 1SFOB 3FPUB 2A74C 3H0GB 2B8FA 1EU4A 5IGBA 3S1NB 3X3NA 1K83B 3RMHA 1PZKD 3OWFA 2K28A 1TWCB 1EL0A 1K8MA 2NTSA 1M8AA 5EPJA 4JK1C 2PW5A 2JA5B 3H91A 4Q5VA 2NN6H 1J9OA 1UAPA 4V0BA 2A69D 4OIKA 2I46A 1U4RA 5KRUA 1CK1A 1Y8OB 2AUKA 5IGEA 4DF7A 2HCIA 1NAPA 1K8OA 5CYUA 1EY0A 2NUCA 1TWFB 3G7LA 1SXTA 2EE1A 3ITPA 2K5DA 3LWEA 4G57A 2KCCA 2NYZD 3MFGA 4ILWA 1EOTA 3SK6A 2KA7A 5D65A 1EYCA 1LLRD 3A8IE 3EQLC 3L9AX 1DOKA 2DNEA 1O80A 5F2DA 3BVZA 2RQXA 3C3LA 4RKBA 3P75A 1ESFA 4OGQC 3VA5A 2B8GA 5IODA 2K5QA 2F0TA 2XVSA 3DHQA 4A3DB 1SNQA 1AFPA 1UUPA 2BE5D 2WKDA 4FF3A 2D9UA 4NMZA 4XDXA 1FR3A 1JORA 1VMCA 2JYOA 3V05A 3L3OC 3I4NB 1D5XC 5C6AA 2IX3A 4KK7A 3T4AC 1FYCA 1GUSA 3MXNA 4IUUA 2RSOA 3HZXA 1Y8NB 4DNTB 3TN2A 4XXEA 2VXWA 4EGVA 4ZK9B 2J7ZA 1TWGB 3GTQB 3VYUA 4YIJA 1TWHB 1SSOA 4A3MB 3IFTA 2LFNA 5COYA 5FK9C 1Q90A 4CBVA 3ERQA 1IL8A 2H1EA 2ZT9C 5KNCA 1V1PB 1X3PA 4KY6A 4K5VA 1BO0A 1D1KA 1E2VA 1SJED 2K7VA 3AMUA 3ZYYX 4WFN3 3MFYA 2B2TA 3HG9A 3VR3A 4K6DA 3DXJC 4X3KA 1STYA 1QWYA 4CHTB 3KBGA 1B50A 2EY5A 5A35A 4XQJA 1LABA 4H13C 2XIWA 1O7ZA 1IHZA 4RA8A 1A3TA 3NUCA 3K0YA 1V1PA 2BDNA 5CV5A 1CI3M 2HUGA 5C4HA 2QDBA 4C3IG 5JAVA 1CT1D 3OPOA 3HOYB 4ZRZA 1TQOA 3WDNA 4ABNA 3VA7A 2AWOA 5KYLA 1I4PA 4ZLTF 2EY1A 3Q22A 1WVLA 2A6HD 4Z9CB 2L55A 4IUVA 1EY7A 1TWAB 5TSSA 5G3LF 1IKMA 4IFDH 2AQ2B 4AYBB 3Q6SA 2IT1A 4DAYA 4BBRB 5M9OA 1U9RA 4DFAA 1RCVD 3MXGA 4A3FB 3P20A 3MVVA 1QJOA 3QOJA 2Y0SB 1BXTA 1T5XD 2RVLA 3PO2B 3OW7A 5DM63 1Q1EA 1CM9A 3I3CA 4NW2A 2HDLA 1JWUD 1KLUD 4XT1B 1LTGD 4XT3B 1V1OA 5D3IB 4RHSA 2WACA 2EJFC 2O4XA 3SVMA 3S14B 3V96A 1DD2A 4BBSB 5FKAC 3GV3A 1PTOF 3QJYA 2LS01 2F0KA 3VYTA 5CBEE 3D4WA 3HOXB 2RBMA 4OHJA 3W2DA 3EA6A 5ELBA 4XYQA 3KLRA 1XYIA 2DNCA 2C5CA 3X3MA 2IX1A 1I3QB 3TZDA 5EQ0A 4K2KA 4FF1A 3MA2B 5I9PA 2F0DA 4DK1A 2MJ8A 1S5ED 4TKOB 1JWSD 1JOQA 5C4ZA 3NE5B 5C0XG 2PQEA 3M3YB 2B2VC 1S4ZA 2MPMA 1XXGA 4RKLA 4F7XA 4Y7NB 2EJGC 3M7GA 1S5CD 1FD7D 3OMCA 1LO5D 4EVOA 2A6ED 4F87A 4BA1I 3HEJA 5JOBA 1EZ6A 1OXUA 5CV8A 5LHY1 5CC4A 2F0WA 5LL6X 1UEAB 3U9OA 1EQVA 2F4IA 2F0QA 3D4DA 1Z6HA 3URYA 1S5DD 1QOHA 2M2LA 2N55A 5DAUA 1EWCA 4IUPA 3VR5A 4RGTA 4KY5A 1SJHD 1QCBD 5CV6A 3PMFA 4WJWA 3HS0C 1B53A 4OO1H 3J81L 2JA7B 3I73A 3GTOB 5EKIA 4ULLA 1RJTA 5DM73 1BDOA 1FNVA 2O5IC 2B2WA 4BY7B 4O1NA 2EVBA 1PRTD 2DY7A 1WTWA 4V190 2K01A 2XRQD 5J39A 1TVXA 1E0BA 2WP8J 3BS1A 4HMIA 3R8BA 1I4XA 2E2IB 1BOSA 4TQUS 3NP8A 1UNSA 2FFKB 4DK0A 3M7NA 3I90A 4BA2I 3M4YA 4J1MA 3MXUA 2JA6B 2IJ0A 4DA2A 1WTRA 1GXDC 3EJIA 5FLXL 4DXGA 4C3JB 4FP5D 3BDCA 1CHQD 2SNMA 4HEDA 1EY9A 5KNBA 2BA0A 4IALA 3OWEB 2PYKA 3RZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RD9 D;  1S5F D;  5ELC A;  1D5M C;  2O2L D;  1JWM D;  1TS5 A;  1ET6 A;  1CK1 A;  1BXT A;  1KLG D;  5ELD A;  5FK9 C;  1G8Z D;  1FNU A;  1T5X D;  2WV6 D;  1L0X B;  1LT6 D;  1V1P B;  3URY A;  1SBB B;  1STE A;  1HTL D;  5ELF A;  2J4X A;  1MD2 D;  1S5D D;  1SJE D;  3O13 A;  1JWU D;  1KLU D;  4ZYS A;  1SXT A;  1CHP D;  1LTG D;  1TS3 A;  1SE3 A;  1V1O A;  3R2T A;  1EWC A;  1SEB D;  1TS4 A;  4RGT A;  5D3I B;  4BWG B;  4RHS A;  1SJH D;  1PRT C;  3TSS A;  3DWQ A;  1JQY D;  3MC0 B;  1D5Z C;  1LTS D;  1B1Z A;  3MFG A;  1KTK A;  1BCP B;  2ICI A;  1XTC D;  5FKA C;  1I4Q A;  1I4G A;  1I4R A;  1PTO F;  1LLR D;  1CQV A;  2NTT A;  2Z8L A;  1FNV A;  1M4V A;  4RHR A;  1RF2 D;  1LTT D;  1SE4 A;  1BCP C;  1EFI D;  1EU3 A;  2AQ1 B;  2TSS A;  4C56 C;  2G9H D;  3BVZ A;  4OHJ A;  1V1P A;  1I4H A;  3W2D A;  3EA6 A;  5ELB A;  1ESF A;  2R61 A;  4O1N A;  1PTO B;  1PRT D;  2SEB D;  3BVG A;  1LT3 D;  1CT1 D;  1PYW D;  4RGN A;  1D6E C;  2XRQ D;  3SEB A;  1ENF A;  2XNA C;  1FGB D;  4L6T B;  1PZJ D;  3EFX D;  1B44 D;  1LTA D;  3R2I A;  4DXF A;  5D3D A;  1LTR D;  1UUP A;  1PZI D;  1LT5 D;  4L63 B;  1LTI D;  1PTO H;  3KLS X;  1LT4 D;  1F77 A;  1AW7 A;  1I4P A;  1S5E D;  1HA5 A;  1QIL A;  3R8B A;  3BZD B;  2AQ3 B;  1JWS D;  2CHB D;  1I4X A;  1JCK B;  1BCP F;  3GP7 A;  1UNS A;  1HXY D;  1TY0 A;  3V05 A;  1GOZ A;  1EU4 A;  4Z9C B;  1D5X C;  1FNW A;  2XRS D;  1LTB D;  3BYY B;  1BCP D;  1TY2 A;  3DWP A;  1AN8 A;  1L0Y B;  1PZK D;  5TSS A;  4RGM A;  3DWA A;  1XXG A;  2RDH A;  3BYT B;  1SE2 A;  1RDP D;  2IJ0 A;  3BVM A;  4RCO A;  2NTS A;  1EEI D;  1DYQ A;  1PTO C;  1S5B D;  2AQ2 B;  2QEJ C;  4UDU C;  4DXG A;  5ELE A;  1S5C D;  5I4D A;  1TS2 A;  1EEF D;  1FD7 D;  4RGO S;  1JR0 D;  1LO5 D;  1PRT F;  4K6L A;  2XN9 C;  2RDG A;  1CHQ D;  1RCV D;  4TSS A;  2IPK D;  1DJR D;  4RFB A;  3CHB D;  1HQR D;  1PTO D;  1ET9 A;  1PRT B;  4RH6 A;  2QIL A;  3OWE B; 
#chains in the Genus database with same CATH topology
 2VB3 X;  5EPL A;  2E2H H;  3G4S A;  3W5O A;  4DR6 Q;  4PMB A;  5G3L D;  5C4J B;  1XTD A;  5LL6 S;  2DN8 A;  1DOM A;  1L0X B;  1PMR A;  1VDZ A;  5IP9 G;  1L1O B;  2QW7 A;  5IYD G;  4HJA A;  2D5D A;  1YNJ D;  4P71 A;  3Q23 A;  1N9W A;  3ND9 A;  2TMP A;  2MUY A;  3IKJ A;  2F52 A;  5M5Y B;  1BUV T;  3GTP H;  2I5M X;  1TS4 A;  3K0X A;  1HRJ A;  3NBH B;  2Z9H A;  4YWK A;  4A3L G;  5IYD H;  4KMU C;  3PO2 G;  1ILP A;  3I4L A;  5E4X A;  5KGU A;  3TP7 A;  4MZ9 A;  1SRU A;  1LV9 A;  2A68 D;  3AB9 A;  1XPO A;  2EYJ A;  2D2C C;  3CC4 A;  2EPB A;  3KDF A;  4LK1 C;  1K3R A;  4GNX A;  2NWG A;  3T51 B;  2UUC L;  4GN4 B;  2CH4 W;  2AKW B;  3CKI B;  2ZTE A;  1YNJ C;  4KTA A;  4IFD J;  2DJF C;  2NVQ B;  4X3U A;  4XQN A;  3I2Z A;  4DR7 L;  2A8V A;  4O2D A;  1HNZ L;  5EKK A;  2Z6K C;  2PMZ B;  2AUJ D;  3FKI B;  4GKK L;  2UXD Q;  2ZM6 L;  1EY4 A;  2WKC A;  3PF5 A;  1XPU A;  1KC8 C;  2WB1 B;  3AU7 A;  4A3J B;  1LTR D;  4WRD A;  4X66 L;  3PUV A;  1NTG A;  4DV4 Q;  1A2U A;  4WJ4 A;  2KCM A;  1Q12 A;  1HA6 A;  3J7A V;  1HUM A;  4A3G G;  4FVM A;  2YV5 A;  2B2W C;  1W6J A;  1I94 Q;  3HOX H;  3CW2 C;  5C44 B;  4A3J H;  5M3M G;  2DJG C;  3DWP A;  4LF7 L;  1CKM A;  4LF8 L;  2NVY B;  1G91 A;  5FLX c;  3S2H B;  1STN A;  4DV5 L;  3HRZ C;  1CSQ A;  1I3Q H;  2B2U A;  2A6H C;  2OQ0 A;  2OXP A;  4E6I A;  2L11 A;  4P74 A;  1VF7 A;  4HAE A;  1WTP A;  2R7Z G;  3TZU A;  4HSV A;  4YWL A;  3HOV H;  4RH6 A;  4YHH L;  2WAQ E;  1YBY A;  4I7Z C;  1YNN D;  5JPM C;  1PLF A;  2MGS A;  3S1R B;  1HH2 P;  1YIT A;  1HR0 Q;  4A3K H;  3GTM B;  2KCN A;  1S3O A;  4JI6 Q;  5HGQ A;  5I2Y A;  1FNU A;  4HR7 B;  1HR0 W;  1SYG A;  3D31 A;  1U4P A;  3DM1 A;  3I72 A;  4OO1 I;  3EIV A;  1QZG A;  3E5S A;  3S1R H;  1KAB A;  1JOK A;  2KED A;  2KVM A;  4CJ1 B;  1TS3 A;  2UUB L;  1QB5 D;  2WAQ B;  1IBL Q;  1MSG A;  5BN5 A;  3ND8 A;  3DUZ A;  2ZXP A;  3J80 E;  1YHB A;  3DWQ A;  4LJZ C;  3TP5 A;  4NXN L;  3T16 A;  2LKV A;  2OCE A;  1B1Z A;  3R3O A;  1KTK A;  4DV2 Q;  1CA6 A;  2R7Z H;  3MAQ A;  5C4X B;  3VYS A;  1X55 A;  1VQP A;  4A3I H;  4G4K A;  1ICW A;  5M5X H;  1TWG H;  1II3 A;  1RF2 D;  1LTT D;  3EBE A;  3G6E A;  1SE4 A;  3C46 A;  3UDX A;  1G29 1;  3M4O B;  1W6K A;  3P1H A;  5C5L A;  3TBI B;  3D4R A;  3ER0 A;  1GHJ A;  2R61 A;  1JMC A;  1SMX A;  2HT1 A;  1GUT A;  2QCP X;  4A3I B;  3I4M G;  5M5X B;  3PQI A;  1NSN S;  3OTO L;  1H9R A;  1VQM A;  1WTX A;  1SAP A;  4LF4 L;  1SLJ A;  4F8M A;  3NWT A;  3GTO H;  4IPC A;  3TME A;  1YZ6 A;  3KLW A;  1B8A A;  1B9M A;  1QIL A;  2EYL A;  5IYB H;  4L5S A;  3T1H L;  4UAI A;  3NWS A;  4IN3 A;  4C3I H;  3NSW A;  4PQX A;  1DM0 B;  5T1I A;  1LTB D;  1YVC A;  1F2Y A;  2F0N A;  3DM3 A;  1DZ1 A;  4ZCK A;  2RDH A;  1KDB A;  2K4K A;  1RDP D;  3BVM A;  4RCO A;  4ZQ3 A;  4KN4 C;  2CQO A;  2QEJ C;  2JA8 H;  3S1M B;  2R7D A;  3E6Z X;  4JPB W;  4C3I B;  4QCL A;  1EEF D;  3K5O A;  2KHJ A;  4DV7 L;  4K6L A;  2ZJR A;  2F0V A;  4TSS A;  4JI5 Q;  1MGS A;  1ENC A;  3HFZ B;  1DXM A;  2B2Y A;  2PNR C;  1MBY A;  2VQF L;  1HQR D;  4GKJ Q;  3BDL A;  1YNN C;  4HJ8 A;  2FJ2 A;  2E2I H;  3PO3 G;  2F0M A;  3S17 B;  1ET6 A;  2A5H A;  2A68 C;  4DU9 A;  1B4O A;  1DON A;  3KK7 A;  3VR6 A;  1Y69 U;  2IL8 A;  3E0J A;  1IYU A;  4Q0F A;  1AE3 A;  2JA5 G;  5HY6 A;  4GKJ L;  1WD1 A;  4GZY C;  3D0F A;  2QKI C;  3FEW X;  1HPC A;  4CKE A;  5J1Z A;  1LM0 A;  4FO2 A;  2HQL A;  1HFN A;  1JE5 A;  1SNM A;  3J7Z C;  3SR1 A;  1A62 A;  3SXH A;  1HNZ Q;  4DV3 L;  5IT9 L;  4K5X A;  2ICI A;  2F0I A;  1XNQ Q;  1VMP A;  3N52 A;  1L0W A;  1I4G A;  1K0R A;  4B3T L;  4A3G H;  3LX0 A;  2E5L L;  1KHI A;  2L4N A;  3I8Z A;  1X65 A;  2E8G A;  2K1B A;  3JAM E;  3GTP B;  3D6W A;  5IIF A;  4LFA Q;  1PHJ A;  1D6E C;  5GQO A;  1FGB D;  4QL5 A;  4KKT A;  3ZJY C;  4DXF A;  3FMC A;  4QIW B;  2B2Y C;  3CF5 A;  1JJG A;  3H0G H;  1Z9F A;  1LT4 D;  3WOE A;  1PH8 A;  4CJ0 B;  2OT2 A;  1N33 L;  1F9S A;  3T56 B;  5I6Y A;  1PH4 A;  4RWS C;  3SK4 A;  3FHW A;  3L7Z C;  1TWC H;  2F0L A;  4PZ8 A;  4B3S Q;  2F0E A;  3D8G A;  1CA5 A;  1L0Y B;  3DMU A;  3M9B A;  3FKI H;  4BBS H;  2CFM A;  2A1A A;  1Q82 C;  2BDO A;  1SR3 A;  2XSC A;  5EBC A;  2R6G A;  4P73 A;  1PFM A;  1IBK L;  3CC7 A;  1TS2 A;  4H7B A;  5BN3 A;  1JR0 D;  1OXV A;  1Y1W G;  1C7Y A;  4KJN A;  1SMY D;  1AZP A;  3AQQ A;  3CRL C;  2YTV A;  4O42 A;  1PTO D;  4O0A A;  1J8I A;  3RLO A;  1DCZ A;  1KRT A;  1JOO A;  1HCZ A;  4G7H C;  2PQA B;  5E7N A;  1NCV A;  1JB3 A;  2BH2 A;  3PUY A;  1A6X A;  3KLS A;  2WAQ G;  3KUP A;  3VYR A;  3BJU A;  2I07 B;  4L8J A;  4NP5 A;  1TWF H;  2CH4 A;  4DKA C;  1N33 Q;  4JI7 L;  3K5M A;  1FL0 A;  1X3Q A;  4LFB L;  2NVY H;  3J81 E;  3RUZ A;  1KNE A;  5AJ3 Q;  3C2P A;  1HTL D;  2K5W A;  4J6H A;  5K36 G;  2XWB B;  3T53 B;  4JI2 Q;  4ZYS A;  3QO2 A;  3HOZ H;  2FMM A;  3RD4 A;  3E0E A;  3R2T A;  4B3R L;  2Q2H A;  5M3F G;  2EXZ A;  5LMU L;  3GTL B;  3GO5 A;  2ATW A;  1JQY D;  3H94 A;  1WI5 A;  3FP9 A;  3HOV B;  1VQ5 A;  4JI1 L;  1SYD A;  4LUV A;  2FXQ A;  1GHK A;  3BZC A;  1F9Q A;  1WOC A;  3OSO A;  4POG A;  3K6O A;  1XTC D;  5I2X A;  4OL7 A;  4K5W A;  3QIA A;  3AYH B;  1CQV A;  3H6M A;  4ZUJ A;  1VQF A;  2IHE A;  2KJX A;  2X6G A;  1ESR A;  2TSS A;  1Q46 A;  3EN2 A;  1Z7T A;  4DV3 Q;  1L1O C;  1NUC A;  5CMD A;  1A3V A;  1X9N A;  3K57 A;  3BVG A;  4OIJ A;  4JBJ A;  3UDF A;  4RGN A;  1ENF A;  2XNA C;  3NK9 A;  1SYB A;  3I4O A;  2L15 A;  3CCQ A;  4HIM A;  4X66 Q;  1B9N A;  1QG7 A;  3STB C;  4RCN A;  5JJL A;  1B2T A;  3C1F A;  2MP1 A;  4JI0 L;  1GUN A;  3I4N H;  4FXD A;  1EIG A;  5IWA L;  2HHH Q;  2F0P A;  2L0C A;  2CHB D;  1JCK B;  2YU9 B;  4IPD A;  2B63 G;  4LUZ A;  4IQZ A;  1RIP A;  5E1F A;  2XRS D;  4K0K Q;  1O78 A;  3KOJ A;  2VQE Q;  3BU2 A;  4KHV A;  1I6H H;  1E24 A;  3A74 A;  4IUQ A;  4BY1 H;  4K8I A;  1VQN A;  2F0J A;  1DYQ A;  4JC0 A;  4IUR A;  1AH9 A;  4UDU C;  3U58 A;  1TWH H;  1PH7 A;  1N8R C;  4RGO S;  1L2F A;  1PRT F;  1EY8 A;  3T1H Q;  1YJN A;  2KEN A;  5C3E B;  3QOL A;  2IY5 B;  1E2Z A;  2CW0 C;  1W2B A;  4JI1 Q;  1Q81 C;  3IFD A;  3HOU B;  3A5Z B;  2X6L A;  1S5F D;  3IAY A;  1GO3 E;  2F0O A;  3NTH A;  4HID A;  5KYI A;  4HSP A;  1V8Q A;  3E3X A;  3UDI A;  1ZYR C;  3VR4 A;  1HHV A;  4KI0 A;  4H0L C;  4HCS A;  1MD2 D;  2Q2T A;  1K8A C;  2R93 B;  2HDM A;  3F2D A;  1XWE A;  1SE3 A;  4B9X A;  4NXM Q;  1H9S B;  4BY1 G;  3VR2 A;  1RL2 A;  2K50 A;  5M3M H;  4A3J G;  4K0K L;  4ZKC B;  4LMQ D;  3HOX G;  1KDC A;  5IGC A;  3NHH A;  1SNP A;  4DAV A;  2B2V A;  1K73 C;  4A3B H;  1HFG A;  2SDF A;  4C3J H;  4R9W A;  2GA4 B;  2PZW A;  2ZXO A;  4HCE A;  1Y1W B;  3HP3 A;  2F0G A;  3S15 B;  1HNX L;  4IFD G;  4C56 C;  4P2C B;  5FLX E;  2UUB Q;  4KJO A;  1HNX Q;  3N6R A;  4YCU A;  2EY2 A;  1S40 A;  4UP7 A;  4A3F G;  2HQE A;  1G2T A;  4NB3 A;  5IOC A;  2SEB D;  2XWJ B;  3E9H A;  3T1Y Q;  1K3B C;  4A3E G;  5C4J H;  2B2U C;  1BQQ T;  3FKI G;  4R8N A;  1J5E L;  5IGG A;  3A8K E;  1LTA D;  4AH6 A;  3B6Y A;  3K5L A;  4DV0 L;  4DR3 Q;  4QJF A;  3SE0 A;  2F0S A;  2K14 A;  2KUM A;  1F77 A;  4K14 A;  5EGT A;  5JJI A;  5ELO A;  1L1O A;  3A7A B;  2F3I A;  2ZTD A;  2I5H A;  2Z6K A;  2HIX A;  3HGB A;  1Y8P B;  3ONA B;  2ZJQ A;  2KEE A;  4JI6 L;  1QVC A;  1A15 A;  1N32 L;  5FOB B;  1KDA A;  5JJZ A;  2E5L Q;  3MXP A;  5HUR A;  5K36 H;  1GVP A;  1ZXT A;  2NVQ H;  1C48 A;  1HNW Q;  2XN9 C;  3HKZ B;  4JW0 A;  4EQP A;  4C2M H;  1I5F A;  1JT8 A;  4PMC A;  5DNF A;  1LUZ A;  5CV4 A;  1NE3 A;  4YY3 L;  1D8L A;  4KKU A;  4JI4 L;  4FXG C;  1RD9 D;  3PO2 H;  5ELC A;  5COR A;  2PZT A;  4DR5 L;  5FJ8 G;  1SYC A;  4C2M B;  2JSO A;  2WV6 D;  1ZYR D;  5C3X A;  3LWU A;  2EJM A;  4KKS A;  2FIN B;  1ROD A;  1SNC A;  2EDG A;  2D0O A;  3S1Q B;  3MTS A;  3KF6 A;  1STH A;  3HOV G;  1CTM A;  2E75 C;  3S24 A;  5IP9 H;  1PFN A;  4QIW E;  1E7Z A;  3O13 A;  5IT9 c;  1PH5 A;  4LUO A;  1VQC A;  1CHP D;  1GKH A;  1G6P A;  2Q8R E;  2RCN A;  3A55 A;  5C44 H;  3H3V I;  1QNK A;  4POF A;  2VW9 A;  4A75 A;  3TSS A;  3S14 H;  1VQA A;  2UUC Q;  5GAH C;  3S1Q H;  2NBF A;  4IFD I;  1C9O A;  4AYB E;  2K5N A;  2B39 A;  4PV1 C;  3BDO A;  4UP8 A;  2CWP A;  1Q3L A;  2K75 A;  2VL6 A;  5FO9 B;  3S9W A;  3ERO A;  4CJ2 C;  1KNA A;  3BG3 A;  4A76 A;  1GJX A;  3I91 A;  5I6W A;  1PXU A;  2CVR A;  1C8C A;  4HTH A;  2B29 A;  3U50 C;  4LFA L;  4A3K B;  2JE6 I;  4LF5 Q;  1KAA A;  3SK5 A;  3HOZ B;  1VQG A;  4LF5 L;  4X64 Q;  1PYW D;  4ZKB B;  1PFB A;  5IE8 A;  4C1N K;  3PUZ A;  5K5P A;  1DGS A;  3T13 A;  1MSH A;  5E3F A;  1RTO A;  2AHO B;  1PZI D;  3NTK A;  1AW7 A;  5KEE A;  1HA5 A;  3KF6 B;  1J5E Q;  3GP7 A;  1CFM A;  2JK8 A;  4UY8 C;  3BYY B;  3TP8 A;  1VQB A;  2HCC A;  2K52 A;  3DWA A;  2V4D A;  2M9V A;  5C4X H;  1CUK A;  2SNS A;  2VUM G;  2BA1 A;  4KD4 A;  3K81 C;  2LY7 A;  1CSP A;  2BH8 A;  3CXC A;  3AFP A;  5KIX A;  3CD6 A;  4DUZ L;  4DK3 C;  3G6J B;  2E2D C;  4XYO A;  4KHZ A;  4LFC L;  3TDQ A;  3DEP A;  1IYV A;  2JEB I;  5AFW A;  4EQN A;  4OWW B;  1EUJ A;  3GTQ H;  1NY4 A;  4A93 G;  1D5M C;  5LMN Q;  3PO3 B;  1OXX K;  2R7F A;  2Z4I A;  4X3T A;  5CV7 A;  1NJI C;  1AE2 A;  2K05 A;  1I6H B;  2NZH A;  1LT6 D;  4FF4 A;  3K7A B;  3GDE A;  3EVQ A;  3C1E A;  1SBB B;  3PUX A;  1R4P B;  4U67 3;  5ELF A;  3CRK C;  2J0T D;  4DV1 Q;  1RKN A;  2MNA A;  2RF4 A;  2K6A A;  3M85 A;  2EYO A;  1SEB D;  2SOB A;  3FRP B;  1F9R A;  1HUN A;  1BF4 A;  2B63 B;  4A93 H;  1GD7 A;  5C0X H;  3HOU H;  4AQY L;  1LTS D;  1Y1V B;  1G2S A;  5IGD A;  3W3A A;  3SK8 A;  1SYE A;  1OXS C;  2N78 A;  3OHX C;  1TII D;  2ZXR A;  1CZG A;  4OX9 Q;  2Z8L A;  3S2D B;  3J7Y W;  1YI2 A;  4JI7 Q;  3PIO A;  1NR2 A;  2WB1 G;  3CCS A;  1IW7 C;  2ICE C;  2L1B A;  2LMC B;  4L5R C;  3S17 H;  1Q8I A;  1PTO B;  4A3E H;  5A2Q E;  3Q0A A;  2PI2 E;  3I70 A;  1K0S A;  1A0I A;  3MWY W;  5JVH 3;  2JXM B;  2NB0 A;  4WOR A;  3TRZ A;  2X69 A;  1PZJ D;  3FVQ A;  1H9S A;  4C3H H;  2YTX A;  4LF9 Q;  4A3C G;  4LAA A;  1K8G A;  5CV9 A;  4B3M L;  4XTC S;  3NXW A;  1YNX A;  1LT5 D;  1LTI D;  1PTO H;  4IUN A;  4DR1 L;  4A3B B;  3KLS X;  4A3E B;  1VQ6 A;  3BZD B;  4RMF A;  4DNR B;  4A3B G;  4IOA A;  4YCV A;  4ZUI A;  5C3W A;  4BXX H;  1NMG A;  2RCF A;  3KF8 B;  2EYH A;  4PG3 A;  3OIP A;  3STB D;  1V43 A;  1V9P A;  2RHQ B;  5IYC G;  1A63 A;  1KIX A;  1PDQ A;  4JI5 L;  2BOS A;  3CCM A;  1S72 A;  1BVS A;  1IKL A;  3Q24 A;  1EEI D;  1TWA H;  2PO4 A;  4DV6 L;  4A3G B;  1N34 L;  1SDF A;  1A2T A;  3J80 i;  4G7O C;  1EY6 A;  3F2U A;  2E2J B;  4NXM L;  1JIC A;  2UU9 L;  4QF4 A;  5A2Q L;  3NBI A;  4MHE A;  2QGQ A;  3SHL A;  4K8J A;  1GUG A;  2QIL A;  4R4C A;  2A69 C;  2Z6B A;  3HOW G;  1N32 Q;  5ELD A;  2IW3 A;  1VCI A;  4AQY Q;  1YHQ A;  1TKW B;  3QR8 A;  5FO7 B;  2FMC A;  1BBW A;  1D2B A;  5M5Y H;  5LMU Q;  4A3L H;  1EWH A;  1OXT A;  3CPF A;  4LF4 Q;  4KHP L;  2Y0S E;  5H1S E;  1EOV A;  1OO9 B;  5HGT A;  3GTK B;  2EYP A;  5IYC H;  1PRT C;  4GN3 B;  4LFB Q;  2VQE L;  2DUD A;  2EYF A;  3K58 A;  2KHS A;  4FF2 A;  4DR2 Q;  2V1C C;  4PNY A;  2D0P A;  2HD3 A;  3GTJ B;  2JN4 A;  2UXB Q;  4IZ8 A;  4PMW A;  5LMN L;  1A8V A;  2F1M A;  1JC7 A;  4DV4 L;  3GTK H;  1EY5 A;  4R4T A;  4NDX A;  2CWA A;  1M4V A;  1WTQ A;  4JBW A;  2F03 A;  4CDC C;  1VQD A;  4C3H G;  1EYD A;  2G9H D;  3HKS A;  4DAP A;  3CU7 A;  4ID6 A;  2ALY B;  1IZ6 A;  1HZC A;  1SNO A;  3NEM A;  2ZM6 Q;  3KFU A;  5JEA G;  3D3R A;  2K03 A;  1H9K A;  1NBW A;  2VUM H;  2VQF Q;  1O7I A;  2R92 H;  2UXB L;  4DR7 Q;  3OW2 A;  3PUW A;  3JAM c;  3KYH C;  1VQ9 A;  1E22 A;  3CQZ B;  2A73 B;  3ICE A;  3RNU A;  3H09 A;  3I4M B;  2VUM B;  3CAM A;  3J80 L;  2R92 B;  4MNO A;  4KN7 C;  2A6E C;  3CCR A;  1HXY D;  1TY0 A;  2R92 G;  5KND A;  1BBU A;  3QWN A;  3A54 A;  1BCP D;  2RSN A;  1HQM C;  3A56 A;  2E74 C;  1XX8 A;  3BYT B;  3GV6 A;  1VS0 A;  2K04 A;  1KQS A;  4BY7 G;  1S5B D;  2F4V Q;  3MZ5 A;  5ELE A;  4HJ7 A;  1SND A;  4FXK C;  5CBA E;  1GUW A;  4ZAI A;  5C3E G;  1XNQ L;  4C3J G;  4FYD A;  2IX0 A;  1NR4 A;  4RFB A;  2EY6 A;  3GTM H;  1B3A A;  1Q8K A;  1WJJ A;  3PCO B;  2DY8 A;  1X3G A;  5AJ3 L;  3KJO A;  2O2L D;  1EQT A;  1TS5 A;  1STA A;  3K59 A;  2B3G A;  4OO1 G;  4HN7 A;  4IPG A;  1R4Q B;  3RZO B;  2F0U A;  1STE A;  4EX5 A;  1NNX A;  1Q7Y C;  1I50 B;  2NN6 I;  2HIV A;  4OWT B;  1WTV A;  4BBS G;  4S3S A;  4DR1 Q;  2YYZ A;  1WCM B;  1LAC A;  4OEL B;  4BY1 B;  2Z1C A;  5JVG 3;  1IW7 D;  1D5Z C;  1I50 H;  3G48 A;  2N8N A;  1M1K C;  2KBN A;  3PIO 3;  1X3F A;  3ULJ A;  3PO3 H;  3IL8 A;  2RKS A;  2RHS B;  1WTO A;  1I4R A;  1B7Y B;  4KD3 A;  4RHR A;  4QY7 A;  3K7A H;  5NUC A;  3MEH A;  1EU3 A;  2IHF A;  1AP0 A;  2A19 A;  1I4H A;  4EQO A;  1XMO L;  4KHP Q;  4GLX A;  1VQO A;  5I9O A;  2UXC L;  3QB3 A;  3PV0 A;  2NVX B;  4YCW A;  1PFS A;  2RDF A;  4A3D G;  2B63 H;  4A93 B;  4AIM A;  5GAG C;  1WCM G;  5CGK A;  2F3W A;  3RLF A;  3NEL A;  2JQO A;  1BR9 A;  3QG1 A;  3CP0 A;  1RTN A;  1VQ7 A;  2GVB A;  2NVX H;  4X62 Q;  4QMG A;  4KV6 A;  1U0L A;  1P16 A;  1X56 A;  3UE1 A;  2LXJ A;  1Z47 A;  3S2D H;  4FNF A;  1QUQ A;  4CKB A;  5JEA J;  5M3M B;  1GOZ A;  3CMA A;  1KXL A;  2UXC Q;  2VNU D;  3PGZ A;  5T1G A;  1CZW A;  2JA8 B;  3S1M H;  1AN8 A;  2PCF B;  4RGM A;  1RHP A;  3NQT A;  1G6Z A;  1Q1B A;  4ME5 A;  2HHH L;  1AEX A;  5C0X J;  4B9W A;  5JEA H;  1R9T B;  1Q86 C;  2C9O A;  2K33 A;  1BNZ A;  1ZEQ X;  5I4D A;  1M90 C;  4C3H B;  1IL2 A;  5E4W C;  2RDG A;  1VQH A;  5BN4 A;  1F2Z A;  1EIY B;  3KDF B;  1QNU A;  1TR5 A;  1JB7 A;  3DEO A;  1IBM L;  4JI4 Q;  3S16 H;  1JWM D;  4IJH A;  2NN6 G;  3D6C A;  5CR3 A;  1X32 A;  1G8Z D;  4RG1 A;  5GAE C;  2E2H B;  2Q8T A;  5EKL A;  3KBX A;  1F2L A;  4X65 Q;  4X3S A;  1CKO A;  1ZKO A;  3HOW B;  4M1U B;  2Z4H A;  4R8I A;  5EPK A;  2O5J C;  3NQI A;  3U9S A;  4R4I A;  5IGF A;  1B70 B;  3MC0 B;  4QUC A;  2WIN B;  5C0X I;  4JV5 Q;  5D14 A;  1UEB A;  3A0J A;  3TP6 A;  1O7L A;  3HOW H;  1U4L A;  4OX9 L;  1EYA A;  2AWN A;  3OMG A;  4DV0 Q;  2NTT A;  1SFO H;  1E1O A;  4TRD A;  1BCP C;  1EFI D;  4BBR H;  5EBD A;  1G51 A;  1UE1 A;  3S1N H;  2JP1 A;  4DR6 L;  1XMQ L;  2MO0 A;  3GD7 A;  5EAY A;  3KJP A;  4R1J A;  3RR5 A;  4IJL A;  1UE5 A;  2CQA A;  3MHB A;  4J8Q A;  1ML0 D;  4XIG S;  4APV A;  4DR3 L;  4DV5 Q;  1VQI A;  1E2W A;  1LT3 D;  2G9D A;  1VQ4 A;  3A8J E;  3SEB A;  1PA6 A;  3R93 A;  4L6T B;  3EFX D;  2OF1 A;  3LNN A;  1TU2 B;  5D3D A;  1D1I A;  4QUF A;  2JA9 A;  4LW1 A;  2K5V A;  1JJC B;  4L63 B;  5M5W B;  4JYA Q;  1ENA A;  2FHT A;  4YWM A;  2KQ3 A;  1MHW C;  1H9J A;  2L12 A;  2QEX A;  1N36 L;  5M3F B;  1EZ8 A;  3I55 A;  5ELN A;  3ULP A;  1TY2 A;  4I65 A;  5M5W H;  2L5T A;  3G71 A;  1YJW A;  1STG A;  2WFW A;  4DR5 Q;  3KF8 A;  4NKL A;  1O7Y A;  1PTO C;  1VQ8 A;  1H9M A;  5IT9 E;  1EIH A;  4WJ3 M;  1SMY C;  4LF6 L;  3FDT A;  3S2H H;  3MEF A;  3GQB A;  2IPK D;  2XTI A;  1DJR D;  3CQZ H;  2M00 A;  1A3U A;  1MJE A;  1SN8 A;  1PRT B;  2C35 B;  2GVA A;  4DUY L;  4A4I A;  2Y0S G;  1C4Q A;  1QE6 A;  2OEO A;  4YHH Q;  2P5Z X;  1YEZ A;  2K32 A;  1FVI A;  1MKH A;  1KLG D;  5IY0 A;  4H44 C;  3JAM L;  3J7A 5;  4JBM A;  5J22 A;  2OQK A;  2BE5 C;  1JE4 A;  2N88 A;  1C0A A;  2J4X A;  4EQ5 A;  5IP7 H;  1JJ2 A;  2L9H A;  2Q8I B;  4UPA A;  2BCO A;  2ASB A;  5JJK A;  4CGY B;  1T5E A;  2WII B;  2R3Z A;  1BKB A;  4C1N I;  4DNI A;  4RAU C;  3M3Y H;  3OOC A;  1BCP B;  4TVA B;  2DGY A;  3NBH A;  4ME3 A;  2OTL A;  1I4Q A;  1N34 Q;  2F0F A;  2WB1 E;  1VQK A;  3GTG B;  1HTP A;  2NVT B;  2QF7 A;  2N3S A;  4DGZ A;  1N36 Q;  1GUO A;  2R7Z B;  1VQE A;  5DEH A;  2AQ1 B;  2H5X A;  3I7F A;  4QGU A;  4GNX B;  1ICF B;  4P72 A;  3NTI A;  3J7A F;  1X6O A;  4IUT A;  3M4O H;  1YHA A;  3A7L A;  2D62 A;  1PV4 A;  4CDF C;  3UI2 A;  1B44 D;  4G7Z C;  2VS1 A;  2PZU A;  4N9P A;  1PH2 A;  5FO8 B;  4MN3 A;  2AQ3 B;  2B2T C;  2CW0 D;  2NZ1 D;  2H4O A;  3CC2 A;  3K5N A;  1FNW A;  4XQQ A;  2ZTC A;  2EZV A;  2KOL A;  1DOL A;  1SE2 A;  4ODG A;  2PPB C;  4B3R Q;  2MQH A;  3F1Z A;  2JA7 H;  1ONL A;  3V2T A;  2RA4 A;  5C44 G;  4K2L A;  2ZJP A;  1B3Q A;  1MI2 A;  4L5T A;  5BR8 L;  1STB A;  3CHB D;  5EJW A;  5ISR A;  4JVZ A;  2E76 C;  3OIQ A;  1ET9 A;  2MHV A;  1XNR Q;  3H3V C;  1LTL A;  3PIP 3;  1SYF A;  3SGI A;  3CCU A;  5FJ8 H;  1TXY A;  4QB4 A;  2F0H A;  1Y14 B;  1SRO A;  2R93 H;  3F2C A;  1QZH A;  4PZ6 A;  2NZO A;  4HJ5 A;  4CKC A;  2KCT A;  1F9P A;  2F3V A;  4QQB X;  1CQF A;  2PW7 A;  3K80 C;  1TT2 A;  2VB2 X;  4DUZ Q;  2UUA Q;  1IBM Q;  4P75 A;  4BWG B;  1K9M C;  4BS9 A;  4B3S L;  3P7J A;  2JA7 G;  3FPP A;  1ILQ A;  3TEH B;  3PF4 A;  3S16 B;  1I6V C;  1VF5 C;  2MO1 A;  4N8X 1;  3H0G G;  4N9T A;  2CKZ B;  3H3V H;  4GLV B;  4DAY B;  5JPN C;  1HZB A;  2EIF A;  1IYJ B;  1E1T A;  3J81 i;  2EOT A;  4DN4 M;  1U4M A;  4M8A A;  4U68 A;  2PMZ E;  1GM5 A;  2KEC A;  3SDZ A;  4H02 A;  4HMJ A;  2JEA I;  1OTC A;  4MIU A;  1BBX C;  3WOF A;  5C5M A;  1AZQ A;  3R2I A;  4X64 L;  4I7A A;  3CCJ A;  1WD0 A;  1WYD A;  4F88 A;  2ENB A;  2IWH A;  2ID0 A;  4B08 A;  4A3F H;  3NPP A;  4KY7 A;  4OXP A;  2EYM A;  1F2M A;  3TQY A;  1BCP F;  2I5L X;  3FPU B;  1SFO B;  2A74 C;  3H0G B;  2B8F A;  1EU4 A;  5IGB A;  3S1N B;  1J6Q A;  3X3N A;  1K83 B;  2EXD A;  3RMH A;  3CCL A;  1PZK D;  3OWF A;  2K28 A;  2G5D A;  1TWC B;  2UU9 Q;  1EL0 A;  1K8M A;  2NTS A;  4LF6 Q;  1M8A A;  1CKN B;  1PH1 A;  4UHV A;  4JI0 Q;  3F8T A;  5EPJ A;  4DV6 Q;  4JK1 C;  3TRE A;  1K83 H;  2PW5 A;  2JA5 B;  4X6A H;  3H91 A;  3W1B A;  2ES2 A;  4Q5V A;  2NN6 H;  1J9O A;  1UAP A;  3HOU G;  4V0B A;  2A69 D;  4OIK A;  2I46 A;  1U4R A;  5KRU A;  1CK1 A;  1SE8 A;  5M3F H;  1Y8O B;  2AUK A;  5IGE A;  3RLN A;  1QUQ B;  2K5H A;  4LWC A;  4DF7 A;  2HCI A;  4DV7 Q;  1NAP A;  1QVG A;  1K8O A;  5CYU A;  1KD1 C;  3L2P A;  1EY0 A;  2NUC A;  1TWF B;  4CDE C;  1XMQ Q;  3G7L A;  4HIO A;  1SXT A;  2EE1 A;  3ITP A;  1XJV A;  4JYA L;  4NPS A;  2K5D A;  3LWE A;  4G57 A;  2KCC A;  2JJQ A;  1NMF A;  1PH9 A;  2VZA A;  4CDD C;  3RN2 A;  2GN5 A;  2NYZ D;  3MFG A;  3CME A;  5FLM G;  4ILW A;  3UE0 A;  3GTL H;  1EOT A;  1HR0 L;  3SK6 A;  4DR4 L;  2KA7 A;  1EQQ A;  5D65 A;  1EYC A;  1LLR D;  3A8I E;  4R4O A;  4JG2 A;  3EQL C;  2OTJ A;  2Q2U A;  3L9A X;  1DOK A;  2DNE A;  1O80 A;  5F2D A;  3J81 c;  3OTO Q;  3BVZ A;  2RQX A;  4OON A;  1PVO A;  3C3L A;  4DV1 L;  4RKB A;  3P75 A;  4DPG A;  1ESF A;  1EFW A;  3E9I A;  4DR4 Q;  4OGQ C;  1UE6 A;  3VA5 A;  2B8G A;  5IOD A;  2K5Q A;  2F0T A;  2XVS A;  3DHQ A;  4A3D B;  3L0O A;  3RZO H;  4JI3 L;  1SNQ A;  1AFP A;  1UUP A;  2BE5 D;  2XGT A;  4GOP A;  2CCZ A;  3T1Y L;  2WKD A;  4FF3 A;  2D9U A;  4NMZ A;  1ASY A;  1VQL A;  3GTG H;  4XDX A;  1WCM H;  3I4N G;  1FR3 A;  1JOR A;  1VMC A;  4A3D H;  2JYO A;  3V05 A;  3L3O C;  3I4N B;  1D5X C;  5C6A A;  1YJ9 A;  2IX3 A;  4KK7 A;  3T4A C;  2YU9 H;  5FLM H;  1FYC A;  1GUS A;  2UUA L;  4IO9 A;  3MXN A;  4IUU A;  1KL9 A;  2RSO A;  1P8L A;  3HZX A;  1Y8N B;  4DNT B;  3TN2 A;  4XXE A;  2VXW A;  1E3P A;  3HKZ G;  4EGV A;  4ZK9 B;  2J7Z A;  1TWG B;  3GTQ B;  3VYU A;  4YIJ A;  1TWH B;  4HIK A;  3K7U C;  4A3M G;  3M4P A;  1SSO A;  4A3M B;  1YIJ A;  3IFT A;  3F2B A;  2LFN A;  1XNR L;  5COY A;  3I56 A;  5FK9 C;  3U4Z A;  1Q90 A;  4CBV A;  4DR2 L;  3ERQ A;  1IL8 A;  2H1E A;  2ZT9 C;  5KNC A;  1V1P B;  1X3P A;  4KY6 A;  1UE7 A;  4K5V A;  1BO0 A;  1D1K A;  5GAD C;  1E2V A;  3JC6 6;  1SJE D;  3HOZ G;  1LYL A;  4ALP A;  2K7V A;  3AMU A;  4BY7 H;  2LSS A;  3ZYY X;  4WFN 3;  3MFY A;  2B2T A;  3HG9 A;  1T9H A;  5GRO A;  3VR3 A;  5L37 A;  4K6D A;  3DXJ C;  4X3K A;  1STY A;  1QWY A;  4CHT B;  3HKZ E;  3KBG A;  4GOP C;  1B50 A;  1D7Q A;  1K28 A;  2EY5 A;  2Q2I A;  5A35 A;  4XQJ A;  1LAB A;  4H13 C;  5LMN W;  4B3T Q;  3CCV A;  3RN5 A;  3ERS X;  2XIW A;  1O7Z A;  1IHZ A;  4RA8 A;  3A5U A;  1A3T A;  3NUC A;  4JI8 L;  3K0Y A;  3AFQ A;  1Y1W H;  1V1P A;  5IWA Q;  2BDN A;  5CV5 A;  3S15 H;  1CI3 M;  2HUG A;  1PH3 A;  5C4H A;  2QDB A;  4AYB G;  4C3I G;  5JAV A;  1CT1 D;  4R4Q A;  3ULL A;  3OPO A;  1V1Q A;  3HOY B;  2OWO A;  1FGU A;  1TQO A;  4ZRZ A;  3WDN A;  1MIU A;  3AEV A;  4ABN A;  3VA7 A;  2AWO A;  5KYL A;  1I4P A;  3W1G A;  4ZLT F;  3RZD H;  2EY1 A;  3Q22 A;  1WVL A;  3MXN B;  2A6H D;  4Z9C B;  2L55 A;  4IPH A;  4Y52 H;  4IUV A;  4OWX B;  1EY7 A;  4YY3 Q;  1TWA B;  1UWV A;  2F4V L;  5TSS A;  5BR8 Q;  5G3L F;  3Q8D A;  1IKM A;  2E2J H;  4IFD H;  2AQ2 B;  1W3S A;  4AYB B;  3Q6S A;  3JAM i;  2IT1 A;  4DAY A;  1X54 A;  4BBR B;  5M9O A;  1U9R A;  4DFA A;  2VY3 A;  1RCV D;  3MXG A;  4BBR G;  4GOP B;  4A3F B;  1EWI A;  3P20 A;  3MVV A;  4N8F A;  2I0Q A;  2QDL A;  1QJO A;  1IXR A;  4DUY Q;  3QOJ A;  2R93 G;  2Y0S B;  1BXT A;  4J15 A;  4JV5 L;  1T5X D;  2RVL A;  4LF7 Q;  3PO2 B;  3OW7 A;  5DM6 3;  1Q1E A;  3BZK A;  1CM9 A;  3I3C A;  4NW2 A;  2HDL A;  1JWU D;  1KLU D;  4MTN A;  4XT1 B;  1EIF A;  1LTG D;  1HJP A;  1PH6 A;  4XT3 B;  4DV2 L;  1V1O A;  3GTJ H;  5D3I B;  4RHS A;  2QA4 A;  2JA8 G;  1KAW A;  2JA5 H;  2WAC A;  4PZ7 A;  1HZA A;  2EJF C;  2O4X A;  3SVM A;  3S14 B;  3V96 A;  1DD2 A;  2JA6 G;  4BBS B;  4JCV E;  5FKA C;  1IBK Q;  3GV3 A;  4OEM B;  4LFC Q;  1PTO F;  3QJY A;  2LS0 1;  2F0K A;  4JBK A;  3VYT A;  4A3C H;  5CBE E;  3D4W A;  5DLQ E;  3HOX B;  2RBM A;  1QVF A;  4OHJ A;  3W2D A;  3EA6 A;  3IRB A;  5ELB A;  4XYQ A;  3KLR A;  2LXK A;  1XYI A;  2EQS A;  2DNC A;  3LGJ A;  4GN5 A;  1IBL L;  2C5C A;  3X3M A;  4JI3 Q;  2IX1 A;  4BXX G;  1I3Q B;  4JOI C;  3J80 c;  3TZD A;  5EQ0 A;  1H95 A;  4K2K A;  3I4M H;  4FF1 A;  3MA2 B;  5I9P A;  2F0D A;  3CCE A;  3K8A A;  1Y1V G;  3PSI A;  4DK1 A;  2MJ8 A;  1S5E D;  5IYB G;  4TKO B;  1JWS D;  4GS3 A;  1JOQ A;  5C4Z A;  3CPW A;  3NE5 B;  5C0X G;  2PQE A;  4IOC A;  3M3Y B;  2B2V C;  1I94 L;  1S4Z A;  2MPM A;  1XXG A;  4RKL A;  4F7X A;  4Y7N B;  3PIP A;  2MFI A;  2EJG C;  1XPR A;  4LF8 Q;  2NVT H;  2YTY A;  3M7G A;  3WWV A;  1S5C D;  2PI2 A;  1WFQ A;  1XMO Q;  1FD7 D;  3OMC A;  1LO5 D;  4EVO A;  1FJG L;  5IP7 G;  2A6E D;  4F87 A;  1MJC A;  4BA1 I;  1CKN A;  3HEJ A;  5JOB A;  1KRS A;  4FDB A;  3U4V A;  4Y7N H;  2N49 A;  1EYG A;  1EZ6 A;  4A3I G;  1OXU A;  3DLL A;  5CV8 A;  3TS2 A;  3J81 j;  2Z0S A;  5LHY 1;  5CC4 A;  2F0W A;  5LL6 X;  1UEA B;  3U9O A;  2PQA A;  1EQV A;  3H15 A;  1VQJ A;  2F4I A;  2F0Q A;  3D4D A;  4JI8 Q;  4MTK A;  3TS0 A;  4GKK Q;  1Z6H A;  3URY A;  4GNX C;  4B3M Q;  3UDG A;  1S5D D;  1QOH A;  2M2L A;  4GLA C;  4HJ9 A;  5C4X G;  2N55 A;  5DAU A;  1EWC A;  4IUP A;  4JOI A;  4RGT A;  3VR5 A;  4KY5 A;  2UXD L;  1SJH D;  1QCB D;  5CV6 A;  3PMF A;  4LF9 L;  4WJW A;  3HS0 C;  1B53 A;  4OO1 H;  3J81 L;  4A3M H;  2JA7 B;  3I73 A;  3GTO B;  4A3K G;  1HNW L;  5EKI A;  4ULL A;  4X62 L;  1RJT A;  2PNH A;  5DM7 3;  1Y1V H;  1WTH A;  3HOY G;  1BDO A;  1FNV A;  2O5I C;  5C3E H;  2B2W A;  4L5Q A;  4BY7 B;  1X3E A;  2EVB A;  1PRT D;  2DY7 A;  4O1N A;  1WTW A;  4V19 0;  2K01 A;  2XRQ D;  1HZ9 A;  4JI2 L;  4LNQ A;  5J39 A;  1TVX A;  1E0B A;  2WP8 J;  2KHI A;  3BS1 A;  4HMI A;  3M4Q A;  2JA6 H;  3R8B A;  4UP9 A;  3NEN A;  1I4X A;  1BOS A;  3NP8 A;  4TQU S;  2E2I B;  1EQR A;  1U5K A;  1UNS A;  2FFK B;  4DK0 A;  4X65 L;  1PYS B;  2AMC B;  3M7N A;  3I90 A;  4BA2 I;  1R9T H;  3M4Y A;  4J1M A;  4DAM A;  3VDY A;  3MXU A;  1PYB A;  4KLK A;  2JA6 B;  5J3B A;  2IJ0 A;  4DA2 A;  1WTR A;  1GXD C;  3EJI A;  5FLX L;  4DXG A;  3HOY H;  4C3J B;  4FP5 D;  3BDC A;  1CHQ D;  2SNM A;  3OYY A;  4DK6 C;  1FJG Q;  4HED A;  1EY9 A;  1ASZ A;  5KNB A;  4NXN Q;  2BA0 A;  4IAL A;  3OWE B;  2PYK A;  3RZD B; 
#chains in the Genus database with same CATH homology
 2VB3 X;  5EPL A;  4PMB A;  5G3L D;  5C4J B;  5LL6 S;  2DN8 A;  1DOM A;  1L0X B;  1PMR A;  1VDZ A;  2D5D A;  1YNJ D;  3Q23 A;  3ND9 A;  2TMP A;  2MUY A;  3IKJ A;  5M5Y B;  1BUV T;  1TS4 A;  1HRJ A;  4KMU C;  1ILP A;  3I4L A;  5E4X A;  5KGU A;  3TP7 A;  1LV9 A;  2A68 D;  3AB9 A;  2EYJ A;  2D2C C;  2EPB A;  4LK1 C;  2NWG A;  3T51 B;  3CKI B;  1YNJ C;  4KTA A;  4IFD J;  2NVQ B;  4X3U A;  4XQN A;  5EKK A;  2PMZ B;  2AUJ D;  3FKI B;  1EY4 A;  2WKC A;  2WB1 B;  3AU7 A;  4A3J B;  1LTR D;  4WRD A;  3PUV A;  1A2U A;  1Q12 A;  1HA6 A;  3J7A V;  1HUM A;  4FVM A;  2B2W C;  1W6J A;  5C44 B;  3DWP A;  2NVY B;  1G91 A;  3S2H B;  1STN A;  3HRZ C;  2B2U A;  2A6H C;  2OXP A;  4E6I A;  2L11 A;  1VF7 A;  4HAE A;  1WTP A;  3TZU A;  4HSV A;  4RH6 A;  4I7Z C;  1YNN D;  5JPM C;  1PLF A;  2MGS A;  3S1R B;  3GTM B;  2KCN A;  5I2Y A;  1FNU A;  4HR7 B;  1SYG A;  3D31 A;  1U4P A;  3DM1 A;  3I72 A;  4OO1 I;  3E5S A;  1KAB A;  1JOK A;  2KED A;  2KVM A;  4CJ1 B;  1TS3 A;  1QB5 D;  2WAQ B;  1MSG A;  5BN5 A;  3ND8 A;  3DUZ A;  2ZXP A;  3J80 E;  3DWQ A;  4LJZ C;  3TP5 A;  3T16 A;  2LKV A;  1B1Z A;  3R3O A;  1KTK A;  1CA6 A;  3MAQ A;  5C4X B;  3VYS A;  4G4K A;  1ICW A;  1II3 A;  1RF2 D;  1LTT D;  1SE4 A;  3C46 A;  1G29 1;  3M4O B;  1W6K A;  3P1H A;  5C5L A;  3TBI B;  3D4R A;  1GHJ A;  2R61 A;  1GUT A;  2QCP X;  4A3I B;  5M5X B;  1NSN S;  1H9R A;  1WTX A;  1SAP A;  4F8M A;  3NWT A;  3TME A;  1B9M A;  1QIL A;  2EYL A;  4UAI A;  3NWS A;  4IN3 A;  3NSW A;  4PQX A;  1DM0 B;  5T1I A;  1LTB D;  1F2Y A;  2F0N A;  1DZ1 A;  2RDH A;  1KDB A;  1RDP D;  3BVM A;  4RCO A;  4ZQ3 A;  4KN4 C;  2QEJ C;  3S1M B;  3E6Z X;  4C3I B;  4QCL A;  1EEF D;  3K5O A;  4K6L A;  2F0V A;  4TSS A;  1MGS A;  1ENC A;  1DXM A;  2B2Y A;  2PNR C;  1MBY A;  1HQR D;  3BDL A;  1YNN C;  2FJ2 A;  2F0M A;  3S17 B;  1ET6 A;  2A5H A;  2A68 C;  4DU9 A;  1B4O A;  1DON A;  3KK7 A;  3VR6 A;  1Y69 U;  2IL8 A;  3E0J A;  1IYU A;  4Q0F A;  1WD1 A;  4GZY C;  2QKI C;  3FEW X;  1HPC A;  4CKE A;  5J1Z A;  4FO2 A;  1HFN A;  1SNM A;  3SR1 A;  3SXH A;  5IT9 L;  4K5X A;  2ICI A;  2F0I A;  1VMP A;  3N52 A;  1I4G A;  3LX0 A;  2L4N A;  3I8Z A;  2K1B A;  3JAM E;  3GTP B;  3D6W A;  5IIF A;  1D6E C;  1FGB D;  4KKT A;  4DXF A;  3FMC A;  4QIW B;  2B2Y C;  1LT4 D;  3WOE A;  4CJ0 B;  2OT2 A;  1F9S A;  3T56 B;  5I6Y A;  4RWS C;  3SK4 A;  3L7Z C;  2F0L A;  2F0E A;  3D8G A;  1CA5 A;  1L0Y B;  3DMU A;  2BDO A;  2XSC A;  5EBC A;  2R6G A;  1PFM A;  1TS2 A;  4H7B A;  5BN3 A;  1JR0 D;  1OXV A;  4KJN A;  1SMY D;  1AZP A;  3CRL C;  4O42 A;  1PTO D;  1J8I A;  1DCZ A;  1JOO A;  1HCZ A;  4G7H C;  1NCV A;  1JB3 A;  3PUY A;  1A6X A;  3KLS A;  3KUP A;  3VYR A;  2I07 B;  4L8J A;  4NP5 A;  3K5M A;  1X3Q A;  3J81 E;  3RUZ A;  1KNE A;  3C2P A;  1HTL D;  2K5W A;  4J6H A;  5K36 G;  2XWB B;  3T53 B;  4ZYS A;  3QO2 A;  2FMM A;  3RD4 A;  3R2T A;  2EXZ A;  3GTL B;  3GO5 A;  1JQY D;  3H94 A;  3HOV B;  1SYD A;  1GHK A;  1F9Q A;  3OSO A;  3K6O A;  1XTC D;  5I2X A;  4OL7 A;  4K5W A;  3QIA A;  1CQV A;  3H6M A;  4ZUJ A;  2X6G A;  2KJX A;  1ESR A;  2TSS A;  1Z7T A;  1NUC A;  5CMD A;  1A3V A;  3K57 A;  3BVG A;  4OIJ A;  4RGN A;  1ENF A;  2XNA C;  3NK9 A;  1SYB A;  1B9N A;  1QG7 A;  4RCN A;  1B2T A;  3C1F A;  2MP1 A;  1GUN A;  4FXD A;  1EIG A;  2F0P A;  2L0C A;  2CHB D;  1JCK B;  2YU9 B;  4IQZ A;  5E1F A;  2XRS D;  1O78 A;  4KHV A;  4IUQ A;  4K8I A;  2F0J A;  1DYQ A;  4IUR A;  4UDU C;  4RGO S;  1PRT F;  1EY8 A;  5C3E B;  3QOL A;  1E2Z A;  2CW0 C;  3IFD A;  3HOU B;  2X6L A;  1S5F D;  3IAY A;  2F0O A;  3NTH A;  5KYI A;  4HSP A;  1V8Q A;  1ZYR C;  3VR4 A;  1HHV A;  4KI0 A;  4H0L C;  4HCS A;  1MD2 D;  2R93 B;  2HDM A;  1XWE A;  1SE3 A;  4B9X A;  1H9S B;  3VR2 A;  4ZKC B;  4LMQ D;  1KDC A;  5IGC A;  3NHH A;  1SNP A;  4DAV A;  2B2V A;  1HFG A;  2SDF A;  4R9W A;  2GA4 B;  2PZW A;  2ZXO A;  4HCE A;  1Y1W B;  3HP3 A;  2F0G A;  3S15 B;  4IFD G;  4C56 C;  4P2C B;  5FLX E;  4KJO A;  3N6R A;  2EY2 A;  2HQE A;  1G2T A;  5IOC A;  2SEB D;  2XWJ B;  2B2U C;  1BQQ T;  4R8N A;  5IGG A;  3A8K E;  1LTA D;  3K5L A;  3SE0 A;  2F0S A;  2KUM A;  1F77 A;  4K14 A;  5EGT A;  3A7A B;  3HGB A;  1Y8P B;  3ONA B;  2KEE A;  1A15 A;  5FOB B;  1KDA A;  5JJZ A;  3MXP A;  5HUR A;  5K36 H;  1ZXT A;  1C48 A;  2XN9 C;  3HKZ B;  4EQP A;  4PMC A;  5DNF A;  5CV4 A;  4KKU A;  4FXG C;  1RD9 D;  5ELC A;  5COR A;  2PZT A;  1SYC A;  4C2M B;  5C3X A;  2JSO A;  2WV6 D;  1ZYR D;  3LWU A;  2EJM A;  4KKS A;  2FIN B;  1ROD A;  1SNC A;  2EDG A;  3S1Q B;  3MTS A;  1STH A;  1CTM A;  2E75 C;  1PFN A;  3O13 A;  1CHP D;  2Q8R E;  3A55 A;  1QNK A;  3TSS A;  2NBF A;  4IFD I;  2B39 A;  4PV1 C;  3BDO A;  1Q3L A;  5FO9 B;  3S9W A;  3ERO A;  4CJ2 C;  1KNA A;  3BG3 A;  1GJX A;  3I91 A;  5I6W A;  1PXU A;  2CVR A;  1C8C A;  4HTH A;  4A3K B;  2JE6 I;  1KAA A;  3SK5 A;  3HOZ B;  1PYW D;  4ZKB B;  1PFB A;  4C1N K;  3PUZ A;  5K5P A;  3T13 A;  1MSH A;  5E3F A;  1RTO A;  1PZI D;  3NTK A;  1AW7 A;  5KEE A;  1HA5 A;  3GP7 A;  1CFM A;  3BYY B;  3TP8 A;  2HCC A;  3DWA A;  2V4D A;  2M9V A;  2SNS A;  2BA1 A;  4KD4 A;  2LY7 A;  5KIX A;  3G6J B;  2E2D C;  4XYO A;  4KHZ A;  3TDQ A;  1IYV A;  3DEP A;  2JEB I;  5AFW A;  4EQN A;  1D5M C;  3PO3 B;  1OXX K;  2Z4I A;  4X3T A;  5CV7 A;  2K05 A;  1I6H B;  1LT6 D;  4FF4 A;  3K7A B;  3EVQ A;  3C1E A;  1SBB B;  3PUX A;  1R4P B;  4U67 3;  5ELF A;  3CRK C;  2J0T D;  1RKN A;  2K6A A;  3M85 A;  2EYO A;  1SEB D;  2SOB A;  3FRP B;  1F9R A;  1HUN A;  1BF4 A;  2B63 B;  5C0X H;  1LTS D;  1Y1V B;  1G2S A;  5IGD A;  3W3A A;  3SK8 A;  1SYE A;  1OXS C;  3OHX C;  1TII D;  2ZXR A;  1CZG A;  2Z8L A;  3S2D B;  3J7Y W;  1NR2 A;  1IW7 C;  2ICE C;  2L1B A;  2LMC B;  1Q8I A;  1PTO B;  5A2Q E;  3Q0A A;  3I70 A;  3MWY W;  5JVH 3;  2JXM B;  2NB0 A;  4WOR A;  2X69 A;  1PZJ D;  3FVQ A;  1H9S A;  4LAA A;  5CV9 A;  4XTC S;  3NXW A;  1LT5 D;  1LTI D;  1PTO H;  4IUN A;  4A3B B;  3KLS X;  4A3E B;  3BZD B;  4DNR B;  4ZUI A;  5C3W A;  2EYH A;  3OIP A;  1V43 A;  1PDQ A;  2BOS A;  1IKL A;  3Q24 A;  1EEI D;  2PO4 A;  4A3G B;  1SDF A;  1A2T A;  4G7O C;  1EY6 A;  3F2U A;  2E2J B;  1JIC A;  4QF4 A;  5A2Q L;  3NBI A;  4MHE A;  3SHL A;  4K8J A;  1GUG A;  2QIL A;  2A69 C;  5ELD A;  2IW3 A;  1VCI A;  1TKW B;  5FO7 B;  2FMC A;  1D2B A;  1EWH A;  1OXT A;  1OO9 B;  5HGT A;  3GTK B;  2EYP A;  1PRT C;  2EYF A;  3K58 A;  2KHS A;  4FF2 A;  4PNY A;  3GTJ B;  4IZ8 A;  4PMW A;  2F1M A;  1JC7 A;  1EY5 A;  4NDX A;  1WTQ A;  1M4V A;  4JBW A;  2F03 A;  4C3H G;  1EYD A;  2G9H D;  4DAP A;  3CU7 A;  4ID6 A;  1SNO A;  5JEA G;  3D3R A;  2K03 A;  1H9K A;  3PUW A;  3CQZ B;  2A73 B;  3H09 A;  3I4M B;  2VUM B;  3J80 L;  2R92 B;  4KN7 C;  2A6E C;  1HXY D;  1TY0 A;  5KND A;  3QWN A;  3A54 A;  1BCP D;  2RSN A;  1HQM C;  3A56 A;  2E74 C;  1XX8 A;  3BYT B;  3GV6 A;  2K04 A;  1S5B D;  3MZ5 A;  5ELE A;  1SND A;  4FXK C;  5CBA E;  1GUW A;  4ZAI A;  4C3J G;  4FYD A;  2IX0 A;  1NR4 A;  4RFB A;  2EY6 A;  1B3A A;  2DY8 A;  2O2L D;  1EQT A;  1TS5 A;  1STA A;  3K59 A;  4OO1 G;  4HN7 A;  1R4Q B;  3RZO B;  2F0U A;  1STE A;  1I50 B;  2NN6 I;  1WTV A;  4S3S A;  2YYZ A;  1WCM B;  1LAC A;  4BY1 B;  2Z1C A;  5JVG 3;  1IW7 D;  1D5Z C;  3PIO 3;  3IL8 A;  2RKS A;  1WTO A;  1I4R A;  4KD3 A;  4RHR A;  5NUC A;  3MEH A;  1EU3 A;  1AP0 A;  1I4H A;  4EQO A;  5I9O A;  3QB3 A;  3PV0 A;  2NVX B;  2RDF A;  4A93 B;  5CGK A;  2F3W A;  3RLF A;  1BR9 A;  3QG1 A;  1RTN A;  4QMG A;  4KV6 A;  1Z47 A;  4FNF A;  4CKB A;  5M3M B;  5JEA J;  1GOZ A;  2VNU D;  5T1G A;  1CZW A;  2JA8 B;  1AN8 A;  2PCF B;  4RGM A;  1RHP A;  3NQT A;  1G6Z A;  1Q1B A;  4ME5 A;  1AEX A;  5C0X J;  4B9W A;  5JEA H;  1R9T B;  2C9O A;  2K33 A;  1BNZ A;  1ZEQ X;  5I4D A;  4C3H B;  5E4W C;  2RDG A;  5BN4 A;  1F2Z A;  1QNU A;  1TR5 A;  3DEO A;  1JWM D;  2NN6 G;  3D6C A;  5CR3 A;  1X32 A;  1G8Z D;  2E2H B;  2Q8T A;  5EKL A;  3KBX A;  1F2L A;  4X3S A;  1ZKO A;  3HOW B;  4M1U B;  2Z4H A;  4R8I A;  5EPK A;  2O5J C;  3NQI A;  3U9S A;  5IGF A;  3MC0 B;  4QUC A;  2WIN B;  5C0X I;  5D14 A;  3TP6 A;  1O7L A;  1U4L A;  1EYA A;  2AWN A;  3OMG A;  2NTT A;  4TRD A;  1BCP C;  1EFI D;  5EBD A;  2JP1 A;  3GD7 A;  2CQA A;  3MHB A;  4J8Q A;  1ML0 D;  4XIG S;  2G9D A;  1E2W A;  1LT3 D;  3A8J E;  3SEB A;  3R93 A;  4L6T B;  3EFX D;  2OF1 A;  3LNN A;  1TU2 B;  5D3D A;  1D1I A;  4QUF A;  4L63 B;  5M5W B;  1ENA A;  2FHT A;  2KQ3 A;  1H9J A;  2L12 A;  5M3F B;  1EZ8 A;  1TY2 A;  4I65 A;  2L5T A;  1STG A;  3KF8 A;  4NKL A;  1O7Y A;  1PTO C;  1H9M A;  5IT9 E;  1EIH A;  1SMY C;  3FDT A;  3GQB A;  2IPK D;  1DJR D;  2M00 A;  1A3U A;  1PRT B;  1C4Q A;  1QE6 A;  2OEO A;  2K32 A;  1KLG D;  4H44 C;  3JAM L;  5J22 A;  2BE5 C;  1JE4 A;  2N88 A;  2J4X A;  2L9H A;  2Q8I B;  2BCO A;  4CGY B;  1T5E A;  2WII B;  2R3Z A;  4C1N I;  4RAU C;  3OOC A;  1BCP B;  3NBH A;  1I4Q A;  2F0F A;  3GTG B;  1HTP A;  2NVT B;  2QF7 A;  4DGZ A;  1GUO A;  2R7Z B;  5DEH A;  2AQ1 B;  3NTI A;  3J7A F;  4IUT A;  3A7L A;  2D62 A;  3UI2 A;  1B44 D;  4G7Z C;  2PZU A;  4N9P A;  5FO8 B;  4MN3 A;  2AQ3 B;  2B2T C;  2CW0 D;  2NZ1 D;  2H4O A;  3K5N A;  1FNW A;  4XQQ A;  2EZV A;  2KOL A;  1DOL A;  1SE2 A;  4ODG A;  2PPB C;  1ONL A;  3V2T A;  2RA4 A;  4K2L A;  1MI2 A;  1STB A;  3CHB D;  5EJW A;  5ISR A;  2E76 C;  3OIQ A;  1ET9 A;  2MHV A;  3H3V C;  3PIP 3;  1SYF A;  4QB4 A;  2F0H A;  4CKC A;  1F9P A;  2F3V A;  1CQF A;  2PW7 A;  1TT2 A;  2VB2 X;  4BWG B;  4BS9 A;  3P7J A;  3FPP A;  1ILQ A;  3S16 B;  1I6V C;  1VF5 C;  4N9T A;  5JPN C;  2EOT A;  4DN4 M;  1U4M A;  4M8A A;  4U68 A;  2KEC A;  3SDZ A;  4HMJ A;  2JEA I;  4MIU A;  1BBX C;  3WOF A;  5C5M A;  1AZQ A;  3R2I A;  1WD0 A;  4F88 A;  2ENB A;  2IWH A;  2ID0 A;  4B08 A;  3NPP A;  4KY7 A;  2EYM A;  1F2M A;  1BCP F;  1SFO B;  3FPU B;  2A74 C;  3H0G B;  2B8F A;  1EU4 A;  5IGB A;  3S1N B;  3X3N A;  1K83 B;  3RMH A;  1PZK D;  3OWF A;  2K28 A;  1TWC B;  1EL0 A;  1K8M A;  2NTS A;  1M8A A;  5EPJ A;  4JK1 C;  2PW5 A;  2JA5 B;  3H91 A;  4Q5V A;  2NN6 H;  1J9O A;  1UAP A;  4V0B A;  2A69 D;  4OIK A;  2I46 A;  1U4R A;  5KRU A;  1CK1 A;  1Y8O B;  2AUK A;  5IGE A;  4DF7 A;  2HCI A;  1NAP A;  1K8O A;  5CYU A;  1EY0 A;  2NUC A;  1TWF B;  3G7L A;  1SXT A;  2EE1 A;  3ITP A;  2K5D A;  3LWE A;  4G57 A;  2KCC A;  2NYZ D;  3MFG A;  4ILW A;  1EOT A;  3SK6 A;  2KA7 A;  5D65 A;  1EYC A;  1LLR D;  3A8I E;  3EQL C;  3L9A X;  1DOK A;  2DNE A;  1O80 A;  5F2D A;  3BVZ A;  2RQX A;  3C3L A;  4RKB A;  3P75 A;  1ESF A;  4OGQ C;  3VA5 A;  2B8G A;  5IOD A;  2K5Q A;  2F0T A;  2XVS A;  3DHQ A;  4A3D B;  1SNQ A;  1AFP A;  1UUP A;  2BE5 D;  2WKD A;  4FF3 A;  2D9U A;  4NMZ A;  4XDX A;  1FR3 A;  1JOR A;  1VMC A;  2JYO A;  3V05 A;  3L3O C;  3I4N B;  1D5X C;  5C6A A;  2IX3 A;  4KK7 A;  3T4A C;  1FYC A;  1GUS A;  3MXN A;  4IUU A;  2RSO A;  3HZX A;  1Y8N B;  4DNT B;  3TN2 A;  4XXE A;  2VXW A;  4EGV A;  4ZK9 B;  2J7Z A;  1TWG B;  3GTQ B;  3VYU A;  4YIJ A;  1TWH B;  1SSO A;  4A3M B;  3IFT A;  2LFN A;  5COY A;  5FK9 C;  1Q90 A;  4CBV A;  3ERQ A;  1IL8 A;  2H1E A;  2ZT9 C;  5KNC A;  1V1P B;  1X3P A;  4KY6 A;  4K5V A;  1BO0 A;  1D1K A;  1E2V A;  1SJE D;  2K7V A;  3AMU A;  3ZYY X;  4WFN 3;  3MFY A;  2B2T A;  3HG9 A;  3VR3 A;  4K6D A;  3DXJ C;  4X3K A;  1STY A;  1QWY A;  4CHT B;  3KBG A;  1B50 A;  2EY5 A;  5A35 A;  4XQJ A;  1LAB A;  4H13 C;  2XIW A;  1O7Z A;  1IHZ A;  4RA8 A;  1A3T A;  3NUC A;  3K0Y A;  1V1P A;  2BDN A;  5CV5 A;  1CI3 M;  2HUG A;  5C4H A;  2QDB A;  4C3I G;  5JAV A;  1CT1 D;  3OPO A;  3HOY B;  4ZRZ A;  1TQO A;  3WDN A;  4ABN A;  3VA7 A;  2AWO A;  5KYL A;  1I4P A;  4ZLT F;  2EY1 A;  3Q22 A;  1WVL A;  2A6H D;  4Z9C B;  2L55 A;  4IUV A;  1EY7 A;  1TWA B;  5TSS A;  5G3L F;  1IKM A;  4IFD H;  2AQ2 B;  4AYB B;  3Q6S A;  2IT1 A;  4DAY A;  4BBR B;  5M9O A;  1U9R A;  4DFA A;  1RCV D;  3MXG A;  4A3F B;  3P20 A;  3MVV A;  1QJO A;  3QOJ A;  2Y0S B;  1BXT A;  1T5X D;  2RVL A;  3PO2 B;  3OW7 A;  5DM6 3;  1Q1E A;  1CM9 A;  3I3C A;  4NW2 A;  2HDL A;  1JWU D;  1KLU D;  4XT1 B;  1LTG D;  4XT3 B;  1V1O A;  5D3I B;  4RHS A;  2WAC A;  2EJF C;  2O4X A;  3SVM A;  3S14 B;  3V96 A;  1DD2 A;  4BBS B;  5FKA C;  3GV3 A;  1PTO F;  3QJY A;  2LS0 1;  2F0K A;  3VYT A;  5CBE E;  3D4W A;  3HOX B;  2RBM A;  4OHJ A;  3W2D A;  3EA6 A;  5ELB A;  4XYQ A;  3KLR A;  1XYI A;  2DNC A;  2C5C A;  3X3M A;  2IX1 A;  1I3Q B;  3TZD A;  5EQ0 A;  4K2K A;  4FF1 A;  3MA2 B;  5I9P A;  2F0D A;  4DK1 A;  2MJ8 A;  1S5E D;  4TKO B;  1JWS D;  1JOQ A;  5C4Z A;  3NE5 B;  5C0X G;  2PQE A;  3M3Y B;  2B2V C;  1S4Z A;  2MPM A;  1XXG A;  4RKL A;  4F7X A;  4Y7N B;  2EJG C;  3M7G A;  1S5C D;  1FD7 D;  3OMC A;  1LO5 D;  4EVO A;  2A6E D;  4F87 A;  4BA1 I;  3HEJ A;  5JOB A;  1EZ6 A;  1OXU A;  5CV8 A;  5LHY 1;  5CC4 A;  2F0W A;  5LL6 X;  1UEA B;  3U9O A;  1EQV A;  2F4I A;  2F0Q A;  3D4D A;  1Z6H A;  3URY A;  1S5D D;  1QOH A;  2M2L A;  2N55 A;  5DAU A;  1EWC A;  4IUP A;  3VR5 A;  4RGT A;  4KY5 A;  1SJH D;  1QCB D;  5CV6 A;  3PMF A;  4WJW A;  3HS0 C;  1B53 A;  4OO1 H;  3J81 L;  2JA7 B;  3I73 A;  3GTO B;  5EKI A;  4ULL A;  1RJT A;  5DM7 3;  1BDO A;  1FNV A;  2O5I C;  2B2W A;  4BY7 B;  4O1N A;  2EVB A;  1PRT D;  2DY7 A;  1WTW A;  4V19 0;  2K01 A;  2XRQ D;  5J39 A;  1TVX A;  1E0B A;  2WP8 J;  3BS1 A;  4HMI A;  3R8B A;  1I4X A;  2E2I B;  1BOS A;  4TQU S;  3NP8 A;  1UNS A;  2FFK B;  4DK0 A;  3M7N A;  3I90 A;  4BA2 I;  3M4Y A;  4J1M A;  3MXU A;  2JA6 B;  2IJ0 A;  4DA2 A;  1WTR A;  1GXD C;  3EJI A;  5FLX L;  4DXG A;  4C3J B;  4FP5 D;  3BDC A;  1CHQ D;  2SNM A;  4HED A;  1EY9 A;  5KNB A;  2BA0 A;  4IAL A;  3OWE B;  2PYK A;  3RZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...