1B4OA

Nmr study of sso7d mutant (f31a) minimized average structure
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
62
structure length
62
Chain Sequence
ATVKFKYKGEEKQVDISKIKKVWRVGKMISATYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A single-point mutation in the extreme heat- and pressure-resistant sso7d protein from sulfolobus solfataricus leads to a major rearrangement of the hydrophobic core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
molecule keywords ENDORIBONUCLEASE P2
total genus 3
structure length 62
sequence length 62
ec nomenclature ec 3.1.27.-:
pdb deposition date 1998-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b4oA00
1F9RA 1HFNA 4HCSA 2JP1A 4HSVA 5EQ0A 1VMCA 2KOLA 2Q8TA 3KBXA 4ZAIA 1SAPA 1GUWA 2KEDA 4X3KA 3KUPA 3DEPA 2FFKB 1WVLA 1NR4A 4X3SA 5COYA 2N88A 2KVMA 4OIJA 4O42A 5EKIA 3DM1A 5CBEE 2L4NA 5DNFA 1BNZA 1PDQA 2K03A 5E4XA 2EPBA 4ZKBB 1S4ZA 1CA5A 1RTOA 2K04A 3IFDA 1MSHA 2RSOA 2HDLA 2FMMA 1KNEA 2L9HA 1U4LA 2RVLA 1X3QA 4IUPA 3I3CA 4R9WA 1XYIA 1CA6A 2BDNA 4ZK9B 3GV3A 4QUCA 1WTWA 2EE1A 1G91A 2M2LA 4CJ2C 3SVMA 1VMPA 4IUQA 3D6WA 1MSGA 3MWYW 1TVXA 1PFBA 1F2LA 1NAPA 4LMQD 2IL8A 3HP3A 1B50A 1EIHA 3TN2A 2L12A 2FINB 1RODA 3FDTA 1PFMA 3GV6A 1WTXA 1IKMA 1G6ZA 1ZXTA 1DOLA 1Q3LA 1JICA 3ONAB 1DOMA 4IUUA 4QUFA 1DONA 5CMDA 2FJ2A 3DEOA 3R93A 1SDFA 4UAIA 1B4OA 3IL8A 3P7JA 1HUNA 4XT1B 1X32A 1QE6A 4R8IA 1WTOA 1HA6A 1QNKA 1BBXC 1WTVA 1QG7A 4U68A 2FHTA 2K05A 1EOTA 2X69A 4MN3A 4IUTA 1PLFA 2MGSA 1NCVA 2KEEA 4ZLTF 2L11A 1MI2A 1AZQA 1O7ZA 4IURA 4CJ0B 4NW2A 5EJWA 3TZDA 1KNAA 1RHPA 1DZ1A 1ILQA 1G2SA 5D65A 1HRJA 1SSOA 1J9OA 1O7YA 5JJZA 5D14A 1WD0A 1EQTA 1ESRA 1HHVA 1JE4A 5CBAE 5EPLA 2VXWA 1EIGA 2X6GA 2RA4A 4HEDA 2SDFA 1RTNA 2H1EA 1LV9A 1BO0A 2MP1A 3I91A 5T1IA 4HAEA 1PFNA 4X3UA 2XIWA 1X3PA 2NWGA 1C8CA 1MGSA 2DY8A 2X6LA 1G2TA 1ILPA 2K01A 2B2UA 1WTRA 1XX8A 4ZKCB 5T1GA 2R3ZA 2HCCA 2JYOA 3LWEA 4DN4M 2K28A 1A15A 2KECA 1WD1A 3UI2A 2D9UA 2EOTA 5AFWA 3I8ZA 4RA8A 2B2VA 2MJ8A 2MPMA 2DY7A 3N52A 3G7LA 1ICWA 1M8AA 2HUGA 4IUVA 4XT3B 3F2UA 1RJTA 3Q6SA 3I90A 4OIKA 1B2TA 1E0BA 2J7ZA 1F9PA 2B2TA 4X3TA 2HDMA 2B2YA 5CORA 1HFGA 1WTQA 1U4MA 1ML0D 2B2WA 1EL0A 2RSNA 2HCIA 5EPKA 4RAUC 3H91A 5EPJA 1IL8A 1F9QA 1DOKA 4RWSC 4CJ1B 1CM9A 1U4RA 2NYZD 1AZPA 2KUMA 1B3AA 1F9SA 1O80A 2CVRA 2Q8RE 1B53A 2B2VC 3QO2A 1NR2A 1IKLA 2B2WC 3FPUB 2B2TC 2B2YC 2NZ1D 2N55A 3MTSA 1BF4A 1AP0A 2B2UC 1J8IA 2L1BA 1WTPA 1HUMA 4XDXA 1U4PA 4MHEA 5E4WC 2K1BA
chains in the Genus database with same CATH superfamily
2RBMA 3G6JB 3CU7A 3OMCA 2HHHL 3K7AH 3K8AA 1QB5D 1VCIA 3PV0A 4KHZA 2B29A 4DV0Q 2JEAI 2F4VQ 3PIO3 2F0VA 1KAWA 3FKIB 4K5WA 4KI0A 4G4KA 2EPBA 3SR1A 3M7NA 4TRDA 4BWGB 1VQIA 4GS3A 1H9KA 4A3FG 4JBMA 1PFSA 1X54A 4ZK9B 3DLLA 3U9OA 5C0XJ 3D6WA 4K0KQ 4JBWA 5ELCA 2D62A 2RHQB 2F0GA 3FDTA 3A5ZB 3D0FA 5GROA 1DOMA 2XTIA 3CAMA 4MIUA 3QR8A 4LUOA 2VQEQ 2EJGC 1DONA 1XNQQ 3BZKA 1JWMD 3RMHA 1NMGA 2PNHA 3BYTB 4PG3A 4JBJA 1HA6A 2BH8A 1D5ZC 3RLOA 2ICEC 2L11A 1X3FA 2A69D 4IURA 1V43A 5F2DA 3CPFA 3M4OB 3KLSX 3HKZG 5D65A 4RKLA 3VYUA 4WFN3 4IQZA 2AUJD 4K14A 1CSPA 4HMIA 1ESRA 2BDOA 4C3JH 3BYYB 1JWSD 3GTLB 4KY6A 2QILA 4CDDC 3U4VA 1IBLQ 2XIWA 2EYFA 4O2DA 1N32L 4ZKCB 5M3MG 3CP0A 4JI2Q 2EYJA 1I4QA 5KRUA 3T56B 1K3BC 3PUXA 4XTCS 3RLNA 2F0OA 2IJ0A 4L5QA 2WAQG 2K50A 3NBHB 1DCZA 2R92H 1SYEA 1F2ZA 4X3TA 3AU7A 3LX0A 4A3FB 2JA8G 1EFID 1N33Q 4J8QA 1VQ6A 2HIXA 3VR6A 1CM9A 2OEOA 3I70A 4IPGA 3TMEA 4DV0L 4TSSA 4DK6C 1KDBA 4A93H 2EY5A 3KFUA 2RHSB 3SHLA 2K52A 4GN4B 4R1JA 1WTPA 2AQ1B 2A8VA 2PI2E 4LF8L 1RL2A 5C0XI 1KDAA 4K0KL 1PYSB 4RGNA 5TSSA 3BZCA 2XWJB 4LAAA 4QJFA 2XVSA 1Y1VB 1D1KA 1HTLD 4DR3Q 1A0IA 2N88A 4B3TQ 3HOZB 4A4IA 2K7VA 1PDQA 4BY1B 4LFAL 3D4RA 3MXPA 2DGYA 2F3VA 1PVOA 4Y52H 5KNCA 2K4KA 2HD3A 2NVQH 1E2WA 3GV3A 1WTWA 2RQXA 5HGTA 3U4ZA 1R9TB 1K8OA 2PI2A 1EEID 5LL6S 3QOLA 5C4ZA 1BDOA 3S1QB 1GUGA 1TXYA 2PW7A 4K8IA 1SE2A 2XWBB 2FINB 4KKSA 3TP5A 2F0WA 3A7AB 1G6ZA 3PMFA 2XRSD 3H0GG 4KLKA 1RIPA 4QUFA 2CW0D 4DR1L 1HQRD 4OEMB 2CWAA 1SMYD 3BVMA 4KK7A 2JA8B 2PYKA 1D5MC 3GTPB 2NN6I 1BBXC 4U68A 1TS2A 1NCVA 3BDOA 3P75A 3GTOB 3G4SA 1N8RC 2F0NA 3K80C 3S16B 4A3MH 1BQQT 1R4PB 2CWPA 2X6GA 4F7XA 4OONA 2E2DC 3K7UC 2X6LA 4A3BB 1L1OC 1IBML 4BBSB 2BH2A 4B3RL 1T5EA 4ZUJA 2RDFA 2UXDL 4A3KH 1M8AA 1EZ6A 5GAEC 2E8GA 2B2YA 4EQPA 4DR2L 1Y1WG 4A3EH 1OXSC 4A3LH 1KABA 4X62L 5JJIA 1KRTA 4NXMQ 4LF5L 1KLGD 1XMOQ 2Z4IA 1LO5D 3O13A 2NVXB 4E6IA 1VQBA 4A3DG 3G6EA 3A0JA 2K33A 3PO2B 4PV1C 1VQDA 5C6AA 1EYAA 2PZTA 2XSCA 1LLRD 4KN4C 2JA6G 1HXYD 4L5SA 4UP8A 4QL5A 2NVYB 4XQNA 5DLQE 1LTSD 5EQ0A 1FJGQ 1BBWA 2GVBA 1HPCA 2K5WA 3S14H 2UU9L 1TWHB 1WFQA 4YCWA 3GTGH 4LF6Q 2KVMA 4JI1L 4IFDI 2K03A 1FGBD 3RNUA 2QF7A 4POFA 2RVLA 1E22A 4IUPA 1GM5A 3HFZB 1SROA 5FO9B 2EE1A 5JJLA 3C3LA 3H0GB 2ASBA 1I4PA 3AFPA 5IP9H 2E76C 2VB2X 2MO1A 4ULLA 3K0YA 4LMQD 1QJOA 4HIOA 2WAQE 5KEEA 4DV1L 4FXKC 4P2CB 2ID0A 2N78A 5CMDA 3DEOA 3EBEA 3S1NH 4N9TA 1TY0A 1Y1WB 3C46A 2EYLA 2EY2A 4FXDA 1PTOF 1YJWA 2GN5A 4RCNA 2K05A 2HT1A 1LTLA 2A68D 3CCVA 4ZLTF 4RH6A 1LYLA 1I4RA 2EY1A 2NZOA 1KLUD 3HKZE 2R7FA 2F0EA 3TZDA 1ET9A 1TR5A 2K5NA 1MIUA 4FYDA 4JI3L 1A3TA 1NJIC 1HZAA 2I5LX 4B9XA 1QILA 3NWTA 5CBAE 3AMUA 2IX0A 3BDCA 4JCVE 4AIMA 2H1EA 1T9HA 2IWHA 4G7OC 1EY8A 1G2TA 1RF2D 2A6ED 3E3XA 2R3ZA 4KY5A 3KLRA 3M4YA 1UE6A 1HQMC 1L2FA 1EYGA 4RHSA 3KF6A 5M3MB 1STAA 4U673 4JPBW 1EL0A 2RSNA 1YHAA 3MVVA 4RAUC 4PZ6A 2F0TA 2NYZD 1U4RA 2C9OA 4RHRA 2B8FA 3T4AC 1B53A 1VQKA 3L7ZC 1JQYD 4OL7A 5FLMG 4ALPA 2N55A 4JOIA 5DEHA 1JB3A 3CCMA 1LT4D 3GQBA 1HUMA 3FEWX 4JI3Q 4R8NA 4GKJL 3CHBD 4ME3A 1H9JA 5J3BA 4DV1Q 3OOCA 4XQQA 3M4PA 1SE3A 3HS0C 3IFTA 2Q8TA 4JI6L 2IHFA 2ALYB 3NK9A 1Y8NB 4IPHA 1V9PA 4LFAQ 5I4DA 4DUYQ 4RGMA 1ENCA 1MBYA 5E4XA 5C3XA 1HNZQ 1YZ6A 4J6HA 4M1UB 3IFDA 1FR3A 4GLAC 1X3QA 1CA6A 1L0WA 5IOCA 2F1MA 3CC7A 4CJ2C 1YNXA 4R4TA 2UUBL 3OTOQ 3M4QA 2QGQA 1EIHA 3OTOL 5CV5A 1EOVA 2VUMG 1IZ6A 1D8LA 5KNDA 2IY5B 1TWHH 3S14B 3I4NB 5GQOA 1SXTA 1XNRQ 1VQJA 2E2IH 4F8MA 4LFBQ 3JAME 2NUCA 3J7AV 4JI4Q 1S5CD 4ID6A 4CDEC 2ZXRA 1B7YB 1DM0B 1EY5A 3PO2H 2MGSA 2PQAB 3HOXH 3J7A5 3D8GA 4NW2A 2NVXH 3BVGA 4IFDJ 2NTTA 3K5MA 2RA4A 1PRTF 1VQLA 2ATWA 1LTID 5J22A 5FJ8G 3ND8A 4KHVA 3UDIA 2QA4A 3PO3G 4GOPB 2N8NA 4OWWB 1EFWA 2KHJA 1VF7A 4OGQC 3QB3A 3VYSA 1A15A 1AN8A 2D9UA 1GD7A 3SK8A 1PRTD 3BG3A 4DR2Q 4DV6Q 1ZEQX 3P1HA 3Q6SA 1S40A 1CHPD 1VQGA 2B2TA 2ES2A 2VUMB 3HOYB 1JJ2A 1OXTA 2EY6A 1Q86C 1XNRL 4LF9L 1F2MA 5C44H 4CDFC 2KUMA 5BN3A 5GADC 1GJXA 4S3SA 2A1AA 1IKLA 1SNPA 4JI0Q 4KKTA 3I4MB 1TU2B 3OYYA 4RCOA 3QJYA 1QCBD 1F9RA 1NTGA 2WFWA 1EUJA 3STBD 1XTDA 1LUZA 5A35A 3RN2A 2Y0SB 5BN4A 2HHHQ 4X3SA 1STHA 1YEZA 4I7ZC 1X56A 2YV5A 1YI2A 2CH4W 3A55A 5FO8B 1I50B 4G57A 4L6TB 2NVQB 1DZ1A 4K6DA 4QUCA 4OX9Q 1E24A 1Z9FA 4Q0FA 5C4XG 5IYBG 4JI2L 1WCMB 4UPAA 3HOWB 3DM3A 1TWFB 4NMZA 1UNSA 2QDBA 1X55A 1I3QH 5IGBA 2KA7A 1WOCA 3BJUA 4P74A 3MA2B 4C3HH 1QVCA 1HNXQ 2OWOA 4MTKA 2X69A 3I4MG 1EOTA 1PLFA 2L0CA 4CJ0B 4A3IB 1Y14B 4DR1Q 1K0SA 1YIJA 4IO9A 3GTJB 2F0SA 4HTHA 1SLJA 1QVFA 2K5HA 4ZYSA 4LFBL 1IYVA 5T1IA 1LV9A 2WV6D 1V1PA 3VYTA 1CZGA 2WAQB 1C8CA 1O7IA 5JAVA 1TWCH 1B9NA 3OMGA 4DN4M 1OXXK 3DMUA 3H3VI 3T53B 1O78A 4C3IH 3NQIA 1CKOA 4WJ3M 4LF7L 1UWVA 2HUGA 3S1MH 2JEBI 2F03A 1B3QA 2A6EC 3M7GA 4DR3L 1SYBA 4A3JB 4BS9A 2JXMB 3UDXA 1Z7TA 1A8VA 3I55A 4PMCA 4C3JB 4JI1Q 4RWSC 1F9QA 4LUZA 5AJ3L 3ER0A 4HCEA 4XIGS 1O80A 1P8LA 1VQNA 4AYBG 2B2VC 2ZT9C 2JJQA 1ONLA 4LJZC 3IKJA 2B2WC 4DV2Q 1YNJD 1XMQL 2OCEA 2IHEA 4CKEA 1J8IA 1TT2A 3A56A 5LMNL 4ZUIA 1UAPA 1JE5A 3ITPA 2E2JB 5LMNQ 1STNA 5GAHC 2J4XA 1Q8KA 2E2JH 1L1OA 5M5YB 3L0OA 3JAMc 4LF4Q 2PCFB 5C4HA 5BR8L 3J80L 4DV4Q 1P16A 4ZAIA 4BBRH 5FLXL 2Y0SG 3V96A 2PZWA 4CGYB 1SN8A 4OIJA 5EKIA 1BNZA 1LT5D 4DUZQ 5K36G 1V8QA 1FVIA 4MZ9A 2K04A 4FDBA 3S17H 5KYLA 2CQAA 4DFAA 4B9WA 3I3CA 2UUAQ 2F4VL 1BUVT 4CHTB 1E3PA 2KCCA 2PW5A 2OTJA 5IODA 1B50A 1SMXA 4GLVB 3L9AX 4X66L 3ICEA 1WCMG 1VQAA 1PFMA 1JICA 2A68C 1VQFA 3H94A 5CV4A 4GZYC 1TWCB 3KJPA 1H95A 1B4OA 3PO3H 4JI7Q 1NNXA 1EY4A 5FJ8H 2EQSA 1QE6A 2QDLA 2ZTEA 2NVTB 2JK8A 1PYBA 2DJFC 4IUTA 3GTJH 1YITA 2UUCL 3S15H 5IT9L 3D3RA 3HOXG 4A3IG 1Q7YC 4DK0A 3T1YL 1KQSA 1PTOB 5M3FB 1MJCA 1JC7A 1GVPA 5J39A 1HHVA 4WORA 5CR3A 1EIGA 2K5DA 2JE6I 1Q1BA 2D2CC 3CCRA 1MD2D 1I3QB 1CK1A 2I0QA 4BY7H 1HTPA 1WTRA 3T16A 3NELA 3A8KE 2A19A 4L5TA 2AUKA 2DUDA 2Q8IB 4DR7L 4BY7B 1IBMQ 2OXPA 1B2TA 1F9PA 4R4IA 3FP9A 4CBVA 2OT2A 4BA1I 4LW1A 1ASYA 3H15A 4YCVA 1X3GA 1S3OA 5I6YA 4C1NI 4LUVA 4HJ7A 1DGSA 5CV9A 4C1NK 2R6GA 3VR5A 3FPPA 3HKZB 2B2TC 1LM0A 1QOHA 3MZ5A 1K0RA 2EIFA 2VZAA 1EQVA 1U4PA 4GLXA 1OTCA 2HQLA 3GTKH 3S2HB 2RDHA 3PO3B 4HCSA 3J80c 1GOZA 1CQVA 1I94Q 3CCUA 3I4MH 1XJVA 1L0YB 5EKLA 3AB9A 2CW0C 3L3OC 4YHHQ 1GUWA 3KUPA 5G3LD 2EDGA 3F8TA 2AQ3B 3KOJA 2VB3X 1QZGA 3PSIA 1VQ9A 3NENA 1E1TA 1N33L 3JAMi 5DNFA 3Q8DA 1PV4A 2R7DA 1SR3A 3MXNB 1KNEA 5IY0A 1E2ZA 2AWOA 4C56C 5E1FA 4JV5L 3S17B 4DV5Q 2AQ2B 1SEBD 1EIFA 1ZKOA 3PCOB 1QUQB 1HJPA 1VQMA 1VS0A 2K5QA 1CFMA 4BBRB 1Q3LA 1N9WA 4K6LA 1ZYRC 2WIIB 1CKMA 5M5YH 3BU2A 1NY4A 4DXFA 3M9BA 3P7JA 2VS1A 3K59A 4LF7Q 3KF6B 1B1ZA 1TWAH 4MN3A 1Q1EA 2L15A 3UE1A 3PQIA 3PIP3 4X65Q 5IYDG 4DR6L 1ILQA 3HOXB 1EYCA 4A75A 2EXDA 1H9RA 1MHWC 2F3WA 3I72A 4M8AA 4CKCA 4FXGC 3P20A 4FF4A 3K81C 4X3UA 4A3JH 2E2IB 4V0BA 1MGSA 1K28A 3S1MB 1TKWB 3VR4A 5C4XH 4NXML 4PQXA 3LNNA 1PTOC 2C5CA 1CT1D 3F2UA 1RJTA 4P72A 1A63A 2J7ZA 1EQQA 5CORA 2B2WA 1VQOA 5EPKA 4KN7C 1I94L 2JA5H 5GAGC 2D0PA 4YCUA 3PUWA 1QZHA 3OWFA 1AZPA 2G9DA 2ZJQA 2NB0A 3EQLC 1NR2A 4A3IH 2UUBQ 3BS1A 4L63B 4F87A 1GUTA 3RZDH 4C3HB 1GKHA 3AFQA 1JR0D 1TWGH 2AKWB 2JA6H 4EQOA 1TQOA 2OQ0A 1EU3A 4DNIA 5L37A 2GA4B 1VMCA 5C44G 1TWFH 1Y1VG 4PMWA 4X3KA 4BBSG 1WCMH 3N6RA 3K57A 4EQ5A 3PGZA 2ZJPA 1HZBA 3HOUB 4IOCA 1CA5A 3D4WA 2VNUD 1XMOL 1NE3A 1LTTD 2K32A 2CCZA 3SVMA 1VMPA 4EQNA 1EY0A 5IT9E 1SE8A 3A74A 5ELOA 3DXJC 1PH4A 1JMCA 3K0XA 4NB3A 4BBRG 3NWSA 2SNSA 3GD7A 1OXVA 3D4DA 2HQEA 4N8FA 1IL2A 5A2QE 1UE1A 3FVQA 3PO2G 1QG7A 1ESFA 4L8JA 2XNAC 3OW2A 1UE7A 3OPOA 4R4CA 5BR8Q 4DV4L 1MI2A 3MHBA 4JVZA 3E5SA 1RHPA 3ERSX 1IW7C 5FLXE 1SSOA 3GTQB 2ZTDA 5D14A 5C44B 1X3EA 1HNWQ 1J6QA 2VXWA 1XNQL 2C35B 5C0XH 1D1IA 1GUNA 2VUMH 1ZYRD 4TVAB 1YHQA 1PMRA 2B8GA 1ILPA 5T1GA 3J80i 3LWEA 1D5XC 1B8AA 1EIYB 2KHSA 5IGEA 3DWPA 2MJ8A 5IGGA 2CH4A 1S5FD 4JI8Q 3F2BA 2F52A 4P71A 2ZM6L 3CCSA 3R2TA 5EPJA 4CJ1B 5D3DA 2EYMA 1X9NA 4JYAL 1N32Q 3EJIA 3RR5A 2EYHA 2I46A 3RUZA 4DNRB 1BF4A 2K14A 1WTHA 2WKCA 1HA5A 5IT9c 2F0FA 5FLMH 4C3HG 5KIXA 5AJ3Q 3B6YA 3RN5A 1Q82C 1FNVA 1I5FA 1LTGD 3NTKA 1XTCD 1OO9B 4DV3L 5HY6A 3SK6A 4A93G 1XWEA 4UP7A 1M4VA 2PQAA 1KD1C 3HZXA 1PH1A 4IN3A 4A3EB 3WDNA 1G91A 3K6OA 1UE5A 3PUYA 4BY7G 5IP9G 3J81L 3RZOH 1SNCA 3NHHA 4DR5Q 4A3KB 1PH6A 4OX9L 4BBSH 3GV6A 3ZYYX 4DAMA 3SK4A 1UEAB 1WJJA 2EVBA 4A3BH 1Y69U 2M00A 2F0HA 5JJKA 3PIOA 4C3JG 2YTVA 5FKAC 1PH9A 3OIPA 2BA0A 1QVGA 4R4QA 5EBDA 3GTOH 4J1MA 4B3MQ 4CDCC 4DR4Q 4LF8Q 1CKNA 1EQTA 4QCLA 4JI8L 4F88A 4BXXH 2O4XA 2CFMA 2MP1A 4HIDA 3EFXD 2NWGA 3F1ZA 3K5LA 3K5OA 5C3EG 1CUKA 3FRPB 1HH2P 3MXGA 4ILWA 3G7LA 2O2LD 3TQYA 2SOBA 5K36H 3JAML 1FGUA 2PPBC 3MXUA 3CXCA 4G7ZC 1LABA 3U50C 1R9TH 1JJGA 3MFYA 2F0LA 2VW9A 5CGKA 1RD9D 1SE4A 4XQJA 3AEVA 1JCKB 3HKSA 1F9SA 2PZUA 3E9IA 2D0OA 3A54A 1Q81C 3E9HA 2ZJRA 4QIWB 3CC2A 5EGTA 2F0KA 1WYDA 3BZDB 2B2UC 1XXGA 2JA6B 4H44C 3HOVB 2YTYA 3S1NB 1A6XA 5I6WA 5HURA 1GO3E 3RZDB 3UDGA 3KLSA 2B39A 2LXKA 1PH8A 1UEBA 4A3LG 4J15A 2KEDA 1F2YA 4ZCKA 3HGBA 4A93B 1A3UA 4LF4L 5COYA 2F0MA 2F0DA 4JV5Q 5CBEE 2EYOA 4ZKBB 4C2MB 4A3CG 1BCPF 3H0GH 1AE3A 1MSHA 1B9MA 5JEAH 2B3GA 3TP8A 3EVQA 5KNBA 3LGJA 3RLFA 1HCZA 1CKNB 1TY2A 2JA9A 3D31A 1NAPA 3MC0B 3NTIA 3QIAA 1KXLA 4MNOA 3J7ZC 2G9HD 3KDFB 1DYQA 2Q2HA 3I4NG 1HR0Q 3QWNA 2UXCL 5M5XB 1QUQA 1IBLL 5C4XB 4A3MG 5CC4A 1B44D 2NVYH 3PIPA 4X65L 2JSOA 4NDXA 5ELBA 4IUNA 4FVMA 4APVA 2RCFA 1A2UA 3MEHA 1WTVA 3S9WA 3C2PA 4L5RC 1JORA 3AYHB 1D6EC 2A69C 1O7ZA 5K5PA 1AZQA 1KTKA 2Z8LA 1YJNA 2Z6KA 1J9OA 1O7YA 2ENBA 2Z6KC 1TWAB 4QIWE 2SDFA 1RTNA 3VR3A 3CCEA 2VY3A 2SNMA 4WJ4A 1S72A 3CW2C 4IALA 2JN4A 3SK5A 2JYOA 3NUCA 2EYPA 1HR0W 3VYRA 4LWCA 1IBKQ 1OXUA 3J81E 4EVOA 2R92G 3NP8A 3CQZH 1FL0A 1NSNS 3GP7A 1HFGA 3SDZA 4GNXA 2OF1A 4A3MB 2F0UA 4B3TL 2E5LL 2JQOA 1XPRA 3S16H 2MFIA 4RKBA 1PRTC 2CVRA 3KBGA 2Y0SE 2BA1A 5ISRA 4FF1A 2B2YC 1SNOA 1BXTA 5ELNA 4A3GG 5G3LF 4DNTB 4MHEA 4DR4L 3GTKB 3NPPA 2A6HC 3NQTA 1SMYC 1A3VA 1PZKD 1VQCA 1N34Q 4NP5A 1SAPA 1N34L 3BDLA 1VQ5A 2EJFC 1STEA 3E6ZX 4AYBE 2R7ZG 2F0PA 2AHOB 5IP7H 1RTOA 3QOJA 2IX1A 2FMMA 3SGIA 1U4LA 3K5NA 3W1GA 3SXHA 2K5VA 1FNWA 1I6VC 3S24A 4FO2A 3U58A 4DV7Q 3ZJYC 1X65A 1HZ9A 4YWKA 2R61A 3TN2A 3S2DH 4YIJA 5I9OA 3ULPA 1Y8PB 2YU9H 1STGA 3S1RH 4WRDA 2LFNA 3R93A 1KC8C 1SDFA 2B63H 4XT1B 1X32A 3A7LA 1SYGA 2E2HH 4MTNA 4K5XA 4NXNL 4DR6Q 1SFOH 1Q12A 3I73A 5FK9C 3KLWA 1XPUA 2AMCB 2NTSA 3F2CA 3S15B 1CSQA 2KHIA 1BOSA 1SNQA 5JJZA 3Q23A 2JA7G 1JE4A 2WKDA 1PYWD 4IPDA 4KMUC 1L1OB 4IJHA 4A3EG 1A2TA 4HAEA 3TBIB 3M3YH 1ICFB 4KV6A 2B2UA 3R2IA 4B3SQ 4NPSA 4UDUC 4I7AA 4XYOA 5HGQA 1WD1A 4C3IG 1PH7A 1LTRD 4JG2A 2BOSA 4DAPA 1PH5A 2I07B 5EKKA 3J81c 4HN7A 4K2KA 3M3YB 1C48A 2KENA 1WTQA 1YHBA 5IE8A 1I4XA 4K5VA 4POGA 5JOBA 1J5EQ 1TS5A 1Y8OB 4ME5A 4OO1H 4X66Q 1VQ7A 1W6JA 3TS2A 1PTOD 3M4OH 2LSSA 3FPUB 3C1EA 3T13A 2ICIA 5NUCA 1PA6A 1T5XD 4AQYL 1SFOB 3IAYA 3JC66 4JI7L 5DAUA 5FOBB 4OWXB 5JPMC 3CPWA 2E2HB 2B63B 2DN8A 5E4WC 1K9MC 1M1KC 4JK1C 2PMZE 3MFGA 4BA2I 3VDYA 5M3FG 4Z9CB 2YU9B 3SE0A 3NXWA 2BE5C 2Q2TA 2QKIC 3DEPA 1GXDC 3S2DB 1YNND 4O42A 3WWVA 5IYBH 4JI0L 3QG1A 2YYZA 1NUCA 3WOEA 3I56A 2VQEL 4DUZL 4TKOB 2EXZA 4IUQA 4DV2L 1TVXA 4OWTB 5LMUQ 3FKIH 5FO7B 1D7QA 1Z47A 3HOYG 1CHQD 3RD4A 1BKBA 5ELDA 3PF5A 4C3IB 4X62Q 2F0JA 4LF6L 1KHIA 1IKMA 1ZXTA 1SRUA 3ERQA 3K7AB 2KBNA 3W2DA 2FJ2A 1C4QA 4LNQA 1TS3A 2WB1B 3A8JE 5JPNC 4B3ML 2L55A 4GKJQ 5JEAJ 2G5DA 2JA7B 2VQFL 4X6AH 2KEEA 3NTHA 4H02A 4ABNA 4KTAA 2FXQA 5LHY1 1HRJA 1JB7A 3VA5A 1FYCA 1WD0A 3KK7A 4OXPA 2WB1E 2B63G 2WP8J 2HIVA 3CQZB 2M9VA 3EROA 1M90C 4P73A 2A73B 2MQHA 3HOWH 3WOFA 4HR7B 2IT1A 3W3AA 3N52A 2LKVA 4IUVA 3H3VC 2UXCQ 4JBKA 1SYDA 1VQ4A 2EZVA 2UUCQ 1ASZA 1SNDA 1JJCB 3HOWG 1E7ZA 2NN6G 1I50H 1PH3A 1DOKA 5I9PA 5IP7G 4FNFA 4PZ8A 5LMNW 4DR5L 1W2BA 3KDFA 1PZJD 3G71A 1Q90A 1JOOA 3BVZA 1AW7A 3PUVA 4DF7A 1QWYA 2N3SA 5D3IB 1AP0A 4JI5L 1TIID 4XDXA 1BCPB 4WJWA 1UUPA 3KF8B 4GKKQ 4R4OA 4HSVA 2KOLA 1STYA 1O7LA 3Q22A 2UXBL 5M5XH 3TZUA 1SBBB 2Z9HA 5ELFA 1IYUA 4JI4L 2L4NA 3CCQA 1AE2A 1EY6A 1BCPD 2RSOA 1GHKA 3DWAA 4R9WA 2TSSA 4DA2A 1XPOA 4OHJA 4UHVA 3KF8A 4PZ7A 1XMQQ 3CRLC 3HOYH 2M2LA 1K83B 4C2MH 1G6PA 1ET6A 3HOUG 1F2LA 5M5WB 4Y7NH 1MJEA 4GNXC 1IW7D 5BN5A 4LF5Q 2I5MX 1J5EL 1WTXA 2NBFA 2ZXOA 2BE5D 3TRZA 4DGZA 1U5KA 3EN2A 4A3GB 2O5JC 2KJXA 4AYBB 3J81i 2D5DA 1HNWL 1HUNA 3HOVH 2CKZB 2RCNA 1WTOA 2UXDQ 1QNKA 4O0AA 5IYCG 3TP6A 1EY9A 5C4JB 2PNRC 2Z1CA 1G2SA 1I4HA 2QW7A 4UP9A 5C3EB 4B3RQ 4V190 1VQHA 3Q24A 5IGDA 4DPGA 1EWCA 3I91A 1DJRD 1G291 2Z6BA 3H09A 4XXEA 3J7YW 2QEJC 2ZM6Q 2LXJA 2MNAA 1V1QA 3TS0A 1IHZA 1K8AC 3GTMB 5ELEA 1YNNC 1Q8IA 1YNJC 2N49A 2K28A 3ND9A 1BBUA 4IZ8A 2E5LQ 3I4NH 1PRTB 1LT6D 1RKNA 5LMUL 3I8ZA 3G48A 4PNYA 4ZQ3A 2A5HA 1H9SB 5I2XA 4YY3Q 3I90A 2K6AA 3CMEA 1GUOA 2UU9Q 3R8BA 4DXGA 2O5IC 4KHPQ 1ML0D 2HCIA 3I4LA 2R93H 3IRBA 1KIXA 1B3AA 1CQFA 5EAYA 2F3IA 3DHQA 3NE5B 2NZ1D 1FNUA 3SEBA 2GVAA 5CV7A 2LS01 3KYHC 4ZRZA 3UE0A 5C3WA 3NBIA 2DNCA 3V2TA 4JI6Q 1HFNA 2CQOA 3CC4A 3PUZA 1ENFA 1EEFD 1EY7A 1RCVD 1WVLA 5IGCA 3RZOB 3OW7A 4QY7A 4DAYA 4DV7L 4K2LA 1JOKA 2NN6H 4DKAC 4G7HC 4JYAQ 4YY3L 3A8IE 1FD7D 2EJMA 1KDCA 4N8X1 1SNMA 5M3MH 3MWYW 4QMGA 4CKBA 1PFBA 5C5LA 1AH9A 1GUSA 1JT8A 4H7BA 3ULJA 2UXBQ 2Q2UA 1RODA 1SYFA 3J80E 1DOLA 3ONAB 2R7ZH 2RKSA 3GTMH 1I6HB 1PZID 3PF4A 4FF3A 3IL8A 3HG9A 3HRZC 4BXXG 4R8IA 1SJED 2LMCB 2VL6A 5JVH3 1PHJA 2PQEA 4QB4A 1BVSA 2V4DA 5IWAQ 1SYCA 4A3DH 5IWAL 5EJWA 4FF2A 5C4JH 2L5TA 3T1YQ 5IGFA 1G51A 3C1FA 4A76A 1JWUD 2LY7A 1EZ8A 1AFPA 2BCOA 4HEDA 1BO0A 3I2ZA 4XYQA 1Y1WH 3EA6A 4DK3C 4HIKA 4LK1C 4K8JA 3F2DA 1X3PA 2DY8A 2K01A 2K75A 2UUAL 1XX8A 4OELB 1YVCA 4A3KG 2OQKA 4GN3B 1BR9A 4LFCL 3L2PA 2DY7A 1S5BD 1LTBD 4Y7NB 5M5WH 1VQPA 1U4MA 3TREA 2XGTA 4N9PA 1BCPC 4GNXB 3H91A 1IL8A 3TSSA 3GTQH 1U0LA 3OIQA 2VQFQ 3QO2A 3GTGB 3KJOA 2QEXA 4A3DB 4JI5Q 1HNXL 4IPCA 1K3RA 1VF5C 4KKUA 2FMCA 4I65A 2IX3A 2L1BA 2RF4A 5E7NA 3FHWA 4HJ9A 1HNZL 1V1OA 4HMJA 4P75A 3URYA 1I6HH 2KCTA 3T1HQ 2R7ZB 4RGTA 3KBXA 4KJNA 2R93G 3A5UA 2H4OA 3K58A 4KD4A 3NSWA 1IXRA 2FFKB 2H5XA 5KGUA 3H3VH 4AQYQ 2AWNA 1WI5A 1HR0L 3ULLA 1S4ZA 4X64Q 3CCJA 4GOPC 1DD2A 2HDLA 2L9HA 4X64L 4HIMA 1XYIA 3LWUA 2BDNA 4DV5L 1C0AA 1E2VA 1MSGA 2WINB 4LF9Q 4Q5VA 3CRKC 1N36L 3HOUH 2IL8A 3HP3A 1N36Q 1Q46A 3OWEB 2L12A 2F0IA 3OHXC 3CF5A 1LT3D 4A3CH 4B08A 1EU4A 1K73C 2YTXA 4ODGA 4UAIA 4YWLA 1TWGB 5C0XG 1F77A 2NZHA 1GHJA 2TMPA 2Z0SA 3R3OA 2Z4HA 1QNUA 2FHTA 4DAYB 4KD3A 1CZWA 5JVG3 4KY7A 4NKLA 3T1HL 2J0TD 2DNEA 1KNAA 3CD6A 4HJAA 4IOAA 1IBKL 5H1SE 2R93B 2JA5B 1A62A 3GTPH 3M85A 2JA8H 1G8ZD 4DV6L 5CV8A 1PH2A 1PFNA 3W1BA 1KL9A 3MAQA 1LACA 1C7YA 4IFDH 2HCCA 1H9MA 1X6OA 3J7AF 2KECA 2E74C 3AQQA 5AFWA 2B2VA 1RDPD 4XT3B 1VQEA 4KHPL 5CYUA 1PXUA 3S1QH 1E0BA 1W6KA 2XN9C 4RG1A 5DM63 1HZCA 2CHBD 5FLXc 4H13C 5C3EH 2ZXPA 4BY1H 3UDFA 2KCMA 1H9SA 4YWMA 2Q8RE 3MEFA 3HOZH 1W3SA 1D2BA 1VDZA 1Y1VH 3TDQA 5EBCA 5CV6A 3J81j 4GKKL 5KYIA 3W5OA 1C9OA 1LTAD 1R4QB 2KQ3A 3I7FA 2A74C 3VR2A 1V1PB 2K1BA 3HOZG 4QF4A 1IYJB 2JP1A 4A3GH 4EX5A 4RMFA 1YBYA 4BY1G 1JOQA 4QGUA 1DXMA 2ZTCA 4DK1A 3V05A 1EQRA 2F0QA 1NR4A 1K8GA 4EGVA 3CKIB 1AEXA 3DM1A 4A3BG 2IW3A 2WACA 4HJ8A 3EIVA 1K83H 4LFCQ 2JA5G 5IIFA 1B70B 1FJGL 4A3FH 4DR7Q 2MHVA 4RFBA 4DU9A 4IFDG 3FKIG 4JW0A 2R92B 4YHHL 2QCPX 2DJGC 1S5DD 1L0XB 5M9OA 4JC0A 1NMFA 4IUUA 4QQBX 2KCNA 4DV3Q 1KAAA 4IJLA 4A3JG 2P5ZX 3X3NA 3S2HH 4H0LC 1EWIA 4JOIC 1Z6HA 2WB1G 3Q0AA 3GTLH 1YJ9A 1U9RA 2F4IA 2IPKD 1CTMA 2E75C 3OSOA 1TS4A 1II3A 2OTLA 3NBHA 5C5MA 5IYDH 3E0JA 4PMBA 4RGOS 5I2YA 3FMCA 4O1NA 2I5HA 2RDGA 2MO0A 1E1OA 2MUYA 5EPLA 3TEHB 1EWHA 3MXNA 5A2QL 4DAVA 3U9SA 3H6MA 4KJOA 4OO1G 1EYDA 3T51B 3CCLA 4UY8C 3S1RB 3HEJA 1VQ8A 3UI2A 5LL6X 2EOTA 3VA7A 4RA8A 2MPMA 1ICWA 4TQUS 4HSPA 3GDEA 3NEMA 4OIKA 3CMAA 4OO1I 3STBC 1I4GA 4B3SL 1CI3M 2HDMA 5E3FA 3TP7A 1KRSA 2V1CC 3I4OA 5JEAG 1NBWA 3DWQA 3DUZA 1MKHA 4FP5D 2PO4A 4HJ5A 5M3FH 2Q2IA 3GO5A 1PTOH 5DM73 2XRQD 1S5ED 2PMZB 3X3MA 1ENAA 5J1ZA 4GN5A 1STBA 3D6CA 3MTSA 4DUYL 2JA7H 5IYCH 2NVTH 1SJHD 2A6HD 4AH6A 2SEBD 3E0EA 1K8MA 4GOPA 3HOVG 4NXNQ
chains in the Genus database with same CATH topology
2RBMA 3G6JB 3CU7A 3OMCA 1QB5D 1VCIA 3PV0A 4KHZA 2JEAI 3PIO3 2F0VA 3FKIB 4K5WA 4KI0A 4G4KA 2EPBA 3SR1A 3M7NA 4TRDA 4BWGB 1H9KA 4ZK9B 3U9OA 5C0XJ 3D6WA 4JBWA 5ELCA 2D62A 2F0GA 3FDTA 1DOMA 4MIUA 1DONA 2EJGC 1JWMD 3RMHA 3BYTB 1HA6A 1D5ZC 2ICEC 2L11A 2A69D 4IURA 1V43A 5F2DA 3M4OB 3KLSX 5D65A 4RKLA 3VYUA 4WFN3 4IQZA 2AUJD 4K14A 4HMIA 1ESRA 2BDOA 3BYYB 1JWSD 3GTLB 4KY6A 2QILA 2XIWA 2EYFA 4ZKCB 2EYJA 1I4QA 5KRUA 3T56B 3PUXA 4XTCS 2F0OA 2IJ0A 1DCZA 1SYEA 1F2ZA 4X3TA 3AU7A 3LX0A 4A3FB 1EFID 4J8QA 3VR6A 1CM9A 2OEOA 3I70A 3TMEA 4TSSA 1KDBA 2EY5A 3SHLA 1WTPA 2AQ1B 5C0XI 1KDAA 4RGNA 5TSSA 2XWJB 4LAAA 2XVSA 1Y1VB 1D1KA 1HTLD 2N88A 3HOZB 2K7VA 1PDQA 4BY1B 3D4RA 3MXPA 2F3VA 5KNCA 1E2WA 3GV3A 1R9TB 2RQXA 5HGTA 1WTWA 1K8OA 1EEID 5LL6S 3QOLA 5C4ZA 1BDOA 3S1QB 1GUGA 2PW7A 4K8IA 1SE2A 2XWBB 2FINB 4KKSA 3TP5A 2F0WA 3A7AB 1G6ZA 3PMFA 2XRSD 4QUFA 2CW0D 1HQRD 1SMYD 3BVMA 4KK7A 2JA8B 2PYKA 1D5MC 3GTPB 2NN6I 1BBXC 4U68A 1TS2A 1NCVA 3BDOA 3P75A 3GTOB 2F0NA 3S16B 1BQQT 1R4PB 2X6GA 4F7XA 2E2DC 2X6LA 4A3BB 4BBSB 1T5EA 4ZUJA 2RDFA 1M8AA 1EZ6A 2B2YA 4EQPA 1OXSC 1KABA 1KLGD 2Z4IA 1LO5D 3O13A 2NVXB 4E6IA 2K33A 3PO2B 4PV1C 5C6AA 1EYAA 2PZTA 2XSCA 1LLRD 4KN4C 1HXYD 2NVYB 4XQNA 1LTSD 5EQ0A 1HPCA 2K5WA 1TWHB 2KVMA 4IFDI 2K03A 1FGBD 2QF7A 2RVLA 4IUPA 5FO9B 2EE1A 3C3LA 3H0GB 1I4PA 2E76C 2VB2X 4ULLA 3K0YA 4LMQD 1QJOA 5KEEA 4FXKC 4P2CB 2ID0A 5CMDA 3DEOA 4N9TA 1TY0A 1Y1WB 3C46A 2EYLA 2EY2A 4FXDA 1PTOF 4RCNA 2K05A 2A68D 4ZLTF 4RH6A 1I4RA 2EY1A 1KLUD 2F0EA 3TZDA 1ET9A 1TR5A 4FYDA 1A3TA 4B9XA 1QILA 3NWTA 5CBAE 3AMUA 2IX0A 3BDCA 2H1EA 2IWHA 4G7OC 1EY8A 1G2TA 1RF2D 2A6ED 2R3ZA 4KY5A 3KLRA 3M4YA 1HQMC 4RHSA 5M3MB 1STAA 4U673 1EL0A 2RSNA 3MVVA 4RAUC 2F0TA 2NYZD 1U4RA 2C9OA 4RHRA 2B8FA 3T4AC 1B53A 3L7ZC 1JQYD 4OL7A 2N55A 5DEHA 1JB3A 1LT4D 3GQBA 1HUMA 3FEWX 4R8NA 3CHBD 1H9JA 3OOCA 4XQQA 1SE3A 3HS0C 3IFTA 2Q8TA 3NK9A 1Y8NB 5I4DA 4RGMA 1ENCA 1MBYA 5E4XA 5C3XA 4J6HA 4M1UB 3IFDA 1FR3A 1X3QA 1CA6A 5IOCA 2F1MA 4CJ2C 1EIHA 5CV5A 5KNDA 3S14B 3I4NB 1SXTA 4F8MA 3JAME 2NUCA 3J7AV 1S5CD 4ID6A 2ZXRA 1DM0B 1EY5A 2MGSA 3D8GA 4NW2A 3BVGA 4IFDJ 2NTTA 3K5MA 2RA4A 1PRTF 1LTID 5J22A 3ND8A 4KHVA 1VF7A 4OGQC 3QB3A 3VYSA 1A15A 1AN8A 2D9UA 3SK8A 1PRTD 3BG3A 1ZEQX 3P1HA 3Q6SA 1CHPD 2B2TA 2VUMB 3HOYB 1OXTA 2EY6A 1F2MA 2KUMA 5BN3A 1GJXA 4S3SA 1IKLA 1SNPA 4KKTA 3I4MB 1TU2B 4RCOA 3QJYA 1QCBD 1F9RA 5A35A 2Y0SB 5BN4A 4X3SA 1STHA 4I7ZC 3A55A 5FO8B 1I50B 4G57A 4L6TB 2NVQB 1DZ1A 4K6DA 4QUCA 4Q0FA 1WCMB 3HOWB 1TWFB 4NMZA 1UNSA 2QDBA 5IGBA 2KA7A 3MA2B 2X69A 1EOTA 1PLFA 2L0CA 4CJ0B 4A3IB 3GTJB 2F0SA 4HTHA 4ZYSA 1IYVA 5T1IA 1LV9A 2WV6D 1V1PA 3VYTA 1CZGA 2WAQB 1C8CA 5JAVA 1B9NA 3OMGA 4DN4M 1OXXK 3DMUA 3T53B 1O78A 3NQIA 2HUGA 2JEBI 2F03A 2A6EC 3M7GA 1SYBA 4A3JB 4BS9A 2JXMB 1Z7TA 4PMCA 4C3JB 4RWSC 1F9QA 4HCEA 4XIGS 1O80A 2B2VC 2ZT9C 1ONLA 4LJZC 3IKJA 2B2WC 1YNJD 4CKEA 1J8IA 1TT2A 3A56A 4ZUIA 1UAPA 3ITPA 2E2JB 1STNA 2J4XA 5M5YB 2PCFB 5C4HA 3J80L 4ZAIA 5FLXL 3V96A 4CGYB 2PZWA 4OIJA 5EKIA 1BNZA 1LT5D 5K36G 1V8QA 2K04A 5KYLA 2CQAA 4DFAA 4B9WA 3I3CA 1BUVT 4CHTB 2KCCA 2PW5A 5IODA 1B50A 3L9AX 1PFMA 1JICA 2A68C 5CV4A 3H94A 4GZYC 1TWCB 1B4OA 1EY4A 1QE6A 2NVTB 4IUTA 5IT9L 3D3RA 4DK0A 1PTOB 5M3FB 1JC7A 5J39A 1HHVA 4WORA 5CR3A 1EIGA 2K5DA 2JE6I 1Q1BA 2D2CC 1MD2D 1I3QB 1CK1A 1HTPA 1WTRA 3T16A 3A8KE 2AUKA 2Q8IB 4BY7B 1B2TA 2OXPA 1F9PA 4CBVA 2OT2A 4BA1I 5I6YA 4C1NI 5CV9A 4C1NK 2R6GA 3VR5A 3FPPA 3HKZB 2B2TC 1QOHA 3MZ5A 1EQVA 1U4PA 3S2HB 2RDHA 3PO3B 4HCSA 1GOZA 1CQVA 1L0YB 5EKLA 3AB9A 2CW0C 3L3OC 1GUWA 3KUPA 5G3LD 2EDGA 2AQ3B 2VB3X 5DNFA 1KNEA 1E2ZA 2AWOA 4C56C 5E1FA 3S17B 2AQ2B 1SEBD 1ZKOA 2K5QA 1CFMA 4BBRB 1Q3LA 4K6LA 1ZYRC 2WIIB 4DXFA 3P7JA 3K59A 1B1ZA 4MN3A 1Q1EA 3PIP3 1ILQA 3HOXB 1EYCA 1H9RA 2F3WA 3I72A 4M8AA 4CKCA 4FXGC 3P20A 4FF4A 4X3UA 2E2IB 4V0BA 1MGSA 3S1MB 1TKWB 3VR4A 4PQXA 3LNNA 1PTOC 2C5CA 1CT1D 3F2UA 1RJTA 2J7ZA 5CORA 2B2WA 5EPKA 4KN7C 3PUWA 3OWFA 1AZPA 2G9DA 2NB0A 3EQLC 1NR2A 3BS1A 4L63B 4F87A 1GUTA 4C3HB 1JR0D 4EQOA 1TQOA 1EU3A 2GA4B 1VMCA 4PMWA 4X3KA 3N6RA 3K57A 3HOUB 1CA5A 3D4WA 2VNUD 1LTTD 2K32A 3SVMA 1VMPA 4EQNA 1EY0A 5IT9E 3DXJC 3NWSA 2SNSA 3GD7A 1OXVA 3D4DA 2HQEA 5A2QE 3FVQA 1QG7A 1ESFA 4L8JA 2XNAC 3OPOA 1MI2A 3MHBA 3E5SA 1RHPA 1IW7C 5FLXE 3GTQB 1SSOA 5C44B 5D14A 2VXWA 5C0XH 1D1IA 1GUNA 1ZYRD 1PMRA 2B8GA 1ILPA 5T1GA 3LWEA 1D5XC 2KHSA 5IGEA 3DWPA 2MJ8A 5IGGA 1S5FD 3R2TA 5EPJA 4CJ1B 5D3DA 2EYMA 3EJIA 2EYHA 2I46A 3RUZA 4DNRB 1BF4A 2WKCA 1HA5A 2F0FA 4C3HG 5KIXA 1FNVA 1LTGD 3NTKA 1XTCD 1OO9B 3SK6A 1XWEA 1M4VA 3HZXA 4IN3A 4A3EB 3WDNA 1G91A 3K6OA 3PUYA 3J81L 1SNCA 3NHHA 4A3KB 3GV6A 3ZYYX 3SK4A 1UEAB 2EVBA 1Y69U 2M00A 2F0HA 4C3JG 5FKAC 3OIPA 2BA0A 5EBDA 4J1MA 1EQTA 4QCLA 4F88A 2O4XA 2MP1A 3EFXD 2NWGA 3K5LA 3K5OA 3FRPB 3MXGA 4ILWA 3G7LA 2O2LD 2SOBA 5K36H 3JAML 2PPBC 3MXUA 4G7ZC 1LABA 3MFYA 2F0LA 5CGKA 1RD9D 1SE4A 4XQJA 1JCKB 1F9SA 2PZUA 3A54A 4QIWB 5EGTA 2F0KA 3BZDB 2B2UC 1XXGA 2JA6B 4H44C 3HOVB 3S1NB 1A6XA 5I6WA 5HURA 3RZDB 3KLSA 2B39A 2KEDA 1F2YA 3HGBA 4A93B 1A3UA 5COYA 2F0MA 2F0DA 5CBEE 2EYOA 4ZKBB 4C2MB 1BCPF 1MSHA 1B9MA 5JEAH 3TP8A 3EVQA 5KNBA 3RLFA 1HCZA 1TY2A 3D31A 1NAPA 3MC0B 3NTIA 3QIAA 2G9HD 1DYQA 3QWNA 5M5XB 5C4XB 5CC4A 1B44D 2JSOA 4NDXA 5ELBA 4IUNA 4FVMA 1A2UA 3MEHA 1WTVA 3S9WA 3C2PA 1JORA 1D6EC 2A69C 1O7ZA 5K5PA 1AZQA 1KTKA 2Z8LA 1J9OA 1O7YA 2ENBA 1TWAB 2SDFA 1RTNA 3VR3A 2SNMA 4IALA 3SK5A 2JYOA 3NUCA 2EYPA 3VYRA 1OXUA 3J81E 4EVOA 3NP8A 1NSNS 3GP7A 1HFGA 3SDZA 2OF1A 4A3MB 2F0UA 4RKBA 1PRTC 2CVRA 3KBGA 5ISRA 2BA1A 4FF1A 2B2YC 1SNOA 1BXTA 5G3LF 4DNTB 4MHEA 3GTKB 3NPPA 2A6HC 3NQTA 1SMYC 1A3VA 1PZKD 4NP5A 1SAPA 3BDLA 2EJFC 1STEA 3E6ZX 2F0PA 1RTOA 3QOJA 2IX1A 2FMMA 1U4LA 3K5NA 3SXHA 1FNWA 1I6VC 4FO2A 2R61A 3TN2A 4YIJA 5I9OA 1Y8PB 1STGA 4WRDA 2LFNA 3R93A 1SDFA 4XT1B 1X32A 3A7LA 1SYGA 4K5XA 1Q12A 3I73A 5FK9C 2NTSA 3S15B 1BOSA 1SNQA 5JJZA 3Q23A 1JE4A 2WKDA 1PYWD 4KMUC 1A2TA 4HAEA 3TBIB 4KV6A 2B2UA 3R2IA 4UDUC 4XYOA 1WD1A 4C3IG 1LTRD 2BOSA 4DAPA 2I07B 5EKKA 4HN7A 4K2KA 3M3YB 1C48A 1WTQA 1I4XA 4K5VA 5JOBA 1TS5A 1Y8OB 4ME5A 4OO1H 1W6JA 1PTOD 3FPUB 3C1EA 3T13A 2ICIA 5NUCA 1T5XD 1SFOB 3IAYA 5DAUA 5FOBB 5JPMC 2E2HB 2B63B 2DN8A 5E4WC 4JK1C 3MFGA 4BA2I 4Z9CB 2YU9B 3SE0A 3NXWA 2BE5C 2QKIC 3DEPA 1GXDC 3S2DB 1YNND 4O42A 3QG1A 2YYZA 1NUCA 3WOEA 4TKOB 2EXZA 4IUQA 1TVXA 5FO7B 1Z47A 1CHQD 3RD4A 5ELDA 4C3IB 2F0JA 1IKMA 1ZXTA 3ERQA 3K7AB 3W2DA 2FJ2A 1C4QA 1TS3A 2WB1B 3A8JE 5JPNC 2L55A 5JEAJ 2JA7B 2KEEA 3NTHA 4ABNA 4KTAA 5LHY1 1HRJA 3VA5A 1FYCA 1WD0A 3KK7A 2WP8J 3CQZB 2M9VA 3EROA 2A73B 3WOFA 4HR7B 2IT1A 3W3AA 3N52A 2LKVA 4IUVA 3H3VC 1SYDA 2EZVA 1SNDA 2NN6G 1DOKA 5I9PA 4FNFA 1PZJD 1Q90A 1JOOA 3BVZA 1AW7A 3PUVA 4DF7A 1QWYA 5D3IB 1AP0A 1TIID 4XDXA 1BCPB 4WJWA 1UUPA 4HSVA 2KOLA 1STYA 1O7LA 3Q22A 3TZUA 1SBBB 5ELFA 1IYUA 2L4NA 1EY6A 1BCPD 2RSOA 1GHKA 3DWAA 4R9WA 2TSSA 4DA2A 4OHJA 3KF8A 3CRLC 2M2LA 1K83B 1ET6A 1F2LA 5M5WB 1IW7D 5BN5A 1WTXA 2NBFA 2ZXOA 2BE5D 4DGZA 4A3GB 2O5JC 2KJXA 4AYBB 2D5DA 1HUNA 1WTOA 1QNKA 3TP6A 1EY9A 5C4JB 2PNRC 2Z1CA 1G2SA 1I4HA 5C3EB 4V190 3Q24A 5IGDA 1EWCA 3I91A 1DJRD 1G291 3H09A 4XXEA 3J7YW 2QEJC 3GTMB 1IHZA 5ELEA 1YNNC 1Q8IA 1YNJC 2K28A 3ND9A 4IZ8A 1PRTB 1LT6D 1RKNA 3I8ZA 4PNYA 4ZQ3A 2A5HA 1H9SB 5I2XA 3I90A 2K6AA 1GUOA 3R8BA 4DXGA 2O5IC 1ML0D 2HCIA 3I4LA 1B3AA 1CQFA 3DHQA 3NE5B 2NZ1D 1FNUA 3SEBA 5CV7A 2LS01 4ZRZA 5C3WA 3NBIA 2DNCA 3V2TA 1HFNA 3PUZA 1ENFA 1EEFD 1EY7A 1RCVD 1WVLA 5IGCA 3RZOB 3OW7A 4DAYA 4K2LA 1JOKA 2NN6H 4G7HC 3A8IE 1FD7D 2EJMA 1KDCA 1SNMA 3MWYW 4QMGA 4CKBA 1PFBA 5C5LA 1GUSA 4H7BA 1RODA 1SYFA 3J80E 1DOLA 3ONAB 2RKSA 1I6HB 1PZID 4FF3A 3IL8A 3HG9A 3HRZC 4R8IA 1SJED 2LMCB 5JVH3 2PQEA 4QB4A 2V4DA 1SYCA 5EJWA 4FF2A 2L5TA 5IGFA 3C1FA 1JWUD 2LY7A 1EZ8A 1AFPA 2BCOA 4HEDA 1BO0A 4XYQA 3EA6A 4LK1C 4K8JA 1X3PA 2DY8A 2K01A 1XX8A 1BR9A 2DY7A 1S5BD 1LTBD 4Y7NB 1U4MA 4N9PA 1BCPC 3H91A 1IL8A 3TSSA 3OIQA 3QO2A 3GTGB 4A3DB 1VF5C 4KKUA 2FMCA 4I65A 2IX3A 2L1BA 1V1OA 4HMJA 3URYA 2R7ZB 4RGTA 3KBXA 4KJNA 2H4OA 3K58A 4KD4A 3NSWA 2FFKB 5KGUA 2AWNA 1S4ZA 1DD2A 2HDLA 2L9HA 1XYIA 3LWUA 2BDNA 1E2VA 1MSGA 2WINB 4Q5VA 3CRKC 2IL8A 3HP3A 3OWEB 2L12A 2F0IA 3OHXC 1LT3D 4B08A 1EU4A 4ODGA 4UAIA 1TWGB 5C0XG 1F77A 2TMPA 1GHJA 3R3OA 2Z4HA 1QNUA 2FHTA 4KD3A 1CZWA 5JVG3 4KY7A 4NKLA 2J0TD 2DNEA 1KNAA 2R93B 2JA5B 3M85A 1G8ZD 5CV8A 1PFNA 3MAQA 1LACA 4IFDH 2HCCA 1H9MA 3J7AF 2KECA 2E74C 5AFWA 2B2VA 1RDPD 4XT3B 5CYUA 1PXUA 1E0BA 1W6KA 2XN9C 5DM63 2CHBD 4H13C 2ZXPA 1H9SA 2Q8RE 1D2BA 1VDZA 3TDQA 5EBCA 5CV6A 5KYIA 1LTAD 1R4QB 2KQ3A 2A74C 3VR2A 1V1PB 2K1BA 4QF4A 2JP1A 1JOQA 1DXMA 4DK1A 3V05A 2F0QA 1NR4A 4EGVA 3CKIB 1AEXA 3DM1A 2IW3A 2WACA 5IIFA 2MHVA 4RFBA 4DU9A 4IFDG 2R92B 2QCPX 1S5DD 1L0XB 5M9OA 4IUUA 2KCNA 1KAAA 3X3NA 4H0LC 1Z6HA 3Q0AA 1U9RA 2F4IA 2IPKD 1CTMA 2E75C 3OSOA 1TS4A 1II3A 3NBHA 5C5MA 3E0JA 4PMBA 4RGOS 5I2YA 3FMCA 4O1NA 2RDGA 5EPLA 2MUYA 1EWHA 3MXNA 5A2QL 4DAVA 3U9SA 3H6MA 4KJOA 4OO1G 1EYDA 3T51B 3S1RB 3HEJA 3UI2A 5LL6X 2EOTA 3VA7A 4RA8A 2MPMA 1ICWA 4TQUS 4HSPA 4OIKA 4OO1I 1I4GA 1CI3M 2HDMA 5E3FA 3TP7A 5JEAG 3DWQA 3DUZA 4FP5D 2PO4A 3GO5A 1PTOH 5DM73 2XRQD 1S5ED 2PMZB 3X3MA 1ENAA 5J1ZA 1STBA 3D6CA 3MTSA 1SJHD 2A6HD 2SEBD 1K8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9R A;  1HFN A;  4HCS A;  2JP1 A;  4HSV A;  5EQ0 A;  1VMC A;  2KOL A;  2Q8T A;  3KBX A;  4ZAI A;  1SAP A;  1GUW A;  2KED A;  4X3K A;  3KUP A;  3DEP A;  2FFK B;  1WVL A;  1NR4 A;  4X3S A;  5COY A;  2N88 A;  2KVM A;  4OIJ A;  4O42 A;  5EKI A;  3DM1 A;  5CBE E;  2L4N A;  5DNF A;  1BNZ A;  1PDQ A;  2K03 A;  5E4X A;  2EPB A;  4ZKB B;  1S4Z A;  1CA5 A;  1RTO A;  2K04 A;  3IFD A;  1MSH A;  2RSO A;  2HDL A;  2FMM A;  1KNE A;  2L9H A;  1U4L A;  2RVL A;  1X3Q A;  4IUP A;  3I3C A;  4R9W A;  1XYI A;  1CA6 A;  2BDN A;  4ZK9 B;  3GV3 A;  4QUC A;  1WTW A;  2EE1 A;  1G91 A;  2M2L A;  4CJ2 C;  3SVM A;  1VMP A;  4IUQ A;  3D6W A;  1MSG A;  3MWY W;  1TVX A;  1PFB A;  1F2L A;  1NAP A;  4LMQ D;  2IL8 A;  3HP3 A;  1B50 A;  1EIH A;  3TN2 A;  2L12 A;  2FIN B;  1ROD A;  3FDT A;  1PFM A;  3GV6 A;  1WTX A;  1IKM A;  1G6Z A;  1ZXT A;  1DOL A;  1Q3L A;  1JIC A;  3ONA B;  1DOM A;  4IUU A;  4QUF A;  1DON A;  5CMD A;  2FJ2 A;  3DEO A;  3R93 A;  1SDF A;  4UAI A;  1B4O A;  3IL8 A;  3P7J A;  1HUN A;  4XT1 B;  1X32 A;  1QE6 A;  4R8I A;  1WTO A;  1HA6 A;  1QNK A;  1BBX C;  1WTV A;  1QG7 A;  4U68 A;  2FHT A;  2K05 A;  1EOT A;  2X69 A;  4MN3 A;  4IUT A;  1PLF A;  2MGS A;  1NCV A;  2KEE A;  4ZLT F;  2L11 A;  1MI2 A;  1AZQ A;  1O7Z A;  4IUR A;  4CJ0 B;  4NW2 A;  5EJW A;  3TZD A;  1KNA A;  1RHP A;  1DZ1 A;  1ILQ A;  1G2S A;  5D65 A;  1HRJ A;  1SSO A;  1J9O A;  1O7Y A;  5JJZ A;  5D14 A;  1WD0 A;  1EQT A;  1ESR A;  1HHV A;  1JE4 A;  5CBA E;  5EPL A;  2VXW A;  1EIG A;  2X6G A;  2RA4 A;  4HED A;  2SDF A;  1RTN A;  2H1E A;  1LV9 A;  1BO0 A;  2MP1 A;  3I91 A;  5T1I A;  4HAE A;  1PFN A;  4X3U A;  2XIW A;  1X3P A;  2NWG A;  1C8C A;  1MGS A;  2DY8 A;  2X6L A;  1G2T A;  1ILP A;  2K01 A;  2B2U A;  1WTR A;  1XX8 A;  4ZKC B;  5T1G A;  2R3Z A;  2HCC A;  2JYO A;  3LWE A;  4DN4 M;  2K28 A;  1A15 A;  2KEC A;  1WD1 A;  3UI2 A;  2D9U A;  2EOT A;  5AFW A;  3I8Z A;  4RA8 A;  2B2V A;  2MJ8 A;  2MPM A;  2DY7 A;  3N52 A;  3G7L A;  1ICW A;  1M8A A;  2HUG A;  4IUV A;  4XT3 B;  3F2U A;  1RJT A;  3Q6S A;  3I90 A;  4OIK A;  1B2T A;  1E0B A;  2J7Z A;  1F9P A;  2B2T A;  4X3T A;  2HDM A;  2B2Y A;  5COR A;  1HFG A;  1WTQ A;  1U4M A;  1ML0 D;  2B2W A;  1EL0 A;  2RSN A;  2HCI A;  5EPK A;  4RAU C;  3H91 A;  5EPJ A;  1IL8 A;  1F9Q A;  1DOK A;  4RWS C;  4CJ1 B;  1CM9 A;  1U4R A;  2NYZ D;  1AZP A;  2KUM A;  1B3A A;  1F9S A;  1O80 A;  2CVR A;  2Q8R E;  1B53 A;  2B2V C;  3QO2 A;  1NR2 A;  1IKL A;  2B2W C;  3FPU B;  2B2T C;  2B2Y C;  2NZ1 D;  2N55 A;  3MTS A;  1BF4 A;  1AP0 A;  2B2U C;  1J8I A;  2L1B A;  1WTP A;  1HUM A;  4XDX A;  1U4P A;  4MHE A;  5E4W C;  2K1B A; 
#chains in the Genus database with same CATH topology
 2RBM A;  3G6J B;  3CU7 A;  3OMC A;  2HHH L;  3K7A H;  3K8A A;  1QB5 D;  1VCI A;  3PV0 A;  4KHZ A;  2B29 A;  4DV0 Q;  2JEA I;  2F4V Q;  3PIO 3;  2F0V A;  1KAW A;  3FKI B;  4K5W A;  4KI0 A;  4G4K A;  2EPB A;  3SR1 A;  3M7N A;  4TRD A;  4BWG B;  1VQI A;  4GS3 A;  1H9K A;  4A3F G;  4JBM A;  1PFS A;  1X54 A;  4ZK9 B;  3DLL A;  3U9O A;  5C0X J;  3D6W A;  4K0K Q;  4JBW A;  5ELC A;  2D62 A;  2RHQ B;  2F0G A;  3FDT A;  3A5Z B;  3D0F A;  5GRO A;  1DOM A;  2XTI A;  3CAM A;  4MIU A;  3QR8 A;  4LUO A;  2VQE Q;  2EJG C;  1DON A;  1XNQ Q;  3BZK A;  1JWM D;  3RMH A;  1NMG A;  2PNH A;  3BYT B;  4PG3 A;  4JBJ A;  1HA6 A;  2BH8 A;  1D5Z C;  3RLO A;  2ICE C;  2L11 A;  1X3F A;  2A69 D;  4IUR A;  1V43 A;  5F2D A;  3CPF A;  3M4O B;  3KLS X;  3HKZ G;  5D65 A;  4RKL A;  3VYU A;  4WFN 3;  4IQZ A;  2AUJ D;  4K14 A;  1CSP A;  4HMI A;  1ESR A;  2BDO A;  4C3J H;  3BYY B;  1JWS D;  3GTL B;  4KY6 A;  2QIL A;  4CDD C;  3U4V A;  1IBL Q;  2XIW A;  2EYF A;  4O2D A;  1N32 L;  4ZKC B;  5M3M G;  3CP0 A;  4JI2 Q;  2EYJ A;  1I4Q A;  5KRU A;  3T56 B;  1K3B C;  3PUX A;  4XTC S;  3RLN A;  2F0O A;  2IJ0 A;  4L5Q A;  2WAQ G;  2K50 A;  3NBH B;  1DCZ A;  2R92 H;  1SYE A;  1F2Z A;  4X3T A;  3AU7 A;  3LX0 A;  4A3F B;  2JA8 G;  1EFI D;  1N33 Q;  4J8Q A;  1VQ6 A;  2HIX A;  3VR6 A;  1CM9 A;  2OEO A;  3I70 A;  4IPG A;  3TME A;  4DV0 L;  4TSS A;  4DK6 C;  1KDB A;  4A93 H;  2EY5 A;  3KFU A;  2RHS B;  3SHL A;  2K52 A;  4GN4 B;  4R1J A;  1WTP A;  2AQ1 B;  2A8V A;  2PI2 E;  4LF8 L;  1RL2 A;  5C0X I;  1KDA A;  4K0K L;  1PYS B;  4RGN A;  5TSS A;  3BZC A;  2XWJ B;  4LAA A;  4QJF A;  2XVS A;  1Y1V B;  1D1K A;  1HTL D;  4DR3 Q;  1A0I A;  2N88 A;  4B3T Q;  3HOZ B;  4A4I A;  2K7V A;  1PDQ A;  4BY1 B;  4LFA L;  3D4R A;  3MXP A;  2DGY A;  2F3V A;  1PVO A;  4Y52 H;  5KNC A;  2K4K A;  2HD3 A;  2NVQ H;  1E2W A;  3GV3 A;  1WTW A;  2RQX A;  5HGT A;  3U4Z A;  1R9T B;  1K8O A;  2PI2 A;  1EEI D;  5LL6 S;  3QOL A;  5C4Z A;  1BDO A;  3S1Q B;  1GUG A;  1TXY A;  2PW7 A;  4K8I A;  1SE2 A;  2XWB B;  2FIN B;  4KKS A;  3TP5 A;  2F0W A;  3A7A B;  1G6Z A;  3PMF A;  2XRS D;  3H0G G;  4KLK A;  1RIP A;  4QUF A;  2CW0 D;  4DR1 L;  1HQR D;  4OEM B;  2CWA A;  1SMY D;  3BVM A;  4KK7 A;  2JA8 B;  2PYK A;  1D5M C;  3GTP B;  2NN6 I;  1BBX C;  4U68 A;  1TS2 A;  1NCV A;  3BDO A;  3P75 A;  3GTO B;  3G4S A;  1N8R C;  2F0N A;  3K80 C;  3S16 B;  4A3M H;  1BQQ T;  1R4P B;  2CWP A;  2X6G A;  4F7X A;  4OON A;  2E2D C;  3K7U C;  2X6L A;  4A3B B;  1L1O C;  1IBM L;  4BBS B;  2BH2 A;  4B3R L;  1T5E A;  4ZUJ A;  2RDF A;  2UXD L;  4A3K H;  1M8A A;  1EZ6 A;  5GAE C;  2E8G A;  2B2Y A;  4EQP A;  4DR2 L;  1Y1W G;  4A3E H;  1OXS C;  4A3L H;  1KAB A;  4X62 L;  5JJI A;  1KRT A;  4NXM Q;  4LF5 L;  1KLG D;  1XMO Q;  2Z4I A;  1LO5 D;  3O13 A;  2NVX B;  4E6I A;  1VQB A;  4A3D G;  3G6E A;  3A0J A;  2K33 A;  3PO2 B;  4PV1 C;  1VQD A;  5C6A A;  1EYA A;  2PZT A;  2XSC A;  1LLR D;  4KN4 C;  2JA6 G;  1HXY D;  4L5S A;  4UP8 A;  4QL5 A;  2NVY B;  4XQN A;  5DLQ E;  1LTS D;  5EQ0 A;  1FJG Q;  1BBW A;  2GVB A;  1HPC A;  2K5W A;  3S14 H;  2UU9 L;  1TWH B;  1WFQ A;  4YCW A;  3GTG H;  4LF6 Q;  2KVM A;  4JI1 L;  4IFD I;  2K03 A;  1FGB D;  3RNU A;  2QF7 A;  4POF A;  2RVL A;  1E22 A;  4IUP A;  1GM5 A;  3HFZ B;  1SRO A;  5FO9 B;  2EE1 A;  5JJL A;  3C3L A;  3H0G B;  2ASB A;  1I4P A;  3AFP A;  5IP9 H;  2E76 C;  2VB2 X;  2MO1 A;  4ULL A;  3K0Y A;  4LMQ D;  1QJO A;  4HIO A;  2WAQ E;  5KEE A;  4DV1 L;  4FXK C;  4P2C B;  2ID0 A;  2N78 A;  5CMD A;  3DEO A;  3EBE A;  3S1N H;  4N9T A;  1TY0 A;  1Y1W B;  3C46 A;  2EYL A;  2EY2 A;  4FXD A;  1PTO F;  1YJW A;  2GN5 A;  4RCN A;  2K05 A;  2HT1 A;  1LTL A;  2A68 D;  3CCV A;  4ZLT F;  4RH6 A;  1LYL A;  1I4R A;  2EY1 A;  2NZO A;  1KLU D;  3HKZ E;  2R7F A;  2F0E A;  3TZD A;  1ET9 A;  1TR5 A;  2K5N A;  1MIU A;  4FYD A;  4JI3 L;  1A3T A;  1NJI C;  1HZA A;  2I5L X;  4B9X A;  1QIL A;  3NWT A;  5CBA E;  3AMU A;  2IX0 A;  3BDC A;  4JCV E;  4AIM A;  2H1E A;  1T9H A;  2IWH A;  4G7O C;  1EY8 A;  1G2T A;  1RF2 D;  2A6E D;  3E3X A;  2R3Z A;  4KY5 A;  3KLR A;  3M4Y A;  1UE6 A;  1HQM C;  1L2F A;  1EYG A;  4RHS A;  3KF6 A;  5M3M B;  1STA A;  4U67 3;  4JPB W;  1EL0 A;  2RSN A;  1YHA A;  3MVV A;  4RAU C;  4PZ6 A;  2F0T A;  2NYZ D;  1U4R A;  2C9O A;  4RHR A;  2B8F A;  3T4A C;  1B53 A;  1VQK A;  3L7Z C;  1JQY D;  4OL7 A;  5FLM G;  4ALP A;  2N55 A;  4JOI A;  5DEH A;  1JB3 A;  3CCM A;  1LT4 D;  3GQB A;  1HUM A;  3FEW X;  4JI3 Q;  4R8N A;  4GKJ L;  3CHB D;  4ME3 A;  1H9J A;  5J3B A;  4DV1 Q;  3OOC A;  4XQQ A;  3M4P A;  1SE3 A;  3HS0 C;  3IFT A;  2Q8T A;  4JI6 L;  2IHF A;  2ALY B;  3NK9 A;  1Y8N B;  4IPH A;  1V9P A;  4LFA Q;  5I4D A;  4DUY Q;  4RGM A;  1ENC A;  1MBY A;  5E4X A;  5C3X A;  1HNZ Q;  1YZ6 A;  4J6H A;  4M1U B;  3IFD A;  1FR3 A;  4GLA C;  1X3Q A;  1CA6 A;  1L0W A;  5IOC A;  2F1M A;  3CC7 A;  4CJ2 C;  1YNX A;  4R4T A;  2UUB L;  3OTO Q;  3M4Q A;  2QGQ A;  1EIH A;  3OTO L;  5CV5 A;  1EOV A;  2VUM G;  1IZ6 A;  1D8L A;  5KND A;  2IY5 B;  1TWH H;  3S14 B;  3I4N B;  5GQO A;  1SXT A;  1XNR Q;  1VQJ A;  2E2I H;  4F8M A;  4LFB Q;  3JAM E;  2NUC A;  3J7A V;  4JI4 Q;  1S5C D;  4ID6 A;  4CDE C;  2ZXR A;  1B7Y B;  1DM0 B;  1EY5 A;  3PO2 H;  2MGS A;  2PQA B;  3HOX H;  3J7A 5;  3D8G A;  4NW2 A;  2NVX H;  3BVG A;  4IFD J;  2NTT A;  3K5M A;  2RA4 A;  1PRT F;  1VQL A;  2ATW A;  1LTI D;  5J22 A;  5FJ8 G;  3ND8 A;  4KHV A;  3UDI A;  2QA4 A;  3PO3 G;  4GOP B;  2N8N A;  4OWW B;  1EFW A;  2KHJ A;  1VF7 A;  4OGQ C;  3QB3 A;  3VYS A;  1A15 A;  1AN8 A;  2D9U A;  1GD7 A;  3SK8 A;  1PRT D;  3BG3 A;  4DR2 Q;  4DV6 Q;  1ZEQ X;  3P1H A;  3Q6S A;  1S40 A;  1CHP D;  1VQG A;  2B2T A;  2ES2 A;  2VUM B;  3HOY B;  1JJ2 A;  1OXT A;  2EY6 A;  1Q86 C;  1XNR L;  4LF9 L;  1F2M A;  5C44 H;  4CDF C;  2KUM A;  5BN3 A;  5GAD C;  1GJX A;  4S3S A;  2A1A A;  1IKL A;  1SNP A;  4JI0 Q;  4KKT A;  3I4M B;  1TU2 B;  3OYY A;  4RCO A;  3QJY A;  1QCB D;  1F9R A;  1NTG A;  2WFW A;  1EUJ A;  3STB D;  1XTD A;  1LUZ A;  5A35 A;  3RN2 A;  2Y0S B;  5BN4 A;  2HHH Q;  4X3S A;  1STH A;  1YEZ A;  4I7Z C;  1X56 A;  2YV5 A;  1YI2 A;  2CH4 W;  3A55 A;  5FO8 B;  1I50 B;  4G57 A;  4L6T B;  2NVQ B;  1DZ1 A;  4K6D A;  4QUC A;  4OX9 Q;  1E24 A;  1Z9F A;  4Q0F A;  5C4X G;  5IYB G;  4JI2 L;  1WCM B;  4UPA A;  3HOW B;  3DM3 A;  1TWF B;  4NMZ A;  1UNS A;  2QDB A;  1X55 A;  1I3Q H;  5IGB A;  2KA7 A;  1WOC A;  3BJU A;  4P74 A;  3MA2 B;  4C3H H;  1QVC A;  1HNX Q;  2OWO A;  4MTK A;  2X69 A;  3I4M G;  1EOT A;  1PLF A;  2L0C A;  4CJ0 B;  4A3I B;  1Y14 B;  4DR1 Q;  1K0S A;  1YIJ A;  4IO9 A;  3GTJ B;  2F0S A;  4HTH A;  1SLJ A;  1QVF A;  2K5H A;  4ZYS A;  4LFB L;  1IYV A;  5T1I A;  1LV9 A;  2WV6 D;  1V1P A;  3VYT A;  1CZG A;  2WAQ B;  1C8C A;  1O7I A;  5JAV A;  1TWC H;  1B9N A;  3OMG A;  4DN4 M;  1OXX K;  3DMU A;  3H3V I;  3T53 B;  1O78 A;  4C3I H;  3NQI A;  1CKO A;  4WJ3 M;  4LF7 L;  1UWV A;  2HUG A;  3S1M H;  2JEB I;  2F03 A;  1B3Q A;  2A6E C;  3M7G A;  4DR3 L;  1SYB A;  4A3J B;  4BS9 A;  2JXM B;  3UDX A;  1Z7T A;  1A8V A;  3I55 A;  4PMC A;  4C3J B;  4JI1 Q;  4RWS C;  1F9Q A;  4LUZ A;  5AJ3 L;  3ER0 A;  4HCE A;  4XIG S;  1O80 A;  1P8L A;  1VQN A;  4AYB G;  2B2V C;  2ZT9 C;  2JJQ A;  1ONL A;  4LJZ C;  3IKJ A;  2B2W C;  4DV2 Q;  1YNJ D;  1XMQ L;  2OCE A;  2IHE A;  4CKE A;  1J8I A;  1TT2 A;  3A56 A;  5LMN L;  4ZUI A;  1UAP A;  1JE5 A;  3ITP A;  2E2J B;  5LMN Q;  1STN A;  5GAH C;  2J4X A;  1Q8K A;  2E2J H;  1L1O A;  5M5Y B;  3L0O A;  3JAM c;  4LF4 Q;  2PCF B;  5C4H A;  5BR8 L;  3J80 L;  4DV4 Q;  1P16 A;  4ZAI A;  4BBR H;  5FLX L;  2Y0S G;  3V96 A;  2PZW A;  4CGY B;  1SN8 A;  4OIJ A;  5EKI A;  1BNZ A;  1LT5 D;  4DUZ Q;  5K36 G;  1V8Q A;  1FVI A;  4MZ9 A;  2K04 A;  4FDB A;  3S17 H;  5KYL A;  2CQA A;  4DFA A;  4B9W A;  3I3C A;  2UUA Q;  2F4V L;  1BUV T;  4CHT B;  1E3P A;  2KCC A;  2PW5 A;  2OTJ A;  5IOD A;  1B50 A;  1SMX A;  4GLV B;  3L9A X;  4X66 L;  3ICE A;  1WCM G;  1VQA A;  1PFM A;  1JIC A;  2A68 C;  1VQF A;  3H94 A;  5CV4 A;  4GZY C;  1TWC B;  3KJP A;  1H95 A;  1B4O A;  3PO3 H;  4JI7 Q;  1NNX A;  1EY4 A;  5FJ8 H;  2EQS A;  1QE6 A;  2QDL A;  2ZTE A;  2NVT B;  2JK8 A;  1PYB A;  2DJF C;  4IUT A;  3GTJ H;  1YIT A;  2UUC L;  3S15 H;  5IT9 L;  3D3R A;  3HOX G;  4A3I G;  1Q7Y C;  4DK0 A;  3T1Y L;  1KQS A;  1PTO B;  5M3F B;  1MJC A;  1JC7 A;  1GVP A;  5J39 A;  1HHV A;  4WOR A;  5CR3 A;  1EIG A;  2K5D A;  2JE6 I;  1Q1B A;  2D2C C;  3CCR A;  1MD2 D;  1I3Q B;  1CK1 A;  2I0Q A;  4BY7 H;  1HTP A;  1WTR A;  3T16 A;  3NEL A;  3A8K E;  2A19 A;  4L5T A;  2AUK A;  2DUD A;  2Q8I B;  4DR7 L;  4BY7 B;  1IBM Q;  2OXP A;  1B2T A;  1F9P A;  4R4I A;  3FP9 A;  4CBV A;  2OT2 A;  4BA1 I;  4LW1 A;  1ASY A;  3H15 A;  4YCV A;  1X3G A;  1S3O A;  5I6Y A;  4C1N I;  4LUV A;  4HJ7 A;  1DGS A;  5CV9 A;  4C1N K;  2R6G A;  3VR5 A;  3FPP A;  3HKZ B;  2B2T C;  1LM0 A;  1QOH A;  3MZ5 A;  1K0R A;  2EIF A;  2VZA A;  1EQV A;  1U4P A;  4GLX A;  1OTC A;  2HQL A;  3GTK H;  3S2H B;  2RDH A;  3PO3 B;  4HCS A;  3J80 c;  1GOZ A;  1CQV A;  1I94 Q;  3CCU A;  3I4M H;  1XJV A;  1L0Y B;  5EKL A;  3AB9 A;  2CW0 C;  3L3O C;  4YHH Q;  1GUW A;  3KUP A;  5G3L D;  2EDG A;  3F8T A;  2AQ3 B;  3KOJ A;  2VB3 X;  1QZG A;  3PSI A;  1VQ9 A;  3NEN A;  1E1T A;  1N33 L;  3JAM i;  5DNF A;  3Q8D A;  1PV4 A;  2R7D A;  1SR3 A;  3MXN B;  1KNE A;  5IY0 A;  1E2Z A;  2AWO A;  4C56 C;  5E1F A;  4JV5 L;  3S17 B;  4DV5 Q;  2AQ2 B;  1SEB D;  1EIF A;  1ZKO A;  3PCO B;  1QUQ B;  1HJP A;  1VQM A;  1VS0 A;  2K5Q A;  1CFM A;  4BBR B;  1Q3L A;  1N9W A;  4K6L A;  1ZYR C;  2WII B;  1CKM A;  5M5Y H;  3BU2 A;  1NY4 A;  4DXF A;  3M9B A;  3P7J A;  2VS1 A;  3K59 A;  4LF7 Q;  3KF6 B;  1B1Z A;  1TWA H;  4MN3 A;  1Q1E A;  2L15 A;  3UE1 A;  3PQI A;  3PIP 3;  4X65 Q;  5IYD G;  4DR6 L;  1ILQ A;  3HOX B;  1EYC A;  4A75 A;  2EXD A;  1H9R A;  1MHW C;  2F3W A;  3I72 A;  4M8A A;  4CKC A;  4FXG C;  3P20 A;  4FF4 A;  3K81 C;  4X3U A;  4A3J H;  2E2I B;  4V0B A;  1MGS A;  1K28 A;  3S1M B;  1TKW B;  3VR4 A;  5C4X H;  4NXM L;  4PQX A;  3LNN A;  1PTO C;  2C5C A;  1CT1 D;  3F2U A;  1RJT A;  4P72 A;  1A63 A;  2J7Z A;  1EQQ A;  5COR A;  2B2W A;  1VQO A;  5EPK A;  4KN7 C;  1I94 L;  2JA5 H;  5GAG C;  2D0P A;  4YCU A;  3PUW A;  1QZH A;  3OWF A;  1AZP A;  2G9D A;  2ZJQ A;  2NB0 A;  3EQL C;  1NR2 A;  4A3I H;  2UUB Q;  3BS1 A;  4L63 B;  4F87 A;  1GUT A;  3RZD H;  4C3H B;  1GKH A;  3AFQ A;  1JR0 D;  1TWG H;  2AKW B;  2JA6 H;  4EQO A;  1TQO A;  2OQ0 A;  1EU3 A;  4DNI A;  5L37 A;  2GA4 B;  1VMC A;  5C44 G;  1TWF H;  1Y1V G;  4PMW A;  4X3K A;  4BBS G;  1WCM H;  3N6R A;  3K57 A;  4EQ5 A;  3PGZ A;  2ZJP A;  1HZB A;  3HOU B;  4IOC A;  1CA5 A;  3D4W A;  2VNU D;  1XMO L;  1NE3 A;  1LTT D;  2K32 A;  2CCZ A;  3SVM A;  1VMP A;  4EQN A;  1EY0 A;  5IT9 E;  1SE8 A;  3A74 A;  5ELO A;  3DXJ C;  1PH4 A;  1JMC A;  3K0X A;  4NB3 A;  4BBR G;  3NWS A;  2SNS A;  3GD7 A;  1OXV A;  3D4D A;  2HQE A;  4N8F A;  1IL2 A;  5A2Q E;  1UE1 A;  3FVQ A;  3PO2 G;  1QG7 A;  1ESF A;  4L8J A;  2XNA C;  3OW2 A;  1UE7 A;  3OPO A;  4R4C A;  5BR8 Q;  4DV4 L;  1MI2 A;  3MHB A;  4JVZ A;  3E5S A;  1RHP A;  3ERS X;  1IW7 C;  5FLX E;  1SSO A;  3GTQ B;  2ZTD A;  5D14 A;  5C44 B;  1X3E A;  1HNW Q;  1J6Q A;  2VXW A;  1XNQ L;  2C35 B;  5C0X H;  1D1I A;  1GUN A;  2VUM H;  1ZYR D;  4TVA B;  1YHQ A;  1PMR A;  2B8G A;  1ILP A;  5T1G A;  3J80 i;  3LWE A;  1D5X C;  1B8A A;  1EIY B;  2KHS A;  5IGE A;  3DWP A;  2MJ8 A;  5IGG A;  2CH4 A;  1S5F D;  4JI8 Q;  3F2B A;  2F52 A;  4P71 A;  2ZM6 L;  3CCS A;  3R2T A;  5EPJ A;  4CJ1 B;  5D3D A;  2EYM A;  1X9N A;  4JYA L;  1N32 Q;  3EJI A;  3RR5 A;  2EYH A;  2I46 A;  3RUZ A;  4DNR B;  1BF4 A;  2K14 A;  1WTH A;  2WKC A;  1HA5 A;  5IT9 c;  2F0F A;  5FLM H;  4C3H G;  5KIX A;  5AJ3 Q;  3B6Y A;  3RN5 A;  1Q82 C;  1FNV A;  1I5F A;  1LTG D;  3NTK A;  1XTC D;  1OO9 B;  4DV3 L;  5HY6 A;  3SK6 A;  4A93 G;  1XWE A;  4UP7 A;  1M4V A;  2PQA A;  1KD1 C;  3HZX A;  1PH1 A;  4IN3 A;  4A3E B;  3WDN A;  1G91 A;  3K6O A;  1UE5 A;  3PUY A;  4BY7 G;  5IP9 G;  3J81 L;  3RZO H;  1SNC A;  3NHH A;  4DR5 Q;  4A3K B;  1PH6 A;  4OX9 L;  4BBS H;  3GV6 A;  3ZYY X;  4DAM A;  3SK4 A;  1UEA B;  1WJJ A;  2EVB A;  4A3B H;  1Y69 U;  2M00 A;  2F0H A;  5JJK A;  3PIO A;  4C3J G;  2YTV A;  5FKA C;  1PH9 A;  3OIP A;  2BA0 A;  1QVG A;  4R4Q A;  5EBD A;  3GTO H;  4J1M A;  4B3M Q;  4CDC C;  4DR4 Q;  4LF8 Q;  1CKN A;  1EQT A;  4QCL A;  4JI8 L;  4F88 A;  4BXX H;  2O4X A;  2CFM A;  2MP1 A;  4HID A;  3EFX D;  2NWG A;  3F1Z A;  3K5L A;  3K5O A;  5C3E G;  1CUK A;  3FRP B;  1HH2 P;  3MXG A;  4ILW A;  3G7L A;  2O2L D;  3TQY A;  2SOB A;  5K36 H;  3JAM L;  1FGU A;  2PPB C;  3MXU A;  3CXC A;  4G7Z C;  1LAB A;  3U50 C;  1R9T H;  1JJG A;  3MFY A;  2F0L A;  2VW9 A;  5CGK A;  1RD9 D;  1SE4 A;  4XQJ A;  3AEV A;  1JCK B;  3HKS A;  1F9S A;  2PZU A;  3E9I A;  2D0O A;  3A54 A;  1Q81 C;  3E9H A;  2ZJR A;  4QIW B;  3CC2 A;  5EGT A;  2F0K A;  1WYD A;  3BZD B;  2B2U C;  1XXG A;  2JA6 B;  4H44 C;  3HOV B;  2YTY A;  3S1N B;  1A6X A;  5I6W A;  5HUR A;  1GO3 E;  3RZD B;  3UDG A;  3KLS A;  2B39 A;  2LXK A;  1PH8 A;  1UEB A;  4A3L G;  4J15 A;  2KED A;  1F2Y A;  4ZCK A;  3HGB A;  4A93 B;  1A3U A;  4LF4 L;  5COY A;  2F0M A;  2F0D A;  4JV5 Q;  5CBE E;  2EYO A;  4ZKB B;  4C2M B;  4A3C G;  1BCP F;  3H0G H;  1AE3 A;  1MSH A;  1B9M A;  5JEA H;  2B3G A;  3TP8 A;  3EVQ A;  5KNB A;  3LGJ A;  3RLF A;  1HCZ A;  1CKN B;  1TY2 A;  2JA9 A;  3D31 A;  1NAP A;  3MC0 B;  3NTI A;  3QIA A;  1KXL A;  4MNO A;  3J7Z C;  2G9H D;  3KDF B;  1DYQ A;  2Q2H A;  3I4N G;  1HR0 Q;  3QWN A;  2UXC L;  5M5X B;  1QUQ A;  1IBL L;  5C4X B;  4A3M G;  5CC4 A;  1B44 D;  2NVY H;  3PIP A;  4X65 L;  2JSO A;  4NDX A;  5ELB A;  4IUN A;  4FVM A;  4APV A;  2RCF A;  1A2U A;  3MEH A;  1WTV A;  3S9W A;  3C2P A;  4L5R C;  1JOR A;  3AYH B;  1D6E C;  2A69 C;  1O7Z A;  5K5P A;  1AZQ A;  1KTK A;  2Z8L A;  1YJN A;  2Z6K A;  1J9O A;  1O7Y A;  2ENB A;  2Z6K C;  1TWA B;  4QIW E;  2SDF A;  1RTN A;  3VR3 A;  3CCE A;  2VY3 A;  2SNM A;  4WJ4 A;  1S72 A;  3CW2 C;  4IAL A;  2JN4 A;  3SK5 A;  2JYO A;  3NUC A;  2EYP A;  1HR0 W;  3VYR A;  4LWC A;  1IBK Q;  1OXU A;  3J81 E;  4EVO A;  2R92 G;  3NP8 A;  3CQZ H;  1FL0 A;  1NSN S;  3GP7 A;  1HFG A;  3SDZ A;  4GNX A;  2OF1 A;  4A3M B;  2F0U A;  4B3T L;  2E5L L;  2JQO A;  1XPR A;  3S16 H;  2MFI A;  4RKB A;  1PRT C;  2CVR A;  3KBG A;  2Y0S E;  2BA1 A;  5ISR A;  4FF1 A;  2B2Y C;  1SNO A;  1BXT A;  5ELN A;  4A3G G;  5G3L F;  4DNT B;  4MHE A;  4DR4 L;  3GTK B;  3NPP A;  2A6H C;  3NQT A;  1SMY C;  1A3V A;  1PZK D;  1VQC A;  1N34 Q;  4NP5 A;  1SAP A;  1N34 L;  3BDL A;  1VQ5 A;  2EJF C;  1STE A;  3E6Z X;  4AYB E;  2R7Z G;  2F0P A;  2AHO B;  5IP7 H;  1RTO A;  3QOJ A;  2IX1 A;  2FMM A;  3SGI A;  1U4L A;  3K5N A;  3W1G A;  3SXH A;  2K5V A;  1FNW A;  1I6V C;  3S24 A;  4FO2 A;  3U58 A;  4DV7 Q;  3ZJY C;  1X65 A;  1HZ9 A;  4YWK A;  2R61 A;  3TN2 A;  3S2D H;  4YIJ A;  5I9O A;  3ULP A;  1Y8P B;  2YU9 H;  1STG A;  3S1R H;  4WRD A;  2LFN A;  3R93 A;  1KC8 C;  1SDF A;  2B63 H;  4XT1 B;  1X32 A;  3A7L A;  1SYG A;  2E2H H;  4MTN A;  4K5X A;  4NXN L;  4DR6 Q;  1SFO H;  1Q12 A;  3I73 A;  5FK9 C;  3KLW A;  1XPU A;  2AMC B;  2NTS A;  3F2C A;  3S15 B;  1CSQ A;  2KHI A;  1BOS A;  1SNQ A;  5JJZ A;  3Q23 A;  2JA7 G;  1JE4 A;  2WKD A;  1PYW D;  4IPD A;  4KMU C;  1L1O B;  4IJH A;  4A3E G;  1A2T A;  4HAE A;  3TBI B;  3M3Y H;  1ICF B;  4KV6 A;  2B2U A;  3R2I A;  4B3S Q;  4NPS A;  4UDU C;  4I7A A;  4XYO A;  5HGQ A;  1WD1 A;  4C3I G;  1PH7 A;  1LTR D;  4JG2 A;  2BOS A;  4DAP A;  1PH5 A;  2I07 B;  5EKK A;  3J81 c;  4HN7 A;  4K2K A;  3M3Y B;  1C48 A;  2KEN A;  1WTQ A;  1YHB A;  5IE8 A;  1I4X A;  4K5V A;  4POG A;  5JOB A;  1J5E Q;  1TS5 A;  1Y8O B;  4ME5 A;  4OO1 H;  4X66 Q;  1VQ7 A;  1W6J A;  3TS2 A;  1PTO D;  3M4O H;  2LSS A;  3FPU B;  3C1E A;  3T13 A;  2ICI A;  5NUC A;  1PA6 A;  1T5X D;  4AQY L;  1SFO B;  3IAY A;  3JC6 6;  4JI7 L;  5DAU A;  5FOB B;  4OWX B;  5JPM C;  3CPW A;  2E2H B;  2B63 B;  2DN8 A;  5E4W C;  1K9M C;  1M1K C;  4JK1 C;  2PMZ E;  3MFG A;  4BA2 I;  3VDY A;  5M3F G;  4Z9C B;  2YU9 B;  3SE0 A;  3NXW A;  2BE5 C;  2Q2T A;  2QKI C;  3DEP A;  1GXD C;  3S2D B;  1YNN D;  4O42 A;  3WWV A;  5IYB H;  4JI0 L;  3QG1 A;  2YYZ A;  1NUC A;  3WOE A;  3I56 A;  2VQE L;  4DUZ L;  4TKO B;  2EXZ A;  4IUQ A;  4DV2 L;  1TVX A;  4OWT B;  5LMU Q;  3FKI H;  5FO7 B;  1D7Q A;  1Z47 A;  3HOY G;  1CHQ D;  3RD4 A;  1BKB A;  5ELD A;  3PF5 A;  4C3I B;  4X62 Q;  2F0J A;  4LF6 L;  1KHI A;  1IKM A;  1ZXT A;  1SRU A;  3ERQ A;  3K7A B;  2KBN A;  3W2D A;  2FJ2 A;  1C4Q A;  4LNQ A;  1TS3 A;  2WB1 B;  3A8J E;  5JPN C;  4B3M L;  2L55 A;  4GKJ Q;  5JEA J;  2G5D A;  2JA7 B;  2VQF L;  4X6A H;  2KEE A;  3NTH A;  4H02 A;  4ABN A;  4KTA A;  2FXQ A;  5LHY 1;  1HRJ A;  1JB7 A;  3VA5 A;  1FYC A;  1WD0 A;  3KK7 A;  4OXP A;  2WB1 E;  2B63 G;  2WP8 J;  2HIV A;  3CQZ B;  2M9V A;  3ERO A;  1M90 C;  4P73 A;  2A73 B;  2MQH A;  3HOW H;  3WOF A;  4HR7 B;  2IT1 A;  3W3A A;  3N52 A;  2LKV A;  4IUV A;  3H3V C;  2UXC Q;  4JBK A;  1SYD A;  1VQ4 A;  2EZV A;  2UUC Q;  1ASZ A;  1SND A;  1JJC B;  3HOW G;  1E7Z A;  2NN6 G;  1I50 H;  1PH3 A;  1DOK A;  5I9P A;  5IP7 G;  4FNF A;  4PZ8 A;  5LMN W;  4DR5 L;  1W2B A;  3KDF A;  1PZJ D;  3G71 A;  1Q90 A;  1JOO A;  3BVZ A;  1AW7 A;  3PUV A;  4DF7 A;  1QWY A;  2N3S A;  5D3I B;  1AP0 A;  4JI5 L;  1TII D;  4XDX A;  1BCP B;  4WJW A;  1UUP A;  3KF8 B;  4GKK Q;  4R4O A;  4HSV A;  2KOL A;  1STY A;  1O7L A;  3Q22 A;  2UXB L;  5M5X H;  3TZU A;  1SBB B;  2Z9H A;  5ELF A;  1IYU A;  4JI4 L;  2L4N A;  3CCQ A;  1AE2 A;  1EY6 A;  1BCP D;  2RSO A;  1GHK A;  3DWA A;  4R9W A;  2TSS A;  4DA2 A;  1XPO A;  4OHJ A;  4UHV A;  3KF8 A;  4PZ7 A;  1XMQ Q;  3CRL C;  3HOY H;  2M2L A;  1K83 B;  4C2M H;  1G6P A;  1ET6 A;  3HOU G;  1F2L A;  5M5W B;  4Y7N H;  1MJE A;  4GNX C;  1IW7 D;  5BN5 A;  4LF5 Q;  2I5M X;  1J5E L;  1WTX A;  2NBF A;  2ZXO A;  2BE5 D;  3TRZ A;  4DGZ A;  1U5K A;  3EN2 A;  4A3G B;  2O5J C;  2KJX A;  4AYB B;  3J81 i;  2D5D A;  1HNW L;  1HUN A;  3HOV H;  2CKZ B;  2RCN A;  1WTO A;  2UXD Q;  1QNK A;  4O0A A;  5IYC G;  3TP6 A;  1EY9 A;  5C4J B;  2PNR C;  2Z1C A;  1G2S A;  1I4H A;  2QW7 A;  4UP9 A;  5C3E B;  4B3R Q;  4V19 0;  1VQH A;  3Q24 A;  5IGD A;  4DPG A;  1EWC A;  3I91 A;  1DJR D;  1G29 1;  2Z6B A;  3H09 A;  4XXE A;  3J7Y W;  2QEJ C;  2ZM6 Q;  2LXJ A;  2MNA A;  1V1Q A;  3TS0 A;  1IHZ A;  1K8A C;  3GTM B;  5ELE A;  1YNN C;  1Q8I A;  1YNJ C;  2N49 A;  2K28 A;  3ND9 A;  1BBU A;  4IZ8 A;  2E5L Q;  3I4N H;  1PRT B;  1LT6 D;  1RKN A;  5LMU L;  3I8Z A;  3G48 A;  4PNY A;  4ZQ3 A;  2A5H A;  1H9S B;  5I2X A;  4YY3 Q;  3I90 A;  2K6A A;  3CME A;  1GUO A;  2UU9 Q;  3R8B A;  4DXG A;  2O5I C;  4KHP Q;  1ML0 D;  2HCI A;  3I4L A;  2R93 H;  3IRB A;  1KIX A;  1B3A A;  1CQF A;  5EAY A;  2F3I A;  3DHQ A;  3NE5 B;  2NZ1 D;  1FNU A;  3SEB A;  2GVA A;  5CV7 A;  2LS0 1;  3KYH C;  4ZRZ A;  3UE0 A;  5C3W A;  3NBI A;  2DNC A;  3V2T A;  4JI6 Q;  1HFN A;  2CQO A;  3CC4 A;  3PUZ A;  1ENF A;  1EEF D;  1EY7 A;  1RCV D;  1WVL A;  5IGC A;  3RZO B;  3OW7 A;  4QY7 A;  4DAY A;  4DV7 L;  4K2L A;  1JOK A;  2NN6 H;  4DKA C;  4G7H C;  4JYA Q;  4YY3 L;  3A8I E;  1FD7 D;  2EJM A;  1KDC A;  4N8X 1;  1SNM A;  5M3M H;  3MWY W;  4QMG A;  4CKB A;  1PFB A;  5C5L A;  1AH9 A;  1GUS A;  1JT8 A;  4H7B A;  3ULJ A;  2UXB Q;  2Q2U A;  1ROD A;  1SYF A;  3J80 E;  1DOL A;  3ONA B;  2R7Z H;  2RKS A;  3GTM H;  1I6H B;  1PZI D;  3PF4 A;  4FF3 A;  3IL8 A;  3HG9 A;  3HRZ C;  4BXX G;  4R8I A;  1SJE D;  2LMC B;  2VL6 A;  5JVH 3;  1PHJ A;  2PQE A;  4QB4 A;  1BVS A;  2V4D A;  5IWA Q;  1SYC A;  4A3D H;  5IWA L;  5EJW A;  4FF2 A;  5C4J H;  2L5T A;  3T1Y Q;  5IGF A;  1G51 A;  3C1F A;  4A76 A;  1JWU D;  2LY7 A;  1EZ8 A;  1AFP A;  2BCO A;  4HED A;  1BO0 A;  3I2Z A;  4XYQ A;  1Y1W H;  3EA6 A;  4DK3 C;  4HIK A;  4LK1 C;  4K8J A;  3F2D A;  1X3P A;  2DY8 A;  2K01 A;  2K75 A;  2UUA L;  1XX8 A;  4OEL B;  1YVC A;  4A3K G;  2OQK A;  4GN3 B;  1BR9 A;  4LFC L;  3L2P A;  2DY7 A;  1S5B D;  1LTB D;  4Y7N B;  5M5W H;  1VQP A;  1U4M A;  3TRE A;  2XGT A;  4N9P A;  1BCP C;  4GNX B;  3H91 A;  1IL8 A;  3TSS A;  3GTQ H;  1U0L A;  3OIQ A;  2VQF Q;  3QO2 A;  3GTG B;  3KJO A;  2QEX A;  4A3D B;  4JI5 Q;  1HNX L;  4IPC A;  1K3R A;  1VF5 C;  4KKU A;  2FMC A;  4I65 A;  2IX3 A;  2L1B A;  2RF4 A;  5E7N A;  3FHW A;  4HJ9 A;  1HNZ L;  1V1O A;  4HMJ A;  4P75 A;  3URY A;  1I6H H;  2KCT A;  3T1H Q;  2R7Z B;  4RGT A;  3KBX A;  4KJN A;  2R93 G;  3A5U A;  2H4O A;  3K58 A;  4KD4 A;  3NSW A;  1IXR A;  2FFK B;  2H5X A;  5KGU A;  3H3V H;  4AQY Q;  2AWN A;  1WI5 A;  1HR0 L;  3ULL A;  1S4Z A;  4X64 Q;  3CCJ A;  4GOP C;  1DD2 A;  2HDL A;  2L9H A;  4X64 L;  4HIM A;  1XYI A;  3LWU A;  2BDN A;  4DV5 L;  1C0A A;  1E2V A;  1MSG A;  2WIN B;  4LF9 Q;  4Q5V A;  3CRK C;  1N36 L;  3HOU H;  2IL8 A;  3HP3 A;  1N36 Q;  1Q46 A;  3OWE B;  2L12 A;  2F0I A;  3OHX C;  3CF5 A;  1LT3 D;  4A3C H;  4B08 A;  1EU4 A;  1K73 C;  2YTX A;  4ODG A;  4UAI A;  4YWL A;  1TWG B;  5C0X G;  1F77 A;  2NZH A;  1GHJ A;  2TMP A;  2Z0S A;  3R3O A;  2Z4H A;  1QNU A;  2FHT A;  4DAY B;  4KD3 A;  1CZW A;  5JVG 3;  4KY7 A;  4NKL A;  3T1H L;  2J0T D;  2DNE A;  1KNA A;  3CD6 A;  4HJA A;  4IOA A;  1IBK L;  5H1S E;  2R93 B;  2JA5 B;  1A62 A;  3GTP H;  3M85 A;  2JA8 H;  1G8Z D;  4DV6 L;  5CV8 A;  1PH2 A;  1PFN A;  3W1B A;  1KL9 A;  3MAQ A;  1LAC A;  1C7Y A;  4IFD H;  2HCC A;  1H9M A;  1X6O A;  3J7A F;  2KEC A;  2E74 C;  3AQQ A;  5AFW A;  2B2V A;  1RDP D;  4XT3 B;  1VQE A;  4KHP L;  5CYU A;  1PXU A;  3S1Q H;  1E0B A;  1W6K A;  2XN9 C;  4RG1 A;  5DM6 3;  1HZC A;  2CHB D;  5FLX c;  4H13 C;  5C3E H;  2ZXP A;  4BY1 H;  3UDF A;  2KCM A;  1H9S A;  4YWM A;  2Q8R E;  3MEF A;  3HOZ H;  1W3S A;  1D2B A;  1VDZ A;  1Y1V H;  3TDQ A;  5EBC A;  5CV6 A;  3J81 j;  4GKK L;  5KYI A;  3W5O A;  1C9O A;  1LTA D;  1R4Q B;  2KQ3 A;  3I7F A;  2A74 C;  3VR2 A;  1V1P B;  2K1B A;  3HOZ G;  4QF4 A;  1IYJ B;  2JP1 A;  4A3G H;  4EX5 A;  4RMF A;  1YBY A;  4BY1 G;  1JOQ A;  4QGU A;  1DXM A;  2ZTC A;  4DK1 A;  3V05 A;  1EQR A;  2F0Q A;  1NR4 A;  1K8G A;  4EGV A;  3CKI B;  1AEX A;  3DM1 A;  4A3B G;  2IW3 A;  2WAC A;  4HJ8 A;  3EIV A;  1K83 H;  4LFC Q;  2JA5 G;  5IIF A;  1B70 B;  1FJG L;  4A3F H;  4DR7 Q;  2MHV A;  4RFB A;  4DU9 A;  4IFD G;  3FKI G;  4JW0 A;  2R92 B;  4YHH L;  2QCP X;  2DJG C;  1S5D D;  1L0X B;  5M9O A;  4JC0 A;  1NMF A;  4IUU A;  4QQB X;  2KCN A;  4DV3 Q;  1KAA A;  4IJL A;  4A3J G;  2P5Z X;  3X3N A;  3S2H H;  4H0L C;  1EWI A;  4JOI C;  1Z6H A;  2WB1 G;  3Q0A A;  3GTL H;  1YJ9 A;  1U9R A;  2F4I A;  2IPK D;  1CTM A;  2E75 C;  3OSO A;  1TS4 A;  1II3 A;  2OTL A;  3NBH A;  5C5M A;  5IYD H;  3E0J A;  4PMB A;  4RGO S;  5I2Y A;  3FMC A;  4O1N A;  2I5H A;  2RDG A;  2MO0 A;  1E1O A;  2MUY A;  5EPL A;  3TEH B;  1EWH A;  3MXN A;  5A2Q L;  4DAV A;  3U9S A;  3H6M A;  4KJO A;  4OO1 G;  1EYD A;  3T51 B;  3CCL A;  4UY8 C;  3S1R B;  3HEJ A;  1VQ8 A;  3UI2 A;  5LL6 X;  2EOT A;  3VA7 A;  4RA8 A;  2MPM A;  1ICW A;  4TQU S;  4HSP A;  3GDE A;  3NEM A;  4OIK A;  3CMA A;  4OO1 I;  3STB C;  1I4G A;  4B3S L;  1CI3 M;  2HDM A;  5E3F A;  3TP7 A;  1KRS A;  2V1C C;  3I4O A;  5JEA G;  1NBW A;  3DWQ A;  3DUZ A;  1MKH A;  4FP5 D;  2PO4 A;  4HJ5 A;  5M3F H;  2Q2I A;  3GO5 A;  1PTO H;  5DM7 3;  2XRQ D;  1S5E D;  2PMZ B;  3X3M A;  1ENA A;  5J1Z A;  4GN5 A;  1STB A;  3D6C A;  3MTS A;  4DUY L;  2JA7 H;  5IYC H;  2NVT H;  1SJH D;  2A6H D;  4AH6 A;  2SEB D;  3E0E A;  1K8M A;  4GOP A;  3HOV G;  4NXN Q; 
#chains in the Genus database with same CATH homology
 2RBM A;  3G6J B;  3CU7 A;  3OMC A;  1QB5 D;  1VCI A;  3PV0 A;  4KHZ A;  2JEA I;  3PIO 3;  2F0V A;  3FKI B;  4K5W A;  4KI0 A;  4G4K A;  2EPB A;  3SR1 A;  3M7N A;  4TRD A;  4BWG B;  1H9K A;  4ZK9 B;  3U9O A;  5C0X J;  3D6W A;  4JBW A;  5ELC A;  2D62 A;  2F0G A;  3FDT A;  1DOM A;  4MIU A;  1DON A;  2EJG C;  1JWM D;  3RMH A;  3BYT B;  1HA6 A;  1D5Z C;  2ICE C;  2L11 A;  2A69 D;  4IUR A;  1V43 A;  5F2D A;  3M4O B;  3KLS X;  5D65 A;  4RKL A;  3VYU A;  4WFN 3;  4IQZ A;  2AUJ D;  4K14 A;  4HMI A;  1ESR A;  2BDO A;  3BYY B;  1JWS D;  3GTL B;  4KY6 A;  2QIL A;  2XIW A;  2EYF A;  4ZKC B;  2EYJ A;  1I4Q A;  5KRU A;  3T56 B;  3PUX A;  4XTC S;  2F0O A;  2IJ0 A;  1DCZ A;  1SYE A;  1F2Z A;  4X3T A;  3AU7 A;  3LX0 A;  4A3F B;  1EFI D;  4J8Q A;  3VR6 A;  1CM9 A;  2OEO A;  3I70 A;  3TME A;  4TSS A;  1KDB A;  2EY5 A;  3SHL A;  1WTP A;  2AQ1 B;  5C0X I;  1KDA A;  4RGN A;  5TSS A;  2XWJ B;  4LAA A;  2XVS A;  1Y1V B;  1D1K A;  1HTL D;  2N88 A;  3HOZ B;  2K7V A;  1PDQ A;  4BY1 B;  3D4R A;  3MXP A;  2F3V A;  5KNC A;  1E2W A;  3GV3 A;  1R9T B;  2RQX A;  5HGT A;  1WTW A;  1K8O A;  1EEI D;  5LL6 S;  3QOL A;  5C4Z A;  1BDO A;  3S1Q B;  1GUG A;  2PW7 A;  4K8I A;  1SE2 A;  2XWB B;  2FIN B;  4KKS A;  3TP5 A;  2F0W A;  3A7A B;  1G6Z A;  3PMF A;  2XRS D;  4QUF A;  2CW0 D;  1HQR D;  1SMY D;  3BVM A;  4KK7 A;  2JA8 B;  2PYK A;  1D5M C;  3GTP B;  2NN6 I;  1BBX C;  4U68 A;  1TS2 A;  1NCV A;  3BDO A;  3P75 A;  3GTO B;  2F0N A;  3S16 B;  1BQQ T;  1R4P B;  2X6G A;  4F7X A;  2E2D C;  2X6L A;  4A3B B;  4BBS B;  1T5E A;  4ZUJ A;  2RDF A;  1M8A A;  1EZ6 A;  2B2Y A;  4EQP A;  1OXS C;  1KAB A;  1KLG D;  2Z4I A;  1LO5 D;  3O13 A;  2NVX B;  4E6I A;  2K33 A;  3PO2 B;  4PV1 C;  5C6A A;  1EYA A;  2PZT A;  2XSC A;  1LLR D;  4KN4 C;  1HXY D;  2NVY B;  4XQN A;  1LTS D;  5EQ0 A;  1HPC A;  2K5W A;  1TWH B;  2KVM A;  4IFD I;  2K03 A;  1FGB D;  2QF7 A;  2RVL A;  4IUP A;  5FO9 B;  2EE1 A;  3C3L A;  3H0G B;  1I4P A;  2E76 C;  2VB2 X;  4ULL A;  3K0Y A;  4LMQ D;  1QJO A;  5KEE A;  4FXK C;  4P2C B;  2ID0 A;  5CMD A;  3DEO A;  4N9T A;  1TY0 A;  1Y1W B;  3C46 A;  2EYL A;  2EY2 A;  4FXD A;  1PTO F;  4RCN A;  2K05 A;  2A68 D;  4ZLT F;  4RH6 A;  1I4R A;  2EY1 A;  1KLU D;  2F0E A;  3TZD A;  1ET9 A;  1TR5 A;  4FYD A;  1A3T A;  4B9X A;  1QIL A;  3NWT A;  5CBA E;  3AMU A;  2IX0 A;  3BDC A;  2H1E A;  2IWH A;  4G7O C;  1EY8 A;  1G2T A;  1RF2 D;  2A6E D;  2R3Z A;  4KY5 A;  3KLR A;  3M4Y A;  1HQM C;  4RHS A;  5M3M B;  1STA A;  4U67 3;  1EL0 A;  2RSN A;  3MVV A;  4RAU C;  2F0T A;  2NYZ D;  1U4R A;  2C9O A;  4RHR A;  2B8F A;  3T4A C;  1B53 A;  3L7Z C;  1JQY D;  4OL7 A;  2N55 A;  5DEH A;  1JB3 A;  1LT4 D;  3GQB A;  1HUM A;  3FEW X;  4R8N A;  3CHB D;  1H9J A;  3OOC A;  4XQQ A;  1SE3 A;  3HS0 C;  3IFT A;  2Q8T A;  3NK9 A;  1Y8N B;  5I4D A;  4RGM A;  1ENC A;  1MBY A;  5E4X A;  5C3X A;  4J6H A;  4M1U B;  3IFD A;  1FR3 A;  1X3Q A;  1CA6 A;  5IOC A;  2F1M A;  4CJ2 C;  1EIH A;  5CV5 A;  5KND A;  3S14 B;  3I4N B;  1SXT A;  4F8M A;  3JAM E;  2NUC A;  3J7A V;  1S5C D;  4ID6 A;  2ZXR A;  1DM0 B;  1EY5 A;  2MGS A;  3D8G A;  4NW2 A;  3BVG A;  4IFD J;  2NTT A;  3K5M A;  2RA4 A;  1PRT F;  1LTI D;  5J22 A;  3ND8 A;  4KHV A;  1VF7 A;  4OGQ C;  3QB3 A;  3VYS A;  1A15 A;  1AN8 A;  2D9U A;  3SK8 A;  1PRT D;  3BG3 A;  1ZEQ X;  3P1H A;  3Q6S A;  1CHP D;  2B2T A;  2VUM B;  3HOY B;  1OXT A;  2EY6 A;  1F2M A;  2KUM A;  5BN3 A;  1GJX A;  4S3S A;  1IKL A;  1SNP A;  4KKT A;  3I4M B;  1TU2 B;  4RCO A;  3QJY A;  1QCB D;  1F9R A;  5A35 A;  2Y0S B;  5BN4 A;  4X3S A;  1STH A;  4I7Z C;  3A55 A;  5FO8 B;  1I50 B;  4G57 A;  4L6T B;  2NVQ B;  1DZ1 A;  4K6D A;  4QUC A;  4Q0F A;  1WCM B;  3HOW B;  1TWF B;  4NMZ A;  1UNS A;  2QDB A;  5IGB A;  2KA7 A;  3MA2 B;  2X69 A;  1EOT A;  1PLF A;  2L0C A;  4CJ0 B;  4A3I B;  3GTJ B;  2F0S A;  4HTH A;  4ZYS A;  1IYV A;  5T1I A;  1LV9 A;  2WV6 D;  1V1P A;  3VYT A;  1CZG A;  2WAQ B;  1C8C A;  5JAV A;  1B9N A;  3OMG A;  4DN4 M;  1OXX K;  3DMU A;  3T53 B;  1O78 A;  3NQI A;  2HUG A;  2JEB I;  2F03 A;  2A6E C;  3M7G A;  1SYB A;  4A3J B;  4BS9 A;  2JXM B;  1Z7T A;  4PMC A;  4C3J B;  4RWS C;  1F9Q A;  4HCE A;  4XIG S;  1O80 A;  2B2V C;  2ZT9 C;  1ONL A;  4LJZ C;  3IKJ A;  2B2W C;  1YNJ D;  4CKE A;  1J8I A;  1TT2 A;  3A56 A;  4ZUI A;  1UAP A;  3ITP A;  2E2J B;  1STN A;  2J4X A;  5M5Y B;  2PCF B;  5C4H A;  3J80 L;  4ZAI A;  5FLX L;  3V96 A;  4CGY B;  2PZW A;  4OIJ A;  5EKI A;  1BNZ A;  1LT5 D;  5K36 G;  1V8Q A;  2K04 A;  5KYL A;  2CQA A;  4DFA A;  4B9W A;  3I3C A;  1BUV T;  4CHT B;  2KCC A;  2PW5 A;  5IOD A;  1B50 A;  3L9A X;  1PFM A;  1JIC A;  2A68 C;  5CV4 A;  3H94 A;  4GZY C;  1TWC B;  1B4O A;  1EY4 A;  1QE6 A;  2NVT B;  4IUT A;  5IT9 L;  3D3R A;  4DK0 A;  1PTO B;  5M3F B;  1JC7 A;  5J39 A;  1HHV A;  4WOR A;  5CR3 A;  1EIG A;  2K5D A;  2JE6 I;  1Q1B A;  2D2C C;  1MD2 D;  1I3Q B;  1CK1 A;  1HTP A;  1WTR A;  3T16 A;  3A8K E;  2AUK A;  2Q8I B;  4BY7 B;  1B2T A;  2OXP A;  1F9P A;  4CBV A;  2OT2 A;  4BA1 I;  5I6Y A;  4C1N I;  5CV9 A;  4C1N K;  2R6G A;  3VR5 A;  3FPP A;  3HKZ B;  2B2T C;  1QOH A;  3MZ5 A;  1EQV A;  1U4P A;  3S2H B;  2RDH A;  3PO3 B;  4HCS A;  1GOZ A;  1CQV A;  1L0Y B;  5EKL A;  3AB9 A;  2CW0 C;  3L3O C;  1GUW A;  3KUP A;  5G3L D;  2EDG A;  2AQ3 B;  2VB3 X;  5DNF A;  1KNE A;  1E2Z A;  2AWO A;  4C56 C;  5E1F A;  3S17 B;  2AQ2 B;  1SEB D;  1ZKO A;  2K5Q A;  1CFM A;  4BBR B;  1Q3L A;  4K6L A;  1ZYR C;  2WII B;  4DXF A;  3P7J A;  3K59 A;  1B1Z A;  4MN3 A;  1Q1E A;  3PIP 3;  1ILQ A;  3HOX B;  1EYC A;  1H9R A;  2F3W A;  3I72 A;  4M8A A;  4CKC A;  4FXG C;  3P20 A;  4FF4 A;  4X3U A;  2E2I B;  4V0B A;  1MGS A;  3S1M B;  1TKW B;  3VR4 A;  4PQX A;  3LNN A;  1PTO C;  2C5C A;  1CT1 D;  3F2U A;  1RJT A;  2J7Z A;  5COR A;  2B2W A;  5EPK A;  4KN7 C;  3PUW A;  3OWF A;  1AZP A;  2G9D A;  2NB0 A;  3EQL C;  1NR2 A;  3BS1 A;  4L63 B;  4F87 A;  1GUT A;  4C3H B;  1JR0 D;  4EQO A;  1TQO A;  1EU3 A;  2GA4 B;  1VMC A;  4PMW A;  4X3K A;  3N6R A;  3K57 A;  3HOU B;  1CA5 A;  3D4W A;  2VNU D;  1LTT D;  2K32 A;  3SVM A;  1VMP A;  4EQN A;  1EY0 A;  5IT9 E;  3DXJ C;  3NWS A;  2SNS A;  3GD7 A;  1OXV A;  3D4D A;  2HQE A;  5A2Q E;  3FVQ A;  1QG7 A;  1ESF A;  4L8J A;  2XNA C;  3OPO A;  1MI2 A;  3MHB A;  3E5S A;  1RHP A;  1IW7 C;  5FLX E;  3GTQ B;  1SSO A;  5C44 B;  5D14 A;  2VXW A;  5C0X H;  1D1I A;  1GUN A;  1ZYR D;  1PMR A;  2B8G A;  1ILP A;  5T1G A;  3LWE A;  1D5X C;  2KHS A;  5IGE A;  3DWP A;  2MJ8 A;  5IGG A;  1S5F D;  3R2T A;  5EPJ A;  4CJ1 B;  5D3D A;  2EYM A;  3EJI A;  2EYH A;  2I46 A;  3RUZ A;  4DNR B;  1BF4 A;  2WKC A;  1HA5 A;  2F0F A;  4C3H G;  5KIX A;  1FNV A;  1LTG D;  3NTK A;  1XTC D;  1OO9 B;  3SK6 A;  1XWE A;  1M4V A;  3HZX A;  4IN3 A;  4A3E B;  3WDN A;  1G91 A;  3K6O A;  3PUY A;  3J81 L;  1SNC A;  3NHH A;  4A3K B;  3GV6 A;  3ZYY X;  3SK4 A;  1UEA B;  2EVB A;  1Y69 U;  2M00 A;  2F0H A;  4C3J G;  5FKA C;  3OIP A;  2BA0 A;  5EBD A;  4J1M A;  1EQT A;  4QCL A;  4F88 A;  2O4X A;  2MP1 A;  3EFX D;  2NWG A;  3K5L A;  3K5O A;  3FRP B;  3MXG A;  4ILW A;  3G7L A;  2O2L D;  2SOB A;  5K36 H;  3JAM L;  2PPB C;  3MXU A;  4G7Z C;  1LAB A;  3MFY A;  2F0L A;  5CGK A;  1RD9 D;  1SE4 A;  4XQJ A;  1JCK B;  1F9S A;  2PZU A;  3A54 A;  4QIW B;  5EGT A;  2F0K A;  3BZD B;  2B2U C;  1XXG A;  2JA6 B;  4H44 C;  3HOV B;  3S1N B;  1A6X A;  5I6W A;  5HUR A;  3RZD B;  3KLS A;  2B39 A;  2KED A;  1F2Y A;  3HGB A;  4A93 B;  1A3U A;  5COY A;  2F0M A;  2F0D A;  5CBE E;  2EYO A;  4ZKB B;  4C2M B;  1BCP F;  1MSH A;  1B9M A;  5JEA H;  3TP8 A;  3EVQ A;  5KNB A;  3RLF A;  1HCZ A;  1TY2 A;  3D31 A;  1NAP A;  3MC0 B;  3NTI A;  3QIA A;  2G9H D;  1DYQ A;  3QWN A;  5M5X B;  5C4X B;  5CC4 A;  1B44 D;  2JSO A;  4NDX A;  5ELB A;  4IUN A;  4FVM A;  1A2U A;  3MEH A;  1WTV A;  3S9W A;  3C2P A;  1JOR A;  1D6E C;  2A69 C;  1O7Z A;  5K5P A;  1AZQ A;  1KTK A;  2Z8L A;  1J9O A;  1O7Y A;  2ENB A;  1TWA B;  2SDF A;  1RTN A;  3VR3 A;  2SNM A;  4IAL A;  3SK5 A;  2JYO A;  3NUC A;  2EYP A;  3VYR A;  1OXU A;  3J81 E;  4EVO A;  3NP8 A;  1NSN S;  3GP7 A;  1HFG A;  3SDZ A;  2OF1 A;  4A3M B;  2F0U A;  4RKB A;  1PRT C;  2CVR A;  3KBG A;  5ISR A;  2BA1 A;  4FF1 A;  2B2Y C;  1SNO A;  1BXT A;  5G3L F;  4DNT B;  4MHE A;  3GTK B;  3NPP A;  2A6H C;  3NQT A;  1SMY C;  1A3V A;  1PZK D;  4NP5 A;  1SAP A;  3BDL A;  2EJF C;  1STE A;  3E6Z X;  2F0P A;  1RTO A;  3QOJ A;  2IX1 A;  2FMM A;  1U4L A;  3K5N A;  3SXH A;  1FNW A;  1I6V C;  4FO2 A;  2R61 A;  3TN2 A;  4YIJ A;  5I9O A;  1Y8P B;  1STG A;  4WRD A;  2LFN A;  3R93 A;  1SDF A;  4XT1 B;  1X32 A;  3A7L A;  1SYG A;  4K5X A;  1Q12 A;  3I73 A;  5FK9 C;  2NTS A;  3S15 B;  1BOS A;  1SNQ A;  5JJZ A;  3Q23 A;  1JE4 A;  2WKD A;  1PYW D;  4KMU C;  1A2T A;  4HAE A;  3TBI B;  4KV6 A;  2B2U A;  3R2I A;  4UDU C;  4XYO A;  1WD1 A;  4C3I G;  1LTR D;  2BOS A;  4DAP A;  2I07 B;  5EKK A;  4HN7 A;  4K2K A;  3M3Y B;  1C48 A;  1WTQ A;  1I4X A;  4K5V A;  5JOB A;  1TS5 A;  1Y8O B;  4ME5 A;  4OO1 H;  1W6J A;  1PTO D;  3FPU B;  3C1E A;  3T13 A;  2ICI A;  5NUC A;  1T5X D;  1SFO B;  3IAY A;  5DAU A;  5FOB B;  5JPM C;  2E2H B;  2B63 B;  2DN8 A;  5E4W C;  4JK1 C;  3MFG A;  4BA2 I;  4Z9C B;  2YU9 B;  3SE0 A;  3NXW A;  2BE5 C;  2QKI C;  3DEP A;  1GXD C;  3S2D B;  1YNN D;  4O42 A;  3QG1 A;  2YYZ A;  1NUC A;  3WOE A;  4TKO B;  2EXZ A;  4IUQ A;  1TVX A;  5FO7 B;  1Z47 A;  1CHQ D;  3RD4 A;  5ELD A;  4C3I B;  2F0J A;  1IKM A;  1ZXT A;  3ERQ A;  3K7A B;  3W2D A;  2FJ2 A;  1C4Q A;  1TS3 A;  2WB1 B;  3A8J E;  5JPN C;  2L55 A;  5JEA J;  2JA7 B;  2KEE A;  3NTH A;  4ABN A;  4KTA A;  5LHY 1;  1HRJ A;  3VA5 A;  1FYC A;  1WD0 A;  3KK7 A;  2WP8 J;  3CQZ B;  2M9V A;  3ERO A;  2A73 B;  3WOF A;  4HR7 B;  2IT1 A;  3W3A A;  3N52 A;  2LKV A;  4IUV A;  3H3V C;  1SYD A;  2EZV A;  1SND A;  2NN6 G;  1DOK A;  5I9P A;  4FNF A;  1PZJ D;  1Q90 A;  1JOO A;  3BVZ A;  1AW7 A;  3PUV A;  4DF7 A;  1QWY A;  5D3I B;  1AP0 A;  1TII D;  4XDX A;  1BCP B;  4WJW A;  1UUP A;  4HSV A;  2KOL A;  1STY A;  1O7L A;  3Q22 A;  3TZU A;  1SBB B;  5ELF A;  1IYU A;  2L4N A;  1EY6 A;  1BCP D;  2RSO A;  1GHK A;  3DWA A;  4R9W A;  2TSS A;  4DA2 A;  4OHJ A;  3KF8 A;  3CRL C;  2M2L A;  1K83 B;  1ET6 A;  1F2L A;  5M5W B;  1IW7 D;  5BN5 A;  1WTX A;  2NBF A;  2ZXO A;  2BE5 D;  4DGZ A;  4A3G B;  2O5J C;  2KJX A;  4AYB B;  2D5D A;  1HUN A;  1WTO A;  1QNK A;  3TP6 A;  1EY9 A;  5C4J B;  2PNR C;  2Z1C A;  1G2S A;  1I4H A;  5C3E B;  4V19 0;  3Q24 A;  5IGD A;  1EWC A;  3I91 A;  1DJR D;  1G29 1;  3H09 A;  4XXE A;  3J7Y W;  2QEJ C;  3GTM B;  1IHZ A;  5ELE A;  1YNN C;  1Q8I A;  1YNJ C;  2K28 A;  3ND9 A;  4IZ8 A;  1PRT B;  1LT6 D;  1RKN A;  3I8Z A;  4PNY A;  4ZQ3 A;  2A5H A;  1H9S B;  5I2X A;  3I90 A;  2K6A A;  1GUO A;  3R8B A;  4DXG A;  2O5I C;  1ML0 D;  2HCI A;  3I4L A;  1B3A A;  1CQF A;  3DHQ A;  3NE5 B;  2NZ1 D;  1FNU A;  3SEB A;  5CV7 A;  2LS0 1;  4ZRZ A;  5C3W A;  3NBI A;  2DNC A;  3V2T A;  1HFN A;  3PUZ A;  1ENF A;  1EEF D;  1EY7 A;  1RCV D;  1WVL A;  5IGC A;  3RZO B;  3OW7 A;  4DAY A;  4K2L A;  1JOK A;  2NN6 H;  4G7H C;  3A8I E;  1FD7 D;  2EJM A;  1KDC A;  1SNM A;  3MWY W;  4QMG A;  4CKB A;  1PFB A;  5C5L A;  1GUS A;  4H7B A;  1ROD A;  1SYF A;  3J80 E;  1DOL A;  3ONA B;  2RKS A;  1I6H B;  1PZI D;  4FF3 A;  3IL8 A;  3HG9 A;  3HRZ C;  4R8I A;  1SJE D;  2LMC B;  5JVH 3;  2PQE A;  4QB4 A;  2V4D A;  1SYC A;  5EJW A;  4FF2 A;  2L5T A;  5IGF A;  3C1F A;  1JWU D;  2LY7 A;  1EZ8 A;  1AFP A;  2BCO A;  4HED A;  1BO0 A;  4XYQ A;  3EA6 A;  4LK1 C;  4K8J A;  1X3P A;  2DY8 A;  2K01 A;  1XX8 A;  1BR9 A;  2DY7 A;  1S5B D;  1LTB D;  4Y7N B;  1U4M A;  4N9P A;  1BCP C;  3H91 A;  1IL8 A;  3TSS A;  3OIQ A;  3QO2 A;  3GTG B;  4A3D B;  1VF5 C;  4KKU A;  2FMC A;  4I65 A;  2IX3 A;  2L1B A;  1V1O A;  4HMJ A;  3URY A;  2R7Z B;  4RGT A;  3KBX A;  4KJN A;  2H4O A;  3K58 A;  4KD4 A;  3NSW A;  2FFK B;  5KGU A;  2AWN A;  1S4Z A;  1DD2 A;  2HDL A;  2L9H A;  1XYI A;  3LWU A;  2BDN A;  1E2V A;  1MSG A;  2WIN B;  4Q5V A;  3CRK C;  2IL8 A;  3HP3 A;  3OWE B;  2L12 A;  2F0I A;  3OHX C;  1LT3 D;  4B08 A;  1EU4 A;  4ODG A;  4UAI A;  1TWG B;  5C0X G;  1F77 A;  2TMP A;  1GHJ A;  3R3O A;  2Z4H A;  1QNU A;  2FHT A;  4KD3 A;  1CZW A;  5JVG 3;  4KY7 A;  4NKL A;  2J0T D;  2DNE A;  1KNA A;  2R93 B;  2JA5 B;  3M85 A;  1G8Z D;  5CV8 A;  1PFN A;  3MAQ A;  1LAC A;  4IFD H;  2HCC A;  1H9M A;  3J7A F;  2KEC A;  2E74 C;  5AFW A;  2B2V A;  1RDP D;  4XT3 B;  5CYU A;  1PXU A;  1E0B A;  1W6K A;  2XN9 C;  5DM6 3;  2CHB D;  4H13 C;  2ZXP A;  1H9S A;  2Q8R E;  1D2B A;  1VDZ A;  3TDQ A;  5EBC A;  5CV6 A;  5KYI A;  1LTA D;  1R4Q B;  2KQ3 A;  2A74 C;  3VR2 A;  1V1P B;  2K1B A;  4QF4 A;  2JP1 A;  1JOQ A;  1DXM A;  4DK1 A;  3V05 A;  2F0Q A;  1NR4 A;  4EGV A;  3CKI B;  1AEX A;  3DM1 A;  2IW3 A;  2WAC A;  5IIF A;  2MHV A;  4RFB A;  4DU9 A;  4IFD G;  2R92 B;  2QCP X;  1S5D D;  1L0X B;  5M9O A;  4IUU A;  2KCN A;  1KAA A;  3X3N A;  4H0L C;  1Z6H A;  3Q0A A;  1U9R A;  2F4I A;  2IPK D;  1CTM A;  2E75 C;  3OSO A;  1TS4 A;  1II3 A;  3NBH A;  5C5M A;  3E0J A;  4PMB A;  4RGO S;  5I2Y A;  3FMC A;  4O1N A;  2RDG A;  5EPL A;  2MUY A;  1EWH A;  3MXN A;  5A2Q L;  4DAV A;  3U9S A;  3H6M A;  4KJO A;  4OO1 G;  1EYD A;  3T51 B;  3S1R B;  3HEJ A;  3UI2 A;  5LL6 X;  2EOT A;  3VA7 A;  4RA8 A;  2MPM A;  1ICW A;  4TQU S;  4HSP A;  4OIK A;  4OO1 I;  1I4G A;  1CI3 M;  2HDM A;  5E3F A;  3TP7 A;  5JEA G;  3DWQ A;  3DUZ A;  4FP5 D;  2PO4 A;  3GO5 A;  1PTO H;  5DM7 3;  2XRQ D;  1S5E D;  2PMZ B;  3X3M A;  1ENA A;  5J1Z A;  1STB A;  3D6C A;  3MTS A;  1SJH D;  2A6H D;  2SEB D;  1K8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...