1B4OA

Nmr study of sso7d mutant (f31a) minimized average structure
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
62
structure length
62
Chain Sequence
ATVKFKYKGEEKQVDISKIKKVWRVGKMISATYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords ENDORIBONUCLEASE P2
publication title A single-point mutation in the extreme heat- and pressure-resistant sso7d protein from sulfolobus solfataricus leads to a major rearrangement of the hydrophobic core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 3
structure length 62
sequence length 62
ec nomenclature ec 3.1.27.-:
pdb deposition date 1998-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b4oA00
2K01A 1X3QA 5EQ0A 2H1EA 1PFBA 1EOTA 1WD0A 4HEDA 1GUWA 3P7JA 4R9WA 3MWYW 5T1IA 1KNEA 3I8ZA 1MI2A 1Q3LA 1S4ZA 1QE6A 5DNFA 3I91A 2L12A 2MJ8A 4ZAIA 2IL8A 2K03A 1X3PA 1CA6A 1WTVA 1SSOA 4XT3B 3H91A 1BNZA 3DEPA 5EPKA 4HCSA 2FJ2A 1IKMA 4XT1B 4R8IA 1A15A 1U4LA 2B2UA 2D9UA 4RAUC 2R3ZA 4X3KA 1WTRA 1AZQA 1G6ZA 1O80A 1U4MA 3KUPA 1ESRA 5COYA 1WVLA 2J7ZA 2EPBA 2M2LA 3IL8A 1O7YA 2B2UC 4IUPA 5E4WC 1SDFA 2HCCA 2EOTA 5CBEE 4OIKA 1F9PA 2FMMA 1AP0A 2K05A 1B4OA 5JJZA 2HUGA 1DOKA 4IUUA 3G7LA 1WTQA 5EPLA 4MN3A 1EIHA 1SAPA 1ICWA 2K28A 2B2YA 1F9SA 2HCIA 3TZDA 2MGSA 4IUQA 1KNAA 1MSHA 3KBXA 1IL8A 1AZPA 3ONAB 1WTWA 2B2YC 5T1GA 4ZKCB 3SVMA 1HUNA 3GV6A 1O7ZA 1J8IA 2CVRA 5CORA 1NR4A 1QG7A 4RA8A 2L1BA 2KVMA 1TVXA 3I3CA 2L11A 3UI2A 1X32A 2SDFA 5EPJA 3TN2A 1XYIA 1JE4A 1HFNA 1RODA 2NWGA 1BBXC 1RTNA 4HSVA 4OIJA 4CJ2C 2X6GA 1VMCA 1RJTA 3N52A 2FINB 1BO0A 1PFMA 2Q8TA 1BF4A 1QNKA 1J9OA 2N88A 5D14A 1M8AA 2RSNA 3FDTA 1PDQA 1PFNA 4QUCA 1EL0A 3F2UA 1ILPA 1U4PA 5EJWA 1F9QA 3Q6SA 4X3UA 1DOMA 1WTPA 1B50A 1G91A 1ZXTA 2K1BA 1MSGA 3LWEA 2KEEA 3FPUB 2K04A 2DY8A 4LMQD 4HAEA 1HFGA 3R93A 4ZKBB 2L4NA 5CMDA 4ZLTF 1MGSA 2KECA 2NYZD 3DM1A 4CJ0B 1CM9A 2L9HA 1ILQA 1B3AA 1RHPA 2KEDA 1JICA 2XIWA 1NAPA 3I90A 4QUFA 2X69A 1VMPA 1HRJA 1U4RA 1F9RA 2B2TA 2HDLA 1DZ1A 1LV9A 4RWSC 4DN4M 1CA5A 1PLFA 2JP1A 1WTXA 1HUMA 2BDNA 2B2VA 2B2TC 4X3TA 2MPMA 1NCVA 2JYOA 1E0BA 2Q8RE 1NR2A 3IFDA 1EQTA 1DOLA 2B2VC 3GV3A 3D6WA 2KUMA 2RSOA 4NW2A 2KOLA 2MP1A 2FHTA 4X3SA 2RA4A 5D65A 4ZK9B 1WD1A 2N55A 3QO2A 1HHVA 2DY7A 4IURA 2FFKB 4U68A 2NZ1D 2X6LA 4MHEA 1B53A 1IKLA 4UAIA 2VXWA 1EIGA 1C8CA 1G2TA 5E4XA 2HDMA 1F2LA 4IUTA 2B2WA 4IUVA 1XX8A 1HA6A 3HP3A 3DEOA 1DONA 3MTSA 4CJ1B 5AFWA 2EE1A 1RTOA 5CBAE 1B2TA 2B2WC 4O42A 4XDXA 1ML0D 1G2SA 5EKIA 1WTOA 2RVLA
chains in the Genus database with same CATH superfamily
4AYBG 3K5LA 2CCZA 1UE7A 3K0XA 3H09A 1ASZA 4R9WA 3JAME 5DNFA 1QE6A 3CD6A 4DV1Q 1Q1BA 3S1MB 2HQLA 1BNZA 3NK9A 1SEBD 3LWUA 3F2BA 1TR5A 1YITA 4KTAA 3ND8A 4DV2L 1YNJC 4X66Q 3HOUB 2A5HA 2HUGA 1DOKA 2R93G 1B7YB 4HJ9A 3D31A 4MN3A 1SAPA 1CTMA 2KENA 5CYUA 2MGSA 4IUQA 4E6IA 1EIYB 1KNAA 2F1MA 2LY7A 3U50C 3J80c 1MBYA 4K2KA 5CV4A 5T1GA 3SGIA 4PMCA 4A76A 4A3IH 1WTHA 2N8NA 2L11A 3UI2A 2G5DA 4V0BA 2N78A 4N9TA 4FXKC 1XNQL 2NVTH 1LTGD 3Q0AA 1I4GA 3VR4A 3F8TA 2AWOA 3K7AB 5CV9A 3N52A 4KD4A 4JK1C 3VA7A 3GTMB 2YU9B 1JOQA 4POFA 2OF1A 1PFNA 4JI2L 4DGZA 2JA5G 3S1QB 3DWPA 1MD2D 2EIFA 2E2IH 1V1PA 1PYWD 3MVVA 3SE0A 3H0GB 4QY7A 2DY8A 3QOJA 2JA8H 5LL6X 2F0OA 4N8FA 4ZKBB 1VDZA 1U5KA 1RKNA 1UEAB 3TP5A 4C56C 4DPGA 1D5MC 3KDFA 1WTXA 2JP1A 2JEAI 2F3VA 2LSSA 3NELA 3SEBA 1D2BA 3OTOL 4P73A 3CQZB 1EU4A 2JYOA 2EZVA 3K80C 3LX0A 2KOLA 5GROA 3M4PA 1HXYD 5JEAJ 4DR7Q 4IURA 2V4DA 3CU7A 1U9RA 1VQOA 2I5MX 4XXEA 4DV3L 4ME3A 1P16A 2LMCB 3E0JA 1A3TA 1ZYRC 1H95A 4H0LC 1CUKA 1X9NA 2R6GA 2CHBD 3D4WA 2ICEC 4DAPA 1Q8KA 2L12A 4Q5VA 3K81C 2KQ3A 3C1EA 1CA6A 3TDQA 4BBRB 4DK0A 1QVCA 3S2HB 1GO3E 4RMFA 4BY1H 1TKWB 1QCBD 5JVH3 4KY6A 2EPBA 1WVLA 4IUNA 3NWTA 3L7ZC 1BR9A 1HNWQ 4YHHQ 3V96A 3A55A 4KKSA 3TZUA 1STBA 1Y1VG 2R7DA 2B63B 1H9MA 1R9TH 2EY5A 1CSPA 1HTLD 4A3KB 2I5HA 1FYCA 1PHJA 2EY2A 3AFPA 4MTNA 3FEWX 1B70B 3FKIB 4C1NK 1BCPF 2E5LL 2HD3A 1JE4A 2IWHA 3ULLA 3J7YW 1BOSA 2K5WA 3DLLA 1HZAA 5ELCA 4BBSH 2MHVA 4BXXH 3A74A 2Q8TA 3A8IE 1BF4A 4PZ8A 2OWOA 1IXRA 3W2DA 5EJWA 1YZ6A 2QEJC 3U9OA 1N34L 4A3JB 1A2TA 2VL6A 3BDCA 4O1NA 4A3EG 4LMQD 2K32A 1V1PB 5C0XJ 2PO4A 5C5MA 1TWAB 1V43A 5M3FG 4DV2Q 5L37A 2NYZD 4DR1L 2L9HA 5I6WA 3HOWG 4WRDA 2F0KA 3K0YA 3J81i 2WV6D 3GDEA 4LF7L 4DN4M 1ET6A 1ICFB 5IY0A 4XQJA 1YNJD 2ZTCA 4IJHA 3OWFA 1JOOA 3VYUA 1JQYD 3DMUA 4I65A 3HKZG 3KDFB 4UDUC 2R92B 4A3MH 1JT8A 1VF5C 3NPPA 4GKKL 4KKUA 1RD9D 3NSWA 1WD1A 4KD3A 2EYPA 2A8VA 1XNQQ 4OONA 2KCCA 2ZJQA 2VUMB 2B2WA 3HOZG 3G48A 1Y69U 1CSQA 2PZUA 3GTKB 3QWNA 4GN4B 4XYOA 1EY0A 2EE1A 5CBAE 1K0SA 1YIJA 1B8AA 4IO9A 4O42A 4QF4A 3FVQA 4H44C 4JI2Q 3PV0A 4F87A 3HZXA 1EZ6A 3MXPA 3T1HL 3B6YA 3W1BA 2K14A 2K7VA 4B9WA 1GJXA 1XWEA 1SSOA 3OSOA 1L0WA 1Q81C 3GTOB 1QVFA 2E75C 2J0TD 1IKMA 1I50H 1PV4A 1LTAD 3AB9A 4EQ5A 4L5TA 1AH9A 3HOXG 2F0UA 4IFDH 1FJGL 4A3GG 1Q12A 2J7ZA 2JA6B 1SDFA 3OTOQ 3BVZA 2IHEA 2G9DA 1F9PA 4OGQC 4HIOA 4YY3L 3W5OA 2AHOB 3R2TA 2ZXOA 4Z9CB 1AN8A 3WOEA 4C3HG 3CF5A 3TS0A 2QDLA 1Z9FA 1PTOB 1NY4A 3PO3G 4P74A 1TWHH 3C1FA 3Q22A 1GOZA 4DV3Q 3BVMA 5EKLA 1PRTC 1PRTB 2R61A 3OPOA 3X3NA 5EKKA 3BU2A 2X6GA 3UE0A 4A3CG 2O2LD 1J9OA 2N88A 5IYBH 3MC0B 1ZYRD 1FNVA 3UE1A 1CK1A 1VF7A 1X56A 4CHTB 3G71A 2JA7G 1DOMA 1WCMH 3E5SA 2NZHA 5M5YB 1EYDA 2B39A 4DNIA 2WB1E 3KF8A 1UUPA 4A3DB 2L4NA 2ZTDA 1HR0L 2CKZB 1UNSA 4DR3L 2F0EA 4CJ0B 2N49A 1CQVA 1ENAA 4ULLA 3S9WA 2B2TA 1CA5A 1W6JA 3FP9A 3RZOH 2RCFA 2JXMB 3BS1A 1AE3A 3SHLA 1DOLA 4C3JG 2YYZA 4RGOS 2LKVA 4LW1A 1H9RA 2E5LQ 2RA4A 3MAQA 2XN9C 1E2VA 5KNDA 4B3SQ 4U68A 1SROA 4RKBA 1KDBA 4UAIA 5IP9G 5FJ8H 3HOYH 3HOVG 1JC7A 2KHJA 3MA2B 5DM73 2B2WC 3UDGA 2K4KA 3GD7A 4KI0A 1VQ9A 1GUWA 2R7ZB 1PZKD 1N34Q 3P7JA 1E2ZA 2YTVA 3BG3A 5T1IA 1F2MA 2O5IC 1EEFD 2KCNA 4WFN3 2JEBI 1A63A 4DR1Q 3GTQB 3J81L 3CC2A 1D5ZC 3DEPA 1VQAA 2ICIA 5C44B 3IRBA 4LF7Q 1G6ZA 4JOIC 5FLXc 4HJAA 4G7ZC 1KQSA 2E2JB 5ELFA 3WDNA 5IT9c 3I4MG 4GKKQ 5JJIA 1LTLA 3GTPB 4JI4L 5M3MH 4MZ9A 1STHA 3KBGA 2HIXA 4QB4A 5JJLA 1O7IA 5ISRA 4WJWA 3BJUA 3ONAB 5KYIA 2IJ0A 1EYCA 4HMIA 1JR0D 3K5MA 1A3UA 4YCUA 4JBMA 3CCLA 1Q46A 4APVA 1IBML 3T1HQ 1SR3A 4WORA 1BUVT 3E6ZX 3T4AC 1BO0A 5I2YA 4K0KL 1NMGA 5JOBA 4J1MA 4FF1A 1Y8PB 3NXWA 4JV5L 1I4QA 2Z4HA 3F2UA 3OW2A 4DV0L 3PGZA 2IW3A 4GNXA 4RHSA 1VQKA 4AH6A 5CC4A 1FJGQ 4IFDI 3S1MH 3M7GA 1MGSA 4XQQA 1IW7D 2A6ED 3KF8B 1JICA 1NAPA 4QUFA 1VQFA 2IHFA 1KABA 4YY3Q 3K57A 2ZXPA 1PH5A 2ES2A 2DUDA 1HUMA 2VNUD 2YTYA 2B2TC 2VZAA 1NCVA 3HOUH 1NR2A 4NW2A 5DM63 5BN5A 5JPMC 2NZ1D 4MHEA 3ULPA 2XNAC 2JJQA 5IOCA 5IGBA 2E2DC 4R4IA 3HP3A 2RHQB 1IZ6A 1PRTD 1KD1C 5F2DA 1N33L 3NTKA 4A3LH 2QW7A 2RBMA 1CZWA 1SXTA 2D0OA 2IPKD 3K7AH 1F2ZA 3JAMc 1OXXK 4DR2Q 2BDOA 3GTMH 2YU9H 2OEOA 3ULJA 1X3PA 1TU2B 4DR3Q 3S1QH 2OXPA 3L2PA 3C46A 4A3GB 1ENFA 3H0GH 2O4XA 5D3DA 1PYBA 1LT6D 4HJ7A 3J81E 2WACA 1O80A 5HY6A 5IODA 4IQZA 5IIFA 1WJJA 3I55A 5I2XA 4GZYC 1RL2A 4GLXA 2CW0C 2QCPX 3A56A 4OIKA 2C9OA 3S2DB 2I0QA 5M5WB 4MIUA 1HR0W 3F2DA 4DV7L 2DGYA 3I7FA 1D7QA 2HCIA 2NZOA 1CT1D 4R8NA 3ZJYC 4HTHA 2B8FA 2Q2UA 3CQZH 1EYGA 4KHPL 1O7ZA 4KLKA 1N9WA 1STGA 1JB3A 2OTJA 1X32A 1XPOA 1CQFA 1SNMA 2WAQB 1E1OA 1VQDA 5H1SE 5JEAH 5C6AA 1AEXA 4TSSA 4I7AA 2IX0A 4DR6Q 1II3A 1V8QA 2NN6G 3ERQA 2Q2TA 1EL0A 4LNQA 4JPBW 4UHVA 5J1ZA 3QOLA 5CV6A 2WB1G 4JI7L 4NXNL 4LF8L 3RN5A 1R4PB 4ZUIA 1XNRL 4NPSA 5HGQA 4GNXC 4GNXB 3RLNA 4BBRH 4ZLTF 3S2HH 1RHPA 4DV4L 1BXTA 4JI4Q 1U4RA 5BR8L 1LV9A 1X3GA 4TRDA 1HH2P 5TSSA 4DF7A 1PZID 5I9PA 1I6VC 2IX1A 1E1TA 3OW7A 3A7LA 2VY3A 3TMEA 2B63H 2ID0A 3I4NG 1IBMQ 2K52A 4CKBA 2HDMA 4A3KH 2UXDL 3PUYA 4YCVA 4K0KQ 3FKIH 5AFWA 2PNRC 1B2TA 4ALPA 4JV5Q 5C4JB 1QB5D 1G2SA 2MUYA 5IYCH 4DV0Q 3AFQA 1Q82C 3EQLC 3SK6A 1YJNA 2O5JC 4A4IA 3I56A 3BVGA 1S4ZA 4LF4L 4BA1I 2QILA 2Q2IA 4H13C 5CGKA 3P20A 1VCIA 3A54A 4QCLA 4OO1I 5EPKA 1EOVA 1YJWA 1UE5A 5J39A 3KLWA 3GP7A 4A3JH 2F52A 1PVOA 3EROA 1G8ZD 2L15A 1VQIA 1JWUD 3D3RA 5KGUA 4RGTA 3VR2A 1TWAH 1S40A 1LTID 5FLMH 1YHQA 2HCCA 1SYFA 4KHVA 1EY5A 3EN2A 1CFMA 2GVAA 3P75A 5LMNL 3KJPA 2QKIC 3RNUA 3EIVA 2K5HA 1KDCA 1PZJD 2R92H 1BQQT 1YEZA 3QJYA 2KVMA 3I3CA 1N33Q 4LUOA 4DU9A 1RODA 2C35B 2NVQB 1K28A 1X3EA 2VUMH 2FINB 4FO2A 3GTKH 1I4HA 1WYDA 4PMBA 4M8AA 5C3EB 1DM0B 1ZKOA 1ZXTA 1SBBB 3QG1A 4V190 1K73C 3RD4A 1STYA 4A3IG 4A93G 1A62A 1HFGA 5C4XB 5K5PA 3PF4A 4FYDA 1ILQA 3FRPB 3GTOH 3C3LA 1STEA 1KLGD 3NBHA 1DZ1A 4JI1L 4DV7Q 1L2FA 2A68C 1B9NA 4RKLA 3M9BA 2CW0D 2JA6H 2HQEA 4X6AH 1M1KC 4IZ8A 4BY7G 2YV5A 1S5ED 2SNMA 4KHPQ 1K83B 1EQQA 4POGA 3EFXD 2MP1A 2XRQD 3NHHA 3Q24A 5IGFA 2JA8G 1PTOH 5G3LF 1MKHA 1A2UA 4HJ8A 1C8CA 2TSSA 3D4DA 4ZRZA 4IUVA 1HA6A 4DXFA 3V05A 4ZYSA 1IBLL 2DNEA 2M9VA 4DUYL 2D0PA 2K75A 4P75A 3RN2A 4G7OC 1X55A 2E8GA 1WD0A 5A2QL 4JI7Q 4LF8Q 2V1CC 2BOSA 5KIXA 1XNRQ 4PZ6A 4U673 1Q3LA 3ICEA 1SNOA 2VQFL 2KA7A 2F0JA 4DKAC 2BH8A 2IX3A 1QNUA 4UP7A 3GTGB 4RHRA 4DV4Q 3U58A 1AE2A 1O78A 3OMCA 5BR8Q 4PMWA 4RAUC 1D1IA 2K5VA 3MEHA 5M5YH 1VQ4A 5J22A 4A3DH 4QJFA 3MXGA 3VR6A 4QMGA 4K6DA 2NTSA 5CBEE 1FNWA 3TQYA 1HQRD 2DN8A 4JBJA 3OYYA 3Q8DA 2PMZE 4RCNA 1EYAA 2UXDQ 4DK3C 4PNYA 2UU9L 3GV6A 2FXQA 2ENBA 2EY6A 2Y0SE 2LXJA 3SK5A 4CDCC 4BY1G 1BBXC 4HSVA 1EWCA 4DUZL 4KJOA 2XSCA 4LF4Q 2EJMA 1VQ8A 1VQHA 1HTPA 1U4PA 3CCJA 3M85A 2A1AA 1F9QA 2R7ZH 4G57A 2CWPA 2JSOA 4JI8L 2AUKA 4IALA 1K9MC 5FO9B 1GVPA 1SE2A 1DJRD 1K0RA 4FNFA 4IPGA 3GTQH 2PI2E 3NP8A 5CV8A 2MO1A 5C0XI 1MJEA 3DHQA 5C44H 4BBSG 4BXXG 5LMNQ 4PZ7A 1QZGA 1BKBA 2CWAA 5KRUA 3NBHB 2E2JH 1TIID 4C3IB 1UE6A 1JJCB 2ATWA 1VS0A 3GTPH 3KLSX 4RG1A 2KCMA 4A3FB 1B53A 1PH1A 1NBWA 4LFBL 1EIGA 5E4XA 5LMNW 1NJIC 2WINB 3RR5A 1Q90A 1XXGA 4GLVB 3PO2B 4M1UB 4B3RL 5EKIA 2CH4A 2RVLA 1TS3A 3E3XA 5K36H 2H1EA 4YIJA 4A3MG 3I8ZA 2RQXA 3CW2C 4S3SA 4CKEA 5A2QE 1N36L 1V9PA 3EBEA 1ESRA 3DM3A 4AYBB 2BA0A 1TY2A 3UDIA 5IP7H 4IUPA 5M9OA 1TXYA 4Y52H 1IYVA 3NTIA 1GUOA 4LF6L 2A68D 4KY5A 1ET9A 1UWVA 2SOBA 3EJIA 4A75A 1EQVA 2K28A 2B2YA 2OTLA 1A0IA 3NWSA 1EWHA 1TS4A 4CDFC 2EVBA 1IL8A 1WTWA 3TP7A 1KTKA 3R3OA 1NUCA 4OL7A 1SYCA 2JN4A 1IBLQ 2EJGC 4J15A 5CORA 4DUYQ 2OCEA 1CKMA 3DWQA 1C48A 2F0DA 1IW7C 2A6EC 2H5XA 5FK9C 3EA6A 4IFDG 1SMYC 2NB0A 2R93B 4F8MA 1QNKA 1TT2A 4LUZA 5D14A 5LHY1 2VQFQ 3M3YB 1PYSB 3FDTA 1PDQA 3Q6SA 4A93B 1PTOC 3GO5A 1G91A 2EYHA 3PF5A 3KK7A 1D1KA 2QEXA 3AQQA 2KCTA 3I2ZA 3R93A 3PSIA 4PG3A 2KECA 3PUVA 1VQPA 1B3AA 4A3GH 4WJ4A 4BY7B 1I94L 2JA5B 4FDBA 4TKOB 2J4XA 4DNTB 5IYBG 4CKCA 3D4RA 4F7XA 3S14B 1S5FD 5EGTA 4B9XA 3A5UA 1SE3A 2EYLA 2UU9Q 1RIPA 4KN4C 1WCMG 4C1NI 3S2DH 5D65A 5M5WH 1XMOL 2UUCL 4ZK9B 2EY1A 2WKDA 1Y1WG 1J5EL 3FPPA 4DUZQ 1K8MA 4IUTA 4L63B 4P72A 3SR1A 4B08A 2OQ0A 2EXZA 1XTCD 1ML0D 5IYDH 3S15B 2M00A 1BBWA 1GUNA 1PFBA 2HIVA 3HEJA 4JI8Q 5C4ZA 1STNA 3ZYYX 3VYRA 4DAVA 2MJ8A 4ZAIA 1E7ZA 3OMGA 1KDAA 4LF9L 4FF4A 3H91A 1I6HB 3T56B 2F0PA 1WI5A 5FJ8G 4H02A 4P71A 3J81c 3HOYG 1U4LA 3R2IA 1SE4A 1H9KA 4EVOA 1WTRA 5COYA 2LS01 3IL8A 1UE1A 2A6HC 1CI3M 4OXPA 4Q0FA 5E7NA 2F0IA 3PQIA 4IUUA 4UP8A 1Y14B 1EIHA 3TZDA 1S72A 1MSHA 3JAMi 4DAMA 4IJLA 2CQOA 4K5XA 2Y0SG 5E1FA 4LFBQ 2B2YC 4L8JA 3OIPA 1SNDA 1I4XA 3PIO3 1OXTA 4IN3A 1CHQD 1A6XA 3D0FA 2SDFA 4B3RQ 4OIJA 1SJED 1JCKB 3NQIA 4TVAB 2NVXB 1BDOA 1MHWC 4LK1C 1Y1VB 4R4QA 4C2MB 1N36Q 1RDPD 5C4JH 2PYKA 2GVBA 1F77A 3OOCA 3LWEA 5CR3A 5KYLA 3RLFA 3BZCA 3MHBA 4QQBX 1D5XC 1K8OA 1L1OA 5GAHC 2QA4A 1SFOB 4K8JA 4JI0L 2I46A 1QVGA 1IBKL 2E2HB 4LF6Q 2C5CA 1PMRA 3LNNA 1HNXL 1VQGA 1HQMC 1FNUA 4X3TA 3I73A 4X64L 1E0BA 4ODGA 3VYTA 3TRZA 4A3EB 1CHPD 3T51B 2GN5A 2K5QA 4DK6C 2RSOA 2FHTA 4X3SA 4JCVE 5M3FB 4HR7B 3HOWB 4N8X1 2CFMA 1K8AC 2Q2HA 4IOAA 3HKSA 1SYGA 4KY7A 3J7AV 4OO1H 3CC7A 4N9PA 4LFAL 4RFBA 1AFPA 4BS9A 1TS5A 1SMYD 3HKZB 2NVQH 2QDBA 4K5WA 4JBWA 1EFID 3HOUG 3D6CA 1PTOD 3JC66 4OELB 3HOZB 5C3EH 4HCEA 5ELNA 4JI6L 1K3BC 2ZTEA 4XT1B 4JVZA 1UEBA 2VW9A 2AMCB 2IT1A 2AQ2B 4NMZA 1I94Q 2BE5C 1AZQA 5C4XH 1KRTA 1Y8NB 2F4VL 2BA1A 4OEMB 4AIMA 1A8VA 3HRZC 4EQPA 4A3LG 1XMOQ 2UUCQ 1YHBA 1H9SA 1EUJA 4CGYB 3CCUA 1PH2A 1C4QA 1J5EQ 4G7HC 2P5ZX 4GOPA 1HR0Q 3SVMA 1K83H 1QZHA 4FF3A 3HOXB 1NR4A 1QJOA 3H0GG 1HZBA 3CXCA 5GADC 4B3TL 1Z6HA 2Z6KA 1NMFA 1PFMA 4C3HB 5C5LA 4UY8C 2RSNA 3I4OA 3PO3B 5M5XB 1PH7A 3L0OA 3TP8A 4LF5L 2SEBD 4LF9Q 5ELEA 1FR3A 2KEEA 4R4TA 2MFIA 3S1NB 4JYAL 4GN3B 3WOFA 4HJ5A 1PH4A 2ZXRA 1EY6A 3GTGH 1L1OC 1L1OB 1CKOA 3KLSA 5FO8B 5JJKA 4LFCL 2XIWA 1Q7YC 1XJVA 1BCPC 1BCPB 5JEAG 2X69A 3CCVA 2ZT9C 3RLOA 3PIOA 2EDGA 4TQUS 2A6HD 1PLFA 2JA7B 1FGBD 3R8BA 1GHKA 1HZ9A 2KHSA 5HURA 1Y1WB 2FFKB 4J8QA 2A74C 3HFZB 1IKLA 4BBRG 3J80i 5A35A 1XX8A 4XYQA 2SNSA 2D5DA 3SXHA 3K7UC 5ELOA 1WTOA 2K01A 4C3JB 4HEDA 1HA5A 5DEHA 4YWLA 3UDFA 4XIGS 4JI0Q 2K03A 1IBKQ 3K5NA 1SNQA 5GQOA 4XT3B 3HOVB 3S16B 1PRTF 1QUQA 3PUZA 4O2DA 4A3KG 1HNXQ 1A15A 5ELBA 1XMQL 1V1OA 2UXBL 3FKIG 1V1QA 2CH4W 4YWMA 1O7YA 1PA6A 3K8AA 2PMZB 5IYCG 1NE3A 4YCWA 2XWBB 1BBUA 4H7BA 3J7A5 2RDGA 1B4OA 1F2YA 2F0GA 1M4VA 1STAA 1N32L 3TP6A 4NB3A 4C3IH 2BCOA 1H9SB 2DJFC 3RZDB 1VQNA 2CVRA 4A3BG 4RA8A 4ID6A 1JORA 4GOPC 4GOPB 4A3FH 4OX9L 3A7AB 2A19A 1HFNA 2XVSA 5G3LD 3I4MB 1RTNA 1RF2D 1PH9A 1RJTA 5EBDA 4CBVA 1DCZA 4K8IA 5C0XH 2A69D 3G4SA 2Z6KC 3PO2H 3K5OA 2XTIA 2B29A 1MJCA 4JI6Q 1B50A 1YVCA 3SK8A 1FL0A 1JWSD 2K04A 2MQHA 3O13A 2F4VQ 1CM9A 4ZQ3A 4NXML 3CC4A 1EY8A 2BE5D 4G4KA 1E3PA 1F9RA 2HDLA 4HMJA 2VUMG 4K6LA 4RWSC 5I6YA 4ILWA 2ALYB 4JG2A 2BDNA 1N8RC 3LGJA 1Q86C 1L0YB 2A73B 2F0FA 4FXDA 1OO9B 2Q8RE 1EQTA 3D6WA 2KUMA 3X3MA 1AW7A 4FF2A 3M4QA 1DXMA 3MZ5A 3PUXA 2HHHL 3U4VA 2PNHA 3DWAA 4ZCKA 1OTCA 4B3TQ 3MXUA 3GTLB 3M4OB 3A5ZB 3K59A 2K50A 5FKAC 1T5XD 4JW0A 1DONA 4HIDA 1EFWA 4LF5Q 1SNPA 4IPCA 4HSPA 5IGDA 2G9HD 2TMPA 2JA6G 4RCOA 2R93H 5GAGC 1DD2A 1X54A 1SE8A 4JYAQ 3VA5A 3I91A 3M3YH 4KKTA 2AWNA 2ZJPA 1X3FA 1VQMA 1E2WA 3T53B 3Q23A 1S3OA 4A93H 1EU3A 2NUCA 4LFCQ 3IFTA 2OT2A 3NTHA 1B3QA 1QOHA 4X3KA 1HZCA 4B3ML 4O0AA 3DXJC 1QUQB 1E24A 1BCPD 1GXDC 2EOTA 1JWMD 1HJPA 4BY7H 5JJZA 3VR3A 2WAQE 3TREA 3TS2A 2JA5H 4NXNQ 4DV6L 2RDHA 3E9HA 1VQCA 3J80L 3S14H 4ABNA 2EYOA 3T16A 1JB7A 1HUNA 1TWFB 4KN7C 1QG7A 4EX5A 1VQEA 1TWGB 4A3DG 4L5QA 5HGTA 2NN6I 2RHSB 3QR8A 2R7FA 2GA4B 1ILPA 3S15H 4Y7NB 1IHZA 3CCEA 4AQYL 3STBC 4CDDC 1XMQQ 4DAYA 4R1JA 3A8JE 2UXBQ 2MNAA 2UUBL 2NVYB 1LM0A 3CP0A 2DJGC 1I6HH 2JE6I 2KEDA 4DV5L 4RH6A 3S17B 2PW5A 5BN4A 4QIWE 1N32Q 1VQ6A 1D6EC 1VQ7A 1SLJA 2MPMA 2WB1B 1LT4D 3KYHC 4ZUJA 2LFNA 2R7ZG 3IAYA 4OX9Q 1EWIA 1KHIA 2F0HA 4J6HA 3S1RB 1F2LA 3ITPA 1WFQA 2F4IA 5C44G 1GD7A 1RTOA 1U0LA 2E74C 2VS1A 4XDXA 3N6RA 1I3QB 5EQ0A 2B3GA 4DR4L 2NVXH 1T5EA 3BDOA 1KNEA 1Y1VH 4C2MH 3I4NB 3GTJB 2IL8A 2XRSD 3BYTB 4JI3L 3T1YL 4NXMQ 2WP8J 3QIAA 3V2TA 2D62A 4HCSA 3D8GA 4EQOA 4R8IA 4B3SL 4PQXA 2FMCA 3KUPA 1Z7TA 3J81j 1EY9A 1SFOH 1SYBA 1SRUA 3OHXC 1OXUA 3EVQA 1TWCB 3CCRA 2E2HH 4YWKA 2Z4IA 1YBYA 5K36G 1PXUA 1B9MA 1O7LA 1X65A 3G7LA 1ICWA 2HHHQ 3NE5B 4A3BB 2WIIB 3KBXA 3PIP3 1DYQA 1ZEQX 4ZKCB 5EBCA 4A3EH 1W2BA 3J80E 1EZ8A 1J8IA 5M3FH 3TN2A 1SMXA 5KNCA 4XQNA 1I5FA 4JI1Q 1FD7D 3HOWH 1B1ZA 3PMFA 3W1GA 5IP7G 2PCFB 1NTGA 1VMCA 1KRSA 2PZTA 1HPCA 3QB3A 4X3UA 1EQRA 2PQAA 4HIMA 4IOCA 1IYUA 1B44D 1KAAA 5I4DA 2XGTA 4B3MQ 1JE5A 4EGVA 4HAEA 1RCVD 2I07B 4DAYB 1EY4A 4X65L 1YHAA 3H3VH 3HOZH 1YNNC 3I90A 1SYEA 1HRJA 1LUZA 2Z1CA 4FVMA 3CPWA 4DV6Q 4DFAA 1T9HA 1BVSA 1GHJA 3AYHB 1PH3A 1H9JA 1OXVA 3BZDB 4A3IB 3NENA 2N55A 3QO2A 4JOIA 2I5LX 3A8KE 2NVTB 4GKJL 5GAEC 1ENCA 3KJOA 2D2CC 3HS0C 5E3FA 3HOXH 4IPDA 1SYDA 2QF7A 1Z47A 4LUVA 5D3IB 1KIXA 3RUZA 2E2IB 4AQYQ 3CPFA 2N3SA 4JBKA 3K6OA 1XTDA 3DUZA 4GN5A 3URYA 5LMUL 4C3HH 2AQ1B 1C7YA 2JA8B 2UUBQ 3PO3H 5M5XH 4KV6A 3H94A 3F2CA 1L0XB 3STBD 1EEID 5CV7A 1J6QA 2LXKA 4DV5Q 1HNZL 4L5SA 4IPHA 2B2UA 2R3ZA 3CCMA 3S1NH 1I4RA 2QGQA 4LAAA 3KF6A 5E4WC 2EYJA 2WAQG 2HT1A 4A3CH 4L5RC 5IYDG 1LTRD 2K05A 1S5CD 1LLRD 1WTQA 2K5DA 2ZJRA 2JA7H 5IGCA 4UPAA 4DR2L 2ZM6L 5FO7B 3UDXA 4PV1C 3MFGA 1Y1WH 1QWYA 4K2LA 3U9SA 1PH8A 4X62L 5C3XA 3L3OC 1JMCA 1IYJB 2NWGA 1VQBA 4DR4Q 2CQAA 3I4LA 3G6JB 4UP9A 3L9AX 4F88A 5IGGA 3CRKC 3TSSA 4CDEC 2VB3X 1EIFA 1TS2A 2L55A 3CCSA 4JC0A 4JI3Q 3T1YQ 1Q1EA 2DNCA 1FVIA 4C3JH 3CKIB 1MSGA 2JA9A 3FPUB 1P8LA 3HGBA 2E76C 1FGUA 1XPRA 4BY1B 2PQAB 2PZWA 5IP9H 3M4YA 3HOVH 3DM1A 4LWCA 3PIPA 3S16H 1W3SA 4RGNA 5J3BA 1EY7A 4HN7A 3SDZA 4DXGA 5IWAL 1R9TB 2Z0SA 3TEHB 4DR6L 5M3MG 1C0AA 1NNXA 3KOJA 4MTKA 5DAUA 1S5BD 5JAVA 2KJXA 3IKJA 1HCZA 2KBNA 1G51A 3AEVA 4DR5L 5AJ3L 2VXWA 1YJ9A 3H15A 4BBSB 2UXCL 3RZDH 3FMCA 3BDLA 3MXNA 2Z9HA 2YTXA 4BA2I 3CMAA 1LT3D 2VQEL 2MO0A 3I4MH 1SN8A 2AKWB 4NKLA 3A0JA 1LYLA 3M7NA 1I4PA 2EQSA 2WFWA 4AYBE 1IL2A 4RGMA 2F0LA 1JJ2A 1GUSA 1VQLA 1WTVA 4BWGB 3H6MA 4X65Q 4DA2A 2K5NA 3H3VI 2K33A 5IGEA 2RKSA 4KJNA 5FLXL 2F3IA 2D9UA 4DK1A 2F0MA 4OO1G 3I72A 1KAWA 2XWJB 4K5VA 2JQOA 2B2UC 1SJHD 5IT9L 1YNND 4A3MB 2A69C 4JI5L 3KF6B 1E22A 1NSNS 2FMMA 1LTBD 1KL9A 4GS3A 4OHJA 4GKJQ 5I9OA 3BYYB 5EAYA 3NUCA 5C3EG 3H3VC 2AQ3B 2L1BA 1GUTA 5IE8A 5EPJA 2VB2X 5DLQE 5C4XG 2EYFA 3GTLH 4CJ2C 3M4OH 4I7ZC 3C2PA 3VR5A 4DNRB 5LMUQ 4NP5A 1M8AA 3T13A 4K14A 3OIQA 2Z6BA 3MFYA 1KXLA 2UUAL 3E0EA 2H4OA 1G6PA 1WTPA 5CV5A 2ASBA 2K1BA 4IFDJ 1I50B 1HNZQ 3J7ZC 1GM5A 3SK4A 4GLAC 3VDYA 5NUCA 3U4ZA 4DV1L 4XTCS 2JK8A 4FXGC 1KLUD 1LABA 3ND9A 5FOBB 4LJZC 1R4QB 5BN3A 1LO5D 2L0CA 2IY5B 3OWEB 5LL6S 3CMEA 3NBIA 2B2VA 2KHIA 2PI2A 4EQNA 3TBIB 5C3WA 1TWHB 4X66L 2ZM6Q 3E9IA 1VQ5A 4P2CB 1JOKA 1CKNA 1UAPA 3GV3A 1XPUA 1TQOA 4X62Q 2PPBC 2DY7A 1HHVA 2X6LA 1LT5D 3AU7A 4QGUA 2B8GA 4WJ3M 1LACA 1ONLA 1S5DD 1TWFH 2BH2A 3DEOA 4QL5A 5JPNC 2EJFC 2PW7A 2Q8IB 4OWWB 3W3AA 4NDXA 2F03A 3MXNB 3JAML 1TWGH 4R4OA 2F0VA 1X3QA 3GQBA 1WCMB 1EOTA 1M90C 5ELDA 2F0QA 1K3RA 3MWYW 1MI2A 3S24A 2NTTA 3CHBD 3PCOB 2EYMA 2AUJD 4FP5D 1PH6A 4Y7NH 2FJ2A 1A3VA 4MNOA 4KMUC 3P1HA 5IWAQ 1U4MA 3RZOB 2F0TA 2NVYH 2M2LA 3MEFA 5KEEA 5FLXE 1C9OA 2K6AA 1GUGA 4OWTB 4OWXB 4KHZA 1PFSA 1AP0A 4L6TB 1PTOF 3AMUA 2NN6H 5IT9E 3PUWA 5EPLA 3ERSX 3S17H 1GKHA 1F9SA 1Q8IA 2EXDA 4DR5Q 5AJ3Q 1SNCA 1LTTD 2F0NA 1AZPA 2OQKA 3HOYB 2UXCQ 2B63G 5C4HA 2L5TA 3CAMA 3KFUA 3VYSA 3F1ZA 4DR7L 1TVXA 1XYIA 5JVG3 2F0SA 2RDFA 2VQEQ 3I70A 4ME5A 1DGSA 2Z8LA 3S1RH 4HIKA 2F3WA 3RMHA 4X64Q 3WWVA 1KC8C 4R4CA 4QUCA 2Y0SB 1MIUA 2F0WA 3FHWA 1I3QH 4C3IG 3CRLC 3NEMA 3G6EA 3I4NH 3GTJH 4QIWB 5CMDA 4LFAQ 1ASYA 2RF4A 4A3JG 4A3FG 1ESFA 3ER0A 1YNXA 4JI5Q 1VQJA 1D8LA 1TY0A 1YI2A 3HG9A 3NQTA 5KNBA 1VMPA 5M3MB 3J7AF 2PQEA 5FLMG 1K8GA 1G291 5C0XG 1WOCA 3PO2G 2WKCA 1X6OA 1TWCH 1HNWL 4KK7A 4YHHL 3IFDA 1LTSD 2B2VC 1Y8OB 3HKZE 3K58A 2R92G 1OXSC 1CKNB 3BZKA 4A3BH 1CZGA 1W6KA 1G2TA 1QILA 3CCQA 1JJGA 3MTSA 4CJ1B 2NBFA 2RCNA 2UUAQ 3KLRA
chains in the Genus database with same CATH topology
3K5LA 3H09A 4R9WA 3JAME 5DNFA 1QE6A 1Q1BA 3S1MB 1BNZA 3NK9A 1SEBD 3LWUA 1TR5A 4KTAA 3ND8A 1YNJC 3HOUB 2A5HA 2HUGA 1DOKA 3D31A 4MN3A 1SAPA 1CTMA 5CYUA 2MGSA 4IUQA 4E6IA 1KNAA 2F1MA 2LY7A 1MBYA 4K2KA 5CV4A 5T1GA 4PMCA 2L11A 3UI2A 4V0BA 4N9TA 4FXKC 1LTGD 3Q0AA 1I4GA 3VR4A 2AWOA 3K7AB 5CV9A 3N52A 4KD4A 4JK1C 3VA7A 3GTMB 2YU9B 1JOQA 2OF1A 1PFNA 4DGZA 3S1QB 3DWPA 1MD2D 1V1PA 1PYWD 3MVVA 3SE0A 3H0GB 2DY8A 3QOJA 5LL6X 2F0OA 4ZKBB 1VDZA 1RKNA 1UEAB 3TP5A 4C56C 1D5MC 1WTXA 2JP1A 2JEAI 2F3VA 3SEBA 1D2BA 3CQZB 1EU4A 2JYOA 2EZVA 3LX0A 2KOLA 1HXYD 5JEAJ 4IURA 2V4DA 3CU7A 1U9RA 4XXEA 2LMCB 3E0JA 1A3TA 1ZYRC 4H0LC 2R6GA 2CHBD 3D4WA 2ICEC 4DAPA 2L12A 4Q5VA 2KQ3A 3C1EA 1CA6A 3TDQA 4BBRB 4DK0A 3S2HB 1TKWB 1QCBD 5JVH3 4KY6A 2EPBA 1WVLA 4IUNA 3NWTA 3L7ZC 1BR9A 3V96A 3A55A 4KKSA 3TZUA 1STBA 2B63B 1H9MA 2EY5A 1HTLD 4A3KB 1FYCA 2EY2A 3FEWX 3FKIB 4C1NK 1BCPF 1JE4A 2IWHA 3J7YW 1BOSA 2K5WA 5ELCA 2MHVA 2Q8TA 3A8IE 1BF4A 3W2DA 5EJWA 2QEJC 3U9OA 4A3JB 1A2TA 3BDCA 4O1NA 4LMQD 2K32A 1V1PB 5C0XJ 2PO4A 5C5MA 1TWAB 1V43A 2NYZD 2L9HA 5I6WA 4WRDA 2F0KA 3K0YA 2WV6D 4DN4M 1ET6A 4XQJA 1YNJD 3OWFA 1JOOA 3VYUA 1JQYD 3DMUA 4I65A 4UDUC 2R92B 1VF5C 3NPPA 4KKUA 1RD9D 3NSWA 1WD1A 4KD3A 2EYPA 2KCCA 2VUMB 2B2WA 1Y69U 3GTKB 2PZUA 3QWNA 4XYOA 1EY0A 2EE1A 5CBAE 4O42A 4QF4A 3FVQA 4H44C 3PV0A 4F87A 3HZXA 1EZ6A 3MXPA 2K7VA 4B9WA 1GJXA 1XWEA 1SSOA 3OSOA 3GTOB 2E75C 2J0TD 1IKMA 1LTAD 3AB9A 2F0UA 4IFDH 1Q12A 2J7ZA 2JA6B 1SDFA 3BVZA 2G9DA 1F9PA 4OGQC 3R2TA 2ZXOA 4Z9CB 1AN8A 3WOEA 4C3HG 1PTOB 3C1FA 3Q22A 1GOZA 3BVMA 5EKLA 1PRTC 1PRTB 2R61A 3OPOA 3X3NA 5EKKA 2X6GA 2O2LD 1J9OA 2N88A 3MC0B 1ZYRD 1FNVA 1CK1A 1VF7A 4CHTB 1DOMA 3E5SA 5M5YB 1EYDA 2B39A 3KF8A 1UUPA 4A3DB 2L4NA 1UNSA 2F0EA 4CJ0B 1CQVA 1ENAA 4ULLA 3S9WA 2B2TA 1CA5A 1W6JA 2JXMB 3BS1A 3SHLA 1DOLA 4C3JG 2YYZA 4RGOS 2LKVA 1H9RA 2RA4A 3MAQA 2XN9C 1E2VA 5KNDA 4U68A 4RKBA 1KDBA 4UAIA 1JC7A 3MA2B 5DM73 2B2WC 3GD7A 4KI0A 1GUWA 2R7ZB 1PZKD 3P7JA 1E2ZA 5T1IA 3BG3A 2O5IC 1F2MA 1EEFD 2KCNA 4WFN3 2JEBI 3GTQB 3J81L 1D5ZC 3DEPA 2ICIA 5C44B 1G6ZA 4G7ZC 2E2JB 5ELFA 3WDNA 3GTPB 1STHA 3KBGA 4QB4A 5ISRA 4WJWA 5KYIA 3ONAB 2IJ0A 1EYCA 4HMIA 1JR0D 3K5MA 1A3UA 4WORA 1BUVT 3E6ZX 3T4AC 1BO0A 5I2YA 5JOBA 4J1MA 4FF1A 1Y8PB 3NXWA 1I4QA 2Z4HA 3F2UA 2IW3A 4RHSA 5CC4A 4IFDI 3M7GA 1MGSA 4XQQA 1IW7D 2A6ED 1JICA 1NAPA 4QUFA 1KABA 3K57A 2ZXPA 1HUMA 2VNUD 2B2TC 1NCVA 1NR2A 4NW2A 5DM63 5BN5A 5JPMC 2NZ1D 4MHEA 2XNAC 5IOCA 5IGBA 2E2DC 3HP3A 1PRTD 5F2DA 3NTKA 2RBMA 1CZWA 1SXTA 2IPKD 1F2ZA 1OXXK 2BDOA 2OEOA 1X3PA 1TU2B 2OXPA 3C46A 4A3GB 1ENFA 2O4XA 5D3DA 1LT6D 3J81E 2WACA 1O80A 5IODA 4IQZA 5IIFA 5I2XA 4GZYC 2CW0C 2QCPX 3A56A 4OIKA 2C9OA 3S2DB 5M5WB 4MIUA 2HCIA 1CT1D 4R8NA 4HTHA 2B8FA 1O7ZA 1STGA 1JB3A 1X32A 1CQFA 1SNMA 2WAQB 5JEAH 5C6AA 1AEXA 4TSSA 2IX0A 1II3A 1V8QA 2NN6G 3ERQA 1EL0A 5J1ZA 3QOLA 5CV6A 1R4PB 4ZUIA 4ZLTF 1RHPA 1BXTA 1U4RA 1LV9A 4TRDA 5TSSA 4DF7A 1PZID 5I9PA 1I6VC 2IX1A 3OW7A 3A7LA 3TMEA 2ID0A 4CKBA 2HDMA 3PUYA 5AFWA 2PNRC 1B2TA 5C4JB 1QB5D 1G2SA 2MUYA 3EQLC 3SK6A 2O5JC 3BVGA 1S4ZA 4BA1I 2QILA 4H13C 5CGKA 3P20A 1VCIA 3A54A 4QCLA 4OO1I 5EPKA 5J39A 3GP7A 3EROA 1G8ZD 1JWUD 3D3RA 5KGUA 4RGTA 3VR2A 1LTID 2HCCA 1SYFA 4KHVA 1EY5A 1CFMA 3P75A 2QKIC 1KDCA 1PZJD 1BQQT 3QJYA 2KVMA 3I3CA 4DU9A 1RODA 2NVQB 2FINB 4FO2A 1I4HA 4PMBA 4M8AA 5C3EB 1DM0B 1ZKOA 1ZXTA 1SBBB 3QG1A 4V190 3RD4A 1STYA 1HFGA 5C4XB 5K5PA 4FYDA 1ILQA 3FRPB 3C3LA 1STEA 1KLGD 3NBHA 1DZ1A 2A68C 1B9NA 4RKLA 2CW0D 2HQEA 4IZ8A 1S5ED 2SNMA 1K83B 3EFXD 2MP1A 2XRQD 3NHHA 3Q24A 5IGFA 1PTOH 5G3LF 1A2UA 1C8CA 2TSSA 3D4DA 4ZRZA 4IUVA 1HA6A 4DXFA 3V05A 4ZYSA 2DNEA 2M9VA 4G7OC 1WD0A 5A2QL 2BOSA 5KIXA 4U673 1Q3LA 1SNOA 2KA7A 2F0JA 2IX3A 1QNUA 3GTGB 4RHRA 1O78A 3OMCA 4PMWA 4RAUC 1D1IA 3MEHA 5J22A 3VR6A 3MXGA 4QMGA 4K6DA 2NTSA 5CBEE 1FNWA 1HQRD 2DN8A 4RCNA 1EYAA 4PNYA 3GV6A 2ENBA 2EY6A 3SK5A 1BBXC 4HSVA 1EWCA 4KJOA 2XSCA 2EJMA 1HTPA 1U4PA 3M85A 1F9QA 4G57A 2JSOA 2AUKA 4IALA 5FO9B 1SE2A 1DJRD 4FNFA 3NP8A 5CV8A 5C0XI 3DHQA 5KRUA 1TIID 4C3IB 3KLSX 4A3FB 1B53A 1EIGA 5E4XA 2WINB 1Q90A 1XXGA 3PO2B 4M1UB 5EKIA 2RVLA 1TS3A 5K36H 2H1EA 4YIJA 3I8ZA 2RQXA 4S3SA 4CKEA 5A2QE 1ESRA 4AYBB 2BA0A 1TY2A 5M9OA 4IUPA 1IYVA 3NTIA 1GUOA 2A68D 4KY5A 1ET9A 2SOBA 3EJIA 1EQVA 2K28A 2B2YA 1EWHA 3NWSA 1TS4A 2EVBA 1IL8A 1WTWA 3TP7A 1KTKA 3R3OA 1NUCA 4OL7A 1SYCA 2EJGC 5CORA 3DWQA 1C48A 2F0DA 1IW7C 2A6EC 5FK9C 3EA6A 4IFDG 1SMYC 2NB0A 2R93B 4F8MA 1QNKA 1TT2A 5D14A 5LHY1 3M3YB 3FDTA 1PDQA 3Q6SA 4A93B 1PTOC 3GO5A 1G91A 2EYHA 3KK7A 1D1KA 3R93A 2KECA 3PUVA 1B3AA 4BY7B 2JA5B 4TKOB 2J4XA 4DNTB 4CKCA 3D4RA 4F7XA 3S14B 1S5FD 5EGTA 4B9XA 1SE3A 2EYLA 4KN4C 4C1NI 5D65A 4ZK9B 2EY1A 2WKDA 3FPPA 1K8MA 4IUTA 4L63B 3SR1A 4B08A 2EXZA 1XTCD 1ML0D 3S15B 2M00A 1GUNA 1PFBA 3HEJA 5C4ZA 1STNA 3ZYYX 3VYRA 4DAVA 2MJ8A 4ZAIA 3OMGA 1KDAA 4FF4A 3H91A 1I6HB 3T56B 2F0PA 1U4LA 3R2IA 1SE4A 1H9KA 4EVOA 1WTRA 5COYA 2LS01 3IL8A 2A6HC 1CI3M 4Q0FA 2F0IA 4IUUA 1EIHA 3TZDA 1MSHA 4K5XA 5E1FA 2B2YC 4L8JA 3OIPA 1SNDA 1I4XA 3PIO3 1OXTA 4IN3A 1CHQD 1A6XA 2SDFA 4OIJA 1SJED 1JCKB 3NQIA 2NVXB 1BDOA 4LK1C 1Y1VB 4C2MB 1RDPD 2PYKA 1F77A 3OOCA 3LWEA 5CR3A 5KYLA 3RLFA 3MHBA 1D5XC 1K8OA 1SFOB 4K8JA 2I46A 2E2HB 2C5CA 1PMRA 3LNNA 1HQMC 1FNUA 4X3TA 3I73A 1E0BA 4ODGA 3VYTA 4A3EB 1CHPD 3T51B 2K5QA 2RSOA 2FHTA 4X3SA 5M3FB 4HR7B 3HOWB 1SYGA 4KY7A 3J7AV 4OO1H 4N9PA 4RFBA 1AFPA 4BS9A 1TS5A 1SMYD 3HKZB 2QDBA 4K5WA 4JBWA 1EFID 3D6CA 1PTOD 3HOZB 4HCEA 4XT1B 2IT1A 2AQ2B 4NMZA 1AZQA 2BE5C 1Y8NB 2BA1A 3HRZC 4EQPA 1H9SA 4CGYB 1C4QA 4G7HC 3SVMA 4FF3A 3HOXB 1NR4A 1QJOA 1Z6HA 1PFMA 4C3HB 5C5LA 2RSNA 3PO3B 5M5XB 3TP8A 2SEBD 5ELEA 1FR3A 2KEEA 3S1NB 3WOFA 2ZXRA 1EY6A 3KLSA 5FO8B 2XIWA 1BCPC 1BCPB 5JEAG 2X69A 2ZT9C 2EDGA 4TQUS 2A6HD 1PLFA 2JA7B 1FGBD 3R8BA 1GHKA 2KHSA 1Y1WB 5HURA 2FFKB 4J8QA 2A74C 1IKLA 5A35A 1XX8A 4XYQA 2SNSA 2D5DA 3SXHA 1WTOA 2K01A 4C3JB 4HEDA 1HA5A 5DEHA 4XIGS 2K03A 3K5NA 1SNQA 4XT3B 3HOVB 3S16B 1PRTF 3PUZA 1A15A 5ELBA 1V1OA 1O7YA 2PMZB 2XWBB 4H7BA 2RDGA 1B4OA 1F2YA 2F0GA 1M4VA 1STAA 3TP6A 2BCOA 1H9SB 3RZDB 2CVRA 4RA8A 4ID6A 1JORA 3A7AB 1HFNA 2XVSA 5G3LD 3I4MB 1RTNA 1RF2D 1RJTA 5EBDA 4CBVA 1DCZA 4K8IA 5C0XH 2A69D 3K5OA 1B50A 3SK8A 1JWSD 2K04A 3O13A 1CM9A 4ZQ3A 1EY8A 2BE5D 4G4KA 1F9RA 2HDLA 4HMJA 4K6LA 4RWSC 5I6YA 4ILWA 2BDNA 1L0YB 2A73B 2F0FA 4FXDA 1OO9B 2Q8RE 1EQTA 3D6WA 2KUMA 3X3MA 1AW7A 4FF2A 1DXMA 3MZ5A 3PUXA 3DWAA 3MXUA 3GTLB 3M4OB 3K59A 5FKAC 1T5XD 1DONA 1SNPA 4HSPA 5IGDA 2G9HD 2TMPA 4RCOA 1DD2A 3VA5A 3I91A 4KKTA 2AWNA 1E2WA 3T53B 3Q23A 1EU3A 2NUCA 3IFTA 2OT2A 3NTHA 1QOHA 4X3KA 3DXJC 1BCPD 1GXDC 2EOTA 1JWMD 5JJZA 3VR3A 2RDHA 3J80L 4ABNA 2EYOA 3T16A 1HUNA 1TWFB 4KN7C 1QG7A 1TWGB 5HGTA 2NN6I 2GA4B 1ILPA 4Y7NB 1IHZA 4DAYA 3A8JE 2NVYB 2JE6I 2KEDA 4RH6A 3S17B 2PW5A 5BN4A 1D6EC 2MPMA 2WB1B 1LT4D 4ZUJA 2LFNA 3IAYA 2F0HA 4J6HA 3S1RB 1F2LA 3ITPA 2F4IA 1RTOA 2E74C 4XDXA 3N6RA 1I3QB 5EQ0A 1T5EA 3BDOA 1KNEA 3I4NB 3GTJB 2IL8A 2XRSD 3BYTB 2WP8J 3QIAA 3V2TA 2D62A 4HCSA 3D8GA 4EQOA 4R8IA 4PQXA 2FMCA 3KUPA 1Z7TA 1EY9A 1SYBA 3OHXC 1OXUA 3EVQA 1TWCB 2Z4IA 5K36G 1PXUA 1B9MA 1O7LA 3G7LA 1ICWA 3NE5B 4A3BB 2WIIB 3KBXA 3PIP3 1DYQA 1ZEQX 4ZKCB 5EBCA 3J80E 1EZ8A 1J8IA 3TN2A 5KNCA 4XQNA 1FD7D 1B1ZA 3PMFA 2PCFB 1VMCA 2PZTA 1HPCA 3QB3A 4X3UA 1IYUA 1B44D 1KAAA 5I4DA 4EGVA 4HAEA 1RCVD 2I07B 1EY4A 1YNNC 3I90A 1SYEA 1HRJA 2Z1CA 4FVMA 4DFAA 1GHJA 1H9JA 1OXVA 3BZDB 4A3IB 2N55A 3QO2A 3A8KE 2NVTB 1ENCA 2D2CC 3HS0C 5E3FA 1SYDA 2QF7A 1Z47A 5D3IB 3RUZA 2E2IB 3K6OA 3DUZA 3URYA 2AQ1B 2JA8B 4KV6A 3H94A 1L0XB 1EEID 5CV7A 2B2UA 2R3ZA 1I4RA 4LAAA 5E4WC 2EYJA 1LTRD 2K05A 1S5CD 1LLRD 1WTQA 2K5DA 5IGCA 5FO7B 4PV1C 3MFGA 1QWYA 4K2LA 3U9SA 5C3XA 3L3OC 2NWGA 2CQAA 3I4LA 3G6JB 4F88A 3L9AX 5IGGA 3CRKC 3TSSA 2VB3X 1TS2A 2L55A 1Q1EA 2DNCA 3CKIB 1MSGA 3FPUB 3HGBA 2E76C 4BY1B 2PZWA 3M4YA 3DM1A 4RGNA 1EY7A 4HN7A 3SDZA 4DXGA 1R9TB 5DAUA 1S5BD 5JAVA 2KJXA 3IKJA 1HCZA 2VXWA 4BBSB 3FMCA 3BDLA 3MXNA 4BA2I 1LT3D 4NKLA 3M7NA 1I4PA 4RGMA 2F0LA 1GUSA 1WTVA 4BWGB 3H6MA 4DA2A 2K33A 5IGEA 2RKSA 4KJNA 5FLXL 2D9UA 4DK1A 2F0MA 4OO1G 3I72A 2XWJB 4K5VA 2B2UC 1SJHD 5IT9L 1YNND 4A3MB 2A69C 1NSNS 2FMMA 1LTBD 4OHJA 5I9OA 3BYYB 3NUCA 3H3VC 2AQ3B 2L1BA 1GUTA 5EPJA 2VB2X 2EYFA 4CJ2C 4I7ZC 3C2PA 3VR5A 4DNRB 4NP5A 1M8AA 3T13A 4K14A 3OIQA 3MFYA 2H4OA 1WTPA 5CV5A 2K1BA 4IFDJ 1I50B 3SK4A 5NUCA 4XTCS 4FXGC 1KLUD 1LABA 3ND9A 5FOBB 4LJZC 1R4QB 5BN3A 1LO5D 2L0CA 3OWEB 5LL6S 3NBIA 2B2VA 4EQNA 3TBIB 5C3WA 1TWHB 4P2CB 1JOKA 1UAPA 3GV3A 1TQOA 2PPBC 1HHVA 2DY7A 2X6LA 1LT5D 3AU7A 2B8GA 1LACA 1ONLA 1S5DD 3DEOA 5JPNC 2EJFC 2PW7A 2Q8IB 3W3AA 4NDXA 2F03A 3JAML 2F0VA 1X3QA 3GQBA 1WCMB 1EOTA 5ELDA 2F0QA 3MWYW 1MI2A 2NTTA 3CHBD 2EYMA 2AUJD 4FP5D 2FJ2A 1A3VA 4KMUC 3P1HA 1U4MA 3RZOB 2F0TA 2M2LA 5KEEA 5FLXE 2K6AA 1GUGA 4KHZA 1AP0A 4L6TB 1PTOF 3AMUA 2NN6H 5IT9E 3PUWA 5EPLA 1Q8IA 1F9SA 1SNCA 1LTTD 2F0NA 1AZPA 3HOYB 5C4HA 2L5TA 3VYSA 1TVXA 1XYIA 5JVG3 2F0SA 2RDFA 3I70A 4ME5A 2Z8LA 2F3WA 3RMHA 4QUCA 2Y0SB 2F0WA 4C3IG 3CRLC 4QIWB 5CMDA 1ESFA 1TY0A 3HG9A 3NQTA 5KNBA 1VMPA 5M3MB 3J7AF 2PQEA 1G291 5C0XG 2WKCA 4KK7A 3IFDA 1LTSD 2B2VC 1Y8OB 3K58A 1OXSC 1CZGA 1W6KA 1G2TA 1QILA 3MTSA 4CJ1B 2NBFA 3KLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K01 A;  1X3Q A;  5EQ0 A;  2H1E A;  1PFB A;  1EOT A;  1WD0 A;  4HED A;  1GUW A;  3P7J A;  4R9W A;  3MWY W;  5T1I A;  1KNE A;  3I8Z A;  1MI2 A;  1Q3L A;  1S4Z A;  1QE6 A;  5DNF A;  3I91 A;  2L12 A;  2MJ8 A;  4ZAI A;  2IL8 A;  2K03 A;  1X3P A;  1CA6 A;  1WTV A;  1SSO A;  4XT3 B;  3H91 A;  1BNZ A;  3DEP A;  5EPK A;  4HCS A;  2FJ2 A;  1IKM A;  4XT1 B;  4R8I A;  1A15 A;  1U4L A;  2B2U A;  2D9U A;  4RAU C;  2R3Z A;  4X3K A;  1WTR A;  1AZQ A;  1G6Z A;  1O80 A;  1U4M A;  3KUP A;  1ESR A;  5COY A;  1WVL A;  2J7Z A;  2EPB A;  2M2L A;  3IL8 A;  1O7Y A;  2B2U C;  4IUP A;  5E4W C;  1SDF A;  2HCC A;  2EOT A;  5CBE E;  4OIK A;  1F9P A;  2FMM A;  1AP0 A;  2K05 A;  1B4O A;  5JJZ A;  2HUG A;  1DOK A;  4IUU A;  3G7L A;  1WTQ A;  5EPL A;  4MN3 A;  1EIH A;  1SAP A;  1ICW A;  2K28 A;  2B2Y A;  1F9S A;  2HCI A;  3TZD A;  2MGS A;  4IUQ A;  1KNA A;  1MSH A;  3KBX A;  1IL8 A;  1AZP A;  3ONA B;  1WTW A;  2B2Y C;  5T1G A;  4ZKC B;  3SVM A;  1HUN A;  3GV6 A;  1O7Z A;  1J8I A;  2CVR A;  5COR A;  1NR4 A;  1QG7 A;  4RA8 A;  2L1B A;  2KVM A;  1TVX A;  3I3C A;  2L11 A;  3UI2 A;  1X32 A;  2SDF A;  5EPJ A;  3TN2 A;  1XYI A;  1JE4 A;  1HFN A;  1ROD A;  2NWG A;  1BBX C;  1RTN A;  4HSV A;  4OIJ A;  4CJ2 C;  2X6G A;  1VMC A;  1RJT A;  3N52 A;  2FIN B;  1BO0 A;  1PFM A;  2Q8T A;  1BF4 A;  1QNK A;  1J9O A;  2N88 A;  5D14 A;  1M8A A;  2RSN A;  3FDT A;  1PDQ A;  1PFN A;  4QUC A;  1EL0 A;  3F2U A;  1ILP A;  1U4P A;  5EJW A;  1F9Q A;  3Q6S A;  4X3U A;  1DOM A;  1WTP A;  1B50 A;  1G91 A;  1ZXT A;  2K1B A;  1MSG A;  3LWE A;  2KEE A;  3FPU B;  2K04 A;  2DY8 A;  4LMQ D;  4HAE A;  1HFG A;  3R93 A;  4ZKB B;  2L4N A;  5CMD A;  4ZLT F;  1MGS A;  2KEC A;  2NYZ D;  3DM1 A;  4CJ0 B;  1CM9 A;  2L9H A;  1ILQ A;  1B3A A;  1RHP A;  2KED A;  1JIC A;  2XIW A;  1NAP A;  3I90 A;  4QUF A;  2X69 A;  1VMP A;  1HRJ A;  1U4R A;  1F9R A;  2B2T A;  2HDL A;  1DZ1 A;  1LV9 A;  4RWS C;  4DN4 M;  1CA5 A;  1PLF A;  2JP1 A;  1WTX A;  1HUM A;  2BDN A;  2B2V A;  2B2T C;  4X3T A;  2MPM A;  1NCV A;  2JYO A;  1E0B A;  2Q8R E;  1NR2 A;  3IFD A;  1EQT A;  1DOL A;  2B2V C;  3GV3 A;  3D6W A;  2KUM A;  2RSO A;  4NW2 A;  2KOL A;  2MP1 A;  2FHT A;  4X3S A;  2RA4 A;  5D65 A;  4ZK9 B;  1WD1 A;  2N55 A;  3QO2 A;  1HHV A;  2DY7 A;  4IUR A;  2FFK B;  4U68 A;  2NZ1 D;  2X6L A;  4MHE A;  1B53 A;  1IKL A;  4UAI A;  2VXW A;  1EIG A;  1C8C A;  1G2T A;  5E4X A;  2HDM A;  1F2L A;  4IUT A;  2B2W A;  4IUV A;  1XX8 A;  1HA6 A;  3HP3 A;  3DEO A;  1DON A;  3MTS A;  4CJ1 B;  5AFW A;  2EE1 A;  1RTO A;  5CBA E;  1B2T A;  2B2W C;  4O42 A;  4XDX A;  1ML0 D;  1G2S A;  5EKI A;  1WTO A;  2RVL A; 
#chains in the Genus database with same CATH topology
 4AYB G;  3K5L A;  2CCZ A;  1UE7 A;  3K0X A;  3H09 A;  1ASZ A;  4R9W A;  3JAM E;  5DNF A;  1QE6 A;  3CD6 A;  4DV1 Q;  1Q1B A;  3S1M B;  2HQL A;  1BNZ A;  3NK9 A;  1SEB D;  3LWU A;  3F2B A;  1TR5 A;  1YIT A;  4KTA A;  3ND8 A;  4DV2 L;  1YNJ C;  4X66 Q;  3HOU B;  2A5H A;  2HUG A;  1DOK A;  2R93 G;  1B7Y B;  4HJ9 A;  3D31 A;  4MN3 A;  1SAP A;  1CTM A;  2KEN A;  5CYU A;  2MGS A;  4IUQ A;  4E6I A;  1EIY B;  1KNA A;  2F1M A;  2LY7 A;  3U50 C;  3J80 c;  1MBY A;  4K2K A;  5CV4 A;  5T1G A;  3SGI A;  4PMC A;  4A76 A;  4A3I H;  1WTH A;  2N8N A;  2L11 A;  3UI2 A;  2G5D A;  4V0B A;  2N78 A;  4N9T A;  4FXK C;  1XNQ L;  2NVT H;  1LTG D;  3Q0A A;  1I4G A;  3VR4 A;  3F8T A;  2AWO A;  3K7A B;  5CV9 A;  3N52 A;  4KD4 A;  4JK1 C;  3VA7 A;  3GTM B;  2YU9 B;  1JOQ A;  4POF A;  2OF1 A;  1PFN A;  4JI2 L;  4DGZ A;  2JA5 G;  3S1Q B;  3DWP A;  1MD2 D;  2EIF A;  2E2I H;  1V1P A;  1PYW D;  3MVV A;  3SE0 A;  3H0G B;  4QY7 A;  2DY8 A;  3QOJ A;  2JA8 H;  5LL6 X;  2F0O A;  4N8F A;  4ZKB B;  1VDZ A;  1U5K A;  1RKN A;  1UEA B;  3TP5 A;  4C56 C;  4DPG A;  1D5M C;  3KDF A;  1WTX A;  2JP1 A;  2JEA I;  2F3V A;  2LSS A;  3NEL A;  3SEB A;  1D2B A;  3OTO L;  4P73 A;  3CQZ B;  1EU4 A;  2JYO A;  2EZV A;  3K80 C;  3LX0 A;  2KOL A;  5GRO A;  3M4P A;  1HXY D;  5JEA J;  4DR7 Q;  4IUR A;  2V4D A;  3CU7 A;  1U9R A;  1VQO A;  2I5M X;  4XXE A;  4DV3 L;  4ME3 A;  1P16 A;  2LMC B;  3E0J A;  1A3T A;  1ZYR C;  1H95 A;  4H0L C;  1CUK A;  1X9N A;  2R6G A;  2CHB D;  3D4W A;  2ICE C;  4DAP A;  1Q8K A;  2L12 A;  4Q5V A;  3K81 C;  2KQ3 A;  3C1E A;  1CA6 A;  3TDQ A;  4BBR B;  4DK0 A;  1QVC A;  3S2H B;  1GO3 E;  4RMF A;  4BY1 H;  1TKW B;  1QCB D;  5JVH 3;  4KY6 A;  2EPB A;  1WVL A;  4IUN A;  3NWT A;  3L7Z C;  1BR9 A;  1HNW Q;  4YHH Q;  3V96 A;  3A55 A;  4KKS A;  3TZU A;  1STB A;  1Y1V G;  2R7D A;  2B63 B;  1H9M A;  1R9T H;  2EY5 A;  1CSP A;  1HTL D;  4A3K B;  2I5H A;  1FYC A;  1PHJ A;  2EY2 A;  3AFP A;  4MTN A;  3FEW X;  1B70 B;  3FKI B;  4C1N K;  1BCP F;  2E5L L;  2HD3 A;  1JE4 A;  2IWH A;  3ULL A;  3J7Y W;  1BOS A;  2K5W A;  3DLL A;  1HZA A;  5ELC A;  4BBS H;  2MHV A;  4BXX H;  3A74 A;  2Q8T A;  3A8I E;  1BF4 A;  4PZ8 A;  2OWO A;  1IXR A;  3W2D A;  5EJW A;  1YZ6 A;  2QEJ C;  3U9O A;  1N34 L;  4A3J B;  1A2T A;  2VL6 A;  3BDC A;  4O1N A;  4A3E G;  4LMQ D;  2K32 A;  1V1P B;  5C0X J;  2PO4 A;  5C5M A;  1TWA B;  1V43 A;  5M3F G;  4DV2 Q;  5L37 A;  2NYZ D;  4DR1 L;  2L9H A;  5I6W A;  3HOW G;  4WRD A;  2F0K A;  3K0Y A;  3J81 i;  2WV6 D;  3GDE A;  4LF7 L;  4DN4 M;  1ET6 A;  1ICF B;  5IY0 A;  4XQJ A;  1YNJ D;  2ZTC A;  4IJH A;  3OWF A;  1JOO A;  3VYU A;  1JQY D;  3DMU A;  4I65 A;  3HKZ G;  3KDF B;  4UDU C;  2R92 B;  4A3M H;  1JT8 A;  1VF5 C;  3NPP A;  4GKK L;  4KKU A;  1RD9 D;  3NSW A;  1WD1 A;  4KD3 A;  2EYP A;  2A8V A;  1XNQ Q;  4OON A;  2KCC A;  2ZJQ A;  2VUM B;  2B2W A;  3HOZ G;  3G48 A;  1Y69 U;  1CSQ A;  2PZU A;  3GTK B;  3QWN A;  4GN4 B;  4XYO A;  1EY0 A;  2EE1 A;  5CBA E;  1K0S A;  1YIJ A;  1B8A A;  4IO9 A;  4O42 A;  4QF4 A;  3FVQ A;  4H44 C;  4JI2 Q;  3PV0 A;  4F87 A;  3HZX A;  1EZ6 A;  3MXP A;  3T1H L;  3B6Y A;  3W1B A;  2K14 A;  2K7V A;  4B9W A;  1GJX A;  1XWE A;  1SSO A;  3OSO A;  1L0W A;  1Q81 C;  3GTO B;  1QVF A;  2E75 C;  2J0T D;  1IKM A;  1I50 H;  1PV4 A;  1LTA D;  3AB9 A;  4EQ5 A;  4L5T A;  1AH9 A;  3HOX G;  2F0U A;  4IFD H;  1FJG L;  4A3G G;  1Q12 A;  2J7Z A;  2JA6 B;  1SDF A;  3OTO Q;  3BVZ A;  2IHE A;  2G9D A;  1F9P A;  4OGQ C;  4HIO A;  4YY3 L;  3W5O A;  2AHO B;  3R2T A;  2ZXO A;  4Z9C B;  1AN8 A;  3WOE A;  4C3H G;  3CF5 A;  3TS0 A;  2QDL A;  1Z9F A;  1PTO B;  1NY4 A;  3PO3 G;  4P74 A;  1TWH H;  3C1F A;  3Q22 A;  1GOZ A;  4DV3 Q;  3BVM A;  5EKL A;  1PRT C;  1PRT B;  2R61 A;  3OPO A;  3X3N A;  5EKK A;  3BU2 A;  2X6G A;  3UE0 A;  4A3C G;  2O2L D;  1J9O A;  2N88 A;  5IYB H;  3MC0 B;  1ZYR D;  1FNV A;  3UE1 A;  1CK1 A;  1VF7 A;  1X56 A;  4CHT B;  3G71 A;  2JA7 G;  1DOM A;  1WCM H;  3E5S A;  2NZH A;  5M5Y B;  1EYD A;  2B39 A;  4DNI A;  2WB1 E;  3KF8 A;  1UUP A;  4A3D B;  2L4N A;  2ZTD A;  1HR0 L;  2CKZ B;  1UNS A;  4DR3 L;  2F0E A;  4CJ0 B;  2N49 A;  1CQV A;  1ENA A;  4ULL A;  3S9W A;  2B2T A;  1CA5 A;  1W6J A;  3FP9 A;  3RZO H;  2RCF A;  2JXM B;  3BS1 A;  1AE3 A;  3SHL A;  1DOL A;  4C3J G;  2YYZ A;  4RGO S;  2LKV A;  4LW1 A;  1H9R A;  2E5L Q;  2RA4 A;  3MAQ A;  2XN9 C;  1E2V A;  5KND A;  4B3S Q;  4U68 A;  1SRO A;  4RKB A;  1KDB A;  4UAI A;  5IP9 G;  5FJ8 H;  3HOY H;  3HOV G;  1JC7 A;  2KHJ A;  3MA2 B;  5DM7 3;  2B2W C;  3UDG A;  2K4K A;  3GD7 A;  4KI0 A;  1VQ9 A;  1GUW A;  2R7Z B;  1PZK D;  1N34 Q;  3P7J A;  1E2Z A;  2YTV A;  3BG3 A;  5T1I A;  1F2M A;  2O5I C;  1EEF D;  2KCN A;  4WFN 3;  2JEB I;  1A63 A;  4DR1 Q;  3GTQ B;  3J81 L;  3CC2 A;  1D5Z C;  3DEP A;  1VQA A;  2ICI A;  5C44 B;  3IRB A;  4LF7 Q;  1G6Z A;  4JOI C;  5FLX c;  4HJA A;  4G7Z C;  1KQS A;  2E2J B;  5ELF A;  3WDN A;  5IT9 c;  3I4M G;  4GKK Q;  5JJI A;  1LTL A;  3GTP B;  4JI4 L;  5M3M H;  4MZ9 A;  1STH A;  3KBG A;  2HIX A;  4QB4 A;  5JJL A;  1O7I A;  5ISR A;  4WJW A;  3BJU A;  3ONA B;  5KYI A;  2IJ0 A;  1EYC A;  4HMI A;  1JR0 D;  3K5M A;  1A3U A;  4YCU A;  4JBM A;  3CCL A;  1Q46 A;  4APV A;  1IBM L;  3T1H Q;  1SR3 A;  4WOR A;  1BUV T;  3E6Z X;  3T4A C;  1BO0 A;  5I2Y A;  4K0K L;  1NMG A;  5JOB A;  4J1M A;  4FF1 A;  1Y8P B;  3NXW A;  4JV5 L;  1I4Q A;  2Z4H A;  3F2U A;  3OW2 A;  4DV0 L;  3PGZ A;  2IW3 A;  4GNX A;  4RHS A;  1VQK A;  4AH6 A;  5CC4 A;  1FJG Q;  4IFD I;  3S1M H;  3M7G A;  1MGS A;  4XQQ A;  1IW7 D;  2A6E D;  3KF8 B;  1JIC A;  1NAP A;  4QUF A;  1VQF A;  2IHF A;  1KAB A;  4YY3 Q;  3K57 A;  2ZXP A;  1PH5 A;  2ES2 A;  2DUD A;  1HUM A;  2VNU D;  2YTY A;  2B2T C;  2VZA A;  1NCV A;  3HOU H;  1NR2 A;  4NW2 A;  5DM6 3;  5BN5 A;  5JPM C;  2NZ1 D;  4MHE A;  3ULP A;  2XNA C;  2JJQ A;  5IOC A;  5IGB A;  2E2D C;  4R4I A;  3HP3 A;  2RHQ B;  1IZ6 A;  1PRT D;  1KD1 C;  5F2D A;  1N33 L;  3NTK A;  4A3L H;  2QW7 A;  2RBM A;  1CZW A;  1SXT A;  2D0O A;  2IPK D;  3K7A H;  1F2Z A;  3JAM c;  1OXX K;  4DR2 Q;  2BDO A;  3GTM H;  2YU9 H;  2OEO A;  3ULJ A;  1X3P A;  1TU2 B;  4DR3 Q;  3S1Q H;  2OXP A;  3L2P A;  3C46 A;  4A3G B;  1ENF A;  3H0G H;  2O4X A;  5D3D A;  1PYB A;  1LT6 D;  4HJ7 A;  3J81 E;  2WAC A;  1O80 A;  5HY6 A;  5IOD A;  4IQZ A;  5IIF A;  1WJJ A;  3I55 A;  5I2X A;  4GZY C;  1RL2 A;  4GLX A;  2CW0 C;  2QCP X;  3A56 A;  4OIK A;  2C9O A;  3S2D B;  2I0Q A;  5M5W B;  4MIU A;  1HR0 W;  3F2D A;  4DV7 L;  2DGY A;  3I7F A;  1D7Q A;  2HCI A;  2NZO A;  1CT1 D;  4R8N A;  3ZJY C;  4HTH A;  2B8F A;  2Q2U A;  3CQZ H;  1EYG A;  4KHP L;  1O7Z A;  4KLK A;  1N9W A;  1STG A;  1JB3 A;  2OTJ A;  1X32 A;  1XPO A;  1CQF A;  1SNM A;  2WAQ B;  1E1O A;  1VQD A;  5H1S E;  5JEA H;  5C6A A;  1AEX A;  4TSS A;  4I7A A;  2IX0 A;  4DR6 Q;  1II3 A;  1V8Q A;  2NN6 G;  3ERQ A;  2Q2T A;  1EL0 A;  4LNQ A;  4JPB W;  4UHV A;  5J1Z A;  3QOL A;  5CV6 A;  2WB1 G;  4JI7 L;  4NXN L;  4LF8 L;  3RN5 A;  1R4P B;  4ZUI A;  1XNR L;  4NPS A;  5HGQ A;  4GNX C;  4GNX B;  3RLN A;  4BBR H;  4ZLT F;  3S2H H;  1RHP A;  4DV4 L;  1BXT A;  4JI4 Q;  1U4R A;  5BR8 L;  1LV9 A;  1X3G A;  4TRD A;  1HH2 P;  5TSS A;  4DF7 A;  1PZI D;  5I9P A;  1I6V C;  2IX1 A;  1E1T A;  3OW7 A;  3A7L A;  2VY3 A;  3TME A;  2B63 H;  2ID0 A;  3I4N G;  1IBM Q;  2K52 A;  4CKB A;  2HDM A;  4A3K H;  2UXD L;  3PUY A;  4YCV A;  4K0K Q;  3FKI H;  5AFW A;  2PNR C;  1B2T A;  4ALP A;  4JV5 Q;  5C4J B;  1QB5 D;  1G2S A;  2MUY A;  5IYC H;  4DV0 Q;  3AFQ A;  1Q82 C;  3EQL C;  3SK6 A;  1YJN A;  2O5J C;  4A4I A;  3I56 A;  3BVG A;  1S4Z A;  4LF4 L;  4BA1 I;  2QIL A;  2Q2I A;  4H13 C;  5CGK A;  3P20 A;  1VCI A;  3A54 A;  4QCL A;  4OO1 I;  5EPK A;  1EOV A;  1YJW A;  1UE5 A;  5J39 A;  3KLW A;  3GP7 A;  4A3J H;  2F52 A;  1PVO A;  3ERO A;  1G8Z D;  2L15 A;  1VQI A;  1JWU D;  3D3R A;  5KGU A;  4RGT A;  3VR2 A;  1TWA H;  1S40 A;  1LTI D;  5FLM H;  1YHQ A;  2HCC A;  1SYF A;  4KHV A;  1EY5 A;  3EN2 A;  1CFM A;  2GVA A;  3P75 A;  5LMN L;  3KJP A;  2QKI C;  3RNU A;  3EIV A;  2K5H A;  1KDC A;  1PZJ D;  2R92 H;  1BQQ T;  1YEZ A;  3QJY A;  2KVM A;  3I3C A;  1N33 Q;  4LUO A;  4DU9 A;  1ROD A;  2C35 B;  2NVQ B;  1K28 A;  1X3E A;  2VUM H;  2FIN B;  4FO2 A;  3GTK H;  1I4H A;  1WYD A;  4PMB A;  4M8A A;  5C3E B;  1DM0 B;  1ZKO A;  1ZXT A;  1SBB B;  3QG1 A;  4V19 0;  1K73 C;  3RD4 A;  1STY A;  4A3I G;  4A93 G;  1A62 A;  1HFG A;  5C4X B;  5K5P A;  3PF4 A;  4FYD A;  1ILQ A;  3FRP B;  3GTO H;  3C3L A;  1STE A;  1KLG D;  3NBH A;  1DZ1 A;  4JI1 L;  4DV7 Q;  1L2F A;  2A68 C;  1B9N A;  4RKL A;  3M9B A;  2CW0 D;  2JA6 H;  2HQE A;  4X6A H;  1M1K C;  4IZ8 A;  4BY7 G;  2YV5 A;  1S5E D;  2SNM A;  4KHP Q;  1K83 B;  1EQQ A;  4POG A;  3EFX D;  2MP1 A;  2XRQ D;  3NHH A;  3Q24 A;  5IGF A;  2JA8 G;  1PTO H;  5G3L F;  1MKH A;  1A2U A;  4HJ8 A;  1C8C A;  2TSS A;  3D4D A;  4ZRZ A;  4IUV A;  1HA6 A;  4DXF A;  3V05 A;  4ZYS A;  1IBL L;  2DNE A;  2M9V A;  4DUY L;  2D0P A;  2K75 A;  4P75 A;  3RN2 A;  4G7O C;  1X55 A;  2E8G A;  1WD0 A;  5A2Q L;  4JI7 Q;  4LF8 Q;  2V1C C;  2BOS A;  5KIX A;  1XNR Q;  4PZ6 A;  4U67 3;  1Q3L A;  3ICE A;  1SNO A;  2VQF L;  2KA7 A;  2F0J A;  4DKA C;  2BH8 A;  2IX3 A;  1QNU A;  4UP7 A;  3GTG B;  4RHR A;  4DV4 Q;  3U58 A;  1AE2 A;  1O78 A;  3OMC A;  5BR8 Q;  4PMW A;  4RAU C;  1D1I A;  2K5V A;  3MEH A;  5M5Y H;  1VQ4 A;  5J22 A;  4A3D H;  4QJF A;  3MXG A;  3VR6 A;  4QMG A;  4K6D A;  2NTS A;  5CBE E;  1FNW A;  3TQY A;  1HQR D;  2DN8 A;  4JBJ A;  3OYY A;  3Q8D A;  2PMZ E;  4RCN A;  1EYA A;  2UXD Q;  4DK3 C;  4PNY A;  2UU9 L;  3GV6 A;  2FXQ A;  2ENB A;  2EY6 A;  2Y0S E;  2LXJ A;  3SK5 A;  4CDC C;  4BY1 G;  1BBX C;  4HSV A;  1EWC A;  4DUZ L;  4KJO A;  2XSC A;  4LF4 Q;  2EJM A;  1VQ8 A;  1VQH A;  1HTP A;  1U4P A;  3CCJ A;  3M85 A;  2A1A A;  1F9Q A;  2R7Z H;  4G57 A;  2CWP A;  2JSO A;  4JI8 L;  2AUK A;  4IAL A;  1K9M C;  5FO9 B;  1GVP A;  1SE2 A;  1DJR D;  1K0R A;  4FNF A;  4IPG A;  3GTQ H;  2PI2 E;  3NP8 A;  5CV8 A;  2MO1 A;  5C0X I;  1MJE A;  3DHQ A;  5C44 H;  4BBS G;  4BXX G;  5LMN Q;  4PZ7 A;  1QZG A;  1BKB A;  2CWA A;  5KRU A;  3NBH B;  2E2J H;  1TII D;  4C3I B;  1UE6 A;  1JJC B;  2ATW A;  1VS0 A;  3GTP H;  3KLS X;  4RG1 A;  2KCM A;  4A3F B;  1B53 A;  1PH1 A;  1NBW A;  4LFB L;  1EIG A;  5E4X A;  5LMN W;  1NJI C;  2WIN B;  3RR5 A;  1Q90 A;  1XXG A;  4GLV B;  3PO2 B;  4M1U B;  4B3R L;  5EKI A;  2CH4 A;  2RVL A;  1TS3 A;  3E3X A;  5K36 H;  2H1E A;  4YIJ A;  4A3M G;  3I8Z A;  2RQX A;  3CW2 C;  4S3S A;  4CKE A;  5A2Q E;  1N36 L;  1V9P A;  3EBE A;  1ESR A;  3DM3 A;  4AYB B;  2BA0 A;  1TY2 A;  3UDI A;  5IP7 H;  4IUP A;  5M9O A;  1TXY A;  4Y52 H;  1IYV A;  3NTI A;  1GUO A;  4LF6 L;  2A68 D;  4KY5 A;  1ET9 A;  1UWV A;  2SOB A;  3EJI A;  4A75 A;  1EQV A;  2K28 A;  2B2Y A;  2OTL A;  1A0I A;  3NWS A;  1EWH A;  1TS4 A;  4CDF C;  2EVB A;  1IL8 A;  1WTW A;  3TP7 A;  1KTK A;  3R3O A;  1NUC A;  4OL7 A;  1SYC A;  2JN4 A;  1IBL Q;  2EJG C;  4J15 A;  5COR A;  4DUY Q;  2OCE A;  1CKM A;  3DWQ A;  1C48 A;  2F0D A;  1IW7 C;  2A6E C;  2H5X A;  5FK9 C;  3EA6 A;  4IFD G;  1SMY C;  2NB0 A;  2R93 B;  4F8M A;  1QNK A;  1TT2 A;  4LUZ A;  5D14 A;  5LHY 1;  2VQF Q;  3M3Y B;  1PYS B;  3FDT A;  1PDQ A;  3Q6S A;  4A93 B;  1PTO C;  3GO5 A;  1G91 A;  2EYH A;  3PF5 A;  3KK7 A;  1D1K A;  2QEX A;  3AQQ A;  2KCT A;  3I2Z A;  3R93 A;  3PSI A;  4PG3 A;  2KEC A;  3PUV A;  1VQP A;  1B3A A;  4A3G H;  4WJ4 A;  4BY7 B;  1I94 L;  2JA5 B;  4FDB A;  4TKO B;  2J4X A;  4DNT B;  5IYB G;  4CKC A;  3D4R A;  4F7X A;  3S14 B;  1S5F D;  5EGT A;  4B9X A;  3A5U A;  1SE3 A;  2EYL A;  2UU9 Q;  1RIP A;  4KN4 C;  1WCM G;  4C1N I;  3S2D H;  5D65 A;  5M5W H;  1XMO L;  2UUC L;  4ZK9 B;  2EY1 A;  2WKD A;  1Y1W G;  1J5E L;  3FPP A;  4DUZ Q;  1K8M A;  4IUT A;  4L63 B;  4P72 A;  3SR1 A;  4B08 A;  2OQ0 A;  2EXZ A;  1XTC D;  1ML0 D;  5IYD H;  3S15 B;  2M00 A;  1BBW A;  1GUN A;  1PFB A;  2HIV A;  3HEJ A;  4JI8 Q;  5C4Z A;  1STN A;  3ZYY X;  3VYR A;  4DAV A;  2MJ8 A;  4ZAI A;  1E7Z A;  3OMG A;  1KDA A;  4LF9 L;  4FF4 A;  3H91 A;  1I6H B;  3T56 B;  2F0P A;  1WI5 A;  5FJ8 G;  4H02 A;  4P71 A;  3J81 c;  3HOY G;  1U4L A;  3R2I A;  1SE4 A;  1H9K A;  4EVO A;  1WTR A;  5COY A;  2LS0 1;  3IL8 A;  1UE1 A;  2A6H C;  1CI3 M;  4OXP A;  4Q0F A;  5E7N A;  2F0I A;  3PQI A;  4IUU A;  4UP8 A;  1Y14 B;  1EIH A;  3TZD A;  1S72 A;  1MSH A;  3JAM i;  4DAM A;  4IJL A;  2CQO A;  4K5X A;  2Y0S G;  5E1F A;  4LFB Q;  2B2Y C;  4L8J A;  3OIP A;  1SND A;  1I4X A;  3PIO 3;  1OXT A;  4IN3 A;  1CHQ D;  1A6X A;  3D0F A;  2SDF A;  4B3R Q;  4OIJ A;  1SJE D;  1JCK B;  3NQI A;  4TVA B;  2NVX B;  1BDO A;  1MHW C;  4LK1 C;  1Y1V B;  4R4Q A;  4C2M B;  1N36 Q;  1RDP D;  5C4J H;  2PYK A;  2GVB A;  1F77 A;  3OOC A;  3LWE A;  5CR3 A;  5KYL A;  3RLF A;  3BZC A;  3MHB A;  4QQB X;  1D5X C;  1K8O A;  1L1O A;  5GAH C;  2QA4 A;  1SFO B;  4K8J A;  4JI0 L;  2I46 A;  1QVG A;  1IBK L;  2E2H B;  4LF6 Q;  2C5C A;  1PMR A;  3LNN A;  1HNX L;  1VQG A;  1HQM C;  1FNU A;  4X3T A;  3I73 A;  4X64 L;  1E0B A;  4ODG A;  3VYT A;  3TRZ A;  4A3E B;  1CHP D;  3T51 B;  2GN5 A;  2K5Q A;  4DK6 C;  2RSO A;  2FHT A;  4X3S A;  4JCV E;  5M3F B;  4HR7 B;  3HOW B;  4N8X 1;  2CFM A;  1K8A C;  2Q2H A;  4IOA A;  3HKS A;  1SYG A;  4KY7 A;  3J7A V;  4OO1 H;  3CC7 A;  4N9P A;  4LFA L;  4RFB A;  1AFP A;  4BS9 A;  1TS5 A;  1SMY D;  3HKZ B;  2NVQ H;  2QDB A;  4K5W A;  4JBW A;  1EFI D;  3HOU G;  3D6C A;  1PTO D;  3JC6 6;  4OEL B;  3HOZ B;  5C3E H;  4HCE A;  5ELN A;  4JI6 L;  1K3B C;  2ZTE A;  4XT1 B;  4JVZ A;  1UEB A;  2VW9 A;  2AMC B;  2IT1 A;  2AQ2 B;  4NMZ A;  1I94 Q;  2BE5 C;  1AZQ A;  5C4X H;  1KRT A;  1Y8N B;  2F4V L;  2BA1 A;  4OEM B;  4AIM A;  1A8V A;  3HRZ C;  4EQP A;  4A3L G;  1XMO Q;  2UUC Q;  1YHB A;  1H9S A;  1EUJ A;  4CGY B;  3CCU A;  1PH2 A;  1C4Q A;  1J5E Q;  4G7H C;  2P5Z X;  4GOP A;  1HR0 Q;  3SVM A;  1K83 H;  1QZH A;  4FF3 A;  3HOX B;  1NR4 A;  1QJO A;  3H0G G;  1HZB A;  3CXC A;  5GAD C;  4B3T L;  1Z6H A;  2Z6K A;  1NMF A;  1PFM A;  4C3H B;  5C5L A;  4UY8 C;  2RSN A;  3I4O A;  3PO3 B;  5M5X B;  1PH7 A;  3L0O A;  3TP8 A;  4LF5 L;  2SEB D;  4LF9 Q;  5ELE A;  1FR3 A;  2KEE A;  4R4T A;  2MFI A;  3S1N B;  4JYA L;  4GN3 B;  3WOF A;  4HJ5 A;  1PH4 A;  2ZXR A;  1EY6 A;  3GTG H;  1L1O C;  1L1O B;  1CKO A;  3KLS A;  5FO8 B;  5JJK A;  4LFC L;  2XIW A;  1Q7Y C;  1XJV A;  1BCP C;  1BCP B;  5JEA G;  2X69 A;  3CCV A;  2ZT9 C;  3RLO A;  3PIO A;  2EDG A;  4TQU S;  2A6H D;  1PLF A;  2JA7 B;  1FGB D;  3R8B A;  1GHK A;  1HZ9 A;  2KHS A;  5HUR A;  1Y1W B;  2FFK B;  4J8Q A;  2A74 C;  3HFZ B;  1IKL A;  4BBR G;  3J80 i;  5A35 A;  1XX8 A;  4XYQ A;  2SNS A;  2D5D A;  3SXH A;  3K7U C;  5ELO A;  1WTO A;  2K01 A;  4C3J B;  4HED A;  1HA5 A;  5DEH A;  4YWL A;  3UDF A;  4XIG S;  4JI0 Q;  2K03 A;  1IBK Q;  3K5N A;  1SNQ A;  5GQO A;  4XT3 B;  3HOV B;  3S16 B;  1PRT F;  1QUQ A;  3PUZ A;  4O2D A;  4A3K G;  1HNX Q;  1A15 A;  5ELB A;  1XMQ L;  1V1O A;  2UXB L;  3FKI G;  1V1Q A;  2CH4 W;  4YWM A;  1O7Y A;  1PA6 A;  3K8A A;  2PMZ B;  5IYC G;  1NE3 A;  4YCW A;  2XWB B;  1BBU A;  4H7B A;  3J7A 5;  2RDG A;  1B4O A;  1F2Y A;  2F0G A;  1M4V A;  1STA A;  1N32 L;  3TP6 A;  4NB3 A;  4C3I H;  2BCO A;  1H9S B;  2DJF C;  3RZD B;  1VQN A;  2CVR A;  4A3B G;  4RA8 A;  4ID6 A;  1JOR A;  4GOP C;  4GOP B;  4A3F H;  4OX9 L;  3A7A B;  2A19 A;  1HFN A;  2XVS A;  5G3L D;  3I4M B;  1RTN A;  1RF2 D;  1PH9 A;  1RJT A;  5EBD A;  4CBV A;  1DCZ A;  4K8I A;  5C0X H;  2A69 D;  3G4S A;  2Z6K C;  3PO2 H;  3K5O A;  2XTI A;  2B29 A;  1MJC A;  4JI6 Q;  1B50 A;  1YVC A;  3SK8 A;  1FL0 A;  1JWS D;  2K04 A;  2MQH A;  3O13 A;  2F4V Q;  1CM9 A;  4ZQ3 A;  4NXM L;  3CC4 A;  1EY8 A;  2BE5 D;  4G4K A;  1E3P A;  1F9R A;  2HDL A;  4HMJ A;  2VUM G;  4K6L A;  4RWS C;  5I6Y A;  4ILW A;  2ALY B;  4JG2 A;  2BDN A;  1N8R C;  3LGJ A;  1Q86 C;  1L0Y B;  2A73 B;  2F0F A;  4FXD A;  1OO9 B;  2Q8R E;  1EQT A;  3D6W A;  2KUM A;  3X3M A;  1AW7 A;  4FF2 A;  3M4Q A;  1DXM A;  3MZ5 A;  3PUX A;  2HHH L;  3U4V A;  2PNH A;  3DWA A;  4ZCK A;  1OTC A;  4B3T Q;  3MXU A;  3GTL B;  3M4O B;  3A5Z B;  3K59 A;  2K50 A;  5FKA C;  1T5X D;  4JW0 A;  1DON A;  4HID A;  1EFW A;  4LF5 Q;  1SNP A;  4IPC A;  4HSP A;  5IGD A;  2G9H D;  2TMP A;  2JA6 G;  4RCO A;  2R93 H;  5GAG C;  1DD2 A;  1X54 A;  1SE8 A;  4JYA Q;  3VA5 A;  3I91 A;  3M3Y H;  4KKT A;  2AWN A;  2ZJP A;  1X3F A;  1VQM A;  1E2W A;  3T53 B;  3Q23 A;  1S3O A;  4A93 H;  1EU3 A;  2NUC A;  4LFC Q;  3IFT A;  2OT2 A;  3NTH A;  1B3Q A;  1QOH A;  4X3K A;  1HZC A;  4B3M L;  4O0A A;  3DXJ C;  1QUQ B;  1E24 A;  1BCP D;  1GXD C;  2EOT A;  1JWM D;  1HJP A;  4BY7 H;  5JJZ A;  3VR3 A;  2WAQ E;  3TRE A;  3TS2 A;  2JA5 H;  4NXN Q;  4DV6 L;  2RDH A;  3E9H A;  1VQC A;  3J80 L;  3S14 H;  4ABN A;  2EYO A;  3T16 A;  1JB7 A;  1HUN A;  1TWF B;  4KN7 C;  1QG7 A;  4EX5 A;  1VQE A;  1TWG B;  4A3D G;  4L5Q A;  5HGT A;  2NN6 I;  2RHS B;  3QR8 A;  2R7F A;  2GA4 B;  1ILP A;  3S15 H;  4Y7N B;  1IHZ A;  3CCE A;  4AQY L;  3STB C;  4CDD C;  1XMQ Q;  4DAY A;  4R1J A;  3A8J E;  2UXB Q;  2MNA A;  2UUB L;  2NVY B;  1LM0 A;  3CP0 A;  2DJG C;  1I6H H;  2JE6 I;  2KED A;  4DV5 L;  4RH6 A;  3S17 B;  2PW5 A;  5BN4 A;  4QIW E;  1N32 Q;  1VQ6 A;  1D6E C;  1VQ7 A;  1SLJ A;  2MPM A;  2WB1 B;  1LT4 D;  3KYH C;  4ZUJ A;  2LFN A;  2R7Z G;  3IAY A;  4OX9 Q;  1EWI A;  1KHI A;  2F0H A;  4J6H A;  3S1R B;  1F2L A;  3ITP A;  1WFQ A;  2F4I A;  5C44 G;  1GD7 A;  1RTO A;  1U0L A;  2E74 C;  2VS1 A;  4XDX A;  3N6R A;  1I3Q B;  5EQ0 A;  2B3G A;  4DR4 L;  2NVX H;  1T5E A;  3BDO A;  1KNE A;  1Y1V H;  4C2M H;  3I4N B;  3GTJ B;  2IL8 A;  2XRS D;  3BYT B;  4JI3 L;  3T1Y L;  4NXM Q;  2WP8 J;  3QIA A;  3V2T A;  2D62 A;  4HCS A;  3D8G A;  4EQO A;  4R8I A;  4B3S L;  4PQX A;  2FMC A;  3KUP A;  1Z7T A;  3J81 j;  1EY9 A;  1SFO H;  1SYB A;  1SRU A;  3OHX C;  1OXU A;  3EVQ A;  1TWC B;  3CCR A;  2E2H H;  4YWK A;  2Z4I A;  1YBY A;  5K36 G;  1PXU A;  1B9M A;  1O7L A;  1X65 A;  3G7L A;  1ICW A;  2HHH Q;  3NE5 B;  4A3B B;  2WII B;  3KBX A;  3PIP 3;  1DYQ A;  1ZEQ X;  4ZKC B;  5EBC A;  4A3E H;  1W2B A;  3J80 E;  1EZ8 A;  1J8I A;  5M3F H;  3TN2 A;  1SMX A;  5KNC A;  4XQN A;  1I5F A;  4JI1 Q;  1FD7 D;  3HOW H;  1B1Z A;  3PMF A;  3W1G A;  5IP7 G;  2PCF B;  1NTG A;  1VMC A;  1KRS A;  2PZT A;  1HPC A;  3QB3 A;  4X3U A;  1EQR A;  2PQA A;  4HIM A;  4IOC A;  1IYU A;  1B44 D;  1KAA A;  5I4D A;  2XGT A;  4B3M Q;  1JE5 A;  4EGV A;  4HAE A;  1RCV D;  2I07 B;  4DAY B;  1EY4 A;  4X65 L;  1YHA A;  3H3V H;  3HOZ H;  1YNN C;  3I90 A;  1SYE A;  1HRJ A;  1LUZ A;  2Z1C A;  4FVM A;  3CPW A;  4DV6 Q;  4DFA A;  1T9H A;  1BVS A;  1GHJ A;  3AYH B;  1PH3 A;  1H9J A;  1OXV A;  3BZD B;  4A3I B;  3NEN A;  2N55 A;  3QO2 A;  4JOI A;  2I5L X;  3A8K E;  2NVT B;  4GKJ L;  5GAE C;  1ENC A;  3KJO A;  2D2C C;  3HS0 C;  5E3F A;  3HOX H;  4IPD A;  1SYD A;  2QF7 A;  1Z47 A;  4LUV A;  5D3I B;  1KIX A;  3RUZ A;  2E2I B;  4AQY Q;  3CPF A;  2N3S A;  4JBK A;  3K6O A;  1XTD A;  3DUZ A;  4GN5 A;  3URY A;  5LMU L;  4C3H H;  2AQ1 B;  1C7Y A;  2JA8 B;  2UUB Q;  3PO3 H;  5M5X H;  4KV6 A;  3H94 A;  3F2C A;  1L0X B;  3STB D;  1EEI D;  5CV7 A;  1J6Q A;  2LXK A;  4DV5 Q;  1HNZ L;  4L5S A;  4IPH A;  2B2U A;  2R3Z A;  3CCM A;  3S1N H;  1I4R A;  2QGQ A;  4LAA A;  3KF6 A;  5E4W C;  2EYJ A;  2WAQ G;  2HT1 A;  4A3C H;  4L5R C;  5IYD G;  1LTR D;  2K05 A;  1S5C D;  1LLR D;  1WTQ A;  2K5D A;  2ZJR A;  2JA7 H;  5IGC A;  4UPA A;  4DR2 L;  2ZM6 L;  5FO7 B;  3UDX A;  4PV1 C;  3MFG A;  1Y1W H;  1QWY A;  4K2L A;  3U9S A;  1PH8 A;  4X62 L;  5C3X A;  3L3O C;  1JMC A;  1IYJ B;  2NWG A;  1VQB A;  4DR4 Q;  2CQA A;  3I4L A;  3G6J B;  4UP9 A;  3L9A X;  4F88 A;  5IGG A;  3CRK C;  3TSS A;  4CDE C;  2VB3 X;  1EIF A;  1TS2 A;  2L55 A;  3CCS A;  4JC0 A;  4JI3 Q;  3T1Y Q;  1Q1E A;  2DNC A;  1FVI A;  4C3J H;  3CKI B;  1MSG A;  2JA9 A;  3FPU B;  1P8L A;  3HGB A;  2E76 C;  1FGU A;  1XPR A;  4BY1 B;  2PQA B;  2PZW A;  5IP9 H;  3M4Y A;  3HOV H;  3DM1 A;  4LWC A;  3PIP A;  3S16 H;  1W3S A;  4RGN A;  5J3B A;  1EY7 A;  4HN7 A;  3SDZ A;  4DXG A;  5IWA L;  1R9T B;  2Z0S A;  3TEH B;  4DR6 L;  5M3M G;  1C0A A;  1NNX A;  3KOJ A;  4MTK A;  5DAU A;  1S5B D;  5JAV A;  2KJX A;  3IKJ A;  1HCZ A;  2KBN A;  1G51 A;  3AEV A;  4DR5 L;  5AJ3 L;  2VXW A;  1YJ9 A;  3H15 A;  4BBS B;  2UXC L;  3RZD H;  3FMC A;  3BDL A;  3MXN A;  2Z9H A;  2YTX A;  4BA2 I;  3CMA A;  1LT3 D;  2VQE L;  2MO0 A;  3I4M H;  1SN8 A;  2AKW B;  4NKL A;  3A0J A;  1LYL A;  3M7N A;  1I4P A;  2EQS A;  2WFW A;  4AYB E;  1IL2 A;  4RGM A;  2F0L A;  1JJ2 A;  1GUS A;  1VQL A;  1WTV A;  4BWG B;  3H6M A;  4X65 Q;  4DA2 A;  2K5N A;  3H3V I;  2K33 A;  5IGE A;  2RKS A;  4KJN A;  5FLX L;  2F3I A;  2D9U A;  4DK1 A;  2F0M A;  4OO1 G;  3I72 A;  1KAW A;  2XWJ B;  4K5V A;  2JQO A;  2B2U C;  1SJH D;  5IT9 L;  1YNN D;  4A3M B;  2A69 C;  4JI5 L;  3KF6 B;  1E22 A;  1NSN S;  2FMM A;  1LTB D;  1KL9 A;  4GS3 A;  4OHJ A;  4GKJ Q;  5I9O A;  3BYY B;  5EAY A;  3NUC A;  5C3E G;  3H3V C;  2AQ3 B;  2L1B A;  1GUT A;  5IE8 A;  5EPJ A;  2VB2 X;  5DLQ E;  5C4X G;  2EYF A;  3GTL H;  4CJ2 C;  3M4O H;  4I7Z C;  3C2P A;  3VR5 A;  4DNR B;  5LMU Q;  4NP5 A;  1M8A A;  3T13 A;  4K14 A;  3OIQ A;  2Z6B A;  3MFY A;  1KXL A;  2UUA L;  3E0E A;  2H4O A;  1G6P A;  1WTP A;  5CV5 A;  2ASB A;  2K1B A;  4IFD J;  1I50 B;  1HNZ Q;  3J7Z C;  1GM5 A;  3SK4 A;  4GLA C;  3VDY A;  5NUC A;  3U4Z A;  4DV1 L;  4XTC S;  2JK8 A;  4FXG C;  1KLU D;  1LAB A;  3ND9 A;  5FOB B;  4LJZ C;  1R4Q B;  5BN3 A;  1LO5 D;  2L0C A;  2IY5 B;  3OWE B;  5LL6 S;  3CME A;  3NBI A;  2B2V A;  2KHI A;  2PI2 A;  4EQN A;  3TBI B;  5C3W A;  1TWH B;  4X66 L;  2ZM6 Q;  3E9I A;  1VQ5 A;  4P2C B;  1JOK A;  1CKN A;  1UAP A;  3GV3 A;  1XPU A;  1TQO A;  4X62 Q;  2PPB C;  2DY7 A;  1HHV A;  2X6L A;  1LT5 D;  3AU7 A;  4QGU A;  2B8G A;  4WJ3 M;  1LAC A;  1ONL A;  1S5D D;  1TWF H;  2BH2 A;  3DEO A;  4QL5 A;  5JPN C;  2EJF C;  2PW7 A;  2Q8I B;  4OWW B;  3W3A A;  4NDX A;  2F03 A;  3MXN B;  3JAM L;  1TWG H;  4R4O A;  2F0V A;  1X3Q A;  3GQB A;  1WCM B;  1EOT A;  1M90 C;  5ELD A;  2F0Q A;  1K3R A;  3MWY W;  1MI2 A;  3S24 A;  2NTT A;  3CHB D;  3PCO B;  2EYM A;  2AUJ D;  4FP5 D;  1PH6 A;  4Y7N H;  2FJ2 A;  1A3V A;  4MNO A;  4KMU C;  3P1H A;  5IWA Q;  1U4M A;  3RZO B;  2F0T A;  2NVY H;  2M2L A;  3MEF A;  5KEE A;  5FLX E;  1C9O A;  2K6A A;  1GUG A;  4OWT B;  4OWX B;  4KHZ A;  1PFS A;  1AP0 A;  4L6T B;  1PTO F;  3AMU A;  2NN6 H;  5IT9 E;  3PUW A;  5EPL A;  3ERS X;  3S17 H;  1GKH A;  1F9S A;  1Q8I A;  2EXD A;  4DR5 Q;  5AJ3 Q;  1SNC A;  1LTT D;  2F0N A;  1AZP A;  2OQK A;  3HOY B;  2UXC Q;  2B63 G;  5C4H A;  2L5T A;  3CAM A;  3KFU A;  3VYS A;  3F1Z A;  4DR7 L;  1TVX A;  1XYI A;  5JVG 3;  2F0S A;  2RDF A;  2VQE Q;  3I70 A;  4ME5 A;  1DGS A;  2Z8L A;  3S1R H;  4HIK A;  2F3W A;  3RMH A;  4X64 Q;  3WWV A;  1KC8 C;  4R4C A;  4QUC A;  2Y0S B;  1MIU A;  2F0W A;  3FHW A;  1I3Q H;  4C3I G;  3CRL C;  3NEM A;  3G6E A;  3I4N H;  3GTJ H;  4QIW B;  5CMD A;  4LFA Q;  1ASY A;  2RF4 A;  4A3J G;  4A3F G;  1ESF A;  3ER0 A;  1YNX A;  4JI5 Q;  1VQJ A;  1D8L A;  1TY0 A;  1YI2 A;  3HG9 A;  3NQT A;  5KNB A;  1VMP A;  5M3M B;  3J7A F;  2PQE A;  5FLM G;  1K8G A;  1G29 1;  5C0X G;  1WOC A;  3PO2 G;  2WKC A;  1X6O A;  1TWC H;  1HNW L;  4KK7 A;  4YHH L;  3IFD A;  1LTS D;  2B2V C;  1Y8O B;  3HKZ E;  3K58 A;  2R92 G;  1OXS C;  1CKN B;  3BZK A;  4A3B H;  1CZG A;  1W6K A;  1G2T A;  1QIL A;  3CCQ A;  1JJG A;  3MTS A;  4CJ1 B;  2NBF A;  2RCN A;  2UUA Q;  3KLR A; 
#chains in the Genus database with same CATH homology
 3K5L A;  3H09 A;  4R9W A;  3JAM E;  5DNF A;  1QE6 A;  1Q1B A;  3S1M B;  1BNZ A;  3NK9 A;  1SEB D;  3LWU A;  1TR5 A;  4KTA A;  3ND8 A;  1YNJ C;  3HOU B;  2A5H A;  2HUG A;  1DOK A;  3D31 A;  4MN3 A;  1SAP A;  1CTM A;  5CYU A;  2MGS A;  4IUQ A;  4E6I A;  1KNA A;  2F1M A;  2LY7 A;  1MBY A;  4K2K A;  5CV4 A;  5T1G A;  4PMC A;  2L11 A;  3UI2 A;  4V0B A;  4N9T A;  4FXK C;  1LTG D;  3Q0A A;  1I4G A;  3VR4 A;  2AWO A;  3K7A B;  5CV9 A;  3N52 A;  4KD4 A;  4JK1 C;  3VA7 A;  3GTM B;  2YU9 B;  1JOQ A;  2OF1 A;  1PFN A;  4DGZ A;  3S1Q B;  3DWP A;  1MD2 D;  1V1P A;  1PYW D;  3MVV A;  3SE0 A;  3H0G B;  2DY8 A;  3QOJ A;  5LL6 X;  2F0O A;  4ZKB B;  1VDZ A;  1RKN A;  1UEA B;  3TP5 A;  4C56 C;  1D5M C;  1WTX A;  2JP1 A;  2JEA I;  2F3V A;  3SEB A;  1D2B A;  3CQZ B;  1EU4 A;  2JYO A;  2EZV A;  3LX0 A;  2KOL A;  1HXY D;  5JEA J;  4IUR A;  2V4D A;  3CU7 A;  1U9R A;  4XXE A;  2LMC B;  3E0J A;  1A3T A;  1ZYR C;  4H0L C;  2R6G A;  2CHB D;  3D4W A;  2ICE C;  4DAP A;  2L12 A;  4Q5V A;  2KQ3 A;  3C1E A;  1CA6 A;  3TDQ A;  4BBR B;  4DK0 A;  3S2H B;  1TKW B;  1QCB D;  5JVH 3;  4KY6 A;  2EPB A;  1WVL A;  4IUN A;  3NWT A;  3L7Z C;  1BR9 A;  3V96 A;  3A55 A;  4KKS A;  3TZU A;  1STB A;  2B63 B;  1H9M A;  2EY5 A;  1HTL D;  4A3K B;  1FYC A;  2EY2 A;  3FEW X;  3FKI B;  4C1N K;  1BCP F;  1JE4 A;  2IWH A;  3J7Y W;  1BOS A;  2K5W A;  5ELC A;  2MHV A;  2Q8T A;  3A8I E;  1BF4 A;  3W2D A;  5EJW A;  2QEJ C;  3U9O A;  4A3J B;  1A2T A;  3BDC A;  4O1N A;  4LMQ D;  2K32 A;  1V1P B;  5C0X J;  2PO4 A;  5C5M A;  1TWA B;  1V43 A;  2NYZ D;  2L9H A;  5I6W A;  4WRD A;  2F0K A;  3K0Y A;  2WV6 D;  4DN4 M;  1ET6 A;  4XQJ A;  1YNJ D;  3OWF A;  1JOO A;  3VYU A;  1JQY D;  3DMU A;  4I65 A;  4UDU C;  2R92 B;  1VF5 C;  3NPP A;  4KKU A;  1RD9 D;  3NSW A;  1WD1 A;  4KD3 A;  2EYP A;  2KCC A;  2VUM B;  2B2W A;  1Y69 U;  3GTK B;  2PZU A;  3QWN A;  4XYO A;  1EY0 A;  2EE1 A;  5CBA E;  4O42 A;  4QF4 A;  3FVQ A;  4H44 C;  3PV0 A;  4F87 A;  3HZX A;  1EZ6 A;  3MXP A;  2K7V A;  4B9W A;  1GJX A;  1XWE A;  1SSO A;  3OSO A;  3GTO B;  2E75 C;  2J0T D;  1IKM A;  1LTA D;  3AB9 A;  2F0U A;  4IFD H;  1Q12 A;  2J7Z A;  2JA6 B;  1SDF A;  3BVZ A;  2G9D A;  1F9P A;  4OGQ C;  3R2T A;  2ZXO A;  4Z9C B;  1AN8 A;  3WOE A;  4C3H G;  1PTO B;  3C1F A;  3Q22 A;  1GOZ A;  3BVM A;  5EKL A;  1PRT C;  1PRT B;  2R61 A;  3OPO A;  3X3N A;  5EKK A;  2X6G A;  2O2L D;  1J9O A;  2N88 A;  3MC0 B;  1ZYR D;  1FNV A;  1CK1 A;  1VF7 A;  4CHT B;  1DOM A;  3E5S A;  5M5Y B;  1EYD A;  2B39 A;  3KF8 A;  1UUP A;  4A3D B;  2L4N A;  1UNS A;  2F0E A;  4CJ0 B;  1CQV A;  1ENA A;  4ULL A;  3S9W A;  2B2T A;  1CA5 A;  1W6J A;  2JXM B;  3BS1 A;  3SHL A;  1DOL A;  4C3J G;  2YYZ A;  4RGO S;  2LKV A;  1H9R A;  2RA4 A;  3MAQ A;  2XN9 C;  1E2V A;  5KND A;  4U68 A;  4RKB A;  1KDB A;  4UAI A;  1JC7 A;  3MA2 B;  5DM7 3;  2B2W C;  3GD7 A;  4KI0 A;  1GUW A;  2R7Z B;  1PZK D;  3P7J A;  1E2Z A;  5T1I A;  3BG3 A;  2O5I C;  1F2M A;  1EEF D;  2KCN A;  4WFN 3;  2JEB I;  3GTQ B;  3J81 L;  1D5Z C;  3DEP A;  2ICI A;  5C44 B;  1G6Z A;  4G7Z C;  2E2J B;  5ELF A;  3WDN A;  3GTP B;  1STH A;  3KBG A;  4QB4 A;  5ISR A;  4WJW A;  5KYI A;  3ONA B;  2IJ0 A;  1EYC A;  4HMI A;  1JR0 D;  3K5M A;  1A3U A;  4WOR A;  1BUV T;  3E6Z X;  3T4A C;  1BO0 A;  5I2Y A;  5JOB A;  4J1M A;  4FF1 A;  1Y8P B;  3NXW A;  1I4Q A;  2Z4H A;  3F2U A;  2IW3 A;  4RHS A;  5CC4 A;  4IFD I;  3M7G A;  1MGS A;  4XQQ A;  1IW7 D;  2A6E D;  1JIC A;  1NAP A;  4QUF A;  1KAB A;  3K57 A;  2ZXP A;  1HUM A;  2VNU D;  2B2T C;  1NCV A;  1NR2 A;  4NW2 A;  5DM6 3;  5BN5 A;  5JPM C;  2NZ1 D;  4MHE A;  2XNA C;  5IOC A;  5IGB A;  2E2D C;  3HP3 A;  1PRT D;  5F2D A;  3NTK A;  2RBM A;  1CZW A;  1SXT A;  2IPK D;  1F2Z A;  1OXX K;  2BDO A;  2OEO A;  1X3P A;  1TU2 B;  2OXP A;  3C46 A;  4A3G B;  1ENF A;  2O4X A;  5D3D A;  1LT6 D;  3J81 E;  2WAC A;  1O80 A;  5IOD A;  4IQZ A;  5IIF A;  5I2X A;  4GZY C;  2CW0 C;  2QCP X;  3A56 A;  4OIK A;  2C9O A;  3S2D B;  5M5W B;  4MIU A;  2HCI A;  1CT1 D;  4R8N A;  4HTH A;  2B8F A;  1O7Z A;  1STG A;  1JB3 A;  1X32 A;  1CQF A;  1SNM A;  2WAQ B;  5JEA H;  5C6A A;  1AEX A;  4TSS A;  2IX0 A;  1II3 A;  1V8Q A;  2NN6 G;  3ERQ A;  1EL0 A;  5J1Z A;  3QOL A;  5CV6 A;  1R4P B;  4ZUI A;  4ZLT F;  1RHP A;  1BXT A;  1U4R A;  1LV9 A;  4TRD A;  5TSS A;  4DF7 A;  1PZI D;  5I9P A;  1I6V C;  2IX1 A;  3OW7 A;  3A7L A;  3TME A;  2ID0 A;  4CKB A;  2HDM A;  3PUY A;  5AFW A;  2PNR C;  1B2T A;  5C4J B;  1QB5 D;  1G2S A;  2MUY A;  3EQL C;  3SK6 A;  2O5J C;  3BVG A;  1S4Z A;  4BA1 I;  2QIL A;  4H13 C;  5CGK A;  3P20 A;  1VCI A;  3A54 A;  4QCL A;  4OO1 I;  5EPK A;  5J39 A;  3GP7 A;  3ERO A;  1G8Z D;  1JWU D;  3D3R A;  5KGU A;  4RGT A;  3VR2 A;  1LTI D;  2HCC A;  1SYF A;  4KHV A;  1EY5 A;  1CFM A;  3P75 A;  2QKI C;  1KDC A;  1PZJ D;  1BQQ T;  3QJY A;  2KVM A;  3I3C A;  4DU9 A;  1ROD A;  2NVQ B;  2FIN B;  4FO2 A;  1I4H A;  4PMB A;  4M8A A;  5C3E B;  1DM0 B;  1ZKO A;  1ZXT A;  1SBB B;  3QG1 A;  4V19 0;  3RD4 A;  1STY A;  1HFG A;  5C4X B;  5K5P A;  4FYD A;  1ILQ A;  3FRP B;  3C3L A;  1STE A;  1KLG D;  3NBH A;  1DZ1 A;  2A68 C;  1B9N A;  4RKL A;  2CW0 D;  2HQE A;  4IZ8 A;  1S5E D;  2SNM A;  1K83 B;  3EFX D;  2MP1 A;  2XRQ D;  3NHH A;  3Q24 A;  5IGF A;  1PTO H;  5G3L F;  1A2U A;  1C8C A;  2TSS A;  3D4D A;  4ZRZ A;  4IUV A;  1HA6 A;  4DXF A;  3V05 A;  4ZYS A;  2DNE A;  2M9V A;  4G7O C;  1WD0 A;  5A2Q L;  2BOS A;  5KIX A;  4U67 3;  1Q3L A;  1SNO A;  2KA7 A;  2F0J A;  2IX3 A;  1QNU A;  3GTG B;  4RHR A;  1O78 A;  3OMC A;  4PMW A;  4RAU C;  1D1I A;  3MEH A;  5J22 A;  3VR6 A;  3MXG A;  4QMG A;  4K6D A;  2NTS A;  5CBE E;  1FNW A;  1HQR D;  2DN8 A;  4RCN A;  1EYA A;  4PNY A;  3GV6 A;  2ENB A;  2EY6 A;  3SK5 A;  1BBX C;  4HSV A;  1EWC A;  4KJO A;  2XSC A;  2EJM A;  1HTP A;  1U4P A;  3M85 A;  1F9Q A;  4G57 A;  2JSO A;  2AUK A;  4IAL A;  5FO9 B;  1SE2 A;  1DJR D;  4FNF A;  3NP8 A;  5CV8 A;  5C0X I;  3DHQ A;  5KRU A;  1TII D;  4C3I B;  3KLS X;  4A3F B;  1B53 A;  1EIG A;  5E4X A;  2WIN B;  1Q90 A;  1XXG A;  3PO2 B;  4M1U B;  5EKI A;  2RVL A;  1TS3 A;  5K36 H;  2H1E A;  4YIJ A;  3I8Z A;  2RQX A;  4S3S A;  4CKE A;  5A2Q E;  1ESR A;  4AYB B;  2BA0 A;  1TY2 A;  5M9O A;  4IUP A;  1IYV A;  3NTI A;  1GUO A;  2A68 D;  4KY5 A;  1ET9 A;  2SOB A;  3EJI A;  1EQV A;  2K28 A;  2B2Y A;  1EWH A;  3NWS A;  1TS4 A;  2EVB A;  1IL8 A;  1WTW A;  3TP7 A;  1KTK A;  3R3O A;  1NUC A;  4OL7 A;  1SYC A;  2EJG C;  5COR A;  3DWQ A;  1C48 A;  2F0D A;  1IW7 C;  2A6E C;  5FK9 C;  3EA6 A;  4IFD G;  1SMY C;  2NB0 A;  2R93 B;  4F8M A;  1QNK A;  1TT2 A;  5D14 A;  5LHY 1;  3M3Y B;  3FDT A;  1PDQ A;  3Q6S A;  4A93 B;  1PTO C;  3GO5 A;  1G91 A;  2EYH A;  3KK7 A;  1D1K A;  3R93 A;  2KEC A;  3PUV A;  1B3A A;  4BY7 B;  2JA5 B;  4TKO B;  2J4X A;  4DNT B;  4CKC A;  3D4R A;  4F7X A;  3S14 B;  1S5F D;  5EGT A;  4B9X A;  1SE3 A;  2EYL A;  4KN4 C;  4C1N I;  5D65 A;  4ZK9 B;  2EY1 A;  2WKD A;  3FPP A;  1K8M A;  4IUT A;  4L63 B;  3SR1 A;  4B08 A;  2EXZ A;  1XTC D;  1ML0 D;  3S15 B;  2M00 A;  1GUN A;  1PFB A;  3HEJ A;  5C4Z A;  1STN A;  3ZYY X;  3VYR A;  4DAV A;  2MJ8 A;  4ZAI A;  3OMG A;  1KDA A;  4FF4 A;  3H91 A;  1I6H B;  3T56 B;  2F0P A;  1U4L A;  3R2I A;  1SE4 A;  1H9K A;  4EVO A;  1WTR A;  5COY A;  2LS0 1;  3IL8 A;  2A6H C;  1CI3 M;  4Q0F A;  2F0I A;  4IUU A;  1EIH A;  3TZD A;  1MSH A;  4K5X A;  5E1F A;  2B2Y C;  4L8J A;  3OIP A;  1SND A;  1I4X A;  3PIO 3;  1OXT A;  4IN3 A;  1CHQ D;  1A6X A;  2SDF A;  4OIJ A;  1SJE D;  1JCK B;  3NQI A;  2NVX B;  1BDO A;  4LK1 C;  1Y1V B;  4C2M B;  1RDP D;  2PYK A;  1F77 A;  3OOC A;  3LWE A;  5CR3 A;  5KYL A;  3RLF A;  3MHB A;  1D5X C;  1K8O A;  1SFO B;  4K8J A;  2I46 A;  2E2H B;  2C5C A;  1PMR A;  3LNN A;  1HQM C;  1FNU A;  4X3T A;  3I73 A;  1E0B A;  4ODG A;  3VYT A;  4A3E B;  1CHP D;  3T51 B;  2K5Q A;  2RSO A;  2FHT A;  4X3S A;  5M3F B;  4HR7 B;  3HOW B;  1SYG A;  4KY7 A;  3J7A V;  4OO1 H;  4N9P A;  4RFB A;  1AFP A;  4BS9 A;  1TS5 A;  1SMY D;  3HKZ B;  2QDB A;  4K5W A;  4JBW A;  1EFI D;  3D6C A;  1PTO D;  3HOZ B;  4HCE A;  4XT1 B;  2IT1 A;  2AQ2 B;  4NMZ A;  1AZQ A;  2BE5 C;  1Y8N B;  2BA1 A;  3HRZ C;  4EQP A;  1H9S A;  4CGY B;  1C4Q A;  4G7H C;  3SVM A;  4FF3 A;  3HOX B;  1NR4 A;  1QJO A;  1Z6H A;  1PFM A;  4C3H B;  5C5L A;  2RSN A;  3PO3 B;  5M5X B;  3TP8 A;  2SEB D;  5ELE A;  1FR3 A;  2KEE A;  3S1N B;  3WOF A;  2ZXR A;  1EY6 A;  3KLS A;  5FO8 B;  2XIW A;  1BCP C;  1BCP B;  5JEA G;  2X69 A;  2ZT9 C;  2EDG A;  4TQU S;  2A6H D;  1PLF A;  2JA7 B;  1FGB D;  3R8B A;  1GHK A;  2KHS A;  1Y1W B;  5HUR A;  2FFK B;  4J8Q A;  2A74 C;  1IKL A;  5A35 A;  1XX8 A;  4XYQ A;  2SNS A;  2D5D A;  3SXH A;  1WTO A;  2K01 A;  4C3J B;  4HED A;  1HA5 A;  5DEH A;  4XIG S;  2K03 A;  3K5N A;  1SNQ A;  4XT3 B;  3HOV B;  3S16 B;  1PRT F;  3PUZ A;  1A15 A;  5ELB A;  1V1O A;  1O7Y A;  2PMZ B;  2XWB B;  4H7B A;  2RDG A;  1B4O A;  1F2Y A;  2F0G A;  1M4V A;  1STA A;  3TP6 A;  2BCO A;  1H9S B;  3RZD B;  2CVR A;  4RA8 A;  4ID6 A;  1JOR A;  3A7A B;  1HFN A;  2XVS A;  5G3L D;  3I4M B;  1RTN A;  1RF2 D;  1RJT A;  5EBD A;  4CBV A;  1DCZ A;  4K8I A;  5C0X H;  2A69 D;  3K5O A;  1B50 A;  3SK8 A;  1JWS D;  2K04 A;  3O13 A;  1CM9 A;  4ZQ3 A;  1EY8 A;  2BE5 D;  4G4K A;  1F9R A;  2HDL A;  4HMJ A;  4K6L A;  4RWS C;  5I6Y A;  4ILW A;  2BDN A;  1L0Y B;  2A73 B;  2F0F A;  4FXD A;  1OO9 B;  2Q8R E;  1EQT A;  3D6W A;  2KUM A;  3X3M A;  1AW7 A;  4FF2 A;  1DXM A;  3MZ5 A;  3PUX A;  3DWA A;  3MXU A;  3GTL B;  3M4O B;  3K59 A;  5FKA C;  1T5X D;  1DON A;  1SNP A;  4HSP A;  5IGD A;  2G9H D;  2TMP A;  4RCO A;  1DD2 A;  3VA5 A;  3I91 A;  4KKT A;  2AWN A;  1E2W A;  3T53 B;  3Q23 A;  1EU3 A;  2NUC A;  3IFT A;  2OT2 A;  3NTH A;  1QOH A;  4X3K A;  3DXJ C;  1BCP D;  1GXD C;  2EOT A;  1JWM D;  5JJZ A;  3VR3 A;  2RDH A;  3J80 L;  4ABN A;  2EYO A;  3T16 A;  1HUN A;  1TWF B;  4KN7 C;  1QG7 A;  1TWG B;  5HGT A;  2NN6 I;  2GA4 B;  1ILP A;  4Y7N B;  1IHZ A;  4DAY A;  3A8J E;  2NVY B;  2JE6 I;  2KED A;  4RH6 A;  3S17 B;  2PW5 A;  5BN4 A;  1D6E C;  2MPM A;  2WB1 B;  1LT4 D;  4ZUJ A;  2LFN A;  3IAY A;  2F0H A;  4J6H A;  3S1R B;  1F2L A;  3ITP A;  2F4I A;  1RTO A;  2E74 C;  4XDX A;  3N6R A;  1I3Q B;  5EQ0 A;  1T5E A;  3BDO A;  1KNE A;  3I4N B;  3GTJ B;  2IL8 A;  2XRS D;  3BYT B;  2WP8 J;  3QIA A;  3V2T A;  2D62 A;  4HCS A;  3D8G A;  4EQO A;  4R8I A;  4PQX A;  2FMC A;  3KUP A;  1Z7T A;  1EY9 A;  1SYB A;  3OHX C;  1OXU A;  3EVQ A;  1TWC B;  2Z4I A;  5K36 G;  1PXU A;  1B9M A;  1O7L A;  3G7L A;  1ICW A;  3NE5 B;  4A3B B;  2WII B;  3KBX A;  3PIP 3;  1DYQ A;  1ZEQ X;  4ZKC B;  5EBC A;  3J80 E;  1EZ8 A;  1J8I A;  3TN2 A;  5KNC A;  4XQN A;  1FD7 D;  1B1Z A;  3PMF A;  2PCF B;  1VMC A;  2PZT A;  1HPC A;  3QB3 A;  4X3U A;  1IYU A;  1B44 D;  1KAA A;  5I4D A;  4EGV A;  4HAE A;  1RCV D;  2I07 B;  1EY4 A;  1YNN C;  3I90 A;  1SYE A;  1HRJ A;  2Z1C A;  4FVM A;  4DFA A;  1GHJ A;  1H9J A;  1OXV A;  3BZD B;  4A3I B;  2N55 A;  3QO2 A;  3A8K E;  2NVT B;  1ENC A;  2D2C C;  3HS0 C;  5E3F A;  1SYD A;  2QF7 A;  1Z47 A;  5D3I B;  3RUZ A;  2E2I B;  3K6O A;  3DUZ A;  3URY A;  2AQ1 B;  2JA8 B;  4KV6 A;  3H94 A;  1L0X B;  1EEI D;  5CV7 A;  2B2U A;  2R3Z A;  1I4R A;  4LAA A;  5E4W C;  2EYJ A;  1LTR D;  2K05 A;  1S5C D;  1LLR D;  1WTQ A;  2K5D A;  5IGC A;  5FO7 B;  4PV1 C;  3MFG A;  1QWY A;  4K2L A;  3U9S A;  5C3X A;  3L3O C;  2NWG A;  2CQA A;  3I4L A;  3G6J B;  4F88 A;  3L9A X;  5IGG A;  3CRK C;  3TSS A;  2VB3 X;  1TS2 A;  2L55 A;  1Q1E A;  2DNC A;  3CKI B;  1MSG A;  3FPU B;  3HGB A;  2E76 C;  4BY1 B;  2PZW A;  3M4Y A;  3DM1 A;  4RGN A;  1EY7 A;  4HN7 A;  3SDZ A;  4DXG A;  1R9T B;  5DAU A;  1S5B D;  5JAV A;  2KJX A;  3IKJ A;  1HCZ A;  2VXW A;  4BBS B;  3FMC A;  3BDL A;  3MXN A;  4BA2 I;  1LT3 D;  4NKL A;  3M7N A;  1I4P A;  4RGM A;  2F0L A;  1GUS A;  1WTV A;  4BWG B;  3H6M A;  4DA2 A;  2K33 A;  5IGE A;  2RKS A;  4KJN A;  5FLX L;  2D9U A;  4DK1 A;  2F0M A;  4OO1 G;  3I72 A;  2XWJ B;  4K5V A;  2B2U C;  1SJH D;  5IT9 L;  1YNN D;  4A3M B;  2A69 C;  1NSN S;  2FMM A;  1LTB D;  4OHJ A;  5I9O A;  3BYY B;  3NUC A;  3H3V C;  2AQ3 B;  2L1B A;  1GUT A;  5EPJ A;  2VB2 X;  2EYF A;  4CJ2 C;  4I7Z C;  3C2P A;  3VR5 A;  4DNR B;  4NP5 A;  1M8A A;  3T13 A;  4K14 A;  3OIQ A;  3MFY A;  2H4O A;  1WTP A;  5CV5 A;  2K1B A;  4IFD J;  1I50 B;  3SK4 A;  5NUC A;  4XTC S;  4FXG C;  1KLU D;  1LAB A;  3ND9 A;  5FOB B;  4LJZ C;  1R4Q B;  5BN3 A;  1LO5 D;  2L0C A;  3OWE B;  5LL6 S;  3NBI A;  2B2V A;  4EQN A;  3TBI B;  5C3W A;  1TWH B;  4P2C B;  1JOK A;  1UAP A;  3GV3 A;  1TQO A;  2PPB C;  1HHV A;  2DY7 A;  2X6L A;  1LT5 D;  3AU7 A;  2B8G A;  1LAC A;  1ONL A;  1S5D D;  3DEO A;  5JPN C;  2EJF C;  2PW7 A;  2Q8I B;  3W3A A;  4NDX A;  2F03 A;  3JAM L;  2F0V A;  1X3Q A;  3GQB A;  1WCM B;  1EOT A;  5ELD A;  2F0Q A;  3MWY W;  1MI2 A;  2NTT A;  3CHB D;  2EYM A;  2AUJ D;  4FP5 D;  2FJ2 A;  1A3V A;  4KMU C;  3P1H A;  1U4M A;  3RZO B;  2F0T A;  2M2L A;  5KEE A;  5FLX E;  2K6A A;  1GUG A;  4KHZ A;  1AP0 A;  4L6T B;  1PTO F;  3AMU A;  2NN6 H;  5IT9 E;  3PUW A;  5EPL A;  1Q8I A;  1F9S A;  1SNC A;  1LTT D;  2F0N A;  1AZP A;  3HOY B;  5C4H A;  2L5T A;  3VYS A;  1TVX A;  1XYI A;  5JVG 3;  2F0S A;  2RDF A;  3I70 A;  4ME5 A;  2Z8L A;  2F3W A;  3RMH A;  4QUC A;  2Y0S B;  2F0W A;  4C3I G;  3CRL C;  4QIW B;  5CMD A;  1ESF A;  1TY0 A;  3HG9 A;  3NQT A;  5KNB A;  1VMP A;  5M3M B;  3J7A F;  2PQE A;  1G29 1;  5C0X G;  2WKC A;  4KK7 A;  3IFD A;  1LTS D;  2B2V C;  1Y8O B;  3K58 A;  1OXS C;  1CZG A;  1W6K A;  1G2T A;  1QIL A;  3MTS A;  4CJ1 B;  2NBF A;  3KLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...