2J0TD

Crystal structure of the catalytic domain of mmp-1 in complex with the inhibitory domain of timp-1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
124
structure length
124
Chain Sequence
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INTERSTITIAL COLLAGENASE
publication title Crystal Structure of the Catalytic Domain of Matrix Metalloproteinase-1 in Complex with the Inhibitory Domain of Tissue Inhibitor of Metalloproteinase-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 124
sequence length 124
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2006-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2j0tD00
5JPMC 3MA2B 3V96A 3T4AC 1JB3A 4ILWA 1UEAB 3G6JB 2WINB 2ICEC 5FO8B 1JC7A 1BUVT 1PXUA 1XWEA 3FRPB 3HRZC 5FO9B 2J0TD 4FXKC 3OHXC 5FOBB 2XWJB 2QKIC 2XWBB 2A73B 1BR9A 1UAPA 3CKIB 2A74C 3HS0C 3I70A 2E2DC 3KLSA 3L3OC 1GXDC 5JPNC 2TMPA 5FO7B 1D2BA 1BQQT 2I07B 4FXGC 2B39A 1OO9B 2WIIB 3CU7A
chains in the Genus database with same CATH superfamily
5JPMC 4K2LA 2EPBA 1S72A 1CSQA 1GD7A 1VQMA 4OELB 2DN8A 4A3GG 1CFMA 1Q90A 1XWEA 3HOWB 3PUYA 2RSNA 2CCZA 3J81j 1HUNA 3P75A 3Q23A 1BR9A 4KY7A 1DOMA 2DY8A 3PQIA 5LMNW 1EWHA 5IGDA 4CKBA 3BDOA 2K1BA 1SFOB 4A93B 3E5SA 1TWAH 2CW0D 3I90A 1QVGA 1BDOA 1MIUA 5E7NA 2L5TA 4YWMA 5M3MB 4IJHA 3NEMA 1TQOA 4LF6Q 2GVBA 2VY3A 1JJGA 2DUDA 2L9HA 2EYFA 4DR6L 4C2MH 3I4OA 2E5LQ 5C4JB 3VYRA 3T56B 4AQYL 3GTQH 4XYQA 2DY7A 5EBDA 1V1PA 4DV0Q 4ZUIA 3MXPA 1SAPA 1JWMD 1TIID 1KDAA 5CGKA 1CSPA 3KBXA 4ILWA 4PZ6A 1IZ6A 2R7ZH 2ZXPA 2ICIA 5CC4A 1LABA 3NQIA 1X3EA 2K04A 3A5UA 4XT1B 3RZDH 5BN5A 1PH8A 1I4HA 4FF1A 1HA6A 2V4DA 1YNXA 3ERQA 1STBA 5C44G 5M5WB 4HCSA 4DU9A 1A6XA 4JI3Q 2XRSD 4BA2I 1F9SA 1VQPA 1EZ8A 2RDHA 4A4IA 2WKCA 4JI4L 1VCIA 2A68C 3Q22A 1OTCA 4LF5Q 1HNWL 4JYAL 4OIKA 1BCPC 1EWIA 3EBEA 3GTGB 4XYOA 3T53B 1HR0L 2HD3A 3HOZH 2XN9C 4CBVA 4JV5L 2F0NA 4GKJL 2VUMB 1F77A 2JA7H 3KUPA 2H1EA 3ZJYC 4LF9L 2E2IB 2TMPA 2QILA 4PZ7A 3A54A 4LFBQ 4P74A 1KQSA 1L1OA 1IW7D 2TSSA 4DR4L 3D3RA 4DFAA 2XRQD 5F2DA 1T5XD 5M5YH 3IL8A 3AQQA 4GNXC 2B2WC 3GDEA 1Y1WB 3D6CA 5IT9L 3I4MH 1K8OA 1STAA 4X66Q 1TWCB 3ULPA 3R2IA 2A19A 5IODA 2MHVA 5COYA 1FL0A 5I6WA 2A6HC 1X6OA 2A1AA 3SE0A 4OWWB 3M9BA 1ZYRC 4A3DH 2EJFC 3S9WA 4A3IB 2R93G 4QGUA 1V43A 3C2PA 3OOCA 3T1YQ 1CA6A 2ZJQA 3X3NA 4DK1A 4B3ML 4GOPA 3I4NH 1UEBA 1JOQA 3KF6A 3DEOA 3EQLC 5EKLA 1RL2A 4QJFA 2VS1A 1TVXA 3MEFA 4CJ2C 1RHPA 4N8FA 3F1ZA 2JN4A 1QJOA 5EKIA 5FO9B 4DV7Q 2B2TA 2RHSB 2XWJB 2Y0SG 4DAVA 1B1ZA 2L0CA 1WOCA 1JOKA 4WJWA 4OX9Q 2B8GA 1CKMA 2CKZB 1EIGA 4E6IA 4F7XA 1WTPA 4P2CB 1UE5A 2I07B 4FNFA 3GQBA 1CM9A 3IFTA 1SJED 1CZGA 5CORA 1S5CD 1YZ6A 4A3MB 1A62A 1C0AA 4RA8A 2JA8H 3D31A 1XJVA 3MXNA 1PYBA 4JPBW 5C4XB 2PNRC 4KKUA 3GTPB 4NW2A 2NZHA 1PTOB 1HTLD 3TN2A 4RGOS 3D4WA 3HP3A 2F0WA 3WWVA 4PQXA 1A3TA 3U9SA 2JE6I 1FJGQ 3M3YH 2KCNA 3M4OH 3HOZG 1N9WA 2R92B 3T51B 1OXUA 5ELOA 2PW5A 4EQPA 4DK6C 1VS0A 1T5EA 5D3IB 2N8NA 4R9WA 3A8JE 2EYJA 5T1IA 1OXSC 4C3IG 1OXXK 3KLWA 2JA7G 2KVMA 1SNMA 4JI7L 1Q1BA 1SNQA 1V8QA 1WCMB 3OIPA 3L0OA 4G7HC 1VQIA 2Z6BA 1JOOA 2KA7A 4R8NA 5JVG3 1E2WA 2WAQG 1KRSA 1K3BC 1VF5C 4DR7Q 1MSGA 2PZUA 4MN3A 4P72A 3HOUB 5JOBA 4QIWE 2SDFA 1FR3A 3G6EA 4QQBX 4CJ0B 2RCNA 4UP8A 2EZVA 3SDZA 4H7BA 1DD2A 5KEEA 4A3DG 1ENCA 2PI2A 2A6EC 2EYOA 4LNQA 3S1RB 4A3EH 5FO7B 2K03A 2WV6D 5EGTA 3I4NG 1KNAA 1HFGA 1SNPA 4BBSB 2ZM6L 4OL7A 3S24A 3JAME 4L6TB 5EPLA 2NTTA 1X32A 2IWHA 5C3EB 1VQ5A 1DONA 2D2CC 1VDZA 2F0HA 5JAVA 4XTCS 5IP7H 1CHQD 5J39A 2FHTA 1QZHA 3QJYA 2BA1A 2KENA 2PMZE 1PVOA 3CCSA 1ILPA 3I4LA 1I50H 4FVMA 4ZQ3A 2JSOA 1MI2A 1F2MA 4L5TA 4S3SA 4QMGA 1UE7A 3HKSA 4PG3A 4R4OA 3TDQA 2WIIB 4I7AA 2E2HB 1KDCA 1EEID 1Y1VB 3Q8DA 4JVZA 4LUOA 4IALA 3FDTA 3RZOB 2UXBQ 3M7GA 5BN3A 5EJWA 2JA8G 3BG3A 1I5FA 3OWEB 3BU2A 1SR3A 4PNYA 4B3TQ 4WFN3 1U0LA 1PH3A 2K7VA 1JMCA 3KOJA 4DV0L 1FD7D 2GN5A 2ZXOA 1KLGD 1RKNA 2JA9A 3MWYW 4B9WA 1WTWA 4DUYQ 2E76C 4GKKQ 3KDFB 2M2LA 2BE5D 3MXGA 1SYGA 4ID6A 1PFMA 4WORA 2UU9Q 3VR2A 1C48A 5ELCA 1N32Q 3A74A 3C1FA 1U4MA 1EQTA 3I70A 3SGIA 3KLSA 3FVQA 2F03A 4DV5L 2YYZA 1PA6A 2JA6H 3BYTB 4OONA 3E3XA 1GVPA 2PI2E 4DNRB 3K6OA 2B2YA 4CJ1B 3CRLC 2EQSA 1CZWA 1B8AA 2JA5B 1EWCA 5CR3A 3NELA 4EGVA 2B3GA 3NENA 1B70B 1K8MA 4JBKA 3S16H 4K2KA 4HJAA 4A3EG 1NUCA 4IURA 2IX1A 1STHA 2C35B 3CU7A 3D4DA 3F2UA 2K5NA 1EIHA 4C3JG 3NHHA 2E2JH 1E3PA 5IGCA 1N36L 5DAUA 1O7ZA 2O2LD 3OHXC 3RLFA 3H3VC 1V9PA 1VQFA 4JOIC 1HNZQ 3T1YL 2JYOA 2F0FA 1AP0A 3JC66 2Z6KC 3F2CA 3RLNA 5IWAL 2K14A 1EUJA 1STYA 4BBRH 3J81i 3BYYB 4LMQD 3GTOH 4H0LC 3SXHA 2Y0SE 3S1NH 4WJ4A 1TWGH 3K7AB 1SXTA 1SMYD 2ASBA 1LT6D 1B3QA 3CC4A 2EYLA 4YCVA 1L2FA 1PZID 2OTJA 3CP0A 1HNXQ 1IYJB 3NTKA 1XMQQ 1EY5A 3J7A5 2O5JC 3RN2A 1I6HB 2QKIC 1B50A 1XMOL 2K4KA 1HJPA 3CCVA 4Y52H 5C0XJ 1LT5D 3VR5A 3S2HH 5GADC 3FMCA 4AH6A 1PV4A 4A3LH 2IL8A 5ELDA 1HNWQ 1EL0A 4JYAQ 3VA7A 3LNNA 3W1GA 2RVLA 2L15A 4CDDC 4JV5Q 2A69D 3ULLA 3KF8A 3CCQA 5DLQE 2WKDA 4KD3A 4JI5Q 4DR3Q 3S1MH 3F2BA 1WTHA 4RCOA 5GQOA 4LF9Q 4P73A 4A3JH 5K5PA 2F3WA 2ENBA 4DR4Q 1F2ZA 4IN3A 1FJGL 1IBMQ 4L5RC 3FPPA 1HH2P 2I5HA 2B2VC 5DM63 5FLXL 3AYHB 1TR5A 1V1PB 3DMUA 2B63G 3J80E 2G5DA 4OXPA 4JBWA 3CCEA 3FKIG 4GN4B 4DXGA 2LS01 4JK1C 1PYWD 3EFXD 2WAQE 4IUNA 2C5CA 1NY4A 4M8AA 4DN4M 1NJIC 1PLFA 3K0XA 2CH4W 3KJPA 4KKSA 2B39A 2FFKB 3KFUA 3K7UC 1I4XA 1MKHA 1PTOF 2HIVA 5FLMH 3PO2B 1NNXA 2IT1A 5CV4A 4DR7L 3K57A 2ZXRA 4GN5A 1QILA 1GUNA 1N33Q 5J22A 1WTRA 3T13A 1BKBA 5KIXA 2EXDA 4QF4A 1TWFB 2EYHA 4JI0L 1FVIA 2SNSA 2NVYH 1I94Q 4X3TA 4A3KB 1YHAA 2F0IA 3PCOB 3SR1A 3S15H 4KHPL 2K6AA 2XIWA 3S14B 1G8ZD 1HCZA 2MGSA 4LF4L 2IW3A 5BN4A 2YTVA 4POGA 1L1OB 3X3MA 1MJEA 3GTMB 3VR3A 2HUGA 3STBC 1YJ9A 3H0GB 4X64Q 1VQKA 5JPNC 2F4IA 1W3SA 1J9OA 1QG7A 1PTOC 1O80A 4DK0A 3GTJB 4RAUC 4R4TA 4A3LG 4XXEA 1QUQA 2E75C 5DEHA 2NUCA 3LWUA 4KI0A 1Q86C 2DJGC 4GOPB 1SE3A 2RDFA 3KF6B 4DR2L 1VQGA 4CDFC 3PO3B 1DXMA 2KCTA 3H91A 1D5MC 1DZ1A 4QUCA 2NVXB 4A76A 1P16A 1S5ED 3HKZG 3GTKB 4TSSA 3NPPA 1G2SA 4DUYL 4GKKL 4KHVA 2I0QA 4EQNA 5JJIA 1WD0A 1CHPD 3CPFA 1B9NA 1SYCA 4J6HA 4GNXA 1S40A 2B2WA 4FO2A 3Q24A 1MD2D 1N32L 2HCCA 3NSWA 2ID0A 2NVQB 4LFAQ 1S5BD 2UUBL 2NVTH 1ESRA 5EPJA 4Y7NB 1BQQT 1J5EL 3HFZB 3NQTA 1R4PB 1C8CA 5FLMG 3MXNB 4U68A 2OQ0A 2Z8LA 1TWHB 5LMNQ 3VA5A 2AMCB 2R61A 3J81L 1AN8A 1JC7A 1EY0A 2MUYA 1GUTA 5HGQA 2OWOA 4LF7Q 3L7ZC 3HOYH 1VMCA 2NZ1D 2LFNA 2K5QA 2NBFA 2B8FA 3UDGA 4DV2Q 3MVVA 4APVA 2R93H 1O7IA 1TKWB 1IL8A 2QCPX 1C7YA 2I5MX 4ZAIA 3URYA 3NWSA 3J80c 2DGYA 5CV5A 1Z47A 1IHZA 3W5OA 1HQRD 4QL5A 3DWAA 1VQ9A 1K73C 3I8ZA 4JC0A 2NN6I 2BH8A 3MFYA 2IJ0A 3BJUA 4HJ8A 3HOVB 3T1HQ 5C44B 3IFDA 1TXYA 1WVLA 1HNZL 4KTAA 1EQRA 4OO1G 4C1NI 2AUKA 3PIOA 4R1JA 2GVAA 4TQUS 1PH1A 1Q8KA 1KL9A 1X9NA 4MTKA 2JK8A 3PIP3 1O7LA 1UEAB 1HNXL 3TSSA 1XMQL 2MPMA 3ND9A 3KLSX 3EA6A 4A3CH 4GN3B 3GP7A 1ZXTA 4BY7H 1XNQQ 4LFCQ 3HOWG 1C4QA 2E2DC 4IPCA 3SVMA 4YCWA 2HQLA 4A3IH 1KNEA 1I4QA 1PH7A 5JJLA 4DV5Q 4HN7A 1Q7YC 4A93G 4J1MA 2SOBA 1WFQA 5C0XI 4QB4A 4EX5A 1ILQA 2RHQB 4BA1I 3K58A 1X3FA 1QZGA 3S17H 3CAMA 1ENFA 1N34L 4DAMA 2KHJA 1EY7A 2K28A 2ZTCA 4RFBA 2F0QA 1QB5D 5FOBB 1CT1D 1Q46A 2IX0A 3RR5A 4CDEC 4C3IH 2KCCA 4CKEA 5IYDH 1YNND 4JI5L 4DR3L 1EEFD 4FDBA 1HHVA 4J8QA 1U4LA 2B2UC 1F2YA 1LTID 4N9PA 5IIFA 1KC8C 4OO1I 2EY2A 4ULLA 4R4IA 1IBML 3K5OA 4C2MB 1SJHD 2G9HD 2Y0SB 2QDLA 4IUVA 4DR1Q 4A3FH 3RMHA 4DXFA 1VQHA 1PRTD 3HOYG 5J3BA 1SYEA 2J0TD 3AU7A 3BVMA 4XT3B 4RGTA 1N36Q 1G291 1VQLA 3GTQB 2J4XA 2JQOA 3S1QH 1K8AC 1XTDA 3CF5A 1DM0B 1SE4A 3CCRA 4MNOA 4V190 3NXWA 2K5DA 3CCUA 1LTGD 5C4XH 2QEXA 3HOXH 2FXQA 2R7ZB 1AE3A 5IWAQ 1GUGA 4K8IA 4NP5A 5KYLA 2VXWA 3A56A 4DAYA 4YHHQ 5A2QE 4ZK9B 1BNZA 1H9JA 1I3QH 5DNFA 1Y14B 1LUZA 1N33L 1QVFA 1GO3E 1Z9FA 3CW2C 2R92H 1G6ZA 1I94L 5IGGA 3NP8A 4HTHA 1XMOQ 1KIXA 4HSPA 2LSSA 1I4RA 2VUMG 3DWPA 4ZUJA 3CD6A 5IT9c 4UY8C 2F0TA 2KOLA 5KNBA 3H3VI 1X65A 1IBKL 4K6DA 3HOZB 3SK5A 1K83H 3EJIA 2CFMA 1RIPA 2ES2A 1PH9A 2CQOA 1DGSA 1Y1WG 2JA7B 2LMCB 3OSOA 3PUZA 3BS1A 3DXJC 3JAMi 4A3CG 4I65A 4BY7G 1LLRD 4K6LA 1VF7A 3QIAA 4X64L 1RJTA 2NTSA 4EQ5A 1TY2A 1J6QA 1UE6A 1B4OA 4A3IG 5M5YB 4DV1Q 3I4MB 1JE4A 3C1EA 3KYHC 1Y8PB 3GTLH 4AYBG 5K36G 3NTIA 4F87A 3K5NA 4A3DB 1NSNS 1HZ9A 2F0DA 1LT3D 2BOSA 1CI3M 3FRPB 3HKZE 4DAPA 2PW7A 1EIYB 4DR5L 1KXLA 1F9QA 2KJXA 5IYDG 3I4NB 4NXML 1KAWA 4K5XA 1W6KA 2KQ3A 3AB9A 4IUUA 3NBHA 1M4VA 4O0AA 4OWXB 1VQ6A 4HMIA 2DNEA 3BZCA 4A3FG 2H4OA 5CV6A 4RHRA 1U4RA 5L37A 3OWFA 3SEBA 1SYDA 1Y1VH 3J7YW 2YU9H 5HGTA 3RZOH 4LFAL 2F0LA 4JI0Q 1PZJD 3ULJA 3DLLA 5C4XG 4JOIA 4ABNA 2F52A 3HOXG 3E0EA 1EU3A 4KHPQ 3TREA 3NUCA 3CXCA 5JJKA 1KABA 1YNJC 2Z6KA 4JG2A 5LMNL 4FP5D 3G6JB 1EYGA 2OQKA 2EJGC 1KRTA 4C3JH 4LF4Q 3F2DA 1LTBD 4LF7L 4KHZA 1HRJA 4ME5A 5DM73 3J7AV 4B3RQ 3BDLA 1VQJA 2R92G 1L1OC 2CQAA 3OYYA 2Q2UA 4DV2L 3G71A 1AH9A 5D3DA 5C4HA 1CQVA 3MAQA 2D0OA 3W2DA 4POFA 1B7YB 1DJRD 3M3YB 2Q8TA 3M4OB 2HCIA 1K9MC 1E7ZA 3DHQA 1ZEQX 4DK3C 2A68D 1I4PA 1CKNA 1GUOA 1BCPD 3T1HL 3DUZA 3LGJA 4LJZC 2I46A 1Y69U 4GOPC 1S3OA 4DR2Q 4FF3A 1UE1A 4IOCA 4C3HH 1STEA 1BVSA 2ZTDA 1S5FD 1HXYD 2K5WA 5IYCG 1BBUA 3I2ZA 4X62L 2DNCA 3CPWA 5CYUA 2B2TC 2E8GA 4BBSG 5M3FH 2AQ1B 5IOCA 5M5XH 1BBXC 4JCVE 3HEJA 5C3EG 2F0PA 1PFSA 3IKJA 1TS3A 2B2VA 1VQEA 2HDLA 1XNQL 4LFCL 3FPUB 1H95A 1SRUA 2A6HD 2F0MA 4HMJA 4B3SL 2EDGA 4HSVA 2X6GA 4QY7A 2UUBQ 1ZYRD 4RKLA 4IFDI 4R4QA 3TMEA 2SNMA 2IPKD 1J5EQ 2FMMA 3MZ5A 4A75A 2F0KA 4KY6A 2EY5A 3A8KE 1PXUA 4O42A 2N88A 1CK1A 4JI8Q 5KNCA 5FKAC 2B63H 1YHBA 1YVCA 3RN5A 3VYSA 2KECA 3EIVA 1MBYA 1I50B 5EPKA 1Y1VG 5H1SE 3E9HA 3FKIH 5JEAJ 3K59A 1BXTA 2A5HA 1NR4A 3PGZA 4HAEA 4LW1A 1JE5A 4FF4A 3R93A 2F0EA 3M4PA 3A7AB 3I7FA 1WTVA 4DNTB 3VDYA 4IUTA 4DR1L 2BH2A 1GKHA 1JQYD 1MGSA 1JB7A 3GD7A 3D0FA 4A3BH 1YBYA 4PZ8A 3D8GA 1D1IA 5KYIA 3JAML 3M4QA 4DKAC 1FYCA 2IX3A 4GNXB 2PQAA 5IP9H 2D62A 1A15A 2L55A 3K0YA 2RSOA 4YHHL 2NWGA 1D5XC 3CMAA 4AIMA 1SE8A 1IBLQ 2D0PA 5I9PA 1VQBA 2AHOB 1U4PA 4KJNA 2LXJA 4OWTB 5JJZA 3LX0A 2JA6B 4ZLTF 4QCLA 4C3HG 2GA4B 1UUPA 2J7ZA 3TP6A 2ZTEA 4JW0A 2ALYB 1Q1EA 2HQEA 4HEDA 3MEHA 1XNRQ 1SYFA 1K28A 2EXZA 3KBGA 4BXXH 3T4AC 5M3FG 3TBIB 3CQZH 1QVCA 1N34Q 1RF2D 4ZCKA 1X54A 1XPUA 3S16B 4YIJA 4FXKC 2MO0A 3R8BA 4YCUA 1LTTD 3K5MA 3NBIA 2CW0C 2RBMA 4AYBE 1K8GA 4DV1L 3KLRA 5C3WA 2E2JB 3GV3A 2A6ED 2NN6H 1SE2A 2Q2TA 1ENAA 4UAIA 2K05A 2Q2HA 2PCFB 1PFBA 4MHEA 5I6YA 1HA5A 1PH2A 4XIGS 2EYPA 1G91A 1X3PA 1QOHA 1GUSA 1YI2A 3HRZC 4UDUC 2Z4IA 3I56A 2AUJD 3SK8A 4BY1H 4IOAA 4KJOA 4RG1A 4G7OC 1L0YB 4BBRB 3WOFA 2RQXA 1HR0W 3K80C 2IHEA 3EVQA 3GTOB 2EY1A 4HIMA 4G57A 1Q81C 1TWGB 4XDXA 1SYBA 1NCVA 4OGQC 4RHSA 5AJ3L 4CDCC 5I9OA 2Z1CA 2PZWA 1B9MA 4JBJA 1F9PA 2N78A 1JR0D 3SK6A 1FNWA 3J81E 3TP5A 4PV1C 2UXDQ 2A74C 3FP9A 4A3BG 1R9TH 3L2PA 3A7LA 1EZ6A 2KHSA 3D6WA 5C0XH 4ZYSA 5IP9G 5E3FA 1S5DD 5FLXc 1W6JA 1YEZA 2Q8RE 1IBKQ 3MTSA 2HDMA 1KTKA 3BVGA 4NMZA 1E1TA 3F8TA 3C46A 4B3RL 2KEDA 1OXTA 4UPAA 2IHFA 3HKZB 2KUMA 4A3JB 1IW7C 2RKSA 4OO1H 1D5ZC 1EY4A 3FEWX 4HJ7A 2R3ZA 3M85A 3EN2A 1JWSD 2PZTA 2VB2X 3O13A 1XX8A 4CKCA 4BXXG 1Q8IA 2FJ2A 4HIOA 2CHBD 4IPDA 2F4VL 3PO2G 3NE5B 2MNAA 1TWHH 5EKKA 4CHTB 1CTMA 4JI1L 1F9RA 1SBBB 2EVBA 4IZ8A 4QIWB 3G7LA 5JEAG 4DR5Q 1G6PA 3OMCA 1Z7TA 4DAYB 5IGEA 2MQHA 3HOWH 1JORA 4IJLA 3I73A 4NXMQ 3W3AA 3A0JA 1F2LA 1QCBD 2NN6G 1GJXA 4WJ3M 3ICEA 3J7AF 1LV9A 2WB1G 2EJMA 1VQOA 4A3GB 1SFOH 4A93H 5E4WC 1RCVD 2B2UA 1SMXA 2OEOA 5C5MA 4C56C 5M3MH 2E74C 4O2DA 1NMGA 2K33A 3E6ZX 1R4QB 1YJWA 2PYKA 2QEJC 4BY1G 4FXDA 2WP8J 4YWLA 3S15B 5FK9C 3H3VH 5LHY1 5C4JH 3H0GG 4Z9CB 1SNOA 4IPHA 1G2TA 1EYDA 4DV6Q 2VQFQ 2PMZB 2AWNA 3BZKA 2VQEL 1EIFA 3QOJA 1JICA 5GROA 3UDXA 3J80L 5C5LA 3K81C 4R4CA 2OF1A 4JI8L 2P5ZX 1Q82C 2F0JA 4FYDA 2RCFA 5IT9E 1I4GA 4IPGA 2Q2IA 3A5ZB 1A0IA 3HS0C 3TQYA 3U4VA 4WRDA 1FGUA 3PO3G 1TU2B 1BF4A 5C0XG 2K5VA 2H5XA 1B2TA 3CC2A 3R2TA 1J8IA 1YHQA 5M5WH 1CUKA 3OPOA 4DV4Q 3SK4A 3MHBA 4UHVA 2D5DA 1JB3A 5TSSA 2G9DA 1LTAD 5T1GA 1NBWA 2ICEC 4XQJA 3H15A 1CKOA 3HGBA 2KHIA 1H9SA 3OW7A 4DGZA 4JI2L 2ZT9C 5CV8A 4QUFA 3GTGH 2QW7A 2R7DA 3NBHB 3RD4A 1IKLA 2A73B 4ZKBB 1A2TA 1TS2A 2VUMH 4ZKCB 4BS9A 1SNDA 5EAYA 2PNHA 4X62Q 1Q3LA 1AEXA 3J81c 2AWOA 3HZXA 2E2IH 2JEBI 1YJNA 3MA2B 4I7ZC 1BCPF 2YTXA 4OHJA 5ELEA 3I72A 1E0BA 1K3RA 4UP9A 1PH6A 1IBLL 4RWSC 1WTOA 1Y1WH 2NVTB 4NXNQ 3S2DB 1H9RA 3CMEA 3CCMA 2F3IA 4DPGA 1TWCH 1A8VA 2M9VA 4K8JA 4IFDJ 1Y8NB 1X3QA 3BZDB 2AQ2B 1II3A 3CCJA 1PYSB 3CC7A 3V2TA 1KD1C 1ASYA 4B3SQ 1A3UA 3PUWA 1H9KA 2F0GA 3VR4A 1SNCA 1XNRL 3A8IE 4GS3A 4NPSA 1PH4A 4ME3A 1E24A 4LUVA 3HOYB 3PSIA 4XQNA 3PV0A 5K36H 5M3MG 2Z0SA 3G48A 3PF5A 3QOLA 1WTXA 2R93B 3VYTA 1JCKB 2JJQA 2VNUD 3HOVG 2L1BA 4HIDA 1EQVA 3UE0A 1EOVA 5D65A 3AMUA 1TWAB 1CKNB 1IYVA 3QWNA 4R8IA 4K14A 2LKVA 5NUCA 3ND8A 4GLVB 3BDCA 1V1QA 1LO5D 4K5WA 5IY0A 2PO4A 3QB3A 2NB0A 3RNUA 1TY0A 5GAHC 2XSCA 2LXKA 5G3LD 5IYBH 1PZKD 1B3AA 2K52A 2JP1A 3WDNA 3TEHB 4A3MH 1UAPA 5CV7A 3STBD 2I5LX 1Y8OB 1LACA 1STNA 4KKTA 1XPRA 2BE5C 1E2VA 3TP8A 3GTPH 2OXPA 1AZPA 4RKBA 1PTOH 3OMGA 3U58A 3V96A 4LK1C 3FHWA 3ONAB 1PTOD 4BY7B 4H13C 2QGQA 3AEVA 3RZDB 3K8AA 2QDBA 2F0SA 3K5LA 1QE6A 4IFDH 4JI6L 2UXDL 4Q0FA 4L5SA 5D14A 4K0KQ 3G4SA 4DUZL 4LWCA 1DOLA 3NK9A 2MP1A 3S17B 4AYBB 1D7QA 4JBMA 1VQ4A 5FJ8H 3Q0AA 3DEPA 3PIPA 2KBNA 4P71A 1WCMH 1NMFA 3OW2A 1XXGA 4X65L 4LF8Q 4DA2A 1ESFA 2K01A 5ELNA 5FO8B 4C3IB 4YY3L 1NR2A 2EE1A 4P75A 3HOUH 3CKIB 2O4XA 4IUQA 5C3XA 3L3OC 4DNIA 4LUZA 2OCEA 5IYCH 3M7NA 1PRTB 2WAQB 5BR8L 3S1RH 1GOZA 4A3FB 3VR6A 4G4KA 2R7ZG 4BBSH 2WFWA 2UUCQ 3S1QB 2PQAB 2CWAA 2F1MA 1VQ7A 1TS4A 5C3EH 1L0XB 1EFID 5E1FA 3HOXB 2WB1E 2M00A 1GXDC 2MJ8A 2QF7A 3P7JA 4HIKA 4EVOA 5IE8A 1LYLA 1SMYC 3M4YA 1I3QB 2YTYA 1MJCA 3TS2A 5AJ3Q 4H02A 1WI5A 3W1BA 1EFWA 5LMUQ 4MTNA 5IYBG 2E2HH 2BDOA 4X6AH 1D1KA 3U50C 4A3MG 2UXCL 1SN8A 2PQEA 4KMUC 2RF4A 1U5KA 2F3VA 4DV6L 4IUPA 1SSOA 2VQFL 1K83B 1DYQA 4EQOA 1EOTA 3GO5A 2RDGA 3KF8B 4X3UA 1ICWA 3I4MG 2L11A 1RTNA 5KRUA 4XQQA 3E0JA 5I2YA 4IO9A 2BCOA 1AW7A 2A69C 5I2XA 2JA8B 1NAPA 1JWUD 2WACA 2ZJPA 1IL2A 2EOTA 2HHHL 2VZAA 1JJ2A 4IFDG 2C9OA 3CHBD 3Q6SA 5A35A 1DOKA 2Q8IB 1O78A 2CWPA 3GTLB 3KJOA 4KV6A 5FJ8G 1PHJA 5A2QL 1LTSD 1WCMG 3VYUA 4DV4L 3IAYA 3DM3A 3N52A 4J15A 4F88A 1U9RA 5CMDA 2F4VQ 3QO2A 2K75A 2DJFC 1LTLA 2L12A 4RH6A 4MIUA 2JA5H 2BDNA 4JI1Q 3PUXA 3AFPA 3HOUG 3MC0B 1X3GA 1EYCA 2PPBC 4UP7A 5HY6A 1SLJA 2OTLA 1QNKA 4HJ5A 1BBWA 4OEMB 1OXVA 2N3SA 5ISRA 3ER0A 4TKOB 4LF6L 3TRZA 4KD4A 1IYUA 2XVSA 4K5VA 1LTRD 3B6YA 3WOEA 2E5LL 4L63B 2YU9B 4NXNL 3H09A 3V05A 1AFPA 5M9OA 2YV5A 5ELBA 2AQ3B 1CA5A 4A3EB 2D9UA 3ERSX 2EYMA 4O1NA 2N55A 2AKWB 1VQ8A 4YWKA 4C3JB 4DV3Q 1HTPA 1S4ZA 2VQEQ 4N9TA 2UUAQ 2X6LA 5HURA 1PDQA 2HIXA 2WINB 3ITPA 3OTOQ 3PMFA 4ZRZA 1LM0A 1VQCA 4KK7A 2ATWA 3K7AH 3NWTA 5C4ZA 3NTHA 2HT1A 2Z9HA 5FLXE 3UDFA 1GHJA 1HZCA 1QUQB 4JI3L 1ASZA 1I6HH 4LF5L 1HZBA 4TVAB 1BCPB 1SEBD 2B29A 3PF4A 1NTGA 3RUZA 2JXMB 2IY5B 4L5QA 2RA4A 4C3HB 3UDIA 1HUMA 4NDXA 4JI2Q 1EQQA 3ZYYX 4LFBL 1JJCB 1SDFA 4H44C 4C1NK 1N8RC 5M3FB 1NE3A 3J80i 5M5XB 1YITA 3P20A 1IXRA 5LL6X 1FNVA 3EROA 4X66L 3U9OA 1MSHA 3MFGA 3TP7A 1VMPA 1BUVT 5IP7G 4DR6Q 3GV6A 2JA5G 1VQDA 3L9AX 2XWBB 1TT2A 5C6AA 2LY7A 1EY9A 4AQYQ 1G51A 4L8JA 4TRDA 4K0KL 5E4XA 4GLAC 1VQAA 1TS5A 5EQ0A 4ALPA 1ZKOA 3R3OA 1D6EC 3MXUA 3UI2A 5J1ZA 1KHIA 1OO9B 3DM1A 4N8X1 5I4DA 4LF8L 1KDBA 2F0VA 4PMBA 2B63B 1QNUA 1ML0D 2L4NA 2BA0A 4DV7L 1HFNA 3FKIB 1WTQA 3PO2H 1BOSA 3JAMc 1K0RA 1EY8A 1UNSA 1B44D 5JEAH 1QWYA 1KLUD 4OX9L 1ICFB 3U4ZA 5IGFA 1M8AA 1D2BA 1H9SB 1TWFH 4HR7B 1A63A 1L0WA 3OIQA 4JI4Q 1WJJA 4RCNA 1AZQA 4A3KH 1XYIA 4KLKA 2XNAC 3S14H 2FINB 1HR0Q 2UUCL 4KN7C 4KN4C 1YNJD 4LAAA 4RGNA 4A3BB 1M90C 4V0BA 4GKJQ 2F0OA 3GTMH 1GM5A 2MO1A 2JEAI 3PUVA 1Z6HA 1P8LA 1RODA 1H9MA 4PMWA 3N6RA 2V1CC 3CCLA 1I6VC 1AE2A 1UWVA 1T9HA 3H0GH 2JA6G 1KAAA 3S1NB 2VL6A 3H94A 1XTCD 4F8MA 4X3KA 5EBCA 3C3LA 1FNUA 1HPCA 5G3LF 1LT4D 1PRTF 2KCMA 5CV9A 2EIFA 3GTJH 5LMUL 5CBAE 1A3VA 1WYDA 1JT8A 3SHLA 4IQZA 2NYZD 3P1HA 3KK7A 4KY5A 4JI6Q 2B2YC 2FMCA 3S2HB 4MZ9A 1GUWA 4M1UB 3PO3H 4DUZQ 4B3MQ 3QG1A 3IRBA 3TS0A 4FXGC 2NVXH 3CQZB 1E1OA 1ONLA 3A55A 5JVH3 4GLXA 5GAGC 3H6MA 1RDPD 2R6GA 3HG9A 4B08A 3GTKH 1K0SA 4X65Q 2CH4A 4A3GH 1B53A 4PMCA 1YNNC 4RGMA 1O7YA 4YY3Q 5IGBA 4HJ9A 3S1MB 4G7ZC 4X3SA 3KDFA 4CGYB 1STGA 2OT2A 5GAEC 2WB1B 4BBRG 1Q12A 2NVQH 2K50A 2Z4HA 5CBEE 5BR8Q 2ZJRA 2VW9A 1PRTC 2F0UA 2VB3X 4Y7NH 2EY6A 2K32A 1A2UA 4BY1B 4DF7A 3RLOA 1E2ZA 5AFWA 2XTIA 1EY6A 3T16A 1PMRA 4GZYC 1BO0A 3LWEA 1PH5A 4OIJA 2SEBD 4ODGA 2O5IC 1YIJA 3PIO3 2N49A 2K5HA 4A3KG 1HZAA 4U673 1EU4A 1CQFA 1ET6A 3AFQA 5KNDA 2QA4A 3J7ZC 1W2BA 2UXBL 1HQMC 2NVYB 1R9TB 1C9OA 5ELFA 2CVRA 4BWGB 1MHWC 3TZUA 4B3TL 4NKLA 1VQNA 1RD9D 5KGUA 1M1KC 3HOVH 2UXCQ 5LL6S 3BVZA 4JI7Q 2R7FA 5C44H 1DCZA 4A3JG 3CRKC 3TZDA 4FF2A 2NZOA 4DV3L 1EYAA 2MFIA 2UUAL 3D4RA 3I3CA 3OTOL 3UE1A 1X55A 1X56A 2UU9L 1GHKA 2X69A 1XPOA 1ET9A 1FGBD 4B9XA 2HHHQ 1PFNA 4HCEA 3E9IA 1SROA 1V1OA 3I55A 4NB3A 1IKMA 2XGTA 4RMFA 3S2DH 1E22A 4Q5VA 2KEEA 3DWQA 2A8VA 1RTOA 1WD1A 3QR8A 2ZM6Q 1D8LA 3I91A
chains in the Genus database with same CATH topology
5JPMC 4K2LA 2EPBA 2DN8A 1CFMA 1Q90A 1XWEA 3HOWB 3PUYA 2RSNA 1HUNA 3P75A 3Q23A 1BR9A 4KY7A 1DOMA 2DY8A 1EWHA 5IGDA 4CKBA 3BDOA 2K1BA 1SFOB 4A93B 3E5SA 3I90A 2CW0D 1BDOA 2L5TA 5M3MB 1TQOA 2L9HA 2EYFA 5C4JB 3VYRA 3T56B 4XYQA 2DY7A 5EBDA 1V1PA 4ZUIA 3MXPA 1SAPA 1JWMD 1TIID 1KDAA 5CGKA 3KBXA 4ILWA 2ZXPA 2ICIA 5CC4A 1LABA 3NQIA 2K04A 4XT1B 5BN5A 1I4HA 4FF1A 1HA6A 2V4DA 3ERQA 1STBA 5M5WB 4HCSA 4DU9A 1A6XA 2XRSD 4BA2I 1F9SA 1EZ8A 2RDHA 2WKCA 1VCIA 2A68C 3Q22A 4OIKA 1BCPC 3GTGB 4XYOA 3T53B 2XN9C 4CBVA 2F0NA 2VUMB 1F77A 3KUPA 2H1EA 2E2IB 2TMPA 2QILA 3A54A 1IW7D 2TSSA 3D3RA 4DFAA 2XRQD 5F2DA 1T5XD 3IL8A 2B2WC 1Y1WB 3D6CA 5IT9L 1K8OA 1STAA 1TWCB 3R2IA 5IODA 2MHVA 5COYA 5I6WA 2A6HC 3SE0A 1ZYRC 2EJFC 3S9WA 4A3IB 1V43A 3C2PA 3OOCA 1CA6A 3X3NA 4DK1A 1JOQA 3DEOA 3EQLC 5EKLA 1TVXA 4CJ2C 1RHPA 5EKIA 1QJOA 5FO9B 2B2TA 2XWJB 4DAVA 1B1ZA 2L0CA 1JOKA 4WJWA 2B8GA 4E6IA 1EIGA 4F7XA 1WTPA 4P2CB 2I07B 4FNFA 3GQBA 1CM9A 3IFTA 1SJED 1CZGA 5CORA 1S5CD 4A3MB 4RA8A 3D31A 3MXNA 5C4XB 2PNRC 4KKUA 3GTPB 4NW2A 1PTOB 1HTLD 3TN2A 4RGOS 3D4WA 3HP3A 2F0WA 4PQXA 1A3TA 3U9SA 2JE6I 2KCNA 2R92B 3T51B 1OXUA 2PW5A 4EQPA 1T5EA 5D3IB 4R9WA 3A8JE 2EYJA 5T1IA 1OXSC 4C3IG 1OXXK 2KVMA 1SNMA 1Q1BA 1SNQA 1V8QA 1WCMB 3OIPA 4G7HC 1JOOA 2KA7A 4R8NA 5JVG3 1E2WA 1VF5C 1MSGA 2PZUA 4MN3A 3HOUB 5JOBA 2SDFA 1FR3A 4CJ0B 2EZVA 3SDZA 4H7BA 1DD2A 5KEEA 1ENCA 2A6EC 2EYOA 3S1RB 5FO7B 2K03A 2WV6D 5EGTA 1KNAA 1HFGA 1SNPA 4BBSB 4OL7A 3JAME 4L6TB 5EPLA 2NTTA 1X32A 2IWHA 5C3EB 1DONA 2D2CC 1VDZA 2F0HA 5JAVA 4XTCS 1CHQD 5J39A 2FHTA 3QJYA 2BA1A 1ILPA 3I4LA 4FVMA 4ZQ3A 2JSOA 1MI2A 1F2MA 4S3SA 4QMGA 3TDQA 2WIIB 2E2HB 1KDCA 1EEID 1Y1VB 4IALA 3FDTA 3RZOB 3M7GA 5BN3A 5EJWA 3BG3A 3OWEB 4PNYA 4WFN3 2K7VA 1FD7D 2ZXOA 1KLGD 1RKNA 3MWYW 1WTWA 4B9WA 2E76C 2M2LA 2BE5D 3MXGA 1SYGA 4ID6A 1PFMA 4WORA 3VR2A 1C48A 5ELCA 3C1FA 1U4MA 1EQTA 3I70A 3KLSA 3FVQA 2F03A 2YYZA 3BYTB 4DNRB 4CJ1B 3K6OA 2B2YA 3CRLC 1CZWA 2JA5B 1EWCA 5CR3A 4EGVA 1K8MA 4K2KA 1NUCA 4IURA 2IX1A 1STHA 3CU7A 3D4DA 3F2UA 1EIHA 4C3JG 3NHHA 5IGCA 5DAUA 1O7ZA 2O2LD 3OHXC 3RLFA 3H3VC 2JYOA 2F0FA 1AP0A 1STYA 3BYYB 4LMQD 4H0LC 3SXHA 3K7AB 1SXTA 1SMYD 1LT6D 2EYLA 1PZID 3NTKA 1EY5A 2O5JC 1I6HB 2QKIC 1B50A 5C0XJ 1LT5D 3VR5A 3FMCA 2IL8A 5ELDA 1EL0A 3VA7A 3LNNA 2RVLA 2A69D 3KF8A 2WKDA 4KD3A 4RCOA 5K5PA 2F3WA 2ENBA 1F2ZA 4IN3A 3FPPA 2B2VC 5DM63 5FLXL 1TR5A 1V1PB 3DMUA 3J80E 4JBWA 4DXGA 2LS01 4JK1C 1PYWD 3EFXD 4IUNA 2C5CA 4DN4M 4M8AA 1PLFA 4KKSA 2B39A 2FFKB 1I4XA 1PTOF 3PO2B 2IT1A 5CV4A 3K57A 2ZXRA 1QILA 1GUNA 5J22A 1WTRA 3T13A 5KIXA 4QF4A 1TWFB 2EYHA 2SNSA 4X3TA 4A3KB 2F0IA 3SR1A 2K6AA 2XIWA 3S14B 1G8ZD 1HCZA 2MGSA 2IW3A 5BN4A 3GTMB 3X3MA 3VR3A 2HUGA 3H0GB 5JPNC 2F4IA 1J9OA 1QG7A 1PTOC 1O80A 4DK0A 3GTJB 4RAUC 4XXEA 2E75C 5DEHA 2NUCA 3LWUA 4KI0A 1SE3A 2RDFA 3PO3B 1DXMA 3H91A 1D5MC 1DZ1A 4QUCA 2NVXB 1S5ED 3GTKB 4TSSA 3NPPA 1G2SA 4KHVA 4EQNA 1WD0A 1CHPD 1B9NA 1SYCA 4J6HA 2B2WA 4FO2A 3Q24A 1MD2D 2HCCA 3NSWA 2ID0A 2NVQB 1S5BD 1ESRA 5EPJA 4Y7NB 1BQQT 3NQTA 1R4PB 1C8CA 4U68A 2Z8LA 1TWHB 3VA5A 3J81L 2R61A 1AN8A 1JC7A 1EY0A 2MUYA 1GUTA 3L7ZC 1VMCA 2NZ1D 2LFNA 2K5QA 2NBFA 2B8FA 3MVVA 1TKWB 1IL8A 2QCPX 4ZAIA 3URYA 3NWSA 5CV5A 1Z47A 1IHZA 1HQRD 3DWAA 3I8ZA 2NN6I 3MFYA 2IJ0A 3HOVB 5C44B 3IFDA 1WVLA 4KTAA 4OO1G 4C1NI 2AUKA 4TQUS 3PIP3 1O7LA 1UEAB 3TSSA 2MPMA 3ND9A 3KLSX 3EA6A 3GP7A 1ZXTA 1C4QA 2E2DC 3SVMA 1KNEA 1I4QA 4HN7A 4J1MA 2SOBA 5C0XI 4QB4A 1ILQA 4BA1I 3K58A 1ENFA 1EY7A 2K28A 4RFBA 2F0QA 1QB5D 5FOBB 1CT1D 2IX0A 2KCCA 4CKEA 1YNND 1EEFD 1HHVA 4J8QA 1U4LA 2B2UC 1F2YA 1LTID 4N9PA 5IIFA 4OO1I 2EY2A 4ULLA 3K5OA 4C2MB 1SJHD 2G9HD 2Y0SB 4IUVA 3RMHA 4DXFA 1PRTD 1SYEA 2J0TD 4XT3B 3AU7A 3BVMA 4RGTA 1G291 3GTQB 2J4XA 1DM0B 1SE4A 4V190 3NXWA 2K5DA 1LTGD 2R7ZB 1GUGA 4K8IA 4NP5A 5KYLA 2VXWA 3A56A 4DAYA 5A2QE 4ZK9B 1BNZA 1H9JA 5DNFA 1G6ZA 5IGGA 3NP8A 4HTHA 4HSPA 1I4RA 3DWPA 4ZUJA 2F0TA 2KOLA 5KNBA 4K6DA 3HOZB 3SK5A 3EJIA 2JA7B 2LMCB 3OSOA 3PUZA 3BS1A 3DXJC 4I65A 1LLRD 4K6LA 1VF7A 3QIAA 1RJTA 2NTSA 1TY2A 1B4OA 5M5YB 3I4MB 1JE4A 3C1EA 1Y8PB 5K36G 3NTIA 4F87A 3K5NA 4A3DB 1NSNS 2F0DA 1LT3D 2BOSA 1CI3M 3FRPB 4DAPA 2PW7A 1F9QA 2KJXA 3I4NB 4K5XA 1W6KA 2KQ3A 3AB9A 4IUUA 3NBHA 1M4VA 4HMIA 2DNEA 2H4OA 5CV6A 4RHRA 1U4RA 3OWFA 3SEBA 1SYDA 3J7YW 5HGTA 2F0LA 1PZJD 4ABNA 1EU3A 3NUCA 1KABA 1YNJC 4FP5D 3G6JB 2EJGC 1LTBD 4KHZA 1HRJA 4ME5A 5DM73 3J7AV 3BDLA 2CQAA 5D3DA 5C4HA 1CQVA 3MAQA 3W2DA 1DJRD 3M3YB 2Q8TA 3M4OB 2HCIA 3DHQA 1ZEQX 2A68D 1I4PA 1GUOA 1BCPD 3DUZA 4LJZC 1Y69U 2I46A 4FF3A 1STEA 1S5FD 1HXYD 2K5WA 2DNCA 5CYUA 2B2TC 2AQ1B 5IOCA 1BBXC 3HEJA 2F0PA 3IKJA 1TS3A 2B2VA 2HDLA 3FPUB 2A6HD 2F0MA 4HMJA 2EDGA 4HSVA 2X6GA 1ZYRD 4RKLA 4IFDI 3TMEA 2SNMA 2IPKD 2FMMA 3MZ5A 2F0KA 4KY6A 2EY5A 3A8KE 1PXUA 4O42A 2N88A 1CK1A 5KNCA 5FKAC 3VYSA 2KECA 5EPKA 1MBYA 1I50B 5JEAJ 3K59A 1BXTA 2A5HA 1NR4A 4HAEA 4FF4A 3R93A 2F0EA 3A7AB 1WTVA 4DNTB 4IUTA 1JQYD 1MGSA 3GD7A 3D8GA 1D1IA 5KYIA 3JAML 1FYCA 2IX3A 2D62A 1A15A 2L55A 3K0YA 2RSOA 2NWGA 1D5XC 5I9PA 1U4PA 4KJNA 5JJZA 3LX0A 2JA6B 4ZLTF 4QCLA 4C3HG 2GA4B 1UUPA 2J7ZA 3TP6A 1Q1EA 2HQEA 4HEDA 3MEHA 1SYFA 2EXZA 3KBGA 3T4AC 3TBIB 1RF2D 3S16B 4YIJA 4FXKC 3R8BA 1LTTD 3K5MA 3NBIA 2CW0C 2RBMA 3KLRA 5C3WA 2E2JB 3GV3A 2A6ED 2NN6H 1SE2A 1ENAA 4UAIA 2K05A 2PCFB 1PFBA 4MHEA 5I6YA 1HA5A 4XIGS 2EYPA 1G91A 1X3PA 1QOHA 1GUSA 3HRZC 4UDUC 2Z4IA 2AUJD 3SK8A 4KJOA 4G7OC 1L0YB 4BBRB 3WOFA 2RQXA 3EVQA 3GTOB 2EY1A 4G57A 1TWGB 4XDXA 1SYBA 1NCVA 4OGQC 4RHSA 5I9OA 2Z1CA 2PZWA 1B9MA 1F9PA 1JR0D 3SK6A 1FNWA 3J81E 3TP5A 4PV1C 2A74C 3A7LA 1EZ6A 2KHSA 3D6WA 5C0XH 4ZYSA 5E3FA 1S5DD 1W6JA 2Q8RE 3MTSA 2HDMA 1KTKA 3BVGA 4NMZA 3C46A 2KEDA 1OXTA 3HKZB 2KUMA 4A3JB 1IW7C 2RKSA 4OO1H 1D5ZC 1EY4A 3FEWX 2R3ZA 3M85A 1JWSD 2PZTA 2VB2X 3O13A 1XX8A 4CKCA 1Q8IA 2FJ2A 2CHBD 3NE5B 5EKKA 4CHTB 1CTMA 1F9RA 1SBBB 2EVBA 4IZ8A 4QIWB 3G7LA 5JEAG 3OMCA 1Z7TA 5IGEA 1JORA 3I73A 3W3AA 1F2LA 1QCBD 2NN6G 1GJXA 3J7AF 1LV9A 2EJMA 4A3GB 5E4WC 1RCVD 2B2UA 2OEOA 5C5MA 4C56C 2E74C 2K33A 3E6ZX 1R4QB 2PYKA 2QEJC 4FXDA 2WP8J 3S15B 5FK9C 5LHY1 4Z9CB 1SNOA 1G2TA 1EYDA 2PMZB 2AWNA 3QOJA 1JICA 3J80L 5C5LA 2OF1A 2F0JA 4FYDA 5IT9E 1I4GA 3HS0C 4WRDA 1TU2B 1BF4A 5C0XG 1B2TA 3R2TA 1J8IA 3OPOA 3SK4A 3MHBA 2D5DA 5TSSA 1JB3A 2G9DA 1LTAD 5T1GA 2ICEC 4XQJA 3HGBA 3OW7A 1H9SA 4DGZA 2ZT9C 5CV8A 4QUFA 3RD4A 1IKLA 2A73B 4ZKBB 1A2TA 1TS2A 4ZKCB 4BS9A 1SNDA 1Q3LA 1AEXA 2AWOA 3HZXA 2JEBI 3MA2B 4I7ZC 1BCPF 4OHJA 5ELEA 3I72A 1E0BA 4RWSC 1WTOA 2NVTB 3S2DB 1H9RA 2M9VA 4K8JA 4IFDJ 1Y8NB 1X3QA 3BZDB 2AQ2B 1II3A 3V2TA 1A3UA 3PUWA 1H9KA 2F0GA 3VR4A 1SNCA 3A8IE 3HOYB 4XQNA 3PV0A 5K36H 1WTXA 3QOLA 2R93B 3VYTA 1JCKB 2VNUD 2L1BA 1EQVA 5D65A 3AMUA 1TWAB 1IYVA 3QWNA 4R8IA 4K14A 2LKVA 5NUCA 3ND8A 3BDCA 1LO5D 4K5WA 2PO4A 3QB3A 2NB0A 1TY0A 2XSCA 5G3LD 1PZKD 1B3AA 3WDNA 2JP1A 1UAPA 5CV7A 1Y8OB 1LACA 1STNA 4KKTA 2BE5C 1E2VA 3TP8A 2OXPA 1AZPA 4RKBA 1PTOH 3OMGA 3V96A 4LK1C 3ONAB 1PTOD 4BY7B 4H13C 3RZDB 2QDBA 2F0SA 3K5LA 1QE6A 4IFDH 4Q0FA 5D14A 1DOLA 3NK9A 2MP1A 3S17B 4AYBB 3Q0AA 3DEPA 1XXGA 4DA2A 1ESFA 2K01A 5FO8B 4C3IB 1NR2A 2EE1A 3CKIB 2O4XA 4IUQA 5C3XA 3L3OC 3M7NA 1PRTB 2WAQB 1GOZA 4A3FB 3VR6A 4G4KA 3S1QB 2F1MA 1TS4A 1L0XB 1EFID 5E1FA 3HOXB 2M00A 1GXDC 2MJ8A 2QF7A 3P7JA 4EVOA 1SMYC 3M4YA 1I3QB 2BDOA 1D1KA 2PQEA 4KMUC 2F3VA 4IUPA 1SSOA 1K83B 1DYQA 4EQOA 1EOTA 3GO5A 2RDGA 4X3UA 1ICWA 2L11A 1RTNA 5KRUA 4XQQA 3E0JA 5I2YA 2BCOA 1AW7A 2A69C 5I2XA 2JA8B 1NAPA 1JWUD 2WACA 2EOTA 4IFDG 2C9OA 3CHBD 3Q6SA 5A35A 1DOKA 2Q8IB 1O78A 3GTLB 4KV6A 5A2QL 1LTSD 3VYUA 3IAYA 3N52A 4F88A 1U9RA 5CMDA 3QO2A 2L12A 4RH6A 4MIUA 2BDNA 3PUXA 3MC0B 1EYCA 2PPBC 1QNKA 1OXVA 5ISRA 4TKOB 4KD4A 1IYUA 2XVSA 4K5VA 1LTRD 3WOEA 2YU9B 4L63B 3H09A 3V05A 1AFPA 5M9OA 5ELBA 2AQ3B 1CA5A 4A3EB 2D9UA 2EYMA 4O1NA 2N55A 4C3JB 1HTPA 1S4ZA 4N9TA 2X6LA 5HURA 1PDQA 2WINB 3ITPA 3PMFA 4ZRZA 4KK7A 3NWTA 5C4ZA 3NTHA 5FLXE 1GHJA 1BCPB 1SEBD 3RUZA 2JXMB 2RA4A 4C3HB 1HUMA 4NDXA 3ZYYX 1SDFA 4H44C 4C1NK 5M3FB 5M5XB 3P20A 5LL6X 1FNVA 3EROA 3U9OA 1MSHA 3MFGA 3TP7A 1VMPA 1BUVT 3GV6A 3L9AX 2XWBB 1TT2A 5C6AA 2LY7A 1EY9A 4L8JA 4TRDA 5E4XA 1TS5A 5EQ0A 1ZKOA 3R3OA 1D6EC 3MXUA 3UI2A 5J1ZA 1OO9B 3DM1A 5I4DA 1KDBA 2F0VA 4PMBA 2B63B 1QNUA 1ML0D 2L4NA 2BA0A 1HFNA 3FKIB 1WTQA 1BOSA 1EY8A 1UNSA 1B44D 5JEAH 1QWYA 1KLUD 5IGFA 1M8AA 1D2BA 1H9SB 4HR7B 3OIQA 4RCNA 1AZQA 1XYIA 2XNAC 2FINB 4KN7C 4KN4C 1YNJD 4LAAA 4RGNA 4A3BB 4V0BA 2F0OA 2JEAI 3PUVA 1Z6HA 1RODA 1H9MA 4PMWA 3N6RA 1I6VC 1KAAA 3S1NB 3H94A 1XTCD 4F8MA 4X3KA 5EBCA 3C3LA 1FNUA 1HPCA 5G3LF 1LT4D 1PRTF 5CV9A 5CBAE 1A3VA 3SHLA 4IQZA 2NYZD 3P1HA 3KK7A 4KY5A 2B2YC 2FMCA 3S2HB 1GUWA 4M1UB 3QG1A 4FXGC 3CQZB 1ONLA 3A55A 5JVH3 3H6MA 1RDPD 2R6GA 3HG9A 4B08A 1B53A 4PMCA 1YNNC 4RGMA 1O7YA 5IGBA 3S1MB 4G7ZC 4X3SA 4CGYB 1STGA 2OT2A 2WB1B 1Q12A 2Z4HA 5CBEE 1PRTC 2F0UA 2VB3X 2EY6A 2K32A 1A2UA 4BY1B 4DF7A 1E2ZA 5AFWA 1EY6A 3T16A 1PMRA 4GZYC 1BO0A 3LWEA 4OIJA 2SEBD 4ODGA 2O5IC 3PIO3 4U673 1EU4A 1CQFA 1ET6A 5KNDA 1HQMC 2NVYB 1R9TB 5ELFA 2CVRA 4BWGB 3TZUA 4NKLA 1RD9D 5KGUA 5LL6S 3BVZA 1DCZA 3CRKC 3TZDA 4FF2A 1EYAA 3D4RA 3I3CA 1GHKA 2X69A 1ET9A 1FGBD 4B9XA 1PFNA 4HCEA 1V1OA 1IKMA 4Q5VA 2KEEA 3DWQA 1RTOA 1WD1A 3I91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPM C;  3MA2 B;  3V96 A;  3T4A C;  1JB3 A;  4ILW A;  1UEA B;  3G6J B;  2WIN B;  2ICE C;  5FO8 B;  1JC7 A;  1BUV T;  1PXU A;  1XWE A;  3FRP B;  3HRZ C;  5FO9 B;  2J0T D;  4FXK C;  3OHX C;  5FOB B;  2XWJ B;  2QKI C;  2XWB B;  2A73 B;  1BR9 A;  1UAP A;  3CKI B;  2A74 C;  3HS0 C;  3I70 A;  2E2D C;  3KLS A;  3L3O C;  1GXD C;  5JPN C;  2TMP A;  5FO7 B;  1D2B A;  1BQQ T;  2I07 B;  4FXG C;  2B39 A;  1OO9 B;  2WII B;  3CU7 A; 
#chains in the Genus database with same CATH topology
 5JPM C;  4K2L A;  2EPB A;  1S72 A;  1CSQ A;  1GD7 A;  1VQM A;  4OEL B;  2DN8 A;  4A3G G;  1CFM A;  1Q90 A;  1XWE A;  3HOW B;  3PUY A;  2RSN A;  2CCZ A;  3J81 j;  1HUN A;  3P75 A;  3Q23 A;  1BR9 A;  4KY7 A;  1DOM A;  2DY8 A;  3PQI A;  5LMN W;  1EWH A;  5IGD A;  4CKB A;  3BDO A;  2K1B A;  1SFO B;  4A93 B;  3E5S A;  1TWA H;  2CW0 D;  3I90 A;  1QVG A;  1BDO A;  1MIU A;  5E7N A;  2L5T A;  4YWM A;  5M3M B;  4IJH A;  3NEM A;  1TQO A;  4LF6 Q;  2GVB A;  2VY3 A;  1JJG A;  2DUD A;  2L9H A;  2EYF A;  4DR6 L;  4C2M H;  3I4O A;  2E5L Q;  5C4J B;  3VYR A;  3T56 B;  4AQY L;  3GTQ H;  4XYQ A;  2DY7 A;  5EBD A;  1V1P A;  4DV0 Q;  4ZUI A;  3MXP A;  1SAP A;  1JWM D;  1TII D;  1KDA A;  5CGK A;  1CSP A;  3KBX A;  4ILW A;  4PZ6 A;  1IZ6 A;  2R7Z H;  2ZXP A;  2ICI A;  5CC4 A;  1LAB A;  3NQI A;  1X3E A;  2K04 A;  3A5U A;  4XT1 B;  3RZD H;  5BN5 A;  1PH8 A;  1I4H A;  4FF1 A;  1HA6 A;  2V4D A;  1YNX A;  3ERQ A;  1STB A;  5C44 G;  5M5W B;  4HCS A;  4DU9 A;  1A6X A;  4JI3 Q;  2XRS D;  4BA2 I;  1F9S A;  1VQP A;  1EZ8 A;  2RDH A;  4A4I A;  2WKC A;  4JI4 L;  1VCI A;  2A68 C;  3Q22 A;  1OTC A;  4LF5 Q;  1HNW L;  4JYA L;  4OIK A;  1BCP C;  1EWI A;  3EBE A;  3GTG B;  4XYO A;  3T53 B;  1HR0 L;  2HD3 A;  3HOZ H;  2XN9 C;  4CBV A;  4JV5 L;  2F0N A;  4GKJ L;  2VUM B;  1F77 A;  2JA7 H;  3KUP A;  2H1E A;  3ZJY C;  4LF9 L;  2E2I B;  2TMP A;  2QIL A;  4PZ7 A;  3A54 A;  4LFB Q;  4P74 A;  1KQS A;  1L1O A;  1IW7 D;  2TSS A;  4DR4 L;  3D3R A;  4DFA A;  2XRQ D;  5F2D A;  1T5X D;  5M5Y H;  3IL8 A;  3AQQ A;  4GNX C;  2B2W C;  3GDE A;  1Y1W B;  3D6C A;  5IT9 L;  3I4M H;  1K8O A;  1STA A;  4X66 Q;  1TWC B;  3ULP A;  3R2I A;  2A19 A;  5IOD A;  2MHV A;  5COY A;  1FL0 A;  5I6W A;  2A6H C;  1X6O A;  2A1A A;  3SE0 A;  4OWW B;  3M9B A;  1ZYR C;  4A3D H;  2EJF C;  3S9W A;  4A3I B;  2R93 G;  4QGU A;  1V43 A;  3C2P A;  3OOC A;  3T1Y Q;  1CA6 A;  2ZJQ A;  3X3N A;  4DK1 A;  4B3M L;  4GOP A;  3I4N H;  1UEB A;  1JOQ A;  3KF6 A;  3DEO A;  3EQL C;  5EKL A;  1RL2 A;  4QJF A;  2VS1 A;  1TVX A;  3MEF A;  4CJ2 C;  1RHP A;  4N8F A;  3F1Z A;  2JN4 A;  1QJO A;  5EKI A;  5FO9 B;  4DV7 Q;  2B2T A;  2RHS B;  2XWJ B;  2Y0S G;  4DAV A;  1B1Z A;  2L0C A;  1WOC A;  1JOK A;  4WJW A;  4OX9 Q;  2B8G A;  1CKM A;  2CKZ B;  1EIG A;  4E6I A;  4F7X A;  1WTP A;  4P2C B;  1UE5 A;  2I07 B;  4FNF A;  3GQB A;  1CM9 A;  3IFT A;  1SJE D;  1CZG A;  5COR A;  1S5C D;  1YZ6 A;  4A3M B;  1A62 A;  1C0A A;  4RA8 A;  2JA8 H;  3D31 A;  1XJV A;  3MXN A;  1PYB A;  4JPB W;  5C4X B;  2PNR C;  4KKU A;  3GTP B;  4NW2 A;  2NZH A;  1PTO B;  1HTL D;  3TN2 A;  4RGO S;  3D4W A;  3HP3 A;  2F0W A;  3WWV A;  4PQX A;  1A3T A;  3U9S A;  2JE6 I;  1FJG Q;  3M3Y H;  2KCN A;  3M4O H;  3HOZ G;  1N9W A;  2R92 B;  3T51 B;  1OXU A;  5ELO A;  2PW5 A;  4EQP A;  4DK6 C;  1VS0 A;  1T5E A;  5D3I B;  2N8N A;  4R9W A;  3A8J E;  2EYJ A;  5T1I A;  1OXS C;  4C3I G;  1OXX K;  3KLW A;  2JA7 G;  2KVM A;  1SNM A;  4JI7 L;  1Q1B A;  1SNQ A;  1V8Q A;  1WCM B;  3OIP A;  3L0O A;  4G7H C;  1VQI A;  2Z6B A;  1JOO A;  2KA7 A;  4R8N A;  5JVG 3;  1E2W A;  2WAQ G;  1KRS A;  1K3B C;  1VF5 C;  4DR7 Q;  1MSG A;  2PZU A;  4MN3 A;  4P72 A;  3HOU B;  5JOB A;  4QIW E;  2SDF A;  1FR3 A;  3G6E A;  4QQB X;  4CJ0 B;  2RCN A;  4UP8 A;  2EZV A;  3SDZ A;  4H7B A;  1DD2 A;  5KEE A;  4A3D G;  1ENC A;  2PI2 A;  2A6E C;  2EYO A;  4LNQ A;  3S1R B;  4A3E H;  5FO7 B;  2K03 A;  2WV6 D;  5EGT A;  3I4N G;  1KNA A;  1HFG A;  1SNP A;  4BBS B;  2ZM6 L;  4OL7 A;  3S24 A;  3JAM E;  4L6T B;  5EPL A;  2NTT A;  1X32 A;  2IWH A;  5C3E B;  1VQ5 A;  1DON A;  2D2C C;  1VDZ A;  2F0H A;  5JAV A;  4XTC S;  5IP7 H;  1CHQ D;  5J39 A;  2FHT A;  1QZH A;  3QJY A;  2BA1 A;  2KEN A;  2PMZ E;  1PVO A;  3CCS A;  1ILP A;  3I4L A;  1I50 H;  4FVM A;  4ZQ3 A;  2JSO A;  1MI2 A;  1F2M A;  4L5T A;  4S3S A;  4QMG A;  1UE7 A;  3HKS A;  4PG3 A;  4R4O A;  3TDQ A;  2WII B;  4I7A A;  2E2H B;  1KDC A;  1EEI D;  1Y1V B;  3Q8D A;  4JVZ A;  4LUO A;  4IAL A;  3FDT A;  3RZO B;  2UXB Q;  3M7G A;  5BN3 A;  5EJW A;  2JA8 G;  3BG3 A;  1I5F A;  3OWE B;  3BU2 A;  1SR3 A;  4PNY A;  4B3T Q;  4WFN 3;  1U0L A;  1PH3 A;  2K7V A;  1JMC A;  3KOJ A;  4DV0 L;  1FD7 D;  2GN5 A;  2ZXO A;  1KLG D;  1RKN A;  2JA9 A;  3MWY W;  4B9W A;  1WTW A;  4DUY Q;  2E76 C;  4GKK Q;  3KDF B;  2M2L A;  2BE5 D;  3MXG A;  1SYG A;  4ID6 A;  1PFM A;  4WOR A;  2UU9 Q;  3VR2 A;  1C48 A;  5ELC A;  1N32 Q;  3A74 A;  3C1F A;  1U4M A;  1EQT A;  3I70 A;  3SGI A;  3KLS A;  3FVQ A;  2F03 A;  4DV5 L;  2YYZ A;  1PA6 A;  2JA6 H;  3BYT B;  4OON A;  3E3X A;  1GVP A;  2PI2 E;  4DNR B;  3K6O A;  2B2Y A;  4CJ1 B;  3CRL C;  2EQS A;  1CZW A;  1B8A A;  2JA5 B;  1EWC A;  5CR3 A;  3NEL A;  4EGV A;  2B3G A;  3NEN A;  1B70 B;  1K8M A;  4JBK A;  3S16 H;  4K2K A;  4HJA A;  4A3E G;  1NUC A;  4IUR A;  2IX1 A;  1STH A;  2C35 B;  3CU7 A;  3D4D A;  3F2U A;  2K5N A;  1EIH A;  4C3J G;  3NHH A;  2E2J H;  1E3P A;  5IGC A;  1N36 L;  5DAU A;  1O7Z A;  2O2L D;  3OHX C;  3RLF A;  3H3V C;  1V9P A;  1VQF A;  4JOI C;  1HNZ Q;  3T1Y L;  2JYO A;  2F0F A;  1AP0 A;  3JC6 6;  2Z6K C;  3F2C A;  3RLN A;  5IWA L;  2K14 A;  1EUJ A;  1STY A;  4BBR H;  3J81 i;  3BYY B;  4LMQ D;  3GTO H;  4H0L C;  3SXH A;  2Y0S E;  3S1N H;  4WJ4 A;  1TWG H;  3K7A B;  1SXT A;  1SMY D;  2ASB A;  1LT6 D;  1B3Q A;  3CC4 A;  2EYL A;  4YCV A;  1L2F A;  1PZI D;  2OTJ A;  3CP0 A;  1HNX Q;  1IYJ B;  3NTK A;  1XMQ Q;  1EY5 A;  3J7A 5;  2O5J C;  3RN2 A;  1I6H B;  2QKI C;  1B50 A;  1XMO L;  2K4K A;  1HJP A;  3CCV A;  4Y52 H;  5C0X J;  1LT5 D;  3VR5 A;  3S2H H;  5GAD C;  3FMC A;  4AH6 A;  1PV4 A;  4A3L H;  2IL8 A;  5ELD A;  1HNW Q;  1EL0 A;  4JYA Q;  3VA7 A;  3LNN A;  3W1G A;  2RVL A;  2L15 A;  4CDD C;  4JV5 Q;  2A69 D;  3ULL A;  3KF8 A;  3CCQ A;  5DLQ E;  2WKD A;  4KD3 A;  4JI5 Q;  4DR3 Q;  3S1M H;  3F2B A;  1WTH A;  4RCO A;  5GQO A;  4LF9 Q;  4P73 A;  4A3J H;  5K5P A;  2F3W A;  2ENB A;  4DR4 Q;  1F2Z A;  4IN3 A;  1FJG L;  1IBM Q;  4L5R C;  3FPP A;  1HH2 P;  2I5H A;  2B2V C;  5DM6 3;  5FLX L;  3AYH B;  1TR5 A;  1V1P B;  3DMU A;  2B63 G;  3J80 E;  2G5D A;  4OXP A;  4JBW A;  3CCE A;  3FKI G;  4GN4 B;  4DXG A;  2LS0 1;  4JK1 C;  1PYW D;  3EFX D;  2WAQ E;  4IUN A;  2C5C A;  1NY4 A;  4M8A A;  4DN4 M;  1NJI C;  1PLF A;  3K0X A;  2CH4 W;  3KJP A;  4KKS A;  2B39 A;  2FFK B;  3KFU A;  3K7U C;  1I4X A;  1MKH A;  1PTO F;  2HIV A;  5FLM H;  3PO2 B;  1NNX A;  2IT1 A;  5CV4 A;  4DR7 L;  3K57 A;  2ZXR A;  4GN5 A;  1QIL A;  1GUN A;  1N33 Q;  5J22 A;  1WTR A;  3T13 A;  1BKB A;  5KIX A;  2EXD A;  4QF4 A;  1TWF B;  2EYH A;  4JI0 L;  1FVI A;  2SNS A;  2NVY H;  1I94 Q;  4X3T A;  4A3K B;  1YHA A;  2F0I A;  3PCO B;  3SR1 A;  3S15 H;  4KHP L;  2K6A A;  2XIW A;  3S14 B;  1G8Z D;  1HCZ A;  2MGS A;  4LF4 L;  2IW3 A;  5BN4 A;  2YTV A;  4POG A;  1L1O B;  3X3M A;  1MJE A;  3GTM B;  3VR3 A;  2HUG A;  3STB C;  1YJ9 A;  3H0G B;  4X64 Q;  1VQK A;  5JPN C;  2F4I A;  1W3S A;  1J9O A;  1QG7 A;  1PTO C;  1O80 A;  4DK0 A;  3GTJ B;  4RAU C;  4R4T A;  4A3L G;  4XXE A;  1QUQ A;  2E75 C;  5DEH A;  2NUC A;  3LWU A;  4KI0 A;  1Q86 C;  2DJG C;  4GOP B;  1SE3 A;  2RDF A;  3KF6 B;  4DR2 L;  1VQG A;  4CDF C;  3PO3 B;  1DXM A;  2KCT A;  3H91 A;  1D5M C;  1DZ1 A;  4QUC A;  2NVX B;  4A76 A;  1P16 A;  1S5E D;  3HKZ G;  3GTK B;  4TSS A;  3NPP A;  1G2S A;  4DUY L;  4GKK L;  4KHV A;  2I0Q A;  4EQN A;  5JJI A;  1WD0 A;  1CHP D;  3CPF A;  1B9N A;  1SYC A;  4J6H A;  4GNX A;  1S40 A;  2B2W A;  4FO2 A;  3Q24 A;  1MD2 D;  1N32 L;  2HCC A;  3NSW A;  2ID0 A;  2NVQ B;  4LFA Q;  1S5B D;  2UUB L;  2NVT H;  1ESR A;  5EPJ A;  4Y7N B;  1BQQ T;  1J5E L;  3HFZ B;  3NQT A;  1R4P B;  1C8C A;  5FLM G;  3MXN B;  4U68 A;  2OQ0 A;  2Z8L A;  1TWH B;  5LMN Q;  3VA5 A;  2AMC B;  2R61 A;  3J81 L;  1AN8 A;  1JC7 A;  1EY0 A;  2MUY A;  1GUT A;  5HGQ A;  2OWO A;  4LF7 Q;  3L7Z C;  3HOY H;  1VMC A;  2NZ1 D;  2LFN A;  2K5Q A;  2NBF A;  2B8F A;  3UDG A;  4DV2 Q;  3MVV A;  4APV A;  2R93 H;  1O7I A;  1TKW B;  1IL8 A;  2QCP X;  1C7Y A;  2I5M X;  4ZAI A;  3URY A;  3NWS A;  3J80 c;  2DGY A;  5CV5 A;  1Z47 A;  1IHZ A;  3W5O A;  1HQR D;  4QL5 A;  3DWA A;  1VQ9 A;  1K73 C;  3I8Z A;  4JC0 A;  2NN6 I;  2BH8 A;  3MFY A;  2IJ0 A;  3BJU A;  4HJ8 A;  3HOV B;  3T1H Q;  5C44 B;  3IFD A;  1TXY A;  1WVL A;  1HNZ L;  4KTA A;  1EQR A;  4OO1 G;  4C1N I;  2AUK A;  3PIO A;  4R1J A;  2GVA A;  4TQU S;  1PH1 A;  1Q8K A;  1KL9 A;  1X9N A;  4MTK A;  2JK8 A;  3PIP 3;  1O7L A;  1UEA B;  1HNX L;  3TSS A;  1XMQ L;  2MPM A;  3ND9 A;  3KLS X;  3EA6 A;  4A3C H;  4GN3 B;  3GP7 A;  1ZXT A;  4BY7 H;  1XNQ Q;  4LFC Q;  3HOW G;  1C4Q A;  2E2D C;  4IPC A;  3SVM A;  4YCW A;  2HQL A;  4A3I H;  1KNE A;  1I4Q A;  1PH7 A;  5JJL A;  4DV5 Q;  4HN7 A;  1Q7Y C;  4A93 G;  4J1M A;  2SOB A;  1WFQ A;  5C0X I;  4QB4 A;  4EX5 A;  1ILQ A;  2RHQ B;  4BA1 I;  3K58 A;  1X3F A;  1QZG A;  3S17 H;  3CAM A;  1ENF A;  1N34 L;  4DAM A;  2KHJ A;  1EY7 A;  2K28 A;  2ZTC A;  4RFB A;  2F0Q A;  1QB5 D;  5FOB B;  1CT1 D;  1Q46 A;  2IX0 A;  3RR5 A;  4CDE C;  4C3I H;  2KCC A;  4CKE A;  5IYD H;  1YNN D;  4JI5 L;  4DR3 L;  1EEF D;  4FDB A;  1HHV A;  4J8Q A;  1U4L A;  2B2U C;  1F2Y A;  1LTI D;  4N9P A;  5IIF A;  1KC8 C;  4OO1 I;  2EY2 A;  4ULL A;  4R4I A;  1IBM L;  3K5O A;  4C2M B;  1SJH D;  2G9H D;  2Y0S B;  2QDL A;  4IUV A;  4DR1 Q;  4A3F H;  3RMH A;  4DXF A;  1VQH A;  1PRT D;  3HOY G;  5J3B A;  1SYE A;  2J0T D;  3AU7 A;  3BVM A;  4XT3 B;  4RGT A;  1N36 Q;  1G29 1;  1VQL A;  3GTQ B;  2J4X A;  2JQO A;  3S1Q H;  1K8A C;  1XTD A;  3CF5 A;  1DM0 B;  1SE4 A;  3CCR A;  4MNO A;  4V19 0;  3NXW A;  2K5D A;  3CCU A;  1LTG D;  5C4X H;  2QEX A;  3HOX H;  2FXQ A;  2R7Z B;  1AE3 A;  5IWA Q;  1GUG A;  4K8I A;  4NP5 A;  5KYL A;  2VXW A;  3A56 A;  4DAY A;  4YHH Q;  5A2Q E;  4ZK9 B;  1BNZ A;  1H9J A;  1I3Q H;  5DNF A;  1Y14 B;  1LUZ A;  1N33 L;  1QVF A;  1GO3 E;  1Z9F A;  3CW2 C;  2R92 H;  1G6Z A;  1I94 L;  5IGG A;  3NP8 A;  4HTH A;  1XMO Q;  1KIX A;  4HSP A;  2LSS A;  1I4R A;  2VUM G;  3DWP A;  4ZUJ A;  3CD6 A;  5IT9 c;  4UY8 C;  2F0T A;  2KOL A;  5KNB A;  3H3V I;  1X65 A;  1IBK L;  4K6D A;  3HOZ B;  3SK5 A;  1K83 H;  3EJI A;  2CFM A;  1RIP A;  2ES2 A;  1PH9 A;  2CQO A;  1DGS A;  1Y1W G;  2JA7 B;  2LMC B;  3OSO A;  3PUZ A;  3BS1 A;  3DXJ C;  3JAM i;  4A3C G;  4I65 A;  4BY7 G;  1LLR D;  4K6L A;  1VF7 A;  3QIA A;  4X64 L;  1RJT A;  2NTS A;  4EQ5 A;  1TY2 A;  1J6Q A;  1UE6 A;  1B4O A;  4A3I G;  5M5Y B;  4DV1 Q;  3I4M B;  1JE4 A;  3C1E A;  3KYH C;  1Y8P B;  3GTL H;  4AYB G;  5K36 G;  3NTI A;  4F87 A;  3K5N A;  4A3D B;  1NSN S;  1HZ9 A;  2F0D A;  1LT3 D;  2BOS A;  1CI3 M;  3FRP B;  3HKZ E;  4DAP A;  2PW7 A;  1EIY B;  4DR5 L;  1KXL A;  1F9Q A;  2KJX A;  5IYD G;  3I4N B;  4NXM L;  1KAW A;  4K5X A;  1W6K A;  2KQ3 A;  3AB9 A;  4IUU A;  3NBH A;  1M4V A;  4O0A A;  4OWX B;  1VQ6 A;  4HMI A;  2DNE A;  3BZC A;  4A3F G;  2H4O A;  5CV6 A;  4RHR A;  1U4R A;  5L37 A;  3OWF A;  3SEB A;  1SYD A;  1Y1V H;  3J7Y W;  2YU9 H;  5HGT A;  3RZO H;  4LFA L;  2F0L A;  4JI0 Q;  1PZJ D;  3ULJ A;  3DLL A;  5C4X G;  4JOI A;  4ABN A;  2F52 A;  3HOX G;  3E0E A;  1EU3 A;  4KHP Q;  3TRE A;  3NUC A;  3CXC A;  5JJK A;  1KAB A;  1YNJ C;  2Z6K A;  4JG2 A;  5LMN L;  4FP5 D;  3G6J B;  1EYG A;  2OQK A;  2EJG C;  1KRT A;  4C3J H;  4LF4 Q;  3F2D A;  1LTB D;  4LF7 L;  4KHZ A;  1HRJ A;  4ME5 A;  5DM7 3;  3J7A V;  4B3R Q;  3BDL A;  1VQJ A;  2R92 G;  1L1O C;  2CQA A;  3OYY A;  2Q2U A;  4DV2 L;  3G71 A;  1AH9 A;  5D3D A;  5C4H A;  1CQV A;  3MAQ A;  2D0O A;  3W2D A;  4POF A;  1B7Y B;  1DJR D;  3M3Y B;  2Q8T A;  3M4O B;  2HCI A;  1K9M C;  1E7Z A;  3DHQ A;  1ZEQ X;  4DK3 C;  2A68 D;  1I4P A;  1CKN A;  1GUO A;  1BCP D;  3T1H L;  3DUZ A;  3LGJ A;  4LJZ C;  2I46 A;  1Y69 U;  4GOP C;  1S3O A;  4DR2 Q;  4FF3 A;  1UE1 A;  4IOC A;  4C3H H;  1STE A;  1BVS A;  2ZTD A;  1S5F D;  1HXY D;  2K5W A;  5IYC G;  1BBU A;  3I2Z A;  4X62 L;  2DNC A;  3CPW A;  5CYU A;  2B2T C;  2E8G A;  4BBS G;  5M3F H;  2AQ1 B;  5IOC A;  5M5X H;  1BBX C;  4JCV E;  3HEJ A;  5C3E G;  2F0P A;  1PFS A;  3IKJ A;  1TS3 A;  2B2V A;  1VQE A;  2HDL A;  1XNQ L;  4LFC L;  3FPU B;  1H95 A;  1SRU A;  2A6H D;  2F0M A;  4HMJ A;  4B3S L;  2EDG A;  4HSV A;  2X6G A;  4QY7 A;  2UUB Q;  1ZYR D;  4RKL A;  4IFD I;  4R4Q A;  3TME A;  2SNM A;  2IPK D;  1J5E Q;  2FMM A;  3MZ5 A;  4A75 A;  2F0K A;  4KY6 A;  2EY5 A;  3A8K E;  1PXU A;  4O42 A;  2N88 A;  1CK1 A;  4JI8 Q;  5KNC A;  5FKA C;  2B63 H;  1YHB A;  1YVC A;  3RN5 A;  3VYS A;  2KEC A;  3EIV A;  1MBY A;  1I50 B;  5EPK A;  1Y1V G;  5H1S E;  3E9H A;  3FKI H;  5JEA J;  3K59 A;  1BXT A;  2A5H A;  1NR4 A;  3PGZ A;  4HAE A;  4LW1 A;  1JE5 A;  4FF4 A;  3R93 A;  2F0E A;  3M4P A;  3A7A B;  3I7F A;  1WTV A;  4DNT B;  3VDY A;  4IUT A;  4DR1 L;  2BH2 A;  1GKH A;  1JQY D;  1MGS A;  1JB7 A;  3GD7 A;  3D0F A;  4A3B H;  1YBY A;  4PZ8 A;  3D8G A;  1D1I A;  5KYI A;  3JAM L;  3M4Q A;  4DKA C;  1FYC A;  2IX3 A;  4GNX B;  2PQA A;  5IP9 H;  2D62 A;  1A15 A;  2L55 A;  3K0Y A;  2RSO A;  4YHH L;  2NWG A;  1D5X C;  3CMA A;  4AIM A;  1SE8 A;  1IBL Q;  2D0P A;  5I9P A;  1VQB A;  2AHO B;  1U4P A;  4KJN A;  2LXJ A;  4OWT B;  5JJZ A;  3LX0 A;  2JA6 B;  4ZLT F;  4QCL A;  4C3H G;  2GA4 B;  1UUP A;  2J7Z A;  3TP6 A;  2ZTE A;  4JW0 A;  2ALY B;  1Q1E A;  2HQE A;  4HED A;  3MEH A;  1XNR Q;  1SYF A;  1K28 A;  2EXZ A;  3KBG A;  4BXX H;  3T4A C;  5M3F G;  3TBI B;  3CQZ H;  1QVC A;  1N34 Q;  1RF2 D;  4ZCK A;  1X54 A;  1XPU A;  3S16 B;  4YIJ A;  4FXK C;  2MO0 A;  3R8B A;  4YCU A;  1LTT D;  3K5M A;  3NBI A;  2CW0 C;  2RBM A;  4AYB E;  1K8G A;  4DV1 L;  3KLR A;  5C3W A;  2E2J B;  3GV3 A;  2A6E D;  2NN6 H;  1SE2 A;  2Q2T A;  1ENA A;  4UAI A;  2K05 A;  2Q2H A;  2PCF B;  1PFB A;  4MHE A;  5I6Y A;  1HA5 A;  1PH2 A;  4XIG S;  2EYP A;  1G91 A;  1X3P A;  1QOH A;  1GUS A;  1YI2 A;  3HRZ C;  4UDU C;  2Z4I A;  3I56 A;  2AUJ D;  3SK8 A;  4BY1 H;  4IOA A;  4KJO A;  4RG1 A;  4G7O C;  1L0Y B;  4BBR B;  3WOF A;  2RQX A;  1HR0 W;  3K80 C;  2IHE A;  3EVQ A;  3GTO B;  2EY1 A;  4HIM A;  4G57 A;  1Q81 C;  1TWG B;  4XDX A;  1SYB A;  1NCV A;  4OGQ C;  4RHS A;  5AJ3 L;  4CDC C;  5I9O A;  2Z1C A;  2PZW A;  1B9M A;  4JBJ A;  1F9P A;  2N78 A;  1JR0 D;  3SK6 A;  1FNW A;  3J81 E;  3TP5 A;  4PV1 C;  2UXD Q;  2A74 C;  3FP9 A;  4A3B G;  1R9T H;  3L2P A;  3A7L A;  1EZ6 A;  2KHS A;  3D6W A;  5C0X H;  4ZYS A;  5IP9 G;  5E3F A;  1S5D D;  5FLX c;  1W6J A;  1YEZ A;  2Q8R E;  1IBK Q;  3MTS A;  2HDM A;  1KTK A;  3BVG A;  4NMZ A;  1E1T A;  3F8T A;  3C46 A;  4B3R L;  2KED A;  1OXT A;  4UPA A;  2IHF A;  3HKZ B;  2KUM A;  4A3J B;  1IW7 C;  2RKS A;  4OO1 H;  1D5Z C;  1EY4 A;  3FEW X;  4HJ7 A;  2R3Z A;  3M85 A;  3EN2 A;  1JWS D;  2PZT A;  2VB2 X;  3O13 A;  1XX8 A;  4CKC A;  4BXX G;  1Q8I A;  2FJ2 A;  4HIO A;  2CHB D;  4IPD A;  2F4V L;  3PO2 G;  3NE5 B;  2MNA A;  1TWH H;  5EKK A;  4CHT B;  1CTM A;  4JI1 L;  1F9R A;  1SBB B;  2EVB A;  4IZ8 A;  4QIW B;  3G7L A;  5JEA G;  4DR5 Q;  1G6P A;  3OMC A;  1Z7T A;  4DAY B;  5IGE A;  2MQH A;  3HOW H;  1JOR A;  4IJL A;  3I73 A;  4NXM Q;  3W3A A;  3A0J A;  1F2L A;  1QCB D;  2NN6 G;  1GJX A;  4WJ3 M;  3ICE A;  3J7A F;  1LV9 A;  2WB1 G;  2EJM A;  1VQO A;  4A3G B;  1SFO H;  4A93 H;  5E4W C;  1RCV D;  2B2U A;  1SMX A;  2OEO A;  5C5M A;  4C56 C;  5M3M H;  2E74 C;  4O2D A;  1NMG A;  2K33 A;  3E6Z X;  1R4Q B;  1YJW A;  2PYK A;  2QEJ C;  4BY1 G;  4FXD A;  2WP8 J;  4YWL A;  3S15 B;  5FK9 C;  3H3V H;  5LHY 1;  5C4J H;  3H0G G;  4Z9C B;  1SNO A;  4IPH A;  1G2T A;  1EYD A;  4DV6 Q;  2VQF Q;  2PMZ B;  2AWN A;  3BZK A;  2VQE L;  1EIF A;  3QOJ A;  1JIC A;  5GRO A;  3UDX A;  3J80 L;  5C5L A;  3K81 C;  4R4C A;  2OF1 A;  4JI8 L;  2P5Z X;  1Q82 C;  2F0J A;  4FYD A;  2RCF A;  5IT9 E;  1I4G A;  4IPG A;  2Q2I A;  3A5Z B;  1A0I A;  3HS0 C;  3TQY A;  3U4V A;  4WRD A;  1FGU A;  3PO3 G;  1TU2 B;  1BF4 A;  5C0X G;  2K5V A;  2H5X A;  1B2T A;  3CC2 A;  3R2T A;  1J8I A;  1YHQ A;  5M5W H;  1CUK A;  3OPO A;  4DV4 Q;  3SK4 A;  3MHB A;  4UHV A;  2D5D A;  1JB3 A;  5TSS A;  2G9D A;  1LTA D;  5T1G A;  1NBW A;  2ICE C;  4XQJ A;  3H15 A;  1CKO A;  3HGB A;  2KHI A;  1H9S A;  3OW7 A;  4DGZ A;  4JI2 L;  2ZT9 C;  5CV8 A;  4QUF A;  3GTG H;  2QW7 A;  2R7D A;  3NBH B;  3RD4 A;  1IKL A;  2A73 B;  4ZKB B;  1A2T A;  1TS2 A;  2VUM H;  4ZKC B;  4BS9 A;  1SND A;  5EAY A;  2PNH A;  4X62 Q;  1Q3L A;  1AEX A;  3J81 c;  2AWO A;  3HZX A;  2E2I H;  2JEB I;  1YJN A;  3MA2 B;  4I7Z C;  1BCP F;  2YTX A;  4OHJ A;  5ELE A;  3I72 A;  1E0B A;  1K3R A;  4UP9 A;  1PH6 A;  1IBL L;  4RWS C;  1WTO A;  1Y1W H;  2NVT B;  4NXN Q;  3S2D B;  1H9R A;  3CME A;  3CCM A;  2F3I A;  4DPG A;  1TWC H;  1A8V A;  2M9V A;  4K8J A;  4IFD J;  1Y8N B;  1X3Q A;  3BZD B;  2AQ2 B;  1II3 A;  3CCJ A;  1PYS B;  3CC7 A;  3V2T A;  1KD1 C;  1ASY A;  4B3S Q;  1A3U A;  3PUW A;  1H9K A;  2F0G A;  3VR4 A;  1SNC A;  1XNR L;  3A8I E;  4GS3 A;  4NPS A;  1PH4 A;  4ME3 A;  1E24 A;  4LUV A;  3HOY B;  3PSI A;  4XQN A;  3PV0 A;  5K36 H;  5M3M G;  2Z0S A;  3G48 A;  3PF5 A;  3QOL A;  1WTX A;  2R93 B;  3VYT A;  1JCK B;  2JJQ A;  2VNU D;  3HOV G;  2L1B A;  4HID A;  1EQV A;  3UE0 A;  1EOV A;  5D65 A;  3AMU A;  1TWA B;  1CKN B;  1IYV A;  3QWN A;  4R8I A;  4K14 A;  2LKV A;  5NUC A;  3ND8 A;  4GLV B;  3BDC A;  1V1Q A;  1LO5 D;  4K5W A;  5IY0 A;  2PO4 A;  3QB3 A;  2NB0 A;  3RNU A;  1TY0 A;  5GAH C;  2XSC A;  2LXK A;  5G3L D;  5IYB H;  1PZK D;  1B3A A;  2K52 A;  2JP1 A;  3WDN A;  3TEH B;  4A3M H;  1UAP A;  5CV7 A;  3STB D;  2I5L X;  1Y8O B;  1LAC A;  1STN A;  4KKT A;  1XPR A;  2BE5 C;  1E2V A;  3TP8 A;  3GTP H;  2OXP A;  1AZP A;  4RKB A;  1PTO H;  3OMG A;  3U58 A;  3V96 A;  4LK1 C;  3FHW A;  3ONA B;  1PTO D;  4BY7 B;  4H13 C;  2QGQ A;  3AEV A;  3RZD B;  3K8A A;  2QDB A;  2F0S A;  3K5L A;  1QE6 A;  4IFD H;  4JI6 L;  2UXD L;  4Q0F A;  4L5S A;  5D14 A;  4K0K Q;  3G4S A;  4DUZ L;  4LWC A;  1DOL A;  3NK9 A;  2MP1 A;  3S17 B;  4AYB B;  1D7Q A;  4JBM A;  1VQ4 A;  5FJ8 H;  3Q0A A;  3DEP A;  3PIP A;  2KBN A;  4P71 A;  1WCM H;  1NMF A;  3OW2 A;  1XXG A;  4X65 L;  4LF8 Q;  4DA2 A;  1ESF A;  2K01 A;  5ELN A;  5FO8 B;  4C3I B;  4YY3 L;  1NR2 A;  2EE1 A;  4P75 A;  3HOU H;  3CKI B;  2O4X A;  4IUQ A;  5C3X A;  3L3O C;  4DNI A;  4LUZ A;  2OCE A;  5IYC H;  3M7N A;  1PRT B;  2WAQ B;  5BR8 L;  3S1R H;  1GOZ A;  4A3F B;  3VR6 A;  4G4K A;  2R7Z G;  4BBS H;  2WFW A;  2UUC Q;  3S1Q B;  2PQA B;  2CWA A;  2F1M A;  1VQ7 A;  1TS4 A;  5C3E H;  1L0X B;  1EFI D;  5E1F A;  3HOX B;  2WB1 E;  2M00 A;  1GXD C;  2MJ8 A;  2QF7 A;  3P7J A;  4HIK A;  4EVO A;  5IE8 A;  1LYL A;  1SMY C;  3M4Y A;  1I3Q B;  2YTY A;  1MJC A;  3TS2 A;  5AJ3 Q;  4H02 A;  1WI5 A;  3W1B A;  1EFW A;  5LMU Q;  4MTN A;  5IYB G;  2E2H H;  2BDO A;  4X6A H;  1D1K A;  3U50 C;  4A3M G;  2UXC L;  1SN8 A;  2PQE A;  4KMU C;  2RF4 A;  1U5K A;  2F3V A;  4DV6 L;  4IUP A;  1SSO A;  2VQF L;  1K83 B;  1DYQ A;  4EQO A;  1EOT A;  3GO5 A;  2RDG A;  3KF8 B;  4X3U A;  1ICW A;  3I4M G;  2L11 A;  1RTN A;  5KRU A;  4XQQ A;  3E0J A;  5I2Y A;  4IO9 A;  2BCO A;  1AW7 A;  2A69 C;  5I2X A;  2JA8 B;  1NAP A;  1JWU D;  2WAC A;  2ZJP A;  1IL2 A;  2EOT A;  2HHH L;  2VZA A;  1JJ2 A;  4IFD G;  2C9O A;  3CHB D;  3Q6S A;  5A35 A;  1DOK A;  2Q8I B;  1O78 A;  2CWP A;  3GTL B;  3KJO A;  4KV6 A;  5FJ8 G;  1PHJ A;  5A2Q L;  1LTS D;  1WCM G;  3VYU A;  4DV4 L;  3IAY A;  3DM3 A;  3N52 A;  4J15 A;  4F88 A;  1U9R A;  5CMD A;  2F4V Q;  3QO2 A;  2K75 A;  2DJF C;  1LTL A;  2L12 A;  4RH6 A;  4MIU A;  2JA5 H;  2BDN A;  4JI1 Q;  3PUX A;  3AFP A;  3HOU G;  3MC0 B;  1X3G A;  1EYC A;  2PPB C;  4UP7 A;  5HY6 A;  1SLJ A;  2OTL A;  1QNK A;  4HJ5 A;  1BBW A;  4OEM B;  1OXV A;  2N3S A;  5ISR A;  3ER0 A;  4TKO B;  4LF6 L;  3TRZ A;  4KD4 A;  1IYU A;  2XVS A;  4K5V A;  1LTR D;  3B6Y A;  3WOE A;  2E5L L;  4L63 B;  2YU9 B;  4NXN L;  3H09 A;  3V05 A;  1AFP A;  5M9O A;  2YV5 A;  5ELB A;  2AQ3 B;  1CA5 A;  4A3E B;  2D9U A;  3ERS X;  2EYM A;  4O1N A;  2N55 A;  2AKW B;  1VQ8 A;  4YWK A;  4C3J B;  4DV3 Q;  1HTP A;  1S4Z A;  2VQE Q;  4N9T A;  2UUA Q;  2X6L A;  5HUR A;  1PDQ A;  2HIX A;  2WIN B;  3ITP A;  3OTO Q;  3PMF A;  4ZRZ A;  1LM0 A;  1VQC A;  4KK7 A;  2ATW A;  3K7A H;  3NWT A;  5C4Z A;  3NTH A;  2HT1 A;  2Z9H A;  5FLX E;  3UDF A;  1GHJ A;  1HZC A;  1QUQ B;  4JI3 L;  1ASZ A;  1I6H H;  4LF5 L;  1HZB A;  4TVA B;  1BCP B;  1SEB D;  2B29 A;  3PF4 A;  1NTG A;  3RUZ A;  2JXM B;  2IY5 B;  4L5Q A;  2RA4 A;  4C3H B;  3UDI A;  1HUM A;  4NDX A;  4JI2 Q;  1EQQ A;  3ZYY X;  4LFB L;  1JJC B;  1SDF A;  4H44 C;  4C1N K;  1N8R C;  5M3F B;  1NE3 A;  3J80 i;  5M5X B;  1YIT A;  3P20 A;  1IXR A;  5LL6 X;  1FNV A;  3ERO A;  4X66 L;  3U9O A;  1MSH A;  3MFG A;  3TP7 A;  1VMP A;  1BUV T;  5IP7 G;  4DR6 Q;  3GV6 A;  2JA5 G;  1VQD A;  3L9A X;  2XWB B;  1TT2 A;  5C6A A;  2LY7 A;  1EY9 A;  4AQY Q;  1G51 A;  4L8J A;  4TRD A;  4K0K L;  5E4X A;  4GLA C;  1VQA A;  1TS5 A;  5EQ0 A;  4ALP A;  1ZKO A;  3R3O A;  1D6E C;  3MXU A;  3UI2 A;  5J1Z A;  1KHI A;  1OO9 B;  3DM1 A;  4N8X 1;  5I4D A;  4LF8 L;  1KDB A;  2F0V A;  4PMB A;  2B63 B;  1QNU A;  1ML0 D;  2L4N A;  2BA0 A;  4DV7 L;  1HFN A;  3FKI B;  1WTQ A;  3PO2 H;  1BOS A;  3JAM c;  1K0R A;  1EY8 A;  1UNS A;  1B44 D;  5JEA H;  1QWY A;  1KLU D;  4OX9 L;  1ICF B;  3U4Z A;  5IGF A;  1M8A A;  1D2B A;  1H9S B;  1TWF H;  4HR7 B;  1A63 A;  1L0W A;  3OIQ A;  4JI4 Q;  1WJJ A;  4RCN A;  1AZQ A;  4A3K H;  1XYI A;  4KLK A;  2XNA C;  3S14 H;  2FIN B;  1HR0 Q;  2UUC L;  4KN7 C;  4KN4 C;  1YNJ D;  4LAA A;  4RGN A;  4A3B B;  1M90 C;  4V0B A;  4GKJ Q;  2F0O A;  3GTM H;  1GM5 A;  2MO1 A;  2JEA I;  3PUV A;  1Z6H A;  1P8L A;  1ROD A;  1H9M A;  4PMW A;  3N6R A;  2V1C C;  3CCL A;  1I6V C;  1AE2 A;  1UWV A;  1T9H A;  3H0G H;  2JA6 G;  1KAA A;  3S1N B;  2VL6 A;  3H94 A;  1XTC D;  4F8M A;  4X3K A;  5EBC A;  3C3L A;  1FNU A;  1HPC A;  5G3L F;  1LT4 D;  1PRT F;  2KCM A;  5CV9 A;  2EIF A;  3GTJ H;  5LMU L;  5CBA E;  1A3V A;  1WYD A;  1JT8 A;  3SHL A;  4IQZ A;  2NYZ D;  3P1H A;  3KK7 A;  4KY5 A;  4JI6 Q;  2B2Y C;  2FMC A;  3S2H B;  4MZ9 A;  1GUW A;  4M1U B;  3PO3 H;  4DUZ Q;  4B3M Q;  3QG1 A;  3IRB A;  3TS0 A;  4FXG C;  2NVX H;  3CQZ B;  1E1O A;  1ONL A;  3A55 A;  5JVH 3;  4GLX A;  5GAG C;  3H6M A;  1RDP D;  2R6G A;  3HG9 A;  4B08 A;  3GTK H;  1K0S A;  4X65 Q;  2CH4 A;  4A3G H;  1B53 A;  4PMC A;  1YNN C;  4RGM A;  1O7Y A;  4YY3 Q;  5IGB A;  4HJ9 A;  3S1M B;  4G7Z C;  4X3S A;  3KDF A;  4CGY B;  1STG A;  2OT2 A;  5GAE C;  2WB1 B;  4BBR G;  1Q12 A;  2NVQ H;  2K50 A;  2Z4H A;  5CBE E;  5BR8 Q;  2ZJR A;  2VW9 A;  1PRT C;  2F0U A;  2VB3 X;  4Y7N H;  2EY6 A;  2K32 A;  1A2U A;  4BY1 B;  4DF7 A;  3RLO A;  1E2Z A;  5AFW A;  2XTI A;  1EY6 A;  3T16 A;  1PMR A;  4GZY C;  1BO0 A;  3LWE A;  1PH5 A;  4OIJ A;  2SEB D;  4ODG A;  2O5I C;  1YIJ A;  3PIO 3;  2N49 A;  2K5H A;  4A3K G;  1HZA A;  4U67 3;  1EU4 A;  1CQF A;  1ET6 A;  3AFQ A;  5KND A;  2QA4 A;  3J7Z C;  1W2B A;  2UXB L;  1HQM C;  2NVY B;  1R9T B;  1C9O A;  5ELF A;  2CVR A;  4BWG B;  1MHW C;  3TZU A;  4B3T L;  4NKL A;  1VQN A;  1RD9 D;  5KGU A;  1M1K C;  3HOV H;  2UXC Q;  5LL6 S;  3BVZ A;  4JI7 Q;  2R7F A;  5C44 H;  1DCZ A;  4A3J G;  3CRK C;  3TZD A;  4FF2 A;  2NZO A;  4DV3 L;  1EYA A;  2MFI A;  2UUA L;  3D4R A;  3I3C A;  3OTO L;  3UE1 A;  1X55 A;  1X56 A;  2UU9 L;  1GHK A;  2X69 A;  1XPO A;  1ET9 A;  1FGB D;  4B9X A;  2HHH Q;  1PFN A;  4HCE A;  3E9I A;  1SRO A;  1V1O A;  3I55 A;  4NB3 A;  1IKM A;  2XGT A;  4RMF A;  3S2D H;  1E22 A;  4Q5V A;  2KEE A;  3DWQ A;  2A8V A;  1RTO A;  1WD1 A;  3QR8 A;  2ZM6 Q;  1D8L A;  3I91 A; 
#chains in the Genus database with same CATH homology
 5JPM C;  4K2L A;  2EPB A;  2DN8 A;  1CFM A;  1Q90 A;  1XWE A;  3HOW B;  3PUY A;  2RSN A;  1HUN A;  3P75 A;  3Q23 A;  1BR9 A;  4KY7 A;  1DOM A;  2DY8 A;  1EWH A;  5IGD A;  4CKB A;  3BDO A;  2K1B A;  1SFO B;  4A93 B;  3E5S A;  3I90 A;  2CW0 D;  1BDO A;  2L5T A;  5M3M B;  1TQO A;  2L9H A;  2EYF A;  5C4J B;  3VYR A;  3T56 B;  4XYQ A;  2DY7 A;  5EBD A;  1V1P A;  4ZUI A;  3MXP A;  1SAP A;  1JWM D;  1TII D;  1KDA A;  5CGK A;  3KBX A;  4ILW A;  2ZXP A;  2ICI A;  5CC4 A;  1LAB A;  3NQI A;  2K04 A;  4XT1 B;  5BN5 A;  1I4H A;  4FF1 A;  1HA6 A;  2V4D A;  3ERQ A;  1STB A;  5M5W B;  4HCS A;  4DU9 A;  1A6X A;  2XRS D;  4BA2 I;  1F9S A;  1EZ8 A;  2RDH A;  2WKC A;  1VCI A;  2A68 C;  3Q22 A;  4OIK A;  1BCP C;  3GTG B;  4XYO A;  3T53 B;  2XN9 C;  4CBV A;  2F0N A;  2VUM B;  1F77 A;  3KUP A;  2H1E A;  2E2I B;  2TMP A;  2QIL A;  3A54 A;  1IW7 D;  2TSS A;  3D3R A;  4DFA A;  2XRQ D;  5F2D A;  1T5X D;  3IL8 A;  2B2W C;  1Y1W B;  3D6C A;  5IT9 L;  1K8O A;  1STA A;  1TWC B;  3R2I A;  5IOD A;  2MHV A;  5COY A;  5I6W A;  2A6H C;  3SE0 A;  1ZYR C;  2EJF C;  3S9W A;  4A3I B;  1V43 A;  3C2P A;  3OOC A;  1CA6 A;  3X3N A;  4DK1 A;  1JOQ A;  3DEO A;  3EQL C;  5EKL A;  1TVX A;  4CJ2 C;  1RHP A;  5EKI A;  1QJO A;  5FO9 B;  2B2T A;  2XWJ B;  4DAV A;  1B1Z A;  2L0C A;  1JOK A;  4WJW A;  2B8G A;  4E6I A;  1EIG A;  4F7X A;  1WTP A;  4P2C B;  2I07 B;  4FNF A;  3GQB A;  1CM9 A;  3IFT A;  1SJE D;  1CZG A;  5COR A;  1S5C D;  4A3M B;  4RA8 A;  3D31 A;  3MXN A;  5C4X B;  2PNR C;  4KKU A;  3GTP B;  4NW2 A;  1PTO B;  1HTL D;  3TN2 A;  4RGO S;  3D4W A;  3HP3 A;  2F0W A;  4PQX A;  1A3T A;  3U9S A;  2JE6 I;  2KCN A;  2R92 B;  3T51 B;  1OXU A;  2PW5 A;  4EQP A;  1T5E A;  5D3I B;  4R9W A;  3A8J E;  2EYJ A;  5T1I A;  1OXS C;  4C3I G;  1OXX K;  2KVM A;  1SNM A;  1Q1B A;  1SNQ A;  1V8Q A;  1WCM B;  3OIP A;  4G7H C;  1JOO A;  2KA7 A;  4R8N A;  5JVG 3;  1E2W A;  1VF5 C;  1MSG A;  2PZU A;  4MN3 A;  3HOU B;  5JOB A;  2SDF A;  1FR3 A;  4CJ0 B;  2EZV A;  3SDZ A;  4H7B A;  1DD2 A;  5KEE A;  1ENC A;  2A6E C;  2EYO A;  3S1R B;  5FO7 B;  2K03 A;  2WV6 D;  5EGT A;  1KNA A;  1HFG A;  1SNP A;  4BBS B;  4OL7 A;  3JAM E;  4L6T B;  5EPL A;  2NTT A;  1X32 A;  2IWH A;  5C3E B;  1DON A;  2D2C C;  1VDZ A;  2F0H A;  5JAV A;  4XTC S;  1CHQ D;  5J39 A;  2FHT A;  3QJY A;  2BA1 A;  1ILP A;  3I4L A;  4FVM A;  4ZQ3 A;  2JSO A;  1MI2 A;  1F2M A;  4S3S A;  4QMG A;  3TDQ A;  2WII B;  2E2H B;  1KDC A;  1EEI D;  1Y1V B;  4IAL A;  3FDT A;  3RZO B;  3M7G A;  5BN3 A;  5EJW A;  3BG3 A;  3OWE B;  4PNY A;  4WFN 3;  2K7V A;  1FD7 D;  2ZXO A;  1KLG D;  1RKN A;  3MWY W;  1WTW A;  4B9W A;  2E76 C;  2M2L A;  2BE5 D;  3MXG A;  1SYG A;  4ID6 A;  1PFM A;  4WOR A;  3VR2 A;  1C48 A;  5ELC A;  3C1F A;  1U4M A;  1EQT A;  3I70 A;  3KLS A;  3FVQ A;  2F03 A;  2YYZ A;  3BYT B;  4DNR B;  4CJ1 B;  3K6O A;  2B2Y A;  3CRL C;  1CZW A;  2JA5 B;  1EWC A;  5CR3 A;  4EGV A;  1K8M A;  4K2K A;  1NUC A;  4IUR A;  2IX1 A;  1STH A;  3CU7 A;  3D4D A;  3F2U A;  1EIH A;  4C3J G;  3NHH A;  5IGC A;  5DAU A;  1O7Z A;  2O2L D;  3OHX C;  3RLF A;  3H3V C;  2JYO A;  2F0F A;  1AP0 A;  1STY A;  3BYY B;  4LMQ D;  4H0L C;  3SXH A;  3K7A B;  1SXT A;  1SMY D;  1LT6 D;  2EYL A;  1PZI D;  3NTK A;  1EY5 A;  2O5J C;  1I6H B;  2QKI C;  1B50 A;  5C0X J;  1LT5 D;  3VR5 A;  3FMC A;  2IL8 A;  5ELD A;  1EL0 A;  3VA7 A;  3LNN A;  2RVL A;  2A69 D;  3KF8 A;  2WKD A;  4KD3 A;  4RCO A;  5K5P A;  2F3W A;  2ENB A;  1F2Z A;  4IN3 A;  3FPP A;  2B2V C;  5DM6 3;  5FLX L;  1TR5 A;  1V1P B;  3DMU A;  3J80 E;  4JBW A;  4DXG A;  2LS0 1;  4JK1 C;  1PYW D;  3EFX D;  4IUN A;  2C5C A;  4DN4 M;  4M8A A;  1PLF A;  4KKS A;  2B39 A;  2FFK B;  1I4X A;  1PTO F;  3PO2 B;  2IT1 A;  5CV4 A;  3K57 A;  2ZXR A;  1QIL A;  1GUN A;  5J22 A;  1WTR A;  3T13 A;  5KIX A;  4QF4 A;  1TWF B;  2EYH A;  2SNS A;  4X3T A;  4A3K B;  2F0I A;  3SR1 A;  2K6A A;  2XIW A;  3S14 B;  1G8Z D;  1HCZ A;  2MGS A;  2IW3 A;  5BN4 A;  3GTM B;  3X3M A;  3VR3 A;  2HUG A;  3H0G B;  5JPN C;  2F4I A;  1J9O A;  1QG7 A;  1PTO C;  1O80 A;  4DK0 A;  3GTJ B;  4RAU C;  4XXE A;  2E75 C;  5DEH A;  2NUC A;  3LWU A;  4KI0 A;  1SE3 A;  2RDF A;  3PO3 B;  1DXM A;  3H91 A;  1D5M C;  1DZ1 A;  4QUC A;  2NVX B;  1S5E D;  3GTK B;  4TSS A;  3NPP A;  1G2S A;  4KHV A;  4EQN A;  1WD0 A;  1CHP D;  1B9N A;  1SYC A;  4J6H A;  2B2W A;  4FO2 A;  3Q24 A;  1MD2 D;  2HCC A;  3NSW A;  2ID0 A;  2NVQ B;  1S5B D;  1ESR A;  5EPJ A;  4Y7N B;  1BQQ T;  3NQT A;  1R4P B;  1C8C A;  4U68 A;  2Z8L A;  1TWH B;  3VA5 A;  3J81 L;  2R61 A;  1AN8 A;  1JC7 A;  1EY0 A;  2MUY A;  1GUT A;  3L7Z C;  1VMC A;  2NZ1 D;  2LFN A;  2K5Q A;  2NBF A;  2B8F A;  3MVV A;  1TKW B;  1IL8 A;  2QCP X;  4ZAI A;  3URY A;  3NWS A;  5CV5 A;  1Z47 A;  1IHZ A;  1HQR D;  3DWA A;  3I8Z A;  2NN6 I;  3MFY A;  2IJ0 A;  3HOV B;  5C44 B;  3IFD A;  1WVL A;  4KTA A;  4OO1 G;  4C1N I;  2AUK A;  4TQU S;  3PIP 3;  1O7L A;  1UEA B;  3TSS A;  2MPM A;  3ND9 A;  3KLS X;  3EA6 A;  3GP7 A;  1ZXT A;  1C4Q A;  2E2D C;  3SVM A;  1KNE A;  1I4Q A;  4HN7 A;  4J1M A;  2SOB A;  5C0X I;  4QB4 A;  1ILQ A;  4BA1 I;  3K58 A;  1ENF A;  1EY7 A;  2K28 A;  4RFB A;  2F0Q A;  1QB5 D;  5FOB B;  1CT1 D;  2IX0 A;  2KCC A;  4CKE A;  1YNN D;  1EEF D;  1HHV A;  4J8Q A;  1U4L A;  2B2U C;  1F2Y A;  1LTI D;  4N9P A;  5IIF A;  4OO1 I;  2EY2 A;  4ULL A;  3K5O A;  4C2M B;  1SJH D;  2G9H D;  2Y0S B;  4IUV A;  3RMH A;  4DXF A;  1PRT D;  1SYE A;  2J0T D;  4XT3 B;  3AU7 A;  3BVM A;  4RGT A;  1G29 1;  3GTQ B;  2J4X A;  1DM0 B;  1SE4 A;  4V19 0;  3NXW A;  2K5D A;  1LTG D;  2R7Z B;  1GUG A;  4K8I A;  4NP5 A;  5KYL A;  2VXW A;  3A56 A;  4DAY A;  5A2Q E;  4ZK9 B;  1BNZ A;  1H9J A;  5DNF A;  1G6Z A;  5IGG A;  3NP8 A;  4HTH A;  4HSP A;  1I4R A;  3DWP A;  4ZUJ A;  2F0T A;  2KOL A;  5KNB A;  4K6D A;  3HOZ B;  3SK5 A;  3EJI A;  2JA7 B;  2LMC B;  3OSO A;  3PUZ A;  3BS1 A;  3DXJ C;  4I65 A;  1LLR D;  4K6L A;  1VF7 A;  3QIA A;  1RJT A;  2NTS A;  1TY2 A;  1B4O A;  5M5Y B;  3I4M B;  1JE4 A;  3C1E A;  1Y8P B;  5K36 G;  3NTI A;  4F87 A;  3K5N A;  4A3D B;  1NSN S;  2F0D A;  1LT3 D;  2BOS A;  1CI3 M;  3FRP B;  4DAP A;  2PW7 A;  1F9Q A;  2KJX A;  3I4N B;  4K5X A;  1W6K A;  2KQ3 A;  3AB9 A;  4IUU A;  3NBH A;  1M4V A;  4HMI A;  2DNE A;  2H4O A;  5CV6 A;  4RHR A;  1U4R A;  3OWF A;  3SEB A;  1SYD A;  3J7Y W;  5HGT A;  2F0L A;  1PZJ D;  4ABN A;  1EU3 A;  3NUC A;  1KAB A;  1YNJ C;  4FP5 D;  3G6J B;  2EJG C;  1LTB D;  4KHZ A;  1HRJ A;  4ME5 A;  5DM7 3;  3J7A V;  3BDL A;  2CQA A;  5D3D A;  5C4H A;  1CQV A;  3MAQ A;  3W2D A;  1DJR D;  3M3Y B;  2Q8T A;  3M4O B;  2HCI A;  3DHQ A;  1ZEQ X;  2A68 D;  1I4P A;  1GUO A;  1BCP D;  3DUZ A;  4LJZ C;  1Y69 U;  2I46 A;  4FF3 A;  1STE A;  1S5F D;  1HXY D;  2K5W A;  2DNC A;  5CYU A;  2B2T C;  2AQ1 B;  5IOC A;  1BBX C;  3HEJ A;  2F0P A;  3IKJ A;  1TS3 A;  2B2V A;  2HDL A;  3FPU B;  2A6H D;  2F0M A;  4HMJ A;  2EDG A;  4HSV A;  2X6G A;  1ZYR D;  4RKL A;  4IFD I;  3TME A;  2SNM A;  2IPK D;  2FMM A;  3MZ5 A;  2F0K A;  4KY6 A;  2EY5 A;  3A8K E;  1PXU A;  4O42 A;  2N88 A;  1CK1 A;  5KNC A;  5FKA C;  3VYS A;  2KEC A;  5EPK A;  1MBY A;  1I50 B;  5JEA J;  3K59 A;  1BXT A;  2A5H A;  1NR4 A;  4HAE A;  4FF4 A;  3R93 A;  2F0E A;  3A7A B;  1WTV A;  4DNT B;  4IUT A;  1JQY D;  1MGS A;  3GD7 A;  3D8G A;  1D1I A;  5KYI A;  3JAM L;  1FYC A;  2IX3 A;  2D62 A;  1A15 A;  2L55 A;  3K0Y A;  2RSO A;  2NWG A;  1D5X C;  5I9P A;  1U4P A;  4KJN A;  5JJZ A;  3LX0 A;  2JA6 B;  4ZLT F;  4QCL A;  4C3H G;  2GA4 B;  1UUP A;  2J7Z A;  3TP6 A;  1Q1E A;  2HQE A;  4HED A;  3MEH A;  1SYF A;  2EXZ A;  3KBG A;  3T4A C;  3TBI B;  1RF2 D;  3S16 B;  4YIJ A;  4FXK C;  3R8B A;  1LTT D;  3K5M A;  3NBI A;  2CW0 C;  2RBM A;  3KLR A;  5C3W A;  2E2J B;  3GV3 A;  2A6E D;  2NN6 H;  1SE2 A;  1ENA A;  4UAI A;  2K05 A;  2PCF B;  1PFB A;  4MHE A;  5I6Y A;  1HA5 A;  4XIG S;  2EYP A;  1G91 A;  1X3P A;  1QOH A;  1GUS A;  3HRZ C;  4UDU C;  2Z4I A;  2AUJ D;  3SK8 A;  4KJO A;  4G7O C;  1L0Y B;  4BBR B;  3WOF A;  2RQX A;  3EVQ A;  3GTO B;  2EY1 A;  4G57 A;  1TWG B;  4XDX A;  1SYB A;  1NCV A;  4OGQ C;  4RHS A;  5I9O A;  2Z1C A;  2PZW A;  1B9M A;  1F9P A;  1JR0 D;  3SK6 A;  1FNW A;  3J81 E;  3TP5 A;  4PV1 C;  2A74 C;  3A7L A;  1EZ6 A;  2KHS A;  3D6W A;  5C0X H;  4ZYS A;  5E3F A;  1S5D D;  1W6J A;  2Q8R E;  3MTS A;  2HDM A;  1KTK A;  3BVG A;  4NMZ A;  3C46 A;  2KED A;  1OXT A;  3HKZ B;  2KUM A;  4A3J B;  1IW7 C;  2RKS A;  4OO1 H;  1D5Z C;  1EY4 A;  3FEW X;  2R3Z A;  3M85 A;  1JWS D;  2PZT A;  2VB2 X;  3O13 A;  1XX8 A;  4CKC A;  1Q8I A;  2FJ2 A;  2CHB D;  3NE5 B;  5EKK A;  4CHT B;  1CTM A;  1F9R A;  1SBB B;  2EVB A;  4IZ8 A;  4QIW B;  3G7L A;  5JEA G;  3OMC A;  1Z7T A;  5IGE A;  1JOR A;  3I73 A;  3W3A A;  1F2L A;  1QCB D;  2NN6 G;  1GJX A;  3J7A F;  1LV9 A;  2EJM A;  4A3G B;  5E4W C;  1RCV D;  2B2U A;  2OEO A;  5C5M A;  4C56 C;  2E74 C;  2K33 A;  3E6Z X;  1R4Q B;  2PYK A;  2QEJ C;  4FXD A;  2WP8 J;  3S15 B;  5FK9 C;  5LHY 1;  4Z9C B;  1SNO A;  1G2T A;  1EYD A;  2PMZ B;  2AWN A;  3QOJ A;  1JIC A;  3J80 L;  5C5L A;  2OF1 A;  2F0J A;  4FYD A;  5IT9 E;  1I4G A;  3HS0 C;  4WRD A;  1TU2 B;  1BF4 A;  5C0X G;  1B2T A;  3R2T A;  1J8I A;  3OPO A;  3SK4 A;  3MHB A;  2D5D A;  5TSS A;  1JB3 A;  2G9D A;  1LTA D;  5T1G A;  2ICE C;  4XQJ A;  3HGB A;  3OW7 A;  1H9S A;  4DGZ A;  2ZT9 C;  5CV8 A;  4QUF A;  3RD4 A;  1IKL A;  2A73 B;  4ZKB B;  1A2T A;  1TS2 A;  4ZKC B;  4BS9 A;  1SND A;  1Q3L A;  1AEX A;  2AWO A;  3HZX A;  2JEB I;  3MA2 B;  4I7Z C;  1BCP F;  4OHJ A;  5ELE A;  3I72 A;  1E0B A;  4RWS C;  1WTO A;  2NVT B;  3S2D B;  1H9R A;  2M9V A;  4K8J A;  4IFD J;  1Y8N B;  1X3Q A;  3BZD B;  2AQ2 B;  1II3 A;  3V2T A;  1A3U A;  3PUW A;  1H9K A;  2F0G A;  3VR4 A;  1SNC A;  3A8I E;  3HOY B;  4XQN A;  3PV0 A;  5K36 H;  1WTX A;  3QOL A;  2R93 B;  3VYT A;  1JCK B;  2VNU D;  2L1B A;  1EQV A;  5D65 A;  3AMU A;  1TWA B;  1IYV A;  3QWN A;  4R8I A;  4K14 A;  2LKV A;  5NUC A;  3ND8 A;  3BDC A;  1LO5 D;  4K5W A;  2PO4 A;  3QB3 A;  2NB0 A;  1TY0 A;  2XSC A;  5G3L D;  1PZK D;  1B3A A;  3WDN A;  2JP1 A;  1UAP A;  5CV7 A;  1Y8O B;  1LAC A;  1STN A;  4KKT A;  2BE5 C;  1E2V A;  3TP8 A;  2OXP A;  1AZP A;  4RKB A;  1PTO H;  3OMG A;  3V96 A;  4LK1 C;  3ONA B;  1PTO D;  4BY7 B;  4H13 C;  3RZD B;  2QDB A;  2F0S A;  3K5L A;  1QE6 A;  4IFD H;  4Q0F A;  5D14 A;  1DOL A;  3NK9 A;  2MP1 A;  3S17 B;  4AYB B;  3Q0A A;  3DEP A;  1XXG A;  4DA2 A;  1ESF A;  2K01 A;  5FO8 B;  4C3I B;  1NR2 A;  2EE1 A;  3CKI B;  2O4X A;  4IUQ A;  5C3X A;  3L3O C;  3M7N A;  1PRT B;  2WAQ B;  1GOZ A;  4A3F B;  3VR6 A;  4G4K A;  3S1Q B;  2F1M A;  1TS4 A;  1L0X B;  1EFI D;  5E1F A;  3HOX B;  2M00 A;  1GXD C;  2MJ8 A;  2QF7 A;  3P7J A;  4EVO A;  1SMY C;  3M4Y A;  1I3Q B;  2BDO A;  1D1K A;  2PQE A;  4KMU C;  2F3V A;  4IUP A;  1SSO A;  1K83 B;  1DYQ A;  4EQO A;  1EOT A;  3GO5 A;  2RDG A;  4X3U A;  1ICW A;  2L11 A;  1RTN A;  5KRU A;  4XQQ A;  3E0J A;  5I2Y A;  2BCO A;  1AW7 A;  2A69 C;  5I2X A;  2JA8 B;  1NAP A;  1JWU D;  2WAC A;  2EOT A;  4IFD G;  2C9O A;  3CHB D;  3Q6S A;  5A35 A;  1DOK A;  2Q8I B;  1O78 A;  3GTL B;  4KV6 A;  5A2Q L;  1LTS D;  3VYU A;  3IAY A;  3N52 A;  4F88 A;  1U9R A;  5CMD A;  3QO2 A;  2L12 A;  4RH6 A;  4MIU A;  2BDN A;  3PUX A;  3MC0 B;  1EYC A;  2PPB C;  1QNK A;  1OXV A;  5ISR A;  4TKO B;  4KD4 A;  1IYU A;  2XVS A;  4K5V A;  1LTR D;  3WOE A;  2YU9 B;  4L63 B;  3H09 A;  3V05 A;  1AFP A;  5M9O A;  5ELB A;  2AQ3 B;  1CA5 A;  4A3E B;  2D9U A;  2EYM A;  4O1N A;  2N55 A;  4C3J B;  1HTP A;  1S4Z A;  4N9T A;  2X6L A;  5HUR A;  1PDQ A;  2WIN B;  3ITP A;  3PMF A;  4ZRZ A;  4KK7 A;  3NWT A;  5C4Z A;  3NTH A;  5FLX E;  1GHJ A;  1BCP B;  1SEB D;  3RUZ A;  2JXM B;  2RA4 A;  4C3H B;  1HUM A;  4NDX A;  3ZYY X;  1SDF A;  4H44 C;  4C1N K;  5M3F B;  5M5X B;  3P20 A;  5LL6 X;  1FNV A;  3ERO A;  3U9O A;  1MSH A;  3MFG A;  3TP7 A;  1VMP A;  1BUV T;  3GV6 A;  3L9A X;  2XWB B;  1TT2 A;  5C6A A;  2LY7 A;  1EY9 A;  4L8J A;  4TRD A;  5E4X A;  1TS5 A;  5EQ0 A;  1ZKO A;  3R3O A;  1D6E C;  3MXU A;  3UI2 A;  5J1Z A;  1OO9 B;  3DM1 A;  5I4D A;  1KDB A;  2F0V A;  4PMB A;  2B63 B;  1QNU A;  1ML0 D;  2L4N A;  2BA0 A;  1HFN A;  3FKI B;  1WTQ A;  1BOS A;  1EY8 A;  1UNS A;  1B44 D;  5JEA H;  1QWY A;  1KLU D;  5IGF A;  1M8A A;  1D2B A;  1H9S B;  4HR7 B;  3OIQ A;  4RCN A;  1AZQ A;  1XYI A;  2XNA C;  2FIN B;  4KN7 C;  4KN4 C;  1YNJ D;  4LAA A;  4RGN A;  4A3B B;  4V0B A;  2F0O A;  2JEA I;  3PUV A;  1Z6H A;  1ROD A;  1H9M A;  4PMW A;  3N6R A;  1I6V C;  1KAA A;  3S1N B;  3H94 A;  1XTC D;  4F8M A;  4X3K A;  5EBC A;  3C3L A;  1FNU A;  1HPC A;  5G3L F;  1LT4 D;  1PRT F;  5CV9 A;  5CBA E;  1A3V A;  3SHL A;  4IQZ A;  2NYZ D;  3P1H A;  3KK7 A;  4KY5 A;  2B2Y C;  2FMC A;  3S2H B;  1GUW A;  4M1U B;  3QG1 A;  4FXG C;  3CQZ B;  1ONL A;  3A55 A;  5JVH 3;  3H6M A;  1RDP D;  2R6G A;  3HG9 A;  4B08 A;  1B53 A;  4PMC A;  1YNN C;  4RGM A;  1O7Y A;  5IGB A;  3S1M B;  4G7Z C;  4X3S A;  4CGY B;  1STG A;  2OT2 A;  2WB1 B;  1Q12 A;  2Z4H A;  5CBE E;  1PRT C;  2F0U A;  2VB3 X;  2EY6 A;  2K32 A;  1A2U A;  4BY1 B;  4DF7 A;  1E2Z A;  5AFW A;  1EY6 A;  3T16 A;  1PMR A;  4GZY C;  1BO0 A;  3LWE A;  4OIJ A;  2SEB D;  4ODG A;  2O5I C;  3PIO 3;  4U67 3;  1EU4 A;  1CQF A;  1ET6 A;  5KND A;  1HQM C;  2NVY B;  1R9T B;  5ELF A;  2CVR A;  4BWG B;  3TZU A;  4NKL A;  1RD9 D;  5KGU A;  5LL6 S;  3BVZ A;  1DCZ A;  3CRK C;  3TZD A;  4FF2 A;  1EYA A;  3D4R A;  3I3C A;  1GHK A;  2X69 A;  1ET9 A;  1FGB D;  4B9X A;  1PFN A;  4HCE A;  1V1O A;  1IKM A;  4Q5V A;  2KEE A;  3DWQ A;  1RTO A;  1WD1 A;  3I91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...