1LT4D

Heat-labile enterotoxin mutant s63k
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Crystal structure of a non-toxic mutant of heat-labile enterotoxin, which is a potent mucosal adjuvant.
pubmed rcsb
source organism Escherichia coli
total genus 27
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1997-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lt4D00
3BZDB 1LO5D 4RGMA 1PTOB 1TY2A 1PRTC 2Z8LA 1AN8A 1BCPB 1I4RA 4BWGB 3V05A 5TSSA 3BYTB 1RDPD 2R61A 1ET6A 1D5MC 1STEA 1EU3A 1UUPA 1PRTB 5D3IB 1JR0D 3R8BA 1TS5A 1F77A 1I4GA 1JWMD 2XNAC 1V1PB 1TS2A 2SEBD 1KLGD 4RHRA 1TY0A 1CHQD 3BVZA 3SEBA 1JCKB 1LTGD 1I4HA 1HQRD 1LTTD 1PZJD 5FK9C 1FNUA 1I4PA 1D5XC 2IPKD 2RDHA 5ELFA 1CHPD 3R2TA 1BXTA 1S5DD 2TSSA 2RDGA 3EA6A 3MC0B 4RGNA 4TSSA 2IJ0A 1SJED 3R2IA 1CK1A 3DWPA 5ELDA 1EEID 1LTAD 1RD9D 1SXTA 1MD2D 3BVMA 2AQ1B 4UDUC 1LT6D 1LT4D 4C56C 2AQ3B 1LTID 1HA5A 1ESFA 2XRQD 1SE3A 4RCOA 5ELEA 5I4DA 2CHBD 1PZKD 1LT3D 1PTOF 1BCPF 1G8ZD 1CT1D 1UNSA 5ELCA 5FKAC 2J4XA 1PTOD 1SE2A 4ZYSA 1LTBD 1JWSD 1PYWD 1EFID 1BCPD 1SJHD 1V1PA 1PRTF 1XTCD 4K6LA 4O1NA 1KTKA 2ICIA 1LT5D 1D6EC 1PRTD 1FNVA 1AW7A 4OHJA 2QEJC 1LTSD 1JQYD 3EFXD 1I4QA 1ENFA 1RF2D 2XN9C 1L0YB 2G9HD 3DWAA 3URYA 1S5CD 1HXYD 1M4VA 2QILA 1L0XB 1EU4A 4RHSA 3DWQA 4DXGA 1SEBD 1D5ZC 1EWCA 2WV6D 1JWUD 1SBBB 5ELBA 1B44D 3CHBD 4RGTA 1FNWA 4L63B 1GOZA 2O2LD 5D3DA 1HTLD 1PTOH 1XXGA 2XRSD 1TS3A 3OWEB 1ET9A 1V1OA 1DJRD 4DXFA 2AQ2B 1LTRD 3BYYB 4L6TB 1TS4A 4RH6A 1SE4A 4RFBA 3KLSX 1QILA 1LLRD 1S5FD 1CQVA 3W2DA 1FD7D 3MFGA 4Z9CB 2NTTA 2NTSA 3BVGA 1RCVD 1S5BD 1EEFD 1S5ED 3O13A 1DYQA 3GP7A 1FGBD 1T5XD 1PTOC 3TSSA 1BCPC 4RGOS 1I4XA 1KLUD 1PZID 1B1ZA
chains in the Genus database with same CATH superfamily
5IGGA 1SNDA 2ZTCA 4FF4A 2YU9H 1JOQA 1Q1EA 5IE8A 2E76C 1BCPB 2Q8RE 3M7GA 4DR5Q 1MJCA 4HJ9A 1PH6A 2F0DA 3NTKA 1SYDA 2F0HA 1CTMA 5T1IA 3WWVA 1PRTB 5M5YB 1JE4A 3K0YA 5FLXL 3U58A 3PO2H 2JA8B 4HJAA 1JMCA 2GVAA 2KHJA 3GV3A 4DK0A 4XQNA 4JI3Q 2ZM6Q 2NB0A 1HQRD 1EY5A 2HDLA 1IYUA 3LNNA 4RKLA 4ULLA 1U5KA 4FYDA 2RF4A 3TEHB 3S1MH 1S5DD 3HEJA 3T1HQ 4ZK9B 1IHZA 2I5LX 1CK1A 3TP8A 3PIPA 2JP1A 3DEPA 2L55A 4NXML 4UDUC 1H9JA 3CCRA 4A3MB 4IFDH 4A93G 1ICFB 3MXGA 1F9RA 2Z0SA 2VZAA 1RTNA 4OWTB 2FMCA 2AWOA 1C8CA 3K7AH 3PO2G 1J8IA 2NVYH 1F9SA 1XTDA 4O1NA 2XSCA 1B53A 1SLJA 2HCCA 3KBGA 1DXMA 4Q0FA 4PMWA 2GVBA 1VQAA 4JI6Q 1U4LA 1A63A 1A8VA 1HTPA 5IOCA 1B50A 2EJFC 3GTLB 5CV6A 1PH7A 3NE5B 3CMEA 4LNQA 1EIFA 1JWUD 1DCZA 4IFDG 2MUYA 3KDFB 3B6YA 4LF4L 1TIID 3N52A 3EVQA 1KNEA 1X3QA 4YHHL 2N49A 2F0TA 2WINB 1ZYRD 3D4DA 4GNXC 4CDEC 1WFQA 1GVPA 4BY7B 3J7AV 1QUQB 1CQVA 2F0NA 1WYDA 4IQZA 3AFQA 1ILQA 1S5BD 4FDBA 4B3MQ 3PF4A 2K7VA 3A54A 1EY7A 3DLLA 4KHPQ 1GUSA 2OCEA 1M8AA 3IAYA 3BZDB 1YNJC 2A8VA 3S1QB 1XPUA 2TMPA 4QCLA 3NP8A 4OONA 4I7AA 2R61A 1ET6A 4JCVE 3HOYB 4E6IA 5FOBB 5ISRA 1LYLA 1TWGB 1IBMQ 4YCUA 3G6EA 4G7OC 1JCKB 1QVFA 3FMCA 1LUZA 2K5WA 1Y8OB 4JI2L 4X65Q 2R93H 2A6HD 1GKHA 3Q8DA 3BJUA 4C2MB 2MNAA 2UUBL 5JEAJ 3DWPA 5DEHA 1ICWA 1MIUA 1LTAD 4OXPA 3RZOH 3CQZB 2F52A 1B9MA 2LMCB 4P71A 1K3RA 1A6XA 3S14B 3CCEA 1XMOQ 1VQCA 4GOPA 1TXYA 1ESFA 5ELEA 2F3IA 2LY7A 2FINB 4DK1A 3D6CA 1KC8C 3CCVA 1CT1D 3U4ZA 5ELCA 2DNEA 5FLMH 3MXUA 1I6HH 2F3VA 2K01A 4QB4A 1KDAA 1NR4A 4I65A 2F0OA 4BA1I 1VQ7A 1PHJA 5GADC 2HD3A 2SNSA 3EFXD 1ENFA 3F2DA 3S1RH 5HGQA 1YI2A 1X56A 1L0YB 2XN9C 2R93G 1EIGA 1SNOA 1BQQT 1HH2P 2KOLA 2SNMA 1U4RA 2BDNA 5M9OA 1K8MA 1LACA 2PNHA 3K59A 3NUCA 3DHQA 1GOZA 4HJ5A 1HZBA 5I2XA 1SAPA 4DR7Q 2QCPX 3T16A 2GN5A 1LTRD 2JQOA 1JT8A 2E2DC 4L6TB 5FLMG 3PUYA 2R92H 1XNQQ 1IBLL 5NUCA 1FD7D 1Q8IA 2FXQA 3GTJH 1VQ8A 2F4VL 4LF8L 1L1OC 2JXMB 1KHIA 1MSGA 1SYFA 2EYPA 3T1YL 1E7ZA 3STBC 3T4AC 1O80A 3ERSX 5ELOA 3ULLA 4CDCC 2UU9L 3DUZA 1YBYA 1LO5D 3K0XA 1I3QH 1PTOB 4ZKCB 3L3OC 2Z8LA 4JI0Q 4B08A 1R9TB 5IODA 4DV0L 2IHEA 1LM0A 1D5MC 2O5JC 2JA5B 4CKBA 1EYAA 1FYCA 4DUZQ 3R8BA 1SDFA 1PYBA 5K5PA 5IP7G 3LGJA 2R92G 4XQQA 3MHBA 1FR3A 1PZJD 4B9XA 1K3BC 1I4PA 2MQHA 2J0TD 2E2HH 2F0LA 1T9HA 2WKDA 1VQKA 4XIGS 5I6YA 2A68D 4X3SA 5IT9c 4GOPB 4GLVB 2OQ0A 4DU9A 3HOXB 4IPCA 5ELDA 1Z6HA 3RLOA 1CA5A 3CCUA 2WKCA 1N32L 4L5TA 2VW9A 4DV3L 3S2HH 2IL8A 2MO1A 4NXMQ 4JI1L 1SE3A 1N8RC 2PO4A 4JBMA 2EJGC 2EZVA 2AKWB 1CKNA 4LUOA 5A35A 3UDIA 2L12A 1RTOA 4DAYA 1EOVA 2Z4IA 2RKSA 1RJTA 4JBJA 1LTLA 2K50A 2K75A 2MHVA 3HKZG 3RLNA 1TWHB 4V190 2SDFA 4C3JH 2F0PA 4BBRH 4CJ2C 1TVXA 1VQGA 3D31A 4A3FG 2JYOA 5C4XB 3NTHA 4IUPA 4FF2A 2M00A 2F0FA 3WOFA 1DGSA 1FGUA 3SK5A 4DN4M 1YHQA 1STHA 2YTXA 3NPPA 4G7HC 4DV2L 2IHFA 4KHZA 4J15A 1SNPA 3FP9A 5T1GA 3VR5A 3OW7A 3OWEB 2BE5C 2NVXH 2XGTA 1BNZA 4PZ7A 5EPLA 2SOBA 4FF1A 3IFTA 2G5DA 4O0AA 4DNIA 4RA8A 4YHHQ 1TS4A 4RH6A 4DV5L 2N88A 2F0JA 1GO3E 2NTSA 2V4DA 1QZHA 2I5HA 3E5SA 4BBRG 4C3JG 2E2JH 2Q8IB 1EEFD 5C4ZA 1P8LA 3CC2A 1WCMG 4DAVA 4DF7A 4A4IA 1Y8NB 1B7YB 5M5XH 4RGMA 4LFAL 3I8ZA 4NDXA 2JSOA 1BBUA 4DGZA 5C3EH 5C4JH 1KDCA 3V05A 5TSSA 2VS1A 3U9OA 3J81L 2HQLA 4ILWA 2WACA 5M3MB 4KD3A 1TS5A 2KCNA 1QVGA 3HKZB 1TWAH 2DUDA 3S1NH 3IL8A 3GTPH 4CDFC 4A3FB 4CJ1B 5EAYA 2HCIA 4ME5A 1Y69U 3NXWA 5IP9H 2TSSA 4B3TL 2YV5A 4DR5L 2VXWA 4JI2Q 3TN2A 3CAMA 4FVMA 5E4XA 5JOBA 1WTRA 1WTWA 3F1ZA 2PZTA 4BBSB 4C56C 1R4PB 5CR3A 3PIOA 4IUNA 3MZ5A 1PVOA 1QG7A 3HRZC 2ZM6L 3UE0A 2A73B 4A3JH 1OTCA 3CKIB 4M8AA 1G8ZD 5IGDA 1FVIA 3H91A 4G7ZC 3T1HL 2R7ZG 2LFNA 4A3BB 4J8QA 4K5VA 5E3FA 4OX9Q 1ESRA 3CXCA 1AW7A 5C3XA 5A2QE 1KDBA 2QW7A 5IP9G 3M4OH 1C4QA 1E2ZA 3DWAA 4UP8A 1BVSA 4P2CB 2B8GA 1STBA 3HS0C 3WOEA 4DPGA 4C3HB 1EU4A 3I3CA 3OOCA 3A0JA 3OMGA 5ELBA 5HY6A 2NN6H 4NB3A 4ZRZA 3CP0A 1XXGA 4A3JG 3J81j 5KYIA 4A3IH 3BYYB 4IJHA 3J7YW 1HNZL 2IX1A 1S5FD 4A3GH 3I4OA 1K83B 4QGUA 1JJCB 4AQYQ 5DM73 4O42A 4KN7C 2F4VQ 1A3TA 2EYHA 5C0XH 3HOUH 5GQOA 3MFYA 2ZXRA 2OTJA 3T1YQ 3JAMc 1Z7TA 2AMCB 1NY4A 2RVLA 3MTSA 2JA7B 2F0SA 2RBMA 1PYSB 2UU9Q 1HQMC 1O7IA 1PFNA 3J81c 4G57A 4F7XA 4ODGA 4ABNA 4X64L 4DV0Q 3G6JB 1SSOA 1VMPA 3HZXA 1PH5A 1I4GA 1X55A 4B3ML 2JA6B 1V1PB 4OO1I 1F2YA 4F87A 4A3DG 1IW7C 1EIHA 4YCWA 4KKTA 1K0SA 2A1AA 1SYBA 4K5WA 2IPKD 4PZ8A 5ELFA 3H15A 3T13A 3PUZA 3KJPA 1YJWA 4DV1Q 4QF4A 3X3MA 2B2YC 1UEBA 3NBHA 3R93A 5I9OA 4TSSA 5L37A 2YYZA 1SJED 4OELB 5C0XG 1EWIA 3HOUG 1X54A 4RG1A 3C3LA 5BN3A 3OHXC 2PMZE 4RCNA 4HMIA 4EQ5A 1IBML 2F0MA 4P73A 2ENBA 1IL2A 2RSOA 4POGA 2ZT9C 2D0OA 5I4DA 2A6ED 1RODA 4JI1Q 4ALPA 2HHHL 1E1OA 4FO2A 5JJZA 2EYMA 5C6AA 1PFSA 3VYSA 1XTCD 1JWSD 3I4MH 3C1FA 1NR2A 1JB7A 4APVA 1NMGA 3SVMA 4LFCQ 1NUCA 2RQXA 3LX0A 1EYGA 2K28A 1XMOL 3GV6A 1EQQA 4BXXH 3M4PA 2G9HD 3FKIG 3URYA 5GROA 3BDLA 1KL9A 3VR6A 2F0VA 4JI4L 1EZ6A 5CBAE 3D4RA 3ONAB 1FL0A 3V96A 4DXGA 5AJ3Q 4R8IA 3K57A 1F2MA 1SEBD 1D5ZC 1WD1A 2WV6D 2QF7A 4DUYL 4YWMA 4IOCA 1JICA 1UE1A 4DV2Q 4MN3A 1WTOA 1X3PA 3A7LA 5EKKA 1Q3LA 5C4HA 2RHQB 5M3FH 1VQLA 1JORA 1X6OA 1NTGA 4A3DB 1C9OA 3NENA 1SE4A 4A3MH 4JI8Q 3I4MG 5I6WA 4DV5Q 2QA4A 1I94L 3D0FA 3SK8A 1Q90A 1DOKA 1WTHA 3S2DB 1W3SA 1S5ED 4FXGC 3TP5A 1YITA 3A8IE 2ES2A 4BXXG 1C48A 5LL6X 5IWAL 3DM1A 2Q2UA 1F2ZA 2C9OA 4R9WA 4L5RC 2EYLA 2K5HA 4K2KA 1QCBD 2WAQG 3KLWA 4XT1B 5FO7B 4QL5A 2QDBA 3KDFA 4LFAQ 1OXTA 4OWXB 2XWBB 1BDOA 1F9PA 2VQFL 2Z6BA 1MHWC 1JR0D 5DLQE 3KF8B 3CC4A 2LS01 1KLGD 3K5LA 1OXSC 1BKBA 3NBHB 3J80L 1LTGD 3MWYW 1B2TA 3GTQB 3MEHA 3S24A 2VUMH 4DKAC 4IFDI 2B29A 3MEFA 3W1BA 3KK7A 2A19A 2R7FA 4B3TQ 1SYEA 4X3TA 1SXTA 2F03A 4DUZL 3OW2A 4KI0A 3J7A5 1LT6D 2AQ3B 2CH4W 2EYOA 1P16A 5HGTA 5K36H 3EROA 4EQPA 2B2WC 4RCOA 2K52A 1PH3A 3I2ZA 1VQEA 1VQHA 5FJ8H 1ILPA 1ML0D 5JPNC 3BZKA 4A3CH 4ZYSA 3H09A 1PYWD 1ZXTA 1SMYC 1KRTA 5I9PA 2CWAA 3G48A 1YNJD 3J7AF 1KTKA 3QIAA 1ONLA 1UEAB 3EQLC 2VUMG 3H0GB 2NVQB 3M3YB 4IALA 1VQ9A 3TS0A 2HDMA 3R3OA 3BS1A 2EXDA 3SK6A 3I4NB 4BY1H 5CORA 4JV5L 5J3BA 5D14A 1JOKA 2L4NA 5IYCH 5K36G 1ENCA 2OQKA 3HOVH 1HTLD 4DR6Q 2KBNA 2K5VA 4KK7A 5FJ8G 3SE0A 2B2TA 4A3CG 4RFBA 1U0LA 1YJ9A 3KBXA 2V1CC 3TBIB 1HNZQ 1GJXA 2J7ZA 1S4ZA 4XT3B 1KD1C 4H13C 4LW1A 4JI7Q 4JOIA 1PH2A 1BCPC 1PZID 3OPOA 3F8TA 4BY1G 1PRTC 5JPMC 4LK1C 2RCFA 3ITPA 1GM5A 2LKVA 4OIJA 2ALYB 2WAQE 1SN8A 4N9PA 2Q2HA 1RIPA 3HOVG 2HQEA 4X64Q 4DR4Q 4C3IH 4PG3A 4CBVA 3QO2A 2F4IA 3J80c 1VF7A 3TZUA 1SROA 1Z47A 2WFWA 1Y1VH 1RHPA 1A3UA 1Z9FA 1E22A 4MTNA 1BXTA 3MC0B 2BDOA 3EA6A 4A93B 1W6KA 1M1KC 2YU9B 3RZDH 3HFZB 2WB1G 2VQEL 1K8OA 2MJ8A 2IT1A 3L9AX 5FLXc 1XMQL 2DNCA 3PO2B 1IXRA 2DJFC 4NW2A 5IGEA 3GO5A 2HHHQ 3S17H 2R6GA 3STBD 4C3IG 1EFID 4K6LA 5FO8B 1CI3M 3S1MB 1AP0A 5C44H 1K0RA 4J1MA 3Q23A 2ZXOA 3I91A 3GTKH 1Y1VG 1AZQA 2JA5H 4DR1L 4A3EH 1RF2D 2M9VA 4JBKA 1KAAA 2K04A 2L1BA 3OIQA 2CFMA 1HZ9A 4IOAA 2DN8A 2K5NA 4XYQA 3NSWA 2KQ3A 1TWCH 2VB2X 3I72A 1VF5C 4TKOB 5G3LF 2EY5A 4JI4Q 3KLSA 5EGTA 1WVLA 4P75A 1QOHA 3K7AB 1PH1A 3D4WA 4RGTA 3RR5A 2MP1A 1JC7A 4DFAA 4DUYQ 1VQJA 3A55A 1H9MA 2RDFA 4OX9L 3HOWH 3H3VC 3BU2A 4K0KL 1HNWL 1MI2A 3AMUA 1L2FA 5C44G 4GS3A 3Q6SA 2LXJA 1I94Q 5JEAH 1K8AC 1UE7A 4QY7A 3GD7A 1H95A 1U4MA 4IURA 3UDXA 4A3EG 1W6JA 4NP5A 4GLAC 3ULPA 1N34L 4QIWB 2L0CA 2EY6A 4BS9A 5IWAQ 4HIDA 1TWHH 3TP7A 3D6WA 1TY2A 3RN2A 4MIUA 5CMDA 1HZCA 1EYDA 4YCVA 3G4SA 1BOSA 4HMJA 2VQFQ 1PH4A 1HHVA 2PZUA 3L0OA 1F9QA 4AQYL 1K9MC 3AYHB 3HOWG 3S9WA 2E2IH 2B8FA 3AEVA 1T5EA 3CRLC 3SEBA 2PPBC 2R7DA 1PH8A 1ASYA 1CHPD 3M9BA 2RDGA 4JI5Q 5JEAG 4IPDA 1IZ6A 2BE5D 2Q2TA 1WTPA 3E6ZX 2FFKB 1GUWA 1LT4D 3PSIA 2WB1E 4V0BA 1PH9A 2B2TC 4P72A 3I73A 2KUMA 3K81C 3VR2A 2X6LA 1LT3D 2ATWA 1A15A 1MGSA 4DNTB 1JB3A 1BF4A 5A2QL 4DV1L 1SJHD 2NZOA 4K2LA 3L7ZC 4K6DA 4DV7L 4XTCS 2R93B 1ZKOA 1IBKL 4GKKL 2EYJA 5LL6S 4JOIC 3S15H 2K5QA 4IUTA 3RZOB 1I4QA 3A74A 4B3SL 2CWPA 4X6AH 1HRJA 1S5CD 4GKJQ 1M4VA 1N9WA 3F2BA 1YZ6A 4RKBA 5HURA 5IIFA 4IPHA 4LF6Q 1VQ4A 4AIMA 2DGYA 4UPAA 4JV5Q 3AQQA 4FP5D 1FNWA 3QR8A 2ICEC 1Q46A 4L63B 1I6HB 1IL8A 3QOLA 4LFCL 4H0LC 5E1FA 3HOZH 3CD6A 1VDZA 2K33A 1OO9B 4HSPA 1KABA 4X66L 4BBSH 3KLRA 3S1RB 1SMXA 4K8IA 2KENA 5AJ3L 3I90A 1X32A 4ID6A 5EPKA 3VR3A 2ZJPA 1G6PA 3C46A 3O13A 5EBCA 2B39A 4LF7Q 3GP7A 1CUKA 1FGBD 2VY3A 1PTOC 2WIIB 2EOTA 3VYTA 2DY8A 4RGOS 4H44C 1GUTA 3OIPA 3J7ZC 3W5OA 5JVH3 5EPJA 2DJGC 3UDGA 3BYTB 3AFPA 3BG3A 4JI8L 2BH8A 2B2VA 3E3XA 1STEA 5C5MA 1A3VA 4EX5A 2R92B 2ASBA 4FF3A 2PQAB 4C3HH 3GTJB 4DK6C 3S16H 2F0KA 5IT9E 1I6VC 2NUCA 3L2PA 3TREA 1LTTD 3MVVA 1HA6A 1FNUA 4IO9A 1WTQA 2VL6A 1BBXC 4LMQD 2QDLA 4MZ9A 4GOPC 4IUVA 5JVG3 1I3QB 2B63H 1WJJA 1XYIA 3GTGH 4EVOA 2UXBL 3AB9A 1C7YA 3BVMA 1EL0A 2EJMA 1XPOA 2VQEQ 3E9IA 1O78A 1HJPA 3M85A 4ZLTF 1XMQQ 3IFDA 1AH9A 3WDNA 5KYLA 4AH6A 4M1UB 2HIXA 5J22A 4A3KH 1V1PA 5CV4A 3TRZA 3GTOB 2E2HB 3NWTA 4LFBL 3OWFA 2PI2A 2PYKA 1U9RA 1O7YA 1STNA 2ICIA 2L5TA 4C1NI 1D6EC 4DV6L 1EYCA 4NXNL 1JE5A 1LTSD 2N78A 1VQPA 1QWYA 1VQ5A 5M5WH 4DR1Q 3ND8A 2B63G 5C3EG 4LWCA 2F0WA 4YIJA 1EWCA 1IW7D 3EN2A 2EVBA 3MXNA 4NMZA 3CCMA 3UDFA 3PO3H 2PW5A 3A8KE 5LMNW 2B2UA 2UXCL 1DJRD 1SNMA 4DXFA 4C3JB 4BBRB 5C3WA 4A3KG 4AYBG 4PZ6A 3NTIA 3PUWA 5C0XI 3H94A 3EJIA 2RCNA 1WCMB 2NVTB 4UP9A 1Y14B 4Z9CB 3P75A 4K0KQ 1BUVT 3CPWA 1HNWQ 1YNNC 1I50H 1O7ZA 1KQSA 1DYQA 4HIKA 3QB3A 2WP8J 2Y0SE 4C1NK 3N6RA 1KLUD 2EY2A 2F0EA 2UUAL 4DR6L 1GUOA 3SXHA 1W2BA 2H5XA 3T56B 1N34Q 4X3UA 1AN8A 2NVXB 2NZHA 2JEBI 5COYA 4UHVA 2G9DA 3PO3G 3GTMB 4H7BA 2SEBD 1GXDC 4FXDA 2E2JB 4IJLA 1CHQD 3BVZA 1PFBA 4LF5Q 4JI7L 3DEOA 4X3KA 2I46A 5FK9C 5KNDA 2F0IA 2Z4HA 5CV5A 4A76A 1Q86C 3NHHA 4KJNA 2NWGA 3UI2A 4TVAB 4DR2Q 1CKOA 2IY5B 3X3NA 2IJ0A 4J6HA 1E2VA 4GZYC 2K6AA 4Y7NH 2NN6G 4ZCKA 4DR4L 3I70A 1KNAA 3CCQA 2L15A 2R7ZB 5DNFA 4A3IG 1PZKD 1TWAB 4TRDA 3S1NB 1OXUA 4XXEA 1ASZA 1EY6A 4JYAQ 3KF8A 2J4XA 4A3GG 3NQTA 2ZJRA 2UUCL 3U50C 1DD2A 1TWFH 1CA6A 2BH2A 2CQAA 3KOJA 5J39A 1CFMA 4DNRB 4DV7Q 1IBKQ 2A69C 4GKKQ 2XIWA 3Q22A 1G2SA 2HIVA 2KHSA 3MXNB 4B3SQ 2K5DA 2RA4A 3AU7A 3E9HA 4A3JB 4HN7A 1Y1WH 5JJKA 2HT1A 4U68A 1MSHA 4YY3Q 1K8GA 2M2LA 1JJ2A 5D3DA 1TS3A 4QJFA 1M90C 3CRKC 1NAPA 4L5SA 3QWNA 1X65A 3A5UA 5M5YH 2IX3A 1MKHA 3DMUA 4K8JA 4KKSA 3JAME 3W2DA 3OTOL 3M4OB 2EPBA 4X66Q 3MFGA 4OEMB 4AYBE 3FDTA 1Q7YC 5GAHC 2E8GA 2JA8H 1QZGA 3LWUA 1HNXQ 4R8NA 3J81E 2PQEA 4JG2A 1EY4A 3G7LA 1Y8PB 1HR0W 1I4XA 4GNXA 2Z1CA 1SMYD 1Y1WG 1S40A 1I4RA 4BWGB 4A3IB 2A74C 2NVQH 2RHSB 1PV4A 3M3YH 1UUPA 3FPPA 3V2TA 1HPCA 4A3GB 1TS2A 4HCEA 2H4OA 1PMRA 1SFOB 3HOUB 4KJOA 2JA8G 4KY6A 4O2DA 3R2TA 1KRSA 5EBDA 2RSNA 3FPUB 4DK3C 1J6QA 2C5CA 1HUNA 2AQ1B 1H9RA 3GTLH 3PIO3 2UXBQ 4IN3A 4OGQC 3DM3A 2DY7A 5M3FG 4IUUA 1NCVA 4GN5A 3RLFA 1STAA 4Q5VA 4A3MG 3PV0A 3NK9A 4JI5L 1BCPD 4DR3L 3KYHC 4LF9L 3FKIB 1R4QB 3KFUA 1PRTD 2KVMA 4X62L 4LFBQ 4OHJA 3GQBA 1NBWA 1HFGA 1E24A 4DV6Q 1JQYD 3NEMA 2CKZB 4BY7H 4NXNQ 1YVCA 5IY0A 2E5LQ 3H3VH 1H9SA 4EQOA 5IGCA 5JJLA 1L0XB 2KHIA 3BZCA 5KGUA 3ICEA 4RHSA 4L5QA 1QE6A 2ZTEA 5EQ0A 3K58A 4WJ4A 2XWJB 2Z6KA 3ND9A 1GUGA 1DOLA 2F0UA 4A93H 4IFDJ 1S3OA 3I4MB 2O2LD 4OIKA 3S1QH 5EKLA 1ZEQX 1G2TA 1VMCA 4LJZC 3VYUA 2UXCQ 3HOYH 4CDDC 1JJGA 3RN5A 4GKJL 1TWGH 1N33L 5E4WC 4KY5A 3PQIA 2NYZD 2NTTA 4GNXB 2XTIA 4LF6L 1D1IA 1RCVD 3BVGA 4OWWB 1V9PA 1NJIC 3LWEA 2WAQB 4BY7G 1QVCA 3VDYA 3OMCA 4ZAIA 4KY7A 1B1ZA 5LMUQ 3RUZA 4PMCA 4PNYA 2QKIC 3A5ZB 4POFA 5IGFA 3HG9A 3P1HA 1UE5A 4C2MH 1HR0Q 2P5ZX 3NWSA 2UUAQ 5M3FB 1L1OA 4HJ8A 1RDPD 3PMFA 3CQZH 3CF5A 1EU3A 3IRBA 2CW0C 3S14H 2D62A 4ZQ3A 1LABA 3E0JA 3TQYA 4RMFA 2K1BA 1JWMD 1YHBA 1II3A 1AE2A 3Q0AA 4LF7L 3HOYG 3KF6A 1VQIA 3TZDA 2C35B 5IYBH 1K73C 3M4QA 4UAIA 2KJXA 4RGNA 3HKSA 3K6OA 3C2PA 3R2IA 4BA2I 4CKCA 3JC66 1EEID 4DAMA 1DM0B 1MD2D 2JA9A 5IYCG 3SGIA 4JBWA 1NMFA 2I5MX 4MNOA 4WRDA 3CCLA 4N8FA 3MAQA 2N55A 1J5EL 3QOJA 1UAPA 1D7QA 3U9SA 1N36L 3F2UA 2VUMB 2EIFA 3FVQA 2X69A 3KJOA 2UUCQ 1H9SB 4LUVA 4CKEA 2PZWA 3E0EA 2YTYA 1JOOA 1CSQA 5IYBG 4QUFA 4PMBA 5D65A 5JAVA 2MO0A 4GLXA 5E7NA 1HXYD 1U4PA 3FEWX 1B9NA 4HJ7A 4JPBW 1OXXK 3MA2B 1G6ZA 1PTOH 4F8MA 1R9TH 1RL2A 2AQ2B 2X6GA 4KMUC 4N8X1 2FMMA 5CV9A 1VQNA 1LLRD 5GAGC 1EOTA 1VQMA 1EY0A 2HUGA 3OTOQ 1B4OA 2KCMA 4HEDA 1NSNS 4BY1B 2IX0A 1HZAA 1LV9A 2L11A 1D8LA 2PNRC 3QJYA 4PV1C 1L1OB 4TQUS 4ZUJA 4GN4B 3A56A 1Q1BA 2NVYB 1QNUA 1GUNA 3HOVB 5BR8L 1XNRQ 1TT2A 3J80E 1SRUA 3VA5A 3HOXH 5IT9L 5KNBA 2QEXA 3T53B 4JK1C 4KN4C 3RNUA 1GHJA 2L9HA 1HFNA 1YHAA 4IZ8A 1C0AA 2EY1A 4KV6A 3KF6B 1H9KA 1V1QA 1F77A 2N8NA 2PCFB 4RHRA 1FJGQ 2JA5G 1I4HA 2WB1B 5FLXE 1HCZA 5CV7A 2BA1A 1PXUA 5BN5A 2Z6KC 2OTLA 1ZYRC 4XQJA 1G51A 3P7JA 1BR9A 1EFWA 3C1EA 4CJ0B 5C4XH 4A75A 3U4VA 4HCSA 2EXZA 1EY8A 1MJEA 1AFPA 3VYRA 5LHY1 4C3IB 2Z9HA 3HOXG 4LF5L 3FRPB 5KIXA 1EZ8A 1E1TA 4B9WA 2H1EA 3TDQA 1Y1VB 3GDEA 4P74A 2ZXPA 2KEEA 2JEAI 2PQAA 1PTOD 5IYDH 3W3AA 4DR2L 3RD4A 1QB5D 5KNCA 4Y52H 3RZDB 4DR3Q 3PF5A 4LF9Q 5KEEA 4DV4L 1FNVA 2D2CC 3P20A 4KLKA 5IP7H 3PIP3 2QEJC 5DAUA 1F2LA 4X62Q 1VQBA 1EWHA 3SDZA 1VQDA 2O4XA 3DWQA 2Q8TA 5C4XG 4JYAL 2VB3X 1SBBB 3D8GA 3S17B 3I4LA 1X3FA 2A6HC 4UP7A 3UE1A 1V1OA 5C44B 3DXJC 2JN4A 4U673 3GTKB 3JAMi 3A8JE 1J9OA 4FNFA 5IYDG 2OWOA 4A3EB 5M3MH 4QIWE 2LSSA 3J81i 2ZTDA 4ZUIA 1N33Q 1DONA 1TWCB 2K14A 1CZGA 4GN3B 4YY3L 2BCOA 2N3SA 4A3FH 5FO9B 2OF1A 2R3ZA 3GTOH 2EYFA 1PFMA 1G291 3SR1A 4HIOA 1VQOA 3Q24A 4B3RL 5LMNL 1X3EA 2AHOB 3HOWB 4NKLA 4YWLA 2KEDA 4N9TA 5D3IB 1V43A 2FJ2A 4JVZA 1UWVA 1GHKA 1B3QA 3CCSA 1YNXA 1CSPA 2ID0A 5I2YA 1HNXL 1CKMA 2UXDL 3BDCA 2Y0SG 4IPGA 1X3GA 5M3MG 2KA7A 2ZJQA 2OEOA 1AE3A 1A0IA 2RDHA 2K05A 4FXKC 4A3BH 3K80C 1SNCA 3EIVA 3OSOA 3FHWA 4HIMA 1WCMH 3HP3A 2NVTH 4ME3A 2MGSA 1LTID 5CBEE 1XX8A 3EBEA 2QGQA 3HOZG 2NBFA 4WJWA 1YNND 2B2YA 2E2IB 1ENAA 1KXLA 1BCPF 4BBSG 3ZYYX 5H1SE 5JJIA 1J5EQ 5FKAC 1K28A 1N36Q 1PRTF 4LF4Q 3TS2A 1VCIA 3NELA 1TR5A 1BBWA 1TKWB 2Q2IA 2CVRA 1XJVA 3RMHA 4XYOA 1WTXA 3GTMH 1PLFA 2JE6I 5CV8A 4MTKA 4UY8C 5GAEC 1O7LA 4A3BG 4R4CA 5C5LA 2QILA 1K83H 3OYYA 1V8QA 3PGZA 2IW3A 1PDQA 1TQOA 2F0QA 4OL7A 4HSVA 1WTVA 5EJWA 1B44D 3PUXA 3K7UC 4EGVA 3JAML 1SNQA 4C3HG 1OXVA 2A68C 1SYCA 1B8AA 2JA7H 3NQIA 3F2CA 1X9NA 3M7NA 1HUMA 1ET9A 2Y0SB 3A7AB 3S15B 4KKUA 2E5LL 1AZPA 2NN6I 3S2HB 2R7ZH 2BA0A 1SR3A 4PQXA 2JA6H 3PCOB 3K5NA 3CCJA 1XWEA 4R4QA 3TSSA 5F2DA 1E0BA 1IKMA 2KCCA 1RKNA 2KECA 1DZ1A 3HOZB 5IGBA 5BR8Q 1YIJA 2UUBQ 1QNKA 1CKNB 2A69D 2JA7G 4LAAA 4K14A 4DAYB 4JI3L 2B3GA 2E74C 2XNAC 4F88A 1TY0A 1KAWA 1Q12A 4YWKA 2AUJD 4L8JA 1S72A 1I5FA 2PW7A 3I56A 4HAEA 5LMUL 2JA6G 3CPFA 2K03A 3K5MA 4WORA 1HR0L 3VA7A 1STGA 2A5HA 1KIXA 1VS0A 4MHEA 2CQOA 3HKZE 2D9UA 4DAPA 1RD9D 4R1JA 5BN4A 2E75C 1VQFA 3ULJA 5C0XJ 1CM9A 4JC0A 1GD7A 1WI5A 1CQFA 1HA5A 3S16B 2XRQD 3ZJYC 2CHBD 2F3WA 3I7FA 2PMZB 1L0WA 2AWNA 3K5OA 5G3LD 1UNSA 3CU7A 1SE2A 3IKJA 2AUKA 1SYGA 2CCZA 4JI6L 5M5XB 2B2WA 1LT5D 1NE3A 2B63B 5C3EB 3GTGB 1MBYA 1Q81C 1CZWA 5C4JB 4A3DH 3HGBA 4DV4Q 3QG1A 1Q8KA 4XDXA 1IBLQ 4HTHA 3ER0A 1Q82C 4CGYB 2XVSA 1A2UA 2GA4B 3S2DH 1G91A 4LF8Q 2K32A 5KRUA 1SFOH 2I0QA 3CC7A 2LXKA 3GTPB 4A3KB 4AYBB 3CHBD 5CC4A 5AFWA 2D5DA 1YJNA 5DM63 2BOSA 4A3LH 2JK8A 3H6MA 3KLSX 4JW0A 3VR4A 3PUVA 5M5WB 2F0GA 4KD4A 4I7ZC 4NPSA 4EQNA 4IUQA 1D2BA 4QUCA 4RAUC 4KHPL 2B2VC 3G71A 1VQ6A 2OT2A 2CH4A 3GTQH 4G4KA 3W1GA 3M4YA 4ZKBB 4K5XA 1WOCA 3FKIH 4R4IA 3J80i 3PO3B 2OXPA 4KTAA 4QMGA 1A2TA 5CYUA 2I07B 2K4KA 3NBIA 1IYJB 4B3RQ 5LMNQ 1N32Q 2EQSA 1EQTA 5J1ZA 4KHVA 4DV3Q 2MPMA 1I50B 3SHLA 1STYA 4A3LG 2YTVA 2UXDQ 1EY9A 3ERQA 4X65L 1D5XC 1EQVA 2F1MA 3CMAA 3SK4A 1XNRL 4LUZA 1B70B 4OO1H 1XPRA 1E3PA 2FHTA 4RWSC 3CW2C 3H0GH 2PI2E 4CHTB 1WD0A 1FJGL 3I4NH 2VNUD 1EUJA 1PTOF 2EE1A 1SE8A 1BO0A 2EDGA 1LTBD 3H3VI 4R4TA 5CGKA 3I55A 1PA6A 4DA2A 4QQBX 4WJ3M 1TU2B 3MXPA 1EQRA 4Y7NB 5EKIA 4OO1G 2B2UC 2CW0D 4WFN3 1EIYB 2KCTA 1IYVA 1B3AA 3D3RA 3H0GG 1D1KA 1IKLA 1DOMA 1QJOA 3KUPA 2MFIA 2O5IC 3TMEA 5ELNA 4HR7B 4R4OA 1UE6A 3T51B 1TWFB 4DR7L 4S3SA 3I4NG 2XRSD 2D0PA 3K8AA 2JJQA 1XNQL 2NZ1D 4H02A 1QILA 1NNXA 3TP6A 1E2WA 2A6EC 1AEXA 1QUQA 1Y1WB 1T5XD 3BDOA 2IWHA 1A62A 4JI0L 1YEZA
chains in the Genus database with same CATH topology
5IGGA 1SNDA 4FF4A 1JOQA 1Q1EA 2E76C 1BCPB 2Q8RE 3M7GA 2F0DA 3NTKA 1SYDA 2F0HA 1CTMA 5T1IA 1PRTB 5M5YB 1JE4A 3K0YA 5FLXL 2JA8B 3GV3A 4DK0A 4XQNA 2NB0A 1HQRD 1EY5A 2HDLA 1IYUA 3LNNA 4RKLA 4ULLA 4FYDA 1S5DD 3HEJA 4ZK9B 1IHZA 1CK1A 3TP8A 2JP1A 3DEPA 2L55A 4UDUC 1H9JA 4IFDH 4A3MB 3MXGA 1F9RA 1RTNA 2FMCA 2AWOA 1C8CA 1J8IA 1F9SA 4O1NA 2XSCA 1B53A 2HCCA 3KBGA 1DXMA 4Q0FA 4PMWA 1U4LA 1HTPA 5IOCA 1B50A 2EJFC 3GTLB 5CV6A 3NE5B 1JWUD 1DCZA 4IFDG 2MUYA 1TIID 3N52A 3EVQA 1KNEA 1X3QA 2F0TA 2WINB 1ZYRD 3D4DA 4BY7B 3J7AV 1CQVA 2F0NA 4IQZA 1ILQA 1S5BD 2K7VA 3A54A 1EY7A 1GUSA 1M8AA 3IAYA 3BZDB 1YNJC 3S1QB 2TMPA 4QCLA 3NP8A 2R61A 1ET6A 3HOYB 4E6IA 5FOBB 5ISRA 1TWGB 4G7OC 1JCKB 3FMCA 2K5WA 1Y8OB 2A6HD 4C2MB 5JEAJ 3DWPA 5DEHA 1ICWA 1LTAD 3CQZB 1B9MA 2LMCB 1A6XA 3S14B 1ESFA 5ELEA 2LY7A 2FINB 4DK1A 3D6CA 1CT1D 5ELCA 2DNEA 3MXUA 2F3VA 2K01A 4QB4A 1KDAA 1NR4A 4I65A 2F0OA 4BA1I 2SNSA 3EFXD 1ENFA 2XN9C 1L0YB 1EIGA 1SNOA 1BQQT 2KOLA 2SNMA 1U4RA 2BDNA 5M9OA 1K8MA 1LACA 3K59A 3NUCA 3DHQA 1GOZA 5I2XA 1SAPA 2QCPX 3T16A 1LTRD 2E2DC 4L6TB 3PUYA 5NUCA 1FD7D 1Q8IA 2JXMB 1MSGA 1SYFA 2EYPA 3T4AC 1O80A 3DUZA 1LO5D 1PTOB 4ZKCB 3L3OC 2Z8LA 4B08A 1R9TB 5IODA 1D5MC 2O5JC 2JA5B 4CKBA 1EYAA 1FYCA 3R8BA 1SDFA 5K5PA 4XQQA 3MHBA 1FR3A 1PZJD 4B9XA 1I4PA 2J0TD 2F0LA 2WKDA 4XIGS 5I6YA 2A68D 4X3SA 4DU9A 3HOXB 5ELDA 1Z6HA 1CA5A 2WKCA 2IL8A 1SE3A 2PO4A 2EJGC 2EZVA 5A35A 2L12A 1RTOA 4DAYA 2Z4IA 2RKSA 1RJTA 2MHVA 1TWHB 4V190 2SDFA 2F0PA 4CJ2C 1TVXA 3D31A 2JYOA 5C4XB 3NTHA 4IUPA 4FF2A 2M00A 2F0FA 3WOFA 3SK5A 4DN4M 1STHA 3NPPA 4G7HC 4KHZA 1SNPA 5T1GA 3VR5A 3OW7A 3OWEB 2BE5C 1BNZA 5EPLA 2SOBA 4FF1A 3IFTA 4RA8A 1TS4A 4RH6A 2N88A 2F0JA 2NTSA 2V4DA 3E5SA 4C3JG 2Q8IB 1EEFD 5C4ZA 4DAVA 4DF7A 1Y8NB 4RGMA 3I8ZA 4NDXA 2JSOA 4DGZA 1KDCA 3V05A 5TSSA 3U9OA 3J81L 4ILWA 2WACA 5M3MB 4KD3A 1TS5A 2KCNA 3HKZB 3IL8A 4A3FB 4CJ1B 2HCIA 4ME5A 1Y69U 3NXWA 2TSSA 2VXWA 3TN2A 5E4XA 4FVMA 5JOBA 1WTRA 1WTWA 2PZTA 4BBSB 4C56C 1R4PB 5CR3A 4IUNA 3MZ5A 1QG7A 3HRZC 2A73B 3CKIB 4M8AA 1G8ZD 5IGDA 3H91A 4G7ZC 2LFNA 4A3BB 4J8QA 4K5VA 5E3FA 1ESRA 1AW7A 5C3XA 5A2QE 1KDBA 1C4QA 1E2ZA 3DWAA 4P2CB 2B8GA 1STBA 3HS0C 3WOEA 4C3HB 1EU4A 3I3CA 3OOCA 3OMGA 5ELBA 2NN6H 4ZRZA 1XXGA 5KYIA 3BYYB 3J7YW 2IX1A 1S5FD 1K83B 5DM73 4O42A 4KN7C 1A3TA 2EYHA 5C0XH 3MFYA 2ZXRA 1Z7TA 2RVLA 3MTSA 2JA7B 2F0SA 2RBMA 1HQMC 1PFNA 4G57A 4F7XA 4ODGA 4ABNA 3G6JB 1SSOA 1VMPA 3HZXA 1I4GA 2JA6B 1V1PB 4OO1I 1F2YA 4F87A 1IW7C 1EIHA 4KKTA 1SYBA 4K5WA 2IPKD 5ELFA 3T13A 3PUZA 4QF4A 3X3MA 2B2YC 3NBHA 3R93A 5I9OA 4TSSA 2YYZA 1SJED 5C0XG 3C3LA 5BN3A 3OHXC 4RCNA 4HMIA 2F0MA 2ENBA 2RSOA 2ZT9C 5I4DA 2A6ED 1RODA 4FO2A 5JJZA 2EYMA 5C6AA 3VYSA 1XTCD 1JWSD 3C1FA 1NR2A 3SVMA 1NUCA 2RQXA 3LX0A 2K28A 3GV6A 2G9HD 3URYA 3BDLA 3VR6A 2F0VA 1EZ6A 5CBAE 3D4RA 3ONAB 3V96A 4DXGA 3K57A 4R8IA 1F2MA 1SEBD 1D5ZC 1WD1A 2WV6D 2QF7A 1JICA 4MN3A 1WTOA 1X3PA 3A7LA 5EKKA 1Q3LA 5C4HA 1JORA 4A3DB 1SE4A 5I6WA 3SK8A 1Q90A 1DOKA 3S2DB 4FXGC 1S5ED 3TP5A 3A8IE 1C48A 5LL6X 3DM1A 1F2ZA 2C9OA 4R9WA 2EYLA 4K2KA 1QCBD 4XT1B 5FO7B 2QDBA 1OXTA 2XWBB 1BDOA 1F9PA 1JR0D 2LS01 1KLGD 3K5LA 1OXSC 3J80L 1LTGD 3MWYW 1B2TA 3GTQB 3MEHA 4IFDI 3KK7A 1SYEA 4X3TA 1SXTA 2F03A 4KI0A 1LT6D 2AQ3B 2EYOA 5HGTA 5K36H 3EROA 4EQPA 2B2WC 4RCOA 1ILPA 1ML0D 5JPNC 4ZYSA 3H09A 1PYWD 1ZXTA 1SMYC 5I9PA 1YNJD 3J7AF 1KTKA 3QIAA 1ONLA 1UEAB 3EQLC 3H0GB 2NVQB 3M3YB 4IALA 2HDMA 3R3OA 3BS1A 3SK6A 3I4NB 5CORA 5D14A 1JOKA 2L4NA 5K36G 1ENCA 1HTLD 4KK7A 3SE0A 2B2TA 4RFBA 3KBXA 3TBIB 1GJXA 2J7ZA 1S4ZA 4XT3B 4H13C 1BCPC 1PZID 3OPOA 1PRTC 5JPMC 4LK1C 3ITPA 2LKVA 4OIJA 4N9PA 2HQEA 4CBVA 3QO2A 2F4IA 1VF7A 3TZUA 1Z47A 1RHPA 1A3UA 1BXTA 3MC0B 2BDOA 3EA6A 4A93B 1W6KA 2YU9B 1K8OA 2MJ8A 2IT1A 3L9AX 2DNCA 3PO2B 4NW2A 5IGEA 3GO5A 2R6GA 4C3IG 1EFID 4K6LA 5FO8B 1CI3M 3S1MB 1AP0A 4J1MA 3Q23A 2ZXOA 3I91A 1AZQA 1RF2D 2M9VA 1KAAA 2K04A 2L1BA 3OIQA 2DN8A 4XYQA 3NSWA 2KQ3A 2VB2X 3I72A 1VF5C 4TKOB 5G3LF 2EY5A 3KLSA 5EGTA 1WVLA 1QOHA 3K7AB 3D4WA 4RGTA 2MP1A 1JC7A 4DFAA 3A55A 1H9MA 2RDFA 3H3VC 1MI2A 3AMUA 3Q6SA 5JEAH 3GD7A 1U4MA 4IURA 1W6JA 4NP5A 4QIWB 2L0CA 2EY6A 4BS9A 3TP7A 3D6WA 1TY2A 4MIUA 5CMDA 1EYDA 1BOSA 4HMJA 1HHVA 2PZUA 1F9QA 3S9WA 2B8FA 1T5EA 3CRLC 3SEBA 2PPBC 1CHPD 2RDGA 5JEAG 2BE5D 1WTPA 3E6ZX 2FFKB 1GUWA 1LT4D 4V0BA 2B2TC 3I73A 2KUMA 3VR2A 2X6LA 1LT3D 1A15A 1MGSA 4DNTB 1JB3A 1BF4A 5A2QL 1SJHD 4K2LA 4K6DA 3L7ZC 2R93B 4XTCS 1ZKOA 2EYJA 5LL6S 2K5QA 4IUTA 3RZOB 1I4QA 1HRJA 1S5CD 1M4VA 4RKBA 5HURA 5IIFA 4FP5D 1FNWA 2ICEC 4L63B 1I6HB 1IL8A 3QOLA 4H0LC 5E1FA 1VDZA 2K33A 1OO9B 4HSPA 1KABA 3KLRA 3S1RB 4K8IA 3I90A 1X32A 4ID6A 5EPKA 3VR3A 3C46A 3O13A 5EBCA 2B39A 3GP7A 1FGBD 1PTOC 3VYTA 2WIIB 2EOTA 2DY8A 4RGOS 4H44C 1GUTA 3OIPA 5JVH3 5EPJA 3BYTB 3BG3A 2B2VA 1STEA 5C5MA 1A3VA 2R92B 4FF3A 3GTJB 2F0KA 5IT9E 1I6VC 2NUCA 1LTTD 3MVVA 1HA6A 1FNUA 1WTQA 1BBXC 4LMQD 4IUVA 5JVG3 1I3QB 1XYIA 4EVOA 3AB9A 3BVMA 1EL0A 2EJMA 1O78A 3M85A 4ZLTF 3IFDA 3WDNA 5KYLA 4M1UB 5J22A 1V1PA 5CV4A 3GTOB 2E2HB 3NWTA 3OWFA 2PYKA 1U9RA 1O7YA 1STNA 2ICIA 2L5TA 4C1NI 1D6EC 1EYCA 1LTSD 1QWYA 3ND8A 2F0WA 4YIJA 1EWCA 1IW7D 2EVBA 3MXNA 4NMZA 2PW5A 3A8KE 2B2UA 1DJRD 1SNMA 4DXFA 4C3JB 4BBRB 5C3WA 3NTIA 3PUWA 5C0XI 3H94A 3EJIA 1WCMB 2NVTB 4Z9CB 3P75A 1BUVT 1YNNC 1O7ZA 1DYQA 3QB3A 2WP8J 4C1NK 3N6RA 1KLUD 2EY2A 2F0EA 1GUOA 3SXHA 3T56B 4X3UA 1AN8A 2NVXB 2JEBI 5COYA 2G9DA 3GTMB 4H7BA 2SEBD 1GXDC 4FXDA 2E2JB 1CHQD 3BVZA 1PFBA 3DEOA 4X3KA 2I46A 5FK9C 5KNDA 2F0IA 2Z4HA 5CV5A 3NHHA 4KJNA 2NWGA 3UI2A 3X3NA 2IJ0A 4J6HA 1E2VA 4GZYC 2K6AA 2NN6G 3I70A 1KNAA 2R7ZB 5DNFA 1PZKD 1TWAB 4TRDA 3S1NB 1OXUA 4XXEA 1EY6A 3KF8A 2J4XA 3NQTA 1DD2A 1CA6A 2CQAA 5J39A 1CFMA 4DNRB 2A69C 2XIWA 3Q22A 1G2SA 2KHSA 2K5DA 2RA4A 3AU7A 4A3JB 4HN7A 4U68A 1MSHA 2M2LA 5D3DA 1TS3A 3CRKC 1NAPA 3QWNA 2IX3A 3DMUA 4KKSA 4K8JA 3JAME 3W2DA 3M4OB 2EPBA 3MFGA 3FDTA 3LWUA 4R8NA 3J81E 2PQEA 1EY4A 3G7LA 1Y8PB 1I4XA 2Z1CA 1SMYD 1I4RA 4BWGB 4A3IB 2A74C 1UUPA 3FPPA 3V2TA 1HPCA 4A3GB 1TS2A 4HCEA 2H4OA 1PMRA 1SFOB 3HOUB 4KJOA 4KY6A 3R2TA 5EBDA 2RSNA 3FPUB 2C5CA 1HUNA 2AQ1B 1H9RA 3PIO3 4IN3A 4OGQC 2DY7A 4IUUA 1NCVA 3RLFA 1STAA 4Q5VA 3PV0A 3NK9A 1BCPD 3FKIB 1R4QB 1PRTD 2KVMA 4OHJA 3GQBA 1HFGA 1JQYD 1H9SA 4EQOA 5IGCA 1L0XB 5KGUA 4RHSA 1QE6A 5EQ0A 3K58A 2XWJB 3ND9A 1GUGA 1DOLA 2F0UA 4IFDJ 3I4MB 2O2LD 4OIKA 5EKLA 1ZEQX 1G2TA 1VMCA 4LJZC 3VYUA 5E4WC 4KY5A 2NYZD 2NTTA 1D1IA 1RCVD 3BVGA 3LWEA 2WAQB 3OMCA 4ZAIA 4KY7A 1B1ZA 3RUZA 4PMCA 4PNYA 2QKIC 5IGFA 3HG9A 3P1HA 3NWSA 5M3FB 1RDPD 3PMFA 1EU3A 2CW0C 2D62A 4ZQ3A 1LABA 3E0JA 2K1BA 1JWMD 1II3A 3Q0AA 3TZDA 4UAIA 2KJXA 4RGNA 3K6OA 3C2PA 3R2IA 4BA2I 4CKCA 1EEID 1DM0B 1MD2D 4JBWA 4WRDA 3MAQA 2N55A 3QOJA 1UAPA 3U9SA 3F2UA 2VUMB 3FVQA 2X69A 1H9SB 4CKEA 2PZWA 1JOOA 4QUFA 4PMBA 5D65A 5JAVA 1HXYD 1U4PA 3FEWX 1B9NA 1OXXK 3MA2B 1G6ZA 1PTOH 4F8MA 2AQ2B 2X6GA 4KMUC 2FMMA 5CV9A 1LLRD 1EOTA 1EY0A 2HUGA 1B4OA 4HEDA 1NSNS 4BY1B 2IX0A 1LV9A 4TQUS 2L11A 2PNRC 3QJYA 4PV1C 4ZUJA 3A56A 1Q1BA 2NVYB 1QNUA 1GUNA 3HOVB 1TT2A 3J80E 3VA5A 5IT9L 5KNBA 3T53B 4JK1C 4KN4C 1GHJA 2L9HA 1HFNA 4IZ8A 2EY1A 4KV6A 1H9KA 1F77A 2PCFB 4RHRA 1I4HA 2WB1B 5FLXE 1HCZA 5CV7A 2BA1A 1PXUA 5BN5A 1ZYRC 4XQJA 3P7JA 1BR9A 3C1EA 4CJ0B 4HCSA 2EXZA 1EY8A 1AFPA 3VYRA 5LHY1 4C3IB 3FRPB 5KIXA 1EZ8A 4B9WA 2H1EA 3TDQA 1Y1VB 2JEAI 2ZXPA 2KEEA 1PTOD 3W3AA 3RD4A 1QB5D 5KNCA 3RZDB 5KEEA 1FNVA 2D2CC 3P20A 3PIP3 2QEJC 5DAUA 1F2LA 1EWHA 3SDZA 2O4XA 3DWQA 2Q8TA 2VB3X 1SBBB 3D8GA 3S17B 3I4LA 2A6HC 1V1OA 5C44B 3DXJC 4U673 3GTKB 3A8JE 1J9OA 4FNFA 4A3EB 4ZUIA 1DONA 1TWCB 1CZGA 2BCOA 5FO9B 2OF1A 2R3ZA 2EYFA 1PFMA 1G291 3SR1A 3Q24A 3HOWB 4NKLA 2KEDA 4N9TA 5D3IB 1V43A 2FJ2A 1GHKA 2ID0A 5I2YA 3BDCA 2KA7A 2OEOA 2RDHA 2K05A 4FXKC 1SNCA 3OSOA 3HP3A 2MGSA 1LTID 5CBEE 1XX8A 2NBFA 4WJWA 1YNND 2B2YA 2E2IB 1ENAA 1BCPF 3ZYYX 5FKAC 1PRTF 1VCIA 1TR5A 1TKWB 2CVRA 3RMHA 4XYOA 1WTXA 1PLFA 2JE6I 5CV8A 1O7LA 5C5LA 2QILA 1V8QA 2IW3A 1PDQA 1TQOA 2F0QA 4OL7A 4HSVA 1WTVA 5EJWA 1B44D 3PUXA 4EGVA 3JAML 1SNQA 4C3HG 1OXVA 2A68C 1SYCA 3NQIA 3M7NA 1HUMA 1ET9A 2Y0SB 3A7AB 3S15B 4KKUA 1AZPA 2NN6I 3S2HB 2BA0A 4PQXA 3K5NA 1XWEA 3TSSA 5F2DA 1E0BA 1IKMA 2KCCA 1RKNA 2KECA 1DZ1A 3HOZB 5IGBA 1QNKA 2A69D 4LAAA 4K14A 2E74C 2XNAC 4F88A 1TY0A 1Q12A 2AUJD 4L8JA 2PW7A 4HAEA 3K5MA 2K03A 4WORA 3VA7A 1STGA 2A5HA 4MHEA 2D9UA 4DAPA 1RD9D 5BN4A 2E75C 5C0XJ 1CM9A 1CQFA 1HA5A 3S16B 2XRQD 2CHBD 2F3WA 2PMZB 2AWNA 3K5OA 5G3LD 1UNSA 3CU7A 1SE2A 3IKJA 2AUKA 1SYGA 5M5XB 2B2WA 1LT5D 2B63B 5C3EB 3GTGB 1MBYA 1CZWA 5C4JB 3HGBA 3QG1A 4XDXA 4HTHA 4CGYB 2XVSA 1A2UA 2GA4B 1G91A 2K32A 5KRUA 3GTPB 4A3KB 4AYBB 3CHBD 5CC4A 5AFWA 2D5DA 5DM63 2BOSA 3H6MA 3KLSX 3VR4A 3PUVA 5M5WB 2F0GA 4KD4A 4I7ZC 4EQNA 4IUQA 1D2BA 4QUCA 4RAUC 2B2VC 2OT2A 4G4KA 3M4YA 4ZKBB 4K5XA 3PO3B 2OXPA 4KTAA 4QMGA 1A2TA 5CYUA 2I07B 3NBIA 1EQTA 5J1ZA 4KHVA 2MPMA 1I50B 3SHLA 1STYA 1EY9A 3ERQA 1D5XC 1EQVA 2F1MA 3SK4A 4OO1H 2FHTA 4RWSC 4CHTB 1WD0A 2VNUD 1PTOF 2EE1A 1BO0A 2EDGA 1LTBD 5CGKA 4DA2A 1TU2B 3MXPA 4Y7NB 5EKIA 4OO1G 2B2UC 2CW0D 4WFN3 1IYVA 1B3AA 3D3RA 1D1KA 1IKLA 1DOMA 1QJOA 3KUPA 2O5IC 3TMEA 4HR7B 3T51B 1TWFB 4S3SA 2XRSD 2NZ1D 1QILA 3TP6A 1E2WA 2A6EC 1AEXA 1Y1WB 1T5XD 2IWHA 3BDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BZD B;  1LO5 D;  4RGM A;  1PTO B;  1TY2 A;  1PRT C;  2Z8L A;  1AN8 A;  1BCP B;  1I4R A;  4BWG B;  3V05 A;  5TSS A;  3BYT B;  1RDP D;  2R61 A;  1ET6 A;  1D5M C;  1STE A;  1EU3 A;  1UUP A;  1PRT B;  5D3I B;  1JR0 D;  3R8B A;  1TS5 A;  1F77 A;  1I4G A;  1JWM D;  2XNA C;  1V1P B;  1TS2 A;  2SEB D;  1KLG D;  4RHR A;  1TY0 A;  1CHQ D;  3BVZ A;  3SEB A;  1JCK B;  1LTG D;  1I4H A;  1HQR D;  1LTT D;  1PZJ D;  5FK9 C;  1FNU A;  1I4P A;  1D5X C;  2IPK D;  2RDH A;  5ELF A;  1CHP D;  3R2T A;  1BXT A;  1S5D D;  2TSS A;  2RDG A;  3EA6 A;  3MC0 B;  4RGN A;  4TSS A;  2IJ0 A;  1SJE D;  3R2I A;  1CK1 A;  3DWP A;  5ELD A;  1EEI D;  1LTA D;  1RD9 D;  1SXT A;  1MD2 D;  3BVM A;  2AQ1 B;  4UDU C;  1LT6 D;  1LT4 D;  4C56 C;  2AQ3 B;  1LTI D;  1HA5 A;  1ESF A;  2XRQ D;  1SE3 A;  4RCO A;  5ELE A;  5I4D A;  2CHB D;  1PZK D;  1LT3 D;  1PTO F;  1BCP F;  1G8Z D;  1CT1 D;  1UNS A;  5ELC A;  5FKA C;  2J4X A;  1PTO D;  1SE2 A;  4ZYS A;  1LTB D;  1JWS D;  1PYW D;  1EFI D;  1BCP D;  1SJH D;  1V1P A;  1PRT F;  1XTC D;  4K6L A;  4O1N A;  1KTK A;  2ICI A;  1LT5 D;  1D6E C;  1PRT D;  1FNV A;  1AW7 A;  4OHJ A;  2QEJ C;  1LTS D;  1JQY D;  3EFX D;  1I4Q A;  1ENF A;  1RF2 D;  2XN9 C;  1L0Y B;  2G9H D;  3DWA A;  3URY A;  1S5C D;  1HXY D;  1M4V A;  2QIL A;  1L0X B;  1EU4 A;  4RHS A;  3DWQ A;  4DXG A;  1SEB D;  1D5Z C;  1EWC A;  2WV6 D;  1JWU D;  1SBB B;  5ELB A;  1B44 D;  3CHB D;  4RGT A;  1FNW A;  4L63 B;  1GOZ A;  2O2L D;  5D3D A;  1HTL D;  1PTO H;  1XXG A;  2XRS D;  1TS3 A;  3OWE B;  1ET9 A;  1V1O A;  1DJR D;  4DXF A;  2AQ2 B;  1LTR D;  3BYY B;  4L6T B;  1TS4 A;  4RH6 A;  1SE4 A;  4RFB A;  3KLS X;  1QIL A;  1LLR D;  1S5F D;  1CQV A;  3W2D A;  1FD7 D;  3MFG A;  4Z9C B;  2NTT A;  2NTS A;  3BVG A;  1RCV D;  1S5B D;  1EEF D;  1S5E D;  3O13 A;  1DYQ A;  3GP7 A;  1FGB D;  1T5X D;  1PTO C;  3TSS A;  1BCP C;  4RGO S;  1I4X A;  1KLU D;  1PZI D;  1B1Z A; 
#chains in the Genus database with same CATH topology
 5IGG A;  1SND A;  2ZTC A;  4FF4 A;  2YU9 H;  1JOQ A;  1Q1E A;  5IE8 A;  2E76 C;  1BCP B;  2Q8R E;  3M7G A;  4DR5 Q;  1MJC A;  4HJ9 A;  1PH6 A;  2F0D A;  3NTK A;  1SYD A;  2F0H A;  1CTM A;  5T1I A;  3WWV A;  1PRT B;  5M5Y B;  1JE4 A;  3K0Y A;  5FLX L;  3U58 A;  3PO2 H;  2JA8 B;  4HJA A;  1JMC A;  2GVA A;  2KHJ A;  3GV3 A;  4DK0 A;  4XQN A;  4JI3 Q;  2ZM6 Q;  2NB0 A;  1HQR D;  1EY5 A;  2HDL A;  1IYU A;  3LNN A;  4RKL A;  4ULL A;  1U5K A;  4FYD A;  2RF4 A;  3TEH B;  3S1M H;  1S5D D;  3HEJ A;  3T1H Q;  4ZK9 B;  1IHZ A;  2I5L X;  1CK1 A;  3TP8 A;  3PIP A;  2JP1 A;  3DEP A;  2L55 A;  4NXM L;  4UDU C;  1H9J A;  3CCR A;  4A3M B;  4IFD H;  4A93 G;  1ICF B;  3MXG A;  1F9R A;  2Z0S A;  2VZA A;  1RTN A;  4OWT B;  2FMC A;  2AWO A;  1C8C A;  3K7A H;  3PO2 G;  1J8I A;  2NVY H;  1F9S A;  1XTD A;  4O1N A;  2XSC A;  1B53 A;  1SLJ A;  2HCC A;  3KBG A;  1DXM A;  4Q0F A;  4PMW A;  2GVB A;  1VQA A;  4JI6 Q;  1U4L A;  1A63 A;  1A8V A;  1HTP A;  5IOC A;  1B50 A;  2EJF C;  3GTL B;  5CV6 A;  1PH7 A;  3NE5 B;  3CME A;  4LNQ A;  1EIF A;  1JWU D;  1DCZ A;  4IFD G;  2MUY A;  3KDF B;  3B6Y A;  4LF4 L;  1TII D;  3N52 A;  3EVQ A;  1KNE A;  1X3Q A;  4YHH L;  2N49 A;  2F0T A;  2WIN B;  1ZYR D;  3D4D A;  4GNX C;  4CDE C;  1WFQ A;  1GVP A;  4BY7 B;  3J7A V;  1QUQ B;  1CQV A;  2F0N A;  1WYD A;  4IQZ A;  3AFQ A;  1ILQ A;  1S5B D;  4FDB A;  4B3M Q;  3PF4 A;  2K7V A;  3A54 A;  1EY7 A;  3DLL A;  4KHP Q;  1GUS A;  2OCE A;  1M8A A;  3IAY A;  3BZD B;  1YNJ C;  2A8V A;  3S1Q B;  1XPU A;  2TMP A;  4QCL A;  3NP8 A;  4OON A;  4I7A A;  2R61 A;  1ET6 A;  4JCV E;  3HOY B;  4E6I A;  5FOB B;  5ISR A;  1LYL A;  1TWG B;  1IBM Q;  4YCU A;  3G6E A;  4G7O C;  1JCK B;  1QVF A;  3FMC A;  1LUZ A;  2K5W A;  1Y8O B;  4JI2 L;  4X65 Q;  2R93 H;  2A6H D;  1GKH A;  3Q8D A;  3BJU A;  4C2M B;  2MNA A;  2UUB L;  5JEA J;  3DWP A;  5DEH A;  1ICW A;  1MIU A;  1LTA D;  4OXP A;  3RZO H;  3CQZ B;  2F52 A;  1B9M A;  2LMC B;  4P71 A;  1K3R A;  1A6X A;  3S14 B;  3CCE A;  1XMO Q;  1VQC A;  4GOP A;  1TXY A;  1ESF A;  5ELE A;  2F3I A;  2LY7 A;  2FIN B;  4DK1 A;  3D6C A;  1KC8 C;  3CCV A;  1CT1 D;  3U4Z A;  5ELC A;  2DNE A;  5FLM H;  3MXU A;  1I6H H;  2F3V A;  2K01 A;  4QB4 A;  1KDA A;  1NR4 A;  4I65 A;  2F0O A;  4BA1 I;  1VQ7 A;  1PHJ A;  5GAD C;  2HD3 A;  2SNS A;  3EFX D;  1ENF A;  3F2D A;  3S1R H;  5HGQ A;  1YI2 A;  1X56 A;  1L0Y B;  2XN9 C;  2R93 G;  1EIG A;  1SNO A;  1BQQ T;  1HH2 P;  2KOL A;  2SNM A;  1U4R A;  2BDN A;  5M9O A;  1K8M A;  1LAC A;  2PNH A;  3K59 A;  3NUC A;  3DHQ A;  1GOZ A;  4HJ5 A;  1HZB A;  5I2X A;  1SAP A;  4DR7 Q;  2QCP X;  3T16 A;  2GN5 A;  1LTR D;  2JQO A;  1JT8 A;  2E2D C;  4L6T B;  5FLM G;  3PUY A;  2R92 H;  1XNQ Q;  1IBL L;  5NUC A;  1FD7 D;  1Q8I A;  2FXQ A;  3GTJ H;  1VQ8 A;  2F4V L;  4LF8 L;  1L1O C;  2JXM B;  1KHI A;  1MSG A;  1SYF A;  2EYP A;  3T1Y L;  1E7Z A;  3STB C;  3T4A C;  1O80 A;  3ERS X;  5ELO A;  3ULL A;  4CDC C;  2UU9 L;  3DUZ A;  1YBY A;  1LO5 D;  3K0X A;  1I3Q H;  1PTO B;  4ZKC B;  3L3O C;  2Z8L A;  4JI0 Q;  4B08 A;  1R9T B;  5IOD A;  4DV0 L;  2IHE A;  1LM0 A;  1D5M C;  2O5J C;  2JA5 B;  4CKB A;  1EYA A;  1FYC A;  4DUZ Q;  3R8B A;  1SDF A;  1PYB A;  5K5P A;  5IP7 G;  3LGJ A;  2R92 G;  4XQQ A;  3MHB A;  1FR3 A;  1PZJ D;  4B9X A;  1K3B C;  1I4P A;  2MQH A;  2J0T D;  2E2H H;  2F0L A;  1T9H A;  2WKD A;  1VQK A;  4XIG S;  5I6Y A;  2A68 D;  4X3S A;  5IT9 c;  4GOP B;  4GLV B;  2OQ0 A;  4DU9 A;  3HOX B;  4IPC A;  5ELD A;  1Z6H A;  3RLO A;  1CA5 A;  3CCU A;  2WKC A;  1N32 L;  4L5T A;  2VW9 A;  4DV3 L;  3S2H H;  2IL8 A;  2MO1 A;  4NXM Q;  4JI1 L;  1SE3 A;  1N8R C;  2PO4 A;  4JBM A;  2EJG C;  2EZV A;  2AKW B;  1CKN A;  4LUO A;  5A35 A;  3UDI A;  2L12 A;  1RTO A;  4DAY A;  1EOV A;  2Z4I A;  2RKS A;  1RJT A;  4JBJ A;  1LTL A;  2K50 A;  2K75 A;  2MHV A;  3HKZ G;  3RLN A;  1TWH B;  4V19 0;  2SDF A;  4C3J H;  2F0P A;  4BBR H;  4CJ2 C;  1TVX A;  1VQG A;  3D31 A;  4A3F G;  2JYO A;  5C4X B;  3NTH A;  4IUP A;  4FF2 A;  2M00 A;  2F0F A;  3WOF A;  1DGS A;  1FGU A;  3SK5 A;  4DN4 M;  1YHQ A;  1STH A;  2YTX A;  3NPP A;  4G7H C;  4DV2 L;  2IHF A;  4KHZ A;  4J15 A;  1SNP A;  3FP9 A;  5T1G A;  3VR5 A;  3OW7 A;  3OWE B;  2BE5 C;  2NVX H;  2XGT A;  1BNZ A;  4PZ7 A;  5EPL A;  2SOB A;  4FF1 A;  3IFT A;  2G5D A;  4O0A A;  4DNI A;  4RA8 A;  4YHH Q;  1TS4 A;  4RH6 A;  4DV5 L;  2N88 A;  2F0J A;  1GO3 E;  2NTS A;  2V4D A;  1QZH A;  2I5H A;  3E5S A;  4BBR G;  4C3J G;  2E2J H;  2Q8I B;  1EEF D;  5C4Z A;  1P8L A;  3CC2 A;  1WCM G;  4DAV A;  4DF7 A;  4A4I A;  1Y8N B;  1B7Y B;  5M5X H;  4RGM A;  4LFA L;  3I8Z A;  4NDX A;  2JSO A;  1BBU A;  4DGZ A;  5C3E H;  5C4J H;  1KDC A;  3V05 A;  5TSS A;  2VS1 A;  3U9O A;  3J81 L;  2HQL A;  4ILW A;  2WAC A;  5M3M B;  4KD3 A;  1TS5 A;  2KCN A;  1QVG A;  3HKZ B;  1TWA H;  2DUD A;  3S1N H;  3IL8 A;  3GTP H;  4CDF C;  4A3F B;  4CJ1 B;  5EAY A;  2HCI A;  4ME5 A;  1Y69 U;  3NXW A;  5IP9 H;  2TSS A;  4B3T L;  2YV5 A;  4DR5 L;  2VXW A;  4JI2 Q;  3TN2 A;  3CAM A;  4FVM A;  5E4X A;  5JOB A;  1WTR A;  1WTW A;  3F1Z A;  2PZT A;  4BBS B;  4C56 C;  1R4P B;  5CR3 A;  3PIO A;  4IUN A;  3MZ5 A;  1PVO A;  1QG7 A;  3HRZ C;  2ZM6 L;  3UE0 A;  2A73 B;  4A3J H;  1OTC A;  3CKI B;  4M8A A;  1G8Z D;  5IGD A;  1FVI A;  3H91 A;  4G7Z C;  3T1H L;  2R7Z G;  2LFN A;  4A3B B;  4J8Q A;  4K5V A;  5E3F A;  4OX9 Q;  1ESR A;  3CXC A;  1AW7 A;  5C3X A;  5A2Q E;  1KDB A;  2QW7 A;  5IP9 G;  3M4O H;  1C4Q A;  1E2Z A;  3DWA A;  4UP8 A;  1BVS A;  4P2C B;  2B8G A;  1STB A;  3HS0 C;  3WOE A;  4DPG A;  4C3H B;  1EU4 A;  3I3C A;  3OOC A;  3A0J A;  3OMG A;  5ELB A;  5HY6 A;  2NN6 H;  4NB3 A;  4ZRZ A;  3CP0 A;  1XXG A;  4A3J G;  3J81 j;  5KYI A;  4A3I H;  3BYY B;  4IJH A;  3J7Y W;  1HNZ L;  2IX1 A;  1S5F D;  4A3G H;  3I4O A;  1K83 B;  4QGU A;  1JJC B;  4AQY Q;  5DM7 3;  4O42 A;  4KN7 C;  2F4V Q;  1A3T A;  2EYH A;  5C0X H;  3HOU H;  5GQO A;  3MFY A;  2ZXR A;  2OTJ A;  3T1Y Q;  3JAM c;  1Z7T A;  2AMC B;  1NY4 A;  2RVL A;  3MTS A;  2JA7 B;  2F0S A;  2RBM A;  1PYS B;  2UU9 Q;  1HQM C;  1O7I A;  1PFN A;  3J81 c;  4G57 A;  4F7X A;  4ODG A;  4ABN A;  4X64 L;  4DV0 Q;  3G6J B;  1SSO A;  1VMP A;  3HZX A;  1PH5 A;  1I4G A;  1X55 A;  4B3M L;  2JA6 B;  1V1P B;  4OO1 I;  1F2Y A;  4F87 A;  4A3D G;  1IW7 C;  1EIH A;  4YCW A;  4KKT A;  1K0S A;  2A1A A;  1SYB A;  4K5W A;  2IPK D;  4PZ8 A;  5ELF A;  3H15 A;  3T13 A;  3PUZ A;  3KJP A;  1YJW A;  4DV1 Q;  4QF4 A;  3X3M A;  2B2Y C;  1UEB A;  3NBH A;  3R93 A;  5I9O A;  4TSS A;  5L37 A;  2YYZ A;  1SJE D;  4OEL B;  5C0X G;  1EWI A;  3HOU G;  1X54 A;  4RG1 A;  3C3L A;  5BN3 A;  3OHX C;  2PMZ E;  4RCN A;  4HMI A;  4EQ5 A;  1IBM L;  2F0M A;  4P73 A;  2ENB A;  1IL2 A;  2RSO A;  4POG A;  2ZT9 C;  2D0O A;  5I4D A;  2A6E D;  1ROD A;  4JI1 Q;  4ALP A;  2HHH L;  1E1O A;  4FO2 A;  5JJZ A;  2EYM A;  5C6A A;  1PFS A;  3VYS A;  1XTC D;  1JWS D;  3I4M H;  3C1F A;  1NR2 A;  1JB7 A;  4APV A;  1NMG A;  3SVM A;  4LFC Q;  1NUC A;  2RQX A;  3LX0 A;  1EYG A;  2K28 A;  1XMO L;  3GV6 A;  1EQQ A;  4BXX H;  3M4P A;  2G9H D;  3FKI G;  3URY A;  5GRO A;  3BDL A;  1KL9 A;  3VR6 A;  2F0V A;  4JI4 L;  1EZ6 A;  5CBA E;  3D4R A;  3ONA B;  1FL0 A;  3V96 A;  4DXG A;  5AJ3 Q;  4R8I A;  3K57 A;  1F2M A;  1SEB D;  1D5Z C;  1WD1 A;  2WV6 D;  2QF7 A;  4DUY L;  4YWM A;  4IOC A;  1JIC A;  1UE1 A;  4DV2 Q;  4MN3 A;  1WTO A;  1X3P A;  3A7L A;  5EKK A;  1Q3L A;  5C4H A;  2RHQ B;  5M3F H;  1VQL A;  1JOR A;  1X6O A;  1NTG A;  4A3D B;  1C9O A;  3NEN A;  1SE4 A;  4A3M H;  4JI8 Q;  3I4M G;  5I6W A;  4DV5 Q;  2QA4 A;  1I94 L;  3D0F A;  3SK8 A;  1Q90 A;  1DOK A;  1WTH A;  3S2D B;  1W3S A;  1S5E D;  4FXG C;  3TP5 A;  1YIT A;  3A8I E;  2ES2 A;  4BXX G;  1C48 A;  5LL6 X;  5IWA L;  3DM1 A;  2Q2U A;  1F2Z A;  2C9O A;  4R9W A;  4L5R C;  2EYL A;  2K5H A;  4K2K A;  1QCB D;  2WAQ G;  3KLW A;  4XT1 B;  5FO7 B;  4QL5 A;  2QDB A;  3KDF A;  4LFA Q;  1OXT A;  4OWX B;  2XWB B;  1BDO A;  1F9P A;  2VQF L;  2Z6B A;  1MHW C;  1JR0 D;  5DLQ E;  3KF8 B;  3CC4 A;  2LS0 1;  1KLG D;  3K5L A;  1OXS C;  1BKB A;  3NBH B;  3J80 L;  1LTG D;  3MWY W;  1B2T A;  3GTQ B;  3MEH A;  3S24 A;  2VUM H;  4DKA C;  4IFD I;  2B29 A;  3MEF A;  3W1B A;  3KK7 A;  2A19 A;  2R7F A;  4B3T Q;  1SYE A;  4X3T A;  1SXT A;  2F03 A;  4DUZ L;  3OW2 A;  4KI0 A;  3J7A 5;  1LT6 D;  2AQ3 B;  2CH4 W;  2EYO A;  1P16 A;  5HGT A;  5K36 H;  3ERO A;  4EQP A;  2B2W C;  4RCO A;  2K52 A;  1PH3 A;  3I2Z A;  1VQE A;  1VQH A;  5FJ8 H;  1ILP A;  1ML0 D;  5JPN C;  3BZK A;  4A3C H;  4ZYS A;  3H09 A;  1PYW D;  1ZXT A;  1SMY C;  1KRT A;  5I9P A;  2CWA A;  3G48 A;  1YNJ D;  3J7A F;  1KTK A;  3QIA A;  1ONL A;  1UEA B;  3EQL C;  2VUM G;  3H0G B;  2NVQ B;  3M3Y B;  4IAL A;  1VQ9 A;  3TS0 A;  2HDM A;  3R3O A;  3BS1 A;  2EXD A;  3SK6 A;  3I4N B;  4BY1 H;  5COR A;  4JV5 L;  5J3B A;  5D14 A;  1JOK A;  2L4N A;  5IYC H;  5K36 G;  1ENC A;  2OQK A;  3HOV H;  1HTL D;  4DR6 Q;  2KBN A;  2K5V A;  4KK7 A;  5FJ8 G;  3SE0 A;  2B2T A;  4A3C G;  4RFB A;  1U0L A;  1YJ9 A;  3KBX A;  2V1C C;  3TBI B;  1HNZ Q;  1GJX A;  2J7Z A;  1S4Z A;  4XT3 B;  1KD1 C;  4H13 C;  4LW1 A;  4JI7 Q;  4JOI A;  1PH2 A;  1BCP C;  1PZI D;  3OPO A;  3F8T A;  4BY1 G;  1PRT C;  5JPM C;  4LK1 C;  2RCF A;  3ITP A;  1GM5 A;  2LKV A;  4OIJ A;  2ALY B;  2WAQ E;  1SN8 A;  4N9P A;  2Q2H A;  1RIP A;  3HOV G;  2HQE A;  4X64 Q;  4DR4 Q;  4C3I H;  4PG3 A;  4CBV A;  3QO2 A;  2F4I A;  3J80 c;  1VF7 A;  3TZU A;  1SRO A;  1Z47 A;  2WFW A;  1Y1V H;  1RHP A;  1A3U A;  1Z9F A;  1E22 A;  4MTN A;  1BXT A;  3MC0 B;  2BDO A;  3EA6 A;  4A93 B;  1W6K A;  1M1K C;  2YU9 B;  3RZD H;  3HFZ B;  2WB1 G;  2VQE L;  1K8O A;  2MJ8 A;  2IT1 A;  3L9A X;  5FLX c;  1XMQ L;  2DNC A;  3PO2 B;  1IXR A;  2DJF C;  4NW2 A;  5IGE A;  3GO5 A;  2HHH Q;  3S17 H;  2R6G A;  3STB D;  4C3I G;  1EFI D;  4K6L A;  5FO8 B;  1CI3 M;  3S1M B;  1AP0 A;  5C44 H;  1K0R A;  4J1M A;  3Q23 A;  2ZXO A;  3I91 A;  3GTK H;  1Y1V G;  1AZQ A;  2JA5 H;  4DR1 L;  4A3E H;  1RF2 D;  2M9V A;  4JBK A;  1KAA A;  2K04 A;  2L1B A;  3OIQ A;  2CFM A;  1HZ9 A;  4IOA A;  2DN8 A;  2K5N A;  4XYQ A;  3NSW A;  2KQ3 A;  1TWC H;  2VB2 X;  3I72 A;  1VF5 C;  4TKO B;  5G3L F;  2EY5 A;  4JI4 Q;  3KLS A;  5EGT A;  1WVL A;  4P75 A;  1QOH A;  3K7A B;  1PH1 A;  3D4W A;  4RGT A;  3RR5 A;  2MP1 A;  1JC7 A;  4DFA A;  4DUY Q;  1VQJ A;  3A55 A;  1H9M A;  2RDF A;  4OX9 L;  3HOW H;  3H3V C;  3BU2 A;  4K0K L;  1HNW L;  1MI2 A;  3AMU A;  1L2F A;  5C44 G;  4GS3 A;  3Q6S A;  2LXJ A;  1I94 Q;  5JEA H;  1K8A C;  1UE7 A;  4QY7 A;  3GD7 A;  1H95 A;  1U4M A;  4IUR A;  3UDX A;  4A3E G;  1W6J A;  4NP5 A;  4GLA C;  3ULP A;  1N34 L;  4QIW B;  2L0C A;  2EY6 A;  4BS9 A;  5IWA Q;  4HID A;  1TWH H;  3TP7 A;  3D6W A;  1TY2 A;  3RN2 A;  4MIU A;  5CMD A;  1HZC A;  1EYD A;  4YCV A;  3G4S A;  1BOS A;  4HMJ A;  2VQF Q;  1PH4 A;  1HHV A;  2PZU A;  3L0O A;  1F9Q A;  4AQY L;  1K9M C;  3AYH B;  3HOW G;  3S9W A;  2E2I H;  2B8F A;  3AEV A;  1T5E A;  3CRL C;  3SEB A;  2PPB C;  2R7D A;  1PH8 A;  1ASY A;  1CHP D;  3M9B A;  2RDG A;  4JI5 Q;  5JEA G;  4IPD A;  1IZ6 A;  2BE5 D;  2Q2T A;  1WTP A;  3E6Z X;  2FFK B;  1GUW A;  1LT4 D;  3PSI A;  2WB1 E;  4V0B A;  1PH9 A;  2B2T C;  4P72 A;  3I73 A;  2KUM A;  3K81 C;  3VR2 A;  2X6L A;  1LT3 D;  2ATW A;  1A15 A;  1MGS A;  4DNT B;  1JB3 A;  1BF4 A;  5A2Q L;  4DV1 L;  1SJH D;  2NZO A;  4K2L A;  3L7Z C;  4K6D A;  4DV7 L;  4XTC S;  2R93 B;  1ZKO A;  1IBK L;  4GKK L;  2EYJ A;  5LL6 S;  4JOI C;  3S15 H;  2K5Q A;  4IUT A;  3RZO B;  1I4Q A;  3A74 A;  4B3S L;  2CWP A;  4X6A H;  1HRJ A;  1S5C D;  4GKJ Q;  1M4V A;  1N9W A;  3F2B A;  1YZ6 A;  4RKB A;  5HUR A;  5IIF A;  4IPH A;  4LF6 Q;  1VQ4 A;  4AIM A;  2DGY A;  4UPA A;  4JV5 Q;  3AQQ A;  4FP5 D;  1FNW A;  3QR8 A;  2ICE C;  1Q46 A;  4L63 B;  1I6H B;  1IL8 A;  3QOL A;  4LFC L;  4H0L C;  5E1F A;  3HOZ H;  3CD6 A;  1VDZ A;  2K33 A;  1OO9 B;  4HSP A;  1KAB A;  4X66 L;  4BBS H;  3KLR A;  3S1R B;  1SMX A;  4K8I A;  2KEN A;  5AJ3 L;  3I90 A;  1X32 A;  4ID6 A;  5EPK A;  3VR3 A;  2ZJP A;  1G6P A;  3C46 A;  3O13 A;  5EBC A;  2B39 A;  4LF7 Q;  3GP7 A;  1CUK A;  1FGB D;  2VY3 A;  1PTO C;  2WII B;  2EOT A;  3VYT A;  2DY8 A;  4RGO S;  4H44 C;  1GUT A;  3OIP A;  3J7Z C;  3W5O A;  5JVH 3;  5EPJ A;  2DJG C;  3UDG A;  3BYT B;  3AFP A;  3BG3 A;  4JI8 L;  2BH8 A;  2B2V A;  3E3X A;  1STE A;  5C5M A;  1A3V A;  4EX5 A;  2R92 B;  2ASB A;  4FF3 A;  2PQA B;  4C3H H;  3GTJ B;  4DK6 C;  3S16 H;  2F0K A;  5IT9 E;  1I6V C;  2NUC A;  3L2P A;  3TRE A;  1LTT D;  3MVV A;  1HA6 A;  1FNU A;  4IO9 A;  1WTQ A;  2VL6 A;  1BBX C;  4LMQ D;  2QDL A;  4MZ9 A;  4GOP C;  4IUV A;  5JVG 3;  1I3Q B;  2B63 H;  1WJJ A;  1XYI A;  3GTG H;  4EVO A;  2UXB L;  3AB9 A;  1C7Y A;  3BVM A;  1EL0 A;  2EJM A;  1XPO A;  2VQE Q;  3E9I A;  1O78 A;  1HJP A;  3M85 A;  4ZLT F;  1XMQ Q;  3IFD A;  1AH9 A;  3WDN A;  5KYL A;  4AH6 A;  4M1U B;  2HIX A;  5J22 A;  4A3K H;  1V1P A;  5CV4 A;  3TRZ A;  3GTO B;  2E2H B;  3NWT A;  4LFB L;  3OWF A;  2PI2 A;  2PYK A;  1U9R A;  1O7Y A;  1STN A;  2ICI A;  2L5T A;  4C1N I;  1D6E C;  4DV6 L;  1EYC A;  4NXN L;  1JE5 A;  1LTS D;  2N78 A;  1VQP A;  1QWY A;  1VQ5 A;  5M5W H;  4DR1 Q;  3ND8 A;  2B63 G;  5C3E G;  4LWC A;  2F0W A;  4YIJ A;  1EWC A;  1IW7 D;  3EN2 A;  2EVB A;  3MXN A;  4NMZ A;  3CCM A;  3UDF A;  3PO3 H;  2PW5 A;  3A8K E;  5LMN W;  2B2U A;  2UXC L;  1DJR D;  1SNM A;  4DXF A;  4C3J B;  4BBR B;  5C3W A;  4A3K G;  4AYB G;  4PZ6 A;  3NTI A;  3PUW A;  5C0X I;  3H94 A;  3EJI A;  2RCN A;  1WCM B;  2NVT B;  4UP9 A;  1Y14 B;  4Z9C B;  3P75 A;  4K0K Q;  1BUV T;  3CPW A;  1HNW Q;  1YNN C;  1I50 H;  1O7Z A;  1KQS A;  1DYQ A;  4HIK A;  3QB3 A;  2WP8 J;  2Y0S E;  4C1N K;  3N6R A;  1KLU D;  2EY2 A;  2F0E A;  2UUA L;  4DR6 L;  1GUO A;  3SXH A;  1W2B A;  2H5X A;  3T56 B;  1N34 Q;  4X3U A;  1AN8 A;  2NVX B;  2NZH A;  2JEB I;  5COY A;  4UHV A;  2G9D A;  3PO3 G;  3GTM B;  4H7B A;  2SEB D;  1GXD C;  4FXD A;  2E2J B;  4IJL A;  1CHQ D;  3BVZ A;  1PFB A;  4LF5 Q;  4JI7 L;  3DEO A;  4X3K A;  2I46 A;  5FK9 C;  5KND A;  2F0I A;  2Z4H A;  5CV5 A;  4A76 A;  1Q86 C;  3NHH A;  4KJN A;  2NWG A;  3UI2 A;  4TVA B;  4DR2 Q;  1CKO A;  2IY5 B;  3X3N A;  2IJ0 A;  4J6H A;  1E2V A;  4GZY C;  2K6A A;  4Y7N H;  2NN6 G;  4ZCK A;  4DR4 L;  3I70 A;  1KNA A;  3CCQ A;  2L15 A;  2R7Z B;  5DNF A;  4A3I G;  1PZK D;  1TWA B;  4TRD A;  3S1N B;  1OXU A;  4XXE A;  1ASZ A;  1EY6 A;  4JYA Q;  3KF8 A;  2J4X A;  4A3G G;  3NQT A;  2ZJR A;  2UUC L;  3U50 C;  1DD2 A;  1TWF H;  1CA6 A;  2BH2 A;  2CQA A;  3KOJ A;  5J39 A;  1CFM A;  4DNR B;  4DV7 Q;  1IBK Q;  2A69 C;  4GKK Q;  2XIW A;  3Q22 A;  1G2S A;  2HIV A;  2KHS A;  3MXN B;  4B3S Q;  2K5D A;  2RA4 A;  3AU7 A;  3E9H A;  4A3J B;  4HN7 A;  1Y1W H;  5JJK A;  2HT1 A;  4U68 A;  1MSH A;  4YY3 Q;  1K8G A;  2M2L A;  1JJ2 A;  5D3D A;  1TS3 A;  4QJF A;  1M90 C;  3CRK C;  1NAP A;  4L5S A;  3QWN A;  1X65 A;  3A5U A;  5M5Y H;  2IX3 A;  1MKH A;  3DMU A;  4K8J A;  4KKS A;  3JAM E;  3W2D A;  3OTO L;  3M4O B;  2EPB A;  4X66 Q;  3MFG A;  4OEM B;  4AYB E;  3FDT A;  1Q7Y C;  5GAH C;  2E8G A;  2JA8 H;  1QZG A;  3LWU A;  1HNX Q;  4R8N A;  3J81 E;  2PQE A;  4JG2 A;  1EY4 A;  3G7L A;  1Y8P B;  1HR0 W;  1I4X A;  4GNX A;  2Z1C A;  1SMY D;  1Y1W G;  1S40 A;  1I4R A;  4BWG B;  4A3I B;  2A74 C;  2NVQ H;  2RHS B;  1PV4 A;  3M3Y H;  1UUP A;  3FPP A;  3V2T A;  1HPC A;  4A3G B;  1TS2 A;  4HCE A;  2H4O A;  1PMR A;  1SFO B;  3HOU B;  4KJO A;  2JA8 G;  4KY6 A;  4O2D A;  3R2T A;  1KRS A;  5EBD A;  2RSN A;  3FPU B;  4DK3 C;  1J6Q A;  2C5C A;  1HUN A;  2AQ1 B;  1H9R A;  3GTL H;  3PIO 3;  2UXB Q;  4IN3 A;  4OGQ C;  3DM3 A;  2DY7 A;  5M3F G;  4IUU A;  1NCV A;  4GN5 A;  3RLF A;  1STA A;  4Q5V A;  4A3M G;  3PV0 A;  3NK9 A;  4JI5 L;  1BCP D;  4DR3 L;  3KYH C;  4LF9 L;  3FKI B;  1R4Q B;  3KFU A;  1PRT D;  2KVM A;  4X62 L;  4LFB Q;  4OHJ A;  3GQB A;  1NBW A;  1HFG A;  1E24 A;  4DV6 Q;  1JQY D;  3NEM A;  2CKZ B;  4BY7 H;  4NXN Q;  1YVC A;  5IY0 A;  2E5L Q;  3H3V H;  1H9S A;  4EQO A;  5IGC A;  5JJL A;  1L0X B;  2KHI A;  3BZC A;  5KGU A;  3ICE A;  4RHS A;  4L5Q A;  1QE6 A;  2ZTE A;  5EQ0 A;  3K58 A;  4WJ4 A;  2XWJ B;  2Z6K A;  3ND9 A;  1GUG A;  1DOL A;  2F0U A;  4A93 H;  4IFD J;  1S3O A;  3I4M B;  2O2L D;  4OIK A;  3S1Q H;  5EKL A;  1ZEQ X;  1G2T A;  1VMC A;  4LJZ C;  3VYU A;  2UXC Q;  3HOY H;  4CDD C;  1JJG A;  3RN5 A;  4GKJ L;  1TWG H;  1N33 L;  5E4W C;  4KY5 A;  3PQI A;  2NYZ D;  2NTT A;  4GNX B;  2XTI A;  4LF6 L;  1D1I A;  1RCV D;  3BVG A;  4OWW B;  1V9P A;  1NJI C;  3LWE A;  2WAQ B;  4BY7 G;  1QVC A;  3VDY A;  3OMC A;  4ZAI A;  4KY7 A;  1B1Z A;  5LMU Q;  3RUZ A;  4PMC A;  4PNY A;  2QKI C;  3A5Z B;  4POF A;  5IGF A;  3HG9 A;  3P1H A;  1UE5 A;  4C2M H;  1HR0 Q;  2P5Z X;  3NWS A;  2UUA Q;  5M3F B;  1L1O A;  4HJ8 A;  1RDP D;  3PMF A;  3CQZ H;  3CF5 A;  1EU3 A;  3IRB A;  2CW0 C;  3S14 H;  2D62 A;  4ZQ3 A;  1LAB A;  3E0J A;  3TQY A;  4RMF A;  2K1B A;  1JWM D;  1YHB A;  1II3 A;  1AE2 A;  3Q0A A;  4LF7 L;  3HOY G;  3KF6 A;  1VQI A;  3TZD A;  2C35 B;  5IYB H;  1K73 C;  3M4Q A;  4UAI A;  2KJX A;  4RGN A;  3HKS A;  3K6O A;  3C2P A;  3R2I A;  4BA2 I;  4CKC A;  3JC6 6;  1EEI D;  4DAM A;  1DM0 B;  1MD2 D;  2JA9 A;  5IYC G;  3SGI A;  4JBW A;  1NMF A;  2I5M X;  4MNO A;  4WRD A;  3CCL A;  4N8F A;  3MAQ A;  2N55 A;  1J5E L;  3QOJ A;  1UAP A;  1D7Q A;  3U9S A;  1N36 L;  3F2U A;  2VUM B;  2EIF A;  3FVQ A;  2X69 A;  3KJO A;  2UUC Q;  1H9S B;  4LUV A;  4CKE A;  2PZW A;  3E0E A;  2YTY A;  1JOO A;  1CSQ A;  5IYB G;  4QUF A;  4PMB A;  5D65 A;  5JAV A;  2MO0 A;  4GLX A;  5E7N A;  1HXY D;  1U4P A;  3FEW X;  1B9N A;  4HJ7 A;  4JPB W;  1OXX K;  3MA2 B;  1G6Z A;  1PTO H;  4F8M A;  1R9T H;  1RL2 A;  2AQ2 B;  2X6G A;  4KMU C;  4N8X 1;  2FMM A;  5CV9 A;  1VQN A;  1LLR D;  5GAG C;  1EOT A;  1VQM A;  1EY0 A;  2HUG A;  3OTO Q;  1B4O A;  2KCM A;  4HED A;  1NSN S;  4BY1 B;  2IX0 A;  1HZA A;  1LV9 A;  2L11 A;  1D8L A;  2PNR C;  3QJY A;  4PV1 C;  1L1O B;  4TQU S;  4ZUJ A;  4GN4 B;  3A56 A;  1Q1B A;  2NVY B;  1QNU A;  1GUN A;  3HOV B;  5BR8 L;  1XNR Q;  1TT2 A;  3J80 E;  1SRU A;  3VA5 A;  3HOX H;  5IT9 L;  5KNB A;  2QEX A;  3T53 B;  4JK1 C;  4KN4 C;  3RNU A;  1GHJ A;  2L9H A;  1HFN A;  1YHA A;  4IZ8 A;  1C0A A;  2EY1 A;  4KV6 A;  3KF6 B;  1H9K A;  1V1Q A;  1F77 A;  2N8N A;  2PCF B;  4RHR A;  1FJG Q;  2JA5 G;  1I4H A;  2WB1 B;  5FLX E;  1HCZ A;  5CV7 A;  2BA1 A;  1PXU A;  5BN5 A;  2Z6K C;  2OTL A;  1ZYR C;  4XQJ A;  1G51 A;  3P7J A;  1BR9 A;  1EFW A;  3C1E A;  4CJ0 B;  5C4X H;  4A75 A;  3U4V A;  4HCS A;  2EXZ A;  1EY8 A;  1MJE A;  1AFP A;  3VYR A;  5LHY 1;  4C3I B;  2Z9H A;  3HOX G;  4LF5 L;  3FRP B;  5KIX A;  1EZ8 A;  1E1T A;  4B9W A;  2H1E A;  3TDQ A;  1Y1V B;  3GDE A;  4P74 A;  2ZXP A;  2KEE A;  2JEA I;  2PQA A;  1PTO D;  5IYD H;  3W3A A;  4DR2 L;  3RD4 A;  1QB5 D;  5KNC A;  4Y52 H;  3RZD B;  4DR3 Q;  3PF5 A;  4LF9 Q;  5KEE A;  4DV4 L;  1FNV A;  2D2C C;  3P20 A;  4KLK A;  5IP7 H;  3PIP 3;  2QEJ C;  5DAU A;  1F2L A;  4X62 Q;  1VQB A;  1EWH A;  3SDZ A;  1VQD A;  2O4X A;  3DWQ A;  2Q8T A;  5C4X G;  4JYA L;  2VB3 X;  1SBB B;  3D8G A;  3S17 B;  3I4L A;  1X3F A;  2A6H C;  4UP7 A;  3UE1 A;  1V1O A;  5C44 B;  3DXJ C;  2JN4 A;  4U67 3;  3GTK B;  3JAM i;  3A8J E;  1J9O A;  4FNF A;  5IYD G;  2OWO A;  4A3E B;  5M3M H;  4QIW E;  2LSS A;  3J81 i;  2ZTD A;  4ZUI A;  1N33 Q;  1DON A;  1TWC B;  2K14 A;  1CZG A;  4GN3 B;  4YY3 L;  2BCO A;  2N3S A;  4A3F H;  5FO9 B;  2OF1 A;  2R3Z A;  3GTO H;  2EYF A;  1PFM A;  1G29 1;  3SR1 A;  4HIO A;  1VQO A;  3Q24 A;  4B3R L;  5LMN L;  1X3E A;  2AHO B;  3HOW B;  4NKL A;  4YWL A;  2KED A;  4N9T A;  5D3I B;  1V43 A;  2FJ2 A;  4JVZ A;  1UWV A;  1GHK A;  1B3Q A;  3CCS A;  1YNX A;  1CSP A;  2ID0 A;  5I2Y A;  1HNX L;  1CKM A;  2UXD L;  3BDC A;  2Y0S G;  4IPG A;  1X3G A;  5M3M G;  2KA7 A;  2ZJQ A;  2OEO A;  1AE3 A;  1A0I A;  2RDH A;  2K05 A;  4FXK C;  4A3B H;  3K80 C;  1SNC A;  3EIV A;  3OSO A;  3FHW A;  4HIM A;  1WCM H;  3HP3 A;  2NVT H;  4ME3 A;  2MGS A;  1LTI D;  5CBE E;  1XX8 A;  3EBE A;  2QGQ A;  3HOZ G;  2NBF A;  4WJW A;  1YNN D;  2B2Y A;  2E2I B;  1ENA A;  1KXL A;  1BCP F;  4BBS G;  3ZYY X;  5H1S E;  5JJI A;  1J5E Q;  5FKA C;  1K28 A;  1N36 Q;  1PRT F;  4LF4 Q;  3TS2 A;  1VCI A;  3NEL A;  1TR5 A;  1BBW A;  1TKW B;  2Q2I A;  2CVR A;  1XJV A;  3RMH A;  4XYO A;  1WTX A;  3GTM H;  1PLF A;  2JE6 I;  5CV8 A;  4MTK A;  4UY8 C;  5GAE C;  1O7L A;  4A3B G;  4R4C A;  5C5L A;  2QIL A;  1K83 H;  3OYY A;  1V8Q A;  3PGZ A;  2IW3 A;  1PDQ A;  1TQO A;  2F0Q A;  4OL7 A;  4HSV A;  1WTV A;  5EJW A;  1B44 D;  3PUX A;  3K7U C;  4EGV A;  3JAM L;  1SNQ A;  4C3H G;  1OXV A;  2A68 C;  1SYC A;  1B8A A;  2JA7 H;  3NQI A;  3F2C A;  1X9N A;  3M7N A;  1HUM A;  1ET9 A;  2Y0S B;  3A7A B;  3S15 B;  4KKU A;  2E5L L;  1AZP A;  2NN6 I;  3S2H B;  2R7Z H;  2BA0 A;  1SR3 A;  4PQX A;  2JA6 H;  3PCO B;  3K5N A;  3CCJ A;  1XWE A;  4R4Q A;  3TSS A;  5F2D A;  1E0B A;  1IKM A;  2KCC A;  1RKN A;  2KEC A;  1DZ1 A;  3HOZ B;  5IGB A;  5BR8 Q;  1YIJ A;  2UUB Q;  1QNK A;  1CKN B;  2A69 D;  2JA7 G;  4LAA A;  4K14 A;  4DAY B;  4JI3 L;  2B3G A;  2E74 C;  2XNA C;  4F88 A;  1TY0 A;  1KAW A;  1Q12 A;  4YWK A;  2AUJ D;  4L8J A;  1S72 A;  1I5F A;  2PW7 A;  3I56 A;  4HAE A;  5LMU L;  2JA6 G;  3CPF A;  2K03 A;  3K5M A;  4WOR A;  1HR0 L;  3VA7 A;  1STG A;  2A5H A;  1KIX A;  1VS0 A;  4MHE A;  2CQO A;  3HKZ E;  2D9U A;  4DAP A;  1RD9 D;  4R1J A;  5BN4 A;  2E75 C;  1VQF A;  3ULJ A;  5C0X J;  1CM9 A;  4JC0 A;  1GD7 A;  1WI5 A;  1CQF A;  1HA5 A;  3S16 B;  2XRQ D;  3ZJY C;  2CHB D;  2F3W A;  3I7F A;  2PMZ B;  1L0W A;  2AWN A;  3K5O A;  5G3L D;  1UNS A;  3CU7 A;  1SE2 A;  3IKJ A;  2AUK A;  1SYG A;  2CCZ A;  4JI6 L;  5M5X B;  2B2W A;  1LT5 D;  1NE3 A;  2B63 B;  5C3E B;  3GTG B;  1MBY A;  1Q81 C;  1CZW A;  5C4J B;  4A3D H;  3HGB A;  4DV4 Q;  3QG1 A;  1Q8K A;  4XDX A;  1IBL Q;  4HTH A;  3ER0 A;  1Q82 C;  4CGY B;  2XVS A;  1A2U A;  2GA4 B;  3S2D H;  1G91 A;  4LF8 Q;  2K32 A;  5KRU A;  1SFO H;  2I0Q A;  3CC7 A;  2LXK A;  3GTP B;  4A3K B;  4AYB B;  3CHB D;  5CC4 A;  5AFW A;  2D5D A;  1YJN A;  5DM6 3;  2BOS A;  4A3L H;  2JK8 A;  3H6M A;  3KLS X;  4JW0 A;  3VR4 A;  3PUV A;  5M5W B;  2F0G A;  4KD4 A;  4I7Z C;  4NPS A;  4EQN A;  4IUQ A;  1D2B A;  4QUC A;  4RAU C;  4KHP L;  2B2V C;  3G71 A;  1VQ6 A;  2OT2 A;  2CH4 A;  3GTQ H;  4G4K A;  3W1G A;  3M4Y A;  4ZKB B;  4K5X A;  1WOC A;  3FKI H;  4R4I A;  3J80 i;  3PO3 B;  2OXP A;  4KTA A;  4QMG A;  1A2T A;  5CYU A;  2I07 B;  2K4K A;  3NBI A;  1IYJ B;  4B3R Q;  5LMN Q;  1N32 Q;  2EQS A;  1EQT A;  5J1Z A;  4KHV A;  4DV3 Q;  2MPM A;  1I50 B;  3SHL A;  1STY A;  4A3L G;  2YTV A;  2UXD Q;  1EY9 A;  3ERQ A;  4X65 L;  1D5X C;  1EQV A;  2F1M A;  3CMA A;  3SK4 A;  1XNR L;  4LUZ A;  1B70 B;  4OO1 H;  1XPR A;  1E3P A;  2FHT A;  4RWS C;  3CW2 C;  3H0G H;  2PI2 E;  4CHT B;  1WD0 A;  1FJG L;  3I4N H;  2VNU D;  1EUJ A;  1PTO F;  2EE1 A;  1SE8 A;  1BO0 A;  2EDG A;  1LTB D;  3H3V I;  4R4T A;  5CGK A;  3I55 A;  1PA6 A;  4DA2 A;  4QQB X;  4WJ3 M;  1TU2 B;  3MXP A;  1EQR A;  4Y7N B;  5EKI A;  4OO1 G;  2B2U C;  2CW0 D;  4WFN 3;  1EIY B;  2KCT A;  1IYV A;  1B3A A;  3D3R A;  3H0G G;  1D1K A;  1IKL A;  1DOM A;  1QJO A;  3KUP A;  2MFI A;  2O5I C;  3TME A;  5ELN A;  4HR7 B;  4R4O A;  1UE6 A;  3T51 B;  1TWF B;  4DR7 L;  4S3S A;  3I4N G;  2XRS D;  2D0P A;  3K8A A;  2JJQ A;  1XNQ L;  2NZ1 D;  4H02 A;  1QIL A;  1NNX A;  3TP6 A;  1E2W A;  2A6E C;  1AEX A;  1QUQ A;  1Y1W B;  1T5X D;  3BDO A;  2IWH A;  1A62 A;  4JI0 L;  1YEZ A; 
#chains in the Genus database with same CATH homology
 5IGG A;  1SND A;  4FF4 A;  1JOQ A;  1Q1E A;  2E76 C;  1BCP B;  2Q8R E;  3M7G A;  2F0D A;  3NTK A;  1SYD A;  2F0H A;  1CTM A;  5T1I A;  1PRT B;  5M5Y B;  1JE4 A;  3K0Y A;  5FLX L;  2JA8 B;  3GV3 A;  4DK0 A;  4XQN A;  2NB0 A;  1HQR D;  1EY5 A;  2HDL A;  1IYU A;  3LNN A;  4RKL A;  4ULL A;  4FYD A;  1S5D D;  3HEJ A;  4ZK9 B;  1IHZ A;  1CK1 A;  3TP8 A;  2JP1 A;  3DEP A;  2L55 A;  4UDU C;  1H9J A;  4IFD H;  4A3M B;  3MXG A;  1F9R A;  1RTN A;  2FMC A;  2AWO A;  1C8C A;  1J8I A;  1F9S A;  4O1N A;  2XSC A;  1B53 A;  2HCC A;  3KBG A;  1DXM A;  4Q0F A;  4PMW A;  1U4L A;  1HTP A;  5IOC A;  1B50 A;  2EJF C;  3GTL B;  5CV6 A;  3NE5 B;  1JWU D;  1DCZ A;  4IFD G;  2MUY A;  1TII D;  3N52 A;  3EVQ A;  1KNE A;  1X3Q A;  2F0T A;  2WIN B;  1ZYR D;  3D4D A;  4BY7 B;  3J7A V;  1CQV A;  2F0N A;  4IQZ A;  1ILQ A;  1S5B D;  2K7V A;  3A54 A;  1EY7 A;  1GUS A;  1M8A A;  3IAY A;  3BZD B;  1YNJ C;  3S1Q B;  2TMP A;  4QCL A;  3NP8 A;  2R61 A;  1ET6 A;  3HOY B;  4E6I A;  5FOB B;  5ISR A;  1TWG B;  4G7O C;  1JCK B;  3FMC A;  2K5W A;  1Y8O B;  2A6H D;  4C2M B;  5JEA J;  3DWP A;  5DEH A;  1ICW A;  1LTA D;  3CQZ B;  1B9M A;  2LMC B;  1A6X A;  3S14 B;  1ESF A;  5ELE A;  2LY7 A;  2FIN B;  4DK1 A;  3D6C A;  1CT1 D;  5ELC A;  2DNE A;  3MXU A;  2F3V A;  2K01 A;  4QB4 A;  1KDA A;  1NR4 A;  4I65 A;  2F0O A;  4BA1 I;  2SNS A;  3EFX D;  1ENF A;  2XN9 C;  1L0Y B;  1EIG A;  1SNO A;  1BQQ T;  2KOL A;  2SNM A;  1U4R A;  2BDN A;  5M9O A;  1K8M A;  1LAC A;  3K59 A;  3NUC A;  3DHQ A;  1GOZ A;  5I2X A;  1SAP A;  2QCP X;  3T16 A;  1LTR D;  2E2D C;  4L6T B;  3PUY A;  5NUC A;  1FD7 D;  1Q8I A;  2JXM B;  1MSG A;  1SYF A;  2EYP A;  3T4A C;  1O80 A;  3DUZ A;  1LO5 D;  1PTO B;  4ZKC B;  3L3O C;  2Z8L A;  4B08 A;  1R9T B;  5IOD A;  1D5M C;  2O5J C;  2JA5 B;  4CKB A;  1EYA A;  1FYC A;  3R8B A;  1SDF A;  5K5P A;  4XQQ A;  3MHB A;  1FR3 A;  1PZJ D;  4B9X A;  1I4P A;  2J0T D;  2F0L A;  2WKD A;  4XIG S;  5I6Y A;  2A68 D;  4X3S A;  4DU9 A;  3HOX B;  5ELD A;  1Z6H A;  1CA5 A;  2WKC A;  2IL8 A;  1SE3 A;  2PO4 A;  2EJG C;  2EZV A;  5A35 A;  2L12 A;  1RTO A;  4DAY A;  2Z4I A;  2RKS A;  1RJT A;  2MHV A;  1TWH B;  4V19 0;  2SDF A;  2F0P A;  4CJ2 C;  1TVX A;  3D31 A;  2JYO A;  5C4X B;  3NTH A;  4IUP A;  4FF2 A;  2M00 A;  2F0F A;  3WOF A;  3SK5 A;  4DN4 M;  1STH A;  3NPP A;  4G7H C;  4KHZ A;  1SNP A;  5T1G A;  3VR5 A;  3OW7 A;  3OWE B;  2BE5 C;  1BNZ A;  5EPL A;  2SOB A;  4FF1 A;  3IFT A;  4RA8 A;  1TS4 A;  4RH6 A;  2N88 A;  2F0J A;  2NTS A;  2V4D A;  3E5S A;  4C3J G;  2Q8I B;  1EEF D;  5C4Z A;  4DAV A;  4DF7 A;  1Y8N B;  4RGM A;  3I8Z A;  4NDX A;  2JSO A;  4DGZ A;  1KDC A;  3V05 A;  5TSS A;  3U9O A;  3J81 L;  4ILW A;  2WAC A;  5M3M B;  4KD3 A;  1TS5 A;  2KCN A;  3HKZ B;  3IL8 A;  4A3F B;  4CJ1 B;  2HCI A;  4ME5 A;  1Y69 U;  3NXW A;  2TSS A;  2VXW A;  3TN2 A;  5E4X A;  4FVM A;  5JOB A;  1WTR A;  1WTW A;  2PZT A;  4BBS B;  4C56 C;  1R4P B;  5CR3 A;  4IUN A;  3MZ5 A;  1QG7 A;  3HRZ C;  2A73 B;  3CKI B;  4M8A A;  1G8Z D;  5IGD A;  3H91 A;  4G7Z C;  2LFN A;  4A3B B;  4J8Q A;  4K5V A;  5E3F A;  1ESR A;  1AW7 A;  5C3X A;  5A2Q E;  1KDB A;  1C4Q A;  1E2Z A;  3DWA A;  4P2C B;  2B8G A;  1STB A;  3HS0 C;  3WOE A;  4C3H B;  1EU4 A;  3I3C A;  3OOC A;  3OMG A;  5ELB A;  2NN6 H;  4ZRZ A;  1XXG A;  5KYI A;  3BYY B;  3J7Y W;  2IX1 A;  1S5F D;  1K83 B;  5DM7 3;  4O42 A;  4KN7 C;  1A3T A;  2EYH A;  5C0X H;  3MFY A;  2ZXR A;  1Z7T A;  2RVL A;  3MTS A;  2JA7 B;  2F0S A;  2RBM A;  1HQM C;  1PFN A;  4G57 A;  4F7X A;  4ODG A;  4ABN A;  3G6J B;  1SSO A;  1VMP A;  3HZX A;  1I4G A;  2JA6 B;  1V1P B;  4OO1 I;  1F2Y A;  4F87 A;  1IW7 C;  1EIH A;  4KKT A;  1SYB A;  4K5W A;  2IPK D;  5ELF A;  3T13 A;  3PUZ A;  4QF4 A;  3X3M A;  2B2Y C;  3NBH A;  3R93 A;  5I9O A;  4TSS A;  2YYZ A;  1SJE D;  5C0X G;  3C3L A;  5BN3 A;  3OHX C;  4RCN A;  4HMI A;  2F0M A;  2ENB A;  2RSO A;  2ZT9 C;  5I4D A;  2A6E D;  1ROD A;  4FO2 A;  5JJZ A;  2EYM A;  5C6A A;  3VYS A;  1XTC D;  1JWS D;  3C1F A;  1NR2 A;  3SVM A;  1NUC A;  2RQX A;  3LX0 A;  2K28 A;  3GV6 A;  2G9H D;  3URY A;  3BDL A;  3VR6 A;  2F0V A;  1EZ6 A;  5CBA E;  3D4R A;  3ONA B;  3V96 A;  4DXG A;  3K57 A;  4R8I A;  1F2M A;  1SEB D;  1D5Z C;  1WD1 A;  2WV6 D;  2QF7 A;  1JIC A;  4MN3 A;  1WTO A;  1X3P A;  3A7L A;  5EKK A;  1Q3L A;  5C4H A;  1JOR A;  4A3D B;  1SE4 A;  5I6W A;  3SK8 A;  1Q90 A;  1DOK A;  3S2D B;  4FXG C;  1S5E D;  3TP5 A;  3A8I E;  1C48 A;  5LL6 X;  3DM1 A;  1F2Z A;  2C9O A;  4R9W A;  2EYL A;  4K2K A;  1QCB D;  4XT1 B;  5FO7 B;  2QDB A;  1OXT A;  2XWB B;  1BDO A;  1F9P A;  1JR0 D;  2LS0 1;  1KLG D;  3K5L A;  1OXS C;  3J80 L;  1LTG D;  3MWY W;  1B2T A;  3GTQ B;  3MEH A;  4IFD I;  3KK7 A;  1SYE A;  4X3T A;  1SXT A;  2F03 A;  4KI0 A;  1LT6 D;  2AQ3 B;  2EYO A;  5HGT A;  5K36 H;  3ERO A;  4EQP A;  2B2W C;  4RCO A;  1ILP A;  1ML0 D;  5JPN C;  4ZYS A;  3H09 A;  1PYW D;  1ZXT A;  1SMY C;  5I9P A;  1YNJ D;  3J7A F;  1KTK A;  3QIA A;  1ONL A;  1UEA B;  3EQL C;  3H0G B;  2NVQ B;  3M3Y B;  4IAL A;  2HDM A;  3R3O A;  3BS1 A;  3SK6 A;  3I4N B;  5COR A;  5D14 A;  1JOK A;  2L4N A;  5K36 G;  1ENC A;  1HTL D;  4KK7 A;  3SE0 A;  2B2T A;  4RFB A;  3KBX A;  3TBI B;  1GJX A;  2J7Z A;  1S4Z A;  4XT3 B;  4H13 C;  1BCP C;  1PZI D;  3OPO A;  1PRT C;  5JPM C;  4LK1 C;  3ITP A;  2LKV A;  4OIJ A;  4N9P A;  2HQE A;  4CBV A;  3QO2 A;  2F4I A;  1VF7 A;  3TZU A;  1Z47 A;  1RHP A;  1A3U A;  1BXT A;  3MC0 B;  2BDO A;  3EA6 A;  4A93 B;  1W6K A;  2YU9 B;  1K8O A;  2MJ8 A;  2IT1 A;  3L9A X;  2DNC A;  3PO2 B;  4NW2 A;  5IGE A;  3GO5 A;  2R6G A;  4C3I G;  1EFI D;  4K6L A;  5FO8 B;  1CI3 M;  3S1M B;  1AP0 A;  4J1M A;  3Q23 A;  2ZXO A;  3I91 A;  1AZQ A;  1RF2 D;  2M9V A;  1KAA A;  2K04 A;  2L1B A;  3OIQ A;  2DN8 A;  4XYQ A;  3NSW A;  2KQ3 A;  2VB2 X;  3I72 A;  1VF5 C;  4TKO B;  5G3L F;  2EY5 A;  3KLS A;  5EGT A;  1WVL A;  1QOH A;  3K7A B;  3D4W A;  4RGT A;  2MP1 A;  1JC7 A;  4DFA A;  3A55 A;  1H9M A;  2RDF A;  3H3V C;  1MI2 A;  3AMU A;  3Q6S A;  5JEA H;  3GD7 A;  1U4M A;  4IUR A;  1W6J A;  4NP5 A;  4QIW B;  2L0C A;  2EY6 A;  4BS9 A;  3TP7 A;  3D6W A;  1TY2 A;  4MIU A;  5CMD A;  1EYD A;  1BOS A;  4HMJ A;  1HHV A;  2PZU A;  1F9Q A;  3S9W A;  2B8F A;  1T5E A;  3CRL C;  3SEB A;  2PPB C;  1CHP D;  2RDG A;  5JEA G;  2BE5 D;  1WTP A;  3E6Z X;  2FFK B;  1GUW A;  1LT4 D;  4V0B A;  2B2T C;  3I73 A;  2KUM A;  3VR2 A;  2X6L A;  1LT3 D;  1A15 A;  1MGS A;  4DNT B;  1JB3 A;  1BF4 A;  5A2Q L;  1SJH D;  4K2L A;  4K6D A;  3L7Z C;  2R93 B;  4XTC S;  1ZKO A;  2EYJ A;  5LL6 S;  2K5Q A;  4IUT A;  3RZO B;  1I4Q A;  1HRJ A;  1S5C D;  1M4V A;  4RKB A;  5HUR A;  5IIF A;  4FP5 D;  1FNW A;  2ICE C;  4L63 B;  1I6H B;  1IL8 A;  3QOL A;  4H0L C;  5E1F A;  1VDZ A;  2K33 A;  1OO9 B;  4HSP A;  1KAB A;  3KLR A;  3S1R B;  4K8I A;  3I90 A;  1X32 A;  4ID6 A;  5EPK A;  3VR3 A;  3C46 A;  3O13 A;  5EBC A;  2B39 A;  3GP7 A;  1FGB D;  1PTO C;  3VYT A;  2WII B;  2EOT A;  2DY8 A;  4RGO S;  4H44 C;  1GUT A;  3OIP A;  5JVH 3;  5EPJ A;  3BYT B;  3BG3 A;  2B2V A;  1STE A;  5C5M A;  1A3V A;  2R92 B;  4FF3 A;  3GTJ B;  2F0K A;  5IT9 E;  1I6V C;  2NUC A;  1LTT D;  3MVV A;  1HA6 A;  1FNU A;  1WTQ A;  1BBX C;  4LMQ D;  4IUV A;  5JVG 3;  1I3Q B;  1XYI A;  4EVO A;  3AB9 A;  3BVM A;  1EL0 A;  2EJM A;  1O78 A;  3M85 A;  4ZLT F;  3IFD A;  3WDN A;  5KYL A;  4M1U B;  5J22 A;  1V1P A;  5CV4 A;  3GTO B;  2E2H B;  3NWT A;  3OWF A;  2PYK A;  1U9R A;  1O7Y A;  1STN A;  2ICI A;  2L5T A;  4C1N I;  1D6E C;  1EYC A;  1LTS D;  1QWY A;  3ND8 A;  2F0W A;  4YIJ A;  1EWC A;  1IW7 D;  2EVB A;  3MXN A;  4NMZ A;  2PW5 A;  3A8K E;  2B2U A;  1DJR D;  1SNM A;  4DXF A;  4C3J B;  4BBR B;  5C3W A;  3NTI A;  3PUW A;  5C0X I;  3H94 A;  3EJI A;  1WCM B;  2NVT B;  4Z9C B;  3P75 A;  1BUV T;  1YNN C;  1O7Z A;  1DYQ A;  3QB3 A;  2WP8 J;  4C1N K;  3N6R A;  1KLU D;  2EY2 A;  2F0E A;  1GUO A;  3SXH A;  3T56 B;  4X3U A;  1AN8 A;  2NVX B;  2JEB I;  5COY A;  2G9D A;  3GTM B;  4H7B A;  2SEB D;  1GXD C;  4FXD A;  2E2J B;  1CHQ D;  3BVZ A;  1PFB A;  3DEO A;  4X3K A;  2I46 A;  5FK9 C;  5KND A;  2F0I A;  2Z4H A;  5CV5 A;  3NHH A;  4KJN A;  2NWG A;  3UI2 A;  3X3N A;  2IJ0 A;  4J6H A;  1E2V A;  4GZY C;  2K6A A;  2NN6 G;  3I70 A;  1KNA A;  2R7Z B;  5DNF A;  1PZK D;  1TWA B;  4TRD A;  3S1N B;  1OXU A;  4XXE A;  1EY6 A;  3KF8 A;  2J4X A;  3NQT A;  1DD2 A;  1CA6 A;  2CQA A;  5J39 A;  1CFM A;  4DNR B;  2A69 C;  2XIW A;  3Q22 A;  1G2S A;  2KHS A;  2K5D A;  2RA4 A;  3AU7 A;  4A3J B;  4HN7 A;  4U68 A;  1MSH A;  2M2L A;  5D3D A;  1TS3 A;  3CRK C;  1NAP A;  3QWN A;  2IX3 A;  3DMU A;  4KKS A;  4K8J A;  3JAM E;  3W2D A;  3M4O B;  2EPB A;  3MFG A;  3FDT A;  3LWU A;  4R8N A;  3J81 E;  2PQE A;  1EY4 A;  3G7L A;  1Y8P B;  1I4X A;  2Z1C A;  1SMY D;  1I4R A;  4BWG B;  4A3I B;  2A74 C;  1UUP A;  3FPP A;  3V2T A;  1HPC A;  4A3G B;  1TS2 A;  4HCE A;  2H4O A;  1PMR A;  1SFO B;  3HOU B;  4KJO A;  4KY6 A;  3R2T A;  5EBD A;  2RSN A;  3FPU B;  2C5C A;  1HUN A;  2AQ1 B;  1H9R A;  3PIO 3;  4IN3 A;  4OGQ C;  2DY7 A;  4IUU A;  1NCV A;  3RLF A;  1STA A;  4Q5V A;  3PV0 A;  3NK9 A;  1BCP D;  3FKI B;  1R4Q B;  1PRT D;  2KVM A;  4OHJ A;  3GQB A;  1HFG A;  1JQY D;  1H9S A;  4EQO A;  5IGC A;  1L0X B;  5KGU A;  4RHS A;  1QE6 A;  5EQ0 A;  3K58 A;  2XWJ B;  3ND9 A;  1GUG A;  1DOL A;  2F0U A;  4IFD J;  3I4M B;  2O2L D;  4OIK A;  5EKL A;  1ZEQ X;  1G2T A;  1VMC A;  4LJZ C;  3VYU A;  5E4W C;  4KY5 A;  2NYZ D;  2NTT A;  1D1I A;  1RCV D;  3BVG A;  3LWE A;  2WAQ B;  3OMC A;  4ZAI A;  4KY7 A;  1B1Z A;  3RUZ A;  4PMC A;  4PNY A;  2QKI C;  5IGF A;  3HG9 A;  3P1H A;  3NWS A;  5M3F B;  1RDP D;  3PMF A;  1EU3 A;  2CW0 C;  2D62 A;  4ZQ3 A;  1LAB A;  3E0J A;  2K1B A;  1JWM D;  1II3 A;  3Q0A A;  3TZD A;  4UAI A;  2KJX A;  4RGN A;  3K6O A;  3C2P A;  3R2I A;  4BA2 I;  4CKC A;  1EEI D;  1DM0 B;  1MD2 D;  4JBW A;  4WRD A;  3MAQ A;  2N55 A;  3QOJ A;  1UAP A;  3U9S A;  3F2U A;  2VUM B;  3FVQ A;  2X69 A;  1H9S B;  4CKE A;  2PZW A;  1JOO A;  4QUF A;  4PMB A;  5D65 A;  5JAV A;  1HXY D;  1U4P A;  3FEW X;  1B9N A;  1OXX K;  3MA2 B;  1G6Z A;  1PTO H;  4F8M A;  2AQ2 B;  2X6G A;  4KMU C;  2FMM A;  5CV9 A;  1LLR D;  1EOT A;  1EY0 A;  2HUG A;  1B4O A;  4HED A;  1NSN S;  4BY1 B;  2IX0 A;  1LV9 A;  4TQU S;  2L11 A;  2PNR C;  3QJY A;  4PV1 C;  4ZUJ A;  3A56 A;  1Q1B A;  2NVY B;  1QNU A;  1GUN A;  3HOV B;  1TT2 A;  3J80 E;  3VA5 A;  5IT9 L;  5KNB A;  3T53 B;  4JK1 C;  4KN4 C;  1GHJ A;  2L9H A;  1HFN A;  4IZ8 A;  2EY1 A;  4KV6 A;  1H9K A;  1F77 A;  2PCF B;  4RHR A;  1I4H A;  2WB1 B;  5FLX E;  1HCZ A;  5CV7 A;  2BA1 A;  1PXU A;  5BN5 A;  1ZYR C;  4XQJ A;  3P7J A;  1BR9 A;  3C1E A;  4CJ0 B;  4HCS A;  2EXZ A;  1EY8 A;  1AFP A;  3VYR A;  5LHY 1;  4C3I B;  3FRP B;  5KIX A;  1EZ8 A;  4B9W A;  2H1E A;  3TDQ A;  1Y1V B;  2JEA I;  2ZXP A;  2KEE A;  1PTO D;  3W3A A;  3RD4 A;  1QB5 D;  5KNC A;  3RZD B;  5KEE A;  1FNV A;  2D2C C;  3P20 A;  3PIP 3;  2QEJ C;  5DAU A;  1F2L A;  1EWH A;  3SDZ A;  2O4X A;  3DWQ A;  2Q8T A;  2VB3 X;  1SBB B;  3D8G A;  3S17 B;  3I4L A;  2A6H C;  1V1O A;  5C44 B;  3DXJ C;  4U67 3;  3GTK B;  3A8J E;  1J9O A;  4FNF A;  4A3E B;  4ZUI A;  1DON A;  1TWC B;  1CZG A;  2BCO A;  5FO9 B;  2OF1 A;  2R3Z A;  2EYF A;  1PFM A;  1G29 1;  3SR1 A;  3Q24 A;  3HOW B;  4NKL A;  2KED A;  4N9T A;  5D3I B;  1V43 A;  2FJ2 A;  1GHK A;  2ID0 A;  5I2Y A;  3BDC A;  2KA7 A;  2OEO A;  2RDH A;  2K05 A;  4FXK C;  1SNC A;  3OSO A;  3HP3 A;  2MGS A;  1LTI D;  5CBE E;  1XX8 A;  2NBF A;  4WJW A;  1YNN D;  2B2Y A;  2E2I B;  1ENA A;  1BCP F;  3ZYY X;  5FKA C;  1PRT F;  1VCI A;  1TR5 A;  1TKW B;  2CVR A;  3RMH A;  4XYO A;  1WTX A;  1PLF A;  2JE6 I;  5CV8 A;  1O7L A;  5C5L A;  2QIL A;  1V8Q A;  2IW3 A;  1PDQ A;  1TQO A;  2F0Q A;  4OL7 A;  4HSV A;  1WTV A;  5EJW A;  1B44 D;  3PUX A;  4EGV A;  3JAM L;  1SNQ A;  4C3H G;  1OXV A;  2A68 C;  1SYC A;  3NQI A;  3M7N A;  1HUM A;  1ET9 A;  2Y0S B;  3A7A B;  3S15 B;  4KKU A;  1AZP A;  2NN6 I;  3S2H B;  2BA0 A;  4PQX A;  3K5N A;  1XWE A;  3TSS A;  5F2D A;  1E0B A;  1IKM A;  2KCC A;  1RKN A;  2KEC A;  1DZ1 A;  3HOZ B;  5IGB A;  1QNK A;  2A69 D;  4LAA A;  4K14 A;  2E74 C;  2XNA C;  4F88 A;  1TY0 A;  1Q12 A;  2AUJ D;  4L8J A;  2PW7 A;  4HAE A;  3K5M A;  2K03 A;  4WOR A;  3VA7 A;  1STG A;  2A5H A;  4MHE A;  2D9U A;  4DAP A;  1RD9 D;  5BN4 A;  2E75 C;  5C0X J;  1CM9 A;  1CQF A;  1HA5 A;  3S16 B;  2XRQ D;  2CHB D;  2F3W A;  2PMZ B;  2AWN A;  3K5O A;  5G3L D;  1UNS A;  3CU7 A;  1SE2 A;  3IKJ A;  2AUK A;  1SYG A;  5M5X B;  2B2W A;  1LT5 D;  2B63 B;  5C3E B;  3GTG B;  1MBY A;  1CZW A;  5C4J B;  3HGB A;  3QG1 A;  4XDX A;  4HTH A;  4CGY B;  2XVS A;  1A2U A;  2GA4 B;  1G91 A;  2K32 A;  5KRU A;  3GTP B;  4A3K B;  4AYB B;  3CHB D;  5CC4 A;  5AFW A;  2D5D A;  5DM6 3;  2BOS A;  3H6M A;  3KLS X;  3VR4 A;  3PUV A;  5M5W B;  2F0G A;  4KD4 A;  4I7Z C;  4EQN A;  4IUQ A;  1D2B A;  4QUC A;  4RAU C;  2B2V C;  2OT2 A;  4G4K A;  3M4Y A;  4ZKB B;  4K5X A;  3PO3 B;  2OXP A;  4KTA A;  4QMG A;  1A2T A;  5CYU A;  2I07 B;  3NBI A;  1EQT A;  5J1Z A;  4KHV A;  2MPM A;  1I50 B;  3SHL A;  1STY A;  1EY9 A;  3ERQ A;  1D5X C;  1EQV A;  2F1M A;  3SK4 A;  4OO1 H;  2FHT A;  4RWS C;  4CHT B;  1WD0 A;  2VNU D;  1PTO F;  2EE1 A;  1BO0 A;  2EDG A;  1LTB D;  5CGK A;  4DA2 A;  1TU2 B;  3MXP A;  4Y7N B;  5EKI A;  4OO1 G;  2B2U C;  2CW0 D;  4WFN 3;  1IYV A;  1B3A A;  3D3R A;  1D1K A;  1IKL A;  1DOM A;  1QJO A;  3KUP A;  2O5I C;  3TME A;  4HR7 B;  3T51 B;  1TWF B;  4S3S A;  2XRS D;  2NZ1 D;  1QIL A;  3TP6 A;  1E2W A;  2A6E C;  1AEX A;  1Y1W B;  1T5X D;  2IWH A;  3BDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...