1LT4D

Heat-labile enterotoxin mutant s63k
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
b'APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Crystal structure of a non-toxic mutant of heat-labile enterotoxin, which is a potent mucosal adjuvant.
pubmed rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 27
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1997-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lt4D00
1DJRD 2XRSD 1PZJD 5ELCA 3DWPA 1S5CD 3R2IA 1BXTA 1JWUD 1PZKD 1LLRD 1LTSD 2O2LD 2R61A 1TS3A 2QILA 1XTCD 1V1OA 4OHJA 1SEBD 3BYTB 1CHPD 5D3DA 3BZDB 3CHBD 1S5FD 5ELBA 4BWGB 1FGBD 1M4VA 1T5XD 3SEBA 2XN9C 1EFID 1ESFA 1FNUA 1L0XB 5FKAC 1V1PB 1F77A 3DWAA 4RHSA 3GP7A 1SXTA 1KTKA 1HQRD 4RGTA 2IJ0A 1RCVD 1DYQA 1AW7A 1PRTB 1PYWD 1TY0A 4RGNA 2RDHA 3MC0B 4L6TB 1AN8A 1LT6D 1BCPC 1RDPD 2G9HD 1B1ZA 4RGMA 1STEA 2Z8LA 3BVGA 3R8BA 1TS2A 1CT1D 2NTSA 1S5ED 4L63B 1TS5A 1PTOC 3EA6A 3MFGA 1S5BD 4RCOA 1EEFD 2ICIA 1KLUD 1S5DD 1BCPD 1D5ZC 1JWMD 2AQ1B 2WV6D 5FK9C 5D3IB 3TSSA 2XNAC 4DXFA 2IPKD 1PTOD 1BCPF 1LT5D 1SE2A 1LTGD 2SEBD 1JR0D 1LTRD 5I4DA 1ENFA 1G8ZD 1PTOF 1RD9D 2J4XA 3R2TA 1QILA 1LTTD 3BVMA 1UUPA 1HXYD 1PZID 1SBBB 2AQ3B 1HA5A 1PTOH 4K6LA 4TSSA 1GOZA 1LT4D 3OWEB 5ELEA 1B44D 1JQYD 1EU3A 1LTBD 3W2DA 1I4GA 1SE4A 1RF2D 1TS4A 4RGOS 1FD7D 1UNSA 1EEID 1JWSD 1EWCA 1D6EC 2CHBD 1PRTC 3BYYB 1I4QA 1LTID 2QEJC 1XXGA 1FNWA 1I4HA 3BVZA 1I4RA 4RFBA 1CHQD 1I4XA 2XRQD 1SJHD 3URYA 4DXGA 1HTLD 1KLGD 2RDGA 4RHRA 1PRTD 4UDUC 4RH6A 1JCKB 5ELDA 1D5MC 1ET6A 4O1NA 1V1PA 2NTTA 3DWQA 1CK1A 3EFXD 1PRTF 1SJED 1EU4A 1FNVA 5ELFA 5TSSA 1LO5D 1TY2A 3O13A 2AQ2B 3V05A 1ET9A 3KLSX 2TSSA 1BCPB 1CQVA 4ZYSA 1SE3A 1L0YB 1LT3D 4Z9CB 1MD2D 1D5XC 4C56C 1LTAD 1I4PA 1PTOB
chains in the Genus database with same CATH superfamily
3BU2A 4NXNL 2A5HA 3CRKC 2QF7A 4BBRG 1E3PA 5IYCG 2PW7A 1IYJB 2MJ8A 3UE0A 4A3BH 4A3BB 2B3GA 1VQKA 1B7YB 4KKUA 1F2ZA 5IGEA 4CHTB 2VY3A 3NP8A 1NJIC 1RTNA 4ZCKA 3NHHA 3T13A 3DEOA 3K5NA 2XN9C 3M4YA 3HRZC 1EY4A 1VF5C 1V1PB 1LYLA 1FJGL 2F4VQ 1JB3A 4G4KA 4YCUA 4DAMA 1XMQL 1OXSC 4YHHQ 1HZCA 1IYVA 4WRDA 3QB3A 1B1ZA 1X3EA 3BVGA 4HJ5A 3HOUH 3HOUB 4QCLA 3KFUA 1CKNA 4V0BA 2I0QA 3HKZE 1LTLA 4K2LA 3HKZB 2KUMA 3H09A 1SROA 2IX3A 3I4MG 4AQYL 1LT5D 3OTOQ 3C46A 5KIXA 4A93H 1YHAA 1Z47A 2E74C 2UUBL 4A93B 3K7AH 1WYDA 3AYHB 3I4OA 4R9WA 2MNAA 2Z6KA 3I4NB 4A3DG 4ZKBB 3VYSA 4HJ7A 5E7NA 4DR1L 3NBHB 4KJNA 1PFMA 2B2TC 3HFZB 2SNMA 1XPUA 4K6LA 3QWNA 3UI2A 4G7HC 2N3SA 3K7UC 1G2SA 4A3LG 3PQIA 4EQ5A 1UEAB 1A3TA 2P5ZX 2HHHQ 2L0CA 1XMOL 1SE8A 1J5EL 3GTQH 4V190 3QOLA 4K8JA 3GTQB 1HNWL 4F87A 1NMGA 4RHRA 3WOFA 2QDBA 4IUPA 2OQ0A 1Q1EA 5J1ZA 3TZDA 1N32Q 4YCWA 1U4LA 3EFXD 4OWTB 1PRTF 2EVBA 1SSOA 1EIYB 5CV6A 1SR3A 4X64L 3NXWA 3ULPA 4CDCC 3CCMA 2ES2A 4JV5Q 3T1HQ 5GROA 1U0LA 2LXJA 1LTAD 1V8QA 4FF2A 4JYAL 1VMCA 2N88A 3GTPB 1PZJD 4EQNA 3W1BA 1CKNB 1WOCA 4GOPB 3HOYG 2R92H 4KD4A 1O7ZA 3RN2A 4YIJA 1Y69U 1QVFA 1X54A 5BR8Q 4AIMA 2QA4A 3CHBD 4BWGB 1VS0A 1PA6A 1B9NA 1EIHA 4L5RC 4C3IH 1EYGA 1PMRA 2E8GA 1EY6A 1RTOA 3TMEA 1GKHA 1EY7A 1HQRD 2LFNA 4C2MH 1HZAA 5CGKA 4GN5A 2WB1G 3GTMH 3R3OA 1VQGA 4OONA 3VYTA 1SNPA 4JBMA 5KRUA 2F4VL 3K57A 2K5WA 2ZTEA 1AEXA 1LABA 2WACA 1NBWA 3KF8A 4YHHL 2C9OA 2BA1A 1DCZA 1HNXQ 3H0GH 1QB5D 3H0GB 2C5CA 2WV6D 3OWFA 3H3VH 1VQDA 2NVTH 2NVTB 2CKZB 4MN3A 5IT9c 2J0TD 1T9HA 1LTRD 5EPLA 4XYOA 5LMUQ 4JI3Q 2F0NA 3OTOL 2AUKA 5FJ8H 3RNUA 1O80A 1E7ZA 1DXMA 5JJLA 3I72A 1DOLA 2PQEA 2F0TA 1Q46A 3NWTA 1EIGA 2OTLA 2KA7A 2YTVA 5KYIA 5LMNQ 1F9QA 5AFWA 5DNFA 1SNCA 1YNND 4HN7A 1KAWA 2X6GA 4IUTA 1PH1A 4WJ4A 2HHHL 4HJAA 4IN3A 1PRTD 2YYZA 1N34Q 4QGUA 2DJFC 2E2HH 2DGYA 4L5SA 4ABNA 3CD6A 1SJED 2NVYH 3SK4A 2NVYB 1PH7A 1Q8IA 3NQTA 4OX9Q 1J8IA 1N32L 4R8NA 2F0UA 4A76A 2F0HA 3OIQA 4JI8Q 5C44H 2K14A 1PH6A 5C44B 2F52A 3B6YA 4WORA 1KDAA 1N8RC 3SR1A 2NWGA 3S1MH 3T1HL 3S1MB 3HKSA 3KF6A 4LW1A 5IOCA 3M85A 3KLRA 3BS1A 4DK1A 4BY7H 4BY7B 3NK9A 2DJGC 1CQFA 2WAQE 3D31A 2F0GA 2WAQB 3HG9A 3CCQA 1G6ZA 3PSIA 4R8IA 1FGUA 3J80i 1LUZA 2UXCL 3PO3G 4BA1I 3CMAA 1TWGB 5BR8L 1BDOA 1Y1WH 3ER0A 3J7AF 4A3FB 1Y1WB 3MXPA 4RWSC 3TN2A 2EYMA 2D62A 1E2ZA 1ILPA 2VUMG 1L1OA 1STNA 4RGNA 2F0LA 5EKKA 2JEAI 3P75A 4BBSH 1YJNA 4R4CA 2SNSA 4BBSB 2JP1A 3I3CA 3MXNA 1HZBA 1VQFA 3K5LA 3OMCA 1PHJA 2EE1A 1HRJA 1ICFB 3LX0A 2F0FA 4DR5Q 2J7ZA 1S5BD 3MFYA 2C35B 2OXPA 2JK8A 3BDLA 5CV5A 4X62Q 5IP9G 4C3HH 2MO0A 4C3HB 2EY1A 1JJGA 1O7YA 3EBEA 1YNJC 4XT3B 3GTOH 1NE3A 1NR4A 4N8FA 1HNXL 5M3MB 3GTOB 4YWMA 4APVA 4N9PA 1PTOF 4JK1C 5KNDA 5LL6X 2IHEA 1K8OA 3H6MA 3JAMi 1PZID 1SBBB 4LF9Q 5LMUL 3PUXA 5EBCA 2QKIC 3DHQA 1F2LA 1EL0A 4Y52H 3KF6B 2I07B 1FVIA 4X3UA 1FNWA 3BVZA 4A3CG 2PW5A 2A19A 1H9MA 3QIAA 3CXCA 5M3FH 2JA8G 5M3FB 3VR5A 2OEOA 5LMNL 2NVXH 4HCEA 2NVXB 5KEEA 2NZHA 1EQVA 2AHOB 3L0OA 2PNRC 1N34L 3DUZA 3MHBA 3H3VI 4A3JH 4A3JB 1YNNC 3HOVB 4P71A 2WIIB 4B3TL 1D5XC 4CDEC 4OX9L 1DJRD 3MXNB 2CH4A 1A15A 5EKIA 1E1TA 2R7ZH 2R7ZB 1YZ6A 2DY8A 5D3DA 3HEJA 1NR2A 1SYEA 1K8AC 4FP5D 2QGQA 2E2JB 4DGZA 1M4VA 2EPBA 1T5XD 3GTGH 2KEEA 2R7FA 3FHWA 3GTGB 1JJCB 1JE5A 3EQLC 4RHSA 1QNUA 1EFWA 4NW2A 1HFNA 4LUOA 3Q6SA 1DYQA 3CAMA 2G9DA 1VQEA 1PDQA 1PYSB 1QOHA 2PQAA 4KN7C 3L2PA 2Z8LA 4LK1C 4UP8A 1C7YA 5EGTA 2NTSA 1F2MA 4IZ8A 4LF7Q 4A3BG 4RCOA 1K9MC 4MNOA 4K6DA 4NDXA 1VQMA 3T1YQ 4DR5L 1AP0A 1PTOD 2UXDL 2F0MA 4FYDA 1GUWA 2ID0A 4X62L 1Q8KA 1Q81C 1KABA 1RODA 1ZYRD 2VNUD 5T1GA 4CKCA 1PLFA 4J1MA 5JOBA 3CCSA 2CQOA 1I4GA 4JI5Q 2OF1A 1X56A 1EEID 1TU2B 2CHBD 1A2TA 2CW0C 3FEWX 1Z9FA 2HCCA 4DN4M 3PIP3 4RA8A 3F1ZA 1CZWA 4IQZA 2PZWA 4BA2I 1SJHD 2L11A 2RVLA 1VF7A 3S14H 4DF7A 3S14B 1HHVA 1ET6A 4O1NA 3PUZA 4I65A 4L8JA 3S2HB 2HD3A 5TSSA 1VQ4A 3A8IE 1P16A 3L7ZC 2Y0SG 2L12A 4A3GH 4A3GB 3OW2A 1VQ9A 1QVGA 1ZXTA 2YTXA 5I4DA 1QWYA 5GAHC 3F2CA 1EYAA 3RLNA 1AZQA 4KY7A 5IP7H 3S2DB 2E2IH 1SMXA 1X3GA 1PVOA 3R2IA 1EYCA 4J8QA 5JJKA 4MZ9A 4H13C 1NSNS 1TS3A 1TWHH 1TWHB 4JI1Q 3G7LA 2BA0A 4JBJA 4A3EH 4CJ2C 1VQLA 4JC0A 1HUNA 1AZPA 4IPCA 4FXDA 2K01A 5BN4A 1NUCA 4ZUJA 5EPKA 4DR2Q 3QG1A 2GVAA 5A2QE 4Q0FA 1XWEA 2CFMA 3TP6A 2LY7A 2KHIA 2RSOA 4YY3Q 1T5EA 3RZDH 5GADC 4CBVA 1KRSA 4HMJA 1NTGA 3ERQA 2EY5A 4RGMA 3AQQA 2R92G 1DOKA 2Z6KC 1IL2A 3PF4A 1VQPA 1ONLA 4IALA 4QJFA 5HGTA 1GJXA 1GUOA 4B9XA 1QUQB 5FLMH 1NY4A 2UU9L 3CPWA 3CCVA 3CW2C 3I2ZA 2IPKD 4B3RQ 3FMCA 4C3IG 1U9RA 2Z4HA 1XPOA 1RD9D 3C2PA 1Z6HA 2R6GA 1CKOA 4P2CB 3KLWA 2L9HA 1IBLQ 2F0EA 1QZGA 4LMQD 3BZKA 3KBGA 1HCZA 4NKLA 4DR3Q 2A6HC 1MJEA 5IT9E 1QJOA 2WINB 1TR5A 3HP3A 3R93A 5EAYA 2RA4A 1HNZL 5JEAJ 2R93H 3RR5A 5DEHA 3S24A 2B2VA 1XX8A 4JI5L 4B08A 2K03A 2PMZE 3BDCA 1VQJA 2PMZB 4LNQA 1NNXA 4H44C 4LF8Q 5IGFA 4POGA 2ASBA 5ELDA 3PCOB 2O5JC 3AFPA 5JJIA 2CQAA 4DV2Q 5ISRA 1TWCH 2JQOA 1V1PA 3NQIA 2K5NA 1EWHA 4HIMA 3TBIB 1I94Q 2UUCQ 1TY2A 2NVQB 2AQ2B 2F0QA 2FINB 2ZT9C 1G91A 1X3PA 3SK5A 2MGSA 2ICEC 3Q24A 4ILWA 1YIJA 3NBIA 3K0YA 4RAUC 5ELNA 1TIID 3DWPA 2EJGC 1S5CD 4CJ1B 1IZ6A 3PIOA 4K14A 4POFA 4IUQA 1V1OA 4U673 2ZJQA 4A3IB 2NYZD 3QO2A 4ME5A 2QDLA 2IWHA 1K3RA 4XYQA 3MAQA 2JA5H 3NBHA 4B9WA 5C3WA 1ESRA 1TWAH 1TWAB 5C44G 1Q3LA 1EQTA 5IYBH 2EY6A 3A74A 4LFCQ 2R7DA 4PZ6A 1J9OA 4DR2L 1PRTB 1DZ1A 1PH3A 2BE5D 2HIXA 2ZXPA 1BCPC 1SRUA 1DD2A 2EXDA 2L5TA 3STBD 1TS2A 5LHY1 4YY3L 3CCUA 2XIWA 1S5ED 3T16A 4C3JH 4GN4B 3L9AX 4C3JB 2YV5A 2WAQG 4CKEA 1EQQA 2JE6I 4LF5L 2AKWB 2K5HA 2PI2A 4QIWE 1Y1WG 2IY5B 2SEBD 4QIWB 2ALYB 1PFSA 3HOXH 3HOWH 5FO8B 2Q2TA 3HOXB 3HOWB 3E9HA 1B9MA 1B4OA 5JVG3 2A73B 1HA5A 4BBSG 3K81C 4I7AA 1WTWA 2OT2A 4GOPA 1GOZA 1YJWA 4TKOB 5IT9L 1CSQA 1IHZA 1ML0D 1IBLL 3K6OA 5ELOA 4DR3L 1D6EC 5BN5A 1SNDA 5DAUA 1I6VC 4XQNA 1G2TA 1I4HA 2EIFA 4DR6Q 1CSPA 1YITA 2KVMA 3NWSA 1AH9A 2RKSA 2A68C 2D0OA 4ZLTF 3M4PA 1HTLD 1KLGD 5CR3A 4RH6A 4LFBQ 3I4NH 3KLSA 1SN8A 2NTTA 4J6HA 5K5PA 2QEXA 1WTRA 4LF8L 2LS01 1SAPA 1ET9A 4GN3B 4DV2L 4JW0A 4GLXA 1C8CA 2CWPA 1LT3D 1I94L 2UUCL 2K28A 2NN6G 3T53B 1KNAA 3OHXC 2Z1CA 4ID6A 1VQAA 3BDOA 3VR4A 2B29A 3VR3A 1OXUA 5CBEE 4BY1G 1JWUD 5M3FG 4YWKA 3VR6A 5KYLA 2ZJPA 1L1OC 5FOBB 1VQ5A 4FF1A 2PI2E 1CHPD 2KBNA 3C1FA 2KOLA 2WFWA 2KCMA 2M00A 1JJ2A 2Q2UA 2B2WA 5I6WA 4QUCA 4A3JG 4OEMB 1A2UA 1FNUA 3FKIB 4F8MA 4GNXB 3UDXA 3LWEA 3GTPH 3FRPB 3U9OA 1MSHA 4IPGA 5C3EG 2JA7G 5CMDA 3TZUA 1EIFA 5C4XB 3E3XA 3SK8A 3PUYA 4L6TB 3M3YB 2R7ZG 2G9HD 1RDPD 4JI0Q 3ND8A 1STEA 1MBYA 3PO2B 1SNMA 3U4ZA 2Z4IA 1JC7A 4IOAA 3A54A 2JA9A 4MHEA 1HPCA 1JWMD 2AQ1B 3AFQA 4L5QA 4AYBE 2OTJA 2XWJB 2E2DC 4AYBB 2NUCA 2KCTA 1SE2A 1E0BA 2BE5C 2LXKA 2MQHA 1JR0D 1WTPA 1QG7A 1MJCA 1JOQA 3STBC 3MTSA 1B2TA 4X6AH 4HCSA 4JBKA 3RZOH 4DA2A 3RZOB 1YNJD 1CKMA 4JI4Q 5F2DA 3D8GA 1GXDC 2QCPX 1QE6A 1PFBA 1UE7A 2F0SA 4DR7Q 4RKLA 4DKAC 1B70B 2KENA 4KD3A 4HMIA 3RLOA 3S9WA 3I4LA 4GZYC 1ENAA 4UAIA 3RMHA 2RDGA 3FDTA 4Y7NH 3CCJA 4DR6L 5EJWA 4Y7NB 1KXLA 1KC8C 3P20A 4LFBL 4X3SA 2WP8J 3ULLA 2TSSA 1C4QA 4NP5A 4ZRZA 1M90C 1PTOH 5ELBA 1PTOB 4PMWA 2UUAQ 2BH8A 1EZ6A 1BBWA 4JVZA 4DV7Q 4KHPQ 5C0XJ 3E6ZX 2B2YA 1S40A 1U4PA 5JJZA 5D14A 4WJ3M 4A3MH 1LTSD 1PH8A 2F3IA 1U4MA 4A3MB 2WKDA 2V4DA 5JAVA 4XT1B 2KJXA 1YI2A 4OHJA 4QQBX 2H4OA 2YTYA 4EQPA 4RKBA 2JA6H 1BF4A 2JA6B 5JPMC 3KDFA 4A3GG 4IFDJ 1HQMC 3TS2A 3M4QA 4NXMQ 1H9JA 3K80C 1B53A 5JEAH 4FF3A 4JV5L 1RCVD 1PYWD 5IP7G 2VQFQ 1EYDA 1HFGA 2FMMA 4KHZA 2E5LQ 3A7LA 2EYPA 1KRTA 3H15A 1CT1D 3PUVA 3AEVA 3GV3A 1W6JA 4JI0L 4FF4A 1S5DD 4A3EG 1TWGH 4A3FH 5D3IB 2HDLA 5A35A 1BNZA 2I5HA 5IGBA 1TKWB 1LTGD 3P7JA 2O5IC 4X66Q 3KJPA 1UE1A 1YHQA 3BZCA 4LJZC 1W6KA 3FPPA 4B3SQ 3S17H 1GHKA 3S17B 5EQ0A 1GUSA 4HSVA 3BJUA 2RHSB 1JB7A 4F88A 1SE4A 4JI4L 1R9TH 3NE5B 1UNSA 5CC4A 1R9TB 4OIJA 3EIVA 3HOZH 4C1NI 2I5LX 3HOZB 5FLMG 3OIPA 1XXGA 1LACA 5G3LF 3TRZA 5M3MH 4XTCS 3KYHC 3D6WA 2L1BA 3VR2A 2CW0D 1F2YA 1NAPA 3JC66 5E1FA 1EU4A 1BBUA 3KDFB 5ELFA 5IIFA 3AU7A 4DUYQ 4JI3L 3OOCA 4IPDA 2M2LA 2F3WA 2VB2X 4ODGA 5IE8A 2Z6BA 1B3AA 4R1JA 1KDCA 2R93G 1Y8OB 1PH2A 5IYDH 3VA7A 5ELCA 4ZAIA 5L37A 2JEBI 2DN8A 2IL8A 1HR0W 1PZKD 1GM5A 3CU7A 2UUAL 2R61A 3UDIA 2DUDA 3K59A 4KHPL 2Q2IA 4DK6C 4A3LH 1IXRA 4DV6Q 1FGBD 4FDBA 1SLJA 3HOVH 1EFID 1EUJA 3IL8A 3NTKA 1H95A 3GP7A 5AJ3Q 1N36Q 4JI8L 1AW7A 4LUZA 2RDHA 3F2DA 3UE1A 2F0VA 4PZ7A 4NXML 2EQSA 5JPNC 4UP7A 1ILQA 2VQFL 3AMUA 3PMFA 2EYJA 4DAYB 2IX1A 4BXXH 1R4QB 1X9NA 1CA5A 2E5LL 2E2JH 3TP5A 3TSSA 4HTHA 2B63G 4HIDA 2PZUA 1BCPF 1MGSA 2JA5G 5IWAQ 3CCRA 4R4IA 3D4DA 3J81E 1K83H 3R2TA 1QILA 5IYBG 3S1NH 1K83B 2F0KA 1CFMA 1E22A 3S1NB 1IL8A 3TREA 3GD7A 3S1RH 1XJVA 3S1RB 2EOTA 4WFN3 3CP0A 2KHSA 1B44D 4AH6A 4B3SL 1JWSD 4HR7B 1EWCA 2F0WA 5G3LD 2A6HD 1LTID 2F3VA 1VQ7A 3CPFA 2WB1E 4KY6A 2WB1B 1YJ9A 1MSGA 3GTKH 2FJ2A 4H02A 3GTKB 3URYA 5FO7B 4CDFC 4MTNA 1SYFA 4OELB 4JPBW 3HOXG 1K28A 1KAAA 1GO3E 1CK1A 3NEMA 2NZ1D 4KJOA 3LWUA 1JORA 1YNXA 2RHQB 2K5VA 3HOUG 3IKJA 5I2XA 4A4IA 3CC2A 4LF9L 3HKZG 3TQYA 4DUYL 2KECA 2QW7A 1UE5A 4DNIA 4JOIA 3I90A 3X3MA 1KNEA 4ULLA 1QUQA 3ZYYX 3A5UA 5C5MA 4CGYB 1VCIA 4A93G 4FXKC 5FLXc 4OWWB 1OXTA 2RSNA 1F9SA 1GVPA 3I4NG 3S2HH 1SEBD 2VB3X 4KLKA 1Q12A 2H1EA 3M7NA 5CYUA 4PG3A 4LF4Q 3K8AA 1VQHA 2FMCA 3A8JE 2L55A 4DV6L 1WD1A 5FKAC 1A6XA 3S2DH 1KTKA 1MHWC 1F9RA 2E76C 1CA6A 1VQ8A 5CV8A 3NUCA 3MC0B 1EZ8A 2WKCA 4P73A 4DK3C 5AJ3L 2X6LA 1D1KA 1E2VA 1NMFA 3GO5A 5M5XH 1N36L 5M5XB 2K33A 2PO4A 1TS5A 4X3KA 3Q22A 2HIVA 2X69A 1KLUD 1BCPD 3J80c 1BR9A 5FO9B 4GOPC 1WCMH 1WCMB 2MFIA 5FK9C 2K5DA 4DXFA 4PMCA 5M5YH 5DM73 2ENBA 3G48A 5M5YB 1TWFH 2EYFA 1TWFB 2Q8RE 2EY2A 4BS9A 5EPJA 2XGTA 4KTAA 4OL7A 5IWAL 1KHIA 3TDQA 5KNBA 4PNYA 1X65A 5C0XH 1EY5A 3PO3B 1HH2P 3T4AC 4TSSA 4UY8C 1LT4D 1STAA 1YEZA 5M5WB 5GAGC 1EU3A 4NXNQ 2D9UA 2VUMB 4LF7L 5J22A 3HZXA 4U68A 4RCNA 2PNHA 5J39A 3T1YL 2CVRA 4IFDH 4GLVB 1BUVT 4DNTB 1VQNA 2A68D 1Q82C 5J3BA 3H3VC 2A6EC 1ENCA 1PV4A 4O42A 4HAEA 1CQVA 3DMUA 1H9RA 3TS0A 1FJGQ 3CRLC 1MD2D 2HQEA 3K58A 1V1QA 2AUJD 3H0GG 1DM0B 2B2WC 1B50A 4XDXA 3RUZA 3I8ZA 3TEHB 1LLRD 4KHVA 5KNCA 5E3FA 3SGIA 3E0JA 2RCFA 5FJ8G 3BZDB 2A1AA 5I9OA 2K04A 4UPAA 2NVQH 1UEBA 4WJWA 2ZTDA 3G4SA 1KL9A 2JA8H 3T51B 2JA8B 1IKMA 3CMEA 2FFKB 3VYUA 2YU9H 4CDDC 2YU9B 1IW7D 4LF4L 2EYOA 4UHVA 2RCNA 1MI2A 1SYGA 4PZ8A 3L3OC 2IW3A 1TXYA 3ERSX 4F7XA 1LT6D 1SYCA 4DUZQ 4ZK9B 4A3MG 3ND9A 2PZTA 4NMZA 4A3IH 1Q7YC 1XMOQ 1J5EQ 4OIKA 3CC7A 1VQIA 4JI1L 5COYA 2JA6G 1SYDA 5C4HA 1K8MA 3PV0A 5HY6A 5A2QL 2B8GA 1WTOA 1G8ZD 3PGZA 2DNCA 4DK0A 1LTTD 2MO1A 3EJIA 2AWOA 5JEAG 4UP9A 1S4ZA 1UE6A 2JXMB 3A7AB 1K0SA 2F0JA 4B3MQ 2I46A 4XIGS 4JYAQ 2N55A 1EWIA 5ELEA 4BY7G 1LTBD 3J81c 3DM1A 1BO0A 4FXGC 1DGSA 1QNKA 4DAPA 2UXBQ 4GKJQ 1JICA 1RL2A 1PH5A 3E0EA 2FHTA 1S3OA 3CCEA 4EX5A 3G6JB 4A3FG 4K5WA 1IKLA 2K05A 2XRQD 1X6OA 1D2BA 2TMPA 3J81j 4B3RL 4GNXA 3K5MA 2K7VA 2B2YC 3T56B 4K2KA 2CH4W 3J7A5 4LAAA 1L0WA 3NTIA 3KLSX 4IUUA 1H9SB 4ZYSA 1BOSA 2EYLA 3V96A 1Q1BA 3KUPA 4C56C 2F0IA 5CV7A 1D7QA 3F8TA 5M9OA 2Z0SA 4IPHA 3HOZG 4IJHA 4C1NK 1GD7A 3IFTA 4QMGA 4C3HG 5D65A 1O78A 2CWAA 5C0XI 1IBKQ 1STGA 2RDFA 5M3MG 2HT1A 1Y8NB 3TP7A 5GAEC 3J7ZC 1EY9A 3BYTB 1S5FD 3D4WA 1I50H 4DFAA 1I50B 1LV9A 1STYA 2KCNA 4ALPA 2JJQA 4X3TA 3C3LA 2XTIA 3SVMA 2XVSA 3RN5A 2ZXRA 3ZJYC 1JE4A 4HEDA 4R4QA 4IFDI 1FYCA 3K7AB 2K5QA 4HSPA 5IYDG 2IJ0A 3U50C 4QY7A 1Q86C 5I9PA 4IUVA 4QB4A 2Y0SE 4S3SA 3CF5A 1F9PA 5CORA 2Y0SB 4IO9A 4K5XA 3MFGA 1R4PB 2DY7A 4NB3A 3ULJA 4DUZL 1IW7C 2A8VA 1D5ZC 3KJOA 2Q8IB 3FKIH 1HR0Q 3HOVG 2G5DA 1L2FA 1X3QA 5C5LA 1A62A 1ENFA 2XSCA 1XTDA 4G7ZC 1NCVA 5C4XH 3BVMA 1UUPA 1SMYD 3M3YH 3AB9A 2NB0A 1VQ6A 4LFCL 4DV0Q 5H1SE 3PO2H 2HDMA 4QUFA 4QF4A 3LGJA 3C1EA 4PQXA 3S16H 3VA5A 1TS4A 3I70A 3S16B 2ATWA 2NZOA 3Q23A 2FXQA 4B3ML 1H9KA 4BXXG 1BBXC 2QEJC 5K36H 2N8NA 3MXUA 1GUTA 4A3KH 1I4RA 2V1CC 3KK7A 4A3KB 2UXBL 1A0IA 4GKJL 3QOJA 3GV6A 2R92B 2B2UA 2B8FA 3RD4A 1Y1VH 1Y1VB 2UXCQ 1GUGA 5LL6S 2KEDA 2EXZA 1XYIA 1LO5D 2IHFA 4JG2A 1RJTA 3FVQA 1EOTA 4JI6Q 3Q0AA 3G71A 4M8AA 4P75A 3MVVA 4OGQC 4C3IB 2HQLA 4LUVA 1W3SA 4OO1H 3DLLA 2GN5A 4C2MB 4GKKQ 3OYYA 3I73A 2Q2HA 4XXEA 3U4VA 4FVMA 3GTMB 1IYUA 3VDYA 2LKVA 2BDOA 2VQEQ 1IBKL 3V2TA 1SDFA 1KD1C 1SNQA 5HGQA 3N52A 1STHA 1KQSA 4PV1C 3QR8A 5FLXE 1EY8A 3CQZH 2JYOA 3CQZB 2IX0A 3GDEA 1PH9A 2SOBA 1VQBA 3M7GA 1TY0A 1A8VA 4RG1A 3E5SA 3A0JA 3A5ZB 4L5TA 4LFAQ 3PIPA 1WVLA 3U58A 1SFOH 1SFOB 4GLAC 5E4XA 1CUKA 4XQQA 3EA6A 2MUYA 4JCVE 1PXUA 4O2DA 1STBA 3PIO3 3IAYA 4RMFA 1XNQQ 1HUMA 3GTLH 1PFNA 5CV4A 3GTLB 1WFQA 2J4XA 2VZAA 4R4OA 3UDGA 1HR0L 3MZ5A 2MP1A 3D0FA 1XPRA 1TVXA 1A3UA 2K4KA 3J80E 2E2HB 3S15H 4FNFA 3S15B 2ZM6Q 3K5OA 2AQ3B 4M1UB 4KKTA 4B3TQ 3OW7A 2BDNA 1I6HH 4K8IA 1I6HB 2RQXA 1UWVA 3MA2B 3OWEB 1CM9A 3W2DA 1RF2D 3G6EA 4RGOS 4DV0L 1FD7D 5C4JH 5IGGA 2BH2A 5C4JB 1N33Q 1Z7TA 1QVCA 1I4QA 1OXXK 4OXPA 1WCMG 3HGBA 3MEFA 3H91A 4KI0A 1SMYC 1QZHA 4BBRH 5IYCH 1CHQD 1X3FA 1I4XA 2M9VA 4BBRB 5IODA 2BCOA 1K73C 4JOIC 3KF8B 4J15A 2B2TA 4UDUC 1JCKB 3KOJA 3PF5A 3RLFA 1W2BA 1B8AA 1FNVA 3GTJH 1AE3A 3O13A 3GTJB 4G7OC 5C0XG 4IOCA 1BCPB 1SE3A 4Z9CB 1WD0A 3SXHA 2RBMA 1DOMA 4X65Q 4JI6L 1P8LA 1I4PA 4G57A 2JSOA 4DR7L 1LM0A 4DAYA 1VQOA 3KBXA 4HIOA 3JAME 4HIKA 1BXTA 5T1IA 4LWCA 4N9TA 3IRBA 3F2BA 3ITPA 4GKKL 1PH4A 4IFDG 4O0AA 5DM63 1YBYA 4XQJA 2UXDQ 1G6PA 1VQCA 3I4MH 3X3NA 3I4MB 4KY5A 2VQEL 3A8KE 1OTCA 2OQKA 1WTHA 3SEBA 2MPMA 5FLXL 1Y8PB 2D2CC 2KHJA 2F0OA 1II3A 4A3DH 1A63A 1QCBD 4A3DB 4KKSA 1ASZA 1AE2A 4GS3A 1AN8A 2AWNA 1AFPA 1V9PA 4DV7L 3H94A 4K0KQ 1RKNA 4DAVA 1OO9B 3W1GA 2NN6H 5CV9A 3Q8DA 4H7BA 4EVOA 4LFAL 3OMGA 1EEFD 1G291 2N49A 1G51A 1ASYA 4OO1I 2AMCB 4JI2Q 4BY1H 1B3QA 4BY1B 2K1BA 1XNQL 1K0RA 2EYHA 3MXGA 3SDZA 1FL0A 3J80L 1K8GA 2HCIA 3CCLA 3OSOA 1N9WA 1GUNA 2PPBC 4KN4C 2H5XA 1JQYD 2D0PA 3F2UA 3J7AV 2ZM6L 1L1OB 4A3IG 4E6IA 2F4IA 5C3EH 2JA7H 3N6RA 5C3EB 1PRTC 1WJJA 2JA7B 1C48A 4DV4Q 3HOYH 3HOYB 4EQOA 1M8AA 2ZXOA 3ONAB 3M4OH 3NPPA 3M4OB 4TRDA 1N33L 2B2VC 1X32A 1VDZA 1PYBA 4X66L 5KGUA 3U9SA 4EGVA 1EQRA 1OXVA 1M1KC 2B39A 3A55A 4DV5Q 4MIUA 4C3JG 1WTQA 2A6ED 1K3BC 3NENA 1CI3M 2HUGA 2XRSD 2IT1A 1V43A 1U5KA 1EOVA 3JAML 1Y14B 4X65L 1JMCA 2A74C 3D6CA 3E9IA 1YHBA 1BVSA 1HTPA 2O2LD 5EBDA 2XWBB 5I2YA 2UU9Q 1ZKOA 3HOWG 3DEPA 1MIUA 3J81i 3UDFA 3FP9A 1MKHA 2EJMA 2Q8TA 3W3AA 1ESFA 3EROA 4DR4Q 3MEHA 4DV1Q 3ICEA 2L15A 3DWAA 1HZ9A 1SXTA 4ZKCB 2EZVA 5LMNW 2DNEA 1GHJA 5C3XA 1C9OA 4PMBA 3S1QH 3S1QB 4I7ZC 2K50A 5CBAE 4LF6Q 1WI5A 1HNZQ 1IBMQ 2LSSA 3R8BA 1SNOA 2VL6A 4DU9A 4QL5A 4L63B 5IY0A 2Z9HA 1I3QH 3OPOA 4OWXB 1I3QB 2ICIA 4JBWA 4ZQ3A 1RIPA 2BOSA 4K0KL 1TT2A 2CCZA 2ZTCA 4YCVA 1HJPA 2PYKA 4DV3Q 3VYRA 4JI2L 4IJLA 1DONA 2F0PA 3NELA 1D1IA 5C4ZA 3HS0C 3LNNA 4CJ0B 2RF4A 1C0AA 5HURA 3CC4A 4P72A 2JN4A 3WOEA 3A56A 3NTHA 4GNXC 1CTMA 3FPUB 1SYBA 2A69D 3BYYB 4P74A 1RHPA 3DM3A 4N8X1 2PQAB 4KV6A 2E2IB 2N78A 1XNRQ 1BQQT 3FKIG 4RFBA 4FO2A 1VMPA 4DV4L 3J81L 2I5MX 2NN6I 2VS1A 3DWQA 4JI7Q 5C4XG 5E4WC 4A3EB 3PO3H 2EJFC 1E2WA 2OCEA 5NUCA 5M5WH 1UAPA 2KCCA 2GA4B 4KK7A 4KMUC 3PO2G 1A3VA 1L0YB 4TVAB 3DXJC 2VUMH 4DNRB 1JOOA 4AYBG 4DV5L 5K36G 2E75C 5C6AA 2KQ3A 4IUNA 4A3KG 3NSWA 3RZDB 2LMCB 2O4XA 2QILA 3I55A 1XTCD 2K6AA 3CKIB 2GVBA 1Y1VG 1HA6A 4LF5Q 2K75A 3IFDA 4NPSA 3W5OA 3JAMc 1X55A 5IP9H 1S72A 1O7LA 1KIXA 1TQOA 2F0DA 2OWOA 3GQBA 3SE0A 4ME3A 2F03A 1L0XB 1XMQQ 1U4RA 3I56A 1F77A 4RGTA 2ZJRA 1E24A 3EN2A 4OO1G 1KDBA 3SK6A 4DR4L 3BG3A 4ZUIA 4YWLA 4DV1L 1JT8A 5EKLA 2D5DA 2VW9A 1PTOC 4AQYQ 4LF6L 1WTVA 1I5FA 5IGDA 3D4RA 1IBML 2UUBQ 2R93B 4A3CH 2SDFA 2XNAC 4HJ9A 1ZYRC 2VXWA 3J7YW 3WWVA 5DLQE 4HJ8A 4DR1Q 1H9SA 2NBFA 1WTXA 3MWYW 1D8LA 3M9BA 1EY0A 4DV3L 4K5VA 1O7IA 1TWCB 5GQOA 1HXYD 2B2UC 1FR3A 4H0LC 5JVH3 4DPGA 2MHVA 3PUWA 4MTKA 1ZEQX 5I6YA 2PCFB 1BKBA 4TQUS 1HNWQ 2F1MA 1YVCA 2K32A 3I91A 4R4TA 1ICWA 3K0XA 2L4NA 1E1OA 4DXGA 3QJYA 1J6QA 1CZGA 3D3RA 2R3ZA 4X64Q 3EVQA 1XNRL 1D5MC 5IGCA 4Q5VA 2A69C 1JOKA 4A75A 1Q90A 4IURA 3TP8A 3V05A 3WDNA 2B63H 2K52A 3SHLA 3I7FA 2B63B 4JI7L 2JA5B 3P1HA 4CKBA 5BN3A 2EDGA
chains in the Genus database with same CATH topology
2A5HA 3CRKC 2QF7A 2PW7A 2MJ8A 4A3BB 4KKUA 1F2ZA 5IGEA 4CHTB 3NP8A 1RTNA 3NHHA 3T13A 3DEOA 3K5NA 2XN9C 3M4YA 3HRZC 1EY4A 1VF5C 1V1PB 1JB3A 4G4KA 1OXSC 1IYVA 4WRDA 3QB3A 1B1ZA 3BVGA 4QCLA 3HOUB 4V0BA 4K2LA 3HKZB 2KUMA 3H09A 2IX3A 1LT5D 3C46A 5KIXA 1Z47A 2E74C 4A93B 4R9WA 3I4NB 4ZKBB 3VYSA 4KJNA 1PFMA 2B2TC 2SNMA 4K6LA 3QWNA 3UI2A 4G7HC 1G2SA 1UEAB 1A3TA 2L0CA 4V190 3QOLA 4K8JA 3GTQB 4F87A 4RHRA 3WOFA 2QDBA 4IUPA 1Q1EA 5J1ZA 3TZDA 1U4LA 3EFXD 1PRTF 2EVBA 1SSOA 5CV6A 3NXWA 4FF2A 1LTAD 1V8QA 1VMCA 2N88A 3GTPB 1PZJD 4EQNA 4KD4A 1O7ZA 4YIJA 1Y69U 3CHBD 4BWGB 1B9NA 1EIHA 1PMRA 1EY6A 1RTOA 3TMEA 1EY7A 1HQRD 2LFNA 5CGKA 3R3OA 3VYTA 1SNPA 5KRUA 3K57A 2K5WA 1AEXA 1LABA 2WACA 3KF8A 2C9OA 2BA1A 1DCZA 1QB5D 3H0GB 2C5CA 2WV6D 3OWFA 2NVTB 4MN3A 2J0TD 1LTRD 5EPLA 4XYOA 2F0NA 2AUKA 1O80A 1DXMA 3I72A 1DOLA 2PQEA 2F0TA 3NWTA 1EIGA 2KA7A 5KYIA 1F9QA 5AFWA 5DNFA 1SNCA 1YNND 4HN7A 2X6GA 4IUTA 4IN3A 1PRTD 2YYZA 4ABNA 1SJED 3SK4A 2NVYB 1Q8IA 3NQTA 1J8IA 4R8NA 2F0UA 2F0HA 3OIQA 5C44B 4WORA 1KDAA 3SR1A 2NWGA 3S1MB 5IOCA 3M85A 3KLRA 3BS1A 4DK1A 4BY7B 3NK9A 1CQFA 3D31A 2F0GA 2WAQB 3HG9A 1G6ZA 4R8IA 4BA1I 1TWGB 1BDOA 3J7AF 4A3FB 1Y1WB 3MXPA 4RWSC 3TN2A 2EYMA 2D62A 1E2ZA 1ILPA 1STNA 4RGNA 2F0LA 5EKKA 2JEAI 3P75A 2SNSA 4BBSB 2JP1A 3I3CA 3MXNA 3K5LA 3OMCA 1HRJA 2EE1A 3LX0A 2F0FA 2J7ZA 1S5BD 3MFYA 2OXPA 3BDLA 5CV5A 4C3HB 2EY1A 1O7YA 1YNJC 4XT3B 1NR4A 5M3MB 3GTOB 4N9PA 1PTOF 4JK1C 5KNDA 5LL6X 1K8OA 3H6MA 1PZID 1SBBB 3PUXA 5EBCA 2QKIC 3DHQA 1F2LA 1EL0A 2I07B 4X3UA 1FNWA 3BVZA 2PW5A 3QIAA 1H9MA 5M3FB 3VR5A 2OEOA 4HCEA 2NVXB 5KEEA 1EQVA 2PNRC 3DUZA 3MHBA 4A3JB 1YNNC 3HOVB 2WIIB 1D5XC 1DJRD 1A15A 5EKIA 2R7ZB 2DY8A 5D3DA 3HEJA 1NR2A 1SYEA 4FP5D 2E2JB 4DGZA 1M4VA 2EPBA 1T5XD 2KEEA 3GTGB 3EQLC 4RHSA 1QNUA 4NW2A 1HFNA 3Q6SA 1DYQA 2G9DA 1PDQA 1QOHA 4KN7C 2Z8LA 4LK1C 5EGTA 2NTSA 1F2MA 4IZ8A 4RCOA 4K6DA 4NDXA 1AP0A 1PTOD 2F0MA 4FYDA 1GUWA 2ID0A 1KABA 1RODA 1ZYRD 2VNUD 5T1GA 4CKCA 1PLFA 4J1MA 5JOBA 1I4GA 2OF1A 1EEID 1TU2B 2CHBD 1A2TA 2CW0C 3FEWX 2HCCA 3PIP3 4DN4M 4RA8A 1CZWA 4IQZA 2PZWA 4BA2I 1SJHD 2L11A 2RVLA 1VF7A 4DF7A 3S14B 1HHVA 1ET6A 4O1NA 3PUZA 4I65A 4L8JA 3S2HB 5TSSA 3A8IE 3L7ZC 2L12A 4A3GB 1ZXTA 5I4DA 1QWYA 1EYAA 1AZQA 4KY7A 3S2DB 3R2IA 1EYCA 4J8QA 4H13C 1NSNS 1TS3A 1TWHB 3G7LA 2BA0A 4CJ2C 1HUNA 1AZPA 4FXDA 2K01A 5BN4A 1NUCA 4ZUJA 5EPKA 3QG1A 5A2QE 4Q0FA 1XWEA 3TP6A 2LY7A 2RSOA 1T5EA 4CBVA 4HMJA 3ERQA 2EY5A 4RGMA 1DOKA 1ONLA 4IALA 5HGTA 1GJXA 1GUOA 4B9XA 2IPKD 3FMCA 4C3IG 1U9RA 2Z4HA 1RD9D 3C2PA 1Z6HA 2R6GA 4P2CB 2L9HA 2F0EA 4LMQD 3KBGA 1HCZA 4NKLA 2A6HC 5IT9E 1QJOA 2WINB 1TR5A 3HP3A 3R93A 2RA4A 5JEAJ 5DEHA 2B2VA 1XX8A 4B08A 2K03A 3BDCA 2PMZB 4H44C 5IGFA 5ELDA 2O5JC 2CQAA 5ISRA 1V1PA 3NQIA 1EWHA 3TBIB 1TY2A 2NVQB 2AQ2B 2F0QA 2FINB 2ZT9C 1G91A 1X3PA 3SK5A 2MGSA 2ICEC 3Q24A 4ILWA 3NBIA 3K0YA 4RAUC 1TIID 3DWPA 2EJGC 1S5CD 4CJ1B 4K14A 4IUQA 1V1OA 4U673 4A3IB 2NYZD 3QO2A 4ME5A 2IWHA 4XYQA 3MAQA 3NBHA 4B9WA 5C3WA 1ESRA 1TWAB 1Q3LA 1EQTA 2EY6A 1J9OA 1PRTB 1DZ1A 2BE5D 2ZXPA 1BCPC 1DD2A 2L5TA 5LHY1 1TS2A 2XIWA 1S5ED 3T16A 3L9AX 4C3JB 4CKEA 2JE6I 2SEBD 4QIWB 5FO8B 3HOXB 3HOWB 1B9MA 1B4OA 5JVG3 2A73B 1HA5A 1WTWA 2OT2A 1GOZA 4TKOB 5IT9L 1IHZA 1ML0D 3K6OA 1D6EC 5BN5A 1SNDA 5DAUA 1I6VC 4XQNA 1G2TA 1I4HA 2KVMA 3NWSA 2RKSA 2A68C 4ZLTF 1HTLD 1KLGD 5CR3A 4RH6A 3KLSA 2NTTA 4J6HA 5K5PA 1WTRA 2LS01 1SAPA 1ET9A 1C8CA 1LT3D 2K28A 2NN6G 3T53B 1KNAA 3OHXC 2Z1CA 4ID6A 3BDOA 3VR4A 3VR3A 1OXUA 5CBEE 1JWUD 3VR6A 5KYLA 5FOBB 4FF1A 1CHPD 3C1FA 2KOLA 2M00A 2B2WA 5I6WA 4QUCA 1A2UA 1FNUA 3FKIB 4F8MA 3LWEA 3FRPB 3U9OA 1MSHA 5CMDA 3TZUA 5C4XB 3SK8A 3PUYA 4L6TB 3M3YB 2G9HD 1RDPD 3ND8A 1STEA 1MBYA 3PO2B 1SNMA 2Z4IA 1JC7A 3A54A 4MHEA 1HPCA 1JWMD 2AQ1B 2XWJB 2E2DC 4AYBB 2NUCA 1SE2A 1E0BA 2BE5C 1JR0D 1WTPA 1QG7A 1JOQA 3MTSA 1B2TA 4HCSA 4DA2A 3RZOB 1YNJD 5F2DA 3D8GA 1GXDC 2QCPX 1QE6A 1PFBA 2F0SA 4RKLA 4KD3A 4HMIA 3S9WA 3I4LA 4GZYC 1ENAA 4UAIA 3RMHA 2RDGA 3FDTA 5EJWA 4Y7NB 3P20A 4X3SA 2WP8J 2TSSA 1C4QA 4NP5A 4ZRZA 1PTOH 5ELBA 1PTOB 4PMWA 1EZ6A 5C0XJ 3E6ZX 2B2YA 1U4PA 5JJZA 5D14A 1LTSD 1U4MA 4A3MB 2WKDA 2V4DA 5JAVA 4XT1B 2KJXA 4OHJA 2H4OA 4EQPA 4RKBA 1BF4A 2JA6B 5JPMC 4IFDJ 1HQMC 1H9JA 1B53A 5JEAH 4FF3A 1RCVD 1PYWD 1EYDA 1HFGA 2FMMA 4KHZA 3A7LA 2EYPA 1CT1D 3PUVA 3GV3A 1W6JA 4FF4A 1S5DD 5D3IB 2HDLA 5A35A 1BNZA 5IGBA 1TKWB 1LTGD 3P7JA 2O5IC 4LJZC 1W6KA 3FPPA 1GHKA 3S17B 5EQ0A 1GUSA 4HSVA 4F88A 1SE4A 3NE5B 1UNSA 5CC4A 1R9TB 4OIJA 4C1NI 3HOZB 3OIPA 1XXGA 1LACA 5G3LF 4XTCS 3D6WA 3VR2A 2L1BA 2CW0D 1F2YA 1NAPA 5E1FA 1EU4A 5ELFA 5IIFA 3AU7A 3OOCA 2M2LA 2F3WA 2VB2X 4ODGA 1B3AA 1KDCA 1Y8OB 3VA7A 5ELCA 4ZAIA 2JEBI 2DN8A 2IL8A 1PZKD 3CU7A 2R61A 3K59A 1FGBD 1EFID 3IL8A 3NTKA 3GP7A 1AW7A 2RDHA 2F0VA 5JPNC 1ILQA 3AMUA 3PMFA 2EYJA 2IX1A 1R4QB 1CA5A 3TP5A 3TSSA 4HTHA 2PZUA 1BCPF 1MGSA 3D4DA 3J81E 3R2TA 1QILA 1K83B 2F0KA 1CFMA 3S1NB 1IL8A 3GD7A 3S1RB 2EOTA 4WFN3 2KHSA 1B44D 1JWSD 4HR7B 1EWCA 2F0WA 5G3LD 2A6HD 1LTID 2F3VA 4KY6A 2WB1B 1MSGA 2FJ2A 3GTKB 3URYA 5FO7B 1SYFA 1KAAA 1CK1A 2NZ1D 4KJOA 3LWUA 1JORA 3IKJA 5I2XA 2KECA 3I90A 3X3MA 1KNEA 4ULLA 3ZYYX 5C5MA 4CGYB 1VCIA 4FXKC 1OXTA 2RSNA 1F9SA 1SEBD 2VB3X 1Q12A 2H1EA 3M7NA 5CYUA 2FMCA 3A8JE 2L55A 1WD1A 5FKAC 1A6XA 1KTKA 1F9RA 2E76C 1CA6A 5CV8A 3NUCA 3MC0B 1EZ8A 2WKCA 2X6LA 1D1KA 1E2VA 3GO5A 5M5XB 2K33A 2PO4A 1TS5A 4X3KA 3Q22A 2X69A 1KLUD 1BCPD 1BR9A 5FO9B 1WCMB 5FK9C 2K5DA 4DXFA 4PMCA 5DM73 2ENBA 5M5YB 2EYFA 1TWFB 2Q8RE 2EY2A 4BS9A 5EPJA 4KTAA 4OL7A 3TDQA 5KNBA 4PNYA 5C0XH 1EY5A 3PO3B 3T4AC 4TSSA 1LT4D 1STAA 5M5WB 1EU3A 2D9UA 2VUMB 5J22A 3HZXA 4U68A 4RCNA 5J39A 2CVRA 4IFDH 1BUVT 4DNTB 2A68D 3H3VC 2A6EC 1ENCA 4O42A 4HAEA 1CQVA 3DMUA 1H9RA 3CRLC 1MD2D 2HQEA 3K58A 2AUJD 1DM0B 2B2WC 1B50A 4XDXA 3RUZA 3I8ZA 1LLRD 4KHVA 5KNCA 5E3FA 3E0JA 3BZDB 5I9OA 2K04A 4WJWA 3T51B 2JA8B 1IKMA 2FFKB 3VYUA 2YU9B 1IW7D 2EYOA 1MI2A 1SYGA 3L3OC 2IW3A 4F7XA 1LT6D 1SYCA 4ZK9B 3ND9A 2PZTA 4NMZA 4OIKA 5COYA 1SYDA 5C4HA 1K8MA 3PV0A 5A2QL 2B8GA 1WTOA 1G8ZD 2DNCA 4DK0A 1LTTD 3EJIA 2AWOA 5JEAG 1S4ZA 2JXMB 3A7AB 2F0JA 2I46A 4XIGS 2N55A 5ELEA 1LTBD 3DM1A 1BO0A 4FXGC 1QNKA 4DAPA 1JICA 2FHTA 3G6JB 4K5WA 1IKLA 2K05A 2XRQD 1D2BA 2TMPA 3K5MA 2K7VA 2B2YC 3T56B 4K2KA 4LAAA 3NTIA 3KLSX 4IUUA 1H9SB 4ZYSA 1BOSA 2EYLA 3V96A 1Q1BA 3KUPA 4C56C 2F0IA 5CV7A 5M9OA 4C1NK 3IFTA 4QMGA 4C3HG 5D65A 1O78A 5C0XI 1STGA 2RDFA 1Y8NB 3TP7A 1EY9A 3BYTB 1S5FD 3D4WA 4DFAA 1I50B 1LV9A 1STYA 2KCNA 4X3TA 3C3LA 3SVMA 2XVSA 2ZXRA 1JE4A 4HEDA 4IFDI 1FYCA 3K7AB 2K5QA 4HSPA 2IJ0A 5I9PA 4IUVA 4QB4A 4S3SA 1F9PA 5CORA 2Y0SB 4K5XA 3MFGA 1R4PB 2DY7A 1IW7C 1D5ZC 2Q8IB 1X3QA 5C5LA 1ENFA 2XSCA 4G7ZC 1NCVA 3BVMA 1UUPA 1SMYD 3AB9A 2NB0A 2HDMA 4QUFA 4QF4A 3C1EA 4PQXA 3VA5A 1TS4A 3I70A 3S16B 3Q23A 1H9KA 1BBXC 2QEJC 5K36H 3MXUA 1GUTA 1I4RA 3KK7A 4A3KB 3QOJA 3GV6A 2R92B 2B2UA 2B8FA 3RD4A 1Y1VB 1GUGA 5LL6S 2KEDA 2EXZA 1XYIA 1LO5D 1RJTA 3FVQA 1EOTA 3Q0AA 4M8AA 3MVVA 4OGQC 4C3IB 4OO1H 4C2MB 3I73A 4XXEA 4FVMA 3GTMB 1IYUA 2LKVA 2BDOA 3V2TA 1SDFA 1SNQA 3N52A 1STHA 4PV1C 5FLXE 1EY8A 2JYOA 3CQZB 2IX0A 2SOBA 3M7GA 1TY0A 3E5SA 1WVLA 1SFOB 5E4XA 4XQQA 3EA6A 2MUYA 1PXUA 1STBA 3PIO3 3IAYA 1HUMA 1PFNA 5CV4A 3GTLB 2J4XA 3MZ5A 2MP1A 1TVXA 1A3UA 2E2HB 3J80E 4FNFA 3S15B 3K5OA 2AQ3B 4M1UB 4KKTA 3OW7A 2BDNA 4K8IA 1I6HB 2RQXA 3MA2B 3OWEB 1CM9A 3W2DA 1RF2D 4RGOS 1FD7D 5IGGA 5C4JB 1Z7TA 1I4QA 1OXXK 3HGBA 3H91A 4KI0A 1SMYC 1CHQD 2M9VA 1I4XA 4BBRB 5IODA 2BCOA 2B2TA 4UDUC 1JCKB 3RLFA 1FNVA 3O13A 3GTJB 4G7OC 5C0XG 1BCPB 1SE3A 4Z9CB 1WD0A 3SXHA 2RBMA 1DOMA 1I4PA 4G57A 2JSOA 4DAYA 3KBXA 3JAME 1BXTA 5T1IA 4N9TA 3ITPA 4IFDG 5DM63 4XQJA 3X3NA 3I4MB 4KY5A 3A8KE 3SEBA 2MPMA 5FLXL 1Y8PB 2D2CC 2F0OA 1II3A 1QCBD 4A3DB 4KKSA 1AN8A 2AWNA 1AFPA 3H94A 1RKNA 4DAVA 1OO9B 2NN6H 5CV9A 4H7BA 4EVOA 3OMGA 1EEFD 1G291 4OO1I 4BY1B 2K1BA 2EYHA 3MXGA 3SDZA 3J80L 2HCIA 3OSOA 1GUNA 2PPBC 4KN4C 1JQYD 3F2UA 3J7AV 4E6IA 2F4IA 3N6RA 5C3EB 1PRTC 2JA7B 1C48A 3HOYB 4EQOA 1M8AA 2ZXOA 3ONAB 3NPPA 3M4OB 4TRDA 2B2VC 1X32A 1VDZA 5KGUA 3U9SA 4EGVA 1OXVA 2B39A 3A55A 4MIUA 4C3JG 1WTQA 2A6ED 1CI3M 2HUGA 2XRSD 2IT1A 1V43A 3JAML 2A74C 3D6CA 1HTPA 2O2LD 5EBDA 2XWBB 5I2YA 1ZKOA 3DEPA 2EJMA 2Q8TA 3W3AA 1ESFA 3EROA 3MEHA 3DWAA 1SXTA 4ZKCB 2EZVA 2DNEA 1GHJA 5C3XA 4PMBA 3S1QB 4I7ZC 5CBAE 3R8BA 1SNOA 4DU9A 4L63B 3OPOA 1I3QB 2ICIA 4JBWA 4ZQ3A 2BOSA 1TT2A 2PYKA 3VYRA 1DONA 2F0PA 1D1IA 5C4ZA 3HS0C 3LNNA 4CJ0B 5HURA 3WOEA 3A56A 3NTHA 1CTMA 3FPUB 1SYBA 2A69D 3BYYB 1RHPA 4KV6A 2E2IB 1BQQT 4RFBA 4FO2A 1VMPA 3J81L 2NN6I 3DWQA 5E4WC 4A3EB 2EJFC 1E2WA 5NUCA 1UAPA 2KCCA 2GA4B 4KK7A 4KMUC 1A3VA 1L0YB 3DXJC 4DNRB 1JOOA 5K36G 2E75C 5C6AA 2KQ3A 4IUNA 3RZDB 3NSWA 2LMCB 2O4XA 2QILA 1XTCD 2K6AA 3CKIB 1HA6A 3IFDA 1O7LA 1TQOA 2F0DA 3GQBA 3SE0A 2F03A 1L0XB 1U4RA 1F77A 4RGTA 4OO1G 1KDBA 3SK6A 3BG3A 4ZUIA 5EKLA 2D5DA 1PTOC 1WTVA 5IGDA 3D4RA 2R93B 2SDFA 2XNAC 1ZYRC 2VXWA 3J7YW 1H9SA 2NBFA 1WTXA 3MWYW 1EY0A 4K5VA 1TWCB 1HXYD 2B2UC 1FR3A 4H0LC 5JVH3 2MHVA 3PUWA 5I6YA 1ZEQX 2PCFB 4TQUS 2F1MA 2K32A 3I91A 1ICWA 2L4NA 4DXGA 3QJYA 3D3RA 1CZGA 2R3ZA 3EVQA 1D5MC 5IGCA 4Q5VA 2A69C 1JOKA 1Q90A 4IURA 3TP8A 3V05A 3WDNA 3SHLA 2B63B 2JA5B 3P1HA 4CKBA 5BN3A 2EDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJR D;  2XRS D;  1PZJ D;  5ELC A;  3DWP A;  1S5C D;  3R2I A;  1BXT A;  1JWU D;  1PZK D;  1LLR D;  1LTS D;  2O2L D;  2R61 A;  1TS3 A;  2QIL A;  1XTC D;  1V1O A;  4OHJ A;  1SEB D;  3BYT B;  1CHP D;  5D3D A;  3BZD B;  3CHB D;  1S5F D;  5ELB A;  4BWG B;  1FGB D;  1M4V A;  1T5X D;  3SEB A;  2XN9 C;  1EFI D;  1ESF A;  1FNU A;  1L0X B;  5FKA C;  1V1P B;  1F77 A;  3DWA A;  4RHS A;  3GP7 A;  1SXT A;  1KTK A;  1HQR D;  4RGT A;  2IJ0 A;  1RCV D;  1DYQ A;  1AW7 A;  1PRT B;  1PYW D;  1TY0 A;  4RGN A;  2RDH A;  3MC0 B;  4L6T B;  1AN8 A;  1LT6 D;  1BCP C;  1RDP D;  2G9H D;  1B1Z A;  4RGM A;  1STE A;  2Z8L A;  3BVG A;  3R8B A;  1TS2 A;  1CT1 D;  2NTS A;  1S5E D;  4L63 B;  1TS5 A;  1PTO C;  3EA6 A;  3MFG A;  1S5B D;  4RCO A;  1EEF D;  2ICI A;  1KLU D;  1S5D D;  1BCP D;  1D5Z C;  1JWM D;  2AQ1 B;  2WV6 D;  5FK9 C;  5D3I B;  3TSS A;  2XNA C;  4DXF A;  2IPK D;  1PTO D;  1BCP F;  1LT5 D;  1SE2 A;  1LTG D;  2SEB D;  1JR0 D;  1LTR D;  5I4D A;  1ENF A;  1G8Z D;  1PTO F;  1RD9 D;  2J4X A;  3R2T A;  1QIL A;  1LTT D;  3BVM A;  1UUP A;  1HXY D;  1PZI D;  1SBB B;  2AQ3 B;  1HA5 A;  1PTO H;  4K6L A;  4TSS A;  1GOZ A;  1LT4 D;  3OWE B;  5ELE A;  1B44 D;  1JQY D;  1EU3 A;  1LTB D;  3W2D A;  1I4G A;  1SE4 A;  1RF2 D;  1TS4 A;  4RGO S;  1FD7 D;  1UNS A;  1EEI D;  1JWS D;  1EWC A;  1D6E C;  2CHB D;  1PRT C;  3BYY B;  1I4Q A;  1LTI D;  2QEJ C;  1XXG A;  1FNW A;  1I4H A;  3BVZ A;  1I4R A;  4RFB A;  1CHQ D;  1I4X A;  2XRQ D;  1SJH D;  3URY A;  4DXG A;  1HTL D;  1KLG D;  2RDG A;  4RHR A;  1PRT D;  4UDU C;  4RH6 A;  1JCK B;  5ELD A;  1D5M C;  1ET6 A;  4O1N A;  1V1P A;  2NTT A;  3DWQ A;  1CK1 A;  3EFX D;  1PRT F;  1SJE D;  1EU4 A;  1FNV A;  5ELF A;  5TSS A;  1LO5 D;  1TY2 A;  3O13 A;  2AQ2 B;  3V05 A;  1ET9 A;  3KLS X;  2TSS A;  1BCP B;  1CQV A;  4ZYS A;  1SE3 A;  1L0Y B;  1LT3 D;  4Z9C B;  1MD2 D;  1D5X C;  4C56 C;  1LTA D;  1I4P A;  1PTO B; 
#chains in the Genus database with same CATH topology
 3BU2 A;  4NXN L;  2A5H A;  3CRK C;  2QF7 A;  4BBR G;  1E3P A;  5IYC G;  2PW7 A;  1IYJ B;  2MJ8 A;  3UE0 A;  4A3B H;  4A3B B;  2B3G A;  1VQK A;  1B7Y B;  4KKU A;  1F2Z A;  5IGE A;  4CHT B;  2VY3 A;  3NP8 A;  1NJI C;  1RTN A;  4ZCK A;  3NHH A;  3T13 A;  3DEO A;  3K5N A;  2XN9 C;  3M4Y A;  3HRZ C;  1EY4 A;  1VF5 C;  1V1P B;  1LYL A;  1FJG L;  2F4V Q;  1JB3 A;  4G4K A;  4YCU A;  4DAM A;  1XMQ L;  1OXS C;  4YHH Q;  1HZC A;  1IYV A;  4WRD A;  3QB3 A;  1B1Z A;  1X3E A;  3BVG A;  4HJ5 A;  3HOU H;  3HOU B;  4QCL A;  3KFU A;  1CKN A;  4V0B A;  2I0Q A;  3HKZ E;  1LTL A;  4K2L A;  3HKZ B;  2KUM A;  3H09 A;  1SRO A;  2IX3 A;  3I4M G;  4AQY L;  1LT5 D;  3OTO Q;  3C46 A;  5KIX A;  4A93 H;  1YHA A;  1Z47 A;  2E74 C;  2UUB L;  4A93 B;  3K7A H;  1WYD A;  3AYH B;  3I4O A;  4R9W A;  2MNA A;  2Z6K A;  3I4N B;  4A3D G;  4ZKB B;  3VYS A;  4HJ7 A;  5E7N A;  4DR1 L;  3NBH B;  4KJN A;  1PFM A;  2B2T C;  3HFZ B;  2SNM A;  1XPU A;  4K6L A;  3QWN A;  3UI2 A;  4G7H C;  2N3S A;  3K7U C;  1G2S A;  4A3L G;  3PQI A;  4EQ5 A;  1UEA B;  1A3T A;  2P5Z X;  2HHH Q;  2L0C A;  1XMO L;  1SE8 A;  1J5E L;  3GTQ H;  4V19 0;  3QOL A;  4K8J A;  3GTQ B;  1HNW L;  4F87 A;  1NMG A;  4RHR A;  3WOF A;  2QDB A;  4IUP A;  2OQ0 A;  1Q1E A;  5J1Z A;  3TZD A;  1N32 Q;  4YCW A;  1U4L A;  3EFX D;  4OWT B;  1PRT F;  2EVB A;  1SSO A;  1EIY B;  5CV6 A;  1SR3 A;  4X64 L;  3NXW A;  3ULP A;  4CDC C;  3CCM A;  2ES2 A;  4JV5 Q;  3T1H Q;  5GRO A;  1U0L A;  2LXJ A;  1LTA D;  1V8Q A;  4FF2 A;  4JYA L;  1VMC A;  2N88 A;  3GTP B;  1PZJ D;  4EQN A;  3W1B A;  1CKN B;  1WOC A;  4GOP B;  3HOY G;  2R92 H;  4KD4 A;  1O7Z A;  3RN2 A;  4YIJ A;  1Y69 U;  1QVF A;  1X54 A;  5BR8 Q;  4AIM A;  2QA4 A;  3CHB D;  4BWG B;  1VS0 A;  1PA6 A;  1B9N A;  1EIH A;  4L5R C;  4C3I H;  1EYG A;  1PMR A;  2E8G A;  1EY6 A;  1RTO A;  3TME A;  1GKH A;  1EY7 A;  1HQR D;  2LFN A;  4C2M H;  1HZA A;  5CGK A;  4GN5 A;  2WB1 G;  3GTM H;  3R3O A;  1VQG A;  4OON A;  3VYT A;  1SNP A;  4JBM A;  5KRU A;  2F4V L;  3K57 A;  2K5W A;  2ZTE A;  1AEX A;  1LAB A;  2WAC A;  1NBW A;  3KF8 A;  4YHH L;  2C9O A;  2BA1 A;  1DCZ A;  1HNX Q;  3H0G H;  1QB5 D;  3H0G B;  2C5C A;  2WV6 D;  3OWF A;  3H3V H;  1VQD A;  2NVT H;  2NVT B;  2CKZ B;  4MN3 A;  5IT9 c;  2J0T D;  1T9H A;  1LTR D;  5EPL A;  4XYO A;  5LMU Q;  4JI3 Q;  2F0N A;  3OTO L;  2AUK A;  5FJ8 H;  3RNU A;  1O80 A;  1E7Z A;  1DXM A;  5JJL A;  3I72 A;  1DOL A;  2PQE A;  2F0T A;  1Q46 A;  3NWT A;  1EIG A;  2OTL A;  2KA7 A;  2YTV A;  5KYI A;  5LMN Q;  1F9Q A;  5AFW A;  5DNF A;  1SNC A;  1YNN D;  4HN7 A;  1KAW A;  2X6G A;  4IUT A;  1PH1 A;  4WJ4 A;  2HHH L;  4HJA A;  4IN3 A;  1PRT D;  2YYZ A;  1N34 Q;  4QGU A;  2DJF C;  2E2H H;  2DGY A;  4L5S A;  4ABN A;  3CD6 A;  1SJE D;  2NVY H;  3SK4 A;  2NVY B;  1PH7 A;  1Q8I A;  3NQT A;  4OX9 Q;  1J8I A;  1N32 L;  4R8N A;  2F0U A;  4A76 A;  2F0H A;  3OIQ A;  4JI8 Q;  5C44 H;  2K14 A;  1PH6 A;  5C44 B;  2F52 A;  3B6Y A;  4WOR A;  1KDA A;  1N8R C;  3SR1 A;  2NWG A;  3S1M H;  3T1H L;  3S1M B;  3HKS A;  3KF6 A;  4LW1 A;  5IOC A;  3M85 A;  3KLR A;  3BS1 A;  4DK1 A;  4BY7 H;  4BY7 B;  3NK9 A;  2DJG C;  1CQF A;  2WAQ E;  3D31 A;  2F0G A;  2WAQ B;  3HG9 A;  3CCQ A;  1G6Z A;  3PSI A;  4R8I A;  1FGU A;  3J80 i;  1LUZ A;  2UXC L;  3PO3 G;  4BA1 I;  3CMA A;  1TWG B;  5BR8 L;  1BDO A;  1Y1W H;  3ER0 A;  3J7A F;  4A3F B;  1Y1W B;  3MXP A;  4RWS C;  3TN2 A;  2EYM A;  2D62 A;  1E2Z A;  1ILP A;  2VUM G;  1L1O A;  1STN A;  4RGN A;  2F0L A;  5EKK A;  2JEA I;  3P75 A;  4BBS H;  1YJN A;  4R4C A;  2SNS A;  4BBS B;  2JP1 A;  3I3C A;  3MXN A;  1HZB A;  1VQF A;  3K5L A;  3OMC A;  1PHJ A;  2EE1 A;  1HRJ A;  1ICF B;  3LX0 A;  2F0F A;  4DR5 Q;  2J7Z A;  1S5B D;  3MFY A;  2C35 B;  2OXP A;  2JK8 A;  3BDL A;  5CV5 A;  4X62 Q;  5IP9 G;  4C3H H;  2MO0 A;  4C3H B;  2EY1 A;  1JJG A;  1O7Y A;  3EBE A;  1YNJ C;  4XT3 B;  3GTO H;  1NE3 A;  1NR4 A;  4N8F A;  1HNX L;  5M3M B;  3GTO B;  4YWM A;  4APV A;  4N9P A;  1PTO F;  4JK1 C;  5KND A;  5LL6 X;  2IHE A;  1K8O A;  3H6M A;  3JAM i;  1PZI D;  1SBB B;  4LF9 Q;  5LMU L;  3PUX A;  5EBC A;  2QKI C;  3DHQ A;  1F2L A;  1EL0 A;  4Y52 H;  3KF6 B;  2I07 B;  1FVI A;  4X3U A;  1FNW A;  3BVZ A;  4A3C G;  2PW5 A;  2A19 A;  1H9M A;  3QIA A;  3CXC A;  5M3F H;  2JA8 G;  5M3F B;  3VR5 A;  2OEO A;  5LMN L;  2NVX H;  4HCE A;  2NVX B;  5KEE A;  2NZH A;  1EQV A;  2AHO B;  3L0O A;  2PNR C;  1N34 L;  3DUZ A;  3MHB A;  3H3V I;  4A3J H;  4A3J B;  1YNN C;  3HOV B;  4P71 A;  2WII B;  4B3T L;  1D5X C;  4CDE C;  4OX9 L;  1DJR D;  3MXN B;  2CH4 A;  1A15 A;  5EKI A;  1E1T A;  2R7Z H;  2R7Z B;  1YZ6 A;  2DY8 A;  5D3D A;  3HEJ A;  1NR2 A;  1SYE A;  1K8A C;  4FP5 D;  2QGQ A;  2E2J B;  4DGZ A;  1M4V A;  2EPB A;  1T5X D;  3GTG H;  2KEE A;  2R7F A;  3FHW A;  3GTG B;  1JJC B;  1JE5 A;  3EQL C;  4RHS A;  1QNU A;  1EFW A;  4NW2 A;  1HFN A;  4LUO A;  3Q6S A;  1DYQ A;  3CAM A;  2G9D A;  1VQE A;  1PDQ A;  1PYS B;  1QOH A;  2PQA A;  4KN7 C;  3L2P A;  2Z8L A;  4LK1 C;  4UP8 A;  1C7Y A;  5EGT A;  2NTS A;  1F2M A;  4IZ8 A;  4LF7 Q;  4A3B G;  4RCO A;  1K9M C;  4MNO A;  4K6D A;  4NDX A;  1VQM A;  3T1Y Q;  4DR5 L;  1AP0 A;  1PTO D;  2UXD L;  2F0M A;  4FYD A;  1GUW A;  2ID0 A;  4X62 L;  1Q8K A;  1Q81 C;  1KAB A;  1ROD A;  1ZYR D;  2VNU D;  5T1G A;  4CKC A;  1PLF A;  4J1M A;  5JOB A;  3CCS A;  2CQO A;  1I4G A;  4JI5 Q;  2OF1 A;  1X56 A;  1EEI D;  1TU2 B;  2CHB D;  1A2T A;  2CW0 C;  3FEW X;  1Z9F A;  2HCC A;  4DN4 M;  3PIP 3;  4RA8 A;  3F1Z A;  1CZW A;  4IQZ A;  2PZW A;  4BA2 I;  1SJH D;  2L11 A;  2RVL A;  1VF7 A;  3S14 H;  4DF7 A;  3S14 B;  1HHV A;  1ET6 A;  4O1N A;  3PUZ A;  4I65 A;  4L8J A;  3S2H B;  2HD3 A;  5TSS A;  1VQ4 A;  3A8I E;  1P16 A;  3L7Z C;  2Y0S G;  2L12 A;  4A3G H;  4A3G B;  3OW2 A;  1VQ9 A;  1QVG A;  1ZXT A;  2YTX A;  5I4D A;  1QWY A;  5GAH C;  3F2C A;  1EYA A;  3RLN A;  1AZQ A;  4KY7 A;  5IP7 H;  3S2D B;  2E2I H;  1SMX A;  1X3G A;  1PVO A;  3R2I A;  1EYC A;  4J8Q A;  5JJK A;  4MZ9 A;  4H13 C;  1NSN S;  1TS3 A;  1TWH H;  1TWH B;  4JI1 Q;  3G7L A;  2BA0 A;  4JBJ A;  4A3E H;  4CJ2 C;  1VQL A;  4JC0 A;  1HUN A;  1AZP A;  4IPC A;  4FXD A;  2K01 A;  5BN4 A;  1NUC A;  4ZUJ A;  5EPK A;  4DR2 Q;  3QG1 A;  2GVA A;  5A2Q E;  4Q0F A;  1XWE A;  2CFM A;  3TP6 A;  2LY7 A;  2KHI A;  2RSO A;  4YY3 Q;  1T5E A;  3RZD H;  5GAD C;  4CBV A;  1KRS A;  4HMJ A;  1NTG A;  3ERQ A;  2EY5 A;  4RGM A;  3AQQ A;  2R92 G;  1DOK A;  2Z6K C;  1IL2 A;  3PF4 A;  1VQP A;  1ONL A;  4IAL A;  4QJF A;  5HGT A;  1GJX A;  1GUO A;  4B9X A;  1QUQ B;  5FLM H;  1NY4 A;  2UU9 L;  3CPW A;  3CCV A;  3CW2 C;  3I2Z A;  2IPK D;  4B3R Q;  3FMC A;  4C3I G;  1U9R A;  2Z4H A;  1XPO A;  1RD9 D;  3C2P A;  1Z6H A;  2R6G A;  1CKO A;  4P2C B;  3KLW A;  2L9H A;  1IBL Q;  2F0E A;  1QZG A;  4LMQ D;  3BZK A;  3KBG A;  1HCZ A;  4NKL A;  4DR3 Q;  2A6H C;  1MJE A;  5IT9 E;  1QJO A;  2WIN B;  1TR5 A;  3HP3 A;  3R93 A;  5EAY A;  2RA4 A;  1HNZ L;  5JEA J;  2R93 H;  3RR5 A;  5DEH A;  3S24 A;  2B2V A;  1XX8 A;  4JI5 L;  4B08 A;  2K03 A;  2PMZ E;  3BDC A;  1VQJ A;  2PMZ B;  4LNQ A;  1NNX A;  4H44 C;  4LF8 Q;  5IGF A;  4POG A;  2ASB A;  5ELD A;  3PCO B;  2O5J C;  3AFP A;  5JJI A;  2CQA A;  4DV2 Q;  5ISR A;  1TWC H;  2JQO A;  1V1P A;  3NQI A;  2K5N A;  1EWH A;  4HIM A;  3TBI B;  1I94 Q;  2UUC Q;  1TY2 A;  2NVQ B;  2AQ2 B;  2F0Q A;  2FIN B;  2ZT9 C;  1G91 A;  1X3P A;  3SK5 A;  2MGS A;  2ICE C;  3Q24 A;  4ILW A;  1YIJ A;  3NBI A;  3K0Y A;  4RAU C;  5ELN A;  1TII D;  3DWP A;  2EJG C;  1S5C D;  4CJ1 B;  1IZ6 A;  3PIO A;  4K14 A;  4POF A;  4IUQ A;  1V1O A;  4U67 3;  2ZJQ A;  4A3I B;  2NYZ D;  3QO2 A;  4ME5 A;  2QDL A;  2IWH A;  1K3R A;  4XYQ A;  3MAQ A;  2JA5 H;  3NBH A;  4B9W A;  5C3W A;  1ESR A;  1TWA H;  1TWA B;  5C44 G;  1Q3L A;  1EQT A;  5IYB H;  2EY6 A;  3A74 A;  4LFC Q;  2R7D A;  4PZ6 A;  1J9O A;  4DR2 L;  1PRT B;  1DZ1 A;  1PH3 A;  2BE5 D;  2HIX A;  2ZXP A;  1BCP C;  1SRU A;  1DD2 A;  2EXD A;  2L5T A;  3STB D;  1TS2 A;  5LHY 1;  4YY3 L;  3CCU A;  2XIW A;  1S5E D;  3T16 A;  4C3J H;  4GN4 B;  3L9A X;  4C3J B;  2YV5 A;  2WAQ G;  4CKE A;  1EQQ A;  2JE6 I;  4LF5 L;  2AKW B;  2K5H A;  2PI2 A;  4QIW E;  1Y1W G;  2IY5 B;  2SEB D;  4QIW B;  2ALY B;  1PFS A;  3HOX H;  3HOW H;  5FO8 B;  2Q2T A;  3HOX B;  3HOW B;  3E9H A;  1B9M A;  1B4O A;  5JVG 3;  2A73 B;  1HA5 A;  4BBS G;  3K81 C;  4I7A A;  1WTW A;  2OT2 A;  4GOP A;  1GOZ A;  1YJW A;  4TKO B;  5IT9 L;  1CSQ A;  1IHZ A;  1ML0 D;  1IBL L;  3K6O A;  5ELO A;  4DR3 L;  1D6E C;  5BN5 A;  1SND A;  5DAU A;  1I6V C;  4XQN A;  1G2T A;  1I4H A;  2EIF A;  4DR6 Q;  1CSP A;  1YIT A;  2KVM A;  3NWS A;  1AH9 A;  2RKS A;  2A68 C;  2D0O A;  4ZLT F;  3M4P A;  1HTL D;  1KLG D;  5CR3 A;  4RH6 A;  4LFB Q;  3I4N H;  3KLS A;  1SN8 A;  2NTT A;  4J6H A;  5K5P A;  2QEX A;  1WTR A;  4LF8 L;  2LS0 1;  1SAP A;  1ET9 A;  4GN3 B;  4DV2 L;  4JW0 A;  4GLX A;  1C8C A;  2CWP A;  1LT3 D;  1I94 L;  2UUC L;  2K28 A;  2NN6 G;  3T53 B;  1KNA A;  3OHX C;  2Z1C A;  4ID6 A;  1VQA A;  3BDO A;  3VR4 A;  2B29 A;  3VR3 A;  1OXU A;  5CBE E;  4BY1 G;  1JWU D;  5M3F G;  4YWK A;  3VR6 A;  5KYL A;  2ZJP A;  1L1O C;  5FOB B;  1VQ5 A;  4FF1 A;  2PI2 E;  1CHP D;  2KBN A;  3C1F A;  2KOL A;  2WFW A;  2KCM A;  2M00 A;  1JJ2 A;  2Q2U A;  2B2W A;  5I6W A;  4QUC A;  4A3J G;  4OEM B;  1A2U A;  1FNU A;  3FKI B;  4F8M A;  4GNX B;  3UDX A;  3LWE A;  3GTP H;  3FRP B;  3U9O A;  1MSH A;  4IPG A;  5C3E G;  2JA7 G;  5CMD A;  3TZU A;  1EIF A;  5C4X B;  3E3X A;  3SK8 A;  3PUY A;  4L6T B;  3M3Y B;  2R7Z G;  2G9H D;  1RDP D;  4JI0 Q;  3ND8 A;  1STE A;  1MBY A;  3PO2 B;  1SNM A;  3U4Z A;  2Z4I A;  1JC7 A;  4IOA A;  3A54 A;  2JA9 A;  4MHE A;  1HPC A;  1JWM D;  2AQ1 B;  3AFQ A;  4L5Q A;  4AYB E;  2OTJ A;  2XWJ B;  2E2D C;  4AYB B;  2NUC A;  2KCT A;  1SE2 A;  1E0B A;  2BE5 C;  2LXK A;  2MQH A;  1JR0 D;  1WTP A;  1QG7 A;  1MJC A;  1JOQ A;  3STB C;  3MTS A;  1B2T A;  4X6A H;  4HCS A;  4JBK A;  3RZO H;  4DA2 A;  3RZO B;  1YNJ D;  1CKM A;  4JI4 Q;  5F2D A;  3D8G A;  1GXD C;  2QCP X;  1QE6 A;  1PFB A;  1UE7 A;  2F0S A;  4DR7 Q;  4RKL A;  4DKA C;  1B70 B;  2KEN A;  4KD3 A;  4HMI A;  3RLO A;  3S9W A;  3I4L A;  4GZY C;  1ENA A;  4UAI A;  3RMH A;  2RDG A;  3FDT A;  4Y7N H;  3CCJ A;  4DR6 L;  5EJW A;  4Y7N B;  1KXL A;  1KC8 C;  3P20 A;  4LFB L;  4X3S A;  2WP8 J;  3ULL A;  2TSS A;  1C4Q A;  4NP5 A;  4ZRZ A;  1M90 C;  1PTO H;  5ELB A;  1PTO B;  4PMW A;  2UUA Q;  2BH8 A;  1EZ6 A;  1BBW A;  4JVZ A;  4DV7 Q;  4KHP Q;  5C0X J;  3E6Z X;  2B2Y A;  1S40 A;  1U4P A;  5JJZ A;  5D14 A;  4WJ3 M;  4A3M H;  1LTS D;  1PH8 A;  2F3I A;  1U4M A;  4A3M B;  2WKD A;  2V4D A;  5JAV A;  4XT1 B;  2KJX A;  1YI2 A;  4OHJ A;  4QQB X;  2H4O A;  2YTY A;  4EQP A;  4RKB A;  2JA6 H;  1BF4 A;  2JA6 B;  5JPM C;  3KDF A;  4A3G G;  4IFD J;  1HQM C;  3TS2 A;  3M4Q A;  4NXM Q;  1H9J A;  3K80 C;  1B53 A;  5JEA H;  4FF3 A;  4JV5 L;  1RCV D;  1PYW D;  5IP7 G;  2VQF Q;  1EYD A;  1HFG A;  2FMM A;  4KHZ A;  2E5L Q;  3A7L A;  2EYP A;  1KRT A;  3H15 A;  1CT1 D;  3PUV A;  3AEV A;  3GV3 A;  1W6J A;  4JI0 L;  4FF4 A;  1S5D D;  4A3E G;  1TWG H;  4A3F H;  5D3I B;  2HDL A;  5A35 A;  1BNZ A;  2I5H A;  5IGB A;  1TKW B;  1LTG D;  3P7J A;  2O5I C;  4X66 Q;  3KJP A;  1UE1 A;  1YHQ A;  3BZC A;  4LJZ C;  1W6K A;  3FPP A;  4B3S Q;  3S17 H;  1GHK A;  3S17 B;  5EQ0 A;  1GUS A;  4HSV A;  3BJU A;  2RHS B;  1JB7 A;  4F88 A;  1SE4 A;  4JI4 L;  1R9T H;  3NE5 B;  1UNS A;  5CC4 A;  1R9T B;  4OIJ A;  3EIV A;  3HOZ H;  4C1N I;  2I5L X;  3HOZ B;  5FLM G;  3OIP A;  1XXG A;  1LAC A;  5G3L F;  3TRZ A;  5M3M H;  4XTC S;  3KYH C;  3D6W A;  2L1B A;  3VR2 A;  2CW0 D;  1F2Y A;  1NAP A;  3JC6 6;  5E1F A;  1EU4 A;  1BBU A;  3KDF B;  5ELF A;  5IIF A;  3AU7 A;  4DUY Q;  4JI3 L;  3OOC A;  4IPD A;  2M2L A;  2F3W A;  2VB2 X;  4ODG A;  5IE8 A;  2Z6B A;  1B3A A;  4R1J A;  1KDC A;  2R93 G;  1Y8O B;  1PH2 A;  5IYD H;  3VA7 A;  5ELC A;  4ZAI A;  5L37 A;  2JEB I;  2DN8 A;  2IL8 A;  1HR0 W;  1PZK D;  1GM5 A;  3CU7 A;  2UUA L;  2R61 A;  3UDI A;  2DUD A;  3K59 A;  4KHP L;  2Q2I A;  4DK6 C;  4A3L H;  1IXR A;  4DV6 Q;  1FGB D;  4FDB A;  1SLJ A;  3HOV H;  1EFI D;  1EUJ A;  3IL8 A;  3NTK A;  1H95 A;  3GP7 A;  5AJ3 Q;  1N36 Q;  4JI8 L;  1AW7 A;  4LUZ A;  2RDH A;  3F2D A;  3UE1 A;  2F0V A;  4PZ7 A;  4NXM L;  2EQS A;  5JPN C;  4UP7 A;  1ILQ A;  2VQF L;  3AMU A;  3PMF A;  2EYJ A;  4DAY B;  2IX1 A;  4BXX H;  1R4Q B;  1X9N A;  1CA5 A;  2E5L L;  2E2J H;  3TP5 A;  3TSS A;  4HTH A;  2B63 G;  4HID A;  2PZU A;  1BCP F;  1MGS A;  2JA5 G;  5IWA Q;  3CCR A;  4R4I A;  3D4D A;  3J81 E;  1K83 H;  3R2T A;  1QIL A;  5IYB G;  3S1N H;  1K83 B;  2F0K A;  1CFM A;  1E22 A;  3S1N B;  1IL8 A;  3TRE A;  3GD7 A;  3S1R H;  1XJV A;  3S1R B;  2EOT A;  4WFN 3;  3CP0 A;  2KHS A;  1B44 D;  4AH6 A;  4B3S L;  1JWS D;  4HR7 B;  1EWC A;  2F0W A;  5G3L D;  2A6H D;  1LTI D;  2F3V A;  1VQ7 A;  3CPF A;  2WB1 E;  4KY6 A;  2WB1 B;  1YJ9 A;  1MSG A;  3GTK H;  2FJ2 A;  4H02 A;  3GTK B;  3URY A;  5FO7 B;  4CDF C;  4MTN A;  1SYF A;  4OEL B;  4JPB W;  3HOX G;  1K28 A;  1KAA A;  1GO3 E;  1CK1 A;  3NEM A;  2NZ1 D;  4KJO A;  3LWU A;  1JOR A;  1YNX A;  2RHQ B;  2K5V A;  3HOU G;  3IKJ A;  5I2X A;  4A4I A;  3CC2 A;  4LF9 L;  3HKZ G;  3TQY A;  4DUY L;  2KEC A;  2QW7 A;  1UE5 A;  4DNI A;  4JOI A;  3I90 A;  3X3M A;  1KNE A;  4ULL A;  1QUQ A;  3ZYY X;  3A5U A;  5C5M A;  4CGY B;  1VCI A;  4A93 G;  4FXK C;  5FLX c;  4OWW B;  1OXT A;  2RSN A;  1F9S A;  1GVP A;  3I4N G;  3S2H H;  1SEB D;  2VB3 X;  4KLK A;  1Q12 A;  2H1E A;  3M7N A;  5CYU A;  4PG3 A;  4LF4 Q;  3K8A A;  1VQH A;  2FMC A;  3A8J E;  2L55 A;  4DV6 L;  1WD1 A;  5FKA C;  1A6X A;  3S2D H;  1KTK A;  1MHW C;  1F9R A;  2E76 C;  1CA6 A;  1VQ8 A;  5CV8 A;  3NUC A;  3MC0 B;  1EZ8 A;  2WKC A;  4P73 A;  4DK3 C;  5AJ3 L;  2X6L A;  1D1K A;  1E2V A;  1NMF A;  3GO5 A;  5M5X H;  1N36 L;  5M5X B;  2K33 A;  2PO4 A;  1TS5 A;  4X3K A;  3Q22 A;  2HIV A;  2X69 A;  1KLU D;  1BCP D;  3J80 c;  1BR9 A;  5FO9 B;  4GOP C;  1WCM H;  1WCM B;  2MFI A;  5FK9 C;  2K5D A;  4DXF A;  4PMC A;  5M5Y H;  5DM7 3;  2ENB A;  3G48 A;  5M5Y B;  1TWF H;  2EYF A;  1TWF B;  2Q8R E;  2EY2 A;  4BS9 A;  5EPJ A;  2XGT A;  4KTA A;  4OL7 A;  5IWA L;  1KHI A;  3TDQ A;  5KNB A;  4PNY A;  1X65 A;  5C0X H;  1EY5 A;  3PO3 B;  1HH2 P;  3T4A C;  4TSS A;  4UY8 C;  1LT4 D;  1STA A;  1YEZ A;  5M5W B;  5GAG C;  1EU3 A;  4NXN Q;  2D9U A;  2VUM B;  4LF7 L;  5J22 A;  3HZX A;  4U68 A;  4RCN A;  2PNH A;  5J39 A;  3T1Y L;  2CVR A;  4IFD H;  4GLV B;  1BUV T;  4DNT B;  1VQN A;  2A68 D;  1Q82 C;  5J3B A;  3H3V C;  2A6E C;  1ENC A;  1PV4 A;  4O42 A;  4HAE A;  1CQV A;  3DMU A;  1H9R A;  3TS0 A;  1FJG Q;  3CRL C;  1MD2 D;  2HQE A;  3K58 A;  1V1Q A;  2AUJ D;  3H0G G;  1DM0 B;  2B2W C;  1B50 A;  4XDX A;  3RUZ A;  3I8Z A;  3TEH B;  1LLR D;  4KHV A;  5KNC A;  5E3F A;  3SGI A;  3E0J A;  2RCF A;  5FJ8 G;  3BZD B;  2A1A A;  5I9O A;  2K04 A;  4UPA A;  2NVQ H;  1UEB A;  4WJW A;  2ZTD A;  3G4S A;  1KL9 A;  2JA8 H;  3T51 B;  2JA8 B;  1IKM A;  3CME A;  2FFK B;  3VYU A;  2YU9 H;  4CDD C;  2YU9 B;  1IW7 D;  4LF4 L;  2EYO A;  4UHV A;  2RCN A;  1MI2 A;  1SYG A;  4PZ8 A;  3L3O C;  2IW3 A;  1TXY A;  3ERS X;  4F7X A;  1LT6 D;  1SYC A;  4DUZ Q;  4ZK9 B;  4A3M G;  3ND9 A;  2PZT A;  4NMZ A;  4A3I H;  1Q7Y C;  1XMO Q;  1J5E Q;  4OIK A;  3CC7 A;  1VQI A;  4JI1 L;  5COY A;  2JA6 G;  1SYD A;  5C4H A;  1K8M A;  3PV0 A;  5HY6 A;  5A2Q L;  2B8G A;  1WTO A;  1G8Z D;  3PGZ A;  2DNC A;  4DK0 A;  1LTT D;  2MO1 A;  3EJI A;  2AWO A;  5JEA G;  4UP9 A;  1S4Z A;  1UE6 A;  2JXM B;  3A7A B;  1K0S A;  2F0J A;  4B3M Q;  2I46 A;  4XIG S;  4JYA Q;  2N55 A;  1EWI A;  5ELE A;  4BY7 G;  1LTB D;  3J81 c;  3DM1 A;  1BO0 A;  4FXG C;  1DGS A;  1QNK A;  4DAP A;  2UXB Q;  4GKJ Q;  1JIC A;  1RL2 A;  1PH5 A;  3E0E A;  2FHT A;  1S3O A;  3CCE A;  4EX5 A;  3G6J B;  4A3F G;  4K5W A;  1IKL A;  2K05 A;  2XRQ D;  1X6O A;  1D2B A;  2TMP A;  3J81 j;  4B3R L;  4GNX A;  3K5M A;  2K7V A;  2B2Y C;  3T56 B;  4K2K A;  2CH4 W;  3J7A 5;  4LAA A;  1L0W A;  3NTI A;  3KLS X;  4IUU A;  1H9S B;  4ZYS A;  1BOS A;  2EYL A;  3V96 A;  1Q1B A;  3KUP A;  4C56 C;  2F0I A;  5CV7 A;  1D7Q A;  3F8T A;  5M9O A;  2Z0S A;  4IPH A;  3HOZ G;  4IJH A;  4C1N K;  1GD7 A;  3IFT A;  4QMG A;  4C3H G;  5D65 A;  1O78 A;  2CWA A;  5C0X I;  1IBK Q;  1STG A;  2RDF A;  5M3M G;  2HT1 A;  1Y8N B;  3TP7 A;  5GAE C;  3J7Z C;  1EY9 A;  3BYT B;  1S5F D;  3D4W A;  1I50 H;  4DFA A;  1I50 B;  1LV9 A;  1STY A;  2KCN A;  4ALP A;  2JJQ A;  4X3T A;  3C3L A;  2XTI A;  3SVM A;  2XVS A;  3RN5 A;  2ZXR A;  3ZJY C;  1JE4 A;  4HED A;  4R4Q A;  4IFD I;  1FYC A;  3K7A B;  2K5Q A;  4HSP A;  5IYD G;  2IJ0 A;  3U50 C;  4QY7 A;  1Q86 C;  5I9P A;  4IUV A;  4QB4 A;  2Y0S E;  4S3S A;  3CF5 A;  1F9P A;  5COR A;  2Y0S B;  4IO9 A;  4K5X A;  3MFG A;  1R4P B;  2DY7 A;  4NB3 A;  3ULJ A;  4DUZ L;  1IW7 C;  2A8V A;  1D5Z C;  3KJO A;  2Q8I B;  3FKI H;  1HR0 Q;  3HOV G;  2G5D A;  1L2F A;  1X3Q A;  5C5L A;  1A62 A;  1ENF A;  2XSC A;  1XTD A;  4G7Z C;  1NCV A;  5C4X H;  3BVM A;  1UUP A;  1SMY D;  3M3Y H;  3AB9 A;  2NB0 A;  1VQ6 A;  4LFC L;  4DV0 Q;  5H1S E;  3PO2 H;  2HDM A;  4QUF A;  4QF4 A;  3LGJ A;  3C1E A;  4PQX A;  3S16 H;  3VA5 A;  1TS4 A;  3I70 A;  3S16 B;  2ATW A;  2NZO A;  3Q23 A;  2FXQ A;  4B3M L;  1H9K A;  4BXX G;  1BBX C;  2QEJ C;  5K36 H;  2N8N A;  3MXU A;  1GUT A;  4A3K H;  1I4R A;  2V1C C;  3KK7 A;  4A3K B;  2UXB L;  1A0I A;  4GKJ L;  3QOJ A;  3GV6 A;  2R92 B;  2B2U A;  2B8F A;  3RD4 A;  1Y1V H;  1Y1V B;  2UXC Q;  1GUG A;  5LL6 S;  2KED A;  2EXZ A;  1XYI A;  1LO5 D;  2IHF A;  4JG2 A;  1RJT A;  3FVQ A;  1EOT A;  4JI6 Q;  3Q0A A;  3G71 A;  4M8A A;  4P75 A;  3MVV A;  4OGQ C;  4C3I B;  2HQL A;  4LUV A;  1W3S A;  4OO1 H;  3DLL A;  2GN5 A;  4C2M B;  4GKK Q;  3OYY A;  3I73 A;  2Q2H A;  4XXE A;  3U4V A;  4FVM A;  3GTM B;  1IYU A;  3VDY A;  2LKV A;  2BDO A;  2VQE Q;  1IBK L;  3V2T A;  1SDF A;  1KD1 C;  1SNQ A;  5HGQ A;  3N52 A;  1STH A;  1KQS A;  4PV1 C;  3QR8 A;  5FLX E;  1EY8 A;  3CQZ H;  2JYO A;  3CQZ B;  2IX0 A;  3GDE A;  1PH9 A;  2SOB A;  1VQB A;  3M7G A;  1TY0 A;  1A8V A;  4RG1 A;  3E5S A;  3A0J A;  3A5Z B;  4L5T A;  4LFA Q;  3PIP A;  1WVL A;  3U58 A;  1SFO H;  1SFO B;  4GLA C;  5E4X A;  1CUK A;  4XQQ A;  3EA6 A;  2MUY A;  4JCV E;  1PXU A;  4O2D A;  1STB A;  3PIO 3;  3IAY A;  4RMF A;  1XNQ Q;  1HUM A;  3GTL H;  1PFN A;  5CV4 A;  3GTL B;  1WFQ A;  2J4X A;  2VZA A;  4R4O A;  3UDG A;  1HR0 L;  3MZ5 A;  2MP1 A;  3D0F A;  1XPR A;  1TVX A;  1A3U A;  2K4K A;  3J80 E;  2E2H B;  3S15 H;  4FNF A;  3S15 B;  2ZM6 Q;  3K5O A;  2AQ3 B;  4M1U B;  4KKT A;  4B3T Q;  3OW7 A;  2BDN A;  1I6H H;  4K8I A;  1I6H B;  2RQX A;  1UWV A;  3MA2 B;  3OWE B;  1CM9 A;  3W2D A;  1RF2 D;  3G6E A;  4RGO S;  4DV0 L;  1FD7 D;  5C4J H;  5IGG A;  2BH2 A;  5C4J B;  1N33 Q;  1Z7T A;  1QVC A;  1I4Q A;  1OXX K;  4OXP A;  1WCM G;  3HGB A;  3MEF A;  3H91 A;  4KI0 A;  1SMY C;  1QZH A;  4BBR H;  5IYC H;  1CHQ D;  1X3F A;  1I4X A;  2M9V A;  4BBR B;  5IOD A;  2BCO A;  1K73 C;  4JOI C;  3KF8 B;  4J15 A;  2B2T A;  4UDU C;  1JCK B;  3KOJ A;  3PF5 A;  3RLF A;  1W2B A;  1B8A A;  1FNV A;  3GTJ H;  1AE3 A;  3O13 A;  3GTJ B;  4G7O C;  5C0X G;  4IOC A;  1BCP B;  1SE3 A;  4Z9C B;  1WD0 A;  3SXH A;  2RBM A;  1DOM A;  4X65 Q;  4JI6 L;  1P8L A;  1I4P A;  4G57 A;  2JSO A;  4DR7 L;  1LM0 A;  4DAY A;  1VQO A;  3KBX A;  4HIO A;  3JAM E;  4HIK A;  1BXT A;  5T1I A;  4LWC A;  4N9T A;  3IRB A;  3F2B A;  3ITP A;  4GKK L;  1PH4 A;  4IFD G;  4O0A A;  5DM6 3;  1YBY A;  4XQJ A;  2UXD Q;  1G6P A;  1VQC A;  3I4M H;  3X3N A;  3I4M B;  4KY5 A;  2VQE L;  3A8K E;  1OTC A;  2OQK A;  1WTH A;  3SEB A;  2MPM A;  5FLX L;  1Y8P B;  2D2C C;  2KHJ A;  2F0O A;  1II3 A;  4A3D H;  1A63 A;  1QCB D;  4A3D B;  4KKS A;  1ASZ A;  1AE2 A;  4GS3 A;  1AN8 A;  2AWN A;  1AFP A;  1V9P A;  4DV7 L;  3H94 A;  4K0K Q;  1RKN A;  4DAV A;  1OO9 B;  3W1G A;  2NN6 H;  5CV9 A;  3Q8D A;  4H7B A;  4EVO A;  4LFA L;  3OMG A;  1EEF D;  1G29 1;  2N49 A;  1G51 A;  1ASY A;  4OO1 I;  2AMC B;  4JI2 Q;  4BY1 H;  1B3Q A;  4BY1 B;  2K1B A;  1XNQ L;  1K0R A;  2EYH A;  3MXG A;  3SDZ A;  1FL0 A;  3J80 L;  1K8G A;  2HCI A;  3CCL A;  3OSO A;  1N9W A;  1GUN A;  2PPB C;  4KN4 C;  2H5X A;  1JQY D;  2D0P A;  3F2U A;  3J7A V;  2ZM6 L;  1L1O B;  4A3I G;  4E6I A;  2F4I A;  5C3E H;  2JA7 H;  3N6R A;  5C3E B;  1PRT C;  1WJJ A;  2JA7 B;  1C48 A;  4DV4 Q;  3HOY H;  3HOY B;  4EQO A;  1M8A A;  2ZXO A;  3ONA B;  3M4O H;  3NPP A;  3M4O B;  4TRD A;  1N33 L;  2B2V C;  1X32 A;  1VDZ A;  1PYB A;  4X66 L;  5KGU A;  3U9S A;  4EGV A;  1EQR A;  1OXV A;  1M1K C;  2B39 A;  3A55 A;  4DV5 Q;  4MIU A;  4C3J G;  1WTQ A;  2A6E D;  1K3B C;  3NEN A;  1CI3 M;  2HUG A;  2XRS D;  2IT1 A;  1V43 A;  1U5K A;  1EOV A;  3JAM L;  1Y14 B;  4X65 L;  1JMC A;  2A74 C;  3D6C A;  3E9I A;  1YHB A;  1BVS A;  1HTP A;  2O2L D;  5EBD A;  2XWB B;  5I2Y A;  2UU9 Q;  1ZKO A;  3HOW G;  3DEP A;  1MIU A;  3J81 i;  3UDF A;  3FP9 A;  1MKH A;  2EJM A;  2Q8T A;  3W3A A;  1ESF A;  3ERO A;  4DR4 Q;  3MEH A;  4DV1 Q;  3ICE A;  2L15 A;  3DWA A;  1HZ9 A;  1SXT A;  4ZKC B;  2EZV A;  5LMN W;  2DNE A;  1GHJ A;  5C3X A;  1C9O A;  4PMB A;  3S1Q H;  3S1Q B;  4I7Z C;  2K50 A;  5CBA E;  4LF6 Q;  1WI5 A;  1HNZ Q;  1IBM Q;  2LSS A;  3R8B A;  1SNO A;  2VL6 A;  4DU9 A;  4QL5 A;  4L63 B;  5IY0 A;  2Z9H A;  1I3Q H;  3OPO A;  4OWX B;  1I3Q B;  2ICI A;  4JBW A;  4ZQ3 A;  1RIP A;  2BOS A;  4K0K L;  1TT2 A;  2CCZ A;  2ZTC A;  4YCV A;  1HJP A;  2PYK A;  4DV3 Q;  3VYR A;  4JI2 L;  4IJL A;  1DON A;  2F0P A;  3NEL A;  1D1I A;  5C4Z A;  3HS0 C;  3LNN A;  4CJ0 B;  2RF4 A;  1C0A A;  5HUR A;  3CC4 A;  4P72 A;  2JN4 A;  3WOE A;  3A56 A;  3NTH A;  4GNX C;  1CTM A;  3FPU B;  1SYB A;  2A69 D;  3BYY B;  4P74 A;  1RHP A;  3DM3 A;  4N8X 1;  2PQA B;  4KV6 A;  2E2I B;  2N78 A;  1XNR Q;  1BQQ T;  3FKI G;  4RFB A;  4FO2 A;  1VMP A;  4DV4 L;  3J81 L;  2I5M X;  2NN6 I;  2VS1 A;  3DWQ A;  4JI7 Q;  5C4X G;  5E4W C;  4A3E B;  3PO3 H;  2EJF C;  1E2W A;  2OCE A;  5NUC A;  5M5W H;  1UAP A;  2KCC A;  2GA4 B;  4KK7 A;  4KMU C;  3PO2 G;  1A3V A;  1L0Y B;  4TVA B;  3DXJ C;  2VUM H;  4DNR B;  1JOO A;  4AYB G;  4DV5 L;  5K36 G;  2E75 C;  5C6A A;  2KQ3 A;  4IUN A;  4A3K G;  3NSW A;  3RZD B;  2LMC B;  2O4X A;  2QIL A;  3I55 A;  1XTC D;  2K6A A;  3CKI B;  2GVB A;  1Y1V G;  1HA6 A;  4LF5 Q;  2K75 A;  3IFD A;  4NPS A;  3W5O A;  3JAM c;  1X55 A;  5IP9 H;  1S72 A;  1O7L A;  1KIX A;  1TQO A;  2F0D A;  2OWO A;  3GQB A;  3SE0 A;  4ME3 A;  2F03 A;  1L0X B;  1XMQ Q;  1U4R A;  3I56 A;  1F77 A;  4RGT A;  2ZJR A;  1E24 A;  3EN2 A;  4OO1 G;  1KDB A;  3SK6 A;  4DR4 L;  3BG3 A;  4ZUI A;  4YWL A;  4DV1 L;  1JT8 A;  5EKL A;  2D5D A;  2VW9 A;  1PTO C;  4AQY Q;  4LF6 L;  1WTV A;  1I5F A;  5IGD A;  3D4R A;  1IBM L;  2UUB Q;  2R93 B;  4A3C H;  2SDF A;  2XNA C;  4HJ9 A;  1ZYR C;  2VXW A;  3J7Y W;  3WWV A;  5DLQ E;  4HJ8 A;  4DR1 Q;  1H9S A;  2NBF A;  1WTX A;  3MWY W;  1D8L A;  3M9B A;  1EY0 A;  4DV3 L;  4K5V A;  1O7I A;  1TWC B;  5GQO A;  1HXY D;  2B2U C;  1FR3 A;  4H0L C;  5JVH 3;  4DPG A;  2MHV A;  3PUW A;  4MTK A;  1ZEQ X;  5I6Y A;  2PCF B;  1BKB A;  4TQU S;  1HNW Q;  2F1M A;  1YVC A;  2K32 A;  3I91 A;  4R4T A;  1ICW A;  3K0X A;  2L4N A;  1E1O A;  4DXG A;  3QJY A;  1J6Q A;  1CZG A;  3D3R A;  2R3Z A;  4X64 Q;  3EVQ A;  1XNR L;  1D5M C;  5IGC A;  4Q5V A;  2A69 C;  1JOK A;  4A75 A;  1Q90 A;  4IUR A;  3TP8 A;  3V05 A;  3WDN A;  2B63 H;  2K52 A;  3SHL A;  3I7F A;  2B63 B;  4JI7 L;  2JA5 B;  3P1H A;  4CKB A;  5BN3 A;  2EDG A; 
#chains in the Genus database with same CATH homology
 2A5H A;  3CRK C;  2QF7 A;  2PW7 A;  2MJ8 A;  4A3B B;  4KKU A;  1F2Z A;  5IGE A;  4CHT B;  3NP8 A;  1RTN A;  3NHH A;  3T13 A;  3DEO A;  3K5N A;  2XN9 C;  3M4Y A;  3HRZ C;  1EY4 A;  1VF5 C;  1V1P B;  1JB3 A;  4G4K A;  1OXS C;  1IYV A;  4WRD A;  3QB3 A;  1B1Z A;  3BVG A;  4QCL A;  3HOU B;  4V0B A;  4K2L A;  3HKZ B;  2KUM A;  3H09 A;  2IX3 A;  1LT5 D;  3C46 A;  5KIX A;  1Z47 A;  2E74 C;  4A93 B;  4R9W A;  3I4N B;  4ZKB B;  3VYS A;  4KJN A;  1PFM A;  2B2T C;  2SNM A;  4K6L A;  3QWN A;  3UI2 A;  4G7H C;  1G2S A;  1UEA B;  1A3T A;  2L0C A;  4V19 0;  3QOL A;  4K8J A;  3GTQ B;  4F87 A;  4RHR A;  3WOF A;  2QDB A;  4IUP A;  1Q1E A;  5J1Z A;  3TZD A;  1U4L A;  3EFX D;  1PRT F;  2EVB A;  1SSO A;  5CV6 A;  3NXW A;  4FF2 A;  1LTA D;  1V8Q A;  1VMC A;  2N88 A;  3GTP B;  1PZJ D;  4EQN A;  4KD4 A;  1O7Z A;  4YIJ A;  1Y69 U;  3CHB D;  4BWG B;  1B9N A;  1EIH A;  1PMR A;  1EY6 A;  1RTO A;  3TME A;  1EY7 A;  1HQR D;  2LFN A;  5CGK A;  3R3O A;  3VYT A;  1SNP A;  5KRU A;  3K57 A;  2K5W A;  1AEX A;  1LAB A;  2WAC A;  3KF8 A;  2C9O A;  2BA1 A;  1DCZ A;  1QB5 D;  3H0G B;  2C5C A;  2WV6 D;  3OWF A;  2NVT B;  4MN3 A;  2J0T D;  1LTR D;  5EPL A;  4XYO A;  2F0N A;  2AUK A;  1O80 A;  1DXM A;  3I72 A;  1DOL A;  2PQE A;  2F0T A;  3NWT A;  1EIG A;  2KA7 A;  5KYI A;  1F9Q A;  5AFW A;  5DNF A;  1SNC A;  1YNN D;  4HN7 A;  2X6G A;  4IUT A;  4IN3 A;  1PRT D;  2YYZ A;  4ABN A;  1SJE D;  3SK4 A;  2NVY B;  1Q8I A;  3NQT A;  1J8I A;  4R8N A;  2F0U A;  2F0H A;  3OIQ A;  5C44 B;  4WOR A;  1KDA A;  3SR1 A;  2NWG A;  3S1M B;  5IOC A;  3M85 A;  3KLR A;  3BS1 A;  4DK1 A;  4BY7 B;  3NK9 A;  1CQF A;  3D31 A;  2F0G A;  2WAQ B;  3HG9 A;  1G6Z A;  4R8I A;  4BA1 I;  1TWG B;  1BDO A;  3J7A F;  4A3F B;  1Y1W B;  3MXP A;  4RWS C;  3TN2 A;  2EYM A;  2D62 A;  1E2Z A;  1ILP A;  1STN A;  4RGN A;  2F0L A;  5EKK A;  2JEA I;  3P75 A;  2SNS A;  4BBS B;  2JP1 A;  3I3C A;  3MXN A;  3K5L A;  3OMC A;  1HRJ A;  2EE1 A;  3LX0 A;  2F0F A;  2J7Z A;  1S5B D;  3MFY A;  2OXP A;  3BDL A;  5CV5 A;  4C3H B;  2EY1 A;  1O7Y A;  1YNJ C;  4XT3 B;  1NR4 A;  5M3M B;  3GTO B;  4N9P A;  1PTO F;  4JK1 C;  5KND A;  5LL6 X;  1K8O A;  3H6M A;  1PZI D;  1SBB B;  3PUX A;  5EBC A;  2QKI C;  3DHQ A;  1F2L A;  1EL0 A;  2I07 B;  4X3U A;  1FNW A;  3BVZ A;  2PW5 A;  3QIA A;  1H9M A;  5M3F B;  3VR5 A;  2OEO A;  4HCE A;  2NVX B;  5KEE A;  1EQV A;  2PNR C;  3DUZ A;  3MHB A;  4A3J B;  1YNN C;  3HOV B;  2WII B;  1D5X C;  1DJR D;  1A15 A;  5EKI A;  2R7Z B;  2DY8 A;  5D3D A;  3HEJ A;  1NR2 A;  1SYE A;  4FP5 D;  2E2J B;  4DGZ A;  1M4V A;  2EPB A;  1T5X D;  2KEE A;  3GTG B;  3EQL C;  4RHS A;  1QNU A;  4NW2 A;  1HFN A;  3Q6S A;  1DYQ A;  2G9D A;  1PDQ A;  1QOH A;  4KN7 C;  2Z8L A;  4LK1 C;  5EGT A;  2NTS A;  1F2M A;  4IZ8 A;  4RCO A;  4K6D A;  4NDX A;  1AP0 A;  1PTO D;  2F0M A;  4FYD A;  1GUW A;  2ID0 A;  1KAB A;  1ROD A;  1ZYR D;  2VNU D;  5T1G A;  4CKC A;  1PLF A;  4J1M A;  5JOB A;  1I4G A;  2OF1 A;  1EEI D;  1TU2 B;  2CHB D;  1A2T A;  2CW0 C;  3FEW X;  2HCC A;  3PIP 3;  4DN4 M;  4RA8 A;  1CZW A;  4IQZ A;  2PZW A;  4BA2 I;  1SJH D;  2L11 A;  2RVL A;  1VF7 A;  4DF7 A;  3S14 B;  1HHV A;  1ET6 A;  4O1N A;  3PUZ A;  4I65 A;  4L8J A;  3S2H B;  5TSS A;  3A8I E;  3L7Z C;  2L12 A;  4A3G B;  1ZXT A;  5I4D A;  1QWY A;  1EYA A;  1AZQ A;  4KY7 A;  3S2D B;  3R2I A;  1EYC A;  4J8Q A;  4H13 C;  1NSN S;  1TS3 A;  1TWH B;  3G7L A;  2BA0 A;  4CJ2 C;  1HUN A;  1AZP A;  4FXD A;  2K01 A;  5BN4 A;  1NUC A;  4ZUJ A;  5EPK A;  3QG1 A;  5A2Q E;  4Q0F A;  1XWE A;  3TP6 A;  2LY7 A;  2RSO A;  1T5E A;  4CBV A;  4HMJ A;  3ERQ A;  2EY5 A;  4RGM A;  1DOK A;  1ONL A;  4IAL A;  5HGT A;  1GJX A;  1GUO A;  4B9X A;  2IPK D;  3FMC A;  4C3I G;  1U9R A;  2Z4H A;  1RD9 D;  3C2P A;  1Z6H A;  2R6G A;  4P2C B;  2L9H A;  2F0E A;  4LMQ D;  3KBG A;  1HCZ A;  4NKL A;  2A6H C;  5IT9 E;  1QJO A;  2WIN B;  1TR5 A;  3HP3 A;  3R93 A;  2RA4 A;  5JEA J;  5DEH A;  2B2V A;  1XX8 A;  4B08 A;  2K03 A;  3BDC A;  2PMZ B;  4H44 C;  5IGF A;  5ELD A;  2O5J C;  2CQA A;  5ISR A;  1V1P A;  3NQI A;  1EWH A;  3TBI B;  1TY2 A;  2NVQ B;  2AQ2 B;  2F0Q A;  2FIN B;  2ZT9 C;  1G91 A;  1X3P A;  3SK5 A;  2MGS A;  2ICE C;  3Q24 A;  4ILW A;  3NBI A;  3K0Y A;  4RAU C;  1TII D;  3DWP A;  2EJG C;  1S5C D;  4CJ1 B;  4K14 A;  4IUQ A;  1V1O A;  4U67 3;  4A3I B;  2NYZ D;  3QO2 A;  4ME5 A;  2IWH A;  4XYQ A;  3MAQ A;  3NBH A;  4B9W A;  5C3W A;  1ESR A;  1TWA B;  1Q3L A;  1EQT A;  2EY6 A;  1J9O A;  1PRT B;  1DZ1 A;  2BE5 D;  2ZXP A;  1BCP C;  1DD2 A;  2L5T A;  5LHY 1;  1TS2 A;  2XIW A;  1S5E D;  3T16 A;  3L9A X;  4C3J B;  4CKE A;  2JE6 I;  2SEB D;  4QIW B;  5FO8 B;  3HOX B;  3HOW B;  1B9M A;  1B4O A;  5JVG 3;  2A73 B;  1HA5 A;  1WTW A;  2OT2 A;  1GOZ A;  4TKO B;  5IT9 L;  1IHZ A;  1ML0 D;  3K6O A;  1D6E C;  5BN5 A;  1SND A;  5DAU A;  1I6V C;  4XQN A;  1G2T A;  1I4H A;  2KVM A;  3NWS A;  2RKS A;  2A68 C;  4ZLT F;  1HTL D;  1KLG D;  5CR3 A;  4RH6 A;  3KLS A;  2NTT A;  4J6H A;  5K5P A;  1WTR A;  2LS0 1;  1SAP A;  1ET9 A;  1C8C A;  1LT3 D;  2K28 A;  2NN6 G;  3T53 B;  1KNA A;  3OHX C;  2Z1C A;  4ID6 A;  3BDO A;  3VR4 A;  3VR3 A;  1OXU A;  5CBE E;  1JWU D;  3VR6 A;  5KYL A;  5FOB B;  4FF1 A;  1CHP D;  3C1F A;  2KOL A;  2M00 A;  2B2W A;  5I6W A;  4QUC A;  1A2U A;  1FNU A;  3FKI B;  4F8M A;  3LWE A;  3FRP B;  3U9O A;  1MSH A;  5CMD A;  3TZU A;  5C4X B;  3SK8 A;  3PUY A;  4L6T B;  3M3Y B;  2G9H D;  1RDP D;  3ND8 A;  1STE A;  1MBY A;  3PO2 B;  1SNM A;  2Z4I A;  1JC7 A;  3A54 A;  4MHE A;  1HPC A;  1JWM D;  2AQ1 B;  2XWJ B;  2E2D C;  4AYB B;  2NUC A;  1SE2 A;  1E0B A;  2BE5 C;  1JR0 D;  1WTP A;  1QG7 A;  1JOQ A;  3MTS A;  1B2T A;  4HCS A;  4DA2 A;  3RZO B;  1YNJ D;  5F2D A;  3D8G A;  1GXD C;  2QCP X;  1QE6 A;  1PFB A;  2F0S A;  4RKL A;  4KD3 A;  4HMI A;  3S9W A;  3I4L A;  4GZY C;  1ENA A;  4UAI A;  3RMH A;  2RDG A;  3FDT A;  5EJW A;  4Y7N B;  3P20 A;  4X3S A;  2WP8 J;  2TSS A;  1C4Q A;  4NP5 A;  4ZRZ A;  1PTO H;  5ELB A;  1PTO B;  4PMW A;  1EZ6 A;  5C0X J;  3E6Z X;  2B2Y A;  1U4P A;  5JJZ A;  5D14 A;  1LTS D;  1U4M A;  4A3M B;  2WKD A;  2V4D A;  5JAV A;  4XT1 B;  2KJX A;  4OHJ A;  2H4O A;  4EQP A;  4RKB A;  1BF4 A;  2JA6 B;  5JPM C;  4IFD J;  1HQM C;  1H9J A;  1B53 A;  5JEA H;  4FF3 A;  1RCV D;  1PYW D;  1EYD A;  1HFG A;  2FMM A;  4KHZ A;  3A7L A;  2EYP A;  1CT1 D;  3PUV A;  3GV3 A;  1W6J A;  4FF4 A;  1S5D D;  5D3I B;  2HDL A;  5A35 A;  1BNZ A;  5IGB A;  1TKW B;  1LTG D;  3P7J A;  2O5I C;  4LJZ C;  1W6K A;  3FPP A;  1GHK A;  3S17 B;  5EQ0 A;  1GUS A;  4HSV A;  4F88 A;  1SE4 A;  3NE5 B;  1UNS A;  5CC4 A;  1R9T B;  4OIJ A;  4C1N I;  3HOZ B;  3OIP A;  1XXG A;  1LAC A;  5G3L F;  4XTC S;  3D6W A;  3VR2 A;  2L1B A;  2CW0 D;  1F2Y A;  1NAP A;  5E1F A;  1EU4 A;  5ELF A;  5IIF A;  3AU7 A;  3OOC A;  2M2L A;  2F3W A;  2VB2 X;  4ODG A;  1B3A A;  1KDC A;  1Y8O B;  3VA7 A;  5ELC A;  4ZAI A;  2JEB I;  2DN8 A;  2IL8 A;  1PZK D;  3CU7 A;  2R61 A;  3K59 A;  1FGB D;  1EFI D;  3IL8 A;  3NTK A;  3GP7 A;  1AW7 A;  2RDH A;  2F0V A;  5JPN C;  1ILQ A;  3AMU A;  3PMF A;  2EYJ A;  2IX1 A;  1R4Q B;  1CA5 A;  3TP5 A;  3TSS A;  4HTH A;  2PZU A;  1BCP F;  1MGS A;  3D4D A;  3J81 E;  3R2T A;  1QIL A;  1K83 B;  2F0K A;  1CFM A;  3S1N B;  1IL8 A;  3GD7 A;  3S1R B;  2EOT A;  4WFN 3;  2KHS A;  1B44 D;  1JWS D;  4HR7 B;  1EWC A;  2F0W A;  5G3L D;  2A6H D;  1LTI D;  2F3V A;  4KY6 A;  2WB1 B;  1MSG A;  2FJ2 A;  3GTK B;  3URY A;  5FO7 B;  1SYF A;  1KAA A;  1CK1 A;  2NZ1 D;  4KJO A;  3LWU A;  1JOR A;  3IKJ A;  5I2X A;  2KEC A;  3I90 A;  3X3M A;  1KNE A;  4ULL A;  3ZYY X;  5C5M A;  4CGY B;  1VCI A;  4FXK C;  1OXT A;  2RSN A;  1F9S A;  1SEB D;  2VB3 X;  1Q12 A;  2H1E A;  3M7N A;  5CYU A;  2FMC A;  3A8J E;  2L55 A;  1WD1 A;  5FKA C;  1A6X A;  1KTK A;  1F9R A;  2E76 C;  1CA6 A;  5CV8 A;  3NUC A;  3MC0 B;  1EZ8 A;  2WKC A;  2X6L A;  1D1K A;  1E2V A;  3GO5 A;  5M5X B;  2K33 A;  2PO4 A;  1TS5 A;  4X3K A;  3Q22 A;  2X69 A;  1KLU D;  1BCP D;  1BR9 A;  5FO9 B;  1WCM B;  5FK9 C;  2K5D A;  4DXF A;  4PMC A;  5DM7 3;  2ENB A;  5M5Y B;  2EYF A;  1TWF B;  2Q8R E;  2EY2 A;  4BS9 A;  5EPJ A;  4KTA A;  4OL7 A;  3TDQ A;  5KNB A;  4PNY A;  5C0X H;  1EY5 A;  3PO3 B;  3T4A C;  4TSS A;  1LT4 D;  1STA A;  5M5W B;  1EU3 A;  2D9U A;  2VUM B;  5J22 A;  3HZX A;  4U68 A;  4RCN A;  5J39 A;  2CVR A;  4IFD H;  1BUV T;  4DNT B;  2A68 D;  3H3V C;  2A6E C;  1ENC A;  4O42 A;  4HAE A;  1CQV A;  3DMU A;  1H9R A;  3CRL C;  1MD2 D;  2HQE A;  3K58 A;  2AUJ D;  1DM0 B;  2B2W C;  1B50 A;  4XDX A;  3RUZ A;  3I8Z A;  1LLR D;  4KHV A;  5KNC A;  5E3F A;  3E0J A;  3BZD B;  5I9O A;  2K04 A;  4WJW A;  3T51 B;  2JA8 B;  1IKM A;  2FFK B;  3VYU A;  2YU9 B;  1IW7 D;  2EYO A;  1MI2 A;  1SYG A;  3L3O C;  2IW3 A;  4F7X A;  1LT6 D;  1SYC A;  4ZK9 B;  3ND9 A;  2PZT A;  4NMZ A;  4OIK A;  5COY A;  1SYD A;  5C4H A;  1K8M A;  3PV0 A;  5A2Q L;  2B8G A;  1WTO A;  1G8Z D;  2DNC A;  4DK0 A;  1LTT D;  3EJI A;  2AWO A;  5JEA G;  1S4Z A;  2JXM B;  3A7A B;  2F0J A;  2I46 A;  4XIG S;  2N55 A;  5ELE A;  1LTB D;  3DM1 A;  1BO0 A;  4FXG C;  1QNK A;  4DAP A;  1JIC A;  2FHT A;  3G6J B;  4K5W A;  1IKL A;  2K05 A;  2XRQ D;  1D2B A;  2TMP A;  3K5M A;  2K7V A;  2B2Y C;  3T56 B;  4K2K A;  4LAA A;  3NTI A;  3KLS X;  4IUU A;  1H9S B;  4ZYS A;  1BOS A;  2EYL A;  3V96 A;  1Q1B A;  3KUP A;  4C56 C;  2F0I A;  5CV7 A;  5M9O A;  4C1N K;  3IFT A;  4QMG A;  4C3H G;  5D65 A;  1O78 A;  5C0X I;  1STG A;  2RDF A;  1Y8N B;  3TP7 A;  1EY9 A;  3BYT B;  1S5F D;  3D4W A;  4DFA A;  1I50 B;  1LV9 A;  1STY A;  2KCN A;  4X3T A;  3C3L A;  3SVM A;  2XVS A;  2ZXR A;  1JE4 A;  4HED A;  4IFD I;  1FYC A;  3K7A B;  2K5Q A;  4HSP A;  2IJ0 A;  5I9P A;  4IUV A;  4QB4 A;  4S3S A;  1F9P A;  5COR A;  2Y0S B;  4K5X A;  3MFG A;  1R4P B;  2DY7 A;  1IW7 C;  1D5Z C;  2Q8I B;  1X3Q A;  5C5L A;  1ENF A;  2XSC A;  4G7Z C;  1NCV A;  3BVM A;  1UUP A;  1SMY D;  3AB9 A;  2NB0 A;  2HDM A;  4QUF A;  4QF4 A;  3C1E A;  4PQX A;  3VA5 A;  1TS4 A;  3I70 A;  3S16 B;  3Q23 A;  1H9K A;  1BBX C;  2QEJ C;  5K36 H;  3MXU A;  1GUT A;  1I4R A;  3KK7 A;  4A3K B;  3QOJ A;  3GV6 A;  2R92 B;  2B2U A;  2B8F A;  3RD4 A;  1Y1V B;  1GUG A;  5LL6 S;  2KED A;  2EXZ A;  1XYI A;  1LO5 D;  1RJT A;  3FVQ A;  1EOT A;  3Q0A A;  4M8A A;  3MVV A;  4OGQ C;  4C3I B;  4OO1 H;  4C2M B;  3I73 A;  4XXE A;  4FVM A;  3GTM B;  1IYU A;  2LKV A;  2BDO A;  3V2T A;  1SDF A;  1SNQ A;  3N52 A;  1STH A;  4PV1 C;  5FLX E;  1EY8 A;  2JYO A;  3CQZ B;  2IX0 A;  2SOB A;  3M7G A;  1TY0 A;  3E5S A;  1WVL A;  1SFO B;  5E4X A;  4XQQ A;  3EA6 A;  2MUY A;  1PXU A;  1STB A;  3PIO 3;  3IAY A;  1HUM A;  1PFN A;  5CV4 A;  3GTL B;  2J4X A;  3MZ5 A;  2MP1 A;  1TVX A;  1A3U A;  2E2H B;  3J80 E;  4FNF A;  3S15 B;  3K5O A;  2AQ3 B;  4M1U B;  4KKT A;  3OW7 A;  2BDN A;  4K8I A;  1I6H B;  2RQX A;  3MA2 B;  3OWE B;  1CM9 A;  3W2D A;  1RF2 D;  4RGO S;  1FD7 D;  5IGG A;  5C4J B;  1Z7T A;  1I4Q A;  1OXX K;  3HGB A;  3H91 A;  4KI0 A;  1SMY C;  1CHQ D;  2M9V A;  1I4X A;  4BBR B;  5IOD A;  2BCO A;  2B2T A;  4UDU C;  1JCK B;  3RLF A;  1FNV A;  3O13 A;  3GTJ B;  4G7O C;  5C0X G;  1BCP B;  1SE3 A;  4Z9C B;  1WD0 A;  3SXH A;  2RBM A;  1DOM A;  1I4P A;  4G57 A;  2JSO A;  4DAY A;  3KBX A;  3JAM E;  1BXT A;  5T1I A;  4N9T A;  3ITP A;  4IFD G;  5DM6 3;  4XQJ A;  3X3N A;  3I4M B;  4KY5 A;  3A8K E;  3SEB A;  2MPM A;  5FLX L;  1Y8P B;  2D2C C;  2F0O A;  1II3 A;  1QCB D;  4A3D B;  4KKS A;  1AN8 A;  2AWN A;  1AFP A;  3H94 A;  1RKN A;  4DAV A;  1OO9 B;  2NN6 H;  5CV9 A;  4H7B A;  4EVO A;  3OMG A;  1EEF D;  1G29 1;  4OO1 I;  4BY1 B;  2K1B A;  2EYH A;  3MXG A;  3SDZ A;  3J80 L;  2HCI A;  3OSO A;  1GUN A;  2PPB C;  4KN4 C;  1JQY D;  3F2U A;  3J7A V;  4E6I A;  2F4I A;  3N6R A;  5C3E B;  1PRT C;  2JA7 B;  1C48 A;  3HOY B;  4EQO A;  1M8A A;  2ZXO A;  3ONA B;  3NPP A;  3M4O B;  4TRD A;  2B2V C;  1X32 A;  1VDZ A;  5KGU A;  3U9S A;  4EGV A;  1OXV A;  2B39 A;  3A55 A;  4MIU A;  4C3J G;  1WTQ A;  2A6E D;  1CI3 M;  2HUG A;  2XRS D;  2IT1 A;  1V43 A;  3JAM L;  2A74 C;  3D6C A;  1HTP A;  2O2L D;  5EBD A;  2XWB B;  5I2Y A;  1ZKO A;  3DEP A;  2EJM A;  2Q8T A;  3W3A A;  1ESF A;  3ERO A;  3MEH A;  3DWA A;  1SXT A;  4ZKC B;  2EZV A;  2DNE A;  1GHJ A;  5C3X A;  4PMB A;  3S1Q B;  4I7Z C;  5CBA E;  3R8B A;  1SNO A;  4DU9 A;  4L63 B;  3OPO A;  1I3Q B;  2ICI A;  4JBW A;  4ZQ3 A;  2BOS A;  1TT2 A;  2PYK A;  3VYR A;  1DON A;  2F0P A;  1D1I A;  5C4Z A;  3HS0 C;  3LNN A;  4CJ0 B;  5HUR A;  3WOE A;  3A56 A;  3NTH A;  1CTM A;  3FPU B;  1SYB A;  2A69 D;  3BYY B;  1RHP A;  4KV6 A;  2E2I B;  1BQQ T;  4RFB A;  4FO2 A;  1VMP A;  3J81 L;  2NN6 I;  3DWQ A;  5E4W C;  4A3E B;  2EJF C;  1E2W A;  5NUC A;  1UAP A;  2KCC A;  2GA4 B;  4KK7 A;  4KMU C;  1A3V A;  1L0Y B;  3DXJ C;  4DNR B;  1JOO A;  5K36 G;  2E75 C;  5C6A A;  2KQ3 A;  4IUN A;  3RZD B;  3NSW A;  2LMC B;  2O4X A;  2QIL A;  1XTC D;  2K6A A;  3CKI B;  1HA6 A;  3IFD A;  1O7L A;  1TQO A;  2F0D A;  3GQB A;  3SE0 A;  2F03 A;  1L0X B;  1U4R A;  1F77 A;  4RGT A;  4OO1 G;  1KDB A;  3SK6 A;  3BG3 A;  4ZUI A;  5EKL A;  2D5D A;  1PTO C;  1WTV A;  5IGD A;  3D4R A;  2R93 B;  2SDF A;  2XNA C;  1ZYR C;  2VXW A;  3J7Y W;  1H9S A;  2NBF A;  1WTX A;  3MWY W;  1EY0 A;  4K5V A;  1TWC B;  1HXY D;  2B2U C;  1FR3 A;  4H0L C;  5JVH 3;  2MHV A;  3PUW A;  5I6Y A;  1ZEQ X;  2PCF B;  4TQU S;  2F1M A;  2K32 A;  3I91 A;  1ICW A;  2L4N A;  4DXG A;  3QJY A;  3D3R A;  1CZG A;  2R3Z A;  3EVQ A;  1D5M C;  5IGC A;  4Q5V A;  2A69 C;  1JOK A;  1Q90 A;  4IUR A;  3TP8 A;  3V05 A;  3WDN A;  3SHL A;  2B63 B;  2JA5 B;  3P1H A;  4CKB A;  5BN3 A;  2EDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...