1LT4D

Heat-labile enterotoxin mutant s63k
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Crystal structure of a non-toxic mutant of heat-labile enterotoxin, which is a potent mucosal adjuvant.
pubmed rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 27
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1997-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lt4D00
1T5XD 2IPKD 4RHRA 1HXYD 2SEBD 3EFXD 1D5MC 1EEFD 4DXGA 1PRTC 1TY2A 1BCPC 4RHSA 1BXTA 3BVZA 1SJED 3R2IA 2G9HD 2TSSA 4RGTA 3R8BA 1AW7A 4RGMA 1FD7D 4RCOA 2O2LD 4RFBA 1SEBD 1JCKB 4Z9CB 1JQYD 2IJ0A 3V05A 5ELEA 3BVGA 3BYYB 4DXFA 1FNUA 1S5CD 2NTTA 4C56C 1B44D 5D3IB 1TS5A 1DJRD 1CHQD 1CK1A 5D3DA 3TSSA 4OHJA 4RH6A 1DYQA 1I4XA 1LT6D 1V1PA 1LT5D 5ELFA 2AQ1B 1LTTD 4TSSA 3MFGA 1D6EC 3EA6A 1GOZA 1LT4D 1RDPD 2XRQD 1SE2A 2NTSA 1B1ZA 1M4VA 1RF2D 1UNSA 3GP7A 5ELDA 1STEA 1PRTD 1PTOB 2RDHA 1L0YB 2XRSD 1BCPD 1KLGD 1PTOF 3R2TA 1PZJD 2XNAC 1TS3A 1PZID 1I4GA 1V1OA 1SJHD 2ICIA 1S5BD 1I4RA 3DWQA 1PTOC 4RGOS 1I4HA 1F77A 1S5FD 3OWEB 1D5ZC 4UDUC 4L6TB 1AN8A 3DWAA 5ELBA 4BWGB 3BYTB 2XN9C 5TSSA 1SE3A 1CT1D 3BVMA 1HA5A 1SBBB 2AQ2B 5FK9C 2WV6D 2QILA 3DWPA 1LLRD 1LO5D 1CQVA 1TS4A 1ENFA 1FNWA 1LTAD 1EEID 1QILA 1KLUD 3URYA 1G8ZD 2AQ3B 1UUPA 1CHPD 1EU3A 1LTSD 1LTBD 1PZKD 1KTKA 3O13A 1I4PA 5ELCA 1FNVA 1XXGA 1BCPF 3KLSX 3MC0B 5FKAC 1XTCD 1RCVD 1D5XC 1I4QA 1PTOH 1ESFA 1EU4A 1RD9D 2R61A 1PTOD 1TS2A 1EFID 4L63B 1LTID 1L0XB 2J4XA 4RGNA 1V1PB 1JR0D 1LT3D 1FGBD 3SEBA 3CHBD 2QEJC 2RDGA 4ZYSA 1MD2D 2CHBD 1S5DD 1ET9A 1ET6A 3BZDB 1S5ED 1LTRD 1JWUD 2Z8LA 1SE4A 4K6LA 5I4DA 1HQRD 3W2DA 1EWCA 1HTLD 1PYWD 1PRTB 1SXTA 1TY0A 4O1NA 1BCPB 1JWMD 1PRTF 1LTGD 1JWSD
chains in the Genus database with same CATH superfamily
2PZTA 1A0IA 1YHQA 5IYCG 2N8NA 4JI0L 3KFUA 3CCQA 1KABA 1Q90A 4QMGA 4OXPA 1MBYA 2R7FA 1XX8A 5A2QL 4CJ0B 5CGKA 5JVG3 3Q8DA 5C3EH 3J80E 4A3GG 1Y1WB 1EQVA 4PNYA 1BR9A 2A6ED 4LJZC 1VQPA 2VL6A 2E75C 4JI7Q 4HJAA 1XNRQ 4A3EB 3H09A 3GTGH 1HUNA 3MXGA 1LT5D 2SNMA 4X3TA 3HKSA 5AJ3Q 3S14B 3HOUB 5L37A 4K0KQ 2HDLA 4A3BB 4JCVE 3T16A 1VQ5A 2XGTA 3E9HA 4HIDA 4EX5A 2F0QA 1CZGA 2UXBL 2RDHA 1HNZQ 2ASBA 2Q8TA 1V8QA 1BVSA 2ZJQA 4DAPA 3LWEA 2L55A 1D1IA 2L1BA 1PXUA 3I3CA 4FO2A 4A3FG 1WD1A 4KHPQ 4DA2A 4NP5A 3I73A 5F2DA 1IBLQ 4RA8A 3BVMA 2R7DA 1VQJA 5IY0A 4TVAB 4A3MG 2ZM6L 3DEPA 1GHJA 1P16A 2B2WC 3QG1A 1WD0A 3H6MA 3CC7A 3NTIA 2UU9Q 4LUZA 2HT1A 4AYBE 1ZKOA 3QB3A 3PQIA 4UP8A 3GTLH 3AFPA 5IYBH 1PZKD 1Z7TA 2CW0C 3MHBA 2BH8A 2JN4A 2F4VL 2MPMA 2UXDL 1H9RA 1V1QA 1GHKA 4G57A 2B63H 1F2ZA 1F2LA 3W1GA 3HOWH 3BU2A 3SHLA 4QIWB 5FLXL 2R7ZG 3QR8A 1V1PB 4KN7C 1NAPA 2DGYA 4F7XA 1EZ8A 1STYA 3I4OA 3NELA 3FVQA 3PIP3 4KN4C 5J1ZA 5LMUL 1S5ED 1YZ6A 1U0LA 3T1YQ 1WI5A 1L1OC 2OF1A 2B2WA 2JXMB 1EWCA 4IFDG 1LUZA 3KYHC 2FXQA 2VB2X 5IGDA 1XNQL 3OIQA 2KOLA 1BDOA 4DF7A 2L4NA 5C3EB 1PRTC 3KLSA 2D62A 3A5UA 3R2IA 4ZK9B 3SK6A 1RKNA 3GTGB 1STHA 4JBJA 4RKLA 4X62L 4A3IH 5KYIA 1FR3A 2CH4A 4LW1A 4M1UB 4KK7A 2MQHA 3OW2A 1II3A 2K75A 4B3SQ 1E1OA 1O7IA 4ID6A 4KJOA 1LT6D 1K0SA 2EZVA 4XQNA 4IUVA 2DNEA 1IHZA 1L1OA 5FLMG 3TMEA 2F0HA 3PUYA 3NUCA 1RDPD 1C7YA 5EPLA 3STBD 3UDGA 4EQNA 4A93H 5FLXc 4DK0A 1DD2A 2B39A 2VW9A 5IP9H 3L3OC 1KAAA 4IFDI 2UXCQ 2J0TD 3A8IE 1IYVA 4IPGA 3TREA 3ITPA 1RTOA 4C3JH 4IN3A 2OQKA 3MTSA 4BWGB 1UE1A 4QGUA 1SBBB 3H94A 4CKCA 3GTLB 2JA5G 1XTDA 2E76C 1LO5D 2F0IA 3IL8A 3I56A 2AWOA 2B63B 4BXXH 2J7ZA 3HOWB 1Q8IA 3GV3A 1LTBD 3HOVG 1I6VC 5J3BA 4GKJQ 2A5HA 5GAGC 1HNXL 2K6AA 4DR7L 1B7YB 1KTKA 2UUAL 1E2WA 2A68D 1SYDA 1H9SB 3KLSX 1VQAA 1YVCA 3MZ5A 4I7AA 2WKDA 1RCVD 2YTVA 1PTOH 1ESFA 3WDNA 2QKIC 2J4XA 4A3LH 4OGQC 4LFBQ 1SNOA 2EYFA 3AMUA 3KBGA 4KV6A 2F1MA 3K5NA 1J8IA 2CHBD 3EBEA 2B8GA 3F2CA 3TP8A 2MO0A 2UUBL 1LYLA 3GTKH 3OMCA 2Z8LA 2ZTDA 1RJTA 1M1KC 1A2TA 1PYWD 3S15H 2Z0SA 5E3FA 1BCPB 1I3QH 2EYHA 4RKBA 1SNCA 2B2UC 1X3EA 4JI4L 4K5XA 1HXYD 3EFXD 1D5MC 1VQOA 1STGA 4FYDA 1H9KA 4R4TA 4KY7A 1A15A 4XYQA 1SJED 3TBIB 1VF7A 1QWYA 2TSSA 5K5PA 1JICA 2OEOA 2Z4IA 5IGEA 3QOJA 1EY0A 4DNIA 1E0BA 2KEDA 2VQFL 3N52A 4UP7A 3H91A 4N9PA 3VR2A 2WB1G 1TU2B 4YHHL 4DV6L 1EOTA 4X64Q 2F0KA 4IOAA 2Q8IB 5FO9B 4N9TA 3L7ZC 4IJLA 4ILWA 2B2UA 3ER0A 1X55A 1VCIA 1L0YB 3PF4A 2B2TC 2IW3A 4IUTA 2JQOA 1XMOQ 1W3SA 4RGOS 2WFWA 2F0OA 3OWEB 2A6HD 4FP5D 1K28A 2K5DA 5EGTA 3CPFA 5BN5A 1Y8PB 2JE6I 3G48A 2O5JC 3RN5A 2EQSA 3OTOL 1FL0A 1TR5A 3FEWX 2LXKA 2VY3A 2HDMA 1EY5A 5C44B 2KHJA 4ABNA 2B2TA 3W5OA 3M7NA 3GTKB 2OTJA 2Q2TA 1K73C 1EFID 2FHTA 2D5DA 1TXYA 4WJWA 5FJ8G 3S15B 3CCRA 1NY4A 2RBMA 1QZGA 4EQPA 1WCMH 2EYJA 2VNUD 1VMPA 5E7NA 4O2DA 2R92G 3K6OA 1TWHH 4GS3A 4JBWA 4K8JA 1ET6A 1ZXTA 4YIJA 4BA1I 3MAQA 4R1JA 4JI6L 3BDLA 5I4DA 3EVQA 1MKHA 4JV5Q 3OWFA 4DR6Q 5LMNQ 4GLXA 2ZJRA 3U9SA 4NXNQ 2SEBD 1EEFD 1I94L 1MJCA 1SYFA 2E74C 5HURA 1WYDA 2ES2A 1UE6A 1NUCA 1E7ZA 2WAQB 4N8X1 3UDFA 4A76A 1E1TA 5ELEA 5HY6A 4LF4Q 2OXPA 2N55A 2RQXA 4PMCA 4GOPC 2X6GA 3B6YA 1Y8OB 4AH6A 5LL6X 1QG7A 3SVMA 4FXGC 3NP8A 3I4MG 2EY1A 1HNWL 5GAHC 2KENA 1JMCA 2PZWA 4A75A 1BQQT 2E5LQ 1MGSA 4TSSA 5IP9G 4JI2Q 3CKIB 3I72A 4LF6Q 2PQAA 3QO2A 1KDCA 2RSOA 3LWUA 2RCNA 3UE0A 2Q2UA 1VMCA 1Y69U 4IURA 4X66L 1H9MA 1E2VA 3NBHA 2JYOA 1SYEA 5DM73 2EE1A 4QL5A 4KY5A 5FO8B 3HRZC 3PIO3 3SGIA 1F9RA 1D5ZC 3HOZG 3D31A 3MEFA 3A8KE 1CFMA 1U9RA 2K4KA 4F87A 5KNCA 4OO1H 4FXDA 4JYAQ 4GOPA 5I2XA 4P75A 1SMYD 5G3LD 4A3KB 2QILA 3TP7A 1YNXA 3NTKA 3ULJA 1K8OA 2HQEA 1QILA 2BCOA 1QB5D 3D6CA 1Z9FA 4DUZL 4K5WA 2K50A 1XWEA 1WCMB 4A3LG 4F8MA 3J81L 2RHQB 2NZHA 1I4QA 3K57A 2G9DA 1PLFA 3I4NB 2N88A 5DLQE 2ZT9C 2AHOB 5HGQA 3CHBD 1K3BC 3MEHA 4F88A 2I46A 1L1OB 1C0AA 1O78A 1MD2D 1O7LA 1VDZA 1EFWA 1STBA 5LMNW 4YWKA 2B2VC 4K6LA 4QIWE 1PRTB 4IOCA 4IUUA 1BUVT 2SNSA 2HUGA 2JP1A 5M3MH 4YY3L 4IZ8A 5IIFA 1OXTA 2BE5C 4R8NA 2L11A 1HZBA 4GNXC 3ULPA 1KXLA 3HOYG 4ZQ3A 1YI2A 4RGTA 2YU9H 2Z1CA 4LF5Q 3MXPA 3GTJB 4B3RQ 3F1ZA 1I50H 2E8GA 2IT1A 2R3ZA 1FNUA 1DONA 1B44D 3BDOA 5C6AA 2RSNA 2R93H 3M4QA 1I4XA 4LFAQ 1VF5C 5T1GA 1IXRA 2B2VA 4XYOA 2SDFA 3NHHA 3MFGA 4OELB 3J81c 1PYBA 4XIGS 4HMJA 2WB1E 2WACA 5GADC 1TIID 1X3FA 1YNJC 4DR3L 4R8IA 3KF8A 2H1EA 1IYJB 2L0CA 2XRSD 2UUCL 1AZPA 1PZJD 5EKIA 5I2YA 1AH9A 4UDUC 1V9PA 2K5WA 1AE3A 4IPDA 3MVVA 3RN2A 1F9PA 1SE3A 4L5QA 1KIXA 1SMXA 3V2TA 4KTAA 3A5ZB 1N34Q 5BR8Q 1LLRD 1IBML 2EYMA 1MJEA 5JJZA 4QCLA 2YTXA 1ILPA 3OW7A 1EEID 2D0PA 4JW0A 1F9QA 1SYCA 2IWHA 3VA5A 1B9MA 1EL0A 4AQYL 3S14H 3HOUH 4OX9L 1U4MA 4C3IH 3VR5A 2PPBC 1I4PA 4ME3A 1NMFA 2F3IA 3JAML 5EPJA 1XPRA 1YJNA 1RD9D 1PTOD 3CRLC 1KL9A 3T51B 5IGFA 3D4DA 3ULLA 3IRBA 1CI3M 1EQQA 5IYDH 1Y14B 4MIUA 4DR4L 4A4IA 1VQ8A 1JWUD 1SE4A 2YU9B 5C4JB 5H1SE 2PMZB 4KKSA 1Y1VG 3EIVA 4ZUJA 1Y8NB 4JI3Q 5FLXE 1FJGQ 4A3DH 2NN6I 2PW5A 1JJCB 1KRTA 2NVQH 2R93B 4MN3A 3VDYA 1ASZA 1X6OA 4KD4A 2JA7G 3EN2A 1A62A 1HFNA 5GROA 3HOXH 3DM3A 5C4XG 1HZAA 4LUOA 1KAWA 3M85A 1X54A 3V05A 1I6HB 1CUKA 2F0FA 3PUXA 1PH1A 1CA5A 1EQTA 3HKZG 3P20A 1CSQA 3QOLA 4JI7L 4R4QA 3RZOH 1XNRL 1V43A 2A73B 2KCNA 2DN8A 3KUPA 1W2BA 5CV7A 3OPOA 4C2MH 1U5KA 5AJ3L 1AFPA 4K0KL 1U4LA 2LXJA 1ESRA 2K28A 3H3VI 2F52A 2MP1A 2JA6H 4UY8C 1Q46A 1OXSC 4CDEC 1SNPA 1J5EL 3NQTA 4BY1H 3HGBA 3T1HQ 1IW7D 2F0MA 3FKIB 3QIAA 3QJYA 2I0QA 3E0EA 4KHPL 5EBCA 4QF4A 1W6JA 4A3CH 5I6YA 4RCNA 4V190 1IBLL 2JSOA 1HA5A 1OXUA 1EIFA 5M3FG 4C3IB 1IL2A 1AEXA 1RTNA 2HIXA 2HHHL 1ENAA 5EKLA 4LF9Q 4DR2L 3J7AV 2F0PA 1FNWA 1SDFA 4M8AA 2UU9L 1Q3LA 4DV4Q 1CHPD 1GXDC 5C0XJ 2AWNA 3RUZA 3TS2A 1SFOB 2YV5A 1JB3A 5ELCA 3PF5A 2GN5A 4DV0Q 1YEZA 3S24A 5JAVA 4TQUS 3D0FA 1YITA 2IHFA 4JC0A 2F0WA 2A6EC 1SSOA 2MO1A 5IT9L 4YWLA 2XIWA 1S5DD 1VQIA 2PQAB 4A3DB 4HMIA 1OXXK 1S3OA 3S17H 5M3MG 4CBVA 2NVQB 4XQQA 3NEMA 3NBHB 5C0XH 3HOXB 5CV5A 2EOTA 1EY4A 4Q0FA 4OWWB 1CSPA 3BJUA 1JWSD 2FMMA 2XSCA 4RHRA 4GZYC 1EWHA 2PNRC 4HJ8A 1KDBA 3L9AX 3G6EA 3I8ZA 3RZOB 3R8BA 1FD7D 4DV7L 2O2LD 1JCKB 4XDXA 1DOLA 2IJ0A 3GO5A 4C2MB 2LKVA 5IGBA 3K0XA 2EIFA 1N32L 4ZKCB 1J9OA 1EZ6A 3MXNA 4ZUIA 2JA6B 1UEAB 2C5CA 2CWAA 4BY1B 1N8RC 5CYUA 5EQ0A 1EWIA 2RA4A 2ZM6Q 1ASYA 1ZYRD 3S1QB 1L2FA 3GV6A 1LABA 3U4ZA 3H3VC 2HCIA 3K80C 4QQBX 1TKWB 1SJHD 1S5BD 1M90C 2F4VQ 1YJWA 1Y1WG 1C8CA 1R9TH 2VUMH 1U4RA 5JJKA 4LF7Q 4B3TL 1CT1D 4A3EG 2A69D 1PFNA 1JORA 1F9SA 2VQEQ 4CKBA 3TQYA 1B8AA 2F0SA 4IUPA 2D0OA 4P73A 1KLUD 5CBEE 5EPKA 4A3BG 5LMUQ 1LTSD 3NPPA 4G4KA 1CTMA 1VQEA 3SK4A 3TDQA 4GKJL 3RLFA 1CZWA 2EVBA 5GQOA 5IP7H 1XNQQ 1XYIA 4UHVA 5J22A 5D65A 3U9OA 4DV5L 3GD7A 1FGUA 3KJOA 3S17B 4GN3B 1DCZA 4HTHA 5C3XA 5IYDG 1HFGA 3PUZA 4DV3Q 1WTRA 3SEBA 3I7FA 1E22A 3CCMA 2RCFA 4JPBW 1A2UA 1EUJA 3J81i 1R4QB 2KJXA 3RR5A 2EY5A 1YNND 2NVYH 2Y0SB 1VQKA 2DNCA 1HTLD 2KHIA 2IHEA 4O1NA 3PO3H 2DUDA 2F3WA 2ID0A 5CV9A 3STBC 5FOBB 1SR3A 3BZCA 2K32A 4C3HB 1YHBA 3DMUA 5IWAQ 1O80A 4PZ6A 1BF4A 3BVZA 4MTKA 4E6IA 4YCUA 5CBAE 5C44H 4RCOA 3LX0A 4EQOA 2ZXOA 4Z9CB 1EYGA 1XMQL 1IBKQ 5DNFA 3VYRA 2ATWA 2MHVA 3SK8A 4ZAIA 2NWGA 4PZ7A 2WIIB 3I90A 4HEDA 1SNQA 2NBFA 2ZXPA 3ERQA 3IFTA 3AEVA 3PMFA 2IX3A 2M9VA 3HKZE 2I5MX 1Z6HA 3EA6A 5C3EG 1N36L 1JB7A 1R9TB 2VUMB 1HQMC 2CKZB 2E2IH 2L12A 2A68C 3S1NB 4P71A 2E2JB 4B3MQ 2KA7A 1A3UA 1HNXQ 4JI8Q 1X9NA 3WOEA 3DWQA 2UUAQ 1DGSA 1S5FD 1PVOA 3DUZA 3ND9A 3F2UA 1K83B 1NCVA 5TSSA 1NBWA 3AFQA 4S3SA 1GJXA 4H44C 4I7ZC 3BZKA 1PFSA 4X65L 3QWNA 1BBUA 5K36H 2D9UA 2TMPA 4FNFA 1VQ4A 4LFCQ 2OT2A 4IJHA 4QJFA 1G6PA 3S9WA 4KJNA 1N9WA 2AQ3B 1KRSA 1EU3A 4GN5A 3VYUA 3S1RB 4ZCKA 1IL8A 1X56A 4OWXB 4JOIC 3FP9A 4JI4Q 3C3LA 3J7A5 2FJ2A 3RZDH 1NMGA 4DK6C 3K59A 5M5YH 2NVYB 3VYTA 3UDXA 1XPUA 3S16H 1EIHA 5KEEA 3PO3B 2QEJC 5IYBG 3W3AA 4BBRH 3JAMi 3PGZA 1PYSB 2JEAI 2B63G 4P2CB 2VQFQ 3AYHB 3HOWG 4BY7B 1HQRD 4A3KH 2QDLA 2BOSA 2B2YC 3VA7A 4PQXA 4DV6Q 3J81E 4KHVA 1T5XD 2IPKD 4PMWA 4NXNL 1KC8C 2BDNA 5JEAH 1SNDA 4RHSA 4WRDA 3LGJA 1B3AA 4EQ5A 3KDFA 4JOIA 4LK1C 4DV1Q 2PMZE 5IGCA 4DAYA 2HQLA 2A6HC 3I2ZA 1T5EA 5EAYA 5G3LF 5D3IB 5E1FA 3CP0A 5KYLA 3I4NH 4BBSB 4AYBB 4HIOA 5JPNC 2E2IB 1VQMA 4Y52H 2NVXB 5EKKA 2YTYA 4PG3A 3VR6A 1QJOA 4N8FA 4DUYL 4J6HA 4POGA 4A3IG 1XPOA 3D4WA 1FYCA 4X3SA 4JI2L 1GOZA 2DJGC 2JA8H 2B2YA 1SE2A 1NE3A 1HR0L 3OTOQ 4C1NK 1WTWA 2IY5B 2F0GA 2GA4B 3I4LA 5CV4A 1KNEA 4I65A 3H3VH 1I4RA 1ICFB 4A3JB 2EXZA 1STNA 3T4AC 2F0JA 1BBWA 5ELBA 3GTJH 1D1KA 2CWPA 4OIKA 3CCVA 4A93G 2V1CC 1JOOA 2ZJPA 1ICWA 3DWPA 3CMEA 2WKCA 1G291 3H0GB 1ML0D 2VB3X 1VQ9A 3HG9A 5EBDA 3RZDB 3S2HH 2ENBA 2B3GA 4C3JG 4JI6Q 4ME5A 5M5YB 2ALYB 3U50C 5IGGA 1C9OA 3UDIA 1QE6A 3S16B 1B70B 3Q22A 2EDGA 3ND8A 2QW7A 4BBRB 5EJWA 3ICEA 1BCPF 1I94Q 1VQ7A 1EU4A 3MXNB 4BXXG 4LF8Q 1H95A 4ZYSA 5IYCH 4IO9A 4HJ7A 2Z6BA 1YBYA 1NR2A 3K58A 1W6KA 3CRKC 1SXTA 4H02A 4LUVA 2MFIA 3JAME 4A3GH 3AQQA 2K1BA 1A6XA 2CFMA 5C44G 1R4PB 1NSNS 4DXGA 4Q5VA 2K7VA 4GKKQ 4FXKC 1WFQA 4P72A 1CKNA 2G9HD 2C9OA 1H9JA 4B3RL 4X66Q 4DR5Q 4LF5L 4RG1A 4DGZA 1RODA 5CR3A 2JA9A 2Q2HA 1F2MA 3BYYB 3FPPA 5I9PA 2AMCB 1SMYC 5LHY1 1CK1A 4DV2Q 1GVPA 2JA8B 3TSSA 2PO4A 1YIJA 2F0EA 1PH3A 1PFMA 1MIUA 4B9XA 2WP8J 4LFAL 4A3FH 4NXML 3CU7A 1K8GA 1M4VA 1RF2D 1UNSA 5C4JH 4DUZQ 1BCPD 3CQZH 2WAQG 1KLGD 1KD1C 1PTOF 3R2TA 2XNAC 1Y1VB 3UI2A 3RLNA 4EGVA 1S72A 2PI2A 5HGTA 4KKTA 2QF7A 1WTXA 1I4HA 1F77A 2L15A 4YCWA 2A8VA 1VQLA 2FMCA 3S2HB 1JT8A 4IFDJ 3V96A 3TP5A 2XWJB 4DNTB 2K01A 1I6HH 4FF3A 2EXDA 3RD4A 2FINB 4DAMA 2ZTCA 1ENFA 5KIXA 2R7ZH 1G51A 3VR4A 1A8VA 5BN4A 2JJQA 4DNRB 3PO2B 4GNXA 2OTLA 3TP6A 2LFNA 1LM0A 5A35A 1QVGA 1GUOA 2Z4HA 1TWFH 3MXUA 5FKAC 1GUSA 4TRDA 1HCZA 1BO0A 5E4XA 2HCCA 2ZTEA 4QY7A 3F2BA 4IFDH 5IODA 5M9OA 4OEMB 5GAEC 4HSVA 1JR0D 3FKIH 4FVMA 4JK1C 1OO9B 3M4YA 3UE1A 5DM63 4H13C 4A3GB 3SXHA 4DPGA 4A3KG 4NB3A 1EY6A 3OOCA 1TWAH 2CQAA 2K03A 1MSHA 1PH8A 3K7AH 5I9OA 2MNAA 1SYBA 3KLRA 1F2YA 1WCMG 3BG3A 1TY2A 3FRPB 1Q86C 4JI3L 1FJGL 1VQFA 2MJ8A 2DY8A 5T1IA 2Y0SE 1BBXC 1Q81C 3C46A 5IT9E 3BDCA 1SFOH 2UUCQ 1QCBD 2B8FA 1JQYD 1EY7A 4A3FB 4JI1Q 4C56C 3J7YW 1DJRD 1Q8KA 1X65A 1CHQD 3Q24A 3A7LA 2VS1A 4HCSA 5E4WC 4RH6A 5JPMC 5C4HA 3CQZB 3MWYW 4A3MB 2WINB 2K33A 3KLWA 2F0DA 1D6EC 2GVBA 3T56B 4HN7A 1DOMA 4JI5Q 2JA5H 2KCCA 2EYLA 4AQYQ 1TS3A 3CAMA 1IKLA 3TEHB 1PTOC 5J39A 4BA2I 4L6TB 3GTPH 2EPBA 2R7ZB 2ZXRA 2AQ2B 2F03A 3D6WA 3M4OH 3JAMc 1TWFB 4K2LA 3I70A 3T13A 4XT3B 4DR4Q 3RMHA 3CCEA 3KDFB 1HNZL 4FF1A 3GTOH 4HAEA 4B9WA 5FO7B 4OO1G 1N33Q 2NYZD 3DXJC 4DAYB 3S1QH 1FNVA 3M3YB 1LTLA 3D8GA 1XTCD 3K5OA 4DV0L 1PFBA 1Q7YC 3TZUA 2R61A 3E5SA 4NKLA 1TWAB 5JJLA 4KY6A 1PH2A 1L0XB 3S1MH 1WTHA 2A19A 3K7AB 3HFZB 2F0VA 1GD7A 1K0RA 4DR1Q 3VR3A 2RVLA 3KK7A 2Z9HA 1A3VA 1GUGA 3A7AB 4GLVB 1G91A 3ONAB 1JWMD 2K5HA 4K14A 1LTGD 1TWGH 3SR1A 3VYSA 4O0AA 1G2TA 2CW0D 4GN4B 4JI0Q 1E3PA 5CV6A 1IW7C 1EY9A 1J5EQ 1AW7A 1BKBA 2BH2A 3WOFA 4RFBA 4OO1I 2F0NA 1HZCA 1S5CD 2NTTA 2KBNA 1WTOA 1HPCA 3J81j 1HUMA 1ILQA 1ZEQX 3T1YL 4KKUA 2JA5B 2O5IC 3FPUB 2XVSA 2AQ1B 4CJ1B 4XTCS 2I5LX 4L5RC 3M9BA 2HHHQ 3MA2B 3X3NA 4DR2Q 1LT4D 5JJIA 2XRQD 3SDZA 3GTPB 3K5LA 4JBMA 2IX1A 1G6ZA 4GOPB 3HOVB 2A1AA 2UXBQ 1PRTD 2JK8A 1AP0A 2R93G 1B3QA 1YHAA 1G2SA 4DN4M 3M4OB 4B08A 1PZID 1B53A 2ICIA 4C3HH 4HIMA 2BDOA 4C1NI 1DXMA 1P8LA 2C35B 3D4RA 1LV9A 1QVCA 1NTGA 2WAQE 3CW2C 2K5NA 4B3SL 4LF7L 4J8QA 3GTOB 3PSIA 4AIMA 4OWTB 4R4OA 2N78A 4NPSA 3KJPA 5KGUA 1CQVA 2VQEL 1B2TA 2NZ1D 3KF6A 3E6ZX 1QZHA 4ZRZA 1GO3E 1QNKA 3A0JA 3CCJA 5FJ8H 1HZ9A 1CKNB 3N6RA 2K14A 4HJ9A 3PUVA 2OQ0A 3S1MB 3BS1A 1KDAA 4P74A 4K2KA 5IT9c 2UXCL 2R92H 2OCEA 2EJFC 4U68A 4CGYB 2UXDQ 1VQHA 4R4CA 2MGSA 3FKIG 1WJJA 3TS0A 1QUQA 3S1NH 2E2JH 1TS2A 4JG2A 4L63B 4L5SA 2DY7A 2K04A 2F0LA 4RAUC 4DV7Q 4WFN3 4DV3L 3PCOB 3TN2A 3HOUG 4C3IG 1K83H 1TWGB 3NENA 4ODGA 4HJ5A 1BNZA 2HD3A 1A3TA 1ET9A 1N32Q 2D2CC 3HEJA 3E0JA 1QVFA 2KCTA 4U673 3M7GA 3OHXC 2X6LA 3J80L 2WB1B 3CPWA 1ZYRC 1EIYB 3DEOA 1D8LA 3TZDA 1GUTA 2RKSA 4YWMA 1VQNA 5IWAL 3S1RH 1PH4A 2CQOA 3SK5A 1QOHA 3I4MH 4LFBL 1PV4A 3D3RA 4L8JA 1NR4A 4XQJA 4X62Q 1KQSA 1X3PA 3F8TA 5NUCA 5C4ZA 5ISRA 1IBKL 1HRJA 3J7AF 1SLJA 3GTMH 5D3DA 3S2DH 1X3QA 1NNXA 2NB0A 2A69C 4OHJA 4A3DG 3KF8B 3NTHA 3PIOA 3L2PA 4RWSC 4GNXB 4B3TQ 3ZJYC 5ELFA 3HOXG 1EQRA 3HOZH 1HJPA 4J1MA 3X3MA 4KHZA 2PQEA 3P75A 2XTIA 4BS9A 4BY7H 4QUFA 5ELDA 2R6GA 1STEA 5LL6S 1WTQA 1O7YA 3P1HA 4MZ9A 3FMCA 4B3ML 2KCMA 4UP9A 1Q1BA 2DJFC 2NZOA 4JI8L 1WTVA 4CDCC 4G7OC 4O42A 2RDFA 2VZAA 1JJ2A 1AN8A 4HCEA 3W1BA 4DV5Q 3J80c 1TWCH 1FVIA 5CORA 2EJMA 2JA6G 1JE4A 4R4IA 5M5WH 3Q23A 1QNUA 3H15A 1XJVA 2GVAA 5DEHA 2WV6D 4X64L 2R92B 4BY1G 2E2HH 1Q1EA 1YNNC 1TS4A 2M2LA 1LTAD 4LFCL 4BBSH 3HZXA 1JJGA 3URYA 1PMRA 2Q2IA 2VXWA 1AZQA 2NVXH 3NK9A 2N49A 4A3CG 3GTQH 1VQDA 4CDDC 4DR7Q 5C5MA 3IFDA 1XMOL 3CCSA 5BN3A 4A3IB 3I55A 4X6AH 3ZYYX 4PZ8A 1BOSA 4JBKA 4RGNA 3FHWA 1C48A 3DM1A 5ELOA 4DK3C 1LT3D 1SRUA 4A3JH 1UE7A 1XMQQ 1JE5A 4EVOA 4Y7NH 3EJIA 5CC4A 2UUBQ 3HOYH 2KEEA 1WOCA 5D14A 3I4MB 3W2DA 1CM9A 4KD3A 4A93B 2A74C 4CKEA 3H0GH 2F0UA 2Z6KC 2O4XA 5JEAJ 4QUCA 1DM0B 3GTMB 3S2DB 1N36Q 4C3JB 3K81C 2K5QA 5C5LA 2AUKA 3C1FA 1PH6A 2G5DA 4RGMA 4FF2A 4IQZA 5CMDA 5I6WA 4DV1L 1SEBD 4DU9A 1WTPA 5C0XG 1S4ZA 2YYZA 4ULLA 3HOZB 1UWVA 3NXWA 1TS5A 4IUQA 4DFAA 1A63A 3CXCA 4JV5L 4PMBA 1HHVA 4IUNA 2Y0SG 4YHHQ 4DR6L 1L0WA 1SNMA 5LMNL 2IX0A 1WVLA 4X65Q 2KECA 5JOBA 1D2BA 1TT2A 1VQBA 1B1ZA 1JOKA 4C3HG 2PZUA 1TWCB 2Z6KA 1Q82C 3LNNA 1PTOB 4UPAA 4FF4A 3NE5B 5M5WB 3A55A 3OMGA 4LF4L 1I4GA 2NN6H 1V1OA 2E2HB 3HS0C 2H5XA 4HIKA 1B4OA 3CCLA 1M8AA 3RLOA 1X3GA 4QB4A 2QEXA 3NSWA 4K5VA 3GTQB 3GDEA 1K8AC 1OTCA 3CD6A 1DZ1A 1JOQA 2E5LL 1I3QB 2I07B 5C0XI 2QGQA 4LF6L 3F2DA 1YJ9A 1STAA 4LNQA 5ELNA 1IYUA 4X3UA 1C4QA 1EY8A 2VUMG 1PH9A 4HSPA 1IKMA 2K52A 4MTNA 2BA0A 5CV8A 1GKHA 4OONA 1SYGA 4Y7NB 4WJ4A 2OWOA 3HOYB 2CVRA 4JVZA 4JYAL 1VQGA 3TRZA 1LTID 4LF8L 1Y1VH 3CF5A 2NVTH 1NJIC 4LWCA 4MNOA 5IP7G 2QCPX 1MHWC 2JA7H 4ZKBB 3I91A 3U4VA 2B29A 4G7ZC 5C4XH 1DOKA 1TY0A 4R9WA 2PNHA 3PUWA 3A56A 1GM5A 3EQLC 4IPHA 1B9NA 5KNDA 4DUYQ 4LMQD 1EYCA 4POFA 1VQCA 1VS0A 4CHTB 4GKKL 1HR0Q 2X69A 1BXTA 4NDXA 3PO2H 1CA6A 3CC2A 3Q6SA 3CCUA 2F0TA 4DR5L 4L5TA 4DXFA 1UAPA 3PO3G 1CKOA 3KF6B 3G71A 2FFKB 1OXVA 3K0YA 4DV2L 2LMCB 1DYQA 4BY7G 1V1PA 1HNWQ 2P5ZX 1SROA 2L5TA 1PH5A 1LTTD 3AB9A 1QUQB 3NWTA 5KNBA 2NTSA 1MI2A 1EIGA 4OIJA 3GP7A 2KUMA 1PHJA 2JEBI 4DK1A 5M3FH 2BE5D 4DKAC 1TQOA 1K8MA 3G4SA 1TWHB 1RHPA 1EYDA 4BBSG 2BA1A 1GUWA 4AYBG 4WJ3M 3KOJA 5FK9C 5COYA 1T9HA 4V0BA 3L0OA 2CH4W 2AKWB 4CJ2C 2K5VA 3HP3A 2LY7A 3OIPA 4ZLTF 2H4OA 1MSGA 2N3SA 1G8ZD 4OL7A 3MFYA 4J15A 1S40A 1JC7A 1LACA 1RIPA 4A3MH 4IPCA 1EOVA 1TVXA 2PCFB 1UE5A 2MUYA 4RMFA 5IOCA 2NVTB 3O13A 1YNJD 5IE8A 5K36G 3IKJA 3CC4A 4A3JG 2JA7B 1D5XC 3G6JB 2QA4A 1Z47A 5C4XB 1HTPA 3P7JA 3NBIA 1N34L 5BR8L 2Q8RE 4KLKA 2XWBB 2KVMA 3J7ZC 5C3WA 3H0GG 1B50A 3HKZB 4GLAC 3BZDB 3PIPA 1I5FA 1LTRD 3C2PA 2SOBA 2RF4A 5M5XH 1HR0W 2K05A 1ONLA 3AU7A 3C1EA 4XT1B 4YY3Q 4NXMQ 4XXEA 4KI0A 4BBRG 1BCPC 5KRUA 3J80i 2QDBA 1GUNA 3R93A 5A2QE 2KQ3A 3KBXA 3FDTA 2AUJD 3BVGA 3M3YH 4H7BA 2PI2E 4NMZA 4UAIA 4JI1L 1H9SA 2EY2A 1X32A 4K6DA 4NW2A 1CKMA 3WWVA 5JEAG 2E2DC 1SAPA 5M3FB 2EYPA 1E24A 1KNAA 3IAYA 1RL2A 3A74A 1EYAA 1Y1WH 1ENCA 2F4IA 4LAAA 2NN6G 1O7ZA 2L9HA 3NQIA 3ERSX 4DR3Q 4IALA 4JI5L 4A3EH 1PDQA 2HIVA 3G7LA 3I4NG 3M4PA 3U58A 5FLMH 3DHQA 2RHSB 2KHSA 4APVA 3E9IA 1PH7A 2PYKA 3CMAA 4A3BH 1KHIA 1HH2P 4DAVA 4G7HC 3NWSA 3DWAA 2EYOA 1Q12A 3BYTB 2XN9C 5DAUA 2JA8G 1D7QA 3DLLA 4CDFC 4PV1C 3R3OA 1IZ6A 4HR7B 1E2ZA 1U4PA 1CQFA 2CCZA 2EJGC 1IBMQ 3PV0A 4FDBA 3A54A 2I5HA 5JVH3 1PA6A 2LS01 5M3MB 2V4DA 2EY6A 1UUPA 4YCVA 4K8IA 3RNUA 3E3XA 4OX9Q 3T1HL 1N33L 4H0LC 1I50B 3T53B 1XXGA 3K8AA 3OSOA 3MC0B 1K9MC 3HOVH 3SE0A 1J6QA 1VQ6A 2M00A 1SN8A 1UEBA 2NUCA 3A8JE 3Q0AA 5M5XB 2IL8A 3OYYA 1FGBD 4ALPA 4KMUC 2RDGA 4LF9L 2ICEC 4WORA 4TKOB 5AFWA 4DV4L 3K5MA 4DR1L 3EROA 3K7UC 1K3RA 1AE2A 3GQBA 3JC66 1HA6A 2F3VA 2LSSA 1SE8A 4MHEA 3PO2G 1PRTF 2PW7A 4X3KA
chains in the Genus database with same CATH topology
2PZTA 1KABA 1Q90A 4QMGA 1MBYA 5A2QL 1XX8A 4CJ0B 5CGKA 5JVG3 3J80E 1Y1WB 1EQVA 4PNYA 1BR9A 2A6ED 4LJZC 2E75C 4A3EB 3H09A 1HUNA 3MXGA 1LT5D 2SNMA 4X3TA 3S14B 3HOUB 2HDLA 4A3BB 3T16A 2F0QA 1CZGA 2RDHA 2Q8TA 1V8QA 4DAPA 3LWEA 2L55A 1D1IA 2L1BA 1PXUA 3I3CA 4FO2A 1WD1A 4DA2A 4NP5A 3I73A 5F2DA 4RA8A 3BVMA 2B2WC 1GHJA 3DEPA 3QG1A 1WD0A 3H6MA 3NTIA 1ZKOA 3QB3A 1PZKD 1Z7TA 2CW0C 3MHBA 2MPMA 1GHKA 1H9RA 4G57A 1F2ZA 1F2LA 3SHLA 4QIWB 5FLXL 4KN7C 1V1PB 1NAPA 4F7XA 1EZ8A 1STYA 3FVQA 3PIP3 4KN4C 5J1ZA 1S5ED 2OF1A 2B2WA 2JXMB 1EWCA 4IFDG 2VB2X 5IGDA 3OIQA 2KOLA 1BDOA 4DF7A 2L4NA 5C3EB 1PRTC 3KLSA 2D62A 3R2IA 4ZK9B 3SK6A 1RKNA 3GTGB 1STHA 4RKLA 5KYIA 1FR3A 4M1UB 4KK7A 1II3A 4ID6A 4KJOA 1LT6D 2EZVA 4XQNA 4IUVA 2DNEA 1IHZA 3TMEA 2F0HA 3PUYA 3NUCA 1RDPD 5EPLA 4EQNA 4DK0A 1DD2A 2B39A 3L3OC 1KAAA 4IFDI 2J0TD 3A8IE 1IYVA 3ITPA 1RTOA 4IN3A 3MTSA 4BWGB 1SBBB 3H94A 4CKCA 3GTLB 2E76C 1LO5D 2F0IA 3IL8A 2AWOA 2B63B 2J7ZA 3HOWB 1Q8IA 3GV3A 1LTBD 1I6VC 2A5HA 2K6AA 1KTKA 1E2WA 2A68D 1SYDA 1H9SB 3KLSX 3MZ5A 2WKDA 1RCVD 1PTOH 1ESFA 3WDNA 2QKIC 2J4XA 4OGQC 1SNOA 2EYFA 3AMUA 3KBGA 4KV6A 2F1MA 3K5NA 1J8IA 2CHBD 2B8GA 3TP8A 3OMCA 2Z8LA 1RJTA 1A2TA 1PYWD 5E3FA 1BCPB 2EYHA 4RKBA 1SNCA 2B2UC 4K5XA 1HXYD 3EFXD 1D5MC 1STGA 4FYDA 1H9KA 4KY7A 1A15A 4XYQA 1SJED 3TBIB 1VF7A 1QWYA 2TSSA 5K5PA 1JICA 2OEOA 2Z4IA 5IGEA 3QOJA 1EY0A 1E0BA 2KEDA 3N52A 3H91A 4N9PA 3VR2A 1TU2B 1EOTA 2F0KA 2Q8IB 5FO9B 4N9TA 3L7ZC 4ILWA 2B2UA 1VCIA 1L0YB 2B2TC 2IW3A 4IUTA 4RGOS 2F0OA 3OWEB 2A6HD 4FP5D 2K5DA 5EGTA 5BN5A 1Y8PB 2JE6I 2O5JC 1TR5A 3FEWX 2HDMA 1EY5A 5C44B 4ABNA 2B2TA 3M7NA 3GTKB 1EFID 2FHTA 2D5DA 4WJWA 3S15B 2RBMA 4EQPA 2EYJA 2VNUD 1VMPA 3K6OA 4JBWA 4K8JA 1ET6A 1ZXTA 4YIJA 4BA1I 3MAQA 3BDLA 5I4DA 3EVQA 3OWFA 3U9SA 2SEBD 1EEFD 1SYFA 2E74C 5HURA 1NUCA 2WAQB 5ELEA 2OXPA 2N55A 2RQXA 4PMCA 2X6GA 1Y8OB 5LL6X 1QG7A 3SVMA 4FXGC 3NP8A 2EY1A 2PZWA 1BQQT 1MGSA 4TSSA 3CKIB 3I72A 3QO2A 1KDCA 2RSOA 3LWUA 1VMCA 1Y69U 4IURA 1H9MA 1E2VA 3NBHA 2JYOA 1SYEA 5DM73 2EE1A 4KY5A 5FO8B 3HRZC 3PIO3 1F9RA 1D5ZC 3D31A 1CFMA 3A8KE 1U9RA 4F87A 5KNCA 4OO1H 4FXDA 5I2XA 1SMYD 5G3LD 4A3KB 2QILA 3TP7A 3NTKA 1K8OA 2HQEA 1QILA 2BCOA 1QB5D 3D6CA 4K5WA 1XWEA 1WCMB 4F8MA 3J81L 3K57A 1I4QA 2G9DA 1PLFA 3I4NB 2N88A 2ZT9C 3CHBD 3MEHA 4F88A 2I46A 1O78A 1MD2D 1O7LA 1VDZA 1STBA 2B2VC 4K6LA 1PRTB 4IUUA 1BUVT 2SNSA 2HUGA 2JP1A 4IZ8A 5IIFA 1OXTA 2BE5C 4R8NA 2L11A 4ZQ3A 4RGTA 2Z1CA 3MXPA 3GTJB 2R3ZA 2IT1A 1FNUA 1DONA 1B44D 3BDOA 5C6AA 2RSNA 1I4XA 1VF5C 5T1GA 2B2VA 4XYOA 2SDFA 3NHHA 3MFGA 4XIGS 4HMJA 2WACA 1TIID 1YNJC 4R8IA 3KF8A 2H1EA 2XRSD 2L0CA 1AZPA 1PZJD 5EKIA 5I2YA 4UDUC 2K5WA 3MVVA 1F9PA 1SE3A 3V2TA 4KTAA 1LLRD 2EYMA 4QCLA 5JJZA 1ILPA 3OW7A 1EEID 1F9QA 1SYCA 2IWHA 3VA5A 1B9MA 1EL0A 1U4MA 3VR5A 2PPBC 1I4PA 3JAML 5EPJA 1RD9D 1PTOD 3CRLC 3T51B 5IGFA 3D4DA 1CI3M 4MIUA 1JWUD 1SE4A 2YU9B 5C4JB 2PMZB 4KKSA 4ZUJA 1Y8NB 5FLXE 2NN6I 2PW5A 2R93B 4MN3A 4KD4A 1HFNA 3M85A 3V05A 1I6HB 2F0FA 3PUXA 1CA5A 1EQTA 3P20A 3QOLA 1V43A 2A73B 2KCNA 2DN8A 3KUPA 5CV7A 3OPOA 1AFPA 1U4LA 1ESRA 2K28A 2MP1A 1OXSC 1SNPA 3NQTA 3HGBA 1IW7D 2F0MA 3FKIB 3QIAA 3QJYA 5EBCA 4QF4A 1W6JA 5I6YA 4RCNA 4V190 2JSOA 1HA5A 1OXUA 4C3IB 1AEXA 1RTNA 1ENAA 5EKLA 3J7AV 2F0PA 1FNWA 1SDFA 4M8AA 1Q3LA 1CHPD 1GXDC 5C0XJ 2AWNA 3RUZA 1SFOB 1JB3A 5ELCA 5JAVA 4TQUS 2F0WA 2A6EC 1SSOA 5IT9L 2XIWA 1S5DD 4A3DB 4HMIA 1OXXK 4CBVA 2NVQB 4XQQA 5C0XH 3HOXB 5CV5A 2EOTA 4Q0FA 1EY4A 1JWSD 2FMMA 2XSCA 4RHRA 4GZYC 1EWHA 2PNRC 1KDBA 3L9AX 3I8ZA 3RZOB 3R8BA 1FD7D 2O2LD 1JCKB 4XDXA 1DOLA 2IJ0A 3GO5A 4C2MB 2LKVA 5IGBA 4ZKCB 1J9OA 1EZ6A 3MXNA 4ZUIA 2JA6B 1UEAB 2C5CA 4BY1B 5CYUA 5EQ0A 2RA4A 1ZYRD 3S1QB 3GV6A 1LABA 3H3VC 2HCIA 1TKWB 1SJHD 1S5BD 1C8CA 1U4RA 1CT1D 2A69D 1PFNA 1JORA 1F9SA 4CKBA 2F0SA 4IUPA 1KLUD 5CBEE 5EPKA 1LTSD 3NPPA 4G4KA 1CTMA 3SK4A 3TDQA 3RLFA 1CZWA 2EVBA 1XYIA 5J22A 5D65A 3U9OA 3GD7A 3S17B 1DCZA 4HTHA 5C3XA 1HFGA 3PUZA 1WTRA 3SEBA 1A2UA 1R4QB 2KJXA 2EY5A 1YNND 2Y0SB 2DNCA 1HTLD 4O1NA 2F3WA 2ID0A 5CV9A 5FOBB 2K32A 4C3HB 3DMUA 1O80A 1BF4A 3BVZA 4E6IA 5CBAE 4RCOA 3LX0A 4EQOA 2ZXOA 4Z9CB 5DNFA 3VYRA 2MHVA 3SK8A 4ZAIA 2NWGA 2WIIB 3I90A 4HEDA 1SNQA 2NBFA 2ZXPA 3ERQA 3IFTA 3PMFA 2IX3A 2M9VA 1Z6HA 3EA6A 1R9TB 2VUMB 1HQMC 2L12A 2A68C 3S1NB 2E2JB 2KA7A 1A3UA 3WOEA 3DWQA 1S5FD 3DUZA 3ND9A 3F2UA 1K83B 1NCVA 5TSSA 1GJXA 4S3SA 4H44C 4I7ZC 3QWNA 5K36H 2D9UA 2TMPA 4FNFA 2OT2A 3S9WA 4KJNA 2AQ3B 1EU3A 3S1RB 3VYUA 1IL8A 3C3LA 2FJ2A 3K59A 2NVYB 3VYTA 1EIHA 5KEEA 3PO3B 2QEJC 3W3AA 2JEAI 4P2CB 4BY7B 1HQRD 2BOSA 2B2YC 3VA7A 4PQXA 3J81E 4KHVA 1T5XD 2IPKD 4PMWA 2BDNA 5JEAH 1SNDA 4RHSA 4WRDA 1B3AA 4LK1C 5IGCA 4DAYA 2A6HC 1T5EA 5G3LF 5D3IB 5E1FA 5KYLA 4BBSB 4AYBB 5JPNC 2E2IB 2NVXB 5EKKA 3VR6A 1QJOA 4J6HA 3D4WA 1FYCA 4X3SA 1GOZA 2B2YA 1SE2A 4C1NK 1WTWA 2F0GA 2GA4B 3I4LA 5CV4A 1KNEA 4I65A 1I4RA 4A3JB 2EXZA 1STNA 3T4AC 2F0JA 5ELBA 1D1KA 4OIKA 1JOOA 1ICWA 3DWPA 2WKCA 1G291 3H0GB 1ML0D 2VB3X 3HG9A 5EBDA 3RZDB 2ENBA 4C3JG 4ME5A 5M5YB 5IGGA 1QE6A 3S16B 3Q22A 2EDGA 3ND8A 4BBRB 5EJWA 1BCPF 1EU4A 4ZYSA 1NR2A 3K58A 1W6KA 3CRKC 1SXTA 3JAME 2K1BA 1A6XA 1R4PB 1NSNS 4DXGA 4Q5VA 2K7VA 4FXKC 2G9HD 2C9OA 1H9JA 4DGZA 1RODA 5CR3A 1F2MA 3BYYB 3FPPA 5I9PA 1SMYC 5LHY1 1CK1A 2JA8B 3TSSA 2PO4A 2F0EA 1PFMA 4B9XA 2WP8J 3CU7A 1M4VA 1RF2D 1UNSA 1BCPD 1KLGD 1PTOF 3R2TA 2XNAC 1Y1VB 3UI2A 4EGVA 5HGTA 4KKTA 2QF7A 1WTXA 1I4HA 1F77A 2FMCA 3S2HB 4IFDJ 3V96A 3TP5A 2XWJB 4DNTB 2K01A 4FF3A 3RD4A 2FINB 1ENFA 5KIXA 3VR4A 5BN4A 4DNRB 3PO2B 3TP6A 2LFNA 5A35A 1GUOA 2Z4HA 3MXUA 5FKAC 1GUSA 4TRDA 1HCZA 1BO0A 5E4XA 2HCCA 4IFDH 5IODA 5M9OA 4HSVA 1JR0D 4FVMA 4JK1C 1OO9B 3M4YA 5DM63 4A3GB 4H13C 3SXHA 1EY6A 3OOCA 2CQAA 2K03A 1MSHA 5I9OA 1SYBA 3KLRA 1F2YA 3BG3A 1TY2A 3FRPB 2MJ8A 2DY8A 5T1IA 1BBXC 3C46A 5IT9E 3BDCA 1QCBD 2B8FA 1JQYD 1EY7A 4A3FB 4C56C 3J7YW 1DJRD 1CHQD 3Q24A 3A7LA 4HCSA 5E4WC 4RH6A 5JPMC 5C4HA 3CQZB 3MWYW 4A3MB 2WINB 2K33A 2F0DA 1D6EC 3T56B 4HN7A 1DOMA 2KCCA 2EYLA 1TS3A 1IKLA 1PTOC 5J39A 4BA2I 4L6TB 2EPBA 2R7ZB 2ZXRA 2AQ2B 2F03A 3D6WA 1TWFB 4K2LA 3I70A 3T13A 4XT3B 3RMHA 4FF1A 4HAEA 4B9WA 5FO7B 4OO1G 2NYZD 3DXJC 1FNVA 3M3YB 3D8GA 1XTCD 3K5OA 1PFBA 3TZUA 2R61A 3E5SA 4NKLA 1TWAB 4KY6A 1L0XB 3K7AB 2F0VA 3VR3A 2RVLA 3KK7A 1A3VA 1GUGA 3A7AB 1G91A 1JWMD 3ONAB 4K14A 1LTGD 3SR1A 3VYSA 1G2TA 2CW0D 5CV6A 1IW7C 1EY9A 1AW7A 3WOFA 4RFBA 4OO1I 2F0NA 1S5CD 2NTTA 1WTOA 1HPCA 1HUMA 1ILQA 1ZEQX 4KKUA 2JA5B 2O5IC 3FPUB 2XVSA 2AQ1B 4CJ1B 4XTCS 3MA2B 3X3NA 1LT4D 2XRQD 3SDZA 3GTPB 3K5LA 2IX1A 1G6ZA 3HOVB 1PRTD 1AP0A 1G2SA 4DN4M 3M4OB 4B08A 1PZID 1B53A 2ICIA 2BDOA 4C1NI 1DXMA 1LV9A 3D4RA 4J8QA 3GTOB 5KGUA 1CQVA 1B2TA 2NZ1D 3E6ZX 4ZRZA 1QNKA 3N6RA 3PUVA 3S1MB 3BS1A 1KDAA 4K2KA 2EJFC 4U68A 4CGYB 2MGSA 1TS2A 4L63B 2DY7A 2K04A 2F0LA 4RAUC 4WFN3 3TN2A 4C3IG 1TWGB 4ODGA 1BNZA 1A3TA 1ET9A 2D2CC 3HEJA 3E0JA 4U673 3M7GA 3OHXC 2X6LA 3J80L 2WB1B 1ZYRC 3DEOA 3TZDA 1GUTA 2RKSA 3SK5A 1QOHA 3D3RA 4L8JA 1NR4A 4XQJA 1X3PA 5NUCA 5C4ZA 5ISRA 1HRJA 3J7AF 5D3DA 1X3QA 2NB0A 2A69C 4OHJA 3NTHA 4RWSC 5ELFA 4J1MA 3X3MA 4KHZA 2PQEA 3P75A 4BS9A 4QUFA 5ELDA 2R6GA 1STEA 5LL6S 1WTQA 1O7YA 3P1HA 3FMCA 1Q1BA 1WTVA 4G7OC 4O42A 2RDFA 1AN8A 4HCEA 5CORA 2EJMA 1JE4A 3Q23A 1QNUA 5DEHA 2WV6D 2R92B 1Q1EA 1YNNC 1TS4A 2M2LA 1LTAD 3HZXA 3URYA 1PMRA 2VXWA 1AZQA 3NK9A 5C5MA 3IFDA 5BN3A 4A3IB 3ZYYX 1BOSA 4RGNA 1C48A 3DM1A 1LT3D 4EVOA 3EJIA 5CC4A 2KEEA 5D14A 3I4MB 3W2DA 1CM9A 4KD3A 4A93B 2A74C 4CKEA 2F0UA 2O4XA 5JEAJ 4QUCA 1DM0B 3GTMB 3S2DB 4C3JB 2K5QA 5C5LA 2AUKA 3C1FA 4FF2A 4RGMA 4IQZA 5CMDA 5I6WA 1SEBD 4DU9A 1WTPA 5C0XG 1S4ZA 2YYZA 4ULLA 3HOZB 3NXWA 1TS5A 4IUQA 4DFAA 4PMBA 1HHVA 4IUNA 1SNMA 2IX0A 1WVLA 2KECA 5JOBA 1D2BA 1TT2A 1B1ZA 1JOKA 4C3HG 2PZUA 1TWCB 3LNNA 1PTOB 4FF4A 3NE5B 5M5WB 3A55A 3OMGA 1I4GA 2NN6H 1V1OA 2E2HB 3HS0C 1B4OA 1M8AA 4QB4A 3NSWA 4K5VA 3GTQB 1DZ1A 1JOQA 1I3QB 2I07B 5C0XI 1STAA 1IYUA 4X3UA 1C4QA 1EY8A 4HSPA 1IKMA 2BA0A 5CV8A 1SYGA 4Y7NB 3HOYB 2CVRA 1LTID 2QCPX 4ZKBB 3I91A 4G7ZC 1DOKA 1TY0A 4R9WA 3PUWA 3A56A 3EQLC 1B9NA 5KNDA 4LMQD 1EYCA 4CHTB 2X69A 1BXTA 4NDXA 1CA6A 3Q6SA 2F0TA 4DXFA 1UAPA 2FFKB 1OXVA 3K0YA 2LMCB 1DYQA 1V1PA 2L5TA 1LTTD 3AB9A 3NWTA 5KNBA 2NTSA 1MI2A 1EIGA 4OIJA 3GP7A 2KUMA 2JEBI 4DK1A 2BE5D 1TQOA 1K8MA 1TWHB 1RHPA 1EYDA 1GUWA 2BA1A 5FK9C 5COYA 4V0BA 4CJ2C 3HP3A 2LY7A 3OIPA 4ZLTF 2H4OA 1MSGA 1G8ZD 4OL7A 3MFYA 1JC7A 1LACA 1TVXA 2PCFB 2MUYA 5IOCA 2NVTB 3O13A 1YNJD 5K36G 3IKJA 2JA7B 1D5XC 3G6JB 1Z47A 5C4XB 1HTPA 3P7JA 3NBIA 2Q8RE 2XWBB 2KVMA 5C3WA 1B50A 3HKZB 3BZDB 1LTRD 3C2PA 2SOBA 2K05A 1ONLA 3AU7A 3C1EA 4XT1B 4XXEA 4KI0A 1BCPC 5KRUA 2QDBA 1GUNA 3R93A 5A2QE 2KQ3A 3KBXA 3FDTA 2AUJD 3BVGA 4H7BA 4NMZA 4UAIA 1H9SA 2EY2A 1X32A 4K6DA 4NW2A 5JEAG 2E2DC 1SAPA 5M3FB 2EYPA 1KNAA 3IAYA 1EYAA 1ENCA 2F4IA 4LAAA 2NN6G 1O7ZA 2L9HA 3NQIA 4IALA 1PDQA 3G7LA 3DHQA 2KHSA 2PYKA 4DAVA 4G7HC 3NWSA 2EYOA 3DWAA 1Q12A 3BYTB 2XN9C 5DAUA 4PV1C 3R3OA 4HR7B 1E2ZA 1U4PA 1CQFA 2EJGC 3PV0A 5JVH3 3A54A 2LS01 5M3MB 2V4DA 2EY6A 1UUPA 4K8IA 4H0LC 1I50B 3T53B 1XXGA 3OSOA 3MC0B 3SE0A 2M00A 2NUCA 3A8JE 3Q0AA 5M5XB 2IL8A 1FGBD 4KMUC 2RDGA 2ICEC 4WORA 4TKOB 5AFWA 3K5MA 3EROA 3GQBA 1HA6A 2F3VA 4MHEA 1PRTF 2PW7A 4X3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T5X D;  2IPK D;  4RHR A;  1HXY D;  2SEB D;  3EFX D;  1D5M C;  1EEF D;  4DXG A;  1PRT C;  1TY2 A;  1BCP C;  4RHS A;  1BXT A;  3BVZ A;  1SJE D;  3R2I A;  2G9H D;  2TSS A;  4RGT A;  3R8B A;  1AW7 A;  4RGM A;  1FD7 D;  4RCO A;  2O2L D;  4RFB A;  1SEB D;  1JCK B;  4Z9C B;  1JQY D;  2IJ0 A;  3V05 A;  5ELE A;  3BVG A;  3BYY B;  4DXF A;  1FNU A;  1S5C D;  2NTT A;  4C56 C;  1B44 D;  5D3I B;  1TS5 A;  1DJR D;  1CHQ D;  1CK1 A;  5D3D A;  3TSS A;  4OHJ A;  4RH6 A;  1DYQ A;  1I4X A;  1LT6 D;  1V1P A;  1LT5 D;  5ELF A;  2AQ1 B;  1LTT D;  4TSS A;  3MFG A;  1D6E C;  3EA6 A;  1GOZ A;  1LT4 D;  1RDP D;  2XRQ D;  1SE2 A;  2NTS A;  1B1Z A;  1M4V A;  1RF2 D;  1UNS A;  3GP7 A;  5ELD A;  1STE A;  1PRT D;  1PTO B;  2RDH A;  1L0Y B;  2XRS D;  1BCP D;  1KLG D;  1PTO F;  3R2T A;  1PZJ D;  2XNA C;  1TS3 A;  1PZI D;  1I4G A;  1V1O A;  1SJH D;  2ICI A;  1S5B D;  1I4R A;  3DWQ A;  1PTO C;  4RGO S;  1I4H A;  1F77 A;  1S5F D;  3OWE B;  1D5Z C;  4UDU C;  4L6T B;  1AN8 A;  3DWA A;  5ELB A;  4BWG B;  3BYT B;  2XN9 C;  5TSS A;  1SE3 A;  1CT1 D;  3BVM A;  1HA5 A;  1SBB B;  2AQ2 B;  5FK9 C;  2WV6 D;  2QIL A;  3DWP A;  1LLR D;  1LO5 D;  1CQV A;  1TS4 A;  1ENF A;  1FNW A;  1LTA D;  1EEI D;  1QIL A;  1KLU D;  3URY A;  1G8Z D;  2AQ3 B;  1UUP A;  1CHP D;  1EU3 A;  1LTS D;  1LTB D;  1PZK D;  1KTK A;  3O13 A;  1I4P A;  5ELC A;  1FNV A;  1XXG A;  1BCP F;  3KLS X;  3MC0 B;  5FKA C;  1XTC D;  1RCV D;  1D5X C;  1I4Q A;  1PTO H;  1ESF A;  1EU4 A;  1RD9 D;  2R61 A;  1PTO D;  1TS2 A;  1EFI D;  4L63 B;  1LTI D;  1L0X B;  2J4X A;  4RGN A;  1V1P B;  1JR0 D;  1LT3 D;  1FGB D;  3SEB A;  3CHB D;  2QEJ C;  2RDG A;  4ZYS A;  1MD2 D;  2CHB D;  1S5D D;  1ET9 A;  1ET6 A;  3BZD B;  1S5E D;  1LTR D;  1JWU D;  2Z8L A;  1SE4 A;  4K6L A;  5I4D A;  1HQR D;  3W2D A;  1EWC A;  1HTL D;  1PYW D;  1PRT B;  1SXT A;  1TY0 A;  4O1N A;  1BCP B;  1JWM D;  1PRT F;  1LTG D;  1JWS D; 
#chains in the Genus database with same CATH topology
 2PZT A;  1A0I A;  1YHQ A;  5IYC G;  2N8N A;  4JI0 L;  3KFU A;  3CCQ A;  1KAB A;  1Q90 A;  4QMG A;  4OXP A;  1MBY A;  2R7F A;  1XX8 A;  5A2Q L;  4CJ0 B;  5CGK A;  5JVG 3;  3Q8D A;  5C3E H;  3J80 E;  4A3G G;  1Y1W B;  1EQV A;  4PNY A;  1BR9 A;  2A6E D;  4LJZ C;  1VQP A;  2VL6 A;  2E75 C;  4JI7 Q;  4HJA A;  1XNR Q;  4A3E B;  3H09 A;  3GTG H;  1HUN A;  3MXG A;  1LT5 D;  2SNM A;  4X3T A;  3HKS A;  5AJ3 Q;  3S14 B;  3HOU B;  5L37 A;  4K0K Q;  2HDL A;  4A3B B;  4JCV E;  3T16 A;  1VQ5 A;  2XGT A;  3E9H A;  4HID A;  4EX5 A;  2F0Q A;  1CZG A;  2UXB L;  2RDH A;  1HNZ Q;  2ASB A;  2Q8T A;  1V8Q A;  1BVS A;  2ZJQ A;  4DAP A;  3LWE A;  2L55 A;  1D1I A;  2L1B A;  1PXU A;  3I3C A;  4FO2 A;  4A3F G;  1WD1 A;  4KHP Q;  4DA2 A;  4NP5 A;  3I73 A;  5F2D A;  1IBL Q;  4RA8 A;  3BVM A;  2R7D A;  1VQJ A;  5IY0 A;  4TVA B;  4A3M G;  2ZM6 L;  3DEP A;  1GHJ A;  1P16 A;  2B2W C;  3QG1 A;  1WD0 A;  3H6M A;  3CC7 A;  3NTI A;  2UU9 Q;  4LUZ A;  2HT1 A;  4AYB E;  1ZKO A;  3QB3 A;  3PQI A;  4UP8 A;  3GTL H;  3AFP A;  5IYB H;  1PZK D;  1Z7T A;  2CW0 C;  3MHB A;  2BH8 A;  2JN4 A;  2F4V L;  2MPM A;  2UXD L;  1H9R A;  1V1Q A;  1GHK A;  4G57 A;  2B63 H;  1F2Z A;  1F2L A;  3W1G A;  3HOW H;  3BU2 A;  3SHL A;  4QIW B;  5FLX L;  2R7Z G;  3QR8 A;  1V1P B;  4KN7 C;  1NAP A;  2DGY A;  4F7X A;  1EZ8 A;  1STY A;  3I4O A;  3NEL A;  3FVQ A;  3PIP 3;  4KN4 C;  5J1Z A;  5LMU L;  1S5E D;  1YZ6 A;  1U0L A;  3T1Y Q;  1WI5 A;  1L1O C;  2OF1 A;  2B2W A;  2JXM B;  1EWC A;  4IFD G;  1LUZ A;  3KYH C;  2FXQ A;  2VB2 X;  5IGD A;  1XNQ L;  3OIQ A;  2KOL A;  1BDO A;  4DF7 A;  2L4N A;  5C3E B;  1PRT C;  3KLS A;  2D62 A;  3A5U A;  3R2I A;  4ZK9 B;  3SK6 A;  1RKN A;  3GTG B;  1STH A;  4JBJ A;  4RKL A;  4X62 L;  4A3I H;  5KYI A;  1FR3 A;  2CH4 A;  4LW1 A;  4M1U B;  4KK7 A;  2MQH A;  3OW2 A;  1II3 A;  2K75 A;  4B3S Q;  1E1O A;  1O7I A;  4ID6 A;  4KJO A;  1LT6 D;  1K0S A;  2EZV A;  4XQN A;  4IUV A;  2DNE A;  1IHZ A;  1L1O A;  5FLM G;  3TME A;  2F0H A;  3PUY A;  3NUC A;  1RDP D;  1C7Y A;  5EPL A;  3STB D;  3UDG A;  4EQN A;  4A93 H;  5FLX c;  4DK0 A;  1DD2 A;  2B39 A;  2VW9 A;  5IP9 H;  3L3O C;  1KAA A;  4IFD I;  2UXC Q;  2J0T D;  3A8I E;  1IYV A;  4IPG A;  3TRE A;  3ITP A;  1RTO A;  4C3J H;  4IN3 A;  2OQK A;  3MTS A;  4BWG B;  1UE1 A;  4QGU A;  1SBB B;  3H94 A;  4CKC A;  3GTL B;  2JA5 G;  1XTD A;  2E76 C;  1LO5 D;  2F0I A;  3IL8 A;  3I56 A;  2AWO A;  2B63 B;  4BXX H;  2J7Z A;  3HOW B;  1Q8I A;  3GV3 A;  1LTB D;  3HOV G;  1I6V C;  5J3B A;  4GKJ Q;  2A5H A;  5GAG C;  1HNX L;  2K6A A;  4DR7 L;  1B7Y B;  1KTK A;  2UUA L;  1E2W A;  2A68 D;  1SYD A;  1H9S B;  3KLS X;  1VQA A;  1YVC A;  3MZ5 A;  4I7A A;  2WKD A;  1RCV D;  2YTV A;  1PTO H;  1ESF A;  3WDN A;  2QKI C;  2J4X A;  4A3L H;  4OGQ C;  4LFB Q;  1SNO A;  2EYF A;  3AMU A;  3KBG A;  4KV6 A;  2F1M A;  3K5N A;  1J8I A;  2CHB D;  3EBE A;  2B8G A;  3F2C A;  3TP8 A;  2MO0 A;  2UUB L;  1LYL A;  3GTK H;  3OMC A;  2Z8L A;  2ZTD A;  1RJT A;  1M1K C;  1A2T A;  1PYW D;  3S15 H;  2Z0S A;  5E3F A;  1BCP B;  1I3Q H;  2EYH A;  4RKB A;  1SNC A;  2B2U C;  1X3E A;  4JI4 L;  4K5X A;  1HXY D;  3EFX D;  1D5M C;  1VQO A;  1STG A;  4FYD A;  1H9K A;  4R4T A;  4KY7 A;  1A15 A;  4XYQ A;  1SJE D;  3TBI B;  1VF7 A;  1QWY A;  2TSS A;  5K5P A;  1JIC A;  2OEO A;  2Z4I A;  5IGE A;  3QOJ A;  1EY0 A;  4DNI A;  1E0B A;  2KED A;  2VQF L;  3N52 A;  4UP7 A;  3H91 A;  4N9P A;  3VR2 A;  2WB1 G;  1TU2 B;  4YHH L;  4DV6 L;  1EOT A;  4X64 Q;  2F0K A;  4IOA A;  2Q8I B;  5FO9 B;  4N9T A;  3L7Z C;  4IJL A;  4ILW A;  2B2U A;  3ER0 A;  1X55 A;  1VCI A;  1L0Y B;  3PF4 A;  2B2T C;  2IW3 A;  4IUT A;  2JQO A;  1XMO Q;  1W3S A;  4RGO S;  2WFW A;  2F0O A;  3OWE B;  2A6H D;  4FP5 D;  1K28 A;  2K5D A;  5EGT A;  3CPF A;  5BN5 A;  1Y8P B;  2JE6 I;  3G48 A;  2O5J C;  3RN5 A;  2EQS A;  3OTO L;  1FL0 A;  1TR5 A;  3FEW X;  2LXK A;  2VY3 A;  2HDM A;  1EY5 A;  5C44 B;  2KHJ A;  4ABN A;  2B2T A;  3W5O A;  3M7N A;  3GTK B;  2OTJ A;  2Q2T A;  1K73 C;  1EFI D;  2FHT A;  2D5D A;  1TXY A;  4WJW A;  5FJ8 G;  3S15 B;  3CCR A;  1NY4 A;  2RBM A;  1QZG A;  4EQP A;  1WCM H;  2EYJ A;  2VNU D;  1VMP A;  5E7N A;  4O2D A;  2R92 G;  3K6O A;  1TWH H;  4GS3 A;  4JBW A;  4K8J A;  1ET6 A;  1ZXT A;  4YIJ A;  4BA1 I;  3MAQ A;  4R1J A;  4JI6 L;  3BDL A;  5I4D A;  3EVQ A;  1MKH A;  4JV5 Q;  3OWF A;  4DR6 Q;  5LMN Q;  4GLX A;  2ZJR A;  3U9S A;  4NXN Q;  2SEB D;  1EEF D;  1I94 L;  1MJC A;  1SYF A;  2E74 C;  5HUR A;  1WYD A;  2ES2 A;  1UE6 A;  1NUC A;  1E7Z A;  2WAQ B;  4N8X 1;  3UDF A;  4A76 A;  1E1T A;  5ELE A;  5HY6 A;  4LF4 Q;  2OXP A;  2N55 A;  2RQX A;  4PMC A;  4GOP C;  2X6G A;  3B6Y A;  1Y8O B;  4AH6 A;  5LL6 X;  1QG7 A;  3SVM A;  4FXG C;  3NP8 A;  3I4M G;  2EY1 A;  1HNW L;  5GAH C;  2KEN A;  1JMC A;  2PZW A;  4A75 A;  1BQQ T;  2E5L Q;  1MGS A;  4TSS A;  5IP9 G;  4JI2 Q;  3CKI B;  3I72 A;  4LF6 Q;  2PQA A;  3QO2 A;  1KDC A;  2RSO A;  3LWU A;  2RCN A;  3UE0 A;  2Q2U A;  1VMC A;  1Y69 U;  4IUR A;  4X66 L;  1H9M A;  1E2V A;  3NBH A;  2JYO A;  1SYE A;  5DM7 3;  2EE1 A;  4QL5 A;  4KY5 A;  5FO8 B;  3HRZ C;  3PIO 3;  3SGI A;  1F9R A;  1D5Z C;  3HOZ G;  3D31 A;  3MEF A;  3A8K E;  1CFM A;  1U9R A;  2K4K A;  4F87 A;  5KNC A;  4OO1 H;  4FXD A;  4JYA Q;  4GOP A;  5I2X A;  4P75 A;  1SMY D;  5G3L D;  4A3K B;  2QIL A;  3TP7 A;  1YNX A;  3NTK A;  3ULJ A;  1K8O A;  2HQE A;  1QIL A;  2BCO A;  1QB5 D;  3D6C A;  1Z9F A;  4DUZ L;  4K5W A;  2K50 A;  1XWE A;  1WCM B;  4A3L G;  4F8M A;  3J81 L;  2RHQ B;  2NZH A;  1I4Q A;  3K57 A;  2G9D A;  1PLF A;  3I4N B;  2N88 A;  5DLQ E;  2ZT9 C;  2AHO B;  5HGQ A;  3CHB D;  1K3B C;  3MEH A;  4F88 A;  2I46 A;  1L1O B;  1C0A A;  1O78 A;  1MD2 D;  1O7L A;  1VDZ A;  1EFW A;  1STB A;  5LMN W;  4YWK A;  2B2V C;  4K6L A;  4QIW E;  1PRT B;  4IOC A;  4IUU A;  1BUV T;  2SNS A;  2HUG A;  2JP1 A;  5M3M H;  4YY3 L;  4IZ8 A;  5IIF A;  1OXT A;  2BE5 C;  4R8N A;  2L11 A;  1HZB A;  4GNX C;  3ULP A;  1KXL A;  3HOY G;  4ZQ3 A;  1YI2 A;  4RGT A;  2YU9 H;  2Z1C A;  4LF5 Q;  3MXP A;  3GTJ B;  4B3R Q;  3F1Z A;  1I50 H;  2E8G A;  2IT1 A;  2R3Z A;  1FNU A;  1DON A;  1B44 D;  3BDO A;  5C6A A;  2RSN A;  2R93 H;  3M4Q A;  1I4X A;  4LFA Q;  1VF5 C;  5T1G A;  1IXR A;  2B2V A;  4XYO A;  2SDF A;  3NHH A;  3MFG A;  4OEL B;  3J81 c;  1PYB A;  4XIG S;  4HMJ A;  2WB1 E;  2WAC A;  5GAD C;  1TII D;  1X3F A;  1YNJ C;  4DR3 L;  4R8I A;  3KF8 A;  2H1E A;  1IYJ B;  2L0C A;  2XRS D;  2UUC L;  1AZP A;  1PZJ D;  5EKI A;  5I2Y A;  1AH9 A;  4UDU C;  1V9P A;  2K5W A;  1AE3 A;  4IPD A;  3MVV A;  3RN2 A;  1F9P A;  1SE3 A;  4L5Q A;  1KIX A;  1SMX A;  3V2T A;  4KTA A;  3A5Z B;  1N34 Q;  5BR8 Q;  1LLR D;  1IBM L;  2EYM A;  1MJE A;  5JJZ A;  4QCL A;  2YTX A;  1ILP A;  3OW7 A;  1EEI D;  2D0P A;  4JW0 A;  1F9Q A;  1SYC A;  2IWH A;  3VA5 A;  1B9M A;  1EL0 A;  4AQY L;  3S14 H;  3HOU H;  4OX9 L;  1U4M A;  4C3I H;  3VR5 A;  2PPB C;  1I4P A;  4ME3 A;  1NMF A;  2F3I A;  3JAM L;  5EPJ A;  1XPR A;  1YJN A;  1RD9 D;  1PTO D;  3CRL C;  1KL9 A;  3T51 B;  5IGF A;  3D4D A;  3ULL A;  3IRB A;  1CI3 M;  1EQQ A;  5IYD H;  1Y14 B;  4MIU A;  4DR4 L;  4A4I A;  1VQ8 A;  1JWU D;  1SE4 A;  2YU9 B;  5C4J B;  5H1S E;  2PMZ B;  4KKS A;  1Y1V G;  3EIV A;  4ZUJ A;  1Y8N B;  4JI3 Q;  5FLX E;  1FJG Q;  4A3D H;  2NN6 I;  2PW5 A;  1JJC B;  1KRT A;  2NVQ H;  2R93 B;  4MN3 A;  3VDY A;  1ASZ A;  1X6O A;  4KD4 A;  2JA7 G;  3EN2 A;  1A62 A;  1HFN A;  5GRO A;  3HOX H;  3DM3 A;  5C4X G;  1HZA A;  4LUO A;  1KAW A;  3M85 A;  1X54 A;  3V05 A;  1I6H B;  1CUK A;  2F0F A;  3PUX A;  1PH1 A;  1CA5 A;  1EQT A;  3HKZ G;  3P20 A;  1CSQ A;  3QOL A;  4JI7 L;  4R4Q A;  3RZO H;  1XNR L;  1V43 A;  2A73 B;  2KCN A;  2DN8 A;  3KUP A;  1W2B A;  5CV7 A;  3OPO A;  4C2M H;  1U5K A;  5AJ3 L;  1AFP A;  4K0K L;  1U4L A;  2LXJ A;  1ESR A;  2K28 A;  3H3V I;  2F52 A;  2MP1 A;  2JA6 H;  4UY8 C;  1Q46 A;  1OXS C;  4CDE C;  1SNP A;  1J5E L;  3NQT A;  4BY1 H;  3HGB A;  3T1H Q;  1IW7 D;  2F0M A;  3FKI B;  3QIA A;  3QJY A;  2I0Q A;  3E0E A;  4KHP L;  5EBC A;  4QF4 A;  1W6J A;  4A3C H;  5I6Y A;  4RCN A;  4V19 0;  1IBL L;  2JSO A;  1HA5 A;  1OXU A;  1EIF A;  5M3F G;  4C3I B;  1IL2 A;  1AEX A;  1RTN A;  2HIX A;  2HHH L;  1ENA A;  5EKL A;  4LF9 Q;  4DR2 L;  3J7A V;  2F0P A;  1FNW A;  1SDF A;  4M8A A;  2UU9 L;  1Q3L A;  4DV4 Q;  1CHP D;  1GXD C;  5C0X J;  2AWN A;  3RUZ A;  3TS2 A;  1SFO B;  2YV5 A;  1JB3 A;  5ELC A;  3PF5 A;  2GN5 A;  4DV0 Q;  1YEZ A;  3S24 A;  5JAV A;  4TQU S;  3D0F A;  1YIT A;  2IHF A;  4JC0 A;  2F0W A;  2A6E C;  1SSO A;  2MO1 A;  5IT9 L;  4YWL A;  2XIW A;  1S5D D;  1VQI A;  2PQA B;  4A3D B;  4HMI A;  1OXX K;  1S3O A;  3S17 H;  5M3M G;  4CBV A;  2NVQ B;  4XQQ A;  3NEM A;  3NBH B;  5C0X H;  3HOX B;  5CV5 A;  2EOT A;  1EY4 A;  4Q0F A;  4OWW B;  1CSP A;  3BJU A;  1JWS D;  2FMM A;  2XSC A;  4RHR A;  4GZY C;  1EWH A;  2PNR C;  4HJ8 A;  1KDB A;  3L9A X;  3G6E A;  3I8Z A;  3RZO B;  3R8B A;  1FD7 D;  4DV7 L;  2O2L D;  1JCK B;  4XDX A;  1DOL A;  2IJ0 A;  3GO5 A;  4C2M B;  2LKV A;  5IGB A;  3K0X A;  2EIF A;  1N32 L;  4ZKC B;  1J9O A;  1EZ6 A;  3MXN A;  4ZUI A;  2JA6 B;  1UEA B;  2C5C A;  2CWA A;  4BY1 B;  1N8R C;  5CYU A;  5EQ0 A;  1EWI A;  2RA4 A;  2ZM6 Q;  1ASY A;  1ZYR D;  3S1Q B;  1L2F A;  3GV6 A;  1LAB A;  3U4Z A;  3H3V C;  2HCI A;  3K80 C;  4QQB X;  1TKW B;  1SJH D;  1S5B D;  1M90 C;  2F4V Q;  1YJW A;  1Y1W G;  1C8C A;  1R9T H;  2VUM H;  1U4R A;  5JJK A;  4LF7 Q;  4B3T L;  1CT1 D;  4A3E G;  2A69 D;  1PFN A;  1JOR A;  1F9S A;  2VQE Q;  4CKB A;  3TQY A;  1B8A A;  2F0S A;  4IUP A;  2D0O A;  4P73 A;  1KLU D;  5CBE E;  5EPK A;  4A3B G;  5LMU Q;  1LTS D;  3NPP A;  4G4K A;  1CTM A;  1VQE A;  3SK4 A;  3TDQ A;  4GKJ L;  3RLF A;  1CZW A;  2EVB A;  5GQO A;  5IP7 H;  1XNQ Q;  1XYI A;  4UHV A;  5J22 A;  5D65 A;  3U9O A;  4DV5 L;  3GD7 A;  1FGU A;  3KJO A;  3S17 B;  4GN3 B;  1DCZ A;  4HTH A;  5C3X A;  5IYD G;  1HFG A;  3PUZ A;  4DV3 Q;  1WTR A;  3SEB A;  3I7F A;  1E22 A;  3CCM A;  2RCF A;  4JPB W;  1A2U A;  1EUJ A;  3J81 i;  1R4Q B;  2KJX A;  3RR5 A;  2EY5 A;  1YNN D;  2NVY H;  2Y0S B;  1VQK A;  2DNC A;  1HTL D;  2KHI A;  2IHE A;  4O1N A;  3PO3 H;  2DUD A;  2F3W A;  2ID0 A;  5CV9 A;  3STB C;  5FOB B;  1SR3 A;  3BZC A;  2K32 A;  4C3H B;  1YHB A;  3DMU A;  5IWA Q;  1O80 A;  4PZ6 A;  1BF4 A;  3BVZ A;  4MTK A;  4E6I A;  4YCU A;  5CBA E;  5C44 H;  4RCO A;  3LX0 A;  4EQO A;  2ZXO A;  4Z9C B;  1EYG A;  1XMQ L;  1IBK Q;  5DNF A;  3VYR A;  2ATW A;  2MHV A;  3SK8 A;  4ZAI A;  2NWG A;  4PZ7 A;  2WII B;  3I90 A;  4HED A;  1SNQ A;  2NBF A;  2ZXP A;  3ERQ A;  3IFT A;  3AEV A;  3PMF A;  2IX3 A;  2M9V A;  3HKZ E;  2I5M X;  1Z6H A;  3EA6 A;  5C3E G;  1N36 L;  1JB7 A;  1R9T B;  2VUM B;  1HQM C;  2CKZ B;  2E2I H;  2L12 A;  2A68 C;  3S1N B;  4P71 A;  2E2J B;  4B3M Q;  2KA7 A;  1A3U A;  1HNX Q;  4JI8 Q;  1X9N A;  3WOE A;  3DWQ A;  2UUA Q;  1DGS A;  1S5F D;  1PVO A;  3DUZ A;  3ND9 A;  3F2U A;  1K83 B;  1NCV A;  5TSS A;  1NBW A;  3AFQ A;  4S3S A;  1GJX A;  4H44 C;  4I7Z C;  3BZK A;  1PFS A;  4X65 L;  3QWN A;  1BBU A;  5K36 H;  2D9U A;  2TMP A;  4FNF A;  1VQ4 A;  4LFC Q;  2OT2 A;  4IJH A;  4QJF A;  1G6P A;  3S9W A;  4KJN A;  1N9W A;  2AQ3 B;  1KRS A;  1EU3 A;  4GN5 A;  3VYU A;  3S1R B;  4ZCK A;  1IL8 A;  1X56 A;  4OWX B;  4JOI C;  3FP9 A;  4JI4 Q;  3C3L A;  3J7A 5;  2FJ2 A;  3RZD H;  1NMG A;  4DK6 C;  3K59 A;  5M5Y H;  2NVY B;  3VYT A;  3UDX A;  1XPU A;  3S16 H;  1EIH A;  5KEE A;  3PO3 B;  2QEJ C;  5IYB G;  3W3A A;  4BBR H;  3JAM i;  3PGZ A;  1PYS B;  2JEA I;  2B63 G;  4P2C B;  2VQF Q;  3AYH B;  3HOW G;  4BY7 B;  1HQR D;  4A3K H;  2QDL A;  2BOS A;  2B2Y C;  3VA7 A;  4PQX A;  4DV6 Q;  3J81 E;  4KHV A;  1T5X D;  2IPK D;  4PMW A;  4NXN L;  1KC8 C;  2BDN A;  5JEA H;  1SND A;  4RHS A;  4WRD A;  3LGJ A;  1B3A A;  4EQ5 A;  3KDF A;  4JOI A;  4LK1 C;  4DV1 Q;  2PMZ E;  5IGC A;  4DAY A;  2HQL A;  2A6H C;  3I2Z A;  1T5E A;  5EAY A;  5G3L F;  5D3I B;  5E1F A;  3CP0 A;  5KYL A;  3I4N H;  4BBS B;  4AYB B;  4HIO A;  5JPN C;  2E2I B;  1VQM A;  4Y52 H;  2NVX B;  5EKK A;  2YTY A;  4PG3 A;  3VR6 A;  1QJO A;  4N8F A;  4DUY L;  4J6H A;  4POG A;  4A3I G;  1XPO A;  3D4W A;  1FYC A;  4X3S A;  4JI2 L;  1GOZ A;  2DJG C;  2JA8 H;  2B2Y A;  1SE2 A;  1NE3 A;  1HR0 L;  3OTO Q;  4C1N K;  1WTW A;  2IY5 B;  2F0G A;  2GA4 B;  3I4L A;  5CV4 A;  1KNE A;  4I65 A;  3H3V H;  1I4R A;  1ICF B;  4A3J B;  2EXZ A;  1STN A;  3T4A C;  2F0J A;  1BBW A;  5ELB A;  3GTJ H;  1D1K A;  2CWP A;  4OIK A;  3CCV A;  4A93 G;  2V1C C;  1JOO A;  2ZJP A;  1ICW A;  3DWP A;  3CME A;  2WKC A;  1G29 1;  3H0G B;  1ML0 D;  2VB3 X;  1VQ9 A;  3HG9 A;  5EBD A;  3RZD B;  3S2H H;  2ENB A;  2B3G A;  4C3J G;  4JI6 Q;  4ME5 A;  5M5Y B;  2ALY B;  3U50 C;  5IGG A;  1C9O A;  3UDI A;  1QE6 A;  3S16 B;  1B70 B;  3Q22 A;  2EDG A;  3ND8 A;  2QW7 A;  4BBR B;  5EJW A;  3ICE A;  1BCP F;  1I94 Q;  1VQ7 A;  1EU4 A;  3MXN B;  4BXX G;  4LF8 Q;  1H95 A;  4ZYS A;  5IYC H;  4IO9 A;  4HJ7 A;  2Z6B A;  1YBY A;  1NR2 A;  3K58 A;  1W6K A;  3CRK C;  1SXT A;  4H02 A;  4LUV A;  2MFI A;  3JAM E;  4A3G H;  3AQQ A;  2K1B A;  1A6X A;  2CFM A;  5C44 G;  1R4P B;  1NSN S;  4DXG A;  4Q5V A;  2K7V A;  4GKK Q;  4FXK C;  1WFQ A;  4P72 A;  1CKN A;  2G9H D;  2C9O A;  1H9J A;  4B3R L;  4X66 Q;  4DR5 Q;  4LF5 L;  4RG1 A;  4DGZ A;  1ROD A;  5CR3 A;  2JA9 A;  2Q2H A;  1F2M A;  3BYY B;  3FPP A;  5I9P A;  2AMC B;  1SMY C;  5LHY 1;  1CK1 A;  4DV2 Q;  1GVP A;  2JA8 B;  3TSS A;  2PO4 A;  1YIJ A;  2F0E A;  1PH3 A;  1PFM A;  1MIU A;  4B9X A;  2WP8 J;  4LFA L;  4A3F H;  4NXM L;  3CU7 A;  1K8G A;  1M4V A;  1RF2 D;  1UNS A;  5C4J H;  4DUZ Q;  1BCP D;  3CQZ H;  2WAQ G;  1KLG D;  1KD1 C;  1PTO F;  3R2T A;  2XNA C;  1Y1V B;  3UI2 A;  3RLN A;  4EGV A;  1S72 A;  2PI2 A;  5HGT A;  4KKT A;  2QF7 A;  1WTX A;  1I4H A;  1F77 A;  2L15 A;  4YCW A;  2A8V A;  1VQL A;  2FMC A;  3S2H B;  1JT8 A;  4IFD J;  3V96 A;  3TP5 A;  2XWJ B;  4DNT B;  2K01 A;  1I6H H;  4FF3 A;  2EXD A;  3RD4 A;  2FIN B;  4DAM A;  2ZTC A;  1ENF A;  5KIX A;  2R7Z H;  1G51 A;  3VR4 A;  1A8V A;  5BN4 A;  2JJQ A;  4DNR B;  3PO2 B;  4GNX A;  2OTL A;  3TP6 A;  2LFN A;  1LM0 A;  5A35 A;  1QVG A;  1GUO A;  2Z4H A;  1TWF H;  3MXU A;  5FKA C;  1GUS A;  4TRD A;  1HCZ A;  1BO0 A;  5E4X A;  2HCC A;  2ZTE A;  4QY7 A;  3F2B A;  4IFD H;  5IOD A;  5M9O A;  4OEM B;  5GAE C;  4HSV A;  1JR0 D;  3FKI H;  4FVM A;  4JK1 C;  1OO9 B;  3M4Y A;  3UE1 A;  5DM6 3;  4H13 C;  4A3G B;  3SXH A;  4DPG A;  4A3K G;  4NB3 A;  1EY6 A;  3OOC A;  1TWA H;  2CQA A;  2K03 A;  1MSH A;  1PH8 A;  3K7A H;  5I9O A;  2MNA A;  1SYB A;  3KLR A;  1F2Y A;  1WCM G;  3BG3 A;  1TY2 A;  3FRP B;  1Q86 C;  4JI3 L;  1FJG L;  1VQF A;  2MJ8 A;  2DY8 A;  5T1I A;  2Y0S E;  1BBX C;  1Q81 C;  3C46 A;  5IT9 E;  3BDC A;  1SFO H;  2UUC Q;  1QCB D;  2B8F A;  1JQY D;  1EY7 A;  4A3F B;  4JI1 Q;  4C56 C;  3J7Y W;  1DJR D;  1Q8K A;  1X65 A;  1CHQ D;  3Q24 A;  3A7L A;  2VS1 A;  4HCS A;  5E4W C;  4RH6 A;  5JPM C;  5C4H A;  3CQZ B;  3MWY W;  4A3M B;  2WIN B;  2K33 A;  3KLW A;  2F0D A;  1D6E C;  2GVB A;  3T56 B;  4HN7 A;  1DOM A;  4JI5 Q;  2JA5 H;  2KCC A;  2EYL A;  4AQY Q;  1TS3 A;  3CAM A;  1IKL A;  3TEH B;  1PTO C;  5J39 A;  4BA2 I;  4L6T B;  3GTP H;  2EPB A;  2R7Z B;  2ZXR A;  2AQ2 B;  2F03 A;  3D6W A;  3M4O H;  3JAM c;  1TWF B;  4K2L A;  3I70 A;  3T13 A;  4XT3 B;  4DR4 Q;  3RMH A;  3CCE A;  3KDF B;  1HNZ L;  4FF1 A;  3GTO H;  4HAE A;  4B9W A;  5FO7 B;  4OO1 G;  1N33 Q;  2NYZ D;  3DXJ C;  4DAY B;  3S1Q H;  1FNV A;  3M3Y B;  1LTL A;  3D8G A;  1XTC D;  3K5O A;  4DV0 L;  1PFB A;  1Q7Y C;  3TZU A;  2R61 A;  3E5S A;  4NKL A;  1TWA B;  5JJL A;  4KY6 A;  1PH2 A;  1L0X B;  3S1M H;  1WTH A;  2A19 A;  3K7A B;  3HFZ B;  2F0V A;  1GD7 A;  1K0R A;  4DR1 Q;  3VR3 A;  2RVL A;  3KK7 A;  2Z9H A;  1A3V A;  1GUG A;  3A7A B;  4GLV B;  1G91 A;  3ONA B;  1JWM D;  2K5H A;  4K14 A;  1LTG D;  1TWG H;  3SR1 A;  3VYS A;  4O0A A;  1G2T A;  2CW0 D;  4GN4 B;  4JI0 Q;  1E3P A;  5CV6 A;  1IW7 C;  1EY9 A;  1J5E Q;  1AW7 A;  1BKB A;  2BH2 A;  3WOF A;  4RFB A;  4OO1 I;  2F0N A;  1HZC A;  1S5C D;  2NTT A;  2KBN A;  1WTO A;  1HPC A;  3J81 j;  1HUM A;  1ILQ A;  1ZEQ X;  3T1Y L;  4KKU A;  2JA5 B;  2O5I C;  3FPU B;  2XVS A;  2AQ1 B;  4CJ1 B;  4XTC S;  2I5L X;  4L5R C;  3M9B A;  2HHH Q;  3MA2 B;  3X3N A;  4DR2 Q;  1LT4 D;  5JJI A;  2XRQ D;  3SDZ A;  3GTP B;  3K5L A;  4JBM A;  2IX1 A;  1G6Z A;  4GOP B;  3HOV B;  2A1A A;  2UXB Q;  1PRT D;  2JK8 A;  1AP0 A;  2R93 G;  1B3Q A;  1YHA A;  1G2S A;  4DN4 M;  3M4O B;  4B08 A;  1PZI D;  1B53 A;  2ICI A;  4C3H H;  4HIM A;  2BDO A;  4C1N I;  1DXM A;  1P8L A;  2C35 B;  3D4R A;  1LV9 A;  1QVC A;  1NTG A;  2WAQ E;  3CW2 C;  2K5N A;  4B3S L;  4LF7 L;  4J8Q A;  3GTO B;  3PSI A;  4AIM A;  4OWT B;  4R4O A;  2N78 A;  4NPS A;  3KJP A;  5KGU A;  1CQV A;  2VQE L;  1B2T A;  2NZ1 D;  3KF6 A;  3E6Z X;  1QZH A;  4ZRZ A;  1GO3 E;  1QNK A;  3A0J A;  3CCJ A;  5FJ8 H;  1HZ9 A;  1CKN B;  3N6R A;  2K14 A;  4HJ9 A;  3PUV A;  2OQ0 A;  3S1M B;  3BS1 A;  1KDA A;  4P74 A;  4K2K A;  5IT9 c;  2UXC L;  2R92 H;  2OCE A;  2EJF C;  4U68 A;  4CGY B;  2UXD Q;  1VQH A;  4R4C A;  2MGS A;  3FKI G;  1WJJ A;  3TS0 A;  1QUQ A;  3S1N H;  2E2J H;  1TS2 A;  4JG2 A;  4L63 B;  4L5S A;  2DY7 A;  2K04 A;  2F0L A;  4RAU C;  4DV7 Q;  4WFN 3;  4DV3 L;  3PCO B;  3TN2 A;  3HOU G;  4C3I G;  1K83 H;  1TWG B;  3NEN A;  4ODG A;  4HJ5 A;  1BNZ A;  2HD3 A;  1A3T A;  1ET9 A;  1N32 Q;  2D2C C;  3HEJ A;  3E0J A;  1QVF A;  2KCT A;  4U67 3;  3M7G A;  3OHX C;  2X6L A;  3J80 L;  2WB1 B;  3CPW A;  1ZYR C;  1EIY B;  3DEO A;  1D8L A;  3TZD A;  1GUT A;  2RKS A;  4YWM A;  1VQN A;  5IWA L;  3S1R H;  1PH4 A;  2CQO A;  3SK5 A;  1QOH A;  3I4M H;  4LFB L;  1PV4 A;  3D3R A;  4L8J A;  1NR4 A;  4XQJ A;  4X62 Q;  1KQS A;  1X3P A;  3F8T A;  5NUC A;  5C4Z A;  5ISR A;  1IBK L;  1HRJ A;  3J7A F;  1SLJ A;  3GTM H;  5D3D A;  3S2D H;  1X3Q A;  1NNX A;  2NB0 A;  2A69 C;  4OHJ A;  4A3D G;  3KF8 B;  3NTH A;  3PIO A;  3L2P A;  4RWS C;  4GNX B;  4B3T Q;  3ZJY C;  5ELF A;  3HOX G;  1EQR A;  3HOZ H;  1HJP A;  4J1M A;  3X3M A;  4KHZ A;  2PQE A;  3P75 A;  2XTI A;  4BS9 A;  4BY7 H;  4QUF A;  5ELD A;  2R6G A;  1STE A;  5LL6 S;  1WTQ A;  1O7Y A;  3P1H A;  4MZ9 A;  3FMC A;  4B3M L;  2KCM A;  4UP9 A;  1Q1B A;  2DJF C;  2NZO A;  4JI8 L;  1WTV A;  4CDC C;  4G7O C;  4O42 A;  2RDF A;  2VZA A;  1JJ2 A;  1AN8 A;  4HCE A;  3W1B A;  4DV5 Q;  3J80 c;  1TWC H;  1FVI A;  5COR A;  2EJM A;  2JA6 G;  1JE4 A;  4R4I A;  5M5W H;  3Q23 A;  1QNU A;  3H15 A;  1XJV A;  2GVA A;  5DEH A;  2WV6 D;  4X64 L;  2R92 B;  4BY1 G;  2E2H H;  1Q1E A;  1YNN C;  1TS4 A;  2M2L A;  1LTA D;  4LFC L;  4BBS H;  3HZX A;  1JJG A;  3URY A;  1PMR A;  2Q2I A;  2VXW A;  1AZQ A;  2NVX H;  3NK9 A;  2N49 A;  4A3C G;  3GTQ H;  1VQD A;  4CDD C;  4DR7 Q;  5C5M A;  3IFD A;  1XMO L;  3CCS A;  5BN3 A;  4A3I B;  3I55 A;  4X6A H;  3ZYY X;  4PZ8 A;  1BOS A;  4JBK A;  4RGN A;  3FHW A;  1C48 A;  3DM1 A;  5ELO A;  4DK3 C;  1LT3 D;  1SRU A;  4A3J H;  1UE7 A;  1XMQ Q;  1JE5 A;  4EVO A;  4Y7N H;  3EJI A;  5CC4 A;  2UUB Q;  3HOY H;  2KEE A;  1WOC A;  5D14 A;  3I4M B;  3W2D A;  1CM9 A;  4KD3 A;  4A93 B;  2A74 C;  4CKE A;  3H0G H;  2F0U A;  2Z6K C;  2O4X A;  5JEA J;  4QUC A;  1DM0 B;  3GTM B;  3S2D B;  1N36 Q;  4C3J B;  3K81 C;  2K5Q A;  5C5L A;  2AUK A;  3C1F A;  1PH6 A;  2G5D A;  4RGM A;  4FF2 A;  4IQZ A;  5CMD A;  5I6W A;  4DV1 L;  1SEB D;  4DU9 A;  1WTP A;  5C0X G;  1S4Z A;  2YYZ A;  4ULL A;  3HOZ B;  1UWV A;  3NXW A;  1TS5 A;  4IUQ A;  4DFA A;  1A63 A;  3CXC A;  4JV5 L;  4PMB A;  1HHV A;  4IUN A;  2Y0S G;  4YHH Q;  4DR6 L;  1L0W A;  1SNM A;  5LMN L;  2IX0 A;  1WVL A;  4X65 Q;  2KEC A;  5JOB A;  1D2B A;  1TT2 A;  1VQB A;  1B1Z A;  1JOK A;  4C3H G;  2PZU A;  1TWC B;  2Z6K A;  1Q82 C;  3LNN A;  1PTO B;  4UPA A;  4FF4 A;  3NE5 B;  5M5W B;  3A55 A;  3OMG A;  4LF4 L;  1I4G A;  2NN6 H;  1V1O A;  2E2H B;  3HS0 C;  2H5X A;  4HIK A;  1B4O A;  3CCL A;  1M8A A;  3RLO A;  1X3G A;  4QB4 A;  2QEX A;  3NSW A;  4K5V A;  3GTQ B;  3GDE A;  1K8A C;  1OTC A;  3CD6 A;  1DZ1 A;  1JOQ A;  2E5L L;  1I3Q B;  2I07 B;  5C0X I;  2QGQ A;  4LF6 L;  3F2D A;  1YJ9 A;  1STA A;  4LNQ A;  5ELN A;  1IYU A;  4X3U A;  1C4Q A;  1EY8 A;  2VUM G;  1PH9 A;  4HSP A;  1IKM A;  2K52 A;  4MTN A;  2BA0 A;  5CV8 A;  1GKH A;  4OON A;  1SYG A;  4Y7N B;  4WJ4 A;  2OWO A;  3HOY B;  2CVR A;  4JVZ A;  4JYA L;  1VQG A;  3TRZ A;  1LTI D;  4LF8 L;  1Y1V H;  3CF5 A;  2NVT H;  1NJI C;  4LWC A;  4MNO A;  5IP7 G;  2QCP X;  1MHW C;  2JA7 H;  4ZKB B;  3I91 A;  3U4V A;  2B29 A;  4G7Z C;  5C4X H;  1DOK A;  1TY0 A;  4R9W A;  2PNH A;  3PUW A;  3A56 A;  1GM5 A;  3EQL C;  4IPH A;  1B9N A;  5KND A;  4DUY Q;  4LMQ D;  1EYC A;  4POF A;  1VQC A;  1VS0 A;  4CHT B;  4GKK L;  1HR0 Q;  2X69 A;  1BXT A;  4NDX A;  3PO2 H;  1CA6 A;  3CC2 A;  3Q6S A;  3CCU A;  2F0T A;  4DR5 L;  4L5T A;  4DXF A;  1UAP A;  3PO3 G;  1CKO A;  3KF6 B;  3G71 A;  2FFK B;  1OXV A;  3K0Y A;  4DV2 L;  2LMC B;  1DYQ A;  4BY7 G;  1V1P A;  1HNW Q;  2P5Z X;  1SRO A;  2L5T A;  1PH5 A;  1LTT D;  3AB9 A;  1QUQ B;  3NWT A;  5KNB A;  2NTS A;  1MI2 A;  1EIG A;  4OIJ A;  3GP7 A;  2KUM A;  1PHJ A;  2JEB I;  4DK1 A;  5M3F H;  2BE5 D;  4DKA C;  1TQO A;  1K8M A;  3G4S A;  1TWH B;  1RHP A;  1EYD A;  4BBS G;  2BA1 A;  1GUW A;  4AYB G;  4WJ3 M;  3KOJ A;  5FK9 C;  5COY A;  1T9H A;  4V0B A;  3L0O A;  2CH4 W;  2AKW B;  4CJ2 C;  2K5V A;  3HP3 A;  2LY7 A;  3OIP A;  4ZLT F;  2H4O A;  1MSG A;  2N3S A;  1G8Z D;  4OL7 A;  3MFY A;  4J15 A;  1S40 A;  1JC7 A;  1LAC A;  1RIP A;  4A3M H;  4IPC A;  1EOV A;  1TVX A;  2PCF B;  1UE5 A;  2MUY A;  4RMF A;  5IOC A;  2NVT B;  3O13 A;  1YNJ D;  5IE8 A;  5K36 G;  3IKJ A;  3CC4 A;  4A3J G;  2JA7 B;  1D5X C;  3G6J B;  2QA4 A;  1Z47 A;  5C4X B;  1HTP A;  3P7J A;  3NBI A;  1N34 L;  5BR8 L;  2Q8R E;  4KLK A;  2XWB B;  2KVM A;  3J7Z C;  5C3W A;  3H0G G;  1B50 A;  3HKZ B;  4GLA C;  3BZD B;  3PIP A;  1I5F A;  1LTR D;  3C2P A;  2SOB A;  2RF4 A;  5M5X H;  1HR0 W;  2K05 A;  1ONL A;  3AU7 A;  3C1E A;  4XT1 B;  4YY3 Q;  4NXM Q;  4XXE A;  4KI0 A;  4BBR G;  1BCP C;  5KRU A;  3J80 i;  2QDB A;  1GUN A;  3R93 A;  5A2Q E;  2KQ3 A;  3KBX A;  3FDT A;  2AUJ D;  3BVG A;  3M3Y H;  4H7B A;  2PI2 E;  4NMZ A;  4UAI A;  4JI1 L;  1H9S A;  2EY2 A;  1X32 A;  4K6D A;  4NW2 A;  1CKM A;  3WWV A;  5JEA G;  2E2D C;  1SAP A;  5M3F B;  2EYP A;  1E24 A;  1KNA A;  3IAY A;  1RL2 A;  3A74 A;  1EYA A;  1Y1W H;  1ENC A;  2F4I A;  4LAA A;  2NN6 G;  1O7Z A;  2L9H A;  3NQI A;  3ERS X;  4DR3 Q;  4IAL A;  4JI5 L;  4A3E H;  1PDQ A;  2HIV A;  3G7L A;  3I4N G;  3M4P A;  3U58 A;  5FLM H;  3DHQ A;  2RHS B;  2KHS A;  4APV A;  3E9I A;  1PH7 A;  2PYK A;  3CMA A;  4A3B H;  1KHI A;  1HH2 P;  4DAV A;  4G7H C;  3NWS A;  3DWA A;  2EYO A;  1Q12 A;  3BYT B;  2XN9 C;  5DAU A;  2JA8 G;  1D7Q A;  3DLL A;  4CDF C;  4PV1 C;  3R3O A;  1IZ6 A;  4HR7 B;  1E2Z A;  1U4P A;  1CQF A;  2CCZ A;  2EJG C;  1IBM Q;  3PV0 A;  4FDB A;  3A54 A;  2I5H A;  5JVH 3;  1PA6 A;  2LS0 1;  5M3M B;  2V4D A;  2EY6 A;  1UUP A;  4YCV A;  4K8I A;  3RNU A;  3E3X A;  4OX9 Q;  3T1H L;  1N33 L;  4H0L C;  1I50 B;  3T53 B;  1XXG A;  3K8A A;  3OSO A;  3MC0 B;  1K9M C;  3HOV H;  3SE0 A;  1J6Q A;  1VQ6 A;  2M00 A;  1SN8 A;  1UEB A;  2NUC A;  3A8J E;  3Q0A A;  5M5X B;  2IL8 A;  3OYY A;  1FGB D;  4ALP A;  4KMU C;  2RDG A;  4LF9 L;  2ICE C;  4WOR A;  4TKO B;  5AFW A;  4DV4 L;  3K5M A;  4DR1 L;  3ERO A;  3K7U C;  1K3R A;  1AE2 A;  3GQB A;  3JC6 6;  1HA6 A;  2F3V A;  2LSS A;  1SE8 A;  4MHE A;  3PO2 G;  1PRT F;  2PW7 A;  4X3K A; 
#chains in the Genus database with same CATH homology
 2PZT A;  1KAB A;  1Q90 A;  4QMG A;  1MBY A;  5A2Q L;  1XX8 A;  4CJ0 B;  5CGK A;  5JVG 3;  3J80 E;  1Y1W B;  1EQV A;  4PNY A;  1BR9 A;  2A6E D;  4LJZ C;  2E75 C;  4A3E B;  3H09 A;  1HUN A;  3MXG A;  1LT5 D;  2SNM A;  4X3T A;  3S14 B;  3HOU B;  2HDL A;  4A3B B;  3T16 A;  2F0Q A;  1CZG A;  2RDH A;  2Q8T A;  1V8Q A;  4DAP A;  3LWE A;  2L55 A;  1D1I A;  2L1B A;  1PXU A;  3I3C A;  4FO2 A;  1WD1 A;  4DA2 A;  4NP5 A;  3I73 A;  5F2D A;  4RA8 A;  3BVM A;  2B2W C;  1GHJ A;  3DEP A;  3QG1 A;  1WD0 A;  3H6M A;  3NTI A;  1ZKO A;  3QB3 A;  1PZK D;  1Z7T A;  2CW0 C;  3MHB A;  2MPM A;  1GHK A;  1H9R A;  4G57 A;  1F2Z A;  1F2L A;  3SHL A;  4QIW B;  5FLX L;  4KN7 C;  1V1P B;  1NAP A;  4F7X A;  1EZ8 A;  1STY A;  3FVQ A;  3PIP 3;  4KN4 C;  5J1Z A;  1S5E D;  2OF1 A;  2B2W A;  2JXM B;  1EWC A;  4IFD G;  2VB2 X;  5IGD A;  3OIQ A;  2KOL A;  1BDO A;  4DF7 A;  2L4N A;  5C3E B;  1PRT C;  3KLS A;  2D62 A;  3R2I A;  4ZK9 B;  3SK6 A;  1RKN A;  3GTG B;  1STH A;  4RKL A;  5KYI A;  1FR3 A;  4M1U B;  4KK7 A;  1II3 A;  4ID6 A;  4KJO A;  1LT6 D;  2EZV A;  4XQN A;  4IUV A;  2DNE A;  1IHZ A;  3TME A;  2F0H A;  3PUY A;  3NUC A;  1RDP D;  5EPL A;  4EQN A;  4DK0 A;  1DD2 A;  2B39 A;  3L3O C;  1KAA A;  4IFD I;  2J0T D;  3A8I E;  1IYV A;  3ITP A;  1RTO A;  4IN3 A;  3MTS A;  4BWG B;  1SBB B;  3H94 A;  4CKC A;  3GTL B;  2E76 C;  1LO5 D;  2F0I A;  3IL8 A;  2AWO A;  2B63 B;  2J7Z A;  3HOW B;  1Q8I A;  3GV3 A;  1LTB D;  1I6V C;  2A5H A;  2K6A A;  1KTK A;  1E2W A;  2A68 D;  1SYD A;  1H9S B;  3KLS X;  3MZ5 A;  2WKD A;  1RCV D;  1PTO H;  1ESF A;  3WDN A;  2QKI C;  2J4X A;  4OGQ C;  1SNO A;  2EYF A;  3AMU A;  3KBG A;  4KV6 A;  2F1M A;  3K5N A;  1J8I A;  2CHB D;  2B8G A;  3TP8 A;  3OMC A;  2Z8L A;  1RJT A;  1A2T A;  1PYW D;  5E3F A;  1BCP B;  2EYH A;  4RKB A;  1SNC A;  2B2U C;  4K5X A;  1HXY D;  3EFX D;  1D5M C;  1STG A;  4FYD A;  1H9K A;  4KY7 A;  1A15 A;  4XYQ A;  1SJE D;  3TBI B;  1VF7 A;  1QWY A;  2TSS A;  5K5P A;  1JIC A;  2OEO A;  2Z4I A;  5IGE A;  3QOJ A;  1EY0 A;  1E0B A;  2KED A;  3N52 A;  3H91 A;  4N9P A;  3VR2 A;  1TU2 B;  1EOT A;  2F0K A;  2Q8I B;  5FO9 B;  4N9T A;  3L7Z C;  4ILW A;  2B2U A;  1VCI A;  1L0Y B;  2B2T C;  2IW3 A;  4IUT A;  4RGO S;  2F0O A;  3OWE B;  2A6H D;  4FP5 D;  2K5D A;  5EGT A;  5BN5 A;  1Y8P B;  2JE6 I;  2O5J C;  1TR5 A;  3FEW X;  2HDM A;  1EY5 A;  5C44 B;  4ABN A;  2B2T A;  3M7N A;  3GTK B;  1EFI D;  2FHT A;  2D5D A;  4WJW A;  3S15 B;  2RBM A;  4EQP A;  2EYJ A;  2VNU D;  1VMP A;  3K6O A;  4JBW A;  4K8J A;  1ET6 A;  1ZXT A;  4YIJ A;  4BA1 I;  3MAQ A;  3BDL A;  5I4D A;  3EVQ A;  3OWF A;  3U9S A;  2SEB D;  1EEF D;  1SYF A;  2E74 C;  5HUR A;  1NUC A;  2WAQ B;  5ELE A;  2OXP A;  2N55 A;  2RQX A;  4PMC A;  2X6G A;  1Y8O B;  5LL6 X;  1QG7 A;  3SVM A;  4FXG C;  3NP8 A;  2EY1 A;  2PZW A;  1BQQ T;  1MGS A;  4TSS A;  3CKI B;  3I72 A;  3QO2 A;  1KDC A;  2RSO A;  3LWU A;  1VMC A;  1Y69 U;  4IUR A;  1H9M A;  1E2V A;  3NBH A;  2JYO A;  1SYE A;  5DM7 3;  2EE1 A;  4KY5 A;  5FO8 B;  3HRZ C;  3PIO 3;  1F9R A;  1D5Z C;  3D31 A;  1CFM A;  3A8K E;  1U9R A;  4F87 A;  5KNC A;  4OO1 H;  4FXD A;  5I2X A;  1SMY D;  5G3L D;  4A3K B;  2QIL A;  3TP7 A;  3NTK A;  1K8O A;  2HQE A;  1QIL A;  2BCO A;  1QB5 D;  3D6C A;  4K5W A;  1XWE A;  1WCM B;  4F8M A;  3J81 L;  3K57 A;  1I4Q A;  2G9D A;  1PLF A;  3I4N B;  2N88 A;  2ZT9 C;  3CHB D;  3MEH A;  4F88 A;  2I46 A;  1O78 A;  1MD2 D;  1O7L A;  1VDZ A;  1STB A;  2B2V C;  4K6L A;  1PRT B;  4IUU A;  1BUV T;  2SNS A;  2HUG A;  2JP1 A;  4IZ8 A;  5IIF A;  1OXT A;  2BE5 C;  4R8N A;  2L11 A;  4ZQ3 A;  4RGT A;  2Z1C A;  3MXP A;  3GTJ B;  2R3Z A;  2IT1 A;  1FNU A;  1DON A;  1B44 D;  3BDO A;  5C6A A;  2RSN A;  1I4X A;  1VF5 C;  5T1G A;  2B2V A;  4XYO A;  2SDF A;  3NHH A;  3MFG A;  4XIG S;  4HMJ A;  2WAC A;  1TII D;  1YNJ C;  4R8I A;  3KF8 A;  2H1E A;  2XRS D;  2L0C A;  1AZP A;  1PZJ D;  5EKI A;  5I2Y A;  4UDU C;  2K5W A;  3MVV A;  1F9P A;  1SE3 A;  3V2T A;  4KTA A;  1LLR D;  2EYM A;  4QCL A;  5JJZ A;  1ILP A;  3OW7 A;  1EEI D;  1F9Q A;  1SYC A;  2IWH A;  3VA5 A;  1B9M A;  1EL0 A;  1U4M A;  3VR5 A;  2PPB C;  1I4P A;  3JAM L;  5EPJ A;  1RD9 D;  1PTO D;  3CRL C;  3T51 B;  5IGF A;  3D4D A;  1CI3 M;  4MIU A;  1JWU D;  1SE4 A;  2YU9 B;  5C4J B;  2PMZ B;  4KKS A;  4ZUJ A;  1Y8N B;  5FLX E;  2NN6 I;  2PW5 A;  2R93 B;  4MN3 A;  4KD4 A;  1HFN A;  3M85 A;  3V05 A;  1I6H B;  2F0F A;  3PUX A;  1CA5 A;  1EQT A;  3P20 A;  3QOL A;  1V43 A;  2A73 B;  2KCN A;  2DN8 A;  3KUP A;  5CV7 A;  3OPO A;  1AFP A;  1U4L A;  1ESR A;  2K28 A;  2MP1 A;  1OXS C;  1SNP A;  3NQT A;  3HGB A;  1IW7 D;  2F0M A;  3FKI B;  3QIA A;  3QJY A;  5EBC A;  4QF4 A;  1W6J A;  5I6Y A;  4RCN A;  4V19 0;  2JSO A;  1HA5 A;  1OXU A;  4C3I B;  1AEX A;  1RTN A;  1ENA A;  5EKL A;  3J7A V;  2F0P A;  1FNW A;  1SDF A;  4M8A A;  1Q3L A;  1CHP D;  1GXD C;  5C0X J;  2AWN A;  3RUZ A;  1SFO B;  1JB3 A;  5ELC A;  5JAV A;  4TQU S;  2F0W A;  2A6E C;  1SSO A;  5IT9 L;  2XIW A;  1S5D D;  4A3D B;  4HMI A;  1OXX K;  4CBV A;  2NVQ B;  4XQQ A;  5C0X H;  3HOX B;  5CV5 A;  2EOT A;  4Q0F A;  1EY4 A;  1JWS D;  2FMM A;  2XSC A;  4RHR A;  4GZY C;  1EWH A;  2PNR C;  1KDB A;  3L9A X;  3I8Z A;  3RZO B;  3R8B A;  1FD7 D;  2O2L D;  1JCK B;  4XDX A;  1DOL A;  2IJ0 A;  3GO5 A;  4C2M B;  2LKV A;  5IGB A;  4ZKC B;  1J9O A;  1EZ6 A;  3MXN A;  4ZUI A;  2JA6 B;  1UEA B;  2C5C A;  4BY1 B;  5CYU A;  5EQ0 A;  2RA4 A;  1ZYR D;  3S1Q B;  3GV6 A;  1LAB A;  3H3V C;  2HCI A;  1TKW B;  1SJH D;  1S5B D;  1C8C A;  1U4R A;  1CT1 D;  2A69 D;  1PFN A;  1JOR A;  1F9S A;  4CKB A;  2F0S A;  4IUP A;  1KLU D;  5CBE E;  5EPK A;  1LTS D;  3NPP A;  4G4K A;  1CTM A;  3SK4 A;  3TDQ A;  3RLF A;  1CZW A;  2EVB A;  1XYI A;  5J22 A;  5D65 A;  3U9O A;  3GD7 A;  3S17 B;  1DCZ A;  4HTH A;  5C3X A;  1HFG A;  3PUZ A;  1WTR A;  3SEB A;  1A2U A;  1R4Q B;  2KJX A;  2EY5 A;  1YNN D;  2Y0S B;  2DNC A;  1HTL D;  4O1N A;  2F3W A;  2ID0 A;  5CV9 A;  5FOB B;  2K32 A;  4C3H B;  3DMU A;  1O80 A;  1BF4 A;  3BVZ A;  4E6I A;  5CBA E;  4RCO A;  3LX0 A;  4EQO A;  2ZXO A;  4Z9C B;  5DNF A;  3VYR A;  2MHV A;  3SK8 A;  4ZAI A;  2NWG A;  2WII B;  3I90 A;  4HED A;  1SNQ A;  2NBF A;  2ZXP A;  3ERQ A;  3IFT A;  3PMF A;  2IX3 A;  2M9V A;  1Z6H A;  3EA6 A;  1R9T B;  2VUM B;  1HQM C;  2L12 A;  2A68 C;  3S1N B;  2E2J B;  2KA7 A;  1A3U A;  3WOE A;  3DWQ A;  1S5F D;  3DUZ A;  3ND9 A;  3F2U A;  1K83 B;  1NCV A;  5TSS A;  1GJX A;  4S3S A;  4H44 C;  4I7Z C;  3QWN A;  5K36 H;  2D9U A;  2TMP A;  4FNF A;  2OT2 A;  3S9W A;  4KJN A;  2AQ3 B;  1EU3 A;  3S1R B;  3VYU A;  1IL8 A;  3C3L A;  2FJ2 A;  3K59 A;  2NVY B;  3VYT A;  1EIH A;  5KEE A;  3PO3 B;  2QEJ C;  3W3A A;  2JEA I;  4P2C B;  4BY7 B;  1HQR D;  2BOS A;  2B2Y C;  3VA7 A;  4PQX A;  3J81 E;  4KHV A;  1T5X D;  2IPK D;  4PMW A;  2BDN A;  5JEA H;  1SND A;  4RHS A;  4WRD A;  1B3A A;  4LK1 C;  5IGC A;  4DAY A;  2A6H C;  1T5E A;  5G3L F;  5D3I B;  5E1F A;  5KYL A;  4BBS B;  4AYB B;  5JPN C;  2E2I B;  2NVX B;  5EKK A;  3VR6 A;  1QJO A;  4J6H A;  3D4W A;  1FYC A;  4X3S A;  1GOZ A;  2B2Y A;  1SE2 A;  4C1N K;  1WTW A;  2F0G A;  2GA4 B;  3I4L A;  5CV4 A;  1KNE A;  4I65 A;  1I4R A;  4A3J B;  2EXZ A;  1STN A;  3T4A C;  2F0J A;  5ELB A;  1D1K A;  4OIK A;  1JOO A;  1ICW A;  3DWP A;  2WKC A;  1G29 1;  3H0G B;  1ML0 D;  2VB3 X;  3HG9 A;  5EBD A;  3RZD B;  2ENB A;  4C3J G;  4ME5 A;  5M5Y B;  5IGG A;  1QE6 A;  3S16 B;  3Q22 A;  2EDG A;  3ND8 A;  4BBR B;  5EJW A;  1BCP F;  1EU4 A;  4ZYS A;  1NR2 A;  3K58 A;  1W6K A;  3CRK C;  1SXT A;  3JAM E;  2K1B A;  1A6X A;  1R4P B;  1NSN S;  4DXG A;  4Q5V A;  2K7V A;  4FXK C;  2G9H D;  2C9O A;  1H9J A;  4DGZ A;  1ROD A;  5CR3 A;  1F2M A;  3BYY B;  3FPP A;  5I9P A;  1SMY C;  5LHY 1;  1CK1 A;  2JA8 B;  3TSS A;  2PO4 A;  2F0E A;  1PFM A;  4B9X A;  2WP8 J;  3CU7 A;  1M4V A;  1RF2 D;  1UNS A;  1BCP D;  1KLG D;  1PTO F;  3R2T A;  2XNA C;  1Y1V B;  3UI2 A;  4EGV A;  5HGT A;  4KKT A;  2QF7 A;  1WTX A;  1I4H A;  1F77 A;  2FMC A;  3S2H B;  4IFD J;  3V96 A;  3TP5 A;  2XWJ B;  4DNT B;  2K01 A;  4FF3 A;  3RD4 A;  2FIN B;  1ENF A;  5KIX A;  3VR4 A;  5BN4 A;  4DNR B;  3PO2 B;  3TP6 A;  2LFN A;  5A35 A;  1GUO A;  2Z4H A;  3MXU A;  5FKA C;  1GUS A;  4TRD A;  1HCZ A;  1BO0 A;  5E4X A;  2HCC A;  4IFD H;  5IOD A;  5M9O A;  4HSV A;  1JR0 D;  4FVM A;  4JK1 C;  1OO9 B;  3M4Y A;  5DM6 3;  4A3G B;  4H13 C;  3SXH A;  1EY6 A;  3OOC A;  2CQA A;  2K03 A;  1MSH A;  5I9O A;  1SYB A;  3KLR A;  1F2Y A;  3BG3 A;  1TY2 A;  3FRP B;  2MJ8 A;  2DY8 A;  5T1I A;  1BBX C;  3C46 A;  5IT9 E;  3BDC A;  1QCB D;  2B8F A;  1JQY D;  1EY7 A;  4A3F B;  4C56 C;  3J7Y W;  1DJR D;  1CHQ D;  3Q24 A;  3A7L A;  4HCS A;  5E4W C;  4RH6 A;  5JPM C;  5C4H A;  3CQZ B;  3MWY W;  4A3M B;  2WIN B;  2K33 A;  2F0D A;  1D6E C;  3T56 B;  4HN7 A;  1DOM A;  2KCC A;  2EYL A;  1TS3 A;  1IKL A;  1PTO C;  5J39 A;  4BA2 I;  4L6T B;  2EPB A;  2R7Z B;  2ZXR A;  2AQ2 B;  2F03 A;  3D6W A;  1TWF B;  4K2L A;  3I70 A;  3T13 A;  4XT3 B;  3RMH A;  4FF1 A;  4HAE A;  4B9W A;  5FO7 B;  4OO1 G;  2NYZ D;  3DXJ C;  1FNV A;  3M3Y B;  3D8G A;  1XTC D;  3K5O A;  1PFB A;  3TZU A;  2R61 A;  3E5S A;  4NKL A;  1TWA B;  4KY6 A;  1L0X B;  3K7A B;  2F0V A;  3VR3 A;  2RVL A;  3KK7 A;  1A3V A;  1GUG A;  3A7A B;  1G91 A;  1JWM D;  3ONA B;  4K14 A;  1LTG D;  3SR1 A;  3VYS A;  1G2T A;  2CW0 D;  5CV6 A;  1IW7 C;  1EY9 A;  1AW7 A;  3WOF A;  4RFB A;  4OO1 I;  2F0N A;  1S5C D;  2NTT A;  1WTO A;  1HPC A;  1HUM A;  1ILQ A;  1ZEQ X;  4KKU A;  2JA5 B;  2O5I C;  3FPU B;  2XVS A;  2AQ1 B;  4CJ1 B;  4XTC S;  3MA2 B;  3X3N A;  1LT4 D;  2XRQ D;  3SDZ A;  3GTP B;  3K5L A;  2IX1 A;  1G6Z A;  3HOV B;  1PRT D;  1AP0 A;  1G2S A;  4DN4 M;  3M4O B;  4B08 A;  1PZI D;  1B53 A;  2ICI A;  2BDO A;  4C1N I;  1DXM A;  1LV9 A;  3D4R A;  4J8Q A;  3GTO B;  5KGU A;  1CQV A;  1B2T A;  2NZ1 D;  3E6Z X;  4ZRZ A;  1QNK A;  3N6R A;  3PUV A;  3S1M B;  3BS1 A;  1KDA A;  4K2K A;  2EJF C;  4U68 A;  4CGY B;  2MGS A;  1TS2 A;  4L63 B;  2DY7 A;  2K04 A;  2F0L A;  4RAU C;  4WFN 3;  3TN2 A;  4C3I G;  1TWG B;  4ODG A;  1BNZ A;  1A3T A;  1ET9 A;  2D2C C;  3HEJ A;  3E0J A;  4U67 3;  3M7G A;  3OHX C;  2X6L A;  3J80 L;  2WB1 B;  1ZYR C;  3DEO A;  3TZD A;  1GUT A;  2RKS A;  3SK5 A;  1QOH A;  3D3R A;  4L8J A;  1NR4 A;  4XQJ A;  1X3P A;  5NUC A;  5C4Z A;  5ISR A;  1HRJ A;  3J7A F;  5D3D A;  1X3Q A;  2NB0 A;  2A69 C;  4OHJ A;  3NTH A;  4RWS C;  5ELF A;  4J1M A;  3X3M A;  4KHZ A;  2PQE A;  3P75 A;  4BS9 A;  4QUF A;  5ELD A;  2R6G A;  1STE A;  5LL6 S;  1WTQ A;  1O7Y A;  3P1H A;  3FMC A;  1Q1B A;  1WTV A;  4G7O C;  4O42 A;  2RDF A;  1AN8 A;  4HCE A;  5COR A;  2EJM A;  1JE4 A;  3Q23 A;  1QNU A;  5DEH A;  2WV6 D;  2R92 B;  1Q1E A;  1YNN C;  1TS4 A;  2M2L A;  1LTA D;  3HZX A;  3URY A;  1PMR A;  2VXW A;  1AZQ A;  3NK9 A;  5C5M A;  3IFD A;  5BN3 A;  4A3I B;  3ZYY X;  1BOS A;  4RGN A;  1C48 A;  3DM1 A;  1LT3 D;  4EVO A;  3EJI A;  5CC4 A;  2KEE A;  5D14 A;  3I4M B;  3W2D A;  1CM9 A;  4KD3 A;  4A93 B;  2A74 C;  4CKE A;  2F0U A;  2O4X A;  5JEA J;  4QUC A;  1DM0 B;  3GTM B;  3S2D B;  4C3J B;  2K5Q A;  5C5L A;  2AUK A;  3C1F A;  4FF2 A;  4RGM A;  4IQZ A;  5CMD A;  5I6W A;  1SEB D;  4DU9 A;  1WTP A;  5C0X G;  1S4Z A;  2YYZ A;  4ULL A;  3HOZ B;  3NXW A;  1TS5 A;  4IUQ A;  4DFA A;  4PMB A;  1HHV A;  4IUN A;  1SNM A;  2IX0 A;  1WVL A;  2KEC A;  5JOB A;  1D2B A;  1TT2 A;  1B1Z A;  1JOK A;  4C3H G;  2PZU A;  1TWC B;  3LNN A;  1PTO B;  4FF4 A;  3NE5 B;  5M5W B;  3A55 A;  3OMG A;  1I4G A;  2NN6 H;  1V1O A;  2E2H B;  3HS0 C;  1B4O A;  1M8A A;  4QB4 A;  3NSW A;  4K5V A;  3GTQ B;  1DZ1 A;  1JOQ A;  1I3Q B;  2I07 B;  5C0X I;  1STA A;  1IYU A;  4X3U A;  1C4Q A;  1EY8 A;  4HSP A;  1IKM A;  2BA0 A;  5CV8 A;  1SYG A;  4Y7N B;  3HOY B;  2CVR A;  1LTI D;  2QCP X;  4ZKB B;  3I91 A;  4G7Z C;  1DOK A;  1TY0 A;  4R9W A;  3PUW A;  3A56 A;  3EQL C;  1B9N A;  5KND A;  4LMQ D;  1EYC A;  4CHT B;  2X69 A;  1BXT A;  4NDX A;  1CA6 A;  3Q6S A;  2F0T A;  4DXF A;  1UAP A;  2FFK B;  1OXV A;  3K0Y A;  2LMC B;  1DYQ A;  1V1P A;  2L5T A;  1LTT D;  3AB9 A;  3NWT A;  5KNB A;  2NTS A;  1MI2 A;  1EIG A;  4OIJ A;  3GP7 A;  2KUM A;  2JEB I;  4DK1 A;  2BE5 D;  1TQO A;  1K8M A;  1TWH B;  1RHP A;  1EYD A;  1GUW A;  2BA1 A;  5FK9 C;  5COY A;  4V0B A;  4CJ2 C;  3HP3 A;  2LY7 A;  3OIP A;  4ZLT F;  2H4O A;  1MSG A;  1G8Z D;  4OL7 A;  3MFY A;  1JC7 A;  1LAC A;  1TVX A;  2PCF B;  2MUY A;  5IOC A;  2NVT B;  3O13 A;  1YNJ D;  5K36 G;  3IKJ A;  2JA7 B;  1D5X C;  3G6J B;  1Z47 A;  5C4X B;  1HTP A;  3P7J A;  3NBI A;  2Q8R E;  2XWB B;  2KVM A;  5C3W A;  1B50 A;  3HKZ B;  3BZD B;  1LTR D;  3C2P A;  2SOB A;  2K05 A;  1ONL A;  3AU7 A;  3C1E A;  4XT1 B;  4XXE A;  4KI0 A;  1BCP C;  5KRU A;  2QDB A;  1GUN A;  3R93 A;  5A2Q E;  2KQ3 A;  3KBX A;  3FDT A;  2AUJ D;  3BVG A;  4H7B A;  4NMZ A;  4UAI A;  1H9S A;  2EY2 A;  1X32 A;  4K6D A;  4NW2 A;  5JEA G;  2E2D C;  1SAP A;  5M3F B;  2EYP A;  1KNA A;  3IAY A;  1EYA A;  1ENC A;  2F4I A;  4LAA A;  2NN6 G;  1O7Z A;  2L9H A;  3NQI A;  4IAL A;  1PDQ A;  3G7L A;  3DHQ A;  2KHS A;  2PYK A;  4DAV A;  4G7H C;  3NWS A;  2EYO A;  3DWA A;  1Q12 A;  3BYT B;  2XN9 C;  5DAU A;  4PV1 C;  3R3O A;  4HR7 B;  1E2Z A;  1U4P A;  1CQF A;  2EJG C;  3PV0 A;  5JVH 3;  3A54 A;  2LS0 1;  5M3M B;  2V4D A;  2EY6 A;  1UUP A;  4K8I A;  4H0L C;  1I50 B;  3T53 B;  1XXG A;  3OSO A;  3MC0 B;  3SE0 A;  2M00 A;  2NUC A;  3A8J E;  3Q0A A;  5M5X B;  2IL8 A;  1FGB D;  4KMU C;  2RDG A;  2ICE C;  4WOR A;  4TKO B;  5AFW A;  3K5M A;  3ERO A;  3GQB A;  1HA6 A;  2F3V A;  4MHE A;  1PRT F;  2PW7 A;  4X3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...