3ERQA

Crystal structure of staphylococcal nuclease variant l25k at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Structural consequences of the ionization of lysine residues at 25 internal positions in a protein.
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3erqA00
1STNA 2EYJA 2F0PA 1TQOA 4WORA 2KHSA 2PZWA 5J1ZA 5K5PA 5IOCA 1NSNS 3NP8A 2PW7A 4PMBA 3TP6A 4DU9A 4F7XA 4QMGA 4HTHA 2OEOA 4J1MA 3V2TA 5I9PA 5JAVA 3D8GA 2F0DA 4J6HA 1SYBA 4K8JA 4EQOA 2F0LA 4IALA 4KY5A 4KHVA 3NXWA 1JOQA 4ZUIA 4E6IA 3LX0A 1SNDA 5CV9A 1SNQA 4NMZA 2F0MA 1II3A 4QF4A 2F0OA 1TT2A 4K5WA 5C4ZA 1NUCA 5J22A 4DF7A 4TRDA 3SK5A 4ID6A 1KDBA 3P75A 1AEXA 2PW5A 3BDLA 5KGUA 3DHQA 3D4DA 5CC4A 3D6CA 4NP5A 3TP8A 3HEJA 4KY7A 3TP5A 5I6WA 1KAAA 5IGEA 2F0NA 1RKNA 5C5MA 5C6AA 5KIXA 5J39A 4RKBA 5I6YA 2LKVA 1A2TA 5NUCA 3VA5A 1A3TA 3OMCA 5CR3A 1SNCA 1F2YA 5E3FA 1EYCA 3S9WA 2EY2A 4KJOA 2ENBA 1TR5A 2M00A 3SXHA 5I9OA 5IGDA 1JORA 1STHA 2F0FA 1EY5A 2SOBA 5C3WA 3H6MA 4KTAA 2F0VA 2EYHA 4I65A 5IIFA 1EY7A 1SNPA 4F8MA 4K2LA 1KDCA 4RKLA 2KQ3A 4B9XA 4HMIA 3MZ5A 2RKSA 3C1FA 2EYOA 2F0QA 4EQNA 2PZTA 1JOOA 1A3UA 2OF1A 2F0GA 1SYDA 3QB3A 2F0SA 3MXPA 4N9PA 3MVVA 2EYLA 4EQPA 3D4WA 1KDAA 2QDBA 5IODA 4K5XA 4DGZA 1EZ6A 1SYFA 3NQTA 1SYGA 2HQEA 4H7BA 5F2DA 1EYAA 4K2KA 4N9TA 3TMEA 1EY9A 1A2UA 5DAUA 5KEEA 3SHLA 2F0EA 3MEHA 3QOJA 4PNYA 2PYKA 3OSOA 3RUZA 2PQEA 4IUNA 2EY1A 5CV8A 2F0IA 4K6DA 3R3OA 5EKKA 2RDFA 5C5LA 5CV7A 1KABA 4KD4A 5ISRA 3ITPA 1F2ZA 2EXZA 2PZUA 2EYFA 5DEHA 2F0UA 4IZ8A 5KRUA 1EY6A 1STYA 1EQVA 3BDCA 1EZ8A 1JOKA 5EKLA 2F0JA 4MIUA 2SNMA 4PMCA 2F0WA 5HURA 5CV6A 4QB4A 1ENCA 4KD3A 5IGGA 5KYIA 5IGFA 3EVQA 1STAA 2RBMA 5CV4A 4EVOA 1U9RA 4KJNA 2SNSA 3MHBA 4HMJA 4WRDA 3U9OA 4NDXA 4YIJA 1EY4A 3DMUA 3ERQA 4KV6A 3QOLA 1SNOA 2F3WA 1ENAA 3EJIA 1STGA 4ME5A 4ZUJA 2F0KA 4K14A 1SYEA 2F0HA 5IGCA 2EY6A 3NHHA 3HZXA 4OL7A 3C1EA 3PMFA 4ODGA 3E5SA 3SK6A 1SYCA 2EY5A 1F2MA 4K8IA 4KY6A 3NK9A 2NUCA 5CGKA 2F0TA 3SR1A 4ZQ3A 4S3SA 4B9WA 3T13A 3TP7A 3OMGA 2F3VA 4DFAA 4LAAA 3OWFA 2WACA 5C3XA 2EYPA 5IGBA 5E1FA 3SK4A 5EGTA 2OXPA 5C4HA 1STBA 1EY8A 5HGTA 1EY0A 4NKLA 1SNMA 5M9OA 2O4XA 3P1HA 4K5VA 3T16A 1IHZA 5KYLA 1A3VA 1EYDA 2EYMA 3NUCA 4R8NA 5JOBA 5CV5A 3SK8A 3EROA 4G57A
chains in the Genus database with same CATH superfamily
1SXTA 4WORA 3WWVA 4C3HH 2KHSA 1BF4A 3ER0A 1NSNS 3HOWH 3CU7A 4JBMA 5JAVA 3V2TA 5LHY1 2NBFA 1QVFA 1RD9D 1Q86C 5JEAH 1GOZA 1WYDA 2A5HA 1PH2A 4FF4A 2A73B 2YYZA 4DAVA 4ABNA 2PW5A 1BCPB 3BDLA 1Q8IA 4KHPQ 3DHQA 3GTPB 3J81E 1VQFA 2VB2X 3ZYYX 3HOYB 1CK1A 4DV6Q 1MBYA 4DK6C 1NR2A 2F0NA 5C6AA 1L0XB 4DUZL 4DV0Q 4DR2Q 3PQIA 3HOVG 2E76C 3ULLA 4QIWB 1QNUA 1H9RA 4OO1I 3SXHA 1B9NA 4POGA 2H5XA 1VQNA 3GTLB 3S16B 3MXGA 1I4RA 4DK3C 4DNIA 4G7HC 4LUZA 2YTXA 1TWGB 1WD0A 1S72A 2PNRC 3GV6A 5DLQE 3D4WA 4DV3Q 3FDTA 3NEMA 1GHJA 4JVZA 3BVGA 5FLXc 3DM3A 4A75A 1ZEQX 4R9WA 5DNFA 1HNWQ 2E5LQ 4CDFC 2B2UA 2EXZA 2Z6KC 4FVMA 2D2CC 3I4NG 1TWAB 2OQKA 3S2DB 1V43A 1BUVT 3HOXB 1FGUA 3EVQA 1Q81C 3K7UC 3M7GA 1GXDC 4QCLA 1ENAA 1WCMG 3NE5B 1A63A 4ME5A 4DV2Q 4IUUA 2RA4A 1VQHA 3C1EA 3PMFA 1PH7A 2QCPX 4KY6A 1WTXA 4UY8C 4DV7L 1TIID 3NENA 4JV5L 1PMRA 1FNVA 5LMUQ 2MUYA 5IYBG 3PO3G 4DAPA 2JXMB 1I50B 3L9AX 2L15A 4IPGA 2QEJC 1VF7A 1C7YA 5BR8Q 1VQAA 3GQBA 4RGMA 1CA6A 1QZHA 2HHHL 1M4VA 1DONA 4FXGC 1K8OA 4C3HG 4CGYB 3HOWG 4XT1B 5I9PA 4HTHA 2Q2TA 1O7IA 4JBWA 4J6HA 2F0DA 2XRQD 3H3VH 1LTRD 5JEAG 2AUKA 4NMZA 1E2WA 2BA0A 1G2TA 4AQYQ 3RN2A 1Q90A 4A3BH 2VUMH 4RHRA 4HSPA 3HEJA 4NB3A 1HZAA 1OXSC 1CSQA 4RKBA 1QUQB 5EBDA 3CCVA 1YZ6A 5M3MH 1I4XA 3CC2A 2NVXB 4A93H 5IGDA 2B63H 3M4YA 2VQFQ 4A3KB 1HQMC 2PQAA 2PPBC 2JA5B 1JOOA 1IYJB 3NPPA 4EQPA 2RCFA 3TREA 1S5BD 4K5XA 1O7LA 1NBWA 3I55A 5A2QE 1VQPA 1LT5D 4IN3A 4IO9A 1JE4A 5IP9H 4A3MB 1ILPA 1AE3A 4IUNA 4OWXB 4CDDC 1EQTA 2D9UA 2UU9Q 4GKJQ 4X65Q 1UE1A 1LT3D 5M3FB 4B3ML 1SE2A 4DUYL 4JI7Q 5D3IB 1CM9A 3CHBD 4A3CH 2K5NA 4KI0A 2WAQG 4C2MB 1T9HA 4KD3A 1IL8A 3PUZA 2AWNA 2HUGA 3D3RA 1U9RA 5EQ0A 5C4XH 1XXGA 1EY4A 5TSSA 1IBMQ 1X56A 1O7ZA 2K52A 3I70A 2RHQB 4CBVA 1BDOA 3HGBA 1I94L 2FXQA 3UI2A 1H9SB 5C3EB 4RGOS 3S1QB 3KF8A 2LXJA 1VQGA 3EIVA 4FO2A 4ZKBB 1U4MA 4S3SA 1K3RA 2VB3X 1S40A 2ZJRA 2O4XA 2JA8B 1SJHD 3URYA 1W6KA 2V1CC 3UE1A 3O13A 4IUQA 1XTCD 1QE6A 2QEXA 4G57A 4IOAA 2R92B 3MFYA 3T1YQ 2XSCA 3WOEA 1F9QA 1KNAA 3TRZA 2R6GA 1VCIA 2DN8A 2B2WA 2MP1A 2AQ1B 4E6IA 1YJNA 3WOFA 1SNQA 4GKKL 1U4PA 1X32A 3VR3A 1GJXA 4A3IB 1YHAA 2Q8TA 2AQ2B 2KEEA 2HD3A 4GN4B 3D6CA 5IYDH 2NN6I 4LUOA 5FO7B 1V1QA 4HJ7A 4QUCA 5I6YA 2BCOA 2LKVA 4DN4M 5GAHC 1VQ5A 1PRTF 2NZOA 4DA2A 5M3MG 4LF4L 2GN5A 1OXVA 3BDOA 2SOBA 4A93G 3MXUA 1G291 2WINB 2WP8J 4K0KQ 3A55A 1ET9A 4N9PA 5C44B 5A35A 4DV4L 2DY7A 3BG3A 3HOZH 5F2DA 5FLMH 1EIGA 1D5MC 4N9TA 2K50A 1D5ZC 4DR7L 3VR5A 1A2UA 5DAUA 4C3JG 1R4PB 2KHJA 5K36G 2DY8A 1Q12A 4KD4A 4IPCA 1HXYD 4OX9L 1EY6A 3BYYB 3S15H 5CBEE 4PMCA 2IJ0A 4QB4A 3S1NH 5IGFA 1HJPA 5I2XA 1K28A 5CV4A 4P71A 4KJNA 3GTMB 1PTOF 1Y1VH 5C4XG 2CH4A 3K6OA 3ND9A 3KBGA 1DZ1A 3J81i 3L7ZC 3GTQH 2WIIB 4L5QA 4JCVE 1EFID 4DAYB 4GKKQ 1PYWD 3SR1A 4FNFA 2DJGC 4R4OA 2KCCA 3AFQA 5IWAQ 2A6HD 2VQEL 2KCTA 3SK4A 3M9BA 3I56A 3J7A5 4XQQA 3H3VC 1XMQL 1GUNA 4NKLA 4F88A 5ELDA 1DOKA 3T16A 3T4AC 3GTPH 2JN4A 3HOYH 4OIKA 1VDZA 2F0PA 1OXTA 2EZVA 3AFPA 1E7ZA 4RAUC 4IOCA 3KF6A 4WFN3 2XN9C 3I4MB 2YV5A 3G7LA 4MTKA 2F0LA 1BCPD 3PSIA 2BOSA 4OXPA 2FHTA 3Q6SA 3GTLH 4PQXA 3S16H 3AU7A 2UXCQ 1C48A 1C8CA 5G3LD 3M3YB 2E2JB 1TWGH 3K59A 2AKWB 2IL8A 5IYDG 4R4CA 1KLGD 3KK7A 3FKIB 3J7ZC 3H3VI 3G6JB 5CR3A 3J80L 1PDQA 4HIOA 4KJOA 4RCNA 4GN5A 4GNXA 1STHA 2PQAB 3HKSA 3OIQA 2MPMA 3FRPB 1U4LA 1BBUA 3TSSA 1TWAH 1MKHA 4A3JB 2MHVA 1EOVA 3S2DH 1HR0W 4B3RL 4OO1H 1TWHB 5GAGC 3OHXC 3HOXH 1IYVA 2HQEA 3E9HA 4ME3A 4UP9A 5JPNC 2MJ8A 1EIYB 2JA7B 3J7YW 4LFAQ 3F8TA 4DXFA 1VQ4A 2A68C 1JMCA 4A3LG 4BBSB 1IKMA 3A7LA 3RMHA 2XVSA 5GADC 3JAME 4DR6Q 1WOCA 1XMQQ 3M7NA 1VF5C 4B3SL 1BNZA 1S4ZA 2B2VC 1I50H 1HUMA 3ERQA 1Y1VG 2BE5D 4AIMA 1SYEA 4C56C 2EY6A 1H95A 3SVMA 3HOUG 3ICEA 4YHHQ 1SEBD 3FVQA 1IBLL 4QL5A 3CCLA 2N55A 4Y7NB 2WACA 1X3PA 2FMMA 2OXPA 1PZID 2D62A 5EPJA 4ZLTF 4LFCQ 4DPGA 2Q8IB 2EDGA 2DGYA 4TQUS 1XNRL 1ZYRD 3HOYG 2EOTA 2B3GA 2R7FA 3U50C 4JYAL 4KK7A 1A8VA 2PMZE 2NVXH 4JI6Q 2MFIA 4A3KH 5J22A 3Q8DA 3TS2A 3X3NA 3T1HL 3OIPA 3AMUA 2JA5H 1D1KA 1QWYA 3GTOB 4LFBQ 1IBKQ 4OHJA 4DV1L 1BO0A 1B8AA 4LF7L 3UDIA 1EIFA 2KECA 4PG3A 1EFWA 1Q46A 4YY3Q 4P73A 1SNCA 2BA1A 4A3MH 1VQIA 4DNTB 3UE0A 5D14A 2M00A 3NTHA 1FJGL 4JI4Q 1B44D 4POFA 3PCOB 2EJMA 2ALYB 2B2YA 1CHQD 2XNAC 1S5DD 1KTKA 5M3FH 2K05A 4X66Q 2YTYA 5IP7H 2VW9A 3P7JA 1F9SA 4C2MH 3J80c 3PV0A 1V9PA 4OO1G 4JI1L 3LGJA 1MD2D 2YTVA 4A76A 4QUFA 3MC0B 4L6TB 3HOXG 1HHVA 3TMEA 2JSOA 2F0EA 3Q23A 3MXNA 4JI8Q 4X62Q 5G3LF 2EYFA 1E3PA 1JB7A 1EQVA 2A6HC 1GD7A 2PO4A 5C3EH 3S1QH 2SNMA 1GUOA 2DUDA 1W2BA 3K5OA 1J5EL 1Z47A 3IRBA 3FHWA 3GTKB 2JA8H 2Z4IA 2K4KA 1ONLA 3R8BA 1VS0A 1PH5A 2R93B 2RSOA 1BCPC 1RIPA 2R92H 2R7ZB 4BY7B 1E1OA 2FINB 1SR3A 3I72A 2B2TA 5LMNL 3CRKC 4BXXH 4Q5VA 4DR1L 3KDFB 5E1FA 2IX3A 3OTOQ 2VNUD 4A3IH 2J0TD 3H91A 2I46A 3FPUB 1A3VA 3K7AB 4J8QA 1LM0A 5J1ZA 5K5PA 3NWTA 1N36Q 5BN4A 1BR9A 4H02A 4JBJA 1HTLD 4FF3A 3GO5A 2AMCB 2I0QA 4NXMQ 3NXWA 1A0IA 1D8LA 1JCKB 5CV9A 2ZXPA 1BBWA 4QF4A 3K5LA 2Q2UA 1TT2A 3K5NA 1SN8A 4DR3Q 4A3KG 4DAMA 4P2CB 5C44H 5CC4A 3HP3A 2JA5G 3L0OA 4NP5A 3UDGA 2RVLA 3EBEA 4KY7A 1L1OA 4LJZC 4HJ5A 4IFDJ 1D7QA 1HFNA 5E4XA 1XNQL 1YNJD 3RLFA 4A3MG 2ENBA 3TQYA 2NN6H 2BDNA 4L5TA 4KTAA 2A1AA 1G51A 1Y1WB 2L9HA 1PH1A 1HNXL 4WJ3M 1VQOA 2RKSA 4RH6A 3UDFA 1RF2D 4PZ8A 4DXGA 5M3FG 2WKCA 1AW7A 1C9OA 1XPRA 4LF9L 2BE5C 5IP7G 2PCFB 1VMCA 4JI3Q 1SRUA 2PI2A 2UUCQ 4IPHA 3GTMH 1X65A 3SHLA 3GDEA 1JWUD 3OSOA 1UEAB 4KKUA 3V96A 1KNEA 4K6DA 5C5LA 1QB5D 4IFDI 2CCZA 1F2ZA 2IHEA 1HH2P 4DV5L 4HCSA 4M8AA 1STYA 3QWNA 1N9WA 4NXNQ 2JYOA 1JJGA 3M4QA 4MIUA 1LTAD 5C3EG 3E9IA 1S5FD 2JP1A 4OEMB 5DM63 2I5HA 1K0RA 1ZYRC 3MHBA 2LXKA 4YIJA 1XMOQ 3DMUA 5KNDA 1A15A 4QY7A 2F3WA 3RN5A 4ZUJA 4JI2Q 3X3MA 2F0KA 2JA8G 3LNNA 2E2IB 4RFBA 2HT1A 1LTID 4LF8L 1XJVA 3NELA 1STEA 4G7OC 2NUCA 3F2BA 4LF5L 3I4MH 1B1ZA 4JI0L 4X6AH 4B9WA 1CZGA 2ZXRA 1LTGD 3TP7A 4L5SA 4BXXG 4RGTA 4JOIC 1C0AA 1RTNA 1FVIA 3M3YH 2N49A 3EQLC 2E2JH 2UUBQ 1JICA 2D0OA 4GOPC 4OONA 3BS1A 1L0YB 3A8IE 3PIPA 3GTGB 3ULPA 3FKIH 3PIP3 4A3DG 4HAEA 3PUWA 2IW3A 2H4OA 3TP5A 1XX8A 4QIWE 5C4ZA 5IT9L 4LF9Q 4DF7A 3DWAA 4DR4L 4A3JH 3R93A 2G9DA 1PLFA 1YVCA 4YCVA 1X55A 5C44G 1DOLA 1TWHH 5JPMC 4DUZQ 1LACA 1EQRA 1RL2A 1YBYA 2EVBA 1CKMA 3K0XA 3VA5A 1PFNA 1H9JA 4LWCA 1JT8A 4JW0A 5JVG3 2JA7H 1KRTA 3PF5A 4V0BA 3SDZA 2UXBL 2NN6G 5IYCH 1HZBA 1EY7A 2A74C 4BBSH 1WTPA 2K6AA 2QW7A 1UE5A 1WTRA 2BH8A 3I90A 3U4ZA 1WTWA 4UP8A 1SE3A 2PYKA 5GROA 2KENA 1WTHA 4V190 3KFUA 5CV7A 1AH9A 1F9RA 1SMXA 4BS9A 3A0JA 1BBXC 1WTQA 3AQQA 3NBHA 4LF5Q 1P8LA 1N34L 1HCZA 4GOPB 2R61A 3OPOA 1SDFA 2O5IC 1I4PA 1M8AA 2BDOA 4Y7NH 5FLXE 5IE8A 1EU4A 1STAA 2RBMA 2FFKB 1PZKD 1SLJA 4BY1B 4NDXA 1B3QA 3QOLA 5T1IA 4IJHA 4K14A 2WKDA 4XQNA 1R9TB 3S1MB 1PH8A 2UXDL 1WTVA 3CCUA 3H94A 1B7YB 3W5OA 4MNOA 2L1BA 2DJFC 3M4OB 4DV7Q 1EEFD 2C9OA 1H9KA 3C2PA 1YIJA 4JV5Q 4ZQ3A 1VQLA 4LAAA 3DWPA 3PF4A 1UE6A 2K5HA 3J7AV 1VQMA 4K5VA 1YNJC 2HHHQ 4B3TL 1M90C 3M4PA 3ONAB 3GTOH 2G9HD 3C46A 2PZWA 5BN3A 5CMDA 4PMBA 1ICFB 2AHOB 3FKIG 4QMGA 4J1MA 2NZHA 3H0GB 2E2DC 4JBKA 4XIGS 3QO2A 4KHVA 5JJKA 2KOLA 2A68D 5HGQA 5KNCA 2JEAI 4XT3B 4APVA 1NUCA 3E6ZX 4RWSC 1I4QA 2JJQA 1BQQT 2EJFC 3DM1A 2NWGA 4KN7C 1L1OB 3FMCA 4A3JG 4KKTA 2CHBD 3D4DA 3HOVB 1ASYA 1N33L 2I07B 4FP5D 1WTOA 1RKNA 5HY6A 3MAQA 1UNSA 1A2TA 3A8JE 5NUCA 2LSSA 1JC7A 3RR5A 4U68A 4X3UA 3W1GA 3S9WA 5IT9c 2EQSA 1QCBD 3C3LA 1YI2A 2NVYB 1SE4A 3BJUA 3N52A 4B9XA 4PZ6A 2F0QA 3QJYA 3VYSA 3QB3A 1FD7D 5M5XB 4ZKCB 1I3QB 2MO1A 2LS01 4BA1I 1SYFA 4A3BG 2VUMG 1HA6A 4CKBA 1UUPA 1B50A 3RUZA 3I4NB 1E2ZA 4HIMA 5CV8A 3GTKH 4TVAB 5DM73 1KABA 3BZCA 2R93H 1ZXTA 1AP0A 2CWAA 2R7ZH 3E3XA 3PGZA 2ZM6L 2B63G 4B3MQ 4N8X1 4DUYQ 4BY7H 3DUZA 1S5CD 3TZUA 2E75C 2ZJPA 3D0FA 2A69D 3BYTB 3G48A 4HN7A 4HR7B 4LNQA 1VQBA 4A3EB 1XPUA 1GVPA 1EIHA 4CDEC 1I5FA 1SNOA 1STGA 1IKLA 2EJGC 1K8GA 1HNZL 3K7AH 5IP9G 3U4VA 1LLRD 2QA4A 3E5SA 3KYHC 2EY5A 2F4IA 3SK6A 1I94Q 2RCNA 4U673 3MWYW 1LTSD 2UUAL 3CPWA 1Y14B 2K33A 2N8NA 4GLVB 5JJZA 1RHPA 4KHZA 1KHIA 4A3CG 1BKBA 4M1UB 2RQXA 2Z9HA 1QVGA 1YNNC 3TEHB 3GV3A 3CCJA 1IHZA 1SBBB 2K1BA 2EYMA 5FK9C 4OGQC 3R2IA 1B9MA 4KLKA 2HCCA 2OEOA 4LUVA 2LY7A 3KOJA 2YU9B 4EQOA 4IALA 4CKEA 1B53A 1JB3A 5IGCA 5E3FA 4AH6A 1SAPA 2C5CA 2RHSB 1Y1WH 2B29A 1HA5A 1OXXK 4UP7A 3A7AB 2BH2A 1LTLA 1FNUA 1S5ED 2H1EA 3KLSA 3SGIA 1HTPA 2HDLA 4L63B 4DK0A 1XTDA 3MTSA 3GTJB 5KIXA 1EU3A 1Q1EA 5AFWA 3ULJA 1VQ6A 1QVCA 4J15A 1L2FA 2KCNA 1EYCA 1OXUA 3CP0A 4LF4Q 2L11A 4CJ0B 1QOHA 4A3GB 3IFTA 2NYZD 4O0AA 3H6MA 3H09A 4NW2A 3K81C 4F8MA 4K2LA 4RKLA 3A54A 1X3QA 2PZTA 4DV4Q 5M5WB 1XPOA 1ESFA 4BBRB 4X64L 3MA2B 1A62A 2KJXA 3NTIA 4HJAA 1MSHA 1EYAA 4K2KA 5ELNA 4DR7Q 3CCQA 1CUKA 3QOJA 2HCIA 3AEVA 2NTSA 2EY1A 1JR0D 2RDFA 5ELEA 5DEHA 3T53B 1LV9A 2E2IH 2WAQB 1GUTA 4OX9Q 2R93G 5KRUA 1MSGA 2R7ZG 3NTKA 5EKLA 4BY7G 1FR3A 2CW0D 2GVBA 4IFDH 2Y0SB 3TDQA 2B2WC 1D5XC 4A4IA 2X6LA 1N8RC 2SNSA 1Z7TA 1PRTB 2ZTDA 3LWUA 3HOZG 5CYUA 4MZ9A 4LW1A 1ASZA 3S17B 5FLMG 2X69A 1CFMA 4HJ8A 2KHIA 5IY0A 4P75A 3GTGH 4Z9CB 2QGQA 1NCVA 1HRJA 4X3TA 3J81L 4YWLA 3CRLC 2EIFA 1PH4A 2EE1A 1RTOA 2VQEQ 3STBC 1MJCA 2ZTEA 3CKIB 4UPAA 5JJLA 3NQIA 2I5MX 1MHWC 5CV5A 5FJ8H 1PH3A 2O2LD 2F3IA 1BVSA 2PW7A 3N6RA 2F03A 3EA6A 2OTJA 5JJIA 3KF8B 3D8GA 3QG1A 1SYBA 2E8GA 2N78A 1LYLA 4KY5A 1SNDA 4IUPA 1PTOB 3OW2A 1IXRA 2XGTA 1Y1WG 1KDBA 2F4VL 2WV6D 3PO2B 3TP8A 2Y0SE 5KNBA 4UAIA 1B2TA 1LO5D 2TMPA 4G4KA 2XWJB 4OWWB 3OMCA 4EX5A 2L55A 1AFPA 2F52A 4JI5L 3EN2A 1EY5A 1TS3A 4YWKA 2EYHA 5IIFA 2A69C 5AJ3L 2RSNA 3A8KE 2NVTB 4QGUA 1SYDA 4B3RQ 2F0SA 2EYLA 2K32A 4C3JB 1H9MA 1V1PA 2CQOA 3T56B 4AYBB 4LF6L 4R4TA 4YCWA 2G5DA 1Q82C 4BY1H 2M2LA 2PQEA 1EL0A 2F1MA 1LABA 5EKKA 2E74C 1JQYD 1ML0D 2WFWA 3I7FA 4IZ8A 1R9TH 1I4HA 3S1MH 1O7YA 3I4OA 1Q1BA 3DWQA 1JOKA 1MI2A 3M4OH 3VYTA 3MEFA 5ELBA 4B3SQ 4IFDG 4JK1C 1X6OA 4HMJA 4WRDA 4TSSA 1NJIC 3EJIA 3D31A 1BCPF 1R4QB 2JA6B 1K0SA 1X54A 5C0XJ 2SDFA 4H13C 5FOBB 1TKWB 1WVLA 3H0GH 1IBLQ 3IAYA 5CORA 2JK8A 3OMGA 4GNXC 4DFAA 3OWFA 2ATWA 3K5MA 1N32L 5EGTA 1EY0A 4JG2A 1YJ9A 4FYDA 3CCRA 1YITA 1IL2A 2KBNA 3H15A 1XNRQ 3HOVH 2ID0A 2Z6KA 3J81c 1HR0L 3EROA 2KVMA 1CQFA 4AYBE 4TKOB 5IOCA 1EWIA 3NP8A 4DU9A 1QUQA 4Y52H 1K8AC 3MFGA 4JYAQ 5E7NA 5C0XI 1AZQA 4EQ5A 1G91A 1I6VC 5A2QL 3F2CA 1JOQA 2NVYH 1HUNA 1J9OA 1WI5A 3T1HQ 3Q0AA 1AEXA 4KHPL 5M5YB 1I4GA 2D0PA 5T1GA 3VR2A 4C3IB 5M5XH 4DV1Q 2VY3A 1I3QH 3KJOA 5I6WA 4DV6L 4LF7Q 3ZJYC 4DV0L 4DR2L 4PV1C 3KF6B 4KN4C 1F2YA 4IJLA 4UHVA 1Y8OB 1UE7A 3I4NH 1FJGQ 3DXJC 3K0YA 2CW0C 5EKIA 1SNPA 1TS2A 3I2ZA 4HMIA 2XRSD 2Z4HA 4RGNA 4HJ9A 3MVVA 1VQCA 4JI1Q 4DV3L 1EZ6A 1SYGA 3HG9A 4A3EH 1V1OA 3NSWA 4P74A 4BY1G 3S2HB 2ZXOA 4GNXB 1CHPD 1E22A 1HNWL 5FO9B 2E5LL 2PZUA 3K8AA 4MTNA 5H1SE 1U5KA 1BOSA 4DKAC 5IYBH 4XXEA 1H9SA 3J80E 2RDGA 2MGSA 4R4QA 3K58A 1JE5A 5I2YA 2ZJQA 2P5ZX 2ICIA 1ICWA 1J5EQ 2IX1A 1OTCA 1YHQA 1DOMA 3K80C 3HOUB 2K5QA 1IYUA 4DV2L 1SMYC 2WB1B 1RCVD 3HZXA 3J7AF 4GS3A 2L0CA 2Z8LA 2L5TA 1SYCA 1FYCA 3OW7A 3S1RB 5LMNQ 1HPCA 1LTBD 2L4NA 1AE2A 3H0GG 2YU9H 5LMUL 4HEDA 2F3VA 4ZYSA 4DR1Q 3F2DA 2VZAA 1EOTA 1TVXA 4CJ2C 3G6EA 1ESRA 2B2YC 3K57A 2K28A 1SNMA 5BR8L 1PFSA 3DEPA 3S24A 4R8NA 2EYJA 3BVMA 3GTJH 1PA6A 4Q0FA 1TU2B 4XDXA 2L12A 4F7XA 4IUVA 3PUYA 2ZT9C 1KC8C 3I4LA 3QIAA 1F2LA 4GLXA 1VQ8A 1YEZA 2R92G 4YWMA 1CT1D 3G71A 4A3GH 2MNAA 1II3A 4K5WA 3VYRA 1VQ9A 4TRDA 3KLRA 1VMPA 2A6ED 1T5EA 2QDLA 1KQSA 4AQYL 1WJJA 5M5WH 5C4JB 4WJWA 5LL6X 3IL8A 4DNRB 4O2DA 4BBRH 2IWHA 4A3IG 5L37A 5C5MA 1U4RA 2B8FA 1GO3E 3F2UA 1A3TA 5EAYA 1XNQQ 2R3ZA 1JORA 5I9OA 3RZOB 1GUSA 3BU2A 2F0FA 2WB1E 5C3WA 1KXLA 1AN8A 2J7ZA 1HNXQ 2VQFL 2LMCB 3CF5A 4CDCC 2EYOA 1V1PB 2B2TC 2QDBA 1DD2A 3I73A 3W1BA 4LMQD 3JAMi 1O80A 1SE8A 4A3EG 1YNND 3S17H 4HCEA 1G6ZA 1ET6A 2A19A 4DV5Q 2UU9L 4GKJL 1L0WA 2JE6I 4X3KA 4X65L 3AB9A 3BDCA 1TS5A 1EZ8A 4DAYA 4JI7L 1HZ9A 4NPSA 1UAPA 1PRTD 1TWCB 1CTMA 5CV6A 3PUVA 5KYIA 1VQJA 1E2VA 4A3FB 3A5UA 4HIDA 2NZ1D 5D65A 3MXNB 1IBML 2B8GA 3KJPA 2F0HA 2K5VA 1IZ6A 3NHHA 4LF8Q 1L1OC 1Y8PB 5GQOA 4GN3B 1GHKA 2O5JC 3CMAA 1Q3LA 4K8IA 3LWEA 1E1TA 2PNHA 1DJRD 2TSSA 1DM0B 4JI0Q 2B39A 3TS0A 3HKZB 2IT1A 1VQEA 2FJ2A 5IGBA 1PTOH 2VL6A 1F77A 4GLAC 2A8VA 1Z9FA 4C1NK 3P1HA 3D6WA 1Y69U 1YNXA 3PO2H 4RA8A 2XWBB 1I6HB 4DK1A 1K9MC 2R7DA 4ZRZA 1X9NA 3T1YL 1PTOD 1RJTA 4XTCS 4CKCA 1CZWA 4BWGB 1VQDA 4ZUIA 3Q22A 3CCMA 2F0MA 4K6LA 1NMFA 1PFBA 4A3GG 2VS1A 2K04A 3I4MG 4DR4Q 2GVAA 2HIVA 4CJ1B 2NVTH 5FO8B 1TY0A 4C3JH 1CSPA 4BBRG 5J39A 2OWOA 3HRZC 5K36H 3A74A 4N8FA 3JAML 2ES2A 3NWSA 3PUXA 1D1IA 1ILQA 2UXBQ 3S14B 1B4OA 5FKAC 1M1KC 4I65A 2JQOA 2FMCA 2B2UC 2RDHA 4MHEA 2OF1A 2F0GA 4HIKA 4K0KL 3MXPA 3RZDB 5ELOA 4FF1A 3HKZE 1KDAA 3TBIB 1KD1C 5IODA 1PZJD 4QQBX 2Y0SG 1EWHA 3QR8A 3STBD 1AZPA 3VR4A 3I91A 2NB0A 4C1NI 3ITPA 2JA6H 2CH4W 2JA7G 2F0UA 1GM5A 1HZCA 3VA7A 1N34Q 1GKHA 1LT6D 4GZYC 5IYCG 2F0JA 2N3SA 4IPDA 3OOCA 1K73C 3HS0C 1HFGA 4BBSG 3J81j 1CI3M 3CQZB 5JEAJ 2K14A 2OQ0A 4ZAIA 1TWFB 3UDXA 1SFOB 1DXMA 1KAWA 2KA7A 3RD4A 4PZ7A 2EPBA 2E2HB 1PXUA 2UXDQ 2K75A 4KKSA 1F2MA 1K83B 3NK9A 2NVQB 2A6EC 2XIWA 1LUZA 1VQ7A 1EYGA 1YJWA 3F1ZA 5IWAL 1IW7D 1STBA 3CD6A 1WCMB 4ILWA 5HGTA 5M5YH 4A3DB 4B3TQ 3TN2A 2J4XA 1WD1A 3EFXD 4C3IH 5JOBA 3PO2G 3SK8A 3CPFA 1CKNA 5CBAE 3TP6A 2CVRA 1JWSD 3FPPA 2Q2HA 1GUGA 2JEBI 5ELCA 3PO3B 2B2VA 2F0OA 2UXCL 1NR4A 3I3CA 1PVOA 1E0BA 2CQAA 1U0LA 3FEWX 1CKOA 5C0XH 2MQHA 2AUJD 1N33Q 3J80i 3JC66 4C3HB 1KAAA 5IGEA 1CA5A 1Q8KA 3HOWB 2PI2E 4AYBG 4WJ4A 1VQKA 4A3LH 2EY2A 3S2HH 1TR5A 1D2BA 1PRTC 4XYOA 1X3EA 1Y8NB 1KLUD 3RNUA 1QZGA 3MZ5A 5J3BA 5BN5A 1PH6A 2I5LX 1A3UA 3R2TA 3M85A 4R4IA 1LTTD 2GA4B 3JAMc 4DR5L 3VDYA 1ENFA 3W3AA 2IPKD 5IT9E 1FGBD 3HOUH 4EGVA 4LFAL 2K5DA 1PHJA 2JA6G 2X6GA 2ZM6Q 5COYA 2K03A 1JJ2A 4I7AA 3S1RH 1B3AA 2N88A 2OCEA 5EJWA 1YHBA 4ALPA 4DR6L 1NE3A 4B08A 3BVZA 3KDFA 2Q8RE 3B6YA 2K5WA 3T51B 4KV6A 1PTOC 2CWPA 1HNZQ 3P20A 2M9VA 2OTLA 3ERSX 3NBHB 1X3FA 2C35B 1PH9A 1JWMD 1BXTA 3GP7A 5EBCA 2UUAQ 1G2SA 1V8QA 4F87A 1TS4A 4YHHL 1SJED 2KUMA 3IFDA 5C3XA 4ZCKA 4PMWA 5C4HA 1P16A 3RLNA 2CFMA 2XTIA 1EY8A 4FF2A 5M9OA 4LFCL 5C4JH 3NUCA 2LFNA 4C3IG 5ELFA 1ZKOA 3KUPA 1NAPA 4R8IA 4RHSA 4OWTB 1DYQA 4RMFA 1XYIA 4H44C 1G6PA 4JI6L 4XYQA 3RZOH 2Z0SA 1MJEA 3LX0A 4FXDA 5EPLA 1FL0A 1NMGA 1FNWA 1W6JA 4JC0A 1T5XD 2DNEA 4FXKC 4IQZA 4DR5Q 5C0XG 1LT4D 5LL6S 4LFBL 2K7VA 1IBKL 4ULLA 3FP9A 2PMZB 4YY3L 5LMNW 3I8ZA 2HIXA 1O78A 2VXWA 4JI4L 1SMYD 5GAEC 3CMEA 3U58A 1TY2A 3ND8A 1KDCA 1RODA 4L5RC 2WAQE 4A3BB 4X66L 2VUMB 3DLLA 4X64Q 3CCEA 3IKJA 1OO9B 1TWCH 3E0EA 3SEBA 3CC7A 1DGSA 3NQTA 4H7BA 4A3FH 4H0LC 1UWVA 3MEHA 5M3MB 4A93B 2B63B 2F0IA 3R3OA 1NY4A 4JI8L 4X62L 4MN3A 2WB1G 1IW7C 1PYSB 3AYHB 2Z1CA 4X3SA 3CC4A 1W3SA 5HURA 2F0WA 1K8MA 1ENCA 3L2PA 1KL9A 3GD7A 3RLOA 3A5ZB 4EVOA 3U9OA 1HQRD 3A56A 4IUTA 2SEBD 1I6HH 4I7ZC 1PFMA 2KCMA 4ODGA 2QKIC 4O1NA 3VYUA 1J6QA 5CGKA 4YCUA 4LK1C 1QNKA 1K3BC 2AWOA 2QF7A 3BZKA 3T13A 2RF4A 3VR6A 1MIUA 1SSOA 3U9SA 5C4XB 1EWCA 3PIOA 1EEID 3CW2C 3OTOL 2KEDA 3PIO3 3KLWA 5KYLA 1KRSA 1EYDA 1CKNB 2IHFA 4QJFA 1STNA 1TQOA 1Z6HA 1N36L 5JVH3 3KLSX 4P72A 2DNCA 1UEBA 5E4WC 1JJCB 4K8JA 4OIJA 4NXML 1QILA 3W2DA 3S14H 1QJOA 4RG1A 1PYBA 1EQQA 4JPBW 1D6EC 4ID6A 3P75A 3SK5A 4DR3L 4CHTB 5KGUA 2F4VQ 4IURA 4FDBA 3RZDH 1G8ZD 3HFZB 3WDNA 2ICEC 2JA9A 4HSVA 5EPKA 1SROA 2ZTCA 5FJ8G 4JI5Q 1S3OA 5D3DA 5FLXL 2NTTA 1CQVA 2F0VA 1E24A 4JOIA 5AJ3Q 2HDMA 2KQ3A 3C1FA 4EQNA 3SE0A 4GOPA 4KMUC 1GUWA 4DGZA 3Q24A 3CQZH 4OELB 4LF6Q 4JI3L 2AQ3B 1EY9A 1MGSA 4UDUC 2UUCL 5KEEA 4A3FG 3KBXA 4PNYA 3CCSA 1TWFH 4O42A 3E0JA 2Q2IA 1SFOH 2CKZB 1QG7A 3DEOA 4RCOA 5ISRA 2ASBA 4BA2I 5I4DA 4R1JA 1TXYA 2IX0A 3CXCA 2E2HH 1RDPD 4G7ZC 4NXNL 2D5DA 3V05A 1WFQA 2K01A 2MO0A 2EXDA 1NTGA 1K83H 3OYYA 3CAMA 2NVQH 3OWEB 3HOZB 5IGGA 2IY5B 3HKZG 1J8IA 2OT2A 3BZDB 1EUJA 1WCMH 1XMOL 1Q7YC 3TZDA 4JI2L 4A3DH 4OL7A 1X3GA 3G4SA 3S15B 2HQLA 1F9PA 1NNXA 2F0TA 3L3OC 1XWEA 3PO3H 4ZK9B 3D4RA 3S1NB 1KIXA 2EYPA 3NBIA 1N32Q 2Z6BA 1A6XA 2QILA 1DCZA 1PV4A 1Y1VB 1B70B 4L8JA 4XQJA 2V4DA 2UUBL 1HR0Q 3GTQB 1C4QA
chains in the Genus database with same CATH topology
1SXTA 4WORA 2KHSA 1BF4A 1NSNS 3CU7A 5JAVA 3V2TA 5LHY1 2NBFA 1RD9D 5JEAH 1GOZA 2A5HA 4FF4A 2A73B 2YYZA 4DAVA 4ABNA 2PW5A 1BCPB 3BDLA 1Q8IA 3DHQA 3GTPB 3J81E 2VB2X 3ZYYX 3HOYB 1CK1A 1MBYA 1NR2A 2F0NA 5C6AA 1L0XB 2E76C 4QIWB 1QNUA 1H9RA 4OO1I 3SXHA 1B9NA 3GTLB 3S16B 3MXGA 1I4RA 4G7HC 1TWGB 1WD0A 2PNRC 3GV6A 3D4WA 3FDTA 1GHJA 3BVGA 1ZEQX 4R9WA 5DNFA 2B2UA 2EXZA 4FVMA 2D2CC 1TWAB 3S2DB 1V43A 1BUVT 3HOXB 3EVQA 3M7GA 1GXDC 4QCLA 1ENAA 3NE5B 4ME5A 4IUUA 2RA4A 3C1EA 3PMFA 2QCPX 4KY6A 1WTXA 1TIID 1PMRA 1FNVA 2MUYA 4DAPA 2JXMB 1I50B 3L9AX 2QEJC 1VF7A 3GQBA 4RGMA 1CA6A 1M4VA 1DONA 4FXGC 1K8OA 4C3HG 4CGYB 4XT1B 5I9PA 4HTHA 4JBWA 4J6HA 2F0DA 2XRQD 1LTRD 5JEAG 2AUKA 4NMZA 1E2WA 2BA0A 1G2TA 1Q90A 4RHRA 4HSPA 3HEJA 1OXSC 4RKBA 5EBDA 1I4XA 2NVXB 5IGDA 3M4YA 4A3KB 1HQMC 2PPBC 2JA5B 1JOOA 3NPPA 4EQPA 1S5BD 4K5XA 1O7LA 5A2QE 1LT5D 4IN3A 1JE4A 4A3MB 1ILPA 4IUNA 1EQTA 2D9UA 1LT3D 5M3FB 1SE2A 5D3IB 1CM9A 3CHBD 4C2MB 4KI0A 4KD3A 1IL8A 3PUZA 2AWNA 2HUGA 3D3RA 1U9RA 5EQ0A 1XXGA 1EY4A 5TSSA 1O7ZA 3I70A 4CBVA 1BDOA 3HGBA 3UI2A 1H9SB 5C3EB 4RGOS 3S1QB 3KF8A 4FO2A 4ZKBB 1U4MA 4S3SA 2VB3X 2O4XA 2JA8B 1SJHD 3URYA 1W6KA 3O13A 4IUQA 1XTCD 1QE6A 4G57A 2R92B 3MFYA 2XSCA 3WOEA 1F9QA 1KNAA 2R6GA 1VCIA 2DN8A 2B2WA 2MP1A 2AQ1B 4E6IA 3WOFA 1SNQA 1U4PA 1X32A 3VR3A 1GJXA 4A3IB 2Q8TA 2AQ2B 2KEEA 3D6CA 2NN6I 5FO7B 4QUCA 5I6YA 2BCOA 2LKVA 4DN4M 1PRTF 4DA2A 1OXVA 3BDOA 2SOBA 3MXUA 1G291 2WINB 2WP8J 3A55A 1ET9A 4N9PA 5C44B 5A35A 2DY7A 3BG3A 5F2DA 1EIGA 1D5MC 4N9TA 1D5ZC 3VR5A 1A2UA 5DAUA 4C3JG 1R4PB 5K36G 2DY8A 1Q12A 4KD4A 1HXYD 1EY6A 3BYYB 5CBEE 4PMCA 2IJ0A 4QB4A 5IGFA 5I2XA 5CV4A 4KJNA 3GTMB 1PTOF 3K6OA 3ND9A 3KBGA 1DZ1A 3L7ZC 2WIIB 1EFID 1PYWD 3SR1A 4FNFA 2KCCA 2A6HD 3SK4A 4XQQA 3H3VC 1GUNA 4NKLA 4F88A 5ELDA 1DOKA 3T16A 3T4AC 4OIKA 1VDZA 2F0PA 1OXTA 2EZVA 4RAUC 4WFN3 2XN9C 3I4MB 3G7LA 2F0LA 1BCPD 2BOSA 2FHTA 3Q6SA 4PQXA 3AU7A 1C48A 1C8CA 5G3LD 3M3YB 2E2JB 3K59A 2IL8A 1KLGD 3KK7A 3FKIB 3G6JB 5CR3A 3J80L 1PDQA 4KJOA 4RCNA 1STHA 3OIQA 2MPMA 3FRPB 1U4LA 3TSSA 4A3JB 2MHVA 4OO1H 1TWHB 3OHXC 1IYVA 2HQEA 5JPNC 2MJ8A 2JA7B 3J7YW 4DXFA 2A68C 4BBSB 1IKMA 3A7LA 3RMHA 2XVSA 3JAME 3M7NA 1VF5C 1BNZA 1S4ZA 2B2VC 1HUMA 3ERQA 2BE5D 1SYEA 4C56C 2EY6A 3SVMA 1SEBD 3FVQA 2N55A 4Y7NB 2WACA 1X3PA 2FMMA 2OXPA 1PZID 2D62A 5EPJA 4ZLTF 2Q8IB 2EDGA 4TQUS 1ZYRD 2EOTA 4KK7A 5J22A 3X3NA 3OIPA 3AMUA 1D1KA 1QWYA 3GTOB 4OHJA 1BO0A 2KECA 1SNCA 2BA1A 4DNTB 5D14A 2M00A 3NTHA 1B44D 2EJMA 2B2YA 1CHQD 2XNAC 1S5DD 1KTKA 2K05A 3P7JA 1F9SA 3PV0A 4OO1G 1MD2D 4QUFA 3MC0B 4L6TB 1HHVA 3TMEA 2JSOA 2F0EA 3Q23A 3MXNA 5G3LF 2EYFA 1EQVA 2A6HC 2PO4A 2SNMA 1GUOA 3K5OA 1Z47A 3GTKB 2Z4IA 1ONLA 3R8BA 2R93B 2RSOA 1BCPC 2R7ZB 4BY7B 2FINB 3I72A 2B2TA 3CRKC 4Q5VA 5E1FA 2IX3A 2VNUD 2J0TD 3H91A 2I46A 3FPUB 1A3VA 3K7AB 4J8QA 5J1ZA 5K5PA 3NWTA 5BN4A 1BR9A 1HTLD 4FF3A 3GO5A 3NXWA 1JCKB 5CV9A 2ZXPA 4QF4A 3K5LA 1TT2A 3K5NA 4P2CB 5CC4A 3HP3A 4NP5A 2RVLA 4KY7A 4LJZC 4IFDJ 1HFNA 5E4XA 1YNJD 3RLFA 2ENBA 2NN6H 2BDNA 4KTAA 1Y1WB 2L9HA 2RKSA 4RH6A 1RF2D 4DXGA 2WKCA 1AW7A 2BE5C 2PCFB 1VMCA 3SHLA 1JWUD 3OSOA 1UEAB 4KKUA 3V96A 1KNEA 4K6DA 5C5LA 1QB5D 4IFDI 1F2ZA 4HCSA 4M8AA 1STYA 3QWNA 2JYOA 4MIUA 1LTAD 1S5FD 2JP1A 5DM63 1ZYRC 3MHBA 4YIJA 3DMUA 5KNDA 1A15A 2F3WA 4ZUJA 3X3MA 2F0KA 3LNNA 2E2IB 4RFBA 1LTID 1STEA 4G7OC 2NUCA 1B1ZA 4B9WA 1CZGA 2ZXRA 1LTGD 3TP7A 4RGTA 1RTNA 3EQLC 1JICA 3BS1A 1L0YB 3A8IE 3GTGB 3PIP3 4HAEA 3PUWA 2IW3A 2H4OA 3TP5A 1XX8A 5C4ZA 5IT9L 4DF7A 3DWAA 3R93A 2G9DA 1PLFA 1DOLA 5JPMC 1LACA 2EVBA 3VA5A 1PFNA 1H9JA 5JVG3 4V0BA 3SDZA 2NN6G 2A74C 1EY7A 1WTPA 2K6AA 1WTRA 3I90A 1WTWA 1SE3A 2PYKA 4V190 5CV7A 1F9RA 4BS9A 1BBXC 1WTQA 3NBHA 1HCZA 2R61A 3OPOA 1SDFA 2O5IC 1I4PA 1M8AA 2BDOA 5FLXE 1EU4A 1STAA 2RBMA 2FFKB 1PZKD 4BY1B 4NDXA 3QOLA 5T1IA 4K14A 2WKDA 4XQNA 1R9TB 3S1MB 1WTVA 3H94A 2L1BA 3M4OB 1EEFD 2C9OA 1H9KA 3C2PA 4ZQ3A 4LAAA 3DWPA 3J7AV 4K5VA 1YNJC 3ONAB 2G9HD 3C46A 2PZWA 5BN3A 5CMDA 4PMBA 4QMGA 4J1MA 3H0GB 2E2DC 4XIGS 3QO2A 4KHVA 2KOLA 2A68D 5KNCA 2JEAI 4XT3B 1NUCA 3E6ZX 4RWSC 1I4QA 1BQQT 2EJFC 3DM1A 2NWGA 4KN7C 3FMCA 4KKTA 2CHBD 3D4DA 3HOVB 2I07B 4FP5D 1WTOA 1RKNA 3MAQA 1UNSA 5NUCA 1A2TA 3A8JE 1JC7A 4U68A 4X3UA 3S9WA 1QCBD 3C3LA 2NVYB 1SE4A 3N52A 4B9XA 2F0QA 3QJYA 3VYSA 3QB3A 1FD7D 5M5XB 4ZKCB 1I3QB 2LS01 4BA1I 1SYFA 1HA6A 4CKBA 1UUPA 1B50A 3RUZA 3I4NB 1E2ZA 5CV8A 5DM73 1KABA 1ZXTA 1AP0A 3DUZA 1S5CD 3TZUA 2E75C 2A69D 3BYTB 4HN7A 4HR7B 4A3EB 1EIHA 1SNOA 1STGA 1IKLA 2EJGC 1LLRD 3E5SA 3SK6A 2EY5A 2F4IA 4U673 1LTSD 3MWYW 2K33A 5JJZA 1RHPA 4KHZA 4M1UB 2RQXA 1YNNC 3GV3A 1IHZA 1SBBB 2K1BA 2EYMA 5FK9C 4OGQC 3R2IA 1B9MA 2HCCA 2OEOA 2LY7A 2YU9B 4EQOA 4IALA 4CKEA 1B53A 1JB3A 5IGCA 5E3FA 1SAPA 2C5CA 1HA5A 1OXXK 3A7AB 1FNUA 1S5ED 2H1EA 3KLSA 1HTPA 2HDLA 4L63B 4DK0A 3MTSA 3GTJB 5KIXA 1EU3A 1Q1EA 5AFWA 2KCNA 1EYCA 1OXUA 2L11A 4CJ0B 1QOHA 4A3GB 3IFTA 2NYZD 3H6MA 3H09A 4NW2A 4F8MA 4K2LA 4RKLA 3A54A 1X3QA 2PZTA 5M5WB 1ESFA 4BBRB 3MA2B 2KJXA 3NTIA 1MSHA 1EYAA 4K2KA 3QOJA 2HCIA 2NTSA 2EY1A 1JR0D 2RDFA 5ELEA 5DEHA 3T53B 1LV9A 2WAQB 1GUTA 5KRUA 1MSGA 3NTKA 5EKLA 1FR3A 2CW0D 4IFDH 2Y0SB 3TDQA 2B2WC 1D5XC 2X6LA 2SNSA 1Z7TA 1PRTB 3LWUA 5CYUA 3S17B 2X69A 1CFMA 4Z9CB 1NCVA 1HRJA 4X3TA 3J81L 3CRLC 2EE1A 1RTOA 3CKIB 3NQIA 5CV5A 2O2LD 2PW7A 3N6RA 2F03A 3EA6A 3D8GA 3QG1A 1SYBA 4KY5A 1SNDA 4IUPA 1PTOB 1KDBA 2WV6D 3PO2B 3TP8A 5KNBA 4UAIA 1B2TA 1LO5D 2TMPA 4G4KA 2XWJB 3OMCA 2L55A 1AFPA 1EY5A 1TS3A 2EYHA 5IIFA 2A69C 2RSNA 3A8KE 2NVTB 1SYDA 2F0SA 2EYLA 2K32A 4C3JB 1H9MA 1V1PA 3T56B 4AYBB 2M2LA 2PQEA 1EL0A 2F1MA 1LABA 5EKKA 2E74C 1JQYD 1ML0D 4IZ8A 1I4HA 1O7YA 1Q1BA 3DWQA 1JOKA 1MI2A 3VYTA 5ELBA 4IFDG 4JK1C 4HMJA 4WRDA 4TSSA 3EJIA 3D31A 1BCPF 1R4QB 2JA6B 5C0XJ 2SDFA 4H13C 5FOBB 1TKWB 1WVLA 3IAYA 5CORA 3OMGA 4DFAA 3OWFA 3K5MA 5EGTA 1EY0A 4FYDA 2ID0A 3EROA 2KVMA 1CQFA 4TKOB 5IOCA 3NP8A 4DU9A 3MFGA 5C0XI 1AZQA 1G91A 1I6VC 5A2QL 1JOQA 1HUNA 1J9OA 3Q0AA 1AEXA 5M5YB 1I4GA 5T1GA 3VR2A 4C3IB 5I6WA 4PV1C 4KN4C 1F2YA 1Y8OB 3DXJC 3K0YA 2CW0C 5EKIA 1SNPA 1TS2A 4HMIA 2XRSD 2Z4HA 4RGNA 3MVVA 1EZ6A 1SYGA 3HG9A 1V1OA 3NSWA 3S2HB 2ZXOA 1CHPD 5FO9B 2PZUA 1BOSA 4XXEA 1H9SA 3J80E 2RDGA 2MGSA 3K58A 5I2YA 2ICIA 1ICWA 2IX1A 1DOMA 3HOUB 2K5QA 1IYUA 1SMYC 2WB1B 1RCVD 3HZXA 3J7AF 2L0CA 2Z8LA 2L5TA 1SYCA 1FYCA 3OW7A 3S1RB 1HPCA 1LTBD 2L4NA 4HEDA 2F3VA 4ZYSA 1EOTA 1TVXA 4CJ2C 1ESRA 2B2YC 3K57A 2K28A 1SNMA 3DEPA 4R8NA 2EYJA 3BVMA 4Q0FA 1TU2B 4XDXA 2L12A 4F7XA 4IUVA 3PUYA 2ZT9C 3I4LA 3QIAA 1F2LA 1CT1D 1II3A 4K5WA 3VYRA 4TRDA 3KLRA 1VMPA 2A6ED 1T5EA 5C4JB 4WJWA 5LL6X 3IL8A 4DNRB 2IWHA 5C5MA 1U4RA 2B8FA 3F2UA 1A3TA 2R3ZA 1JORA 5I9OA 3RZOB 1GUSA 2F0FA 5C3WA 1AN8A 2J7ZA 2LMCB 2EYOA 1V1PB 2B2TC 2QDBA 1DD2A 3I73A 4LMQD 1O80A 1YNND 1G6ZA 4HCEA 1ET6A 2JE6I 4X3KA 3AB9A 3BDCA 1TS5A 1EZ8A 4DAYA 1UAPA 1PRTD 1TWCB 1CTMA 5CV6A 3PUVA 5KYIA 1E2VA 4A3FB 2NZ1D 5D65A 2B8GA 2F0HA 3NHHA 1Y8PB 1GHKA 2O5JC 1Q3LA 4K8IA 3LWEA 1DJRD 2TSSA 1DM0B 2B39A 3HKZB 2IT1A 2FJ2A 5IGBA 1PTOH 1F77A 4C1NK 3P1HA 3D6WA 1Y69U 4RA8A 2XWBB 1I6HB 4DK1A 4ZRZA 1PTOD 1RJTA 4XTCS 4CKCA 1CZWA 4BWGB 4ZUIA 3Q22A 2F0MA 4K6LA 1PFBA 2K04A 4CJ1B 5FO8B 1TY0A 5J39A 3HRZC 5K36H 3JAML 3NWSA 3PUXA 1D1IA 1ILQA 3S14B 1B4OA 5FKAC 4I65A 2FMCA 2B2UC 2RDHA 4MHEA 2OF1A 2F0GA 3MXPA 3RZDB 4FF1A 3TBIB 1KDAA 5IODA 1PZJD 1EWHA 1AZPA 3VR4A 3I91A 2NB0A 4C1NI 3ITPA 2F0UA 3VA7A 1LT6D 4GZYC 2F0JA 3OOCA 3HS0C 1HFGA 1CI3M 3CQZB 5JEAJ 4ZAIA 1TWFB 1SFOB 1DXMA 3RD4A 2KA7A 2EPBA 2E2HB 1PXUA 4KKSA 1F2MA 1K83B 3NK9A 2NVQB 2A6EC 2XIWA 1IW7D 1STBA 1WCMB 4ILWA 5HGTA 4A3DB 3TN2A 2J4XA 1WD1A 3EFXD 5JOBA 3SK8A 5CBAE 3TP6A 2CVRA 1JWSD 3FPPA 1GUGA 2JEBI 5ELCA 3PO3B 2B2VA 2F0OA 1NR4A 3I3CA 1E0BA 2CQAA 3FEWX 5C0XH 2AUJD 4C3HB 1KAAA 5IGEA 1CA5A 3HOWB 2EY2A 1TR5A 1D2BA 1PRTC 4XYOA 1Y8NB 1KLUD 3MZ5A 5BN5A 1A3UA 3R2TA 3M85A 1LTTD 2GA4B 1ENFA 3W3AA 2IPKD 5IT9E 1FGBD 4EGVA 2K5DA 2X6GA 5COYA 2K03A 1B3AA 2N88A 5EJWA 4B08A 3BVZA 2Q8RE 2K5WA 3T51B 4KV6A 1PTOC 3P20A 2M9VA 1JWMD 1BXTA 3GP7A 5EBCA 1G2SA 1V8QA 4F87A 1TS4A 1SJED 2KUMA 3IFDA 5C3XA 4PMWA 5C4HA 1EY8A 4FF2A 5M9OA 3NUCA 2LFNA 4C3IG 5ELFA 1ZKOA 3KUPA 1NAPA 4R8IA 4RHSA 1DYQA 1XYIA 4H44C 4XYQA 3LX0A 4FXDA 5EPLA 1FNWA 1W6JA 1T5XD 2DNEA 4FXKC 4IQZA 5C0XG 1LT4D 5LL6S 2K7VA 4ULLA 2PMZB 3I8ZA 1O78A 2VXWA 1SMYD 1TY2A 3ND8A 1KDCA 1RODA 4A3BB 2VUMB 3IKJA 1OO9B 3SEBA 3NQTA 4H7BA 4H0LC 3MEHA 5M3MB 4A93B 2B63B 2F0IA 3R3OA 4MN3A 1IW7C 2Z1CA 4X3SA 5HURA 2F0WA 1K8MA 1ENCA 3GD7A 4EVOA 3U9OA 1HQRD 3A56A 4IUTA 2SEBD 4I7ZC 1PFMA 4ODGA 2QKIC 4O1NA 3VYUA 5CGKA 4LK1C 1QNKA 2AWOA 2QF7A 3T13A 3VR6A 1SSOA 3U9SA 5C4XB 1EWCA 1EEID 2KEDA 3PIO3 5KYLA 1EYDA 1STNA 1TQOA 1Z6HA 5JVH3 3KLSX 2DNCA 5E4WC 4K8JA 4OIJA 1QILA 3W2DA 1QJOA 3SK5A 4ID6A 1D6EC 3P75A 4CHTB 5KGUA 4IURA 1G8ZD 3WDNA 2ICEC 4HSVA 5EPKA 5D3DA 5FLXL 2NTTA 1CQVA 2F0VA 2HDMA 2KQ3A 3C1FA 4EQNA 3SE0A 4KMUC 1GUWA 4DGZA 3Q24A 2AQ3B 1EY9A 1MGSA 4UDUC 5KEEA 3KBXA 4PNYA 4O42A 3E0JA 1QG7A 3DEOA 4RCOA 5ISRA 4BA2I 5I4DA 2IX0A 1RDPD 4G7ZC 2D5DA 3V05A 2K01A 3OWEB 3HOZB 5IGGA 1J8IA 2OT2A 3BZDB 3TZDA 4OL7A 3S15B 1F9PA 2F0TA 3L3OC 1XWEA 4ZK9B 3D4RA 3S1NB 2EYPA 3NBIA 1A6XA 2QILA 1DCZA 1Y1VB 4L8JA 4XQJA 2V4DA 3GTQB 1C4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STN A;  2EYJ A;  2F0P A;  1TQO A;  4WOR A;  2KHS A;  2PZW A;  5J1Z A;  5K5P A;  5IOC A;  1NSN S;  3NP8 A;  2PW7 A;  4PMB A;  3TP6 A;  4DU9 A;  4F7X A;  4QMG A;  4HTH A;  2OEO A;  4J1M A;  3V2T A;  5I9P A;  5JAV A;  3D8G A;  2F0D A;  4J6H A;  1SYB A;  4K8J A;  4EQO A;  2F0L A;  4IAL A;  4KY5 A;  4KHV A;  3NXW A;  1JOQ A;  4ZUI A;  4E6I A;  3LX0 A;  1SND A;  5CV9 A;  1SNQ A;  4NMZ A;  2F0M A;  1II3 A;  4QF4 A;  2F0O A;  1TT2 A;  4K5W A;  5C4Z A;  1NUC A;  5J22 A;  4DF7 A;  4TRD A;  3SK5 A;  4ID6 A;  1KDB A;  3P75 A;  1AEX A;  2PW5 A;  3BDL A;  5KGU A;  3DHQ A;  3D4D A;  5CC4 A;  3D6C A;  4NP5 A;  3TP8 A;  3HEJ A;  4KY7 A;  3TP5 A;  5I6W A;  1KAA A;  5IGE A;  2F0N A;  1RKN A;  5C5M A;  5C6A A;  5KIX A;  5J39 A;  4RKB A;  5I6Y A;  2LKV A;  1A2T A;  5NUC A;  3VA5 A;  1A3T A;  3OMC A;  5CR3 A;  1SNC A;  1F2Y A;  5E3F A;  1EYC A;  3S9W A;  2EY2 A;  4KJO A;  2ENB A;  1TR5 A;  2M00 A;  3SXH A;  5I9O A;  5IGD A;  1JOR A;  1STH A;  2F0F A;  1EY5 A;  2SOB A;  5C3W A;  3H6M A;  4KTA A;  2F0V A;  2EYH A;  4I65 A;  5IIF A;  1EY7 A;  1SNP A;  4F8M A;  4K2L A;  1KDC A;  4RKL A;  2KQ3 A;  4B9X A;  4HMI A;  3MZ5 A;  2RKS A;  3C1F A;  2EYO A;  2F0Q A;  4EQN A;  2PZT A;  1JOO A;  1A3U A;  2OF1 A;  2F0G A;  1SYD A;  3QB3 A;  2F0S A;  3MXP A;  4N9P A;  3MVV A;  2EYL A;  4EQP A;  3D4W A;  1KDA A;  2QDB A;  5IOD A;  4K5X A;  4DGZ A;  1EZ6 A;  1SYF A;  3NQT A;  1SYG A;  2HQE A;  4H7B A;  5F2D A;  1EYA A;  4K2K A;  4N9T A;  3TME A;  1EY9 A;  1A2U A;  5DAU A;  5KEE A;  3SHL A;  2F0E A;  3MEH A;  3QOJ A;  4PNY A;  2PYK A;  3OSO A;  3RUZ A;  2PQE A;  4IUN A;  2EY1 A;  5CV8 A;  2F0I A;  4K6D A;  3R3O A;  5EKK A;  2RDF A;  5C5L A;  5CV7 A;  1KAB A;  4KD4 A;  5ISR A;  3ITP A;  1F2Z A;  2EXZ A;  2PZU A;  2EYF A;  5DEH A;  2F0U A;  4IZ8 A;  5KRU A;  1EY6 A;  1STY A;  1EQV A;  3BDC A;  1EZ8 A;  1JOK A;  5EKL A;  2F0J A;  4MIU A;  2SNM A;  4PMC A;  2F0W A;  5HUR A;  5CV6 A;  4QB4 A;  1ENC A;  4KD3 A;  5IGG A;  5KYI A;  5IGF A;  3EVQ A;  1STA A;  2RBM A;  5CV4 A;  4EVO A;  1U9R A;  4KJN A;  2SNS A;  3MHB A;  4HMJ A;  4WRD A;  3U9O A;  4NDX A;  4YIJ A;  1EY4 A;  3DMU A;  3ERQ A;  4KV6 A;  3QOL A;  1SNO A;  2F3W A;  1ENA A;  3EJI A;  1STG A;  4ME5 A;  4ZUJ A;  2F0K A;  4K14 A;  1SYE A;  2F0H A;  5IGC A;  2EY6 A;  3NHH A;  3HZX A;  4OL7 A;  3C1E A;  3PMF A;  4ODG A;  3E5S A;  3SK6 A;  1SYC A;  2EY5 A;  1F2M A;  4K8I A;  4KY6 A;  3NK9 A;  2NUC A;  5CGK A;  2F0T A;  3SR1 A;  4ZQ3 A;  4S3S A;  4B9W A;  3T13 A;  3TP7 A;  3OMG A;  2F3V A;  4DFA A;  4LAA A;  3OWF A;  2WAC A;  5C3X A;  2EYP A;  5IGB A;  5E1F A;  3SK4 A;  5EGT A;  2OXP A;  5C4H A;  1STB A;  1EY8 A;  5HGT A;  1EY0 A;  4NKL A;  1SNM A;  5M9O A;  2O4X A;  3P1H A;  4K5V A;  3T16 A;  1IHZ A;  5KYL A;  1A3V A;  1EYD A;  2EYM A;  3NUC A;  4R8N A;  5JOB A;  5CV5 A;  3SK8 A;  3ERO A;  4G57 A; 
#chains in the Genus database with same CATH topology
 1SXT A;  4WOR A;  3WWV A;  4C3H H;  2KHS A;  1BF4 A;  3ER0 A;  1NSN S;  3HOW H;  3CU7 A;  4JBM A;  5JAV A;  3V2T A;  5LHY 1;  2NBF A;  1QVF A;  1RD9 D;  1Q86 C;  5JEA H;  1GOZ A;  1WYD A;  2A5H A;  1PH2 A;  4FF4 A;  2A73 B;  2YYZ A;  4DAV A;  4ABN A;  2PW5 A;  1BCP B;  3BDL A;  1Q8I A;  4KHP Q;  3DHQ A;  3GTP B;  3J81 E;  1VQF A;  2VB2 X;  3ZYY X;  3HOY B;  1CK1 A;  4DV6 Q;  1MBY A;  4DK6 C;  1NR2 A;  2F0N A;  5C6A A;  1L0X B;  4DUZ L;  4DV0 Q;  4DR2 Q;  3PQI A;  3HOV G;  2E76 C;  3ULL A;  4QIW B;  1QNU A;  1H9R A;  4OO1 I;  3SXH A;  1B9N A;  4POG A;  2H5X A;  1VQN A;  3GTL B;  3S16 B;  3MXG A;  1I4R A;  4DK3 C;  4DNI A;  4G7H C;  4LUZ A;  2YTX A;  1TWG B;  1WD0 A;  1S72 A;  2PNR C;  3GV6 A;  5DLQ E;  3D4W A;  4DV3 Q;  3FDT A;  3NEM A;  1GHJ A;  4JVZ A;  3BVG A;  5FLX c;  3DM3 A;  4A75 A;  1ZEQ X;  4R9W A;  5DNF A;  1HNW Q;  2E5L Q;  4CDF C;  2B2U A;  2EXZ A;  2Z6K C;  4FVM A;  2D2C C;  3I4N G;  1TWA B;  2OQK A;  3S2D B;  1V43 A;  1BUV T;  3HOX B;  1FGU A;  3EVQ A;  1Q81 C;  3K7U C;  3M7G A;  1GXD C;  4QCL A;  1ENA A;  1WCM G;  3NE5 B;  1A63 A;  4ME5 A;  4DV2 Q;  4IUU A;  2RA4 A;  1VQH A;  3C1E A;  3PMF A;  1PH7 A;  2QCP X;  4KY6 A;  1WTX A;  4UY8 C;  4DV7 L;  1TII D;  3NEN A;  4JV5 L;  1PMR A;  1FNV A;  5LMU Q;  2MUY A;  5IYB G;  3PO3 G;  4DAP A;  2JXM B;  1I50 B;  3L9A X;  2L15 A;  4IPG A;  2QEJ C;  1VF7 A;  1C7Y A;  5BR8 Q;  1VQA A;  3GQB A;  4RGM A;  1CA6 A;  1QZH A;  2HHH L;  1M4V A;  1DON A;  4FXG C;  1K8O A;  4C3H G;  4CGY B;  3HOW G;  4XT1 B;  5I9P A;  4HTH A;  2Q2T A;  1O7I A;  4JBW A;  4J6H A;  2F0D A;  2XRQ D;  3H3V H;  1LTR D;  5JEA G;  2AUK A;  4NMZ A;  1E2W A;  2BA0 A;  1G2T A;  4AQY Q;  3RN2 A;  1Q90 A;  4A3B H;  2VUM H;  4RHR A;  4HSP A;  3HEJ A;  4NB3 A;  1HZA A;  1OXS C;  1CSQ A;  4RKB A;  1QUQ B;  5EBD A;  3CCV A;  1YZ6 A;  5M3M H;  1I4X A;  3CC2 A;  2NVX B;  4A93 H;  5IGD A;  2B63 H;  3M4Y A;  2VQF Q;  4A3K B;  1HQM C;  2PQA A;  2PPB C;  2JA5 B;  1JOO A;  1IYJ B;  3NPP A;  4EQP A;  2RCF A;  3TRE A;  1S5B D;  4K5X A;  1O7L A;  1NBW A;  3I55 A;  5A2Q E;  1VQP A;  1LT5 D;  4IN3 A;  4IO9 A;  1JE4 A;  5IP9 H;  4A3M B;  1ILP A;  1AE3 A;  4IUN A;  4OWX B;  4CDD C;  1EQT A;  2D9U A;  2UU9 Q;  4GKJ Q;  4X65 Q;  1UE1 A;  1LT3 D;  5M3F B;  4B3M L;  1SE2 A;  4DUY L;  4JI7 Q;  5D3I B;  1CM9 A;  3CHB D;  4A3C H;  2K5N A;  4KI0 A;  2WAQ G;  4C2M B;  1T9H A;  4KD3 A;  1IL8 A;  3PUZ A;  2AWN A;  2HUG A;  3D3R A;  1U9R A;  5EQ0 A;  5C4X H;  1XXG A;  1EY4 A;  5TSS A;  1IBM Q;  1X56 A;  1O7Z A;  2K52 A;  3I70 A;  2RHQ B;  4CBV A;  1BDO A;  3HGB A;  1I94 L;  2FXQ A;  3UI2 A;  1H9S B;  5C3E B;  4RGO S;  3S1Q B;  3KF8 A;  2LXJ A;  1VQG A;  3EIV A;  4FO2 A;  4ZKB B;  1U4M A;  4S3S A;  1K3R A;  2VB3 X;  1S40 A;  2ZJR A;  2O4X A;  2JA8 B;  1SJH D;  3URY A;  1W6K A;  2V1C C;  3UE1 A;  3O13 A;  4IUQ A;  1XTC D;  1QE6 A;  2QEX A;  4G57 A;  4IOA A;  2R92 B;  3MFY A;  3T1Y Q;  2XSC A;  3WOE A;  1F9Q A;  1KNA A;  3TRZ A;  2R6G A;  1VCI A;  2DN8 A;  2B2W A;  2MP1 A;  2AQ1 B;  4E6I A;  1YJN A;  3WOF A;  1SNQ A;  4GKK L;  1U4P A;  1X32 A;  3VR3 A;  1GJX A;  4A3I B;  1YHA A;  2Q8T A;  2AQ2 B;  2KEE A;  2HD3 A;  4GN4 B;  3D6C A;  5IYD H;  2NN6 I;  4LUO A;  5FO7 B;  1V1Q A;  4HJ7 A;  4QUC A;  5I6Y A;  2BCO A;  2LKV A;  4DN4 M;  5GAH C;  1VQ5 A;  1PRT F;  2NZO A;  4DA2 A;  5M3M G;  4LF4 L;  2GN5 A;  1OXV A;  3BDO A;  2SOB A;  4A93 G;  3MXU A;  1G29 1;  2WIN B;  2WP8 J;  4K0K Q;  3A55 A;  1ET9 A;  4N9P A;  5C44 B;  5A35 A;  4DV4 L;  2DY7 A;  3BG3 A;  3HOZ H;  5F2D A;  5FLM H;  1EIG A;  1D5M C;  4N9T A;  2K50 A;  1D5Z C;  4DR7 L;  3VR5 A;  1A2U A;  5DAU A;  4C3J G;  1R4P B;  2KHJ A;  5K36 G;  2DY8 A;  1Q12 A;  4KD4 A;  4IPC A;  1HXY D;  4OX9 L;  1EY6 A;  3BYY B;  3S15 H;  5CBE E;  4PMC A;  2IJ0 A;  4QB4 A;  3S1N H;  5IGF A;  1HJP A;  5I2X A;  1K28 A;  5CV4 A;  4P71 A;  4KJN A;  3GTM B;  1PTO F;  1Y1V H;  5C4X G;  2CH4 A;  3K6O A;  3ND9 A;  3KBG A;  1DZ1 A;  3J81 i;  3L7Z C;  3GTQ H;  2WII B;  4L5Q A;  4JCV E;  1EFI D;  4DAY B;  4GKK Q;  1PYW D;  3SR1 A;  4FNF A;  2DJG C;  4R4O A;  2KCC A;  3AFQ A;  5IWA Q;  2A6H D;  2VQE L;  2KCT A;  3SK4 A;  3M9B A;  3I56 A;  3J7A 5;  4XQQ A;  3H3V C;  1XMQ L;  1GUN A;  4NKL A;  4F88 A;  5ELD A;  1DOK A;  3T16 A;  3T4A C;  3GTP H;  2JN4 A;  3HOY H;  4OIK A;  1VDZ A;  2F0P A;  1OXT A;  2EZV A;  3AFP A;  1E7Z A;  4RAU C;  4IOC A;  3KF6 A;  4WFN 3;  2XN9 C;  3I4M B;  2YV5 A;  3G7L A;  4MTK A;  2F0L A;  1BCP D;  3PSI A;  2BOS A;  4OXP A;  2FHT A;  3Q6S A;  3GTL H;  4PQX A;  3S16 H;  3AU7 A;  2UXC Q;  1C48 A;  1C8C A;  5G3L D;  3M3Y B;  2E2J B;  1TWG H;  3K59 A;  2AKW B;  2IL8 A;  5IYD G;  4R4C A;  1KLG D;  3KK7 A;  3FKI B;  3J7Z C;  3H3V I;  3G6J B;  5CR3 A;  3J80 L;  1PDQ A;  4HIO A;  4KJO A;  4RCN A;  4GN5 A;  4GNX A;  1STH A;  2PQA B;  3HKS A;  3OIQ A;  2MPM A;  3FRP B;  1U4L A;  1BBU A;  3TSS A;  1TWA H;  1MKH A;  4A3J B;  2MHV A;  1EOV A;  3S2D H;  1HR0 W;  4B3R L;  4OO1 H;  1TWH B;  5GAG C;  3OHX C;  3HOX H;  1IYV A;  2HQE A;  3E9H A;  4ME3 A;  4UP9 A;  5JPN C;  2MJ8 A;  1EIY B;  2JA7 B;  3J7Y W;  4LFA Q;  3F8T A;  4DXF A;  1VQ4 A;  2A68 C;  1JMC A;  4A3L G;  4BBS B;  1IKM A;  3A7L A;  3RMH A;  2XVS A;  5GAD C;  3JAM E;  4DR6 Q;  1WOC A;  1XMQ Q;  3M7N A;  1VF5 C;  4B3S L;  1BNZ A;  1S4Z A;  2B2V C;  1I50 H;  1HUM A;  3ERQ A;  1Y1V G;  2BE5 D;  4AIM A;  1SYE A;  4C56 C;  2EY6 A;  1H95 A;  3SVM A;  3HOU G;  3ICE A;  4YHH Q;  1SEB D;  3FVQ A;  1IBL L;  4QL5 A;  3CCL A;  2N55 A;  4Y7N B;  2WAC A;  1X3P A;  2FMM A;  2OXP A;  1PZI D;  2D62 A;  5EPJ A;  4ZLT F;  4LFC Q;  4DPG A;  2Q8I B;  2EDG A;  2DGY A;  4TQU S;  1XNR L;  1ZYR D;  3HOY G;  2EOT A;  2B3G A;  2R7F A;  3U50 C;  4JYA L;  4KK7 A;  1A8V A;  2PMZ E;  2NVX H;  4JI6 Q;  2MFI A;  4A3K H;  5J22 A;  3Q8D A;  3TS2 A;  3X3N A;  3T1H L;  3OIP A;  3AMU A;  2JA5 H;  1D1K A;  1QWY A;  3GTO B;  4LFB Q;  1IBK Q;  4OHJ A;  4DV1 L;  1BO0 A;  1B8A A;  4LF7 L;  3UDI A;  1EIF A;  2KEC A;  4PG3 A;  1EFW A;  1Q46 A;  4YY3 Q;  4P73 A;  1SNC A;  2BA1 A;  4A3M H;  1VQI A;  4DNT B;  3UE0 A;  5D14 A;  2M00 A;  3NTH A;  1FJG L;  4JI4 Q;  1B44 D;  4POF A;  3PCO B;  2EJM A;  2ALY B;  2B2Y A;  1CHQ D;  2XNA C;  1S5D D;  1KTK A;  5M3F H;  2K05 A;  4X66 Q;  2YTY A;  5IP7 H;  2VW9 A;  3P7J A;  1F9S A;  4C2M H;  3J80 c;  3PV0 A;  1V9P A;  4OO1 G;  4JI1 L;  3LGJ A;  1MD2 D;  2YTV A;  4A76 A;  4QUF A;  3MC0 B;  4L6T B;  3HOX G;  1HHV A;  3TME A;  2JSO A;  2F0E A;  3Q23 A;  3MXN A;  4JI8 Q;  4X62 Q;  5G3L F;  2EYF A;  1E3P A;  1JB7 A;  1EQV A;  2A6H C;  1GD7 A;  2PO4 A;  5C3E H;  3S1Q H;  2SNM A;  1GUO A;  2DUD A;  1W2B A;  3K5O A;  1J5E L;  1Z47 A;  3IRB A;  3FHW A;  3GTK B;  2JA8 H;  2Z4I A;  2K4K A;  1ONL A;  3R8B A;  1VS0 A;  1PH5 A;  2R93 B;  2RSO A;  1BCP C;  1RIP A;  2R92 H;  2R7Z B;  4BY7 B;  1E1O A;  2FIN B;  1SR3 A;  3I72 A;  2B2T A;  5LMN L;  3CRK C;  4BXX H;  4Q5V A;  4DR1 L;  3KDF B;  5E1F A;  2IX3 A;  3OTO Q;  2VNU D;  4A3I H;  2J0T D;  3H91 A;  2I46 A;  3FPU B;  1A3V A;  3K7A B;  4J8Q A;  1LM0 A;  5J1Z A;  5K5P A;  3NWT A;  1N36 Q;  5BN4 A;  1BR9 A;  4H02 A;  4JBJ A;  1HTL D;  4FF3 A;  3GO5 A;  2AMC B;  2I0Q A;  4NXM Q;  3NXW A;  1A0I A;  1D8L A;  1JCK B;  5CV9 A;  2ZXP A;  1BBW A;  4QF4 A;  3K5L A;  2Q2U A;  1TT2 A;  3K5N A;  1SN8 A;  4DR3 Q;  4A3K G;  4DAM A;  4P2C B;  5C44 H;  5CC4 A;  3HP3 A;  2JA5 G;  3L0O A;  4NP5 A;  3UDG A;  2RVL A;  3EBE A;  4KY7 A;  1L1O A;  4LJZ C;  4HJ5 A;  4IFD J;  1D7Q A;  1HFN A;  5E4X A;  1XNQ L;  1YNJ D;  3RLF A;  4A3M G;  2ENB A;  3TQY A;  2NN6 H;  2BDN A;  4L5T A;  4KTA A;  2A1A A;  1G51 A;  1Y1W B;  2L9H A;  1PH1 A;  1HNX L;  4WJ3 M;  1VQO A;  2RKS A;  4RH6 A;  3UDF A;  1RF2 D;  4PZ8 A;  4DXG A;  5M3F G;  2WKC A;  1AW7 A;  1C9O A;  1XPR A;  4LF9 L;  2BE5 C;  5IP7 G;  2PCF B;  1VMC A;  4JI3 Q;  1SRU A;  2PI2 A;  2UUC Q;  4IPH A;  3GTM H;  1X65 A;  3SHL A;  3GDE A;  1JWU D;  3OSO A;  1UEA B;  4KKU A;  3V96 A;  1KNE A;  4K6D A;  5C5L A;  1QB5 D;  4IFD I;  2CCZ A;  1F2Z A;  2IHE A;  1HH2 P;  4DV5 L;  4HCS A;  4M8A A;  1STY A;  3QWN A;  1N9W A;  4NXN Q;  2JYO A;  1JJG A;  3M4Q A;  4MIU A;  1LTA D;  5C3E G;  3E9I A;  1S5F D;  2JP1 A;  4OEM B;  5DM6 3;  2I5H A;  1K0R A;  1ZYR C;  3MHB A;  2LXK A;  4YIJ A;  1XMO Q;  3DMU A;  5KND A;  1A15 A;  4QY7 A;  2F3W A;  3RN5 A;  4ZUJ A;  4JI2 Q;  3X3M A;  2F0K A;  2JA8 G;  3LNN A;  2E2I B;  4RFB A;  2HT1 A;  1LTI D;  4LF8 L;  1XJV A;  3NEL A;  1STE A;  4G7O C;  2NUC A;  3F2B A;  4LF5 L;  3I4M H;  1B1Z A;  4JI0 L;  4X6A H;  4B9W A;  1CZG A;  2ZXR A;  1LTG D;  3TP7 A;  4L5S A;  4BXX G;  4RGT A;  4JOI C;  1C0A A;  1RTN A;  1FVI A;  3M3Y H;  2N49 A;  3EQL C;  2E2J H;  2UUB Q;  1JIC A;  2D0O A;  4GOP C;  4OON A;  3BS1 A;  1L0Y B;  3A8I E;  3PIP A;  3GTG B;  3ULP A;  3FKI H;  3PIP 3;  4A3D G;  4HAE A;  3PUW A;  2IW3 A;  2H4O A;  3TP5 A;  1XX8 A;  4QIW E;  5C4Z A;  5IT9 L;  4LF9 Q;  4DF7 A;  3DWA A;  4DR4 L;  4A3J H;  3R93 A;  2G9D A;  1PLF A;  1YVC A;  4YCV A;  1X55 A;  5C44 G;  1DOL A;  1TWH H;  5JPM C;  4DUZ Q;  1LAC A;  1EQR A;  1RL2 A;  1YBY A;  2EVB A;  1CKM A;  3K0X A;  3VA5 A;  1PFN A;  1H9J A;  4LWC A;  1JT8 A;  4JW0 A;  5JVG 3;  2JA7 H;  1KRT A;  3PF5 A;  4V0B A;  3SDZ A;  2UXB L;  2NN6 G;  5IYC H;  1HZB A;  1EY7 A;  2A74 C;  4BBS H;  1WTP A;  2K6A A;  2QW7 A;  1UE5 A;  1WTR A;  2BH8 A;  3I90 A;  3U4Z A;  1WTW A;  4UP8 A;  1SE3 A;  2PYK A;  5GRO A;  2KEN A;  1WTH A;  4V19 0;  3KFU A;  5CV7 A;  1AH9 A;  1F9R A;  1SMX A;  4BS9 A;  3A0J A;  1BBX C;  1WTQ A;  3AQQ A;  3NBH A;  4LF5 Q;  1P8L A;  1N34 L;  1HCZ A;  4GOP B;  2R61 A;  3OPO A;  1SDF A;  2O5I C;  1I4P A;  1M8A A;  2BDO A;  4Y7N H;  5FLX E;  5IE8 A;  1EU4 A;  1STA A;  2RBM A;  2FFK B;  1PZK D;  1SLJ A;  4BY1 B;  4NDX A;  1B3Q A;  3QOL A;  5T1I A;  4IJH A;  4K14 A;  2WKD A;  4XQN A;  1R9T B;  3S1M B;  1PH8 A;  2UXD L;  1WTV A;  3CCU A;  3H94 A;  1B7Y B;  3W5O A;  4MNO A;  2L1B A;  2DJF C;  3M4O B;  4DV7 Q;  1EEF D;  2C9O A;  1H9K A;  3C2P A;  1YIJ A;  4JV5 Q;  4ZQ3 A;  1VQL A;  4LAA A;  3DWP A;  3PF4 A;  1UE6 A;  2K5H A;  3J7A V;  1VQM A;  4K5V A;  1YNJ C;  2HHH Q;  4B3T L;  1M90 C;  3M4P A;  3ONA B;  3GTO H;  2G9H D;  3C46 A;  2PZW A;  5BN3 A;  5CMD A;  4PMB A;  1ICF B;  2AHO B;  3FKI G;  4QMG A;  4J1M A;  2NZH A;  3H0G B;  2E2D C;  4JBK A;  4XIG S;  3QO2 A;  4KHV A;  5JJK A;  2KOL A;  2A68 D;  5HGQ A;  5KNC A;  2JEA I;  4XT3 B;  4APV A;  1NUC A;  3E6Z X;  4RWS C;  1I4Q A;  2JJQ A;  1BQQ T;  2EJF C;  3DM1 A;  2NWG A;  4KN7 C;  1L1O B;  3FMC A;  4A3J G;  4KKT A;  2CHB D;  3D4D A;  3HOV B;  1ASY A;  1N33 L;  2I07 B;  4FP5 D;  1WTO A;  1RKN A;  5HY6 A;  3MAQ A;  1UNS A;  1A2T A;  3A8J E;  5NUC A;  2LSS A;  1JC7 A;  3RR5 A;  4U68 A;  4X3U A;  3W1G A;  3S9W A;  5IT9 c;  2EQS A;  1QCB D;  3C3L A;  1YI2 A;  2NVY B;  1SE4 A;  3BJU A;  3N52 A;  4B9X A;  4PZ6 A;  2F0Q A;  3QJY A;  3VYS A;  3QB3 A;  1FD7 D;  5M5X B;  4ZKC B;  1I3Q B;  2MO1 A;  2LS0 1;  4BA1 I;  1SYF A;  4A3B G;  2VUM G;  1HA6 A;  4CKB A;  1UUP A;  1B50 A;  3RUZ A;  3I4N B;  1E2Z A;  4HIM A;  5CV8 A;  3GTK H;  4TVA B;  5DM7 3;  1KAB A;  3BZC A;  2R93 H;  1ZXT A;  1AP0 A;  2CWA A;  2R7Z H;  3E3X A;  3PGZ A;  2ZM6 L;  2B63 G;  4B3M Q;  4N8X 1;  4DUY Q;  4BY7 H;  3DUZ A;  1S5C D;  3TZU A;  2E75 C;  2ZJP A;  3D0F A;  2A69 D;  3BYT B;  3G48 A;  4HN7 A;  4HR7 B;  4LNQ A;  1VQB A;  4A3E B;  1XPU A;  1GVP A;  1EIH A;  4CDE C;  1I5F A;  1SNO A;  1STG A;  1IKL A;  2EJG C;  1K8G A;  1HNZ L;  3K7A H;  5IP9 G;  3U4V A;  1LLR D;  2QA4 A;  3E5S A;  3KYH C;  2EY5 A;  2F4I A;  3SK6 A;  1I94 Q;  2RCN A;  4U67 3;  3MWY W;  1LTS D;  2UUA L;  3CPW A;  1Y14 B;  2K33 A;  2N8N A;  4GLV B;  5JJZ A;  1RHP A;  4KHZ A;  1KHI A;  4A3C G;  1BKB A;  4M1U B;  2RQX A;  2Z9H A;  1QVG A;  1YNN C;  3TEH B;  3GV3 A;  3CCJ A;  1IHZ A;  1SBB B;  2K1B A;  2EYM A;  5FK9 C;  4OGQ C;  3R2I A;  1B9M A;  4KLK A;  2HCC A;  2OEO A;  4LUV A;  2LY7 A;  3KOJ A;  2YU9 B;  4EQO A;  4IAL A;  4CKE A;  1B53 A;  1JB3 A;  5IGC A;  5E3F A;  4AH6 A;  1SAP A;  2C5C A;  2RHS B;  1Y1W H;  2B29 A;  1HA5 A;  1OXX K;  4UP7 A;  3A7A B;  2BH2 A;  1LTL A;  1FNU A;  1S5E D;  2H1E A;  3KLS A;  3SGI A;  1HTP A;  2HDL A;  4L63 B;  4DK0 A;  1XTD A;  3MTS A;  3GTJ B;  5KIX A;  1EU3 A;  1Q1E A;  5AFW A;  3ULJ A;  1VQ6 A;  1QVC A;  4J15 A;  1L2F A;  2KCN A;  1EYC A;  1OXU A;  3CP0 A;  4LF4 Q;  2L11 A;  4CJ0 B;  1QOH A;  4A3G B;  3IFT A;  2NYZ D;  4O0A A;  3H6M A;  3H09 A;  4NW2 A;  3K81 C;  4F8M A;  4K2L A;  4RKL A;  3A54 A;  1X3Q A;  2PZT A;  4DV4 Q;  5M5W B;  1XPO A;  1ESF A;  4BBR B;  4X64 L;  3MA2 B;  1A62 A;  2KJX A;  3NTI A;  4HJA A;  1MSH A;  1EYA A;  4K2K A;  5ELN A;  4DR7 Q;  3CCQ A;  1CUK A;  3QOJ A;  2HCI A;  3AEV A;  2NTS A;  2EY1 A;  1JR0 D;  2RDF A;  5ELE A;  5DEH A;  3T53 B;  1LV9 A;  2E2I H;  2WAQ B;  1GUT A;  4OX9 Q;  2R93 G;  5KRU A;  1MSG A;  2R7Z G;  3NTK A;  5EKL A;  4BY7 G;  1FR3 A;  2CW0 D;  2GVB A;  4IFD H;  2Y0S B;  3TDQ A;  2B2W C;  1D5X C;  4A4I A;  2X6L A;  1N8R C;  2SNS A;  1Z7T A;  1PRT B;  2ZTD A;  3LWU A;  3HOZ G;  5CYU A;  4MZ9 A;  4LW1 A;  1ASZ A;  3S17 B;  5FLM G;  2X69 A;  1CFM A;  4HJ8 A;  2KHI A;  5IY0 A;  4P75 A;  3GTG H;  4Z9C B;  2QGQ A;  1NCV A;  1HRJ A;  4X3T A;  3J81 L;  4YWL A;  3CRL C;  2EIF A;  1PH4 A;  2EE1 A;  1RTO A;  2VQE Q;  3STB C;  1MJC A;  2ZTE A;  3CKI B;  4UPA A;  5JJL A;  3NQI A;  2I5M X;  1MHW C;  5CV5 A;  5FJ8 H;  1PH3 A;  2O2L D;  2F3I A;  1BVS A;  2PW7 A;  3N6R A;  2F03 A;  3EA6 A;  2OTJ A;  5JJI A;  3KF8 B;  3D8G A;  3QG1 A;  1SYB A;  2E8G A;  2N78 A;  1LYL A;  4KY5 A;  1SND A;  4IUP A;  1PTO B;  3OW2 A;  1IXR A;  2XGT A;  1Y1W G;  1KDB A;  2F4V L;  2WV6 D;  3PO2 B;  3TP8 A;  2Y0S E;  5KNB A;  4UAI A;  1B2T A;  1LO5 D;  2TMP A;  4G4K A;  2XWJ B;  4OWW B;  3OMC A;  4EX5 A;  2L55 A;  1AFP A;  2F52 A;  4JI5 L;  3EN2 A;  1EY5 A;  1TS3 A;  4YWK A;  2EYH A;  5IIF A;  2A69 C;  5AJ3 L;  2RSN A;  3A8K E;  2NVT B;  4QGU A;  1SYD A;  4B3R Q;  2F0S A;  2EYL A;  2K32 A;  4C3J B;  1H9M A;  1V1P A;  2CQO A;  3T56 B;  4AYB B;  4LF6 L;  4R4T A;  4YCW A;  2G5D A;  1Q82 C;  4BY1 H;  2M2L A;  2PQE A;  1EL0 A;  2F1M A;  1LAB A;  5EKK A;  2E74 C;  1JQY D;  1ML0 D;  2WFW A;  3I7F A;  4IZ8 A;  1R9T H;  1I4H A;  3S1M H;  1O7Y A;  3I4O A;  1Q1B A;  3DWQ A;  1JOK A;  1MI2 A;  3M4O H;  3VYT A;  3MEF A;  5ELB A;  4B3S Q;  4IFD G;  4JK1 C;  1X6O A;  4HMJ A;  4WRD A;  4TSS A;  1NJI C;  3EJI A;  3D31 A;  1BCP F;  1R4Q B;  2JA6 B;  1K0S A;  1X54 A;  5C0X J;  2SDF A;  4H13 C;  5FOB B;  1TKW B;  1WVL A;  3H0G H;  1IBL Q;  3IAY A;  5COR A;  2JK8 A;  3OMG A;  4GNX C;  4DFA A;  3OWF A;  2ATW A;  3K5M A;  1N32 L;  5EGT A;  1EY0 A;  4JG2 A;  1YJ9 A;  4FYD A;  3CCR A;  1YIT A;  1IL2 A;  2KBN A;  3H15 A;  1XNR Q;  3HOV H;  2ID0 A;  2Z6K A;  3J81 c;  1HR0 L;  3ERO A;  2KVM A;  1CQF A;  4AYB E;  4TKO B;  5IOC A;  1EWI A;  3NP8 A;  4DU9 A;  1QUQ A;  4Y52 H;  1K8A C;  3MFG A;  4JYA Q;  5E7N A;  5C0X I;  1AZQ A;  4EQ5 A;  1G91 A;  1I6V C;  5A2Q L;  3F2C A;  1JOQ A;  2NVY H;  1HUN A;  1J9O A;  1WI5 A;  3T1H Q;  3Q0A A;  1AEX A;  4KHP L;  5M5Y B;  1I4G A;  2D0P A;  5T1G A;  3VR2 A;  4C3I B;  5M5X H;  4DV1 Q;  2VY3 A;  1I3Q H;  3KJO A;  5I6W A;  4DV6 L;  4LF7 Q;  3ZJY C;  4DV0 L;  4DR2 L;  4PV1 C;  3KF6 B;  4KN4 C;  1F2Y A;  4IJL A;  4UHV A;  1Y8O B;  1UE7 A;  3I4N H;  1FJG Q;  3DXJ C;  3K0Y A;  2CW0 C;  5EKI A;  1SNP A;  1TS2 A;  3I2Z A;  4HMI A;  2XRS D;  2Z4H A;  4RGN A;  4HJ9 A;  3MVV A;  1VQC A;  4JI1 Q;  4DV3 L;  1EZ6 A;  1SYG A;  3HG9 A;  4A3E H;  1V1O A;  3NSW A;  4P74 A;  4BY1 G;  3S2H B;  2ZXO A;  4GNX B;  1CHP D;  1E22 A;  1HNW L;  5FO9 B;  2E5L L;  2PZU A;  3K8A A;  4MTN A;  5H1S E;  1U5K A;  1BOS A;  4DKA C;  5IYB H;  4XXE A;  1H9S A;  3J80 E;  2RDG A;  2MGS A;  4R4Q A;  3K58 A;  1JE5 A;  5I2Y A;  2ZJQ A;  2P5Z X;  2ICI A;  1ICW A;  1J5E Q;  2IX1 A;  1OTC A;  1YHQ A;  1DOM A;  3K80 C;  3HOU B;  2K5Q A;  1IYU A;  4DV2 L;  1SMY C;  2WB1 B;  1RCV D;  3HZX A;  3J7A F;  4GS3 A;  2L0C A;  2Z8L A;  2L5T A;  1SYC A;  1FYC A;  3OW7 A;  3S1R B;  5LMN Q;  1HPC A;  1LTB D;  2L4N A;  1AE2 A;  3H0G G;  2YU9 H;  5LMU L;  4HED A;  2F3V A;  4ZYS A;  4DR1 Q;  3F2D A;  2VZA A;  1EOT A;  1TVX A;  4CJ2 C;  3G6E A;  1ESR A;  2B2Y C;  3K57 A;  2K28 A;  1SNM A;  5BR8 L;  1PFS A;  3DEP A;  3S24 A;  4R8N A;  2EYJ A;  3BVM A;  3GTJ H;  1PA6 A;  4Q0F A;  1TU2 B;  4XDX A;  2L12 A;  4F7X A;  4IUV A;  3PUY A;  2ZT9 C;  1KC8 C;  3I4L A;  3QIA A;  1F2L A;  4GLX A;  1VQ8 A;  1YEZ A;  2R92 G;  4YWM A;  1CT1 D;  3G71 A;  4A3G H;  2MNA A;  1II3 A;  4K5W A;  3VYR A;  1VQ9 A;  4TRD A;  3KLR A;  1VMP A;  2A6E D;  1T5E A;  2QDL A;  1KQS A;  4AQY L;  1WJJ A;  5M5W H;  5C4J B;  4WJW A;  5LL6 X;  3IL8 A;  4DNR B;  4O2D A;  4BBR H;  2IWH A;  4A3I G;  5L37 A;  5C5M A;  1U4R A;  2B8F A;  1GO3 E;  3F2U A;  1A3T A;  5EAY A;  1XNQ Q;  2R3Z A;  1JOR A;  5I9O A;  3RZO B;  1GUS A;  3BU2 A;  2F0F A;  2WB1 E;  5C3W A;  1KXL A;  1AN8 A;  2J7Z A;  1HNX Q;  2VQF L;  2LMC B;  3CF5 A;  4CDC C;  2EYO A;  1V1P B;  2B2T C;  2QDB A;  1DD2 A;  3I73 A;  3W1B A;  4LMQ D;  3JAM i;  1O80 A;  1SE8 A;  4A3E G;  1YNN D;  3S17 H;  4HCE A;  1G6Z A;  1ET6 A;  2A19 A;  4DV5 Q;  2UU9 L;  4GKJ L;  1L0W A;  2JE6 I;  4X3K A;  4X65 L;  3AB9 A;  3BDC A;  1TS5 A;  1EZ8 A;  4DAY A;  4JI7 L;  1HZ9 A;  4NPS A;  1UAP A;  1PRT D;  1TWC B;  1CTM A;  5CV6 A;  3PUV A;  5KYI A;  1VQJ A;  1E2V A;  4A3F B;  3A5U A;  4HID A;  2NZ1 D;  5D65 A;  3MXN B;  1IBM L;  2B8G A;  3KJP A;  2F0H A;  2K5V A;  1IZ6 A;  3NHH A;  4LF8 Q;  1L1O C;  1Y8P B;  5GQO A;  4GN3 B;  1GHK A;  2O5J C;  3CMA A;  1Q3L A;  4K8I A;  3LWE A;  1E1T A;  2PNH A;  1DJR D;  2TSS A;  1DM0 B;  4JI0 Q;  2B39 A;  3TS0 A;  3HKZ B;  2IT1 A;  1VQE A;  2FJ2 A;  5IGB A;  1PTO H;  2VL6 A;  1F77 A;  4GLA C;  2A8V A;  1Z9F A;  4C1N K;  3P1H A;  3D6W A;  1Y69 U;  1YNX A;  3PO2 H;  4RA8 A;  2XWB B;  1I6H B;  4DK1 A;  1K9M C;  2R7D A;  4ZRZ A;  1X9N A;  3T1Y L;  1PTO D;  1RJT A;  4XTC S;  4CKC A;  1CZW A;  4BWG B;  1VQD A;  4ZUI A;  3Q22 A;  3CCM A;  2F0M A;  4K6L A;  1NMF A;  1PFB A;  4A3G G;  2VS1 A;  2K04 A;  3I4M G;  4DR4 Q;  2GVA A;  2HIV A;  4CJ1 B;  2NVT H;  5FO8 B;  1TY0 A;  4C3J H;  1CSP A;  4BBR G;  5J39 A;  2OWO A;  3HRZ C;  5K36 H;  3A74 A;  4N8F A;  3JAM L;  2ES2 A;  3NWS A;  3PUX A;  1D1I A;  1ILQ A;  2UXB Q;  3S14 B;  1B4O A;  5FKA C;  1M1K C;  4I65 A;  2JQO A;  2FMC A;  2B2U C;  2RDH A;  4MHE A;  2OF1 A;  2F0G A;  4HIK A;  4K0K L;  3MXP A;  3RZD B;  5ELO A;  4FF1 A;  3HKZ E;  1KDA A;  3TBI B;  1KD1 C;  5IOD A;  1PZJ D;  4QQB X;  2Y0S G;  1EWH A;  3QR8 A;  3STB D;  1AZP A;  3VR4 A;  3I91 A;  2NB0 A;  4C1N I;  3ITP A;  2JA6 H;  2CH4 W;  2JA7 G;  2F0U A;  1GM5 A;  1HZC A;  3VA7 A;  1N34 Q;  1GKH A;  1LT6 D;  4GZY C;  5IYC G;  2F0J A;  2N3S A;  4IPD A;  3OOC A;  1K73 C;  3HS0 C;  1HFG A;  4BBS G;  3J81 j;  1CI3 M;  3CQZ B;  5JEA J;  2K14 A;  2OQ0 A;  4ZAI A;  1TWF B;  3UDX A;  1SFO B;  1DXM A;  1KAW A;  2KA7 A;  3RD4 A;  4PZ7 A;  2EPB A;  2E2H B;  1PXU A;  2UXD Q;  2K75 A;  4KKS A;  1F2M A;  1K83 B;  3NK9 A;  2NVQ B;  2A6E C;  2XIW A;  1LUZ A;  1VQ7 A;  1EYG A;  1YJW A;  3F1Z A;  5IWA L;  1IW7 D;  1STB A;  3CD6 A;  1WCM B;  4ILW A;  5HGT A;  5M5Y H;  4A3D B;  4B3T Q;  3TN2 A;  2J4X A;  1WD1 A;  3EFX D;  4C3I H;  5JOB A;  3PO2 G;  3SK8 A;  3CPF A;  1CKN A;  5CBA E;  3TP6 A;  2CVR A;  1JWS D;  3FPP A;  2Q2H A;  1GUG A;  2JEB I;  5ELC A;  3PO3 B;  2B2V A;  2F0O A;  2UXC L;  1NR4 A;  3I3C A;  1PVO A;  1E0B A;  2CQA A;  1U0L A;  3FEW X;  1CKO A;  5C0X H;  2MQH A;  2AUJ D;  1N33 Q;  3J80 i;  3JC6 6;  4C3H B;  1KAA A;  5IGE A;  1CA5 A;  1Q8K A;  3HOW B;  2PI2 E;  4AYB G;  4WJ4 A;  1VQK A;  4A3L H;  2EY2 A;  3S2H H;  1TR5 A;  1D2B A;  1PRT C;  4XYO A;  1X3E A;  1Y8N B;  1KLU D;  3RNU A;  1QZG A;  3MZ5 A;  5J3B A;  5BN5 A;  1PH6 A;  2I5L X;  1A3U A;  3R2T A;  3M85 A;  4R4I A;  1LTT D;  2GA4 B;  3JAM c;  4DR5 L;  3VDY A;  1ENF A;  3W3A A;  2IPK D;  5IT9 E;  1FGB D;  3HOU H;  4EGV A;  4LFA L;  2K5D A;  1PHJ A;  2JA6 G;  2X6G A;  2ZM6 Q;  5COY A;  2K03 A;  1JJ2 A;  4I7A A;  3S1R H;  1B3A A;  2N88 A;  2OCE A;  5EJW A;  1YHB A;  4ALP A;  4DR6 L;  1NE3 A;  4B08 A;  3BVZ A;  3KDF A;  2Q8R E;  3B6Y A;  2K5W A;  3T51 B;  4KV6 A;  1PTO C;  2CWP A;  1HNZ Q;  3P20 A;  2M9V A;  2OTL A;  3ERS X;  3NBH B;  1X3F A;  2C35 B;  1PH9 A;  1JWM D;  1BXT A;  3GP7 A;  5EBC A;  2UUA Q;  1G2S A;  1V8Q A;  4F87 A;  1TS4 A;  4YHH L;  1SJE D;  2KUM A;  3IFD A;  5C3X A;  4ZCK A;  4PMW A;  5C4H A;  1P16 A;  3RLN A;  2CFM A;  2XTI A;  1EY8 A;  4FF2 A;  5M9O A;  4LFC L;  5C4J H;  3NUC A;  2LFN A;  4C3I G;  5ELF A;  1ZKO A;  3KUP A;  1NAP A;  4R8I A;  4RHS A;  4OWT B;  1DYQ A;  4RMF A;  1XYI A;  4H44 C;  1G6P A;  4JI6 L;  4XYQ A;  3RZO H;  2Z0S A;  1MJE A;  3LX0 A;  4FXD A;  5EPL A;  1FL0 A;  1NMG A;  1FNW A;  1W6J A;  4JC0 A;  1T5X D;  2DNE A;  4FXK C;  4IQZ A;  4DR5 Q;  5C0X G;  1LT4 D;  5LL6 S;  4LFB L;  2K7V A;  1IBK L;  4ULL A;  3FP9 A;  2PMZ B;  4YY3 L;  5LMN W;  3I8Z A;  2HIX A;  1O78 A;  2VXW A;  4JI4 L;  1SMY D;  5GAE C;  3CME A;  3U58 A;  1TY2 A;  3ND8 A;  1KDC A;  1ROD A;  4L5R C;  2WAQ E;  4A3B B;  4X66 L;  2VUM B;  3DLL A;  4X64 Q;  3CCE A;  3IKJ A;  1OO9 B;  1TWC H;  3E0E A;  3SEB A;  3CC7 A;  1DGS A;  3NQT A;  4H7B A;  4A3F H;  4H0L C;  1UWV A;  3MEH A;  5M3M B;  4A93 B;  2B63 B;  2F0I A;  3R3O A;  1NY4 A;  4JI8 L;  4X62 L;  4MN3 A;  2WB1 G;  1IW7 C;  1PYS B;  3AYH B;  2Z1C A;  4X3S A;  3CC4 A;  1W3S A;  5HUR A;  2F0W A;  1K8M A;  1ENC A;  3L2P A;  1KL9 A;  3GD7 A;  3RLO A;  3A5Z B;  4EVO A;  3U9O A;  1HQR D;  3A56 A;  4IUT A;  2SEB D;  1I6H H;  4I7Z C;  1PFM A;  2KCM A;  4ODG A;  2QKI C;  4O1N A;  3VYU A;  1J6Q A;  5CGK A;  4YCU A;  4LK1 C;  1QNK A;  1K3B C;  2AWO A;  2QF7 A;  3BZK A;  3T13 A;  2RF4 A;  3VR6 A;  1MIU A;  1SSO A;  3U9S A;  5C4X B;  1EWC A;  3PIO A;  1EEI D;  3CW2 C;  3OTO L;  2KED A;  3PIO 3;  3KLW A;  5KYL A;  1KRS A;  1EYD A;  1CKN B;  2IHF A;  4QJF A;  1STN A;  1TQO A;  1Z6H A;  1N36 L;  5JVH 3;  3KLS X;  4P72 A;  2DNC A;  1UEB A;  5E4W C;  1JJC B;  4K8J A;  4OIJ A;  4NXM L;  1QIL A;  3W2D A;  3S14 H;  1QJO A;  4RG1 A;  1PYB A;  1EQQ A;  4JPB W;  1D6E C;  4ID6 A;  3P75 A;  3SK5 A;  4DR3 L;  4CHT B;  5KGU A;  2F4V Q;  4IUR A;  4FDB A;  3RZD H;  1G8Z D;  3HFZ B;  3WDN A;  2ICE C;  2JA9 A;  4HSV A;  5EPK A;  1SRO A;  2ZTC A;  5FJ8 G;  4JI5 Q;  1S3O A;  5D3D A;  5FLX L;  2NTT A;  1CQV A;  2F0V A;  1E24 A;  4JOI A;  5AJ3 Q;  2HDM A;  2KQ3 A;  3C1F A;  4EQN A;  3SE0 A;  4GOP A;  4KMU C;  1GUW A;  4DGZ A;  3Q24 A;  3CQZ H;  4OEL B;  4LF6 Q;  4JI3 L;  2AQ3 B;  1EY9 A;  1MGS A;  4UDU C;  2UUC L;  5KEE A;  4A3F G;  3KBX A;  4PNY A;  3CCS A;  1TWF H;  4O42 A;  3E0J A;  2Q2I A;  1SFO H;  2CKZ B;  1QG7 A;  3DEO A;  4RCO A;  5ISR A;  2ASB A;  4BA2 I;  5I4D A;  4R1J A;  1TXY A;  2IX0 A;  3CXC A;  2E2H H;  1RDP D;  4G7Z C;  4NXN L;  2D5D A;  3V05 A;  1WFQ A;  2K01 A;  2MO0 A;  2EXD A;  1NTG A;  1K83 H;  3OYY A;  3CAM A;  2NVQ H;  3OWE B;  3HOZ B;  5IGG A;  2IY5 B;  3HKZ G;  1J8I A;  2OT2 A;  3BZD B;  1EUJ A;  1WCM H;  1XMO L;  1Q7Y C;  3TZD A;  4JI2 L;  4A3D H;  4OL7 A;  1X3G A;  3G4S A;  3S15 B;  2HQL A;  1F9P A;  1NNX A;  2F0T A;  3L3O C;  1XWE A;  3PO3 H;  4ZK9 B;  3D4R A;  3S1N B;  1KIX A;  2EYP A;  3NBI A;  1N32 Q;  2Z6B A;  1A6X A;  2QIL A;  1DCZ A;  1PV4 A;  1Y1V B;  1B70 B;  4L8J A;  4XQJ A;  2V4D A;  2UUB L;  1HR0 Q;  3GTQ B;  1C4Q A; 
#chains in the Genus database with same CATH homology
 1SXT A;  4WOR A;  2KHS A;  1BF4 A;  1NSN S;  3CU7 A;  5JAV A;  3V2T A;  5LHY 1;  2NBF A;  1RD9 D;  5JEA H;  1GOZ A;  2A5H A;  4FF4 A;  2A73 B;  2YYZ A;  4DAV A;  4ABN A;  2PW5 A;  1BCP B;  3BDL A;  1Q8I A;  3DHQ A;  3GTP B;  3J81 E;  2VB2 X;  3ZYY X;  3HOY B;  1CK1 A;  1MBY A;  1NR2 A;  2F0N A;  5C6A A;  1L0X B;  2E76 C;  4QIW B;  1QNU A;  1H9R A;  4OO1 I;  3SXH A;  1B9N A;  3GTL B;  3S16 B;  3MXG A;  1I4R A;  4G7H C;  1TWG B;  1WD0 A;  2PNR C;  3GV6 A;  3D4W A;  3FDT A;  1GHJ A;  3BVG A;  1ZEQ X;  4R9W A;  5DNF A;  2B2U A;  2EXZ A;  4FVM A;  2D2C C;  1TWA B;  3S2D B;  1V43 A;  1BUV T;  3HOX B;  3EVQ A;  3M7G A;  1GXD C;  4QCL A;  1ENA A;  3NE5 B;  4ME5 A;  4IUU A;  2RA4 A;  3C1E A;  3PMF A;  2QCP X;  4KY6 A;  1WTX A;  1TII D;  1PMR A;  1FNV A;  2MUY A;  4DAP A;  2JXM B;  1I50 B;  3L9A X;  2QEJ C;  1VF7 A;  3GQB A;  4RGM A;  1CA6 A;  1M4V A;  1DON A;  4FXG C;  1K8O A;  4C3H G;  4CGY B;  4XT1 B;  5I9P A;  4HTH A;  4JBW A;  4J6H A;  2F0D A;  2XRQ D;  1LTR D;  5JEA G;  2AUK A;  4NMZ A;  1E2W A;  2BA0 A;  1G2T A;  1Q90 A;  4RHR A;  4HSP A;  3HEJ A;  1OXS C;  4RKB A;  5EBD A;  1I4X A;  2NVX B;  5IGD A;  3M4Y A;  4A3K B;  1HQM C;  2PPB C;  2JA5 B;  1JOO A;  3NPP A;  4EQP A;  1S5B D;  4K5X A;  1O7L A;  5A2Q E;  1LT5 D;  4IN3 A;  1JE4 A;  4A3M B;  1ILP A;  4IUN A;  1EQT A;  2D9U A;  1LT3 D;  5M3F B;  1SE2 A;  5D3I B;  1CM9 A;  3CHB D;  4C2M B;  4KI0 A;  4KD3 A;  1IL8 A;  3PUZ A;  2AWN A;  2HUG A;  3D3R A;  1U9R A;  5EQ0 A;  1XXG A;  1EY4 A;  5TSS A;  1O7Z A;  3I70 A;  4CBV A;  1BDO A;  3HGB A;  3UI2 A;  1H9S B;  5C3E B;  4RGO S;  3S1Q B;  3KF8 A;  4FO2 A;  4ZKB B;  1U4M A;  4S3S A;  2VB3 X;  2O4X A;  2JA8 B;  1SJH D;  3URY A;  1W6K A;  3O13 A;  4IUQ A;  1XTC D;  1QE6 A;  4G57 A;  2R92 B;  3MFY A;  2XSC A;  3WOE A;  1F9Q A;  1KNA A;  2R6G A;  1VCI A;  2DN8 A;  2B2W A;  2MP1 A;  2AQ1 B;  4E6I A;  3WOF A;  1SNQ A;  1U4P A;  1X32 A;  3VR3 A;  1GJX A;  4A3I B;  2Q8T A;  2AQ2 B;  2KEE A;  3D6C A;  2NN6 I;  5FO7 B;  4QUC A;  5I6Y A;  2BCO A;  2LKV A;  4DN4 M;  1PRT F;  4DA2 A;  1OXV A;  3BDO A;  2SOB A;  3MXU A;  1G29 1;  2WIN B;  2WP8 J;  3A55 A;  1ET9 A;  4N9P A;  5C44 B;  5A35 A;  2DY7 A;  3BG3 A;  5F2D A;  1EIG A;  1D5M C;  4N9T A;  1D5Z C;  3VR5 A;  1A2U A;  5DAU A;  4C3J G;  1R4P B;  5K36 G;  2DY8 A;  1Q12 A;  4KD4 A;  1HXY D;  1EY6 A;  3BYY B;  5CBE E;  4PMC A;  2IJ0 A;  4QB4 A;  5IGF A;  5I2X A;  5CV4 A;  4KJN A;  3GTM B;  1PTO F;  3K6O A;  3ND9 A;  3KBG A;  1DZ1 A;  3L7Z C;  2WII B;  1EFI D;  1PYW D;  3SR1 A;  4FNF A;  2KCC A;  2A6H D;  3SK4 A;  4XQQ A;  3H3V C;  1GUN A;  4NKL A;  4F88 A;  5ELD A;  1DOK A;  3T16 A;  3T4A C;  4OIK A;  1VDZ A;  2F0P A;  1OXT A;  2EZV A;  4RAU C;  4WFN 3;  2XN9 C;  3I4M B;  3G7L A;  2F0L A;  1BCP D;  2BOS A;  2FHT A;  3Q6S A;  4PQX A;  3AU7 A;  1C48 A;  1C8C A;  5G3L D;  3M3Y B;  2E2J B;  3K59 A;  2IL8 A;  1KLG D;  3KK7 A;  3FKI B;  3G6J B;  5CR3 A;  3J80 L;  1PDQ A;  4KJO A;  4RCN A;  1STH A;  3OIQ A;  2MPM A;  3FRP B;  1U4L A;  3TSS A;  4A3J B;  2MHV A;  4OO1 H;  1TWH B;  3OHX C;  1IYV A;  2HQE A;  5JPN C;  2MJ8 A;  2JA7 B;  3J7Y W;  4DXF A;  2A68 C;  4BBS B;  1IKM A;  3A7L A;  3RMH A;  2XVS A;  3JAM E;  3M7N A;  1VF5 C;  1BNZ A;  1S4Z A;  2B2V C;  1HUM A;  3ERQ A;  2BE5 D;  1SYE A;  4C56 C;  2EY6 A;  3SVM A;  1SEB D;  3FVQ A;  2N55 A;  4Y7N B;  2WAC A;  1X3P A;  2FMM A;  2OXP A;  1PZI D;  2D62 A;  5EPJ A;  4ZLT F;  2Q8I B;  2EDG A;  4TQU S;  1ZYR D;  2EOT A;  4KK7 A;  5J22 A;  3X3N A;  3OIP A;  3AMU A;  1D1K A;  1QWY A;  3GTO B;  4OHJ A;  1BO0 A;  2KEC A;  1SNC A;  2BA1 A;  4DNT B;  5D14 A;  2M00 A;  3NTH A;  1B44 D;  2EJM A;  2B2Y A;  1CHQ D;  2XNA C;  1S5D D;  1KTK A;  2K05 A;  3P7J A;  1F9S A;  3PV0 A;  4OO1 G;  1MD2 D;  4QUF A;  3MC0 B;  4L6T B;  1HHV A;  3TME A;  2JSO A;  2F0E A;  3Q23 A;  3MXN A;  5G3L F;  2EYF A;  1EQV A;  2A6H C;  2PO4 A;  2SNM A;  1GUO A;  3K5O A;  1Z47 A;  3GTK B;  2Z4I A;  1ONL A;  3R8B A;  2R93 B;  2RSO A;  1BCP C;  2R7Z B;  4BY7 B;  2FIN B;  3I72 A;  2B2T A;  3CRK C;  4Q5V A;  5E1F A;  2IX3 A;  2VNU D;  2J0T D;  3H91 A;  2I46 A;  3FPU B;  1A3V A;  3K7A B;  4J8Q A;  5J1Z A;  5K5P A;  3NWT A;  5BN4 A;  1BR9 A;  1HTL D;  4FF3 A;  3GO5 A;  3NXW A;  1JCK B;  5CV9 A;  2ZXP A;  4QF4 A;  3K5L A;  1TT2 A;  3K5N A;  4P2C B;  5CC4 A;  3HP3 A;  4NP5 A;  2RVL A;  4KY7 A;  4LJZ C;  4IFD J;  1HFN A;  5E4X A;  1YNJ D;  3RLF A;  2ENB A;  2NN6 H;  2BDN A;  4KTA A;  1Y1W B;  2L9H A;  2RKS A;  4RH6 A;  1RF2 D;  4DXG A;  2WKC A;  1AW7 A;  2BE5 C;  2PCF B;  1VMC A;  3SHL A;  1JWU D;  3OSO A;  1UEA B;  4KKU A;  3V96 A;  1KNE A;  4K6D A;  5C5L A;  1QB5 D;  4IFD I;  1F2Z A;  4HCS A;  4M8A A;  1STY A;  3QWN A;  2JYO A;  4MIU A;  1LTA D;  1S5F D;  2JP1 A;  5DM6 3;  1ZYR C;  3MHB A;  4YIJ A;  3DMU A;  5KND A;  1A15 A;  2F3W A;  4ZUJ A;  3X3M A;  2F0K A;  3LNN A;  2E2I B;  4RFB A;  1LTI D;  1STE A;  4G7O C;  2NUC A;  1B1Z A;  4B9W A;  1CZG A;  2ZXR A;  1LTG D;  3TP7 A;  4RGT A;  1RTN A;  3EQL C;  1JIC A;  3BS1 A;  1L0Y B;  3A8I E;  3GTG B;  3PIP 3;  4HAE A;  3PUW A;  2IW3 A;  2H4O A;  3TP5 A;  1XX8 A;  5C4Z A;  5IT9 L;  4DF7 A;  3DWA A;  3R93 A;  2G9D A;  1PLF A;  1DOL A;  5JPM C;  1LAC A;  2EVB A;  3VA5 A;  1PFN A;  1H9J A;  5JVG 3;  4V0B A;  3SDZ A;  2NN6 G;  2A74 C;  1EY7 A;  1WTP A;  2K6A A;  1WTR A;  3I90 A;  1WTW A;  1SE3 A;  2PYK A;  4V19 0;  5CV7 A;  1F9R A;  4BS9 A;  1BBX C;  1WTQ A;  3NBH A;  1HCZ A;  2R61 A;  3OPO A;  1SDF A;  2O5I C;  1I4P A;  1M8A A;  2BDO A;  5FLX E;  1EU4 A;  1STA A;  2RBM A;  2FFK B;  1PZK D;  4BY1 B;  4NDX A;  3QOL A;  5T1I A;  4K14 A;  2WKD A;  4XQN A;  1R9T B;  3S1M B;  1WTV A;  3H94 A;  2L1B A;  3M4O B;  1EEF D;  2C9O A;  1H9K A;  3C2P A;  4ZQ3 A;  4LAA A;  3DWP A;  3J7A V;  4K5V A;  1YNJ C;  3ONA B;  2G9H D;  3C46 A;  2PZW A;  5BN3 A;  5CMD A;  4PMB A;  4QMG A;  4J1M A;  3H0G B;  2E2D C;  4XIG S;  3QO2 A;  4KHV A;  2KOL A;  2A68 D;  5KNC A;  2JEA I;  4XT3 B;  1NUC A;  3E6Z X;  4RWS C;  1I4Q A;  1BQQ T;  2EJF C;  3DM1 A;  2NWG A;  4KN7 C;  3FMC A;  4KKT A;  2CHB D;  3D4D A;  3HOV B;  2I07 B;  4FP5 D;  1WTO A;  1RKN A;  3MAQ A;  1UNS A;  5NUC A;  1A2T A;  3A8J E;  1JC7 A;  4U68 A;  4X3U A;  3S9W A;  1QCB D;  3C3L A;  2NVY B;  1SE4 A;  3N52 A;  4B9X A;  2F0Q A;  3QJY A;  3VYS A;  3QB3 A;  1FD7 D;  5M5X B;  4ZKC B;  1I3Q B;  2LS0 1;  4BA1 I;  1SYF A;  1HA6 A;  4CKB A;  1UUP A;  1B50 A;  3RUZ A;  3I4N B;  1E2Z A;  5CV8 A;  5DM7 3;  1KAB A;  1ZXT A;  1AP0 A;  3DUZ A;  1S5C D;  3TZU A;  2E75 C;  2A69 D;  3BYT B;  4HN7 A;  4HR7 B;  4A3E B;  1EIH A;  1SNO A;  1STG A;  1IKL A;  2EJG C;  1LLR D;  3E5S A;  3SK6 A;  2EY5 A;  2F4I A;  4U67 3;  1LTS D;  3MWY W;  2K33 A;  5JJZ A;  1RHP A;  4KHZ A;  4M1U B;  2RQX A;  1YNN C;  3GV3 A;  1IHZ A;  1SBB B;  2K1B A;  2EYM A;  5FK9 C;  4OGQ C;  3R2I A;  1B9M A;  2HCC A;  2OEO A;  2LY7 A;  2YU9 B;  4EQO A;  4IAL A;  4CKE A;  1B53 A;  1JB3 A;  5IGC A;  5E3F A;  1SAP A;  2C5C A;  1HA5 A;  1OXX K;  3A7A B;  1FNU A;  1S5E D;  2H1E A;  3KLS A;  1HTP A;  2HDL A;  4L63 B;  4DK0 A;  3MTS A;  3GTJ B;  5KIX A;  1EU3 A;  1Q1E A;  5AFW A;  2KCN A;  1EYC A;  1OXU A;  2L11 A;  4CJ0 B;  1QOH A;  4A3G B;  3IFT A;  2NYZ D;  3H6M A;  3H09 A;  4NW2 A;  4F8M A;  4K2L A;  4RKL A;  3A54 A;  1X3Q A;  2PZT A;  5M5W B;  1ESF A;  4BBR B;  3MA2 B;  2KJX A;  3NTI A;  1MSH A;  1EYA A;  4K2K A;  3QOJ A;  2HCI A;  2NTS A;  2EY1 A;  1JR0 D;  2RDF A;  5ELE A;  5DEH A;  3T53 B;  1LV9 A;  2WAQ B;  1GUT A;  5KRU A;  1MSG A;  3NTK A;  5EKL A;  1FR3 A;  2CW0 D;  4IFD H;  2Y0S B;  3TDQ A;  2B2W C;  1D5X C;  2X6L A;  2SNS A;  1Z7T A;  1PRT B;  3LWU A;  5CYU A;  3S17 B;  2X69 A;  1CFM A;  4Z9C B;  1NCV A;  1HRJ A;  4X3T A;  3J81 L;  3CRL C;  2EE1 A;  1RTO A;  3CKI B;  3NQI A;  5CV5 A;  2O2L D;  2PW7 A;  3N6R A;  2F03 A;  3EA6 A;  3D8G A;  3QG1 A;  1SYB A;  4KY5 A;  1SND A;  4IUP A;  1PTO B;  1KDB A;  2WV6 D;  3PO2 B;  3TP8 A;  5KNB A;  4UAI A;  1B2T A;  1LO5 D;  2TMP A;  4G4K A;  2XWJ B;  3OMC A;  2L55 A;  1AFP A;  1EY5 A;  1TS3 A;  2EYH A;  5IIF A;  2A69 C;  2RSN A;  3A8K E;  2NVT B;  1SYD A;  2F0S A;  2EYL A;  2K32 A;  4C3J B;  1H9M A;  1V1P A;  3T56 B;  4AYB B;  2M2L A;  2PQE A;  1EL0 A;  2F1M A;  1LAB A;  5EKK A;  2E74 C;  1JQY D;  1ML0 D;  4IZ8 A;  1I4H A;  1O7Y A;  1Q1B A;  3DWQ A;  1JOK A;  1MI2 A;  3VYT A;  5ELB A;  4IFD G;  4JK1 C;  4HMJ A;  4WRD A;  4TSS A;  3EJI A;  3D31 A;  1BCP F;  1R4Q B;  2JA6 B;  5C0X J;  2SDF A;  4H13 C;  5FOB B;  1TKW B;  1WVL A;  3IAY A;  5COR A;  3OMG A;  4DFA A;  3OWF A;  3K5M A;  5EGT A;  1EY0 A;  4FYD A;  2ID0 A;  3ERO A;  2KVM A;  1CQF A;  4TKO B;  5IOC A;  3NP8 A;  4DU9 A;  3MFG A;  5C0X I;  1AZQ A;  1G91 A;  1I6V C;  5A2Q L;  1JOQ A;  1HUN A;  1J9O A;  3Q0A A;  1AEX A;  5M5Y B;  1I4G A;  5T1G A;  3VR2 A;  4C3I B;  5I6W A;  4PV1 C;  4KN4 C;  1F2Y A;  1Y8O B;  3DXJ C;  3K0Y A;  2CW0 C;  5EKI A;  1SNP A;  1TS2 A;  4HMI A;  2XRS D;  2Z4H A;  4RGN A;  3MVV A;  1EZ6 A;  1SYG A;  3HG9 A;  1V1O A;  3NSW A;  3S2H B;  2ZXO A;  1CHP D;  5FO9 B;  2PZU A;  1BOS A;  4XXE A;  1H9S A;  3J80 E;  2RDG A;  2MGS A;  3K58 A;  5I2Y A;  2ICI A;  1ICW A;  2IX1 A;  1DOM A;  3HOU B;  2K5Q A;  1IYU A;  1SMY C;  2WB1 B;  1RCV D;  3HZX A;  3J7A F;  2L0C A;  2Z8L A;  2L5T A;  1SYC A;  1FYC A;  3OW7 A;  3S1R B;  1HPC A;  1LTB D;  2L4N A;  4HED A;  2F3V A;  4ZYS A;  1EOT A;  1TVX A;  4CJ2 C;  1ESR A;  2B2Y C;  3K57 A;  2K28 A;  1SNM A;  3DEP A;  4R8N A;  2EYJ A;  3BVM A;  4Q0F A;  1TU2 B;  4XDX A;  2L12 A;  4F7X A;  4IUV A;  3PUY A;  2ZT9 C;  3I4L A;  3QIA A;  1F2L A;  1CT1 D;  1II3 A;  4K5W A;  3VYR A;  4TRD A;  3KLR A;  1VMP A;  2A6E D;  1T5E A;  5C4J B;  4WJW A;  5LL6 X;  3IL8 A;  4DNR B;  2IWH A;  5C5M A;  1U4R A;  2B8F A;  3F2U A;  1A3T A;  2R3Z A;  1JOR A;  5I9O A;  3RZO B;  1GUS A;  2F0F A;  5C3W A;  1AN8 A;  2J7Z A;  2LMC B;  2EYO A;  1V1P B;  2B2T C;  2QDB A;  1DD2 A;  3I73 A;  4LMQ D;  1O80 A;  1YNN D;  1G6Z A;  4HCE A;  1ET6 A;  2JE6 I;  4X3K A;  3AB9 A;  3BDC A;  1TS5 A;  1EZ8 A;  4DAY A;  1UAP A;  1PRT D;  1TWC B;  1CTM A;  5CV6 A;  3PUV A;  5KYI A;  1E2V A;  4A3F B;  2NZ1 D;  5D65 A;  2B8G A;  2F0H A;  3NHH A;  1Y8P B;  1GHK A;  2O5J C;  1Q3L A;  4K8I A;  3LWE A;  1DJR D;  2TSS A;  1DM0 B;  2B39 A;  3HKZ B;  2IT1 A;  2FJ2 A;  5IGB A;  1PTO H;  1F77 A;  4C1N K;  3P1H A;  3D6W A;  1Y69 U;  4RA8 A;  2XWB B;  1I6H B;  4DK1 A;  4ZRZ A;  1PTO D;  1RJT A;  4XTC S;  4CKC A;  1CZW A;  4BWG B;  4ZUI A;  3Q22 A;  2F0M A;  4K6L A;  1PFB A;  2K04 A;  4CJ1 B;  5FO8 B;  1TY0 A;  5J39 A;  3HRZ C;  5K36 H;  3JAM L;  3NWS A;  3PUX A;  1D1I A;  1ILQ A;  3S14 B;  1B4O A;  5FKA C;  4I65 A;  2FMC A;  2B2U C;  2RDH A;  4MHE A;  2OF1 A;  2F0G A;  3MXP A;  3RZD B;  4FF1 A;  3TBI B;  1KDA A;  5IOD A;  1PZJ D;  1EWH A;  1AZP A;  3VR4 A;  3I91 A;  2NB0 A;  4C1N I;  3ITP A;  2F0U A;  3VA7 A;  1LT6 D;  4GZY C;  2F0J A;  3OOC A;  3HS0 C;  1HFG A;  1CI3 M;  3CQZ B;  5JEA J;  4ZAI A;  1TWF B;  1SFO B;  1DXM A;  3RD4 A;  2KA7 A;  2EPB A;  2E2H B;  1PXU A;  4KKS A;  1F2M A;  1K83 B;  3NK9 A;  2NVQ B;  2A6E C;  2XIW A;  1IW7 D;  1STB A;  1WCM B;  4ILW A;  5HGT A;  4A3D B;  3TN2 A;  2J4X A;  1WD1 A;  3EFX D;  5JOB A;  3SK8 A;  5CBA E;  3TP6 A;  2CVR A;  1JWS D;  3FPP A;  1GUG A;  2JEB I;  5ELC A;  3PO3 B;  2B2V A;  2F0O A;  1NR4 A;  3I3C A;  1E0B A;  2CQA A;  3FEW X;  5C0X H;  2AUJ D;  4C3H B;  1KAA A;  5IGE A;  1CA5 A;  3HOW B;  2EY2 A;  1TR5 A;  1D2B A;  1PRT C;  4XYO A;  1Y8N B;  1KLU D;  3MZ5 A;  5BN5 A;  1A3U A;  3R2T A;  3M85 A;  1LTT D;  2GA4 B;  1ENF A;  3W3A A;  2IPK D;  5IT9 E;  1FGB D;  4EGV A;  2K5D A;  2X6G A;  5COY A;  2K03 A;  1B3A A;  2N88 A;  5EJW A;  4B08 A;  3BVZ A;  2Q8R E;  2K5W A;  3T51 B;  4KV6 A;  1PTO C;  3P20 A;  2M9V A;  1JWM D;  1BXT A;  3GP7 A;  5EBC A;  1G2S A;  1V8Q A;  4F87 A;  1TS4 A;  1SJE D;  2KUM A;  3IFD A;  5C3X A;  4PMW A;  5C4H A;  1EY8 A;  4FF2 A;  5M9O A;  3NUC A;  2LFN A;  4C3I G;  5ELF A;  1ZKO A;  3KUP A;  1NAP A;  4R8I A;  4RHS A;  1DYQ A;  1XYI A;  4H44 C;  4XYQ A;  3LX0 A;  4FXD A;  5EPL A;  1FNW A;  1W6J A;  1T5X D;  2DNE A;  4FXK C;  4IQZ A;  5C0X G;  1LT4 D;  5LL6 S;  2K7V A;  4ULL A;  2PMZ B;  3I8Z A;  1O78 A;  2VXW A;  1SMY D;  1TY2 A;  3ND8 A;  1KDC A;  1ROD A;  4A3B B;  2VUM B;  3IKJ A;  1OO9 B;  3SEB A;  3NQT A;  4H7B A;  4H0L C;  3MEH A;  5M3M B;  4A93 B;  2B63 B;  2F0I A;  3R3O A;  4MN3 A;  1IW7 C;  2Z1C A;  4X3S A;  5HUR A;  2F0W A;  1K8M A;  1ENC A;  3GD7 A;  4EVO A;  3U9O A;  1HQR D;  3A56 A;  4IUT A;  2SEB D;  4I7Z C;  1PFM A;  4ODG A;  2QKI C;  4O1N A;  3VYU A;  5CGK A;  4LK1 C;  1QNK A;  2AWO A;  2QF7 A;  3T13 A;  3VR6 A;  1SSO A;  3U9S A;  5C4X B;  1EWC A;  1EEI D;  2KED A;  3PIO 3;  5KYL A;  1EYD A;  1STN A;  1TQO A;  1Z6H A;  5JVH 3;  3KLS X;  2DNC A;  5E4W C;  4K8J A;  4OIJ A;  1QIL A;  3W2D A;  1QJO A;  3SK5 A;  4ID6 A;  1D6E C;  3P75 A;  4CHT B;  5KGU A;  4IUR A;  1G8Z D;  3WDN A;  2ICE C;  4HSV A;  5EPK A;  5D3D A;  5FLX L;  2NTT A;  1CQV A;  2F0V A;  2HDM A;  2KQ3 A;  3C1F A;  4EQN A;  3SE0 A;  4KMU C;  1GUW A;  4DGZ A;  3Q24 A;  2AQ3 B;  1EY9 A;  1MGS A;  4UDU C;  5KEE A;  3KBX A;  4PNY A;  4O42 A;  3E0J A;  1QG7 A;  3DEO A;  4RCO A;  5ISR A;  4BA2 I;  5I4D A;  2IX0 A;  1RDP D;  4G7Z C;  2D5D A;  3V05 A;  2K01 A;  3OWE B;  3HOZ B;  5IGG A;  1J8I A;  2OT2 A;  3BZD B;  3TZD A;  4OL7 A;  3S15 B;  1F9P A;  2F0T A;  3L3O C;  1XWE A;  4ZK9 B;  3D4R A;  3S1N B;  2EYP A;  3NBI A;  1A6X A;  2QIL A;  1DCZ A;  1Y1V B;  4L8J A;  4XQJ A;  2V4D A;  3GTQ B;  1C4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...