3ERQA

Crystal structure of staphylococcal nuclease variant l25k at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Structural consequences of the ionization of lysine residues at 25 internal positions in a protein.
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3erqA00
3DMUA 5CR3A 3E5SA 4DFAA 1SYEA 5EKKA 2NUCA 5C4ZA 5CV4A 5I9PA 1JOQA 1STYA 1SNOA 2HQEA 1TR5A 3NHHA 5EGTA 2F0KA 5J1ZA 5KYLA 5KEEA 5J39A 2EYHA 3ERQA 1SYDA 2F0UA 4HMIA 2EYOA 2PZUA 2F0LA 2WACA 4KY5A 3D4DA 5CV8A 3SK5A 4B9WA 3TP7A 3MXPA 4B9XA 5I6YA 1TQOA 1F2YA 5DEHA 4E6IA 1EYAA 4NDXA 5J22A 5IGBA 1JOKA 2F3VA 1STHA 4YIJA 4F7XA 3ITPA 1SNCA 2SOBA 3NUCA 3QOJA 3SXHA 5KRUA 4IZ8A 4K14A 4NMZA 4NKLA 3SR1A 4EVOA 2EY1A 4QB4A 2QDBA 3NP8A 1JORA 5IGGA 3SK8A 1EYCA 4G57A 1EY6A 1EY7A 1SNDA 2PW5A 3DHQA 4R8NA 5CV7A 4ZQ3A 5IGFA 4EQOA 5F2DA 1EYDA 5IODA 4K8JA 5E1FA 3QOLA 5C3XA 5M9OA 1RKNA 4KY6A 1SNMA 1EQVA 4DU9A 5CC4A 4PMCA 3MVVA 1KDAA 2PYKA 1SNPA 1SYCA 3OMGA 2EY2A 3C1FA 4J1MA 1JOOA 3OSOA 1KDCA 3V2TA 4OL7A 5IGEA 2PQEA 5HGTA 2F0OA 4RKBA 1U9RA 4IALA 3MZ5A 5C5LA 1EZ6A 5CV5A 4K5XA 4N9TA 1A3TA 4IUNA 1EY9A 1STGA 1II3A 4PNYA 4J6HA 2EY6A 3T13A 1F2MA 3D8GA 4ID6A 4K6DA 5I6WA 3SK6A 2O4XA 4ODGA 5C4HA 5IGDA 1EY4A 3D6CA 2LKVA 3MHBA 4TRDA 4WORA 4DF7A 3U9OA 4H7BA 1KAAA 2RDFA 5IGCA 5IIFA 1F2ZA 4K2LA 1EY5A 4QF4A 4DGZA 5I9OA 1STNA 2F0PA 5C3WA 2SNMA 2EYLA 4KD4A 1IHZA 2F0SA 4KJNA 4RKLA 3C1EA 5E3FA 2F0DA 3OWFA 3NK9A 4K8IA 4KV6A 4KY7A 1SYBA 5NUCA 5K5PA 2EXZA 4HTHA 3PMFA 2F0WA 5IOCA 3H6MA 3D4WA 3HZXA 3S9WA 5ISRA 2RKSA 2OEOA 3NQTA 2RBMA 2F0QA 5JAVA 4PMBA 2PZTA 5CGKA 5KYIA 1A3UA 1SYGA 2M00A 1EZ8A 1SYFA 3EVQA 4N9PA 3TP8A 1NUCA 2F0FA 2F0MA 3EJIA 4ZUJA 5JOBA 3TP5A 1A2TA 5HURA 2F0JA 1STAA 1A3VA 3NXWA 5KGUA 4HMJA 3T16A 1ENCA 3OMCA 2F0NA 5CV6A 5C5MA 3SK4A 2OF1A 2ENBA 5CV9A 2F0VA 4QMGA 4NP5A 3SHLA 1EY8A 1NSNS 3TMEA 3LX0A 1KDBA 3BDLA 2F0EA 2SNSA 2EY5A 3RUZA 1TT2A 2PZWA 4EQPA 2OXPA 3QB3A 4KTAA 4ZUIA 1ENAA 2F0TA 2F0IA 2KHSA 1A2UA 3MEHA 1SNQA 2KQ3A 2EYPA 4ME5A 4I65A 3TP6A 5C6AA 1KABA 4KHVA 4KJOA 5DAUA 2EYFA 5KIXA 2F0HA 4LAAA 2F3WA 3HEJA 4KD3A 4K5VA 4MIUA 3VA5A 1EY0A 4WRDA 2EYMA 4S3SA 4K2KA 2F0GA 2PW7A 5EKLA 1STBA 4EQNA 4F8MA 3R3OA 3P1HA 3BDCA 3EROA 2EYJA 1AEXA 3P75A 4K5WA
chains in the Genus database with same CATH superfamily
5CR3A 2AWOA 3MA2B 1MIUA 2NUCA 4NXNQ 1E24A 1BQQT 4JBWA 5FLXL 1VQFA 3RLOA 3W1GA 1L0XB 4B9WA 4KHPL 3NQIA 2NZOA 2N3SA 1AFPA 1KLGD 2F03A 3ER0A 2HIXA 1XMQQ 4HIOA 1BBUA 1SNCA 5FKAC 3MXUA 1G6ZA 2NVQH 5C44G 5GROA 1N9WA 1B9NA 5IGFA 3RLNA 3U4ZA 1EYDA 1STEA 3QOLA 4YHHL 4X6AH 4BBSB 4GNXC 4XIGS 1DYQA 2YTYA 1X56A 4QGUA 3QO2A 1GM5A 3I4MB 3TN2A 1TS4A 4JI8Q 1ML0D 2RDGA 4BBSG 4X64L 4P73A 3ULLA 4KI0A 1TWCB 5I2YA 2O4XA 4UP7A 2IX0A 2KCNA 1VCIA 1CUKA 3AB9A 1ZYRC 1N34L 3I4MG 2LKVA 2F4VQ 5A35A 4H7BA 3MFYA 2F3IA 2EIFA 4K2LA 1O7YA 4X65Q 3TREA 2JA6G 2F0PA 2XIWA 1IHZA 1BKBA 2QKIC 2VNUD 3I4MH 4OIKA 3KFUA 5IOCA 4KKUA 2EXDA 1DD2A 2X6GA 2UXDQ 1YIJA 1TWCH 4XQJA 4YWMA 4X3SA 1EZ8A 3A54A 4A3FB 1NUCA 2B2UC 2IW3A 3PV0A 1WCMB 4RGTA 2WB1E 4A4IA 1NE3A 4QMGA 2BE5D 1JWSD 3LX0A 2DNCA 4PV1C 1B3QA 4A3FG 1TT2A 3KF6B 2GVBA 1WCMG 3NTIA 2VZAA 1VQ9A 4LFCQ 3CMAA 5DLQE 3HOZB 2WIIB 1K8OA 4JK1C 1GD7A 4A3FH 2F3WA 1WTXA 3PO3B 1LTID 3R2IA 1T9HA 1WCMH 4K2KA 4EQNA 2NVYB 4B3SL 4RCNA 3R3OA 3PO2H 3L9AX 4DFAA 2A68D 4ZYSA 1EIYB 4RCOA 5I9PA 4R4TA 4IURA 1E0BA 3K7UC 1I6VC 2JYOA 4JC0A 5JJLA 3HOZH 4CKEA 5C0XG 2Z6KC 1U0LA 2K1BA 3PO3H 1PTOC 3WOEA 1X3QA 2A69C 4JW0A 3R8BA 4DAVA 4TVAB 1DOMA 1PH2A 1CM9A 2B8FA 4DR3L 3JAME 1RKNA 3QWNA 4KKTA 4M1UB 4MTKA 1EQQA 1E2VA 1IBLQ 3V2TA 1Y1WG 2UXCQ 3I90A 5FLXE 2ASBA 2A6HC 3EN2A 4N9TA 2CCZA 4RHSA 4N8X1 1B8AA 1F2MA 4PZ6A 3EA6A 5C4HA 3D31A 1LTSD 3C3LA 4A3CH 1Y8PB 2IWHA 4CDFC 4IFDI 2LY7A 3P20A 1F2ZA 2HT1A 2MQHA 1STNA 4Q5VA 4JI0Q 2UUAQ 2NTTA 4KY7A 2L0CA 5FO8B 2CW0C 1K0RA 2B29A 1VQ7A 1UE6A 3K59A 3H3VI 4OXPA 2R7ZG 1WYDA 2JK8A 2CKZB 2A6EC 3HP3A 3OW2A 5IWAQ 4GKKQ 3NWTA 3CU7A 2FHTA 1SSOA 2B39A 2M2LA 5ELOA 4DK1A 2Z9HA 3SK4A 1B3AA 1KDBA 2EY5A 1PRTD 1K0SA 4KLKA 1LTLA 1FGUA 1SNQA 2D62A 3S1NH 3KK7A 3TS0A 4CJ2C 1QVGA 1G2SA 2JQOA 1Z6HA 2Q2UA 1ZKOA 1FD7D 1BO0A 3TZUA 5EPJA 3J81E 3T56B 1PH9A 4DR1Q 2FMMA 4JI7Q 1H9RA 2E2DC 5EGTA 3HS0C 4BY1B 2CWAA 2E2JH 1RTNA 2WACA 5AJ3L 4HJ8A 3D4DA 4CHTB 4DAYA 1X54A 4F7XA 1F9PA 1O78A 2EY1A 2QDBA 5EJWA 2HDMA 2NN6H 4JBKA 4K8JA 4BY1H 1HQRD 3K7AB 3KLRA 3K5NA 3D4RA 3OMGA 3J81j 1GJXA 2EY2A 1RIPA 2GA4B 1KIXA 2V4DA 4N8FA 4OL7A 1CZGA 5FLMG 2A68C 4GNXA 1NMGA 5LMUL 5C4XB 5JJKA 1QNKA 4K5XA 5K36G 4AIMA 1SXTA 1B53A 2JXMB 4J6HA 2EY6A 2VB2X 1TS2A 1JWUD 1VDZA 5FLMH 1CA6A 3S16B 2K01A 4ODGA 3K7AH 2ZT9C 5IGDA 4JYAQ 1H9SA 5C4XG 3MHBA 5K36H 4DV5Q 3IFDA 3FPUB 4DGZA 1C8CA 3ULJA 1VQKA 2SNMA 1I4HA 3OWFA 5C4XH 3IAYA 1PRTF 1CKNA 2AQ3B 4X66Q 1X9NA 3GQBA 4A3MG 1HA5A 5JAVA 2F0QA 4Y7NB 3S16H 2EDGA 3FRPB 5IYDG 3U50C 4ZKBB 4N9PA 5JOBA 1FGBD 4GN4B 4IFDG 1A3VA 2DNEA 2JP1A 2B2UA 1TWFB 4QUCA 3E9HA 4BS9A 1K28A 1K8MA 4HIDA 3AFPA 5M5XB 2L1BA 3SHLA 1E3PA 3BDLA 2F0EA 1N33Q 4C3HG 3U4VA 2K28A 4KTAA 1ENAA 4IFDH 1YBYA 2B2WA 2F52A 1JT8A 1G291 3MEHA 2K05A 1D1KA 2KQ3A 4Y7NH 4KJOA 4APVA 4DN4M 4X62L 1UE5A 3MXGA 4XDXA 5LL6S 1IL2A 3K0YA 4IJHA 5I2XA 2D5DA 1I4RA 1QNUA 2B63B 1HUNA 3G7LA 3RNUA 1TWFH 4PZ7A 3BDCA 1HNZL 1D5XC 5M5XH 3KDFB 4L5RC 4K5WA 4LF7Q 3DMUA 4FDBA 3UE0A 4HJ9A 1LLRD 1VMCA 1U4MA 5KEEA 2QA4A 1WFQA 2B63G 2PZUA 2F0LA 3I91A 4HJ5A 4WJWA 1O80A 2IX3A 1EFWA 3J81c 2KVMA 1WD1A 1HZ9A 1YNJC 1IKLA 2WINB 4FO2A 2B63H 5KRUA 4K14A 3SGIA 1I3QB 1LTTD 1JORA 2JA7G 2Y0SE 1KNAA 2K52A 4H44C 5M9OA 2ID0A 2IY5B 3RZOB 2PNHA 4DU9A 1SJHD 4LMQD 4ZKCB 1PFMA 3M4YA 3AU7A 5IGEA 2WB1G 3TDQA 4ABNA 1Q3LA 2NVTB 1OTCA 2CQOA 2Z4HA 2R7DA 1I3QH 1S5BD 2NB0A 2P5ZX 2BH2A 3OYYA 2VXWA 1GOZA 4MTNA 4DV3Q 3RZOH 4QL5A 5IGCA 3HOWB 3M3YB 1EY5A 1L1OA 4JI6Q 3SVMA 5BR8L 1Z47A 1LTRD 2RSOA 4DR2Q 2NVTH 1E2WA 1VQDA 2G9DA 2H1EA 3HOWG 3UE1A 4IPCA 1BCPD 4DV1Q 4LNQA 3IL8A 1V1OA 1HNXQ 4A3LH 1WTWA 1A3UA 1SYFA 5FJ8H 2F0MA 4ZUJA 1WVLA 2HHHL 1EWCA 3HOWH 3M3YH 2D0OA 2EJGC 3NXWA 3T1YQ 4OWTB 1YNNC 1RDPD 2ZM6L 3OMCA 4JI3Q 4FXKC 3P7JA 1CKOA 2OF1A 2C5CA 1A8VA 1V9PA 1K8AC 1S5DD 4L8JA 4KHPQ 2F0TA 3MXNB 3R93A 2ICIA 1G91A 3TSSA 2KEEA 3S17B 1X6OA 1IYJB 4LF5L 4MIUA 1EY0A 1FNUA 2DUDA 1QOHA 3S1QB 3W2DA 4RWSC 2ZXOA 5DNFA 3P75A 3RN5A 5M5WH 4ZK9B 4IO9A 3UI2A 3F2UA 5J1ZA 5D3IB 5IP7G 2B2YA 4KMUC 2F0UA 1KLUD 4KY5A 3EBEA 2LXJA 3J80c 2MPMA 1EYAA 3H94A 2VS1A 4NDXA 5IP7H 5IGBA 4XQQA 3Q8DA 2IHEA 3S1QH 3KUPA 4DR5L 2F4IA 3Q23A 4JBMA 4JV5L 5IGGA 1B50A 2KHJA 3DHQA 1N34Q 1I4XA 2H5XA 2KECA 4LF4L 2Q8TA 4UAIA 2IPKD 1GUGA 2GN5A 4C1NK 2PQEA 4EGVA 1VQ8A 3HKZE 1XNQL 1BCPF 1II3A 2ATWA 5M3MG 3G4SA 3KLSA 5I6WA 1XMOL 3OWEB 4QIWE 1I50B 1KAAA 5BN5A 1BDOA 1M90C 2LFNA 4CKBA 3DM1A 3PUZA 1MHWC 3CCUA 3M4PA 3N52A 4RKLA 2F0DA 3NEMA 3KF8A 1B7YB 4A3IG 1SN8A 1XJVA 2XVSA 2WAQB 2OTLA 4A3GB 4CGYB 2X6LA 1I50H 4LJZC 1YITA 3BYTB 3K5MA 1SYGA 1NTGA 3BVMA 3TP5A 4B3SQ 5JPMC 1PRTB 1FJGQ 3PIPA 4A3GG 1ENCA 5C5MA 5JEAG 2F0VA 2XN9C 5TSSA 3B6YA 2RHQB 5IT9L 4AQYL 2CFMA 3QB3A 1R9TB 2Q8RE 1PH6A 4A3GH 2G9HD 1SR3A 5JEAH 1EWIA 3CPFA 1BXTA 1CT1D 4Y52H 2RCNA 2DJGC 1VF5C 4IUVA 3NBHB 2F0SA 3DUZA 3AYHB 2KENA 4DR3Q 4G7HC 4XTCS 4XYOA 1R9TH 3GTQB 5FOBB 4HMIA 2JN4A 5CV8A 1S3OA 1IBKL 1WJJA 4Q0FA 1N36L 1IW7D 4OGQC 1HH2P 5ELEA 1EYGA 2X69A 1HNWL 3STBC 1HFNA 4CJ1B 2EJMA 3F8TA 1MSHA 3NP8A 4R8NA 1EY6A 1SNDA 4X3UA 4RHRA 2L9HA 3A8KE 3AFQA 1EUJA 4YWKA 1JJGA 2MO0A 4DXFA 3GDEA 3PIO3 1EIHA 2Z6BA 1MKHA 2JJQA 1KDCA 2SDFA 3CCLA 4OO1I 5C44B 3PIP3 2QEXA 1HXYD 1SE2A 1UEAB 3RR5A 1EY9A 3K58A 2EOTA 2Q2HA 1LYLA 2OQKA 4MN3A 1PDQA 2D9UA 1QUQA 4IPDA 1BVSA 2YV5A 1E1TA 3CCJA 3VR4A 4OWXB 1LTAD 4RGNA 4A75A 5C44H 1EU3A 4RG1A 4JVZA 4WJ4A 3A5UA 3C1EA 2VQEQ 3NK9A 1LT4D 5JJZA 2HCIA 4OWWB 4G7ZC 5T1IA 3FHWA 5A2QL 3NQTA 1CI3M 4P71A 1SAPA 1UNSA 2Z0SA 2IL8A 2JA6B 3TP8A 3I7FA 1WTHA 2F0JA 1DXMA 2XSCA 3EQLC 3R2TA 4XT3B 4BBSH 3L0OA 3VA7A 3BVGA 2SNSA 3A8JE 2PZWA 4KK7A 5AJ3Q 4LF9L 2Z1CA 1N32L 2Y0SG 3A56A 1W6JA 3D6WA 4PMWA 2KCMA 3OTOL 2CVRA 5COYA 1SMXA 2ZTEA 4IUQA 2JA6H 4JPBW 3G71A 3RLFA 2N88A 4F8MA 1LABA 2Z8LA 1A15A 5BN3A 1PH8A 1V1PA 2EYJA 2WP8J 4B3RL 1ZEQX 1RD9D 4IPHA 2HQEA 5KYLA 5ELNA 3MWYW 3KLSX 3ERQA 4JI5L 3CW2C 2EQSA 2B2TC 1AH9A 1AW7A 3I72A 1UAPA 1X3GA 5IT9E 5LMUQ 5GAHC 1D6EC 3GTLB 1VQMA 2SOBA 2XNAC 1X3EA 1MJCA 5M3FB 3HGBA 1DOKA 1EQTA 2B3GA 2H4OA 4CBVA 5IODA 4F88A 4UY8C 2C35B 3K5LA 5M3FG 3MVVA 2JE6I 4FP5D 3CHBD 3DEOA 3GTLH 5HGTA 1ICFB 5IYBG 1ASZA 4HJ7A 1GXDC 3KOJA 1XPUA 4LF6L 2NVYH 2DGYA 2EVBA 5C0XH 1Q82C 4AYBE 4L5SA 4HAEA 1GUWA 5IYBH 3NSWA 3DWPA 1Y1WB 1HCZA 3H3VC 2RDFA 4LFAQ 1LUZA 1BCPB 1DZ1A 2K4KA 1OXXK 2WFWA 4A93B 3GO5A 2IJ0A 4DV6L 2Q2IA 4UPAA 1NBWA 4RH6A 4OO1G 1GUSA 3K57A 3N6RA 1HPCA 1LACA 3VR6A 1TWGB 4LW1A 4DV0L 1PH4A 1NJIC 4O42A 4DR4Q 1X65A 1S5CD 5IYCG 4A93G 2OQ0A 3GV6A 5CGKA 1UUPA 1IBML 1J5EQ 1Y1WH 1HNZQ 1OXUA 3NPPA 4R4CA 4CDEC 1OXVA 2ZXPA 1PH1A 5G3LD 3J7A5 4O2DA 4H13C 3S1RB 1CK1A 3QR8A 2R7ZB 4H0LC 2NVXB 2VQFL 1EEFD 1A62A 2BA1A 1YJ9A 3HEJA 4RA8A 2AUJD 1STBA 2JA8B 1MD2D 2CQAA 5A2QE 1AEXA 3E5SA 3S1RH 1JE4A 1IKMA 1HR0W 2R7ZH 3NWSA 4HCEA 3BZCA 3NHHA 1AN8A 2NVXH 5J39A 2JA8G 1D8LA 4GZYC 2EPBA 3ONAB 2YTXA 4YIJA 1Q46A 3F2DA 1YJNA 3SXHA 1PZKD 4P72A 2A19A 2JA8H 1DM0B 4IZ8A 4NMZA 4L6TB 1PV4A 1U4PA 5CV7A 4DV2L 1LT3D 5IT9c 3K81C 4KY6A 3GTOB 5ELFA 1MGSA 1QVFA 3E6ZX 2PYKA 1IZ6A 1S5ED 2NYZD 3GD7A 5BR8Q 4YY3L 2MNAA 3RMHA 1VQ6A 3CCQA 1VQOA 3ND8A 2F0OA 4IALA 4NPSA 5C5LA 4DUYQ 1XNRL 3S14B 2BE5C 1R4PB 4DNTB 5C0XJ 2ZTDA 4K0KL 5I4DA 4HJAA 4QCLA 1G2TA 2PMZE 1H9SB 2PQAA 3D8GA 5CBEE 1Q12A 2UU9L 2HHHQ 4DR7L 1PH5A 1Q8KA 3GTOH 3NELA 4WORA 4IOCA 2IX1A 3X3MA 2ZM6Q 4V0BA 3G6JB 1Z9FA 5G3LF 1F9RA 2BDOA 3MTSA 1KD1C 3FMCA 1KRTA 3VDYA 3K0XA 4GN5A 3UDGA 3S14H 2DY7A 1ICWA 1AE3A 3PUWA 3H6MA 3S9WA 2UXDL 4QJFA 3JAMc 3I56A 3VYSA 5E7NA 4HSPA 4LF5Q 1F2LA 3SEBA 2E5LL 1PYSB 1W2BA 4GLVB 1ET9A 4UP9A 2R6GA 3TEHB 3IRBA 3KBXA 4XYQA 1BF4A 3T16A 5FLXc 1G6PA 3WWVA 3VR5A 2XTIA 3RUZA 4A3MB 2VW9A 3LGJA 3OHXC 4RFBA 2KHSA 4LFCL 1JCKB 2ES2A 4I7ZC 4R4OA 2EYPA 5C6AA 2RHSB 4KHVA 4GOPC 3CD6A 4JI4Q 2J4XA 1TWHB 3OIQA 4A3BG 3HOYB 5JJIA 3HKSA 2DJFC 2MUYA 2F0GA 1VMPA 3AEVA 4HIKA 4K6LA 4C3HB 1YJWA 3IKJA 2XRSD 1VQPA 5DM73 4A3MH 4LF4Q 1TR5A 2KCTA 4JOIC 5IYDH 3HOYG 4X3KA 3FP9A 2MFIA 4DAMA 1B1ZA 3CCEA 5ELBA 4TSSA 4OIJA 5C3EB 1TWHH 4ME3A 3HOYH 1V8QA 2QW7A 1JR0D 3CKIB 1E22A 1TY2A 4R4IA 1G8ZD 2K5QA 4C3HH 4EVOA 1AZQA 4I7AA 3HOVG 1XMOQ 3G6EA 3J7ZC 1CFMA 1LTBD 1PZJD 5C3EG 1UE1A 1X32A 3H3VH 1YHQA 4MNOA 1I4PA 5GAGC 2UXBQ 1NCVA 1IBLL 3OIPA 3W1BA 3GTKB 3C1FA 2K03A 3OSOA 4FVMA 1ASYA 2A74C 5KNBA 2ZJQA 4L63B 2K5NA 2JA7B 5H1SE 2Z6KA 4OEMB 1YHBA 1CHQD 3NBIA 4ID6A 1PRTC 2TSSA 1K8GA 1VQIA 1L1OB 4LF8Q 1O7LA 4ZLTF 2WB1B 3CMEA 1B4OA 1GUTA 1RF2D 1TXYA 2UUAL 1Q1EA 3I8ZA 2JA7H 4IUUA 4OELB 3CCRA 1FL0A 3PMFA 1I94Q 1F9SA 2B8GA 2F0WA 4X3TA 2XWJB 1LO5D 1SBBB 2K50A 4DUZL 2OEOA 1CQVA 3I4OA 1S4ZA 2M00A 1HR0L 2DY8A 2YYZA 1K73C 1O7IA 2F0FA 3NENA 2K5DA 3M85A 1SMYD 2LXKA 5CV9A 1EEID 5D65A 4RGMA 2JSOA 1Y8OB 1UWVA 2XRQD 1IBKQ 2JA5G 4HIMA 1WI5A 1N36Q 1C7YA 4IOAA 2Q2TA 2B2VC 1HNWQ 1EL0A 3MEFA 4S3SA 3RN2A 1GUOA 4J15A 1KQSA 2UUCL 1DOLA 4HN7A 5CV4A 4J8QA 1STYA 1B9MA 3BJUA 1CA5A 2F0KA 1OO9B 3GV3A 1JQYD 3WDNA 4UP8A 2FXQA 1SYDA 3SK5A 4IFDJ 4AYBG 4F87A 5LMNW 5DEHA 1WTOA 2A73B 3UDFA 5J22A 3M4OB 1JOKA 2RCFA 1XPRA 3C2PA 1RL2A 1EQRA 1B70B 3SK8A 1EY7A 2KJXA 5F2DA 1PFBA 4KN7C 2WKDA 4DR6L 4YHHQ 1QZHA 1SNPA 1Q90A 1JOOA 3A7AB 3M4OH 3S17H 1HQMC 4DXGA 1BNZA 1STGA 2CWPA 2ZJRA 4GOPB 2YU9B 1LT6D 4X64Q 1LM0A 2QILA 4JG2A 4JYAL 1VF7A 1GHKA 4A3JG 1OXTA 1SE4A 4TRDA 4DV5L 2NBFA 1VQGA 1PH7A 1WOCA 3KF8B 1Y69U 2PI2E 3BU2A 3T53B 3DWAA 4LF9Q 5M3MB 1N32Q 4KV6A 3Q24A 3K80C 2Q8IB 1S72A 1AE2A 1VQEA 1Y14B 3CAMA 2VL6A 3MXNA 4X66L 3PUYA 3D4WA 4XT1B 2YU9H 4FF1A 3OTOQ 3CC2A 1HHVA 4R4QA 4GKJL 1BR9A 1PMRA 2E75C 2K5HA 5IP9G 3CQZB 4B3RQ 1NMFA 2QGQA 4A3IB 3IFTA 1Q7YC 3I55A 3M9BA 5M3MH 4JI5Q 5IP9H 1T5XD 2LMCB 4EX5A 1PLFA 1Q86C 1YHAA 1ZYRD 1O7ZA 4I65A 2E2HB 1WTRA 2GVAA 4NXML 3CCVA 3CQZH 3E0EA 5J3BA 3U58A 2NWGA 4A3IH 3EROA 1A2TA 1QB5D 4FXGC 1H95A 2K14A 1DJRD 1P16A 4BXXG 1NR4A 3V05A 1KHIA 4LFBL 2KCCA 3CXCA 2MHVA 1W3SA 4P74A 1WTQA 1DONA 1M1KC 5KNDA 5EPKA 1XTDA 4FF3A 1NY4A 1VQHA 4TKOB 1Y8NB 4BXXH 1YI2A 4KKSA 2SEBD 2F3VA 4RMFA 4JI2L 4NW2A 4LF6Q 2IHFA 1XPOA 4HEDA 3SDZA 1JJ2A 1X3PA 1EYCA 1EIFA 2UUBL 1BCPC 1MJEA 2K6AA 2EE1A 2R3ZA 3A55A 3E0JA 3NTHA 1I4QA 1QE6A 1ESRA 1ILPA 4DV6Q 3URYA 4C56C 4A3KG 3J81i 4NB3A 3Q6SA 4DV0Q 3MC0B 1U9RA 1WTVA 1ILQA 1EZ6A 4O1NA 3CCSA 1PYBA 3KJOA 1Q81C 1KL9A 5EBCA 4JI1L 3E9IA 4M8AA 1IBMQ 1QUQB 1C4QA 1CKMA 1PYWD 3FPPA 3PUVA 4K6DA 5BN4A 1W6KA 1RJTA 2IT1A 1VQJA 4DK6C 2VB3X 2RDHA 3M4QA 3GTQH 4QF4A 1PTOD 3S1MB 2CH4W 2A69D 1B2TA 4KJNA 3VYRA 1SYBA 1EU4A 2EXZA 2VQFQ 3GTMB 1JC7A 4DV1L 1TKWB 3G48A 5ELDA 1HNXL 2K7VA 1M4VA 1XTCD 1TVXA 2BH8A 3LWUA 3TBIB 1EFID 5DM63 1I6HB 4KHZA 1L2FA 3AQQA 5GAEC 3BS1A 3T1YL 2EZVA 1GO3E 1VQLA 4B3TL 1YVCA 4JI3L 3E3XA 2A6HD 3S1MH 1PFNA 2F0NA 1NNXA 5LMNL 1NSNS 2RF4A 1SEBD 1XWEA 3GTMH 2J0TD 3DM3A 4DV7L 1L0YB 3ZJYC 1PVOA 1A6XA 5D14A 4K5VA 4ULLA 1I6HH 1V1PB 2B2VA 3T1HL 5EKLA 4BA2I 1D5ZC 2KOLA 4ALPA 2CW0D 1H9KA 2L12A 2Y0SB 4DV2Q 1T5EA 1H9JA 4POGA 1JOQA 3J7AF 4B3ML 3CC4A 3W3AA 4L5TA 2A6ED 5CYUA 2EYOA 4IPGA 3GTJB 3BZDB 1DGSA 1U5KA 4GS3A 4YY3Q 2CH4A 2MP1A 1L0WA 5JEAJ 1SFOB 3UDIA 2MO1A 4R8IA 1QZGA 3NTKA 1SE3A 4DV4L 1XNRQ 2I0QA 1QJOA 4R1JA 3BG3A 1WTPA 4K0KQ 1U4LA 4QB4A 3H15A 2UU9Q 4G57A 4YCUA 2QF7A 4DR7Q 4C3JB 2R7FA 4XQNA 3K6OA 3FEWX 4U673 4DK0A 5GQOA 3GTJH 3PCOB 1R4QB 2RQXA 1EQVA 5CC4A 3NE5B 3J80i 1KDAA 4HR7B 3I73A 1PTOF 1SFOH 1M8AA 1RTOA 4C3JG 2I07B 1YNXA 1JJCB 4RKBA 4UHVA 5LHY1 3PUXA 1A3TA 1D7QA 3J81L 3LWEA 4PNYA 5JPNC 2OTJA 2E5LQ 3OPOA 1VQBA 1YEZA 1JB3A 4C3JH 4DPGA 3M7GA 1BBXC 1S40A 2L4NA 1LT5D 5CBAE 3PO2B 3TQYA 4LUOA 2B2WC 2FFKB 2R92B 2K04A 3QIAA 1P8LA 3S2HB 2D2CC 2VY3A 5K5PA 2ALYB 1G51A 5M5YB 3PO2G 1E1OA 2NN6I 1XXGA 2R92G 2RBMA 3BVZA 3L7ZC 5M3FH 3EVQA 2G5DA 3K5OA 1FJGL 3HOZG 2I46A 1IW7C 5ELCA 2E8GA 3L2PA 1D5MC 1F9QA 2R92H 1LTGD 3PO3G 1K83B 3S2HH 3PF5A 5M5YH 3ZYYX 2AQ2B 1CHPD 4V190 1A2UA 3KF6A 4HSVA 1FYCA 2I5MX 3VYTA 1VQNA 2F1MA 4JCVE 2EYFA 4OX9L 4X62Q 1JE5A 1EOTA 4A3DB 4OO1H 2E2IB 2N8NA 3P1HA 3ULPA 1K83H 3Q0AA 4RGOS 1UEBA 2HQLA 1VS0A 3RD4A 4IUPA 5EKKA 5IYCH 4A93H 4OHJA 4A3DG 3RZDB 1HTPA 2K5WA 4GN3B 3CPWA 1Q8IA 1TWGH 3TP7A 2NTSA 1F2YA 2WV6D 4PZ8A 3F2CA 4A3CG 1MSGA 3D0FA 3HKZB 3T51B 4A3DH 1SLJA 2E2IH 4NKLA 1VQCA 3DXJC 4QIWB 1L1OC 4ZCKA 2QEJC 3HKZG 2WKCA 1V1QA 3RZDH 3CP0A 4H02A 5JVG3 4NXNL 1J6QA 1SNMA 1RCVD 4FF4A 3A0JA 2K33A 4U68A 4WFN3 4J1MA 3PQIA 1UE7A 3BZKA 1Y1VB 4LUVA 2AMCB 4DAYB 3J80L 2PI2A 3L3OC 2BDNA 4HCSA 3MZ5A 2L15A 1XMQL 3S1NB 4IUNA 3CRLC 2PQAB 4DUZQ 1SROA 3S24A 1HR0Q 2KA7A 2ICEC 1Y1VG 3BDOA 2JEBI 3OW7A 1KXLA 2MGSA 1YNJD 3H0GB 4A76A 4B08A 1A0IA 1Y1VH 2VQEL 2EYLA 3W5OA 3S2DB 1JWMD 4LUZA 5E3FA 3HRZC 2E2JB 4GNXB 1NAPA 2K75A 3H0GG 4JI8L 2RKSA 4XXEA 1HZBA 4C3IB 1KTKA 2PZTA 2V1CC 2AHOB 1Z7TA 4BY7B 2RA4A 2UUCQ 2NZ1D 3H0GH 2B2YC 5KGUA 1ONLA 2F4VL 1IYUA 2ZXRA 4YCVA 4C3IG 1PH3A 4FYDA 3S2DH 2KBNA 4X65L 3TMEA 1C0AA 4BY7G 4P2CB 4EQPA 2OXPA 4ZUIA 3KJPA 1K3RA 2F0IA 1CKNB 1E2ZA 4C3IH 3HOXB 4YCWA 2N78A 2TMPA 2WAQE 2NN6G 4EQ5A 1GUNA 4BY1G 2K5VA 1B44D 1JB7A 4BY7H 3VA5A 3DWQA 2JEAI 3BYYB 3I4NB 2FJ2A 3QJYA 1CQFA 3HOXG 2A1AA 4QY7A 2AUKA 5EAYA 3V96A 4DR6Q 3I4NG 4C2MB 3LNNA 1FNWA 3HOXH 3Q22A 4BBRB 1HJPA 2QCPX 4R9WA 3CC7A 4A3BB 1TQOA 5EQ0A 3M7NA 1ENFA 1YNND 1C9OA 1KAWA 1JICA 3I4NH 3T4AC 1BBWA 3S15B 4QQBX 3SR1A 3VYUA 4BBRG 3CF5A 2A5HA 3A5ZB 4DR5Q 4AH6A 2HD3A 4DKAC 4JV5Q 2OT2A 2I5HA 1VQ4A 5E1FA 1HZCA 4C2MH 2O5IC 2L55A 4GLAC 1TY0A 1QCBD 4BBRH 1RODA 4PMCA 4A3BH 1PZID 1SYCA 1HFGA 4UDUC 3HOVB 4P75A 2B2TA 2E74C 3S15H 1IYVA 4POFA 2KUMA 1IXRA 1XNQQ 2ZTCA 1PTOB 4GKJQ 3GTGB 1TIID 2RVLA 1EY4A 1BOSA 3D6CA 4LFAL 2PCFB 3D3RA 4ZAIA 2FINB 3K8AA 3X3NA 5C3WA 5GADC 5LL6X 3HOVH 1I5FA 4K8IA 5C3EH 4ZRZA 3O13A 4IQZA 1E7ZA 2XWBB 1CTMA 2UXCL 4HTHA 4DR4L 4ILWA 1PTOH 1VQ5A 1FR3A 1H9MA 4NXMQ 1EOVA 1J5EL 1PXUA 3GTGH 2NZHA 3J80E 4MHEA 2D0PA 4YWLA 1F77A 5FO9B 5IIFA 3I3CA 1STAA 2DN8A 4G7OC 2L5TA 2BCOA 5KNCA 5CV6A 1K3BC 5FO7B 1A63A 1EY8A 3GTKH 4LFBQ 4IJLA 4JI0L 2O5JC 1Q1BA 4AQYQ 4ME5A 3HG9A 5KIXA 5C4JB 1EWHA 4JI2Q 4KD3A 1C48A 2EYMA 5IWAL 4GKKL 3CRKC 2L11A 2ZJPA 2BOSA 2UUBQ 5HY6A 3PSIA 1V43A 4RAUC 2JA5B 1YZ6A 3I2ZA 3KDFA 1KRSA 4DA2A 2EYHA 4O0AA 2HIVA 3PGZA 5I6YA 3TZDA 4DK3C 5C4JH 5EBDA 1HTLD 1STHA 2EJFC 3ITPA 3OOCA 2AQ1B 1IL8A 4JI1Q 2OCEA 1QVCA 2JA5H 1SE8A 2R93B 5EKIA 4AYBB 2HUGA 2CHBD 3AMUA 2MJ8A 4EQOA 3KBGA 3HFZB 4DR1L 5C3XA 4G4KA 4JI7L 1ESFA 3HOUB 4A3LG 4BWGB 5CORA 5IE8A 2R93G 2N49A 5FJ8G 1HA6A 4DUYL 1AZPA 3HOUG 3J7AV 4TQUS 3A7LA 3QG1A 1JMCA 3FVQA 2R93H 3T13A 2N55A 1PFSA 1GVPA 1TWAB 4L5QA 3HOUH 3A74A 4MZ9A 4DF7A 4B3TQ 3U9OA 3FKIB 1J8IA 5LMNQ 5M5WB 3STBD 5I9OA 3ND9A 3ICEA 4KD4A 2LS01 3PF4A 4WJ3M 1XX8A 3FKIG 4DV7Q 4FXDA 4LWCA 4A3JB 1XYIA 4A3EB 4C1NI 1WD0A 1TWAH 2R61A 3F1ZA 2AKWB 5KYIA 2PNRC 3A8IE 1CZWA 4PG3A 3T1HQ 1X55A 3H09A 3FKIH 3DEPA 2A8VA 1LV9A 3EIVA 2XGTA 4GLXA 4QUFA 4A3EG 2VUMB 2HDLA 4B3MQ 2ENBA 4NP5A 3C46A 1TU2B 4PQXA 1HZAA 4FNFA 4A3JH 2BA0A 2O2LD 4A3EH 3JAMi 3MAQA 1BUVT 2VUMG 4JI4L 1KABA 4DV4Q 4JBJA 1FNVA 2LSSA 1D1IA 2PW7A 2VUMH 4FF2A 2AWNA 1SYEA 3I4LA 5C4ZA 1RHPA 5D3DA 1SNOA 1QG7A 1QWYA 4KN4C 1N33L 1AP0A 4B9XA 3MXPA 3VR2A 4CDDC 3EFXD 4E6IA 1VQAA 1U4RA 3NUCA 3QOJA 1GKHA 2E76C 5EPLA 4DAPA 5CMDA 1ZXTA 4CJ0B 1NR2A 2PMZB 4BA1I 4GOPA 1CSPA 4CKCA 5E4XA 2PW5A 1QILA 4ZQ3A 4LF7L 4OONA 1MI2A 1EIGA 4DNRB 4DNIA 2I5LX 4Z9CB 2UXBL 3SE0A 4JOIA 3JC66 2E2HH 3DLLA 1SMYC 5CV5A 4CDCC 5FK9C 5HGQA 2RSNA 4IN3A 3F2BA 3PIOA 1PA6A 3ERSX 2FMCA 3SK6A 1TS5A 3MFGA 3TRZA 2WAQG 1S5FD 1K9MC 4LF8L 5IY0A 4A3KB 1I4GA 5JVH3 1SDFA 1X3FA 2KHIA 3FDTA 2PPBC 2KEDA 1GHJA 1KC8C 1KNEA 3TS2A 2PO4A 5NUCA 2M9VA 1I94L 3GP7A 3GTPB 2JA9A 5ISRA 1ET6A 3HZXA 5L37A 3KYHC 3VR3A 3CCMA 3WOFA 2J7ZA 4OX9Q 2QDLA 4PMBA 2Z4IA 4A3KH 5E4WC 3EJIA 5HURA 2HCCA 1OXSC 1SRUA 1PHJA 1HUMA 4DV3L 4HMJA 1HRJA 2C9OA 1CSQA 2OWOA 1J9OA 5AFWA 2K32A 4IUTA 4JI6L 5T1GA 3GTPH 1D2BA 4DR2L 3U9SA 3UDXA 3J7YW 1TS3A 1MBYA 5C0XI 3TP6A 5DAUA 2YTVA 1FVIA 2F0HA 4LAAA 3I70A 4WRDA 3JAML 3KLWA 1SJED 1DCZA 3H91A 1N8RC 4LK1C 2NVQB 3NBHA
chains in the Genus database with same CATH topology
5CR3A 2AWOA 3MA2B 2NUCA 1BQQT 4JBWA 5FLXL 1L0XB 4B9WA 3NQIA 1AFPA 1KLGD 2F03A 1SNCA 5FKAC 3MXUA 1G6ZA 1B9NA 5IGFA 1EYDA 1STEA 3QOLA 4BBSB 4XIGS 1DYQA 3QO2A 3I4MB 3TN2A 1TS4A 1ML0D 2RDGA 4KI0A 1TWCB 5I2YA 2O4XA 2IX0A 2KCNA 1VCIA 3AB9A 1ZYRC 2LKVA 5A35A 4H7BA 3MFYA 4K2LA 1O7YA 2F0PA 2XIWA 1IHZA 2VNUD 2QKIC 4OIKA 5IOCA 4KKUA 1DD2A 2X6GA 4XQJA 4X3SA 1EZ8A 3A54A 4A3FB 1NUCA 2B2UC 2IW3A 3PV0A 1WCMB 4RGTA 4QMGA 2BE5D 1JWSD 3LX0A 2DNCA 4PV1C 1TT2A 3NTIA 3HOZB 2WIIB 1K8OA 4JK1C 2F3WA 1WTXA 3PO3B 1LTID 3R2IA 4K2KA 4EQNA 2NVYB 4RCNA 3R3OA 3L9AX 4DFAA 2A68D 4ZYSA 4RCOA 5I9PA 4IURA 1E0BA 1I6VC 2JYOA 4CKEA 5C0XG 2K1BA 1PTOC 3WOEA 1X3QA 2A69C 3R8BA 4DAVA 1DOMA 1CM9A 2B8FA 3JAME 1RKNA 3QWNA 4KKTA 4M1UB 1E2VA 3V2TA 3I90A 5FLXE 2A6HC 4N9TA 4RHSA 1F2MA 3EA6A 5C4HA 3D31A 1LTSD 3C3LA 1Y8PB 2IWHA 4IFDI 2LY7A 3P20A 1F2ZA 1STNA 4Q5VA 2NTTA 4KY7A 2L0CA 5FO8B 2CW0C 3K59A 2A6EC 3HP3A 3NWTA 2FHTA 3CU7A 1SSOA 2B39A 2M2LA 4DK1A 3SK4A 1B3AA 1KDBA 2EY5A 1PRTD 1SNQA 2D62A 3KK7A 4CJ2C 1G2SA 1Z6HA 1ZKOA 1FD7D 1BO0A 3TZUA 5EPJA 3J81E 3T56B 2FMMA 1H9RA 2E2DC 5EGTA 3HS0C 4BY1B 1RTNA 2WACA 3D4DA 4CHTB 4DAYA 4F7XA 1F9PA 1O78A 2EY1A 2QDBA 5EJWA 2HDMA 2NN6H 4K8JA 1HQRD 3K7AB 3KLRA 3K5NA 3D4RA 3OMGA 1GJXA 2EY2A 2GA4B 2V4DA 4OL7A 1CZGA 2A68C 5C4XB 1QNKA 4K5XA 5K36G 1SXTA 1B53A 2JXMB 4J6HA 2EY6A 2VB2X 1TS2A 1JWUD 1VDZA 1CA6A 3S16B 2K01A 4ODGA 2ZT9C 5IGDA 1H9SA 3MHBA 5K36H 3IFDA 3FPUB 4DGZA 1C8CA 2SNMA 1I4HA 3OWFA 3IAYA 1PRTF 2AQ3B 3GQBA 1HA5A 5JAVA 2F0QA 4Y7NB 2EDGA 3FRPB 4ZKBB 4N9PA 5JOBA 1FGBD 4IFDG 1A3VA 4QUCA 2DNEA 2B2UA 1TWFB 2JP1A 4BS9A 1K8MA 5M5XB 2L1BA 3SHLA 3BDLA 2F0EA 4C3HG 2K28A 4KTAA 1ENAA 4IFDH 2B2WA 1G291 3MEHA 2K05A 1D1KA 2KQ3A 4KJOA 4DN4M 3MXGA 4XDXA 5LL6S 3K0YA 5I2XA 2D5DA 1I4RA 1QNUA 2B63B 1HUNA 3G7LA 3BDCA 1D5XC 4K5WA 3DMUA 1LLRD 1VMCA 1U4MA 5KEEA 2PZUA 2F0LA 3I91A 4WJWA 1O80A 2IX3A 2KVMA 1WD1A 1YNJC 1IKLA 2WINB 4FO2A 5KRUA 4K14A 1I3QB 1LTTD 1JORA 1KNAA 4H44C 5M9OA 2ID0A 3RZOB 4DU9A 1SJHD 4LMQD 4ZKCB 1PFMA 3M4YA 3AU7A 5IGEA 3TDQA 4ABNA 1Q3LA 2NVTB 2Z4HA 1S5BD 2NB0A 2VXWA 1GOZA 5IGCA 3HOWB 3M3YB 1EY5A 3SVMA 1Z47A 1LTRD 2RSOA 1E2WA 2G9DA 2H1EA 1BCPD 3IL8A 1V1OA 1WTWA 1A3UA 1SYFA 2F0MA 4ZUJA 1WVLA 1EWCA 2EJGC 3NXWA 1YNNC 1RDPD 3OMCA 4FXKC 3P7JA 2OF1A 2C5CA 1S5DD 4L8JA 2F0TA 3R93A 2ICIA 1G91A 3TSSA 2KEEA 3S17B 4MIUA 1EY0A 1FNUA 1QOHA 3S1QB 3W2DA 4RWSC 2ZXOA 5DNFA 3P75A 4ZK9B 3UI2A 3F2UA 5J1ZA 5D3IB 2B2YA 4KMUC 2F0UA 1KLUD 4KY5A 2MPMA 1EYAA 3H94A 4NDXA 5IGBA 4XQQA 3KUPA 2F4IA 3Q23A 5IGGA 1B50A 3DHQA 1I4XA 2KECA 2Q8TA 4UAIA 2IPKD 1GUGA 4C1NK 2PQEA 4EGVA 1BCPF 1II3A 3KLSA 5I6WA 3OWEB 1I50B 1KAAA 5BN5A 1BDOA 2LFNA 4CKBA 3DM1A 3PUZA 3N52A 4RKLA 2F0DA 3KF8A 2XVSA 2WAQB 4A3GB 4CGYB 2X6LA 4LJZC 3BYTB 3K5MA 1SYGA 3BVMA 3TP5A 5JPMC 1PRTB 1ENCA 5C5MA 5JEAG 2F0VA 2XN9C 5TSSA 5IT9L 3QB3A 1R9TB 2Q8RE 2G9HD 5JEAH 1BXTA 1CT1D 1VF5C 4IUVA 2F0SA 3DUZA 4G7HC 4XTCS 4XYOA 3GTQB 5FOBB 4HMIA 5CV8A 4Q0FA 1IW7D 4OGQC 5ELEA 2X69A 1HFNA 4CJ1B 2EJMA 1MSHA 3NP8A 4R8NA 1EY6A 1SNDA 4X3UA 4RHRA 2L9HA 3A8KE 4DXFA 1EIHA 3PIO3 1KDCA 2SDFA 4OO1I 5C44B 3PIP3 1HXYD 1SE2A 1UEAB 1EY9A 3K58A 2EOTA 4MN3A 1PDQA 2D9UA 3VR4A 1LTAD 4RGNA 1EU3A 3C1EA 3NK9A 1LT4D 5JJZA 2HCIA 4G7ZC 5T1IA 5A2QL 3NQTA 1CI3M 1SAPA 1UNSA 2IL8A 2JA6B 3TP8A 2F0JA 1DXMA 2XSCA 3EQLC 3R2TA 4XT3B 3VA7A 3BVGA 2SNSA 3A8JE 2PZWA 4KK7A 2Z1CA 3A56A 1W6JA 3D6WA 4PMWA 2CVRA 5COYA 4IUQA 3RLFA 2N88A 4F8MA 1LABA 2Z8LA 1A15A 5BN3A 1V1PA 2EYJA 2WP8J 1ZEQX 1RD9D 2HQEA 5KYLA 3MWYW 3KLSX 3ERQA 2B2TC 1AW7A 3I72A 1UAPA 5IT9E 1D6EC 3GTLB 2SOBA 2XNAC 5M3FB 3HGBA 1DOKA 1EQTA 2H4OA 4CBVA 5IODA 4F88A 3K5LA 3MVVA 2JE6I 4FP5D 3CHBD 3DEOA 5HGTA 1GXDC 2EVBA 5C0XH 4HAEA 1GUWA 1Y1WB 3NSWA 3DWPA 1HCZA 3H3VC 2RDFA 1DZ1A 1BCPB 1OXXK 4A93B 3GO5A 2IJ0A 4RH6A 4OO1G 1GUSA 3K57A 3N6RA 1HPCA 1LACA 3VR6A 1TWGB 4O42A 1S5CD 3GV6A 5CGKA 1UUPA 1OXUA 3NPPA 1OXVA 2ZXPA 5G3LD 4H13C 3S1RB 1CK1A 2R7ZB 4H0LC 2NVXB 1EEFD 2BA1A 3HEJA 4RA8A 2AUJD 1STBA 2JA8B 1MD2D 2CQAA 5A2QE 1AEXA 3E5SA 1JE4A 1IKMA 3NWSA 4HCEA 3NHHA 1AN8A 5J39A 4GZYC 2EPBA 3ONAB 4YIJA 3SXHA 1PZKD 1DM0B 4IZ8A 4NMZA 4L6TB 1U4PA 5CV7A 1LT3D 4KY6A 3GTOB 5ELFA 1MGSA 3E6ZX 2PYKA 2NYZD 1S5ED 3GD7A 3RMHA 3ND8A 2F0OA 4IALA 5C5LA 3S14B 2BE5C 1R4PB 4DNTB 5C0XJ 4QCLA 1G2TA 5I4DA 1H9SB 3D8GA 5CBEE 1Q12A 4WORA 2IX1A 3X3MA 4V0BA 3G6JB 5G3LF 1F9RA 2BDOA 3MTSA 3FMCA 2DY7A 1ICWA 3PUWA 3H6MA 3S9WA 3VYSA 4HSPA 1F2LA 3SEBA 1ET9A 2R6GA 3KBXA 4XYQA 1BF4A 3T16A 3VR5A 3RUZA 4A3MB 3OHXC 4RFBA 2KHSA 1JCKB 4I7ZC 2EYPA 5C6AA 4KHVA 2J4XA 1TWHB 3OIQA 3HOYB 2MUYA 2F0GA 1VMPA 4K6LA 4C3HB 3IKJA 2XRSD 5DM73 1TR5A 4X3KA 1B1ZA 5ELBA 4TSSA 4OIJA 5C3EB 1V8QA 1JR0D 3CKIB 1TY2A 1G8ZD 2K5QA 4EVOA 1AZQA 1CFMA 1LTBD 1PZJD 1X32A 1I4PA 1NCVA 3OIPA 3GTKB 3C1FA 2K03A 3OSOA 4FVMA 2A74C 5KNBA 4L63B 2JA7B 3NBIA 1CHQD 4ID6A 1PRTC 2TSSA 1O7LA 4ZLTF 2WB1B 1B4OA 1GUTA 1RF2D 1Q1EA 3I8ZA 4IUUA 3PMFA 1F9SA 2B8GA 2F0WA 4X3TA 2XWJB 1LO5D 1SBBB 2OEOA 1CQVA 1S4ZA 2M00A 2DY8A 2YYZA 2F0FA 2K5DA 3M85A 1SMYD 5CV9A 1EEID 5D65A 4RGMA 2JSOA 1Y8OB 2XRQD 2B2VC 1EL0A 4S3SA 1GUOA 1DOLA 4HN7A 5CV4A 4J8QA 1STYA 1B9MA 1CA5A 2F0KA 1OO9B 3GV3A 1JQYD 3WDNA 1SYDA 3SK5A 4IFDJ 4F87A 1WTOA 5DEHA 2A73B 5J22A 3M4OB 1JOKA 3C2PA 3SK8A 1EY7A 2KJXA 5F2DA 1PFBA 4KN7C 2WKDA 1SNPA 1Q90A 1JOOA 3A7AB 1HQMC 4DXGA 1BNZA 1STGA 2YU9B 1LT6D 2QILA 1VF7A 1GHKA 1OXTA 1SE4A 4TRDA 2NBFA 1Y69U 3T53B 3DWAA 5M3MB 4KV6A 3Q24A 2Q8IB 3MXNA 3PUYA 3D4WA 4XT1B 4FF1A 1HHVA 1BR9A 1PMRA 2E75C 3CQZB 4A3IB 3IFTA 1T5XD 2LMCB 1PLFA 1ZYRD 1O7ZA 4I65A 2E2HB 1WTRA 2NWGA 3EROA 1A2TA 1QB5D 4FXGC 1DJRD 1NR4A 3V05A 2KCCA 2MHVA 1WTQA 1DONA 5KNDA 5EPKA 4FF3A 4TKOB 1Y8NB 4KKSA 2SEBD 2F3VA 4NW2A 4HEDA 3SDZA 1X3PA 1EYCA 1BCPC 2K6AA 2EE1A 2R3ZA 3A55A 3E0JA 3NTHA 1I4QA 1QE6A 1ESRA 1ILPA 3URYA 4C56C 3Q6SA 3MC0B 1U9RA 1WTVA 1ILQA 1EZ6A 4O1NA 5EBCA 4M8AA 3FPPA 1C4QA 4K6DA 1PYWD 3PUVA 5BN4A 1W6KA 1RJTA 2IT1A 2VB3X 2RDHA 4QF4A 1PTOD 3S1MB 2A69D 1B2TA 4KJNA 3VYRA 1SYBA 1EU4A 2EXZA 3GTMB 1JC7A 1TKWB 5ELDA 2K7VA 1M4VA 1XTCD 1TVXA 3LWUA 3TBIB 1EFID 5DM63 1I6HB 4KHZA 3BS1A 2EZVA 2A6HD 1PFNA 2F0NA 1NSNS 1SEBD 1XWEA 2J0TD 1L0YB 1A6XA 5D14A 4K5VA 4ULLA 1V1PB 2B2VA 5EKLA 4BA2I 1D5ZC 2KOLA 2CW0D 1H9KA 2L12A 2Y0SB 1T5EA 1H9JA 1JOQA 3J7AF 3W3AA 2A6ED 5CYUA 2EYOA 3GTJB 3BZDB 5JEAJ 2MP1A 1SFOB 4R8IA 3NTKA 1SE3A 1QJOA 3BG3A 1WTPA 1U4LA 4QB4A 4G57A 2QF7A 4C3JB 4XQNA 3K6OA 3FEWX 4U673 4DK0A 1R4QB 2RQXA 1EQVA 5CC4A 3NE5B 1KDAA 4HR7B 3I73A 1PTOF 1M8AA 1RTOA 4C3JG 2I07B 4RKBA 5LHY1 3PUXA 1A3TA 3J81L 3LWEA 4PNYA 5JPNC 3OPOA 1JB3A 3M7GA 1BBXC 2L4NA 1LT5D 5CBAE 3PO2B 2B2WC 2FFKB 2R92B 2K04A 3QIAA 3S2HB 2D2CC 5K5PA 5M5YB 2NN6I 1XXGA 2RBMA 3BVZA 3L7ZC 3EVQA 3K5OA 2I46A 1IW7C 5ELCA 1D5MC 1F9QA 1LTGD 1K83B 3ZYYX 2AQ2B 1CHPD 4V190 1A2UA 4HSVA 1FYCA 3VYTA 2F1MA 2EYFA 1EOTA 4A3DB 4OO1H 2E2IB 3P1HA 3Q0AA 4RGOS 3RD4A 4IUPA 5EKKA 4OHJA 3RZDB 1HTPA 2K5WA 1Q8IA 3TP7A 2NTSA 1F2YA 2WV6D 1MSGA 3HKZB 3T51B 4NKLA 3DXJC 4QIWB 2QEJC 2WKCA 5JVG3 1SNMA 1RCVD 4FF4A 2K33A 4U68A 4WFN3 4J1MA 1Y1VB 3J80L 3L3OC 2BDNA 4HCSA 3MZ5A 3S1NB 4IUNA 3CRLC 2KA7A 2ICEC 3BDOA 2JEBI 3OW7A 2MGSA 1YNJD 3H0GB 4B08A 2EYLA 3S2DB 1JWMD 5E3FA 2E2JB 3HRZC 1NAPA 2RKSA 4XXEA 4C3IB 1KTKA 2PZTA 1Z7TA 4BY7B 2RA4A 2NZ1D 2B2YC 5KGUA 1ONLA 1IYUA 2ZXRA 4C3IG 4FYDA 3TMEA 4P2CB 4EQPA 2OXPA 4ZUIA 2F0IA 1E2ZA 3HOXB 2TMPA 2NN6G 1GUNA 1B44D 3VA5A 3DWQA 2JEAI 3BYYB 3I4NB 2FJ2A 3QJYA 1CQFA 2AUKA 3V96A 4C2MB 3LNNA 1FNWA 3Q22A 4BBRB 2QCPX 4R9WA 4A3BB 1TQOA 5EQ0A 3M7NA 1ENFA 1YNND 1JICA 3T4AC 3S15B 3SR1A 3VYUA 2A5HA 2OT2A 5E1FA 2O5IC 2L55A 1TY0A 1QCBD 1RODA 4PMCA 1PZID 1SYCA 1HFGA 4UDUC 3HOVB 2B2TA 2E74C 1IYVA 2KUMA 1PTOB 3GTGB 1TIID 2RVLA 1EY4A 1BOSA 3D6CA 2PCFB 3D3RA 4ZAIA 2FINB 3X3NA 5C3WA 5LL6X 4K8IA 4ZRZA 3O13A 4IQZA 2XWBB 1CTMA 4HTHA 4ILWA 1PTOH 1FR3A 1H9MA 1PXUA 3J80E 4MHEA 1F77A 5FO9B 5IIFA 3I3CA 1STAA 2DN8A 4G7OC 2L5TA 2BCOA 5KNCA 5CV6A 5FO7B 1EY8A 2O5JC 1Q1BA 4ME5A 3HG9A 5KIXA 5C4JB 1EWHA 4KD3A 1C48A 2EYMA 3CRKC 2L11A 2BOSA 1V43A 4RAUC 2JA5B 4DA2A 2EYHA 5I6YA 3TZDA 5EBDA 1HTLD 1STHA 2EJFC 3ITPA 3OOCA 2AQ1B 1IL8A 2R93B 5EKIA 4AYBB 2HUGA 2CHBD 3AMUA 2MJ8A 4EQOA 3KBGA 5C3XA 4G4KA 3HOUB 1ESFA 4BWGB 5CORA 1HA6A 1AZPA 3J7AV 4TQUS 3A7LA 3QG1A 3FVQA 3T13A 2N55A 1TWAB 4DF7A 3U9OA 3FKIB 1J8IA 5M5WB 5I9OA 3ND9A 4KD4A 2LS01 1XX8A 4FXDA 4A3JB 1XYIA 4A3EB 4C1NI 1WD0A 2R61A 5KYIA 2PNRC 3A8IE 1CZWA 3H09A 3DEPA 1LV9A 4QUFA 2VUMB 2HDLA 2ENBA 4NP5A 3C46A 1TU2B 4PQXA 4FNFA 2BA0A 2O2LD 3MAQA 1BUVT 1KABA 1FNVA 1D1IA 2PW7A 4FF2A 2AWNA 1SYEA 3I4LA 5C4ZA 5D3DA 1RHPA 1SNOA 1QG7A 1QWYA 4KN4C 1AP0A 4B9XA 3MXPA 3VR2A 3EFXD 4E6IA 1U4RA 3NUCA 3QOJA 5CMDA 4DAPA 2E76C 5EPLA 1ZXTA 4CJ0B 1NR2A 2PMZB 4BA1I 4CKCA 5E4XA 2PW5A 1QILA 4ZQ3A 1MI2A 1EIGA 4DNRB 4Z9CB 3SE0A 1SMYC 5CV5A 5FK9C 2RSNA 4IN3A 2FMCA 3SK6A 1TS5A 3MFGA 1S5FD 4A3KB 1I4GA 5JVH3 1SDFA 3FDTA 2PPBC 2KEDA 1GHJA 1KNEA 2PO4A 5NUCA 2M9VA 3GP7A 3GTPB 5ISRA 1ET6A 3HZXA 3VR3A 3WOFA 2J7ZA 4PMBA 2Z4IA 5E4WC 5HURA 3EJIA 2HCCA 1OXSC 1HUMA 4HMJA 1HRJA 2C9OA 1J9OA 5AFWA 2K32A 4IUTA 5T1GA 1D2BA 3U9SA 3J7YW 1TS3A 1MBYA 5C0XI 3TP6A 5DAUA 2F0HA 4LAAA 3I70A 4WRDA 3JAML 1SJED 1DCZA 3H91A 4LK1C 2NVQB 3NBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMU A;  5CR3 A;  3E5S A;  4DFA A;  1SYE A;  5EKK A;  2NUC A;  5C4Z A;  5CV4 A;  5I9P A;  1JOQ A;  1STY A;  1SNO A;  2HQE A;  1TR5 A;  3NHH A;  5EGT A;  2F0K A;  5J1Z A;  5KYL A;  5KEE A;  5J39 A;  2EYH A;  3ERQ A;  1SYD A;  2F0U A;  4HMI A;  2EYO A;  2PZU A;  2F0L A;  2WAC A;  4KY5 A;  3D4D A;  5CV8 A;  3SK5 A;  4B9W A;  3TP7 A;  3MXP A;  4B9X A;  5I6Y A;  1TQO A;  1F2Y A;  5DEH A;  4E6I A;  1EYA A;  4NDX A;  5J22 A;  5IGB A;  1JOK A;  2F3V A;  1STH A;  4YIJ A;  4F7X A;  3ITP A;  1SNC A;  2SOB A;  3NUC A;  3QOJ A;  3SXH A;  5KRU A;  4IZ8 A;  4K14 A;  4NMZ A;  4NKL A;  3SR1 A;  4EVO A;  2EY1 A;  4QB4 A;  2QDB A;  3NP8 A;  1JOR A;  5IGG A;  3SK8 A;  1EYC A;  4G57 A;  1EY6 A;  1EY7 A;  1SND A;  2PW5 A;  3DHQ A;  4R8N A;  5CV7 A;  4ZQ3 A;  5IGF A;  4EQO A;  5F2D A;  1EYD A;  5IOD A;  4K8J A;  5E1F A;  3QOL A;  5C3X A;  5M9O A;  1RKN A;  4KY6 A;  1SNM A;  1EQV A;  4DU9 A;  5CC4 A;  4PMC A;  3MVV A;  1KDA A;  2PYK A;  1SNP A;  1SYC A;  3OMG A;  2EY2 A;  3C1F A;  4J1M A;  1JOO A;  3OSO A;  1KDC A;  3V2T A;  4OL7 A;  5IGE A;  2PQE A;  5HGT A;  2F0O A;  4RKB A;  1U9R A;  4IAL A;  3MZ5 A;  5C5L A;  1EZ6 A;  5CV5 A;  4K5X A;  4N9T A;  1A3T A;  4IUN A;  1EY9 A;  1STG A;  1II3 A;  4PNY A;  4J6H A;  2EY6 A;  3T13 A;  1F2M A;  3D8G A;  4ID6 A;  4K6D A;  5I6W A;  3SK6 A;  2O4X A;  4ODG A;  5C4H A;  5IGD A;  1EY4 A;  3D6C A;  2LKV A;  3MHB A;  4TRD A;  4WOR A;  4DF7 A;  3U9O A;  4H7B A;  1KAA A;  2RDF A;  5IGC A;  5IIF A;  1F2Z A;  4K2L A;  1EY5 A;  4QF4 A;  4DGZ A;  5I9O A;  1STN A;  2F0P A;  5C3W A;  2SNM A;  2EYL A;  4KD4 A;  1IHZ A;  2F0S A;  4KJN A;  4RKL A;  3C1E A;  5E3F A;  2F0D A;  3OWF A;  3NK9 A;  4K8I A;  4KV6 A;  4KY7 A;  1SYB A;  5NUC A;  5K5P A;  2EXZ A;  4HTH A;  3PMF A;  2F0W A;  5IOC A;  3H6M A;  3D4W A;  3HZX A;  3S9W A;  5ISR A;  2RKS A;  2OEO A;  3NQT A;  2RBM A;  2F0Q A;  5JAV A;  4PMB A;  2PZT A;  5CGK A;  5KYI A;  1A3U A;  1SYG A;  2M00 A;  1EZ8 A;  1SYF A;  3EVQ A;  4N9P A;  3TP8 A;  1NUC A;  2F0F A;  2F0M A;  3EJI A;  4ZUJ A;  5JOB A;  3TP5 A;  1A2T A;  5HUR A;  2F0J A;  1STA A;  1A3V A;  3NXW A;  5KGU A;  4HMJ A;  3T16 A;  1ENC A;  3OMC A;  2F0N A;  5CV6 A;  5C5M A;  3SK4 A;  2OF1 A;  2ENB A;  5CV9 A;  2F0V A;  4QMG A;  4NP5 A;  3SHL A;  1EY8 A;  1NSN S;  3TME A;  3LX0 A;  1KDB A;  3BDL A;  2F0E A;  2SNS A;  2EY5 A;  3RUZ A;  1TT2 A;  2PZW A;  4EQP A;  2OXP A;  3QB3 A;  4KTA A;  4ZUI A;  1ENA A;  2F0T A;  2F0I A;  2KHS A;  1A2U A;  3MEH A;  1SNQ A;  2KQ3 A;  2EYP A;  4ME5 A;  4I65 A;  3TP6 A;  5C6A A;  1KAB A;  4KHV A;  4KJO A;  5DAU A;  2EYF A;  5KIX A;  2F0H A;  4LAA A;  2F3W A;  3HEJ A;  4KD3 A;  4K5V A;  4MIU A;  3VA5 A;  1EY0 A;  4WRD A;  2EYM A;  4S3S A;  4K2K A;  2F0G A;  2PW7 A;  5EKL A;  1STB A;  4EQN A;  4F8M A;  3R3O A;  3P1H A;  3BDC A;  3ERO A;  2EYJ A;  1AEX A;  3P75 A;  4K5W A; 
#chains in the Genus database with same CATH topology
 5CR3 A;  2AWO A;  3MA2 B;  1MIU A;  2NUC A;  4NXN Q;  1E24 A;  1BQQ T;  4JBW A;  5FLX L;  1VQF A;  3RLO A;  3W1G A;  1L0X B;  4B9W A;  4KHP L;  3NQI A;  2NZO A;  2N3S A;  1AFP A;  1KLG D;  2F03 A;  3ER0 A;  2HIX A;  1XMQ Q;  4HIO A;  1BBU A;  1SNC A;  5FKA C;  3MXU A;  1G6Z A;  2NVQ H;  5C44 G;  5GRO A;  1N9W A;  1B9N A;  5IGF A;  3RLN A;  3U4Z A;  1EYD A;  1STE A;  3QOL A;  4YHH L;  4X6A H;  4BBS B;  4GNX C;  4XIG S;  1DYQ A;  2YTY A;  1X56 A;  4QGU A;  3QO2 A;  1GM5 A;  3I4M B;  3TN2 A;  1TS4 A;  4JI8 Q;  1ML0 D;  2RDG A;  4BBS G;  4X64 L;  4P73 A;  3ULL A;  4KI0 A;  1TWC B;  5I2Y A;  2O4X A;  4UP7 A;  2IX0 A;  2KCN A;  1VCI A;  1CUK A;  3AB9 A;  1ZYR C;  1N34 L;  3I4M G;  2LKV A;  2F4V Q;  5A35 A;  4H7B A;  3MFY A;  2F3I A;  2EIF A;  4K2L A;  1O7Y A;  4X65 Q;  3TRE A;  2JA6 G;  2F0P A;  2XIW A;  1IHZ A;  1BKB A;  2QKI C;  2VNU D;  3I4M H;  4OIK A;  3KFU A;  5IOC A;  4KKU A;  2EXD A;  1DD2 A;  2X6G A;  2UXD Q;  1YIJ A;  1TWC H;  4XQJ A;  4YWM A;  4X3S A;  1EZ8 A;  3A54 A;  4A3F B;  1NUC A;  2B2U C;  2IW3 A;  3PV0 A;  1WCM B;  4RGT A;  2WB1 E;  4A4I A;  1NE3 A;  4QMG A;  2BE5 D;  1JWS D;  3LX0 A;  2DNC A;  4PV1 C;  1B3Q A;  4A3F G;  1TT2 A;  3KF6 B;  2GVB A;  1WCM G;  3NTI A;  2VZA A;  1VQ9 A;  4LFC Q;  3CMA A;  5DLQ E;  3HOZ B;  2WII B;  1K8O A;  4JK1 C;  1GD7 A;  4A3F H;  2F3W A;  1WTX A;  3PO3 B;  1LTI D;  3R2I A;  1T9H A;  1WCM H;  4K2K A;  4EQN A;  2NVY B;  4B3S L;  4RCN A;  3R3O A;  3PO2 H;  3L9A X;  4DFA A;  2A68 D;  4ZYS A;  1EIY B;  4RCO A;  5I9P A;  4R4T A;  4IUR A;  1E0B A;  3K7U C;  1I6V C;  2JYO A;  4JC0 A;  5JJL A;  3HOZ H;  4CKE A;  5C0X G;  2Z6K C;  1U0L A;  2K1B A;  3PO3 H;  1PTO C;  3WOE A;  1X3Q A;  2A69 C;  4JW0 A;  3R8B A;  4DAV A;  4TVA B;  1DOM A;  1PH2 A;  1CM9 A;  2B8F A;  4DR3 L;  3JAM E;  1RKN A;  3QWN A;  4KKT A;  4M1U B;  4MTK A;  1EQQ A;  1E2V A;  1IBL Q;  3V2T A;  1Y1W G;  2UXC Q;  3I90 A;  5FLX E;  2ASB A;  2A6H C;  3EN2 A;  4N9T A;  2CCZ A;  4RHS A;  4N8X 1;  1B8A A;  1F2M A;  4PZ6 A;  3EA6 A;  5C4H A;  3D31 A;  1LTS D;  3C3L A;  4A3C H;  1Y8P B;  2IWH A;  4CDF C;  4IFD I;  2LY7 A;  3P20 A;  1F2Z A;  2HT1 A;  2MQH A;  1STN A;  4Q5V A;  4JI0 Q;  2UUA Q;  2NTT A;  4KY7 A;  2L0C A;  5FO8 B;  2CW0 C;  1K0R A;  2B29 A;  1VQ7 A;  1UE6 A;  3K59 A;  3H3V I;  4OXP A;  2R7Z G;  1WYD A;  2JK8 A;  2CKZ B;  2A6E C;  3HP3 A;  3OW2 A;  5IWA Q;  4GKK Q;  3NWT A;  3CU7 A;  2FHT A;  1SSO A;  2B39 A;  2M2L A;  5ELO A;  4DK1 A;  2Z9H A;  3SK4 A;  1B3A A;  1KDB A;  2EY5 A;  1PRT D;  1K0S A;  4KLK A;  1LTL A;  1FGU A;  1SNQ A;  2D62 A;  3S1N H;  3KK7 A;  3TS0 A;  4CJ2 C;  1QVG A;  1G2S A;  2JQO A;  1Z6H A;  2Q2U A;  1ZKO A;  1FD7 D;  1BO0 A;  3TZU A;  5EPJ A;  3J81 E;  3T56 B;  1PH9 A;  4DR1 Q;  2FMM A;  4JI7 Q;  1H9R A;  2E2D C;  5EGT A;  3HS0 C;  4BY1 B;  2CWA A;  2E2J H;  1RTN A;  2WAC A;  5AJ3 L;  4HJ8 A;  3D4D A;  4CHT B;  4DAY A;  1X54 A;  4F7X A;  1F9P A;  1O78 A;  2EY1 A;  2QDB A;  5EJW A;  2HDM A;  2NN6 H;  4JBK A;  4K8J A;  4BY1 H;  1HQR D;  3K7A B;  3KLR A;  3K5N A;  3D4R A;  3OMG A;  3J81 j;  1GJX A;  2EY2 A;  1RIP A;  2GA4 B;  1KIX A;  2V4D A;  4N8F A;  4OL7 A;  1CZG A;  5FLM G;  2A68 C;  4GNX A;  1NMG A;  5LMU L;  5C4X B;  5JJK A;  1QNK A;  4K5X A;  5K36 G;  4AIM A;  1SXT A;  1B53 A;  2JXM B;  4J6H A;  2EY6 A;  2VB2 X;  1TS2 A;  1JWU D;  1VDZ A;  5FLM H;  1CA6 A;  3S16 B;  2K01 A;  4ODG A;  3K7A H;  2ZT9 C;  5IGD A;  4JYA Q;  1H9S A;  5C4X G;  3MHB A;  5K36 H;  4DV5 Q;  3IFD A;  3FPU B;  4DGZ A;  1C8C A;  3ULJ A;  1VQK A;  2SNM A;  1I4H A;  3OWF A;  5C4X H;  3IAY A;  1PRT F;  1CKN A;  2AQ3 B;  4X66 Q;  1X9N A;  3GQB A;  4A3M G;  1HA5 A;  5JAV A;  2F0Q A;  4Y7N B;  3S16 H;  2EDG A;  3FRP B;  5IYD G;  3U50 C;  4ZKB B;  4N9P A;  5JOB A;  1FGB D;  4GN4 B;  4IFD G;  1A3V A;  2DNE A;  2JP1 A;  2B2U A;  1TWF B;  4QUC A;  3E9H A;  4BS9 A;  1K28 A;  1K8M A;  4HID A;  3AFP A;  5M5X B;  2L1B A;  3SHL A;  1E3P A;  3BDL A;  2F0E A;  1N33 Q;  4C3H G;  3U4V A;  2K28 A;  4KTA A;  1ENA A;  4IFD H;  1YBY A;  2B2W A;  2F52 A;  1JT8 A;  1G29 1;  3MEH A;  2K05 A;  1D1K A;  2KQ3 A;  4Y7N H;  4KJO A;  4APV A;  4DN4 M;  4X62 L;  1UE5 A;  3MXG A;  4XDX A;  5LL6 S;  1IL2 A;  3K0Y A;  4IJH A;  5I2X A;  2D5D A;  1I4R A;  1QNU A;  2B63 B;  1HUN A;  3G7L A;  3RNU A;  1TWF H;  4PZ7 A;  3BDC A;  1HNZ L;  1D5X C;  5M5X H;  3KDF B;  4L5R C;  4K5W A;  4LF7 Q;  3DMU A;  4FDB A;  3UE0 A;  4HJ9 A;  1LLR D;  1VMC A;  1U4M A;  5KEE A;  2QA4 A;  1WFQ A;  2B63 G;  2PZU A;  2F0L A;  3I91 A;  4HJ5 A;  4WJW A;  1O80 A;  2IX3 A;  1EFW A;  3J81 c;  2KVM A;  1WD1 A;  1HZ9 A;  1YNJ C;  1IKL A;  2WIN B;  4FO2 A;  2B63 H;  5KRU A;  4K14 A;  3SGI A;  1I3Q B;  1LTT D;  1JOR A;  2JA7 G;  2Y0S E;  1KNA A;  2K52 A;  4H44 C;  5M9O A;  2ID0 A;  2IY5 B;  3RZO B;  2PNH A;  4DU9 A;  1SJH D;  4LMQ D;  4ZKC B;  1PFM A;  3M4Y A;  3AU7 A;  5IGE A;  2WB1 G;  3TDQ A;  4ABN A;  1Q3L A;  2NVT B;  1OTC A;  2CQO A;  2Z4H A;  2R7D A;  1I3Q H;  1S5B D;  2NB0 A;  2P5Z X;  2BH2 A;  3OYY A;  2VXW A;  1GOZ A;  4MTN A;  4DV3 Q;  3RZO H;  4QL5 A;  5IGC A;  3HOW B;  3M3Y B;  1EY5 A;  1L1O A;  4JI6 Q;  3SVM A;  5BR8 L;  1Z47 A;  1LTR D;  2RSO A;  4DR2 Q;  2NVT H;  1E2W A;  1VQD A;  2G9D A;  2H1E A;  3HOW G;  3UE1 A;  4IPC A;  1BCP D;  4DV1 Q;  4LNQ A;  3IL8 A;  1V1O A;  1HNX Q;  4A3L H;  1WTW A;  1A3U A;  1SYF A;  5FJ8 H;  2F0M A;  4ZUJ A;  1WVL A;  2HHH L;  1EWC A;  3HOW H;  3M3Y H;  2D0O A;  2EJG C;  3NXW A;  3T1Y Q;  4OWT B;  1YNN C;  1RDP D;  2ZM6 L;  3OMC A;  4JI3 Q;  4FXK C;  3P7J A;  1CKO A;  2OF1 A;  2C5C A;  1A8V A;  1V9P A;  1K8A C;  1S5D D;  4L8J A;  4KHP Q;  2F0T A;  3MXN B;  3R93 A;  2ICI A;  1G91 A;  3TSS A;  2KEE A;  3S17 B;  1X6O A;  1IYJ B;  4LF5 L;  4MIU A;  1EY0 A;  1FNU A;  2DUD A;  1QOH A;  3S1Q B;  3W2D A;  4RWS C;  2ZXO A;  5DNF A;  3P75 A;  3RN5 A;  5M5W H;  4ZK9 B;  4IO9 A;  3UI2 A;  3F2U A;  5J1Z A;  5D3I B;  5IP7 G;  2B2Y A;  4KMU C;  2F0U A;  1KLU D;  4KY5 A;  3EBE A;  2LXJ A;  3J80 c;  2MPM A;  1EYA A;  3H94 A;  2VS1 A;  4NDX A;  5IP7 H;  5IGB A;  4XQQ A;  3Q8D A;  2IHE A;  3S1Q H;  3KUP A;  4DR5 L;  2F4I A;  3Q23 A;  4JBM A;  4JV5 L;  5IGG A;  1B50 A;  2KHJ A;  3DHQ A;  1N34 Q;  1I4X A;  2H5X A;  2KEC A;  4LF4 L;  2Q8T A;  4UAI A;  2IPK D;  1GUG A;  2GN5 A;  4C1N K;  2PQE A;  4EGV A;  1VQ8 A;  3HKZ E;  1XNQ L;  1BCP F;  1II3 A;  2ATW A;  5M3M G;  3G4S A;  3KLS A;  5I6W A;  1XMO L;  3OWE B;  4QIW E;  1I50 B;  1KAA A;  5BN5 A;  1BDO A;  1M90 C;  2LFN A;  4CKB A;  3DM1 A;  3PUZ A;  1MHW C;  3CCU A;  3M4P A;  3N52 A;  4RKL A;  2F0D A;  3NEM A;  3KF8 A;  1B7Y B;  4A3I G;  1SN8 A;  1XJV A;  2XVS A;  2WAQ B;  2OTL A;  4A3G B;  4CGY B;  2X6L A;  1I50 H;  4LJZ C;  1YIT A;  3BYT B;  3K5M A;  1SYG A;  1NTG A;  3BVM A;  3TP5 A;  4B3S Q;  5JPM C;  1PRT B;  1FJG Q;  3PIP A;  4A3G G;  1ENC A;  5C5M A;  5JEA G;  2F0V A;  2XN9 C;  5TSS A;  3B6Y A;  2RHQ B;  5IT9 L;  4AQY L;  2CFM A;  3QB3 A;  1R9T B;  2Q8R E;  1PH6 A;  4A3G H;  2G9H D;  1SR3 A;  5JEA H;  1EWI A;  3CPF A;  1BXT A;  1CT1 D;  4Y52 H;  2RCN A;  2DJG C;  1VF5 C;  4IUV A;  3NBH B;  2F0S A;  3DUZ A;  3AYH B;  2KEN A;  4DR3 Q;  4G7H C;  4XTC S;  4XYO A;  1R9T H;  3GTQ B;  5FOB B;  4HMI A;  2JN4 A;  5CV8 A;  1S3O A;  1IBK L;  1WJJ A;  4Q0F A;  1N36 L;  1IW7 D;  4OGQ C;  1HH2 P;  5ELE A;  1EYG A;  2X69 A;  1HNW L;  3STB C;  1HFN A;  4CJ1 B;  2EJM A;  3F8T A;  1MSH A;  3NP8 A;  4R8N A;  1EY6 A;  1SND A;  4X3U A;  4RHR A;  2L9H A;  3A8K E;  3AFQ A;  1EUJ A;  4YWK A;  1JJG A;  2MO0 A;  4DXF A;  3GDE A;  3PIO 3;  1EIH A;  2Z6B A;  1MKH A;  2JJQ A;  1KDC A;  2SDF A;  3CCL A;  4OO1 I;  5C44 B;  3PIP 3;  2QEX A;  1HXY D;  1SE2 A;  1UEA B;  3RR5 A;  1EY9 A;  3K58 A;  2EOT A;  2Q2H A;  1LYL A;  2OQK A;  4MN3 A;  1PDQ A;  2D9U A;  1QUQ A;  4IPD A;  1BVS A;  2YV5 A;  1E1T A;  3CCJ A;  3VR4 A;  4OWX B;  1LTA D;  4RGN A;  4A75 A;  5C44 H;  1EU3 A;  4RG1 A;  4JVZ A;  4WJ4 A;  3A5U A;  3C1E A;  2VQE Q;  3NK9 A;  1LT4 D;  5JJZ A;  2HCI A;  4OWW B;  4G7Z C;  5T1I A;  3FHW A;  5A2Q L;  3NQT A;  1CI3 M;  4P71 A;  1SAP A;  1UNS A;  2Z0S A;  2IL8 A;  2JA6 B;  3TP8 A;  3I7F A;  1WTH A;  2F0J A;  1DXM A;  2XSC A;  3EQL C;  3R2T A;  4XT3 B;  4BBS H;  3L0O A;  3VA7 A;  3BVG A;  2SNS A;  3A8J E;  2PZW A;  4KK7 A;  5AJ3 Q;  4LF9 L;  2Z1C A;  1N32 L;  2Y0S G;  3A56 A;  1W6J A;  3D6W A;  4PMW A;  2KCM A;  3OTO L;  2CVR A;  5COY A;  1SMX A;  2ZTE A;  4IUQ A;  2JA6 H;  4JPB W;  3G71 A;  3RLF A;  2N88 A;  4F8M A;  1LAB A;  2Z8L A;  1A15 A;  5BN3 A;  1PH8 A;  1V1P A;  2EYJ A;  2WP8 J;  4B3R L;  1ZEQ X;  1RD9 D;  4IPH A;  2HQE A;  5KYL A;  5ELN A;  3MWY W;  3KLS X;  3ERQ A;  4JI5 L;  3CW2 C;  2EQS A;  2B2T C;  1AH9 A;  1AW7 A;  3I72 A;  1UAP A;  1X3G A;  5IT9 E;  5LMU Q;  5GAH C;  1D6E C;  3GTL B;  1VQM A;  2SOB A;  2XNA C;  1X3E A;  1MJC A;  5M3F B;  3HGB A;  1DOK A;  1EQT A;  2B3G A;  2H4O A;  4CBV A;  5IOD A;  4F88 A;  4UY8 C;  2C35 B;  3K5L A;  5M3F G;  3MVV A;  2JE6 I;  4FP5 D;  3CHB D;  3DEO A;  3GTL H;  5HGT A;  1ICF B;  5IYB G;  1ASZ A;  4HJ7 A;  1GXD C;  3KOJ A;  1XPU A;  4LF6 L;  2NVY H;  2DGY A;  2EVB A;  5C0X H;  1Q82 C;  4AYB E;  4L5S A;  4HAE A;  1GUW A;  5IYB H;  3NSW A;  3DWP A;  1Y1W B;  1HCZ A;  3H3V C;  2RDF A;  4LFA Q;  1LUZ A;  1BCP B;  1DZ1 A;  2K4K A;  1OXX K;  2WFW A;  4A93 B;  3GO5 A;  2IJ0 A;  4DV6 L;  2Q2I A;  4UPA A;  1NBW A;  4RH6 A;  4OO1 G;  1GUS A;  3K57 A;  3N6R A;  1HPC A;  1LAC A;  3VR6 A;  1TWG B;  4LW1 A;  4DV0 L;  1PH4 A;  1NJI C;  4O42 A;  4DR4 Q;  1X65 A;  1S5C D;  5IYC G;  4A93 G;  2OQ0 A;  3GV6 A;  5CGK A;  1UUP A;  1IBM L;  1J5E Q;  1Y1W H;  1HNZ Q;  1OXU A;  3NPP A;  4R4C A;  4CDE C;  1OXV A;  2ZXP A;  1PH1 A;  5G3L D;  3J7A 5;  4O2D A;  4H13 C;  3S1R B;  1CK1 A;  3QR8 A;  2R7Z B;  4H0L C;  2NVX B;  2VQF L;  1EEF D;  1A62 A;  2BA1 A;  1YJ9 A;  3HEJ A;  4RA8 A;  2AUJ D;  1STB A;  2JA8 B;  1MD2 D;  2CQA A;  5A2Q E;  1AEX A;  3E5S A;  3S1R H;  1JE4 A;  1IKM A;  1HR0 W;  2R7Z H;  3NWS A;  4HCE A;  3BZC A;  3NHH A;  1AN8 A;  2NVX H;  5J39 A;  2JA8 G;  1D8L A;  4GZY C;  2EPB A;  3ONA B;  2YTX A;  4YIJ A;  1Q46 A;  3F2D A;  1YJN A;  3SXH A;  1PZK D;  4P72 A;  2A19 A;  2JA8 H;  1DM0 B;  4IZ8 A;  4NMZ A;  4L6T B;  1PV4 A;  1U4P A;  5CV7 A;  4DV2 L;  1LT3 D;  5IT9 c;  3K81 C;  4KY6 A;  3GTO B;  5ELF A;  1MGS A;  1QVF A;  3E6Z X;  2PYK A;  1IZ6 A;  1S5E D;  2NYZ D;  3GD7 A;  5BR8 Q;  4YY3 L;  2MNA A;  3RMH A;  1VQ6 A;  3CCQ A;  1VQO A;  3ND8 A;  2F0O A;  4IAL A;  4NPS A;  5C5L A;  4DUY Q;  1XNR L;  3S14 B;  2BE5 C;  1R4P B;  4DNT B;  5C0X J;  2ZTD A;  4K0K L;  5I4D A;  4HJA A;  4QCL A;  1G2T A;  2PMZ E;  1H9S B;  2PQA A;  3D8G A;  5CBE E;  1Q12 A;  2UU9 L;  2HHH Q;  4DR7 L;  1PH5 A;  1Q8K A;  3GTO H;  3NEL A;  4WOR A;  4IOC A;  2IX1 A;  3X3M A;  2ZM6 Q;  4V0B A;  3G6J B;  1Z9F A;  5G3L F;  1F9R A;  2BDO A;  3MTS A;  1KD1 C;  3FMC A;  1KRT A;  3VDY A;  3K0X A;  4GN5 A;  3UDG A;  3S14 H;  2DY7 A;  1ICW A;  1AE3 A;  3PUW A;  3H6M A;  3S9W A;  2UXD L;  4QJF A;  3JAM c;  3I56 A;  3VYS A;  5E7N A;  4HSP A;  4LF5 Q;  1F2L A;  3SEB A;  2E5L L;  1PYS B;  1W2B A;  4GLV B;  1ET9 A;  4UP9 A;  2R6G A;  3TEH B;  3IRB A;  3KBX A;  4XYQ A;  1BF4 A;  3T16 A;  5FLX c;  1G6P A;  3WWV A;  3VR5 A;  2XTI A;  3RUZ A;  4A3M B;  2VW9 A;  3LGJ A;  3OHX C;  4RFB A;  2KHS A;  4LFC L;  1JCK B;  2ES2 A;  4I7Z C;  4R4O A;  2EYP A;  5C6A A;  2RHS B;  4KHV A;  4GOP C;  3CD6 A;  4JI4 Q;  2J4X A;  1TWH B;  3OIQ A;  4A3B G;  3HOY B;  5JJI A;  3HKS A;  2DJF C;  2MUY A;  2F0G A;  1VMP A;  3AEV A;  4HIK A;  4K6L A;  4C3H B;  1YJW A;  3IKJ A;  2XRS D;  1VQP A;  5DM7 3;  4A3M H;  4LF4 Q;  1TR5 A;  2KCT A;  4JOI C;  5IYD H;  3HOY G;  4X3K A;  3FP9 A;  2MFI A;  4DAM A;  1B1Z A;  3CCE A;  5ELB A;  4TSS A;  4OIJ A;  5C3E B;  1TWH H;  4ME3 A;  3HOY H;  1V8Q A;  2QW7 A;  1JR0 D;  3CKI B;  1E22 A;  1TY2 A;  4R4I A;  1G8Z D;  2K5Q A;  4C3H H;  4EVO A;  1AZQ A;  4I7A A;  3HOV G;  1XMO Q;  3G6E A;  3J7Z C;  1CFM A;  1LTB D;  1PZJ D;  5C3E G;  1UE1 A;  1X32 A;  3H3V H;  1YHQ A;  4MNO A;  1I4P A;  5GAG C;  2UXB Q;  1NCV A;  1IBL L;  3OIP A;  3W1B A;  3GTK B;  3C1F A;  2K03 A;  3OSO A;  4FVM A;  1ASY A;  2A74 C;  5KNB A;  2ZJQ A;  4L63 B;  2K5N A;  2JA7 B;  5H1S E;  2Z6K A;  4OEM B;  1YHB A;  1CHQ D;  3NBI A;  4ID6 A;  1PRT C;  2TSS A;  1K8G A;  1VQI A;  1L1O B;  4LF8 Q;  1O7L A;  4ZLT F;  2WB1 B;  3CME A;  1B4O A;  1GUT A;  1RF2 D;  1TXY A;  2UUA L;  1Q1E A;  3I8Z A;  2JA7 H;  4IUU A;  4OEL B;  3CCR A;  1FL0 A;  3PMF A;  1I94 Q;  1F9S A;  2B8G A;  2F0W A;  4X3T A;  2XWJ B;  1LO5 D;  1SBB B;  2K50 A;  4DUZ L;  2OEO A;  1CQV A;  3I4O A;  1S4Z A;  2M00 A;  1HR0 L;  2DY8 A;  2YYZ A;  1K73 C;  1O7I A;  2F0F A;  3NEN A;  2K5D A;  3M85 A;  1SMY D;  2LXK A;  5CV9 A;  1EEI D;  5D65 A;  4RGM A;  2JSO A;  1Y8O B;  1UWV A;  2XRQ D;  1IBK Q;  2JA5 G;  4HIM A;  1WI5 A;  1N36 Q;  1C7Y A;  4IOA A;  2Q2T A;  2B2V C;  1HNW Q;  1EL0 A;  3MEF A;  4S3S A;  3RN2 A;  1GUO A;  4J15 A;  1KQS A;  2UUC L;  1DOL A;  4HN7 A;  5CV4 A;  4J8Q A;  1STY A;  1B9M A;  3BJU A;  1CA5 A;  2F0K A;  1OO9 B;  3GV3 A;  1JQY D;  3WDN A;  4UP8 A;  2FXQ A;  1SYD A;  3SK5 A;  4IFD J;  4AYB G;  4F87 A;  5LMN W;  5DEH A;  1WTO A;  2A73 B;  3UDF A;  5J22 A;  3M4O B;  1JOK A;  2RCF A;  1XPR A;  3C2P A;  1RL2 A;  1EQR A;  1B70 B;  3SK8 A;  1EY7 A;  2KJX A;  5F2D A;  1PFB A;  4KN7 C;  2WKD A;  4DR6 L;  4YHH Q;  1QZH A;  1SNP A;  1Q90 A;  1JOO A;  3A7A B;  3M4O H;  3S17 H;  1HQM C;  4DXG A;  1BNZ A;  1STG A;  2CWP A;  2ZJR A;  4GOP B;  2YU9 B;  1LT6 D;  4X64 Q;  1LM0 A;  2QIL A;  4JG2 A;  4JYA L;  1VF7 A;  1GHK A;  4A3J G;  1OXT A;  1SE4 A;  4TRD A;  4DV5 L;  2NBF A;  1VQG A;  1PH7 A;  1WOC A;  3KF8 B;  1Y69 U;  2PI2 E;  3BU2 A;  3T53 B;  3DWA A;  4LF9 Q;  5M3M B;  1N32 Q;  4KV6 A;  3Q24 A;  3K80 C;  2Q8I B;  1S72 A;  1AE2 A;  1VQE A;  1Y14 B;  3CAM A;  2VL6 A;  3MXN A;  4X66 L;  3PUY A;  3D4W A;  4XT1 B;  2YU9 H;  4FF1 A;  3OTO Q;  3CC2 A;  1HHV A;  4R4Q A;  4GKJ L;  1BR9 A;  1PMR A;  2E75 C;  2K5H A;  5IP9 G;  3CQZ B;  4B3R Q;  1NMF A;  2QGQ A;  4A3I B;  3IFT A;  1Q7Y C;  3I55 A;  3M9B A;  5M3M H;  4JI5 Q;  5IP9 H;  1T5X D;  2LMC B;  4EX5 A;  1PLF A;  1Q86 C;  1YHA A;  1ZYR D;  1O7Z A;  4I65 A;  2E2H B;  1WTR A;  2GVA A;  4NXM L;  3CCV A;  3CQZ H;  3E0E A;  5J3B A;  3U58 A;  2NWG A;  4A3I H;  3ERO A;  1A2T A;  1QB5 D;  4FXG C;  1H95 A;  2K14 A;  1DJR D;  1P16 A;  4BXX G;  1NR4 A;  3V05 A;  1KHI A;  4LFB L;  2KCC A;  3CXC A;  2MHV A;  1W3S A;  4P74 A;  1WTQ A;  1DON A;  1M1K C;  5KND A;  5EPK A;  1XTD A;  4FF3 A;  1NY4 A;  1VQH A;  4TKO B;  1Y8N B;  4BXX H;  1YI2 A;  4KKS A;  2SEB D;  2F3V A;  4RMF A;  4JI2 L;  4NW2 A;  4LF6 Q;  2IHF A;  1XPO A;  4HED A;  3SDZ A;  1JJ2 A;  1X3P A;  1EYC A;  1EIF A;  2UUB L;  1BCP C;  1MJE A;  2K6A A;  2EE1 A;  2R3Z A;  3A55 A;  3E0J A;  3NTH A;  1I4Q A;  1QE6 A;  1ESR A;  1ILP A;  4DV6 Q;  3URY A;  4C56 C;  4A3K G;  3J81 i;  4NB3 A;  3Q6S A;  4DV0 Q;  3MC0 B;  1U9R A;  1WTV A;  1ILQ A;  1EZ6 A;  4O1N A;  3CCS A;  1PYB A;  3KJO A;  1Q81 C;  1KL9 A;  5EBC A;  4JI1 L;  3E9I A;  4M8A A;  1IBM Q;  1QUQ B;  1C4Q A;  1CKM A;  1PYW D;  3FPP A;  3PUV A;  4K6D A;  5BN4 A;  1W6K A;  1RJT A;  2IT1 A;  1VQJ A;  4DK6 C;  2VB3 X;  2RDH A;  3M4Q A;  3GTQ H;  4QF4 A;  1PTO D;  3S1M B;  2CH4 W;  2A69 D;  1B2T A;  4KJN A;  3VYR A;  1SYB A;  1EU4 A;  2EXZ A;  2VQF Q;  3GTM B;  1JC7 A;  4DV1 L;  1TKW B;  3G48 A;  5ELD A;  1HNX L;  2K7V A;  1M4V A;  1XTC D;  1TVX A;  2BH8 A;  3LWU A;  3TBI B;  1EFI D;  5DM6 3;  1I6H B;  4KHZ A;  1L2F A;  3AQQ A;  5GAE C;  3BS1 A;  3T1Y L;  2EZV A;  1GO3 E;  1VQL A;  4B3T L;  1YVC A;  4JI3 L;  3E3X A;  2A6H D;  3S1M H;  1PFN A;  2F0N A;  1NNX A;  5LMN L;  1NSN S;  2RF4 A;  1SEB D;  1XWE A;  3GTM H;  2J0T D;  3DM3 A;  4DV7 L;  1L0Y B;  3ZJY C;  1PVO A;  1A6X A;  5D14 A;  4K5V A;  4ULL A;  1I6H H;  1V1P B;  2B2V A;  3T1H L;  5EKL A;  4BA2 I;  1D5Z C;  2KOL A;  4ALP A;  2CW0 D;  1H9K A;  2L12 A;  2Y0S B;  4DV2 Q;  1T5E A;  1H9J A;  4POG A;  1JOQ A;  3J7A F;  4B3M L;  3CC4 A;  3W3A A;  4L5T A;  2A6E D;  5CYU A;  2EYO A;  4IPG A;  3GTJ B;  3BZD B;  1DGS A;  1U5K A;  4GS3 A;  4YY3 Q;  2CH4 A;  2MP1 A;  1L0W A;  5JEA J;  1SFO B;  3UDI A;  2MO1 A;  4R8I A;  1QZG A;  3NTK A;  1SE3 A;  4DV4 L;  1XNR Q;  2I0Q A;  1QJO A;  4R1J A;  3BG3 A;  1WTP A;  4K0K Q;  1U4L A;  4QB4 A;  3H15 A;  2UU9 Q;  4G57 A;  4YCU A;  2QF7 A;  4DR7 Q;  4C3J B;  2R7F A;  4XQN A;  3K6O A;  3FEW X;  4U67 3;  4DK0 A;  5GQO A;  3GTJ H;  3PCO B;  1R4Q B;  2RQX A;  1EQV A;  5CC4 A;  3NE5 B;  3J80 i;  1KDA A;  4HR7 B;  3I73 A;  1PTO F;  1SFO H;  1M8A A;  1RTO A;  4C3J G;  2I07 B;  1YNX A;  1JJC B;  4RKB A;  4UHV A;  5LHY 1;  3PUX A;  1A3T A;  1D7Q A;  3J81 L;  3LWE A;  4PNY A;  5JPN C;  2OTJ A;  2E5L Q;  3OPO A;  1VQB A;  1YEZ A;  1JB3 A;  4C3J H;  4DPG A;  3M7G A;  1BBX C;  1S40 A;  2L4N A;  1LT5 D;  5CBA E;  3PO2 B;  3TQY A;  4LUO A;  2B2W C;  2FFK B;  2R92 B;  2K04 A;  3QIA A;  1P8L A;  3S2H B;  2D2C C;  2VY3 A;  5K5P A;  2ALY B;  1G51 A;  5M5Y B;  3PO2 G;  1E1O A;  2NN6 I;  1XXG A;  2R92 G;  2RBM A;  3BVZ A;  3L7Z C;  5M3F H;  3EVQ A;  2G5D A;  3K5O A;  1FJG L;  3HOZ G;  2I46 A;  1IW7 C;  5ELC A;  2E8G A;  3L2P A;  1D5M C;  1F9Q A;  2R92 H;  1LTG D;  3PO3 G;  1K83 B;  3S2H H;  3PF5 A;  5M5Y H;  3ZYY X;  2AQ2 B;  1CHP D;  4V19 0;  1A2U A;  3KF6 A;  4HSV A;  1FYC A;  2I5M X;  3VYT A;  1VQN A;  2F1M A;  4JCV E;  2EYF A;  4OX9 L;  4X62 Q;  1JE5 A;  1EOT A;  4A3D B;  4OO1 H;  2E2I B;  2N8N A;  3P1H A;  3ULP A;  1K83 H;  3Q0A A;  4RGO S;  1UEB A;  2HQL A;  1VS0 A;  3RD4 A;  4IUP A;  5EKK A;  5IYC H;  4A93 H;  4OHJ A;  4A3D G;  3RZD B;  1HTP A;  2K5W A;  4GN3 B;  3CPW A;  1Q8I A;  1TWG H;  3TP7 A;  2NTS A;  1F2Y A;  2WV6 D;  4PZ8 A;  3F2C A;  4A3C G;  1MSG A;  3D0F A;  3HKZ B;  3T51 B;  4A3D H;  1SLJ A;  2E2I H;  4NKL A;  1VQC A;  3DXJ C;  4QIW B;  1L1O C;  4ZCK A;  2QEJ C;  3HKZ G;  2WKC A;  1V1Q A;  3RZD H;  3CP0 A;  4H02 A;  5JVG 3;  4NXN L;  1J6Q A;  1SNM A;  1RCV D;  4FF4 A;  3A0J A;  2K33 A;  4U68 A;  4WFN 3;  4J1M A;  3PQI A;  1UE7 A;  3BZK A;  1Y1V B;  4LUV A;  2AMC B;  4DAY B;  3J80 L;  2PI2 A;  3L3O C;  2BDN A;  4HCS A;  3MZ5 A;  2L15 A;  1XMQ L;  3S1N B;  4IUN A;  3CRL C;  2PQA B;  4DUZ Q;  1SRO A;  3S24 A;  1HR0 Q;  2KA7 A;  2ICE C;  1Y1V G;  3BDO A;  2JEB I;  3OW7 A;  1KXL A;  2MGS A;  1YNJ D;  3H0G B;  4A76 A;  4B08 A;  1A0I A;  1Y1V H;  2VQE L;  2EYL A;  3W5O A;  3S2D B;  1JWM D;  4LUZ A;  5E3F A;  3HRZ C;  2E2J B;  4GNX B;  1NAP A;  2K75 A;  3H0G G;  4JI8 L;  2RKS A;  4XXE A;  1HZB A;  4C3I B;  1KTK A;  2PZT A;  2V1C C;  2AHO B;  1Z7T A;  4BY7 B;  2RA4 A;  2UUC Q;  2NZ1 D;  3H0G H;  2B2Y C;  5KGU A;  1ONL A;  2F4V L;  1IYU A;  2ZXR A;  4YCV A;  4C3I G;  1PH3 A;  4FYD A;  3S2D H;  2KBN A;  4X65 L;  3TME A;  1C0A A;  4BY7 G;  4P2C B;  4EQP A;  2OXP A;  4ZUI A;  3KJP A;  1K3R A;  2F0I A;  1CKN B;  1E2Z A;  4C3I H;  3HOX B;  4YCW A;  2N78 A;  2TMP A;  2WAQ E;  2NN6 G;  4EQ5 A;  1GUN A;  4BY1 G;  2K5V A;  1B44 D;  1JB7 A;  4BY7 H;  3VA5 A;  3DWQ A;  2JEA I;  3BYY B;  3I4N B;  2FJ2 A;  3QJY A;  1CQF A;  3HOX G;  2A1A A;  4QY7 A;  2AUK A;  5EAY A;  3V96 A;  4DR6 Q;  3I4N G;  4C2M B;  3LNN A;  1FNW A;  3HOX H;  3Q22 A;  4BBR B;  1HJP A;  2QCP X;  4R9W A;  3CC7 A;  4A3B B;  1TQO A;  5EQ0 A;  3M7N A;  1ENF A;  1YNN D;  1C9O A;  1KAW A;  1JIC A;  3I4N H;  3T4A C;  1BBW A;  3S15 B;  4QQB X;  3SR1 A;  3VYU A;  4BBR G;  3CF5 A;  2A5H A;  3A5Z B;  4DR5 Q;  4AH6 A;  2HD3 A;  4DKA C;  4JV5 Q;  2OT2 A;  2I5H A;  1VQ4 A;  5E1F A;  1HZC A;  4C2M H;  2O5I C;  2L55 A;  4GLA C;  1TY0 A;  1QCB D;  4BBR H;  1ROD A;  4PMC A;  4A3B H;  1PZI D;  1SYC A;  1HFG A;  4UDU C;  3HOV B;  4P75 A;  2B2T A;  2E74 C;  3S15 H;  1IYV A;  4POF A;  2KUM A;  1IXR A;  1XNQ Q;  2ZTC A;  1PTO B;  4GKJ Q;  3GTG B;  1TII D;  2RVL A;  1EY4 A;  1BOS A;  3D6C A;  4LFA L;  2PCF B;  3D3R A;  4ZAI A;  2FIN B;  3K8A A;  3X3N A;  5C3W A;  5GAD C;  5LL6 X;  3HOV H;  1I5F A;  4K8I A;  5C3E H;  4ZRZ A;  3O13 A;  4IQZ A;  1E7Z A;  2XWB B;  1CTM A;  2UXC L;  4HTH A;  4DR4 L;  4ILW A;  1PTO H;  1VQ5 A;  1FR3 A;  1H9M A;  4NXM Q;  1EOV A;  1J5E L;  1PXU A;  3GTG H;  2NZH A;  3J80 E;  4MHE A;  2D0P A;  4YWL A;  1F77 A;  5FO9 B;  5IIF A;  3I3C A;  1STA A;  2DN8 A;  4G7O C;  2L5T A;  2BCO A;  5KNC A;  5CV6 A;  1K3B C;  5FO7 B;  1A63 A;  1EY8 A;  3GTK H;  4LFB Q;  4IJL A;  4JI0 L;  2O5J C;  1Q1B A;  4AQY Q;  4ME5 A;  3HG9 A;  5KIX A;  5C4J B;  1EWH A;  4JI2 Q;  4KD3 A;  1C48 A;  2EYM A;  5IWA L;  4GKK L;  3CRK C;  2L11 A;  2ZJP A;  2BOS A;  2UUB Q;  5HY6 A;  3PSI A;  1V43 A;  4RAU C;  2JA5 B;  1YZ6 A;  3I2Z A;  3KDF A;  1KRS A;  4DA2 A;  2EYH A;  4O0A A;  2HIV A;  3PGZ A;  5I6Y A;  3TZD A;  4DK3 C;  5C4J H;  5EBD A;  1HTL D;  1STH A;  2EJF C;  3ITP A;  3OOC A;  2AQ1 B;  1IL8 A;  4JI1 Q;  2OCE A;  1QVC A;  2JA5 H;  1SE8 A;  2R93 B;  5EKI A;  4AYB B;  2HUG A;  2CHB D;  3AMU A;  2MJ8 A;  4EQO A;  3KBG A;  3HFZ B;  4DR1 L;  5C3X A;  4G4K A;  4JI7 L;  1ESF A;  3HOU B;  4A3L G;  4BWG B;  5COR A;  5IE8 A;  2R93 G;  2N49 A;  5FJ8 G;  1HA6 A;  4DUY L;  1AZP A;  3HOU G;  3J7A V;  4TQU S;  3A7L A;  3QG1 A;  1JMC A;  3FVQ A;  2R93 H;  3T13 A;  2N55 A;  1PFS A;  1GVP A;  1TWA B;  4L5Q A;  3HOU H;  3A74 A;  4MZ9 A;  4DF7 A;  4B3T Q;  3U9O A;  3FKI B;  1J8I A;  5LMN Q;  5M5W B;  3STB D;  5I9O A;  3ND9 A;  3ICE A;  4KD4 A;  2LS0 1;  3PF4 A;  4WJ3 M;  1XX8 A;  3FKI G;  4DV7 Q;  4FXD A;  4LWC A;  4A3J B;  1XYI A;  4A3E B;  4C1N I;  1WD0 A;  1TWA H;  2R61 A;  3F1Z A;  2AKW B;  5KYI A;  2PNR C;  3A8I E;  1CZW A;  4PG3 A;  3T1H Q;  1X55 A;  3H09 A;  3FKI H;  3DEP A;  2A8V A;  1LV9 A;  3EIV A;  2XGT A;  4GLX A;  4QUF A;  4A3E G;  2VUM B;  2HDL A;  4B3M Q;  2ENB A;  4NP5 A;  3C46 A;  1TU2 B;  4PQX A;  1HZA A;  4FNF A;  4A3J H;  2BA0 A;  2O2L D;  4A3E H;  3JAM i;  3MAQ A;  1BUV T;  2VUM G;  4JI4 L;  1KAB A;  4DV4 Q;  4JBJ A;  1FNV A;  2LSS A;  1D1I A;  2PW7 A;  2VUM H;  4FF2 A;  2AWN A;  1SYE A;  3I4L A;  5C4Z A;  1RHP A;  5D3D A;  1SNO A;  1QG7 A;  1QWY A;  4KN4 C;  1N33 L;  1AP0 A;  4B9X A;  3MXP A;  3VR2 A;  4CDD C;  3EFX D;  4E6I A;  1VQA A;  1U4R A;  3NUC A;  3QOJ A;  1GKH A;  2E76 C;  5EPL A;  4DAP A;  5CMD A;  1ZXT A;  4CJ0 B;  1NR2 A;  2PMZ B;  4BA1 I;  4GOP A;  1CSP A;  4CKC A;  5E4X A;  2PW5 A;  1QIL A;  4ZQ3 A;  4LF7 L;  4OON A;  1MI2 A;  1EIG A;  4DNR B;  4DNI A;  2I5L X;  4Z9C B;  2UXB L;  3SE0 A;  4JOI A;  3JC6 6;  2E2H H;  3DLL A;  1SMY C;  5CV5 A;  4CDC C;  5FK9 C;  5HGQ A;  2RSN A;  4IN3 A;  3F2B A;  3PIO A;  1PA6 A;  3ERS X;  2FMC A;  3SK6 A;  1TS5 A;  3MFG A;  3TRZ A;  2WAQ G;  1S5F D;  1K9M C;  4LF8 L;  5IY0 A;  4A3K B;  1I4G A;  5JVH 3;  1SDF A;  1X3F A;  2KHI A;  3FDT A;  2PPB C;  2KED A;  1GHJ A;  1KC8 C;  1KNE A;  3TS2 A;  2PO4 A;  5NUC A;  2M9V A;  1I94 L;  3GP7 A;  3GTP B;  2JA9 A;  5ISR A;  1ET6 A;  3HZX A;  5L37 A;  3KYH C;  3VR3 A;  3CCM A;  3WOF A;  2J7Z A;  4OX9 Q;  2QDL A;  4PMB A;  2Z4I A;  4A3K H;  5E4W C;  3EJI A;  5HUR A;  2HCC A;  1OXS C;  1SRU A;  1PHJ A;  1HUM A;  4DV3 L;  4HMJ A;  1HRJ A;  2C9O A;  1CSQ A;  2OWO A;  1J9O A;  5AFW A;  2K32 A;  4IUT A;  4JI6 L;  5T1G A;  3GTP H;  1D2B A;  4DR2 L;  3U9S A;  3UDX A;  3J7Y W;  1TS3 A;  1MBY A;  5C0X I;  3TP6 A;  5DAU A;  2YTV A;  1FVI A;  2F0H A;  4LAA A;  3I70 A;  4WRD A;  3JAM L;  3KLW A;  1SJE D;  1DCZ A;  3H91 A;  1N8R C;  4LK1 C;  2NVQ B;  3NBH A; 
#chains in the Genus database with same CATH homology
 5CR3 A;  2AWO A;  3MA2 B;  2NUC A;  1BQQ T;  4JBW A;  5FLX L;  1L0X B;  4B9W A;  3NQI A;  1AFP A;  1KLG D;  2F03 A;  1SNC A;  5FKA C;  3MXU A;  1G6Z A;  1B9N A;  5IGF A;  1EYD A;  1STE A;  3QOL A;  4BBS B;  4XIG S;  1DYQ A;  3QO2 A;  3I4M B;  3TN2 A;  1TS4 A;  1ML0 D;  2RDG A;  4KI0 A;  1TWC B;  5I2Y A;  2O4X A;  2IX0 A;  2KCN A;  1VCI A;  3AB9 A;  1ZYR C;  2LKV A;  5A35 A;  4H7B A;  3MFY A;  4K2L A;  1O7Y A;  2F0P A;  2XIW A;  1IHZ A;  2VNU D;  2QKI C;  4OIK A;  5IOC A;  4KKU A;  1DD2 A;  2X6G A;  4XQJ A;  4X3S A;  1EZ8 A;  3A54 A;  4A3F B;  1NUC A;  2B2U C;  2IW3 A;  3PV0 A;  1WCM B;  4RGT A;  4QMG A;  2BE5 D;  1JWS D;  3LX0 A;  2DNC A;  4PV1 C;  1TT2 A;  3NTI A;  3HOZ B;  2WII B;  1K8O A;  4JK1 C;  2F3W A;  1WTX A;  3PO3 B;  1LTI D;  3R2I A;  4K2K A;  4EQN A;  2NVY B;  4RCN A;  3R3O A;  3L9A X;  4DFA A;  2A68 D;  4ZYS A;  4RCO A;  5I9P A;  4IUR A;  1E0B A;  1I6V C;  2JYO A;  4CKE A;  5C0X G;  2K1B A;  1PTO C;  3WOE A;  1X3Q A;  2A69 C;  3R8B A;  4DAV A;  1DOM A;  1CM9 A;  2B8F A;  3JAM E;  1RKN A;  3QWN A;  4KKT A;  4M1U B;  1E2V A;  3V2T A;  3I90 A;  5FLX E;  2A6H C;  4N9T A;  4RHS A;  1F2M A;  3EA6 A;  5C4H A;  3D31 A;  1LTS D;  3C3L A;  1Y8P B;  2IWH A;  4IFD I;  2LY7 A;  3P20 A;  1F2Z A;  1STN A;  4Q5V A;  2NTT A;  4KY7 A;  2L0C A;  5FO8 B;  2CW0 C;  3K59 A;  2A6E C;  3HP3 A;  3NWT A;  2FHT A;  3CU7 A;  1SSO A;  2B39 A;  2M2L A;  4DK1 A;  3SK4 A;  1B3A A;  1KDB A;  2EY5 A;  1PRT D;  1SNQ A;  2D62 A;  3KK7 A;  4CJ2 C;  1G2S A;  1Z6H A;  1ZKO A;  1FD7 D;  1BO0 A;  3TZU A;  5EPJ A;  3J81 E;  3T56 B;  2FMM A;  1H9R A;  2E2D C;  5EGT A;  3HS0 C;  4BY1 B;  1RTN A;  2WAC A;  3D4D A;  4CHT B;  4DAY A;  4F7X A;  1F9P A;  1O78 A;  2EY1 A;  2QDB A;  5EJW A;  2HDM A;  2NN6 H;  4K8J A;  1HQR D;  3K7A B;  3KLR A;  3K5N A;  3D4R A;  3OMG A;  1GJX A;  2EY2 A;  2GA4 B;  2V4D A;  4OL7 A;  1CZG A;  2A68 C;  5C4X B;  1QNK A;  4K5X A;  5K36 G;  1SXT A;  1B53 A;  2JXM B;  4J6H A;  2EY6 A;  2VB2 X;  1TS2 A;  1JWU D;  1VDZ A;  1CA6 A;  3S16 B;  2K01 A;  4ODG A;  2ZT9 C;  5IGD A;  1H9S A;  3MHB A;  5K36 H;  3IFD A;  3FPU B;  4DGZ A;  1C8C A;  2SNM A;  1I4H A;  3OWF A;  3IAY A;  1PRT F;  2AQ3 B;  3GQB A;  1HA5 A;  5JAV A;  2F0Q A;  4Y7N B;  2EDG A;  3FRP B;  4ZKB B;  4N9P A;  5JOB A;  1FGB D;  4IFD G;  1A3V A;  4QUC A;  2DNE A;  2B2U A;  1TWF B;  2JP1 A;  4BS9 A;  1K8M A;  5M5X B;  2L1B A;  3SHL A;  3BDL A;  2F0E A;  4C3H G;  2K28 A;  4KTA A;  1ENA A;  4IFD H;  2B2W A;  1G29 1;  3MEH A;  2K05 A;  1D1K A;  2KQ3 A;  4KJO A;  4DN4 M;  3MXG A;  4XDX A;  5LL6 S;  3K0Y A;  5I2X A;  2D5D A;  1I4R A;  1QNU A;  2B63 B;  1HUN A;  3G7L A;  3BDC A;  1D5X C;  4K5W A;  3DMU A;  1LLR D;  1VMC A;  1U4M A;  5KEE A;  2PZU A;  2F0L A;  3I91 A;  4WJW A;  1O80 A;  2IX3 A;  2KVM A;  1WD1 A;  1YNJ C;  1IKL A;  2WIN B;  4FO2 A;  5KRU A;  4K14 A;  1I3Q B;  1LTT D;  1JOR A;  1KNA A;  4H44 C;  5M9O A;  2ID0 A;  3RZO B;  4DU9 A;  1SJH D;  4LMQ D;  4ZKC B;  1PFM A;  3M4Y A;  3AU7 A;  5IGE A;  3TDQ A;  4ABN A;  1Q3L A;  2NVT B;  2Z4H A;  1S5B D;  2NB0 A;  2VXW A;  1GOZ A;  5IGC A;  3HOW B;  3M3Y B;  1EY5 A;  3SVM A;  1Z47 A;  1LTR D;  2RSO A;  1E2W A;  2G9D A;  2H1E A;  1BCP D;  3IL8 A;  1V1O A;  1WTW A;  1A3U A;  1SYF A;  2F0M A;  4ZUJ A;  1WVL A;  1EWC A;  2EJG C;  3NXW A;  1YNN C;  1RDP D;  3OMC A;  4FXK C;  3P7J A;  2OF1 A;  2C5C A;  1S5D D;  4L8J A;  2F0T A;  3R93 A;  2ICI A;  1G91 A;  3TSS A;  2KEE A;  3S17 B;  4MIU A;  1EY0 A;  1FNU A;  1QOH A;  3S1Q B;  3W2D A;  4RWS C;  2ZXO A;  5DNF A;  3P75 A;  4ZK9 B;  3UI2 A;  3F2U A;  5J1Z A;  5D3I B;  2B2Y A;  4KMU C;  2F0U A;  1KLU D;  4KY5 A;  2MPM A;  1EYA A;  3H94 A;  4NDX A;  5IGB A;  4XQQ A;  3KUP A;  2F4I A;  3Q23 A;  5IGG A;  1B50 A;  3DHQ A;  1I4X A;  2KEC A;  2Q8T A;  4UAI A;  2IPK D;  1GUG A;  4C1N K;  2PQE A;  4EGV A;  1BCP F;  1II3 A;  3KLS A;  5I6W A;  3OWE B;  1I50 B;  1KAA A;  5BN5 A;  1BDO A;  2LFN A;  4CKB A;  3DM1 A;  3PUZ A;  3N52 A;  4RKL A;  2F0D A;  3KF8 A;  2XVS A;  2WAQ B;  4A3G B;  4CGY B;  2X6L A;  4LJZ C;  3BYT B;  3K5M A;  1SYG A;  3BVM A;  3TP5 A;  5JPM C;  1PRT B;  1ENC A;  5C5M A;  5JEA G;  2F0V A;  2XN9 C;  5TSS A;  5IT9 L;  3QB3 A;  1R9T B;  2Q8R E;  2G9H D;  5JEA H;  1BXT A;  1CT1 D;  1VF5 C;  4IUV A;  2F0S A;  3DUZ A;  4G7H C;  4XTC S;  4XYO A;  3GTQ B;  5FOB B;  4HMI A;  5CV8 A;  4Q0F A;  1IW7 D;  4OGQ C;  5ELE A;  2X69 A;  1HFN A;  4CJ1 B;  2EJM A;  1MSH A;  3NP8 A;  4R8N A;  1EY6 A;  1SND A;  4X3U A;  4RHR A;  2L9H A;  3A8K E;  4DXF A;  1EIH A;  3PIO 3;  1KDC A;  2SDF A;  4OO1 I;  5C44 B;  3PIP 3;  1HXY D;  1SE2 A;  1UEA B;  1EY9 A;  3K58 A;  2EOT A;  4MN3 A;  1PDQ A;  2D9U A;  3VR4 A;  1LTA D;  4RGN A;  1EU3 A;  3C1E A;  3NK9 A;  1LT4 D;  5JJZ A;  2HCI A;  4G7Z C;  5T1I A;  5A2Q L;  3NQT A;  1CI3 M;  1SAP A;  1UNS A;  2IL8 A;  2JA6 B;  3TP8 A;  2F0J A;  1DXM A;  2XSC A;  3EQL C;  3R2T A;  4XT3 B;  3VA7 A;  3BVG A;  2SNS A;  3A8J E;  2PZW A;  4KK7 A;  2Z1C A;  3A56 A;  1W6J A;  3D6W A;  4PMW A;  2CVR A;  5COY A;  4IUQ A;  3RLF A;  2N88 A;  4F8M A;  1LAB A;  2Z8L A;  1A15 A;  5BN3 A;  1V1P A;  2EYJ A;  2WP8 J;  1ZEQ X;  1RD9 D;  2HQE A;  5KYL A;  3MWY W;  3KLS X;  3ERQ A;  2B2T C;  1AW7 A;  3I72 A;  1UAP A;  5IT9 E;  1D6E C;  3GTL B;  2SOB A;  2XNA C;  5M3F B;  3HGB A;  1DOK A;  1EQT A;  2H4O A;  4CBV A;  5IOD A;  4F88 A;  3K5L A;  3MVV A;  2JE6 I;  4FP5 D;  3CHB D;  3DEO A;  5HGT A;  1GXD C;  2EVB A;  5C0X H;  4HAE A;  1GUW A;  1Y1W B;  3NSW A;  3DWP A;  1HCZ A;  3H3V C;  2RDF A;  1DZ1 A;  1BCP B;  1OXX K;  4A93 B;  3GO5 A;  2IJ0 A;  4RH6 A;  4OO1 G;  1GUS A;  3K57 A;  3N6R A;  1HPC A;  1LAC A;  3VR6 A;  1TWG B;  4O42 A;  1S5C D;  3GV6 A;  5CGK A;  1UUP A;  1OXU A;  3NPP A;  1OXV A;  2ZXP A;  5G3L D;  4H13 C;  3S1R B;  1CK1 A;  2R7Z B;  4H0L C;  2NVX B;  1EEF D;  2BA1 A;  3HEJ A;  4RA8 A;  2AUJ D;  1STB A;  2JA8 B;  1MD2 D;  2CQA A;  5A2Q E;  1AEX A;  3E5S A;  1JE4 A;  1IKM A;  3NWS A;  4HCE A;  3NHH A;  1AN8 A;  5J39 A;  4GZY C;  2EPB A;  3ONA B;  4YIJ A;  3SXH A;  1PZK D;  1DM0 B;  4IZ8 A;  4NMZ A;  4L6T B;  1U4P A;  5CV7 A;  1LT3 D;  4KY6 A;  3GTO B;  5ELF A;  1MGS A;  3E6Z X;  2PYK A;  2NYZ D;  1S5E D;  3GD7 A;  3RMH A;  3ND8 A;  2F0O A;  4IAL A;  5C5L A;  3S14 B;  2BE5 C;  1R4P B;  4DNT B;  5C0X J;  4QCL A;  1G2T A;  5I4D A;  1H9S B;  3D8G A;  5CBE E;  1Q12 A;  4WOR A;  2IX1 A;  3X3M A;  4V0B A;  3G6J B;  5G3L F;  1F9R A;  2BDO A;  3MTS A;  3FMC A;  2DY7 A;  1ICW A;  3PUW A;  3H6M A;  3S9W A;  3VYS A;  4HSP A;  1F2L A;  3SEB A;  1ET9 A;  2R6G A;  3KBX A;  4XYQ A;  1BF4 A;  3T16 A;  3VR5 A;  3RUZ A;  4A3M B;  3OHX C;  4RFB A;  2KHS A;  1JCK B;  4I7Z C;  2EYP A;  5C6A A;  4KHV A;  2J4X A;  1TWH B;  3OIQ A;  3HOY B;  2MUY A;  2F0G A;  1VMP A;  4K6L A;  4C3H B;  3IKJ A;  2XRS D;  5DM7 3;  1TR5 A;  4X3K A;  1B1Z A;  5ELB A;  4TSS A;  4OIJ A;  5C3E B;  1V8Q A;  1JR0 D;  3CKI B;  1TY2 A;  1G8Z D;  2K5Q A;  4EVO A;  1AZQ A;  1CFM A;  1LTB D;  1PZJ D;  1X32 A;  1I4P A;  1NCV A;  3OIP A;  3GTK B;  3C1F A;  2K03 A;  3OSO A;  4FVM A;  2A74 C;  5KNB A;  4L63 B;  2JA7 B;  3NBI A;  1CHQ D;  4ID6 A;  1PRT C;  2TSS A;  1O7L A;  4ZLT F;  2WB1 B;  1B4O A;  1GUT A;  1RF2 D;  1Q1E A;  3I8Z A;  4IUU A;  3PMF A;  1F9S A;  2B8G A;  2F0W A;  4X3T A;  2XWJ B;  1LO5 D;  1SBB B;  2OEO A;  1CQV A;  1S4Z A;  2M00 A;  2DY8 A;  2YYZ A;  2F0F A;  2K5D A;  3M85 A;  1SMY D;  5CV9 A;  1EEI D;  5D65 A;  4RGM A;  2JSO A;  1Y8O B;  2XRQ D;  2B2V C;  1EL0 A;  4S3S A;  1GUO A;  1DOL A;  4HN7 A;  5CV4 A;  4J8Q A;  1STY A;  1B9M A;  1CA5 A;  2F0K A;  1OO9 B;  3GV3 A;  1JQY D;  3WDN A;  1SYD A;  3SK5 A;  4IFD J;  4F87 A;  1WTO A;  5DEH A;  2A73 B;  5J22 A;  3M4O B;  1JOK A;  3C2P A;  3SK8 A;  1EY7 A;  2KJX A;  5F2D A;  1PFB A;  4KN7 C;  2WKD A;  1SNP A;  1Q90 A;  1JOO A;  3A7A B;  1HQM C;  4DXG A;  1BNZ A;  1STG A;  2YU9 B;  1LT6 D;  2QIL A;  1VF7 A;  1GHK A;  1OXT A;  1SE4 A;  4TRD A;  2NBF A;  1Y69 U;  3T53 B;  3DWA A;  5M3M B;  4KV6 A;  3Q24 A;  2Q8I B;  3MXN A;  3PUY A;  3D4W A;  4XT1 B;  4FF1 A;  1HHV A;  1BR9 A;  1PMR A;  2E75 C;  3CQZ B;  4A3I B;  3IFT A;  1T5X D;  2LMC B;  1PLF A;  1ZYR D;  1O7Z A;  4I65 A;  2E2H B;  1WTR A;  2NWG A;  3ERO A;  1A2T A;  1QB5 D;  4FXG C;  1DJR D;  1NR4 A;  3V05 A;  2KCC A;  2MHV A;  1WTQ A;  1DON A;  5KND A;  5EPK A;  4FF3 A;  4TKO B;  1Y8N B;  4KKS A;  2SEB D;  2F3V A;  4NW2 A;  4HED A;  3SDZ A;  1X3P A;  1EYC A;  1BCP C;  2K6A A;  2EE1 A;  2R3Z A;  3A55 A;  3E0J A;  3NTH A;  1I4Q A;  1QE6 A;  1ESR A;  1ILP A;  3URY A;  4C56 C;  3Q6S A;  3MC0 B;  1U9R A;  1WTV A;  1ILQ A;  1EZ6 A;  4O1N A;  5EBC A;  4M8A A;  3FPP A;  1C4Q A;  4K6D A;  1PYW D;  3PUV A;  5BN4 A;  1W6K A;  1RJT A;  2IT1 A;  2VB3 X;  2RDH A;  4QF4 A;  1PTO D;  3S1M B;  2A69 D;  1B2T A;  4KJN A;  3VYR A;  1SYB A;  1EU4 A;  2EXZ A;  3GTM B;  1JC7 A;  1TKW B;  5ELD A;  2K7V A;  1M4V A;  1XTC D;  1TVX A;  3LWU A;  3TBI B;  1EFI D;  5DM6 3;  1I6H B;  4KHZ A;  3BS1 A;  2EZV A;  2A6H D;  1PFN A;  2F0N A;  1NSN S;  1SEB D;  1XWE A;  2J0T D;  1L0Y B;  1A6X A;  5D14 A;  4K5V A;  4ULL A;  1V1P B;  2B2V A;  5EKL A;  4BA2 I;  1D5Z C;  2KOL A;  2CW0 D;  1H9K A;  2L12 A;  2Y0S B;  1T5E A;  1H9J A;  1JOQ A;  3J7A F;  3W3A A;  2A6E D;  5CYU A;  2EYO A;  3GTJ B;  3BZD B;  5JEA J;  2MP1 A;  1SFO B;  4R8I A;  3NTK A;  1SE3 A;  1QJO A;  3BG3 A;  1WTP A;  1U4L A;  4QB4 A;  4G57 A;  2QF7 A;  4C3J B;  4XQN A;  3K6O A;  3FEW X;  4U67 3;  4DK0 A;  1R4Q B;  2RQX A;  1EQV A;  5CC4 A;  3NE5 B;  1KDA A;  4HR7 B;  3I73 A;  1PTO F;  1M8A A;  1RTO A;  4C3J G;  2I07 B;  4RKB A;  5LHY 1;  3PUX A;  1A3T A;  3J81 L;  3LWE A;  4PNY A;  5JPN C;  3OPO A;  1JB3 A;  3M7G A;  1BBX C;  2L4N A;  1LT5 D;  5CBA E;  3PO2 B;  2B2W C;  2FFK B;  2R92 B;  2K04 A;  3QIA A;  3S2H B;  2D2C C;  5K5P A;  5M5Y B;  2NN6 I;  1XXG A;  2RBM A;  3BVZ A;  3L7Z C;  3EVQ A;  3K5O A;  2I46 A;  1IW7 C;  5ELC A;  1D5M C;  1F9Q A;  1LTG D;  1K83 B;  3ZYY X;  2AQ2 B;  1CHP D;  4V19 0;  1A2U A;  4HSV A;  1FYC A;  3VYT A;  2F1M A;  2EYF A;  1EOT A;  4A3D B;  4OO1 H;  2E2I B;  3P1H A;  3Q0A A;  4RGO S;  3RD4 A;  4IUP A;  5EKK A;  4OHJ A;  3RZD B;  1HTP A;  2K5W A;  1Q8I A;  3TP7 A;  2NTS A;  1F2Y A;  2WV6 D;  1MSG A;  3HKZ B;  3T51 B;  4NKL A;  3DXJ C;  4QIW B;  2QEJ C;  2WKC A;  5JVG 3;  1SNM A;  1RCV D;  4FF4 A;  2K33 A;  4U68 A;  4WFN 3;  4J1M A;  1Y1V B;  3J80 L;  3L3O C;  2BDN A;  4HCS A;  3MZ5 A;  3S1N B;  4IUN A;  3CRL C;  2KA7 A;  2ICE C;  3BDO A;  2JEB I;  3OW7 A;  2MGS A;  1YNJ D;  3H0G B;  4B08 A;  2EYL A;  3S2D B;  1JWM D;  5E3F A;  2E2J B;  3HRZ C;  1NAP A;  2RKS A;  4XXE A;  4C3I B;  1KTK A;  2PZT A;  1Z7T A;  4BY7 B;  2RA4 A;  2NZ1 D;  2B2Y C;  5KGU A;  1ONL A;  1IYU A;  2ZXR A;  4C3I G;  4FYD A;  3TME A;  4P2C B;  4EQP A;  2OXP A;  4ZUI A;  2F0I A;  1E2Z A;  3HOX B;  2TMP A;  2NN6 G;  1GUN A;  1B44 D;  3VA5 A;  3DWQ A;  2JEA I;  3BYY B;  3I4N B;  2FJ2 A;  3QJY A;  1CQF A;  2AUK A;  3V96 A;  4C2M B;  3LNN A;  1FNW A;  3Q22 A;  4BBR B;  2QCP X;  4R9W A;  4A3B B;  1TQO A;  5EQ0 A;  3M7N A;  1ENF A;  1YNN D;  1JIC A;  3T4A C;  3S15 B;  3SR1 A;  3VYU A;  2A5H A;  2OT2 A;  5E1F A;  2O5I C;  2L55 A;  1TY0 A;  1QCB D;  1ROD A;  4PMC A;  1PZI D;  1SYC A;  1HFG A;  4UDU C;  3HOV B;  2B2T A;  2E74 C;  1IYV A;  2KUM A;  1PTO B;  3GTG B;  1TII D;  2RVL A;  1EY4 A;  1BOS A;  3D6C A;  2PCF B;  3D3R A;  4ZAI A;  2FIN B;  3X3N A;  5C3W A;  5LL6 X;  4K8I A;  4ZRZ A;  3O13 A;  4IQZ A;  2XWB B;  1CTM A;  4HTH A;  4ILW A;  1PTO H;  1FR3 A;  1H9M A;  1PXU A;  3J80 E;  4MHE A;  1F77 A;  5FO9 B;  5IIF A;  3I3C A;  1STA A;  2DN8 A;  4G7O C;  2L5T A;  2BCO A;  5KNC A;  5CV6 A;  5FO7 B;  1EY8 A;  2O5J C;  1Q1B A;  4ME5 A;  3HG9 A;  5KIX A;  5C4J B;  1EWH A;  4KD3 A;  1C48 A;  2EYM A;  3CRK C;  2L11 A;  2BOS A;  1V43 A;  4RAU C;  2JA5 B;  4DA2 A;  2EYH A;  5I6Y A;  3TZD A;  5EBD A;  1HTL D;  1STH A;  2EJF C;  3ITP A;  3OOC A;  2AQ1 B;  1IL8 A;  2R93 B;  5EKI A;  4AYB B;  2HUG A;  2CHB D;  3AMU A;  2MJ8 A;  4EQO A;  3KBG A;  5C3X A;  4G4K A;  3HOU B;  1ESF A;  4BWG B;  5COR A;  1HA6 A;  1AZP A;  3J7A V;  4TQU S;  3A7L A;  3QG1 A;  3FVQ A;  3T13 A;  2N55 A;  1TWA B;  4DF7 A;  3U9O A;  3FKI B;  1J8I A;  5M5W B;  5I9O A;  3ND9 A;  4KD4 A;  2LS0 1;  1XX8 A;  4FXD A;  4A3J B;  1XYI A;  4A3E B;  4C1N I;  1WD0 A;  2R61 A;  5KYI A;  2PNR C;  3A8I E;  1CZW A;  3H09 A;  3DEP A;  1LV9 A;  4QUF A;  2VUM B;  2HDL A;  2ENB A;  4NP5 A;  3C46 A;  1TU2 B;  4PQX A;  4FNF A;  2BA0 A;  2O2L D;  3MAQ A;  1BUV T;  1KAB A;  1FNV A;  1D1I A;  2PW7 A;  4FF2 A;  2AWN A;  1SYE A;  3I4L A;  5C4Z A;  5D3D A;  1RHP A;  1SNO A;  1QG7 A;  1QWY A;  4KN4 C;  1AP0 A;  4B9X A;  3MXP A;  3VR2 A;  3EFX D;  4E6I A;  1U4R A;  3NUC A;  3QOJ A;  5CMD A;  4DAP A;  2E76 C;  5EPL A;  1ZXT A;  4CJ0 B;  1NR2 A;  2PMZ B;  4BA1 I;  4CKC A;  5E4X A;  2PW5 A;  1QIL A;  4ZQ3 A;  1MI2 A;  1EIG A;  4DNR B;  4Z9C B;  3SE0 A;  1SMY C;  5CV5 A;  5FK9 C;  2RSN A;  4IN3 A;  2FMC A;  3SK6 A;  1TS5 A;  3MFG A;  1S5F D;  4A3K B;  1I4G A;  5JVH 3;  1SDF A;  3FDT A;  2PPB C;  2KED A;  1GHJ A;  1KNE A;  2PO4 A;  5NUC A;  2M9V A;  3GP7 A;  3GTP B;  5ISR A;  1ET6 A;  3HZX A;  3VR3 A;  3WOF A;  2J7Z A;  4PMB A;  2Z4I A;  5E4W C;  5HUR A;  3EJI A;  2HCC A;  1OXS C;  1HUM A;  4HMJ A;  1HRJ A;  2C9O A;  1J9O A;  5AFW A;  2K32 A;  4IUT A;  5T1G A;  1D2B A;  3U9S A;  3J7Y W;  1TS3 A;  1MBY A;  5C0X I;  3TP6 A;  5DAU A;  2F0H A;  4LAA A;  3I70 A;  4WRD A;  3JAM L;  1SJE D;  1DCZ A;  3H91 A;  4LK1 C;  2NVQ B;  3NBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...