4AQYQ

Structure of ribosome-apramycin complexes
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aqyQ00
4A3JG 1EIFA 1UE5A 1QVCA 1NMFA 5IYBH 2ZJRA 1SR3A 5FLXc 1HR0Q 3ERSX 2UUAQ 3I4MH 1TWFH 1YJ9A 4QL5A 4L5SA 1YJNA 1YEZA 2QEXA 1G6PA 4DV1L 2B3GA 3BU2A 4PZ6A 4B3SQ 4A3BG 4IPDA 2E2JH 4XIGS 3K80C 3UE1A 1FGUA 4A3FH 2CWAA 1OXVA 1JMCA 2JJQA 4LFBL 2JEAI 2HIXA 1HNWQ 3OW2A 4KLKA 1R9TH 1U5KA 4DV3L 2JA6H 1VQEA 2YTYA 3UDFA 1IBLQ 1VQLA 3U50C 2OCEA 3CW2C 4AIMA 3CCVA 1QZGA 2CCZA 4IOCA 1N34L 2KCMA 1IZ6A 3D0FA 1VQDA 4KHPL 1K8GA 4A3LG 3KJPA 1Q1EA 4LF9L 4A3JH 3ULPA 1Y14B 1PH9A 3PF4A 4QGUA 3EBEA 1TWGH 3UE0A 3DLLA 4FDBA 4UPAA 2PMZE 1A62A 1YHBA 3I4OA 3ULJA 4DKAC 5JEAG 5IWAQ 5FJ8G 4HIMA 4PG3A 5M3MH 2N49A 5HY6A 2UUCQ 4A3BH 3J81j 3PF5A 3DM3A 2B63H 4OWXB 4IOAA 3CPWA 3A5ZB 2MO1A 4JI8Q 1UE7A 1KXLA 4DV4Q 3SGIA 1SN8A 2K50A 2KHJA 2FXQA 1X3EA 1JT8A 2EXDA 1UE6A 2QGQA 5M5XH 3PCOB 4GKJL 5C0XJ 1MJCA 3IRBA 4JI3L 5IP9G 4LF8Q 1PA6A 1YJWA 1TWCH 1IBLL 3CC7A 4DUZQ 4LF7Q 1K0RA 5GAHC 4A3LH 3S16H 3GD7A 4LFAQ 3ULLA 2NN6G 4YY3Q 1S3OA 1IXRA 5GADC 2R7ZG 4JV5Q 3HKZG 3S1RH 2ZTDA 4JI1Q 4AYBE 4UP8A 1D8LA 3F2BA 4DV2Q 4JI0Q 4AH6A 4LF6Q 3RN5A 1Q7YC 4LUVA 3F1ZA 1LYLA 3E9IA 5IWAL 5M5WH 1OTCA 2CQOA 1RIPA 3RN2A 4DV5Q 2UUCL 2I5HA 4C3JH 2Z0SA 3CQZH 1OXUA 3RR5A 3U4VA 3AFPA 3GTPH 4JI7Q 4JI8L 4LFCQ 4NPSA 1XNRQ 1CKNB 3CCLA 3CD6A 1X65A 4DV4L 1MIUA 1Z9FA 4MTNA 1P8LA 2E2HH 3CCUA 2K4KA 3PUXA 1CKNA 3BZCA 5IP9H 3CCMA 4WJ3M 2XTIA 1PH3A 3L0OA 4IPGA 2PQAA 3I4NG 1CSQA 3U4ZA 4X66L 3GTQH 2R7FA 1I94L 1PH1A 4JOIA 3GTGH 2NN6I 1LM0A 1YZ6A 2JK8A 4HIKA 2OQ0A 2R92G 2R7ZH 4GN4B 1YIJA 5HGQA 1Q82C 1PH8A 1YNXA 2ES2A 4PMWA 4JI6Q 2F52A 4LF7L 1N33Q 1VQOA 2IHEA 1K9MC 4LFAL 4YY3L 1QVFA 3GTLH 3I7FA 1SROA 5J3BA 1EWIA 3I56A 4JV5L 2EIFA 4QY7A 4HJ5A 1VQHA 4IPCA 4JI1L 4DV2L 4JI0L 1L1OC 4LF6L 4X62Q 2BH8A 3PUZA 2JEBI 2AWNA 2ZJQA 3EIVA 1P16A 1GD7A 2B29A 4DV5L 3MXNB 4A76A 3CMAA 2JA9A 3TEHB 4P71A 4LFCL 5LMUQ 3H0GG 1XNRL 3UDGA 4IFDG 1VQAA 1X54A 2VL6A 1ASYA 4UY8C 3F2DA 1EYGA 2KCTA 5IYDG 1EQRA 3STBC 4GOPC 1YHAA 3RLOA 1BVSA 2HT1A 2HIVA 5ELOA 2NVQH 3GTJH 1X9NA 2R92H 1SMXA 2ATWA 4X64Q 4X6AH 3HOWH 4HJ7A 4UP7A 1PYBA 3G4SA 4DV6Q 2VUMG 2UXBQ 3CC4A 1IYJB 4JI6L 1N33L 2MQHA 1PV4A 2ZM6L 2YTXA 4YWMA 1V9PA 3MEFA 1UE1A 4A3KG 4A3CG 4YHHQ 4XTCS 3J81c 1X6OA 3K8AA 4TQUS 4X62L 4Y7NH 1W3SA 5M5YH 1S72A 4YWKA 3GTOH 3HOUG 4HIDA 1YHQA 3H0GH 1X3FA 3HKSA 2IY5B 4IFDI 3HOZG 3I2ZA 3CCEA 3UDXA 1N36L 5IYDH 3PSIA 2GVAA 2JE6I 4GKJQ 1KRTA 5LMUL 1Q46A 5IYCG 3OYYA 3H15A 3AQQA 3RZDH 4JI3Q 1BBWA 3M7NA 1VQFA 3PUYA 1Q86C 2VY3A 4QJFA 2ZTEA 4R1JA 2VUMH 5IT9c 1J5EQ 2DUDA 2XGTA 4X64L 4JI4Q 2IHFA 1XJVA 1HNZQ 4DV6L 1Z47A 2A8VA 4OX9Q 2UXBL 4X65Q 1VS0A 4A3KH 4B3MQ 4A3CH 1HNXL 1K83H 1VQBA 2N8NA 3K0XA 1LTLA 3M4QA 4MNOA 2D0OA 4P72A 1I50H 3H3VI 3H3VH 2OTJA 2AHOB 2RHQB 1X55A 4DAYB 1KIXA 2I5LX 2WAQG 4GNXC 4YHHL 4HJ9A 4IO9A 3W5OA 3GTKH 3HOUH 4L5QA 1B8AA 3OTOQ 1WOCA 5K36G 3HOZH 4KHZA 5LMNW 3A74A 5C4XG 1PVOA 4JCVE 4C2MH 4B3TQ 1D7QA 3PO2G 2ID0A 3HKZE 3W1GA 5IYCH 4BXXG 2K14A 3NENA 3GTMH 1PYSB 4BY1G 2Q2HA 1AH9A 4JG2A 4O2DA 2ALYB 2Y0SG 4X66Q 2R93G 1I94Q 2MO0A 3J80c 1X56A 4R4CA 3HOYG 3S1MH 4LW1A 2Z6KC 4JI2Q 1I5FA 5ELNA 1KRSA 2WP8J 5LMNQ 3CXCA 3CMEA 4DUYQ 5H1SE 1J5EL 1JJ2A 3S2HH 1VQ7A 2EQSA 1QVGA 4JI4L 2JA7G 5FJ8H 1HNZL 1OXTA 2BA0A 3J7ZC 4TVAB 1SLJA 4ME3A 1FVIA 4B3RQ 4OX9L 1UEBA 4X65L 4B3ML 1XPOA 2NZHA 4DR5Q 4JBKA 1AE2A 1KL9A 3KYHC 4GS3A 4DR6L 2YYZA 1SE8A 2MFIA 1PFSA 1KHIA 3OTOL 3PO2H 3KF6B 2E8GA 2PI2A 4UP9A 2YTVA 2CWPA 4DR1Q 4BY1H 4P75A 2R93H 2PQAB 4P74A 3RNUA 3KF6A 4B3TL 1A8VA 2VZAA 1VQNA 1WI5A 1V1QA 2YV5A 3HOYH 2NVTH 3TS2A 2MNAA 5IE8A 1NJIC 1RL2A 1M1KC 1H95A 3L2PA 5C0XG 2JA8G 4IPHA 2V1CC 2ZJPA 4DV0Q 1Q8KA 1ASZA 4JI2L 4DR4Q 2JA7H 4R4TA 5JJLA 3BJUA 2ZM6Q 3JAMc 5LMNL 1WCMG 3CPFA 4DUYL 2WFWA 2IT1A 1PH4A 5GROA 4LUZA 1I3QH 3AFQA 2JQOA 1WYDA 1IBKQ 3G6EA 1HZCA 4B3RL 2ASBA 4DR5L 3KLWA 4A4IA 4APVA 1L1OB 4DK6C 3HOXG 1XTDA 3E9HA 4DR3Q 4GLAC 1C9OA 2E5LL 4JBWA 4NB3A 2KBNA 3F8TA 2K75A 4DNIA 1L1OA 3PIOA 3S15H 2GN5A 1N36Q 1GVPA 1C7YA 2WB1G 5DLQE 4NXNQ 3KJOA 4DR2Q 1Y1WG 2OTLA 4DR1L 5JJIA 1GM5A 2K5VA 2VQEQ 3I4NH 4RMFA 3STBD 3CF5A 1KQSA 1WFQA 1SRUA 4YCVA 5C0XI 2JA8H 3JC66 4GOPB 4C3HH 4H02A 4MZ9A 3J7A5 4LF4Q 4IJHA 4R4QA 1WCMH 1VQPA 1XNQQ 5IYBG 1M90C 2BH2A 4HJ8A 4GOPA 5BR8Q 2F4VQ 3EN2A 2KHIA 3G71A 4DV0L 4DR4L 2PNHA 4IJLA 5M3FG 2K5HA 1HNXQ 4DPGA 2CFMA 1E1TA 3TRZA 3K7UC 4DR7Q 1JJGA 2YU9H 3M4OH 1XPRA 3S2DH 3NELA 4O0AA 2R7DA 1VQMA 3HOXH 1FJGL 2L15A 1IBKL 4OWWB 4OONA 1N9WA 2VQFQ 1Q81C 2IX0A 3B6YA 2HHHQ 3ZJYC 4OO1G 4KI0A 1HR0W 2OQKA 4DR3L 1Y1WH 5JJKA 3KOJA 1EFWA 1C0AA 4R4IA 2A19A 2DGYA 1TWHH 3M3YH 4GLVB 4NXNL 3GDEA 4NXMQ 4DR2L 2VQEL 5JEAJ 2E2IH 4K0KQ 2OWOA 1CKMA 1XPUA 2WAQE 1DGSA 2D62A 2K5NA 3AYHB 1E24A 5C3EG 1AE3A 1BBUA 1HZ9A 3FP9A 3Q8DA 5M3FH 4LF4L 5M3MG 4A93G 1XNQL 5BR8L 2F4VL 1L2FA 1NE3A 1U0LA 2B63G 1K3RA 2I5MX 1YITA 4POGA 1YI2A 1V43A 3PIPA 2Y0SE 4DR7L 4DR6Q 1HH2P 2UUBQ 1XMOQ 4GLXA 2N78A 2R6GA 1EOVA 1Y1VG 2D0PA 1WJJA 4PZ7A 3WWVA 4LF5L 3AEVA 3A0JA 4OO1I 3CP0A 3PUVA 5C4JH 2VQFL 4GNXB 5GAGC 2K52A 2HHHL 3HOVG 1KD1C 2AKWB 1NTGA 3M9BA 4GNXA 1FL0A 3KFUA 1G51A 1N8RC 3S14H 1EIYB 3PO3G 1GKHA 1VQCA 2N3SA 4GN5A 4HIOA 1E7ZA 3T1HL 5AJ3Q 1W2BA 1MKHA 1VQIA 5C3EH 1B70B 1VQJA 3CAMA 4NXML 4BY7G 5EAYA 4K0KL 3G48A 3HFZB 2VS1A 4A93H 4EQ5A 3J81i 2KENA 3FKIG 2UUAL 2UXDQ 5IP7G 2CKZB 1HR0L 2Q2IA 1YBYA 2PI2E 5FLMG 2HQLA 3ICEA 4DV7Q 1VQ5A 1X3GA 1VQKA 3S1NH 1VCIA 2Z6KA 4B3SL 1N32Q 2LXKA 1Y1VH 2ZTCA 3K7AH 3TREA 1HNWL 2BA1A 4AQYQ 1EQQA 4DK3C 2NVYH 2E5LQ 2NVXH 2NZOA 3I55A 2JA5G 2UUBL 4POFA 1XMOL 3HOVH 1IL2A 5C4XH 3CCRA 1QUQB 4C3IH 3BZKA 2LSSA 4BXXH 4LWCA 3PO3H 1SFOH 2LXJA 1QUQA 4HJAA 1VQGA 1CUKA 1PHJA 3U58A 3CC2A 1EUJA 3GO5A 4BY7H 3NBHB 1CKOA 2F3IA 5GQOA 2A1AA 1QZHA 1PH7A 3VDYA 2IX1A 3CCSA 4QIWE 4BA1I 1L0WA 3RZOH 3FKIH 4RG1A 3UDIA 5IP7H 5AJ3L 3HOWG 1JB7A 3ER0A 1UWVA 3S24A 3T1YQ 3W1BA 4GN3B 4LUOA 5FLMH 2UU9Q 4PZ8A 1J6QA 1K8AC 2UXDL 3TQYA 3M85A 5C44G 1LUZA 3KDFB 2C35B 1XMQQ 4J15A 2WB1E 4BBSG 3A5UA 2UXCQ 1VQ4A 3M4PA 2AWOA 4DV7L 4IFDJ 3KDFA 1FJGQ 2JA5H 1N32L 4AYBG 4JOIC 1E22A 4JBMA 1VQ8A 1Q1BA 3CCQA 2H5XA 3K81C 3RLFA 4A3EG 2Q2UA 2QA4A 1A0IA 4R4OA 4A3DG 3J80i 4AQYL 1OXSC 4A3IG 3CCJA 3TS0A 4A3GG 3KF8B 1KAWA 4LF8L 3S17H 2RCNA 4QQBX 4A3MG 2I0QA 4JBJA 3PUWA 4P73A 4JI5Q 4GKKQ 2Q2TA 4DUZL 1IBMQ 1HZAA 4YWLA 4JC0A 4JYAQ 1I6HH 4YCUA 4L5TA 1S40A 1HJPA 4BBRG 3D31A 2RHSB 5IY0A 1MJEA 3LGJA 1KC8C 4LNQA 1JJCB 1VQ9A 4OXPA 3L7ZC 4BA2I 4Y52H 5C44H 4DV1Q 1T9HA 1TXYA 1VQ6A 3T1YL 2UU9L 3I4MG 4BBSH 3RLNA 5E7NA 5GAEC 3PV0A 4YCWA 1Q12A 1XMQL 1E3PA 4LFBQ 1G291 1HZBA 2UXCL 1TWAH 3S1QH 4WJ4A 1YVCA 2RF4A 4LF5Q 2VW9A 4DV3Q 4A3EH 4A3FG 1PH2A 4JI7L 4A3DH 1A63A 1NBWA 4A3IH 4A3GH 1GO3E 1CSPA 4DAMA 3PGZA 2JA6G 1PH6A 1NMGA 2VNUD 3FHWA 4A3MH 1NY4A 4EX5A 2AMCB 3E0EA 1N34Q 1B7YB 4KHPQ 4A75A 1JE5A 3JAMi 1E1OA 4L5RC 4LF9Q 4BBRH 3T1HQ 1O7IA 3NEMA 4JI5L 4GKKL 2GVBA 3F2CA 1K73C 1PH5A 1IBML 4ALPA 1OXXK 4JYAL 4OWTB 1BKBA
chains in the Genus database with same CATH superfamily
1EIFA 1H9KA 2FMCA 4O1NA 1YJ9A 4QL5A 2QEXA 1BCPB 4DAVA 1G6PA 4DV1L 5LL6S 3BU2A 4DF7A 4A3BG 3OIPA 2OF1A 4XIGS 4RA8A 5ELFA 2JJQA 4LFBL 2JEAI 1WTXA 3OW2A 1R9TH 1JR0D 4KY5A 3QR8A 2E74C 1VQEA 3K5MA 1RJTA 4F87A 1GUSA 2CCZA 2EOTA 3S16B 1VQDA 1F2LA 3QB3A 3PF4A 1LT4D 3UE0A 5JPMC 1T5EA 3DLLA 4FDBA 3I8ZA 3I4OA 4IN3A 2I07B 2G9DA 1TVXA 4PG3A 1ENFA 2N49A 2UUCQ 1LV9A 3DM3A 1AN8A 4OWXB 1S5BD 3A5ZB 2XWBB 1WTOA 3GTPB 1OO9B 4K5XA 3H91A 2O5IC 2K50A 5LL6X 1RF2D 2KHJA 3K58A 1R4PB 1JT8A 1BDOA 5C0XJ 4JI3L 4CDDC 1YJWA 3T51B 2B8GA 4LF7Q 2R7ZB 3GD7A 5IT9L 1CT1D 2NN6G 2WKCA 2Z8LA 5GADC 1TY2A 3KUPA 3VR5A 5JEAH 3ERQA 4DV2Q 1EZ6A 3K0YA 4AH6A 4LF6Q 4LUVA 1LYLA 1OTCA 1RIPA 2O2LD 4K5WA 2Z0SA 2EYJA 3S15B 4JI8L 1XNRQ 1X65A 1MIUA 1P8LA 5IP9H 2FJ2A 3OW7A 3CCMA 2E76C 3WDNA 1E2VA 1V1PA 2PQAA 1PRTD 3I4NG 4X66L 1HQRD 1I94L 2R92B 1B3QA 5C6AA 2B2VA 1YIJA 5HGQA 1CTMA 1Q82C 2ES2A 1JORA 2IHEA 4LFAL 4YY3L 1QVFA 2EE1A 5J3BA 2EIFA 3VYTA 4HJ5A 1MSHA 2A6HD 1SE2A 3HG9A 4KKUA 1SNMA 2BH8A 3DUZA 1BCPF 4TRDA 4X3SA 5M5YB 4IUPA 1RCVD 1TIID 3KLSA 1HRJA 4L8JA 1YHAA 4RKLA 1IHZA 2HT1A 1D1KA 5ELOA 3GTJH 3MFYA 2EYFA 1KABA 4X64Q 2CQAA 2A5HA 4HJ7A 1F9QA 4DV6Q 3JAML 4XYQA 4YWMA 1BNZA 4FF4A 2ENBA 4XTCS 3GTKB 1GUWA 2F0EA 2SNSA 1A3UA 2XNAC 3M7GA 4HIDA 1QOHA 2F0PA 1X3FA 2PYKA 4IFDI 4IFDH 2AQ1B 3PSIA 5LMUL 2TMPA 3AQQA 1BBWA 1EIHA 3M7NA 3SK8A 2VY3A 2ZXRA 5IT9c 2XGTA 4I7ZC 4RGOS 5CV9A 2IHFA 5E4XA 4UAIA 2A8VA 2UXBL 1EY5A 2SOBA 4P72A 2X6GA 1I50H 4HCEA 1NNXA 5C5LA 2WAQG 4GNXC 3DWPA 4YHHL 4HJ9A 4IO9A 3OTOQ 1WOCA 1JCKB 1HTPA 4DAYA 3HOZH 4MTKA 4DXFA 3T56B 4B3TQ 3PO2G 5ELBA 3W1GA 2R93B 2H4OA 1PYSB 5CC4A 4O2DA 3P1HA 4DU9A 1LLRD 3J80c 4R4CA 3HOYG 2ICIA 5FO9B 1A2UA 3CXCA 3CMEA 5H1SE 1VQ7A 1NSNS 5FJ8H 1HNZL 1OXTA 4OX9L 1UEBA 4B3ML 1WTVA 4JBKA 3A7AB 3F2UA 4FNFA 5KYLA 5K36H 1KL9A 4DR6L 1PFSA 1KHIA 2IPKD 1U4PA 2KEEA 2XIWA 4BY1H 4P74A 3KF6A 1WI5A 2NVTH 2MNAA 1GXDC 3Q24A 2K5DA 1MD2D 2V1CC 1ENAA 3MXGA 4C3HG 2JA7H 1SYEA 4R4TA 3JAMc 4DUYL 4LUZA 3AFQA 5D65A 1WYDA 4B3RL 3SE0A 1YNJC 4DR5L 2KHSA 4DK6C 2K75A 1GUTA 3S15H 1B4OA 1N36Q 1BF4A 2WB1G 5DLQE 1Y1WG 2OTLA 1CFMA 2K5VA 4RMFA 1Z6HA 4EQPA 1Y8OB 3STBD 3CF5A 5C0XI 5C0XH 4J1MA 3JC66 4MZ9A 1HFGA 4LF4Q 1WCMH 1M90C 2BH2A 4HJ8A 4GOPA 5M3FG 2E2JB 1HNXQ 4OIJA 3M4OH 3NQTA 3MHBA 1A3VA 1IBKL 4OWWB 1U9RA 1Q81C 3ZJYC 5C4JB 2OQKA 3W3AA 4DR3L 1STEA 3Q0AA 1B2TA 2A19A 2DGYA 3M3YH 5J22A 3I91A 3S14B 4JVZA 2VQEL 1ILQA 4K0KQ 4K14A 2RA4A 5CV6A 1EOTA 1XPUA 2WAQE 1DGSA 1E24A 1SNPA 1BBUA 1HZ9A 2B63B 3K57A 3NXWA 4P2CB 1XNQL 1NE3A 1I4XA 1L2FA 3A54A 1K3RA 1BO0A 2E75C 2K03A 3PIPA 1KDBA 4K8JA 1EWHA 3NE5B 4GLXA 4LF5L 4OO1I 4OO1H 3MEHA 2F0DA 4G7ZC 1DOLA 3TMEA 5IODA 1HTLD 1NTGA 3M9BA 1QILA 3PO3B 1FL0A 1SFOB 1PYWD 2N3SA 4GN5A 1PTOD 2EYHA 5AJ3Q 1VQIA 5EAYA 1XWEA 3HFZB 2VS1A 4A93H 1G2SA 2HD3A 2B8FA 3J81E 1UEAB 3FKIG 1SYGA 1TR5A 2UUAL 1HR0L 1YBYA 1WD0A 4KV6A 3BYTB 2IWHA 2Z6KA 3Q23A 3CHBD 1E2WA 1F2ZA 2BE5D 1GOZA 1JOKA 1Y1VH 2PMZB 4ZQ3A 1HNWL 1GUGA 3PQIA 1ZYRD 2E5LQ 2NZOA 2JA5G 1O7LA 2RVLA 1SXTA 3HOVH 1CZWA 5IGBA 1PLFA 3CCRA 4C3IH 2N55A 5M9OA 4LWCA 3S17B 2CVRA 1PHJA 5A2QL 3GO5A 4BY7H 4CKBA 2F3IA 1QZHA 2IX1A 1HQMC 1PH7A 3VDYA 4QIWE 4BA1I 4FVMA 3UDIA 3AB9A 4LMQD 3HOWG 1STYA 5E4WC 4GN3B 3W1BA 3IAYA 5C44B 4BBSB 1D5ZC 4ZUIA 3KDFB 2C35B 4J15A 2WB1E 1F9RA 3A5UA 2UXCQ 1VQ4A 3M4PA 1MHWC 4HSVA 4N9PA 4KD3A 4AYBB 1QG7A 1FJGQ 2PZTA 1VQ8A 1Q1BA 3R93A 5G3LF 3RLFA 3PMFA 4R4OA 2B2VC 4AQYL 4DFAA 3TS0A 2R3ZA 1PRTC 3KLRA 3EVQA 1KAWA 3DEOA 3KF8A 2I0QA 2RDGA 4R9WA 1IBMQ 4BBRB 1S5FD 1I6HH 2SEBD 4YCUA 4LNQA 1HJPA 5DNFA 3D31A 1G6ZA 3L7ZC 4I7AA 3I73A 2A6HC 3HRZC 5EKLA 4DV1Q 1ZKOA 3T1YL 2UU9L 3I4MG 1WVLA 5E3FA 4IUNA 4LFBQ 2DNCA 1YVCA 1A63A 4HTHA 4A3IH 1R9TB 4A3GH 1CSPA 3K5LA 3PGZA 1PH6A 2LMCB 3H94A 1E1OA 1H9SA 3T1HQ 1O7IA 3NEMA 5KGUA 1K73C 5FKAC 5A35A 1BKBA 4QUCA 1A2TA 1SR3A 1TY0A 3OMGA 3K5NA 4B3SQ 2K5QA 2E2JH 3K80C 3UI2A 1FGUA 1JMCA 2F0NA 3DWQA 1U5KA 2JA6H 1HCZA 1ZXTA 3TP6A 2X69A 1K8MA 2OCEA 3CW2C 2B39A 4IOCA 1JOQA 2KCMA 4PNYA 1K8GA 4A3LG 3KJPA 1Q1EA 4A3JH 4KN4C 5I9OA 3MTSA 1PH9A 1SNCA 1A62A 5FJ8G 5KNBA 4HIMA 5HY6A 3J81j 2B63H 4IOAA 4JI8Q 1KXLA 2A68D 4QF4A 1SYFA 2LFNA 1SN8A 4X3UA 2FXQA 1X3EA 1UE6A 2QGQA 3DWAA 5M5XH 4GKJL 3MVVA 1GUOA 2HDMA 5FLXE 1PA6A 3T16A 1TWCH 3CC7A 2A69D 1UNSA 5I9PA 4LFAQ 4YY3Q 4J6HA 1S3OA 1IXRA 1SE3A 1D5MC 2R7ZG 3S1RH 2WIIB 3QOJA 4IURA 2ZTDA 3BZDB 4IUVA 3EJIA 1D8LA 1II3A 4YIJA 3RN5A 3D4RA 2EY2A 2RQXA 5M5WH 2O5JC 2PPBC 4C3JH 3HGBA 3CQZH 3RR5A 1CKNB 3CD6A 4ABNA 2EPBA 2D2CC 2K4KA 3SEBA 4WJ3M 2XTIA 3L0OA 3FEWX 3GTJB 1QNUA 3GTGH 1YZ6A 2J4XA 4HIKA 4RH6A 2OQ0A 2R92G 2V4DA 1YNXA 1RHPA 1SSOA 2K04A 3R2IA 1K9MC 5ELCA 1JICA 3I7FA 3I56A 4JV5L 4QY7A 1SJHD 4JI1L 4JI0L 3NTIA 2PZWA 3PUZA 4EVOA 4RGNA 5IGDA 1IL8A 2AWNA 3FPPA 1P16A 1GD7A 2B29A 3MXNB 1KNAA 3S9WA 3BVZA 3TEHB 4LFCL 5LMUQ 2DY8A 3G6JB 1HUNA 1VQAA 1X54A 3GV6A 2KCTA 5IYDG 1EQRA 1U4RA 3STBC 4GOPC 4N8FA 1IKLA 1ML0D 2HDLA 2HIVA 4DXGA 2MPMA 1EEID 1PYBA 3OMCA 2UXBQ 2L9HA 3H6MA 2WACA 1N33L 4LAAA 3TSSA 2ZM6L 2VB2X 5CV7A 5EGTA 3MEFA 1G91A 2LS01 5COYA 4YHHQ 1I50B 3BVGA 3J81c 4JPBW 4Y7NH 1FNWA 5DAUA 3GTOH 3HOZB 1PFNA 3H0GH 3HKSA 2F0IA 5C3WA 4HSPA 2RSNA 3I2ZA 3UDXA 2JE6I 4N9TA 1KRTA 1CK1A 3BVMA 1ET9A 2BDNA 3OYYA 5IYCG 3H15A 3RZDH 4F88A 1Y69U 5JVG3 1HUMA 1XTCD 1EZ8A 3PUYA 4QJFA 2VUMH 4RCOA 5IOCA 2DUDA 2L12A 5FOBB 5BN3A 2RDFA 5JJZA 1XJVA 1HNZQ 1I6VC 1PZJD 4OX9Q 4PQXA 1VS0A 4A3KH 4B3MQ 3OOCA 3OWEB 4A3CH 5BN5A 3DM1A 1LTLA 4IALA 1LTRD 2RHQB 2QILA 2I5LX 1KIXA 3HOUH 3W5OA 5C4XB 4KHZA 3P20A 3A74A 4BY1B 3EQLC 2Y0SB 3NENA 3GTMH 1AH9A 1ET6A 2ALYB 4KTAA 2R93G 1PTOC 2NVTB 1TU2B 3N6RA 2ICEC 3SXHA 3S1MH 3FVQA 2F0LA 2Z6KC 2K7VA 1AFPA 1SDFA 4DUYQ 1JJ2A 2JA7B 3S2HH 1QVGA 4JI4L 2NUCA 1JC7A 4TVAB 1SLJA 4B3RQ 4M8AA 4X65L 2BE5C 2NZHA 4DR5Q 1IYUA 3M4YA 4FF3A 1ZYRC 2MHVA 2YYZA 1SE8A 4K5VA 1EY9A 2E8GA 2YTVA 4P75A 1QJOA 1VQNA 3HZXA 3VR2A 3U9OA 1NR4A 3D4DA 4IPHA 3J80L 3IL8A 3K59A 1WCMB 1Q8KA 4WRDA 2ZJPA 4JI2L 2XVSA 1LTBD 3BJUA 5LMNL 1CM9A 1PH4A 1I3QH 2JQOA 3M4OB 1IBKQ 3G6EA 1HZCA 2RDHA 4IQZA 4A4IA 2Z4HA 4DR3Q 1I4HA 4ZKBB 4KK7A 2EJMA 4G4KA 1L1OA 3SK5A 4DNIA 2SDFA 4CHTB 1KLGD 2K05A 4KN7C 1GM5A 3M3YB 1RTOA 2VQEQ 4KD4A 2IL8A 1GHKA 1WFQA 1SRUA 4ZK9B 2JA8H 3R8BA 4RKBA 5CV8A 4IJHA 4DK1A 4B9XA 1XNQQ 3EN2A 4DV0L 4DR4L 2D9UA 3SHLA 1LT5D 3IFTA 1XPRA 2F0GA 4ULLA 3HOXH 1H9JA 2L15A 1LABA 1N9WA 5CMDA 3B6YA 3GQBA 4KI0A 1HR0W 3PIP3 5EBCA 1EFWA 1B53A 4R4IA 1TWHH 1X3PA 4GLVB 4L63B 3GDEA 3NK9A 2E2IH 2XRSD 3H3VC 4A93B 2D62A 2Q8TA 4TKOB 4JW0A 2X6LA 1A3TA 1VMCA 2B63G 4POGA 1JB3A 1Y1VB 4DR7L 4DAPA 1HH2P 2DJGC 2D0PA 3A0JA 3HOVB 2VQFL 4GNXB 3SDZA 2NTTA 4C3IB 2HHHL 2AKWB 4DNTB 3KFUA 2HCIA 2F0FA 1MI2A 3PO3G 4BY7B 1BOSA 4NXML 4ZUJA 3SR1A 1W2BA 5C3EH 1SEBD 1DOMA 3C1EA 4EQ5A 4FP5D 2KENA 2MJ8A 4DA2A 2I46A 2PI2E 1EY6A 2F4IA 3TP5A 3ICEA 3S1NH 3R2TA 2WINB 2CH4W 3RMHA 2A68C 2QKIC 2TSSA 3K7AH 3QG1A 2NVXH 4AQYQ 4DK3C 3I55A 2AUKA 1XMOL 5C4XH 1HXYD 1QUQB 3BZKA 2A69C 3CC2A 1CUKA 4JK1C 1EUJA 4NP5A 3NBHB 1I6HB 3V2TA 3CCSA 1D5XC 4UDUC 1L0WA 3RZOH 4RG1A 5IP7H 1M8AA 3ER0A 3T1YQ 1LT3D 1DM0B 2UU9Q 5FLMH 4PZ8A 1ICFB 2UXDL 3TQYA 5C44G 4BBSG 3C2PA 1X32A 1FYCA 2AWOA 3KLSX 3TBIB 1O80A 4AYBG 4A3IB 3CCQA 2H5XA 3K81C 4A3GB 2QA4A 1A0IA 3Q22A 3CCJA 3KBXA 1TS5A 1ENCA 4QQBX 1FNUA 3MA2B 3A56A 5D3IB 4BBRG 4KMUC 5IY0A 1MJEA 4X3KA 4K6LA 1K28A 4KKTA 5ELEA 4Y52H 1VQ6A 1TXYA 3I90A 4XQJA 1B9NA 3PV0A 1Q12A 1XMQL 1E3PA 1TWAH 4A3EH 4A3DH 3J7AV 4CDFC 1XXGA 2JA6B 1GO3E 3VYUA 3L3OC 4FO2A 5IGEA 1HA6A 4A3MH 3TP8A 5CR3A 1B7YB 4L5RC 1XX8A 4GKKL 3F2CA 4A3JB 1OXXK 3IKJA 4JYAL 1U4MA 1UE5A 1QVCA 1NMFA 5EKIA 2ZJRA 1O7ZA 1BCPD 3K6OA 1K83B 5EQ0A 5CGKA 5KIXA 3X3MA 3NSWA 2OT2A 4H7BA 2B3GA 4IPDA 1IW7D 3UE1A 1U4LA 1EL0A 4A3FH 2HIXA 3ZYYX 4ZKCB 3E3XA 3NBIA 4DV3L 1SYCA 5M5XB 4R8IA 1VQLA 2CW0D 1TWCB 4AIMA 1QZGA 5FK9C 5C4ZA 1E0BA 1RD9D 2F0QA 2B2UA 1SMYD 3ULPA 3S1RB 1Y14B 4QGUA 4U673 1ESRA 2PMZE 3ULJA 4DKAC 5JEAG 2PW7A 3A55A 2K01A 2J0TD 4A3BH 5M5WB 2N88A 4M1UB 4XQNA 3CPWA 3KK7A 3CU7A 4C3JB 1UE7A 1M4VA 1NAPA 3CQZB 2WV6D 3SGIA 4BWGB 3BDLA 2EXDA 3PCOB 1MJCA 2DY7A 4LF8Q 5IP9G 1C8CA 4EQOA 2PQEA 1IBLL 3GTGB 3CRLC 4DUZQ 5GAHC 3HKZB 4ZRZA 3ULLA 1ZEQX 3D6CA 4JV5Q 1B50A 4JI1Q 4AYBE 1VF5C 2Z6BA 4UP8A 3F2BA 4JI0Q 3K5OA 5TSSA 3F1ZA 3E9IA 5IWAL 5EKKA 4DK0A 3RN2A 5I4DA 2FINB 2I5HA 4N8X1 2OXPA 3U4VA 5K5PA 4JI7Q 4LFCQ 3SK6A 3CCLA 1W6KA 4DV4L 1AEXA 1RKNA 1V1PB 2F0UA 3CCUA 3PUXA 3BZCA 3NPPA 1F2MA 3P75A 1PH3A 4IPGA 1DXMA 3U4ZA 2R7FA 4JOIA 2NN6I 1LM0A 1PRTB 1PZID 2JK8A 4GN4B 2B2TA 2KCCA 1N33Q 1LO5D 4PMWA 2EXZA 3TN2A 3GTLH 3CRKC 1EWIA 1SE4A 1EFID 2L55A 4FYDA 1VQHA 4IPCA 1FGBD 1L1OC 1DJRD 1SJED 2RSOA 1CA5A 4HMJA 4ODGA 4Y7NB 4LK1C 3EIVA 2NTSA 3QIAA 4DV5L 3GTOB 4A76A 3H0GB 3CMAA 2EVBA 2M00A 3AU7A 3QJYA 4P71A 1MSGA 4IFDG 2VL6A 3QOLA 1ASYA 3F2DA 3N52A 2CHBD 3RZDB 3RLOA 2EYPA 3RD4A 3VR6A 2NVQH 4HCSA 4CDCC 1SMXA 5D14A 2VUMB 4X6AH 1PZKD 3T53B 4UP7A 3G4SA 1JWSD 2WKDA 3CC4A 1IYJB 3MAQA 4JI6L 2MQHA 1PV4A 2YTXA 4A3KB 4MIUA 3VR4A 1UE1A 1KNEA 1X6OA 3K8AA 4CJ2C 4CKEA 3HOUB 4X62L 2KECA 1W3SA 2NB0A 1B44D 1S72A 1TS3A 1YHQA 2IY5B 3HOZG 3CCEA 2JYOA 1N36L 3GTMB 1WTHA 3HS0C 3MXPA 4JI3Q 1WTPA 1WTWA 5CORA 2G5DA 2ZTEA 4R1JA 4ID6A 3S1MB 1PFMA 2DN8A 4QB4A 4JI4Q 3S2HB 1Z47A 4H13C 1LTTD 2MP1A 4X65Q 5IGFA 1HNXL 1K83H 1VQBA 2N8NA 4MNOA 2D0OA 2OTJA 5HURA 3URYA 4DAYB 1X55A 5I6WA 4L5QA 3J81L 5K36G 1HA5A 3NP8A 5LMNW 3WOFA 5C4XG 4C2MH 1LTSD 2ID0A 2K14A 4TSSA 3A7LA 2EY1A 4BY1G 2Q2HA 1JE4A 2Y0SG 4X66Q 2F0TA 1I94Q 2MO0A 4G57A 3EFXD 1C4QA 3NHHA 4K8IA 4JI2Q 1I5FA 1PDQA 3LWEA 1PRTF 2WP8J 5LMNQ 2F3VA 2QDLA 4H44C 1J5EL 2EQSA 4HR7B 2JA7G 2RBMA 2BA0A 1F2YA 4GZYC 1I3QB 4ME3A 4QCLA 4RHRA 1BXTA 1JWMD 2Z1CA 1AE2A 3KYHC 1EWCA 3MC0B 2MFIA 2BCOA 3PO2H 2PCFB 3BYYB 3KF6B 5IT9E 2PI2A 4UP9A 1TQOA 3RNUA 2EYOA 2VZAA 4EQNA 1HHVA 1YNND 3HOYH 2Z9HA 2JA8B 5BN4A 4U68A 1RL2A 1NJIC 3L2PA 5C0XG 5CBEE 3W2DA 4DV0Q 2F0OA 1ASZA 4DR4Q 5JJLA 3BS1A 1WCMG 2FHTA 1SBBB 2IT1A 5GROA 1CHPD 5T1GA 2ASBA 3HOXB 5FO7B 2A74C 4APVA 1XTDA 2M2LA 3E9HA 3OIQA 1C9OA 4GLAC 2E5LL 3F8TA 2GN5A 4KHVA 1GVPA 1C7YA 4OEMB 4I65A 4DR1L 1TWHB 1KQSA 3U9SA 1ICWA 2E2IB 4YCVA 4GOPB 4C3HH 3J7AF 4H02A 3J7A5 1VQPA 5DM63 4CBVA 2JN4A 2KHIA 3G71A 2PNHA 1S5CD 2K5HA 4DPGA 2LKVA 1A15A 4DR7Q 2YU9H 1FD7D 5G3LD 3S2DH 2NWGA 3NELA 2R7DA 1F9PA 1FJGL 4OONA 5I2XA 2VQFQ 1ONLA 3I3CA 3LWUA 2HHHQ 1Q90A 1O78A 4OO1G 4O42A 1CHQD 1L0XB 5F2DA 2LY7A 1Y1WH 1AZPA 3KOJA 4KKSA 3NTHA 1C0AA 3T4AC 1GHJA 1G2TA 4NXNL 4ME5A 1AP0A 4K6DA 4NXMQ 4DR2L 2NYZD 2HQEA 5L37A 4RAUC 5C3EB 1V1OA 5J1ZA 1D2BA 2K5NA 1BCPC 3AYHB 5M3MB 1AE3A 1DONA 1VDZA 5M3FH 3FP9A 3Q8DA 4A93G 3TZDA 1LT6D 5BR8L 2F4VL 1S5ED 1J8IA 1U0LA 2XN9C 3S1NB 1IW7C 2I5MX 1YI2A 2PNRC 3OSOA 2Y0SE 4DR6Q 3K7AB 4NW2A 1XMOQ 2N78A 1Y1VG 2R6GA 2SNMA 3WWVA 2NVXB 3CP0A 4KJOA 2F0SA 4OL7A 2B2UC 5GAGC 1HFNA 2K52A 1EY8A 3HOVG 2CW0C 4B9WA 2PZUA 3ND9A 4C3IG 1G51A 3V96A 2PW5A 1A6XA 4HIOA 1SMYC 1E7ZA 3T1HL 1MKHA 4BY7G 3RZOB 1B70B 1QNKA 1PTOB 3G48A 4PV1C 2XRQD 2UXDQ 5FLXL 1DZ1A 2Q2IA 4C56C 2HQLA 1VQ5A 1CQFA 1X3GA 1DOKA 3TP7A 4B3SL 2LXKA 5C4HA 5JVH3 1TKWB 3TREA 2E2HB 2C9OA 1BUVT 2NVYH 2XWJB 2UUBL 1C48A 4MN3A 5KNCA 1IL2A 4IUUA 3GTQB 2LSSA 4BXXH 1I4RA 2LXJA 1VQGA 2RKSA 3I70A 3U58A 2A1AA 2IJ0A 3KBGA 4BS9A 3FKIH 3S24A 1UWVA 4LUOA 4RWSC 2DJFC 4HEDA 1K8AC 2IW3A 1XMQQ 4CKCA 4ZLTF 1LUZA 3DXJC 2NBFA 4DV7L 1IKMA 4F7XA 1TWAB 3KDFA 4QUFA 4A3EB 2JA5H 4A3DB 3R3OA 1N32L 4JOIC 4JBMA 1EYDA 1NCVA 3TDQA 2B2TC 3J80i 3O13A 3OHXC 4A3IG 1E2ZA 2PO4A 4A3GG 3KF8B 2A6ED 2QEJC 4A3MB 2KVMA 2RCNA 4GKKQ 4KJNA 1HZAA 1RTNA 4JYAQ 3MFGA 2L11A 2MGSA 1KDCA 4L5TA 3HOWH 2RHSB 3TZUA 3LGJA 4XQQA 4G7OC 4HN7A 1JJCB 5JPNC 3ITPA 1T9HA 3RLNA 3BDOA 5GAEC 4YCWA 3CKIB 3EA6A 1HZBA 4A3FB 3S1QH 4WJ4A 2RF4A 4LF5Q 2VW9A 4DV3Q 1PH2A 1NBWA 4DAMA 3L9AX 1EYAA 2JA6G 3D3RA 2VNUD 1H9SB 1NY4A 2AMCB 3E0EA 5ISRA 4NMZA 1CQVA 1FR3A 3JAMi 4A75A 3C1FA 2F1MA 4JI5L 2GVBA 2EDGA 4A3JG 4X3TA 2UUAQ 1KAAA 5IYBH 3I4MH 1PTOF 5FLXc 1HR0Q 2JP1A 3ERSX 1TWFH 2AQ3B 4L5SA 4A3BB 4V190 1YJNA 1YEZA 2B2WA 1VMPA 4PZ6A 2J7ZA 3DMUA 1J9OA 1AW7A 1OXVA 2CWAA 5HGTA 2ZXOA 1HNWQ 1Y8NB 4E6IA 4KLKA 1STHA 2IX3A 2F0VA 2YTYA 4UHVA 4WJWA 3UDFA 1IBLQ 3U50C 2QF7A 1LTGD 5C5MA 3CCVA 4ZAIA 4ZYSA 1N34L 1IZ6A 3D0FA 4KHPL 4CDEC 1KDAA 4C1NI 4LF9L 3MWYW 3NWTA 4XYOA 4FXDA 3EBEA 1TWGH 4UPAA 1YHBA 4PMBA 1I4PA 5IWAQ 1EU4A 5ELDA 5M3MH 3PF5A 1STBA 3E0JA 2MO1A 2AUJD 2BDOA 3T13A 4DV4Q 3D8GA 4C3JG 3MZ5A 4EGVA 2B2YA 1B1ZA 3IRBA 3OWFA 4K2LA 1SYBA 4A3LH 1K0RA 1HPCA 2EZVA 5AFWA 3S16H 4K2KA 1SNQA 4CJ0B 4WORA 3HKZG 3GTLB 1I4GA 1PTOH 2R61A 4XDXA 1Q7YC 4XT3B 1F9SA 3BG3A 1EY7A 2CQOA 4DV5Q 2UUCL 1OXUA 5A2QE 1BQQT 3AFPA 3GTPH 4NPSA 3C46A 5EBDA 1TS4A 2K32A 1Z9FA 4MTNA 2E2HH 2F0MA 5EPLA 2G9HD 1CKNA 3I4NB 5DM73 2HCCA 4R8NA 1YNNC 3PIO3 1CSQA 3GTQH 2NVQB 1PH1A 3IFDA 1Q3LA 1STNA 3LX0A 3OPOA 2R7ZH 4JI6Q 1PH8A 4LF7L 2F52A 5E1FA 1VQOA 4CGYB 1CZGA 2HUGA 1SROA 1H9MA 4PMCA 2Z4IA 4DV2L 1XYIA 4LF6L 2P5ZX 4S3SA 4X62Q 2JEBI 2ZJQA 2K28A 1I4QA 2JA9A 3FDTA 5D3DA 3H0GG 1XNRL 3MXNA 3UDGA 5I2YA 5KYIA 4UY8C 4FF1A 1EYGA 4ZCKA 2L5TA 1BVSA 3VA7A 3MXUA 2L0CA 4Z9CB 1X9NA 2R92H 2ATWA 3DEPA 1PMRA 2VUMG 2FFKB 5KRUA 4B08A 4KY6A 1V9PA 1D6EC 4A3KG 4KY7A 4A3CG 1AZQA 4IUQA 3VYSA 4TQUS 1TS2A 3EROA 5M5YH 1ILPA 3Q6SA 1MBYA 2KUMA 4YWKA 3HOUG 1SNOA 1K0SA 4C2MB 2L1BA 5IYDH 2F0HA 2GVAA 4GKJQ 1Q46A 1G8ZD 1ESFA 1VQFA 1JQYD 1Q86C 5KEEA 2XSCA 4Q0FA 1J5EQ 4ILWA 4X64L 1PXUA 4DV6L 2K5WA 2EJFC 4NDXA 2JSOA 3H3VI 3K0XA 2WAQB 3M4QA 3H3VH 2AHOB 2Q8RE 3I4LA 3GTKH 2M9VA 4DN4M 1GJXA 1RDPD 1B8AA 5FO8B 2RCFA 3PO2B 3QO2A 3HP3A 1PVOA 4JCVE 1D7QA 5IYCH 3HKZE 4BXXG 4HAEA 4JG2A 1LACA 1EY4A 3HOYB 1EQTA 2H1EA 3LNNA 1X56A 2Q8IB 4LW1A 1T5XD 3RUZA 5ELNA 1KRSA 1EIGA 4RGMA 2EY6A 5IGGA 1LTAD 3J7ZC 1FVIA 4C1NK 1XPOA 1GUNA 2O4XA 4GS3A 1KLUD 2EYLA 4WFN3 2C5CA 1R4QB 3OTOL 5T1IA 3HEJA 4DR1Q 2CWPA 3QWNA 4IUTA 2R93H 2PQAB 4B3TL 1A8VA 1V1QA 2YV5A 3TS2A 3NUCA 1Q8IA 3NWSA 5IE8A 1M1KC 1H95A 3E5SA 5IIFA 3D6WA 1QCBD 4C3HB 2JA8G 2NN6H 4XXEA 4RFBA 1STGA 3H09A 2ZM6Q 1WTQA 2E2DC 3CPFA 2WFWA 4L6TB 2MUYA 4QIWB 5KNDA 4CJ1B 2YU9B 3S2DB 4QMGA 5CV4A 3KLWA 1X3QA 1L1OB 3HOXG 4JBWA 2WB1B 2KBNA 4NB3A 3PIOA 1Y1WB 2A6EC 2VXWA 1V8QA 4NXNQ 3NTKA 1EU3A 3KJOA 3A8JE 4OELB 4DR2Q 4V0BA 5JJIA 3DHQA 3I4NH 5J39A 3A8KE 4OIKA 2A73B 2F3WA 3WOEA 2QW7A 4R4QA 5IYBG 1KTKA 3D4WA 5M3FB 5BR8Q 2F4VQ 1TT2A 4XT1B 4IJLA 3VR3A 1IYVA 1DCZA 4FXKC 2CFMA 1E1TA 1JWUD 2ZT9C 5C3XA 2AQ2B 3TRZA 3K7UC 2ZXPA 1JJGA 4O0AA 2D5DA 3FPUB 2KJXA 1VQMA 1RODA 4NKLA 2IX0A 1MGSA 4J8QA 3SK4A 1O7YA 5JJKA 1QWYA 3ND8A 4OHJA 1EYCA 1D1IA 1DYQA 3BDCA 1EY0A 5JEAJ 2B2WC 1LTID 2OWOA 1CKMA 2QCPX 2K33A 3AMUA 5C3EG 1UUPA 4LF4L 5M3MG 3ONAB 2F0WA 4F8MA 3G7LA 1NR2A 1YITA 1V43A 4RCNA 1WD1A 3GV3A 5CYUA 2F03A 2UUBQ 1EOVA 4PZ7A 1DD2A 1WJJA 2NVYB 4HMIA 3AEVA 2DNEA 3PUVA 5C4JH 1KD1C 1CA6A 1EEFD 3SVMA 4GNXA 1N8RC 2F0KA 3S14H 1EIYB 2FMMA 1GKHA 1VQCA 3P7JA 4G7HC 1SYDA 2VB3X 4FXGC 3FMCA 1VQJA 3A8IE 3CAMA 3FKIB 4K0KL 4Q5VA 3C3LA 1CI3M 4OGQC 3J81i 1STAA 1S5DD 2CKZB 5IP7G 1K8OA 1FNVA 5FLMG 2B2YC 1NUCA 4DV7Q 1VQKA 1K3BC 2KA7A 3J7YW 1VCIA 2EYMA 5I6YA 1N32Q 2ZTCA 3E6ZX 2JA5B 1WTRA 2BA1A 1EQQA 3VYRA 5CV5A 5DEHA 4POFA 1H9RA 1JOOA 3V05A 1PFBA 5IGCA 3PO3H 2BOSA 2KOLA 1SFOH 4HJAA 1QUQA 1SAPA 1Y8PB 1CKOA 5GQOA 2EJGC 3HOWB 1BR9A 4RHSA 3NBHA 3FRPB 5AJ3L 1JB7A 1VF7A 3I72A 1S4ZA 1J6QA 2K6AA 3M85A 2KQ3A 2QDBA 1B3AA 4DNRB 4IFDJ 3S1QB 2GA4B 3GP7A 1YNJD 1EQVA 4H0LC 1E22A 5CBAE 2Q2UA 4A3EG 4A3DG 2OEOA 3J80E 1OXSC 1F77A 5EPKA 3X3NA 4LF8L 3S17H 4A3MG 5EJWA 4JBJA 3PUWA 4LJZC 4P73A 4JI5Q 2Q2TA 4DUZL 4YWLA 4JC0A 1S40A 1W6JA 4RGTA 1Z7TA 5LHY1 1KC8C 5EPJA 1BBXC 2JXMB 1VQ9A 4OXPA 3I4MB 4BA2I 1TWFB 2K1BA 5C44H 4BBSH 4MHEA 5E7NA 2NZ1D 4DGZA 2F0JA 1G291 2UXCL 1SNDA 4A3FG 4JI7L 2KEDA 3NQIA 5JAVA 5NUCA 1QE6A 2L4NA 2KCNA 1NMGA 3VA5A 3FHWA 4EX5A 1N34Q 1QB5D 5JOBA 1UAPA 4KHPQ 1B9MA 4IZ8A 1JE5A 3JAME 4LF9Q 4BBRH 2EY5A 2CH4A 1IBML 1PH5A 4ALPA 1L0YB 4OWTB 4FF2A 1TWGB
chains in the Genus database with same CATH topology
4A3JG 1EIFA 1UE5A 1QVCA 1NMFA 5IYBH 2ZJRA 1SR3A 5FLXc 1HR0Q 3ERSX 2UUAQ 3I4MH 1TWFH 1YJ9A 4QL5A 4L5SA 1YJNA 1YEZA 2QEXA 1G6PA 4DV1L 2B3GA 3BU2A 4PZ6A 4B3SQ 4A3BG 4IPDA 2E2JH 4XIGS 3K80C 3UE1A 1FGUA 4A3FH 2CWAA 1OXVA 1JMCA 2JJQA 4LFBL 2JEAI 2HIXA 1HNWQ 3OW2A 4KLKA 1R9TH 1U5KA 4DV3L 2JA6H 1VQEA 2YTYA 3UDFA 1IBLQ 1VQLA 3U50C 2OCEA 3CW2C 4AIMA 3CCVA 1QZGA 2CCZA 4IOCA 1N34L 2KCMA 1IZ6A 3D0FA 1VQDA 4KHPL 1K8GA 4A3LG 3KJPA 1Q1EA 4LF9L 4A3JH 3ULPA 1Y14B 1PH9A 3PF4A 4QGUA 3EBEA 1TWGH 3UE0A 3DLLA 4FDBA 4UPAA 2PMZE 1A62A 1YHBA 3I4OA 3ULJA 4DKAC 5JEAG 5IWAQ 5FJ8G 4HIMA 4PG3A 5M3MH 2N49A 5HY6A 2UUCQ 4A3BH 3J81j 3PF5A 3DM3A 2B63H 4OWXB 4IOAA 3CPWA 3A5ZB 2MO1A 4JI8Q 1UE7A 1KXLA 4DV4Q 3SGIA 1SN8A 2K50A 2KHJA 2FXQA 1X3EA 1JT8A 2EXDA 1UE6A 2QGQA 5M5XH 3PCOB 4GKJL 5C0XJ 1MJCA 3IRBA 4JI3L 5IP9G 4LF8Q 1PA6A 1YJWA 1TWCH 1IBLL 3CC7A 4DUZQ 4LF7Q 1K0RA 5GAHC 4A3LH 3S16H 3GD7A 4LFAQ 3ULLA 2NN6G 4YY3Q 1S3OA 1IXRA 5GADC 2R7ZG 4JV5Q 3HKZG 3S1RH 2ZTDA 4JI1Q 4AYBE 4UP8A 1D8LA 3F2BA 4DV2Q 4JI0Q 4AH6A 4LF6Q 3RN5A 1Q7YC 4LUVA 3F1ZA 1LYLA 3E9IA 5IWAL 5M5WH 1OTCA 2CQOA 1RIPA 3RN2A 4DV5Q 2UUCL 2I5HA 4C3JH 2Z0SA 3CQZH 1OXUA 3RR5A 3U4VA 3AFPA 3GTPH 4JI7Q 4JI8L 4LFCQ 4NPSA 1XNRQ 1CKNB 3CCLA 3CD6A 1X65A 4DV4L 1MIUA 1Z9FA 4MTNA 1P8LA 2E2HH 3CCUA 2K4KA 3PUXA 1CKNA 3BZCA 5IP9H 3CCMA 4WJ3M 2XTIA 1PH3A 3L0OA 4IPGA 2PQAA 3I4NG 1CSQA 3U4ZA 4X66L 3GTQH 2R7FA 1I94L 1PH1A 4JOIA 3GTGH 2NN6I 1LM0A 1YZ6A 2JK8A 4HIKA 2OQ0A 2R92G 2R7ZH 4GN4B 1YIJA 5HGQA 1Q82C 1PH8A 1YNXA 2ES2A 4PMWA 4JI6Q 2F52A 4LF7L 1N33Q 1VQOA 2IHEA 1K9MC 4LFAL 4YY3L 1QVFA 3GTLH 3I7FA 1SROA 5J3BA 1EWIA 3I56A 4JV5L 2EIFA 4QY7A 4HJ5A 1VQHA 4IPCA 4JI1L 4DV2L 4JI0L 1L1OC 4LF6L 4X62Q 2BH8A 3PUZA 2JEBI 2AWNA 2ZJQA 3EIVA 1P16A 1GD7A 2B29A 4DV5L 3MXNB 4A76A 3CMAA 2JA9A 3TEHB 4P71A 4LFCL 5LMUQ 3H0GG 1XNRL 3UDGA 4IFDG 1VQAA 1X54A 2VL6A 1ASYA 4UY8C 3F2DA 1EYGA 2KCTA 5IYDG 1EQRA 3STBC 4GOPC 1YHAA 3RLOA 1BVSA 2HT1A 2HIVA 5ELOA 2NVQH 3GTJH 1X9NA 2R92H 1SMXA 2ATWA 4X64Q 4X6AH 3HOWH 4HJ7A 4UP7A 1PYBA 3G4SA 4DV6Q 2VUMG 2UXBQ 3CC4A 1IYJB 4JI6L 1N33L 2MQHA 1PV4A 2ZM6L 2YTXA 4YWMA 1V9PA 3MEFA 1UE1A 4A3KG 4A3CG 4YHHQ 4XTCS 3J81c 1X6OA 3K8AA 4TQUS 4X62L 4Y7NH 1W3SA 5M5YH 1S72A 4YWKA 3GTOH 3HOUG 4HIDA 1YHQA 3H0GH 1X3FA 3HKSA 2IY5B 4IFDI 3HOZG 3I2ZA 3CCEA 3UDXA 1N36L 5IYDH 3PSIA 2GVAA 2JE6I 4GKJQ 1KRTA 5LMUL 1Q46A 5IYCG 3OYYA 3H15A 3AQQA 3RZDH 4JI3Q 1BBWA 3M7NA 1VQFA 3PUYA 1Q86C 2VY3A 4QJFA 2ZTEA 4R1JA 2VUMH 5IT9c 1J5EQ 2DUDA 2XGTA 4X64L 4JI4Q 2IHFA 1XJVA 1HNZQ 4DV6L 1Z47A 2A8VA 4OX9Q 2UXBL 4X65Q 1VS0A 4A3KH 4B3MQ 4A3CH 1HNXL 1K83H 1VQBA 2N8NA 3K0XA 1LTLA 3M4QA 4MNOA 2D0OA 4P72A 1I50H 3H3VI 3H3VH 2OTJA 2AHOB 2RHQB 1X55A 4DAYB 1KIXA 2I5LX 2WAQG 4GNXC 4YHHL 4HJ9A 4IO9A 3W5OA 3GTKH 3HOUH 4L5QA 1B8AA 3OTOQ 1WOCA 5K36G 3HOZH 4KHZA 5LMNW 3A74A 5C4XG 1PVOA 4JCVE 4C2MH 4B3TQ 1D7QA 3PO2G 2ID0A 3HKZE 3W1GA 5IYCH 4BXXG 2K14A 3NENA 3GTMH 1PYSB 4BY1G 2Q2HA 1AH9A 4JG2A 4O2DA 2ALYB 2Y0SG 4X66Q 2R93G 1I94Q 2MO0A 3J80c 1X56A 4R4CA 3HOYG 3S1MH 4LW1A 2Z6KC 4JI2Q 1I5FA 5ELNA 1KRSA 2WP8J 5LMNQ 3CXCA 3CMEA 4DUYQ 5H1SE 1J5EL 1JJ2A 3S2HH 1VQ7A 2EQSA 1QVGA 4JI4L 2JA7G 5FJ8H 1HNZL 1OXTA 2BA0A 3J7ZC 4TVAB 1SLJA 4ME3A 1FVIA 4B3RQ 4OX9L 1UEBA 4X65L 4B3ML 1XPOA 2NZHA 4DR5Q 4JBKA 1AE2A 1KL9A 3KYHC 4GS3A 4DR6L 2YYZA 1SE8A 2MFIA 1PFSA 1KHIA 3OTOL 3PO2H 3KF6B 2E8GA 2PI2A 4UP9A 2YTVA 2CWPA 4DR1Q 4BY1H 4P75A 2R93H 2PQAB 4P74A 3RNUA 3KF6A 4B3TL 1A8VA 2VZAA 1VQNA 1WI5A 1V1QA 2YV5A 3HOYH 2NVTH 3TS2A 2MNAA 5IE8A 1NJIC 1RL2A 1M1KC 1H95A 3L2PA 5C0XG 2JA8G 4IPHA 2V1CC 2ZJPA 4DV0Q 1Q8KA 1ASZA 4JI2L 4DR4Q 2JA7H 4R4TA 5JJLA 3BJUA 2ZM6Q 3JAMc 5LMNL 1WCMG 3CPFA 4DUYL 2WFWA 2IT1A 1PH4A 5GROA 4LUZA 1I3QH 3AFQA 2JQOA 1WYDA 1IBKQ 3G6EA 1HZCA 4B3RL 2ASBA 4DR5L 3KLWA 4A4IA 4APVA 1L1OB 4DK6C 3HOXG 1XTDA 3E9HA 4DR3Q 4GLAC 1C9OA 2E5LL 4JBWA 4NB3A 2KBNA 3F8TA 2K75A 4DNIA 1L1OA 3PIOA 3S15H 2GN5A 1N36Q 1GVPA 1C7YA 2WB1G 5DLQE 4NXNQ 3KJOA 4DR2Q 1Y1WG 2OTLA 4DR1L 5JJIA 1GM5A 2K5VA 2VQEQ 3I4NH 4RMFA 3STBD 3CF5A 1KQSA 1WFQA 1SRUA 4YCVA 5C0XI 2JA8H 3JC66 4GOPB 4C3HH 4H02A 4MZ9A 3J7A5 4LF4Q 4IJHA 4R4QA 1WCMH 1VQPA 1XNQQ 5IYBG 1M90C 2BH2A 4HJ8A 4GOPA 5BR8Q 2F4VQ 3EN2A 2KHIA 3G71A 4DV0L 4DR4L 2PNHA 4IJLA 5M3FG 2K5HA 1HNXQ 4DPGA 2CFMA 1E1TA 3TRZA 3K7UC 4DR7Q 1JJGA 2YU9H 3M4OH 1XPRA 3S2DH 3NELA 4O0AA 2R7DA 1VQMA 3HOXH 1FJGL 2L15A 1IBKL 4OWWB 4OONA 1N9WA 2VQFQ 1Q81C 2IX0A 3B6YA 2HHHQ 3ZJYC 4OO1G 4KI0A 1HR0W 2OQKA 4DR3L 1Y1WH 5JJKA 3KOJA 1EFWA 1C0AA 4R4IA 2A19A 2DGYA 1TWHH 3M3YH 4GLVB 4NXNL 3GDEA 4NXMQ 4DR2L 2VQEL 5JEAJ 2E2IH 4K0KQ 2OWOA 1CKMA 1XPUA 2WAQE 1DGSA 2D62A 2K5NA 3AYHB 1E24A 5C3EG 1AE3A 1BBUA 1HZ9A 3FP9A 3Q8DA 5M3FH 4LF4L 5M3MG 4A93G 1XNQL 5BR8L 2F4VL 1L2FA 1NE3A 1U0LA 2B63G 1K3RA 2I5MX 1YITA 4POGA 1YI2A 1V43A 3PIPA 2Y0SE 4DR7L 4DR6Q 1HH2P 2UUBQ 1XMOQ 4GLXA 2N78A 2R6GA 1EOVA 1Y1VG 2D0PA 1WJJA 4PZ7A 3WWVA 4LF5L 3AEVA 3A0JA 4OO1I 3CP0A 3PUVA 5C4JH 2VQFL 4GNXB 5GAGC 2K52A 2HHHL 3HOVG 1KD1C 2AKWB 1NTGA 3M9BA 4GNXA 1FL0A 3KFUA 1G51A 1N8RC 3S14H 1EIYB 3PO3G 1GKHA 1VQCA 2N3SA 4GN5A 4HIOA 1E7ZA 3T1HL 5AJ3Q 1W2BA 1MKHA 1VQIA 5C3EH 1B70B 1VQJA 3CAMA 4NXML 4BY7G 5EAYA 4K0KL 3G48A 3HFZB 2VS1A 4A93H 4EQ5A 3J81i 2KENA 3FKIG 2UUAL 2UXDQ 5IP7G 2CKZB 1HR0L 2Q2IA 1YBYA 2PI2E 5FLMG 2HQLA 3ICEA 4DV7Q 1VQ5A 1X3GA 1VQKA 3S1NH 1VCIA 2Z6KA 4B3SL 1N32Q 2LXKA 1Y1VH 2ZTCA 3K7AH 3TREA 1HNWL 2BA1A 4AQYQ 1EQQA 4DK3C 2NVYH 2E5LQ 2NVXH 2NZOA 3I55A 2JA5G 2UUBL 4POFA 1XMOL 3HOVH 1IL2A 5C4XH 3CCRA 1QUQB 4C3IH 3BZKA 2LSSA 4BXXH 4LWCA 3PO3H 1SFOH 2LXJA 1QUQA 4HJAA 1VQGA 1CUKA 1PHJA 3U58A 3CC2A 1EUJA 3GO5A 4BY7H 3NBHB 1CKOA 2F3IA 5GQOA 2A1AA 1QZHA 1PH7A 3VDYA 2IX1A 3CCSA 4QIWE 4BA1I 1L0WA 3RZOH 3FKIH 4RG1A 3UDIA 5IP7H 5AJ3L 3HOWG 1JB7A 3ER0A 1UWVA 3S24A 3T1YQ 3W1BA 4GN3B 4LUOA 5FLMH 2UU9Q 4PZ8A 1J6QA 1K8AC 2UXDL 3TQYA 3M85A 5C44G 1LUZA 3KDFB 2C35B 1XMQQ 4J15A 2WB1E 4BBSG 3A5UA 2UXCQ 1VQ4A 3M4PA 2AWOA 4DV7L 4IFDJ 3KDFA 1FJGQ 2JA5H 1N32L 4AYBG 4JOIC 1E22A 4JBMA 1VQ8A 1Q1BA 3CCQA 2H5XA 3K81C 3RLFA 4A3EG 2Q2UA 2QA4A 1A0IA 4R4OA 4A3DG 3J80i 4AQYL 1OXSC 4A3IG 3CCJA 3TS0A 4A3GG 3KF8B 1KAWA 4LF8L 3S17H 2RCNA 4QQBX 4A3MG 2I0QA 4JBJA 3PUWA 4P73A 4JI5Q 4GKKQ 2Q2TA 4DUZL 1IBMQ 1HZAA 4YWLA 4JC0A 4JYAQ 1I6HH 4YCUA 4L5TA 1S40A 1HJPA 4BBRG 3D31A 2RHSB 5IY0A 1MJEA 3LGJA 1KC8C 4LNQA 1JJCB 1VQ9A 4OXPA 3L7ZC 4BA2I 4Y52H 5C44H 4DV1Q 1T9HA 1TXYA 1VQ6A 3T1YL 2UU9L 3I4MG 4BBSH 3RLNA 5E7NA 5GAEC 3PV0A 4YCWA 1Q12A 1XMQL 1E3PA 4LFBQ 1G291 1HZBA 2UXCL 1TWAH 3S1QH 4WJ4A 1YVCA 2RF4A 4LF5Q 2VW9A 4DV3Q 4A3EH 4A3FG 1PH2A 4JI7L 4A3DH 1A63A 1NBWA 4A3IH 4A3GH 1GO3E 1CSPA 4DAMA 3PGZA 2JA6G 1PH6A 1NMGA 2VNUD 3FHWA 4A3MH 1NY4A 4EX5A 2AMCB 3E0EA 1N34Q 1B7YB 4KHPQ 4A75A 1JE5A 3JAMi 1E1OA 4L5RC 4LF9Q 4BBRH 3T1HQ 1O7IA 3NEMA 4JI5L 4GKKL 2GVBA 3F2CA 1K73C 1PH5A 1IBML 4ALPA 1OXXK 4JYAL 4OWTB 1BKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3J G;  1EIF A;  1UE5 A;  1QVC A;  1NMF A;  5IYB H;  2ZJR A;  1SR3 A;  5FLX c;  1HR0 Q;  3ERS X;  2UUA Q;  3I4M H;  1TWF H;  1YJ9 A;  4QL5 A;  4L5S A;  1YJN A;  1YEZ A;  2QEX A;  1G6P A;  4DV1 L;  2B3G A;  3BU2 A;  4PZ6 A;  4B3S Q;  4A3B G;  4IPD A;  2E2J H;  4XIG S;  3K80 C;  3UE1 A;  1FGU A;  4A3F H;  2CWA A;  1OXV A;  1JMC A;  2JJQ A;  4LFB L;  2JEA I;  2HIX A;  1HNW Q;  3OW2 A;  4KLK A;  1R9T H;  1U5K A;  4DV3 L;  2JA6 H;  1VQE A;  2YTY A;  3UDF A;  1IBL Q;  1VQL A;  3U50 C;  2OCE A;  3CW2 C;  4AIM A;  3CCV A;  1QZG A;  2CCZ A;  4IOC A;  1N34 L;  2KCM A;  1IZ6 A;  3D0F A;  1VQD A;  4KHP L;  1K8G A;  4A3L G;  3KJP A;  1Q1E A;  4LF9 L;  4A3J H;  3ULP A;  1Y14 B;  1PH9 A;  3PF4 A;  4QGU A;  3EBE A;  1TWG H;  3UE0 A;  3DLL A;  4FDB A;  4UPA A;  2PMZ E;  1A62 A;  1YHB A;  3I4O A;  3ULJ A;  4DKA C;  5JEA G;  5IWA Q;  5FJ8 G;  4HIM A;  4PG3 A;  5M3M H;  2N49 A;  5HY6 A;  2UUC Q;  4A3B H;  3J81 j;  3PF5 A;  3DM3 A;  2B63 H;  4OWX B;  4IOA A;  3CPW A;  3A5Z B;  2MO1 A;  4JI8 Q;  1UE7 A;  1KXL A;  4DV4 Q;  3SGI A;  1SN8 A;  2K50 A;  2KHJ A;  2FXQ A;  1X3E A;  1JT8 A;  2EXD A;  1UE6 A;  2QGQ A;  5M5X H;  3PCO B;  4GKJ L;  5C0X J;  1MJC A;  3IRB A;  4JI3 L;  5IP9 G;  4LF8 Q;  1PA6 A;  1YJW A;  1TWC H;  1IBL L;  3CC7 A;  4DUZ Q;  4LF7 Q;  1K0R A;  5GAH C;  4A3L H;  3S16 H;  3GD7 A;  4LFA Q;  3ULL A;  2NN6 G;  4YY3 Q;  1S3O A;  1IXR A;  5GAD C;  2R7Z G;  4JV5 Q;  3HKZ G;  3S1R H;  2ZTD A;  4JI1 Q;  4AYB E;  4UP8 A;  1D8L A;  3F2B A;  4DV2 Q;  4JI0 Q;  4AH6 A;  4LF6 Q;  3RN5 A;  1Q7Y C;  4LUV A;  3F1Z A;  1LYL A;  3E9I A;  5IWA L;  5M5W H;  1OTC A;  2CQO A;  1RIP A;  3RN2 A;  4DV5 Q;  2UUC L;  2I5H A;  4C3J H;  2Z0S A;  3CQZ H;  1OXU A;  3RR5 A;  3U4V A;  3AFP A;  3GTP H;  4JI7 Q;  4JI8 L;  4LFC Q;  4NPS A;  1XNR Q;  1CKN B;  3CCL A;  3CD6 A;  1X65 A;  4DV4 L;  1MIU A;  1Z9F A;  4MTN A;  1P8L A;  2E2H H;  3CCU A;  2K4K A;  3PUX A;  1CKN A;  3BZC A;  5IP9 H;  3CCM A;  4WJ3 M;  2XTI A;  1PH3 A;  3L0O A;  4IPG A;  2PQA A;  3I4N G;  1CSQ A;  3U4Z A;  4X66 L;  3GTQ H;  2R7F A;  1I94 L;  1PH1 A;  4JOI A;  3GTG H;  2NN6 I;  1LM0 A;  1YZ6 A;  2JK8 A;  4HIK A;  2OQ0 A;  2R92 G;  2R7Z H;  4GN4 B;  1YIJ A;  5HGQ A;  1Q82 C;  1PH8 A;  1YNX A;  2ES2 A;  4PMW A;  4JI6 Q;  2F52 A;  4LF7 L;  1N33 Q;  1VQO A;  2IHE A;  1K9M C;  4LFA L;  4YY3 L;  1QVF A;  3GTL H;  3I7F A;  1SRO A;  5J3B A;  1EWI A;  3I56 A;  4JV5 L;  2EIF A;  4QY7 A;  4HJ5 A;  1VQH A;  4IPC A;  4JI1 L;  4DV2 L;  4JI0 L;  1L1O C;  4LF6 L;  4X62 Q;  2BH8 A;  3PUZ A;  2JEB I;  2AWN A;  2ZJQ A;  3EIV A;  1P16 A;  1GD7 A;  2B29 A;  4DV5 L;  3MXN B;  4A76 A;  3CMA A;  2JA9 A;  3TEH B;  4P71 A;  4LFC L;  5LMU Q;  3H0G G;  1XNR L;  3UDG A;  4IFD G;  1VQA A;  1X54 A;  2VL6 A;  1ASY A;  4UY8 C;  3F2D A;  1EYG A;  2KCT A;  5IYD G;  1EQR A;  3STB C;  4GOP C;  1YHA A;  3RLO A;  1BVS A;  2HT1 A;  2HIV A;  5ELO A;  2NVQ H;  3GTJ H;  1X9N A;  2R92 H;  1SMX A;  2ATW A;  4X64 Q;  4X6A H;  3HOW H;  4HJ7 A;  4UP7 A;  1PYB A;  3G4S A;  4DV6 Q;  2VUM G;  2UXB Q;  3CC4 A;  1IYJ B;  4JI6 L;  1N33 L;  2MQH A;  1PV4 A;  2ZM6 L;  2YTX A;  4YWM A;  1V9P A;  3MEF A;  1UE1 A;  4A3K G;  4A3C G;  4YHH Q;  4XTC S;  3J81 c;  1X6O A;  3K8A A;  4TQU S;  4X62 L;  4Y7N H;  1W3S A;  5M5Y H;  1S72 A;  4YWK A;  3GTO H;  3HOU G;  4HID A;  1YHQ A;  3H0G H;  1X3F A;  3HKS A;  2IY5 B;  4IFD I;  3HOZ G;  3I2Z A;  3CCE A;  3UDX A;  1N36 L;  5IYD H;  3PSI A;  2GVA A;  2JE6 I;  4GKJ Q;  1KRT A;  5LMU L;  1Q46 A;  5IYC G;  3OYY A;  3H15 A;  3AQQ A;  3RZD H;  4JI3 Q;  1BBW A;  3M7N A;  1VQF A;  3PUY A;  1Q86 C;  2VY3 A;  4QJF A;  2ZTE A;  4R1J A;  2VUM H;  5IT9 c;  1J5E Q;  2DUD A;  2XGT A;  4X64 L;  4JI4 Q;  2IHF A;  1XJV A;  1HNZ Q;  4DV6 L;  1Z47 A;  2A8V A;  4OX9 Q;  2UXB L;  4X65 Q;  1VS0 A;  4A3K H;  4B3M Q;  4A3C H;  1HNX L;  1K83 H;  1VQB A;  2N8N A;  3K0X A;  1LTL A;  3M4Q A;  4MNO A;  2D0O A;  4P72 A;  1I50 H;  3H3V I;  3H3V H;  2OTJ A;  2AHO B;  2RHQ B;  1X55 A;  4DAY B;  1KIX A;  2I5L X;  2WAQ G;  4GNX C;  4YHH L;  4HJ9 A;  4IO9 A;  3W5O A;  3GTK H;  3HOU H;  4L5Q A;  1B8A A;  3OTO Q;  1WOC A;  5K36 G;  3HOZ H;  4KHZ A;  5LMN W;  3A74 A;  5C4X G;  1PVO A;  4JCV E;  4C2M H;  4B3T Q;  1D7Q A;  3PO2 G;  2ID0 A;  3HKZ E;  3W1G A;  5IYC H;  4BXX G;  2K14 A;  3NEN A;  3GTM H;  1PYS B;  4BY1 G;  2Q2H A;  1AH9 A;  4JG2 A;  4O2D A;  2ALY B;  2Y0S G;  4X66 Q;  2R93 G;  1I94 Q;  2MO0 A;  3J80 c;  1X56 A;  4R4C A;  3HOY G;  3S1M H;  4LW1 A;  2Z6K C;  4JI2 Q;  1I5F A;  5ELN A;  1KRS A;  2WP8 J;  5LMN Q;  3CXC A;  3CME A;  4DUY Q;  5H1S E;  1J5E L;  1JJ2 A;  3S2H H;  1VQ7 A;  2EQS A;  1QVG A;  4JI4 L;  2JA7 G;  5FJ8 H;  1HNZ L;  1OXT A;  2BA0 A;  3J7Z C;  4TVA B;  1SLJ A;  4ME3 A;  1FVI A;  4B3R Q;  4OX9 L;  1UEB A;  4X65 L;  4B3M L;  1XPO A;  2NZH A;  4DR5 Q;  4JBK A;  1AE2 A;  1KL9 A;  3KYH C;  4GS3 A;  4DR6 L;  2YYZ A;  1SE8 A;  2MFI A;  1PFS A;  1KHI A;  3OTO L;  3PO2 H;  3KF6 B;  2E8G A;  2PI2 A;  4UP9 A;  2YTV A;  2CWP A;  4DR1 Q;  4BY1 H;  4P75 A;  2R93 H;  2PQA B;  4P74 A;  3RNU A;  3KF6 A;  4B3T L;  1A8V A;  2VZA A;  1VQN A;  1WI5 A;  1V1Q A;  2YV5 A;  3HOY H;  2NVT H;  3TS2 A;  2MNA A;  5IE8 A;  1NJI C;  1RL2 A;  1M1K C;  1H95 A;  3L2P A;  5C0X G;  2JA8 G;  4IPH A;  2V1C C;  2ZJP A;  4DV0 Q;  1Q8K A;  1ASZ A;  4JI2 L;  4DR4 Q;  2JA7 H;  4R4T A;  5JJL A;  3BJU A;  2ZM6 Q;  3JAM c;  5LMN L;  1WCM G;  3CPF A;  4DUY L;  2WFW A;  2IT1 A;  1PH4 A;  5GRO A;  4LUZ A;  1I3Q H;  3AFQ A;  2JQO A;  1WYD A;  1IBK Q;  3G6E A;  1HZC A;  4B3R L;  2ASB A;  4DR5 L;  3KLW A;  4A4I A;  4APV A;  1L1O B;  4DK6 C;  3HOX G;  1XTD A;  3E9H A;  4DR3 Q;  4GLA C;  1C9O A;  2E5L L;  4JBW A;  4NB3 A;  2KBN A;  3F8T A;  2K75 A;  4DNI A;  1L1O A;  3PIO A;  3S15 H;  2GN5 A;  1N36 Q;  1GVP A;  1C7Y A;  2WB1 G;  5DLQ E;  4NXN Q;  3KJO A;  4DR2 Q;  1Y1W G;  2OTL A;  4DR1 L;  5JJI A;  1GM5 A;  2K5V A;  2VQE Q;  3I4N H;  4RMF A;  3STB D;  3CF5 A;  1KQS A;  1WFQ A;  1SRU A;  4YCV A;  5C0X I;  2JA8 H;  3JC6 6;  4GOP B;  4C3H H;  4H02 A;  4MZ9 A;  3J7A 5;  4LF4 Q;  4IJH A;  4R4Q A;  1WCM H;  1VQP A;  1XNQ Q;  5IYB G;  1M90 C;  2BH2 A;  4HJ8 A;  4GOP A;  5BR8 Q;  2F4V Q;  3EN2 A;  2KHI A;  3G71 A;  4DV0 L;  4DR4 L;  2PNH A;  4IJL A;  5M3F G;  2K5H A;  1HNX Q;  4DPG A;  2CFM A;  1E1T A;  3TRZ A;  3K7U C;  4DR7 Q;  1JJG A;  2YU9 H;  3M4O H;  1XPR A;  3S2D H;  3NEL A;  4O0A A;  2R7D A;  1VQM A;  3HOX H;  1FJG L;  2L15 A;  1IBK L;  4OWW B;  4OON A;  1N9W A;  2VQF Q;  1Q81 C;  2IX0 A;  3B6Y A;  2HHH Q;  3ZJY C;  4OO1 G;  4KI0 A;  1HR0 W;  2OQK A;  4DR3 L;  1Y1W H;  5JJK A;  3KOJ A;  1EFW A;  1C0A A;  4R4I A;  2A19 A;  2DGY A;  1TWH H;  3M3Y H;  4GLV B;  4NXN L;  3GDE A;  4NXM Q;  4DR2 L;  2VQE L;  5JEA J;  2E2I H;  4K0K Q;  2OWO A;  1CKM A;  1XPU A;  2WAQ E;  1DGS A;  2D62 A;  2K5N A;  3AYH B;  1E24 A;  5C3E G;  1AE3 A;  1BBU A;  1HZ9 A;  3FP9 A;  3Q8D A;  5M3F H;  4LF4 L;  5M3M G;  4A93 G;  1XNQ L;  5BR8 L;  2F4V L;  1L2F A;  1NE3 A;  1U0L A;  2B63 G;  1K3R A;  2I5M X;  1YIT A;  4POG A;  1YI2 A;  1V43 A;  3PIP A;  2Y0S E;  4DR7 L;  4DR6 Q;  1HH2 P;  2UUB Q;  1XMO Q;  4GLX A;  2N78 A;  2R6G A;  1EOV A;  1Y1V G;  2D0P A;  1WJJ A;  4PZ7 A;  3WWV A;  4LF5 L;  3AEV A;  3A0J A;  4OO1 I;  3CP0 A;  3PUV A;  5C4J H;  2VQF L;  4GNX B;  5GAG C;  2K52 A;  2HHH L;  3HOV G;  1KD1 C;  2AKW B;  1NTG A;  3M9B A;  4GNX A;  1FL0 A;  3KFU A;  1G51 A;  1N8R C;  3S14 H;  1EIY B;  3PO3 G;  1GKH A;  1VQC A;  2N3S A;  4GN5 A;  4HIO A;  1E7Z A;  3T1H L;  5AJ3 Q;  1W2B A;  1MKH A;  1VQI A;  5C3E H;  1B70 B;  1VQJ A;  3CAM A;  4NXM L;  4BY7 G;  5EAY A;  4K0K L;  3G48 A;  3HFZ B;  2VS1 A;  4A93 H;  4EQ5 A;  3J81 i;  2KEN A;  3FKI G;  2UUA L;  2UXD Q;  5IP7 G;  2CKZ B;  1HR0 L;  2Q2I A;  1YBY A;  2PI2 E;  5FLM G;  2HQL A;  3ICE A;  4DV7 Q;  1VQ5 A;  1X3G A;  1VQK A;  3S1N H;  1VCI A;  2Z6K A;  4B3S L;  1N32 Q;  2LXK A;  1Y1V H;  2ZTC A;  3K7A H;  3TRE A;  1HNW L;  2BA1 A;  4AQY Q;  1EQQ A;  4DK3 C;  2NVY H;  2E5L Q;  2NVX H;  2NZO A;  3I55 A;  2JA5 G;  2UUB L;  4POF A;  1XMO L;  3HOV H;  1IL2 A;  5C4X H;  3CCR A;  1QUQ B;  4C3I H;  3BZK A;  2LSS A;  4BXX H;  4LWC A;  3PO3 H;  1SFO H;  2LXJ A;  1QUQ A;  4HJA A;  1VQG A;  1CUK A;  1PHJ A;  3U58 A;  3CC2 A;  1EUJ A;  3GO5 A;  4BY7 H;  3NBH B;  1CKO A;  2F3I A;  5GQO A;  2A1A A;  1QZH A;  1PH7 A;  3VDY A;  2IX1 A;  3CCS A;  4QIW E;  4BA1 I;  1L0W A;  3RZO H;  3FKI H;  4RG1 A;  3UDI A;  5IP7 H;  5AJ3 L;  3HOW G;  1JB7 A;  3ER0 A;  1UWV A;  3S24 A;  3T1Y Q;  3W1B A;  4GN3 B;  4LUO A;  5FLM H;  2UU9 Q;  4PZ8 A;  1J6Q A;  1K8A C;  2UXD L;  3TQY A;  3M85 A;  5C44 G;  1LUZ A;  3KDF B;  2C35 B;  1XMQ Q;  4J15 A;  2WB1 E;  4BBS G;  3A5U A;  2UXC Q;  1VQ4 A;  3M4P A;  2AWO A;  4DV7 L;  4IFD J;  3KDF A;  1FJG Q;  2JA5 H;  1N32 L;  4AYB G;  4JOI C;  1E22 A;  4JBM A;  1VQ8 A;  1Q1B A;  3CCQ A;  2H5X A;  3K81 C;  3RLF A;  4A3E G;  2Q2U A;  2QA4 A;  1A0I A;  4R4O A;  4A3D G;  3J80 i;  4AQY L;  1OXS C;  4A3I G;  3CCJ A;  3TS0 A;  4A3G G;  3KF8 B;  1KAW A;  4LF8 L;  3S17 H;  2RCN A;  4QQB X;  4A3M G;  2I0Q A;  4JBJ A;  3PUW A;  4P73 A;  4JI5 Q;  4GKK Q;  2Q2T A;  4DUZ L;  1IBM Q;  1HZA A;  4YWL A;  4JC0 A;  4JYA Q;  1I6H H;  4YCU A;  4L5T A;  1S40 A;  1HJP A;  4BBR G;  3D31 A;  2RHS B;  5IY0 A;  1MJE A;  3LGJ A;  1KC8 C;  4LNQ A;  1JJC B;  1VQ9 A;  4OXP A;  3L7Z C;  4BA2 I;  4Y52 H;  5C44 H;  4DV1 Q;  1T9H A;  1TXY A;  1VQ6 A;  3T1Y L;  2UU9 L;  3I4M G;  4BBS H;  3RLN A;  5E7N A;  5GAE C;  3PV0 A;  4YCW A;  1Q12 A;  1XMQ L;  1E3P A;  4LFB Q;  1G29 1;  1HZB A;  2UXC L;  1TWA H;  3S1Q H;  4WJ4 A;  1YVC A;  2RF4 A;  4LF5 Q;  2VW9 A;  4DV3 Q;  4A3E H;  4A3F G;  1PH2 A;  4JI7 L;  4A3D H;  1A63 A;  1NBW A;  4A3I H;  4A3G H;  1GO3 E;  1CSP A;  4DAM A;  3PGZ A;  2JA6 G;  1PH6 A;  1NMG A;  2VNU D;  3FHW A;  4A3M H;  1NY4 A;  4EX5 A;  2AMC B;  3E0E A;  1N34 Q;  1B7Y B;  4KHP Q;  4A75 A;  1JE5 A;  3JAM i;  1E1O A;  4L5R C;  4LF9 Q;  4BBR H;  3T1H Q;  1O7I A;  3NEM A;  4JI5 L;  4GKK L;  2GVB A;  3F2C A;  1K73 C;  1PH5 A;  1IBM L;  4ALP A;  1OXX K;  4JYA L;  4OWT B;  1BKB A; 
#chains in the Genus database with same CATH topology
 1EIF A;  1H9K A;  2FMC A;  4O1N A;  1YJ9 A;  4QL5 A;  2QEX A;  1BCP B;  4DAV A;  1G6P A;  4DV1 L;  5LL6 S;  3BU2 A;  4DF7 A;  4A3B G;  3OIP A;  2OF1 A;  4XIG S;  4RA8 A;  5ELF A;  2JJQ A;  4LFB L;  2JEA I;  1WTX A;  3OW2 A;  1R9T H;  1JR0 D;  4KY5 A;  3QR8 A;  2E74 C;  1VQE A;  3K5M A;  1RJT A;  4F87 A;  1GUS A;  2CCZ A;  2EOT A;  3S16 B;  1VQD A;  1F2L A;  3QB3 A;  3PF4 A;  1LT4 D;  3UE0 A;  5JPM C;  1T5E A;  3DLL A;  4FDB A;  3I8Z A;  3I4O A;  4IN3 A;  2I07 B;  2G9D A;  1TVX A;  4PG3 A;  1ENF A;  2N49 A;  2UUC Q;  1LV9 A;  3DM3 A;  1AN8 A;  4OWX B;  1S5B D;  3A5Z B;  2XWB B;  1WTO A;  3GTP B;  1OO9 B;  4K5X A;  3H91 A;  2O5I C;  2K50 A;  5LL6 X;  1RF2 D;  2KHJ A;  3K58 A;  1R4P B;  1JT8 A;  1BDO A;  5C0X J;  4JI3 L;  4CDD C;  1YJW A;  3T51 B;  2B8G A;  4LF7 Q;  2R7Z B;  3GD7 A;  5IT9 L;  1CT1 D;  2NN6 G;  2WKC A;  2Z8L A;  5GAD C;  1TY2 A;  3KUP A;  3VR5 A;  5JEA H;  3ERQ A;  4DV2 Q;  1EZ6 A;  3K0Y A;  4AH6 A;  4LF6 Q;  4LUV A;  1LYL A;  1OTC A;  1RIP A;  2O2L D;  4K5W A;  2Z0S A;  2EYJ A;  3S15 B;  4JI8 L;  1XNR Q;  1X65 A;  1MIU A;  1P8L A;  5IP9 H;  2FJ2 A;  3OW7 A;  3CCM A;  2E76 C;  3WDN A;  1E2V A;  1V1P A;  2PQA A;  1PRT D;  3I4N G;  4X66 L;  1HQR D;  1I94 L;  2R92 B;  1B3Q A;  5C6A A;  2B2V A;  1YIJ A;  5HGQ A;  1CTM A;  1Q82 C;  2ES2 A;  1JOR A;  2IHE A;  4LFA L;  4YY3 L;  1QVF A;  2EE1 A;  5J3B A;  2EIF A;  3VYT A;  4HJ5 A;  1MSH A;  2A6H D;  1SE2 A;  3HG9 A;  4KKU A;  1SNM A;  2BH8 A;  3DUZ A;  1BCP F;  4TRD A;  4X3S A;  5M5Y B;  4IUP A;  1RCV D;  1TII D;  3KLS A;  1HRJ A;  4L8J A;  1YHA A;  4RKL A;  1IHZ A;  2HT1 A;  1D1K A;  5ELO A;  3GTJ H;  3MFY A;  2EYF A;  1KAB A;  4X64 Q;  2CQA A;  2A5H A;  4HJ7 A;  1F9Q A;  4DV6 Q;  3JAM L;  4XYQ A;  4YWM A;  1BNZ A;  4FF4 A;  2ENB A;  4XTC S;  3GTK B;  1GUW A;  2F0E A;  2SNS A;  1A3U A;  2XNA C;  3M7G A;  4HID A;  1QOH A;  2F0P A;  1X3F A;  2PYK A;  4IFD I;  4IFD H;  2AQ1 B;  3PSI A;  5LMU L;  2TMP A;  3AQQ A;  1BBW A;  1EIH A;  3M7N A;  3SK8 A;  2VY3 A;  2ZXR A;  5IT9 c;  2XGT A;  4I7Z C;  4RGO S;  5CV9 A;  2IHF A;  5E4X A;  4UAI A;  2A8V A;  2UXB L;  1EY5 A;  2SOB A;  4P72 A;  2X6G A;  1I50 H;  4HCE A;  1NNX A;  5C5L A;  2WAQ G;  4GNX C;  3DWP A;  4YHH L;  4HJ9 A;  4IO9 A;  3OTO Q;  1WOC A;  1JCK B;  1HTP A;  4DAY A;  3HOZ H;  4MTK A;  4DXF A;  3T56 B;  4B3T Q;  3PO2 G;  5ELB A;  3W1G A;  2R93 B;  2H4O A;  1PYS B;  5CC4 A;  4O2D A;  3P1H A;  4DU9 A;  1LLR D;  3J80 c;  4R4C A;  3HOY G;  2ICI A;  5FO9 B;  1A2U A;  3CXC A;  3CME A;  5H1S E;  1VQ7 A;  1NSN S;  5FJ8 H;  1HNZ L;  1OXT A;  4OX9 L;  1UEB A;  4B3M L;  1WTV A;  4JBK A;  3A7A B;  3F2U A;  4FNF A;  5KYL A;  5K36 H;  1KL9 A;  4DR6 L;  1PFS A;  1KHI A;  2IPK D;  1U4P A;  2KEE A;  2XIW A;  4BY1 H;  4P74 A;  3KF6 A;  1WI5 A;  2NVT H;  2MNA A;  1GXD C;  3Q24 A;  2K5D A;  1MD2 D;  2V1C C;  1ENA A;  3MXG A;  4C3H G;  2JA7 H;  1SYE A;  4R4T A;  3JAM c;  4DUY L;  4LUZ A;  3AFQ A;  5D65 A;  1WYD A;  4B3R L;  3SE0 A;  1YNJ C;  4DR5 L;  2KHS A;  4DK6 C;  2K75 A;  1GUT A;  3S15 H;  1B4O A;  1N36 Q;  1BF4 A;  2WB1 G;  5DLQ E;  1Y1W G;  2OTL A;  1CFM A;  2K5V A;  4RMF A;  1Z6H A;  4EQP A;  1Y8O B;  3STB D;  3CF5 A;  5C0X I;  5C0X H;  4J1M A;  3JC6 6;  4MZ9 A;  1HFG A;  4LF4 Q;  1WCM H;  1M90 C;  2BH2 A;  4HJ8 A;  4GOP A;  5M3F G;  2E2J B;  1HNX Q;  4OIJ A;  3M4O H;  3NQT A;  3MHB A;  1A3V A;  1IBK L;  4OWW B;  1U9R A;  1Q81 C;  3ZJY C;  5C4J B;  2OQK A;  3W3A A;  4DR3 L;  1STE A;  3Q0A A;  1B2T A;  2A19 A;  2DGY A;  3M3Y H;  5J22 A;  3I91 A;  3S14 B;  4JVZ A;  2VQE L;  1ILQ A;  4K0K Q;  4K14 A;  2RA4 A;  5CV6 A;  1EOT A;  1XPU A;  2WAQ E;  1DGS A;  1E24 A;  1SNP A;  1BBU A;  1HZ9 A;  2B63 B;  3K57 A;  3NXW A;  4P2C B;  1XNQ L;  1NE3 A;  1I4X A;  1L2F A;  3A54 A;  1K3R A;  1BO0 A;  2E75 C;  2K03 A;  3PIP A;  1KDB A;  4K8J A;  1EWH A;  3NE5 B;  4GLX A;  4LF5 L;  4OO1 I;  4OO1 H;  3MEH A;  2F0D A;  4G7Z C;  1DOL A;  3TME A;  5IOD A;  1HTL D;  1NTG A;  3M9B A;  1QIL A;  3PO3 B;  1FL0 A;  1SFO B;  1PYW D;  2N3S A;  4GN5 A;  1PTO D;  2EYH A;  5AJ3 Q;  1VQI A;  5EAY A;  1XWE A;  3HFZ B;  2VS1 A;  4A93 H;  1G2S A;  2HD3 A;  2B8F A;  3J81 E;  1UEA B;  3FKI G;  1SYG A;  1TR5 A;  2UUA L;  1HR0 L;  1YBY A;  1WD0 A;  4KV6 A;  3BYT B;  2IWH A;  2Z6K A;  3Q23 A;  3CHB D;  1E2W A;  1F2Z A;  2BE5 D;  1GOZ A;  1JOK A;  1Y1V H;  2PMZ B;  4ZQ3 A;  1HNW L;  1GUG A;  3PQI A;  1ZYR D;  2E5L Q;  2NZO A;  2JA5 G;  1O7L A;  2RVL A;  1SXT A;  3HOV H;  1CZW A;  5IGB A;  1PLF A;  3CCR A;  4C3I H;  2N55 A;  5M9O A;  4LWC A;  3S17 B;  2CVR A;  1PHJ A;  5A2Q L;  3GO5 A;  4BY7 H;  4CKB A;  2F3I A;  1QZH A;  2IX1 A;  1HQM C;  1PH7 A;  3VDY A;  4QIW E;  4BA1 I;  4FVM A;  3UDI A;  3AB9 A;  4LMQ D;  3HOW G;  1STY A;  5E4W C;  4GN3 B;  3W1B A;  3IAY A;  5C44 B;  4BBS B;  1D5Z C;  4ZUI A;  3KDF B;  2C35 B;  4J15 A;  2WB1 E;  1F9R A;  3A5U A;  2UXC Q;  1VQ4 A;  3M4P A;  1MHW C;  4HSV A;  4N9P A;  4KD3 A;  4AYB B;  1QG7 A;  1FJG Q;  2PZT A;  1VQ8 A;  1Q1B A;  3R93 A;  5G3L F;  3RLF A;  3PMF A;  4R4O A;  2B2V C;  4AQY L;  4DFA A;  3TS0 A;  2R3Z A;  1PRT C;  3KLR A;  3EVQ A;  1KAW A;  3DEO A;  3KF8 A;  2I0Q A;  2RDG A;  4R9W A;  1IBM Q;  4BBR B;  1S5F D;  1I6H H;  2SEB D;  4YCU A;  4LNQ A;  1HJP A;  5DNF A;  3D31 A;  1G6Z A;  3L7Z C;  4I7A A;  3I73 A;  2A6H C;  3HRZ C;  5EKL A;  4DV1 Q;  1ZKO A;  3T1Y L;  2UU9 L;  3I4M G;  1WVL A;  5E3F A;  4IUN A;  4LFB Q;  2DNC A;  1YVC A;  1A63 A;  4HTH A;  4A3I H;  1R9T B;  4A3G H;  1CSP A;  3K5L A;  3PGZ A;  1PH6 A;  2LMC B;  3H94 A;  1E1O A;  1H9S A;  3T1H Q;  1O7I A;  3NEM A;  5KGU A;  1K73 C;  5FKA C;  5A35 A;  1BKB A;  4QUC A;  1A2T A;  1SR3 A;  1TY0 A;  3OMG A;  3K5N A;  4B3S Q;  2K5Q A;  2E2J H;  3K80 C;  3UI2 A;  1FGU A;  1JMC A;  2F0N A;  3DWQ A;  1U5K A;  2JA6 H;  1HCZ A;  1ZXT A;  3TP6 A;  2X69 A;  1K8M A;  2OCE A;  3CW2 C;  2B39 A;  4IOC A;  1JOQ A;  2KCM A;  4PNY A;  1K8G A;  4A3L G;  3KJP A;  1Q1E A;  4A3J H;  4KN4 C;  5I9O A;  3MTS A;  1PH9 A;  1SNC A;  1A62 A;  5FJ8 G;  5KNB A;  4HIM A;  5HY6 A;  3J81 j;  2B63 H;  4IOA A;  4JI8 Q;  1KXL A;  2A68 D;  4QF4 A;  1SYF A;  2LFN A;  1SN8 A;  4X3U A;  2FXQ A;  1X3E A;  1UE6 A;  2QGQ A;  3DWA A;  5M5X H;  4GKJ L;  3MVV A;  1GUO A;  2HDM A;  5FLX E;  1PA6 A;  3T16 A;  1TWC H;  3CC7 A;  2A69 D;  1UNS A;  5I9P A;  4LFA Q;  4YY3 Q;  4J6H A;  1S3O A;  1IXR A;  1SE3 A;  1D5M C;  2R7Z G;  3S1R H;  2WII B;  3QOJ A;  4IUR A;  2ZTD A;  3BZD B;  4IUV A;  3EJI A;  1D8L A;  1II3 A;  4YIJ A;  3RN5 A;  3D4R A;  2EY2 A;  2RQX A;  5M5W H;  2O5J C;  2PPB C;  4C3J H;  3HGB A;  3CQZ H;  3RR5 A;  1CKN B;  3CD6 A;  4ABN A;  2EPB A;  2D2C C;  2K4K A;  3SEB A;  4WJ3 M;  2XTI A;  3L0O A;  3FEW X;  3GTJ B;  1QNU A;  3GTG H;  1YZ6 A;  2J4X A;  4HIK A;  4RH6 A;  2OQ0 A;  2R92 G;  2V4D A;  1YNX A;  1RHP A;  1SSO A;  2K04 A;  3R2I A;  1K9M C;  5ELC A;  1JIC A;  3I7F A;  3I56 A;  4JV5 L;  4QY7 A;  1SJH D;  4JI1 L;  4JI0 L;  3NTI A;  2PZW A;  3PUZ A;  4EVO A;  4RGN A;  5IGD A;  1IL8 A;  2AWN A;  3FPP A;  1P16 A;  1GD7 A;  2B29 A;  3MXN B;  1KNA A;  3S9W A;  3BVZ A;  3TEH B;  4LFC L;  5LMU Q;  2DY8 A;  3G6J B;  1HUN A;  1VQA A;  1X54 A;  3GV6 A;  2KCT A;  5IYD G;  1EQR A;  1U4R A;  3STB C;  4GOP C;  4N8F A;  1IKL A;  1ML0 D;  2HDL A;  2HIV A;  4DXG A;  2MPM A;  1EEI D;  1PYB A;  3OMC A;  2UXB Q;  2L9H A;  3H6M A;  2WAC A;  1N33 L;  4LAA A;  3TSS A;  2ZM6 L;  2VB2 X;  5CV7 A;  5EGT A;  3MEF A;  1G91 A;  2LS0 1;  5COY A;  4YHH Q;  1I50 B;  3BVG A;  3J81 c;  4JPB W;  4Y7N H;  1FNW A;  5DAU A;  3GTO H;  3HOZ B;  1PFN A;  3H0G H;  3HKS A;  2F0I A;  5C3W A;  4HSP A;  2RSN A;  3I2Z A;  3UDX A;  2JE6 I;  4N9T A;  1KRT A;  1CK1 A;  3BVM A;  1ET9 A;  2BDN A;  3OYY A;  5IYC G;  3H15 A;  3RZD H;  4F88 A;  1Y69 U;  5JVG 3;  1HUM A;  1XTC D;  1EZ8 A;  3PUY A;  4QJF A;  2VUM H;  4RCO A;  5IOC A;  2DUD A;  2L12 A;  5FOB B;  5BN3 A;  2RDF A;  5JJZ A;  1XJV A;  1HNZ Q;  1I6V C;  1PZJ D;  4OX9 Q;  4PQX A;  1VS0 A;  4A3K H;  4B3M Q;  3OOC A;  3OWE B;  4A3C H;  5BN5 A;  3DM1 A;  1LTL A;  4IAL A;  1LTR D;  2RHQ B;  2QIL A;  2I5L X;  1KIX A;  3HOU H;  3W5O A;  5C4X B;  4KHZ A;  3P20 A;  3A74 A;  4BY1 B;  3EQL C;  2Y0S B;  3NEN A;  3GTM H;  1AH9 A;  1ET6 A;  2ALY B;  4KTA A;  2R93 G;  1PTO C;  2NVT B;  1TU2 B;  3N6R A;  2ICE C;  3SXH A;  3S1M H;  3FVQ A;  2F0L A;  2Z6K C;  2K7V A;  1AFP A;  1SDF A;  4DUY Q;  1JJ2 A;  2JA7 B;  3S2H H;  1QVG A;  4JI4 L;  2NUC A;  1JC7 A;  4TVA B;  1SLJ A;  4B3R Q;  4M8A A;  4X65 L;  2BE5 C;  2NZH A;  4DR5 Q;  1IYU A;  3M4Y A;  4FF3 A;  1ZYR C;  2MHV A;  2YYZ A;  1SE8 A;  4K5V A;  1EY9 A;  2E8G A;  2YTV A;  4P75 A;  1QJO A;  1VQN A;  3HZX A;  3VR2 A;  3U9O A;  1NR4 A;  3D4D A;  4IPH A;  3J80 L;  3IL8 A;  3K59 A;  1WCM B;  1Q8K A;  4WRD A;  2ZJP A;  4JI2 L;  2XVS A;  1LTB D;  3BJU A;  5LMN L;  1CM9 A;  1PH4 A;  1I3Q H;  2JQO A;  3M4O B;  1IBK Q;  3G6E A;  1HZC A;  2RDH A;  4IQZ A;  4A4I A;  2Z4H A;  4DR3 Q;  1I4H A;  4ZKB B;  4KK7 A;  2EJM A;  4G4K A;  1L1O A;  3SK5 A;  4DNI A;  2SDF A;  4CHT B;  1KLG D;  2K05 A;  4KN7 C;  1GM5 A;  3M3Y B;  1RTO A;  2VQE Q;  4KD4 A;  2IL8 A;  1GHK A;  1WFQ A;  1SRU A;  4ZK9 B;  2JA8 H;  3R8B A;  4RKB A;  5CV8 A;  4IJH A;  4DK1 A;  4B9X A;  1XNQ Q;  3EN2 A;  4DV0 L;  4DR4 L;  2D9U A;  3SHL A;  1LT5 D;  3IFT A;  1XPR A;  2F0G A;  4ULL A;  3HOX H;  1H9J A;  2L15 A;  1LAB A;  1N9W A;  5CMD A;  3B6Y A;  3GQB A;  4KI0 A;  1HR0 W;  3PIP 3;  5EBC A;  1EFW A;  1B53 A;  4R4I A;  1TWH H;  1X3P A;  4GLV B;  4L63 B;  3GDE A;  3NK9 A;  2E2I H;  2XRS D;  3H3V C;  4A93 B;  2D62 A;  2Q8T A;  4TKO B;  4JW0 A;  2X6L A;  1A3T A;  1VMC A;  2B63 G;  4POG A;  1JB3 A;  1Y1V B;  4DR7 L;  4DAP A;  1HH2 P;  2DJG C;  2D0P A;  3A0J A;  3HOV B;  2VQF L;  4GNX B;  3SDZ A;  2NTT A;  4C3I B;  2HHH L;  2AKW B;  4DNT B;  3KFU A;  2HCI A;  2F0F A;  1MI2 A;  3PO3 G;  4BY7 B;  1BOS A;  4NXM L;  4ZUJ A;  3SR1 A;  1W2B A;  5C3E H;  1SEB D;  1DOM A;  3C1E A;  4EQ5 A;  4FP5 D;  2KEN A;  2MJ8 A;  4DA2 A;  2I46 A;  2PI2 E;  1EY6 A;  2F4I A;  3TP5 A;  3ICE A;  3S1N H;  3R2T A;  2WIN B;  2CH4 W;  3RMH A;  2A68 C;  2QKI C;  2TSS A;  3K7A H;  3QG1 A;  2NVX H;  4AQY Q;  4DK3 C;  3I55 A;  2AUK A;  1XMO L;  5C4X H;  1HXY D;  1QUQ B;  3BZK A;  2A69 C;  3CC2 A;  1CUK A;  4JK1 C;  1EUJ A;  4NP5 A;  3NBH B;  1I6H B;  3V2T A;  3CCS A;  1D5X C;  4UDU C;  1L0W A;  3RZO H;  4RG1 A;  5IP7 H;  1M8A A;  3ER0 A;  3T1Y Q;  1LT3 D;  1DM0 B;  2UU9 Q;  5FLM H;  4PZ8 A;  1ICF B;  2UXD L;  3TQY A;  5C44 G;  4BBS G;  3C2P A;  1X32 A;  1FYC A;  2AWO A;  3KLS X;  3TBI B;  1O80 A;  4AYB G;  4A3I B;  3CCQ A;  2H5X A;  3K81 C;  4A3G B;  2QA4 A;  1A0I A;  3Q22 A;  3CCJ A;  3KBX A;  1TS5 A;  1ENC A;  4QQB X;  1FNU A;  3MA2 B;  3A56 A;  5D3I B;  4BBR G;  4KMU C;  5IY0 A;  1MJE A;  4X3K A;  4K6L A;  1K28 A;  4KKT A;  5ELE A;  4Y52 H;  1VQ6 A;  1TXY A;  3I90 A;  4XQJ A;  1B9N A;  3PV0 A;  1Q12 A;  1XMQ L;  1E3P A;  1TWA H;  4A3E H;  4A3D H;  3J7A V;  4CDF C;  1XXG A;  2JA6 B;  1GO3 E;  3VYU A;  3L3O C;  4FO2 A;  5IGE A;  1HA6 A;  4A3M H;  3TP8 A;  5CR3 A;  1B7Y B;  4L5R C;  1XX8 A;  4GKK L;  3F2C A;  4A3J B;  1OXX K;  3IKJ A;  4JYA L;  1U4M A;  1UE5 A;  1QVC A;  1NMF A;  5EKI A;  2ZJR A;  1O7Z A;  1BCP D;  3K6O A;  1K83 B;  5EQ0 A;  5CGK A;  5KIX A;  3X3M A;  3NSW A;  2OT2 A;  4H7B A;  2B3G A;  4IPD A;  1IW7 D;  3UE1 A;  1U4L A;  1EL0 A;  4A3F H;  2HIX A;  3ZYY X;  4ZKC B;  3E3X A;  3NBI A;  4DV3 L;  1SYC A;  5M5X B;  4R8I A;  1VQL A;  2CW0 D;  1TWC B;  4AIM A;  1QZG A;  5FK9 C;  5C4Z A;  1E0B A;  1RD9 D;  2F0Q A;  2B2U A;  1SMY D;  3ULP A;  3S1R B;  1Y14 B;  4QGU A;  4U67 3;  1ESR A;  2PMZ E;  3ULJ A;  4DKA C;  5JEA G;  2PW7 A;  3A55 A;  2K01 A;  2J0T D;  4A3B H;  5M5W B;  2N88 A;  4M1U B;  4XQN A;  3CPW A;  3KK7 A;  3CU7 A;  4C3J B;  1UE7 A;  1M4V A;  1NAP A;  3CQZ B;  2WV6 D;  3SGI A;  4BWG B;  3BDL A;  2EXD A;  3PCO B;  1MJC A;  2DY7 A;  4LF8 Q;  5IP9 G;  1C8C A;  4EQO A;  2PQE A;  1IBL L;  3GTG B;  3CRL C;  4DUZ Q;  5GAH C;  3HKZ B;  4ZRZ A;  3ULL A;  1ZEQ X;  3D6C A;  4JV5 Q;  1B50 A;  4JI1 Q;  4AYB E;  1VF5 C;  2Z6B A;  4UP8 A;  3F2B A;  4JI0 Q;  3K5O A;  5TSS A;  3F1Z A;  3E9I A;  5IWA L;  5EKK A;  4DK0 A;  3RN2 A;  5I4D A;  2FIN B;  2I5H A;  4N8X 1;  2OXP A;  3U4V A;  5K5P A;  4JI7 Q;  4LFC Q;  3SK6 A;  3CCL A;  1W6K A;  4DV4 L;  1AEX A;  1RKN A;  1V1P B;  2F0U A;  3CCU A;  3PUX A;  3BZC A;  3NPP A;  1F2M A;  3P75 A;  1PH3 A;  4IPG A;  1DXM A;  3U4Z A;  2R7F A;  4JOI A;  2NN6 I;  1LM0 A;  1PRT B;  1PZI D;  2JK8 A;  4GN4 B;  2B2T A;  2KCC A;  1N33 Q;  1LO5 D;  4PMW A;  2EXZ A;  3TN2 A;  3GTL H;  3CRK C;  1EWI A;  1SE4 A;  1EFI D;  2L55 A;  4FYD A;  1VQH A;  4IPC A;  1FGB D;  1L1O C;  1DJR D;  1SJE D;  2RSO A;  1CA5 A;  4HMJ A;  4ODG A;  4Y7N B;  4LK1 C;  3EIV A;  2NTS A;  3QIA A;  4DV5 L;  3GTO B;  4A76 A;  3H0G B;  3CMA A;  2EVB A;  2M00 A;  3AU7 A;  3QJY A;  4P71 A;  1MSG A;  4IFD G;  2VL6 A;  3QOL A;  1ASY A;  3F2D A;  3N52 A;  2CHB D;  3RZD B;  3RLO A;  2EYP A;  3RD4 A;  3VR6 A;  2NVQ H;  4HCS A;  4CDC C;  1SMX A;  5D14 A;  2VUM B;  4X6A H;  1PZK D;  3T53 B;  4UP7 A;  3G4S A;  1JWS D;  2WKD A;  3CC4 A;  1IYJ B;  3MAQ A;  4JI6 L;  2MQH A;  1PV4 A;  2YTX A;  4A3K B;  4MIU A;  3VR4 A;  1UE1 A;  1KNE A;  1X6O A;  3K8A A;  4CJ2 C;  4CKE A;  3HOU B;  4X62 L;  2KEC A;  1W3S A;  2NB0 A;  1B44 D;  1S72 A;  1TS3 A;  1YHQ A;  2IY5 B;  3HOZ G;  3CCE A;  2JYO A;  1N36 L;  3GTM B;  1WTH A;  3HS0 C;  3MXP A;  4JI3 Q;  1WTP A;  1WTW A;  5COR A;  2G5D A;  2ZTE A;  4R1J A;  4ID6 A;  3S1M B;  1PFM A;  2DN8 A;  4QB4 A;  4JI4 Q;  3S2H B;  1Z47 A;  4H13 C;  1LTT D;  2MP1 A;  4X65 Q;  5IGF A;  1HNX L;  1K83 H;  1VQB A;  2N8N A;  4MNO A;  2D0O A;  2OTJ A;  5HUR A;  3URY A;  4DAY B;  1X55 A;  5I6W A;  4L5Q A;  3J81 L;  5K36 G;  1HA5 A;  3NP8 A;  5LMN W;  3WOF A;  5C4X G;  4C2M H;  1LTS D;  2ID0 A;  2K14 A;  4TSS A;  3A7L A;  2EY1 A;  4BY1 G;  2Q2H A;  1JE4 A;  2Y0S G;  4X66 Q;  2F0T A;  1I94 Q;  2MO0 A;  4G57 A;  3EFX D;  1C4Q A;  3NHH A;  4K8I A;  4JI2 Q;  1I5F A;  1PDQ A;  3LWE A;  1PRT F;  2WP8 J;  5LMN Q;  2F3V A;  2QDL A;  4H44 C;  1J5E L;  2EQS A;  4HR7 B;  2JA7 G;  2RBM A;  2BA0 A;  1F2Y A;  4GZY C;  1I3Q B;  4ME3 A;  4QCL A;  4RHR A;  1BXT A;  1JWM D;  2Z1C A;  1AE2 A;  3KYH C;  1EWC A;  3MC0 B;  2MFI A;  2BCO A;  3PO2 H;  2PCF B;  3BYY B;  3KF6 B;  5IT9 E;  2PI2 A;  4UP9 A;  1TQO A;  3RNU A;  2EYO A;  2VZA A;  4EQN A;  1HHV A;  1YNN D;  3HOY H;  2Z9H A;  2JA8 B;  5BN4 A;  4U68 A;  1RL2 A;  1NJI C;  3L2P A;  5C0X G;  5CBE E;  3W2D A;  4DV0 Q;  2F0O A;  1ASZ A;  4DR4 Q;  5JJL A;  3BS1 A;  1WCM G;  2FHT A;  1SBB B;  2IT1 A;  5GRO A;  1CHP D;  5T1G A;  2ASB A;  3HOX B;  5FO7 B;  2A74 C;  4APV A;  1XTD A;  2M2L A;  3E9H A;  3OIQ A;  1C9O A;  4GLA C;  2E5L L;  3F8T A;  2GN5 A;  4KHV A;  1GVP A;  1C7Y A;  4OEM B;  4I65 A;  4DR1 L;  1TWH B;  1KQS A;  3U9S A;  1ICW A;  2E2I B;  4YCV A;  4GOP B;  4C3H H;  3J7A F;  4H02 A;  3J7A 5;  1VQP A;  5DM6 3;  4CBV A;  2JN4 A;  2KHI A;  3G71 A;  2PNH A;  1S5C D;  2K5H A;  4DPG A;  2LKV A;  1A15 A;  4DR7 Q;  2YU9 H;  1FD7 D;  5G3L D;  3S2D H;  2NWG A;  3NEL A;  2R7D A;  1F9P A;  1FJG L;  4OON A;  5I2X A;  2VQF Q;  1ONL A;  3I3C A;  3LWU A;  2HHH Q;  1Q90 A;  1O78 A;  4OO1 G;  4O42 A;  1CHQ D;  1L0X B;  5F2D A;  2LY7 A;  1Y1W H;  1AZP A;  3KOJ A;  4KKS A;  3NTH A;  1C0A A;  3T4A C;  1GHJ A;  1G2T A;  4NXN L;  4ME5 A;  1AP0 A;  4K6D A;  4NXM Q;  4DR2 L;  2NYZ D;  2HQE A;  5L37 A;  4RAU C;  5C3E B;  1V1O A;  5J1Z A;  1D2B A;  2K5N A;  1BCP C;  3AYH B;  5M3M B;  1AE3 A;  1DON A;  1VDZ A;  5M3F H;  3FP9 A;  3Q8D A;  4A93 G;  3TZD A;  1LT6 D;  5BR8 L;  2F4V L;  1S5E D;  1J8I A;  1U0L A;  2XN9 C;  3S1N B;  1IW7 C;  2I5M X;  1YI2 A;  2PNR C;  3OSO A;  2Y0S E;  4DR6 Q;  3K7A B;  4NW2 A;  1XMO Q;  2N78 A;  1Y1V G;  2R6G A;  2SNM A;  3WWV A;  2NVX B;  3CP0 A;  4KJO A;  2F0S A;  4OL7 A;  2B2U C;  5GAG C;  1HFN A;  2K52 A;  1EY8 A;  3HOV G;  2CW0 C;  4B9W A;  2PZU A;  3ND9 A;  4C3I G;  1G51 A;  3V96 A;  2PW5 A;  1A6X A;  4HIO A;  1SMY C;  1E7Z A;  3T1H L;  1MKH A;  4BY7 G;  3RZO B;  1B70 B;  1QNK A;  1PTO B;  3G48 A;  4PV1 C;  2XRQ D;  2UXD Q;  5FLX L;  1DZ1 A;  2Q2I A;  4C56 C;  2HQL A;  1VQ5 A;  1CQF A;  1X3G A;  1DOK A;  3TP7 A;  4B3S L;  2LXK A;  5C4H A;  5JVH 3;  1TKW B;  3TRE A;  2E2H B;  2C9O A;  1BUV T;  2NVY H;  2XWJ B;  2UUB L;  1C48 A;  4MN3 A;  5KNC A;  1IL2 A;  4IUU A;  3GTQ B;  2LSS A;  4BXX H;  1I4R A;  2LXJ A;  1VQG A;  2RKS A;  3I70 A;  3U58 A;  2A1A A;  2IJ0 A;  3KBG A;  4BS9 A;  3FKI H;  3S24 A;  1UWV A;  4LUO A;  4RWS C;  2DJF C;  4HED A;  1K8A C;  2IW3 A;  1XMQ Q;  4CKC A;  4ZLT F;  1LUZ A;  3DXJ C;  2NBF A;  4DV7 L;  1IKM A;  4F7X A;  1TWA B;  3KDF A;  4QUF A;  4A3E B;  2JA5 H;  4A3D B;  3R3O A;  1N32 L;  4JOI C;  4JBM A;  1EYD A;  1NCV A;  3TDQ A;  2B2T C;  3J80 i;  3O13 A;  3OHX C;  4A3I G;  1E2Z A;  2PO4 A;  4A3G G;  3KF8 B;  2A6E D;  2QEJ C;  4A3M B;  2KVM A;  2RCN A;  4GKK Q;  4KJN A;  1HZA A;  1RTN A;  4JYA Q;  3MFG A;  2L11 A;  2MGS A;  1KDC A;  4L5T A;  3HOW H;  2RHS B;  3TZU A;  3LGJ A;  4XQQ A;  4G7O C;  4HN7 A;  1JJC B;  5JPN C;  3ITP A;  1T9H A;  3RLN A;  3BDO A;  5GAE C;  4YCW A;  3CKI B;  3EA6 A;  1HZB A;  4A3F B;  3S1Q H;  4WJ4 A;  2RF4 A;  4LF5 Q;  2VW9 A;  4DV3 Q;  1PH2 A;  1NBW A;  4DAM A;  3L9A X;  1EYA A;  2JA6 G;  3D3R A;  2VNU D;  1H9S B;  1NY4 A;  2AMC B;  3E0E A;  5ISR A;  4NMZ A;  1CQV A;  1FR3 A;  3JAM i;  4A75 A;  3C1F A;  2F1M A;  4JI5 L;  2GVB A;  2EDG A;  4A3J G;  4X3T A;  2UUA Q;  1KAA A;  5IYB H;  3I4M H;  1PTO F;  5FLX c;  1HR0 Q;  2JP1 A;  3ERS X;  1TWF H;  2AQ3 B;  4L5S A;  4A3B B;  4V19 0;  1YJN A;  1YEZ A;  2B2W A;  1VMP A;  4PZ6 A;  2J7Z A;  3DMU A;  1J9O A;  1AW7 A;  1OXV A;  2CWA A;  5HGT A;  2ZXO A;  1HNW Q;  1Y8N B;  4E6I A;  4KLK A;  1STH A;  2IX3 A;  2F0V A;  2YTY A;  4UHV A;  4WJW A;  3UDF A;  1IBL Q;  3U50 C;  2QF7 A;  1LTG D;  5C5M A;  3CCV A;  4ZAI A;  4ZYS A;  1N34 L;  1IZ6 A;  3D0F A;  4KHP L;  4CDE C;  1KDA A;  4C1N I;  4LF9 L;  3MWY W;  3NWT A;  4XYO A;  4FXD A;  3EBE A;  1TWG H;  4UPA A;  1YHB A;  4PMB A;  1I4P A;  5IWA Q;  1EU4 A;  5ELD A;  5M3M H;  3PF5 A;  1STB A;  3E0J A;  2MO1 A;  2AUJ D;  2BDO A;  3T13 A;  4DV4 Q;  3D8G A;  4C3J G;  3MZ5 A;  4EGV A;  2B2Y A;  1B1Z A;  3IRB A;  3OWF A;  4K2L A;  1SYB A;  4A3L H;  1K0R A;  1HPC A;  2EZV A;  5AFW A;  3S16 H;  4K2K A;  1SNQ A;  4CJ0 B;  4WOR A;  3HKZ G;  3GTL B;  1I4G A;  1PTO H;  2R61 A;  4XDX A;  1Q7Y C;  4XT3 B;  1F9S A;  3BG3 A;  1EY7 A;  2CQO A;  4DV5 Q;  2UUC L;  1OXU A;  5A2Q E;  1BQQ T;  3AFP A;  3GTP H;  4NPS A;  3C46 A;  5EBD A;  1TS4 A;  2K32 A;  1Z9F A;  4MTN A;  2E2H H;  2F0M A;  5EPL A;  2G9H D;  1CKN A;  3I4N B;  5DM7 3;  2HCC A;  4R8N A;  1YNN C;  3PIO 3;  1CSQ A;  3GTQ H;  2NVQ B;  1PH1 A;  3IFD A;  1Q3L A;  1STN A;  3LX0 A;  3OPO A;  2R7Z H;  4JI6 Q;  1PH8 A;  4LF7 L;  2F52 A;  5E1F A;  1VQO A;  4CGY B;  1CZG A;  2HUG A;  1SRO A;  1H9M A;  4PMC A;  2Z4I A;  4DV2 L;  1XYI A;  4LF6 L;  2P5Z X;  4S3S A;  4X62 Q;  2JEB I;  2ZJQ A;  2K28 A;  1I4Q A;  2JA9 A;  3FDT A;  5D3D A;  3H0G G;  1XNR L;  3MXN A;  3UDG A;  5I2Y A;  5KYI A;  4UY8 C;  4FF1 A;  1EYG A;  4ZCK A;  2L5T A;  1BVS A;  3VA7 A;  3MXU A;  2L0C A;  4Z9C B;  1X9N A;  2R92 H;  2ATW A;  3DEP A;  1PMR A;  2VUM G;  2FFK B;  5KRU A;  4B08 A;  4KY6 A;  1V9P A;  1D6E C;  4A3K G;  4KY7 A;  4A3C G;  1AZQ A;  4IUQ A;  3VYS A;  4TQU S;  1TS2 A;  3ERO A;  5M5Y H;  1ILP A;  3Q6S A;  1MBY A;  2KUM A;  4YWK A;  3HOU G;  1SNO A;  1K0S A;  4C2M B;  2L1B A;  5IYD H;  2F0H A;  2GVA A;  4GKJ Q;  1Q46 A;  1G8Z D;  1ESF A;  1VQF A;  1JQY D;  1Q86 C;  5KEE A;  2XSC A;  4Q0F A;  1J5E Q;  4ILW A;  4X64 L;  1PXU A;  4DV6 L;  2K5W A;  2EJF C;  4NDX A;  2JSO A;  3H3V I;  3K0X A;  2WAQ B;  3M4Q A;  3H3V H;  2AHO B;  2Q8R E;  3I4L A;  3GTK H;  2M9V A;  4DN4 M;  1GJX A;  1RDP D;  1B8A A;  5FO8 B;  2RCF A;  3PO2 B;  3QO2 A;  3HP3 A;  1PVO A;  4JCV E;  1D7Q A;  5IYC H;  3HKZ E;  4BXX G;  4HAE A;  4JG2 A;  1LAC A;  1EY4 A;  3HOY B;  1EQT A;  2H1E A;  3LNN A;  1X56 A;  2Q8I B;  4LW1 A;  1T5X D;  3RUZ A;  5ELN A;  1KRS A;  1EIG A;  4RGM A;  2EY6 A;  5IGG A;  1LTA D;  3J7Z C;  1FVI A;  4C1N K;  1XPO A;  1GUN A;  2O4X A;  4GS3 A;  1KLU D;  2EYL A;  4WFN 3;  2C5C A;  1R4Q B;  3OTO L;  5T1I A;  3HEJ A;  4DR1 Q;  2CWP A;  3QWN A;  4IUT A;  2R93 H;  2PQA B;  4B3T L;  1A8V A;  1V1Q A;  2YV5 A;  3TS2 A;  3NUC A;  1Q8I A;  3NWS A;  5IE8 A;  1M1K C;  1H95 A;  3E5S A;  5IIF A;  3D6W A;  1QCB D;  4C3H B;  2JA8 G;  2NN6 H;  4XXE A;  4RFB A;  1STG A;  3H09 A;  2ZM6 Q;  1WTQ A;  2E2D C;  3CPF A;  2WFW A;  4L6T B;  2MUY A;  4QIW B;  5KND A;  4CJ1 B;  2YU9 B;  3S2D B;  4QMG A;  5CV4 A;  3KLW A;  1X3Q A;  1L1O B;  3HOX G;  4JBW A;  2WB1 B;  2KBN A;  4NB3 A;  3PIO A;  1Y1W B;  2A6E C;  2VXW A;  1V8Q A;  4NXN Q;  3NTK A;  1EU3 A;  3KJO A;  3A8J E;  4OEL B;  4DR2 Q;  4V0B A;  5JJI A;  3DHQ A;  3I4N H;  5J39 A;  3A8K E;  4OIK A;  2A73 B;  2F3W A;  3WOE A;  2QW7 A;  4R4Q A;  5IYB G;  1KTK A;  3D4W A;  5M3F B;  5BR8 Q;  2F4V Q;  1TT2 A;  4XT1 B;  4IJL A;  3VR3 A;  1IYV A;  1DCZ A;  4FXK C;  2CFM A;  1E1T A;  1JWU D;  2ZT9 C;  5C3X A;  2AQ2 B;  3TRZ A;  3K7U C;  2ZXP A;  1JJG A;  4O0A A;  2D5D A;  3FPU B;  2KJX A;  1VQM A;  1ROD A;  4NKL A;  2IX0 A;  1MGS A;  4J8Q A;  3SK4 A;  1O7Y A;  5JJK A;  1QWY A;  3ND8 A;  4OHJ A;  1EYC A;  1D1I A;  1DYQ A;  3BDC A;  1EY0 A;  5JEA J;  2B2W C;  1LTI D;  2OWO A;  1CKM A;  2QCP X;  2K33 A;  3AMU A;  5C3E G;  1UUP A;  4LF4 L;  5M3M G;  3ONA B;  2F0W A;  4F8M A;  3G7L A;  1NR2 A;  1YIT A;  1V43 A;  4RCN A;  1WD1 A;  3GV3 A;  5CYU A;  2F03 A;  2UUB Q;  1EOV A;  4PZ7 A;  1DD2 A;  1WJJ A;  2NVY B;  4HMI A;  3AEV A;  2DNE A;  3PUV A;  5C4J H;  1KD1 C;  1CA6 A;  1EEF D;  3SVM A;  4GNX A;  1N8R C;  2F0K A;  3S14 H;  1EIY B;  2FMM A;  1GKH A;  1VQC A;  3P7J A;  4G7H C;  1SYD A;  2VB3 X;  4FXG C;  3FMC A;  1VQJ A;  3A8I E;  3CAM A;  3FKI B;  4K0K L;  4Q5V A;  3C3L A;  1CI3 M;  4OGQ C;  3J81 i;  1STA A;  1S5D D;  2CKZ B;  5IP7 G;  1K8O A;  1FNV A;  5FLM G;  2B2Y C;  1NUC A;  4DV7 Q;  1VQK A;  1K3B C;  2KA7 A;  3J7Y W;  1VCI A;  2EYM A;  5I6Y A;  1N32 Q;  2ZTC A;  3E6Z X;  2JA5 B;  1WTR A;  2BA1 A;  1EQQ A;  3VYR A;  5CV5 A;  5DEH A;  4POF A;  1H9R A;  1JOO A;  3V05 A;  1PFB A;  5IGC A;  3PO3 H;  2BOS A;  2KOL A;  1SFO H;  4HJA A;  1QUQ A;  1SAP A;  1Y8P B;  1CKO A;  5GQO A;  2EJG C;  3HOW B;  1BR9 A;  4RHS A;  3NBH A;  3FRP B;  5AJ3 L;  1JB7 A;  1VF7 A;  3I72 A;  1S4Z A;  1J6Q A;  2K6A A;  3M85 A;  2KQ3 A;  2QDB A;  1B3A A;  4DNR B;  4IFD J;  3S1Q B;  2GA4 B;  3GP7 A;  1YNJ D;  1EQV A;  4H0L C;  1E22 A;  5CBA E;  2Q2U A;  4A3E G;  4A3D G;  2OEO A;  3J80 E;  1OXS C;  1F77 A;  5EPK A;  3X3N A;  4LF8 L;  3S17 H;  4A3M G;  5EJW A;  4JBJ A;  3PUW A;  4LJZ C;  4P73 A;  4JI5 Q;  2Q2T A;  4DUZ L;  4YWL A;  4JC0 A;  1S40 A;  1W6J A;  4RGT A;  1Z7T A;  5LHY 1;  1KC8 C;  5EPJ A;  1BBX C;  2JXM B;  1VQ9 A;  4OXP A;  3I4M B;  4BA2 I;  1TWF B;  2K1B A;  5C44 H;  4BBS H;  4MHE A;  5E7N A;  2NZ1 D;  4DGZ A;  2F0J A;  1G29 1;  2UXC L;  1SND A;  4A3F G;  4JI7 L;  2KED A;  3NQI A;  5JAV A;  5NUC A;  1QE6 A;  2L4N A;  2KCN A;  1NMG A;  3VA5 A;  3FHW A;  4EX5 A;  1N34 Q;  1QB5 D;  5JOB A;  1UAP A;  4KHP Q;  1B9M A;  4IZ8 A;  1JE5 A;  3JAM E;  4LF9 Q;  4BBR H;  2EY5 A;  2CH4 A;  1IBM L;  1PH5 A;  4ALP A;  1L0Y B;  4OWT B;  4FF2 A;  1TWG B; 
#chains in the Genus database with same CATH homology
 4A3J G;  1EIF A;  1UE5 A;  1QVC A;  1NMF A;  5IYB H;  2ZJR A;  1SR3 A;  5FLX c;  1HR0 Q;  3ERS X;  2UUA Q;  3I4M H;  1TWF H;  1YJ9 A;  4QL5 A;  4L5S A;  1YJN A;  1YEZ A;  2QEX A;  1G6P A;  4DV1 L;  2B3G A;  3BU2 A;  4PZ6 A;  4B3S Q;  4A3B G;  4IPD A;  2E2J H;  4XIG S;  3K80 C;  3UE1 A;  1FGU A;  4A3F H;  2CWA A;  1OXV A;  1JMC A;  2JJQ A;  4LFB L;  2JEA I;  2HIX A;  1HNW Q;  3OW2 A;  4KLK A;  1R9T H;  1U5K A;  4DV3 L;  2JA6 H;  1VQE A;  2YTY A;  3UDF A;  1IBL Q;  1VQL A;  3U50 C;  2OCE A;  3CW2 C;  4AIM A;  3CCV A;  1QZG A;  2CCZ A;  4IOC A;  1N34 L;  2KCM A;  1IZ6 A;  3D0F A;  1VQD A;  4KHP L;  1K8G A;  4A3L G;  3KJP A;  1Q1E A;  4LF9 L;  4A3J H;  3ULP A;  1Y14 B;  1PH9 A;  3PF4 A;  4QGU A;  3EBE A;  1TWG H;  3UE0 A;  3DLL A;  4FDB A;  4UPA A;  2PMZ E;  1A62 A;  1YHB A;  3I4O A;  3ULJ A;  4DKA C;  5JEA G;  5IWA Q;  5FJ8 G;  4HIM A;  4PG3 A;  5M3M H;  2N49 A;  5HY6 A;  2UUC Q;  4A3B H;  3J81 j;  3PF5 A;  3DM3 A;  2B63 H;  4OWX B;  4IOA A;  3CPW A;  3A5Z B;  2MO1 A;  4JI8 Q;  1UE7 A;  1KXL A;  4DV4 Q;  3SGI A;  1SN8 A;  2K50 A;  2KHJ A;  2FXQ A;  1X3E A;  1JT8 A;  2EXD A;  1UE6 A;  2QGQ A;  5M5X H;  3PCO B;  4GKJ L;  5C0X J;  1MJC A;  3IRB A;  4JI3 L;  5IP9 G;  4LF8 Q;  1PA6 A;  1YJW A;  1TWC H;  1IBL L;  3CC7 A;  4DUZ Q;  4LF7 Q;  1K0R A;  5GAH C;  4A3L H;  3S16 H;  3GD7 A;  4LFA Q;  3ULL A;  2NN6 G;  4YY3 Q;  1S3O A;  1IXR A;  5GAD C;  2R7Z G;  4JV5 Q;  3HKZ G;  3S1R H;  2ZTD A;  4JI1 Q;  4AYB E;  4UP8 A;  1D8L A;  3F2B A;  4DV2 Q;  4JI0 Q;  4AH6 A;  4LF6 Q;  3RN5 A;  1Q7Y C;  4LUV A;  3F1Z A;  1LYL A;  3E9I A;  5IWA L;  5M5W H;  1OTC A;  2CQO A;  1RIP A;  3RN2 A;  4DV5 Q;  2UUC L;  2I5H A;  4C3J H;  2Z0S A;  3CQZ H;  1OXU A;  3RR5 A;  3U4V A;  3AFP A;  3GTP H;  4JI7 Q;  4JI8 L;  4LFC Q;  4NPS A;  1XNR Q;  1CKN B;  3CCL A;  3CD6 A;  1X65 A;  4DV4 L;  1MIU A;  1Z9F A;  4MTN A;  1P8L A;  2E2H H;  3CCU A;  2K4K A;  3PUX A;  1CKN A;  3BZC A;  5IP9 H;  3CCM A;  4WJ3 M;  2XTI A;  1PH3 A;  3L0O A;  4IPG A;  2PQA A;  3I4N G;  1CSQ A;  3U4Z A;  4X66 L;  3GTQ H;  2R7F A;  1I94 L;  1PH1 A;  4JOI A;  3GTG H;  2NN6 I;  1LM0 A;  1YZ6 A;  2JK8 A;  4HIK A;  2OQ0 A;  2R92 G;  2R7Z H;  4GN4 B;  1YIJ A;  5HGQ A;  1Q82 C;  1PH8 A;  1YNX A;  2ES2 A;  4PMW A;  4JI6 Q;  2F52 A;  4LF7 L;  1N33 Q;  1VQO A;  2IHE A;  1K9M C;  4LFA L;  4YY3 L;  1QVF A;  3GTL H;  3I7F A;  1SRO A;  5J3B A;  1EWI A;  3I56 A;  4JV5 L;  2EIF A;  4QY7 A;  4HJ5 A;  1VQH A;  4IPC A;  4JI1 L;  4DV2 L;  4JI0 L;  1L1O C;  4LF6 L;  4X62 Q;  2BH8 A;  3PUZ A;  2JEB I;  2AWN A;  2ZJQ A;  3EIV A;  1P16 A;  1GD7 A;  2B29 A;  4DV5 L;  3MXN B;  4A76 A;  3CMA A;  2JA9 A;  3TEH B;  4P71 A;  4LFC L;  5LMU Q;  3H0G G;  1XNR L;  3UDG A;  4IFD G;  1VQA A;  1X54 A;  2VL6 A;  1ASY A;  4UY8 C;  3F2D A;  1EYG A;  2KCT A;  5IYD G;  1EQR A;  3STB C;  4GOP C;  1YHA A;  3RLO A;  1BVS A;  2HT1 A;  2HIV A;  5ELO A;  2NVQ H;  3GTJ H;  1X9N A;  2R92 H;  1SMX A;  2ATW A;  4X64 Q;  4X6A H;  3HOW H;  4HJ7 A;  4UP7 A;  1PYB A;  3G4S A;  4DV6 Q;  2VUM G;  2UXB Q;  3CC4 A;  1IYJ B;  4JI6 L;  1N33 L;  2MQH A;  1PV4 A;  2ZM6 L;  2YTX A;  4YWM A;  1V9P A;  3MEF A;  1UE1 A;  4A3K G;  4A3C G;  4YHH Q;  4XTC S;  3J81 c;  1X6O A;  3K8A A;  4TQU S;  4X62 L;  4Y7N H;  1W3S A;  5M5Y H;  1S72 A;  4YWK A;  3GTO H;  3HOU G;  4HID A;  1YHQ A;  3H0G H;  1X3F A;  3HKS A;  2IY5 B;  4IFD I;  3HOZ G;  3I2Z A;  3CCE A;  3UDX A;  1N36 L;  5IYD H;  3PSI A;  2GVA A;  2JE6 I;  4GKJ Q;  1KRT A;  5LMU L;  1Q46 A;  5IYC G;  3OYY A;  3H15 A;  3AQQ A;  3RZD H;  4JI3 Q;  1BBW A;  3M7N A;  1VQF A;  3PUY A;  1Q86 C;  2VY3 A;  4QJF A;  2ZTE A;  4R1J A;  2VUM H;  5IT9 c;  1J5E Q;  2DUD A;  2XGT A;  4X64 L;  4JI4 Q;  2IHF A;  1XJV A;  1HNZ Q;  4DV6 L;  1Z47 A;  2A8V A;  4OX9 Q;  2UXB L;  4X65 Q;  1VS0 A;  4A3K H;  4B3M Q;  4A3C H;  1HNX L;  1K83 H;  1VQB A;  2N8N A;  3K0X A;  1LTL A;  3M4Q A;  4MNO A;  2D0O A;  4P72 A;  1I50 H;  3H3V I;  3H3V H;  2OTJ A;  2AHO B;  2RHQ B;  1X55 A;  4DAY B;  1KIX A;  2I5L X;  2WAQ G;  4GNX C;  4YHH L;  4HJ9 A;  4IO9 A;  3W5O A;  3GTK H;  3HOU H;  4L5Q A;  1B8A A;  3OTO Q;  1WOC A;  5K36 G;  3HOZ H;  4KHZ A;  5LMN W;  3A74 A;  5C4X G;  1PVO A;  4JCV E;  4C2M H;  4B3T Q;  1D7Q A;  3PO2 G;  2ID0 A;  3HKZ E;  3W1G A;  5IYC H;  4BXX G;  2K14 A;  3NEN A;  3GTM H;  1PYS B;  4BY1 G;  2Q2H A;  1AH9 A;  4JG2 A;  4O2D A;  2ALY B;  2Y0S G;  4X66 Q;  2R93 G;  1I94 Q;  2MO0 A;  3J80 c;  1X56 A;  4R4C A;  3HOY G;  3S1M H;  4LW1 A;  2Z6K C;  4JI2 Q;  1I5F A;  5ELN A;  1KRS A;  2WP8 J;  5LMN Q;  3CXC A;  3CME A;  4DUY Q;  5H1S E;  1J5E L;  1JJ2 A;  3S2H H;  1VQ7 A;  2EQS A;  1QVG A;  4JI4 L;  2JA7 G;  5FJ8 H;  1HNZ L;  1OXT A;  2BA0 A;  3J7Z C;  4TVA B;  1SLJ A;  4ME3 A;  1FVI A;  4B3R Q;  4OX9 L;  1UEB A;  4X65 L;  4B3M L;  1XPO A;  2NZH A;  4DR5 Q;  4JBK A;  1AE2 A;  1KL9 A;  3KYH C;  4GS3 A;  4DR6 L;  2YYZ A;  1SE8 A;  2MFI A;  1PFS A;  1KHI A;  3OTO L;  3PO2 H;  3KF6 B;  2E8G A;  2PI2 A;  4UP9 A;  2YTV A;  2CWP A;  4DR1 Q;  4BY1 H;  4P75 A;  2R93 H;  2PQA B;  4P74 A;  3RNU A;  3KF6 A;  4B3T L;  1A8V A;  2VZA A;  1VQN A;  1WI5 A;  1V1Q A;  2YV5 A;  3HOY H;  2NVT H;  3TS2 A;  2MNA A;  5IE8 A;  1NJI C;  1RL2 A;  1M1K C;  1H95 A;  3L2P A;  5C0X G;  2JA8 G;  4IPH A;  2V1C C;  2ZJP A;  4DV0 Q;  1Q8K A;  1ASZ A;  4JI2 L;  4DR4 Q;  2JA7 H;  4R4T A;  5JJL A;  3BJU A;  2ZM6 Q;  3JAM c;  5LMN L;  1WCM G;  3CPF A;  4DUY L;  2WFW A;  2IT1 A;  1PH4 A;  5GRO A;  4LUZ A;  1I3Q H;  3AFQ A;  2JQO A;  1WYD A;  1IBK Q;  3G6E A;  1HZC A;  4B3R L;  2ASB A;  4DR5 L;  3KLW A;  4A4I A;  4APV A;  1L1O B;  4DK6 C;  3HOX G;  1XTD A;  3E9H A;  4DR3 Q;  4GLA C;  1C9O A;  2E5L L;  4JBW A;  4NB3 A;  2KBN A;  3F8T A;  2K75 A;  4DNI A;  1L1O A;  3PIO A;  3S15 H;  2GN5 A;  1N36 Q;  1GVP A;  1C7Y A;  2WB1 G;  5DLQ E;  4NXN Q;  3KJO A;  4DR2 Q;  1Y1W G;  2OTL A;  4DR1 L;  5JJI A;  1GM5 A;  2K5V A;  2VQE Q;  3I4N H;  4RMF A;  3STB D;  3CF5 A;  1KQS A;  1WFQ A;  1SRU A;  4YCV A;  5C0X I;  2JA8 H;  3JC6 6;  4GOP B;  4C3H H;  4H02 A;  4MZ9 A;  3J7A 5;  4LF4 Q;  4IJH A;  4R4Q A;  1WCM H;  1VQP A;  1XNQ Q;  5IYB G;  1M90 C;  2BH2 A;  4HJ8 A;  4GOP A;  5BR8 Q;  2F4V Q;  3EN2 A;  2KHI A;  3G71 A;  4DV0 L;  4DR4 L;  2PNH A;  4IJL A;  5M3F G;  2K5H A;  1HNX Q;  4DPG A;  2CFM A;  1E1T A;  3TRZ A;  3K7U C;  4DR7 Q;  1JJG A;  2YU9 H;  3M4O H;  1XPR A;  3S2D H;  3NEL A;  4O0A A;  2R7D A;  1VQM A;  3HOX H;  1FJG L;  2L15 A;  1IBK L;  4OWW B;  4OON A;  1N9W A;  2VQF Q;  1Q81 C;  2IX0 A;  3B6Y A;  2HHH Q;  3ZJY C;  4OO1 G;  4KI0 A;  1HR0 W;  2OQK A;  4DR3 L;  1Y1W H;  5JJK A;  3KOJ A;  1EFW A;  1C0A A;  4R4I A;  2A19 A;  2DGY A;  1TWH H;  3M3Y H;  4GLV B;  4NXN L;  3GDE A;  4NXM Q;  4DR2 L;  2VQE L;  5JEA J;  2E2I H;  4K0K Q;  2OWO A;  1CKM A;  1XPU A;  2WAQ E;  1DGS A;  2D62 A;  2K5N A;  3AYH B;  1E24 A;  5C3E G;  1AE3 A;  1BBU A;  1HZ9 A;  3FP9 A;  3Q8D A;  5M3F H;  4LF4 L;  5M3M G;  4A93 G;  1XNQ L;  5BR8 L;  2F4V L;  1L2F A;  1NE3 A;  1U0L A;  2B63 G;  1K3R A;  2I5M X;  1YIT A;  4POG A;  1YI2 A;  1V43 A;  3PIP A;  2Y0S E;  4DR7 L;  4DR6 Q;  1HH2 P;  2UUB Q;  1XMO Q;  4GLX A;  2N78 A;  2R6G A;  1EOV A;  1Y1V G;  2D0P A;  1WJJ A;  4PZ7 A;  3WWV A;  4LF5 L;  3AEV A;  3A0J A;  4OO1 I;  3CP0 A;  3PUV A;  5C4J H;  2VQF L;  4GNX B;  5GAG C;  2K52 A;  2HHH L;  3HOV G;  1KD1 C;  2AKW B;  1NTG A;  3M9B A;  4GNX A;  1FL0 A;  3KFU A;  1G51 A;  1N8R C;  3S14 H;  1EIY B;  3PO3 G;  1GKH A;  1VQC A;  2N3S A;  4GN5 A;  4HIO A;  1E7Z A;  3T1H L;  5AJ3 Q;  1W2B A;  1MKH A;  1VQI A;  5C3E H;  1B70 B;  1VQJ A;  3CAM A;  4NXM L;  4BY7 G;  5EAY A;  4K0K L;  3G48 A;  3HFZ B;  2VS1 A;  4A93 H;  4EQ5 A;  3J81 i;  2KEN A;  3FKI G;  2UUA L;  2UXD Q;  5IP7 G;  2CKZ B;  1HR0 L;  2Q2I A;  1YBY A;  2PI2 E;  5FLM G;  2HQL A;  3ICE A;  4DV7 Q;  1VQ5 A;  1X3G A;  1VQK A;  3S1N H;  1VCI A;  2Z6K A;  4B3S L;  1N32 Q;  2LXK A;  1Y1V H;  2ZTC A;  3K7A H;  3TRE A;  1HNW L;  2BA1 A;  4AQY Q;  1EQQ A;  4DK3 C;  2NVY H;  2E5L Q;  2NVX H;  2NZO A;  3I55 A;  2JA5 G;  2UUB L;  4POF A;  1XMO L;  3HOV H;  1IL2 A;  5C4X H;  3CCR A;  1QUQ B;  4C3I H;  3BZK A;  2LSS A;  4BXX H;  4LWC A;  3PO3 H;  1SFO H;  2LXJ A;  1QUQ A;  4HJA A;  1VQG A;  1CUK A;  1PHJ A;  3U58 A;  3CC2 A;  1EUJ A;  3GO5 A;  4BY7 H;  3NBH B;  1CKO A;  2F3I A;  5GQO A;  2A1A A;  1QZH A;  1PH7 A;  3VDY A;  2IX1 A;  3CCS A;  4QIW E;  4BA1 I;  1L0W A;  3RZO H;  3FKI H;  4RG1 A;  3UDI A;  5IP7 H;  5AJ3 L;  3HOW G;  1JB7 A;  3ER0 A;  1UWV A;  3S24 A;  3T1Y Q;  3W1B A;  4GN3 B;  4LUO A;  5FLM H;  2UU9 Q;  4PZ8 A;  1J6Q A;  1K8A C;  2UXD L;  3TQY A;  3M85 A;  5C44 G;  1LUZ A;  3KDF B;  2C35 B;  1XMQ Q;  4J15 A;  2WB1 E;  4BBS G;  3A5U A;  2UXC Q;  1VQ4 A;  3M4P A;  2AWO A;  4DV7 L;  4IFD J;  3KDF A;  1FJG Q;  2JA5 H;  1N32 L;  4AYB G;  4JOI C;  1E22 A;  4JBM A;  1VQ8 A;  1Q1B A;  3CCQ A;  2H5X A;  3K81 C;  3RLF A;  4A3E G;  2Q2U A;  2QA4 A;  1A0I A;  4R4O A;  4A3D G;  3J80 i;  4AQY L;  1OXS C;  4A3I G;  3CCJ A;  3TS0 A;  4A3G G;  3KF8 B;  1KAW A;  4LF8 L;  3S17 H;  2RCN A;  4QQB X;  4A3M G;  2I0Q A;  4JBJ A;  3PUW A;  4P73 A;  4JI5 Q;  4GKK Q;  2Q2T A;  4DUZ L;  1IBM Q;  1HZA A;  4YWL A;  4JC0 A;  4JYA Q;  1I6H H;  4YCU A;  4L5T A;  1S40 A;  1HJP A;  4BBR G;  3D31 A;  2RHS B;  5IY0 A;  1MJE A;  3LGJ A;  1KC8 C;  4LNQ A;  1JJC B;  1VQ9 A;  4OXP A;  3L7Z C;  4BA2 I;  4Y52 H;  5C44 H;  4DV1 Q;  1T9H A;  1TXY A;  1VQ6 A;  3T1Y L;  2UU9 L;  3I4M G;  4BBS H;  3RLN A;  5E7N A;  5GAE C;  3PV0 A;  4YCW A;  1Q12 A;  1XMQ L;  1E3P A;  4LFB Q;  1G29 1;  1HZB A;  2UXC L;  1TWA H;  3S1Q H;  4WJ4 A;  1YVC A;  2RF4 A;  4LF5 Q;  2VW9 A;  4DV3 Q;  4A3E H;  4A3F G;  1PH2 A;  4JI7 L;  4A3D H;  1A63 A;  1NBW A;  4A3I H;  4A3G H;  1GO3 E;  1CSP A;  4DAM A;  3PGZ A;  2JA6 G;  1PH6 A;  1NMG A;  2VNU D;  3FHW A;  4A3M H;  1NY4 A;  4EX5 A;  2AMC B;  3E0E A;  1N34 Q;  1B7Y B;  4KHP Q;  4A75 A;  1JE5 A;  3JAM i;  1E1O A;  4L5R C;  4LF9 Q;  4BBR H;  3T1H Q;  1O7I A;  3NEM A;  4JI5 L;  4GKK L;  2GVB A;  3F2C A;  1K73 C;  1PH5 A;  1IBM L;  4ALP A;  1OXX K;  4JYA L;  4OWT B;  1BKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...