4AQYQ

Structure of ribosome-apramycin complexes
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aqyQ00
2WAQE 5HY6A 3H3VH 2UUAQ 1HNXQ 3E9HA 2Y0SG 3OYYA 4LW1A 3ULPA 1YJWA 2ZTCA 2ZM6L 1E1TA 1FVIA 1V1QA 1JJCB 4IJLA 1Z47A 2OQKA 5LMNQ 4DV0Q 4HJ9A 4BXXH 4IFDG 1TXYA 2UXCL 3K0XA 4X64L 4GLXA 2F4VL 3PO3G 4DR5L 4AQYL 4DV0L 1IBMQ 4IOCA 2CQOA 5LMNL 3I4MG 1E7ZA 3H0GG 3PSIA 1K8GA 1C0AA 1VQOA 4JV5Q 2R92H 4PZ6A 1V9PA 3HKZG 3RN2A 3W1GA 3CCMA 3T1HQ 1L1OA 4A3KG 3G71A 3J80c 1VQ5A 3CC2A 4X65Q 3AEVA 4A93H 4JV5L 3KF6A 4POGA 2CFMA 4MNOA 1KAWA 2JJQA 3M85A 4IPHA 3HOXH 2MFIA 4X65L 1B8AA 4JCVE 1WOCA 1KIXA 4R4IA 5ELOA 1UWVA 2GVAA 4OONA 2ZJRA 3T1YQ 2HQLA 1FL0A 3CXCA 4A3CH 1Y1VH 4KLKA 1TWAH 4A3IG 4O2DA 3KDFA 1T9HA 4DR6Q 3S2DH 3K7AH 3PGZA 1S3OA 2WP8J 5IYBG 1Q1BA 3NELA 3CCEA 2JEBI 2YYZA 4DR6L 5E7NA 1I5FA 2OCEA 1KHIA 2ID0A 3RN5A 3HOWG 3K7UC 1U0LA 1EFWA 3MXNB 4YCWA 1Y14B 2VY3A 1HZBA 2PQAB 3ZJYC 1VS0A 1WI5A 3CP0A 1YHQA 2UU9Q 1OXSC 3A74A 1PH2A 1GVPA 1J5EQ 3UDFA 1JB7A 4JI7Q 3S2HH 3DM3A 3F1ZA 4QL5A 4GNXB 2E2HH 2NVTH 2UU9L 2L15A 5C0XJ 5LMUQ 4DUYL 3BZCA 4JI7L 1FGUA 2H5XA 3LGJA 1EUJA 5FJ8G 4ALPA 5IP7H 5IP9H 4HIOA 2OTJA 1KRSA 3UE0A 1EYGA 1I3QH 4DPGA 3HOYG 3SGIA 3GTJH 4AYBE 4YCVA 4A3JH 1Q7YC 3D0FA 4HJ5A 3H3VI 4R4QA 5AJ3Q 2BA0A 5IYDG 1PH4A 1LM0A 2JA9A 4UP9A 3UE1A 4BY7G 3EIVA 3RLOA 4GNXC 2R7ZH 4LF4Q 2K5VA 2AWOA 1L2FA 3GTMH 1E3PA 4JBJA 4A3LG 2UXDL 1OXTA 3VDYA 3GTQH 1UE6A 2B3GA 2LXJA 4DV4Q 1KD1C 3STBC 2A1AA 4LF4L 3A0JA 3ER0A 3OTOQ 3S24A 3BZKA 3S17H 3FKIH 2OTLA 4JI8Q 2FXQA 1AE2A 2R93G 1KL9A 1QUQA 1XTDA 4EX5A 3CC4A 1XPUA 4DR4Q 1I6HH 1UEBA 2UXBQ 1NE3A 2GVBA 4YWLA 2K5NA 4KI0A 4GOPC 5JJIA 4Y7NH 4R4OA 1VQIA 3CPFA 1HZCA 5M3MG 1PH9A 2UXBL 5GAHC 2JA5G 1I50H 4BA2I 2NZOA 3J81i 1W3SA 1RL2A 2YTXA 3CAMA 1I94Q 4YCUA 4TVAB 1CKOA 2D62A 1EWIA 4HJ7A 4LF8Q 4GKKQ 3U4ZA 1E24A 4DR2L 4DAYB 1P8LA 4QJFA 3J81j 2R92G 4JI3Q 2AWNA 2AMCB 4GN4B 5HGQA 4BBSH 1GKHA 4K0KQ 5IWAL 5K36G 4JYAQ 2N78A 1A63A 1K3RA 2V1CC 4DV5Q 3HOXG 4K0KL 1UE5A 3EBEA 2PI2E 2Q2UA 2IT1A 4A3MH 4JYAL 1PVOA 2OQ0A 4DV5L 1LUZA 3TRZA 2I0QA 2PI2A 1IBLQ 1M90C 1Y1VG 3CPWA 1IBKQ 3HOVG 1WFQA 4R4TA 2JE6I 3KJOA 1N32Q 1UE1A 2IX1A 1OXXK 2ALYB 1IBKL 2E2IH 2NVYH 1LTLA 3S1QH 4LF7L 1VCIA 3EN2A 1XNRQ 4RMFA 1N32L 3U4VA 4P75A 2UUBQ 1HJPA 1WJJA 4NXNL 2KENA 4LUVA 4HJAA 1NY4A 4B3MQ 1OXUA 2BA1A 2VL6A 2VZAA 2HHHQ 1N33Q 2OWOA 1HR0L 1SRUA 2UUBL 2IX0A 3PUXA 4LF6Q 4LF9Q 2E2JH 3I4NH 3S14H 4DK6C 1CKNA 1KRTA 3HKSA 3HOUH 1L0WA 1PYSB 4LF6L 4LF9L 4A3BH 2HT1A 2N8NA 2MQHA 2RF4A 3B6YA 1EQQA 1HNXL 1HZ9A 2UUAL 1C9OA 4KHPQ 3UDGA 1AH9A 1IYJB 3RR5A 1YHBA 4YY3Q 4Y52H 2K52A 3E9IA 2CCZA 4DV2Q 4B3RQ 2K4KA 5GROA 3I2ZA 3CW2C 1VQDA 1ASZA 1VQ6A 4YY3L 3M4QA 2EIFA 5C3EH 4A3JG 1QVCA 3GO5A 4PZ8A 1HNZQ 1VQ9A 2ZJQA 2JA6G 1JT8A 1SR3A 3ICEA 4POFA 4DV3Q 1HNZL 3T1HL 1SFOH 1PH3A 2B63H 3F8TA 1KXLA 4JBKA 2VQEQ 2IY5B 4DV3L 1EIFA 1PA6A 5C44H 3GTKH 2D0OA 3S15H 1OTCA 1L1OB 3FKIG 5M3FH 3CCQA 3PV0A 1Q12A 5DLQE 2K14A 4L5QA 3KJPA 3T1YL 1XMOQ 4JI2Q 1MJEA 2Z0SA 1K0RA 2K75A 3AFQA 1XMOL 1R9TH 5JEAG 4IO9A 3KFUA 1PHJA 1JJ2A 4WJ4A 2I5LX 2KHJA 1GM5A 1QVFA 2IHEA 5M5WH 2Y0SE 2JA7H 4GLVB 3RLNA 1V43A 1WCMH 5LMNW 3AFPA 4DAMA 3PCOB 2PQAA 4PZ7A 3RNUA 1P16A 5GQOA 3AQQA 4APVA 4C3HH 1J5EL 4P72A 2LXKA 4JOIC 4FDBA 4A3FH 2A8VA 4P74A 3HFZB 5LMUL 4JI4Q 1Q8KA 1PV4A 3HKZE 4GNXA 1N36Q 1BBUA 3L0OA 1N34Q 4HIMA 3OW2A 4JI4L 1N36L 2B29A 4DR1Q 4A3MG 1LYLA 2MNAA 3CD6A 1TWFH 4JI1Q 2JA8G 4LUOA 2AHOB 5AJ3L 1EQRA 4JI5Q 2WFWA 4P73A 4DKAC 3J7ZC 4PG3A 1GD7A 1NBWA 3I56A 4AIMA 4UY8C 2HIXA 2UUCQ 4GOPA 3M4PA 1JJGA 1X54A 4JI5L 1X65A 3M4OH 3IRBA 4DV4L 3PF5A 1SE8A 2I5MX 3I4MH 3H0GH 1PYBA 3OTOL 2QA4A 2CWAA 3ULLA 5EAYA 4JI8L 4XTCS 1MIUA 4A3KH 1OXVA 4IPGA 4MTNA 1VQHA 2WB1E 1B70B 1RIPA 2BH2A 1AE3A 4DR4L 5C4XH 1FJGQ 1G51A 1GO3E 4DK3C 2KBNA 1X56A 3L7ZC 5GADC 5C4JH 2NN6I 2JEAI 4A3BG 3KLWA 3HOUG 2N49A 5GAEC 4BXXG 4A3DH 3CMEA 2HIVA 1QUQB 3GD7A 3K81C 4DUZQ 2RCNA 4B3SQ 1VQBA 1Q81C 3J80i 1I94L 1X9NA 2VQFQ 4L5SA 3K8AA 3FP9A 4R1JA 1QZGA 1VQCA 3GTPH 4B3SL 4LF8L 4GKKL 5C3EG 2Z6KC 3AYHB 2VQFL 4A93G 4X62Q 4JI3L 4L5TA 3GTLH 3CCUA 2B63G 1PH7A 1S40A 2Q2IA 4X62L 1VQEA 1XMQQ 2WAQG 2K50A 3JC66 1Z9FA 4A3CG 5C44G 3CMAA 2NN6G 1PFSA 3CCVA 1CSQA 4X66Q 1XMQL 1TWCH 4UP8A 1ASYA 3MEFA 1IBLL 2K5HA 2ZTDA 1WYDA 3PUVA 4X66L 3NENA 2VUMH 3W5OA 3U50C 4A75A 1TWGH 3UDIA 4JI6Q 1BKBA 3UDXA 2CKZB 1S72A 1XNRL 3DLLA 3HOYH 1YZ6A 1G6PA 3G48A 1C7YA 1HZAA 4P71A 1NMGA 4OO1I 1XNQQ 1B7YB 4B3ML 1N33L 1EIYB 1VQAA 2HHHL 5JEAJ 3E0EA 2EXDA 5IY0A 1XNQL 1H95A 3NEMA 1CKMA 3CC7A 1G291 5JJLA 4MZ9A 3PUYA 4A3LH 3L2PA 1HH2P 4LF5Q 3F2BA 1D7QA 1VQ7A 1K83H 2R7FA 2JQOA 3K80C 3TQYA 5IP9G 5IP7G 4DV7Q 4GN5A 4KHPL 2LSSA 4R4CA 3F2DA 4IOAA 3JAMi 1CKNB 3CCLA 1KQSA 4DV2L 4B3RL 1BBWA 2GN5A 4OX9Q 5M5XH 3PUWA 1VQGA 2I5HA 2D0PA 4OO1G 4PMWA 2ZM6Q 5M3MH 2NVXH 1VQLA 2R7ZG 4OX9L 1PH6A 3S1NH 2JA5H 2UXCQ 4WJ3M 1YI2A 5FLMH 1W2BA 1IBML 4X64Q 2RHSB 4H02A 1NTGA 4DR5Q 4AQYQ 3TS0A 3CF5A 1YIJA 2F4VQ 1N8RC 2MO0A 4EQ5A 2VQEL 1PH1A 3GTOH 3PIOA 2DUDA 3J81c 4OWWB 1UE7A 1Q46A 3KF6B 2PMZE 1Y1WH 1HNWQ 3M9BA 4DNIA 4O0AA 1HR0W 3RZOH 1Q86C 1YBYA 1NMFA 4DV6Q 4JI2L 1A62A 4QY7A 1HNWL 5C4XG 1XPOA 2XTIA 4AYBG 1IL2A 5IYCH 4DV6L 1KC8C 3HOZH 2XGTA 4QIWE 3KF8B 4JOIA 4NPSA 3KDFB 4ME3A 4A3DG 4BA1I 3NBHB 1U5KA 4A3EH 5M5YH 3PO2H 1L1OC 2KCMA 1PH5A 4YWKA 3M7NA 1X6OA 1M1KC 3HOVH 4A3GH 4BBRH 2MO1A 1XPRA 3F2CA 3S1RH 4J15A 3U58A 1O7IA 4GS3A 1A8VA 3M3YH 3BU2A 4BBSG 3PF4A 5IT9c 2ZTEA 1SROA 5BR8Q 3S16H 4IPCA 4BY1H 4TQUS 3ERSX 3KOJA 4HIKA 3GTGH 4L5RC 4HIDA 2VW9A 1J6QA 2CWPA 2WB1G 5BR8L 1YEZA 1BVSA 4JBWA 4JG2A 1N34L 1D8LA 3TEHB 1E22A 2A19A 2R6GA 3FHWA 1XJVA 4DUYQ 4DR1L 4DR7Q 2E5LQ 4JBMA 1K8AC 3CCRA 3ULJA 4JI1L 3GDEA 4DR7L 2E5LL 4OXPA 2VUMG 4AH6A 3PO3H 3PIPA 3H15A 3STBD 5H1SE 1TWHH 2UUCL 4C3JH 3I7FA 1A0IA 2IHFA 4LFCQ 4B3TQ 1DGSA 1VQPA 1IXRA 3I4NG 3Q8DA 4NB3A 5C0XI 4LFCL 2JA6H 4B3TL 3JAMc 1PH8A 4GOPB 2UXDQ 4C3IH 4LFAQ 1FJGL 1E1OA 2BH8A 2N3SA 5GAGC 4DR3Q 2Q2HA 4IJHA 4NXMQ 3A5UA 1SLJA 2F52A 2Z6KA 2JK8A 4LFAL 3CCJA 2NZHA 4DR3L 4HJ8A 4A3IH 1JMCA 1N9WA 1YVCA 4NXML 4X6AH 2E8GA 4DUZL 2QEXA 5IYBH 1QZHA 2ASBA 4UPAA 2KCTA 2R7DA 3HOWH 3CQZH 1X3FA 4QQBX 4JC0A 3G6EA 3S1MH 3PUZA 5C0XG 1SMXA 2C35B 5FLMG 2NVQH 1Q1EA 3TREA 2VNUD 2VS1A 1CUKA 1YHAA 4DR2Q 1VQJA 4GLAC 4LUZA 2EQSA 5M3FG 1EOVA 1QVGA 1Y1WG 2YU9H 3G4SA 1SN8A 5IWAQ 3KYHC 1K9MC 5J3BA 4GN3B 1YNXA 2F3IA 2AKWB 3A5ZB 5FJ8H 4YHHQ 1VQ4A 1VQMA 4IFDJ 5JJKA 4A4IA 1NJIC 3RZDH 4XIGS 1IZ6A 1VQKA 2DGYA 3W1BA 5IYCG 4YHHL 2YTVA 4C2MH 3HOZG 1K73C 1YJ9A 4JI6L 4RG1A 1YITA 1X3GA 2JA7G 4LFBQ 4A3EG 2KHIA 5IYDH 3BJUA 4BY7H 2QGQA 2ATWA 3PO2G 3I55A 1WCMG 5IE8A 4IPDA 2JA8H 1X55A 1YJNA 4A3GG 3RLFA 4IFDI 4LWCA 4OWXB 4BBRG 1VQFA 2YV5A 4LF7Q 4LFBL 1MKHA 4A76A 4QGUA 3WWVA 2ZJPA 4A3FG 1X3EA 4OWTB 1VQNA 5FLXc 4NXNQ 4KHZA 2YTYA 3D31A 4JI0Q 3TS2A 4GKJQ 4DV1Q 4LF5L 2R93H 4BY1G 1HR0Q 4JI0L 1VQ8A 4DV7L 1JE5A 2PNHA 4UP7A 5ELNA 3I4OA 4LNQA 4GKJL 2RHQB 4YWMA 4DV1L 2ES2A 3J7A5 3CCSA 1MJCA 2Q2TA 1CSPA 1Q82C
chains in the Genus database with same CATH superfamily
2IL8A 3OYYA 1QB5D 2K5DA 1K73C 3HOUH 1FVIA 5LMNQ 1Z47A 5AFWA 2UXCL 5COYA 1R9TB 1IYVA 4IOCA 1DOMA 1C0AA 1VQOA 3HOZB 1GUOA 4JV5Q 3QOJA 1IBML 3HKZG 3RN2A 2JA7B 3G71A 1LT3D 1VQ5A 3OMGA 4POGA 4A3GB 1KLGD 4IPHA 1LLRD 2EJMA 4X65L 3QJYA 1WOCA 5BN3A 4RCNA 3M3YB 2ZJRA 4K6DA 2HQLA 1L0XB 4KLKA 3DEOA 4O2DA 4DR6Q 1B2TA 3PGZA 1Q1BA 3NELA 4FVMA 2JEBI 3CCEA 5E7NA 1I5FA 1S5BD 1BCPB 1U0LA 3MXNB 3VYTA 4M1UB 1U4PA 4YIJA 5EBCA 3GV6A 3IAYA 1PH2A 3A7AB 5E4WC 3TN2A 4QL5A 3F1ZA 3I4MB 2RKSA 1B3AA 1TR5A 1B9NA 1FGUA 2H5XA 1EUJA 5IP7H 3I3CA 1KRSA 1PZJD 5G3LF 2K5WA 4PV1C 1EYGA 4DPGA 4A3DB 2X6GA 4HJ5A 4R4QA 5AJ3Q 2BA0A 5IYDG 2P5ZX 1LM0A 1PZID 2AQ2B 2RQXA 4UP9A 4BY7G 2R7ZH 4LF4Q 2F0QA 1RKNA 2AQ3B 3GTMH 4DV4Q 2LXJA 5I9OA 1VF7A 2A1AA 1AN8A 4HEDA 3S24A 1JOQA 1L0YB 4EX5A 4DR4Q 1I6HH 1E2VA 1UEBA 4DF7A 2UXBQ 5CV7A 2K5NA 3CPFA 1PH9A 2PZUA 3UI2A 1CHPD 2NZOA 3JAME 1HA5A 5A2QL 3CAMA 1I94Q 4YCUA 3D4WA 3T16A 1RTOA 3HOYB 4DR2L 2NUCA 4QJFA 4JI3Q 4Z9CB 2AMCB 2F0VA 3MXPA 4BBSH 1A3TA 1NNXA 2N78A 1EL0A 1WTXA 2WIIB 1H9RA 3EBEA 4PMBA 2Q2UA 2MPMA 3BVMA 3TRZA 1FNUA 2J7ZA 4KY7A 3KJOA 1N32Q 2FMMA 2F0OA 1K0SA 2E2IH 2NVYH 2F0TA 1XXGA 4LF7L 3NQIA 3VR4A 1XNRQ 1K8OA 3CRKC 1SE4A 4B3MQ 2VL6A 2HHHQ 2UUBL 1SRUA 4LF6Q 4LF9Q 4KY5A 2PNRC 3HKSA 3D4RA 4A3BH 3D6WA 1EY5A 2MQHA 2RF4A 1STAA 3W2DA 5I9PA 1IYJB 3RR5A 2J4XA 3D6CA 1T5XD 3Q24A 2A6HC 1UAPA 2DJFC 2XVSA 3I2ZA 5ELCA 5J1ZA 4YY3L 1PZKD 4NP5A 3T51B 1HNZQ 1VQ9A 1PDQA 5G3LD 1PRTF 1C8CA 2K33A 3F8TA 3S1RB 5KNDA 1SYDA 4QB4A 4DV3L 1PA6A 1AZPA 3ND9A 3S15H 2PMZB 1U4LA 1L1OB 5M3FH 3CCQA 3T1YL 1Q12A 3KJPA 4L5QA 4F8MA 1K0RA 2K75A 5IIFA 3AFQA 1J9OA 1XMOL 1GUWA 4IO9A 4QIWB 5KNCA 1PLFA 1LTRD 4WJ4A 1GM5A 4V0BA 5FLXL 4KKUA 4GLVB 3RLNA 3VR6A 1V43A 1TWHB 3AFPA 4C3JB 4PZ7A 2PQAA 3AQQA 2JP1A 4C3HH 1BNZA 3GTJB 2B2WC 2H4OA 1ML0D 1STNA 4P74A 2RCFA 3HFZB 4JI4Q 1Q8KA 1PV4A 2CH4A 3L0OA 1N34Q 3E5SA 4UAIA 1K28A 3NBIA 1LYLA 3AB9A 5EPKA 2K32A 3CD6A 5DAUA 3R8BA 2AHOB 5J39A 1PFBA 3J7ZC 1GD7A 2F0JA 3C1EA 4AIMA 3I56A 2UUCQ 5D14A 4GOPA 4HCEA 1TT2A 1X65A 5CC4A 1WTVA 2I5MX 3H0GH 1S5ED 2CWAA 5IGFA 1I50B 5EAYA 3MVVA 1UUPA 4JI8L 4XTCS 1MIUA 1OXVA 1AE3A 1ZEQX 2BE5D 4ABNA 3FDTA 1G51A 1X56A 4A3BG 1IHZA 2KOLA 2KJXA 4CHTB 1QUQB 3GD7A 3K81C 2EJGC 4B3SQ 5D3IB 1Q81C 1BCPF 2EPBA 2VQFQ 3ERQA 4LF8L 3SHLA 1IW7D 5D65A 4A93G 1D2BA 2JA8B 3H09A 4ZUJA 1QJOA 1S40A 1RD9D 2K50A 1A6XA 1W6KA 2JYOA 4XQQA 1TWCH 3I91A 3MEFA 2ZTDA 4KV6A 2VUMH 2EOTA 3W5OA 2Z6BA 3U50C 1FD7D 1TWGH 1BKBA 2CKZB 1S72A 4ZKBB 1YZ6A 1C7YA 1MGSA 1NMGA 3MA2B 3LNNA 3TP8A 1WD0A 3HOUB 1B7YB 3NTKA 4OEMB 1N33L 3VA5A 3D8GA 3E0EA 2EXDA 1CKMA 2B2VC 4C3HG 5DM73 3F2BA 1D7QA 1VQ7A 2KHSA 4DAVA 1Y8OB 5IP9G 4DV7Q 1AZQA 1FR3A 4R9WA 3JAMi 1KAAA 4B3RL 1BBWA 2GN5A 4HCSA 5M5XH 3LX0A 1IKLA 4B9WA 4CDCC 3TZDA 2NVXH 1BUVT 5C0XH 1A3VA 2UXCQ 2RHSB 3ONAB 3BVGA 3K5MA 2MO0A 1K3BC 3GV3A 3BZDB 1HUMA 2DUDA 5E3FA 3J81c 1BBXC 2H1EA 2PMZE 1HNWQ 2QILA 2L55A 1JOOA 3HOZH 4QIWE 3KF8B 4NPSA 3NBHB 2EY5A 4A3EH 3L9AX 1B3QA 4G7HC 1M1KC 3HOVH 4A3GH 2D9UA 4FXDA 2X6LA 3MXGA 1XX8A 1EEFD 2O2LD 1O7IA 3U58A 3D4DA 3M3YH 3BU2A 2F0PA 1SROA 3K58A 4IPCA 2R7ZB 4L5RC 3GTMB 1NUCA 4JG2A 3TP7A 3C46A 3TEHB 2R6GA 2JXMB 2F0SA 2D5DA 4N9PA 3BYTB 4DR1L 4JBMA 2EJFC 1SNCA 1K8AC 1D1KA 4CBVA 1I6HB 4DR7L 2VUMG 4K5WA 3I90A 2DY8A 5C4XB 3I7FA 1A0IA 2IHFA 4C56C 1E2WA 3I8ZA 1IXRA 4NB3A 5BN4A 2JA6H 4ID6A 1EYCA 2QCPX 2Q2HA 3SK4A 2F52A 2PO4A 2Z6KA 1SNDA 2JK8A 4LFAL 4BBSB 1STYA 1I4GA 3SE0A 4HJ8A 1JMCA 4NXML 4DUZL 2RBMA 2WB1B 2RDGA 4UDUC 1FNWA 2ASBA 2KCTA 4QQBX 4JC0A 5C5MA 5C0XG 1PFNA 1SMXA 1G8ZD 1Q1EA 3MTSA 4DR2Q 1G2TA 3HEJA 1AFPA 3G4SA 1SN8A 3KYHC 1K9MC 3DWAA 3A5ZB 2AKWB 5EPJA 1VQMA 4IFDJ 1D1IA 1LTSD 4A4IA 5JJKA 1SNOA 3OIPA 2C5CA 2DGYA 4YHHL 2YTVA 1WTPA 3HOZG 4JI6L 1X3GA 2JA7G 4A3EG 3X3MA 3NTHA 1PTOH 5IE8A 1SEBD 3KBGA 1YJNA 4A3GG 1VQFA 1EZ6A 4DN4M 4LF7Q 1MKHA 4A76A 3WOFA 1F2ZA 4MN3A 2X69A 1X3EA 4F88A 1VQNA 4KHZA 3D31A 3TS2A 1EIGA 3FPPA 1VQ8A 2A6HD 4LNQA 5ELNA 4GKJL 2K01A 5EPLA 2Q2TA 1CSPA 4GLXA 4XYOA 3S15B 5M3FB 1JCKB 2F0LA 1YJWA 1Y1WB 3ULPA 2D2CC 2ZM6L 1V1QA 3S9WA 4B9XA 4IFDG 3K0XA 1EQTA 4DV0L 4AQYL 2KEDA 2ZT9C 2CQOA 3I4MG 1E7ZA 3PSIA 1RJTA 2RSOA 1K8GA 4FF2A 2LKVA 5D3DA 3CCMA 2J0TD 1L1OA 4DU9A 3J80c 5K36H 1BXTA 1I4HA 4C3HB 1G6ZA 3LWUA 3BVZA 3T1YQ 2QF7A 4BY1B 3KDFA 3K7AH 3DWQA 4LJZC 4X3SA 1F2MA 1HPCA 1EY6A 2YYZA 2OCEA 5C4ZA 3RN5A 1SJHD 1MI2A 1EFWA 1Y14B 1AW7A 2B2YA 2PQAB 1STGA 1LTAD 3A74A 2M2LA 5ELBA 4RGMA 1GVPA 4DXGA 1JB7A 1V1OA 3DM3A 3H0GB 3QG1A 2L15A 2R61A 3V05A 2UU9L 4JI7L 5BN5A 2OTJA 4KKTA 3HOYG 2KCCA 4G4KA 2V4DA 3GTJH 2MUYA 1Q7YC 3H3VI 5A2QE 1WTRA 1PH4A 3UE1A 1SE3A 2K7VA 2GA4B 1OXTA 4IUVA 5LHY1 2F0FA 3E0JA 5EQ0A 4JI8Q 2OTLA 2FXQA 2L9HA 3OPOA 4LK1C 1QUQA 2LMCB 3CC4A 2N55A 2NVQB 4YWLA 4GOPC 1HZCA 5JVH3 1I50H 4IURA 5IT9L 4BA2I 1RL2A 2YTXA 1CKOA 2D62A 2HUGA 4LF8Q 1F9PA 3J81j 1MSGA 2AWNA 4IQZA 4X3TA 1GUSA 2KCNA 1UEAB 5K36G 1PRTC 2A68C 4K0KL 4C1NI 1U9RA 4JYAL 1PVOA 4DV5L 4G7OC 3T13A 2I0QA 3BDOA 2IX1A 1QG7A 2A6EC 1IBKL 2ALYB 1SYBA 4XQNA 1D6EC 4IUPA 4RMFA 3GTQB 2NVXB 4NXNL 1N33Q 1OXUA 2BA1A 5IGGA 3I4NH 4CKBA 3X3NA 1KABA 3NK9A 1L0WA 1KDBA 2RDFA 3B6YA 2R92B 1HNXL 1EWHA 1YHBA 3SDZA 3H94A 2G9DA 4C3JG 4B3RQ 2K4KA 2IPKD 5FLXE 1V8QA 3GO5A 4A3EB 3FMCA 1U4RA 3HOVB 1Y1VB 2NTTA 4CDEC 1TWAB 3T1HL 1SFOH 1KXLA 2K05A 3I70A 2RSNA 3MFGA 1LABA 5C3XA 1KDAA 2Z1CA 3GTKH 4HR7B 4K8IA 3KF8A 1LTGD 1LV9A 1ZKOA 2OXPA 3NBHA 1SYGA 1BOSA 5FO7B 3NQTA 4K5XA 3BDCA 1PHJA 3QOLA 2NVTB 1ZYRC 1QVFA 1Z7TA 5M5WH 3H6MA 1WCMH 5IGBA 3V96A 1CHQD 1V1PA 3QWNA 4V190 3R2IA 1PYWD 4P72A 3Q23A 4A3FH 1BCPC 1X32A 4A3JB 2A8VA 5LMUL 4NDXA 2JA6B 1N36Q 2Z8LA 2A73B 5JVG3 1T5EA 3IKJA 2B29A 5DM63 5CV4A 4DR1Q 2MNAA 1GJXA 1TWFH 5IGCA 2JA8G 3FKIB 2WFWA 4P73A 4DKAC 2WKCA 1ZXTA 3VYSA 5CMDA 1QNKA 5C3WA 4UY8C 3M4PA 3KLSA 4JI5L 2DY7A 3HG9A 2E76C 4EQPA 1EYDA 1PYBA 2PCFB 3OTOL 2QA4A 5IGDA 4A3KH 4MTNA 1B70B 1RIPA 5C4XH 1JWSD 1GO3E 3K59A 2KBNA 3L7ZC 4PMCA 2NN6I 1HTLD 5C4JH 1X3QA 3HOUG 2HCCA 1AP0A 5CV9A 4DUZQ 4WORA 2RCNA 3J7YW 1B4OA 1VQBA 1XTCD 3WOEA 4L5SA 3FP9A 1RHPA 4A3MB 2Z6KC 3AYHB 3QR8A 1PTOB 4X62Q 2L11A 4L5TA 4DAYA 3FRPB 5NUCA 5LL6S 1PH7A 1GOZA 4X3KA 4QUCA 4RHRA 4ZUIA 3CMAA 4UHVA 1CSQA 4IALA 5I2XA 4X66Q 1XMQL 1DD2A 3VR2A 2K5HA 3NENA 1PTOC 1VMCA 3F2UA 4U68A 3WDNA 5JJZA 4JI6Q 2KQ3A 1FGBD 5FO9B 1G6PA 3G48A 3R3OA 1EU4A 1HZAA 4P71A 1E0BA 1QNUA 1EIYB 5IY0A 1XNQL 1H95A 4MZ9A 4A3LH 3DUZA 3L2PA 1Y69U 1HH2P 4O42A 1DXMA 2EYMA 5IP7G 4KN7C 1A2TA 1C48A 4GN5A 2Q8IB 2K6AA 3VR5A 4IOAA 1D5MC 1CKNB 1TS4A 3CCLA 1KQSA 4DV2L 4FF1A 1NR2A 2WAQB 4OX9Q 1VQGA 5C44B 2ZM6Q 2R7ZG 5M3MH 1VQLA 1PH6A 2JA5H 3TP6A 1NAPA 3K7AB 5FLMH 1W2BA 4H02A 1NTGA 4AQYQ 4KHVA 1N8RC 1PH1A 1GUTA 1Y1WH 3IFDA 1LTTD 2E75C 4O0AA 3TDQA 1YNJC 1A62A 2XRQD 4QY7A 5C4XG 2XTIA 5FK9C 4F7XA 4DV6L 4FYDA 4JOIA 3KDFB 4R8IA 3RUZA 1L1OC 2KCMA 1XPRA 5KYLA 1O7YA 1EU3A 3NXWA 4BBSG 3H91A 2C9OA 1QOHA 1SNQA 4KKSA 4BY1H 3ERSX 4ILWA 3KOJA 4RGTA 4RKLA 2LY7A 4HIDA 2VW9A 2CWPA 2WB1G 2KUMA 5E1FA 5BR8L 1BVSA 2A74C 4JBWA 4CKEA 3RD4A 1E22A 1EY9A 2F0NA 4U673 1II3A 2E5LQ 4DNRB 4JI1L 2B2YC 1B1ZA 2OT2A 2B2TC 2QEJC 1DZ1A 2EZVA 4HSVA 3PIPA 1HRJA 1GHJA 3H15A 3EFXD 3C2PA 3DEPA 3P20A 1O78A 4AYBB 3GP7A 3EA6A 4QUFA 1DYQA 2G5DA 4LFCL 4RHSA 4B3TL 3JAMc 1W6JA 4HAEA 4C3IH 1HTPA 1EWCA 2ICEC 5EJWA 1E1OA 2BH8A 4DR3Q 1FJGL 4DNTB 4IJHA 1SLJA 3GTPB 4RGNA 3CCJA 2NBFA 2ICIA 1A15A 4A3IH 3GTLB 4X6AH 3SK8A 2AUJD 5IYBH 1MSHA 1CM9A 1CT1D 3CQZH 1X3FA 4OIKA 5FLMG 3NPPA 1PRTD 2NVQH 2A68D 2Z9HA 3TREA 2VNUD 2VS1A 1VQJA 4LUZA 5M3FG 1EOVA 4OHJA 5KIXA 2YU9H 1Y1WG 3I4NB 2CH4W 2A6ED 2F3IA 4GN3B 5FJ8H 5IGEA 3MEHA 2QDBA 3RZDH 3MZ5A 3W1BA 2F0WA 1F9SA 3BDLA 2A69C 4RG1A 5CV8A 4EGVA 2KHIA 5CBAE 4ME5A 3RLFA 4LFBL 2YV5A 2L1BA 3WWVA 2ZJPA 5C5LA 2SOBA 4WFN3 4NXNQ 4JI0Q 4DV1Q 4XYQA 1SFOB 4BY1G 1LO5D 4S3SA 2PNHA 4UP7A 5KYIA 2RHQB 2ES2A 5A35A 3CKIB 3GTQH 2XRSD 1Q82C 3GTKB 2WAQE 1FYCA 2DN8A 4KMUC 5JPMC 3H3VH 1HNXQ 4H44C 3E9HA 1TS5A 1TVXA 4LW1A 4QMGA 2K28A 4IJLA 1JJCB 4BXXH 4MTKA 4HJ9A 3A55A 3SK5A 2F4VL 4DR5L 4F87A 1IBMQ 5LMNL 1M4VA 1PTOF 3H0GG 1F77A 2R92H 5M5WB 1V9PA 1J8IA 1TIID 3W1GA 5EGTA 3T1HQ 1SNPA 5CR3A 3AEVA 5M5YB 4X65Q 3PO2B 3CU7A 4JV5L 1WCMB 3KF6A 1KAWA 2JJQA 3M85A 2MFIA 1B8AA 4JCVE 1O7LA 4A3FB 1ZYRD 1UWVA 4ZAIA 2XNAC 4A3CH 1Y1VH 1TWAH 4A3IG 1T9HA 1JOKA 1S3OA 2R3ZA 4IUQA 4KJOA 5IYBG 2K1BA 4DR6L 1BCPD 1TWFB 3BG3A 1KHIA 1CK1A 2Y0SB 2EY1A 3ZJYC 1V1PB 3J80E 1VS0A 1WI5A 1YHQA 3VA7A 1OXSC 3IL8A 3PO3B 4DAPA 3S2HH 3UDFA 2E2HH 2NVTH 5LMUQ 5C0XJ 1VF5C 4A3KB 4BS9A 1QE6A 5FJ8G 1A2UA 1TS3A 3UE0A 5JAVA 4IZ8A 2LS01 1SMYC 4NKLA 5C4JB 5IT9E 5FKAC 4AYBE 4YCVA 4A3JH 2BCOA 3J81L 2QKIC 4RGOS 4DFAA 1QCBD 2XWBB 3R93A 2K5VA 2AWOA 1E3PA 1JB3A 2UXDL 2B3GA 4LF4L 3A0JA 1JC7A 1S4ZA 5CV6A 3OTOQ 3S17H 3FKIH 3HOWB 2EDGA 5HGTA 1AE2A 3J7AV 1KL9A 1XTDA 3R2TA 2HCIA 4KI0A 5JJIA 5JEAH 4R4OA 1VQIA 2UXBL 2K04A 3J81i 1ENAA 1W3SA 4CDDC 2K03A 5M9OA 3U4ZA 4TKOB 1E24A 3OWFA 2XN9C 4DAYB 2R92G 2BOSA 1GKHA 1PTOD 3U9SA 4ZK9B 1A63A 1K3RA 3SVMA 2F0GA 4K2KA 1UE5A 3BYYB 2F0EA 4A3MH 5I2YA 2PI2A 1NR4A 3HOVG 1Y1VG 3PIO3 1SSOA 1DCZA 2JE6I 4WRDA 2DNEA 1OXXK 1WTWA 3EN2A 1N32L 2OEOA 1CTMA 1D5XC 2TMPA 5M3MB 2UUBQ 1HJPA 1WJJA 3C3LA 2KENA 4LUVA 2JA5B 3NP8A 2VZAA 2OWOA 4K14A 1HR0L 2B8GA 2CQAA 3OIQA 5EKLA 4DK6C 1CKNA 1PYSB 2F0KA 4LF6L 4LF9L 2PZTA 1EQQA 2UUAL 1HZ9A 3UDGA 1ICFB 1JWUD 2EYPA 5KGUA 4YY3Q 4Y52H 2K52A 3E9IA 4DV2Q 4O1NA 2B2UA 4DGZA 1VQ6A 3HOXB 3AMUA 3DM1A 1TY2A 5C3EH 4A3JG 2ZJQA 1MHWC 4PZ8A 2JA6G 1YNJD 4MIUA 3P75A 3ICEA 4POFA 4DV3Q 1HNZL 4JBKA 1SYEA 5C44H 1YNNC 2I46A 2NN6H 4L8JA 2D0OA 1OTCA 3FKIG 3HP3A 2L0CA 5DLQE 1XMOQ 1HA6A 1MJEA 2Z0SA 3NE5B 3K6OA 3ITPA 2O5IC 4PQXA 5JEAG 3ND8A 5IOCA 3KFUA 1Y8NB 2I5LX 2KHJA 1F9QA 2IHEA 2Y0SE 1KNEA 1TU2B 4DAMA 3SK6A 2Z4IA 1P16A 4APVA 1J5EL 1CI3M 4JOIC 2NWGA 3L3OC 3E6ZX 2OF1A 3EJIA 2ENBA 3FEWX 2B8FA 4GNXA 2QW7A 1I4RA 4C3IB 4HIMA 1IKMA 4JI4L 3MWYW 3QB3A 2IJ0A 4A3MG 2NB0A 2WV6D 4JI1Q 4FXGC 1RODA 4LUOA 4A3IB 1EQRA 1TQOA 3J80L 1NBWA 1JJGA 5FO8B 1X54A 3CQZB 4Y7NB 3ULLA 1TKWB 4IPGA 1VQHA 2WB1E 2E74C 1FJGQ 1WVLA 4DK3C 2BDNA 2YU9B 2JEAI 2JN4A 3KLWA 2HIVA 2KA7A 3NHHA 4K8JA 1XYIA 2SNSA 3RZDB 3MXUA 1QWYA 3J80i 5I4DA 4R1JA 1QZGA 1VQCA 3GTPH 4B3SL 4GKKL 5C3EG 1H9KA 3NSWA 2VQFL 1KDCA 1VMPA 3GTLH 4FXKC 1F2YA 2Q2IA 2WAQG 3CRLC 1G91A 2A69D 1WTOA 1Z9FA 1U4MA 5C44G 2NN6G 1PFSA 4G57A 1F2LA 4UP8A 1IBLL 3DXJC 2JSOA 1BF4A 2VB2X 3PUVA 4J6HA 4ZYSA 5FOBB 3S14B 2E2JB 4KN4C 3NWSA 3NTIA 4R8NA 5KEEA 4I7ZC 3UDXA 5C4HA 3DLLA 4XT1B 4XT3B 4OO1I 2MGSA 2NTSA 4CKCA 2NYZD 1VQAA 3M4YA 5I6YA 4J1MA 3NEMA 4JK1C 5JJLA 1HCZA 3PUYA 3K57A 1JQYD 1K83H 3H3VC 2JQOA 3K80C 5CORA 4KHPL 2LSSA 2B63B 1Q3LA 4K2LA 4E6IA 2FMCA 2I5HA 2PW7A 4PMWA 3TSSA 4WJ3M 1YI2A 2FFKB 3I73A 2F4VQ 1YIJA 4DR5Q 1STEA 3CF5A 2VQEL 2F1MA 4HMIA 3KF6B 3EVQA 2HDMA 5DEHA 3RZOH 1EEID 1Q86C 1G2SA 4JI2L 1I4QA 1LT5D 3EROA 1HNWL 2EE1A 3S2HB 4AYBG 1IL2A 4CGYB 2E2HB 5KNBA 4ME3A 4BA1I 5M5YH 3PO2H 1PH5A 1BDOA 4RAUC 4N9TA 4TSSA 1DONA 4GS3A 2F0MA 3GQBA 2IW3A 2MHVA 3U9OA 4IN3A 4HMJA 5F2DA 4TQUS 4HIKA 5KRUA 3SR1A 1SMYD 5I6WA 4EQOA 1B50A 2A19A 2F0IA 1XJVA 4I7AA 3D3RA 4DR7Q 3S17B 3M4OB 3SEBA 4M8AA 3GDEA 4RFBA 2FINB 2HD3A 1JR0D 3PO3H 2M00A 4ODGA 1DGSA 1JICA 5LL6X 2IWHA 3I4NG 2K5QA 1PH8A 3P7JA 2UXDQ 4QF4A 4LFAQ 5GAGC 1EZ8A 2N3SA 1TS2A 5J22A 2SNMA 1QILA 2ZXOA 4NXMQ 1S5DD 1PFMA 1ILPA 2EXZA 4RWSC 1N9WA 3K5OA 4JPBW 2E8GA 4XXEA 4XDXA 3G7LA 2QEXA 1ESFA 3KK7A 3HOWH 1CZWA 1LTBD 1ET6A 3G6EA 3KUPA 1EIHA 3C1FA 3J7AF 1YHAA 4GLAC 3SXHA 1WTHA 2EQSA 3N52A 5ELFA 2MJ8A 2KECA 3K0YA 5J3BA 1YNXA 4YHHQ 3V2TA 1EFID 1NJIC 4XIGS 1IZ6A 3QO2A 1VQKA 3MAQA 4C2MH 2A5HA 1EY8A 1UNSA 3FVQA 3KLSX 1YITA 4ZLTF 2HQEA 1ENFA 3BJUA 3PO2G 3I55A 1WCMG 1SNMA 1X55A 4NMZA 3N6RA 4QGUA 5C3EB 4A3FG 4IUTA 1RF2D 5FLXc 2YTYA 4GKJQ 5CBEE 4LF5L 2R93H 1HR0Q 3E3XA 1EYAA 3S1NB 3A56A 1JE5A 1RTNA 3OSOA 4KD4A 1S5CD 1STBA 4G7ZC 1JE4A 2XWJB 3CCSA 4K6LA 3J7A5 5HY6A 3GTOB 3OHXC 2UUAQ 3W3AA 2Y0SG 2ZTCA 4DV0Q 1E1TA 2OQKA 1LT6D 1BO0A 4OL7A 1TXYA 2EY6A 4X64L 3PO3G 1YNND 3RMHA 1CQFA 2EYJA 2F3WA 4CJ2C 4PZ6A 3G6JB 4ZRZA 2AUKA 1ICWA 4A3KG 3CC2A 4A93H 3PMFA 2CFMA 4KJNA 4MNOA 3HOXH 4BBRB 2B2UC 3FPUB 1KIXA 1HFNA 4R4IA 5ELOA 4OONA 2GVAA 2Q8TA 2L4NA 3CXCA 1FL0A 1M8AA 3PIP3 3S16B 3K5LA 1STHA 2F4IA 3GTGB 3S2DH 1XWEA 3A8JE 4I65A 2WP8J 2L12A 5EKIA 2PYKA 3J81E 4L63B 2F0DA 1VDZA 2ID0A 4WJWA 3HOWG 3K7UC 4YCWA 1ILQA 2VY3A 1HZBA 4KD3A 3EQLC 3CP0A 2UU9Q 1J5EQ 4JI7Q 3OWEB 4GNXB 4DUYL 3BZCA 2Z4HA 1WD1A 3HKZB 3LGJA 4ALPA 4HIOA 5IP9H 2F3VA 1I3QH 3SGIA 3D0FA 1O7ZA 1X3PA 2JA9A 2O4XA 3EIVA 1K8MA 3RLOA 3T56B 4GNXC 4FO2A 1DM0B 2LFNA 1L2FA 4A3LG 4JBJA 3VDYA 1OO9B 1UE6A 1SJED 1KD1C 3STBC 3ER0A 3BZKA 1TY0A 1CFMA 1NSNS 4FF3A 2R93G 3S1MB 4ZKCB 3KBXA 3LWEA 1SAPA 1XPUA 5CGKA 1NE3A 2GVBA 1DOLA 4FF4A 1PXUA 4Y7NH 5M3MG 4J8QA 2ZXRA 5GAHC 2JA5G 1EY0A 1H9SB 2CW0C 4TVAB 2RVLA 1HUNA 2QDLA 4PNYA 1EWIA 4HJ7A 4GKKQ 1SYCA 1P8LA 4GN4B 1MD2D 5HGQA 4K0KQ 4BY7B 4H0LC 5IWAL 2B39A 4JYAQ 4MHEA 4DV5Q 2V1CC 3I4LA 3HOXG 2PI2E 2IT1A 2OQ0A 1LUZA 1K83B 1GUNA 1ONLA 4N8FA 1IBLQ 1M90C 1IBKQ 3CPWA 2F0HA 1WFQA 4R4TA 2TSSA 4Q0FA 1UE1A 1A3UA 1LTLA 3JAML 3S1QH 1VCIA 2N88A 3U4VA 2CVRA 4P75A 4HJAA 1NY4A 2HDLA 4P2CB 2WACA 2IX0A 3PUXA 3S14H 2E2JH 1KRTA 3DHQA 1EQVA 1Y8PB 2HT1A 2N8NA 1AH9A 4KHPQ 3RZOB 1C9OA 4K5VA 4RCOA 2CCZA 5GROA 3Q22A 3CW2C 1VQDA 1ASZA 2EVBA 3M4QA 2EIFA 1QVCA 2E2DC 4TRDA 1JT8A 1SR3A 5TSSA 2B63H 1PH3A 1RCVD 4C3IG 2VQEQ 2EYOA 1Q90A 2IY5B 1EIFA 3PV0A 4RH6A 2K14A 4JI2Q 1CA5A 3PQIA 4ZCKA 1DJRD 1R9TH 5HURA 3ZYYX 1R4QB 1JJ2A 3CHBD 1I4PA 3OOCA 1D5ZC 2VB3X 2JA7H 1SE2A 4EQNA 3MXNA 5LMNW 3PCOB 3RNUA 5GQOA 4RA8A 2LXKA 4FDBA 2DJGC 1B9MA 4DA2A 1WTQA 3T53B 5E4XA 4XQJA 3HKZE 4DXFA 1BBUA 3A8KE 1H9JA 4QCLA 3OW2A 1N36L 3VR3A 3T4AC 1S5FD 4CJ1B 3P1HA 1AEXA 4OO1H 4KTAA 5AJ3L 2WINB 4JI5Q 4PG3A 2KVMA 2HIXA 4IFDH 2EYHA 3M4OH 1SDFA 3IRBA 1ENCA 4DV4L 4CDFC 1SE8A 3PF5A 3I4MH 2XIWA 1IYUA 4H13C 4OIJA 1Q8IA 2AQ1B 1B44D 3TMEA 2BH2A 4DR4L 4NW2A 5GADC 3BS1A 2ZXPA 4RKBA 2N49A 4IUNA 5IODA 5GAEC 3CMEA 4BXXG 4A3DH 4GZYC 2L5TA 5C6AA 2KEEA 3K5NA 1I94L 5EKKA 1X9NA 4C2MB 3K8AA 4HTHA 5K5PA 3AU7A 1ESRA 4HSPA 4ULLA 4JI3L 1LTID 2XSCA 3VYRA 3CCUA 2B63G 2SDFA 1E2ZA 4IUUA 4X62L 1VQEA 1XMQQ 1I6VC 3MFYA 2E2IB 2NVYB 3JC66 2WKDA 1BQQT 1NCVA 4A3CG 3CCVA 4OELB 1PMRA 2R93B 1ASYA 3TBIB 3M7GA 2RDHA 4Q5VA 4X3UA 1WYDA 4X66L 5DNFA 5CV5A 4A75A 3UDIA 3HOYH 1XNRL 3A7LA 2EYFA 3Q6SA 4A3BB 4ZQ3A 1XNQQ 4FP5D 4B3ML 3HRZC 1LACA 2HHHL 1HHVA 2NZ1D 1GUGA 5JEAJ 2RA4A 1R4PB 1GXDC 5T1IA 3CC7A 1G291 3A54A 4LF5Q 2R7FA 3TQYA 4A93B 3NWTA 3QIAA 4R4CA 3F2DA 4LAAA 3NUCA 3O13A 3PUWA 2D0PA 1GHKA 4OO1G 2FHTA 1C4QA 4OX9L 3S1NH 4DK1A 3S2DB 5JPNC 5JOBA 4X64Q 3OMCA 3TS0A 4EQ5A 1SBBB 3PIOA 3GTOH 3MC0B 5EBDA 2IX3A 1DOKA 2CHBD 4C1NK 4OWWB 2I07B 1UE7A 1Q46A 4KY6A 3M9BA 4DNIA 1HR0W 1YBYA 1NMFA 4DV6Q 1XPOA 5IYCH 1KC8C 2XGTA 2B2WA 3TZUA 4A3DG 1U5KA 2FJ2A 2PZWA 3Q0AA 4YWKA 1HXYD 4LMQD 3M7NA 1X6OA 1HQMC 1I3QB 2MO1A 4BBRH 1FNVA 3F2CA 3S1RH 4J15A 4L6TB 5ELEA 1A8VA 2F0UA 4KK7A 5IT9c 2ZTEA 3PF4A 5L37A 5BR8Q 3S16H 1H9MA 3MHBA 3GTGH 1SYFA 1J6QA 4EVOA 1YEZA 4CJ0B 1N34L 2B2TA 1D8LA 2PQEA 3FHWA 2G9HD 5ELDA 4DUYQ 2M9VA 3CCRA 3ULJA 1SXTA 1CZGA 1IL8A 1CQVA 2E5LL 4OXPA 4AH6A 3STBD 1EY7A 1MBYA 1KLUD 1TWHH 5H1SE 2UUCL 4C3JH 2Q8RE 4LFCQ 2VXWA 4B3TQ 1JORA 1VQPA 3Q8DA 5C0XI 4JW0A 1JWMD 3HZXA 3I72A 2O5JC 4GOPB 5CYUA 3HGBA 5T1GA 4N8X1 3A5UA 4BWGB 2CW0D 2NZHA 4DR3L 3URYA 1YVCA 1H9SA 1Z6HA 4DK0A 1I4XA 1QZHA 3DWPA 2BE5C 2PPBC 4B08A 2EYLA 4UPAA 2SEBD 2R7DA 3TP5A 1HQRD 1O80A 1F9RA 4H7BA 3S1MH 3PUZA 3DMUA 3OW7A 1TWCB 2C35B 3HS0C 2PW5A 1EY4A 1PRTB 1LT4D 4JVZA 1CUKA 3S1QB 1KTKA 2VUMB 1RDPD 1TWGB 1QVGA 1IW7C 5IWAQ 2EY2A 1B53A 2MP1A 2BDOA 1VQ4A 3A8IE 1ET9A 4OGQC 2F03A 5IYCG 4HN7A 2B2VA 1EOTA 1YJ9A 4LFBQ 5IYDH 4BY7H 2QGQA 2ATWA 1BR9A 4IPDA 2JA8H 4IFDI 1HFGA 4LWCA 4OWXB 3IFTA 4BBRG 5ISRA 1CA6A 4OWTB 3KLRA 5M5XB 3VYUA 4FNFA 2DNCA 4JI0L 4DV7L 1KNAA 3I4OA 4YWMA 4DV1L 1MJCA
chains in the Genus database with same CATH topology
2WAQE 5HY6A 3H3VH 2UUAQ 1HNXQ 3E9HA 2Y0SG 3OYYA 4LW1A 3ULPA 1YJWA 2ZTCA 2ZM6L 1E1TA 1FVIA 1V1QA 1JJCB 4IJLA 1Z47A 2OQKA 5LMNQ 4DV0Q 4HJ9A 4BXXH 4IFDG 1TXYA 2UXCL 3K0XA 4X64L 4GLXA 2F4VL 3PO3G 4DR5L 4AQYL 4DV0L 1IBMQ 4IOCA 2CQOA 5LMNL 3I4MG 1E7ZA 3H0GG 3PSIA 1K8GA 1C0AA 1VQOA 4JV5Q 2R92H 4PZ6A 1V9PA 3HKZG 3RN2A 3W1GA 3CCMA 3T1HQ 1L1OA 4A3KG 3G71A 3J80c 1VQ5A 3CC2A 4X65Q 3AEVA 4A93H 4JV5L 3KF6A 4POGA 2CFMA 4MNOA 1KAWA 2JJQA 3M85A 4IPHA 3HOXH 2MFIA 4X65L 1B8AA 4JCVE 1WOCA 1KIXA 4R4IA 5ELOA 1UWVA 2GVAA 4OONA 2ZJRA 3T1YQ 2HQLA 1FL0A 3CXCA 4A3CH 1Y1VH 4KLKA 1TWAH 4A3IG 4O2DA 3KDFA 1T9HA 4DR6Q 3S2DH 3K7AH 3PGZA 1S3OA 2WP8J 5IYBG 1Q1BA 3NELA 3CCEA 2JEBI 2YYZA 4DR6L 5E7NA 1I5FA 2OCEA 1KHIA 2ID0A 3RN5A 3HOWG 3K7UC 1U0LA 1EFWA 3MXNB 4YCWA 1Y14B 2VY3A 1HZBA 2PQAB 3ZJYC 1VS0A 1WI5A 3CP0A 1YHQA 2UU9Q 1OXSC 3A74A 1PH2A 1GVPA 1J5EQ 3UDFA 1JB7A 4JI7Q 3S2HH 3DM3A 3F1ZA 4QL5A 4GNXB 2E2HH 2NVTH 2UU9L 2L15A 5C0XJ 5LMUQ 4DUYL 3BZCA 4JI7L 1FGUA 2H5XA 3LGJA 1EUJA 5FJ8G 4ALPA 5IP7H 5IP9H 4HIOA 2OTJA 1KRSA 3UE0A 1EYGA 1I3QH 4DPGA 3HOYG 3SGIA 3GTJH 4AYBE 4YCVA 4A3JH 1Q7YC 3D0FA 4HJ5A 3H3VI 4R4QA 5AJ3Q 2BA0A 5IYDG 1PH4A 1LM0A 2JA9A 4UP9A 3UE1A 4BY7G 3EIVA 3RLOA 4GNXC 2R7ZH 4LF4Q 2K5VA 2AWOA 1L2FA 3GTMH 1E3PA 4JBJA 4A3LG 2UXDL 1OXTA 3VDYA 3GTQH 1UE6A 2B3GA 2LXJA 4DV4Q 1KD1C 3STBC 2A1AA 4LF4L 3A0JA 3ER0A 3OTOQ 3S24A 3BZKA 3S17H 3FKIH 2OTLA 4JI8Q 2FXQA 1AE2A 2R93G 1KL9A 1QUQA 1XTDA 4EX5A 3CC4A 1XPUA 4DR4Q 1I6HH 1UEBA 2UXBQ 1NE3A 2GVBA 4YWLA 2K5NA 4KI0A 4GOPC 5JJIA 4Y7NH 4R4OA 1VQIA 3CPFA 1HZCA 5M3MG 1PH9A 2UXBL 5GAHC 2JA5G 1I50H 4BA2I 2NZOA 3J81i 1W3SA 1RL2A 2YTXA 3CAMA 1I94Q 4YCUA 4TVAB 1CKOA 2D62A 1EWIA 4HJ7A 4LF8Q 4GKKQ 3U4ZA 1E24A 4DR2L 4DAYB 1P8LA 4QJFA 3J81j 2R92G 4JI3Q 2AWNA 2AMCB 4GN4B 5HGQA 4BBSH 1GKHA 4K0KQ 5IWAL 5K36G 4JYAQ 2N78A 1A63A 1K3RA 2V1CC 4DV5Q 3HOXG 4K0KL 1UE5A 3EBEA 2PI2E 2Q2UA 2IT1A 4A3MH 4JYAL 1PVOA 2OQ0A 4DV5L 1LUZA 3TRZA 2I0QA 2PI2A 1IBLQ 1M90C 1Y1VG 3CPWA 1IBKQ 3HOVG 1WFQA 4R4TA 2JE6I 3KJOA 1N32Q 1UE1A 2IX1A 1OXXK 2ALYB 1IBKL 2E2IH 2NVYH 1LTLA 3S1QH 4LF7L 1VCIA 3EN2A 1XNRQ 4RMFA 1N32L 3U4VA 4P75A 2UUBQ 1HJPA 1WJJA 4NXNL 2KENA 4LUVA 4HJAA 1NY4A 4B3MQ 1OXUA 2BA1A 2VL6A 2VZAA 2HHHQ 1N33Q 2OWOA 1HR0L 1SRUA 2UUBL 2IX0A 3PUXA 4LF6Q 4LF9Q 2E2JH 3I4NH 3S14H 4DK6C 1CKNA 1KRTA 3HKSA 3HOUH 1L0WA 1PYSB 4LF6L 4LF9L 4A3BH 2HT1A 2N8NA 2MQHA 2RF4A 3B6YA 1EQQA 1HNXL 1HZ9A 2UUAL 1C9OA 4KHPQ 3UDGA 1AH9A 1IYJB 3RR5A 1YHBA 4YY3Q 4Y52H 2K52A 3E9IA 2CCZA 4DV2Q 4B3RQ 2K4KA 5GROA 3I2ZA 3CW2C 1VQDA 1ASZA 1VQ6A 4YY3L 3M4QA 2EIFA 5C3EH 4A3JG 1QVCA 3GO5A 4PZ8A 1HNZQ 1VQ9A 2ZJQA 2JA6G 1JT8A 1SR3A 3ICEA 4POFA 4DV3Q 1HNZL 3T1HL 1SFOH 1PH3A 2B63H 3F8TA 1KXLA 4JBKA 2VQEQ 2IY5B 4DV3L 1EIFA 1PA6A 5C44H 3GTKH 2D0OA 3S15H 1OTCA 1L1OB 3FKIG 5M3FH 3CCQA 3PV0A 1Q12A 5DLQE 2K14A 4L5QA 3KJPA 3T1YL 1XMOQ 4JI2Q 1MJEA 2Z0SA 1K0RA 2K75A 3AFQA 1XMOL 1R9TH 5JEAG 4IO9A 3KFUA 1PHJA 1JJ2A 4WJ4A 2I5LX 2KHJA 1GM5A 1QVFA 2IHEA 5M5WH 2Y0SE 2JA7H 4GLVB 3RLNA 1V43A 1WCMH 5LMNW 3AFPA 4DAMA 3PCOB 2PQAA 4PZ7A 3RNUA 1P16A 5GQOA 3AQQA 4APVA 4C3HH 1J5EL 4P72A 2LXKA 4JOIC 4FDBA 4A3FH 2A8VA 4P74A 3HFZB 5LMUL 4JI4Q 1Q8KA 1PV4A 3HKZE 4GNXA 1N36Q 1BBUA 3L0OA 1N34Q 4HIMA 3OW2A 4JI4L 1N36L 2B29A 4DR1Q 4A3MG 1LYLA 2MNAA 3CD6A 1TWFH 4JI1Q 2JA8G 4LUOA 2AHOB 5AJ3L 1EQRA 4JI5Q 2WFWA 4P73A 4DKAC 3J7ZC 4PG3A 1GD7A 1NBWA 3I56A 4AIMA 4UY8C 2HIXA 2UUCQ 4GOPA 3M4PA 1JJGA 1X54A 4JI5L 1X65A 3M4OH 3IRBA 4DV4L 3PF5A 1SE8A 2I5MX 3I4MH 3H0GH 1PYBA 3OTOL 2QA4A 2CWAA 3ULLA 5EAYA 4JI8L 4XTCS 1MIUA 4A3KH 1OXVA 4IPGA 4MTNA 1VQHA 2WB1E 1B70B 1RIPA 2BH2A 1AE3A 4DR4L 5C4XH 1FJGQ 1G51A 1GO3E 4DK3C 2KBNA 1X56A 3L7ZC 5GADC 5C4JH 2NN6I 2JEAI 4A3BG 3KLWA 3HOUG 2N49A 5GAEC 4BXXG 4A3DH 3CMEA 2HIVA 1QUQB 3GD7A 3K81C 4DUZQ 2RCNA 4B3SQ 1VQBA 1Q81C 3J80i 1I94L 1X9NA 2VQFQ 4L5SA 3K8AA 3FP9A 4R1JA 1QZGA 1VQCA 3GTPH 4B3SL 4LF8L 4GKKL 5C3EG 2Z6KC 3AYHB 2VQFL 4A93G 4X62Q 4JI3L 4L5TA 3GTLH 3CCUA 2B63G 1PH7A 1S40A 2Q2IA 4X62L 1VQEA 1XMQQ 2WAQG 2K50A 3JC66 1Z9FA 4A3CG 5C44G 3CMAA 2NN6G 1PFSA 3CCVA 1CSQA 4X66Q 1XMQL 1TWCH 4UP8A 1ASYA 3MEFA 1IBLL 2K5HA 2ZTDA 1WYDA 3PUVA 4X66L 3NENA 2VUMH 3W5OA 3U50C 4A75A 1TWGH 3UDIA 4JI6Q 1BKBA 3UDXA 2CKZB 1S72A 1XNRL 3DLLA 3HOYH 1YZ6A 1G6PA 3G48A 1C7YA 1HZAA 4P71A 1NMGA 4OO1I 1XNQQ 1B7YB 4B3ML 1N33L 1EIYB 1VQAA 2HHHL 5JEAJ 3E0EA 2EXDA 5IY0A 1XNQL 1H95A 3NEMA 1CKMA 3CC7A 1G291 5JJLA 4MZ9A 3PUYA 4A3LH 3L2PA 1HH2P 4LF5Q 3F2BA 1D7QA 1VQ7A 1K83H 2R7FA 2JQOA 3K80C 3TQYA 5IP9G 5IP7G 4DV7Q 4GN5A 4KHPL 2LSSA 4R4CA 3F2DA 4IOAA 3JAMi 1CKNB 3CCLA 1KQSA 4DV2L 4B3RL 1BBWA 2GN5A 4OX9Q 5M5XH 3PUWA 1VQGA 2I5HA 2D0PA 4OO1G 4PMWA 2ZM6Q 5M3MH 2NVXH 1VQLA 2R7ZG 4OX9L 1PH6A 3S1NH 2JA5H 2UXCQ 4WJ3M 1YI2A 5FLMH 1W2BA 1IBML 4X64Q 2RHSB 4H02A 1NTGA 4DR5Q 4AQYQ 3TS0A 3CF5A 1YIJA 2F4VQ 1N8RC 2MO0A 4EQ5A 2VQEL 1PH1A 3GTOH 3PIOA 2DUDA 3J81c 4OWWB 1UE7A 1Q46A 3KF6B 2PMZE 1Y1WH 1HNWQ 3M9BA 4DNIA 4O0AA 1HR0W 3RZOH 1Q86C 1YBYA 1NMFA 4DV6Q 4JI2L 1A62A 4QY7A 1HNWL 5C4XG 1XPOA 2XTIA 4AYBG 1IL2A 5IYCH 4DV6L 1KC8C 3HOZH 2XGTA 4QIWE 3KF8B 4JOIA 4NPSA 3KDFB 4ME3A 4A3DG 4BA1I 3NBHB 1U5KA 4A3EH 5M5YH 3PO2H 1L1OC 2KCMA 1PH5A 4YWKA 3M7NA 1X6OA 1M1KC 3HOVH 4A3GH 4BBRH 2MO1A 1XPRA 3F2CA 3S1RH 4J15A 3U58A 1O7IA 4GS3A 1A8VA 3M3YH 3BU2A 4BBSG 3PF4A 5IT9c 2ZTEA 1SROA 5BR8Q 3S16H 4IPCA 4BY1H 4TQUS 3ERSX 3KOJA 4HIKA 3GTGH 4L5RC 4HIDA 2VW9A 1J6QA 2CWPA 2WB1G 5BR8L 1YEZA 1BVSA 4JBWA 4JG2A 1N34L 1D8LA 3TEHB 1E22A 2A19A 2R6GA 3FHWA 1XJVA 4DUYQ 4DR1L 4DR7Q 2E5LQ 4JBMA 1K8AC 3CCRA 3ULJA 4JI1L 3GDEA 4DR7L 2E5LL 4OXPA 2VUMG 4AH6A 3PO3H 3PIPA 3H15A 3STBD 5H1SE 1TWHH 2UUCL 4C3JH 3I7FA 1A0IA 2IHFA 4LFCQ 4B3TQ 1DGSA 1VQPA 1IXRA 3I4NG 3Q8DA 4NB3A 5C0XI 4LFCL 2JA6H 4B3TL 3JAMc 1PH8A 4GOPB 2UXDQ 4C3IH 4LFAQ 1FJGL 1E1OA 2BH8A 2N3SA 5GAGC 4DR3Q 2Q2HA 4IJHA 4NXMQ 3A5UA 1SLJA 2F52A 2Z6KA 2JK8A 4LFAL 3CCJA 2NZHA 4DR3L 4HJ8A 4A3IH 1JMCA 1N9WA 1YVCA 4NXML 4X6AH 2E8GA 4DUZL 2QEXA 5IYBH 1QZHA 2ASBA 4UPAA 2KCTA 2R7DA 3HOWH 3CQZH 1X3FA 4QQBX 4JC0A 3G6EA 3S1MH 3PUZA 5C0XG 1SMXA 2C35B 5FLMG 2NVQH 1Q1EA 3TREA 2VNUD 2VS1A 1CUKA 1YHAA 4DR2Q 1VQJA 4GLAC 4LUZA 2EQSA 5M3FG 1EOVA 1QVGA 1Y1WG 2YU9H 3G4SA 1SN8A 5IWAQ 3KYHC 1K9MC 5J3BA 4GN3B 1YNXA 2F3IA 2AKWB 3A5ZB 5FJ8H 4YHHQ 1VQ4A 1VQMA 4IFDJ 5JJKA 4A4IA 1NJIC 3RZDH 4XIGS 1IZ6A 1VQKA 2DGYA 3W1BA 5IYCG 4YHHL 2YTVA 4C2MH 3HOZG 1K73C 1YJ9A 4JI6L 4RG1A 1YITA 1X3GA 2JA7G 4LFBQ 4A3EG 2KHIA 5IYDH 3BJUA 4BY7H 2QGQA 2ATWA 3PO2G 3I55A 1WCMG 5IE8A 4IPDA 2JA8H 1X55A 1YJNA 4A3GG 3RLFA 4IFDI 4LWCA 4OWXB 4BBRG 1VQFA 2YV5A 4LF7Q 4LFBL 1MKHA 4A76A 4QGUA 3WWVA 2ZJPA 4A3FG 1X3EA 4OWTB 1VQNA 5FLXc 4NXNQ 4KHZA 2YTYA 3D31A 4JI0Q 3TS2A 4GKJQ 4DV1Q 4LF5L 2R93H 4BY1G 1HR0Q 4JI0L 1VQ8A 4DV7L 1JE5A 2PNHA 4UP7A 5ELNA 3I4OA 4LNQA 4GKJL 2RHQB 4YWMA 4DV1L 2ES2A 3J7A5 3CCSA 1MJCA 2Q2TA 1CSPA 1Q82C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ E;  5HY6 A;  3H3V H;  2UUA Q;  1HNX Q;  3E9H A;  2Y0S G;  3OYY A;  4LW1 A;  3ULP A;  1YJW A;  2ZTC A;  2ZM6 L;  1E1T A;  1FVI A;  1V1Q A;  1JJC B;  4IJL A;  1Z47 A;  2OQK A;  5LMN Q;  4DV0 Q;  4HJ9 A;  4BXX H;  4IFD G;  1TXY A;  2UXC L;  3K0X A;  4X64 L;  4GLX A;  2F4V L;  3PO3 G;  4DR5 L;  4AQY L;  4DV0 L;  1IBM Q;  4IOC A;  2CQO A;  5LMN L;  3I4M G;  1E7Z A;  3H0G G;  3PSI A;  1K8G A;  1C0A A;  1VQO A;  4JV5 Q;  2R92 H;  4PZ6 A;  1V9P A;  3HKZ G;  3RN2 A;  3W1G A;  3CCM A;  3T1H Q;  1L1O A;  4A3K G;  3G71 A;  3J80 c;  1VQ5 A;  3CC2 A;  4X65 Q;  3AEV A;  4A93 H;  4JV5 L;  3KF6 A;  4POG A;  2CFM A;  4MNO A;  1KAW A;  2JJQ A;  3M85 A;  4IPH A;  3HOX H;  2MFI A;  4X65 L;  1B8A A;  4JCV E;  1WOC A;  1KIX A;  4R4I A;  5ELO A;  1UWV A;  2GVA A;  4OON A;  2ZJR A;  3T1Y Q;  2HQL A;  1FL0 A;  3CXC A;  4A3C H;  1Y1V H;  4KLK A;  1TWA H;  4A3I G;  4O2D A;  3KDF A;  1T9H A;  4DR6 Q;  3S2D H;  3K7A H;  3PGZ A;  1S3O A;  2WP8 J;  5IYB G;  1Q1B A;  3NEL A;  3CCE A;  2JEB I;  2YYZ A;  4DR6 L;  5E7N A;  1I5F A;  2OCE A;  1KHI A;  2ID0 A;  3RN5 A;  3HOW G;  3K7U C;  1U0L A;  1EFW A;  3MXN B;  4YCW A;  1Y14 B;  2VY3 A;  1HZB A;  2PQA B;  3ZJY C;  1VS0 A;  1WI5 A;  3CP0 A;  1YHQ A;  2UU9 Q;  1OXS C;  3A74 A;  1PH2 A;  1GVP A;  1J5E Q;  3UDF A;  1JB7 A;  4JI7 Q;  3S2H H;  3DM3 A;  3F1Z A;  4QL5 A;  4GNX B;  2E2H H;  2NVT H;  2UU9 L;  2L15 A;  5C0X J;  5LMU Q;  4DUY L;  3BZC A;  4JI7 L;  1FGU A;  2H5X A;  3LGJ A;  1EUJ A;  5FJ8 G;  4ALP A;  5IP7 H;  5IP9 H;  4HIO A;  2OTJ A;  1KRS A;  3UE0 A;  1EYG A;  1I3Q H;  4DPG A;  3HOY G;  3SGI A;  3GTJ H;  4AYB E;  4YCV A;  4A3J H;  1Q7Y C;  3D0F A;  4HJ5 A;  3H3V I;  4R4Q A;  5AJ3 Q;  2BA0 A;  5IYD G;  1PH4 A;  1LM0 A;  2JA9 A;  4UP9 A;  3UE1 A;  4BY7 G;  3EIV A;  3RLO A;  4GNX C;  2R7Z H;  4LF4 Q;  2K5V A;  2AWO A;  1L2F A;  3GTM H;  1E3P A;  4JBJ A;  4A3L G;  2UXD L;  1OXT A;  3VDY A;  3GTQ H;  1UE6 A;  2B3G A;  2LXJ A;  4DV4 Q;  1KD1 C;  3STB C;  2A1A A;  4LF4 L;  3A0J A;  3ER0 A;  3OTO Q;  3S24 A;  3BZK A;  3S17 H;  3FKI H;  2OTL A;  4JI8 Q;  2FXQ A;  1AE2 A;  2R93 G;  1KL9 A;  1QUQ A;  1XTD A;  4EX5 A;  3CC4 A;  1XPU A;  4DR4 Q;  1I6H H;  1UEB A;  2UXB Q;  1NE3 A;  2GVB A;  4YWL A;  2K5N A;  4KI0 A;  4GOP C;  5JJI A;  4Y7N H;  4R4O A;  1VQI A;  3CPF A;  1HZC A;  5M3M G;  1PH9 A;  2UXB L;  5GAH C;  2JA5 G;  1I50 H;  4BA2 I;  2NZO A;  3J81 i;  1W3S A;  1RL2 A;  2YTX A;  3CAM A;  1I94 Q;  4YCU A;  4TVA B;  1CKO A;  2D62 A;  1EWI A;  4HJ7 A;  4LF8 Q;  4GKK Q;  3U4Z A;  1E24 A;  4DR2 L;  4DAY B;  1P8L A;  4QJF A;  3J81 j;  2R92 G;  4JI3 Q;  2AWN A;  2AMC B;  4GN4 B;  5HGQ A;  4BBS H;  1GKH A;  4K0K Q;  5IWA L;  5K36 G;  4JYA Q;  2N78 A;  1A63 A;  1K3R A;  2V1C C;  4DV5 Q;  3HOX G;  4K0K L;  1UE5 A;  3EBE A;  2PI2 E;  2Q2U A;  2IT1 A;  4A3M H;  4JYA L;  1PVO A;  2OQ0 A;  4DV5 L;  1LUZ A;  3TRZ A;  2I0Q A;  2PI2 A;  1IBL Q;  1M90 C;  1Y1V G;  3CPW A;  1IBK Q;  3HOV G;  1WFQ A;  4R4T A;  2JE6 I;  3KJO A;  1N32 Q;  1UE1 A;  2IX1 A;  1OXX K;  2ALY B;  1IBK L;  2E2I H;  2NVY H;  1LTL A;  3S1Q H;  4LF7 L;  1VCI A;  3EN2 A;  1XNR Q;  4RMF A;  1N32 L;  3U4V A;  4P75 A;  2UUB Q;  1HJP A;  1WJJ A;  4NXN L;  2KEN A;  4LUV A;  4HJA A;  1NY4 A;  4B3M Q;  1OXU A;  2BA1 A;  2VL6 A;  2VZA A;  2HHH Q;  1N33 Q;  2OWO A;  1HR0 L;  1SRU A;  2UUB L;  2IX0 A;  3PUX A;  4LF6 Q;  4LF9 Q;  2E2J H;  3I4N H;  3S14 H;  4DK6 C;  1CKN A;  1KRT A;  3HKS A;  3HOU H;  1L0W A;  1PYS B;  4LF6 L;  4LF9 L;  4A3B H;  2HT1 A;  2N8N A;  2MQH A;  2RF4 A;  3B6Y A;  1EQQ A;  1HNX L;  1HZ9 A;  2UUA L;  1C9O A;  4KHP Q;  3UDG A;  1AH9 A;  1IYJ B;  3RR5 A;  1YHB A;  4YY3 Q;  4Y52 H;  2K52 A;  3E9I A;  2CCZ A;  4DV2 Q;  4B3R Q;  2K4K A;  5GRO A;  3I2Z A;  3CW2 C;  1VQD A;  1ASZ A;  1VQ6 A;  4YY3 L;  3M4Q A;  2EIF A;  5C3E H;  4A3J G;  1QVC A;  3GO5 A;  4PZ8 A;  1HNZ Q;  1VQ9 A;  2ZJQ A;  2JA6 G;  1JT8 A;  1SR3 A;  3ICE A;  4POF A;  4DV3 Q;  1HNZ L;  3T1H L;  1SFO H;  1PH3 A;  2B63 H;  3F8T A;  1KXL A;  4JBK A;  2VQE Q;  2IY5 B;  4DV3 L;  1EIF A;  1PA6 A;  5C44 H;  3GTK H;  2D0O A;  3S15 H;  1OTC A;  1L1O B;  3FKI G;  5M3F H;  3CCQ A;  3PV0 A;  1Q12 A;  5DLQ E;  2K14 A;  4L5Q A;  3KJP A;  3T1Y L;  1XMO Q;  4JI2 Q;  1MJE A;  2Z0S A;  1K0R A;  2K75 A;  3AFQ A;  1XMO L;  1R9T H;  5JEA G;  4IO9 A;  3KFU A;  1PHJ A;  1JJ2 A;  4WJ4 A;  2I5L X;  2KHJ A;  1GM5 A;  1QVF A;  2IHE A;  5M5W H;  2Y0S E;  2JA7 H;  4GLV B;  3RLN A;  1V43 A;  1WCM H;  5LMN W;  3AFP A;  4DAM A;  3PCO B;  2PQA A;  4PZ7 A;  3RNU A;  1P16 A;  5GQO A;  3AQQ A;  4APV A;  4C3H H;  1J5E L;  4P72 A;  2LXK A;  4JOI C;  4FDB A;  4A3F H;  2A8V A;  4P74 A;  3HFZ B;  5LMU L;  4JI4 Q;  1Q8K A;  1PV4 A;  3HKZ E;  4GNX A;  1N36 Q;  1BBU A;  3L0O A;  1N34 Q;  4HIM A;  3OW2 A;  4JI4 L;  1N36 L;  2B29 A;  4DR1 Q;  4A3M G;  1LYL A;  2MNA A;  3CD6 A;  1TWF H;  4JI1 Q;  2JA8 G;  4LUO A;  2AHO B;  5AJ3 L;  1EQR A;  4JI5 Q;  2WFW A;  4P73 A;  4DKA C;  3J7Z C;  4PG3 A;  1GD7 A;  1NBW A;  3I56 A;  4AIM A;  4UY8 C;  2HIX A;  2UUC Q;  4GOP A;  3M4P A;  1JJG A;  1X54 A;  4JI5 L;  1X65 A;  3M4O H;  3IRB A;  4DV4 L;  3PF5 A;  1SE8 A;  2I5M X;  3I4M H;  3H0G H;  1PYB A;  3OTO L;  2QA4 A;  2CWA A;  3ULL A;  5EAY A;  4JI8 L;  4XTC S;  1MIU A;  4A3K H;  1OXV A;  4IPG A;  4MTN A;  1VQH A;  2WB1 E;  1B70 B;  1RIP A;  2BH2 A;  1AE3 A;  4DR4 L;  5C4X H;  1FJG Q;  1G51 A;  1GO3 E;  4DK3 C;  2KBN A;  1X56 A;  3L7Z C;  5GAD C;  5C4J H;  2NN6 I;  2JEA I;  4A3B G;  3KLW A;  3HOU G;  2N49 A;  5GAE C;  4BXX G;  4A3D H;  3CME A;  2HIV A;  1QUQ B;  3GD7 A;  3K81 C;  4DUZ Q;  2RCN A;  4B3S Q;  1VQB A;  1Q81 C;  3J80 i;  1I94 L;  1X9N A;  2VQF Q;  4L5S A;  3K8A A;  3FP9 A;  4R1J A;  1QZG A;  1VQC A;  3GTP H;  4B3S L;  4LF8 L;  4GKK L;  5C3E G;  2Z6K C;  3AYH B;  2VQF L;  4A93 G;  4X62 Q;  4JI3 L;  4L5T A;  3GTL H;  3CCU A;  2B63 G;  1PH7 A;  1S40 A;  2Q2I A;  4X62 L;  1VQE A;  1XMQ Q;  2WAQ G;  2K50 A;  3JC6 6;  1Z9F A;  4A3C G;  5C44 G;  3CMA A;  2NN6 G;  1PFS A;  3CCV A;  1CSQ A;  4X66 Q;  1XMQ L;  1TWC H;  4UP8 A;  1ASY A;  3MEF A;  1IBL L;  2K5H A;  2ZTD A;  1WYD A;  3PUV A;  4X66 L;  3NEN A;  2VUM H;  3W5O A;  3U50 C;  4A75 A;  1TWG H;  3UDI A;  4JI6 Q;  1BKB A;  3UDX A;  2CKZ B;  1S72 A;  1XNR L;  3DLL A;  3HOY H;  1YZ6 A;  1G6P A;  3G48 A;  1C7Y A;  1HZA A;  4P71 A;  1NMG A;  4OO1 I;  1XNQ Q;  1B7Y B;  4B3M L;  1N33 L;  1EIY B;  1VQA A;  2HHH L;  5JEA J;  3E0E A;  2EXD A;  5IY0 A;  1XNQ L;  1H95 A;  3NEM A;  1CKM A;  3CC7 A;  1G29 1;  5JJL A;  4MZ9 A;  3PUY A;  4A3L H;  3L2P A;  1HH2 P;  4LF5 Q;  3F2B A;  1D7Q A;  1VQ7 A;  1K83 H;  2R7F A;  2JQO A;  3K80 C;  3TQY A;  5IP9 G;  5IP7 G;  4DV7 Q;  4GN5 A;  4KHP L;  2LSS A;  4R4C A;  3F2D A;  4IOA A;  3JAM i;  1CKN B;  3CCL A;  1KQS A;  4DV2 L;  4B3R L;  1BBW A;  2GN5 A;  4OX9 Q;  5M5X H;  3PUW A;  1VQG A;  2I5H A;  2D0P A;  4OO1 G;  4PMW A;  2ZM6 Q;  5M3M H;  2NVX H;  1VQL A;  2R7Z G;  4OX9 L;  1PH6 A;  3S1N H;  2JA5 H;  2UXC Q;  4WJ3 M;  1YI2 A;  5FLM H;  1W2B A;  1IBM L;  4X64 Q;  2RHS B;  4H02 A;  1NTG A;  4DR5 Q;  4AQY Q;  3TS0 A;  3CF5 A;  1YIJ A;  2F4V Q;  1N8R C;  2MO0 A;  4EQ5 A;  2VQE L;  1PH1 A;  3GTO H;  3PIO A;  2DUD A;  3J81 c;  4OWW B;  1UE7 A;  1Q46 A;  3KF6 B;  2PMZ E;  1Y1W H;  1HNW Q;  3M9B A;  4DNI A;  4O0A A;  1HR0 W;  3RZO H;  1Q86 C;  1YBY A;  1NMF A;  4DV6 Q;  4JI2 L;  1A62 A;  4QY7 A;  1HNW L;  5C4X G;  1XPO A;  2XTI A;  4AYB G;  1IL2 A;  5IYC H;  4DV6 L;  1KC8 C;  3HOZ H;  2XGT A;  4QIW E;  3KF8 B;  4JOI A;  4NPS A;  3KDF B;  4ME3 A;  4A3D G;  4BA1 I;  3NBH B;  1U5K A;  4A3E H;  5M5Y H;  3PO2 H;  1L1O C;  2KCM A;  1PH5 A;  4YWK A;  3M7N A;  1X6O A;  1M1K C;  3HOV H;  4A3G H;  4BBR H;  2MO1 A;  1XPR A;  3F2C A;  3S1R H;  4J15 A;  3U58 A;  1O7I A;  4GS3 A;  1A8V A;  3M3Y H;  3BU2 A;  4BBS G;  3PF4 A;  5IT9 c;  2ZTE A;  1SRO A;  5BR8 Q;  3S16 H;  4IPC A;  4BY1 H;  4TQU S;  3ERS X;  3KOJ A;  4HIK A;  3GTG H;  4L5R C;  4HID A;  2VW9 A;  1J6Q A;  2CWP A;  2WB1 G;  5BR8 L;  1YEZ A;  1BVS A;  4JBW A;  4JG2 A;  1N34 L;  1D8L A;  3TEH B;  1E22 A;  2A19 A;  2R6G A;  3FHW A;  1XJV A;  4DUY Q;  4DR1 L;  4DR7 Q;  2E5L Q;  4JBM A;  1K8A C;  3CCR A;  3ULJ A;  4JI1 L;  3GDE A;  4DR7 L;  2E5L L;  4OXP A;  2VUM G;  4AH6 A;  3PO3 H;  3PIP A;  3H15 A;  3STB D;  5H1S E;  1TWH H;  2UUC L;  4C3J H;  3I7F A;  1A0I A;  2IHF A;  4LFC Q;  4B3T Q;  1DGS A;  1VQP A;  1IXR A;  3I4N G;  3Q8D A;  4NB3 A;  5C0X I;  4LFC L;  2JA6 H;  4B3T L;  3JAM c;  1PH8 A;  4GOP B;  2UXD Q;  4C3I H;  4LFA Q;  1FJG L;  1E1O A;  2BH8 A;  2N3S A;  5GAG C;  4DR3 Q;  2Q2H A;  4IJH A;  4NXM Q;  3A5U A;  1SLJ A;  2F52 A;  2Z6K A;  2JK8 A;  4LFA L;  3CCJ A;  2NZH A;  4DR3 L;  4HJ8 A;  4A3I H;  1JMC A;  1N9W A;  1YVC A;  4NXM L;  4X6A H;  2E8G A;  4DUZ L;  2QEX A;  5IYB H;  1QZH A;  2ASB A;  4UPA A;  2KCT A;  2R7D A;  3HOW H;  3CQZ H;  1X3F A;  4QQB X;  4JC0 A;  3G6E A;  3S1M H;  3PUZ A;  5C0X G;  1SMX A;  2C35 B;  5FLM G;  2NVQ H;  1Q1E A;  3TRE A;  2VNU D;  2VS1 A;  1CUK A;  1YHA A;  4DR2 Q;  1VQJ A;  4GLA C;  4LUZ A;  2EQS A;  5M3F G;  1EOV A;  1QVG A;  1Y1W G;  2YU9 H;  3G4S A;  1SN8 A;  5IWA Q;  3KYH C;  1K9M C;  5J3B A;  4GN3 B;  1YNX A;  2F3I A;  2AKW B;  3A5Z B;  5FJ8 H;  4YHH Q;  1VQ4 A;  1VQM A;  4IFD J;  5JJK A;  4A4I A;  1NJI C;  3RZD H;  4XIG S;  1IZ6 A;  1VQK A;  2DGY A;  3W1B A;  5IYC G;  4YHH L;  2YTV A;  4C2M H;  3HOZ G;  1K73 C;  1YJ9 A;  4JI6 L;  4RG1 A;  1YIT A;  1X3G A;  2JA7 G;  4LFB Q;  4A3E G;  2KHI A;  5IYD H;  3BJU A;  4BY7 H;  2QGQ A;  2ATW A;  3PO2 G;  3I55 A;  1WCM G;  5IE8 A;  4IPD A;  2JA8 H;  1X55 A;  1YJN A;  4A3G G;  3RLF A;  4IFD I;  4LWC A;  4OWX B;  4BBR G;  1VQF A;  2YV5 A;  4LF7 Q;  4LFB L;  1MKH A;  4A76 A;  4QGU A;  3WWV A;  2ZJP A;  4A3F G;  1X3E A;  4OWT B;  1VQN A;  5FLX c;  4NXN Q;  4KHZ A;  2YTY A;  3D31 A;  4JI0 Q;  3TS2 A;  4GKJ Q;  4DV1 Q;  4LF5 L;  2R93 H;  4BY1 G;  1HR0 Q;  4JI0 L;  1VQ8 A;  4DV7 L;  1JE5 A;  2PNH A;  4UP7 A;  5ELN A;  3I4O A;  4LNQ A;  4GKJ L;  2RHQ B;  4YWM A;  4DV1 L;  2ES2 A;  3J7A 5;  3CCS A;  1MJC A;  2Q2T A;  1CSP A;  1Q82 C; 
#chains in the Genus database with same CATH topology
 2IL8 A;  3OYY A;  1QB5 D;  2K5D A;  1K73 C;  3HOU H;  1FVI A;  5LMN Q;  1Z47 A;  5AFW A;  2UXC L;  5COY A;  1R9T B;  1IYV A;  4IOC A;  1DOM A;  1C0A A;  1VQO A;  3HOZ B;  1GUO A;  4JV5 Q;  3QOJ A;  1IBM L;  3HKZ G;  3RN2 A;  2JA7 B;  3G71 A;  1LT3 D;  1VQ5 A;  3OMG A;  4POG A;  4A3G B;  1KLG D;  4IPH A;  1LLR D;  2EJM A;  4X65 L;  3QJY A;  1WOC A;  5BN3 A;  4RCN A;  3M3Y B;  2ZJR A;  4K6D A;  2HQL A;  1L0X B;  4KLK A;  3DEO A;  4O2D A;  4DR6 Q;  1B2T A;  3PGZ A;  1Q1B A;  3NEL A;  4FVM A;  2JEB I;  3CCE A;  5E7N A;  1I5F A;  1S5B D;  1BCP B;  1U0L A;  3MXN B;  3VYT A;  4M1U B;  1U4P A;  4YIJ A;  5EBC A;  3GV6 A;  3IAY A;  1PH2 A;  3A7A B;  5E4W C;  3TN2 A;  4QL5 A;  3F1Z A;  3I4M B;  2RKS A;  1B3A A;  1TR5 A;  1B9N A;  1FGU A;  2H5X A;  1EUJ A;  5IP7 H;  3I3C A;  1KRS A;  1PZJ D;  5G3L F;  2K5W A;  4PV1 C;  1EYG A;  4DPG A;  4A3D B;  2X6G A;  4HJ5 A;  4R4Q A;  5AJ3 Q;  2BA0 A;  5IYD G;  2P5Z X;  1LM0 A;  1PZI D;  2AQ2 B;  2RQX A;  4UP9 A;  4BY7 G;  2R7Z H;  4LF4 Q;  2F0Q A;  1RKN A;  2AQ3 B;  3GTM H;  4DV4 Q;  2LXJ A;  5I9O A;  1VF7 A;  2A1A A;  1AN8 A;  4HED A;  3S24 A;  1JOQ A;  1L0Y B;  4EX5 A;  4DR4 Q;  1I6H H;  1E2V A;  1UEB A;  4DF7 A;  2UXB Q;  5CV7 A;  2K5N A;  3CPF A;  1PH9 A;  2PZU A;  3UI2 A;  1CHP D;  2NZO A;  3JAM E;  1HA5 A;  5A2Q L;  3CAM A;  1I94 Q;  4YCU A;  3D4W A;  3T16 A;  1RTO A;  3HOY B;  4DR2 L;  2NUC A;  4QJF A;  4JI3 Q;  4Z9C B;  2AMC B;  2F0V A;  3MXP A;  4BBS H;  1A3T A;  1NNX A;  2N78 A;  1EL0 A;  1WTX A;  2WII B;  1H9R A;  3EBE A;  4PMB A;  2Q2U A;  2MPM A;  3BVM A;  3TRZ A;  1FNU A;  2J7Z A;  4KY7 A;  3KJO A;  1N32 Q;  2FMM A;  2F0O A;  1K0S A;  2E2I H;  2NVY H;  2F0T A;  1XXG A;  4LF7 L;  3NQI A;  3VR4 A;  1XNR Q;  1K8O A;  3CRK C;  1SE4 A;  4B3M Q;  2VL6 A;  2HHH Q;  2UUB L;  1SRU A;  4LF6 Q;  4LF9 Q;  4KY5 A;  2PNR C;  3HKS A;  3D4R A;  4A3B H;  3D6W A;  1EY5 A;  2MQH A;  2RF4 A;  1STA A;  3W2D A;  5I9P A;  1IYJ B;  3RR5 A;  2J4X A;  3D6C A;  1T5X D;  3Q24 A;  2A6H C;  1UAP A;  2DJF C;  2XVS A;  3I2Z A;  5ELC A;  5J1Z A;  4YY3 L;  1PZK D;  4NP5 A;  3T51 B;  1HNZ Q;  1VQ9 A;  1PDQ A;  5G3L D;  1PRT F;  1C8C A;  2K33 A;  3F8T A;  3S1R B;  5KND A;  1SYD A;  4QB4 A;  4DV3 L;  1PA6 A;  1AZP A;  3ND9 A;  3S15 H;  2PMZ B;  1U4L A;  1L1O B;  5M3F H;  3CCQ A;  3T1Y L;  1Q12 A;  3KJP A;  4L5Q A;  4F8M A;  1K0R A;  2K75 A;  5IIF A;  3AFQ A;  1J9O A;  1XMO L;  1GUW A;  4IO9 A;  4QIW B;  5KNC A;  1PLF A;  1LTR D;  4WJ4 A;  1GM5 A;  4V0B A;  5FLX L;  4KKU A;  4GLV B;  3RLN A;  3VR6 A;  1V43 A;  1TWH B;  3AFP A;  4C3J B;  4PZ7 A;  2PQA A;  3AQQ A;  2JP1 A;  4C3H H;  1BNZ A;  3GTJ B;  2B2W C;  2H4O A;  1ML0 D;  1STN A;  4P74 A;  2RCF A;  3HFZ B;  4JI4 Q;  1Q8K A;  1PV4 A;  2CH4 A;  3L0O A;  1N34 Q;  3E5S A;  4UAI A;  1K28 A;  3NBI A;  1LYL A;  3AB9 A;  5EPK A;  2K32 A;  3CD6 A;  5DAU A;  3R8B A;  2AHO B;  5J39 A;  1PFB A;  3J7Z C;  1GD7 A;  2F0J A;  3C1E A;  4AIM A;  3I56 A;  2UUC Q;  5D14 A;  4GOP A;  4HCE A;  1TT2 A;  1X65 A;  5CC4 A;  1WTV A;  2I5M X;  3H0G H;  1S5E D;  2CWA A;  5IGF A;  1I50 B;  5EAY A;  3MVV A;  1UUP A;  4JI8 L;  4XTC S;  1MIU A;  1OXV A;  1AE3 A;  1ZEQ X;  2BE5 D;  4ABN A;  3FDT A;  1G51 A;  1X56 A;  4A3B G;  1IHZ A;  2KOL A;  2KJX A;  4CHT B;  1QUQ B;  3GD7 A;  3K81 C;  2EJG C;  4B3S Q;  5D3I B;  1Q81 C;  1BCP F;  2EPB A;  2VQF Q;  3ERQ A;  4LF8 L;  3SHL A;  1IW7 D;  5D65 A;  4A93 G;  1D2B A;  2JA8 B;  3H09 A;  4ZUJ A;  1QJO A;  1S40 A;  1RD9 D;  2K50 A;  1A6X A;  1W6K A;  2JYO A;  4XQQ A;  1TWC H;  3I91 A;  3MEF A;  2ZTD A;  4KV6 A;  2VUM H;  2EOT A;  3W5O A;  2Z6B A;  3U50 C;  1FD7 D;  1TWG H;  1BKB A;  2CKZ B;  1S72 A;  4ZKB B;  1YZ6 A;  1C7Y A;  1MGS A;  1NMG A;  3MA2 B;  3LNN A;  3TP8 A;  1WD0 A;  3HOU B;  1B7Y B;  3NTK A;  4OEM B;  1N33 L;  3VA5 A;  3D8G A;  3E0E A;  2EXD A;  1CKM A;  2B2V C;  4C3H G;  5DM7 3;  3F2B A;  1D7Q A;  1VQ7 A;  2KHS A;  4DAV A;  1Y8O B;  5IP9 G;  4DV7 Q;  1AZQ A;  1FR3 A;  4R9W A;  3JAM i;  1KAA A;  4B3R L;  1BBW A;  2GN5 A;  4HCS A;  5M5X H;  3LX0 A;  1IKL A;  4B9W A;  4CDC C;  3TZD A;  2NVX H;  1BUV T;  5C0X H;  1A3V A;  2UXC Q;  2RHS B;  3ONA B;  3BVG A;  3K5M A;  2MO0 A;  1K3B C;  3GV3 A;  3BZD B;  1HUM A;  2DUD A;  5E3F A;  3J81 c;  1BBX C;  2H1E A;  2PMZ E;  1HNW Q;  2QIL A;  2L55 A;  1JOO A;  3HOZ H;  4QIW E;  3KF8 B;  4NPS A;  3NBH B;  2EY5 A;  4A3E H;  3L9A X;  1B3Q A;  4G7H C;  1M1K C;  3HOV H;  4A3G H;  2D9U A;  4FXD A;  2X6L A;  3MXG A;  1XX8 A;  1EEF D;  2O2L D;  1O7I A;  3U58 A;  3D4D A;  3M3Y H;  3BU2 A;  2F0P A;  1SRO A;  3K58 A;  4IPC A;  2R7Z B;  4L5R C;  3GTM B;  1NUC A;  4JG2 A;  3TP7 A;  3C46 A;  3TEH B;  2R6G A;  2JXM B;  2F0S A;  2D5D A;  4N9P A;  3BYT B;  4DR1 L;  4JBM A;  2EJF C;  1SNC A;  1K8A C;  1D1K A;  4CBV A;  1I6H B;  4DR7 L;  2VUM G;  4K5W A;  3I90 A;  2DY8 A;  5C4X B;  3I7F A;  1A0I A;  2IHF A;  4C56 C;  1E2W A;  3I8Z A;  1IXR A;  4NB3 A;  5BN4 A;  2JA6 H;  4ID6 A;  1EYC A;  2QCP X;  2Q2H A;  3SK4 A;  2F52 A;  2PO4 A;  2Z6K A;  1SND A;  2JK8 A;  4LFA L;  4BBS B;  1STY A;  1I4G A;  3SE0 A;  4HJ8 A;  1JMC A;  4NXM L;  4DUZ L;  2RBM A;  2WB1 B;  2RDG A;  4UDU C;  1FNW A;  2ASB A;  2KCT A;  4QQB X;  4JC0 A;  5C5M A;  5C0X G;  1PFN A;  1SMX A;  1G8Z D;  1Q1E A;  3MTS A;  4DR2 Q;  1G2T A;  3HEJ A;  1AFP A;  3G4S A;  1SN8 A;  3KYH C;  1K9M C;  3DWA A;  3A5Z B;  2AKW B;  5EPJ A;  1VQM A;  4IFD J;  1D1I A;  1LTS D;  4A4I A;  5JJK A;  1SNO A;  3OIP A;  2C5C A;  2DGY A;  4YHH L;  2YTV A;  1WTP A;  3HOZ G;  4JI6 L;  1X3G A;  2JA7 G;  4A3E G;  3X3M A;  3NTH A;  1PTO H;  5IE8 A;  1SEB D;  3KBG A;  1YJN A;  4A3G G;  1VQF A;  1EZ6 A;  4DN4 M;  4LF7 Q;  1MKH A;  4A76 A;  3WOF A;  1F2Z A;  4MN3 A;  2X69 A;  1X3E A;  4F88 A;  1VQN A;  4KHZ A;  3D31 A;  3TS2 A;  1EIG A;  3FPP A;  1VQ8 A;  2A6H D;  4LNQ A;  5ELN A;  4GKJ L;  2K01 A;  5EPL A;  2Q2T A;  1CSP A;  4GLX A;  4XYO A;  3S15 B;  5M3F B;  1JCK B;  2F0L A;  1YJW A;  1Y1W B;  3ULP A;  2D2C C;  2ZM6 L;  1V1Q A;  3S9W A;  4B9X A;  4IFD G;  3K0X A;  1EQT A;  4DV0 L;  4AQY L;  2KED A;  2ZT9 C;  2CQO A;  3I4M G;  1E7Z A;  3PSI A;  1RJT A;  2RSO A;  1K8G A;  4FF2 A;  2LKV A;  5D3D A;  3CCM A;  2J0T D;  1L1O A;  4DU9 A;  3J80 c;  5K36 H;  1BXT A;  1I4H A;  4C3H B;  1G6Z A;  3LWU A;  3BVZ A;  3T1Y Q;  2QF7 A;  4BY1 B;  3KDF A;  3K7A H;  3DWQ A;  4LJZ C;  4X3S A;  1F2M A;  1HPC A;  1EY6 A;  2YYZ A;  2OCE A;  5C4Z A;  3RN5 A;  1SJH D;  1MI2 A;  1EFW A;  1Y14 B;  1AW7 A;  2B2Y A;  2PQA B;  1STG A;  1LTA D;  3A74 A;  2M2L A;  5ELB A;  4RGM A;  1GVP A;  4DXG A;  1JB7 A;  1V1O A;  3DM3 A;  3H0G B;  3QG1 A;  2L15 A;  2R61 A;  3V05 A;  2UU9 L;  4JI7 L;  5BN5 A;  2OTJ A;  4KKT A;  3HOY G;  2KCC A;  4G4K A;  2V4D A;  3GTJ H;  2MUY A;  1Q7Y C;  3H3V I;  5A2Q E;  1WTR A;  1PH4 A;  3UE1 A;  1SE3 A;  2K7V A;  2GA4 B;  1OXT A;  4IUV A;  5LHY 1;  2F0F A;  3E0J A;  5EQ0 A;  4JI8 Q;  2OTL A;  2FXQ A;  2L9H A;  3OPO A;  4LK1 C;  1QUQ A;  2LMC B;  3CC4 A;  2N55 A;  2NVQ B;  4YWL A;  4GOP C;  1HZC A;  5JVH 3;  1I50 H;  4IUR A;  5IT9 L;  4BA2 I;  1RL2 A;  2YTX A;  1CKO A;  2D62 A;  2HUG A;  4LF8 Q;  1F9P A;  3J81 j;  1MSG A;  2AWN A;  4IQZ A;  4X3T A;  1GUS A;  2KCN A;  1UEA B;  5K36 G;  1PRT C;  2A68 C;  4K0K L;  4C1N I;  1U9R A;  4JYA L;  1PVO A;  4DV5 L;  4G7O C;  3T13 A;  2I0Q A;  3BDO A;  2IX1 A;  1QG7 A;  2A6E C;  1IBK L;  2ALY B;  1SYB A;  4XQN A;  1D6E C;  4IUP A;  4RMF A;  3GTQ B;  2NVX B;  4NXN L;  1N33 Q;  1OXU A;  2BA1 A;  5IGG A;  3I4N H;  4CKB A;  3X3N A;  1KAB A;  3NK9 A;  1L0W A;  1KDB A;  2RDF A;  3B6Y A;  2R92 B;  1HNX L;  1EWH A;  1YHB A;  3SDZ A;  3H94 A;  2G9D A;  4C3J G;  4B3R Q;  2K4K A;  2IPK D;  5FLX E;  1V8Q A;  3GO5 A;  4A3E B;  3FMC A;  1U4R A;  3HOV B;  1Y1V B;  2NTT A;  4CDE C;  1TWA B;  3T1H L;  1SFO H;  1KXL A;  2K05 A;  3I70 A;  2RSN A;  3MFG A;  1LAB A;  5C3X A;  1KDA A;  2Z1C A;  3GTK H;  4HR7 B;  4K8I A;  3KF8 A;  1LTG D;  1LV9 A;  1ZKO A;  2OXP A;  3NBH A;  1SYG A;  1BOS A;  5FO7 B;  3NQT A;  4K5X A;  3BDC A;  1PHJ A;  3QOL A;  2NVT B;  1ZYR C;  1QVF A;  1Z7T A;  5M5W H;  3H6M A;  1WCM H;  5IGB A;  3V96 A;  1CHQ D;  1V1P A;  3QWN A;  4V19 0;  3R2I A;  1PYW D;  4P72 A;  3Q23 A;  4A3F H;  1BCP C;  1X32 A;  4A3J B;  2A8V A;  5LMU L;  4NDX A;  2JA6 B;  1N36 Q;  2Z8L A;  2A73 B;  5JVG 3;  1T5E A;  3IKJ A;  2B29 A;  5DM6 3;  5CV4 A;  4DR1 Q;  2MNA A;  1GJX A;  1TWF H;  5IGC A;  2JA8 G;  3FKI B;  2WFW A;  4P73 A;  4DKA C;  2WKC A;  1ZXT A;  3VYS A;  5CMD A;  1QNK A;  5C3W A;  4UY8 C;  3M4P A;  3KLS A;  4JI5 L;  2DY7 A;  3HG9 A;  2E76 C;  4EQP A;  1EYD A;  1PYB A;  2PCF B;  3OTO L;  2QA4 A;  5IGD A;  4A3K H;  4MTN A;  1B70 B;  1RIP A;  5C4X H;  1JWS D;  1GO3 E;  3K59 A;  2KBN A;  3L7Z C;  4PMC A;  2NN6 I;  1HTL D;  5C4J H;  1X3Q A;  3HOU G;  2HCC A;  1AP0 A;  5CV9 A;  4DUZ Q;  4WOR A;  2RCN A;  3J7Y W;  1B4O A;  1VQB A;  1XTC D;  3WOE A;  4L5S A;  3FP9 A;  1RHP A;  4A3M B;  2Z6K C;  3AYH B;  3QR8 A;  1PTO B;  4X62 Q;  2L11 A;  4L5T A;  4DAY A;  3FRP B;  5NUC A;  5LL6 S;  1PH7 A;  1GOZ A;  4X3K A;  4QUC A;  4RHR A;  4ZUI A;  3CMA A;  4UHV A;  1CSQ A;  4IAL A;  5I2X A;  4X66 Q;  1XMQ L;  1DD2 A;  3VR2 A;  2K5H A;  3NEN A;  1PTO C;  1VMC A;  3F2U A;  4U68 A;  3WDN A;  5JJZ A;  4JI6 Q;  2KQ3 A;  1FGB D;  5FO9 B;  1G6P A;  3G48 A;  3R3O A;  1EU4 A;  1HZA A;  4P71 A;  1E0B A;  1QNU A;  1EIY B;  5IY0 A;  1XNQ L;  1H95 A;  4MZ9 A;  4A3L H;  3DUZ A;  3L2P A;  1Y69 U;  1HH2 P;  4O42 A;  1DXM A;  2EYM A;  5IP7 G;  4KN7 C;  1A2T A;  1C48 A;  4GN5 A;  2Q8I B;  2K6A A;  3VR5 A;  4IOA A;  1D5M C;  1CKN B;  1TS4 A;  3CCL A;  1KQS A;  4DV2 L;  4FF1 A;  1NR2 A;  2WAQ B;  4OX9 Q;  1VQG A;  5C44 B;  2ZM6 Q;  2R7Z G;  5M3M H;  1VQL A;  1PH6 A;  2JA5 H;  3TP6 A;  1NAP A;  3K7A B;  5FLM H;  1W2B A;  4H02 A;  1NTG A;  4AQY Q;  4KHV A;  1N8R C;  1PH1 A;  1GUT A;  1Y1W H;  3IFD A;  1LTT D;  2E75 C;  4O0A A;  3TDQ A;  1YNJ C;  1A62 A;  2XRQ D;  4QY7 A;  5C4X G;  2XTI A;  5FK9 C;  4F7X A;  4DV6 L;  4FYD A;  4JOI A;  3KDF B;  4R8I A;  3RUZ A;  1L1O C;  2KCM A;  1XPR A;  5KYL A;  1O7Y A;  1EU3 A;  3NXW A;  4BBS G;  3H91 A;  2C9O A;  1QOH A;  1SNQ A;  4KKS A;  4BY1 H;  3ERS X;  4ILW A;  3KOJ A;  4RGT A;  4RKL A;  2LY7 A;  4HID A;  2VW9 A;  2CWP A;  2WB1 G;  2KUM A;  5E1F A;  5BR8 L;  1BVS A;  2A74 C;  4JBW A;  4CKE A;  3RD4 A;  1E22 A;  1EY9 A;  2F0N A;  4U67 3;  1II3 A;  2E5L Q;  4DNR B;  4JI1 L;  2B2Y C;  1B1Z A;  2OT2 A;  2B2T C;  2QEJ C;  1DZ1 A;  2EZV A;  4HSV A;  3PIP A;  1HRJ A;  1GHJ A;  3H15 A;  3EFX D;  3C2P A;  3DEP A;  3P20 A;  1O78 A;  4AYB B;  3GP7 A;  3EA6 A;  4QUF A;  1DYQ A;  2G5D A;  4LFC L;  4RHS A;  4B3T L;  3JAM c;  1W6J A;  4HAE A;  4C3I H;  1HTP A;  1EWC A;  2ICE C;  5EJW A;  1E1O A;  2BH8 A;  4DR3 Q;  1FJG L;  4DNT B;  4IJH A;  1SLJ A;  3GTP B;  4RGN A;  3CCJ A;  2NBF A;  2ICI A;  1A15 A;  4A3I H;  3GTL B;  4X6A H;  3SK8 A;  2AUJ D;  5IYB H;  1MSH A;  1CM9 A;  1CT1 D;  3CQZ H;  1X3F A;  4OIK A;  5FLM G;  3NPP A;  1PRT D;  2NVQ H;  2A68 D;  2Z9H A;  3TRE A;  2VNU D;  2VS1 A;  1VQJ A;  4LUZ A;  5M3F G;  1EOV A;  4OHJ A;  5KIX A;  2YU9 H;  1Y1W G;  3I4N B;  2CH4 W;  2A6E D;  2F3I A;  4GN3 B;  5FJ8 H;  5IGE A;  3MEH A;  2QDB A;  3RZD H;  3MZ5 A;  3W1B A;  2F0W A;  1F9S A;  3BDL A;  2A69 C;  4RG1 A;  5CV8 A;  4EGV A;  2KHI A;  5CBA E;  4ME5 A;  3RLF A;  4LFB L;  2YV5 A;  2L1B A;  3WWV A;  2ZJP A;  5C5L A;  2SOB A;  4WFN 3;  4NXN Q;  4JI0 Q;  4DV1 Q;  4XYQ A;  1SFO B;  4BY1 G;  1LO5 D;  4S3S A;  2PNH A;  4UP7 A;  5KYI A;  2RHQ B;  2ES2 A;  5A35 A;  3CKI B;  3GTQ H;  2XRS D;  1Q82 C;  3GTK B;  2WAQ E;  1FYC A;  2DN8 A;  4KMU C;  5JPM C;  3H3V H;  1HNX Q;  4H44 C;  3E9H A;  1TS5 A;  1TVX A;  4LW1 A;  4QMG A;  2K28 A;  4IJL A;  1JJC B;  4BXX H;  4MTK A;  4HJ9 A;  3A55 A;  3SK5 A;  2F4V L;  4DR5 L;  4F87 A;  1IBM Q;  5LMN L;  1M4V A;  1PTO F;  3H0G G;  1F77 A;  2R92 H;  5M5W B;  1V9P A;  1J8I A;  1TII D;  3W1G A;  5EGT A;  3T1H Q;  1SNP A;  5CR3 A;  3AEV A;  5M5Y B;  4X65 Q;  3PO2 B;  3CU7 A;  4JV5 L;  1WCM B;  3KF6 A;  1KAW A;  2JJQ A;  3M85 A;  2MFI A;  1B8A A;  4JCV E;  1O7L A;  4A3F B;  1ZYR D;  1UWV A;  4ZAI A;  2XNA C;  4A3C H;  1Y1V H;  1TWA H;  4A3I G;  1T9H A;  1JOK A;  1S3O A;  2R3Z A;  4IUQ A;  4KJO A;  5IYB G;  2K1B A;  4DR6 L;  1BCP D;  1TWF B;  3BG3 A;  1KHI A;  1CK1 A;  2Y0S B;  2EY1 A;  3ZJY C;  1V1P B;  3J80 E;  1VS0 A;  1WI5 A;  1YHQ A;  3VA7 A;  1OXS C;  3IL8 A;  3PO3 B;  4DAP A;  3S2H H;  3UDF A;  2E2H H;  2NVT H;  5LMU Q;  5C0X J;  1VF5 C;  4A3K B;  4BS9 A;  1QE6 A;  5FJ8 G;  1A2U A;  1TS3 A;  3UE0 A;  5JAV A;  4IZ8 A;  2LS0 1;  1SMY C;  4NKL A;  5C4J B;  5IT9 E;  5FKA C;  4AYB E;  4YCV A;  4A3J H;  2BCO A;  3J81 L;  2QKI C;  4RGO S;  4DFA A;  1QCB D;  2XWB B;  3R93 A;  2K5V A;  2AWO A;  1E3P A;  1JB3 A;  2UXD L;  2B3G A;  4LF4 L;  3A0J A;  1JC7 A;  1S4Z A;  5CV6 A;  3OTO Q;  3S17 H;  3FKI H;  3HOW B;  2EDG A;  5HGT A;  1AE2 A;  3J7A V;  1KL9 A;  1XTD A;  3R2T A;  2HCI A;  4KI0 A;  5JJI A;  5JEA H;  4R4O A;  1VQI A;  2UXB L;  2K04 A;  3J81 i;  1ENA A;  1W3S A;  4CDD C;  2K03 A;  5M9O A;  3U4Z A;  4TKO B;  1E24 A;  3OWF A;  2XN9 C;  4DAY B;  2R92 G;  2BOS A;  1GKH A;  1PTO D;  3U9S A;  4ZK9 B;  1A63 A;  1K3R A;  3SVM A;  2F0G A;  4K2K A;  1UE5 A;  3BYY B;  2F0E A;  4A3M H;  5I2Y A;  2PI2 A;  1NR4 A;  3HOV G;  1Y1V G;  3PIO 3;  1SSO A;  1DCZ A;  2JE6 I;  4WRD A;  2DNE A;  1OXX K;  1WTW A;  3EN2 A;  1N32 L;  2OEO A;  1CTM A;  1D5X C;  2TMP A;  5M3M B;  2UUB Q;  1HJP A;  1WJJ A;  3C3L A;  2KEN A;  4LUV A;  2JA5 B;  3NP8 A;  2VZA A;  2OWO A;  4K14 A;  1HR0 L;  2B8G A;  2CQA A;  3OIQ A;  5EKL A;  4DK6 C;  1CKN A;  1PYS B;  2F0K A;  4LF6 L;  4LF9 L;  2PZT A;  1EQQ A;  2UUA L;  1HZ9 A;  3UDG A;  1ICF B;  1JWU D;  2EYP A;  5KGU A;  4YY3 Q;  4Y52 H;  2K52 A;  3E9I A;  4DV2 Q;  4O1N A;  2B2U A;  4DGZ A;  1VQ6 A;  3HOX B;  3AMU A;  3DM1 A;  1TY2 A;  5C3E H;  4A3J G;  2ZJQ A;  1MHW C;  4PZ8 A;  2JA6 G;  1YNJ D;  4MIU A;  3P75 A;  3ICE A;  4POF A;  4DV3 Q;  1HNZ L;  4JBK A;  1SYE A;  5C44 H;  1YNN C;  2I46 A;  2NN6 H;  4L8J A;  2D0O A;  1OTC A;  3FKI G;  3HP3 A;  2L0C A;  5DLQ E;  1XMO Q;  1HA6 A;  1MJE A;  2Z0S A;  3NE5 B;  3K6O A;  3ITP A;  2O5I C;  4PQX A;  5JEA G;  3ND8 A;  5IOC A;  3KFU A;  1Y8N B;  2I5L X;  2KHJ A;  1F9Q A;  2IHE A;  2Y0S E;  1KNE A;  1TU2 B;  4DAM A;  3SK6 A;  2Z4I A;  1P16 A;  4APV A;  1J5E L;  1CI3 M;  4JOI C;  2NWG A;  3L3O C;  3E6Z X;  2OF1 A;  3EJI A;  2ENB A;  3FEW X;  2B8F A;  4GNX A;  2QW7 A;  1I4R A;  4C3I B;  4HIM A;  1IKM A;  4JI4 L;  3MWY W;  3QB3 A;  2IJ0 A;  4A3M G;  2NB0 A;  2WV6 D;  4JI1 Q;  4FXG C;  1ROD A;  4LUO A;  4A3I B;  1EQR A;  1TQO A;  3J80 L;  1NBW A;  1JJG A;  5FO8 B;  1X54 A;  3CQZ B;  4Y7N B;  3ULL A;  1TKW B;  4IPG A;  1VQH A;  2WB1 E;  2E74 C;  1FJG Q;  1WVL A;  4DK3 C;  2BDN A;  2YU9 B;  2JEA I;  2JN4 A;  3KLW A;  2HIV A;  2KA7 A;  3NHH A;  4K8J A;  1XYI A;  2SNS A;  3RZD B;  3MXU A;  1QWY A;  3J80 i;  5I4D A;  4R1J A;  1QZG A;  1VQC A;  3GTP H;  4B3S L;  4GKK L;  5C3E G;  1H9K A;  3NSW A;  2VQF L;  1KDC A;  1VMP A;  3GTL H;  4FXK C;  1F2Y A;  2Q2I A;  2WAQ G;  3CRL C;  1G91 A;  2A69 D;  1WTO A;  1Z9F A;  1U4M A;  5C44 G;  2NN6 G;  1PFS A;  4G57 A;  1F2L A;  4UP8 A;  1IBL L;  3DXJ C;  2JSO A;  1BF4 A;  2VB2 X;  3PUV A;  4J6H A;  4ZYS A;  5FOB B;  3S14 B;  2E2J B;  4KN4 C;  3NWS A;  3NTI A;  4R8N A;  5KEE A;  4I7Z C;  3UDX A;  5C4H A;  3DLL A;  4XT1 B;  4XT3 B;  4OO1 I;  2MGS A;  2NTS A;  4CKC A;  2NYZ D;  1VQA A;  3M4Y A;  5I6Y A;  4J1M A;  3NEM A;  4JK1 C;  5JJL A;  1HCZ A;  3PUY A;  3K57 A;  1JQY D;  1K83 H;  3H3V C;  2JQO A;  3K80 C;  5COR A;  4KHP L;  2LSS A;  2B63 B;  1Q3L A;  4K2L A;  4E6I A;  2FMC A;  2I5H A;  2PW7 A;  4PMW A;  3TSS A;  4WJ3 M;  1YI2 A;  2FFK B;  3I73 A;  2F4V Q;  1YIJ A;  4DR5 Q;  1STE A;  3CF5 A;  2VQE L;  2F1M A;  4HMI A;  3KF6 B;  3EVQ A;  2HDM A;  5DEH A;  3RZO H;  1EEI D;  1Q86 C;  1G2S A;  4JI2 L;  1I4Q A;  1LT5 D;  3ERO A;  1HNW L;  2EE1 A;  3S2H B;  4AYB G;  1IL2 A;  4CGY B;  2E2H B;  5KNB A;  4ME3 A;  4BA1 I;  5M5Y H;  3PO2 H;  1PH5 A;  1BDO A;  4RAU C;  4N9T A;  4TSS A;  1DON A;  4GS3 A;  2F0M A;  3GQB A;  2IW3 A;  2MHV A;  3U9O A;  4IN3 A;  4HMJ A;  5F2D A;  4TQU S;  4HIK A;  5KRU A;  3SR1 A;  1SMY D;  5I6W A;  4EQO A;  1B50 A;  2A19 A;  2F0I A;  1XJV A;  4I7A A;  3D3R A;  4DR7 Q;  3S17 B;  3M4O B;  3SEB A;  4M8A A;  3GDE A;  4RFB A;  2FIN B;  2HD3 A;  1JR0 D;  3PO3 H;  2M00 A;  4ODG A;  1DGS A;  1JIC A;  5LL6 X;  2IWH A;  3I4N G;  2K5Q A;  1PH8 A;  3P7J A;  2UXD Q;  4QF4 A;  4LFA Q;  5GAG C;  1EZ8 A;  2N3S A;  1TS2 A;  5J22 A;  2SNM A;  1QIL A;  2ZXO A;  4NXM Q;  1S5D D;  1PFM A;  1ILP A;  2EXZ A;  4RWS C;  1N9W A;  3K5O A;  4JPB W;  2E8G A;  4XXE A;  4XDX A;  3G7L A;  2QEX A;  1ESF A;  3KK7 A;  3HOW H;  1CZW A;  1LTB D;  1ET6 A;  3G6E A;  3KUP A;  1EIH A;  3C1F A;  3J7A F;  1YHA A;  4GLA C;  3SXH A;  1WTH A;  2EQS A;  3N52 A;  5ELF A;  2MJ8 A;  2KEC A;  3K0Y A;  5J3B A;  1YNX A;  4YHH Q;  3V2T A;  1EFI D;  1NJI C;  4XIG S;  1IZ6 A;  3QO2 A;  1VQK A;  3MAQ A;  4C2M H;  2A5H A;  1EY8 A;  1UNS A;  3FVQ A;  3KLS X;  1YIT A;  4ZLT F;  2HQE A;  1ENF A;  3BJU A;  3PO2 G;  3I55 A;  1WCM G;  1SNM A;  1X55 A;  4NMZ A;  3N6R A;  4QGU A;  5C3E B;  4A3F G;  4IUT A;  1RF2 D;  5FLX c;  2YTY A;  4GKJ Q;  5CBE E;  4LF5 L;  2R93 H;  1HR0 Q;  3E3X A;  1EYA A;  3S1N B;  3A56 A;  1JE5 A;  1RTN A;  3OSO A;  4KD4 A;  1S5C D;  1STB A;  4G7Z C;  1JE4 A;  2XWJ B;  3CCS A;  4K6L A;  3J7A 5;  5HY6 A;  3GTO B;  3OHX C;  2UUA Q;  3W3A A;  2Y0S G;  2ZTC A;  4DV0 Q;  1E1T A;  2OQK A;  1LT6 D;  1BO0 A;  4OL7 A;  1TXY A;  2EY6 A;  4X64 L;  3PO3 G;  1YNN D;  3RMH A;  1CQF A;  2EYJ A;  2F3W A;  4CJ2 C;  4PZ6 A;  3G6J B;  4ZRZ A;  2AUK A;  1ICW A;  4A3K G;  3CC2 A;  4A93 H;  3PMF A;  2CFM A;  4KJN A;  4MNO A;  3HOX H;  4BBR B;  2B2U C;  3FPU B;  1KIX A;  1HFN A;  4R4I A;  5ELO A;  4OON A;  2GVA A;  2Q8T A;  2L4N A;  3CXC A;  1FL0 A;  1M8A A;  3PIP 3;  3S16 B;  3K5L A;  1STH A;  2F4I A;  3GTG B;  3S2D H;  1XWE A;  3A8J E;  4I65 A;  2WP8 J;  2L12 A;  5EKI A;  2PYK A;  3J81 E;  4L63 B;  2F0D A;  1VDZ A;  2ID0 A;  4WJW A;  3HOW G;  3K7U C;  4YCW A;  1ILQ A;  2VY3 A;  1HZB A;  4KD3 A;  3EQL C;  3CP0 A;  2UU9 Q;  1J5E Q;  4JI7 Q;  3OWE B;  4GNX B;  4DUY L;  3BZC A;  2Z4H A;  1WD1 A;  3HKZ B;  3LGJ A;  4ALP A;  4HIO A;  5IP9 H;  2F3V A;  1I3Q H;  3SGI A;  3D0F A;  1O7Z A;  1X3P A;  2JA9 A;  2O4X A;  3EIV A;  1K8M A;  3RLO A;  3T56 B;  4GNX C;  4FO2 A;  1DM0 B;  2LFN A;  1L2F A;  4A3L G;  4JBJ A;  3VDY A;  1OO9 B;  1UE6 A;  1SJE D;  1KD1 C;  3STB C;  3ER0 A;  3BZK A;  1TY0 A;  1CFM A;  1NSN S;  4FF3 A;  2R93 G;  3S1M B;  4ZKC B;  3KBX A;  3LWE A;  1SAP A;  1XPU A;  5CGK A;  1NE3 A;  2GVB A;  1DOL A;  4FF4 A;  1PXU A;  4Y7N H;  5M3M G;  4J8Q A;  2ZXR A;  5GAH C;  2JA5 G;  1EY0 A;  1H9S B;  2CW0 C;  4TVA B;  2RVL A;  1HUN A;  2QDL A;  4PNY A;  1EWI A;  4HJ7 A;  4GKK Q;  1SYC A;  1P8L A;  4GN4 B;  1MD2 D;  5HGQ A;  4K0K Q;  4BY7 B;  4H0L C;  5IWA L;  2B39 A;  4JYA Q;  4MHE A;  4DV5 Q;  2V1C C;  3I4L A;  3HOX G;  2PI2 E;  2IT1 A;  2OQ0 A;  1LUZ A;  1K83 B;  1GUN A;  1ONL A;  4N8F A;  1IBL Q;  1M90 C;  1IBK Q;  3CPW A;  2F0H A;  1WFQ A;  4R4T A;  2TSS A;  4Q0F A;  1UE1 A;  1A3U A;  1LTL A;  3JAM L;  3S1Q H;  1VCI A;  2N88 A;  3U4V A;  2CVR A;  4P75 A;  4HJA A;  1NY4 A;  2HDL A;  4P2C B;  2WAC A;  2IX0 A;  3PUX A;  3S14 H;  2E2J H;  1KRT A;  3DHQ A;  1EQV A;  1Y8P B;  2HT1 A;  2N8N A;  1AH9 A;  4KHP Q;  3RZO B;  1C9O A;  4K5V A;  4RCO A;  2CCZ A;  5GRO A;  3Q22 A;  3CW2 C;  1VQD A;  1ASZ A;  2EVB A;  3M4Q A;  2EIF A;  1QVC A;  2E2D C;  4TRD A;  1JT8 A;  1SR3 A;  5TSS A;  2B63 H;  1PH3 A;  1RCV D;  4C3I G;  2VQE Q;  2EYO A;  1Q90 A;  2IY5 B;  1EIF A;  3PV0 A;  4RH6 A;  2K14 A;  4JI2 Q;  1CA5 A;  3PQI A;  4ZCK A;  1DJR D;  1R9T H;  5HUR A;  3ZYY X;  1R4Q B;  1JJ2 A;  3CHB D;  1I4P A;  3OOC A;  1D5Z C;  2VB3 X;  2JA7 H;  1SE2 A;  4EQN A;  3MXN A;  5LMN W;  3PCO B;  3RNU A;  5GQO A;  4RA8 A;  2LXK A;  4FDB A;  2DJG C;  1B9M A;  4DA2 A;  1WTQ A;  3T53 B;  5E4X A;  4XQJ A;  3HKZ E;  4DXF A;  1BBU A;  3A8K E;  1H9J A;  4QCL A;  3OW2 A;  1N36 L;  3VR3 A;  3T4A C;  1S5F D;  4CJ1 B;  3P1H A;  1AEX A;  4OO1 H;  4KTA A;  5AJ3 L;  2WIN B;  4JI5 Q;  4PG3 A;  2KVM A;  2HIX A;  4IFD H;  2EYH A;  3M4O H;  1SDF A;  3IRB A;  1ENC A;  4DV4 L;  4CDF C;  1SE8 A;  3PF5 A;  3I4M H;  2XIW A;  1IYU A;  4H13 C;  4OIJ A;  1Q8I A;  2AQ1 B;  1B44 D;  3TME A;  2BH2 A;  4DR4 L;  4NW2 A;  5GAD C;  3BS1 A;  2ZXP A;  4RKB A;  2N49 A;  4IUN A;  5IOD A;  5GAE C;  3CME A;  4BXX G;  4A3D H;  4GZY C;  2L5T A;  5C6A A;  2KEE A;  3K5N A;  1I94 L;  5EKK A;  1X9N A;  4C2M B;  3K8A A;  4HTH A;  5K5P A;  3AU7 A;  1ESR A;  4HSP A;  4ULL A;  4JI3 L;  1LTI D;  2XSC A;  3VYR A;  3CCU A;  2B63 G;  2SDF A;  1E2Z A;  4IUU A;  4X62 L;  1VQE A;  1XMQ Q;  1I6V C;  3MFY A;  2E2I B;  2NVY B;  3JC6 6;  2WKD A;  1BQQ T;  1NCV A;  4A3C G;  3CCV A;  4OEL B;  1PMR A;  2R93 B;  1ASY A;  3TBI B;  3M7G A;  2RDH A;  4Q5V A;  4X3U A;  1WYD A;  4X66 L;  5DNF A;  5CV5 A;  4A75 A;  3UDI A;  3HOY H;  1XNR L;  3A7L A;  2EYF A;  3Q6S A;  4A3B B;  4ZQ3 A;  1XNQ Q;  4FP5 D;  4B3M L;  3HRZ C;  1LAC A;  2HHH L;  1HHV A;  2NZ1 D;  1GUG A;  5JEA J;  2RA4 A;  1R4P B;  1GXD C;  5T1I A;  3CC7 A;  1G29 1;  3A54 A;  4LF5 Q;  2R7F A;  3TQY A;  4A93 B;  3NWT A;  3QIA A;  4R4C A;  3F2D A;  4LAA A;  3NUC A;  3O13 A;  3PUW A;  2D0P A;  1GHK A;  4OO1 G;  2FHT A;  1C4Q A;  4OX9 L;  3S1N H;  4DK1 A;  3S2D B;  5JPN C;  5JOB A;  4X64 Q;  3OMC A;  3TS0 A;  4EQ5 A;  1SBB B;  3PIO A;  3GTO H;  3MC0 B;  5EBD A;  2IX3 A;  1DOK A;  2CHB D;  4C1N K;  4OWW B;  2I07 B;  1UE7 A;  1Q46 A;  4KY6 A;  3M9B A;  4DNI A;  1HR0 W;  1YBY A;  1NMF A;  4DV6 Q;  1XPO A;  5IYC H;  1KC8 C;  2XGT A;  2B2W A;  3TZU A;  4A3D G;  1U5K A;  2FJ2 A;  2PZW A;  3Q0A A;  4YWK A;  1HXY D;  4LMQ D;  3M7N A;  1X6O A;  1HQM C;  1I3Q B;  2MO1 A;  4BBR H;  1FNV A;  3F2C A;  3S1R H;  4J15 A;  4L6T B;  5ELE A;  1A8V A;  2F0U A;  4KK7 A;  5IT9 c;  2ZTE A;  3PF4 A;  5L37 A;  5BR8 Q;  3S16 H;  1H9M A;  3MHB A;  3GTG H;  1SYF A;  1J6Q A;  4EVO A;  1YEZ A;  4CJ0 B;  1N34 L;  2B2T A;  1D8L A;  2PQE A;  3FHW A;  2G9H D;  5ELD A;  4DUY Q;  2M9V A;  3CCR A;  3ULJ A;  1SXT A;  1CZG A;  1IL8 A;  1CQV A;  2E5L L;  4OXP A;  4AH6 A;  3STB D;  1EY7 A;  1MBY A;  1KLU D;  1TWH H;  5H1S E;  2UUC L;  4C3J H;  2Q8R E;  4LFC Q;  2VXW A;  4B3T Q;  1JOR A;  1VQP A;  3Q8D A;  5C0X I;  4JW0 A;  1JWM D;  3HZX A;  3I72 A;  2O5J C;  4GOP B;  5CYU A;  3HGB A;  5T1G A;  4N8X 1;  3A5U A;  4BWG B;  2CW0 D;  2NZH A;  4DR3 L;  3URY A;  1YVC A;  1H9S A;  1Z6H A;  4DK0 A;  1I4X A;  1QZH A;  3DWP A;  2BE5 C;  2PPB C;  4B08 A;  2EYL A;  4UPA A;  2SEB D;  2R7D A;  3TP5 A;  1HQR D;  1O80 A;  1F9R A;  4H7B A;  3S1M H;  3PUZ A;  3DMU A;  3OW7 A;  1TWC B;  2C35 B;  3HS0 C;  2PW5 A;  1EY4 A;  1PRT B;  1LT4 D;  4JVZ A;  1CUK A;  3S1Q B;  1KTK A;  2VUM B;  1RDP D;  1TWG B;  1QVG A;  1IW7 C;  5IWA Q;  2EY2 A;  1B53 A;  2MP1 A;  2BDO A;  1VQ4 A;  3A8I E;  1ET9 A;  4OGQ C;  2F03 A;  5IYC G;  4HN7 A;  2B2V A;  1EOT A;  1YJ9 A;  4LFB Q;  5IYD H;  4BY7 H;  2QGQ A;  2ATW A;  1BR9 A;  4IPD A;  2JA8 H;  4IFD I;  1HFG A;  4LWC A;  4OWX B;  3IFT A;  4BBR G;  5ISR A;  1CA6 A;  4OWT B;  3KLR A;  5M5X B;  3VYU A;  4FNF A;  2DNC A;  4JI0 L;  4DV7 L;  1KNA A;  3I4O A;  4YWM A;  4DV1 L;  1MJC A; 
#chains in the Genus database with same CATH homology
 2WAQ E;  5HY6 A;  3H3V H;  2UUA Q;  1HNX Q;  3E9H A;  2Y0S G;  3OYY A;  4LW1 A;  3ULP A;  1YJW A;  2ZTC A;  2ZM6 L;  1E1T A;  1FVI A;  1V1Q A;  1JJC B;  4IJL A;  1Z47 A;  2OQK A;  5LMN Q;  4DV0 Q;  4HJ9 A;  4BXX H;  4IFD G;  1TXY A;  2UXC L;  3K0X A;  4X64 L;  4GLX A;  2F4V L;  3PO3 G;  4DR5 L;  4AQY L;  4DV0 L;  1IBM Q;  4IOC A;  2CQO A;  5LMN L;  3I4M G;  1E7Z A;  3H0G G;  3PSI A;  1K8G A;  1C0A A;  1VQO A;  4JV5 Q;  2R92 H;  4PZ6 A;  1V9P A;  3HKZ G;  3RN2 A;  3W1G A;  3CCM A;  3T1H Q;  1L1O A;  4A3K G;  3G71 A;  3J80 c;  1VQ5 A;  3CC2 A;  4X65 Q;  3AEV A;  4A93 H;  4JV5 L;  3KF6 A;  4POG A;  2CFM A;  4MNO A;  1KAW A;  2JJQ A;  3M85 A;  4IPH A;  3HOX H;  2MFI A;  4X65 L;  1B8A A;  4JCV E;  1WOC A;  1KIX A;  4R4I A;  5ELO A;  1UWV A;  2GVA A;  4OON A;  2ZJR A;  3T1Y Q;  2HQL A;  1FL0 A;  3CXC A;  4A3C H;  1Y1V H;  4KLK A;  1TWA H;  4A3I G;  4O2D A;  3KDF A;  1T9H A;  4DR6 Q;  3S2D H;  3K7A H;  3PGZ A;  1S3O A;  2WP8 J;  5IYB G;  1Q1B A;  3NEL A;  3CCE A;  2JEB I;  2YYZ A;  4DR6 L;  5E7N A;  1I5F A;  2OCE A;  1KHI A;  2ID0 A;  3RN5 A;  3HOW G;  3K7U C;  1U0L A;  1EFW A;  3MXN B;  4YCW A;  1Y14 B;  2VY3 A;  1HZB A;  2PQA B;  3ZJY C;  1VS0 A;  1WI5 A;  3CP0 A;  1YHQ A;  2UU9 Q;  1OXS C;  3A74 A;  1PH2 A;  1GVP A;  1J5E Q;  3UDF A;  1JB7 A;  4JI7 Q;  3S2H H;  3DM3 A;  3F1Z A;  4QL5 A;  4GNX B;  2E2H H;  2NVT H;  2UU9 L;  2L15 A;  5C0X J;  5LMU Q;  4DUY L;  3BZC A;  4JI7 L;  1FGU A;  2H5X A;  3LGJ A;  1EUJ A;  5FJ8 G;  4ALP A;  5IP7 H;  5IP9 H;  4HIO A;  2OTJ A;  1KRS A;  3UE0 A;  1EYG A;  1I3Q H;  4DPG A;  3HOY G;  3SGI A;  3GTJ H;  4AYB E;  4YCV A;  4A3J H;  1Q7Y C;  3D0F A;  4HJ5 A;  3H3V I;  4R4Q A;  5AJ3 Q;  2BA0 A;  5IYD G;  1PH4 A;  1LM0 A;  2JA9 A;  4UP9 A;  3UE1 A;  4BY7 G;  3EIV A;  3RLO A;  4GNX C;  2R7Z H;  4LF4 Q;  2K5V A;  2AWO A;  1L2F A;  3GTM H;  1E3P A;  4JBJ A;  4A3L G;  2UXD L;  1OXT A;  3VDY A;  3GTQ H;  1UE6 A;  2B3G A;  2LXJ A;  4DV4 Q;  1KD1 C;  3STB C;  2A1A A;  4LF4 L;  3A0J A;  3ER0 A;  3OTO Q;  3S24 A;  3BZK A;  3S17 H;  3FKI H;  2OTL A;  4JI8 Q;  2FXQ A;  1AE2 A;  2R93 G;  1KL9 A;  1QUQ A;  1XTD A;  4EX5 A;  3CC4 A;  1XPU A;  4DR4 Q;  1I6H H;  1UEB A;  2UXB Q;  1NE3 A;  2GVB A;  4YWL A;  2K5N A;  4KI0 A;  4GOP C;  5JJI A;  4Y7N H;  4R4O A;  1VQI A;  3CPF A;  1HZC A;  5M3M G;  1PH9 A;  2UXB L;  5GAH C;  2JA5 G;  1I50 H;  4BA2 I;  2NZO A;  3J81 i;  1W3S A;  1RL2 A;  2YTX A;  3CAM A;  1I94 Q;  4YCU A;  4TVA B;  1CKO A;  2D62 A;  1EWI A;  4HJ7 A;  4LF8 Q;  4GKK Q;  3U4Z A;  1E24 A;  4DR2 L;  4DAY B;  1P8L A;  4QJF A;  3J81 j;  2R92 G;  4JI3 Q;  2AWN A;  2AMC B;  4GN4 B;  5HGQ A;  4BBS H;  1GKH A;  4K0K Q;  5IWA L;  5K36 G;  4JYA Q;  2N78 A;  1A63 A;  1K3R A;  2V1C C;  4DV5 Q;  3HOX G;  4K0K L;  1UE5 A;  3EBE A;  2PI2 E;  2Q2U A;  2IT1 A;  4A3M H;  4JYA L;  1PVO A;  2OQ0 A;  4DV5 L;  1LUZ A;  3TRZ A;  2I0Q A;  2PI2 A;  1IBL Q;  1M90 C;  1Y1V G;  3CPW A;  1IBK Q;  3HOV G;  1WFQ A;  4R4T A;  2JE6 I;  3KJO A;  1N32 Q;  1UE1 A;  2IX1 A;  1OXX K;  2ALY B;  1IBK L;  2E2I H;  2NVY H;  1LTL A;  3S1Q H;  4LF7 L;  1VCI A;  3EN2 A;  1XNR Q;  4RMF A;  1N32 L;  3U4V A;  4P75 A;  2UUB Q;  1HJP A;  1WJJ A;  4NXN L;  2KEN A;  4LUV A;  4HJA A;  1NY4 A;  4B3M Q;  1OXU A;  2BA1 A;  2VL6 A;  2VZA A;  2HHH Q;  1N33 Q;  2OWO A;  1HR0 L;  1SRU A;  2UUB L;  2IX0 A;  3PUX A;  4LF6 Q;  4LF9 Q;  2E2J H;  3I4N H;  3S14 H;  4DK6 C;  1CKN A;  1KRT A;  3HKS A;  3HOU H;  1L0W A;  1PYS B;  4LF6 L;  4LF9 L;  4A3B H;  2HT1 A;  2N8N A;  2MQH A;  2RF4 A;  3B6Y A;  1EQQ A;  1HNX L;  1HZ9 A;  2UUA L;  1C9O A;  4KHP Q;  3UDG A;  1AH9 A;  1IYJ B;  3RR5 A;  1YHB A;  4YY3 Q;  4Y52 H;  2K52 A;  3E9I A;  2CCZ A;  4DV2 Q;  4B3R Q;  2K4K A;  5GRO A;  3I2Z A;  3CW2 C;  1VQD A;  1ASZ A;  1VQ6 A;  4YY3 L;  3M4Q A;  2EIF A;  5C3E H;  4A3J G;  1QVC A;  3GO5 A;  4PZ8 A;  1HNZ Q;  1VQ9 A;  2ZJQ A;  2JA6 G;  1JT8 A;  1SR3 A;  3ICE A;  4POF A;  4DV3 Q;  1HNZ L;  3T1H L;  1SFO H;  1PH3 A;  2B63 H;  3F8T A;  1KXL A;  4JBK A;  2VQE Q;  2IY5 B;  4DV3 L;  1EIF A;  1PA6 A;  5C44 H;  3GTK H;  2D0O A;  3S15 H;  1OTC A;  1L1O B;  3FKI G;  5M3F H;  3CCQ A;  3PV0 A;  1Q12 A;  5DLQ E;  2K14 A;  4L5Q A;  3KJP A;  3T1Y L;  1XMO Q;  4JI2 Q;  1MJE A;  2Z0S A;  1K0R A;  2K75 A;  3AFQ A;  1XMO L;  1R9T H;  5JEA G;  4IO9 A;  3KFU A;  1PHJ A;  1JJ2 A;  4WJ4 A;  2I5L X;  2KHJ A;  1GM5 A;  1QVF A;  2IHE A;  5M5W H;  2Y0S E;  2JA7 H;  4GLV B;  3RLN A;  1V43 A;  1WCM H;  5LMN W;  3AFP A;  4DAM A;  3PCO B;  2PQA A;  4PZ7 A;  3RNU A;  1P16 A;  5GQO A;  3AQQ A;  4APV A;  4C3H H;  1J5E L;  4P72 A;  2LXK A;  4JOI C;  4FDB A;  4A3F H;  2A8V A;  4P74 A;  3HFZ B;  5LMU L;  4JI4 Q;  1Q8K A;  1PV4 A;  3HKZ E;  4GNX A;  1N36 Q;  1BBU A;  3L0O A;  1N34 Q;  4HIM A;  3OW2 A;  4JI4 L;  1N36 L;  2B29 A;  4DR1 Q;  4A3M G;  1LYL A;  2MNA A;  3CD6 A;  1TWF H;  4JI1 Q;  2JA8 G;  4LUO A;  2AHO B;  5AJ3 L;  1EQR A;  4JI5 Q;  2WFW A;  4P73 A;  4DKA C;  3J7Z C;  4PG3 A;  1GD7 A;  1NBW A;  3I56 A;  4AIM A;  4UY8 C;  2HIX A;  2UUC Q;  4GOP A;  3M4P A;  1JJG A;  1X54 A;  4JI5 L;  1X65 A;  3M4O H;  3IRB A;  4DV4 L;  3PF5 A;  1SE8 A;  2I5M X;  3I4M H;  3H0G H;  1PYB A;  3OTO L;  2QA4 A;  2CWA A;  3ULL A;  5EAY A;  4JI8 L;  4XTC S;  1MIU A;  4A3K H;  1OXV A;  4IPG A;  4MTN A;  1VQH A;  2WB1 E;  1B70 B;  1RIP A;  2BH2 A;  1AE3 A;  4DR4 L;  5C4X H;  1FJG Q;  1G51 A;  1GO3 E;  4DK3 C;  2KBN A;  1X56 A;  3L7Z C;  5GAD C;  5C4J H;  2NN6 I;  2JEA I;  4A3B G;  3KLW A;  3HOU G;  2N49 A;  5GAE C;  4BXX G;  4A3D H;  3CME A;  2HIV A;  1QUQ B;  3GD7 A;  3K81 C;  4DUZ Q;  2RCN A;  4B3S Q;  1VQB A;  1Q81 C;  3J80 i;  1I94 L;  1X9N A;  2VQF Q;  4L5S A;  3K8A A;  3FP9 A;  4R1J A;  1QZG A;  1VQC A;  3GTP H;  4B3S L;  4LF8 L;  4GKK L;  5C3E G;  2Z6K C;  3AYH B;  2VQF L;  4A93 G;  4X62 Q;  4JI3 L;  4L5T A;  3GTL H;  3CCU A;  2B63 G;  1PH7 A;  1S40 A;  2Q2I A;  4X62 L;  1VQE A;  1XMQ Q;  2WAQ G;  2K50 A;  3JC6 6;  1Z9F A;  4A3C G;  5C44 G;  3CMA A;  2NN6 G;  1PFS A;  3CCV A;  1CSQ A;  4X66 Q;  1XMQ L;  1TWC H;  4UP8 A;  1ASY A;  3MEF A;  1IBL L;  2K5H A;  2ZTD A;  1WYD A;  3PUV A;  4X66 L;  3NEN A;  2VUM H;  3W5O A;  3U50 C;  4A75 A;  1TWG H;  3UDI A;  4JI6 Q;  1BKB A;  3UDX A;  2CKZ B;  1S72 A;  1XNR L;  3DLL A;  3HOY H;  1YZ6 A;  1G6P A;  3G48 A;  1C7Y A;  1HZA A;  4P71 A;  1NMG A;  4OO1 I;  1XNQ Q;  1B7Y B;  4B3M L;  1N33 L;  1EIY B;  1VQA A;  2HHH L;  5JEA J;  3E0E A;  2EXD A;  5IY0 A;  1XNQ L;  1H95 A;  3NEM A;  1CKM A;  3CC7 A;  1G29 1;  5JJL A;  4MZ9 A;  3PUY A;  4A3L H;  3L2P A;  1HH2 P;  4LF5 Q;  3F2B A;  1D7Q A;  1VQ7 A;  1K83 H;  2R7F A;  2JQO A;  3K80 C;  3TQY A;  5IP9 G;  5IP7 G;  4DV7 Q;  4GN5 A;  4KHP L;  2LSS A;  4R4C A;  3F2D A;  4IOA A;  3JAM i;  1CKN B;  3CCL A;  1KQS A;  4DV2 L;  4B3R L;  1BBW A;  2GN5 A;  4OX9 Q;  5M5X H;  3PUW A;  1VQG A;  2I5H A;  2D0P A;  4OO1 G;  4PMW A;  2ZM6 Q;  5M3M H;  2NVX H;  1VQL A;  2R7Z G;  4OX9 L;  1PH6 A;  3S1N H;  2JA5 H;  2UXC Q;  4WJ3 M;  1YI2 A;  5FLM H;  1W2B A;  1IBM L;  4X64 Q;  2RHS B;  4H02 A;  1NTG A;  4DR5 Q;  4AQY Q;  3TS0 A;  3CF5 A;  1YIJ A;  2F4V Q;  1N8R C;  2MO0 A;  4EQ5 A;  2VQE L;  1PH1 A;  3GTO H;  3PIO A;  2DUD A;  3J81 c;  4OWW B;  1UE7 A;  1Q46 A;  3KF6 B;  2PMZ E;  1Y1W H;  1HNW Q;  3M9B A;  4DNI A;  4O0A A;  1HR0 W;  3RZO H;  1Q86 C;  1YBY A;  1NMF A;  4DV6 Q;  4JI2 L;  1A62 A;  4QY7 A;  1HNW L;  5C4X G;  1XPO A;  2XTI A;  4AYB G;  1IL2 A;  5IYC H;  4DV6 L;  1KC8 C;  3HOZ H;  2XGT A;  4QIW E;  3KF8 B;  4JOI A;  4NPS A;  3KDF B;  4ME3 A;  4A3D G;  4BA1 I;  3NBH B;  1U5K A;  4A3E H;  5M5Y H;  3PO2 H;  1L1O C;  2KCM A;  1PH5 A;  4YWK A;  3M7N A;  1X6O A;  1M1K C;  3HOV H;  4A3G H;  4BBR H;  2MO1 A;  1XPR A;  3F2C A;  3S1R H;  4J15 A;  3U58 A;  1O7I A;  4GS3 A;  1A8V A;  3M3Y H;  3BU2 A;  4BBS G;  3PF4 A;  5IT9 c;  2ZTE A;  1SRO A;  5BR8 Q;  3S16 H;  4IPC A;  4BY1 H;  4TQU S;  3ERS X;  3KOJ A;  4HIK A;  3GTG H;  4L5R C;  4HID A;  2VW9 A;  1J6Q A;  2CWP A;  2WB1 G;  5BR8 L;  1YEZ A;  1BVS A;  4JBW A;  4JG2 A;  1N34 L;  1D8L A;  3TEH B;  1E22 A;  2A19 A;  2R6G A;  3FHW A;  1XJV A;  4DUY Q;  4DR1 L;  4DR7 Q;  2E5L Q;  4JBM A;  1K8A C;  3CCR A;  3ULJ A;  4JI1 L;  3GDE A;  4DR7 L;  2E5L L;  4OXP A;  2VUM G;  4AH6 A;  3PO3 H;  3PIP A;  3H15 A;  3STB D;  5H1S E;  1TWH H;  2UUC L;  4C3J H;  3I7F A;  1A0I A;  2IHF A;  4LFC Q;  4B3T Q;  1DGS A;  1VQP A;  1IXR A;  3I4N G;  3Q8D A;  4NB3 A;  5C0X I;  4LFC L;  2JA6 H;  4B3T L;  3JAM c;  1PH8 A;  4GOP B;  2UXD Q;  4C3I H;  4LFA Q;  1FJG L;  1E1O A;  2BH8 A;  2N3S A;  5GAG C;  4DR3 Q;  2Q2H A;  4IJH A;  4NXM Q;  3A5U A;  1SLJ A;  2F52 A;  2Z6K A;  2JK8 A;  4LFA L;  3CCJ A;  2NZH A;  4DR3 L;  4HJ8 A;  4A3I H;  1JMC A;  1N9W A;  1YVC A;  4NXM L;  4X6A H;  2E8G A;  4DUZ L;  2QEX A;  5IYB H;  1QZH A;  2ASB A;  4UPA A;  2KCT A;  2R7D A;  3HOW H;  3CQZ H;  1X3F A;  4QQB X;  4JC0 A;  3G6E A;  3S1M H;  3PUZ A;  5C0X G;  1SMX A;  2C35 B;  5FLM G;  2NVQ H;  1Q1E A;  3TRE A;  2VNU D;  2VS1 A;  1CUK A;  1YHA A;  4DR2 Q;  1VQJ A;  4GLA C;  4LUZ A;  2EQS A;  5M3F G;  1EOV A;  1QVG A;  1Y1W G;  2YU9 H;  3G4S A;  1SN8 A;  5IWA Q;  3KYH C;  1K9M C;  5J3B A;  4GN3 B;  1YNX A;  2F3I A;  2AKW B;  3A5Z B;  5FJ8 H;  4YHH Q;  1VQ4 A;  1VQM A;  4IFD J;  5JJK A;  4A4I A;  1NJI C;  3RZD H;  4XIG S;  1IZ6 A;  1VQK A;  2DGY A;  3W1B A;  5IYC G;  4YHH L;  2YTV A;  4C2M H;  3HOZ G;  1K73 C;  1YJ9 A;  4JI6 L;  4RG1 A;  1YIT A;  1X3G A;  2JA7 G;  4LFB Q;  4A3E G;  2KHI A;  5IYD H;  3BJU A;  4BY7 H;  2QGQ A;  2ATW A;  3PO2 G;  3I55 A;  1WCM G;  5IE8 A;  4IPD A;  2JA8 H;  1X55 A;  1YJN A;  4A3G G;  3RLF A;  4IFD I;  4LWC A;  4OWX B;  4BBR G;  1VQF A;  2YV5 A;  4LF7 Q;  4LFB L;  1MKH A;  4A76 A;  4QGU A;  3WWV A;  2ZJP A;  4A3F G;  1X3E A;  4OWT B;  1VQN A;  5FLX c;  4NXN Q;  4KHZ A;  2YTY A;  3D31 A;  4JI0 Q;  3TS2 A;  4GKJ Q;  4DV1 Q;  4LF5 L;  2R93 H;  4BY1 G;  1HR0 Q;  4JI0 L;  1VQ8 A;  4DV7 L;  1JE5 A;  2PNH A;  4UP7 A;  5ELN A;  3I4O A;  4LNQ A;  4GKJ L;  2RHQ B;  4YWM A;  4DV1 L;  2ES2 A;  3J7A 5;  3CCS A;  1MJC A;  2Q2T A;  1CSP A;  1Q82 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...