4AQYQ

Structure of ribosome-apramycin complexes
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aqyQ00
1QZGA 1VQ8A 1NJIC 2E2IH 3GTQH 1EUJA 2R7DA 2K5HA 5ELOA 4GN5A 1YEZA 2N8NA 4JI2Q 2VQFL 3GD7A 1XMOL 3T1YQ 1SROA 1MJCA 4DR5Q 2NVQH 1SFOH 4R4IA 1D7QA 2JE6I 3JAMi 5JEAJ 5HGQA 4LW1A 1VQCA 3HOXG 4OWWB 1WYDA 4XTCS 2AKWB 5M3FG 1QUQB 2UUCL 3NELA 1EYGA 2UXCQ 1TWFH 1WOCA 1L1OB 1VQDA 1X3FA 3J81j 4DV5L 4NB3A 2Q2UA 3S14H 2OQ0A 1YJ9A 3KF8B 3CAMA 3AEVA 4A3DG 1HNXL 4X65Q 3GTKH 4KHPQ 2RF4A 4OXPA 4YY3Q 5FLMH 4DR2Q 1VQAA 1X56A 5JEAG 1K73C 4B3ML 1GO3E 4IPCA 4JYAQ 1SLJA 2D0OA 4KLKA 4GOPA 4GLXA 3F1ZA 4A76A 1MIUA 4A3FH 2MNAA 4UPAA 3J7A5 1Q7YC 3KFUA 2IY5B 2E8GA 5M5XH 4DV3Q 2MO0A 1EIYB 1IXRA 3CCUA 1TWAH 1V1QA 4LF6L 4A3CG 1PH7A 2HIXA 3EN2A 1WJJA 1A62A 1AE2A 3CCQA 4C3JH 2DUDA 2E5LQ 4LF8Q 1N32L 3J80i 3DM3A 1A8VA 1YJWA 3J81c 4IPGA 1CKNA 2AWNA 3RZOH 3T1HL 4IOAA 4DAYB 4BBRG 4X64Q 4LFCQ 1L1OC 1OXTA 1YJNA 1IBLQ 1A63A 4PG3A 4QIWE 1KRSA 1PV4A 1N8RC 1BBWA 3UDFA 4O2DA 3HOWG 1E7ZA 4LWCA 1P16A 3PSIA 2MQHA 3GO5A 4DUYQ 5BR8L 1BVSA 2OQKA 4IFDI 4L5QA 1EIFA 1S72A 4HIMA 1T9HA 3H3VH 1LM0A 1XPOA 1UWVA 5FLMG 4RMFA 4DV0Q 3K7AH 1O7IA 2VQEL 2VW9A 2DGYA 1VQKA 3JC66 2BA0A 2ZJRA 4IPDA 3KOJA 4JCVE 4BY1G 4A3FG 1PH6A 4JI5L 4A3IH 3AYHB 2A1AA 3CCRA 1XMQL 1J6QA 1NY4A 1YHBA 4P74A 4DKAC 5ELNA 4OWXB 1NTGA 1IZ6A 1I5FA 4JI4Q 4LFBL 4YCUA 2OTJA 5IE8A 5IWAL 1HNZL 1IBMQ 2D62A 4JI7Q 1Z9FA 4LFAL 3MXNB 5M5YH 1QVCA 1YHAA 4B3RL 4A3JH 2E2JH 3H0GH 1UE1A 1C9OA 1L1OA 3ZJYC 1IYJB 5HY6A 2RCNA 1VQNA 2WFWA 4X62L 2R92H 2AMCB 1OXSC 3AQQA 1E22A 4YCVA 5LMNQ 3ULPA 3CCMA 4DNIA 2JA9A 1HR0Q 3F2CA 5M3MH 3W5OA 2VY3A 1B70B 2JJQA 3A74A 4LUOA 1J5EL 2HQLA 2LSSA 1PH2A 4DR6L 1X54A 3TS2A 3S1RH 4LUVA 1KRTA 4A3IG 1UE5A 3M9BA 2JA5H 4IO9A 3PV0A 2K5VA 4JI8Q 2UXDL 1NBWA 4AQYL 1K3RA 5K36G 3OTOL 4EQ5A 1VQMA 3BJUA 5LMUQ 1BBUA 4DV1Q 4DR3L 4DR1Q 1CKOA 3U4ZA 4AYBE 4GOPC 3CMAA 4TQUS 1N36Q 3S1QH 2I5MX 1K8AC 2WB1E 2IX0A 4H02A 1FJGQ 4LF4Q 1GVPA 4BBSH 1OXVA 4GKJQ 1FVIA 4GN3B 2Z6KA 1VCIA 3GTGH 4DUZL 1CSPA 1I6HH 2ZJPA 2UUAQ 2F52A 4A3JG 2ZJQA 4LF5Q 4B3TQ 1N9WA 2JQOA 2Y0SE 4LF9L 3H0GG 3FKIH 3KJOA 1IL2A 1PHJA 2BH2A 3CCVA 2UUBL 3G6EA 3LGJA 4JBMA 1YVCA 2WAQG 1HZ9A 4MZ9A 2R92G 3CC7A 3PF5A 1I94Q 1Q81C 4X66L 1VQGA 1JJ2A 5GADC 5C4XH 4YCWA 3S24A 5GAHC 4HJ7A 1UEBA 4YWKA 4DAMA 5M3MG 2D0PA 1IBKL 4DR7L 1YZ6A 4GLVB 4LF7Q 1JB7A 1WFQA 3S16H 3K7UC 4NPSA 4BBRH 2F4VQ 1TWHH 3I2ZA 5C44H 3NBHB 3TS0A 4L5TA 2GVBA 3T1YL 2JA5G 4DR5L 3L7ZC 5IP7H 3HOWH 4XIGS 2CCZA 5DLQE 3CXCA 4OONA 4DV2L 1VS0A 4JOIC 3A0JA 3HKZE 1M1KC 3PO3H 3NENA 2WB1G 4O0AA 1GKHA 4NXML 4C3IH 2UXCL 4GNXC 1OTCA 3E9IA 3A5UA 1L0WA 3EIVA 4JI6Q 4BBSG 1YBYA 3D31A 4BY1H 3ULJA 4AH6A 4YY3L 1HNWL 4DR2L 1W3SA 4HJ8A 4JYAL 2BA1A 2AWOA 3FKIG 2NN6G 4YWMA 2XTIA 3K80C 1PH9A 4YHHQ 3OYYA 4JBJA 4P72A 4DV4Q 3GTJH 1HNXQ 3PUWA 5C4XG 4A3KH 3RLOA 3STBD 3CPFA 1FL0A 5IYBH 3CP0A 4K0KL 2UXBL 1Y1WH 2PI2E 2E2HH 1SMXA 4DV6L 3GTLH 1Q8KA 3HOVH 3GDEA 1PYSB 4RG1A 5C44G 2E5LL 3ER0A 4LF8L 4LF6Q 3IRBA 4NXNL 3KF6B 5IP7G 4LFCL 4X64L 4DPGA 1Q82C 4EX5A 2C35B 1VQ5A 4WJ3M 2ZTDA 3B6YA 2HHHQ 4UY8C 3K81C 2NZOA 4JI3Q 1Q12A 3PO3G 1YIJA 4R4CA 4UP9A 3L2PA 1DGSA 1P8LA 4R1JA 3T1HQ 4DUYL 4JOIA 3PUVA 4L5SA 3ERSX 1VQHA 1PH5A 3UDXA 3D0FA 1WI5A 1B7YB 5IYCH 3S1NH 4QJFA 2K50A 2QGQA 1K0RA 3SGIA 3J81i 2K75A 3U4VA 4IFDG 1VQ4A 4DV0L 4GNXA 4HJAA 2PQAB 2KHIA 5E7NA 3STBC 1LTLA 3K8AA 2QA4A 2JEAI 1E24A 4PZ6A 4TVAB 4A3LH 1PH3A 4A3EH 2JA7H 1N34Q 1XNRQ 2ZTCA 1QVGA 5FLXc 1RL2A 2R6GA 3KLWA 3CC4A 1C0AA 1E1OA 3DLLA 5GQOA 2Z6KC 3UDIA 2BH8A 3NEMA 2N78A 5C0XJ 2VQEQ 4A3KG 1XJVA 4DR4Q 5IYBG 3M3YH 1Y1WG 4J15A 4HJ9A 3RLFA 3S1MH 3HOVG 3WWVA 3PUYA 3CPWA 4JI5Q 4A3BH 2KBNA 4APVA 4JI4L 1SE8A 1JMCA 2NVTH 4JI0Q 1Y1VH 4OO1G 1QUQA 3HOUH 1EFWA 4KHZA 5C0XG 1X3GA 4C3HH 4PMWA 1KHIA 1I3QH 5C4JH 4BY7H 4LFBQ 1Q1BA 1PH8A 5IWAQ 1X3EA 3TEHB 1HNZQ 3PF4A 3GTPH 2VUMH 1D8LA 4A3MH 2MFIA 5IYCG 5LMNL 2UU9Q 1XNQL 3PO2H 1KXLA 4B3RQ 1HR0L 3BZKA 1VQEA 3G48A 3J7ZC 4B3SL 4A3LG 4DV7Q 4A3EG 2JA7G 1NE3A 1LYLA 2N49A 2L15A 4JI1Q 3H3VI 4A75A 2ASBA 4AIMA 2B29A 5LMNW 1J5EQ 3M7NA 3W1BA 1HR0W 2MO1A 3AFPA 4DK3C 4Y7NH 4OX9Q 4DV1L 2B63H 4GS3A 4DR6Q 1MJEA 1AH9A 3M4OH 3CC2A 4JBKA 4LUZA 2CFMA 1JE5A 1HJPA 1N33Q 2IX1A 2XGTA 1GM5A 2QEXA 4A3BG 4JV5Q 3UDGA 2ZM6Q 4AQYQ 1Y1VG 4GKJL 1YNXA 3I7FA 4IJHA 4POGA 2F3IA 4R4QA 1WCMG 3HOUG 1YHQA 3CQZH 1XPUA 2YU9H 3RN2A 2UUAL 4LF5L 1KC8C 2OWOA 4BY7G 4GKKQ 1AE3A 2CWAA 3TREA 1KL9A 5FJ8H 5C3EH 1VQLA 2NVXH 1PFSA 3M4QA 1M90C 1I94L 2VUMG 2HIVA 3I4OA 4DUZQ 4A3MG 4R4TA 3PO2G 2VS1A 1HZBA 3HOYH 2JK8A 1SR3A 3JAMc 4JI2L 4HIDA 5H1SE 4HIOA 2Q2IA 2UUBQ 2R93H 2B3GA 3S15H 1CSQA 1PYBA 5AJ3Q 1VQFA 1U5KA 3GTMH 3ICEA 2PI2A 1K83H 1Z47A 3E0EA 3CD6A 2ID0A 4IPHA 1YITA 1VQ7A 1TWGH 1X65A 1HZCA 4AYBG 2VQFQ 4QGUA 1IBKQ 2CQOA 1ASYA 4YWLA 2VL6A 3UE0A 1XMOQ 2I0QA 3PIPA 4DK6C 4DR7Q 2B63G 2NZHA 5IP9H 3I4NH 1VQPA 2ES2A 2EQSA 1KIXA 4X65L 4KHPL 2A8VA 2LXJA 3I55A 3KJPA 2Y0SG 3PCOB 4JI6L 1G291 2K52A 3M4PA 3PIOA 4DV2Q 2UUCQ 4A3GG 2GVAA 1W2BA 3W1GA 1X9NA 5IYDH 2V1CC 1Q46A 4MNOA 3CF5A 4DV5Q 3PUXA 4DV3L 4NXMQ 1TWCH 3K0XA 2YTYA 3KDFB 5FJ8G 5C3EG 3J80c 4B3MQ 3E9HA 1VQBA 3S17H 4P73A 4YHHL 1VQ9A 3BZCA 3CCJA 2KENA 3KYHC 4DV4L 4HIKA 1HNWQ 4BXXH 3HOYG 1X55A 3RLNA 1Y14B 2IHEA 2NN6I 2I5HA 1KQSA 1B8AA 5EAYA 1E1TA 1SN8A 2R93G 4POFA 4BA1I 1HH2P 1IBLL 3HFZB 2GN5A 4IFDJ 4IOCA 3CCSA 4A93H 4UP7A 1HZAA 2A19A 2R7FA 1N32Q 3HKZG 4QL5A 5J3BA 4K0KQ 2UXBQ 3ULLA 4P75A 1JT8A 4DV6Q 3UE1A 2HHHL 5IY0A 5IP9G 3I4NG 3PUZA 2RHSB 4JI3L 1LUZA 2YTVA 3EBEA 3RN5A 1Q86C 4NXNQ 1L2FA 3G4SA 2KCMA 2LXKA 5IYDG 1BKBA 4OWTB 4JC0A 1E3PA 5BR8Q 3I56A 3CCLA 3RR5A 1KAWA 2N3SA 2EIFA 2YTXA 3G71A 1N34L 1XNRL 4JBWA 2JEBI 2IHFA 4HJ5A 1VQ6A 1RIPA 4IJLA 4BXXG 3A5ZB 4DR4L 1NMGA 1V43A 1G6PA 1XMQQ 4JG2A 1I50H 3U50C 3FP9A 5M5WH 2OCEA 1IBML 4Y52H 3AFQA 5GAEC 4JI7L 2JA8H 3I4MH 1WCMH 2ZTEA 2Q2TA 3TRZA 1KD1C 1EQRA 3F8TA 1ASZA 1K9MC 1CUKA 4A93G 4JI0L 1GD7A 1V9PA 2K5NA 3S2HH 2PNHA 3CW2C 2R7ZH 3PGZA 3GTOH 3RZDH 4LFAQ 3S2DH 3U58A 2ATWA 4C2MH 4OO1I 4PZ8A 2CWPA 3HKSA 5JJLA 1QVFA 3CMEA 5JJKA 3F2DA 5C0XI 4ME3A 3MEFA 1R9TH 2UU9L 1PVOA 1XPRA 1VQJA 4GOPB 1FGUA 4X62Q 1PH1A 2EXDA 2CKZB 2YV5A 1X6OA 4UP8A 3F2BA 3KDFA 4GLAC 2I5LX 2RHQB 2Z0SA 1JJCB 1EOVA 2WAQE 2OTLA 4JI8L 3HOZH 1H95A 2JA6H 4DV7L 5JJIA 1TXYA 1XNQQ 1U0LA 1PH4A 5LMUL 4JI1L 4DR1L 2KCTA 4MTNA 2WP8J 2HT1A 1JJGA 1N36L 4QQBX 2Q2HA 3VDYA 2NVYH 3KF6A 4OX9L 1FJGL 2UXDQ 4LF4L 3M85A 4B3SQ 2VNUD 1UE6A 1CKNB 4A3GH 3I4MG 2JA8G 1N33L 3OTOQ 1QZHA 1S40A 1CKMA 3HOXH 2H5XA 4DR3Q 4JV5L 4PZ7A 2ALYB 2KHJA 4A4IA 5IT9c 2ZM6L 3RNUA 1K8GA 4B3TL 5GAGC 5M3FH 3Q8DA 4P71A 2K14A 4L5RC 1UE7A 2IT1A 2R7ZG 3FHWA 4BA2I 1XTDA 3H15A 2FXQA 4QY7A 1A0IA 1S3OA 1OXXK 4A3DH 4LNQA 1Q1EA 4GKKL 1PA6A 4GN4B 2PQAA 3BU2A 2AHOB 3L0OA 1OXUA 3OW2A 1EQQA 4LF9Q 1SRUA 1VQIA 4LF7L 2PMZE 4R4OA 2K4KA 4WJ4A 1MKHA 2F4VL 1EWIA 1NMFA 3TQYA 4ALPA 1G51A 4X66Q 4GNXB 4KI0A 4FDBA 5GROA 3HOZG 5AJ3L 4A3CH 3CCEA 1VQOA 2YYZA 4X6AH 1C7YA 2VZAA 2JA6G 1YI2A
chains in the Genus database with same CATH superfamily
4FF4A 1VQ8A 1NJIC 3GTQH 1E2WA 3S1RB 5KYLA 1STEA 1WTHA 3MTSA 1SROA 4F88A 4R4IA 1D7QA 1G8ZD 1VF7A 2AQ2B 2JE6I 3JAMi 3Q23A 3S1QB 4OWWB 2WB1B 1JB3A 1RTNA 3J81j 1VQDA 3NTIA 4OIJA 1BR9A 2OQ0A 3GTGB 3KF8B 3MA2B 1K73C 3D6CA 4JYAQ 1SLJA 3VR3A 4GLXA 1SYDA 2MNAA 3J7A5 1Q7YC 5EBDA 5EPJA 1EIYB 3CCUA 5CORA 4A3CG 4XYQA 4XT1B 1QNKA 1WJJA 3CCQA 1TWHB 5C44B 3J80i 3J81c 4ZUIA 3RZOH 4DAYB 2EZVA 1F9SA 3VR4A 4LFCQ 1L1OC 3I8ZA 3GV6A 1GUTA 2B8GA 1BBWA 1PZJD 1E2VA 1RF2D 2XSCA 3HOWG 2PNRC 2QDBA 4LWCA 3MVVA 2NTSA 3GO5A 1BVSA 3NPPA 1BXTA 3WDNA 5IOCA 1KLGD 4KKUA 5FK9C 1UAPA 4HIMA 4RCNA 3H3VH 1STBA 1WD0A 1G91A 1C4QA 5CMDA 1QJOA 5A2QL 2ZJRA 3KOJA 1QWYA 2CVRA 4A3IH 3GTJB 3MXNA 4A3KB 4R9WA 2K5QA 2B2WC 4OWXB 4C3JG 1NTGA 4ABNA 4LFBL 2OTJA 2LY7A 5IE8A 1AN8A 4B9WA 1LTBD 2OT2A 4JI7Q 4LFAL 5M5YH 1EIGA 2FINB 1F9PA 1I4HA 5EKKA 4FXDA 3GQBA 1VQNA 1E0BA 1JR0D 1NSNS 3AQQA 1E22A 4YCVA 3ULPA 5C3XA 1B70B 2B2UA 3X3MA 4A3EB 3A56A 1PRTB 1KRTA 4IO9A 5T1GA 3M3YB 4EQ5A 5D3DA 1VQMA 1ET6A 3U4ZA 4QUFA 1DM0B 4TQUS 2I5MX 1K8AC 4H02A 1O80A 4BBSH 4GKJQ 1EY7A 1GXDC 4DUZL 1CSPA 4FYDA 2CW0D 2UUAQ 4LF5Q 4A3JG 1I3QB 1N9WA 2Y0SE 4RFBA 3KJOA 1AFPA 2F0JA 3E5SA 1V1OA 3BG3A 3GTPB 1HZ9A 2FJ2A 2R92G 1I94Q 2VUMB 4HMIA 5CV7A 1Q81C 4HJ7A 5GAHC 1UEBA 5M3MG 1IBKL 1YZ6A 3HGBA 1CQFA 4GLVB 3N6RA 4BBRH 4M8AA 1B50A 1RTOA 4L5TA 1U4RA 2GVBA 5LHY1 5JJZA 1WTPA 4XIGS 4RGTA 2RCFA 4R8IA 1EQTA 3M4OB 1M1KC 4N9TA 3PO3H 3I90A 4NXML 5I2YA 1BOSA 4BY1H 3TZUA 4AH6A 2YU9B 1SYBA 1W3SA 4HJ8A 1HUMA 1IL8A 1KABA 2NN6G 1LABA 2O2LD 2NVXB 1SSOA 3K80C 3BVZA 1B1ZA 4XQJA 3SE0A 3OYYA 2IPKD 3MFYA 3PUWA 4RCOA 3RLOA 3STBD 3CPFA 4K0KL 3ZYYX 3E0JA 2K1BA 3JAML 2I07B 4O1NA 3SR1A 3GDEA 1K83B 4RG1A 4LF8L 4FP5D 1EEFD 3IRBA 3W2DA 5C0XH 2DN8A 5LL6S 2F0WA 4UDUC 1Q12A 4R4CA 4UP9A 4ZQ3A 4C3IG 1PTOH 1TS2A 4KHVA 3T1HQ 4JOIA 5C4ZA 3NUCA 1WTQA 4L5SA 3UDXA 3S1NH 3MWYW 1STNA 2QGQA 1K0RA 1YNJC 3J81i 4DV0L 4GNXA 5ELFA 2JEAI 1TWCB 2FHTA 4PZ6A 5DM63 1XNRQ 1QVGA 1RL2A 4PQXA 3J80L 1C0AA 2Z6KC 3NEMA 4DR4Q 5L37A 5IYBG 1BF4A 4J15A 3MEHA 4HJ9A 3HOVG 3T53B 3CPWA 2F0SA 3TMEA 5CGKA 2NVTH 2EXZA 1Y1VH 4ZLTF 4OO1G 1QUQA 2H4OA 1EZ8A 2A69C 3HOUH 4CBVA 1EFWA 1LTAD 1STHA 2F0GA 1UNSA 2CQAA 5C4JH 4DXFA 3BDLA 5E4XA 5IYCG 3PO2H 2BDOA 1PRTD 1DXMA 1NNXA 4YIJA 1VQEA 1PZKD 3TDQA 4B3SL 4DV7Q 4M1UB 2JA7G 5KRUA 3H3VI 2F4IA 3IFDA 4A75A 2ASBA 4AIMA 2B29A 3M7NA 3W1BA 2XWBB 3NTKA 1I50B 2B63H 5M5WB 4DR6Q 2KCCA 4GS3A 1AH9A 3D4WA 1O7YA 4LUZA 1WCMB 2CFMA 1HJPA 4XXEA 2EJGC 2XGTA 2ZM6Q 2BOSA 1WTWA 3I7FA 3S2HB 4NMZA 1SEBD 2EOTA 3OW7A 4CJ0B 5KYIA 2OWOA 4GKKQ 1AE3A 4K6DA 3TREA 5C3EH 1PFSA 3M4QA 1M90C 4EQPA 4A3MG 1SMYC 3HOYH 2K32A 5H1SE 2K04A 2Q2IA 1Z7TA 3S15H 1U5KA 1Z47A 3TP8A 1YITA 2EY6A 1VQ7A 1EY5A 3MXUA 4OHJA 1TWGH 1X65A 4AYBG 1ASYA 2CQOA 5EBCA 1GHJA 4DK6C 5F2DA 4CGYB 1VQPA 1QOHA 1V1PB 4OGQC 2ZXPA 3KJPA 2K52A 3M4PA 4DV2Q 2D9UA 1X9NA 1W2BA 5IYDH 1Q46A 3X3NA 3MC0B 3KDFB 1IW7C 3E9HA 4P73A 3BZCA 5CC4A 4CDEC 3BS1A 3I3CA 1E1TA 2R93G 4BA1I 1HH2P 1ICWA 2PCFB 2KECA 4A93H 2R7FA 3I91A 3HKZG 3L9AX 4P75A 1QCBD 4R8NA 1JE4A 3UE1A 1BBXC 1SFOB 1KDAA 2HHHL 5IP9G 3BYYB 3A54A 1LUZA 1U9RA 3NSWA 1STAA 3CKIB 4N9PA 3NK9A 1L2FA 1BKBA 3S14B 4ID6A 1E3PA 4JC0A 4HTHA 3GTKB 2EIFA 4IQZA 4RKLA 3NQTA 4X3KA 3VA5A 1VQ6A 2HQEA 4IJLA 1IKLA 1NMGA 5M5XB 1G6PA 4JG2A 3OPOA 3FP9A 4JVZA 2OCEA 1HQMC 1JOOA 5GAEC 5KIXA 4JI7L 2ZTEA 1KD1C 3F8TA 4C3JB 4FVMA 3D3RA 1CUKA 1RD9D 3D4DA 4JI0L 5FLXE 5EPLA 1HQRD 3GTOH 4LFAQ 3J81L 2ATWA 1EIHA 4G7ZC 5C0XI 2F0FA 5C6AA 2EXDA 1A3VA 1X6OA 3F2BA 1LTTD 2BE5C 5J1ZA 1LLRD 2RHQB 1EOVA 2OTLA 3OSOA 1JWSD 1LTSD 2Z4IA 1D5XC 4ZRZA 1EOTA 1L0YB 1S5ED 2WP8J 1JJGA 2XNAC 1S4ZA 4LJZC 2Q2HA 1UEAB 2NVYH 1CM9A 1CZWA 1EQVA 1CTMA 2VNUD 5D14A 1CKNB 3I4MG 1AZQA 2F0NA 3RNUA 5IT9c 1L0XB 4FNFA 4IZ8A 3NWTA 1UE7A 2IT1A 3CHBD 4L5RC 4K8JA 5C3WA 4U68A 1A0IA 4A3DH 4LNQA 1Q1EA 1PA6A 4A3JB 4GN4B 3BU2A 5JEAH 2KEDA 5T1IA 4UAIA 5FOBB 1D2BA 1PFMA 2R92B 2MJ8A 3TQYA 2HDLA 4DK0A 1EY8A 2D5DA 2A6EC 5GROA 3HOZG 5AJ3L 5M3MB 2YYZA 4X6AH 3U9OA 2JA6G 1YI2A 2E2IH 1EUJA 3FDTA 2R7DA 2VQFL 5DNFA 1LACA 2NVQH 3A8IE 4NKLA 3HOXG 1GUOA 1QE6A 5M3FG 2UUCL 3NELA 1WTRA 4DV5L 4NB3A 1YJ9A 3DEOA 3CAMA 2RF4A 4OXPA 3DHQA 1I6HB 2WACA 4B3ML 4X3UA 1SNQA 4KLKA 4GOPA 1WD1A 5JVH3 3NE5B 3KFUA 4UPAA 2IY5B 1ESRA 3P7JA 2HUGA 3P20A 2MO0A 4N8X1 5D65A 1V1QA 1BUVT 1TR5A 2QCPX 1MI2A 1A62A 4LF8Q 1GUWA 1YJWA 2EYMA 3T1HL 4IOAA 3T56B 4BBRG 3OHXC 1IBLQ 1OXTA 4PG3A 5I4DA 1TY0A 2F0OA 4KD3A 1PV4A 4G7OC 4C3IB 3URYA 5I6WA 2MQHA 4LAAA 1AP0A 2V4DA 3HEJA 4WORA 4L5QA 5FLMG 1CZGA 4DV0Q 1ET9A 3GP7A 3QIAA 4EQOA 1VQKA 2BA0A 4K5WA 4BY1G 4JCVE 2MHVA 4A3FG 1PH6A 1G6ZA 1K28A 2K6AA 3AU7A 4KKTA 3AYHB 3K59A 1FNUA 1YHBA 1AW7A 1H9KA 2F0HA 1S5DD 1HTPA 1BCPC 3HOVB 3H6MA 4MN3A 4QIWB 4YCUA 2XIWA 1IBMQ 2JYOA 1HFNA 4DNRB 1QVCA 2RSNA 4P2CB 4F87A 3H0GH 1D6EC 1IYJB 5HY6A 2DY7A 4X62L 1KTKA 3KF8A 4ODGA 2KHSA 3OMGA 1W6KA 4BS9A 1F2MA 3W5OA 2VY3A 4J8QA 2SNSA 4DR6L 2O5IC 1X54A 2JA7B 3S1RH 1UE5A 3M9BA 2B2YA 3T51B 1NBWA 1MHWC 1K3RA 3OTOL 1A3TA 3BJUA 5LMUQ 1EYCA 3S1MB 3S1QH 2F0UA 2K5WA 4FXGC 4DAYA 4I7AA 2R3ZA 3M7GA 1OXVA 3HRZC 3FPPA 1FVIA 4GN3B 4L6TB 3RD4A 3GTGH 4WJWA 2ZJPA 4J6HA 2ZJQA 4LF9L 2BH2A 4HEDA 1IL2A 1FR3A 1D1IA 3MHBA 2WAQG 4A3MB 2F3WA 1A3UA 4X66L 3Q24A 5GADC 2R61A 4HN7A 3D6WA 4YWKA 3K7UC 4NPSA 1TWHH 5C44H 3TS0A 1U4PA 2JA5G 4DR5L 4AYBB 5IP7H 2WINB 2CCZA 4DV2L 1VS0A 4JOIC 5AFWA 4F8MA 1SBBB 1VMCA 4O0AA 1CA6A 4ME5A 5G3LF 1NCVA 4GNXC 1EEID 1LT5D 2EYLA 3A5UA 3EIVA 1ZYRD 1HRJA 1YBYA 1TS3A 3N52A 2Z1CA 3CQZB 4CDFC 3ULJA 3C2PA 3RMHA 4DR2L 2O5JC 3FKIG 4YWMA 2EY1A 2F0TA 3KUPA 3R93A 4P72A 3GTJH 5C4XG 4A3KH 4NW2A 2HCCA 2R93B 2PI2E 1O7ZA 3CRKC 1Y8NB 2E5LL 3MFGA 3IAYA 5JPNC 3HKZB 2F0KA 1SJED 4X64L 1AEXA 1Q82C 4EX5A 4WJ3M 2ZTDA 3B6YA 2HHHQ 3K81C 3DWQA 1LT6D 4KJNA 2K03A 3C3LA 3PIO3 1IYUA 1YIJA 4RGNA 1EWHA 4IUNA 2A69D 4DUYL 1F77A 3ERSX 1QG7A 3D0FA 1B7YB 2K75A 3U4VA 2A74C 3A7AB 1VQ4A 2PQAB 2QA4A 1SNPA 4A3LH 4NP5A 1HPCA 4A3EH 2ZTCA 1JQYD 1E1OA 2B8FA 5GQOA 3UDIA 5C0XJ 3NTHA 3M3YH 2ZXRA 1Y1WG 5CV4A 3MZ5A 4H44C 3A55A 5BN5A 1J9OA 1QNUA 4JI4L 1JMCA 4JI0Q 2KA7A 3BVGA 4V190 1RHPA 1Y8PB 3BVMA 1I3QH 3I73A 1Q1BA 2AUKA 3EROA 1X3EA 3GTPH 2VUMH 2MFIA 5LMNL 1KXLA 4B3RQ 1A2UA 4BWGB 2H1EA 5A35A 3AMUA 1Y69U 3J7ZC 1GUGA 2DNCA 1SMYD 1NE3A 3KBXA 1LYLA 2L15A 5K36H 1Y8OB 2K5DA 2MO1A 1KNEA 1MJEA 5DEHA 3M4OH 3CC2A 3I4MB 3TN2A 2CHBD 4A3BG 1TY2A 1C48A 1TS4A 3BDOA 3DEPA 1U4MA 3K5LA 1XPUA 1JWUD 2YU9H 2Z4HA 2RVLA 4C3HG 1KC8C 3S2DB 4C2MB 4BY7G 1F9RA 4QMGA 1VQLA 2NVXH 2NZ1D 1LO5D 4DXGA 1IW7D 3HOZB 2B3GA 4CJ1B 1PYBA 5AJ3Q 3ICEA 2JA6B 2PI2A 1K83H 3CD6A 1F9QA 2PW7A 1FNVA 3HP3A 2VQFQ 4QGUA 1NAPA 4DR7Q 4YWLA 3Q22A 3PIPA 3ERQA 2N55A 4HR7B 2D2CC 4A3GB 3ITPA 3HOXB 3OIQA 4IFDH 4JI6L 5M3FB 3PCOB 1EFID 5IGEA 2UUCQ 2GVAA 5IT9L 4DV5Q 1DJRD 2PYKA 1H9JA 1TWCH 5FJ8G 4IUQA 2PQEA 4B3MQ 2P5ZX 3CCJA 4DV4L 4HIKA 1H9MA 1HNWQ 4MTKA 1X55A 5FO8B 2IHEA 4LK1C 2I5HA 3PIP3 3TP7A 4OEMB 5EAYA 1SN8A 5A2QE 1IBLL 3ND9A 3CCSA 4UP7A 4E6IA 1JT8A 5J3BA 3K0YA 3ULLA 4DAPA 1HA6A 1SNDA 5IY0A 3I4NG 3PUZA 2RHSB 4L63B 3QWNA 4JI3L 1T5EA 1IYVA 3EBEA 4NXNQ 1ZKOA 1F2YA 1I4GA 2ICEC 3H09A 1KAAA 2JSOA 3G4SA 2KCMA 1TWFB 4OWTB 5ELEA 1RKNA 3RR5A 1K8MA 1KAWA 2PZTA 1BCPF 2ZT9C 4F7XA 4B08A 1SNOA 4CHTB 2F3VA 3G71A 1N34L 1S5FD 3ONAB 5IODA 5EKLA 4HMJA 5IGDA 5FO9B 4A3FB 2BE5D 3LWUA 1RIPA 4BXXG 3A5ZB 1G2TA 1V43A 2EJFC 3TZDA 2CH4A 2LKVA 5I2XA 1I50H 1FGBD 3U50C 1TWAB 5M5WH 2RDGA 1IBML 1J8IA 1WCMH 1VMPA 2Q2TA 1WTXA 1K9MC 1GD7A 1V9PA 3S2HH 2EYJA 4ZK9B 3PGZA 3EJIA 1O7LA 1V1PA 3U58A 2F0QA 5FO7B 2N88A 2OEOA 3QO2A 4MIUA 3HKSA 1GHKA 1QVFA 2UU9L 2KCNA 1XPRA 4X62Q 2NTTA 1PH1A 3DWAA 2VB3X 5C5MA 3KDFA 2I5LX 2L55A 2Z0SA 1F2LA 3K7AB 1K0SA 5JJIA 1TXYA 4FF2A 4K14A 1PH4A 5LMUL 4JI1L 1PTOF 2A6ED 4QF4A 3VDYA 1SJHD 3KF6A 5KNBA 4OX9L 1B53A 3M85A 1UE6A 4JK1C 1SNMA 5DM73 2JA8G 1ENFA 3OTOQ 2AUJD 1S40A 1CKMA 2IX3A 2H5XA 2JN4A 2PO4A 4JV5L 2ALYB 4A4IA 1K8GA 2B2VC 2R7ZG 1I6VC 3T4AC 3H15A 4S3SA 3I72A 1OXXK 1LV9A 2VXWA 2B2WA 3Q6SA 3NQIA 1PFNA 4LF9Q 2E2JB 3SK5A 2C9OA 1SRUA 4WFN3 3HG9A 4C1NI 1VQIA 2WAQB 3LWEA 4RHSA 4X66Q 4IALA 4GNXB 4A3CH 3KK7A 3CRLC 3U9SA 1C7YA 2K5HA 5ELOA 4JI2Q 2JA5B 1MJCA 4DR5Q 1SFOH 3P75A 3JAME 5ELBA 2OF1A 5JEAJ 4LW1A 1VQCA 2X6LA 1WYDA 2AKWB 1QUQB 1L1OB 1X3FA 3S14H 4Z9CB 2K7VA 3GTKH 4X65Q 4DR2Q 2Z6BA 1GO3E 3FKIB 2DJGC 4IPCA 3VR5A 1KDCA 3VYUA 1O78A 1TU2B 2E8GA 5M5XH 4DV3Q 5C4XB 3D8GA 2Z9HA 1IXRA 1DOKA 1S5BD 4TRDA 1PH7A 3EN2A 1EY6A 3S16B 4C3JH 4K8IA 3J80E 2E5LQ 4EGVA 3DM3A 1A8VA 1XXGA 1CKNA 5C4HA 3HOWB 2M00A 4X64Q 1YJNA 4QIWE 1KRSA 1X3QA 3T13A 4O2DA 3OMCA 4TSSA 5JPMC 3R2IA 4DUYQ 3T16A 5BR8L 1ILPA 2B2TC 2A6HC 3OOCA 2XWJB 4IFDI 2XRQD 1RCVD 1S72A 1LM0A 2BCOA 2PW5A 1O7IA 2VW9A 2DGYA 1STGA 3JC66 5ELDA 4IPDA 3SK8A 5J39A 2X6GA 1XMQL 1NY4A 4P74A 4HCSA 5ELNA 1Y1WB 2E2HB 3GTLB 2EYFA 1IHZA 2J4XA 4JI4Q 1JOQA 4DGZA 1TIID 4FF1A 2D62A 1Z9FA 4KY6A 1PYWD 4RAUC 4B9XA 1TVXA 1YHAA 4B3RL 4A3JH 2DY8A 2L5TA 1UE1A 2O4XA 2RCNA 2R92H 5LMNQ 3R2TA 4I65A 1JWMD 5M3MH 2JJQA 3I70A 1PH2A 3TS2A 3QB3A 2EE1A 4A3IG 2K5VA 1SXTA 4Q5VA 4RKBA 4G4KA 1BBUA 4IUPA 4DR1Q 4AYBE 1N36Q 2WB1E 3J7AF 4A3BB 4ZKBB 1YNNC 4LF4Q 1GVPA 1TQOA 3H3VC 2Z6KA 1VCIA 1I6HH 2AQ3B 4C3HB 4B3TQ 4BY7B 1DOMA 2NN6H 4DN4M 3EA6A 3CCVA 1PHJA 3G6EA 3QJYA 2DNEA 4MZ9A 1SAPA 3WOFA 3J7AV 1A15A 1VQGA 3KLSX 3S24A 4DAVA 4DAMA 2D0PA 4DR7L 1C8CA 1KDBA 4EQNA 4LF7Q 1JB7A 1WFQA 3I2ZA 1EY0A 3HZXA 3NBHB 1XTCD 1I4QA 3EQLC 3G6JB 5E1FA 3T1YL 5KNCA 5DLQE 3CXCA 4OONA 1WTVA 4KD4A 1B9MA 3HKZE 3NENA 5FKAC 1HHVA 1GKHA 5CR3A 4C3IH 1EWCA 2UXCL 2E2DC 3E9IA 4BBSG 4JI6Q 3NWSA 1LT3D 3SK4A 1EU3A 3C1FA 4YY3L 1HNWL 1D5MC 4ZYSA 2AWOA 3W3AA 4DNTB 5JVG3 1I4PA 1WVLA 3FPUB 3BZDB 4JBJA 1HNXQ 1CFMA 4DV4Q 3V2TA 1II3A 2F0EA 1FL0A 5IYBH 3CP0A 1HTLD 2KUMA 1SMXA 1Q8KA 2VB2X 3HOVH 3GTMB 1PYSB 5I9OA 4LF6Q 4OO1H 4NXNL 1SE4A 2K05A 5M9OA 3OWEB 4DPGA 3I4NB 4C1NK 2B2UC 2NZOA 4JI3Q 2K01A 3SVMA 3PO3G 3L2PA 1P8LA 4R1JA 3MXGA 1R4QB 3PUVA 5IYCH 1WI5A 3J81E 4IFDG 3UI2A 4N8FA 3K8AA 4TVAB 3K58A 2AQ1B 1PH3A 3S17B 4FO2A 2JA7H 1N34Q 5FLXc 3KLWA 3DLLA 2BH8A 2N78A 2VQEQ 2DJFC 3ND8A 3S1MH 4JI5Q 4APVA 1SE8A 1PZID 1CHQD 1AZPA 1FYCA 1STYA 3VR2A 4KHZA 3IL8A 5C0XG 5LL6X 1X3GA 1KHIA 2NB0A 5IIFA 1PH8A 5IWAQ 4OELB 1X32A 1HNZQ 3TEHB 4MHEA 4CJ2C 2IWHA 2MP1A 4A3MH 2UU9Q 4DA2A 1HR0L 2NYZD 2Q8RE 3G48A 1JC7A 1H9SB 1LT4D 3VYSA 4CDDC 4QCLA 4JI1Q 5LMNW 1J5EQ 5KNDA 4H13C 3LX0A 4Y7NH 4DV1L 4OX9Q 1PTOC 2JA8B 4JBKA 1DONA 1JE5A 2IX1A 4JV5Q 2OXPA 4AQYQ 1Y1VG 3TSSA 1YNXA 4IJHA 2F3IA 1WCMG 2R7ZB 1RDPD 1YHQA 3CQZH 3HOUG 2QDLA 4C56C 2XVSA 4CKCA 3RZDB 2EYPA 4HSPA 1SYGA 5TSSA 1KL9A 3NBIA 1R9TB 1JORA 3PO2G 4IUUA 1HXYD 1DD2A 1R4PB 2JK8A 1SR3A 4JI2L 2KVMA 1HA5A 5DAUA 2UUBQ 2R93H 4H7BA 1VDZA 1BO0A 2RA4A 1PXUA 3I4LA 4IPHA 4KY5A 4Y7NB 1BQQT 1QB5D 2RQXA 3NHHA 2VL6A 3UE0A 1W6JA 2B63G 2NZHA 1PLFA 5IP9H 2QW7A 2ES2A 1ILQA 2EQSA 5CBEE 4X65L 2A8VA 3DMUA 3I55A 2Y0SG 3WOEA 3PIOA 1FNWA 1MD2D 4MNOA 1YNJD 4DV3L 3PQIA 2XN9C 2YTYA 5C3EG 4WRDA 5EQ0A 1VQBA 4YHHL 4K2LA 2KENA 1G2SA 3HOYG 2E76C 4ZUJA 3RLNA 1Y14B 2NN6I 4RGOS 1XX8A 4POFA 3HFZB 2GN5A 4IFDJ 4IOCA 1MGSA 3GTQB 1HZAA 2UXBQ 4DV6Q 1CK1A 1EU4A 2IJ0A 1EZ6A 1D1KA 4KK7A 1ML0D 2YTVA 2JXMB 5CYUA 1Q86C 1Q90A 3IFTA 4V0BA 1PDQA 2L4NA 3EVQA 5IYDG 5BR8Q 3BYTB 3L3OC 4J1MA 2SEBD 2N3SA 3QOLA 2YTXA 1PFBA 4HJ5A 1CA5A 4PV1C 3FMCA 3C1EA 1B9NA 1MBYA 2K28A 1XMQQ 5I9PA 2PZUA 3AFQA 3I4MH 1GUSA 1MSHA 3TRZA 1EQRA 2SOBA 4A93G 1SE2A 2K5NA 4G57A 4DF7A 1EY9A 3CW2C 4ZKCB 4HSVA 3RZOB 4DU9A 1NUCA 3S2DH 2F03A 4C2MH 4OO1I 4PZ8A 5JJLA 5JJKA 3CMEA 1SYCA 4ME3A 1PVOA 2CKZB 4GLAC 2JP1A 3HOZH 1JJCB 1QILA 2WAQE 2JA6H 1CQVA 1XNQQ 4DR1L 4MTNA 5IGGA 1N36L 4A3IB 2L11A 4QQBX 2M2LA 1HCZA 4LF4L 4XQQA 4A3GH 1EL0A 1N33L 1QZHA 1B3AA 4JW0A 3HOXH 2KHJA 4B3TL 4JPBW 5M3FH 3A8JE 4P71A 2K14A 1PRTF 3FHWA 1XTDA 2X69A 2FXQA 4IURA 4QY7A 1S3OA 3O13A 5I6YA 5M5YB 2Q8IB 2K33A 1A6XA 1EQQA 2AHOB 1OXUA 4OL7A 3D4RA 1TT2A 3F2UA 3VA7A 4LF7L 4WJ4A 4IN3A 1Q3LA 1MKHA 2TSSA 4ALPA 1NMFA 5G3LD 1X3PA 2ICIA 5KGUA 4FDBA 3DXJC 3MXNB 1QZGA 4PMBA 2KQ3A 3TP5A 3FRPB 1A2TA 4GN5A 1YEZA 2N8NA 2J7ZA 3GD7A 2RSOA 3T1YQ 4CKEA 1XMOL 2HCIA 2A68C 5CBAE 2LS01 2SNMA 5HGQA 3A8KE 1LTID 5BN3A 4ILWA 3R8BA 1EYAA 4RA8A 4XTCS 2UXCQ 1EYGA 1TWFH 1Q8IA 1WOCA 2EYHA 3QR8A 2Q2UA 4BBSB 5JOBA 2Z8LA 3AEVA 4A3DG 2PMZB 1HNXL 4KHPQ 5CV9A 2EY2A 2G9HD 4X3TA 4YY3Q 5FLMH 4PNYA 1VQAA 1X56A 5JEAG 2D0OA 5EKIA 3F1ZA 4A76A 1MIUA 2A6HD 4A3FH 5IGBA 3TP6A 3NXWA 5CV5A 1TWAH 4LF6L 2HIXA 1AE2A 5NUCA 2RBMA 4BBRB 4U673 4NDXA 2DUDA 1N32L 3DUZA 1EYDA 2RKSA 3K5MA 4IPGA 2AWNA 4KY7A 3CU7A 1A63A 1BCPB 4FXKC 4CKBA 1N8RC 3UDFA 1U4LA 3QG1A 3PO3B 1E7ZA 4K5VA 1P16A 3PSIA 3SDZA 1ZYRC 3PMFA 3SHLA 2OQKA 4BY1B 1EIFA 4Q0FA 1T9HA 4IUVA 1XPOA 1UWVA 4RMFA 4PMCA 3K7AH 2VQEL 2B39A 1XYIA 5IGCA 4JI5L 2A1AA 3CCRA 1J6QA 2L9HA 2NWGA 4DKAC 5D3IB 1BDOA 2E74C 3C46A 2F0MA 1IZ6A 1I5FA 3KLRA 5IWAL 1HNZL 1B2TA 1K3BC 3K57A 3AB9A 3DM1A 2E2JH 1YNND 4KKSA 1C9OA 1L1OA 3ZJYC 2F0PA 1PTOB 1UUPA 1GUNA 1MSGA 2WFWA 2AMCB 2KOLA 1OXSC 1B4OA 3S1NB 2WKCA 3CCMA 4DNIA 2JA9A 1HR0Q 4G7HC 3F2CA 4XYOA 4ZCKA 1J5EL 4LUOA 3A74A 3R3OA 2HQLA 1S5CD 2LSSA 1XWEA 1ENCA 1D5ZC 2QKIC 2HDMA 3VYRA 2E75C 4LUVA 4OIKA 2JA5H 3VR6A 3PV0A 4JI8Q 2UXDL 3VYTA 5FLXL 4AQYL 1F2ZA 3SK6A 5COYA 4DV1Q 1JOKA 4DR3L 1CKOA 4GOPC 3CMAA 2IX0A 1T5XD 1FJGQ 2EDGA 2NVTB 1Y1VB 1M8AA 3HOUB 3FVQA 2KJXA 1DOLA 2F52A 1ZXTA 2HD3A 2JQOA 5C4JB 3H0GG 3FKIH 2G9DA 1E2ZA 2UUBL 1I4RA 3LGJA 4JBMA 1YVCA 5IT9E 4EVOA 3CC7A 3PF5A 3PO2B 1JJ2A 5C4XH 4YCWA 2BDNA 2EVBA 3S16H 2F4VQ 1TS5A 2A73B 3L7ZC 3HOWH 1ZEQX 2B63B 3A0JA 1ONLA 2CW0C 2WB1G 3E6ZX 1OTCA 1NR4A 2Y0SB 1L0WA 2GA4B 3D31A 1ENAA 1LTGD 2F0LA 2F0IA 1ESFA 4JYAL 2BA1A 1LTRD 5C3EB 2A5HA 4KN4C 5HGTA 5J22A 2XTIA 1PH9A 4YHHQ 4KV6A 2I46A 3HOYB 4UHVA 2UXBL 4O42A 3A7LA 1Y1WH 2E2HH 4DV6L 3GTLH 1CT1D 3S15B 1BCPD 5C44G 2QILA 3ER0A 1TWGB 3KF6B 2MUYA 4KMUC 4LFCL 5IP7G 1FD7D 2C35B 1VQ5A 4UY8C 2SDFA 3KBGA 3MXPA 4XT3B 2ENBA 1DGSA 1ICFB 3HS0C 1VQHA 2B2YC 2L0CA 1PH5A 2WIIB 4QJFA 2K50A 5E3FA 3SGIA 1K8OA 4HJAA 1KLUD 2FMMA 2KHIA 5E7NA 1LTLA 3STBC 1HFGA 1E24A 4ZAIA 2C5CA 2TMPA 3MAQA 2R6GA 3CC4A 2EJMA 4A3KG 1XJVA 2EYOA 2FFKB 3NBHA 3RLFA 2L1BA 3WWVA 3PUYA 2L12A 4A3BH 2KBNA 1JICA 3DWPA 4A93B 5CV6A 1PTOD 4C3HH 3J7YW 3OWFA 4PMWA 4BY7H 4LFBQ 3PF4A 1OO9B 1D8LA 4H0LC 2LMCB 1XNQL 2NBFA 1B3QA 4L8JA 3BZKA 2QEJC 3NP8A 3S9WA 4A3LG 4A3EG 5ELCA 1CI3M 2N49A 3LNNA 3FEWX 2F0VA 4LMQD 1HR0W 3AFPA 4DK3C 1N33Q 2F0DA 1IKMA 1GM5A 2QEXA 3UDGA 3Q0AA 4GKJL 3G7LA 4POGA 4R4QA 3RUZA 5E4WC 2MPMA 3RN2A 2UUAL 3BDCA 4LF5L 3SXHA 3GTOB 1I4XA 1PRTC 2CWAA 5FJ8H 1I94L 2VUMG 2HIVA 3IKJA 3I4OA 4DUZQ 4R4TA 1DYQA 2VS1A 1HZBA 3V96A 2Q8TA 3JAMc 4HIDA 4HIOA 1CSQA 1VQFA 3GTMH 3E0EA 2ID0A 4K5XA 1EY4A 4GZYC 1HZCA 5K36G 2I0QA 1IBKQ 5K5PA 1XMOQ 2PZWA 2NVYB 2M9VA 1SYEA 3I4NH 3H94A 1KIXA 4KHPL 1DZ1A 5IGFA 4TKOB 2LXJA 2CH4W 4K6LA 1WTOA 4A3GG 1G291 3W1GA 3H91A 2V1CC 3CF5A 4A3DB 5CV8A 3PUXA 4NXMQ 4XQNA 3K0XA 5KEEA 3J80c 3S17H 1VQ9A 4HAEA 3KYHC 2B2VA 5JAVA 4BXXH 1H9SA 1BNZA 4QB4A 1KQSA 3GV3A 2MGSA 1B8AA 5EPKA 4QUCA 1H9RA 1HUNA 3OIPA 4DFAA 4KTAA 3K5NA 2E2IB 2A19A 3KLSA 4QL5A 4K0KQ 1N32Q 4CDCC 3EFXD 4ULLA 2NVQB 2WKDA 4X3SA 3V05A 5EGTA 4RHRA 3P1HA 3K6OA 3RN5A 1JCKB 2RDHA 4IUTA 2IW3A 4RH6A 5ISRA 2LXKA 3M4YA 2NUCA 5BN4A 3I56A 3CCLA 1RJTA 2QF7A 1GJXA 1XNRL 4KJOA 4JBWA 2JEBI 2IHFA 3TBIB 2G5DA 4DR4L 5C5LA 3E3XA 4Y52H 2JA8H 1SNCA 1ASZA 1RODA 4RWSC 5HURA 2ZXOA 2PNHA 2R7ZH 2LFNA 3RZDH 3SEBA 4KN7C 2EY5A 2CWPA 3F2DA 4I7ZC 3MEFA 1R9TH 2J0TD 1VQJA 4GOPB 4FF3A 1FGUA 4K2KA 2YV5A 4UP8A 2PPBC 2F1MA 1SE3A 1H95A 4JI8L 4DV7L 1M4VA 3K5OA 1U0LA 1DCZA 2KCTA 2XRSD 2HT1A 1SDFA 2RDFA 1B44D 1VF5C 2IL8A 2WV6D 2FMCA 1TKWB 1V8QA 1KNAA 1SYFA 2B2TA 1FJGL 4B3SQ 1PMRA 2UXDQ 1GOZA 4DR3Q 4PZ7A 2ZM6L 2KEEA 2A68D 5GAGC 3Q8DA 2EPBA 4BA2I 1CHPD 4GKKL 2PQAA 3L0OA 3OW2A 3QOJA 3H0GB 4RGMA 1Z6HA 2PMZE 4R4OA 2K4KA 4XDXA 5EJWA 2F4VL 1NR2A 1EWIA 1G51A 4HCEA 4KI0A 3CCEA 1VQOA 4DK1A 2VZAA
chains in the Genus database with same CATH topology
1QZGA 1VQ8A 1NJIC 2E2IH 3GTQH 1EUJA 2R7DA 2K5HA 5ELOA 4GN5A 1YEZA 2N8NA 4JI2Q 2VQFL 3GD7A 1XMOL 3T1YQ 1SROA 1MJCA 4DR5Q 2NVQH 1SFOH 4R4IA 1D7QA 2JE6I 3JAMi 5JEAJ 5HGQA 4LW1A 1VQCA 3HOXG 4OWWB 1WYDA 4XTCS 2AKWB 5M3FG 1QUQB 2UUCL 3NELA 1EYGA 2UXCQ 1TWFH 1WOCA 1L1OB 1VQDA 1X3FA 3J81j 4DV5L 4NB3A 2Q2UA 3S14H 2OQ0A 1YJ9A 3KF8B 3CAMA 3AEVA 4A3DG 1HNXL 4X65Q 3GTKH 4KHPQ 2RF4A 4OXPA 4YY3Q 5FLMH 4DR2Q 1VQAA 1X56A 5JEAG 1K73C 4B3ML 1GO3E 4IPCA 4JYAQ 1SLJA 2D0OA 4KLKA 4GOPA 4GLXA 3F1ZA 4A76A 1MIUA 4A3FH 2MNAA 4UPAA 3J7A5 1Q7YC 3KFUA 2IY5B 2E8GA 5M5XH 4DV3Q 2MO0A 1EIYB 1IXRA 3CCUA 1TWAH 1V1QA 4LF6L 4A3CG 1PH7A 2HIXA 3EN2A 1WJJA 1A62A 1AE2A 3CCQA 4C3JH 2DUDA 2E5LQ 4LF8Q 1N32L 3J80i 3DM3A 1A8VA 1YJWA 3J81c 4IPGA 1CKNA 2AWNA 3RZOH 3T1HL 4IOAA 4DAYB 4BBRG 4X64Q 4LFCQ 1L1OC 1OXTA 1YJNA 1IBLQ 1A63A 4PG3A 4QIWE 1KRSA 1PV4A 1N8RC 1BBWA 3UDFA 4O2DA 3HOWG 1E7ZA 4LWCA 1P16A 3PSIA 2MQHA 3GO5A 4DUYQ 5BR8L 1BVSA 2OQKA 4IFDI 4L5QA 1EIFA 1S72A 4HIMA 1T9HA 3H3VH 1LM0A 1XPOA 1UWVA 5FLMG 4RMFA 4DV0Q 3K7AH 1O7IA 2VQEL 2VW9A 2DGYA 1VQKA 3JC66 2BA0A 2ZJRA 4IPDA 3KOJA 4JCVE 4BY1G 4A3FG 1PH6A 4JI5L 4A3IH 3AYHB 2A1AA 3CCRA 1XMQL 1J6QA 1NY4A 1YHBA 4P74A 4DKAC 5ELNA 4OWXB 1NTGA 1IZ6A 1I5FA 4JI4Q 4LFBL 4YCUA 2OTJA 5IE8A 5IWAL 1HNZL 1IBMQ 2D62A 4JI7Q 1Z9FA 4LFAL 3MXNB 5M5YH 1QVCA 1YHAA 4B3RL 4A3JH 2E2JH 3H0GH 1UE1A 1C9OA 1L1OA 3ZJYC 1IYJB 5HY6A 2RCNA 1VQNA 2WFWA 4X62L 2R92H 2AMCB 1OXSC 3AQQA 1E22A 4YCVA 5LMNQ 3ULPA 3CCMA 4DNIA 2JA9A 1HR0Q 3F2CA 5M3MH 3W5OA 2VY3A 1B70B 2JJQA 3A74A 4LUOA 1J5EL 2HQLA 2LSSA 1PH2A 4DR6L 1X54A 3TS2A 3S1RH 4LUVA 1KRTA 4A3IG 1UE5A 3M9BA 2JA5H 4IO9A 3PV0A 2K5VA 4JI8Q 2UXDL 1NBWA 4AQYL 1K3RA 5K36G 3OTOL 4EQ5A 1VQMA 3BJUA 5LMUQ 1BBUA 4DV1Q 4DR3L 4DR1Q 1CKOA 3U4ZA 4AYBE 4GOPC 3CMAA 4TQUS 1N36Q 3S1QH 2I5MX 1K8AC 2WB1E 2IX0A 4H02A 1FJGQ 4LF4Q 1GVPA 4BBSH 1OXVA 4GKJQ 1FVIA 4GN3B 2Z6KA 1VCIA 3GTGH 4DUZL 1CSPA 1I6HH 2ZJPA 2UUAQ 2F52A 4A3JG 2ZJQA 4LF5Q 4B3TQ 1N9WA 2JQOA 2Y0SE 4LF9L 3H0GG 3FKIH 3KJOA 1IL2A 1PHJA 2BH2A 3CCVA 2UUBL 3G6EA 3LGJA 4JBMA 1YVCA 2WAQG 1HZ9A 4MZ9A 2R92G 3CC7A 3PF5A 1I94Q 1Q81C 4X66L 1VQGA 1JJ2A 5GADC 5C4XH 4YCWA 3S24A 5GAHC 4HJ7A 1UEBA 4YWKA 4DAMA 5M3MG 2D0PA 1IBKL 4DR7L 1YZ6A 4GLVB 4LF7Q 1JB7A 1WFQA 3S16H 3K7UC 4NPSA 4BBRH 2F4VQ 1TWHH 3I2ZA 5C44H 3NBHB 3TS0A 4L5TA 2GVBA 3T1YL 2JA5G 4DR5L 3L7ZC 5IP7H 3HOWH 4XIGS 2CCZA 5DLQE 3CXCA 4OONA 4DV2L 1VS0A 4JOIC 3A0JA 3HKZE 1M1KC 3PO3H 3NENA 2WB1G 4O0AA 1GKHA 4NXML 4C3IH 2UXCL 4GNXC 1OTCA 3E9IA 3A5UA 1L0WA 3EIVA 4JI6Q 4BBSG 1YBYA 3D31A 4BY1H 3ULJA 4AH6A 4YY3L 1HNWL 4DR2L 1W3SA 4HJ8A 4JYAL 2BA1A 2AWOA 3FKIG 2NN6G 4YWMA 2XTIA 3K80C 1PH9A 4YHHQ 3OYYA 4JBJA 4P72A 4DV4Q 3GTJH 1HNXQ 3PUWA 5C4XG 4A3KH 3RLOA 3STBD 3CPFA 1FL0A 5IYBH 3CP0A 4K0KL 2UXBL 1Y1WH 2PI2E 2E2HH 1SMXA 4DV6L 3GTLH 1Q8KA 3HOVH 3GDEA 1PYSB 4RG1A 5C44G 2E5LL 3ER0A 4LF8L 4LF6Q 3IRBA 4NXNL 3KF6B 5IP7G 4LFCL 4X64L 4DPGA 1Q82C 4EX5A 2C35B 1VQ5A 4WJ3M 2ZTDA 3B6YA 2HHHQ 4UY8C 3K81C 2NZOA 4JI3Q 1Q12A 3PO3G 1YIJA 4R4CA 4UP9A 3L2PA 1DGSA 1P8LA 4R1JA 3T1HQ 4DUYL 4JOIA 3PUVA 4L5SA 3ERSX 1VQHA 1PH5A 3UDXA 3D0FA 1WI5A 1B7YB 5IYCH 3S1NH 4QJFA 2K50A 2QGQA 1K0RA 3SGIA 3J81i 2K75A 3U4VA 4IFDG 1VQ4A 4DV0L 4GNXA 4HJAA 2PQAB 2KHIA 5E7NA 3STBC 1LTLA 3K8AA 2QA4A 2JEAI 1E24A 4PZ6A 4TVAB 4A3LH 1PH3A 4A3EH 2JA7H 1N34Q 1XNRQ 2ZTCA 1QVGA 5FLXc 1RL2A 2R6GA 3KLWA 3CC4A 1C0AA 1E1OA 3DLLA 5GQOA 2Z6KC 3UDIA 2BH8A 3NEMA 2N78A 5C0XJ 2VQEQ 4A3KG 1XJVA 4DR4Q 5IYBG 3M3YH 1Y1WG 4J15A 4HJ9A 3RLFA 3S1MH 3HOVG 3WWVA 3PUYA 3CPWA 4JI5Q 4A3BH 2KBNA 4APVA 4JI4L 1SE8A 1JMCA 2NVTH 4JI0Q 1Y1VH 4OO1G 1QUQA 3HOUH 1EFWA 4KHZA 5C0XG 1X3GA 4C3HH 4PMWA 1KHIA 1I3QH 5C4JH 4BY7H 4LFBQ 1Q1BA 1PH8A 5IWAQ 1X3EA 3TEHB 1HNZQ 3PF4A 3GTPH 2VUMH 1D8LA 4A3MH 2MFIA 5IYCG 5LMNL 2UU9Q 1XNQL 3PO2H 1KXLA 4B3RQ 1HR0L 3BZKA 1VQEA 3G48A 3J7ZC 4B3SL 4A3LG 4DV7Q 4A3EG 2JA7G 1NE3A 1LYLA 2N49A 2L15A 4JI1Q 3H3VI 4A75A 2ASBA 4AIMA 2B29A 5LMNW 1J5EQ 3M7NA 3W1BA 1HR0W 2MO1A 3AFPA 4DK3C 4Y7NH 4OX9Q 4DV1L 2B63H 4GS3A 4DR6Q 1MJEA 1AH9A 3M4OH 3CC2A 4JBKA 4LUZA 2CFMA 1JE5A 1HJPA 1N33Q 2IX1A 2XGTA 1GM5A 2QEXA 4A3BG 4JV5Q 3UDGA 2ZM6Q 4AQYQ 1Y1VG 4GKJL 1YNXA 3I7FA 4IJHA 4POGA 2F3IA 4R4QA 1WCMG 3HOUG 1YHQA 3CQZH 1XPUA 2YU9H 3RN2A 2UUAL 4LF5L 1KC8C 2OWOA 4BY7G 4GKKQ 1AE3A 2CWAA 3TREA 1KL9A 5FJ8H 5C3EH 1VQLA 2NVXH 1PFSA 3M4QA 1M90C 1I94L 2VUMG 2HIVA 3I4OA 4DUZQ 4A3MG 4R4TA 3PO2G 2VS1A 1HZBA 3HOYH 2JK8A 1SR3A 3JAMc 4JI2L 4HIDA 5H1SE 4HIOA 2Q2IA 2UUBQ 2R93H 2B3GA 3S15H 1CSQA 1PYBA 5AJ3Q 1VQFA 1U5KA 3GTMH 3ICEA 2PI2A 1K83H 1Z47A 3E0EA 3CD6A 2ID0A 4IPHA 1YITA 1VQ7A 1TWGH 1X65A 1HZCA 4AYBG 2VQFQ 4QGUA 1IBKQ 2CQOA 1ASYA 4YWLA 2VL6A 3UE0A 1XMOQ 2I0QA 3PIPA 4DK6C 4DR7Q 2B63G 2NZHA 5IP9H 3I4NH 1VQPA 2ES2A 2EQSA 1KIXA 4X65L 4KHPL 2A8VA 2LXJA 3I55A 3KJPA 2Y0SG 3PCOB 4JI6L 1G291 2K52A 3M4PA 3PIOA 4DV2Q 2UUCQ 4A3GG 2GVAA 1W2BA 3W1GA 1X9NA 5IYDH 2V1CC 1Q46A 4MNOA 3CF5A 4DV5Q 3PUXA 4DV3L 4NXMQ 1TWCH 3K0XA 2YTYA 3KDFB 5FJ8G 5C3EG 3J80c 4B3MQ 3E9HA 1VQBA 3S17H 4P73A 4YHHL 1VQ9A 3BZCA 3CCJA 2KENA 3KYHC 4DV4L 4HIKA 1HNWQ 4BXXH 3HOYG 1X55A 3RLNA 1Y14B 2IHEA 2NN6I 2I5HA 1KQSA 1B8AA 5EAYA 1E1TA 1SN8A 2R93G 4POFA 4BA1I 1HH2P 1IBLL 3HFZB 2GN5A 4IFDJ 4IOCA 3CCSA 4A93H 4UP7A 1HZAA 2A19A 2R7FA 1N32Q 3HKZG 4QL5A 5J3BA 4K0KQ 2UXBQ 3ULLA 4P75A 1JT8A 4DV6Q 3UE1A 2HHHL 5IY0A 5IP9G 3I4NG 3PUZA 2RHSB 4JI3L 1LUZA 2YTVA 3EBEA 3RN5A 1Q86C 4NXNQ 1L2FA 3G4SA 2KCMA 2LXKA 5IYDG 1BKBA 4OWTB 4JC0A 1E3PA 5BR8Q 3I56A 3CCLA 3RR5A 1KAWA 2N3SA 2EIFA 2YTXA 3G71A 1N34L 1XNRL 4JBWA 2JEBI 2IHFA 4HJ5A 1VQ6A 1RIPA 4IJLA 4BXXG 3A5ZB 4DR4L 1NMGA 1V43A 1G6PA 1XMQQ 4JG2A 1I50H 3U50C 3FP9A 5M5WH 2OCEA 1IBML 4Y52H 3AFQA 5GAEC 4JI7L 2JA8H 3I4MH 1WCMH 2ZTEA 2Q2TA 3TRZA 1KD1C 1EQRA 3F8TA 1ASZA 1K9MC 1CUKA 4A93G 4JI0L 1GD7A 1V9PA 2K5NA 3S2HH 2PNHA 3CW2C 2R7ZH 3PGZA 3GTOH 3RZDH 4LFAQ 3S2DH 3U58A 2ATWA 4C2MH 4OO1I 4PZ8A 2CWPA 3HKSA 5JJLA 1QVFA 3CMEA 5JJKA 3F2DA 5C0XI 4ME3A 3MEFA 1R9TH 2UU9L 1PVOA 1XPRA 1VQJA 4GOPB 1FGUA 4X62Q 1PH1A 2EXDA 2CKZB 2YV5A 1X6OA 4UP8A 3F2BA 3KDFA 4GLAC 2I5LX 2RHQB 2Z0SA 1JJCB 1EOVA 2WAQE 2OTLA 4JI8L 3HOZH 1H95A 2JA6H 4DV7L 5JJIA 1TXYA 1XNQQ 1U0LA 1PH4A 5LMUL 4JI1L 4DR1L 2KCTA 4MTNA 2WP8J 2HT1A 1JJGA 1N36L 4QQBX 2Q2HA 3VDYA 2NVYH 3KF6A 4OX9L 1FJGL 2UXDQ 4LF4L 3M85A 4B3SQ 2VNUD 1UE6A 1CKNB 4A3GH 3I4MG 2JA8G 1N33L 3OTOQ 1QZHA 1S40A 1CKMA 3HOXH 2H5XA 4DR3Q 4JV5L 4PZ7A 2ALYB 2KHJA 4A4IA 5IT9c 2ZM6L 3RNUA 1K8GA 4B3TL 5GAGC 5M3FH 3Q8DA 4P71A 2K14A 4L5RC 1UE7A 2IT1A 2R7ZG 3FHWA 4BA2I 1XTDA 3H15A 2FXQA 4QY7A 1A0IA 1S3OA 1OXXK 4A3DH 4LNQA 1Q1EA 4GKKL 1PA6A 4GN4B 2PQAA 3BU2A 2AHOB 3L0OA 1OXUA 3OW2A 1EQQA 4LF9Q 1SRUA 1VQIA 4LF7L 2PMZE 4R4OA 2K4KA 4WJ4A 1MKHA 2F4VL 1EWIA 1NMFA 3TQYA 4ALPA 1G51A 4X66Q 4GNXB 4KI0A 4FDBA 5GROA 3HOZG 5AJ3L 4A3CH 3CCEA 1VQOA 2YYZA 4X6AH 1C7YA 2VZAA 2JA6G 1YI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZG A;  1VQ8 A;  1NJI C;  2E2I H;  3GTQ H;  1EUJ A;  2R7D A;  2K5H A;  5ELO A;  4GN5 A;  1YEZ A;  2N8N A;  4JI2 Q;  2VQF L;  3GD7 A;  1XMO L;  3T1Y Q;  1SRO A;  1MJC A;  4DR5 Q;  2NVQ H;  1SFO H;  4R4I A;  1D7Q A;  2JE6 I;  3JAM i;  5JEA J;  5HGQ A;  4LW1 A;  1VQC A;  3HOX G;  4OWW B;  1WYD A;  4XTC S;  2AKW B;  5M3F G;  1QUQ B;  2UUC L;  3NEL A;  1EYG A;  2UXC Q;  1TWF H;  1WOC A;  1L1O B;  1VQD A;  1X3F A;  3J81 j;  4DV5 L;  4NB3 A;  2Q2U A;  3S14 H;  2OQ0 A;  1YJ9 A;  3KF8 B;  3CAM A;  3AEV A;  4A3D G;  1HNX L;  4X65 Q;  3GTK H;  4KHP Q;  2RF4 A;  4OXP A;  4YY3 Q;  5FLM H;  4DR2 Q;  1VQA A;  1X56 A;  5JEA G;  1K73 C;  4B3M L;  1GO3 E;  4IPC A;  4JYA Q;  1SLJ A;  2D0O A;  4KLK A;  4GOP A;  4GLX A;  3F1Z A;  4A76 A;  1MIU A;  4A3F H;  2MNA A;  4UPA A;  3J7A 5;  1Q7Y C;  3KFU A;  2IY5 B;  2E8G A;  5M5X H;  4DV3 Q;  2MO0 A;  1EIY B;  1IXR A;  3CCU A;  1TWA H;  1V1Q A;  4LF6 L;  4A3C G;  1PH7 A;  2HIX A;  3EN2 A;  1WJJ A;  1A62 A;  1AE2 A;  3CCQ A;  4C3J H;  2DUD A;  2E5L Q;  4LF8 Q;  1N32 L;  3J80 i;  3DM3 A;  1A8V A;  1YJW A;  3J81 c;  4IPG A;  1CKN A;  2AWN A;  3RZO H;  3T1H L;  4IOA A;  4DAY B;  4BBR G;  4X64 Q;  4LFC Q;  1L1O C;  1OXT A;  1YJN A;  1IBL Q;  1A63 A;  4PG3 A;  4QIW E;  1KRS A;  1PV4 A;  1N8R C;  1BBW A;  3UDF A;  4O2D A;  3HOW G;  1E7Z A;  4LWC A;  1P16 A;  3PSI A;  2MQH A;  3GO5 A;  4DUY Q;  5BR8 L;  1BVS A;  2OQK A;  4IFD I;  4L5Q A;  1EIF A;  1S72 A;  4HIM A;  1T9H A;  3H3V H;  1LM0 A;  1XPO A;  1UWV A;  5FLM G;  4RMF A;  4DV0 Q;  3K7A H;  1O7I A;  2VQE L;  2VW9 A;  2DGY A;  1VQK A;  3JC6 6;  2BA0 A;  2ZJR A;  4IPD A;  3KOJ A;  4JCV E;  4BY1 G;  4A3F G;  1PH6 A;  4JI5 L;  4A3I H;  3AYH B;  2A1A A;  3CCR A;  1XMQ L;  1J6Q A;  1NY4 A;  1YHB A;  4P74 A;  4DKA C;  5ELN A;  4OWX B;  1NTG A;  1IZ6 A;  1I5F A;  4JI4 Q;  4LFB L;  4YCU A;  2OTJ A;  5IE8 A;  5IWA L;  1HNZ L;  1IBM Q;  2D62 A;  4JI7 Q;  1Z9F A;  4LFA L;  3MXN B;  5M5Y H;  1QVC A;  1YHA A;  4B3R L;  4A3J H;  2E2J H;  3H0G H;  1UE1 A;  1C9O A;  1L1O A;  3ZJY C;  1IYJ B;  5HY6 A;  2RCN A;  1VQN A;  2WFW A;  4X62 L;  2R92 H;  2AMC B;  1OXS C;  3AQQ A;  1E22 A;  4YCV A;  5LMN Q;  3ULP A;  3CCM A;  4DNI A;  2JA9 A;  1HR0 Q;  3F2C A;  5M3M H;  3W5O A;  2VY3 A;  1B70 B;  2JJQ A;  3A74 A;  4LUO A;  1J5E L;  2HQL A;  2LSS A;  1PH2 A;  4DR6 L;  1X54 A;  3TS2 A;  3S1R H;  4LUV A;  1KRT A;  4A3I G;  1UE5 A;  3M9B A;  2JA5 H;  4IO9 A;  3PV0 A;  2K5V A;  4JI8 Q;  2UXD L;  1NBW A;  4AQY L;  1K3R A;  5K36 G;  3OTO L;  4EQ5 A;  1VQM A;  3BJU A;  5LMU Q;  1BBU A;  4DV1 Q;  4DR3 L;  4DR1 Q;  1CKO A;  3U4Z A;  4AYB E;  4GOP C;  3CMA A;  4TQU S;  1N36 Q;  3S1Q H;  2I5M X;  1K8A C;  2WB1 E;  2IX0 A;  4H02 A;  1FJG Q;  4LF4 Q;  1GVP A;  4BBS H;  1OXV A;  4GKJ Q;  1FVI A;  4GN3 B;  2Z6K A;  1VCI A;  3GTG H;  4DUZ L;  1CSP A;  1I6H H;  2ZJP A;  2UUA Q;  2F52 A;  4A3J G;  2ZJQ A;  4LF5 Q;  4B3T Q;  1N9W A;  2JQO A;  2Y0S E;  4LF9 L;  3H0G G;  3FKI H;  3KJO A;  1IL2 A;  1PHJ A;  2BH2 A;  3CCV A;  2UUB L;  3G6E A;  3LGJ A;  4JBM A;  1YVC A;  2WAQ G;  1HZ9 A;  4MZ9 A;  2R92 G;  3CC7 A;  3PF5 A;  1I94 Q;  1Q81 C;  4X66 L;  1VQG A;  1JJ2 A;  5GAD C;  5C4X H;  4YCW A;  3S24 A;  5GAH C;  4HJ7 A;  1UEB A;  4YWK A;  4DAM A;  5M3M G;  2D0P A;  1IBK L;  4DR7 L;  1YZ6 A;  4GLV B;  4LF7 Q;  1JB7 A;  1WFQ A;  3S16 H;  3K7U C;  4NPS A;  4BBR H;  2F4V Q;  1TWH H;  3I2Z A;  5C44 H;  3NBH B;  3TS0 A;  4L5T A;  2GVB A;  3T1Y L;  2JA5 G;  4DR5 L;  3L7Z C;  5IP7 H;  3HOW H;  4XIG S;  2CCZ A;  5DLQ E;  3CXC A;  4OON A;  4DV2 L;  1VS0 A;  4JOI C;  3A0J A;  3HKZ E;  1M1K C;  3PO3 H;  3NEN A;  2WB1 G;  4O0A A;  1GKH A;  4NXM L;  4C3I H;  2UXC L;  4GNX C;  1OTC A;  3E9I A;  3A5U A;  1L0W A;  3EIV A;  4JI6 Q;  4BBS G;  1YBY A;  3D31 A;  4BY1 H;  3ULJ A;  4AH6 A;  4YY3 L;  1HNW L;  4DR2 L;  1W3S A;  4HJ8 A;  4JYA L;  2BA1 A;  2AWO A;  3FKI G;  2NN6 G;  4YWM A;  2XTI A;  3K80 C;  1PH9 A;  4YHH Q;  3OYY A;  4JBJ A;  4P72 A;  4DV4 Q;  3GTJ H;  1HNX Q;  3PUW A;  5C4X G;  4A3K H;  3RLO A;  3STB D;  3CPF A;  1FL0 A;  5IYB H;  3CP0 A;  4K0K L;  2UXB L;  1Y1W H;  2PI2 E;  2E2H H;  1SMX A;  4DV6 L;  3GTL H;  1Q8K A;  3HOV H;  3GDE A;  1PYS B;  4RG1 A;  5C44 G;  2E5L L;  3ER0 A;  4LF8 L;  4LF6 Q;  3IRB A;  4NXN L;  3KF6 B;  5IP7 G;  4LFC L;  4X64 L;  4DPG A;  1Q82 C;  4EX5 A;  2C35 B;  1VQ5 A;  4WJ3 M;  2ZTD A;  3B6Y A;  2HHH Q;  4UY8 C;  3K81 C;  2NZO A;  4JI3 Q;  1Q12 A;  3PO3 G;  1YIJ A;  4R4C A;  4UP9 A;  3L2P A;  1DGS A;  1P8L A;  4R1J A;  3T1H Q;  4DUY L;  4JOI A;  3PUV A;  4L5S A;  3ERS X;  1VQH A;  1PH5 A;  3UDX A;  3D0F A;  1WI5 A;  1B7Y B;  5IYC H;  3S1N H;  4QJF A;  2K50 A;  2QGQ A;  1K0R A;  3SGI A;  3J81 i;  2K75 A;  3U4V A;  4IFD G;  1VQ4 A;  4DV0 L;  4GNX A;  4HJA A;  2PQA B;  2KHI A;  5E7N A;  3STB C;  1LTL A;  3K8A A;  2QA4 A;  2JEA I;  1E24 A;  4PZ6 A;  4TVA B;  4A3L H;  1PH3 A;  4A3E H;  2JA7 H;  1N34 Q;  1XNR Q;  2ZTC A;  1QVG A;  5FLX c;  1RL2 A;  2R6G A;  3KLW A;  3CC4 A;  1C0A A;  1E1O A;  3DLL A;  5GQO A;  2Z6K C;  3UDI A;  2BH8 A;  3NEM A;  2N78 A;  5C0X J;  2VQE Q;  4A3K G;  1XJV A;  4DR4 Q;  5IYB G;  3M3Y H;  1Y1W G;  4J15 A;  4HJ9 A;  3RLF A;  3S1M H;  3HOV G;  3WWV A;  3PUY A;  3CPW A;  4JI5 Q;  4A3B H;  2KBN A;  4APV A;  4JI4 L;  1SE8 A;  1JMC A;  2NVT H;  4JI0 Q;  1Y1V H;  4OO1 G;  1QUQ A;  3HOU H;  1EFW A;  4KHZ A;  5C0X G;  1X3G A;  4C3H H;  4PMW A;  1KHI A;  1I3Q H;  5C4J H;  4BY7 H;  4LFB Q;  1Q1B A;  1PH8 A;  5IWA Q;  1X3E A;  3TEH B;  1HNZ Q;  3PF4 A;  3GTP H;  2VUM H;  1D8L A;  4A3M H;  2MFI A;  5IYC G;  5LMN L;  2UU9 Q;  1XNQ L;  3PO2 H;  1KXL A;  4B3R Q;  1HR0 L;  3BZK A;  1VQE A;  3G48 A;  3J7Z C;  4B3S L;  4A3L G;  4DV7 Q;  4A3E G;  2JA7 G;  1NE3 A;  1LYL A;  2N49 A;  2L15 A;  4JI1 Q;  3H3V I;  4A75 A;  2ASB A;  4AIM A;  2B29 A;  5LMN W;  1J5E Q;  3M7N A;  3W1B A;  1HR0 W;  2MO1 A;  3AFP A;  4DK3 C;  4Y7N H;  4OX9 Q;  4DV1 L;  2B63 H;  4GS3 A;  4DR6 Q;  1MJE A;  1AH9 A;  3M4O H;  3CC2 A;  4JBK A;  4LUZ A;  2CFM A;  1JE5 A;  1HJP A;  1N33 Q;  2IX1 A;  2XGT A;  1GM5 A;  2QEX A;  4A3B G;  4JV5 Q;  3UDG A;  2ZM6 Q;  4AQY Q;  1Y1V G;  4GKJ L;  1YNX A;  3I7F A;  4IJH A;  4POG A;  2F3I A;  4R4Q A;  1WCM G;  3HOU G;  1YHQ A;  3CQZ H;  1XPU A;  2YU9 H;  3RN2 A;  2UUA L;  4LF5 L;  1KC8 C;  2OWO A;  4BY7 G;  4GKK Q;  1AE3 A;  2CWA A;  3TRE A;  1KL9 A;  5FJ8 H;  5C3E H;  1VQL A;  2NVX H;  1PFS A;  3M4Q A;  1M90 C;  1I94 L;  2VUM G;  2HIV A;  3I4O A;  4DUZ Q;  4A3M G;  4R4T A;  3PO2 G;  2VS1 A;  1HZB A;  3HOY H;  2JK8 A;  1SR3 A;  3JAM c;  4JI2 L;  4HID A;  5H1S E;  4HIO A;  2Q2I A;  2UUB Q;  2R93 H;  2B3G A;  3S15 H;  1CSQ A;  1PYB A;  5AJ3 Q;  1VQF A;  1U5K A;  3GTM H;  3ICE A;  2PI2 A;  1K83 H;  1Z47 A;  3E0E A;  3CD6 A;  2ID0 A;  4IPH A;  1YIT A;  1VQ7 A;  1TWG H;  1X65 A;  1HZC A;  4AYB G;  2VQF Q;  4QGU A;  1IBK Q;  2CQO A;  1ASY A;  4YWL A;  2VL6 A;  3UE0 A;  1XMO Q;  2I0Q A;  3PIP A;  4DK6 C;  4DR7 Q;  2B63 G;  2NZH A;  5IP9 H;  3I4N H;  1VQP A;  2ES2 A;  2EQS A;  1KIX A;  4X65 L;  4KHP L;  2A8V A;  2LXJ A;  3I55 A;  3KJP A;  2Y0S G;  3PCO B;  4JI6 L;  1G29 1;  2K52 A;  3M4P A;  3PIO A;  4DV2 Q;  2UUC Q;  4A3G G;  2GVA A;  1W2B A;  3W1G A;  1X9N A;  5IYD H;  2V1C C;  1Q46 A;  4MNO A;  3CF5 A;  4DV5 Q;  3PUX A;  4DV3 L;  4NXM Q;  1TWC H;  3K0X A;  2YTY A;  3KDF B;  5FJ8 G;  5C3E G;  3J80 c;  4B3M Q;  3E9H A;  1VQB A;  3S17 H;  4P73 A;  4YHH L;  1VQ9 A;  3BZC A;  3CCJ A;  2KEN A;  3KYH C;  4DV4 L;  4HIK A;  1HNW Q;  4BXX H;  3HOY G;  1X55 A;  3RLN A;  1Y14 B;  2IHE A;  2NN6 I;  2I5H A;  1KQS A;  1B8A A;  5EAY A;  1E1T A;  1SN8 A;  2R93 G;  4POF A;  4BA1 I;  1HH2 P;  1IBL L;  3HFZ B;  2GN5 A;  4IFD J;  4IOC A;  3CCS A;  4A93 H;  4UP7 A;  1HZA A;  2A19 A;  2R7F A;  1N32 Q;  3HKZ G;  4QL5 A;  5J3B A;  4K0K Q;  2UXB Q;  3ULL A;  4P75 A;  1JT8 A;  4DV6 Q;  3UE1 A;  2HHH L;  5IY0 A;  5IP9 G;  3I4N G;  3PUZ A;  2RHS B;  4JI3 L;  1LUZ A;  2YTV A;  3EBE A;  3RN5 A;  1Q86 C;  4NXN Q;  1L2F A;  3G4S A;  2KCM A;  2LXK A;  5IYD G;  1BKB A;  4OWT B;  4JC0 A;  1E3P A;  5BR8 Q;  3I56 A;  3CCL A;  3RR5 A;  1KAW A;  2N3S A;  2EIF A;  2YTX A;  3G71 A;  1N34 L;  1XNR L;  4JBW A;  2JEB I;  2IHF A;  4HJ5 A;  1VQ6 A;  1RIP A;  4IJL A;  4BXX G;  3A5Z B;  4DR4 L;  1NMG A;  1V43 A;  1G6P A;  1XMQ Q;  4JG2 A;  1I50 H;  3U50 C;  3FP9 A;  5M5W H;  2OCE A;  1IBM L;  4Y52 H;  3AFQ A;  5GAE C;  4JI7 L;  2JA8 H;  3I4M H;  1WCM H;  2ZTE A;  2Q2T A;  3TRZ A;  1KD1 C;  1EQR A;  3F8T A;  1ASZ A;  1K9M C;  1CUK A;  4A93 G;  4JI0 L;  1GD7 A;  1V9P A;  2K5N A;  3S2H H;  2PNH A;  3CW2 C;  2R7Z H;  3PGZ A;  3GTO H;  3RZD H;  4LFA Q;  3S2D H;  3U58 A;  2ATW A;  4C2M H;  4OO1 I;  4PZ8 A;  2CWP A;  3HKS A;  5JJL A;  1QVF A;  3CME A;  5JJK A;  3F2D A;  5C0X I;  4ME3 A;  3MEF A;  1R9T H;  2UU9 L;  1PVO A;  1XPR A;  1VQJ A;  4GOP B;  1FGU A;  4X62 Q;  1PH1 A;  2EXD A;  2CKZ B;  2YV5 A;  1X6O A;  4UP8 A;  3F2B A;  3KDF A;  4GLA C;  2I5L X;  2RHQ B;  2Z0S A;  1JJC B;  1EOV A;  2WAQ E;  2OTL A;  4JI8 L;  3HOZ H;  1H95 A;  2JA6 H;  4DV7 L;  5JJI A;  1TXY A;  1XNQ Q;  1U0L A;  1PH4 A;  5LMU L;  4JI1 L;  4DR1 L;  2KCT A;  4MTN A;  2WP8 J;  2HT1 A;  1JJG A;  1N36 L;  4QQB X;  2Q2H A;  3VDY A;  2NVY H;  3KF6 A;  4OX9 L;  1FJG L;  2UXD Q;  4LF4 L;  3M85 A;  4B3S Q;  2VNU D;  1UE6 A;  1CKN B;  4A3G H;  3I4M G;  2JA8 G;  1N33 L;  3OTO Q;  1QZH A;  1S40 A;  1CKM A;  3HOX H;  2H5X A;  4DR3 Q;  4JV5 L;  4PZ7 A;  2ALY B;  2KHJ A;  4A4I A;  5IT9 c;  2ZM6 L;  3RNU A;  1K8G A;  4B3T L;  5GAG C;  5M3F H;  3Q8D A;  4P71 A;  2K14 A;  4L5R C;  1UE7 A;  2IT1 A;  2R7Z G;  3FHW A;  4BA2 I;  1XTD A;  3H15 A;  2FXQ A;  4QY7 A;  1A0I A;  1S3O A;  1OXX K;  4A3D H;  4LNQ A;  1Q1E A;  4GKK L;  1PA6 A;  4GN4 B;  2PQA A;  3BU2 A;  2AHO B;  3L0O A;  1OXU A;  3OW2 A;  1EQQ A;  4LF9 Q;  1SRU A;  1VQI A;  4LF7 L;  2PMZ E;  4R4O A;  2K4K A;  4WJ4 A;  1MKH A;  2F4V L;  1EWI A;  1NMF A;  3TQY A;  4ALP A;  1G51 A;  4X66 Q;  4GNX B;  4KI0 A;  4FDB A;  5GRO A;  3HOZ G;  5AJ3 L;  4A3C H;  3CCE A;  1VQO A;  2YYZ A;  4X6A H;  1C7Y A;  2VZA A;  2JA6 G;  1YI2 A; 
#chains in the Genus database with same CATH topology
 4FF4 A;  1VQ8 A;  1NJI C;  3GTQ H;  1E2W A;  3S1R B;  5KYL A;  1STE A;  1WTH A;  3MTS A;  1SRO A;  4F88 A;  4R4I A;  1D7Q A;  1G8Z D;  1VF7 A;  2AQ2 B;  2JE6 I;  3JAM i;  3Q23 A;  3S1Q B;  4OWW B;  2WB1 B;  1JB3 A;  1RTN A;  3J81 j;  1VQD A;  3NTI A;  4OIJ A;  1BR9 A;  2OQ0 A;  3GTG B;  3KF8 B;  3MA2 B;  1K73 C;  3D6C A;  4JYA Q;  1SLJ A;  3VR3 A;  4GLX A;  1SYD A;  2MNA A;  3J7A 5;  1Q7Y C;  5EBD A;  5EPJ A;  1EIY B;  3CCU A;  5COR A;  4A3C G;  4XYQ A;  4XT1 B;  1QNK A;  1WJJ A;  3CCQ A;  1TWH B;  5C44 B;  3J80 i;  3J81 c;  4ZUI A;  3RZO H;  4DAY B;  2EZV A;  1F9S A;  3VR4 A;  4LFC Q;  1L1O C;  3I8Z A;  3GV6 A;  1GUT A;  2B8G A;  1BBW A;  1PZJ D;  1E2V A;  1RF2 D;  2XSC A;  3HOW G;  2PNR C;  2QDB A;  4LWC A;  3MVV A;  2NTS A;  3GO5 A;  1BVS A;  3NPP A;  1BXT A;  3WDN A;  5IOC A;  1KLG D;  4KKU A;  5FK9 C;  1UAP A;  4HIM A;  4RCN A;  3H3V H;  1STB A;  1WD0 A;  1G91 A;  1C4Q A;  5CMD A;  1QJO A;  5A2Q L;  2ZJR A;  3KOJ A;  1QWY A;  2CVR A;  4A3I H;  3GTJ B;  3MXN A;  4A3K B;  4R9W A;  2K5Q A;  2B2W C;  4OWX B;  4C3J G;  1NTG A;  4ABN A;  4LFB L;  2OTJ A;  2LY7 A;  5IE8 A;  1AN8 A;  4B9W A;  1LTB D;  2OT2 A;  4JI7 Q;  4LFA L;  5M5Y H;  1EIG A;  2FIN B;  1F9P A;  1I4H A;  5EKK A;  4FXD A;  3GQB A;  1VQN A;  1E0B A;  1JR0 D;  1NSN S;  3AQQ A;  1E22 A;  4YCV A;  3ULP A;  5C3X A;  1B70 B;  2B2U A;  3X3M A;  4A3E B;  3A56 A;  1PRT B;  1KRT A;  4IO9 A;  5T1G A;  3M3Y B;  4EQ5 A;  5D3D A;  1VQM A;  1ET6 A;  3U4Z A;  4QUF A;  1DM0 B;  4TQU S;  2I5M X;  1K8A C;  4H02 A;  1O80 A;  4BBS H;  4GKJ Q;  1EY7 A;  1GXD C;  4DUZ L;  1CSP A;  4FYD A;  2CW0 D;  2UUA Q;  4LF5 Q;  4A3J G;  1I3Q B;  1N9W A;  2Y0S E;  4RFB A;  3KJO A;  1AFP A;  2F0J A;  3E5S A;  1V1O A;  3BG3 A;  3GTP B;  1HZ9 A;  2FJ2 A;  2R92 G;  1I94 Q;  2VUM B;  4HMI A;  5CV7 A;  1Q81 C;  4HJ7 A;  5GAH C;  1UEB A;  5M3M G;  1IBK L;  1YZ6 A;  3HGB A;  1CQF A;  4GLV B;  3N6R A;  4BBR H;  4M8A A;  1B50 A;  1RTO A;  4L5T A;  1U4R A;  2GVB A;  5LHY 1;  5JJZ A;  1WTP A;  4XIG S;  4RGT A;  2RCF A;  4R8I A;  1EQT A;  3M4O B;  1M1K C;  4N9T A;  3PO3 H;  3I90 A;  4NXM L;  5I2Y A;  1BOS A;  4BY1 H;  3TZU A;  4AH6 A;  2YU9 B;  1SYB A;  1W3S A;  4HJ8 A;  1HUM A;  1IL8 A;  1KAB A;  2NN6 G;  1LAB A;  2O2L D;  2NVX B;  1SSO A;  3K80 C;  3BVZ A;  1B1Z A;  4XQJ A;  3SE0 A;  3OYY A;  2IPK D;  3MFY A;  3PUW A;  4RCO A;  3RLO A;  3STB D;  3CPF A;  4K0K L;  3ZYY X;  3E0J A;  2K1B A;  3JAM L;  2I07 B;  4O1N A;  3SR1 A;  3GDE A;  1K83 B;  4RG1 A;  4LF8 L;  4FP5 D;  1EEF D;  3IRB A;  3W2D A;  5C0X H;  2DN8 A;  5LL6 S;  2F0W A;  4UDU C;  1Q12 A;  4R4C A;  4UP9 A;  4ZQ3 A;  4C3I G;  1PTO H;  1TS2 A;  4KHV A;  3T1H Q;  4JOI A;  5C4Z A;  3NUC A;  1WTQ A;  4L5S A;  3UDX A;  3S1N H;  3MWY W;  1STN A;  2QGQ A;  1K0R A;  1YNJ C;  3J81 i;  4DV0 L;  4GNX A;  5ELF A;  2JEA I;  1TWC B;  2FHT A;  4PZ6 A;  5DM6 3;  1XNR Q;  1QVG A;  1RL2 A;  4PQX A;  3J80 L;  1C0A A;  2Z6K C;  3NEM A;  4DR4 Q;  5L37 A;  5IYB G;  1BF4 A;  4J15 A;  3MEH A;  4HJ9 A;  3HOV G;  3T53 B;  3CPW A;  2F0S A;  3TME A;  5CGK A;  2NVT H;  2EXZ A;  1Y1V H;  4ZLT F;  4OO1 G;  1QUQ A;  2H4O A;  1EZ8 A;  2A69 C;  3HOU H;  4CBV A;  1EFW A;  1LTA D;  1STH A;  2F0G A;  1UNS A;  2CQA A;  5C4J H;  4DXF A;  3BDL A;  5E4X A;  5IYC G;  3PO2 H;  2BDO A;  1PRT D;  1DXM A;  1NNX A;  4YIJ A;  1VQE A;  1PZK D;  3TDQ A;  4B3S L;  4DV7 Q;  4M1U B;  2JA7 G;  5KRU A;  3H3V I;  2F4I A;  3IFD A;  4A75 A;  2ASB A;  4AIM A;  2B29 A;  3M7N A;  3W1B A;  2XWB B;  3NTK A;  1I50 B;  2B63 H;  5M5W B;  4DR6 Q;  2KCC A;  4GS3 A;  1AH9 A;  3D4W A;  1O7Y A;  4LUZ A;  1WCM B;  2CFM A;  1HJP A;  4XXE A;  2EJG C;  2XGT A;  2ZM6 Q;  2BOS A;  1WTW A;  3I7F A;  3S2H B;  4NMZ A;  1SEB D;  2EOT A;  3OW7 A;  4CJ0 B;  5KYI A;  2OWO A;  4GKK Q;  1AE3 A;  4K6D A;  3TRE A;  5C3E H;  1PFS A;  3M4Q A;  1M90 C;  4EQP A;  4A3M G;  1SMY C;  3HOY H;  2K32 A;  5H1S E;  2K04 A;  2Q2I A;  1Z7T A;  3S15 H;  1U5K A;  1Z47 A;  3TP8 A;  1YIT A;  2EY6 A;  1VQ7 A;  1EY5 A;  3MXU A;  4OHJ A;  1TWG H;  1X65 A;  4AYB G;  1ASY A;  2CQO A;  5EBC A;  1GHJ A;  4DK6 C;  5F2D A;  4CGY B;  1VQP A;  1QOH A;  1V1P B;  4OGQ C;  2ZXP A;  3KJP A;  2K52 A;  3M4P A;  4DV2 Q;  2D9U A;  1X9N A;  1W2B A;  5IYD H;  1Q46 A;  3X3N A;  3MC0 B;  3KDF B;  1IW7 C;  3E9H A;  4P73 A;  3BZC A;  5CC4 A;  4CDE C;  3BS1 A;  3I3C A;  1E1T A;  2R93 G;  4BA1 I;  1HH2 P;  1ICW A;  2PCF B;  2KEC A;  4A93 H;  2R7F A;  3I91 A;  3HKZ G;  3L9A X;  4P75 A;  1QCB D;  4R8N A;  1JE4 A;  3UE1 A;  1BBX C;  1SFO B;  1KDA A;  2HHH L;  5IP9 G;  3BYY B;  3A54 A;  1LUZ A;  1U9R A;  3NSW A;  1STA A;  3CKI B;  4N9P A;  3NK9 A;  1L2F A;  1BKB A;  3S14 B;  4ID6 A;  1E3P A;  4JC0 A;  4HTH A;  3GTK B;  2EIF A;  4IQZ A;  4RKL A;  3NQT A;  4X3K A;  3VA5 A;  1VQ6 A;  2HQE A;  4IJL A;  1IKL A;  1NMG A;  5M5X B;  1G6P A;  4JG2 A;  3OPO A;  3FP9 A;  4JVZ A;  2OCE A;  1HQM C;  1JOO A;  5GAE C;  5KIX A;  4JI7 L;  2ZTE A;  1KD1 C;  3F8T A;  4C3J B;  4FVM A;  3D3R A;  1CUK A;  1RD9 D;  3D4D A;  4JI0 L;  5FLX E;  5EPL A;  1HQR D;  3GTO H;  4LFA Q;  3J81 L;  2ATW A;  1EIH A;  4G7Z C;  5C0X I;  2F0F A;  5C6A A;  2EXD A;  1A3V A;  1X6O A;  3F2B A;  1LTT D;  2BE5 C;  5J1Z A;  1LLR D;  2RHQ B;  1EOV A;  2OTL A;  3OSO A;  1JWS D;  1LTS D;  2Z4I A;  1D5X C;  4ZRZ A;  1EOT A;  1L0Y B;  1S5E D;  2WP8 J;  1JJG A;  2XNA C;  1S4Z A;  4LJZ C;  2Q2H A;  1UEA B;  2NVY H;  1CM9 A;  1CZW A;  1EQV A;  1CTM A;  2VNU D;  5D14 A;  1CKN B;  3I4M G;  1AZQ A;  2F0N A;  3RNU A;  5IT9 c;  1L0X B;  4FNF A;  4IZ8 A;  3NWT A;  1UE7 A;  2IT1 A;  3CHB D;  4L5R C;  4K8J A;  5C3W A;  4U68 A;  1A0I A;  4A3D H;  4LNQ A;  1Q1E A;  1PA6 A;  4A3J B;  4GN4 B;  3BU2 A;  5JEA H;  2KED A;  5T1I A;  4UAI A;  5FOB B;  1D2B A;  1PFM A;  2R92 B;  2MJ8 A;  3TQY A;  2HDL A;  4DK0 A;  1EY8 A;  2D5D A;  2A6E C;  5GRO A;  3HOZ G;  5AJ3 L;  5M3M B;  2YYZ A;  4X6A H;  3U9O A;  2JA6 G;  1YI2 A;  2E2I H;  1EUJ A;  3FDT A;  2R7D A;  2VQF L;  5DNF A;  1LAC A;  2NVQ H;  3A8I E;  4NKL A;  3HOX G;  1GUO A;  1QE6 A;  5M3F G;  2UUC L;  3NEL A;  1WTR A;  4DV5 L;  4NB3 A;  1YJ9 A;  3DEO A;  3CAM A;  2RF4 A;  4OXP A;  3DHQ A;  1I6H B;  2WAC A;  4B3M L;  4X3U A;  1SNQ A;  4KLK A;  4GOP A;  1WD1 A;  5JVH 3;  3NE5 B;  3KFU A;  4UPA A;  2IY5 B;  1ESR A;  3P7J A;  2HUG A;  3P20 A;  2MO0 A;  4N8X 1;  5D65 A;  1V1Q A;  1BUV T;  1TR5 A;  2QCP X;  1MI2 A;  1A62 A;  4LF8 Q;  1GUW A;  1YJW A;  2EYM A;  3T1H L;  4IOA A;  3T56 B;  4BBR G;  3OHX C;  1IBL Q;  1OXT A;  4PG3 A;  5I4D A;  1TY0 A;  2F0O A;  4KD3 A;  1PV4 A;  4G7O C;  4C3I B;  3URY A;  5I6W A;  2MQH A;  4LAA A;  1AP0 A;  2V4D A;  3HEJ A;  4WOR A;  4L5Q A;  5FLM G;  1CZG A;  4DV0 Q;  1ET9 A;  3GP7 A;  3QIA A;  4EQO A;  1VQK A;  2BA0 A;  4K5W A;  4BY1 G;  4JCV E;  2MHV A;  4A3F G;  1PH6 A;  1G6Z A;  1K28 A;  2K6A A;  3AU7 A;  4KKT A;  3AYH B;  3K59 A;  1FNU A;  1YHB A;  1AW7 A;  1H9K A;  2F0H A;  1S5D D;  1HTP A;  1BCP C;  3HOV B;  3H6M A;  4MN3 A;  4QIW B;  4YCU A;  2XIW A;  1IBM Q;  2JYO A;  1HFN A;  4DNR B;  1QVC A;  2RSN A;  4P2C B;  4F87 A;  3H0G H;  1D6E C;  1IYJ B;  5HY6 A;  2DY7 A;  4X62 L;  1KTK A;  3KF8 A;  4ODG A;  2KHS A;  3OMG A;  1W6K A;  4BS9 A;  1F2M A;  3W5O A;  2VY3 A;  4J8Q A;  2SNS A;  4DR6 L;  2O5I C;  1X54 A;  2JA7 B;  3S1R H;  1UE5 A;  3M9B A;  2B2Y A;  3T51 B;  1NBW A;  1MHW C;  1K3R A;  3OTO L;  1A3T A;  3BJU A;  5LMU Q;  1EYC A;  3S1M B;  3S1Q H;  2F0U A;  2K5W A;  4FXG C;  4DAY A;  4I7A A;  2R3Z A;  3M7G A;  1OXV A;  3HRZ C;  3FPP A;  1FVI A;  4GN3 B;  4L6T B;  3RD4 A;  3GTG H;  4WJW A;  2ZJP A;  4J6H A;  2ZJQ A;  4LF9 L;  2BH2 A;  4HED A;  1IL2 A;  1FR3 A;  1D1I A;  3MHB A;  2WAQ G;  4A3M B;  2F3W A;  1A3U A;  4X66 L;  3Q24 A;  5GAD C;  2R61 A;  4HN7 A;  3D6W A;  4YWK A;  3K7U C;  4NPS A;  1TWH H;  5C44 H;  3TS0 A;  1U4P A;  2JA5 G;  4DR5 L;  4AYB B;  5IP7 H;  2WIN B;  2CCZ A;  4DV2 L;  1VS0 A;  4JOI C;  5AFW A;  4F8M A;  1SBB B;  1VMC A;  4O0A A;  1CA6 A;  4ME5 A;  5G3L F;  1NCV A;  4GNX C;  1EEI D;  1LT5 D;  2EYL A;  3A5U A;  3EIV A;  1ZYR D;  1HRJ A;  1YBY A;  1TS3 A;  3N52 A;  2Z1C A;  3CQZ B;  4CDF C;  3ULJ A;  3C2P A;  3RMH A;  4DR2 L;  2O5J C;  3FKI G;  4YWM A;  2EY1 A;  2F0T A;  3KUP A;  3R93 A;  4P72 A;  3GTJ H;  5C4X G;  4A3K H;  4NW2 A;  2HCC A;  2R93 B;  2PI2 E;  1O7Z A;  3CRK C;  1Y8N B;  2E5L L;  3MFG A;  3IAY A;  5JPN C;  3HKZ B;  2F0K A;  1SJE D;  4X64 L;  1AEX A;  1Q82 C;  4EX5 A;  4WJ3 M;  2ZTD A;  3B6Y A;  2HHH Q;  3K81 C;  3DWQ A;  1LT6 D;  4KJN A;  2K03 A;  3C3L A;  3PIO 3;  1IYU A;  1YIJ A;  4RGN A;  1EWH A;  4IUN A;  2A69 D;  4DUY L;  1F77 A;  3ERS X;  1QG7 A;  3D0F A;  1B7Y B;  2K75 A;  3U4V A;  2A74 C;  3A7A B;  1VQ4 A;  2PQA B;  2QA4 A;  1SNP A;  4A3L H;  4NP5 A;  1HPC A;  4A3E H;  2ZTC A;  1JQY D;  1E1O A;  2B8F A;  5GQO A;  3UDI A;  5C0X J;  3NTH A;  3M3Y H;  2ZXR A;  1Y1W G;  5CV4 A;  3MZ5 A;  4H44 C;  3A55 A;  5BN5 A;  1J9O A;  1QNU A;  4JI4 L;  1JMC A;  4JI0 Q;  2KA7 A;  3BVG A;  4V19 0;  1RHP A;  1Y8P B;  3BVM A;  1I3Q H;  3I73 A;  1Q1B A;  2AUK A;  3ERO A;  1X3E A;  3GTP H;  2VUM H;  2MFI A;  5LMN L;  1KXL A;  4B3R Q;  1A2U A;  4BWG B;  2H1E A;  5A35 A;  3AMU A;  1Y69 U;  3J7Z C;  1GUG A;  2DNC A;  1SMY D;  1NE3 A;  3KBX A;  1LYL A;  2L15 A;  5K36 H;  1Y8O B;  2K5D A;  2MO1 A;  1KNE A;  1MJE A;  5DEH A;  3M4O H;  3CC2 A;  3I4M B;  3TN2 A;  2CHB D;  4A3B G;  1TY2 A;  1C48 A;  1TS4 A;  3BDO A;  3DEP A;  1U4M A;  3K5L A;  1XPU A;  1JWU D;  2YU9 H;  2Z4H A;  2RVL A;  4C3H G;  1KC8 C;  3S2D B;  4C2M B;  4BY7 G;  1F9R A;  4QMG A;  1VQL A;  2NVX H;  2NZ1 D;  1LO5 D;  4DXG A;  1IW7 D;  3HOZ B;  2B3G A;  4CJ1 B;  1PYB A;  5AJ3 Q;  3ICE A;  2JA6 B;  2PI2 A;  1K83 H;  3CD6 A;  1F9Q A;  2PW7 A;  1FNV A;  3HP3 A;  2VQF Q;  4QGU A;  1NAP A;  4DR7 Q;  4YWL A;  3Q22 A;  3PIP A;  3ERQ A;  2N55 A;  4HR7 B;  2D2C C;  4A3G B;  3ITP A;  3HOX B;  3OIQ A;  4IFD H;  4JI6 L;  5M3F B;  3PCO B;  1EFI D;  5IGE A;  2UUC Q;  2GVA A;  5IT9 L;  4DV5 Q;  1DJR D;  2PYK A;  1H9J A;  1TWC H;  5FJ8 G;  4IUQ A;  2PQE A;  4B3M Q;  2P5Z X;  3CCJ A;  4DV4 L;  4HIK A;  1H9M A;  1HNW Q;  4MTK A;  1X55 A;  5FO8 B;  2IHE A;  4LK1 C;  2I5H A;  3PIP 3;  3TP7 A;  4OEM B;  5EAY A;  1SN8 A;  5A2Q E;  1IBL L;  3ND9 A;  3CCS A;  4UP7 A;  4E6I A;  1JT8 A;  5J3B A;  3K0Y A;  3ULL A;  4DAP A;  1HA6 A;  1SND A;  5IY0 A;  3I4N G;  3PUZ A;  2RHS B;  4L63 B;  3QWN A;  4JI3 L;  1T5E A;  1IYV A;  3EBE A;  4NXN Q;  1ZKO A;  1F2Y A;  1I4G A;  2ICE C;  3H09 A;  1KAA A;  2JSO A;  3G4S A;  2KCM A;  1TWF B;  4OWT B;  5ELE A;  1RKN A;  3RR5 A;  1K8M A;  1KAW A;  2PZT A;  1BCP F;  2ZT9 C;  4F7X A;  4B08 A;  1SNO A;  4CHT B;  2F3V A;  3G71 A;  1N34 L;  1S5F D;  3ONA B;  5IOD A;  5EKL A;  4HMJ A;  5IGD A;  5FO9 B;  4A3F B;  2BE5 D;  3LWU A;  1RIP A;  4BXX G;  3A5Z B;  1G2T A;  1V43 A;  2EJF C;  3TZD A;  2CH4 A;  2LKV A;  5I2X A;  1I50 H;  1FGB D;  3U50 C;  1TWA B;  5M5W H;  2RDG A;  1IBM L;  1J8I A;  1WCM H;  1VMP A;  2Q2T A;  1WTX A;  1K9M C;  1GD7 A;  1V9P A;  3S2H H;  2EYJ A;  4ZK9 B;  3PGZ A;  3EJI A;  1O7L A;  1V1P A;  3U58 A;  2F0Q A;  5FO7 B;  2N88 A;  2OEO A;  3QO2 A;  4MIU A;  3HKS A;  1GHK A;  1QVF A;  2UU9 L;  2KCN A;  1XPR A;  4X62 Q;  2NTT A;  1PH1 A;  3DWA A;  2VB3 X;  5C5M A;  3KDF A;  2I5L X;  2L55 A;  2Z0S A;  1F2L A;  3K7A B;  1K0S A;  5JJI A;  1TXY A;  4FF2 A;  4K14 A;  1PH4 A;  5LMU L;  4JI1 L;  1PTO F;  2A6E D;  4QF4 A;  3VDY A;  1SJH D;  3KF6 A;  5KNB A;  4OX9 L;  1B53 A;  3M85 A;  1UE6 A;  4JK1 C;  1SNM A;  5DM7 3;  2JA8 G;  1ENF A;  3OTO Q;  2AUJ D;  1S40 A;  1CKM A;  2IX3 A;  2H5X A;  2JN4 A;  2PO4 A;  4JV5 L;  2ALY B;  4A4I A;  1K8G A;  2B2V C;  2R7Z G;  1I6V C;  3T4A C;  3H15 A;  4S3S A;  3I72 A;  1OXX K;  1LV9 A;  2VXW A;  2B2W A;  3Q6S A;  3NQI A;  1PFN A;  4LF9 Q;  2E2J B;  3SK5 A;  2C9O A;  1SRU A;  4WFN 3;  3HG9 A;  4C1N I;  1VQI A;  2WAQ B;  3LWE A;  4RHS A;  4X66 Q;  4IAL A;  4GNX B;  4A3C H;  3KK7 A;  3CRL C;  3U9S A;  1C7Y A;  2K5H A;  5ELO A;  4JI2 Q;  2JA5 B;  1MJC A;  4DR5 Q;  1SFO H;  3P75 A;  3JAM E;  5ELB A;  2OF1 A;  5JEA J;  4LW1 A;  1VQC A;  2X6L A;  1WYD A;  2AKW B;  1QUQ B;  1L1O B;  1X3F A;  3S14 H;  4Z9C B;  2K7V A;  3GTK H;  4X65 Q;  4DR2 Q;  2Z6B A;  1GO3 E;  3FKI B;  2DJG C;  4IPC A;  3VR5 A;  1KDC A;  3VYU A;  1O78 A;  1TU2 B;  2E8G A;  5M5X H;  4DV3 Q;  5C4X B;  3D8G A;  2Z9H A;  1IXR A;  1DOK A;  1S5B D;  4TRD A;  1PH7 A;  3EN2 A;  1EY6 A;  3S16 B;  4C3J H;  4K8I A;  3J80 E;  2E5L Q;  4EGV A;  3DM3 A;  1A8V A;  1XXG A;  1CKN A;  5C4H A;  3HOW B;  2M00 A;  4X64 Q;  1YJN A;  4QIW E;  1KRS A;  1X3Q A;  3T13 A;  4O2D A;  3OMC A;  4TSS A;  5JPM C;  3R2I A;  4DUY Q;  3T16 A;  5BR8 L;  1ILP A;  2B2T C;  2A6H C;  3OOC A;  2XWJ B;  4IFD I;  2XRQ D;  1RCV D;  1S72 A;  1LM0 A;  2BCO A;  2PW5 A;  1O7I A;  2VW9 A;  2DGY A;  1STG A;  3JC6 6;  5ELD A;  4IPD A;  3SK8 A;  5J39 A;  2X6G A;  1XMQ L;  1NY4 A;  4P74 A;  4HCS A;  5ELN A;  1Y1W B;  2E2H B;  3GTL B;  2EYF A;  1IHZ A;  2J4X A;  4JI4 Q;  1JOQ A;  4DGZ A;  1TII D;  4FF1 A;  2D62 A;  1Z9F A;  4KY6 A;  1PYW D;  4RAU C;  4B9X A;  1TVX A;  1YHA A;  4B3R L;  4A3J H;  2DY8 A;  2L5T A;  1UE1 A;  2O4X A;  2RCN A;  2R92 H;  5LMN Q;  3R2T A;  4I65 A;  1JWM D;  5M3M H;  2JJQ A;  3I70 A;  1PH2 A;  3TS2 A;  3QB3 A;  2EE1 A;  4A3I G;  2K5V A;  1SXT A;  4Q5V A;  4RKB A;  4G4K A;  1BBU A;  4IUP A;  4DR1 Q;  4AYB E;  1N36 Q;  2WB1 E;  3J7A F;  4A3B B;  4ZKB B;  1YNN C;  4LF4 Q;  1GVP A;  1TQO A;  3H3V C;  2Z6K A;  1VCI A;  1I6H H;  2AQ3 B;  4C3H B;  4B3T Q;  4BY7 B;  1DOM A;  2NN6 H;  4DN4 M;  3EA6 A;  3CCV A;  1PHJ A;  3G6E A;  3QJY A;  2DNE A;  4MZ9 A;  1SAP A;  3WOF A;  3J7A V;  1A15 A;  1VQG A;  3KLS X;  3S24 A;  4DAV A;  4DAM A;  2D0P A;  4DR7 L;  1C8C A;  1KDB A;  4EQN A;  4LF7 Q;  1JB7 A;  1WFQ A;  3I2Z A;  1EY0 A;  3HZX A;  3NBH B;  1XTC D;  1I4Q A;  3EQL C;  3G6J B;  5E1F A;  3T1Y L;  5KNC A;  5DLQ E;  3CXC A;  4OON A;  1WTV A;  4KD4 A;  1B9M A;  3HKZ E;  3NEN A;  5FKA C;  1HHV A;  1GKH A;  5CR3 A;  4C3I H;  1EWC A;  2UXC L;  2E2D C;  3E9I A;  4BBS G;  4JI6 Q;  3NWS A;  1LT3 D;  3SK4 A;  1EU3 A;  3C1F A;  4YY3 L;  1HNW L;  1D5M C;  4ZYS A;  2AWO A;  3W3A A;  4DNT B;  5JVG 3;  1I4P A;  1WVL A;  3FPU B;  3BZD B;  4JBJ A;  1HNX Q;  1CFM A;  4DV4 Q;  3V2T A;  1II3 A;  2F0E A;  1FL0 A;  5IYB H;  3CP0 A;  1HTL D;  2KUM A;  1SMX A;  1Q8K A;  2VB2 X;  3HOV H;  3GTM B;  1PYS B;  5I9O A;  4LF6 Q;  4OO1 H;  4NXN L;  1SE4 A;  2K05 A;  5M9O A;  3OWE B;  4DPG A;  3I4N B;  4C1N K;  2B2U C;  2NZO A;  4JI3 Q;  2K01 A;  3SVM A;  3PO3 G;  3L2P A;  1P8L A;  4R1J A;  3MXG A;  1R4Q B;  3PUV A;  5IYC H;  1WI5 A;  3J81 E;  4IFD G;  3UI2 A;  4N8F A;  3K8A A;  4TVA B;  3K58 A;  2AQ1 B;  1PH3 A;  3S17 B;  4FO2 A;  2JA7 H;  1N34 Q;  5FLX c;  3KLW A;  3DLL A;  2BH8 A;  2N78 A;  2VQE Q;  2DJF C;  3ND8 A;  3S1M H;  4JI5 Q;  4APV A;  1SE8 A;  1PZI D;  1CHQ D;  1AZP A;  1FYC A;  1STY A;  3VR2 A;  4KHZ A;  3IL8 A;  5C0X G;  5LL6 X;  1X3G A;  1KHI A;  2NB0 A;  5IIF A;  1PH8 A;  5IWA Q;  4OEL B;  1X32 A;  1HNZ Q;  3TEH B;  4MHE A;  4CJ2 C;  2IWH A;  2MP1 A;  4A3M H;  2UU9 Q;  4DA2 A;  1HR0 L;  2NYZ D;  2Q8R E;  3G48 A;  1JC7 A;  1H9S B;  1LT4 D;  3VYS A;  4CDD C;  4QCL A;  4JI1 Q;  5LMN W;  1J5E Q;  5KND A;  4H13 C;  3LX0 A;  4Y7N H;  4DV1 L;  4OX9 Q;  1PTO C;  2JA8 B;  4JBK A;  1DON A;  1JE5 A;  2IX1 A;  4JV5 Q;  2OXP A;  4AQY Q;  1Y1V G;  3TSS A;  1YNX A;  4IJH A;  2F3I A;  1WCM G;  2R7Z B;  1RDP D;  1YHQ A;  3CQZ H;  3HOU G;  2QDL A;  4C56 C;  2XVS A;  4CKC A;  3RZD B;  2EYP A;  4HSP A;  1SYG A;  5TSS A;  1KL9 A;  3NBI A;  1R9T B;  1JOR A;  3PO2 G;  4IUU A;  1HXY D;  1DD2 A;  1R4P B;  2JK8 A;  1SR3 A;  4JI2 L;  2KVM A;  1HA5 A;  5DAU A;  2UUB Q;  2R93 H;  4H7B A;  1VDZ A;  1BO0 A;  2RA4 A;  1PXU A;  3I4L A;  4IPH A;  4KY5 A;  4Y7N B;  1BQQ T;  1QB5 D;  2RQX A;  3NHH A;  2VL6 A;  3UE0 A;  1W6J A;  2B63 G;  2NZH A;  1PLF A;  5IP9 H;  2QW7 A;  2ES2 A;  1ILQ A;  2EQS A;  5CBE E;  4X65 L;  2A8V A;  3DMU A;  3I55 A;  2Y0S G;  3WOE A;  3PIO A;  1FNW A;  1MD2 D;  4MNO A;  1YNJ D;  4DV3 L;  3PQI A;  2XN9 C;  2YTY A;  5C3E G;  4WRD A;  5EQ0 A;  1VQB A;  4YHH L;  4K2L A;  2KEN A;  1G2S A;  3HOY G;  2E76 C;  4ZUJ A;  3RLN A;  1Y14 B;  2NN6 I;  4RGO S;  1XX8 A;  4POF A;  3HFZ B;  2GN5 A;  4IFD J;  4IOC A;  1MGS A;  3GTQ B;  1HZA A;  2UXB Q;  4DV6 Q;  1CK1 A;  1EU4 A;  2IJ0 A;  1EZ6 A;  1D1K A;  4KK7 A;  1ML0 D;  2YTV A;  2JXM B;  5CYU A;  1Q86 C;  1Q90 A;  3IFT A;  4V0B A;  1PDQ A;  2L4N A;  3EVQ A;  5IYD G;  5BR8 Q;  3BYT B;  3L3O C;  4J1M A;  2SEB D;  2N3S A;  3QOL A;  2YTX A;  1PFB A;  4HJ5 A;  1CA5 A;  4PV1 C;  3FMC A;  3C1E A;  1B9N A;  1MBY A;  2K28 A;  1XMQ Q;  5I9P A;  2PZU A;  3AFQ A;  3I4M H;  1GUS A;  1MSH A;  3TRZ A;  1EQR A;  2SOB A;  4A93 G;  1SE2 A;  2K5N A;  4G57 A;  4DF7 A;  1EY9 A;  3CW2 C;  4ZKC B;  4HSV A;  3RZO B;  4DU9 A;  1NUC A;  3S2D H;  2F03 A;  4C2M H;  4OO1 I;  4PZ8 A;  5JJL A;  5JJK A;  3CME A;  1SYC A;  4ME3 A;  1PVO A;  2CKZ B;  4GLA C;  2JP1 A;  3HOZ H;  1JJC B;  1QIL A;  2WAQ E;  2JA6 H;  1CQV A;  1XNQ Q;  4DR1 L;  4MTN A;  5IGG A;  1N36 L;  4A3I B;  2L11 A;  4QQB X;  2M2L A;  1HCZ A;  4LF4 L;  4XQQ A;  4A3G H;  1EL0 A;  1N33 L;  1QZH A;  1B3A A;  4JW0 A;  3HOX H;  2KHJ A;  4B3T L;  4JPB W;  5M3F H;  3A8J E;  4P71 A;  2K14 A;  1PRT F;  3FHW A;  1XTD A;  2X69 A;  2FXQ A;  4IUR A;  4QY7 A;  1S3O A;  3O13 A;  5I6Y A;  5M5Y B;  2Q8I B;  2K33 A;  1A6X A;  1EQQ A;  2AHO B;  1OXU A;  4OL7 A;  3D4R A;  1TT2 A;  3F2U A;  3VA7 A;  4LF7 L;  4WJ4 A;  4IN3 A;  1Q3L A;  1MKH A;  2TSS A;  4ALP A;  1NMF A;  5G3L D;  1X3P A;  2ICI A;  5KGU A;  4FDB A;  3DXJ C;  3MXN B;  1QZG A;  4PMB A;  2KQ3 A;  3TP5 A;  3FRP B;  1A2T A;  4GN5 A;  1YEZ A;  2N8N A;  2J7Z A;  3GD7 A;  2RSO A;  3T1Y Q;  4CKE A;  1XMO L;  2HCI A;  2A68 C;  5CBA E;  2LS0 1;  2SNM A;  5HGQ A;  3A8K E;  1LTI D;  5BN3 A;  4ILW A;  3R8B A;  1EYA A;  4RA8 A;  4XTC S;  2UXC Q;  1EYG A;  1TWF H;  1Q8I A;  1WOC A;  2EYH A;  3QR8 A;  2Q2U A;  4BBS B;  5JOB A;  2Z8L A;  3AEV A;  4A3D G;  2PMZ B;  1HNX L;  4KHP Q;  5CV9 A;  2EY2 A;  2G9H D;  4X3T A;  4YY3 Q;  5FLM H;  4PNY A;  1VQA A;  1X56 A;  5JEA G;  2D0O A;  5EKI A;  3F1Z A;  4A76 A;  1MIU A;  2A6H D;  4A3F H;  5IGB A;  3TP6 A;  3NXW A;  5CV5 A;  1TWA H;  4LF6 L;  2HIX A;  1AE2 A;  5NUC A;  2RBM A;  4BBR B;  4U67 3;  4NDX A;  2DUD A;  1N32 L;  3DUZ A;  1EYD A;  2RKS A;  3K5M A;  4IPG A;  2AWN A;  4KY7 A;  3CU7 A;  1A63 A;  1BCP B;  4FXK C;  4CKB A;  1N8R C;  3UDF A;  1U4L A;  3QG1 A;  3PO3 B;  1E7Z A;  4K5V A;  1P16 A;  3PSI A;  3SDZ A;  1ZYR C;  3PMF A;  3SHL A;  2OQK A;  4BY1 B;  1EIF A;  4Q0F A;  1T9H A;  4IUV A;  1XPO A;  1UWV A;  4RMF A;  4PMC A;  3K7A H;  2VQE L;  2B39 A;  1XYI A;  5IGC A;  4JI5 L;  2A1A A;  3CCR A;  1J6Q A;  2L9H A;  2NWG A;  4DKA C;  5D3I B;  1BDO A;  2E74 C;  3C46 A;  2F0M A;  1IZ6 A;  1I5F A;  3KLR A;  5IWA L;  1HNZ L;  1B2T A;  1K3B C;  3K57 A;  3AB9 A;  3DM1 A;  2E2J H;  1YNN D;  4KKS A;  1C9O A;  1L1O A;  3ZJY C;  2F0P A;  1PTO B;  1UUP A;  1GUN A;  1MSG A;  2WFW A;  2AMC B;  2KOL A;  1OXS C;  1B4O A;  3S1N B;  2WKC A;  3CCM A;  4DNI A;  2JA9 A;  1HR0 Q;  4G7H C;  3F2C A;  4XYO A;  4ZCK A;  1J5E L;  4LUO A;  3A74 A;  3R3O A;  2HQL A;  1S5C D;  2LSS A;  1XWE A;  1ENC A;  1D5Z C;  2QKI C;  2HDM A;  3VYR A;  2E75 C;  4LUV A;  4OIK A;  2JA5 H;  3VR6 A;  3PV0 A;  4JI8 Q;  2UXD L;  3VYT A;  5FLX L;  4AQY L;  1F2Z A;  3SK6 A;  5COY A;  4DV1 Q;  1JOK A;  4DR3 L;  1CKO A;  4GOP C;  3CMA A;  2IX0 A;  1T5X D;  1FJG Q;  2EDG A;  2NVT B;  1Y1V B;  1M8A A;  3HOU B;  3FVQ A;  2KJX A;  1DOL A;  2F52 A;  1ZXT A;  2HD3 A;  2JQO A;  5C4J B;  3H0G G;  3FKI H;  2G9D A;  1E2Z A;  2UUB L;  1I4R A;  3LGJ A;  4JBM A;  1YVC A;  5IT9 E;  4EVO A;  3CC7 A;  3PF5 A;  3PO2 B;  1JJ2 A;  5C4X H;  4YCW A;  2BDN A;  2EVB A;  3S16 H;  2F4V Q;  1TS5 A;  2A73 B;  3L7Z C;  3HOW H;  1ZEQ X;  2B63 B;  3A0J A;  1ONL A;  2CW0 C;  2WB1 G;  3E6Z X;  1OTC A;  1NR4 A;  2Y0S B;  1L0W A;  2GA4 B;  3D31 A;  1ENA A;  1LTG D;  2F0L A;  2F0I A;  1ESF A;  4JYA L;  2BA1 A;  1LTR D;  5C3E B;  2A5H A;  4KN4 C;  5HGT A;  5J22 A;  2XTI A;  1PH9 A;  4YHH Q;  4KV6 A;  2I46 A;  3HOY B;  4UHV A;  2UXB L;  4O42 A;  3A7L A;  1Y1W H;  2E2H H;  4DV6 L;  3GTL H;  1CT1 D;  3S15 B;  1BCP D;  5C44 G;  2QIL A;  3ER0 A;  1TWG B;  3KF6 B;  2MUY A;  4KMU C;  4LFC L;  5IP7 G;  1FD7 D;  2C35 B;  1VQ5 A;  4UY8 C;  2SDF A;  3KBG A;  3MXP A;  4XT3 B;  2ENB A;  1DGS A;  1ICF B;  3HS0 C;  1VQH A;  2B2Y C;  2L0C A;  1PH5 A;  2WII B;  4QJF A;  2K50 A;  5E3F A;  3SGI A;  1K8O A;  4HJA A;  1KLU D;  2FMM A;  2KHI A;  5E7N A;  1LTL A;  3STB C;  1HFG A;  1E24 A;  4ZAI A;  2C5C A;  2TMP A;  3MAQ A;  2R6G A;  3CC4 A;  2EJM A;  4A3K G;  1XJV A;  2EYO A;  2FFK B;  3NBH A;  3RLF A;  2L1B A;  3WWV A;  3PUY A;  2L12 A;  4A3B H;  2KBN A;  1JIC A;  3DWP A;  4A93 B;  5CV6 A;  1PTO D;  4C3H H;  3J7Y W;  3OWF A;  4PMW A;  4BY7 H;  4LFB Q;  3PF4 A;  1OO9 B;  1D8L A;  4H0L C;  2LMC B;  1XNQ L;  2NBF A;  1B3Q A;  4L8J A;  3BZK A;  2QEJ C;  3NP8 A;  3S9W A;  4A3L G;  4A3E G;  5ELC A;  1CI3 M;  2N49 A;  3LNN A;  3FEW X;  2F0V A;  4LMQ D;  1HR0 W;  3AFP A;  4DK3 C;  1N33 Q;  2F0D A;  1IKM A;  1GM5 A;  2QEX A;  3UDG A;  3Q0A A;  4GKJ L;  3G7L A;  4POG A;  4R4Q A;  3RUZ A;  5E4W C;  2MPM A;  3RN2 A;  2UUA L;  3BDC A;  4LF5 L;  3SXH A;  3GTO B;  1I4X A;  1PRT C;  2CWA A;  5FJ8 H;  1I94 L;  2VUM G;  2HIV A;  3IKJ A;  3I4O A;  4DUZ Q;  4R4T A;  1DYQ A;  2VS1 A;  1HZB A;  3V96 A;  2Q8T A;  3JAM c;  4HID A;  4HIO A;  1CSQ A;  1VQF A;  3GTM H;  3E0E A;  2ID0 A;  4K5X A;  1EY4 A;  4GZY C;  1HZC A;  5K36 G;  2I0Q A;  1IBK Q;  5K5P A;  1XMO Q;  2PZW A;  2NVY B;  2M9V A;  1SYE A;  3I4N H;  3H94 A;  1KIX A;  4KHP L;  1DZ1 A;  5IGF A;  4TKO B;  2LXJ A;  2CH4 W;  4K6L A;  1WTO A;  4A3G G;  1G29 1;  3W1G A;  3H91 A;  2V1C C;  3CF5 A;  4A3D B;  5CV8 A;  3PUX A;  4NXM Q;  4XQN A;  3K0X A;  5KEE A;  3J80 c;  3S17 H;  1VQ9 A;  4HAE A;  3KYH C;  2B2V A;  5JAV A;  4BXX H;  1H9S A;  1BNZ A;  4QB4 A;  1KQS A;  3GV3 A;  2MGS A;  1B8A A;  5EPK A;  4QUC A;  1H9R A;  1HUN A;  3OIP A;  4DFA A;  4KTA A;  3K5N A;  2E2I B;  2A19 A;  3KLS A;  4QL5 A;  4K0K Q;  1N32 Q;  4CDC C;  3EFX D;  4ULL A;  2NVQ B;  2WKD A;  4X3S A;  3V05 A;  5EGT A;  4RHR A;  3P1H A;  3K6O A;  3RN5 A;  1JCK B;  2RDH A;  4IUT A;  2IW3 A;  4RH6 A;  5ISR A;  2LXK A;  3M4Y A;  2NUC A;  5BN4 A;  3I56 A;  3CCL A;  1RJT A;  2QF7 A;  1GJX A;  1XNR L;  4KJO A;  4JBW A;  2JEB I;  2IHF A;  3TBI B;  2G5D A;  4DR4 L;  5C5L A;  3E3X A;  4Y52 H;  2JA8 H;  1SNC A;  1ASZ A;  1ROD A;  4RWS C;  5HUR A;  2ZXO A;  2PNH A;  2R7Z H;  2LFN A;  3RZD H;  3SEB A;  4KN7 C;  2EY5 A;  2CWP A;  3F2D A;  4I7Z C;  3MEF A;  1R9T H;  2J0T D;  1VQJ A;  4GOP B;  4FF3 A;  1FGU A;  4K2K A;  2YV5 A;  4UP8 A;  2PPB C;  2F1M A;  1SE3 A;  1H95 A;  4JI8 L;  4DV7 L;  1M4V A;  3K5O A;  1U0L A;  1DCZ A;  2KCT A;  2XRS D;  2HT1 A;  1SDF A;  2RDF A;  1B44 D;  1VF5 C;  2IL8 A;  2WV6 D;  2FMC A;  1TKW B;  1V8Q A;  1KNA A;  1SYF A;  2B2T A;  1FJG L;  4B3S Q;  1PMR A;  2UXD Q;  1GOZ A;  4DR3 Q;  4PZ7 A;  2ZM6 L;  2KEE A;  2A68 D;  5GAG C;  3Q8D A;  2EPB A;  4BA2 I;  1CHP D;  4GKK L;  2PQA A;  3L0O A;  3OW2 A;  3QOJ A;  3H0G B;  4RGM A;  1Z6H A;  2PMZ E;  4R4O A;  2K4K A;  4XDX A;  5EJW A;  2F4V L;  1NR2 A;  1EWI A;  1G51 A;  4HCE A;  4KI0 A;  3CCE A;  1VQO A;  4DK1 A;  2VZA A; 
#chains in the Genus database with same CATH homology
 1QZG A;  1VQ8 A;  1NJI C;  2E2I H;  3GTQ H;  1EUJ A;  2R7D A;  2K5H A;  5ELO A;  4GN5 A;  1YEZ A;  2N8N A;  4JI2 Q;  2VQF L;  3GD7 A;  1XMO L;  3T1Y Q;  1SRO A;  1MJC A;  4DR5 Q;  2NVQ H;  1SFO H;  4R4I A;  1D7Q A;  2JE6 I;  3JAM i;  5JEA J;  5HGQ A;  4LW1 A;  1VQC A;  3HOX G;  4OWW B;  1WYD A;  4XTC S;  2AKW B;  5M3F G;  1QUQ B;  2UUC L;  3NEL A;  1EYG A;  2UXC Q;  1TWF H;  1WOC A;  1L1O B;  1VQD A;  1X3F A;  3J81 j;  4DV5 L;  4NB3 A;  2Q2U A;  3S14 H;  2OQ0 A;  1YJ9 A;  3KF8 B;  3CAM A;  3AEV A;  4A3D G;  1HNX L;  4X65 Q;  3GTK H;  4KHP Q;  2RF4 A;  4OXP A;  4YY3 Q;  5FLM H;  4DR2 Q;  1VQA A;  1X56 A;  5JEA G;  1K73 C;  4B3M L;  1GO3 E;  4IPC A;  4JYA Q;  1SLJ A;  2D0O A;  4KLK A;  4GOP A;  4GLX A;  3F1Z A;  4A76 A;  1MIU A;  4A3F H;  2MNA A;  4UPA A;  3J7A 5;  1Q7Y C;  3KFU A;  2IY5 B;  2E8G A;  5M5X H;  4DV3 Q;  2MO0 A;  1EIY B;  1IXR A;  3CCU A;  1TWA H;  1V1Q A;  4LF6 L;  4A3C G;  1PH7 A;  2HIX A;  3EN2 A;  1WJJ A;  1A62 A;  1AE2 A;  3CCQ A;  4C3J H;  2DUD A;  2E5L Q;  4LF8 Q;  1N32 L;  3J80 i;  3DM3 A;  1A8V A;  1YJW A;  3J81 c;  4IPG A;  1CKN A;  2AWN A;  3RZO H;  3T1H L;  4IOA A;  4DAY B;  4BBR G;  4X64 Q;  4LFC Q;  1L1O C;  1OXT A;  1YJN A;  1IBL Q;  1A63 A;  4PG3 A;  4QIW E;  1KRS A;  1PV4 A;  1N8R C;  1BBW A;  3UDF A;  4O2D A;  3HOW G;  1E7Z A;  4LWC A;  1P16 A;  3PSI A;  2MQH A;  3GO5 A;  4DUY Q;  5BR8 L;  1BVS A;  2OQK A;  4IFD I;  4L5Q A;  1EIF A;  1S72 A;  4HIM A;  1T9H A;  3H3V H;  1LM0 A;  1XPO A;  1UWV A;  5FLM G;  4RMF A;  4DV0 Q;  3K7A H;  1O7I A;  2VQE L;  2VW9 A;  2DGY A;  1VQK A;  3JC6 6;  2BA0 A;  2ZJR A;  4IPD A;  3KOJ A;  4JCV E;  4BY1 G;  4A3F G;  1PH6 A;  4JI5 L;  4A3I H;  3AYH B;  2A1A A;  3CCR A;  1XMQ L;  1J6Q A;  1NY4 A;  1YHB A;  4P74 A;  4DKA C;  5ELN A;  4OWX B;  1NTG A;  1IZ6 A;  1I5F A;  4JI4 Q;  4LFB L;  4YCU A;  2OTJ A;  5IE8 A;  5IWA L;  1HNZ L;  1IBM Q;  2D62 A;  4JI7 Q;  1Z9F A;  4LFA L;  3MXN B;  5M5Y H;  1QVC A;  1YHA A;  4B3R L;  4A3J H;  2E2J H;  3H0G H;  1UE1 A;  1C9O A;  1L1O A;  3ZJY C;  1IYJ B;  5HY6 A;  2RCN A;  1VQN A;  2WFW A;  4X62 L;  2R92 H;  2AMC B;  1OXS C;  3AQQ A;  1E22 A;  4YCV A;  5LMN Q;  3ULP A;  3CCM A;  4DNI A;  2JA9 A;  1HR0 Q;  3F2C A;  5M3M H;  3W5O A;  2VY3 A;  1B70 B;  2JJQ A;  3A74 A;  4LUO A;  1J5E L;  2HQL A;  2LSS A;  1PH2 A;  4DR6 L;  1X54 A;  3TS2 A;  3S1R H;  4LUV A;  1KRT A;  4A3I G;  1UE5 A;  3M9B A;  2JA5 H;  4IO9 A;  3PV0 A;  2K5V A;  4JI8 Q;  2UXD L;  1NBW A;  4AQY L;  1K3R A;  5K36 G;  3OTO L;  4EQ5 A;  1VQM A;  3BJU A;  5LMU Q;  1BBU A;  4DV1 Q;  4DR3 L;  4DR1 Q;  1CKO A;  3U4Z A;  4AYB E;  4GOP C;  3CMA A;  4TQU S;  1N36 Q;  3S1Q H;  2I5M X;  1K8A C;  2WB1 E;  2IX0 A;  4H02 A;  1FJG Q;  4LF4 Q;  1GVP A;  4BBS H;  1OXV A;  4GKJ Q;  1FVI A;  4GN3 B;  2Z6K A;  1VCI A;  3GTG H;  4DUZ L;  1CSP A;  1I6H H;  2ZJP A;  2UUA Q;  2F52 A;  4A3J G;  2ZJQ A;  4LF5 Q;  4B3T Q;  1N9W A;  2JQO A;  2Y0S E;  4LF9 L;  3H0G G;  3FKI H;  3KJO A;  1IL2 A;  1PHJ A;  2BH2 A;  3CCV A;  2UUB L;  3G6E A;  3LGJ A;  4JBM A;  1YVC A;  2WAQ G;  1HZ9 A;  4MZ9 A;  2R92 G;  3CC7 A;  3PF5 A;  1I94 Q;  1Q81 C;  4X66 L;  1VQG A;  1JJ2 A;  5GAD C;  5C4X H;  4YCW A;  3S24 A;  5GAH C;  4HJ7 A;  1UEB A;  4YWK A;  4DAM A;  5M3M G;  2D0P A;  1IBK L;  4DR7 L;  1YZ6 A;  4GLV B;  4LF7 Q;  1JB7 A;  1WFQ A;  3S16 H;  3K7U C;  4NPS A;  4BBR H;  2F4V Q;  1TWH H;  3I2Z A;  5C44 H;  3NBH B;  3TS0 A;  4L5T A;  2GVB A;  3T1Y L;  2JA5 G;  4DR5 L;  3L7Z C;  5IP7 H;  3HOW H;  4XIG S;  2CCZ A;  5DLQ E;  3CXC A;  4OON A;  4DV2 L;  1VS0 A;  4JOI C;  3A0J A;  3HKZ E;  1M1K C;  3PO3 H;  3NEN A;  2WB1 G;  4O0A A;  1GKH A;  4NXM L;  4C3I H;  2UXC L;  4GNX C;  1OTC A;  3E9I A;  3A5U A;  1L0W A;  3EIV A;  4JI6 Q;  4BBS G;  1YBY A;  3D31 A;  4BY1 H;  3ULJ A;  4AH6 A;  4YY3 L;  1HNW L;  4DR2 L;  1W3S A;  4HJ8 A;  4JYA L;  2BA1 A;  2AWO A;  3FKI G;  2NN6 G;  4YWM A;  2XTI A;  3K80 C;  1PH9 A;  4YHH Q;  3OYY A;  4JBJ A;  4P72 A;  4DV4 Q;  3GTJ H;  1HNX Q;  3PUW A;  5C4X G;  4A3K H;  3RLO A;  3STB D;  3CPF A;  1FL0 A;  5IYB H;  3CP0 A;  4K0K L;  2UXB L;  1Y1W H;  2PI2 E;  2E2H H;  1SMX A;  4DV6 L;  3GTL H;  1Q8K A;  3HOV H;  3GDE A;  1PYS B;  4RG1 A;  5C44 G;  2E5L L;  3ER0 A;  4LF8 L;  4LF6 Q;  3IRB A;  4NXN L;  3KF6 B;  5IP7 G;  4LFC L;  4X64 L;  4DPG A;  1Q82 C;  4EX5 A;  2C35 B;  1VQ5 A;  4WJ3 M;  2ZTD A;  3B6Y A;  2HHH Q;  4UY8 C;  3K81 C;  2NZO A;  4JI3 Q;  1Q12 A;  3PO3 G;  1YIJ A;  4R4C A;  4UP9 A;  3L2P A;  1DGS A;  1P8L A;  4R1J A;  3T1H Q;  4DUY L;  4JOI A;  3PUV A;  4L5S A;  3ERS X;  1VQH A;  1PH5 A;  3UDX A;  3D0F A;  1WI5 A;  1B7Y B;  5IYC H;  3S1N H;  4QJF A;  2K50 A;  2QGQ A;  1K0R A;  3SGI A;  3J81 i;  2K75 A;  3U4V A;  4IFD G;  1VQ4 A;  4DV0 L;  4GNX A;  4HJA A;  2PQA B;  2KHI A;  5E7N A;  3STB C;  1LTL A;  3K8A A;  2QA4 A;  2JEA I;  1E24 A;  4PZ6 A;  4TVA B;  4A3L H;  1PH3 A;  4A3E H;  2JA7 H;  1N34 Q;  1XNR Q;  2ZTC A;  1QVG A;  5FLX c;  1RL2 A;  2R6G A;  3KLW A;  3CC4 A;  1C0A A;  1E1O A;  3DLL A;  5GQO A;  2Z6K C;  3UDI A;  2BH8 A;  3NEM A;  2N78 A;  5C0X J;  2VQE Q;  4A3K G;  1XJV A;  4DR4 Q;  5IYB G;  3M3Y H;  1Y1W G;  4J15 A;  4HJ9 A;  3RLF A;  3S1M H;  3HOV G;  3WWV A;  3PUY A;  3CPW A;  4JI5 Q;  4A3B H;  2KBN A;  4APV A;  4JI4 L;  1SE8 A;  1JMC A;  2NVT H;  4JI0 Q;  1Y1V H;  4OO1 G;  1QUQ A;  3HOU H;  1EFW A;  4KHZ A;  5C0X G;  1X3G A;  4C3H H;  4PMW A;  1KHI A;  1I3Q H;  5C4J H;  4BY7 H;  4LFB Q;  1Q1B A;  1PH8 A;  5IWA Q;  1X3E A;  3TEH B;  1HNZ Q;  3PF4 A;  3GTP H;  2VUM H;  1D8L A;  4A3M H;  2MFI A;  5IYC G;  5LMN L;  2UU9 Q;  1XNQ L;  3PO2 H;  1KXL A;  4B3R Q;  1HR0 L;  3BZK A;  1VQE A;  3G48 A;  3J7Z C;  4B3S L;  4A3L G;  4DV7 Q;  4A3E G;  2JA7 G;  1NE3 A;  1LYL A;  2N49 A;  2L15 A;  4JI1 Q;  3H3V I;  4A75 A;  2ASB A;  4AIM A;  2B29 A;  5LMN W;  1J5E Q;  3M7N A;  3W1B A;  1HR0 W;  2MO1 A;  3AFP A;  4DK3 C;  4Y7N H;  4OX9 Q;  4DV1 L;  2B63 H;  4GS3 A;  4DR6 Q;  1MJE A;  1AH9 A;  3M4O H;  3CC2 A;  4JBK A;  4LUZ A;  2CFM A;  1JE5 A;  1HJP A;  1N33 Q;  2IX1 A;  2XGT A;  1GM5 A;  2QEX A;  4A3B G;  4JV5 Q;  3UDG A;  2ZM6 Q;  4AQY Q;  1Y1V G;  4GKJ L;  1YNX A;  3I7F A;  4IJH A;  4POG A;  2F3I A;  4R4Q A;  1WCM G;  3HOU G;  1YHQ A;  3CQZ H;  1XPU A;  2YU9 H;  3RN2 A;  2UUA L;  4LF5 L;  1KC8 C;  2OWO A;  4BY7 G;  4GKK Q;  1AE3 A;  2CWA A;  3TRE A;  1KL9 A;  5FJ8 H;  5C3E H;  1VQL A;  2NVX H;  1PFS A;  3M4Q A;  1M90 C;  1I94 L;  2VUM G;  2HIV A;  3I4O A;  4DUZ Q;  4A3M G;  4R4T A;  3PO2 G;  2VS1 A;  1HZB A;  3HOY H;  2JK8 A;  1SR3 A;  3JAM c;  4JI2 L;  4HID A;  5H1S E;  4HIO A;  2Q2I A;  2UUB Q;  2R93 H;  2B3G A;  3S15 H;  1CSQ A;  1PYB A;  5AJ3 Q;  1VQF A;  1U5K A;  3GTM H;  3ICE A;  2PI2 A;  1K83 H;  1Z47 A;  3E0E A;  3CD6 A;  2ID0 A;  4IPH A;  1YIT A;  1VQ7 A;  1TWG H;  1X65 A;  1HZC A;  4AYB G;  2VQF Q;  4QGU A;  1IBK Q;  2CQO A;  1ASY A;  4YWL A;  2VL6 A;  3UE0 A;  1XMO Q;  2I0Q A;  3PIP A;  4DK6 C;  4DR7 Q;  2B63 G;  2NZH A;  5IP9 H;  3I4N H;  1VQP A;  2ES2 A;  2EQS A;  1KIX A;  4X65 L;  4KHP L;  2A8V A;  2LXJ A;  3I55 A;  3KJP A;  2Y0S G;  3PCO B;  4JI6 L;  1G29 1;  2K52 A;  3M4P A;  3PIO A;  4DV2 Q;  2UUC Q;  4A3G G;  2GVA A;  1W2B A;  3W1G A;  1X9N A;  5IYD H;  2V1C C;  1Q46 A;  4MNO A;  3CF5 A;  4DV5 Q;  3PUX A;  4DV3 L;  4NXM Q;  1TWC H;  3K0X A;  2YTY A;  3KDF B;  5FJ8 G;  5C3E G;  3J80 c;  4B3M Q;  3E9H A;  1VQB A;  3S17 H;  4P73 A;  4YHH L;  1VQ9 A;  3BZC A;  3CCJ A;  2KEN A;  3KYH C;  4DV4 L;  4HIK A;  1HNW Q;  4BXX H;  3HOY G;  1X55 A;  3RLN A;  1Y14 B;  2IHE A;  2NN6 I;  2I5H A;  1KQS A;  1B8A A;  5EAY A;  1E1T A;  1SN8 A;  2R93 G;  4POF A;  4BA1 I;  1HH2 P;  1IBL L;  3HFZ B;  2GN5 A;  4IFD J;  4IOC A;  3CCS A;  4A93 H;  4UP7 A;  1HZA A;  2A19 A;  2R7F A;  1N32 Q;  3HKZ G;  4QL5 A;  5J3B A;  4K0K Q;  2UXB Q;  3ULL A;  4P75 A;  1JT8 A;  4DV6 Q;  3UE1 A;  2HHH L;  5IY0 A;  5IP9 G;  3I4N G;  3PUZ A;  2RHS B;  4JI3 L;  1LUZ A;  2YTV A;  3EBE A;  3RN5 A;  1Q86 C;  4NXN Q;  1L2F A;  3G4S A;  2KCM A;  2LXK A;  5IYD G;  1BKB A;  4OWT B;  4JC0 A;  1E3P A;  5BR8 Q;  3I56 A;  3CCL A;  3RR5 A;  1KAW A;  2N3S A;  2EIF A;  2YTX A;  3G71 A;  1N34 L;  1XNR L;  4JBW A;  2JEB I;  2IHF A;  4HJ5 A;  1VQ6 A;  1RIP A;  4IJL A;  4BXX G;  3A5Z B;  4DR4 L;  1NMG A;  1V43 A;  1G6P A;  1XMQ Q;  4JG2 A;  1I50 H;  3U50 C;  3FP9 A;  5M5W H;  2OCE A;  1IBM L;  4Y52 H;  3AFQ A;  5GAE C;  4JI7 L;  2JA8 H;  3I4M H;  1WCM H;  2ZTE A;  2Q2T A;  3TRZ A;  1KD1 C;  1EQR A;  3F8T A;  1ASZ A;  1K9M C;  1CUK A;  4A93 G;  4JI0 L;  1GD7 A;  1V9P A;  2K5N A;  3S2H H;  2PNH A;  3CW2 C;  2R7Z H;  3PGZ A;  3GTO H;  3RZD H;  4LFA Q;  3S2D H;  3U58 A;  2ATW A;  4C2M H;  4OO1 I;  4PZ8 A;  2CWP A;  3HKS A;  5JJL A;  1QVF A;  3CME A;  5JJK A;  3F2D A;  5C0X I;  4ME3 A;  3MEF A;  1R9T H;  2UU9 L;  1PVO A;  1XPR A;  1VQJ A;  4GOP B;  1FGU A;  4X62 Q;  1PH1 A;  2EXD A;  2CKZ B;  2YV5 A;  1X6O A;  4UP8 A;  3F2B A;  3KDF A;  4GLA C;  2I5L X;  2RHQ B;  2Z0S A;  1JJC B;  1EOV A;  2WAQ E;  2OTL A;  4JI8 L;  3HOZ H;  1H95 A;  2JA6 H;  4DV7 L;  5JJI A;  1TXY A;  1XNQ Q;  1U0L A;  1PH4 A;  5LMU L;  4JI1 L;  4DR1 L;  2KCT A;  4MTN A;  2WP8 J;  2HT1 A;  1JJG A;  1N36 L;  4QQB X;  2Q2H A;  3VDY A;  2NVY H;  3KF6 A;  4OX9 L;  1FJG L;  2UXD Q;  4LF4 L;  3M85 A;  4B3S Q;  2VNU D;  1UE6 A;  1CKN B;  4A3G H;  3I4M G;  2JA8 G;  1N33 L;  3OTO Q;  1QZH A;  1S40 A;  1CKM A;  3HOX H;  2H5X A;  4DR3 Q;  4JV5 L;  4PZ7 A;  2ALY B;  2KHJ A;  4A4I A;  5IT9 c;  2ZM6 L;  3RNU A;  1K8G A;  4B3T L;  5GAG C;  5M3F H;  3Q8D A;  4P71 A;  2K14 A;  4L5R C;  1UE7 A;  2IT1 A;  2R7Z G;  3FHW A;  4BA2 I;  1XTD A;  3H15 A;  2FXQ A;  4QY7 A;  1A0I A;  1S3O A;  1OXX K;  4A3D H;  4LNQ A;  1Q1E A;  4GKK L;  1PA6 A;  4GN4 B;  2PQA A;  3BU2 A;  2AHO B;  3L0O A;  1OXU A;  3OW2 A;  1EQQ A;  4LF9 Q;  1SRU A;  1VQI A;  4LF7 L;  2PMZ E;  4R4O A;  2K4K A;  4WJ4 A;  1MKH A;  2F4V L;  1EWI A;  1NMF A;  3TQY A;  4ALP A;  1G51 A;  4X66 Q;  4GNX B;  4KI0 A;  4FDB A;  5GRO A;  3HOZ G;  5AJ3 L;  4A3C H;  3CCE A;  1VQO A;  2YYZ A;  4X6A H;  1C7Y A;  2VZA A;  2JA6 G;  1YI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...