4AQYQ

Structure of ribosome-apramycin complexes
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4aqyQ00
1EWIA 2QGQA 4MNOA 4DV1Q 2F4VQ 3CMEA 4LW1A 2Z6KC 1KRSA 5ELOA 3UDIA 3J81i 3HOUH 4PZ7A 5GAHC 5C3EG 1QVFA 2ASBA 3ICEA 5C4XG 3PO3H 1U0LA 3CAMA 3HOVH 2MQHA 1D8LA 1YEZA 2E5LL 1WCMH 2VUMG 4X65L 4B3SL 1G6PA 3HOWG 2KCTA 1EQQA 5JJKA 2RHSB 3IRBA 3D0FA 4LNQA 2PQAA 5IP9G 1JMCA 1C7YA 1GVPA 4P74A 3ERSX 2AHOB 4DR3L 3RLOA 3CC4A 3HOZH 1X54A 2VQEQ 3CCEA 1JJ2A 3PV0A 3OTOL 3STBD 1YJ9A 1N32Q 3CXCA 1IZ6A 2EQSA 4AYBG 5LMNL 1VQ8A 2I5MX 2ID0A 2E5LQ 2NN6G 4A93H 2UXDQ 3CCQA 2HIVA 5IYCG 3F2DA 1HNWQ 4YCWA 5H1SE 3MEFA 1VQDA 1CKNB 2YTVA 4UP7A 3B6YA 2CWAA 1EQRA 4C3JH 1VQJA 2E2JH 2ZJQA 4JYAL 2YTYA 3A5UA 2JA8H 3EBEA 2D0OA 4JI1L 2NZOA 3RLNA 2GVAA 3A0JA 3PF4A 3AEVA 3GTGH 4HJ7A 1UE1A 2A1AA 4JCVE 1NY4A 1G51A 2RCNA 3J80i 4X65Q 3OYYA 4PZ8A 4B3SQ 3KYHC 3I4MG 1WJJA 2R7DA 4DV2Q 4MTNA 1TWCH 4R1JA 1EIFA 1YBYA 4L5QA 4GLXA 2HQLA 1XJVA 3L0OA 4EX5A 2UUBQ 2JA9A 1CKMA 4DAYB 3UDFA 4L5TA 1E24A 3KDFB 4LF8L 2UXCQ 3I4NH 3S2DH 1LTLA 2E2IH 2KCMA 4A3CH 2A8VA 1MJCA 4DV4L 4B3RL 3ULJA 5IYDH 1YNXA 1QZHA 4A3GG 4A3LG 1NMFA 1XNRQ 3HOYH 1K9MC 2AMCB 4O0AA 1KIXA 3PSIA 5IP9H 5J3BA 1P8LA 1XMOL 1CSQA 3W5OA 4DV5L 1X6OA 5HY6A 4C3IH 1HZAA 4QGUA 3J81j 1Y1WH 3FKIH 3RNUA 1EIYB 1BBWA 1Q46A 1Q81C 3MXNB 4FDBA 3H3VH 3JAMc 3AFQA 2Q2TA 1A0IA 2CWPA 2PI2A 2OTLA 4DAMA 4AQYL 3S14H 3HKZE 3EIVA 3RN5A 1TWGH 5M5XH 1H95A 1NBWA 2R6GA 1VQMA 1E1TA 2JE6I 1VQPA 4A3EG 1OXUA 1PH9A 4IFDJ 3AQQA 2R7FA 3CC2A 4TQUS 4P71A 2JA7G 4A3BG 1KHIA 4A3DG 2XGTA 1FJGL 3HOVG 4IO9A 2VL6A 5DLQE 4HIDA 1UE6A 2ZM6L 4JI6Q 4BBSH 5JJIA 4GNXA 1L0WA 4JI3Q 3G6EA 4QY7A 2ZM6Q 1VQFA 1M1KC 1WFQA 2VZAA 4P72A 4YY3Q 3S1QH 2JA5G 4LFAL 1Q8KA 3KFUA 1PH7A 4LWCA 4GOPC 4A3FG 4JI1Q 1KRTA 4EQ5A 2XTIA 3HOXH 3PO2H 4LF4Q 1AE2A 1KL9A 1Y1VG 4YWKA 1XMQL 2R92H 1TWFH 3S1MH 1PVOA 3DM3A 3E9IA 4A76A 3K0XA 1Z9FA 2WP8J 3GTJH 4JI5L 4AQYQ 1PH4A 1RL2A 4HJAA 4NXNQ 1T9HA 4GNXB 2NVXH 4DR2L 4A3KH 3AFPA 2IX1A 4QL5A 4OONA 1N32L 1W3SA 1FGUA 1PFSA 2D62A 1Q1BA 2DGYA 2F3IA 2MNAA 3KJOA 3CC7A 1PH6A 1IBLL 4JI7Q 3M3YH 1BVSA 1N33Q 3TS2A 2JJQA 4BA1I 4A3MH 4JI8L 4H02A 3KF6B 4DUYQ 4JV5Q 1K3RA 4TVAB 2R93H 2JEBI 4BXXG 4DV3Q 3H0GH 4IOCA 2K5VA 2NVTH 4RG1A 4DV7L 2UUCQ 1XNRL 1I94Q 3GDEA 4Y52H 2VQFQ 4GKJQ 1OXSC 3HOZG 5GQOA 2OQ0A 4YY3L 2WB1E 2QEXA 2WAQG 2Z0SA 1J5EQ 1CSPA 1VQAA 4DV1L 3U58A 3F1ZA 2NVQH 3CQZH 2LSSA 3CPFA 1AE3A 1S40A 1J5EL 4KLKA 1MJEA 3I2ZA 2ZJPA 5M5YH 1IBMQ 1GM5A 1PH3A 2K52A 1XPUA 1SRUA 3HKZG 2K50A 3J7ZC 5GAEC 4P73A 4PZ6A 1E7ZA 4R4IA 3ULPA 1VS0A 2K4KA 2F52A 4DUYL 4DR5Q 3S1RH 1R9TH 3S2HH 1X3FA 1VQBA 2AWNA 2YYZA 2JEAI 1VQKA 2B63G 5GADC 2Y0SG 5M3FH 1A8VA 3G48A 1X55A 4JI0Q 5IWAQ 4RMFA 5C44G 1SN8A 3RN2A 2NN6I 3TS0A 2HHHQ 1K83H 1PA6A 1V9PA 2PMZE 3D31A 1XMQQ 4DK3C 3S24A 3EN2A 3PUWA 5E7NA 3RR5A 4A3IG 4A3JH 1OXXK 3F2CA 4HIOA 1VQ6A 1V43A 1W2BA 3PUZA 1IBML 4HJ8A 4BA2I 3RZDH 2JA6H 4LFBL 4DK6C 4BY1G 4B3ML 1ASYA 5AJ3Q 4GS3A 4Y7NH 4DR1L 1VQLA 4BBSG 3GD7A 2RF4A 1CKNA 2PI2E 4IJLA 1HNXQ 2BA1A 5AJ3L 3VDYA 3RZOH 2NVYH 3UDXA 3GTMH 3S16H 1G291 4JBMA 4DV2L 1JB7A 3UDGA 2AWOA 1HZ9A 3FKIG 4NB3A 4DV3L 5IY0A 4IFDG 4DV0Q 1WYDA 4HIKA 3Q8DA 1SFOH 3U4ZA 3KOJA 1M90C 5C4JH 2VY3A 3F2BA 4X62L 1VQHA 1YVCA 1IXRA 3SGIA 3J81c 4IPGA 4ALPA 4LF7Q 3H15A 4IPCA 1NMGA 2CKZB 2GN5A 1XTDA 4A4IA 1Q7YC 1L1OC 5JEAJ 1GD7A 3TEHB 3T1HL 3NENA 2KENA 4DKAC 1XMOQ 4LFCL 1PHJA 3TQYA 3T1HQ 4DV5Q 4A3MG 4YCUA 1VQGA 4LF4L 3CCUA 2B29A 2ALYB 1XNQQ 3S17H 2NZHA 1X3GA 4LF6L 3CCRA 4IJHA 2UU9Q 1PYSB 2ZTDA 1EYGA 4JBKA 5IYBG 3E0EA 4UY8C 2E8GA 5FJ8G 1HNXL 2KHJA 1AH9A 4JI6L 1QZGA 3UE1A 5IE8A 4QQBX 3AYHB 4WJ4A 2IHEA 5C0XI 2JA8G 2IY5B 3KDFA 2YV5A 3W1BA 4BY1H 2RHQB 3FHWA 3PUYA 1K0RA 5JJLA 1I6HH 5FLMG 1I50H 1IBKQ 4B3TL 3UE0A 4XTCS 1ASZA 4L5RC 4JI4Q 1C9OA 1KQSA 1VQNA 3K7UC 2PQAB 3JC66 4X64L 1N36L 2K14A 1TWAH 1Q82C 3S1NH 1SLJA 3M4OH 2V1CC 1EUJA 3W1GA 3CP0A 2JQOA 3I4OA 4R4QA 1Q1EA 1MKHA 1XNQL 3H0GG 1S72A 4JYAQ 4BY7G 3HFZB 4JI5Q 1O7IA 4PG3A 1X65A 4LFCQ 2QA4A 5M3FG 2HT1A 4BBRG 3F8TA 3NBHB 3PGZA 5C44H 4R4TA 1PV4A 2BH2A 4A3LH 1HNZQ 4JBJA 2MFIA 5LMUL 4A3IH 2UUAL 3OTOQ 2R7ZH 2VQEL 5K36G 5C0XG 4B3RQ 4ME3A 2OTJA 4JG2A 3I55A 2A19A 3T1YL 2OWOA 4DR3Q 4R4OA 4YCVA 5IT9c 1YHAA 1B7YB 4DV0L 4HJ9A 4LF8Q 1YIJA 1BKBA 1EFWA 2WB1G 1QUQB 4DR4L 4QIWE 3CCVA 1IYJB 1S3OA 1J6QA 5IP7G 1I5FA 1L2FA 1EOVA 1TWHH 2GVBA 4DV7Q 2UUCL 1MIUA 2BA0A 3LGJA 3G4SA 1N8RC 3CD6A 4KHPQ 4DR1Q 3PCOB 4A3EH 1E1OA 3M9BA 1HZCA 3DLLA 4AYBE 1N34Q 1YZ6A 2JA7H 4A3BH 2H5XA 3PUXA 2Y0SE 5ELNA 1UWVA 1X56A 3BZKA 4UPAA 4A3JG 4LF6Q 4OO1G 4OO1I 4DR2Q 2UUAQ 3ULLA 4AIMA 4K0KL 1N9WA 3H3VI 4X66L 1YHBA 4LF9L 1BBUA 3KF8B 4DV6Q 3CF5A 3PIPA 1N33L 4LF5Q 1HH2P 2N49A 1K8GA 4A3FH 4POGA 2AKWB 1JE5A 2HIXA 2IHFA 2CFMA 2EXDA 5LMNQ 1C0AA 4GOPB 4WJ3M 4GN5A 4A75A 1VQ9A 1HR0W 3M85A 1N36Q 1TXYA 4DV4Q 1PH5A 1P16A 2R92G 1WOCA 4OXPA 3KJPA 2N8NA 5FJ8H 1K73C 2R7ZG 4KHPL 2N3SA 4B3TQ 4MZ9A 3I4NG 3L7ZC 2D0PA 2OCEA 1U5KA 4GLVB 3K7AH 5IYDG 1X9NA 3PIOA 4A3GH 3HOYG 3BZCA 3K81C 3M4QA 1FVIA 2CQOA 2F4VL 1YI2A 1QVGA 3L2PA 4AH6A 4BXXH 4B3MQ 4DNIA 3HKSA 1X3EA 3U50C 1JJGA 5C0XJ 3T1YQ 2UU9L 1LUZA 5M3MH 3GTOH 1LM0A 3KF6A 4NPSA 4GLAC 2PNHA 4LF5L 2ZTCA 4J15A 4JV5L 2I5LX 2FXQA 1SE8A 4JI8Q 3NEMA 2KHIA 1HNWL 1YITA 4JI0L 3GTQH 1WCMG 2VUMH 3GO5A 2C35B 4QJFA 4XIGS 3S15H 1Y14B 1UEBA 4LUVA 1NTGA 1QVCA 3K80C 4X62Q 1VQIA 4OX9Q 2UXBL 4A3DH 2ZTEA 4GKKQ 2Q2IA 2Q2HA 3CW2C 4DR7Q 4YHHQ 1HJPA 5GAGC 1HR0Q 3TREA 4C3HH 2ES2A 5FLMH 2R93G 1XPOA 2KBNA 1QUQA 3OW2A 3ZJYC 2E2HH 2JA5H 1UE7A 1N34L 5IYCH 1B70B 1B8AA 5IP7H 2B3GA 2N78A 1JJCB 2OQKA 3HOXG 1SROA 2YU9H 4OWWB 1IL2A 3CPWA 3M7NA 4YWMA 3PO2G 1Y1VH 2UUBL 4BY7H 1NE3A 1L1OA 3PF5A 4BBRH 1VCIA 4NXML 3PO3G 4JI2Q 2YTXA 4DUZL 4HJ5A 4DR6Q 2JA6G 4A3KG 1I94L 1PH8A 4HIMA 2ATWA 3M4PA 3CCLA 3CCJA 1VQOA 5FLXc 1PYBA 5IWAL 1OXTA 3WWVA 1K8AC 4PMWA 1HR0L 2HHHL 1E22A 2EIFA 3TRZA 1XPRA 3PUVA 4OX9L 2DUDA 2CCZA 2UXBQ 2IX0A 3A5ZB 3BU2A 1YHQA 1KC8C 1D7QA 5BR8L 1HNZL 3ER0A 4GN3B 4X6AH 4C2MH 2LXJA 4A3CG 2MO1A 4IPHA 1OXVA 4GOPA 4R4CA 3JAMi 4JOIC 1GKHA 5LMNW 3CCMA 1SR3A 3KLWA 4JC0A 5GROA 1YJWA 4JI2L 4L5SA 4DPGA 1VQ4A 4DR6L 4DUZQ 1NJIC 4JOIA 2Z6KA 5C3EH 3HOUG 2UXDL 1CKOA 4NXMQ 2L15A 3STBC 1VQEA 4POFA 4JI3L 5C4XH 1WI5A 1UE5A 2IT1A 3J80c 2VNUD 1KD1C 1VQCA 1IBKL 2JK8A 1A63A 3HOWH 1E3PA 1DGSA 1HZBA 1LYLA 4JBWA 3I56A 1FJGQ 2VQFL 4GKJL 4LFBQ 3A74A 4DR4Q 1VQ7A 5HGQA 1KXLA 4P75A 5M3MG 5IYBH 2B63H 2K5HA 4KHZA 4GN4B 1Q12A 2K5NA 4IPDA 1RIPA 4DR7L 2ZJRA 3CMAA 1V1QA 4LUZA 4YHHL 1I3QH 2WFWA 4A93G 3GTLH 1VQ5A 2Q2UA 3CCSA 4GKKL 1Q86C 2I5HA 2BH8A 4UP9A 4O2DA 4APVA 5JEAG 4GNXC 1IBLQ 5BR8Q 4JI7L 3GTPH 1SMXA 3RLFA 5LMUQ 4NXNL 1FL0A 3E9HA 1PH1A 2VS1A 4KI0A 4LUOA 4OWXB 1OTCA 4DV6L 3FP9A 1JT8A 3NELA 1PH2A 4LF9Q 1Z47A 4DR5L 2LXKA 2I0QA 2K75A 2WAQE 2MO0A 1YJNA 1Y1WG 4YWLA 3J7A5 4X66Q 3I7FA 4IFDI 5EAYA 1L1OB 4K0KQ 3G71A 4UP8A 5M5WH 4IOAA 3U4VA 4LFAQ 4OWTB 1KAWA 3GTKH 1GO3E 3I4MH 1CUKA 4LF7L 4X64Q 3BJUA 2VW9A 2UXCL 4JI4L 3K8AA 1A62A
chains in the Genus database with same CATH superfamily
1EWIA 4DV1Q 1X3QA 1I6HB 3DXJC 2EZVA 3UDIA 3NHHA 4C1NI 3HOUH 4PZ7A 1QVFA 4Q5VA 3CAMA 3HOVH 2MQHA 5I9OA 3OOCA 1WCMH 3PQIA 3NUCA 5ELDA 5CV6A 2RHSB 2PNRC 4KJNA 3Q0AA 2PO4A 4ZRZA 1XWEA 4DR3L 2XRSD 1R4QB 1PRTB 5ELCA 3GTJB 4HMIA 2PW7A 4OEMB 3VYTA 4ZYSA 2Y0SB 2EQSA 4AYBG 4K2LA 1DXMA 2KQ3A 4U68A 4NKLA 2MGSA 1BF4A 2E5LQ 1GJXA 3CCQA 3F2DA 1F77A 3MTSA 2Z4HA 1VQDA 1CKNB 2YTVA 1V1OA 3B6YA 2YTYA 1MHWC 1TWHB 1R4PB 3S2HB 1E2VA 4JI1L 2D0OA 3RLNA 1QCBD 3A0JA 1QJOA 1HA5A 1VF7A 1HQRD 1A15A 4HJ7A 2SOBA 4KY7A 1B44D 2RQXA 3LX0A 4ZKCB 4X65Q 2L9HA 2K03A 1WJJA 4G4KA 2M9VA 3K58A 1FYCA 5AFWA 2E76C 3BVGA 1SYCA 2KCCA 2UUBQ 2JA9A 4L5TA 1E24A 4LF8L 4DAVA 4A3CH 2KCMA 1S4ZA 2B2TC 2MUYA 1YNXA 3PO3B 1H9SB 2AMCB 3QG1A 5EPLA 3P1HA 1CSQA 3W5OA 2QKIC 5HY6A 1HZAA 2HQEA 1EIYB 1BBWA 1PRTC 1Q3LA 2O5JC 1QNKA 2CWPA 2PI2A 3HOYB 3OW7A 4DAMA 3S14H 1LT5D 3KK7A 4CHTB 3VYRA 1ML0D 1TWCB 4P71A 2F0UA 3TBIB 2JA7G 3J81L 1FJGL 4JI6Q 4HIDA 1UE6A 2F0OA 2ZM6Q 1M1KC 4P72A 5C4HA 3S1QH 1XTCD 1HPCA 4LFAL 1HFNA 2J0TD 2ICEC 2QILA 4LWCA 3F2UA 4JI1Q 1TWGB 1PRTD 3HOWB 3PO2H 4TRDA 2Z8LA 1KL9A 1Y1VG 4YWKA 1QILA 2R92H 3E9IA 1Z9FA 1PH4A 4JI5L 1CTMA 1RL2A 4NXNQ 4ID6A 2B2VC 3P20A 4OGQC 5HURA 3NPPA 4OONA 5I2XA 1FGUA 2D62A 2F3IA 1JJGA 2OXPA 4O1NA 3KJOA 3M3YH 1BVSA 2JJQA 2R92B 4A3MH 4JI8L 3V05A 1K3RA 2F0FA 3NK9A 4TVAB 2Q8IB 2JEBI 4CBVA 4BXXG 1BBXC 1STBA 2L12A 2Z1CA 4OHJA 1UEAB 3NBHA 2EVBA 2WAQG 2DNEA 2DY8A 2RDHA 5M5WB 1MJEA 3OIPA 1JOKA 1GM5A 1SRUA 1XXGA 2K50A 4PZ6A 2NTTA 3C1FA 1BQQT 3T4AC 1E2WA 4ZUIA 4DUYL 3PMFA 4DR5Q 4K2KA 5CMDA 5C4JB 5IWAQ 3Q24A 5C44G 2HHHQ 1HUNA 2NN6I 3TS0A 3N52A 1PA6A 2E5LL 3HG9A 3S24A 3EN2A 4A3JH 5E7NA 3RR5A 4A3IG 1SE4A 2IL8A 4EGVA 1SNDA 4U673 1V43A 1W2BA 4XDXA 3RZDH 4LFBL 1LACA 4DK6C 5KIXA 2O4XA 1VDZA 4BY1G 1BCPD 4B3ML 4IJLA 5AJ3L 4G7ZC 3RZOH 2Q8RE 3NTIA 4JBMA 4DV2L 2A6HC 1JB7A 1VMPA 3FKIG 2F0GA 5KEEA 1WYDA 4HIKA 5M3FB 3U4ZA 3KOJA 1M90C 2CHBD 2VY3A 4ALPA 4X62L 3S17B 1XTDA 3GTGB 4A4IA 1RF2D 3R2IA 1Q7YC 2Z6BA 1GD7A 2B2WA 3T1HL 5I6YA 3H6MA 3S1QB 2KENA 3L9AX 1EWHA 4DV5Q 4LF4L 1ZYRC 1LTGD 4IQZA 4LF6L 1PYSB 1EYGA 4BY7B 4RGOS 2A6EC 1DD2A 4UY8C 1F2YA 2E8GA 4JI6L 1QZGA 4RGNA 2X69A 1O78A 3QO2A 2FFKB 2BE5D 3NQIA 2EXZA 2JA7B 2NYZD 1K0RA 1A6XA 1IBKQ 2F0NA 3UE0A 1D1KA 4C3IB 1CA5A 1ZEQX 4L5RC 1L0XB 4K5WA 2HDLA 3Q22A 1NCVA 3S1NH 4G7HC 1EUJA 3W1GA 1PFBA 1A3VA 4JYAQ 2MHVA 3KLSX 4LFCQ 2QA4A 1B2TA 4KJOA 4BBRG 3BYTB 4WRDA 4A3LH 5EPJA 5LMUL 2UUAL 5C0XG 4JG2A 3I55A 4FF1A 3QOLA 1T5EA 5EKIA 1BKBA 1QB5D 4QF4A 3FPUB 2WB1G 4DR4L 1IYJB 1S3OA 1NNXA 2CVRA 2PQEA 1I5FA 4JW0A 1MIUA 2QCPX 4KY6A 3LGJA 3CD6A 3T51B 1I4HA 3PCOB 5KGUA 1ENCA 4EQOA 2IX3A 2F3VA 2VB2X 2JA7H 5D3IB 2QDLA 2D5DA 4LF6Q 4UPAA 4OO1G 1N9WA 2NBFA 3A8KE 1YHBA 5C3WA 1BBUA 3KF8B 4DV6Q 1N33L 1HH2P 2MJ8A 4A3FH 1JE5A 2CFMA 2EXDA 4GOPB 5CGKA 1HR0W 3HOUB 2R92G 5C5LA 2EYOA 4OL7A 1STHA 3BDCA 4MZ9A 3I4NG 2D0PA 5ELEA 3SXHA 3BG3A 3J7YW 2VB3X 3TN2A 1X9NA 3BZCA 5FO7B 2K5QA 1EIGA 3L2PA 1FR3A 2HD3A 3IFTA 3K57A 1A3UA 1EOTA 2J4XA 2KEEA 2ZXOA 2B2UC 1DOLA 2UU9L 4ABNA 1CI3M 5IGCA 4NPSA 1F9PA 3C46A 4LF5L 2ZTCA 4JV5L 1STNA 3S15B 4LJZC 3M4OB 3I4LA 2DY7A 1VQIA 4B9WA 5KYIA 4GKKQ 3CW2C 2Q2HA 1DCZA 3D4RA 3BVZA 2K04A 5FLMH 1TWFB 2KBNA 2A73B 4I65A 2KA7A 2K28A 1UE7A 3LWUA 1H9SA 1JJCB 2OQKA 3R3OA 3M7NA 1SROA 4K8JA 2YU9H 1SSOA 1TU2B 2UUBL 2A69C 4RHRA 3NBIA 4NXML 4FXDA 4WFN3 2YTXA 4DUZL 4HJ5A 3HKZB 1DOMA 1ESFA 4A3KG 1SE2A 3TZDA 2ATWA 3CCLA 1QNUA 3T13A 1EZ6A 4MIUA 1Q8IA 5EBCA 2PZUA 5KNDA 1WVLA 2DUDA 1AZQA 3H0GB 3SHLA 1YNNC 4TSSA 2IWHA 4X6AH 3E0JA 1OXVA 2FINB 1MD2D 3MWYW 3CCMA 1SR3A 3SDZA 2IW3A 4L5SA 4CDDC 4DPGA 1VQ4A 4DR6L 1NJIC 3HOUG 4JOIA 3HRZC 5JJZA 5DM73 2K33A 2R93H 2IT1A 4KKUA 1G2TA 5D14A 4A3MB 3HOWH 3MC0B 1E3PA 3I4NB 2VQFL 1VQ7A 5HGQA 4B08A 4P75A 5M3MG 1KXLA 2F03A 3P7JA 2K5HA 3QIAA 4KHZA 1SYBA 1Q12A 3DEOA 2BOSA 4F8MA 3CMAA 1E2ZA 1M8AA 4YHHL 4A93G 2NN6H 1VQ5A 2Q2UA 3X3NA 1VQ6A 4GNXC 2JA8B 5BR8Q 4DK1A 1K0SA 3DMUA 4NXNL 3HEJA 1ONLA 2K5WA 1FL0A 4OWXB 2X6LA 1OTCA 3FP9A 4BS9A 1JT8A 3FDTA 4LF9Q 1V1PB 4ZKBB 2LXKA 2I0QA 5CORA 4YWLA 5HGTA 2SNSA 2L1BA 4CJ1B 2ENBA 2B63B 3I4MH 1CFMA 3BJUA 2UXCL 1A62A 1RHPA 4RGMA 1JB3A 5ELOA 2JA5B 4JPBW 5GAHC 5C3EG 5C0XH 2ASBA 1U4LA 4V190 2O2LD 5C4XG 3PO3H 3BDOA 1D8LA 2VUMG 1QE6A 1G6PA 5CBAE 3BDLA 1GUGA 1EQQA 5JJKA 3ONAB 3TP6A 3D0FA 2M00A 2PQAA 1JMCA 3CCEA 1DZ1A 4HN7A 3STBD 1YJ9A 1N32Q 2EYMA 3CXCA 1BDOA 1VQ8A 5LMNL 2ID0A 3QB3A 1ZKOA 3EJIA 2UXDQ 3MXPA 5IYCG 2L4NA 2RSNA 2LY7A 3MEFA 1VQJA 1F2ZA 2JA8H 4NW2A 3GTGH 3QR8A 4JCVE 2A1AA 4BBRB 4B3SQ 4PZ8A 2XIWA 1CA6A 1AN8A 1TWCH 4K8IA 4L5QA 3SVMA 2HQLA 5F2DA 3L0OA 4DAYA 1CKMA 5M5XB 2IJ0A 1IW7C 3SK8A 1K3BC 1STYA 2EOTA 3S2DH 1IYVA 1LTLA 2A8VA 1MJCA 3ULJA 5BN5A 4DF7A 4A3GG 1XNRQ 4A3DB 1K9MC 4O0AA 5FOBB 1KIXA 3PSIA 1ZYRD 3Q6SA 5J3BA 3FMCA 1P8LA 4RWSC 1QOHA 1IKLA 4C3IH 4QGUA 1RD9D 3K6OA 3FKIH 3RNUA 1KLGD 3NSWA 3JAMc 4KN7C 4ZCKA 1A0IA 2OTLA 4AQYL 3HKZE 3H91A 3MVVA 3T53B 1VQMA 1E1TA 5IGGA 1BR9A 2JE6I 1PH9A 1FNVA 3SR1A 3AQQA 2WB1B 3CC2A 2XN9C 4KV6A 2LMCB 1KHIA 2F0DA 1TS3A 3HOVG 4IO9A 1NAPA 1RTOA 4JI3Q 2WKCA 2F0JA 1WFQA 2F0LA 2RDGA 2VZAA 1BCPC 3T56B 3KFUA 3OIQA 1PH7A 5A2QE 1ZXTA 4EQ5A 2PZTA 1ET9A 3HOXH 4M1UB 4LF4Q 3QJYA 1AE2A 1XMQL 5DEHA 1HA6A 3D3RA 4PQXA 2E2DC 1JC7A 3GQBA 4A76A 3K0XA 4AQYQ 1T9HA 2NVXH 4DR2L 4A3KH 2IX1A 4QL5A 2SEBD 1N32L 1W3SA 3U9OA 1Q1BA 2DGYA 3S15H 1PH6A 1ENFA 4BA1I 4DUYQ 2RKSA 2V4DA 4DV3Q 2R93B 3HS0C 1XNRL 1I94Q 1OXSC 3DHQA 2QEXA 2E74C 2Z0SA 4MHEA 4DV1L 3U58A 1JWSD 2NVQH 3CQZH 2LSSA 3CPFA 2L0CA 4RKBA 1S40A 1RCVD 2QDBA 4KLKA 2FMMA 4EQNA 3FVQA 3J7ZC 1F9QA 3K5LA 4J1MA 1E7ZA 1RJTA 4R4IA 3N6RA 1VS0A 2F52A 3S2HH 1VQBA 2YYZA 3E5SA 2JEAI 3W3AA 1VQKA 2JXMB 4LK1C 5GADC 2JN4A 1U4PA 3K5MA 1A8VA 2L55A 4JI0Q 4PMCA 1MI2A 1Y1WB 1K83H 1PFNA 1V9PA 2PMZE 4DK3C 4OO1H 1SEBD 3F2CA 2HUGA 1BOSA 2VUMB 4E6IA 3IL8A 2FJ2A 4BBSG 4RFBA 2EY2A 3GD7A 2RF4A 1CKNA 1HNXQ 3VDYA 2NVYH 3GTMH 3S16H 1G291 4DA2A 2L5TA 2EE1A 3QWNA 3UDGA 2AWOA 2NZ1D 4IFDG 4DV0Q 1M4VA 2PYKA 4LF7Q 1SNQA 2J7ZA 4IPGA 2XSCA 4DXGA 3H15A 2CKZB 3RD4A 1EL0A 1L1OC 2P5ZX 5JEAJ 2NWGA 3NENA 3VR6A 4DKAC 1XMOQ 3NTKA 4ZUJA 3TQYA 3T1HQ 2AQ2B 2B29A 1XNQQ 3S17H 1U4MA 1X3GA 4YIJA 3CCRA 4IJHA 5IIFA 4JBKA 2ZTDA 5IYBG 3E0EA 3M4YA 3MXGA 3K0YA 5I4DA 4K14A 2EJGC 4FO2A 5FJ8G 1CK1A 1AH9A 4L6TB 3AYHB 4GZYC 1XX8A 2IHEA 5I2YA 2JA8G 5FK9C 1B9NA 5FO8B 4RCNA 2E2HB 1I6HH 5FLMG 2B2VA 1ASZA 3VA7A 4JI4Q 2GA4B 3K7UC 1N36L 1TWAH 3M4OH 2V1CC 5L37A 2JQOA 1KDCA 1EEID 4BY7G 3HFZB 1I6VC 1O7IA 1X65A 5M3FG 4CJ2C 5C44H 1JWMD 2F1MA 2I07B 2Z4IA 1PTOF 1GUNA 3DWPA 1KLUD 1PV4A 5IGEA 4A3IH 2VQEL 5K36G 2G5DA 2F0TA 2A19A 4CDCC 4DR3Q 1Y8PB 4C3IG 3IFDA 1B7YB 1GUOA 1WTHA 2PZWA 1EFWA 3KLSA 4H0LC 4JVZA 4WJWA 4QIWE 3CCVA 1TWHH 1EOVA 2GVBA 2BA0A 1PDQA 2WAQB 3G4SA 1EY6A 4KHPQ 2NVTB 1F9RA 3CHBD 4A3EH 4RA8A 3M9BA 3DLLA 4AYBE 4IN3A 5FO9B 3V96A 2Y0SE 3MHBA 1UWVA 1X56A 4A3JG 2UUAQ 1KAAA 4K0KL 3A56A 1PLFA 3PIPA 3GTKB 3WDNA 1K8GA 2K1BA 5DM63 4POGA 1WTVA 2AKWB 4PV1C 4WJ3M 3NE5B 3M85A 1R9TB 2I46A 1P16A 4ZAIA 1S5DD 4OXPA 3KJPA 2EYJA 2N3SA 4B3TQ 3EQLC 1U5KA 4GLVB 3K7AH 3PIOA 3K81C 1FVIA 4HEDA 1RTNA 1CQVA 4C1NK 4LAAA 3ZYYX 1B3AA 5C0XJ 1EYAA 1LUZA 1WD1A 4P2CB 1EY0A 3SK6A 4GLAC 2PNHA 2O5IC 2HCIA 3AB9A 1II3A 3S14B 2KHIA 1HNWL 3E3XA 2VUMH 3GO5A 4QJFA 4XIGS 1UEBA 1NTGA 1QVCA 4X62Q 2D9UA 4A3DH 4DAPA 1TWAB 2ZTEA 2F0IA 5IGFA 2Q2IA 3FEWX 5GAGC 4DXFA 1TT2A 3TREA 1XYIA 4DK0A 2R93G 4FF4A 1QUQA 3OW2A 1H9MA 2A68D 2RBMA 5IYCH 2F0VA 2B3GA 2N78A 2OT2A 4XYQA 4QUFA 1IL2A 4OWWB 4NDXA 2CH4W 4FYDA 4DR6Q 2JA6G 1JCKB 2PCFB 1PH8A 4IUPA 4UDUC 2TMPA 1K8AC 1HR0L 1E22A 5E4XA 4KN4C 1JORA 3PUVA 3MXNA 4ZK9B 1A2UA 1D6EC 4DFAA 3ER0A 3L3OC 4MTKA 1O80A 2LXJA 5CV4A 2EYPA 5JPNC 4IPHA 1Y1VB 4RGTA 4K6LA 1UNSA 1A2TA 3KLWA 1YJWA 1SNMA 4DUZQ 4F7XA 2CH4A 2Z6KA 5C3EH 2L15A 4XT1B 4POFA 5C4XH 1UE5A 3J80c 1QWYA 1VQCA 1B1ZA 1IBKL 1LTAD 1DJRD 3BVMA 2AQ1B 4CKBA 1DGSA 4JBWA 1LYLA 1LT6D 4GKJL 4LFBQ 1LTSD 5C6AA 1G91A 1GUSA 2K5NA 1L0YB 1UUPA 2ZJRA 1BCPF 2F0HA 4FVMA 4LUZA 2WACA 1I3QH 2WFWA 3GTLH 2BDOA 1Q86C 3I70A 2F0EA 5LMUQ 1I4GA 2A69D 1PH2A 2NUCA 2K75A 1B4OA 2MO0A 1YJNA 1SNPA 5BN4A 1L1OB 1SJED 2QW7A 1AZPA 5M5WH 4IOAA 4LFAQ 1KAWA 4XQJA 1WD0A 4OIJA 1SMYC 2VW9A 3K8AA 4H13C 4MNOA 1EY5A 3CMEA 4IUVA 1KRSA 4DGZA 1D5ZC 4FF3A 1K8OA 5E1FA 2KECA 1GHJA 2K05A 4X65L 4KD3A 3HOWG 2KCTA 1PMRA 1PTOC 5CYUA 4P74A 3ERSX 2NVXB 2B2YC 1JJ2A 3TDQA 3OSOA 3PV0A 3KF8A 4QIWB 4A3JB 1IZ6A 4A3KB 3OWFA 4J8QA 4A93H 2NN6G 1MSGA 3KLRA 4YCWA 2MNAA 2UXDL 4UP7A 5BN3A 2CWAA 1EQRA 4C3JH 2E2JH 4H44C 4JYAL 1IHZA 3EBEA 5ELFA 4KKSA 1DYQA 1I4PA 5EBDA 1G51A 3J80i 1JQYD 1F2MA 3KYHC 3I4MG 2R7DA 4DV2Q 1SYDA 2E75C 4R1JA 4IALA 1XJVA 4EX5A 2E2IH 4DV4L 4B3RL 1QZHA 4A3LG 2K5DA 5C4XB 3T16A 4JK1C 2B2TA 5IP9H 1JOQA 4L63B 4DV5L 1X6OA 4UHVA 3J81j 1Y1WH 1Q46A 1Q81C 3MEHA 3MXNB 4FDBA 3AFQA 1CT1D 2Q2TA 2H4OA 2EYHA 2LS01 3EIVA 1TWGH 3EVQA 5IODA 1H95A 4X3TA 3PO2B 2R6GA 1VQPA 1OXUA 3GTOB 2R7FA 4TQUS 2TSSA 3QOJA 4A3BG 4A3DG 2XGTA 1BCPB 1JOOA 1BXTA 2VL6A 4BBSH 2EDGA 5JJIA 4GNXA 4YY3Q 1KNAA 1JR0D 1U9RA 2B8GA 4IUQA 4A3FG 3J7AF 3P75A 1F9SA 1KRTA 1SYEA 1SXTA 2XTIA 2F3WA 4CGYB 1CHPD 1GXDC 3S1MH 1JICA 2Z9HA 2WP8J 4FXGC 2VXWA 1IW7D 3I72A 4XQQA 3HOZB 3TS2A 5COYA 4L8JA 3CRLC 4FXKC 3JAME 2K01A 2CW0C 4IOCA 2K5VA 1GOZA 2NVTH 4RG1A 5CV7A 2VQFQ 3HOZG 2EY1A 5GQOA 4YY3L 2A68C 2WB1E 1J5EQ 1D5XC 1VQAA 1CZGA 3F1ZA 3I2ZA 1KDAA 2ZJPA 1IBMQ 1PH3A 1XPUA 1Y8NB 5FLXE 3PIO3 2K7VA 2NVQB 4ME5A 4C3JB 2K4KA 1D5MC 1RDPD 1EY4A 1R9TH 4A3IB 1WTXA 4DU9A 2ZXPA 2Y0SG 4G7OC 2B2UA 5M3FH 4V0BA 1SNCA 3R8BA 5IOCA 4RMFA 1PTOD 3D31A 2R61A 3PUWA 4XT3B 1TKWB 3GP7A 1OXXK 1I4XA 3OHXC 4HJ8A 2M2LA 2PW5A 3J80L 2B2YA 1ASYA 4GS3A 4DR1L 1VQLA 1U4RA 4ULLA 2PI2E 5CV5A 2BA1A 1EEFD 4A3EB 3UDXA 3OWEB 3VR3A 3VA5A 4NB3A 1Z7TA 4DV3L 5IGBA 1G2SA 1S5BD 5IY0A 1PXUA 2ICIA 1SFOH 3SEBA 5C4JH 3UI2A 3F2BA 1VQHA 1YVCA 2L11A 2N88A 2B2WC 5CBEE 1EIHA 4IPCA 1MSHA 2NTSA 5J39A 3TEHB 1PHJA 3G7LA 1VMCA 4YCUA 1VQGA 3CCUA 4HTHA 1ENAA 4K5VA 2UU9Q 3D4WA 4RAUC 3TP5A 3HGBA 1HNXL 2KHJA 4C3JG 5IE8A 4WJ4A 2IY5B 3VYUA 4NMZA 2JA6B 3PUYA 1HTLD 4HSPA 2B39A 4B3TL 4XTCS 3SE0A 3I8ZA 1KQSA 5ELBA 2K14A 4K5XA 4G57A 1IYUA 1Q1EA 4IFDH 1MKHA 1LTID 3H0GG 1YNJD 3VR5A 1XNQL 4X3UA 4JI5Q 1K8MA 5T1IA 3MAQA 1Y8OB 3F8TA 4M8AA 2A74C 1Y69U 3OPOA 2X6GA 2MFIA 3A7AB 1SJHD 2R7ZH 3DWQA 2DNCA 4ME3A 5JVG3 2OTJA 4BWGB 1G6ZA 1EY8A 5TSSA 3T1YL 2OWOA 3CKIB 4O42A 2KOLA 5IT9c 4HJ9A 1KABA 3I90A 1YIJA 1FD7D 2AQ3B 1MGSA 1QUQB 2AUJD 1J6QA 5IP7G 1L2FA 1O7LA 1PTOH 4DR1Q 3H09A 1HZCA 1STAA 3X3MA 4N9TA 2DN8A 4A3BH 2H5XA 3PUXA 3BZKA 4OO1I 4DR2Q 3ULLA 3IAYA 3MFYA 3H3VI 4X66L 1DOKA 5J22A 4UAIA 1O7ZA 3I4MB 2K32A 4LF5Q 2IHFA 3NP8A 5EJWA 5M9OA 1N36Q 1TXYA 3S1RB 2HDMA 1WOCA 1B53A 5A2QL 2N8NA 2MP1A 5FJ8H 4KHPL 5K36H 3TSSA 2OCEA 3FRPB 5IYDG 4A3GH 3EROA 3HOYG 4IZ8A 3URYA 2F4VL 1YI2A 3MXUA 4DNTB 1T5XD 4BXXH 1EU3A 1NSNS 2XRQD 4B3MQ 3HKSA 1X3EA 3WOFA 2BE5C 1HQMC 3TP7A 1LM0A 1X32A 1D1IA 5CV8A 4KMUC 4CDFC 4J15A 4QCLA 2I5LX 5C44B 1SE8A 2LFNA 2LKVA 4S3SA 3PIP3 2A5HA 1YITA 4JI0L 1J8IA 3GTQH 1WCMG 1YNND 5EPKA 2RDFA 3EA6A 2UXBL 4I7AA 5EGTA 2BCOA 4TKOB 4YHHQ 4KY5A 4C3HH 2ES2A 1XPOA 3R2TA 3NTHA 2E2HH 2JA5H 2C9OA 3C3LA 2CW0D 1N34L 1B70B 4WORA 3HOXG 1VF5C 4BY7H 4YWMA 1TS4A 1VCIA 2Q8TA 4QB4A 4XYOA 4ZLTF 3AMUA 4A3GB 3JAML 4AYBB 4HSVA 4HIMA 3M4PA 4RH6A 1CQFA 3CCJA 4KTAA 1VQOA 1LLRD 1PZJD 4PMWA 3TRZA 4X3SA 3DEPA 1XPRA 5KNCA 2UXBQ 1DONA 3D6CA 1PZID 1YHQA 1KC8C 3RUZA 4GN3B 4C2MH 1DM0B 4A3CG 1F2LA 4GOPA 3W2DA 2KHSA 1AW7A 2RCFA 3TP8A 1BNZA 4JOIC 3LNNA 1GKHA 5J1ZA 1KDBA 1RODA 4JI2L 5GROA 1WTOA 4DN4M 3VR2A 4IURA 1CKOA 4PMBA 4NXMQ 1X3PA 2E2IB 1VQEA 3NWSA 4JI3L 2VNUD 4C3HB 2KUMA 1KD1C 2DJGC 2JK8A 5C5MA 2N55A 5G3LD 3CRKC 2NB0A 3A54A 5E3FA 4DR4Q 4C56C 2B63H 2WKDA 2OF1A 2EYFA 5JPMC 1RIPA 3J81E 1ILPA 3J80E 1GUWA 4EQPA 2I5HA 4UP9A 4APVA 4O2DA 3I91A 5JEAG 1IBLQ 4RHSA 4JI7L 3GTPH 3RLFA 1EQTA 1PH1A 2F0SA 1BUVT 2ZXRA 1B9MA 4DR5L 3ND8A 1Y1WG 3J7A5 4A93B 4X66Q 3J7AV 1JWUD 3MZ5A 5A35A 1K28A 5EAYA 4IFDI 4K0KQ 3U9SA 1FGBD 4UP8A 3G71A 3U4VA 4F87A 4OWTB 1TS5A 2JP1A 1GO3E 1CUKA 4LF7L 1V8QA 4JI4L 1WTRA 2QGQA 3S1NB 2F4VQ 4LW1A 2Z6KC 3J81i 3SK4A 5LL6X 3ICEA 1I50B 3NQTA 1EYDA 3H94A 1U0LA 2HCCA 4KK7A 1YEZA 4B3SL 2H1EA 3IRBA 5JOBA 4LNQA 3GV6A 5IP9G 1C7YA 1GVPA 2RVLA 2AHOB 5K5PA 3RLOA 3CC4A 3HOZH 1X54A 2VQEQ 4R8IA 3OTOL 2I5MX 4RCOA 5IGDA 1GHKA 5KYLA 3S2DB 2HIVA 5FLXL 1HNWQ 5H1SE 3HZXA 1PFMA 1QG7A 2MPMA 2ZJQA 1MBYA 1I4QA 3RMHA 3A5UA 4OIKA 2NZOA 2GVAA 3PF4A 5ISRA 3AEVA 4BBSB 1UE1A 2XWBB 1NY4A 3KBGA 2RCNA 4R9WA 3CQZB 3OYYA 4PNYA 1SFOB 5CV9A 4MTNA 1CHQD 1EIFA 1YBYA 1I4RA 4KHVA 4GLXA 4J6HA 4DAYB 3K59A 3UDFA 3KDFB 2UXCQ 3I4NH 1LABA 3SK5A 3IKJA 5IYDH 1NMFA 3HOYH 2XVSA 3ITPA 1XMOL 3C2PA 5JVH3 1ILQA 3H3VH 2WINB 1W6JA 1NR2A 3D4DA 3C1EA 5LHY1 3RN5A 1EU4A 3CU7A 5M5XH 1NBWA 1H9RA 3HOXB 3H3VC 1HUMA 4N8FA 5G3LF 1GUTA 4A3EG 4IFDJ 2EJFC 3KBXA 2RA4A 5DLQE 2ZM6L 1L0WA 4C3HG 2WIIB 3G6EA 4QY7A 1VQFA 1OO9B 3K7AB 2JA5G 1Q8KA 4GOPC 3OMGA 4DNRB 2JSOA 3E6ZX 1CM9A 1IL8A 3NWTA 5EKKA 1TWFH 1PVOA 3DM3A 4QUCA 3GTJH 4HJAA 4GNXB 3AFPA 1S5ED 3BS1A 1PFSA 3CC7A 1PYWD 3GTQB 1A3TA 5KRUA 1IBLL 4JI7Q 1N33Q 4H02A 3KF6B 4JV5Q 3A8JE 3H0GH 1WTWA 3I73A 4DV7L 2UUCQ 3GDEA 4Y52H 4GKJQ 4CKCA 2D2CC 2OQ0A 4X3KA 1CSPA 4MN3A 1AE3A 1J5EL 1IKMA 2F4IA 5M5YH 4IUTA 2K52A 5FKAC 3HKZG 1HXYD 5GAEC 1TQOA 4P73A 2SNMA 1STGA 3ULPA 3S1RH 1X3FA 2AWNA 2B63G 1E0BA 4F88A 1EQVA 3DM1A 1D2BA 3G48A 3GTLB 1X55A 2BDNA 3RN2A 1SN8A 1C48A 1TS2A 1XMQQ 1AEXA 3D8GA 2KVMA 1TVXA 1O7YA 3RZOB 4HIOA 3PUZA 1IBML 4BA2I 2JA6H 1KNEA 5AJ3Q 4Y7NH 1TY2A 1PTOB 5C3EB 2F0WA 1HZ9A 4ZQ3A 5NUCA 4CKEA 4ILWA 3AU7A 3BYYB 5KNBA 3TMEA 3Q8DA 1K83B 3WOEA 1EY7A 3NXWA 1NR4A 3SGIA 1IXRA 3J81c 4RKLA 4LMQD 1NMGA 2GN5A 2A6ED 5M3MB 5C4ZA 1SYFA 1LO5D 4Z9CB 1JE4A 4LFCL 1ICFB 4A3MG 3GTPB 3OMCA 1LTTD 2ALYB 3HP3A 5C3XA 2NZHA 5LL6S 2IPKD 4A3FB 3FKIB 2EPBA 3VR4A 1CZWA 1SNOA 2RSOA 2YU9B 1EYCA 3UE1A 4QQBX 1WCMB 5C0XI 3KDFA 2YV5A 2FMCA 1Q90A 3W1BA 4BY1H 2R3ZA 4A3BB 2RHQB 1LTBD 1SYGA 1B3QA 3FHWA 3RZDB 4Y7NB 1TY0A 5JJLA 1PZKD 1HRJA 1I50H 4ODGA 4Q0FA 1C9OA 1VQNA 2PQAB 3JC66 4X64L 1AFPA 1Q82C 1SLJA 3CP0A 4R4QA 3I4OA 3LWEA 1S72A 3D6WA 3M7GA 4HCEA 4PG3A 2HT1A 1S5FD 3S1MB 2XWJB 3NBHB 3PGZA 1SMYD 4R4TA 2BH2A 1HNZQ 4JBJA 4FF2A 3OTOQ 4B3RQ 5CC4A 4R4OA 4YCVA 1YHAA 1FNWA 4DV0L 4LF8Q 1RKNA 1EWCA 2A6HD 3V2TA 4HCSA 4EVOA 1TR5A 2EYLA 4DV7Q 2UUCL 3EFXD 1N8RC 3TZUA 2SDFA 1E1OA 1J9OA 3ND9A 1N34Q 1YZ6A 1STEA 1HCZA 5ELNA 5EQ0A 3M3YB 1H9JA 4AIMA 2KCNA 4LF9L 3CF5A 4HAEA 3O13A 1WTQA 2N49A 2DJFC 2HIXA 5LMNQ 1C0AA 3K5NA 4GN5A 4A75A 1VQ9A 3BZDB 4H7BA 2XNAC 4DV4Q 1PH5A 1TIID 4XXEA 5JEAH 4KKTA 1EFID 4KD4A 1K73C 2R7ZG 2F0QA 3L7ZC 5IT9L 5I6WA 2FHTA 1YNJC 1PRTF 2B8FA 2QF7A 3M4QA 2CQOA 3KUPA 1QVGA 4AH6A 1UAPA 3R93A 1B50A 4DNIA 3U50C 4HMJA 3T1YQ 2F0KA 3A55A 5M3MH 3GTOH 3KF6A 2NVYB 3GTMB 3S16B 3K5OA 2FXQA 4JI8Q 1S5CD 3NEMA 3VYSA 1EZ8A 2C35B 4I7ZC 1FNUA 4HR7B 1Y14B 4LUVA 3K80C 1KTKA 2CQAA 2K6AA 4OX9Q 1LT3D 4DR7Q 1HJPA 4CDEC 1HR0Q 4C2MB 2F0PA 1SE3A 3ZJYC 1BO0A 4FNFA 2EY6A 1B8AA 5IP7H 5JAVA 2PPBC 1V1PA 1HTPA 3ERQA 3PO2G 2ZT9C 4NP5A 5CR3A 3CPWA 1Y1VH 4IUUA 1NE3A 1L1OA 3PF5A 4BBRH 2C5CA 3PO3G 5I9PA 4JI2Q 1NUCA 4FP5D 4OELB 5EKLA 1I94L 5FLXc 1PYBA 5IWAL 1OXTA 3WWVA 2HHHL 1LTRD 2EIFA 3A8IE 1H9KA 2EJMA 2R7ZB 4R8NA 3MA2B 4OX9L 2CCZA 2E2JB 2IX0A 3A5ZB 3BU2A 2OEOA 1D7QA 3MFGA 5BR8L 1HNZL 3A7LA 2MO1A 2F0MA 1I3QB 2PMZB 4IUNA 4R4CA 2KJXA 3JAMi 1HFGA 5D3DA 1C8CA 5LMNW 2G9HD 1W6KA 4JC0A 5DNFA 1ICWA 4XQNA 4B9XA 3HOVB 4BY1B 3STBC 1WI5A 3GV3A 3I3CA 1A63A 2WV6D 1ESRA 1HZBA 1SAPA 3I56A 1FJGQ 3A74A 5IYBH 3FPPA 5IT9E 1EY9A 4IPDA 4GN4B 3DWAA 4DR7L 1V1QA 1LV9A 1C4QA 1SDFA 1LT4D 2AUKA 4K6DA 5DAUA 4GKKL 3CCSA 2EY5A 2KEDA 2BH8A 1SMXA 4N8X1 3E9HA 4CJ0B 2VS1A 4LUOA 4KI0A 5T1GA 1G8ZD 3Q23A 4DV6L 3NELA 1SBBB 1Z47A 1Z6HA 2WAQE 3I7FA 3DUZA 3S9WA 1AP0A 1WTPA 2QEJC 3G6JB 3GTKH 1HHVA 5M5YB 5D65A 1ET6A 2G9DA 4X64Q 2JYOA 4QMGA 4N9PA 5E4WC
chains in the Genus database with same CATH topology
1EWIA 2QGQA 4MNOA 4DV1Q 2F4VQ 3CMEA 4LW1A 2Z6KC 1KRSA 5ELOA 3UDIA 3J81i 3HOUH 4PZ7A 5GAHC 5C3EG 1QVFA 2ASBA 3ICEA 5C4XG 3PO3H 1U0LA 3CAMA 3HOVH 2MQHA 1D8LA 1YEZA 2E5LL 1WCMH 2VUMG 4X65L 4B3SL 1G6PA 3HOWG 2KCTA 1EQQA 5JJKA 2RHSB 3IRBA 3D0FA 4LNQA 2PQAA 5IP9G 1JMCA 1C7YA 1GVPA 4P74A 3ERSX 2AHOB 4DR3L 3RLOA 3CC4A 3HOZH 1X54A 2VQEQ 3CCEA 1JJ2A 3PV0A 3OTOL 3STBD 1YJ9A 1N32Q 3CXCA 1IZ6A 2EQSA 4AYBG 5LMNL 1VQ8A 2I5MX 2ID0A 2E5LQ 2NN6G 4A93H 2UXDQ 3CCQA 2HIVA 5IYCG 3F2DA 1HNWQ 4YCWA 5H1SE 3MEFA 1VQDA 1CKNB 2YTVA 4UP7A 3B6YA 2CWAA 1EQRA 4C3JH 1VQJA 2E2JH 2ZJQA 4JYAL 2YTYA 3A5UA 2JA8H 3EBEA 2D0OA 4JI1L 2NZOA 3RLNA 2GVAA 3A0JA 3PF4A 3AEVA 3GTGH 4HJ7A 1UE1A 2A1AA 4JCVE 1NY4A 1G51A 2RCNA 3J80i 4X65Q 3OYYA 4PZ8A 4B3SQ 3KYHC 3I4MG 1WJJA 2R7DA 4DV2Q 4MTNA 1TWCH 4R1JA 1EIFA 1YBYA 4L5QA 4GLXA 2HQLA 1XJVA 3L0OA 4EX5A 2UUBQ 2JA9A 1CKMA 4DAYB 3UDFA 4L5TA 1E24A 3KDFB 4LF8L 2UXCQ 3I4NH 3S2DH 1LTLA 2E2IH 2KCMA 4A3CH 2A8VA 1MJCA 4DV4L 4B3RL 3ULJA 5IYDH 1YNXA 1QZHA 4A3GG 4A3LG 1NMFA 1XNRQ 3HOYH 1K9MC 2AMCB 4O0AA 1KIXA 3PSIA 5IP9H 5J3BA 1P8LA 1XMOL 1CSQA 3W5OA 4DV5L 1X6OA 5HY6A 4C3IH 1HZAA 4QGUA 3J81j 1Y1WH 3FKIH 3RNUA 1EIYB 1BBWA 1Q46A 1Q81C 3MXNB 4FDBA 3H3VH 3JAMc 3AFQA 2Q2TA 1A0IA 2CWPA 2PI2A 2OTLA 4DAMA 4AQYL 3S14H 3HKZE 3EIVA 3RN5A 1TWGH 5M5XH 1H95A 1NBWA 2R6GA 1VQMA 1E1TA 2JE6I 1VQPA 4A3EG 1OXUA 1PH9A 4IFDJ 3AQQA 2R7FA 3CC2A 4TQUS 4P71A 2JA7G 4A3BG 1KHIA 4A3DG 2XGTA 1FJGL 3HOVG 4IO9A 2VL6A 5DLQE 4HIDA 1UE6A 2ZM6L 4JI6Q 4BBSH 5JJIA 4GNXA 1L0WA 4JI3Q 3G6EA 4QY7A 2ZM6Q 1VQFA 1M1KC 1WFQA 2VZAA 4P72A 4YY3Q 3S1QH 2JA5G 4LFAL 1Q8KA 3KFUA 1PH7A 4LWCA 4GOPC 4A3FG 4JI1Q 1KRTA 4EQ5A 2XTIA 3HOXH 3PO2H 4LF4Q 1AE2A 1KL9A 1Y1VG 4YWKA 1XMQL 2R92H 1TWFH 3S1MH 1PVOA 3DM3A 3E9IA 4A76A 3K0XA 1Z9FA 2WP8J 3GTJH 4JI5L 4AQYQ 1PH4A 1RL2A 4HJAA 4NXNQ 1T9HA 4GNXB 2NVXH 4DR2L 4A3KH 3AFPA 2IX1A 4QL5A 4OONA 1N32L 1W3SA 1FGUA 1PFSA 2D62A 1Q1BA 2DGYA 2F3IA 2MNAA 3KJOA 3CC7A 1PH6A 1IBLL 4JI7Q 3M3YH 1BVSA 1N33Q 3TS2A 2JJQA 4BA1I 4A3MH 4JI8L 4H02A 3KF6B 4DUYQ 4JV5Q 1K3RA 4TVAB 2R93H 2JEBI 4BXXG 4DV3Q 3H0GH 4IOCA 2K5VA 2NVTH 4RG1A 4DV7L 2UUCQ 1XNRL 1I94Q 3GDEA 4Y52H 2VQFQ 4GKJQ 1OXSC 3HOZG 5GQOA 2OQ0A 4YY3L 2WB1E 2QEXA 2WAQG 2Z0SA 1J5EQ 1CSPA 1VQAA 4DV1L 3U58A 3F1ZA 2NVQH 3CQZH 2LSSA 3CPFA 1AE3A 1S40A 1J5EL 4KLKA 1MJEA 3I2ZA 2ZJPA 5M5YH 1IBMQ 1GM5A 1PH3A 2K52A 1XPUA 1SRUA 3HKZG 2K50A 3J7ZC 5GAEC 4P73A 4PZ6A 1E7ZA 4R4IA 3ULPA 1VS0A 2K4KA 2F52A 4DUYL 4DR5Q 3S1RH 1R9TH 3S2HH 1X3FA 1VQBA 2AWNA 2YYZA 2JEAI 1VQKA 2B63G 5GADC 2Y0SG 5M3FH 1A8VA 3G48A 1X55A 4JI0Q 5IWAQ 4RMFA 5C44G 1SN8A 3RN2A 2NN6I 3TS0A 2HHHQ 1K83H 1PA6A 1V9PA 2PMZE 3D31A 1XMQQ 4DK3C 3S24A 3EN2A 3PUWA 5E7NA 3RR5A 4A3IG 4A3JH 1OXXK 3F2CA 4HIOA 1VQ6A 1V43A 1W2BA 3PUZA 1IBML 4HJ8A 4BA2I 3RZDH 2JA6H 4LFBL 4DK6C 4BY1G 4B3ML 1ASYA 5AJ3Q 4GS3A 4Y7NH 4DR1L 1VQLA 4BBSG 3GD7A 2RF4A 1CKNA 2PI2E 4IJLA 1HNXQ 2BA1A 5AJ3L 3VDYA 3RZOH 2NVYH 3UDXA 3GTMH 3S16H 1G291 4JBMA 4DV2L 1JB7A 3UDGA 2AWOA 1HZ9A 3FKIG 4NB3A 4DV3L 5IY0A 4IFDG 4DV0Q 1WYDA 4HIKA 3Q8DA 1SFOH 3U4ZA 3KOJA 1M90C 5C4JH 2VY3A 3F2BA 4X62L 1VQHA 1YVCA 1IXRA 3SGIA 3J81c 4IPGA 4ALPA 4LF7Q 3H15A 4IPCA 1NMGA 2CKZB 2GN5A 1XTDA 4A4IA 1Q7YC 1L1OC 5JEAJ 1GD7A 3TEHB 3T1HL 3NENA 2KENA 4DKAC 1XMOQ 4LFCL 1PHJA 3TQYA 3T1HQ 4DV5Q 4A3MG 4YCUA 1VQGA 4LF4L 3CCUA 2B29A 2ALYB 1XNQQ 3S17H 2NZHA 1X3GA 4LF6L 3CCRA 4IJHA 2UU9Q 1PYSB 2ZTDA 1EYGA 4JBKA 5IYBG 3E0EA 4UY8C 2E8GA 5FJ8G 1HNXL 2KHJA 1AH9A 4JI6L 1QZGA 3UE1A 5IE8A 4QQBX 3AYHB 4WJ4A 2IHEA 5C0XI 2JA8G 2IY5B 3KDFA 2YV5A 3W1BA 4BY1H 2RHQB 3FHWA 3PUYA 1K0RA 5JJLA 1I6HH 5FLMG 1I50H 1IBKQ 4B3TL 3UE0A 4XTCS 1ASZA 4L5RC 4JI4Q 1C9OA 1KQSA 1VQNA 3K7UC 2PQAB 3JC66 4X64L 1N36L 2K14A 1TWAH 1Q82C 3S1NH 1SLJA 3M4OH 2V1CC 1EUJA 3W1GA 3CP0A 2JQOA 3I4OA 4R4QA 1Q1EA 1MKHA 1XNQL 3H0GG 1S72A 4JYAQ 4BY7G 3HFZB 4JI5Q 1O7IA 4PG3A 1X65A 4LFCQ 2QA4A 5M3FG 2HT1A 4BBRG 3F8TA 3NBHB 3PGZA 5C44H 4R4TA 1PV4A 2BH2A 4A3LH 1HNZQ 4JBJA 2MFIA 5LMUL 4A3IH 2UUAL 3OTOQ 2R7ZH 2VQEL 5K36G 5C0XG 4B3RQ 4ME3A 2OTJA 4JG2A 3I55A 2A19A 3T1YL 2OWOA 4DR3Q 4R4OA 4YCVA 5IT9c 1YHAA 1B7YB 4DV0L 4HJ9A 4LF8Q 1YIJA 1BKBA 1EFWA 2WB1G 1QUQB 4DR4L 4QIWE 3CCVA 1IYJB 1S3OA 1J6QA 5IP7G 1I5FA 1L2FA 1EOVA 1TWHH 2GVBA 4DV7Q 2UUCL 1MIUA 2BA0A 3LGJA 3G4SA 1N8RC 3CD6A 4KHPQ 4DR1Q 3PCOB 4A3EH 1E1OA 3M9BA 1HZCA 3DLLA 4AYBE 1N34Q 1YZ6A 2JA7H 4A3BH 2H5XA 3PUXA 2Y0SE 5ELNA 1UWVA 1X56A 3BZKA 4UPAA 4A3JG 4LF6Q 4OO1G 4OO1I 4DR2Q 2UUAQ 3ULLA 4AIMA 4K0KL 1N9WA 3H3VI 4X66L 1YHBA 4LF9L 1BBUA 3KF8B 4DV6Q 3CF5A 3PIPA 1N33L 4LF5Q 1HH2P 2N49A 1K8GA 4A3FH 4POGA 2AKWB 1JE5A 2HIXA 2IHFA 2CFMA 2EXDA 5LMNQ 1C0AA 4GOPB 4WJ3M 4GN5A 4A75A 1VQ9A 1HR0W 3M85A 1N36Q 1TXYA 4DV4Q 1PH5A 1P16A 2R92G 1WOCA 4OXPA 3KJPA 2N8NA 5FJ8H 1K73C 2R7ZG 4KHPL 2N3SA 4B3TQ 4MZ9A 3I4NG 3L7ZC 2D0PA 2OCEA 1U5KA 4GLVB 3K7AH 5IYDG 1X9NA 3PIOA 4A3GH 3HOYG 3BZCA 3K81C 3M4QA 1FVIA 2CQOA 2F4VL 1YI2A 1QVGA 3L2PA 4AH6A 4BXXH 4B3MQ 4DNIA 3HKSA 1X3EA 3U50C 1JJGA 5C0XJ 3T1YQ 2UU9L 1LUZA 5M3MH 3GTOH 1LM0A 3KF6A 4NPSA 4GLAC 2PNHA 4LF5L 2ZTCA 4J15A 4JV5L 2I5LX 2FXQA 1SE8A 4JI8Q 3NEMA 2KHIA 1HNWL 1YITA 4JI0L 3GTQH 1WCMG 2VUMH 3GO5A 2C35B 4QJFA 4XIGS 3S15H 1Y14B 1UEBA 4LUVA 1NTGA 1QVCA 3K80C 4X62Q 1VQIA 4OX9Q 2UXBL 4A3DH 2ZTEA 4GKKQ 2Q2IA 2Q2HA 3CW2C 4DR7Q 4YHHQ 1HJPA 5GAGC 1HR0Q 3TREA 4C3HH 2ES2A 5FLMH 2R93G 1XPOA 2KBNA 1QUQA 3OW2A 3ZJYC 2E2HH 2JA5H 1UE7A 1N34L 5IYCH 1B70B 1B8AA 5IP7H 2B3GA 2N78A 1JJCB 2OQKA 3HOXG 1SROA 2YU9H 4OWWB 1IL2A 3CPWA 3M7NA 4YWMA 3PO2G 1Y1VH 2UUBL 4BY7H 1NE3A 1L1OA 3PF5A 4BBRH 1VCIA 4NXML 3PO3G 4JI2Q 2YTXA 4DUZL 4HJ5A 4DR6Q 2JA6G 4A3KG 1I94L 1PH8A 4HIMA 2ATWA 3M4PA 3CCLA 3CCJA 1VQOA 5FLXc 1PYBA 5IWAL 1OXTA 3WWVA 1K8AC 4PMWA 1HR0L 2HHHL 1E22A 2EIFA 3TRZA 1XPRA 3PUVA 4OX9L 2DUDA 2CCZA 2UXBQ 2IX0A 3A5ZB 3BU2A 1YHQA 1KC8C 1D7QA 5BR8L 1HNZL 3ER0A 4GN3B 4X6AH 4C2MH 2LXJA 4A3CG 2MO1A 4IPHA 1OXVA 4GOPA 4R4CA 3JAMi 4JOIC 1GKHA 5LMNW 3CCMA 1SR3A 3KLWA 4JC0A 5GROA 1YJWA 4JI2L 4L5SA 4DPGA 1VQ4A 4DR6L 4DUZQ 1NJIC 4JOIA 2Z6KA 5C3EH 3HOUG 2UXDL 1CKOA 4NXMQ 2L15A 3STBC 1VQEA 4POFA 4JI3L 5C4XH 1WI5A 1UE5A 2IT1A 3J80c 2VNUD 1KD1C 1VQCA 1IBKL 2JK8A 1A63A 3HOWH 1E3PA 1DGSA 1HZBA 1LYLA 4JBWA 3I56A 1FJGQ 2VQFL 4GKJL 4LFBQ 3A74A 4DR4Q 1VQ7A 5HGQA 1KXLA 4P75A 5M3MG 5IYBH 2B63H 2K5HA 4KHZA 4GN4B 1Q12A 2K5NA 4IPDA 1RIPA 4DR7L 2ZJRA 3CMAA 1V1QA 4LUZA 4YHHL 1I3QH 2WFWA 4A93G 3GTLH 1VQ5A 2Q2UA 3CCSA 4GKKL 1Q86C 2I5HA 2BH8A 4UP9A 4O2DA 4APVA 5JEAG 4GNXC 1IBLQ 5BR8Q 4JI7L 3GTPH 1SMXA 3RLFA 5LMUQ 4NXNL 1FL0A 3E9HA 1PH1A 2VS1A 4KI0A 4LUOA 4OWXB 1OTCA 4DV6L 3FP9A 1JT8A 3NELA 1PH2A 4LF9Q 1Z47A 4DR5L 2LXKA 2I0QA 2K75A 2WAQE 2MO0A 1YJNA 1Y1WG 4YWLA 3J7A5 4X66Q 3I7FA 4IFDI 5EAYA 1L1OB 4K0KQ 3G71A 4UP8A 5M5WH 4IOAA 3U4VA 4LFAQ 4OWTB 1KAWA 3GTKH 1GO3E 3I4MH 1CUKA 4LF7L 4X64Q 3BJUA 2VW9A 2UXCL 4JI4L 3K8AA 1A62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWI A;  2QGQ A;  4MNO A;  4DV1 Q;  2F4V Q;  3CME A;  4LW1 A;  2Z6K C;  1KRS A;  5ELO A;  3UDI A;  3J81 i;  3HOU H;  4PZ7 A;  5GAH C;  5C3E G;  1QVF A;  2ASB A;  3ICE A;  5C4X G;  3PO3 H;  1U0L A;  3CAM A;  3HOV H;  2MQH A;  1D8L A;  1YEZ A;  2E5L L;  1WCM H;  2VUM G;  4X65 L;  4B3S L;  1G6P A;  3HOW G;  2KCT A;  1EQQ A;  5JJK A;  2RHS B;  3IRB A;  3D0F A;  4LNQ A;  2PQA A;  5IP9 G;  1JMC A;  1C7Y A;  1GVP A;  4P74 A;  3ERS X;  2AHO B;  4DR3 L;  3RLO A;  3CC4 A;  3HOZ H;  1X54 A;  2VQE Q;  3CCE A;  1JJ2 A;  3PV0 A;  3OTO L;  3STB D;  1YJ9 A;  1N32 Q;  3CXC A;  1IZ6 A;  2EQS A;  4AYB G;  5LMN L;  1VQ8 A;  2I5M X;  2ID0 A;  2E5L Q;  2NN6 G;  4A93 H;  2UXD Q;  3CCQ A;  2HIV A;  5IYC G;  3F2D A;  1HNW Q;  4YCW A;  5H1S E;  3MEF A;  1VQD A;  1CKN B;  2YTV A;  4UP7 A;  3B6Y A;  2CWA A;  1EQR A;  4C3J H;  1VQJ A;  2E2J H;  2ZJQ A;  4JYA L;  2YTY A;  3A5U A;  2JA8 H;  3EBE A;  2D0O A;  4JI1 L;  2NZO A;  3RLN A;  2GVA A;  3A0J A;  3PF4 A;  3AEV A;  3GTG H;  4HJ7 A;  1UE1 A;  2A1A A;  4JCV E;  1NY4 A;  1G51 A;  2RCN A;  3J80 i;  4X65 Q;  3OYY A;  4PZ8 A;  4B3S Q;  3KYH C;  3I4M G;  1WJJ A;  2R7D A;  4DV2 Q;  4MTN A;  1TWC H;  4R1J A;  1EIF A;  1YBY A;  4L5Q A;  4GLX A;  2HQL A;  1XJV A;  3L0O A;  4EX5 A;  2UUB Q;  2JA9 A;  1CKM A;  4DAY B;  3UDF A;  4L5T A;  1E24 A;  3KDF B;  4LF8 L;  2UXC Q;  3I4N H;  3S2D H;  1LTL A;  2E2I H;  2KCM A;  4A3C H;  2A8V A;  1MJC A;  4DV4 L;  4B3R L;  3ULJ A;  5IYD H;  1YNX A;  1QZH A;  4A3G G;  4A3L G;  1NMF A;  1XNR Q;  3HOY H;  1K9M C;  2AMC B;  4O0A A;  1KIX A;  3PSI A;  5IP9 H;  5J3B A;  1P8L A;  1XMO L;  1CSQ A;  3W5O A;  4DV5 L;  1X6O A;  5HY6 A;  4C3I H;  1HZA A;  4QGU A;  3J81 j;  1Y1W H;  3FKI H;  3RNU A;  1EIY B;  1BBW A;  1Q46 A;  1Q81 C;  3MXN B;  4FDB A;  3H3V H;  3JAM c;  3AFQ A;  2Q2T A;  1A0I A;  2CWP A;  2PI2 A;  2OTL A;  4DAM A;  4AQY L;  3S14 H;  3HKZ E;  3EIV A;  3RN5 A;  1TWG H;  5M5X H;  1H95 A;  1NBW A;  2R6G A;  1VQM A;  1E1T A;  2JE6 I;  1VQP A;  4A3E G;  1OXU A;  1PH9 A;  4IFD J;  3AQQ A;  2R7F A;  3CC2 A;  4TQU S;  4P71 A;  2JA7 G;  4A3B G;  1KHI A;  4A3D G;  2XGT A;  1FJG L;  3HOV G;  4IO9 A;  2VL6 A;  5DLQ E;  4HID A;  1UE6 A;  2ZM6 L;  4JI6 Q;  4BBS H;  5JJI A;  4GNX A;  1L0W A;  4JI3 Q;  3G6E A;  4QY7 A;  2ZM6 Q;  1VQF A;  1M1K C;  1WFQ A;  2VZA A;  4P72 A;  4YY3 Q;  3S1Q H;  2JA5 G;  4LFA L;  1Q8K A;  3KFU A;  1PH7 A;  4LWC A;  4GOP C;  4A3F G;  4JI1 Q;  1KRT A;  4EQ5 A;  2XTI A;  3HOX H;  3PO2 H;  4LF4 Q;  1AE2 A;  1KL9 A;  1Y1V G;  4YWK A;  1XMQ L;  2R92 H;  1TWF H;  3S1M H;  1PVO A;  3DM3 A;  3E9I A;  4A76 A;  3K0X A;  1Z9F A;  2WP8 J;  3GTJ H;  4JI5 L;  4AQY Q;  1PH4 A;  1RL2 A;  4HJA A;  4NXN Q;  1T9H A;  4GNX B;  2NVX H;  4DR2 L;  4A3K H;  3AFP A;  2IX1 A;  4QL5 A;  4OON A;  1N32 L;  1W3S A;  1FGU A;  1PFS A;  2D62 A;  1Q1B A;  2DGY A;  2F3I A;  2MNA A;  3KJO A;  3CC7 A;  1PH6 A;  1IBL L;  4JI7 Q;  3M3Y H;  1BVS A;  1N33 Q;  3TS2 A;  2JJQ A;  4BA1 I;  4A3M H;  4JI8 L;  4H02 A;  3KF6 B;  4DUY Q;  4JV5 Q;  1K3R A;  4TVA B;  2R93 H;  2JEB I;  4BXX G;  4DV3 Q;  3H0G H;  4IOC A;  2K5V A;  2NVT H;  4RG1 A;  4DV7 L;  2UUC Q;  1XNR L;  1I94 Q;  3GDE A;  4Y52 H;  2VQF Q;  4GKJ Q;  1OXS C;  3HOZ G;  5GQO A;  2OQ0 A;  4YY3 L;  2WB1 E;  2QEX A;  2WAQ G;  2Z0S A;  1J5E Q;  1CSP A;  1VQA A;  4DV1 L;  3U58 A;  3F1Z A;  2NVQ H;  3CQZ H;  2LSS A;  3CPF A;  1AE3 A;  1S40 A;  1J5E L;  4KLK A;  1MJE A;  3I2Z A;  2ZJP A;  5M5Y H;  1IBM Q;  1GM5 A;  1PH3 A;  2K52 A;  1XPU A;  1SRU A;  3HKZ G;  2K50 A;  3J7Z C;  5GAE C;  4P73 A;  4PZ6 A;  1E7Z A;  4R4I A;  3ULP A;  1VS0 A;  2K4K A;  2F52 A;  4DUY L;  4DR5 Q;  3S1R H;  1R9T H;  3S2H H;  1X3F A;  1VQB A;  2AWN A;  2YYZ A;  2JEA I;  1VQK A;  2B63 G;  5GAD C;  2Y0S G;  5M3F H;  1A8V A;  3G48 A;  1X55 A;  4JI0 Q;  5IWA Q;  4RMF A;  5C44 G;  1SN8 A;  3RN2 A;  2NN6 I;  3TS0 A;  2HHH Q;  1K83 H;  1PA6 A;  1V9P A;  2PMZ E;  3D31 A;  1XMQ Q;  4DK3 C;  3S24 A;  3EN2 A;  3PUW A;  5E7N A;  3RR5 A;  4A3I G;  4A3J H;  1OXX K;  3F2C A;  4HIO A;  1VQ6 A;  1V43 A;  1W2B A;  3PUZ A;  1IBM L;  4HJ8 A;  4BA2 I;  3RZD H;  2JA6 H;  4LFB L;  4DK6 C;  4BY1 G;  4B3M L;  1ASY A;  5AJ3 Q;  4GS3 A;  4Y7N H;  4DR1 L;  1VQL A;  4BBS G;  3GD7 A;  2RF4 A;  1CKN A;  2PI2 E;  4IJL A;  1HNX Q;  2BA1 A;  5AJ3 L;  3VDY A;  3RZO H;  2NVY H;  3UDX A;  3GTM H;  3S16 H;  1G29 1;  4JBM A;  4DV2 L;  1JB7 A;  3UDG A;  2AWO A;  1HZ9 A;  3FKI G;  4NB3 A;  4DV3 L;  5IY0 A;  4IFD G;  4DV0 Q;  1WYD A;  4HIK A;  3Q8D A;  1SFO H;  3U4Z A;  3KOJ A;  1M90 C;  5C4J H;  2VY3 A;  3F2B A;  4X62 L;  1VQH A;  1YVC A;  1IXR A;  3SGI A;  3J81 c;  4IPG A;  4ALP A;  4LF7 Q;  3H15 A;  4IPC A;  1NMG A;  2CKZ B;  2GN5 A;  1XTD A;  4A4I A;  1Q7Y C;  1L1O C;  5JEA J;  1GD7 A;  3TEH B;  3T1H L;  3NEN A;  2KEN A;  4DKA C;  1XMO Q;  4LFC L;  1PHJ A;  3TQY A;  3T1H Q;  4DV5 Q;  4A3M G;  4YCU A;  1VQG A;  4LF4 L;  3CCU A;  2B29 A;  2ALY B;  1XNQ Q;  3S17 H;  2NZH A;  1X3G A;  4LF6 L;  3CCR A;  4IJH A;  2UU9 Q;  1PYS B;  2ZTD A;  1EYG A;  4JBK A;  5IYB G;  3E0E A;  4UY8 C;  2E8G A;  5FJ8 G;  1HNX L;  2KHJ A;  1AH9 A;  4JI6 L;  1QZG A;  3UE1 A;  5IE8 A;  4QQB X;  3AYH B;  4WJ4 A;  2IHE A;  5C0X I;  2JA8 G;  2IY5 B;  3KDF A;  2YV5 A;  3W1B A;  4BY1 H;  2RHQ B;  3FHW A;  3PUY A;  1K0R A;  5JJL A;  1I6H H;  5FLM G;  1I50 H;  1IBK Q;  4B3T L;  3UE0 A;  4XTC S;  1ASZ A;  4L5R C;  4JI4 Q;  1C9O A;  1KQS A;  1VQN A;  3K7U C;  2PQA B;  3JC6 6;  4X64 L;  1N36 L;  2K14 A;  1TWA H;  1Q82 C;  3S1N H;  1SLJ A;  3M4O H;  2V1C C;  1EUJ A;  3W1G A;  3CP0 A;  2JQO A;  3I4O A;  4R4Q A;  1Q1E A;  1MKH A;  1XNQ L;  3H0G G;  1S72 A;  4JYA Q;  4BY7 G;  3HFZ B;  4JI5 Q;  1O7I A;  4PG3 A;  1X65 A;  4LFC Q;  2QA4 A;  5M3F G;  2HT1 A;  4BBR G;  3F8T A;  3NBH B;  3PGZ A;  5C44 H;  4R4T A;  1PV4 A;  2BH2 A;  4A3L H;  1HNZ Q;  4JBJ A;  2MFI A;  5LMU L;  4A3I H;  2UUA L;  3OTO Q;  2R7Z H;  2VQE L;  5K36 G;  5C0X G;  4B3R Q;  4ME3 A;  2OTJ A;  4JG2 A;  3I55 A;  2A19 A;  3T1Y L;  2OWO A;  4DR3 Q;  4R4O A;  4YCV A;  5IT9 c;  1YHA A;  1B7Y B;  4DV0 L;  4HJ9 A;  4LF8 Q;  1YIJ A;  1BKB A;  1EFW A;  2WB1 G;  1QUQ B;  4DR4 L;  4QIW E;  3CCV A;  1IYJ B;  1S3O A;  1J6Q A;  5IP7 G;  1I5F A;  1L2F A;  1EOV A;  1TWH H;  2GVB A;  4DV7 Q;  2UUC L;  1MIU A;  2BA0 A;  3LGJ A;  3G4S A;  1N8R C;  3CD6 A;  4KHP Q;  4DR1 Q;  3PCO B;  4A3E H;  1E1O A;  3M9B A;  1HZC A;  3DLL A;  4AYB E;  1N34 Q;  1YZ6 A;  2JA7 H;  4A3B H;  2H5X A;  3PUX A;  2Y0S E;  5ELN A;  1UWV A;  1X56 A;  3BZK A;  4UPA A;  4A3J G;  4LF6 Q;  4OO1 G;  4OO1 I;  4DR2 Q;  2UUA Q;  3ULL A;  4AIM A;  4K0K L;  1N9W A;  3H3V I;  4X66 L;  1YHB A;  4LF9 L;  1BBU A;  3KF8 B;  4DV6 Q;  3CF5 A;  3PIP A;  1N33 L;  4LF5 Q;  1HH2 P;  2N49 A;  1K8G A;  4A3F H;  4POG A;  2AKW B;  1JE5 A;  2HIX A;  2IHF A;  2CFM A;  2EXD A;  5LMN Q;  1C0A A;  4GOP B;  4WJ3 M;  4GN5 A;  4A75 A;  1VQ9 A;  1HR0 W;  3M85 A;  1N36 Q;  1TXY A;  4DV4 Q;  1PH5 A;  1P16 A;  2R92 G;  1WOC A;  4OXP A;  3KJP A;  2N8N A;  5FJ8 H;  1K73 C;  2R7Z G;  4KHP L;  2N3S A;  4B3T Q;  4MZ9 A;  3I4N G;  3L7Z C;  2D0P A;  2OCE A;  1U5K A;  4GLV B;  3K7A H;  5IYD G;  1X9N A;  3PIO A;  4A3G H;  3HOY G;  3BZC A;  3K81 C;  3M4Q A;  1FVI A;  2CQO A;  2F4V L;  1YI2 A;  1QVG A;  3L2P A;  4AH6 A;  4BXX H;  4B3M Q;  4DNI A;  3HKS A;  1X3E A;  3U50 C;  1JJG A;  5C0X J;  3T1Y Q;  2UU9 L;  1LUZ A;  5M3M H;  3GTO H;  1LM0 A;  3KF6 A;  4NPS A;  4GLA C;  2PNH A;  4LF5 L;  2ZTC A;  4J15 A;  4JV5 L;  2I5L X;  2FXQ A;  1SE8 A;  4JI8 Q;  3NEM A;  2KHI A;  1HNW L;  1YIT A;  4JI0 L;  3GTQ H;  1WCM G;  2VUM H;  3GO5 A;  2C35 B;  4QJF A;  4XIG S;  3S15 H;  1Y14 B;  1UEB A;  4LUV A;  1NTG A;  1QVC A;  3K80 C;  4X62 Q;  1VQI A;  4OX9 Q;  2UXB L;  4A3D H;  2ZTE A;  4GKK Q;  2Q2I A;  2Q2H A;  3CW2 C;  4DR7 Q;  4YHH Q;  1HJP A;  5GAG C;  1HR0 Q;  3TRE A;  4C3H H;  2ES2 A;  5FLM H;  2R93 G;  1XPO A;  2KBN A;  1QUQ A;  3OW2 A;  3ZJY C;  2E2H H;  2JA5 H;  1UE7 A;  1N34 L;  5IYC H;  1B70 B;  1B8A A;  5IP7 H;  2B3G A;  2N78 A;  1JJC B;  2OQK A;  3HOX G;  1SRO A;  2YU9 H;  4OWW B;  1IL2 A;  3CPW A;  3M7N A;  4YWM A;  3PO2 G;  1Y1V H;  2UUB L;  4BY7 H;  1NE3 A;  1L1O A;  3PF5 A;  4BBR H;  1VCI A;  4NXM L;  3PO3 G;  4JI2 Q;  2YTX A;  4DUZ L;  4HJ5 A;  4DR6 Q;  2JA6 G;  4A3K G;  1I94 L;  1PH8 A;  4HIM A;  2ATW A;  3M4P A;  3CCL A;  3CCJ A;  1VQO A;  5FLX c;  1PYB A;  5IWA L;  1OXT A;  3WWV A;  1K8A C;  4PMW A;  1HR0 L;  2HHH L;  1E22 A;  2EIF A;  3TRZ A;  1XPR A;  3PUV A;  4OX9 L;  2DUD A;  2CCZ A;  2UXB Q;  2IX0 A;  3A5Z B;  3BU2 A;  1YHQ A;  1KC8 C;  1D7Q A;  5BR8 L;  1HNZ L;  3ER0 A;  4GN3 B;  4X6A H;  4C2M H;  2LXJ A;  4A3C G;  2MO1 A;  4IPH A;  1OXV A;  4GOP A;  4R4C A;  3JAM i;  4JOI C;  1GKH A;  5LMN W;  3CCM A;  1SR3 A;  3KLW A;  4JC0 A;  5GRO A;  1YJW A;  4JI2 L;  4L5S A;  4DPG A;  1VQ4 A;  4DR6 L;  4DUZ Q;  1NJI C;  4JOI A;  2Z6K A;  5C3E H;  3HOU G;  2UXD L;  1CKO A;  4NXM Q;  2L15 A;  3STB C;  1VQE A;  4POF A;  4JI3 L;  5C4X H;  1WI5 A;  1UE5 A;  2IT1 A;  3J80 c;  2VNU D;  1KD1 C;  1VQC A;  1IBK L;  2JK8 A;  1A63 A;  3HOW H;  1E3P A;  1DGS A;  1HZB A;  1LYL A;  4JBW A;  3I56 A;  1FJG Q;  2VQF L;  4GKJ L;  4LFB Q;  3A74 A;  4DR4 Q;  1VQ7 A;  5HGQ A;  1KXL A;  4P75 A;  5M3M G;  5IYB H;  2B63 H;  2K5H A;  4KHZ A;  4GN4 B;  1Q12 A;  2K5N A;  4IPD A;  1RIP A;  4DR7 L;  2ZJR A;  3CMA A;  1V1Q A;  4LUZ A;  4YHH L;  1I3Q H;  2WFW A;  4A93 G;  3GTL H;  1VQ5 A;  2Q2U A;  3CCS A;  4GKK L;  1Q86 C;  2I5H A;  2BH8 A;  4UP9 A;  4O2D A;  4APV A;  5JEA G;  4GNX C;  1IBL Q;  5BR8 Q;  4JI7 L;  3GTP H;  1SMX A;  3RLF A;  5LMU Q;  4NXN L;  1FL0 A;  3E9H A;  1PH1 A;  2VS1 A;  4KI0 A;  4LUO A;  4OWX B;  1OTC A;  4DV6 L;  3FP9 A;  1JT8 A;  3NEL A;  1PH2 A;  4LF9 Q;  1Z47 A;  4DR5 L;  2LXK A;  2I0Q A;  2K75 A;  2WAQ E;  2MO0 A;  1YJN A;  1Y1W G;  4YWL A;  3J7A 5;  4X66 Q;  3I7F A;  4IFD I;  5EAY A;  1L1O B;  4K0K Q;  3G71 A;  4UP8 A;  5M5W H;  4IOA A;  3U4V A;  4LFA Q;  4OWT B;  1KAW A;  3GTK H;  1GO3 E;  3I4M H;  1CUK A;  4LF7 L;  4X64 Q;  3BJU A;  2VW9 A;  2UXC L;  4JI4 L;  3K8A A;  1A62 A; 
#chains in the Genus database with same CATH topology
 1EWI A;  4DV1 Q;  1X3Q A;  1I6H B;  3DXJ C;  2EZV A;  3UDI A;  3NHH A;  4C1N I;  3HOU H;  4PZ7 A;  1QVF A;  4Q5V A;  3CAM A;  3HOV H;  2MQH A;  5I9O A;  3OOC A;  1WCM H;  3PQI A;  3NUC A;  5ELD A;  5CV6 A;  2RHS B;  2PNR C;  4KJN A;  3Q0A A;  2PO4 A;  4ZRZ A;  1XWE A;  4DR3 L;  2XRS D;  1R4Q B;  1PRT B;  5ELC A;  3GTJ B;  4HMI A;  2PW7 A;  4OEM B;  3VYT A;  4ZYS A;  2Y0S B;  2EQS A;  4AYB G;  4K2L A;  1DXM A;  2KQ3 A;  4U68 A;  4NKL A;  2MGS A;  1BF4 A;  2E5L Q;  1GJX A;  3CCQ A;  3F2D A;  1F77 A;  3MTS A;  2Z4H A;  1VQD A;  1CKN B;  2YTV A;  1V1O A;  3B6Y A;  2YTY A;  1MHW C;  1TWH B;  1R4P B;  3S2H B;  1E2V A;  4JI1 L;  2D0O A;  3RLN A;  1QCB D;  3A0J A;  1QJO A;  1HA5 A;  1VF7 A;  1HQR D;  1A15 A;  4HJ7 A;  2SOB A;  4KY7 A;  1B44 D;  2RQX A;  3LX0 A;  4ZKC B;  4X65 Q;  2L9H A;  2K03 A;  1WJJ A;  4G4K A;  2M9V A;  3K58 A;  1FYC A;  5AFW A;  2E76 C;  3BVG A;  1SYC A;  2KCC A;  2UUB Q;  2JA9 A;  4L5T A;  1E24 A;  4LF8 L;  4DAV A;  4A3C H;  2KCM A;  1S4Z A;  2B2T C;  2MUY A;  1YNX A;  3PO3 B;  1H9S B;  2AMC B;  3QG1 A;  5EPL A;  3P1H A;  1CSQ A;  3W5O A;  2QKI C;  5HY6 A;  1HZA A;  2HQE A;  1EIY B;  1BBW A;  1PRT C;  1Q3L A;  2O5J C;  1QNK A;  2CWP A;  2PI2 A;  3HOY B;  3OW7 A;  4DAM A;  3S14 H;  1LT5 D;  3KK7 A;  4CHT B;  3VYR A;  1ML0 D;  1TWC B;  4P71 A;  2F0U A;  3TBI B;  2JA7 G;  3J81 L;  1FJG L;  4JI6 Q;  4HID A;  1UE6 A;  2F0O A;  2ZM6 Q;  1M1K C;  4P72 A;  5C4H A;  3S1Q H;  1XTC D;  1HPC A;  4LFA L;  1HFN A;  2J0T D;  2ICE C;  2QIL A;  4LWC A;  3F2U A;  4JI1 Q;  1TWG B;  1PRT D;  3HOW B;  3PO2 H;  4TRD A;  2Z8L A;  1KL9 A;  1Y1V G;  4YWK A;  1QIL A;  2R92 H;  3E9I A;  1Z9F A;  1PH4 A;  4JI5 L;  1CTM A;  1RL2 A;  4NXN Q;  4ID6 A;  2B2V C;  3P20 A;  4OGQ C;  5HUR A;  3NPP A;  4OON A;  5I2X A;  1FGU A;  2D62 A;  2F3I A;  1JJG A;  2OXP A;  4O1N A;  3KJO A;  3M3Y H;  1BVS A;  2JJQ A;  2R92 B;  4A3M H;  4JI8 L;  3V05 A;  1K3R A;  2F0F A;  3NK9 A;  4TVA B;  2Q8I B;  2JEB I;  4CBV A;  4BXX G;  1BBX C;  1STB A;  2L12 A;  2Z1C A;  4OHJ A;  1UEA B;  3NBH A;  2EVB A;  2WAQ G;  2DNE A;  2DY8 A;  2RDH A;  5M5W B;  1MJE A;  3OIP A;  1JOK A;  1GM5 A;  1SRU A;  1XXG A;  2K50 A;  4PZ6 A;  2NTT A;  3C1F A;  1BQQ T;  3T4A C;  1E2W A;  4ZUI A;  4DUY L;  3PMF A;  4DR5 Q;  4K2K A;  5CMD A;  5C4J B;  5IWA Q;  3Q24 A;  5C44 G;  2HHH Q;  1HUN A;  2NN6 I;  3TS0 A;  3N52 A;  1PA6 A;  2E5L L;  3HG9 A;  3S24 A;  3EN2 A;  4A3J H;  5E7N A;  3RR5 A;  4A3I G;  1SE4 A;  2IL8 A;  4EGV A;  1SND A;  4U67 3;  1V43 A;  1W2B A;  4XDX A;  3RZD H;  4LFB L;  1LAC A;  4DK6 C;  5KIX A;  2O4X A;  1VDZ A;  4BY1 G;  1BCP D;  4B3M L;  4IJL A;  5AJ3 L;  4G7Z C;  3RZO H;  2Q8R E;  3NTI A;  4JBM A;  4DV2 L;  2A6H C;  1JB7 A;  1VMP A;  3FKI G;  2F0G A;  5KEE A;  1WYD A;  4HIK A;  5M3F B;  3U4Z A;  3KOJ A;  1M90 C;  2CHB D;  2VY3 A;  4ALP A;  4X62 L;  3S17 B;  1XTD A;  3GTG B;  4A4I A;  1RF2 D;  3R2I A;  1Q7Y C;  2Z6B A;  1GD7 A;  2B2W A;  3T1H L;  5I6Y A;  3H6M A;  3S1Q B;  2KEN A;  3L9A X;  1EWH A;  4DV5 Q;  4LF4 L;  1ZYR C;  1LTG D;  4IQZ A;  4LF6 L;  1PYS B;  1EYG A;  4BY7 B;  4RGO S;  2A6E C;  1DD2 A;  4UY8 C;  1F2Y A;  2E8G A;  4JI6 L;  1QZG A;  4RGN A;  2X69 A;  1O78 A;  3QO2 A;  2FFK B;  2BE5 D;  3NQI A;  2EXZ A;  2JA7 B;  2NYZ D;  1K0R A;  1A6X A;  1IBK Q;  2F0N A;  3UE0 A;  1D1K A;  4C3I B;  1CA5 A;  1ZEQ X;  4L5R C;  1L0X B;  4K5W A;  2HDL A;  3Q22 A;  1NCV A;  3S1N H;  4G7H C;  1EUJ A;  3W1G A;  1PFB A;  1A3V A;  4JYA Q;  2MHV A;  3KLS X;  4LFC Q;  2QA4 A;  1B2T A;  4KJO A;  4BBR G;  3BYT B;  4WRD A;  4A3L H;  5EPJ A;  5LMU L;  2UUA L;  5C0X G;  4JG2 A;  3I55 A;  4FF1 A;  3QOL A;  1T5E A;  5EKI A;  1BKB A;  1QB5 D;  4QF4 A;  3FPU B;  2WB1 G;  4DR4 L;  1IYJ B;  1S3O A;  1NNX A;  2CVR A;  2PQE A;  1I5F A;  4JW0 A;  1MIU A;  2QCP X;  4KY6 A;  3LGJ A;  3CD6 A;  3T51 B;  1I4H A;  3PCO B;  5KGU A;  1ENC A;  4EQO A;  2IX3 A;  2F3V A;  2VB2 X;  2JA7 H;  5D3I B;  2QDL A;  2D5D A;  4LF6 Q;  4UPA A;  4OO1 G;  1N9W A;  2NBF A;  3A8K E;  1YHB A;  5C3W A;  1BBU A;  3KF8 B;  4DV6 Q;  1N33 L;  1HH2 P;  2MJ8 A;  4A3F H;  1JE5 A;  2CFM A;  2EXD A;  4GOP B;  5CGK A;  1HR0 W;  3HOU B;  2R92 G;  5C5L A;  2EYO A;  4OL7 A;  1STH A;  3BDC A;  4MZ9 A;  3I4N G;  2D0P A;  5ELE A;  3SXH A;  3BG3 A;  3J7Y W;  2VB3 X;  3TN2 A;  1X9N A;  3BZC A;  5FO7 B;  2K5Q A;  1EIG A;  3L2P A;  1FR3 A;  2HD3 A;  3IFT A;  3K57 A;  1A3U A;  1EOT A;  2J4X A;  2KEE A;  2ZXO A;  2B2U C;  1DOL A;  2UU9 L;  4ABN A;  1CI3 M;  5IGC A;  4NPS A;  1F9P A;  3C46 A;  4LF5 L;  2ZTC A;  4JV5 L;  1STN A;  3S15 B;  4LJZ C;  3M4O B;  3I4L A;  2DY7 A;  1VQI A;  4B9W A;  5KYI A;  4GKK Q;  3CW2 C;  2Q2H A;  1DCZ A;  3D4R A;  3BVZ A;  2K04 A;  5FLM H;  1TWF B;  2KBN A;  2A73 B;  4I65 A;  2KA7 A;  2K28 A;  1UE7 A;  3LWU A;  1H9S A;  1JJC B;  2OQK A;  3R3O A;  3M7N A;  1SRO A;  4K8J A;  2YU9 H;  1SSO A;  1TU2 B;  2UUB L;  2A69 C;  4RHR A;  3NBI A;  4NXM L;  4FXD A;  4WFN 3;  2YTX A;  4DUZ L;  4HJ5 A;  3HKZ B;  1DOM A;  1ESF A;  4A3K G;  1SE2 A;  3TZD A;  2ATW A;  3CCL A;  1QNU A;  3T13 A;  1EZ6 A;  4MIU A;  1Q8I A;  5EBC A;  2PZU A;  5KND A;  1WVL A;  2DUD A;  1AZQ A;  3H0G B;  3SHL A;  1YNN C;  4TSS A;  2IWH A;  4X6A H;  3E0J A;  1OXV A;  2FIN B;  1MD2 D;  3MWY W;  3CCM A;  1SR3 A;  3SDZ A;  2IW3 A;  4L5S A;  4CDD C;  4DPG A;  1VQ4 A;  4DR6 L;  1NJI C;  3HOU G;  4JOI A;  3HRZ C;  5JJZ A;  5DM7 3;  2K33 A;  2R93 H;  2IT1 A;  4KKU A;  1G2T A;  5D14 A;  4A3M B;  3HOW H;  3MC0 B;  1E3P A;  3I4N B;  2VQF L;  1VQ7 A;  5HGQ A;  4B08 A;  4P75 A;  5M3M G;  1KXL A;  2F03 A;  3P7J A;  2K5H A;  3QIA A;  4KHZ A;  1SYB A;  1Q12 A;  3DEO A;  2BOS A;  4F8M A;  3CMA A;  1E2Z A;  1M8A A;  4YHH L;  4A93 G;  2NN6 H;  1VQ5 A;  2Q2U A;  3X3N A;  1VQ6 A;  4GNX C;  2JA8 B;  5BR8 Q;  4DK1 A;  1K0S A;  3DMU A;  4NXN L;  3HEJ A;  1ONL A;  2K5W A;  1FL0 A;  4OWX B;  2X6L A;  1OTC A;  3FP9 A;  4BS9 A;  1JT8 A;  3FDT A;  4LF9 Q;  1V1P B;  4ZKB B;  2LXK A;  2I0Q A;  5COR A;  4YWL A;  5HGT A;  2SNS A;  2L1B A;  4CJ1 B;  2ENB A;  2B63 B;  3I4M H;  1CFM A;  3BJU A;  2UXC L;  1A62 A;  1RHP A;  4RGM A;  1JB3 A;  5ELO A;  2JA5 B;  4JPB W;  5GAH C;  5C3E G;  5C0X H;  2ASB A;  1U4L A;  4V19 0;  2O2L D;  5C4X G;  3PO3 H;  3BDO A;  1D8L A;  2VUM G;  1QE6 A;  1G6P A;  5CBA E;  3BDL A;  1GUG A;  1EQQ A;  5JJK A;  3ONA B;  3TP6 A;  3D0F A;  2M00 A;  2PQA A;  1JMC A;  3CCE A;  1DZ1 A;  4HN7 A;  3STB D;  1YJ9 A;  1N32 Q;  2EYM A;  3CXC A;  1BDO A;  1VQ8 A;  5LMN L;  2ID0 A;  3QB3 A;  1ZKO A;  3EJI A;  2UXD Q;  3MXP A;  5IYC G;  2L4N A;  2RSN A;  2LY7 A;  3MEF A;  1VQJ A;  1F2Z A;  2JA8 H;  4NW2 A;  3GTG H;  3QR8 A;  4JCV E;  2A1A A;  4BBR B;  4B3S Q;  4PZ8 A;  2XIW A;  1CA6 A;  1AN8 A;  1TWC H;  4K8I A;  4L5Q A;  3SVM A;  2HQL A;  5F2D A;  3L0O A;  4DAY A;  1CKM A;  5M5X B;  2IJ0 A;  1IW7 C;  3SK8 A;  1K3B C;  1STY A;  2EOT A;  3S2D H;  1IYV A;  1LTL A;  2A8V A;  1MJC A;  3ULJ A;  5BN5 A;  4DF7 A;  4A3G G;  1XNR Q;  4A3D B;  1K9M C;  4O0A A;  5FOB B;  1KIX A;  3PSI A;  1ZYR D;  3Q6S A;  5J3B A;  3FMC A;  1P8L A;  4RWS C;  1QOH A;  1IKL A;  4C3I H;  4QGU A;  1RD9 D;  3K6O A;  3FKI H;  3RNU A;  1KLG D;  3NSW A;  3JAM c;  4KN7 C;  4ZCK A;  1A0I A;  2OTL A;  4AQY L;  3HKZ E;  3H91 A;  3MVV A;  3T53 B;  1VQM A;  1E1T A;  5IGG A;  1BR9 A;  2JE6 I;  1PH9 A;  1FNV A;  3SR1 A;  3AQQ A;  2WB1 B;  3CC2 A;  2XN9 C;  4KV6 A;  2LMC B;  1KHI A;  2F0D A;  1TS3 A;  3HOV G;  4IO9 A;  1NAP A;  1RTO A;  4JI3 Q;  2WKC A;  2F0J A;  1WFQ A;  2F0L A;  2RDG A;  2VZA A;  1BCP C;  3T56 B;  3KFU A;  3OIQ A;  1PH7 A;  5A2Q E;  1ZXT A;  4EQ5 A;  2PZT A;  1ET9 A;  3HOX H;  4M1U B;  4LF4 Q;  3QJY A;  1AE2 A;  1XMQ L;  5DEH A;  1HA6 A;  3D3R A;  4PQX A;  2E2D C;  1JC7 A;  3GQB A;  4A76 A;  3K0X A;  4AQY Q;  1T9H A;  2NVX H;  4DR2 L;  4A3K H;  2IX1 A;  4QL5 A;  2SEB D;  1N32 L;  1W3S A;  3U9O A;  1Q1B A;  2DGY A;  3S15 H;  1PH6 A;  1ENF A;  4BA1 I;  4DUY Q;  2RKS A;  2V4D A;  4DV3 Q;  2R93 B;  3HS0 C;  1XNR L;  1I94 Q;  1OXS C;  3DHQ A;  2QEX A;  2E74 C;  2Z0S A;  4MHE A;  4DV1 L;  3U58 A;  1JWS D;  2NVQ H;  3CQZ H;  2LSS A;  3CPF A;  2L0C A;  4RKB A;  1S40 A;  1RCV D;  2QDB A;  4KLK A;  2FMM A;  4EQN A;  3FVQ A;  3J7Z C;  1F9Q A;  3K5L A;  4J1M A;  1E7Z A;  1RJT A;  4R4I A;  3N6R A;  1VS0 A;  2F52 A;  3S2H H;  1VQB A;  2YYZ A;  3E5S A;  2JEA I;  3W3A A;  1VQK A;  2JXM B;  4LK1 C;  5GAD C;  2JN4 A;  1U4P A;  3K5M A;  1A8V A;  2L55 A;  4JI0 Q;  4PMC A;  1MI2 A;  1Y1W B;  1K83 H;  1PFN A;  1V9P A;  2PMZ E;  4DK3 C;  4OO1 H;  1SEB D;  3F2C A;  2HUG A;  1BOS A;  2VUM B;  4E6I A;  3IL8 A;  2FJ2 A;  4BBS G;  4RFB A;  2EY2 A;  3GD7 A;  2RF4 A;  1CKN A;  1HNX Q;  3VDY A;  2NVY H;  3GTM H;  3S16 H;  1G29 1;  4DA2 A;  2L5T A;  2EE1 A;  3QWN A;  3UDG A;  2AWO A;  2NZ1 D;  4IFD G;  4DV0 Q;  1M4V A;  2PYK A;  4LF7 Q;  1SNQ A;  2J7Z A;  4IPG A;  2XSC A;  4DXG A;  3H15 A;  2CKZ B;  3RD4 A;  1EL0 A;  1L1O C;  2P5Z X;  5JEA J;  2NWG A;  3NEN A;  3VR6 A;  4DKA C;  1XMO Q;  3NTK A;  4ZUJ A;  3TQY A;  3T1H Q;  2AQ2 B;  2B29 A;  1XNQ Q;  3S17 H;  1U4M A;  1X3G A;  4YIJ A;  3CCR A;  4IJH A;  5IIF A;  4JBK A;  2ZTD A;  5IYB G;  3E0E A;  3M4Y A;  3MXG A;  3K0Y A;  5I4D A;  4K14 A;  2EJG C;  4FO2 A;  5FJ8 G;  1CK1 A;  1AH9 A;  4L6T B;  3AYH B;  4GZY C;  1XX8 A;  2IHE A;  5I2Y A;  2JA8 G;  5FK9 C;  1B9N A;  5FO8 B;  4RCN A;  2E2H B;  1I6H H;  5FLM G;  2B2V A;  1ASZ A;  3VA7 A;  4JI4 Q;  2GA4 B;  3K7U C;  1N36 L;  1TWA H;  3M4O H;  2V1C C;  5L37 A;  2JQO A;  1KDC A;  1EEI D;  4BY7 G;  3HFZ B;  1I6V C;  1O7I A;  1X65 A;  5M3F G;  4CJ2 C;  5C44 H;  1JWM D;  2F1M A;  2I07 B;  2Z4I A;  1PTO F;  1GUN A;  3DWP A;  1KLU D;  1PV4 A;  5IGE A;  4A3I H;  2VQE L;  5K36 G;  2G5D A;  2F0T A;  2A19 A;  4CDC C;  4DR3 Q;  1Y8P B;  4C3I G;  3IFD A;  1B7Y B;  1GUO A;  1WTH A;  2PZW A;  1EFW A;  3KLS A;  4H0L C;  4JVZ A;  4WJW A;  4QIW E;  3CCV A;  1TWH H;  1EOV A;  2GVB A;  2BA0 A;  1PDQ A;  2WAQ B;  3G4S A;  1EY6 A;  4KHP Q;  2NVT B;  1F9R A;  3CHB D;  4A3E H;  4RA8 A;  3M9B A;  3DLL A;  4AYB E;  4IN3 A;  5FO9 B;  3V96 A;  2Y0S E;  3MHB A;  1UWV A;  1X56 A;  4A3J G;  2UUA Q;  1KAA A;  4K0K L;  3A56 A;  1PLF A;  3PIP A;  3GTK B;  3WDN A;  1K8G A;  2K1B A;  5DM6 3;  4POG A;  1WTV A;  2AKW B;  4PV1 C;  4WJ3 M;  3NE5 B;  3M85 A;  1R9T B;  2I46 A;  1P16 A;  4ZAI A;  1S5D D;  4OXP A;  3KJP A;  2EYJ A;  2N3S A;  4B3T Q;  3EQL C;  1U5K A;  4GLV B;  3K7A H;  3PIO A;  3K81 C;  1FVI A;  4HED A;  1RTN A;  1CQV A;  4C1N K;  4LAA A;  3ZYY X;  1B3A A;  5C0X J;  1EYA A;  1LUZ A;  1WD1 A;  4P2C B;  1EY0 A;  3SK6 A;  4GLA C;  2PNH A;  2O5I C;  2HCI A;  3AB9 A;  1II3 A;  3S14 B;  2KHI A;  1HNW L;  3E3X A;  2VUM H;  3GO5 A;  4QJF A;  4XIG S;  1UEB A;  1NTG A;  1QVC A;  4X62 Q;  2D9U A;  4A3D H;  4DAP A;  1TWA B;  2ZTE A;  2F0I A;  5IGF A;  2Q2I A;  3FEW X;  5GAG C;  4DXF A;  1TT2 A;  3TRE A;  1XYI A;  4DK0 A;  2R93 G;  4FF4 A;  1QUQ A;  3OW2 A;  1H9M A;  2A68 D;  2RBM A;  5IYC H;  2F0V A;  2B3G A;  2N78 A;  2OT2 A;  4XYQ A;  4QUF A;  1IL2 A;  4OWW B;  4NDX A;  2CH4 W;  4FYD A;  4DR6 Q;  2JA6 G;  1JCK B;  2PCF B;  1PH8 A;  4IUP A;  4UDU C;  2TMP A;  1K8A C;  1HR0 L;  1E22 A;  5E4X A;  4KN4 C;  1JOR A;  3PUV A;  3MXN A;  4ZK9 B;  1A2U A;  1D6E C;  4DFA A;  3ER0 A;  3L3O C;  4MTK A;  1O80 A;  2LXJ A;  5CV4 A;  2EYP A;  5JPN C;  4IPH A;  1Y1V B;  4RGT A;  4K6L A;  1UNS A;  1A2T A;  3KLW A;  1YJW A;  1SNM A;  4DUZ Q;  4F7X A;  2CH4 A;  2Z6K A;  5C3E H;  2L15 A;  4XT1 B;  4POF A;  5C4X H;  1UE5 A;  3J80 c;  1QWY A;  1VQC A;  1B1Z A;  1IBK L;  1LTA D;  1DJR D;  3BVM A;  2AQ1 B;  4CKB A;  1DGS A;  4JBW A;  1LYL A;  1LT6 D;  4GKJ L;  4LFB Q;  1LTS D;  5C6A A;  1G91 A;  1GUS A;  2K5N A;  1L0Y B;  1UUP A;  2ZJR A;  1BCP F;  2F0H A;  4FVM A;  4LUZ A;  2WAC A;  1I3Q H;  2WFW A;  3GTL H;  2BDO A;  1Q86 C;  3I70 A;  2F0E A;  5LMU Q;  1I4G A;  2A69 D;  1PH2 A;  2NUC A;  2K75 A;  1B4O A;  2MO0 A;  1YJN A;  1SNP A;  5BN4 A;  1L1O B;  1SJE D;  2QW7 A;  1AZP A;  5M5W H;  4IOA A;  4LFA Q;  1KAW A;  4XQJ A;  1WD0 A;  4OIJ A;  1SMY C;  2VW9 A;  3K8A A;  4H13 C;  4MNO A;  1EY5 A;  3CME A;  4IUV A;  1KRS A;  4DGZ A;  1D5Z C;  4FF3 A;  1K8O A;  5E1F A;  2KEC A;  1GHJ A;  2K05 A;  4X65 L;  4KD3 A;  3HOW G;  2KCT A;  1PMR A;  1PTO C;  5CYU A;  4P74 A;  3ERS X;  2NVX B;  2B2Y C;  1JJ2 A;  3TDQ A;  3OSO A;  3PV0 A;  3KF8 A;  4QIW B;  4A3J B;  1IZ6 A;  4A3K B;  3OWF A;  4J8Q A;  4A93 H;  2NN6 G;  1MSG A;  3KLR A;  4YCW A;  2MNA A;  2UXD L;  4UP7 A;  5BN3 A;  2CWA A;  1EQR A;  4C3J H;  2E2J H;  4H44 C;  4JYA L;  1IHZ A;  3EBE A;  5ELF A;  4KKS A;  1DYQ A;  1I4P A;  5EBD A;  1G51 A;  3J80 i;  1JQY D;  1F2M A;  3KYH C;  3I4M G;  2R7D A;  4DV2 Q;  1SYD A;  2E75 C;  4R1J A;  4IAL A;  1XJV A;  4EX5 A;  2E2I H;  4DV4 L;  4B3R L;  1QZH A;  4A3L G;  2K5D A;  5C4X B;  3T16 A;  4JK1 C;  2B2T A;  5IP9 H;  1JOQ A;  4L63 B;  4DV5 L;  1X6O A;  4UHV A;  3J81 j;  1Y1W H;  1Q46 A;  1Q81 C;  3MEH A;  3MXN B;  4FDB A;  3AFQ A;  1CT1 D;  2Q2T A;  2H4O A;  2EYH A;  2LS0 1;  3EIV A;  1TWG H;  3EVQ A;  5IOD A;  1H95 A;  4X3T A;  3PO2 B;  2R6G A;  1VQP A;  1OXU A;  3GTO B;  2R7F A;  4TQU S;  2TSS A;  3QOJ A;  4A3B G;  4A3D G;  2XGT A;  1BCP B;  1JOO A;  1BXT A;  2VL6 A;  4BBS H;  2EDG A;  5JJI A;  4GNX A;  4YY3 Q;  1KNA A;  1JR0 D;  1U9R A;  2B8G A;  4IUQ A;  4A3F G;  3J7A F;  3P75 A;  1F9S A;  1KRT A;  1SYE A;  1SXT A;  2XTI A;  2F3W A;  4CGY B;  1CHP D;  1GXD C;  3S1M H;  1JIC A;  2Z9H A;  2WP8 J;  4FXG C;  2VXW A;  1IW7 D;  3I72 A;  4XQQ A;  3HOZ B;  3TS2 A;  5COY A;  4L8J A;  3CRL C;  4FXK C;  3JAM E;  2K01 A;  2CW0 C;  4IOC A;  2K5V A;  1GOZ A;  2NVT H;  4RG1 A;  5CV7 A;  2VQF Q;  3HOZ G;  2EY1 A;  5GQO A;  4YY3 L;  2A68 C;  2WB1 E;  1J5E Q;  1D5X C;  1VQA A;  1CZG A;  3F1Z A;  3I2Z A;  1KDA A;  2ZJP A;  1IBM Q;  1PH3 A;  1XPU A;  1Y8N B;  5FLX E;  3PIO 3;  2K7V A;  2NVQ B;  4ME5 A;  4C3J B;  2K4K A;  1D5M C;  1RDP D;  1EY4 A;  1R9T H;  4A3I B;  1WTX A;  4DU9 A;  2ZXP A;  2Y0S G;  4G7O C;  2B2U A;  5M3F H;  4V0B A;  1SNC A;  3R8B A;  5IOC A;  4RMF A;  1PTO D;  3D31 A;  2R61 A;  3PUW A;  4XT3 B;  1TKW B;  3GP7 A;  1OXX K;  1I4X A;  3OHX C;  4HJ8 A;  2M2L A;  2PW5 A;  3J80 L;  2B2Y A;  1ASY A;  4GS3 A;  4DR1 L;  1VQL A;  1U4R A;  4ULL A;  2PI2 E;  5CV5 A;  2BA1 A;  1EEF D;  4A3E B;  3UDX A;  3OWE B;  3VR3 A;  3VA5 A;  4NB3 A;  1Z7T A;  4DV3 L;  5IGB A;  1G2S A;  1S5B D;  5IY0 A;  1PXU A;  2ICI A;  1SFO H;  3SEB A;  5C4J H;  3UI2 A;  3F2B A;  1VQH A;  1YVC A;  2L11 A;  2N88 A;  2B2W C;  5CBE E;  1EIH A;  4IPC A;  1MSH A;  2NTS A;  5J39 A;  3TEH B;  1PHJ A;  3G7L A;  1VMC A;  4YCU A;  1VQG A;  3CCU A;  4HTH A;  1ENA A;  4K5V A;  2UU9 Q;  3D4W A;  4RAU C;  3TP5 A;  3HGB A;  1HNX L;  2KHJ A;  4C3J G;  5IE8 A;  4WJ4 A;  2IY5 B;  3VYU A;  4NMZ A;  2JA6 B;  3PUY A;  1HTL D;  4HSP A;  2B39 A;  4B3T L;  4XTC S;  3SE0 A;  3I8Z A;  1KQS A;  5ELB A;  2K14 A;  4K5X A;  4G57 A;  1IYU A;  1Q1E A;  4IFD H;  1MKH A;  1LTI D;  3H0G G;  1YNJ D;  3VR5 A;  1XNQ L;  4X3U A;  4JI5 Q;  1K8M A;  5T1I A;  3MAQ A;  1Y8O B;  3F8T A;  4M8A A;  2A74 C;  1Y69 U;  3OPO A;  2X6G A;  2MFI A;  3A7A B;  1SJH D;  2R7Z H;  3DWQ A;  2DNC A;  4ME3 A;  5JVG 3;  2OTJ A;  4BWG B;  1G6Z A;  1EY8 A;  5TSS A;  3T1Y L;  2OWO A;  3CKI B;  4O42 A;  2KOL A;  5IT9 c;  4HJ9 A;  1KAB A;  3I90 A;  1YIJ A;  1FD7 D;  2AQ3 B;  1MGS A;  1QUQ B;  2AUJ D;  1J6Q A;  5IP7 G;  1L2F A;  1O7L A;  1PTO H;  4DR1 Q;  3H09 A;  1HZC A;  1STA A;  3X3M A;  4N9T A;  2DN8 A;  4A3B H;  2H5X A;  3PUX A;  3BZK A;  4OO1 I;  4DR2 Q;  3ULL A;  3IAY A;  3MFY A;  3H3V I;  4X66 L;  1DOK A;  5J22 A;  4UAI A;  1O7Z A;  3I4M B;  2K32 A;  4LF5 Q;  2IHF A;  3NP8 A;  5EJW A;  5M9O A;  1N36 Q;  1TXY A;  3S1R B;  2HDM A;  1WOC A;  1B53 A;  5A2Q L;  2N8N A;  2MP1 A;  5FJ8 H;  4KHP L;  5K36 H;  3TSS A;  2OCE A;  3FRP B;  5IYD G;  4A3G H;  3ERO A;  3HOY G;  4IZ8 A;  3URY A;  2F4V L;  1YI2 A;  3MXU A;  4DNT B;  1T5X D;  4BXX H;  1EU3 A;  1NSN S;  2XRQ D;  4B3M Q;  3HKS A;  1X3E A;  3WOF A;  2BE5 C;  1HQM C;  3TP7 A;  1LM0 A;  1X32 A;  1D1I A;  5CV8 A;  4KMU C;  4CDF C;  4J15 A;  4QCL A;  2I5L X;  5C44 B;  1SE8 A;  2LFN A;  2LKV A;  4S3S A;  3PIP 3;  2A5H A;  1YIT A;  4JI0 L;  1J8I A;  3GTQ H;  1WCM G;  1YNN D;  5EPK A;  2RDF A;  3EA6 A;  2UXB L;  4I7A A;  5EGT A;  2BCO A;  4TKO B;  4YHH Q;  4KY5 A;  4C3H H;  2ES2 A;  1XPO A;  3R2T A;  3NTH A;  2E2H H;  2JA5 H;  2C9O A;  3C3L A;  2CW0 D;  1N34 L;  1B70 B;  4WOR A;  3HOX G;  1VF5 C;  4BY7 H;  4YWM A;  1TS4 A;  1VCI A;  2Q8T A;  4QB4 A;  4XYO A;  4ZLT F;  3AMU A;  4A3G B;  3JAM L;  4AYB B;  4HSV A;  4HIM A;  3M4P A;  4RH6 A;  1CQF A;  3CCJ A;  4KTA A;  1VQO A;  1LLR D;  1PZJ D;  4PMW A;  3TRZ A;  4X3S A;  3DEP A;  1XPR A;  5KNC A;  2UXB Q;  1DON A;  3D6C A;  1PZI D;  1YHQ A;  1KC8 C;  3RUZ A;  4GN3 B;  4C2M H;  1DM0 B;  4A3C G;  1F2L A;  4GOP A;  3W2D A;  2KHS A;  1AW7 A;  2RCF A;  3TP8 A;  1BNZ A;  4JOI C;  3LNN A;  1GKH A;  5J1Z A;  1KDB A;  1ROD A;  4JI2 L;  5GRO A;  1WTO A;  4DN4 M;  3VR2 A;  4IUR A;  1CKO A;  4PMB A;  4NXM Q;  1X3P A;  2E2I B;  1VQE A;  3NWS A;  4JI3 L;  2VNU D;  4C3H B;  2KUM A;  1KD1 C;  2DJG C;  2JK8 A;  5C5M A;  2N55 A;  5G3L D;  3CRK C;  2NB0 A;  3A54 A;  5E3F A;  4DR4 Q;  4C56 C;  2B63 H;  2WKD A;  2OF1 A;  2EYF A;  5JPM C;  1RIP A;  3J81 E;  1ILP A;  3J80 E;  1GUW A;  4EQP A;  2I5H A;  4UP9 A;  4APV A;  4O2D A;  3I91 A;  5JEA G;  1IBL Q;  4RHS A;  4JI7 L;  3GTP H;  3RLF A;  1EQT A;  1PH1 A;  2F0S A;  1BUV T;  2ZXR A;  1B9M A;  4DR5 L;  3ND8 A;  1Y1W G;  3J7A 5;  4A93 B;  4X66 Q;  3J7A V;  1JWU D;  3MZ5 A;  5A35 A;  1K28 A;  5EAY A;  4IFD I;  4K0K Q;  3U9S A;  1FGB D;  4UP8 A;  3G71 A;  3U4V A;  4F87 A;  4OWT B;  1TS5 A;  2JP1 A;  1GO3 E;  1CUK A;  4LF7 L;  1V8Q A;  4JI4 L;  1WTR A;  2QGQ A;  3S1N B;  2F4V Q;  4LW1 A;  2Z6K C;  3J81 i;  3SK4 A;  5LL6 X;  3ICE A;  1I50 B;  3NQT A;  1EYD A;  3H94 A;  1U0L A;  2HCC A;  4KK7 A;  1YEZ A;  4B3S L;  2H1E A;  3IRB A;  5JOB A;  4LNQ A;  3GV6 A;  5IP9 G;  1C7Y A;  1GVP A;  2RVL A;  2AHO B;  5K5P A;  3RLO A;  3CC4 A;  3HOZ H;  1X54 A;  2VQE Q;  4R8I A;  3OTO L;  2I5M X;  4RCO A;  5IGD A;  1GHK A;  5KYL A;  3S2D B;  2HIV A;  5FLX L;  1HNW Q;  5H1S E;  3HZX A;  1PFM A;  1QG7 A;  2MPM A;  2ZJQ A;  1MBY A;  1I4Q A;  3RMH A;  3A5U A;  4OIK A;  2NZO A;  2GVA A;  3PF4 A;  5ISR A;  3AEV A;  4BBS B;  1UE1 A;  2XWB B;  1NY4 A;  3KBG A;  2RCN A;  4R9W A;  3CQZ B;  3OYY A;  4PNY A;  1SFO B;  5CV9 A;  4MTN A;  1CHQ D;  1EIF A;  1YBY A;  1I4R A;  4KHV A;  4GLX A;  4J6H A;  4DAY B;  3K59 A;  3UDF A;  3KDF B;  2UXC Q;  3I4N H;  1LAB A;  3SK5 A;  3IKJ A;  5IYD H;  1NMF A;  3HOY H;  2XVS A;  3ITP A;  1XMO L;  3C2P A;  5JVH 3;  1ILQ A;  3H3V H;  2WIN B;  1W6J A;  1NR2 A;  3D4D A;  3C1E A;  5LHY 1;  3RN5 A;  1EU4 A;  3CU7 A;  5M5X H;  1NBW A;  1H9R A;  3HOX B;  3H3V C;  1HUM A;  4N8F A;  5G3L F;  1GUT A;  4A3E G;  4IFD J;  2EJF C;  3KBX A;  2RA4 A;  5DLQ E;  2ZM6 L;  1L0W A;  4C3H G;  2WII B;  3G6E A;  4QY7 A;  1VQF A;  1OO9 B;  3K7A B;  2JA5 G;  1Q8K A;  4GOP C;  3OMG A;  4DNR B;  2JSO A;  3E6Z X;  1CM9 A;  1IL8 A;  3NWT A;  5EKK A;  1TWF H;  1PVO A;  3DM3 A;  4QUC A;  3GTJ H;  4HJA A;  4GNX B;  3AFP A;  1S5E D;  3BS1 A;  1PFS A;  3CC7 A;  1PYW D;  3GTQ B;  1A3T A;  5KRU A;  1IBL L;  4JI7 Q;  1N33 Q;  4H02 A;  3KF6 B;  4JV5 Q;  3A8J E;  3H0G H;  1WTW A;  3I73 A;  4DV7 L;  2UUC Q;  3GDE A;  4Y52 H;  4GKJ Q;  4CKC A;  2D2C C;  2OQ0 A;  4X3K A;  1CSP A;  4MN3 A;  1AE3 A;  1J5E L;  1IKM A;  2F4I A;  5M5Y H;  4IUT A;  2K52 A;  5FKA C;  3HKZ G;  1HXY D;  5GAE C;  1TQO A;  4P73 A;  2SNM A;  1STG A;  3ULP A;  3S1R H;  1X3F A;  2AWN A;  2B63 G;  1E0B A;  4F88 A;  1EQV A;  3DM1 A;  1D2B A;  3G48 A;  3GTL B;  1X55 A;  2BDN A;  3RN2 A;  1SN8 A;  1C48 A;  1TS2 A;  1XMQ Q;  1AEX A;  3D8G A;  2KVM A;  1TVX A;  1O7Y A;  3RZO B;  4HIO A;  3PUZ A;  1IBM L;  4BA2 I;  2JA6 H;  1KNE A;  5AJ3 Q;  4Y7N H;  1TY2 A;  1PTO B;  5C3E B;  2F0W A;  1HZ9 A;  4ZQ3 A;  5NUC A;  4CKE A;  4ILW A;  3AU7 A;  3BYY B;  5KNB A;  3TME A;  3Q8D A;  1K83 B;  3WOE A;  1EY7 A;  3NXW A;  1NR4 A;  3SGI A;  1IXR A;  3J81 c;  4RKL A;  4LMQ D;  1NMG A;  2GN5 A;  2A6E D;  5M3M B;  5C4Z A;  1SYF A;  1LO5 D;  4Z9C B;  1JE4 A;  4LFC L;  1ICF B;  4A3M G;  3GTP B;  3OMC A;  1LTT D;  2ALY B;  3HP3 A;  5C3X A;  2NZH A;  5LL6 S;  2IPK D;  4A3F B;  3FKI B;  2EPB A;  3VR4 A;  1CZW A;  1SNO A;  2RSO A;  2YU9 B;  1EYC A;  3UE1 A;  4QQB X;  1WCM B;  5C0X I;  3KDF A;  2YV5 A;  2FMC A;  1Q90 A;  3W1B A;  4BY1 H;  2R3Z A;  4A3B B;  2RHQ B;  1LTB D;  1SYG A;  1B3Q A;  3FHW A;  3RZD B;  4Y7N B;  1TY0 A;  5JJL A;  1PZK D;  1HRJ A;  1I50 H;  4ODG A;  4Q0F A;  1C9O A;  1VQN A;  2PQA B;  3JC6 6;  4X64 L;  1AFP A;  1Q82 C;  1SLJ A;  3CP0 A;  4R4Q A;  3I4O A;  3LWE A;  1S72 A;  3D6W A;  3M7G A;  4HCE A;  4PG3 A;  2HT1 A;  1S5F D;  3S1M B;  2XWJ B;  3NBH B;  3PGZ A;  1SMY D;  4R4T A;  2BH2 A;  1HNZ Q;  4JBJ A;  4FF2 A;  3OTO Q;  4B3R Q;  5CC4 A;  4R4O A;  4YCV A;  1YHA A;  1FNW A;  4DV0 L;  4LF8 Q;  1RKN A;  1EWC A;  2A6H D;  3V2T A;  4HCS A;  4EVO A;  1TR5 A;  2EYL A;  4DV7 Q;  2UUC L;  3EFX D;  1N8R C;  3TZU A;  2SDF A;  1E1O A;  1J9O A;  3ND9 A;  1N34 Q;  1YZ6 A;  1STE A;  1HCZ A;  5ELN A;  5EQ0 A;  3M3Y B;  1H9J A;  4AIM A;  2KCN A;  4LF9 L;  3CF5 A;  4HAE A;  3O13 A;  1WTQ A;  2N49 A;  2DJF C;  2HIX A;  5LMN Q;  1C0A A;  3K5N A;  4GN5 A;  4A75 A;  1VQ9 A;  3BZD B;  4H7B A;  2XNA C;  4DV4 Q;  1PH5 A;  1TII D;  4XXE A;  5JEA H;  4KKT A;  1EFI D;  4KD4 A;  1K73 C;  2R7Z G;  2F0Q A;  3L7Z C;  5IT9 L;  5I6W A;  2FHT A;  1YNJ C;  1PRT F;  2B8F A;  2QF7 A;  3M4Q A;  2CQO A;  3KUP A;  1QVG A;  4AH6 A;  1UAP A;  3R93 A;  1B50 A;  4DNI A;  3U50 C;  4HMJ A;  3T1Y Q;  2F0K A;  3A55 A;  5M3M H;  3GTO H;  3KF6 A;  2NVY B;  3GTM B;  3S16 B;  3K5O A;  2FXQ A;  4JI8 Q;  1S5C D;  3NEM A;  3VYS A;  1EZ8 A;  2C35 B;  4I7Z C;  1FNU A;  4HR7 B;  1Y14 B;  4LUV A;  3K80 C;  1KTK A;  2CQA A;  2K6A A;  4OX9 Q;  1LT3 D;  4DR7 Q;  1HJP A;  4CDE C;  1HR0 Q;  4C2M B;  2F0P A;  1SE3 A;  3ZJY C;  1BO0 A;  4FNF A;  2EY6 A;  1B8A A;  5IP7 H;  5JAV A;  2PPB C;  1V1P A;  1HTP A;  3ERQ A;  3PO2 G;  2ZT9 C;  4NP5 A;  5CR3 A;  3CPW A;  1Y1V H;  4IUU A;  1NE3 A;  1L1O A;  3PF5 A;  4BBR H;  2C5C A;  3PO3 G;  5I9P A;  4JI2 Q;  1NUC A;  4FP5 D;  4OEL B;  5EKL A;  1I94 L;  5FLX c;  1PYB A;  5IWA L;  1OXT A;  3WWV A;  2HHH L;  1LTR D;  2EIF A;  3A8I E;  1H9K A;  2EJM A;  2R7Z B;  4R8N A;  3MA2 B;  4OX9 L;  2CCZ A;  2E2J B;  2IX0 A;  3A5Z B;  3BU2 A;  2OEO A;  1D7Q A;  3MFG A;  5BR8 L;  1HNZ L;  3A7L A;  2MO1 A;  2F0M A;  1I3Q B;  2PMZ B;  4IUN A;  4R4C A;  2KJX A;  3JAM i;  1HFG A;  5D3D A;  1C8C A;  5LMN W;  2G9H D;  1W6K A;  4JC0 A;  5DNF A;  1ICW A;  4XQN A;  4B9X A;  3HOV B;  4BY1 B;  3STB C;  1WI5 A;  3GV3 A;  3I3C A;  1A63 A;  2WV6 D;  1ESR A;  1HZB A;  1SAP A;  3I56 A;  1FJG Q;  3A74 A;  5IYB H;  3FPP A;  5IT9 E;  1EY9 A;  4IPD A;  4GN4 B;  3DWA A;  4DR7 L;  1V1Q A;  1LV9 A;  1C4Q A;  1SDF A;  1LT4 D;  2AUK A;  4K6D A;  5DAU A;  4GKK L;  3CCS A;  2EY5 A;  2KED A;  2BH8 A;  1SMX A;  4N8X 1;  3E9H A;  4CJ0 B;  2VS1 A;  4LUO A;  4KI0 A;  5T1G A;  1G8Z D;  3Q23 A;  4DV6 L;  3NEL A;  1SBB B;  1Z47 A;  1Z6H A;  2WAQ E;  3I7F A;  3DUZ A;  3S9W A;  1AP0 A;  1WTP A;  2QEJ C;  3G6J B;  3GTK H;  1HHV A;  5M5Y B;  5D65 A;  1ET6 A;  2G9D A;  4X64 Q;  2JYO A;  4QMG A;  4N9P A;  5E4W C; 
#chains in the Genus database with same CATH homology
 1EWI A;  2QGQ A;  4MNO A;  4DV1 Q;  2F4V Q;  3CME A;  4LW1 A;  2Z6K C;  1KRS A;  5ELO A;  3UDI A;  3J81 i;  3HOU H;  4PZ7 A;  5GAH C;  5C3E G;  1QVF A;  2ASB A;  3ICE A;  5C4X G;  3PO3 H;  1U0L A;  3CAM A;  3HOV H;  2MQH A;  1D8L A;  1YEZ A;  2E5L L;  1WCM H;  2VUM G;  4X65 L;  4B3S L;  1G6P A;  3HOW G;  2KCT A;  1EQQ A;  5JJK A;  2RHS B;  3IRB A;  3D0F A;  4LNQ A;  2PQA A;  5IP9 G;  1JMC A;  1C7Y A;  1GVP A;  4P74 A;  3ERS X;  2AHO B;  4DR3 L;  3RLO A;  3CC4 A;  3HOZ H;  1X54 A;  2VQE Q;  3CCE A;  1JJ2 A;  3PV0 A;  3OTO L;  3STB D;  1YJ9 A;  1N32 Q;  3CXC A;  1IZ6 A;  2EQS A;  4AYB G;  5LMN L;  1VQ8 A;  2I5M X;  2ID0 A;  2E5L Q;  2NN6 G;  4A93 H;  2UXD Q;  3CCQ A;  2HIV A;  5IYC G;  3F2D A;  1HNW Q;  4YCW A;  5H1S E;  3MEF A;  1VQD A;  1CKN B;  2YTV A;  4UP7 A;  3B6Y A;  2CWA A;  1EQR A;  4C3J H;  1VQJ A;  2E2J H;  2ZJQ A;  4JYA L;  2YTY A;  3A5U A;  2JA8 H;  3EBE A;  2D0O A;  4JI1 L;  2NZO A;  3RLN A;  2GVA A;  3A0J A;  3PF4 A;  3AEV A;  3GTG H;  4HJ7 A;  1UE1 A;  2A1A A;  4JCV E;  1NY4 A;  1G51 A;  2RCN A;  3J80 i;  4X65 Q;  3OYY A;  4PZ8 A;  4B3S Q;  3KYH C;  3I4M G;  1WJJ A;  2R7D A;  4DV2 Q;  4MTN A;  1TWC H;  4R1J A;  1EIF A;  1YBY A;  4L5Q A;  4GLX A;  2HQL A;  1XJV A;  3L0O A;  4EX5 A;  2UUB Q;  2JA9 A;  1CKM A;  4DAY B;  3UDF A;  4L5T A;  1E24 A;  3KDF B;  4LF8 L;  2UXC Q;  3I4N H;  3S2D H;  1LTL A;  2E2I H;  2KCM A;  4A3C H;  2A8V A;  1MJC A;  4DV4 L;  4B3R L;  3ULJ A;  5IYD H;  1YNX A;  1QZH A;  4A3G G;  4A3L G;  1NMF A;  1XNR Q;  3HOY H;  1K9M C;  2AMC B;  4O0A A;  1KIX A;  3PSI A;  5IP9 H;  5J3B A;  1P8L A;  1XMO L;  1CSQ A;  3W5O A;  4DV5 L;  1X6O A;  5HY6 A;  4C3I H;  1HZA A;  4QGU A;  3J81 j;  1Y1W H;  3FKI H;  3RNU A;  1EIY B;  1BBW A;  1Q46 A;  1Q81 C;  3MXN B;  4FDB A;  3H3V H;  3JAM c;  3AFQ A;  2Q2T A;  1A0I A;  2CWP A;  2PI2 A;  2OTL A;  4DAM A;  4AQY L;  3S14 H;  3HKZ E;  3EIV A;  3RN5 A;  1TWG H;  5M5X H;  1H95 A;  1NBW A;  2R6G A;  1VQM A;  1E1T A;  2JE6 I;  1VQP A;  4A3E G;  1OXU A;  1PH9 A;  4IFD J;  3AQQ A;  2R7F A;  3CC2 A;  4TQU S;  4P71 A;  2JA7 G;  4A3B G;  1KHI A;  4A3D G;  2XGT A;  1FJG L;  3HOV G;  4IO9 A;  2VL6 A;  5DLQ E;  4HID A;  1UE6 A;  2ZM6 L;  4JI6 Q;  4BBS H;  5JJI A;  4GNX A;  1L0W A;  4JI3 Q;  3G6E A;  4QY7 A;  2ZM6 Q;  1VQF A;  1M1K C;  1WFQ A;  2VZA A;  4P72 A;  4YY3 Q;  3S1Q H;  2JA5 G;  4LFA L;  1Q8K A;  3KFU A;  1PH7 A;  4LWC A;  4GOP C;  4A3F G;  4JI1 Q;  1KRT A;  4EQ5 A;  2XTI A;  3HOX H;  3PO2 H;  4LF4 Q;  1AE2 A;  1KL9 A;  1Y1V G;  4YWK A;  1XMQ L;  2R92 H;  1TWF H;  3S1M H;  1PVO A;  3DM3 A;  3E9I A;  4A76 A;  3K0X A;  1Z9F A;  2WP8 J;  3GTJ H;  4JI5 L;  4AQY Q;  1PH4 A;  1RL2 A;  4HJA A;  4NXN Q;  1T9H A;  4GNX B;  2NVX H;  4DR2 L;  4A3K H;  3AFP A;  2IX1 A;  4QL5 A;  4OON A;  1N32 L;  1W3S A;  1FGU A;  1PFS A;  2D62 A;  1Q1B A;  2DGY A;  2F3I A;  2MNA A;  3KJO A;  3CC7 A;  1PH6 A;  1IBL L;  4JI7 Q;  3M3Y H;  1BVS A;  1N33 Q;  3TS2 A;  2JJQ A;  4BA1 I;  4A3M H;  4JI8 L;  4H02 A;  3KF6 B;  4DUY Q;  4JV5 Q;  1K3R A;  4TVA B;  2R93 H;  2JEB I;  4BXX G;  4DV3 Q;  3H0G H;  4IOC A;  2K5V A;  2NVT H;  4RG1 A;  4DV7 L;  2UUC Q;  1XNR L;  1I94 Q;  3GDE A;  4Y52 H;  2VQF Q;  4GKJ Q;  1OXS C;  3HOZ G;  5GQO A;  2OQ0 A;  4YY3 L;  2WB1 E;  2QEX A;  2WAQ G;  2Z0S A;  1J5E Q;  1CSP A;  1VQA A;  4DV1 L;  3U58 A;  3F1Z A;  2NVQ H;  3CQZ H;  2LSS A;  3CPF A;  1AE3 A;  1S40 A;  1J5E L;  4KLK A;  1MJE A;  3I2Z A;  2ZJP A;  5M5Y H;  1IBM Q;  1GM5 A;  1PH3 A;  2K52 A;  1XPU A;  1SRU A;  3HKZ G;  2K50 A;  3J7Z C;  5GAE C;  4P73 A;  4PZ6 A;  1E7Z A;  4R4I A;  3ULP A;  1VS0 A;  2K4K A;  2F52 A;  4DUY L;  4DR5 Q;  3S1R H;  1R9T H;  3S2H H;  1X3F A;  1VQB A;  2AWN A;  2YYZ A;  2JEA I;  1VQK A;  2B63 G;  5GAD C;  2Y0S G;  5M3F H;  1A8V A;  3G48 A;  1X55 A;  4JI0 Q;  5IWA Q;  4RMF A;  5C44 G;  1SN8 A;  3RN2 A;  2NN6 I;  3TS0 A;  2HHH Q;  1K83 H;  1PA6 A;  1V9P A;  2PMZ E;  3D31 A;  1XMQ Q;  4DK3 C;  3S24 A;  3EN2 A;  3PUW A;  5E7N A;  3RR5 A;  4A3I G;  4A3J H;  1OXX K;  3F2C A;  4HIO A;  1VQ6 A;  1V43 A;  1W2B A;  3PUZ A;  1IBM L;  4HJ8 A;  4BA2 I;  3RZD H;  2JA6 H;  4LFB L;  4DK6 C;  4BY1 G;  4B3M L;  1ASY A;  5AJ3 Q;  4GS3 A;  4Y7N H;  4DR1 L;  1VQL A;  4BBS G;  3GD7 A;  2RF4 A;  1CKN A;  2PI2 E;  4IJL A;  1HNX Q;  2BA1 A;  5AJ3 L;  3VDY A;  3RZO H;  2NVY H;  3UDX A;  3GTM H;  3S16 H;  1G29 1;  4JBM A;  4DV2 L;  1JB7 A;  3UDG A;  2AWO A;  1HZ9 A;  3FKI G;  4NB3 A;  4DV3 L;  5IY0 A;  4IFD G;  4DV0 Q;  1WYD A;  4HIK A;  3Q8D A;  1SFO H;  3U4Z A;  3KOJ A;  1M90 C;  5C4J H;  2VY3 A;  3F2B A;  4X62 L;  1VQH A;  1YVC A;  1IXR A;  3SGI A;  3J81 c;  4IPG A;  4ALP A;  4LF7 Q;  3H15 A;  4IPC A;  1NMG A;  2CKZ B;  2GN5 A;  1XTD A;  4A4I A;  1Q7Y C;  1L1O C;  5JEA J;  1GD7 A;  3TEH B;  3T1H L;  3NEN A;  2KEN A;  4DKA C;  1XMO Q;  4LFC L;  1PHJ A;  3TQY A;  3T1H Q;  4DV5 Q;  4A3M G;  4YCU A;  1VQG A;  4LF4 L;  3CCU A;  2B29 A;  2ALY B;  1XNQ Q;  3S17 H;  2NZH A;  1X3G A;  4LF6 L;  3CCR A;  4IJH A;  2UU9 Q;  1PYS B;  2ZTD A;  1EYG A;  4JBK A;  5IYB G;  3E0E A;  4UY8 C;  2E8G A;  5FJ8 G;  1HNX L;  2KHJ A;  1AH9 A;  4JI6 L;  1QZG A;  3UE1 A;  5IE8 A;  4QQB X;  3AYH B;  4WJ4 A;  2IHE A;  5C0X I;  2JA8 G;  2IY5 B;  3KDF A;  2YV5 A;  3W1B A;  4BY1 H;  2RHQ B;  3FHW A;  3PUY A;  1K0R A;  5JJL A;  1I6H H;  5FLM G;  1I50 H;  1IBK Q;  4B3T L;  3UE0 A;  4XTC S;  1ASZ A;  4L5R C;  4JI4 Q;  1C9O A;  1KQS A;  1VQN A;  3K7U C;  2PQA B;  3JC6 6;  4X64 L;  1N36 L;  2K14 A;  1TWA H;  1Q82 C;  3S1N H;  1SLJ A;  3M4O H;  2V1C C;  1EUJ A;  3W1G A;  3CP0 A;  2JQO A;  3I4O A;  4R4Q A;  1Q1E A;  1MKH A;  1XNQ L;  3H0G G;  1S72 A;  4JYA Q;  4BY7 G;  3HFZ B;  4JI5 Q;  1O7I A;  4PG3 A;  1X65 A;  4LFC Q;  2QA4 A;  5M3F G;  2HT1 A;  4BBR G;  3F8T A;  3NBH B;  3PGZ A;  5C44 H;  4R4T A;  1PV4 A;  2BH2 A;  4A3L H;  1HNZ Q;  4JBJ A;  2MFI A;  5LMU L;  4A3I H;  2UUA L;  3OTO Q;  2R7Z H;  2VQE L;  5K36 G;  5C0X G;  4B3R Q;  4ME3 A;  2OTJ A;  4JG2 A;  3I55 A;  2A19 A;  3T1Y L;  2OWO A;  4DR3 Q;  4R4O A;  4YCV A;  5IT9 c;  1YHA A;  1B7Y B;  4DV0 L;  4HJ9 A;  4LF8 Q;  1YIJ A;  1BKB A;  1EFW A;  2WB1 G;  1QUQ B;  4DR4 L;  4QIW E;  3CCV A;  1IYJ B;  1S3O A;  1J6Q A;  5IP7 G;  1I5F A;  1L2F A;  1EOV A;  1TWH H;  2GVB A;  4DV7 Q;  2UUC L;  1MIU A;  2BA0 A;  3LGJ A;  3G4S A;  1N8R C;  3CD6 A;  4KHP Q;  4DR1 Q;  3PCO B;  4A3E H;  1E1O A;  3M9B A;  1HZC A;  3DLL A;  4AYB E;  1N34 Q;  1YZ6 A;  2JA7 H;  4A3B H;  2H5X A;  3PUX A;  2Y0S E;  5ELN A;  1UWV A;  1X56 A;  3BZK A;  4UPA A;  4A3J G;  4LF6 Q;  4OO1 G;  4OO1 I;  4DR2 Q;  2UUA Q;  3ULL A;  4AIM A;  4K0K L;  1N9W A;  3H3V I;  4X66 L;  1YHB A;  4LF9 L;  1BBU A;  3KF8 B;  4DV6 Q;  3CF5 A;  3PIP A;  1N33 L;  4LF5 Q;  1HH2 P;  2N49 A;  1K8G A;  4A3F H;  4POG A;  2AKW B;  1JE5 A;  2HIX A;  2IHF A;  2CFM A;  2EXD A;  5LMN Q;  1C0A A;  4GOP B;  4WJ3 M;  4GN5 A;  4A75 A;  1VQ9 A;  1HR0 W;  3M85 A;  1N36 Q;  1TXY A;  4DV4 Q;  1PH5 A;  1P16 A;  2R92 G;  1WOC A;  4OXP A;  3KJP A;  2N8N A;  5FJ8 H;  1K73 C;  2R7Z G;  4KHP L;  2N3S A;  4B3T Q;  4MZ9 A;  3I4N G;  3L7Z C;  2D0P A;  2OCE A;  1U5K A;  4GLV B;  3K7A H;  5IYD G;  1X9N A;  3PIO A;  4A3G H;  3HOY G;  3BZC A;  3K81 C;  3M4Q A;  1FVI A;  2CQO A;  2F4V L;  1YI2 A;  1QVG A;  3L2P A;  4AH6 A;  4BXX H;  4B3M Q;  4DNI A;  3HKS A;  1X3E A;  3U50 C;  1JJG A;  5C0X J;  3T1Y Q;  2UU9 L;  1LUZ A;  5M3M H;  3GTO H;  1LM0 A;  3KF6 A;  4NPS A;  4GLA C;  2PNH A;  4LF5 L;  2ZTC A;  4J15 A;  4JV5 L;  2I5L X;  2FXQ A;  1SE8 A;  4JI8 Q;  3NEM A;  2KHI A;  1HNW L;  1YIT A;  4JI0 L;  3GTQ H;  1WCM G;  2VUM H;  3GO5 A;  2C35 B;  4QJF A;  4XIG S;  3S15 H;  1Y14 B;  1UEB A;  4LUV A;  1NTG A;  1QVC A;  3K80 C;  4X62 Q;  1VQI A;  4OX9 Q;  2UXB L;  4A3D H;  2ZTE A;  4GKK Q;  2Q2I A;  2Q2H A;  3CW2 C;  4DR7 Q;  4YHH Q;  1HJP A;  5GAG C;  1HR0 Q;  3TRE A;  4C3H H;  2ES2 A;  5FLM H;  2R93 G;  1XPO A;  2KBN A;  1QUQ A;  3OW2 A;  3ZJY C;  2E2H H;  2JA5 H;  1UE7 A;  1N34 L;  5IYC H;  1B70 B;  1B8A A;  5IP7 H;  2B3G A;  2N78 A;  1JJC B;  2OQK A;  3HOX G;  1SRO A;  2YU9 H;  4OWW B;  1IL2 A;  3CPW A;  3M7N A;  4YWM A;  3PO2 G;  1Y1V H;  2UUB L;  4BY7 H;  1NE3 A;  1L1O A;  3PF5 A;  4BBR H;  1VCI A;  4NXM L;  3PO3 G;  4JI2 Q;  2YTX A;  4DUZ L;  4HJ5 A;  4DR6 Q;  2JA6 G;  4A3K G;  1I94 L;  1PH8 A;  4HIM A;  2ATW A;  3M4P A;  3CCL A;  3CCJ A;  1VQO A;  5FLX c;  1PYB A;  5IWA L;  1OXT A;  3WWV A;  1K8A C;  4PMW A;  1HR0 L;  2HHH L;  1E22 A;  2EIF A;  3TRZ A;  1XPR A;  3PUV A;  4OX9 L;  2DUD A;  2CCZ A;  2UXB Q;  2IX0 A;  3A5Z B;  3BU2 A;  1YHQ A;  1KC8 C;  1D7Q A;  5BR8 L;  1HNZ L;  3ER0 A;  4GN3 B;  4X6A H;  4C2M H;  2LXJ A;  4A3C G;  2MO1 A;  4IPH A;  1OXV A;  4GOP A;  4R4C A;  3JAM i;  4JOI C;  1GKH A;  5LMN W;  3CCM A;  1SR3 A;  3KLW A;  4JC0 A;  5GRO A;  1YJW A;  4JI2 L;  4L5S A;  4DPG A;  1VQ4 A;  4DR6 L;  4DUZ Q;  1NJI C;  4JOI A;  2Z6K A;  5C3E H;  3HOU G;  2UXD L;  1CKO A;  4NXM Q;  2L15 A;  3STB C;  1VQE A;  4POF A;  4JI3 L;  5C4X H;  1WI5 A;  1UE5 A;  2IT1 A;  3J80 c;  2VNU D;  1KD1 C;  1VQC A;  1IBK L;  2JK8 A;  1A63 A;  3HOW H;  1E3P A;  1DGS A;  1HZB A;  1LYL A;  4JBW A;  3I56 A;  1FJG Q;  2VQF L;  4GKJ L;  4LFB Q;  3A74 A;  4DR4 Q;  1VQ7 A;  5HGQ A;  1KXL A;  4P75 A;  5M3M G;  5IYB H;  2B63 H;  2K5H A;  4KHZ A;  4GN4 B;  1Q12 A;  2K5N A;  4IPD A;  1RIP A;  4DR7 L;  2ZJR A;  3CMA A;  1V1Q A;  4LUZ A;  4YHH L;  1I3Q H;  2WFW A;  4A93 G;  3GTL H;  1VQ5 A;  2Q2U A;  3CCS A;  4GKK L;  1Q86 C;  2I5H A;  2BH8 A;  4UP9 A;  4O2D A;  4APV A;  5JEA G;  4GNX C;  1IBL Q;  5BR8 Q;  4JI7 L;  3GTP H;  1SMX A;  3RLF A;  5LMU Q;  4NXN L;  1FL0 A;  3E9H A;  1PH1 A;  2VS1 A;  4KI0 A;  4LUO A;  4OWX B;  1OTC A;  4DV6 L;  3FP9 A;  1JT8 A;  3NEL A;  1PH2 A;  4LF9 Q;  1Z47 A;  4DR5 L;  2LXK A;  2I0Q A;  2K75 A;  2WAQ E;  2MO0 A;  1YJN A;  1Y1W G;  4YWL A;  3J7A 5;  4X66 Q;  3I7F A;  4IFD I;  5EAY A;  1L1O B;  4K0K Q;  3G71 A;  4UP8 A;  5M5W H;  4IOA A;  3U4V A;  4LFA Q;  4OWT B;  1KAW A;  3GTK H;  1GO3 E;  3I4M H;  1CUK A;  4LF7 L;  4X64 Q;  3BJU A;  2VW9 A;  2UXC L;  4JI4 L;  3K8A A;  1A62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...