4EQNA

Crystal structure of staphylococcal nuclease variant delta+phs v23e/i72k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
b'KLHKEPATLIKAIDGDTEKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23E/I72K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4eqnA00
4J6HA 1KDAA 2F0GA 5DAUA 2F0OA 1KABA 5IGFA 4J1MA 2F0SA 1EY9A 1SYCA 5EGTA 3D8GA 4KJNA 5E3FA 3QOLA 4NDXA 4RKBA 2M00A 2EYHA 2RKSA 4N9PA 2F0TA 4K5XA 5CV9A 5KEEA 3SR1A 2EYFA 5KGUA 2LKVA 5C6AA 3EJIA 1SYBA 3R3OA 3NUCA 1KDBA 2PZWA 3OMGA 1STNA 2EYMA 3NK9A 3HZXA 3MHBA 1EYAA 5C3XA 2F0HA 4EQOA 5CV7A 4KD3A 4ZQ3A 3SK6A 1JORA 2F0NA 5JAVA 4OL7A 4LAAA 2RDFA 5DEHA 4R8NA 4G57A 3T16A 4K14A 5EKKA 3TP6A 1STGA 1A3VA 2EYLA 4F7XA 5KYIA 2F0PA 5KIXA 3RUZA 2F0KA 1EQVA 3ERQA 4KTAA 4PMBA 5I6YA 1KDCA 3TP8A 1IHZA 4NP5A 4K5WA 4DGZA 3OMCA 4K2LA 5J1ZA 5K5PA 3E5SA 3P75A 3BDCA 2F0DA 2F0EA 3ITPA 3QOJA 4PMCA 1SYEA 4PNYA 5CC4A 3NXWA 4WRDA 3D4DA 2F0JA 5IGEA 1ENAA 1EY7A 1TQOA 4H7BA 1JOOA 3SK5A 2KHSA 4YIJA 5E1FA 3NHHA 5C4ZA 2F0LA 3P1HA 4MIUA 2PZUA 1EY0A 1EY8A 4KY6A 3DHQA 2ENBA 2PZTA 3MXPA 1A2UA 4I65A 4IUNA 5IGDA 5IGCA 2F0QA 1AEXA 1JOKA 4S3SA 2EY6A 5IIFA 5CV6A 3LX0A 2F0FA 1TR5A 3D4WA 4QB4A 2EYOA 2EY1A 2PW7A 5IGGA 3SHLA 4HMIA 4B9WA 4ID6A 3MEHA 2PYKA 3MVVA 4ME5A 4QMGA 5CR3A 2F0VA 2F3VA 4E6IA 2KQ3A 4K6DA 4KD4A 2EY2A 5M9OA 4IZ8A 5KYLA 3EROA 1NSNS 1SNPA 5CV5A 1STYA 5NUCA 4DFAA 1A3TA 4KY5A 1F2ZA 2OXPA 2F0WA 1F2MA 1SNMA 3BDLA 3DMUA 3PMFA 5C5MA 5IOCA 1KAAA 3OWFA 1STHA 5HGTA 5J39A 2EY5A 3C1FA 1SYFA 1JOQA 1SNOA 2F0UA 5J22A 4KY7A 1EYCA 1A3UA 1RKNA 3QB3A 3V2TA 5C4HA 1SNQA 3U9OA 5IODA 2QDBA 3SK4A 2OEOA 1EY4A 4ZUIA 1F2YA 1U9RA 3H6MA 1A2TA 1SYGA 2NUCA 4KV6A 4TRDA 5IGBA 2PW5A 4NKLA 4K5VA 3TP7A 1STAA 4QF4A 3NP8A 3SK8A 1EZ6A 5C3WA 5CGKA 4DF7A 4IALA 4HMJA 1ENCA 4ZUJA 2SOBA 1SYDA 4F8MA 2WACA 3SXHA 3HEJA 4K8IA 1EZ8A 3MZ5A 5I6WA 2EYJA 3D6CA 1EY6A 1SNCA 5I9PA 5HURA 5I9OA 2EYPA 1EYDA 1SNDA 4ODGA 4B9XA 4EQPA 4K8JA 1TT2A 5CV8A 4EVOA 4KJOA 4N9TA 3TMEA 2HQEA 4KHVA 5CV4A 4DU9A 4EQNA 2F3WA 2EXZA 2SNSA 5ISRA 2RBMA 3C1EA 5EKLA 1STBA 1II3A 2SNMA 5C5LA 3EVQA 1EY5A 2F0IA 2OF1A 3TP5A 4WORA 3OSOA 4K2KA 3NQTA 5KRUA 5F2DA 4RKLA 3S9WA 3T13A 3VA5A 1NUCA 2O4XA 4NMZA 4HTHA 2PQEA 5JOBA 2F0MA
chains in the Genus database with same CATH superfamily
1K0RA 3GQBA 4OX9Q 3I4LA 3NPPA 2ZJRA 1GHJA 3N6RA 2WAQB 4A3FG 3IAYA 1GUNA 2JYOA 3BZDB 1L2FA 1HNXL 4OEMB 4MTKA 4RGTA 2ID0A 1WTVA 1VQEA 1LT5D 2K32A 2X6LA 2HUGA 1QZHA 2C5CA 4P2CB 1WTXA 1LLRD 4P74A 5FOBB 1PDQA 5JJKA 5GQOA 4K2LA 2NYZD 1OXVA 3CC4A 5C4XG 4F88A 4HSPA 1Y1VH 3AMUA 2JJQA 1A6XA 1BF4A 3TZUA 1JOOA 2MP1A 4WJ3M 3NHHA 3HOYH 1LABA 4X64Q 1LV9A 3TEHB 1Q82C 5FLXL 2PO4A 4BY7H 2J7ZA 2B2YC 4L63B 3E3XA 3J80E 1LT3D 1E3PA 1FJGQ 3H0GH 1FVIA 3DM3A 1D5ZC 4XXEA 2VUMG 4UAIA 3GO5A 4GLVB 1D1IA 3H15A 3CPWA 3OPOA 2WFWA 1CT1D 2ZTDA 2CQAA 4BBSG 4GN5A 2XRSD 1WTRA 1E7ZA 4A3MH 2XWJB 3FHWA 2HCIA 1O7ZA 1SMXA 2BOSA 2RA4A 1GVPA 4M1UB 4DR6Q 1HA5A 1U4RA 2K01A 2N3SA 3T1HQ 4HMJA 3AEVA 3U4VA 4X66Q 4JI3L 1PYWD 1VF7A 3PO3G 3HOZG 3GV6A 1I4XA 4LW1A 3CXCA 1I3QH 1Q7YC 1H95A 1ESRA 3L3OC 1B9MA 4DR5L 5EBCA 3Q0AA 2RVLA 4XTCS 4LNQA 2JA8B 4JI2Q 4B3SL 1E22A 4XIGS 4OWXB 2AQ3B 2K52A 4IFDH 3F2CA 3G71A 3U50C 2F0GA 1CTMA 5IGFA 2OTLA 1PFMA 5LMNW 1VQGA 4A3DH 1I4HA 3K80C 3KLSA 5IE8A 2JQOA 1Q8IA 3SVMA 4HIKA 4JYAQ 2A8VA 1JE5A 3AYHB 4A3LH 1HFNA 4FXGC 2O5JC 1DM0B 4OO1G 3J81E 1BCPF 4QIWE 3HOYG 2EYLA 4FNFA 1B2TA 4JBMA 3IL8A 3PSIA 1IHZA 3TDQA 1I5FA 1S4ZA 2XTIA 2SEBD 3RLNA 1RCVD 3KK7A 1QVFA 3HOXH 1W6KA 3AU7A 1KHIA 3SK5A 4OO1I 2VY3A 2KVMA 3A5ZB 4JG2A 2NVTH 2B2VA 1X3FA 1QOHA 4ZCKA 1ZXTA 5D3IB 5C44G 1RHPA 2EY6A 2MJ8A 3D4WA 4B08A 2EY1A 4UP7A 5GADC 5ELDA 1EIHA 1YIJA 2LFNA 4ME5A 1N32Q 3HKZE 3M4OH 4A3MG 5JEAH 1TIID 2E8GA 1HZ9A 4P72A 4IZ8A 5M9OA 3T1YL 2PPBC 4BXXG 1GHKA 1STYA 1A3TA 1SLJA 1E1OA 4JBWA 4NXML 2AMCB 4FF1A 2UXCQ 3CU7A 1EQQA 4CHTB 1WOCA 1Y8OB 4P71A 4IOCA 4HJ8A 3GTQH 2Q2UA 3H6MA 2JA9A 2O2LD 1TWGH 2CCZA 2HCCA 4X3TA 1IYVA 4LMQD 3K8AA 3STBD 4A3CG 2UUAQ 3WWVA 4Y52H 4AQYL 4JI6Q 2CKZB 2OCEA 1HXYD 4L5TA 3MFYA 1XMOL 1HUMA 3GTMH 3MAQA 1V1QA 3PQIA 4B3RL 1LTLA 2P5ZX 2F03A 5EPJA 2H5XA 4LWCA 1XPOA 4IPCA 5K36H 2TSSA 4FF4A 4ALPA 3NEMA 2MUYA 3CC7A 4DUZQ 2M00A 1DOMA 2FXQA 2VW9A 4A76A 4V190 2JA6G 3PCOB 1V43A 3S2HH 4C3JB 1IW7D 1LTGD 2Y0SG 4K0KQ 2J4XA 1F77A 4RCNA 3H3VH 3VA7A 4LF9L 4KD3A 4ZQ3A 3SK6A 2CH4W 2G9DA 5IP9G 5JAVA 4OL7A 3DEOA 3T16A 4H13C 1JT8A 3RUZA 3MTSA 1EOVA 2K6AA 1I94Q 2CQOA 2ALYB 2PI2A 3UDIA 4RHSA 1C48A 1CKNA 4CJ1B 4DR4L 3DM1A 4JI3Q 3EA6A 1HZCA 2R7DA 5CC4A 3ND9A 1HNWQ 1PFNA 1Y8NB 3RN2A 1OO9B 4RH6A 3F2BA 2KEDA 3ICEA 3RZDH 4A3BH 1LTSD 4CJ2C 4LFBQ 2KCCA 4LUVA 1I50H 1AEXA 3GD7A 2OT2A 2Q2HA 4S3SA 4ZLTF 4JI7L 1CQFA 1GO3E 2Q8TA 2PQAB 1Q8KA 1UAPA 3NELA 1TVXA 1PH3A 2VZAA 1HHVA 1E0BA 5CR3A 5KEEA 1WTWA 2L4NA 3OHXC 2KEEA 4DFAA 3I73A 4UY8C 1JICA 2UU9L 1EIFA 4TKOB 1M4VA 2UUCL 5H1SE 2WKCA 2EY5A 1SNOA 1HR0Q 5J22A 1Q46A 1VQFA 4C3IG 3URYA 1XXGA 4A3EG 1EIGA 1SE4A 2XSCA 2EJMA 1A2TA 5LMNL 4R1JA 4R4QA 1XPUA 3MXNB 4NKLA 2E5LL 2DNEA 1HFGA 4QF4A 5C4XB 1F9RA 4JI0L 5E7NA 3I4OA 2BCOA 1QJOA 5FKAC 1TWHH 5K36G 2KCMA 3S1RH 4O2DA 3A0JA 1MIUA 2L55A 2DY8A 5M5YH 2K50A 5JVH3 1IL2A 3C1EA 1C0AA 3CPFA 1PMRA 2UUBQ 3WOEA 1YNJC 4FO2A 4X62L 1PTOF 3PUZA 5C0XG 1L0XB 2OQKA 4OONA 4BBRH 2EJFC 5ELBA 4DPGA 3KBXA 1HZAA 3CQZB 4A3KB 4BBSB 1DOKA 2HD3A 3M4QA 3VR4A 1LYLA 1PFBA 2QA4A 5EGTA 5E3FA 3P20A 4GLXA 4J15A 1S3OA 5FLMH 1F9SA 2WB1E 3ULJA 3H94A 4IOAA 2CW0C 5C0XI 5EQ0A 1YHAA 1O7YA 1XNRQ 2B2YA 2IT1A 5M5XH 3PV0A 1LTTD 3HOZB 1Y1WH 2K7VA 3Q24A 2F4VL 1JWMD 1T9HA 2VQFQ 2D0OA 1G6PA 4EX5A 1DOLA 1GUSA 3G6EA 3ITPA 1IZ6A 4RWSC 1CI3M 4QUFA 2IHEA 1TQOA 3UE1A 3FPUB 1VQHA 4O1NA 4UP9A 4JI5L 5FLXE 5KNDA 3GTKH 4G7OC 2D9UA 1LM0A 3ER0A 2ZT9C 4RHRA 2NVXH 1E2ZA 4PQXA 3MEHA 4OHJA 2WIIB 4IO9A 3DWQA 1F2ZA 5C5MA 1Y1VB 3TBIB 1JWUD 4BWGB 1SR3A 3C1FA 2H1EA 3HOYB 2UXDQ 3CCRA 3CCVA 2EIFA 3L7ZC 4FXKC 4BY7B 5LMUL 1F2YA 2EOTA 2F3IA 4PZ7A 2ZTEA 3NP8A 5D65A 2I5HA 1UWVA 5C3WA 4OX9L 2ICEC 2E2HH 2NTTA 2JA8G 3K7AH 1X3QA 1B7YB 1D5XC 1SE8A 1Y8PB 4RGMA 4BBRG 2WINB 4A3GH 4G4KA 2EYJA 5I9OA 1C4QA 3BDOA 1J5EL 4R4CA 2QGQA 1N34L 1JQYD 3PF4A 1Q12A 1II3A 2V1CC 4A3MB 1ZEQX 3S14H 1PXUA 4JI7Q 1EWCA 4NMZA 4HTHA 5EAYA 4DA2A 1DXMA 2F0MA 4J6HA 2L0CA 2AWNA 5C0XJ 2A6EC 5CORA 4K5XA 5CV9A 1I3QB 5ELEA 1C9OA 3GTGH 3BYTB 4X64L 2LKVA 5C6AA 3K58A 1SYBA 2JN4A 1VQOA 2XIWA 5T1IA 1NMFA 2DNCA 1VQ6A 3A8KE 2K33A 3NBHB 2IX1A 4KHPQ 4XYQA 4R8NA 3ERSX 1CHPD 3L0OA 2B2TC 4PZ8A 4L5SA 1FJGL 5LMNQ 3M3YH 1TWCH 1WTOA 1M8AA 4I7ZC 2VQEL 1G2TA 3OMCA 2L5TA 3BDCA 2JEAI 3AFPA 3GTPH 3OW7A 5I2YA 1BXTA 4QIWB 4A3DB 5IP7H 1R4QB 4IPGA 3J81j 2E2IH 1A63A 1KQSA 2ZXPA 4YY3Q 4KY6A 4TVAB 1PH7A 1K28A 2LY7A 4YWMA 5CYUA 1ZYRD 3K81C 5CV6A 4DR6L 1TR5A 3JC66 1L0YB 5D3DA 1EWHA 1H9MA 2Y0SB 2EXDA 2R6GA 2OXPA 3HOXB 1KAAA 1B8AA 2R3ZA 4QY7A 4DUYQ 1G8ZD 4LF7Q 2NVTB 3HKZB 3V2TA 4JI2L 5I4DA 4A3GG 3OTOQ 3C46A 3S24A 2NVYH 3OW2A 3S2DH 3SK8A 1PTOB 3A8JE 1SMYD 1S72A 3VR3A 3M4OB 4F8MA 3FVQA 2WACA 3VYRA 1UUPA 1SAPA 4FXDA 4PZ6A 2IPKD 1G2SA 1RL2A 4LUOA 3BJUA 2EYPA 4DR3Q 4K8JA 2NN6G 4N9TA 4JYAL 4EQNA 5ISRA 4JI5Q 3M4PA 4DK3C 4HCEA 3PUWA 4WORA 1TWGB 3I55A 1VQMA 3CCSA 1TS5A 4HN7A 3QO2A 4DAMA 1J9OA 2YTVA 4C1NK 3D31A 3KDFB 4AH6A 1KABA 3D8GA 4RCOA 2F0TA 3HOUH 2RSOA 4H44C 2RCNA 3TRZA 1DGSA 3GTMB 2DJGC 4RGNA 4JBKA 3NK9A 3PUXA 3PO2H 3MHBA 1SEBD 4YCUA 2X69A 1LTAD 1OXUA 1CA6A 2FINB 5EKKA 5LL6S 1FGBD 2F0PA 2JSOA 2ZTCA 1N32L 2A6HC 1CFMA 1EIYB 2JK8A 2A69D 3QG1A 5K5PA 4PNYA 1XMQQ 1UE6A 3KLRA 3S2HB 4KN4C 2KHSA 3VR5A 2UXCL 2PZUA 1EY8A 1J5EQ 2PZTA 1N34Q 3PIP3 5IGCA 4B3MQ 1DZ1A 3NBIA 1LTRD 1PHJA 3S1QH 2CVRA 3R2TA 1I4QA 2ZXOA 2Q2TA 1EOTA 2UUAL 1QVCA 3QJYA 3S17H 2F3VA 2IX3A 5FJ8H 3PIOA 4FP5D 1PTOC 1Z47A 5M3FH 4JI6L 3F2DA 1ESFA 4MNOA 1OXXK 2QEJC 1BCPD 1NAPA 2L11A 1CKOA 4A3BB 1RIPA 1NY4A 3I4MH 5IYBG 1MGSA 1I50B 5EPLA 1WVLA 4IUUA 1VQ9A 4BY1G 4JC0A 3BVGA 4AYBE 2LXKA 2SOBA 1N36Q 4DUZL 4N8X1 1T5EA 2V4DA 2AHOB 2VQEQ 2NZ1D 4K0KL 2LXJA 4A3KG 4H0LC 2G5DA 2RCFA 2Z8LA 4Z9CB 2SNMA 4LF5Q 4PMWA 4Y7NH 3CRKC 3ULLA 4RKLA 2B39A 3I90A 4APVA 1I94L 3PO2G 2PQAA 5DAUA 2F0OA 1HNWL 2EYHA 1TWHB 2BE5D 2EYFA 3S1RB 4ZYSA 1QVGA 2YTXA 3VYUA 3R3OA 2PZWA 1QNUA 3F2UA 1K83H 4LFBL 2K14A 3A55A 1RODA 2I0QA 5M5YB 4HSVA 2AUJD 2Z4HA 3K5OA 2B2UC 1R9TH 3I91A 3H3VC 2XGTA 5HGQA 3HP3A 2UXBQ 1JR0D 1P16A 4BBRB 1TS4A 1KNEA 2HT1A 5C4JH 4JVZA 2RQXA 4DV3Q 4Q0FA 3MXNA 4DR1Q 1X65A 4WRDA 1WFQA 2PI2E 1EUJA 4KKTA 3HOVH 1HR0L 3CCUA 1OXTA 2BH2A 3KF6B 2KENA 1F9PA 2K5QA 1CSPA 3CD6A 1Y1VG 4ME3A 5M5XB 4GOPB 2B8GA 3KJPA 1Y1WB 1B3AA 4JI8Q 1QILA 5BN4A 2VB3X 4M8AA 1AW7A 4K6DA 4BY7G 3BZKA 4QQBX 3HG9A 3VR6A 4H02A 5J3BA 1SNPA 5FLXc 3CCEA 1AE3A 4OGQC 2AUKA 2XNAC 3PMFA 1CZGA 2FMCA 3H0GG 3MA2B 2H4OA 1ET9A 2I46A 1S5DD 3FP9A 1GUOA 1KNAA 3O13A 1SNQA 2IWHA 3U9OA 4HIOA 2QDBA 2UUBL 3EN2A 3UDFA 1U9RA 5IWAQ 1SYGA 4TRDA 1VQNA 1GXDC 4DV1L 3G6JB 4TSSA 4UP8A 1LO5D 1FGUA 1BBUA 2NVXB 4ZUJA 1PA6A 3SXHA 1N9WA 3HEJA 4X3SA 1K8GA 4OWTB 4R4TA 3MWYW 3R8BA 1TT2A 3SDZA 2F4IA 1HA6A 1HNZQ 1XNRL 2EXZA 3W1BA 1HQRD 1BUVT 1YBYA 1I4PA 1YHQA 3HOWH 3OSOA 2B2TA 3T13A 1NUCA 5HY6A 3I72A 2VQFL 3Q6SA 5DM73 1WJJA 1ILQA 1AP0A 2E2HB 1MJCA 1V1PB 2JEBI 3K7AB 2RSNA 2HIXA 4JBJA 4A3GB 5ELNA 4IJLA 1SROA 2K4KA 3DWAA 5KGUA 4IFDG 1E1TA 2N88A 4V0BA 4HJAA 1Q1BA 3SGIA 1G51A 1STNA 2EPBA 3Q8DA 1UNSA 1W6JA 1YHBA 3SE0A 3CRLC 4A3DG 1EQRA 2Q8IB 4F7XA 3JAMi 3S14B 5KYIA 3ERQA 3T53B 4DGZA 4GOPC 4IFDI 3OIPA 1G291 3OYYA 4A3LG 4FVMA 5IYCH 1I6VC 1ML0D 3D4DA 1VQ4A 3GTGB 1EEFD 3CF5A 1S40A 1Y69U 1UEBA 2UXDL 4XT3B 3MXPA 3PUYA 4JOIC 5A35A 5IGDA 1VQ7A 1XWEA 3HOXG 4DAYA 1PH2A 1XPRA 5IGGA 3M3YB 1TWCB 3HKZG 4HMIA 4B9WA 4E6IA 2BA0A 2PYKA 4PG3A 1H9RA 4CKCA 4A3IH 4NB3A 1HTLD 3RLOA 4CDDC 2E74C 5NUCA 2PMZE 2KCTA 3LGJA 3GTPB 5GROA 5HGTA 2E2IB 1FD7D 3K0XA 2ATWA 1YNNC 1PRTB 2DY7A 1EYCA 5G3LF 5JEAG 3KF8B 1FNUA 1EY4A 2B63H 2WAQE 1U4MA 1M1KC 3NBHA 4IUPA 1VQ8A 3TQYA 3M85A 3CCLA 2MHVA 2Z0SA 4JPBW 1IBKQ 3HOWG 2IJ0A 5IT9L 3D6CA 1HZBA 5JPMC 1FNWA 2AQ1B 1EYDA 1SNDA 4ODGA 3KBGA 1IBMQ 3DUZA 4YCWA 3K59A 1PH6A 4KHPL 4A93H 1OTCA 2NVYB 2NBFA 4JI4Q 2NWGA 3S2DB 2IHFA 1S5CD 4ZUIA 4GZYC 1D7QA 1XTCD 2CH4A 1GKHA 1MKHA 5JJZA 4HJ7A 3L2PA 4KJNA 4NDXA 4DK1A 1PLFA 2I5LX 5T1GA 2MPMA 5EJWA 4BY1B 4YY3L 1Z9FA 2E2DC 3BU2A 1H9SB 4C3HH 1SE3A 5IYCG 3V96A 1UE1A 2ASBA 1VQJA 3BVMA 4IFDJ 1K73C 1WD1A 2R92H 1MI2A 4K14A 1STGA 2I07B 3J80L 4NW2A 3HKSA 4U673 4DV1Q 1EQVA 3ONAB 4KTAA 5IY0A 1SN8A 1G91A 2R7ZH 4IN3A 3MXGA 5JJLA 3E5SA 1VQCA 1WI5A 4KKSA 4NXNQ 3A74A 4OELB 5FO7B 4XQQA 5TSSA 5C4ZA 5E1FA 1GM5A 3HOUB 3KUPA 4DUYL 4ULLA 4LF7L 2IL8A 4MIUA 4U68A 1U4LA 1MD2D 4A3JH 4DR7L 3PO2B 1A2UA 1X3EA 4YHHQ 4G7ZC 4F87A 3OTOL 3H3VI 1JOKA 1PRTC 3M7NA 4WFN3 3E6ZX 2Q2IA 1B3QA 1TU2B 2A68C 3IRBA 3UI2A 4UPAA 2K5NA 4A3BG 3CC2A 2PNHA 4L8JA 4QMGA 2F0VA 3EBEA 2ZJQA 5BR8Q 1YEZA 5GAGC 3EROA 4DXFA 2YU9H 1SNMA 4DR3L 2F52A 4IPHA 1K8OA 1SJHD 4LFAQ 1K0SA 4GN3B 4C2MH 4POFA 3FMCA 5FK9C 4C56C 1TXYA 2OEOA 1PYSB 1VQBA 4PV1C 4QL5A 4LF4Q 4DV2Q 1CUKA 4CBVA 2GVBA 3S1QB 4CKBA 3GTJH 3TS0A 1S5BD 1P8LA 2PW5A 1M90C 5JEAJ 2FMMA 1SXTA 1WCMH 3I4NH 2HHHQ 3S17B 1UE5A 1HRJA 1IXRA 5M3FB 1KXLA 5A2QL 1EZ8A 3I70A 1S5FD 4MHEA 2A19A 5I9PA 3W3AA 4DV0Q 4DV5Q 1XYIA 5IYDH 5EKLA 2OWOA 3I4MB 2B2UA 3TP5A 1A15A 4GS3A 3JAML 5BN3A 4K2KA 1CM9A 3NQTA 5F2DA 1L0WA 4FF3A 4C3HG 3S16H 5JOBA 5KNCA 3H0GB 1KDAA 3HRZC 3P7JA 1EY9A 1XMQL 1BKBA 2WB1G 2R92G 3NE5B 1BBXC 1J8IA 2K28A 1JCKB 3DLLA 2IY5B 2EYMA 4B3ML 4HEDA 1HTPA 2XVSA 3RR5A 4HCSA 5FLMG 5M5WH 3V05A 4LUZA 4Y7NB 5EBDA 5L37A 4Q5VA 2VB2X 2RF4A 1ASZA 2N49A 1LUZA 3RZOH 2NVQH 1Q1EA 2ZXRA 3T4AC 3K7UC 3P75A 2F0EA 4OIJA 4HIDA 3NXWA 1Y1WG 1PYBA 1X54A 3P1HA 1F9QA 4ZKCB 3CMEA 1K83B 3DHQA 2ENBA 3H09A 4JV5Q 1W2BA 4DV4Q 4QJFA 4O0AA 1R9TB 1ILPA 4QB4A 1EWIA 1JMCA 1TS3A 2BH8A 5GAHC 4ID6A 1N36L 3RLFA 2SDFA 4L6TB 1X56A 1W3SA 4MZ9A 2RDGA 2CHBD 3J7A5 3AB9A 3WOFA 1N8RC 2F0WA 4C3JH 3IKJA 2MO0A 1RDPD 1SYFA 3HOVB 2F0UA 1RKNA 1X32A 1NR4A 4IQZA 2K04A 5IODA 3K5NA 4LF5L 1EL0A 4JCVE 2KHIA 2QF7A 2KBNA 2OQ0A 1EU3A 1YJNA 1CQVA 1D6EC 1LACA 3T56B 1X9NA 2NB0A 2QKIC 4K8IA 2I5MX 3JAMc 3PF5A 4CKEA 4EVOA 4O42A 1U5KA 1E2VA 2R93H 1AE2A 2HQEA 1K8MA 2F3WA 4RMFA 4N8FA 4DR7Q 5C5LA 1TWFH 2E75C 2UXBL 3KF6A 4A3FH 1YNJD 1XTDA 3VYSA 4DV3L 4DN4M 4X6AH 4DR1L 4GOPA 4POGA 4J1MA 3J7ZC 4I7AA 1QG7A 3TZDA 1SJED 3C3LA 3BS1A 3B6YA 3ULPA 1V9PA 1ICWA 4CJ0B 1BBWA 3D4RA 3L9AX 2CW0D 1S5ED 4JOIA 3KLSX 4R4IA 5AFWA 2FFKB 2RDFA 3GTQB 3HOWB 2K1BA 4JI8L 2QW7A 4RA8A 1C8CA 4PMBA 5I6YA 3NTHA 4K5WA 4NPSA 1LT4D 1PH9A 4LF8Q 5D14A 3LWUA 5FO9B 1B50A 3FDTA 4GNXB 1JJCB 4YIJA 4ILWA 1PH1A 2Z6KC 5AJ3Q 2VUMH 3MEFA 5IWAL 2ZM6Q 3LX0A 4UDUC 2F0FA 5IP7G 1CHQD 3RNUA 1VQKA 2EYOA 2PW7A 2KUMA 4IPDA 1ET6A 1BO0A 3MVVA 1VQPA 2EDGA 3I8ZA 2KQ3A 1XNQL 2PNRC 2BDNA 4K6LA 1I6HH 1NSNS 2CWAA 3FPPA 2RDHA 1F2LA 1F2MA 3DMUA 2ICIA 3GTOH 1V1PA 4DK0A 3OWFA 4DV7Q 1EQTA 3FRPB 1EYGA 1HJPA 2JA5H 1HNZL 3OWEB 4KHZA 2JE6I 4KY7A 3QB3A 2DUDA 3PO3H 3BG3A 4KV6A 2TMPA 4K5VA 3STBC 1B70B 2MQHA 1Y14B 1VMCA 1LT6D 4IALA 2QEXA 1X3GA 5IT9E 3GTLH 4A3IB 2XRQD 2PCFB 2R7FA 3K5MA 4GN4B 2FHTA 1EY6A 2MFIA 1B1ZA 4EQPA 4DK6C 3G48A 1L1OB 3SEBA 5COYA 3TMEA 4DU9A 1XX8A 3RZDB 4C1NI 3NTIA 1WD0A 1VQAA 2F0IA 2B63B 4IUQA 1BOSA 3E9HA 1UEAB 1BVSA 1O80A 2PQEA 1VMPA 3LWEA 1QUQB 1PH5A 1JJ2A 4WJ4A 2K5WA 1IW7C 4ZKBB 2N78A 4OO1H 3SR1A 2A6ED 1PRTF 2AKWB 4J8QA 4ZRZA 3CCMA 3PGZA 2D5DA 1B53A 2DN8A 4X65Q 4GNXC 4KI0A 3WDNA 1V8QA 4EQOA 2RHQB 2J0TD 3S1NH 3TS2A 4A93B 4LAAA 1OXSC 2EZVA 3HOUG 3KF8A 2QILA 2OTJA 1EEID 1FNVA 2D62A 1N33Q 1TY2A 4XYOA 4HJ9A 3KOJA 4RG1A 5J1ZA 4PMCA 2F0DA 5C44H 1SYEA 4KKUA 1Q81C 1ENAA 1GOZA 4ABNA 5C3EH 1DJRD 4CDEC 2KECA 4C3HB 4MN3A 1LTBD 2YV5A 1PZJD 3J7AF 4BXXH 4P75A 5IIFA 2WB1B 3X3MA 1BNZA 2R92B 1NR2A 1IKLA 3CP0A 2JA5G 3K57A 3SHLA 1IBKL 3NTKA 3IFDA 1KTKA 2R7ZB 1JE4A 1Q3LA 1KRSA 1SRUA 1TS2A 1PVOA 1A0IA 4KY5A 2Z9HA 1STHA 5J39A 3NWTA 1IBML 1MBYA 5FJ8G 4A3JB 4A3CH 2VL6A 5M3FG 4DR2Q 2Q8RE 1L1OC 1H9SA 4JI4L 3PIO3 2VNUD 4AYBG 1CA5A 3CW2C 2WV6D 3J80i 3UDGA 1VCIA 3I4MG 5A2QE 1SYDA 1TWAH 3QR8A 2EE1A 4GKJL 3J7YW 4FDBA 2KCNA 4ZK9B 2YU9B 4DV6Q 4IUVA 4DNTB 4YCVA 3DXJC 4C2MB 4LFCQ 2C35B 4JI1Q 1ENFA 3JAME 1STBA 2YTYA 2NTSA 1FL0A 3A54A 2KOLA 4DAPA 3EVQA 3GTKB 3HGBA 2M2LA 3CAMA 3GTJB 4LF6Q 5KRUA 2JA6H 1IL8A 2N55A 1MHWC 1IBLQ 1WCMB 4RFBA 3I4NB 5G3LD 3S1MH 1JJGA 2WKDA 1SYCA 1ICFB 3KLWA 1SFOH 4NXNL 4RAUC 1XNQQ 4XDXA 2E76C 4N9PA 4A4IA 5IP9H 1WTPA 3OIQA 1K3RA 1MSHA 3OMGA 2Y0SE 4YHHL 1SDFA 3RMHA 5C3XA 2MO1A 4R4OA 5M3MH 3OOCA 4GKKQ 5EKIA 3TP6A 5C3EG 3HFZB 3LNNA 1PTOH 3I2ZA 1YITA 3A5UA 1NBWA 1KC8C 1KDCA 3RD4A 3S16B 4NP5A 5BR8L 1B44D 5BN5A 5LL6X 1A62A 3GP7A 4QUCA 1SSOA 2A6HD 4L5RC 4AIMA 3TSSA 1EY7A 4LFAL 4P73A 4XT1B 1J6QA 3M4YA 5I2XA 3K5LA 1HNXQ 1EY0A 1CZWA 3GV3A 1K9MC 4OIKA 2B29A 4I65A 2K05A 4LF4L 4DV2L 2CFMA 5M5WB 1IKMA 2ES2A 2X6GA 2MGSA 3HOVG 3J81i 2HHHL 3FKIH 3RZOB 4HR7B 2NVQB 4KD4A 2GA4B 1GD7A 4C3IH 5ELOA 4A3EH 4XQJA 1KD1C 1VQLA 4DV0L 5IOCA 1BDOA 1PTOD 5GAEC 4DV5L 5FO8B 3IFTA 5JVG3 1A8VA 4CGYB 3E0JA 2Z4IA 1CSQA 1Q86C 2WP8J 1MSGA 2NUCA 4CDFC 4QCLA 2QDLA 1QNKA 1STAA 3S15H 3Q23A 4G7HC 4X3KA 1EZ6A 2JA7H 1U4PA 3VYTA 1VDZA 4RGOS 4DF7A 2E2JH 1RF2D 5ELCA 3EQLC 4X3UA 4YWKA 2Z1CA 1ONLA 2DJFC 3I56A 3MZ5A 1PV4A 1SNCA 5C0XH 3QIAA 2A73B 3AFQA 4B9XA 3I7FA 2VXWA 2KHJA 5CV8A 4ZAIA 1UE7A 1KAWA 2L1BA 1EY5A 2IW3A 3G4SA 1CKMA 4HAEA 5M3MG 1FYCA 1PZKD 3U58A 3W5OA 1KL9A 1EFWA 2F1MA 2L9HA 3TN2A 3CCJA 3AQQA 1KDBA 4DR5Q 1KIXA 2Z6KA 2R93B 4JV5L 3HZXA 4DV4L 1EYAA 2LSSA 5CV7A 1Z7TA 4YWLA 4MTNA 2R61A 3KYHC 3TREA 1TWFB 4B3SQ 2LS01 2B2WC 3A56A 4KMUC 4A3FB 2F0KA 1GUGA 3BVZA 3TP8A 1K8AC 3Q22A 4JW0A 4TQUS 2AQ2B 3VR2A 1DYQA 1IYJB 5IGEA 1WTQA 4GKJQ 4H7BA 3A7LA 4LK1C 3FKIG 1ZYRC 1PH8A 3W1GA 4DAVA 1WYDA 1JC7A 2N8NA 1VQ5A 2M9VA 1NMGA 3KJOA 2XWBB 1YI2A 1JB3A 4EQ5A 2XN9C 2JA7G 3W2DA 2K5DA 4OWWB 4XQNA 4LJZC 1QCBD 4DNRB 1JOQA 3I3CA 1A3UA 2BDOA 2VUMB 2GVAA 3M9BA 1GJXA 2JA8H 4A3IG 3SK4A 2WAQG 2K5VA 2KA7A 2KJXA 2RHSB 4CDCC 1SMYC 3C2PA 1GUWA 1WTHA 3TP7A 2A5HA 2JP1A 1DONA 1BCPB 1RTNA 1HQMC 2L15A 5CBEE 5JPNC 2B63G 1I6HB 3T1YQ 3KDFA 3GTOB 4NXMQ 1RTOA 4FF2A 5KNBA 1HUNA 1EU4A 1O7IA 2JA5B 5CMDA 4KJOA 4KHVA 4GNXA 2EVBA 4DKAC 4BA2I 2ZJPA 3PO3B 1E24A 2K5HA 1JB7A 1AFPA 5IT9c 4BS9A 1T5XD 1AZPA 2YYZA 4LF8L 2F0SA 3MC0B 3QOLA 2FJ2A 4A93G 3GTLB 4AQYQ 1EFID 3ZJYC 4UHVA 1XMOQ 3EJIA 1LTID 4AYBB 3NUCA 5AJ3L 1GUTA 1I4RA 4B3RQ 3M7GA 1H9KA 1VQDA 2ZM6L 1JORA 2D0PA 2F0NA 2K75A 5DEHA 4G57A 1MJEA 3J81L 2A69C 4KK7A 1DD2A 4R9WA 1JWSD 3X3NA 3QOJA 1YNXA 2Z6BA 2BA1A 1V1OA 2F0JA 4DV7L 2F0LA 3D0FA 3J80c 1X3PA 2EJGC 4BA1I 2R7ZG 3NENA 1AZQA 1C7YA 1B4OA 4LF9Q 1L1OA 1RD9D 3S1NB 3BYYB 4B3TL 1IYUA 3A8IE 4A3JG 1I4GA 1Z6HA 1XJVA 4HJ5A 1TY0A 1BCPC 2EY2A 5KYLA 3J7AV 3E0EA 5C44B 4DR4Q 1QUQA 3BDLA 1QE6A 5C3EB 4IUTA 4DAYB 2B2VC 1KLGD 3D3RA 2K03A 5C4HA 4IURA 1YNND 2A1AA 3DEPA 1VF5C 1CKNB 5DNFA 1QZGA 2NN6H 1HPCA 5C4JB 4EGVA 3KFUA 3PUVA 5ELFA 5I6WA 2QCPX 5E4XA 5HURA 2HDMA 3R2IA 2UU9Q 2UUCQ 2G9HD 3CMAA 4X65L 1WCMG 3F1ZA 3I4NG 3H91A 5CV4A 2NZHA 2O5IC 1SBBB 2RBMA 2VS1A 4JK1C 5CBAE 4GLAC 2OF1A 4R8IA 2HIVA 1YJ9A 1AN8A 3VA5A 2O4XA 2E5LQ 3CKIB 5IYDG 1N33L 3UE0A 2A74C 4JI0Q 3N52A 2AWOA 2BE5C 2B3GA 1TWAB 1VS0A 3FEWX 2JXMB 4RKBA 3ZYYX 2RKSA 3RN5A 3K6OA 3VDYA 1O78A 2L12A 1YJWA 1D8LA 1DCZA 2CWPA 3J81c 4HIMA 1KLUD 2GN5A 4IJHA 2LMCB 2MNAA 1NNXA 1NCVA 1BQQT 1PH4A 1PFSA 2F0HA 1D5MC 2EQSA 3F8TA 3D6WA 4X62Q 2JA6B 1A3VA 3DWPA 4WJWA 3T1HL 5KIXA 3PIPA 2D2CC 1D2BA 4KN7C 2DGYA 4X66L 4FYDA 1E2WA 2C9OA 1YVCA 3S1MB 1SFOB 1FR3A 3NQIA 3EFXD 1R4PB 1TKWB 4L5QA 1H9JA 3K0YA 4DNIA 1YZ6A 4DR2L 1QWYA 4IUNA 2F0QA 3A7AB 1X6OA 5M3MB 1HR0W 5LHY1 1CK1A 5C4XH 1PRTD 2F4VQ 1HH2P 2A68D 4DXGA 1G6ZA 5IYBH 1KRTA 3MFGA 5CV5A 3R93A 2B8FA 1QB5D 1SE2A 3QWNA 4DV6L 3GDEA 4KLKA 4BY1H 3ND8A 1NJIC 2NZOA 4LFCL 4OXPA 1O7LA 3U4ZA 3EIVA 4JI1L 1BR9A 5E4WC 3HS0C 3E9IA 5DLQE 4LF6L 1X55A 4C3JG 1PZID 5IGBA 1NE3A 3NSWA 3MXUA 3UDXA 3U9SA 5EPKA 5CGKA 4A75A 1AH9A 3CQZH 4A3KH 3CCQA 1IBLL 4BBSH 1ENCA 2NN6I 3FKIB 1STEA 1ASYA 1Q90A 3T51B 4C3IB 4A3EB 1K3BC 1D1KA 2IX0A 1ZKOA 2HDLA 3BZCA 1HCZA 1U0LA 2SNSA 4GKKL 1VQIA 1RJTA 4QGUA 1NTGA 2HQLA 2PMZB 5LMUQ 3HOZH 1B9NA 5JJIA 3NWSA 3CHBD 3S9WA 5DM63 2B2WA 3S15B 4B3TQ 3G7LA 2JA7B 2R93G 2E2JB
chains in the Genus database with same CATH topology
3GQBA 3I4LA 3NPPA 1GHJA 3N6RA 2WAQB 3IAYA 1GUNA 2JYOA 3BZDB 4RGTA 2ID0A 1WTVA 1LT5D 2K32A 2X6LA 2HUGA 2C5CA 4P2CB 1WTXA 1LLRD 5FOBB 1PDQA 4K2LA 2NYZD 1OXVA 4F88A 4HSPA 3AMUA 1A6XA 1BF4A 3TZUA 1JOOA 2MP1A 3NHHA 1LABA 1LV9A 5FLXL 2PO4A 2J7ZA 2B2YC 4L63B 3J80E 1LT3D 1D5ZC 4XXEA 4UAIA 3GO5A 1D1IA 3OPOA 1CT1D 2CQAA 2XRSD 1WTRA 2XWJB 2HCIA 1O7ZA 2BOSA 2RA4A 4M1UB 1HA5A 1U4RA 2K01A 4HMJA 1PYWD 1VF7A 3GV6A 1I4XA 1ESRA 3L3OC 1B9MA 5EBCA 3Q0AA 2RVLA 4XTCS 2JA8B 4XIGS 2AQ3B 4IFDH 2F0GA 1CTMA 5IGFA 1PFMA 1I4HA 3KLSA 1Q8IA 3SVMA 1HFNA 4FXGC 2O5JC 1DM0B 4OO1G 3J81E 1BCPF 2EYLA 4FNFA 1B2TA 3IL8A 1IHZA 3TDQA 1S4ZA 2SEBD 1RCVD 3KK7A 1W6KA 3AU7A 3SK5A 4OO1I 2KVMA 2B2VA 1QOHA 1ZXTA 5D3IB 1RHPA 2EY6A 2MJ8A 3D4WA 4B08A 2EY1A 5ELDA 1EIHA 2LFNA 4ME5A 5JEAH 1TIID 5M9OA 2PPBC 4IZ8A 1GHKA 1STYA 1A3TA 4JBWA 4FF1A 3CU7A 4CHTB 1Y8OB 3H6MA 2O2LD 2HCCA 4X3TA 1IYVA 4LMQD 1HXYD 3MFYA 1HUMA 3MAQA 2F03A 5EPJA 5K36H 2TSSA 4FF4A 2MUYA 2M00A 1DOMA 4V190 1V43A 4C3JB 1IW7D 1LTGD 2J4XA 1F77A 4RCNA 3VA7A 4KD3A 4ZQ3A 3SK6A 2G9DA 5JAVA 4OL7A 3DEOA 3T16A 4H13C 3RUZA 3MTSA 2K6AA 4RHSA 1C48A 4CJ1B 3DM1A 3EA6A 5CC4A 3ND9A 1PFNA 1Y8NB 1OO9B 4RH6A 2KEDA 1LTSD 4CJ2C 2KCCA 1AEXA 3GD7A 2OT2A 4S3SA 4ZLTF 1CQFA 2Q8TA 1UAPA 1TVXA 1HHVA 1E0BA 5CR3A 5KEEA 1WTWA 2L4NA 3OHXC 2KEEA 4DFAA 3I73A 1JICA 4TKOB 1M4VA 2WKCA 2EY5A 1SNOA 5J22A 4C3IG 3URYA 1XXGA 1EIGA 1SE4A 2XSCA 2EJMA 1A2TA 4NKLA 2DNEA 1HFGA 4QF4A 5C4XB 1F9RA 2BCOA 1QJOA 5FKAC 5K36G 2L55A 2DY8A 5JVH3 3C1EA 1PMRA 3WOEA 1YNJC 4FO2A 1PTOF 3PUZA 5C0XG 1L0XB 2EJFC 5ELBA 3KBXA 3CQZB 4A3KB 4BBSB 1DOKA 3VR4A 1PFBA 5EGTA 5E3FA 3P20A 1F9SA 3H94A 2CW0C 5C0XI 5EQ0A 1O7YA 2B2YA 2IT1A 3PV0A 1LTTD 3HOZB 2K7VA 3Q24A 1JWMD 1DOLA 1GUSA 3ITPA 4RWSC 1CI3M 4QUFA 1TQOA 3FPUB 4O1NA 5FLXE 5KNDA 4G7OC 2D9UA 2ZT9C 4RHRA 1E2ZA 4PQXA 3MEHA 4OHJA 2WIIB 3DWQA 1F2ZA 5C5MA 1Y1VB 3TBIB 1JWUD 4BWGB 3C1FA 2H1EA 3HOYB 3L7ZC 4FXKC 4BY7B 1F2YA 2EOTA 3NP8A 5D65A 5C3WA 2ICEC 2NTTA 1X3QA 1D5XC 1Y8PB 4RGMA 2WINB 4G4KA 2EYJA 5I9OA 1C4QA 3BDOA 1JQYD 1Q12A 1II3A 4A3MB 1ZEQX 1PXUA 1EWCA 4NMZA 4DA2A 4HTHA 1DXMA 2F0MA 4J6HA 2L0CA 2AWNA 5C0XJ 2A6EC 5CORA 4K5XA 5CV9A 1I3QB 5ELEA 3BYTB 2LKVA 5C6AA 3K58A 1SYBA 2XIWA 5T1IA 2DNCA 3A8KE 2K33A 2IX1A 4XYQA 4R8NA 1CHPD 2B2TC 1WTOA 1M8AA 4I7ZC 1G2TA 3OMCA 2L5TA 3BDCA 2JEAI 3OW7A 5I2YA 1BXTA 4QIWB 4A3DB 1R4QB 2ZXPA 4KY6A 2LY7A 5CYUA 1ZYRD 5CV6A 1TR5A 1L0YB 5D3DA 1EWHA 1H9MA 2Y0SB 2R6GA 2OXPA 3HOXB 1KAAA 2R3ZA 1G8ZD 2NVTB 3HKZB 3V2TA 5I4DA 3C46A 3SK8A 1PTOB 3A8JE 1SMYD 3VR3A 3M4OB 4F8MA 3FVQA 2WACA 3VYRA 1UUPA 1SAPA 4FXDA 2IPKD 1G2SA 2EYPA 4K8JA 2NN6G 4N9TA 4EQNA 5ISRA 4HCEA 3PUWA 4WORA 1TWGB 1TS5A 4HN7A 3QO2A 1J9OA 4C1NK 3D31A 1KABA 3D8GA 4RCOA 2F0TA 2RSOA 4H44C 3GTMB 4RGNA 3NK9A 3PUXA 3MHBA 1SEBD 2X69A 1LTAD 1OXUA 1CA6A 2FINB 5EKKA 5LL6S 1FGBD 2F0PA 2JSOA 2A6HC 1CFMA 2A69D 3QG1A 5K5PA 4PNYA 3KLRA 3S2HB 4KN4C 2KHSA 3VR5A 2PZUA 1EY8A 2PZTA 3PIP3 5IGCA 1DZ1A 3NBIA 1LTRD 2CVRA 3R2TA 1I4QA 2ZXOA 1EOTA 3QJYA 2F3VA 2IX3A 4FP5D 1PTOC 1Z47A 1ESFA 1OXXK 2QEJC 1BCPD 1NAPA 2L11A 4A3BB 1MGSA 1I50B 5EPLA 1WVLA 4IUUA 3BVGA 2SOBA 1T5EA 2V4DA 2NZ1D 4H0LC 2Z8LA 4Z9CB 2SNMA 4PMWA 3CRKC 4RKLA 2B39A 3I90A 5DAUA 2F0OA 2EYHA 1TWHB 2BE5D 2EYFA 3S1RB 4ZYSA 3VYUA 3R3OA 2PZWA 1QNUA 3F2UA 3A55A 1RODA 5M5YB 4HSVA 2AUJD 2Z4HA 3K5OA 2B2UC 3I91A 3H3VC 3HP3A 1JR0D 4BBRB 1TS4A 1KNEA 2RQXA 4Q0FA 3MXNA 4WRDA 4KKTA 1OXTA 1F9PA 2K5QA 5M5XB 2B8GA 1Y1WB 1B3AA 1QILA 5BN4A 2VB3X 4M8AA 1AW7A 4K6DA 3HG9A 3VR6A 1SNPA 4OGQC 2AUKA 2XNAC 3PMFA 1CZGA 2FMCA 3MA2B 2H4OA 1ET9A 2I46A 1S5DD 1GUOA 1KNAA 3O13A 1SNQA 2IWHA 3U9OA 2QDBA 1U9RA 1SYGA 4TRDA 1GXDC 3G6JB 4TSSA 1LO5D 2NVXB 4ZUJA 3SXHA 3HEJA 4X3SA 3MWYW 3R8BA 1TT2A 3SDZA 2F4IA 1HA6A 2EXZA 1HQRD 1BUVT 1I4PA 3OSOA 2B2TA 3T13A 1NUCA 3I72A 3Q6SA 5DM73 1ILQA 1AP0A 2E2HB 1V1PB 2JEBI 3K7AB 2RSNA 4A3GB 3DWAA 5KGUA 4IFDG 2N88A 4V0BA 1Q1BA 1STNA 2EPBA 1UNSA 1W6JA 3SE0A 3CRLC 2Q8IB 4F7XA 3S14B 5KYIA 3ERQA 3T53B 4DGZA 4IFDI 3OIPA 1G291 4FVMA 1I6VC 1ML0D 3D4DA 3GTGB 1EEFD 1Y69U 4XT3B 3MXPA 3PUYA 5A35A 5IGDA 1XWEA 4DAYA 5IGGA 3M3YB 1TWCB 4HMIA 4B9WA 4E6IA 2BA0A 2PYKA 1H9RA 4CKCA 1HTLD 2E74C 5NUCA 3GTPB 5HGTA 2E2IB 1FD7D 1YNNC 1PRTB 2DY7A 1EYCA 5G3LF 5JEAG 1FNUA 1EY4A 1U4MA 3NBHA 4IUPA 3M85A 2MHVA 2IJ0A 5IT9L 3D6CA 5JPMC 1FNWA 2AQ1B 1EYDA 1SNDA 4ODGA 3KBGA 3DUZA 3K59A 2NVYB 2NBFA 2NWGA 3S2DB 1S5CD 4ZUIA 4GZYC 1XTCD 5JJZA 4KJNA 4NDXA 4DK1A 1PLFA 5T1GA 2MPMA 5EJWA 4BY1B 2E2DC 1H9SB 1SE3A 3V96A 3BVMA 4IFDJ 1WD1A 1MI2A 4K14A 1STGA 2I07B 3J80L 4NW2A 4U673 1EQVA 3ONAB 4KTAA 1G91A 4IN3A 3MXGA 3E5SA 4KKSA 5FO7B 4XQQA 5TSSA 5C4ZA 5E1FA 3HOUB 3KUPA 4ULLA 2IL8A 4MIUA 4U68A 1U4LA 1MD2D 3PO2B 1A2UA 4G7ZC 4F87A 1JOKA 1PRTC 3M7NA 4WFN3 3E6ZX 1TU2B 2A68C 3UI2A 4L8JA 4QMGA 2F0VA 3EROA 4DXFA 1SNMA 1K8OA 1SJHD 3FMCA 5FK9C 4C56C 2OEOA 4PV1C 4CBVA 3S1QB 4CKBA 1S5BD 2PW5A 5JEAJ 2FMMA 1SXTA 3S17B 1HRJA 5M3FB 5A2QL 1EZ8A 3I70A 1S5FD 4MHEA 5I9PA 3W3AA 1XYIA 5EKLA 3I4MB 2B2UA 3TP5A 1A15A 3JAML 5BN3A 4K2KA 1CM9A 3NQTA 5F2DA 4FF3A 4C3HG 5JOBA 5KNCA 3H0GB 1KDAA 3HRZC 3P7JA 1EY9A 3NE5B 1BBXC 1J8IA 2K28A 1JCKB 2EYMA 4HEDA 1HTPA 2XVSA 4HCSA 3V05A 4Y7NB 5EBDA 4Q5VA 2VB2X 1Q1EA 2ZXRA 3T4AC 3P75A 2F0EA 4OIJA 3NXWA 3P1HA 1F9QA 4ZKCB 1K83B 3DHQA 2ENBA 3H09A 1R9TB 1ILPA 4QB4A 1TS3A 4ID6A 3RLFA 2SDFA 4L6TB 2RDGA 2CHBD 3AB9A 3WOFA 2F0WA 3IKJA 1RDPD 1SYFA 3HOVB 2F0UA 1RKNA 1X32A 1NR4A 4IQZA 2K04A 5IODA 3K5NA 1EL0A 2QF7A 1EU3A 1CQVA 1D6EC 1LACA 3T56B 2NB0A 2QKIC 4K8IA 4CKEA 4EVOA 4O42A 1E2VA 2HQEA 1K8MA 2F3WA 5C5LA 2E75C 1YNJD 3VYSA 4DN4M 4J1MA 1QG7A 3TZDA 1SJED 3C3LA 3BS1A 1ICWA 4CJ0B 3D4RA 3L9AX 2CW0D 1S5ED 3KLSX 5AFWA 2FFKB 2RDFA 3GTQB 3HOWB 2K1BA 4RA8A 1C8CA 4PMBA 5I6YA 3NTHA 4K5WA 1LT4D 5D14A 3LWUA 5FO9B 1B50A 3FDTA 4YIJA 4ILWA 3LX0A 4UDUC 2F0FA 1CHQD 2EYOA 2PW7A 2KUMA 1ET6A 1BO0A 3MVVA 2EDGA 3I8ZA 2KQ3A 2PNRC 2BDNA 4K6LA 1NSNS 3FPPA 2RDHA 1F2LA 1F2MA 3DMUA 2ICIA 1V1PA 4DK0A 3OWFA 1EQTA 3FRPB 3OWEB 4KHZA 2JE6I 4KY7A 3QB3A 3BG3A 4KV6A 2TMPA 4K5VA 1VMCA 1LT6D 4IALA 5IT9E 4A3IB 2XRQD 2PCFB 3K5MA 2FHTA 1EY6A 1B1ZA 4EQPA 3TMEA 3SEBA 5COYA 4DU9A 1XX8A 3RZDB 4C1NI 3NTIA 1WD0A 2F0IA 2B63B 4IUQA 1BOSA 1UEAB 1O80A 2PQEA 1VMPA 3LWEA 2K5WA 1IW7C 4ZKBB 4OO1H 3SR1A 2A6ED 1PRTF 4J8QA 4ZRZA 2D5DA 1B53A 2DN8A 4KI0A 3WDNA 1V8QA 4EQOA 2J0TD 4A93B 4LAAA 1OXSC 2EZVA 3KF8A 2QILA 1EEID 1FNVA 2D62A 1TY2A 4XYOA 5J1ZA 4PMCA 2F0DA 1SYEA 4KKUA 1ENAA 1GOZA 4ABNA 1DJRD 2KECA 4C3HB 4MN3A 1LTBD 1PZJD 3J7AF 5IIFA 2WB1B 3X3MA 1BNZA 2R92B 1NR2A 1IKLA 3K57A 3SHLA 3NTKA 3IFDA 1KTKA 2R7ZB 1JE4A 1Q3LA 1TS2A 4KY5A 1STHA 5J39A 3NWTA 1MBYA 4A3JB 2Q8RE 1H9SA 3PIO3 2VNUD 1CA5A 2WV6D 1VCIA 5A2QE 1SYDA 2EE1A 3J7YW 2KCNA 4ZK9B 2YU9B 4IUVA 4DNTB 3DXJC 4C2MB 1ENFA 3JAME 1STBA 2NTSA 3A54A 2KOLA 4DAPA 3EVQA 3GTKB 3HGBA 2M2LA 3GTJB 5KRUA 1IL8A 2N55A 1WCMB 4RFBA 3I4NB 5G3LD 2WKDA 1SYCA 4RAUC 4XDXA 2E76C 4N9PA 1WTPA 3OIQA 1MSHA 3OMGA 1SDFA 3RMHA 5C3XA 3OOCA 5EKIA 3TP6A 3LNNA 1PTOH 3S16B 1KDCA 3RD4A 4NP5A 1B44D 5BN5A 5LL6X 3GP7A 4QUCA 1SSOA 2A6HD 3TSSA 1EY7A 4XT1B 3M4YA 5I2XA 3K5LA 1EY0A 1CZWA 3GV3A 4OIKA 4I65A 2K05A 5M5WB 1IKMA 2X6GA 2MGSA 3RZOB 4HR7B 2NVQB 4KD4A 2GA4B 4XQJA 5IOCA 1BDOA 1PTOD 5FO8B 3IFTA 5JVG3 4CGYB 3E0JA 2Z4IA 2WP8J 1MSGA 2NUCA 4QCLA 1QNKA 1STAA 3Q23A 4G7HC 4X3KA 1EZ6A 1U4PA 3VYTA 1VDZA 4RGOS 4DF7A 1RF2D 5ELCA 3EQLC 4X3UA 2Z1CA 1ONLA 3MZ5A 1SNCA 5C0XH 3QIAA 2A73B 4B9XA 2VXWA 5CV8A 4ZAIA 2L1BA 1EY5A 2IW3A 4HAEA 1FYCA 1PZKD 2F1MA 2L9HA 3TN2A 1KDBA 2R93B 3HZXA 1EYAA 5CV7A 1Z7TA 2R61A 1TWFB 2LS01 2B2WC 3A56A 4KMUC 4A3FB 2F0KA 1GUGA 3BVZA 3TP8A 3Q22A 4TQUS 2AQ2B 3VR2A 1DYQA 5IGEA 1WTQA 4H7BA 3A7LA 4LK1C 1ZYRC 4DAVA 1JC7A 2M9VA 2XWBB 1JB3A 2XN9C 3W2DA 2K5DA 4XQNA 4LJZC 1QCBD 4DNRB 1JOQA 3I3CA 1A3UA 2BDOA 2VUMB 1GJXA 3SK4A 2KA7A 2KJXA 1SMYC 3C2PA 1GUWA 3TP7A 2A5HA 2JP1A 1DONA 1BCPB 1RTNA 1HQMC 5CBEE 5JPNC 1I6HB 3GTOB 4FF2A 1RTOA 5KNBA 1HUNA 1EU4A 2JA5B 5CMDA 4KJOA 4KHVA 2EVBA 4BA2I 3PO3B 1AFPA 4BS9A 1T5XD 1AZPA 2YYZA 2F0SA 3MC0B 3QOLA 2FJ2A 3GTLB 1EFID 3EJIA 1LTID 4AYBB 3NUCA 1GUTA 1I4RA 3M7GA 1H9KA 1JORA 2F0NA 5DEHA 4G57A 3J81L 2A69C 4KK7A 1DD2A 4R9WA 1JWSD 3X3NA 3QOJA 2BA1A 1V1OA 2F0JA 2F0LA 1X3PA 2EJGC 4BA1I 1AZQA 1B4OA 1RD9D 3S1NB 3BYYB 1IYUA 3A8IE 1I4GA 1Z6HA 1TY0A 1BCPC 2EY2A 5KYLA 3J7AV 5C44B 3BDLA 1QE6A 5C3EB 4IUTA 2B2VC 1KLGD 3D3RA 2K03A 5C4HA 4IURA 1YNND 3DEPA 1VF5C 5DNFA 2NN6H 1HPCA 5C4JB 4EGVA 3PUVA 5ELFA 5I6WA 2QCPX 5E4XA 5HURA 2HDMA 3R2IA 2G9HD 3H91A 5CV4A 2O5IC 1SBBB 2RBMA 4JK1C 5CBAE 2OF1A 4R8IA 3VA5A 1AN8A 2O4XA 3CKIB 2A74C 3N52A 2AWOA 2BE5C 3FEWX 1TWAB 2JXMB 4RKBA 3ZYYX 2RKSA 3K6OA 1O78A 2L12A 1DCZA 1KLUD 2LMCB 1NCVA 1BQQT 2F0HA 1D5MC 3D6WA 2JA6B 1A3VA 3DWPA 4WJWA 5KIXA 2D2CC 1D2BA 4KN7C 4FYDA 1E2WA 2C9OA 3S1MB 1SFOB 1FR3A 3NQIA 3EFXD 1R4PB 1TKWB 1H9JA 3K0YA 1QWYA 4IUNA 2F0QA 3A7AB 5M3MB 5LHY1 1CK1A 1PRTD 2A68D 4DXGA 1G6ZA 3MFGA 5CV5A 3R93A 2B8FA 1QB5D 1SE2A 3QWNA 3ND8A 1O7LA 1BR9A 5E4WC 3HS0C 4C3JG 1PZID 5IGBA 3NSWA 3MXUA 3U9SA 5EPKA 5CGKA 1ENCA 2NN6I 3FKIB 1STEA 1Q90A 3T51B 4C3IB 4A3EB 1D1KA 2IX0A 1ZKOA 2HDLA 1HCZA 2SNSA 1RJTA 2PMZB 1B9NA 3NWSA 3CHBD 3S9WA 5DM63 2B2WA 3S15B 3G7LA 2JA7B 2E2JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6H A;  1KDA A;  2F0G A;  5DAU A;  2F0O A;  1KAB A;  5IGF A;  4J1M A;  2F0S A;  1EY9 A;  1SYC A;  5EGT A;  3D8G A;  4KJN A;  5E3F A;  3QOL A;  4NDX A;  4RKB A;  2M00 A;  2EYH A;  2RKS A;  4N9P A;  2F0T A;  4K5X A;  5CV9 A;  5KEE A;  3SR1 A;  2EYF A;  5KGU A;  2LKV A;  5C6A A;  3EJI A;  1SYB A;  3R3O A;  3NUC A;  1KDB A;  2PZW A;  3OMG A;  1STN A;  2EYM A;  3NK9 A;  3HZX A;  3MHB A;  1EYA A;  5C3X A;  2F0H A;  4EQO A;  5CV7 A;  4KD3 A;  4ZQ3 A;  3SK6 A;  1JOR A;  2F0N A;  5JAV A;  4OL7 A;  4LAA A;  2RDF A;  5DEH A;  4R8N A;  4G57 A;  3T16 A;  4K14 A;  5EKK A;  3TP6 A;  1STG A;  1A3V A;  2EYL A;  4F7X A;  5KYI A;  2F0P A;  5KIX A;  3RUZ A;  2F0K A;  1EQV A;  3ERQ A;  4KTA A;  4PMB A;  5I6Y A;  1KDC A;  3TP8 A;  1IHZ A;  4NP5 A;  4K5W A;  4DGZ A;  3OMC A;  4K2L A;  5J1Z A;  5K5P A;  3E5S A;  3P75 A;  3BDC A;  2F0D A;  2F0E A;  3ITP A;  3QOJ A;  4PMC A;  1SYE A;  4PNY A;  5CC4 A;  3NXW A;  4WRD A;  3D4D A;  2F0J A;  5IGE A;  1ENA A;  1EY7 A;  1TQO A;  4H7B A;  1JOO A;  3SK5 A;  2KHS A;  4YIJ A;  5E1F A;  3NHH A;  5C4Z A;  2F0L A;  3P1H A;  4MIU A;  2PZU A;  1EY0 A;  1EY8 A;  4KY6 A;  3DHQ A;  2ENB A;  2PZT A;  3MXP A;  1A2U A;  4I65 A;  4IUN A;  5IGD A;  5IGC A;  2F0Q A;  1AEX A;  1JOK A;  4S3S A;  2EY6 A;  5IIF A;  5CV6 A;  3LX0 A;  2F0F A;  1TR5 A;  3D4W A;  4QB4 A;  2EYO A;  2EY1 A;  2PW7 A;  5IGG A;  3SHL A;  4HMI A;  4B9W A;  4ID6 A;  3MEH A;  2PYK A;  3MVV A;  4ME5 A;  4QMG A;  5CR3 A;  2F0V A;  2F3V A;  4E6I A;  2KQ3 A;  4K6D A;  4KD4 A;  2EY2 A;  5M9O A;  4IZ8 A;  5KYL A;  3ERO A;  1NSN S;  1SNP A;  5CV5 A;  1STY A;  5NUC A;  4DFA A;  1A3T A;  4KY5 A;  1F2Z A;  2OXP A;  2F0W A;  1F2M A;  1SNM A;  3BDL A;  3DMU A;  3PMF A;  5C5M A;  5IOC A;  1KAA A;  3OWF A;  1STH A;  5HGT A;  5J39 A;  2EY5 A;  3C1F A;  1SYF A;  1JOQ A;  1SNO A;  2F0U A;  5J22 A;  4KY7 A;  1EYC A;  1A3U A;  1RKN A;  3QB3 A;  3V2T A;  5C4H A;  1SNQ A;  3U9O A;  5IOD A;  2QDB A;  3SK4 A;  2OEO A;  1EY4 A;  4ZUI A;  1F2Y A;  1U9R A;  3H6M A;  1A2T A;  1SYG A;  2NUC A;  4KV6 A;  4TRD A;  5IGB A;  2PW5 A;  4NKL A;  4K5V A;  3TP7 A;  1STA A;  4QF4 A;  3NP8 A;  3SK8 A;  1EZ6 A;  5C3W A;  5CGK A;  4DF7 A;  4IAL A;  4HMJ A;  1ENC A;  4ZUJ A;  2SOB A;  1SYD A;  4F8M A;  2WAC A;  3SXH A;  3HEJ A;  4K8I A;  1EZ8 A;  3MZ5 A;  5I6W A;  2EYJ A;  3D6C A;  1EY6 A;  1SNC A;  5I9P A;  5HUR A;  5I9O A;  2EYP A;  1EYD A;  1SND A;  4ODG A;  4B9X A;  4EQP A;  4K8J A;  1TT2 A;  5CV8 A;  4EVO A;  4KJO A;  4N9T A;  3TME A;  2HQE A;  4KHV A;  5CV4 A;  4DU9 A;  4EQN A;  2F3W A;  2EXZ A;  2SNS A;  5ISR A;  2RBM A;  3C1E A;  5EKL A;  1STB A;  1II3 A;  2SNM A;  5C5L A;  3EVQ A;  1EY5 A;  2F0I A;  2OF1 A;  3TP5 A;  4WOR A;  3OSO A;  4K2K A;  3NQT A;  5KRU A;  5F2D A;  4RKL A;  3S9W A;  3T13 A;  3VA5 A;  1NUC A;  2O4X A;  4NMZ A;  4HTH A;  2PQE A;  5JOB A;  2F0M A; 
#chains in the Genus database with same CATH topology
 1K0R A;  3GQB A;  4OX9 Q;  3I4L A;  3NPP A;  2ZJR A;  1GHJ A;  3N6R A;  2WAQ B;  4A3F G;  3IAY A;  1GUN A;  2JYO A;  3BZD B;  1L2F A;  1HNX L;  4OEM B;  4MTK A;  4RGT A;  2ID0 A;  1WTV A;  1VQE A;  1LT5 D;  2K32 A;  2X6L A;  2HUG A;  1QZH A;  2C5C A;  4P2C B;  1WTX A;  1LLR D;  4P74 A;  5FOB B;  1PDQ A;  5JJK A;  5GQO A;  4K2L A;  2NYZ D;  1OXV A;  3CC4 A;  5C4X G;  4F88 A;  4HSP A;  1Y1V H;  3AMU A;  2JJQ A;  1A6X A;  1BF4 A;  3TZU A;  1JOO A;  2MP1 A;  4WJ3 M;  3NHH A;  3HOY H;  1LAB A;  4X64 Q;  1LV9 A;  3TEH B;  1Q82 C;  5FLX L;  2PO4 A;  4BY7 H;  2J7Z A;  2B2Y C;  4L63 B;  3E3X A;  3J80 E;  1LT3 D;  1E3P A;  1FJG Q;  3H0G H;  1FVI A;  3DM3 A;  1D5Z C;  4XXE A;  2VUM G;  4UAI A;  3GO5 A;  4GLV B;  1D1I A;  3H15 A;  3CPW A;  3OPO A;  2WFW A;  1CT1 D;  2ZTD A;  2CQA A;  4BBS G;  4GN5 A;  2XRS D;  1WTR A;  1E7Z A;  4A3M H;  2XWJ B;  3FHW A;  2HCI A;  1O7Z A;  1SMX A;  2BOS A;  2RA4 A;  1GVP A;  4M1U B;  4DR6 Q;  1HA5 A;  1U4R A;  2K01 A;  2N3S A;  3T1H Q;  4HMJ A;  3AEV A;  3U4V A;  4X66 Q;  4JI3 L;  1PYW D;  1VF7 A;  3PO3 G;  3HOZ G;  3GV6 A;  1I4X A;  4LW1 A;  3CXC A;  1I3Q H;  1Q7Y C;  1H95 A;  1ESR A;  3L3O C;  1B9M A;  4DR5 L;  5EBC A;  3Q0A A;  2RVL A;  4XTC S;  4LNQ A;  2JA8 B;  4JI2 Q;  4B3S L;  1E22 A;  4XIG S;  4OWX B;  2AQ3 B;  2K52 A;  4IFD H;  3F2C A;  3G71 A;  3U50 C;  2F0G A;  1CTM A;  5IGF A;  2OTL A;  1PFM A;  5LMN W;  1VQG A;  4A3D H;  1I4H A;  3K80 C;  3KLS A;  5IE8 A;  2JQO A;  1Q8I A;  3SVM A;  4HIK A;  4JYA Q;  2A8V A;  1JE5 A;  3AYH B;  4A3L H;  1HFN A;  4FXG C;  2O5J C;  1DM0 B;  4OO1 G;  3J81 E;  1BCP F;  4QIW E;  3HOY G;  2EYL A;  4FNF A;  1B2T A;  4JBM A;  3IL8 A;  3PSI A;  1IHZ A;  3TDQ A;  1I5F A;  1S4Z A;  2XTI A;  2SEB D;  3RLN A;  1RCV D;  3KK7 A;  1QVF A;  3HOX H;  1W6K A;  3AU7 A;  1KHI A;  3SK5 A;  4OO1 I;  2VY3 A;  2KVM A;  3A5Z B;  4JG2 A;  2NVT H;  2B2V A;  1X3F A;  1QOH A;  4ZCK A;  1ZXT A;  5D3I B;  5C44 G;  1RHP A;  2EY6 A;  2MJ8 A;  3D4W A;  4B08 A;  2EY1 A;  4UP7 A;  5GAD C;  5ELD A;  1EIH A;  1YIJ A;  2LFN A;  4ME5 A;  1N32 Q;  3HKZ E;  3M4O H;  4A3M G;  5JEA H;  1TII D;  2E8G A;  1HZ9 A;  4P72 A;  4IZ8 A;  5M9O A;  3T1Y L;  2PPB C;  4BXX G;  1GHK A;  1STY A;  1A3T A;  1SLJ A;  1E1O A;  4JBW A;  4NXM L;  2AMC B;  4FF1 A;  2UXC Q;  3CU7 A;  1EQQ A;  4CHT B;  1WOC A;  1Y8O B;  4P71 A;  4IOC A;  4HJ8 A;  3GTQ H;  2Q2U A;  3H6M A;  2JA9 A;  2O2L D;  1TWG H;  2CCZ A;  2HCC A;  4X3T A;  1IYV A;  4LMQ D;  3K8A A;  3STB D;  4A3C G;  2UUA Q;  3WWV A;  4Y52 H;  4AQY L;  4JI6 Q;  2CKZ B;  2OCE A;  1HXY D;  4L5T A;  3MFY A;  1XMO L;  1HUM A;  3GTM H;  3MAQ A;  1V1Q A;  3PQI A;  4B3R L;  1LTL A;  2P5Z X;  2F03 A;  5EPJ A;  2H5X A;  4LWC A;  1XPO A;  4IPC A;  5K36 H;  2TSS A;  4FF4 A;  4ALP A;  3NEM A;  2MUY A;  3CC7 A;  4DUZ Q;  2M00 A;  1DOM A;  2FXQ A;  2VW9 A;  4A76 A;  4V19 0;  2JA6 G;  3PCO B;  1V43 A;  3S2H H;  4C3J B;  1IW7 D;  1LTG D;  2Y0S G;  4K0K Q;  2J4X A;  1F77 A;  4RCN A;  3H3V H;  3VA7 A;  4LF9 L;  4KD3 A;  4ZQ3 A;  3SK6 A;  2CH4 W;  2G9D A;  5IP9 G;  5JAV A;  4OL7 A;  3DEO A;  3T16 A;  4H13 C;  1JT8 A;  3RUZ A;  3MTS A;  1EOV A;  2K6A A;  1I94 Q;  2CQO A;  2ALY B;  2PI2 A;  3UDI A;  4RHS A;  1C48 A;  1CKN A;  4CJ1 B;  4DR4 L;  3DM1 A;  4JI3 Q;  3EA6 A;  1HZC A;  2R7D A;  5CC4 A;  3ND9 A;  1HNW Q;  1PFN A;  1Y8N B;  3RN2 A;  1OO9 B;  4RH6 A;  3F2B A;  2KED A;  3ICE A;  3RZD H;  4A3B H;  1LTS D;  4CJ2 C;  4LFB Q;  2KCC A;  4LUV A;  1I50 H;  1AEX A;  3GD7 A;  2OT2 A;  2Q2H A;  4S3S A;  4ZLT F;  4JI7 L;  1CQF A;  1GO3 E;  2Q8T A;  2PQA B;  1Q8K A;  1UAP A;  3NEL A;  1TVX A;  1PH3 A;  2VZA A;  1HHV A;  1E0B A;  5CR3 A;  5KEE A;  1WTW A;  2L4N A;  3OHX C;  2KEE A;  4DFA A;  3I73 A;  4UY8 C;  1JIC A;  2UU9 L;  1EIF A;  4TKO B;  1M4V A;  2UUC L;  5H1S E;  2WKC A;  2EY5 A;  1SNO A;  1HR0 Q;  5J22 A;  1Q46 A;  1VQF A;  4C3I G;  3URY A;  1XXG A;  4A3E G;  1EIG A;  1SE4 A;  2XSC A;  2EJM A;  1A2T A;  5LMN L;  4R1J A;  4R4Q A;  1XPU A;  3MXN B;  4NKL A;  2E5L L;  2DNE A;  1HFG A;  4QF4 A;  5C4X B;  1F9R A;  4JI0 L;  5E7N A;  3I4O A;  2BCO A;  1QJO A;  5FKA C;  1TWH H;  5K36 G;  2KCM A;  3S1R H;  4O2D A;  3A0J A;  1MIU A;  2L55 A;  2DY8 A;  5M5Y H;  2K50 A;  5JVH 3;  1IL2 A;  3C1E A;  1C0A A;  3CPF A;  1PMR A;  2UUB Q;  3WOE A;  1YNJ C;  4FO2 A;  4X62 L;  1PTO F;  3PUZ A;  5C0X G;  1L0X B;  2OQK A;  4OON A;  4BBR H;  2EJF C;  5ELB A;  4DPG A;  3KBX A;  1HZA A;  3CQZ B;  4A3K B;  4BBS B;  1DOK A;  2HD3 A;  3M4Q A;  3VR4 A;  1LYL A;  1PFB A;  2QA4 A;  5EGT A;  5E3F A;  3P20 A;  4GLX A;  4J15 A;  1S3O A;  5FLM H;  1F9S A;  2WB1 E;  3ULJ A;  3H94 A;  4IOA A;  2CW0 C;  5C0X I;  5EQ0 A;  1YHA A;  1O7Y A;  1XNR Q;  2B2Y A;  2IT1 A;  5M5X H;  3PV0 A;  1LTT D;  3HOZ B;  1Y1W H;  2K7V A;  3Q24 A;  2F4V L;  1JWM D;  1T9H A;  2VQF Q;  2D0O A;  1G6P A;  4EX5 A;  1DOL A;  1GUS A;  3G6E A;  3ITP A;  1IZ6 A;  4RWS C;  1CI3 M;  4QUF A;  2IHE A;  1TQO A;  3UE1 A;  3FPU B;  1VQH A;  4O1N A;  4UP9 A;  4JI5 L;  5FLX E;  5KND A;  3GTK H;  4G7O C;  2D9U A;  1LM0 A;  3ER0 A;  2ZT9 C;  4RHR A;  2NVX H;  1E2Z A;  4PQX A;  3MEH A;  4OHJ A;  2WII B;  4IO9 A;  3DWQ A;  1F2Z A;  5C5M A;  1Y1V B;  3TBI B;  1JWU D;  4BWG B;  1SR3 A;  3C1F A;  2H1E A;  3HOY B;  2UXD Q;  3CCR A;  3CCV A;  2EIF A;  3L7Z C;  4FXK C;  4BY7 B;  5LMU L;  1F2Y A;  2EOT A;  2F3I A;  4PZ7 A;  2ZTE A;  3NP8 A;  5D65 A;  2I5H A;  1UWV A;  5C3W A;  4OX9 L;  2ICE C;  2E2H H;  2NTT A;  2JA8 G;  3K7A H;  1X3Q A;  1B7Y B;  1D5X C;  1SE8 A;  1Y8P B;  4RGM A;  4BBR G;  2WIN B;  4A3G H;  4G4K A;  2EYJ A;  5I9O A;  1C4Q A;  3BDO A;  1J5E L;  4R4C A;  2QGQ A;  1N34 L;  1JQY D;  3PF4 A;  1Q12 A;  1II3 A;  2V1C C;  4A3M B;  1ZEQ X;  3S14 H;  1PXU A;  4JI7 Q;  1EWC A;  4NMZ A;  4HTH A;  5EAY A;  4DA2 A;  1DXM A;  2F0M A;  4J6H A;  2L0C A;  2AWN A;  5C0X J;  2A6E C;  5COR A;  4K5X A;  5CV9 A;  1I3Q B;  5ELE A;  1C9O A;  3GTG H;  3BYT B;  4X64 L;  2LKV A;  5C6A A;  3K58 A;  1SYB A;  2JN4 A;  1VQO A;  2XIW A;  5T1I A;  1NMF A;  2DNC A;  1VQ6 A;  3A8K E;  2K33 A;  3NBH B;  2IX1 A;  4KHP Q;  4XYQ A;  4R8N A;  3ERS X;  1CHP D;  3L0O A;  2B2T C;  4PZ8 A;  4L5S A;  1FJG L;  5LMN Q;  3M3Y H;  1TWC H;  1WTO A;  1M8A A;  4I7Z C;  2VQE L;  1G2T A;  3OMC A;  2L5T A;  3BDC A;  2JEA I;  3AFP A;  3GTP H;  3OW7 A;  5I2Y A;  1BXT A;  4QIW B;  4A3D B;  5IP7 H;  1R4Q B;  4IPG A;  3J81 j;  2E2I H;  1A63 A;  1KQS A;  2ZXP A;  4YY3 Q;  4KY6 A;  4TVA B;  1PH7 A;  1K28 A;  2LY7 A;  4YWM A;  5CYU A;  1ZYR D;  3K81 C;  5CV6 A;  4DR6 L;  1TR5 A;  3JC6 6;  1L0Y B;  5D3D A;  1EWH A;  1H9M A;  2Y0S B;  2EXD A;  2R6G A;  2OXP A;  3HOX B;  1KAA A;  1B8A A;  2R3Z A;  4QY7 A;  4DUY Q;  1G8Z D;  4LF7 Q;  2NVT B;  3HKZ B;  3V2T A;  4JI2 L;  5I4D A;  4A3G G;  3OTO Q;  3C46 A;  3S24 A;  2NVY H;  3OW2 A;  3S2D H;  3SK8 A;  1PTO B;  3A8J E;  1SMY D;  1S72 A;  3VR3 A;  3M4O B;  4F8M A;  3FVQ A;  2WAC A;  3VYR A;  1UUP A;  1SAP A;  4FXD A;  4PZ6 A;  2IPK D;  1G2S A;  1RL2 A;  4LUO A;  3BJU A;  2EYP A;  4DR3 Q;  4K8J A;  2NN6 G;  4N9T A;  4JYA L;  4EQN A;  5ISR A;  4JI5 Q;  3M4P A;  4DK3 C;  4HCE A;  3PUW A;  4WOR A;  1TWG B;  3I55 A;  1VQM A;  3CCS A;  1TS5 A;  4HN7 A;  3QO2 A;  4DAM A;  1J9O A;  2YTV A;  4C1N K;  3D31 A;  3KDF B;  4AH6 A;  1KAB A;  3D8G A;  4RCO A;  2F0T A;  3HOU H;  2RSO A;  4H44 C;  2RCN A;  3TRZ A;  1DGS A;  3GTM B;  2DJG C;  4RGN A;  4JBK A;  3NK9 A;  3PUX A;  3PO2 H;  3MHB A;  1SEB D;  4YCU A;  2X69 A;  1LTA D;  1OXU A;  1CA6 A;  2FIN B;  5EKK A;  5LL6 S;  1FGB D;  2F0P A;  2JSO A;  2ZTC A;  1N32 L;  2A6H C;  1CFM A;  1EIY B;  2JK8 A;  2A69 D;  3QG1 A;  5K5P A;  4PNY A;  1XMQ Q;  1UE6 A;  3KLR A;  3S2H B;  4KN4 C;  2KHS A;  3VR5 A;  2UXC L;  2PZU A;  1EY8 A;  1J5E Q;  2PZT A;  1N34 Q;  3PIP 3;  5IGC A;  4B3M Q;  1DZ1 A;  3NBI A;  1LTR D;  1PHJ A;  3S1Q H;  2CVR A;  3R2T A;  1I4Q A;  2ZXO A;  2Q2T A;  1EOT A;  2UUA L;  1QVC A;  3QJY A;  3S17 H;  2F3V A;  2IX3 A;  5FJ8 H;  3PIO A;  4FP5 D;  1PTO C;  1Z47 A;  5M3F H;  4JI6 L;  3F2D A;  1ESF A;  4MNO A;  1OXX K;  2QEJ C;  1BCP D;  1NAP A;  2L11 A;  1CKO A;  4A3B B;  1RIP A;  1NY4 A;  3I4M H;  5IYB G;  1MGS A;  1I50 B;  5EPL A;  1WVL A;  4IUU A;  1VQ9 A;  4BY1 G;  4JC0 A;  3BVG A;  4AYB E;  2LXK A;  2SOB A;  1N36 Q;  4DUZ L;  4N8X 1;  1T5E A;  2V4D A;  2AHO B;  2VQE Q;  2NZ1 D;  4K0K L;  2LXJ A;  4A3K G;  4H0L C;  2G5D A;  2RCF A;  2Z8L A;  4Z9C B;  2SNM A;  4LF5 Q;  4PMW A;  4Y7N H;  3CRK C;  3ULL A;  4RKL A;  2B39 A;  3I90 A;  4APV A;  1I94 L;  3PO2 G;  2PQA A;  5DAU A;  2F0O A;  1HNW L;  2EYH A;  1TWH B;  2BE5 D;  2EYF A;  3S1R B;  4ZYS A;  1QVG A;  2YTX A;  3VYU A;  3R3O A;  2PZW A;  1QNU A;  3F2U A;  1K83 H;  4LFB L;  2K14 A;  3A55 A;  1ROD A;  2I0Q A;  5M5Y B;  4HSV A;  2AUJ D;  2Z4H A;  3K5O A;  2B2U C;  1R9T H;  3I91 A;  3H3V C;  2XGT A;  5HGQ A;  3HP3 A;  2UXB Q;  1JR0 D;  1P16 A;  4BBR B;  1TS4 A;  1KNE A;  2HT1 A;  5C4J H;  4JVZ A;  2RQX A;  4DV3 Q;  4Q0F A;  3MXN A;  4DR1 Q;  1X65 A;  4WRD A;  1WFQ A;  2PI2 E;  1EUJ A;  4KKT A;  3HOV H;  1HR0 L;  3CCU A;  1OXT A;  2BH2 A;  3KF6 B;  2KEN A;  1F9P A;  2K5Q A;  1CSP A;  3CD6 A;  1Y1V G;  4ME3 A;  5M5X B;  4GOP B;  2B8G A;  3KJP A;  1Y1W B;  1B3A A;  4JI8 Q;  1QIL A;  5BN4 A;  2VB3 X;  4M8A A;  1AW7 A;  4K6D A;  4BY7 G;  3BZK A;  4QQB X;  3HG9 A;  3VR6 A;  4H02 A;  5J3B A;  1SNP A;  5FLX c;  3CCE A;  1AE3 A;  4OGQ C;  2AUK A;  2XNA C;  3PMF A;  1CZG A;  2FMC A;  3H0G G;  3MA2 B;  2H4O A;  1ET9 A;  2I46 A;  1S5D D;  3FP9 A;  1GUO A;  1KNA A;  3O13 A;  1SNQ A;  2IWH A;  3U9O A;  4HIO A;  2QDB A;  2UUB L;  3EN2 A;  3UDF A;  1U9R A;  5IWA Q;  1SYG A;  4TRD A;  1VQN A;  1GXD C;  4DV1 L;  3G6J B;  4TSS A;  4UP8 A;  1LO5 D;  1FGU A;  1BBU A;  2NVX B;  4ZUJ A;  1PA6 A;  3SXH A;  1N9W A;  3HEJ A;  4X3S A;  1K8G A;  4OWT B;  4R4T A;  3MWY W;  3R8B A;  1TT2 A;  3SDZ A;  2F4I A;  1HA6 A;  1HNZ Q;  1XNR L;  2EXZ A;  3W1B A;  1HQR D;  1BUV T;  1YBY A;  1I4P A;  1YHQ A;  3HOW H;  3OSO A;  2B2T A;  3T13 A;  1NUC A;  5HY6 A;  3I72 A;  2VQF L;  3Q6S A;  5DM7 3;  1WJJ A;  1ILQ A;  1AP0 A;  2E2H B;  1MJC A;  1V1P B;  2JEB I;  3K7A B;  2RSN A;  2HIX A;  4JBJ A;  4A3G B;  5ELN A;  4IJL A;  1SRO A;  2K4K A;  3DWA A;  5KGU A;  4IFD G;  1E1T A;  2N88 A;  4V0B A;  4HJA A;  1Q1B A;  3SGI A;  1G51 A;  1STN A;  2EPB A;  3Q8D A;  1UNS A;  1W6J A;  1YHB A;  3SE0 A;  3CRL C;  4A3D G;  1EQR A;  2Q8I B;  4F7X A;  3JAM i;  3S14 B;  5KYI A;  3ERQ A;  3T53 B;  4DGZ A;  4GOP C;  4IFD I;  3OIP A;  1G29 1;  3OYY A;  4A3L G;  4FVM A;  5IYC H;  1I6V C;  1ML0 D;  3D4D A;  1VQ4 A;  3GTG B;  1EEF D;  3CF5 A;  1S40 A;  1Y69 U;  1UEB A;  2UXD L;  4XT3 B;  3MXP A;  3PUY A;  4JOI C;  5A35 A;  5IGD A;  1VQ7 A;  1XWE A;  3HOX G;  4DAY A;  1PH2 A;  1XPR A;  5IGG A;  3M3Y B;  1TWC B;  3HKZ G;  4HMI A;  4B9W A;  4E6I A;  2BA0 A;  2PYK A;  4PG3 A;  1H9R A;  4CKC A;  4A3I H;  4NB3 A;  1HTL D;  3RLO A;  4CDD C;  2E74 C;  5NUC A;  2PMZ E;  2KCT A;  3LGJ A;  3GTP B;  5GRO A;  5HGT A;  2E2I B;  1FD7 D;  3K0X A;  2ATW A;  1YNN C;  1PRT B;  2DY7 A;  1EYC A;  5G3L F;  5JEA G;  3KF8 B;  1FNU A;  1EY4 A;  2B63 H;  2WAQ E;  1U4M A;  1M1K C;  3NBH A;  4IUP A;  1VQ8 A;  3TQY A;  3M85 A;  3CCL A;  2MHV A;  2Z0S A;  4JPB W;  1IBK Q;  3HOW G;  2IJ0 A;  5IT9 L;  3D6C A;  1HZB A;  5JPM C;  1FNW A;  2AQ1 B;  1EYD A;  1SND A;  4ODG A;  3KBG A;  1IBM Q;  3DUZ A;  4YCW A;  3K59 A;  1PH6 A;  4KHP L;  4A93 H;  1OTC A;  2NVY B;  2NBF A;  4JI4 Q;  2NWG A;  3S2D B;  2IHF A;  1S5C D;  4ZUI A;  4GZY C;  1D7Q A;  1XTC D;  2CH4 A;  1GKH A;  1MKH A;  5JJZ A;  4HJ7 A;  3L2P A;  4KJN A;  4NDX A;  4DK1 A;  1PLF A;  2I5L X;  5T1G A;  2MPM A;  5EJW A;  4BY1 B;  4YY3 L;  1Z9F A;  2E2D C;  3BU2 A;  1H9S B;  4C3H H;  1SE3 A;  5IYC G;  3V96 A;  1UE1 A;  2ASB A;  1VQJ A;  3BVM A;  4IFD J;  1K73 C;  1WD1 A;  2R92 H;  1MI2 A;  4K14 A;  1STG A;  2I07 B;  3J80 L;  4NW2 A;  3HKS A;  4U67 3;  4DV1 Q;  1EQV A;  3ONA B;  4KTA A;  5IY0 A;  1SN8 A;  1G91 A;  2R7Z H;  4IN3 A;  3MXG A;  5JJL A;  3E5S A;  1VQC A;  1WI5 A;  4KKS A;  4NXN Q;  3A74 A;  4OEL B;  5FO7 B;  4XQQ A;  5TSS A;  5C4Z A;  5E1F A;  1GM5 A;  3HOU B;  3KUP A;  4DUY L;  4ULL A;  4LF7 L;  2IL8 A;  4MIU A;  4U68 A;  1U4L A;  1MD2 D;  4A3J H;  4DR7 L;  3PO2 B;  1A2U A;  1X3E A;  4YHH Q;  4G7Z C;  4F87 A;  3OTO L;  3H3V I;  1JOK A;  1PRT C;  3M7N A;  4WFN 3;  3E6Z X;  2Q2I A;  1B3Q A;  1TU2 B;  2A68 C;  3IRB A;  3UI2 A;  4UPA A;  2K5N A;  4A3B G;  3CC2 A;  2PNH A;  4L8J A;  4QMG A;  2F0V A;  3EBE A;  2ZJQ A;  5BR8 Q;  1YEZ A;  5GAG C;  3ERO A;  4DXF A;  2YU9 H;  1SNM A;  4DR3 L;  2F52 A;  4IPH A;  1K8O A;  1SJH D;  4LFA Q;  1K0S A;  4GN3 B;  4C2M H;  4POF A;  3FMC A;  5FK9 C;  4C56 C;  1TXY A;  2OEO A;  1PYS B;  1VQB A;  4PV1 C;  4QL5 A;  4LF4 Q;  4DV2 Q;  1CUK A;  4CBV A;  2GVB A;  3S1Q B;  4CKB A;  3GTJ H;  3TS0 A;  1S5B D;  1P8L A;  2PW5 A;  1M90 C;  5JEA J;  2FMM A;  1SXT A;  1WCM H;  3I4N H;  2HHH Q;  3S17 B;  1UE5 A;  1HRJ A;  1IXR A;  5M3F B;  1KXL A;  5A2Q L;  1EZ8 A;  3I70 A;  1S5F D;  4MHE A;  2A19 A;  5I9P A;  3W3A A;  4DV0 Q;  4DV5 Q;  1XYI A;  5IYD H;  5EKL A;  2OWO A;  3I4M B;  2B2U A;  3TP5 A;  1A15 A;  4GS3 A;  3JAM L;  5BN3 A;  4K2K A;  1CM9 A;  3NQT A;  5F2D A;  1L0W A;  4FF3 A;  4C3H G;  3S16 H;  5JOB A;  5KNC A;  3H0G B;  1KDA A;  3HRZ C;  3P7J A;  1EY9 A;  1XMQ L;  1BKB A;  2WB1 G;  2R92 G;  3NE5 B;  1BBX C;  1J8I A;  2K28 A;  1JCK B;  3DLL A;  2IY5 B;  2EYM A;  4B3M L;  4HED A;  1HTP A;  2XVS A;  3RR5 A;  4HCS A;  5FLM G;  5M5W H;  3V05 A;  4LUZ A;  4Y7N B;  5EBD A;  5L37 A;  4Q5V A;  2VB2 X;  2RF4 A;  1ASZ A;  2N49 A;  1LUZ A;  3RZO H;  2NVQ H;  1Q1E A;  2ZXR A;  3T4A C;  3K7U C;  3P75 A;  2F0E A;  4OIJ A;  4HID A;  3NXW A;  1Y1W G;  1PYB A;  1X54 A;  3P1H A;  1F9Q A;  4ZKC B;  3CME A;  1K83 B;  3DHQ A;  2ENB A;  3H09 A;  4JV5 Q;  1W2B A;  4DV4 Q;  4QJF A;  4O0A A;  1R9T B;  1ILP A;  4QB4 A;  1EWI A;  1JMC A;  1TS3 A;  2BH8 A;  5GAH C;  4ID6 A;  1N36 L;  3RLF A;  2SDF A;  4L6T B;  1X56 A;  1W3S A;  4MZ9 A;  2RDG A;  2CHB D;  3J7A 5;  3AB9 A;  3WOF A;  1N8R C;  2F0W A;  4C3J H;  3IKJ A;  2MO0 A;  1RDP D;  1SYF A;  3HOV B;  2F0U A;  1RKN A;  1X32 A;  1NR4 A;  4IQZ A;  2K04 A;  5IOD A;  3K5N A;  4LF5 L;  1EL0 A;  4JCV E;  2KHI A;  2QF7 A;  2KBN A;  2OQ0 A;  1EU3 A;  1YJN A;  1CQV A;  1D6E C;  1LAC A;  3T56 B;  1X9N A;  2NB0 A;  2QKI C;  4K8I A;  2I5M X;  3JAM c;  3PF5 A;  4CKE A;  4EVO A;  4O42 A;  1U5K A;  1E2V A;  2R93 H;  1AE2 A;  2HQE A;  1K8M A;  2F3W A;  4RMF A;  4N8F A;  4DR7 Q;  5C5L A;  1TWF H;  2E75 C;  2UXB L;  3KF6 A;  4A3F H;  1YNJ D;  1XTD A;  3VYS A;  4DV3 L;  4DN4 M;  4X6A H;  4DR1 L;  4GOP A;  4POG A;  4J1M A;  3J7Z C;  4I7A A;  1QG7 A;  3TZD A;  1SJE D;  3C3L A;  3BS1 A;  3B6Y A;  3ULP A;  1V9P A;  1ICW A;  4CJ0 B;  1BBW A;  3D4R A;  3L9A X;  2CW0 D;  1S5E D;  4JOI A;  3KLS X;  4R4I A;  5AFW A;  2FFK B;  2RDF A;  3GTQ B;  3HOW B;  2K1B A;  4JI8 L;  2QW7 A;  4RA8 A;  1C8C A;  4PMB A;  5I6Y A;  3NTH A;  4K5W A;  4NPS A;  1LT4 D;  1PH9 A;  4LF8 Q;  5D14 A;  3LWU A;  5FO9 B;  1B50 A;  3FDT A;  4GNX B;  1JJC B;  4YIJ A;  4ILW A;  1PH1 A;  2Z6K C;  5AJ3 Q;  2VUM H;  3MEF A;  5IWA L;  2ZM6 Q;  3LX0 A;  4UDU C;  2F0F A;  5IP7 G;  1CHQ D;  3RNU A;  1VQK A;  2EYO A;  2PW7 A;  2KUM A;  4IPD A;  1ET6 A;  1BO0 A;  3MVV A;  1VQP A;  2EDG A;  3I8Z A;  2KQ3 A;  1XNQ L;  2PNR C;  2BDN A;  4K6L A;  1I6H H;  1NSN S;  2CWA A;  3FPP A;  2RDH A;  1F2L A;  1F2M A;  3DMU A;  2ICI A;  3GTO H;  1V1P A;  4DK0 A;  3OWF A;  4DV7 Q;  1EQT A;  3FRP B;  1EYG A;  1HJP A;  2JA5 H;  1HNZ L;  3OWE B;  4KHZ A;  2JE6 I;  4KY7 A;  3QB3 A;  2DUD A;  3PO3 H;  3BG3 A;  4KV6 A;  2TMP A;  4K5V A;  3STB C;  1B70 B;  2MQH A;  1Y14 B;  1VMC A;  1LT6 D;  4IAL A;  2QEX A;  1X3G A;  5IT9 E;  3GTL H;  4A3I B;  2XRQ D;  2PCF B;  2R7F A;  3K5M A;  4GN4 B;  2FHT A;  1EY6 A;  2MFI A;  1B1Z A;  4EQP A;  4DK6 C;  3G48 A;  1L1O B;  3SEB A;  5COY A;  3TME A;  4DU9 A;  1XX8 A;  3RZD B;  4C1N I;  3NTI A;  1WD0 A;  1VQA A;  2F0I A;  2B63 B;  4IUQ A;  1BOS A;  3E9H A;  1UEA B;  1BVS A;  1O80 A;  2PQE A;  1VMP A;  3LWE A;  1QUQ B;  1PH5 A;  1JJ2 A;  4WJ4 A;  2K5W A;  1IW7 C;  4ZKB B;  2N78 A;  4OO1 H;  3SR1 A;  2A6E D;  1PRT F;  2AKW B;  4J8Q A;  4ZRZ A;  3CCM A;  3PGZ A;  2D5D A;  1B53 A;  2DN8 A;  4X65 Q;  4GNX C;  4KI0 A;  3WDN A;  1V8Q A;  4EQO A;  2RHQ B;  2J0T D;  3S1N H;  3TS2 A;  4A93 B;  4LAA A;  1OXS C;  2EZV A;  3HOU G;  3KF8 A;  2QIL A;  2OTJ A;  1EEI D;  1FNV A;  2D62 A;  1N33 Q;  1TY2 A;  4XYO A;  4HJ9 A;  3KOJ A;  4RG1 A;  5J1Z A;  4PMC A;  2F0D A;  5C44 H;  1SYE A;  4KKU A;  1Q81 C;  1ENA A;  1GOZ A;  4ABN A;  5C3E H;  1DJR D;  4CDE C;  2KEC A;  4C3H B;  4MN3 A;  1LTB D;  2YV5 A;  1PZJ D;  3J7A F;  4BXX H;  4P75 A;  5IIF A;  2WB1 B;  3X3M A;  1BNZ A;  2R92 B;  1NR2 A;  1IKL A;  3CP0 A;  2JA5 G;  3K57 A;  3SHL A;  1IBK L;  3NTK A;  3IFD A;  1KTK A;  2R7Z B;  1JE4 A;  1Q3L A;  1KRS A;  1SRU A;  1TS2 A;  1PVO A;  1A0I A;  4KY5 A;  2Z9H A;  1STH A;  5J39 A;  3NWT A;  1IBM L;  1MBY A;  5FJ8 G;  4A3J B;  4A3C H;  2VL6 A;  5M3F G;  4DR2 Q;  2Q8R E;  1L1O C;  1H9S A;  4JI4 L;  3PIO 3;  2VNU D;  4AYB G;  1CA5 A;  3CW2 C;  2WV6 D;  3J80 i;  3UDG A;  1VCI A;  3I4M G;  5A2Q E;  1SYD A;  1TWA H;  3QR8 A;  2EE1 A;  4GKJ L;  3J7Y W;  4FDB A;  2KCN A;  4ZK9 B;  2YU9 B;  4DV6 Q;  4IUV A;  4DNT B;  4YCV A;  3DXJ C;  4C2M B;  4LFC Q;  2C35 B;  4JI1 Q;  1ENF A;  3JAM E;  1STB A;  2YTY A;  2NTS A;  1FL0 A;  3A54 A;  2KOL A;  4DAP A;  3EVQ A;  3GTK B;  3HGB A;  2M2L A;  3CAM A;  3GTJ B;  4LF6 Q;  5KRU A;  2JA6 H;  1IL8 A;  2N55 A;  1MHW C;  1IBL Q;  1WCM B;  4RFB A;  3I4N B;  5G3L D;  3S1M H;  1JJG A;  2WKD A;  1SYC A;  1ICF B;  3KLW A;  1SFO H;  4NXN L;  4RAU C;  1XNQ Q;  4XDX A;  2E76 C;  4N9P A;  4A4I A;  5IP9 H;  1WTP A;  3OIQ A;  1K3R A;  1MSH A;  3OMG A;  2Y0S E;  4YHH L;  1SDF A;  3RMH A;  5C3X A;  2MO1 A;  4R4O A;  5M3M H;  3OOC A;  4GKK Q;  5EKI A;  3TP6 A;  5C3E G;  3HFZ B;  3LNN A;  1PTO H;  3I2Z A;  1YIT A;  3A5U A;  1NBW A;  1KC8 C;  1KDC A;  3RD4 A;  3S16 B;  4NP5 A;  5BR8 L;  1B44 D;  5BN5 A;  5LL6 X;  1A62 A;  3GP7 A;  4QUC A;  1SSO A;  2A6H D;  4L5R C;  4AIM A;  3TSS A;  1EY7 A;  4LFA L;  4P73 A;  4XT1 B;  1J6Q A;  3M4Y A;  5I2X A;  3K5L A;  1HNX Q;  1EY0 A;  1CZW A;  3GV3 A;  1K9M C;  4OIK A;  2B29 A;  4I65 A;  2K05 A;  4LF4 L;  4DV2 L;  2CFM A;  5M5W B;  1IKM A;  2ES2 A;  2X6G A;  2MGS A;  3HOV G;  3J81 i;  2HHH L;  3FKI H;  3RZO B;  4HR7 B;  2NVQ B;  4KD4 A;  2GA4 B;  1GD7 A;  4C3I H;  5ELO A;  4A3E H;  4XQJ A;  1KD1 C;  1VQL A;  4DV0 L;  5IOC A;  1BDO A;  1PTO D;  5GAE C;  4DV5 L;  5FO8 B;  3IFT A;  5JVG 3;  1A8V A;  4CGY B;  3E0J A;  2Z4I A;  1CSQ A;  1Q86 C;  2WP8 J;  1MSG A;  2NUC A;  4CDF C;  4QCL A;  2QDL A;  1QNK A;  1STA A;  3S15 H;  3Q23 A;  4G7H C;  4X3K A;  1EZ6 A;  2JA7 H;  1U4P A;  3VYT A;  1VDZ A;  4RGO S;  4DF7 A;  2E2J H;  1RF2 D;  5ELC A;  3EQL C;  4X3U A;  4YWK A;  2Z1C A;  1ONL A;  2DJF C;  3I56 A;  3MZ5 A;  1PV4 A;  1SNC A;  5C0X H;  3QIA A;  2A73 B;  3AFQ A;  4B9X A;  3I7F A;  2VXW A;  2KHJ A;  5CV8 A;  4ZAI A;  1UE7 A;  1KAW A;  2L1B A;  1EY5 A;  2IW3 A;  3G4S A;  1CKM A;  4HAE A;  5M3M G;  1FYC A;  1PZK D;  3U58 A;  3W5O A;  1KL9 A;  1EFW A;  2F1M A;  2L9H A;  3TN2 A;  3CCJ A;  3AQQ A;  1KDB A;  4DR5 Q;  1KIX A;  2Z6K A;  2R93 B;  4JV5 L;  3HZX A;  4DV4 L;  1EYA A;  2LSS A;  5CV7 A;  1Z7T A;  4YWL A;  4MTN A;  2R61 A;  3KYH C;  3TRE A;  1TWF B;  4B3S Q;  2LS0 1;  2B2W C;  3A56 A;  4KMU C;  4A3F B;  2F0K A;  1GUG A;  3BVZ A;  3TP8 A;  1K8A C;  3Q22 A;  4JW0 A;  4TQU S;  2AQ2 B;  3VR2 A;  1DYQ A;  1IYJ B;  5IGE A;  1WTQ A;  4GKJ Q;  4H7B A;  3A7L A;  4LK1 C;  3FKI G;  1ZYR C;  1PH8 A;  3W1G A;  4DAV A;  1WYD A;  1JC7 A;  2N8N A;  1VQ5 A;  2M9V A;  1NMG A;  3KJO A;  2XWB B;  1YI2 A;  1JB3 A;  4EQ5 A;  2XN9 C;  2JA7 G;  3W2D A;  2K5D A;  4OWW B;  4XQN A;  4LJZ C;  1QCB D;  4DNR B;  1JOQ A;  3I3C A;  1A3U A;  2BDO A;  2VUM B;  2GVA A;  3M9B A;  1GJX A;  2JA8 H;  4A3I G;  3SK4 A;  2WAQ G;  2K5V A;  2KA7 A;  2KJX A;  2RHS B;  4CDC C;  1SMY C;  3C2P A;  1GUW A;  1WTH A;  3TP7 A;  2A5H A;  2JP1 A;  1DON A;  1BCP B;  1RTN A;  1HQM C;  2L15 A;  5CBE E;  5JPN C;  2B63 G;  1I6H B;  3T1Y Q;  3KDF A;  3GTO B;  4NXM Q;  1RTO A;  4FF2 A;  5KNB A;  1HUN A;  1EU4 A;  1O7I A;  2JA5 B;  5CMD A;  4KJO A;  4KHV A;  4GNX A;  2EVB A;  4DKA C;  4BA2 I;  2ZJP A;  3PO3 B;  1E24 A;  2K5H A;  1JB7 A;  1AFP A;  5IT9 c;  4BS9 A;  1T5X D;  1AZP A;  2YYZ A;  4LF8 L;  2F0S A;  3MC0 B;  3QOL A;  2FJ2 A;  4A93 G;  3GTL B;  4AQY Q;  1EFI D;  3ZJY C;  4UHV A;  1XMO Q;  3EJI A;  1LTI D;  4AYB B;  3NUC A;  5AJ3 L;  1GUT A;  1I4R A;  4B3R Q;  3M7G A;  1H9K A;  1VQD A;  2ZM6 L;  1JOR A;  2D0P A;  2F0N A;  2K75 A;  5DEH A;  4G57 A;  1MJE A;  3J81 L;  2A69 C;  4KK7 A;  1DD2 A;  4R9W A;  1JWS D;  3X3N A;  3QOJ A;  1YNX A;  2Z6B A;  2BA1 A;  1V1O A;  2F0J A;  4DV7 L;  2F0L A;  3D0F A;  3J80 c;  1X3P A;  2EJG C;  4BA1 I;  2R7Z G;  3NEN A;  1AZQ A;  1C7Y A;  1B4O A;  4LF9 Q;  1L1O A;  1RD9 D;  3S1N B;  3BYY B;  4B3T L;  1IYU A;  3A8I E;  4A3J G;  1I4G A;  1Z6H A;  1XJV A;  4HJ5 A;  1TY0 A;  1BCP C;  2EY2 A;  5KYL A;  3J7A V;  3E0E A;  5C44 B;  4DR4 Q;  1QUQ A;  3BDL A;  1QE6 A;  5C3E B;  4IUT A;  4DAY B;  2B2V C;  1KLG D;  3D3R A;  2K03 A;  5C4H A;  4IUR A;  1YNN D;  2A1A A;  3DEP A;  1VF5 C;  1CKN B;  5DNF A;  1QZG A;  2NN6 H;  1HPC A;  5C4J B;  4EGV A;  3KFU A;  3PUV A;  5ELF A;  5I6W A;  2QCP X;  5E4X A;  5HUR A;  2HDM A;  3R2I A;  2UU9 Q;  2UUC Q;  2G9H D;  3CMA A;  4X65 L;  1WCM G;  3F1Z A;  3I4N G;  3H91 A;  5CV4 A;  2NZH A;  2O5I C;  1SBB B;  2RBM A;  2VS1 A;  4JK1 C;  5CBA E;  4GLA C;  2OF1 A;  4R8I A;  2HIV A;  1YJ9 A;  1AN8 A;  3VA5 A;  2O4X A;  2E5L Q;  3CKI B;  5IYD G;  1N33 L;  3UE0 A;  2A74 C;  4JI0 Q;  3N52 A;  2AWO A;  2BE5 C;  2B3G A;  1TWA B;  1VS0 A;  3FEW X;  2JXM B;  4RKB A;  3ZYY X;  2RKS A;  3RN5 A;  3K6O A;  3VDY A;  1O78 A;  2L12 A;  1YJW A;  1D8L A;  1DCZ A;  2CWP A;  3J81 c;  4HIM A;  1KLU D;  2GN5 A;  4IJH A;  2LMC B;  2MNA A;  1NNX A;  1NCV A;  1BQQ T;  1PH4 A;  1PFS A;  2F0H A;  1D5M C;  2EQS A;  3F8T A;  3D6W A;  4X62 Q;  2JA6 B;  1A3V A;  3DWP A;  4WJW A;  3T1H L;  5KIX A;  3PIP A;  2D2C C;  1D2B A;  4KN7 C;  2DGY A;  4X66 L;  4FYD A;  1E2W A;  2C9O A;  1YVC A;  3S1M B;  1SFO B;  1FR3 A;  3NQI A;  3EFX D;  1R4P B;  1TKW B;  4L5Q A;  1H9J A;  3K0Y A;  4DNI A;  1YZ6 A;  4DR2 L;  1QWY A;  4IUN A;  2F0Q A;  3A7A B;  1X6O A;  5M3M B;  1HR0 W;  5LHY 1;  1CK1 A;  5C4X H;  1PRT D;  2F4V Q;  1HH2 P;  2A68 D;  4DXG A;  1G6Z A;  5IYB H;  1KRT A;  3MFG A;  5CV5 A;  3R93 A;  2B8F A;  1QB5 D;  1SE2 A;  3QWN A;  4DV6 L;  3GDE A;  4KLK A;  4BY1 H;  3ND8 A;  1NJI C;  2NZO A;  4LFC L;  4OXP A;  1O7L A;  3U4Z A;  3EIV A;  4JI1 L;  1BR9 A;  5E4W C;  3HS0 C;  3E9I A;  5DLQ E;  4LF6 L;  1X55 A;  4C3J G;  1PZI D;  5IGB A;  1NE3 A;  3NSW A;  3MXU A;  3UDX A;  3U9S A;  5EPK A;  5CGK A;  4A75 A;  1AH9 A;  3CQZ H;  4A3K H;  3CCQ A;  1IBL L;  4BBS H;  1ENC A;  2NN6 I;  3FKI B;  1STE A;  1ASY A;  1Q90 A;  3T51 B;  4C3I B;  4A3E B;  1K3B C;  1D1K A;  2IX0 A;  1ZKO A;  2HDL A;  3BZC A;  1HCZ A;  1U0L A;  2SNS A;  4GKK L;  1VQI A;  1RJT A;  4QGU A;  1NTG A;  2HQL A;  2PMZ B;  5LMU Q;  3HOZ H;  1B9N A;  5JJI A;  3NWS A;  3CHB D;  3S9W A;  5DM6 3;  2B2W A;  3S15 B;  4B3T Q;  3G7L A;  2JA7 B;  2R93 G;  2E2J B; 
#chains in the Genus database with same CATH homology
 3GQB A;  3I4L A;  3NPP A;  1GHJ A;  3N6R A;  2WAQ B;  3IAY A;  1GUN A;  2JYO A;  3BZD B;  4RGT A;  2ID0 A;  1WTV A;  1LT5 D;  2K32 A;  2X6L A;  2HUG A;  2C5C A;  4P2C B;  1WTX A;  1LLR D;  5FOB B;  1PDQ A;  4K2L A;  2NYZ D;  1OXV A;  4F88 A;  4HSP A;  3AMU A;  1A6X A;  1BF4 A;  3TZU A;  1JOO A;  2MP1 A;  3NHH A;  1LAB A;  1LV9 A;  5FLX L;  2PO4 A;  2J7Z A;  2B2Y C;  4L63 B;  3J80 E;  1LT3 D;  1D5Z C;  4XXE A;  4UAI A;  3GO5 A;  1D1I A;  3OPO A;  1CT1 D;  2CQA A;  2XRS D;  1WTR A;  2XWJ B;  2HCI A;  1O7Z A;  2BOS A;  2RA4 A;  4M1U B;  1HA5 A;  1U4R A;  2K01 A;  4HMJ A;  1PYW D;  1VF7 A;  3GV6 A;  1I4X A;  1ESR A;  3L3O C;  1B9M A;  5EBC A;  3Q0A A;  2RVL A;  4XTC S;  2JA8 B;  4XIG S;  2AQ3 B;  4IFD H;  2F0G A;  1CTM A;  5IGF A;  1PFM A;  1I4H A;  3KLS A;  1Q8I A;  3SVM A;  1HFN A;  4FXG C;  2O5J C;  1DM0 B;  4OO1 G;  3J81 E;  1BCP F;  2EYL A;  4FNF A;  1B2T A;  3IL8 A;  1IHZ A;  3TDQ A;  1S4Z A;  2SEB D;  1RCV D;  3KK7 A;  1W6K A;  3AU7 A;  3SK5 A;  4OO1 I;  2KVM A;  2B2V A;  1QOH A;  1ZXT A;  5D3I B;  1RHP A;  2EY6 A;  2MJ8 A;  3D4W A;  4B08 A;  2EY1 A;  5ELD A;  1EIH A;  2LFN A;  4ME5 A;  5JEA H;  1TII D;  5M9O A;  2PPB C;  4IZ8 A;  1GHK A;  1STY A;  1A3T A;  4JBW A;  4FF1 A;  3CU7 A;  4CHT B;  1Y8O B;  3H6M A;  2O2L D;  2HCC A;  4X3T A;  1IYV A;  4LMQ D;  1HXY D;  3MFY A;  1HUM A;  3MAQ A;  2F03 A;  5EPJ A;  5K36 H;  2TSS A;  4FF4 A;  2MUY A;  2M00 A;  1DOM A;  4V19 0;  1V43 A;  4C3J B;  1IW7 D;  1LTG D;  2J4X A;  1F77 A;  4RCN A;  3VA7 A;  4KD3 A;  4ZQ3 A;  3SK6 A;  2G9D A;  5JAV A;  4OL7 A;  3DEO A;  3T16 A;  4H13 C;  3RUZ A;  3MTS A;  2K6A A;  4RHS A;  1C48 A;  4CJ1 B;  3DM1 A;  3EA6 A;  5CC4 A;  3ND9 A;  1PFN A;  1Y8N B;  1OO9 B;  4RH6 A;  2KED A;  1LTS D;  4CJ2 C;  2KCC A;  1AEX A;  3GD7 A;  2OT2 A;  4S3S A;  4ZLT F;  1CQF A;  2Q8T A;  1UAP A;  1TVX A;  1HHV A;  1E0B A;  5CR3 A;  5KEE A;  1WTW A;  2L4N A;  3OHX C;  2KEE A;  4DFA A;  3I73 A;  1JIC A;  4TKO B;  1M4V A;  2WKC A;  2EY5 A;  1SNO A;  5J22 A;  4C3I G;  3URY A;  1XXG A;  1EIG A;  1SE4 A;  2XSC A;  2EJM A;  1A2T A;  4NKL A;  2DNE A;  1HFG A;  4QF4 A;  5C4X B;  1F9R A;  2BCO A;  1QJO A;  5FKA C;  5K36 G;  2L55 A;  2DY8 A;  5JVH 3;  3C1E A;  1PMR A;  3WOE A;  1YNJ C;  4FO2 A;  1PTO F;  3PUZ A;  5C0X G;  1L0X B;  2EJF C;  5ELB A;  3KBX A;  3CQZ B;  4A3K B;  4BBS B;  1DOK A;  3VR4 A;  1PFB A;  5EGT A;  5E3F A;  3P20 A;  1F9S A;  3H94 A;  2CW0 C;  5C0X I;  5EQ0 A;  1O7Y A;  2B2Y A;  2IT1 A;  3PV0 A;  1LTT D;  3HOZ B;  2K7V A;  3Q24 A;  1JWM D;  1DOL A;  1GUS A;  3ITP A;  4RWS C;  1CI3 M;  4QUF A;  1TQO A;  3FPU B;  4O1N A;  5FLX E;  5KND A;  4G7O C;  2D9U A;  2ZT9 C;  4RHR A;  1E2Z A;  4PQX A;  3MEH A;  4OHJ A;  2WII B;  3DWQ A;  1F2Z A;  5C5M A;  1Y1V B;  3TBI B;  1JWU D;  4BWG B;  3C1F A;  2H1E A;  3HOY B;  3L7Z C;  4FXK C;  4BY7 B;  1F2Y A;  2EOT A;  3NP8 A;  5D65 A;  5C3W A;  2ICE C;  2NTT A;  1X3Q A;  1D5X C;  1Y8P B;  4RGM A;  2WIN B;  4G4K A;  2EYJ A;  5I9O A;  1C4Q A;  3BDO A;  1JQY D;  1Q12 A;  1II3 A;  4A3M B;  1ZEQ X;  1PXU A;  1EWC A;  4NMZ A;  4DA2 A;  4HTH A;  1DXM A;  2F0M A;  4J6H A;  2L0C A;  2AWN A;  5C0X J;  2A6E C;  5COR A;  4K5X A;  5CV9 A;  1I3Q B;  5ELE A;  3BYT B;  2LKV A;  5C6A A;  3K58 A;  1SYB A;  2XIW A;  5T1I A;  2DNC A;  3A8K E;  2K33 A;  2IX1 A;  4XYQ A;  4R8N A;  1CHP D;  2B2T C;  1WTO A;  1M8A A;  4I7Z C;  1G2T A;  3OMC A;  2L5T A;  3BDC A;  2JEA I;  3OW7 A;  5I2Y A;  1BXT A;  4QIW B;  4A3D B;  1R4Q B;  2ZXP A;  4KY6 A;  2LY7 A;  5CYU A;  1ZYR D;  5CV6 A;  1TR5 A;  1L0Y B;  5D3D A;  1EWH A;  1H9M A;  2Y0S B;  2R6G A;  2OXP A;  3HOX B;  1KAA A;  2R3Z A;  1G8Z D;  2NVT B;  3HKZ B;  3V2T A;  5I4D A;  3C46 A;  3SK8 A;  1PTO B;  3A8J E;  1SMY D;  3VR3 A;  3M4O B;  4F8M A;  3FVQ A;  2WAC A;  3VYR A;  1UUP A;  1SAP A;  4FXD A;  2IPK D;  1G2S A;  2EYP A;  4K8J A;  2NN6 G;  4N9T A;  4EQN A;  5ISR A;  4HCE A;  3PUW A;  4WOR A;  1TWG B;  1TS5 A;  4HN7 A;  3QO2 A;  1J9O A;  4C1N K;  3D31 A;  1KAB A;  3D8G A;  4RCO A;  2F0T A;  2RSO A;  4H44 C;  3GTM B;  4RGN A;  3NK9 A;  3PUX A;  3MHB A;  1SEB D;  2X69 A;  1LTA D;  1OXU A;  1CA6 A;  2FIN B;  5EKK A;  5LL6 S;  1FGB D;  2F0P A;  2JSO A;  2A6H C;  1CFM A;  2A69 D;  3QG1 A;  5K5P A;  4PNY A;  3KLR A;  3S2H B;  4KN4 C;  2KHS A;  3VR5 A;  2PZU A;  1EY8 A;  2PZT A;  3PIP 3;  5IGC A;  1DZ1 A;  3NBI A;  1LTR D;  2CVR A;  3R2T A;  1I4Q A;  2ZXO A;  1EOT A;  3QJY A;  2F3V A;  2IX3 A;  4FP5 D;  1PTO C;  1Z47 A;  1ESF A;  1OXX K;  2QEJ C;  1BCP D;  1NAP A;  2L11 A;  4A3B B;  1MGS A;  1I50 B;  5EPL A;  1WVL A;  4IUU A;  3BVG A;  2SOB A;  1T5E A;  2V4D A;  2NZ1 D;  4H0L C;  2Z8L A;  4Z9C B;  2SNM A;  4PMW A;  3CRK C;  4RKL A;  2B39 A;  3I90 A;  5DAU A;  2F0O A;  2EYH A;  1TWH B;  2BE5 D;  2EYF A;  3S1R B;  4ZYS A;  3VYU A;  3R3O A;  2PZW A;  1QNU A;  3F2U A;  3A55 A;  1ROD A;  5M5Y B;  4HSV A;  2AUJ D;  2Z4H A;  3K5O A;  2B2U C;  3I91 A;  3H3V C;  3HP3 A;  1JR0 D;  4BBR B;  1TS4 A;  1KNE A;  2RQX A;  4Q0F A;  3MXN A;  4WRD A;  4KKT A;  1OXT A;  1F9P A;  2K5Q A;  5M5X B;  2B8G A;  1Y1W B;  1B3A A;  1QIL A;  5BN4 A;  2VB3 X;  4M8A A;  1AW7 A;  4K6D A;  3HG9 A;  3VR6 A;  1SNP A;  4OGQ C;  2AUK A;  2XNA C;  3PMF A;  1CZG A;  2FMC A;  3MA2 B;  2H4O A;  1ET9 A;  2I46 A;  1S5D D;  1GUO A;  1KNA A;  3O13 A;  1SNQ A;  2IWH A;  3U9O A;  2QDB A;  1U9R A;  1SYG A;  4TRD A;  1GXD C;  3G6J B;  4TSS A;  1LO5 D;  2NVX B;  4ZUJ A;  3SXH A;  3HEJ A;  4X3S A;  3MWY W;  3R8B A;  1TT2 A;  3SDZ A;  2F4I A;  1HA6 A;  2EXZ A;  1HQR D;  1BUV T;  1I4P A;  3OSO A;  2B2T A;  3T13 A;  1NUC A;  3I72 A;  3Q6S A;  5DM7 3;  1ILQ A;  1AP0 A;  2E2H B;  1V1P B;  2JEB I;  3K7A B;  2RSN A;  4A3G B;  3DWA A;  5KGU A;  4IFD G;  2N88 A;  4V0B A;  1Q1B A;  1STN A;  2EPB A;  1UNS A;  1W6J A;  3SE0 A;  3CRL C;  2Q8I B;  4F7X A;  3S14 B;  5KYI A;  3ERQ A;  3T53 B;  4DGZ A;  4IFD I;  3OIP A;  1G29 1;  4FVM A;  1I6V C;  1ML0 D;  3D4D A;  3GTG B;  1EEF D;  1Y69 U;  4XT3 B;  3MXP A;  3PUY A;  5A35 A;  5IGD A;  1XWE A;  4DAY A;  5IGG A;  3M3Y B;  1TWC B;  4HMI A;  4B9W A;  4E6I A;  2BA0 A;  2PYK A;  1H9R A;  4CKC A;  1HTL D;  2E74 C;  5NUC A;  3GTP B;  5HGT A;  2E2I B;  1FD7 D;  1YNN C;  1PRT B;  2DY7 A;  1EYC A;  5G3L F;  5JEA G;  1FNU A;  1EY4 A;  1U4M A;  3NBH A;  4IUP A;  3M85 A;  2MHV A;  2IJ0 A;  5IT9 L;  3D6C A;  5JPM C;  1FNW A;  2AQ1 B;  1EYD A;  1SND A;  4ODG A;  3KBG A;  3DUZ A;  3K59 A;  2NVY B;  2NBF A;  2NWG A;  3S2D B;  1S5C D;  4ZUI A;  4GZY C;  1XTC D;  5JJZ A;  4KJN A;  4NDX A;  4DK1 A;  1PLF A;  5T1G A;  2MPM A;  5EJW A;  4BY1 B;  2E2D C;  1H9S B;  1SE3 A;  3V96 A;  3BVM A;  4IFD J;  1WD1 A;  1MI2 A;  4K14 A;  1STG A;  2I07 B;  3J80 L;  4NW2 A;  4U67 3;  1EQV A;  3ONA B;  4KTA A;  1G91 A;  4IN3 A;  3MXG A;  3E5S A;  4KKS A;  5FO7 B;  4XQQ A;  5TSS A;  5C4Z A;  5E1F A;  3HOU B;  3KUP A;  4ULL A;  2IL8 A;  4MIU A;  4U68 A;  1U4L A;  1MD2 D;  3PO2 B;  1A2U A;  4G7Z C;  4F87 A;  1JOK A;  1PRT C;  3M7N A;  4WFN 3;  3E6Z X;  1TU2 B;  2A68 C;  3UI2 A;  4L8J A;  4QMG A;  2F0V A;  3ERO A;  4DXF A;  1SNM A;  1K8O A;  1SJH D;  3FMC A;  5FK9 C;  4C56 C;  2OEO A;  4PV1 C;  4CBV A;  3S1Q B;  4CKB A;  1S5B D;  2PW5 A;  5JEA J;  2FMM A;  1SXT A;  3S17 B;  1HRJ A;  5M3F B;  5A2Q L;  1EZ8 A;  3I70 A;  1S5F D;  4MHE A;  5I9P A;  3W3A A;  1XYI A;  5EKL A;  3I4M B;  2B2U A;  3TP5 A;  1A15 A;  3JAM L;  5BN3 A;  4K2K A;  1CM9 A;  3NQT A;  5F2D A;  4FF3 A;  4C3H G;  5JOB A;  5KNC A;  3H0G B;  1KDA A;  3HRZ C;  3P7J A;  1EY9 A;  3NE5 B;  1BBX C;  1J8I A;  2K28 A;  1JCK B;  2EYM A;  4HED A;  1HTP A;  2XVS A;  4HCS A;  3V05 A;  4Y7N B;  5EBD A;  4Q5V A;  2VB2 X;  1Q1E A;  2ZXR A;  3T4A C;  3P75 A;  2F0E A;  4OIJ A;  3NXW A;  3P1H A;  1F9Q A;  4ZKC B;  1K83 B;  3DHQ A;  2ENB A;  3H09 A;  1R9T B;  1ILP A;  4QB4 A;  1TS3 A;  4ID6 A;  3RLF A;  2SDF A;  4L6T B;  2RDG A;  2CHB D;  3AB9 A;  3WOF A;  2F0W A;  3IKJ A;  1RDP D;  1SYF A;  3HOV B;  2F0U A;  1RKN A;  1X32 A;  1NR4 A;  4IQZ A;  2K04 A;  5IOD A;  3K5N A;  1EL0 A;  2QF7 A;  1EU3 A;  1CQV A;  1D6E C;  1LAC A;  3T56 B;  2NB0 A;  2QKI C;  4K8I A;  4CKE A;  4EVO A;  4O42 A;  1E2V A;  2HQE A;  1K8M A;  2F3W A;  5C5L A;  2E75 C;  1YNJ D;  3VYS A;  4DN4 M;  4J1M A;  1QG7 A;  3TZD A;  1SJE D;  3C3L A;  3BS1 A;  1ICW A;  4CJ0 B;  3D4R A;  3L9A X;  2CW0 D;  1S5E D;  3KLS X;  5AFW A;  2FFK B;  2RDF A;  3GTQ B;  3HOW B;  2K1B A;  4RA8 A;  1C8C A;  4PMB A;  5I6Y A;  3NTH A;  4K5W A;  1LT4 D;  5D14 A;  3LWU A;  5FO9 B;  1B50 A;  3FDT A;  4YIJ A;  4ILW A;  3LX0 A;  4UDU C;  2F0F A;  1CHQ D;  2EYO A;  2PW7 A;  2KUM A;  1ET6 A;  1BO0 A;  3MVV A;  2EDG A;  3I8Z A;  2KQ3 A;  2PNR C;  2BDN A;  4K6L A;  1NSN S;  3FPP A;  2RDH A;  1F2L A;  1F2M A;  3DMU A;  2ICI A;  1V1P A;  4DK0 A;  3OWF A;  1EQT A;  3FRP B;  3OWE B;  4KHZ A;  2JE6 I;  4KY7 A;  3QB3 A;  3BG3 A;  4KV6 A;  2TMP A;  4K5V A;  1VMC A;  1LT6 D;  4IAL A;  5IT9 E;  4A3I B;  2XRQ D;  2PCF B;  3K5M A;  2FHT A;  1EY6 A;  1B1Z A;  4EQP A;  3TME A;  3SEB A;  5COY A;  4DU9 A;  1XX8 A;  3RZD B;  4C1N I;  3NTI A;  1WD0 A;  2F0I A;  2B63 B;  4IUQ A;  1BOS A;  1UEA B;  1O80 A;  2PQE A;  1VMP A;  3LWE A;  2K5W A;  1IW7 C;  4ZKB B;  4OO1 H;  3SR1 A;  2A6E D;  1PRT F;  4J8Q A;  4ZRZ A;  2D5D A;  1B53 A;  2DN8 A;  4KI0 A;  3WDN A;  1V8Q A;  4EQO A;  2J0T D;  4A93 B;  4LAA A;  1OXS C;  2EZV A;  3KF8 A;  2QIL A;  1EEI D;  1FNV A;  2D62 A;  1TY2 A;  4XYO A;  5J1Z A;  4PMC A;  2F0D A;  1SYE A;  4KKU A;  1ENA A;  1GOZ A;  4ABN A;  1DJR D;  2KEC A;  4C3H B;  4MN3 A;  1LTB D;  1PZJ D;  3J7A F;  5IIF A;  2WB1 B;  3X3M A;  1BNZ A;  2R92 B;  1NR2 A;  1IKL A;  3K57 A;  3SHL A;  3NTK A;  3IFD A;  1KTK A;  2R7Z B;  1JE4 A;  1Q3L A;  1TS2 A;  4KY5 A;  1STH A;  5J39 A;  3NWT A;  1MBY A;  4A3J B;  2Q8R E;  1H9S A;  3PIO 3;  2VNU D;  1CA5 A;  2WV6 D;  1VCI A;  5A2Q E;  1SYD A;  2EE1 A;  3J7Y W;  2KCN A;  4ZK9 B;  2YU9 B;  4IUV A;  4DNT B;  3DXJ C;  4C2M B;  1ENF A;  3JAM E;  1STB A;  2NTS A;  3A54 A;  2KOL A;  4DAP A;  3EVQ A;  3GTK B;  3HGB A;  2M2L A;  3GTJ B;  5KRU A;  1IL8 A;  2N55 A;  1WCM B;  4RFB A;  3I4N B;  5G3L D;  2WKD A;  1SYC A;  4RAU C;  4XDX A;  2E76 C;  4N9P A;  1WTP A;  3OIQ A;  1MSH A;  3OMG A;  1SDF A;  3RMH A;  5C3X A;  3OOC A;  5EKI A;  3TP6 A;  3LNN A;  1PTO H;  3S16 B;  1KDC A;  3RD4 A;  4NP5 A;  1B44 D;  5BN5 A;  5LL6 X;  3GP7 A;  4QUC A;  1SSO A;  2A6H D;  3TSS A;  1EY7 A;  4XT1 B;  3M4Y A;  5I2X A;  3K5L A;  1EY0 A;  1CZW A;  3GV3 A;  4OIK A;  4I65 A;  2K05 A;  5M5W B;  1IKM A;  2X6G A;  2MGS A;  3RZO B;  4HR7 B;  2NVQ B;  4KD4 A;  2GA4 B;  4XQJ A;  5IOC A;  1BDO A;  1PTO D;  5FO8 B;  3IFT A;  5JVG 3;  4CGY B;  3E0J A;  2Z4I A;  2WP8 J;  1MSG A;  2NUC A;  4QCL A;  1QNK A;  1STA A;  3Q23 A;  4G7H C;  4X3K A;  1EZ6 A;  1U4P A;  3VYT A;  1VDZ A;  4RGO S;  4DF7 A;  1RF2 D;  5ELC A;  3EQL C;  4X3U A;  2Z1C A;  1ONL A;  3MZ5 A;  1SNC A;  5C0X H;  3QIA A;  2A73 B;  4B9X A;  2VXW A;  5CV8 A;  4ZAI A;  2L1B A;  1EY5 A;  2IW3 A;  4HAE A;  1FYC A;  1PZK D;  2F1M A;  2L9H A;  3TN2 A;  1KDB A;  2R93 B;  3HZX A;  1EYA A;  5CV7 A;  1Z7T A;  2R61 A;  1TWF B;  2LS0 1;  2B2W C;  3A56 A;  4KMU C;  4A3F B;  2F0K A;  1GUG A;  3BVZ A;  3TP8 A;  3Q22 A;  4TQU S;  2AQ2 B;  3VR2 A;  1DYQ A;  5IGE A;  1WTQ A;  4H7B A;  3A7L A;  4LK1 C;  1ZYR C;  4DAV A;  1JC7 A;  2M9V A;  2XWB B;  1JB3 A;  2XN9 C;  3W2D A;  2K5D A;  4XQN A;  4LJZ C;  1QCB D;  4DNR B;  1JOQ A;  3I3C A;  1A3U A;  2BDO A;  2VUM B;  1GJX A;  3SK4 A;  2KA7 A;  2KJX A;  1SMY C;  3C2P A;  1GUW A;  3TP7 A;  2A5H A;  2JP1 A;  1DON A;  1BCP B;  1RTN A;  1HQM C;  5CBE E;  5JPN C;  1I6H B;  3GTO B;  4FF2 A;  1RTO A;  5KNB A;  1HUN A;  1EU4 A;  2JA5 B;  5CMD A;  4KJO A;  4KHV A;  2EVB A;  4BA2 I;  3PO3 B;  1AFP A;  4BS9 A;  1T5X D;  1AZP A;  2YYZ A;  2F0S A;  3MC0 B;  3QOL A;  2FJ2 A;  3GTL B;  1EFI D;  3EJI A;  1LTI D;  4AYB B;  3NUC A;  1GUT A;  1I4R A;  3M7G A;  1H9K A;  1JOR A;  2F0N A;  5DEH A;  4G57 A;  3J81 L;  2A69 C;  4KK7 A;  1DD2 A;  4R9W A;  1JWS D;  3X3N A;  3QOJ A;  2BA1 A;  1V1O A;  2F0J A;  2F0L A;  1X3P A;  2EJG C;  4BA1 I;  1AZQ A;  1B4O A;  1RD9 D;  3S1N B;  3BYY B;  1IYU A;  3A8I E;  1I4G A;  1Z6H A;  1TY0 A;  1BCP C;  2EY2 A;  5KYL A;  3J7A V;  5C44 B;  3BDL A;  1QE6 A;  5C3E B;  4IUT A;  2B2V C;  1KLG D;  3D3R A;  2K03 A;  5C4H A;  4IUR A;  1YNN D;  3DEP A;  1VF5 C;  5DNF A;  2NN6 H;  1HPC A;  5C4J B;  4EGV A;  3PUV A;  5ELF A;  5I6W A;  2QCP X;  5E4X A;  5HUR A;  2HDM A;  3R2I A;  2G9H D;  3H91 A;  5CV4 A;  2O5I C;  1SBB B;  2RBM A;  4JK1 C;  5CBA E;  2OF1 A;  4R8I A;  3VA5 A;  1AN8 A;  2O4X A;  3CKI B;  2A74 C;  3N52 A;  2AWO A;  2BE5 C;  3FEW X;  1TWA B;  2JXM B;  4RKB A;  3ZYY X;  2RKS A;  3K6O A;  1O78 A;  2L12 A;  1DCZ A;  1KLU D;  2LMC B;  1NCV A;  1BQQ T;  2F0H A;  1D5M C;  3D6W A;  2JA6 B;  1A3V A;  3DWP A;  4WJW A;  5KIX A;  2D2C C;  1D2B A;  4KN7 C;  4FYD A;  1E2W A;  2C9O A;  3S1M B;  1SFO B;  1FR3 A;  3NQI A;  3EFX D;  1R4P B;  1TKW B;  1H9J A;  3K0Y A;  1QWY A;  4IUN A;  2F0Q A;  3A7A B;  5M3M B;  5LHY 1;  1CK1 A;  1PRT D;  2A68 D;  4DXG A;  1G6Z A;  3MFG A;  5CV5 A;  3R93 A;  2B8F A;  1QB5 D;  1SE2 A;  3QWN A;  3ND8 A;  1O7L A;  1BR9 A;  5E4W C;  3HS0 C;  4C3J G;  1PZI D;  5IGB A;  3NSW A;  3MXU A;  3U9S A;  5EPK A;  5CGK A;  1ENC A;  2NN6 I;  3FKI B;  1STE A;  1Q90 A;  3T51 B;  4C3I B;  4A3E B;  1D1K A;  2IX0 A;  1ZKO A;  2HDL A;  1HCZ A;  2SNS A;  1RJT A;  2PMZ B;  1B9N A;  3NWS A;  3CHB D;  3S9W A;  5DM6 3;  2B2W A;  3S15 B;  3G7L A;  2JA7 B;  2E2J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...