4EQNA

Crystal structure of staphylococcal nuclease variant delta+phs v23e/i72k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTEKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23E/I72K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4eqnA00
5IGCA 1EZ6A 4K8IA 4EQNA 2EYJA 3QOLA 2EYPA 3SK4A 3LX0A 4KTAA 4WRDA 4YIJA 1SYGA 3RUZA 2OEOA 4EQOA 4WORA 3MZ5A 1KDAA 2F0DA 2F0IA 2PW7A 2SOBA 3MXPA 2PQEA 5C5MA 2EXZA 1SNQA 4KD3A 5M9OA 2LKVA 3HZXA 1EY9A 4K8JA 3NQTA 5JAVA 4PMBA 4F8MA 1JORA 1EY0A 1EYCA 1NUCA 3SK8A 1JOQA 1AEXA 4ZUJA 1F2ZA 5J22A 4TRDA 1SYFA 3P75A 5EKLA 2F0VA 2F0TA 3OWFA 1EY5A 4G57A 1A2TA 3NHHA 5CV6A 1SYDA 4RKBA 5C4ZA 5CV8A 5CV5A 3T16A 5IGGA 2PZTA 2SNSA 1JOKA 1STHA 3TP6A 2OF1A 2F0QA 3PMFA 3DHQA 5CV9A 5IGFA 4OL7A 4NP5A 5I6YA 1A3TA 2F0KA 3EROA 1STNA 2EYOA 2PYKA 2EY6A 2M00A 1JOOA 2WACA 5CGKA 1A3VA 3OMGA 3SK6A 5CV7A 1KAAA 5IGEA 5K5PA 4K5VA 4R8NA 5I9PA 5KEEA 3NXWA 5C4HA 2SNMA 4KJNA 4QMGA 4KV6A 4K5XA 4E6IA 2F0LA 4IALA 5KIXA 1ENCA 2EY1A 5NUCA 4B9XA 1SNCA 2ENBA 2F0HA 2EYFA 2F0EA 2PZWA 3OMCA 4KJOA 1EZ8A 2F0SA 4DGZA 3H6MA 3EJIA 4LAAA 3MEHA 4DU9A 3D4WA 3S9WA 4QF4A 3D8GA 2F0MA 3SK5A 1II3A 3TMEA 3ITPA 1A3UA 4DFAA 1U9RA 2PZUA 1EY7A 5CR3A 5EKKA 1F2MA 3MVVA 3P1HA 5E3FA 2F0WA 2F3VA 4N9TA 4ME5A 5IGBA 3C1EA 2F0JA 4J1MA 2F0FA 5I6WA 4MIUA 1SNPA 3HEJA 2F3WA 1SNDA 4IZ8A 2EYLA 4K6DA 3BDCA 4ZQ3A 3TP7A 4HTHA 3EVQA 1SYCA 1RKNA 5DEHA 1SYBA 5IGDA 5EGTA 5IODA 4KY6A 2EYMA 2NUCA 4K14A 3T13A 4EQPA 1NSNS 1SNMA 2F0GA 4DF7A 2OXPA 5IOCA 5DAUA 2RBMA 4ZUIA 2KQ3A 2QDBA 3NK9A 2PW5A 3NP8A 5C5LA 5KGUA 5ISRA 3E5SA 2F0PA 4HMJA 3D6CA 4EVOA 3R3OA 3SR1A 5IIFA 2KHSA 2F0UA 5F2DA 4KY5A 1EY8A 4B9WA 2EY2A 1KDCA 1KDBA 2F0OA 5I9OA 4K5WA 5E1FA 1SYEA 1F2YA 3D4DA 4RKLA 5C3XA 4NKLA 1EYAA 2EYHA 1STAA 4N9PA 3QB3A 5JOBA 2HQEA 1TT2A 4J6HA 3SHLA 3MHBA 2RKSA 3DMUA 2EY5A 3BDLA 3QOJA 5CV4A 5CC4A 2O4XA 1STGA 4PMCA 3TP8A 4NMZA 4IUNA 5KYIA 3ERQA 1TR5A 1IHZA 4ODGA 4PNYA 3C1FA 3OSOA 4NDXA 4QB4A 5C3WA 2F0NA 1ENAA 4ID6A 1STBA 1EYDA 4K2KA 4KHVA 3U9OA 1EY4A 3NUCA 5KYLA 5HURA 3TP5A 5KRUA 1SNOA 4K2LA 1A2UA 4KD4A 1EY6A 1EQVA 1TQOA 4H7BA 4S3SA 4KY7A 4I65A 3SXHA 5C6AA 3V2TA 3VA5A 5HGTA 1KABA 1STYA 5J39A 2RDFA 4HMIA 4F7XA 5J1ZA
chains in the Genus database with same CATH superfamily
1PTOD 2QW7A 3M4OH 3BYYB 2WAQG 3BZDB 1CZGA 1SXTA 1XPOA 4WRDA 3HOYB 5BN3A 1O7LA 4A3KH 4BBRB 1VMPA 1YZ6A 1TS2A 3MXPA 5EPKA 2JA5H 3CC2A 4DK3C 2VXWA 2JA6B 4P72A 2IX0A 1EQTA 1TVXA 3DEPA 2F0TA 1CT1D 3TRZA 2KHIA 2ZXPA 3L0OA 4U68A 5CV8A 4APVA 3X3MA 2ALYB 1VQMA 3F2CA 4JI1Q 1PV4A 1X3QA 2YTYA 1SMYC 2D2CC 4A76A 1JJGA 2X69A 3A8JE 1TWCB 5LL6S 5FLXE 5KEEA 3OIPA 1V9PA 2M2LA 4KJNA 1AP0A 4JW0A 5IYCH 1V1PB 1NMFA 2PI2E 3H0GG 5IE8A 3J80c 1PH1A 4ZKCB 2F0SA 4ZK9B 4LAAA 4DV4L 4C3JG 5C4XG 1U0LA 1EFWA 1BQQT 4DN4M 1AN8A 2F0JA 1LACA 2F3WA 4KN4C 4JI7Q 2IHEA 4HTHA 1PTOH 1UEBA 4P75A 2PMZB 3J81c 2JA7B 1UAPA 2LXKA 5C3EB 2EYMA 4A3MH 4BA1I 1E2ZA 1E3PA 2FFKB 3PO3H 1RIPA 3CMEA 1B9NA 1YNJD 1YNXA 3CQZB 1CA5A 3NP8A 3KUPA 5M3FH 1D6EC 1GUTA 4XT1B 4JG2A 1PH8A 2EY2A 1EU3A 4K5WA 1PZID 4RKLA 2R93G 1I50B 3S1QB 1K8MA 1AFPA 5CV4A 1W2BA 4DV5Q 3TP8A 2E2DC 1YITA 4DV2L 1WCMH 2K1BA 3CC4A 1N9WA 3ZJYC 1IXRA 2PNHA 2Z1CA 3R93A 4YY3Q 5BR8L 2NN6H 4A3JB 3NENA 2JA5G 1ONLA 1WI5A 1SDFA 1X55A 3NSWA 4TVAB 1TY2A 1FJGL 3VR4A 1P16A 1VQPA 1K9MC 3QR8A 1B70B 4DR3Q 5M3MB 1FD7D 1J6QA 1JJ2A 2PPBC 2VW9A 4YWKA 1A6XA 4B3SL 2ES2A 1BCPD 2CHBD 2KCTA 1ASZA 1FNWA 4K8JA 1YIJA 3NQTA 1I4XA 1YJWA 1PTOC 2JA8H 1G6ZA 1A62A 1JT8A 3DXJC 1QVFA 3LNNA 4ZAIA 5IYCG 3KLRA 5IGGA 2ID0A 3DHQA 3HG9A 2EY6A 4LFAL 1CKNB 3NWTA 1HNXQ 2NVTB 2R7FA 1NMGA 2A6HD 3S16B 5JEAG 2A19A 1PRTC 3S14H 1V1QA 2WKCA 1SNCA 4KJOA 1SE3A 3CCRA 2IW3A 3PO3G 1U4LA 4GNXB 4DU9A 2ICEC 4KLKA 4NXNL 1CHPD 1ENFA 1KLUD 1Y1WB 2JEAI 1F9QA 4N9TA 5M3FG 1M8AA 2HT1A 5I6WA 1ASYA 1EYGA 3JAMc 1VQDA 3TZUA 3S1MH 4X3TA 2CKZB 1D1KA 1ILPA 1WCMG 4B3MQ 3STBC 1L0YB 1EEID 1FYCA 5KNDA 1AH9A 2K14A 2NN6G 3H94A 4YHHQ 4DNTB 4KY5A 2C9OA 1EY8A 3I4NB 4LF6Q 3PUVA 1PH2A 1YNJC 1F2YA 1OXSC 2VY3A 4BY7G 4A93B 5TSSA 1XMQL 1D5ZC 4P71A 1I6HB 1IL8A 2Z6KC 3OW2A 1LT6D 4AYBB 4FF4A 1U4PA 1EIGA 2V4DA 1A0IA 1EY4A 2YV5A 1WTPA 4HJ9A 2JA8G 1LTRD 1GXDC 1XNQL 5C6AA 3D4RA 4K0KL 1R9TH 1QVGA 2AWNA 2DJFC 2B2WA 4F7XA 4HIKA 2WV6D 4JBWA 1JWSD 2F0IA 2B29A 3VYUA 1EEFD 5CBAE 4A4IA 3T1HQ 5IY0A 3I56A 2A6ED 1B3AA 1WTHA 4BA2I 4DAPA 2F0VA 3RZOB 4ZCKA 1TU2B 2VB2X 3UDGA 4RKBA 3HOVB 2VUMH 2WAQE 1HNWL 2UUAL 5GAGC 1JWUD 4X66Q 1JICA 1I4PA 3ULLA 4RGOS 1GJXA 3FDTA 1HFGA 2DNCA 4NPSA 1ICWA 5E7NA 2E76C 4QGUA 2QCPX 1Q1BA 4IN3A 1Y8PB 2E2JB 2PNRC 4FYDA 1AE2A 4M8AA 2JA6H 3LWEA 3NTHA 1A3UA 2A6HC 4JI2Q 2EZVA 3S15H 3P1HA 4L5QA 4L5SA 4KI0A 3I4MB 2NZHA 3BU2A 3IAYA 4JI4L 1PHJA 4LF8L 2XN9C 3MXUA 4H44C 3QO2A 5DEHA 2A8VA 4N8FA 3CHBD 5DLQE 3T13A 2ZTDA 5EBCA 1Y8OB 3KJPA 4PZ6A 2N55A 5LHY1 5FOBB 4KHPQ 4QUCA 2KVMA 3OWEB 3PUYA 3R3OA 4IOAA 1NR2A 1EIFA 1LTID 3NPPA 1QVCA 3DMUA 1U4RA 2E74C 1TS5A 3HRZC 2DY7A 2JJQA 1BO0A 2JA9A 4JI6L 2B2TC 3K80C 2KCMA 2CH4A 1Y1VG 1RF2D 2R92G 4I65A 3HOXB 4X64Q 5JPNC 1GOZA 1HA5A 3W2DA 2VUMG 1RJTA 3S2HB 4OWXB 5COYA 4CBVA 1N34L 3HOUH 1KDAA 3L3OC 1N32L 1O7ZA 1XPUA 3SDZA 1OXTA 4DUYL 2Q2TA 1EWHA 2UXCQ 2VQFL 4IUQA 4QUFA 1CKMA 2B8FA 2K52A 2Y0SG 4FXDA 1EUJA 4DR5Q 2F03A 3L2PA 1JE4A 2MHVA 3FKIB 3ICEA 2KHJA 4UHVA 4WJWA 2JA6G 5J3BA 4IUVA 5C0XJ 4Q5VA 5M3MH 3C3LA 3K7AB 2LMCB 2VL6A 1PZJD 4IUTA 3MFYA 5CMDA 3CAMA 4QIWE 2PZWA 3OMCA 1SE4A 1DM0B 2N8NA 4HIOA 3J80E 1HNZL 1YNND 2CH4W 2CVRA 3CXCA 4IPHA 2UUCQ 1B4OA 3GTGB 2KUMA 2B63B 2F0FA 1GUNA 2D9UA 2AQ1B 1SNDA 1TWAB 2MNAA 1DOLA 1B9MA 2KECA 3BVZA 1K3BC 1HHVA 4L8JA 2K5VA 2L55A 4X62L 1XX8A 3A5ZB 5EGTA 2YU9B 2NUCA 2VS1A 1VQGA 4LF9Q 5K36H 3DUZA 1UEAB 1EL0A 3GTJB 3J81E 2QDBA 2RCFA 2NVTH 2WFWA 5ISRA 3K5MA 5LMNW 1S5BD 5F2DA 2ZTCA 2NN6I 5C3EG 1MSGA 1QNUA 1KDBA 5I9OA 1AZPA 3G6EA 1YHAA 3D4DA 4NKLA 2F4VL 4R4IA 3QOJA 1QJOA 1Y1WH 4PNYA 3CCSA 1LTBD 4DUZQ 1VQKA 1ENAA 4XIGS 2RF4A 1EYDA 2JK8A 1PRTB 1TQOA 5FJ8H 2YYZA 2JYOA 2OT2A 2HQLA 3NE5B 3GTOH 3ERSX 3GV6A 5J1ZA 4DV1L 1AE3A 1R4PB 4B3TQ 2Z6KA 1F9RA 3GO5A 4LK1C 4BWGB 3H3VI 1E0BA 5M5XH 5ELCA 4BBSB 1SN8A 1NR4A 4PMBA 5M3MG 1PH4A 1EY0A 1TXYA 4IFDJ 4ZUJA 4DR4Q 1C8CA 1XXGA 1A63A 3TDQA 5IYDH 3HP3A 4RGMA 1SYDA 3M4QA 3QWNA 2CW0D 1QUQA 1PFSA 2DUDA 1X3PA 3S24A 3E9IA 3GDEA 4A3DH 2JQOA 2NYZD 1XWEA 3HKZB 4C2MH 3WWVA 4KV6A 5IYBH 1ENCA 2JN4A 4XQNA 1H9JA 4B9XA 2B8GA 4DAVA 4DA2A 1G6PA 1GUSA 3E9HA 5KNBA 2ZM6Q 1EQRA 2GVAA 3MEHA 3S9WA 4LW1A 2F0MA 4DV6L 1II3A 2LS01 4CDEC 1C48A 3VR2A 3VR6A 4G7OC 1H95A 1KIXA 1TWFB 4MIUA 4OGQC 2A73B 1E2WA 4LUVA 5JJZA 2DGYA 1VQJA 2J4XA 3M3YB 2CQOA 1YNNC 5HGQA 2RVLA 3ULJA 2NVYH 4O42A 1VQ5A 4FF1A 3E3XA 4LFBQ 1VMCA 3JAME 1Y1WG 4A3IB 1BCPF 4FNFA 4C56C 2NVXH 2KQ3A 3KF8B 4PZ7A 4GOPC 2IHFA 5JPMC 3BYTB 4A3FH 2L11A 5LMNQ 4DK1A 5FJ8G 3M4YA 1KTKA 4A3GB 2CFMA 2L5TA 4LJZC 1LLRD 3N52A 1STAA 1YBYA 1I3QB 1QILA 4GKKL 2PQAB 5D65A 3I4MH 4C3IH 3OOCA 5ELOA 3E6ZX 3C1FA 4NDXA 4Y7NB 4OEMB 4ULLA 3NUCA 1O80A 4DK6C 4A93G 1A15A 4HIDA 1G8ZD 3TQYA 1OTCA 3VA5A 4JV5Q 5IYDG 1VQ6A 5M5WB 5M5YB 1NCVA 3LX0A 3RN2A 4ZLTF 1IKMA 2H4OA 2PW7A 2B2TA 3FVQA 4KD3A 1X9NA 1HQMC 4DV7Q 1PH6A 4A3DG 1LV9A 2R6GA 2RA4A 3P20A 1HR0W 1SE8A 3A7LA 5IYBG 3G6JB 2VZAA 1D7QA 1QB5D 2FJ2A 5LL6X 3U58A 4GS3A 4OWWB 2BE5D 1V43A 2RDGA 3S2DH 1IBKQ 5CV5A 3T16A 5A35A 4DV5L 1D5XC 4LWCA 2VQEL 1HPCA 2F0QA 4OL7A 5K5PA 5I9PA 1PFBA 2Y0SE 5C4JB 1RODA 5LMUQ 3HGBA 1JQYD 1B1ZA 1HRJA 5I4DA 2IJ0A 1U4MA 2ZXRA 2PI2A 5EKIA 2R7ZB 3NEMA 2BOSA 3T1YQ 1NJIC 1YJ9A 4R1JA 3OTOL 1XMOQ 3BG3A 5GROA 3T4AC 4RHRA 4XXEA 4PMWA 1B2TA 4A3FG 3T53B 3K5NA 5ELNA 2QKIC 3FHWA 1S5DD 3KLWA 4NB3A 3I3CA 2DY8A 4K14A 4DR7L 2N78A 3I4MG 4C3IG 4JI3L 2G9DA 1VQOA 3A8KE 3I91A 5KGUA 1VQFA 2BDOA 4XTCS 3D6CA 3GTLH 1LM0A 2A1AA 1MGSA 4B9WA 4GKJQ 1GD7A 3A74A 2F0OA 3BZKA 4B3RQ 1X6OA 3NBHA 1Y69U 1L1OC 1JB3A 4DAMA 3S1RB 2VNUD 4C1NK 3KF6A 4DV3Q 5JEAH 3PGZA 1MJCA 2B63H 2KA7A 4OX9Q 4QB4A 4JI8Q 1TWAH 1EWIA 3HOZB 5BN4A 4ID6A 2MPMA 2SDFA 5KYLA 2PMZE 2KCCA 3TP5A 5HURA 4H02A 5ELBA 5KRUA 4X65L 3PO2H 2BCOA 1SJED 3M7NA 4S3SA 3AYHB 2XRQD 4AQYQ 1T9HA 1KL9A 2EYJA 1PFNA 3S17H 1D1IA 4PG3A 3VR5A 2EXZA 1EY9A 2MFIA 1RTOA 3I90A 3HOXG 2JEBI 1LO5D 2NVQH 1Z9FA 1TS4A 1HR0Q 3J7YW 3H09A 2EVBA 1EQQA 5E4WC 1EOVA 4N8X1 2SNSA 4JPBW 1ZYRD 4BY7H 3RLFA 1SFOB 3CCMA 1VQ8A 1JOOA 3OMGA 1A3VA 1B8AA 2BE5C 1FVIA 4QMGA 2KBNA 4A3BH 2UXBL 1VQIA 2K75A 2GN5A 1TKWB 2FMMA 1EZ8A 4DR1L 1ZKOA 4BXXH 2Z8LA 4DR6L 3GQBA 1Q86C 1QOHA 2PZUA 1VQCA 5CR3A 3MVVA 5E3FA 5ELFA 3H3VH 1FGUA 4ME5A 4J1MA 3GTKB 2AHOB 2IPKD 1HH2P 4OONA 2OCEA 3K5LA 1GHKA 3AFQA 3OYYA 2WKDA 4LF4L 4Q0FA 2B63G 3DM3A 2L4NA 1IW7D 1CFMA 4FP5D 2H5XA 4HMJA 2F0PA 4EVOA 4FVMA 3G7LA 3PO2G 1EIYB 1TIID 2KEEA 4DV4Q 4POGA 2JXMB 5T1IA 1TS3A 3QB3A 4J6HA 1SLJA 1DOKA 2RKSA 1HXYD 3BDLA 3D0FA 4HJAA 1PXUA 4PMCA 1SRUA 5GQOA 1S3OA 3CMAA 3MC0B 4GOPA 3GTQH 2ASBA 4CJ2C 2YTVA 2ZXOA 2UU9L 1NAPA 2I5HA 4FDBA 1KQSA 3PIP3 4I7ZC 4C3HH 3U4ZA 1EY6A 1ILQA 4CDDC 1ESRA 4HMIA 1K0SA 4LF7L 1HUNA 1CSPA 2B2YA 3PUZA 3QOLA 4YIJA 4LMQD 3KBGA 1OXVA 2NB0A 1BR9A 2PQEA 2RQXA 1SNQA 2WB1B 2LKVA 4OIJA 1K8GA 2H1EA 5J22A 1M4VA 4DV2Q 4A3BG 3HOWB 3K58A 5C44B 2AUKA 3R2TA 1LT4D 4IJHA 5BR8Q 4AYBE 3K59A 4HJ5A 2MP1A 4BXXG 3K57A 2N49A 1FJGQ 1C9OA 3MXGA 2PYKA 5I2YA 1I6VC 3SK6A 1WTWA 4DAYA 2L9HA 5IWAL 3A5UA 3A8IE 3NXWA 1SBBB 1HZAA 2V1CC 1CZWA 1ZYRC 3HKSA 3KLSX 4E6IA 5M5YH 4B3SQ 1Y1VH 4DGZA 2XIWA 2R92H 1B7YB 3I7FA 4LFCL 3FMCA 4QF4A 1BCPC 3HKZG 5ELDA 3TMEA 1WVLA 1KNAA 4H13C 4KHZA 4DFAA 3UE1A 5EKKA 2XGTA 4R4CA 1HJPA 3URYA 2XTIA 3CCUA 1D8LA 1E24A 1CM9A 4OWTB 2A69D 3DM1A 4A3EB 1H9SA 1MSHA 4RHSA 5JVG3 1V8QA 4JYAL 1DONA 4CKCA 4LFAQ 3HOYH 2WIIB 4BBRH 2LFNA 1HZCA 1ICFB 1JMCA 4HAEA 2K50A 5D3IB 2E2HB 4C3HG 2IX1A 4A3IG 4ILWA 2K33A 2CCZA 1E7ZA 4NXNQ 4O2DA 5JOBA 2HQEA 3UDIA 3MHBA 2UXDL 1JE5A 4XYOA 2FHTA 3EN2A 5C3WA 2B3GA 1FGBD 5EQ0A 3UDFA 3G71A 1CSQA 2K28A 1KAWA 3B6YA 3CKIB 2R3ZA 3TS0A 1TWCH 4KHVA 1QG7A 3JC66 1RL2A 1K73C 2WP8J 4O0AA 5ELEA 1L1OA 3V2TA 3H0GB 1KABA 1STYA 1L2FA 1BBXC 3F8TA 5FLXc 3VR3A 3W3AA 1ET6A 4HN7A 2QEXA 3MEFA 3D3RA 3IL8A 4HSVA 1Q90A 3SK4A 1Y8NB 1V1OA 4C3JB 2K5QA 1FL0A 2RCNA 4A3LH 4NXML 5C5MA 5C4XB 4R4TA 2R7DA 3S1RH 3SK8A 1WFQA 4MN3A 3S1NB 5EKLA 2JA7H 3OWFA 4RG1A 4RFBA 5C3EH 3C2PA 4KKTA 2K03A 3HOZH 2MQHA 3UI2A 1VQLA 1JOKA 2E8GA 4HR7B 3RLNA 3CQZH 3KJOA 2E5LL 1Z6HA 2LXJA 3PSIA 1VQ7A 1XNQQ 4K0KQ 5CGKA 1KLGD 1XNRQ 3GTPB 2KOLA 4R8NA 2CWAA 2K32A 4IPCA 3K6OA 3BS1A 1IKLA 5HY6A 2R93B 1I50H 3S1QH 2EY1A 5NUCA 2NBFA 5IT9L 3PCOB 2F0EA 4IO9A 1XTDA 2CQAA 3EJIA 1TWHB 3M4OB 2EJGC 2FXQA 3HOYG 3DEOA 1CUKA 4A3KB 4BBRG 3NELA 3MXNA 1F2MA 4LUZA 4A3JH 2A6EC 3GTMB 2JA5B 1WTQA 2Q8IB 2F4IA 2Z4IA 5DM73 1W6JA 3BDCA 4JI0L 4KKSA 3Q22A 1HNWQ 1IBLL 2UUAQ 4JI5L 3A55A 1SR3A 1I4RA 5EPJA 4RWSC 3I55A 5FLMH 2DNEA 4LF5Q 2UUBL 1NE3A 1Z7TA 2A69C 2CWPA 3I73A 4ME3A 5G3LF 2RHSB 1G51A 1WD1A 1FNVA 4P74A 4JBJA 1XPRA 1XTCD 5C3XA 3RLOA 1AZQA 1J5EL 1WOCA 1DJRD 3PIPA 2A68D 4JI4Q 5FK9C 4A3LG 2NZ1D 4LF8Q 1STBA 4OHJA 1IBML 3RMHA 4HJ7A 4YCWA 1VDZA 2RDHA 4DR2L 2J0TD 3OIQA 1A2UA 5H1SE 3S16H 1EQVA 3SXHA 4IUPA 1Q81C 4KY7A 1U5KA 4ALPA 3JAMi 1PTOB 3PV0A 1DZ1A 2JA7G 4A3MB 2BDNA 4IJLA 3HOZG 3PO3B 4KTAA 1H9KA 2P5ZX 2OEOA 1GUWA 1N33L 2ZTEA 4IOCA 1QZHA 2XNAC 4F8MA 2OWOA 3FRPB 2HDMA 1NUCA 2C5CA 1K83B 1SYFA 3MAQA 3IKJA 5LMNL 4R4QA 1YJNA 4XYQA 2HHHQ 1E22A 1Q1EA 1UNSA 4JI6Q 2HUGA 1X54A 5EBDA 2KJXA 1WCMB 3V96A 5CV9A 3GV3A 2AKWB 1UE1A 1N36L 4A3JG 3EIVA 3I4NH 2XWBB 1CI3M 4QCLA 4DV0L 1STEA 4IALA 1N34Q 3G48A 2F0HA 3CCEA 4A93H 1E1OA 4R4OA 1N32Q 4GLXA 5FLMG 3T51B 4DUYQ 2TSSA 5GADC 1I6HH 5AJ3L 1M90C 2VQFQ 3SK5A 4CKEA 3ITPA 3A7AB 4QY7A 3FEWX 4ZRZA 3PF4A 1U9RA 3HOWH 1BF4A 4A3CH 1LTLA 2JA8B 1F2LA 1S5ED 1NTGA 2Q2HA 1M1KC 2Z0SA 2KEDA 1BVSA 1OO9B 2F0GA 4DNIA 1XJVA 1I94L 3CP0A 2RBMA 3HKZE 4G7ZC 3CU7A 4X3UA 3SVMA 3NK9A 1K8AC 3E5SA 3CCJA 1IZ6A 1IYJB 1JR0D 3CCQA 1S5FD 1BBUA 4DNRB 4WJ3M 1ZEQX 4EGVA 2IY5B 2OTJA 5BN5A 1W6KA 1UE7A 2I0QA 2OQKA 3S14B 1HNZQ 3RZOH 2EYHA 2L15A 3TP6A 1NBWA 3RD4A 2ATWA 2E2IB 3HOVH 2I5MX 3AEVA 4L63B 1DYQA 3H15A 1PH5A 4JCVE 1QUQB 4X62Q 4CHTB 2MUYA 2PO4A 4JI1L 5DM63 1CA6A 1WTRA 2GVBA 2Q2UA 3J81j 4ZYSA 2A68C 2E2JH 4UY8C 1KNEA 2A5HA 3KLSA 4CJ1B 3S1MB 5C0XH 4AIMA 1D2BA 2HIXA 4JOIA 1BCPB 2HIVA 4K8IA 4EQNA 5JJKA 1PFMA 3RUZA 1F77A 2E2HH 1CTMA 1SJHD 1VQAA 4WORA 2SOBA 2B2YC 3KDFA 2F4VQ 3UE0A 1SSOA 3CCVA 3I4NG 3TEHB 4RA8A 3P75A 1K8OA 1VCIA 1A2TA 4J8QA 3WOEA 4JI7L 1UWVA 2WB1G 3T56B 1HUMA 2K04A 3QIAA 3A54A 2OF1A 1T5EA 3W5OA 4CJ0B 2BH8A 4AYBG 1WJJA 2QILA 5IT9c 3F1ZA 3HOWG 4A3CG 3M4PA 3WOFA 1X3EA 1BNZA 5C4HA 5C44G 4DV1Q 3AU7A 3SE0A 5FO8B 3D31A 4R9WA 1R9TB 1PVOA 1LTAD 1L0XB 4V0BA 5G3LD 1DOMA 2K4KA 1DXMA 3EFXD 5I2XA 2MO1A 3D4WA 1B3QA 2IX3A 2F0WA 3O13A 2F3VA 2Z4HA 3C1EA 3W1BA 4RGNA 4ZQ3A 4YY3L 1L0WA 1SYCA 3HOXH 4CKBA 5FKAC 1Q3LA 4MZ9A 1K28A 4GLVB 1C0AA 2CW0C 1SMXA 3HOVG 2ZT9C 2VUMB 2OXPA 3S2HH 5IOCA 5DAUA 1D5MC 3AQQA 1R4QB 1CQFA 4DR3L 3GTPH 4QJFA 3NTIA 2HCIA 3UDXA 1RDPD 5A2QL 3G4SA 3WDNA 3KFUA 3H91A 3HFZB 1V1PA 2LY7A 1KDCA 2Y0SB 4GLAC 1TWHH 1UE5A 2RHQB 1CQVA 4FXGC 4DV6Q 5GAEC 1TT2A 5C0XG 3R8BA 3FKIH 1Q46A 3GTMH 5KYIA 3ERQA 4IFDH 4IPGA 4JC0A 3S15B 2F0NA 5EPLA 5AFWA 1EIHA 2VB3X 3FP9A 3VYRA 3K7AH 4L5TA 4KD4A 1X3GA 1EWCA 4JK1C 1Y14B 1I5FA 4KKUA 1C7YA 3LGJA 2RDFA 1PRTD 4XT3B 4HCSA 1HNXL 2EYPA 4EQOA 1GVPA 1QNKA 3GTGH 4K6LA 3Q24A 1JORA 1LTGD 3SEBA 1HZ9A 3NBIA 4GKKQ 3K7UC 5D14A 2K5DA 2X6GA 4HCEA 1DD2A 2YU9H 4G57A 2AQ2B 2ZJRA 3NHHA 1KRTA 1WTVA 1MJEA 3EQLC 2I07B 1MD2D 1S5CD 2HDLA 3GTJH 2Z9HA 4GN5A 4A75A 3PMFA 5I6YA 3MFGA 4NP5A 4XDXA 3STBD 2EYOA 3L9AX 5JVH3 1JCKB 4B3ML 2B39A 3NQIA 3F2DA 1LTTD 1X65A 2N3SA 5FLXL 2MO0A 2B2VC 3MA2B 2BA1A 4UPAA 4YHHL 2QA4A 3NBHB 1PA6A 3H6MA 4LF6L 3KF6B 1C4QA 3HOUB 4G7HC 1EY7A 4V190 1K83H 3OHXC 3AFPA 3HEJA 4P73A 3BVGA 1HTLD 2VQEQ 2J7ZA 5IODA 3I2ZA 4QQBX 5IGDA 3DWPA 4KY6A 1Q12A 2KCNA 3Q0AA 1MHWC 4A3KG 1SNMA 2D5DA 3FKIG 2SEBD 4X6AH 3KBXA 2BH2A 4ZUIA 4IFDG 1PZKD 3LWUA 2PW5A 1CKNA 3AMUA 4POFA 4BBSH 4HJ8A 1JWMD 2F1MA 1RTNA 1DGSA 2B2UC 1JC7A 5EJWA 3T1HL 4GNXA 3OTOQ 1YHQA 4N9PA 2QF7A 1VQNA 2EJFC 2JE6I 1STGA 1GHJA 4RGTA 1B50A 1RCVD 2L12A 3ND8A 1OXUA 1P8LA 1QWYA 1VQBA 1Q7YC 5D3DA 4JBKA 4DR7Q 1IL2A 2NZOA 4X66L 2EE1A 2HD3A 1GUGA 4F88A 4JI3Q 2O2LD 3BVMA 2XRSD 5GAHC 3Q23A 1NY4A 1I4QA 1XYIA 1CKOA 1BBWA 1SYGA 4AH6A 1JB7A 2MGSA 3CRKC 3HZXA 1TWFH 4BY1B 3TZDA 4A3MG 1J8IA 1OXXK 4JI2L 2E2IH 4PV1C 3M3YH 3TN2A 1EY5A 1WTXA 1HCZA 4A3IH 4YWMA 1TWGB 1CK1A 4TSSA 4X65Q 2F3IA 2AQ3B 3RZDB 5IP7H 4GN4B 4YCVA 1STNA 3X3NA 5IP9H 2E75C 1B44D 3I70A 3H3VC 2NWGA 1N8RC 3PIO3 5CBEE 3AB9A 4KHPL 1BKBA 1W3SA 5KIXA 4A3GH 1I3QH 1KC8C 2EYFA 1G2SA 3GTOB 4UP7A 4OXPA 4RAUC 2WB1E 2Q8RE 3CCLA 1S72A 4Y7NH 3K81C 1SE2A 5M5XB 4BBSG 4GOPB 2QEJC 1G91A 4PQXA 2EYLA 4IQZA 4K6DA 1HZBA 3TP7A 1LT5D 1H9MA 2I46A 2EPBA 3ER0A 3CF5A 4OO1H 1RHPA 4J15A 4DF7A 5M5WH 4FO2A 3F2UA 4UP8A 4HIMA 1O7IA 4X64L 3DWQA 4LNQA 1SROA 3BJUA 2UXBQ 3QG1A 4A3DB 2F0UA 1XNRL 3KK7A 4C2MB 5T1GA 1S4ZA 4DR1Q 2EQSA 4YWLA 3ZYYX 3CPWA 3OW7A 1SYEA 5E1FA 4DR6Q 3SHLA 2UXCL 1YI2A 4X3SA 2EY5A 1JJCB 4P2CB 4H0LC 5C0XI 1BOSA 4DR5L 2RSOA 4IURA 3ND9A 1PYWD 2WAQB 1RD9D 3U9OA 1Q82C 1WD0A 3A0JA 2AWOA 1SNOA 2M9VA 2X6LA 5C4JH 4LF4Q 4H7BA 4DAYB 4MNOA 4I7AA 2NVYB 3E0EA 1FR3A 4IUUA 2IT1A 2OQ0A 4XQQA 2R7ZH 3TBIB 3CC7A 1E1TA 1PYSB 1IW7C 2EXDA 3MWYW 1WTOA 3J80i 4LF5L 2NVXB 3MZ5A 2F0DA 5IP7G 2O5IC 4JOIC 3M9BA 5IP9G 4A3FB 4NW2A 1VQ4A 2TMPA 3IRBA 1EYCA 2JP1A 2UUCL 1VF5C 2YTXA 4A3GG 4PZ8A 2L0CA 1J9OA 2A74C 5CV6A 3I4LA 2IL8A 1BXTA 4FXKC 5C4ZA 2UU9Q 1H9SB 4C3IB 3VYSA 4KN7C 3J81i 2F0KA 4F87A 3EROA 2M00A 4LF9L 1CHQD 4Z9CB 4LF7Q 2LSSA 1PLFA 5IT9E 1X32A 1K3RA 3R2IA 1H9RA 2R61A 3NWSA 3J7A5 4OO1G 2BA0A 1XMQQ 1VQEA 4O1NA 4UDUC 1IYUA 4KK7A 4MHEA 1PH7A 3D8GA 4TQUS 2K5HA 2ICIA 4L5RC 1YEZA 4R8IA 4XQJA 1PDQA 2DN8A 3V05A 3IFDA 3ONAB 1SNPA 1GM5A 4DUZL 2PCFB 2QGQA 1E2VA 3Q8DA 4RH6A 2B2VA 1SYBA 2HHHL 5CYUA 1L1OB 1NSNS 3S2DB 1A8VA 1ZXTA 5IWAQ 4UP9A 1F9SA 4IFDI 4M1UB 2XWJB 1B53A 1LYLA 2KHSA 4HEDA 2K5WA 4B3TL 3VYTA 4X3KA 4LFCQ 4BS9A 3CD6A 1VS0A 2JSOA 1G291 1EYAA 3GD7A 5CC4A 2Q8TA 2R7ZG 3I8ZA 4DR4L 3ULPA 4ODGA 3HS0C 3OSOA 1SFOH 1SEBD 4TKOB 1PH3A 2N88A 2K7VA 2D62A 3W1GA 4K2LA 1G2TA 4JYAQ 2NTSA 2B2UA 2HCCA 3PUWA 1KXLA 1QZGA 1AW7A 3J7AV 1K0RA 5IGCA 1EZ6A 3K5OA 2EDGA 2RSNA 2NTTA 4EQ5A 4Y52H 4QIWB 2EJMA 3A56A 3I72A 4DK0A 5M9OA 3L7ZC 3VA7A 2ZM6L 5JAVA 2FMCA 3MXNB 3GTKH 3GTLB 5CORA 2UXDQ 1IYVA 1AEXA 1BUVT 1F2ZA 3M7GA 1TY0A 4TRDA 1X3FA 3J7ZC 1BDOA 1NNXA 2AMCB 3M85A 1UE6A 4WJ4A 1VQHA 4CDFC 5JJLA 1STHA 1GKHA 1LT3D 4LFBL 3PIOA 2FINB 2XVSA 2WACA 5IGEA 1PTOF 5CV7A 1QCBD 2QDLA 2EIFA 4K5VA 4YCUA 2SNMA 3CW2C 3PO2B 4DXGA 1QE6A 3C46A 5M3FB 3D6WA 2ENBA 4NXMQ 3RNUA 3MTSA 4ZKBB 3S17B 4JVZA 4BY1H 3J80L 3F2BA 1VQ9A 5IGBA 4DXFA 2NVQB 4IZ8A 1PRTF 3NTKA 1TWGH 2E5LQ 3HOUG 4G4KA 3RZDH 1HTPA 3Q6SA 2C35B 4EX5A 2F52A 1HFNA 4JV5L 4BY7B 4C1NI 3J81L 4U673 4OELB 3SR1A 5IIFA 1ML0D 4RCOA 2Z6BA 3FPUB 2WINB 1SAPA 4A3BB 4FF3A 1WYDA 4DV7L 3PQIA 5C44H 3KOJA 2O4XA 1MBYA 5FO7B 1KHIA 1I4GA 4IUNA 4GNXC 1TR5A 1IHZA 1LUZA 1FNUA 2ZJPA 4JI0Q 1IBLQ 4JI5Q 4CGYB 4K2KA 1IBKL 5L37A 1S40A 1ESFA 1O7YA 3N6RA 4KMUC 3RR5A 2G9HD 4RCNA 2UUBQ 2XSCA 3CRLC 5JJIA 1PMRA 3KF8A 1EFID 5LMUL 3I4OA 3TREA 5IGFA 3E0JA 2L1BA 3BDOA 3U4VA 3T1YL 3K8AA 5JEAJ 2ZJQA 2K6AA 3QJYA 1J5EQ 1JOQA 1XMOL 5K36G 5EAYA 2PQAA 1SMYD 4A3EH 2D0OA 2I5LX 5FO9B 3TS2A 1X56A 3DWAA 1DCZA 4MTKA 1IBMQ 3DLLA 1HQRD 2PZTA 1EU4A 1Q8IA 2K05A 3FPPA 1LTSD 4BY1G 4DKAC 4DR2Q 3PUXA 4QL5A 3GTQB 1A3TA 4ABNA 3BZCA 2Q2IA 2O5JC 1T5XD 2GA4B 1KAAA 4RMFA 1VF7A 3U50C 4DPGA 4OIKA 4C3HB 4GZYC 1Z47A 4K5XA 4FF2A 2F0LA 5E4XA 3SGIA 2EOTA 1N33Q 3EA6A 4GKJL 1KRSA 4B3RL 4OO1I 2K5NA 2AUJD 2DJGC 3K0XA 4DV3L 5DNFA 4L6TB 1F9PA 4OX9L 4JI8L 1KD1C 4GN3B 3OPOA 3EVQA 1RKNA 2G5DA 3H0GH 2KENA 2D0PA 4EQPA 1LABA 1N36Q 4MTNA 2OTLA 1EOTA 2MJ8A 3TSSA 3JAML 4C3JH 3GP7A 5A2QE 4DV0Q 5C5LA 5C4XH 4WFN3 4AQYL 3K0YA 4JBMA 4B08A 3RN5A 1ET9A 3KDFB 4LUOA 1HA6A 3S1NH 5KNCA 5AJ3Q 1Q8KA 3CPFA 1MKHA 3EBEA 2B2WC 1Y1VB 3P7JA 1UUPA 2R92B 4NMZA 3IFTA 1GUOA 2K01A 4HSPA 1HR0L 1MIUA 3PF5A 4UAIA 1MI2A 1O78A 3J7AF 1PYBA 3KYHC 1I4HA 4IPDA 3U9SA 1I94Q 1YVCA 2R93H 3VDYA 2IWHA 5HGTA 4A3EG 1GO3E 1PH9A 5J39A 4CDCC 1YHBA
chains in the Genus database with same CATH topology
1PTOD 3BYYB 3BZDB 1CZGA 1SXTA 3HOYB 4WRDA 5BN3A 1O7LA 4BBRB 1VMPA 1TS2A 3MXPA 5EPKA 2VXWA 2JA6B 2IX0A 1EQTA 1TVXA 3DEPA 2F0TA 1CT1D 2ZXPA 4U68A 5CV8A 3X3MA 1X3QA 1SMYC 2D2CC 2X69A 3A8JE 1TWCB 5LL6S 5FLXE 5KEEA 3OIPA 2M2LA 4KJNA 1AP0A 1V1PB 4ZKCB 2F0SA 4ZK9B 4LAAA 4C3JG 1BQQT 4DN4M 1AN8A 2F0JA 1LACA 2F3WA 4KN4C 4HTHA 1PTOH 2PMZB 2JA7B 1EIHA 1UAPA 5C3EB 2EYMA 4BA1I 1E2ZA 2FFKB 1B9NA 1YNJD 3CQZB 1CA5A 3NP8A 3KUPA 1D6EC 1GUTA 4XT1B 2EY2A 1EU3A 4K5WA 1PZID 4RKLA 1I50B 3S1QB 1K8MA 1AFPA 5CV4A 3TP8A 2E2DC 2K1BA 2Z1CA 3R93A 2NN6H 4A3JB 1ONLA 1SDFA 3NSWA 1TY2A 3VR4A 5M3MB 1FD7D 2PPBC 1A6XA 1BCPD 2CHBD 1FNWA 4K8JA 3NQTA 1I4XA 1PTOC 1G6ZA 3DXJC 3LNNA 4ZAIA 3KLRA 5IGGA 2ID0A 3DHQA 3HG9A 2EY6A 3NWTA 2NVTB 2A6HD 3S16B 5JEAG 1PRTC 2WKCA 1SNCA 4KJOA 1SE3A 2IW3A 1U4LA 4DU9A 2ICEC 1CHPD 1ENFA 1KLUD 1Y1WB 2JEAI 1F9QA 4N9TA 1M8AA 5I6WA 3TZUA 4X3TA 1D1KA 1ILPA 1L0YB 1EEID 1FYCA 5KNDA 2NN6G 3H94A 4DNTB 4KY5A 2C9OA 1EY8A 3I4NB 3PUVA 1YNJC 1F2YA 1OXSC 4A93B 5TSSA 1D5ZC 1I6HB 1IL8A 1LT6D 4AYBB 4FF4A 1U4PA 1EIGA 2V4DA 1EY4A 1WTPA 1LTRD 1GXDC 5C6AA 3D4RA 2AWNA 2B2WA 4F7XA 2WV6D 4JBWA 1JWSD 2F0IA 3VYUA 5CBAE 1EEFD 2A6ED 1B3AA 4BA2I 4DAPA 2F0VA 3RZOB 1TU2B 2VB2X 4RKBA 3HOVB 1JWUD 1JICA 1I4PA 4RGOS 1GJXA 3FDTA 1HFGA 2DNCA 1ICWA 2E76C 2QCPX 1Q1BA 4IN3A 1Y8PB 2E2JB 2PNRC 4FYDA 4M8AA 3LWEA 3NTHA 1A3UA 2A6HC 2EZVA 3P1HA 3I4MB 4KI0A 3IAYA 2XN9C 3MXUA 4H44C 3QO2A 5DEHA 3CHBD 3T13A 5EBCA 1Y8OB 2N55A 5LHY1 5FOBB 4QUCA 2KVMA 3OWEB 3PUYA 3R3OA 1NR2A 1LTID 3NPPA 3DMUA 1U4RA 2E74C 1TS5A 3HRZC 2DY7A 1BO0A 2B2TC 1RF2D 4I65A 3HOXB 5JPNC 1GOZA 1HA5A 3W2DA 1RJTA 3S2HB 5COYA 4CBVA 1KDAA 3L3OC 1O7ZA 3SDZA 1OXTA 1EWHA 4IUQA 4QUFA 2B8FA 4FXDA 2F03A 1JE4A 2MHVA 3FKIB 4WJWA 4IUVA 5C0XJ 4Q5VA 3C3LA 3K7AB 2LMCB 1PZJD 4IUTA 3MFYA 5CMDA 2PZWA 3OMCA 1SE4A 1DM0B 3J80E 1YNND 2CVRA 1B4OA 3GTGB 2KUMA 2B63B 2F0FA 1GUNA 2D9UA 2AQ1B 1SNDA 1TWAB 1DOLA 1B9MA 2KECA 3BVZA 1HHVA 4L8JA 2L55A 1XX8A 5EGTA 2YU9B 2NUCA 5K36H 3DUZA 1UEAB 1EL0A 3GTJB 3J81E 2QDBA 5ISRA 3K5MA 1S5BD 5F2DA 2NN6I 1MSGA 1QNUA 1KDBA 5I9OA 1AZPA 3D4DA 4NKLA 3QOJA 1QJOA 4PNYA 1LTBD 1ENAA 4XIGS 1EYDA 1PRTB 1TQOA 2YYZA 2JYOA 2OT2A 3NE5B 5J1ZA 3GV6A 1R4PB 3GO5A 1F9RA 4LK1C 4BWGB 1E0BA 5ELCA 4BBSB 1NR4A 4PMBA 1EY0A 4IFDJ 4ZUJA 1C8CA 1XXGA 3TDQA 3HP3A 4RGMA 1SYDA 3QWNA 2CW0D 1X3PA 2NYZD 1XWEA 3HKZB 4KV6A 1ENCA 4XQNA 1H9JA 4B9XA 2B8GA 4DAVA 4DA2A 1GUSA 5KNBA 3MEHA 3S9WA 2F0MA 1II3A 2LS01 1C48A 3VR2A 3VR6A 4G7OC 1TWFB 4MIUA 4OGQC 2A73B 1E2WA 5JJZA 2J4XA 3M3YB 1YNNC 2RVLA 4O42A 4FF1A 1VMCA 3JAME 4A3IB 1BCPF 4FNFA 4C56C 2KQ3A 5JPMC 3BYTB 2L11A 4DK1A 3M4YA 1KTKA 4A3GB 4LJZC 2L5TA 1LLRD 3N52A 1STAA 1I3QB 1QILA 5D65A 3OOCA 3E6ZX 3C1FA 4NDXA 4Y7NB 4ULLA 3NUCA 1O80A 1A15A 1G8ZD 3VA5A 5M5WB 5M5YB 1NCVA 3LX0A 4ZLTF 1IKMA 2H4OA 2PW7A 2B2TA 3FVQA 4KD3A 1HQMC 1LV9A 2R6GA 2RA4A 3P20A 3A7LA 3G6JB 1QB5D 2FJ2A 5LL6X 2BE5D 1V43A 2RDGA 5CV5A 3T16A 5A35A 1D5XC 1HPCA 2F0QA 4OL7A 5K5PA 5I9PA 1PFBA 5C4JB 1RODA 3HGBA 1JQYD 1B1ZA 1HRJA 5I4DA 2IJ0A 1U4MA 2ZXRA 5EKIA 2R7ZB 2BOSA 3BG3A 3T4AC 4RHRA 4XXEA 4PMWA 1B2TA 3T53B 3K5NA 2QKIC 1S5DD 3I3CA 2DY8A 4K14A 4C3IG 2G9DA 3A8KE 3I91A 5KGUA 2BDOA 4XTCS 3D6CA 1MGSA 4B9WA 2F0OA 3NBHA 1Y69U 1JB3A 3S1RB 2VNUD 4C1NK 5JEAH 2KA7A 4QB4A 3HOZB 5BN4A 4ID6A 2MPMA 2SDFA 5KYLA 2KCCA 3TP5A 5HURA 5ELBA 5KRUA 2BCOA 1SJED 3M7NA 4S3SA 2XRQD 2EYJA 1PFNA 1D1IA 3VR5A 2EXZA 1EY9A 1RTOA 3I90A 2JEBI 1LO5D 1TS4A 3J7YW 3H09A 2EVBA 5E4WC 2SNSA 1ZYRD 3RLFA 1SFOB 1JOOA 1A3VA 3OMGA 2BE5C 4QMGA 1TKWB 2FMMA 1EZ8A 1ZKOA 2Z8LA 3GQBA 1QOHA 2PZUA 5CR3A 3MVVA 5E3FA 5ELFA 4ME5A 4J1MA 3GTKB 2IPKD 3K5LA 1GHKA 2WKDA 4Q0FA 2L4NA 1IW7D 1CFMA 4FP5D 4HMJA 2F0PA 4EVOA 4FVMA 3G7LA 1TIID 2KEEA 2JXMB 5T1IA 1TS3A 3QB3A 4J6HA 1DOKA 2RKSA 1HXYD 3BDLA 1PXUA 4PMCA 3MC0B 4CJ2C 2ZXOA 1NAPA 3PIP3 4I7ZC 1EY6A 1ILQA 1ESRA 4HMIA 1HUNA 2B2YA 3PUZA 3QOLA 4YIJA 4LMQD 3KBGA 1OXVA 2NB0A 1BR9A 2PQEA 2RQXA 1SNQA 2WB1B 2LKVA 4OIJA 2H1EA 5J22A 1M4VA 3HOWB 3K58A 5C44B 2AUKA 3R2TA 1LT4D 3K59A 2MP1A 3K57A 3MXGA 2PYKA 5I2YA 1I6VC 3SK6A 1WTWA 4DAYA 2L9HA 3A8IE 3NXWA 1SBBB 3KLSX 1CZWA 1ZYRC 4E6IA 4DGZA 2XIWA 3FMCA 4QF4A 1BCPC 5ELDA 1WVLA 3TMEA 1KNAA 4H13C 4KHZA 4DFAA 5EKKA 3URYA 1CM9A 2A69D 3DM1A 4A3EB 1H9SA 1MSHA 4RHSA 5JVG3 1V8QA 1DONA 4CKCA 2WIIB 2LFNA 4HAEA 5D3IB 2E2HB 4C3HG 2IX1A 4ILWA 2K33A 5JOBA 2HQEA 3MHBA 4XYOA 2FHTA 5C3WA 1FGBD 5EQ0A 2K28A 3CKIB 2R3ZA 4KHVA 1QG7A 2WP8J 5ELEA 3V2TA 3H0GB 1KABA 1STYA 1BBXC 3VR3A 3W3AA 1ET6A 4HN7A 3D3RA 3IL8A 4HSVA 1Q90A 3SK4A 1Y8NB 1V1OA 4C3JB 2K5QA 5C5MA 5C4XB 3SK8A 4MN3A 3S1NB 5EKLA 3OWFA 4RFBA 3C2PA 4KKTA 2K03A 3UI2A 1JOKA 4HR7B 1Z6HA 5CGKA 1KLGD 3GTPB 2KOLA 4R8NA 2K32A 3K6OA 3BS1A 1IKLA 2R93B 2EY1A 5NUCA 2NBFA 5IT9L 2F0EA 2CQAA 3EJIA 1TWHB 3M4OB 2EJGC 3DEOA 4A3KB 3MXNA 1F2MA 2A6EC 3GTMB 2JA5B 1WTQA 2Q8IB 2F4IA 2Z4IA 5DM73 1W6JA 3BDCA 4KKSA 3Q22A 3A55A 1I4RA 5EPJA 4RWSC 2DNEA 1Z7TA 2A69C 3I73A 5G3LF 1WD1A 1FNVA 1XTCD 5C3XA 1AZQA 1DJRD 2A68D 5FK9C 2NZ1D 1STBA 4OHJA 3RMHA 1VDZA 2RDHA 2J0TD 3OIQA 1A2UA 1EQVA 3SXHA 4IUPA 1DZ1A 4KY7A 1PTOB 3PV0A 4A3MB 2BDNA 3PO3B 4KTAA 1H9KA 2OEOA 1GUWA 2XNAC 4F8MA 3FRPB 2HDMA 1NUCA 2C5CA 1K83B 1SYFA 3MAQA 3IKJA 4XYQA 1Q1EA 1UNSA 2HUGA 5EBDA 2KJXA 1WCMB 3V96A 5CV9A 3GV3A 2XWBB 1CI3M 4QCLA 1STEA 4IALA 2F0HA 3T51B 2TSSA 3SK5A 4CKEA 3ITPA 3A7AB 3FEWX 4ZRZA 1U9RA 1BF4A 2JA8B 1F2LA 1S5ED 2KEDA 1OO9B 2F0GA 2RBMA 4G7ZC 3CU7A 4X3UA 3SVMA 3NK9A 3E5SA 1JR0D 1S5FD 4DNRB 1ZEQX 4EGVA 5BN5A 1W6KA 3S14B 2EYHA 3TP6A 3RD4A 2E2IB 4L63B 1DYQA 4CHTB 2MUYA 2PO4A 5DM63 1CA6A 1WTRA 4ZYSA 2A68C 1KNEA 2A5HA 3KLSA 4CJ1B 3S1MB 5C0XH 1D2BA 1BCPB 4K8IA 4EQNA 1PFMA 3RUZA 1F77A 1CTMA 1SJHD 4WORA 2SOBA 2B2YC 1SSOA 4RA8A 3P75A 1K8OA 1VCIA 1A2TA 4J8QA 3WOEA 3T56B 1HUMA 2K04A 3QIAA 3A54A 2OF1A 1T5EA 4CJ0B 2QILA 3WOFA 1BNZA 5C4HA 3AU7A 3SE0A 5FO8B 3D31A 4R9WA 1R9TB 1LTAD 1L0XB 4V0BA 5G3LD 1DOMA 1DXMA 3EFXD 5I2XA 3D4WA 2IX3A 2F0WA 3O13A 2F3VA 2Z4HA 3C1EA 4RGNA 4ZQ3A 1SYCA 4CKBA 5FKAC 1Q3LA 2CW0C 2ZT9C 2VUMB 2OXPA 5IOCA 5DAUA 1D5MC 1R4QB 1CQFA 3NTIA 2HCIA 1RDPD 5A2QL 3WDNA 3H91A 1V1PA 2LY7A 1KDCA 2Y0SB 1CQVA 4FXGC 1TT2A 5C0XG 3R8BA 5KYIA 3ERQA 4IFDH 3S15B 2F0NA 5EPLA 5AFWA 2VB3X 3VYRA 4KD4A 1EWCA 4JK1C 4KKUA 2RDFA 1PRTD 4XT3B 4HCSA 2EYPA 4EQOA 1QNKA 4K6LA 3Q24A 1JORA 1LTGD 3SEBA 3NBIA 5D14A 2K5DA 2X6GA 4HCEA 1DD2A 4G57A 2AQ2B 1WTVA 3NHHA 3EQLC 2I07B 1MD2D 1S5CD 2HDLA 3PMFA 5I6YA 3MFGA 4NP5A 4XDXA 2EYOA 3L9AX 5JVH3 1JCKB 2B39A 3NQIA 1LTTD 5FLXL 2B2VC 3MA2B 2BA1A 3H6MA 1C4QA 3HOUB 4G7HC 1EY7A 4V190 3OHXC 3HEJA 3BVGA 1HTLD 2J7ZA 5IODA 5IGDA 3DWPA 4KY6A 1Q12A 2KCNA 3Q0AA 1SNMA 2D5DA 2SEBD 3KBXA 4ZUIA 4IFDG 1PZKD 3LWUA 2PW5A 3AMUA 1JWMD 2F1MA 1RTNA 2B2UC 1JC7A 5EJWA 4N9PA 2QF7A 2EJFC 2JE6I 1STGA 1GHJA 4RGTA 1B50A 1RCVD 2L12A 1OXUA 1QWYA 3ND8A 5D3DA 2EE1A 4F88A 1GUGA 2O2LD 3BVMA 2XRSD 3Q23A 1I4QA 1XYIA 1SYGA 2MGSA 3CRKC 3HZXA 4BY1B 3TZDA 1J8IA 1OXXK 4PV1C 3TN2A 1EY5A 1WTXA 1HCZA 1TWGB 1CK1A 4TSSA 2AQ3B 3RZDB 1STNA 3X3NA 2E75C 1B44D 3I70A 3H3VC 2NWGA 3PIO3 5CBEE 3AB9A 5KIXA 2EYFA 1G2SA 3GTOB 4RAUC 2Q8RE 1SE2A 5M5XB 2QEJC 1G91A 4PQXA 2EYLA 4IQZA 4K6DA 3TP7A 1LT5D 1H9MA 2I46A 2EPBA 4OO1H 1RHPA 4DF7A 4FO2A 3F2UA 3DWQA 3QG1A 4A3DB 2F0UA 3KK7A 4C2MB 5T1GA 1S4ZA 3ZYYX 3OW7A 1SYEA 5E1FA 3SHLA 4X3SA 2EY5A 4P2CB 4H0LC 5C0XI 1BOSA 2RSOA 4IURA 3ND9A 1PYWD 2WAQB 1RD9D 3U9OA 1WD0A 2AWOA 1SNOA 2M9VA 2X6LA 4H7BA 2NVYB 1FR3A 4IUUA 2IT1A 4XQQA 3TBIB 1IW7C 3MWYW 1WTOA 2NVXB 3MZ5A 2F0DA 2O5IC 4A3FB 4NW2A 2TMPA 1EYCA 2JP1A 1VF5C 2L0CA 1J9OA 2A74C 5CV6A 3I4LA 2IL8A 1BXTA 4FXKC 5C4ZA 1H9SB 4C3IB 3VYSA 4KN7C 2F0KA 4F87A 3EROA 2M00A 1CHQD 4Z9CB 1PLFA 5IT9E 1X32A 1H9RA 2R61A 3R2IA 3NWSA 4OO1G 2BA0A 4O1NA 4UDUC 1IYUA 4KK7A 4MHEA 3D8GA 4TQUS 2ICIA 4R8IA 4XQJA 1PDQA 2DN8A 3V05A 3IFDA 3ONAB 1SNPA 2PCFB 1E2VA 4RH6A 2B2VA 1SYBA 5CYUA 1NSNS 3S2DB 1ZXTA 1F9SA 4IFDI 4M1UB 2XWJB 1B53A 2KHSA 4HEDA 2K5WA 3VYTA 4X3KA 4BS9A 2JSOA 1G291 1EYAA 3GD7A 5CC4A 2Q8TA 3I8ZA 4ODGA 3HS0C 3OSOA 1SEBD 4TKOB 2N88A 2K7VA 2D62A 4K2LA 1G2TA 2NTSA 2B2UA 2HCCA 3PUWA 1AW7A 3J7AV 5IGCA 1EZ6A 3K5OA 2EDGA 2RSNA 2NTTA 4QIWB 2EJMA 3A56A 3I72A 4DK0A 5M9OA 3L7ZC 3VA7A 5JAVA 2FMCA 3GTLB 5CORA 1IYVA 1AEXA 1BUVT 1F2ZA 3M7GA 1TY0A 4TRDA 1BDOA 3M85A 1STHA 1LT3D 2FINB 2XVSA 2WACA 5IGEA 1PTOF 5CV7A 1QCBD 4K5VA 2SNMA 3PO2B 4DXGA 1QE6A 3C46A 5M3FB 3D6WA 2ENBA 3MTSA 4ZKBB 3S17B 3J80L 5IGBA 4DXFA 2NVQB 4IZ8A 1PRTF 3NTKA 4G4KA 1HTPA 3Q6SA 1HFNA 4BY7B 4C1NI 3J81L 4U673 3SR1A 5IIFA 1ML0D 4RCOA 3FPUB 2WINB 1SAPA 4A3BB 4FF3A 2O4XA 1MBYA 5FO7B 4IUNA 1I4GA 1TR5A 1IHZA 1FNUA 4CGYB 4K2KA 1ESFA 1O7YA 3N6RA 4KMUC 2G9HD 4RCNA 2XSCA 3CRLC 1PMRA 3KF8A 1EFID 5IGFA 3E0JA 2L1BA 3BDOA 5JEAJ 2K6AA 3QJYA 1JOQA 5K36G 1SMYD 5FO9B 3DWAA 1DCZA 1HQRD 2PZTA 1EU4A 1Q8IA 2K05A 3FPPA 1LTSD 3PUXA 3GTQB 1A3TA 4ABNA 2O5JC 1T5XD 2GA4B 1KAAA 1VF7A 4OIKA 4C3HB 4GZYC 1Z47A 4K5XA 4FF2A 2F0LA 5E4XA 2EOTA 3EA6A 4OO1I 2AUJD 5DNFA 4L6TB 1F9PA 3OPOA 3EVQA 1RKNA 4EQPA 1LABA 1EOTA 2MJ8A 3TSSA 3JAML 3GP7A 5A2QE 5C5LA 4WFN3 3K0YA 4B08A 1ET9A 1HA6A 5KNCA 2B2WC 1Y1VB 3P7JA 1UUPA 2R92B 4NMZA 3IFTA 1GUOA 2K01A 4HSPA 4UAIA 1MI2A 1O78A 3J7AF 1I4HA 3U9SA 2IWHA 5HGTA 5J39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGC A;  1EZ6 A;  4K8I A;  4EQN A;  2EYJ A;  3QOL A;  2EYP A;  3SK4 A;  3LX0 A;  4KTA A;  4WRD A;  4YIJ A;  1SYG A;  3RUZ A;  2OEO A;  4EQO A;  4WOR A;  3MZ5 A;  1KDA A;  2F0D A;  2F0I A;  2PW7 A;  2SOB A;  3MXP A;  2PQE A;  5C5M A;  2EXZ A;  1SNQ A;  4KD3 A;  5M9O A;  2LKV A;  3HZX A;  1EY9 A;  4K8J A;  3NQT A;  5JAV A;  4PMB A;  4F8M A;  1JOR A;  1EY0 A;  1EYC A;  1NUC A;  3SK8 A;  1JOQ A;  1AEX A;  4ZUJ A;  1F2Z A;  5J22 A;  4TRD A;  1SYF A;  3P75 A;  5EKL A;  2F0V A;  2F0T A;  3OWF A;  1EY5 A;  4G57 A;  1A2T A;  3NHH A;  5CV6 A;  1SYD A;  4RKB A;  5C4Z A;  5CV8 A;  5CV5 A;  3T16 A;  5IGG A;  2PZT A;  2SNS A;  1JOK A;  1STH A;  3TP6 A;  2OF1 A;  2F0Q A;  3PMF A;  3DHQ A;  5CV9 A;  5IGF A;  4OL7 A;  4NP5 A;  5I6Y A;  1A3T A;  2F0K A;  3ERO A;  1STN A;  2EYO A;  2PYK A;  2EY6 A;  2M00 A;  1JOO A;  2WAC A;  5CGK A;  1A3V A;  3OMG A;  3SK6 A;  5CV7 A;  1KAA A;  5IGE A;  5K5P A;  4K5V A;  4R8N A;  5I9P A;  5KEE A;  3NXW A;  5C4H A;  2SNM A;  4KJN A;  4QMG A;  4KV6 A;  4K5X A;  4E6I A;  2F0L A;  4IAL A;  5KIX A;  1ENC A;  2EY1 A;  5NUC A;  4B9X A;  1SNC A;  2ENB A;  2F0H A;  2EYF A;  2F0E A;  2PZW A;  3OMC A;  4KJO A;  1EZ8 A;  2F0S A;  4DGZ A;  3H6M A;  3EJI A;  4LAA A;  3MEH A;  4DU9 A;  3D4W A;  3S9W A;  4QF4 A;  3D8G A;  2F0M A;  3SK5 A;  1II3 A;  3TME A;  3ITP A;  1A3U A;  4DFA A;  1U9R A;  2PZU A;  1EY7 A;  5CR3 A;  5EKK A;  1F2M A;  3MVV A;  3P1H A;  5E3F A;  2F0W A;  2F3V A;  4N9T A;  4ME5 A;  5IGB A;  3C1E A;  2F0J A;  4J1M A;  2F0F A;  5I6W A;  4MIU A;  1SNP A;  3HEJ A;  2F3W A;  1SND A;  4IZ8 A;  2EYL A;  4K6D A;  3BDC A;  4ZQ3 A;  3TP7 A;  4HTH A;  3EVQ A;  1SYC A;  1RKN A;  5DEH A;  1SYB A;  5IGD A;  5EGT A;  5IOD A;  4KY6 A;  2EYM A;  2NUC A;  4K14 A;  3T13 A;  4EQP A;  1NSN S;  1SNM A;  2F0G A;  4DF7 A;  2OXP A;  5IOC A;  5DAU A;  2RBM A;  4ZUI A;  2KQ3 A;  2QDB A;  3NK9 A;  2PW5 A;  3NP8 A;  5C5L A;  5KGU A;  5ISR A;  3E5S A;  2F0P A;  4HMJ A;  3D6C A;  4EVO A;  3R3O A;  3SR1 A;  5IIF A;  2KHS A;  2F0U A;  5F2D A;  4KY5 A;  1EY8 A;  4B9W A;  2EY2 A;  1KDC A;  1KDB A;  2F0O A;  5I9O A;  4K5W A;  5E1F A;  1SYE A;  1F2Y A;  3D4D A;  4RKL A;  5C3X A;  4NKL A;  1EYA A;  2EYH A;  1STA A;  4N9P A;  3QB3 A;  5JOB A;  2HQE A;  1TT2 A;  4J6H A;  3SHL A;  3MHB A;  2RKS A;  3DMU A;  2EY5 A;  3BDL A;  3QOJ A;  5CV4 A;  5CC4 A;  2O4X A;  1STG A;  4PMC A;  3TP8 A;  4NMZ A;  4IUN A;  5KYI A;  3ERQ A;  1TR5 A;  1IHZ A;  4ODG A;  4PNY A;  3C1F A;  3OSO A;  4NDX A;  4QB4 A;  5C3W A;  2F0N A;  1ENA A;  4ID6 A;  1STB A;  1EYD A;  4K2K A;  4KHV A;  3U9O A;  1EY4 A;  3NUC A;  5KYL A;  5HUR A;  3TP5 A;  5KRU A;  1SNO A;  4K2L A;  1A2U A;  4KD4 A;  1EY6 A;  1EQV A;  1TQO A;  4H7B A;  4S3S A;  4KY7 A;  4I65 A;  3SXH A;  5C6A A;  3V2T A;  3VA5 A;  5HGT A;  1KAB A;  1STY A;  5J39 A;  2RDF A;  4HMI A;  4F7X A;  5J1Z A; 
#chains in the Genus database with same CATH topology
 1PTO D;  2QW7 A;  3M4O H;  3BYY B;  2WAQ G;  3BZD B;  1CZG A;  1SXT A;  1XPO A;  4WRD A;  3HOY B;  5BN3 A;  1O7L A;  4A3K H;  4BBR B;  1VMP A;  1YZ6 A;  1TS2 A;  3MXP A;  5EPK A;  2JA5 H;  3CC2 A;  4DK3 C;  2VXW A;  2JA6 B;  4P72 A;  2IX0 A;  1EQT A;  1TVX A;  3DEP A;  2F0T A;  1CT1 D;  3TRZ A;  2KHI A;  2ZXP A;  3L0O A;  4U68 A;  5CV8 A;  4APV A;  3X3M A;  2ALY B;  1VQM A;  3F2C A;  4JI1 Q;  1PV4 A;  1X3Q A;  2YTY A;  1SMY C;  2D2C C;  4A76 A;  1JJG A;  2X69 A;  3A8J E;  1TWC B;  5LL6 S;  5FLX E;  5KEE A;  3OIP A;  1V9P A;  2M2L A;  4KJN A;  1AP0 A;  4JW0 A;  5IYC H;  1V1P B;  1NMF A;  2PI2 E;  3H0G G;  5IE8 A;  3J80 c;  1PH1 A;  4ZKC B;  2F0S A;  4ZK9 B;  4LAA A;  4DV4 L;  4C3J G;  5C4X G;  1U0L A;  1EFW A;  1BQQ T;  4DN4 M;  1AN8 A;  2F0J A;  1LAC A;  2F3W A;  4KN4 C;  4JI7 Q;  2IHE A;  4HTH A;  1PTO H;  1UEB A;  4P75 A;  2PMZ B;  3J81 c;  2JA7 B;  1UAP A;  2LXK A;  5C3E B;  2EYM A;  4A3M H;  4BA1 I;  1E2Z A;  1E3P A;  2FFK B;  3PO3 H;  1RIP A;  3CME A;  1B9N A;  1YNJ D;  1YNX A;  3CQZ B;  1CA5 A;  3NP8 A;  3KUP A;  5M3F H;  1D6E C;  1GUT A;  4XT1 B;  4JG2 A;  1PH8 A;  2EY2 A;  1EU3 A;  4K5W A;  1PZI D;  4RKL A;  2R93 G;  1I50 B;  3S1Q B;  1K8M A;  1AFP A;  5CV4 A;  1W2B A;  4DV5 Q;  3TP8 A;  2E2D C;  1YIT A;  4DV2 L;  1WCM H;  2K1B A;  3CC4 A;  1N9W A;  3ZJY C;  1IXR A;  2PNH A;  2Z1C A;  3R93 A;  4YY3 Q;  5BR8 L;  2NN6 H;  4A3J B;  3NEN A;  2JA5 G;  1ONL A;  1WI5 A;  1SDF A;  1X55 A;  3NSW A;  4TVA B;  1TY2 A;  1FJG L;  3VR4 A;  1P16 A;  1VQP A;  1K9M C;  3QR8 A;  1B70 B;  4DR3 Q;  5M3M B;  1FD7 D;  1J6Q A;  1JJ2 A;  2PPB C;  2VW9 A;  4YWK A;  1A6X A;  4B3S L;  2ES2 A;  1BCP D;  2CHB D;  2KCT A;  1ASZ A;  1FNW A;  4K8J A;  1YIJ A;  3NQT A;  1I4X A;  1YJW A;  1PTO C;  2JA8 H;  1G6Z A;  1A62 A;  1JT8 A;  3DXJ C;  1QVF A;  3LNN A;  4ZAI A;  5IYC G;  3KLR A;  5IGG A;  2ID0 A;  3DHQ A;  3HG9 A;  2EY6 A;  4LFA L;  1CKN B;  3NWT A;  1HNX Q;  2NVT B;  2R7F A;  1NMG A;  2A6H D;  3S16 B;  5JEA G;  2A19 A;  1PRT C;  3S14 H;  1V1Q A;  2WKC A;  1SNC A;  4KJO A;  1SE3 A;  3CCR A;  2IW3 A;  3PO3 G;  1U4L A;  4GNX B;  4DU9 A;  2ICE C;  4KLK A;  4NXN L;  1CHP D;  1ENF A;  1KLU D;  1Y1W B;  2JEA I;  1F9Q A;  4N9T A;  5M3F G;  1M8A A;  2HT1 A;  5I6W A;  1ASY A;  1EYG A;  3JAM c;  1VQD A;  3TZU A;  3S1M H;  4X3T A;  2CKZ B;  1D1K A;  1ILP A;  1WCM G;  4B3M Q;  3STB C;  1L0Y B;  1EEI D;  1FYC A;  5KND A;  1AH9 A;  2K14 A;  2NN6 G;  3H94 A;  4YHH Q;  4DNT B;  4KY5 A;  2C9O A;  1EY8 A;  3I4N B;  4LF6 Q;  3PUV A;  1PH2 A;  1YNJ C;  1F2Y A;  1OXS C;  2VY3 A;  4BY7 G;  4A93 B;  5TSS A;  1XMQ L;  1D5Z C;  4P71 A;  1I6H B;  1IL8 A;  2Z6K C;  3OW2 A;  1LT6 D;  4AYB B;  4FF4 A;  1U4P A;  1EIG A;  2V4D A;  1A0I A;  1EY4 A;  2YV5 A;  1WTP A;  4HJ9 A;  2JA8 G;  1LTR D;  1GXD C;  1XNQ L;  5C6A A;  3D4R A;  4K0K L;  1R9T H;  1QVG A;  2AWN A;  2DJF C;  2B2W A;  4F7X A;  4HIK A;  2WV6 D;  4JBW A;  1JWS D;  2F0I A;  2B29 A;  3VYU A;  1EEF D;  5CBA E;  4A4I A;  3T1H Q;  5IY0 A;  3I56 A;  2A6E D;  1B3A A;  1WTH A;  4BA2 I;  4DAP A;  2F0V A;  3RZO B;  4ZCK A;  1TU2 B;  2VB2 X;  3UDG A;  4RKB A;  3HOV B;  2VUM H;  2WAQ E;  1HNW L;  2UUA L;  5GAG C;  1JWU D;  4X66 Q;  1JIC A;  1I4P A;  3ULL A;  4RGO S;  1GJX A;  3FDT A;  1HFG A;  2DNC A;  4NPS A;  1ICW A;  5E7N A;  2E76 C;  4QGU A;  2QCP X;  1Q1B A;  4IN3 A;  1Y8P B;  2E2J B;  2PNR C;  4FYD A;  1AE2 A;  4M8A A;  2JA6 H;  3LWE A;  3NTH A;  1A3U A;  2A6H C;  4JI2 Q;  2EZV A;  3S15 H;  3P1H A;  4L5Q A;  4L5S A;  4KI0 A;  3I4M B;  2NZH A;  3BU2 A;  3IAY A;  4JI4 L;  1PHJ A;  4LF8 L;  2XN9 C;  3MXU A;  4H44 C;  3QO2 A;  5DEH A;  2A8V A;  4N8F A;  3CHB D;  5DLQ E;  3T13 A;  2ZTD A;  5EBC A;  1Y8O B;  3KJP A;  4PZ6 A;  2N55 A;  5LHY 1;  5FOB B;  4KHP Q;  4QUC A;  2KVM A;  3OWE B;  3PUY A;  3R3O A;  4IOA A;  1NR2 A;  1EIF A;  1LTI D;  3NPP A;  1QVC A;  3DMU A;  1U4R A;  2E74 C;  1TS5 A;  3HRZ C;  2DY7 A;  2JJQ A;  1BO0 A;  2JA9 A;  4JI6 L;  2B2T C;  3K80 C;  2KCM A;  2CH4 A;  1Y1V G;  1RF2 D;  2R92 G;  4I65 A;  3HOX B;  4X64 Q;  5JPN C;  1GOZ A;  1HA5 A;  3W2D A;  2VUM G;  1RJT A;  3S2H B;  4OWX B;  5COY A;  4CBV A;  1N34 L;  3HOU H;  1KDA A;  3L3O C;  1N32 L;  1O7Z A;  1XPU A;  3SDZ A;  1OXT A;  4DUY L;  2Q2T A;  1EWH A;  2UXC Q;  2VQF L;  4IUQ A;  4QUF A;  1CKM A;  2B8F A;  2K52 A;  2Y0S G;  4FXD A;  1EUJ A;  4DR5 Q;  2F03 A;  3L2P A;  1JE4 A;  2MHV A;  3FKI B;  3ICE A;  2KHJ A;  4UHV A;  4WJW A;  2JA6 G;  5J3B A;  4IUV A;  5C0X J;  4Q5V A;  5M3M H;  3C3L A;  3K7A B;  2LMC B;  2VL6 A;  1PZJ D;  4IUT A;  3MFY A;  5CMD A;  3CAM A;  4QIW E;  2PZW A;  3OMC A;  1SE4 A;  1DM0 B;  2N8N A;  4HIO A;  3J80 E;  1HNZ L;  1YNN D;  2CH4 W;  2CVR A;  3CXC A;  4IPH A;  2UUC Q;  1B4O A;  3GTG B;  2KUM A;  2B63 B;  2F0F A;  1GUN A;  2D9U A;  2AQ1 B;  1SND A;  1TWA B;  2MNA A;  1DOL A;  1B9M A;  2KEC A;  3BVZ A;  1K3B C;  1HHV A;  4L8J A;  2K5V A;  2L55 A;  4X62 L;  1XX8 A;  3A5Z B;  5EGT A;  2YU9 B;  2NUC A;  2VS1 A;  1VQG A;  4LF9 Q;  5K36 H;  3DUZ A;  1UEA B;  1EL0 A;  3GTJ B;  3J81 E;  2QDB A;  2RCF A;  2NVT H;  2WFW A;  5ISR A;  3K5M A;  5LMN W;  1S5B D;  5F2D A;  2ZTC A;  2NN6 I;  5C3E G;  1MSG A;  1QNU A;  1KDB A;  5I9O A;  1AZP A;  3G6E A;  1YHA A;  3D4D A;  4NKL A;  2F4V L;  4R4I A;  3QOJ A;  1QJO A;  1Y1W H;  4PNY A;  3CCS A;  1LTB D;  4DUZ Q;  1VQK A;  1ENA A;  4XIG S;  2RF4 A;  1EYD A;  2JK8 A;  1PRT B;  1TQO A;  5FJ8 H;  2YYZ A;  2JYO A;  2OT2 A;  2HQL A;  3NE5 B;  3GTO H;  3ERS X;  3GV6 A;  5J1Z A;  4DV1 L;  1AE3 A;  1R4P B;  4B3T Q;  2Z6K A;  1F9R A;  3GO5 A;  4LK1 C;  4BWG B;  3H3V I;  1E0B A;  5M5X H;  5ELC A;  4BBS B;  1SN8 A;  1NR4 A;  4PMB A;  5M3M G;  1PH4 A;  1EY0 A;  1TXY A;  4IFD J;  4ZUJ A;  4DR4 Q;  1C8C A;  1XXG A;  1A63 A;  3TDQ A;  5IYD H;  3HP3 A;  4RGM A;  1SYD A;  3M4Q A;  3QWN A;  2CW0 D;  1QUQ A;  1PFS A;  2DUD A;  1X3P A;  3S24 A;  3E9I A;  3GDE A;  4A3D H;  2JQO A;  2NYZ D;  1XWE A;  3HKZ B;  4C2M H;  3WWV A;  4KV6 A;  5IYB H;  1ENC A;  2JN4 A;  4XQN A;  1H9J A;  4B9X A;  2B8G A;  4DAV A;  4DA2 A;  1G6P A;  1GUS A;  3E9H A;  5KNB A;  2ZM6 Q;  1EQR A;  2GVA A;  3MEH A;  3S9W A;  4LW1 A;  2F0M A;  4DV6 L;  1II3 A;  2LS0 1;  4CDE C;  1C48 A;  3VR2 A;  3VR6 A;  4G7O C;  1H95 A;  1KIX A;  1TWF B;  4MIU A;  4OGQ C;  2A73 B;  1E2W A;  4LUV A;  5JJZ A;  2DGY A;  1VQJ A;  2J4X A;  3M3Y B;  2CQO A;  1YNN C;  5HGQ A;  2RVL A;  3ULJ A;  2NVY H;  4O42 A;  1VQ5 A;  4FF1 A;  3E3X A;  4LFB Q;  1VMC A;  3JAM E;  1Y1W G;  4A3I B;  1BCP F;  4FNF A;  4C56 C;  2NVX H;  2KQ3 A;  3KF8 B;  4PZ7 A;  4GOP C;  2IHF A;  5JPM C;  3BYT B;  4A3F H;  2L11 A;  5LMN Q;  4DK1 A;  5FJ8 G;  3M4Y A;  1KTK A;  4A3G B;  2CFM A;  2L5T A;  4LJZ C;  1LLR D;  3N52 A;  1STA A;  1YBY A;  1I3Q B;  1QIL A;  4GKK L;  2PQA B;  5D65 A;  3I4M H;  4C3I H;  3OOC A;  5ELO A;  3E6Z X;  3C1F A;  4NDX A;  4Y7N B;  4OEM B;  4ULL A;  3NUC A;  1O80 A;  4DK6 C;  4A93 G;  1A15 A;  4HID A;  1G8Z D;  3TQY A;  1OTC A;  3VA5 A;  4JV5 Q;  5IYD G;  1VQ6 A;  5M5W B;  5M5Y B;  1NCV A;  3LX0 A;  3RN2 A;  4ZLT F;  1IKM A;  2H4O A;  2PW7 A;  2B2T A;  3FVQ A;  4KD3 A;  1X9N A;  1HQM C;  4DV7 Q;  1PH6 A;  4A3D G;  1LV9 A;  2R6G A;  2RA4 A;  3P20 A;  1HR0 W;  1SE8 A;  3A7L A;  5IYB G;  3G6J B;  2VZA A;  1D7Q A;  1QB5 D;  2FJ2 A;  5LL6 X;  3U58 A;  4GS3 A;  4OWW B;  2BE5 D;  1V43 A;  2RDG A;  3S2D H;  1IBK Q;  5CV5 A;  3T16 A;  5A35 A;  4DV5 L;  1D5X C;  4LWC A;  2VQE L;  1HPC A;  2F0Q A;  4OL7 A;  5K5P A;  5I9P A;  1PFB A;  2Y0S E;  5C4J B;  1ROD A;  5LMU Q;  3HGB A;  1JQY D;  1B1Z A;  1HRJ A;  5I4D A;  2IJ0 A;  1U4M A;  2ZXR A;  2PI2 A;  5EKI A;  2R7Z B;  3NEM A;  2BOS A;  3T1Y Q;  1NJI C;  1YJ9 A;  4R1J A;  3OTO L;  1XMO Q;  3BG3 A;  5GRO A;  3T4A C;  4RHR A;  4XXE A;  4PMW A;  1B2T A;  4A3F G;  3T53 B;  3K5N A;  5ELN A;  2QKI C;  3FHW A;  1S5D D;  3KLW A;  4NB3 A;  3I3C A;  2DY8 A;  4K14 A;  4DR7 L;  2N78 A;  3I4M G;  4C3I G;  4JI3 L;  2G9D A;  1VQO A;  3A8K E;  3I91 A;  5KGU A;  1VQF A;  2BDO A;  4XTC S;  3D6C A;  3GTL H;  1LM0 A;  2A1A A;  1MGS A;  4B9W A;  4GKJ Q;  1GD7 A;  3A74 A;  2F0O A;  3BZK A;  4B3R Q;  1X6O A;  3NBH A;  1Y69 U;  1L1O C;  1JB3 A;  4DAM A;  3S1R B;  2VNU D;  4C1N K;  3KF6 A;  4DV3 Q;  5JEA H;  3PGZ A;  1MJC A;  2B63 H;  2KA7 A;  4OX9 Q;  4QB4 A;  4JI8 Q;  1TWA H;  1EWI A;  3HOZ B;  5BN4 A;  4ID6 A;  2MPM A;  2SDF A;  5KYL A;  2PMZ E;  2KCC A;  3TP5 A;  5HUR A;  4H02 A;  5ELB A;  5KRU A;  4X65 L;  3PO2 H;  2BCO A;  1SJE D;  3M7N A;  4S3S A;  3AYH B;  2XRQ D;  4AQY Q;  1T9H A;  1KL9 A;  2EYJ A;  1PFN A;  3S17 H;  1D1I A;  4PG3 A;  3VR5 A;  2EXZ A;  1EY9 A;  2MFI A;  1RTO A;  3I90 A;  3HOX G;  2JEB I;  1LO5 D;  2NVQ H;  1Z9F A;  1TS4 A;  1HR0 Q;  3J7Y W;  3H09 A;  2EVB A;  1EQQ A;  5E4W C;  1EOV A;  4N8X 1;  2SNS A;  4JPB W;  1ZYR D;  4BY7 H;  3RLF A;  1SFO B;  3CCM A;  1VQ8 A;  1JOO A;  3OMG A;  1A3V A;  1B8A A;  2BE5 C;  1FVI A;  4QMG A;  2KBN A;  4A3B H;  2UXB L;  1VQI A;  2K75 A;  2GN5 A;  1TKW B;  2FMM A;  1EZ8 A;  4DR1 L;  1ZKO A;  4BXX H;  2Z8L A;  4DR6 L;  3GQB A;  1Q86 C;  1QOH A;  2PZU A;  1VQC A;  5CR3 A;  3MVV A;  5E3F A;  5ELF A;  3H3V H;  1FGU A;  4ME5 A;  4J1M A;  3GTK B;  2AHO B;  2IPK D;  1HH2 P;  4OON A;  2OCE A;  3K5L A;  1GHK A;  3AFQ A;  3OYY A;  2WKD A;  4LF4 L;  4Q0F A;  2B63 G;  3DM3 A;  2L4N A;  1IW7 D;  1CFM A;  4FP5 D;  2H5X A;  4HMJ A;  2F0P A;  4EVO A;  4FVM A;  3G7L A;  3PO2 G;  1EIY B;  1TII D;  2KEE A;  4DV4 Q;  4POG A;  2JXM B;  5T1I A;  1TS3 A;  3QB3 A;  4J6H A;  1SLJ A;  1DOK A;  2RKS A;  1HXY D;  3BDL A;  3D0F A;  4HJA A;  1PXU A;  4PMC A;  1SRU A;  5GQO A;  1S3O A;  3CMA A;  3MC0 B;  4GOP A;  3GTQ H;  2ASB A;  4CJ2 C;  2YTV A;  2ZXO A;  2UU9 L;  1NAP A;  2I5H A;  4FDB A;  1KQS A;  3PIP 3;  4I7Z C;  4C3H H;  3U4Z A;  1EY6 A;  1ILQ A;  4CDD C;  1ESR A;  4HMI A;  1K0S A;  4LF7 L;  1HUN A;  1CSP A;  2B2Y A;  3PUZ A;  3QOL A;  4YIJ A;  4LMQ D;  3KBG A;  1OXV A;  2NB0 A;  1BR9 A;  2PQE A;  2RQX A;  1SNQ A;  2WB1 B;  2LKV A;  4OIJ A;  1K8G A;  2H1E A;  5J22 A;  1M4V A;  4DV2 Q;  4A3B G;  3HOW B;  3K58 A;  5C44 B;  2AUK A;  3R2T A;  1LT4 D;  4IJH A;  5BR8 Q;  4AYB E;  3K59 A;  4HJ5 A;  2MP1 A;  4BXX G;  3K57 A;  2N49 A;  1FJG Q;  1C9O A;  3MXG A;  2PYK A;  5I2Y A;  1I6V C;  3SK6 A;  1WTW A;  4DAY A;  2L9H A;  5IWA L;  3A5U A;  3A8I E;  3NXW A;  1SBB B;  1HZA A;  2V1C C;  1CZW A;  1ZYR C;  3HKS A;  3KLS X;  4E6I A;  5M5Y H;  4B3S Q;  1Y1V H;  4DGZ A;  2XIW A;  2R92 H;  1B7Y B;  3I7F A;  4LFC L;  3FMC A;  4QF4 A;  1BCP C;  3HKZ G;  5ELD A;  3TME A;  1WVL A;  1KNA A;  4H13 C;  4KHZ A;  4DFA A;  3UE1 A;  5EKK A;  2XGT A;  4R4C A;  1HJP A;  3URY A;  2XTI A;  3CCU A;  1D8L A;  1E24 A;  1CM9 A;  4OWT B;  2A69 D;  3DM1 A;  4A3E B;  1H9S A;  1MSH A;  4RHS A;  5JVG 3;  1V8Q A;  4JYA L;  1DON A;  4CKC A;  4LFA Q;  3HOY H;  2WII B;  4BBR H;  2LFN A;  1HZC A;  1ICF B;  1JMC A;  4HAE A;  2K50 A;  5D3I B;  2E2H B;  4C3H G;  2IX1 A;  4A3I G;  4ILW A;  2K33 A;  2CCZ A;  1E7Z A;  4NXN Q;  4O2D A;  5JOB A;  2HQE A;  3UDI A;  3MHB A;  2UXD L;  1JE5 A;  4XYO A;  2FHT A;  3EN2 A;  5C3W A;  2B3G A;  1FGB D;  5EQ0 A;  3UDF A;  3G71 A;  1CSQ A;  2K28 A;  1KAW A;  3B6Y A;  3CKI B;  2R3Z A;  3TS0 A;  1TWC H;  4KHV A;  1QG7 A;  3JC6 6;  1RL2 A;  1K73 C;  2WP8 J;  4O0A A;  5ELE A;  1L1O A;  3V2T A;  3H0G B;  1KAB A;  1STY A;  1L2F A;  1BBX C;  3F8T A;  5FLX c;  3VR3 A;  3W3A A;  1ET6 A;  4HN7 A;  2QEX A;  3MEF A;  3D3R A;  3IL8 A;  4HSV A;  1Q90 A;  3SK4 A;  1Y8N B;  1V1O A;  4C3J B;  2K5Q A;  1FL0 A;  2RCN A;  4A3L H;  4NXM L;  5C5M A;  5C4X B;  4R4T A;  2R7D A;  3S1R H;  3SK8 A;  1WFQ A;  4MN3 A;  3S1N B;  5EKL A;  2JA7 H;  3OWF A;  4RG1 A;  4RFB A;  5C3E H;  3C2P A;  4KKT A;  2K03 A;  3HOZ H;  2MQH A;  3UI2 A;  1VQL A;  1JOK A;  2E8G A;  4HR7 B;  3RLN A;  3CQZ H;  3KJO A;  2E5L L;  1Z6H A;  2LXJ A;  3PSI A;  1VQ7 A;  1XNQ Q;  4K0K Q;  5CGK A;  1KLG D;  1XNR Q;  3GTP B;  2KOL A;  4R8N A;  2CWA A;  2K32 A;  4IPC A;  3K6O A;  3BS1 A;  1IKL A;  5HY6 A;  2R93 B;  1I50 H;  3S1Q H;  2EY1 A;  5NUC A;  2NBF A;  5IT9 L;  3PCO B;  2F0E A;  4IO9 A;  1XTD A;  2CQA A;  3EJI A;  1TWH B;  3M4O B;  2EJG C;  2FXQ A;  3HOY G;  3DEO A;  1CUK A;  4A3K B;  4BBR G;  3NEL A;  3MXN A;  1F2M A;  4LUZ A;  4A3J H;  2A6E C;  3GTM B;  2JA5 B;  1WTQ A;  2Q8I B;  2F4I A;  2Z4I A;  5DM7 3;  1W6J A;  3BDC A;  4JI0 L;  4KKS A;  3Q22 A;  1HNW Q;  1IBL L;  2UUA Q;  4JI5 L;  3A55 A;  1SR3 A;  1I4R A;  5EPJ A;  4RWS C;  3I55 A;  5FLM H;  2DNE A;  4LF5 Q;  2UUB L;  1NE3 A;  1Z7T A;  2A69 C;  2CWP A;  3I73 A;  4ME3 A;  5G3L F;  2RHS B;  1G51 A;  1WD1 A;  1FNV A;  4P74 A;  4JBJ A;  1XPR A;  1XTC D;  5C3X A;  3RLO A;  1AZQ A;  1J5E L;  1WOC A;  1DJR D;  3PIP A;  2A68 D;  4JI4 Q;  5FK9 C;  4A3L G;  2NZ1 D;  4LF8 Q;  1STB A;  4OHJ A;  1IBM L;  3RMH A;  4HJ7 A;  4YCW A;  1VDZ A;  2RDH A;  4DR2 L;  2J0T D;  3OIQ A;  1A2U A;  5H1S E;  3S16 H;  1EQV A;  3SXH A;  4IUP A;  1Q81 C;  4KY7 A;  1U5K A;  4ALP A;  3JAM i;  1PTO B;  3PV0 A;  1DZ1 A;  2JA7 G;  4A3M B;  2BDN A;  4IJL A;  3HOZ G;  3PO3 B;  4KTA A;  1H9K A;  2P5Z X;  2OEO A;  1GUW A;  1N33 L;  2ZTE A;  4IOC A;  1QZH A;  2XNA C;  4F8M A;  2OWO A;  3FRP B;  2HDM A;  1NUC A;  2C5C A;  1K83 B;  1SYF A;  3MAQ A;  3IKJ A;  5LMN L;  4R4Q A;  1YJN A;  4XYQ A;  2HHH Q;  1E22 A;  1Q1E A;  1UNS A;  4JI6 Q;  2HUG A;  1X54 A;  5EBD A;  2KJX A;  1WCM B;  3V96 A;  5CV9 A;  3GV3 A;  2AKW B;  1UE1 A;  1N36 L;  4A3J G;  3EIV A;  3I4N H;  2XWB B;  1CI3 M;  4QCL A;  4DV0 L;  1STE A;  4IAL A;  1N34 Q;  3G48 A;  2F0H A;  3CCE A;  4A93 H;  1E1O A;  4R4O A;  1N32 Q;  4GLX A;  5FLM G;  3T51 B;  4DUY Q;  2TSS A;  5GAD C;  1I6H H;  5AJ3 L;  1M90 C;  2VQF Q;  3SK5 A;  4CKE A;  3ITP A;  3A7A B;  4QY7 A;  3FEW X;  4ZRZ A;  3PF4 A;  1U9R A;  3HOW H;  1BF4 A;  4A3C H;  1LTL A;  2JA8 B;  1F2L A;  1S5E D;  1NTG A;  2Q2H A;  1M1K C;  2Z0S A;  2KED A;  1BVS A;  1OO9 B;  2F0G A;  4DNI A;  1XJV A;  1I94 L;  3CP0 A;  2RBM A;  3HKZ E;  4G7Z C;  3CU7 A;  4X3U A;  3SVM A;  3NK9 A;  1K8A C;  3E5S A;  3CCJ A;  1IZ6 A;  1IYJ B;  1JR0 D;  3CCQ A;  1S5F D;  1BBU A;  4DNR B;  4WJ3 M;  1ZEQ X;  4EGV A;  2IY5 B;  2OTJ A;  5BN5 A;  1W6K A;  1UE7 A;  2I0Q A;  2OQK A;  3S14 B;  1HNZ Q;  3RZO H;  2EYH A;  2L15 A;  3TP6 A;  1NBW A;  3RD4 A;  2ATW A;  2E2I B;  3HOV H;  2I5M X;  3AEV A;  4L63 B;  1DYQ A;  3H15 A;  1PH5 A;  4JCV E;  1QUQ B;  4X62 Q;  4CHT B;  2MUY A;  2PO4 A;  4JI1 L;  5DM6 3;  1CA6 A;  1WTR A;  2GVB A;  2Q2U A;  3J81 j;  4ZYS A;  2A68 C;  2E2J H;  4UY8 C;  1KNE A;  2A5H A;  3KLS A;  4CJ1 B;  3S1M B;  5C0X H;  4AIM A;  1D2B A;  2HIX A;  4JOI A;  1BCP B;  2HIV A;  4K8I A;  4EQN A;  5JJK A;  1PFM A;  3RUZ A;  1F77 A;  2E2H H;  1CTM A;  1SJH D;  1VQA A;  4WOR A;  2SOB A;  2B2Y C;  3KDF A;  2F4V Q;  3UE0 A;  1SSO A;  3CCV A;  3I4N G;  3TEH B;  4RA8 A;  3P75 A;  1K8O A;  1VCI A;  1A2T A;  4J8Q A;  3WOE A;  4JI7 L;  1UWV A;  2WB1 G;  3T56 B;  1HUM A;  2K04 A;  3QIA A;  3A54 A;  2OF1 A;  1T5E A;  3W5O A;  4CJ0 B;  2BH8 A;  4AYB G;  1WJJ A;  2QIL A;  5IT9 c;  3F1Z A;  3HOW G;  4A3C G;  3M4P A;  3WOF A;  1X3E A;  1BNZ A;  5C4H A;  5C44 G;  4DV1 Q;  3AU7 A;  3SE0 A;  5FO8 B;  3D31 A;  4R9W A;  1R9T B;  1PVO A;  1LTA D;  1L0X B;  4V0B A;  5G3L D;  1DOM A;  2K4K A;  1DXM A;  3EFX D;  5I2X A;  2MO1 A;  3D4W A;  1B3Q A;  2IX3 A;  2F0W A;  3O13 A;  2F3V A;  2Z4H A;  3C1E A;  3W1B A;  4RGN A;  4ZQ3 A;  4YY3 L;  1L0W A;  1SYC A;  3HOX H;  4CKB A;  5FKA C;  1Q3L A;  4MZ9 A;  1K28 A;  4GLV B;  1C0A A;  2CW0 C;  1SMX A;  3HOV G;  2ZT9 C;  2VUM B;  2OXP A;  3S2H H;  5IOC A;  5DAU A;  1D5M C;  3AQQ A;  1R4Q B;  1CQF A;  4DR3 L;  3GTP H;  4QJF A;  3NTI A;  2HCI A;  3UDX A;  1RDP D;  5A2Q L;  3G4S A;  3WDN A;  3KFU A;  3H91 A;  3HFZ B;  1V1P A;  2LY7 A;  1KDC A;  2Y0S B;  4GLA C;  1TWH H;  1UE5 A;  2RHQ B;  1CQV A;  4FXG C;  4DV6 Q;  5GAE C;  1TT2 A;  5C0X G;  3R8B A;  3FKI H;  1Q46 A;  3GTM H;  5KYI A;  3ERQ A;  4IFD H;  4IPG A;  4JC0 A;  3S15 B;  2F0N A;  5EPL A;  5AFW A;  1EIH A;  2VB3 X;  3FP9 A;  3VYR A;  3K7A H;  4L5T A;  4KD4 A;  1X3G A;  1EWC A;  4JK1 C;  1Y14 B;  1I5F A;  4KKU A;  1C7Y A;  3LGJ A;  2RDF A;  1PRT D;  4XT3 B;  4HCS A;  1HNX L;  2EYP A;  4EQO A;  1GVP A;  1QNK A;  3GTG H;  4K6L A;  3Q24 A;  1JOR A;  1LTG D;  3SEB A;  1HZ9 A;  3NBI A;  4GKK Q;  3K7U C;  5D14 A;  2K5D A;  2X6G A;  4HCE A;  1DD2 A;  2YU9 H;  4G57 A;  2AQ2 B;  2ZJR A;  3NHH A;  1KRT A;  1WTV A;  1MJE A;  3EQL C;  2I07 B;  1MD2 D;  1S5C D;  2HDL A;  3GTJ H;  2Z9H A;  4GN5 A;  4A75 A;  3PMF A;  5I6Y A;  3MFG A;  4NP5 A;  4XDX A;  3STB D;  2EYO A;  3L9A X;  5JVH 3;  1JCK B;  4B3M L;  2B39 A;  3NQI A;  3F2D A;  1LTT D;  1X65 A;  2N3S A;  5FLX L;  2MO0 A;  2B2V C;  3MA2 B;  2BA1 A;  4UPA A;  4YHH L;  2QA4 A;  3NBH B;  1PA6 A;  3H6M A;  4LF6 L;  3KF6 B;  1C4Q A;  3HOU B;  4G7H C;  1EY7 A;  4V19 0;  1K83 H;  3OHX C;  3AFP A;  3HEJ A;  4P73 A;  3BVG A;  1HTL D;  2VQE Q;  2J7Z A;  5IOD A;  3I2Z A;  4QQB X;  5IGD A;  3DWP A;  4KY6 A;  1Q12 A;  2KCN A;  3Q0A A;  1MHW C;  4A3K G;  1SNM A;  2D5D A;  3FKI G;  2SEB D;  4X6A H;  3KBX A;  2BH2 A;  4ZUI A;  4IFD G;  1PZK D;  3LWU A;  2PW5 A;  1CKN A;  3AMU A;  4POF A;  4BBS H;  4HJ8 A;  1JWM D;  2F1M A;  1RTN A;  1DGS A;  2B2U C;  1JC7 A;  5EJW A;  3T1H L;  4GNX A;  3OTO Q;  1YHQ A;  4N9P A;  2QF7 A;  1VQN A;  2EJF C;  2JE6 I;  1STG A;  1GHJ A;  4RGT A;  1B50 A;  1RCV D;  2L12 A;  3ND8 A;  1OXU A;  1P8L A;  1QWY A;  1VQB A;  1Q7Y C;  5D3D A;  4JBK A;  4DR7 Q;  1IL2 A;  2NZO A;  4X66 L;  2EE1 A;  2HD3 A;  1GUG A;  4F88 A;  4JI3 Q;  2O2L D;  3BVM A;  2XRS D;  5GAH C;  3Q23 A;  1NY4 A;  1I4Q A;  1XYI A;  1CKO A;  1BBW A;  1SYG A;  4AH6 A;  1JB7 A;  2MGS A;  3CRK C;  3HZX A;  1TWF H;  4BY1 B;  3TZD A;  4A3M G;  1J8I A;  1OXX K;  4JI2 L;  2E2I H;  4PV1 C;  3M3Y H;  3TN2 A;  1EY5 A;  1WTX A;  1HCZ A;  4A3I H;  4YWM A;  1TWG B;  1CK1 A;  4TSS A;  4X65 Q;  2F3I A;  2AQ3 B;  3RZD B;  5IP7 H;  4GN4 B;  4YCV A;  1STN A;  3X3N A;  5IP9 H;  2E75 C;  1B44 D;  3I70 A;  3H3V C;  2NWG A;  1N8R C;  3PIO 3;  5CBE E;  3AB9 A;  4KHP L;  1BKB A;  1W3S A;  5KIX A;  4A3G H;  1I3Q H;  1KC8 C;  2EYF A;  1G2S A;  3GTO B;  4UP7 A;  4OXP A;  4RAU C;  2WB1 E;  2Q8R E;  3CCL A;  1S72 A;  4Y7N H;  3K81 C;  1SE2 A;  5M5X B;  4BBS G;  4GOP B;  2QEJ C;  1G91 A;  4PQX A;  2EYL A;  4IQZ A;  4K6D A;  1HZB A;  3TP7 A;  1LT5 D;  1H9M A;  2I46 A;  2EPB A;  3ER0 A;  3CF5 A;  4OO1 H;  1RHP A;  4J15 A;  4DF7 A;  5M5W H;  4FO2 A;  3F2U A;  4UP8 A;  4HIM A;  1O7I A;  4X64 L;  3DWQ A;  4LNQ A;  1SRO A;  3BJU A;  2UXB Q;  3QG1 A;  4A3D B;  2F0U A;  1XNR L;  3KK7 A;  4C2M B;  5T1G A;  1S4Z A;  4DR1 Q;  2EQS A;  4YWL A;  3ZYY X;  3CPW A;  3OW7 A;  1SYE A;  5E1F A;  4DR6 Q;  3SHL A;  2UXC L;  1YI2 A;  4X3S A;  2EY5 A;  1JJC B;  4P2C B;  4H0L C;  5C0X I;  1BOS A;  4DR5 L;  2RSO A;  4IUR A;  3ND9 A;  1PYW D;  2WAQ B;  1RD9 D;  3U9O A;  1Q82 C;  1WD0 A;  3A0J A;  2AWO A;  1SNO A;  2M9V A;  2X6L A;  5C4J H;  4LF4 Q;  4H7B A;  4DAY B;  4MNO A;  4I7A A;  2NVY B;  3E0E A;  1FR3 A;  4IUU A;  2IT1 A;  2OQ0 A;  4XQQ A;  2R7Z H;  3TBI B;  3CC7 A;  1E1T A;  1PYS B;  1IW7 C;  2EXD A;  3MWY W;  1WTO A;  3J80 i;  4LF5 L;  2NVX B;  3MZ5 A;  2F0D A;  5IP7 G;  2O5I C;  4JOI C;  3M9B A;  5IP9 G;  4A3F B;  4NW2 A;  1VQ4 A;  2TMP A;  3IRB A;  1EYC A;  2JP1 A;  2UUC L;  1VF5 C;  2YTX A;  4A3G G;  4PZ8 A;  2L0C A;  1J9O A;  2A74 C;  5CV6 A;  3I4L A;  2IL8 A;  1BXT A;  4FXK C;  5C4Z A;  2UU9 Q;  1H9S B;  4C3I B;  3VYS A;  4KN7 C;  3J81 i;  2F0K A;  4F87 A;  3ERO A;  2M00 A;  4LF9 L;  1CHQ D;  4Z9C B;  4LF7 Q;  2LSS A;  1PLF A;  5IT9 E;  1X32 A;  1K3R A;  3R2I A;  1H9R A;  2R61 A;  3NWS A;  3J7A 5;  4OO1 G;  2BA0 A;  1XMQ Q;  1VQE A;  4O1N A;  4UDU C;  1IYU A;  4KK7 A;  4MHE A;  1PH7 A;  3D8G A;  4TQU S;  2K5H A;  2ICI A;  4L5R C;  1YEZ A;  4R8I A;  4XQJ A;  1PDQ A;  2DN8 A;  3V05 A;  3IFD A;  3ONA B;  1SNP A;  1GM5 A;  4DUZ L;  2PCF B;  2QGQ A;  1E2V A;  3Q8D A;  4RH6 A;  2B2V A;  1SYB A;  2HHH L;  5CYU A;  1L1O B;  1NSN S;  3S2D B;  1A8V A;  1ZXT A;  5IWA Q;  4UP9 A;  1F9S A;  4IFD I;  4M1U B;  2XWJ B;  1B53 A;  1LYL A;  2KHS A;  4HED A;  2K5W A;  4B3T L;  3VYT A;  4X3K A;  4LFC Q;  4BS9 A;  3CD6 A;  1VS0 A;  2JSO A;  1G29 1;  1EYA A;  3GD7 A;  5CC4 A;  2Q8T A;  2R7Z G;  3I8Z A;  4DR4 L;  3ULP A;  4ODG A;  3HS0 C;  3OSO A;  1SFO H;  1SEB D;  4TKO B;  1PH3 A;  2N88 A;  2K7V A;  2D62 A;  3W1G A;  4K2L A;  1G2T A;  4JYA Q;  2NTS A;  2B2U A;  2HCC A;  3PUW A;  1KXL A;  1QZG A;  1AW7 A;  3J7A V;  1K0R A;  5IGC A;  1EZ6 A;  3K5O A;  2EDG A;  2RSN A;  2NTT A;  4EQ5 A;  4Y52 H;  4QIW B;  2EJM A;  3A56 A;  3I72 A;  4DK0 A;  5M9O A;  3L7Z C;  3VA7 A;  2ZM6 L;  5JAV A;  2FMC A;  3MXN B;  3GTK H;  3GTL B;  5COR A;  2UXD Q;  1IYV A;  1AEX A;  1BUV T;  1F2Z A;  3M7G A;  1TY0 A;  4TRD A;  1X3F A;  3J7Z C;  1BDO A;  1NNX A;  2AMC B;  3M85 A;  1UE6 A;  4WJ4 A;  1VQH A;  4CDF C;  5JJL A;  1STH A;  1GKH A;  1LT3 D;  4LFB L;  3PIO A;  2FIN B;  2XVS A;  2WAC A;  5IGE A;  1PTO F;  5CV7 A;  1QCB D;  2QDL A;  2EIF A;  4K5V A;  4YCU A;  2SNM A;  3CW2 C;  3PO2 B;  4DXG A;  1QE6 A;  3C46 A;  5M3F B;  3D6W A;  2ENB A;  4NXM Q;  3RNU A;  3MTS A;  4ZKB B;  3S17 B;  4JVZ A;  4BY1 H;  3J80 L;  3F2B A;  1VQ9 A;  5IGB A;  4DXF A;  2NVQ B;  4IZ8 A;  1PRT F;  3NTK A;  1TWG H;  2E5L Q;  3HOU G;  4G4K A;  3RZD H;  1HTP A;  3Q6S A;  2C35 B;  4EX5 A;  2F52 A;  1HFN A;  4JV5 L;  4BY7 B;  4C1N I;  3J81 L;  4U67 3;  4OEL B;  3SR1 A;  5IIF A;  1ML0 D;  4RCO A;  2Z6B A;  3FPU B;  2WIN B;  1SAP A;  4A3B B;  4FF3 A;  1WYD A;  4DV7 L;  3PQI A;  5C44 H;  3KOJ A;  2O4X A;  1MBY A;  5FO7 B;  1KHI A;  1I4G A;  4IUN A;  4GNX C;  1TR5 A;  1IHZ A;  1LUZ A;  1FNU A;  2ZJP A;  4JI0 Q;  1IBL Q;  4JI5 Q;  4CGY B;  4K2K A;  1IBK L;  5L37 A;  1S40 A;  1ESF A;  1O7Y A;  3N6R A;  4KMU C;  3RR5 A;  2G9H D;  4RCN A;  2UUB Q;  2XSC A;  3CRL C;  5JJI A;  1PMR A;  3KF8 A;  1EFI D;  5LMU L;  3I4O A;  3TRE A;  5IGF A;  3E0J A;  2L1B A;  3BDO A;  3U4V A;  3T1Y L;  3K8A A;  5JEA J;  2ZJQ A;  2K6A A;  3QJY A;  1J5E Q;  1JOQ A;  1XMO L;  5K36 G;  5EAY A;  2PQA A;  1SMY D;  4A3E H;  2D0O A;  2I5L X;  5FO9 B;  3TS2 A;  1X56 A;  3DWA A;  1DCZ A;  4MTK A;  1IBM Q;  3DLL A;  1HQR D;  2PZT A;  1EU4 A;  1Q8I A;  2K05 A;  3FPP A;  1LTS D;  4BY1 G;  4DKA C;  4DR2 Q;  3PUX A;  4QL5 A;  3GTQ B;  1A3T A;  4ABN A;  3BZC A;  2Q2I A;  2O5J C;  1T5X D;  2GA4 B;  1KAA A;  4RMF A;  1VF7 A;  3U50 C;  4DPG A;  4OIK A;  4C3H B;  4GZY C;  1Z47 A;  4K5X A;  4FF2 A;  2F0L A;  5E4X A;  3SGI A;  2EOT A;  1N33 Q;  3EA6 A;  4GKJ L;  1KRS A;  4B3R L;  4OO1 I;  2K5N A;  2AUJ D;  2DJG C;  3K0X A;  4DV3 L;  5DNF A;  4L6T B;  1F9P A;  4OX9 L;  4JI8 L;  1KD1 C;  4GN3 B;  3OPO A;  3EVQ A;  1RKN A;  2G5D A;  3H0G H;  2KEN A;  2D0P A;  4EQP A;  1LAB A;  1N36 Q;  4MTN A;  2OTL A;  1EOT A;  2MJ8 A;  3TSS A;  3JAM L;  4C3J H;  3GP7 A;  5A2Q E;  4DV0 Q;  5C5L A;  5C4X H;  4WFN 3;  4AQY L;  3K0Y A;  4JBM A;  4B08 A;  3RN5 A;  1ET9 A;  3KDF B;  4LUO A;  1HA6 A;  3S1N H;  5KNC A;  5AJ3 Q;  1Q8K A;  3CPF A;  1MKH A;  3EBE A;  2B2W C;  1Y1V B;  3P7J A;  1UUP A;  2R92 B;  4NMZ A;  3IFT A;  1GUO A;  2K01 A;  4HSP A;  1HR0 L;  1MIU A;  3PF5 A;  4UAI A;  1MI2 A;  1O78 A;  3J7A F;  1PYB A;  3KYH C;  1I4H A;  4IPD A;  3U9S A;  1I94 Q;  1YVC A;  2R93 H;  3VDY A;  2IWH A;  5HGT A;  4A3E G;  1GO3 E;  1PH9 A;  5J39 A;  4CDC C;  1YHB A; 
#chains in the Genus database with same CATH homology
 1PTO D;  3BYY B;  3BZD B;  1CZG A;  1SXT A;  3HOY B;  4WRD A;  5BN3 A;  1O7L A;  4BBR B;  1VMP A;  1TS2 A;  3MXP A;  5EPK A;  2VXW A;  2JA6 B;  2IX0 A;  1EQT A;  1TVX A;  3DEP A;  2F0T A;  1CT1 D;  2ZXP A;  4U68 A;  5CV8 A;  3X3M A;  1X3Q A;  1SMY C;  2D2C C;  2X69 A;  3A8J E;  1TWC B;  5LL6 S;  5FLX E;  5KEE A;  3OIP A;  2M2L A;  4KJN A;  1AP0 A;  1V1P B;  4ZKC B;  2F0S A;  4ZK9 B;  4LAA A;  4C3J G;  1BQQ T;  4DN4 M;  1AN8 A;  2F0J A;  1LAC A;  2F3W A;  4KN4 C;  4HTH A;  1PTO H;  2PMZ B;  2JA7 B;  1EIH A;  1UAP A;  5C3E B;  2EYM A;  4BA1 I;  1E2Z A;  2FFK B;  1B9N A;  1YNJ D;  3CQZ B;  1CA5 A;  3NP8 A;  3KUP A;  1D6E C;  1GUT A;  4XT1 B;  2EY2 A;  1EU3 A;  4K5W A;  1PZI D;  4RKL A;  1I50 B;  3S1Q B;  1K8M A;  1AFP A;  5CV4 A;  3TP8 A;  2E2D C;  2K1B A;  2Z1C A;  3R93 A;  2NN6 H;  4A3J B;  1ONL A;  1SDF A;  3NSW A;  1TY2 A;  3VR4 A;  5M3M B;  1FD7 D;  2PPB C;  1A6X A;  1BCP D;  2CHB D;  1FNW A;  4K8J A;  3NQT A;  1I4X A;  1PTO C;  1G6Z A;  3DXJ C;  3LNN A;  4ZAI A;  3KLR A;  5IGG A;  2ID0 A;  3DHQ A;  3HG9 A;  2EY6 A;  3NWT A;  2NVT B;  2A6H D;  3S16 B;  5JEA G;  1PRT C;  2WKC A;  1SNC A;  4KJO A;  1SE3 A;  2IW3 A;  1U4L A;  4DU9 A;  2ICE C;  1CHP D;  1ENF A;  1KLU D;  1Y1W B;  2JEA I;  1F9Q A;  4N9T A;  1M8A A;  5I6W A;  3TZU A;  4X3T A;  1D1K A;  1ILP A;  1L0Y B;  1EEI D;  1FYC A;  5KND A;  2NN6 G;  3H94 A;  4DNT B;  4KY5 A;  2C9O A;  1EY8 A;  3I4N B;  3PUV A;  1YNJ C;  1F2Y A;  1OXS C;  4A93 B;  5TSS A;  1D5Z C;  1I6H B;  1IL8 A;  1LT6 D;  4AYB B;  4FF4 A;  1U4P A;  1EIG A;  2V4D A;  1EY4 A;  1WTP A;  1LTR D;  1GXD C;  5C6A A;  3D4R A;  2AWN A;  2B2W A;  4F7X A;  2WV6 D;  4JBW A;  1JWS D;  2F0I A;  3VYU A;  5CBA E;  1EEF D;  2A6E D;  1B3A A;  4BA2 I;  4DAP A;  2F0V A;  3RZO B;  1TU2 B;  2VB2 X;  4RKB A;  3HOV B;  1JWU D;  1JIC A;  1I4P A;  4RGO S;  1GJX A;  3FDT A;  1HFG A;  2DNC A;  1ICW A;  2E76 C;  2QCP X;  1Q1B A;  4IN3 A;  1Y8P B;  2E2J B;  2PNR C;  4FYD A;  4M8A A;  3LWE A;  3NTH A;  1A3U A;  2A6H C;  2EZV A;  3P1H A;  3I4M B;  4KI0 A;  3IAY A;  2XN9 C;  3MXU A;  4H44 C;  3QO2 A;  5DEH A;  3CHB D;  3T13 A;  5EBC A;  1Y8O B;  2N55 A;  5LHY 1;  5FOB B;  4QUC A;  2KVM A;  3OWE B;  3PUY A;  3R3O A;  1NR2 A;  1LTI D;  3NPP A;  3DMU A;  1U4R A;  2E74 C;  1TS5 A;  3HRZ C;  2DY7 A;  1BO0 A;  2B2T C;  1RF2 D;  4I65 A;  3HOX B;  5JPN C;  1GOZ A;  1HA5 A;  3W2D A;  1RJT A;  3S2H B;  5COY A;  4CBV A;  1KDA A;  3L3O C;  1O7Z A;  3SDZ A;  1OXT A;  1EWH A;  4IUQ A;  4QUF A;  2B8F A;  4FXD A;  2F03 A;  1JE4 A;  2MHV A;  3FKI B;  4WJW A;  4IUV A;  5C0X J;  4Q5V A;  3C3L A;  3K7A B;  2LMC B;  1PZJ D;  4IUT A;  3MFY A;  5CMD A;  2PZW A;  3OMC A;  1SE4 A;  1DM0 B;  3J80 E;  1YNN D;  2CVR A;  1B4O A;  3GTG B;  2KUM A;  2B63 B;  2F0F A;  1GUN A;  2D9U A;  2AQ1 B;  1SND A;  1TWA B;  1DOL A;  1B9M A;  2KEC A;  3BVZ A;  1HHV A;  4L8J A;  2L55 A;  1XX8 A;  5EGT A;  2YU9 B;  2NUC A;  5K36 H;  3DUZ A;  1UEA B;  1EL0 A;  3GTJ B;  3J81 E;  2QDB A;  5ISR A;  3K5M A;  1S5B D;  5F2D A;  2NN6 I;  1MSG A;  1QNU A;  1KDB A;  5I9O A;  1AZP A;  3D4D A;  4NKL A;  3QOJ A;  1QJO A;  4PNY A;  1LTB D;  1ENA A;  4XIG S;  1EYD A;  1PRT B;  1TQO A;  2YYZ A;  2JYO A;  2OT2 A;  3NE5 B;  5J1Z A;  3GV6 A;  1R4P B;  3GO5 A;  1F9R A;  4LK1 C;  4BWG B;  1E0B A;  5ELC A;  4BBS B;  1NR4 A;  4PMB A;  1EY0 A;  4IFD J;  4ZUJ A;  1C8C A;  1XXG A;  3TDQ A;  3HP3 A;  4RGM A;  1SYD A;  3QWN A;  2CW0 D;  1X3P A;  2NYZ D;  1XWE A;  3HKZ B;  4KV6 A;  1ENC A;  4XQN A;  1H9J A;  4B9X A;  2B8G A;  4DAV A;  4DA2 A;  1GUS A;  5KNB A;  3MEH A;  3S9W A;  2F0M A;  1II3 A;  2LS0 1;  1C48 A;  3VR2 A;  3VR6 A;  4G7O C;  1TWF B;  4MIU A;  4OGQ C;  2A73 B;  1E2W A;  5JJZ A;  2J4X A;  3M3Y B;  1YNN C;  2RVL A;  4O42 A;  4FF1 A;  1VMC A;  3JAM E;  4A3I B;  1BCP F;  4FNF A;  4C56 C;  2KQ3 A;  5JPM C;  3BYT B;  2L11 A;  4DK1 A;  3M4Y A;  1KTK A;  4A3G B;  4LJZ C;  2L5T A;  1LLR D;  3N52 A;  1STA A;  1I3Q B;  1QIL A;  5D65 A;  3OOC A;  3E6Z X;  3C1F A;  4NDX A;  4Y7N B;  4ULL A;  3NUC A;  1O80 A;  1A15 A;  1G8Z D;  3VA5 A;  5M5W B;  5M5Y B;  1NCV A;  3LX0 A;  4ZLT F;  1IKM A;  2H4O A;  2PW7 A;  2B2T A;  3FVQ A;  4KD3 A;  1HQM C;  1LV9 A;  2R6G A;  2RA4 A;  3P20 A;  3A7L A;  3G6J B;  1QB5 D;  2FJ2 A;  5LL6 X;  2BE5 D;  1V43 A;  2RDG A;  5CV5 A;  3T16 A;  5A35 A;  1D5X C;  1HPC A;  2F0Q A;  4OL7 A;  5K5P A;  5I9P A;  1PFB A;  5C4J B;  1ROD A;  3HGB A;  1JQY D;  1B1Z A;  1HRJ A;  5I4D A;  2IJ0 A;  1U4M A;  2ZXR A;  5EKI A;  2R7Z B;  2BOS A;  3BG3 A;  3T4A C;  4RHR A;  4XXE A;  4PMW A;  1B2T A;  3T53 B;  3K5N A;  2QKI C;  1S5D D;  3I3C A;  2DY8 A;  4K14 A;  4C3I G;  2G9D A;  3A8K E;  3I91 A;  5KGU A;  2BDO A;  4XTC S;  3D6C A;  1MGS A;  4B9W A;  2F0O A;  3NBH A;  1Y69 U;  1JB3 A;  3S1R B;  2VNU D;  4C1N K;  5JEA H;  2KA7 A;  4QB4 A;  3HOZ B;  5BN4 A;  4ID6 A;  2MPM A;  2SDF A;  5KYL A;  2KCC A;  3TP5 A;  5HUR A;  5ELB A;  5KRU A;  2BCO A;  1SJE D;  3M7N A;  4S3S A;  2XRQ D;  2EYJ A;  1PFN A;  1D1I A;  3VR5 A;  2EXZ A;  1EY9 A;  1RTO A;  3I90 A;  2JEB I;  1LO5 D;  1TS4 A;  3J7Y W;  3H09 A;  2EVB A;  5E4W C;  2SNS A;  1ZYR D;  3RLF A;  1SFO B;  1JOO A;  1A3V A;  3OMG A;  2BE5 C;  4QMG A;  1TKW B;  2FMM A;  1EZ8 A;  1ZKO A;  2Z8L A;  3GQB A;  1QOH A;  2PZU A;  5CR3 A;  3MVV A;  5E3F A;  5ELF A;  4ME5 A;  4J1M A;  3GTK B;  2IPK D;  3K5L A;  1GHK A;  2WKD A;  4Q0F A;  2L4N A;  1IW7 D;  1CFM A;  4FP5 D;  4HMJ A;  2F0P A;  4EVO A;  4FVM A;  3G7L A;  1TII D;  2KEE A;  2JXM B;  5T1I A;  1TS3 A;  3QB3 A;  4J6H A;  1DOK A;  2RKS A;  1HXY D;  3BDL A;  1PXU A;  4PMC A;  3MC0 B;  4CJ2 C;  2ZXO A;  1NAP A;  3PIP 3;  4I7Z C;  1EY6 A;  1ILQ A;  1ESR A;  4HMI A;  1HUN A;  2B2Y A;  3PUZ A;  3QOL A;  4YIJ A;  4LMQ D;  3KBG A;  1OXV A;  2NB0 A;  1BR9 A;  2PQE A;  2RQX A;  1SNQ A;  2WB1 B;  2LKV A;  4OIJ A;  2H1E A;  5J22 A;  1M4V A;  3HOW B;  3K58 A;  5C44 B;  2AUK A;  3R2T A;  1LT4 D;  3K59 A;  2MP1 A;  3K57 A;  3MXG A;  2PYK A;  5I2Y A;  1I6V C;  3SK6 A;  1WTW A;  4DAY A;  2L9H A;  3A8I E;  3NXW A;  1SBB B;  3KLS X;  1CZW A;  1ZYR C;  4E6I A;  4DGZ A;  2XIW A;  3FMC A;  4QF4 A;  1BCP C;  5ELD A;  1WVL A;  3TME A;  1KNA A;  4H13 C;  4KHZ A;  4DFA A;  5EKK A;  3URY A;  1CM9 A;  2A69 D;  3DM1 A;  4A3E B;  1H9S A;  1MSH A;  4RHS A;  5JVG 3;  1V8Q A;  1DON A;  4CKC A;  2WII B;  2LFN A;  4HAE A;  5D3I B;  2E2H B;  4C3H G;  2IX1 A;  4ILW A;  2K33 A;  5JOB A;  2HQE A;  3MHB A;  4XYO A;  2FHT A;  5C3W A;  1FGB D;  5EQ0 A;  2K28 A;  3CKI B;  2R3Z A;  4KHV A;  1QG7 A;  2WP8 J;  5ELE A;  3V2T A;  3H0G B;  1KAB A;  1STY A;  1BBX C;  3VR3 A;  3W3A A;  1ET6 A;  4HN7 A;  3D3R A;  3IL8 A;  4HSV A;  1Q90 A;  3SK4 A;  1Y8N B;  1V1O A;  4C3J B;  2K5Q A;  5C5M A;  5C4X B;  3SK8 A;  4MN3 A;  3S1N B;  5EKL A;  3OWF A;  4RFB A;  3C2P A;  4KKT A;  2K03 A;  3UI2 A;  1JOK A;  4HR7 B;  1Z6H A;  5CGK A;  1KLG D;  3GTP B;  2KOL A;  4R8N A;  2K32 A;  3K6O A;  3BS1 A;  1IKL A;  2R93 B;  2EY1 A;  5NUC A;  2NBF A;  5IT9 L;  2F0E A;  2CQA A;  3EJI A;  1TWH B;  3M4O B;  2EJG C;  3DEO A;  4A3K B;  3MXN A;  1F2M A;  2A6E C;  3GTM B;  2JA5 B;  1WTQ A;  2Q8I B;  2F4I A;  2Z4I A;  5DM7 3;  1W6J A;  3BDC A;  4KKS A;  3Q22 A;  3A55 A;  1I4R A;  5EPJ A;  4RWS C;  2DNE A;  1Z7T A;  2A69 C;  3I73 A;  5G3L F;  1WD1 A;  1FNV A;  1XTC D;  5C3X A;  1AZQ A;  1DJR D;  2A68 D;  5FK9 C;  2NZ1 D;  1STB A;  4OHJ A;  3RMH A;  1VDZ A;  2RDH A;  2J0T D;  3OIQ A;  1A2U A;  1EQV A;  3SXH A;  4IUP A;  1DZ1 A;  4KY7 A;  1PTO B;  3PV0 A;  4A3M B;  2BDN A;  3PO3 B;  4KTA A;  1H9K A;  2OEO A;  1GUW A;  2XNA C;  4F8M A;  3FRP B;  2HDM A;  1NUC A;  2C5C A;  1K83 B;  1SYF A;  3MAQ A;  3IKJ A;  4XYQ A;  1Q1E A;  1UNS A;  2HUG A;  5EBD A;  2KJX A;  1WCM B;  3V96 A;  5CV9 A;  3GV3 A;  2XWB B;  1CI3 M;  4QCL A;  1STE A;  4IAL A;  2F0H A;  3T51 B;  2TSS A;  3SK5 A;  4CKE A;  3ITP A;  3A7A B;  3FEW X;  4ZRZ A;  1U9R A;  1BF4 A;  2JA8 B;  1F2L A;  1S5E D;  2KED A;  1OO9 B;  2F0G A;  2RBM A;  4G7Z C;  3CU7 A;  4X3U A;  3SVM A;  3NK9 A;  3E5S A;  1JR0 D;  1S5F D;  4DNR B;  1ZEQ X;  4EGV A;  5BN5 A;  1W6K A;  3S14 B;  2EYH A;  3TP6 A;  3RD4 A;  2E2I B;  4L63 B;  1DYQ A;  4CHT B;  2MUY A;  2PO4 A;  5DM6 3;  1CA6 A;  1WTR A;  4ZYS A;  2A68 C;  1KNE A;  2A5H A;  3KLS A;  4CJ1 B;  3S1M B;  5C0X H;  1D2B A;  1BCP B;  4K8I A;  4EQN A;  1PFM A;  3RUZ A;  1F77 A;  1CTM A;  1SJH D;  4WOR A;  2SOB A;  2B2Y C;  1SSO A;  4RA8 A;  3P75 A;  1K8O A;  1VCI A;  1A2T A;  4J8Q A;  3WOE A;  3T56 B;  1HUM A;  2K04 A;  3QIA A;  3A54 A;  2OF1 A;  1T5E A;  4CJ0 B;  2QIL A;  3WOF A;  1BNZ A;  5C4H A;  3AU7 A;  3SE0 A;  5FO8 B;  3D31 A;  4R9W A;  1R9T B;  1LTA D;  1L0X B;  4V0B A;  5G3L D;  1DOM A;  1DXM A;  3EFX D;  5I2X A;  3D4W A;  2IX3 A;  2F0W A;  3O13 A;  2F3V A;  2Z4H A;  3C1E A;  4RGN A;  4ZQ3 A;  1SYC A;  4CKB A;  5FKA C;  1Q3L A;  2CW0 C;  2ZT9 C;  2VUM B;  2OXP A;  5IOC A;  5DAU A;  1D5M C;  1R4Q B;  1CQF A;  3NTI A;  2HCI A;  1RDP D;  5A2Q L;  3WDN A;  3H91 A;  1V1P A;  2LY7 A;  1KDC A;  2Y0S B;  1CQV A;  4FXG C;  1TT2 A;  5C0X G;  3R8B A;  5KYI A;  3ERQ A;  4IFD H;  3S15 B;  2F0N A;  5EPL A;  5AFW A;  2VB3 X;  3VYR A;  4KD4 A;  1EWC A;  4JK1 C;  4KKU A;  2RDF A;  1PRT D;  4XT3 B;  4HCS A;  2EYP A;  4EQO A;  1QNK A;  4K6L A;  3Q24 A;  1JOR A;  1LTG D;  3SEB A;  3NBI A;  5D14 A;  2K5D A;  2X6G A;  4HCE A;  1DD2 A;  4G57 A;  2AQ2 B;  1WTV A;  3NHH A;  3EQL C;  2I07 B;  1MD2 D;  1S5C D;  2HDL A;  3PMF A;  5I6Y A;  3MFG A;  4NP5 A;  4XDX A;  2EYO A;  3L9A X;  5JVH 3;  1JCK B;  2B39 A;  3NQI A;  1LTT D;  5FLX L;  2B2V C;  3MA2 B;  2BA1 A;  3H6M A;  1C4Q A;  3HOU B;  4G7H C;  1EY7 A;  4V19 0;  3OHX C;  3HEJ A;  3BVG A;  1HTL D;  2J7Z A;  5IOD A;  5IGD A;  3DWP A;  4KY6 A;  1Q12 A;  2KCN A;  3Q0A A;  1SNM A;  2D5D A;  2SEB D;  3KBX A;  4ZUI A;  4IFD G;  1PZK D;  3LWU A;  2PW5 A;  3AMU A;  1JWM D;  2F1M A;  1RTN A;  2B2U C;  1JC7 A;  5EJW A;  4N9P A;  2QF7 A;  2EJF C;  2JE6 I;  1STG A;  1GHJ A;  4RGT A;  1B50 A;  1RCV D;  2L12 A;  1OXU A;  1QWY A;  3ND8 A;  5D3D A;  2EE1 A;  4F88 A;  1GUG A;  2O2L D;  3BVM A;  2XRS D;  3Q23 A;  1I4Q A;  1XYI A;  1SYG A;  2MGS A;  3CRK C;  3HZX A;  4BY1 B;  3TZD A;  1J8I A;  1OXX K;  4PV1 C;  3TN2 A;  1EY5 A;  1WTX A;  1HCZ A;  1TWG B;  1CK1 A;  4TSS A;  2AQ3 B;  3RZD B;  1STN A;  3X3N A;  2E75 C;  1B44 D;  3I70 A;  3H3V C;  2NWG A;  3PIO 3;  5CBE E;  3AB9 A;  5KIX A;  2EYF A;  1G2S A;  3GTO B;  4RAU C;  2Q8R E;  1SE2 A;  5M5X B;  2QEJ C;  1G91 A;  4PQX A;  2EYL A;  4IQZ A;  4K6D A;  3TP7 A;  1LT5 D;  1H9M A;  2I46 A;  2EPB A;  4OO1 H;  1RHP A;  4DF7 A;  4FO2 A;  3F2U A;  3DWQ A;  3QG1 A;  4A3D B;  2F0U A;  3KK7 A;  4C2M B;  5T1G A;  1S4Z A;  3ZYY X;  3OW7 A;  1SYE A;  5E1F A;  3SHL A;  4X3S A;  2EY5 A;  4P2C B;  4H0L C;  5C0X I;  1BOS A;  2RSO A;  4IUR A;  3ND9 A;  1PYW D;  2WAQ B;  1RD9 D;  3U9O A;  1WD0 A;  2AWO A;  1SNO A;  2M9V A;  2X6L A;  4H7B A;  2NVY B;  1FR3 A;  4IUU A;  2IT1 A;  4XQQ A;  3TBI B;  1IW7 C;  3MWY W;  1WTO A;  2NVX B;  3MZ5 A;  2F0D A;  2O5I C;  4A3F B;  4NW2 A;  2TMP A;  1EYC A;  2JP1 A;  1VF5 C;  2L0C A;  1J9O A;  2A74 C;  5CV6 A;  3I4L A;  2IL8 A;  1BXT A;  4FXK C;  5C4Z A;  1H9S B;  4C3I B;  3VYS A;  4KN7 C;  2F0K A;  4F87 A;  3ERO A;  2M00 A;  1CHQ D;  4Z9C B;  1PLF A;  5IT9 E;  1X32 A;  1H9R A;  2R61 A;  3R2I A;  3NWS A;  4OO1 G;  2BA0 A;  4O1N A;  4UDU C;  1IYU A;  4KK7 A;  4MHE A;  3D8G A;  4TQU S;  2ICI A;  4R8I A;  4XQJ A;  1PDQ A;  2DN8 A;  3V05 A;  3IFD A;  3ONA B;  1SNP A;  2PCF B;  1E2V A;  4RH6 A;  2B2V A;  1SYB A;  5CYU A;  1NSN S;  3S2D B;  1ZXT A;  1F9S A;  4IFD I;  4M1U B;  2XWJ B;  1B53 A;  2KHS A;  4HED A;  2K5W A;  3VYT A;  4X3K A;  4BS9 A;  2JSO A;  1G29 1;  1EYA A;  3GD7 A;  5CC4 A;  2Q8T A;  3I8Z A;  4ODG A;  3HS0 C;  3OSO A;  1SEB D;  4TKO B;  2N88 A;  2K7V A;  2D62 A;  4K2L A;  1G2T A;  2NTS A;  2B2U A;  2HCC A;  3PUW A;  1AW7 A;  3J7A V;  5IGC A;  1EZ6 A;  3K5O A;  2EDG A;  2RSN A;  2NTT A;  4QIW B;  2EJM A;  3A56 A;  3I72 A;  4DK0 A;  5M9O A;  3L7Z C;  3VA7 A;  5JAV A;  2FMC A;  3GTL B;  5COR A;  1IYV A;  1AEX A;  1BUV T;  1F2Z A;  3M7G A;  1TY0 A;  4TRD A;  1BDO A;  3M85 A;  1STH A;  1LT3 D;  2FIN B;  2XVS A;  2WAC A;  5IGE A;  1PTO F;  5CV7 A;  1QCB D;  4K5V A;  2SNM A;  3PO2 B;  4DXG A;  1QE6 A;  3C46 A;  5M3F B;  3D6W A;  2ENB A;  3MTS A;  4ZKB B;  3S17 B;  3J80 L;  5IGB A;  4DXF A;  2NVQ B;  4IZ8 A;  1PRT F;  3NTK A;  4G4K A;  1HTP A;  3Q6S A;  1HFN A;  4BY7 B;  4C1N I;  3J81 L;  4U67 3;  3SR1 A;  5IIF A;  1ML0 D;  4RCO A;  3FPU B;  2WIN B;  1SAP A;  4A3B B;  4FF3 A;  2O4X A;  1MBY A;  5FO7 B;  4IUN A;  1I4G A;  1TR5 A;  1IHZ A;  1FNU A;  4CGY B;  4K2K A;  1ESF A;  1O7Y A;  3N6R A;  4KMU C;  2G9H D;  4RCN A;  2XSC A;  3CRL C;  1PMR A;  3KF8 A;  1EFI D;  5IGF A;  3E0J A;  2L1B A;  3BDO A;  5JEA J;  2K6A A;  3QJY A;  1JOQ A;  5K36 G;  1SMY D;  5FO9 B;  3DWA A;  1DCZ A;  1HQR D;  2PZT A;  1EU4 A;  1Q8I A;  2K05 A;  3FPP A;  1LTS D;  3PUX A;  3GTQ B;  1A3T A;  4ABN A;  2O5J C;  1T5X D;  2GA4 B;  1KAA A;  1VF7 A;  4OIK A;  4C3H B;  4GZY C;  1Z47 A;  4K5X A;  4FF2 A;  2F0L A;  5E4X A;  2EOT A;  3EA6 A;  4OO1 I;  2AUJ D;  5DNF A;  4L6T B;  1F9P A;  3OPO A;  3EVQ A;  1RKN A;  4EQP A;  1LAB A;  1EOT A;  2MJ8 A;  3TSS A;  3JAM L;  3GP7 A;  5A2Q E;  5C5L A;  4WFN 3;  3K0Y A;  4B08 A;  1ET9 A;  1HA6 A;  5KNC A;  2B2W C;  1Y1V B;  3P7J A;  1UUP A;  2R92 B;  4NMZ A;  3IFT A;  1GUO A;  2K01 A;  4HSP A;  4UAI A;  1MI2 A;  1O78 A;  3J7A F;  1I4H A;  3U9S A;  2IWH A;  5HGT A;  5J39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...