5HURA

Crystal structure of staphylococcal nuclease variant delta+phs l25t/i92k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKTMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25T/I92K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5hurA00
4N9PA 4KD3A 2LKVA 3SHLA 2PYKA 4K5WA 2O4XA 4S3SA 2F0EA 4WORA 5CR3A 1JOOA 5E3FA 1STBA 5F2DA 2HQEA 5C4HA 4EVOA 1KAAA 2KQ3A 4EQPA 4KTAA 2F0NA 1TT2A 4N9TA 4K2KA 3TP6A 4OL7A 2EXZA 4ZQ3A 5EKKA 2F0DA 4NMZA 4NDXA 4B9WA 2EY1A 4E6IA 4LAAA 1EY6A 5I6YA 1STAA 5KGUA 2F0QA 3BDLA 1NUCA 3E5SA 4ZUIA 4KJOA 4F7XA 2OXPA 4J1MA 2NUCA 1EQVA 1JORA 1KDCA 2F3WA 4IALA 4K5VA 1IHZA 2F0FA 2F0IA 2PZUA 2SOBA 3P1HA 5EGTA 1A3UA 3R3OA 3ERQA 5IOCA 1A2TA 2F0LA 4PMCA 3TP5A 1SYFA 4WRDA 2F3VA 3T16A 5IIFA 2EY6A 4K14A 3HEJA 1RKNA 1TR5A 3OWFA 4KY5A 4K5XA 5I6WA 1JOKA 5M9OA 2QDBA 2EYPA 3H6MA 1EY9A 4IUNA 4DGZA 4KY6A 5C3WA 4NKLA 4DU9A 5KIXA 5CV5A 2F0MA 1STHA 2OEOA 3QOLA 4ME5A 3VA5A 2KHSA 4NP5A 5J22A 3NQTA 1KABA 3D4WA 5CV7A 5IGBA 1SNDA 1EY5A 5CV6A 1A2UA 5JAVA 5KYLA 5C3XA 1EZ6A 3OSOA 3C1EA 2F0OA 4QMGA 2F0JA 5K5PA 2F0UA 1SNMA 2F0WA 4EQNA 3D4DA 1ENAA 5HURA 5I9OA 4J6HA 4K2LA 3NP8A 5J39A 1U9RA 2F0GA 3MZ5A 1SNCA 5CV4A 3D8GA 1ENCA 2F0VA 1SYGA 2EY5A 2EYMA 1EY4A 4YIJA 5KRUA 1F2MA 1F2YA 2PW5A 4RKBA 4DFAA 1EZ8A 2RBMA 1EY0A 5IGEA 1A3TA 1STNA 5CV9A 4ODGA 1NSNS 1EYAA 2F0HA 4G57A 4DF7A 4K8JA 3OMGA 3EVQA 3PMFA 5IGGA 1EYDA 2PQEA 5IODA 4ID6A 3MHBA 5ISRA 1A3VA 2ENBA 2PW7A 3NXWA 4QB4A 3C1FA 5C5LA 3SK5A 3V2TA 1JOQA 5I9PA 2F0KA 1F2ZA 3HZXA 5J1ZA 3SXHA 4I65A 1SYBA 2OF1A 2EYHA 2SNSA 3DHQA 4RKLA 2EYOA 4H7BA 4KJNA 3MXPA 4R8NA 2RDFA 4ZUJA 5KYIA 3TP7A 1SYDA 5C5MA 2EYLA 1SNOA 2F0PA 5DAUA 3SK4A 2EYFA 1KDAA 3BDCA 1SYCA 1SNQA 3NUCA 3P75A 5E1FA 5EKLA 3TP8A 5KEEA 5IGCA 3DMUA 1KDBA 4F8MA 2EYJA 5CV8A 3MVVA 3SK6A 5JOBA 1STYA 2PZWA 1EY7A 3EJIA 3OMCA 5C4ZA 5CGKA 3QB3A 3LX0A 2F0SA 3T13A 3EROA 3NHHA 2PZTA 3D6CA 3NK9A 4HTHA 1EYCA 4HMJA 4QF4A 5CC4A 5IGFA 4PMBA 1SNPA 2F0TA 4KY7A 3S9WA 5HGTA 5DEHA 4EQOA 2M00A 3QOJA 4KD4A 3TMEA 4IZ8A 1SYEA 3RUZA 4MIUA 5C6AA 4PNYA 2RKSA 4HMIA 4KHVA 1II3A 3ITPA 4K8IA 3MEHA 4TRDA 3SK8A 3SR1A 4K6DA 1AEXA 1EY8A 4KV6A 4B9XA 5IGDA 1STGA 1TQOA 2WACA 3U9OA 2SNMA 2EY2A 5NUCA
chains in the Genus database with same CATH superfamily
1YJNA 4XYQA 2LFNA 2OTLA 1E2VA 5F2DA 4C3IG 3ZJYC 1UE1A 2HQEA 3HOXG 1PH9A 3MXGA 1IL2A 2VUMB 1QNKA 1TWHH 2I0QA 2GN5A 1L1OA 1MJCA 1BBXC 1VQEA 4U673 2NZOA 3U4ZA 3W2DA 5ELCA 3K81C 2A6HD 3EN2A 1PRTB 1HR0Q 3KOJA 3E9HA 3OIQA 1B9MA 2F4VQ 3T4AC 5C0XG 2R6GA 3ERQA 3L7ZC 5IWAQ 1U4PA 1Q90A 1A0IA 2EY6A 1YJWA 1I5FA 5I6WA 2CHBD 4C3HG 2C35B 2I07B 3C2PA 2QGQA 3CAMA 4NXNL 4ME5A 1MGSA 3H91A 4GN4B 5DNFA 4DK0A 1PTOC 3BZKA 3I4NG 1IZ6A 4A3DB 4UP7A 4KMUC 2A69C 4AYBB 2JA5H 5CMDA 2LS01 3K80C 3E0JA 5CBEE 1F2MA 2VQEQ 4AQYQ 4FP5D 3KLRA 3KDFB 2RBMA 5ELEA 1NSNS 3NBHB 2VZAA 4X62L 2R7ZG 1R4QB 2Z6KC 3PMFA 2PQEA 4U68A 1VQGA 2WAQB 4OO1G 1V1QA 3OIPA 3ULPA 1JB3A 3AFQA 4ME3A 3T1HL 1IBLQ 2R93H 1K83B 3MXUA 2UXDQ 3OTOQ 2SEBD 1Q3LA 4XQNA 5KYIA 5T1IA 4DR6Q 5EPJA 2K52A 4OXPA 3BYTB 3TP8A 3ERSX 3LNNA 2WKCA 4DR5L 1KDBA 3NTHA 1L1OB 4JI6L 5LL6S 2VB3X 3CC4A 1I94L 2E8GA 1BBUA 2BDNA 5ELNA 2F0SA 2NVQB 3NHHA 2VL6A 4G7OC 1PTOD 1PRTF 2L9HA 2XN9C 2PPBC 3PF5A 1YNNC 2XWJB 1SYEA 1TWAH 3ICEA 3PUZA 5C4XH 1X3FA 1PA6A 3J7A5 1FD7D 4S3SA 5E4XA 2LSSA 1XPOA 3CP0A 1HNZQ 3S16H 2E5LL 4OONA 4JI1Q 1TT2A 4BBSB 4DK3C 2UU9Q 1H9RA 3CHBD 5EKKA 5M3FH 1SMYD 1FJGQ 1VQAA 2B8GA 2E2IB 4A3MB 3IAYA 1T5XD 1SLJA 4JC0A 1E2ZA 5IYBH 2RSOA 1FNUA 4A3KH 1VQ7A 4HJ5A 1PLFA 2LY7A 1CK1A 2F0LA 2QKIC 4O42A 3GTOB 2HIXA 4LF7L 4FYDA 1MKHA 5IY0A 4YWLA 3L0OA 4K5XA 3J81c 2I5LX 2DGYA 2Y0SB 4BXXG 1K73C 2B2YA 1CA5A 2Q8TA 3VA5A 3QO2A 4JW0A 1EY5A 1NTGA 2B2UA 4C3IB 3CQZB 3HS0C 2OWOA 2F0JA 3HOXB 1FGBD 1GUGA 5I2XA 4DV6Q 3GTMH 2WKDA 4DR2L 4X64Q 4DK6C 2EYMA 4HSPA 1S4ZA 4GN3B 5JJIA 3B6YA 4HCSA 4IQZA 1DOMA 1HR0L 2F0HA 2A74C 2FINB 3G71A 1S40A 1DOLA 3C1FA 4LF5Q 1JOQA 2QEJC 4JBKA 5IWAL 1ET9A 3D6WA 1C4QA 2NVTH 2B8FA 1ICFB 1ILQA 1LT4D 2OF1A 4C3HB 1EWCA 3MXPA 4PG3A 3K6OA 4P75A 1PFSA 2E75C 1VMCA 4ULLA 2IX1A 4DXFA 4FF3A 1MI2A 3S14H 1D5MC 1I4PA 1FNWA 3DM3A 1Y1WH 3I4NB 1LTBD 1PFNA 4TSSA 2AQ1B 5M5XH 3NK9A 1VQNA 1RTNA 2GVBA 2TSSA 3S1QB 3QOJA 2BA1A 1L1OC 3ER0A 5IGDA 2GVAA 1RCVD 4LF8Q 4DR3Q 4KD3A 1XMQL 4RGMA 3BZCA 1QVGA 2Q2TA 2R7ZB 4RWSC 5CR3A 4H0LC 1CZGA 4A3FG 3S17H 1KAAA 3TZDA 4IOCA 4R4TA 5JPMC 3TP6A 3H3VC 3R2TA 1V1PB 3M4PA 3J81j 5K36G 1DM0B 4H13C 2PI2A 1O7ZA 2F0QA 2WB1B 3K58A 2K75A 5FLMH 2EE1A 3GTLH 2BE5D 1CFMA 4IJLA 2NB0A 4LFCQ 4B3TL 1LTGD 2HIVA 1U4LA 1PVOA 2KA7A 2F3VA 4B3MQ 3HOUB 1EQTA 2K5NA 2VW9A 5CBAE 1IBML 3W1BA 1AZPA 3SDZA 3C3LA 2UXBQ 3H6MA 4CDEC 1TIID 1WI5A 1P8LA 4X65Q 1XX8A 2VY3A 3K5LA 1STHA 3S1NB 1G291 3O13A 4HJ8A 4DUZQ 1G6ZA 2N78A 1BNZA 1CKOA 1FR3A 1DXMA 3PIPA 3H15A 1CSPA 3DLLA 3LWEA 4HCEA 4MNOA 1MIUA 3NP8A 4EX5A 1QE6A 2IPKD 3STBC 2Y0SE 2VQFQ 1NR4A 2ICEC 2F0VA 5M5WH 1J5EL 4M8AA 4DF7A 4RG1A 3CCMA 1YHBA 5IYDH 3FVQA 4GKKL 1B2TA 4GLAC 4QB4A 2IX0A 3G4SA 4PZ8A 3VR2A 5IE8A 1HQRD 3R93A 4DPGA 2RDGA 3H0GH 4YWMA 4JI7Q 3TS2A 5GAHC 2AWOA 4X3UA 4GLXA 4H7BA 2Z8LA 3N6RA 1NJIC 4FVMA 2IX3A 1SNOA 5E4WC 3BDCA 4EQ5A 4BBRH 5IGCA 3MVVA 3F8TA 1PH8A 2YTVA 3VYSA 4QUCA 2JA5G 4JI3L 3D31A 4B3SL 4DAMA 4XYOA 2M00A 1SMXA 4KD4A 2RF4A 1ONLA 5FK9C 5G3LF 1II3A 3LWUA 4X64L 3AMUA 3STBD 2PNHA 5CV4A 4X3SA 1EL0A 5BR8L 3MWYW 2QW7A 1JB7A 4CBVA 3F2UA 2R92H 2A19A 1QZHA 1OXVA 3SGIA 2IY5B 4EQPA 2JQOA 3GV3A 2A68C 2R93G 1ZXTA 5IT9E 1B1ZA 3PUVA 3U58A 1SBBB 3KLWA 1ASZA 3IKJA 2CH4A 3E5SA 1KDCA 1HTPA 3GQBA 2B2YC 3EBEA 4RGTA 2F0IA 4L8JA 1HCZA 2SOBA 4TKOB 4IJHA 2Q8RE 1TWCH 4EGVA 1GKHA 3T16A 3HOZH 2B2UC 4K14A 2HUGA 1GUSA 1BCPD 2JE6I 3DWAA 4UAIA 1OXXK 5C4XG 4IUVA 4C2MB 1QUQA 4XIGS 1QILA 1SJHD 2KHSA 3D4WA 3GTKB 3F2DA 1HNXQ 3QR8A 2PMZE 4Y7NB 1ML0D 4QMGA 4A3FB 1D5ZC 1FYCA 1D1KA 2MQHA 1UWVA 5BN3A 1G6PA 4DV7Q 2D9UA 1WTWA 5M3FG 1IKLA 3DUZA 4FXGC 1ENCA 3KJOA 2JEAI 1RODA 3GP7A 3S1MH 2R7DA 5IYBG 1E2WA 3J80i 4G57A 3EA6A 2HT1A 4A3KG 3T53B 4P71A 4JI4Q 4KN7C 1DYQA 3K7AH 2MO1A 3S2HH 1N34Q 3PO2H 1GUNA 5JPNC 3RLOA 2X69A 1BVSA 3HZXA 1Q12A 4B3ML 1EIHA 4KLKA 4XT1B 2NN6I 5EKLA 1DZ1A 3P7JA 5KEEA 1AP0A 3P20A 1KRTA 1M4VA 2PZWA 2B2VA 2H4OA 2NVXH 2B29A 1HR0W 4IPGA 4JI5L 4QF4A 1EYCA 1UUPA 5IGFA 4PMBA 4P72A 3S9WA 1HXYD 2BA0A 2BOSA 4KK7A 3CCEA 2A6ED 2RKSA 1DGSA 5AJ3Q 2WACA 5DM63 5NUCA 4DUYQ 4DAYA 2PCFB 4GNXA 2O4XA 2RHSB 5C4HA 4IURA 1XNQL 2PQAA 1E7ZA 2B2WC 2K4KA 5KNCA 2KQ3A 4ZKBB 1SRUA 5EQ0A 1SJED 3AEVA 4N9TA 1IYUA 1S5FD 1X3QA 1QUQB 4OL7A 4RGNA 3H09A 5D3IB 1Y8OB 1Y14B 1VQMA 3RZDH 2RCNA 1Q81C 5T1GA 4K5VA 4HIMA 1HQMC 1Y1WG 4CJ0B 1T9HA 1TS5A 4ZYSA 5D14A 1YIJA 2JN4A 1OXTA 2WP8J 2JA5B 3NWSA 2HCCA 3H94A 4K0KL 3MFGA 3CMEA 5KNDA 2JYOA 1EQQA 3FRPB 2K1BA 3UDFA 3S1RH 1GD7A 1HH2P 3G7LA 4LJZC 2MNAA 2C9OA 4J15A 3KF8B 5C3EH 5EPLA 4LFAL 1A6XA 1I3QH 1SNMA 4RHSA 5FLXL 1KD1C 3I8ZA 4A3CH 3BVMA 1F2LA 1QJOA 1X3GA 1PH7A 1BQQT 3D8GA 1CM9A 1K9MC 5FLMG 2ZM6L 1BR9A 1X65A 2F3IA 1EY0A 3PUXA 1A8VA 4DV3Q 1XMOQ 1EUJA 4NXMQ 1N32Q 4P74A 4HN7A 1A3VA 2ENBA 2PW7A 4DR1L 3DEPA 1BKBA 1XNRQ 5J1ZA 2SNSA 2UUCL 5GROA 1GO3E 2G9DA 3T1YQ 5C4XB 3MTSA 1KXLA 2K32A 1ZYRD 4JVZA 3MFYA 5LMUQ 1HPCA 2NVYH 3NE5B 3K5NA 4WJ3M 1YJ9A 3S16B 1HRJA 3J81L 4POFA 5M3FB 1MSGA 4IPCA 4DV7L 4MIUA 2A6HC 2N88A 1SR3A 1W2BA 1UEAB 4KV6A 4IUTA 4ZAIA 4JPBW 5IYDG 1V9PA 4A3KB 4LF6Q 4GS3A 1S5CD 1SROA 3GTJB 4KTAA 2FMCA 1WOCA 4DR7Q 2ATWA 1RIPA 2EJMA 3H0GG 4OX9Q 3Q22A 2F0DA 4X66Q 3TREA 3W3AA 3M7GA 3GTPH 2A8VA 1STAA 4A93H 4P73A 4RA8A 3NTKA 3S15H 4C3JB 4J1MA 4BBRG 1VQKA 1H9JA 2KCMA 4RAUC 2CQOA 3FKIH 3A8IE 3VYUA 3R3OA 3A55A 4A3GH 3HGBA 1LM0A 1UE5A 4WRDA 5IIFA 3GTMB 3EQLC 3VR6A 4RCOA 2JA7H 1PTOF 1XXGA 3DEOA 3TDQA 3WOEA 3CMAA 3HG9A 2OEOA 4C1NK 2JA6H 2JP1A 3K0XA 3OW7A 5AJ3L 5CV6A 1G8ZD 2R92G 2NTTA 1B8AA 1EWIA 1ENAA 2V1CC 2NVTB 3I4OA 4RHRA 1DJRD 1YNXA 3AU7A 4BY1H 5JEAH 2UUAQ 4JI0Q 3A0JA 1C48A 1QNUA 3IRBA 3J81E 4KKUA 1LUZA 3S14B 5TSSA 5EJWA 2P5ZX 3NXWA 3HKZE 1EIGA 3HOZG 2DY7A 5M5XB 4GKJQ 4XDXA 3KLSX 1N9WA 3HKSA 3VR3A 1QVCA 1QG7A 1H9MA 2B2VC 1AFPA 4IO9A 5ELFA 4APVA 1CQFA 2E74C 4KJNA 3L3OC 1AE2A 4DV4Q 1U4RA 2XWBB 2G9HD 2FFKB 1IYVA 2Z4IA 2UXCQ 1SE3A 1LTRD 3VA7A 4DV1L 3S17B 2RQXA 1STYA 3ZYYX 3FHWA 4DV0Q 3J80E 1SMYC 5EBDA 3NELA 5KIXA 4IZ8A 5D65A 1OTCA 3SK8A 4YHHQ 4X6AH 1FL0A 3GTLB 1I4RA 2LKVA 1JJGA 2IWHA 1Y69U 3N52A 1SDFA 3PO2G 1I6VC 1WCMH 1YNJD 4ZQ3A 2WIIB 5EPKA 1J6QA 4PZ7A 4LAAA 1IYJB 5FLXc 3QG1A 1F9PA 5I6YA 1W3SA 4FDBA 4L5TA 3J7AF 1HUNA 3I3CA 4A76A 4L5QA 1MHWC 3T1YL 4K6LA 1CI3M 3FMCA 1JC7A 2HHHQ 3A56A 4Q5VA 3CPWA 2K28A 3CU7A 3HEJA 1PZKD 1RJTA 4ZRZA 1E3PA 4IUNA 5M5WB 1V8QA 1SE8A 4L63B 3HOVH 4A3BH 1JJCB 5IGBA 3M7NA 4UP9A 1CZWA 1WD1A 1Y1VH 4CKEA 1RF2D 4EQNA 5LMNQ 4AH6A 5HURA 5I9OA 3Q0AA 4YCWA 3BYYB 5BN4A 5IP7H 3F1ZA 5J39A 5JVG3 3H0GB 1RD9D 2J7ZA 1EWHA 1F2YA 4OX9L 3OOCA 2XRSD 3S24A 1TXYA 1WTXA 4BBRB 2UUBL 1KAWA 1M8AA 1S72A 5IGGA 1PZID 1BO0A 1RDPD 1ILPA 1JWUD 2CH4W 2EJFC 1F77A 3X3NA 3U50C 4KKTA 1IBKL 5C44H 4LUOA 1CQVA 3LGJA 4HR7B 3JAMc 1K3RA 3SE0A 3CCJA 1HFNA 1KDAA 4R8IA 1KLUD 3J7YW 5M5YH 1GHKA 4F8MA 5C3EG 3HFZB 1R4PB 2K5DA 3GDEA 4KI0A 1EEID 4A3CG 3KYHC 3EROA 1BOSA 1VQFA 5M3MH 2F4VL 1HNWQ 4AYBE 4J8QA 1KRSA 1TVXA 1D2BA 1B9NA 1TQOA 4N8FA 1BCPB 3SHLA 1J8IA 2BE5C 1TWCB 3RD4A 4CKBA 4A3LH 5JEAJ 3HOZB 4XT3B 1NCVA 2WAQE 3IFTA 2RCFA 4F88A 4JI8Q 4IUPA 5KGUA 3BDLA 4QGUA 1BBWA 3NBIA 2Z9HA 3PQIA 4ZUIA 1L2FA 4G4KA 4XTCS 1U0LA 3UI2A 4DXGA 2YTYA 2VB2X 2KJXA 5EGTA 4MZ9A 3M9BA 2PNRC 1A2TA 4ZCKA 4PMCA 4QQBX 2VQEL 4JBWA 4AQYL 4JV5Q 4G7ZC 4KHPQ 3VDYA 2KBNA 1X32A 5CV5A 3S1MB 1VQLA 1MSHA 4NP5A 3NQTA 1NBWA 1IBLL 4YHHL 1EZ6A 3K7AB 4JG2A 2KCCA 3OTOL 2ZTCA 2UXDL 3S2HB 4Y52H 1GM5A 1UAPA 4DR6L 3I72A 1BDOA 3HOWH 2MGSA 2C5CA 2KHIA 4LF4Q 2YU9H 4L5RC 2IT1A 3Q24A 4A93G 4YCUA 5FO9B 2E2JH 4YY3Q 1EYAA 4GOPA 3FKIG 4K8JA 2EXDA 4DV2Q 4DV5Q 2JK8A 1Z6HA 3V2TA 4A3GG 3PSIA 2NVXB 4JCVE 5A2QL 1IL8A 4OWWB 3URYA 2XVSA 2HHHL 3U4VA 2JA7G 2OQKA 2QEXA 3CD6A 5ELBA 1AW7A 3DHQA 1BCPF 1PYBA 2F4IA 2JA6G 4R1JA 1HNZL 2QA4A 4WJWA 4JI1L 4IFDI 4QIWB 2UU9L 1ZKOA 3NSWA 5IYCH 1TY0A 4KHZA 2XIWA 1FJGL 2L15A 2ZXRA 4TQUS 3KF6A 2N49A 1FGUA 4KY7A 1Y8NB 1LT6D 2CFMA 4BY1G 1Q8KA 4K8IA 5KRUA 5JEAG 3RZDB 3VR5A 4UDUC 1N36Q 2SNMA 5IOCA 3KLSA 4RFBA 1A62A 4LF9Q 1GJXA 1GOZA 1VQ8A 1O78A 5E7NA 4WJ4A 2KCTA 2E2IH 3PO3H 3FPPA 4XXEA 1I4HA 1BCPC 1JQYD 2EQSA 1NUCA 3TSSA 2WINB 2ZJRA 3IFDA 3K59A 1TWGH 3S1RB 3R2IA 4DV6L 1AH9A 1I4XA 3KBXA 5HGQA 2F0FA 2K50A 5C3EB 1WTVA 1A3UA 4OWTB 1I3QB 1G91A 4LWCA 1E22A 4O1NA 3TP5A 2L5TA 1JOKA 3HP3A 4NB3A 1EY9A 5C3WA 2G5DA 1PXUA 1EOVA 4LF5L 1IKMA 1BXTA 1HNWL 3CQZH 1EIYB 4JYAQ 3MXNA 3RLNA 3FP9A 2F0UA 1WCMG 2ASBA 2D2CC 2ES2A 3MZ5A 1NAPA 1Q8IA 5FKAC 2I5HA 1IW7C 3J81i 3A8KE 1WVLA 1VF7A 2HDLA 2EZVA 1YVCA 3UDGA 1TS3A 4YCVA 1R9TH 2ZJPA 2WB1E 2FMMA 4CDFC 1QVFA 2NVYB 1Y8PB 3KF6B 3MHBA 2K5WA 3SK5A 1AE3A 3HOYH 1I4QA 2MHVA 4B3RQ 4LF8L 4DR3L 1O7IA 1ASYA 1D7QA 2K6AA 5C0XI 1WTQA 2A6EC 1YITA 3GTGH 4BA2I 3HOVG 4A3BG 1QWYA 2WV6D 1E1OA 2O5IC 4H44C 5E1FA 1HZCA 2K7VA 1Y1VG 3AQQA 2IW3A 4X3TA 1NMFA 3QIAA 5J3BA 1M1KC 2Z1CA 1Q46A 4BY7H 1CKMA 3S1QH 4DR4Q 5GADC 5IP7G 2KVMA 1K0SA 2L12A 2NN6H 4P2CB 4HTHA 1PYSB 3A5ZB 4A3IH 3EIVA 4JOIA 4LFCL 3GTPB 4A93B 4KHVA 1WTOA 3C46A 3Q6SA 2D5DA 3NPPA 1GUOA 3PIP3 1IW7D 1LO5D 3S15B 1LTID 1B44D 4QIWE 4V0BA 2VNUD 1XPRA 2F0EA 4B08A 1JOOA 2UXBL 1DOKA 4EVOA 4A3GB 4ZLTF 4X65L 4A3JH 2HCIA 1ESFA 3KJPA 2OCEA 5C44G 2JA7B 3UDIA 4DUZL 4NMZA 1TWHB 4LUZA 4OO1I 3MXNB 1UE6A 1LTTD 1P16A 2D0PA 1RL2A 2JA6B 4OIJA 2K5VA 1VF5C 1JORA 1S5BD 1SFOH 1HJPA 2VQFL 3HOUH 2L4NA 1NE3A 4LUVA 3VYTA 4CJ2C 1Q1BA 1YEZA 3KFUA 1W6JA 4HAEA 5M3MG 3CCQA 5I2YA 1RKNA 3FDTA 2K5HA 1E0BA 2B63H 1X56A 2PI2E 1LYLA 2A5HA 4DGZA 2V4DA 4DU9A 1VQ9A 3PGZA 4H02A 2F0MA 4JK1C 2VUMG 5J22A 2JJQA 3EFXD 3BU2A 2ZTEA 4JI7L 2F0OA 4A3LG 4GOPC 3I2ZA 5GAEC 3G6EA 2KEDA 2LMCB 3E0EA 3RN5A 2WFWA 1SYGA 1TWFH 1B4OA 1SE2A 2PW5A 4RKBA 1L0YB 2R3ZA 5ELOA 3K57A 1ZYRC 2VS1A 1CT1D 4G7HC 2YV5A 4WFN3 5HY6A 4DN4M 4NXNQ 1PYWD 1I50H 1SN8A 3M4OH 1HHVA 1F2ZA 1PZJD 1Z7TA 2B39A 3SXHA 4UP8A 1PFMA 4TVAB 4RKLA 2AUKA 3TEHB 3UE1A 4QUFA 2R93B 2H5XA 2EYLA 5DAUA 2OT2A 2MUYA 2KHJA 2RDHA 3SEBA 2MFIA 5JOBA 4MTKA 2BDOA 4HIDA 1WTRA 2J4XA 1WCMB 3HOWG 3V05A 4X62Q 2JA8H 4A3EH 1HZ9A 3MA2B 3RR5A 5GAGC 4CDCC 3ULLA 1AEXA 2WAQG 3MEFA 3I4MH 3U9OA 1GVPA 3BS1A 3T1HQ 1TWAB 4DAYB 3OYYA 4GNXB 4WORA 2PQAB 4GZYC 2JXMB 1FNVA 3WDNA 2CCZA 1C7YA 3PUWA 2EXZA 4DR5Q 3M3YH 1HNXL 4JI6Q 3HOVB 4QY7A 4A3BB 1AN8A 4HSVA 4IALA 5IYCG 4JBMA 2A1AA 4PMWA 2XTIA 1SYFA 2Q2UA 4UPAA 1G2TA 4C2MH 1IXRA 4FXKC 2B3GA 2DJGC 2VXWA 1HTLD 3CW2C 3JAML 4JI4L 2E5LQ 4Y7NH 2BH2A 1TY2A 2AQ2B 1N34L 1EU3A 1NMGA 3PCOB 4C56C 1TKWB 5CV7A 3GTQH 2D62A 1STEA 1XPUA 1A2UA 4M1UB 5FLXE 5C3XA 1VQCA 1TS2A 2CVRA 1KLGD 4DNIA 2AMCB 5JJLA 1VS0A 2I5MX 1O7YA 2F0GA 3PO3G 3D3RA 1DD2A 4UY8C 1F9RA 1MBYA 1TS4A 4LF7Q 1EZ8A 1JICA 3W1GA 5M5YB 2YYZA 1LACA 3K5OA 4FF2A 2Y0SG 3RZOH 1WTHA 2DNCA 4A75A 3S2DH 1I6HH 3UDXA 2E2HH 1XTDA 3AYHB 1I4GA 2HDMA 1K8MA 4RCNA 5M3MB 3I55A 3RMHA 4DUYL 5KNBA 3NQIA 2KECA 4R8NA 1PDQA 4LFBQ 3TP7A 1W6KA 4ILWA 2L1BA 4OHJA 4JOIC 4FXDA 4DR2Q 1E1TA 3UE0A 3K0YA 4LK1C 2FJ2A 1PH3A 3EJIA 1RTOA 3JC66 3OHXC 1S5DD 1ESRA 3E9IA 5FOBB 1Y1WB 5CC4A 1SEBD 1YNJC 3MAQA 2DJFC 5DEHA 2K5QA 2NTSA 2EY2A 1KNEA 2O2LD 1UE7A 3JAME 2YTXA 1X3PA 3HOYG 3NENA 3M4QA 2F0NA 4OIKA 4BWGB 3FPUB 4IUQA 1PH4A 1PH5A 3TRZA 4B9WA 4E6IA 2BCOA 4GNXC 1WTPA 5FO8B 1JMCA 4F7XA 3I56A 2OXPA 2NUCA 1H9SA 3OWEB 4KN4C 4BY7G 2NN6G 4DV3L 3F2BA 3HOWB 3OW2A 4O0AA 1XMOL 1XMQQ 4NXML 1N32L 4A3IG 2YU9B 2QDBA 4X3KA 5C4JH 2TMPA 4KY6A 2E2JB 1SAPA 1Q82C 3CCLA 4PV1C 3NEMA 3D4RA 3QOLA 3AB9A 4DAVA 2HQLA 2K33A 3ND9A 1XNRL 1WFQA 4LW1A 3AFPA 3OSOA 1XYIA 1JT8A 1LTSD 4R4OA 4NW2A 1EEFD 4A3JG 2Z6BA 1U9RA 2WB1G 3IL8A 1U4MA 3RLFA 5GQOA 5LMUL 1PTOH 4B3TQ 1X9NA 1EY4A 2MO0A 2QILA 2FXQA 2F1MA 1IBMQ 1O7LA 3HOUG 1HUMA 5FJ8H 1ENFA 5IODA 3E6ZX 1T5EA 2ZTDA 5C5LA 2AQ3B 2A69D 4C1NI 2B63G 4QJFA 1PHJA 4LF6L 1TU2B 1L0XB 3SK4A 2CKZB 3CCUA 4DR7L 3DMUA 2NZHA 5CV8A 4X66L 1J5EQ 4RGOS 2JEBI 3CXCA 3LX0A 3PO3B 1K8GA 4GKKQ 1H9SB 1CA6A 1KNAA 2JA9A 3RUZA 4B9XA 4FO2A 2HD3A 1TWGB 1STGA 1X3EA 5C4ZA 3GTJH 2LXJA 4N9PA 4OWXB 3CCRA 3NTIA 2OTJA 1PRTC 2E2DC 2ZXPA 4MN3A 5IP9H 3D0FA 3OPOA 2L55A 4K2KA 4BS9A 2R92B 4HJ9A 4NPSA 1WD0A 1V1PA 1YNND 3GV6A 1YBYA 4C3JH 3J7AV 2CW0C 2KOLA 4JI3Q 3E3XA 1NY4A 4B3SQ 4LFBL 2F3WA 3A8JE 1CHQD 3DXJC 2R61A 3A54A 1OO9B 1AZQA 2VUMH 1YHQA 4GLVB 2SDFA 2UUAL 4JI0L 5BR8Q 4A3EG 2JA8G 1CUKA 4R4QA 4ABNA 2FHTA 3BG3A 3BVZA 4IPDA 4NKLA 3TQYA 3I4MG 3J80c 4GKJL 1R9TB 2KEEA 3PIOA 4MHEA 2RHQB 1SNDA 5KYLA 2K05A 2A73B 1EQRA 1VDZA 4IUUA 1VQJA 2Z0SA 1GHJA 3HOYB 1GUTA 1PRTD 4K2LA 1JWMD 4DV4L 4DNTB 1QZGA 2DUDA 3L9AX 4IPHA 2UXCL 1H9KA 4JI2Q 2Z4HA 3GTGB 1SXTA 2X6LA 5IGEA 1C0AA 1A3TA 5EBCA 4DV0L 2ALYB 2CW0D 1H95A 3OMGA 4ID6A 1N8RC 4BY7B 4IOAA 5BN5A 4A3DH 2F0KA 2RSNA 2RA4A 3MC0B 3NWTA 4A3IB 4I65A 1SYBA 3BVGA 2BH8A 3PO2B 2EYOA 2RDFA 1CHPD 1SYDA 2EVBA 1V1OA 2QCPX 2EYFA 1M90C 4PZ6A 3CC2A 1LLRD 1LTAD 4CKCA 2N55A 3G48A 1EY7A 3OMCA 3QB3A 4A3JB 1LV9A 1EFID 4HMJA 4IFDH 1GXDC 2K04A 1K83H 2L11A 2B2WA 2M9VA 2XRQD 5C6AA 4PNYA 5I9PA 2PMZB 4TRDA 4FF1A 1A63A 1EOTA 4K6DA 2IL8A 3T13A 2O5JC 4CHTB 1SFOB 2CWAA 3RNUA 1STBA 3BDOA 1E24A 1JR0D 1B7YB 2NVQH 1J9OA 1KL9A 2B63B 4DK1A 1WYDA 3GD7A 1B50A 2EY1A 4CDDC 3TZUA 4KKSA 4LNQA 1B3AA 5IT9L 1MJEA 3H3VH 4L6TB 5LMNL 4JI5Q 1PFBA 1HA6A 3T51B 1EQVA 5L37A 4OEMB 2KCNA 4N8X1 1OXUA 1LT3D 2J0TD 1A15A 1QCBD 4BBSH 3OWFA 1C8CA 1Q1EA 1S5ED 4CGYB 3H3VI 1XNQQ 1TWFB 1VQIA 1JE5A 1PH2A 4A3MH 2CWPA 3ND8A 1EYGA 5JAVA 1VQBA 3HRZC 1PH6A 3GTOH 1I50B 3M4OB 1S3OA 1SNCA 2K14A 2EY5A 3I90A 4RH6A 4L5SA 4DNRB 1STNA 5CV9A 2EPBA 4R9WA 4GOPB 3M4YA 5A2QE 3J7ZC 4K0KQ 5AFWA 4PQXA 3VYRA 1HFGA 1EYDA 2MJ8A 4C3IH 1K3BC 3PIO3 3HOXH 3PUYA 2JA8B 4A3EB 2EOTA 4LFAQ 4DKAC 4ZUJA 1YHAA 3CPFA 3I4MB 2XGTA 3I70A 3P75A 1SNQA 3HKZG 1N33Q 4JI8L 1KTKA 5C0XH 4OELB 3X3MA 2ZM6Q 2GA4B 3T56B 3CKIB 3D6CA 3CRLC 3M3YB 4DA2A 1K8OA 3QWNA 5CYUA 5I4DA 2Q2HA 4C3HH 3BJUA 1K28A 4DR1Q 3ITPA 3I91A 1L0WA 3F2CA 2QF7A 1EY8A 3JAMi 4JI2L 1EU4A 1HZBA 2EDGA 4JV5L 2AHOB 1VCIA 2PYKA 5FJ8G 4OGQC 5E3FA 2B2TA 2UUCQ 2Q2IA 3K7UC 4KHPL 5D3DA 4R4CA 3I4NH 3M85A 3KUPA 4POGA 2N8NA 4R4IA 2KUMA 1LT5D 4Q0FA 4RMFA 1O80A 2Q8IB 4JBJA 1JWSD 2AUJD 1Z47A 1SE4A 3GTQB 3DM1A 3TS0A 1OXSC 1IHZA 3A7LA 2ZJQA 3P1HA 4LF4L 2R7ZH 3VR4A 3R8BA 4IN3A 4OO1H 1FVIA 5H1SE 3FKIB 2A68D 4YY3L 1TR5A 5COYA 3QJYA 4KY5A 1B53A 5M9OA 1VQ4A 4CJ1B 2EYPA 4DV2L 1Z9FA 4DV5L 1B70B 2KENA 5JJKA 1XTCD 1VQPA 4IFDJ 3BZDB 3A5UA 5DLQE 3KF8A 4HIKA 5IP9G 1U5KA 3CC7A 3RZOB 5CORA 1F9SA 4QL5A 3S2DB 1I6HB 2E2HB 4J6HA 3ULJA 3CF5A 3I4LA 5G3LD 4C3JG 4YIJA 4DFAA 5FO7B 3TBIB 1CTMA 2ZXOA 4ODGA 3S1NH 5EKIA 4ALPA 1JCKB 3SVMA 4AIMA 2LXKA 4BA1I 4BY1B 3EVQA 1VQ6A 5ISRA 5JJZA 2F03A 4GN5A 3FEWX 1N36L 1EIFA 3Q23A 3TN2A 2ID0A 2EYHA 4LF9L 1ZEQX 2H1EA 3V96A 2RVLA 2Z6KA 2F0PA 3K8AA 3KBGA 1X6OA 1SYCA 1K0RA 3NUCA 3K5MA 1Q7YC 1JJ2A 2NYZD 4HJAA 1PV4A 2DNEA 2DY8A 3SK6A 5IT9c 1D6EC 1SSOA 3U9SA 1CKNA 2K03A 5CGKA 1KC8C 2EJGC 1XJVA 3RN2A 2PZTA 1DCZA 3DWPA 3WOFA 2ICIA 5LHY1 1G51A 1CSQA 4HMIA 2QDLA 4HEDA 3SR1A 3MEHA 3CCSA 4BXXH 3DWQA 1MD2D 2OQ0A 1X54A 1BF4A 1K8AC 1PH1A 4K5WA 1D5XC 2M2LA 1V43A 2D0OA 1JE4A 1VQHA 4A4IA 4A3DG 1HZAA 1F9QA 2IJ0A 4AYBG 2L0CA 1LABA 2NZ1D 1WJJA 5LL6X 4DAPA 2CQAA 3KK7A 1HA5A 1QOHA 3Q8DA 4XQJA 1BUVT 4DV1Q 4NDXA 5C4JB 2XNAC 2ZT9C 4O2DA 4JYAL 1EY6A 2R7FA 4ZK9B 1UNSA 4KJOA 2AWNA 3HKZB 1G2SA 1VQ5A 4HIOA 1GUWA 1UEBA 2PZUA 4Z9CB 2NBFA 1N33L 2MP1A 2JSOA 1DONA 4IFDG 4FNFA 3CRKC 4FF4A 2E76C 1PTOB 1D8LA 1X55A 3ONAB 5C0XJ 4UHVA 3L2PA 1YZ6A 3A7AB 5ELDA 1RHPA 4F87A 3CCVA 1LTLA 1NR2A 3W5OA 4B3RL 1KABA 4LMQD 1I94Q 4I7AA 2N3SA 5DM73 3C1EA 5LMNW 5K5PA 2F0WA 3D4DA 3I73A 1KQSA 4YWKA 1Y1VB 3G6JB 1XWEA 2DN8A 2IHEA 2AKWB 2PO4A 4I7ZC 4QCLA 1CKNB 1QB5D 4DR4L 2XSCA 4ZKCB 4HJ7A 1Q86C 1VQOA 3GTKH 1KHIA 1B3QA 1YI2A 1ICWA 1KIXA 2X6GA 4XQQA 4A3FH 1VMPA 4BBSG 5K36H 2I46A 1VQDA 2NWGA 1ET6A 1D1IA 4A3MG 5C44B 5C5MA 3PF4A 1EFWA 2MPMA 2IHFA 2EYJA 5EAYA 3KDFA 2K01A 3A74A 4MTNA 1NNXA 5JVH3 3NBHA 4V190 2B2TC 2UUBQ 3I7FA 1SNPA 2EIFA 2F0TA 3WWVA 5HGTA 4EQOA 3TMEA 1PMRA 3PV0A 3GO5A 3J80L 1C9OA 5A35A 2F52A 1IBKQ
chains in the Genus database with same CATH topology
4XYQA 2LFNA 1E2VA 5F2DA 4C3IG 2HQEA 3MXGA 2VUMB 1QNKA 1BBXC 4U673 3W2DA 5ELCA 2A6HD 1PRTB 3OIQA 1B9MA 3T4AC 5C0XG 2R6GA 3ERQA 3L7ZC 1U4PA 1Q90A 2EY6A 5I6WA 2CHBD 4C3HG 2I07B 3C2PA 4ME5A 1MGSA 3H91A 5DNFA 4DK0A 1PTOC 4A3DB 4KMUC 2A69C 4AYBB 5CMDA 2LS01 3E0JA 5CBEE 1F2MA 4FP5D 3KLRA 2RBMA 5ELEA 1NSNS 1R4QB 3PMFA 2PQEA 4U68A 2WAQB 4OO1G 3OIPA 1JB3A 1K83B 3MXUA 2SEBD 1Q3LA 4XQNA 5KYIA 5T1IA 5EPJA 3BYTB 3TP8A 3LNNA 2WKCA 1KDBA 3NTHA 5LL6S 2VB3X 2BDNA 2F0SA 2NVQB 3NHHA 4G7OC 1PTOD 1PRTF 2L9HA 2XN9C 2PPBC 1YNNC 2XWJB 1SYEA 3PUZA 1FD7D 4S3SA 5E4XA 1TT2A 4BBSB 1H9RA 3CHBD 5EKKA 1SMYD 2B8GA 2E2IB 4A3MB 3IAYA 1T5XD 1E2ZA 2RSOA 1FNUA 1PLFA 2LY7A 1CK1A 2F0LA 2QKIC 4O42A 3GTOB 4FYDA 4K5XA 2Y0SB 2B2YA 1CA5A 2Q8TA 3VA5A 3QO2A 1EY5A 2B2UA 4C3IB 3CQZB 3HS0C 2F0JA 3HOXB 1FGBD 1GUGA 5I2XA 2WKDA 2EYMA 4HSPA 1S4ZA 4HCSA 4IQZA 1DOMA 2F0HA 2A74C 2FINB 1DOLA 3C1FA 1JOQA 2QEJC 1ET9A 3D6WA 1C4QA 2B8FA 1ILQA 1LT4D 2OF1A 4C3HB 1EWCA 3MXPA 3K6OA 2E75C 1VMCA 4ULLA 2IX1A 4DXFA 4FF3A 1MI2A 1D5MC 1I4PA 1FNWA 3I4NB 1LTBD 1PFNA 4TSSA 2AQ1B 3NK9A 1RTNA 2TSSA 3S1QB 3QOJA 2BA1A 5IGDA 1RCVD 4KD3A 2R7ZB 4RGMA 4RWSC 5CR3A 4H0LC 1CZGA 1KAAA 3TZDA 5JPMC 3TP6A 3H3VC 3R2TA 1V1PB 5K36G 1DM0B 4H13C 1O7ZA 2F0QA 2WB1B 3K58A 2EE1A 2BE5D 1CFMA 2NB0A 1LTGD 1U4LA 2KA7A 2F3VA 3HOUB 1EQTA 5CBAE 1AZPA 3SDZA 3C3LA 3H6MA 1TIID 3K5LA 1XX8A 1STHA 3S1NB 1G291 3O13A 1G6ZA 1BNZA 1FR3A 1DXMA 3LWEA 4HCEA 3NP8A 1QE6A 2IPKD 1NR4A 2ICEC 2F0VA 4M8AA 4DF7A 3FVQA 1B2TA 4QB4A 2IX0A 3VR2A 1HQRD 3R93A 2RDGA 2AWOA 4X3UA 4H7BA 2Z8LA 3N6RA 4FVMA 2IX3A 1SNOA 5E4WC 3BDCA 5IGCA 3MVVA 3VYSA 4QUCA 3D31A 4XYOA 2M00A 4KD4A 1ONLA 5FK9C 5G3LF 1II3A 3LWUA 3AMUA 5CV4A 4X3SA 1EL0A 3MWYW 4CBVA 3F2UA 1OXVA 4EQPA 3GV3A 2A68C 1ZXTA 5IT9E 1B1ZA 3PUVA 1SBBB 3IKJA 3E5SA 1KDCA 1HTPA 3GQBA 2B2YC 4RGTA 2F0IA 4L8JA 1HCZA 2SOBA 4TKOB 2Q8RE 4EGVA 3T16A 2B2UC 4K14A 2HUGA 1GUSA 1BCPD 2JE6I 3DWAA 4UAIA 1OXXK 4IUVA 4C2MB 4XIGS 1QILA 1SJHD 2KHSA 3D4WA 3GTKB 4Y7NB 1ML0D 4QMGA 4A3FB 1D5ZC 1FYCA 1D1KA 5BN3A 2D9UA 1WTWA 1IKLA 3DUZA 4FXGC 1ENCA 2JEAI 1RODA 3GP7A 1E2WA 4G57A 3EA6A 3T53B 4KN7C 1DYQA 1GUNA 5JPNC 2X69A 3HZXA 1Q12A 1EIHA 4XT1B 2NN6I 5EKLA 1DZ1A 3P7JA 5KEEA 1AP0A 3P20A 1M4VA 2PZWA 2B2VA 2H4OA 4QF4A 1EYCA 1UUPA 5IGFA 4PMBA 3S9WA 1HXYD 2BA0A 2BOSA 4KK7A 2A6ED 2RKSA 2WACA 5DM63 5NUCA 4DAYA 2PCFB 2O4XA 5C4HA 4IURA 2B2WC 5KNCA 2KQ3A 4ZKBB 5EQ0A 1SJED 4N9TA 1IYUA 1S5FD 1X3QA 4OL7A 4RGNA 3H09A 5D3IB 1Y8OB 5T1GA 4K5VA 1HQMC 4CJ0B 1TS5A 4ZYSA 5D14A 1OXTA 2WP8J 2JA5B 3NWSA 2HCCA 3H94A 3MFGA 5KNDA 2JYOA 3FRPB 2K1BA 3G7LA 4LJZC 2C9OA 5EPLA 1A6XA 1SNMA 4RHSA 5FLXL 3I8ZA 3BVMA 1F2LA 1QJOA 1BQQT 3D8GA 1CM9A 1BR9A 3PUXA 1EY0A 4HN7A 1A3VA 2ENBA 2PW7A 3DEPA 5J1ZA 2SNSA 2G9DA 5C4XB 3MTSA 2K32A 1ZYRD 3MFYA 1HPCA 3NE5B 3K5NA 3S16B 1HRJA 3J81L 5M3FB 1MSGA 4MIUA 2A6HC 2N88A 1UEAB 4KV6A 4IUTA 4ZAIA 4A3KB 1S5CD 3GTJB 4KTAA 2FMCA 2EJMA 3Q22A 2F0DA 3W3AA 3M7GA 1STAA 4RA8A 3NTKA 4C3JB 4J1MA 1H9JA 4RAUC 3A8IE 3VYUA 3R3OA 3A55A 3HGBA 4WRDA 5IIFA 3GTMB 3EQLC 3VR6A 4RCOA 1PTOF 1XXGA 3DEOA 3TDQA 3WOEA 3HG9A 2OEOA 4C1NK 2JP1A 3OW7A 5CV6A 1G8ZD 2NTTA 1ENAA 2NVTB 4RHRA 1DJRD 3AU7A 5JEAH 1C48A 1QNUA 3J81E 4KKUA 3S14B 5TSSA 5EJWA 3NXWA 1EIGA 2DY7A 5M5XB 4XDXA 3KLSX 3VR3A 1QG7A 1H9MA 2B2VC 1AFPA 5ELFA 1CQFA 2E74C 4KJNA 3L3OC 1U4RA 2XWBB 2G9HD 2FFKB 1IYVA 2Z4IA 1SE3A 1LTRD 3VA7A 3S17B 2RQXA 1STYA 3ZYYX 3J80E 1SMYC 5EBDA 5KIXA 4IZ8A 5D65A 3SK8A 3GTLB 1I4RA 2LKVA 2IWHA 1Y69U 3N52A 1SDFA 1I6VC 1YNJD 4ZQ3A 2WIIB 5EPKA 4LAAA 3QG1A 1F9PA 5I6YA 3J7AF 1HUNA 3I3CA 4K6LA 1CI3M 3FMCA 1JC7A 3A56A 4Q5VA 2K28A 3CU7A 3HEJA 1PZKD 1RJTA 4ZRZA 4IUNA 5M5WB 1V8QA 4L63B 5IGBA 3M7NA 1CZWA 1WD1A 4CKEA 1RF2D 4EQNA 5HURA 5I9OA 3Q0AA 5BN4A 3BYYB 5J39A 5JVG3 3H0GB 1RD9D 2J7ZA 1EWHA 1F2YA 3OOCA 2XRSD 1WTXA 4BBRB 1M8AA 5IGGA 1PZID 1BO0A 1RDPD 1ILPA 1JWUD 2EJFC 1F77A 3X3NA 4KKTA 1CQVA 4HR7B 3SE0A 1HFNA 1KDAA 4R8IA 1KLUD 3J7YW 1GHKA 4F8MA 1R4PB 2K5DA 4KI0A 1EEID 3EROA 1BOSA 4J8QA 1TVXA 1D2BA 1B9NA 1TQOA 1BCPB 3SHLA 1J8IA 2BE5C 1TWCB 3RD4A 4CKBA 5JEAJ 3HOZB 4XT3B 1NCVA 3IFTA 4F88A 4IUPA 5KGUA 3BDLA 3NBIA 4ZUIA 4G4KA 4XTCS 3UI2A 4DXGA 2VB2X 2KJXA 5EGTA 2PNRC 1A2TA 4PMCA 4JBWA 4G7ZC 1X32A 5CV5A 3S1MB 1MSHA 4NP5A 3NQTA 1EZ6A 3K7AB 2KCCA 3S2HB 1UAPA 3I72A 1BDOA 2MGSA 2C5CA 2IT1A 3Q24A 5FO9B 1EYAA 4K8JA 1Z6HA 3V2TA 2NVXB 5A2QL 1IL8A 3URYA 2XVSA 5ELBA 1AW7A 3DHQA 1BCPF 2F4IA 4WJWA 4IFDI 4QIWB 1ZKOA 3NSWA 1TY0A 4KHZA 2XIWA 2ZXRA 4TQUS 4KY7A 1Y8NB 1LT6D 4K8IA 5KRUA 5JEAG 3RZDB 3VR5A 4UDUC 2SNMA 5IOCA 3KLSA 4RFBA 1GJXA 1GOZA 1O78A 3FPPA 4XXEA 1I4HA 1BCPC 1JQYD 1NUCA 3TSSA 2WINB 3S1RB 3IFDA 3K59A 3R2IA 1I4XA 3KBXA 2F0FA 5C3EB 1WTVA 1A3UA 1G91A 1I3QB 4O1NA 3TP5A 2L5TA 1JOKA 3HP3A 1EY9A 5C3WA 1PXUA 1IKMA 1BXTA 3MXNA 2F0UA 2D2CC 3MZ5A 1NAPA 1Q8IA 5FKAC 1IW7C 3A8KE 1WVLA 1VF7A 2HDLA 2EZVA 1TS3A 2FMMA 2NVYB 1Y8PB 3MHBA 2K5WA 3SK5A 1I4QA 2MHVA 2K6AA 5C0XI 1WTQA 2A6EC 4BA2I 1QWYA 2WV6D 2O5IC 4H44C 5E1FA 2K7VA 2IW3A 4X3TA 3QIAA 2Z1CA 2KVMA 2L12A 2NN6H 4P2CB 4HTHA 3GTPB 4A93B 4KHVA 1WTOA 3C46A 2D5DA 3Q6SA 3NPPA 1GUOA 3PIP3 1IW7D 1LO5D 3S15B 1LTID 1B44D 4V0BA 2VNUD 2F0EA 4B08A 1JOOA 1DOKA 4EVOA 4A3GB 4ZLTF 2HCIA 1ESFA 2JA7B 4NMZA 1TWHB 4OO1I 1LTTD 2JA6B 4OIJA 1VF5C 1JORA 1S5BD 2L4NA 3VYTA 4CJ2C 1Q1BA 1W6JA 4HAEA 5I2YA 1RKNA 3FDTA 1E0BA 2A5HA 4DGZA 2V4DA 4DU9A 2F0MA 4JK1C 5J22A 3EFXD 2F0OA 2KEDA 2LMCB 1SYGA 1B4OA 1SE2A 2PW5A 4RKBA 1L0YB 2R3ZA 3K57A 1ZYRC 1CT1D 4G7HC 4WFN3 4DN4M 1PYWD 1HHVA 1F2ZA 1PZJD 1Z7TA 2B39A 3SXHA 1PFMA 4RKLA 2AUKA 4QUFA 2R93B 2EYLA 5DAUA 2OT2A 2MUYA 2RDHA 3SEBA 5JOBA 2BDOA 1WTRA 2J4XA 1WCMB 3V05A 3MA2B 1AEXA 3U9OA 3BS1A 1TWAB 4WORA 4GZYC 2JXMB 1FNVA 3WDNA 3PUWA 2EXZA 3HOVB 4A3BB 1AN8A 4HSVA 4IALA 4PMWA 1SYFA 1G2TA 4FXKC 2VXWA 1HTLD 3JAML 1TY2A 2AQ2B 1EU3A 4C56C 1TKWB 5CV7A 2D62A 1STEA 1A2UA 4M1UB 5FLXE 5C3XA 2CVRA 1TS2A 1KLGD 1O7YA 2F0GA 3D3RA 1DD2A 1F9RA 1MBYA 1TS4A 1EZ8A 1JICA 5M5YB 2YYZA 1LACA 3K5OA 4FF2A 2DNCA 1I4GA 2HDMA 1K8MA 4RCNA 5M3MB 3RMHA 5KNBA 3NQIA 2KECA 4R8NA 1PDQA 3TP7A 1W6KA 4ILWA 2L1BA 4OHJA 4FXDA 3K0YA 4LK1C 2FJ2A 3EJIA 1RTOA 3OHXC 1S5DD 1ESRA 5FOBB 1Y1WB 5CC4A 1SEBD 1YNJC 3MAQA 5DEHA 2K5QA 2NTSA 2EY2A 1KNEA 2O2LD 3JAME 1X3PA 4OIKA 4BWGB 2F0NA 3FPUB 4IUQA 4B9WA 4E6IA 2BCOA 1WTPA 5FO8B 4F7XA 2OXPA 2NUCA 1H9SA 3OWEB 4KN4C 2NN6G 3HOWB 2YU9B 2QDBA 4X3KA 2TMPA 4KY6A 2E2JB 1SAPA 4PV1C 3D4RA 3QOLA 3AB9A 4DAVA 2K33A 3ND9A 1XYIA 3OSOA 1LTSD 4NW2A 1EEFD 1U9RA 3IL8A 1U4MA 3RLFA 1PTOH 1EY4A 2QILA 2F1MA 1O7LA 1HUMA 1ENFA 5IODA 3E6ZX 1T5EA 5C5LA 2AQ3B 2A69D 4C1NI 1TU2B 1L0XB 3SK4A 3DMUA 5CV8A 4RGOS 2JEBI 3LX0A 3PO3B 1H9SB 1CA6A 1KNAA 3RUZA 4B9XA 4FO2A 1TWGB 1STGA 5C4ZA 4N9PA 3NTIA 1PRTC 2E2DC 2ZXPA 4MN3A 3OPOA 2L55A 4K2KA 4BS9A 2R92B 1WD0A 1V1PA 1YNND 3GV6A 3J7AV 2CW0C 2KOLA 2F3WA 3A8JE 1CHQD 3DXJC 2R61A 3A54A 1OO9B 1AZQA 2SDFA 4ABNA 2FHTA 3BG3A 3BVZA 4NKLA 1R9TB 2KEEA 4MHEA 5KYLA 1SNDA 2K05A 2A73B 1VDZA 4IUUA 1GHJA 3HOYB 1GUTA 1PRTD 4K2LA 1JWMD 4DNTB 3L9AX 1H9KA 2Z4HA 3GTGB 1SXTA 2X6LA 5IGEA 1A3TA 5EBCA 2CW0D 3OMGA 4ID6A 4BY7B 5BN5A 2F0KA 2RSNA 2RA4A 3MC0B 3NWTA 4A3IB 4I65A 1SYBA 3BVGA 3PO2B 2EYOA 2RDFA 1CHPD 1SYDA 2EVBA 1V1OA 2QCPX 2EYFA 1LLRD 1LTAD 4CKCA 2N55A 1EY7A 3OMCA 3QB3A 4A3JB 1LV9A 1EFID 4HMJA 4IFDH 1GXDC 2K04A 2L11A 2M9VA 2B2WA 5C6AA 2XRQD 4PNYA 5I9PA 2PMZB 4TRDA 4FF1A 1EOTA 4K6DA 2IL8A 3T13A 2O5JC 4CHTB 1SFOB 1STBA 3BDOA 1JR0D 1J9OA 2B63B 4DK1A 3GD7A 1B50A 2EY1A 3TZUA 4KKSA 1B3AA 5IT9L 4L6TB 1PFBA 1HA6A 3T51B 1EQVA 2KCNA 1OXUA 1LT3D 2J0TD 1A15A 1QCBD 3OWFA 1C8CA 1Q1EA 1S5ED 4CGYB 1TWFB 3ND8A 5JAVA 3HRZC 1I50B 3M4OB 1SNCA 2EY5A 3I90A 4RH6A 4DNRB 1STNA 5CV9A 2EPBA 4R9WA 3M4YA 5A2QE 5AFWA 4PQXA 3VYRA 1HFGA 1EYDA 2MJ8A 3PIO3 3PUYA 2JA8B 4A3EB 2EOTA 4ZUJA 3I4MB 3I70A 3P75A 1SNQA 1KTKA 5C0XH 3X3MA 2GA4B 3T56B 3CKIB 3D6CA 3CRLC 3M3YB 4DA2A 1K8OA 3QWNA 5CYUA 5I4DA 3ITPA 3I91A 2QF7A 1EY8A 1EU4A 2EDGA 1VCIA 2PYKA 4OGQC 5E3FA 2B2TA 5D3DA 3M85A 3KUPA 2KUMA 1LT5D 4Q0FA 1O80A 2Q8IB 1JWSD 2AUJD 1Z47A 1SE4A 3GTQB 3DM1A 1OXSC 1IHZA 3A7LA 3P1HA 3VR4A 3R8BA 4IN3A 4OO1H 3FKIB 2A68D 1TR5A 5COYA 3QJYA 4KY5A 1B53A 5M9OA 4CJ1B 2EYPA 1XTCD 4IFDJ 3BZDB 3KF8A 3RZOB 5CORA 1F9SA 3S2DB 1I6HB 2E2HB 4J6HA 3I4LA 5G3LD 4C3JG 4YIJA 4DFAA 5FO7B 3TBIB 1CTMA 2ZXOA 4ODGA 5EKIA 1JCKB 3SVMA 4BA1I 4BY1B 3EVQA 5ISRA 5JJZA 2F03A 3FEWX 3Q23A 3TN2A 2ID0A 2EYHA 1ZEQX 2H1EA 3V96A 2RVLA 2F0PA 3KBGA 1SYCA 3NUCA 3K5MA 2NYZD 2DNEA 2DY8A 3SK6A 1SSOA 1D6EC 3U9SA 2K03A 5CGKA 2EJGC 2PZTA 1DCZA 3DWPA 3WOFA 2ICIA 5LHY1 4HMIA 4HEDA 3SR1A 3MEHA 3DWQA 1MD2D 1BF4A 4K5WA 1D5XC 2M2LA 1V43A 1JE4A 1F9QA 2IJ0A 2L0CA 1LABA 2NZ1D 5LL6X 4DAPA 2CQAA 3KK7A 1HA5A 1QOHA 4XQJA 1BUVT 4NDXA 5C4JB 2XNAC 2ZT9C 1EY6A 4ZK9B 1UNSA 4KJOA 2AWNA 3HKZB 1G2SA 1GUWA 2PZUA 4Z9CB 2NBFA 2MP1A 2JSOA 1DONA 4IFDG 4FNFA 3CRKC 4FF4A 2E76C 1PTOB 3ONAB 5C0XJ 3A7AB 5ELDA 4F87A 1RHPA 1NR2A 1KABA 4LMQD 5DM73 3C1EA 5K5PA 2F0WA 3D4DA 3I73A 1Y1VB 3G6JB 1XWEA 2DN8A 2PO4A 4I7ZC 4QCLA 1QB5D 2XSCA 4ZKCB 1ICWA 2X6GA 4XQQA 1VMPA 5K36H 2I46A 2NWGA 1ET6A 1D1IA 5C44B 5C5MA 2MPMA 2EYJA 2K01A 5JVH3 3NBHA 4V190 2B2TC 1SNPA 2F0TA 5HGTA 4EQOA 3TMEA 1PMRA 3PV0A 3GO5A 3J80L 5A35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N9P A;  4KD3 A;  2LKV A;  3SHL A;  2PYK A;  4K5W A;  2O4X A;  4S3S A;  2F0E A;  4WOR A;  5CR3 A;  1JOO A;  5E3F A;  1STB A;  5F2D A;  2HQE A;  5C4H A;  4EVO A;  1KAA A;  2KQ3 A;  4EQP A;  4KTA A;  2F0N A;  1TT2 A;  4N9T A;  4K2K A;  3TP6 A;  4OL7 A;  2EXZ A;  4ZQ3 A;  5EKK A;  2F0D A;  4NMZ A;  4NDX A;  4B9W A;  2EY1 A;  4E6I A;  4LAA A;  1EY6 A;  5I6Y A;  1STA A;  5KGU A;  2F0Q A;  3BDL A;  1NUC A;  3E5S A;  4ZUI A;  4KJO A;  4F7X A;  2OXP A;  4J1M A;  2NUC A;  1EQV A;  1JOR A;  1KDC A;  2F3W A;  4IAL A;  4K5V A;  1IHZ A;  2F0F A;  2F0I A;  2PZU A;  2SOB A;  3P1H A;  5EGT A;  1A3U A;  3R3O A;  3ERQ A;  5IOC A;  1A2T A;  2F0L A;  4PMC A;  3TP5 A;  1SYF A;  4WRD A;  2F3V A;  3T16 A;  5IIF A;  2EY6 A;  4K14 A;  3HEJ A;  1RKN A;  1TR5 A;  3OWF A;  4KY5 A;  4K5X A;  5I6W A;  1JOK A;  5M9O A;  2QDB A;  2EYP A;  3H6M A;  1EY9 A;  4IUN A;  4DGZ A;  4KY6 A;  5C3W A;  4NKL A;  4DU9 A;  5KIX A;  5CV5 A;  2F0M A;  1STH A;  2OEO A;  3QOL A;  4ME5 A;  3VA5 A;  2KHS A;  4NP5 A;  5J22 A;  3NQT A;  1KAB A;  3D4W A;  5CV7 A;  5IGB A;  1SND A;  1EY5 A;  5CV6 A;  1A2U A;  5JAV A;  5KYL A;  5C3X A;  1EZ6 A;  3OSO A;  3C1E A;  2F0O A;  4QMG A;  2F0J A;  5K5P A;  2F0U A;  1SNM A;  2F0W A;  4EQN A;  3D4D A;  1ENA A;  5HUR A;  5I9O A;  4J6H A;  4K2L A;  3NP8 A;  5J39 A;  1U9R A;  2F0G A;  3MZ5 A;  1SNC A;  5CV4 A;  3D8G A;  1ENC A;  2F0V A;  1SYG A;  2EY5 A;  2EYM A;  1EY4 A;  4YIJ A;  5KRU A;  1F2M A;  1F2Y A;  2PW5 A;  4RKB A;  4DFA A;  1EZ8 A;  2RBM A;  1EY0 A;  5IGE A;  1A3T A;  1STN A;  5CV9 A;  4ODG A;  1NSN S;  1EYA A;  2F0H A;  4G57 A;  4DF7 A;  4K8J A;  3OMG A;  3EVQ A;  3PMF A;  5IGG A;  1EYD A;  2PQE A;  5IOD A;  4ID6 A;  3MHB A;  5ISR A;  1A3V A;  2ENB A;  2PW7 A;  3NXW A;  4QB4 A;  3C1F A;  5C5L A;  3SK5 A;  3V2T A;  1JOQ A;  5I9P A;  2F0K A;  1F2Z A;  3HZX A;  5J1Z A;  3SXH A;  4I65 A;  1SYB A;  2OF1 A;  2EYH A;  2SNS A;  3DHQ A;  4RKL A;  2EYO A;  4H7B A;  4KJN A;  3MXP A;  4R8N A;  2RDF A;  4ZUJ A;  5KYI A;  3TP7 A;  1SYD A;  5C5M A;  2EYL A;  1SNO A;  2F0P A;  5DAU A;  3SK4 A;  2EYF A;  1KDA A;  3BDC A;  1SYC A;  1SNQ A;  3NUC A;  3P75 A;  5E1F A;  5EKL A;  3TP8 A;  5KEE A;  5IGC A;  3DMU A;  1KDB A;  4F8M A;  2EYJ A;  5CV8 A;  3MVV A;  3SK6 A;  5JOB A;  1STY A;  2PZW A;  1EY7 A;  3EJI A;  3OMC A;  5C4Z A;  5CGK A;  3QB3 A;  3LX0 A;  2F0S A;  3T13 A;  3ERO A;  3NHH A;  2PZT A;  3D6C A;  3NK9 A;  4HTH A;  1EYC A;  4HMJ A;  4QF4 A;  5CC4 A;  5IGF A;  4PMB A;  1SNP A;  2F0T A;  4KY7 A;  3S9W A;  5HGT A;  5DEH A;  4EQO A;  2M00 A;  3QOJ A;  4KD4 A;  3TME A;  4IZ8 A;  1SYE A;  3RUZ A;  4MIU A;  5C6A A;  4PNY A;  2RKS A;  4HMI A;  4KHV A;  1II3 A;  3ITP A;  4K8I A;  3MEH A;  4TRD A;  3SK8 A;  3SR1 A;  4K6D A;  1AEX A;  1EY8 A;  4KV6 A;  4B9X A;  5IGD A;  1STG A;  1TQO A;  2WAC A;  3U9O A;  2SNM A;  2EY2 A;  5NUC A; 
#chains in the Genus database with same CATH topology
 1YJN A;  4XYQ A;  2LFN A;  2OTL A;  1E2V A;  5F2D A;  4C3I G;  3ZJY C;  1UE1 A;  2HQE A;  3HOX G;  1PH9 A;  3MXG A;  1IL2 A;  2VUM B;  1QNK A;  1TWH H;  2I0Q A;  2GN5 A;  1L1O A;  1MJC A;  1BBX C;  1VQE A;  4U67 3;  2NZO A;  3U4Z A;  3W2D A;  5ELC A;  3K81 C;  2A6H D;  3EN2 A;  1PRT B;  1HR0 Q;  3KOJ A;  3E9H A;  3OIQ A;  1B9M A;  2F4V Q;  3T4A C;  5C0X G;  2R6G A;  3ERQ A;  3L7Z C;  5IWA Q;  1U4P A;  1Q90 A;  1A0I A;  2EY6 A;  1YJW A;  1I5F A;  5I6W A;  2CHB D;  4C3H G;  2C35 B;  2I07 B;  3C2P A;  2QGQ A;  3CAM A;  4NXN L;  4ME5 A;  1MGS A;  3H91 A;  4GN4 B;  5DNF A;  4DK0 A;  1PTO C;  3BZK A;  3I4N G;  1IZ6 A;  4A3D B;  4UP7 A;  4KMU C;  2A69 C;  4AYB B;  2JA5 H;  5CMD A;  2LS0 1;  3K80 C;  3E0J A;  5CBE E;  1F2M A;  2VQE Q;  4AQY Q;  4FP5 D;  3KLR A;  3KDF B;  2RBM A;  5ELE A;  1NSN S;  3NBH B;  2VZA A;  4X62 L;  2R7Z G;  1R4Q B;  2Z6K C;  3PMF A;  2PQE A;  4U68 A;  1VQG A;  2WAQ B;  4OO1 G;  1V1Q A;  3OIP A;  3ULP A;  1JB3 A;  3AFQ A;  4ME3 A;  3T1H L;  1IBL Q;  2R93 H;  1K83 B;  3MXU A;  2UXD Q;  3OTO Q;  2SEB D;  1Q3L A;  4XQN A;  5KYI A;  5T1I A;  4DR6 Q;  5EPJ A;  2K52 A;  4OXP A;  3BYT B;  3TP8 A;  3ERS X;  3LNN A;  2WKC A;  4DR5 L;  1KDB A;  3NTH A;  1L1O B;  4JI6 L;  5LL6 S;  2VB3 X;  3CC4 A;  1I94 L;  2E8G A;  1BBU A;  2BDN A;  5ELN A;  2F0S A;  2NVQ B;  3NHH A;  2VL6 A;  4G7O C;  1PTO D;  1PRT F;  2L9H A;  2XN9 C;  2PPB C;  3PF5 A;  1YNN C;  2XWJ B;  1SYE A;  1TWA H;  3ICE A;  3PUZ A;  5C4X H;  1X3F A;  1PA6 A;  3J7A 5;  1FD7 D;  4S3S A;  5E4X A;  2LSS A;  1XPO A;  3CP0 A;  1HNZ Q;  3S16 H;  2E5L L;  4OON A;  4JI1 Q;  1TT2 A;  4BBS B;  4DK3 C;  2UU9 Q;  1H9R A;  3CHB D;  5EKK A;  5M3F H;  1SMY D;  1FJG Q;  1VQA A;  2B8G A;  2E2I B;  4A3M B;  3IAY A;  1T5X D;  1SLJ A;  4JC0 A;  1E2Z A;  5IYB H;  2RSO A;  1FNU A;  4A3K H;  1VQ7 A;  4HJ5 A;  1PLF A;  2LY7 A;  1CK1 A;  2F0L A;  2QKI C;  4O42 A;  3GTO B;  2HIX A;  4LF7 L;  4FYD A;  1MKH A;  5IY0 A;  4YWL A;  3L0O A;  4K5X A;  3J81 c;  2I5L X;  2DGY A;  2Y0S B;  4BXX G;  1K73 C;  2B2Y A;  1CA5 A;  2Q8T A;  3VA5 A;  3QO2 A;  4JW0 A;  1EY5 A;  1NTG A;  2B2U A;  4C3I B;  3CQZ B;  3HS0 C;  2OWO A;  2F0J A;  3HOX B;  1FGB D;  1GUG A;  5I2X A;  4DV6 Q;  3GTM H;  2WKD A;  4DR2 L;  4X64 Q;  4DK6 C;  2EYM A;  4HSP A;  1S4Z A;  4GN3 B;  5JJI A;  3B6Y A;  4HCS A;  4IQZ A;  1DOM A;  1HR0 L;  2F0H A;  2A74 C;  2FIN B;  3G71 A;  1S40 A;  1DOL A;  3C1F A;  4LF5 Q;  1JOQ A;  2QEJ C;  4JBK A;  5IWA L;  1ET9 A;  3D6W A;  1C4Q A;  2NVT H;  2B8F A;  1ICF B;  1ILQ A;  1LT4 D;  2OF1 A;  4C3H B;  1EWC A;  3MXP A;  4PG3 A;  3K6O A;  4P75 A;  1PFS A;  2E75 C;  1VMC A;  4ULL A;  2IX1 A;  4DXF A;  4FF3 A;  1MI2 A;  3S14 H;  1D5M C;  1I4P A;  1FNW A;  3DM3 A;  1Y1W H;  3I4N B;  1LTB D;  1PFN A;  4TSS A;  2AQ1 B;  5M5X H;  3NK9 A;  1VQN A;  1RTN A;  2GVB A;  2TSS A;  3S1Q B;  3QOJ A;  2BA1 A;  1L1O C;  3ER0 A;  5IGD A;  2GVA A;  1RCV D;  4LF8 Q;  4DR3 Q;  4KD3 A;  1XMQ L;  4RGM A;  3BZC A;  1QVG A;  2Q2T A;  2R7Z B;  4RWS C;  5CR3 A;  4H0L C;  1CZG A;  4A3F G;  3S17 H;  1KAA A;  3TZD A;  4IOC A;  4R4T A;  5JPM C;  3TP6 A;  3H3V C;  3R2T A;  1V1P B;  3M4P A;  3J81 j;  5K36 G;  1DM0 B;  4H13 C;  2PI2 A;  1O7Z A;  2F0Q A;  2WB1 B;  3K58 A;  2K75 A;  5FLM H;  2EE1 A;  3GTL H;  2BE5 D;  1CFM A;  4IJL A;  2NB0 A;  4LFC Q;  4B3T L;  1LTG D;  2HIV A;  1U4L A;  1PVO A;  2KA7 A;  2F3V A;  4B3M Q;  3HOU B;  1EQT A;  2K5N A;  2VW9 A;  5CBA E;  1IBM L;  3W1B A;  1AZP A;  3SDZ A;  3C3L A;  2UXB Q;  3H6M A;  4CDE C;  1TII D;  1WI5 A;  1P8L A;  4X65 Q;  1XX8 A;  2VY3 A;  3K5L A;  1STH A;  3S1N B;  1G29 1;  3O13 A;  4HJ8 A;  4DUZ Q;  1G6Z A;  2N78 A;  1BNZ A;  1CKO A;  1FR3 A;  1DXM A;  3PIP A;  3H15 A;  1CSP A;  3DLL A;  3LWE A;  4HCE A;  4MNO A;  1MIU A;  3NP8 A;  4EX5 A;  1QE6 A;  2IPK D;  3STB C;  2Y0S E;  2VQF Q;  1NR4 A;  2ICE C;  2F0V A;  5M5W H;  1J5E L;  4M8A A;  4DF7 A;  4RG1 A;  3CCM A;  1YHB A;  5IYD H;  3FVQ A;  4GKK L;  1B2T A;  4GLA C;  4QB4 A;  2IX0 A;  3G4S A;  4PZ8 A;  3VR2 A;  5IE8 A;  1HQR D;  3R93 A;  4DPG A;  2RDG A;  3H0G H;  4YWM A;  4JI7 Q;  3TS2 A;  5GAH C;  2AWO A;  4X3U A;  4GLX A;  4H7B A;  2Z8L A;  3N6R A;  1NJI C;  4FVM A;  2IX3 A;  1SNO A;  5E4W C;  3BDC A;  4EQ5 A;  4BBR H;  5IGC A;  3MVV A;  3F8T A;  1PH8 A;  2YTV A;  3VYS A;  4QUC A;  2JA5 G;  4JI3 L;  3D31 A;  4B3S L;  4DAM A;  4XYO A;  2M00 A;  1SMX A;  4KD4 A;  2RF4 A;  1ONL A;  5FK9 C;  5G3L F;  1II3 A;  3LWU A;  4X64 L;  3AMU A;  3STB D;  2PNH A;  5CV4 A;  4X3S A;  1EL0 A;  5BR8 L;  3MWY W;  2QW7 A;  1JB7 A;  4CBV A;  3F2U A;  2R92 H;  2A19 A;  1QZH A;  1OXV A;  3SGI A;  2IY5 B;  4EQP A;  2JQO A;  3GV3 A;  2A68 C;  2R93 G;  1ZXT A;  5IT9 E;  1B1Z A;  3PUV A;  3U58 A;  1SBB B;  3KLW A;  1ASZ A;  3IKJ A;  2CH4 A;  3E5S A;  1KDC A;  1HTP A;  3GQB A;  2B2Y C;  3EBE A;  4RGT A;  2F0I A;  4L8J A;  1HCZ A;  2SOB A;  4TKO B;  4IJH A;  2Q8R E;  1TWC H;  4EGV A;  1GKH A;  3T16 A;  3HOZ H;  2B2U C;  4K14 A;  2HUG A;  1GUS A;  1BCP D;  2JE6 I;  3DWA A;  4UAI A;  1OXX K;  5C4X G;  4IUV A;  4C2M B;  1QUQ A;  4XIG S;  1QIL A;  1SJH D;  2KHS A;  3D4W A;  3GTK B;  3F2D A;  1HNX Q;  3QR8 A;  2PMZ E;  4Y7N B;  1ML0 D;  4QMG A;  4A3F B;  1D5Z C;  1FYC A;  1D1K A;  2MQH A;  1UWV A;  5BN3 A;  1G6P A;  4DV7 Q;  2D9U A;  1WTW A;  5M3F G;  1IKL A;  3DUZ A;  4FXG C;  1ENC A;  3KJO A;  2JEA I;  1ROD A;  3GP7 A;  3S1M H;  2R7D A;  5IYB G;  1E2W A;  3J80 i;  4G57 A;  3EA6 A;  2HT1 A;  4A3K G;  3T53 B;  4P71 A;  4JI4 Q;  4KN7 C;  1DYQ A;  3K7A H;  2MO1 A;  3S2H H;  1N34 Q;  3PO2 H;  1GUN A;  5JPN C;  3RLO A;  2X69 A;  1BVS A;  3HZX A;  1Q12 A;  4B3M L;  1EIH A;  4KLK A;  4XT1 B;  2NN6 I;  5EKL A;  1DZ1 A;  3P7J A;  5KEE A;  1AP0 A;  3P20 A;  1KRT A;  1M4V A;  2PZW A;  2B2V A;  2H4O A;  2NVX H;  2B29 A;  1HR0 W;  4IPG A;  4JI5 L;  4QF4 A;  1EYC A;  1UUP A;  5IGF A;  4PMB A;  4P72 A;  3S9W A;  1HXY D;  2BA0 A;  2BOS A;  4KK7 A;  3CCE A;  2A6E D;  2RKS A;  1DGS A;  5AJ3 Q;  2WAC A;  5DM6 3;  5NUC A;  4DUY Q;  4DAY A;  2PCF B;  4GNX A;  2O4X A;  2RHS B;  5C4H A;  4IUR A;  1XNQ L;  2PQA A;  1E7Z A;  2B2W C;  2K4K A;  5KNC A;  2KQ3 A;  4ZKB B;  1SRU A;  5EQ0 A;  1SJE D;  3AEV A;  4N9T A;  1IYU A;  1S5F D;  1X3Q A;  1QUQ B;  4OL7 A;  4RGN A;  3H09 A;  5D3I B;  1Y8O B;  1Y14 B;  1VQM A;  3RZD H;  2RCN A;  1Q81 C;  5T1G A;  4K5V A;  4HIM A;  1HQM C;  1Y1W G;  4CJ0 B;  1T9H A;  1TS5 A;  4ZYS A;  5D14 A;  1YIJ A;  2JN4 A;  1OXT A;  2WP8 J;  2JA5 B;  3NWS A;  2HCC A;  3H94 A;  4K0K L;  3MFG A;  3CME A;  5KND A;  2JYO A;  1EQQ A;  3FRP B;  2K1B A;  3UDF A;  3S1R H;  1GD7 A;  1HH2 P;  3G7L A;  4LJZ C;  2MNA A;  2C9O A;  4J15 A;  3KF8 B;  5C3E H;  5EPL A;  4LFA L;  1A6X A;  1I3Q H;  1SNM A;  4RHS A;  5FLX L;  1KD1 C;  3I8Z A;  4A3C H;  3BVM A;  1F2L A;  1QJO A;  1X3G A;  1PH7 A;  1BQQ T;  3D8G A;  1CM9 A;  1K9M C;  5FLM G;  2ZM6 L;  1BR9 A;  1X65 A;  2F3I A;  1EY0 A;  3PUX A;  1A8V A;  4DV3 Q;  1XMO Q;  1EUJ A;  4NXM Q;  1N32 Q;  4P74 A;  4HN7 A;  1A3V A;  2ENB A;  2PW7 A;  4DR1 L;  3DEP A;  1BKB A;  1XNR Q;  5J1Z A;  2SNS A;  2UUC L;  5GRO A;  1GO3 E;  2G9D A;  3T1Y Q;  5C4X B;  3MTS A;  1KXL A;  2K32 A;  1ZYR D;  4JVZ A;  3MFY A;  5LMU Q;  1HPC A;  2NVY H;  3NE5 B;  3K5N A;  4WJ3 M;  1YJ9 A;  3S16 B;  1HRJ A;  3J81 L;  4POF A;  5M3F B;  1MSG A;  4IPC A;  4DV7 L;  4MIU A;  2A6H C;  2N88 A;  1SR3 A;  1W2B A;  1UEA B;  4KV6 A;  4IUT A;  4ZAI A;  4JPB W;  5IYD G;  1V9P A;  4A3K B;  4LF6 Q;  4GS3 A;  1S5C D;  1SRO A;  3GTJ B;  4KTA A;  2FMC A;  1WOC A;  4DR7 Q;  2ATW A;  1RIP A;  2EJM A;  3H0G G;  4OX9 Q;  3Q22 A;  2F0D A;  4X66 Q;  3TRE A;  3W3A A;  3M7G A;  3GTP H;  2A8V A;  1STA A;  4A93 H;  4P73 A;  4RA8 A;  3NTK A;  3S15 H;  4C3J B;  4J1M A;  4BBR G;  1VQK A;  1H9J A;  2KCM A;  4RAU C;  2CQO A;  3FKI H;  3A8I E;  3VYU A;  3R3O A;  3A55 A;  4A3G H;  3HGB A;  1LM0 A;  1UE5 A;  4WRD A;  5IIF A;  3GTM B;  3EQL C;  3VR6 A;  4RCO A;  2JA7 H;  1PTO F;  1XXG A;  3DEO A;  3TDQ A;  3WOE A;  3CMA A;  3HG9 A;  2OEO A;  4C1N K;  2JA6 H;  2JP1 A;  3K0X A;  3OW7 A;  5AJ3 L;  5CV6 A;  1G8Z D;  2R92 G;  2NTT A;  1B8A A;  1EWI A;  1ENA A;  2V1C C;  2NVT B;  3I4O A;  4RHR A;  1DJR D;  1YNX A;  3AU7 A;  4BY1 H;  5JEA H;  2UUA Q;  4JI0 Q;  3A0J A;  1C48 A;  1QNU A;  3IRB A;  3J81 E;  4KKU A;  1LUZ A;  3S14 B;  5TSS A;  5EJW A;  2P5Z X;  3NXW A;  3HKZ E;  1EIG A;  3HOZ G;  2DY7 A;  5M5X B;  4GKJ Q;  4XDX A;  3KLS X;  1N9W A;  3HKS A;  3VR3 A;  1QVC A;  1QG7 A;  1H9M A;  2B2V C;  1AFP A;  4IO9 A;  5ELF A;  4APV A;  1CQF A;  2E74 C;  4KJN A;  3L3O C;  1AE2 A;  4DV4 Q;  1U4R A;  2XWB B;  2G9H D;  2FFK B;  1IYV A;  2Z4I A;  2UXC Q;  1SE3 A;  1LTR D;  3VA7 A;  4DV1 L;  3S17 B;  2RQX A;  1STY A;  3ZYY X;  3FHW A;  4DV0 Q;  3J80 E;  1SMY C;  5EBD A;  3NEL A;  5KIX A;  4IZ8 A;  5D65 A;  1OTC A;  3SK8 A;  4YHH Q;  4X6A H;  1FL0 A;  3GTL B;  1I4R A;  2LKV A;  1JJG A;  2IWH A;  1Y69 U;  3N52 A;  1SDF A;  3PO2 G;  1I6V C;  1WCM H;  1YNJ D;  4ZQ3 A;  2WII B;  5EPK A;  1J6Q A;  4PZ7 A;  4LAA A;  1IYJ B;  5FLX c;  3QG1 A;  1F9P A;  5I6Y A;  1W3S A;  4FDB A;  4L5T A;  3J7A F;  1HUN A;  3I3C A;  4A76 A;  4L5Q A;  1MHW C;  3T1Y L;  4K6L A;  1CI3 M;  3FMC A;  1JC7 A;  2HHH Q;  3A56 A;  4Q5V A;  3CPW A;  2K28 A;  3CU7 A;  3HEJ A;  1PZK D;  1RJT A;  4ZRZ A;  1E3P A;  4IUN A;  5M5W B;  1V8Q A;  1SE8 A;  4L63 B;  3HOV H;  4A3B H;  1JJC B;  5IGB A;  3M7N A;  4UP9 A;  1CZW A;  1WD1 A;  1Y1V H;  4CKE A;  1RF2 D;  4EQN A;  5LMN Q;  4AH6 A;  5HUR A;  5I9O A;  3Q0A A;  4YCW A;  3BYY B;  5BN4 A;  5IP7 H;  3F1Z A;  5J39 A;  5JVG 3;  3H0G B;  1RD9 D;  2J7Z A;  1EWH A;  1F2Y A;  4OX9 L;  3OOC A;  2XRS D;  3S24 A;  1TXY A;  1WTX A;  4BBR B;  2UUB L;  1KAW A;  1M8A A;  1S72 A;  5IGG A;  1PZI D;  1BO0 A;  1RDP D;  1ILP A;  1JWU D;  2CH4 W;  2EJF C;  1F77 A;  3X3N A;  3U50 C;  4KKT A;  1IBK L;  5C44 H;  4LUO A;  1CQV A;  3LGJ A;  4HR7 B;  3JAM c;  1K3R A;  3SE0 A;  3CCJ A;  1HFN A;  1KDA A;  4R8I A;  1KLU D;  3J7Y W;  5M5Y H;  1GHK A;  4F8M A;  5C3E G;  3HFZ B;  1R4P B;  2K5D A;  3GDE A;  4KI0 A;  1EEI D;  4A3C G;  3KYH C;  3ERO A;  1BOS A;  1VQF A;  5M3M H;  2F4V L;  1HNW Q;  4AYB E;  4J8Q A;  1KRS A;  1TVX A;  1D2B A;  1B9N A;  1TQO A;  4N8F A;  1BCP B;  3SHL A;  1J8I A;  2BE5 C;  1TWC B;  3RD4 A;  4CKB A;  4A3L H;  5JEA J;  3HOZ B;  4XT3 B;  1NCV A;  2WAQ E;  3IFT A;  2RCF A;  4F88 A;  4JI8 Q;  4IUP A;  5KGU A;  3BDL A;  4QGU A;  1BBW A;  3NBI A;  2Z9H A;  3PQI A;  4ZUI A;  1L2F A;  4G4K A;  4XTC S;  1U0L A;  3UI2 A;  4DXG A;  2YTY A;  2VB2 X;  2KJX A;  5EGT A;  4MZ9 A;  3M9B A;  2PNR C;  1A2T A;  4ZCK A;  4PMC A;  4QQB X;  2VQE L;  4JBW A;  4AQY L;  4JV5 Q;  4G7Z C;  4KHP Q;  3VDY A;  2KBN A;  1X32 A;  5CV5 A;  3S1M B;  1VQL A;  1MSH A;  4NP5 A;  3NQT A;  1NBW A;  1IBL L;  4YHH L;  1EZ6 A;  3K7A B;  4JG2 A;  2KCC A;  3OTO L;  2ZTC A;  2UXD L;  3S2H B;  4Y52 H;  1GM5 A;  1UAP A;  4DR6 L;  3I72 A;  1BDO A;  3HOW H;  2MGS A;  2C5C A;  2KHI A;  4LF4 Q;  2YU9 H;  4L5R C;  2IT1 A;  3Q24 A;  4A93 G;  4YCU A;  5FO9 B;  2E2J H;  4YY3 Q;  1EYA A;  4GOP A;  3FKI G;  4K8J A;  2EXD A;  4DV2 Q;  4DV5 Q;  2JK8 A;  1Z6H A;  3V2T A;  4A3G G;  3PSI A;  2NVX B;  4JCV E;  5A2Q L;  1IL8 A;  4OWW B;  3URY A;  2XVS A;  2HHH L;  3U4V A;  2JA7 G;  2OQK A;  2QEX A;  3CD6 A;  5ELB A;  1AW7 A;  3DHQ A;  1BCP F;  1PYB A;  2F4I A;  2JA6 G;  4R1J A;  1HNZ L;  2QA4 A;  4WJW A;  4JI1 L;  4IFD I;  4QIW B;  2UU9 L;  1ZKO A;  3NSW A;  5IYC H;  1TY0 A;  4KHZ A;  2XIW A;  1FJG L;  2L15 A;  2ZXR A;  4TQU S;  3KF6 A;  2N49 A;  1FGU A;  4KY7 A;  1Y8N B;  1LT6 D;  2CFM A;  4BY1 G;  1Q8K A;  4K8I A;  5KRU A;  5JEA G;  3RZD B;  3VR5 A;  4UDU C;  1N36 Q;  2SNM A;  5IOC A;  3KLS A;  4RFB A;  1A62 A;  4LF9 Q;  1GJX A;  1GOZ A;  1VQ8 A;  1O78 A;  5E7N A;  4WJ4 A;  2KCT A;  2E2I H;  3PO3 H;  3FPP A;  4XXE A;  1I4H A;  1BCP C;  1JQY D;  2EQS A;  1NUC A;  3TSS A;  2WIN B;  2ZJR A;  3IFD A;  3K59 A;  1TWG H;  3S1R B;  3R2I A;  4DV6 L;  1AH9 A;  1I4X A;  3KBX A;  5HGQ A;  2F0F A;  2K50 A;  5C3E B;  1WTV A;  1A3U A;  4OWT B;  1I3Q B;  1G91 A;  4LWC A;  1E22 A;  4O1N A;  3TP5 A;  2L5T A;  1JOK A;  3HP3 A;  4NB3 A;  1EY9 A;  5C3W A;  2G5D A;  1PXU A;  1EOV A;  4LF5 L;  1IKM A;  1BXT A;  1HNW L;  3CQZ H;  1EIY B;  4JYA Q;  3MXN A;  3RLN A;  3FP9 A;  2F0U A;  1WCM G;  2ASB A;  2D2C C;  2ES2 A;  3MZ5 A;  1NAP A;  1Q8I A;  5FKA C;  2I5H A;  1IW7 C;  3J81 i;  3A8K E;  1WVL A;  1VF7 A;  2HDL A;  2EZV A;  1YVC A;  3UDG A;  1TS3 A;  4YCV A;  1R9T H;  2ZJP A;  2WB1 E;  2FMM A;  4CDF C;  1QVF A;  2NVY B;  1Y8P B;  3KF6 B;  3MHB A;  2K5W A;  3SK5 A;  1AE3 A;  3HOY H;  1I4Q A;  2MHV A;  4B3R Q;  4LF8 L;  4DR3 L;  1O7I A;  1ASY A;  1D7Q A;  2K6A A;  5C0X I;  1WTQ A;  2A6E C;  1YIT A;  3GTG H;  4BA2 I;  3HOV G;  4A3B G;  1QWY A;  2WV6 D;  1E1O A;  2O5I C;  4H44 C;  5E1F A;  1HZC A;  2K7V A;  1Y1V G;  3AQQ A;  2IW3 A;  4X3T A;  1NMF A;  3QIA A;  5J3B A;  1M1K C;  2Z1C A;  1Q46 A;  4BY7 H;  1CKM A;  3S1Q H;  4DR4 Q;  5GAD C;  5IP7 G;  2KVM A;  1K0S A;  2L12 A;  2NN6 H;  4P2C B;  4HTH A;  1PYS B;  3A5Z B;  4A3I H;  3EIV A;  4JOI A;  4LFC L;  3GTP B;  4A93 B;  4KHV A;  1WTO A;  3C46 A;  3Q6S A;  2D5D A;  3NPP A;  1GUO A;  3PIP 3;  1IW7 D;  1LO5 D;  3S15 B;  1LTI D;  1B44 D;  4QIW E;  4V0B A;  2VNU D;  1XPR A;  2F0E A;  4B08 A;  1JOO A;  2UXB L;  1DOK A;  4EVO A;  4A3G B;  4ZLT F;  4X65 L;  4A3J H;  2HCI A;  1ESF A;  3KJP A;  2OCE A;  5C44 G;  2JA7 B;  3UDI A;  4DUZ L;  4NMZ A;  1TWH B;  4LUZ A;  4OO1 I;  3MXN B;  1UE6 A;  1LTT D;  1P16 A;  2D0P A;  1RL2 A;  2JA6 B;  4OIJ A;  2K5V A;  1VF5 C;  1JOR A;  1S5B D;  1SFO H;  1HJP A;  2VQF L;  3HOU H;  2L4N A;  1NE3 A;  4LUV A;  3VYT A;  4CJ2 C;  1Q1B A;  1YEZ A;  3KFU A;  1W6J A;  4HAE A;  5M3M G;  3CCQ A;  5I2Y A;  1RKN A;  3FDT A;  2K5H A;  1E0B A;  2B63 H;  1X56 A;  2PI2 E;  1LYL A;  2A5H A;  4DGZ A;  2V4D A;  4DU9 A;  1VQ9 A;  3PGZ A;  4H02 A;  2F0M A;  4JK1 C;  2VUM G;  5J22 A;  2JJQ A;  3EFX D;  3BU2 A;  2ZTE A;  4JI7 L;  2F0O A;  4A3L G;  4GOP C;  3I2Z A;  5GAE C;  3G6E A;  2KED A;  2LMC B;  3E0E A;  3RN5 A;  2WFW A;  1SYG A;  1TWF H;  1B4O A;  1SE2 A;  2PW5 A;  4RKB A;  1L0Y B;  2R3Z A;  5ELO A;  3K57 A;  1ZYR C;  2VS1 A;  1CT1 D;  4G7H C;  2YV5 A;  4WFN 3;  5HY6 A;  4DN4 M;  4NXN Q;  1PYW D;  1I50 H;  1SN8 A;  3M4O H;  1HHV A;  1F2Z A;  1PZJ D;  1Z7T A;  2B39 A;  3SXH A;  4UP8 A;  1PFM A;  4TVA B;  4RKL A;  2AUK A;  3TEH B;  3UE1 A;  4QUF A;  2R93 B;  2H5X A;  2EYL A;  5DAU A;  2OT2 A;  2MUY A;  2KHJ A;  2RDH A;  3SEB A;  2MFI A;  5JOB A;  4MTK A;  2BDO A;  4HID A;  1WTR A;  2J4X A;  1WCM B;  3HOW G;  3V05 A;  4X62 Q;  2JA8 H;  4A3E H;  1HZ9 A;  3MA2 B;  3RR5 A;  5GAG C;  4CDC C;  3ULL A;  1AEX A;  2WAQ G;  3MEF A;  3I4M H;  3U9O A;  1GVP A;  3BS1 A;  3T1H Q;  1TWA B;  4DAY B;  3OYY A;  4GNX B;  4WOR A;  2PQA B;  4GZY C;  2JXM B;  1FNV A;  3WDN A;  2CCZ A;  1C7Y A;  3PUW A;  2EXZ A;  4DR5 Q;  3M3Y H;  1HNX L;  4JI6 Q;  3HOV B;  4QY7 A;  4A3B B;  1AN8 A;  4HSV A;  4IAL A;  5IYC G;  4JBM A;  2A1A A;  4PMW A;  2XTI A;  1SYF A;  2Q2U A;  4UPA A;  1G2T A;  4C2M H;  1IXR A;  4FXK C;  2B3G A;  2DJG C;  2VXW A;  1HTL D;  3CW2 C;  3JAM L;  4JI4 L;  2E5L Q;  4Y7N H;  2BH2 A;  1TY2 A;  2AQ2 B;  1N34 L;  1EU3 A;  1NMG A;  3PCO B;  4C56 C;  1TKW B;  5CV7 A;  3GTQ H;  2D62 A;  1STE A;  1XPU A;  1A2U A;  4M1U B;  5FLX E;  5C3X A;  1VQC A;  1TS2 A;  2CVR A;  1KLG D;  4DNI A;  2AMC B;  5JJL A;  1VS0 A;  2I5M X;  1O7Y A;  2F0G A;  3PO3 G;  3D3R A;  1DD2 A;  4UY8 C;  1F9R A;  1MBY A;  1TS4 A;  4LF7 Q;  1EZ8 A;  1JIC A;  3W1G A;  5M5Y B;  2YYZ A;  1LAC A;  3K5O A;  4FF2 A;  2Y0S G;  3RZO H;  1WTH A;  2DNC A;  4A75 A;  3S2D H;  1I6H H;  3UDX A;  2E2H H;  1XTD A;  3AYH B;  1I4G A;  2HDM A;  1K8M A;  4RCN A;  5M3M B;  3I55 A;  3RMH A;  4DUY L;  5KNB A;  3NQI A;  2KEC A;  4R8N A;  1PDQ A;  4LFB Q;  3TP7 A;  1W6K A;  4ILW A;  2L1B A;  4OHJ A;  4JOI C;  4FXD A;  4DR2 Q;  1E1T A;  3UE0 A;  3K0Y A;  4LK1 C;  2FJ2 A;  1PH3 A;  3EJI A;  1RTO A;  3JC6 6;  3OHX C;  1S5D D;  1ESR A;  3E9I A;  5FOB B;  1Y1W B;  5CC4 A;  1SEB D;  1YNJ C;  3MAQ A;  2DJF C;  5DEH A;  2K5Q A;  2NTS A;  2EY2 A;  1KNE A;  2O2L D;  1UE7 A;  3JAM E;  2YTX A;  1X3P A;  3HOY G;  3NEN A;  3M4Q A;  2F0N A;  4OIK A;  4BWG B;  3FPU B;  4IUQ A;  1PH4 A;  1PH5 A;  3TRZ A;  4B9W A;  4E6I A;  2BCO A;  4GNX C;  1WTP A;  5FO8 B;  1JMC A;  4F7X A;  3I56 A;  2OXP A;  2NUC A;  1H9S A;  3OWE B;  4KN4 C;  4BY7 G;  2NN6 G;  4DV3 L;  3F2B A;  3HOW B;  3OW2 A;  4O0A A;  1XMO L;  1XMQ Q;  4NXM L;  1N32 L;  4A3I G;  2YU9 B;  2QDB A;  4X3K A;  5C4J H;  2TMP A;  4KY6 A;  2E2J B;  1SAP A;  1Q82 C;  3CCL A;  4PV1 C;  3NEM A;  3D4R A;  3QOL A;  3AB9 A;  4DAV A;  2HQL A;  2K33 A;  3ND9 A;  1XNR L;  1WFQ A;  4LW1 A;  3AFP A;  3OSO A;  1XYI A;  1JT8 A;  1LTS D;  4R4O A;  4NW2 A;  1EEF D;  4A3J G;  2Z6B A;  1U9R A;  2WB1 G;  3IL8 A;  1U4M A;  3RLF A;  5GQO A;  5LMU L;  1PTO H;  4B3T Q;  1X9N A;  1EY4 A;  2MO0 A;  2QIL A;  2FXQ A;  2F1M A;  1IBM Q;  1O7L A;  3HOU G;  1HUM A;  5FJ8 H;  1ENF A;  5IOD A;  3E6Z X;  1T5E A;  2ZTD A;  5C5L A;  2AQ3 B;  2A69 D;  4C1N I;  2B63 G;  4QJF A;  1PHJ A;  4LF6 L;  1TU2 B;  1L0X B;  3SK4 A;  2CKZ B;  3CCU A;  4DR7 L;  3DMU A;  2NZH A;  5CV8 A;  4X66 L;  1J5E Q;  4RGO S;  2JEB I;  3CXC A;  3LX0 A;  3PO3 B;  1K8G A;  4GKK Q;  1H9S B;  1CA6 A;  1KNA A;  2JA9 A;  3RUZ A;  4B9X A;  4FO2 A;  2HD3 A;  1TWG B;  1STG A;  1X3E A;  5C4Z A;  3GTJ H;  2LXJ A;  4N9P A;  4OWX B;  3CCR A;  3NTI A;  2OTJ A;  1PRT C;  2E2D C;  2ZXP A;  4MN3 A;  5IP9 H;  3D0F A;  3OPO A;  2L55 A;  4K2K A;  4BS9 A;  2R92 B;  4HJ9 A;  4NPS A;  1WD0 A;  1V1P A;  1YNN D;  3GV6 A;  1YBY A;  4C3J H;  3J7A V;  2CW0 C;  2KOL A;  4JI3 Q;  3E3X A;  1NY4 A;  4B3S Q;  4LFB L;  2F3W A;  3A8J E;  1CHQ D;  3DXJ C;  2R61 A;  3A54 A;  1OO9 B;  1AZQ A;  2VUM H;  1YHQ A;  4GLV B;  2SDF A;  2UUA L;  4JI0 L;  5BR8 Q;  4A3E G;  2JA8 G;  1CUK A;  4R4Q A;  4ABN A;  2FHT A;  3BG3 A;  3BVZ A;  4IPD A;  4NKL A;  3TQY A;  3I4M G;  3J80 c;  4GKJ L;  1R9T B;  2KEE A;  3PIO A;  4MHE A;  2RHQ B;  1SND A;  5KYL A;  2K05 A;  2A73 B;  1EQR A;  1VDZ A;  4IUU A;  1VQJ A;  2Z0S A;  1GHJ A;  3HOY B;  1GUT A;  1PRT D;  4K2L A;  1JWM D;  4DV4 L;  4DNT B;  1QZG A;  2DUD A;  3L9A X;  4IPH A;  2UXC L;  1H9K A;  4JI2 Q;  2Z4H A;  3GTG B;  1SXT A;  2X6L A;  5IGE A;  1C0A A;  1A3T A;  5EBC A;  4DV0 L;  2ALY B;  2CW0 D;  1H95 A;  3OMG A;  4ID6 A;  1N8R C;  4BY7 B;  4IOA A;  5BN5 A;  4A3D H;  2F0K A;  2RSN A;  2RA4 A;  3MC0 B;  3NWT A;  4A3I B;  4I65 A;  1SYB A;  3BVG A;  2BH8 A;  3PO2 B;  2EYO A;  2RDF A;  1CHP D;  1SYD A;  2EVB A;  1V1O A;  2QCP X;  2EYF A;  1M90 C;  4PZ6 A;  3CC2 A;  1LLR D;  1LTA D;  4CKC A;  2N55 A;  3G48 A;  1EY7 A;  3OMC A;  3QB3 A;  4A3J B;  1LV9 A;  1EFI D;  4HMJ A;  4IFD H;  1GXD C;  2K04 A;  1K83 H;  2L11 A;  2B2W A;  2M9V A;  2XRQ D;  5C6A A;  4PNY A;  5I9P A;  2PMZ B;  4TRD A;  4FF1 A;  1A63 A;  1EOT A;  4K6D A;  2IL8 A;  3T13 A;  2O5J C;  4CHT B;  1SFO B;  2CWA A;  3RNU A;  1STB A;  3BDO A;  1E24 A;  1JR0 D;  1B7Y B;  2NVQ H;  1J9O A;  1KL9 A;  2B63 B;  4DK1 A;  1WYD A;  3GD7 A;  1B50 A;  2EY1 A;  4CDD C;  3TZU A;  4KKS A;  4LNQ A;  1B3A A;  5IT9 L;  1MJE A;  3H3V H;  4L6T B;  5LMN L;  4JI5 Q;  1PFB A;  1HA6 A;  3T51 B;  1EQV A;  5L37 A;  4OEM B;  2KCN A;  4N8X 1;  1OXU A;  1LT3 D;  2J0T D;  1A15 A;  1QCB D;  4BBS H;  3OWF A;  1C8C A;  1Q1E A;  1S5E D;  4CGY B;  3H3V I;  1XNQ Q;  1TWF B;  1VQI A;  1JE5 A;  1PH2 A;  4A3M H;  2CWP A;  3ND8 A;  1EYG A;  5JAV A;  1VQB A;  3HRZ C;  1PH6 A;  3GTO H;  1I50 B;  3M4O B;  1S3O A;  1SNC A;  2K14 A;  2EY5 A;  3I90 A;  4RH6 A;  4L5S A;  4DNR B;  1STN A;  5CV9 A;  2EPB A;  4R9W A;  4GOP B;  3M4Y A;  5A2Q E;  3J7Z C;  4K0K Q;  5AFW A;  4PQX A;  3VYR A;  1HFG A;  1EYD A;  2MJ8 A;  4C3I H;  1K3B C;  3PIO 3;  3HOX H;  3PUY A;  2JA8 B;  4A3E B;  2EOT A;  4LFA Q;  4DKA C;  4ZUJ A;  1YHA A;  3CPF A;  3I4M B;  2XGT A;  3I70 A;  3P75 A;  1SNQ A;  3HKZ G;  1N33 Q;  4JI8 L;  1KTK A;  5C0X H;  4OEL B;  3X3M A;  2ZM6 Q;  2GA4 B;  3T56 B;  3CKI B;  3D6C A;  3CRL C;  3M3Y B;  4DA2 A;  1K8O A;  3QWN A;  5CYU A;  5I4D A;  2Q2H A;  4C3H H;  3BJU A;  1K28 A;  4DR1 Q;  3ITP A;  3I91 A;  1L0W A;  3F2C A;  2QF7 A;  1EY8 A;  3JAM i;  4JI2 L;  1EU4 A;  1HZB A;  2EDG A;  4JV5 L;  2AHO B;  1VCI A;  2PYK A;  5FJ8 G;  4OGQ C;  5E3F A;  2B2T A;  2UUC Q;  2Q2I A;  3K7U C;  4KHP L;  5D3D A;  4R4C A;  3I4N H;  3M85 A;  3KUP A;  4POG A;  2N8N A;  4R4I A;  2KUM A;  1LT5 D;  4Q0F A;  4RMF A;  1O80 A;  2Q8I B;  4JBJ A;  1JWS D;  2AUJ D;  1Z47 A;  1SE4 A;  3GTQ B;  3DM1 A;  3TS0 A;  1OXS C;  1IHZ A;  3A7L A;  2ZJQ A;  3P1H A;  4LF4 L;  2R7Z H;  3VR4 A;  3R8B A;  4IN3 A;  4OO1 H;  1FVI A;  5H1S E;  3FKI B;  2A68 D;  4YY3 L;  1TR5 A;  5COY A;  3QJY A;  4KY5 A;  1B53 A;  5M9O A;  1VQ4 A;  4CJ1 B;  2EYP A;  4DV2 L;  1Z9F A;  4DV5 L;  1B70 B;  2KEN A;  5JJK A;  1XTC D;  1VQP A;  4IFD J;  3BZD B;  3A5U A;  5DLQ E;  3KF8 A;  4HIK A;  5IP9 G;  1U5K A;  3CC7 A;  3RZO B;  5COR A;  1F9S A;  4QL5 A;  3S2D B;  1I6H B;  2E2H B;  4J6H A;  3ULJ A;  3CF5 A;  3I4L A;  5G3L D;  4C3J G;  4YIJ A;  4DFA A;  5FO7 B;  3TBI B;  1CTM A;  2ZXO A;  4ODG A;  3S1N H;  5EKI A;  4ALP A;  1JCK B;  3SVM A;  4AIM A;  2LXK A;  4BA1 I;  4BY1 B;  3EVQ A;  1VQ6 A;  5ISR A;  5JJZ A;  2F03 A;  4GN5 A;  3FEW X;  1N36 L;  1EIF A;  3Q23 A;  3TN2 A;  2ID0 A;  2EYH A;  4LF9 L;  1ZEQ X;  2H1E A;  3V96 A;  2RVL A;  2Z6K A;  2F0P A;  3K8A A;  3KBG A;  1X6O A;  1SYC A;  1K0R A;  3NUC A;  3K5M A;  1Q7Y C;  1JJ2 A;  2NYZ D;  4HJA A;  1PV4 A;  2DNE A;  2DY8 A;  3SK6 A;  5IT9 c;  1D6E C;  1SSO A;  3U9S A;  1CKN A;  2K03 A;  5CGK A;  1KC8 C;  2EJG C;  1XJV A;  3RN2 A;  2PZT A;  1DCZ A;  3DWP A;  3WOF A;  2ICI A;  5LHY 1;  1G51 A;  1CSQ A;  4HMI A;  2QDL A;  4HED A;  3SR1 A;  3MEH A;  3CCS A;  4BXX H;  3DWQ A;  1MD2 D;  2OQ0 A;  1X54 A;  1BF4 A;  1K8A C;  1PH1 A;  4K5W A;  1D5X C;  2M2L A;  1V43 A;  2D0O A;  1JE4 A;  1VQH A;  4A4I A;  4A3D G;  1HZA A;  1F9Q A;  2IJ0 A;  4AYB G;  2L0C A;  1LAB A;  2NZ1 D;  1WJJ A;  5LL6 X;  4DAP A;  2CQA A;  3KK7 A;  1HA5 A;  1QOH A;  3Q8D A;  4XQJ A;  1BUV T;  4DV1 Q;  4NDX A;  5C4J B;  2XNA C;  2ZT9 C;  4O2D A;  4JYA L;  1EY6 A;  2R7F A;  4ZK9 B;  1UNS A;  4KJO A;  2AWN A;  3HKZ B;  1G2S A;  1VQ5 A;  4HIO A;  1GUW A;  1UEB A;  2PZU A;  4Z9C B;  2NBF A;  1N33 L;  2MP1 A;  2JSO A;  1DON A;  4IFD G;  4FNF A;  3CRK C;  4FF4 A;  2E76 C;  1PTO B;  1D8L A;  1X55 A;  3ONA B;  5C0X J;  4UHV A;  3L2P A;  1YZ6 A;  3A7A B;  5ELD A;  1RHP A;  4F87 A;  3CCV A;  1LTL A;  1NR2 A;  3W5O A;  4B3R L;  1KAB A;  4LMQ D;  1I94 Q;  4I7A A;  2N3S A;  5DM7 3;  3C1E A;  5LMN W;  5K5P A;  2F0W A;  3D4D A;  3I73 A;  1KQS A;  4YWK A;  1Y1V B;  3G6J B;  1XWE A;  2DN8 A;  2IHE A;  2AKW B;  2PO4 A;  4I7Z C;  4QCL A;  1CKN B;  1QB5 D;  4DR4 L;  2XSC A;  4ZKC B;  4HJ7 A;  1Q86 C;  1VQO A;  3GTK H;  1KHI A;  1B3Q A;  1YI2 A;  1ICW A;  1KIX A;  2X6G A;  4XQQ A;  4A3F H;  1VMP A;  4BBS G;  5K36 H;  2I46 A;  1VQD A;  2NWG A;  1ET6 A;  1D1I A;  4A3M G;  5C44 B;  5C5M A;  3PF4 A;  1EFW A;  2MPM A;  2IHF A;  2EYJ A;  5EAY A;  3KDF A;  2K01 A;  3A74 A;  4MTN A;  1NNX A;  5JVH 3;  3NBH A;  4V19 0;  2B2T C;  2UUB Q;  3I7F A;  1SNP A;  2EIF A;  2F0T A;  3WWV A;  5HGT A;  4EQO A;  3TME A;  1PMR A;  3PV0 A;  3GO5 A;  3J80 L;  1C9O A;  5A35 A;  2F52 A;  1IBK Q; 
#chains in the Genus database with same CATH homology
 4XYQ A;  2LFN A;  1E2V A;  5F2D A;  4C3I G;  2HQE A;  3MXG A;  2VUM B;  1QNK A;  1BBX C;  4U67 3;  3W2D A;  5ELC A;  2A6H D;  1PRT B;  3OIQ A;  1B9M A;  3T4A C;  5C0X G;  2R6G A;  3ERQ A;  3L7Z C;  1U4P A;  1Q90 A;  2EY6 A;  5I6W A;  2CHB D;  4C3H G;  2I07 B;  3C2P A;  4ME5 A;  1MGS A;  3H91 A;  5DNF A;  4DK0 A;  1PTO C;  4A3D B;  4KMU C;  2A69 C;  4AYB B;  5CMD A;  2LS0 1;  3E0J A;  5CBE E;  1F2M A;  4FP5 D;  3KLR A;  2RBM A;  5ELE A;  1NSN S;  1R4Q B;  3PMF A;  2PQE A;  4U68 A;  2WAQ B;  4OO1 G;  3OIP A;  1JB3 A;  1K83 B;  3MXU A;  2SEB D;  1Q3L A;  4XQN A;  5KYI A;  5T1I A;  5EPJ A;  3BYT B;  3TP8 A;  3LNN A;  2WKC A;  1KDB A;  3NTH A;  5LL6 S;  2VB3 X;  2BDN A;  2F0S A;  2NVQ B;  3NHH A;  4G7O C;  1PTO D;  1PRT F;  2L9H A;  2XN9 C;  2PPB C;  1YNN C;  2XWJ B;  1SYE A;  3PUZ A;  1FD7 D;  4S3S A;  5E4X A;  1TT2 A;  4BBS B;  1H9R A;  3CHB D;  5EKK A;  1SMY D;  2B8G A;  2E2I B;  4A3M B;  3IAY A;  1T5X D;  1E2Z A;  2RSO A;  1FNU A;  1PLF A;  2LY7 A;  1CK1 A;  2F0L A;  2QKI C;  4O42 A;  3GTO B;  4FYD A;  4K5X A;  2Y0S B;  2B2Y A;  1CA5 A;  2Q8T A;  3VA5 A;  3QO2 A;  1EY5 A;  2B2U A;  4C3I B;  3CQZ B;  3HS0 C;  2F0J A;  3HOX B;  1FGB D;  1GUG A;  5I2X A;  2WKD A;  2EYM A;  4HSP A;  1S4Z A;  4HCS A;  4IQZ A;  1DOM A;  2F0H A;  2A74 C;  2FIN B;  1DOL A;  3C1F A;  1JOQ A;  2QEJ C;  1ET9 A;  3D6W A;  1C4Q A;  2B8F A;  1ILQ A;  1LT4 D;  2OF1 A;  4C3H B;  1EWC A;  3MXP A;  3K6O A;  2E75 C;  1VMC A;  4ULL A;  2IX1 A;  4DXF A;  4FF3 A;  1MI2 A;  1D5M C;  1I4P A;  1FNW A;  3I4N B;  1LTB D;  1PFN A;  4TSS A;  2AQ1 B;  3NK9 A;  1RTN A;  2TSS A;  3S1Q B;  3QOJ A;  2BA1 A;  5IGD A;  1RCV D;  4KD3 A;  2R7Z B;  4RGM A;  4RWS C;  5CR3 A;  4H0L C;  1CZG A;  1KAA A;  3TZD A;  5JPM C;  3TP6 A;  3H3V C;  3R2T A;  1V1P B;  5K36 G;  1DM0 B;  4H13 C;  1O7Z A;  2F0Q A;  2WB1 B;  3K58 A;  2EE1 A;  2BE5 D;  1CFM A;  2NB0 A;  1LTG D;  1U4L A;  2KA7 A;  2F3V A;  3HOU B;  1EQT A;  5CBA E;  1AZP A;  3SDZ A;  3C3L A;  3H6M A;  1TII D;  3K5L A;  1XX8 A;  1STH A;  3S1N B;  1G29 1;  3O13 A;  1G6Z A;  1BNZ A;  1FR3 A;  1DXM A;  3LWE A;  4HCE A;  3NP8 A;  1QE6 A;  2IPK D;  1NR4 A;  2ICE C;  2F0V A;  4M8A A;  4DF7 A;  3FVQ A;  1B2T A;  4QB4 A;  2IX0 A;  3VR2 A;  1HQR D;  3R93 A;  2RDG A;  2AWO A;  4X3U A;  4H7B A;  2Z8L A;  3N6R A;  4FVM A;  2IX3 A;  1SNO A;  5E4W C;  3BDC A;  5IGC A;  3MVV A;  3VYS A;  4QUC A;  3D31 A;  4XYO A;  2M00 A;  4KD4 A;  1ONL A;  5FK9 C;  5G3L F;  1II3 A;  3LWU A;  3AMU A;  5CV4 A;  4X3S A;  1EL0 A;  3MWY W;  4CBV A;  3F2U A;  1OXV A;  4EQP A;  3GV3 A;  2A68 C;  1ZXT A;  5IT9 E;  1B1Z A;  3PUV A;  1SBB B;  3IKJ A;  3E5S A;  1KDC A;  1HTP A;  3GQB A;  2B2Y C;  4RGT A;  2F0I A;  4L8J A;  1HCZ A;  2SOB A;  4TKO B;  2Q8R E;  4EGV A;  3T16 A;  2B2U C;  4K14 A;  2HUG A;  1GUS A;  1BCP D;  2JE6 I;  3DWA A;  4UAI A;  1OXX K;  4IUV A;  4C2M B;  4XIG S;  1QIL A;  1SJH D;  2KHS A;  3D4W A;  3GTK B;  4Y7N B;  1ML0 D;  4QMG A;  4A3F B;  1D5Z C;  1FYC A;  1D1K A;  5BN3 A;  2D9U A;  1WTW A;  1IKL A;  3DUZ A;  4FXG C;  1ENC A;  2JEA I;  1ROD A;  3GP7 A;  1E2W A;  4G57 A;  3EA6 A;  3T53 B;  4KN7 C;  1DYQ A;  1GUN A;  5JPN C;  2X69 A;  3HZX A;  1Q12 A;  1EIH A;  4XT1 B;  2NN6 I;  5EKL A;  1DZ1 A;  3P7J A;  5KEE A;  1AP0 A;  3P20 A;  1M4V A;  2PZW A;  2B2V A;  2H4O A;  4QF4 A;  1EYC A;  1UUP A;  5IGF A;  4PMB A;  3S9W A;  1HXY D;  2BA0 A;  2BOS A;  4KK7 A;  2A6E D;  2RKS A;  2WAC A;  5DM6 3;  5NUC A;  4DAY A;  2PCF B;  2O4X A;  5C4H A;  4IUR A;  2B2W C;  5KNC A;  2KQ3 A;  4ZKB B;  5EQ0 A;  1SJE D;  4N9T A;  1IYU A;  1S5F D;  1X3Q A;  4OL7 A;  4RGN A;  3H09 A;  5D3I B;  1Y8O B;  5T1G A;  4K5V A;  1HQM C;  4CJ0 B;  1TS5 A;  4ZYS A;  5D14 A;  1OXT A;  2WP8 J;  2JA5 B;  3NWS A;  2HCC A;  3H94 A;  3MFG A;  5KND A;  2JYO A;  3FRP B;  2K1B A;  3G7L A;  4LJZ C;  2C9O A;  5EPL A;  1A6X A;  1SNM A;  4RHS A;  5FLX L;  3I8Z A;  3BVM A;  1F2L A;  1QJO A;  1BQQ T;  3D8G A;  1CM9 A;  1BR9 A;  3PUX A;  1EY0 A;  4HN7 A;  1A3V A;  2ENB A;  2PW7 A;  3DEP A;  5J1Z A;  2SNS A;  2G9D A;  5C4X B;  3MTS A;  2K32 A;  1ZYR D;  3MFY A;  1HPC A;  3NE5 B;  3K5N A;  3S16 B;  1HRJ A;  3J81 L;  5M3F B;  1MSG A;  4MIU A;  2A6H C;  2N88 A;  1UEA B;  4KV6 A;  4IUT A;  4ZAI A;  4A3K B;  1S5C D;  3GTJ B;  4KTA A;  2FMC A;  2EJM A;  3Q22 A;  2F0D A;  3W3A A;  3M7G A;  1STA A;  4RA8 A;  3NTK A;  4C3J B;  4J1M A;  1H9J A;  4RAU C;  3A8I E;  3VYU A;  3R3O A;  3A55 A;  3HGB A;  4WRD A;  5IIF A;  3GTM B;  3EQL C;  3VR6 A;  4RCO A;  1PTO F;  1XXG A;  3DEO A;  3TDQ A;  3WOE A;  3HG9 A;  2OEO A;  4C1N K;  2JP1 A;  3OW7 A;  5CV6 A;  1G8Z D;  2NTT A;  1ENA A;  2NVT B;  4RHR A;  1DJR D;  3AU7 A;  5JEA H;  1C48 A;  1QNU A;  3J81 E;  4KKU A;  3S14 B;  5TSS A;  5EJW A;  3NXW A;  1EIG A;  2DY7 A;  5M5X B;  4XDX A;  3KLS X;  3VR3 A;  1QG7 A;  1H9M A;  2B2V C;  1AFP A;  5ELF A;  1CQF A;  2E74 C;  4KJN A;  3L3O C;  1U4R A;  2XWB B;  2G9H D;  2FFK B;  1IYV A;  2Z4I A;  1SE3 A;  1LTR D;  3VA7 A;  3S17 B;  2RQX A;  1STY A;  3ZYY X;  3J80 E;  1SMY C;  5EBD A;  5KIX A;  4IZ8 A;  5D65 A;  3SK8 A;  3GTL B;  1I4R A;  2LKV A;  2IWH A;  1Y69 U;  3N52 A;  1SDF A;  1I6V C;  1YNJ D;  4ZQ3 A;  2WII B;  5EPK A;  4LAA A;  3QG1 A;  1F9P A;  5I6Y A;  3J7A F;  1HUN A;  3I3C A;  4K6L A;  1CI3 M;  3FMC A;  1JC7 A;  3A56 A;  4Q5V A;  2K28 A;  3CU7 A;  3HEJ A;  1PZK D;  1RJT A;  4ZRZ A;  4IUN A;  5M5W B;  1V8Q A;  4L63 B;  5IGB A;  3M7N A;  1CZW A;  1WD1 A;  4CKE A;  1RF2 D;  4EQN A;  5HUR A;  5I9O A;  3Q0A A;  5BN4 A;  3BYY B;  5J39 A;  5JVG 3;  3H0G B;  1RD9 D;  2J7Z A;  1EWH A;  1F2Y A;  3OOC A;  2XRS D;  1WTX A;  4BBR B;  1M8A A;  5IGG A;  1PZI D;  1BO0 A;  1RDP D;  1ILP A;  1JWU D;  2EJF C;  1F77 A;  3X3N A;  4KKT A;  1CQV A;  4HR7 B;  3SE0 A;  1HFN A;  1KDA A;  4R8I A;  1KLU D;  3J7Y W;  1GHK A;  4F8M A;  1R4P B;  2K5D A;  4KI0 A;  1EEI D;  3ERO A;  1BOS A;  4J8Q A;  1TVX A;  1D2B A;  1B9N A;  1TQO A;  1BCP B;  3SHL A;  1J8I A;  2BE5 C;  1TWC B;  3RD4 A;  4CKB A;  5JEA J;  3HOZ B;  4XT3 B;  1NCV A;  3IFT A;  4F88 A;  4IUP A;  5KGU A;  3BDL A;  3NBI A;  4ZUI A;  4G4K A;  4XTC S;  3UI2 A;  4DXG A;  2VB2 X;  2KJX A;  5EGT A;  2PNR C;  1A2T A;  4PMC A;  4JBW A;  4G7Z C;  1X32 A;  5CV5 A;  3S1M B;  1MSH A;  4NP5 A;  3NQT A;  1EZ6 A;  3K7A B;  2KCC A;  3S2H B;  1UAP A;  3I72 A;  1BDO A;  2MGS A;  2C5C A;  2IT1 A;  3Q24 A;  5FO9 B;  1EYA A;  4K8J A;  1Z6H A;  3V2T A;  2NVX B;  5A2Q L;  1IL8 A;  3URY A;  2XVS A;  5ELB A;  1AW7 A;  3DHQ A;  1BCP F;  2F4I A;  4WJW A;  4IFD I;  4QIW B;  1ZKO A;  3NSW A;  1TY0 A;  4KHZ A;  2XIW A;  2ZXR A;  4TQU S;  4KY7 A;  1Y8N B;  1LT6 D;  4K8I A;  5KRU A;  5JEA G;  3RZD B;  3VR5 A;  4UDU C;  2SNM A;  5IOC A;  3KLS A;  4RFB A;  1GJX A;  1GOZ A;  1O78 A;  3FPP A;  4XXE A;  1I4H A;  1BCP C;  1JQY D;  1NUC A;  3TSS A;  2WIN B;  3S1R B;  3IFD A;  3K59 A;  3R2I A;  1I4X A;  3KBX A;  2F0F A;  5C3E B;  1WTV A;  1A3U A;  1G91 A;  1I3Q B;  4O1N A;  3TP5 A;  2L5T A;  1JOK A;  3HP3 A;  1EY9 A;  5C3W A;  1PXU A;  1IKM A;  1BXT A;  3MXN A;  2F0U A;  2D2C C;  3MZ5 A;  1NAP A;  1Q8I A;  5FKA C;  1IW7 C;  3A8K E;  1WVL A;  1VF7 A;  2HDL A;  2EZV A;  1TS3 A;  2FMM A;  2NVY B;  1Y8P B;  3MHB A;  2K5W A;  3SK5 A;  1I4Q A;  2MHV A;  2K6A A;  5C0X I;  1WTQ A;  2A6E C;  4BA2 I;  1QWY A;  2WV6 D;  2O5I C;  4H44 C;  5E1F A;  2K7V A;  2IW3 A;  4X3T A;  3QIA A;  2Z1C A;  2KVM A;  2L12 A;  2NN6 H;  4P2C B;  4HTH A;  3GTP B;  4A93 B;  4KHV A;  1WTO A;  3C46 A;  2D5D A;  3Q6S A;  3NPP A;  1GUO A;  3PIP 3;  1IW7 D;  1LO5 D;  3S15 B;  1LTI D;  1B44 D;  4V0B A;  2VNU D;  2F0E A;  4B08 A;  1JOO A;  1DOK A;  4EVO A;  4A3G B;  4ZLT F;  2HCI A;  1ESF A;  2JA7 B;  4NMZ A;  1TWH B;  4OO1 I;  1LTT D;  2JA6 B;  4OIJ A;  1VF5 C;  1JOR A;  1S5B D;  2L4N A;  3VYT A;  4CJ2 C;  1Q1B A;  1W6J A;  4HAE A;  5I2Y A;  1RKN A;  3FDT A;  1E0B A;  2A5H A;  4DGZ A;  2V4D A;  4DU9 A;  2F0M A;  4JK1 C;  5J22 A;  3EFX D;  2F0O A;  2KED A;  2LMC B;  1SYG A;  1B4O A;  1SE2 A;  2PW5 A;  4RKB A;  1L0Y B;  2R3Z A;  3K57 A;  1ZYR C;  1CT1 D;  4G7H C;  4WFN 3;  4DN4 M;  1PYW D;  1HHV A;  1F2Z A;  1PZJ D;  1Z7T A;  2B39 A;  3SXH A;  1PFM A;  4RKL A;  2AUK A;  4QUF A;  2R93 B;  2EYL A;  5DAU A;  2OT2 A;  2MUY A;  2RDH A;  3SEB A;  5JOB A;  2BDO A;  1WTR A;  2J4X A;  1WCM B;  3V05 A;  3MA2 B;  1AEX A;  3U9O A;  3BS1 A;  1TWA B;  4WOR A;  4GZY C;  2JXM B;  1FNV A;  3WDN A;  3PUW A;  2EXZ A;  3HOV B;  4A3B B;  1AN8 A;  4HSV A;  4IAL A;  4PMW A;  1SYF A;  1G2T A;  4FXK C;  2VXW A;  1HTL D;  3JAM L;  1TY2 A;  2AQ2 B;  1EU3 A;  4C56 C;  1TKW B;  5CV7 A;  2D62 A;  1STE A;  1A2U A;  4M1U B;  5FLX E;  5C3X A;  2CVR A;  1TS2 A;  1KLG D;  1O7Y A;  2F0G A;  3D3R A;  1DD2 A;  1F9R A;  1MBY A;  1TS4 A;  1EZ8 A;  1JIC A;  5M5Y B;  2YYZ A;  1LAC A;  3K5O A;  4FF2 A;  2DNC A;  1I4G A;  2HDM A;  1K8M A;  4RCN A;  5M3M B;  3RMH A;  5KNB A;  3NQI A;  2KEC A;  4R8N A;  1PDQ A;  3TP7 A;  1W6K A;  4ILW A;  2L1B A;  4OHJ A;  4FXD A;  3K0Y A;  4LK1 C;  2FJ2 A;  3EJI A;  1RTO A;  3OHX C;  1S5D D;  1ESR A;  5FOB B;  1Y1W B;  5CC4 A;  1SEB D;  1YNJ C;  3MAQ A;  5DEH A;  2K5Q A;  2NTS A;  2EY2 A;  1KNE A;  2O2L D;  3JAM E;  1X3P A;  4OIK A;  4BWG B;  2F0N A;  3FPU B;  4IUQ A;  4B9W A;  4E6I A;  2BCO A;  1WTP A;  5FO8 B;  4F7X A;  2OXP A;  2NUC A;  1H9S A;  3OWE B;  4KN4 C;  2NN6 G;  3HOW B;  2YU9 B;  2QDB A;  4X3K A;  2TMP A;  4KY6 A;  2E2J B;  1SAP A;  4PV1 C;  3D4R A;  3QOL A;  3AB9 A;  4DAV A;  2K33 A;  3ND9 A;  1XYI A;  3OSO A;  1LTS D;  4NW2 A;  1EEF D;  1U9R A;  3IL8 A;  1U4M A;  3RLF A;  1PTO H;  1EY4 A;  2QIL A;  2F1M A;  1O7L A;  1HUM A;  1ENF A;  5IOD A;  3E6Z X;  1T5E A;  5C5L A;  2AQ3 B;  2A69 D;  4C1N I;  1TU2 B;  1L0X B;  3SK4 A;  3DMU A;  5CV8 A;  4RGO S;  2JEB I;  3LX0 A;  3PO3 B;  1H9S B;  1CA6 A;  1KNA A;  3RUZ A;  4B9X A;  4FO2 A;  1TWG B;  1STG A;  5C4Z A;  4N9P A;  3NTI A;  1PRT C;  2E2D C;  2ZXP A;  4MN3 A;  3OPO A;  2L55 A;  4K2K A;  4BS9 A;  2R92 B;  1WD0 A;  1V1P A;  1YNN D;  3GV6 A;  3J7A V;  2CW0 C;  2KOL A;  2F3W A;  3A8J E;  1CHQ D;  3DXJ C;  2R61 A;  3A54 A;  1OO9 B;  1AZQ A;  2SDF A;  4ABN A;  2FHT A;  3BG3 A;  3BVZ A;  4NKL A;  1R9T B;  2KEE A;  4MHE A;  5KYL A;  1SND A;  2K05 A;  2A73 B;  1VDZ A;  4IUU A;  1GHJ A;  3HOY B;  1GUT A;  1PRT D;  4K2L A;  1JWM D;  4DNT B;  3L9A X;  1H9K A;  2Z4H A;  3GTG B;  1SXT A;  2X6L A;  5IGE A;  1A3T A;  5EBC A;  2CW0 D;  3OMG A;  4ID6 A;  4BY7 B;  5BN5 A;  2F0K A;  2RSN A;  2RA4 A;  3MC0 B;  3NWT A;  4A3I B;  4I65 A;  1SYB A;  3BVG A;  3PO2 B;  2EYO A;  2RDF A;  1CHP D;  1SYD A;  2EVB A;  1V1O A;  2QCP X;  2EYF A;  1LLR D;  1LTA D;  4CKC A;  2N55 A;  1EY7 A;  3OMC A;  3QB3 A;  4A3J B;  1LV9 A;  1EFI D;  4HMJ A;  4IFD H;  1GXD C;  2K04 A;  2L11 A;  2M9V A;  2B2W A;  5C6A A;  2XRQ D;  4PNY A;  5I9P A;  2PMZ B;  4TRD A;  4FF1 A;  1EOT A;  4K6D A;  2IL8 A;  3T13 A;  2O5J C;  4CHT B;  1SFO B;  1STB A;  3BDO A;  1JR0 D;  1J9O A;  2B63 B;  4DK1 A;  3GD7 A;  1B50 A;  2EY1 A;  3TZU A;  4KKS A;  1B3A A;  5IT9 L;  4L6T B;  1PFB A;  1HA6 A;  3T51 B;  1EQV A;  2KCN A;  1OXU A;  1LT3 D;  2J0T D;  1A15 A;  1QCB D;  3OWF A;  1C8C A;  1Q1E A;  1S5E D;  4CGY B;  1TWF B;  3ND8 A;  5JAV A;  3HRZ C;  1I50 B;  3M4O B;  1SNC A;  2EY5 A;  3I90 A;  4RH6 A;  4DNR B;  1STN A;  5CV9 A;  2EPB A;  4R9W A;  3M4Y A;  5A2Q E;  5AFW A;  4PQX A;  3VYR A;  1HFG A;  1EYD A;  2MJ8 A;  3PIO 3;  3PUY A;  2JA8 B;  4A3E B;  2EOT A;  4ZUJ A;  3I4M B;  3I70 A;  3P75 A;  1SNQ A;  1KTK A;  5C0X H;  3X3M A;  2GA4 B;  3T56 B;  3CKI B;  3D6C A;  3CRL C;  3M3Y B;  4DA2 A;  1K8O A;  3QWN A;  5CYU A;  5I4D A;  3ITP A;  3I91 A;  2QF7 A;  1EY8 A;  1EU4 A;  2EDG A;  1VCI A;  2PYK A;  4OGQ C;  5E3F A;  2B2T A;  5D3D A;  3M85 A;  3KUP A;  2KUM A;  1LT5 D;  4Q0F A;  1O80 A;  2Q8I B;  1JWS D;  2AUJ D;  1Z47 A;  1SE4 A;  3GTQ B;  3DM1 A;  1OXS C;  1IHZ A;  3A7L A;  3P1H A;  3VR4 A;  3R8B A;  4IN3 A;  4OO1 H;  3FKI B;  2A68 D;  1TR5 A;  5COY A;  3QJY A;  4KY5 A;  1B53 A;  5M9O A;  4CJ1 B;  2EYP A;  1XTC D;  4IFD J;  3BZD B;  3KF8 A;  3RZO B;  5COR A;  1F9S A;  3S2D B;  1I6H B;  2E2H B;  4J6H A;  3I4L A;  5G3L D;  4C3J G;  4YIJ A;  4DFA A;  5FO7 B;  3TBI B;  1CTM A;  2ZXO A;  4ODG A;  5EKI A;  1JCK B;  3SVM A;  4BA1 I;  4BY1 B;  3EVQ A;  5ISR A;  5JJZ A;  2F03 A;  3FEW X;  3Q23 A;  3TN2 A;  2ID0 A;  2EYH A;  1ZEQ X;  2H1E A;  3V96 A;  2RVL A;  2F0P A;  3KBG A;  1SYC A;  3NUC A;  3K5M A;  2NYZ D;  2DNE A;  2DY8 A;  3SK6 A;  1SSO A;  1D6E C;  3U9S A;  2K03 A;  5CGK A;  2EJG C;  2PZT A;  1DCZ A;  3DWP A;  3WOF A;  2ICI A;  5LHY 1;  4HMI A;  4HED A;  3SR1 A;  3MEH A;  3DWQ A;  1MD2 D;  1BF4 A;  4K5W A;  1D5X C;  2M2L A;  1V43 A;  1JE4 A;  1F9Q A;  2IJ0 A;  2L0C A;  1LAB A;  2NZ1 D;  5LL6 X;  4DAP A;  2CQA A;  3KK7 A;  1HA5 A;  1QOH A;  4XQJ A;  1BUV T;  4NDX A;  5C4J B;  2XNA C;  2ZT9 C;  1EY6 A;  4ZK9 B;  1UNS A;  4KJO A;  2AWN A;  3HKZ B;  1G2S A;  1GUW A;  2PZU A;  4Z9C B;  2NBF A;  2MP1 A;  2JSO A;  1DON A;  4IFD G;  4FNF A;  3CRK C;  4FF4 A;  2E76 C;  1PTO B;  3ONA B;  5C0X J;  3A7A B;  5ELD A;  4F87 A;  1RHP A;  1NR2 A;  1KAB A;  4LMQ D;  5DM7 3;  3C1E A;  5K5P A;  2F0W A;  3D4D A;  3I73 A;  1Y1V B;  3G6J B;  1XWE A;  2DN8 A;  2PO4 A;  4I7Z C;  4QCL A;  1QB5 D;  2XSC A;  4ZKC B;  1ICW A;  2X6G A;  4XQQ A;  1VMP A;  5K36 H;  2I46 A;  2NWG A;  1ET6 A;  1D1I A;  5C44 B;  5C5M A;  2MPM A;  2EYJ A;  2K01 A;  5JVH 3;  3NBH A;  4V19 0;  2B2T C;  1SNP A;  2F0T A;  5HGT A;  4EQO A;  3TME A;  1PMR A;  3PV0 A;  3GO5 A;  3J80 L;  5A35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...