5HURA

Crystal structure of staphylococcal nuclease variant delta+phs l25t/i92k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKTMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25T/I92K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5hurA00
3TP7A 1EY0A 2F0LA 1KDBA 3T13A 2PZWA 4B9WA 4ME5A 1AEXA 3ERQA 3NK9A 4ZUIA 4KD4A 4KJNA 4PMBA 5JAVA 4EVOA 3QB3A 1EQVA 4K14A 5KEEA 1RKNA 5HURA 4KD3A 3VA5A 3TMEA 1EY5A 5HGTA 3P75A 2F0PA 2F0KA 2F0IA 4EQOA 4QB4A 5IGCA 1SYFA 3TP6A 1JOKA 1EY8A 2SOBA 3D8GA 2OEOA 1A3UA 4DFAA 4F7XA 3EJIA 4KY7A 5IGDA 1EY6A 5IGBA 4HMIA 4IALA 3RUZA 4B9XA 5KGUA 5C6AA 4F8MA 1JOOA 1SNPA 4IZ8A 2PW5A 5F2DA 4G57A 1EZ8A 5CR3A 2EYHA 4ID6A 2KQ3A 5CV6A 4OL7A 4N9PA 5CV8A 5C3XA 2EYFA 2F0HA 4PNYA 4WORA 2F0GA 1A3VA 1TT2A 2HQEA 3C1EA 1IHZA 3U9OA 5NUCA 5I9PA 2PW7A 2PZUA 1STBA 4ZQ3A 2EXZA 1TR5A 1JORA 2OF1A 2RDFA 1STHA 3MVVA 4H7BA 4R8NA 1SYDA 1KAAA 3TP8A 2EY5A 2KHSA 2PQEA 4HMJA 5EGTA 5JOBA 2F3WA 5IGFA 1STNA 3NUCA 4YIJA 4K8JA 4KY6A 1SYCA 3SR1A 5KYIA 5C4ZA 2F0MA 3E5SA 2LKVA 2SNSA 2F0TA 3C1FA 5C4HA 1EY7A 5EKKA 1TQOA 4KHVA 5CC4A 1NUCA 1EY9A 3NP8A 5E1FA 5I6YA 3D6CA 2EYPA 3EROA 3D4DA 3OSOA 1SYGA 1SNOA 3OMCA 4KTAA 5E3FA 1SNCA 1ENCA 5IGGA 2F0EA 4TRDA 2F0DA 2WACA 3DHQA 4RKBA 4NDXA 2M00A 1EYCA 2F0NA 5CV7A 5IGEA 4K5XA 4RKLA 2EYOA 2O4XA 5EKLA 5J1ZA 1STGA 4K8IA 1A2UA 3V2TA 2F0UA 2F0FA 3PMFA 4K5VA 1SNDA 2F0WA 4NMZA 2ENBA 3P1HA 4WRDA 1SNQA 3MHBA 4N9TA 3SHLA 2EY2A 3SXHA 4EQPA 2EYLA 1ENAA 4QMGA 3MXPA 2SNMA 4S3SA 3OWFA 4NP5A 4ODGA 3R3OA 4K5WA 5DAUA 5DEHA 1EZ6A 3TP5A 4KY5A 4KJOA 5CV4A 2F0QA 1A2TA 1KDAA 2EYJA 5KIXA 5I9OA 4ZUJA 5IOCA 3SK6A 3NHHA 1NSNS 3EVQA 3OMGA 4E6IA 1KABA 5KRUA 2EY1A 5C5MA 5IIFA 3NXWA 4QF4A 5KYLA 2EY6A 1KDCA 5I6WA 4MIUA 1F2YA 3MZ5A 2PZTA 1F2MA 2RBMA 3S9WA 1STYA 1SYBA 4LAAA 5CV5A 2NUCA 2F0JA 3T16A 4K6DA 5IODA 3DMUA 3HEJA 5C3WA 1EY4A 5C5LA 3D4WA 5CGKA 2F0OA 4NKLA 2PYKA 5K5PA 4K2KA 3QOJA 4PMCA 2F0SA 1JOQA 1EYDA 1II3A 4KV6A 4DGZA 2OXPA 3BDLA 3QOLA 4DF7A 4K2LA 1STAA 3SK5A 3NQTA 1A3TA 1U9RA 1F2ZA 4I65A 4DU9A 5J22A 2F0VA 3HZXA 4EQNA 5J39A 1EYAA 4J6HA 5M9OA 2F3VA 4J1MA 1SNMA 2QDBA 3BDCA 5CV9A 3SK8A 4HTHA 3SK4A 3ITPA 4IUNA 2EYMA 3H6MA 5ISRA 3MEHA 1SYEA 2RKSA 3LX0A
chains in the Genus database with same CATH superfamily
1T5XD 3TP7A 4JI8L 3SEBA 2A68C 3DUZA 1VF7A 5I2YA 5G3LD 2MFIA 1TKWB 1YNND 4EVOA 1HA6A 5C44B 4QQBX 1QJOA 1PRTC 2N55A 3IKJA 1EY5A 4RH6A 5IGCA 1KC8C 5C3EB 3GO5A 3T53B 2DJGC 1X54A 4GNXA 5C6AA 3UE1A 1PH9A 1GUNA 4AQYL 1BBUA 1SNPA 4IZ8A 1SROA 1N36Q 4DR7Q 5FK9C 3PF4A 2LY7A 4WORA 2F0GA 4LF5Q 2JA7G 5FO9B 1TR5A 3MVVA 4JI1Q 4R8NA 1VS0A 5AFWA 4RGTA 4TVAB 1PH1A 1Z6HA 4KY6A 3ULLA 1BCPF 1QNUA 4QIWE 5CBEE 5CC4A 4AH6A 1PTOF 1PTOB 2EQSA 2K04A 3TQYA 2QEJC 4JI1L 3CQZH 4RKBA 4MNOA 1KQSA 3U9SA 1EWIA 4WJ4A 1X3EA 1PH2A 4JK1C 3NBHB 3TREA 4LUOA 1C48A 5HY6A 1N36L 2EY2A 1SDFA 1CHPD 1QVCA 1Y1VH 2SNMA 2YTXA 5I4DA 1QZHA 3R3OA 3I4LA 4DV4Q 2ASBA 4DUYQ 2CKZB 3VR4A 3HKZG 1HRJA 5FOBB 1A2TA 2OTJA 5KIXA 4JPBW 4KKUA 5I9OA 4A3BH 4LUVA 1YNNC 1MKHA 1F2MA 4BY7H 4JI0L 4GKKQ 2NUCA 2J4XA 4KKTA 3TN2A 4ZRZA 1PVOA 4GKJQ 2KHIA 3P7JA 5AJ3L 3PGZA 2JA7H 4C3IH 2ZT9C 4IFDI 1I50B 2V1CC 4KV6A 1C0AA 3M3YH 3GV3A 3OYYA 3VYRA 3ER0A 2MGSA 4JV5Q 4LWCA 1TWAB 2H5XA 5FLXc 4DV4L 4DV1L 1AH9A 4IQZA 1Z9FA 3BDCA 3Q8DA 2SDFA 1YVCA 4ALPA 4HIOA 5M3MH 1NBWA 2DGYA 1PTOC 4G4KA 1EY0A 2HIXA 4DAYB 3HOVB 1IKMA 1I3QB 4L8JA 3CPWA 1HPCA 1ICFB 2K05A 2RDGA 3CPFA 1W6KA 2WV6D 2IHFA 2YTYA 1LTAD 3T1YQ 1A3UA 1D5XC 3TZUA 4IFDJ 1ASYA 4L5SA 4RGMA 4PNYA 2R6GA 4RHRA 3SGIA 5I9PA 4RGNA 2HCIA 3G7LA 1AE3A 4JI3L 1IL8A 4HN7A 1R4QB 1Y1WB 4AQYQ 1UNSA 5KYIA 3E5SA 2CWPA 3KDFB 1CQVA 3N52A 3C1FA 2A8VA 2ZM6Q 5BN3A 3M4OH 2B2TA 2GVBA 3D6CA 5A35A 3OSOA 3VR2A 1XMOL 1XPUA 3SDZA 3OMCA 4KTAA 1I4GA 3P20A 4DA2A 1WTRA 4TRDA 2WACA 4BBSH 2B29A 1ONLA 1EIHA 3AFQA 5TSSA 1LTID 2QEXA 4WJ3M 1EIFA 3V2TA 3PMFA 3U4ZA 1HNXQ 4ZAIA 4B3MQ 1HUMA 4F87A 2HDMA 1LYLA 3KLRA 1A63A 3TEHB 3BS1A 3QIAA 2E2IH 1I6HB 2JYOA 4KJOA 1G291 2JA6G 4IFDH 2RCNA 1C8CA 3LWUA 3S1MH 2JJQA 4PZ8A 5DM73 3PO2B 1OXVA 4KK7A 4R4OA 2VW9A 3KYHC 1BQQT 1STYA 4A3GB 1B44D 3T16A 4HJ7A 1E1OA 1BBXC 1JB3A 3S15B 1I50H 3RZOB 5CBAE 2XTIA 2MJ8A 1Q12A 2NZHA 1VQPA 4GKJL 4JI4Q 3UI2A 3PCOB 2JEAI 2QF7A 1A3TA 2B2WA 2NN6H 2J7ZA 1E24A 3HZXA 3RD4A 1ZYRC 1BUVT 2I5LX 5G3LF 2F3VA 1S5ED 4M8AA 5M5XH 3HOWB 3M4QA 2VQFL 4LK1C 5E4WC 4A3IG 1YITA 1JJ2A 2YU9H 4OEMB 4P74A 2IX3A 1VQIA 2PNRC 2K01A 1BCPC 3W2DA 1AEXA 1V8QA 1WCMH 1FNWA 2V4DA 3DM3A 1AW7A 4GNXB 4JC0A 2AHOB 2RA4A 4BA2I 1KL9A 1JB7A 3M4PA 1HNZQ 1DXMA 3TP6A 5FLXL 3NBIA 4KY7A 2VUMH 4RWSC 3KBGA 1PFSA 2F0HA 1CZGA 4R4TA 3WOEA 1BOSA 3J81c 1EL0A 2MP1A 1TWAH 1SJHD 4H7BA 5FJ8G 1WTVA 1AZPA 4BBSG 1JR0D 5IP7H 3HKSA 5JEAG 1PHJA 4HJ8A 1TY0A 5JVH3 1VQ5A 1ZEQX 1EY7A 1TQOA 1FGBD 3I4MB 2IT1A 2KHJA 2IW3A 1G2SA 4YCWA 2I5MX 2VNUD 5M5YH 2HUGA 1JWUD 3G6EA 3X3MA 4IPDA 3RLNA 1A2UA 2Q2HA 5EQ0A 1K8MA 2F0WA 2RVLA 1HR0L 1NR2A 1E2VA 3UE0A 4A3KH 3H0GB 2G9DA 2RSOA 1CA5A 1ILPA 5DAUA 5C3EH 1GD7A 2A68D 3ZJYC 2JA6H 4R4IA 1U0LA 4Q0FA 5KNBA 2A73B 3MAQA 2IX1A 1TY2A 2NZOA 1GXDC 4MIUA 2Z9HA 3R2TA 1HTPA 4IUQA 1Y14B 3S9WA 3JAML 1AE2A 1YNJD 4TSSA 1HUNA 1EIGA 4IURA 2KBNA 4CGYB 2UXCL 5C3WA 4CDFC 3VYTA 5FKAC 3QOJA 3J81E 4RG1A 4XXEA 3UDGA 1P8LA 3QO2A 2NN6G 2ZJQA 1VQFA 2GVAA 1RJTA 3DEPA 2D0OA 4I7AA 1Y8OB 4DNIA 4DV2L 5J39A 1EYAA 1VQBA 2NYZD 4R9WA 1PZKD 2D9UA 4X3SA 3FEWX 4A3IH 1RL2A 4J15A 2K03A 3H6MA 4DR4Q 3S2DB 4X66Q 1LTGD 2I07B 1CUKA 2CQOA 4OO1I 1XTCD 3K0XA 3MFYA 2UU9L 2JP1A 3FKIH 2KEDA 4GNXC 2NVXH 2L55A 5M3FG 4JBMA 1E3PA 1BCPD 4GLAC 1Y1VG 1I6VC 1XX8A 2A69D 2F0PA 2HHHL 3D8GA 4F7XA 3I73A 5M3FB 2NVYH 1JJGA 2G5DA 1MIUA 1EU4A 3RUZA 2EOTA 5BR8Q 4HIMA 1XMOQ 3K81C 4EQPA 3EN2A 3CF5A 3J7AV 4BY7B 2KUMA 3CP0A 1ZYRD 2L15A 4A3EB 5IT9c 3KJPA 3AFPA 3I7FA 1K8GA 5JEAH 1MI2A 1RIPA 4LF4Q 2KECA 4JW0A 5HGQA 1JJCB 2F4VL 1NR4A 1O80A 2TSSA 1SNOA 1XMQQ 5IT9E 3CC4A 4BY1B 3KF6A 3GTKH 4FXDA 5IGGA 1F9PA 2KEEA 4FXKC 3CMAA 4QY7A 1SE4A 1XNQL 1EWCA 2Z6KC 2XN9C 3MHBA 5EPJA 3HOXB 1PYSB 4DV3Q 2Z4IA 4C3IG 2EYJA 3M4YA 5IOCA 5C3EG 1QOHA 1CSPA 3KF8A 3DWQA 4O42A 1BF4A 2Z1CA 3T51B 2KCNA 4XDXA 2N88A 1XPRA 3Q22A 4C1NI 2B2VA 4JCVE 3GTLH 3T1HQ 2WAQG 3VYSA 3WDNA 3GTPH 1C4QA 3MTSA 5IYCH 1FD7D 5EPLA 4C3JB 1U4MA 4JI8Q 5JEAJ 5M3MG 1MSHA 4PV1C 2JQOA 1F77A 1VQHA 5T1GA 5EPKA 4KHPQ 2DN8A 2F0VA 4EQNA 1SE8A 2B2VC 3HOVH 4HCEA 2A5HA 2VB2X 1Q8IA 2QDBA 2X6LA 2EYMA 5LL6S 4IFDG 3CCEA 3T4AC 2K75A 1LLRD 4A3GH 2H4OA 1Q1EA 1T9HA 4PQXA 2CW0C 2JA5H 1MD2D 1KLGD 1C9OA 1I4HA 4HIDA 5KEEA 1N34L 3PUVA 3K7UC 4A3FG 1LTTD 2R92G 4QB4A 1WVLA 4P71A 4GN5A 3FVQA 1MHWC 2IL8A 4JG2A 3PO3H 3IAYA 2EVBA 4DAPA 4IO9A 3HOWH 1LACA 3ERSX 2EXDA 4EX5A 1V1QA 2JK8A 1WTXA 3K5NA 3GTGB 1VMCA 5EBCA 2PW7A 2LS01 3FPPA 3SVMA 4B3TL 3STBC 2PPBC 3OPOA 4A3MB 4TQUS 1YNJC 4A3IB 1CA6A 1HZ9A 4XT1B 3NWTA 2LKVA 1T5EA 2XVSA 2R3ZA 2EDGA 5E3FA 1JCKB 3E0JA 2KCTA 5IGEA 1HR0W 5IT9L 2D0PA 4OO1H 2CQAA 1ENFA 2H1EA 1K0SA 4JI3Q 4NMZA 2Z8LA 1PV4A 1G8ZD 3OWFA 4LF6L 4HSVA 4ODGA 3H3VI 5A2QL 2R93G 5LMNL 3OMGA 1D5MC 1SN8A 4DAMA 4QF4A 1U4LA 4X62L 1KTKA 2WIIB 4LFCL 5M5YB 1F9SA 4A3JB 2R7ZH 5C5LA 3KJOA 3RR5A 4X62Q 4NKLA 3HOZG 3QWNA 3E6ZX 3BDOA 3CAMA 1ZXTA 5FLMH 1W6JA 1B9NA 1I4QA 3L2PA 4FVMA 3HRZC 2MO0A 1B9MA 1GHKA 4J1MA 4LF6Q 1EOVA 1I94Q 3MFGA 3NTIA 3J80E 2XSCA 3GDEA 3MA2B 1TWCH 4H44C 3AYHB 1Q3LA 3F8TA 3S17H 1Q81C 2FMMA 4KD4A 4KJNA 1G6PA 4B08A 5LMUL 1AP0A 3I3CA 1Y1WH 1Q86C 3FRPB 4BY7G 3AMUA 3M7NA 3V05A 2HQLA 3FHWA 1CSQA 2KJXA 3J7YW 1CHQD 4YY3L 1YZ6A 1GUGA 5D3IB 2LXJA 1E1TA 4C3JH 3TS2A 3LNNA 2L12A 1NJIC 5C3XA 4ME3A 3PIP3 3K58A 3EQLC 4CJ0B 1YEZA 1ZKOA 2HQEA 2VZAA 1NAPA 1YHQA 4OIJA 5NUCA 2JA8H 4ZQ3A 1STBA 3TP8A 4A3CG 1FNUA 1Y8PB 1Q7YC 2OT2A 3GTQB 4YIJA 4A3DB 3SR1A 1SYCA 1DOKA 2QKIC 2FXQA 1E2WA 1GUOA 5E1FA 3HOYH 4Y7NB 4DK0A 3PF5A 1LT6D 3OW7A 1H9SA 1YJ9A 4LFAL 1WI5A 1V43A 3F2UA 4KN4C 3E9HA 4DNRB 4NXML 4C56C 4KN7C 1IYJB 2EPBA 2ZJPA 1SNDA 1VQ9A 1CKNA 3HP3A 4C3HH 1IBLQ 1LTRD 3D4RA 3U50C 1O7IA 2WFWA 4YWMA 2Z6BA 2ZTDA 4K5WA 1TWFB 4DR7L 3CRLC 1XYIA 1K8OA 5EJWA 5M3FH 2B63G 3A5UA 3C46A 1BVSA 1JMCA 4E6IA 1EQQA 5C5MA 3K59A 3PV0A 3KDFA 1OTCA 1PLFA 4AYBB 1B50A 1S40A 1HH2P 1SYBA 1YBYA 1IKLA 3UDIA 1EY4A 4KI0A 4DN4M 4AYBE 2A19A 2UXDQ 1HFNA 4ZKBB 1SMXA 2JN4A 4FP5D 1FJGQ 4I7ZC 3NTHA 1BCPB 2KCCA 4OX9L 4XTCS 2YTVA 3FKIB 5J3BA 2UUBQ 4MN3A 4FYDA 4HTHA 4H13C 4JI5L 2Q2UA 5KNCA 2PO4A 1QE6A 1TWCB 3TRZA 2BOSA 2NBFA 4A3JG 5KRUA 1MSGA 2K5HA 1I5FA 2UXDL 3K7AH 3ONAB 4HEDA 3T56B 4RCOA 2CWAA 4JYAQ 1TVXA 3DM1A 3M9BA 5LMNQ 2NTTA 1A6XA 3VA5A 4C3HG 2F0IA 2E5LL 5IYDG 2R93B 3D3RA 2B3GA 2K32A 5IE8A 1EY6A 1DONA 1EWHA 1F9RA 3I70A 1K3BC 1NMGA 4G57A 2XIWA 3L7ZC 2EYFA 2E2JH 1HJPA 2Z4HA 1IHZA 1PYWD 1NNXA 5ELBA 4IUPA 1VQAA 3CRKC 1SSOA 1TXYA 1TS3A 2Q8TA 2OCEA 3A0JA 2N49A 5JJZA 3QJYA 4JI7L 4Y52H 1VQ4A 2QA4A 1L1OA 1WCMG 2HHHQ 3VR5A 3TZDA 3NP8A 3STBD 3A55A 3GTLB 1IW7C 2D2CC 3EROA 4P75A 5CMDA 3F2BA 4LUZA 1Y69U 2RHQB 4B3TQ 2M00A 3KK7A 2ALYB 4RKLA 2EYOA 3I90A 1TWHB 4MTNA 2FFKB 3ULPA 1EQTA 1L0XB 1QUQB 1X56A 4A3GG 4DR2L 2UXBL 4X65L 2EYLA 1ENAA 1QWYA 4CKCA 1EZ6A 2E8GA 1XNRQ 1HNZL 5FJ8H 4JV5L 4G7HC 3CCQA 2C35B 4JI5Q 4WJWA 3L9AX 3L3OC 4XYQA 3CD6A 3UDXA 5C0XJ 2Q2TA 5EAYA 4L6TB 2KOLA 4EGVA 3MXUA 2I0QA 2UXCQ 4RAUC 1TWGB 5IODA 4R4CA 3PUYA 2Q8RE 1KXLA 1S5DD 2IX0A 4PMCA 2DUDA 3HOUH 3QOLA 5DNFA 1KRTA 3S24A 5JJIA 3SK5A 3TBIB 1CQFA 2M2LA 5JVG3 3GTOH 2L4NA 1O7YA 4BS9A 2JA5B 1PTOH 1SNMA 1QCBD 3SK8A 1WJJA 1OXSC 3S16B 3K5OA 2YU9B 5IGBA 1N32L 2C5CA 2BA1A 1KDBA 3OHXC 1K83H 1ASZA 1KNEA 4A3JH 3VA7A 3GTJB 3NK9A 3URYA 1EQVA 2VL6A 1RKNA 5HURA 2LMCB 4KD3A 1ESRA 4LFCQ 5HGTA 1K8AC 1QG7A 2BDNA 5FO7B 1HZCA 4X64Q 4IPHA 2OQ0A 4OONA 4U68A 1K73C 1SFOB 5IYDH 4HMIA 1FGUA 3Q6SA 2E76C 4BBRH 4IUTA 1P16A 5CR3A 2DNCA 4ID6A 3V96A 1FL0A 4G7OC 1MGSA 2Y0SG 4XT3B 3O13A 4TKOB 2PZUA 4X65Q 1JE4A 1H9JA 2EXZA 4UHVA 3WWVA 4U673 4BY1G 1DJRD 2B2WC 2K50A 3LGJA 4DUZL 1D2BA 3Q24A 1X6OA 1KLUD 1DYQA 2IWHA 4KHVA 2VQEL 1FNVA 4GZYC 3GP7A 1E2ZA 3DLLA 1SYGA 4X3TA 2WB1G 4ZCKA 1HA5A 4DV7L 5GQOA 3SE0A 2R93H 4LF8Q 5C0XH 3J80L 2JA8B 4QGUA 2HCCA 1N33L 1LTSD 3ND8A 3W5OA 2K1BA 2VB3X 1F9QA 5ELDA 1RDPD 2AWNA 2B2UA 3T1YL 1GJXA 2BA0A 3A54A 4FF4A 4LFBQ 3OTOQ 2A74C 3NHHA 1R9TH 3HGBA 4L5RC 4OXPA 5I6WA 4A3KG 2PZTA 3X3NA 1XTDA 1IBML 1UUPA 4M1UB 5C4JH 2KA7A 1X65A 4AIMA 1LT5D 3BZKA 4DV1Q 3BDLA 4EQ5A 5IP9H 3KOJA 1PH8A 4A3EH 3NBHA 1JQYD 2WINB 4H0LC 3RZDB 1V1PB 4POGA 1QB5D 4UY8C 2B63B 1SR3A 1SLJA 1Y1WG 5BN5A 4HIKA 2A6EC 1GHJA 3D31A 3I72A 4GOPA 3JAMc 4A3FB 2XGTA 4K0KL 4JI0Q 3R93A 1VQ6A 1B3QA 4BXXG 2PZWA 4JI2Q 1R4PB 1G2TA 3GTOB 2AQ1B 1HR0Q 4A3MH 1D8LA 3F2DA 2QILA 5JPMC 2XWBB 1EYGA 2AKWB 2SOBA 1M90C 1WCMB 5C4XG 1K83B 4BBRB 3JAME 4HJAA 3F2CA 5KGUA 3GTJH 2PQAB 3N6RA 1HXYD 1GUSA 1EZ8A 2UUAQ 2UUCL 3J7AF 3J81i 2AQ3B 1X3GA 1EUJA 4CBVA 2PQEA 1H9RA 4F88A 2OQKA 1ESFA 1X32A 1EOTA 1Z7TA 4O0AA 4NXMQ 1PH4A 1CK1A 1X3FA 3KF6B 2PCFB 1LV9A 5C4ZA 4OIKA 5FO8B 3H94A 3K5LA 1RTOA 4OGQC 2Q8IB 4PG3A 3GTPB 1YJNA 3S1QB 2MPMA 2K5QA 4C3HB 1DGSA 1M1KC 2ICIA 3H09A 2E2HH 3TSSA 2CCZA 1STGA 4K8IA 4H02A 1WTQA 1J6QA 3CKIB 3A5ZB 3TP5A 1RODA 1A8VA 2F0QA 1KDAA 4RGOS 1K28A 4RA8A 3CCMA 1BXTA 3A74A 1SMYC 1H95A 4K0KQ 2F0JA 1PA6A 4N8X1 4GKKL 1KHIA 1SXTA 3HEJA 2B8GA 2IJ0A 5C4JB 3RN5A 2GN5A 2UU9Q 2F0OA 5K5PA 4X3UA 4IJHA 3T1HL 1PMRA 2VS1A 3RLOA 3G71A 4A3EG 1SJED 2X6GA 3GV6A 2B8FA 4I65A 1SE3A 1ET6A 2CVRA 3PO2G 5K36H 4JI4L 1SAPA 1I94L 1U5KA 2UXBQ 2YYZA 5IYCG 3QR8A 1VQJA 1IZ6A 4GN3B 3VDYA 2A6HC 2F0LA 3I91A 2JA7B 5LMNW 2A6HD 5I2XA 1SE2A 4V0BA 4HJ9A 4BXXH 4QUFA 4PMBA 3M7GA 1S5FD 4FXGC 5C4XH 3HKZE 1F2LA 1HTLD 2JA6B 4KKSA 5L37A 3HOUG 4GOPC 2PW5A 5CV6A 2KQ3A 3IFDA 5M3MB 2F4VQ 1A3VA 3PUWA 4JBWA 4LF4L 4LF8L 4DR5Q 3Q0AA 2WAQE 1SYDA 1E7ZA 2F3WA 5A2QE 2NVTH 1STNA 1UE7A 2LXKA 1DOMA 4K8JA 3GTKB 4DR5L 2CH4W 1B3AA 2F0MA 1H9KA 1J5EL 4APVA 2DNEA 1VQMA 1BNZA 4C3IB 1CKMA 3ICEA 1RF2D 5COYA 4CDEC 4Z9CB 2IHEA 2E2HB 2ICEC 3FDTA 2FJ2A 4FDBA 4A93G 3S2HB 2B2YA 4UP7A 4IOCA 3BZDB 1I4XA 3HOVG 3EFXD 1NE3A 2IPKD 2QDLA 3H3VC 1IBKQ 2F4IA 4J8QA 5DEHA 1HQMC 1UE6A 5CV4A 4RMFA 4A3BG 3BYYB 4IPGA 3NQIA 1PTOD 1KABA 1LM0A 1EIYB 5M5XB 4RFBA 4GLVB 3NENA 3KUPA 4XIGS 2AUKA 3MZ5A 4DV6Q 4MTKA 3OOCA 1YNXA 3I4OA 4A3DG 2KCMA 3S1QH 3HOYG 4RCNA 1V1PA 3I4MH 5IYBG 1H9SB 1FR3A 2EJGC 3S16H 1G91A 2B2TC 1B4OA 4ULLA 3S1NH 1S3OA 1HNWQ 5J22A 1Q82C 1S4ZA 5LL6X 1CKNB 2VQFQ 4WFN3 4KLKA 1JE5A 4PMWA 5C0XI 1KAWA 4NW2A 1PRTD 1TS2A 1PRTB 3HKZB 3MC0B 5AJ3Q 1LT3D 3H0GH 2CHBD 1WD1A 4LF9L 3HOXG 3T13A 2G9HD 4XYOA 4B9WA 3PUXA 1KIXA 1H9MA 3CCVA 1CFMA 1HHVA 4YHHL 2WB1B 2PQAA 3TMEA 1QNKA 1DCZA 4DUYL 4X3KA 4DFAA 1X3PA 1L1OC 3UDFA 4A76A 4F8MA 3BJUA 3G4SA 2EZVA 3DXJC 5F2DA 1LTBD 2EYHA 4JI6Q 2O5JC 1A0IA 5CV8A 2DY8A 3U58A 4DV3L 2NB0A 1DZ1A 3ZYYX 1OO9B 3C3LA 4JBKA 1LTLA 5CYUA 3HOZH 5ELFA 3TS0A 2EY5A 2KHSA 2NVTB 5JOBA 4DAVA 1N9WA 4AYBG 2HDLA 3I2ZA 4DXGA 3NUCA 1JC7A 4CDCC 1C7YA 3BYTB 2MUYA 2ZTCA 2F52A 1CI3M 1XMQL 2UUAL 1NUCA 2FHTA 3D4DA 1BR9A 1ET9A 5LHY1 1YIJA 1PH6A 2F0DA 3CXCA 3I4NB 1BKBA 4K5XA 4LF5L 5J1ZA 1Q46A 5C44G 1WD0A 1WTOA 4K5VA 4A75A 2RCFA 2RF4A 3K6OA 5ELNA 4JI2L 1CT1D 1PH3A 4IJLA 3NWSA 3I4MG 5JPNC 2D5DA 2L5TA 2E74C 3D6WA 2DY7A 4L5QA 3F1ZA 4LF7Q 1X3QA 2DJFC 1MBYA 3W3AA 3M3YB 2B2YC 3VR6A 4CHTB 2EE1A 4DV0Q 1SRUA 2L11A 2QW7A 3DMUA 2VUMB 4DK1A 3KLSX 3KLWA 4B3SL 2B63H 3A56A 4DKAC 1TS4A 1JICA 3BU2A 1LT4D 3TDQA 3I55A 4DGZA 2OXPA 1PFNA 3FPUB 1QZGA 2C9OA 1U9RA 3EA6A 4DV6L 3S2HH 1HCZA 5ELOA 2VY3A 4O1NA 1UWVA 1PZID 1W2BA 5CV9A 3M4OB 3CCRA 1M4VA 2SEBD 5GADC 1HZAA 1J8IA 4UPAA 4LFBL 3HOXH 2AWOA 2PMZE 1CTMA 2XNAC 3H0GG 3R2IA 1NMFA 4LJZC 2QGQA 3QB3A 4K14A 1N33Q 2R92H 3GTMH 4DNTB 3G6JB 2B2UC 3CCJA 3K0YA 1I6HH 4LF7L 3J7A5 4IALA 2FINB 5CORA 5IP7G 3PO3G 4DR1L 2E2DC 4N9PA 3K8AA 1VQOA 3E3XA 2M9VA 1TT2A 3C1EA 1KRSA 3EBEA 3U9OA 1O7LA 1JORA 2OF1A 1L1OB 2WAQB 5GROA 1IXRA 1VQDA 3RZOH 2E2IB 3DWPA 3QG1A 4C1NK 2BH2A 3J80i 2F0TA 1L2FA 1VQKA 5EKIA 5I6YA 1AFPA 5E4XA 3PO2H 1PXUA 4JYAL 1D1KA 3CMEA 5C44H 3W1GA 3DHQA 3HFZB 5EKLA 2O4XA 3BG3A 4IPCA 3JC66 1WTWA 3HOYB 1GUWA 2R61A 4OO1G 3OWEB 4L63B 3P1HA 3S1MB 2RHSB 3PIO3 3S2DH 4QMGA 1YHBA 4XQJA 4HJ5A 4X64L 4DPGA 1LO5D 3S14B 1QVGA 3J81j 1RTNA 4A3BB 3NXWA 4UP9A 1VQGA 2Y0SE 3GD7A 4XQNA 4FF2A 1WYDA 4YHHQ 2XWJB 3R8BA 2NVYB 5KNDA 1GKHA 5GAGC 2K5VA 4A93B 5FLMG 2JSOA 1EYDA 4LF9Q 4CJ2C 1K0RA 4P72A 4CJ1B 1YI2A 3RMHA 1RHPA 1F2ZA 5DM63 1EU3A 3NPPA 1VMPA 4J6HA 4QIWB 1V9PA 4Y7NH 2O5IC 2A69C 2VXWA 2ATWA 2NN6I 1Y1VB 5JJLA 1XNRL 4UP8A 1GOZA 2FMCA 1L0YB 4LFAQ 4ZUIA 4DR2Q 1EQRA 3MXGA 5ELCA 3J81L 3S1NB 3EIVA 1EY8A 1FYCA 2D62A 2EIFA 4B9XA 2ZTEA 4A3LH 1JOOA 3VYUA 1QVFA 2J0TD 3E0EA 4JI7Q 5GAEC 4N8FA 2R7ZG 4ZK9B 2JA8G 1B8AA 4HMJA 5EGTA 2L9HA 2K28A 4MZ9A 1S5BD 2AUJD 1SEBD 2OWOA 2PI2E 4NB3A 4DR3Q 1GO3E 3RLFA 3A8JE 3DWAA 2WP8J 3HS0C 1CM9A 3PUZA 2VQEQ 1ENCA 2F0EA 2I46A 1I4PA 2EJMA 2K7VA 3BVMA 3RZDH 1TU2B 2E2JB 4ZKCB 3FMCA 2BH8A 2E75C 4X66L 2L0CA 4P2CB 2Y0SB 4S3SA 1XXGA 1HFGA 5D14A 2E5LQ 1DM0B 1S5CD 4HSPA 1NY4A 2Z6KA 2PNHA 2K52A 2LFNA 5IYBH 1TWGH 1K3RA 3EVQA 1VQ7A 1R9TB 1A62A 1WFQA 3CW2C 5KYLA 2CW0D 5FLXE 4X6AH 2KENA 3HOZB 3I4NH 3J80c 4K6DA 3NTKA 5M5WB 1PDQA 2RSNA 1BO0A 1CZWA 3MWYW 2CH4A 3KLSA 3PSIA 4K2KA 2JEBI 1U4PA 1E22A 1II3A 4DF7A 1STEA 4GOPB 4KHPL 3NSWA 4IUVA 4QUCA 1NCVA 1VF5C 5M9OA 1KNAA 1A15A 1G51A 5D65A 4LNQA 4A3FH 2WB1E 4BY1H 4DR6L 3PQIA 3BVZA 3MEHA 1JT8A 1OXXK 2RQXA 3NEMA 3CCSA 1J9OA 3RNUA 2R7ZB 4QJFA 4IOAA 2MNAA 3K80C 4A3LG 4QCLA 2KVMA 2X69A 4JOIC 3CC2A 2Q2IA 2BCOA 2F1MA 4EQOA 4NXNL 4OWWB 1DOLA 2LSSA 4C2MB 1JOKA 4ILWA 3HOWG 4A93H 4KMUC 1MJCA 2A6ED 3LWEA 2AMCB 2WKDA 3Q23A 1L0WA 5IWAQ 4OL7A 2ZXRA 1UEBA 5IY0A 1VCIA 5K36G 1VQEA 2RDFA 3I4NG 1KAAA 3G48A 2PMZB 1E0BA 1EEID 4HCSA 2SNSA 4B3RL 2O2LD 5C4HA 5E7NA 5IWAL 2YV5A 4IN3A 4ZLTF 2EYPA 1CKOA 1SNCA 1OXUA 3WOFA 1EYCA 2F0NA 1KD1C 4NXNQ 4YWLA 4Q5VA 2P5ZX 4L5TA 2F0UA 1I4RA 2MO1A 5LMUQ 3FP9A 3GQBA 4PZ7A 4XQQA 2ENBA 1SNQA 4UAIA 1VQ8A 1N8RC 3MXPA 2ES2A 4A3KB 3C2PA 5JJKA 2UUCQ 1N32Q 4KY5A 1XWEA 4OWXB 2ZXPA 3KBXA 1VQLA 1HQRD 4ZUJA 1DD2A 5H1SE 4BBSB 2EY6A 4C3JG 4FF3A 1EFID 1F2YA 2RBMA 4GS3A 2K33A 5CV5A 4LMQD 1TS5A 4PZ6A 4DR6Q 3BZCA 3J7ZC 3K7AB 2NZ1D 1AZQA 2PYKA 2HIVA 2AQ2B 2MQHA 4MHEA 2OTLA 1O78A 2TMPA 5GAHC 1UE1A 1IL2A 1XJVA 3S1RB 4BWGB 1IBKL 1IYVA 2UUBL 1D1IA 3NE5B 2ID0A 1BDOA 1ICWA 1OXTA 2RDHA 1WTPA 3OIPA 5ISRA 1AN8A 1HNXL 4B3ML 2RKSA 1S72A 3LX0A 4R8IA 3S15H 2NWGA 3D0FA 3L0OA 1Q1BA 4LW1A 3PO3B 3NELA 5JAVA 3MXNB 3ND9A 1EFWA 4A4IA 3I56A 4HAEA 1IYUA 1BBWA 5C4XB 2ZM6L 2F0KA 1QILA 2B39A 2OEOA 3EJIA 3H15A 1B1ZA 1O7ZA 3OTOL 4DV5Q 1VQCA 4R4QA 3AQQA 4DR3L 1WOCA 1TWHH 1STHA 4C2MH 3S14H 1GVPA 3B6YA 1ML0D 1V1OA 5BR8L 1TIID 4DV7Q 3GTGH 2WKCA 2XRQD 3MEFA 1UE5A 2F3IA 4DV5L 2JA5G 1D5ZC 1EY9A 1VDZA 4FNFA 3HG9A 2BE5C 5C0XG 4JOIA 5CV7A 3CU7A 4NDXA 2HD3A 4P73A 4DUZQ 2A1AA 3S17B 4JI6L 5EBDA 1ILQA 4WRDA 4N9TA 4UDUC 3SHLA 3HOUB 3KFUA 4NP5A 1YHAA 1EEFD 4FF1A 2EJFC 1LABA 1PZJD 4DV2Q 2K5NA 4BBRG 1VQNA 3CCLA 1HZBA 2ZXOA 1N34Q 1NSNS 4YY3Q 5IIFA 2CFMA 4JBJA 1IW7D 4CDDC 1Y8NB 4OX9Q 2N78A 3U4VA 3D4WA 3KF8B 4CKEA 2L1BA 3AU7A 4HR7B 5IP9G 2NVQB 2N3SA 4NPSA 4K6LA 3NQTA 1D6EC 1SMYD 3JAMi 3S1RH 1HNWL 3OIQA 1W3SA 5T1IA 2BDOA 3SK4A 1B53A 3IL8A 3ITPA 4IUNA 2JE6I 1RCVD 2K14A 1PH5A 2HT1A 3A8KE 3K57A 2IY5B 1IBLL 4ME5A 1Q8KA 3ERQA 2F03A 2K4KA 1PFMA 3OW2A 3H91A 4DK3C 4G7ZC 1XNQQ 4OELB 1XPOA 3I8ZA 1X9NA 3CQZB 3P75A 2N8NA 3A8IE 1K9MC 3BVGA 1SYFA 4DAYA 4OWTB 3E9IA 1TWFH 3K5MA 3AB9A 5IGDA 2QCPX 5ELEA 1QUQA 1Z47A 2MHVA 4A3DH 3A7LA 3A7AB 4B3RQ 4DK6C 2NTSA 3DEOA 3VR3A 1G6ZA 3M85A 2NVXB 5IGFA 3H3VH 3ULJA 1WTHA 1J5EQ 1GM5A 5EKKA 4POFA 1SFOH 3FKIG 4V190 1B7YB 2GA4B 3GTQH 3W1BA 2K5DA 2XRSD 1FVIA 4IUUA 2R7FA 2Z0SA 3CHBD 2K6AA 4RHSA 2I5HA 4GLXA 1D7QA 1JWMD 1U4RA 1PRTF 2F0FA 4A3MG 4DR1Q 1YJWA 3AEVA 4YWKA 1M8AA 2R7DA 4OHJA 1PFBA 1UAPA 3SXHA 2PI2A 3CCUA 1B70B 4JVZA 1UEAB 5M5WH 1NTGA 2K5WA 2JXMB 3PIPA 1RD9D 3CC7A 3SK6A 3RN2A 4KHZA 2EY1A 3GTMB 2R92B 4DXFA 1B2TA 4R1JA 1KDCA 1Q90A 1IBMQ 4LAAA 1JWSD 4ABNA 1LUZA 4BA1I 3PIOA 4DR4L 5CGKA 2JA9A 4QL5A 1JOQA 2F0SA 4B3SQ 2VUMG 4O2DA 4A3CH 4YCUA 1GUTA 5D3DA 4K2LA 4CKBA 1STAA 2BE5D 4DV0L 1SBBB 3IFTA 4DU9A 4YCVA 1I3QH 1X55A 5DLQE 4GN4B 5BN4A 3IRBA 1PH7A 3MXNA 4ZYSA 2NVQH 2ZJRA 1PYBA 1FJGL 1SYEA 4FO2A 1MJEA
chains in the Genus database with same CATH topology
1T5XD 3TP7A 3SEBA 2A68C 3DUZA 1VF7A 5I2YA 5G3LD 1TKWB 1YNND 4EVOA 1HA6A 5C44B 1QJOA 1PRTC 2N55A 3IKJA 1EY5A 4RH6A 5IGCA 5C3EB 3GO5A 3T53B 5C6AA 1GUNA 1SNPA 4IZ8A 5FK9C 2LY7A 4WORA 2F0GA 5FO9B 1TR5A 3MVVA 4R8NA 5AFWA 4RGTA 1Z6HA 4KY6A 1BCPF 1QNUA 5CBEE 5CC4A 1PTOF 1PTOB 2K04A 2QEJC 4RKBA 3U9SA 4JK1C 1C48A 2EY2A 1SDFA 1CHPD 2SNMA 5I4DA 3R3OA 3I4LA 3VR4A 1HRJA 5FOBB 1A2TA 5KIXA 4KKUA 5I9OA 1YNNC 1F2MA 3TN2A 2NUCA 2J4XA 4KKTA 4ZRZA 3P7JA 2ZT9C 4IFDI 1I50B 4KV6A 3GV3A 3VYRA 2MGSA 1TWAB 4IQZA 3BDCA 2SDFA 1PTOC 4G4KA 1EY0A 3HOVB 1IKMA 1I3QB 4L8JA 1HPCA 2K05A 2RDGA 1W6KA 2WV6D 1LTAD 1A3UA 1D5XC 3TZUA 4IFDJ 4RGMA 4PNYA 2R6GA 4RHRA 5I9PA 4RGNA 2HCIA 3G7LA 1IL8A 4HN7A 1R4QB 1Y1WB 1UNSA 5KYIA 3E5SA 1CQVA 3N52A 3C1FA 5BN3A 2B2TA 3D6CA 5A35A 3OSOA 3VR2A 3SDZA 3OMCA 4KTAA 1I4GA 3P20A 4DA2A 1WTRA 4TRDA 2WACA 1ONLA 1EIHA 5TSSA 1LTID 3V2TA 3PMFA 4ZAIA 1HUMA 4F87A 2HDMA 3KLRA 3BS1A 3QIAA 1I6HB 2JYOA 4KJOA 1G291 4IFDH 1C8CA 3LWUA 5DM73 3PO2B 1OXVA 4KK7A 1BQQT 1STYA 4A3GB 1B44D 3T16A 1BBXC 1JB3A 3S15B 3RZOB 5CBAE 2MJ8A 1Q12A 3UI2A 2JEAI 2QF7A 1A3TA 2B2WA 2NN6H 2J7ZA 3HZXA 3RD4A 1ZYRC 1BUVT 5G3LF 2F3VA 1S5ED 4M8AA 3HOWB 4LK1C 5E4WC 2IX3A 2PNRC 2K01A 1BCPC 3W2DA 1AEXA 1V8QA 1FNWA 2V4DA 1AW7A 2RA4A 4BA2I 1DXMA 3TP6A 5FLXL 3NBIA 4KY7A 4RWSC 3KBGA 2F0HA 1CZGA 3WOEA 1BOSA 1EL0A 2MP1A 1SJHD 4H7BA 1WTVA 1AZPA 1JR0D 5JEAG 1TY0A 5JVH3 1ZEQX 1EY7A 1TQOA 1FGBD 3I4MB 2IT1A 2IW3A 1G2SA 2VNUD 2HUGA 1JWUD 3X3MA 1A2UA 5EQ0A 1K8MA 2F0WA 2RVLA 1NR2A 1E2VA 3H0GB 2G9DA 2RSOA 1CA5A 1ILPA 5DAUA 2A68D 2IX1A 4Q0FA 5KNBA 2A73B 3MAQA 1TY2A 1GXDC 4MIUA 3R2TA 1HTPA 4IUQA 3S9WA 3JAML 1YNJD 4TSSA 1HUNA 1EIGA 4IURA 4CGYB 5C3WA 3VYTA 5FKAC 3QOJA 3J81E 4XXEA 3QO2A 2NN6G 1RJTA 3DEPA 1Y8OB 5J39A 1EYAA 2NYZD 4R9WA 1PZKD 2D9UA 4X3SA 3FEWX 2K03A 3H6MA 3S2DB 1LTGD 2I07B 4OO1I 1XTCD 3MFYA 2JP1A 2KEDA 2L55A 1BCPD 1I6VC 1XX8A 2A69D 2F0PA 3D8GA 4F7XA 3I73A 5M3FB 1EU4A 3RUZA 2EOTA 4EQPA 3J7AV 4BY7B 2KUMA 1ZYRD 4A3EB 5JEAH 1MI2A 2KECA 1NR4A 1O80A 2TSSA 1SNOA 5IT9E 4BY1B 4FXDA 5IGGA 1F9PA 2KEEA 4FXKC 1SE4A 1EWCA 2XN9C 3MHBA 5EPJA 3HOXB 2Z4IA 4C3IG 2EYJA 3M4YA 5IOCA 1QOHA 3KF8A 3DWQA 4O42A 1BF4A 2Z1CA 3T51B 2KCNA 4XDXA 2N88A 3Q22A 4C1NI 2B2VA 3VYSA 3WDNA 1C4QA 3MTSA 1FD7D 5EPLA 4C3JB 1U4MA 5JEAJ 1MSHA 4PV1C 1F77A 5T1GA 5EPKA 2DN8A 2F0VA 4EQNA 2B2VC 4HCEA 2A5HA 2VB2X 1Q8IA 2QDBA 2X6LA 2EYMA 5LL6S 4IFDG 3T4AC 1LLRD 2H4OA 1Q1EA 4PQXA 2CW0C 1MD2D 1KLGD 1I4HA 5KEEA 3PUVA 1LTTD 4QB4A 1WVLA 3FVQA 2IL8A 3IAYA 2EVBA 4DAPA 1LACA 1WTXA 3K5NA 3GTGB 1VMCA 5EBCA 2PW7A 2LS01 3FPPA 3SVMA 2PPBC 3OPOA 4A3MB 4TQUS 1YNJC 1CA6A 4A3IB 4XT1B 3NWTA 2LKVA 1T5EA 2XVSA 2R3ZA 2EDGA 5E3FA 1JCKB 3E0JA 5IGEA 5IT9L 4OO1H 2CQAA 1ENFA 2H1EA 4NMZA 2Z8LA 1G8ZD 3OWFA 4HSVA 4ODGA 5A2QL 3OMGA 1D5MC 4QF4A 1U4LA 1KTKA 2WIIB 5M5YB 1F9SA 4A3JB 5C5LA 4NKLA 3QWNA 3E6ZX 3BDOA 1ZXTA 1W6JA 1B9NA 1I4QA 4FVMA 3HRZC 1B9MA 1GHKA 4J1MA 3MFGA 3NTIA 3J80E 2XSCA 3MA2B 4H44C 1Q3LA 2FMMA 4KD4A 4KJNA 4B08A 1AP0A 3I3CA 3FRPB 3AMUA 3M7NA 3V05A 2KJXA 3J7YW 1CHQD 5D3IB 1GUGA 3LNNA 2L12A 5C3XA 3PIP3 3K58A 3EQLC 4CJ0B 1ZKOA 2HQEA 1NAPA 4OIJA 5NUCA 4ZQ3A 1STBA 3TP8A 1FNUA 1Y8PB 2OT2A 3GTQB 4YIJA 4A3DB 3SR1A 1SYCA 1DOKA 2QKIC 1E2WA 1GUOA 5E1FA 4Y7NB 4DK0A 1LT6D 3OW7A 1H9SA 1V43A 3F2UA 4KN4C 4DNRB 4C56C 4KN7C 2EPBA 1SNDA 3HP3A 1LTRD 3D4RA 4K5WA 1TWFB 1K8OA 3CRLC 1XYIA 5EJWA 3C46A 4E6IA 5C5MA 3K59A 3PV0A 1PLFA 4AYBB 1B50A 1SYBA 1IKLA 1EY4A 4KI0A 4DN4M 1HFNA 4ZKBB 4FP5D 4I7ZC 3NTHA 1BCPB 2KCCA 4XTCS 3FKIB 4MN3A 4FYDA 4HTHA 4H13C 5KNCA 2PO4A 1QE6A 1TWCB 2BOSA 2NBFA 5KRUA 1MSGA 3ONAB 4HEDA 3T56B 4RCOA 1TVXA 3DM1A 2NTTA 1A6XA 3VA5A 4C3HG 2F0IA 2R93B 3D3RA 2K32A 1EY6A 1DONA 1EWHA 1F9RA 3I70A 4G57A 2XIWA 3L7ZC 2EYFA 2Z4HA 1IHZA 1PYWD 5ELBA 4IUPA 3CRKC 1SSOA 1TS3A 2Q8TA 5JJZA 3QJYA 3VR5A 3TZDA 3NP8A 3A55A 3GTLB 1IW7C 2D2CC 3EROA 5CMDA 1Y69U 2M00A 3KK7A 4RKLA 2EYOA 3I90A 1TWHB 2FFKB 1EQTA 1L0XB 2EYLA 1ENAA 1QWYA 4CKCA 1EZ6A 4G7HC 4WJWA 3L9AX 3L3OC 4XYQA 5C0XJ 4L6TB 2KOLA 4EGVA 3MXUA 4RAUC 1TWGB 5IODA 3PUYA 2Q8RE 1S5DD 2IX0A 4PMCA 3QOLA 5DNFA 3SK5A 3TBIB 1CQFA 2M2LA 5JVG3 2L4NA 1O7YA 4BS9A 2JA5B 1PTOH 1SNMA 1QCBD 3SK8A 1OXSC 3S16B 3K5OA 2YU9B 5IGBA 2C5CA 2BA1A 1KDBA 3OHXC 1KNEA 3VA7A 3GTJB 3NK9A 3URYA 1EQVA 1RKNA 5HURA 2LMCB 4KD3A 1ESRA 5HGTA 1QG7A 2BDNA 5FO7B 1SFOB 4U68A 4HMIA 3Q6SA 2E76C 4IUTA 5CR3A 2DNCA 4ID6A 3V96A 4G7OC 1MGSA 4XT3B 3O13A 4TKOB 2PZUA 1JE4A 1H9JA 2EXZA 4U673 1DJRD 2B2WC 1D2BA 3Q24A 1KLUD 1DYQA 2IWHA 4KHVA 1FNVA 4GZYC 3GP7A 1E2ZA 1SYGA 4X3TA 1HA5A 3SE0A 5C0XH 3J80L 2JA8B 2HCCA 1LTSD 3ND8A 2K1BA 2VB3X 1F9QA 5ELDA 1RDPD 2AWNA 2B2UA 1GJXA 2BA0A 3A54A 4FF4A 2A74C 3NHHA 3HGBA 5I6WA 2PZTA 3X3NA 1UUPA 4M1UB 2KA7A 1LT5D 3BDLA 3NBHA 1JQYD 2WINB 4H0LC 3RZDB 1V1PB 1QB5D 2B63B 5BN5A 2A6EC 1GHJA 3D31A 3I72A 4A3FB 3R93A 2PZWA 1R4PB 1G2TA 3GTOB 2AQ1B 2QILA 5JPMC 2XWBB 2SOBA 1WCMB 1K83B 4BBRB 3JAME 5KGUA 3N6RA 1HXYD 1GUSA 1EZ8A 3J7AF 2AQ3B 4CBVA 2PQEA 1H9RA 4F88A 1ESFA 1X32A 1EOTA 1Z7TA 1CK1A 2PCFB 1LV9A 5C4ZA 4OIKA 5FO8B 3H94A 3K5LA 1RTOA 4OGQC 2Q8IB 3GTPB 3S1QB 2MPMA 2K5QA 4C3HB 2ICIA 3H09A 3TSSA 1STGA 4K8IA 1WTQA 3CKIB 3TP5A 1RODA 2F0QA 1KDAA 4RGOS 4RA8A 1BXTA 1SMYC 2F0JA 1SXTA 3HEJA 2B8GA 2IJ0A 5C4JB 2F0OA 5K5PA 4X3UA 1PMRA 1SJED 2X6GA 3GV6A 2B8FA 4I65A 1SE3A 1ET6A 2CVRA 5K36H 1SAPA 2YYZA 2A6HC 2F0LA 3I91A 2JA7B 2A6HD 5I2XA 1SE2A 4V0BA 4QUFA 4PMBA 3M7GA 1S5FD 4FXGC 1F2LA 1HTLD 2JA6B 4KKSA 2PW5A 5CV6A 2KQ3A 3IFDA 5M3MB 1A3VA 3PUWA 4JBWA 3Q0AA 1SYDA 2F3WA 5A2QE 1STNA 4K8JA 1DOMA 3GTKB 1B3AA 2F0MA 1H9KA 2DNEA 1BNZA 4C3IB 1RF2D 5COYA 4Z9CB 2E2HB 2ICEC 3FDTA 2FJ2A 3S2HB 2B2YA 3BZDB 1I4XA 3EFXD 2IPKD 3H3VC 2F4IA 4J8QA 5DEHA 1HQMC 5CV4A 3BYYB 3NQIA 1PTOD 1KABA 5M5XB 4RFBA 3KUPA 4XIGS 2AUKA 3MZ5A 3OOCA 4RCNA 1V1PA 1H9SB 1FR3A 2EJGC 1G91A 2B2TC 1B4OA 4ULLA 5J22A 1S4ZA 5LL6X 4WFN3 4PMWA 5C0XI 4NW2A 1PRTD 1TS2A 1PRTB 3HKZB 3MC0B 1LT3D 2CHBD 1WD1A 3T13A 2G9HD 4XYOA 4B9WA 3PUXA 1H9MA 1CFMA 1HHVA 2WB1B 3TMEA 1QNKA 1DCZA 4X3KA 4DFAA 1X3PA 4F8MA 2EZVA 3DXJC 5F2DA 1LTBD 2EYHA 2O5JC 5CV8A 2DY8A 2NB0A 1DZ1A 3ZYYX 1OO9B 3C3LA 5CYUA 5ELFA 2EY5A 2KHSA 2NVTB 5JOBA 4DAVA 2HDLA 4DXGA 3NUCA 1JC7A 3BYTB 2MUYA 1CI3M 1NUCA 2FHTA 3D4DA 1BR9A 1ET9A 5LHY1 2F0DA 3I4NB 4K5XA 5J1ZA 1WD0A 1WTOA 4K5VA 3K6OA 1CT1D 3NWSA 5JPNC 2D5DA 2L5TA 2E74C 3D6WA 2DY7A 1X3QA 1MBYA 3W3AA 3M3YB 2B2YC 3VR6A 4CHTB 2EE1A 2L11A 3DMUA 2VUMB 4DK1A 3KLSX 3A56A 1TS4A 1JICA 1LT4D 3TDQA 4DGZA 2OXPA 1PFNA 3FPUB 2C9OA 1U9RA 3EA6A 1HCZA 4O1NA 1PZID 5CV9A 3M4OB 1M4VA 2SEBD 1J8IA 2AWOA 1CTMA 2XNAC 3R2IA 4LJZC 3QB3A 4K14A 4DNTB 3G6JB 2B2UC 3K0YA 4IALA 2FINB 5CORA 2E2DC 4N9PA 2M9VA 1TT2A 3C1EA 3U9OA 1O7LA 1JORA 2OF1A 2WAQB 2E2IB 3DWPA 3QG1A 4C1NK 2F0TA 5EKIA 5I6YA 1AFPA 5E4XA 1PXUA 1D1KA 3DHQA 5EKLA 2O4XA 3BG3A 1WTWA 3HOYB 1GUWA 2R61A 4OO1G 3OWEB 3P1HA 4L63B 3S1MB 3PIO3 4QMGA 4XQJA 1LO5D 3S14B 1RTNA 4A3BB 3NXWA 3GD7A 4XQNA 4FF2A 2XWJB 3R8BA 2NVYB 5KNDA 4A93B 2JSOA 1EYDA 4CJ2C 4CJ1B 3RMHA 1RHPA 1F2ZA 5DM63 1EU3A 3NPPA 1VMPA 4J6HA 4QIWB 2O5IC 2A69C 2VXWA 2NN6I 1Y1VB 1GOZA 2FMCA 1L0YB 4ZUIA 3MXGA 5ELCA 3J81L 3S1NB 1EY8A 1FYCA 2D62A 4B9XA 1JOOA 3VYUA 2J0TD 4ZK9B 4HMJA 5EGTA 2L9HA 2K28A 1S5BD 2AUJD 1SEBD 3RLFA 3A8JE 3DWAA 2WP8J 3HS0C 1CM9A 3PUZA 1ENCA 2F0EA 2I46A 1I4PA 2EJMA 2K7VA 3BVMA 1TU2B 2E2JB 4ZKCB 3FMCA 2E75C 2L0CA 4P2CB 2Y0SB 4S3SA 1XXGA 1HFGA 5D14A 1DM0B 1S5CD 4HSPA 2LFNA 3EVQA 1R9TB 5KYLA 2CW0D 5FLXE 3HOZB 4K6DA 3NTKA 5M5WB 1PDQA 2RSNA 1BO0A 1CZWA 3MWYW 3KLSA 4K2KA 2JEBI 1U4PA 1II3A 4DF7A 1STEA 3NSWA 4IUVA 4QUCA 1NCVA 1VF5C 5M9OA 1KNAA 1A15A 5D65A 3BVZA 3MEHA 1OXXK 2RQXA 1J9OA 2R7ZB 4QCLA 2KVMA 2X69A 2BCOA 2F1MA 4EQOA 1DOLA 4C2MB 1JOKA 4ILWA 4KMUC 2A6ED 3LWEA 2WKDA 3Q23A 4OL7A 2ZXRA 1VCIA 5K36G 2RDFA 1KAAA 2PMZB 1E0BA 1EEID 4HCSA 2SNSA 2O2LD 5C4HA 4IN3A 4ZLTF 2EYPA 1SNCA 1OXUA 3WOFA 1EYCA 2F0NA 4Q5VA 2F0UA 1I4RA 3GQBA 4XQQA 2ENBA 1SNQA 4UAIA 3MXPA 4A3KB 3C2PA 4KY5A 1XWEA 2ZXPA 3KBXA 1HQRD 4ZUJA 1DD2A 4BBSB 2EY6A 4C3JG 4FF3A 1EFID 1F2YA 2RBMA 2K33A 5CV5A 4LMQD 1TS5A 3K7AB 2NZ1D 1AZQA 2PYKA 2AQ2B 4MHEA 1O78A 2TMPA 3S1RB 4BWGB 1IYVA 1D1IA 3NE5B 2ID0A 1BDOA 1ICWA 1OXTA 1WTPA 2RDHA 3OIPA 5ISRA 1AN8A 2RKSA 3LX0A 4R8IA 2NWGA 1Q1BA 3PO3B 5JAVA 3ND9A 4HAEA 1IYUA 5C4XB 2F0KA 1QILA 2B39A 2OEOA 3EJIA 1B1ZA 1O7ZA 1STHA 1ML0D 1V1OA 1TIID 2WKCA 2XRQD 1D5ZC 1EY9A 1VDZA 4FNFA 3HG9A 2BE5C 5C0XG 5CV7A 3CU7A 4NDXA 3S17B 5EBDA 1ILQA 4WRDA 4N9TA 4UDUC 3SHLA 3HOUB 4NP5A 1EEFD 4FF1A 2EJFC 1LABA 1PZJD 2ZXOA 1NSNS 5IIFA 1IW7D 1Y8NB 3D4WA 4CKEA 2L1BA 3AU7A 4HR7B 2NVQB 4K6LA 3NQTA 1D6EC 1SMYD 3OIQA 5T1IA 2BDOA 3SK4A 1B53A 3IL8A 3ITPA 4IUNA 2JE6I 1RCVD 3A8KE 3K57A 4ME5A 3ERQA 2F03A 1PFMA 3H91A 4G7ZC 3I8ZA 3CQZB 3P75A 3A8IE 3BVGA 1SYFA 4DAYA 3K5MA 3AB9A 5IGDA 2QCPX 5ELEA 1Z47A 2MHVA 3A7LA 3A7AB 2NTSA 3DEOA 3VR3A 1G6ZA 3M85A 2NVXB 5IGFA 5EKKA 4V190 2GA4B 2K5DA 2XRSD 4IUUA 3CHBD 2K6AA 4RHSA 1JWMD 1U4RA 1PRTF 2F0FA 1M8AA 4OHJA 1PFBA 1UAPA 3SXHA 1UEAB 2K5WA 2JXMB 1RD9D 3SK6A 4KHZA 2EY1A 3GTMB 2R92B 4DXFA 1B2TA 1KDCA 1Q90A 4LAAA 1JWSD 4ABNA 4BA1I 5CGKA 1JOQA 2F0SA 1GUTA 5D3DA 4K2LA 4CKBA 1STAA 2BE5D 1SBBB 3IFTA 4DU9A 5BN4A 3MXNA 4ZYSA 1SYEA 4FO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TP7 A;  1EY0 A;  2F0L A;  1KDB A;  3T13 A;  2PZW A;  4B9W A;  4ME5 A;  1AEX A;  3ERQ A;  3NK9 A;  4ZUI A;  4KD4 A;  4KJN A;  4PMB A;  5JAV A;  4EVO A;  3QB3 A;  1EQV A;  4K14 A;  5KEE A;  1RKN A;  5HUR A;  4KD3 A;  3VA5 A;  3TME A;  1EY5 A;  5HGT A;  3P75 A;  2F0P A;  2F0K A;  2F0I A;  4EQO A;  4QB4 A;  5IGC A;  1SYF A;  3TP6 A;  1JOK A;  1EY8 A;  2SOB A;  3D8G A;  2OEO A;  1A3U A;  4DFA A;  4F7X A;  3EJI A;  4KY7 A;  5IGD A;  1EY6 A;  5IGB A;  4HMI A;  4IAL A;  3RUZ A;  4B9X A;  5KGU A;  5C6A A;  4F8M A;  1JOO A;  1SNP A;  4IZ8 A;  2PW5 A;  5F2D A;  4G57 A;  1EZ8 A;  5CR3 A;  2EYH A;  4ID6 A;  2KQ3 A;  5CV6 A;  4OL7 A;  4N9P A;  5CV8 A;  5C3X A;  2EYF A;  2F0H A;  4PNY A;  4WOR A;  2F0G A;  1A3V A;  1TT2 A;  2HQE A;  3C1E A;  1IHZ A;  3U9O A;  5NUC A;  5I9P A;  2PW7 A;  2PZU A;  1STB A;  4ZQ3 A;  2EXZ A;  1TR5 A;  1JOR A;  2OF1 A;  2RDF A;  1STH A;  3MVV A;  4H7B A;  4R8N A;  1SYD A;  1KAA A;  3TP8 A;  2EY5 A;  2KHS A;  2PQE A;  4HMJ A;  5EGT A;  5JOB A;  2F3W A;  5IGF A;  1STN A;  3NUC A;  4YIJ A;  4K8J A;  4KY6 A;  1SYC A;  3SR1 A;  5KYI A;  5C4Z A;  2F0M A;  3E5S A;  2LKV A;  2SNS A;  2F0T A;  3C1F A;  5C4H A;  1EY7 A;  5EKK A;  1TQO A;  4KHV A;  5CC4 A;  1NUC A;  1EY9 A;  3NP8 A;  5E1F A;  5I6Y A;  3D6C A;  2EYP A;  3ERO A;  3D4D A;  3OSO A;  1SYG A;  1SNO A;  3OMC A;  4KTA A;  5E3F A;  1SNC A;  1ENC A;  5IGG A;  2F0E A;  4TRD A;  2F0D A;  2WAC A;  3DHQ A;  4RKB A;  4NDX A;  2M00 A;  1EYC A;  2F0N A;  5CV7 A;  5IGE A;  4K5X A;  4RKL A;  2EYO A;  2O4X A;  5EKL A;  5J1Z A;  1STG A;  4K8I A;  1A2U A;  3V2T A;  2F0U A;  2F0F A;  3PMF A;  4K5V A;  1SND A;  2F0W A;  4NMZ A;  2ENB A;  3P1H A;  4WRD A;  1SNQ A;  3MHB A;  4N9T A;  3SHL A;  2EY2 A;  3SXH A;  4EQP A;  2EYL A;  1ENA A;  4QMG A;  3MXP A;  2SNM A;  4S3S A;  3OWF A;  4NP5 A;  4ODG A;  3R3O A;  4K5W A;  5DAU A;  5DEH A;  1EZ6 A;  3TP5 A;  4KY5 A;  4KJO A;  5CV4 A;  2F0Q A;  1A2T A;  1KDA A;  2EYJ A;  5KIX A;  5I9O A;  4ZUJ A;  5IOC A;  3SK6 A;  3NHH A;  1NSN S;  3EVQ A;  3OMG A;  4E6I A;  1KAB A;  5KRU A;  2EY1 A;  5C5M A;  5IIF A;  3NXW A;  4QF4 A;  5KYL A;  2EY6 A;  1KDC A;  5I6W A;  4MIU A;  1F2Y A;  3MZ5 A;  2PZT A;  1F2M A;  2RBM A;  3S9W A;  1STY A;  1SYB A;  4LAA A;  5CV5 A;  2NUC A;  2F0J A;  3T16 A;  4K6D A;  5IOD A;  3DMU A;  3HEJ A;  5C3W A;  1EY4 A;  5C5L A;  3D4W A;  5CGK A;  2F0O A;  4NKL A;  2PYK A;  5K5P A;  4K2K A;  3QOJ A;  4PMC A;  2F0S A;  1JOQ A;  1EYD A;  1II3 A;  4KV6 A;  4DGZ A;  2OXP A;  3BDL A;  3QOL A;  4DF7 A;  4K2L A;  1STA A;  3SK5 A;  3NQT A;  1A3T A;  1U9R A;  1F2Z A;  4I65 A;  4DU9 A;  5J22 A;  2F0V A;  3HZX A;  4EQN A;  5J39 A;  1EYA A;  4J6H A;  5M9O A;  2F3V A;  4J1M A;  1SNM A;  2QDB A;  3BDC A;  5CV9 A;  3SK8 A;  4HTH A;  3SK4 A;  3ITP A;  4IUN A;  2EYM A;  3H6M A;  5ISR A;  3MEH A;  1SYE A;  2RKS A;  3LX0 A; 
#chains in the Genus database with same CATH topology
 1T5X D;  3TP7 A;  4JI8 L;  3SEB A;  2A68 C;  3DUZ A;  1VF7 A;  5I2Y A;  5G3L D;  2MFI A;  1TKW B;  1YNN D;  4EVO A;  1HA6 A;  5C44 B;  4QQB X;  1QJO A;  1PRT C;  2N55 A;  3IKJ A;  1EY5 A;  4RH6 A;  5IGC A;  1KC8 C;  5C3E B;  3GO5 A;  3T53 B;  2DJG C;  1X54 A;  4GNX A;  5C6A A;  3UE1 A;  1PH9 A;  1GUN A;  4AQY L;  1BBU A;  1SNP A;  4IZ8 A;  1SRO A;  1N36 Q;  4DR7 Q;  5FK9 C;  3PF4 A;  2LY7 A;  4WOR A;  2F0G A;  4LF5 Q;  2JA7 G;  5FO9 B;  1TR5 A;  3MVV A;  4JI1 Q;  4R8N A;  1VS0 A;  5AFW A;  4RGT A;  4TVA B;  1PH1 A;  1Z6H A;  4KY6 A;  3ULL A;  1BCP F;  1QNU A;  4QIW E;  5CBE E;  5CC4 A;  4AH6 A;  1PTO F;  1PTO B;  2EQS A;  2K04 A;  3TQY A;  2QEJ C;  4JI1 L;  3CQZ H;  4RKB A;  4MNO A;  1KQS A;  3U9S A;  1EWI A;  4WJ4 A;  1X3E A;  1PH2 A;  4JK1 C;  3NBH B;  3TRE A;  4LUO A;  1C48 A;  5HY6 A;  1N36 L;  2EY2 A;  1SDF A;  1CHP D;  1QVC A;  1Y1V H;  2SNM A;  2YTX A;  5I4D A;  1QZH A;  3R3O A;  3I4L A;  4DV4 Q;  2ASB A;  4DUY Q;  2CKZ B;  3VR4 A;  3HKZ G;  1HRJ A;  5FOB B;  1A2T A;  2OTJ A;  5KIX A;  4JPB W;  4KKU A;  5I9O A;  4A3B H;  4LUV A;  1YNN C;  1MKH A;  1F2M A;  4BY7 H;  4JI0 L;  4GKK Q;  2NUC A;  2J4X A;  4KKT A;  3TN2 A;  4ZRZ A;  1PVO A;  4GKJ Q;  2KHI A;  3P7J A;  5AJ3 L;  3PGZ A;  2JA7 H;  4C3I H;  2ZT9 C;  4IFD I;  1I50 B;  2V1C C;  4KV6 A;  1C0A A;  3M3Y H;  3GV3 A;  3OYY A;  3VYR A;  3ER0 A;  2MGS A;  4JV5 Q;  4LWC A;  1TWA B;  2H5X A;  5FLX c;  4DV4 L;  4DV1 L;  1AH9 A;  4IQZ A;  1Z9F A;  3BDC A;  3Q8D A;  2SDF A;  1YVC A;  4ALP A;  4HIO A;  5M3M H;  1NBW A;  2DGY A;  1PTO C;  4G4K A;  1EY0 A;  2HIX A;  4DAY B;  3HOV B;  1IKM A;  1I3Q B;  4L8J A;  3CPW A;  1HPC A;  1ICF B;  2K05 A;  2RDG A;  3CPF A;  1W6K A;  2WV6 D;  2IHF A;  2YTY A;  1LTA D;  3T1Y Q;  1A3U A;  1D5X C;  3TZU A;  4IFD J;  1ASY A;  4L5S A;  4RGM A;  4PNY A;  2R6G A;  4RHR A;  3SGI A;  5I9P A;  4RGN A;  2HCI A;  3G7L A;  1AE3 A;  4JI3 L;  1IL8 A;  4HN7 A;  1R4Q B;  1Y1W B;  4AQY Q;  1UNS A;  5KYI A;  3E5S A;  2CWP A;  3KDF B;  1CQV A;  3N52 A;  3C1F A;  2A8V A;  2ZM6 Q;  5BN3 A;  3M4O H;  2B2T A;  2GVB A;  3D6C A;  5A35 A;  3OSO A;  3VR2 A;  1XMO L;  1XPU A;  3SDZ A;  3OMC A;  4KTA A;  1I4G A;  3P20 A;  4DA2 A;  1WTR A;  4TRD A;  2WAC A;  4BBS H;  2B29 A;  1ONL A;  1EIH A;  3AFQ A;  5TSS A;  1LTI D;  2QEX A;  4WJ3 M;  1EIF A;  3V2T A;  3PMF A;  3U4Z A;  1HNX Q;  4ZAI A;  4B3M Q;  1HUM A;  4F87 A;  2HDM A;  1LYL A;  3KLR A;  1A63 A;  3TEH B;  3BS1 A;  3QIA A;  2E2I H;  1I6H B;  2JYO A;  4KJO A;  1G29 1;  2JA6 G;  4IFD H;  2RCN A;  1C8C A;  3LWU A;  3S1M H;  2JJQ A;  4PZ8 A;  5DM7 3;  3PO2 B;  1OXV A;  4KK7 A;  4R4O A;  2VW9 A;  3KYH C;  1BQQ T;  1STY A;  4A3G B;  1B44 D;  3T16 A;  4HJ7 A;  1E1O A;  1BBX C;  1JB3 A;  3S15 B;  1I50 H;  3RZO B;  5CBA E;  2XTI A;  2MJ8 A;  1Q12 A;  2NZH A;  1VQP A;  4GKJ L;  4JI4 Q;  3UI2 A;  3PCO B;  2JEA I;  2QF7 A;  1A3T A;  2B2W A;  2NN6 H;  2J7Z A;  1E24 A;  3HZX A;  3RD4 A;  1ZYR C;  1BUV T;  2I5L X;  5G3L F;  2F3V A;  1S5E D;  4M8A A;  5M5X H;  3HOW B;  3M4Q A;  2VQF L;  4LK1 C;  5E4W C;  4A3I G;  1YIT A;  1JJ2 A;  2YU9 H;  4OEM B;  4P74 A;  2IX3 A;  1VQI A;  2PNR C;  2K01 A;  1BCP C;  3W2D A;  1AEX A;  1V8Q A;  1WCM H;  1FNW A;  2V4D A;  3DM3 A;  1AW7 A;  4GNX B;  4JC0 A;  2AHO B;  2RA4 A;  4BA2 I;  1KL9 A;  1JB7 A;  3M4P A;  1HNZ Q;  1DXM A;  3TP6 A;  5FLX L;  3NBI A;  4KY7 A;  2VUM H;  4RWS C;  3KBG A;  1PFS A;  2F0H A;  1CZG A;  4R4T A;  3WOE A;  1BOS A;  3J81 c;  1EL0 A;  2MP1 A;  1TWA H;  1SJH D;  4H7B A;  5FJ8 G;  1WTV A;  1AZP A;  4BBS G;  1JR0 D;  5IP7 H;  3HKS A;  5JEA G;  1PHJ A;  4HJ8 A;  1TY0 A;  5JVH 3;  1VQ5 A;  1ZEQ X;  1EY7 A;  1TQO A;  1FGB D;  3I4M B;  2IT1 A;  2KHJ A;  2IW3 A;  1G2S A;  4YCW A;  2I5M X;  2VNU D;  5M5Y H;  2HUG A;  1JWU D;  3G6E A;  3X3M A;  4IPD A;  3RLN A;  1A2U A;  2Q2H A;  5EQ0 A;  1K8M A;  2F0W A;  2RVL A;  1HR0 L;  1NR2 A;  1E2V A;  3UE0 A;  4A3K H;  3H0G B;  2G9D A;  2RSO A;  1CA5 A;  1ILP A;  5DAU A;  5C3E H;  1GD7 A;  2A68 D;  3ZJY C;  2JA6 H;  4R4I A;  1U0L A;  4Q0F A;  5KNB A;  2A73 B;  3MAQ A;  2IX1 A;  1TY2 A;  2NZO A;  1GXD C;  4MIU A;  2Z9H A;  3R2T A;  1HTP A;  4IUQ A;  1Y14 B;  3S9W A;  3JAM L;  1AE2 A;  1YNJ D;  4TSS A;  1HUN A;  1EIG A;  4IUR A;  2KBN A;  4CGY B;  2UXC L;  5C3W A;  4CDF C;  3VYT A;  5FKA C;  3QOJ A;  3J81 E;  4RG1 A;  4XXE A;  3UDG A;  1P8L A;  3QO2 A;  2NN6 G;  2ZJQ A;  1VQF A;  2GVA A;  1RJT A;  3DEP A;  2D0O A;  4I7A A;  1Y8O B;  4DNI A;  4DV2 L;  5J39 A;  1EYA A;  1VQB A;  2NYZ D;  4R9W A;  1PZK D;  2D9U A;  4X3S A;  3FEW X;  4A3I H;  1RL2 A;  4J15 A;  2K03 A;  3H6M A;  4DR4 Q;  3S2D B;  4X66 Q;  1LTG D;  2I07 B;  1CUK A;  2CQO A;  4OO1 I;  1XTC D;  3K0X A;  3MFY A;  2UU9 L;  2JP1 A;  3FKI H;  2KED A;  4GNX C;  2NVX H;  2L55 A;  5M3F G;  4JBM A;  1E3P A;  1BCP D;  4GLA C;  1Y1V G;  1I6V C;  1XX8 A;  2A69 D;  2F0P A;  2HHH L;  3D8G A;  4F7X A;  3I73 A;  5M3F B;  2NVY H;  1JJG A;  2G5D A;  1MIU A;  1EU4 A;  3RUZ A;  2EOT A;  5BR8 Q;  4HIM A;  1XMO Q;  3K81 C;  4EQP A;  3EN2 A;  3CF5 A;  3J7A V;  4BY7 B;  2KUM A;  3CP0 A;  1ZYR D;  2L15 A;  4A3E B;  5IT9 c;  3KJP A;  3AFP A;  3I7F A;  1K8G A;  5JEA H;  1MI2 A;  1RIP A;  4LF4 Q;  2KEC A;  4JW0 A;  5HGQ A;  1JJC B;  2F4V L;  1NR4 A;  1O80 A;  2TSS A;  1SNO A;  1XMQ Q;  5IT9 E;  3CC4 A;  4BY1 B;  3KF6 A;  3GTK H;  4FXD A;  5IGG A;  1F9P A;  2KEE A;  4FXK C;  3CMA A;  4QY7 A;  1SE4 A;  1XNQ L;  1EWC A;  2Z6K C;  2XN9 C;  3MHB A;  5EPJ A;  3HOX B;  1PYS B;  4DV3 Q;  2Z4I A;  4C3I G;  2EYJ A;  3M4Y A;  5IOC A;  5C3E G;  1QOH A;  1CSP A;  3KF8 A;  3DWQ A;  4O42 A;  1BF4 A;  2Z1C A;  3T51 B;  2KCN A;  4XDX A;  2N88 A;  1XPR A;  3Q22 A;  4C1N I;  2B2V A;  4JCV E;  3GTL H;  3T1H Q;  2WAQ G;  3VYS A;  3WDN A;  3GTP H;  1C4Q A;  3MTS A;  5IYC H;  1FD7 D;  5EPL A;  4C3J B;  1U4M A;  4JI8 Q;  5JEA J;  5M3M G;  1MSH A;  4PV1 C;  2JQO A;  1F77 A;  1VQH A;  5T1G A;  5EPK A;  4KHP Q;  2DN8 A;  2F0V A;  4EQN A;  1SE8 A;  2B2V C;  3HOV H;  4HCE A;  2A5H A;  2VB2 X;  1Q8I A;  2QDB A;  2X6L A;  2EYM A;  5LL6 S;  4IFD G;  3CCE A;  3T4A C;  2K75 A;  1LLR D;  4A3G H;  2H4O A;  1Q1E A;  1T9H A;  4PQX A;  2CW0 C;  2JA5 H;  1MD2 D;  1KLG D;  1C9O A;  1I4H A;  4HID A;  5KEE A;  1N34 L;  3PUV A;  3K7U C;  4A3F G;  1LTT D;  2R92 G;  4QB4 A;  1WVL A;  4P71 A;  4GN5 A;  3FVQ A;  1MHW C;  2IL8 A;  4JG2 A;  3PO3 H;  3IAY A;  2EVB A;  4DAP A;  4IO9 A;  3HOW H;  1LAC A;  3ERS X;  2EXD A;  4EX5 A;  1V1Q A;  2JK8 A;  1WTX A;  3K5N A;  3GTG B;  1VMC A;  5EBC A;  2PW7 A;  2LS0 1;  3FPP A;  3SVM A;  4B3T L;  3STB C;  2PPB C;  3OPO A;  4A3M B;  4TQU S;  1YNJ C;  4A3I B;  1CA6 A;  1HZ9 A;  4XT1 B;  3NWT A;  2LKV A;  1T5E A;  2XVS A;  2R3Z A;  2EDG A;  5E3F A;  1JCK B;  3E0J A;  2KCT A;  5IGE A;  1HR0 W;  5IT9 L;  2D0P A;  4OO1 H;  2CQA A;  1ENF A;  2H1E A;  1K0S A;  4JI3 Q;  4NMZ A;  2Z8L A;  1PV4 A;  1G8Z D;  3OWF A;  4LF6 L;  4HSV A;  4ODG A;  3H3V I;  5A2Q L;  2R93 G;  5LMN L;  3OMG A;  1D5M C;  1SN8 A;  4DAM A;  4QF4 A;  1U4L A;  4X62 L;  1KTK A;  2WII B;  4LFC L;  5M5Y B;  1F9S A;  4A3J B;  2R7Z H;  5C5L A;  3KJO A;  3RR5 A;  4X62 Q;  4NKL A;  3HOZ G;  3QWN A;  3E6Z X;  3BDO A;  3CAM A;  1ZXT A;  5FLM H;  1W6J A;  1B9N A;  1I4Q A;  3L2P A;  4FVM A;  3HRZ C;  2MO0 A;  1B9M A;  1GHK A;  4J1M A;  4LF6 Q;  1EOV A;  1I94 Q;  3MFG A;  3NTI A;  3J80 E;  2XSC A;  3GDE A;  3MA2 B;  1TWC H;  4H44 C;  3AYH B;  1Q3L A;  3F8T A;  3S17 H;  1Q81 C;  2FMM A;  4KD4 A;  4KJN A;  1G6P A;  4B08 A;  5LMU L;  1AP0 A;  3I3C A;  1Y1W H;  1Q86 C;  3FRP B;  4BY7 G;  3AMU A;  3M7N A;  3V05 A;  2HQL A;  3FHW A;  1CSQ A;  2KJX A;  3J7Y W;  1CHQ D;  4YY3 L;  1YZ6 A;  1GUG A;  5D3I B;  2LXJ A;  1E1T A;  4C3J H;  3TS2 A;  3LNN A;  2L12 A;  1NJI C;  5C3X A;  4ME3 A;  3PIP 3;  3K58 A;  3EQL C;  4CJ0 B;  1YEZ A;  1ZKO A;  2HQE A;  2VZA A;  1NAP A;  1YHQ A;  4OIJ A;  5NUC A;  2JA8 H;  4ZQ3 A;  1STB A;  3TP8 A;  4A3C G;  1FNU A;  1Y8P B;  1Q7Y C;  2OT2 A;  3GTQ B;  4YIJ A;  4A3D B;  3SR1 A;  1SYC A;  1DOK A;  2QKI C;  2FXQ A;  1E2W A;  1GUO A;  5E1F A;  3HOY H;  4Y7N B;  4DK0 A;  3PF5 A;  1LT6 D;  3OW7 A;  1H9S A;  1YJ9 A;  4LFA L;  1WI5 A;  1V43 A;  3F2U A;  4KN4 C;  3E9H A;  4DNR B;  4NXM L;  4C56 C;  4KN7 C;  1IYJ B;  2EPB A;  2ZJP A;  1SND A;  1VQ9 A;  1CKN A;  3HP3 A;  4C3H H;  1IBL Q;  1LTR D;  3D4R A;  3U50 C;  1O7I A;  2WFW A;  4YWM A;  2Z6B A;  2ZTD A;  4K5W A;  1TWF B;  4DR7 L;  3CRL C;  1XYI A;  1K8O A;  5EJW A;  5M3F H;  2B63 G;  3A5U A;  3C46 A;  1BVS A;  1JMC A;  4E6I A;  1EQQ A;  5C5M A;  3K59 A;  3PV0 A;  3KDF A;  1OTC A;  1PLF A;  4AYB B;  1B50 A;  1S40 A;  1HH2 P;  1SYB A;  1YBY A;  1IKL A;  3UDI A;  1EY4 A;  4KI0 A;  4DN4 M;  4AYB E;  2A19 A;  2UXD Q;  1HFN A;  4ZKB B;  1SMX A;  2JN4 A;  4FP5 D;  1FJG Q;  4I7Z C;  3NTH A;  1BCP B;  2KCC A;  4OX9 L;  4XTC S;  2YTV A;  3FKI B;  5J3B A;  2UUB Q;  4MN3 A;  4FYD A;  4HTH A;  4H13 C;  4JI5 L;  2Q2U A;  5KNC A;  2PO4 A;  1QE6 A;  1TWC B;  3TRZ A;  2BOS A;  2NBF A;  4A3J G;  5KRU A;  1MSG A;  2K5H A;  1I5F A;  2UXD L;  3K7A H;  3ONA B;  4HED A;  3T56 B;  4RCO A;  2CWA A;  4JYA Q;  1TVX A;  3DM1 A;  3M9B A;  5LMN Q;  2NTT A;  1A6X A;  3VA5 A;  4C3H G;  2F0I A;  2E5L L;  5IYD G;  2R93 B;  3D3R A;  2B3G A;  2K32 A;  5IE8 A;  1EY6 A;  1DON A;  1EWH A;  1F9R A;  3I70 A;  1K3B C;  1NMG A;  4G57 A;  2XIW A;  3L7Z C;  2EYF A;  2E2J H;  1HJP A;  2Z4H A;  1IHZ A;  1PYW D;  1NNX A;  5ELB A;  4IUP A;  1VQA A;  3CRK C;  1SSO A;  1TXY A;  1TS3 A;  2Q8T A;  2OCE A;  3A0J A;  2N49 A;  5JJZ A;  3QJY A;  4JI7 L;  4Y52 H;  1VQ4 A;  2QA4 A;  1L1O A;  1WCM G;  2HHH Q;  3VR5 A;  3TZD A;  3NP8 A;  3STB D;  3A55 A;  3GTL B;  1IW7 C;  2D2C C;  3ERO A;  4P75 A;  5CMD A;  3F2B A;  4LUZ A;  1Y69 U;  2RHQ B;  4B3T Q;  2M00 A;  3KK7 A;  2ALY B;  4RKL A;  2EYO A;  3I90 A;  1TWH B;  4MTN A;  2FFK B;  3ULP A;  1EQT A;  1L0X B;  1QUQ B;  1X56 A;  4A3G G;  4DR2 L;  2UXB L;  4X65 L;  2EYL A;  1ENA A;  1QWY A;  4CKC A;  1EZ6 A;  2E8G A;  1XNR Q;  1HNZ L;  5FJ8 H;  4JV5 L;  4G7H C;  3CCQ A;  2C35 B;  4JI5 Q;  4WJW A;  3L9A X;  3L3O C;  4XYQ A;  3CD6 A;  3UDX A;  5C0X J;  2Q2T A;  5EAY A;  4L6T B;  2KOL A;  4EGV A;  3MXU A;  2I0Q A;  2UXC Q;  4RAU C;  1TWG B;  5IOD A;  4R4C A;  3PUY A;  2Q8R E;  1KXL A;  1S5D D;  2IX0 A;  4PMC A;  2DUD A;  3HOU H;  3QOL A;  5DNF A;  1KRT A;  3S24 A;  5JJI A;  3SK5 A;  3TBI B;  1CQF A;  2M2L A;  5JVG 3;  3GTO H;  2L4N A;  1O7Y A;  4BS9 A;  2JA5 B;  1PTO H;  1SNM A;  1QCB D;  3SK8 A;  1WJJ A;  1OXS C;  3S16 B;  3K5O A;  2YU9 B;  5IGB A;  1N32 L;  2C5C A;  2BA1 A;  1KDB A;  3OHX C;  1K83 H;  1ASZ A;  1KNE A;  4A3J H;  3VA7 A;  3GTJ B;  3NK9 A;  3URY A;  1EQV A;  2VL6 A;  1RKN A;  5HUR A;  2LMC B;  4KD3 A;  1ESR A;  4LFC Q;  5HGT A;  1K8A C;  1QG7 A;  2BDN A;  5FO7 B;  1HZC A;  4X64 Q;  4IPH A;  2OQ0 A;  4OON A;  4U68 A;  1K73 C;  1SFO B;  5IYD H;  4HMI A;  1FGU A;  3Q6S A;  2E76 C;  4BBR H;  4IUT A;  1P16 A;  5CR3 A;  2DNC A;  4ID6 A;  3V96 A;  1FL0 A;  4G7O C;  1MGS A;  2Y0S G;  4XT3 B;  3O13 A;  4TKO B;  2PZU A;  4X65 Q;  1JE4 A;  1H9J A;  2EXZ A;  4UHV A;  3WWV A;  4U67 3;  4BY1 G;  1DJR D;  2B2W C;  2K50 A;  3LGJ A;  4DUZ L;  1D2B A;  3Q24 A;  1X6O A;  1KLU D;  1DYQ A;  2IWH A;  4KHV A;  2VQE L;  1FNV A;  4GZY C;  3GP7 A;  1E2Z A;  3DLL A;  1SYG A;  4X3T A;  2WB1 G;  4ZCK A;  1HA5 A;  4DV7 L;  5GQO A;  3SE0 A;  2R93 H;  4LF8 Q;  5C0X H;  3J80 L;  2JA8 B;  4QGU A;  2HCC A;  1N33 L;  1LTS D;  3ND8 A;  3W5O A;  2K1B A;  2VB3 X;  1F9Q A;  5ELD A;  1RDP D;  2AWN A;  2B2U A;  3T1Y L;  1GJX A;  2BA0 A;  3A54 A;  4FF4 A;  4LFB Q;  3OTO Q;  2A74 C;  3NHH A;  1R9T H;  3HGB A;  4L5R C;  4OXP A;  5I6W A;  4A3K G;  2PZT A;  3X3N A;  1XTD A;  1IBM L;  1UUP A;  4M1U B;  5C4J H;  2KA7 A;  1X65 A;  4AIM A;  1LT5 D;  3BZK A;  4DV1 Q;  3BDL A;  4EQ5 A;  5IP9 H;  3KOJ A;  1PH8 A;  4A3E H;  3NBH A;  1JQY D;  2WIN B;  4H0L C;  3RZD B;  1V1P B;  4POG A;  1QB5 D;  4UY8 C;  2B63 B;  1SR3 A;  1SLJ A;  1Y1W G;  5BN5 A;  4HIK A;  2A6E C;  1GHJ A;  3D31 A;  3I72 A;  4GOP A;  3JAM c;  4A3F B;  2XGT A;  4K0K L;  4JI0 Q;  3R93 A;  1VQ6 A;  1B3Q A;  4BXX G;  2PZW A;  4JI2 Q;  1R4P B;  1G2T A;  3GTO B;  2AQ1 B;  1HR0 Q;  4A3M H;  1D8L A;  3F2D A;  2QIL A;  5JPM C;  2XWB B;  1EYG A;  2AKW B;  2SOB A;  1M90 C;  1WCM B;  5C4X G;  1K83 B;  4BBR B;  3JAM E;  4HJA A;  3F2C A;  5KGU A;  3GTJ H;  2PQA B;  3N6R A;  1HXY D;  1GUS A;  1EZ8 A;  2UUA Q;  2UUC L;  3J7A F;  3J81 i;  2AQ3 B;  1X3G A;  1EUJ A;  4CBV A;  2PQE A;  1H9R A;  4F88 A;  2OQK A;  1ESF A;  1X32 A;  1EOT A;  1Z7T A;  4O0A A;  4NXM Q;  1PH4 A;  1CK1 A;  1X3F A;  3KF6 B;  2PCF B;  1LV9 A;  5C4Z A;  4OIK A;  5FO8 B;  3H94 A;  3K5L A;  1RTO A;  4OGQ C;  2Q8I B;  4PG3 A;  3GTP B;  1YJN A;  3S1Q B;  2MPM A;  2K5Q A;  4C3H B;  1DGS A;  1M1K C;  2ICI A;  3H09 A;  2E2H H;  3TSS A;  2CCZ A;  1STG A;  4K8I A;  4H02 A;  1WTQ A;  1J6Q A;  3CKI B;  3A5Z B;  3TP5 A;  1ROD A;  1A8V A;  2F0Q A;  1KDA A;  4RGO S;  1K28 A;  4RA8 A;  3CCM A;  1BXT A;  3A74 A;  1SMY C;  1H95 A;  4K0K Q;  2F0J A;  1PA6 A;  4N8X 1;  4GKK L;  1KHI A;  1SXT A;  3HEJ A;  2B8G A;  2IJ0 A;  5C4J B;  3RN5 A;  2GN5 A;  2UU9 Q;  2F0O A;  5K5P A;  4X3U A;  4IJH A;  3T1H L;  1PMR A;  2VS1 A;  3RLO A;  3G71 A;  4A3E G;  1SJE D;  2X6G A;  3GV6 A;  2B8F A;  4I65 A;  1SE3 A;  1ET6 A;  2CVR A;  3PO2 G;  5K36 H;  4JI4 L;  1SAP A;  1I94 L;  1U5K A;  2UXB Q;  2YYZ A;  5IYC G;  3QR8 A;  1VQJ A;  1IZ6 A;  4GN3 B;  3VDY A;  2A6H C;  2F0L A;  3I91 A;  2JA7 B;  5LMN W;  2A6H D;  5I2X A;  1SE2 A;  4V0B A;  4HJ9 A;  4BXX H;  4QUF A;  4PMB A;  3M7G A;  1S5F D;  4FXG C;  5C4X H;  3HKZ E;  1F2L A;  1HTL D;  2JA6 B;  4KKS A;  5L37 A;  3HOU G;  4GOP C;  2PW5 A;  5CV6 A;  2KQ3 A;  3IFD A;  5M3M B;  2F4V Q;  1A3V A;  3PUW A;  4JBW A;  4LF4 L;  4LF8 L;  4DR5 Q;  3Q0A A;  2WAQ E;  1SYD A;  1E7Z A;  2F3W A;  5A2Q E;  2NVT H;  1STN A;  1UE7 A;  2LXK A;  1DOM A;  4K8J A;  3GTK B;  4DR5 L;  2CH4 W;  1B3A A;  2F0M A;  1H9K A;  1J5E L;  4APV A;  2DNE A;  1VQM A;  1BNZ A;  4C3I B;  1CKM A;  3ICE A;  1RF2 D;  5COY A;  4CDE C;  4Z9C B;  2IHE A;  2E2H B;  2ICE C;  3FDT A;  2FJ2 A;  4FDB A;  4A93 G;  3S2H B;  2B2Y A;  4UP7 A;  4IOC A;  3BZD B;  1I4X A;  3HOV G;  3EFX D;  1NE3 A;  2IPK D;  2QDL A;  3H3V C;  1IBK Q;  2F4I A;  4J8Q A;  5DEH A;  1HQM C;  1UE6 A;  5CV4 A;  4RMF A;  4A3B G;  3BYY B;  4IPG A;  3NQI A;  1PTO D;  1KAB A;  1LM0 A;  1EIY B;  5M5X B;  4RFB A;  4GLV B;  3NEN A;  3KUP A;  4XIG S;  2AUK A;  3MZ5 A;  4DV6 Q;  4MTK A;  3OOC A;  1YNX A;  3I4O A;  4A3D G;  2KCM A;  3S1Q H;  3HOY G;  4RCN A;  1V1P A;  3I4M H;  5IYB G;  1H9S B;  1FR3 A;  2EJG C;  3S16 H;  1G91 A;  2B2T C;  1B4O A;  4ULL A;  3S1N H;  1S3O A;  1HNW Q;  5J22 A;  1Q82 C;  1S4Z A;  5LL6 X;  1CKN B;  2VQF Q;  4WFN 3;  4KLK A;  1JE5 A;  4PMW A;  5C0X I;  1KAW A;  4NW2 A;  1PRT D;  1TS2 A;  1PRT B;  3HKZ B;  3MC0 B;  5AJ3 Q;  1LT3 D;  3H0G H;  2CHB D;  1WD1 A;  4LF9 L;  3HOX G;  3T13 A;  2G9H D;  4XYO A;  4B9W A;  3PUX A;  1KIX A;  1H9M A;  3CCV A;  1CFM A;  1HHV A;  4YHH L;  2WB1 B;  2PQA A;  3TME A;  1QNK A;  1DCZ A;  4DUY L;  4X3K A;  4DFA A;  1X3P A;  1L1O C;  3UDF A;  4A76 A;  4F8M A;  3BJU A;  3G4S A;  2EZV A;  3DXJ C;  5F2D A;  1LTB D;  2EYH A;  4JI6 Q;  2O5J C;  1A0I A;  5CV8 A;  2DY8 A;  3U58 A;  4DV3 L;  2NB0 A;  1DZ1 A;  3ZYY X;  1OO9 B;  3C3L A;  4JBK A;  1LTL A;  5CYU A;  3HOZ H;  5ELF A;  3TS0 A;  2EY5 A;  2KHS A;  2NVT B;  5JOB A;  4DAV A;  1N9W A;  4AYB G;  2HDL A;  3I2Z A;  4DXG A;  3NUC A;  1JC7 A;  4CDC C;  1C7Y A;  3BYT B;  2MUY A;  2ZTC A;  2F52 A;  1CI3 M;  1XMQ L;  2UUA L;  1NUC A;  2FHT A;  3D4D A;  1BR9 A;  1ET9 A;  5LHY 1;  1YIJ A;  1PH6 A;  2F0D A;  3CXC A;  3I4N B;  1BKB A;  4K5X A;  4LF5 L;  5J1Z A;  1Q46 A;  5C44 G;  1WD0 A;  1WTO A;  4K5V A;  4A75 A;  2RCF A;  2RF4 A;  3K6O A;  5ELN A;  4JI2 L;  1CT1 D;  1PH3 A;  4IJL A;  3NWS A;  3I4M G;  5JPN C;  2D5D A;  2L5T A;  2E74 C;  3D6W A;  2DY7 A;  4L5Q A;  3F1Z A;  4LF7 Q;  1X3Q A;  2DJF C;  1MBY A;  3W3A A;  3M3Y B;  2B2Y C;  3VR6 A;  4CHT B;  2EE1 A;  4DV0 Q;  1SRU A;  2L11 A;  2QW7 A;  3DMU A;  2VUM B;  4DK1 A;  3KLS X;  3KLW A;  4B3S L;  2B63 H;  3A56 A;  4DKA C;  1TS4 A;  1JIC A;  3BU2 A;  1LT4 D;  3TDQ A;  3I55 A;  4DGZ A;  2OXP A;  1PFN A;  3FPU B;  1QZG A;  2C9O A;  1U9R A;  3EA6 A;  4DV6 L;  3S2H H;  1HCZ A;  5ELO A;  2VY3 A;  4O1N A;  1UWV A;  1PZI D;  1W2B A;  5CV9 A;  3M4O B;  3CCR A;  1M4V A;  2SEB D;  5GAD C;  1HZA A;  1J8I A;  4UPA A;  4LFB L;  3HOX H;  2AWO A;  2PMZ E;  1CTM A;  2XNA C;  3H0G G;  3R2I A;  1NMF A;  4LJZ C;  2QGQ A;  3QB3 A;  4K14 A;  1N33 Q;  2R92 H;  3GTM H;  4DNT B;  3G6J B;  2B2U C;  3CCJ A;  3K0Y A;  1I6H H;  4LF7 L;  3J7A 5;  4IAL A;  2FIN B;  5COR A;  5IP7 G;  3PO3 G;  4DR1 L;  2E2D C;  4N9P A;  3K8A A;  1VQO A;  3E3X A;  2M9V A;  1TT2 A;  3C1E A;  1KRS A;  3EBE A;  3U9O A;  1O7L A;  1JOR A;  2OF1 A;  1L1O B;  2WAQ B;  5GRO A;  1IXR A;  1VQD A;  3RZO H;  2E2I B;  3DWP A;  3QG1 A;  4C1N K;  2BH2 A;  3J80 i;  2F0T A;  1L2F A;  1VQK A;  5EKI A;  5I6Y A;  1AFP A;  5E4X A;  3PO2 H;  1PXU A;  4JYA L;  1D1K A;  3CME A;  5C44 H;  3W1G A;  3DHQ A;  3HFZ B;  5EKL A;  2O4X A;  3BG3 A;  4IPC A;  3JC6 6;  1WTW A;  3HOY B;  1GUW A;  2R61 A;  4OO1 G;  3OWE B;  4L63 B;  3P1H A;  3S1M B;  2RHS B;  3PIO 3;  3S2D H;  4QMG A;  1YHB A;  4XQJ A;  4HJ5 A;  4X64 L;  4DPG A;  1LO5 D;  3S14 B;  1QVG A;  3J81 j;  1RTN A;  4A3B B;  3NXW A;  4UP9 A;  1VQG A;  2Y0S E;  3GD7 A;  4XQN A;  4FF2 A;  1WYD A;  4YHH Q;  2XWJ B;  3R8B A;  2NVY B;  5KND A;  1GKH A;  5GAG C;  2K5V A;  4A93 B;  5FLM G;  2JSO A;  1EYD A;  4LF9 Q;  4CJ2 C;  1K0R A;  4P72 A;  4CJ1 B;  1YI2 A;  3RMH A;  1RHP A;  1F2Z A;  5DM6 3;  1EU3 A;  3NPP A;  1VMP A;  4J6H A;  4QIW B;  1V9P A;  4Y7N H;  2O5I C;  2A69 C;  2VXW A;  2ATW A;  2NN6 I;  1Y1V B;  5JJL A;  1XNR L;  4UP8 A;  1GOZ A;  2FMC A;  1L0Y B;  4LFA Q;  4ZUI A;  4DR2 Q;  1EQR A;  3MXG A;  5ELC A;  3J81 L;  3S1N B;  3EIV A;  1EY8 A;  1FYC A;  2D62 A;  2EIF A;  4B9X A;  2ZTE A;  4A3L H;  1JOO A;  3VYU A;  1QVF A;  2J0T D;  3E0E A;  4JI7 Q;  5GAE C;  4N8F A;  2R7Z G;  4ZK9 B;  2JA8 G;  1B8A A;  4HMJ A;  5EGT A;  2L9H A;  2K28 A;  4MZ9 A;  1S5B D;  2AUJ D;  1SEB D;  2OWO A;  2PI2 E;  4NB3 A;  4DR3 Q;  1GO3 E;  3RLF A;  3A8J E;  3DWA A;  2WP8 J;  3HS0 C;  1CM9 A;  3PUZ A;  2VQE Q;  1ENC A;  2F0E A;  2I46 A;  1I4P A;  2EJM A;  2K7V A;  3BVM A;  3RZD H;  1TU2 B;  2E2J B;  4ZKC B;  3FMC A;  2BH8 A;  2E75 C;  4X66 L;  2L0C A;  4P2C B;  2Y0S B;  4S3S A;  1XXG A;  1HFG A;  5D14 A;  2E5L Q;  1DM0 B;  1S5C D;  4HSP A;  1NY4 A;  2Z6K A;  2PNH A;  2K52 A;  2LFN A;  5IYB H;  1TWG H;  1K3R A;  3EVQ A;  1VQ7 A;  1R9T B;  1A62 A;  1WFQ A;  3CW2 C;  5KYL A;  2CW0 D;  5FLX E;  4X6A H;  2KEN A;  3HOZ B;  3I4N H;  3J80 c;  4K6D A;  3NTK A;  5M5W B;  1PDQ A;  2RSN A;  1BO0 A;  1CZW A;  3MWY W;  2CH4 A;  3KLS A;  3PSI A;  4K2K A;  2JEB I;  1U4P A;  1E22 A;  1II3 A;  4DF7 A;  1STE A;  4GOP B;  4KHP L;  3NSW A;  4IUV A;  4QUC A;  1NCV A;  1VF5 C;  5M9O A;  1KNA A;  1A15 A;  1G51 A;  5D65 A;  4LNQ A;  4A3F H;  2WB1 E;  4BY1 H;  4DR6 L;  3PQI A;  3BVZ A;  3MEH A;  1JT8 A;  1OXX K;  2RQX A;  3NEM A;  3CCS A;  1J9O A;  3RNU A;  2R7Z B;  4QJF A;  4IOA A;  2MNA A;  3K80 C;  4A3L G;  4QCL A;  2KVM A;  2X69 A;  4JOI C;  3CC2 A;  2Q2I A;  2BCO A;  2F1M A;  4EQO A;  4NXN L;  4OWW B;  1DOL A;  2LSS A;  4C2M B;  1JOK A;  4ILW A;  3HOW G;  4A93 H;  4KMU C;  1MJC A;  2A6E D;  3LWE A;  2AMC B;  2WKD A;  3Q23 A;  1L0W A;  5IWA Q;  4OL7 A;  2ZXR A;  1UEB A;  5IY0 A;  1VCI A;  5K36 G;  1VQE A;  2RDF A;  3I4N G;  1KAA A;  3G48 A;  2PMZ B;  1E0B A;  1EEI D;  4HCS A;  2SNS A;  4B3R L;  2O2L D;  5C4H A;  5E7N A;  5IWA L;  2YV5 A;  4IN3 A;  4ZLT F;  2EYP A;  1CKO A;  1SNC A;  1OXU A;  3WOF A;  1EYC A;  2F0N A;  1KD1 C;  4NXN Q;  4YWL A;  4Q5V A;  2P5Z X;  4L5T A;  2F0U A;  1I4R A;  2MO1 A;  5LMU Q;  3FP9 A;  3GQB A;  4PZ7 A;  4XQQ A;  2ENB A;  1SNQ A;  4UAI A;  1VQ8 A;  1N8R C;  3MXP A;  2ES2 A;  4A3K B;  3C2P A;  5JJK A;  2UUC Q;  1N32 Q;  4KY5 A;  1XWE A;  4OWX B;  2ZXP A;  3KBX A;  1VQL A;  1HQR D;  4ZUJ A;  1DD2 A;  5H1S E;  4BBS B;  2EY6 A;  4C3J G;  4FF3 A;  1EFI D;  1F2Y A;  2RBM A;  4GS3 A;  2K33 A;  5CV5 A;  4LMQ D;  1TS5 A;  4PZ6 A;  4DR6 Q;  3BZC A;  3J7Z C;  3K7A B;  2NZ1 D;  1AZQ A;  2PYK A;  2HIV A;  2AQ2 B;  2MQH A;  4MHE A;  2OTL A;  1O78 A;  2TMP A;  5GAH C;  1UE1 A;  1IL2 A;  1XJV A;  3S1R B;  4BWG B;  1IBK L;  1IYV A;  2UUB L;  1D1I A;  3NE5 B;  2ID0 A;  1BDO A;  1ICW A;  1OXT A;  2RDH A;  1WTP A;  3OIP A;  5ISR A;  1AN8 A;  1HNX L;  4B3M L;  2RKS A;  1S72 A;  3LX0 A;  4R8I A;  3S15 H;  2NWG A;  3D0F A;  3L0O A;  1Q1B A;  4LW1 A;  3PO3 B;  3NEL A;  5JAV A;  3MXN B;  3ND9 A;  1EFW A;  4A4I A;  3I56 A;  4HAE A;  1IYU A;  1BBW A;  5C4X B;  2ZM6 L;  2F0K A;  1QIL A;  2B39 A;  2OEO A;  3EJI A;  3H15 A;  1B1Z A;  1O7Z A;  3OTO L;  4DV5 Q;  1VQC A;  4R4Q A;  3AQQ A;  4DR3 L;  1WOC A;  1TWH H;  1STH A;  4C2M H;  3S14 H;  1GVP A;  3B6Y A;  1ML0 D;  1V1O A;  5BR8 L;  1TII D;  4DV7 Q;  3GTG H;  2WKC A;  2XRQ D;  3MEF A;  1UE5 A;  2F3I A;  4DV5 L;  2JA5 G;  1D5Z C;  1EY9 A;  1VDZ A;  4FNF A;  3HG9 A;  2BE5 C;  5C0X G;  4JOI A;  5CV7 A;  3CU7 A;  4NDX A;  2HD3 A;  4P73 A;  4DUZ Q;  2A1A A;  3S17 B;  4JI6 L;  5EBD A;  1ILQ A;  4WRD A;  4N9T A;  4UDU C;  3SHL A;  3HOU B;  3KFU A;  4NP5 A;  1YHA A;  1EEF D;  4FF1 A;  2EJF C;  1LAB A;  1PZJ D;  4DV2 Q;  2K5N A;  4BBR G;  1VQN A;  3CCL A;  1HZB A;  2ZXO A;  1N34 Q;  1NSN S;  4YY3 Q;  5IIF A;  2CFM A;  4JBJ A;  1IW7 D;  4CDD C;  1Y8N B;  4OX9 Q;  2N78 A;  3U4V A;  3D4W A;  3KF8 B;  4CKE A;  2L1B A;  3AU7 A;  4HR7 B;  5IP9 G;  2NVQ B;  2N3S A;  4NPS A;  4K6L A;  3NQT A;  1D6E C;  1SMY D;  3JAM i;  3S1R H;  1HNW L;  3OIQ A;  1W3S A;  5T1I A;  2BDO A;  3SK4 A;  1B53 A;  3IL8 A;  3ITP A;  4IUN A;  2JE6 I;  1RCV D;  2K14 A;  1PH5 A;  2HT1 A;  3A8K E;  3K57 A;  2IY5 B;  1IBL L;  4ME5 A;  1Q8K A;  3ERQ A;  2F03 A;  2K4K A;  1PFM A;  3OW2 A;  3H91 A;  4DK3 C;  4G7Z C;  1XNQ Q;  4OEL B;  1XPO A;  3I8Z A;  1X9N A;  3CQZ B;  3P75 A;  2N8N A;  3A8I E;  1K9M C;  3BVG A;  1SYF A;  4DAY A;  4OWT B;  3E9I A;  1TWF H;  3K5M A;  3AB9 A;  5IGD A;  2QCP X;  5ELE A;  1QUQ A;  1Z47 A;  2MHV A;  4A3D H;  3A7L A;  3A7A B;  4B3R Q;  4DK6 C;  2NTS A;  3DEO A;  3VR3 A;  1G6Z A;  3M85 A;  2NVX B;  5IGF A;  3H3V H;  3ULJ A;  1WTH A;  1J5E Q;  1GM5 A;  5EKK A;  4POF A;  1SFO H;  3FKI G;  4V19 0;  1B7Y B;  2GA4 B;  3GTQ H;  3W1B A;  2K5D A;  2XRS D;  1FVI A;  4IUU A;  2R7F A;  2Z0S A;  3CHB D;  2K6A A;  4RHS A;  2I5H A;  4GLX A;  1D7Q A;  1JWM D;  1U4R A;  1PRT F;  2F0F A;  4A3M G;  4DR1 Q;  1YJW A;  3AEV A;  4YWK A;  1M8A A;  2R7D A;  4OHJ A;  1PFB A;  1UAP A;  3SXH A;  2PI2 A;  3CCU A;  1B70 B;  4JVZ A;  1UEA B;  5M5W H;  1NTG A;  2K5W A;  2JXM B;  3PIP A;  1RD9 D;  3CC7 A;  3SK6 A;  3RN2 A;  4KHZ A;  2EY1 A;  3GTM B;  2R92 B;  4DXF A;  1B2T A;  4R1J A;  1KDC A;  1Q90 A;  1IBM Q;  4LAA A;  1JWS D;  4ABN A;  1LUZ A;  4BA1 I;  3PIO A;  4DR4 L;  5CGK A;  2JA9 A;  4QL5 A;  1JOQ A;  2F0S A;  4B3S Q;  2VUM G;  4O2D A;  4A3C H;  4YCU A;  1GUT A;  5D3D A;  4K2L A;  4CKB A;  1STA A;  2BE5 D;  4DV0 L;  1SBB B;  3IFT A;  4DU9 A;  4YCV A;  1I3Q H;  1X55 A;  5DLQ E;  4GN4 B;  5BN4 A;  3IRB A;  1PH7 A;  3MXN A;  4ZYS A;  2NVQ H;  2ZJR A;  1PYB A;  1FJG L;  1SYE A;  4FO2 A;  1MJE A; 
#chains in the Genus database with same CATH homology
 1T5X D;  3TP7 A;  3SEB A;  2A68 C;  3DUZ A;  1VF7 A;  5I2Y A;  5G3L D;  1TKW B;  1YNN D;  4EVO A;  1HA6 A;  5C44 B;  1QJO A;  1PRT C;  2N55 A;  3IKJ A;  1EY5 A;  4RH6 A;  5IGC A;  5C3E B;  3GO5 A;  3T53 B;  5C6A A;  1GUN A;  1SNP A;  4IZ8 A;  5FK9 C;  2LY7 A;  4WOR A;  2F0G A;  5FO9 B;  1TR5 A;  3MVV A;  4R8N A;  5AFW A;  4RGT A;  1Z6H A;  4KY6 A;  1BCP F;  1QNU A;  5CBE E;  5CC4 A;  1PTO F;  1PTO B;  2K04 A;  2QEJ C;  4RKB A;  3U9S A;  4JK1 C;  1C48 A;  2EY2 A;  1SDF A;  1CHP D;  2SNM A;  5I4D A;  3R3O A;  3I4L A;  3VR4 A;  1HRJ A;  5FOB B;  1A2T A;  5KIX A;  4KKU A;  5I9O A;  1YNN C;  1F2M A;  3TN2 A;  2NUC A;  2J4X A;  4KKT A;  4ZRZ A;  3P7J A;  2ZT9 C;  4IFD I;  1I50 B;  4KV6 A;  3GV3 A;  3VYR A;  2MGS A;  1TWA B;  4IQZ A;  3BDC A;  2SDF A;  1PTO C;  4G4K A;  1EY0 A;  3HOV B;  1IKM A;  1I3Q B;  4L8J A;  1HPC A;  2K05 A;  2RDG A;  1W6K A;  2WV6 D;  1LTA D;  1A3U A;  1D5X C;  3TZU A;  4IFD J;  4RGM A;  4PNY A;  2R6G A;  4RHR A;  5I9P A;  4RGN A;  2HCI A;  3G7L A;  1IL8 A;  4HN7 A;  1R4Q B;  1Y1W B;  1UNS A;  5KYI A;  3E5S A;  1CQV A;  3N52 A;  3C1F A;  5BN3 A;  2B2T A;  3D6C A;  5A35 A;  3OSO A;  3VR2 A;  3SDZ A;  3OMC A;  4KTA A;  1I4G A;  3P20 A;  4DA2 A;  1WTR A;  4TRD A;  2WAC A;  1ONL A;  1EIH A;  5TSS A;  1LTI D;  3V2T A;  3PMF A;  4ZAI A;  1HUM A;  4F87 A;  2HDM A;  3KLR A;  3BS1 A;  3QIA A;  1I6H B;  2JYO A;  4KJO A;  1G29 1;  4IFD H;  1C8C A;  3LWU A;  5DM7 3;  3PO2 B;  1OXV A;  4KK7 A;  1BQQ T;  1STY A;  4A3G B;  1B44 D;  3T16 A;  1BBX C;  1JB3 A;  3S15 B;  3RZO B;  5CBA E;  2MJ8 A;  1Q12 A;  3UI2 A;  2JEA I;  2QF7 A;  1A3T A;  2B2W A;  2NN6 H;  2J7Z A;  3HZX A;  3RD4 A;  1ZYR C;  1BUV T;  5G3L F;  2F3V A;  1S5E D;  4M8A A;  3HOW B;  4LK1 C;  5E4W C;  2IX3 A;  2PNR C;  2K01 A;  1BCP C;  3W2D A;  1AEX A;  1V8Q A;  1FNW A;  2V4D A;  1AW7 A;  2RA4 A;  4BA2 I;  1DXM A;  3TP6 A;  5FLX L;  3NBI A;  4KY7 A;  4RWS C;  3KBG A;  2F0H A;  1CZG A;  3WOE A;  1BOS A;  1EL0 A;  2MP1 A;  1SJH D;  4H7B A;  1WTV A;  1AZP A;  1JR0 D;  5JEA G;  1TY0 A;  5JVH 3;  1ZEQ X;  1EY7 A;  1TQO A;  1FGB D;  3I4M B;  2IT1 A;  2IW3 A;  1G2S A;  2VNU D;  2HUG A;  1JWU D;  3X3M A;  1A2U A;  5EQ0 A;  1K8M A;  2F0W A;  2RVL A;  1NR2 A;  1E2V A;  3H0G B;  2G9D A;  2RSO A;  1CA5 A;  1ILP A;  5DAU A;  2A68 D;  2IX1 A;  4Q0F A;  5KNB A;  2A73 B;  3MAQ A;  1TY2 A;  1GXD C;  4MIU A;  3R2T A;  1HTP A;  4IUQ A;  3S9W A;  3JAM L;  1YNJ D;  4TSS A;  1HUN A;  1EIG A;  4IUR A;  4CGY B;  5C3W A;  3VYT A;  5FKA C;  3QOJ A;  3J81 E;  4XXE A;  3QO2 A;  2NN6 G;  1RJT A;  3DEP A;  1Y8O B;  5J39 A;  1EYA A;  2NYZ D;  4R9W A;  1PZK D;  2D9U A;  4X3S A;  3FEW X;  2K03 A;  3H6M A;  3S2D B;  1LTG D;  2I07 B;  4OO1 I;  1XTC D;  3MFY A;  2JP1 A;  2KED A;  2L55 A;  1BCP D;  1I6V C;  1XX8 A;  2A69 D;  2F0P A;  3D8G A;  4F7X A;  3I73 A;  5M3F B;  1EU4 A;  3RUZ A;  2EOT A;  4EQP A;  3J7A V;  4BY7 B;  2KUM A;  1ZYR D;  4A3E B;  5JEA H;  1MI2 A;  2KEC A;  1NR4 A;  1O80 A;  2TSS A;  1SNO A;  5IT9 E;  4BY1 B;  4FXD A;  5IGG A;  1F9P A;  2KEE A;  4FXK C;  1SE4 A;  1EWC A;  2XN9 C;  3MHB A;  5EPJ A;  3HOX B;  2Z4I A;  4C3I G;  2EYJ A;  3M4Y A;  5IOC A;  1QOH A;  3KF8 A;  3DWQ A;  4O42 A;  1BF4 A;  2Z1C A;  3T51 B;  2KCN A;  4XDX A;  2N88 A;  3Q22 A;  4C1N I;  2B2V A;  3VYS A;  3WDN A;  1C4Q A;  3MTS A;  1FD7 D;  5EPL A;  4C3J B;  1U4M A;  5JEA J;  1MSH A;  4PV1 C;  1F77 A;  5T1G A;  5EPK A;  2DN8 A;  2F0V A;  4EQN A;  2B2V C;  4HCE A;  2A5H A;  2VB2 X;  1Q8I A;  2QDB A;  2X6L A;  2EYM A;  5LL6 S;  4IFD G;  3T4A C;  1LLR D;  2H4O A;  1Q1E A;  4PQX A;  2CW0 C;  1MD2 D;  1KLG D;  1I4H A;  5KEE A;  3PUV A;  1LTT D;  4QB4 A;  1WVL A;  3FVQ A;  2IL8 A;  3IAY A;  2EVB A;  4DAP A;  1LAC A;  1WTX A;  3K5N A;  3GTG B;  1VMC A;  5EBC A;  2PW7 A;  2LS0 1;  3FPP A;  3SVM A;  2PPB C;  3OPO A;  4A3M B;  4TQU S;  1YNJ C;  1CA6 A;  4A3I B;  4XT1 B;  3NWT A;  2LKV A;  1T5E A;  2XVS A;  2R3Z A;  2EDG A;  5E3F A;  1JCK B;  3E0J A;  5IGE A;  5IT9 L;  4OO1 H;  2CQA A;  1ENF A;  2H1E A;  4NMZ A;  2Z8L A;  1G8Z D;  3OWF A;  4HSV A;  4ODG A;  5A2Q L;  3OMG A;  1D5M C;  4QF4 A;  1U4L A;  1KTK A;  2WII B;  5M5Y B;  1F9S A;  4A3J B;  5C5L A;  4NKL A;  3QWN A;  3E6Z X;  3BDO A;  1ZXT A;  1W6J A;  1B9N A;  1I4Q A;  4FVM A;  3HRZ C;  1B9M A;  1GHK A;  4J1M A;  3MFG A;  3NTI A;  3J80 E;  2XSC A;  3MA2 B;  4H44 C;  1Q3L A;  2FMM A;  4KD4 A;  4KJN A;  4B08 A;  1AP0 A;  3I3C A;  3FRP B;  3AMU A;  3M7N A;  3V05 A;  2KJX A;  3J7Y W;  1CHQ D;  5D3I B;  1GUG A;  3LNN A;  2L12 A;  5C3X A;  3PIP 3;  3K58 A;  3EQL C;  4CJ0 B;  1ZKO A;  2HQE A;  1NAP A;  4OIJ A;  5NUC A;  4ZQ3 A;  1STB A;  3TP8 A;  1FNU A;  1Y8P B;  2OT2 A;  3GTQ B;  4YIJ A;  4A3D B;  3SR1 A;  1SYC A;  1DOK A;  2QKI C;  1E2W A;  1GUO A;  5E1F A;  4Y7N B;  4DK0 A;  1LT6 D;  3OW7 A;  1H9S A;  1V43 A;  3F2U A;  4KN4 C;  4DNR B;  4C56 C;  4KN7 C;  2EPB A;  1SND A;  3HP3 A;  1LTR D;  3D4R A;  4K5W A;  1TWF B;  1K8O A;  3CRL C;  1XYI A;  5EJW A;  3C46 A;  4E6I A;  5C5M A;  3K59 A;  3PV0 A;  1PLF A;  4AYB B;  1B50 A;  1SYB A;  1IKL A;  1EY4 A;  4KI0 A;  4DN4 M;  1HFN A;  4ZKB B;  4FP5 D;  4I7Z C;  3NTH A;  1BCP B;  2KCC A;  4XTC S;  3FKI B;  4MN3 A;  4FYD A;  4HTH A;  4H13 C;  5KNC A;  2PO4 A;  1QE6 A;  1TWC B;  2BOS A;  2NBF A;  5KRU A;  1MSG A;  3ONA B;  4HED A;  3T56 B;  4RCO A;  1TVX A;  3DM1 A;  2NTT A;  1A6X A;  3VA5 A;  4C3H G;  2F0I A;  2R93 B;  3D3R A;  2K32 A;  1EY6 A;  1DON A;  1EWH A;  1F9R A;  3I70 A;  4G57 A;  2XIW A;  3L7Z C;  2EYF A;  2Z4H A;  1IHZ A;  1PYW D;  5ELB A;  4IUP A;  3CRK C;  1SSO A;  1TS3 A;  2Q8T A;  5JJZ A;  3QJY A;  3VR5 A;  3TZD A;  3NP8 A;  3A55 A;  3GTL B;  1IW7 C;  2D2C C;  3ERO A;  5CMD A;  1Y69 U;  2M00 A;  3KK7 A;  4RKL A;  2EYO A;  3I90 A;  1TWH B;  2FFK B;  1EQT A;  1L0X B;  2EYL A;  1ENA A;  1QWY A;  4CKC A;  1EZ6 A;  4G7H C;  4WJW A;  3L9A X;  3L3O C;  4XYQ A;  5C0X J;  4L6T B;  2KOL A;  4EGV A;  3MXU A;  4RAU C;  1TWG B;  5IOD A;  3PUY A;  2Q8R E;  1S5D D;  2IX0 A;  4PMC A;  3QOL A;  5DNF A;  3SK5 A;  3TBI B;  1CQF A;  2M2L A;  5JVG 3;  2L4N A;  1O7Y A;  4BS9 A;  2JA5 B;  1PTO H;  1SNM A;  1QCB D;  3SK8 A;  1OXS C;  3S16 B;  3K5O A;  2YU9 B;  5IGB A;  2C5C A;  2BA1 A;  1KDB A;  3OHX C;  1KNE A;  3VA7 A;  3GTJ B;  3NK9 A;  3URY A;  1EQV A;  1RKN A;  5HUR A;  2LMC B;  4KD3 A;  1ESR A;  5HGT A;  1QG7 A;  2BDN A;  5FO7 B;  1SFO B;  4U68 A;  4HMI A;  3Q6S A;  2E76 C;  4IUT A;  5CR3 A;  2DNC A;  4ID6 A;  3V96 A;  4G7O C;  1MGS A;  4XT3 B;  3O13 A;  4TKO B;  2PZU A;  1JE4 A;  1H9J A;  2EXZ A;  4U67 3;  1DJR D;  2B2W C;  1D2B A;  3Q24 A;  1KLU D;  1DYQ A;  2IWH A;  4KHV A;  1FNV A;  4GZY C;  3GP7 A;  1E2Z A;  1SYG A;  4X3T A;  1HA5 A;  3SE0 A;  5C0X H;  3J80 L;  2JA8 B;  2HCC A;  1LTS D;  3ND8 A;  2K1B A;  2VB3 X;  1F9Q A;  5ELD A;  1RDP D;  2AWN A;  2B2U A;  1GJX A;  2BA0 A;  3A54 A;  4FF4 A;  2A74 C;  3NHH A;  3HGB A;  5I6W A;  2PZT A;  3X3N A;  1UUP A;  4M1U B;  2KA7 A;  1LT5 D;  3BDL A;  3NBH A;  1JQY D;  2WIN B;  4H0L C;  3RZD B;  1V1P B;  1QB5 D;  2B63 B;  5BN5 A;  2A6E C;  1GHJ A;  3D31 A;  3I72 A;  4A3F B;  3R93 A;  2PZW A;  1R4P B;  1G2T A;  3GTO B;  2AQ1 B;  2QIL A;  5JPM C;  2XWB B;  2SOB A;  1WCM B;  1K83 B;  4BBR B;  3JAM E;  5KGU A;  3N6R A;  1HXY D;  1GUS A;  1EZ8 A;  3J7A F;  2AQ3 B;  4CBV A;  2PQE A;  1H9R A;  4F88 A;  1ESF A;  1X32 A;  1EOT A;  1Z7T A;  1CK1 A;  2PCF B;  1LV9 A;  5C4Z A;  4OIK A;  5FO8 B;  3H94 A;  3K5L A;  1RTO A;  4OGQ C;  2Q8I B;  3GTP B;  3S1Q B;  2MPM A;  2K5Q A;  4C3H B;  2ICI A;  3H09 A;  3TSS A;  1STG A;  4K8I A;  1WTQ A;  3CKI B;  3TP5 A;  1ROD A;  2F0Q A;  1KDA A;  4RGO S;  4RA8 A;  1BXT A;  1SMY C;  2F0J A;  1SXT A;  3HEJ A;  2B8G A;  2IJ0 A;  5C4J B;  2F0O A;  5K5P A;  4X3U A;  1PMR A;  1SJE D;  2X6G A;  3GV6 A;  2B8F A;  4I65 A;  1SE3 A;  1ET6 A;  2CVR A;  5K36 H;  1SAP A;  2YYZ A;  2A6H C;  2F0L A;  3I91 A;  2JA7 B;  2A6H D;  5I2X A;  1SE2 A;  4V0B A;  4QUF A;  4PMB A;  3M7G A;  1S5F D;  4FXG C;  1F2L A;  1HTL D;  2JA6 B;  4KKS A;  2PW5 A;  5CV6 A;  2KQ3 A;  3IFD A;  5M3M B;  1A3V A;  3PUW A;  4JBW A;  3Q0A A;  1SYD A;  2F3W A;  5A2Q E;  1STN A;  4K8J A;  1DOM A;  3GTK B;  1B3A A;  2F0M A;  1H9K A;  2DNE A;  1BNZ A;  4C3I B;  1RF2 D;  5COY A;  4Z9C B;  2E2H B;  2ICE C;  3FDT A;  2FJ2 A;  3S2H B;  2B2Y A;  3BZD B;  1I4X A;  3EFX D;  2IPK D;  3H3V C;  2F4I A;  4J8Q A;  5DEH A;  1HQM C;  5CV4 A;  3BYY B;  3NQI A;  1PTO D;  1KAB A;  5M5X B;  4RFB A;  3KUP A;  4XIG S;  2AUK A;  3MZ5 A;  3OOC A;  4RCN A;  1V1P A;  1H9S B;  1FR3 A;  2EJG C;  1G91 A;  2B2T C;  1B4O A;  4ULL A;  5J22 A;  1S4Z A;  5LL6 X;  4WFN 3;  4PMW A;  5C0X I;  4NW2 A;  1PRT D;  1TS2 A;  1PRT B;  3HKZ B;  3MC0 B;  1LT3 D;  2CHB D;  1WD1 A;  3T13 A;  2G9H D;  4XYO A;  4B9W A;  3PUX A;  1H9M A;  1CFM A;  1HHV A;  2WB1 B;  3TME A;  1QNK A;  1DCZ A;  4X3K A;  4DFA A;  1X3P A;  4F8M A;  2EZV A;  3DXJ C;  5F2D A;  1LTB D;  2EYH A;  2O5J C;  5CV8 A;  2DY8 A;  2NB0 A;  1DZ1 A;  3ZYY X;  1OO9 B;  3C3L A;  5CYU A;  5ELF A;  2EY5 A;  2KHS A;  2NVT B;  5JOB A;  4DAV A;  2HDL A;  4DXG A;  3NUC A;  1JC7 A;  3BYT B;  2MUY A;  1CI3 M;  1NUC A;  2FHT A;  3D4D A;  1BR9 A;  1ET9 A;  5LHY 1;  2F0D A;  3I4N B;  4K5X A;  5J1Z A;  1WD0 A;  1WTO A;  4K5V A;  3K6O A;  1CT1 D;  3NWS A;  5JPN C;  2D5D A;  2L5T A;  2E74 C;  3D6W A;  2DY7 A;  1X3Q A;  1MBY A;  3W3A A;  3M3Y B;  2B2Y C;  3VR6 A;  4CHT B;  2EE1 A;  2L11 A;  3DMU A;  2VUM B;  4DK1 A;  3KLS X;  3A56 A;  1TS4 A;  1JIC A;  1LT4 D;  3TDQ A;  4DGZ A;  2OXP A;  1PFN A;  3FPU B;  2C9O A;  1U9R A;  3EA6 A;  1HCZ A;  4O1N A;  1PZI D;  5CV9 A;  3M4O B;  1M4V A;  2SEB D;  1J8I A;  2AWO A;  1CTM A;  2XNA C;  3R2I A;  4LJZ C;  3QB3 A;  4K14 A;  4DNT B;  3G6J B;  2B2U C;  3K0Y A;  4IAL A;  2FIN B;  5COR A;  2E2D C;  4N9P A;  2M9V A;  1TT2 A;  3C1E A;  3U9O A;  1O7L A;  1JOR A;  2OF1 A;  2WAQ B;  2E2I B;  3DWP A;  3QG1 A;  4C1N K;  2F0T A;  5EKI A;  5I6Y A;  1AFP A;  5E4X A;  1PXU A;  1D1K A;  3DHQ A;  5EKL A;  2O4X A;  3BG3 A;  1WTW A;  3HOY B;  1GUW A;  2R61 A;  4OO1 G;  3OWE B;  3P1H A;  4L63 B;  3S1M B;  3PIO 3;  4QMG A;  4XQJ A;  1LO5 D;  3S14 B;  1RTN A;  4A3B B;  3NXW A;  3GD7 A;  4XQN A;  4FF2 A;  2XWJ B;  3R8B A;  2NVY B;  5KND A;  4A93 B;  2JSO A;  1EYD A;  4CJ2 C;  4CJ1 B;  3RMH A;  1RHP A;  1F2Z A;  5DM6 3;  1EU3 A;  3NPP A;  1VMP A;  4J6H A;  4QIW B;  2O5I C;  2A69 C;  2VXW A;  2NN6 I;  1Y1V B;  1GOZ A;  2FMC A;  1L0Y B;  4ZUI A;  3MXG A;  5ELC A;  3J81 L;  3S1N B;  1EY8 A;  1FYC A;  2D62 A;  4B9X A;  1JOO A;  3VYU A;  2J0T D;  4ZK9 B;  4HMJ A;  5EGT A;  2L9H A;  2K28 A;  1S5B D;  2AUJ D;  1SEB D;  3RLF A;  3A8J E;  3DWA A;  2WP8 J;  3HS0 C;  1CM9 A;  3PUZ A;  1ENC A;  2F0E A;  2I46 A;  1I4P A;  2EJM A;  2K7V A;  3BVM A;  1TU2 B;  2E2J B;  4ZKC B;  3FMC A;  2E75 C;  2L0C A;  4P2C B;  2Y0S B;  4S3S A;  1XXG A;  1HFG A;  5D14 A;  1DM0 B;  1S5C D;  4HSP A;  2LFN A;  3EVQ A;  1R9T B;  5KYL A;  2CW0 D;  5FLX E;  3HOZ B;  4K6D A;  3NTK A;  5M5W B;  1PDQ A;  2RSN A;  1BO0 A;  1CZW A;  3MWY W;  3KLS A;  4K2K A;  2JEB I;  1U4P A;  1II3 A;  4DF7 A;  1STE A;  3NSW A;  4IUV A;  4QUC A;  1NCV A;  1VF5 C;  5M9O A;  1KNA A;  1A15 A;  5D65 A;  3BVZ A;  3MEH A;  1OXX K;  2RQX A;  1J9O A;  2R7Z B;  4QCL A;  2KVM A;  2X69 A;  2BCO A;  2F1M A;  4EQO A;  1DOL A;  4C2M B;  1JOK A;  4ILW A;  4KMU C;  2A6E D;  3LWE A;  2WKD A;  3Q23 A;  4OL7 A;  2ZXR A;  1VCI A;  5K36 G;  2RDF A;  1KAA A;  2PMZ B;  1E0B A;  1EEI D;  4HCS A;  2SNS A;  2O2L D;  5C4H A;  4IN3 A;  4ZLT F;  2EYP A;  1SNC A;  1OXU A;  3WOF A;  1EYC A;  2F0N A;  4Q5V A;  2F0U A;  1I4R A;  3GQB A;  4XQQ A;  2ENB A;  1SNQ A;  4UAI A;  3MXP A;  4A3K B;  3C2P A;  4KY5 A;  1XWE A;  2ZXP A;  3KBX A;  1HQR D;  4ZUJ A;  1DD2 A;  4BBS B;  2EY6 A;  4C3J G;  4FF3 A;  1EFI D;  1F2Y A;  2RBM A;  2K33 A;  5CV5 A;  4LMQ D;  1TS5 A;  3K7A B;  2NZ1 D;  1AZQ A;  2PYK A;  2AQ2 B;  4MHE A;  1O78 A;  2TMP A;  3S1R B;  4BWG B;  1IYV A;  1D1I A;  3NE5 B;  2ID0 A;  1BDO A;  1ICW A;  1OXT A;  1WTP A;  2RDH A;  3OIP A;  5ISR A;  1AN8 A;  2RKS A;  3LX0 A;  4R8I A;  2NWG A;  1Q1B A;  3PO3 B;  5JAV A;  3ND9 A;  4HAE A;  1IYU A;  5C4X B;  2F0K A;  1QIL A;  2B39 A;  2OEO A;  3EJI A;  1B1Z A;  1O7Z A;  1STH A;  1ML0 D;  1V1O A;  1TII D;  2WKC A;  2XRQ D;  1D5Z C;  1EY9 A;  1VDZ A;  4FNF A;  3HG9 A;  2BE5 C;  5C0X G;  5CV7 A;  3CU7 A;  4NDX A;  3S17 B;  5EBD A;  1ILQ A;  4WRD A;  4N9T A;  4UDU C;  3SHL A;  3HOU B;  4NP5 A;  1EEF D;  4FF1 A;  2EJF C;  1LAB A;  1PZJ D;  2ZXO A;  1NSN S;  5IIF A;  1IW7 D;  1Y8N B;  3D4W A;  4CKE A;  2L1B A;  3AU7 A;  4HR7 B;  2NVQ B;  4K6L A;  3NQT A;  1D6E C;  1SMY D;  3OIQ A;  5T1I A;  2BDO A;  3SK4 A;  1B53 A;  3IL8 A;  3ITP A;  4IUN A;  2JE6 I;  1RCV D;  3A8K E;  3K57 A;  4ME5 A;  3ERQ A;  2F03 A;  1PFM A;  3H91 A;  4G7Z C;  3I8Z A;  3CQZ B;  3P75 A;  3A8I E;  3BVG A;  1SYF A;  4DAY A;  3K5M A;  3AB9 A;  5IGD A;  2QCP X;  5ELE A;  1Z47 A;  2MHV A;  3A7L A;  3A7A B;  2NTS A;  3DEO A;  3VR3 A;  1G6Z A;  3M85 A;  2NVX B;  5IGF A;  5EKK A;  4V19 0;  2GA4 B;  2K5D A;  2XRS D;  4IUU A;  3CHB D;  2K6A A;  4RHS A;  1JWM D;  1U4R A;  1PRT F;  2F0F A;  1M8A A;  4OHJ A;  1PFB A;  1UAP A;  3SXH A;  1UEA B;  2K5W A;  2JXM B;  1RD9 D;  3SK6 A;  4KHZ A;  2EY1 A;  3GTM B;  2R92 B;  4DXF A;  1B2T A;  1KDC A;  1Q90 A;  4LAA A;  1JWS D;  4ABN A;  4BA1 I;  5CGK A;  1JOQ A;  2F0S A;  1GUT A;  5D3D A;  4K2L A;  4CKB A;  1STA A;  2BE5 D;  1SBB B;  3IFT A;  4DU9 A;  5BN4 A;  3MXN A;  4ZYS A;  1SYE A;  4FO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...