5HURA

Crystal structure of staphylococcal nuclease variant delta+phs l25t/i92k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKTMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25T/I92K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5hurA00
1KAAA 3BDLA 4MIUA 5EGTA 4ZQ3A 3OMGA 3P75A 3ITPA 2LKVA 2QDBA 3TMEA 1EY4A 2RKSA 1SYCA 3T13A 2RBMA 2ENBA 4NP5A 1EY6A 3EJIA 3TP7A 5KYLA 4K8IA 4YIJA 2EY5A 2F0WA 2F0LA 2PW5A 5I6YA 1SYGA 5C3WA 3MVVA 3VA5A 4DF7A 4HTHA 3DMUA 3NXWA 5IIFA 5KYIA 2OEOA 3D6CA 4KTAA 2KQ3A 1SYDA 2SNSA 3RUZA 2O4XA 1EZ8A 5EKLA 4H7BA 2F0SA 3NQTA 4DGZA 1NUCA 2KHSA 3QOLA 4KV6A 2EYFA 5E1FA 3U9OA 1A3TA 4N9PA 4TRDA 1RKNA 5KRUA 2NUCA 5IGEA 2EYJA 3NHHA 3SK8A 5ISRA 1KABA 3MEHA 2F3VA 5CV7A 2F0DA 2SNMA 4IUNA 3C1FA 1SNOA 3DHQA 3EROA 4ID6A 4K2LA 3E5SA 4K6DA 5IOCA 3TP6A 3NK9A 2OXPA 2F0PA 4K5XA 4KJOA 5C3XA 1U9RA 3HZXA 2PZTA 5IGCA 1SNQA 3MZ5A 1EZ6A 4ZUJA 5DAUA 3SK4A 4K5WA 1JOQA 1JOKA 1II3A 1EYCA 2F0MA 3MHBA 4K14A 5C5LA 1SNMA 3TP8A 5KEEA 5CV6A 1ENAA 2EY1A 2M00A 5HURA 4F8MA 3NP8A 3S9WA 1A3UA 4EQPA 1STYA 4QB4A 3SHLA 5I6WA 2PQEA 3D4WA 5J22A 1A3VA 4EVOA 2F0KA 2F0EA 2F0FA 3D4DA 5F2DA 3D8GA 5E3FA 5KIXA 5CV8A 4DU9A 5M9OA 4RKBA 4NKLA 1STBA 4S3SA 4F7XA 4KY6A 1SYEA 5I9PA 5K5PA 3LX0A 1AEXA 3EVQA 2EYHA 5CV4A 2HQEA 4J6HA 1A2TA 4EQOA 2EY6A 2PW7A 3OSOA 4ZUIA 4IZ8A 1KDBA 4ME5A 4QF4A 4RKLA 1NSNS 1SNPA 5J39A 1F2ZA 4KJNA 1EY0A 5CGKA 1STNA 1TT2A 2F0OA 4B9WA 5C6AA 1SNDA 4WRDA 2F0JA 2OF1A 1EQVA 1STAA 1EYDA 4OL7A 2EY2A 2F0UA 3T16A 4EQNA 1STHA 4KY7A 5C5MA 2F0IA 4LAAA 4IALA 1F2MA 2PYKA 5CV5A 5JOBA 4E6IA 3ERQA 2F0TA 3SR1A 4PMCA 1STGA 3SXHA 3PMFA 4HMJA 1SNCA 5J1ZA 5CC4A 5IGDA 1EY8A 4NDXA 5IGGA 2WACA 1EY5A 4K2KA 1SYBA 4I65A 3H6MA 4KD4A 5CR3A 5KGUA 1EYAA 3V2TA 5NUCA 5IGBA 5IGFA 4K5VA 4ODGA 2F3WA 3QOJA 3BDCA 3MXPA 1KDAA 2EYLA 3SK5A 4G57A 3NUCA 4KD3A 4PNYA 4KY5A 3QB3A 3SK6A 3R3OA 3C1EA 4J1MA 1SYFA 4R8NA 1TQOA 5C4ZA 3TP5A 2F0NA 1JORA 2PZUA 4WORA 5IODA 2F0GA 4HMIA 4N9TA 5C4HA 4B9XA 4DFAA 5I9OA 1KDCA 2EXZA 4KHVA 2F0VA 4NMZA 5EKKA 1EY7A 2EYOA 2SOBA 4K8JA 5HGTA 1JOOA 3HEJA 1IHZA 3P1HA 1ENCA 1A2UA 2PZWA 2F0HA 2EYMA 2EYPA 1F2YA 2RDFA 3OMCA 4QMGA 3OWFA 5JAVA 2F0QA 5CV9A 5DEHA 1EY9A 4PMBA 1TR5A
chains in the Genus database with same CATH superfamily
1ILPA 1KNEA 1LT6D 1GHJA 1XNRL 4U68A 4AQYL 1PTOH 2RBMA 4ZLTF 4K8IA 3U4VA 3RLOA 5JJZA 3I4NG 1G6PA 1M1KC 1B4OA 1F9PA 4IPCA 3GTPB 1TY2A 1Y8PB 4RFBA 5E1FA 3A74A 1LO5D 5IP7G 5EPLA 1FR3A 1LTAD 4DR7L 2IL8A 2BOSA 3NTIA 1LT4D 3G71A 3S14B 3TN2A 3FVQA 1NJIC 2JA8G 1SNQA 4M8AA 1G2TA 2JJQA 1X56A 3IRBA 3S1RB 2JA9A 3TEHB 2I07B 2M00A 4JCVE 4XIGS 5J22A 2IJ0A 2XVSA 2D62A 2F0EA 4CKCA 1K83H 4JI0Q 2CWPA 3SVMA 2JA8B 5IWAQ 3RZOH 4K6LA 5CV4A 1RDPD 5FO7B 4IZ8A 4BXXH 4B3SL 3S2HB 3CF5A 2L11A 5C6AA 4DV7L 3CCJA 2K6AA 1V1PB 2E2DC 2E2JB 4X3UA 4HIDA 1PZJD 3HS0C 3NTHA 5CYUA 2IWHA 3L0OA 3NENA 1ICWA 1YVCA 3PF4A 4DUYQ 2JEBI 3ER0A 4KD4A 1PV4A 1STEA 1MSGA 1EYAA 1H95A 3TZDA 4DPGA 1LTGD 1U0LA 4BS9A 2L12A 1MBYA 2DJGC 2D5DA 3NUCA 1UUPA 2ZTEA 4MTKA 3SK6A 4OWWB 2K28A 3TS2A 2F0NA 3W1BA 3L2PA 5C4HA 4DAMA 5GQOA 2QW7A 5LMUL 3HEJA 3M4QA 3NELA 1HUMA 2BE5D 3GTPH 5FLXc 2EYPA 1HNXL 3UDIA 1YI2A 3OWFA 1C7YA 3QIAA 4IUUA 5FOBB 2UUBQ 1Q81C 2ICIA 4X6AH 4NB3A 3MWYW 4ZQ3A 1PVOA 1KLGD 2EQSA 3S14H 2JA6G 3I4NH 5JVG3 4JI5Q 1J5EL 1A62A 3HKSA 4UP8A 2FMMA 3KLRA 4IFDJ 1YEZA 1M90C 3T51B 4HEDA 3S1RH 1YNXA 3HOXG 1HA6A 1H9SA 3NSWA 1VQMA 1IBLL 1HZ9A 3S1MB 5IP7H 1A63A 1TS5A 1NUCA 5IE8A 4P75A 2JA8H 5GAEC 2JQOA 2RHQB 4POFA 2A69C 1V1QA 2B29A 2RDGA 3HOXB 1E2WA 1FNWA 3K0YA 4NPSA 4RHSA 5IGCA 1ILQA 2NZHA 3KBGA 2F0MA 3CCSA 5C5LA 4JBWA 1XTDA 5AJ3Q 1CSQA 2EY1A 1EOVA 1J9OA 1RODA 2LY7A 1BBWA 2BDOA 3BZKA 2Q8IB 4A3FB 1EQQA 2EE1A 3M7GA 5CBEE 1HJPA 5F2DA 5KIXA 1NE3A 2H5XA 3GTOH 1I4GA 3R93A 3PO3B 4K0KQ 1VQ6A 3RD4A 4X65L 4H02A 2K5VA 2QGQA 2B8FA 2LMCB 4DUZQ 1VDZA 1SNPA 1R9TH 5CGKA 1STNA 5DLQE 1X54A 2B3GA 1Q12A 4DAYA 3AFQA 2F0UA 4EQNA 3MXUA 1STHA 4A3CG 3W5OA 5CV5A 5FO9B 2F0TA 1BCPF 3SXHA 3CQZB 3I3CA 1WVLA 4B3RQ 3J7A5 1PZID 4BBSG 1EFID 2CKZB 4QCLA 4K2KA 2WB1G 3CC2A 1C48A 2HQLA 1XMQL 4FNFA 4GKJL 3FKIG 5C0XJ 2B2VA 1JWSD 2YV5A 4A3IG 3H15A 1I50B 3C1EA 2UXDQ 2XWJB 2I5HA 4BBSB 1PLFA 5M3MG 4HMIA 1G51A 2QA4A 3WDNA 3S1QH 3FKIB 2B2WA 2CQOA 3S1MH 3X3MA 2VXWA 4A3IB 3NEMA 3K7AB 1VF7A 2F4VQ 2JA6H 3E0JA 5EGTA 4JI6Q 5M3MB 1SR3A 3L9AX 2HIXA 3ITPA 3HOXH 3VYSA 5K36G 4HJ5A 1U4PA 3OTOL 3PIO3 1VQ7A 1GOZA 2F0LA 2FINB 5C3WA 4LFCL 4LW1A 1K8GA 2OEOA 2NVQB 3I4MG 2KQ3A 2I5LX 1BXTA 3QJYA 3U9OA 4UHVA 3K58A 1NR2A 5FLXE 4B3MQ 1JJGA 1Y8OB 2YTYA 4TQUS 4B3TL 3D31A 1KQSA 2AWOA 2PZTA 1JE5A 1B44D 3Q6SA 4A3MG 3SK4A 3GTGH 3MHBA 2L15A 3U9SA 5M5XB 1K73C 1PFNA 2NVXB 4OWTB 1EU3A 1ZYRC 1X6OA 4HJAA 1B9NA 1SROA 1YBYA 3J81c 1ASZA 4AYBE 1MGSA 4A3MB 2K14A 2RCNA 2R93G 1RTNA 4ZYSA 1AZQA 1LLRD 3H91A 4EQOA 2EY6A 1EFWA 1TIID 4A3CH 3IFTA 5HY6A 1PYSB 2VS1A 4PZ6A 1I4HA 2KEEA 1I50H 4HIOA 1EIFA 2VL6A 1X3FA 3CCVA 4G7ZC 1PH8A 4CDCC 5M5WH 4BBSH 4LWCA 2ZTDA 4KI0A 3T1HQ 5JEAJ 1X3PA 1BVSA 4N8FA 1O80A 5BN4A 2L5TA 3ULLA 1SMYD 3VYRA 1EY8A 4IPDA 3GV3A 4JBJA 2NYZD 3LNNA 4A3IH 4NXMQ 4KMUC 4MTNA 2I46A 3URYA 2B2UC 4ODGA 3QOJA 5M3MH 4OIKA 1NMGA 3HOUG 1B8AA 4FF2A 1FVIA 4KHPQ 3TRZA 1YHAA 1O7LA 1HFGA 4KHVA 5HGTA 1EY7A 2EYOA 1GVPA 1QVCA 1FNVA 1BCPC 4DK3C 1Q86C 3OHXC 5CV9A 3RMHA 5K36H 5EKIA 3GTMB 4LF6L 4YHHL 2IHEA 1E24A 2MNAA 3KK7A 3VYTA 1EOTA 1X3GA 3OMGA 3P75A 4YWLA 1XPUA 2V1CC 3RZDB 2C9OA 4DN4M 1VF5C 3I4MH 4DR2Q 2OTJA 4FP5D 4BY7G 1K8OA 5C44G 1GUTA 2F0WA 5D14A 4L5SA 5ELOA 4BBRG 4FVMA 1J8IA 3CRLC 3DMUA 5M5XH 2EJMA 3QWNA 1GXDC 2NVXH 4Y52H 3KJOA 4P71A 1WTWA 2X6GA 4KV6A 2EYFA 1N36L 3PIOA 2ZJQA 4A3MH 2PMZB 5I2YA 1N34L 1JB7A 2O5IC 3GTKB 4JW0A 1SNOA 4LFBQ 4BBRB 1PDQA 4OWXB 3VDYA 3J7AF 3D3RA 3GTJB 1U9RA 4CDDC 3D4RA 4K5WA 3KFUA 1EYCA 3H3VH 4IURA 1CSPA 1B53A 4IFDI 2P5ZX 2HCCA 1GJXA 2G5DA 1T5XD 1GKHA 1STYA 2R93H 2K04A 2B63B 4C2MB 3D8GA 1PFSA 3KYHC 1DOKA 2JA7G 3OOCA 5M9OA 3CCUA 2HHHQ 1S5DD 2FHTA 2PW7A 3OSOA 3PGZA 1UE7A 1L1OA 1TT2A 5GAGC 1TWAB 1X65A 3RLNA 1EYDA 3R2IA 1QVFA 1PFMA 2JA7B 2VB2X 4KY7A 5C5MA 4G7HC 2N78A 1H9SB 2PO4A 1MKHA 4C3JG 4HMJA 2SEBD 4R4CA 1PHJA 2ZXOA 4A76A 1O78A 2HIVA 3HOUH 1PXUA 1I4QA 3J81E 1CKNA 2UXCL 2KECA 3A54A 2LXJA 4C3JB 1PRTC 1IBKL 1BKBA 4ME3A 5JJKA 3NBHA 1LUZA 3RN5A 4DR5Q 2E5LL 2MP1A 3JAML 3I2ZA 3OW2A 2JK8A 4APVA 1BQQT 1Y1VG 2R7ZG 1SNDA 1WTXA 1XJVA 1LTRD 1HNZL 5G3LD 3UE0A 3GTKH 4BY7H 5C44H 4BBRH 4DR3L 1KXLA 4OO1I 1V1OA 1BUVT 1GO3E 2JP1A 3PSIA 3DM3A 2EVBA 4NP5A 1EY6A 2RSNA 3TP7A 4DAYB 3F2UA 3S16B 5I6YA 3MVVA 1CK1A 1L0WA 2R7ZB 1NNXA 2X69A 1EZ8A 1RIPA 4X3TA 2IT1A 4C2MH 5M3FG 4X64Q 2CH4W 2C5CA 3C3LA 1K0SA 4DR6Q 4JI2Q 3PUVA 5FLMG 1L0YB 3K8AA 2N8NA 4PV1C 1IBMQ 1HUNA 5M5YB 2ZJRA 2L4NA 1TS3A 3E9HA 2RHSB 4GOPC 5G3LF 3M9BA 4OELB 1PH6A 3BJUA 4HJ7A 5C3EG 1TWAH 1KRSA 1HZAA 3TP8A 1HR0W 1ENAA 2JA7H 1IKLA 1T9HA 4R4TA 1I4XA 4EQPA 3SHLA 2PQEA 2F0FA 4GLVB 1HNWQ 3M4YA 2O2LD 1WD0A 3ZJYC 3J80i 4O2DA 4YCUA 1XPOA 2FXQA 3DEOA 3TSSA 1EL0A 4ZUJA 2XSCA 4ME5A 4DV6L 1LM0A 4YWKA 1Y69U 1B2TA 4HAEA 2D9UA 4C3JH 4JI0L 1CZWA 1DYQA 3AMUA 1B9MA 3BS1A 1TS4A 1QB5D 2A6ED 3SR1A 1HZCA 2ID0A 1PH9A 5CC4A 2XRQD 4JI8Q 1SJHD 4UP9A 3VYUA 1EQTA 1GM5A 1I4RA 3MXNA 1Z9FA 2GA4B 2NVYB 2JXMB 5CBAE 1KDAA 1K3RA 4POGA 1QNUA 4DV3Q 4JI7Q 4NW2A 2LXKA 4DUYL 1S5FD 3S16H 1HR0Q 3ULPA 2HD3A 3JAMi 2JE6I 1Y1VH 2DN8A 2R92G 4NMZA 2R7ZH 4X62L 5FJ8G 1N32Q 3CKIB 4J8QA 4AYBG 2A69D 3UE1A 1KAAA 2VQFQ 3HOVG 4YCWA 3T53B 4FF1A 5M5YH 3MEFA 2QF7A 3PV0A 4A3BG 1SYCA 4JOIA 3T13A 2R92B 4L6TB 4XQJA 1JE4A 2J7ZA 2EY5A 5FKAC 5M3FH 1Z47A 2N3SA 1PMRA 2Y0SB 4LF5Q 2UUBL 2N88A 1NR4A 4IUVA 1GUOA 4PQXA 5FLMH 1XX8A 2IX3A 2DNEA 1M4VA 3FPUB 4QUFA 2JA5B 4A3BB 1A3TA 4TRDA 3KLSA 1CFMA 2NUCA 5A2QE 5IGEA 2R7DA 3I4LA 3SK8A 5JJLA 1KABA 4UDUC 5C3EH 1CZGA 4K6DA 4K2LA 1G2SA 2BA1A 3TDQA 3TREA 3NK9A 1I6HB 2F0PA 4KJOA 4R1JA 1YIJA 1EZ6A 2DNCA 4BA2I 1QCBD 1XXGA 4N8X1 1JOKA 2L9HA 2EIFA 1S3OA 1S40A 4UP7A 1F9SA 4HN7A 5IT9L 1V8QA 2ALYB 3TZUA 2NN6G 4U673 1JWMD 3I91A 1XTCD 4RGOS 5AJ3L 1SN8A 1PTOF 2NVYH 3VR4A 5HGQA 4IUTA 4GKKL 3A7LA 4ULLA 3S2DH 4FF3A 4QF4A 1ML0D 2EJGC 2KJXA 4HR7B 5C4XG 3J7YW 1STAA 1WJJA 3I4OA 3UDFA 4DA2A 1B3QA 3EIVA 4K0KL 1PYBA 1STGA 4A3DG 2DGYA 5IGDA 3DWQA 1RCVD 2EXDA 3FEWX 2K5DA 4Q5VA 1TS2A 4ZAIA 5C4XB 1VQNA 3EBEA 5C0XG 2WV6D 3W2DA 3I7FA 2F3WA 3HP3A 4DV2Q 4IUPA 3RN2A 3V05A 2R92H 4A3DB 2Q8RE 1D8LA 5FJ8H 1HH2P 1ICFB 3OIPA 2ZJPA 4N9TA 2PMZE 2LFNA 5KNDA 2EXZA 3I72A 1F9QA 3HOVH 2K5NA 1CTMA 3L3OC 1K8MA 2Q2HA 4A3BH 2UXDL 5DEHA 1N33Q 1J6QA 1VQCA 1WTRA 3KUPA 2BH8A 1I6HH 1LTID 1L1OB 2H1EA 1ENFA 5IP9G 1UWVA 1ZYRD 2F4VL 1D6EC 4O42A 1VQBA 3VA5A 4DNIA 2ES2A 1QWYA 2KCNA 4JI6L 2XNAC 1HTLD 1I3QB 3G7LA 4X66Q 3KDFA 2KENA 4DXGA 3NE5B 4FXDA 3T1YQ 1GHKA 3NQIA 3A5ZB 3V96A 1Y8NB 4L63B 1HFNA 3MEHA 1B3AA 3EROA 1CKNB 3AQQA 1Z7TA 1Q8IA 3MZ5A 4R4IA 3A5UA 1TWGB 3KF8A 4TKOB 2Z1CA 2RA4A 2NN6H 4KKSA 4XDXA 4B3ML 1EUJA 2JYOA 1UE5A 3NBHB 2VZAA 5I6WA 3F8TA 3MC0B 1AW7A 4XXEA 2CCZA 3HOYB 3U4ZA 3MA2B 1PA6A 2ZXRA 4NKLA 4A3FG 3VR5A 5C4XH 1EWIA 3LX0A 1S5BD 5K5PA 2EYHA 3BVZA 3M4OB 3S9WA 1VQ5A 5J39A 1YHQA 4L5QA 1RTOA 4A3DH 3S2HH 3PO3G 1PH3A 5J3BA 2KHJA 3EA6A 2E2JH 3SDZA 3S17B 2F0IA 1BCPD 1YNND 5JEAG 1VQEA 1SE8A 5I2XA 1ASYA 5C0XH 5DNFA 2UU9Q 5NUCA 3K80C 1ET6A 1UE6A 3C2PA 4B08A 3T1HL 4RCOA 4MN3A 5D65A 1FJGQ 3J7ZC 4PNYA 1PTOC 1W6KA 3A0JA 1WTHA 1LTBD 4NXML 4JI3Q 1X3QA 5I9OA 1S5CD 4RA8A 2G9HD 2RSOA 3AFPA 1JOOA 2HCIA 2MFIA 4QL5A 4OHJA 4DR1Q 2Z6BA 1AZPA 4O0AA 1EWHA 4KHPL 4MZ9A 4X3KA 2E2HB 4O1NA 1Q90A 5IP9H 2OT2A 1QG7A 1HQMC 1TWGH 3CCLA 1XNQQ 3CC7A 1B50A 1SYGA 4A3LG 4JC0A 5H1SE 1IYVA 5KYIA 4B3SQ 1VS0A 1N9WA 3RUZA 3DM1A 4H7BA 2K01A 3MFYA 4OEMB 3MXNB 2DJFC 2SNMA 3GO5A 2ASBA 2Z8LA 1OXVA 2GVAA 3STBC 2OXPA 1CM9A 5C3XA 3ERSX 2QDLA 3A8IE 3W3AA 2CWAA 1VQJA 4C1NK 4LFBL 4A3FH 5GAHC 1F2LA 3B6YA 4R8IA 4KY6A 5LMUQ 3PO3H 2AHOB 1XMOQ 3E6ZX 1EEID 5JEAH 2F0JA 3G4SA 1B70B 1NBWA 5FO8B 1U4RA 2DY7A 4FYDA 5JOBA 5DM63 1HCZA 2Z4IA 3ERQA 2NBFA 3ND8A 4JK1C 3H0GB 3CQZH 4DR4Q 3U50C 2NB0A 2FFKB 4L8JA 5I4DA 1H9MA 3EN2A 4IN3A 3D0FA 5IGBA 2PNHA 2E74C 2E2HH 3IL8A 3H94A 4YCVA 4ZK9B 1S72A 2JEAI 4XQQA 1SE3A 1PRTF 3A7AB 1CKOA 1PH1A 1VQKA 1PZKD 4X3SA 2VNUD 1JORA 2F0GA 1LTSD 2A1AA 4DFAA 4GS3A 4A3EG 4CJ2C 3ULJA 2SOBA 1WCMG 2B2TC 1BO0A 1MJCA 3S15B 1RL2A 3FKIH 2M2LA 4P72A 2BA0A 2JN4A 1TR5A 3K7AH 4IUQA 1EYGA 1IYUA 2QDBA 4A3LH 4A3EB 4FDBA 1WCMB 4CKEA 2Z4HA 1VMCA 4KN4C 1PYWD 1F9RA 1P16A 4HCSA 4HTHA 4DF7A 2O5JC 2AMCB 1S4ZA 1I94Q 4KTAA 2NVQH 4LF7Q 4RMFA 3DWAA 4C1NI 2UUCQ 2EYJA 3VA7A 5EQ0A 1V9PA 1WFQA 2F3VA 2LSSA 2RDHA 2SDFA 2K7VA 3HGBA 4IUNA 4EQ5A 5IOCA 4RG1A 4J15A 5C4JB 3PUWA 3TP6A 4LF4L 2CVRA 1AN8A 1MHWC 4X64L 3M3YB 1A0IA 3K5MA 5COYA 2IX0A 4DR6L 1K3BC 5HURA 4JI2L 2WFWA 5BR8L 1IBML 1QNKA 1X55A 4A3KG 3D4DA 1CHQD 2R61A 1IW7C 3M85A 1H9KA 4DV5L 2WKCA 1CT1D 1DZ1A 1WYDA 1X3EA 2HQEA 2E8GA 2B63G 2NWGA 1JT8A 1HZBA 1EWCA 1HNWL 1EU4A 4A3KB 1EIYB 1N8RC 1TWFB 3AU7A 5ELDA 1C9OA 4CKBA 1L0XB 3R2TA 2MGSA 3HG9A 1M8AA 3LWEA 3Q23A 2VUMB 1DJRD 3OTOQ 3AEVA 1B1ZA 5IGGA 3S15H 1BR9A 2K5QA 1CQVA 3KDFB 3RR5A 1SYBA 2JSOA 4JI4L 3KF6A 3V2TA 2B2UA 2PI2A 3P7JA 4GN4B 4JBKA 1IL2A 2PQAA 3MXPA 2BH2A 1E1OA 2OQ0A 1YZ6A 3J80L 3QB3A 5TSSA 4A3EH 5C4ZA 1NMFA 1WCMH 1NY4A 3KF8B 3Q22A 1W2BA 2F4IA 4JV5Q 4HIMA 1MD2D 1KDCA 1QOHA 3RLFA 2FJ2A 1HA5A 1V43A 3Q24A 2RDFA 3GV6A 4DV3L 3NTKA 4JI7L 2F0QA 1EQRA 1MIUA 3CCEA 1EEFD 4NXNQ 3SE0A 1WTQA 1HR0L 3GTMH 3WWVA 4BY1B 2LKVA 1DD2A 1RD9D 1N32L 2F03A 3RZDH 3L7ZC 3PO2B 2KCMA 3TS0A 4YIJA 2K4KA 3NXWA 3CXCA 4A4IA 4P2CB 5IIFA 1NCVA 4GNXC 4WFN3 1UAPA 4AH6A 3OPOA 3CPWA 4DV4Q 5EKLA 4V190 2B2YC 1DCZA 3G6EA 1AP0A 1KAWA 3E0EA 5ISRA 2WAQG 3ZYYX 1DXMA 4LF5L 4CDFC 4K5XA 5D3DA 1KTKA 3GTJH 4UAIA 4A3KH 3GQBA 1TWFH 1U4MA 3MXGA 4DV1Q 3GTLB 5GROA 3E3XA 1RHPA 2WAQB 3AYHB 3OW7A 2GN5A 4JYAQ 5ELCA 4LF9Q 5CV8A 2B63H 3PUXA 4BA1I 1LV9A 1ESRA 1JR0D 1A2TA 4A3GB 3K5NA 4DV0Q 4RKLA 1VQ8A 2VB3X 4C56C 1K8AC 3P20A 2UUAQ 4F88A 5LMNW 4YHHQ 2CH4A 1I6VC 4FO2A 2EZVA 2PYKA 1O7IA 4OX9Q 4ZKCB 1E0BA 3KJPA 4R4OA 1H9RA 4C3IG 2K50A 1YNJC 4QGUA 3HOZG 1Q1BA 3G48A 1KNAA 1SMYC 4I65A 1CA5A 2IHFA 2NTSA 4H44C 4K5VA 3NWTA 4BWGB 2NVTB 1N36Q 1ZKOA 2OWOA 1DM0B 3JAME 3R3OA 2OCEA 1E22A 4C3IB 3HOZB 2VQEQ 5IWAL 4JI1Q 4GNXA 1SAPA 1Q8KA 2F0VA 2B2YA 4DV2L 1DONA 1ENCA 1JQYD 5IT9c 4PMBA 3BDLA 1W3SA 4G4KA 2NTTA 4MHEA 5D3IB 3DLLA 1PTOB 3CW2C 3EJIA 1G8ZD 5EPJA 3H3VC 5LMNQ 1Q7YC 3BU2A 1X32A 3C46A 2K5HA 1DGSA 1JMCA 2YU9B 3IKJA 2QILA 4QJFA 4HIKA 1D5MC 1MSHA 3FPPA 4N9PA 2Y0SG 5CV7A 4GOPA 1E2ZA 3HOWG 2ZTCA 4Y7NB 1JJ2A 4IO9A 2JA5G 2K75A 4X66L 4IFDG 4L5TA 1JOQA 1OO9B 4RHRA 1SEBD 5KEEA 3T1YL 1BBUA 4RCNA 1A3UA 3I73A 4QB4A 1SRUA 1JC7A 2A6HC 1IBKQ 3I8ZA 3HOWB 4OIJA 4ZRZA 4JI5L 3RZOB 3FP9A 4JBMA 1PTOD 5I9PA 2Q8TA 1D5XC 5E7NA 4IOAA 3PUYA 2XRSD 1D2BA 3NPPA 4ZUIA 2A68C 1QUQA 1VQ4A 1EY0A 2F0OA 4OXPA 4WRDA 1U5KA 2AWNA 1SJED 4C3IH 3PF5A 1W6JA 4LAAA 3HOZH 2CFMA 1DOMA 1C4QA 5L37A 3NBIA 5J1ZA 1D1KA 4LUVA 1VQ9A 3E9IA 1UEBA 3R8BA 2ZM6Q 1KHIA 1K0RA 2NZOA 5LL6X 3DUZA 3BYTB 1A8VA 1SLJA 3DWPA 3EQLC 2C35B 2MO0A 3TP5A 4DNRB 4L5RC 2PZUA 2UU9L 4GLAC 3CHBD 1G291 5EKKA 3WOFA 4K8JA 4UPAA 1FJGL 1VQPA 2YU9H 2K03A 3BVMA 4DUZL 1QILA 3STBD 2L1BA 3PCOB 4Q0FA 4JI3L 4LF8Q 4OO1G 4Z9CB 1VCIA 3TMEA 3TQYA 1VQAA 3I4NB 1EY4A 4Y7NH 4QQBX 1FNUA 5EBCA 4B3RL 1AE2A 2F1MA 4DR1L 1G91A 4DK1A 2WP8J 1ESFA 1VQHA 3SGIA 4DV6Q 2PPBC 3D6CA 2Q2TA 4A93G 2Z6KC 4CJ1B 2XWBB 1JICA 2F0SA 2ICEC 2MQHA 3QOLA 3HOWH 4P73A 5KRUA 2JA5H 1A6XA 3NHHA 1XNQL 1OXSC 2L0CA 4IFDH 1JB3A 3KF6B 5LHY1 3QO2A 4V0BA 2HT1A 5IT9E 2PQAB 3HZXA 5A35A 4QY7A 1MI2A 4A93B 3CPFA 3KBXA 3ND9A 4KKTA 4RGTA 1TY0A 4OONA 4AIMA 1Q82C 2D2CC 2Q2IA 5IYDG 3GTOB 1BCPB 3BZCA 1CQFA 4DU9A 3WOEA 3H3VI 4F7XA 3CU7A 4RGMA 2H4OA 3F1ZA 1AEXA 4G7OC 4X62Q 3UI2A 2A74C 1RF2D 4J6HA 1R9TB 3HOYG 1CUKA 1GUGA 1ZXTA 4KK7A 3EFXD 1WTVA 4DK6C 2QEXA 3Q8DA 3LWUA 4KN7C 4FXGC 2MHVA 2BDNA 5KNCA 3T16A 4RWSC 5ELEA 3GDEA 1D1IA 4E6IA 4YY3Q 2J4XA 2UXBQ 2XN9C 1C0AA 2A6EC 1XMOL 4WJ3M 3SEBA 3JC66 2FMCA 4A75A 4LFAQ 2OTLA 4ALPA 5CR3A 3H6MA 1P8LA 4CHTB 5IGFA 4JG2A 2XTIA 2CW0C 4MNOA 3U58A 2EYLA 2B2VC 4KY5A 4WJ4A 2NZ1D 4DR4L 5JPMC 1GD7A 2QKIC 1QZHA 3KOJA 1PH7A 3S1QB 1WOCA 2Z6KA 3I56A 1XNRQ 5EAYA 4AQYQ 4OO1H 2B2WC 1FGBD 4QMGA 3D6WA 2JA6B 2I5MX 5BN3A 4QIWB 2KA7A 2M9VA 4IQZA 3S24A 4MIUA 4GN5A 2WAQE 4ZCKA 2RKSA 2AQ3B 1UEAB 4IPGA 1BF4A 1KIXA 4A93H 4DAPA 5LL6S 4GKKQ 3HRZC 1IZ6A 4ILWA 4DR7Q 3NWSA 1IW7D 2EPBA 1PFBA 1K9MC 5CMDA 2O4XA 2BCOA 1BNZA 2KHSA 1I3QH 1LT3D 1RKNA 1QVGA 3OYYA 4I7AA 3UDXA 4GZYC 3DXJC 1F77A 1I94L 1X9NA 1CI3M 2QEJC 1LTLA 2F52A 4LF7L 3GTGB 1PRTB 4I7ZC 1II3A 1C8CA 5FLXL 2UUCL 1NAPA 5IYDH 3F2DA 5CV6A 2PCFB 3N6RA 1WTOA 4XTCS 4GNXB 2EJFC 2IX1A 4WJWA 1EIGA 2HUGA 3J7AV 2F3IA 2V4DA 4DV7Q 2YTXA 3HOYH 4S3SA 4DR2L 1XPRA 1HXYD 3A55A 1Q3LA 1SE4A 3CCQA 1IXRA 3BVGA 2E75C 3M4OH 1R4QB 3X3NA 4B9WA 3PIP3 3BG3A 5JJIA 2ZT9C 1CHPD 5M5WB 1KLUD 1YJNA 2WB1B 4DK0A 2AQ2B 3CCMA 4LUZA 3PUZA 3I90A 1E2VA 3S17H 4TVAB 2MUYA 4DNTB 3CMAA 1FD7D 3K7UC 1SNCA 2LS01 1VQFA 1TVXA 3O13A 2R3ZA 4RH6A 2WACA 4GN3B 1SSOA 2KEDA 3W1GA 1GUSA 4CGYB 1SDFA 5KGUA 2A73B 2KCTA 3H0GG 2ATWA 1G6ZA 1PRTD 1OXTA 4IPHA 4GOPB 1BDOA 1S5ED 1HNXQ 5T1IA 1DOLA 1LT5D 3ONAB 1LYLA 4WORA 1ZEQX 1FGUA 3IFDA 3K57A 1ET9A 1R4PB 3BZDB 3M4PA 1WI5A 2HHHL 2A19A 1QE6A 2XIWA 3P1HA 1J5EQ 2PZWA 1WD1A 2F0HA 1F2YA 3A8KE 4P74A 4ZKBB 3CCRA 2E2IB 1GUWA 2TSSA 4LK1C 3CAMA 4HSPA 3HFZB 1IBLQ 4JV5L 2Y0SE 3G6JB 3I4MB 3LGJA 1QUQB 2VY3A 1OXUA 3F2BA 2J0TD 4UY8C 1YJWA 2CHBD 1KRTA 2DUDA 4NXNL 2MO1A 3HKZG 1SYDA 2YTVA 3VR6A 4DGZA 2AQ1B 4C3HG 1Q46A 4PMWA 2BE5C 1RJTA 1KD1C 1K28A 4RGNA 1VQLA 2F0DA 4LJZC 3A56A 3VR3A 2KBNA 2RF4A 4DR5L 3S1NB 1AFPA 3HKZB 1Q1EA 2WIIB 1OTCA 4DV4L 1SXTA 4RAUC 3T4AC 1TWCB 4XT1B 4IJHA 1VQOA 5DM73 4C3HB 4X65Q 2R93B 1YNJD 5BN5A 3J80c 4CJ0B 3D4WA 4EX5A 4A3JG 2KOLA 2I0QA 2E76C 2RVLA 2AUJD 2HDLA 3GP7A 3EVQA 4DV1L 1JJCB 3FMCA 1HPCA 2EDGA 2D0PA 1Z6HA 4KHZA 1PH4A 1L1OC 4JYAL 4LF9L 5EPKA 4OL7A 4A3JB 3CP0A 1XMQQ 1O7YA 4GKJQ 1E1TA 2VW9A 3I70A 5JPNC 4DV0L 1VQGA 1YNNC 1VMPA 2A5HA 4NDXA 4PZ8A 3H0GH 1SBBB 5EBDA 5GADC 3PIPA 1HRJA 3HOUB 2UUAL 2Z9HA 1XYIA 2E2IH 2VUMG 3K6OA 1E7ZA 2Z0SA 3JAMc 1YHBA 4OX9L 4JVZA 3DEPA 4J1MA 3F2CA 5ELBA 3J81L 4B9XA 3OIQA 2B2TA 3GTQB 2PI2E 1OXXK 1Y14B 2K52A 4M1UB 5E4WC 2EYMA 3OMCA 5JAVA 1EY9A 5ELNA 4FXKC 4LFCQ 4BY7B 3A8JE 5C44B 3IAYA 2VQEL 3KLWA 4JI1L 3N52A 1V1PA 3S1NH 2ENBA 2HDMA 2CQAA 2WKDA 5KYLA 4JI8L 1TXYA 1TWCH 1IKMA 1E3PA 2A6HD 2PW5A 1I4PA 1NTGA 2MPMA 4EGVA 4BY1G 4B3TQ 4C3HH 3PO2G 1FYCA 1L2FA 3CMEA 1KC8C 3NQTA 5IY0A 4R4QA 5IYCG 3MAQA 4IJLA 5LMNL 2IW3A 2A68D 2N55A 1EIHA 2R6GA 3C1FA 3E5SA 5C4JH 1CKMA 1O7ZA 5DAUA 1UNSA 3K5LA 4A3JH 3M3YH 4KKUA 1GUNA 1VQIA 2K1BA 3KLSX 3TBIB 3NP8A 2VQFL 4PZ7A 1B7YB 1YITA 4FF4A 1PH5A 2NN6I 3I55A 4KLKA 2Q2UA 1KDBA 5FK9C 1F2ZA 4KJNA 2AUKA 4HCEA 4QIWE 2XGTA 2RQXA 4A3GG 4IALA 4XT3B 2G9DA 1MJEA 3GTQH 1QJOA 2VUMH 4DAVA 1EY5A 3J80E 1TKWB 4XYOA 3CC4A 3FHWA 1IYJB 3BDCA 1LABA 1KL9A 4KD3A 5IYBG 5C0XI 1IL8A 1BOSA 3J81i 2ZXPA 4DXFA 1SYFA 4LNQA 1TWHB 1JCKB 3VR2A 5IODA 2ZM6L 3RNUA 4LF6Q 3AB9A 1Y1VB 2WINB 4LF4Q 4ABNA 1WTPA 1Y1WG 2QCPX 4YWMA 3QG1A 1IHZA 3K0XA 4HSVA 2KCCA 3GD7A 2YYZA 2L55A 2B8GA 1SFOB 1U4LA 3MTSA 4LUOA 5BR8Q 4JPBW 1HQRD 3J81j 3OWEB 2OQKA 2KVMA 1SMXA 2K5WA 4BY1H 1HHVA 3CRKC 4DV5Q 1Y1WB 1AE3A 1FL0A 4JOIC 5M3FB 3QR8A 1N34Q 1BBXC 3PO2H 1AH9A 1XWEA 2K33A 2PNRC 4H0LC 4LF8L 5IYCH 3H09A 2RCFA 2SNSA 1SE2A 2GVBA 3FDTA 2EOTA 5C3EB 2WB1E 1CA6A 4R9WA 1H9JA 2N49A 4ID6A 3DHQA 4QUCA 2IPKD 5CORA 5KNBA 5E4XA 5A2QL 4JI4Q 1YJ9A 2KHIA 4K14A 3M7NA 1SNMA 4CDEC 4XQNA 3Q0AA 3BYYB 1N33L 4F8MA 5EJWA 3FRPB 1VQDA 1A3VA 4EVOA 2F0KA 2MJ8A 3K59A 3GTLH 1D5ZC 5E3FA 2X6LA 3PQIA 3K81C 4F87A 3BDOA 4TSSA 2CW0D 4XYQA 4RKBA 1STBA 1SYEA 2DY8A 1TU2B 3S2DB 1JWUD 4GLXA 5T1GA 3K5OA 1NSNS 4A3GH 2IY5B 2OF1A 1EQVA 1HTPA 1UE1A 1TWHH 2EY2A 4BXXG 2UXCQ 1F2MA 4HJ9A 1I5FA 4PMCA 1QZGA 3PMFA 2R7FA 3UDGA 1A15A 1K83B 2B39A 4IOCA 2K32A 5IYBH 1SFOH 1D7QA 1T5EA 2E5LQ 1ONLA 2KUMA 4OGQC 3CD6A 4YY3L 3SK5A 2K05A 4G57A 2A8VA 2TMPA 2UXBL 4CBVA 4AYBB 1Y1WH 4R8NA 1TQOA 2AKWB 2NVTH 2D0OA 4DKAC 4LFAL 4H13C 1LTTD 4HJ8A 1HNZQ 1PH2A 4PG3A 4DR3Q 3HOVB 3ICEA 3MFGA 5AFWA 4LMQD 1A2UA 3HKZE 5JVH3 1LACA 5ELFA 3T56B
chains in the Genus database with same CATH topology
1ILPA 1KNEA 1LT6D 1GHJA 4U68A 1PTOH 2RBMA 4ZLTF 4K8IA 5JJZA 1B4OA 1F9PA 3GTPB 1TY2A 1Y8PB 4RFBA 5E1FA 1LO5D 5EPLA 1FR3A 1LTAD 2IL8A 2BOSA 3NTIA 1LT4D 3S14B 3TN2A 3FVQA 1SNQA 4M8AA 1G2TA 3S1RB 2I07B 2M00A 4XIGS 5J22A 2IJ0A 2XVSA 2D62A 2F0EA 4CKCA 3SVMA 2JA8B 4K6LA 5CV4A 1RDPD 5FO7B 4IZ8A 3S2HB 2L11A 5C6AA 2K6AA 1V1PB 2E2DC 2E2JB 4X3UA 1PZJD 3HS0C 3NTHA 5CYUA 2IWHA 1ICWA 2JEBI 4KD4A 1STEA 1MSGA 1EYAA 3TZDA 1LTGD 4BS9A 2L12A 1MBYA 2D5DA 3NUCA 1UUPA 3SK6A 2K28A 2F0NA 5C4HA 3HEJA 1HUMA 2BE5D 2EYPA 3OWFA 3QIAA 4IUUA 5FOBB 2ICIA 3MWYW 4ZQ3A 1KLGD 5JVG3 2FMMA 3KLRA 4IFDJ 3T51B 4HEDA 1HA6A 1H9SA 3NSWA 3S1MB 1TS5A 1NUCA 2A69C 3HOXB 2RDGA 1E2WA 1FNWA 3K0YA 4RHSA 5IGCA 1ILQA 3KBGA 2F0MA 5C5LA 4JBWA 2EY1A 1RODA 1J9OA 2LY7A 2BDOA 2Q8IB 4A3FB 2EE1A 3M7GA 5CBEE 5F2DA 5KIXA 1I4GA 3R93A 3PO3B 3RD4A 2B8FA 2LMCB 1VDZA 1SNPA 5CGKA 1STNA 1Q12A 4DAYA 2F0UA 4EQNA 3MXUA 1STHA 5CV5A 5FO9B 2F0TA 1BCPF 3SXHA 3CQZB 3I3CA 1WVLA 1PZID 1EFID 4QCLA 4K2KA 1C48A 4FNFA 5C0XJ 2B2VA 1JWSD 1I50B 3C1EA 2XWJB 4BBSB 1PLFA 4HMIA 3WDNA 3FKIB 2B2WA 3X3MA 2VXWA 4A3IB 3K7AB 1VF7A 3E0JA 5EGTA 5M3MB 3L9AX 3ITPA 3VYSA 5K36G 1U4PA 3PIO3 1GOZA 2F0LA 2FINB 5C3WA 2NVQB 2OEOA 2KQ3A 1BXTA 3QJYA 3U9OA 3K58A 1NR2A 5FLXE 1Y8OB 4TQUS 3D31A 2AWOA 2PZTA 1B44D 3Q6SA 3SK4A 3MHBA 3U9SA 5M5XB 1PFNA 2NVXB 1EU3A 1ZYRC 1B9NA 1MGSA 4A3MB 1RTNA 4ZYSA 1AZQA 1LLRD 3H91A 4EQOA 2EY6A 1TIID 3IFTA 1I4HA 2KEEA 4G7ZC 4KI0A 5JEAJ 1X3PA 1O80A 5BN4A 2L5TA 1SMYD 3VYRA 1EY8A 3GV3A 2NYZD 3LNNA 4KMUC 2I46A 3URYA 2B2UC 4ODGA 3QOJA 4OIKA 4FF2A 1O7LA 1HFGA 4KHVA 5HGTA 1EY7A 2EYOA 1FNVA 1BCPC 3OHXC 5CV9A 3RMHA 5K36H 5EKIA 3GTMB 3KK7A 3VYTA 1EOTA 3OMGA 3P75A 3RZDB 2C9OA 4DN4M 1VF5C 1K8OA 4FP5D 1GUTA 2F0WA 5D14A 4FVMA 1J8IA 3CRLC 3DMUA 2EJMA 3QWNA 1GXDC 1WTWA 2X6GA 4KV6A 2EYFA 2PMZB 5I2YA 2O5IC 3GTKB 1SNOA 4BBRB 1PDQA 3J7AF 3D3RA 3GTJB 1U9RA 3D4RA 4K5WA 1EYCA 4IURA 1B53A 4IFDI 1GJXA 2HCCA 1T5XD 1STYA 2K04A 2B63B 4C2MB 3D8GA 1DOKA 3OOCA 5M9OA 1S5DD 2FHTA 2PW7A 3OSOA 1TT2A 1TWAB 1EYDA 3R2IA 1PFMA 2JA7B 2VB2X 4KY7A 5C5MA 4G7HC 1H9SB 2PO4A 4C3JG 4HMJA 2SEBD 2ZXOA 1O78A 1PXUA 1I4QA 3J81E 2KECA 3A54A 4C3JB 1PRTC 3NBHA 2MP1A 3JAML 1BQQT 1SNDA 1WTXA 1LTRD 5G3LD 4OO1I 1V1OA 1BUVT 2JP1A 2EVBA 4NP5A 1EY6A 2RSNA 3TP7A 3F2UA 3S16B 5I6YA 3MVVA 1CK1A 2R7ZB 2X69A 1EZ8A 4X3TA 2IT1A 3C3LA 2C5CA 3PUVA 1L0YB 4PV1C 1HUNA 5M5YB 2L4NA 1TS3A 5G3LF 3TP8A 1ENAA 1IKLA 1I4XA 4EQPA 3SHLA 2PQEA 2F0FA 3M4YA 2O2LD 1WD0A 3DEOA 3TSSA 1EL0A 4ZUJA 2XSCA 4ME5A 1Y69U 1B2TA 4HAEA 2D9UA 1CZWA 1DYQA 3AMUA 1B9MA 3BS1A 1TS4A 1QB5D 2A6ED 3SR1A 2ID0A 5CC4A 2XRQD 3VYUA 1SJHD 1EQTA 1I4RA 3MXNA 2GA4B 2NVYB 2JXMB 5CBAE 1KDAA 1QNUA 4NW2A 1S5FD 2JE6I 2DN8A 4NMZA 3CKIB 4J8QA 2A69D 1KAAA 3T53B 4FF1A 2QF7A 3PV0A 1SYCA 3T13A 2R92B 4L6TB 4XQJA 1JE4A 2J7ZA 2EY5A 5FKAC 1Z47A 1PMRA 2Y0SB 2N88A 1NR4A 4IUVA 1GUOA 4PQXA 1XX8A 2IX3A 2DNEA 1M4VA 3FPUB 4QUFA 2JA5B 4A3BB 1A3TA 4TRDA 3KLSA 1CFMA 2NUCA 5A2QE 5IGEA 3SK8A 3I4LA 1KABA 4UDUC 1CZGA 4K6DA 4K2LA 1G2SA 2BA1A 3TDQA 1I6HB 3NK9A 2F0PA 4KJOA 1EZ6A 2DNCA 4BA2I 1QCBD 1XXGA 1JOKA 2L9HA 1F9SA 4HN7A 5IT9L 1V8QA 3TZUA 2NN6G 4U673 1JWMD 3I91A 1XTCD 4RGOS 1PTOF 3VR4A 4IUTA 3A7LA 4ULLA 4FF3A 4QF4A 1ML0D 2EJGC 2KJXA 4HR7B 3J7YW 1STAA 4DA2A 1STGA 5IGDA 3DWQA 1RCVD 3FEWX 2K5DA 4Q5VA 1TS2A 4ZAIA 5C4XB 5C0XG 2WV6D 3W2DA 2F3WA 3HP3A 4IUPA 3V05A 4A3DB 2Q8RE 3OIPA 4N9TA 2LFNA 5KNDA 2EXZA 3I72A 1F9QA 1CTMA 3L3OC 1K8MA 5DEHA 1WTRA 3KUPA 1LTID 2H1EA 1ENFA 1ZYRD 1D6EC 4O42A 3VA5A 1QWYA 2KCNA 2XNAC 1HTLD 1I3QB 3G7LA 4DXGA 3NE5B 4FXDA 1GHKA 3NQIA 3V96A 1Y8NB 4L63B 1HFNA 3MEHA 1B3AA 3EROA 1Z7TA 1Q8IA 3MZ5A 1TWGB 3KF8A 4TKOB 2Z1CA 2RA4A 2NN6H 4KKSA 4XDXA 2JYOA 5I6WA 3MC0B 1AW7A 4XXEA 3HOYB 3MA2B 2ZXRA 4NKLA 3VR5A 5K5PA 3LX0A 1S5BD 2EYHA 3BVZA 3M4OB 3S9WA 5J39A 1RTOA 3EA6A 3S17B 3SDZA 2F0IA 1BCPD 1YNND 5JEAG 5I2XA 5C0XH 5DNFA 5NUCA 1ET6A 3C2PA 4B08A 4RCOA 4MN3A 5D65A 4PNYA 1PTOC 1W6KA 1LTBD 1X3QA 5I9OA 1S5CD 4RA8A 2G9HD 2RSOA 1JOOA 2HCIA 4OHJA 1AZPA 1EWHA 4X3KA 2E2HB 4O1NA 1Q90A 2OT2A 1QG7A 1HQMC 1B50A 1SYGA 1IYVA 5KYIA 3RUZA 3DM1A 4H7BA 2K01A 3MFYA 2SNMA 3GO5A 2Z8LA 1OXVA 2OXPA 1CM9A 5C3XA 3A8IE 3W3AA 4C1NK 1F2LA 4R8IA 4KY6A 3E6ZX 1EEID 5JEAH 2F0JA 4FYDA 5FO8B 1U4RA 2DY7A 5JOBA 5DM63 1HCZA 2Z4IA 3ERQA 2NBFA 3ND8A 4JK1C 3H0GB 2NB0A 2FFKB 4L8JA 5I4DA 1H9MA 4IN3A 5IGBA 2E74C 3IL8A 3H94A 4ZK9B 2JEAI 4XQQA 1SE3A 1PRTF 3A7AB 1PZKD 4X3SA 2VNUD 1JORA 2F0GA 1LTSD 4DFAA 4CJ2C 2SOBA 2B2TC 1BO0A 3S15B 2M2LA 2BA0A 1TR5A 4IUQA 1IYUA 2QDBA 4A3EB 1WCMB 4CKEA 2Z4HA 1VMCA 4KN4C 1PYWD 1F9RA 4HTHA 4HCSA 4DF7A 2O5JC 1S4ZA 4KTAA 3DWAA 4C1NI 2EYJA 3VA7A 5EQ0A 2F3VA 2RDHA 3HGBA 2SDFA 4IUNA 2K7VA 5IOCA 5C4JB 3PUWA 3TP6A 2CVRA 1AN8A 3M3YB 3K5MA 5COYA 2IX0A 5HURA 1QNKA 3D4DA 1CHQD 2R61A 1IW7C 3M85A 1H9KA 2WKCA 1CT1D 1DZ1A 2HQEA 2NWGA 1EWCA 1EU4A 4A3KB 1TWFB 3AU7A 5ELDA 4CKBA 1L0XB 3R2TA 2MGSA 3HG9A 1M8AA 3LWEA 3Q23A 2VUMB 1DJRD 1B1ZA 5IGGA 1BR9A 2K5QA 1CQVA 1SYBA 2JSOA 3V2TA 2B2UA 3P7JA 3MXPA 3J80L 3QB3A 5TSSA 5C4ZA 3Q22A 2F4IA 1MD2D 1KDCA 1QOHA 3RLFA 2FJ2A 1HA5A 1V43A 3Q24A 2RDFA 3GV6A 3NTKA 2F0QA 1EEFD 3SE0A 1WTQA 4BY1B 2LKVA 1DD2A 1RD9D 2F03A 3L7ZC 3PO2B 4YIJA 3NXWA 5IIFA 4P2CB 1NCVA 4WFN3 1UAPA 3OPOA 5EKLA 4V190 2B2YC 1DCZA 1AP0A 5ISRA 3ZYYX 1DXMA 4K5XA 5D3DA 1KTKA 4UAIA 3GQBA 1U4MA 3MXGA 3GTLB 1RHPA 2WAQB 3OW7A 5ELCA 5CV8A 3PUXA 4BA1I 1LV9A 1ESRA 1JR0D 1A2TA 4A3GB 3K5NA 4RKLA 2VB3X 4C56C 3P20A 4F88A 1I6VC 4FO2A 2EZVA 2PYKA 4ZKCB 1E0BA 1H9RA 4C3IG 1YNJC 1Q1BA 1KNAA 1SMYC 4I65A 1CA5A 2NTSA 4H44C 4K5VA 3NWTA 4BWGB 2NVTB 1ZKOA 1DM0B 3JAME 3R3OA 4C3IB 3HOZB 1SAPA 2F0VA 2B2YA 1DONA 1ENCA 1JQYD 4PMBA 3BDLA 5D3IB 4G4KA 2NTTA 4MHEA 1PTOB 3EJIA 1G8ZD 5EPJA 3H3VC 1X32A 3C46A 2YU9B 3IKJA 2QILA 1D5MC 1MSHA 3FPPA 4N9PA 5CV7A 1E2ZA 4Y7NB 4IFDG 1JOQA 1OO9B 4RHRA 1SEBD 5KEEA 4RCNA 1A3UA 3I73A 4QB4A 1JC7A 2A6HC 3I8ZA 3HOWB 4OIJA 4ZRZA 3RZOB 1PTOD 5I9PA 2Q8TA 1D5XC 3PUYA 2XRSD 1D2BA 3NPPA 4ZUIA 2A68C 1EY0A 2F0OA 4WRDA 2AWNA 1SJED 1W6JA 4LAAA 1DOMA 1C4QA 3NBIA 5J1ZA 1D1KA 3R8BA 5LL6X 3DUZA 3BYTB 3DWPA 3EQLC 3TP5A 4DNRB 2PZUA 3CHBD 1G291 5EKKA 3WOFA 4K8JA 2K03A 3BVMA 1QILA 2L1BA 4Q0FA 4OO1G 4Z9CB 1VCIA 3TMEA 3I4NB 1EY4A 1FNUA 5EBCA 2F1MA 1G91A 4DK1A 2WP8J 1ESFA 2PPBC 3D6CA 4CJ1B 2XWBB 1JICA 2F0SA 2ICEC 3QOLA 5KRUA 1A6XA 3NHHA 1OXSC 2L0CA 4IFDH 1JB3A 5LHY1 3QO2A 4V0BA 5IT9E 3HZXA 5A35A 1MI2A 4A93B 3KBXA 3ND9A 4KKTA 4RGTA 1TY0A 2D2CC 3GTOB 1BCPB 1CQFA 4DU9A 3WOEA 4F7XA 3CU7A 4RGMA 2H4OA 1AEXA 4G7OC 3UI2A 2A74C 1RF2D 4J6HA 1R9TB 4KK7A 1GUGA 1ZXTA 3EFXD 1WTVA 3LWUA 4KN7C 4FXGC 2MHVA 2BDNA 5KNCA 3T16A 4RWSC 5ELEA 1D1IA 4E6IA 2J4XA 2XN9C 2A6EC 3SEBA 2FMCA 5CR3A 3H6MA 4CHTB 5IGFA 2CW0C 2EYLA 2B2VC 4KY5A 2NZ1D 5JPMC 2QKIC 3S1QB 4OO1H 2B2WC 1FGBD 4QMGA 3D6WA 2JA6B 5BN3A 4QIWB 4IQZA 2KA7A 2M9VA 4MIUA 2RKSA 2AQ3B 1UEAB 1BF4A 4DAPA 5LL6S 3HRZC 4ILWA 3NWSA 1IW7D 2EPBA 1PFBA 5CMDA 2O4XA 2BCOA 1BNZA 2KHSA 1LT3D 1RKNA 4GZYC 3DXJC 1F77A 1CI3M 2QEJC 3GTGB 1PRTB 4I7ZC 1II3A 1C8CA 5FLXL 1NAPA 5CV6A 2PCFB 3N6RA 1WTOA 4XTCS 2EJFC 2IX1A 4WJWA 1EIGA 2HUGA 3J7AV 2V4DA 4S3SA 1HXYD 3A55A 1Q3LA 1SE4A 3BVGA 2E75C 1R4QB 3X3NA 4B9WA 3PIP3 3BG3A 2ZT9C 1CHPD 5M5WB 1KLUD 2WB1B 4DK0A 2AQ2B 3PUZA 3I90A 1E2VA 2MUYA 4DNTB 1FD7D 1SNCA 2LS01 1TVXA 3O13A 2R3ZA 4RH6A 2WACA 1SSOA 2KEDA 1GUSA 4CGYB 1SDFA 5KGUA 2A73B 1G6ZA 1PRTD 1OXTA 1BDOA 1S5ED 5T1IA 1DOLA 1LT5D 3ONAB 4WORA 1ZEQX 3K57A 3IFDA 1ET9A 1R4PB 3BZDB 1QE6A 2XIWA 3P1HA 2PZWA 1WD1A 2F0HA 1F2YA 3A8KE 4ZKBB 2E2IB 1GUWA 2TSSA 4LK1C 4HSPA 3G6JB 3I4MB 1OXUA 2J0TD 2CHBD 1SYDA 3VR6A 4DGZA 2AQ1B 4C3HG 4PMWA 2BE5C 1RJTA 4RGNA 2F0DA 4LJZC 3A56A 3VR3A 3S1NB 1AFPA 3HKZB 1Q1EA 2WIIB 1SXTA 4RAUC 3T4AC 1TWCB 4XT1B 5DM73 4C3HB 2R93B 1YNJD 5BN5A 4CJ0B 3D4WA 2KOLA 2E76C 2RVLA 2AUJD 2HDLA 3GP7A 3EVQA 3FMCA 1HPCA 2EDGA 4KHZA 1Z6HA 5EPKA 4OL7A 4A3JB 1O7YA 3I70A 5JPNC 1YNNC 1VMPA 2A5HA 4NDXA 1SBBB 5EBDA 1HRJA 3HOUB 1XYIA 3K6OA 3DEPA 4J1MA 5ELBA 3J81L 4B9XA 3OIQA 2B2TA 3GTQB 1OXXK 4M1UB 5E4WC 2EYMA 3OMCA 5JAVA 1EY9A 4BY7B 4FXKC 3A8JE 5C44B 3IAYA 3N52A 1V1PA 2ENBA 2HDMA 2CQAA 2WKDA 5KYLA 1IKMA 2A6HD 2PW5A 1I4PA 2MPMA 4EGVA 1FYCA 3NQTA 3MAQA 2IW3A 2A68D 2N55A 1EIHA 2R6GA 3C1FA 3E5SA 1O7ZA 5DAUA 1UNSA 3K5LA 4KKUA 1GUNA 2K1BA 3KLSX 3TBIB 3NP8A 4FF4A 2NN6I 1KDBA 5FK9C 1F2ZA 4KJNA 2AUKA 4HCEA 2RQXA 4IALA 4XT3B 2G9DA 1QJOA 4DAVA 1EY5A 3J80E 1TKWB 4XYOA 3BDCA 1LABA 4KD3A 5C0XI 1IL8A 1BOSA 2ZXPA 4DXFA 1SYFA 1TWHB 1JCKB 3VR2A 5IODA 3AB9A 1Y1VB 2WINB 4ABNA 1WTPA 2QCPX 3QG1A 1IHZA 4HSVA 2KCCA 3GD7A 2YYZA 2L55A 2B8GA 1SFOB 1U4LA 3MTSA 1HQRD 3OWEB 2KVMA 2K5WA 1HHVA 3CRKC 1Y1WB 5M3FB 1BBXC 1XWEA 2K33A 2PNRC 4H0LC 3H09A 2SNSA 1SE2A 3FDTA 2EOTA 5C3EB 1CA6A 4R9WA 1H9JA 4ID6A 3DHQA 4QUCA 2IPKD 5CORA 5KNBA 5E4XA 5A2QL 4K14A 3M7NA 1SNMA 4XQNA 3Q0AA 3BYYB 4F8MA 5EJWA 3FRPB 1A3VA 4EVOA 2F0KA 2MJ8A 3K59A 1D5ZC 5E3FA 2X6LA 4F87A 3BDOA 4TSSA 2CW0D 4XYQA 4RKBA 1STBA 1SYEA 2DY8A 1TU2B 3S2DB 1JWUD 5T1GA 3K5OA 1NSNS 2OF1A 1EQVA 1HTPA 2EY2A 1F2MA 4PMCA 3PMFA 1A15A 1K83B 2B39A 2K32A 1T5EA 1ONLA 2KUMA 4OGQC 3SK5A 2K05A 4G57A 2TMPA 4CBVA 4AYBB 4R8NA 1TQOA 4H13C 1LTTD 3HOVB 3MFGA 5AFWA 4LMQD 1A2UA 5JVH3 1LACA 5ELFA 3T56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAA A;  3BDL A;  4MIU A;  5EGT A;  4ZQ3 A;  3OMG A;  3P75 A;  3ITP A;  2LKV A;  2QDB A;  3TME A;  1EY4 A;  2RKS A;  1SYC A;  3T13 A;  2RBM A;  2ENB A;  4NP5 A;  1EY6 A;  3EJI A;  3TP7 A;  5KYL A;  4K8I A;  4YIJ A;  2EY5 A;  2F0W A;  2F0L A;  2PW5 A;  5I6Y A;  1SYG A;  5C3W A;  3MVV A;  3VA5 A;  4DF7 A;  4HTH A;  3DMU A;  3NXW A;  5IIF A;  5KYI A;  2OEO A;  3D6C A;  4KTA A;  2KQ3 A;  1SYD A;  2SNS A;  3RUZ A;  2O4X A;  1EZ8 A;  5EKL A;  4H7B A;  2F0S A;  3NQT A;  4DGZ A;  1NUC A;  2KHS A;  3QOL A;  4KV6 A;  2EYF A;  5E1F A;  3U9O A;  1A3T A;  4N9P A;  4TRD A;  1RKN A;  5KRU A;  2NUC A;  5IGE A;  2EYJ A;  3NHH A;  3SK8 A;  5ISR A;  1KAB A;  3MEH A;  2F3V A;  5CV7 A;  2F0D A;  2SNM A;  4IUN A;  3C1F A;  1SNO A;  3DHQ A;  3ERO A;  4ID6 A;  4K2L A;  3E5S A;  4K6D A;  5IOC A;  3TP6 A;  3NK9 A;  2OXP A;  2F0P A;  4K5X A;  4KJO A;  5C3X A;  1U9R A;  3HZX A;  2PZT A;  5IGC A;  1SNQ A;  3MZ5 A;  1EZ6 A;  4ZUJ A;  5DAU A;  3SK4 A;  4K5W A;  1JOQ A;  1JOK A;  1II3 A;  1EYC A;  2F0M A;  3MHB A;  4K14 A;  5C5L A;  1SNM A;  3TP8 A;  5KEE A;  5CV6 A;  1ENA A;  2EY1 A;  2M00 A;  5HUR A;  4F8M A;  3NP8 A;  3S9W A;  1A3U A;  4EQP A;  1STY A;  4QB4 A;  3SHL A;  5I6W A;  2PQE A;  3D4W A;  5J22 A;  1A3V A;  4EVO A;  2F0K A;  2F0E A;  2F0F A;  3D4D A;  5F2D A;  3D8G A;  5E3F A;  5KIX A;  5CV8 A;  4DU9 A;  5M9O A;  4RKB A;  4NKL A;  1STB A;  4S3S A;  4F7X A;  4KY6 A;  1SYE A;  5I9P A;  5K5P A;  3LX0 A;  1AEX A;  3EVQ A;  2EYH A;  5CV4 A;  2HQE A;  4J6H A;  1A2T A;  4EQO A;  2EY6 A;  2PW7 A;  3OSO A;  4ZUI A;  4IZ8 A;  1KDB A;  4ME5 A;  4QF4 A;  4RKL A;  1NSN S;  1SNP A;  5J39 A;  1F2Z A;  4KJN A;  1EY0 A;  5CGK A;  1STN A;  1TT2 A;  2F0O A;  4B9W A;  5C6A A;  1SND A;  4WRD A;  2F0J A;  2OF1 A;  1EQV A;  1STA A;  1EYD A;  4OL7 A;  2EY2 A;  2F0U A;  3T16 A;  4EQN A;  1STH A;  4KY7 A;  5C5M A;  2F0I A;  4LAA A;  4IAL A;  1F2M A;  2PYK A;  5CV5 A;  5JOB A;  4E6I A;  3ERQ A;  2F0T A;  3SR1 A;  4PMC A;  1STG A;  3SXH A;  3PMF A;  4HMJ A;  1SNC A;  5J1Z A;  5CC4 A;  5IGD A;  1EY8 A;  4NDX A;  5IGG A;  2WAC A;  1EY5 A;  4K2K A;  1SYB A;  4I65 A;  3H6M A;  4KD4 A;  5CR3 A;  5KGU A;  1EYA A;  3V2T A;  5NUC A;  5IGB A;  5IGF A;  4K5V A;  4ODG A;  2F3W A;  3QOJ A;  3BDC A;  3MXP A;  1KDA A;  2EYL A;  3SK5 A;  4G57 A;  3NUC A;  4KD3 A;  4PNY A;  4KY5 A;  3QB3 A;  3SK6 A;  3R3O A;  3C1E A;  4J1M A;  1SYF A;  4R8N A;  1TQO A;  5C4Z A;  3TP5 A;  2F0N A;  1JOR A;  2PZU A;  4WOR A;  5IOD A;  2F0G A;  4HMI A;  4N9T A;  5C4H A;  4B9X A;  4DFA A;  5I9O A;  1KDC A;  2EXZ A;  4KHV A;  2F0V A;  4NMZ A;  5EKK A;  1EY7 A;  2EYO A;  2SOB A;  4K8J A;  5HGT A;  1JOO A;  3HEJ A;  1IHZ A;  3P1H A;  1ENC A;  1A2U A;  2PZW A;  2F0H A;  2EYM A;  2EYP A;  1F2Y A;  2RDF A;  3OMC A;  4QMG A;  3OWF A;  5JAV A;  2F0Q A;  5CV9 A;  5DEH A;  1EY9 A;  4PMB A;  1TR5 A; 
#chains in the Genus database with same CATH topology
 1ILP A;  1KNE A;  1LT6 D;  1GHJ A;  1XNR L;  4U68 A;  4AQY L;  1PTO H;  2RBM A;  4ZLT F;  4K8I A;  3U4V A;  3RLO A;  5JJZ A;  3I4N G;  1G6P A;  1M1K C;  1B4O A;  1F9P A;  4IPC A;  3GTP B;  1TY2 A;  1Y8P B;  4RFB A;  5E1F A;  3A74 A;  1LO5 D;  5IP7 G;  5EPL A;  1FR3 A;  1LTA D;  4DR7 L;  2IL8 A;  2BOS A;  3NTI A;  1LT4 D;  3G71 A;  3S14 B;  3TN2 A;  3FVQ A;  1NJI C;  2JA8 G;  1SNQ A;  4M8A A;  1G2T A;  2JJQ A;  1X56 A;  3IRB A;  3S1R B;  2JA9 A;  3TEH B;  2I07 B;  2M00 A;  4JCV E;  4XIG S;  5J22 A;  2IJ0 A;  2XVS A;  2D62 A;  2F0E A;  4CKC A;  1K83 H;  4JI0 Q;  2CWP A;  3SVM A;  2JA8 B;  5IWA Q;  3RZO H;  4K6L A;  5CV4 A;  1RDP D;  5FO7 B;  4IZ8 A;  4BXX H;  4B3S L;  3S2H B;  3CF5 A;  2L11 A;  5C6A A;  4DV7 L;  3CCJ A;  2K6A A;  1V1P B;  2E2D C;  2E2J B;  4X3U A;  4HID A;  1PZJ D;  3HS0 C;  3NTH A;  5CYU A;  2IWH A;  3L0O A;  3NEN A;  1ICW A;  1YVC A;  3PF4 A;  4DUY Q;  2JEB I;  3ER0 A;  4KD4 A;  1PV4 A;  1STE A;  1MSG A;  1EYA A;  1H95 A;  3TZD A;  4DPG A;  1LTG D;  1U0L A;  4BS9 A;  2L12 A;  1MBY A;  2DJG C;  2D5D A;  3NUC A;  1UUP A;  2ZTE A;  4MTK A;  3SK6 A;  4OWW B;  2K28 A;  3TS2 A;  2F0N A;  3W1B A;  3L2P A;  5C4H A;  4DAM A;  5GQO A;  2QW7 A;  5LMU L;  3HEJ A;  3M4Q A;  3NEL A;  1HUM A;  2BE5 D;  3GTP H;  5FLX c;  2EYP A;  1HNX L;  3UDI A;  1YI2 A;  3OWF A;  1C7Y A;  3QIA A;  4IUU A;  5FOB B;  2UUB Q;  1Q81 C;  2ICI A;  4X6A H;  4NB3 A;  3MWY W;  4ZQ3 A;  1PVO A;  1KLG D;  2EQS A;  3S14 H;  2JA6 G;  3I4N H;  5JVG 3;  4JI5 Q;  1J5E L;  1A62 A;  3HKS A;  4UP8 A;  2FMM A;  3KLR A;  4IFD J;  1YEZ A;  1M90 C;  3T51 B;  4HED A;  3S1R H;  1YNX A;  3HOX G;  1HA6 A;  1H9S A;  3NSW A;  1VQM A;  1IBL L;  1HZ9 A;  3S1M B;  5IP7 H;  1A63 A;  1TS5 A;  1NUC A;  5IE8 A;  4P75 A;  2JA8 H;  5GAE C;  2JQO A;  2RHQ B;  4POF A;  2A69 C;  1V1Q A;  2B29 A;  2RDG A;  3HOX B;  1E2W A;  1FNW A;  3K0Y A;  4NPS A;  4RHS A;  5IGC A;  1ILQ A;  2NZH A;  3KBG A;  2F0M A;  3CCS A;  5C5L A;  4JBW A;  1XTD A;  5AJ3 Q;  1CSQ A;  2EY1 A;  1EOV A;  1J9O A;  1ROD A;  2LY7 A;  1BBW A;  2BDO A;  3BZK A;  2Q8I B;  4A3F B;  1EQQ A;  2EE1 A;  3M7G A;  5CBE E;  1HJP A;  5F2D A;  5KIX A;  1NE3 A;  2H5X A;  3GTO H;  1I4G A;  3R93 A;  3PO3 B;  4K0K Q;  1VQ6 A;  3RD4 A;  4X65 L;  4H02 A;  2K5V A;  2QGQ A;  2B8F A;  2LMC B;  4DUZ Q;  1VDZ A;  1SNP A;  1R9T H;  5CGK A;  1STN A;  5DLQ E;  1X54 A;  2B3G A;  1Q12 A;  4DAY A;  3AFQ A;  2F0U A;  4EQN A;  3MXU A;  1STH A;  4A3C G;  3W5O A;  5CV5 A;  5FO9 B;  2F0T A;  1BCP F;  3SXH A;  3CQZ B;  3I3C A;  1WVL A;  4B3R Q;  3J7A 5;  1PZI D;  4BBS G;  1EFI D;  2CKZ B;  4QCL A;  4K2K A;  2WB1 G;  3CC2 A;  1C48 A;  2HQL A;  1XMQ L;  4FNF A;  4GKJ L;  3FKI G;  5C0X J;  2B2V A;  1JWS D;  2YV5 A;  4A3I G;  3H15 A;  1I50 B;  3C1E A;  2UXD Q;  2XWJ B;  2I5H A;  4BBS B;  1PLF A;  5M3M G;  4HMI A;  1G51 A;  2QA4 A;  3WDN A;  3S1Q H;  3FKI B;  2B2W A;  2CQO A;  3S1M H;  3X3M A;  2VXW A;  4A3I B;  3NEM A;  3K7A B;  1VF7 A;  2F4V Q;  2JA6 H;  3E0J A;  5EGT A;  4JI6 Q;  5M3M B;  1SR3 A;  3L9A X;  2HIX A;  3ITP A;  3HOX H;  3VYS A;  5K36 G;  4HJ5 A;  1U4P A;  3OTO L;  3PIO 3;  1VQ7 A;  1GOZ A;  2F0L A;  2FIN B;  5C3W A;  4LFC L;  4LW1 A;  1K8G A;  2OEO A;  2NVQ B;  3I4M G;  2KQ3 A;  2I5L X;  1BXT A;  3QJY A;  3U9O A;  4UHV A;  3K58 A;  1NR2 A;  5FLX E;  4B3M Q;  1JJG A;  1Y8O B;  2YTY A;  4TQU S;  4B3T L;  3D31 A;  1KQS A;  2AWO A;  2PZT A;  1JE5 A;  1B44 D;  3Q6S A;  4A3M G;  3SK4 A;  3GTG H;  3MHB A;  2L15 A;  3U9S A;  5M5X B;  1K73 C;  1PFN A;  2NVX B;  4OWT B;  1EU3 A;  1ZYR C;  1X6O A;  4HJA A;  1B9N A;  1SRO A;  1YBY A;  3J81 c;  1ASZ A;  4AYB E;  1MGS A;  4A3M B;  2K14 A;  2RCN A;  2R93 G;  1RTN A;  4ZYS A;  1AZQ A;  1LLR D;  3H91 A;  4EQO A;  2EY6 A;  1EFW A;  1TII D;  4A3C H;  3IFT A;  5HY6 A;  1PYS B;  2VS1 A;  4PZ6 A;  1I4H A;  2KEE A;  1I50 H;  4HIO A;  1EIF A;  2VL6 A;  1X3F A;  3CCV A;  4G7Z C;  1PH8 A;  4CDC C;  5M5W H;  4BBS H;  4LWC A;  2ZTD A;  4KI0 A;  3T1H Q;  5JEA J;  1X3P A;  1BVS A;  4N8F A;  1O80 A;  5BN4 A;  2L5T A;  3ULL A;  1SMY D;  3VYR A;  1EY8 A;  4IPD A;  3GV3 A;  4JBJ A;  2NYZ D;  3LNN A;  4A3I H;  4NXM Q;  4KMU C;  4MTN A;  2I46 A;  3URY A;  2B2U C;  4ODG A;  3QOJ A;  5M3M H;  4OIK A;  1NMG A;  3HOU G;  1B8A A;  4FF2 A;  1FVI A;  4KHP Q;  3TRZ A;  1YHA A;  1O7L A;  1HFG A;  4KHV A;  5HGT A;  1EY7 A;  2EYO A;  1GVP A;  1QVC A;  1FNV A;  1BCP C;  4DK3 C;  1Q86 C;  3OHX C;  5CV9 A;  3RMH A;  5K36 H;  5EKI A;  3GTM B;  4LF6 L;  4YHH L;  2IHE A;  1E24 A;  2MNA A;  3KK7 A;  3VYT A;  1EOT A;  1X3G A;  3OMG A;  3P75 A;  4YWL A;  1XPU A;  2V1C C;  3RZD B;  2C9O A;  4DN4 M;  1VF5 C;  3I4M H;  4DR2 Q;  2OTJ A;  4FP5 D;  4BY7 G;  1K8O A;  5C44 G;  1GUT A;  2F0W A;  5D14 A;  4L5S A;  5ELO A;  4BBR G;  4FVM A;  1J8I A;  3CRL C;  3DMU A;  5M5X H;  2EJM A;  3QWN A;  1GXD C;  2NVX H;  4Y52 H;  3KJO A;  4P71 A;  1WTW A;  2X6G A;  4KV6 A;  2EYF A;  1N36 L;  3PIO A;  2ZJQ A;  4A3M H;  2PMZ B;  5I2Y A;  1N34 L;  1JB7 A;  2O5I C;  3GTK B;  4JW0 A;  1SNO A;  4LFB Q;  4BBR B;  1PDQ A;  4OWX B;  3VDY A;  3J7A F;  3D3R A;  3GTJ B;  1U9R A;  4CDD C;  3D4R A;  4K5W A;  3KFU A;  1EYC A;  3H3V H;  4IUR A;  1CSP A;  1B53 A;  4IFD I;  2P5Z X;  2HCC A;  1GJX A;  2G5D A;  1T5X D;  1GKH A;  1STY A;  2R93 H;  2K04 A;  2B63 B;  4C2M B;  3D8G A;  1PFS A;  3KYH C;  1DOK A;  2JA7 G;  3OOC A;  5M9O A;  3CCU A;  2HHH Q;  1S5D D;  2FHT A;  2PW7 A;  3OSO A;  3PGZ A;  1UE7 A;  1L1O A;  1TT2 A;  5GAG C;  1TWA B;  1X65 A;  3RLN A;  1EYD A;  3R2I A;  1QVF A;  1PFM A;  2JA7 B;  2VB2 X;  4KY7 A;  5C5M A;  4G7H C;  2N78 A;  1H9S B;  2PO4 A;  1MKH A;  4C3J G;  4HMJ A;  2SEB D;  4R4C A;  1PHJ A;  2ZXO A;  4A76 A;  1O78 A;  2HIV A;  3HOU H;  1PXU A;  1I4Q A;  3J81 E;  1CKN A;  2UXC L;  2KEC A;  3A54 A;  2LXJ A;  4C3J B;  1PRT C;  1IBK L;  1BKB A;  4ME3 A;  5JJK A;  3NBH A;  1LUZ A;  3RN5 A;  4DR5 Q;  2E5L L;  2MP1 A;  3JAM L;  3I2Z A;  3OW2 A;  2JK8 A;  4APV A;  1BQQ T;  1Y1V G;  2R7Z G;  1SND A;  1WTX A;  1XJV A;  1LTR D;  1HNZ L;  5G3L D;  3UE0 A;  3GTK H;  4BY7 H;  5C44 H;  4BBR H;  4DR3 L;  1KXL A;  4OO1 I;  1V1O A;  1BUV T;  1GO3 E;  2JP1 A;  3PSI A;  3DM3 A;  2EVB A;  4NP5 A;  1EY6 A;  2RSN A;  3TP7 A;  4DAY B;  3F2U A;  3S16 B;  5I6Y A;  3MVV A;  1CK1 A;  1L0W A;  2R7Z B;  1NNX A;  2X69 A;  1EZ8 A;  1RIP A;  4X3T A;  2IT1 A;  4C2M H;  5M3F G;  4X64 Q;  2CH4 W;  2C5C A;  3C3L A;  1K0S A;  4DR6 Q;  4JI2 Q;  3PUV A;  5FLM G;  1L0Y B;  3K8A A;  2N8N A;  4PV1 C;  1IBM Q;  1HUN A;  5M5Y B;  2ZJR A;  2L4N A;  1TS3 A;  3E9H A;  2RHS B;  4GOP C;  5G3L F;  3M9B A;  4OEL B;  1PH6 A;  3BJU A;  4HJ7 A;  5C3E G;  1TWA H;  1KRS A;  1HZA A;  3TP8 A;  1HR0 W;  1ENA A;  2JA7 H;  1IKL A;  1T9H A;  4R4T A;  1I4X A;  4EQP A;  3SHL A;  2PQE A;  2F0F A;  4GLV B;  1HNW Q;  3M4Y A;  2O2L D;  1WD0 A;  3ZJY C;  3J80 i;  4O2D A;  4YCU A;  1XPO A;  2FXQ A;  3DEO A;  3TSS A;  1EL0 A;  4ZUJ A;  2XSC A;  4ME5 A;  4DV6 L;  1LM0 A;  4YWK A;  1Y69 U;  1B2T A;  4HAE A;  2D9U A;  4C3J H;  4JI0 L;  1CZW A;  1DYQ A;  3AMU A;  1B9M A;  3BS1 A;  1TS4 A;  1QB5 D;  2A6E D;  3SR1 A;  1HZC A;  2ID0 A;  1PH9 A;  5CC4 A;  2XRQ D;  4JI8 Q;  1SJH D;  4UP9 A;  3VYU A;  1EQT A;  1GM5 A;  1I4R A;  3MXN A;  1Z9F A;  2GA4 B;  2NVY B;  2JXM B;  5CBA E;  1KDA A;  1K3R A;  4POG A;  1QNU A;  4DV3 Q;  4JI7 Q;  4NW2 A;  2LXK A;  4DUY L;  1S5F D;  3S16 H;  1HR0 Q;  3ULP A;  2HD3 A;  3JAM i;  2JE6 I;  1Y1V H;  2DN8 A;  2R92 G;  4NMZ A;  2R7Z H;  4X62 L;  5FJ8 G;  1N32 Q;  3CKI B;  4J8Q A;  4AYB G;  2A69 D;  3UE1 A;  1KAA A;  2VQF Q;  3HOV G;  4YCW A;  3T53 B;  4FF1 A;  5M5Y H;  3MEF A;  2QF7 A;  3PV0 A;  4A3B G;  1SYC A;  4JOI A;  3T13 A;  2R92 B;  4L6T B;  4XQJ A;  1JE4 A;  2J7Z A;  2EY5 A;  5FKA C;  5M3F H;  1Z47 A;  2N3S A;  1PMR A;  2Y0S B;  4LF5 Q;  2UUB L;  2N88 A;  1NR4 A;  4IUV A;  1GUO A;  4PQX A;  5FLM H;  1XX8 A;  2IX3 A;  2DNE A;  1M4V A;  3FPU B;  4QUF A;  2JA5 B;  4A3B B;  1A3T A;  4TRD A;  3KLS A;  1CFM A;  2NUC A;  5A2Q E;  5IGE A;  2R7D A;  3I4L A;  3SK8 A;  5JJL A;  1KAB A;  4UDU C;  5C3E H;  1CZG A;  4K6D A;  4K2L A;  1G2S A;  2BA1 A;  3TDQ A;  3TRE A;  3NK9 A;  1I6H B;  2F0P A;  4KJO A;  4R1J A;  1YIJ A;  1EZ6 A;  2DNC A;  4BA2 I;  1QCB D;  1XXG A;  4N8X 1;  1JOK A;  2L9H A;  2EIF A;  1S3O A;  1S40 A;  4UP7 A;  1F9S A;  4HN7 A;  5IT9 L;  1V8Q A;  2ALY B;  3TZU A;  2NN6 G;  4U67 3;  1JWM D;  3I91 A;  1XTC D;  4RGO S;  5AJ3 L;  1SN8 A;  1PTO F;  2NVY H;  3VR4 A;  5HGQ A;  4IUT A;  4GKK L;  3A7L A;  4ULL A;  3S2D H;  4FF3 A;  4QF4 A;  1ML0 D;  2EJG C;  2KJX A;  4HR7 B;  5C4X G;  3J7Y W;  1STA A;  1WJJ A;  3I4O A;  3UDF A;  4DA2 A;  1B3Q A;  3EIV A;  4K0K L;  1PYB A;  1STG A;  4A3D G;  2DGY A;  5IGD A;  3DWQ A;  1RCV D;  2EXD A;  3FEW X;  2K5D A;  4Q5V A;  1TS2 A;  4ZAI A;  5C4X B;  1VQN A;  3EBE A;  5C0X G;  2WV6 D;  3W2D A;  3I7F A;  2F3W A;  3HP3 A;  4DV2 Q;  4IUP A;  3RN2 A;  3V05 A;  2R92 H;  4A3D B;  2Q8R E;  1D8L A;  5FJ8 H;  1HH2 P;  1ICF B;  3OIP A;  2ZJP A;  4N9T A;  2PMZ E;  2LFN A;  5KND A;  2EXZ A;  3I72 A;  1F9Q A;  3HOV H;  2K5N A;  1CTM A;  3L3O C;  1K8M A;  2Q2H A;  4A3B H;  2UXD L;  5DEH A;  1N33 Q;  1J6Q A;  1VQC A;  1WTR A;  3KUP A;  2BH8 A;  1I6H H;  1LTI D;  1L1O B;  2H1E A;  1ENF A;  5IP9 G;  1UWV A;  1ZYR D;  2F4V L;  1D6E C;  4O42 A;  1VQB A;  3VA5 A;  4DNI A;  2ES2 A;  1QWY A;  2KCN A;  4JI6 L;  2XNA C;  1HTL D;  1I3Q B;  3G7L A;  4X66 Q;  3KDF A;  2KEN A;  4DXG A;  3NE5 B;  4FXD A;  3T1Y Q;  1GHK A;  3NQI A;  3A5Z B;  3V96 A;  1Y8N B;  4L63 B;  1HFN A;  3MEH A;  1B3A A;  3ERO A;  1CKN B;  3AQQ A;  1Z7T A;  1Q8I A;  3MZ5 A;  4R4I A;  3A5U A;  1TWG B;  3KF8 A;  4TKO B;  2Z1C A;  2RA4 A;  2NN6 H;  4KKS A;  4XDX A;  4B3M L;  1EUJ A;  2JYO A;  1UE5 A;  3NBH B;  2VZA A;  5I6W A;  3F8T A;  3MC0 B;  1AW7 A;  4XXE A;  2CCZ A;  3HOY B;  3U4Z A;  3MA2 B;  1PA6 A;  2ZXR A;  4NKL A;  4A3F G;  3VR5 A;  5C4X H;  1EWI A;  3LX0 A;  1S5B D;  5K5P A;  2EYH A;  3BVZ A;  3M4O B;  3S9W A;  1VQ5 A;  5J39 A;  1YHQ A;  4L5Q A;  1RTO A;  4A3D H;  3S2H H;  3PO3 G;  1PH3 A;  5J3B A;  2KHJ A;  3EA6 A;  2E2J H;  3SDZ A;  3S17 B;  2F0I A;  1BCP D;  1YNN D;  5JEA G;  1VQE A;  1SE8 A;  5I2X A;  1ASY A;  5C0X H;  5DNF A;  2UU9 Q;  5NUC A;  3K80 C;  1ET6 A;  1UE6 A;  3C2P A;  4B08 A;  3T1H L;  4RCO A;  4MN3 A;  5D65 A;  1FJG Q;  3J7Z C;  4PNY A;  1PTO C;  1W6K A;  3A0J A;  1WTH A;  1LTB D;  4NXM L;  4JI3 Q;  1X3Q A;  5I9O A;  1S5C D;  4RA8 A;  2G9H D;  2RSO A;  3AFP A;  1JOO A;  2HCI A;  2MFI A;  4QL5 A;  4OHJ A;  4DR1 Q;  2Z6B A;  1AZP A;  4O0A A;  1EWH A;  4KHP L;  4MZ9 A;  4X3K A;  2E2H B;  4O1N A;  1Q90 A;  5IP9 H;  2OT2 A;  1QG7 A;  1HQM C;  1TWG H;  3CCL A;  1XNQ Q;  3CC7 A;  1B50 A;  1SYG A;  4A3L G;  4JC0 A;  5H1S E;  1IYV A;  5KYI A;  4B3S Q;  1VS0 A;  1N9W A;  3RUZ A;  3DM1 A;  4H7B A;  2K01 A;  3MFY A;  4OEM B;  3MXN B;  2DJF C;  2SNM A;  3GO5 A;  2ASB A;  2Z8L A;  1OXV A;  2GVA A;  3STB C;  2OXP A;  1CM9 A;  5C3X A;  3ERS X;  2QDL A;  3A8I E;  3W3A A;  2CWA A;  1VQJ A;  4C1N K;  4LFB L;  4A3F H;  5GAH C;  1F2L A;  3B6Y A;  4R8I A;  4KY6 A;  5LMU Q;  3PO3 H;  2AHO B;  1XMO Q;  3E6Z X;  1EEI D;  5JEA H;  2F0J A;  3G4S A;  1B70 B;  1NBW A;  5FO8 B;  1U4R A;  2DY7 A;  4FYD A;  5JOB A;  5DM6 3;  1HCZ A;  2Z4I A;  3ERQ A;  2NBF A;  3ND8 A;  4JK1 C;  3H0G B;  3CQZ H;  4DR4 Q;  3U50 C;  2NB0 A;  2FFK B;  4L8J A;  5I4D A;  1H9M A;  3EN2 A;  4IN3 A;  3D0F A;  5IGB A;  2PNH A;  2E74 C;  2E2H H;  3IL8 A;  3H94 A;  4YCV A;  4ZK9 B;  1S72 A;  2JEA I;  4XQQ A;  1SE3 A;  1PRT F;  3A7A B;  1CKO A;  1PH1 A;  1VQK A;  1PZK D;  4X3S A;  2VNU D;  1JOR A;  2F0G A;  1LTS D;  2A1A A;  4DFA A;  4GS3 A;  4A3E G;  4CJ2 C;  3ULJ A;  2SOB A;  1WCM G;  2B2T C;  1BO0 A;  1MJC A;  3S15 B;  1RL2 A;  3FKI H;  2M2L A;  4P72 A;  2BA0 A;  2JN4 A;  1TR5 A;  3K7A H;  4IUQ A;  1EYG A;  1IYU A;  2QDB A;  4A3L H;  4A3E B;  4FDB A;  1WCM B;  4CKE A;  2Z4H A;  1VMC A;  4KN4 C;  1PYW D;  1F9R A;  1P16 A;  4HCS A;  4HTH A;  4DF7 A;  2O5J C;  2AMC B;  1S4Z A;  1I94 Q;  4KTA A;  2NVQ H;  4LF7 Q;  4RMF A;  3DWA A;  4C1N I;  2UUC Q;  2EYJ A;  3VA7 A;  5EQ0 A;  1V9P A;  1WFQ A;  2F3V A;  2LSS A;  2RDH A;  2SDF A;  2K7V A;  3HGB A;  4IUN A;  4EQ5 A;  5IOC A;  4RG1 A;  4J15 A;  5C4J B;  3PUW A;  3TP6 A;  4LF4 L;  2CVR A;  1AN8 A;  1MHW C;  4X64 L;  3M3Y B;  1A0I A;  3K5M A;  5COY A;  2IX0 A;  4DR6 L;  1K3B C;  5HUR A;  4JI2 L;  2WFW A;  5BR8 L;  1IBM L;  1QNK A;  1X55 A;  4A3K G;  3D4D A;  1CHQ D;  2R61 A;  1IW7 C;  3M85 A;  1H9K A;  4DV5 L;  2WKC A;  1CT1 D;  1DZ1 A;  1WYD A;  1X3E A;  2HQE A;  2E8G A;  2B63 G;  2NWG A;  1JT8 A;  1HZB A;  1EWC A;  1HNW L;  1EU4 A;  4A3K B;  1EIY B;  1N8R C;  1TWF B;  3AU7 A;  5ELD A;  1C9O A;  4CKB A;  1L0X B;  3R2T A;  2MGS A;  3HG9 A;  1M8A A;  3LWE A;  3Q23 A;  2VUM B;  1DJR D;  3OTO Q;  3AEV A;  1B1Z A;  5IGG A;  3S15 H;  1BR9 A;  2K5Q A;  1CQV A;  3KDF B;  3RR5 A;  1SYB A;  2JSO A;  4JI4 L;  3KF6 A;  3V2T A;  2B2U A;  2PI2 A;  3P7J A;  4GN4 B;  4JBK A;  1IL2 A;  2PQA A;  3MXP A;  2BH2 A;  1E1O A;  2OQ0 A;  1YZ6 A;  3J80 L;  3QB3 A;  5TSS A;  4A3E H;  5C4Z A;  1NMF A;  1WCM H;  1NY4 A;  3KF8 B;  3Q22 A;  1W2B A;  2F4I A;  4JV5 Q;  4HIM A;  1MD2 D;  1KDC A;  1QOH A;  3RLF A;  2FJ2 A;  1HA5 A;  1V43 A;  3Q24 A;  2RDF A;  3GV6 A;  4DV3 L;  3NTK A;  4JI7 L;  2F0Q A;  1EQR A;  1MIU A;  3CCE A;  1EEF D;  4NXN Q;  3SE0 A;  1WTQ A;  1HR0 L;  3GTM H;  3WWV A;  4BY1 B;  2LKV A;  1DD2 A;  1RD9 D;  1N32 L;  2F03 A;  3RZD H;  3L7Z C;  3PO2 B;  2KCM A;  3TS0 A;  4YIJ A;  2K4K A;  3NXW A;  3CXC A;  4A4I A;  4P2C B;  5IIF A;  1NCV A;  4GNX C;  4WFN 3;  1UAP A;  4AH6 A;  3OPO A;  3CPW A;  4DV4 Q;  5EKL A;  4V19 0;  2B2Y C;  1DCZ A;  3G6E A;  1AP0 A;  1KAW A;  3E0E A;  5ISR A;  2WAQ G;  3ZYY X;  1DXM A;  4LF5 L;  4CDF C;  4K5X A;  5D3D A;  1KTK A;  3GTJ H;  4UAI A;  4A3K H;  3GQB A;  1TWF H;  1U4M A;  3MXG A;  4DV1 Q;  3GTL B;  5GRO A;  3E3X A;  1RHP A;  2WAQ B;  3AYH B;  3OW7 A;  2GN5 A;  4JYA Q;  5ELC A;  4LF9 Q;  5CV8 A;  2B63 H;  3PUX A;  4BA1 I;  1LV9 A;  1ESR A;  1JR0 D;  1A2T A;  4A3G B;  3K5N A;  4DV0 Q;  4RKL A;  1VQ8 A;  2VB3 X;  4C56 C;  1K8A C;  3P20 A;  2UUA Q;  4F88 A;  5LMN W;  4YHH Q;  2CH4 A;  1I6V C;  4FO2 A;  2EZV A;  2PYK A;  1O7I A;  4OX9 Q;  4ZKC B;  1E0B A;  3KJP A;  4R4O A;  1H9R A;  4C3I G;  2K50 A;  1YNJ C;  4QGU A;  3HOZ G;  1Q1B A;  3G48 A;  1KNA A;  1SMY C;  4I65 A;  1CA5 A;  2IHF A;  2NTS A;  4H44 C;  4K5V A;  3NWT A;  4BWG B;  2NVT B;  1N36 Q;  1ZKO A;  2OWO A;  1DM0 B;  3JAM E;  3R3O A;  2OCE A;  1E22 A;  4C3I B;  3HOZ B;  2VQE Q;  5IWA L;  4JI1 Q;  4GNX A;  1SAP A;  1Q8K A;  2F0V A;  2B2Y A;  4DV2 L;  1DON A;  1ENC A;  1JQY D;  5IT9 c;  4PMB A;  3BDL A;  1W3S A;  4G4K A;  2NTT A;  4MHE A;  5D3I B;  3DLL A;  1PTO B;  3CW2 C;  3EJI A;  1G8Z D;  5EPJ A;  3H3V C;  5LMN Q;  1Q7Y C;  3BU2 A;  1X32 A;  3C46 A;  2K5H A;  1DGS A;  1JMC A;  2YU9 B;  3IKJ A;  2QIL A;  4QJF A;  4HIK A;  1D5M C;  1MSH A;  3FPP A;  4N9P A;  2Y0S G;  5CV7 A;  4GOP A;  1E2Z A;  3HOW G;  2ZTC A;  4Y7N B;  1JJ2 A;  4IO9 A;  2JA5 G;  2K75 A;  4X66 L;  4IFD G;  4L5T A;  1JOQ A;  1OO9 B;  4RHR A;  1SEB D;  5KEE A;  3T1Y L;  1BBU A;  4RCN A;  1A3U A;  3I73 A;  4QB4 A;  1SRU A;  1JC7 A;  2A6H C;  1IBK Q;  3I8Z A;  3HOW B;  4OIJ A;  4ZRZ A;  4JI5 L;  3RZO B;  3FP9 A;  4JBM A;  1PTO D;  5I9P A;  2Q8T A;  1D5X C;  5E7N A;  4IOA A;  3PUY A;  2XRS D;  1D2B A;  3NPP A;  4ZUI A;  2A68 C;  1QUQ A;  1VQ4 A;  1EY0 A;  2F0O A;  4OXP A;  4WRD A;  1U5K A;  2AWN A;  1SJE D;  4C3I H;  3PF5 A;  1W6J A;  4LAA A;  3HOZ H;  2CFM A;  1DOM A;  1C4Q A;  5L37 A;  3NBI A;  5J1Z A;  1D1K A;  4LUV A;  1VQ9 A;  3E9I A;  1UEB A;  3R8B A;  2ZM6 Q;  1KHI A;  1K0R A;  2NZO A;  5LL6 X;  3DUZ A;  3BYT B;  1A8V A;  1SLJ A;  3DWP A;  3EQL C;  2C35 B;  2MO0 A;  3TP5 A;  4DNR B;  4L5R C;  2PZU A;  2UU9 L;  4GLA C;  3CHB D;  1G29 1;  5EKK A;  3WOF A;  4K8J A;  4UPA A;  1FJG L;  1VQP A;  2YU9 H;  2K03 A;  3BVM A;  4DUZ L;  1QIL A;  3STB D;  2L1B A;  3PCO B;  4Q0F A;  4JI3 L;  4LF8 Q;  4OO1 G;  4Z9C B;  1VCI A;  3TME A;  3TQY A;  1VQA A;  3I4N B;  1EY4 A;  4Y7N H;  4QQB X;  1FNU A;  5EBC A;  4B3R L;  1AE2 A;  2F1M A;  4DR1 L;  1G91 A;  4DK1 A;  2WP8 J;  1ESF A;  1VQH A;  3SGI A;  4DV6 Q;  2PPB C;  3D6C A;  2Q2T A;  4A93 G;  2Z6K C;  4CJ1 B;  2XWB B;  1JIC A;  2F0S A;  2ICE C;  2MQH A;  3QOL A;  3HOW H;  4P73 A;  5KRU A;  2JA5 H;  1A6X A;  3NHH A;  1XNQ L;  1OXS C;  2L0C A;  4IFD H;  1JB3 A;  3KF6 B;  5LHY 1;  3QO2 A;  4V0B A;  2HT1 A;  5IT9 E;  2PQA B;  3HZX A;  5A35 A;  4QY7 A;  1MI2 A;  4A93 B;  3CPF A;  3KBX A;  3ND9 A;  4KKT A;  4RGT A;  1TY0 A;  4OON A;  4AIM A;  1Q82 C;  2D2C C;  2Q2I A;  5IYD G;  3GTO B;  1BCP B;  3BZC A;  1CQF A;  4DU9 A;  3WOE A;  3H3V I;  4F7X A;  3CU7 A;  4RGM A;  2H4O A;  3F1Z A;  1AEX A;  4G7O C;  4X62 Q;  3UI2 A;  2A74 C;  1RF2 D;  4J6H A;  1R9T B;  3HOY G;  1CUK A;  1GUG A;  1ZXT A;  4KK7 A;  3EFX D;  1WTV A;  4DK6 C;  2QEX A;  3Q8D A;  3LWU A;  4KN7 C;  4FXG C;  2MHV A;  2BDN A;  5KNC A;  3T16 A;  4RWS C;  5ELE A;  3GDE A;  1D1I A;  4E6I A;  4YY3 Q;  2J4X A;  2UXB Q;  2XN9 C;  1C0A A;  2A6E C;  1XMO L;  4WJ3 M;  3SEB A;  3JC6 6;  2FMC A;  4A75 A;  4LFA Q;  2OTL A;  4ALP A;  5CR3 A;  3H6M A;  1P8L A;  4CHT B;  5IGF A;  4JG2 A;  2XTI A;  2CW0 C;  4MNO A;  3U58 A;  2EYL A;  2B2V C;  4KY5 A;  4WJ4 A;  2NZ1 D;  4DR4 L;  5JPM C;  1GD7 A;  2QKI C;  1QZH A;  3KOJ A;  1PH7 A;  3S1Q B;  1WOC A;  2Z6K A;  3I56 A;  1XNR Q;  5EAY A;  4AQY Q;  4OO1 H;  2B2W C;  1FGB D;  4QMG A;  3D6W A;  2JA6 B;  2I5M X;  5BN3 A;  4QIW B;  2KA7 A;  2M9V A;  4IQZ A;  3S24 A;  4MIU A;  4GN5 A;  2WAQ E;  4ZCK A;  2RKS A;  2AQ3 B;  1UEA B;  4IPG A;  1BF4 A;  1KIX A;  4A93 H;  4DAP A;  5LL6 S;  4GKK Q;  3HRZ C;  1IZ6 A;  4ILW A;  4DR7 Q;  3NWS A;  1IW7 D;  2EPB A;  1PFB A;  1K9M C;  5CMD A;  2O4X A;  2BCO A;  1BNZ A;  2KHS A;  1I3Q H;  1LT3 D;  1RKN A;  1QVG A;  3OYY A;  4I7A A;  3UDX A;  4GZY C;  3DXJ C;  1F77 A;  1I94 L;  1X9N A;  1CI3 M;  2QEJ C;  1LTL A;  2F52 A;  4LF7 L;  3GTG B;  1PRT B;  4I7Z C;  1II3 A;  1C8C A;  5FLX L;  2UUC L;  1NAP A;  5IYD H;  3F2D A;  5CV6 A;  2PCF B;  3N6R A;  1WTO A;  4XTC S;  4GNX B;  2EJF C;  2IX1 A;  4WJW A;  1EIG A;  2HUG A;  3J7A V;  2F3I A;  2V4D A;  4DV7 Q;  2YTX A;  3HOY H;  4S3S A;  4DR2 L;  1XPR A;  1HXY D;  3A55 A;  1Q3L A;  1SE4 A;  3CCQ A;  1IXR A;  3BVG A;  2E75 C;  3M4O H;  1R4Q B;  3X3N A;  4B9W A;  3PIP 3;  3BG3 A;  5JJI A;  2ZT9 C;  1CHP D;  5M5W B;  1KLU D;  1YJN A;  2WB1 B;  4DK0 A;  2AQ2 B;  3CCM A;  4LUZ A;  3PUZ A;  3I90 A;  1E2V A;  3S17 H;  4TVA B;  2MUY A;  4DNT B;  3CMA A;  1FD7 D;  3K7U C;  1SNC A;  2LS0 1;  1VQF A;  1TVX A;  3O13 A;  2R3Z A;  4RH6 A;  2WAC A;  4GN3 B;  1SSO A;  2KED A;  3W1G A;  1GUS A;  4CGY B;  1SDF A;  5KGU A;  2A73 B;  2KCT A;  3H0G G;  2ATW A;  1G6Z A;  1PRT D;  1OXT A;  4IPH A;  4GOP B;  1BDO A;  1S5E D;  1HNX Q;  5T1I A;  1DOL A;  1LT5 D;  3ONA B;  1LYL A;  4WOR A;  1ZEQ X;  1FGU A;  3IFD A;  3K57 A;  1ET9 A;  1R4P B;  3BZD B;  3M4P A;  1WI5 A;  2HHH L;  2A19 A;  1QE6 A;  2XIW A;  3P1H A;  1J5E Q;  2PZW A;  1WD1 A;  2F0H A;  1F2Y A;  3A8K E;  4P74 A;  4ZKB B;  3CCR A;  2E2I B;  1GUW A;  2TSS A;  4LK1 C;  3CAM A;  4HSP A;  3HFZ B;  1IBL Q;  4JV5 L;  2Y0S E;  3G6J B;  3I4M B;  3LGJ A;  1QUQ B;  2VY3 A;  1OXU A;  3F2B A;  2J0T D;  4UY8 C;  1YJW A;  2CHB D;  1KRT A;  2DUD A;  4NXN L;  2MO1 A;  3HKZ G;  1SYD A;  2YTV A;  3VR6 A;  4DGZ A;  2AQ1 B;  4C3H G;  1Q46 A;  4PMW A;  2BE5 C;  1RJT A;  1KD1 C;  1K28 A;  4RGN A;  1VQL A;  2F0D A;  4LJZ C;  3A56 A;  3VR3 A;  2KBN A;  2RF4 A;  4DR5 L;  3S1N B;  1AFP A;  3HKZ B;  1Q1E A;  2WII B;  1OTC A;  4DV4 L;  1SXT A;  4RAU C;  3T4A C;  1TWC B;  4XT1 B;  4IJH A;  1VQO A;  5DM7 3;  4C3H B;  4X65 Q;  2R93 B;  1YNJ D;  5BN5 A;  3J80 c;  4CJ0 B;  3D4W A;  4EX5 A;  4A3J G;  2KOL A;  2I0Q A;  2E76 C;  2RVL A;  2AUJ D;  2HDL A;  3GP7 A;  3EVQ A;  4DV1 L;  1JJC B;  3FMC A;  1HPC A;  2EDG A;  2D0P A;  1Z6H A;  4KHZ A;  1PH4 A;  1L1O C;  4JYA L;  4LF9 L;  5EPK A;  4OL7 A;  4A3J B;  3CP0 A;  1XMQ Q;  1O7Y A;  4GKJ Q;  1E1T A;  2VW9 A;  3I70 A;  5JPN C;  4DV0 L;  1VQG A;  1YNN C;  1VMP A;  2A5H A;  4NDX A;  4PZ8 A;  3H0G H;  1SBB B;  5EBD A;  5GAD C;  3PIP A;  1HRJ A;  3HOU B;  2UUA L;  2Z9H A;  1XYI A;  2E2I H;  2VUM G;  3K6O A;  1E7Z A;  2Z0S A;  3JAM c;  1YHB A;  4OX9 L;  4JVZ A;  3DEP A;  4J1M A;  3F2C A;  5ELB A;  3J81 L;  4B9X A;  3OIQ A;  2B2T A;  3GTQ B;  2PI2 E;  1OXX K;  1Y14 B;  2K52 A;  4M1U B;  5E4W C;  2EYM A;  3OMC A;  5JAV A;  1EY9 A;  5ELN A;  4FXK C;  4LFC Q;  4BY7 B;  3A8J E;  5C44 B;  3IAY A;  2VQE L;  3KLW A;  4JI1 L;  3N52 A;  1V1P A;  3S1N H;  2ENB A;  2HDM A;  2CQA A;  2WKD A;  5KYL A;  4JI8 L;  1TXY A;  1TWC H;  1IKM A;  1E3P A;  2A6H D;  2PW5 A;  1I4P A;  1NTG A;  2MPM A;  4EGV A;  4BY1 G;  4B3T Q;  4C3H H;  3PO2 G;  1FYC A;  1L2F A;  3CME A;  1KC8 C;  3NQT A;  5IY0 A;  4R4Q A;  5IYC G;  3MAQ A;  4IJL A;  5LMN L;  2IW3 A;  2A68 D;  2N55 A;  1EIH A;  2R6G A;  3C1F A;  3E5S A;  5C4J H;  1CKM A;  1O7Z A;  5DAU A;  1UNS A;  3K5L A;  4A3J H;  3M3Y H;  4KKU A;  1GUN A;  1VQI A;  2K1B A;  3KLS X;  3TBI B;  3NP8 A;  2VQF L;  4PZ7 A;  1B7Y B;  1YIT A;  4FF4 A;  1PH5 A;  2NN6 I;  3I55 A;  4KLK A;  2Q2U A;  1KDB A;  5FK9 C;  1F2Z A;  4KJN A;  2AUK A;  4HCE A;  4QIW E;  2XGT A;  2RQX A;  4A3G G;  4IAL A;  4XT3 B;  2G9D A;  1MJE A;  3GTQ H;  1QJO A;  2VUM H;  4DAV A;  1EY5 A;  3J80 E;  1TKW B;  4XYO A;  3CC4 A;  3FHW A;  1IYJ B;  3BDC A;  1LAB A;  1KL9 A;  4KD3 A;  5IYB G;  5C0X I;  1IL8 A;  1BOS A;  3J81 i;  2ZXP A;  4DXF A;  1SYF A;  4LNQ A;  1TWH B;  1JCK B;  3VR2 A;  5IOD A;  2ZM6 L;  3RNU A;  4LF6 Q;  3AB9 A;  1Y1V B;  2WIN B;  4LF4 Q;  4ABN A;  1WTP A;  1Y1W G;  2QCP X;  4YWM A;  3QG1 A;  1IHZ A;  3K0X A;  4HSV A;  2KCC A;  3GD7 A;  2YYZ A;  2L55 A;  2B8G A;  1SFO B;  1U4L A;  3MTS A;  4LUO A;  5BR8 Q;  4JPB W;  1HQR D;  3J81 j;  3OWE B;  2OQK A;  2KVM A;  1SMX A;  2K5W A;  4BY1 H;  1HHV A;  3CRK C;  4DV5 Q;  1Y1W B;  1AE3 A;  1FL0 A;  4JOI C;  5M3F B;  3QR8 A;  1N34 Q;  1BBX C;  3PO2 H;  1AH9 A;  1XWE A;  2K33 A;  2PNR C;  4H0L C;  4LF8 L;  5IYC H;  3H09 A;  2RCF A;  2SNS A;  1SE2 A;  2GVB A;  3FDT A;  2EOT A;  5C3E B;  2WB1 E;  1CA6 A;  4R9W A;  1H9J A;  2N49 A;  4ID6 A;  3DHQ A;  4QUC A;  2IPK D;  5COR A;  5KNB A;  5E4X A;  5A2Q L;  4JI4 Q;  1YJ9 A;  2KHI A;  4K14 A;  3M7N A;  1SNM A;  4CDE C;  4XQN A;  3Q0A A;  3BYY B;  1N33 L;  4F8M A;  5EJW A;  3FRP B;  1VQD A;  1A3V A;  4EVO A;  2F0K A;  2MJ8 A;  3K59 A;  3GTL H;  1D5Z C;  5E3F A;  2X6L A;  3PQI A;  3K81 C;  4F87 A;  3BDO A;  4TSS A;  2CW0 D;  4XYQ A;  4RKB A;  1STB A;  1SYE A;  2DY8 A;  1TU2 B;  3S2D B;  1JWU D;  4GLX A;  5T1G A;  3K5O A;  1NSN S;  4A3G H;  2IY5 B;  2OF1 A;  1EQV A;  1HTP A;  1UE1 A;  1TWH H;  2EY2 A;  4BXX G;  2UXC Q;  1F2M A;  4HJ9 A;  1I5F A;  4PMC A;  1QZG A;  3PMF A;  2R7F A;  3UDG A;  1A15 A;  1K83 B;  2B39 A;  4IOC A;  2K32 A;  5IYB H;  1SFO H;  1D7Q A;  1T5E A;  2E5L Q;  1ONL A;  2KUM A;  4OGQ C;  3CD6 A;  4YY3 L;  3SK5 A;  2K05 A;  4G57 A;  2A8V A;  2TMP A;  2UXB L;  4CBV A;  4AYB B;  1Y1W H;  4R8N A;  1TQO A;  2AKW B;  2NVT H;  2D0O A;  4DKA C;  4LFA L;  4H13 C;  1LTT D;  4HJ8 A;  1HNZ Q;  1PH2 A;  4PG3 A;  4DR3 Q;  3HOV B;  3ICE A;  3MFG A;  5AFW A;  4LMQ D;  1A2U A;  3HKZ E;  5JVH 3;  1LAC A;  5ELF A;  3T56 B; 
#chains in the Genus database with same CATH homology
 1ILP A;  1KNE A;  1LT6 D;  1GHJ A;  4U68 A;  1PTO H;  2RBM A;  4ZLT F;  4K8I A;  5JJZ A;  1B4O A;  1F9P A;  3GTP B;  1TY2 A;  1Y8P B;  4RFB A;  5E1F A;  1LO5 D;  5EPL A;  1FR3 A;  1LTA D;  2IL8 A;  2BOS A;  3NTI A;  1LT4 D;  3S14 B;  3TN2 A;  3FVQ A;  1SNQ A;  4M8A A;  1G2T A;  3S1R B;  2I07 B;  2M00 A;  4XIG S;  5J22 A;  2IJ0 A;  2XVS A;  2D62 A;  2F0E A;  4CKC A;  3SVM A;  2JA8 B;  4K6L A;  5CV4 A;  1RDP D;  5FO7 B;  4IZ8 A;  3S2H B;  2L11 A;  5C6A A;  2K6A A;  1V1P B;  2E2D C;  2E2J B;  4X3U A;  1PZJ D;  3HS0 C;  3NTH A;  5CYU A;  2IWH A;  1ICW A;  2JEB I;  4KD4 A;  1STE A;  1MSG A;  1EYA A;  3TZD A;  1LTG D;  4BS9 A;  2L12 A;  1MBY A;  2D5D A;  3NUC A;  1UUP A;  3SK6 A;  2K28 A;  2F0N A;  5C4H A;  3HEJ A;  1HUM A;  2BE5 D;  2EYP A;  3OWF A;  3QIA A;  4IUU A;  5FOB B;  2ICI A;  3MWY W;  4ZQ3 A;  1KLG D;  5JVG 3;  2FMM A;  3KLR A;  4IFD J;  3T51 B;  4HED A;  1HA6 A;  1H9S A;  3NSW A;  3S1M B;  1TS5 A;  1NUC A;  2A69 C;  3HOX B;  2RDG A;  1E2W A;  1FNW A;  3K0Y A;  4RHS A;  5IGC A;  1ILQ A;  3KBG A;  2F0M A;  5C5L A;  4JBW A;  2EY1 A;  1ROD A;  1J9O A;  2LY7 A;  2BDO A;  2Q8I B;  4A3F B;  2EE1 A;  3M7G A;  5CBE E;  5F2D A;  5KIX A;  1I4G A;  3R93 A;  3PO3 B;  3RD4 A;  2B8F A;  2LMC B;  1VDZ A;  1SNP A;  5CGK A;  1STN A;  1Q12 A;  4DAY A;  2F0U A;  4EQN A;  3MXU A;  1STH A;  5CV5 A;  5FO9 B;  2F0T A;  1BCP F;  3SXH A;  3CQZ B;  3I3C A;  1WVL A;  1PZI D;  1EFI D;  4QCL A;  4K2K A;  1C48 A;  4FNF A;  5C0X J;  2B2V A;  1JWS D;  1I50 B;  3C1E A;  2XWJ B;  4BBS B;  1PLF A;  4HMI A;  3WDN A;  3FKI B;  2B2W A;  3X3M A;  2VXW A;  4A3I B;  3K7A B;  1VF7 A;  3E0J A;  5EGT A;  5M3M B;  3L9A X;  3ITP A;  3VYS A;  5K36 G;  1U4P A;  3PIO 3;  1GOZ A;  2F0L A;  2FIN B;  5C3W A;  2NVQ B;  2OEO A;  2KQ3 A;  1BXT A;  3QJY A;  3U9O A;  3K58 A;  1NR2 A;  5FLX E;  1Y8O B;  4TQU S;  3D31 A;  2AWO A;  2PZT A;  1B44 D;  3Q6S A;  3SK4 A;  3MHB A;  3U9S A;  5M5X B;  1PFN A;  2NVX B;  1EU3 A;  1ZYR C;  1B9N A;  1MGS A;  4A3M B;  1RTN A;  4ZYS A;  1AZQ A;  1LLR D;  3H91 A;  4EQO A;  2EY6 A;  1TII D;  3IFT A;  1I4H A;  2KEE A;  4G7Z C;  4KI0 A;  5JEA J;  1X3P A;  1O80 A;  5BN4 A;  2L5T A;  1SMY D;  3VYR A;  1EY8 A;  3GV3 A;  2NYZ D;  3LNN A;  4KMU C;  2I46 A;  3URY A;  2B2U C;  4ODG A;  3QOJ A;  4OIK A;  4FF2 A;  1O7L A;  1HFG A;  4KHV A;  5HGT A;  1EY7 A;  2EYO A;  1FNV A;  1BCP C;  3OHX C;  5CV9 A;  3RMH A;  5K36 H;  5EKI A;  3GTM B;  3KK7 A;  3VYT A;  1EOT A;  3OMG A;  3P75 A;  3RZD B;  2C9O A;  4DN4 M;  1VF5 C;  1K8O A;  4FP5 D;  1GUT A;  2F0W A;  5D14 A;  4FVM A;  1J8I A;  3CRL C;  3DMU A;  2EJM A;  3QWN A;  1GXD C;  1WTW A;  2X6G A;  4KV6 A;  2EYF A;  2PMZ B;  5I2Y A;  2O5I C;  3GTK B;  1SNO A;  4BBR B;  1PDQ A;  3J7A F;  3D3R A;  3GTJ B;  1U9R A;  3D4R A;  4K5W A;  1EYC A;  4IUR A;  1B53 A;  4IFD I;  1GJX A;  2HCC A;  1T5X D;  1STY A;  2K04 A;  2B63 B;  4C2M B;  3D8G A;  1DOK A;  3OOC A;  5M9O A;  1S5D D;  2FHT A;  2PW7 A;  3OSO A;  1TT2 A;  1TWA B;  1EYD A;  3R2I A;  1PFM A;  2JA7 B;  2VB2 X;  4KY7 A;  5C5M A;  4G7H C;  1H9S B;  2PO4 A;  4C3J G;  4HMJ A;  2SEB D;  2ZXO A;  1O78 A;  1PXU A;  1I4Q A;  3J81 E;  2KEC A;  3A54 A;  4C3J B;  1PRT C;  3NBH A;  2MP1 A;  3JAM L;  1BQQ T;  1SND A;  1WTX A;  1LTR D;  5G3L D;  4OO1 I;  1V1O A;  1BUV T;  2JP1 A;  2EVB A;  4NP5 A;  1EY6 A;  2RSN A;  3TP7 A;  3F2U A;  3S16 B;  5I6Y A;  3MVV A;  1CK1 A;  2R7Z B;  2X69 A;  1EZ8 A;  4X3T A;  2IT1 A;  3C3L A;  2C5C A;  3PUV A;  1L0Y B;  4PV1 C;  1HUN A;  5M5Y B;  2L4N A;  1TS3 A;  5G3L F;  3TP8 A;  1ENA A;  1IKL A;  1I4X A;  4EQP A;  3SHL A;  2PQE A;  2F0F A;  3M4Y A;  2O2L D;  1WD0 A;  3DEO A;  3TSS A;  1EL0 A;  4ZUJ A;  2XSC A;  4ME5 A;  1Y69 U;  1B2T A;  4HAE A;  2D9U A;  1CZW A;  1DYQ A;  3AMU A;  1B9M A;  3BS1 A;  1TS4 A;  1QB5 D;  2A6E D;  3SR1 A;  2ID0 A;  5CC4 A;  2XRQ D;  3VYU A;  1SJH D;  1EQT A;  1I4R A;  3MXN A;  2GA4 B;  2NVY B;  2JXM B;  5CBA E;  1KDA A;  1QNU A;  4NW2 A;  1S5F D;  2JE6 I;  2DN8 A;  4NMZ A;  3CKI B;  4J8Q A;  2A69 D;  1KAA A;  3T53 B;  4FF1 A;  2QF7 A;  3PV0 A;  1SYC A;  3T13 A;  2R92 B;  4L6T B;  4XQJ A;  1JE4 A;  2J7Z A;  2EY5 A;  5FKA C;  1Z47 A;  1PMR A;  2Y0S B;  2N88 A;  1NR4 A;  4IUV A;  1GUO A;  4PQX A;  1XX8 A;  2IX3 A;  2DNE A;  1M4V A;  3FPU B;  4QUF A;  2JA5 B;  4A3B B;  1A3T A;  4TRD A;  3KLS A;  1CFM A;  2NUC A;  5A2Q E;  5IGE A;  3SK8 A;  3I4L A;  1KAB A;  4UDU C;  1CZG A;  4K6D A;  4K2L A;  1G2S A;  2BA1 A;  3TDQ A;  1I6H B;  3NK9 A;  2F0P A;  4KJO A;  1EZ6 A;  2DNC A;  4BA2 I;  1QCB D;  1XXG A;  1JOK A;  2L9H A;  1F9S A;  4HN7 A;  5IT9 L;  1V8Q A;  3TZU A;  2NN6 G;  4U67 3;  1JWM D;  3I91 A;  1XTC D;  4RGO S;  1PTO F;  3VR4 A;  4IUT A;  3A7L A;  4ULL A;  4FF3 A;  4QF4 A;  1ML0 D;  2EJG C;  2KJX A;  4HR7 B;  3J7Y W;  1STA A;  4DA2 A;  1STG A;  5IGD A;  3DWQ A;  1RCV D;  3FEW X;  2K5D A;  4Q5V A;  1TS2 A;  4ZAI A;  5C4X B;  5C0X G;  2WV6 D;  3W2D A;  2F3W A;  3HP3 A;  4IUP A;  3V05 A;  4A3D B;  2Q8R E;  3OIP A;  4N9T A;  2LFN A;  5KND A;  2EXZ A;  3I72 A;  1F9Q A;  1CTM A;  3L3O C;  1K8M A;  5DEH A;  1WTR A;  3KUP A;  1LTI D;  2H1E A;  1ENF A;  1ZYR D;  1D6E C;  4O42 A;  3VA5 A;  1QWY A;  2KCN A;  2XNA C;  1HTL D;  1I3Q B;  3G7L A;  4DXG A;  3NE5 B;  4FXD A;  1GHK A;  3NQI A;  3V96 A;  1Y8N B;  4L63 B;  1HFN A;  3MEH A;  1B3A A;  3ERO A;  1Z7T A;  1Q8I A;  3MZ5 A;  1TWG B;  3KF8 A;  4TKO B;  2Z1C A;  2RA4 A;  2NN6 H;  4KKS A;  4XDX A;  2JYO A;  5I6W A;  3MC0 B;  1AW7 A;  4XXE A;  3HOY B;  3MA2 B;  2ZXR A;  4NKL A;  3VR5 A;  5K5P A;  3LX0 A;  1S5B D;  2EYH A;  3BVZ A;  3M4O B;  3S9W A;  5J39 A;  1RTO A;  3EA6 A;  3S17 B;  3SDZ A;  2F0I A;  1BCP D;  1YNN D;  5JEA G;  5I2X A;  5C0X H;  5DNF A;  5NUC A;  1ET6 A;  3C2P A;  4B08 A;  4RCO A;  4MN3 A;  5D65 A;  4PNY A;  1PTO C;  1W6K A;  1LTB D;  1X3Q A;  5I9O A;  1S5C D;  4RA8 A;  2G9H D;  2RSO A;  1JOO A;  2HCI A;  4OHJ A;  1AZP A;  1EWH A;  4X3K A;  2E2H B;  4O1N A;  1Q90 A;  2OT2 A;  1QG7 A;  1HQM C;  1B50 A;  1SYG A;  1IYV A;  5KYI A;  3RUZ A;  3DM1 A;  4H7B A;  2K01 A;  3MFY A;  2SNM A;  3GO5 A;  2Z8L A;  1OXV A;  2OXP A;  1CM9 A;  5C3X A;  3A8I E;  3W3A A;  4C1N K;  1F2L A;  4R8I A;  4KY6 A;  3E6Z X;  1EEI D;  5JEA H;  2F0J A;  4FYD A;  5FO8 B;  1U4R A;  2DY7 A;  5JOB A;  5DM6 3;  1HCZ A;  2Z4I A;  3ERQ A;  2NBF A;  3ND8 A;  4JK1 C;  3H0G B;  2NB0 A;  2FFK B;  4L8J A;  5I4D A;  1H9M A;  4IN3 A;  5IGB A;  2E74 C;  3IL8 A;  3H94 A;  4ZK9 B;  2JEA I;  4XQQ A;  1SE3 A;  1PRT F;  3A7A B;  1PZK D;  4X3S A;  2VNU D;  1JOR A;  2F0G A;  1LTS D;  4DFA A;  4CJ2 C;  2SOB A;  2B2T C;  1BO0 A;  3S15 B;  2M2L A;  2BA0 A;  1TR5 A;  4IUQ A;  1IYU A;  2QDB A;  4A3E B;  1WCM B;  4CKE A;  2Z4H A;  1VMC A;  4KN4 C;  1PYW D;  1F9R A;  4HTH A;  4HCS A;  4DF7 A;  2O5J C;  1S4Z A;  4KTA A;  3DWA A;  4C1N I;  2EYJ A;  3VA7 A;  5EQ0 A;  2F3V A;  2RDH A;  3HGB A;  2SDF A;  4IUN A;  2K7V A;  5IOC A;  5C4J B;  3PUW A;  3TP6 A;  2CVR A;  1AN8 A;  3M3Y B;  3K5M A;  5COY A;  2IX0 A;  5HUR A;  1QNK A;  3D4D A;  1CHQ D;  2R61 A;  1IW7 C;  3M85 A;  1H9K A;  2WKC A;  1CT1 D;  1DZ1 A;  2HQE A;  2NWG A;  1EWC A;  1EU4 A;  4A3K B;  1TWF B;  3AU7 A;  5ELD A;  4CKB A;  1L0X B;  3R2T A;  2MGS A;  3HG9 A;  1M8A A;  3LWE A;  3Q23 A;  2VUM B;  1DJR D;  1B1Z A;  5IGG A;  1BR9 A;  2K5Q A;  1CQV A;  1SYB A;  2JSO A;  3V2T A;  2B2U A;  3P7J A;  3MXP A;  3J80 L;  3QB3 A;  5TSS A;  5C4Z A;  3Q22 A;  2F4I A;  1MD2 D;  1KDC A;  1QOH A;  3RLF A;  2FJ2 A;  1HA5 A;  1V43 A;  3Q24 A;  2RDF A;  3GV6 A;  3NTK A;  2F0Q A;  1EEF D;  3SE0 A;  1WTQ A;  4BY1 B;  2LKV A;  1DD2 A;  1RD9 D;  2F03 A;  3L7Z C;  3PO2 B;  4YIJ A;  3NXW A;  5IIF A;  4P2C B;  1NCV A;  4WFN 3;  1UAP A;  3OPO A;  5EKL A;  4V19 0;  2B2Y C;  1DCZ A;  1AP0 A;  5ISR A;  3ZYY X;  1DXM A;  4K5X A;  5D3D A;  1KTK A;  4UAI A;  3GQB A;  1U4M A;  3MXG A;  3GTL B;  1RHP A;  2WAQ B;  3OW7 A;  5ELC A;  5CV8 A;  3PUX A;  4BA1 I;  1LV9 A;  1ESR A;  1JR0 D;  1A2T A;  4A3G B;  3K5N A;  4RKL A;  2VB3 X;  4C56 C;  3P20 A;  4F88 A;  1I6V C;  4FO2 A;  2EZV A;  2PYK A;  4ZKC B;  1E0B A;  1H9R A;  4C3I G;  1YNJ C;  1Q1B A;  1KNA A;  1SMY C;  4I65 A;  1CA5 A;  2NTS A;  4H44 C;  4K5V A;  3NWT A;  4BWG B;  2NVT B;  1ZKO A;  1DM0 B;  3JAM E;  3R3O A;  4C3I B;  3HOZ B;  1SAP A;  2F0V A;  2B2Y A;  1DON A;  1ENC A;  1JQY D;  4PMB A;  3BDL A;  5D3I B;  4G4K A;  2NTT A;  4MHE A;  1PTO B;  3EJI A;  1G8Z D;  5EPJ A;  3H3V C;  1X32 A;  3C46 A;  2YU9 B;  3IKJ A;  2QIL A;  1D5M C;  1MSH A;  3FPP A;  4N9P A;  5CV7 A;  1E2Z A;  4Y7N B;  4IFD G;  1JOQ A;  1OO9 B;  4RHR A;  1SEB D;  5KEE A;  4RCN A;  1A3U A;  3I73 A;  4QB4 A;  1JC7 A;  2A6H C;  3I8Z A;  3HOW B;  4OIJ A;  4ZRZ A;  3RZO B;  1PTO D;  5I9P A;  2Q8T A;  1D5X C;  3PUY A;  2XRS D;  1D2B A;  3NPP A;  4ZUI A;  2A68 C;  1EY0 A;  2F0O A;  4WRD A;  2AWN A;  1SJE D;  1W6J A;  4LAA A;  1DOM A;  1C4Q A;  3NBI A;  5J1Z A;  1D1K A;  3R8B A;  5LL6 X;  3DUZ A;  3BYT B;  3DWP A;  3EQL C;  3TP5 A;  4DNR B;  2PZU A;  3CHB D;  1G29 1;  5EKK A;  3WOF A;  4K8J A;  2K03 A;  3BVM A;  1QIL A;  2L1B A;  4Q0F A;  4OO1 G;  4Z9C B;  1VCI A;  3TME A;  3I4N B;  1EY4 A;  1FNU A;  5EBC A;  2F1M A;  1G91 A;  4DK1 A;  2WP8 J;  1ESF A;  2PPB C;  3D6C A;  4CJ1 B;  2XWB B;  1JIC A;  2F0S A;  2ICE C;  3QOL A;  5KRU A;  1A6X A;  3NHH A;  1OXS C;  2L0C A;  4IFD H;  1JB3 A;  5LHY 1;  3QO2 A;  4V0B A;  5IT9 E;  3HZX A;  5A35 A;  1MI2 A;  4A93 B;  3KBX A;  3ND9 A;  4KKT A;  4RGT A;  1TY0 A;  2D2C C;  3GTO B;  1BCP B;  1CQF A;  4DU9 A;  3WOE A;  4F7X A;  3CU7 A;  4RGM A;  2H4O A;  1AEX A;  4G7O C;  3UI2 A;  2A74 C;  1RF2 D;  4J6H A;  1R9T B;  4KK7 A;  1GUG A;  1ZXT A;  3EFX D;  1WTV A;  3LWU A;  4KN7 C;  4FXG C;  2MHV A;  2BDN A;  5KNC A;  3T16 A;  4RWS C;  5ELE A;  1D1I A;  4E6I A;  2J4X A;  2XN9 C;  2A6E C;  3SEB A;  2FMC A;  5CR3 A;  3H6M A;  4CHT B;  5IGF A;  2CW0 C;  2EYL A;  2B2V C;  4KY5 A;  2NZ1 D;  5JPM C;  2QKI C;  3S1Q B;  4OO1 H;  2B2W C;  1FGB D;  4QMG A;  3D6W A;  2JA6 B;  5BN3 A;  4QIW B;  4IQZ A;  2KA7 A;  2M9V A;  4MIU A;  2RKS A;  2AQ3 B;  1UEA B;  1BF4 A;  4DAP A;  5LL6 S;  3HRZ C;  4ILW A;  3NWS A;  1IW7 D;  2EPB A;  1PFB A;  5CMD A;  2O4X A;  2BCO A;  1BNZ A;  2KHS A;  1LT3 D;  1RKN A;  4GZY C;  3DXJ C;  1F77 A;  1CI3 M;  2QEJ C;  3GTG B;  1PRT B;  4I7Z C;  1II3 A;  1C8C A;  5FLX L;  1NAP A;  5CV6 A;  2PCF B;  3N6R A;  1WTO A;  4XTC S;  2EJF C;  2IX1 A;  4WJW A;  1EIG A;  2HUG A;  3J7A V;  2V4D A;  4S3S A;  1HXY D;  3A55 A;  1Q3L A;  1SE4 A;  3BVG A;  2E75 C;  1R4Q B;  3X3N A;  4B9W A;  3PIP 3;  3BG3 A;  2ZT9 C;  1CHP D;  5M5W B;  1KLU D;  2WB1 B;  4DK0 A;  2AQ2 B;  3PUZ A;  3I90 A;  1E2V A;  2MUY A;  4DNT B;  1FD7 D;  1SNC A;  2LS0 1;  1TVX A;  3O13 A;  2R3Z A;  4RH6 A;  2WAC A;  1SSO A;  2KED A;  1GUS A;  4CGY B;  1SDF A;  5KGU A;  2A73 B;  1G6Z A;  1PRT D;  1OXT A;  1BDO A;  1S5E D;  5T1I A;  1DOL A;  1LT5 D;  3ONA B;  4WOR A;  1ZEQ X;  3K57 A;  3IFD A;  1ET9 A;  1R4P B;  3BZD B;  1QE6 A;  2XIW A;  3P1H A;  2PZW A;  1WD1 A;  2F0H A;  1F2Y A;  3A8K E;  4ZKB B;  2E2I B;  1GUW A;  2TSS A;  4LK1 C;  4HSP A;  3G6J B;  3I4M B;  1OXU A;  2J0T D;  2CHB D;  1SYD A;  3VR6 A;  4DGZ A;  2AQ1 B;  4C3H G;  4PMW A;  2BE5 C;  1RJT A;  4RGN A;  2F0D A;  4LJZ C;  3A56 A;  3VR3 A;  3S1N B;  1AFP A;  3HKZ B;  1Q1E A;  2WII B;  1SXT A;  4RAU C;  3T4A C;  1TWC B;  4XT1 B;  5DM7 3;  4C3H B;  2R93 B;  1YNJ D;  5BN5 A;  4CJ0 B;  3D4W A;  2KOL A;  2E76 C;  2RVL A;  2AUJ D;  2HDL A;  3GP7 A;  3EVQ A;  3FMC A;  1HPC A;  2EDG A;  4KHZ A;  1Z6H A;  5EPK A;  4OL7 A;  4A3J B;  1O7Y A;  3I70 A;  5JPN C;  1YNN C;  1VMP A;  2A5H A;  4NDX A;  1SBB B;  5EBD A;  1HRJ A;  3HOU B;  1XYI A;  3K6O A;  3DEP A;  4J1M A;  5ELB A;  3J81 L;  4B9X A;  3OIQ A;  2B2T A;  3GTQ B;  1OXX K;  4M1U B;  5E4W C;  2EYM A;  3OMC A;  5JAV A;  1EY9 A;  4BY7 B;  4FXK C;  3A8J E;  5C44 B;  3IAY A;  3N52 A;  1V1P A;  2ENB A;  2HDM A;  2CQA A;  2WKD A;  5KYL A;  1IKM A;  2A6H D;  2PW5 A;  1I4P A;  2MPM A;  4EGV A;  1FYC A;  3NQT A;  3MAQ A;  2IW3 A;  2A68 D;  2N55 A;  1EIH A;  2R6G A;  3C1F A;  3E5S A;  1O7Z A;  5DAU A;  1UNS A;  3K5L A;  4KKU A;  1GUN A;  2K1B A;  3KLS X;  3TBI B;  3NP8 A;  4FF4 A;  2NN6 I;  1KDB A;  5FK9 C;  1F2Z A;  4KJN A;  2AUK A;  4HCE A;  2RQX A;  4IAL A;  4XT3 B;  2G9D A;  1QJO A;  4DAV A;  1EY5 A;  3J80 E;  1TKW B;  4XYO A;  3BDC A;  1LAB A;  4KD3 A;  5C0X I;  1IL8 A;  1BOS A;  2ZXP A;  4DXF A;  1SYF A;  1TWH B;  1JCK B;  3VR2 A;  5IOD A;  3AB9 A;  1Y1V B;  2WIN B;  4ABN A;  1WTP A;  2QCP X;  3QG1 A;  1IHZ A;  4HSV A;  2KCC A;  3GD7 A;  2YYZ A;  2L55 A;  2B8G A;  1SFO B;  1U4L A;  3MTS A;  1HQR D;  3OWE B;  2KVM A;  2K5W A;  1HHV A;  3CRK C;  1Y1W B;  5M3F B;  1BBX C;  1XWE A;  2K33 A;  2PNR C;  4H0L C;  3H09 A;  2SNS A;  1SE2 A;  3FDT A;  2EOT A;  5C3E B;  1CA6 A;  4R9W A;  1H9J A;  4ID6 A;  3DHQ A;  4QUC A;  2IPK D;  5COR A;  5KNB A;  5E4X A;  5A2Q L;  4K14 A;  3M7N A;  1SNM A;  4XQN A;  3Q0A A;  3BYY B;  4F8M A;  5EJW A;  3FRP B;  1A3V A;  4EVO A;  2F0K A;  2MJ8 A;  3K59 A;  1D5Z C;  5E3F A;  2X6L A;  4F87 A;  3BDO A;  4TSS A;  2CW0 D;  4XYQ A;  4RKB A;  1STB A;  1SYE A;  2DY8 A;  1TU2 B;  3S2D B;  1JWU D;  5T1G A;  3K5O A;  1NSN S;  2OF1 A;  1EQV A;  1HTP A;  2EY2 A;  1F2M A;  4PMC A;  3PMF A;  1A15 A;  1K83 B;  2B39 A;  2K32 A;  1T5E A;  1ONL A;  2KUM A;  4OGQ C;  3SK5 A;  2K05 A;  4G57 A;  2TMP A;  4CBV A;  4AYB B;  4R8N A;  1TQO A;  4H13 C;  1LTT D;  3HOV B;  3MFG A;  5AFW A;  4LMQ D;  1A2U A;  5JVH 3;  1LAC A;  5ELF A;  3T56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...