5HURA

Crystal structure of staphylococcal nuclease variant delta+phs l25t/i92k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKTMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25T/I92K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5hurA00
3NQTA 2RKSA 2F0GA 2SNSA 3P1HA 4ODGA 2RBMA 1NSNS 3T13A 4B9XA 4B9WA 3HEJA 5NUCA 5KIXA 2EYMA 1SNOA 1EYCA 5C5MA 4F7XA 1KDAA 4KD4A 5EKLA 3TP5A 2F0QA 5C5LA 4EQNA 4R8NA 3BDCA 3MEHA 3TP8A 2F0FA 3QOJA 1STNA 3ERQA 4K5XA 3D6CA 3EJIA 2KHSA 3H6MA 1STGA 2EY2A 3TMEA 2EYPA 4IZ8A 5IGFA 2EYFA 1STBA 2EYOA 2EY6A 2F0LA 2F0JA 4PMBA 4KJOA 5E3FA 1STYA 4PNYA 3RUZA 5IGBA 4K5WA 4F8MA 2F0KA 5CV7A 1RKNA 3BDLA 5CC4A 1SNCA 1SYEA 4KJNA 1STAA 1A3VA 4ZUJA 2PW7A 3VA5A 5IGEA 5ISRA 1ENAA 1NUCA 4ZUIA 2F0HA 5IODA 1ENCA 5K5PA 5E1FA 1A3UA 3SK6A 3T16A 4DU9A 3NK9A 3MXPA 3E5SA 4K5VA 2OEOA 3QB3A 1EY5A 1F2YA 1STHA 4G57A 5I6YA 5CR3A 5M9OA 5KYIA 3ITPA 1U9RA 4ID6A 4NDXA 5IGDA 1EY4A 3SK5A 5JOBA 3OWFA 4K6DA 5J1ZA 4K8JA 1SNPA 4QF4A 2PZWA 1JOOA 2F3WA 5IIFA 5JAVA 4HMIA 4RKLA 4TRDA 3D4WA 1SNDA 4NKLA 4I65A 5CV5A 1SYGA 1SNQA 1EQVA 3C1FA 3MVVA 4NP5A 5KRUA 1EY8A 1TR5A 3NHHA 4KY6A 3OSOA 3NUCA 4J1MA 3V2TA 3LX0A 3TP7A 5C3WA 4K8IA 4N9PA 5C4HA 2PZTA 1KDBA 4DF7A 5IGGA 1EYDA 3DMUA 1F2MA 5C4ZA 2F0DA 5CV6A 5CGKA 5KYLA 2EYJA 1SYBA 5I9OA 5DEHA 3PMFA 4K2LA 2WACA 4RKBA 3P75A 2EXZA 1IHZA 1KDCA 1TT2A 4KY7A 2EY5A 4QB4A 2F0MA 2SOBA 3MHBA 2F0EA 4QMGA 3DHQA 4J6HA 4E6IA 1KAAA 2F0OA 2F0IA 2EY1A 5KEEA 4IUNA 5C3XA 3QOLA 3SK4A 4NMZA 3SXHA 3EROA 4ME5A 1TQOA 4MIUA 2LKVA 4H7BA 2PW5A 5CV8A 5EGTA 3SK8A 2M00A 4KHVA 5DAUA 4EQPA 3U9OA 4WORA 2O4XA 2OXPA 5J22A 1SNMA 2EYHA 4KTAA 2RDFA 4IALA 2PZUA 4HTHA 4K14A 3NP8A 3NXWA 3SHLA 5IGCA 1EYAA 5J39A 2QDBA 5HURA 1EZ8A 1II3A 3OMCA 4HMJA 3EVQA 4DFAA 1EZ6A 4PMCA 1A2TA 1JORA 1EY0A 1EY6A 2F0TA 1F2ZA 1SYFA 1EY7A 5KGUA 3D8GA 1SYCA 3R3OA 4K2KA 4S3SA 2PYKA 2F0NA 4LAAA 4WRDA 4ZQ3A 2F0VA 5I9PA 4KV6A 4DGZA 4EQOA 2HQEA 5IOCA 3HZXA 5I6WA 3S9WA 2F3VA 2KQ3A 2OF1A 4EVOA 1JOQA 3C1EA 3MZ5A 5CV4A 1A2UA 3OMGA 3SR1A 1AEXA 2F0UA 5EKKA 4KD3A 4YIJA 2PQEA 5F2DA 3TP6A 2ENBA 1EY9A 1KABA 2F0PA 2F0SA 2NUCA 3D4DA 4OL7A 2SNMA 5HGTA 2F0WA 1A3TA 2EYLA 5CV9A 1JOKA 4KY5A 4N9TA 1SYDA 5C6AA
chains in the Genus database with same CATH superfamily
2JQOA 5M3MB 1U4LA 1CUKA 1YBYA 3MTSA 4MTNA 2L5TA 2MQHA 1K0SA 2Y0SG 5IYBG 3L2PA 1BXTA 1CT1D 4BY7H 2RVLA 3ND8A 3WWVA 3MAQA 2EY6A 2EIFA 5IGBA 3R2TA 1DGSA 2WB1B 4JI5Q 1D5MC 1RHPA 1IW7C 1I4QA 1V1PB 1Y8NB 2R92H 4BBSH 3ZYYX 5IT9E 5M3FG 1MHWC 3I4NH 4A3MH 4X3KA 2NVYH 3J80L 4A93G 3GD7A 1AE3A 4JI6L 4LFCQ 1KNEA 4LW1A 3E9IA 1Z6HA 1FNUA 2RDGA 4DV4Q 3R93A 5ELFA 1SE2A 2NN6G 1KNAA 5JJIA 3OWFA 5JAVA 2F3WA 2K14A 4R8IA 5CV5A 2K1BA 3EIVA 3HOUB 1EQVA 2B2TC 1BOSA 3F1ZA 3RLNA 2XTIA 4QCLA 2KBNA 4DNIA 3KK7A 5TSSA 1GM5A 1Y8PB 4MN3A 1YJNA 4LNQA 3CC7A 2Z1CA 5IGGA 3EN2A 5EPLA 4P2CB 1YNND 1XPOA 1QVCA 4KN7C 2D0PA 1EOVA 1QB5D 3UDFA 4XT1B 4A3GH 1PLFA 5I2YA 4BY1H 4L5RC 4CKEA 3PO2B 3BVGA 3AFQA 2MGSA 4KN4C 5EBCA 2RDFA 4HIDA 5EQ0A 4A3EH 4A3KB 2L9HA 1MGSA 2VXWA 1PTOB 3S17H 2IT1A 3CHBD 4K2KA 4ZQ3A 3T1HQ 3ND9A 1S4ZA 4R4CA 2I46A 1C0AA 1LV9A 1ZYRD 2KVMA 2JA6B 1AEXA 1DOKA 1B70B 1RD9D 3J81c 5GAHC 1C7YA 4QGUA 5HGTA 1EQQA 4HIKA 2K05A 4GKJL 2H5XA 3CCSA 3GTJB 2SNSA 4X62L 1ENFA 4R4TA 3PO3B 4Q0FA 2JK8A 4HIMA 2VB2X 1SNOA 4DUZQ 3S2DB 3L0OA 2PPBC 4JI3Q 1Y1WG 3FKIG 2B63H 1RF2D 2Q8TA 2L0CA 1E7ZA 4XQQA 1CA5A 2AWNA 3CCLA 2B2WA 4DNRB 4TKOB 1I4XA 1S5ED 5CC4A 1SNCA 4KJNA 4UDUC 4HAEA 3L7ZC 3CCMA 4UPAA 1YNNC 2A6HD 1B1ZA 1PXUA 3E6ZX 4LMQD 5AJ3L 3H0GH 1PZKD 2BE5D 1SDFA 4BBRB 1DJRD 4HMIA 5JEAJ 4DV0Q 3HOVH 3D0FA 4LWCA 1EY8A 2RSNA 4J1MA 4A3IH 4O1NA 3LX0A 3V2TA 3RMHA 4JI5L 5IYDH 1CHQD 1K28A 1CQVA 3ULJA 1VCIA 4P71A 3CCUA 2V1CC 1QUQA 2WACA 4A76A 2VW9A 3I7FA 3HOWB 1L1OB 1UEBA 4GN5A 5G3LF 4LFCL 1ZYRC 4BBSG 4NMZA 4DV4L 1PA6A 1X6OA 4UAIA 4LK1C 4A3MG 3NELA 1NR4A 2QW7A 1CKMA 5C3EG 3I72A 1E3PA 1GUTA 4A3BH 1GUOA 3I8ZA 1U0LA 4GOPA 1XTCD 4DFAA 4HSPA 1VQLA 1KXLA 4IQZA 3F2UA 5I9PA 4POGA 4DV3Q 1WTXA 2PQAA 5IP7H 4OELB 3SEBA 4A3LG 1Z7TA 3VR4A 1MBYA 4F88A 1YHBA 4JBKA 5J3BA 5CV9A 3OIQA 3S1MB 2Q2UA 5T1GA 3PUZA 2XWJB 4A3GG 2F4IA 4HSVA 2F3IA 4F7XA 2A6HC 3RN5A 4HJ7A 4BY7B 1CKNB 2RHSB 3KOJA 4R8NA 3TP8A 3CCRA 3QOJA 1VQ6A 1BO0A 1B4OA 1HA6A 1STGA 2XN9C 4IFDJ 2B2UC 2BE5C 1HR0Q 1QNUA 1Y14B 3DWPA 4H02A 3T1HL 4G7OC 2R92B 2B39A 2UUBQ 2V4DA 4A3EG 1LTSD 1F9RA 2BA1A 5FJ8H 3DM3A 3K5OA 1IXRA 1AFPA 3DLLA 2JA5H 4JI0Q 3QIAA 4R4QA 3FHWA 4GS3A 3KLWA 4FP5D 2YTXA 1XXGA 4XIGS 4DAMA 2QF7A 1EY4A 2VNUD 4L6TB 1VQBA 4DUZL 3VA7A 3BG3A 4QF4A 4NXNQ 4WJWA 2CWAA 2G9HD 3FMCA 4IPHA 1S72A 2KEEA 4IPGA 3E3XA 3C3LA 2PZTA 2R7DA 2IHEA 2K52A 1RTOA 1WTVA 1KIXA 3GTOB 1HFNA 1L0YB 3LWEA 1YJWA 1AW7A 1SE3A 1LTRD 2EJFC 4J6HA 2JYOA 2K5NA 2EDGA 4IUNA 2KCCA 5C4XB 2EOTA 5IP9H 1VQEA 3PF5A 5I4DA 1JJCB 1B2TA 1SEBD 1WCMG 3U9OA 1PH3A 3BZKA 3CMAA 5C0XH 4DV0L 5HURA 3OMCA 3J80E 3S17B 4YY3Q 2M9VA 3HP3A 2I0QA 4DR7L 1F2ZA 2C9OA 4R4IA 4DGZA 4EVOA 3MZ5A 2UXCQ 2DJGC 3D4RA 1V1PA 4X3TA 4CKCA 4HJ5A 1GUNA 4GNXC 2B2VA 1D7QA 4OL7A 1KABA 2NUCA 4GKKQ 2F0WA 4FNFA 4GLVB 4KKSA 4P73A 4N9TA 1DYQA 2F0GA 4GN3B 2WINB 3UDIA 5IT9c 3DEOA 1XX8A 1JB3A 1YI2A 1D1KA 2Z8LA 3UE1A 3SGIA 2B63B 3KYHC 3I70A 5C5LA 5AFWA 3AQQA 1SAPA 4Y7NB 2QCPX 4C3IG 1X54A 1B3QA 2EYFA 5K36H 2BH8A 2DUDA 4DV3L 4C1NI 3GP7A 3I55A 3RR5A 1JJGA 3BDOA 3RN2A 2F0HA 3RLOA 2JA8G 1B53A 4PZ6A 5BN5A 4G57A 2HDLA 4JBMA 1QZHA 1SFOB 3K5NA 4JI1Q 1MSGA 3HOVB 1LYLA 2DNEA 3HKZE 4FF1A 2Z9HA 4A3IB 4DXGA 4IUPA 2ALYB 1BDOA 5C4JH 4RFBA 1J9OA 1WTWA 3CD6A 1D2BA 2R7ZG 1K3RA 4DF7A 1EYDA 2UUBL 1HXYD 3I4LA 3QG1A 2WKCA 2RQXA 1LT4D 3QO2A 5H1SE 4JOIC 1EIHA 4X6AH 1L0XB 1GUGA 1C4QA 1NBWA 1X3EA 2KHJA 4JI0L 1O7IA 4E6IA 2MO1A 2CW0D 1FGUA 1PH2A 2BH2A 1YIJA 1MSHA 2M00A 4EQPA 2E5LQ 1Q8IA 4RMFA 4DR1Q 4DN4M 4A3BB 2WAQE 1ZEQX 4KHZA 4UP8A 4I7AA 2JA5G 1FGBD 3L3OC 4NXNL 1K0RA 1WTPA 1HRJA 3WOEA 1W3SA 1YVCA 1HUMA 2WP8J 4IJHA 1VF5C 5DNFA 4IFDG 1ET9A 1SYFA 2VQFQ 3D8GA 2SDFA 1QCBD 2ASBA 4S3SA 3CRLC 2I07B 2WKDA 1GUWA 5IYCH 2NWGA 1NE3A 3M4YA 1NJIC 2KECA 3TP6A 1FJGQ 3D4DA 4C1NK 4QIWE 4A3JG 1VQHA 2ZXRA 1QOHA 2VQEQ 4ODGA 3K57A 2AQ1B 3P1HA 1NSNS 1QE6A 5NUCA 1K83H 3W5OA 3NTHA 2FMMA 5L37A 5JVH3 1KDAA 3K7UC 1A63A 2L4NA 4XQNA 2ZM6Q 2F03A 1D5ZC 4CGYB 5E4WC 1I94Q 1STNA 1S5CD 3VR5A 2YTYA 4PMBA 1EIYB 2ZJQA 2LSSA 1I4HA 4JI2Q 1I4RA 2UXCL 2C35B 3EFXD 3VA5A 4H0LC 1V43A 2ATWA 3K8AA 3OWEB 1KQSA 3DWQA 4GKKL 1TWAB 5D65A 2Q2IA 1EWHA 3OOCA 3SK6A 4DXFA 4LUZA 3PO3H 1L1OA 4A75A 3HGBA 4OONA 5LHY1 2K32A 1G2SA 1LT6D 3OW2A 3M9BA 3U50C 1U4RA 3D4WA 2RCNA 4LF8L 2CW0C 3I73A 2ZXPA 1WTRA 2IW3A 3NUCA 1HH2P 3VYRA 3TZUA 1PH6A 2AQ2B 3U4VA 2OQ0A 2XWBB 1I3QH 1IYJB 4JV5Q 3KJOA 3BZDB 2IL8A 2XRQD 1I6VC 2EXZA 1TT2A 1LT5D 2GVBA 1WD0A 2LFNA 2SOBA 4ZCKA 2F0IA 4FXKC 4IN3A 2YU9B 3EROA 3SK8A 4BBRH 3TS0A 2NVTB 2OTLA 1D5XC 3I3CA 4JI1L 3A54A 5M3MG 1ZKOA 3GTPH 3FVQA 4IUUA 1EYAA 1CKNA 1O78A 2AHOB 3NQIA 1T9HA 1QWYA 2F0TA 3MEFA 3K5LA 2RA4A 3AU7A 3CP0A 4OHJA 1VQ5A 4LAAA 1GHJA 4XXEA 4KV6A 3H3VC 3Q23A 5I6WA 1JOQA 5CV4A 1FVIA 3OMGA 2MNAA 2Q8RE 3HOWH 4A3FH 2WB1G 5EKKA 1EUJA 2PQEA 3MXNB 1PH5A 4KKUA 1UAPA 1EQRA 5DM73 1A3TA 2QILA 3FP9A 4OX9Q 2Q2TA 4B08A 5GAGC 1P8LA 4TSSA 3I4MG 2E5LL 2L15A 1VQ9A 4DR1L 2BA0A 5FLMG 2B2WC 2A6ED 4UHVA 3HOXB 1K8AC 1GD7A 1PRTB 4A3CH 2EY2A 2C5CA 3IFDA 1SMXA 3HOUG 1ZXTA 1HNZQ 2VQFL 3A7LA 5E3FA 4WFN3 4JI7Q 1ESRA 1B50A 4LF9L 1CFMA 3BDLA 3W3AA 1XNQL 1C8CA 2CCZA 2OCEA 2NYZD 1UE1A 1FJGL 1KC8C 3LWUA 3IRBA 3S1MH 1KLGD 2VQEL 3NTKA 5M9OA 3QJYA 3H15A 4NDXA 5IGDA 5ELBA 2LXKA 2KENA 3BYTB 3UI2A 3PO2G 4OGQC 2ZT9C 2JJQA 1JMCA 2K04A 2ZM6L 1BBXC 1TXYA 1I94L 5LMNW 5C4JB 1GJXA 3PCOB 3NWSA 4OO1H 2R93B 4A3KG 2XVSA 4V190 3GV3A 4FF3A 3J81i 1L0WA 3D6WA 1X55A 4JI2L 2JP1A 2OQKA 3BVMA 3MC0B 2NZ1D 2F0DA 4BXXH 4HN7A 2MPMA 3S1NB 4K2LA 4DR4Q 1PFSA 3EQLC 2JA6G 3MHBA 5JJZA 4APVA 4GOPC 4EX5A 4ZRZA 5CV8A 4C3JH 4C2MH 5M5WB 5BR8Q 2TSSA 4A3DB 5KNBA 4J8QA 4WORA 2JSOA 1I50H 3GTKH 5ELOA 2FHTA 2VB3X 4HTHA 3PO3G 1JWUD 2UU9Q 2HDMA 4JW0A 3JAMc 2CWPA 2AKWB 2E2DC 5KGUA 5FO9B 1EY7A 1GVPA 3B6YA 3R8BA 1ONLA 2A6EC 1SR3A 2XIWA 4IOCA 2Z4HA 4HJ9A 3BS1A 2O5JC 5JJLA 3VR6A 3GTOH 4B3SQ 4JV5L 5EJWA 2M2LA 3HOYH 2JA9A 1VQPA 1JCKB 4AH6A 2B29A 1BCPB 4WJ3M 2F0SA 5C4XH 5IE8A 1R4QB 2E75C 4L63B 1W6JA 1K83B 2Q8IB 3S1QH 4JC0A 3T13A 1QG7A 3RNUA 2EYMA 2E2IH 2QA4A 3E0JA 3NEMA 1JR0D 2Z6BA 1C48A 2PNHA 4EQNA 4RAUC 1PFMA 1VQMA 1YEZA 3ERQA 1TVXA 1AE2A 3NTIA 4BBRG 1CQFA 3OPOA 2F0LA 1HZBA 1SRUA 4PNYA 3MA2B 1TY0A 3KLSX 1W2BA 3SE0A 3AYHB 3W1BA 3T4AC 3S15B 5E4XA 2CFMA 1N8RC 2VUMH 2PO4A 2RCFA 1VQOA 1Y1VG 4OX9L 3E5SA 4HEDA 1TS3A 4BA2I 4ID6A 2L12A 1UE7A 4IPDA 1SSOA 1N32Q 3J81L 1M1KC 3KFUA 1SNPA 3HKZB 1F9SA 4DKAC 3KF6B 4R4OA 4Y7NH 1E2VA 1SYGA 2L55A 1YZ6A 5ELCA 2MJ8A 2BCOA 3TP7A 1HHVA 1HNZL 4K8IA 1X32A 2H1EA 4CDFC 1I3QB 1ET6A 4PQXA 4JI7L 5ELNA 1O7ZA 5CORA 2B8FA 1S3OA 1AP0A 4JVZA 3TREA 4RKBA 1JJ2A 3GDEA 1UUPA 3A5UA 1PTOD 4IOAA 3OTOQ 2ES2A 2F0EA 2CH4A 1IYUA 3CCEA 3SXHA 2WAQB 5G3LD 1SFOH 1J6QA 3K7AB 1PFNA 2OXPA 3GTPB 2EYHA 5FKAC 5EBDA 2E76C 4K14A 5A35A 3P7JA 1EZ6A 4BS9A 1LTBD 4F87A 4BY7G 2B2VC 4GLAC 3KLSA 1OXVA 1PTOF 3GTMH 2CQOA 1SJED 3S9WA 4ALPA 3CPWA 3C1EA 3OIPA 2RSOA 4A3FB 2KUMA 4IO9A 1YNJD 4XQJA 3M85A 2R92G 3J7YW 4QIWB 4QUFA 4RCOA 3CCVA 4DR4L 3I4NG 1GHKA 2G9DA 2SNMA 1BNZA 1EWIA 4RA8A 1SYDA 5C6AA 3ULPA 2IPKD 1KAWA 2RBMA 3CAMA 5FOBB 5BR8L 1IL8A 3ONAB 2D2CC 5FLXc 3PUVA 2R7FA 5FO8B 4BA1I 2LS01 1OXXK 4YCUA 2UU9L 1HCZA 4K5XA 1CSPA 4JPBW 3T51B 3W2DA 2KHSA 4UP7A 3VR3A 1O7YA 1NY4A 2LXJA 2A69D 1IBMQ 1QNKA 4N8X1 4B3SL 1RKNA 4IPCA 3CRKC 5BN3A 4O2DA 4ZUJA 4RGTA 3K58A 4JI8Q 2JEBI 4I7ZC 2QGQA 1ASZA 1N9WA 1SE8A 4BY1G 1QVGA 3ITPA 3I90A 3SK5A 5JOBA 1FR3A 3STBD 1PTOC 3WDNA 4HJAA 1N34Q 5HGQA 1X3QA 3CF5A 3M7NA 3HOZB 3W1GA 2HD3A 3NSWA 1DONA 3NWTA 5CBAE 1IBKQ 1TWAH 4KK7A 3NBHB 3PMFA 3VR2A 1E24A 1KDCA 3MXNA 1PYBA 2FFKB 2NN6I 5LL6X 1VQ7A 4RHSA 4C3JB 1IKLA 3G71A 3EA6A 4C2MB 5FK9C 1YNJC 4JYAQ 1TQOA 4L5QA 4DR6Q 1EIGA 4JI3L 4XYOA 2E74C 1I50B 1M90C 3GTKB 1LTAD 1GXDC 3IL8A 4XTCS 2MHVA 5C3EB 5GAEC 4K0KQ 5C0XJ 1CTMA 4ZKCB 2QDBA 3K6OA 3MFGA 1CZWA 2NB0A 1IBLQ 2B63G 1VQIA 4OEMB 1MKHA 4HJ8A 1Q82C 3M4OB 2A74C 3LGJA 1ICFB 4YHHQ 1VS0A 3HOYB 2HQLA 3SR1A 4ULLA 1DOMA 2YTVA 1KRSA 5A2QL 1G91A 2AUJD 4J15A 4JBWA 3PQIA 4HCEA 2A69C 1PH4A 2YU9H 1K9MC 3S1QB 4R9WA 4DK3C 5I2XA 2NVTH 3NE5B 2E2IB 5KIXA 4X3UA 3H0GG 1HQRD 3M4PA 1V9PA 5M5YB 3BVZA 4QJFA 1NMGA 2ZTDA 5C44H 1Q46A 4AQYQ 2UXBQ 2Z6KA 4OXPA 2E2JH 3TMEA 1K8GA 4JI4Q 3HOVG 3D31A 3STBC 3FPUB 2N8NA 4A3IG 2OWOA 2JE6I 3URYA 1IKMA 1L1OC 3KF8B 1NCVA 1SBBB 4B3MQ 5IYDG 4ZKBB 3UDXA 2VUMB 2JEAI 5ELEA 5IY0A 1ENCA 3GO5A 3TN2A 1AZQA 3CKIB 3QB3A 2CHBD 2RDHA 3MFYA 2K75A 3PSIA 2Y0SE 4NB3A 3HOXH 3CQZH 1XMOQ 4LUOA 4RKLA 2K5WA 4I65A 4A3BG 1HPCA 1KLUD 3I56A 4MTKA 5IT9L 2UXDQ 4XT3B 1OXTA 1PFBA 2MO0A 5D3DA 3GTLH 1UE5A 4AYBG 4CJ1B 3TSSA 1IBML 4L5TA 5T1IA 1D6EC 5IP7G 1MD2D 1SYBA 1GO3E 3KJPA 3P75A 4JI8L 1IHZA 5JJKA 2F4VQ 1O80A 2K5DA 2R61A 1F9QA 1KRTA 1FL0A 5J22A 1N36Q 1HR0L 2PZUA 1N34L 3NP8A 4PG3A 3KBGA 5J39A 2VZAA 5EAYA 1S5BD 2E2HB 3DUZA 5BN4A 2R93H 1EY0A 3IFTA 2RF4A 3GTMB 1LUZA 1SYCA 2F0VA 1WTHA 2ZJPA 3GTGH 4G7HC 3CW2C 1PZJD 3RZDB 1JB7A 1EYGA 2X6LA 3S1NH 2F0UA 1IBKL 3NBIA 4KD3A 3TBIB 5FJ8G 1C9OA 4DR2Q 3JC66 3S1RB 5M5WH 2R3ZA 4A3DH 4C56C 4JYAL 1EEID 4DR6L 4B9WA 3I91A 3KUPA 3CPFA 2K7VA 1DXMA 3CCJA 4R1JA 5C5MA 2A5HA 3G7LA 1A62A 1I4PA 4K0KL 1TWHB 4ZYSA 3KF6A 4LFAQ 1Q7YC 1VQ4A 1T5XD 2R6GA 3EJIA 4GN4B 4IZ8A 4A4IA 1IBLL 3IAYA 1XYIA 2I5LX 2NZOA 4YHHL 2IX0A 3F2BA 1SYEA 1A8VA 2PNRC 4O42A 4TVAB 2A73B 4C3HH 1NNXA 1JE5A 2QDLA 1H9KA 1U4PA 5DLQE 1Q86C 1PV4A 2EVBA 1UNSA 4K6DA 4K8JA 4CDCC 5CBEE 1VMPA 1TWFB 5IP9G 3SVMA 4YY3L 4M8AA 4AQYL 2UXBL 3GV6A 4JI4L 5C0XG 4DK0A 1TWCB 2A1AA 2H4OA 2HHHQ 1G6PA 3V05A 3S15H 1RIPA 4DAVA 5M3FH 4B3ML 4LF6Q 1QJOA 3A55A 4FYDA 4A93H 5I9OA 1EWCA 1Y8OB 3M3YH 5DEHA 4K6LA 4DAYB 5CYUA 1B9NA 2B2YA 4OIJA 4QMGA 1TU2B 3VYSA 2NN6H 1F77A 2KOLA 1KTKA 1XJVA 1BF4A 2AMCB 3BZCA 2TMPA 1ILQA 4DV7Q 1X65A 3G6JB 1H9JA 3S14B 1II3A 3EVQA 3E0EA 2UXDL 4NW2A 4PZ8A 2VS1A 3AMUA 3S2HH 2HCIA 3G6EA 4L5SA 5K36G 3C46A 1EOTA 3NENA 2EQSA 4CJ2C 1JQYD 1XMQQ 3QWNA 5F2DA 1GKHA 3TDQA 3HRZC 1E1TA 2F4VL 4RWSC 2I5MX 3CXCA 2JA7B 3E9HA 1XTDA 5ELDA 1WOCA 3J7AV 2ID0A 3TS2A 2RKSA 3K7AH 4CBVA 3VYTA 1EYCA 2ZTCA 5C44B 2FJ2A 1D8LA 1M8AA 2K6AA 2E2JB 1HR0W 2F0FA 4KI0A 4KKTA 3D6CA 1RTNA 3OW7A 3F8TA 4FXDA 2EYOA 1KD1C 4DNTB 3DXJC 1PYSB 1SROA 1WYDA 2R93G 1TWGB 2PW7A 1U4MA 4DR2L 1LT3D 1D1IA 3H3VI 3NBHA 1A3UA 4DU9A 3F2DA 4P72A 1O7LA 4LF5Q 1CI3M 1WI5A 1IZ6A 1ASYA 3CQZB 1STEA 1ICWA 4DV5Q 3JAMi 1AN8A 2MFIA 1CKOA 4X62Q 2PMZE 2ZJRA 2ZTEA 4LFAL 4LF4Q 4KY6A 1IL2A 4ILWA 3GTLB 2BOSA 1GUSA 1E0BA 2K33A 3TQYA 2P5ZX 1FD7D 1M4VA 5CV6A 3K81C 3I2ZA 4B3RQ 1TY2A 3L9AX 3K80C 5IYCG 1EEFD 1EU3A 1MJEA 3N6RA 1X9NA 3CU7A 3C2PA 2J7ZA 3H09A 4KY7A 4QB4A 2EXDA 3CCQA 4XDXA 1MI2A 3QOLA 5EGTA 2O2LD 4MIUA 1AZPA 4H7BA 3FDTA 4EGVA 2MUYA 2X69A 1E2ZA 2D5DA 2NTTA 3NPPA 1HUNA 4XYQA 2K5QA 4IALA 1HNWQ 3BJUA 3HOZH 3BYYB 2L11A 1EL0A 1JORA 1EY6A 4LF7Q 3J80c 2HHHL 3GTGB 2XRSD 1E2WA 4EQOA 3CMEA 1XWEA 2I5HA 3KF8A 1H9SB 4LF6L 1PRTD 1LO5D 1Q1BA 2FXQA 2ENBA 1PH7A 3KLRA 5COYA 3G4SA 5C3EH 3I4MB 1CK1A 3WOFA 1HA5A 4DV7L 4KD4A 3V96A 3TP5A 5KNCA 2F0QA 2KHIA 1DCZA 4IFDI 2XNAC 2PCFB 2HIXA 3FEWX 3O13A 3HKZG 2UUCQ 3M4OH 5IGFA 1PRTF 1S5DD 1STBA 3S16H 1Q90A 4KJOA 2KCMA 2WIIB 3DM1A 3KBXA 2NVXB 3RUZA 2O5IC 4ZAIA 4F8MA 3T1YQ 4A3LH 2EJMA 1ILPA 3RZOH 4IUTA 4QUCA 1G51A 1STAA 4C3HB 1XMQL 3JAML 1ENAA 4ZUIA 1JE4A 4NPSA 1LTID 3NK9A 1PHJA 2OEOA 2Y0SB 4LFBQ 5KYIA 2LMCB 5M5YH 2LY7A 4X65Q 1RL2A 5J1ZA 3MXGA 1WJJA 1PH1A 2WAQG 4TRDA 1YJ9A 1SNDA 1H95A 1J5EQ 4NP5A 1HFGA 4Q5VA 1CZGA 5IWAQ 3PF4A 3OSOA 5C0XI 1QZGA 1CSQA 4HCSA 2QKIC 2IHFA 4N9PA 1T5EA 3PUXA 4U673 5M3FB 3ULLA 2AUKA 3LNNA 3GQBA 4PMWA 1JWSD 1Q8KA 4A93B 4RGMA 3M3YB 4DV2Q 4AYBE 1WTQA 1CM9A 1S5FD 2EYJA 1TS4A 4OWWB 2EJGC 1YNXA 5JVG3 2A8VA 1LACA 1BUVT 3HOWG 4A3FG 2AWOA 1X3PA 2F0OA 3BU2A 4UY8C 1EFID 1PRTC 4ME5A 4LF5L 2EE1A 1DD2A 3A0JA 4QQBX 4DV5L 1TIID 1I6HH 4KTAA 2E8GA 1BCPD 4RCNA 5IGCA 4LF4L 4HMJA 3K0YA 4A3CG 1KL9A 3S2HB 2FMCA 4RGNA 2F0NA 5M5XB 1PH9A 4POFA 1FNVA 3A74A 3HZXA 2KCNA 2OF1A 1SE4A 2K5HA 1G2TA 4B3RL 4AIMA 3I4OA 1QILA 1IYVA 3X3MA 1EY9A 4X64Q 1BCPF 2Z6KC 1VQKA 4G4KA 3HG9A 1WCMH 1VMCA 3HEJA 1K73C 3GTQB 2GN5A 3PIPA 1YHAA 5EKLA 4P75A 2E2HH 1HNWL 2KJXA 3H6MA 1Y69U 1BBWA 1MJCA 4DR3Q 2F0JA 4LF7L 2K03A 3RZDH 4OO1G 1BR9A 3HOZG 1A0IA 4DR7Q 1NTGA 2QEXA 3M7GA 1X3FA 3S1RH 3AB9A 2CVRA 3H91A 4BXXG 3A8IE 4DAYA 5LL6S 4YWKA 4YCVA 2OT2A 3H3VH 1Y1VB 2F1MA 1F2YA 1EU4A 4G7ZC 4OWXB 4GNXB 1TWHH 1Y1WB 1Q1EA 3FKIB 1RDPD 4C3JG 4H13C 4CDEC 5JEAH 3PV0A 3TRZA 4C3IH 5KRUA 4U68A 1WTOA 3NHHA 2UUCL 4B3TQ 3TEHB 3K5MA 5FLXL 2YYZA 1BCPC 4CDDC 4KHPQ 4DV6Q 2NTSA 3T1YL 1HQMC 5C4ZA 1DM0B 2B2TA 2K5VA 2JA8H 1NR2A 1S40A 4YWLA 3HOYG 2G5DA 3FPPA 1KAAA 1VQ8A 2JN4A 5C3XA 1UE6A 5C4XG 4LFBL 2LKVA 4RHRA 1TWFH 4KLKA 3EBEA 1R9TH 1I5FA 1G291 4FO2A 4KMUC 4X65L 1LTGD 5FO7B 1VQDA 1Q12A 1J5EL 1TWCH 3IKJA 1BVSA 5IWAL 4PMCA 1A2TA 2JXMB 2IX1A 2KCTA 3PIP3 2R7ZH 5E7NA 4FF2A 2DY7A 4IUQA 2F3VA 2IX3A 4DV2L 3AEVA 1Z9FA 4HR7B 1N33Q 4YIJA 4BBSB 1Q3LA 2AQ3B 1VQFA 2F0PA 2J0TD 3I4NB 1HTLD 2IJ0A 4A3MB 1N32L 4JBJA 2NVYB 1EIFA 2VUMG 3RLFA 2DJFC 2EPBA 4ABNA 4LUVA 3F2CA 4QY7A 1PMRA 3S14H 2HIVA 1F2LA 3Q0AA 2N88A 3MEHA 1PVOA 1SJHD 2K50A 4YWMA 2N49A 3S16B 4IFDH 2EYPA 3A5ZB 4X3SA 1Q81C 3AFPA 3H94A 2HT1A 5LMUQ 4PZ7A 1CA6A 2GVAA 4K5WA 3RZOB 4DA2A 1FNWA 2UUAQ 1AH9A 4L8JA 2WB1E 3OTOL 1HNXQ 1NAPA 4JK1C 3KDFB 3FRPB 5HY6A 4A3JH 4YCWA 1E1OA 2JA7H 1U5KA 2VL6A 4X64L 4A3GB 1DZ1A 4K5VA 1LABA 5I6YA 5CR3A 4BY1B 3SDZA 4V0BA 1LLRD 3ER0A 2PMZB 4QL5A 3UDGA 1JOOA 3J7AF 1PYWD 1MIUA 2K28A 3A7AB 3Q24A 1LTLA 2Q2HA 3Q8DA 5GQOA 4DR3L 4A3EB 5LMNQ 5C3WA 2B2YC 1KDBA 3A8JE 4NXMQ 3G48A 1TWGH 1F2MA 2A19A 1VQGA 1CHPD 5CGKA 1Z47A 1XNRQ 2BDOA 2WV6D 4LJZC 1H9SA 1YITA 3TZDA 4X66Q 1P16A 2F0MA 1G6ZA 5KEEA 1WFQA 3A8KE 4TQUS 2EY1A 1XPUA 2FINB 3SK4A 1SXTA 4KHVA 1I6HB 4H44C 1SNMA 4DUYQ 3JAME 3NXWA 1K8MA 1X56A 3OHXC 2ICEC 1B8AA 4FF4A 4O0AA 1W6KA 4B3TL 4WJ4A 4CHTB 4LF8Q 4PV1C 3R3OA 1H9RA 2D0OA 3OYYA 4RH6A 3U4ZA 5JEAG 4DV6L 4KHPL 2KQ3A 4EQ5A 3UE0A 2NVQH 1VQAA 4N8FA 1J8IA 1SN8A 2Z0SA 2KA7A 3T53B 5KNDA 1WCMB 3Q22A 1JOKA 1VDZA 2D9UA 2N78A 4KY5A 1K8OA 2WFWA 5M3MH 4M1UB 3H0GB 2HCCA 4JG2A 3D3RA 3PIOA 3BDCA 2IY5B 2F52A 1HTPA 3J81E 4UP9A 2B8GA 4DR5Q 4OO1I 1ML0D 3M4QA 3DWAA 2F0KA 5CV7A 1H9MA 1HJPA 2IWHA 1A3VA 1N33L 2YV5A 4Z9CB 2B2UA 4ZLTF 5CMDA 5ISRA 3CC2A 1NUCA 2L1BA 4DV1Q 5E1FA 3T16A 1UEAB 1EY5A 3I4MH 1JC7A 1STHA 3P20A 1UWVA 2XSCA 5FLMH 1YHQA 1U9RA 1V8QA 4ZK9B 3J7ZC 2PZWA 5IIFA 4C3IB 2DNCA 1HZAA 1SNQA 3MVVA 4RGOS 3HOUH 2K4KA 2QEJC 2NVXH 5EKIA 3ICEA 2J4XA 2MP1A 5LMUL 2ZXOA 3DMUA 4AYBB 1OTCA 1TS5A 2UUAL 2JA8B 1HNXL 3A56A 4MNOA 2Z4IA 3U9SA 4OWTB 1QVFA 5D3IB 2VY3A 4LF9Q 2X6GA 1XNQQ 5IYBH 3DHQA 3X3NA 1G8ZD 5IODA 5K5PA 1R4PB 1R9TB 1V1OA 1RJTA 3PO2H 3U58A 4MZ9A 3K59A 5GROA 2JA7G 2O4XA 1V1QA 1JT8A 2D62A 2CQAA 2GA4B 1EZ8A 2R7ZB 1WVLA 5C44G 2EZVA 3ZJYC 3QR8A 4A3KH 4Y52H 1TS2A 3RD4A 4FXGC 5LMNL 2NBFA 1PZID 3J81j 1L2FA 4WRDA 2RHQB 2PYKA 1PTOH 1LTTD 3PIO3 4NXML 2HQEA 4IUVA 2OTJA 3S24A 3T56B 1XNRL 1A2UA 1QUQB 4DK1A 4IURA 2N55A 2JA6H 1OXSC 3R2IA 1OXUA 1B44D 4X66L 4HIOA 4JI6Q 2B3GA 1BQQT 4MHEA 1WD1A 3MXUA 1XMOL 2A68D 3NQTA 2JA5B 5FLXE 4B9XA 1FYCA 1SLJA 3GTJH 1A15A 1SMYD 2KEDA 4GNXA 4DK6C 2ICIA 1K3BC 4DUYL 1OO9B 3J7A5 1GOZA 1I4GA 3HOXG 4GOPB 3S2DH 4DAPA 1F9PA 4FVMA 4FDBA 5M5XH 3PGZA 1E22A 2PQAB 1STYA 2DGYA 1BKBA 3VDYA 3HS0C 1EQTA 4A3JB 3PUYA 1PH8A 5IGEA 1JWMD 3HKSA 3DEPA 5EPKA 3MXPA 5GADC 1N36L 5JPMC 3GTQH 1TKWB 1NMFA 1VF7A 2N3SA 1B7YB 5DM63 4RG1A 4DPGA 2BDNA 4NKLA 3J80i 3PUWA 3VYUA 3C1FA 1IW7D 1TR5A 5JPNC 1HZCA 4JCVE 4CKBA 1VQCA 4IJLA 4DR5L 5C4HA 2NZHA 2XGTA 1RCVD 1XPRA 1B3AA 5D14A 5KYLA 2PI2E 1VQNA 1Y1VH 4DV1L 2EY5A 4GKJQ 4BWGB 1Y1WH 3FKIH 1EFWA 2SEBD 3CC4A 1VQJA 2PW5A 5A2QE 4A3DG 3Q6SA 5DAUA 2DN8A 4JOIA 4P74A 4CJ0B 2DY8A 1RODA 2HUGA 3SHLA 2CKZB 1X3GA 2A68C 5EPJA 4GZYC 1B9MA 1SMYC 2K01A 1PDQA 1A6XA 1BBUA 1DOLA 1LM0A 1HZ9A 3ERSX 2CH4W 3N52A 5IOCA 2NVQB 4GLXA 1JICA 1ESFA 3HFZB 3K0XA 4OIKA 3KDFA 4C3HG 2PI2A 2EYLA 1KHIA 5AJ3Q 4ME3A 3MWYW
chains in the Genus database with same CATH topology
5M3MB 1U4LA 3MTSA 2L5TA 1BXTA 1CT1D 2RVLA 3ND8A 3MAQA 2EY6A 5IGBA 3R2TA 2WB1B 1D5MC 1RHPA 1IW7C 1I4QA 1V1PB 1Y8NB 3ZYYX 5IT9E 4X3KA 3J80L 3GD7A 1KNEA 1Z6HA 1FNUA 2RDGA 3R93A 5ELFA 1SE2A 2NN6G 1KNAA 3OWFA 5JAVA 2F3WA 4R8IA 5CV5A 2K1BA 3HOUB 1EQVA 2B2TC 1BOSA 4QCLA 3KK7A 5TSSA 1Y8PB 4MN3A 2Z1CA 5IGGA 5EPLA 4P2CB 1YNND 4KN7C 1QB5D 4XT1B 1PLFA 5I2YA 4CKEA 3PO2B 3BVGA 2MGSA 4KN4C 5EBCA 2RDFA 5EQ0A 4A3KB 2L9HA 1MGSA 2VXWA 1PTOB 2IT1A 3CHBD 4K2KA 4ZQ3A 3ND9A 1S4ZA 2I46A 1LV9A 1ZYRD 2KVMA 2JA6B 1AEXA 1DOKA 1RD9D 5HGTA 2K05A 3GTJB 2SNSA 1ENFA 3PO3B 4Q0FA 2VB2X 1SNOA 3S2DB 2PPBC 1RF2D 2Q8TA 2L0CA 4XQQA 1CA5A 2AWNA 2B2WA 4DNRB 4TKOB 1I4XA 1S5ED 5CC4A 1SNCA 4KJNA 4UDUC 4HAEA 3L7ZC 1YNNC 2A6HD 1B1ZA 1PXUA 3E6ZX 4LMQD 1PZKD 2BE5D 1SDFA 4BBRB 1DJRD 4HMIA 5JEAJ 1EY8A 2RSNA 4J1MA 4O1NA 3LX0A 3V2TA 3RMHA 1CHQD 1CQVA 1VCIA 2WACA 3HOWB 5G3LF 1ZYRC 4NMZA 4UAIA 4LK1C 1NR4A 3I72A 1GUTA 1GUOA 3I8ZA 1XTCD 4DFAA 4HSPA 4IQZA 3F2UA 5I9PA 1WTXA 3SEBA 1Z7TA 3VR4A 1MBYA 4F88A 5CV9A 3OIQA 3S1MB 5T1GA 3PUZA 2XWJB 2F4IA 4HSVA 4F7XA 2A6HC 4BY7B 4R8NA 3TP8A 3QOJA 1BO0A 1B4OA 1HA6A 1STGA 2XN9C 4IFDJ 2B2UC 2BE5C 1QNUA 3DWPA 4G7OC 2R92B 2B39A 2V4DA 1LTSD 1F9RA 2BA1A 3K5OA 1AFPA 3QIAA 4FP5D 1XXGA 4XIGS 2QF7A 1EY4A 2VNUD 4L6TB 3VA7A 3BG3A 4QF4A 4WJWA 2G9HD 3FMCA 2KEEA 3C3LA 2PZTA 1RTOA 1WTVA 3GTOB 1HFNA 1L0YB 3LWEA 1AW7A 1SE3A 1LTRD 2EJFC 4J6HA 2JYOA 2EDGA 4IUNA 2KCCA 5C4XB 2EOTA 5I4DA 1B2TA 1SEBD 3U9OA 5C0XH 5HURA 3OMCA 3J80E 3S17B 2M9VA 3HP3A 1F2ZA 2C9OA 4DGZA 4EVOA 3MZ5A 4X3TA 4CKCA 1V1PA 3D4RA 1GUNA 2B2VA 4OL7A 1KABA 2NUCA 2F0WA 4FNFA 4KKSA 4N9TA 1DYQA 2F0GA 2WINB 3DEOA 1XX8A 1JB3A 1D1KA 2Z8LA 2B63B 3I70A 5C5LA 5AFWA 1SAPA 4Y7NB 2QCPX 4C3IG 2EYFA 5K36H 4C1NI 3GP7A 3BDOA 2F0HA 1B53A 5BN5A 4G57A 2HDLA 1SFOB 3K5NA 3HOVB 1MSGA 2DNEA 4FF1A 4A3IB 4DXGA 4IUPA 1BDOA 4RFBA 1J9OA 1WTWA 1D2BA 4DF7A 1EYDA 1HXYD 3I4LA 3QG1A 2WKCA 2RQXA 1LT4D 3QO2A 1EIHA 1L0XB 1GUGA 1C4QA 4E6IA 2CW0D 1MSHA 2M00A 4EQPA 1Q8IA 4DN4M 4A3BB 1ZEQX 4KHZA 1FGBD 3L3OC 1WTPA 1HRJA 3WOEA 1HUMA 2WP8J 1VF5C 5DNFA 4IFDG 1ET9A 1SYFA 3D8GA 2SDFA 1QCBD 4S3SA 3CRLC 2I07B 2WKDA 1GUWA 2NWGA 3M4YA 2KECA 3TP6A 3D4DA 4C1NK 2ZXRA 1QOHA 4ODGA 3K57A 2AQ1B 3P1HA 1NSNS 1QE6A 5NUCA 3NTHA 2FMMA 5JVH3 1KDAA 2L4NA 4XQNA 2F03A 1D5ZC 4CGYB 5E4WC 1STNA 1S5CD 3VR5A 4PMBA 1I4HA 1I4RA 3EFXD 3VA5A 4H0LC 1V43A 3OWEB 3DWQA 1TWAB 5D65A 4DXFA 1EWHA 3OOCA 3SK6A 3HGBA 5LHY1 2K32A 1G2SA 1LT6D 1U4RA 3D4WA 2CW0C 3I73A 2ZXPA 1WTRA 2IW3A 3NUCA 3VYRA 3TZUA 2AQ2B 2XWBB 3BZDB 2IL8A 2XRQD 1I6VC 2EXZA 1TT2A 1LT5D 1WD0A 2LFNA 2SOBA 2F0IA 4FXKC 4IN3A 2YU9B 3EROA 3SK8A 2NVTB 1D5XC 3I3CA 3A54A 1ZKOA 3FVQA 4IUUA 1EYAA 1O78A 3NQIA 1QWYA 2F0TA 3K5LA 2RA4A 3AU7A 4OHJA 4LAAA 1GHJA 4XXEA 4KV6A 3H3VC 3Q23A 5I6WA 1JOQA 5CV4A 3OMGA 2Q8RE 5EKKA 2PQEA 4KKUA 1UAPA 5DM73 1A3TA 2QILA 4B08A 4TSSA 2BA0A 2B2WC 2A6ED 3HOXB 1PRTB 2EY2A 2C5CA 3IFDA 1ZXTA 3A7LA 5E3FA 4WFN3 1ESRA 1B50A 1CFMA 3BDLA 3W3AA 1C8CA 2NYZD 3LWUA 1KLGD 3NTKA 5M9OA 3QJYA 4NDXA 5IGDA 5ELBA 3BYTB 3UI2A 4OGQC 2ZT9C 2K04A 1BBXC 5C4JB 1GJXA 3NWSA 4OO1H 2R93B 2XVSA 4V190 3GV3A 4FF3A 3D6WA 2JP1A 3BVMA 3MC0B 2NZ1D 2F0DA 4HN7A 2MPMA 3S1NB 4K2LA 3EQLC 3MHBA 5JJZA 4ZRZA 5CV8A 5M5WB 2TSSA 4A3DB 5KNBA 4J8QA 4WORA 2JSOA 2FHTA 2VB3X 4HTHA 1JWUD 2HDMA 2E2DC 5KGUA 5FO9B 1EY7A 3R8BA 1ONLA 2A6EC 2XIWA 2Z4HA 3BS1A 2O5JC 3VR6A 5EJWA 2M2LA 1JCKB 1BCPB 2F0SA 1R4QB 2E75C 4L63B 1W6JA 1K83B 2Q8IB 3T13A 1QG7A 2EYMA 3E0JA 1JR0D 1C48A 4EQNA 4RAUC 1PFMA 3ERQA 1TVXA 3NTIA 1CQFA 3OPOA 2F0LA 4PNYA 3MA2B 1TY0A 3KLSX 3SE0A 3T4AC 3S15B 5E4XA 2PO4A 3E5SA 4HEDA 1TS3A 4BA2I 4ID6A 2L12A 1SSOA 3J81L 1SNPA 3HKZB 1F9SA 1E2VA 1SYGA 2L55A 5ELCA 2MJ8A 2BCOA 3TP7A 1HHVA 4K8IA 1X32A 2H1EA 1I3QB 1ET6A 4PQXA 1O7ZA 5CORA 2B8FA 1AP0A 4RKBA 1UUPA 1PTOD 2F0EA 1IYUA 3SXHA 5G3LD 2WAQB 3K7AB 1PFNA 2OXPA 3GTPB 2EYHA 5FKAC 5EBDA 2E76C 4K14A 5A35A 3P7JA 1EZ6A 4BS9A 1LTBD 4F87A 2B2VC 3KLSA 1OXVA 1PTOF 1SJED 3S9WA 3C1EA 3OIPA 2RSOA 4A3FB 2KUMA 1YNJD 4XQJA 3M85A 3J7YW 4QIWB 4QUFA 4RCOA 1GHKA 2G9DA 2SNMA 1BNZA 4RA8A 1SYDA 5C6AA 2IPKD 2RBMA 5FOBB 1IL8A 3ONAB 2D2CC 3PUVA 5FO8B 4BA1I 2LS01 1OXXK 1HCZA 4K5XA 3T51B 3W2DA 2KHSA 3VR3A 1O7YA 2A69D 1QNKA 1RKNA 3CRKC 5BN3A 4ZUJA 4RGTA 3K58A 2JEBI 4I7ZC 3ITPA 3I90A 3SK5A 5JOBA 1FR3A 1PTOC 3WDNA 1X3QA 3M7NA 3HOZB 3NSWA 1DONA 3NWTA 5CBAE 4KK7A 3PMFA 3VR2A 1KDCA 2FFKB 3MXNA 2NN6I 5LL6X 4RHSA 4C3JB 1IKLA 3EA6A 4C2MB 5FK9C 1YNJC 1TQOA 1EIGA 4XYOA 2E74C 1I50B 3GTKB 1LTAD 1GXDC 3IL8A 4XTCS 2MHVA 5C3EB 5C0XJ 1CTMA 4ZKCB 2QDBA 3K6OA 3MFGA 1CZWA 2NB0A 3M4OB 2A74C 3HOYB 3SR1A 4ULLA 1DOMA 5A2QL 1G91A 2AUJD 4JBWA 4HCEA 2A69C 3S1QB 4R9WA 5I2XA 3NE5B 2E2IB 5KIXA 4X3UA 1HQRD 5M5YB 3BVZA 3TMEA 3D31A 3FPUB 2JE6I 3URYA 1IKMA 1NCVA 1SBBB 4ZKBB 2VUMB 2JEAI 5ELEA 1ENCA 3GO5A 3TN2A 1AZQA 3CKIB 3QB3A 2CHBD 2RDHA 3MFYA 4RKLA 2K5WA 4I65A 1HPCA 1KLUD 5IT9L 4XT3B 1OXTA 1PFBA 5D3DA 4CJ1B 3TSSA 5T1IA 1D6EC 1MD2D 1SYBA 3P75A 1IHZA 1O80A 2K5DA 2R61A 1F9QA 5J22A 2PZUA 3NP8A 3KBGA 5J39A 1S5BD 2E2HB 3DUZA 5BN4A 1EY0A 3IFTA 3GTMB 1SYCA 2F0VA 4G7HC 3RZDB 1PZJD 2X6LA 2F0UA 3NBIA 4KD3A 3TBIB 3S1RB 2R3ZA 4C56C 1EEID 4B9WA 3I91A 3KUPA 2K7VA 1DXMA 5C5MA 2A5HA 3G7LA 1I4PA 1TWHB 4ZYSA 1T5XD 2R6GA 3EJIA 4IZ8A 3IAYA 1XYIA 2IX0A 1SYEA 2PNRC 4O42A 2A73B 1H9KA 1U4PA 2EVBA 1UNSA 4K6DA 4K8JA 5CBEE 3SVMA 1VMPA 1TWFB 4M8AA 3GV6A 5C0XG 4DK0A 1TWCB 2H4OA 3V05A 4DAVA 4FYDA 1QJOA 3A55A 5I9OA 1EWCA 1Y8OB 5DEHA 4K6LA 5CYUA 1B9NA 2B2YA 4OIJA 4QMGA 1TU2B 3VYSA 2NN6H 1F77A 2KOLA 1KTKA 1BF4A 2TMPA 1ILQA 3G6JB 1H9JA 3S14B 1II3A 3EVQA 4NW2A 3AMUA 2HCIA 5K36G 3C46A 1EOTA 4CJ2C 1JQYD 3QWNA 5F2DA 3TDQA 3HRZC 4RWSC 2JA7B 5ELDA 3J7AV 2ID0A 2RKSA 4CBVA 3VYTA 1EYCA 5C44B 2FJ2A 1M8AA 2K6AA 2E2JB 2F0FA 4KI0A 4KKTA 3D6CA 1RTNA 3OW7A 4FXDA 2EYOA 4DNTB 3DXJC 1TWGB 2PW7A 1U4MA 1LT3D 1D1IA 3NBHA 1A3UA 4DU9A 1O7LA 1CI3M 3CQZB 1STEA 1ICWA 1AN8A 4KY6A 4ILWA 3GTLB 2BOSA 1GUSA 1E0BA 2K33A 1FD7D 1M4VA 5CV6A 1TY2A 3L9AX 1EEFD 1EU3A 3N6RA 3CU7A 3C2PA 2J7ZA 3H09A 4KY7A 4QB4A 4XDXA 1MI2A 3QOLA 5EGTA 2O2LD 4MIUA 1AZPA 4H7BA 3FDTA 4EGVA 2MUYA 2X69A 1E2ZA 2D5DA 2NTTA 3NPPA 1HUNA 4XYQA 2K5QA 4IALA 3BYYB 2L11A 1EL0A 1JORA 1EY6A 3GTGB 2XRSD 1E2WA 4EQOA 1XWEA 3KF8A 1H9SB 1PRTD 1LO5D 1Q1BA 2ENBA 3KLRA 5COYA 3I4MB 1CK1A 3WOFA 1HA5A 4KD4A 3V96A 3TP5A 5KNCA 2F0QA 1DCZA 4IFDI 2XNAC 2PCFB 3FEWX 3O13A 5IGFA 1PRTF 1S5DD 1STBA 1Q90A 4KJOA 2WIIB 3DM1A 3KBXA 2NVXB 3RUZA 2O5IC 4ZAIA 4F8MA 2EJMA 1ILPA 4IUTA 4QUCA 4C3HB 1STAA 3JAML 1ENAA 4ZUIA 1JE4A 1LTID 3NK9A 2OEOA 2Y0SB 5KYIA 2LMCB 2LY7A 5J1ZA 3MXGA 4TRDA 1SNDA 4NP5A 1HFGA 4Q5VA 1CZGA 3OSOA 5C0XI 4HCSA 2QKIC 4N9PA 1T5EA 3PUXA 4U673 5M3FB 2AUKA 3LNNA 3GQBA 4PMWA 1JWSD 4A93B 4RGMA 3M3YB 1WTQA 1CM9A 1S5FD 2EYJA 1TS4A 2EJGC 5JVG3 1LACA 1BUVT 2AWOA 1X3PA 2F0OA 1EFID 1PRTC 4ME5A 2EE1A 1DD2A 1TIID 4KTAA 1BCPD 4RCNA 5IGCA 4HMJA 3K0YA 3S2HB 2FMCA 4RGNA 2F0NA 5M5XB 1FNVA 3HZXA 2KCNA 2OF1A 1SE4A 1G2TA 1QILA 1IYVA 3X3MA 1EY9A 1BCPF 4G4KA 3HG9A 1VMCA 3HEJA 3GTQB 5EKLA 2KJXA 3H6MA 1Y69U 2F0JA 2K03A 4OO1G 1BR9A 3M7GA 3AB9A 2CVRA 3H91A 3A8IE 4DAYA 5LL6S 2OT2A 1Y1VB 2F1MA 1F2YA 1EU4A 4G7ZC 1Y1WB 1Q1EA 3FKIB 1RDPD 4C3JG 4H13C 5JEAH 3PV0A 5KRUA 4U68A 1WTOA 3NHHA 3K5MA 5FLXL 2YYZA 1BCPC 2NTSA 1HQMC 5C4ZA 1DM0B 2B2TA 1NR2A 3FPPA 1KAAA 5C3XA 2LKVA 4RHRA 1G291 4FO2A 4KMUC 1LTGD 5FO7B 1Q12A 3IKJA 4PMCA 1A2TA 2JXMB 2IX1A 3PIP3 4FF2A 2DY7A 4IUQA 2F3VA 2IX3A 4HR7B 4YIJA 4BBSB 1Q3LA 2AQ3B 2F0PA 2J0TD 3I4NB 1HTLD 2IJ0A 4A3MB 2NVYB 3RLFA 2EPBA 4ABNA 1PMRA 1F2LA 3Q0AA 2N88A 3MEHA 1SJHD 3S16B 4IFDH 2EYPA 4X3SA 3H94A 1CA6A 4K5WA 3RZOB 4DA2A 1FNWA 4L8JA 1NAPA 4JK1C 3FRPB 4A3GB 1DZ1A 4K5VA 1LABA 5I6YA 5CR3A 4BY1B 3SDZA 4V0BA 1LLRD 2PMZB 1JOOA 3J7AF 1PYWD 2K28A 3A7AB 3Q24A 4A3EB 5C3WA 2B2YC 1KDBA 3A8JE 1F2MA 1CHPD 5CGKA 1Z47A 2BDOA 2WV6D 4LJZC 1H9SA 3TZDA 2F0MA 1G6ZA 5KEEA 4TQUS 3A8KE 2EY1A 2FINB 3SK4A 1SXTA 4KHVA 1I6HB 4H44C 1SNMA 3JAME 3NXWA 1K8MA 3OHXC 2ICEC 4FF4A 1W6KA 4CHTB 4PV1C 3R3OA 1H9RA 4RH6A 5JEAG 2KQ3A 1J8IA 2KA7A 3T53B 5KNDA 1WCMB 3Q22A 1JOKA 1VDZA 2D9UA 4KY5A 1K8OA 4M1UB 3H0GB 2HCCA 3D3RA 3BDCA 1HTPA 3J81E 2B8GA 4OO1I 1ML0D 3DWAA 2F0KA 5CV7A 1H9MA 2IWHA 1A3VA 4Z9CB 2B2UA 4ZLTF 5CMDA 5ISRA 1NUCA 2L1BA 5E1FA 3T16A 1UEAB 1EY5A 1JC7A 1STHA 3P20A 2XSCA 1U9RA 1V8QA 4ZK9B 2PZWA 5IIFA 4C3IB 2DNCA 1SNQA 3MVVA 4RGOS 2QEJC 5EKIA 2J4XA 2MP1A 2ZXOA 3DMUA 4AYBB 1TS5A 2JA8B 3A56A 2Z4IA 3U9SA 5D3IB 2X6GA 3DHQA 3X3NA 1G8ZD 5IODA 5K5PA 1R4PB 1R9TB 1V1OA 1RJTA 3K59A 2O4XA 2D62A 2CQAA 2GA4B 1EZ8A 2R7ZB 1WVLA 2EZVA 1TS2A 3RD4A 4FXGC 2NBFA 1PZID 4WRDA 2PYKA 1PTOH 1LTTD 3PIO3 2HQEA 4IUVA 3T56B 1A2UA 4DK1A 4IURA 2N55A 1OXSC 3R2IA 1OXUA 1B44D 1BQQT 4MHEA 1WD1A 3MXUA 2A68D 3NQTA 2JA5B 5FLXE 4B9XA 1FYCA 1A15A 1SMYD 2KEDA 2ICIA 1OO9B 1GOZA 1I4GA 4DAPA 1F9PA 4FVMA 1STYA 3HS0C 1EQTA 4A3JB 3PUYA 5IGEA 1JWMD 3DEPA 5EPKA 3MXPA 5JPMC 1TKWB 1VF7A 5DM63 2BDNA 4NKLA 3VYUA 3PUWA 3C1FA 1IW7D 1TR5A 5JPNC 4CKBA 5C4HA 1RCVD 1B3AA 5D14A 5KYLA 2EY5A 4BWGB 2SEBD 2PW5A 5A2QE 3Q6SA 5DAUA 2DN8A 4CJ0B 2DY8A 1RODA 2HUGA 3SHLA 2A68C 5EPJA 4GZYC 1B9MA 1SMYC 2K01A 1PDQA 1A6XA 1DOLA 3N52A 5IOCA 2NVQB 1JICA 1ESFA 4OIKA 4C3HG 2EYLA 3MWYW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQT A;  2RKS A;  2F0G A;  2SNS A;  3P1H A;  4ODG A;  2RBM A;  1NSN S;  3T13 A;  4B9X A;  4B9W A;  3HEJ A;  5NUC A;  5KIX A;  2EYM A;  1SNO A;  1EYC A;  5C5M A;  4F7X A;  1KDA A;  4KD4 A;  5EKL A;  3TP5 A;  2F0Q A;  5C5L A;  4EQN A;  4R8N A;  3BDC A;  3MEH A;  3TP8 A;  2F0F A;  3QOJ A;  1STN A;  3ERQ A;  4K5X A;  3D6C A;  3EJI A;  2KHS A;  3H6M A;  1STG A;  2EY2 A;  3TME A;  2EYP A;  4IZ8 A;  5IGF A;  2EYF A;  1STB A;  2EYO A;  2EY6 A;  2F0L A;  2F0J A;  4PMB A;  4KJO A;  5E3F A;  1STY A;  4PNY A;  3RUZ A;  5IGB A;  4K5W A;  4F8M A;  2F0K A;  5CV7 A;  1RKN A;  3BDL A;  5CC4 A;  1SNC A;  1SYE A;  4KJN A;  1STA A;  1A3V A;  4ZUJ A;  2PW7 A;  3VA5 A;  5IGE A;  5ISR A;  1ENA A;  1NUC A;  4ZUI A;  2F0H A;  5IOD A;  1ENC A;  5K5P A;  5E1F A;  1A3U A;  3SK6 A;  3T16 A;  4DU9 A;  3NK9 A;  3MXP A;  3E5S A;  4K5V A;  2OEO A;  3QB3 A;  1EY5 A;  1F2Y A;  1STH A;  4G57 A;  5I6Y A;  5CR3 A;  5M9O A;  5KYI A;  3ITP A;  1U9R A;  4ID6 A;  4NDX A;  5IGD A;  1EY4 A;  3SK5 A;  5JOB A;  3OWF A;  4K6D A;  5J1Z A;  4K8J A;  1SNP A;  4QF4 A;  2PZW A;  1JOO A;  2F3W A;  5IIF A;  5JAV A;  4HMI A;  4RKL A;  4TRD A;  3D4W A;  1SND A;  4NKL A;  4I65 A;  5CV5 A;  1SYG A;  1SNQ A;  1EQV A;  3C1F A;  3MVV A;  4NP5 A;  5KRU A;  1EY8 A;  1TR5 A;  3NHH A;  4KY6 A;  3OSO A;  3NUC A;  4J1M A;  3V2T A;  3LX0 A;  3TP7 A;  5C3W A;  4K8I A;  4N9P A;  5C4H A;  2PZT A;  1KDB A;  4DF7 A;  5IGG A;  1EYD A;  3DMU A;  1F2M A;  5C4Z A;  2F0D A;  5CV6 A;  5CGK A;  5KYL A;  2EYJ A;  1SYB A;  5I9O A;  5DEH A;  3PMF A;  4K2L A;  2WAC A;  4RKB A;  3P75 A;  2EXZ A;  1IHZ A;  1KDC A;  1TT2 A;  4KY7 A;  2EY5 A;  4QB4 A;  2F0M A;  2SOB A;  3MHB A;  2F0E A;  4QMG A;  3DHQ A;  4J6H A;  4E6I A;  1KAA A;  2F0O A;  2F0I A;  2EY1 A;  5KEE A;  4IUN A;  5C3X A;  3QOL A;  3SK4 A;  4NMZ A;  3SXH A;  3ERO A;  4ME5 A;  1TQO A;  4MIU A;  2LKV A;  4H7B A;  2PW5 A;  5CV8 A;  5EGT A;  3SK8 A;  2M00 A;  4KHV A;  5DAU A;  4EQP A;  3U9O A;  4WOR A;  2O4X A;  2OXP A;  5J22 A;  1SNM A;  2EYH A;  4KTA A;  2RDF A;  4IAL A;  2PZU A;  4HTH A;  4K14 A;  3NP8 A;  3NXW A;  3SHL A;  5IGC A;  1EYA A;  5J39 A;  2QDB A;  5HUR A;  1EZ8 A;  1II3 A;  3OMC A;  4HMJ A;  3EVQ A;  4DFA A;  1EZ6 A;  4PMC A;  1A2T A;  1JOR A;  1EY0 A;  1EY6 A;  2F0T A;  1F2Z A;  1SYF A;  1EY7 A;  5KGU A;  3D8G A;  1SYC A;  3R3O A;  4K2K A;  4S3S A;  2PYK A;  2F0N A;  4LAA A;  4WRD A;  4ZQ3 A;  2F0V A;  5I9P A;  4KV6 A;  4DGZ A;  4EQO A;  2HQE A;  5IOC A;  3HZX A;  5I6W A;  3S9W A;  2F3V A;  2KQ3 A;  2OF1 A;  4EVO A;  1JOQ A;  3C1E A;  3MZ5 A;  5CV4 A;  1A2U A;  3OMG A;  3SR1 A;  1AEX A;  2F0U A;  5EKK A;  4KD3 A;  4YIJ A;  2PQE A;  5F2D A;  3TP6 A;  2ENB A;  1EY9 A;  1KAB A;  2F0P A;  2F0S A;  2NUC A;  3D4D A;  4OL7 A;  2SNM A;  5HGT A;  2F0W A;  1A3T A;  2EYL A;  5CV9 A;  1JOK A;  4KY5 A;  4N9T A;  1SYD A;  5C6A A; 
#chains in the Genus database with same CATH topology
 2JQO A;  5M3M B;  1U4L A;  1CUK A;  1YBY A;  3MTS A;  4MTN A;  2L5T A;  2MQH A;  1K0S A;  2Y0S G;  5IYB G;  3L2P A;  1BXT A;  1CT1 D;  4BY7 H;  2RVL A;  3ND8 A;  3WWV A;  3MAQ A;  2EY6 A;  2EIF A;  5IGB A;  3R2T A;  1DGS A;  2WB1 B;  4JI5 Q;  1D5M C;  1RHP A;  1IW7 C;  1I4Q A;  1V1P B;  1Y8N B;  2R92 H;  4BBS H;  3ZYY X;  5IT9 E;  5M3F G;  1MHW C;  3I4N H;  4A3M H;  4X3K A;  2NVY H;  3J80 L;  4A93 G;  3GD7 A;  1AE3 A;  4JI6 L;  4LFC Q;  1KNE A;  4LW1 A;  3E9I A;  1Z6H A;  1FNU A;  2RDG A;  4DV4 Q;  3R93 A;  5ELF A;  1SE2 A;  2NN6 G;  1KNA A;  5JJI A;  3OWF A;  5JAV A;  2F3W A;  2K14 A;  4R8I A;  5CV5 A;  2K1B A;  3EIV A;  3HOU B;  1EQV A;  2B2T C;  1BOS A;  3F1Z A;  3RLN A;  2XTI A;  4QCL A;  2KBN A;  4DNI A;  3KK7 A;  5TSS A;  1GM5 A;  1Y8P B;  4MN3 A;  1YJN A;  4LNQ A;  3CC7 A;  2Z1C A;  5IGG A;  3EN2 A;  5EPL A;  4P2C B;  1YNN D;  1XPO A;  1QVC A;  4KN7 C;  2D0P A;  1EOV A;  1QB5 D;  3UDF A;  4XT1 B;  4A3G H;  1PLF A;  5I2Y A;  4BY1 H;  4L5R C;  4CKE A;  3PO2 B;  3BVG A;  3AFQ A;  2MGS A;  4KN4 C;  5EBC A;  2RDF A;  4HID A;  5EQ0 A;  4A3E H;  4A3K B;  2L9H A;  1MGS A;  2VXW A;  1PTO B;  3S17 H;  2IT1 A;  3CHB D;  4K2K A;  4ZQ3 A;  3T1H Q;  3ND9 A;  1S4Z A;  4R4C A;  2I46 A;  1C0A A;  1LV9 A;  1ZYR D;  2KVM A;  2JA6 B;  1AEX A;  1DOK A;  1B70 B;  1RD9 D;  3J81 c;  5GAH C;  1C7Y A;  4QGU A;  5HGT A;  1EQQ A;  4HIK A;  2K05 A;  4GKJ L;  2H5X A;  3CCS A;  3GTJ B;  2SNS A;  4X62 L;  1ENF A;  4R4T A;  3PO3 B;  4Q0F A;  2JK8 A;  4HIM A;  2VB2 X;  1SNO A;  4DUZ Q;  3S2D B;  3L0O A;  2PPB C;  4JI3 Q;  1Y1W G;  3FKI G;  2B63 H;  1RF2 D;  2Q8T A;  2L0C A;  1E7Z A;  4XQQ A;  1CA5 A;  2AWN A;  3CCL A;  2B2W A;  4DNR B;  4TKO B;  1I4X A;  1S5E D;  5CC4 A;  1SNC A;  4KJN A;  4UDU C;  4HAE A;  3L7Z C;  3CCM A;  4UPA A;  1YNN C;  2A6H D;  1B1Z A;  1PXU A;  3E6Z X;  4LMQ D;  5AJ3 L;  3H0G H;  1PZK D;  2BE5 D;  1SDF A;  4BBR B;  1DJR D;  4HMI A;  5JEA J;  4DV0 Q;  3HOV H;  3D0F A;  4LWC A;  1EY8 A;  2RSN A;  4J1M A;  4A3I H;  4O1N A;  3LX0 A;  3V2T A;  3RMH A;  4JI5 L;  5IYD H;  1CHQ D;  1K28 A;  1CQV A;  3ULJ A;  1VCI A;  4P71 A;  3CCU A;  2V1C C;  1QUQ A;  2WAC A;  4A76 A;  2VW9 A;  3I7F A;  3HOW B;  1L1O B;  1UEB A;  4GN5 A;  5G3L F;  4LFC L;  1ZYR C;  4BBS G;  4NMZ A;  4DV4 L;  1PA6 A;  1X6O A;  4UAI A;  4LK1 C;  4A3M G;  3NEL A;  1NR4 A;  2QW7 A;  1CKM A;  5C3E G;  3I72 A;  1E3P A;  1GUT A;  4A3B H;  1GUO A;  3I8Z A;  1U0L A;  4GOP A;  1XTC D;  4DFA A;  4HSP A;  1VQL A;  1KXL A;  4IQZ A;  3F2U A;  5I9P A;  4POG A;  4DV3 Q;  1WTX A;  2PQA A;  5IP7 H;  4OEL B;  3SEB A;  4A3L G;  1Z7T A;  3VR4 A;  1MBY A;  4F88 A;  1YHB A;  4JBK A;  5J3B A;  5CV9 A;  3OIQ A;  3S1M B;  2Q2U A;  5T1G A;  3PUZ A;  2XWJ B;  4A3G G;  2F4I A;  4HSV A;  2F3I A;  4F7X A;  2A6H C;  3RN5 A;  4HJ7 A;  4BY7 B;  1CKN B;  2RHS B;  3KOJ A;  4R8N A;  3TP8 A;  3CCR A;  3QOJ A;  1VQ6 A;  1BO0 A;  1B4O A;  1HA6 A;  1STG A;  2XN9 C;  4IFD J;  2B2U C;  2BE5 C;  1HR0 Q;  1QNU A;  1Y14 B;  3DWP A;  4H02 A;  3T1H L;  4G7O C;  2R92 B;  2B39 A;  2UUB Q;  2V4D A;  4A3E G;  1LTS D;  1F9R A;  2BA1 A;  5FJ8 H;  3DM3 A;  3K5O A;  1IXR A;  1AFP A;  3DLL A;  2JA5 H;  4JI0 Q;  3QIA A;  4R4Q A;  3FHW A;  4GS3 A;  3KLW A;  4FP5 D;  2YTX A;  1XXG A;  4XIG S;  4DAM A;  2QF7 A;  1EY4 A;  2VNU D;  4L6T B;  1VQB A;  4DUZ L;  3VA7 A;  3BG3 A;  4QF4 A;  4NXN Q;  4WJW A;  2CWA A;  2G9H D;  3FMC A;  4IPH A;  1S72 A;  2KEE A;  4IPG A;  3E3X A;  3C3L A;  2PZT A;  2R7D A;  2IHE A;  2K52 A;  1RTO A;  1WTV A;  1KIX A;  3GTO B;  1HFN A;  1L0Y B;  3LWE A;  1YJW A;  1AW7 A;  1SE3 A;  1LTR D;  2EJF C;  4J6H A;  2JYO A;  2K5N A;  2EDG A;  4IUN A;  2KCC A;  5C4X B;  2EOT A;  5IP9 H;  1VQE A;  3PF5 A;  5I4D A;  1JJC B;  1B2T A;  1SEB D;  1WCM G;  3U9O A;  1PH3 A;  3BZK A;  3CMA A;  5C0X H;  4DV0 L;  5HUR A;  3OMC A;  3J80 E;  3S17 B;  4YY3 Q;  2M9V A;  3HP3 A;  2I0Q A;  4DR7 L;  1F2Z A;  2C9O A;  4R4I A;  4DGZ A;  4EVO A;  3MZ5 A;  2UXC Q;  2DJG C;  3D4R A;  1V1P A;  4X3T A;  4CKC A;  4HJ5 A;  1GUN A;  4GNX C;  2B2V A;  1D7Q A;  4OL7 A;  1KAB A;  2NUC A;  4GKK Q;  2F0W A;  4FNF A;  4GLV B;  4KKS A;  4P73 A;  4N9T A;  1DYQ A;  2F0G A;  4GN3 B;  2WIN B;  3UDI A;  5IT9 c;  3DEO A;  1XX8 A;  1JB3 A;  1YI2 A;  1D1K A;  2Z8L A;  3UE1 A;  3SGI A;  2B63 B;  3KYH C;  3I70 A;  5C5L A;  5AFW A;  3AQQ A;  1SAP A;  4Y7N B;  2QCP X;  4C3I G;  1X54 A;  1B3Q A;  2EYF A;  5K36 H;  2BH8 A;  2DUD A;  4DV3 L;  4C1N I;  3GP7 A;  3I55 A;  3RR5 A;  1JJG A;  3BDO A;  3RN2 A;  2F0H A;  3RLO A;  2JA8 G;  1B53 A;  4PZ6 A;  5BN5 A;  4G57 A;  2HDL A;  4JBM A;  1QZH A;  1SFO B;  3K5N A;  4JI1 Q;  1MSG A;  3HOV B;  1LYL A;  2DNE A;  3HKZ E;  4FF1 A;  2Z9H A;  4A3I B;  4DXG A;  4IUP A;  2ALY B;  1BDO A;  5C4J H;  4RFB A;  1J9O A;  1WTW A;  3CD6 A;  1D2B A;  2R7Z G;  1K3R A;  4DF7 A;  1EYD A;  2UUB L;  1HXY D;  3I4L A;  3QG1 A;  2WKC A;  2RQX A;  1LT4 D;  3QO2 A;  5H1S E;  4JOI C;  1EIH A;  4X6A H;  1L0X B;  1GUG A;  1C4Q A;  1NBW A;  1X3E A;  2KHJ A;  4JI0 L;  1O7I A;  4E6I A;  2MO1 A;  2CW0 D;  1FGU A;  1PH2 A;  2BH2 A;  1YIJ A;  1MSH A;  2M00 A;  4EQP A;  2E5L Q;  1Q8I A;  4RMF A;  4DR1 Q;  4DN4 M;  4A3B B;  2WAQ E;  1ZEQ X;  4KHZ A;  4UP8 A;  4I7A A;  2JA5 G;  1FGB D;  3L3O C;  4NXN L;  1K0R A;  1WTP A;  1HRJ A;  3WOE A;  1W3S A;  1YVC A;  1HUM A;  2WP8 J;  4IJH A;  1VF5 C;  5DNF A;  4IFD G;  1ET9 A;  1SYF A;  2VQF Q;  3D8G A;  2SDF A;  1QCB D;  2ASB A;  4S3S A;  3CRL C;  2I07 B;  2WKD A;  1GUW A;  5IYC H;  2NWG A;  1NE3 A;  3M4Y A;  1NJI C;  2KEC A;  3TP6 A;  1FJG Q;  3D4D A;  4C1N K;  4QIW E;  4A3J G;  1VQH A;  2ZXR A;  1QOH A;  2VQE Q;  4ODG A;  3K57 A;  2AQ1 B;  3P1H A;  1NSN S;  1QE6 A;  5NUC A;  1K83 H;  3W5O A;  3NTH A;  2FMM A;  5L37 A;  5JVH 3;  1KDA A;  3K7U C;  1A63 A;  2L4N A;  4XQN A;  2ZM6 Q;  2F03 A;  1D5Z C;  4CGY B;  5E4W C;  1I94 Q;  1STN A;  1S5C D;  3VR5 A;  2YTY A;  4PMB A;  1EIY B;  2ZJQ A;  2LSS A;  1I4H A;  4JI2 Q;  1I4R A;  2UXC L;  2C35 B;  3EFX D;  3VA5 A;  4H0L C;  1V43 A;  2ATW A;  3K8A A;  3OWE B;  1KQS A;  3DWQ A;  4GKK L;  1TWA B;  5D65 A;  2Q2I A;  1EWH A;  3OOC A;  3SK6 A;  4DXF A;  4LUZ A;  3PO3 H;  1L1O A;  4A75 A;  3HGB A;  4OON A;  5LHY 1;  2K32 A;  1G2S A;  1LT6 D;  3OW2 A;  3M9B A;  3U50 C;  1U4R A;  3D4W A;  2RCN A;  4LF8 L;  2CW0 C;  3I73 A;  2ZXP A;  1WTR A;  2IW3 A;  3NUC A;  1HH2 P;  3VYR A;  3TZU A;  1PH6 A;  2AQ2 B;  3U4V A;  2OQ0 A;  2XWB B;  1I3Q H;  1IYJ B;  4JV5 Q;  3KJO A;  3BZD B;  2IL8 A;  2XRQ D;  1I6V C;  2EXZ A;  1TT2 A;  1LT5 D;  2GVB A;  1WD0 A;  2LFN A;  2SOB A;  4ZCK A;  2F0I A;  4FXK C;  4IN3 A;  2YU9 B;  3ERO A;  3SK8 A;  4BBR H;  3TS0 A;  2NVT B;  2OTL A;  1D5X C;  3I3C A;  4JI1 L;  3A54 A;  5M3M G;  1ZKO A;  3GTP H;  3FVQ A;  4IUU A;  1EYA A;  1CKN A;  1O78 A;  2AHO B;  3NQI A;  1T9H A;  1QWY A;  2F0T A;  3MEF A;  3K5L A;  2RA4 A;  3AU7 A;  3CP0 A;  4OHJ A;  1VQ5 A;  4LAA A;  1GHJ A;  4XXE A;  4KV6 A;  3H3V C;  3Q23 A;  5I6W A;  1JOQ A;  5CV4 A;  1FVI A;  3OMG A;  2MNA A;  2Q8R E;  3HOW H;  4A3F H;  2WB1 G;  5EKK A;  1EUJ A;  2PQE A;  3MXN B;  1PH5 A;  4KKU A;  1UAP A;  1EQR A;  5DM7 3;  1A3T A;  2QIL A;  3FP9 A;  4OX9 Q;  2Q2T A;  4B08 A;  5GAG C;  1P8L A;  4TSS A;  3I4M G;  2E5L L;  2L15 A;  1VQ9 A;  4DR1 L;  2BA0 A;  5FLM G;  2B2W C;  2A6E D;  4UHV A;  3HOX B;  1K8A C;  1GD7 A;  1PRT B;  4A3C H;  2EY2 A;  2C5C A;  3IFD A;  1SMX A;  3HOU G;  1ZXT A;  1HNZ Q;  2VQF L;  3A7L A;  5E3F A;  4WFN 3;  4JI7 Q;  1ESR A;  1B50 A;  4LF9 L;  1CFM A;  3BDL A;  3W3A A;  1XNQ L;  1C8C A;  2CCZ A;  2OCE A;  2NYZ D;  1UE1 A;  1FJG L;  1KC8 C;  3LWU A;  3IRB A;  3S1M H;  1KLG D;  2VQE L;  3NTK A;  5M9O A;  3QJY A;  3H15 A;  4NDX A;  5IGD A;  5ELB A;  2LXK A;  2KEN A;  3BYT B;  3UI2 A;  3PO2 G;  4OGQ C;  2ZT9 C;  2JJQ A;  1JMC A;  2K04 A;  2ZM6 L;  1BBX C;  1TXY A;  1I94 L;  5LMN W;  5C4J B;  1GJX A;  3PCO B;  3NWS A;  4OO1 H;  2R93 B;  4A3K G;  2XVS A;  4V19 0;  3GV3 A;  4FF3 A;  3J81 i;  1L0W A;  3D6W A;  1X55 A;  4JI2 L;  2JP1 A;  2OQK A;  3BVM A;  3MC0 B;  2NZ1 D;  2F0D A;  4BXX H;  4HN7 A;  2MPM A;  3S1N B;  4K2L A;  4DR4 Q;  1PFS A;  3EQL C;  2JA6 G;  3MHB A;  5JJZ A;  4APV A;  4GOP C;  4EX5 A;  4ZRZ A;  5CV8 A;  4C3J H;  4C2M H;  5M5W B;  5BR8 Q;  2TSS A;  4A3D B;  5KNB A;  4J8Q A;  4WOR A;  2JSO A;  1I50 H;  3GTK H;  5ELO A;  2FHT A;  2VB3 X;  4HTH A;  3PO3 G;  1JWU D;  2UU9 Q;  2HDM A;  4JW0 A;  3JAM c;  2CWP A;  2AKW B;  2E2D C;  5KGU A;  5FO9 B;  1EY7 A;  1GVP A;  3B6Y A;  3R8B A;  1ONL A;  2A6E C;  1SR3 A;  2XIW A;  4IOC A;  2Z4H A;  4HJ9 A;  3BS1 A;  2O5J C;  5JJL A;  3VR6 A;  3GTO H;  4B3S Q;  4JV5 L;  5EJW A;  2M2L A;  3HOY H;  2JA9 A;  1VQP A;  1JCK B;  4AH6 A;  2B29 A;  1BCP B;  4WJ3 M;  2F0S A;  5C4X H;  5IE8 A;  1R4Q B;  2E75 C;  4L63 B;  1W6J A;  1K83 B;  2Q8I B;  3S1Q H;  4JC0 A;  3T13 A;  1QG7 A;  3RNU A;  2EYM A;  2E2I H;  2QA4 A;  3E0J A;  3NEM A;  1JR0 D;  2Z6B A;  1C48 A;  2PNH A;  4EQN A;  4RAU C;  1PFM A;  1VQM A;  1YEZ A;  3ERQ A;  1TVX A;  1AE2 A;  3NTI A;  4BBR G;  1CQF A;  3OPO A;  2F0L A;  1HZB A;  1SRU A;  4PNY A;  3MA2 B;  1TY0 A;  3KLS X;  1W2B A;  3SE0 A;  3AYH B;  3W1B A;  3T4A C;  3S15 B;  5E4X A;  2CFM A;  1N8R C;  2VUM H;  2PO4 A;  2RCF A;  1VQO A;  1Y1V G;  4OX9 L;  3E5S A;  4HED A;  1TS3 A;  4BA2 I;  4ID6 A;  2L12 A;  1UE7 A;  4IPD A;  1SSO A;  1N32 Q;  3J81 L;  1M1K C;  3KFU A;  1SNP A;  3HKZ B;  1F9S A;  4DKA C;  3KF6 B;  4R4O A;  4Y7N H;  1E2V A;  1SYG A;  2L55 A;  1YZ6 A;  5ELC A;  2MJ8 A;  2BCO A;  3TP7 A;  1HHV A;  1HNZ L;  4K8I A;  1X32 A;  2H1E A;  4CDF C;  1I3Q B;  1ET6 A;  4PQX A;  4JI7 L;  5ELN A;  1O7Z A;  5COR A;  2B8F A;  1S3O A;  1AP0 A;  4JVZ A;  3TRE A;  4RKB A;  1JJ2 A;  3GDE A;  1UUP A;  3A5U A;  1PTO D;  4IOA A;  3OTO Q;  2ES2 A;  2F0E A;  2CH4 A;  1IYU A;  3CCE A;  3SXH A;  2WAQ B;  5G3L D;  1SFO H;  1J6Q A;  3K7A B;  1PFN A;  2OXP A;  3GTP B;  2EYH A;  5FKA C;  5EBD A;  2E76 C;  4K14 A;  5A35 A;  3P7J A;  1EZ6 A;  4BS9 A;  1LTB D;  4F87 A;  4BY7 G;  2B2V C;  4GLA C;  3KLS A;  1OXV A;  1PTO F;  3GTM H;  2CQO A;  1SJE D;  3S9W A;  4ALP A;  3CPW A;  3C1E A;  3OIP A;  2RSO A;  4A3F B;  2KUM A;  4IO9 A;  1YNJ D;  4XQJ A;  3M85 A;  2R92 G;  3J7Y W;  4QIW B;  4QUF A;  4RCO A;  3CCV A;  4DR4 L;  3I4N G;  1GHK A;  2G9D A;  2SNM A;  1BNZ A;  1EWI A;  4RA8 A;  1SYD A;  5C6A A;  3ULP A;  2IPK D;  1KAW A;  2RBM A;  3CAM A;  5FOB B;  5BR8 L;  1IL8 A;  3ONA B;  2D2C C;  5FLX c;  3PUV A;  2R7F A;  5FO8 B;  4BA1 I;  2LS0 1;  1OXX K;  4YCU A;  2UU9 L;  1HCZ A;  4K5X A;  1CSP A;  4JPB W;  3T51 B;  3W2D A;  2KHS A;  4UP7 A;  3VR3 A;  1O7Y A;  1NY4 A;  2LXJ A;  2A69 D;  1IBM Q;  1QNK A;  4N8X 1;  4B3S L;  1RKN A;  4IPC A;  3CRK C;  5BN3 A;  4O2D A;  4ZUJ A;  4RGT A;  3K58 A;  4JI8 Q;  2JEB I;  4I7Z C;  2QGQ A;  1ASZ A;  1N9W A;  1SE8 A;  4BY1 G;  1QVG A;  3ITP A;  3I90 A;  3SK5 A;  5JOB A;  1FR3 A;  3STB D;  1PTO C;  3WDN A;  4HJA A;  1N34 Q;  5HGQ A;  1X3Q A;  3CF5 A;  3M7N A;  3HOZ B;  3W1G A;  2HD3 A;  3NSW A;  1DON A;  3NWT A;  5CBA E;  1IBK Q;  1TWA H;  4KK7 A;  3NBH B;  3PMF A;  3VR2 A;  1E24 A;  1KDC A;  3MXN A;  1PYB A;  2FFK B;  2NN6 I;  5LL6 X;  1VQ7 A;  4RHS A;  4C3J B;  1IKL A;  3G71 A;  3EA6 A;  4C2M B;  5FK9 C;  1YNJ C;  4JYA Q;  1TQO A;  4L5Q A;  4DR6 Q;  1EIG A;  4JI3 L;  4XYO A;  2E74 C;  1I50 B;  1M90 C;  3GTK B;  1LTA D;  1GXD C;  3IL8 A;  4XTC S;  2MHV A;  5C3E B;  5GAE C;  4K0K Q;  5C0X J;  1CTM A;  4ZKC B;  2QDB A;  3K6O A;  3MFG A;  1CZW A;  2NB0 A;  1IBL Q;  2B63 G;  1VQI A;  4OEM B;  1MKH A;  4HJ8 A;  1Q82 C;  3M4O B;  2A74 C;  3LGJ A;  1ICF B;  4YHH Q;  1VS0 A;  3HOY B;  2HQL A;  3SR1 A;  4ULL A;  1DOM A;  2YTV A;  1KRS A;  5A2Q L;  1G91 A;  2AUJ D;  4J15 A;  4JBW A;  3PQI A;  4HCE A;  2A69 C;  1PH4 A;  2YU9 H;  1K9M C;  3S1Q B;  4R9W A;  4DK3 C;  5I2X A;  2NVT H;  3NE5 B;  2E2I B;  5KIX A;  4X3U A;  3H0G G;  1HQR D;  3M4P A;  1V9P A;  5M5Y B;  3BVZ A;  4QJF A;  1NMG A;  2ZTD A;  5C44 H;  1Q46 A;  4AQY Q;  2UXB Q;  2Z6K A;  4OXP A;  2E2J H;  3TME A;  1K8G A;  4JI4 Q;  3HOV G;  3D31 A;  3STB C;  3FPU B;  2N8N A;  4A3I G;  2OWO A;  2JE6 I;  3URY A;  1IKM A;  1L1O C;  3KF8 B;  1NCV A;  1SBB B;  4B3M Q;  5IYD G;  4ZKB B;  3UDX A;  2VUM B;  2JEA I;  5ELE A;  5IY0 A;  1ENC A;  3GO5 A;  3TN2 A;  1AZQ A;  3CKI B;  3QB3 A;  2CHB D;  2RDH A;  3MFY A;  2K75 A;  3PSI A;  2Y0S E;  4NB3 A;  3HOX H;  3CQZ H;  1XMO Q;  4LUO A;  4RKL A;  2K5W A;  4I65 A;  4A3B G;  1HPC A;  1KLU D;  3I56 A;  4MTK A;  5IT9 L;  2UXD Q;  4XT3 B;  1OXT A;  1PFB A;  2MO0 A;  5D3D A;  3GTL H;  1UE5 A;  4AYB G;  4CJ1 B;  3TSS A;  1IBM L;  4L5T A;  5T1I A;  1D6E C;  5IP7 G;  1MD2 D;  1SYB A;  1GO3 E;  3KJP A;  3P75 A;  4JI8 L;  1IHZ A;  5JJK A;  2F4V Q;  1O80 A;  2K5D A;  2R61 A;  1F9Q A;  1KRT A;  1FL0 A;  5J22 A;  1N36 Q;  1HR0 L;  2PZU A;  1N34 L;  3NP8 A;  4PG3 A;  3KBG A;  5J39 A;  2VZA A;  5EAY A;  1S5B D;  2E2H B;  3DUZ A;  5BN4 A;  2R93 H;  1EY0 A;  3IFT A;  2RF4 A;  3GTM B;  1LUZ A;  1SYC A;  2F0V A;  1WTH A;  2ZJP A;  3GTG H;  4G7H C;  3CW2 C;  1PZJ D;  3RZD B;  1JB7 A;  1EYG A;  2X6L A;  3S1N H;  2F0U A;  1IBK L;  3NBI A;  4KD3 A;  3TBI B;  5FJ8 G;  1C9O A;  4DR2 Q;  3JC6 6;  3S1R B;  5M5W H;  2R3Z A;  4A3D H;  4C56 C;  4JYA L;  1EEI D;  4DR6 L;  4B9W A;  3I91 A;  3KUP A;  3CPF A;  2K7V A;  1DXM A;  3CCJ A;  4R1J A;  5C5M A;  2A5H A;  3G7L A;  1A62 A;  1I4P A;  4K0K L;  1TWH B;  4ZYS A;  3KF6 A;  4LFA Q;  1Q7Y C;  1VQ4 A;  1T5X D;  2R6G A;  3EJI A;  4GN4 B;  4IZ8 A;  4A4I A;  1IBL L;  3IAY A;  1XYI A;  2I5L X;  2NZO A;  4YHH L;  2IX0 A;  3F2B A;  1SYE A;  1A8V A;  2PNR C;  4O42 A;  4TVA B;  2A73 B;  4C3H H;  1NNX A;  1JE5 A;  2QDL A;  1H9K A;  1U4P A;  5DLQ E;  1Q86 C;  1PV4 A;  2EVB A;  1UNS A;  4K6D A;  4K8J A;  4CDC C;  5CBE E;  1VMP A;  1TWF B;  5IP9 G;  3SVM A;  4YY3 L;  4M8A A;  4AQY L;  2UXB L;  3GV6 A;  4JI4 L;  5C0X G;  4DK0 A;  1TWC B;  2A1A A;  2H4O A;  2HHH Q;  1G6P A;  3V05 A;  3S15 H;  1RIP A;  4DAV A;  5M3F H;  4B3M L;  4LF6 Q;  1QJO A;  3A55 A;  4FYD A;  4A93 H;  5I9O A;  1EWC A;  1Y8O B;  3M3Y H;  5DEH A;  4K6L A;  4DAY B;  5CYU A;  1B9N A;  2B2Y A;  4OIJ A;  4QMG A;  1TU2 B;  3VYS A;  2NN6 H;  1F77 A;  2KOL A;  1KTK A;  1XJV A;  1BF4 A;  2AMC B;  3BZC A;  2TMP A;  1ILQ A;  4DV7 Q;  1X65 A;  3G6J B;  1H9J A;  3S14 B;  1II3 A;  3EVQ A;  3E0E A;  2UXD L;  4NW2 A;  4PZ8 A;  2VS1 A;  3AMU A;  3S2H H;  2HCI A;  3G6E A;  4L5S A;  5K36 G;  3C46 A;  1EOT A;  3NEN A;  2EQS A;  4CJ2 C;  1JQY D;  1XMQ Q;  3QWN A;  5F2D A;  1GKH A;  3TDQ A;  3HRZ C;  1E1T A;  2F4V L;  4RWS C;  2I5M X;  3CXC A;  2JA7 B;  3E9H A;  1XTD A;  5ELD A;  1WOC A;  3J7A V;  2ID0 A;  3TS2 A;  2RKS A;  3K7A H;  4CBV A;  3VYT A;  1EYC A;  2ZTC A;  5C44 B;  2FJ2 A;  1D8L A;  1M8A A;  2K6A A;  2E2J B;  1HR0 W;  2F0F A;  4KI0 A;  4KKT A;  3D6C A;  1RTN A;  3OW7 A;  3F8T A;  4FXD A;  2EYO A;  1KD1 C;  4DNT B;  3DXJ C;  1PYS B;  1SRO A;  1WYD A;  2R93 G;  1TWG B;  2PW7 A;  1U4M A;  4DR2 L;  1LT3 D;  1D1I A;  3H3V I;  3NBH A;  1A3U A;  4DU9 A;  3F2D A;  4P72 A;  1O7L A;  4LF5 Q;  1CI3 M;  1WI5 A;  1IZ6 A;  1ASY A;  3CQZ B;  1STE A;  1ICW A;  4DV5 Q;  3JAM i;  1AN8 A;  2MFI A;  1CKO A;  4X62 Q;  2PMZ E;  2ZJR A;  2ZTE A;  4LFA L;  4LF4 Q;  4KY6 A;  1IL2 A;  4ILW A;  3GTL B;  2BOS A;  1GUS A;  1E0B A;  2K33 A;  3TQY A;  2P5Z X;  1FD7 D;  1M4V A;  5CV6 A;  3K81 C;  3I2Z A;  4B3R Q;  1TY2 A;  3L9A X;  3K80 C;  5IYC G;  1EEF D;  1EU3 A;  1MJE A;  3N6R A;  1X9N A;  3CU7 A;  3C2P A;  2J7Z A;  3H09 A;  4KY7 A;  4QB4 A;  2EXD A;  3CCQ A;  4XDX A;  1MI2 A;  3QOL A;  5EGT A;  2O2L D;  4MIU A;  1AZP A;  4H7B A;  3FDT A;  4EGV A;  2MUY A;  2X69 A;  1E2Z A;  2D5D A;  2NTT A;  3NPP A;  1HUN A;  4XYQ A;  2K5Q A;  4IAL A;  1HNW Q;  3BJU A;  3HOZ H;  3BYY B;  2L11 A;  1EL0 A;  1JOR A;  1EY6 A;  4LF7 Q;  3J80 c;  2HHH L;  3GTG B;  2XRS D;  1E2W A;  4EQO A;  3CME A;  1XWE A;  2I5H A;  3KF8 A;  1H9S B;  4LF6 L;  1PRT D;  1LO5 D;  1Q1B A;  2FXQ A;  2ENB A;  1PH7 A;  3KLR A;  5COY A;  3G4S A;  5C3E H;  3I4M B;  1CK1 A;  3WOF A;  1HA5 A;  4DV7 L;  4KD4 A;  3V96 A;  3TP5 A;  5KNC A;  2F0Q A;  2KHI A;  1DCZ A;  4IFD I;  2XNA C;  2PCF B;  2HIX A;  3FEW X;  3O13 A;  3HKZ G;  2UUC Q;  3M4O H;  5IGF A;  1PRT F;  1S5D D;  1STB A;  3S16 H;  1Q90 A;  4KJO A;  2KCM A;  2WII B;  3DM1 A;  3KBX A;  2NVX B;  3RUZ A;  2O5I C;  4ZAI A;  4F8M A;  3T1Y Q;  4A3L H;  2EJM A;  1ILP A;  3RZO H;  4IUT A;  4QUC A;  1G51 A;  1STA A;  4C3H B;  1XMQ L;  3JAM L;  1ENA A;  4ZUI A;  1JE4 A;  4NPS A;  1LTI D;  3NK9 A;  1PHJ A;  2OEO A;  2Y0S B;  4LFB Q;  5KYI A;  2LMC B;  5M5Y H;  2LY7 A;  4X65 Q;  1RL2 A;  5J1Z A;  3MXG A;  1WJJ A;  1PH1 A;  2WAQ G;  4TRD A;  1YJ9 A;  1SND A;  1H95 A;  1J5E Q;  4NP5 A;  1HFG A;  4Q5V A;  1CZG A;  5IWA Q;  3PF4 A;  3OSO A;  5C0X I;  1QZG A;  1CSQ A;  4HCS A;  2QKI C;  2IHF A;  4N9P A;  1T5E A;  3PUX A;  4U67 3;  5M3F B;  3ULL A;  2AUK A;  3LNN A;  3GQB A;  4PMW A;  1JWS D;  1Q8K A;  4A93 B;  4RGM A;  3M3Y B;  4DV2 Q;  4AYB E;  1WTQ A;  1CM9 A;  1S5F D;  2EYJ A;  1TS4 A;  4OWW B;  2EJG C;  1YNX A;  5JVG 3;  2A8V A;  1LAC A;  1BUV T;  3HOW G;  4A3F G;  2AWO A;  1X3P A;  2F0O A;  3BU2 A;  4UY8 C;  1EFI D;  1PRT C;  4ME5 A;  4LF5 L;  2EE1 A;  1DD2 A;  3A0J A;  4QQB X;  4DV5 L;  1TII D;  1I6H H;  4KTA A;  2E8G A;  1BCP D;  4RCN A;  5IGC A;  4LF4 L;  4HMJ A;  3K0Y A;  4A3C G;  1KL9 A;  3S2H B;  2FMC A;  4RGN A;  2F0N A;  5M5X B;  1PH9 A;  4POF A;  1FNV A;  3A74 A;  3HZX A;  2KCN A;  2OF1 A;  1SE4 A;  2K5H A;  1G2T A;  4B3R L;  4AIM A;  3I4O A;  1QIL A;  1IYV A;  3X3M A;  1EY9 A;  4X64 Q;  1BCP F;  2Z6K C;  1VQK A;  4G4K A;  3HG9 A;  1WCM H;  1VMC A;  3HEJ A;  1K73 C;  3GTQ B;  2GN5 A;  3PIP A;  1YHA A;  5EKL A;  4P75 A;  2E2H H;  1HNW L;  2KJX A;  3H6M A;  1Y69 U;  1BBW A;  1MJC A;  4DR3 Q;  2F0J A;  4LF7 L;  2K03 A;  3RZD H;  4OO1 G;  1BR9 A;  3HOZ G;  1A0I A;  4DR7 Q;  1NTG A;  2QEX A;  3M7G A;  1X3F A;  3S1R H;  3AB9 A;  2CVR A;  3H91 A;  4BXX G;  3A8I E;  4DAY A;  5LL6 S;  4YWK A;  4YCV A;  2OT2 A;  3H3V H;  1Y1V B;  2F1M A;  1F2Y A;  1EU4 A;  4G7Z C;  4OWX B;  4GNX B;  1TWH H;  1Y1W B;  1Q1E A;  3FKI B;  1RDP D;  4C3J G;  4H13 C;  4CDE C;  5JEA H;  3PV0 A;  3TRZ A;  4C3I H;  5KRU A;  4U68 A;  1WTO A;  3NHH A;  2UUC L;  4B3T Q;  3TEH B;  3K5M A;  5FLX L;  2YYZ A;  1BCP C;  4CDD C;  4KHP Q;  4DV6 Q;  2NTS A;  3T1Y L;  1HQM C;  5C4Z A;  1DM0 B;  2B2T A;  2K5V A;  2JA8 H;  1NR2 A;  1S40 A;  4YWL A;  3HOY G;  2G5D A;  3FPP A;  1KAA A;  1VQ8 A;  2JN4 A;  5C3X A;  1UE6 A;  5C4X G;  4LFB L;  2LKV A;  4RHR A;  1TWF H;  4KLK A;  3EBE A;  1R9T H;  1I5F A;  1G29 1;  4FO2 A;  4KMU C;  4X65 L;  1LTG D;  5FO7 B;  1VQD A;  1Q12 A;  1J5E L;  1TWC H;  3IKJ A;  1BVS A;  5IWA L;  4PMC A;  1A2T A;  2JXM B;  2IX1 A;  2KCT A;  3PIP 3;  2R7Z H;  5E7N A;  4FF2 A;  2DY7 A;  4IUQ A;  2F3V A;  2IX3 A;  4DV2 L;  3AEV A;  1Z9F A;  4HR7 B;  1N33 Q;  4YIJ A;  4BBS B;  1Q3L A;  2AQ3 B;  1VQF A;  2F0P A;  2J0T D;  3I4N B;  1HTL D;  2IJ0 A;  4A3M B;  1N32 L;  4JBJ A;  2NVY B;  1EIF A;  2VUM G;  3RLF A;  2DJF C;  2EPB A;  4ABN A;  4LUV A;  3F2C A;  4QY7 A;  1PMR A;  3S14 H;  2HIV A;  1F2L A;  3Q0A A;  2N88 A;  3MEH A;  1PVO A;  1SJH D;  2K50 A;  4YWM A;  2N49 A;  3S16 B;  4IFD H;  2EYP A;  3A5Z B;  4X3S A;  1Q81 C;  3AFP A;  3H94 A;  2HT1 A;  5LMU Q;  4PZ7 A;  1CA6 A;  2GVA A;  4K5W A;  3RZO B;  4DA2 A;  1FNW A;  2UUA Q;  1AH9 A;  4L8J A;  2WB1 E;  3OTO L;  1HNX Q;  1NAP A;  4JK1 C;  3KDF B;  3FRP B;  5HY6 A;  4A3J H;  4YCW A;  1E1O A;  2JA7 H;  1U5K A;  2VL6 A;  4X64 L;  4A3G B;  1DZ1 A;  4K5V A;  1LAB A;  5I6Y A;  5CR3 A;  4BY1 B;  3SDZ A;  4V0B A;  1LLR D;  3ER0 A;  2PMZ B;  4QL5 A;  3UDG A;  1JOO A;  3J7A F;  1PYW D;  1MIU A;  2K28 A;  3A7A B;  3Q24 A;  1LTL A;  2Q2H A;  3Q8D A;  5GQO A;  4DR3 L;  4A3E B;  5LMN Q;  5C3W A;  2B2Y C;  1KDB A;  3A8J E;  4NXM Q;  3G48 A;  1TWG H;  1F2M A;  2A19 A;  1VQG A;  1CHP D;  5CGK A;  1Z47 A;  1XNR Q;  2BDO A;  2WV6 D;  4LJZ C;  1H9S A;  1YIT A;  3TZD A;  4X66 Q;  1P16 A;  2F0M A;  1G6Z A;  5KEE A;  1WFQ A;  3A8K E;  4TQU S;  2EY1 A;  1XPU A;  2FIN B;  3SK4 A;  1SXT A;  4KHV A;  1I6H B;  4H44 C;  1SNM A;  4DUY Q;  3JAM E;  3NXW A;  1K8M A;  1X56 A;  3OHX C;  2ICE C;  1B8A A;  4FF4 A;  4O0A A;  1W6K A;  4B3T L;  4WJ4 A;  4CHT B;  4LF8 Q;  4PV1 C;  3R3O A;  1H9R A;  2D0O A;  3OYY A;  4RH6 A;  3U4Z A;  5JEA G;  4DV6 L;  4KHP L;  2KQ3 A;  4EQ5 A;  3UE0 A;  2NVQ H;  1VQA A;  4N8F A;  1J8I A;  1SN8 A;  2Z0S A;  2KA7 A;  3T53 B;  5KND A;  1WCM B;  3Q22 A;  1JOK A;  1VDZ A;  2D9U A;  2N78 A;  4KY5 A;  1K8O A;  2WFW A;  5M3M H;  4M1U B;  3H0G B;  2HCC A;  4JG2 A;  3D3R A;  3PIO A;  3BDC A;  2IY5 B;  2F52 A;  1HTP A;  3J81 E;  4UP9 A;  2B8G A;  4DR5 Q;  4OO1 I;  1ML0 D;  3M4Q A;  3DWA A;  2F0K A;  5CV7 A;  1H9M A;  1HJP A;  2IWH A;  1A3V A;  1N33 L;  2YV5 A;  4Z9C B;  2B2U A;  4ZLT F;  5CMD A;  5ISR A;  3CC2 A;  1NUC A;  2L1B A;  4DV1 Q;  5E1F A;  3T16 A;  1UEA B;  1EY5 A;  3I4M H;  1JC7 A;  1STH A;  3P20 A;  1UWV A;  2XSC A;  5FLM H;  1YHQ A;  1U9R A;  1V8Q A;  4ZK9 B;  3J7Z C;  2PZW A;  5IIF A;  4C3I B;  2DNC A;  1HZA A;  1SNQ A;  3MVV A;  4RGO S;  3HOU H;  2K4K A;  2QEJ C;  2NVX H;  5EKI A;  3ICE A;  2J4X A;  2MP1 A;  5LMU L;  2ZXO A;  3DMU A;  4AYB B;  1OTC A;  1TS5 A;  2UUA L;  2JA8 B;  1HNX L;  3A56 A;  4MNO A;  2Z4I A;  3U9S A;  4OWT B;  1QVF A;  5D3I B;  2VY3 A;  4LF9 Q;  2X6G A;  1XNQ Q;  5IYB H;  3DHQ A;  3X3N A;  1G8Z D;  5IOD A;  5K5P A;  1R4P B;  1R9T B;  1V1O A;  1RJT A;  3PO2 H;  3U58 A;  4MZ9 A;  3K59 A;  5GRO A;  2JA7 G;  2O4X A;  1V1Q A;  1JT8 A;  2D62 A;  2CQA A;  2GA4 B;  1EZ8 A;  2R7Z B;  1WVL A;  5C44 G;  2EZV A;  3ZJY C;  3QR8 A;  4A3K H;  4Y52 H;  1TS2 A;  3RD4 A;  4FXG C;  5LMN L;  2NBF A;  1PZI D;  3J81 j;  1L2F A;  4WRD A;  2RHQ B;  2PYK A;  1PTO H;  1LTT D;  3PIO 3;  4NXM L;  2HQE A;  4IUV A;  2OTJ A;  3S24 A;  3T56 B;  1XNR L;  1A2U A;  1QUQ B;  4DK1 A;  4IUR A;  2N55 A;  2JA6 H;  1OXS C;  3R2I A;  1OXU A;  1B44 D;  4X66 L;  4HIO A;  4JI6 Q;  2B3G A;  1BQQ T;  4MHE A;  1WD1 A;  3MXU A;  1XMO L;  2A68 D;  3NQT A;  2JA5 B;  5FLX E;  4B9X A;  1FYC A;  1SLJ A;  3GTJ H;  1A15 A;  1SMY D;  2KED A;  4GNX A;  4DK6 C;  2ICI A;  1K3B C;  4DUY L;  1OO9 B;  3J7A 5;  1GOZ A;  1I4G A;  3HOX G;  4GOP B;  3S2D H;  4DAP A;  1F9P A;  4FVM A;  4FDB A;  5M5X H;  3PGZ A;  1E22 A;  2PQA B;  1STY A;  2DGY A;  1BKB A;  3VDY A;  3HS0 C;  1EQT A;  4A3J B;  3PUY A;  1PH8 A;  5IGE A;  1JWM D;  3HKS A;  3DEP A;  5EPK A;  3MXP A;  5GAD C;  1N36 L;  5JPM C;  3GTQ H;  1TKW B;  1NMF A;  1VF7 A;  2N3S A;  1B7Y B;  5DM6 3;  4RG1 A;  4DPG A;  2BDN A;  4NKL A;  3J80 i;  3PUW A;  3VYU A;  3C1F A;  1IW7 D;  1TR5 A;  5JPN C;  1HZC A;  4JCV E;  4CKB A;  1VQC A;  4IJL A;  4DR5 L;  5C4H A;  2NZH A;  2XGT A;  1RCV D;  1XPR A;  1B3A A;  5D14 A;  5KYL A;  2PI2 E;  1VQN A;  1Y1V H;  4DV1 L;  2EY5 A;  4GKJ Q;  4BWG B;  1Y1W H;  3FKI H;  1EFW A;  2SEB D;  3CC4 A;  1VQJ A;  2PW5 A;  5A2Q E;  4A3D G;  3Q6S A;  5DAU A;  2DN8 A;  4JOI A;  4P74 A;  4CJ0 B;  2DY8 A;  1ROD A;  2HUG A;  3SHL A;  2CKZ B;  1X3G A;  2A68 C;  5EPJ A;  4GZY C;  1B9M A;  1SMY C;  2K01 A;  1PDQ A;  1A6X A;  1BBU A;  1DOL A;  1LM0 A;  1HZ9 A;  3ERS X;  2CH4 W;  3N52 A;  5IOC A;  2NVQ B;  4GLX A;  1JIC A;  1ESF A;  3HFZ B;  3K0X A;  4OIK A;  3KDF A;  4C3H G;  2PI2 A;  2EYL A;  1KHI A;  5AJ3 Q;  4ME3 A;  3MWY W; 
#chains in the Genus database with same CATH homology
 5M3M B;  1U4L A;  3MTS A;  2L5T A;  1BXT A;  1CT1 D;  2RVL A;  3ND8 A;  3MAQ A;  2EY6 A;  5IGB A;  3R2T A;  2WB1 B;  1D5M C;  1RHP A;  1IW7 C;  1I4Q A;  1V1P B;  1Y8N B;  3ZYY X;  5IT9 E;  4X3K A;  3J80 L;  3GD7 A;  1KNE A;  1Z6H A;  1FNU A;  2RDG A;  3R93 A;  5ELF A;  1SE2 A;  2NN6 G;  1KNA A;  3OWF A;  5JAV A;  2F3W A;  4R8I A;  5CV5 A;  2K1B A;  3HOU B;  1EQV A;  2B2T C;  1BOS A;  4QCL A;  3KK7 A;  5TSS A;  1Y8P B;  4MN3 A;  2Z1C A;  5IGG A;  5EPL A;  4P2C B;  1YNN D;  4KN7 C;  1QB5 D;  4XT1 B;  1PLF A;  5I2Y A;  4CKE A;  3PO2 B;  3BVG A;  2MGS A;  4KN4 C;  5EBC A;  2RDF A;  5EQ0 A;  4A3K B;  2L9H A;  1MGS A;  2VXW A;  1PTO B;  2IT1 A;  3CHB D;  4K2K A;  4ZQ3 A;  3ND9 A;  1S4Z A;  2I46 A;  1LV9 A;  1ZYR D;  2KVM A;  2JA6 B;  1AEX A;  1DOK A;  1RD9 D;  5HGT A;  2K05 A;  3GTJ B;  2SNS A;  1ENF A;  3PO3 B;  4Q0F A;  2VB2 X;  1SNO A;  3S2D B;  2PPB C;  1RF2 D;  2Q8T A;  2L0C A;  4XQQ A;  1CA5 A;  2AWN A;  2B2W A;  4DNR B;  4TKO B;  1I4X A;  1S5E D;  5CC4 A;  1SNC A;  4KJN A;  4UDU C;  4HAE A;  3L7Z C;  1YNN C;  2A6H D;  1B1Z A;  1PXU A;  3E6Z X;  4LMQ D;  1PZK D;  2BE5 D;  1SDF A;  4BBR B;  1DJR D;  4HMI A;  5JEA J;  1EY8 A;  2RSN A;  4J1M A;  4O1N A;  3LX0 A;  3V2T A;  3RMH A;  1CHQ D;  1CQV A;  1VCI A;  2WAC A;  3HOW B;  5G3L F;  1ZYR C;  4NMZ A;  4UAI A;  4LK1 C;  1NR4 A;  3I72 A;  1GUT A;  1GUO A;  3I8Z A;  1XTC D;  4DFA A;  4HSP A;  4IQZ A;  3F2U A;  5I9P A;  1WTX A;  3SEB A;  1Z7T A;  3VR4 A;  1MBY A;  4F88 A;  5CV9 A;  3OIQ A;  3S1M B;  5T1G A;  3PUZ A;  2XWJ B;  2F4I A;  4HSV A;  4F7X A;  2A6H C;  4BY7 B;  4R8N A;  3TP8 A;  3QOJ A;  1BO0 A;  1B4O A;  1HA6 A;  1STG A;  2XN9 C;  4IFD J;  2B2U C;  2BE5 C;  1QNU A;  3DWP A;  4G7O C;  2R92 B;  2B39 A;  2V4D A;  1LTS D;  1F9R A;  2BA1 A;  3K5O A;  1AFP A;  3QIA A;  4FP5 D;  1XXG A;  4XIG S;  2QF7 A;  1EY4 A;  2VNU D;  4L6T B;  3VA7 A;  3BG3 A;  4QF4 A;  4WJW A;  2G9H D;  3FMC A;  2KEE A;  3C3L A;  2PZT A;  1RTO A;  1WTV A;  3GTO B;  1HFN A;  1L0Y B;  3LWE A;  1AW7 A;  1SE3 A;  1LTR D;  2EJF C;  4J6H A;  2JYO A;  2EDG A;  4IUN A;  2KCC A;  5C4X B;  2EOT A;  5I4D A;  1B2T A;  1SEB D;  3U9O A;  5C0X H;  5HUR A;  3OMC A;  3J80 E;  3S17 B;  2M9V A;  3HP3 A;  1F2Z A;  2C9O A;  4DGZ A;  4EVO A;  3MZ5 A;  4X3T A;  4CKC A;  1V1P A;  3D4R A;  1GUN A;  2B2V A;  4OL7 A;  1KAB A;  2NUC A;  2F0W A;  4FNF A;  4KKS A;  4N9T A;  1DYQ A;  2F0G A;  2WIN B;  3DEO A;  1XX8 A;  1JB3 A;  1D1K A;  2Z8L A;  2B63 B;  3I70 A;  5C5L A;  5AFW A;  1SAP A;  4Y7N B;  2QCP X;  4C3I G;  2EYF A;  5K36 H;  4C1N I;  3GP7 A;  3BDO A;  2F0H A;  1B53 A;  5BN5 A;  4G57 A;  2HDL A;  1SFO B;  3K5N A;  3HOV B;  1MSG A;  2DNE A;  4FF1 A;  4A3I B;  4DXG A;  4IUP A;  1BDO A;  4RFB A;  1J9O A;  1WTW A;  1D2B A;  4DF7 A;  1EYD A;  1HXY D;  3I4L A;  3QG1 A;  2WKC A;  2RQX A;  1LT4 D;  3QO2 A;  1EIH A;  1L0X B;  1GUG A;  1C4Q A;  4E6I A;  2CW0 D;  1MSH A;  2M00 A;  4EQP A;  1Q8I A;  4DN4 M;  4A3B B;  1ZEQ X;  4KHZ A;  1FGB D;  3L3O C;  1WTP A;  1HRJ A;  3WOE A;  1HUM A;  2WP8 J;  1VF5 C;  5DNF A;  4IFD G;  1ET9 A;  1SYF A;  3D8G A;  2SDF A;  1QCB D;  4S3S A;  3CRL C;  2I07 B;  2WKD A;  1GUW A;  2NWG A;  3M4Y A;  2KEC A;  3TP6 A;  3D4D A;  4C1N K;  2ZXR A;  1QOH A;  4ODG A;  3K57 A;  2AQ1 B;  3P1H A;  1NSN S;  1QE6 A;  5NUC A;  3NTH A;  2FMM A;  5JVH 3;  1KDA A;  2L4N A;  4XQN A;  2F03 A;  1D5Z C;  4CGY B;  5E4W C;  1STN A;  1S5C D;  3VR5 A;  4PMB A;  1I4H A;  1I4R A;  3EFX D;  3VA5 A;  4H0L C;  1V43 A;  3OWE B;  3DWQ A;  1TWA B;  5D65 A;  4DXF A;  1EWH A;  3OOC A;  3SK6 A;  3HGB A;  5LHY 1;  2K32 A;  1G2S A;  1LT6 D;  1U4R A;  3D4W A;  2CW0 C;  3I73 A;  2ZXP A;  1WTR A;  2IW3 A;  3NUC A;  3VYR A;  3TZU A;  2AQ2 B;  2XWB B;  3BZD B;  2IL8 A;  2XRQ D;  1I6V C;  2EXZ A;  1TT2 A;  1LT5 D;  1WD0 A;  2LFN A;  2SOB A;  2F0I A;  4FXK C;  4IN3 A;  2YU9 B;  3ERO A;  3SK8 A;  2NVT B;  1D5X C;  3I3C A;  3A54 A;  1ZKO A;  3FVQ A;  4IUU A;  1EYA A;  1O78 A;  3NQI A;  1QWY A;  2F0T A;  3K5L A;  2RA4 A;  3AU7 A;  4OHJ A;  4LAA A;  1GHJ A;  4XXE A;  4KV6 A;  3H3V C;  3Q23 A;  5I6W A;  1JOQ A;  5CV4 A;  3OMG A;  2Q8R E;  5EKK A;  2PQE A;  4KKU A;  1UAP A;  5DM7 3;  1A3T A;  2QIL A;  4B08 A;  4TSS A;  2BA0 A;  2B2W C;  2A6E D;  3HOX B;  1PRT B;  2EY2 A;  2C5C A;  3IFD A;  1ZXT A;  3A7L A;  5E3F A;  4WFN 3;  1ESR A;  1B50 A;  1CFM A;  3BDL A;  3W3A A;  1C8C A;  2NYZ D;  3LWU A;  1KLG D;  3NTK A;  5M9O A;  3QJY A;  4NDX A;  5IGD A;  5ELB A;  3BYT B;  3UI2 A;  4OGQ C;  2ZT9 C;  2K04 A;  1BBX C;  5C4J B;  1GJX A;  3NWS A;  4OO1 H;  2R93 B;  2XVS A;  4V19 0;  3GV3 A;  4FF3 A;  3D6W A;  2JP1 A;  3BVM A;  3MC0 B;  2NZ1 D;  2F0D A;  4HN7 A;  2MPM A;  3S1N B;  4K2L A;  3EQL C;  3MHB A;  5JJZ A;  4ZRZ A;  5CV8 A;  5M5W B;  2TSS A;  4A3D B;  5KNB A;  4J8Q A;  4WOR A;  2JSO A;  2FHT A;  2VB3 X;  4HTH A;  1JWU D;  2HDM A;  2E2D C;  5KGU A;  5FO9 B;  1EY7 A;  3R8B A;  1ONL A;  2A6E C;  2XIW A;  2Z4H A;  3BS1 A;  2O5J C;  3VR6 A;  5EJW A;  2M2L A;  1JCK B;  1BCP B;  2F0S A;  1R4Q B;  2E75 C;  4L63 B;  1W6J A;  1K83 B;  2Q8I B;  3T13 A;  1QG7 A;  2EYM A;  3E0J A;  1JR0 D;  1C48 A;  4EQN A;  4RAU C;  1PFM A;  3ERQ A;  1TVX A;  3NTI A;  1CQF A;  3OPO A;  2F0L A;  4PNY A;  3MA2 B;  1TY0 A;  3KLS X;  3SE0 A;  3T4A C;  3S15 B;  5E4X A;  2PO4 A;  3E5S A;  4HED A;  1TS3 A;  4BA2 I;  4ID6 A;  2L12 A;  1SSO A;  3J81 L;  1SNP A;  3HKZ B;  1F9S A;  1E2V A;  1SYG A;  2L55 A;  5ELC A;  2MJ8 A;  2BCO A;  3TP7 A;  1HHV A;  4K8I A;  1X32 A;  2H1E A;  1I3Q B;  1ET6 A;  4PQX A;  1O7Z A;  5COR A;  2B8F A;  1AP0 A;  4RKB A;  1UUP A;  1PTO D;  2F0E A;  1IYU A;  3SXH A;  5G3L D;  2WAQ B;  3K7A B;  1PFN A;  2OXP A;  3GTP B;  2EYH A;  5FKA C;  5EBD A;  2E76 C;  4K14 A;  5A35 A;  3P7J A;  1EZ6 A;  4BS9 A;  1LTB D;  4F87 A;  2B2V C;  3KLS A;  1OXV A;  1PTO F;  1SJE D;  3S9W A;  3C1E A;  3OIP A;  2RSO A;  4A3F B;  2KUM A;  1YNJ D;  4XQJ A;  3M85 A;  3J7Y W;  4QIW B;  4QUF A;  4RCO A;  1GHK A;  2G9D A;  2SNM A;  1BNZ A;  4RA8 A;  1SYD A;  5C6A A;  2IPK D;  2RBM A;  5FOB B;  1IL8 A;  3ONA B;  2D2C C;  3PUV A;  5FO8 B;  4BA1 I;  2LS0 1;  1OXX K;  1HCZ A;  4K5X A;  3T51 B;  3W2D A;  2KHS A;  3VR3 A;  1O7Y A;  2A69 D;  1QNK A;  1RKN A;  3CRK C;  5BN3 A;  4ZUJ A;  4RGT A;  3K58 A;  2JEB I;  4I7Z C;  3ITP A;  3I90 A;  3SK5 A;  5JOB A;  1FR3 A;  1PTO C;  3WDN A;  1X3Q A;  3M7N A;  3HOZ B;  3NSW A;  1DON A;  3NWT A;  5CBA E;  4KK7 A;  3PMF A;  3VR2 A;  1KDC A;  2FFK B;  3MXN A;  2NN6 I;  5LL6 X;  4RHS A;  4C3J B;  1IKL A;  3EA6 A;  4C2M B;  5FK9 C;  1YNJ C;  1TQO A;  1EIG A;  4XYO A;  2E74 C;  1I50 B;  3GTK B;  1LTA D;  1GXD C;  3IL8 A;  4XTC S;  2MHV A;  5C3E B;  5C0X J;  1CTM A;  4ZKC B;  2QDB A;  3K6O A;  3MFG A;  1CZW A;  2NB0 A;  3M4O B;  2A74 C;  3HOY B;  3SR1 A;  4ULL A;  1DOM A;  5A2Q L;  1G91 A;  2AUJ D;  4JBW A;  4HCE A;  2A69 C;  3S1Q B;  4R9W A;  5I2X A;  3NE5 B;  2E2I B;  5KIX A;  4X3U A;  1HQR D;  5M5Y B;  3BVZ A;  3TME A;  3D31 A;  3FPU B;  2JE6 I;  3URY A;  1IKM A;  1NCV A;  1SBB B;  4ZKB B;  2VUM B;  2JEA I;  5ELE A;  1ENC A;  3GO5 A;  3TN2 A;  1AZQ A;  3CKI B;  3QB3 A;  2CHB D;  2RDH A;  3MFY A;  4RKL A;  2K5W A;  4I65 A;  1HPC A;  1KLU D;  5IT9 L;  4XT3 B;  1OXT A;  1PFB A;  5D3D A;  4CJ1 B;  3TSS A;  5T1I A;  1D6E C;  1MD2 D;  1SYB A;  3P75 A;  1IHZ A;  1O80 A;  2K5D A;  2R61 A;  1F9Q A;  5J22 A;  2PZU A;  3NP8 A;  3KBG A;  5J39 A;  1S5B D;  2E2H B;  3DUZ A;  5BN4 A;  1EY0 A;  3IFT A;  3GTM B;  1SYC A;  2F0V A;  4G7H C;  3RZD B;  1PZJ D;  2X6L A;  2F0U A;  3NBI A;  4KD3 A;  3TBI B;  3S1R B;  2R3Z A;  4C56 C;  1EEI D;  4B9W A;  3I91 A;  3KUP A;  2K7V A;  1DXM A;  5C5M A;  2A5H A;  3G7L A;  1I4P A;  1TWH B;  4ZYS A;  1T5X D;  2R6G A;  3EJI A;  4IZ8 A;  3IAY A;  1XYI A;  2IX0 A;  1SYE A;  2PNR C;  4O42 A;  2A73 B;  1H9K A;  1U4P A;  2EVB A;  1UNS A;  4K6D A;  4K8J A;  5CBE E;  3SVM A;  1VMP A;  1TWF B;  4M8A A;  3GV6 A;  5C0X G;  4DK0 A;  1TWC B;  2H4O A;  3V05 A;  4DAV A;  4FYD A;  1QJO A;  3A55 A;  5I9O A;  1EWC A;  1Y8O B;  5DEH A;  4K6L A;  5CYU A;  1B9N A;  2B2Y A;  4OIJ A;  4QMG A;  1TU2 B;  3VYS A;  2NN6 H;  1F77 A;  2KOL A;  1KTK A;  1BF4 A;  2TMP A;  1ILQ A;  3G6J B;  1H9J A;  3S14 B;  1II3 A;  3EVQ A;  4NW2 A;  3AMU A;  2HCI A;  5K36 G;  3C46 A;  1EOT A;  4CJ2 C;  1JQY D;  3QWN A;  5F2D A;  3TDQ A;  3HRZ C;  4RWS C;  2JA7 B;  5ELD A;  3J7A V;  2ID0 A;  2RKS A;  4CBV A;  3VYT A;  1EYC A;  5C44 B;  2FJ2 A;  1M8A A;  2K6A A;  2E2J B;  2F0F A;  4KI0 A;  4KKT A;  3D6C A;  1RTN A;  3OW7 A;  4FXD A;  2EYO A;  4DNT B;  3DXJ C;  1TWG B;  2PW7 A;  1U4M A;  1LT3 D;  1D1I A;  3NBH A;  1A3U A;  4DU9 A;  1O7L A;  1CI3 M;  3CQZ B;  1STE A;  1ICW A;  1AN8 A;  4KY6 A;  4ILW A;  3GTL B;  2BOS A;  1GUS A;  1E0B A;  2K33 A;  1FD7 D;  1M4V A;  5CV6 A;  1TY2 A;  3L9A X;  1EEF D;  1EU3 A;  3N6R A;  3CU7 A;  3C2P A;  2J7Z A;  3H09 A;  4KY7 A;  4QB4 A;  4XDX A;  1MI2 A;  3QOL A;  5EGT A;  2O2L D;  4MIU A;  1AZP A;  4H7B A;  3FDT A;  4EGV A;  2MUY A;  2X69 A;  1E2Z A;  2D5D A;  2NTT A;  3NPP A;  1HUN A;  4XYQ A;  2K5Q A;  4IAL A;  3BYY B;  2L11 A;  1EL0 A;  1JOR A;  1EY6 A;  3GTG B;  2XRS D;  1E2W A;  4EQO A;  1XWE A;  3KF8 A;  1H9S B;  1PRT D;  1LO5 D;  1Q1B A;  2ENB A;  3KLR A;  5COY A;  3I4M B;  1CK1 A;  3WOF A;  1HA5 A;  4KD4 A;  3V96 A;  3TP5 A;  5KNC A;  2F0Q A;  1DCZ A;  4IFD I;  2XNA C;  2PCF B;  3FEW X;  3O13 A;  5IGF A;  1PRT F;  1S5D D;  1STB A;  1Q90 A;  4KJO A;  2WII B;  3DM1 A;  3KBX A;  2NVX B;  3RUZ A;  2O5I C;  4ZAI A;  4F8M A;  2EJM A;  1ILP A;  4IUT A;  4QUC A;  4C3H B;  1STA A;  3JAM L;  1ENA A;  4ZUI A;  1JE4 A;  1LTI D;  3NK9 A;  2OEO A;  2Y0S B;  5KYI A;  2LMC B;  2LY7 A;  5J1Z A;  3MXG A;  4TRD A;  1SND A;  4NP5 A;  1HFG A;  4Q5V A;  1CZG A;  3OSO A;  5C0X I;  4HCS A;  2QKI C;  4N9P A;  1T5E A;  3PUX A;  4U67 3;  5M3F B;  2AUK A;  3LNN A;  3GQB A;  4PMW A;  1JWS D;  4A93 B;  4RGM A;  3M3Y B;  1WTQ A;  1CM9 A;  1S5F D;  2EYJ A;  1TS4 A;  2EJG C;  5JVG 3;  1LAC A;  1BUV T;  2AWO A;  1X3P A;  2F0O A;  1EFI D;  1PRT C;  4ME5 A;  2EE1 A;  1DD2 A;  1TII D;  4KTA A;  1BCP D;  4RCN A;  5IGC A;  4HMJ A;  3K0Y A;  3S2H B;  2FMC A;  4RGN A;  2F0N A;  5M5X B;  1FNV A;  3HZX A;  2KCN A;  2OF1 A;  1SE4 A;  1G2T A;  1QIL A;  1IYV A;  3X3M A;  1EY9 A;  1BCP F;  4G4K A;  3HG9 A;  1VMC A;  3HEJ A;  3GTQ B;  5EKL A;  2KJX A;  3H6M A;  1Y69 U;  2F0J A;  2K03 A;  4OO1 G;  1BR9 A;  3M7G A;  3AB9 A;  2CVR A;  3H91 A;  3A8I E;  4DAY A;  5LL6 S;  2OT2 A;  1Y1V B;  2F1M A;  1F2Y A;  1EU4 A;  4G7Z C;  1Y1W B;  1Q1E A;  3FKI B;  1RDP D;  4C3J G;  4H13 C;  5JEA H;  3PV0 A;  5KRU A;  4U68 A;  1WTO A;  3NHH A;  3K5M A;  5FLX L;  2YYZ A;  1BCP C;  2NTS A;  1HQM C;  5C4Z A;  1DM0 B;  2B2T A;  1NR2 A;  3FPP A;  1KAA A;  5C3X A;  2LKV A;  4RHR A;  1G29 1;  4FO2 A;  4KMU C;  1LTG D;  5FO7 B;  1Q12 A;  3IKJ A;  4PMC A;  1A2T A;  2JXM B;  2IX1 A;  3PIP 3;  4FF2 A;  2DY7 A;  4IUQ A;  2F3V A;  2IX3 A;  4HR7 B;  4YIJ A;  4BBS B;  1Q3L A;  2AQ3 B;  2F0P A;  2J0T D;  3I4N B;  1HTL D;  2IJ0 A;  4A3M B;  2NVY B;  3RLF A;  2EPB A;  4ABN A;  1PMR A;  1F2L A;  3Q0A A;  2N88 A;  3MEH A;  1SJH D;  3S16 B;  4IFD H;  2EYP A;  4X3S A;  3H94 A;  1CA6 A;  4K5W A;  3RZO B;  4DA2 A;  1FNW A;  4L8J A;  1NAP A;  4JK1 C;  3FRP B;  4A3G B;  1DZ1 A;  4K5V A;  1LAB A;  5I6Y A;  5CR3 A;  4BY1 B;  3SDZ A;  4V0B A;  1LLR D;  2PMZ B;  1JOO A;  3J7A F;  1PYW D;  2K28 A;  3A7A B;  3Q24 A;  4A3E B;  5C3W A;  2B2Y C;  1KDB A;  3A8J E;  1F2M A;  1CHP D;  5CGK A;  1Z47 A;  2BDO A;  2WV6 D;  4LJZ C;  1H9S A;  3TZD A;  2F0M A;  1G6Z A;  5KEE A;  4TQU S;  3A8K E;  2EY1 A;  2FIN B;  3SK4 A;  1SXT A;  4KHV A;  1I6H B;  4H44 C;  1SNM A;  3JAM E;  3NXW A;  1K8M A;  3OHX C;  2ICE C;  4FF4 A;  1W6K A;  4CHT B;  4PV1 C;  3R3O A;  1H9R A;  4RH6 A;  5JEA G;  2KQ3 A;  1J8I A;  2KA7 A;  3T53 B;  5KND A;  1WCM B;  3Q22 A;  1JOK A;  1VDZ A;  2D9U A;  4KY5 A;  1K8O A;  4M1U B;  3H0G B;  2HCC A;  3D3R A;  3BDC A;  1HTP A;  3J81 E;  2B8G A;  4OO1 I;  1ML0 D;  3DWA A;  2F0K A;  5CV7 A;  1H9M A;  2IWH A;  1A3V A;  4Z9C B;  2B2U A;  4ZLT F;  5CMD A;  5ISR A;  1NUC A;  2L1B A;  5E1F A;  3T16 A;  1UEA B;  1EY5 A;  1JC7 A;  1STH A;  3P20 A;  2XSC A;  1U9R A;  1V8Q A;  4ZK9 B;  2PZW A;  5IIF A;  4C3I B;  2DNC A;  1SNQ A;  3MVV A;  4RGO S;  2QEJ C;  5EKI A;  2J4X A;  2MP1 A;  2ZXO A;  3DMU A;  4AYB B;  1TS5 A;  2JA8 B;  3A56 A;  2Z4I A;  3U9S A;  5D3I B;  2X6G A;  3DHQ A;  3X3N A;  1G8Z D;  5IOD A;  5K5P A;  1R4P B;  1R9T B;  1V1O A;  1RJT A;  3K59 A;  2O4X A;  2D62 A;  2CQA A;  2GA4 B;  1EZ8 A;  2R7Z B;  1WVL A;  2EZV A;  1TS2 A;  3RD4 A;  4FXG C;  2NBF A;  1PZI D;  4WRD A;  2PYK A;  1PTO H;  1LTT D;  3PIO 3;  2HQE A;  4IUV A;  3T56 B;  1A2U A;  4DK1 A;  4IUR A;  2N55 A;  1OXS C;  3R2I A;  1OXU A;  1B44 D;  1BQQ T;  4MHE A;  1WD1 A;  3MXU A;  2A68 D;  3NQT A;  2JA5 B;  5FLX E;  4B9X A;  1FYC A;  1A15 A;  1SMY D;  2KED A;  2ICI A;  1OO9 B;  1GOZ A;  1I4G A;  4DAP A;  1F9P A;  4FVM A;  1STY A;  3HS0 C;  1EQT A;  4A3J B;  3PUY A;  5IGE A;  1JWM D;  3DEP A;  5EPK A;  3MXP A;  5JPM C;  1TKW B;  1VF7 A;  5DM6 3;  2BDN A;  4NKL A;  3VYU A;  3PUW A;  3C1F A;  1IW7 D;  1TR5 A;  5JPN C;  4CKB A;  5C4H A;  1RCV D;  1B3A A;  5D14 A;  5KYL A;  2EY5 A;  4BWG B;  2SEB D;  2PW5 A;  5A2Q E;  3Q6S A;  5DAU A;  2DN8 A;  4CJ0 B;  2DY8 A;  1ROD A;  2HUG A;  3SHL A;  2A68 C;  5EPJ A;  4GZY C;  1B9M A;  1SMY C;  2K01 A;  1PDQ A;  1A6X A;  1DOL A;  3N52 A;  5IOC A;  2NVQ B;  1JIC A;  1ESF A;  4OIK A;  4C3H G;  2EYL A;  3MWY W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...