1NUCA

Staphylococcal nuclease, v23c variant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclease
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
total genus 36
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1997-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1nucA00
3QOJA 5CV8A 4F8MA 1SNMA 3D6CA 2ENBA 4K8JA 1STAA 2EYHA 1KDCA 1SNPA 2RBMA 1NUCA 1F2YA 2HQEA 1EY6A 4N9PA 3DMUA 2EXZA 3HEJA 5JAVA 1EY9A 1SYCA 1JORA 4ZUIA 3SXHA 2F0OA 5CV7A 4QB4A 3D8GA 2F0UA 5CV4A 3T13A 4J1MA 3R3OA 2F0EA 2F0DA 2RKSA 2KHSA 3C1FA 4TRDA 4WRDA 3T16A 5E3FA 2OXPA 3VA5A 3U9OA 1A2TA 2EYOA 2M00A 1SYBA 3OMGA 3SHLA 5KEEA 1A3UA 1SYFA 2EY2A 5KRUA 2PZWA 1EYAA 3DHQA 4KTAA 1EY5A 5C6AA 4K2LA 1TR5A 4MIUA 1F2MA 2F0SA 3P75A 4KJOA 4N9TA 3V2TA 3NK9A 4KV6A 4ME5A 4OL7A 3QOLA 4ODGA 5C4ZA 3OSOA 4PMBA 4E6IA 4HMJA 5CGKA 5ISRA 2F0TA 1SNQA 3LX0A 3TP5A 1STGA 3H6MA 2OEOA 1II3A 5EKKA 1EYDA 4DU9A 5I6WA 2EY1A 4EQOA 3S9WA 2O4XA 3SR1A 2F0KA 1KDBA 2PW7A 4K6DA 5J39A 3D4WA 1JOQA 2EYJA 5F2DA 2EYLA 2F0GA 4B9XA 2NUCA 1STYA 3SK5A 5I6YA 3SK8A 1KDAA 4J6HA 5E1FA 3BDLA 4I65A 1SNDA 4DF7A 5C5LA 4DGZA 5C5MA 3MVVA 1STBA 3BDCA 3NHHA 4KY6A 5IGBA 3OMCA 4LAAA 5IIFA 2EY6A 3D4DA 2F0LA 4QMGA 3NUCA 1KABA 2F3VA 1EY8A 4H7BA 4K5XA 4PNYA 3TP7A 4KY7A 1STHA 5C4HA 4ZQ3A 4ID6A 2OF1A 2F0MA 4K14A 5KYLA 2PZTA 5K5PA 2F0HA 1EQVA 3MHBA 5KGUA 1NSNS 5NUCA 2SNSA 2EYFA 5CV5A 1EZ8A 5HGTA 5DAUA 2LKVA 2SNMA 2EYMA 4YIJA 5J22A 1ENCA 2F3WA 5KYIA 3MXPA 2F0JA 1A2UA 1U9RA 4KHVA 1A3VA 4IUNA 3ERQA 3ITPA 1RKNA 1JOKA 4NKLA 3RUZA 4EQNA 3TP8A 4KJNA 4RKBA 3PMFA 2EYPA 1SYDA 3P1HA 4IALA 1JOOA 4K2KA 4QF4A 3NXWA 5CV9A 5M9OA 1KAAA 3E5SA 5CR3A 3MEHA 3NP8A 4DFAA 4K8IA 1TQOA 3C1EA 4IZ8A 2RDFA 3SK6A 5KIXA 5J1ZA 4KD3A 1AEXA 4ZUJA 3EVQA 2WACA 1TT2A 4NP5A 2F0VA 2F0PA 5CC4A 4WORA 5IGGA 5IGEA 5IOCA 2PZUA 1SYEA 5IODA 2F0WA 5IGFA 5JOBA 1STNA 3OWFA 4K5VA 5IGCA 2SOBA 4HTHA 3SK4A 5HURA 5C3XA 1EZ6A 4NDXA 4EVOA 4KD4A 1IHZA 4NMZA 1EY7A 3EROA 1EY0A 1EYCA 3HZXA 2PW5A 2F0NA 1F2ZA 1EY4A 5DEHA 4HMIA 5C3WA 4R8NA 1ENAA 4K5WA 2EY5A 3TP6A 4G57A 3MZ5A 5CV6A 4EQPA 2PQEA 1SNOA 5EGTA 5I9PA 5IGDA 3EJIA 1SNCA 3TMEA 2QDBA 4RKLA 4KY5A 2F0IA 2F0FA 2F0QA 4F7XA 2PYKA 1A3TA 3NQTA 4PMCA 1SYGA 2KQ3A 4S3SA 5EKLA 5I9OA 3QB3A 4B9WA
chains in the Genus database with same CATH superfamily
1VF5C 3CCSA 3DM1A 3KLSA 1YHQA 5C3EG 2JA7H 4Y52H 4JYAQ 5JJLA 1JQYD 2R7ZG 3MEFA 2BOSA 1BNZA 1VMCA 3TZUA 3EFXD 2PNRC 4DK6C 1ZKOA 1Y1WG 5CV7A 3H15A 1C9OA 1KHIA 1KNAA 3MFGA 4F87A 3MXNA 4HEDA 2J4XA 1VQAA 3D4RA 1MGSA 1WTHA 4K2LA 2L55A 4DAYA 3GTMH 1AW7A 1TXYA 1JT8A 4DV4Q 4HMJA 1PRTD 1RD9D 3BVGA 3ER0A 1LTID 1WCMG 3TP5A 1QZHA 2EJGC 3M4QA 1JR0D 1IYJB 3I4NG 4L5RC 5LHY1 1KDBA 1WJJA 5C3EB 4K6DA 5BR8L 1RIPA 4JK1C 3JC66 4HJ5A 4FF2A 3CCUA 2R7ZB 2NVTB 5FLMG 1OO9B 1STYA 3CU7A 4NXMQ 3ND8A 2HIXA 3OMCA 4NW2A 4DR7L 3D4DA 1ENFA 1UNSA 3OW2A 4KHPQ 1H9MA 5H1SE 4H44C 3KOJA 3S1QB 2Q2HA 4UY8C 3JAML 1VQ8A 1HQMC 1RDPD 1SR3A 4FNFA 5TSSA 4CHTB 1AZPA 1QOHA 4MTNA 1PH9A 3PUYA 1A6XA 3RZDB 1CSPA 5M5WH 3M4OH 1HCZA 4G7HC 1VQNA 3J81L 3T1YL 5EPKA 2PQAB 1UEAB 1SMXA 5A2QL 1J5EQ 1IKLA 3A8IE 4GZYC 2ASBA 4XQQA 3SVMA 3M7GA 5IOCA 1B44D 1NCVA 1TIID 2F0WA 2I5LX 1N36L 1VQBA 1N34L 1V8QA 2OCEA 5IGCA 2AWOA 1Z9FA 2CKZB 3F1ZA 2B63G 1L0YB 2B2TA 2IY5B 2VUMH 2B3GA 2QILA 4HMIA 3CCMA 4P2CB 1M8AA 3KDFB 4ZCKA 3F8TA 4X3TA 3TSSA 2PQEA 5LL6X 2XIWA 3SGIA 4DUYQ 1MHWC 5CORA 3M3YB 1I94L 2G9HD 4LFBQ 3FPUB 3KBXA 5EKLA 4A3IH 4CDDC 2JSOA 4DR5L 4G4KA 1KNEA 4A3MH 1EL0A 3I7FA 1CKMA 1F2YA 3OTOQ 1EY9A 1CQFA 2L15A 1TWAH 1G2SA 4HAEA 2E2HH 4GOPB 1TY2A 5BN3A 2E2IB 4JI2L 3JAMc 3LWEA 3M4PA 4R4TA 3KYHC 3VA5A 1IW7C 2B63B 3A74A 3DEPA 5C4XH 4UAIA 2EY2A 2GVAA 3NBHA 1GUGA 4KTAA 3TS2A 1PVOA 2F0SA 3FMCA 3J81c 3K80C 3L7ZC 1DOKA 2Z9HA 4ZRZA 2NB0A 5IP9H 4BXXH 2VQFQ 1G6PA 3KJOA 1II3A 3Q24A 3S9WA 2MUYA 3S16H 2VB3X 2N78A 2A6EC 3PO3B 2X69A 3GTQH 2D62A 1FNWA 1CKOA 4UP7A 1OXVA 2MO1A 3OPOA 1PXUA 5IGBA 4FDBA 2NVYB 2DNCA 3U58A 4X62Q 2ICEC 2K1BA 3MTSA 1S40A 1KABA 3J7AV 3WWVA 1B50A 4ZQ3A 5FJ8H 4DV0L 1L1OA 4UDUC 1XXGA 3KF6B 1ONLA 3CCQA 4KLKA 4LUOA 2JXMB 3HKZE 1TS3A 1HNXQ 3HOZB 3S1RB 5KYIA 4JI7L 1BVSA 1PV4A 2NN6G 4QF4A 4A3KG 2K5HA 3NTKA 5FLXE 2XSCA 3PUVA 1TT2A 4BBSH 5ELCA 5IODA 2B2YC 1Y1WH 2Z8LA 3H09A 2C35B 2R93G 4IUPA 1ESFA 4ME3A 4C1NK 4ULLA 1X3EA 2JA5B 4PMWA 2B39A 1B1ZA 4G57A 4GLAC 3TP6A 2FINB 5AJ3L 1UE1A 5M5XB 3G4SA 5BN4A 1TWCH 2B2UC 1HA6A 4BY1G 5BR8Q 3X3MA 4PMCA 3MXGA 1WCMH 4DR4L 3A8JE 3K0YA 3I4NH 2AKWB 1O7LA 3TDQA 3U50C 3IRBA 1JWSD 3IL8A 4JI4L 3ICEA 2K01A 4LF8L 3AMUA 4DNTB 2HT1A 3NWTA 2KHJA 1CK1A 2HUGA 5EQ0A 1N33L 2CCZA 1FVIA 5CV4A 1LT3D 2F0DA 4WRDA 4OO1G 3CPWA 1VQ4A 4H02A 4P72A 2RA4A 1QUQB 2VS1A 4PQXA 1VCIA 2F52A 3P75A 4KV6A 4RHSA 1AH9A 1PH3A 4P73A 2P5ZX 3MXUA 1N9WA 3H3VH 3D0FA 3UDFA 3HOYB 1N36Q 2AWNA 2V1CC 1SJHD 5J39A 5EPLA 3R2TA 2C5CA 4L8JA 3OHXC 3BJUA 3SK5A 5JJKA 4HSPA 1SNDA 4C1NI 1D2BA 1HJPA 4LAAA 5IIFA 2EY6A 4TVAB 1WD0A 1LTTD 1D1KA 2K32A 3SEBA 5KYLA 3BYYB 1I94Q 4OWWB 2QDLA 2A69D 4IQZA 1F77A 3EN2A 1GHJA 1ENCA 4M8AA 1EQQA 4IUNA 3BDOA 5ELBA 4FF3A 4EQNA 1OXTA 4KJNA 1H9JA 4A3GG 2EYPA 1SYDA 2ZJRA 3MEHA 1GKHA 1NR4A 2RDFA 1Q8KA 5C4JB 2JA8B 1AEXA 2LFNA 4BY7G 1STNA 4TKOB 2Y0SE 4UPAA 3T1HQ 1X55A 2E5LQ 5I2XA 2EPBA 5IYBH 1ENAA 2J0TD 1F9QA 4LF6L 3VYUA 3K5OA 1JE5A 2B2VA 1D1IA 5EGTA 1AE3A 1FYCA 1PDQA 4F7XA 4RWSC 4DAMA 4QIWE 3Q0AA 2KQ3A 3CPFA 1N32Q 3F2BA 4JI3L 1B3QA 3L9AX 4F8MA 3AYHB 3S1MB 4DR3L 4OIKA 1E2ZA 4ZAIA 4WJ3M 3K5NA 1PTOH 1Z6HA 4QUCA 2GA4B 3TN2A 1YJWA 3UDIA 4DK1A 1X54A 2K5NA 1SYCA 4BY7B 1BBXC 3W3AA 3S14H 5A35A 3HKSA 4ZKCB 3N52A 3FPPA 1Q82C 1IL8A 1Q3LA 4FXKC 3OMGA 1EYAA 1X65A 4JI7Q 1SE3A 4N9TA 4HCSA 3AB9A 2OQ0A 2VL6A 1CA6A 2MNAA 1VQFA 4IO9A 3H3VC 1JWUD 1YNNC 1J9OA 4KKUA 2NN6H 2M2LA 4DV5L 4DU9A 4A3KH 3RNUA 3SR1A 1D5MC 2RVLA 3J80E 1YNXA 2F0GA 4B9XA 2NUCA 4UP9A 1LTAD 1SE8A 2NWGA 5LMNL 2H4OA 2UUBL 3K7AH 3QO2A 5IWAL 1FR3A 2R93H 3ULPA 4KY7A 4V0BA 1G51A 1I6HB 4ID6A 4GN5A 4K14A 4JC0A 4FXDA 4X3UA 3R2IA 1T9HA 5NUCA 5HGTA 1JB3A 4C3HB 1EFWA 1EZ8A 4DR4Q 1PYBA 3DLLA 3CRKC 1JC7A 1SE4A 4GN3B 4BY1H 1M4VA 2WAQE 4A93B 1IXRA 1S4ZA 2HHHQ 2RDHA 1CI3M 2UU9Q 1JOOA 3GQBA 2XWJB 4POGA 1E3PA 2K52A 5LL6S 4PZ7A 4BBRH 2EJMA 2WACA 1GXDC 1NAPA 2F0VA 1GOZA 4KKSA 2DNEA 2R6GA 2IJ0A 2PI2E 1PTOF 4OO1H 3EROA 1EY0A 2JA6B 2B2TC 3GTKH 3S17B 3RMHA 5DEHA 1VQEA 1K0RA 5GQOA 1E2WA 4A3CG 1V1PA 1XWEA 2AUKA 3TEHB 5JPNC 3TMEA 2QDBA 3A0JA 3CHBD 2F0IA 1V1OA 4DV4L 2JA7B 2PNHA 1SYGA 1I6VC 1I4XA 4ZKBB 3BU2A 3E0JA 4JBWA 4DXGA 2XGTA 1AN8A 4QJFA 5T1IA 1WTOA 1KTKA 5J3BA 4B3RL 5IE8A 5JAVA 4HJAA 4H0LC 1ET9A 3W1GA 2F0OA 4NXML 4ZYSA 1EU4A 1ILPA 2F0UA 1BCPF 4HN7A 1YHAA 1LTBD 2B2WA 4XT3B 3GTMB 1K3BC 1D7QA 1S5CD 4IPDA 4XXEA 4MIUA 1B2TA 4OL7A 4ODGA 4CDCC 4OWTB 4PMBA 3W5OA 5IT9E 1EIYB 3I90A 3VR2A 4A3GH 1J5EL 1BCPC 1IBMQ 2N8NA 1HQRD 1R4PB 1BUVT 1SBBB 1I50H 2K05A 1FL0A 1F9PA 1C4QA 1LM0A 1VF7A 3TP7A 2HD3A 2E75C 1X3QA 1L1OC 2CVRA 5COYA 2B29A 1LT5D 1CKNA 1ET6A 4X3SA 2JA9A 5M5WB 2EYFA 3EQLC 2ZJQA 4A3IG 1ZYRC 2KEDA 3MXPA 1P8LA 4A3MG 4JVZA 3CKIB 3P1HA 1JCKB 5JJIA 3UDXA 1DGSA 2KCTA 1A8VA 1BF4A 1QJOA 1PYWD 4JW0A 5D3DA 2F03A 1RTOA 1EUJA 1HZBA 1C8CA 3SK4A 1UEBA 4R8IA 5C3XA 2JN4A 4A3JG 4NMZA 3CCRA 3J7YW 4YHHQ 1EYCA 1QZGA 1F2ZA 2I5MX 1OTCA 1R9TH 5IP9G 2BH8A 3IKJA 3MZ5A 3NE5B 1VQPA 3TRZA 4DV5Q 5ELOA 4A3IB 1HZAA 4R4OA 3J81j 1C7YA 4A3MB 2R61A 1HTPA 2IX0A 2VQFL 3PUXA 3QOJA 4P71A 1ML0D 1UE5A 1DJRD 1TWAB 1XNQQ 4HCEA 1KXLA 2LY7A 2E2HB 4DKAC 1EIGA 2Q2IA 3DEOA 4IFDJ 1EIFA 1X3FA 1NMFA 5C4XB 3CW2C 3FKIG 3C1FA 4OWXB 4X62L 3K57A 2QA4A 2OXPA 4JI5Q 5E4WC 2AHOB 4CKCA 5KRUA 5C6AA 2KUMA 1HNXL 1DCZA 3HOUG 2G9DA 4E6IA 1PA6A 3S16B 3DUZA 2L9HA 2I07B 2Z4IA 3O13A 3GTQB 4DR6Q 3PSIA 4BBSG 1TU2B 3FRPB 4YY3Q 2F0KA 3CCEA 2M9VA 4RH6A 1S5FD 3EA6A 3GTGH 3MVVA 1MD2D 1C48A 4N8X1 2CFMA 4LUZA 1JMCA 1NJIC 1A15A 3K6OA 4XYOA 1XX8A 3KLWA 1TS2A 3DWPA 4XQNA 2ATWA 1IW7D 4A3CH 2K5WA 2UXBQ 3A7LA 1Y1VH 4B3RQ 1NBWA 4K2KA 1HH2P 2YU9H 3LNNA 4A4IA 4BBSB 1LTGD 1F2LA 2N88A 2SEBD 2WIIB 4DFAA 5CBEE 3CCLA 1Y1WB 3C1EA 2EDGA 2L1BA 3SK6A 1IBLQ 3EVQA 4J15A 2RDGA 5IGEA 1EQTA 1SYEA 3K58A 4PV1C 1WTVA 1O7YA 3OWFA 1ZEQX 2A6ED 2KBNA 3PO2G 4HTHA 4O2DA 3KF8B 4LWCA 1CSQA 5EJWA 4AYBE 1VMPA 2ID0A 1MJEA 1TWCB 1K3RA 3GD7A 4FP5D 4EX5A 1WCMB 2B2VC 4A3DH 1SNOA 2WB1E 1RJTA 3LWUA 3I4NB 1DOLA 3F2DA 2FMMA 4S3SA 4ZUIA 4JCVE 5KNCA 1O7ZA 4DR1Q 1IYVA 2KCCA 1YNJC 1RCVD 1JORA 1B70B 1RF2D 2F3IA 3BYTB 3S2DH 2QEXA 3U9OA 2E2JH 4X65Q 4IOCA 3OW7A 2PZWA 3NELA 2E2DC 3OYYA 3PF5A 4C2MH 4XTCS 5JVH3 3OSOA 4O0AA 3CC4A 4B3SQ 2Z4HA 5CGKA 5IYCG 4DV2Q 4OGQC 3DWAA 4EQ5A 5BN5A 2D0PA 4YCUA 1XYIA 3KF6A 1G8ZD 1JOQA 2A73B 2ZTCA 2A74C 5FLXL 1VQDA 5DM73 5GADC 1IL2A 2K5DA 3CQZH 1HA5A 5C5LA 1PH5A 2Q8RE 2RCNA 4IFDG 3F2CA 2KVMA 2L11A 5IYBG 2HQLA 3T1HL 2QGQA 1SXTA 4A3JH 2YTXA 4O42A 2UUCQ 4M1UB 2E5LL 1E22A 2VQEL 1EQVA 5FKAC 1NR2A 3W1BA 1SAPA 2Q8IB 4BWGB 4NXNL 4YIJA 5J22A 2KOLA 1PRTC 3ERQA 2HCIA 2DJGC 1QVCA 1OXXK 1N32L 4V190 1G91A 3E5SA 3HKZG 2N55A 3R93A 3ERSX 4CGYB 2JJQA 3PIOA 4JBMA 4DUZL 2CQAA 1WI5A 2Z1CA 4L6TB 1S5BD 3E3XA 5IGGA 3HFZB 5GAHC 2E8GA 3C46A 1Y8OB 1D8LA 3FKIH 2Z6KA 3TBIB 3V05A 1AE2A 3VYRA 1YEZA 2R92G 4DXFA 1JJ2A 1JJCB 2R7DA 3P20A 1PFBA 4O1NA 1YVCA 1EY4A 1F9SA 1D5ZC 2DGYA 3SDZA 5M3FH 4OXPA 5HY6A 3EJIA 1SNCA 1KLUD 2ZXOA 3HOUH 1BBUA 5EAYA 4DN4M 2F0FA 5K5PA 3S15H 4X3KA 1PTOB 1UUPA 1GO3E 5CV9A 5FLXc 4JBJA 3I91A 1K8GA 1QUQA 3WOFA 2NZOA 3HG9A 3HKZB 3S14B 3BVMA 2CQOA 4JBKA 2ENBA 1NTGA 3NSWA 1VQMA 5G3LF 3DWQA 1ESRA 2H1EA 1O80A 2K28A 2IL8A 4J1MA 2N3SA 2B2WC 1U4PA 1CUKA 3K8AA 4Z9CB 3RD4A 1A3UA 4DR2Q 5ELNA 1Z47A 4C3IH 4KK7A 1D5XC 3PGZA 4A3KB 5C4ZA 1P16A 2K50A 3T4AC 5LMUL 2KA7A 3STBD 4BBRG 1BCPB 3GV3A 3J80i 1EWCA 2UU9L 2HHHL 3C2PA 4EQOA 2O4XA 4U673 2YTYA 2NN6I 1NNXA 3VR6A 2Z6BA 3K7AB 1WYDA 1G2TA 2K5VA 1SJED 1H9SA 4BS9A 1SFOH 4DV6Q 2R93B 3PO2H 4RGMA 5IP7G 3GTPH 2H5XA 1I3QH 1BO0A 4C56C 1XMQL 2F0MA 4U68A 3GP7A 3M9BA 4BY1B 1GUNA 3QJYA 1W3SA 2VXWA 4HIOA 1W6JA 3KUPA 4IUVA 4HSVA 1A2UA 2RSNA 1XNRQ 5FK9C 3N6RA 3VR3A 3WOEA 3OWEB 4BBRB 3PMFA 5C0XI 1SEBD 1GUSA 1VQGA 2CWPA 2RHSB 1YNND 5HGQA 2IW3A 3J7AF 4OONA 1PLFA 1CHPD 1I5FA 1LTRD 1FJGQ 3GTKB 4PZ8A 5KNDA 3RZOH 2XTIA 3CP0A 4EVOA 1KRTA 1IHZA 1EY7A 2LXKA 4GNXC 2XRQD 1FGUA 5FOBB 1HNWQ 3HOVH 3Q22A 4DV7Q 1BBWA 2CW0C 2Y0SG 2A68D 3NENA 4MZ9A 3I8ZA 1DONA 4C3JH 5IGDA 1CQVA 2K4KA 1QG7A 5M3MH 5IYCH 5I9OA 1R4QB 3K0XA 1GUOA 4B9WA 2IX3A 4IJLA 3KFUA 1B53A 1JE4A 1SNPA 2RBMA 2HQEA 1TS5A 1EY6A 1IBML 3DXJC 1WFQA 2CHBD 2JEAI 4L5TA 3J80L 2VQEQ 3T53B 4QB4A 4IFDH 1YIJA 3WDNA 2GN5A 1A62A 3BS1A 2XNAC 4NXNQ 2EYOA 2XWBB 2HCCA 5KEEA 3VA7A 1EY5A 1V1QA 1B4OA 1J8IA 2Q2UA 4A3GB 3PCOB 2K14A 4G7ZC 1V9PA 4DUZQ 1SNQA 1YZ6A 3CF5A 1WTWA 4JPBW 1U0LA 5E4XA 2DY7A 1I50B 2KCMA 4CKBA 3OIPA 4QIWB 3J7A5 1SMYD 1RHPA 2K75A 4JI1Q 1STBA 1LABA 2RCFA 1PTOD 4QMGA 2R92H 4YHHL 2KECA 3MAQA 2NVQH 1CA5A 1EOTA 1HR0Q 4GKKL 1VQIA 3H91A 4GKJL 4OELB 4RGTA 3PF4A 4QCLA 1K0SA 2F3WA 3G71A 4KHVA 2IWHA 5M5YH 1U4MA 4KI0A 4IALA 3T51B 5L37A 4DNRB 1TWGH 3W2DA 3J80c 3GTJH 3CXCA 2D2CC 1XNQL 5KIXA 4F88A 2WAQG 1B3AA 1EWIA 4MN3A 4WORA 4DA2A 1H9RA 4LF4L 5JOBA 1BCPD 1R9TB 3AU7A 1EZ6A 1TKWB 3BZCA 4LFAQ 2DJFC 3I4LA 2IPKD 4RMFA 3H94A 4JI5L 4HR7B 5LMUQ 1HR0W 4A3FH 2WKDA 5CV6A 4ZK9B 4YCWA 3BZDB 4KY5A 3ULJA 2F4VL 1C0AA 1K8AC 1O7IA 1MBYA 4DR6L 5ELFA 4YY3L 2BH2A 4N9PA 2WV6D 2WAQB 1XMQQ 4YCVA 3SXHA 4B08A 2AUJD 1CM9A 2BDOA 2TSSA 5IP7H 3QG1A 2Z0SA 2L12A 3NWSA 1SYBA 1TWHH 2NTTA 4IUUA 2NZ1D 3I55A 1QVFA 2PCFB 1Y1VG 3V2TA 2K5QA 3QOLA 4CJ2C 2VZAA 4AIMA 2MPMA 4R1JA 2R7FA 1BQQT 2UXBL 1STGA 1DM0B 3AEVA 4A3BG 3GTGB 1IYUA 3UI2A 3KK7A 3CCJA 3IFTA 4TQUS 3CC2A 1IBLL 1LACA 3H0GH 5DLQE 5ELEA 3K5MA 3I2ZA 3PIO3 3UDGA 4ZLTF 4R9WA 1VQ5A 1A0IA 1EY8A 3CMEA 1FNUA 2OT2A 3A5ZB 1UE7A 4KN4C 4A3DG 4JG2A 2OF1A 4LK1C 1NSNS 3T56B 4LFCQ 1Y1VB 1ZXTA 5IT9c 2YU9B 2A6HD 3KLRA 1JOKA 4NKLA 4YWMA 1MIUA 3Q8DA 1YI2A 4CKEA 1RL2A 1X3GA 3CMAA 4HIDA 4L5QA 3NP8A 2B2UA 1VQJA 4MTKA 4DR1L 4P74A 3FVQA 4IPHA 5J1ZA 1E2VA 4NP5A 1K8MA 4QGUA 3G6EA 2LSSA 1BR9A 2QKIC 1EYGA 2Z6KC 4LJZC 1OXUA 5HURA 1G291 5E7NA 1KIXA 1ILQA 1LUZA 2F0NA 2KHIA 1YHBA 3VR4A 5GAGC 4A3DB 4LF9L 4X65L 3UE1A 2MJ8A 4KN7C 1WTPA 4WJ4A 3M7NA 3UE0A 4A3EG 1WTXA 2VB2X 2PMZE 4B3SL 4RCOA 1ASYA 2NVXH 4LF5Q 1VS0A 4DV2L 5EBCA 3IAYA 1SNMA 1PH6A 2O5JC 2EYHA 5JVG3 4JV5Q 4OHJA 1NUCA 1EEFD 4IUQA 3S2DB 3U4ZA 4FXGC 5IY0A 2E2JB 4H13C 1RTNA 4GKKQ 4QUFA 3FP9A 5CBAE 3T16A 4GKJQ 2B8GA 1HRJA 3RLOA 4C2MB 2ZM6Q 2UUCL 3SHLA 4IPGA 2DUDA 4TSSA 4B3ML 4JI6L 3VYSA 3U4VA 1TR5A 3BG3A 1BOSA 1Q90A 2SDFA 2OTJA 1XPRA 2V4DA 4IPCA 5ISRA 3LX0A 4POFA 3H6MA 1EYDA 2L5TA 4LF4Q 2ALYB 2YV5A 3CQZB 3PV0A 4HJ9A 3GO5A 1YBYA 3P7JA 4YWKA 1KL9A 3HOXH 4A3JB 5KNBA 5FO8B 4J6HA 1K73C 2BE5C 5C5MA 3GTOH 1M90C 3HOWH 1CT1D 2X6GA 1JJGA 4H7BA 4LMQD 5M3FG 3X3NA 1QILA 2WFWA 2F0HA 3K7UC 2F4VQ 1EU3A 4A76A 3ZYYX 1K9MC 2ZTDA 2J7ZA 1X9NA 1A3VA 1Z7TA 1RKNA 1ASZA 3I56A 1YJ9A 2Q2TA 1QNUA 4RKBA 4DV3Q 4JI8Q 2CH4A 1Q7YC 3Q23A 2UUAQ 3BVZA 3TREA 4K8IA 1T5EA 3FKIB 2YTVA 4Q5VA 2PQAA 5JEAJ 2QF7A 3QWNA 4GNXB 3CC7A 1TWFH 5LMNW 4K5VA 2EVBA 1RODA 4KKTA 1B7YB 5D3IB 4C3IG 4FF1A 5M3FB 3HZXA 3MWYW 3NQIA 4XDXA 3K59A 1CZWA 3HOUB 1XPUA 3A55A 4DR2L 3S15B 2AQ3B 1KAWA 4AYBG 2E76C 1QVGA 2GVBA 4R4QA 3KDFA 2F0QA 2NTSA 1VQOA 2K33A 3S2HH 1WVLA 4A3BH 4AQYQ 2WB1G 4K8JA 1STAA 3RLNA 2O5IC 4X64Q 1HUMA 3HEJA 1N8RC 1HNZQ 1LO5D 3KJPA 4DV6L 1K83H 1E0BA 3LGJA 3GDEA 1X3PA 5ELDA 3T13A 3RN5A 1U4LA 1DOMA 1VQHA 1Q1BA 2FMCA 2PO4A 3NPPA 4RGOS 4C3IB 2A5HA 1A2TA 1LT4D 2M00A 4GOPA 2F1MA 3NTIA 1YITA 4ILWA 1GJXA 3DHQA 5CMDA 4KJOA 3E0EA 3S1NH 4ME5A 2FFKB 4AYBB 1FGBD 2EE1A 2XN9C 1XNRL 4ABNA 5C0XJ 2JP1A 5C44H 3ULLA 4BA1I 1SFOB 2I5HA 3MXNB 4JOIA 2PW7A 2WB1B 3PO2B 1AP0A 3AFQA 4DAYB 5I6YA 1I3QB 3I4OA 3GTPB 4DGZA 3NTHA 4LF9Q 1MJCA 3HOVG 1FJGL 2X6LA 4YWLA 1G6ZA 5C4HA 2HIVA 4C3JG 2WINB 4OIJA 1U5KA 2LS01 4OX9L 1HNWL 4DV7L 5KGUA 5M3MG 2AQ1B 4PG3A 3TS0A 4DPGA 2SNMA 4A3EH 2EYMA 1WTRA 1I4HA 2ICIA 4UP8A 3H3VI 1DXMA 2K03A 3ITPA 1NY4A 1PRTF 2QEJC 1TVXA 4K0KQ 2NBFA 3E9IA 3RZOB 5G3LD 1PFMA 3PO3G 2HDLA 3CCVA 4B3MQ 1ICWA 4JI6Q 3HOVB 4LF7Q 3VDYA 3JAME 3B6YA 1B9NA 3I70A 2A8VA 2PW5A 4Y7NH 1WD1A 2I0QA 2QW7A 3CD6A 1QWYA 4C3JB 1TY0A 4K5WA 3HS0C 1PZJD 5M3MB 4UHVA 3GTLH 3J81E 3HP3A 2K6AA 2OTLA 1KRSA 5A2QE 1A3TA 3M4YA 3AQQA 1Y69U 3HOZG 1X6OA 1DZ1A 5CV8A 3I4MH 2BCOA 4LNQA 2KJXA 1Q1EA 2HDMA 3DMUA 2UXCQ 4GS3A 4FVMA 3D8GA 4JI1L 5JEAG 1GUWA 2RKSA 1GVPA 1IBKQ 4IFDI 4B3TQ 3E9HA 3FHWA 3PUWA 1T5XD 4RAUC 1K8OA 1F2MA 5EKIA 1HR0L 3MC0B 2KCNA 4X6AH 3M85A 4DAVA 1GM5A 2JA5G 2ZXRA 2CW0D 3AFPA 2F0TA 1QCBD 1I4GA 5I6WA 2WP8J 4DV1L 3D4WA 4LW1A 4CDEC 3SE0A 1PH4A 3NBHB 2EQSA 2R92B 3PIPA 3PUZA 4DF7A 5C3EH 2VW9A 1DD2A 3QR8A 4KY6A 2NVQB 4A3FG 2R7ZH 2NVTH 2DY8A 2F3VA 4A75A 4K5XA 4PNYA 2RHQB 4LFAL 2A1AA 1JICA 2CH4W 2BA1A 3HGBA 1KC8C 1EFID 5M5YB 2D0OA 1EOVA 4CBVA 1MKHA 3DM3A 2L4NA 5DAUA 1LTLA 2MQHA 4QY7A 3S1QH 2F0JA 1TWGB 4QQBX 2VY3A 3GTJB 1CTMA 3TQYA 3VR5A 1L0WA 5C0XG 3RZDH 1PH8A 4WJWA 3D31A 1TQOA 4RG1A 1L1OB 1IZ6A 4EGVA 3HOYG 1SLJA 1UAPA 5DNFA 5CC4A 2ZJPA 5IGFA 4DR7Q 2FXQA 4A3FB 4MHEA 5FLMH 4NDXA 1XMOL 1NMGA 1GHKA 1GD7A 5C3WA 2BA0A 4EQPA 2NZHA 4APVA 1PH2A 4OEMB 4RKLA 2JQOA 4MNOA 1VQ6A 5FO9B 1EIHA 1I4PA 3T1YQ 3QB3A 1Q86C 1KQSA 1AZQA 5GAEC 3H0GG 3M3YH 4A3LG 4X66L 1DYQA 4DNIA 4DK3C 1N34Q 1VQLA 4OX9Q 5CYUA 4OO1I 2JA8G 1TWHB 1LV9A 1PYSB 5EPJA 2JK8A 3S24A 5K36G 4RCNA 2LMCB 1CHQD 2E2IH 2IHFA 3BZKA 1BXTA 2B63H 3NK9A 4LFCL 1HFNA 5D14A 1U4RA 1I4QA 3KLSX 3L3OC 2ZT9C 4IURA 5GROA 4DR5Q 2OEOA 5EKKA 1H9SB 4R4IA 3H0GB 5D65A 3CRLC 1PMRA 1HZCA 2EYLA 3URYA 1NE3A 2F4IA 4GLXA 3KBGA 5E1FA 1WTQA 4JI2Q 3NHHA 3PO3H 4L5SA 2Y0SB 1PFSA 1PH1A 3R8BA 2NVYH 4NPSA 2UXDL 1HPCA 2OQKA 1VQKA 4Q0FA 4RA8A 3PQIA 4L63B 4JI0L 3U9SA 3IFDA 2CWAA 2JEBI 1U9RA 4N8FA 2LXJA 2MFIA 3STBC 3A8KE 3HOZH 4LF5L 3S1RH 1KD1C 3C3LA 1J6QA 1JWMD 2MO0A 2IHEA 2JYOA 4XIGS 4JV5L 4ZUJA 4I7ZC 2PPBC 1E7ZA 2XRSD 2WKCA 1X56A 3D3RA 5DM63 5JEAH 1VDZA 4BA2I 1M1KC 1VQ7A 5FO7B 4DV0Q 4XT1B 2ZXPA 1H9KA 2A19A 2ZM6L 4R8NA 1MSGA 2NVXB 3A54A 3FDTA 4DV1Q 1SSOA 3RLFA 3V96A 2JA5H 3G7LA 4C3HG 4AH6A 5M5XH 4CDFC 3HOXG 1LTSD 1HUNA 2PI2A 4A93G 1XTCD 4CJ0B 1KDCA 1H95A 3HOWG 2BDNA 1L0XB 4IUTA 2FHTA 4HJ7A 2FJ2A 4XYQA 1VQCA 3K81C 1OXSC 1Q8IA 2F0EA 2NYZD 4TRDA 2A69C 5I4DA 2O2LD 4GOPC 1SYFA 2A68C 5AJ3Q 2G5DA 1JB7A 2JA6G 4KMUC 1ZYRD 5IT9L 3TZDA 4I7AA 5AFWA 1V43A 3A7AB 3MA2B 5IYDG 2AQ2B 4IJHA 1AFPA 1CZGA 1SRUA 4DV3L 4JI8L 3A5UA 3HOXB 5C0XH 4JOIC 4JI4Q 2UUAL 2JA7G 1SROA 3GTOB 2EYJA 4LF8Q 3I72A 3HOWB 3HOYH 1FD7D 1YJNA 2EIFA 1XMOQ 1EWHA 2L0CA 1N33Q 1KDAA 3BDLA 1B9MA 4I65A 4J8QA 4FF4A 4RHRA 4JYAL 2F0LA 2R3ZA 3NUCA 3OIQA 1STHA 1FNVA 1X32A 1SDFA 2PZTA 1S72A 3MHBA 3EBEA 2SNSA 5EBDA 2LKVA 3I3CA 1HHVA 4X66Q 2D9UA 3RUZA 2IX1A 3VYTA 1S5DD 1XJVA 3NBIA 4CJ1B 1KLGD 4P75A 5M9OA 1A63A 5CR3A 2C9OA 4AQYL 4A3LH 4IZ8A 1TWFB 1L2FA 3RN2A 4KD3A 3OOCA 3MFYA 1LLRD 4X64L 1SMYC 1Y8PB 2F0PA 2XVSA 4HIMA 3K5LA 1HNZL 2B2YA 2MHVA 1PTOC 2Q8TA 5C4JH 2JA8H 2SOBA 1UE6A 2RQXA 5JJZA 3A56A 1PRTB 4KD4A 4XQJA 1PFNA 1E1OA 2VNUD 2BE5D 5K36H 1BKBA 3NEMA 1MSHA 2EY5A 4RGNA 1TS4A 3I73A 4HIKA 3GV6A 4KHPL 1VQ9A 1IKMA 5I2YA 3S2HB 1PZID 5C44G 5I9PA 4A3BB 1SN8A 2QCPX 1LT6D 4NB3A 3L2PA 3E6ZX 1W2BA 4LUVA 4DK0A 3RR5A 4G7OC 1XTDA 1SE2A 1W6KA 4IOAA 4GLVB 3D6CA 1K83B 4FYDA 1PH7A 4PZ6A 1HTLD 2EJFC 2EXZA 4WFN3 1Q46A 3S1MH 3J7ZC 1V1PB 2UXDQ 4GN4B 3R3OA 2KHSA 4BY7H 1HXYD 5E3FA 4JI0Q 3PIP3 3S1NB 1Y8NB 2E74C 1MI2A 2EOTA 2VUMG 1HZ9A 4LF6Q 1D6EC 5JPMC 1BDOA 5C44B 1STEA 1E1TA 2D5DA 3CAMA 4HJ8A 1CFMA 1Q12A 3M4OB 4JI3Q 1E24A 1QE6A 2RF4A 4KHZA 2EY1A 4DR3Q 1PZKD 1GUTA 1LYLA 4DUYL 2KENA 4K0KL 1I4RA 1ICFB 2B8FA 5F2DA 4LFBL 2PMZB 3L0OA 1Y14B 3FEWX 1O78A 4R4CA 3SK8A 3BDCA 3F2UA 5T1GA 3OTOL 4DAPA 4LF7L 4K6LA 1QB5D 1EEID 2I46A 4ALPA 1S3OA 5C4XG 3ZJYC 4A3EB 3QIAA 2VUMB 3EIVA 2EXDA 1K28A 2ZTEA 1XPOA 2K7VA 5CV5A 4GNXA 1I6HH 1F9RA 4IN3A 4FO2A 1QNKA 2EZVA 3I4MG 4BXXG 4QL5A 4C3HH 3TP8A 2RSOA 1Q81C 3NXWA 1KAAA 1HFGA 1EQRA 2AMCB 2DN8A 2N49A 4A93H 1UWVA 3G48A 1CKNB 1YNJD 5LMNQ 2ES2A 2UUBQ 2UXCL 2JE6I 2PZUA 3G6JB 3JAMi 3HRZC 2IT1A 5IWAQ 4Y7NB 3D6WA 2K04A 2TMPA 3GTLB 5FJ8G 1IBKL 4B3TL 1WOCA 3J81i 3KF8A 2YYZA 1PHJA 2JA6H 3Q6SA 3S17H 2MP1A 2A6HC 4RFBA 3I4MB 2KEEA 1B8AA 3NQTA 2PYKA 3ND9A 1S5ED 5IYDH 3ONAB 2OWOA 2MGSA
chains in the Genus database with same CATH topology
1VF5C 3DM1A 3KLSA 1JQYD 2BOSA 1BNZA 1VMCA 3TZUA 3EFXD 2PNRC 1ZKOA 5CV7A 1KNAA 3MFGA 4F87A 3MXNA 4HEDA 2J4XA 3D4RA 1MGSA 4K2LA 2L55A 4DAYA 1AW7A 4HMJA 1PRTD 1RD9D 3BVGA 1LTID 3TP5A 2EJGC 1JR0D 5LHY1 1KDBA 5C3EB 4K6DA 4FF2A 4JK1C 2R7ZB 2NVTB 1OO9B 1STYA 3CU7A 3ND8A 3OMCA 4NW2A 3D4DA 1ENFA 1UNSA 1H9MA 4H44C 3S1QB 3JAML 1HQMC 1RDPD 4FNFA 5TSSA 4CHTB 1AZPA 1QOHA 3PUYA 1A6XA 3RZDB 1HCZA 4G7HC 3J81L 5EPKA 1UEAB 5A2QL 1IKLA 3A8IE 4GZYC 4XQQA 3SVMA 3M7GA 5IOCA 1B44D 1NCVA 1TIID 2F0WA 1V8QA 5IGCA 2AWOA 1L0YB 2B2TA 2QILA 4HMIA 4P2CB 1M8AA 4X3TA 3TSSA 2PQEA 5LL6X 2XIWA 5CORA 3M3YB 2G9HD 3FPUB 3KBXA 5EKLA 2JSOA 4G4KA 1KNEA 1EL0A 1F2YA 1EY9A 1CQFA 1G2SA 4HAEA 1TY2A 5BN3A 2E2IB 3LWEA 3VA5A 1IW7C 2B63B 3DEPA 4UAIA 2EY2A 3NBHA 1GUGA 4KTAA 2F0SA 3FMCA 3L7ZC 1DOKA 4ZRZA 2NB0A 1II3A 3Q24A 3S9WA 2MUYA 2VB3X 2A6EC 3PO3B 2X69A 2D62A 1FNWA 1OXVA 3OPOA 1PXUA 5IGBA 2NVYB 2DNCA 2ICEC 2K1BA 3MTSA 1KABA 3J7AV 1B50A 4ZQ3A 4UDUC 1XXGA 1ONLA 2JXMB 1TS3A 3HOZB 3S1RB 5KYIA 2NN6G 4QF4A 3NTKA 5FLXE 2XSCA 3PUVA 1TT2A 5ELCA 5IODA 2B2YC 2Z8LA 3H09A 4IUPA 1ESFA 4C1NK 4ULLA 2JA5B 4PMWA 2B39A 1B1ZA 4G57A 3TP6A 2FINB 5M5XB 5BN4A 2B2UC 1HA6A 3X3MA 4PMCA 3MXGA 3A8JE 3K0YA 3TDQA 1O7LA 1JWSD 3IL8A 2K01A 3AMUA 4DNTB 3NWTA 1CK1A 2HUGA 5EQ0A 5CV4A 1LT3D 2F0DA 4WRDA 4OO1G 2RA4A 4PQXA 1VCIA 3P75A 4KV6A 4RHSA 3MXUA 3HOYB 2AWNA 1SJHD 5J39A 5EPLA 3R2TA 2C5CA 4L8JA 3OHXC 3SK5A 4HSPA 1SNDA 4C1NI 1D2BA 4LAAA 5IIFA 2EY6A 1WD0A 1LTTD 1D1KA 2K32A 3SEBA 5KYLA 3BYYB 2A69D 4IQZA 1F77A 1GHJA 1ENCA 4M8AA 4IUNA 3BDOA 5ELBA 4FF3A 4EQNA 1OXTA 4KJNA 1H9JA 2EYPA 1SYDA 3MEHA 1NR4A 2RDFA 5C4JB 2JA8B 1AEXA 2LFNA 1STNA 4TKOB 5I2XA 2EPBA 1ENAA 2J0TD 1F9QA 3VYUA 3K5OA 2B2VA 1D1IA 5EGTA 1PDQA 1FYCA 4F7XA 4RWSC 3Q0AA 2KQ3A 3L9AX 4F8MA 3S1MB 4OIKA 1E2ZA 4ZAIA 3K5NA 1PTOH 1Z6HA 4QUCA 2GA4B 3TN2A 4DK1A 4BY7B 1SYCA 1BBXC 3W3AA 5A35A 4ZKCB 3N52A 3FPPA 1IL8A 1Q3LA 4FXKC 3OMGA 1EYAA 1SE3A 4N9TA 4HCSA 3AB9A 1CA6A 3H3VC 1JWUD 1YNNC 1J9OA 4KKUA 2NN6H 2M2LA 4DU9A 3SR1A 1D5MC 2RVLA 3J80E 2F0GA 4B9XA 2NUCA 1LTAD 2NWGA 2H4OA 3QO2A 1FR3A 4KY7A 4V0BA 1I6HB 4ID6A 4K14A 4FXDA 4X3UA 3R2IA 5NUCA 5HGTA 1JB3A 4C3HB 1EZ8A 3CRKC 1JC7A 1SE4A 1M4VA 4A93B 1S4ZA 2RDHA 1CI3M 1JOOA 3GQBA 2XWJB 5LL6S 2EJMA 2WACA 1GXDC 1NAPA 2F0VA 4KKSA 1GOZA 2DNEA 2R6GA 2IJ0A 1PTOF 4OO1H 3EROA 1EY0A 2JA6B 2B2TC 3S17B 3RMHA 5DEHA 1E2WA 1V1PA 1XWEA 2AUKA 5JPNC 3TMEA 2QDBA 3CHBD 2F0IA 1V1OA 2JA7B 1SYGA 1I6VC 1I4XA 4ZKBB 3E0JA 4JBWA 4DXGA 1AN8A 5T1IA 1WTOA 1KTKA 5JAVA 4H0LC 1ET9A 2F0OA 4ZYSA 1EU4A 1ILPA 2F0UA 1BCPF 4HN7A 1LTBD 2B2WA 4XT3B 3GTMB 1S5CD 4XXEA 4MIUA 1B2TA 4OL7A 4ODGA 4PMBA 5IT9E 3I90A 3VR2A 1BCPC 1HQRD 1R4PB 1BUVT 1SBBB 2K05A 1F9PA 1C4QA 1VF7A 3TP7A 2E75C 1X3QA 2CVRA 5COYA 1LT5D 1ET6A 4X3SA 5M5WB 2EYFA 3EQLC 1ZYRC 2KEDA 3MXPA 3CKIB 3P1HA 1JCKB 1BF4A 1QJOA 1PYWD 5D3DA 2F03A 1RTOA 1C8CA 3SK4A 4R8IA 5C3XA 4NMZA 3J7YW 1EYCA 1F2ZA 3IKJA 3MZ5A 3NE5B 4A3IB 4A3MB 2R61A 1HTPA 2IX0A 3PUXA 3QOJA 1ML0D 1DJRD 1TWAB 4HCEA 2LY7A 2E2HB 1EIGA 3DEOA 4IFDJ 5C4XB 3C1FA 3K57A 2OXPA 5E4WC 4CKCA 5KRUA 5C6AA 2KUMA 1DCZA 2G9DA 4E6IA 3S16B 3DUZA 2L9HA 2I07B 2Z4IA 3O13A 3GTQB 1TU2B 3FRPB 2F0KA 2M9VA 4RH6A 1S5FD 3EA6A 3MVVA 1MD2D 1C48A 1A15A 3K6OA 4XYOA 1XX8A 1TS2A 3DWPA 4XQNA 1IW7D 2K5WA 3A7LA 4K2KA 3LNNA 4BBSB 1LTGD 1F2LA 2N88A 2SEBD 2WIIB 4DFAA 5CBEE 1Y1WB 3C1EA 2EDGA 2L1BA 3SK6A 3EVQA 2RDGA 5IGEA 1EQTA 1SYEA 3K58A 4PV1C 1WTVA 1O7YA 3OWFA 1ZEQX 2A6ED 4HTHA 5EJWA 1VMPA 2ID0A 1TWCB 3GD7A 4FP5D 1WCMB 2B2VC 1SNOA 3LWUA 1RJTA 3I4NB 1DOLA 2FMMA 4S3SA 4ZUIA 5KNCA 1O7ZA 1IYVA 2KCCA 1YNJC 1RCVD 1JORA 1RF2D 3BYTB 3U9OA 3OW7A 2PZWA 2E2DC 4XTCS 5JVH3 3OSOA 2Z4HA 5CGKA 4OGQC 3DWAA 5BN5A 1XYIA 1G8ZD 1JOQA 2A73B 2A74C 5FLXL 5DM73 2K5DA 1HA5A 5C5LA 2Q8RE 4IFDG 2KVMA 2L11A 1SXTA 4O42A 4M1UB 1EQVA 5FKAC 1NR2A 1SAPA 2Q8IB 4BWGB 4YIJA 5J22A 2KOLA 1PRTC 3ERQA 2HCIA 1OXXK 1G91A 4V190 3E5SA 2N55A 3R93A 4CGYB 2CQAA 2Z1CA 4L6TB 1S5BD 5IGGA 3C46A 1Y8OB 3TBIB 3V05A 3VYRA 4DXFA 3P20A 1PFBA 4O1NA 1EY4A 1F9SA 1D5ZC 3SDZA 3EJIA 1SNCA 1KLUD 2ZXOA 4DN4M 2F0FA 5K5PA 4X3KA 1PTOB 1UUPA 5CV9A 3I91A 3WOFA 3HG9A 3HKZB 3S14B 3BVMA 2ENBA 3NSWA 5G3LF 3DWQA 1ESRA 2H1EA 1O80A 2K28A 2IL8A 4J1MA 2B2WC 1U4PA 4Z9CB 3RD4A 1A3UA 1Z47A 4KK7A 1D5XC 4A3KB 5C4ZA 3T4AC 2KA7A 1BCPB 3GV3A 1EWCA 3C2PA 4EQOA 2O4XA 4U673 2NN6I 3VR6A 3K7AB 1G2TA 1SJED 1H9SA 4BS9A 2R93B 4RGMA 1BO0A 4C56C 2F0MA 4U68A 3GP7A 4BY1B 1GUNA 3QJYA 2VXWA 1W6JA 3KUPA 4IUVA 4HSVA 1A2UA 2RSNA 5FK9C 3N6RA 3VR3A 3WOEA 3OWEB 4BBRB 3PMFA 5C0XI 1SEBD 1GUSA 1YNND 2IW3A 3J7AF 1PLFA 1CHPD 1LTRD 3GTKB 5KNDA 4EVOA 1IHZA 1EY7A 2XRQD 5FOBB 3Q22A 2CW0C 2A68D 3I8ZA 1DONA 5IGDA 1CQVA 1QG7A 5I9OA 1R4QB 1GUOA 4B9WA 2IX3A 1B53A 1JE4A 1SNPA 2RBMA 2HQEA 1TS5A 1EY6A 3DXJC 2CHBD 2JEAI 3J80L 3T53B 4QB4A 4IFDH 3WDNA 3BS1A 2XNAC 2EYOA 2XWBB 2HCCA 5KEEA 3VA7A 1EY5A 1B4OA 1J8IA 4A3GB 4G7ZC 1SNQA 1WTWA 5E4XA 2DY7A 1I50B 4CKBA 3OIPA 4QIWB 1SMYD 1RHPA 1STBA 1LABA 1PTOD 4QMGA 2KECA 3MAQA 1CA5A 1EOTA 3H91A 4RGTA 4QCLA 2F3WA 4KHVA 2IWHA 1U4MA 4KI0A 4IALA 3T51B 4DNRB 3W2DA 2D2CC 5KIXA 4F88A 1B3AA 4MN3A 4WORA 4DA2A 1H9RA 5JOBA 1BCPD 1R9TB 3AU7A 1EZ6A 1TKWB 3I4LA 2IPKD 3H94A 4HR7B 2WKDA 5CV6A 4ZK9B 3BZDB 4KY5A 1MBYA 5ELFA 4N9PA 2WV6D 2WAQB 3SXHA 4B08A 2AUJD 1CM9A 2BDOA 2TSSA 3QG1A 2L12A 3NWSA 1SYBA 2NTTA 4IUUA 2NZ1D 2PCFB 3V2TA 2K5QA 3QOLA 4CJ2C 2MPMA 1BQQT 1STGA 1DM0B 3GTGB 1IYUA 3UI2A 3KK7A 3IFTA 4TQUS 1LACA 5ELEA 3K5MA 3PIO3 4ZLTF 4R9WA 1EY8A 1FNUA 2OT2A 4KN4C 2OF1A 4LK1C 1NSNS 3T56B 1Y1VB 1ZXTA 2YU9B 2A6HD 3KLRA 1JOKA 4NKLA 4CKEA 3NP8A 2B2UA 3FVQA 5J1ZA 1E2VA 4NP5A 1K8MA 1BR9A 2QKIC 4LJZC 1OXUA 5HURA 1G291 1ILQA 2F0NA 3VR4A 4A3DB 2MJ8A 4KN7C 1WTPA 3M7NA 1WTXA 2VB2X 4RCOA 5EBCA 3IAYA 1SNMA 2O5JC 2EYHA 5JVG3 4OHJA 1NUCA 1EEFD 4IUQA 3S2DB 4FXGC 2E2JB 4H13C 1RTNA 4QUFA 5CBAE 3T16A 2B8GA 1HRJA 4C2MB 3SHLA 4TSSA 3VYSA 1TR5A 3BG3A 1BOSA 1Q90A 2SDFA 2V4DA 5ISRA 3LX0A 3H6MA 1EYDA 2L5TA 3CQZB 3PV0A 3GO5A 3P7JA 4A3JB 5KNBA 5FO8B 4J6HA 2BE5C 5C5MA 1CT1D 2X6GA 4H7BA 4LMQD 3X3NA 1QILA 2F0HA 1EU3A 3ZYYX 2J7ZA 1A3VA 1Z7TA 1RKNA 1QNUA 4RKBA 3Q23A 3BVZA 4K8IA 1T5EA 3FKIB 4Q5VA 5JEAJ 2QF7A 3QWNA 4K5VA 2EVBA 1RODA 4KKTA 5D3IB 4C3IG 4FF1A 5M3FB 3HZXA 3MWYW 3NQIA 4XDXA 3K59A 1CZWA 3HOUB 3A55A 3S15B 2AQ3B 2E76C 2F0QA 2NTSA 2K33A 1WVLA 4K8JA 1STAA 2O5IC 1HUMA 3HEJA 1LO5D 1E0BA 5ELDA 1X3PA 3T13A 1U4LA 1DOMA 1Q1BA 2FMCA 2PO4A 3NPPA 4RGOS 4C3IB 2A5HA 1A2TA 1LT4D 2M00A 2F1MA 3NTIA 4ILWA 1GJXA 3DHQA 5CMDA 4KJOA 4ME5A 2FFKB 4AYBB 1FGBD 2EE1A 2XN9C 4ABNA 5C0XJ 2JP1A 4BA1I 1SFOB 2PW7A 2WB1B 3PO2B 1AP0A 5I6YA 3GTPB 1I3QB 4DGZA 3NTHA 2X6LA 1G6ZA 5C4HA 4C3JG 2WINB 4OIJA 2LS01 5KGUA 2AQ1B 2SNMA 2EYMA 1WTRA 1I4HA 2ICIA 1DXMA 2K03A 3ITPA 1PRTF 2QEJC 1TVXA 2NBFA 3RZOB 5G3LD 1PFMA 2HDLA 1ICWA 3HOVB 3JAME 1B9NA 3I70A 2PW5A 1WD1A 1QWYA 4C3JB 1TY0A 4K5WA 3HS0C 1PZJD 5M3MB 3J81E 3HP3A 2K6AA 5A2QE 1A3TA 3M4YA 1Y69U 1DZ1A 5CV8A 2BCOA 2KJXA 1Q1EA 2HDMA 3DMUA 4FVMA 3D8GA 5JEAG 1GUWA 2RKSA 4IFDI 3PUWA 1T5XD 4RAUC 1K8OA 1F2MA 5EKIA 3MC0B 2KCNA 3M85A 4DAVA 2ZXRA 2CW0D 2F0TA 1QCBD 1I4GA 5I6WA 2WP8J 3D4WA 3SE0A 2R92B 3PUZA 4DF7A 1DD2A 4KY6A 2NVQB 2DY8A 2F3VA 4K5XA 4PNYA 1JICA 2BA1A 3HGBA 1EFID 5M5YB 4CBVA 2L4NA 5DAUA 2F0JA 1TWGB 3GTJB 1CTMA 3VR5A 5C0XG 4WJWA 3D31A 1TQOA 4EGVA 1UAPA 5DNFA 5CC4A 5IGFA 4A3FB 4MHEA 4NDXA 1GHKA 5C3WA 2BA0A 4EQPA 4RKLA 5FO9B 1EIHA 1I4PA 3QB3A 1AZQA 1DYQA 5CYUA 4OO1I 1TWHB 1LV9A 5EPJA 5K36G 4RCNA 2LMCB 1CHQD 1BXTA 3NK9A 1HFNA 5D14A 1U4RA 1I4QA 3KLSX 3L3OC 2ZT9C 4IURA 2OEOA 5EKKA 1H9SB 3H0GB 5D65A 3CRLC 1PMRA 2EYLA 3URYA 2F4IA 3KBGA 5E1FA 1WTQA 3NHHA 2Y0SB 3R8BA 1HPCA 4Q0FA 4RA8A 4L63B 3U9SA 3IFDA 2JEBI 1U9RA 3A8KE 3C3LA 1JWMD 2JYOA 4XIGS 4ZUJA 4I7ZC 2PPBC 2XRSD 2WKCA 3D3RA 5DM63 5JEAH 1VDZA 4BA2I 5FO7B 4XT1B 2ZXPA 1H9KA 4R8NA 1MSGA 2NVXB 3A54A 3FDTA 1SSOA 3RLFA 3V96A 3G7LA 4C3HG 1LTSD 1HUNA 1XTCD 4CJ0B 1KDCA 2BDNA 1L0XB 4IUTA 2FHTA 2FJ2A 4XYQA 1OXSC 1Q8IA 2F0EA 2NYZD 4TRDA 2A69C 5I4DA 2O2LD 1SYFA 2A68C 4KMUC 1ZYRD 5IT9L 3TZDA 5AFWA 1V43A 3A7AB 3MA2B 2AQ2B 1AFPA 1CZGA 3HOXB 5C0XH 3GTOB 2EYJA 3I72A 3HOWB 1FD7D 1EWHA 2L0CA 1KDAA 3BDLA 1B9MA 4I65A 4J8QA 4FF4A 4RHRA 2F0LA 2R3ZA 3NUCA 3OIQA 1STHA 1FNVA 1X32A 1SDFA 2PZTA 3MHBA 2SNSA 5EBDA 2LKVA 3I3CA 1HHVA 2D9UA 3RUZA 2IX1A 3VYTA 1S5DD 3NBIA 4CJ1B 1KLGD 5M9OA 5CR3A 2C9OA 4IZ8A 1TWFB 4KD3A 3OOCA 3MFYA 1LLRD 1SMYC 1Y8PB 2F0PA 2XVSA 3K5LA 2B2YA 2MHVA 1PTOC 2Q8TA 2SOBA 2RQXA 5JJZA 3A56A 1PRTB 4KD4A 4XQJA 1PFNA 2VNUD 2BE5D 5K36H 1MSHA 2EY5A 4RGNA 1TS4A 3I73A 3GV6A 1IKMA 5I2YA 3S2HB 1PZID 5I9PA 4A3BB 2QCPX 1LT6D 3E6ZX 4DK0A 4G7OC 1SE2A 1W6KA 3D6CA 1K83B 4FYDA 1HTLD 2EJFC 2EXZA 4WFN3 1V1PB 3R3OA 2KHSA 1HXYD 5E3FA 3PIP3 3S1NB 1Y8NB 2E74C 1MI2A 2EOTA 1D6EC 5JPMC 1BDOA 5C44B 1STEA 2D5DA 1CFMA 1Q12A 3M4OB 1QE6A 4KHZA 2EY1A 1PZKD 1GUTA 1I4RA 2B8FA 5F2DA 2PMZB 3FEWX 1O78A 3SK8A 3BDCA 3F2UA 5T1GA 4DAPA 4K6LA 1QB5D 1EEID 2I46A 4A3EB 3QIAA 2VUMB 2K7VA 5CV5A 1F9RA 4IN3A 4FO2A 1QNKA 2EZVA 3TP8A 2RSOA 3NXWA 1KAAA 1HFGA 2DN8A 1YNJD 2JE6I 2PZUA 3G6JB 3HRZC 2IT1A 4Y7NB 3D6WA 2K04A 2TMPA 3GTLB 3KF8A 2YYZA 3Q6SA 2MP1A 2A6HC 4RFBA 3I4MB 2KEEA 2PYKA 3NQTA 3ND9A 1S5ED 3ONAB 2MGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QOJ A;  5CV8 A;  4F8M A;  1SNM A;  3D6C A;  2ENB A;  4K8J A;  1STA A;  2EYH A;  1KDC A;  1SNP A;  2RBM A;  1NUC A;  1F2Y A;  2HQE A;  1EY6 A;  4N9P A;  3DMU A;  2EXZ A;  3HEJ A;  5JAV A;  1EY9 A;  1SYC A;  1JOR A;  4ZUI A;  3SXH A;  2F0O A;  5CV7 A;  4QB4 A;  3D8G A;  2F0U A;  5CV4 A;  3T13 A;  4J1M A;  3R3O A;  2F0E A;  2F0D A;  2RKS A;  2KHS A;  3C1F A;  4TRD A;  4WRD A;  3T16 A;  5E3F A;  2OXP A;  3VA5 A;  3U9O A;  1A2T A;  2EYO A;  2M00 A;  1SYB A;  3OMG A;  3SHL A;  5KEE A;  1A3U A;  1SYF A;  2EY2 A;  5KRU A;  2PZW A;  1EYA A;  3DHQ A;  4KTA A;  1EY5 A;  5C6A A;  4K2L A;  1TR5 A;  4MIU A;  1F2M A;  2F0S A;  3P75 A;  4KJO A;  4N9T A;  3V2T A;  3NK9 A;  4KV6 A;  4ME5 A;  4OL7 A;  3QOL A;  4ODG A;  5C4Z A;  3OSO A;  4PMB A;  4E6I A;  4HMJ A;  5CGK A;  5ISR A;  2F0T A;  1SNQ A;  3LX0 A;  3TP5 A;  1STG A;  3H6M A;  2OEO A;  1II3 A;  5EKK A;  1EYD A;  4DU9 A;  5I6W A;  2EY1 A;  4EQO A;  3S9W A;  2O4X A;  3SR1 A;  2F0K A;  1KDB A;  2PW7 A;  4K6D A;  5J39 A;  3D4W A;  1JOQ A;  2EYJ A;  5F2D A;  2EYL A;  2F0G A;  4B9X A;  2NUC A;  1STY A;  3SK5 A;  5I6Y A;  3SK8 A;  1KDA A;  4J6H A;  5E1F A;  3BDL A;  4I65 A;  1SND A;  4DF7 A;  5C5L A;  4DGZ A;  5C5M A;  3MVV A;  1STB A;  3BDC A;  3NHH A;  4KY6 A;  5IGB A;  3OMC A;  4LAA A;  5IIF A;  2EY6 A;  3D4D A;  2F0L A;  4QMG A;  3NUC A;  1KAB A;  2F3V A;  1EY8 A;  4H7B A;  4K5X A;  4PNY A;  3TP7 A;  4KY7 A;  1STH A;  5C4H A;  4ZQ3 A;  4ID6 A;  2OF1 A;  2F0M A;  4K14 A;  5KYL A;  2PZT A;  5K5P A;  2F0H A;  1EQV A;  3MHB A;  5KGU A;  1NSN S;  5NUC A;  2SNS A;  2EYF A;  5CV5 A;  1EZ8 A;  5HGT A;  5DAU A;  2LKV A;  2SNM A;  2EYM A;  4YIJ A;  5J22 A;  1ENC A;  2F3W A;  5KYI A;  3MXP A;  2F0J A;  1A2U A;  1U9R A;  4KHV A;  1A3V A;  4IUN A;  3ERQ A;  3ITP A;  1RKN A;  1JOK A;  4NKL A;  3RUZ A;  4EQN A;  3TP8 A;  4KJN A;  4RKB A;  3PMF A;  2EYP A;  1SYD A;  3P1H A;  4IAL A;  1JOO A;  4K2K A;  4QF4 A;  3NXW A;  5CV9 A;  5M9O A;  1KAA A;  3E5S A;  5CR3 A;  3MEH A;  3NP8 A;  4DFA A;  4K8I A;  1TQO A;  3C1E A;  4IZ8 A;  2RDF A;  3SK6 A;  5KIX A;  5J1Z A;  4KD3 A;  1AEX A;  4ZUJ A;  3EVQ A;  2WAC A;  1TT2 A;  4NP5 A;  2F0V A;  2F0P A;  5CC4 A;  4WOR A;  5IGG A;  5IGE A;  5IOC A;  2PZU A;  1SYE A;  5IOD A;  2F0W A;  5IGF A;  5JOB A;  1STN A;  3OWF A;  4K5V A;  5IGC A;  2SOB A;  4HTH A;  3SK4 A;  5HUR A;  5C3X A;  1EZ6 A;  4NDX A;  4EVO A;  4KD4 A;  1IHZ A;  4NMZ A;  1EY7 A;  3ERO A;  1EY0 A;  1EYC A;  3HZX A;  2PW5 A;  2F0N A;  1F2Z A;  1EY4 A;  5DEH A;  4HMI A;  5C3W A;  4R8N A;  1ENA A;  4K5W A;  2EY5 A;  3TP6 A;  4G57 A;  3MZ5 A;  5CV6 A;  4EQP A;  2PQE A;  1SNO A;  5EGT A;  5I9P A;  5IGD A;  3EJI A;  1SNC A;  3TME A;  2QDB A;  4RKL A;  4KY5 A;  2F0I A;  2F0F A;  2F0Q A;  4F7X A;  2PYK A;  1A3T A;  3NQT A;  4PMC A;  1SYG A;  2KQ3 A;  4S3S A;  5EKL A;  5I9O A;  3QB3 A;  4B9W A; 
#chains in the Genus database with same CATH topology
 1VF5 C;  3CCS A;  3DM1 A;  3KLS A;  1YHQ A;  5C3E G;  2JA7 H;  4Y52 H;  4JYA Q;  5JJL A;  1JQY D;  2R7Z G;  3MEF A;  2BOS A;  1BNZ A;  1VMC A;  3TZU A;  3EFX D;  2PNR C;  4DK6 C;  1ZKO A;  1Y1W G;  5CV7 A;  3H15 A;  1C9O A;  1KHI A;  1KNA A;  3MFG A;  4F87 A;  3MXN A;  4HED A;  2J4X A;  1VQA A;  3D4R A;  1MGS A;  1WTH A;  4K2L A;  2L55 A;  4DAY A;  3GTM H;  1AW7 A;  1TXY A;  1JT8 A;  4DV4 Q;  4HMJ A;  1PRT D;  1RD9 D;  3BVG A;  3ER0 A;  1LTI D;  1WCM G;  3TP5 A;  1QZH A;  2EJG C;  3M4Q A;  1JR0 D;  1IYJ B;  3I4N G;  4L5R C;  5LHY 1;  1KDB A;  1WJJ A;  5C3E B;  4K6D A;  5BR8 L;  1RIP A;  4JK1 C;  3JC6 6;  4HJ5 A;  4FF2 A;  3CCU A;  2R7Z B;  2NVT B;  5FLM G;  1OO9 B;  1STY A;  3CU7 A;  4NXM Q;  3ND8 A;  2HIX A;  3OMC A;  4NW2 A;  4DR7 L;  3D4D A;  1ENF A;  1UNS A;  3OW2 A;  4KHP Q;  1H9M A;  5H1S E;  4H44 C;  3KOJ A;  3S1Q B;  2Q2H A;  4UY8 C;  3JAM L;  1VQ8 A;  1HQM C;  1RDP D;  1SR3 A;  4FNF A;  5TSS A;  4CHT B;  1AZP A;  1QOH A;  4MTN A;  1PH9 A;  3PUY A;  1A6X A;  3RZD B;  1CSP A;  5M5W H;  3M4O H;  1HCZ A;  4G7H C;  1VQN A;  3J81 L;  3T1Y L;  5EPK A;  2PQA B;  1UEA B;  1SMX A;  5A2Q L;  1J5E Q;  1IKL A;  3A8I E;  4GZY C;  2ASB A;  4XQQ A;  3SVM A;  3M7G A;  5IOC A;  1B44 D;  1NCV A;  1TII D;  2F0W A;  2I5L X;  1N36 L;  1VQB A;  1N34 L;  1V8Q A;  2OCE A;  5IGC A;  2AWO A;  1Z9F A;  2CKZ B;  3F1Z A;  2B63 G;  1L0Y B;  2B2T A;  2IY5 B;  2VUM H;  2B3G A;  2QIL A;  4HMI A;  3CCM A;  4P2C B;  1M8A A;  3KDF B;  4ZCK A;  3F8T A;  4X3T A;  3TSS A;  2PQE A;  5LL6 X;  2XIW A;  3SGI A;  4DUY Q;  1MHW C;  5COR A;  3M3Y B;  1I94 L;  2G9H D;  4LFB Q;  3FPU B;  3KBX A;  5EKL A;  4A3I H;  4CDD C;  2JSO A;  4DR5 L;  4G4K A;  1KNE A;  4A3M H;  1EL0 A;  3I7F A;  1CKM A;  1F2Y A;  3OTO Q;  1EY9 A;  1CQF A;  2L15 A;  1TWA H;  1G2S A;  4HAE A;  2E2H H;  4GOP B;  1TY2 A;  5BN3 A;  2E2I B;  4JI2 L;  3JAM c;  3LWE A;  3M4P A;  4R4T A;  3KYH C;  3VA5 A;  1IW7 C;  2B63 B;  3A74 A;  3DEP A;  5C4X H;  4UAI A;  2EY2 A;  2GVA A;  3NBH A;  1GUG A;  4KTA A;  3TS2 A;  1PVO A;  2F0S A;  3FMC A;  3J81 c;  3K80 C;  3L7Z C;  1DOK A;  2Z9H A;  4ZRZ A;  2NB0 A;  5IP9 H;  4BXX H;  2VQF Q;  1G6P A;  3KJO A;  1II3 A;  3Q24 A;  3S9W A;  2MUY A;  3S16 H;  2VB3 X;  2N78 A;  2A6E C;  3PO3 B;  2X69 A;  3GTQ H;  2D62 A;  1FNW A;  1CKO A;  4UP7 A;  1OXV A;  2MO1 A;  3OPO A;  1PXU A;  5IGB A;  4FDB A;  2NVY B;  2DNC A;  3U58 A;  4X62 Q;  2ICE C;  2K1B A;  3MTS A;  1S40 A;  1KAB A;  3J7A V;  3WWV A;  1B50 A;  4ZQ3 A;  5FJ8 H;  4DV0 L;  1L1O A;  4UDU C;  1XXG A;  3KF6 B;  1ONL A;  3CCQ A;  4KLK A;  4LUO A;  2JXM B;  3HKZ E;  1TS3 A;  1HNX Q;  3HOZ B;  3S1R B;  5KYI A;  4JI7 L;  1BVS A;  1PV4 A;  2NN6 G;  4QF4 A;  4A3K G;  2K5H A;  3NTK A;  5FLX E;  2XSC A;  3PUV A;  1TT2 A;  4BBS H;  5ELC A;  5IOD A;  2B2Y C;  1Y1W H;  2Z8L A;  3H09 A;  2C35 B;  2R93 G;  4IUP A;  1ESF A;  4ME3 A;  4C1N K;  4ULL A;  1X3E A;  2JA5 B;  4PMW A;  2B39 A;  1B1Z A;  4G57 A;  4GLA C;  3TP6 A;  2FIN B;  5AJ3 L;  1UE1 A;  5M5X B;  3G4S A;  5BN4 A;  1TWC H;  2B2U C;  1HA6 A;  4BY1 G;  5BR8 Q;  3X3M A;  4PMC A;  3MXG A;  1WCM H;  4DR4 L;  3A8J E;  3K0Y A;  3I4N H;  2AKW B;  1O7L A;  3TDQ A;  3U50 C;  3IRB A;  1JWS D;  3IL8 A;  4JI4 L;  3ICE A;  2K01 A;  4LF8 L;  3AMU A;  4DNT B;  2HT1 A;  3NWT A;  2KHJ A;  1CK1 A;  2HUG A;  5EQ0 A;  1N33 L;  2CCZ A;  1FVI A;  5CV4 A;  1LT3 D;  2F0D A;  4WRD A;  4OO1 G;  3CPW A;  1VQ4 A;  4H02 A;  4P72 A;  2RA4 A;  1QUQ B;  2VS1 A;  4PQX A;  1VCI A;  2F52 A;  3P75 A;  4KV6 A;  4RHS A;  1AH9 A;  1PH3 A;  4P73 A;  2P5Z X;  3MXU A;  1N9W A;  3H3V H;  3D0F A;  3UDF A;  3HOY B;  1N36 Q;  2AWN A;  2V1C C;  1SJH D;  5J39 A;  5EPL A;  3R2T A;  2C5C A;  4L8J A;  3OHX C;  3BJU A;  3SK5 A;  5JJK A;  4HSP A;  1SND A;  4C1N I;  1D2B A;  1HJP A;  4LAA A;  5IIF A;  2EY6 A;  4TVA B;  1WD0 A;  1LTT D;  1D1K A;  2K32 A;  3SEB A;  5KYL A;  3BYY B;  1I94 Q;  4OWW B;  2QDL A;  2A69 D;  4IQZ A;  1F77 A;  3EN2 A;  1GHJ A;  1ENC A;  4M8A A;  1EQQ A;  4IUN A;  3BDO A;  5ELB A;  4FF3 A;  4EQN A;  1OXT A;  4KJN A;  1H9J A;  4A3G G;  2EYP A;  1SYD A;  2ZJR A;  3MEH A;  1GKH A;  1NR4 A;  2RDF A;  1Q8K A;  5C4J B;  2JA8 B;  1AEX A;  2LFN A;  4BY7 G;  1STN A;  4TKO B;  2Y0S E;  4UPA A;  3T1H Q;  1X55 A;  2E5L Q;  5I2X A;  2EPB A;  5IYB H;  1ENA A;  2J0T D;  1F9Q A;  4LF6 L;  3VYU A;  3K5O A;  1JE5 A;  2B2V A;  1D1I A;  5EGT A;  1AE3 A;  1FYC A;  1PDQ A;  4F7X A;  4RWS C;  4DAM A;  4QIW E;  3Q0A A;  2KQ3 A;  3CPF A;  1N32 Q;  3F2B A;  4JI3 L;  1B3Q A;  3L9A X;  4F8M A;  3AYH B;  3S1M B;  4DR3 L;  4OIK A;  1E2Z A;  4ZAI A;  4WJ3 M;  3K5N A;  1PTO H;  1Z6H A;  4QUC A;  2GA4 B;  3TN2 A;  1YJW A;  3UDI A;  4DK1 A;  1X54 A;  2K5N A;  1SYC A;  4BY7 B;  1BBX C;  3W3A A;  3S14 H;  5A35 A;  3HKS A;  4ZKC B;  3N52 A;  3FPP A;  1Q82 C;  1IL8 A;  1Q3L A;  4FXK C;  3OMG A;  1EYA A;  1X65 A;  4JI7 Q;  1SE3 A;  4N9T A;  4HCS A;  3AB9 A;  2OQ0 A;  2VL6 A;  1CA6 A;  2MNA A;  1VQF A;  4IO9 A;  3H3V C;  1JWU D;  1YNN C;  1J9O A;  4KKU A;  2NN6 H;  2M2L A;  4DV5 L;  4DU9 A;  4A3K H;  3RNU A;  3SR1 A;  1D5M C;  2RVL A;  3J80 E;  1YNX A;  2F0G A;  4B9X A;  2NUC A;  4UP9 A;  1LTA D;  1SE8 A;  2NWG A;  5LMN L;  2H4O A;  2UUB L;  3K7A H;  3QO2 A;  5IWA L;  1FR3 A;  2R93 H;  3ULP A;  4KY7 A;  4V0B A;  1G51 A;  1I6H B;  4ID6 A;  4GN5 A;  4K14 A;  4JC0 A;  4FXD A;  4X3U A;  3R2I A;  1T9H A;  5NUC A;  5HGT A;  1JB3 A;  4C3H B;  1EFW A;  1EZ8 A;  4DR4 Q;  1PYB A;  3DLL A;  3CRK C;  1JC7 A;  1SE4 A;  4GN3 B;  4BY1 H;  1M4V A;  2WAQ E;  4A93 B;  1IXR A;  1S4Z A;  2HHH Q;  2RDH A;  1CI3 M;  2UU9 Q;  1JOO A;  3GQB A;  2XWJ B;  4POG A;  1E3P A;  2K52 A;  5LL6 S;  4PZ7 A;  4BBR H;  2EJM A;  2WAC A;  1GXD C;  1NAP A;  2F0V A;  1GOZ A;  4KKS A;  2DNE A;  2R6G A;  2IJ0 A;  2PI2 E;  1PTO F;  4OO1 H;  3ERO A;  1EY0 A;  2JA6 B;  2B2T C;  3GTK H;  3S17 B;  3RMH A;  5DEH A;  1VQE A;  1K0R A;  5GQO A;  1E2W A;  4A3C G;  1V1P A;  1XWE A;  2AUK A;  3TEH B;  5JPN C;  3TME A;  2QDB A;  3A0J A;  3CHB D;  2F0I A;  1V1O A;  4DV4 L;  2JA7 B;  2PNH A;  1SYG A;  1I6V C;  1I4X A;  4ZKB B;  3BU2 A;  3E0J A;  4JBW A;  4DXG A;  2XGT A;  1AN8 A;  4QJF A;  5T1I A;  1WTO A;  1KTK A;  5J3B A;  4B3R L;  5IE8 A;  5JAV A;  4HJA A;  4H0L C;  1ET9 A;  3W1G A;  2F0O A;  4NXM L;  4ZYS A;  1EU4 A;  1ILP A;  2F0U A;  1BCP F;  4HN7 A;  1YHA A;  1LTB D;  2B2W A;  4XT3 B;  3GTM B;  1K3B C;  1D7Q A;  1S5C D;  4IPD A;  4XXE A;  4MIU A;  1B2T A;  4OL7 A;  4ODG A;  4CDC C;  4OWT B;  4PMB A;  3W5O A;  5IT9 E;  1EIY B;  3I90 A;  3VR2 A;  4A3G H;  1J5E L;  1BCP C;  1IBM Q;  2N8N A;  1HQR D;  1R4P B;  1BUV T;  1SBB B;  1I50 H;  2K05 A;  1FL0 A;  1F9P A;  1C4Q A;  1LM0 A;  1VF7 A;  3TP7 A;  2HD3 A;  2E75 C;  1X3Q A;  1L1O C;  2CVR A;  5COY A;  2B29 A;  1LT5 D;  1CKN A;  1ET6 A;  4X3S A;  2JA9 A;  5M5W B;  2EYF A;  3EQL C;  2ZJQ A;  4A3I G;  1ZYR C;  2KED A;  3MXP A;  1P8L A;  4A3M G;  4JVZ A;  3CKI B;  3P1H A;  1JCK B;  5JJI A;  3UDX A;  1DGS A;  2KCT A;  1A8V A;  1BF4 A;  1QJO A;  1PYW D;  4JW0 A;  5D3D A;  2F03 A;  1RTO A;  1EUJ A;  1HZB A;  1C8C A;  3SK4 A;  1UEB A;  4R8I A;  5C3X A;  2JN4 A;  4A3J G;  4NMZ A;  3CCR A;  3J7Y W;  4YHH Q;  1EYC A;  1QZG A;  1F2Z A;  2I5M X;  1OTC A;  1R9T H;  5IP9 G;  2BH8 A;  3IKJ A;  3MZ5 A;  3NE5 B;  1VQP A;  3TRZ A;  4DV5 Q;  5ELO A;  4A3I B;  1HZA A;  4R4O A;  3J81 j;  1C7Y A;  4A3M B;  2R61 A;  1HTP A;  2IX0 A;  2VQF L;  3PUX A;  3QOJ A;  4P71 A;  1ML0 D;  1UE5 A;  1DJR D;  1TWA B;  1XNQ Q;  4HCE A;  1KXL A;  2LY7 A;  2E2H B;  4DKA C;  1EIG A;  2Q2I A;  3DEO A;  4IFD J;  1EIF A;  1X3F A;  1NMF A;  5C4X B;  3CW2 C;  3FKI G;  3C1F A;  4OWX B;  4X62 L;  3K57 A;  2QA4 A;  2OXP A;  4JI5 Q;  5E4W C;  2AHO B;  4CKC A;  5KRU A;  5C6A A;  2KUM A;  1HNX L;  1DCZ A;  3HOU G;  2G9D A;  4E6I A;  1PA6 A;  3S16 B;  3DUZ A;  2L9H A;  2I07 B;  2Z4I A;  3O13 A;  3GTQ B;  4DR6 Q;  3PSI A;  4BBS G;  1TU2 B;  3FRP B;  4YY3 Q;  2F0K A;  3CCE A;  2M9V A;  4RH6 A;  1S5F D;  3EA6 A;  3GTG H;  3MVV A;  1MD2 D;  1C48 A;  4N8X 1;  2CFM A;  4LUZ A;  1JMC A;  1NJI C;  1A15 A;  3K6O A;  4XYO A;  1XX8 A;  3KLW A;  1TS2 A;  3DWP A;  4XQN A;  2ATW A;  1IW7 D;  4A3C H;  2K5W A;  2UXB Q;  3A7L A;  1Y1V H;  4B3R Q;  1NBW A;  4K2K A;  1HH2 P;  2YU9 H;  3LNN A;  4A4I A;  4BBS B;  1LTG D;  1F2L A;  2N88 A;  2SEB D;  2WII B;  4DFA A;  5CBE E;  3CCL A;  1Y1W B;  3C1E A;  2EDG A;  2L1B A;  3SK6 A;  1IBL Q;  3EVQ A;  4J15 A;  2RDG A;  5IGE A;  1EQT A;  1SYE A;  3K58 A;  4PV1 C;  1WTV A;  1O7Y A;  3OWF A;  1ZEQ X;  2A6E D;  2KBN A;  3PO2 G;  4HTH A;  4O2D A;  3KF8 B;  4LWC A;  1CSQ A;  5EJW A;  4AYB E;  1VMP A;  2ID0 A;  1MJE A;  1TWC B;  1K3R A;  3GD7 A;  4FP5 D;  4EX5 A;  1WCM B;  2B2V C;  4A3D H;  1SNO A;  2WB1 E;  1RJT A;  3LWU A;  3I4N B;  1DOL A;  3F2D A;  2FMM A;  4S3S A;  4ZUI A;  4JCV E;  5KNC A;  1O7Z A;  4DR1 Q;  1IYV A;  2KCC A;  1YNJ C;  1RCV D;  1JOR A;  1B70 B;  1RF2 D;  2F3I A;  3BYT B;  3S2D H;  2QEX A;  3U9O A;  2E2J H;  4X65 Q;  4IOC A;  3OW7 A;  2PZW A;  3NEL A;  2E2D C;  3OYY A;  3PF5 A;  4C2M H;  4XTC S;  5JVH 3;  3OSO A;  4O0A A;  3CC4 A;  4B3S Q;  2Z4H A;  5CGK A;  5IYC G;  4DV2 Q;  4OGQ C;  3DWA A;  4EQ5 A;  5BN5 A;  2D0P A;  4YCU A;  1XYI A;  3KF6 A;  1G8Z D;  1JOQ A;  2A73 B;  2ZTC A;  2A74 C;  5FLX L;  1VQD A;  5DM7 3;  5GAD C;  1IL2 A;  2K5D A;  3CQZ H;  1HA5 A;  5C5L A;  1PH5 A;  2Q8R E;  2RCN A;  4IFD G;  3F2C A;  2KVM A;  2L11 A;  5IYB G;  2HQL A;  3T1H L;  2QGQ A;  1SXT A;  4A3J H;  2YTX A;  4O42 A;  2UUC Q;  4M1U B;  2E5L L;  1E22 A;  2VQE L;  1EQV A;  5FKA C;  1NR2 A;  3W1B A;  1SAP A;  2Q8I B;  4BWG B;  4NXN L;  4YIJ A;  5J22 A;  2KOL A;  1PRT C;  3ERQ A;  2HCI A;  2DJG C;  1QVC A;  1OXX K;  1N32 L;  4V19 0;  1G91 A;  3E5S A;  3HKZ G;  2N55 A;  3R93 A;  3ERS X;  4CGY B;  2JJQ A;  3PIO A;  4JBM A;  4DUZ L;  2CQA A;  1WI5 A;  2Z1C A;  4L6T B;  1S5B D;  3E3X A;  5IGG A;  3HFZ B;  5GAH C;  2E8G A;  3C46 A;  1Y8O B;  1D8L A;  3FKI H;  2Z6K A;  3TBI B;  3V05 A;  1AE2 A;  3VYR A;  1YEZ A;  2R92 G;  4DXF A;  1JJ2 A;  1JJC B;  2R7D A;  3P20 A;  1PFB A;  4O1N A;  1YVC A;  1EY4 A;  1F9S A;  1D5Z C;  2DGY A;  3SDZ A;  5M3F H;  4OXP A;  5HY6 A;  3EJI A;  1SNC A;  1KLU D;  2ZXO A;  3HOU H;  1BBU A;  5EAY A;  4DN4 M;  2F0F A;  5K5P A;  3S15 H;  4X3K A;  1PTO B;  1UUP A;  1GO3 E;  5CV9 A;  5FLX c;  4JBJ A;  3I91 A;  1K8G A;  1QUQ A;  3WOF A;  2NZO A;  3HG9 A;  3HKZ B;  3S14 B;  3BVM A;  2CQO A;  4JBK A;  2ENB A;  1NTG A;  3NSW A;  1VQM A;  5G3L F;  3DWQ A;  1ESR A;  2H1E A;  1O80 A;  2K28 A;  2IL8 A;  4J1M A;  2N3S A;  2B2W C;  1U4P A;  1CUK A;  3K8A A;  4Z9C B;  3RD4 A;  1A3U A;  4DR2 Q;  5ELN A;  1Z47 A;  4C3I H;  4KK7 A;  1D5X C;  3PGZ A;  4A3K B;  5C4Z A;  1P16 A;  2K50 A;  3T4A C;  5LMU L;  2KA7 A;  3STB D;  4BBR G;  1BCP B;  3GV3 A;  3J80 i;  1EWC A;  2UU9 L;  2HHH L;  3C2P A;  4EQO A;  2O4X A;  4U67 3;  2YTY A;  2NN6 I;  1NNX A;  3VR6 A;  2Z6B A;  3K7A B;  1WYD A;  1G2T A;  2K5V A;  1SJE D;  1H9S A;  4BS9 A;  1SFO H;  4DV6 Q;  2R93 B;  3PO2 H;  4RGM A;  5IP7 G;  3GTP H;  2H5X A;  1I3Q H;  1BO0 A;  4C56 C;  1XMQ L;  2F0M A;  4U68 A;  3GP7 A;  3M9B A;  4BY1 B;  1GUN A;  3QJY A;  1W3S A;  2VXW A;  4HIO A;  1W6J A;  3KUP A;  4IUV A;  4HSV A;  1A2U A;  2RSN A;  1XNR Q;  5FK9 C;  3N6R A;  3VR3 A;  3WOE A;  3OWE B;  4BBR B;  3PMF A;  5C0X I;  1SEB D;  1GUS A;  1VQG A;  2CWP A;  2RHS B;  1YNN D;  5HGQ A;  2IW3 A;  3J7A F;  4OON A;  1PLF A;  1CHP D;  1I5F A;  1LTR D;  1FJG Q;  3GTK B;  4PZ8 A;  5KND A;  3RZO H;  2XTI A;  3CP0 A;  4EVO A;  1KRT A;  1IHZ A;  1EY7 A;  2LXK A;  4GNX C;  2XRQ D;  1FGU A;  5FOB B;  1HNW Q;  3HOV H;  3Q22 A;  4DV7 Q;  1BBW A;  2CW0 C;  2Y0S G;  2A68 D;  3NEN A;  4MZ9 A;  3I8Z A;  1DON A;  4C3J H;  5IGD A;  1CQV A;  2K4K A;  1QG7 A;  5M3M H;  5IYC H;  5I9O A;  1R4Q B;  3K0X A;  1GUO A;  4B9W A;  2IX3 A;  4IJL A;  3KFU A;  1B53 A;  1JE4 A;  1SNP A;  2RBM A;  2HQE A;  1TS5 A;  1EY6 A;  1IBM L;  3DXJ C;  1WFQ A;  2CHB D;  2JEA I;  4L5T A;  3J80 L;  2VQE Q;  3T53 B;  4QB4 A;  4IFD H;  1YIJ A;  3WDN A;  2GN5 A;  1A62 A;  3BS1 A;  2XNA C;  4NXN Q;  2EYO A;  2XWB B;  2HCC A;  5KEE A;  3VA7 A;  1EY5 A;  1V1Q A;  1B4O A;  1J8I A;  2Q2U A;  4A3G B;  3PCO B;  2K14 A;  4G7Z C;  1V9P A;  4DUZ Q;  1SNQ A;  1YZ6 A;  3CF5 A;  1WTW A;  4JPB W;  1U0L A;  5E4X A;  2DY7 A;  1I50 B;  2KCM A;  4CKB A;  3OIP A;  4QIW B;  3J7A 5;  1SMY D;  1RHP A;  2K75 A;  4JI1 Q;  1STB A;  1LAB A;  2RCF A;  1PTO D;  4QMG A;  2R92 H;  4YHH L;  2KEC A;  3MAQ A;  2NVQ H;  1CA5 A;  1EOT A;  1HR0 Q;  4GKK L;  1VQI A;  3H91 A;  4GKJ L;  4OEL B;  4RGT A;  3PF4 A;  4QCL A;  1K0S A;  2F3W A;  3G71 A;  4KHV A;  2IWH A;  5M5Y H;  1U4M A;  4KI0 A;  4IAL A;  3T51 B;  5L37 A;  4DNR B;  1TWG H;  3W2D A;  3J80 c;  3GTJ H;  3CXC A;  2D2C C;  1XNQ L;  5KIX A;  4F88 A;  2WAQ G;  1B3A A;  1EWI A;  4MN3 A;  4WOR A;  4DA2 A;  1H9R A;  4LF4 L;  5JOB A;  1BCP D;  1R9T B;  3AU7 A;  1EZ6 A;  1TKW B;  3BZC A;  4LFA Q;  2DJF C;  3I4L A;  2IPK D;  4RMF A;  3H94 A;  4JI5 L;  4HR7 B;  5LMU Q;  1HR0 W;  4A3F H;  2WKD A;  5CV6 A;  4ZK9 B;  4YCW A;  3BZD B;  4KY5 A;  3ULJ A;  2F4V L;  1C0A A;  1K8A C;  1O7I A;  1MBY A;  4DR6 L;  5ELF A;  4YY3 L;  2BH2 A;  4N9P A;  2WV6 D;  2WAQ B;  1XMQ Q;  4YCV A;  3SXH A;  4B08 A;  2AUJ D;  1CM9 A;  2BDO A;  2TSS A;  5IP7 H;  3QG1 A;  2Z0S A;  2L12 A;  3NWS A;  1SYB A;  1TWH H;  2NTT A;  4IUU A;  2NZ1 D;  3I55 A;  1QVF A;  2PCF B;  1Y1V G;  3V2T A;  2K5Q A;  3QOL A;  4CJ2 C;  2VZA A;  4AIM A;  2MPM A;  4R1J A;  2R7F A;  1BQQ T;  2UXB L;  1STG A;  1DM0 B;  3AEV A;  4A3B G;  3GTG B;  1IYU A;  3UI2 A;  3KK7 A;  3CCJ A;  3IFT A;  4TQU S;  3CC2 A;  1IBL L;  1LAC A;  3H0G H;  5DLQ E;  5ELE A;  3K5M A;  3I2Z A;  3PIO 3;  3UDG A;  4ZLT F;  4R9W A;  1VQ5 A;  1A0I A;  1EY8 A;  3CME A;  1FNU A;  2OT2 A;  3A5Z B;  1UE7 A;  4KN4 C;  4A3D G;  4JG2 A;  2OF1 A;  4LK1 C;  1NSN S;  3T56 B;  4LFC Q;  1Y1V B;  1ZXT A;  5IT9 c;  2YU9 B;  2A6H D;  3KLR A;  1JOK A;  4NKL A;  4YWM A;  1MIU A;  3Q8D A;  1YI2 A;  4CKE A;  1RL2 A;  1X3G A;  3CMA A;  4HID A;  4L5Q A;  3NP8 A;  2B2U A;  1VQJ A;  4MTK A;  4DR1 L;  4P74 A;  3FVQ A;  4IPH A;  5J1Z A;  1E2V A;  4NP5 A;  1K8M A;  4QGU A;  3G6E A;  2LSS A;  1BR9 A;  2QKI C;  1EYG A;  2Z6K C;  4LJZ C;  1OXU A;  5HUR A;  1G29 1;  5E7N A;  1KIX A;  1ILQ A;  1LUZ A;  2F0N A;  2KHI A;  1YHB A;  3VR4 A;  5GAG C;  4A3D B;  4LF9 L;  4X65 L;  3UE1 A;  2MJ8 A;  4KN7 C;  1WTP A;  4WJ4 A;  3M7N A;  3UE0 A;  4A3E G;  1WTX A;  2VB2 X;  2PMZ E;  4B3S L;  4RCO A;  1ASY A;  2NVX H;  4LF5 Q;  1VS0 A;  4DV2 L;  5EBC A;  3IAY A;  1SNM A;  1PH6 A;  2O5J C;  2EYH A;  5JVG 3;  4JV5 Q;  4OHJ A;  1NUC A;  1EEF D;  4IUQ A;  3S2D B;  3U4Z A;  4FXG C;  5IY0 A;  2E2J B;  4H13 C;  1RTN A;  4GKK Q;  4QUF A;  3FP9 A;  5CBA E;  3T16 A;  4GKJ Q;  2B8G A;  1HRJ A;  3RLO A;  4C2M B;  2ZM6 Q;  2UUC L;  3SHL A;  4IPG A;  2DUD A;  4TSS A;  4B3M L;  4JI6 L;  3VYS A;  3U4V A;  1TR5 A;  3BG3 A;  1BOS A;  1Q90 A;  2SDF A;  2OTJ A;  1XPR A;  2V4D A;  4IPC A;  5ISR A;  3LX0 A;  4POF A;  3H6M A;  1EYD A;  2L5T A;  4LF4 Q;  2ALY B;  2YV5 A;  3CQZ B;  3PV0 A;  4HJ9 A;  3GO5 A;  1YBY A;  3P7J A;  4YWK A;  1KL9 A;  3HOX H;  4A3J B;  5KNB A;  5FO8 B;  4J6H A;  1K73 C;  2BE5 C;  5C5M A;  3GTO H;  1M90 C;  3HOW H;  1CT1 D;  2X6G A;  1JJG A;  4H7B A;  4LMQ D;  5M3F G;  3X3N A;  1QIL A;  2WFW A;  2F0H A;  3K7U C;  2F4V Q;  1EU3 A;  4A76 A;  3ZYY X;  1K9M C;  2ZTD A;  2J7Z A;  1X9N A;  1A3V A;  1Z7T A;  1RKN A;  1ASZ A;  3I56 A;  1YJ9 A;  2Q2T A;  1QNU A;  4RKB A;  4DV3 Q;  4JI8 Q;  2CH4 A;  1Q7Y C;  3Q23 A;  2UUA Q;  3BVZ A;  3TRE A;  4K8I A;  1T5E A;  3FKI B;  2YTV A;  4Q5V A;  2PQA A;  5JEA J;  2QF7 A;  3QWN A;  4GNX B;  3CC7 A;  1TWF H;  5LMN W;  4K5V A;  2EVB A;  1ROD A;  4KKT A;  1B7Y B;  5D3I B;  4C3I G;  4FF1 A;  5M3F B;  3HZX A;  3MWY W;  3NQI A;  4XDX A;  3K59 A;  1CZW A;  3HOU B;  1XPU A;  3A55 A;  4DR2 L;  3S15 B;  2AQ3 B;  1KAW A;  4AYB G;  2E76 C;  1QVG A;  2GVB A;  4R4Q A;  3KDF A;  2F0Q A;  2NTS A;  1VQO A;  2K33 A;  3S2H H;  1WVL A;  4A3B H;  4AQY Q;  2WB1 G;  4K8J A;  1STA A;  3RLN A;  2O5I C;  4X64 Q;  1HUM A;  3HEJ A;  1N8R C;  1HNZ Q;  1LO5 D;  3KJP A;  4DV6 L;  1K83 H;  1E0B A;  3LGJ A;  3GDE A;  1X3P A;  5ELD A;  3T13 A;  3RN5 A;  1U4L A;  1DOM A;  1VQH A;  1Q1B A;  2FMC A;  2PO4 A;  3NPP A;  4RGO S;  4C3I B;  2A5H A;  1A2T A;  1LT4 D;  2M00 A;  4GOP A;  2F1M A;  3NTI A;  1YIT A;  4ILW A;  1GJX A;  3DHQ A;  5CMD A;  4KJO A;  3E0E A;  3S1N H;  4ME5 A;  2FFK B;  4AYB B;  1FGB D;  2EE1 A;  2XN9 C;  1XNR L;  4ABN A;  5C0X J;  2JP1 A;  5C44 H;  3ULL A;  4BA1 I;  1SFO B;  2I5H A;  3MXN B;  4JOI A;  2PW7 A;  2WB1 B;  3PO2 B;  1AP0 A;  3AFQ A;  4DAY B;  5I6Y A;  1I3Q B;  3I4O A;  3GTP B;  4DGZ A;  3NTH A;  4LF9 Q;  1MJC A;  3HOV G;  1FJG L;  2X6L A;  4YWL A;  1G6Z A;  5C4H A;  2HIV A;  4C3J G;  2WIN B;  4OIJ A;  1U5K A;  2LS0 1;  4OX9 L;  1HNW L;  4DV7 L;  5KGU A;  5M3M G;  2AQ1 B;  4PG3 A;  3TS0 A;  4DPG A;  2SNM A;  4A3E H;  2EYM A;  1WTR A;  1I4H A;  2ICI A;  4UP8 A;  3H3V I;  1DXM A;  2K03 A;  3ITP A;  1NY4 A;  1PRT F;  2QEJ C;  1TVX A;  4K0K Q;  2NBF A;  3E9I A;  3RZO B;  5G3L D;  1PFM A;  3PO3 G;  2HDL A;  3CCV A;  4B3M Q;  1ICW A;  4JI6 Q;  3HOV B;  4LF7 Q;  3VDY A;  3JAM E;  3B6Y A;  1B9N A;  3I70 A;  2A8V A;  2PW5 A;  4Y7N H;  1WD1 A;  2I0Q A;  2QW7 A;  3CD6 A;  1QWY A;  4C3J B;  1TY0 A;  4K5W A;  3HS0 C;  1PZJ D;  5M3M B;  4UHV A;  3GTL H;  3J81 E;  3HP3 A;  2K6A A;  2OTL A;  1KRS A;  5A2Q E;  1A3T A;  3M4Y A;  3AQQ A;  1Y69 U;  3HOZ G;  1X6O A;  1DZ1 A;  5CV8 A;  3I4M H;  2BCO A;  4LNQ A;  2KJX A;  1Q1E A;  2HDM A;  3DMU A;  2UXC Q;  4GS3 A;  4FVM A;  3D8G A;  4JI1 L;  5JEA G;  1GUW A;  2RKS A;  1GVP A;  1IBK Q;  4IFD I;  4B3T Q;  3E9H A;  3FHW A;  3PUW A;  1T5X D;  4RAU C;  1K8O A;  1F2M A;  5EKI A;  1HR0 L;  3MC0 B;  2KCN A;  4X6A H;  3M85 A;  4DAV A;  1GM5 A;  2JA5 G;  2ZXR A;  2CW0 D;  3AFP A;  2F0T A;  1QCB D;  1I4G A;  5I6W A;  2WP8 J;  4DV1 L;  3D4W A;  4LW1 A;  4CDE C;  3SE0 A;  1PH4 A;  3NBH B;  2EQS A;  2R92 B;  3PIP A;  3PUZ A;  4DF7 A;  5C3E H;  2VW9 A;  1DD2 A;  3QR8 A;  4KY6 A;  2NVQ B;  4A3F G;  2R7Z H;  2NVT H;  2DY8 A;  2F3V A;  4A75 A;  4K5X A;  4PNY A;  2RHQ B;  4LFA L;  2A1A A;  1JIC A;  2CH4 W;  2BA1 A;  3HGB A;  1KC8 C;  1EFI D;  5M5Y B;  2D0O A;  1EOV A;  4CBV A;  1MKH A;  3DM3 A;  2L4N A;  5DAU A;  1LTL A;  2MQH A;  4QY7 A;  3S1Q H;  2F0J A;  1TWG B;  4QQB X;  2VY3 A;  3GTJ B;  1CTM A;  3TQY A;  3VR5 A;  1L0W A;  5C0X G;  3RZD H;  1PH8 A;  4WJW A;  3D31 A;  1TQO A;  4RG1 A;  1L1O B;  1IZ6 A;  4EGV A;  3HOY G;  1SLJ A;  1UAP A;  5DNF A;  5CC4 A;  2ZJP A;  5IGF A;  4DR7 Q;  2FXQ A;  4A3F B;  4MHE A;  5FLM H;  4NDX A;  1XMO L;  1NMG A;  1GHK A;  1GD7 A;  5C3W A;  2BA0 A;  4EQP A;  2NZH A;  4APV A;  1PH2 A;  4OEM B;  4RKL A;  2JQO A;  4MNO A;  1VQ6 A;  5FO9 B;  1EIH A;  1I4P A;  3T1Y Q;  3QB3 A;  1Q86 C;  1KQS A;  1AZQ A;  5GAE C;  3H0G G;  3M3Y H;  4A3L G;  4X66 L;  1DYQ A;  4DNI A;  4DK3 C;  1N34 Q;  1VQL A;  4OX9 Q;  5CYU A;  4OO1 I;  2JA8 G;  1TWH B;  1LV9 A;  1PYS B;  5EPJ A;  2JK8 A;  3S24 A;  5K36 G;  4RCN A;  2LMC B;  1CHQ D;  2E2I H;  2IHF A;  3BZK A;  1BXT A;  2B63 H;  3NK9 A;  4LFC L;  1HFN A;  5D14 A;  1U4R A;  1I4Q A;  3KLS X;  3L3O C;  2ZT9 C;  4IUR A;  5GRO A;  4DR5 Q;  2OEO A;  5EKK A;  1H9S B;  4R4I A;  3H0G B;  5D65 A;  3CRL C;  1PMR A;  1HZC A;  2EYL A;  3URY A;  1NE3 A;  2F4I A;  4GLX A;  3KBG A;  5E1F A;  1WTQ A;  4JI2 Q;  3NHH A;  3PO3 H;  4L5S A;  2Y0S B;  1PFS A;  1PH1 A;  3R8B A;  2NVY H;  4NPS A;  2UXD L;  1HPC A;  2OQK A;  1VQK A;  4Q0F A;  4RA8 A;  3PQI A;  4L63 B;  4JI0 L;  3U9S A;  3IFD A;  2CWA A;  2JEB I;  1U9R A;  4N8F A;  2LXJ A;  2MFI A;  3STB C;  3A8K E;  3HOZ H;  4LF5 L;  3S1R H;  1KD1 C;  3C3L A;  1J6Q A;  1JWM D;  2MO0 A;  2IHE A;  2JYO A;  4XIG S;  4JV5 L;  4ZUJ A;  4I7Z C;  2PPB C;  1E7Z A;  2XRS D;  2WKC A;  1X56 A;  3D3R A;  5DM6 3;  5JEA H;  1VDZ A;  4BA2 I;  1M1K C;  1VQ7 A;  5FO7 B;  4DV0 Q;  4XT1 B;  2ZXP A;  1H9K A;  2A19 A;  2ZM6 L;  4R8N A;  1MSG A;  2NVX B;  3A54 A;  3FDT A;  4DV1 Q;  1SSO A;  3RLF A;  3V96 A;  2JA5 H;  3G7L A;  4C3H G;  4AH6 A;  5M5X H;  4CDF C;  3HOX G;  1LTS D;  1HUN A;  2PI2 A;  4A93 G;  1XTC D;  4CJ0 B;  1KDC A;  1H95 A;  3HOW G;  2BDN A;  1L0X B;  4IUT A;  2FHT A;  4HJ7 A;  2FJ2 A;  4XYQ A;  1VQC A;  3K81 C;  1OXS C;  1Q8I A;  2F0E A;  2NYZ D;  4TRD A;  2A69 C;  5I4D A;  2O2L D;  4GOP C;  1SYF A;  2A68 C;  5AJ3 Q;  2G5D A;  1JB7 A;  2JA6 G;  4KMU C;  1ZYR D;  5IT9 L;  3TZD A;  4I7A A;  5AFW A;  1V43 A;  3A7A B;  3MA2 B;  5IYD G;  2AQ2 B;  4IJH A;  1AFP A;  1CZG A;  1SRU A;  4DV3 L;  4JI8 L;  3A5U A;  3HOX B;  5C0X H;  4JOI C;  4JI4 Q;  2UUA L;  2JA7 G;  1SRO A;  3GTO B;  2EYJ A;  4LF8 Q;  3I72 A;  3HOW B;  3HOY H;  1FD7 D;  1YJN A;  2EIF A;  1XMO Q;  1EWH A;  2L0C A;  1N33 Q;  1KDA A;  3BDL A;  1B9M A;  4I65 A;  4J8Q A;  4FF4 A;  4RHR A;  4JYA L;  2F0L A;  2R3Z A;  3NUC A;  3OIQ A;  1STH A;  1FNV A;  1X32 A;  1SDF A;  2PZT A;  1S72 A;  3MHB A;  3EBE A;  2SNS A;  5EBD A;  2LKV A;  3I3C A;  1HHV A;  4X66 Q;  2D9U A;  3RUZ A;  2IX1 A;  3VYT A;  1S5D D;  1XJV A;  3NBI A;  4CJ1 B;  1KLG D;  4P75 A;  5M9O A;  1A63 A;  5CR3 A;  2C9O A;  4AQY L;  4A3L H;  4IZ8 A;  1TWF B;  1L2F A;  3RN2 A;  4KD3 A;  3OOC A;  3MFY A;  1LLR D;  4X64 L;  1SMY C;  1Y8P B;  2F0P A;  2XVS A;  4HIM A;  3K5L A;  1HNZ L;  2B2Y A;  2MHV A;  1PTO C;  2Q8T A;  5C4J H;  2JA8 H;  2SOB A;  1UE6 A;  2RQX A;  5JJZ A;  3A56 A;  1PRT B;  4KD4 A;  4XQJ A;  1PFN A;  1E1O A;  2VNU D;  2BE5 D;  5K36 H;  1BKB A;  3NEM A;  1MSH A;  2EY5 A;  4RGN A;  1TS4 A;  3I73 A;  4HIK A;  3GV6 A;  4KHP L;  1VQ9 A;  1IKM A;  5I2Y A;  3S2H B;  1PZI D;  5C44 G;  5I9P A;  4A3B B;  1SN8 A;  2QCP X;  1LT6 D;  4NB3 A;  3L2P A;  3E6Z X;  1W2B A;  4LUV A;  4DK0 A;  3RR5 A;  4G7O C;  1XTD A;  1SE2 A;  1W6K A;  4IOA A;  4GLV B;  3D6C A;  1K83 B;  4FYD A;  1PH7 A;  4PZ6 A;  1HTL D;  2EJF C;  2EXZ A;  4WFN 3;  1Q46 A;  3S1M H;  3J7Z C;  1V1P B;  2UXD Q;  4GN4 B;  3R3O A;  2KHS A;  4BY7 H;  1HXY D;  5E3F A;  4JI0 Q;  3PIP 3;  3S1N B;  1Y8N B;  2E74 C;  1MI2 A;  2EOT A;  2VUM G;  1HZ9 A;  4LF6 Q;  1D6E C;  5JPM C;  1BDO A;  5C44 B;  1STE A;  1E1T A;  2D5D A;  3CAM A;  4HJ8 A;  1CFM A;  1Q12 A;  3M4O B;  4JI3 Q;  1E24 A;  1QE6 A;  2RF4 A;  4KHZ A;  2EY1 A;  4DR3 Q;  1PZK D;  1GUT A;  1LYL A;  4DUY L;  2KEN A;  4K0K L;  1I4R A;  1ICF B;  2B8F A;  5F2D A;  4LFB L;  2PMZ B;  3L0O A;  1Y14 B;  3FEW X;  1O78 A;  4R4C A;  3SK8 A;  3BDC A;  3F2U A;  5T1G A;  3OTO L;  4DAP A;  4LF7 L;  4K6L A;  1QB5 D;  1EEI D;  2I46 A;  4ALP A;  1S3O A;  5C4X G;  3ZJY C;  4A3E B;  3QIA A;  2VUM B;  3EIV A;  2EXD A;  1K28 A;  2ZTE A;  1XPO A;  2K7V A;  5CV5 A;  4GNX A;  1I6H H;  1F9R A;  4IN3 A;  4FO2 A;  1QNK A;  2EZV A;  3I4M G;  4BXX G;  4QL5 A;  4C3H H;  3TP8 A;  2RSO A;  1Q81 C;  3NXW A;  1KAA A;  1HFG A;  1EQR A;  2AMC B;  2DN8 A;  2N49 A;  4A93 H;  1UWV A;  3G48 A;  1CKN B;  1YNJ D;  5LMN Q;  2ES2 A;  2UUB Q;  2UXC L;  2JE6 I;  2PZU A;  3G6J B;  3JAM i;  3HRZ C;  2IT1 A;  5IWA Q;  4Y7N B;  3D6W A;  2K04 A;  2TMP A;  3GTL B;  5FJ8 G;  1IBK L;  4B3T L;  1WOC A;  3J81 i;  3KF8 A;  2YYZ A;  1PHJ A;  2JA6 H;  3Q6S A;  3S17 H;  2MP1 A;  2A6H C;  4RFB A;  3I4M B;  2KEE A;  1B8A A;  3NQT A;  2PYK A;  3ND9 A;  1S5E D;  5IYD H;  3ONA B;  2OWO A;  2MGS A; 
#chains in the Genus database with same CATH homology
 1VF5 C;  3DM1 A;  3KLS A;  1JQY D;  2BOS A;  1BNZ A;  1VMC A;  3TZU A;  3EFX D;  2PNR C;  1ZKO A;  5CV7 A;  1KNA A;  3MFG A;  4F87 A;  3MXN A;  4HED A;  2J4X A;  3D4R A;  1MGS A;  4K2L A;  2L55 A;  4DAY A;  1AW7 A;  4HMJ A;  1PRT D;  1RD9 D;  3BVG A;  1LTI D;  3TP5 A;  2EJG C;  1JR0 D;  5LHY 1;  1KDB A;  5C3E B;  4K6D A;  4FF2 A;  4JK1 C;  2R7Z B;  2NVT B;  1OO9 B;  1STY A;  3CU7 A;  3ND8 A;  3OMC A;  4NW2 A;  3D4D A;  1ENF A;  1UNS A;  1H9M A;  4H44 C;  3S1Q B;  3JAM L;  1HQM C;  1RDP D;  4FNF A;  5TSS A;  4CHT B;  1AZP A;  1QOH A;  3PUY A;  1A6X A;  3RZD B;  1HCZ A;  4G7H C;  3J81 L;  5EPK A;  1UEA B;  5A2Q L;  1IKL A;  3A8I E;  4GZY C;  4XQQ A;  3SVM A;  3M7G A;  5IOC A;  1B44 D;  1NCV A;  1TII D;  2F0W A;  1V8Q A;  5IGC A;  2AWO A;  1L0Y B;  2B2T A;  2QIL A;  4HMI A;  4P2C B;  1M8A A;  4X3T A;  3TSS A;  2PQE A;  5LL6 X;  2XIW A;  5COR A;  3M3Y B;  2G9H D;  3FPU B;  3KBX A;  5EKL A;  2JSO A;  4G4K A;  1KNE A;  1EL0 A;  1F2Y A;  1EY9 A;  1CQF A;  1G2S A;  4HAE A;  1TY2 A;  5BN3 A;  2E2I B;  3LWE A;  3VA5 A;  1IW7 C;  2B63 B;  3DEP A;  4UAI A;  2EY2 A;  3NBH A;  1GUG A;  4KTA A;  2F0S A;  3FMC A;  3L7Z C;  1DOK A;  4ZRZ A;  2NB0 A;  1II3 A;  3Q24 A;  3S9W A;  2MUY A;  2VB3 X;  2A6E C;  3PO3 B;  2X69 A;  2D62 A;  1FNW A;  1OXV A;  3OPO A;  1PXU A;  5IGB A;  2NVY B;  2DNC A;  2ICE C;  2K1B A;  3MTS A;  1KAB A;  3J7A V;  1B50 A;  4ZQ3 A;  4UDU C;  1XXG A;  1ONL A;  2JXM B;  1TS3 A;  3HOZ B;  3S1R B;  5KYI A;  2NN6 G;  4QF4 A;  3NTK A;  5FLX E;  2XSC A;  3PUV A;  1TT2 A;  5ELC A;  5IOD A;  2B2Y C;  2Z8L A;  3H09 A;  4IUP A;  1ESF A;  4C1N K;  4ULL A;  2JA5 B;  4PMW A;  2B39 A;  1B1Z A;  4G57 A;  3TP6 A;  2FIN B;  5M5X B;  5BN4 A;  2B2U C;  1HA6 A;  3X3M A;  4PMC A;  3MXG A;  3A8J E;  3K0Y A;  3TDQ A;  1O7L A;  1JWS D;  3IL8 A;  2K01 A;  3AMU A;  4DNT B;  3NWT A;  1CK1 A;  2HUG A;  5EQ0 A;  5CV4 A;  1LT3 D;  2F0D A;  4WRD A;  4OO1 G;  2RA4 A;  4PQX A;  1VCI A;  3P75 A;  4KV6 A;  4RHS A;  3MXU A;  3HOY B;  2AWN A;  1SJH D;  5J39 A;  5EPL A;  3R2T A;  2C5C A;  4L8J A;  3OHX C;  3SK5 A;  4HSP A;  1SND A;  4C1N I;  1D2B A;  4LAA A;  5IIF A;  2EY6 A;  1WD0 A;  1LTT D;  1D1K A;  2K32 A;  3SEB A;  5KYL A;  3BYY B;  2A69 D;  4IQZ A;  1F77 A;  1GHJ A;  1ENC A;  4M8A A;  4IUN A;  3BDO A;  5ELB A;  4FF3 A;  4EQN A;  1OXT A;  4KJN A;  1H9J A;  2EYP A;  1SYD A;  3MEH A;  1NR4 A;  2RDF A;  5C4J B;  2JA8 B;  1AEX A;  2LFN A;  1STN A;  4TKO B;  5I2X A;  2EPB A;  1ENA A;  2J0T D;  1F9Q A;  3VYU A;  3K5O A;  2B2V A;  1D1I A;  5EGT A;  1PDQ A;  1FYC A;  4F7X A;  4RWS C;  3Q0A A;  2KQ3 A;  3L9A X;  4F8M A;  3S1M B;  4OIK A;  1E2Z A;  4ZAI A;  3K5N A;  1PTO H;  1Z6H A;  4QUC A;  2GA4 B;  3TN2 A;  4DK1 A;  4BY7 B;  1SYC A;  1BBX C;  3W3A A;  5A35 A;  4ZKC B;  3N52 A;  3FPP A;  1IL8 A;  1Q3L A;  4FXK C;  3OMG A;  1EYA A;  1SE3 A;  4N9T A;  4HCS A;  3AB9 A;  1CA6 A;  3H3V C;  1JWU D;  1YNN C;  1J9O A;  4KKU A;  2NN6 H;  2M2L A;  4DU9 A;  3SR1 A;  1D5M C;  2RVL A;  3J80 E;  2F0G A;  4B9X A;  2NUC A;  1LTA D;  2NWG A;  2H4O A;  3QO2 A;  1FR3 A;  4KY7 A;  4V0B A;  1I6H B;  4ID6 A;  4K14 A;  4FXD A;  4X3U A;  3R2I A;  5NUC A;  5HGT A;  1JB3 A;  4C3H B;  1EZ8 A;  3CRK C;  1JC7 A;  1SE4 A;  1M4V A;  4A93 B;  1S4Z A;  2RDH A;  1CI3 M;  1JOO A;  3GQB A;  2XWJ B;  5LL6 S;  2EJM A;  2WAC A;  1GXD C;  1NAP A;  2F0V A;  4KKS A;  1GOZ A;  2DNE A;  2R6G A;  2IJ0 A;  1PTO F;  4OO1 H;  3ERO A;  1EY0 A;  2JA6 B;  2B2T C;  3S17 B;  3RMH A;  5DEH A;  1E2W A;  1V1P A;  1XWE A;  2AUK A;  5JPN C;  3TME A;  2QDB A;  3CHB D;  2F0I A;  1V1O A;  2JA7 B;  1SYG A;  1I6V C;  1I4X A;  4ZKB B;  3E0J A;  4JBW A;  4DXG A;  1AN8 A;  5T1I A;  1WTO A;  1KTK A;  5JAV A;  4H0L C;  1ET9 A;  2F0O A;  4ZYS A;  1EU4 A;  1ILP A;  2F0U A;  1BCP F;  4HN7 A;  1LTB D;  2B2W A;  4XT3 B;  3GTM B;  1S5C D;  4XXE A;  4MIU A;  1B2T A;  4OL7 A;  4ODG A;  4PMB A;  5IT9 E;  3I90 A;  3VR2 A;  1BCP C;  1HQR D;  1R4P B;  1BUV T;  1SBB B;  2K05 A;  1F9P A;  1C4Q A;  1VF7 A;  3TP7 A;  2E75 C;  1X3Q A;  2CVR A;  5COY A;  1LT5 D;  1ET6 A;  4X3S A;  5M5W B;  2EYF A;  3EQL C;  1ZYR C;  2KED A;  3MXP A;  3CKI B;  3P1H A;  1JCK B;  1BF4 A;  1QJO A;  1PYW D;  5D3D A;  2F03 A;  1RTO A;  1C8C A;  3SK4 A;  4R8I A;  5C3X A;  4NMZ A;  3J7Y W;  1EYC A;  1F2Z A;  3IKJ A;  3MZ5 A;  3NE5 B;  4A3I B;  4A3M B;  2R61 A;  1HTP A;  2IX0 A;  3PUX A;  3QOJ A;  1ML0 D;  1DJR D;  1TWA B;  4HCE A;  2LY7 A;  2E2H B;  1EIG A;  3DEO A;  4IFD J;  5C4X B;  3C1F A;  3K57 A;  2OXP A;  5E4W C;  4CKC A;  5KRU A;  5C6A A;  2KUM A;  1DCZ A;  2G9D A;  4E6I A;  3S16 B;  3DUZ A;  2L9H A;  2I07 B;  2Z4I A;  3O13 A;  3GTQ B;  1TU2 B;  3FRP B;  2F0K A;  2M9V A;  4RH6 A;  1S5F D;  3EA6 A;  3MVV A;  1MD2 D;  1C48 A;  1A15 A;  3K6O A;  4XYO A;  1XX8 A;  1TS2 A;  3DWP A;  4XQN A;  1IW7 D;  2K5W A;  3A7L A;  4K2K A;  3LNN A;  4BBS B;  1LTG D;  1F2L A;  2N88 A;  2SEB D;  2WII B;  4DFA A;  5CBE E;  1Y1W B;  3C1E A;  2EDG A;  2L1B A;  3SK6 A;  3EVQ A;  2RDG A;  5IGE A;  1EQT A;  1SYE A;  3K58 A;  4PV1 C;  1WTV A;  1O7Y A;  3OWF A;  1ZEQ X;  2A6E D;  4HTH A;  5EJW A;  1VMP A;  2ID0 A;  1TWC B;  3GD7 A;  4FP5 D;  1WCM B;  2B2V C;  1SNO A;  3LWU A;  1RJT A;  3I4N B;  1DOL A;  2FMM A;  4S3S A;  4ZUI A;  5KNC A;  1O7Z A;  1IYV A;  2KCC A;  1YNJ C;  1RCV D;  1JOR A;  1RF2 D;  3BYT B;  3U9O A;  3OW7 A;  2PZW A;  2E2D C;  4XTC S;  5JVH 3;  3OSO A;  2Z4H A;  5CGK A;  4OGQ C;  3DWA A;  5BN5 A;  1XYI A;  1G8Z D;  1JOQ A;  2A73 B;  2A74 C;  5FLX L;  5DM7 3;  2K5D A;  1HA5 A;  5C5L A;  2Q8R E;  4IFD G;  2KVM A;  2L11 A;  1SXT A;  4O42 A;  4M1U B;  1EQV A;  5FKA C;  1NR2 A;  1SAP A;  2Q8I B;  4BWG B;  4YIJ A;  5J22 A;  2KOL A;  1PRT C;  3ERQ A;  2HCI A;  1OXX K;  1G91 A;  4V19 0;  3E5S A;  2N55 A;  3R93 A;  4CGY B;  2CQA A;  2Z1C A;  4L6T B;  1S5B D;  5IGG A;  3C46 A;  1Y8O B;  3TBI B;  3V05 A;  3VYR A;  4DXF A;  3P20 A;  1PFB A;  4O1N A;  1EY4 A;  1F9S A;  1D5Z C;  3SDZ A;  3EJI A;  1SNC A;  1KLU D;  2ZXO A;  4DN4 M;  2F0F A;  5K5P A;  4X3K A;  1PTO B;  1UUP A;  5CV9 A;  3I91 A;  3WOF A;  3HG9 A;  3HKZ B;  3S14 B;  3BVM A;  2ENB A;  3NSW A;  5G3L F;  3DWQ A;  1ESR A;  2H1E A;  1O80 A;  2K28 A;  2IL8 A;  4J1M A;  2B2W C;  1U4P A;  4Z9C B;  3RD4 A;  1A3U A;  1Z47 A;  4KK7 A;  1D5X C;  4A3K B;  5C4Z A;  3T4A C;  2KA7 A;  1BCP B;  3GV3 A;  1EWC A;  3C2P A;  4EQO A;  2O4X A;  4U67 3;  2NN6 I;  3VR6 A;  3K7A B;  1G2T A;  1SJE D;  1H9S A;  4BS9 A;  2R93 B;  4RGM A;  1BO0 A;  4C56 C;  2F0M A;  4U68 A;  3GP7 A;  4BY1 B;  1GUN A;  3QJY A;  2VXW A;  1W6J A;  3KUP A;  4IUV A;  4HSV A;  1A2U A;  2RSN A;  5FK9 C;  3N6R A;  3VR3 A;  3WOE A;  3OWE B;  4BBR B;  3PMF A;  5C0X I;  1SEB D;  1GUS A;  1YNN D;  2IW3 A;  3J7A F;  1PLF A;  1CHP D;  1LTR D;  3GTK B;  5KND A;  4EVO A;  1IHZ A;  1EY7 A;  2XRQ D;  5FOB B;  3Q22 A;  2CW0 C;  2A68 D;  3I8Z A;  1DON A;  5IGD A;  1CQV A;  1QG7 A;  5I9O A;  1R4Q B;  1GUO A;  4B9W A;  2IX3 A;  1B53 A;  1JE4 A;  1SNP A;  2RBM A;  2HQE A;  1TS5 A;  1EY6 A;  3DXJ C;  2CHB D;  2JEA I;  3J80 L;  3T53 B;  4QB4 A;  4IFD H;  3WDN A;  3BS1 A;  2XNA C;  2EYO A;  2XWB B;  2HCC A;  5KEE A;  3VA7 A;  1EY5 A;  1B4O A;  1J8I A;  4A3G B;  4G7Z C;  1SNQ A;  1WTW A;  5E4X A;  2DY7 A;  1I50 B;  4CKB A;  3OIP A;  4QIW B;  1SMY D;  1RHP A;  1STB A;  1LAB A;  1PTO D;  4QMG A;  2KEC A;  3MAQ A;  1CA5 A;  1EOT A;  3H91 A;  4RGT A;  4QCL A;  2F3W A;  4KHV A;  2IWH A;  1U4M A;  4KI0 A;  4IAL A;  3T51 B;  4DNR B;  3W2D A;  2D2C C;  5KIX A;  4F88 A;  1B3A A;  4MN3 A;  4WOR A;  4DA2 A;  1H9R A;  5JOB A;  1BCP D;  1R9T B;  3AU7 A;  1EZ6 A;  1TKW B;  3I4L A;  2IPK D;  3H94 A;  4HR7 B;  2WKD A;  5CV6 A;  4ZK9 B;  3BZD B;  4KY5 A;  1MBY A;  5ELF A;  4N9P A;  2WV6 D;  2WAQ B;  3SXH A;  4B08 A;  2AUJ D;  1CM9 A;  2BDO A;  2TSS A;  3QG1 A;  2L12 A;  3NWS A;  1SYB A;  2NTT A;  4IUU A;  2NZ1 D;  2PCF B;  3V2T A;  2K5Q A;  3QOL A;  4CJ2 C;  2MPM A;  1BQQ T;  1STG A;  1DM0 B;  3GTG B;  1IYU A;  3UI2 A;  3KK7 A;  3IFT A;  4TQU S;  1LAC A;  5ELE A;  3K5M A;  3PIO 3;  4ZLT F;  4R9W A;  1EY8 A;  1FNU A;  2OT2 A;  4KN4 C;  2OF1 A;  4LK1 C;  1NSN S;  3T56 B;  1Y1V B;  1ZXT A;  2YU9 B;  2A6H D;  3KLR A;  1JOK A;  4NKL A;  4CKE A;  3NP8 A;  2B2U A;  3FVQ A;  5J1Z A;  1E2V A;  4NP5 A;  1K8M A;  1BR9 A;  2QKI C;  4LJZ C;  1OXU A;  5HUR A;  1G29 1;  1ILQ A;  2F0N A;  3VR4 A;  4A3D B;  2MJ8 A;  4KN7 C;  1WTP A;  3M7N A;  1WTX A;  2VB2 X;  4RCO A;  5EBC A;  3IAY A;  1SNM A;  2O5J C;  2EYH A;  5JVG 3;  4OHJ A;  1NUC A;  1EEF D;  4IUQ A;  3S2D B;  4FXG C;  2E2J B;  4H13 C;  1RTN A;  4QUF A;  5CBA E;  3T16 A;  2B8G A;  1HRJ A;  4C2M B;  3SHL A;  4TSS A;  3VYS A;  1TR5 A;  3BG3 A;  1BOS A;  1Q90 A;  2SDF A;  2V4D A;  5ISR A;  3LX0 A;  3H6M A;  1EYD A;  2L5T A;  3CQZ B;  3PV0 A;  3GO5 A;  3P7J A;  4A3J B;  5KNB A;  5FO8 B;  4J6H A;  2BE5 C;  5C5M A;  1CT1 D;  2X6G A;  4H7B A;  4LMQ D;  3X3N A;  1QIL A;  2F0H A;  1EU3 A;  3ZYY X;  2J7Z A;  1A3V A;  1Z7T A;  1RKN A;  1QNU A;  4RKB A;  3Q23 A;  3BVZ A;  4K8I A;  1T5E A;  3FKI B;  4Q5V A;  5JEA J;  2QF7 A;  3QWN A;  4K5V A;  2EVB A;  1ROD A;  4KKT A;  5D3I B;  4C3I G;  4FF1 A;  5M3F B;  3HZX A;  3MWY W;  3NQI A;  4XDX A;  3K59 A;  1CZW A;  3HOU B;  3A55 A;  3S15 B;  2AQ3 B;  2E76 C;  2F0Q A;  2NTS A;  2K33 A;  1WVL A;  4K8J A;  1STA A;  2O5I C;  1HUM A;  3HEJ A;  1LO5 D;  1E0B A;  5ELD A;  1X3P A;  3T13 A;  1U4L A;  1DOM A;  1Q1B A;  2FMC A;  2PO4 A;  3NPP A;  4RGO S;  4C3I B;  2A5H A;  1A2T A;  1LT4 D;  2M00 A;  2F1M A;  3NTI A;  4ILW A;  1GJX A;  3DHQ A;  5CMD A;  4KJO A;  4ME5 A;  2FFK B;  4AYB B;  1FGB D;  2EE1 A;  2XN9 C;  4ABN A;  5C0X J;  2JP1 A;  4BA1 I;  1SFO B;  2PW7 A;  2WB1 B;  3PO2 B;  1AP0 A;  5I6Y A;  3GTP B;  1I3Q B;  4DGZ A;  3NTH A;  2X6L A;  1G6Z A;  5C4H A;  4C3J G;  2WIN B;  4OIJ A;  2LS0 1;  5KGU A;  2AQ1 B;  2SNM A;  2EYM A;  1WTR A;  1I4H A;  2ICI A;  1DXM A;  2K03 A;  3ITP A;  1PRT F;  2QEJ C;  1TVX A;  2NBF A;  3RZO B;  5G3L D;  1PFM A;  2HDL A;  1ICW A;  3HOV B;  3JAM E;  1B9N A;  3I70 A;  2PW5 A;  1WD1 A;  1QWY A;  4C3J B;  1TY0 A;  4K5W A;  3HS0 C;  1PZJ D;  5M3M B;  3J81 E;  3HP3 A;  2K6A A;  5A2Q E;  1A3T A;  3M4Y A;  1Y69 U;  1DZ1 A;  5CV8 A;  2BCO A;  2KJX A;  1Q1E A;  2HDM A;  3DMU A;  4FVM A;  3D8G A;  5JEA G;  1GUW A;  2RKS A;  4IFD I;  3PUW A;  1T5X D;  4RAU C;  1K8O A;  1F2M A;  5EKI A;  3MC0 B;  2KCN A;  3M85 A;  4DAV A;  2ZXR A;  2CW0 D;  2F0T A;  1QCB D;  1I4G A;  5I6W A;  2WP8 J;  3D4W A;  3SE0 A;  2R92 B;  3PUZ A;  4DF7 A;  1DD2 A;  4KY6 A;  2NVQ B;  2DY8 A;  2F3V A;  4K5X A;  4PNY A;  1JIC A;  2BA1 A;  3HGB A;  1EFI D;  5M5Y B;  4CBV A;  2L4N A;  5DAU A;  2F0J A;  1TWG B;  3GTJ B;  1CTM A;  3VR5 A;  5C0X G;  4WJW A;  3D31 A;  1TQO A;  4EGV A;  1UAP A;  5DNF A;  5CC4 A;  5IGF A;  4A3F B;  4MHE A;  4NDX A;  1GHK A;  5C3W A;  2BA0 A;  4EQP A;  4RKL A;  5FO9 B;  1EIH A;  1I4P A;  3QB3 A;  1AZQ A;  1DYQ A;  5CYU A;  4OO1 I;  1TWH B;  1LV9 A;  5EPJ A;  5K36 G;  4RCN A;  2LMC B;  1CHQ D;  1BXT A;  3NK9 A;  1HFN A;  5D14 A;  1U4R A;  1I4Q A;  3KLS X;  3L3O C;  2ZT9 C;  4IUR A;  2OEO A;  5EKK A;  1H9S B;  3H0G B;  5D65 A;  3CRL C;  1PMR A;  2EYL A;  3URY A;  2F4I A;  3KBG A;  5E1F A;  1WTQ A;  3NHH A;  2Y0S B;  3R8B A;  1HPC A;  4Q0F A;  4RA8 A;  4L63 B;  3U9S A;  3IFD A;  2JEB I;  1U9R A;  3A8K E;  3C3L A;  1JWM D;  2JYO A;  4XIG S;  4ZUJ A;  4I7Z C;  2PPB C;  2XRS D;  2WKC A;  3D3R A;  5DM6 3;  5JEA H;  1VDZ A;  4BA2 I;  5FO7 B;  4XT1 B;  2ZXP A;  1H9K A;  4R8N A;  1MSG A;  2NVX B;  3A54 A;  3FDT A;  1SSO A;  3RLF A;  3V96 A;  3G7L A;  4C3H G;  1LTS D;  1HUN A;  1XTC D;  4CJ0 B;  1KDC A;  2BDN A;  1L0X B;  4IUT A;  2FHT A;  2FJ2 A;  4XYQ A;  1OXS C;  1Q8I A;  2F0E A;  2NYZ D;  4TRD A;  2A69 C;  5I4D A;  2O2L D;  1SYF A;  2A68 C;  4KMU C;  1ZYR D;  5IT9 L;  3TZD A;  5AFW A;  1V43 A;  3A7A B;  3MA2 B;  2AQ2 B;  1AFP A;  1CZG A;  3HOX B;  5C0X H;  3GTO B;  2EYJ A;  3I72 A;  3HOW B;  1FD7 D;  1EWH A;  2L0C A;  1KDA A;  3BDL A;  1B9M A;  4I65 A;  4J8Q A;  4FF4 A;  4RHR A;  2F0L A;  2R3Z A;  3NUC A;  3OIQ A;  1STH A;  1FNV A;  1X32 A;  1SDF A;  2PZT A;  3MHB A;  2SNS A;  5EBD A;  2LKV A;  3I3C A;  1HHV A;  2D9U A;  3RUZ A;  2IX1 A;  3VYT A;  1S5D D;  3NBI A;  4CJ1 B;  1KLG D;  5M9O A;  5CR3 A;  2C9O A;  4IZ8 A;  1TWF B;  4KD3 A;  3OOC A;  3MFY A;  1LLR D;  1SMY C;  1Y8P B;  2F0P A;  2XVS A;  3K5L A;  2B2Y A;  2MHV A;  1PTO C;  2Q8T A;  2SOB A;  2RQX A;  5JJZ A;  3A56 A;  1PRT B;  4KD4 A;  4XQJ A;  1PFN A;  2VNU D;  2BE5 D;  5K36 H;  1MSH A;  2EY5 A;  4RGN A;  1TS4 A;  3I73 A;  3GV6 A;  1IKM A;  5I2Y A;  3S2H B;  1PZI D;  5I9P A;  4A3B B;  2QCP X;  1LT6 D;  3E6Z X;  4DK0 A;  4G7O C;  1SE2 A;  1W6K A;  3D6C A;  1K83 B;  4FYD A;  1HTL D;  2EJF C;  2EXZ A;  4WFN 3;  1V1P B;  3R3O A;  2KHS A;  1HXY D;  5E3F A;  3PIP 3;  3S1N B;  1Y8N B;  2E74 C;  1MI2 A;  2EOT A;  1D6E C;  5JPM C;  1BDO A;  5C44 B;  1STE A;  2D5D A;  1CFM A;  1Q12 A;  3M4O B;  1QE6 A;  4KHZ A;  2EY1 A;  1PZK D;  1GUT A;  1I4R A;  2B8F A;  5F2D A;  2PMZ B;  3FEW X;  1O78 A;  3SK8 A;  3BDC A;  3F2U A;  5T1G A;  4DAP A;  4K6L A;  1QB5 D;  1EEI D;  2I46 A;  4A3E B;  3QIA A;  2VUM B;  2K7V A;  5CV5 A;  1F9R A;  4IN3 A;  4FO2 A;  1QNK A;  2EZV A;  3TP8 A;  2RSO A;  3NXW A;  1KAA A;  1HFG A;  2DN8 A;  1YNJ D;  2JE6 I;  2PZU A;  3G6J B;  3HRZ C;  2IT1 A;  4Y7N B;  3D6W A;  2K04 A;  2TMP A;  3GTL B;  3KF8 A;  2YYZ A;  3Q6S A;  2MP1 A;  2A6H C;  4RFB A;  3I4M B;  2KEE A;  2PYK A;  3NQT A;  3ND9 A;  1S5E D;  3ONA B;  2MGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...