1NUCA

Staphylococcal nuclease, v23c variant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
134
Chain Sequence
LHKEPATLIKAIDGDTKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Nuclease
total genus 36
structure length 134
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1997-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1nucA00
5I6WA 4K5XA 2F0HA 2EYOA 4K5WA 3P1HA 4DFAA 2F0DA 3SK4A 2M00A 1TQOA 4DU9A 5CGKA 3MVVA 5CV8A 5KGUA 2F0WA 3ITPA 5M9OA 1NSNS 1STAA 3HEJA 2NUCA 1JOKA 3MHBA 3QOJA 5JAVA 4R8NA 4KV6A 4NMZA 4RKBA 4WORA 1SYGA 2WACA 4TRDA 2F0QA 3QOLA 2EYMA 3P75A 5C5MA 1EYDA 3VA5A 5J22A 4K5VA 4ME5A 2EY1A 3D4DA 4DGZA 1KDAA 3TMEA 4I65A 4DF7A 2F0JA 5IGFA 1RKNA 2F0OA 4HTHA 3TP8A 4EQOA 2EY6A 4PMBA 1II3A 4OL7A 2LKVA 4N9TA 5CV4A 4ODGA 4ZUIA 5IGBA 5C6AA 5K5PA 5KEEA 4KY7A 1SYEA 5CV9A 1A3TA 3NHHA 1IHZA 4IUNA 1KABA 1SNQA 2PZWA 4K2KA 4J6HA 1ENAA 2O4XA 2SNSA 3LX0A 5F2DA 3SHLA 2OF1A 4K8JA 2F0MA 3T16A 5IGGA 1EY5A 2KHSA 5C5LA 4H7BA 5CV7A 3D4WA 1EZ8A 1AEXA 1TR5A 3OMCA 1JORA 4ZQ3A 5EGTA 2EYJA 2F0KA 4PMCA 1SYFA 2EYLA 5CV6A 4F8MA 4B9XA 5JOBA 4NKLA 1SYBA 5EKKA 5CC4A 1EYCA 2F0TA 5I9OA 2F0EA 2F0NA 3NQTA 3NXWA 4EQPA 5C3WA 5J39A 1JOQA 1JOOA 2ENBA 2F0GA 3C1EA 3R3OA 2F0IA 1EY8A 2SNMA 4KD4A 3S9WA 5C3XA 2F0LA 3EJIA 3OSOA 3E5SA 3T13A 2F0FA 1NUCA 4IALA 3SK6A 3BDCA 1A3UA 1STHA 4WRDA 3V2TA 4MIUA 5HURA 2F0PA 4F7XA 4KY5A 4K2LA 5C4HA 3BDLA 3MXPA 5IOCA 1STGA 1SNOA 4PNYA 1A3VA 3TP5A 1A2UA 3HZXA 4S3SA 1F2ZA 3PMFA 3MZ5A 3TP7A 1SYCA 4NDXA 3DMUA 1EY0A 1SNDA 3DHQA 1KDCA 3NP8A 4QF4A 5DEHA 5DAUA 3C1FA 4ZUJA 1KDBA 1STNA 1U9RA 4NP5A 5IIFA 5IODA 2PZTA 2EY5A 1EYAA 1EQVA 2HQEA 4KY6A 4QMGA 3SXHA 4K8IA 3RUZA 2EYPA 1ENCA 1SNCA 1SYDA 2EY2A 4HMJA 4KJOA 2PW5A 2KQ3A 5E1FA 2PQEA 5J1ZA 4J1MA 1EY9A 2F3VA 3U9OA 5I9PA 3D8GA 5IGDA 2OXPA 4YIJA 4LAAA 3H6MA 1EY4A 2EYHA 4ID6A 5IGCA 3SK8A 3SK5A 3EVQA 4B9WA 5NUCA 2RKSA 4RKLA 4KJNA 5E3FA 1EY6A 3OMGA 3OWFA 4HMIA 1SNPA 5KYIA 4K6DA 2F0VA 1STBA 4KD3A 5HGTA 3SR1A 1TT2A 4G57A 5KRUA 1STYA 2OEOA 2PW7A 3NK9A 1F2YA 5KIXA 4QB4A 3ERQA 5CR3A 4IZ8A 3NUCA 4E6IA 2EYFA 5ISRA 1SNMA 2QDBA 1EZ6A 2RDFA 3D6CA 4KTAA 5I6YA 1A2TA 3MEHA 2RBMA 1EY7A 4K14A 2PZUA 2F0UA 1F2MA 2F3WA 5CV5A 5EKLA 4EQNA 5C4ZA 2PYKA 4EVOA 1KAAA 2SOBA 5IGEA 3TP6A 2F0SA 2EXZA 4N9PA 4KHVA 5KYLA 3QB3A 3EROA
chains in the Genus database with same CATH superfamily
3R2TA 1OXSC 4KMUC 2YU9H 3S1NB 1SMYD 3TN2A 5CV8A 4K0KQ 3OIPA 1W2BA 1HRJA 1K28A 4KV6A 1QUQB 5FOBB 4RHRA 1SROA 2FINB 5C0XG 3Q0AA 5M5YH 1BBUA 2JE6I 3PIO3 1VQBA 1LTID 1XPRA 1LACA 1HQRD 3KYHC 3KLSX 4QL5A 2IW3A 4PMBA 3HOXG 3FEWX 5ELEA 5EBCA 3A8IE 3LNNA 2M2LA 1KABA 3OIQA 3CMAA 1ENAA 1B1ZA 1X3QA 5F2DA 1PYBA 4DV7L 2F0MA 2KCNA 3T16A 1RCVD 5G3LD 4JI8Q 5IGGA 1MJCA 1HQMC 2CKZB 4IPDA 1X54A 3OMCA 1PTOH 2F0KA 2FJ2A 5JEAG 1K0RA 1AW7A 4B3TQ 4UDUC 4A76A 1C7YA 3K5NA 5C0XH 3K8AA 3KOJA 1TWHH 1CA6A 1JOQA 5GAHC 5I2YA 2XSCA 1FD7D 1NR4A 3D4RA 3G71A 1VQIA 1EIHA 2MO1A 2K5QA 2NZ1D 1Q7YC 3FKIG 3HOXH 3I4MB 1KNEA 1L1OC 4UP7A 2A68C 1I4QA 1X3GA 2F4IA 5C3EG 1R4PB 2WAQB 5ELBA 3A54A 4A3MB 3RLOA 3HZXA 4S3SA 4C56C 4JI3Q 1UE1A 4G7ZC 5JEAH 2A69D 2JXMB 3CCRA 1E1TA 1YJNA 1WD0A 1OXVA 2PZTA 4JBWA 3STBD 3EA6A 1HH2P 1TWGB 2LSSA 3OOCA 2PW5A 1PFNA 5E1FA 3QJYA 3T1YL 1LTSD 3FKIH 3LWUA 3D8GA 1U4LA 1G8ZD 2UXCL 2WINB 4PV1C 2K33A 4B9WA 1PFSA 1S5ED 3BJUA 4Z9CB 5C3EH 3OMGA 3CQZB 5HGTA 3SR1A 1EEFD 2CHBD 2VW9A 2PMZB 1STYA 4KI0A 2LXKA 2BDNA 3S14H 3F8TA 3FP9A 1TS4A 1TWCB 5LMNL 1UE6A 3NBIA 2B2VA 3H3VC 2QDBA 5M3MB 4FF2A 3TDQA 1AZPA 4B3SQ 1EY7A 1GJXA 1WTHA 4DR3L 4L5RC 1SAPA 3GV6A 3NTKA 4EVOA 1KAAA 1V1QA 4N9PA 4GOPB 4KHVA 3QB3A 4C2MH 5LMUQ 2EYOA 1A8VA 4RCOA 1KL9A 1XPUA 1TQOA 4BA2I 1ENFA 3D0FA 1LT3D 1NSNS 1RODA 2NTSA 2E2IB 1JOKA 3KBXA 2F4VL 1MBYA 4OGQC 4TRDA 3W1GA 4LUOA 3BVGA 2EY1A 1O78A 3VYTA 3H15A 3F2DA 2K75A 2YU9B 1VDZA 3Q24A 3CCEA 3C3LA 5IGBA 5C6AA 3NWSA 2NVXH 1L1OA 1A3TA 5T1IA 3LX0A 3QR8A 1K8OA 4K8JA 4ZLTF 4L5SA 2OTLA 1ZEQX 2UUAL 1TR5A 4MHEA 1E0BA 4JI6Q 1PRTC 2N49A 1HR0L 1R4QB 5C3WA 2E5LQ 4HIMA 3K81C 4JOIC 2I46A 4ABNA 4DR7L 1EWIA 2EPBA 3VYUA 2G9HD 2NVYB 3I72A 5FKAC 4IPCA 1I50H 3G6EA 3EIVA 2DNCA 4A3BG 2MUYA 3LGJA 4DR2L 1CQFA 5C4HA 3CMEA 1VQ6A 3H3VI 3HFZB 4BWGB 4NPSA 4DV3L 3DHQA 1KDCA 3DWQA 4NP5A 4DUYL 1VS0A 1C48A 4KY6A 1PH1A 1NBWA 1SYDA 4K6LA 1X3EA 2Z6KA 4RG1A 1EY9A 2J0TD 3R8BA 2JA5G 4CDFC 2QEJC 3M9BA 4Y52H 1TY2A 4A3BH 4QJFA 1SNPA 1JC7A 1IBLL 1K8GA 1TT2A 1S5CD 1ZYRC 4X3UA 3S1RB 1XNRQ 3PIPA 3FKIB 4E6IA 4X65Q 1AN8A 1HFNA 1VQHA 3GTOB 2E2DC 3SEBA 5M5WH 4K14A 2RBMA 1EFID 5C3EB 4DAYA 1K8AC 1Q1EA 2JA5H 4K5XA 5ELCA 2MJ8A 3AYHB 3OW2A 1BCPF 1KQSA 2QILA 2KBNA 3S14B 2F0WA 2VUMB 2NUCA 1VF5C 4ME3A 2MQHA 3MXUA 1LT6D 2CW0C 1Q90A 4P75A 5IWAL 3GTMH 4ZK9B 4POGA 2R61A 4LF9Q 3TS2A 1HJPA 2E74C 4DV1Q 1LLRD 2A73B 4YCWA 4C1NK 1Q81C 3BU2A 2EJGC 4C3HG 1QWYA 3ND9A 2D2CC 3EN2A 2O4XA 3H09A 1GUOA 3E0JA 2Z0SA 4ZCKA 3CC4A 5C5LA 1B3QA 1XMQQ 1YNXA 4NXML 2EYJA 3OTOQ 4B3RQ 2OQ0A 4BXXG 1EIFA 4RHSA 1EYCA 2NVXB 1Q86C 1G6PA 4HSPA 5HGQA 5C4JH 1O7YA 4QY7A 4B3ML 1U0LA 1Z7TA 1FJGL 4A3FG 4C3HH 4LFAQ 3GTGH 1K3BC 1F9RA 3U4VA 4Y7NH 1D5MC 1SDFA 4BY1G 1VQFA 4A93G 3PMFA 5BR8L 1WYDA 1LTLA 1X3FA 2FMCA 4BXXH 5BN4A 3JAMi 1WTPA 4A3EG 2EY5A 2X6LA 3F1ZA 4OIJA 2HQEA 3SXHA 1BCPB 1VQ8A 2RSNA 1N33Q 3HOWG 4BBSB 1I50B 1PDQA 2VB3X 5GAEC 1X55A 4A3FH 4LF5L 4FP5D 3SK5A 1UAPA 2G9DA 5HY6A 4LF4L 4BY1H 5EAYA 4A93H 3K5OA 5KRUA 2HD3A 5DLQE 2PPBC 1AP0A 3BYTB 4O42A 1SE8A 1TWAB 4A3EH 1IW7C 4LFCL 1K3RA 3D6CA 1S5BD 3RN5A 4IUPA 1PH7A 1FVIA 3HOWH 1KLUD 1Z6HA 2K14A 2WP8J 2EDGA 2K05A 3K58A 4JI4Q 4LF8L 1HA5A 1M4VA 3TZUA 4X64Q 5CGKA 2VL6A 1OO9B 3ITPA 1SR3A 4A3JG 3ERSX 1YNJD 4AIMA 1SMYC 3QOJA 5JPMC 2SEBD 2IX0A 4RKBA 1XXGA 5M5WB 5E7NA 3I4NG 1NTGA 1MKHA 1YEZA 2MHVA 1OXXK 2B8GA 2JA5B 4MNOA 1F77A 2ZM6Q 1VCIA 4IUUA 1Y1VG 3T4AC 3PV0A 1JQYD 4J6HA 2VB2X 2O5IC 2IHFA 1ILQA 5GAGC 3GTMB 4GLAC 4A3JH 2HHHL 1JORA 3AFPA 1KTKA 3AEVA 2NVQH 1S40A 3I4OA 5CV6A 2VQFL 4F8MA 4DV5L 1WVLA 4DR6Q 4KHPQ 1AZQA 3I4NH 1Y8PB 3VR6A 1D6EC 1ML0D 2BA0A 2F0TA 4OIKA 3Q8DA 1YI2A 3H3VH 1RHPA 1XPOA 2DUDA 2CVRA 3W3AA 2ZTCA 4XIGS 1Y1VH 4XQNA 5D14A 2A19A 3I8ZA 4DNIA 2R92B 4WRDA 2Z8LA 1E22A 5IOCA 3I3CA 4JYAQ 4JV5L 5IE8A 4UY8C 4BBRG 2EZVA 2K6AA 4QQBX 1N32L 2IX1A 2A69C 4CDDC 4F87A 3GTPB 1Y8NB 1FGBD 1ENCA 1IYJB 2EY2A 2Y0SG 3STBC 2JA7G 4Y7NB 3HOZB 1I6HB 1ZKOA 1SRUA 2KCMA 4TQUS 2EYHA 3G6JB 1FGUA 2DY8A 3BDOA 3T56B 4GN5A 4BBRH 5H1SE 4LF7Q 3ND8A 4I7ZC 1K9MC 1HNWL 3NPPA 4DV2Q 1PVOA 2O5JC 4A3FB 3NBHB 2N88A 4FXKC 1EQTA 3GV3A 3J7ZC 1PYWD 1UE7A 2K5HA 3K59A 4DKAC 1F9PA 3W1BA 3NSWA 4DR4L 2VZAA 2PNHA 4A93B 3TRZA 2Q2HA 3OPOA 5EPLA 2F0HA 4C3IG 1Y1WB 4N8FA 1SE4A 3KF8B 3WDNA 4JI0L 1EWCA 4A3EB 1G51A 1MIUA 1VMCA 1WCMG 4R8NA 4HCEA 1JCKB 1L0WA 2WACA 3HOWB 1T5XD 2L1BA 3I90A 3T1HL 4GNXC 3CC7A 2VQEQ 4I65A 3S16H 2PCFB 5EQ0A 1RKNA 1II3A 1CHPD 3BS1A 1YJ9A 1MSGA 2PZWA 3CF5A 4C3IH 5D3DA 3GQBA 3T53B 1AE3A 1EOVA 2BE5D 2UUCL 1D5XC 1WCMH 4MTNA 4PQXA 2NVTH 4U68A 5CORA 2NTTA 5IYCG 1B50A 5EKKA 1ASZA 2OQKA 4L63B 5J39A 4JBJA 4UP8A 5EBDA 5M5XH 2K4KA 3OYYA 2MNAA 2JYOA 1HZCA 2F0LA 2Q2UA 1RF2D 2F0FA 4CJ2C 3I56A 1K83B 2ZXRA 2KHJA 4LMQD 4OELB 1EUJA 2F0PA 4HR7B 5IP7G 1STGA 1KRTA 2B8FA 3M4QA 5IYCH 3X3MA 2A8VA 5DM73 1B4OA 2BA1A 2I5LX 1JJ2A 1YJWA 3BZCA 1CSPA 2RDHA 4R4IA 2UXCQ 4F88A 1YHQA 1NAPA 2H1EA 1XJVA 1UE5A 1GHKA 4OHJA 1JR0D 2IWHA 4DNTB 3GTKH 2PI2E 1TXYA 5I9PA 4YIJA 1QZGA 3PF5A 4IPGA 2Z4HA 2ICIA 5LMNQ 1EFWA 4HMIA 1DCZA 4OX9L 5IP7H 3QIAA 2K5NA 3S1MH 4XQQA 4DUZL 4DV6L 2UXBL 4IPHA 4XYOA 4DR3Q 4QB4A 4IQZA 1V43A 4GNXA 3I4LA 4KTAA 1O7LA 4CJ1B 3MEHA 3PGZA 1CKNA 4CKBA 3DM3A 4IFDJ 3EROA 2JA6G 2F4VQ 2ZT9C 1PH9A 1PRTB 4DR1L 2PO4A 5AJ3Q 1ESRA 4NMZA 4X66Q 3I55A 4AYBG 1SYGA 2Y0SB 4FF3A 1ICFB 2B2YC 2JA7B 4C3JG 3VA5A 1IYUA 1CZWA 2RCNA 1JWUD 1KDAA 3NE5B 1C9OA 3IKJA 4DR5L 2EY6A 2XVSA 4ODGA 2UUAQ 2CH4A 4IO9A 3RZDH 2ZXOA 2JA6H 1FR3A 3J7AV 1I94Q 4GN3B 1N36Q 3CC2A 3CKIB 1TS5A 4ZQ3A 4CKCA 5EGTA 4HJ7A 2C5CA 4DR7Q 1SYFA 1H9SA 3CCJA 4C3JH 1TS2A 4WJ3M 1J5EQ 5I9OA 2DY7A 3NQTA 2F0NA 3J81L 1DD2A 2B2VC 1HA6A 3AMUA 3C1EA 4C3IB 3GTJB 1JJGA 3S2HB 2SNMA 3FPPA 2PMZE 1WCMB 3MAQA 2R7FA 3PO3B 4YHHL 2GVAA 3CW2C 1EQQA 4F7XA 4DUYQ 3BDLA 4OWXB 3VR5A 2AUJD 1CKOA 1P16A 1WTVA 1SLJA 1SNDA 1I4HA 2L0CA 1I4PA 1CFMA 3VYSA 5IT9L 4IUTA 4RCNA 1HCZA 1U4PA 2Q2TA 2NZOA 1ICWA 1V9PA 2B39A 2UXDL 4M8AA 4PMWA 2B3GA 3T51B 4CDCC 4J1MA 1M1KC 1LV9A 3BZDB 2KJXA 2ZJRA 4HJAA 1F9QA 2OXPA 1I3QB 2RHSB 1EY4A 3EBEA 3ONAB 3EVQA 3PSIA 3CCLA 4KD3A 1LTGD 3DLLA 1WFQA 3VR4A 5IT9E 3M4PA 1RTOA 2FMMA 4JG2A 1F9SA 1I4RA 2B2YA 4JVZA 1HNXL 3A7AB 1NE3A 1LABA 3S1QB 3HOYG 2JN4A 3DXJC 2E8GA 2D0PA 2HIXA 2PYKA 4OWWB 3QG1A 1L0YB 5I2XA 3A0JA 4UHVA 2M00A 2NB0A 1FNUA 2B2UA 5IWAQ 4FDBA 5IYBG 3CXCA 1YIJA 1U4MA 4WORA 3CPFA 2F3IA 1YNJC 3ICEA 1PTOF 4R4TA 3PUZA 1RD9D 4ZKCB 5J22A 4HN7A 4DGZA 5L37A 2D5DA 3C46A 5IGFA 3HOYH 3K80C 2Z6KC 4N9TA 2OT2A 4NXMQ 2L5TA 3NHHA 4V0BA 4XT1B 2BDOA 4RAUC 1YNND 2OF1A 2ZJPA 4H7BA 5IYBH 3D4WA 3V05A 3W2DA 5JJIA 1RTNA 4B9XA 5G3LF 2N8NA 3WWVA 4J8QA 4B3MQ 1HPCA 5KNCA 4CKEA 1UEAB 5FLXL 3IL8A 5FJ8G 1VQOA 4TKOB 3S9WA 3RNUA 3MXNB 4A4IA 5C0XJ 2BCOA 4GKJL 4J15A 5BR8Q 1XNQL 4MIUA 1HUNA 1F2LA 3WOEA 4RGOS 4LWCA 4PNYA 1A3VA 3WOFA 1A2UA 5M5YB 5C44G 3MZ5A 1SYCA 5DEHA 4RGNA 1E2WA 4WFN3 3I2ZA 5FLXE 1U9RA 2H4OA 4WJ4A 2D0OA 2X69A 5FJ8H 2AWNA 5JEAJ 2FFKB 1BCPD 2H5XA 3P20A 1PZKD 1DJRD 4LF4Q 4U673 1FNVA 1JWMD 1PTOB 4YWMA 1GUNA 3S15H 2QF7A 4HIKA 1X56A 4LFCQ 3F2CA 4H13C 4OEMB 3GD7A 1TWHB 5C44H 2OEOA 1F2YA 3KDFB 4K0KL 2XGTA 5COYA 4P74A 1VQEA 2L9HA 1SSOA 1Q1BA 3A8JE 3HOXB 1SNMA 4DK0A 1JB7A 1QVGA 1CM9A 2AQ2B 3UI2A 3RZOH 1TU2B 2DN8A 3A7LA 2EQSA 2YTVA 3TEHB 2ASBA 4DAVA 4IUQA 5EJWA 2RA4A 3MFGA 2HCCA 1HUMA 4YWKA 1KAWA 2BH2A 2EXDA 4PZ8A 1EIGA 3DEPA 2YTYA 2KEDA 4R1JA 1YZ6A 1PV4A 4DF7A 4CGYB 1VQ7A 2QCPX 4L6TB 4B08A 1RIPA 1HFGA 1UNSA 1VQKA 3BYYB 1PH8A 1LTBD 5K5PA 5KEEA 1ZXTA 1SYEA 2E75C 2R3ZA 2Q8IB 2Q8RE 1JMCA 3SHLA 2VQFQ 1XMOL 3PQIA 3CAMA 4DV4Q 3HOUG 2KVMA 1EY5A 1VQDA 4KLKA 2BE5C 4GS3A 3E3XA 2UU9L 1GUGA 3NELA 4V190 1O80A 4X3KA 1AE2A 3SVMA 4JI3L 3NXWA 4KKSA 1S4ZA 2JK8A 3PIOA 1KLGD 4C2MB 3FPUB 4FXGC 4AQYL 3ZYYX 2OTJA 2Q2IA 4JV5Q 3M7GA 4KN4C 3SK6A 4IOCA 4C1NI 3HOUH 4KY5A 3J7AF 1N32Q 2WKDA 3MTSA 1MHWC 3TP7A 1DONA 5DAUA 4HCSA 1EYAA 1DOMA 3Q6SA 2QA4A 1D7QA 1PA6A 1GO3E 2PNRC 5LL6X 1YHBA 1A0IA 2F3VA 1I6VC 4LAAA 2OWOA 4GZYC 1D2BA 1YBYA 5LHY1 1EL0A 3OWFA 3UE1A 1PLFA 2BOSA 3AFQA 3M4OH 1HNWQ 5LMUL 1A15A 1QZHA 5JJLA 4LW1A 4HJ5A 1VQNA 4IURA 2JA8G 3FVQA 2B2WC 1KNAA 4DAMA 1VQJA 1XX8A 3E9HA 2LMCB 4DR4Q 1QUQA 1N34L 3K5MA 1S5DD 2FXQA 4P71A 3GP7A 3U4ZA 1OTCA 2J4XA 3S17H 1QB5D 4JI0Q 5DM63 2NN6I 2HT1A 1WI5A 5IYDG 3ER0A 2TMPA 1A62A 1RJTA 4X62L 4LF6L 3D6WA 1B44D 4HIOA 1H95A 3T1HQ 4XXEA 3J80L 2ATWA 3MC0B 3RZOB 1R9TH 3ZJYC 4KKUA 2JA8H 5M3FG 1A6XA 4JI5L 4R9WA 1I4XA 4NXNL 4EQOA 2LKVA 2Z1CA 4UPAA 5A2QL 4A3BB 2KHIA 2E5LL 2UUCQ 1FNWA 3DUZA 1IHZA 1NJIC 1G291 1FYCA 5IYDH 5LL6S 3KUPA 3J80E 3N52A 4LFBQ 3MXGA 2IX3A 1C4QA 1X3PA 2K52A 5M3FH 5GADC 2KCTA 4APVA 5KYLA 1B9NA 3RD4A 5A2QE 1W6KA 4FNFA 5CBAE 2NWGA 2QGQA 5KNBA 4H0LC 4JI2Q 3NTHA 1JE5A 1LT5D 3HKSA 1A3UA 1PZID 2AUKA 1S3OA 1UUPA 2MPMA 3ULLA 2R93G 1W3SA 1EU4A 4G7HC 1WD1A 3SDZA 3TP5A 4CHTB 4QUCA 1Q82C 2B2WA 4RWSC 3HG9A 3TBIB 4QMGA 4CDEC 5T1GA 1RL2A 2CFMA 2L15A 1DOLA 4DXFA 1CA5A 3KLSA 3HOUB 2VY3A 4OX9Q 1G2TA 4DUZQ 3ULPA 2E2HH 2UXBQ 1IKMA 4DK1A 2D62A 4KJNA 3A74A 4GLVB 4GOPA 2R93H 1STBA 1STEA 2EOTA 2KENA 3MA2B 4DV0L 5C4JB 2FHTA 1XWEA 4X3SA 1OXTA 1J9OA 4GKKL 1MD2D 3A8KE 5ISRA 3GTQH 4C3HB 2R7ZG 3GTGB 2PZUA 5CV5A 3A55A 4BY7H 1KXLA 1HTPA 4DR1Q 2ICEC 1I5FA 3E0EA 5I6WA 3F2BA 4X3TA 2YTXA 1L0XB 2KEEA 1CSQA 5KNDA 1H9MA 1SE3A 3S24A 2C35B 2K5VA 2XTIA 1V1PA 1U4RA 3R2IA 3BVMA 4DR5Q 3S17B 2EJMA 5C5MA 1EYDA 3OWEB 5EPKA 4B3RL 2R7ZH 4JK1C 4O1NA 4A3KG 1KD1C 3U50C 1VQ4A 1GD7A 2JJQA 4FF4A 4ZUIA 1IBML 3O13A 4BY1B 5CV9A 2QDLA 2E2JH 3CPWA 1AEXA 1YNNC 3L0OA 2RVLA 2M9VA 4PMCA 4AH6A 4A3DG 5ELOA 1M8AA 1CUKA 1L1OB 3J80c 1E3PA 4EX5A 4A3KH 3R3OA 2V4DA 4P73A 1EY8A 4HJ9A 1SE2A 4DV7Q 1YHAA 1VQ9A 3L7ZC 1VQ5A 1E2ZA 1NUCA 2RCFA 4IALA 1QVFA 4YCVA 1JJCB 3NTIA 1VQPA 1V8QA 4N8X1 1Q8IA 1VF7A 1QJOA 1F2ZA 2NN6G 3S1NH 2UXDQ 4A3DH 4KHZA 2WIIB 3Q22A 3KFUA 3K6OA 1PRTF 2L11A 2GVBA 1SNCA 5DNFA 1BBXC 3PO2G 1BCPC 2Y0SE 4A3JB 2I0QA 1K73C 1EU3A 3VDYA 1VQAA 2NVQB 5NUCA 4HIDA 1IL8A 3I4MG 1ET9A 5E3FA 1D8LA 2CWAA 3L9AX 3I4NB 2F0VA 2JQOA 3QO2A 1HNXQ 2A1AA 4X64L 4DXGA 2NN6H 4POFA 2L12A 1AH9A 2WAQG 4A3MG 4YY3L 5CR3A 3T1YQ 1BDOA 1Y1VB 2HUGA 5GROA 2E2HB 2R93B 1DOKA 3PO2H 2ZTDA 1BKBA 2A6HD 2EXZA 3QWNA 2ZM6L 4FYDA 2KCCA 2RF4A 3GTLH 4UP9A 4K5WA 3PUYA 3RLFA 3I4MH 1C0AA 2DJFC 4LJZC 3D3RA 3MHBA 4PG3A 1QNKA 1PFMA 4A3MH 2F1MA 3RLNA 1DGSA 2EIFA 4DAYB 3HP3A 4A75A 1HZAA 3TMEA 3RN2A 5ELFA 2RDGA 3TP8A 2K01A 4RFBA 5M3MG 1TWGH 4ULLA 1ESFA 1P8LA 1W6JA 1Z9FA 3IFDA 2XWBB 1HNZL 4BBRB 3G48A 1TIID 2AQ1B 5JPNC 1U5KA 3MWYW 3S2DH 1NY4A 2R7ZB 3J7YW 1XTCD 1LTTD 4OXPA 5JOBA 4RGTA 3W5OA 1SEBD 2XNAC 4GKJQ 4YCUA 1IZ6A 1Q12A 1TWCH 2JA9A 1XNQQ 1G6ZA 3MFYA 3U58A 3M3YH 3OSOA 5M3MH 4LNQA 3Q23A 1NNXA 2HDMA 1JWSD 2K32A 2B2UC 1HR0Q 1PH3A 4OONA 4R4CA 1DYQA 2A74C 2IJ0A 3VYRA 3TQYA 2ZTEA 1AFPA 1LTRD 3S16B 4QF4A 2XRSD 3FRPB 2E2IH 2YV5A 2ZJQA 1X9NA 3RUZA 1GVPA 2AKWB 3AQQA 1EOTA 4DR2Q 2MP1A 4ID6A 5IGCA 2IL8A 4DV3Q 4A3DB 2NVTB 3PF4A 1PTOD 4BA1I 3A5ZB 4DNRB 3VR2A 3NEMA 1C8CA 4HAEA 4FO2A 1EYGA 4G57A 5E4XA 2PW7A 1TWFH 3NK9A 5M5XB 2AMCB 2B63G 3J81E 3NUCA 1GOZA 3NWTA 3PUVA 1EZ6A 4QCLA 2B2TC 4EQ5A 2DGYA 2ID0A 5C4ZA 1JB3A 2VQEL 1IBLQ 1H9JA 4GLXA 3P1HA 3SK4A 3MVVA 5FO8B 4MN3A 5KGUA 2NVYH 1Q46A 1L2FA 4DK6C 2XWJB 1LO5D 3CCMA 2B63H 2D9UA 3PO2B 4AYBE 3GTKB 3HOVG 3GTLB 2F0JA 2PQAA 1XMOQ 1EWHA 4JI1L 3NQIA 4IUVA 3UE0A 3LWEA 3FDTA 3K0XA 1PZJD 1SNQA 2EJFC 3S1MB 2JEBI 2UU9Q 1HHVA 3K0YA 1M90C 2J7ZA 3L3OC 3DWPA 2WB1G 1X32A 3OW7A 4AQYQ 2VUMG 5J3BA 1SYBA 1XTDA 2CQOA 1SFOH 1D1IA 1NR2A 3HOVH 3C2PA 1PYSB 2EE1A 3S1RH 1KC8C 4RH6A 1YITA 1IYVA 4P2CB 5I4DA 4ZAIA 1Y14B 3S2DB 3GTOH 3DEOA 2RSOA 2UUBL 4KK7A 4XDXA 3SGIA 3BDCA 4DN4M 5HURA 2L55A 2MFIA 3IFTA 1VQLA 5BN5A 1WTRA 4P72A 2VUMH 3URYA 1KDBA 5EKIA 1VQCA 3M3YB 3H91A 4PZ6A 1FJGQ 4ZYSA 2QKIC 3IRBA 4K8IA 2B2TA 3RZDB 4A3IG 2JA6B 1LM0A 1S5FD 1PH5A 3NBHA 1FL0A 5IP9G 2ALYB 4AYBB 1T9HA 2RKSA 4K6DA 1SJED 4C3JB 4JI7L 1N34Q 4QIWE 2JP1A 5D3IB 1Y8OB 1N9WA 3KF8A 2KUMA 2CCZA 2Q8TA 1LT4D 4NB3A 5C4XG 2K28A 5AJ3L 4O2DA 1BF4A 4X66L 3CCQA 3KBGA 2HCIA 4DPGA 5I6YA 4A3IH 4LF5Q 3EQLC 3CCSA 4M1UB 2F0UA 2F3WA 2SOBA 5IGEA 3TP6A 4X62Q 4LF6Q 2IT1A 1V1PB 4R4QA 4BBSG 2CQAA 3J81c 5IP9H 4DU9A 1TWFB 1GXDC 4XYQA 3VR3A 4JI5Q 5FO9B 1UEBA 3J81j 1HZBA 1IBKL 1I94L 4TSSA 2KA7A 1N36L 1SMXA 4NXNQ 1G91A 1GKHA 2DJGC 2F0QA 5C4XH 2WB1E 5JVH3 2F03A 2LXJA 4ZKBB 3CRLC 1DZ1A 3KF6A 4HEDA 3KLWA 4LF8Q 4KN7C 1B8AA 2F0OA 4HTHA 4IJHA 1J5EL 4OO1I 1ASYA 5IT9c 1EEID 4BBSH 3CD6A 1A63A 4DAPA 2B63B 2KHSA 1BXTA 4YWLA 1Y69U 1CTMA 4JCVE 4A3CG 2LFNA 4JI8L 4ALPA 1JT8A 1TKWB 1TWAH 4B3TL 4QIWB 1CT1D 5ELDA 5C3XA 1Z47A 5AFWA 4HSVA 2HHHQ 2CWPA 3DWAA 4DV5Q 2TSSA 1SFOB 4K2LA 3MXPA 2AQ3B 3K7UC 3HOVB 3FMCA 2K1BA 1LYLA 3I7FA 3KJPA 1NMGA 1YVCA 4FF1A 3HOYB 3C1FA 4ZUJA 3CU7A 1STNA 4XTCS 5IIFA 5LMNW 1S72A 4A3CH 3BVZA 4H02A 4HMJA 4KJOA 2KQ3A 5GQOA 1PH4A 3JC66 1TVXA 2WB1B 3SK8A 4FVMA 4DV0Q 1ONLA 1K0SA 4RKLA 5KYIA 4GKKQ 5D65A 2K03A 4R4OA 4MZ9A 2R92G 4X6AH 1CI3M 5KIXA 1MSHA 1IL2A 2O2LD 2WV6D 3PCOB 1V1OA 3G4SA 2B29A 4JOIA 1UWVA 3I73A 1IKLA 4EQNA 1F2MA 4IN3A 2XRQD 1T5EA 2F0SA 4RA8A 2OCEA 1KIXA 4B3SL 2A6HC 5FLXc 3HOZG 1X65A 3GO5A 1D1KA 3MEFA 2RQXA 3HEJA 3M85A 1PH2A 4IFDI 3CCVA 3A5UA 2R92H 4GNXB 2I5HA 5FLMG 4A3IB 1SN8A 2N3SA 1B7YB 3OHXC 1CKNB 2EYMA 1HR0W 4R8IA 4JBKA 3EFXD 1PFBA 2PI2A 1G2SA 1IBMQ 2A6EC 2KOLA 3AU7A 3PUWA 4I7AA 1HZ9A 4OL7A 3S15B 4XQJA 3GTPH 1VQMA 5C44B 3HOZH 3G7LA 1I6HH 1QNUA 3HKZG 5C4XB 1WTXA 4GOPC 5CV7A 2VNUD 2WFWA 1Y1WG 2QW7A 5FLMH 3J80i 3AB9A 3JAML 4NKLA 4TVAB 2HIVA 2F0EA 1BOSA 2MGSA 4JI6L 1JOOA 1KRSA 2ENBA 1O7IA 5A35A 1HTLD 5EPJA 2N78A 2A68D 3EJIA 4IJLA 2ES2A 4OWTB 3HGBA 1XYIA 3V2TA 3HRZC 2GA4B 3R93A 1H9SB 5JVG3 1SNOA 3JAME 1ILPA 2K5DA 2CH4W 3BG3A 1QE6A 1Y1WH 1EY0A 3NP8A 2AWOA 4XT3B 1EQRA 1GUTA 1E1OA 3UDXA 2X6GA 2EYPA 3K7AH 1DXMA 2PQEA 5J1ZA 1B9MA 2F52A 1EIYB 3SE0A 4DK3C 1QILA 4LUZA 4UAIA 1BO0A 3FHWA 2C9OA 4YY3Q 3H0GG 1EY6A 4OO1G 3L2PA 1BUVT 1PXUA 1PTOC 1D5ZC 1GHJA 1PH6A 1K8MA 2XIWA 2NYZD 2RHQB 3PUXA 5CBEE 3NENA 3TREA 1BBWA 2R7DA 1A2TA 3RMHA 5EKLA 4HJ8A 1XNRL 1B2TA 3K5LA 1B70B 4BY7G 3P7JA 4X65L 2DNEA 1BR9A 2EVBA 3N6RA 3RR5A 4L8JA 2F0DA 3CHBD 4CJ0B 4DV6Q 4H44C 3E6ZX 3TZDA 3H0GH 4OO1H 1JE4A 1K83H 5JAVA 3HKZE 4QGUA 2PQAB 4DV4L 2IY5B 1Q8KA 3P75A 5IY0A 4A3LG 4JC0A 4K5VA 5BN3A 3D4DA 4FXDA 3D31A 1HNZQ 1RDPD 2LY7A 2HDLA 5CV4A 5TSSA 2IHEA 1GM5A 4KY7A 3M4OB 1PHJA 1BVSA 4ZRZA 4LF9L 2IPKD 2SNSA 4DV1L 3MXNA 3K57A 1WTWA 1WTQA 1PRTD 1GUSA 1PMRA 1O7ZA 1X6OA 1MI2A 4A3GG 2LS01 2NZHA 1CQVA 1XMQL 4A3LH 1HXYD 2KECA 5CC4A 3OTOL 4O0AA 1JICA 2ZXPA 3GDEA 4KD4A 2K7VA 3E5SA 3T13A 3TS0A 3I91A 3CRKC 3U9SA 2P5ZX 3M7NA 4LUVA 1R9TB 1OXUA 2HQLA 2XN9C 5C0XI 2JA8B 3DM1A 2K5WA 1WTOA 4LFAL 3J7A5 2Z6BA 3KLRA 3DMUA 1E2VA 3E9IA 4GN4B 4A3GH 5CYUA 1BQQT 3UDIA 4IFDG 1TY0A 3UDFA 3KDFA 4JW0A 4NW2A 4YHHQ 2JA7H 3KK7A 3JAMc 3UDGA 1H9KA 2I07B 3HKZB 3U9OA 4RMFA 5IGDA 3M4YA 2JSOA 3VA7A 4ILWA 4EGVA 1N33L 2N55A 5JJZA 4G7OC 4RGMA 5M3FB 3PO3G 1ZYRD 3K7AB 3KJOA 1MGSA 2NBFA 4IFDH 1QCBD 2VXWA 5FO7B 1WJJA 1VMPA 4Q0FA 1LUZA 1SJHD 1I4GA 2AHOB 1CK1A 3HS0C 1H9RA 4L5TA 2A5HA 2GN5A 2MO0A 3GTJH 4DFAA 3S2HH 2SDFA 4IOAA 5M9OA 1QVCA 1STAA 2CW0D 3PO3H 4JI4L 4WJWA 1KHIA 4Q5VA 3KF6B 5ELNA 4JI1Q 4LK1C 3CCUA 4LFBL 3QOLA 2R6GA 1Q3LA 1NMFA 4ME5A 1ET6A 1J6QA 1VQGA 1E7ZA 3A56A 1E24A 3H0GB 1MJEA 4PZ7A 4IUNA 4K2KA 1QOHA 2VS1A 4BS9A 2G5DA 2Z4IA 5FK9C 4JI2L 1I3QH 1N8RC 1EZ8A 4QUFA 2EYLA 3GTQB 1NCVA 4JPBW 1TS3A 1J8IA 1DM0B 4BY7B 2A6ED 4EQPA 2L4NA 3ULJA 2QEXA 2UUBQ 4DR6L 2F0GA 4KHPL 1LTAD 2F0IA 2I5MX 3BZKA 3S1QH 3CP0A 1STHA 2BH8A 1BNZA 3IAYA 4MTKA 3H94A 1GUWA 4NDXA 4G4KA 5IODA 3CQZH 1B3AA 3I70A 4JYAL 3F2UA 1EQVA 2JEAI 1IXRA 5E4WC 4JBMA 5JJKA 4CBVA 2E76C 5K36G 1SXTA 2E2JB 1QG7A 3H6MA 2YYZA 4JI7Q 2Z9HA 3B6YA 4A3GB 3X3NA 3V96A 4KKTA 3TSSA 5CMDA 4L5QA 1CKMA 1IW7D 1SBBB 1B53A 2K04A 3ERQA 4A3KB 4IZ8A 2EYFA 3PIP3 2WKCA 2RDFA 2WAQE 1CZGA 3J81i 1WOCA 4LF7L 1CHQD 4DA2A 5K36H 2K50A 4DV2L 2V1CC 1IBKQ
chains in the Genus database with same CATH topology
3R2TA 1OXSC 4KMUC 3S1NB 1SMYD 3TN2A 5CV8A 3OIPA 1HRJA 4KV6A 5FOBB 4RHRA 2FINB 5C0XG 3Q0AA 2JE6I 3PIO3 1LTID 1LACA 1HQRD 3KLSX 2IW3A 4PMBA 3FEWX 5ELEA 5EBCA 3A8IE 3LNNA 2M2LA 1KABA 3OIQA 1ENAA 1B1ZA 1X3QA 5F2DA 2F0MA 2KCNA 3T16A 1RCVD 5G3LD 5IGGA 1HQMC 3OMCA 1PTOH 2F0KA 2FJ2A 5JEAG 1AW7A 4UDUC 3K5NA 5C0XH 1CA6A 1JOQA 5I2YA 2XSCA 1FD7D 1NR4A 3D4RA 1EIHA 2K5QA 2NZ1D 3I4MB 1KNEA 2A68C 1I4QA 2F4IA 1R4PB 2WAQB 5ELBA 3A54A 4A3MB 3HZXA 4S3SA 4C56C 4G7ZC 5JEAH 2A69D 2JXMB 1WD0A 1OXVA 2PZTA 4JBWA 3EA6A 1TWGB 3OOCA 2PW5A 1PFNA 5E1FA 3QJYA 1LTSD 3LWUA 3D8GA 1U4LA 1G8ZD 2WINB 4PV1C 2K33A 4B9WA 1S5ED 4Z9CB 3OMGA 3CQZB 5HGTA 3SR1A 1EEFD 2CHBD 2PMZB 1STYA 4KI0A 2BDNA 1TS4A 1TWCB 3NBIA 2B2VA 3H3VC 2QDBA 5M3MB 4FF2A 3TDQA 1AZPA 1EY7A 1GJXA 1SAPA 3GV6A 3NTKA 4EVOA 1KAAA 4N9PA 4KHVA 3QB3A 2EYOA 4RCOA 1TQOA 4BA2I 1ENFA 1LT3D 1NSNS 1RODA 2NTSA 2E2IB 1JOKA 3KBXA 1MBYA 4OGQC 4TRDA 3BVGA 2EY1A 1O78A 3VYTA 2YU9B 1VDZA 3Q24A 3C3LA 5IGBA 5C6AA 3NWSA 1A3TA 5T1IA 3LX0A 1K8OA 4K8JA 4ZLTF 1ZEQX 1TR5A 4MHEA 1E0BA 1PRTC 1R4QB 5C3WA 2I46A 4ABNA 2EPBA 3VYUA 2G9HD 2NVYB 3I72A 5FKAC 2DNCA 2MUYA 1CQFA 5C4HA 4BWGB 3DHQA 1KDCA 3DWQA 4NP5A 1C48A 4KY6A 1SYDA 4K6LA 1EY9A 2J0TD 3R8BA 2QEJC 1TY2A 1SNPA 1JC7A 1TT2A 1S5CD 1ZYRC 4X3UA 3S1RB 3FKIB 4E6IA 1AN8A 1HFNA 3GTOB 2E2DC 3SEBA 4K14A 2RBMA 1EFID 5C3EB 4DAYA 1Q1EA 4K5XA 5ELCA 2MJ8A 1BCPF 2QILA 3S14B 2F0WA 2VUMB 2NUCA 1VF5C 3MXUA 1LT6D 2CW0C 1Q90A 4ZK9B 2R61A 2E74C 1LLRD 2A73B 4C1NK 4C3HG 2EJGC 1QWYA 3ND9A 2D2CC 2O4XA 3H09A 1GUOA 3E0JA 5C5LA 2EYJA 4RHSA 1EYCA 2NVXB 4HSPA 1O7YA 1Z7TA 1F9RA 1D5MC 1SDFA 3PMFA 2FMCA 5BN4A 1WTPA 2EY5A 2X6LA 4OIJA 2HQEA 3SXHA 1BCPB 2RSNA 4BBSB 1I50B 1PDQA 2VB3X 4FP5D 3SK5A 1UAPA 2G9DA 3K5OA 5KRUA 2PPBC 1AP0A 3BYTB 4O42A 1TWAB 1IW7C 3D6CA 1S5BD 1KLUD 1Z6HA 2WP8J 2EDGA 2K05A 3K58A 1HA5A 1M4VA 3TZUA 5CGKA 1OO9B 3ITPA 1YNJD 5JPMC 1SMYC 3QOJA 2SEBD 2IX0A 4RKBA 1XXGA 5M5WB 2MHVA 1OXXK 2B8GA 2JA5B 1F77A 1VCIA 4IUUA 3T4AC 3PV0A 1JQYD 4J6HA 2VB2X 2O5IC 1ILQA 3GTMB 1JORA 1KTKA 5CV6A 1WVLA 4F8MA 1AZQA 1Y8PB 3VR6A 1D6EC 1ML0D 2BA0A 2F0TA 4OIKA 1RHPA 2CVRA 3W3AA 4XIGS 4XQNA 5D14A 3I8ZA 2R92B 4WRDA 2Z8LA 5IOCA 3I3CA 2EZVA 2K6AA 2IX1A 2A69C 4F87A 3GTPB 1Y8NB 1FGBD 1ENCA 2EY2A 4Y7NB 3HOZB 1I6HB 1ZKOA 4TQUS 2EYHA 3G6JB 2DY8A 3BDOA 3T56B 3ND8A 4I7ZC 3NPPA 2O5JC 4A3FB 2N88A 3GV3A 1EQTA 4FXKC 3K59A 1PYWD 1F9PA 3NSWA 4A93B 3OPOA 5EPLA 2F0HA 4C3IG 1Y1WB 1SE4A 3WDNA 1EWCA 4A3EB 1VMCA 4R8NA 4HCEA 1JCKB 2WACA 3HOWB 1T5XD 2L1BA 3I90A 4I65A 2PCFB 5EQ0A 1RKNA 1II3A 1CHPD 3BS1A 1MSGA 2PZWA 5D3DA 3GQBA 3T53B 2BE5D 1D5XC 4PQXA 4U68A 5CORA 2NTTA 1B50A 5EKKA 4L63B 5J39A 5EBDA 2JYOA 2F0LA 1RF2D 2F0FA 4CJ2C 1K83B 2ZXRA 4LMQD 2F0PA 4HR7B 1STGA 2B8FA 3X3MA 5DM73 1B4OA 2BA1A 2RDHA 4F88A 1NAPA 2H1EA 1GHKA 4OHJA 1JR0D 2IWHA 4DNTB 5I9PA 4YIJA 2Z4HA 2ICIA 4HMIA 1DCZA 3QIAA 4XQQA 4XYOA 4QB4A 4IQZA 1V43A 3I4LA 4KTAA 1O7LA 4CJ1B 3MEHA 4CKBA 4IFDJ 3EROA 2ZT9C 1PRTB 2PO4A 1ESRA 4NMZA 1SYGA 2Y0SB 4FF3A 2B2YC 2JA7B 4C3JG 3VA5A 1IYUA 1CZWA 1JWUD 1KDAA 3NE5B 3IKJA 2EY6A 2XVSA 4ODGA 2ZXOA 1FR3A 3J7AV 3CKIB 1TS5A 4ZQ3A 4CKCA 5EGTA 2C5CA 1SYFA 1H9SA 1TS2A 5I9OA 2DY7A 3NQTA 2F0NA 3J81L 1DD2A 2B2VC 1HA6A 3AMUA 3C1EA 4C3IB 3GTJB 3S2HB 2SNMA 3FPPA 1WCMB 3MAQA 3PO3B 4F7XA 3BDLA 3VR5A 2AUJD 1WTVA 1SNDA 1I4HA 2L0CA 1I4PA 1CFMA 3VYSA 5IT9L 4IUTA 4RCNA 1HCZA 1U4PA 1ICWA 2B39A 4M8AA 4PMWA 3T51B 4J1MA 1LV9A 3BZDB 2KJXA 1F9QA 2OXPA 1I3QB 1EY4A 3ONAB 3EVQA 4KD3A 1LTGD 3VR4A 5IT9E 1RTOA 2FMMA 1F9SA 1I4RA 2B2YA 3A7AB 1LABA 3S1QB 3DXJC 2PYKA 1L0YB 3QG1A 5I2XA 2M00A 2NB0A 1FNUA 2B2UA 1U4MA 4WORA 1YNJC 1PTOF 4ZKCB 3PUZA 1RD9D 5J22A 4HN7A 4DGZA 2D5DA 3C46A 5IGFA 4N9TA 2OT2A 2L5TA 3NHHA 4V0BA 4XT1B 2BDOA 4RAUC 1YNND 2OF1A 4H7BA 3D4WA 3V05A 3W2DA 1RTNA 4B9XA 5G3LF 4J8QA 1HPCA 5KNCA 4CKEA 1UEAB 5FLXL 3IL8A 4TKOB 3S9WA 5C0XJ 2BCOA 4MIUA 1HUNA 1F2LA 3WOEA 4RGOS 4PNYA 1A3VA 3WOFA 1A2UA 5M5YB 3MZ5A 1SYCA 5DEHA 4RGNA 1E2WA 4WFN3 5FLXE 1U9RA 2H4OA 2X69A 2AWNA 5JEAJ 2FFKB 1BCPD 3P20A 1PZKD 1DJRD 4U673 1FNVA 1JWMD 1PTOB 1GUNA 2QF7A 4H13C 3GD7A 1TWHB 2OEOA 1F2YA 5COYA 2L9HA 1SSOA 1Q1BA 3A8JE 3HOXB 1SNMA 4DK0A 1CM9A 2AQ2B 3UI2A 1TU2B 2DN8A 3A7LA 4DAVA 4IUQA 5EJWA 2RA4A 3MFGA 2HCCA 1HUMA 1EIGA 3DEPA 2KEDA 4DF7A 4CGYB 2QCPX 4L6TB 4B08A 1HFGA 1UNSA 3BYYB 1LTBD 5K5PA 5KEEA 1ZXTA 1SYEA 2E75C 2R3ZA 2Q8IB 2Q8RE 3SHLA 2KVMA 1EY5A 2BE5C 1GUGA 4V190 1O80A 4X3KA 3SVMA 3NXWA 4KKSA 1S4ZA 1KLGD 4C2MB 3FPUB 4FXGC 3ZYYX 3M7GA 4KN4C 3SK6A 4C1NI 4KY5A 3J7AF 2WKDA 3MTSA 3TP7A 1DONA 5DAUA 4HCSA 1EYAA 1DOMA 3Q6SA 2PNRC 5LL6X 2F3VA 1I6VC 4LAAA 4GZYC 1D2BA 1EL0A 5LHY1 3OWFA 1PLFA 2BOSA 1A15A 4IURA 3FVQA 2B2WC 1KNAA 1XX8A 2LMCB 3K5MA 1S5DD 3GP7A 2J4XA 1QB5D 5DM63 2NN6I 2TMPA 1RJTA 3D6WA 1B44D 4XXEA 3J80L 3MC0B 3RZOB 4KKUA 1A6XA 4R9WA 1I4XA 4EQOA 2LKVA 2Z1CA 5A2QL 4A3BB 1FNWA 3DUZA 1IHZA 1G291 1FYCA 5LL6S 3KUPA 3J80E 3N52A 3MXGA 2IX3A 1C4QA 1X3PA 5KYLA 1B9NA 3RD4A 5A2QE 1W6KA 4FNFA 5CBAE 2NWGA 5KNBA 4H0LC 3NTHA 1LT5D 1A3UA 1PZID 2AUKA 1UUPA 2MPMA 1EU4A 4G7HC 1WD1A 3SDZA 3TP5A 4CHTB 4QUCA 2B2WA 4RWSC 3HG9A 3TBIB 4QMGA 5T1GA 1DOLA 4DXFA 1CA5A 3KLSA 3HOUB 1G2TA 1IKMA 4DK1A 2D62A 4KJNA 1STBA 1STEA 2EOTA 3MA2B 5C4JB 2FHTA 1XWEA 4X3SA 1OXTA 1J9OA 1MD2D 3A8KE 5ISRA 4C3HB 3GTGB 2PZUA 5CV5A 3A55A 1HTPA 2ICEC 5I6WA 4X3TA 1L0XB 2KEEA 5KNDA 1H9MA 1SE3A 1V1PA 1U4RA 3R2IA 3BVMA 3S17B 2EJMA 5C5MA 1EYDA 3OWEB 5EPKA 4JK1C 4O1NA 4FF4A 4ZUIA 3O13A 4BY1B 5CV9A 1AEXA 1YNNC 2RVLA 2M9VA 4PMCA 1M8AA 3R3OA 2V4DA 1EY8A 1SE2A 3L7ZC 1E2ZA 1NUCA 4IALA 3NTIA 1V8QA 1Q8IA 1VF7A 1QJOA 1F2ZA 2NN6G 4KHZA 2WIIB 3Q22A 3K6OA 1PRTF 2L11A 1SNCA 5DNFA 1BBXC 1BCPC 4A3JB 1EU3A 2NVQB 5NUCA 1IL8A 1ET9A 5E3FA 3L9AX 3I4NB 2F0VA 3QO2A 4DXGA 2NN6H 2L12A 5CR3A 1BDOA 1Y1VB 2HUGA 2E2HB 2R93B 1DOKA 4FYDA 2A6HD 2EXZA 3QWNA 2KCCA 4K5WA 3PUYA 3RLFA 4LJZC 3D3RA 3MHBA 1QNKA 1PFMA 2F1MA 3HP3A 3TMEA 5ELFA 2RDGA 3TP8A 2K01A 4RFBA 4ULLA 1ESFA 1W6JA 3IFDA 2XWBB 4BBRB 1TIID 2AQ1B 5JPNC 3MWYW 2R7ZB 3J7YW 1XTCD 1LTTD 5JOBA 4RGTA 1SEBD 2XNAC 1Q12A 1G6ZA 3MFYA 3OSOA 3Q23A 2HDMA 1JWSD 2K32A 2B2UC 1DYQA 2A74C 2IJ0A 3VYRA 1AFPA 1LTRD 3S16B 4QF4A 2XRSD 3FRPB 3RUZA 1EOTA 2MP1A 4ID6A 5IGCA 2IL8A 4A3DB 2NVTB 1PTOD 4BA1I 4DNRB 3VR2A 1C8CA 4HAEA 4FO2A 4G57A 5E4XA 2PW7A 3NK9A 5M5XB 3J81E 3NUCA 1GOZA 3NWTA 3PUVA 1EZ6A 4QCLA 2B2TC 2ID0A 5C4ZA 1JB3A 1H9JA 3P1HA 3SK4A 3MVVA 5FO8B 4MN3A 5KGUA 2XWJB 1LO5D 2D9UA 3PO2B 3GTKB 3GTLB 2F0JA 1EWHA 3NQIA 4IUVA 3LWEA 3FDTA 1PZJD 1SNQA 2EJFC 3S1MB 2JEBI 1HHVA 3K0YA 2J7ZA 3L3OC 3DWPA 1X32A 3OW7A 1SYBA 1D1IA 1NR2A 3C2PA 2EE1A 4RH6A 1IYVA 4P2CB 5I4DA 4ZAIA 3S2DB 3DEOA 2RSOA 4KK7A 4XDXA 3BDCA 4DN4M 5HURA 2L55A 3IFTA 5BN5A 1WTRA 3URYA 1KDBA 5EKIA 3M3YB 3H91A 4ZYSA 2QKIC 3RZDB 4K8IA 2B2TA 2JA6B 1S5FD 3NBHA 4AYBB 2RKSA 4K6DA 1SJED 4C3JB 2JP1A 5D3IB 1Y8OB 3KF8A 2KUMA 2Q8TA 1LT4D 2K28A 1BF4A 3KBGA 2HCIA 5I6YA 3EQLC 4M1UB 2F0UA 2F3WA 2SOBA 5IGEA 3TP6A 2IT1A 1V1PB 2CQAA 4DU9A 1TWFB 1GXDC 4XYQA 3VR3A 5FO9B 4TSSA 2KA7A 1G91A 2F0QA 5JVH3 2F03A 4ZKBB 3CRLC 1DZ1A 4HEDA 4KN7C 2F0OA 4HTHA 4OO1I 1EEID 4DAPA 2B63B 2KHSA 1BXTA 1Y69U 1CTMA 2LFNA 1TKWB 4QIWB 1CT1D 5ELDA 5C3XA 1Z47A 5AFWA 4HSVA 3DWAA 2TSSA 1SFOB 4K2LA 3MXPA 2AQ3B 3HOVB 3FMCA 2K1BA 4FF1A 3HOYB 3C1FA 4ZUJA 3CU7A 1STNA 4XTCS 5IIFA 3BVZA 4HMJA 4KJOA 2KQ3A 1TVXA 2WB1B 3SK8A 4FVMA 1ONLA 4RKLA 5KYIA 5D65A 2K03A 1CI3M 5KIXA 1MSHA 2O2LD 2WV6D 1V1OA 3I73A 1IKLA 4EQNA 1F2MA 4IN3A 2XRQD 1T5EA 2F0SA 4RA8A 2A6HC 3GO5A 1D1KA 2RQXA 3HEJA 3M85A 4IFDI 4A3IB 3OHXC 2EYMA 4R8IA 3EFXD 1PFBA 1G2SA 2A6EC 2KOLA 3AU7A 3PUWA 4OL7A 3S15B 4XQJA 5C44B 3G7LA 1QNUA 5C4XB 1WTXA 5CV7A 2VNUD 3AB9A 3JAML 4NKLA 2F0EA 1BOSA 2MGSA 1JOOA 2ENBA 5A35A 1HTLD 5EPJA 2A68D 3EJIA 3HGBA 1XYIA 3V2TA 3HRZC 2GA4B 3R93A 1H9SB 5JVG3 1SNOA 3JAME 1ILPA 2K5DA 3BG3A 1QE6A 1EY0A 3NP8A 2AWOA 4XT3B 1GUTA 2X6GA 2EYPA 1DXMA 2PQEA 5J1ZA 1B9MA 3SE0A 1QILA 4UAIA 1BO0A 2C9OA 1EY6A 4OO1G 1BUVT 1PXUA 1PTOC 1D5ZC 1GHJA 1K8MA 2XIWA 2NYZD 3PUXA 5CBEE 1A2TA 3RMHA 5EKLA 1B2TA 3K5LA 3P7JA 2DNEA 1BR9A 2EVBA 3N6RA 4L8JA 2F0DA 4CJ0B 3CHBD 4H44C 3E6ZX 3TZDA 4OO1H 1JE4A 5JAVA 3P75A 4K5VA 5BN3A 3D4DA 4FXDA 3D31A 1RDPD 2LY7A 2HDLA 5CV4A 5TSSA 4KY7A 3M4OB 4ZRZA 2IPKD 2SNSA 3MXNA 3K57A 1WTWA 1WTQA 1PRTD 1GUSA 1PMRA 1O7ZA 1MI2A 2LS01 1CQVA 1HXYD 2KECA 5CC4A 1JICA 2ZXPA 4KD4A 2K7VA 3E5SA 3T13A 3I91A 3CRKC 3U9SA 3M7NA 1R9TB 1OXUA 5C0XI 2XN9C 2JA8B 3DM1A 2K5WA 1WTOA 3KLRA 3DMUA 1E2VA 5CYUA 1BQQT 4IFDG 1TY0A 4NW2A 3KK7A 1H9KA 2I07B 3HKZB 3U9OA 5IGDA 3M4YA 2JSOA 3VA7A 4ILWA 4EGVA 2N55A 5JJZA 4G7OC 4RGMA 5M3FB 1ZYRD 3K7AB 1MGSA 2NBFA 4IFDH 1QCBD 2VXWA 5FO7B 1VMPA 4Q0FA 1SJHD 1I4GA 3HS0C 1CK1A 1H9RA 2A5HA 4DFAA 2SDFA 5M9OA 1STAA 2CW0D 4WJWA 4Q5VA 4LK1C 3QOLA 2R6GA 1Q3LA 4ME5A 1ET6A 3A56A 3H0GB 4IUNA 4K2KA 1QOHA 4BS9A 2Z4IA 5FK9C 1EZ8A 4QUFA 2EYLA 3GTQB 1NCVA 1TS3A 1J8IA 1DM0B 4BY7B 2A6ED 4EQPA 2L4NA 2F0GA 1LTAD 2F0IA 1STHA 1BNZA 3IAYA 3H94A 1GUWA 4NDXA 4G4KA 5IODA 1B3AA 3I70A 3F2UA 1EQVA 2JEAI 5E4WC 4CBVA 2E76C 5K36G 1SXTA 2E2JB 1QG7A 3H6MA 2YYZA 4A3GB 3X3NA 3V96A 4KKTA 3TSSA 5CMDA 1IW7D 1SBBB 1B53A 2K04A 3ERQA 4A3KB 4IZ8A 2EYFA 3PIP3 2WKCA 2RDFA 1CZGA 1CHQD 4DA2A 5K36H 4IUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I6W A;  4K5X A;  2F0H A;  2EYO A;  4K5W A;  3P1H A;  4DFA A;  2F0D A;  3SK4 A;  2M00 A;  1TQO A;  4DU9 A;  5CGK A;  3MVV A;  5CV8 A;  5KGU A;  2F0W A;  3ITP A;  5M9O A;  1NSN S;  1STA A;  3HEJ A;  2NUC A;  1JOK A;  3MHB A;  3QOJ A;  5JAV A;  4R8N A;  4KV6 A;  4NMZ A;  4RKB A;  4WOR A;  1SYG A;  2WAC A;  4TRD A;  2F0Q A;  3QOL A;  2EYM A;  3P75 A;  5C5M A;  1EYD A;  3VA5 A;  5J22 A;  4K5V A;  4ME5 A;  2EY1 A;  3D4D A;  4DGZ A;  1KDA A;  3TME A;  4I65 A;  4DF7 A;  2F0J A;  5IGF A;  1RKN A;  2F0O A;  4HTH A;  3TP8 A;  4EQO A;  2EY6 A;  4PMB A;  1II3 A;  4OL7 A;  2LKV A;  4N9T A;  5CV4 A;  4ODG A;  4ZUI A;  5IGB A;  5C6A A;  5K5P A;  5KEE A;  4KY7 A;  1SYE A;  5CV9 A;  1A3T A;  3NHH A;  1IHZ A;  4IUN A;  1KAB A;  1SNQ A;  2PZW A;  4K2K A;  4J6H A;  1ENA A;  2O4X A;  2SNS A;  3LX0 A;  5F2D A;  3SHL A;  2OF1 A;  4K8J A;  2F0M A;  3T16 A;  5IGG A;  1EY5 A;  2KHS A;  5C5L A;  4H7B A;  5CV7 A;  3D4W A;  1EZ8 A;  1AEX A;  1TR5 A;  3OMC A;  1JOR A;  4ZQ3 A;  5EGT A;  2EYJ A;  2F0K A;  4PMC A;  1SYF A;  2EYL A;  5CV6 A;  4F8M A;  4B9X A;  5JOB A;  4NKL A;  1SYB A;  5EKK A;  5CC4 A;  1EYC A;  2F0T A;  5I9O A;  2F0E A;  2F0N A;  3NQT A;  3NXW A;  4EQP A;  5C3W A;  5J39 A;  1JOQ A;  1JOO A;  2ENB A;  2F0G A;  3C1E A;  3R3O A;  2F0I A;  1EY8 A;  2SNM A;  4KD4 A;  3S9W A;  5C3X A;  2F0L A;  3EJI A;  3OSO A;  3E5S A;  3T13 A;  2F0F A;  1NUC A;  4IAL A;  3SK6 A;  3BDC A;  1A3U A;  1STH A;  4WRD A;  3V2T A;  4MIU A;  5HUR A;  2F0P A;  4F7X A;  4KY5 A;  4K2L A;  5C4H A;  3BDL A;  3MXP A;  5IOC A;  1STG A;  1SNO A;  4PNY A;  1A3V A;  3TP5 A;  1A2U A;  3HZX A;  4S3S A;  1F2Z A;  3PMF A;  3MZ5 A;  3TP7 A;  1SYC A;  4NDX A;  3DMU A;  1EY0 A;  1SND A;  3DHQ A;  1KDC A;  3NP8 A;  4QF4 A;  5DEH A;  5DAU A;  3C1F A;  4ZUJ A;  1KDB A;  1STN A;  1U9R A;  4NP5 A;  5IIF A;  5IOD A;  2PZT A;  2EY5 A;  1EYA A;  1EQV A;  2HQE A;  4KY6 A;  4QMG A;  3SXH A;  4K8I A;  3RUZ A;  2EYP A;  1ENC A;  1SNC A;  1SYD A;  2EY2 A;  4HMJ A;  4KJO A;  2PW5 A;  2KQ3 A;  5E1F A;  2PQE A;  5J1Z A;  4J1M A;  1EY9 A;  2F3V A;  3U9O A;  5I9P A;  3D8G A;  5IGD A;  2OXP A;  4YIJ A;  4LAA A;  3H6M A;  1EY4 A;  2EYH A;  4ID6 A;  5IGC A;  3SK8 A;  3SK5 A;  3EVQ A;  4B9W A;  5NUC A;  2RKS A;  4RKL A;  4KJN A;  5E3F A;  1EY6 A;  3OMG A;  3OWF A;  4HMI A;  1SNP A;  5KYI A;  4K6D A;  2F0V A;  1STB A;  4KD3 A;  5HGT A;  3SR1 A;  1TT2 A;  4G57 A;  5KRU A;  1STY A;  2OEO A;  2PW7 A;  3NK9 A;  1F2Y A;  5KIX A;  4QB4 A;  3ERQ A;  5CR3 A;  4IZ8 A;  3NUC A;  4E6I A;  2EYF A;  5ISR A;  1SNM A;  2QDB A;  1EZ6 A;  2RDF A;  3D6C A;  4KTA A;  5I6Y A;  1A2T A;  3MEH A;  2RBM A;  1EY7 A;  4K14 A;  2PZU A;  2F0U A;  1F2M A;  2F3W A;  5CV5 A;  5EKL A;  4EQN A;  5C4Z A;  2PYK A;  4EVO A;  1KAA A;  2SOB A;  5IGE A;  3TP6 A;  2F0S A;  2EXZ A;  4N9P A;  4KHV A;  5KYL A;  3QB3 A;  3ERO A; 
#chains in the Genus database with same CATH topology
 3R2T A;  1OXS C;  4KMU C;  2YU9 H;  3S1N B;  1SMY D;  3TN2 A;  5CV8 A;  4K0K Q;  3OIP A;  1W2B A;  1HRJ A;  1K28 A;  4KV6 A;  1QUQ B;  5FOB B;  4RHR A;  1SRO A;  2FIN B;  5C0X G;  3Q0A A;  5M5Y H;  1BBU A;  2JE6 I;  3PIO 3;  1VQB A;  1LTI D;  1XPR A;  1LAC A;  1HQR D;  3KYH C;  3KLS X;  4QL5 A;  2IW3 A;  4PMB A;  3HOX G;  3FEW X;  5ELE A;  5EBC A;  3A8I E;  3LNN A;  2M2L A;  1KAB A;  3OIQ A;  3CMA A;  1ENA A;  1B1Z A;  1X3Q A;  5F2D A;  1PYB A;  4DV7 L;  2F0M A;  2KCN A;  3T16 A;  1RCV D;  5G3L D;  4JI8 Q;  5IGG A;  1MJC A;  1HQM C;  2CKZ B;  4IPD A;  1X54 A;  3OMC A;  1PTO H;  2F0K A;  2FJ2 A;  5JEA G;  1K0R A;  1AW7 A;  4B3T Q;  4UDU C;  4A76 A;  1C7Y A;  3K5N A;  5C0X H;  3K8A A;  3KOJ A;  1TWH H;  1CA6 A;  1JOQ A;  5GAH C;  5I2Y A;  2XSC A;  1FD7 D;  1NR4 A;  3D4R A;  3G71 A;  1VQI A;  1EIH A;  2MO1 A;  2K5Q A;  2NZ1 D;  1Q7Y C;  3FKI G;  3HOX H;  3I4M B;  1KNE A;  1L1O C;  4UP7 A;  2A68 C;  1I4Q A;  1X3G A;  2F4I A;  5C3E G;  1R4P B;  2WAQ B;  5ELB A;  3A54 A;  4A3M B;  3RLO A;  3HZX A;  4S3S A;  4C56 C;  4JI3 Q;  1UE1 A;  4G7Z C;  5JEA H;  2A69 D;  2JXM B;  3CCR A;  1E1T A;  1YJN A;  1WD0 A;  1OXV A;  2PZT A;  4JBW A;  3STB D;  3EA6 A;  1HH2 P;  1TWG B;  2LSS A;  3OOC A;  2PW5 A;  1PFN A;  5E1F A;  3QJY A;  3T1Y L;  1LTS D;  3FKI H;  3LWU A;  3D8G A;  1U4L A;  1G8Z D;  2UXC L;  2WIN B;  4PV1 C;  2K33 A;  4B9W A;  1PFS A;  1S5E D;  3BJU A;  4Z9C B;  5C3E H;  3OMG A;  3CQZ B;  5HGT A;  3SR1 A;  1EEF D;  2CHB D;  2VW9 A;  2PMZ B;  1STY A;  4KI0 A;  2LXK A;  2BDN A;  3S14 H;  3F8T A;  3FP9 A;  1TS4 A;  1TWC B;  5LMN L;  1UE6 A;  3NBI A;  2B2V A;  3H3V C;  2QDB A;  5M3M B;  4FF2 A;  3TDQ A;  1AZP A;  4B3S Q;  1EY7 A;  1GJX A;  1WTH A;  4DR3 L;  4L5R C;  1SAP A;  3GV6 A;  3NTK A;  4EVO A;  1KAA A;  1V1Q A;  4N9P A;  4GOP B;  4KHV A;  3QB3 A;  4C2M H;  5LMU Q;  2EYO A;  1A8V A;  4RCO A;  1KL9 A;  1XPU A;  1TQO A;  4BA2 I;  1ENF A;  3D0F A;  1LT3 D;  1NSN S;  1ROD A;  2NTS A;  2E2I B;  1JOK A;  3KBX A;  2F4V L;  1MBY A;  4OGQ C;  4TRD A;  3W1G A;  4LUO A;  3BVG A;  2EY1 A;  1O78 A;  3VYT A;  3H15 A;  3F2D A;  2K75 A;  2YU9 B;  1VDZ A;  3Q24 A;  3CCE A;  3C3L A;  5IGB A;  5C6A A;  3NWS A;  2NVX H;  1L1O A;  1A3T A;  5T1I A;  3LX0 A;  3QR8 A;  1K8O A;  4K8J A;  4ZLT F;  4L5S A;  2OTL A;  1ZEQ X;  2UUA L;  1TR5 A;  4MHE A;  1E0B A;  4JI6 Q;  1PRT C;  2N49 A;  1HR0 L;  1R4Q B;  5C3W A;  2E5L Q;  4HIM A;  3K81 C;  4JOI C;  2I46 A;  4ABN A;  4DR7 L;  1EWI A;  2EPB A;  3VYU A;  2G9H D;  2NVY B;  3I72 A;  5FKA C;  4IPC A;  1I50 H;  3G6E A;  3EIV A;  2DNC A;  4A3B G;  2MUY A;  3LGJ A;  4DR2 L;  1CQF A;  5C4H A;  3CME A;  1VQ6 A;  3H3V I;  3HFZ B;  4BWG B;  4NPS A;  4DV3 L;  3DHQ A;  1KDC A;  3DWQ A;  4NP5 A;  4DUY L;  1VS0 A;  1C48 A;  4KY6 A;  1PH1 A;  1NBW A;  1SYD A;  4K6L A;  1X3E A;  2Z6K A;  4RG1 A;  1EY9 A;  2J0T D;  3R8B A;  2JA5 G;  4CDF C;  2QEJ C;  3M9B A;  4Y52 H;  1TY2 A;  4A3B H;  4QJF A;  1SNP A;  1JC7 A;  1IBL L;  1K8G A;  1TT2 A;  1S5C D;  1ZYR C;  4X3U A;  3S1R B;  1XNR Q;  3PIP A;  3FKI B;  4E6I A;  4X65 Q;  1AN8 A;  1HFN A;  1VQH A;  3GTO B;  2E2D C;  3SEB A;  5M5W H;  4K14 A;  2RBM A;  1EFI D;  5C3E B;  4DAY A;  1K8A C;  1Q1E A;  2JA5 H;  4K5X A;  5ELC A;  2MJ8 A;  3AYH B;  3OW2 A;  1BCP F;  1KQS A;  2QIL A;  2KBN A;  3S14 B;  2F0W A;  2VUM B;  2NUC A;  1VF5 C;  4ME3 A;  2MQH A;  3MXU A;  1LT6 D;  2CW0 C;  1Q90 A;  4P75 A;  5IWA L;  3GTM H;  4ZK9 B;  4POG A;  2R61 A;  4LF9 Q;  3TS2 A;  1HJP A;  2E74 C;  4DV1 Q;  1LLR D;  2A73 B;  4YCW A;  4C1N K;  1Q81 C;  3BU2 A;  2EJG C;  4C3H G;  1QWY A;  3ND9 A;  2D2C C;  3EN2 A;  2O4X A;  3H09 A;  1GUO A;  3E0J A;  2Z0S A;  4ZCK A;  3CC4 A;  5C5L A;  1B3Q A;  1XMQ Q;  1YNX A;  4NXM L;  2EYJ A;  3OTO Q;  4B3R Q;  2OQ0 A;  4BXX G;  1EIF A;  4RHS A;  1EYC A;  2NVX B;  1Q86 C;  1G6P A;  4HSP A;  5HGQ A;  5C4J H;  1O7Y A;  4QY7 A;  4B3M L;  1U0L A;  1Z7T A;  1FJG L;  4A3F G;  4C3H H;  4LFA Q;  3GTG H;  1K3B C;  1F9R A;  3U4V A;  4Y7N H;  1D5M C;  1SDF A;  4BY1 G;  1VQF A;  4A93 G;  3PMF A;  5BR8 L;  1WYD A;  1LTL A;  1X3F A;  2FMC A;  4BXX H;  5BN4 A;  3JAM i;  1WTP A;  4A3E G;  2EY5 A;  2X6L A;  3F1Z A;  4OIJ A;  2HQE A;  3SXH A;  1BCP B;  1VQ8 A;  2RSN A;  1N33 Q;  3HOW G;  4BBS B;  1I50 B;  1PDQ A;  2VB3 X;  5GAE C;  1X55 A;  4A3F H;  4LF5 L;  4FP5 D;  3SK5 A;  1UAP A;  2G9D A;  5HY6 A;  4LF4 L;  4BY1 H;  5EAY A;  4A93 H;  3K5O A;  5KRU A;  2HD3 A;  5DLQ E;  2PPB C;  1AP0 A;  3BYT B;  4O42 A;  1SE8 A;  1TWA B;  4A3E H;  1IW7 C;  4LFC L;  1K3R A;  3D6C A;  1S5B D;  3RN5 A;  4IUP A;  1PH7 A;  1FVI A;  3HOW H;  1KLU D;  1Z6H A;  2K14 A;  2WP8 J;  2EDG A;  2K05 A;  3K58 A;  4JI4 Q;  4LF8 L;  1HA5 A;  1M4V A;  3TZU A;  4X64 Q;  5CGK A;  2VL6 A;  1OO9 B;  3ITP A;  1SR3 A;  4A3J G;  3ERS X;  1YNJ D;  4AIM A;  1SMY C;  3QOJ A;  5JPM C;  2SEB D;  2IX0 A;  4RKB A;  1XXG A;  5M5W B;  5E7N A;  3I4N G;  1NTG A;  1MKH A;  1YEZ A;  2MHV A;  1OXX K;  2B8G A;  2JA5 B;  4MNO A;  1F77 A;  2ZM6 Q;  1VCI A;  4IUU A;  1Y1V G;  3T4A C;  3PV0 A;  1JQY D;  4J6H A;  2VB2 X;  2O5I C;  2IHF A;  1ILQ A;  5GAG C;  3GTM B;  4GLA C;  4A3J H;  2HHH L;  1JOR A;  3AFP A;  1KTK A;  3AEV A;  2NVQ H;  1S40 A;  3I4O A;  5CV6 A;  2VQF L;  4F8M A;  4DV5 L;  1WVL A;  4DR6 Q;  4KHP Q;  1AZQ A;  3I4N H;  1Y8P B;  3VR6 A;  1D6E C;  1ML0 D;  2BA0 A;  2F0T A;  4OIK A;  3Q8D A;  1YI2 A;  3H3V H;  1RHP A;  1XPO A;  2DUD A;  2CVR A;  3W3A A;  2ZTC A;  4XIG S;  1Y1V H;  4XQN A;  5D14 A;  2A19 A;  3I8Z A;  4DNI A;  2R92 B;  4WRD A;  2Z8L A;  1E22 A;  5IOC A;  3I3C A;  4JYA Q;  4JV5 L;  5IE8 A;  4UY8 C;  4BBR G;  2EZV A;  2K6A A;  4QQB X;  1N32 L;  2IX1 A;  2A69 C;  4CDD C;  4F87 A;  3GTP B;  1Y8N B;  1FGB D;  1ENC A;  1IYJ B;  2EY2 A;  2Y0S G;  3STB C;  2JA7 G;  4Y7N B;  3HOZ B;  1I6H B;  1ZKO A;  1SRU A;  2KCM A;  4TQU S;  2EYH A;  3G6J B;  1FGU A;  2DY8 A;  3BDO A;  3T56 B;  4GN5 A;  4BBR H;  5H1S E;  4LF7 Q;  3ND8 A;  4I7Z C;  1K9M C;  1HNW L;  3NPP A;  4DV2 Q;  1PVO A;  2O5J C;  4A3F B;  3NBH B;  2N88 A;  4FXK C;  1EQT A;  3GV3 A;  3J7Z C;  1PYW D;  1UE7 A;  2K5H A;  3K59 A;  4DKA C;  1F9P A;  3W1B A;  3NSW A;  4DR4 L;  2VZA A;  2PNH A;  4A93 B;  3TRZ A;  2Q2H A;  3OPO A;  5EPL A;  2F0H A;  4C3I G;  1Y1W B;  4N8F A;  1SE4 A;  3KF8 B;  3WDN A;  4JI0 L;  1EWC A;  4A3E B;  1G51 A;  1MIU A;  1VMC A;  1WCM G;  4R8N A;  4HCE A;  1JCK B;  1L0W A;  2WAC A;  3HOW B;  1T5X D;  2L1B A;  3I90 A;  3T1H L;  4GNX C;  3CC7 A;  2VQE Q;  4I65 A;  3S16 H;  2PCF B;  5EQ0 A;  1RKN A;  1II3 A;  1CHP D;  3BS1 A;  1YJ9 A;  1MSG A;  2PZW A;  3CF5 A;  4C3I H;  5D3D A;  3GQB A;  3T53 B;  1AE3 A;  1EOV A;  2BE5 D;  2UUC L;  1D5X C;  1WCM H;  4MTN A;  4PQX A;  2NVT H;  4U68 A;  5COR A;  2NTT A;  5IYC G;  1B50 A;  5EKK A;  1ASZ A;  2OQK A;  4L63 B;  5J39 A;  4JBJ A;  4UP8 A;  5EBD A;  5M5X H;  2K4K A;  3OYY A;  2MNA A;  2JYO A;  1HZC A;  2F0L A;  2Q2U A;  1RF2 D;  2F0F A;  4CJ2 C;  3I56 A;  1K83 B;  2ZXR A;  2KHJ A;  4LMQ D;  4OEL B;  1EUJ A;  2F0P A;  4HR7 B;  5IP7 G;  1STG A;  1KRT A;  2B8F A;  3M4Q A;  5IYC H;  3X3M A;  2A8V A;  5DM7 3;  1B4O A;  2BA1 A;  2I5L X;  1JJ2 A;  1YJW A;  3BZC A;  1CSP A;  2RDH A;  4R4I A;  2UXC Q;  4F88 A;  1YHQ A;  1NAP A;  2H1E A;  1XJV A;  1UE5 A;  1GHK A;  4OHJ A;  1JR0 D;  2IWH A;  4DNT B;  3GTK H;  2PI2 E;  1TXY A;  5I9P A;  4YIJ A;  1QZG A;  3PF5 A;  4IPG A;  2Z4H A;  2ICI A;  5LMN Q;  1EFW A;  4HMI A;  1DCZ A;  4OX9 L;  5IP7 H;  3QIA A;  2K5N A;  3S1M H;  4XQQ A;  4DUZ L;  4DV6 L;  2UXB L;  4IPH A;  4XYO A;  4DR3 Q;  4QB4 A;  4IQZ A;  1V43 A;  4GNX A;  3I4L A;  4KTA A;  1O7L A;  4CJ1 B;  3MEH A;  3PGZ A;  1CKN A;  4CKB A;  3DM3 A;  4IFD J;  3ERO A;  2JA6 G;  2F4V Q;  2ZT9 C;  1PH9 A;  1PRT B;  4DR1 L;  2PO4 A;  5AJ3 Q;  1ESR A;  4NMZ A;  4X66 Q;  3I55 A;  4AYB G;  1SYG A;  2Y0S B;  4FF3 A;  1ICF B;  2B2Y C;  2JA7 B;  4C3J G;  3VA5 A;  1IYU A;  1CZW A;  2RCN A;  1JWU D;  1KDA A;  3NE5 B;  1C9O A;  3IKJ A;  4DR5 L;  2EY6 A;  2XVS A;  4ODG A;  2UUA Q;  2CH4 A;  4IO9 A;  3RZD H;  2ZXO A;  2JA6 H;  1FR3 A;  3J7A V;  1I94 Q;  4GN3 B;  1N36 Q;  3CC2 A;  3CKI B;  1TS5 A;  4ZQ3 A;  4CKC A;  5EGT A;  4HJ7 A;  2C5C A;  4DR7 Q;  1SYF A;  1H9S A;  3CCJ A;  4C3J H;  1TS2 A;  4WJ3 M;  1J5E Q;  5I9O A;  2DY7 A;  3NQT A;  2F0N A;  3J81 L;  1DD2 A;  2B2V C;  1HA6 A;  3AMU A;  3C1E A;  4C3I B;  3GTJ B;  1JJG A;  3S2H B;  2SNM A;  3FPP A;  2PMZ E;  1WCM B;  3MAQ A;  2R7F A;  3PO3 B;  4YHH L;  2GVA A;  3CW2 C;  1EQQ A;  4F7X A;  4DUY Q;  3BDL A;  4OWX B;  3VR5 A;  2AUJ D;  1CKO A;  1P16 A;  1WTV A;  1SLJ A;  1SND A;  1I4H A;  2L0C A;  1I4P A;  1CFM A;  3VYS A;  5IT9 L;  4IUT A;  4RCN A;  1HCZ A;  1U4P A;  2Q2T A;  2NZO A;  1ICW A;  1V9P A;  2B39 A;  2UXD L;  4M8A A;  4PMW A;  2B3G A;  3T51 B;  4CDC C;  4J1M A;  1M1K C;  1LV9 A;  3BZD B;  2KJX A;  2ZJR A;  4HJA A;  1F9Q A;  2OXP A;  1I3Q B;  2RHS B;  1EY4 A;  3EBE A;  3ONA B;  3EVQ A;  3PSI A;  3CCL A;  4KD3 A;  1LTG D;  3DLL A;  1WFQ A;  3VR4 A;  5IT9 E;  3M4P A;  1RTO A;  2FMM A;  4JG2 A;  1F9S A;  1I4R A;  2B2Y A;  4JVZ A;  1HNX L;  3A7A B;  1NE3 A;  1LAB A;  3S1Q B;  3HOY G;  2JN4 A;  3DXJ C;  2E8G A;  2D0P A;  2HIX A;  2PYK A;  4OWW B;  3QG1 A;  1L0Y B;  5I2X A;  3A0J A;  4UHV A;  2M00 A;  2NB0 A;  1FNU A;  2B2U A;  5IWA Q;  4FDB A;  5IYB G;  3CXC A;  1YIJ A;  1U4M A;  4WOR A;  3CPF A;  2F3I A;  1YNJ C;  3ICE A;  1PTO F;  4R4T A;  3PUZ A;  1RD9 D;  4ZKC B;  5J22 A;  4HN7 A;  4DGZ A;  5L37 A;  2D5D A;  3C46 A;  5IGF A;  3HOY H;  3K80 C;  2Z6K C;  4N9T A;  2OT2 A;  4NXM Q;  2L5T A;  3NHH A;  4V0B A;  4XT1 B;  2BDO A;  4RAU C;  1YNN D;  2OF1 A;  2ZJP A;  4H7B A;  5IYB H;  3D4W A;  3V05 A;  3W2D A;  5JJI A;  1RTN A;  4B9X A;  5G3L F;  2N8N A;  3WWV A;  4J8Q A;  4B3M Q;  1HPC A;  5KNC A;  4CKE A;  1UEA B;  5FLX L;  3IL8 A;  5FJ8 G;  1VQO A;  4TKO B;  3S9W A;  3RNU A;  3MXN B;  4A4I A;  5C0X J;  2BCO A;  4GKJ L;  4J15 A;  5BR8 Q;  1XNQ L;  4MIU A;  1HUN A;  1F2L A;  3WOE A;  4RGO S;  4LWC A;  4PNY A;  1A3V A;  3WOF A;  1A2U A;  5M5Y B;  5C44 G;  3MZ5 A;  1SYC A;  5DEH A;  4RGN A;  1E2W A;  4WFN 3;  3I2Z A;  5FLX E;  1U9R A;  2H4O A;  4WJ4 A;  2D0O A;  2X69 A;  5FJ8 H;  2AWN A;  5JEA J;  2FFK B;  1BCP D;  2H5X A;  3P20 A;  1PZK D;  1DJR D;  4LF4 Q;  4U67 3;  1FNV A;  1JWM D;  1PTO B;  4YWM A;  1GUN A;  3S15 H;  2QF7 A;  4HIK A;  1X56 A;  4LFC Q;  3F2C A;  4H13 C;  4OEM B;  3GD7 A;  1TWH B;  5C44 H;  2OEO A;  1F2Y A;  3KDF B;  4K0K L;  2XGT A;  5COY A;  4P74 A;  1VQE A;  2L9H A;  1SSO A;  1Q1B A;  3A8J E;  3HOX B;  1SNM A;  4DK0 A;  1JB7 A;  1QVG A;  1CM9 A;  2AQ2 B;  3UI2 A;  3RZO H;  1TU2 B;  2DN8 A;  3A7L A;  2EQS A;  2YTV A;  3TEH B;  2ASB A;  4DAV A;  4IUQ A;  5EJW A;  2RA4 A;  3MFG A;  2HCC A;  1HUM A;  4YWK A;  1KAW A;  2BH2 A;  2EXD A;  4PZ8 A;  1EIG A;  3DEP A;  2YTY A;  2KED A;  4R1J A;  1YZ6 A;  1PV4 A;  4DF7 A;  4CGY B;  1VQ7 A;  2QCP X;  4L6T B;  4B08 A;  1RIP A;  1HFG A;  1UNS A;  1VQK A;  3BYY B;  1PH8 A;  1LTB D;  5K5P A;  5KEE A;  1ZXT A;  1SYE A;  2E75 C;  2R3Z A;  2Q8I B;  2Q8R E;  1JMC A;  3SHL A;  2VQF Q;  1XMO L;  3PQI A;  3CAM A;  4DV4 Q;  3HOU G;  2KVM A;  1EY5 A;  1VQD A;  4KLK A;  2BE5 C;  4GS3 A;  3E3X A;  2UU9 L;  1GUG A;  3NEL A;  4V19 0;  1O80 A;  4X3K A;  1AE2 A;  3SVM A;  4JI3 L;  3NXW A;  4KKS A;  1S4Z A;  2JK8 A;  3PIO A;  1KLG D;  4C2M B;  3FPU B;  4FXG C;  4AQY L;  3ZYY X;  2OTJ A;  2Q2I A;  4JV5 Q;  3M7G A;  4KN4 C;  3SK6 A;  4IOC A;  4C1N I;  3HOU H;  4KY5 A;  3J7A F;  1N32 Q;  2WKD A;  3MTS A;  1MHW C;  3TP7 A;  1DON A;  5DAU A;  4HCS A;  1EYA A;  1DOM A;  3Q6S A;  2QA4 A;  1D7Q A;  1PA6 A;  1GO3 E;  2PNR C;  5LL6 X;  1YHB A;  1A0I A;  2F3V A;  1I6V C;  4LAA A;  2OWO A;  4GZY C;  1D2B A;  1YBY A;  5LHY 1;  1EL0 A;  3OWF A;  3UE1 A;  1PLF A;  2BOS A;  3AFQ A;  3M4O H;  1HNW Q;  5LMU L;  1A15 A;  1QZH A;  5JJL A;  4LW1 A;  4HJ5 A;  1VQN A;  4IUR A;  2JA8 G;  3FVQ A;  2B2W C;  1KNA A;  4DAM A;  1VQJ A;  1XX8 A;  3E9H A;  2LMC B;  4DR4 Q;  1QUQ A;  1N34 L;  3K5M A;  1S5D D;  2FXQ A;  4P71 A;  3GP7 A;  3U4Z A;  1OTC A;  2J4X A;  3S17 H;  1QB5 D;  4JI0 Q;  5DM6 3;  2NN6 I;  2HT1 A;  1WI5 A;  5IYD G;  3ER0 A;  2TMP A;  1A62 A;  1RJT A;  4X62 L;  4LF6 L;  3D6W A;  1B44 D;  4HIO A;  1H95 A;  3T1H Q;  4XXE A;  3J80 L;  2ATW A;  3MC0 B;  3RZO B;  1R9T H;  3ZJY C;  4KKU A;  2JA8 H;  5M3F G;  1A6X A;  4JI5 L;  4R9W A;  1I4X A;  4NXN L;  4EQO A;  2LKV A;  2Z1C A;  4UPA A;  5A2Q L;  4A3B B;  2KHI A;  2E5L L;  2UUC Q;  1FNW A;  3DUZ A;  1IHZ A;  1NJI C;  1G29 1;  1FYC A;  5IYD H;  5LL6 S;  3KUP A;  3J80 E;  3N52 A;  4LFB Q;  3MXG A;  2IX3 A;  1C4Q A;  1X3P A;  2K52 A;  5M3F H;  5GAD C;  2KCT A;  4APV A;  5KYL A;  1B9N A;  3RD4 A;  5A2Q E;  1W6K A;  4FNF A;  5CBA E;  2NWG A;  2QGQ A;  5KNB A;  4H0L C;  4JI2 Q;  3NTH A;  1JE5 A;  1LT5 D;  3HKS A;  1A3U A;  1PZI D;  2AUK A;  1S3O A;  1UUP A;  2MPM A;  3ULL A;  2R93 G;  1W3S A;  1EU4 A;  4G7H C;  1WD1 A;  3SDZ A;  3TP5 A;  4CHT B;  4QUC A;  1Q82 C;  2B2W A;  4RWS C;  3HG9 A;  3TBI B;  4QMG A;  4CDE C;  5T1G A;  1RL2 A;  2CFM A;  2L15 A;  1DOL A;  4DXF A;  1CA5 A;  3KLS A;  3HOU B;  2VY3 A;  4OX9 Q;  1G2T A;  4DUZ Q;  3ULP A;  2E2H H;  2UXB Q;  1IKM A;  4DK1 A;  2D62 A;  4KJN A;  3A74 A;  4GLV B;  4GOP A;  2R93 H;  1STB A;  1STE A;  2EOT A;  2KEN A;  3MA2 B;  4DV0 L;  5C4J B;  2FHT A;  1XWE A;  4X3S A;  1OXT A;  1J9O A;  4GKK L;  1MD2 D;  3A8K E;  5ISR A;  3GTQ H;  4C3H B;  2R7Z G;  3GTG B;  2PZU A;  5CV5 A;  3A55 A;  4BY7 H;  1KXL A;  1HTP A;  4DR1 Q;  2ICE C;  1I5F A;  3E0E A;  5I6W A;  3F2B A;  4X3T A;  2YTX A;  1L0X B;  2KEE A;  1CSQ A;  5KND A;  1H9M A;  1SE3 A;  3S24 A;  2C35 B;  2K5V A;  2XTI A;  1V1P A;  1U4R A;  3R2I A;  3BVM A;  4DR5 Q;  3S17 B;  2EJM A;  5C5M A;  1EYD A;  3OWE B;  5EPK A;  4B3R L;  2R7Z H;  4JK1 C;  4O1N A;  4A3K G;  1KD1 C;  3U50 C;  1VQ4 A;  1GD7 A;  2JJQ A;  4FF4 A;  4ZUI A;  1IBM L;  3O13 A;  4BY1 B;  5CV9 A;  2QDL A;  2E2J H;  3CPW A;  1AEX A;  1YNN C;  3L0O A;  2RVL A;  2M9V A;  4PMC A;  4AH6 A;  4A3D G;  5ELO A;  1M8A A;  1CUK A;  1L1O B;  3J80 c;  1E3P A;  4EX5 A;  4A3K H;  3R3O A;  2V4D A;  4P73 A;  1EY8 A;  4HJ9 A;  1SE2 A;  4DV7 Q;  1YHA A;  1VQ9 A;  3L7Z C;  1VQ5 A;  1E2Z A;  1NUC A;  2RCF A;  4IAL A;  1QVF A;  4YCV A;  1JJC B;  3NTI A;  1VQP A;  1V8Q A;  4N8X 1;  1Q8I A;  1VF7 A;  1QJO A;  1F2Z A;  2NN6 G;  3S1N H;  2UXD Q;  4A3D H;  4KHZ A;  2WII B;  3Q22 A;  3KFU A;  3K6O A;  1PRT F;  2L11 A;  2GVB A;  1SNC A;  5DNF A;  1BBX C;  3PO2 G;  1BCP C;  2Y0S E;  4A3J B;  2I0Q A;  1K73 C;  1EU3 A;  3VDY A;  1VQA A;  2NVQ B;  5NUC A;  4HID A;  1IL8 A;  3I4M G;  1ET9 A;  5E3F A;  1D8L A;  2CWA A;  3L9A X;  3I4N B;  2F0V A;  2JQO A;  3QO2 A;  1HNX Q;  2A1A A;  4X64 L;  4DXG A;  2NN6 H;  4POF A;  2L12 A;  1AH9 A;  2WAQ G;  4A3M G;  4YY3 L;  5CR3 A;  3T1Y Q;  1BDO A;  1Y1V B;  2HUG A;  5GRO A;  2E2H B;  2R93 B;  1DOK A;  3PO2 H;  2ZTD A;  1BKB A;  2A6H D;  2EXZ A;  3QWN A;  2ZM6 L;  4FYD A;  2KCC A;  2RF4 A;  3GTL H;  4UP9 A;  4K5W A;  3PUY A;  3RLF A;  3I4M H;  1C0A A;  2DJF C;  4LJZ C;  3D3R A;  3MHB A;  4PG3 A;  1QNK A;  1PFM A;  4A3M H;  2F1M A;  3RLN A;  1DGS A;  2EIF A;  4DAY B;  3HP3 A;  4A75 A;  1HZA A;  3TME A;  3RN2 A;  5ELF A;  2RDG A;  3TP8 A;  2K01 A;  4RFB A;  5M3M G;  1TWG H;  4ULL A;  1ESF A;  1P8L A;  1W6J A;  1Z9F A;  3IFD A;  2XWB B;  1HNZ L;  4BBR B;  3G48 A;  1TII D;  2AQ1 B;  5JPN C;  1U5K A;  3MWY W;  3S2D H;  1NY4 A;  2R7Z B;  3J7Y W;  1XTC D;  1LTT D;  4OXP A;  5JOB A;  4RGT A;  3W5O A;  1SEB D;  2XNA C;  4GKJ Q;  4YCU A;  1IZ6 A;  1Q12 A;  1TWC H;  2JA9 A;  1XNQ Q;  1G6Z A;  3MFY A;  3U58 A;  3M3Y H;  3OSO A;  5M3M H;  4LNQ A;  3Q23 A;  1NNX A;  2HDM A;  1JWS D;  2K32 A;  2B2U C;  1HR0 Q;  1PH3 A;  4OON A;  4R4C A;  1DYQ A;  2A74 C;  2IJ0 A;  3VYR A;  3TQY A;  2ZTE A;  1AFP A;  1LTR D;  3S16 B;  4QF4 A;  2XRS D;  3FRP B;  2E2I H;  2YV5 A;  2ZJQ A;  1X9N A;  3RUZ A;  1GVP A;  2AKW B;  3AQQ A;  1EOT A;  4DR2 Q;  2MP1 A;  4ID6 A;  5IGC A;  2IL8 A;  4DV3 Q;  4A3D B;  2NVT B;  3PF4 A;  1PTO D;  4BA1 I;  3A5Z B;  4DNR B;  3VR2 A;  3NEM A;  1C8C A;  4HAE A;  4FO2 A;  1EYG A;  4G57 A;  5E4X A;  2PW7 A;  1TWF H;  3NK9 A;  5M5X B;  2AMC B;  2B63 G;  3J81 E;  3NUC A;  1GOZ A;  3NWT A;  3PUV A;  1EZ6 A;  4QCL A;  2B2T C;  4EQ5 A;  2DGY A;  2ID0 A;  5C4Z A;  1JB3 A;  2VQE L;  1IBL Q;  1H9J A;  4GLX A;  3P1H A;  3SK4 A;  3MVV A;  5FO8 B;  4MN3 A;  5KGU A;  2NVY H;  1Q46 A;  1L2F A;  4DK6 C;  2XWJ B;  1LO5 D;  3CCM A;  2B63 H;  2D9U A;  3PO2 B;  4AYB E;  3GTK B;  3HOV G;  3GTL B;  2F0J A;  2PQA A;  1XMO Q;  1EWH A;  4JI1 L;  3NQI A;  4IUV A;  3UE0 A;  3LWE A;  3FDT A;  3K0X A;  1PZJ D;  1SNQ A;  2EJF C;  3S1M B;  2JEB I;  2UU9 Q;  1HHV A;  3K0Y A;  1M90 C;  2J7Z A;  3L3O C;  3DWP A;  2WB1 G;  1X32 A;  3OW7 A;  4AQY Q;  2VUM G;  5J3B A;  1SYB A;  1XTD A;  2CQO A;  1SFO H;  1D1I A;  1NR2 A;  3HOV H;  3C2P A;  1PYS B;  2EE1 A;  3S1R H;  1KC8 C;  4RH6 A;  1YIT A;  1IYV A;  4P2C B;  5I4D A;  4ZAI A;  1Y14 B;  3S2D B;  3GTO H;  3DEO A;  2RSO A;  2UUB L;  4KK7 A;  4XDX A;  3SGI A;  3BDC A;  4DN4 M;  5HUR A;  2L55 A;  2MFI A;  3IFT A;  1VQL A;  5BN5 A;  1WTR A;  4P72 A;  2VUM H;  3URY A;  1KDB A;  5EKI A;  1VQC A;  3M3Y B;  3H91 A;  4PZ6 A;  1FJG Q;  4ZYS A;  2QKI C;  3IRB A;  4K8I A;  2B2T A;  3RZD B;  4A3I G;  2JA6 B;  1LM0 A;  1S5F D;  1PH5 A;  3NBH A;  1FL0 A;  5IP9 G;  2ALY B;  4AYB B;  1T9H A;  2RKS A;  4K6D A;  1SJE D;  4C3J B;  4JI7 L;  1N34 Q;  4QIW E;  2JP1 A;  5D3I B;  1Y8O B;  1N9W A;  3KF8 A;  2KUM A;  2CCZ A;  2Q8T A;  1LT4 D;  4NB3 A;  5C4X G;  2K28 A;  5AJ3 L;  4O2D A;  1BF4 A;  4X66 L;  3CCQ A;  3KBG A;  2HCI A;  4DPG A;  5I6Y A;  4A3I H;  4LF5 Q;  3EQL C;  3CCS A;  4M1U B;  2F0U A;  2F3W A;  2SOB A;  5IGE A;  3TP6 A;  4X62 Q;  4LF6 Q;  2IT1 A;  1V1P B;  4R4Q A;  4BBS G;  2CQA A;  3J81 c;  5IP9 H;  4DU9 A;  1TWF B;  1GXD C;  4XYQ A;  3VR3 A;  4JI5 Q;  5FO9 B;  1UEB A;  3J81 j;  1HZB A;  1IBK L;  1I94 L;  4TSS A;  2KA7 A;  1N36 L;  1SMX A;  4NXN Q;  1G91 A;  1GKH A;  2DJG C;  2F0Q A;  5C4X H;  2WB1 E;  5JVH 3;  2F03 A;  2LXJ A;  4ZKB B;  3CRL C;  1DZ1 A;  3KF6 A;  4HED A;  3KLW A;  4LF8 Q;  4KN7 C;  1B8A A;  2F0O A;  4HTH A;  4IJH A;  1J5E L;  4OO1 I;  1ASY A;  5IT9 c;  1EEI D;  4BBS H;  3CD6 A;  1A63 A;  4DAP A;  2B63 B;  2KHS A;  1BXT A;  4YWL A;  1Y69 U;  1CTM A;  4JCV E;  4A3C G;  2LFN A;  4JI8 L;  4ALP A;  1JT8 A;  1TKW B;  1TWA H;  4B3T L;  4QIW B;  1CT1 D;  5ELD A;  5C3X A;  1Z47 A;  5AFW A;  4HSV A;  2HHH Q;  2CWP A;  3DWA A;  4DV5 Q;  2TSS A;  1SFO B;  4K2L A;  3MXP A;  2AQ3 B;  3K7U C;  3HOV B;  3FMC A;  2K1B A;  1LYL A;  3I7F A;  3KJP A;  1NMG A;  1YVC A;  4FF1 A;  3HOY B;  3C1F A;  4ZUJ A;  3CU7 A;  1STN A;  4XTC S;  5IIF A;  5LMN W;  1S72 A;  4A3C H;  3BVZ A;  4H02 A;  4HMJ A;  4KJO A;  2KQ3 A;  5GQO A;  1PH4 A;  3JC6 6;  1TVX A;  2WB1 B;  3SK8 A;  4FVM A;  4DV0 Q;  1ONL A;  1K0S A;  4RKL A;  5KYI A;  4GKK Q;  5D65 A;  2K03 A;  4R4O A;  4MZ9 A;  2R92 G;  4X6A H;  1CI3 M;  5KIX A;  1MSH A;  1IL2 A;  2O2L D;  2WV6 D;  3PCO B;  1V1O A;  3G4S A;  2B29 A;  4JOI A;  1UWV A;  3I73 A;  1IKL A;  4EQN A;  1F2M A;  4IN3 A;  2XRQ D;  1T5E A;  2F0S A;  4RA8 A;  2OCE A;  1KIX A;  4B3S L;  2A6H C;  5FLX c;  3HOZ G;  1X65 A;  3GO5 A;  1D1K A;  3MEF A;  2RQX A;  3HEJ A;  3M85 A;  1PH2 A;  4IFD I;  3CCV A;  3A5U A;  2R92 H;  4GNX B;  2I5H A;  5FLM G;  4A3I B;  1SN8 A;  2N3S A;  1B7Y B;  3OHX C;  1CKN B;  2EYM A;  1HR0 W;  4R8I A;  4JBK A;  3EFX D;  1PFB A;  2PI2 A;  1G2S A;  1IBM Q;  2A6E C;  2KOL A;  3AU7 A;  3PUW A;  4I7A A;  1HZ9 A;  4OL7 A;  3S15 B;  4XQJ A;  3GTP H;  1VQM A;  5C44 B;  3HOZ H;  3G7L A;  1I6H H;  1QNU A;  3HKZ G;  5C4X B;  1WTX A;  4GOP C;  5CV7 A;  2VNU D;  2WFW A;  1Y1W G;  2QW7 A;  5FLM H;  3J80 i;  3AB9 A;  3JAM L;  4NKL A;  4TVA B;  2HIV A;  2F0E A;  1BOS A;  2MGS A;  4JI6 L;  1JOO A;  1KRS A;  2ENB A;  1O7I A;  5A35 A;  1HTL D;  5EPJ A;  2N78 A;  2A68 D;  3EJI A;  4IJL A;  2ES2 A;  4OWT B;  3HGB A;  1XYI A;  3V2T A;  3HRZ C;  2GA4 B;  3R93 A;  1H9S B;  5JVG 3;  1SNO A;  3JAM E;  1ILP A;  2K5D A;  2CH4 W;  3BG3 A;  1QE6 A;  1Y1W H;  1EY0 A;  3NP8 A;  2AWO A;  4XT3 B;  1EQR A;  1GUT A;  1E1O A;  3UDX A;  2X6G A;  2EYP A;  3K7A H;  1DXM A;  2PQE A;  5J1Z A;  1B9M A;  2F52 A;  1EIY B;  3SE0 A;  4DK3 C;  1QIL A;  4LUZ A;  4UAI A;  1BO0 A;  3FHW A;  2C9O A;  4YY3 Q;  3H0G G;  1EY6 A;  4OO1 G;  3L2P A;  1BUV T;  1PXU A;  1PTO C;  1D5Z C;  1GHJ A;  1PH6 A;  1K8M A;  2XIW A;  2NYZ D;  2RHQ B;  3PUX A;  5CBE E;  3NEN A;  3TRE A;  1BBW A;  2R7D A;  1A2T A;  3RMH A;  5EKL A;  4HJ8 A;  1XNR L;  1B2T A;  3K5L A;  1B70 B;  4BY7 G;  3P7J A;  4X65 L;  2DNE A;  1BR9 A;  2EVB A;  3N6R A;  3RR5 A;  4L8J A;  2F0D A;  3CHB D;  4CJ0 B;  4DV6 Q;  4H44 C;  3E6Z X;  3TZD A;  3H0G H;  4OO1 H;  1JE4 A;  1K83 H;  5JAV A;  3HKZ E;  4QGU A;  2PQA B;  4DV4 L;  2IY5 B;  1Q8K A;  3P75 A;  5IY0 A;  4A3L G;  4JC0 A;  4K5V A;  5BN3 A;  3D4D A;  4FXD A;  3D31 A;  1HNZ Q;  1RDP D;  2LY7 A;  2HDL A;  5CV4 A;  5TSS A;  2IHE A;  1GM5 A;  4KY7 A;  3M4O B;  1PHJ A;  1BVS A;  4ZRZ A;  4LF9 L;  2IPK D;  2SNS A;  4DV1 L;  3MXN A;  3K57 A;  1WTW A;  1WTQ A;  1PRT D;  1GUS A;  1PMR A;  1O7Z A;  1X6O A;  1MI2 A;  4A3G G;  2LS0 1;  2NZH A;  1CQV A;  1XMQ L;  4A3L H;  1HXY D;  2KEC A;  5CC4 A;  3OTO L;  4O0A A;  1JIC A;  2ZXP A;  3GDE A;  4KD4 A;  2K7V A;  3E5S A;  3T13 A;  3TS0 A;  3I91 A;  3CRK C;  3U9S A;  2P5Z X;  3M7N A;  4LUV A;  1R9T B;  1OXU A;  2HQL A;  2XN9 C;  5C0X I;  2JA8 B;  3DM1 A;  2K5W A;  1WTO A;  4LFA L;  3J7A 5;  2Z6B A;  3KLR A;  3DMU A;  1E2V A;  3E9I A;  4GN4 B;  4A3G H;  5CYU A;  1BQQ T;  3UDI A;  4IFD G;  1TY0 A;  3UDF A;  3KDF A;  4JW0 A;  4NW2 A;  4YHH Q;  2JA7 H;  3KK7 A;  3JAM c;  3UDG A;  1H9K A;  2I07 B;  3HKZ B;  3U9O A;  4RMF A;  5IGD A;  3M4Y A;  2JSO A;  3VA7 A;  4ILW A;  4EGV A;  1N33 L;  2N55 A;  5JJZ A;  4G7O C;  4RGM A;  5M3F B;  3PO3 G;  1ZYR D;  3K7A B;  3KJO A;  1MGS A;  2NBF A;  4IFD H;  1QCB D;  2VXW A;  5FO7 B;  1WJJ A;  1VMP A;  4Q0F A;  1LUZ A;  1SJH D;  1I4G A;  2AHO B;  1CK1 A;  3HS0 C;  1H9R A;  4L5T A;  2A5H A;  2GN5 A;  2MO0 A;  3GTJ H;  4DFA A;  3S2H H;  2SDF A;  4IOA A;  5M9O A;  1QVC A;  1STA A;  2CW0 D;  3PO3 H;  4JI4 L;  4WJW A;  1KHI A;  4Q5V A;  3KF6 B;  5ELN A;  4JI1 Q;  4LK1 C;  3CCU A;  4LFB L;  3QOL A;  2R6G A;  1Q3L A;  1NMF A;  4ME5 A;  1ET6 A;  1J6Q A;  1VQG A;  1E7Z A;  3A56 A;  1E24 A;  3H0G B;  1MJE A;  4PZ7 A;  4IUN A;  4K2K A;  1QOH A;  2VS1 A;  4BS9 A;  2G5D A;  2Z4I A;  5FK9 C;  4JI2 L;  1I3Q H;  1N8R C;  1EZ8 A;  4QUF A;  2EYL A;  3GTQ B;  1NCV A;  4JPB W;  1TS3 A;  1J8I A;  1DM0 B;  4BY7 B;  2A6E D;  4EQP A;  2L4N A;  3ULJ A;  2QEX A;  2UUB Q;  4DR6 L;  2F0G A;  4KHP L;  1LTA D;  2F0I A;  2I5M X;  3BZK A;  3S1Q H;  3CP0 A;  1STH A;  2BH8 A;  1BNZ A;  3IAY A;  4MTK A;  3H94 A;  1GUW A;  4NDX A;  4G4K A;  5IOD A;  3CQZ H;  1B3A A;  3I70 A;  4JYA L;  3F2U A;  1EQV A;  2JEA I;  1IXR A;  5E4W C;  4JBM A;  5JJK A;  4CBV A;  2E76 C;  5K36 G;  1SXT A;  2E2J B;  1QG7 A;  3H6M A;  2YYZ A;  4JI7 Q;  2Z9H A;  3B6Y A;  4A3G B;  3X3N A;  3V96 A;  4KKT A;  3TSS A;  5CMD A;  4L5Q A;  1CKM A;  1IW7 D;  1SBB B;  1B53 A;  2K04 A;  3ERQ A;  4A3K B;  4IZ8 A;  2EYF A;  3PIP 3;  2WKC A;  2RDF A;  2WAQ E;  1CZG A;  3J81 i;  1WOC A;  4LF7 L;  1CHQ D;  4DA2 A;  5K36 H;  2K50 A;  4DV2 L;  2V1C C;  1IBK Q; 
#chains in the Genus database with same CATH homology
 3R2T A;  1OXS C;  4KMU C;  3S1N B;  1SMY D;  3TN2 A;  5CV8 A;  3OIP A;  1HRJ A;  4KV6 A;  5FOB B;  4RHR A;  2FIN B;  5C0X G;  3Q0A A;  2JE6 I;  3PIO 3;  1LTI D;  1LAC A;  1HQR D;  3KLS X;  2IW3 A;  4PMB A;  3FEW X;  5ELE A;  5EBC A;  3A8I E;  3LNN A;  2M2L A;  1KAB A;  3OIQ A;  1ENA A;  1B1Z A;  1X3Q A;  5F2D A;  2F0M A;  2KCN A;  3T16 A;  1RCV D;  5G3L D;  5IGG A;  1HQM C;  3OMC A;  1PTO H;  2F0K A;  2FJ2 A;  5JEA G;  1AW7 A;  4UDU C;  3K5N A;  5C0X H;  1CA6 A;  1JOQ A;  5I2Y A;  2XSC A;  1FD7 D;  1NR4 A;  3D4R A;  1EIH A;  2K5Q A;  2NZ1 D;  3I4M B;  1KNE A;  2A68 C;  1I4Q A;  2F4I A;  1R4P B;  2WAQ B;  5ELB A;  3A54 A;  4A3M B;  3HZX A;  4S3S A;  4C56 C;  4G7Z C;  5JEA H;  2A69 D;  2JXM B;  1WD0 A;  1OXV A;  2PZT A;  4JBW A;  3EA6 A;  1TWG B;  3OOC A;  2PW5 A;  1PFN A;  5E1F A;  3QJY A;  1LTS D;  3LWU A;  3D8G A;  1U4L A;  1G8Z D;  2WIN B;  4PV1 C;  2K33 A;  4B9W A;  1S5E D;  4Z9C B;  3OMG A;  3CQZ B;  5HGT A;  3SR1 A;  1EEF D;  2CHB D;  2PMZ B;  1STY A;  4KI0 A;  2BDN A;  1TS4 A;  1TWC B;  3NBI A;  2B2V A;  3H3V C;  2QDB A;  5M3M B;  4FF2 A;  3TDQ A;  1AZP A;  1EY7 A;  1GJX A;  1SAP A;  3GV6 A;  3NTK A;  4EVO A;  1KAA A;  4N9P A;  4KHV A;  3QB3 A;  2EYO A;  4RCO A;  1TQO A;  4BA2 I;  1ENF A;  1LT3 D;  1NSN S;  1ROD A;  2NTS A;  2E2I B;  1JOK A;  3KBX A;  1MBY A;  4OGQ C;  4TRD A;  3BVG A;  2EY1 A;  1O78 A;  3VYT A;  2YU9 B;  1VDZ A;  3Q24 A;  3C3L A;  5IGB A;  5C6A A;  3NWS A;  1A3T A;  5T1I A;  3LX0 A;  1K8O A;  4K8J A;  4ZLT F;  1ZEQ X;  1TR5 A;  4MHE A;  1E0B A;  1PRT C;  1R4Q B;  5C3W A;  2I46 A;  4ABN A;  2EPB A;  3VYU A;  2G9H D;  2NVY B;  3I72 A;  5FKA C;  2DNC A;  2MUY A;  1CQF A;  5C4H A;  4BWG B;  3DHQ A;  1KDC A;  3DWQ A;  4NP5 A;  1C48 A;  4KY6 A;  1SYD A;  4K6L A;  1EY9 A;  2J0T D;  3R8B A;  2QEJ C;  1TY2 A;  1SNP A;  1JC7 A;  1TT2 A;  1S5C D;  1ZYR C;  4X3U A;  3S1R B;  3FKI B;  4E6I A;  1AN8 A;  1HFN A;  3GTO B;  2E2D C;  3SEB A;  4K14 A;  2RBM A;  1EFI D;  5C3E B;  4DAY A;  1Q1E A;  4K5X A;  5ELC A;  2MJ8 A;  1BCP F;  2QIL A;  3S14 B;  2F0W A;  2VUM B;  2NUC A;  1VF5 C;  3MXU A;  1LT6 D;  2CW0 C;  1Q90 A;  4ZK9 B;  2R61 A;  2E74 C;  1LLR D;  2A73 B;  4C1N K;  4C3H G;  2EJG C;  1QWY A;  3ND9 A;  2D2C C;  2O4X A;  3H09 A;  1GUO A;  3E0J A;  5C5L A;  2EYJ A;  4RHS A;  1EYC A;  2NVX B;  4HSP A;  1O7Y A;  1Z7T A;  1F9R A;  1D5M C;  1SDF A;  3PMF A;  2FMC A;  5BN4 A;  1WTP A;  2EY5 A;  2X6L A;  4OIJ A;  2HQE A;  3SXH A;  1BCP B;  2RSN A;  4BBS B;  1I50 B;  1PDQ A;  2VB3 X;  4FP5 D;  3SK5 A;  1UAP A;  2G9D A;  3K5O A;  5KRU A;  2PPB C;  1AP0 A;  3BYT B;  4O42 A;  1TWA B;  1IW7 C;  3D6C A;  1S5B D;  1KLU D;  1Z6H A;  2WP8 J;  2EDG A;  2K05 A;  3K58 A;  1HA5 A;  1M4V A;  3TZU A;  5CGK A;  1OO9 B;  3ITP A;  1YNJ D;  5JPM C;  1SMY C;  3QOJ A;  2SEB D;  2IX0 A;  4RKB A;  1XXG A;  5M5W B;  2MHV A;  1OXX K;  2B8G A;  2JA5 B;  1F77 A;  1VCI A;  4IUU A;  3T4A C;  3PV0 A;  1JQY D;  4J6H A;  2VB2 X;  2O5I C;  1ILQ A;  3GTM B;  1JOR A;  1KTK A;  5CV6 A;  1WVL A;  4F8M A;  1AZQ A;  1Y8P B;  3VR6 A;  1D6E C;  1ML0 D;  2BA0 A;  2F0T A;  4OIK A;  1RHP A;  2CVR A;  3W3A A;  4XIG S;  4XQN A;  5D14 A;  3I8Z A;  2R92 B;  4WRD A;  2Z8L A;  5IOC A;  3I3C A;  2EZV A;  2K6A A;  2IX1 A;  2A69 C;  4F87 A;  3GTP B;  1Y8N B;  1FGB D;  1ENC A;  2EY2 A;  4Y7N B;  3HOZ B;  1I6H B;  1ZKO A;  4TQU S;  2EYH A;  3G6J B;  2DY8 A;  3BDO A;  3T56 B;  3ND8 A;  4I7Z C;  3NPP A;  2O5J C;  4A3F B;  2N88 A;  3GV3 A;  1EQT A;  4FXK C;  3K59 A;  1PYW D;  1F9P A;  3NSW A;  4A93 B;  3OPO A;  5EPL A;  2F0H A;  4C3I G;  1Y1W B;  1SE4 A;  3WDN A;  1EWC A;  4A3E B;  1VMC A;  4R8N A;  4HCE A;  1JCK B;  2WAC A;  3HOW B;  1T5X D;  2L1B A;  3I90 A;  4I65 A;  2PCF B;  5EQ0 A;  1RKN A;  1II3 A;  1CHP D;  3BS1 A;  1MSG A;  2PZW A;  5D3D A;  3GQB A;  3T53 B;  2BE5 D;  1D5X C;  4PQX A;  4U68 A;  5COR A;  2NTT A;  1B50 A;  5EKK A;  4L63 B;  5J39 A;  5EBD A;  2JYO A;  2F0L A;  1RF2 D;  2F0F A;  4CJ2 C;  1K83 B;  2ZXR A;  4LMQ D;  2F0P A;  4HR7 B;  1STG A;  2B8F A;  3X3M A;  5DM7 3;  1B4O A;  2BA1 A;  2RDH A;  4F88 A;  1NAP A;  2H1E A;  1GHK A;  4OHJ A;  1JR0 D;  2IWH A;  4DNT B;  5I9P A;  4YIJ A;  2Z4H A;  2ICI A;  4HMI A;  1DCZ A;  3QIA A;  4XQQ A;  4XYO A;  4QB4 A;  4IQZ A;  1V43 A;  3I4L A;  4KTA A;  1O7L A;  4CJ1 B;  3MEH A;  4CKB A;  4IFD J;  3ERO A;  2ZT9 C;  1PRT B;  2PO4 A;  1ESR A;  4NMZ A;  1SYG A;  2Y0S B;  4FF3 A;  2B2Y C;  2JA7 B;  4C3J G;  3VA5 A;  1IYU A;  1CZW A;  1JWU D;  1KDA A;  3NE5 B;  3IKJ A;  2EY6 A;  2XVS A;  4ODG A;  2ZXO A;  1FR3 A;  3J7A V;  3CKI B;  1TS5 A;  4ZQ3 A;  4CKC A;  5EGT A;  2C5C A;  1SYF A;  1H9S A;  1TS2 A;  5I9O A;  2DY7 A;  3NQT A;  2F0N A;  3J81 L;  1DD2 A;  2B2V C;  1HA6 A;  3AMU A;  3C1E A;  4C3I B;  3GTJ B;  3S2H B;  2SNM A;  3FPP A;  1WCM B;  3MAQ A;  3PO3 B;  4F7X A;  3BDL A;  3VR5 A;  2AUJ D;  1WTV A;  1SND A;  1I4H A;  2L0C A;  1I4P A;  1CFM A;  3VYS A;  5IT9 L;  4IUT A;  4RCN A;  1HCZ A;  1U4P A;  1ICW A;  2B39 A;  4M8A A;  4PMW A;  3T51 B;  4J1M A;  1LV9 A;  3BZD B;  2KJX A;  1F9Q A;  2OXP A;  1I3Q B;  1EY4 A;  3ONA B;  3EVQ A;  4KD3 A;  1LTG D;  3VR4 A;  5IT9 E;  1RTO A;  2FMM A;  1F9S A;  1I4R A;  2B2Y A;  3A7A B;  1LAB A;  3S1Q B;  3DXJ C;  2PYK A;  1L0Y B;  3QG1 A;  5I2X A;  2M00 A;  2NB0 A;  1FNU A;  2B2U A;  1U4M A;  4WOR A;  1YNJ C;  1PTO F;  4ZKC B;  3PUZ A;  1RD9 D;  5J22 A;  4HN7 A;  4DGZ A;  2D5D A;  3C46 A;  5IGF A;  4N9T A;  2OT2 A;  2L5T A;  3NHH A;  4V0B A;  4XT1 B;  2BDO A;  4RAU C;  1YNN D;  2OF1 A;  4H7B A;  3D4W A;  3V05 A;  3W2D A;  1RTN A;  4B9X A;  5G3L F;  4J8Q A;  1HPC A;  5KNC A;  4CKE A;  1UEA B;  5FLX L;  3IL8 A;  4TKO B;  3S9W A;  5C0X J;  2BCO A;  4MIU A;  1HUN A;  1F2L A;  3WOE A;  4RGO S;  4PNY A;  1A3V A;  3WOF A;  1A2U A;  5M5Y B;  3MZ5 A;  1SYC A;  5DEH A;  4RGN A;  1E2W A;  4WFN 3;  5FLX E;  1U9R A;  2H4O A;  2X69 A;  2AWN A;  5JEA J;  2FFK B;  1BCP D;  3P20 A;  1PZK D;  1DJR D;  4U67 3;  1FNV A;  1JWM D;  1PTO B;  1GUN A;  2QF7 A;  4H13 C;  3GD7 A;  1TWH B;  2OEO A;  1F2Y A;  5COY A;  2L9H A;  1SSO A;  1Q1B A;  3A8J E;  3HOX B;  1SNM A;  4DK0 A;  1CM9 A;  2AQ2 B;  3UI2 A;  1TU2 B;  2DN8 A;  3A7L A;  4DAV A;  4IUQ A;  5EJW A;  2RA4 A;  3MFG A;  2HCC A;  1HUM A;  1EIG A;  3DEP A;  2KED A;  4DF7 A;  4CGY B;  2QCP X;  4L6T B;  4B08 A;  1HFG A;  1UNS A;  3BYY B;  1LTB D;  5K5P A;  5KEE A;  1ZXT A;  1SYE A;  2E75 C;  2R3Z A;  2Q8I B;  2Q8R E;  3SHL A;  2KVM A;  1EY5 A;  2BE5 C;  1GUG A;  4V19 0;  1O80 A;  4X3K A;  3SVM A;  3NXW A;  4KKS A;  1S4Z A;  1KLG D;  4C2M B;  3FPU B;  4FXG C;  3ZYY X;  3M7G A;  4KN4 C;  3SK6 A;  4C1N I;  4KY5 A;  3J7A F;  2WKD A;  3MTS A;  3TP7 A;  1DON A;  5DAU A;  4HCS A;  1EYA A;  1DOM A;  3Q6S A;  2PNR C;  5LL6 X;  2F3V A;  1I6V C;  4LAA A;  4GZY C;  1D2B A;  1EL0 A;  5LHY 1;  3OWF A;  1PLF A;  2BOS A;  1A15 A;  4IUR A;  3FVQ A;  2B2W C;  1KNA A;  1XX8 A;  2LMC B;  3K5M A;  1S5D D;  3GP7 A;  2J4X A;  1QB5 D;  5DM6 3;  2NN6 I;  2TMP A;  1RJT A;  3D6W A;  1B44 D;  4XXE A;  3J80 L;  3MC0 B;  3RZO B;  4KKU A;  1A6X A;  4R9W A;  1I4X A;  4EQO A;  2LKV A;  2Z1C A;  5A2Q L;  4A3B B;  1FNW A;  3DUZ A;  1IHZ A;  1G29 1;  1FYC A;  5LL6 S;  3KUP A;  3J80 E;  3N52 A;  3MXG A;  2IX3 A;  1C4Q A;  1X3P A;  5KYL A;  1B9N A;  3RD4 A;  5A2Q E;  1W6K A;  4FNF A;  5CBA E;  2NWG A;  5KNB A;  4H0L C;  3NTH A;  1LT5 D;  1A3U A;  1PZI D;  2AUK A;  1UUP A;  2MPM A;  1EU4 A;  4G7H C;  1WD1 A;  3SDZ A;  3TP5 A;  4CHT B;  4QUC A;  2B2W A;  4RWS C;  3HG9 A;  3TBI B;  4QMG A;  5T1G A;  1DOL A;  4DXF A;  1CA5 A;  3KLS A;  3HOU B;  1G2T A;  1IKM A;  4DK1 A;  2D62 A;  4KJN A;  1STB A;  1STE A;  2EOT A;  3MA2 B;  5C4J B;  2FHT A;  1XWE A;  4X3S A;  1OXT A;  1J9O A;  1MD2 D;  3A8K E;  5ISR A;  4C3H B;  3GTG B;  2PZU A;  5CV5 A;  3A55 A;  1HTP A;  2ICE C;  5I6W A;  4X3T A;  1L0X B;  2KEE A;  5KND A;  1H9M A;  1SE3 A;  1V1P A;  1U4R A;  3R2I A;  3BVM A;  3S17 B;  2EJM A;  5C5M A;  1EYD A;  3OWE B;  5EPK A;  4JK1 C;  4O1N A;  4FF4 A;  4ZUI A;  3O13 A;  4BY1 B;  5CV9 A;  1AEX A;  1YNN C;  2RVL A;  2M9V A;  4PMC A;  1M8A A;  3R3O A;  2V4D A;  1EY8 A;  1SE2 A;  3L7Z C;  1E2Z A;  1NUC A;  4IAL A;  3NTI A;  1V8Q A;  1Q8I A;  1VF7 A;  1QJO A;  1F2Z A;  2NN6 G;  4KHZ A;  2WII B;  3Q22 A;  3K6O A;  1PRT F;  2L11 A;  1SNC A;  5DNF A;  1BBX C;  1BCP C;  4A3J B;  1EU3 A;  2NVQ B;  5NUC A;  1IL8 A;  1ET9 A;  5E3F A;  3L9A X;  3I4N B;  2F0V A;  3QO2 A;  4DXG A;  2NN6 H;  2L12 A;  5CR3 A;  1BDO A;  1Y1V B;  2HUG A;  2E2H B;  2R93 B;  1DOK A;  4FYD A;  2A6H D;  2EXZ A;  3QWN A;  2KCC A;  4K5W A;  3PUY A;  3RLF A;  4LJZ C;  3D3R A;  3MHB A;  1QNK A;  1PFM A;  2F1M A;  3HP3 A;  3TME A;  5ELF A;  2RDG A;  3TP8 A;  2K01 A;  4RFB A;  4ULL A;  1ESF A;  1W6J A;  3IFD A;  2XWB B;  4BBR B;  1TII D;  2AQ1 B;  5JPN C;  3MWY W;  2R7Z B;  3J7Y W;  1XTC D;  1LTT D;  5JOB A;  4RGT A;  1SEB D;  2XNA C;  1Q12 A;  1G6Z A;  3MFY A;  3OSO A;  3Q23 A;  2HDM A;  1JWS D;  2K32 A;  2B2U C;  1DYQ A;  2A74 C;  2IJ0 A;  3VYR A;  1AFP A;  1LTR D;  3S16 B;  4QF4 A;  2XRS D;  3FRP B;  3RUZ A;  1EOT A;  2MP1 A;  4ID6 A;  5IGC A;  2IL8 A;  4A3D B;  2NVT B;  1PTO D;  4BA1 I;  4DNR B;  3VR2 A;  1C8C A;  4HAE A;  4FO2 A;  4G57 A;  5E4X A;  2PW7 A;  3NK9 A;  5M5X B;  3J81 E;  3NUC A;  1GOZ A;  3NWT A;  3PUV A;  1EZ6 A;  4QCL A;  2B2T C;  2ID0 A;  5C4Z A;  1JB3 A;  1H9J A;  3P1H A;  3SK4 A;  3MVV A;  5FO8 B;  4MN3 A;  5KGU A;  2XWJ B;  1LO5 D;  2D9U A;  3PO2 B;  3GTK B;  3GTL B;  2F0J A;  1EWH A;  3NQI A;  4IUV A;  3LWE A;  3FDT A;  1PZJ D;  1SNQ A;  2EJF C;  3S1M B;  2JEB I;  1HHV A;  3K0Y A;  2J7Z A;  3L3O C;  3DWP A;  1X32 A;  3OW7 A;  1SYB A;  1D1I A;  1NR2 A;  3C2P A;  2EE1 A;  4RH6 A;  1IYV A;  4P2C B;  5I4D A;  4ZAI A;  3S2D B;  3DEO A;  2RSO A;  4KK7 A;  4XDX A;  3BDC A;  4DN4 M;  5HUR A;  2L55 A;  3IFT A;  5BN5 A;  1WTR A;  3URY A;  1KDB A;  5EKI A;  3M3Y B;  3H91 A;  4ZYS A;  2QKI C;  3RZD B;  4K8I A;  2B2T A;  2JA6 B;  1S5F D;  3NBH A;  4AYB B;  2RKS A;  4K6D A;  1SJE D;  4C3J B;  2JP1 A;  5D3I B;  1Y8O B;  3KF8 A;  2KUM A;  2Q8T A;  1LT4 D;  2K28 A;  1BF4 A;  3KBG A;  2HCI A;  5I6Y A;  3EQL C;  4M1U B;  2F0U A;  2F3W A;  2SOB A;  5IGE A;  3TP6 A;  2IT1 A;  1V1P B;  2CQA A;  4DU9 A;  1TWF B;  1GXD C;  4XYQ A;  3VR3 A;  5FO9 B;  4TSS A;  2KA7 A;  1G91 A;  2F0Q A;  5JVH 3;  2F03 A;  4ZKB B;  3CRL C;  1DZ1 A;  4HED A;  4KN7 C;  2F0O A;  4HTH A;  4OO1 I;  1EEI D;  4DAP A;  2B63 B;  2KHS A;  1BXT A;  1Y69 U;  1CTM A;  2LFN A;  1TKW B;  4QIW B;  1CT1 D;  5ELD A;  5C3X A;  1Z47 A;  5AFW A;  4HSV A;  3DWA A;  2TSS A;  1SFO B;  4K2L A;  3MXP A;  2AQ3 B;  3HOV B;  3FMC A;  2K1B A;  4FF1 A;  3HOY B;  3C1F A;  4ZUJ A;  3CU7 A;  1STN A;  4XTC S;  5IIF A;  3BVZ A;  4HMJ A;  4KJO A;  2KQ3 A;  1TVX A;  2WB1 B;  3SK8 A;  4FVM A;  1ONL A;  4RKL A;  5KYI A;  5D65 A;  2K03 A;  1CI3 M;  5KIX A;  1MSH A;  2O2L D;  2WV6 D;  1V1O A;  3I73 A;  1IKL A;  4EQN A;  1F2M A;  4IN3 A;  2XRQ D;  1T5E A;  2F0S A;  4RA8 A;  2A6H C;  3GO5 A;  1D1K A;  2RQX A;  3HEJ A;  3M85 A;  4IFD I;  4A3I B;  3OHX C;  2EYM A;  4R8I A;  3EFX D;  1PFB A;  1G2S A;  2A6E C;  2KOL A;  3AU7 A;  3PUW A;  4OL7 A;  3S15 B;  4XQJ A;  5C44 B;  3G7L A;  1QNU A;  5C4X B;  1WTX A;  5CV7 A;  2VNU D;  3AB9 A;  3JAM L;  4NKL A;  2F0E A;  1BOS A;  2MGS A;  1JOO A;  2ENB A;  5A35 A;  1HTL D;  5EPJ A;  2A68 D;  3EJI A;  3HGB A;  1XYI A;  3V2T A;  3HRZ C;  2GA4 B;  3R93 A;  1H9S B;  5JVG 3;  1SNO A;  3JAM E;  1ILP A;  2K5D A;  3BG3 A;  1QE6 A;  1EY0 A;  3NP8 A;  2AWO A;  4XT3 B;  1GUT A;  2X6G A;  2EYP A;  1DXM A;  2PQE A;  5J1Z A;  1B9M A;  3SE0 A;  1QIL A;  4UAI A;  1BO0 A;  2C9O A;  1EY6 A;  4OO1 G;  1BUV T;  1PXU A;  1PTO C;  1D5Z C;  1GHJ A;  1K8M A;  2XIW A;  2NYZ D;  3PUX A;  5CBE E;  1A2T A;  3RMH A;  5EKL A;  1B2T A;  3K5L A;  3P7J A;  2DNE A;  1BR9 A;  2EVB A;  3N6R A;  4L8J A;  2F0D A;  4CJ0 B;  3CHB D;  4H44 C;  3E6Z X;  3TZD A;  4OO1 H;  1JE4 A;  5JAV A;  3P75 A;  4K5V A;  5BN3 A;  3D4D A;  4FXD A;  3D31 A;  1RDP D;  2LY7 A;  2HDL A;  5CV4 A;  5TSS A;  4KY7 A;  3M4O B;  4ZRZ A;  2IPK D;  2SNS A;  3MXN A;  3K57 A;  1WTW A;  1WTQ A;  1PRT D;  1GUS A;  1PMR A;  1O7Z A;  1MI2 A;  2LS0 1;  1CQV A;  1HXY D;  2KEC A;  5CC4 A;  1JIC A;  2ZXP A;  4KD4 A;  2K7V A;  3E5S A;  3T13 A;  3I91 A;  3CRK C;  3U9S A;  3M7N A;  1R9T B;  1OXU A;  5C0X I;  2XN9 C;  2JA8 B;  3DM1 A;  2K5W A;  1WTO A;  3KLR A;  3DMU A;  1E2V A;  5CYU A;  1BQQ T;  4IFD G;  1TY0 A;  4NW2 A;  3KK7 A;  1H9K A;  2I07 B;  3HKZ B;  3U9O A;  5IGD A;  3M4Y A;  2JSO A;  3VA7 A;  4ILW A;  4EGV A;  2N55 A;  5JJZ A;  4G7O C;  4RGM A;  5M3F B;  1ZYR D;  3K7A B;  1MGS A;  2NBF A;  4IFD H;  1QCB D;  2VXW A;  5FO7 B;  1VMP A;  4Q0F A;  1SJH D;  1I4G A;  3HS0 C;  1CK1 A;  1H9R A;  2A5H A;  4DFA A;  2SDF A;  5M9O A;  1STA A;  2CW0 D;  4WJW A;  4Q5V A;  4LK1 C;  3QOL A;  2R6G A;  1Q3L A;  4ME5 A;  1ET6 A;  3A56 A;  3H0G B;  4IUN A;  4K2K A;  1QOH A;  4BS9 A;  2Z4I A;  5FK9 C;  1EZ8 A;  4QUF A;  2EYL A;  3GTQ B;  1NCV A;  1TS3 A;  1J8I A;  1DM0 B;  4BY7 B;  2A6E D;  4EQP A;  2L4N A;  2F0G A;  1LTA D;  2F0I A;  1STH A;  1BNZ A;  3IAY A;  3H94 A;  1GUW A;  4NDX A;  4G4K A;  5IOD A;  1B3A A;  3I70 A;  3F2U A;  1EQV A;  2JEA I;  5E4W C;  4CBV A;  2E76 C;  5K36 G;  1SXT A;  2E2J B;  1QG7 A;  3H6M A;  2YYZ A;  4A3G B;  3X3N A;  3V96 A;  4KKT A;  3TSS A;  5CMD A;  1IW7 D;  1SBB B;  1B53 A;  2K04 A;  3ERQ A;  4A3K B;  4IZ8 A;  2EYF A;  3PIP 3;  2WKC A;  2RDF A;  1CZG A;  1CHQ D;  4DA2 A;  5K36 H;  4IUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...