2JA6H

Cpd lesion containing rna polymerase ii elongation complex b
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
135
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title CPD damage recognition by transcribing RNA polymerase II.
pubmed doi rcsb
total genus 15
structure length 135
sequence length 145
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja6H00
3PF4A 3I4NH 3KLWA 4BA1I 4XIGS 2I5MX 4DK6C 3CC4A 4LF6Q 1FJGQ 1EUJA 3RN5A 1XNRL 3ULLA 3CCJA 1SFOH 1WYDA 5IWAL 4EX5A 2ZM6L 2VUMG 4IFDJ 4A93H 4A3IG 4BY1G 4C3IH 3BZKA 1Z9FA 3L2PA 1G291 4JI8Q 1TWCH 4DR4L 1JT8A 4RMFA 1N34Q 3TQYA 1LTLA 1MIUA 5BR8Q 5C44H 5K36G 2PQAB 3PUYA 2UUBQ 4X62Q 1PH9A 3S16H 3T1HQ 2PQAA 1KRSA 4QY7A 4IOCA 4DV5Q 4OONA 1Y1VG 3RN2A 1HNXQ 1VQLA 3GTQH 5LMUL 3HOVH 1OXTA 3OTOQ 2Z6KA 1Q1BA 3UE0A 4BBRH 3U58A 1JJ2A 1EIFA 1IL2A 1JMCA 4IFDI 1S40A 4NXMQ 2VQEL 4GN3B 5J3BA 1A8VA 2MO1A 4OWXB 2FXQA 3RLFA 1I94L 3F2BA 1BVSA 5HY6A 3EN2A 2JA6H 2ZJPA 4HIMA 4GNXC 4LFBL 3HFZB 3PUVA 1IBLL 2VL6A 3RLNA 5C3EH 1K73C 3HOYG 4JG2A 1K8GA 1SN8A 1UWVA 3VDYA 3M9BA 1XMOQ 2OQKA 5H1SE 1OXXK 4A76A 2K5NA 2BH8A 4JBKA 5LMNW 4IJLA 4DR6L 3PO2H 1NJIC 1TWAH 4ME3A 4HJ7A 4YCUA 1L0WA 3KF8B 3STBD 3CCQA 1S72A 1HNWQ 1PH3A 1PV4A 1IZ6A 4UPAA 4DR2L 4LFAQ 1LM0A 5IY0A 4JI0Q 2JA6G 4B3ML 3F2CA 3M7NA 2IHEA 4DUZQ 2UXCL 4DV2Q 1HR0L 1CUKA 2RCNA 3BJUA 3TEHB 4KI0A 5IP9G 5FLXc 1N8RC 1N36L 4B3SQ 3GDEA 4NPSA 4P74A 3HOXH 4LF4Q 1X56A 4GN4B 2B63G 2NN6G 2NN6I 2PNHA 1VQHA 1PH6A 5JJKA 1YI2A 1VQ8A 1AE2A 2VZAA 3GTKH 2OCEA 3KOJA 4DR7Q 1NMFA 2JA9A 5IYBG 2E5LQ 1KD1C 3HOWG 1IYJB 2KBNA 2RHQB 3S15H 3CCSA 1DGSA 1YNXA 1HJPA 1X6OA 3J80i 5GAEC 3CCEA 3GTMH 3ER0A 4DV4L 1YHBA 2QEXA 1N33Q 4JI5L 3LGJA 2IX0A 1W2BA 3CMEA 5IYCG 4JYAQ 2K4KA 3I56A 1YJWA 1HNZL 1N32L 1MJCA 1XPOA 2KCTA 3W1GA 4YHHL 1IBKL 4B3RL 1H95A 2WB1E 3WWVA 4TVAB 3PIPA 2UXDQ 1HZAA 2E2JH 2NZHA 2WB1G 1SMXA 3A5ZB 4DR1L 3TS2A 3K80C 4KHPL 3CQZH 3CPWA 4R1JA 2NZOA 4OXPA 5M3MH 1NMGA 3HKSA 1X9NA 4LF5Q 1YHAA 2OTJA 4A3KH 3RLOA 4LF8L 4B3TL 2K50A 4C3JH 4HJ5A 3H3VH 2OWOA 3HOUH 4WJ4A 2PMZE 2KCMA 2OQ0A 1Y1WH 5IT9c 4JI2Q 3U50C 3HKZE 3FKIG 4LF6L 1FJGL 2JA5H 1NY4A 1ASYA 4OWTB 1XPUA 2JEBI 1CSQA 1JB7A 4HIDA 1UE5A 2MFIA 3CPFA 1XMQL 2NVYH 4A3DG 1YVCA 2VUMH 1NBWA 4JI8L 4POFA 4BY1H 3H0GG 1QVGA 1NE3A 3TREA 5M3MG 1JE5A 4DV6Q 1N34L 1XNQQ 5BR8L 1VCIA 3G71A 3CMAA 4GKKQ 2KHJA 2WFWA 2UUBL 4X62L 3H3VI 1HR0W 4LUVA 3OW2A 1N9WA 4UP8A 1X3GA 3KJPA 4GLXA 4LFCQ 1TWGH 1HNXL 1AE3A 2R7ZG 2JA5G 4A3MG 1K83H 4A3BG 3OTOL 4LF9Q 1VQ9A 2H5XA 3CC2A 1Y1VH 2R7FA 3CF5A 1RIPA 5C0XG 3S1MH 2Z6KC 4NXML 1P8LA 2UXBQ 3UDXA 1CKMA 3PIOA 1VQKA 3RR5A 4IO9A 2IX1A 3G48A 4YWMA 4QIWE 2AWOA 4P75A 4FDBA 4RG1A 1Z47A 5FLMG 1YITA 2Y0SE 4DV1Q 4JV5Q 2HHHQ 1VQFA 2QGQA 1K3RA 5FJ8H 2Y0SG 4GN5A 2UXBL 1OXSC 1KC8C 3TS0A 3HOYH 4BY7G 4DV3L 4GOPC 4A3LH 1VQBA 4L5RC 4X66Q 3CCLA 3CXCA 1LUZA 2JA8G 1U0LA 2QA4A 1IXRA 1D8LA 4GLAC 4UP7A 1PFSA 1VQNA 1Q12A 2HQLA 3M4PA 2I5HA 4IPGA 3J81i 4AQYQ 3F1ZA 3BZCA 1YJ9A 2HT1A 1E1TA 5LMNQ 4JI4Q 4JI0L 2R93G 4R4OA 4DUZL 2DUDA 4O2DA 1E3PA 4DV2L 3M4OH 1VQCA 4HJ9A 2JE6I 2WP8J 4B3SL 1MJEA 3CAMA 5JJIA 5FJ8G 5EAYA 4LF4L 2N3SA 1GVPA 4DKAC 5IP9H 1PH8A 1BBWA 2A8VA 2CFMA 1VQMA 4P72A 3GTGH 4A3LG 3AQQA 2B63H 4IPHA 1WFQA 2YV5A 4EQ5A 4C2MH 3UDGA 1VQ5A 3I4MG 3FHWA 1VS0A 2E5LL 3T1YL 2ZTDA 3I2ZA 4YWLA 4LNQA 3NELA 3RZOH 2OTLA 5C4XG 4O0AA 3HOWH 1FGUA 1A62A 5IYBH 5IYDG 1Q7YC 4POGA 2L15A 1GKHA 1UEBA 4X65Q 2VQFQ 5IWAQ 2N49A 3S1RH 3TRZA 1QZHA 2AKWB 4YY3Q 1V1QA 2UU9Q 1UE1A 1Y14B 4A75A 4DR3Q 5M5YH 5IYCH 2N8NA 2GN5A 2UXDL 2JQOA 1K8AC 4QL5A 1YHQA 4LUZA 3DLLA 3K8AA 1QUQB 2LXJA 1VQIA 3AFPA 4J15A 3J80c 3CCMA 4UP9A 2JA7G 2VY3A 5JEAG 1B7YB 3S17H 1X3FA 4PZ7A 3K7UC 3GD7A 5GAGC 1YJNA 3K7AH 1XPRA 2UUAQ 4LF5L 1PYSB 2XTIA 4BXXG 4JOIC 2K14A 4JI1L 1Q86C 2UUCQ 2ZJQA 1HZBA 3D0FA 2R7DA 1YZ6A 3PGZA 2GVBA 4NXNQ 2VQEQ 3KF6B 2IHFA 1I6HH 1KIXA 1LYLA 5IP7H 4BBSG 3EIVA 2KENA 4A4IA 3OYYA 1UE6A 1X3EA 3KF6A 5M5XH 3KYHC 3AEVA 1SROA 4JBJA 3FKIH 3GTLH 2CWPA 1PVOA 2MNAA 3I7FA 4A3EG 2XGTA 1GO3E 4A3DH 2IY5B 2N78A 1J5EL 1HNWL 1XNQL 4DV6L 4X6AH 1TWHH 1L1OB 1I3QH 2F3IA 3I55A 1C0AA 3E0EA 4DR6Q 3H0GH 1EQRA 3E9HA 1QVCA 1Q82C 1L1OA 2JJQA 4L5QA 3S1NH 3S2HH 3S1QH 1B8AA 5IP7G 3S24A 1U5KA 2I5LX 2V1CC 2A19A 3F2DA 4LF9L 2ASBA 1HR0Q 2R7ZH 1GD7A 4QGUA 4A3MH 4DK3C 4JI7Q 2VW9A 4A3BH 3MXNB 1Q1EA 3U4ZA 4AIMA 4LF7Q 4MZ9A 3UDFA 4JCVE 2EIFA 1EOVA 4YCWA 2F4VQ 4A3JG 2YYZA 2VS1A 4PMWA 4DAMA 5C0XJ 1E24A 3F8TA 1M1KC 4IJHA 4BA2I 1HZ9A 1S3OA 4QQBX 2E8GA 4HJ8A 4R4TA 3HOZG 2ZJRA 1X65A 4L5SA 3JC66 4OX9Q 4JV5L 1XJVA 1IBMQ 2BA0A 4H02A 1K0RA 2PI2E 5FLMH 2Q2TA 3A0JA 1C9OA 4IPCA 4DR5Q 4OO1G 1KHIA 3M4QA 1G6PA 2CCZA 1SE8A 2PI2A 4X66L 3T1HL 2R92H 3KFUA 4A3GG 4A3CG 4DV5L 3CCRA 4BY7H 4HIOA 4MNOA 5ELOA 3CD6A 4MTNA 1A63A 2MQHA 3G6EA 4AQYL 2ATWA 1X54A 2JA8H 1QZGA 2LXKA 1N32Q 5LMNL 1SR3A 3SGIA 5C0XI 3J7ZC 4JI4L 4B3RQ 1P16A 3PF5A 1MKHA 1VQJA 4IOAA 1EQQA 1BKBA 1SRUA 3M85A 2R93H 4AYBG 3RZDH 1T9HA 1ASZA 4KLKA 3S2DH 3PSIA 4JI6Q 3A74A 3UE1A 1KQSA 3S14H 3K81C 1K9MC 1RL2A 1TWFH 2YTXA 3W1BA 3J81c 5M5WH 1FL0A 2R92G 1WCMG 3B6YA 1XMOL 1CKNB 3H15A 3PO3H 1VQAA 2B29A 4Y7NH 5AJ3Q 3ICEA 4X64Q 2HIVA 3CCUA 3I4MH 1CKNA 1AH9A 4DV0Q 4R4QA 2ALYB 1I5FA 1YEZA 2ZTEA 3PUXA 4X65L 2VQFL 1HZCA 4GKJQ 5C4XH 3CC7A 3MEFA 1XMQQ 2NVTH 4IPDA 4YY3L 5IYDH 5M3FG 4LFAL 2UU9L 5GAHC 2HIXA 1VQEA 2E2IH 3E9IA 4DR3L 3K0XA 2B3GA 4LUOA 1VQPA 4DUYQ 3JAMc 1B70B 2Q2IA 4P71A 1VQOA 2YTYA 4ALPA 4YWKA 2YU9H 3CW2C 4R4CA 2NVQH 3NENA 2EXDA 4A3FG 2CQOA 4JI3Q 3PO3G 1VQ6A 1I50H 4K0KQ 4YCVA 1FVIA 3ULPA 2JA7H 4KHZA 4L5TA 3I4NG 2CKZB 5JEAJ 4DV7Q 1KRTA 3JAMi 2UUAL 1UE7A 3J81j 4DR7L 2UUCL 2WAQE 2MO0A 4IFDG 4A93G 1NTGA 1L2FA 2WAQG 5GROA 4NXNL 4BXXH 1VQ7A 1VQGA 1XNRQ 1JJGA 1N33L 2ZM6Q 3RNUA 1TXYA 1A0IA 2LSSA 4PZ6A 3Q8DA 4UY8C 1KL9A 4JYAL 4BBSH 5C44G 4GOPB 2C35B 4R4IA 3ULJA 3GO5A 4DR4Q 2VNUD 3AYHB 3W5OA 1EIYB 3NEMA 4GOPA 3CCVA 1YIJA 2A1AA 1HH2P 2Z0SA 1BBUA 4DNIA 4DV3Q 4A3EH 3HOVG 3L0OA 1VQ4A 1CKOA 1QUQA 4BBRG 1SLJA 3IRBA 1KXLA 5LMUQ 3BU2A 2KHIA 1WI5A 4JBWA 3GTPH 4GNXB 4AH6A 3GTJH 2AHOB 1L1OC 2D0OA 4WJ3M 2I0QA 2AMCB 1X55A 1I94Q 3D31A 1JJCB 4JI2L 2JEAI 4Y52H 4GNXA 4PZ8A 1M90C 4APVA 4JI7L 5C3EG 2BA1A 2NVXH 4LF7L 4LFBQ 1IBLQ 2F4VL 3DM3A 4C3HH 5GADC 3A5UA 1J6QA 1PH7A 5C4JH 4XTCS 4A3JH 2JK8A 2RF4A 2YTVA 1PH4A 3PO2G 4OX9L 3T1YQ 1IBML 4GKKL 3HOZH 1R9TH 3CP0A 3PV0A 4DR5L 3UDIA 1PA6A 1PH5A 1W3SA 1WJJA 1G51A 5JJLA 1OTCA 1Q8KA 4LFCL 2R6GA 1Q81C 2K5VA 3KJOA 2Q2HA 4DR2Q 4B3MQ 1KAWA 4TQUS 1E1OA 4A3CH 4LW1A 3HOXG 4A3GH 5DLQE 2UXCQ 4HIKA 1WOCA 3U4VA 4DAYB 3KDFB 5HGQA 3AFQA 1E7ZA 1XTDA 2DGYA 4LWCA 1N36Q 2IT1A 4JBMA 2BH2A 3STBC 3KDFA 2E2HH 2D0PA 5ELNA 4QJFA 4DPGA 2CWAA 3FP9A 1PH2A 1EYGA 2F52A 4JI6L 2K5HA 4JOIA 5IE8A 3NBHB 4DV1L 4OWWB 3GTOH 4NB3A 2HHHL 2K52A 4PG3A 4HJAA 1OXVA 2GVAA 4JI1Q 2RHSB 1V9PA 4JC0A 2AWNA 2ES2A 1D7QA 3EBEA 1VQDA 4OO1I 1EFWA 2K75A 4DV4Q 5GQOA 3G4SA 4GS3A 3PUWA 5AJ3L 1WCMH 3PUZA 4P73A 4X64L 1PH1A 4JI5Q 2ID0A 3HKZG 4DV0L 4GKJL 1GM5A 1HNZQ 4YHHQ 1IBKQ 1YBYA 3I4OA 4AYBE 4A3IH 5M3FH 2D62A 1OXUA 2EQSA 3ERSX 4DUYL 1Q46A 4DR1Q 1J5EQ 5E7NA 4A3KG 1E22A 1V43A 3L7ZC 1CSPA 3ZJYC 2Q2UA 4KHPQ 2ZTCA 1C7YA 1EWIA 3M3YH 1PYBA 3HOUG 1PHJA 4JI3L 1Y1WG 1QVFA 3PCOB 4GLVB 4B3TQ 4LF8Q 3J7A5 4K0KL 1O7IA 4A3FH 4DV7L
chains in the Genus database with same CATH superfamily
1JWSD 3KLWA 1FJGQ 4IUVA 2VUMB 1MSHA 4A3IB 3RN5A 2KEEA 4HAEA 4EX5A 4IFDJ 2CHBD 4OIJA 3BZKA 1WD0A 4L63B 1TWCH 2PYKA 4DR4L 1JT8A 3MXPA 5BR8Q 1FD7D 1K83B 2O4XA 1Y1VB 3T1HQ 4QY7A 4DV5Q 4OONA 1VQLA 3GTQH 2JN4A 2O2LD 4KJOA 4BBRH 1IL2A 2EY6A 4IALA 4NXMQ 4IZ8A 1EYDA 4OWXB 4FF4A 2PW7A 1TS5A 2F3VA 3F2BA 2Q8IB 2D9UA 3EN2A 5HY6A 2A6EC 5I4DA 2JA6H 1BCPC 3RMHA 4GNXC 2EJFC 1IL8A 5C3EH 3L9AX 1K8GA 1PZKD 2NN6H 3G6JB 3M9BA 5D14A 2OQKA 3R8BA 4CDEC 5LMNW 3VYSA 1H9KA 4ME3A 3CCQA 4YIJA 1PH3A 2R3ZA 4ABNA 2F0NA 4LFAQ 3TP7A 4JI0Q 1F2YA 4FXDA 4DV2Q 2RCNA 3BJUA 5IP9G 1N8RC 4K2LA 3GDEA 4GN4B 4FXKC 4H13C 4JW0A 4OIKA 4PMBA 5JJKA 1YI2A 1VQ8A 3HOWB 2OCEA 4DR7Q 2JA9A 2E5LQ 3S15H 1TS3A 1DGSA 1U4MA 1X3PA 3VA5A 1X6OA 3J80i 1I4RA 1HQMC 2HD3A 1KTKA 1LT5D 3FMCA 1JWMD 1B3QA 1ESRA 2EYMA 2WB1E 3DWQA 1A2TA 4OGQC 4TRDA 2FJ2A 4TVAB 3K6OA 3WWVA 2E2JH 2E74C 4ZUJA 1RODA 3CPWA 1QJOA 4OXPA 5M3MH 4A3KH 3RLOA 3R2TA 3BZDB 1NCVA 2OWOA 3HOUH 4QUCA 1Y1WH 3IL8A 5EPKA 3HKZE 3FKIG 4LF6L 4ME5A 2JA5H 4IUTA 4OWTB 1A3TA 1HUMA 1KDAA 4RWSC 2JEBI 1JB7A 2MFIA 2NVYH 4KN7C 1PTOB 3CQZB 4NKLA 1FNWA 1NBWA 1F9SA 2X6GA 3H0GB 4NW2A 4JI8L 2E2DC 3QOJA 3TREA 4DV6Q 1N34L 5BN5A 5IIFA 3CMAA 2KHJA 1G8ZD 1HR0W 1D5ZC 3SE0A 1ZYRC 1N9WA 1X3GA 3D6WA 4A3BB 2R7ZG 3PQIA 1EY0A 1SYCA 2EE1A 1VQ9A 5FOBB 3CC2A 2NUCA 2R7FA 3CF5A 3L3OC 5E4XA 3PIOA 1HTLD 4QIWB 1DJRD 5IT9E 5F2DA 4ZRZA 5FLMG 3IFDA 1CA6A 4DFAA 2A68C 2F0JA 4F7XA 5NUCA 4DV1Q 2HQEA 1K3RA 2Y0SG 4BY7B 3MXUA 1SBBB 5EBDA 4DV3L 3T4AC 4GOPC 1EIHA 1K3BC 2WKCA 4PV1C 4QUFA 1IXRA 1D8LA 4GLAC 3P1HA 2L5TA 1HNWL 3J81i 3U9SA 1YJ9A 3BZCA 1U9RA 3RZDB 1E1TA 2R93B 1AZQA 2NB0A 1B3AA 1EZ8A 2Z4HA 5FLXL 2M00A 2TMPA 5FJ8G 4EQPA 5EAYA 4LF4L 1LABA 2N3SA 4DKAC 5IP9H 1MBYA 3GTGH 2EYHA 4A3LG 3AQQA 1VQ5A 4ZUIA 3T1YL 3I2ZA 5DAUA 3RZOH 5C4XG 2N88A 4POGA 1KLUD 5EPJA 1LTSD 1MD2D 2VQFQ 5IGGA 3ND8A 2Q8TA 2NZ1D 1B2TA 4HR7B 2Z9HA 4DR3Q 1WTPA 1RHPA 1NNXA 2VB3X 2JQOA 1K8AC 1YHQA 3HS0C 1QUQB 4J15A 4KD3A 3J80c 1K28A 1PRTB 1EY4A 1B7YB 5JEAG 5A35A 3K7UC 3GD7A 1EZ6A 4NDXA 4B9XA 4BXXG 5EBCA 4JI1L 2UUCQ 3KLSX 3K58A 2ZJQA 1HZBA 4H0LC 3PGZA 2IHFA 1I6HH 1KIXA 1B9NA 2AQ3B 5IP7H 4N9TA 4BBSG 1RKNA 4O42A 1ESFA 2RVLA 4KY7A 5E4WC 1SROA 3FKIH 2B2WC 2MNAA 5EPLA 4CKCA 1O80A 1BO0A 1LV9A 1SAPA 1I4PA 1J5EL 1XNQL 2EY5A 2XN9C 1EQRA 4U673 3S1NH 3SK5A 3S2HH 5M5XB 3G7LA 3DWAA 3H3VC 1TS4A 1HFNA 2I5LX 4LF9L 5CYUA 5FKAC 2R7ZH 3K5LA 4C3HG 4DK3C 1HTPA 1LTRD 1STHA 3MXNB 2K6AA 4JCVE 1EOVA 4PMWA 5C0XJ 1GUOA 3F8TA 3MXNA 1VMCA 2ENBA 1HZ9A 1S3OA 1B50A 3ITPA 1BCPF 2FMMA 1SYEA 3HOZG 4FXGC 4OX9Q 3S1QB 3KUPA 1WTVA 1IBMQ 2BA0A 5FLMH 4OO1G 4G7HC 3T56B 1KHIA 3M4QA 1SE8A 4X66L 3KFUA 3CRLC 5ELOA 4RHRA 4AQYL 3U9OA 2ATWA 5LMNL 3J7ZC 1KNEA 4B3RQ 1PFMA 1VQJA 4J1MA 4AYBG 5CBAE 3NUCA 5C5MA 1CI3M 3PSIA 2A69D 3S14H 3C3LA 3J81c 5M5WH 2R92G 4RH6A 1CKNB 2JA8B 2B29A 1F77A 1LACA 3CCUA 4RKLA 1CKNA 4DV0Q 2ZTEA 3PUXA 2KJXA 5C4XH 1XMQQ 1CHQD 3DEPA 3I91A 2LMCB 4OELB 3S2DB 2C9OA 5CV4A 4UHVA 3E9IA 1TKWB 2B3GA 1VQPA 2O5JC 4DAPA 1DYQA 1I4XA 4JK1C 1M8AA 2YTYA 4FNFA 2G5DA 3AB9A 3PO3B 1ICWA 2EXDA 3I4NB 5C5LA 5IGBA 3T16A 4L5TA 2DNEA 4DV7Q 1KRTA 1UE7A 3Q6SA 3J81j 3MTSA 3D4WA 3QB3A 1PRTC 2WAQE 4IFDG 5GROA 2XRQD 2NTSA 4BXXH 3BDLA 1VQ7A 1N33L 2ZM6Q 2RSNA 4PZ6A 4H44C 1W6JA 4FF2A 1WVLA 4BBSH 5C44G 2KCCA 2C35B 4KHVA 3ULJA 5KRUA 3FPUB 1EIYB 3NEMA 4UAIA 2JA7B 5CV9A 2A6HC 1F9RA 4PQXA 3CCVA 2Z0SA 2OEOA 1EWHA 3L0OA 5E1FA 4B08A 1CKOA 2K5WA 3IRBA 1S5ED 5CV7A 2F0DA 2AMCB 4KMUC 2DN8A 2JEAI 4PZ8A 2WKDA 4JI7L 1KDCA 2EDGA 4LF7L 1IBLQ 3DM3A 4C3HH 5GADC 3A5UA 2HCIA 1IW7D 3PO2B 2JK8A 1TWAB 1ET6A 2YTVA 1D1KA 1FNUA 4GKKL 2K04A 3HOZH 1R9TH 3PV0A 3MAQA 2ZXRA 1G51A 1QNKA 1Q8KA 4OO1H 1EFID 4LFCL 2K5VA 2KQ3A 1KAWA 2LY7A 3HOXG 3U4VA 4WFN3 3KDFB 2WACA 1E7ZA 1XTDA 2DGYA 2XWJB 2EY1A 4QB4A 1N36Q 2BH2A 5LL6S 5JPNC 3KDFA 2E2HH 1L0YB 4DPGA 5G3LF 1ZXTA 1PH2A 1EYGA 5E3FA 1L0XB 2K5HA 4XQNA 4JPBW 2QCPX 4OWWB 4RA8A 4HJAA 1ICFB 2RHSB 1V9PA 4JC0A 5J39A 4ID6A 2DNCA 4NP5A 4DV4Q 1EYCA 4GS3A 1SEBD 4X64L 4JI5Q 2EXZA 4MHEA 4IUUA 5HGTA 1GM5A 1YNNC 2BCOA 2JSOA 1IBKQ 2IL8A 4N9PA 3I4OA 3OSOA 4AYBE 3JAML 4A3IH 4WORA 1OXUA 1Q46A 3MA2B 4KJNA 3MEHA 4M8AA 4KHPQ 4DK1A 3WOFA 2ZTCA 2GA4B 1PYBA 1QVFA 2A6ED 3J7A5 4GLVB 3E6ZX 5EQ0A 3DM1A 1K8OA 2KA7A 1C4QA 2KEDA 3E0JA 1EYAA 3PF4A 2RQXA 3QWNA 4XIGS 4DK6C 1BOSA 3ULLA 3CCJA 1SFOH 1WYDA 5IWAL 4IFDH 2RKSA 3HZXA 1G291 2BDNA 2L9HA 4RMFA 2K32A 3MWYW 1E2VA 1MIUA 2XRSD 3BVZA 5C44H 1XXGA 2PQAB 2UUBQ 5KNDA 2Z1CA 2PQAA 1KRSA 4IOCA 1HNXQ 3OTOQ 2VB2X 4K5WA 1RTNA 2VQEL 1I94L 3M7GA 1BVSA 1CQVA 5FO7B 3CHBD 4BS9A 3HOYG 5CGKA 2F0KA 1UWVA 3VDYA 1MGSA 1OXXK 2BH8A 4JBKA 1NJIC 1F2ZA 4HJ7A 1L0WA 1STNA 3E5SA 1EY8A 3P20A 5JPMC 1IZ6A 4UPAA 1LM0A 2JA6G 3CKIB 4B3ML 2ZT9C 3F2CA 4DUZQ 2J4XA 5KGUA 2B2YA 3VYTA 1CUKA 4XYOA 3HOXH 2QILA 2NN6G 1STAA 1VQHA 3VR6A 1UNSA 3OIQA 1AE2A 2EPBA 2AQ2B 2VZAA 1I6VC 3KOJA 1IYJB 2RHQB 1YNXA 3GTMH 2EOTA 3ER0A 2QEXA 1W2BA 4LMQD 4RFBA 4JYAQ 3I56A 1HNZL 1MJCA 1ZYRD 3W1GA 3DMUA 1U4RA 1SNOA 3K7AB 2NZHA 2WB1G 3CRKC 3LWUA 3VR2A 4DR1L 3OWEB 4I7AA 3TS2A 4K8JA 3CQZH 3A56A 5C4HA 4R1JA 1DM0B 2NZOA 3BVMA 5FLXE 1NMGA 3OMCA 4B3TL 1FGBD 3H3VH 1DCZA 3AU7A 2RDGA 2KCMA 5IT9c 3GTLB 2B2UA 1FJGL 5JVG3 1PRTF 1BBXC 1ASYA 3J7AV 4BWGB 4HIDA 1HUNA 1RDPD 1TWHB 4A3DG 1SYFA 1YVCA 2SDFA 1XWEA 2L11A 2MP1A 2KUMA 5M3MG 1KABA 5BR8L 1VCIA 1TQOA 1H9MA 1D5XC 1SMYC 1SJED 1TWGH 2JA5G 3HRZC 3EFXD 1IYUA 1S5BD 1QNUA 3VYUA 5C0XG 4F88A 4NXML 3S1MH 2UXBQ 1SJHD 3UDXA 3SK4A 3QR8A 4IO9A 2IX1A 4YWMA 2QW7A 4QIWE 1E2WA 1Z47A 3Q22A 1YITA 3KBGA 4X3KA 1UUPA 1VQFA 2QGQA 4GN5A 1EY5A 4P2CB 3HOYH 2PW5A 3HGBA 1G91A 3GV3A 4L5RC 3CCLA 3V96A 3CXCA 1LUZA 1T5EA 1U0LA 2I46A 5FO9B 2JA8G 2RSOA 4RCOA 4WRDA 2KVMA 3F1ZA 2K28A 4JI4Q 4JI0L 4DV2L 1VQCA 2JE6I 1MJEA 2B2YC 1AZPA 3J80L 2EY2A 1BBWA 1PYWD 3QO2A 4P72A 2YV5A 1F2LA 2J0TD 3FHWA 2E5LL 4EQNA 4LNQA 2OTLA 3C1EA 4O0AA 5IYDG 3M4OB 2L15A 4X65Q 3S1RH 1LLRD 2N49A 1HA6A 3FEWX 2UU9Q 4M1UB 2F0WA 1PXUA 1TY2A 1UE1A 2XNAC 2ICEC 3SXHA 3ZYYX 5M5YH 2N8NA 4C2MB 3K8AA 3NWSA 2JA7G 4RGNA 4UP9A 3N6RA 2BE5C 4PZ7A 3J7AF 1XPRA 2UUAQ 5I6WA 2JP1A 1PZJD 3X3MA 1DXMA 1LYLA 2KENA 3OYYA 1UE6A 1X3EA 5M5XH 1HFGA 2B2UC 5A2QL 3Q24A 1NR4A 3UI2A 3WDNA 1PVOA 4C1NI 2D5DA 4A3EG 2XGTA 4R9WA 4A3DH 4X6AH 3NBIA 4DV6L 5C3WA 3GTPB 1AFPA 1I3QH 2F3IA 4ZQ3A 1C0AA 5IGEA 4CJ0B 1NAPA 3KBXA 4K5VA 4L5QA 1STGA 3S1QH 5IP7G 2NVXB 2V1CC 2A19A 1GD7A 4QGUA 4FYDA 2VW9A 3A8KE 3U4ZA 3VR3A 4AIMA 2EIFA 2F4VQ 1SE2A 2YYZA 3SHLA 5C0XH 4A3JG 1JOQA 1E24A 4DN4M 4EVOA 4X3UA 3OWFA 2ZJRA 3A8IE 3J81L 3OOCA 1XJVA 1C9OA 4IPCA 3K5NA 3K5OA 2CCZA 2PI2A 4A3MB 1C48A 4A3GG 2F0LA 3TN2A 3GP7A 2JA8H 3NSWA 2LXKA 5CC4A 2K03A 3MFGA 1P16A 4DXFA 5C4ZA 3GTOB 1EQQA 3M85A 2IWHA 2M2LA 4KLKA 3S2DH 2IJ0A 4RGOS 2NWGA 2D2CC 2YTXA 4RGMA 3H94A 4C1NK 1WCMB 1QE6A 1GUWA 4V190 1XMOL 3PO3H 2JYOA 1A2UA 3ICEA 2HIVA 1ILQA 1AH9A 1I5FA 1GUSA 2VQFL 1RJTA 4N8X1 1KNAA 2LFNA 3MEFA 3CC7A 4DNRB 5IYDH 5M3FG 1WTXA 2HIXA 2E2IH 2F0IA 1MI2A 4DR3L 3K0XA 4DUYQ 4KN4C 1HRJA 2YU9H 4YWKA 1K0SA 2NVQH 1EY6A 1D5MC 4J8QA 4Y7NB 1EEID 5IGFA 3K59A 1I50H 3ULPA 2JA7H 3TZUA 2NVTB 2UUCL 2MO0A 3DEOA 1NTGA 4A93G 1L2FA 2WAQG 4C3IG 1XNRQ 1TWCB 1QILA 2F0GA 4UY8C 2EVBA 5JOBA 3GO5A 3VR4A 3W5OA 4ZKBB 4ILWA 4UDUC 1YIJA 2A1AA 4BBRB 5JJZA 4DV3Q 4A3EH 1BNZA 4R8NA 3HOVG 1VQ4A 1IHZA 1QUQA 3JAME 5LMUQ 2KHIA 4IURA 4NMZA 4TSSA 1T5XD 1G6ZA 3GTJH 2AHOB 3A54A 3R3OA 1B44D 2EYFA 1X55A 2SNSA 3MZ5A 2IX3A 3D31A 5TSSA 4JI2L 3GQBA 4LFBQ 2Q8RE 4ZLTF 2B2VA 2XSCA 5C4JH 1VF7A 4A3JH 5T1GA 1PH4A 4OX9L 3T1YQ 2NTTA 1IBML 1CHPD 1PTOC 2E75C 5ISRA 3H09A 3SVMA 2BDOA 1CZGA 1OTCA 4I65A 1Q81C 3ND9A 2L0CA 1AW7A 4DR2Q 3R2IA 1IKMA 2P5ZX 4LW1A 4A3GH 2UXCQ 2K1BA 1WOCA 4DAYB 4CDDC 5CBEE 4LWCA 4JBMA 4DAYA 2F0TA 3S15B 3DXJC 4IUPA 4RKBA 3VA7A 4JOIA 1I4GA 3NBHB 2HHHL 4LAAA 4JI1Q 4E6IA 1RD9D 2AWNA 1D7QA 3EBEA 1ILPA 3NBHA 4FF1A 1ET9A 1CFMA 4LK1C 1V1PB 3NHHA 2PNRC 4P73A 2ID0A 1V1PA 4DV0L 4H7BA 4YHHQ 1VMPA 1B9MA 5EKKA 2DY7A 5M3FH 4A3KB 1DOMA 1J5EQ 2Q2UA 1E22A 3L7ZC 1IKLA 3ZJYC 1EWCA 4C3JG 1Y1WB 1BDOA 4RGTA 2K05A 4LF8Q 4DV7L 5EKLA 4BA1I 2F0VA 3CC4A 5D3IB 4K2KA 5KIXA 4Q5VA 2VUMG 2ZM6L 4KY5A 4A3IG 4A93H 4ZYSA 1JICA 3OW7A 1Y8NB 4C3IH 1Z9FA 3FVQA 3W3AA 2DJGC 1LTLA 5DEHA 4X62Q 1PH9A 3S16H 5ELCA 4WJWA 1SYBA 2CH4W 1Y1VG 1DONA 3HOVH 1OXTA 2QDBA 1Q1BA 3UE0A 1JJ2A 1ENAA 1EIFA 1EQVA 5L37A 1SNMA 1JMCA 2PCFB 1AP0A 2MO1A 3LNNA 3MC0B 2E76C 2J7ZA 4HIMA 1IBLL 3D3RA 3RLNA 3BYTB 3S9WA 1UAPA 1D2BA 4JG2A 2B2VC 5H1SE 4A76A 1TR5A 2EYOA 4DR6L 5IODA 4YCUA 3KF8B 3STBD 4X3TA 1PV4A 5KYIA 5C6AA 2SEBD 5IY0A 2IHEA 2X6LA 1HR0L 3GTGB 4B3SQ 5FLXc 4KI0A 2JXMB 1N36L 4NPSA 1SXTA 4CHTB 1X56A 3M4YA 5J1ZA 1S5FD 1TS2A 2NN6I 2PNHA 1PH6A 3RZOB 3I3CA 1NMFA 3HOWG 1KD1C 4XYQA 2HCCA 2KBNA 1GUTA 3CCSA 4DNTB 2ICIA 4DV4L 1N33Q 4JI5L 3O13A 2EYPA 3CMEA 2RDHA 1FYCA 2F1MA 2K4KA 5I6YA 1N32L 4K6DA 1IBKL 1SMYD 3J7YW 3PIPA 2UXDQ 1HZAA 3GTKB 1SMXA 3TBIB 2N55A 4KHPL 4CKEA 3VR5A 1ML0D 1O7ZA 1Y8OB 1HPCA 3HKSA 1QG7A 4LF5Q 1I6HB 3I72A 4C3JH 3J80E 4HJ5A 1NUCA 2PMZE 4HEDA 3FKIB 3NE5B 2OQ0A 1O78A 1NY4A 3I8ZA 3NTHA 3CPFA 3MXGA 5J22A 2VUMH 4POFA 3EA6A 1HXYD 3H0GG 1QVGA 2L12A 3S1NB 3G71A 4GKKQ 2XIWA 2SOBA 2UUBL 2CW0C 4LUVA 3OW2A 4GLXA 1BCPD 4LFCQ 4N8FA 1HNXL 1AE3A 3LX0A 4A3MG 1K83H 4A3BG 2QF7A 3OTOL 1JCKB 1Y1VH 1RIPA 3CU7A 3I4LA 2MJ8A 3BYYB 1P8LA 1TVXA 4BY1B 1VQKA 3RR5A 3SR1A 1BUVT 2Y0SB 4JV5Q 3P75A 1LT3D 1OXSC 5A2QE 1KC8C 1TT2A 4BY7G 2XVSA 1VQBA 4CBVA 3OPOA 2K5DA 1JQYD 2FFKB 2QA4A 1PTOF 1R4QB 4UP7A 4TKOB 2HQLA 4HMIA 1DD2A 3NWTA 2R93G 4R4OA 3K57A 4DUZL 1WD1A 3S14B 4O2DA 1E3PA 4LJZC 3M4OH 4HJ9A 2QDLA 1Z6HA 5CV6A 4G57A 2FHTA 5JJIA 1GVPA 1RTOA 1PH8A 2A8VA 1VQMA 4G4KA 4IPHA 1WFQA 4EQ5A 4C2MH 1LTBD 5C4XB 2CH4A 2ZTDA 3RD4A 2F03A 4YWLA 1STEA 1FGUA 1A62A 3HOWH 3J81E 1GKHA 1UEBA 3TRZA 5IWAQ 4HCSA 1QZHA 2AKWB 4YY3Q 3SK6A 1YNJC 4KK7A 2EYJA 1Y14B 1CZWA 1SNPA 3NK9A 2B63B 1M4VA 1VQIA 1A3UA 1I4QA 1X3FA 1LT4D 4KKTA 1II3A 1PYSB 2XTIA 3NPPA 1Q86C 1YZ6A 2R7DA 4DF7A 5ELEA 2DY8A 4NXNQ 2VQEQ 3KF6B 4BBSB 3EIVA 3QJYA 3URYA 4A4IA 3KF6A 1H9RA 3KYHC 3PMFA 3AEVA 2ZXPA 4JBJA 3S17B 5M9OA 2CWPA 4CJ1B 1FNVA 1U4LA 1AEXA 2B2TA 5I2YA 4FVMA 2X69A 4JVZA 2IY5B 1L1OB 4G7OC 1PTOH 4RHSA 3H0GH 1C8CA 1NSNS 1HQRD 2K01A 3TDQA 1Q82C 4HMJA 1L1OA 1Q3LA 4IUNA 2H4OA 1B8AA 3KK7A 2C5CA 1U5KA 3QOLA 4DGZA 1CT1D 1VDZA 4C3HB 2A68D 4G7ZC 3LWEA 4KTAA 4A3MH 4A3BH 2UXBL 1H9SB 4MZ9A 4YCWA 1S4ZA 3EROA 5CMDA 1H9SA 4K5XA 3HOZB 4BA2I 2E8GA 1X65A 3JC66 3RUZA 1K0RA 2PI2E 4CGYB 1PLFA 3A0JA 4DR5Q 1RCVD 1E2ZA 1G6PA 5G3LD 3T1HL 4DV5L 3CCRA 4BY7H 4KKUA 3CD6A 1A63A 3ONAB 3G6EA 2E2HB 1X54A 1SR3A 3SGIA 3D8GA 1WTRA 4JI4L 2PZTA 4HN7A 4AYBB 5CORA 1D1IA 3BS1A 2R93H 3RZDH 2F3WA 4JI6Q 2AQ1B 1K9MC 2M9VA 1RL2A 2R92B 3A55A 3W1BA 1SNCA 3N52A 1CA5A 2B8GA 3B6YA 5C3XA 3H15A 3W2DA 4Y7NH 5AJ3Q 1J9OA 1LT6D 4R4QA 1YEZA 4GKJQ 4X65L 2NVTH 4IPDA 3NQTA 4LFAL 2UU9L 4S3SA 2MHVA 3VYRA 1B53A 1TWFB 1EIGA 4EQOA 3JAMc 4P71A 2F4IA 2AUKA 3DWPA 2RA4A 1QWYA 4R4CA 3TZDA 1DOLA 1ENCA 1EY9A 3PO3G 4JI3Q 3I4MB 1VQ6A 4K0KQ 2MGSA 1FVIA 3I4NG 4KHZA 2CKZB 2UUAL 4DR7L 1SFOB 3EQLC 3A8JE 4ZAIA 1ONLA 2Z8LA 1A3VA 5KEEA 1KDBA 1TXYA 1MSGA 1A0IA 5C44B 1PTOD 1JWUD 5EKIA 4GOPB 1V1OA 4R4IA 4DR4Q 3AYHB 1BQQT 4GOPA 2B2TC 4DNIA 1JC7A 3Q0AA 3BU2A 3PIP3 4ZCKA 4AH6A 1L1OC 4F87A 2I0QA 4WJ3M 3MVVA 1M90C 2VXWA 1GJXA 2BA1A 1S5CD 4O1NA 2F4VL 5CR3A 2WINB 1J6QA 4OHJA 2K7VA 2IPKD 5DM73 3PO2G 3MFYA 3CP0A 1PH5A 1PA6A 1WJJA 4IQZA 5JJLA 2CQAA 2R6GA 3KJOA 2Q2HA 3HOXB 3TP5A 1E1OA 1GOZA 5COYA 1CTMA 1WTHA 5HGQA 4HTHA 2F0EA 3TSSA 3EVQA 2D0PA 2MUYA 4QCLA 2CWAA 3SDZA 2F52A 1STYA 3GTMB 1SDFA 5IE8A 4DV1L 2CVRA 4NB3A 2K52A 4PG3A 5IOCA 1OXVA 1IYVA 2GVAA 4V0BA 2L55A 2OXPA 4OO1I 1EFWA 3NQIA 3PUWA 1CQFA 3PUZA 3SK8A 3K0YA 5CV8A 4FF3A 3AMUA 2B2WA 4Q0FA 2BOSA 1SE3A 1O7LA 1SNQA 1TIID 1X3QA 4F8MA 2PZUA 4KV6A 3E3XA 1PRTD 4DUYL 1XX8A 1PZID 1V43A 1C7YA 1EWIA 2B8FA 1AN8A 2OT2A 4J6HA 3T13A 3EJIA 3TMEA 3I4NH 4DK0A 4DU9A 2I5MX 4LF6Q 1SE4A 1EUJA 2A6HD 1SSOA 1XNRL 3QIAA 2A5HA 4BY1G 1QOHA 2HDLA 3L2PA 4JI8Q 3M3YB 3OIPA 4KD4A 1N34Q 3TQYA 4IUQA 1PFNA 1TWGB 5K36G 4A3FB 3PUYA 4I7ZC 4K14A 4K6LA 4B9WA 2DJFC 5ELDA 3S1MB 3RN2A 5LMUL 5JAVA 3KLRA 2Z6KA 3U58A 4XDXA 4IFDI 1S40A 4GN3B 5J3BA 1A8VA 3RLFA 2FXQA 5D65A 5AFWA 2ZJPA 4LFBL 3HFZB 3PUVA 3HOYB 2HDMA 2VL6A 1S5DD 1K73C 3Q23A 3GTQB 4CDCC 1G2SA 1SN8A 5EJWA 1XMOQ 2K5NA 2G9HD 4IJLA 1EQTA 3PO2H 1TWAH 3TP6A 1S72A 1F2MA 1HNWQ 2JA6B 4FP5D 4DR2L 3M7NA 1O7YA 2UXCL 1I4HA 5C3EB 1TY0A 3TEHB 4DXGA 3A7AB 4P74A 3IAYA 4LF4Q 5HURA 2B63G 1JOOA 4KKSA 3GTKH 4RCNA 3OHXC 3S1RB 5IYBG 1YNND 5BN4A 1HA5A 5KNCA 1V8QA 4HSVA 5FO8B 2XWBB 1HJPA 3CCEA 5GAEC 1CM9A 1PMRA 1YHBA 5M5YB 3LGJA 2IX0A 2O5IC 3FDTA 5IYCG 2CW0D 2K33A 1GUNA 1YJWA 1XPOA 2KCTA 4U68A 4CJ2C 4XQQA 2WB1B 1NR2A 4YHHL 4B3RL 1H95A 3TP8A 2EZVA 1JORA 2ZXOA 1GUGA 3A5ZB 3T53B 3K80C 3C1FA 1K8MA 2OTJA 1LTID 1X9NA 1YHAA 1BF4A 2QEJC 1LTAD 3A7LA 2QKIC 4LF8L 2K50A 2PQEA 4WJ4A 1Q90A 5IGCA 4XXEA 2K5QA 4JI2Q 3U50C 3HKZB 1Y8PB 3MHBA 2E2JB 1XPUA 4A3DB 1CSQA 2TSSA 5T1IA 1UE5A 1XMQL 1I3QB 1X32A 1GHJA 5LHY1 5M3MB 4BY1H 1NE3A 1XNQQ 1JE5A 2F0HA 3HOUB 1Z7TA 2WFWA 1D6EC 3KLSA 4X62L 3H3VI 5K36H 2JA5B 2IW3A 4UP8A 3KJPA 5JVH3 2SNMA 1A15A 4LF9Q 2A73B 1B1ZA 2H5XA 2NVYB 3GV6A 2Z6KC 1CKMA 3G48A 1WTQA 4ZKCB 2AWOA 2A74C 4FDBA 4P75A 4RG1A 1B4OA 2Y0SE 2HHHQ 5FJ8H 1Q8IA 1YNJD 3TS0A 2F0MA 4A3LH 4X66Q 3OMGA 3T51B 2Z6BA 1PFSA 1VQNA 1Q12A 2NYZD 1ZEQX 2I5HA 3M4PA 4IPGA 4AQYQ 2HT1A 5LMNQ 1F9QA 5KYLA 2DUDA 1EU4A 2WP8J 3D4DA 5K5PA 5KNBA 4B3SL 3CAMA 5LL6X 2CFMA 2Z4IA 2B63H 3UDGA 3I4MG 5JEAH 2F0QA 1VS0A 5IGDA 2F0UA 2NBFA 2RDFA 3NELA 1H9JA 2E2IB 5IYBH 1Q7YC 5I9OA 3I73A 2LKVA 1V1QA 2FMCA 1STBA 3KF8A 2YU9B 2NVQB 4A75A 1EL0A 1TU2B 4QF4A 5IYCH 1OO9B 3DUZA 1I50B 2GN5A 2UXDL 4GZYC 4QL5A 4LUZA 3DLLA 2LXJA 3AFPA 1JE4A 3CCMA 4XQJA 3S17H 2VY3A 4PMCA 3BDOA 5GAGC 1YJNA 3K7AH 4LF5L 3NP8A 4JOIC 2K14A 5BN3A 3D0FA 1PDQA 2RBMA 1ZKOA 2GVBA 3IFTA 5IT9L 3BDCA 1LO5D 1LTTD 3HEJA 3NTIA 3X3NA 1ENFA 4RAUC 3GTLH 4A3EB 3FPPA 4MIUA 3I7FA 1W6KA 2L1BA 1GO3E 2N78A 2HUGA 5CV5A 1GHKA 1TWHH 3BG3A 5ELBA 3GTJB 3I55A 2KECA 2RCFA 3E0EA 4DR6Q 3E9HA 1QVCA 3C46A 2JJQA 4L6TB 1BXTA 1SYGA 3S24A 4ULLA 4HSPA 3F2DA 2KHSA 2ASBA 5D3DA 5DNFA 1HR0Q 2G9DA 4JI7Q 1EU3A 5C4JB 4XT1B 4A3JB 1Q1EA 4LF7Q 2B39A 3UDFA 1E0BA 3HP3A 2VS1A 4DAMA 1M1KC 4IJHA 4QQBX 4HJ8A 4R4TA 4L5SA 4JV5L 3S2HB 3PIO3 2H1EA 4H02A 2WV6D 2Q2TA 1A6XA 4A3GB 2R7ZB 2R92H 4A3CG 1RF2D 3H91A 4HIOA 4MNOA 4MTNA 2MQHA 1WTWA 1QZGA 1N32Q 4Z9CB 1KXLA 5C0XI 1Y69U 3PF5A 1J8IA 1MKHA 1EOTA 4IOAA 1DOKA 1BKBA 1SRUA 4OL7A 1T9HA 1ASZA 3A74A 3UE1A 1EEFD 1KQSA 3K81C 1TWFH 1PFBA 4OEMB 1FL0A 1WCMG 1U4PA 1WTOA 1JB3A 1VQAA 4DAVA 1R4PB 4X64Q 3I4MH 2L4NA 1BR9A 3ERQA 2AUJD 2ALYB 1HZCA 5M3FB 2BE5D 4YY3L 3H6MA 5GAHC 1VQEA 4X3SA 4LUOA 1B70B 5M5WB 2Q2IA 1VQOA 4ALPA 3CW2C 3NENA 5FK9C 4EGVA 4A3FG 1EY7A 5ELFA 2KOLA 2R61A 2CQOA 4KY6A 4DA2A 1UEAB 4YCVA 1QCBD 5JEAJ 3JAMi 4K8IA 5I9PA 2PPBC 4A93B 2WAQB 4MN3A 4PNYA 4C3IB 3BVGA 4NXNL 2A69C 1JJGA 2LS01 1VQGA 3RNUA 4XT3B 2LSSA 2MPMA 3K5MA 3Q8DA 1F9PA 4R8IA 2F0OA 4JYAL 1KL9A 3S16B 2F0SA 2VNUD 1LTGD 3SEBA 3D4RA 3HOVB 1HH2P 1BBUA 5DM63 3I90A 4BBRG 2EJGC 1SLJA 4C56C 1WI5A 1BCPB 4JBWA 3GTPH 4GNXB 2D0OA 3QG1A 1I94Q 4Y52H 1JJCB 4CDFC 4ZK9B 4GNXA 4APVA 1JR0D 4QMGA 5C3EG 2NVXH 4IN3A 4FO2A 4ODGA 3R93A 1PH7A 2PO4A 4XTCS 2RF4A 3V05A 1DZ1A 2F0FA 1FR3A 1JOKA 4DR5L 3HG9A 1CK1A 3UDIA 1W3SA 3F2UA 1SNDA 4CKBA 2F0PA 4B3MQ 4TQUS 4A3CH 3D6CA 5DLQE 4HIKA 3V2TA 3NTKA 3AFQA 1KLGD 2IT1A 4HCEA 3I70A 4MTKA 3NXWA 3STBC 5ELNA 4QJFA 1R9TB 2V4DA 2WIIB 3FP9A 4JI6L 3GTOH 2ES2A 1VQDA 2PMZB 2I07B 1XTCD 2K75A 2FINB 2EYLA 5GQOA 3G4SA 4L8JA 2PZWA 2EJMA 5AJ3L 1WCMH 1PH1A 3C2PA 1IW7C 1SYDA 3HKZG 4GKJL 1QB5D 1HNZQ 3IKJA 1HHVA 1YBYA 3FRPB 1XYIA 2D62A 2EQSA 3ERSX 4DR1Q 1G2TA 3P7JA 1HCZA 5E7NA 4A3KG 4C3JB 1CSPA 1GXDC 1VF5C 3DHQA 1MHWC 2OF1A 3M3YH 1KAAA 2KCNA 1PHJA 3HOUG 5EGTA 4JI3L 1Y1WG 4K0KL 3PCOB 4B3TQ 1O7IA 3WOEA 4A3FH 5I2XA
chains in the Genus database with same CATH topology
3PF4A 3I4NH 3KLWA 4BA1I 4XIGS 2I5MX 4DK6C 3CC4A 4LF6Q 1FJGQ 1EUJA 3RN5A 1XNRL 3ULLA 3CCJA 1SFOH 1WYDA 5IWAL 4EX5A 2ZM6L 2VUMG 4IFDJ 4A93H 4A3IG 4BY1G 4C3IH 3BZKA 1Z9FA 3L2PA 1G291 4JI8Q 1TWCH 4DR4L 1JT8A 4RMFA 1N34Q 3TQYA 1LTLA 1MIUA 5BR8Q 5C44H 5K36G 2PQAB 3PUYA 2UUBQ 4X62Q 1PH9A 3S16H 3T1HQ 2PQAA 1KRSA 4QY7A 4IOCA 4DV5Q 4OONA 1Y1VG 3RN2A 1HNXQ 1VQLA 3GTQH 5LMUL 3HOVH 1OXTA 3OTOQ 2Z6KA 1Q1BA 3UE0A 4BBRH 3U58A 1JJ2A 1EIFA 1IL2A 1JMCA 4IFDI 1S40A 4NXMQ 2VQEL 4GN3B 5J3BA 1A8VA 2MO1A 4OWXB 2FXQA 3RLFA 1I94L 3F2BA 1BVSA 5HY6A 3EN2A 2JA6H 2ZJPA 4HIMA 4GNXC 4LFBL 3HFZB 3PUVA 1IBLL 2VL6A 3RLNA 5C3EH 1K73C 3HOYG 4JG2A 1K8GA 1SN8A 1UWVA 3VDYA 3M9BA 1XMOQ 2OQKA 5H1SE 1OXXK 4A76A 2K5NA 2BH8A 4JBKA 5LMNW 4IJLA 4DR6L 3PO2H 1NJIC 1TWAH 4ME3A 4HJ7A 4YCUA 1L0WA 3KF8B 3STBD 3CCQA 1S72A 1HNWQ 1PH3A 1PV4A 1IZ6A 4UPAA 4DR2L 4LFAQ 1LM0A 5IY0A 4JI0Q 2JA6G 4B3ML 3F2CA 3M7NA 2IHEA 4DUZQ 2UXCL 4DV2Q 1HR0L 1CUKA 2RCNA 3BJUA 3TEHB 4KI0A 5IP9G 5FLXc 1N8RC 1N36L 4B3SQ 3GDEA 4NPSA 4P74A 3HOXH 4LF4Q 1X56A 4GN4B 2B63G 2NN6G 2NN6I 2PNHA 1VQHA 1PH6A 5JJKA 1YI2A 1VQ8A 1AE2A 2VZAA 3GTKH 2OCEA 3KOJA 4DR7Q 1NMFA 2JA9A 5IYBG 2E5LQ 1KD1C 3HOWG 1IYJB 2KBNA 2RHQB 3S15H 3CCSA 1DGSA 1YNXA 1HJPA 1X6OA 3J80i 5GAEC 3CCEA 3GTMH 3ER0A 4DV4L 1YHBA 2QEXA 1N33Q 4JI5L 3LGJA 2IX0A 1W2BA 3CMEA 5IYCG 4JYAQ 2K4KA 3I56A 1YJWA 1HNZL 1N32L 1MJCA 1XPOA 2KCTA 3W1GA 4YHHL 1IBKL 4B3RL 1H95A 2WB1E 3WWVA 4TVAB 3PIPA 2UXDQ 1HZAA 2E2JH 2NZHA 2WB1G 1SMXA 3A5ZB 4DR1L 3TS2A 3K80C 4KHPL 3CQZH 3CPWA 4R1JA 2NZOA 4OXPA 5M3MH 1NMGA 3HKSA 1X9NA 4LF5Q 1YHAA 2OTJA 4A3KH 3RLOA 4LF8L 4B3TL 2K50A 4C3JH 4HJ5A 3H3VH 2OWOA 3HOUH 4WJ4A 2PMZE 2KCMA 2OQ0A 1Y1WH 5IT9c 4JI2Q 3U50C 3HKZE 3FKIG 4LF6L 1FJGL 2JA5H 1NY4A 1ASYA 4OWTB 1XPUA 2JEBI 1CSQA 1JB7A 4HIDA 1UE5A 2MFIA 3CPFA 1XMQL 2NVYH 4A3DG 1YVCA 2VUMH 1NBWA 4JI8L 4POFA 4BY1H 3H0GG 1QVGA 1NE3A 3TREA 5M3MG 1JE5A 4DV6Q 1N34L 1XNQQ 5BR8L 1VCIA 3G71A 3CMAA 4GKKQ 2KHJA 2WFWA 2UUBL 4X62L 3H3VI 1HR0W 4LUVA 3OW2A 1N9WA 4UP8A 1X3GA 3KJPA 4GLXA 4LFCQ 1TWGH 1HNXL 1AE3A 2R7ZG 2JA5G 4A3MG 1K83H 4A3BG 3OTOL 4LF9Q 1VQ9A 2H5XA 3CC2A 1Y1VH 2R7FA 3CF5A 1RIPA 5C0XG 3S1MH 2Z6KC 4NXML 1P8LA 2UXBQ 3UDXA 1CKMA 3PIOA 1VQKA 3RR5A 4IO9A 2IX1A 3G48A 4YWMA 4QIWE 2AWOA 4P75A 4FDBA 4RG1A 1Z47A 5FLMG 1YITA 2Y0SE 4DV1Q 4JV5Q 2HHHQ 1VQFA 2QGQA 1K3RA 5FJ8H 2Y0SG 4GN5A 2UXBL 1OXSC 1KC8C 3TS0A 3HOYH 4BY7G 4DV3L 4GOPC 4A3LH 1VQBA 4L5RC 4X66Q 3CCLA 3CXCA 1LUZA 2JA8G 1U0LA 2QA4A 1IXRA 1D8LA 4GLAC 4UP7A 1PFSA 1VQNA 1Q12A 2HQLA 3M4PA 2I5HA 4IPGA 3J81i 4AQYQ 3F1ZA 3BZCA 1YJ9A 2HT1A 1E1TA 5LMNQ 4JI4Q 4JI0L 2R93G 4R4OA 4DUZL 2DUDA 4O2DA 1E3PA 4DV2L 3M4OH 1VQCA 4HJ9A 2JE6I 2WP8J 4B3SL 1MJEA 3CAMA 5JJIA 5FJ8G 5EAYA 4LF4L 2N3SA 1GVPA 4DKAC 5IP9H 1PH8A 1BBWA 2A8VA 2CFMA 1VQMA 4P72A 3GTGH 4A3LG 3AQQA 2B63H 4IPHA 1WFQA 2YV5A 4EQ5A 4C2MH 3UDGA 1VQ5A 3I4MG 3FHWA 1VS0A 2E5LL 3T1YL 2ZTDA 3I2ZA 4YWLA 4LNQA 3NELA 3RZOH 2OTLA 5C4XG 4O0AA 3HOWH 1FGUA 1A62A 5IYBH 5IYDG 1Q7YC 4POGA 2L15A 1GKHA 1UEBA 4X65Q 2VQFQ 5IWAQ 2N49A 3S1RH 3TRZA 1QZHA 2AKWB 4YY3Q 1V1QA 2UU9Q 1UE1A 1Y14B 4A75A 4DR3Q 5M5YH 5IYCH 2N8NA 2GN5A 2UXDL 2JQOA 1K8AC 4QL5A 1YHQA 4LUZA 3DLLA 3K8AA 1QUQB 2LXJA 1VQIA 3AFPA 4J15A 3J80c 3CCMA 4UP9A 2JA7G 2VY3A 5JEAG 1B7YB 3S17H 1X3FA 4PZ7A 3K7UC 3GD7A 5GAGC 1YJNA 3K7AH 1XPRA 2UUAQ 4LF5L 1PYSB 2XTIA 4BXXG 4JOIC 2K14A 4JI1L 1Q86C 2UUCQ 2ZJQA 1HZBA 3D0FA 2R7DA 1YZ6A 3PGZA 2GVBA 4NXNQ 2VQEQ 3KF6B 2IHFA 1I6HH 1KIXA 1LYLA 5IP7H 4BBSG 3EIVA 2KENA 4A4IA 3OYYA 1UE6A 1X3EA 3KF6A 5M5XH 3KYHC 3AEVA 1SROA 4JBJA 3FKIH 3GTLH 2CWPA 1PVOA 2MNAA 3I7FA 4A3EG 2XGTA 1GO3E 4A3DH 2IY5B 2N78A 1J5EL 1HNWL 1XNQL 4DV6L 4X6AH 1TWHH 1L1OB 1I3QH 2F3IA 3I55A 1C0AA 3E0EA 4DR6Q 3H0GH 1EQRA 3E9HA 1QVCA 1Q82C 1L1OA 2JJQA 4L5QA 3S1NH 3S2HH 3S1QH 1B8AA 5IP7G 3S24A 1U5KA 2I5LX 2V1CC 2A19A 3F2DA 4LF9L 2ASBA 1HR0Q 2R7ZH 1GD7A 4QGUA 4A3MH 4DK3C 4JI7Q 2VW9A 4A3BH 3MXNB 1Q1EA 3U4ZA 4AIMA 4LF7Q 4MZ9A 3UDFA 4JCVE 2EIFA 1EOVA 4YCWA 2F4VQ 4A3JG 2YYZA 2VS1A 4PMWA 4DAMA 5C0XJ 1E24A 3F8TA 1M1KC 4IJHA 4BA2I 1HZ9A 1S3OA 4QQBX 2E8GA 4HJ8A 4R4TA 3HOZG 2ZJRA 1X65A 4L5SA 3JC66 4OX9Q 4JV5L 1XJVA 1IBMQ 2BA0A 4H02A 1K0RA 2PI2E 5FLMH 2Q2TA 3A0JA 1C9OA 4IPCA 4DR5Q 4OO1G 1KHIA 3M4QA 1G6PA 2CCZA 1SE8A 2PI2A 4X66L 3T1HL 2R92H 3KFUA 4A3GG 4A3CG 4DV5L 3CCRA 4BY7H 4HIOA 4MNOA 5ELOA 3CD6A 4MTNA 1A63A 2MQHA 3G6EA 4AQYL 2ATWA 1X54A 2JA8H 1QZGA 2LXKA 1N32Q 5LMNL 1SR3A 3SGIA 5C0XI 3J7ZC 4JI4L 4B3RQ 1P16A 3PF5A 1MKHA 1VQJA 4IOAA 1EQQA 1BKBA 1SRUA 3M85A 2R93H 4AYBG 3RZDH 1T9HA 1ASZA 4KLKA 3S2DH 3PSIA 4JI6Q 3A74A 3UE1A 1KQSA 3S14H 3K81C 1K9MC 1RL2A 1TWFH 2YTXA 3W1BA 3J81c 5M5WH 1FL0A 2R92G 1WCMG 3B6YA 1XMOL 1CKNB 3H15A 3PO3H 1VQAA 2B29A 4Y7NH 5AJ3Q 3ICEA 4X64Q 2HIVA 3CCUA 3I4MH 1CKNA 1AH9A 4DV0Q 4R4QA 2ALYB 1I5FA 1YEZA 2ZTEA 3PUXA 4X65L 2VQFL 1HZCA 4GKJQ 5C4XH 3CC7A 3MEFA 1XMQQ 2NVTH 4IPDA 4YY3L 5IYDH 5M3FG 4LFAL 2UU9L 5GAHC 2HIXA 1VQEA 2E2IH 3E9IA 4DR3L 3K0XA 2B3GA 4LUOA 1VQPA 4DUYQ 3JAMc 1B70B 2Q2IA 4P71A 1VQOA 2YTYA 4ALPA 4YWKA 2YU9H 3CW2C 4R4CA 2NVQH 3NENA 2EXDA 4A3FG 2CQOA 4JI3Q 3PO3G 1VQ6A 1I50H 4K0KQ 4YCVA 1FVIA 3ULPA 2JA7H 4KHZA 4L5TA 3I4NG 2CKZB 5JEAJ 4DV7Q 1KRTA 3JAMi 2UUAL 1UE7A 3J81j 4DR7L 2UUCL 2WAQE 2MO0A 4IFDG 4A93G 1NTGA 1L2FA 2WAQG 5GROA 4NXNL 4BXXH 1VQ7A 1VQGA 1XNRQ 1JJGA 1N33L 2ZM6Q 3RNUA 1TXYA 1A0IA 2LSSA 4PZ6A 3Q8DA 4UY8C 1KL9A 4JYAL 4BBSH 5C44G 4GOPB 2C35B 4R4IA 3ULJA 3GO5A 4DR4Q 2VNUD 3AYHB 3W5OA 1EIYB 3NEMA 4GOPA 3CCVA 1YIJA 2A1AA 1HH2P 2Z0SA 1BBUA 4DNIA 4DV3Q 4A3EH 3HOVG 3L0OA 1VQ4A 1CKOA 1QUQA 4BBRG 1SLJA 3IRBA 1KXLA 5LMUQ 3BU2A 2KHIA 1WI5A 4JBWA 3GTPH 4GNXB 4AH6A 3GTJH 2AHOB 1L1OC 2D0OA 4WJ3M 2I0QA 2AMCB 1X55A 1I94Q 3D31A 1JJCB 4JI2L 2JEAI 4Y52H 4GNXA 4PZ8A 1M90C 4APVA 4JI7L 5C3EG 2BA1A 2NVXH 4LF7L 4LFBQ 1IBLQ 2F4VL 3DM3A 4C3HH 5GADC 3A5UA 1J6QA 1PH7A 5C4JH 4XTCS 4A3JH 2JK8A 2RF4A 2YTVA 1PH4A 3PO2G 4OX9L 3T1YQ 1IBML 4GKKL 3HOZH 1R9TH 3CP0A 3PV0A 4DR5L 3UDIA 1PA6A 1PH5A 1W3SA 1WJJA 1G51A 5JJLA 1OTCA 1Q8KA 4LFCL 2R6GA 1Q81C 2K5VA 3KJOA 2Q2HA 4DR2Q 4B3MQ 1KAWA 4TQUS 1E1OA 4A3CH 4LW1A 3HOXG 4A3GH 5DLQE 2UXCQ 4HIKA 1WOCA 3U4VA 4DAYB 3KDFB 5HGQA 3AFQA 1E7ZA 1XTDA 2DGYA 4LWCA 1N36Q 2IT1A 4JBMA 2BH2A 3STBC 3KDFA 2E2HH 2D0PA 5ELNA 4QJFA 4DPGA 2CWAA 3FP9A 1PH2A 1EYGA 2F52A 4JI6L 2K5HA 4JOIA 5IE8A 3NBHB 4DV1L 4OWWB 3GTOH 4NB3A 2HHHL 2K52A 4PG3A 4HJAA 1OXVA 2GVAA 4JI1Q 2RHSB 1V9PA 4JC0A 2AWNA 2ES2A 1D7QA 3EBEA 1VQDA 4OO1I 1EFWA 2K75A 4DV4Q 5GQOA 3G4SA 4GS3A 3PUWA 5AJ3L 1WCMH 3PUZA 4P73A 4X64L 1PH1A 4JI5Q 2ID0A 3HKZG 4DV0L 4GKJL 1GM5A 1HNZQ 4YHHQ 1IBKQ 1YBYA 3I4OA 4AYBE 4A3IH 5M3FH 2D62A 1OXUA 2EQSA 3ERSX 4DUYL 1Q46A 4DR1Q 1J5EQ 5E7NA 4A3KG 1E22A 1V43A 3L7ZC 1CSPA 3ZJYC 2Q2UA 4KHPQ 2ZTCA 1C7YA 1EWIA 3M3YH 1PYBA 3HOUG 1PHJA 4JI3L 1Y1WG 1QVFA 3PCOB 4GLVB 4B3TQ 4LF8Q 3J7A5 4K0KL 1O7IA 4A3FH 4DV7L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PF4 A;  3I4N H;  3KLW A;  4BA1 I;  4XIG S;  2I5M X;  4DK6 C;  3CC4 A;  4LF6 Q;  1FJG Q;  1EUJ A;  3RN5 A;  1XNR L;  3ULL A;  3CCJ A;  1SFO H;  1WYD A;  5IWA L;  4EX5 A;  2ZM6 L;  2VUM G;  4IFD J;  4A93 H;  4A3I G;  4BY1 G;  4C3I H;  3BZK A;  1Z9F A;  3L2P A;  1G29 1;  4JI8 Q;  1TWC H;  4DR4 L;  1JT8 A;  4RMF A;  1N34 Q;  3TQY A;  1LTL A;  1MIU A;  5BR8 Q;  5C44 H;  5K36 G;  2PQA B;  3PUY A;  2UUB Q;  4X62 Q;  1PH9 A;  3S16 H;  3T1H Q;  2PQA A;  1KRS A;  4QY7 A;  4IOC A;  4DV5 Q;  4OON A;  1Y1V G;  3RN2 A;  1HNX Q;  1VQL A;  3GTQ H;  5LMU L;  3HOV H;  1OXT A;  3OTO Q;  2Z6K A;  1Q1B A;  3UE0 A;  4BBR H;  3U58 A;  1JJ2 A;  1EIF A;  1IL2 A;  1JMC A;  4IFD I;  1S40 A;  4NXM Q;  2VQE L;  4GN3 B;  5J3B A;  1A8V A;  2MO1 A;  4OWX B;  2FXQ A;  3RLF A;  1I94 L;  3F2B A;  1BVS A;  5HY6 A;  3EN2 A;  2JA6 H;  2ZJP A;  4HIM A;  4GNX C;  4LFB L;  3HFZ B;  3PUV A;  1IBL L;  2VL6 A;  3RLN A;  5C3E H;  1K73 C;  3HOY G;  4JG2 A;  1K8G A;  1SN8 A;  1UWV A;  3VDY A;  3M9B A;  1XMO Q;  2OQK A;  5H1S E;  1OXX K;  4A76 A;  2K5N A;  2BH8 A;  4JBK A;  5LMN W;  4IJL A;  4DR6 L;  3PO2 H;  1NJI C;  1TWA H;  4ME3 A;  4HJ7 A;  4YCU A;  1L0W A;  3KF8 B;  3STB D;  3CCQ A;  1S72 A;  1HNW Q;  1PH3 A;  1PV4 A;  1IZ6 A;  4UPA A;  4DR2 L;  4LFA Q;  1LM0 A;  5IY0 A;  4JI0 Q;  2JA6 G;  4B3M L;  3F2C A;  3M7N A;  2IHE A;  4DUZ Q;  2UXC L;  4DV2 Q;  1HR0 L;  1CUK A;  2RCN A;  3BJU A;  3TEH B;  4KI0 A;  5IP9 G;  5FLX c;  1N8R C;  1N36 L;  4B3S Q;  3GDE A;  4NPS A;  4P74 A;  3HOX H;  4LF4 Q;  1X56 A;  4GN4 B;  2B63 G;  2NN6 G;  2NN6 I;  2PNH A;  1VQH A;  1PH6 A;  5JJK A;  1YI2 A;  1VQ8 A;  1AE2 A;  2VZA A;  3GTK H;  2OCE A;  3KOJ A;  4DR7 Q;  1NMF A;  2JA9 A;  5IYB G;  2E5L Q;  1KD1 C;  3HOW G;  1IYJ B;  2KBN A;  2RHQ B;  3S15 H;  3CCS A;  1DGS A;  1YNX A;  1HJP A;  1X6O A;  3J80 i;  5GAE C;  3CCE A;  3GTM H;  3ER0 A;  4DV4 L;  1YHB A;  2QEX A;  1N33 Q;  4JI5 L;  3LGJ A;  2IX0 A;  1W2B A;  3CME A;  5IYC G;  4JYA Q;  2K4K A;  3I56 A;  1YJW A;  1HNZ L;  1N32 L;  1MJC A;  1XPO A;  2KCT A;  3W1G A;  4YHH L;  1IBK L;  4B3R L;  1H95 A;  2WB1 E;  3WWV A;  4TVA B;  3PIP A;  2UXD Q;  1HZA A;  2E2J H;  2NZH A;  2WB1 G;  1SMX A;  3A5Z B;  4DR1 L;  3TS2 A;  3K80 C;  4KHP L;  3CQZ H;  3CPW A;  4R1J A;  2NZO A;  4OXP A;  5M3M H;  1NMG A;  3HKS A;  1X9N A;  4LF5 Q;  1YHA A;  2OTJ A;  4A3K H;  3RLO A;  4LF8 L;  4B3T L;  2K50 A;  4C3J H;  4HJ5 A;  3H3V H;  2OWO A;  3HOU H;  4WJ4 A;  2PMZ E;  2KCM A;  2OQ0 A;  1Y1W H;  5IT9 c;  4JI2 Q;  3U50 C;  3HKZ E;  3FKI G;  4LF6 L;  1FJG L;  2JA5 H;  1NY4 A;  1ASY A;  4OWT B;  1XPU A;  2JEB I;  1CSQ A;  1JB7 A;  4HID A;  1UE5 A;  2MFI A;  3CPF A;  1XMQ L;  2NVY H;  4A3D G;  1YVC A;  2VUM H;  1NBW A;  4JI8 L;  4POF A;  4BY1 H;  3H0G G;  1QVG A;  1NE3 A;  3TRE A;  5M3M G;  1JE5 A;  4DV6 Q;  1N34 L;  1XNQ Q;  5BR8 L;  1VCI A;  3G71 A;  3CMA A;  4GKK Q;  2KHJ A;  2WFW A;  2UUB L;  4X62 L;  3H3V I;  1HR0 W;  4LUV A;  3OW2 A;  1N9W A;  4UP8 A;  1X3G A;  3KJP A;  4GLX A;  4LFC Q;  1TWG H;  1HNX L;  1AE3 A;  2R7Z G;  2JA5 G;  4A3M G;  1K83 H;  4A3B G;  3OTO L;  4LF9 Q;  1VQ9 A;  2H5X A;  3CC2 A;  1Y1V H;  2R7F A;  3CF5 A;  1RIP A;  5C0X G;  3S1M H;  2Z6K C;  4NXM L;  1P8L A;  2UXB Q;  3UDX A;  1CKM A;  3PIO A;  1VQK A;  3RR5 A;  4IO9 A;  2IX1 A;  3G48 A;  4YWM A;  4QIW E;  2AWO A;  4P75 A;  4FDB A;  4RG1 A;  1Z47 A;  5FLM G;  1YIT A;  2Y0S E;  4DV1 Q;  4JV5 Q;  2HHH Q;  1VQF A;  2QGQ A;  1K3R A;  5FJ8 H;  2Y0S G;  4GN5 A;  2UXB L;  1OXS C;  1KC8 C;  3TS0 A;  3HOY H;  4BY7 G;  4DV3 L;  4GOP C;  4A3L H;  1VQB A;  4L5R C;  4X66 Q;  3CCL A;  3CXC A;  1LUZ A;  2JA8 G;  1U0L A;  2QA4 A;  1IXR A;  1D8L A;  4GLA C;  4UP7 A;  1PFS A;  1VQN A;  1Q12 A;  2HQL A;  3M4P A;  2I5H A;  4IPG A;  3J81 i;  4AQY Q;  3F1Z A;  3BZC A;  1YJ9 A;  2HT1 A;  1E1T A;  5LMN Q;  4JI4 Q;  4JI0 L;  2R93 G;  4R4O A;  4DUZ L;  2DUD A;  4O2D A;  1E3P A;  4DV2 L;  3M4O H;  1VQC A;  4HJ9 A;  2JE6 I;  2WP8 J;  4B3S L;  1MJE A;  3CAM A;  5JJI A;  5FJ8 G;  5EAY A;  4LF4 L;  2N3S A;  1GVP A;  4DKA C;  5IP9 H;  1PH8 A;  1BBW A;  2A8V A;  2CFM A;  1VQM A;  4P72 A;  3GTG H;  4A3L G;  3AQQ A;  2B63 H;  4IPH A;  1WFQ A;  2YV5 A;  4EQ5 A;  4C2M H;  3UDG A;  1VQ5 A;  3I4M G;  3FHW A;  1VS0 A;  2E5L L;  3T1Y L;  2ZTD A;  3I2Z A;  4YWL A;  4LNQ A;  3NEL A;  3RZO H;  2OTL A;  5C4X G;  4O0A A;  3HOW H;  1FGU A;  1A62 A;  5IYB H;  5IYD G;  1Q7Y C;  4POG A;  2L15 A;  1GKH A;  1UEB A;  4X65 Q;  2VQF Q;  5IWA Q;  2N49 A;  3S1R H;  3TRZ A;  1QZH A;  2AKW B;  4YY3 Q;  1V1Q A;  2UU9 Q;  1UE1 A;  1Y14 B;  4A75 A;  4DR3 Q;  5M5Y H;  5IYC H;  2N8N A;  2GN5 A;  2UXD L;  2JQO A;  1K8A C;  4QL5 A;  1YHQ A;  4LUZ A;  3DLL A;  3K8A A;  1QUQ B;  2LXJ A;  1VQI A;  3AFP A;  4J15 A;  3J80 c;  3CCM A;  4UP9 A;  2JA7 G;  2VY3 A;  5JEA G;  1B7Y B;  3S17 H;  1X3F A;  4PZ7 A;  3K7U C;  3GD7 A;  5GAG C;  1YJN A;  3K7A H;  1XPR A;  2UUA Q;  4LF5 L;  1PYS B;  2XTI A;  4BXX G;  4JOI C;  2K14 A;  4JI1 L;  1Q86 C;  2UUC Q;  2ZJQ A;  1HZB A;  3D0F A;  2R7D A;  1YZ6 A;  3PGZ A;  2GVB A;  4NXN Q;  2VQE Q;  3KF6 B;  2IHF A;  1I6H H;  1KIX A;  1LYL A;  5IP7 H;  4BBS G;  3EIV A;  2KEN A;  4A4I A;  3OYY A;  1UE6 A;  1X3E A;  3KF6 A;  5M5X H;  3KYH C;  3AEV A;  1SRO A;  4JBJ A;  3FKI H;  3GTL H;  2CWP A;  1PVO A;  2MNA A;  3I7F A;  4A3E G;  2XGT A;  1GO3 E;  4A3D H;  2IY5 B;  2N78 A;  1J5E L;  1HNW L;  1XNQ L;  4DV6 L;  4X6A H;  1TWH H;  1L1O B;  1I3Q H;  2F3I A;  3I55 A;  1C0A A;  3E0E A;  4DR6 Q;  3H0G H;  1EQR A;  3E9H A;  1QVC A;  1Q82 C;  1L1O A;  2JJQ A;  4L5Q A;  3S1N H;  3S2H H;  3S1Q H;  1B8A A;  5IP7 G;  3S24 A;  1U5K A;  2I5L X;  2V1C C;  2A19 A;  3F2D A;  4LF9 L;  2ASB A;  1HR0 Q;  2R7Z H;  1GD7 A;  4QGU A;  4A3M H;  4DK3 C;  4JI7 Q;  2VW9 A;  4A3B H;  3MXN B;  1Q1E A;  3U4Z A;  4AIM A;  4LF7 Q;  4MZ9 A;  3UDF A;  4JCV E;  2EIF A;  1EOV A;  4YCW A;  2F4V Q;  4A3J G;  2YYZ A;  2VS1 A;  4PMW A;  4DAM A;  5C0X J;  1E24 A;  3F8T A;  1M1K C;  4IJH A;  4BA2 I;  1HZ9 A;  1S3O A;  4QQB X;  2E8G A;  4HJ8 A;  4R4T A;  3HOZ G;  2ZJR A;  1X65 A;  4L5S A;  3JC6 6;  4OX9 Q;  4JV5 L;  1XJV A;  1IBM Q;  2BA0 A;  4H02 A;  1K0R A;  2PI2 E;  5FLM H;  2Q2T A;  3A0J A;  1C9O A;  4IPC A;  4DR5 Q;  4OO1 G;  1KHI A;  3M4Q A;  1G6P A;  2CCZ A;  1SE8 A;  2PI2 A;  4X66 L;  3T1H L;  2R92 H;  3KFU A;  4A3G G;  4A3C G;  4DV5 L;  3CCR A;  4BY7 H;  4HIO A;  4MNO A;  5ELO A;  3CD6 A;  4MTN A;  1A63 A;  2MQH A;  3G6E A;  4AQY L;  2ATW A;  1X54 A;  2JA8 H;  1QZG A;  2LXK A;  1N32 Q;  5LMN L;  1SR3 A;  3SGI A;  5C0X I;  3J7Z C;  4JI4 L;  4B3R Q;  1P16 A;  3PF5 A;  1MKH A;  1VQJ A;  4IOA A;  1EQQ A;  1BKB A;  1SRU A;  3M85 A;  2R93 H;  4AYB G;  3RZD H;  1T9H A;  1ASZ A;  4KLK A;  3S2D H;  3PSI A;  4JI6 Q;  3A74 A;  3UE1 A;  1KQS A;  3S14 H;  3K81 C;  1K9M C;  1RL2 A;  1TWF H;  2YTX A;  3W1B A;  3J81 c;  5M5W H;  1FL0 A;  2R92 G;  1WCM G;  3B6Y A;  1XMO L;  1CKN B;  3H15 A;  3PO3 H;  1VQA A;  2B29 A;  4Y7N H;  5AJ3 Q;  3ICE A;  4X64 Q;  2HIV A;  3CCU A;  3I4M H;  1CKN A;  1AH9 A;  4DV0 Q;  4R4Q A;  2ALY B;  1I5F A;  1YEZ A;  2ZTE A;  3PUX A;  4X65 L;  2VQF L;  1HZC A;  4GKJ Q;  5C4X H;  3CC7 A;  3MEF A;  1XMQ Q;  2NVT H;  4IPD A;  4YY3 L;  5IYD H;  5M3F G;  4LFA L;  2UU9 L;  5GAH C;  2HIX A;  1VQE A;  2E2I H;  3E9I A;  4DR3 L;  3K0X A;  2B3G A;  4LUO A;  1VQP A;  4DUY Q;  3JAM c;  1B70 B;  2Q2I A;  4P71 A;  1VQO A;  2YTY A;  4ALP A;  4YWK A;  2YU9 H;  3CW2 C;  4R4C A;  2NVQ H;  3NEN A;  2EXD A;  4A3F G;  2CQO A;  4JI3 Q;  3PO3 G;  1VQ6 A;  1I50 H;  4K0K Q;  4YCV A;  1FVI A;  3ULP A;  2JA7 H;  4KHZ A;  4L5T A;  3I4N G;  2CKZ B;  5JEA J;  4DV7 Q;  1KRT A;  3JAM i;  2UUA L;  1UE7 A;  3J81 j;  4DR7 L;  2UUC L;  2WAQ E;  2MO0 A;  4IFD G;  4A93 G;  1NTG A;  1L2F A;  2WAQ G;  5GRO A;  4NXN L;  4BXX H;  1VQ7 A;  1VQG A;  1XNR Q;  1JJG A;  1N33 L;  2ZM6 Q;  3RNU A;  1TXY A;  1A0I A;  2LSS A;  4PZ6 A;  3Q8D A;  4UY8 C;  1KL9 A;  4JYA L;  4BBS H;  5C44 G;  4GOP B;  2C35 B;  4R4I A;  3ULJ A;  3GO5 A;  4DR4 Q;  2VNU D;  3AYH B;  3W5O A;  1EIY B;  3NEM A;  4GOP A;  3CCV A;  1YIJ A;  2A1A A;  1HH2 P;  2Z0S A;  1BBU A;  4DNI A;  4DV3 Q;  4A3E H;  3HOV G;  3L0O A;  1VQ4 A;  1CKO A;  1QUQ A;  4BBR G;  1SLJ A;  3IRB A;  1KXL A;  5LMU Q;  3BU2 A;  2KHI A;  1WI5 A;  4JBW A;  3GTP H;  4GNX B;  4AH6 A;  3GTJ H;  2AHO B;  1L1O C;  2D0O A;  4WJ3 M;  2I0Q A;  2AMC B;  1X55 A;  1I94 Q;  3D31 A;  1JJC B;  4JI2 L;  2JEA I;  4Y52 H;  4GNX A;  4PZ8 A;  1M90 C;  4APV A;  4JI7 L;  5C3E G;  2BA1 A;  2NVX H;  4LF7 L;  4LFB Q;  1IBL Q;  2F4V L;  3DM3 A;  4C3H H;  5GAD C;  3A5U A;  1J6Q A;  1PH7 A;  5C4J H;  4XTC S;  4A3J H;  2JK8 A;  2RF4 A;  2YTV A;  1PH4 A;  3PO2 G;  4OX9 L;  3T1Y Q;  1IBM L;  4GKK L;  3HOZ H;  1R9T H;  3CP0 A;  3PV0 A;  4DR5 L;  3UDI A;  1PA6 A;  1PH5 A;  1W3S A;  1WJJ A;  1G51 A;  5JJL A;  1OTC A;  1Q8K A;  4LFC L;  2R6G A;  1Q81 C;  2K5V A;  3KJO A;  2Q2H A;  4DR2 Q;  4B3M Q;  1KAW A;  4TQU S;  1E1O A;  4A3C H;  4LW1 A;  3HOX G;  4A3G H;  5DLQ E;  2UXC Q;  4HIK A;  1WOC A;  3U4V A;  4DAY B;  3KDF B;  5HGQ A;  3AFQ A;  1E7Z A;  1XTD A;  2DGY A;  4LWC A;  1N36 Q;  2IT1 A;  4JBM A;  2BH2 A;  3STB C;  3KDF A;  2E2H H;  2D0P A;  5ELN A;  4QJF A;  4DPG A;  2CWA A;  3FP9 A;  1PH2 A;  1EYG A;  2F52 A;  4JI6 L;  2K5H A;  4JOI A;  5IE8 A;  3NBH B;  4DV1 L;  4OWW B;  3GTO H;  4NB3 A;  2HHH L;  2K52 A;  4PG3 A;  4HJA A;  1OXV A;  2GVA A;  4JI1 Q;  2RHS B;  1V9P A;  4JC0 A;  2AWN A;  2ES2 A;  1D7Q A;  3EBE A;  1VQD A;  4OO1 I;  1EFW A;  2K75 A;  4DV4 Q;  5GQO A;  3G4S A;  4GS3 A;  3PUW A;  5AJ3 L;  1WCM H;  3PUZ A;  4P73 A;  4X64 L;  1PH1 A;  4JI5 Q;  2ID0 A;  3HKZ G;  4DV0 L;  4GKJ L;  1GM5 A;  1HNZ Q;  4YHH Q;  1IBK Q;  1YBY A;  3I4O A;  4AYB E;  4A3I H;  5M3F H;  2D62 A;  1OXU A;  2EQS A;  3ERS X;  4DUY L;  1Q46 A;  4DR1 Q;  1J5E Q;  5E7N A;  4A3K G;  1E22 A;  1V43 A;  3L7Z C;  1CSP A;  3ZJY C;  2Q2U A;  4KHP Q;  2ZTC A;  1C7Y A;  1EWI A;  3M3Y H;  1PYB A;  3HOU G;  1PHJ A;  4JI3 L;  1Y1W G;  1QVF A;  3PCO B;  4GLV B;  4B3T Q;  4LF8 Q;  3J7A 5;  4K0K L;  1O7I A;  4A3F H;  4DV7 L; 
#chains in the Genus database with same CATH topology
 1JWS D;  3KLW A;  1FJG Q;  4IUV A;  2VUM B;  1MSH A;  4A3I B;  3RN5 A;  2KEE A;  4HAE A;  4EX5 A;  4IFD J;  2CHB D;  4OIJ A;  3BZK A;  1WD0 A;  4L63 B;  1TWC H;  2PYK A;  4DR4 L;  1JT8 A;  3MXP A;  5BR8 Q;  1FD7 D;  1K83 B;  2O4X A;  1Y1V B;  3T1H Q;  4QY7 A;  4DV5 Q;  4OON A;  1VQL A;  3GTQ H;  2JN4 A;  2O2L D;  4KJO A;  4BBR H;  1IL2 A;  2EY6 A;  4IAL A;  4NXM Q;  4IZ8 A;  1EYD A;  4OWX B;  4FF4 A;  2PW7 A;  1TS5 A;  2F3V A;  3F2B A;  2Q8I B;  2D9U A;  3EN2 A;  5HY6 A;  2A6E C;  5I4D A;  2JA6 H;  1BCP C;  3RMH A;  4GNX C;  2EJF C;  1IL8 A;  5C3E H;  3L9A X;  1K8G A;  1PZK D;  2NN6 H;  3G6J B;  3M9B A;  5D14 A;  2OQK A;  3R8B A;  4CDE C;  5LMN W;  3VYS A;  1H9K A;  4ME3 A;  3CCQ A;  4YIJ A;  1PH3 A;  2R3Z A;  4ABN A;  2F0N A;  4LFA Q;  3TP7 A;  4JI0 Q;  1F2Y A;  4FXD A;  4DV2 Q;  2RCN A;  3BJU A;  5IP9 G;  1N8R C;  4K2L A;  3GDE A;  4GN4 B;  4FXK C;  4H13 C;  4JW0 A;  4OIK A;  4PMB A;  5JJK A;  1YI2 A;  1VQ8 A;  3HOW B;  2OCE A;  4DR7 Q;  2JA9 A;  2E5L Q;  3S15 H;  1TS3 A;  1DGS A;  1U4M A;  1X3P A;  3VA5 A;  1X6O A;  3J80 i;  1I4R A;  1HQM C;  2HD3 A;  1KTK A;  1LT5 D;  3FMC A;  1JWM D;  1B3Q A;  1ESR A;  2EYM A;  2WB1 E;  3DWQ A;  1A2T A;  4OGQ C;  4TRD A;  2FJ2 A;  4TVA B;  3K6O A;  3WWV A;  2E2J H;  2E74 C;  4ZUJ A;  1ROD A;  3CPW A;  1QJO A;  4OXP A;  5M3M H;  4A3K H;  3RLO A;  3R2T A;  3BZD B;  1NCV A;  2OWO A;  3HOU H;  4QUC A;  1Y1W H;  3IL8 A;  5EPK A;  3HKZ E;  3FKI G;  4LF6 L;  4ME5 A;  2JA5 H;  4IUT A;  4OWT B;  1A3T A;  1HUM A;  1KDA A;  4RWS C;  2JEB I;  1JB7 A;  2MFI A;  2NVY H;  4KN7 C;  1PTO B;  3CQZ B;  4NKL A;  1FNW A;  1NBW A;  1F9S A;  2X6G A;  3H0G B;  4NW2 A;  4JI8 L;  2E2D C;  3QOJ A;  3TRE A;  4DV6 Q;  1N34 L;  5BN5 A;  5IIF A;  3CMA A;  2KHJ A;  1G8Z D;  1HR0 W;  1D5Z C;  3SE0 A;  1ZYR C;  1N9W A;  1X3G A;  3D6W A;  4A3B B;  2R7Z G;  3PQI A;  1EY0 A;  1SYC A;  2EE1 A;  1VQ9 A;  5FOB B;  3CC2 A;  2NUC A;  2R7F A;  3CF5 A;  3L3O C;  5E4X A;  3PIO A;  1HTL D;  4QIW B;  1DJR D;  5IT9 E;  5F2D A;  4ZRZ A;  5FLM G;  3IFD A;  1CA6 A;  4DFA A;  2A68 C;  2F0J A;  4F7X A;  5NUC A;  4DV1 Q;  2HQE A;  1K3R A;  2Y0S G;  4BY7 B;  3MXU A;  1SBB B;  5EBD A;  4DV3 L;  3T4A C;  4GOP C;  1EIH A;  1K3B C;  2WKC A;  4PV1 C;  4QUF A;  1IXR A;  1D8L A;  4GLA C;  3P1H A;  2L5T A;  1HNW L;  3J81 i;  3U9S A;  1YJ9 A;  3BZC A;  1U9R A;  3RZD B;  1E1T A;  2R93 B;  1AZQ A;  2NB0 A;  1B3A A;  1EZ8 A;  2Z4H A;  5FLX L;  2M00 A;  2TMP A;  5FJ8 G;  4EQP A;  5EAY A;  4LF4 L;  1LAB A;  2N3S A;  4DKA C;  5IP9 H;  1MBY A;  3GTG H;  2EYH A;  4A3L G;  3AQQ A;  1VQ5 A;  4ZUI A;  3T1Y L;  3I2Z A;  5DAU A;  3RZO H;  5C4X G;  2N88 A;  4POG A;  1KLU D;  5EPJ A;  1LTS D;  1MD2 D;  2VQF Q;  5IGG A;  3ND8 A;  2Q8T A;  2NZ1 D;  1B2T A;  4HR7 B;  2Z9H A;  4DR3 Q;  1WTP A;  1RHP A;  1NNX A;  2VB3 X;  2JQO A;  1K8A C;  1YHQ A;  3HS0 C;  1QUQ B;  4J15 A;  4KD3 A;  3J80 c;  1K28 A;  1PRT B;  1EY4 A;  1B7Y B;  5JEA G;  5A35 A;  3K7U C;  3GD7 A;  1EZ6 A;  4NDX A;  4B9X A;  4BXX G;  5EBC A;  4JI1 L;  2UUC Q;  3KLS X;  3K58 A;  2ZJQ A;  1HZB A;  4H0L C;  3PGZ A;  2IHF A;  1I6H H;  1KIX A;  1B9N A;  2AQ3 B;  5IP7 H;  4N9T A;  4BBS G;  1RKN A;  4O42 A;  1ESF A;  2RVL A;  4KY7 A;  5E4W C;  1SRO A;  3FKI H;  2B2W C;  2MNA A;  5EPL A;  4CKC A;  1O80 A;  1BO0 A;  1LV9 A;  1SAP A;  1I4P A;  1J5E L;  1XNQ L;  2EY5 A;  2XN9 C;  1EQR A;  4U67 3;  3S1N H;  3SK5 A;  3S2H H;  5M5X B;  3G7L A;  3DWA A;  3H3V C;  1TS4 A;  1HFN A;  2I5L X;  4LF9 L;  5CYU A;  5FKA C;  2R7Z H;  3K5L A;  4C3H G;  4DK3 C;  1HTP A;  1LTR D;  1STH A;  3MXN B;  2K6A A;  4JCV E;  1EOV A;  4PMW A;  5C0X J;  1GUO A;  3F8T A;  3MXN A;  1VMC A;  2ENB A;  1HZ9 A;  1S3O A;  1B50 A;  3ITP A;  1BCP F;  2FMM A;  1SYE A;  3HOZ G;  4FXG C;  4OX9 Q;  3S1Q B;  3KUP A;  1WTV A;  1IBM Q;  2BA0 A;  5FLM H;  4OO1 G;  4G7H C;  3T56 B;  1KHI A;  3M4Q A;  1SE8 A;  4X66 L;  3KFU A;  3CRL C;  5ELO A;  4RHR A;  4AQY L;  3U9O A;  2ATW A;  5LMN L;  3J7Z C;  1KNE A;  4B3R Q;  1PFM A;  1VQJ A;  4J1M A;  4AYB G;  5CBA E;  3NUC A;  5C5M A;  1CI3 M;  3PSI A;  2A69 D;  3S14 H;  3C3L A;  3J81 c;  5M5W H;  2R92 G;  4RH6 A;  1CKN B;  2JA8 B;  2B29 A;  1F77 A;  1LAC A;  3CCU A;  4RKL A;  1CKN A;  4DV0 Q;  2ZTE A;  3PUX A;  2KJX A;  5C4X H;  1XMQ Q;  1CHQ D;  3DEP A;  3I91 A;  2LMC B;  4OEL B;  3S2D B;  2C9O A;  5CV4 A;  4UHV A;  3E9I A;  1TKW B;  2B3G A;  1VQP A;  2O5J C;  4DAP A;  1DYQ A;  1I4X A;  4JK1 C;  1M8A A;  2YTY A;  4FNF A;  2G5D A;  3AB9 A;  3PO3 B;  1ICW A;  2EXD A;  3I4N B;  5C5L A;  5IGB A;  3T16 A;  4L5T A;  2DNE A;  4DV7 Q;  1KRT A;  1UE7 A;  3Q6S A;  3J81 j;  3MTS A;  3D4W A;  3QB3 A;  1PRT C;  2WAQ E;  4IFD G;  5GRO A;  2XRQ D;  2NTS A;  4BXX H;  3BDL A;  1VQ7 A;  1N33 L;  2ZM6 Q;  2RSN A;  4PZ6 A;  4H44 C;  1W6J A;  4FF2 A;  1WVL A;  4BBS H;  5C44 G;  2KCC A;  2C35 B;  4KHV A;  3ULJ A;  5KRU A;  3FPU B;  1EIY B;  3NEM A;  4UAI A;  2JA7 B;  5CV9 A;  2A6H C;  1F9R A;  4PQX A;  3CCV A;  2Z0S A;  2OEO A;  1EWH A;  3L0O A;  5E1F A;  4B08 A;  1CKO A;  2K5W A;  3IRB A;  1S5E D;  5CV7 A;  2F0D A;  2AMC B;  4KMU C;  2DN8 A;  2JEA I;  4PZ8 A;  2WKD A;  4JI7 L;  1KDC A;  2EDG A;  4LF7 L;  1IBL Q;  3DM3 A;  4C3H H;  5GAD C;  3A5U A;  2HCI A;  1IW7 D;  3PO2 B;  2JK8 A;  1TWA B;  1ET6 A;  2YTV A;  1D1K A;  1FNU A;  4GKK L;  2K04 A;  3HOZ H;  1R9T H;  3PV0 A;  3MAQ A;  2ZXR A;  1G51 A;  1QNK A;  1Q8K A;  4OO1 H;  1EFI D;  4LFC L;  2K5V A;  2KQ3 A;  1KAW A;  2LY7 A;  3HOX G;  3U4V A;  4WFN 3;  3KDF B;  2WAC A;  1E7Z A;  1XTD A;  2DGY A;  2XWJ B;  2EY1 A;  4QB4 A;  1N36 Q;  2BH2 A;  5LL6 S;  5JPN C;  3KDF A;  2E2H H;  1L0Y B;  4DPG A;  5G3L F;  1ZXT A;  1PH2 A;  1EYG A;  5E3F A;  1L0X B;  2K5H A;  4XQN A;  4JPB W;  2QCP X;  4OWW B;  4RA8 A;  4HJA A;  1ICF B;  2RHS B;  1V9P A;  4JC0 A;  5J39 A;  4ID6 A;  2DNC A;  4NP5 A;  4DV4 Q;  1EYC A;  4GS3 A;  1SEB D;  4X64 L;  4JI5 Q;  2EXZ A;  4MHE A;  4IUU A;  5HGT A;  1GM5 A;  1YNN C;  2BCO A;  2JSO A;  1IBK Q;  2IL8 A;  4N9P A;  3I4O A;  3OSO A;  4AYB E;  3JAM L;  4A3I H;  4WOR A;  1OXU A;  1Q46 A;  3MA2 B;  4KJN A;  3MEH A;  4M8A A;  4KHP Q;  4DK1 A;  3WOF A;  2ZTC A;  2GA4 B;  1PYB A;  1QVF A;  2A6E D;  3J7A 5;  4GLV B;  3E6Z X;  5EQ0 A;  3DM1 A;  1K8O A;  2KA7 A;  1C4Q A;  2KED A;  3E0J A;  1EYA A;  3PF4 A;  2RQX A;  3QWN A;  4XIG S;  4DK6 C;  1BOS A;  3ULL A;  3CCJ A;  1SFO H;  1WYD A;  5IWA L;  4IFD H;  2RKS A;  3HZX A;  1G29 1;  2BDN A;  2L9H A;  4RMF A;  2K32 A;  3MWY W;  1E2V A;  1MIU A;  2XRS D;  3BVZ A;  5C44 H;  1XXG A;  2PQA B;  2UUB Q;  5KND A;  2Z1C A;  2PQA A;  1KRS A;  4IOC A;  1HNX Q;  3OTO Q;  2VB2 X;  4K5W A;  1RTN A;  2VQE L;  1I94 L;  3M7G A;  1BVS A;  1CQV A;  5FO7 B;  3CHB D;  4BS9 A;  3HOY G;  5CGK A;  2F0K A;  1UWV A;  3VDY A;  1MGS A;  1OXX K;  2BH8 A;  4JBK A;  1NJI C;  1F2Z A;  4HJ7 A;  1L0W A;  1STN A;  3E5S A;  1EY8 A;  3P20 A;  5JPM C;  1IZ6 A;  4UPA A;  1LM0 A;  2JA6 G;  3CKI B;  4B3M L;  2ZT9 C;  3F2C A;  4DUZ Q;  2J4X A;  5KGU A;  2B2Y A;  3VYT A;  1CUK A;  4XYO A;  3HOX H;  2QIL A;  2NN6 G;  1STA A;  1VQH A;  3VR6 A;  1UNS A;  3OIQ A;  1AE2 A;  2EPB A;  2AQ2 B;  2VZA A;  1I6V C;  3KOJ A;  1IYJ B;  2RHQ B;  1YNX A;  3GTM H;  2EOT A;  3ER0 A;  2QEX A;  1W2B A;  4LMQ D;  4RFB A;  4JYA Q;  3I56 A;  1HNZ L;  1MJC A;  1ZYR D;  3W1G A;  3DMU A;  1U4R A;  1SNO A;  3K7A B;  2NZH A;  2WB1 G;  3CRK C;  3LWU A;  3VR2 A;  4DR1 L;  3OWE B;  4I7A A;  3TS2 A;  4K8J A;  3CQZ H;  3A56 A;  5C4H A;  4R1J A;  1DM0 B;  2NZO A;  3BVM A;  5FLX E;  1NMG A;  3OMC A;  4B3T L;  1FGB D;  3H3V H;  1DCZ A;  3AU7 A;  2RDG A;  2KCM A;  5IT9 c;  3GTL B;  2B2U A;  1FJG L;  5JVG 3;  1PRT F;  1BBX C;  1ASY A;  3J7A V;  4BWG B;  4HID A;  1HUN A;  1RDP D;  1TWH B;  4A3D G;  1SYF A;  1YVC A;  2SDF A;  1XWE A;  2L11 A;  2MP1 A;  2KUM A;  5M3M G;  1KAB A;  5BR8 L;  1VCI A;  1TQO A;  1H9M A;  1D5X C;  1SMY C;  1SJE D;  1TWG H;  2JA5 G;  3HRZ C;  3EFX D;  1IYU A;  1S5B D;  1QNU A;  3VYU A;  5C0X G;  4F88 A;  4NXM L;  3S1M H;  2UXB Q;  1SJH D;  3UDX A;  3SK4 A;  3QR8 A;  4IO9 A;  2IX1 A;  4YWM A;  2QW7 A;  4QIW E;  1E2W A;  1Z47 A;  3Q22 A;  1YIT A;  3KBG A;  4X3K A;  1UUP A;  1VQF A;  2QGQ A;  4GN5 A;  1EY5 A;  4P2C B;  3HOY H;  2PW5 A;  3HGB A;  1G91 A;  3GV3 A;  4L5R C;  3CCL A;  3V96 A;  3CXC A;  1LUZ A;  1T5E A;  1U0L A;  2I46 A;  5FO9 B;  2JA8 G;  2RSO A;  4RCO A;  4WRD A;  2KVM A;  3F1Z A;  2K28 A;  4JI4 Q;  4JI0 L;  4DV2 L;  1VQC A;  2JE6 I;  1MJE A;  2B2Y C;  1AZP A;  3J80 L;  2EY2 A;  1BBW A;  1PYW D;  3QO2 A;  4P72 A;  2YV5 A;  1F2L A;  2J0T D;  3FHW A;  2E5L L;  4EQN A;  4LNQ A;  2OTL A;  3C1E A;  4O0A A;  5IYD G;  3M4O B;  2L15 A;  4X65 Q;  3S1R H;  1LLR D;  2N49 A;  1HA6 A;  3FEW X;  2UU9 Q;  4M1U B;  2F0W A;  1PXU A;  1TY2 A;  1UE1 A;  2XNA C;  2ICE C;  3SXH A;  3ZYY X;  5M5Y H;  2N8N A;  4C2M B;  3K8A A;  3NWS A;  2JA7 G;  4RGN A;  4UP9 A;  3N6R A;  2BE5 C;  4PZ7 A;  3J7A F;  1XPR A;  2UUA Q;  5I6W A;  2JP1 A;  1PZJ D;  3X3M A;  1DXM A;  1LYL A;  2KEN A;  3OYY A;  1UE6 A;  1X3E A;  5M5X H;  1HFG A;  2B2U C;  5A2Q L;  3Q24 A;  1NR4 A;  3UI2 A;  3WDN A;  1PVO A;  4C1N I;  2D5D A;  4A3E G;  2XGT A;  4R9W A;  4A3D H;  4X6A H;  3NBI A;  4DV6 L;  5C3W A;  3GTP B;  1AFP A;  1I3Q H;  2F3I A;  4ZQ3 A;  1C0A A;  5IGE A;  4CJ0 B;  1NAP A;  3KBX A;  4K5V A;  4L5Q A;  1STG A;  3S1Q H;  5IP7 G;  2NVX B;  2V1C C;  2A19 A;  1GD7 A;  4QGU A;  4FYD A;  2VW9 A;  3A8K E;  3U4Z A;  3VR3 A;  4AIM A;  2EIF A;  2F4V Q;  1SE2 A;  2YYZ A;  3SHL A;  5C0X H;  4A3J G;  1JOQ A;  1E24 A;  4DN4 M;  4EVO A;  4X3U A;  3OWF A;  2ZJR A;  3A8I E;  3J81 L;  3OOC A;  1XJV A;  1C9O A;  4IPC A;  3K5N A;  3K5O A;  2CCZ A;  2PI2 A;  4A3M B;  1C48 A;  4A3G G;  2F0L A;  3TN2 A;  3GP7 A;  2JA8 H;  3NSW A;  2LXK A;  5CC4 A;  2K03 A;  3MFG A;  1P16 A;  4DXF A;  5C4Z A;  3GTO B;  1EQQ A;  3M85 A;  2IWH A;  2M2L A;  4KLK A;  3S2D H;  2IJ0 A;  4RGO S;  2NWG A;  2D2C C;  2YTX A;  4RGM A;  3H94 A;  4C1N K;  1WCM B;  1QE6 A;  1GUW A;  4V19 0;  1XMO L;  3PO3 H;  2JYO A;  1A2U A;  3ICE A;  2HIV A;  1ILQ A;  1AH9 A;  1I5F A;  1GUS A;  2VQF L;  1RJT A;  4N8X 1;  1KNA A;  2LFN A;  3MEF A;  3CC7 A;  4DNR B;  5IYD H;  5M3F G;  1WTX A;  2HIX A;  2E2I H;  2F0I A;  1MI2 A;  4DR3 L;  3K0X A;  4DUY Q;  4KN4 C;  1HRJ A;  2YU9 H;  4YWK A;  1K0S A;  2NVQ H;  1EY6 A;  1D5M C;  4J8Q A;  4Y7N B;  1EEI D;  5IGF A;  3K59 A;  1I50 H;  3ULP A;  2JA7 H;  3TZU A;  2NVT B;  2UUC L;  2MO0 A;  3DEO A;  1NTG A;  4A93 G;  1L2F A;  2WAQ G;  4C3I G;  1XNR Q;  1TWC B;  1QIL A;  2F0G A;  4UY8 C;  2EVB A;  5JOB A;  3GO5 A;  3VR4 A;  3W5O A;  4ZKB B;  4ILW A;  4UDU C;  1YIJ A;  2A1A A;  4BBR B;  5JJZ A;  4DV3 Q;  4A3E H;  1BNZ A;  4R8N A;  3HOV G;  1VQ4 A;  1IHZ A;  1QUQ A;  3JAM E;  5LMU Q;  2KHI A;  4IUR A;  4NMZ A;  4TSS A;  1T5X D;  1G6Z A;  3GTJ H;  2AHO B;  3A54 A;  3R3O A;  1B44 D;  2EYF A;  1X55 A;  2SNS A;  3MZ5 A;  2IX3 A;  3D31 A;  5TSS A;  4JI2 L;  3GQB A;  4LFB Q;  2Q8R E;  4ZLT F;  2B2V A;  2XSC A;  5C4J H;  1VF7 A;  4A3J H;  5T1G A;  1PH4 A;  4OX9 L;  3T1Y Q;  2NTT A;  1IBM L;  1CHP D;  1PTO C;  2E75 C;  5ISR A;  3H09 A;  3SVM A;  2BDO A;  1CZG A;  1OTC A;  4I65 A;  1Q81 C;  3ND9 A;  2L0C A;  1AW7 A;  4DR2 Q;  3R2I A;  1IKM A;  2P5Z X;  4LW1 A;  4A3G H;  2UXC Q;  2K1B A;  1WOC A;  4DAY B;  4CDD C;  5CBE E;  4LWC A;  4JBM A;  4DAY A;  2F0T A;  3S15 B;  3DXJ C;  4IUP A;  4RKB A;  3VA7 A;  4JOI A;  1I4G A;  3NBH B;  2HHH L;  4LAA A;  4JI1 Q;  4E6I A;  1RD9 D;  2AWN A;  1D7Q A;  3EBE A;  1ILP A;  3NBH A;  4FF1 A;  1ET9 A;  1CFM A;  4LK1 C;  1V1P B;  3NHH A;  2PNR C;  4P73 A;  2ID0 A;  1V1P A;  4DV0 L;  4H7B A;  4YHH Q;  1VMP A;  1B9M A;  5EKK A;  2DY7 A;  5M3F H;  4A3K B;  1DOM A;  1J5E Q;  2Q2U A;  1E22 A;  3L7Z C;  1IKL A;  3ZJY C;  1EWC A;  4C3J G;  1Y1W B;  1BDO A;  4RGT A;  2K05 A;  4LF8 Q;  4DV7 L;  5EKL A;  4BA1 I;  2F0V A;  3CC4 A;  5D3I B;  4K2K A;  5KIX A;  4Q5V A;  2VUM G;  2ZM6 L;  4KY5 A;  4A3I G;  4A93 H;  4ZYS A;  1JIC A;  3OW7 A;  1Y8N B;  4C3I H;  1Z9F A;  3FVQ A;  3W3A A;  2DJG C;  1LTL A;  5DEH A;  4X62 Q;  1PH9 A;  3S16 H;  5ELC A;  4WJW A;  1SYB A;  2CH4 W;  1Y1V G;  1DON A;  3HOV H;  1OXT A;  2QDB A;  1Q1B A;  3UE0 A;  1JJ2 A;  1ENA A;  1EIF A;  1EQV A;  5L37 A;  1SNM A;  1JMC A;  2PCF B;  1AP0 A;  2MO1 A;  3LNN A;  3MC0 B;  2E76 C;  2J7Z A;  4HIM A;  1IBL L;  3D3R A;  3RLN A;  3BYT B;  3S9W A;  1UAP A;  1D2B A;  4JG2 A;  2B2V C;  5H1S E;  4A76 A;  1TR5 A;  2EYO A;  4DR6 L;  5IOD A;  4YCU A;  3KF8 B;  3STB D;  4X3T A;  1PV4 A;  5KYI A;  5C6A A;  2SEB D;  5IY0 A;  2IHE A;  2X6L A;  1HR0 L;  3GTG B;  4B3S Q;  5FLX c;  4KI0 A;  2JXM B;  1N36 L;  4NPS A;  1SXT A;  4CHT B;  1X56 A;  3M4Y A;  5J1Z A;  1S5F D;  1TS2 A;  2NN6 I;  2PNH A;  1PH6 A;  3RZO B;  3I3C A;  1NMF A;  3HOW G;  1KD1 C;  4XYQ A;  2HCC A;  2KBN A;  1GUT A;  3CCS A;  4DNT B;  2ICI A;  4DV4 L;  1N33 Q;  4JI5 L;  3O13 A;  2EYP A;  3CME A;  2RDH A;  1FYC A;  2F1M A;  2K4K A;  5I6Y A;  1N32 L;  4K6D A;  1IBK L;  1SMY D;  3J7Y W;  3PIP A;  2UXD Q;  1HZA A;  3GTK B;  1SMX A;  3TBI B;  2N55 A;  4KHP L;  4CKE A;  3VR5 A;  1ML0 D;  1O7Z A;  1Y8O B;  1HPC A;  3HKS A;  1QG7 A;  4LF5 Q;  1I6H B;  3I72 A;  4C3J H;  3J80 E;  4HJ5 A;  1NUC A;  2PMZ E;  4HED A;  3FKI B;  3NE5 B;  2OQ0 A;  1O78 A;  1NY4 A;  3I8Z A;  3NTH A;  3CPF A;  3MXG A;  5J22 A;  2VUM H;  4POF A;  3EA6 A;  1HXY D;  3H0G G;  1QVG A;  2L12 A;  3S1N B;  3G71 A;  4GKK Q;  2XIW A;  2SOB A;  2UUB L;  2CW0 C;  4LUV A;  3OW2 A;  4GLX A;  1BCP D;  4LFC Q;  4N8F A;  1HNX L;  1AE3 A;  3LX0 A;  4A3M G;  1K83 H;  4A3B G;  2QF7 A;  3OTO L;  1JCK B;  1Y1V H;  1RIP A;  3CU7 A;  3I4L A;  2MJ8 A;  3BYY B;  1P8L A;  1TVX A;  4BY1 B;  1VQK A;  3RR5 A;  3SR1 A;  1BUV T;  2Y0S B;  4JV5 Q;  3P75 A;  1LT3 D;  1OXS C;  5A2Q E;  1KC8 C;  1TT2 A;  4BY7 G;  2XVS A;  1VQB A;  4CBV A;  3OPO A;  2K5D A;  1JQY D;  2FFK B;  2QA4 A;  1PTO F;  1R4Q B;  4UP7 A;  4TKO B;  2HQL A;  4HMI A;  1DD2 A;  3NWT A;  2R93 G;  4R4O A;  3K57 A;  4DUZ L;  1WD1 A;  3S14 B;  4O2D A;  1E3P A;  4LJZ C;  3M4O H;  4HJ9 A;  2QDL A;  1Z6H A;  5CV6 A;  4G57 A;  2FHT A;  5JJI A;  1GVP A;  1RTO A;  1PH8 A;  2A8V A;  1VQM A;  4G4K A;  4IPH A;  1WFQ A;  4EQ5 A;  4C2M H;  1LTB D;  5C4X B;  2CH4 A;  2ZTD A;  3RD4 A;  2F03 A;  4YWL A;  1STE A;  1FGU A;  1A62 A;  3HOW H;  3J81 E;  1GKH A;  1UEB A;  3TRZ A;  5IWA Q;  4HCS A;  1QZH A;  2AKW B;  4YY3 Q;  3SK6 A;  1YNJ C;  4KK7 A;  2EYJ A;  1Y14 B;  1CZW A;  1SNP A;  3NK9 A;  2B63 B;  1M4V A;  1VQI A;  1A3U A;  1I4Q A;  1X3F A;  1LT4 D;  4KKT A;  1II3 A;  1PYS B;  2XTI A;  3NPP A;  1Q86 C;  1YZ6 A;  2R7D A;  4DF7 A;  5ELE A;  2DY8 A;  4NXN Q;  2VQE Q;  3KF6 B;  4BBS B;  3EIV A;  3QJY A;  3URY A;  4A4I A;  3KF6 A;  1H9R A;  3KYH C;  3PMF A;  3AEV A;  2ZXP A;  4JBJ A;  3S17 B;  5M9O A;  2CWP A;  4CJ1 B;  1FNV A;  1U4L A;  1AEX A;  2B2T A;  5I2Y A;  4FVM A;  2X69 A;  4JVZ A;  2IY5 B;  1L1O B;  4G7O C;  1PTO H;  4RHS A;  3H0G H;  1C8C A;  1NSN S;  1HQR D;  2K01 A;  3TDQ A;  1Q82 C;  4HMJ A;  1L1O A;  1Q3L A;  4IUN A;  2H4O A;  1B8A A;  3KK7 A;  2C5C A;  1U5K A;  3QOL A;  4DGZ A;  1CT1 D;  1VDZ A;  4C3H B;  2A68 D;  4G7Z C;  3LWE A;  4KTA A;  4A3M H;  4A3B H;  2UXB L;  1H9S B;  4MZ9 A;  4YCW A;  1S4Z A;  3ERO A;  5CMD A;  1H9S A;  4K5X A;  3HOZ B;  4BA2 I;  2E8G A;  1X65 A;  3JC6 6;  3RUZ A;  1K0R A;  2PI2 E;  4CGY B;  1PLF A;  3A0J A;  4DR5 Q;  1RCV D;  1E2Z A;  1G6P A;  5G3L D;  3T1H L;  4DV5 L;  3CCR A;  4BY7 H;  4KKU A;  3CD6 A;  1A63 A;  3ONA B;  3G6E A;  2E2H B;  1X54 A;  1SR3 A;  3SGI A;  3D8G A;  1WTR A;  4JI4 L;  2PZT A;  4HN7 A;  4AYB B;  5COR A;  1D1I A;  3BS1 A;  2R93 H;  3RZD H;  2F3W A;  4JI6 Q;  2AQ1 B;  1K9M C;  2M9V A;  1RL2 A;  2R92 B;  3A55 A;  3W1B A;  1SNC A;  3N52 A;  1CA5 A;  2B8G A;  3B6Y A;  5C3X A;  3H15 A;  3W2D A;  4Y7N H;  5AJ3 Q;  1J9O A;  1LT6 D;  4R4Q A;  1YEZ A;  4GKJ Q;  4X65 L;  2NVT H;  4IPD A;  3NQT A;  4LFA L;  2UU9 L;  4S3S A;  2MHV A;  3VYR A;  1B53 A;  1TWF B;  1EIG A;  4EQO A;  3JAM c;  4P71 A;  2F4I A;  2AUK A;  3DWP A;  2RA4 A;  1QWY A;  4R4C A;  3TZD A;  1DOL A;  1ENC A;  1EY9 A;  3PO3 G;  4JI3 Q;  3I4M B;  1VQ6 A;  4K0K Q;  2MGS A;  1FVI A;  3I4N G;  4KHZ A;  2CKZ B;  2UUA L;  4DR7 L;  1SFO B;  3EQL C;  3A8J E;  4ZAI A;  1ONL A;  2Z8L A;  1A3V A;  5KEE A;  1KDB A;  1TXY A;  1MSG A;  1A0I A;  5C44 B;  1PTO D;  1JWU D;  5EKI A;  4GOP B;  1V1O A;  4R4I A;  4DR4 Q;  3AYH B;  1BQQ T;  4GOP A;  2B2T C;  4DNI A;  1JC7 A;  3Q0A A;  3BU2 A;  3PIP 3;  4ZCK A;  4AH6 A;  1L1O C;  4F87 A;  2I0Q A;  4WJ3 M;  3MVV A;  1M90 C;  2VXW A;  1GJX A;  2BA1 A;  1S5C D;  4O1N A;  2F4V L;  5CR3 A;  2WIN B;  1J6Q A;  4OHJ A;  2K7V A;  2IPK D;  5DM7 3;  3PO2 G;  3MFY A;  3CP0 A;  1PH5 A;  1PA6 A;  1WJJ A;  4IQZ A;  5JJL A;  2CQA A;  2R6G A;  3KJO A;  2Q2H A;  3HOX B;  3TP5 A;  1E1O A;  1GOZ A;  5COY A;  1CTM A;  1WTH A;  5HGQ A;  4HTH A;  2F0E A;  3TSS A;  3EVQ A;  2D0P A;  2MUY A;  4QCL A;  2CWA A;  3SDZ A;  2F52 A;  1STY A;  3GTM B;  1SDF A;  5IE8 A;  4DV1 L;  2CVR A;  4NB3 A;  2K52 A;  4PG3 A;  5IOC A;  1OXV A;  1IYV A;  2GVA A;  4V0B A;  2L55 A;  2OXP A;  4OO1 I;  1EFW A;  3NQI A;  3PUW A;  1CQF A;  3PUZ A;  3SK8 A;  3K0Y A;  5CV8 A;  4FF3 A;  3AMU A;  2B2W A;  4Q0F A;  2BOS A;  1SE3 A;  1O7L A;  1SNQ A;  1TII D;  1X3Q A;  4F8M A;  2PZU A;  4KV6 A;  3E3X A;  1PRT D;  4DUY L;  1XX8 A;  1PZI D;  1V43 A;  1C7Y A;  1EWI A;  2B8F A;  1AN8 A;  2OT2 A;  4J6H A;  3T13 A;  3EJI A;  3TME A;  3I4N H;  4DK0 A;  4DU9 A;  2I5M X;  4LF6 Q;  1SE4 A;  1EUJ A;  2A6H D;  1SSO A;  1XNR L;  3QIA A;  2A5H A;  4BY1 G;  1QOH A;  2HDL A;  3L2P A;  4JI8 Q;  3M3Y B;  3OIP A;  4KD4 A;  1N34 Q;  3TQY A;  4IUQ A;  1PFN A;  1TWG B;  5K36 G;  4A3F B;  3PUY A;  4I7Z C;  4K14 A;  4K6L A;  4B9W A;  2DJF C;  5ELD A;  3S1M B;  3RN2 A;  5LMU L;  5JAV A;  3KLR A;  2Z6K A;  3U58 A;  4XDX A;  4IFD I;  1S40 A;  4GN3 B;  5J3B A;  1A8V A;  3RLF A;  2FXQ A;  5D65 A;  5AFW A;  2ZJP A;  4LFB L;  3HFZ B;  3PUV A;  3HOY B;  2HDM A;  2VL6 A;  1S5D D;  1K73 C;  3Q23 A;  3GTQ B;  4CDC C;  1G2S A;  1SN8 A;  5EJW A;  1XMO Q;  2K5N A;  2G9H D;  4IJL A;  1EQT A;  3PO2 H;  1TWA H;  3TP6 A;  1S72 A;  1F2M A;  1HNW Q;  2JA6 B;  4FP5 D;  4DR2 L;  3M7N A;  1O7Y A;  2UXC L;  1I4H A;  5C3E B;  1TY0 A;  3TEH B;  4DXG A;  3A7A B;  4P74 A;  3IAY A;  4LF4 Q;  5HUR A;  2B63 G;  1JOO A;  4KKS A;  3GTK H;  4RCN A;  3OHX C;  3S1R B;  5IYB G;  1YNN D;  5BN4 A;  1HA5 A;  5KNC A;  1V8Q A;  4HSV A;  5FO8 B;  2XWB B;  1HJP A;  3CCE A;  5GAE C;  1CM9 A;  1PMR A;  1YHB A;  5M5Y B;  3LGJ A;  2IX0 A;  2O5I C;  3FDT A;  5IYC G;  2CW0 D;  2K33 A;  1GUN A;  1YJW A;  1XPO A;  2KCT A;  4U68 A;  4CJ2 C;  4XQQ A;  2WB1 B;  1NR2 A;  4YHH L;  4B3R L;  1H95 A;  3TP8 A;  2EZV A;  1JOR A;  2ZXO A;  1GUG A;  3A5Z B;  3T53 B;  3K80 C;  3C1F A;  1K8M A;  2OTJ A;  1LTI D;  1X9N A;  1YHA A;  1BF4 A;  2QEJ C;  1LTA D;  3A7L A;  2QKI C;  4LF8 L;  2K50 A;  2PQE A;  4WJ4 A;  1Q90 A;  5IGC A;  4XXE A;  2K5Q A;  4JI2 Q;  3U50 C;  3HKZ B;  1Y8P B;  3MHB A;  2E2J B;  1XPU A;  4A3D B;  1CSQ A;  2TSS A;  5T1I A;  1UE5 A;  1XMQ L;  1I3Q B;  1X32 A;  1GHJ A;  5LHY 1;  5M3M B;  4BY1 H;  1NE3 A;  1XNQ Q;  1JE5 A;  2F0H A;  3HOU B;  1Z7T A;  2WFW A;  1D6E C;  3KLS A;  4X62 L;  3H3V I;  5K36 H;  2JA5 B;  2IW3 A;  4UP8 A;  3KJP A;  5JVH 3;  2SNM A;  1A15 A;  4LF9 Q;  2A73 B;  1B1Z A;  2H5X A;  2NVY B;  3GV6 A;  2Z6K C;  1CKM A;  3G48 A;  1WTQ A;  4ZKC B;  2AWO A;  2A74 C;  4FDB A;  4P75 A;  4RG1 A;  1B4O A;  2Y0S E;  2HHH Q;  5FJ8 H;  1Q8I A;  1YNJ D;  3TS0 A;  2F0M A;  4A3L H;  4X66 Q;  3OMG A;  3T51 B;  2Z6B A;  1PFS A;  1VQN A;  1Q12 A;  2NYZ D;  1ZEQ X;  2I5H A;  3M4P A;  4IPG A;  4AQY Q;  2HT1 A;  5LMN Q;  1F9Q A;  5KYL A;  2DUD A;  1EU4 A;  2WP8 J;  3D4D A;  5K5P A;  5KNB A;  4B3S L;  3CAM A;  5LL6 X;  2CFM A;  2Z4I A;  2B63 H;  3UDG A;  3I4M G;  5JEA H;  2F0Q A;  1VS0 A;  5IGD A;  2F0U A;  2NBF A;  2RDF A;  3NEL A;  1H9J A;  2E2I B;  5IYB H;  1Q7Y C;  5I9O A;  3I73 A;  2LKV A;  1V1Q A;  2FMC A;  1STB A;  3KF8 A;  2YU9 B;  2NVQ B;  4A75 A;  1EL0 A;  1TU2 B;  4QF4 A;  5IYC H;  1OO9 B;  3DUZ A;  1I50 B;  2GN5 A;  2UXD L;  4GZY C;  4QL5 A;  4LUZ A;  3DLL A;  2LXJ A;  3AFP A;  1JE4 A;  3CCM A;  4XQJ A;  3S17 H;  2VY3 A;  4PMC A;  3BDO A;  5GAG C;  1YJN A;  3K7A H;  4LF5 L;  3NP8 A;  4JOI C;  2K14 A;  5BN3 A;  3D0F A;  1PDQ A;  2RBM A;  1ZKO A;  2GVB A;  3IFT A;  5IT9 L;  3BDC A;  1LO5 D;  1LTT D;  3HEJ A;  3NTI A;  3X3N A;  1ENF A;  4RAU C;  3GTL H;  4A3E B;  3FPP A;  4MIU A;  3I7F A;  1W6K A;  2L1B A;  1GO3 E;  2N78 A;  2HUG A;  5CV5 A;  1GHK A;  1TWH H;  3BG3 A;  5ELB A;  3GTJ B;  3I55 A;  2KEC A;  2RCF A;  3E0E A;  4DR6 Q;  3E9H A;  1QVC A;  3C46 A;  2JJQ A;  4L6T B;  1BXT A;  1SYG A;  3S24 A;  4ULL A;  4HSP A;  3F2D A;  2KHS A;  2ASB A;  5D3D A;  5DNF A;  1HR0 Q;  2G9D A;  4JI7 Q;  1EU3 A;  5C4J B;  4XT1 B;  4A3J B;  1Q1E A;  4LF7 Q;  2B39 A;  3UDF A;  1E0B A;  3HP3 A;  2VS1 A;  4DAM A;  1M1K C;  4IJH A;  4QQB X;  4HJ8 A;  4R4T A;  4L5S A;  4JV5 L;  3S2H B;  3PIO 3;  2H1E A;  4H02 A;  2WV6 D;  2Q2T A;  1A6X A;  4A3G B;  2R7Z B;  2R92 H;  4A3C G;  1RF2 D;  3H91 A;  4HIO A;  4MNO A;  4MTN A;  2MQH A;  1WTW A;  1QZG A;  1N32 Q;  4Z9C B;  1KXL A;  5C0X I;  1Y69 U;  3PF5 A;  1J8I A;  1MKH A;  1EOT A;  4IOA A;  1DOK A;  1BKB A;  1SRU A;  4OL7 A;  1T9H A;  1ASZ A;  3A74 A;  3UE1 A;  1EEF D;  1KQS A;  3K81 C;  1TWF H;  1PFB A;  4OEM B;  1FL0 A;  1WCM G;  1U4P A;  1WTO A;  1JB3 A;  1VQA A;  4DAV A;  1R4P B;  4X64 Q;  3I4M H;  2L4N A;  1BR9 A;  3ERQ A;  2AUJ D;  2ALY B;  1HZC A;  5M3F B;  2BE5 D;  4YY3 L;  3H6M A;  5GAH C;  1VQE A;  4X3S A;  4LUO A;  1B70 B;  5M5W B;  2Q2I A;  1VQO A;  4ALP A;  3CW2 C;  3NEN A;  5FK9 C;  4EGV A;  4A3F G;  1EY7 A;  5ELF A;  2KOL A;  2R61 A;  2CQO A;  4KY6 A;  4DA2 A;  1UEA B;  4YCV A;  1QCB D;  5JEA J;  3JAM i;  4K8I A;  5I9P A;  2PPB C;  4A93 B;  2WAQ B;  4MN3 A;  4PNY A;  4C3I B;  3BVG A;  4NXN L;  2A69 C;  1JJG A;  2LS0 1;  1VQG A;  3RNU A;  4XT3 B;  2LSS A;  2MPM A;  3K5M A;  3Q8D A;  1F9P A;  4R8I A;  2F0O A;  4JYA L;  1KL9 A;  3S16 B;  2F0S A;  2VNU D;  1LTG D;  3SEB A;  3D4R A;  3HOV B;  1HH2 P;  1BBU A;  5DM6 3;  3I90 A;  4BBR G;  2EJG C;  1SLJ A;  4C56 C;  1WI5 A;  1BCP B;  4JBW A;  3GTP H;  4GNX B;  2D0O A;  3QG1 A;  1I94 Q;  4Y52 H;  1JJC B;  4CDF C;  4ZK9 B;  4GNX A;  4APV A;  1JR0 D;  4QMG A;  5C3E G;  2NVX H;  4IN3 A;  4FO2 A;  4ODG A;  3R93 A;  1PH7 A;  2PO4 A;  4XTC S;  2RF4 A;  3V05 A;  1DZ1 A;  2F0F A;  1FR3 A;  1JOK A;  4DR5 L;  3HG9 A;  1CK1 A;  3UDI A;  1W3S A;  3F2U A;  1SND A;  4CKB A;  2F0P A;  4B3M Q;  4TQU S;  4A3C H;  3D6C A;  5DLQ E;  4HIK A;  3V2T A;  3NTK A;  3AFQ A;  1KLG D;  2IT1 A;  4HCE A;  3I70 A;  4MTK A;  3NXW A;  3STB C;  5ELN A;  4QJF A;  1R9T B;  2V4D A;  2WII B;  3FP9 A;  4JI6 L;  3GTO H;  2ES2 A;  1VQD A;  2PMZ B;  2I07 B;  1XTC D;  2K75 A;  2FIN B;  2EYL A;  5GQO A;  3G4S A;  4L8J A;  2PZW A;  2EJM A;  5AJ3 L;  1WCM H;  1PH1 A;  3C2P A;  1IW7 C;  1SYD A;  3HKZ G;  4GKJ L;  1QB5 D;  1HNZ Q;  3IKJ A;  1HHV A;  1YBY A;  3FRP B;  1XYI A;  2D62 A;  2EQS A;  3ERS X;  4DR1 Q;  1G2T A;  3P7J A;  1HCZ A;  5E7N A;  4A3K G;  4C3J B;  1CSP A;  1GXD C;  1VF5 C;  3DHQ A;  1MHW C;  2OF1 A;  3M3Y H;  1KAA A;  2KCN A;  1PHJ A;  3HOU G;  5EGT A;  4JI3 L;  1Y1W G;  4K0K L;  3PCO B;  4B3T Q;  1O7I A;  3WOE A;  4A3F H;  5I2X A; 
#chains in the Genus database with same CATH homology
 3PF4 A;  3I4N H;  3KLW A;  4BA1 I;  4XIG S;  2I5M X;  4DK6 C;  3CC4 A;  4LF6 Q;  1FJG Q;  1EUJ A;  3RN5 A;  1XNR L;  3ULL A;  3CCJ A;  1SFO H;  1WYD A;  5IWA L;  4EX5 A;  2ZM6 L;  2VUM G;  4IFD J;  4A93 H;  4A3I G;  4BY1 G;  4C3I H;  3BZK A;  1Z9F A;  3L2P A;  1G29 1;  4JI8 Q;  1TWC H;  4DR4 L;  1JT8 A;  4RMF A;  1N34 Q;  3TQY A;  1LTL A;  1MIU A;  5BR8 Q;  5C44 H;  5K36 G;  2PQA B;  3PUY A;  2UUB Q;  4X62 Q;  1PH9 A;  3S16 H;  3T1H Q;  2PQA A;  1KRS A;  4QY7 A;  4IOC A;  4DV5 Q;  4OON A;  1Y1V G;  3RN2 A;  1HNX Q;  1VQL A;  3GTQ H;  5LMU L;  3HOV H;  1OXT A;  3OTO Q;  2Z6K A;  1Q1B A;  3UE0 A;  4BBR H;  3U58 A;  1JJ2 A;  1EIF A;  1IL2 A;  1JMC A;  4IFD I;  1S40 A;  4NXM Q;  2VQE L;  4GN3 B;  5J3B A;  1A8V A;  2MO1 A;  4OWX B;  2FXQ A;  3RLF A;  1I94 L;  3F2B A;  1BVS A;  5HY6 A;  3EN2 A;  2JA6 H;  2ZJP A;  4HIM A;  4GNX C;  4LFB L;  3HFZ B;  3PUV A;  1IBL L;  2VL6 A;  3RLN A;  5C3E H;  1K73 C;  3HOY G;  4JG2 A;  1K8G A;  1SN8 A;  1UWV A;  3VDY A;  3M9B A;  1XMO Q;  2OQK A;  5H1S E;  1OXX K;  4A76 A;  2K5N A;  2BH8 A;  4JBK A;  5LMN W;  4IJL A;  4DR6 L;  3PO2 H;  1NJI C;  1TWA H;  4ME3 A;  4HJ7 A;  4YCU A;  1L0W A;  3KF8 B;  3STB D;  3CCQ A;  1S72 A;  1HNW Q;  1PH3 A;  1PV4 A;  1IZ6 A;  4UPA A;  4DR2 L;  4LFA Q;  1LM0 A;  5IY0 A;  4JI0 Q;  2JA6 G;  4B3M L;  3F2C A;  3M7N A;  2IHE A;  4DUZ Q;  2UXC L;  4DV2 Q;  1HR0 L;  1CUK A;  2RCN A;  3BJU A;  3TEH B;  4KI0 A;  5IP9 G;  5FLX c;  1N8R C;  1N36 L;  4B3S Q;  3GDE A;  4NPS A;  4P74 A;  3HOX H;  4LF4 Q;  1X56 A;  4GN4 B;  2B63 G;  2NN6 G;  2NN6 I;  2PNH A;  1VQH A;  1PH6 A;  5JJK A;  1YI2 A;  1VQ8 A;  1AE2 A;  2VZA A;  3GTK H;  2OCE A;  3KOJ A;  4DR7 Q;  1NMF A;  2JA9 A;  5IYB G;  2E5L Q;  1KD1 C;  3HOW G;  1IYJ B;  2KBN A;  2RHQ B;  3S15 H;  3CCS A;  1DGS A;  1YNX A;  1HJP A;  1X6O A;  3J80 i;  5GAE C;  3CCE A;  3GTM H;  3ER0 A;  4DV4 L;  1YHB A;  2QEX A;  1N33 Q;  4JI5 L;  3LGJ A;  2IX0 A;  1W2B A;  3CME A;  5IYC G;  4JYA Q;  2K4K A;  3I56 A;  1YJW A;  1HNZ L;  1N32 L;  1MJC A;  1XPO A;  2KCT A;  3W1G A;  4YHH L;  1IBK L;  4B3R L;  1H95 A;  2WB1 E;  3WWV A;  4TVA B;  3PIP A;  2UXD Q;  1HZA A;  2E2J H;  2NZH A;  2WB1 G;  1SMX A;  3A5Z B;  4DR1 L;  3TS2 A;  3K80 C;  4KHP L;  3CQZ H;  3CPW A;  4R1J A;  2NZO A;  4OXP A;  5M3M H;  1NMG A;  3HKS A;  1X9N A;  4LF5 Q;  1YHA A;  2OTJ A;  4A3K H;  3RLO A;  4LF8 L;  4B3T L;  2K50 A;  4C3J H;  4HJ5 A;  3H3V H;  2OWO A;  3HOU H;  4WJ4 A;  2PMZ E;  2KCM A;  2OQ0 A;  1Y1W H;  5IT9 c;  4JI2 Q;  3U50 C;  3HKZ E;  3FKI G;  4LF6 L;  1FJG L;  2JA5 H;  1NY4 A;  1ASY A;  4OWT B;  1XPU A;  2JEB I;  1CSQ A;  1JB7 A;  4HID A;  1UE5 A;  2MFI A;  3CPF A;  1XMQ L;  2NVY H;  4A3D G;  1YVC A;  2VUM H;  1NBW A;  4JI8 L;  4POF A;  4BY1 H;  3H0G G;  1QVG A;  1NE3 A;  3TRE A;  5M3M G;  1JE5 A;  4DV6 Q;  1N34 L;  1XNQ Q;  5BR8 L;  1VCI A;  3G71 A;  3CMA A;  4GKK Q;  2KHJ A;  2WFW A;  2UUB L;  4X62 L;  3H3V I;  1HR0 W;  4LUV A;  3OW2 A;  1N9W A;  4UP8 A;  1X3G A;  3KJP A;  4GLX A;  4LFC Q;  1TWG H;  1HNX L;  1AE3 A;  2R7Z G;  2JA5 G;  4A3M G;  1K83 H;  4A3B G;  3OTO L;  4LF9 Q;  1VQ9 A;  2H5X A;  3CC2 A;  1Y1V H;  2R7F A;  3CF5 A;  1RIP A;  5C0X G;  3S1M H;  2Z6K C;  4NXM L;  1P8L A;  2UXB Q;  3UDX A;  1CKM A;  3PIO A;  1VQK A;  3RR5 A;  4IO9 A;  2IX1 A;  3G48 A;  4YWM A;  4QIW E;  2AWO A;  4P75 A;  4FDB A;  4RG1 A;  1Z47 A;  5FLM G;  1YIT A;  2Y0S E;  4DV1 Q;  4JV5 Q;  2HHH Q;  1VQF A;  2QGQ A;  1K3R A;  5FJ8 H;  2Y0S G;  4GN5 A;  2UXB L;  1OXS C;  1KC8 C;  3TS0 A;  3HOY H;  4BY7 G;  4DV3 L;  4GOP C;  4A3L H;  1VQB A;  4L5R C;  4X66 Q;  3CCL A;  3CXC A;  1LUZ A;  2JA8 G;  1U0L A;  2QA4 A;  1IXR A;  1D8L A;  4GLA C;  4UP7 A;  1PFS A;  1VQN A;  1Q12 A;  2HQL A;  3M4P A;  2I5H A;  4IPG A;  3J81 i;  4AQY Q;  3F1Z A;  3BZC A;  1YJ9 A;  2HT1 A;  1E1T A;  5LMN Q;  4JI4 Q;  4JI0 L;  2R93 G;  4R4O A;  4DUZ L;  2DUD A;  4O2D A;  1E3P A;  4DV2 L;  3M4O H;  1VQC A;  4HJ9 A;  2JE6 I;  2WP8 J;  4B3S L;  1MJE A;  3CAM A;  5JJI A;  5FJ8 G;  5EAY A;  4LF4 L;  2N3S A;  1GVP A;  4DKA C;  5IP9 H;  1PH8 A;  1BBW A;  2A8V A;  2CFM A;  1VQM A;  4P72 A;  3GTG H;  4A3L G;  3AQQ A;  2B63 H;  4IPH A;  1WFQ A;  2YV5 A;  4EQ5 A;  4C2M H;  3UDG A;  1VQ5 A;  3I4M G;  3FHW A;  1VS0 A;  2E5L L;  3T1Y L;  2ZTD A;  3I2Z A;  4YWL A;  4LNQ A;  3NEL A;  3RZO H;  2OTL A;  5C4X G;  4O0A A;  3HOW H;  1FGU A;  1A62 A;  5IYB H;  5IYD G;  1Q7Y C;  4POG A;  2L15 A;  1GKH A;  1UEB A;  4X65 Q;  2VQF Q;  5IWA Q;  2N49 A;  3S1R H;  3TRZ A;  1QZH A;  2AKW B;  4YY3 Q;  1V1Q A;  2UU9 Q;  1UE1 A;  1Y14 B;  4A75 A;  4DR3 Q;  5M5Y H;  5IYC H;  2N8N A;  2GN5 A;  2UXD L;  2JQO A;  1K8A C;  4QL5 A;  1YHQ A;  4LUZ A;  3DLL A;  3K8A A;  1QUQ B;  2LXJ A;  1VQI A;  3AFP A;  4J15 A;  3J80 c;  3CCM A;  4UP9 A;  2JA7 G;  2VY3 A;  5JEA G;  1B7Y B;  3S17 H;  1X3F A;  4PZ7 A;  3K7U C;  3GD7 A;  5GAG C;  1YJN A;  3K7A H;  1XPR A;  2UUA Q;  4LF5 L;  1PYS B;  2XTI A;  4BXX G;  4JOI C;  2K14 A;  4JI1 L;  1Q86 C;  2UUC Q;  2ZJQ A;  1HZB A;  3D0F A;  2R7D A;  1YZ6 A;  3PGZ A;  2GVB A;  4NXN Q;  2VQE Q;  3KF6 B;  2IHF A;  1I6H H;  1KIX A;  1LYL A;  5IP7 H;  4BBS G;  3EIV A;  2KEN A;  4A4I A;  3OYY A;  1UE6 A;  1X3E A;  3KF6 A;  5M5X H;  3KYH C;  3AEV A;  1SRO A;  4JBJ A;  3FKI H;  3GTL H;  2CWP A;  1PVO A;  2MNA A;  3I7F A;  4A3E G;  2XGT A;  1GO3 E;  4A3D H;  2IY5 B;  2N78 A;  1J5E L;  1HNW L;  1XNQ L;  4DV6 L;  4X6A H;  1TWH H;  1L1O B;  1I3Q H;  2F3I A;  3I55 A;  1C0A A;  3E0E A;  4DR6 Q;  3H0G H;  1EQR A;  3E9H A;  1QVC A;  1Q82 C;  1L1O A;  2JJQ A;  4L5Q A;  3S1N H;  3S2H H;  3S1Q H;  1B8A A;  5IP7 G;  3S24 A;  1U5K A;  2I5L X;  2V1C C;  2A19 A;  3F2D A;  4LF9 L;  2ASB A;  1HR0 Q;  2R7Z H;  1GD7 A;  4QGU A;  4A3M H;  4DK3 C;  4JI7 Q;  2VW9 A;  4A3B H;  3MXN B;  1Q1E A;  3U4Z A;  4AIM A;  4LF7 Q;  4MZ9 A;  3UDF A;  4JCV E;  2EIF A;  1EOV A;  4YCW A;  2F4V Q;  4A3J G;  2YYZ A;  2VS1 A;  4PMW A;  4DAM A;  5C0X J;  1E24 A;  3F8T A;  1M1K C;  4IJH A;  4BA2 I;  1HZ9 A;  1S3O A;  4QQB X;  2E8G A;  4HJ8 A;  4R4T A;  3HOZ G;  2ZJR A;  1X65 A;  4L5S A;  3JC6 6;  4OX9 Q;  4JV5 L;  1XJV A;  1IBM Q;  2BA0 A;  4H02 A;  1K0R A;  2PI2 E;  5FLM H;  2Q2T A;  3A0J A;  1C9O A;  4IPC A;  4DR5 Q;  4OO1 G;  1KHI A;  3M4Q A;  1G6P A;  2CCZ A;  1SE8 A;  2PI2 A;  4X66 L;  3T1H L;  2R92 H;  3KFU A;  4A3G G;  4A3C G;  4DV5 L;  3CCR A;  4BY7 H;  4HIO A;  4MNO A;  5ELO A;  3CD6 A;  4MTN A;  1A63 A;  2MQH A;  3G6E A;  4AQY L;  2ATW A;  1X54 A;  2JA8 H;  1QZG A;  2LXK A;  1N32 Q;  5LMN L;  1SR3 A;  3SGI A;  5C0X I;  3J7Z C;  4JI4 L;  4B3R Q;  1P16 A;  3PF5 A;  1MKH A;  1VQJ A;  4IOA A;  1EQQ A;  1BKB A;  1SRU A;  3M85 A;  2R93 H;  4AYB G;  3RZD H;  1T9H A;  1ASZ A;  4KLK A;  3S2D H;  3PSI A;  4JI6 Q;  3A74 A;  3UE1 A;  1KQS A;  3S14 H;  3K81 C;  1K9M C;  1RL2 A;  1TWF H;  2YTX A;  3W1B A;  3J81 c;  5M5W H;  1FL0 A;  2R92 G;  1WCM G;  3B6Y A;  1XMO L;  1CKN B;  3H15 A;  3PO3 H;  1VQA A;  2B29 A;  4Y7N H;  5AJ3 Q;  3ICE A;  4X64 Q;  2HIV A;  3CCU A;  3I4M H;  1CKN A;  1AH9 A;  4DV0 Q;  4R4Q A;  2ALY B;  1I5F A;  1YEZ A;  2ZTE A;  3PUX A;  4X65 L;  2VQF L;  1HZC A;  4GKJ Q;  5C4X H;  3CC7 A;  3MEF A;  1XMQ Q;  2NVT H;  4IPD A;  4YY3 L;  5IYD H;  5M3F G;  4LFA L;  2UU9 L;  5GAH C;  2HIX A;  1VQE A;  2E2I H;  3E9I A;  4DR3 L;  3K0X A;  2B3G A;  4LUO A;  1VQP A;  4DUY Q;  3JAM c;  1B70 B;  2Q2I A;  4P71 A;  1VQO A;  2YTY A;  4ALP A;  4YWK A;  2YU9 H;  3CW2 C;  4R4C A;  2NVQ H;  3NEN A;  2EXD A;  4A3F G;  2CQO A;  4JI3 Q;  3PO3 G;  1VQ6 A;  1I50 H;  4K0K Q;  4YCV A;  1FVI A;  3ULP A;  2JA7 H;  4KHZ A;  4L5T A;  3I4N G;  2CKZ B;  5JEA J;  4DV7 Q;  1KRT A;  3JAM i;  2UUA L;  1UE7 A;  3J81 j;  4DR7 L;  2UUC L;  2WAQ E;  2MO0 A;  4IFD G;  4A93 G;  1NTG A;  1L2F A;  2WAQ G;  5GRO A;  4NXN L;  4BXX H;  1VQ7 A;  1VQG A;  1XNR Q;  1JJG A;  1N33 L;  2ZM6 Q;  3RNU A;  1TXY A;  1A0I A;  2LSS A;  4PZ6 A;  3Q8D A;  4UY8 C;  1KL9 A;  4JYA L;  4BBS H;  5C44 G;  4GOP B;  2C35 B;  4R4I A;  3ULJ A;  3GO5 A;  4DR4 Q;  2VNU D;  3AYH B;  3W5O A;  1EIY B;  3NEM A;  4GOP A;  3CCV A;  1YIJ A;  2A1A A;  1HH2 P;  2Z0S A;  1BBU A;  4DNI A;  4DV3 Q;  4A3E H;  3HOV G;  3L0O A;  1VQ4 A;  1CKO A;  1QUQ A;  4BBR G;  1SLJ A;  3IRB A;  1KXL A;  5LMU Q;  3BU2 A;  2KHI A;  1WI5 A;  4JBW A;  3GTP H;  4GNX B;  4AH6 A;  3GTJ H;  2AHO B;  1L1O C;  2D0O A;  4WJ3 M;  2I0Q A;  2AMC B;  1X55 A;  1I94 Q;  3D31 A;  1JJC B;  4JI2 L;  2JEA I;  4Y52 H;  4GNX A;  4PZ8 A;  1M90 C;  4APV A;  4JI7 L;  5C3E G;  2BA1 A;  2NVX H;  4LF7 L;  4LFB Q;  1IBL Q;  2F4V L;  3DM3 A;  4C3H H;  5GAD C;  3A5U A;  1J6Q A;  1PH7 A;  5C4J H;  4XTC S;  4A3J H;  2JK8 A;  2RF4 A;  2YTV A;  1PH4 A;  3PO2 G;  4OX9 L;  3T1Y Q;  1IBM L;  4GKK L;  3HOZ H;  1R9T H;  3CP0 A;  3PV0 A;  4DR5 L;  3UDI A;  1PA6 A;  1PH5 A;  1W3S A;  1WJJ A;  1G51 A;  5JJL A;  1OTC A;  1Q8K A;  4LFC L;  2R6G A;  1Q81 C;  2K5V A;  3KJO A;  2Q2H A;  4DR2 Q;  4B3M Q;  1KAW A;  4TQU S;  1E1O A;  4A3C H;  4LW1 A;  3HOX G;  4A3G H;  5DLQ E;  2UXC Q;  4HIK A;  1WOC A;  3U4V A;  4DAY B;  3KDF B;  5HGQ A;  3AFQ A;  1E7Z A;  1XTD A;  2DGY A;  4LWC A;  1N36 Q;  2IT1 A;  4JBM A;  2BH2 A;  3STB C;  3KDF A;  2E2H H;  2D0P A;  5ELN A;  4QJF A;  4DPG A;  2CWA A;  3FP9 A;  1PH2 A;  1EYG A;  2F52 A;  4JI6 L;  2K5H A;  4JOI A;  5IE8 A;  3NBH B;  4DV1 L;  4OWW B;  3GTO H;  4NB3 A;  2HHH L;  2K52 A;  4PG3 A;  4HJA A;  1OXV A;  2GVA A;  4JI1 Q;  2RHS B;  1V9P A;  4JC0 A;  2AWN A;  2ES2 A;  1D7Q A;  3EBE A;  1VQD A;  4OO1 I;  1EFW A;  2K75 A;  4DV4 Q;  5GQO A;  3G4S A;  4GS3 A;  3PUW A;  5AJ3 L;  1WCM H;  3PUZ A;  4P73 A;  4X64 L;  1PH1 A;  4JI5 Q;  2ID0 A;  3HKZ G;  4DV0 L;  4GKJ L;  1GM5 A;  1HNZ Q;  4YHH Q;  1IBK Q;  1YBY A;  3I4O A;  4AYB E;  4A3I H;  5M3F H;  2D62 A;  1OXU A;  2EQS A;  3ERS X;  4DUY L;  1Q46 A;  4DR1 Q;  1J5E Q;  5E7N A;  4A3K G;  1E22 A;  1V43 A;  3L7Z C;  1CSP A;  3ZJY C;  2Q2U A;  4KHP Q;  2ZTC A;  1C7Y A;  1EWI A;  3M3Y H;  1PYB A;  3HOU G;  1PHJ A;  4JI3 L;  1Y1W G;  1QVF A;  3PCO B;  4GLV B;  4B3T Q;  4LF8 Q;  3J7A 5;  4K0K L;  1O7I A;  4A3F H;  4DV7 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...