4LWCA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lwcA00
1LM0A 4JI4L 1JJCB 1HNZQ 1G291 3WWVA 1NMGA 3AYHB 3FHWA 1QZHA 1YNXA 1C9OA 2BH8A 4P75A 4YWMA 1KIXA 5K36G 4R4IA 1HZ9A 4GOPC 1JMCA 2I5HA 3F8TA 4JI8Q 3S2DH 4JOIA 3FKIG 5IP7G 1VQLA 4DR1L 3HKZE 4NXNL 3M4QA 4A3BH 4R4QA 3J80i 2VZAA 2LXJA 4A3KH 4GLVB 1HR0L 3GTPH 4DR2Q 2ZM6L 1Y14B 2Z0SA 1YJWA 1N34L 4OO1G 1CKMA 2R6GA 2F3IA 2F4VQ 2KENA 3GTOH 4OX9Q 4JC0A 2JA9A 4DR3Q 1VQ8A 1A63A 1UE6A 5GAEC 1YVCA 1Q81C 4BBRH 3CCRA 1HZAA 2JA8G 1KAWA 3EBEA 2IT1A 3D0FA 2PMZE 1OTCA 3TS2A 3E9HA 1FJGQ 2R93H 1KQSA 4PZ7A 4KLKA 2MO1A 1N36Q 3GTGH 5FLXc 2AKWB 4JI1L 1NMFA 1E3PA 1PYSB 4DV2Q 5BR8Q 1W2BA 4GN5A 1PH4A 2ZJRA 4DR6Q 2E5LQ 2UUAL 1YI2A 1H95A 3GTJH 4IPGA 1TWHH 3U4ZA 2VQEL 1EQRA 4DNIA 1XNQQ 4X62L 2ZTCA 3F2DA 1VS0A 1HJPA 2IHEA 1PV4A 2HHHL 2I5LX 1YJNA 4LFBQ 4A3JG 1OXUA 2JK8A 3KF6A 4RG1A 3BU2A 4BA1I 4HIDA 1VQ9A 1XJVA 5JEAG 4JI0Q 4GOPB 4LFCQ 1BBWA 5C0XI 1G6PA 4LUOA 2YTVA 3I4NG 4OWXB 1YZ6A 3S2HH 2EXDA 2MO0A 4LF9Q 1OXVA 1CKNB 2K50A 4JI5L 5GAGC 4R4OA 2NZHA 1HNXQ 3CAMA 4A3GH 1VQ5A 3PO2H 1YITA 3ERSX 5HY6A 3A5UA 2DUDA 2PNHA 2YV5A 4BY1H 4B3TQ 3CMEA 3TQYA 1NE3A 5C3EH 2VW9A 1UE7A 3I2ZA 4DV4L 2UUBL 5IYBG 1E24A 1SROA 3I4MG 1PA6A 5DLQE 3TEHB 4ME3A 3HOVH 5GAHC 4JOIC 2FXQA 2K4KA 1FGUA 2IHFA 1QVFA 3OYYA 1TWCH 5IE8A 4L5SA 1B8AA 4QGUA 4DR7Q 2AMCB 2A8VA 3K0XA 2R7ZG 3HOWG 1U0LA 1V9PA 4H02A 1QUQB 4RMFA 1I3QH 1L0WA 4C2MH 3CC7A 3CCSA 3J81j 1PHJA 2WP8J 2MQHA 3LGJA 4JI4Q 4BXXH 1PYBA 2D0OA 5JEAJ 2EQSA 4DAMA 2JA7H 3GTQH 2PQAB 2KCMA 1GVPA 1PFSA 3CCQA 3PO3H 5FJ8G 4DV0L 1IBKL 4YY3Q 1D8LA 3A5ZB 3T1YL 1KD1C 2PI2E 4LF6L 2PI2A 4DR1Q 4UPAA 3ULJA 3MXNB 4PG3A 4LNQA 2WAQE 1IBMQ 1HR0Q 4KI0A 2ZM6Q 3I4OA 4NB3A 3BJUA 1N34Q 4YCWA 3KLWA 2N78A 4B3MQ 1E1OA 1XMOL 1QUQA 2ID0A 1WOCA 4MNOA 1BKBA 2ZTDA 3CW2C 3M9BA 1W3SA 4P72A 2CCZA 1O7IA 4DUYL 1V1QA 2N49A 1Y1WH 4JI3L 4BY7H 2MFIA 4BA2I 1T9HA 1C0AA 1K9MC 4DV1L 4JI1Q 2B3GA 1YJ9A 1LYLA 3S16H 4JV5Q 1IZ6A 3CF5A 3G48A 3J80c 1Z47A 1YHBA 2ZJQA 5C44G 2BA1A 4JYAL 4BBRG 4UY8C 3T1HL 1PH3A 5M3FH 2XGTA 1BVSA 1TXYA 5LMNL 2VQEQ 4X66L 3RLFA 3SGIA 4KHPL 3G6EA 1X3EA 2JEBI 1VQEA 2ES2A 4NPSA 4A3EH 1B7YB 3BZCA 4YCUA 2OQ0A 4YHHL 1N33Q 1VQCA 1IYJB 4GKJL 2YTXA 2RHSB 2D62A 5E7NA 2VUMH 1AE2A 4HJAA 1P8LA 3CCJA 1XPRA 1XPUA 2JJQA 3CC2A 3PUYA 3B6YA 5C0XG 1LUZA 3NEMA 2I0QA 4JI2L 4L5RC 3KJPA 1NJIC 3CC4A 2OQKA 1WYDA 4K0KL 5LMNW 5IP9H 1D7QA 4LWCA 4DV7Q 3HKZG 4YWKA 4IPCA 1SN8A 3JC66 1WCMH 3J81i 3NENA 4DV4Q 2UUBQ 1PH1A 4P73A 3M85A 3UE1A 2Z6KA 4WJ3M 5AJ3L 3KF6B 3U4VA 4DV5Q 4A3GG 4A93G 2VQFQ 1CSPA 1A62A 4HIOA 1VQPA 2WFWA 4BY1G 1Q7YC 4P74A 4DUZL 2C35B 5JJKA 3L7ZC 1JE5A 4A3CH 3H3VH 4HJ8A 4APVA 4DK3C 2UXCQ 4JBKA 4ALPA 2F52A 4DV6Q 5IYCH 3PUZA 2YU9H 4B3RL 4C3JH 5FLMG 2Q2TA 4A75A 3H3VI 1K3RA 1N9WA 2NVQH 1VQJA 5C0XJ 3F2CA 4DV0Q 1IBKQ 2AWOA 3CCEA 3PCOB 1Z9FA 3T1YQ 3ULPA 2JA5G 1TWFH 1YIJA 4LF6Q 1WJJA 1VQGA 4BXXG 4DR4L 4YWLA 2JA7G 1X6OA 3K7AH 5M3MH 4JI7L 2R7FA 2JA6G 1YHQA 3NBHB 3HOYH 3PO3G 3S15H 3S1NH 1Y1VG 5GROA 3E0EA 1I50H 3KYHC 2NN6I 3W1BA 3PIPA 2BA0A 1EYGA 4TVAB 2OWOA 1XMOQ 2IX0A 4LF8Q 2R92H 2GN5A 3NELA 2E2IH 3CP0A 4EX5A 1C7YA 1I5FA 4GNXA 3GTMH 3ULLA 3DLLA 4DUYQ 4IFDI 2K52A 1X3FA 4XTCS 4JI3Q 2CKZB 5M5YH 1P16A 1IL2A 4JBJA 4NXML 4LW1A 3PIOA 1JB7A 3VDYA 4IPHA 3S24A 3CCUA 1VQ6A 2K14A 2QEXA 4GLAC 1DGSA 4LF7L 5C4JH 1GM5A 1GKHA 4JYAQ 4LF4L 1HNWL 4A3LH 1NTGA 1M1KC 1Y1WG 4O0AA 3TRZA 3K81C 4IJHA 4X66Q 1VQBA 5LMUL 4MTNA 4BBSH 4BY7G 1Q12A 3HOXH 4KHPQ 3CCVA 1VQOA 3STBC 2UUCQ 1V43A 1GO3E 2OCEA 2L15A 3JAMc 4YHHQ 3ICEA 4B3SL 1L2FA 2Z6KC 2Q2IA 1KXLA 5M3FG 2K5NA 4GKJQ 2Y0SG 4IOCA 2K75A 3PUWA 1EWIA 4A3DH 1UE1A 1OXXK 3L0OA 1ASYA 1EIYB 2UU9L 2F4VL 1EIFA 4JI2Q 4AIMA 3KJOA 3F2BA 5IYDH 4A3EG 3DM3A 2JQOA 4NXNQ 2B63H 1VQIA 4K0KQ 3S1QH 1KC8C 1BBUA 3W5OA 2VUMG 1PH5A 5IWAL 3K80C 1AE3A 2KBNA 1UE5A 4P71A 1N36L 1Q86C 5AJ3Q 2UXDL 4LF5L 3EN2A 1QZGA 3J7A5 1KHIA 4A3BG 4UP9A 2K5VA 3RR5A 5IP9G 4A3KG 3UE0A 5HGQA 2HIVA 1XMQL 1MIUA 5J3BA 4DAYB 4A3FH 1WCMG 4MZ9A 3KF8B 4HIKA 3M4PA 1AH9A 2RF4A 2YYZA 1X9NA 4B3RQ 1VQMA 4AYBG 1SFOH 1S40A 4QY7A 2UUAQ 1SLJA 1A8VA 4YCVA 4QJFA 3J81c 4GNXC 1PH2A 3RN2A 4JI0L 3S17H 2WB1G 1XPOA 1ASZA 1MKHA 2R93G 4A3CG 4EQ5A 4X62Q 4QQBX 4J15A 4LF9L 1L1OB 1G51A 2K5HA 2KHJA 2I5MX 2MNAA 4HIMA 1EQQA 4JBWA 2HHHQ 2NVTH 4DR4Q 1HNXL 2XTIA 3TREA 4GKKL 1X54A 1KRTA 3L2PA 3CCLA 1S72A 4GN3B 3CD6A 1PH7A 4OWWB 3PV0A 1EOVA 4JI5Q 1S3OA 1K8GA 4XIGS 2NN6G 3A74A 4PMWA 3I7FA 3MEFA 5M3MG 2Q2HA 4IPDA 4GN4B 4POGA 1I94L 3S1RH 1VQFA 4UP7A 4Y7NH 3HOYG 2RHQB 5H1SE 2JEAI 3HOZH 1HZCA 5C4XH 4NXMQ 1VQKA 1WI5A 4IFDG 3AFQA 3KDFA 3UDXA 3H15A 1KL9A 2R7DA 4AQYL 2R92G 3GDEA 3M4OH 4IOAA 2CFMA 2HIXA 4LF7Q 1GD7A 4LF8L 1PH6A 4DV3L 1B70B 1L1OA 4JCVE 5IT9c 4KHZA 3OTOL 3CPFA 1TWGH 1X55A 4LF4Q 3PO2G 1I6HH 1SRUA 2E8GA 5LMUQ 3RLOA 3RZOH 2OTJA 2AWNA 3KOJA 4A3MH 3M7NA 4YY3L 2EIFA 3HOUH 1N32L 4JG2A 5C3EG 1J5EL 1XNRL 4DR5L 2VL6A 4GNXB 4B3SQ 3HOVG 3S1MH 4X65L 2N8NA 4A3LG 5M5WH 1PH9A 1IBLL 1IBML 4WJ4A 1Q1EA 4A4IA 1K83H 2UXBL 1X3GA 4OONA 4A3IH 4BBSG 2A1AA 3HOXG 3PSIA 4O2DA 3CXCA 4LFAL 3CPWA 2HT1A 2JE6I 1RIPA 1Q82C 4FDBA 2UU9Q 4X6AH 2UUCL 4LUVA 3RLNA 3PF5A 1R9TH 4B3ML 2BH2A 4A76A 4AH6A 3UDGA 3U50C 5C44H 1FVIA 4R1JA 2KHIA 3W1GA 2B29A 1YBYA 4IFDJ 3K8AA 4X64L 5IWAQ 4IJLA 4A3DG 1OXSC 2A19A 3H0GH 3GO5A 3K7UC 1QVGA 4JV5L 2UXDQ 4Y52H 2CWAA 5IYDG 4OXPA 4LF5Q 2IX1A 5JJLA 2B63G 3UDIA 1LTLA 2D0PA 1HR0W 1HZBA 3CCMA 1OXTA 1XMQQ 1SR3A 4JI6L 1VQHA 4L5QA 2NZOA 5EAYA 4DV1Q 1NY4A 3UDFA 4R4TA 1UWVA 2ZJPA 3ER0A 3IRBA 3FKIH 5IP7H 2VS1A 1K8AC 1HNZL 4PZ6A 1MJCA 3T1HQ 4JBMA 1TWAH 5M5XH 5LMNQ 2VNUD 2GVAA 1SE8A 3F1ZA 4A3FG 1Q8KA 1U5KA 4DKAC 2V1CC 3D31A 4QL5A 4L5TA 2ALYB 2CQOA 4HJ7A 4JI8L 2IY5B 3PUXA 4HJ5A 4A93H 3E9IA 4GKKQ 4OO1I 1L1OC 4DV7L 2JA8H 2LXKA 3A0JA 4DR2L 1XTDA 1X65A 3ZJYC 2H5XA 3I56A 3U58A 1K0RA 4OX9L 3BZKA 1QVCA 4DV5L 1HH2P 1PH8A 4DR3L 4GS3A 5FLMH 1I94Q 2VQFL 1N33L 1E22A 1SMXA 1VQDA 1EFWA 4GOPA 2VY3A 2WAQG 1FL0A 1X56A 1VQNA 2JA5H 1FJGL 3EIVA 2DGYA 4AQYQ 5ELOA 2NVXH 2ASBA 2UXCL 2Y0SE 1YHAA 3PGZA 4DV2L 1VQ7A 2Q2UA 4DV6L 1CUKA 5BR8L 1CKNA 1E1TA 3OTOQ 1VQAA 2HQLA 4DV3Q 3TS0A 4DR6L 2E5LL 4A3JH 2JA6H 3HOZG 1CKOA 5C4XG 3GTKH 1Y1VH 2AHOB 4DUZQ 1N32Q 1VCIA 3CMAA 4QIWE 1J5EQ 1XNQL 3I4NH 4TQUS 3G4SA 1XNRQ 3S14H 4DR5Q 3AFPA 1MJEA 4X65Q 3RZDH 4LFBL 1IBLQ 3Q8DA 3I55A 3HFZB 1K73C 2UXBQ 1JJGA 2YTYA 1NBWA 4LFCL 4GLXA 1IXRA 3CQZH 4LFAQ 4C3IH 3HKSA 4PZ8A 3KDFB 3OW2A 1J6QA 1UEBA 4A3MG 3HOUG 2RCNA 5ELNA 5JJIA 3I4MH 1PVOA 1CSQA 4DPGA 3PF4A 3STBD 1KRSA 5IYBH 2OTLA 2NVYH 4HJ9A 1Q1BA 1M90C 5IYCG 2ZTEA 5IY0A 1HNWQ 4C3HH 1RL2A 3JAMi 3AQQA 3AEVA 5GADC 4JI7Q 1YEZA 2N3SA 5GQOA 4X64Q 4A3IG 2GVBA 2PQAA 4UP8A 1WFQA 4OWTB 2R7ZH 4DK6C 3G71A 4B3TL 3HOWH 4AYBE 1EUJA 1JT8A 1Q46A 1N8RC 3GD7A 3PUVA 4POFA 4LUZA 3M3YH 2E2JH 2WB1E 4IO9A 2E2HH 3KFUA 3FP9A 1JJ2A 4JI6Q 2QGQA 2ATWA 3J7ZC 2QA4A 3H0GG 4DR7L 5FJ8H 3RNUA 2LSSA 3GTLH 2KCTA 1A0IA 2CWPA 1VQ4A 3RN5A 4R4CA 1E7ZA
chains in the Genus database with same CATH superfamily
1F77A 1KAAA 1TQOA 1EY7A 4F7XA 4K5XA 1YNXA 1KIXA 1EZ6A 1SYFA 2J0TD 3F8TA 4JI8Q 2F0EA 5JAVA 5IP7G 1ZEQX 1DZ1A 4DR1L 4NXNL 3M4QA 2QILA 1JCKB 3RMHA 5IGEA 4XT3B 1K3BC 4GLVB 1C8CA 3GTPH 1K0SA 2ZM6L 4OO1G 1YJWA 3GTQB 5ELEA 4JC0A 1VDZA 1LTTD 3GTKB 4C1NI 5IIFA 1BNZA 5BN4A 5GAEC 5K5PA 3D0FA 3TS2A 2PMZE 3E9HA 4K8JA 3RZDB 4PZ7A 1KQSA 2MO1A 3GTGH 1SMYC 1BOSA 1EWHA 2O2LD 1V1PA 1G8ZD 4RGOS 5L37A 1H95A 4IPGA 2PO4A 2A73B 2XSCA 4RG1A 2JK8A 2A74C 4A3JG 3BU2A 4BA1I 4HIDA 1N33L 5IT9L 1BF4A 1GJXA 2MPMA 2YTVA 1DD2A 2PPBC 4OWXB 2MO0A 1G2TA 1OXVA 1YNNC 3EFXD 4A3GH 1VQ5A 3GTLB 3PO2H 1YITA 1HXYD 3ERSX 3A5UA 4C3IG 2PNHA 4A3EB 4BY1H 4B3TQ 1EY6A 2VW9A 3I4MG 1B3AA 5IYBG 1SROA 1STBA 2Z4HA 5DLQE 1PA6A 5JPNC 5D14A 2AQ2B 1G6ZA 1QVFA 1TWCH 1R4PB 2A8VA 2R7ZG 3HOWG 1U0LA 1V9PA 1GUOA 1QUQB 2FJ2A 3J81j 3LGJA 2JSOA 4BXXH 2D0OA 2EQSA 4DAMA 2JA7H 4MHEA 1GVPA 5EPKA 4GZYC 4DV0L 2KEEA 4YY3Q 3T1YL 1H9KA 1KD1C 3NTKA 2PI2A 1B9MA 4JVZA 1T5XD 4LNQA 1A3VA 1IBMQ 5DM63 2WACA 3I4OA 4NB3A 3BJUA 4YCWA 1KLUD 1XYIA 1XMOL 1QUQA 2NYZD 1EEID 2DNCA 2M2LA 1STEA 1KABA 1HTPA 4JI3L 4BY7H 1C0AA 5M3MB 5G3LF 2B3GA 1YJ9A 1RTOA 1IZ6A 2F0QA 4JW0A 4XQJA 1PFNA 2AQ1B 2ZJQA 2BA1A 4JYAL 4BBRG 2LMCB 1BVSA 1TXYA 1JOKA 2RDFA 4X66L 1CM9A 1EY9A 2RVLA 4H7BA 3SGIA 3GTMB 4A3GB 4KHPL 2A6ED 3PO2B 5BN5A 1B7YB 3BZCA 4YHHL 3SE0A 3K58A 1O78A 1UEAB 1IYJB 1PMRA 2YTXA 1VF5C 3T53B 5E7NA 1TT2A 2PMZB 1AE2A 2WKDA 1CZGA 1FNUA 3GV6A 4KKUA 3QOLA 3CC2A 3PUYA 5C0XG 3KF8A 3NEMA 4L5RC 1MGSA 2RBMA 5E4WC 4KMUC 3CC4A 4ZLTF 1WYDA 2DJGC 4EVOA 3OOCA 2KUMA 1Y69U 2SEBD 1XTCD 5TSSA 2JA7B 4KY6A 4DV4Q 2EYLA 4P73A 3M85A 1PH1A 4WJ3M 1RTNA 3IAYA 4DV5Q 3RUZA 2VQFQ 1NCVA 5I6YA 1GUWA 3H6MA 4HIOA 1Q7YC 2B63B 4HSPA 4CHTB 1JE5A 4A3CH 3IL8A 1RCVD 1U4RA 1STGA 3KK7A 4JBKA 2EYFA 4DV6Q 3PUZA 1ICFB 3I90A 2Q2TA 1LLRD 1FD7D 1VQJA 3QR8A 1IBKQ 2F0LA 4DAPA 4YIJA 1YIJA 4LF6Q 3A54A 1Z6HA 1GXDC 4A3FB 4YWLA 2NN6H 2K33A 2JXMB 2F0OA 1DOLA 2ZXPA 4KV6A 4HCSA 2NN6I 3PIPA 2QKIC 4TVAB 2IX0A 4PV1C 2R92H 4PQXA 1PZJD 5CBAE 2E2IH 1AEXA 2F1MA 2K52A 5EQ0A 4HAEA 2B39A 2CKZB 3KLSA 4L8JA 4XTCS 4JBJA 3MFYA 1FGBD 4LW1A 1VQ6A 4PMBA 4ABNA 5EKKA 5JPMC 1GM5A 3C2PA 2ENBA 4LF4L 1HNWL 1NTGA 4BBSH 1Q12A 1HUMA 1SMYD 2SOBA 3X3NA 3CCVA 2UUCQ 3STBC 2L15A 3DWAA 2Z6KC 2Q2IA 2K03A 4IOCA 1F2LA 3L0OA 1ASYA 1IKLA 2F4VL 3SVMA 1A2TA 1LV9A 4A3EG 2JQOA 4NXNQ 1VQIA 4K0KQ 1TVXA 3W5OA 3DMUA 5ELBA 2VB3X 1X3QA 2FMMA 1AE3A 2KBNA 1FR3A 4P71A 3S9WA 1K83B 3NBIA 4A3IB 1PTOF 2G9HD 4XYQA 1YNND 4ZCKA 1XMQL 4DAYB 3OWEB 4HIKA 5D65A 4FYDA 2DJFC 2B2WC 4ILWA 1S40A 1QNUA 1SLJA 1A8VA 4YCVA 4JI0L 3RN2A 3S17H 2E2IB 1MKHA 5DNFA 1CQFA 4EQ5A 3FMCA 5FO8B 2RKSA 1L1OB 2KHJA 3BZDB 2XTIA 4C3JG 1KRTA 1ENFA 1WD0A 4GN3B 2AUJD 3O13A 3QOJA 1S3OA 1K8GA 2DNEA 3HS0C 3NQIA 3X3MA 5M3MG 3PIP3 3W2DA 4GN4B 4Y7NH 5H1SE 2JEAI 3KDFA 3H15A 1KL9A 2R7DA 1O7LA 2CFMA 1GD7A 1L1OA 3OTOL 4JCVE 3AB9A 1X55A 3PO2G 1I6HH 3U9SA 5LMUQ 3KOJA 2K5WA 1SE2A 1LT3D 2A68C 1K28A 1IHZA 1GOZA 4WJ4A 5FLXE 4OONA 2A1AA 3CXCA 3K5MA 1RIPA 4N8X1 4XDXA 2UUCL 1R9TH 2G5DA 2BH2A 4A76A 4R1JA 3I4NB 2EE1A 1AZPA 3S14B 4X64L 5IWAQ 4LAAA 3Q23A 4LF5Q 2IX1A 5JJLA 4HMIA 2B63G 2K5DA 5A2QL 1LTLA 2O5JC 1SYEA 1KNAA 2NZOA 5FOBB 1SEBD 1NY4A 2JP1A 1KNEA 4R4TA 1F2YA 1UWVA 3IRBA 5IP7H 3MXGA 3IFTA 4PZ6A 3C3LA 5M5XH 2VNUD 5BN3A 4A3FG 3D31A 5C5LA 3CU7A 4OO1H 2ALYB 4JI8L 4CJ0B 2WIIB 1EEFD 1S4ZA 2K28A 4GKKQ 4OO1I 2M9VA 4DV7L 2LXKA 2XRQD 4KD3A 3JAME 1XTDA 1IL8A 2HDMA 3I56A 1Y8PB 1I6HB 1HRJA 4GS3A 5FLMH 1I94Q 1QNKA 5T1GA 2IJ0A 1WTPA 1FL0A 2JA5H 4RKLA 2NVXH 2UXCL 3Q0AA 4LF8Q 2KA7A 5E4XA 4A3JH 3GTOB 1PRTC 4UDUC 2AHOB 1E2ZA 3CMAA 4X3KA 4QIWE 1ICWA 3ERQA 4TQUS 1SXTA 1XNRQ 3OMCA 4FXGC 4WRDA 1H9RA 1WTWA 4X65Q 4KJOA 3HEJA 3HFZB 4J1MA 4LFAQ 1BQQT 4C3IH 4DGZA 4A3MG 3I4MH 3STBD 5IYBH 2OTLA 4F87A 3OPOA 1PDQA 3MAQA 2P5ZX 2CQAA 4A3IG 2GVBA 2PQAA 2R7ZH 4B3TL 3TZUA 3HOWH 4FP5D 2Q8TA 1EUJA 1I4QA 3LNNA 2B2TA 3S2HB 3KFUA 3CKIB 3FP9A 2ATWA 2QA4A 2B2UC 4KHVA 3HGBA 2KCTA 1VQ4A 4DK3C 3NWSA 3IKJA 4I7ZC 1JJCB 2NB0A 1PRTB 4KD4A 1NMGA 1W6KA 2MHVA 4P75A 1C9OA 4OGQC 5EBDA 4CBVA 4WFN3 1F9PA 4JOIA 1VQLA 2F0HA 2L0CA 2VZAA 2LXJA 2JA5B 1AW7A 2NVXB 3J80L 1MHWC 4WJWA 5KYLA 1Y14B 2F3IA 2F4VQ 4CDDC 2JA9A 1KDAA 4DR3Q 1UAPA 4RCNA 1UE6A 4DNRB 1YVCA 4BBRH 1G91A 5IODA 3EBEA 1LTID 2IT1A 2R93H 4XYOA 5FLXc 4FF1A 2AKWB 1ESFA 1PYSB 5BR8Q 3CRKC 1W2BA 4GN5A 4Q0FA 2ZJRA 2UUAL 1TWHH 1TY2A 1EQRA 4DNIA 5C0XH 1VS0A 2HHHL 2IHEA 1PV4A 2I5LX 1YJNA 2B2VC 2K32A 2R7ZB 3KF6A 4LFCQ 2KEDA 3NQTA 1XJVA 4JI0Q 1Y8OB 4RCOA 1IYVA 4G4KA 5C0XI 1Q90A 3I3CA 4LUOA 2KECA 3I4NG 1FNWA 2A68D 3EA6A 5M3FB 2EXDA 4CKBA 2EY5A 3NXWA 2K50A 5GAGC 3SK5A 5C4HA 1J9OA 3CAMA 3D4RA 1JE4A 2J7ZA 2L55A 4KY5A 4RWSC 1CQVA 5HY6A 2DUDA 5JVG3 4QIWB 3TQYA 5C3EH 3I70A 4DV4L 4HR7B 4ME3A 5ISRA 5GAHC 1FGUA 2IHFA 3OYYA 4L5SA 1B8AA 3K0XA 3D6WA 3CCSA 1BCPB 5JEAJ 2JYOA 3GTQH 1QJOA 2OXPA 3OMGA 1BR9A 2F0WA 1KDBA 2A5HA 3MXUA 1IBKL 5KNDA 2PI2E 4LF6L 1D5MC 4Q5VA 4UPAA 1WTQA 2R93B 2WAQE 1HR0Q 3P1HA 1N34Q 2YU9B 1HA5A 1SYBA 5LL6X 1PFMA 2ID0A 4QB4A 3C46A 3P20A 1W3SA 2Z1CA 2XWJB 2CCZA 1V1QA 1ML0D 1EL0A 1MSGA 2MFIA 1CFMA 4DV1L 4JI1Q 4OEMB 4KY7A 2HCIA 4IUQA 3HOYB 3G48A 1YHBA 2ZXOA 4X3UA 4UY8C 3WOFA 2VQEQ 1DM0B 2XVSA 1STAA 4NPSA 4A3EH 1IYUA 5C3EB 4H0LC 1PRTD 4ZKBB 1XPRA 5EBCA 1XPUA 4G7HC 3RD4A 2JJQA 2MP1A 1GHJA 2F3WA 2RQXA 1V1PB 2OQKA 4K0KL 1D7QA 1WVLA 4DV7Q 3HKZG 1GHKA 4YWKA 4G7ZC 2HD3A 4KKSA 3NENA 2UUBQ 3J81L 1FNVA 5I2XA 2K01A 1TS2A 3U4VA 4M1UB 3T51B 1CSPA 1VQPA 1B44D 4P74A 3H3VH 4HJ8A 3S1QB 1SNQA 5E3FA 4APVA 2UXCQ 3TP5A 3BVZA 3VA5A 2B8FA 3A8KE 4C3JH 5FLMG 5CC4A 3H3VI 1K3RA 1N9WA 3TP6A 3CCEA 3PCOB 3ULPA 2JA5G 1WJJA 2C9OA 1VQGA 3BDCA 3QO2A 2F3VA 1SYGA 5M3MH 4JI7L 2R7FA 3L3OC 3NBHB 3URYA 2F0IA 2LY7A 3KUPA 1NAPA 4E6IA 3VR2A 3H3VC 2EYMA 3BVGA 2LFNA 3NELA 2XIWA 2KQ3A 4EX5A 3GTMH 3DLLA 4DUYQ 1B3QA 1X3FA 1P16A 2R3ZA 5DM73 1SNCA 3S24A 4NMZA 1E2WA 4ZQ3A 1GKHA 2WAQB 3D3RA 1O7YA 1M1KC 4O0AA 4RGTA 3D6CA 5LMUL 3NBHA 1LTAD 4N9PA 2C5CA 1V43A 5C4XB 5M3FG 4GKJQ 3M4OB 1BCPD 2K75A 3EQLC 1EWIA 1ET6A 3FRPB 3A55A 3DXJC 2WV6D 2B63H 3BVMA 4J8QA 1S5CD 3NUCA 4R9WA 5IWAL 3K80C 3S1MB 3G7LA 1N36L 5LL6S 1I4XA 4C3JB 2PYKA 1Q86C 5AJ3Q 1SJHD 3NE5B 3EN2A 4LF5L 1CA5A 4UP9A 2K5VA 3RR5A 5IP9G 3UE0A 5HGQA 2HIVA 1MIUA 4A3FH 4DAVA 1TY0A 1A2UA 1EYAA 2PZTA 3KF8B 3M4PA 5ELFA 1X9NA 2YYZA 4B3RQ 2FINB 3BS1A 2UUAQ 1EYDA 1PH2A 1XPOA 1ZKOA 1ASZA 2R93G 5CV6A 4J15A 3PQIA 4RGMA 2K5HA 4DR4Q 2HHHQ 2NVTH 1S5BD 4GKKL 3CCLA 5IOCA 5C3XA 1ENCA 3CD6A 1F9RA 3LX0A 1WTRA 1PH7A 1TWAB 3PV0A 4XIGS 3A74A 3I7FA 3MEFA 1RF2D 3E6ZX 2F03A 4IPDA 1I94L 1VQFA 2K04A 3HOYG 5CV5A 1HZCA 4NXMQ 3LWUA 4IFDG 3UDXA 3GDEA 4LF8L 1PH6A 1M4VA 1B70B 1BUVT 4KHZA 3CPFA 1TWGH 4K5WA 3SEBA 1KDCA 1SRUA 2E8GA 2OTJA 4A3MH 2EIFA 5C3EG 1HHVA 2PQEA 1TIID 1XNRL 4B3SQ 2SDFA 2VL6A 3J7AF 4X65L 4HN7A 2N8NA 4KN7C 5M5WH 1K83H 4K6LA 4A3IH 2KCCA 2NUCA 1WD1A 4LFAL 2HT1A 1STHA 2UU9Q 4B3ML 4LUVA 3PF5A 1EYCA 3G6JB 3U50C 2K7VA 1SBBB 2V4DA 5KNCA 2RA4A 2B29A 1YBYA 3K57A 3Q24A 4IJLA 4A3DG 1CZWA 1OXSC 1B1ZA 4IUUA 1EQTA 1NR2A 4JV5L 2UXDQ 1EIGA 3DEPA 2D0PA 3I8ZA 3R2IA 2D2CC 1HR0W 1HZBA 4L63B 3CCMA 1A6XA 3E5SA 5J1ZA 4L5QA 5JVH3 2NVTB 2NWGA 4C3HB 3ZYYX 4DV1Q 4FXKC 1DCZA 4DXGA 2ZJPA 1C48A 4K5VA 1EU3A 1MSHA 3FPUB 1HUNA 2GVAA 1SE8A 2KJXA 2O4XA 1D5ZC 1Q8KA 1LTBD 3M3YB 2E2JB 2E2HB 1O7ZA 2IY5B 3PUXA 2EY2A 2LS01 2EYJA 3E9IA 1L1OC 5KYIA 2B2YA 4K6DA 4EQNA 1X65A 4CKCA 3ZJYC 2H5XA 1TWGB 3BZKA 1PH8A 4V190 4DR3L 4A3MB 3A8JE 1VQDA 3TSSA 4GOPA 1RJTA 2WAQG 1JORA 5ELOA 5M5WB 1LACA 2HDLA 1CUKA 2MUYA 1CKNA 5BR8L 4X3SA 1VQAA 4DV3Q 1QCBD 1D1IA 3GV3A 3HOZG 3BDOA 1CKOA 1ET9A 1F2ZA 5C4XG 1STYA 1Y1VH 1N32Q 1VCIA 1J5EQ 3I4NH 2CVRA 3VR5A 3S14H 4ZK9B 1EU4A 4CGYB 4LFCL 3CQZH 4RHRA 4QUFA 3KDFB 3HOUG 2RCNA 5ELNA 5JJIA 5I6WA 3PF4A 4K2KA 2I07B 4HJ9A 1G2SA 5IY0A 3T13A 5FKAC 1RL2A 5E1FA 5GADC 4JI7Q 1ILPA 2X6GA 4UP8A 4DA2A 2QEJC 4DFAA 4DK6C 2CH4W 3GD7A 3R8BA 1SE4A 4MN3A 3DHQA 4IO9A 5CBEE 4KTAA 3MXNA 4HMJA 2MJ8A 1JJ2A 3J7ZC 3H0GG 4WORA 3RNUA 1QG7A 4NDXA 4BS9A 2PZWA 4R4CA 1BDOA 5EAYA 2BDOA 1ZXTA 1G291 3SHLA 1H9JA 1HQMC 3AYHB 3FHWA 1QZHA 3FDTA 1QOHA 3A8IE 4Z9CB 4YWMA 5K36G 4K8IA 5IT9E 3I4LA 3S2DH 3ITPA 3HKZE 4N9TA 4UAIA 4R4QA 3J80i 1I3QB 1HFGA 4QCLA 1HR0L 4DR2Q 2Z8LA 3WOEA 4OL7A 3K5NA 1N34L 3QJYA 1CKMA 5HGTA 1EFID 3GTOH 1Y1VB 2F0UA 1VQ8A 1A63A 2FFKB 1HZAA 3A7LA 2JA8G 2H4OA 1N36Q 4CJ1B 4JI1L 2F0GA 1NMFA 4DV2Q 3CQZB 1EY0A 5FO7B 1CI3M 2F0NA 2JN4A 1YI2A 1E2VA 1NR4A 2VQEL 4X62L 4M8AA 1HJPA 4LFBQ 4EQPA 1OXUA 1RD9D 2B2TC 1ZYRC 1VQ9A 2F0MA 1G6PA 3W3AA 1I4GA 4QMGA 5LHY1 1YZ6A 3S2HH 1UUPA 5FK9C 1D1KA 4JI5L 4R4OA 2NZHA 2SNSA 2EJMA 3D4WA 3CMEA 1NE3A 1UE7A 3I2ZA 2UUBL 2L4NA 3SXHA 2VUMB 4IALA 4JOIC 1LTRD 4C3HG 1AFPA 2FXQA 2A6HC 5IE8A 3S2DB 3AU7A 2EJGC 3H94A 1L0WA 1I4RA 3MWYW 4C2MH 1PHJA 2XWBB 4JI4Q 5HURA 1PYBA 3ND8A 3K6OA 1WCMB 2XNAC 2PQAB 2KCMA 4CDEC 1PFSA 2L11A 3V96A 3CCQA 1RKNA 5FJ8G 2EVBA 1ILQA 3M7GA 4ULLA 3ULJA 3D4DA 4QUCA 2E74C 4OELB 4KI0A 1WTOA 2DY7A 3GP7A 4B3MQ 1E1OA 4DXFA 2ZTDA 3J7YW 4LK1C 4DUYL 2N49A 2SNMA 1JQYD 4P2CB 1TKWB 1T9HA 4XQQA 2F0KA 3HRZC 4JV5Q 3S15B 3S1NB 3HKZB 1Z47A 3BYYB 1I50B 1PH3A 1PRTF 5M3FH 2XGTA 5LMNL 3TDQA 1V8QA 3RLFA 4CDFC 1ENAA 1X3EA 2JEBI 2ES2A 3KLRA 2OQ0A 5C4ZA 1VQCA 3NWTA 4GKJL 2RHSB 1U4LA 4ZUIA 1Y8NB 1NUCA 1LUZA 3B6YA 2I0QA 1NJIC 5A35A 3OHXC 4C2MB 5IP9H 2PNRC 4HCEA 1C4QA 4IPCA 3J81i 3VYTA 3UE1A 5AJ3L 3KF6B 2Q8RE 2TMPA 2QF7A 3ONAB 2F0VA 1EY8A 1XXGA 4DUZL 5JJKA 1HCZA 2DY8A 4FNFA 3OSOA 4ALPA 2F52A 4ZRZA 5IYCH 2YU9H 4B3RL 1LTSD 5ELDA 4A75A 1BCPC 5C0XJ 3F2CA 1Z9FA 1CT1D 5C5MA 3SR1A 3SK6A 5ELCA 4DR4L 3NTHA 1PXUA 4UHVA 1X6OA 3PMFA 1NSNS 1H9SA 3VYSA 3HOYH 3PO3G 1Y1VG 5GROA 2M00A 3KYHC 4IFDH 1EYGA 2BA0A 5T1IA 2EXZA 4IN3A 1C7YA 1I5FA 4GNXA 3ULLA 4IFDI 4ME5A 3QB3A 5CV7A 1IL2A 4NXML 4G7OC 1JB7A 3CCUA 1CA6A 2QEXA 1GUNA 4GLAC 1BCPF 3Q6SA 1W6JA 3VYUA 5CGKA 3TRZA 1Y1WG 5KNBA 3K81C 4IJHA 1VQBA 4MTNA 1CK1A 5EKLA 3S1RB 3ICEA 1GO3E 2CHBD 3JAMc 4B3SL 4KK7A 1CHPD 1KXLA 1V1OA 2K5NA 2OEOA 2BE5C 2L1BA 4A3DH 5CR3A 2UU9L 1EIFA 4JI2Q 4AIMA 3DM3A 2DN8A 1ZYRD 2EPBA 1KC8C 1BBUA 3S1QH 2VUMG 1F9SA 1AP0A 4MIUA 1HQRD 2UXDL 2NBFA 3KBGA 1QZGA 3J7A5 1CTMA 4ID6A 2OT2A 2D5DA 5J3BA 1WCMG 2K05A 4KJNA 3NP8A 1AH9A 3K0YA 5KIXA 2IX3A 1VQMA 1SFOH 2A6HD 4MTKA 4QJFA 1B4OA 2E75C 1L0YB 4X62Q 2HUGA 4XQNA 4LF9L 1G51A 1EQQA 4JBWA 1II3A 1QWYA 1HNXL 1HPCA 1JWSD 3FKIB 2Z4IA 4C1NK 5IGBA 1S72A 1XWEA 1EWCA 4QF4A 1GUGA 1EOVA 3U9OA 4JI5Q 5A2QE 2Q2HA 3OW7A 4ZAIA 3HOZH 2RHQB 5C4XH 3VYRA 4V0BA 3HP3A 2O5IC 3M4OH 4LF7Q 2PW7A 4A3DB 2L9HA 4DV3L 1PYWD 4NKLA 3NPPA 4EQOA 3RZOH 2AWNA 1AZQA 3M7NA 3HOUH 1N32L 1J5EL 2A69C 1ONLA 1WTHA 2RDGA 3S1MH 3J7AV 4A3LG 1PH9A 1Q1EA 4A4IA 1X3GA 4C56C 3HOXG 1Q82C 3I73A 1R4QB 4X6AH 3RLNA 4AH6A 3UDGA 4IUNA 5C44H 2KHIA 3W1GA 2F4IA 2L5TA 2A19A 3H0GH 5COYA 4B9XA 1SFOB 1QVGA 2CWAA 5IYDG 3VR3A 4H44C 1OXTA 1B50A 1VQHA 5K36H 1A15A 2KHSA 1S5DD 5CV9A 1JICA 2D9UA 4KKTA 3ER0A 5D3IB 4JPBW 3N52A 1TWAH 4NW2A 5LMNQ 3F1ZA 1M8AA 1U5KA 4DKAC 2V1CC 4QL5A 3E3XA 1SNOA 4L5TA 4TKOB 2IPKD 3HOZB 1DYQA 2EZVA 4A93H 5FLXL 3QIAA 2JA8H 3A0JA 4DR2L 1EZ8A 4BWGB 3I72A 1TR5A 1K0RA 1SNMA 3RZOB 4TRDA 1QVCA 1HH2P 2WKCA 3BYTB 3HOUB 4DNTB 1TS5A 2Z9HA 2VY3A 2ASBA 4AQYQ 4FO2A 1B2TA 2QCPX 2Y0SE 3GTPB 1YHAA 3EJIA 4DV2L 2HQLA 2OF1A 2JA6H 2RDHA 3TBIB 4DUZQ 3FVQA 5C44B 2F0TA 3P7JA 2FMCA 3G4SA 4DR5Q 5EJWA 2EY6A 5I9PA 3H0GB 4LFBL 4I65A 1IBLQ 3Q8DA 3I55A 3GTGB 1K73C 2UXBQ 1D6EC 1TU2B 2YTYA 3J80E 1KTKA 3HKSA 4PZ8A 4CKEA 1J6QA 1UEBA 1HFNA 5F2DA 1PVOA 3VR4A 4DPGA 1KRSA 2NVYH 1M90C 5IYCG 2ZTEA 4C3HH 2EJFC 2KVMA 3AQQA 3F2UA 2BE5D 1YEZA 2N3SA 5GQOA 3NTIA 3JAML 4OWTB 4DF7A 4AYBE 1JT8A 1Q46A 4POFA 4LUZA 1RDPD 3M3YH 3FPPA 2E2JH 2WB1E 5EKIA 3I91A 2E2HH 1D2BA 4JI6Q 5FJ8H 3TN2A 2B2YC 1A0IA 4A93B 1PZKD 2Q8IB 3T16A 3RN5A 2JA8B 1LM0A 4JI4L 4BY1B 1HNZQ 3C1FA 3WWVA 1MD2D 4X3TA 2BH8A 1VMCA 3D8GA 2MGSA 4XT1B 5I4DA 1ESRA 4R4IA 1HZ9A 4GOPC 1JMCA 2I5HA 3R93A 1TWCB 3FKIG 3TP7A 4A3BH 4A3KH 3DEOA 1AN8A 2Z0SA 2R6GA 5JJZA 2KENA 2JA6B 4OX9Q 2IL8A 1PFBA 1Q81C 3CCRA 5CV8A 1PZID 1KAWA 1OTCA 4ODGA 2LKVA 1FJGQ 1HTLD 4KLKA 1BXTA 3BDLA 1E3PA 2FHTA 3MC0B 1PH4A 4DR6Q 2E5LQ 1NNXA 3KLSX 3GTJH 2NVYB 3U4ZA 3EROA 2X69A 1XNQQ 5FO9B 2ZTCA 4J6HA 1SNPA 2I46A 3K5LA 3F2DA 1QB5D 1SAPA 4BY7B 2CH4A 1PTOH 5CMDA 3OIQA 5JEAG 4GOPB 1BBWA 2F0DA 1F2MA 5CV4A 1JWMD 2Y0SB 3R2TA 4LF9Q 1CKNB 2A69D 3BG3A 2EYHA 5EGTA 1LTGD 1HNXQ 2E76C 2ZXRA 1EY4A 5IGDA 2VB2X 3K5OA 2YV5A 4IURA 2CW0C 5D3DA 1U4MA 1E24A 3TEHB 3HOVH 2RCFA 1X32A 4O1NA 1PTOC 2K4KA 4QGUA 4DR7Q 2AMCB 2QDLA 2HCCA 4H02A 4RMFA 4FF3A 4A3BB 1I3QH 1JOOA 3CC7A 3OWFA 4A3KB 1SSOA 2MQHA 2PCFB 2WP8J 3C1EA 2RSNA 2QDBA 4L6TB 3EVQA 5CYUA 3PO3H 3SK4A 4RHSA 3MHBA 4F88A 4AYBB 1D8LA 3A5ZB 4DR1Q 3R3OA 3MXNB 4PG3A 1TS3A 2WB1B 5IGCA 5JOBA 2ZM6Q 1B53A 2IW3A 4OIKA 3KLWA 2PW5A 1QILA 2N78A 3J81E 1WOCA 4MNOA 3GTJB 1BKBA 1VMPA 3CW2C 3M9BA 4P72A 1O7IA 1GUTA 1Y1WH 3MEHA 3DWPA 1SE3A 1YNJC 4RH6A 4BA2I 1K9MC 3A56A 1PTOB 1LYLA 1STNA 2EYPA 3S16H 3CF5A 3J80c 5C44G 3T1HL 2TSSA 2R92B 5M9OA 1MI2A 3G6EA 1Q8IA 3L9AX 1VQEA 5G3LD 1UNSA 1BO0A 3HG9A 4YCUA 1N33Q 4B08A 2D62A 2VUMH 5C3WA 4HJAA 1P8LA 3CCJA 3HOVB 4DAYA 4EGVA 1LT6D 2BOSA 5EPJA 4JI2L 5IGGA 1PLFA 3KJPA 4BBSB 4O42A 4R8IA 2K1BA 4OIJA 2J4XA 5LMNW 4LWCA 3LWEA 1SN8A 2WINB 1DOMA 1TS4A 1WCMH 3JC66 2F0PA 2Z6KA 3PO3B 1X3PA 4A3GG 2X6LA 4A93G 1LABA 2ICIA 3GQBA 3N6RA 1A62A 3KBXA 2WFWA 4BY1G 3K59A 2C35B 4FXDA 3L7ZC 3VR6A 1K8MA 4R8NA 5NUCA 2NVQH 5KEEA 4DV0Q 2AWOA 3T1YQ 3M4YA 1EY5A 1TWFH 2PZUA 1E0BA 1I4HA 1Y1WB 4FF2A 4BXXG 3CRLC 2EDGA 2JA7G 3K7AH 1RHPA 2JA6G 1YHQA 3S16B 2F0SA 3S15H 3S1NH 1EOTA 4TSSA 3E0EA 4ZYSA 1I50H 3T56B 4JK1C 3W1BA 2OWOA 1A3UA 2B2WA 1XMOQ 2GN5A 3S17B 4HEDA 3CP0A 2EY1A 4JI3Q 5M5YH 4I7AA 2Z6BA 3MA2B 3MZ5A 1DONA 3PIOA 3VDYA 4IPHA 4U68A 4RKBA 4KN4C 2K14A 5I9OA 1DGSA 4LF7L 5C4JH 4JYAQ 3VA7A 3MVVA 4A3LH 1WTXA 1QE6A 2ICEC 4X66Q 4BY7G 3HOXH 3DUZA 4KHPQ 4RAUC 4Y7NB 1VQOA 2N55A 2OCEA 4YHHQ 1S5FD 1L2FA 1O80A 4PMCA 4B9WA 2K6AA 2Y0SG 3NK9A 1JOQA 3PUWA 4DN4M 1UE1A 5I2YA 3AMUA 1OXXK 1EIYB 3KJOA 1XX8A 2NZ1D 3F2BA 5IYDH 3HZXA 4U673 1SDFA 4LMQD 1IW7C 4HSVA 1PH5A 3QG1A 2AUKA 4F8MA 1A3TA 1UE5A 5IGFA 2NVQB 1I6VC 1KHIA 2BDNA 4A3BG 1I4PA 2K5QA 1K8OA 1TWFB 4A3KG 1R9TB 1Z7TA 1B9NA 4MZ9A 5J22A 2CW0D 3K7AB 1J8IA 4OHJA 3TP8A 5DEHA 5KRUA 2RF4A 3DWQA 5AFWA 4AYBG 1PTOD 4QY7A 4K14A 3J81c 4GNXC 3SDZA 1MBYA 2WB1G 4A3CG 1CHQD 4QQBX 1SJED 3CHBD 3WDNA 2MNAA 2KOLA 2I5MX 2B8GA 4HIMA 1D5XC 5M5YB 3IFDA 1L0XB 4H13C 3TREA 2NTSA 1WTVA 1X54A 3L2PA 5C4JB 4OWWB 5M5XB 2NTTA 3E0JA 2NN6G 4PMWA 1IKMA 3HOXB 4POGA 3S1RH 4UP7A 2ZT9C 1VQKA 1WI5A 5EPLA 4S3SA 1S5ED 1SYCA 3AFQA 1HA6A 4AQYL 2R92G 4IOAA 2HIXA 3FEWX 3PIO3 4DU9A 4LF4Q 1HNWQ 1H9SB 5IT9c 4ZKCB 3RLOA 4FVMA 1GUSA 1YNJD 1KLGD 1T5EA 4YY3L 4JG2A 1VF7A 1OO9B 4LJZC 4DR5L 4GNXB 1DJRD 1LT4D 3HOVG 1IBLL 1IBML 2UXBL 4HTHA 4BBSG 3PSIA 4O2DA 3CPWA 2JE6I 1DOKA 4FDBA 4A3JB 3Q22A 1JB3A 2XN9C 2XRSD 2E2DC 1FVIA 2VXWA 4IFDJ 2G9DA 1JWUD 3K8AA 4DK0A 3GO5A 3K7UC 3ND9A 4G57A 1BBXC 1DXMA 4Y52H 4OXPA 4C3IB 1EQVA 2IWHA 2HQEA 3UDIA 3I4MB 1XMQQ 1SR3A 4JI6L 4CJ2C 1LO5D 4N8FA 3UDFA 1SYDA 3A7AB 4IQZA 3DM1A 3FKIH 3MTSA 4RA8A 4DK1A 2VS1A 3MFGA 4NP5A 5DAUA 1K8AC 1HNZL 3HOWB 1MJCA 3T1HQ 4JBMA 2BCOA 2EYOA 4FF4A 2CQOA 4HJ7A 4HJ5A 3H91A 3TMEA 2EOTA 1LT5D 4XXEA 2B2UA 2GA4B 2H1EA 3SK8A 3TZDA 5KGUA 3NHHA 3U58A 1JC7A 4OX9L 5CORA 1H9MA 4DV5L 1EIHA 4IUVA 2VQFL 3OIPA 3MXPA 1E22A 1SMXA 1EFWA 1X56A 4CDCC 1VQNA 1FJGL 3EIVA 2DGYA 2A6EC 3PGZA 4IUTA 1VQ7A 2Q2UA 4DV6L 3TS0A 1E1TA 3OTOQ 1JR0D 4DR6L 2E5LL 1U4PA 5JEAH 3QWNA 4ZUJA 3GTKH 2AQ3B 4PNYA 5C6AA 4K2LA 1XNQL 4BBRB 4RGNA 3AFPA 1MJEA 3P75A 3RZDH 1JJGA 1NBWA 3T4AC 4GLXA 2F0JA 1IXRA 3OW2A 1Q3LA 1SNDA 1CSQA 1F9QA 1U9RA 2L12A 3UI2A 3V2TA 1TWHB 1Q1BA 2R61A 5J39A 2RSOA 3JAMi 3AEVA 4IZ8A 4X64Q 2KCNA 1WFQA 1FYCA 3V05A 4IUPA 3G71A 1N8RC 2B2VA 4RFBA 3PUVA 2F0FA 1IW7D 3NSWA 2QW7A 2QGQA 4DR7L 1RODA 2N88A 2LSSA 3GTLH 2CWPA 3H09A 1E7ZA
chains in the Genus database with same CATH topology
1LM0A 4JI4L 1JJCB 1HNZQ 1G291 3WWVA 1NMGA 3AYHB 3FHWA 1QZHA 1YNXA 1C9OA 2BH8A 4P75A 4YWMA 1KIXA 5K36G 4R4IA 1HZ9A 4GOPC 1JMCA 2I5HA 3F8TA 4JI8Q 3S2DH 4JOIA 3FKIG 5IP7G 1VQLA 4DR1L 3HKZE 4NXNL 3M4QA 4A3BH 4R4QA 3J80i 2VZAA 2LXJA 4A3KH 4GLVB 1HR0L 3GTPH 4DR2Q 2ZM6L 1Y14B 2Z0SA 1YJWA 1N34L 4OO1G 1CKMA 2R6GA 2F3IA 2F4VQ 2KENA 3GTOH 4OX9Q 4JC0A 2JA9A 4DR3Q 1VQ8A 1A63A 1UE6A 5GAEC 1YVCA 1Q81C 4BBRH 3CCRA 1HZAA 2JA8G 1KAWA 3EBEA 2IT1A 3D0FA 2PMZE 1OTCA 3TS2A 3E9HA 1FJGQ 2R93H 1KQSA 4PZ7A 4KLKA 2MO1A 1N36Q 3GTGH 5FLXc 2AKWB 4JI1L 1NMFA 1E3PA 1PYSB 4DV2Q 5BR8Q 1W2BA 4GN5A 1PH4A 2ZJRA 4DR6Q 2E5LQ 2UUAL 1YI2A 1H95A 3GTJH 4IPGA 1TWHH 3U4ZA 2VQEL 1EQRA 4DNIA 1XNQQ 4X62L 2ZTCA 3F2DA 1VS0A 1HJPA 2IHEA 1PV4A 2HHHL 2I5LX 1YJNA 4LFBQ 4A3JG 1OXUA 2JK8A 3KF6A 4RG1A 3BU2A 4BA1I 4HIDA 1VQ9A 1XJVA 5JEAG 4JI0Q 4GOPB 4LFCQ 1BBWA 5C0XI 1G6PA 4LUOA 2YTVA 3I4NG 4OWXB 1YZ6A 3S2HH 2EXDA 2MO0A 4LF9Q 1OXVA 1CKNB 2K50A 4JI5L 5GAGC 4R4OA 2NZHA 1HNXQ 3CAMA 4A3GH 1VQ5A 3PO2H 1YITA 3ERSX 5HY6A 3A5UA 2DUDA 2PNHA 2YV5A 4BY1H 4B3TQ 3CMEA 3TQYA 1NE3A 5C3EH 2VW9A 1UE7A 3I2ZA 4DV4L 2UUBL 5IYBG 1E24A 1SROA 3I4MG 1PA6A 5DLQE 3TEHB 4ME3A 3HOVH 5GAHC 4JOIC 2FXQA 2K4KA 1FGUA 2IHFA 1QVFA 3OYYA 1TWCH 5IE8A 4L5SA 1B8AA 4QGUA 4DR7Q 2AMCB 2A8VA 3K0XA 2R7ZG 3HOWG 1U0LA 1V9PA 4H02A 1QUQB 4RMFA 1I3QH 1L0WA 4C2MH 3CC7A 3CCSA 3J81j 1PHJA 2WP8J 2MQHA 3LGJA 4JI4Q 4BXXH 1PYBA 2D0OA 5JEAJ 2EQSA 4DAMA 2JA7H 3GTQH 2PQAB 2KCMA 1GVPA 1PFSA 3CCQA 3PO3H 5FJ8G 4DV0L 1IBKL 4YY3Q 1D8LA 3A5ZB 3T1YL 1KD1C 2PI2E 4LF6L 2PI2A 4DR1Q 4UPAA 3ULJA 3MXNB 4PG3A 4LNQA 2WAQE 1IBMQ 1HR0Q 4KI0A 2ZM6Q 3I4OA 4NB3A 3BJUA 1N34Q 4YCWA 3KLWA 2N78A 4B3MQ 1E1OA 1XMOL 1QUQA 2ID0A 1WOCA 4MNOA 1BKBA 2ZTDA 3CW2C 3M9BA 1W3SA 4P72A 2CCZA 1O7IA 4DUYL 1V1QA 2N49A 1Y1WH 4JI3L 4BY7H 2MFIA 4BA2I 1T9HA 1C0AA 1K9MC 4DV1L 4JI1Q 2B3GA 1YJ9A 1LYLA 3S16H 4JV5Q 1IZ6A 3CF5A 3G48A 3J80c 1Z47A 1YHBA 2ZJQA 5C44G 2BA1A 4JYAL 4BBRG 4UY8C 3T1HL 1PH3A 5M3FH 2XGTA 1BVSA 1TXYA 5LMNL 2VQEQ 4X66L 3RLFA 3SGIA 4KHPL 3G6EA 1X3EA 2JEBI 1VQEA 2ES2A 4NPSA 4A3EH 1B7YB 3BZCA 4YCUA 2OQ0A 4YHHL 1N33Q 1VQCA 1IYJB 4GKJL 2YTXA 2RHSB 2D62A 5E7NA 2VUMH 1AE2A 4HJAA 1P8LA 3CCJA 1XPRA 1XPUA 2JJQA 3CC2A 3PUYA 3B6YA 5C0XG 1LUZA 3NEMA 2I0QA 4JI2L 4L5RC 3KJPA 1NJIC 3CC4A 2OQKA 1WYDA 4K0KL 5LMNW 5IP9H 1D7QA 4LWCA 4DV7Q 3HKZG 4YWKA 4IPCA 1SN8A 3JC66 1WCMH 3J81i 3NENA 4DV4Q 2UUBQ 1PH1A 4P73A 3M85A 3UE1A 2Z6KA 4WJ3M 5AJ3L 3KF6B 3U4VA 4DV5Q 4A3GG 4A93G 2VQFQ 1CSPA 1A62A 4HIOA 1VQPA 2WFWA 4BY1G 1Q7YC 4P74A 4DUZL 2C35B 5JJKA 3L7ZC 1JE5A 4A3CH 3H3VH 4HJ8A 4APVA 4DK3C 2UXCQ 4JBKA 4ALPA 2F52A 4DV6Q 5IYCH 3PUZA 2YU9H 4B3RL 4C3JH 5FLMG 2Q2TA 4A75A 3H3VI 1K3RA 1N9WA 2NVQH 1VQJA 5C0XJ 3F2CA 4DV0Q 1IBKQ 2AWOA 3CCEA 3PCOB 1Z9FA 3T1YQ 3ULPA 2JA5G 1TWFH 1YIJA 4LF6Q 1WJJA 1VQGA 4BXXG 4DR4L 4YWLA 2JA7G 1X6OA 3K7AH 5M3MH 4JI7L 2R7FA 2JA6G 1YHQA 3NBHB 3HOYH 3PO3G 3S15H 3S1NH 1Y1VG 5GROA 3E0EA 1I50H 3KYHC 2NN6I 3W1BA 3PIPA 2BA0A 1EYGA 4TVAB 2OWOA 1XMOQ 2IX0A 4LF8Q 2R92H 2GN5A 3NELA 2E2IH 3CP0A 4EX5A 1C7YA 1I5FA 4GNXA 3GTMH 3ULLA 3DLLA 4DUYQ 4IFDI 2K52A 1X3FA 4XTCS 4JI3Q 2CKZB 5M5YH 1P16A 1IL2A 4JBJA 4NXML 4LW1A 3PIOA 1JB7A 3VDYA 4IPHA 3S24A 3CCUA 1VQ6A 2K14A 2QEXA 4GLAC 1DGSA 4LF7L 5C4JH 1GM5A 1GKHA 4JYAQ 4LF4L 1HNWL 4A3LH 1NTGA 1M1KC 1Y1WG 4O0AA 3TRZA 3K81C 4IJHA 4X66Q 1VQBA 5LMUL 4MTNA 4BBSH 4BY7G 1Q12A 3HOXH 4KHPQ 3CCVA 1VQOA 3STBC 2UUCQ 1V43A 1GO3E 2OCEA 2L15A 3JAMc 4YHHQ 3ICEA 4B3SL 1L2FA 2Z6KC 2Q2IA 1KXLA 5M3FG 2K5NA 4GKJQ 2Y0SG 4IOCA 2K75A 3PUWA 1EWIA 4A3DH 1UE1A 1OXXK 3L0OA 1ASYA 1EIYB 2UU9L 2F4VL 1EIFA 4JI2Q 4AIMA 3KJOA 3F2BA 5IYDH 4A3EG 3DM3A 2JQOA 4NXNQ 2B63H 1VQIA 4K0KQ 3S1QH 1KC8C 1BBUA 3W5OA 2VUMG 1PH5A 5IWAL 3K80C 1AE3A 2KBNA 1UE5A 4P71A 1N36L 1Q86C 5AJ3Q 2UXDL 4LF5L 3EN2A 1QZGA 3J7A5 1KHIA 4A3BG 4UP9A 2K5VA 3RR5A 5IP9G 4A3KG 3UE0A 5HGQA 2HIVA 1XMQL 1MIUA 5J3BA 4DAYB 4A3FH 1WCMG 4MZ9A 3KF8B 4HIKA 3M4PA 1AH9A 2RF4A 2YYZA 1X9NA 4B3RQ 1VQMA 4AYBG 1SFOH 1S40A 4QY7A 2UUAQ 1SLJA 1A8VA 4YCVA 4QJFA 3J81c 4GNXC 1PH2A 3RN2A 4JI0L 3S17H 2WB1G 1XPOA 1ASZA 1MKHA 2R93G 4A3CG 4EQ5A 4X62Q 4QQBX 4J15A 4LF9L 1L1OB 1G51A 2K5HA 2KHJA 2I5MX 2MNAA 4HIMA 1EQQA 4JBWA 2HHHQ 2NVTH 4DR4Q 1HNXL 2XTIA 3TREA 4GKKL 1X54A 1KRTA 3L2PA 3CCLA 1S72A 4GN3B 3CD6A 1PH7A 4OWWB 3PV0A 1EOVA 4JI5Q 1S3OA 1K8GA 4XIGS 2NN6G 3A74A 4PMWA 3I7FA 3MEFA 5M3MG 2Q2HA 4IPDA 4GN4B 4POGA 1I94L 3S1RH 1VQFA 4UP7A 4Y7NH 3HOYG 2RHQB 5H1SE 2JEAI 3HOZH 1HZCA 5C4XH 4NXMQ 1VQKA 1WI5A 4IFDG 3AFQA 3KDFA 3UDXA 3H15A 1KL9A 2R7DA 4AQYL 2R92G 3GDEA 3M4OH 4IOAA 2CFMA 2HIXA 4LF7Q 1GD7A 4LF8L 1PH6A 4DV3L 1B70B 1L1OA 4JCVE 5IT9c 4KHZA 3OTOL 3CPFA 1TWGH 1X55A 4LF4Q 3PO2G 1I6HH 1SRUA 2E8GA 5LMUQ 3RLOA 3RZOH 2OTJA 2AWNA 3KOJA 4A3MH 3M7NA 4YY3L 2EIFA 3HOUH 1N32L 4JG2A 5C3EG 1J5EL 1XNRL 4DR5L 2VL6A 4GNXB 4B3SQ 3HOVG 3S1MH 4X65L 2N8NA 4A3LG 5M5WH 1PH9A 1IBLL 1IBML 4WJ4A 1Q1EA 4A4IA 1K83H 2UXBL 1X3GA 4OONA 4A3IH 4BBSG 2A1AA 3HOXG 3PSIA 4O2DA 3CXCA 4LFAL 3CPWA 2HT1A 2JE6I 1RIPA 1Q82C 4FDBA 2UU9Q 4X6AH 2UUCL 4LUVA 3RLNA 3PF5A 1R9TH 4B3ML 2BH2A 4A76A 4AH6A 3UDGA 3U50C 5C44H 1FVIA 4R1JA 2KHIA 3W1GA 2B29A 1YBYA 4IFDJ 3K8AA 4X64L 5IWAQ 4IJLA 4A3DG 1OXSC 2A19A 3H0GH 3GO5A 3K7UC 1QVGA 4JV5L 2UXDQ 4Y52H 2CWAA 5IYDG 4OXPA 4LF5Q 2IX1A 5JJLA 2B63G 3UDIA 1LTLA 2D0PA 1HR0W 1HZBA 3CCMA 1OXTA 1XMQQ 1SR3A 4JI6L 1VQHA 4L5QA 2NZOA 5EAYA 4DV1Q 1NY4A 3UDFA 4R4TA 1UWVA 2ZJPA 3ER0A 3IRBA 3FKIH 5IP7H 2VS1A 1K8AC 1HNZL 4PZ6A 1MJCA 3T1HQ 4JBMA 1TWAH 5M5XH 5LMNQ 2VNUD 2GVAA 1SE8A 3F1ZA 4A3FG 1Q8KA 1U5KA 4DKAC 2V1CC 3D31A 4QL5A 4L5TA 2ALYB 2CQOA 4HJ7A 4JI8L 2IY5B 3PUXA 4HJ5A 4A93H 3E9IA 4GKKQ 4OO1I 1L1OC 4DV7L 2JA8H 2LXKA 3A0JA 4DR2L 1XTDA 1X65A 3ZJYC 2H5XA 3I56A 3U58A 1K0RA 4OX9L 3BZKA 1QVCA 4DV5L 1HH2P 1PH8A 4DR3L 4GS3A 5FLMH 1I94Q 2VQFL 1N33L 1E22A 1SMXA 1VQDA 1EFWA 4GOPA 2VY3A 2WAQG 1FL0A 1X56A 1VQNA 2JA5H 1FJGL 3EIVA 2DGYA 4AQYQ 5ELOA 2NVXH 2ASBA 2UXCL 2Y0SE 1YHAA 3PGZA 4DV2L 1VQ7A 2Q2UA 4DV6L 1CUKA 5BR8L 1CKNA 1E1TA 3OTOQ 1VQAA 2HQLA 4DV3Q 3TS0A 4DR6L 2E5LL 4A3JH 2JA6H 3HOZG 1CKOA 5C4XG 3GTKH 1Y1VH 2AHOB 4DUZQ 1N32Q 1VCIA 3CMAA 4QIWE 1J5EQ 1XNQL 3I4NH 4TQUS 3G4SA 1XNRQ 3S14H 4DR5Q 3AFPA 1MJEA 4X65Q 3RZDH 4LFBL 1IBLQ 3Q8DA 3I55A 3HFZB 1K73C 2UXBQ 1JJGA 2YTYA 1NBWA 4LFCL 4GLXA 1IXRA 3CQZH 4LFAQ 4C3IH 3HKSA 4PZ8A 3KDFB 3OW2A 1J6QA 1UEBA 4A3MG 3HOUG 2RCNA 5ELNA 5JJIA 3I4MH 1PVOA 1CSQA 4DPGA 3PF4A 3STBD 1KRSA 5IYBH 2OTLA 2NVYH 4HJ9A 1Q1BA 1M90C 5IYCG 2ZTEA 5IY0A 1HNWQ 4C3HH 1RL2A 3JAMi 3AQQA 3AEVA 5GADC 4JI7Q 1YEZA 2N3SA 5GQOA 4X64Q 4A3IG 2GVBA 2PQAA 4UP8A 1WFQA 4OWTB 2R7ZH 4DK6C 3G71A 4B3TL 3HOWH 4AYBE 1EUJA 1JT8A 1Q46A 1N8RC 3GD7A 3PUVA 4POFA 4LUZA 3M3YH 2E2JH 2WB1E 4IO9A 2E2HH 3KFUA 3FP9A 1JJ2A 4JI6Q 2QGQA 2ATWA 3J7ZC 2QA4A 3H0GG 4DR7L 5FJ8H 3RNUA 2LSSA 3GTLH 2KCTA 1A0IA 2CWPA 1VQ4A 3RN5A 4R4CA 1E7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM0 A;  4JI4 L;  1JJC B;  1HNZ Q;  1G29 1;  3WWV A;  1NMG A;  3AYH B;  3FHW A;  1QZH A;  1YNX A;  1C9O A;  2BH8 A;  4P75 A;  4YWM A;  1KIX A;  5K36 G;  4R4I A;  1HZ9 A;  4GOP C;  1JMC A;  2I5H A;  3F8T A;  4JI8 Q;  3S2D H;  4JOI A;  3FKI G;  5IP7 G;  1VQL A;  4DR1 L;  3HKZ E;  4NXN L;  3M4Q A;  4A3B H;  4R4Q A;  3J80 i;  2VZA A;  2LXJ A;  4A3K H;  4GLV B;  1HR0 L;  3GTP H;  4DR2 Q;  2ZM6 L;  1Y14 B;  2Z0S A;  1YJW A;  1N34 L;  4OO1 G;  1CKM A;  2R6G A;  2F3I A;  2F4V Q;  2KEN A;  3GTO H;  4OX9 Q;  4JC0 A;  2JA9 A;  4DR3 Q;  1VQ8 A;  1A63 A;  1UE6 A;  5GAE C;  1YVC A;  1Q81 C;  4BBR H;  3CCR A;  1HZA A;  2JA8 G;  1KAW A;  3EBE A;  2IT1 A;  3D0F A;  2PMZ E;  1OTC A;  3TS2 A;  3E9H A;  1FJG Q;  2R93 H;  1KQS A;  4PZ7 A;  4KLK A;  2MO1 A;  1N36 Q;  3GTG H;  5FLX c;  2AKW B;  4JI1 L;  1NMF A;  1E3P A;  1PYS B;  4DV2 Q;  5BR8 Q;  1W2B A;  4GN5 A;  1PH4 A;  2ZJR A;  4DR6 Q;  2E5L Q;  2UUA L;  1YI2 A;  1H95 A;  3GTJ H;  4IPG A;  1TWH H;  3U4Z A;  2VQE L;  1EQR A;  4DNI A;  1XNQ Q;  4X62 L;  2ZTC A;  3F2D A;  1VS0 A;  1HJP A;  2IHE A;  1PV4 A;  2HHH L;  2I5L X;  1YJN A;  4LFB Q;  4A3J G;  1OXU A;  2JK8 A;  3KF6 A;  4RG1 A;  3BU2 A;  4BA1 I;  4HID A;  1VQ9 A;  1XJV A;  5JEA G;  4JI0 Q;  4GOP B;  4LFC Q;  1BBW A;  5C0X I;  1G6P A;  4LUO A;  2YTV A;  3I4N G;  4OWX B;  1YZ6 A;  3S2H H;  2EXD A;  2MO0 A;  4LF9 Q;  1OXV A;  1CKN B;  2K50 A;  4JI5 L;  5GAG C;  4R4O A;  2NZH A;  1HNX Q;  3CAM A;  4A3G H;  1VQ5 A;  3PO2 H;  1YIT A;  3ERS X;  5HY6 A;  3A5U A;  2DUD A;  2PNH A;  2YV5 A;  4BY1 H;  4B3T Q;  3CME A;  3TQY A;  1NE3 A;  5C3E H;  2VW9 A;  1UE7 A;  3I2Z A;  4DV4 L;  2UUB L;  5IYB G;  1E24 A;  1SRO A;  3I4M G;  1PA6 A;  5DLQ E;  3TEH B;  4ME3 A;  3HOV H;  5GAH C;  4JOI C;  2FXQ A;  2K4K A;  1FGU A;  2IHF A;  1QVF A;  3OYY A;  1TWC H;  5IE8 A;  4L5S A;  1B8A A;  4QGU A;  4DR7 Q;  2AMC B;  2A8V A;  3K0X A;  2R7Z G;  3HOW G;  1U0L A;  1V9P A;  4H02 A;  1QUQ B;  4RMF A;  1I3Q H;  1L0W A;  4C2M H;  3CC7 A;  3CCS A;  3J81 j;  1PHJ A;  2WP8 J;  2MQH A;  3LGJ A;  4JI4 Q;  4BXX H;  1PYB A;  2D0O A;  5JEA J;  2EQS A;  4DAM A;  2JA7 H;  3GTQ H;  2PQA B;  2KCM A;  1GVP A;  1PFS A;  3CCQ A;  3PO3 H;  5FJ8 G;  4DV0 L;  1IBK L;  4YY3 Q;  1D8L A;  3A5Z B;  3T1Y L;  1KD1 C;  2PI2 E;  4LF6 L;  2PI2 A;  4DR1 Q;  4UPA A;  3ULJ A;  3MXN B;  4PG3 A;  4LNQ A;  2WAQ E;  1IBM Q;  1HR0 Q;  4KI0 A;  2ZM6 Q;  3I4O A;  4NB3 A;  3BJU A;  1N34 Q;  4YCW A;  3KLW A;  2N78 A;  4B3M Q;  1E1O A;  1XMO L;  1QUQ A;  2ID0 A;  1WOC A;  4MNO A;  1BKB A;  2ZTD A;  3CW2 C;  3M9B A;  1W3S A;  4P72 A;  2CCZ A;  1O7I A;  4DUY L;  1V1Q A;  2N49 A;  1Y1W H;  4JI3 L;  4BY7 H;  2MFI A;  4BA2 I;  1T9H A;  1C0A A;  1K9M C;  4DV1 L;  4JI1 Q;  2B3G A;  1YJ9 A;  1LYL A;  3S16 H;  4JV5 Q;  1IZ6 A;  3CF5 A;  3G48 A;  3J80 c;  1Z47 A;  1YHB A;  2ZJQ A;  5C44 G;  2BA1 A;  4JYA L;  4BBR G;  4UY8 C;  3T1H L;  1PH3 A;  5M3F H;  2XGT A;  1BVS A;  1TXY A;  5LMN L;  2VQE Q;  4X66 L;  3RLF A;  3SGI A;  4KHP L;  3G6E A;  1X3E A;  2JEB I;  1VQE A;  2ES2 A;  4NPS A;  4A3E H;  1B7Y B;  3BZC A;  4YCU A;  2OQ0 A;  4YHH L;  1N33 Q;  1VQC A;  1IYJ B;  4GKJ L;  2YTX A;  2RHS B;  2D62 A;  5E7N A;  2VUM H;  1AE2 A;  4HJA A;  1P8L A;  3CCJ A;  1XPR A;  1XPU A;  2JJQ A;  3CC2 A;  3PUY A;  3B6Y A;  5C0X G;  1LUZ A;  3NEM A;  2I0Q A;  4JI2 L;  4L5R C;  3KJP A;  1NJI C;  3CC4 A;  2OQK A;  1WYD A;  4K0K L;  5LMN W;  5IP9 H;  1D7Q A;  4LWC A;  4DV7 Q;  3HKZ G;  4YWK A;  4IPC A;  1SN8 A;  3JC6 6;  1WCM H;  3J81 i;  3NEN A;  4DV4 Q;  2UUB Q;  1PH1 A;  4P73 A;  3M85 A;  3UE1 A;  2Z6K A;  4WJ3 M;  5AJ3 L;  3KF6 B;  3U4V A;  4DV5 Q;  4A3G G;  4A93 G;  2VQF Q;  1CSP A;  1A62 A;  4HIO A;  1VQP A;  2WFW A;  4BY1 G;  1Q7Y C;  4P74 A;  4DUZ L;  2C35 B;  5JJK A;  3L7Z C;  1JE5 A;  4A3C H;  3H3V H;  4HJ8 A;  4APV A;  4DK3 C;  2UXC Q;  4JBK A;  4ALP A;  2F52 A;  4DV6 Q;  5IYC H;  3PUZ A;  2YU9 H;  4B3R L;  4C3J H;  5FLM G;  2Q2T A;  4A75 A;  3H3V I;  1K3R A;  1N9W A;  2NVQ H;  1VQJ A;  5C0X J;  3F2C A;  4DV0 Q;  1IBK Q;  2AWO A;  3CCE A;  3PCO B;  1Z9F A;  3T1Y Q;  3ULP A;  2JA5 G;  1TWF H;  1YIJ A;  4LF6 Q;  1WJJ A;  1VQG A;  4BXX G;  4DR4 L;  4YWL A;  2JA7 G;  1X6O A;  3K7A H;  5M3M H;  4JI7 L;  2R7F A;  2JA6 G;  1YHQ A;  3NBH B;  3HOY H;  3PO3 G;  3S15 H;  3S1N H;  1Y1V G;  5GRO A;  3E0E A;  1I50 H;  3KYH C;  2NN6 I;  3W1B A;  3PIP A;  2BA0 A;  1EYG A;  4TVA B;  2OWO A;  1XMO Q;  2IX0 A;  4LF8 Q;  2R92 H;  2GN5 A;  3NEL A;  2E2I H;  3CP0 A;  4EX5 A;  1C7Y A;  1I5F A;  4GNX A;  3GTM H;  3ULL A;  3DLL A;  4DUY Q;  4IFD I;  2K52 A;  1X3F A;  4XTC S;  4JI3 Q;  2CKZ B;  5M5Y H;  1P16 A;  1IL2 A;  4JBJ A;  4NXM L;  4LW1 A;  3PIO A;  1JB7 A;  3VDY A;  4IPH A;  3S24 A;  3CCU A;  1VQ6 A;  2K14 A;  2QEX A;  4GLA C;  1DGS A;  4LF7 L;  5C4J H;  1GM5 A;  1GKH A;  4JYA Q;  4LF4 L;  1HNW L;  4A3L H;  1NTG A;  1M1K C;  1Y1W G;  4O0A A;  3TRZ A;  3K81 C;  4IJH A;  4X66 Q;  1VQB A;  5LMU L;  4MTN A;  4BBS H;  4BY7 G;  1Q12 A;  3HOX H;  4KHP Q;  3CCV A;  1VQO A;  3STB C;  2UUC Q;  1V43 A;  1GO3 E;  2OCE A;  2L15 A;  3JAM c;  4YHH Q;  3ICE A;  4B3S L;  1L2F A;  2Z6K C;  2Q2I A;  1KXL A;  5M3F G;  2K5N A;  4GKJ Q;  2Y0S G;  4IOC A;  2K75 A;  3PUW A;  1EWI A;  4A3D H;  1UE1 A;  1OXX K;  3L0O A;  1ASY A;  1EIY B;  2UU9 L;  2F4V L;  1EIF A;  4JI2 Q;  4AIM A;  3KJO A;  3F2B A;  5IYD H;  4A3E G;  3DM3 A;  2JQO A;  4NXN Q;  2B63 H;  1VQI A;  4K0K Q;  3S1Q H;  1KC8 C;  1BBU A;  3W5O A;  2VUM G;  1PH5 A;  5IWA L;  3K80 C;  1AE3 A;  2KBN A;  1UE5 A;  4P71 A;  1N36 L;  1Q86 C;  5AJ3 Q;  2UXD L;  4LF5 L;  3EN2 A;  1QZG A;  3J7A 5;  1KHI A;  4A3B G;  4UP9 A;  2K5V A;  3RR5 A;  5IP9 G;  4A3K G;  3UE0 A;  5HGQ A;  2HIV A;  1XMQ L;  1MIU A;  5J3B A;  4DAY B;  4A3F H;  1WCM G;  4MZ9 A;  3KF8 B;  4HIK A;  3M4P A;  1AH9 A;  2RF4 A;  2YYZ A;  1X9N A;  4B3R Q;  1VQM A;  4AYB G;  1SFO H;  1S40 A;  4QY7 A;  2UUA Q;  1SLJ A;  1A8V A;  4YCV A;  4QJF A;  3J81 c;  4GNX C;  1PH2 A;  3RN2 A;  4JI0 L;  3S17 H;  2WB1 G;  1XPO A;  1ASZ A;  1MKH A;  2R93 G;  4A3C G;  4EQ5 A;  4X62 Q;  4QQB X;  4J15 A;  4LF9 L;  1L1O B;  1G51 A;  2K5H A;  2KHJ A;  2I5M X;  2MNA A;  4HIM A;  1EQQ A;  4JBW A;  2HHH Q;  2NVT H;  4DR4 Q;  1HNX L;  2XTI A;  3TRE A;  4GKK L;  1X54 A;  1KRT A;  3L2P A;  3CCL A;  1S72 A;  4GN3 B;  3CD6 A;  1PH7 A;  4OWW B;  3PV0 A;  1EOV A;  4JI5 Q;  1S3O A;  1K8G A;  4XIG S;  2NN6 G;  3A74 A;  4PMW A;  3I7F A;  3MEF A;  5M3M G;  2Q2H A;  4IPD A;  4GN4 B;  4POG A;  1I94 L;  3S1R H;  1VQF A;  4UP7 A;  4Y7N H;  3HOY G;  2RHQ B;  5H1S E;  2JEA I;  3HOZ H;  1HZC A;  5C4X H;  4NXM Q;  1VQK A;  1WI5 A;  4IFD G;  3AFQ A;  3KDF A;  3UDX A;  3H15 A;  1KL9 A;  2R7D A;  4AQY L;  2R92 G;  3GDE A;  3M4O H;  4IOA A;  2CFM A;  2HIX A;  4LF7 Q;  1GD7 A;  4LF8 L;  1PH6 A;  4DV3 L;  1B70 B;  1L1O A;  4JCV E;  5IT9 c;  4KHZ A;  3OTO L;  3CPF A;  1TWG H;  1X55 A;  4LF4 Q;  3PO2 G;  1I6H H;  1SRU A;  2E8G A;  5LMU Q;  3RLO A;  3RZO H;  2OTJ A;  2AWN A;  3KOJ A;  4A3M H;  3M7N A;  4YY3 L;  2EIF A;  3HOU H;  1N32 L;  4JG2 A;  5C3E G;  1J5E L;  1XNR L;  4DR5 L;  2VL6 A;  4GNX B;  4B3S Q;  3HOV G;  3S1M H;  4X65 L;  2N8N A;  4A3L G;  5M5W H;  1PH9 A;  1IBL L;  1IBM L;  4WJ4 A;  1Q1E A;  4A4I A;  1K83 H;  2UXB L;  1X3G A;  4OON A;  4A3I H;  4BBS G;  2A1A A;  3HOX G;  3PSI A;  4O2D A;  3CXC A;  4LFA L;  3CPW A;  2HT1 A;  2JE6 I;  1RIP A;  1Q82 C;  4FDB A;  2UU9 Q;  4X6A H;  2UUC L;  4LUV A;  3RLN A;  3PF5 A;  1R9T H;  4B3M L;  2BH2 A;  4A76 A;  4AH6 A;  3UDG A;  3U50 C;  5C44 H;  1FVI A;  4R1J A;  2KHI A;  3W1G A;  2B29 A;  1YBY A;  4IFD J;  3K8A A;  4X64 L;  5IWA Q;  4IJL A;  4A3D G;  1OXS C;  2A19 A;  3H0G H;  3GO5 A;  3K7U C;  1QVG A;  4JV5 L;  2UXD Q;  4Y52 H;  2CWA A;  5IYD G;  4OXP A;  4LF5 Q;  2IX1 A;  5JJL A;  2B63 G;  3UDI A;  1LTL A;  2D0P A;  1HR0 W;  1HZB A;  3CCM A;  1OXT A;  1XMQ Q;  1SR3 A;  4JI6 L;  1VQH A;  4L5Q A;  2NZO A;  5EAY A;  4DV1 Q;  1NY4 A;  3UDF A;  4R4T A;  1UWV A;  2ZJP A;  3ER0 A;  3IRB A;  3FKI H;  5IP7 H;  2VS1 A;  1K8A C;  1HNZ L;  4PZ6 A;  1MJC A;  3T1H Q;  4JBM A;  1TWA H;  5M5X H;  5LMN Q;  2VNU D;  2GVA A;  1SE8 A;  3F1Z A;  4A3F G;  1Q8K A;  1U5K A;  4DKA C;  2V1C C;  3D31 A;  4QL5 A;  4L5T A;  2ALY B;  2CQO A;  4HJ7 A;  4JI8 L;  2IY5 B;  3PUX A;  4HJ5 A;  4A93 H;  3E9I A;  4GKK Q;  4OO1 I;  1L1O C;  4DV7 L;  2JA8 H;  2LXK A;  3A0J A;  4DR2 L;  1XTD A;  1X65 A;  3ZJY C;  2H5X A;  3I56 A;  3U58 A;  1K0R A;  4OX9 L;  3BZK A;  1QVC A;  4DV5 L;  1HH2 P;  1PH8 A;  4DR3 L;  4GS3 A;  5FLM H;  1I94 Q;  2VQF L;  1N33 L;  1E22 A;  1SMX A;  1VQD A;  1EFW A;  4GOP A;  2VY3 A;  2WAQ G;  1FL0 A;  1X56 A;  1VQN A;  2JA5 H;  1FJG L;  3EIV A;  2DGY A;  4AQY Q;  5ELO A;  2NVX H;  2ASB A;  2UXC L;  2Y0S E;  1YHA A;  3PGZ A;  4DV2 L;  1VQ7 A;  2Q2U A;  4DV6 L;  1CUK A;  5BR8 L;  1CKN A;  1E1T A;  3OTO Q;  1VQA A;  2HQL A;  4DV3 Q;  3TS0 A;  4DR6 L;  2E5L L;  4A3J H;  2JA6 H;  3HOZ G;  1CKO A;  5C4X G;  3GTK H;  1Y1V H;  2AHO B;  4DUZ Q;  1N32 Q;  1VCI A;  3CMA A;  4QIW E;  1J5E Q;  1XNQ L;  3I4N H;  4TQU S;  3G4S A;  1XNR Q;  3S14 H;  4DR5 Q;  3AFP A;  1MJE A;  4X65 Q;  3RZD H;  4LFB L;  1IBL Q;  3Q8D A;  3I55 A;  3HFZ B;  1K73 C;  2UXB Q;  1JJG A;  2YTY A;  1NBW A;  4LFC L;  4GLX A;  1IXR A;  3CQZ H;  4LFA Q;  4C3I H;  3HKS A;  4PZ8 A;  3KDF B;  3OW2 A;  1J6Q A;  1UEB A;  4A3M G;  3HOU G;  2RCN A;  5ELN A;  5JJI A;  3I4M H;  1PVO A;  1CSQ A;  4DPG A;  3PF4 A;  3STB D;  1KRS A;  5IYB H;  2OTL A;  2NVY H;  4HJ9 A;  1Q1B A;  1M90 C;  5IYC G;  2ZTE A;  5IY0 A;  1HNW Q;  4C3H H;  1RL2 A;  3JAM i;  3AQQ A;  3AEV A;  5GAD C;  4JI7 Q;  1YEZ A;  2N3S A;  5GQO A;  4X64 Q;  4A3I G;  2GVB A;  2PQA A;  4UP8 A;  1WFQ A;  4OWT B;  2R7Z H;  4DK6 C;  3G71 A;  4B3T L;  3HOW H;  4AYB E;  1EUJ A;  1JT8 A;  1Q46 A;  1N8R C;  3GD7 A;  3PUV A;  4POF A;  4LUZ A;  3M3Y H;  2E2J H;  2WB1 E;  4IO9 A;  2E2H H;  3KFU A;  3FP9 A;  1JJ2 A;  4JI6 Q;  2QGQ A;  2ATW A;  3J7Z C;  2QA4 A;  3H0G G;  4DR7 L;  5FJ8 H;  3RNU A;  2LSS A;  3GTL H;  2KCT A;  1A0I A;  2CWP A;  1VQ4 A;  3RN5 A;  4R4C A;  1E7Z A; 
#chains in the Genus database with same CATH topology
 1F77 A;  1KAA A;  1TQO A;  1EY7 A;  4F7X A;  4K5X A;  1YNX A;  1KIX A;  1EZ6 A;  1SYF A;  2J0T D;  3F8T A;  4JI8 Q;  2F0E A;  5JAV A;  5IP7 G;  1ZEQ X;  1DZ1 A;  4DR1 L;  4NXN L;  3M4Q A;  2QIL A;  1JCK B;  3RMH A;  5IGE A;  4XT3 B;  1K3B C;  4GLV B;  1C8C A;  3GTP H;  1K0S A;  2ZM6 L;  4OO1 G;  1YJW A;  3GTQ B;  5ELE A;  4JC0 A;  1VDZ A;  1LTT D;  3GTK B;  4C1N I;  5IIF A;  1BNZ A;  5BN4 A;  5GAE C;  5K5P A;  3D0F A;  3TS2 A;  2PMZ E;  3E9H A;  4K8J A;  3RZD B;  4PZ7 A;  1KQS A;  2MO1 A;  3GTG H;  1SMY C;  1BOS A;  1EWH A;  2O2L D;  1V1P A;  1G8Z D;  4RGO S;  5L37 A;  1H95 A;  4IPG A;  2PO4 A;  2A73 B;  2XSC A;  4RG1 A;  2JK8 A;  2A74 C;  4A3J G;  3BU2 A;  4BA1 I;  4HID A;  1N33 L;  5IT9 L;  1BF4 A;  1GJX A;  2MPM A;  2YTV A;  1DD2 A;  2PPB C;  4OWX B;  2MO0 A;  1G2T A;  1OXV A;  1YNN C;  3EFX D;  4A3G H;  1VQ5 A;  3GTL B;  3PO2 H;  1YIT A;  1HXY D;  3ERS X;  3A5U A;  4C3I G;  2PNH A;  4A3E B;  4BY1 H;  4B3T Q;  1EY6 A;  2VW9 A;  3I4M G;  1B3A A;  5IYB G;  1SRO A;  1STB A;  2Z4H A;  5DLQ E;  1PA6 A;  5JPN C;  5D14 A;  2AQ2 B;  1G6Z A;  1QVF A;  1TWC H;  1R4P B;  2A8V A;  2R7Z G;  3HOW G;  1U0L A;  1V9P A;  1GUO A;  1QUQ B;  2FJ2 A;  3J81 j;  3LGJ A;  2JSO A;  4BXX H;  2D0O A;  2EQS A;  4DAM A;  2JA7 H;  4MHE A;  1GVP A;  5EPK A;  4GZY C;  4DV0 L;  2KEE A;  4YY3 Q;  3T1Y L;  1H9K A;  1KD1 C;  3NTK A;  2PI2 A;  1B9M A;  4JVZ A;  1T5X D;  4LNQ A;  1A3V A;  1IBM Q;  5DM6 3;  2WAC A;  3I4O A;  4NB3 A;  3BJU A;  4YCW A;  1KLU D;  1XYI A;  1XMO L;  1QUQ A;  2NYZ D;  1EEI D;  2DNC A;  2M2L A;  1STE A;  1KAB A;  1HTP A;  4JI3 L;  4BY7 H;  1C0A A;  5M3M B;  5G3L F;  2B3G A;  1YJ9 A;  1RTO A;  1IZ6 A;  2F0Q A;  4JW0 A;  4XQJ A;  1PFN A;  2AQ1 B;  2ZJQ A;  2BA1 A;  4JYA L;  4BBR G;  2LMC B;  1BVS A;  1TXY A;  1JOK A;  2RDF A;  4X66 L;  1CM9 A;  1EY9 A;  2RVL A;  4H7B A;  3SGI A;  3GTM B;  4A3G B;  4KHP L;  2A6E D;  3PO2 B;  5BN5 A;  1B7Y B;  3BZC A;  4YHH L;  3SE0 A;  3K58 A;  1O78 A;  1UEA B;  1IYJ B;  1PMR A;  2YTX A;  1VF5 C;  3T53 B;  5E7N A;  1TT2 A;  2PMZ B;  1AE2 A;  2WKD A;  1CZG A;  1FNU A;  3GV6 A;  4KKU A;  3QOL A;  3CC2 A;  3PUY A;  5C0X G;  3KF8 A;  3NEM A;  4L5R C;  1MGS A;  2RBM A;  5E4W C;  4KMU C;  3CC4 A;  4ZLT F;  1WYD A;  2DJG C;  4EVO A;  3OOC A;  2KUM A;  1Y69 U;  2SEB D;  1XTC D;  5TSS A;  2JA7 B;  4KY6 A;  4DV4 Q;  2EYL A;  4P73 A;  3M85 A;  1PH1 A;  4WJ3 M;  1RTN A;  3IAY A;  4DV5 Q;  3RUZ A;  2VQF Q;  1NCV A;  5I6Y A;  1GUW A;  3H6M A;  4HIO A;  1Q7Y C;  2B63 B;  4HSP A;  4CHT B;  1JE5 A;  4A3C H;  3IL8 A;  1RCV D;  1U4R A;  1STG A;  3KK7 A;  4JBK A;  2EYF A;  4DV6 Q;  3PUZ A;  1ICF B;  3I90 A;  2Q2T A;  1LLR D;  1FD7 D;  1VQJ A;  3QR8 A;  1IBK Q;  2F0L A;  4DAP A;  4YIJ A;  1YIJ A;  4LF6 Q;  3A54 A;  1Z6H A;  1GXD C;  4A3F B;  4YWL A;  2NN6 H;  2K33 A;  2JXM B;  2F0O A;  1DOL A;  2ZXP A;  4KV6 A;  4HCS A;  2NN6 I;  3PIP A;  2QKI C;  4TVA B;  2IX0 A;  4PV1 C;  2R92 H;  4PQX A;  1PZJ D;  5CBA E;  2E2I H;  1AEX A;  2F1M A;  2K52 A;  5EQ0 A;  4HAE A;  2B39 A;  2CKZ B;  3KLS A;  4L8J A;  4XTC S;  4JBJ A;  3MFY A;  1FGB D;  4LW1 A;  1VQ6 A;  4PMB A;  4ABN A;  5EKK A;  5JPM C;  1GM5 A;  3C2P A;  2ENB A;  4LF4 L;  1HNW L;  1NTG A;  4BBS H;  1Q12 A;  1HUM A;  1SMY D;  2SOB A;  3X3N A;  3CCV A;  2UUC Q;  3STB C;  2L15 A;  3DWA A;  2Z6K C;  2Q2I A;  2K03 A;  4IOC A;  1F2L A;  3L0O A;  1ASY A;  1IKL A;  2F4V L;  3SVM A;  1A2T A;  1LV9 A;  4A3E G;  2JQO A;  4NXN Q;  1VQI A;  4K0K Q;  1TVX A;  3W5O A;  3DMU A;  5ELB A;  2VB3 X;  1X3Q A;  2FMM A;  1AE3 A;  2KBN A;  1FR3 A;  4P71 A;  3S9W A;  1K83 B;  3NBI A;  4A3I B;  1PTO F;  2G9H D;  4XYQ A;  1YNN D;  4ZCK A;  1XMQ L;  4DAY B;  3OWE B;  4HIK A;  5D65 A;  4FYD A;  2DJF C;  2B2W C;  4ILW A;  1S40 A;  1QNU A;  1SLJ A;  1A8V A;  4YCV A;  4JI0 L;  3RN2 A;  3S17 H;  2E2I B;  1MKH A;  5DNF A;  1CQF A;  4EQ5 A;  3FMC A;  5FO8 B;  2RKS A;  1L1O B;  2KHJ A;  3BZD B;  2XTI A;  4C3J G;  1KRT A;  1ENF A;  1WD0 A;  4GN3 B;  2AUJ D;  3O13 A;  3QOJ A;  1S3O A;  1K8G A;  2DNE A;  3HS0 C;  3NQI A;  3X3M A;  5M3M G;  3PIP 3;  3W2D A;  4GN4 B;  4Y7N H;  5H1S E;  2JEA I;  3KDF A;  3H15 A;  1KL9 A;  2R7D A;  1O7L A;  2CFM A;  1GD7 A;  1L1O A;  3OTO L;  4JCV E;  3AB9 A;  1X55 A;  3PO2 G;  1I6H H;  3U9S A;  5LMU Q;  3KOJ A;  2K5W A;  1SE2 A;  1LT3 D;  2A68 C;  1K28 A;  1IHZ A;  1GOZ A;  4WJ4 A;  5FLX E;  4OON A;  2A1A A;  3CXC A;  3K5M A;  1RIP A;  4N8X 1;  4XDX A;  2UUC L;  1R9T H;  2G5D A;  2BH2 A;  4A76 A;  4R1J A;  3I4N B;  2EE1 A;  1AZP A;  3S14 B;  4X64 L;  5IWA Q;  4LAA A;  3Q23 A;  4LF5 Q;  2IX1 A;  5JJL A;  4HMI A;  2B63 G;  2K5D A;  5A2Q L;  1LTL A;  2O5J C;  1SYE A;  1KNA A;  2NZO A;  5FOB B;  1SEB D;  1NY4 A;  2JP1 A;  1KNE A;  4R4T A;  1F2Y A;  1UWV A;  3IRB A;  5IP7 H;  3MXG A;  3IFT A;  4PZ6 A;  3C3L A;  5M5X H;  2VNU D;  5BN3 A;  4A3F G;  3D31 A;  5C5L A;  3CU7 A;  4OO1 H;  2ALY B;  4JI8 L;  4CJ0 B;  2WII B;  1EEF D;  1S4Z A;  2K28 A;  4GKK Q;  4OO1 I;  2M9V A;  4DV7 L;  2LXK A;  2XRQ D;  4KD3 A;  3JAM E;  1XTD A;  1IL8 A;  2HDM A;  3I56 A;  1Y8P B;  1I6H B;  1HRJ A;  4GS3 A;  5FLM H;  1I94 Q;  1QNK A;  5T1G A;  2IJ0 A;  1WTP A;  1FL0 A;  2JA5 H;  4RKL A;  2NVX H;  2UXC L;  3Q0A A;  4LF8 Q;  2KA7 A;  5E4X A;  4A3J H;  3GTO B;  1PRT C;  4UDU C;  2AHO B;  1E2Z A;  3CMA A;  4X3K A;  4QIW E;  1ICW A;  3ERQ A;  4TQU S;  1SXT A;  1XNR Q;  3OMC A;  4FXG C;  4WRD A;  1H9R A;  1WTW A;  4X65 Q;  4KJO A;  3HEJ A;  3HFZ B;  4J1M A;  4LFA Q;  1BQQ T;  4C3I H;  4DGZ A;  4A3M G;  3I4M H;  3STB D;  5IYB H;  2OTL A;  4F87 A;  3OPO A;  1PDQ A;  3MAQ A;  2P5Z X;  2CQA A;  4A3I G;  2GVB A;  2PQA A;  2R7Z H;  4B3T L;  3TZU A;  3HOW H;  4FP5 D;  2Q8T A;  1EUJ A;  1I4Q A;  3LNN A;  2B2T A;  3S2H B;  3KFU A;  3CKI B;  3FP9 A;  2ATW A;  2QA4 A;  2B2U C;  4KHV A;  3HGB A;  2KCT A;  1VQ4 A;  4DK3 C;  3NWS A;  3IKJ A;  4I7Z C;  1JJC B;  2NB0 A;  1PRT B;  4KD4 A;  1NMG A;  1W6K A;  2MHV A;  4P75 A;  1C9O A;  4OGQ C;  5EBD A;  4CBV A;  4WFN 3;  1F9P A;  4JOI A;  1VQL A;  2F0H A;  2L0C A;  2VZA A;  2LXJ A;  2JA5 B;  1AW7 A;  2NVX B;  3J80 L;  1MHW C;  4WJW A;  5KYL A;  1Y14 B;  2F3I A;  2F4V Q;  4CDD C;  2JA9 A;  1KDA A;  4DR3 Q;  1UAP A;  4RCN A;  1UE6 A;  4DNR B;  1YVC A;  4BBR H;  1G91 A;  5IOD A;  3EBE A;  1LTI D;  2IT1 A;  2R93 H;  4XYO A;  5FLX c;  4FF1 A;  2AKW B;  1ESF A;  1PYS B;  5BR8 Q;  3CRK C;  1W2B A;  4GN5 A;  4Q0F A;  2ZJR A;  2UUA L;  1TWH H;  1TY2 A;  1EQR A;  4DNI A;  5C0X H;  1VS0 A;  2HHH L;  2IHE A;  1PV4 A;  2I5L X;  1YJN A;  2B2V C;  2K32 A;  2R7Z B;  3KF6 A;  4LFC Q;  2KED A;  3NQT A;  1XJV A;  4JI0 Q;  1Y8O B;  4RCO A;  1IYV A;  4G4K A;  5C0X I;  1Q90 A;  3I3C A;  4LUO A;  2KEC A;  3I4N G;  1FNW A;  2A68 D;  3EA6 A;  5M3F B;  2EXD A;  4CKB A;  2EY5 A;  3NXW A;  2K50 A;  5GAG C;  3SK5 A;  5C4H A;  1J9O A;  3CAM A;  3D4R A;  1JE4 A;  2J7Z A;  2L55 A;  4KY5 A;  4RWS C;  1CQV A;  5HY6 A;  2DUD A;  5JVG 3;  4QIW B;  3TQY A;  5C3E H;  3I70 A;  4DV4 L;  4HR7 B;  4ME3 A;  5ISR A;  5GAH C;  1FGU A;  2IHF A;  3OYY A;  4L5S A;  1B8A A;  3K0X A;  3D6W A;  3CCS A;  1BCP B;  5JEA J;  2JYO A;  3GTQ H;  1QJO A;  2OXP A;  3OMG A;  1BR9 A;  2F0W A;  1KDB A;  2A5H A;  3MXU A;  1IBK L;  5KND A;  2PI2 E;  4LF6 L;  1D5M C;  4Q5V A;  4UPA A;  1WTQ A;  2R93 B;  2WAQ E;  1HR0 Q;  3P1H A;  1N34 Q;  2YU9 B;  1HA5 A;  1SYB A;  5LL6 X;  1PFM A;  2ID0 A;  4QB4 A;  3C46 A;  3P20 A;  1W3S A;  2Z1C A;  2XWJ B;  2CCZ A;  1V1Q A;  1ML0 D;  1EL0 A;  1MSG A;  2MFI A;  1CFM A;  4DV1 L;  4JI1 Q;  4OEM B;  4KY7 A;  2HCI A;  4IUQ A;  3HOY B;  3G48 A;  1YHB A;  2ZXO A;  4X3U A;  4UY8 C;  3WOF A;  2VQE Q;  1DM0 B;  2XVS A;  1STA A;  4NPS A;  4A3E H;  1IYU A;  5C3E B;  4H0L C;  1PRT D;  4ZKB B;  1XPR A;  5EBC A;  1XPU A;  4G7H C;  3RD4 A;  2JJQ A;  2MP1 A;  1GHJ A;  2F3W A;  2RQX A;  1V1P B;  2OQK A;  4K0K L;  1D7Q A;  1WVL A;  4DV7 Q;  3HKZ G;  1GHK A;  4YWK A;  4G7Z C;  2HD3 A;  4KKS A;  3NEN A;  2UUB Q;  3J81 L;  1FNV A;  5I2X A;  2K01 A;  1TS2 A;  3U4V A;  4M1U B;  3T51 B;  1CSP A;  1VQP A;  1B44 D;  4P74 A;  3H3V H;  4HJ8 A;  3S1Q B;  1SNQ A;  5E3F A;  4APV A;  2UXC Q;  3TP5 A;  3BVZ A;  3VA5 A;  2B8F A;  3A8K E;  4C3J H;  5FLM G;  5CC4 A;  3H3V I;  1K3R A;  1N9W A;  3TP6 A;  3CCE A;  3PCO B;  3ULP A;  2JA5 G;  1WJJ A;  2C9O A;  1VQG A;  3BDC A;  3QO2 A;  2F3V A;  1SYG A;  5M3M H;  4JI7 L;  2R7F A;  3L3O C;  3NBH B;  3URY A;  2F0I A;  2LY7 A;  3KUP A;  1NAP A;  4E6I A;  3VR2 A;  3H3V C;  2EYM A;  3BVG A;  2LFN A;  3NEL A;  2XIW A;  2KQ3 A;  4EX5 A;  3GTM H;  3DLL A;  4DUY Q;  1B3Q A;  1X3F A;  1P16 A;  2R3Z A;  5DM7 3;  1SNC A;  3S24 A;  4NMZ A;  1E2W A;  4ZQ3 A;  1GKH A;  2WAQ B;  3D3R A;  1O7Y A;  1M1K C;  4O0A A;  4RGT A;  3D6C A;  5LMU L;  3NBH A;  1LTA D;  4N9P A;  2C5C A;  1V43 A;  5C4X B;  5M3F G;  4GKJ Q;  3M4O B;  1BCP D;  2K75 A;  3EQL C;  1EWI A;  1ET6 A;  3FRP B;  3A55 A;  3DXJ C;  2WV6 D;  2B63 H;  3BVM A;  4J8Q A;  1S5C D;  3NUC A;  4R9W A;  5IWA L;  3K80 C;  3S1M B;  3G7L A;  1N36 L;  5LL6 S;  1I4X A;  4C3J B;  2PYK A;  1Q86 C;  5AJ3 Q;  1SJH D;  3NE5 B;  3EN2 A;  4LF5 L;  1CA5 A;  4UP9 A;  2K5V A;  3RR5 A;  5IP9 G;  3UE0 A;  5HGQ A;  2HIV A;  1MIU A;  4A3F H;  4DAV A;  1TY0 A;  1A2U A;  1EYA A;  2PZT A;  3KF8 B;  3M4P A;  5ELF A;  1X9N A;  2YYZ A;  4B3R Q;  2FIN B;  3BS1 A;  2UUA Q;  1EYD A;  1PH2 A;  1XPO A;  1ZKO A;  1ASZ A;  2R93 G;  5CV6 A;  4J15 A;  3PQI A;  4RGM A;  2K5H A;  4DR4 Q;  2HHH Q;  2NVT H;  1S5B D;  4GKK L;  3CCL A;  5IOC A;  5C3X A;  1ENC A;  3CD6 A;  1F9R A;  3LX0 A;  1WTR A;  1PH7 A;  1TWA B;  3PV0 A;  4XIG S;  3A74 A;  3I7F A;  3MEF A;  1RF2 D;  3E6Z X;  2F03 A;  4IPD A;  1I94 L;  1VQF A;  2K04 A;  3HOY G;  5CV5 A;  1HZC A;  4NXM Q;  3LWU A;  4IFD G;  3UDX A;  3GDE A;  4LF8 L;  1PH6 A;  1M4V A;  1B70 B;  1BUV T;  4KHZ A;  3CPF A;  1TWG H;  4K5W A;  3SEB A;  1KDC A;  1SRU A;  2E8G A;  2OTJ A;  4A3M H;  2EIF A;  5C3E G;  1HHV A;  2PQE A;  1TII D;  1XNR L;  4B3S Q;  2SDF A;  2VL6 A;  3J7A F;  4X65 L;  4HN7 A;  2N8N A;  4KN7 C;  5M5W H;  1K83 H;  4K6L A;  4A3I H;  2KCC A;  2NUC A;  1WD1 A;  4LFA L;  2HT1 A;  1STH A;  2UU9 Q;  4B3M L;  4LUV A;  3PF5 A;  1EYC A;  3G6J B;  3U50 C;  2K7V A;  1SBB B;  2V4D A;  5KNC A;  2RA4 A;  2B29 A;  1YBY A;  3K57 A;  3Q24 A;  4IJL A;  4A3D G;  1CZW A;  1OXS C;  1B1Z A;  4IUU A;  1EQT A;  1NR2 A;  4JV5 L;  2UXD Q;  1EIG A;  3DEP A;  2D0P A;  3I8Z A;  3R2I A;  2D2C C;  1HR0 W;  1HZB A;  4L63 B;  3CCM A;  1A6X A;  3E5S A;  5J1Z A;  4L5Q A;  5JVH 3;  2NVT B;  2NWG A;  4C3H B;  3ZYY X;  4DV1 Q;  4FXK C;  1DCZ A;  4DXG A;  2ZJP A;  1C48 A;  4K5V A;  1EU3 A;  1MSH A;  3FPU B;  1HUN A;  2GVA A;  1SE8 A;  2KJX A;  2O4X A;  1D5Z C;  1Q8K A;  1LTB D;  3M3Y B;  2E2J B;  2E2H B;  1O7Z A;  2IY5 B;  3PUX A;  2EY2 A;  2LS0 1;  2EYJ A;  3E9I A;  1L1O C;  5KYI A;  2B2Y A;  4K6D A;  4EQN A;  1X65 A;  4CKC A;  3ZJY C;  2H5X A;  1TWG B;  3BZK A;  1PH8 A;  4V19 0;  4DR3 L;  4A3M B;  3A8J E;  1VQD A;  3TSS A;  4GOP A;  1RJT A;  2WAQ G;  1JOR A;  5ELO A;  5M5W B;  1LAC A;  2HDL A;  1CUK A;  2MUY A;  1CKN A;  5BR8 L;  4X3S A;  1VQA A;  4DV3 Q;  1QCB D;  1D1I A;  3GV3 A;  3HOZ G;  3BDO A;  1CKO A;  1ET9 A;  1F2Z A;  5C4X G;  1STY A;  1Y1V H;  1N32 Q;  1VCI A;  1J5E Q;  3I4N H;  2CVR A;  3VR5 A;  3S14 H;  4ZK9 B;  1EU4 A;  4CGY B;  4LFC L;  3CQZ H;  4RHR A;  4QUF A;  3KDF B;  3HOU G;  2RCN A;  5ELN A;  5JJI A;  5I6W A;  3PF4 A;  4K2K A;  2I07 B;  4HJ9 A;  1G2S A;  5IY0 A;  3T13 A;  5FKA C;  1RL2 A;  5E1F A;  5GAD C;  4JI7 Q;  1ILP A;  2X6G A;  4UP8 A;  4DA2 A;  2QEJ C;  4DFA A;  4DK6 C;  2CH4 W;  3GD7 A;  3R8B A;  1SE4 A;  4MN3 A;  3DHQ A;  4IO9 A;  5CBE E;  4KTA A;  3MXN A;  4HMJ A;  2MJ8 A;  1JJ2 A;  3J7Z C;  3H0G G;  4WOR A;  3RNU A;  1QG7 A;  4NDX A;  4BS9 A;  2PZW A;  4R4C A;  1BDO A;  5EAY A;  2BDO A;  1ZXT A;  1G29 1;  3SHL A;  1H9J A;  1HQM C;  3AYH B;  3FHW A;  1QZH A;  3FDT A;  1QOH A;  3A8I E;  4Z9C B;  4YWM A;  5K36 G;  4K8I A;  5IT9 E;  3I4L A;  3S2D H;  3ITP A;  3HKZ E;  4N9T A;  4UAI A;  4R4Q A;  3J80 i;  1I3Q B;  1HFG A;  4QCL A;  1HR0 L;  4DR2 Q;  2Z8L A;  3WOE A;  4OL7 A;  3K5N A;  1N34 L;  3QJY A;  1CKM A;  5HGT A;  1EFI D;  3GTO H;  1Y1V B;  2F0U A;  1VQ8 A;  1A63 A;  2FFK B;  1HZA A;  3A7L A;  2JA8 G;  2H4O A;  1N36 Q;  4CJ1 B;  4JI1 L;  2F0G A;  1NMF A;  4DV2 Q;  3CQZ B;  1EY0 A;  5FO7 B;  1CI3 M;  2F0N A;  2JN4 A;  1YI2 A;  1E2V A;  1NR4 A;  2VQE L;  4X62 L;  4M8A A;  1HJP A;  4LFB Q;  4EQP A;  1OXU A;  1RD9 D;  2B2T C;  1ZYR C;  1VQ9 A;  2F0M A;  1G6P A;  3W3A A;  1I4G A;  4QMG A;  5LHY 1;  1YZ6 A;  3S2H H;  1UUP A;  5FK9 C;  1D1K A;  4JI5 L;  4R4O A;  2NZH A;  2SNS A;  2EJM A;  3D4W A;  3CME A;  1NE3 A;  1UE7 A;  3I2Z A;  2UUB L;  2L4N A;  3SXH A;  2VUM B;  4IAL A;  4JOI C;  1LTR D;  4C3H G;  1AFP A;  2FXQ A;  2A6H C;  5IE8 A;  3S2D B;  3AU7 A;  2EJG C;  3H94 A;  1L0W A;  1I4R A;  3MWY W;  4C2M H;  1PHJ A;  2XWB B;  4JI4 Q;  5HUR A;  1PYB A;  3ND8 A;  3K6O A;  1WCM B;  2XNA C;  2PQA B;  2KCM A;  4CDE C;  1PFS A;  2L11 A;  3V96 A;  3CCQ A;  1RKN A;  5FJ8 G;  2EVB A;  1ILQ A;  3M7G A;  4ULL A;  3ULJ A;  3D4D A;  4QUC A;  2E74 C;  4OEL B;  4KI0 A;  1WTO A;  2DY7 A;  3GP7 A;  4B3M Q;  1E1O A;  4DXF A;  2ZTD A;  3J7Y W;  4LK1 C;  4DUY L;  2N49 A;  2SNM A;  1JQY D;  4P2C B;  1TKW B;  1T9H A;  4XQQ A;  2F0K A;  3HRZ C;  4JV5 Q;  3S15 B;  3S1N B;  3HKZ B;  1Z47 A;  3BYY B;  1I50 B;  1PH3 A;  1PRT F;  5M3F H;  2XGT A;  5LMN L;  3TDQ A;  1V8Q A;  3RLF A;  4CDF C;  1ENA A;  1X3E A;  2JEB I;  2ES2 A;  3KLR A;  2OQ0 A;  5C4Z A;  1VQC A;  3NWT A;  4GKJ L;  2RHS B;  1U4L A;  4ZUI A;  1Y8N B;  1NUC A;  1LUZ A;  3B6Y A;  2I0Q A;  1NJI C;  5A35 A;  3OHX C;  4C2M B;  5IP9 H;  2PNR C;  4HCE A;  1C4Q A;  4IPC A;  3J81 i;  3VYT A;  3UE1 A;  5AJ3 L;  3KF6 B;  2Q8R E;  2TMP A;  2QF7 A;  3ONA B;  2F0V A;  1EY8 A;  1XXG A;  4DUZ L;  5JJK A;  1HCZ A;  2DY8 A;  4FNF A;  3OSO A;  4ALP A;  2F52 A;  4ZRZ A;  5IYC H;  2YU9 H;  4B3R L;  1LTS D;  5ELD A;  4A75 A;  1BCP C;  5C0X J;  3F2C A;  1Z9F A;  1CT1 D;  5C5M A;  3SR1 A;  3SK6 A;  5ELC A;  4DR4 L;  3NTH A;  1PXU A;  4UHV A;  1X6O A;  3PMF A;  1NSN S;  1H9S A;  3VYS A;  3HOY H;  3PO3 G;  1Y1V G;  5GRO A;  2M00 A;  3KYH C;  4IFD H;  1EYG A;  2BA0 A;  5T1I A;  2EXZ A;  4IN3 A;  1C7Y A;  1I5F A;  4GNX A;  3ULL A;  4IFD I;  4ME5 A;  3QB3 A;  5CV7 A;  1IL2 A;  4NXM L;  4G7O C;  1JB7 A;  3CCU A;  1CA6 A;  2QEX A;  1GUN A;  4GLA C;  1BCP F;  3Q6S A;  1W6J A;  3VYU A;  5CGK A;  3TRZ A;  1Y1W G;  5KNB A;  3K81 C;  4IJH A;  1VQB A;  4MTN A;  1CK1 A;  5EKL A;  3S1R B;  3ICE A;  1GO3 E;  2CHB D;  3JAM c;  4B3S L;  4KK7 A;  1CHP D;  1KXL A;  1V1O A;  2K5N A;  2OEO A;  2BE5 C;  2L1B A;  4A3D H;  5CR3 A;  2UU9 L;  1EIF A;  4JI2 Q;  4AIM A;  3DM3 A;  2DN8 A;  1ZYR D;  2EPB A;  1KC8 C;  1BBU A;  3S1Q H;  2VUM G;  1F9S A;  1AP0 A;  4MIU A;  1HQR D;  2UXD L;  2NBF A;  3KBG A;  1QZG A;  3J7A 5;  1CTM A;  4ID6 A;  2OT2 A;  2D5D A;  5J3B A;  1WCM G;  2K05 A;  4KJN A;  3NP8 A;  1AH9 A;  3K0Y A;  5KIX A;  2IX3 A;  1VQM A;  1SFO H;  2A6H D;  4MTK A;  4QJF A;  1B4O A;  2E75 C;  1L0Y B;  4X62 Q;  2HUG A;  4XQN A;  4LF9 L;  1G51 A;  1EQQ A;  4JBW A;  1II3 A;  1QWY A;  1HNX L;  1HPC A;  1JWS D;  3FKI B;  2Z4I A;  4C1N K;  5IGB A;  1S72 A;  1XWE A;  1EWC A;  4QF4 A;  1GUG A;  1EOV A;  3U9O A;  4JI5 Q;  5A2Q E;  2Q2H A;  3OW7 A;  4ZAI A;  3HOZ H;  2RHQ B;  5C4X H;  3VYR A;  4V0B A;  3HP3 A;  2O5I C;  3M4O H;  4LF7 Q;  2PW7 A;  4A3D B;  2L9H A;  4DV3 L;  1PYW D;  4NKL A;  3NPP A;  4EQO A;  3RZO H;  2AWN A;  1AZQ A;  3M7N A;  3HOU H;  1N32 L;  1J5E L;  2A69 C;  1ONL A;  1WTH A;  2RDG A;  3S1M H;  3J7A V;  4A3L G;  1PH9 A;  1Q1E A;  4A4I A;  1X3G A;  4C56 C;  3HOX G;  1Q82 C;  3I73 A;  1R4Q B;  4X6A H;  3RLN A;  4AH6 A;  3UDG A;  4IUN A;  5C44 H;  2KHI A;  3W1G A;  2F4I A;  2L5T A;  2A19 A;  3H0G H;  5COY A;  4B9X A;  1SFO B;  1QVG A;  2CWA A;  5IYD G;  3VR3 A;  4H44 C;  1OXT A;  1B50 A;  1VQH A;  5K36 H;  1A15 A;  2KHS A;  1S5D D;  5CV9 A;  1JIC A;  2D9U A;  4KKT A;  3ER0 A;  5D3I B;  4JPB W;  3N52 A;  1TWA H;  4NW2 A;  5LMN Q;  3F1Z A;  1M8A A;  1U5K A;  4DKA C;  2V1C C;  4QL5 A;  3E3X A;  1SNO A;  4L5T A;  4TKO B;  2IPK D;  3HOZ B;  1DYQ A;  2EZV A;  4A93 H;  5FLX L;  3QIA A;  2JA8 H;  3A0J A;  4DR2 L;  1EZ8 A;  4BWG B;  3I72 A;  1TR5 A;  1K0R A;  1SNM A;  3RZO B;  4TRD A;  1QVC A;  1HH2 P;  2WKC A;  3BYT B;  3HOU B;  4DNT B;  1TS5 A;  2Z9H A;  2VY3 A;  2ASB A;  4AQY Q;  4FO2 A;  1B2T A;  2QCP X;  2Y0S E;  3GTP B;  1YHA A;  3EJI A;  4DV2 L;  2HQL A;  2OF1 A;  2JA6 H;  2RDH A;  3TBI B;  4DUZ Q;  3FVQ A;  5C44 B;  2F0T A;  3P7J A;  2FMC A;  3G4S A;  4DR5 Q;  5EJW A;  2EY6 A;  5I9P A;  3H0G B;  4LFB L;  4I65 A;  1IBL Q;  3Q8D A;  3I55 A;  3GTG B;  1K73 C;  2UXB Q;  1D6E C;  1TU2 B;  2YTY A;  3J80 E;  1KTK A;  3HKS A;  4PZ8 A;  4CKE A;  1J6Q A;  1UEB A;  1HFN A;  5F2D A;  1PVO A;  3VR4 A;  4DPG A;  1KRS A;  2NVY H;  1M90 C;  5IYC G;  2ZTE A;  4C3H H;  2EJF C;  2KVM A;  3AQQ A;  3F2U A;  2BE5 D;  1YEZ A;  2N3S A;  5GQO A;  3NTI A;  3JAM L;  4OWT B;  4DF7 A;  4AYB E;  1JT8 A;  1Q46 A;  4POF A;  4LUZ A;  1RDP D;  3M3Y H;  3FPP A;  2E2J H;  2WB1 E;  5EKI A;  3I91 A;  2E2H H;  1D2B A;  4JI6 Q;  5FJ8 H;  3TN2 A;  2B2Y C;  1A0I A;  4A93 B;  1PZK D;  2Q8I B;  3T16 A;  3RN5 A;  2JA8 B;  1LM0 A;  4JI4 L;  4BY1 B;  1HNZ Q;  3C1F A;  3WWV A;  1MD2 D;  4X3T A;  2BH8 A;  1VMC A;  3D8G A;  2MGS A;  4XT1 B;  5I4D A;  1ESR A;  4R4I A;  1HZ9 A;  4GOP C;  1JMC A;  2I5H A;  3R93 A;  1TWC B;  3FKI G;  3TP7 A;  4A3B H;  4A3K H;  3DEO A;  1AN8 A;  2Z0S A;  2R6G A;  5JJZ A;  2KEN A;  2JA6 B;  4OX9 Q;  2IL8 A;  1PFB A;  1Q81 C;  3CCR A;  5CV8 A;  1PZI D;  1KAW A;  1OTC A;  4ODG A;  2LKV A;  1FJG Q;  1HTL D;  4KLK A;  1BXT A;  3BDL A;  1E3P A;  2FHT A;  3MC0 B;  1PH4 A;  4DR6 Q;  2E5L Q;  1NNX A;  3KLS X;  3GTJ H;  2NVY B;  3U4Z A;  3ERO A;  2X69 A;  1XNQ Q;  5FO9 B;  2ZTC A;  4J6H A;  1SNP A;  2I46 A;  3K5L A;  3F2D A;  1QB5 D;  1SAP A;  4BY7 B;  2CH4 A;  1PTO H;  5CMD A;  3OIQ A;  5JEA G;  4GOP B;  1BBW A;  2F0D A;  1F2M A;  5CV4 A;  1JWM D;  2Y0S B;  3R2T A;  4LF9 Q;  1CKN B;  2A69 D;  3BG3 A;  2EYH A;  5EGT A;  1LTG D;  1HNX Q;  2E76 C;  2ZXR A;  1EY4 A;  5IGD A;  2VB2 X;  3K5O A;  2YV5 A;  4IUR A;  2CW0 C;  5D3D A;  1U4M A;  1E24 A;  3TEH B;  3HOV H;  2RCF A;  1X32 A;  4O1N A;  1PTO C;  2K4K A;  4QGU A;  4DR7 Q;  2AMC B;  2QDL A;  2HCC A;  4H02 A;  4RMF A;  4FF3 A;  4A3B B;  1I3Q H;  1JOO A;  3CC7 A;  3OWF A;  4A3K B;  1SSO A;  2MQH A;  2PCF B;  2WP8 J;  3C1E A;  2RSN A;  2QDB A;  4L6T B;  3EVQ A;  5CYU A;  3PO3 H;  3SK4 A;  4RHS A;  3MHB A;  4F88 A;  4AYB B;  1D8L A;  3A5Z B;  4DR1 Q;  3R3O A;  3MXN B;  4PG3 A;  1TS3 A;  2WB1 B;  5IGC A;  5JOB A;  2ZM6 Q;  1B53 A;  2IW3 A;  4OIK A;  3KLW A;  2PW5 A;  1QIL A;  2N78 A;  3J81 E;  1WOC A;  4MNO A;  3GTJ B;  1BKB A;  1VMP A;  3CW2 C;  3M9B A;  4P72 A;  1O7I A;  1GUT A;  1Y1W H;  3MEH A;  3DWP A;  1SE3 A;  1YNJ C;  4RH6 A;  4BA2 I;  1K9M C;  3A56 A;  1PTO B;  1LYL A;  1STN A;  2EYP A;  3S16 H;  3CF5 A;  3J80 c;  5C44 G;  3T1H L;  2TSS A;  2R92 B;  5M9O A;  1MI2 A;  3G6E A;  1Q8I A;  3L9A X;  1VQE A;  5G3L D;  1UNS A;  1BO0 A;  3HG9 A;  4YCU A;  1N33 Q;  4B08 A;  2D62 A;  2VUM H;  5C3W A;  4HJA A;  1P8L A;  3CCJ A;  3HOV B;  4DAY A;  4EGV A;  1LT6 D;  2BOS A;  5EPJ A;  4JI2 L;  5IGG A;  1PLF A;  3KJP A;  4BBS B;  4O42 A;  4R8I A;  2K1B A;  4OIJ A;  2J4X A;  5LMN W;  4LWC A;  3LWE A;  1SN8 A;  2WIN B;  1DOM A;  1TS4 A;  1WCM H;  3JC6 6;  2F0P A;  2Z6K A;  3PO3 B;  1X3P A;  4A3G G;  2X6L A;  4A93 G;  1LAB A;  2ICI A;  3GQB A;  3N6R A;  1A62 A;  3KBX A;  2WFW A;  4BY1 G;  3K59 A;  2C35 B;  4FXD A;  3L7Z C;  3VR6 A;  1K8M A;  4R8N A;  5NUC A;  2NVQ H;  5KEE A;  4DV0 Q;  2AWO A;  3T1Y Q;  3M4Y A;  1EY5 A;  1TWF H;  2PZU A;  1E0B A;  1I4H A;  1Y1W B;  4FF2 A;  4BXX G;  3CRL C;  2EDG A;  2JA7 G;  3K7A H;  1RHP A;  2JA6 G;  1YHQ A;  3S16 B;  2F0S A;  3S15 H;  3S1N H;  1EOT A;  4TSS A;  3E0E A;  4ZYS A;  1I50 H;  3T56 B;  4JK1 C;  3W1B A;  2OWO A;  1A3U A;  2B2W A;  1XMO Q;  2GN5 A;  3S17 B;  4HED A;  3CP0 A;  2EY1 A;  4JI3 Q;  5M5Y H;  4I7A A;  2Z6B A;  3MA2 B;  3MZ5 A;  1DON A;  3PIO A;  3VDY A;  4IPH A;  4U68 A;  4RKB A;  4KN4 C;  2K14 A;  5I9O A;  1DGS A;  4LF7 L;  5C4J H;  4JYA Q;  3VA7 A;  3MVV A;  4A3L H;  1WTX A;  1QE6 A;  2ICE C;  4X66 Q;  4BY7 G;  3HOX H;  3DUZ A;  4KHP Q;  4RAU C;  4Y7N B;  1VQO A;  2N55 A;  2OCE A;  4YHH Q;  1S5F D;  1L2F A;  1O80 A;  4PMC A;  4B9W A;  2K6A A;  2Y0S G;  3NK9 A;  1JOQ A;  3PUW A;  4DN4 M;  1UE1 A;  5I2Y A;  3AMU A;  1OXX K;  1EIY B;  3KJO A;  1XX8 A;  2NZ1 D;  3F2B A;  5IYD H;  3HZX A;  4U67 3;  1SDF A;  4LMQ D;  1IW7 C;  4HSV A;  1PH5 A;  3QG1 A;  2AUK A;  4F8M A;  1A3T A;  1UE5 A;  5IGF A;  2NVQ B;  1I6V C;  1KHI A;  2BDN A;  4A3B G;  1I4P A;  2K5Q A;  1K8O A;  1TWF B;  4A3K G;  1R9T B;  1Z7T A;  1B9N A;  4MZ9 A;  5J22 A;  2CW0 D;  3K7A B;  1J8I A;  4OHJ A;  3TP8 A;  5DEH A;  5KRU A;  2RF4 A;  3DWQ A;  5AFW A;  4AYB G;  1PTO D;  4QY7 A;  4K14 A;  3J81 c;  4GNX C;  3SDZ A;  1MBY A;  2WB1 G;  4A3C G;  1CHQ D;  4QQB X;  1SJE D;  3CHB D;  3WDN A;  2MNA A;  2KOL A;  2I5M X;  2B8G A;  4HIM A;  1D5X C;  5M5Y B;  3IFD A;  1L0X B;  4H13 C;  3TRE A;  2NTS A;  1WTV A;  1X54 A;  3L2P A;  5C4J B;  4OWW B;  5M5X B;  2NTT A;  3E0J A;  2NN6 G;  4PMW A;  1IKM A;  3HOX B;  4POG A;  3S1R H;  4UP7 A;  2ZT9 C;  1VQK A;  1WI5 A;  5EPL A;  4S3S A;  1S5E D;  1SYC A;  3AFQ A;  1HA6 A;  4AQY L;  2R92 G;  4IOA A;  2HIX A;  3FEW X;  3PIO 3;  4DU9 A;  4LF4 Q;  1HNW Q;  1H9S B;  5IT9 c;  4ZKC B;  3RLO A;  4FVM A;  1GUS A;  1YNJ D;  1KLG D;  1T5E A;  4YY3 L;  4JG2 A;  1VF7 A;  1OO9 B;  4LJZ C;  4DR5 L;  4GNX B;  1DJR D;  1LT4 D;  3HOV G;  1IBL L;  1IBM L;  2UXB L;  4HTH A;  4BBS G;  3PSI A;  4O2D A;  3CPW A;  2JE6 I;  1DOK A;  4FDB A;  4A3J B;  3Q22 A;  1JB3 A;  2XN9 C;  2XRS D;  2E2D C;  1FVI A;  2VXW A;  4IFD J;  2G9D A;  1JWU D;  3K8A A;  4DK0 A;  3GO5 A;  3K7U C;  3ND9 A;  4G57 A;  1BBX C;  1DXM A;  4Y52 H;  4OXP A;  4C3I B;  1EQV A;  2IWH A;  2HQE A;  3UDI A;  3I4M B;  1XMQ Q;  1SR3 A;  4JI6 L;  4CJ2 C;  1LO5 D;  4N8F A;  3UDF A;  1SYD A;  3A7A B;  4IQZ A;  3DM1 A;  3FKI H;  3MTS A;  4RA8 A;  4DK1 A;  2VS1 A;  3MFG A;  4NP5 A;  5DAU A;  1K8A C;  1HNZ L;  3HOW B;  1MJC A;  3T1H Q;  4JBM A;  2BCO A;  2EYO A;  4FF4 A;  2CQO A;  4HJ7 A;  4HJ5 A;  3H91 A;  3TME A;  2EOT A;  1LT5 D;  4XXE A;  2B2U A;  2GA4 B;  2H1E A;  3SK8 A;  3TZD A;  5KGU A;  3NHH A;  3U58 A;  1JC7 A;  4OX9 L;  5COR A;  1H9M A;  4DV5 L;  1EIH A;  4IUV A;  2VQF L;  3OIP A;  3MXP A;  1E22 A;  1SMX A;  1EFW A;  1X56 A;  4CDC C;  1VQN A;  1FJG L;  3EIV A;  2DGY A;  2A6E C;  3PGZ A;  4IUT A;  1VQ7 A;  2Q2U A;  4DV6 L;  3TS0 A;  1E1T A;  3OTO Q;  1JR0 D;  4DR6 L;  2E5L L;  1U4P A;  5JEA H;  3QWN A;  4ZUJ A;  3GTK H;  2AQ3 B;  4PNY A;  5C6A A;  4K2L A;  1XNQ L;  4BBR B;  4RGN A;  3AFP A;  1MJE A;  3P75 A;  3RZD H;  1JJG A;  1NBW A;  3T4A C;  4GLX A;  2F0J A;  1IXR A;  3OW2 A;  1Q3L A;  1SND A;  1CSQ A;  1F9Q A;  1U9R A;  2L12 A;  3UI2 A;  3V2T A;  1TWH B;  1Q1B A;  2R61 A;  5J39 A;  2RSO A;  3JAM i;  3AEV A;  4IZ8 A;  4X64 Q;  2KCN A;  1WFQ A;  1FYC A;  3V05 A;  4IUP A;  3G71 A;  1N8R C;  2B2V A;  4RFB A;  3PUV A;  2F0F A;  1IW7 D;  3NSW A;  2QW7 A;  2QGQ A;  4DR7 L;  1ROD A;  2N88 A;  2LSS A;  3GTL H;  2CWP A;  3H09 A;  1E7Z A; 
#chains in the Genus database with same CATH homology
 1LM0 A;  4JI4 L;  1JJC B;  1HNZ Q;  1G29 1;  3WWV A;  1NMG A;  3AYH B;  3FHW A;  1QZH A;  1YNX A;  1C9O A;  2BH8 A;  4P75 A;  4YWM A;  1KIX A;  5K36 G;  4R4I A;  1HZ9 A;  4GOP C;  1JMC A;  2I5H A;  3F8T A;  4JI8 Q;  3S2D H;  4JOI A;  3FKI G;  5IP7 G;  1VQL A;  4DR1 L;  3HKZ E;  4NXN L;  3M4Q A;  4A3B H;  4R4Q A;  3J80 i;  2VZA A;  2LXJ A;  4A3K H;  4GLV B;  1HR0 L;  3GTP H;  4DR2 Q;  2ZM6 L;  1Y14 B;  2Z0S A;  1YJW A;  1N34 L;  4OO1 G;  1CKM A;  2R6G A;  2F3I A;  2F4V Q;  2KEN A;  3GTO H;  4OX9 Q;  4JC0 A;  2JA9 A;  4DR3 Q;  1VQ8 A;  1A63 A;  1UE6 A;  5GAE C;  1YVC A;  1Q81 C;  4BBR H;  3CCR A;  1HZA A;  2JA8 G;  1KAW A;  3EBE A;  2IT1 A;  3D0F A;  2PMZ E;  1OTC A;  3TS2 A;  3E9H A;  1FJG Q;  2R93 H;  1KQS A;  4PZ7 A;  4KLK A;  2MO1 A;  1N36 Q;  3GTG H;  5FLX c;  2AKW B;  4JI1 L;  1NMF A;  1E3P A;  1PYS B;  4DV2 Q;  5BR8 Q;  1W2B A;  4GN5 A;  1PH4 A;  2ZJR A;  4DR6 Q;  2E5L Q;  2UUA L;  1YI2 A;  1H95 A;  3GTJ H;  4IPG A;  1TWH H;  3U4Z A;  2VQE L;  1EQR A;  4DNI A;  1XNQ Q;  4X62 L;  2ZTC A;  3F2D A;  1VS0 A;  1HJP A;  2IHE A;  1PV4 A;  2HHH L;  2I5L X;  1YJN A;  4LFB Q;  4A3J G;  1OXU A;  2JK8 A;  3KF6 A;  4RG1 A;  3BU2 A;  4BA1 I;  4HID A;  1VQ9 A;  1XJV A;  5JEA G;  4JI0 Q;  4GOP B;  4LFC Q;  1BBW A;  5C0X I;  1G6P A;  4LUO A;  2YTV A;  3I4N G;  4OWX B;  1YZ6 A;  3S2H H;  2EXD A;  2MO0 A;  4LF9 Q;  1OXV A;  1CKN B;  2K50 A;  4JI5 L;  5GAG C;  4R4O A;  2NZH A;  1HNX Q;  3CAM A;  4A3G H;  1VQ5 A;  3PO2 H;  1YIT A;  3ERS X;  5HY6 A;  3A5U A;  2DUD A;  2PNH A;  2YV5 A;  4BY1 H;  4B3T Q;  3CME A;  3TQY A;  1NE3 A;  5C3E H;  2VW9 A;  1UE7 A;  3I2Z A;  4DV4 L;  2UUB L;  5IYB G;  1E24 A;  1SRO A;  3I4M G;  1PA6 A;  5DLQ E;  3TEH B;  4ME3 A;  3HOV H;  5GAH C;  4JOI C;  2FXQ A;  2K4K A;  1FGU A;  2IHF A;  1QVF A;  3OYY A;  1TWC H;  5IE8 A;  4L5S A;  1B8A A;  4QGU A;  4DR7 Q;  2AMC B;  2A8V A;  3K0X A;  2R7Z G;  3HOW G;  1U0L A;  1V9P A;  4H02 A;  1QUQ B;  4RMF A;  1I3Q H;  1L0W A;  4C2M H;  3CC7 A;  3CCS A;  3J81 j;  1PHJ A;  2WP8 J;  2MQH A;  3LGJ A;  4JI4 Q;  4BXX H;  1PYB A;  2D0O A;  5JEA J;  2EQS A;  4DAM A;  2JA7 H;  3GTQ H;  2PQA B;  2KCM A;  1GVP A;  1PFS A;  3CCQ A;  3PO3 H;  5FJ8 G;  4DV0 L;  1IBK L;  4YY3 Q;  1D8L A;  3A5Z B;  3T1Y L;  1KD1 C;  2PI2 E;  4LF6 L;  2PI2 A;  4DR1 Q;  4UPA A;  3ULJ A;  3MXN B;  4PG3 A;  4LNQ A;  2WAQ E;  1IBM Q;  1HR0 Q;  4KI0 A;  2ZM6 Q;  3I4O A;  4NB3 A;  3BJU A;  1N34 Q;  4YCW A;  3KLW A;  2N78 A;  4B3M Q;  1E1O A;  1XMO L;  1QUQ A;  2ID0 A;  1WOC A;  4MNO A;  1BKB A;  2ZTD A;  3CW2 C;  3M9B A;  1W3S A;  4P72 A;  2CCZ A;  1O7I A;  4DUY L;  1V1Q A;  2N49 A;  1Y1W H;  4JI3 L;  4BY7 H;  2MFI A;  4BA2 I;  1T9H A;  1C0A A;  1K9M C;  4DV1 L;  4JI1 Q;  2B3G A;  1YJ9 A;  1LYL A;  3S16 H;  4JV5 Q;  1IZ6 A;  3CF5 A;  3G48 A;  3J80 c;  1Z47 A;  1YHB A;  2ZJQ A;  5C44 G;  2BA1 A;  4JYA L;  4BBR G;  4UY8 C;  3T1H L;  1PH3 A;  5M3F H;  2XGT A;  1BVS A;  1TXY A;  5LMN L;  2VQE Q;  4X66 L;  3RLF A;  3SGI A;  4KHP L;  3G6E A;  1X3E A;  2JEB I;  1VQE A;  2ES2 A;  4NPS A;  4A3E H;  1B7Y B;  3BZC A;  4YCU A;  2OQ0 A;  4YHH L;  1N33 Q;  1VQC A;  1IYJ B;  4GKJ L;  2YTX A;  2RHS B;  2D62 A;  5E7N A;  2VUM H;  1AE2 A;  4HJA A;  1P8L A;  3CCJ A;  1XPR A;  1XPU A;  2JJQ A;  3CC2 A;  3PUY A;  3B6Y A;  5C0X G;  1LUZ A;  3NEM A;  2I0Q A;  4JI2 L;  4L5R C;  3KJP A;  1NJI C;  3CC4 A;  2OQK A;  1WYD A;  4K0K L;  5LMN W;  5IP9 H;  1D7Q A;  4LWC A;  4DV7 Q;  3HKZ G;  4YWK A;  4IPC A;  1SN8 A;  3JC6 6;  1WCM H;  3J81 i;  3NEN A;  4DV4 Q;  2UUB Q;  1PH1 A;  4P73 A;  3M85 A;  3UE1 A;  2Z6K A;  4WJ3 M;  5AJ3 L;  3KF6 B;  3U4V A;  4DV5 Q;  4A3G G;  4A93 G;  2VQF Q;  1CSP A;  1A62 A;  4HIO A;  1VQP A;  2WFW A;  4BY1 G;  1Q7Y C;  4P74 A;  4DUZ L;  2C35 B;  5JJK A;  3L7Z C;  1JE5 A;  4A3C H;  3H3V H;  4HJ8 A;  4APV A;  4DK3 C;  2UXC Q;  4JBK A;  4ALP A;  2F52 A;  4DV6 Q;  5IYC H;  3PUZ A;  2YU9 H;  4B3R L;  4C3J H;  5FLM G;  2Q2T A;  4A75 A;  3H3V I;  1K3R A;  1N9W A;  2NVQ H;  1VQJ A;  5C0X J;  3F2C A;  4DV0 Q;  1IBK Q;  2AWO A;  3CCE A;  3PCO B;  1Z9F A;  3T1Y Q;  3ULP A;  2JA5 G;  1TWF H;  1YIJ A;  4LF6 Q;  1WJJ A;  1VQG A;  4BXX G;  4DR4 L;  4YWL A;  2JA7 G;  1X6O A;  3K7A H;  5M3M H;  4JI7 L;  2R7F A;  2JA6 G;  1YHQ A;  3NBH B;  3HOY H;  3PO3 G;  3S15 H;  3S1N H;  1Y1V G;  5GRO A;  3E0E A;  1I50 H;  3KYH C;  2NN6 I;  3W1B A;  3PIP A;  2BA0 A;  1EYG A;  4TVA B;  2OWO A;  1XMO Q;  2IX0 A;  4LF8 Q;  2R92 H;  2GN5 A;  3NEL A;  2E2I H;  3CP0 A;  4EX5 A;  1C7Y A;  1I5F A;  4GNX A;  3GTM H;  3ULL A;  3DLL A;  4DUY Q;  4IFD I;  2K52 A;  1X3F A;  4XTC S;  4JI3 Q;  2CKZ B;  5M5Y H;  1P16 A;  1IL2 A;  4JBJ A;  4NXM L;  4LW1 A;  3PIO A;  1JB7 A;  3VDY A;  4IPH A;  3S24 A;  3CCU A;  1VQ6 A;  2K14 A;  2QEX A;  4GLA C;  1DGS A;  4LF7 L;  5C4J H;  1GM5 A;  1GKH A;  4JYA Q;  4LF4 L;  1HNW L;  4A3L H;  1NTG A;  1M1K C;  1Y1W G;  4O0A A;  3TRZ A;  3K81 C;  4IJH A;  4X66 Q;  1VQB A;  5LMU L;  4MTN A;  4BBS H;  4BY7 G;  1Q12 A;  3HOX H;  4KHP Q;  3CCV A;  1VQO A;  3STB C;  2UUC Q;  1V43 A;  1GO3 E;  2OCE A;  2L15 A;  3JAM c;  4YHH Q;  3ICE A;  4B3S L;  1L2F A;  2Z6K C;  2Q2I A;  1KXL A;  5M3F G;  2K5N A;  4GKJ Q;  2Y0S G;  4IOC A;  2K75 A;  3PUW A;  1EWI A;  4A3D H;  1UE1 A;  1OXX K;  3L0O A;  1ASY A;  1EIY B;  2UU9 L;  2F4V L;  1EIF A;  4JI2 Q;  4AIM A;  3KJO A;  3F2B A;  5IYD H;  4A3E G;  3DM3 A;  2JQO A;  4NXN Q;  2B63 H;  1VQI A;  4K0K Q;  3S1Q H;  1KC8 C;  1BBU A;  3W5O A;  2VUM G;  1PH5 A;  5IWA L;  3K80 C;  1AE3 A;  2KBN A;  1UE5 A;  4P71 A;  1N36 L;  1Q86 C;  5AJ3 Q;  2UXD L;  4LF5 L;  3EN2 A;  1QZG A;  3J7A 5;  1KHI A;  4A3B G;  4UP9 A;  2K5V A;  3RR5 A;  5IP9 G;  4A3K G;  3UE0 A;  5HGQ A;  2HIV A;  1XMQ L;  1MIU A;  5J3B A;  4DAY B;  4A3F H;  1WCM G;  4MZ9 A;  3KF8 B;  4HIK A;  3M4P A;  1AH9 A;  2RF4 A;  2YYZ A;  1X9N A;  4B3R Q;  1VQM A;  4AYB G;  1SFO H;  1S40 A;  4QY7 A;  2UUA Q;  1SLJ A;  1A8V A;  4YCV A;  4QJF A;  3J81 c;  4GNX C;  1PH2 A;  3RN2 A;  4JI0 L;  3S17 H;  2WB1 G;  1XPO A;  1ASZ A;  1MKH A;  2R93 G;  4A3C G;  4EQ5 A;  4X62 Q;  4QQB X;  4J15 A;  4LF9 L;  1L1O B;  1G51 A;  2K5H A;  2KHJ A;  2I5M X;  2MNA A;  4HIM A;  1EQQ A;  4JBW A;  2HHH Q;  2NVT H;  4DR4 Q;  1HNX L;  2XTI A;  3TRE A;  4GKK L;  1X54 A;  1KRT A;  3L2P A;  3CCL A;  1S72 A;  4GN3 B;  3CD6 A;  1PH7 A;  4OWW B;  3PV0 A;  1EOV A;  4JI5 Q;  1S3O A;  1K8G A;  4XIG S;  2NN6 G;  3A74 A;  4PMW A;  3I7F A;  3MEF A;  5M3M G;  2Q2H A;  4IPD A;  4GN4 B;  4POG A;  1I94 L;  3S1R H;  1VQF A;  4UP7 A;  4Y7N H;  3HOY G;  2RHQ B;  5H1S E;  2JEA I;  3HOZ H;  1HZC A;  5C4X H;  4NXM Q;  1VQK A;  1WI5 A;  4IFD G;  3AFQ A;  3KDF A;  3UDX A;  3H15 A;  1KL9 A;  2R7D A;  4AQY L;  2R92 G;  3GDE A;  3M4O H;  4IOA A;  2CFM A;  2HIX A;  4LF7 Q;  1GD7 A;  4LF8 L;  1PH6 A;  4DV3 L;  1B70 B;  1L1O A;  4JCV E;  5IT9 c;  4KHZ A;  3OTO L;  3CPF A;  1TWG H;  1X55 A;  4LF4 Q;  3PO2 G;  1I6H H;  1SRU A;  2E8G A;  5LMU Q;  3RLO A;  3RZO H;  2OTJ A;  2AWN A;  3KOJ A;  4A3M H;  3M7N A;  4YY3 L;  2EIF A;  3HOU H;  1N32 L;  4JG2 A;  5C3E G;  1J5E L;  1XNR L;  4DR5 L;  2VL6 A;  4GNX B;  4B3S Q;  3HOV G;  3S1M H;  4X65 L;  2N8N A;  4A3L G;  5M5W H;  1PH9 A;  1IBL L;  1IBM L;  4WJ4 A;  1Q1E A;  4A4I A;  1K83 H;  2UXB L;  1X3G A;  4OON A;  4A3I H;  4BBS G;  2A1A A;  3HOX G;  3PSI A;  4O2D A;  3CXC A;  4LFA L;  3CPW A;  2HT1 A;  2JE6 I;  1RIP A;  1Q82 C;  4FDB A;  2UU9 Q;  4X6A H;  2UUC L;  4LUV A;  3RLN A;  3PF5 A;  1R9T H;  4B3M L;  2BH2 A;  4A76 A;  4AH6 A;  3UDG A;  3U50 C;  5C44 H;  1FVI A;  4R1J A;  2KHI A;  3W1G A;  2B29 A;  1YBY A;  4IFD J;  3K8A A;  4X64 L;  5IWA Q;  4IJL A;  4A3D G;  1OXS C;  2A19 A;  3H0G H;  3GO5 A;  3K7U C;  1QVG A;  4JV5 L;  2UXD Q;  4Y52 H;  2CWA A;  5IYD G;  4OXP A;  4LF5 Q;  2IX1 A;  5JJL A;  2B63 G;  3UDI A;  1LTL A;  2D0P A;  1HR0 W;  1HZB A;  3CCM A;  1OXT A;  1XMQ Q;  1SR3 A;  4JI6 L;  1VQH A;  4L5Q A;  2NZO A;  5EAY A;  4DV1 Q;  1NY4 A;  3UDF A;  4R4T A;  1UWV A;  2ZJP A;  3ER0 A;  3IRB A;  3FKI H;  5IP7 H;  2VS1 A;  1K8A C;  1HNZ L;  4PZ6 A;  1MJC A;  3T1H Q;  4JBM A;  1TWA H;  5M5X H;  5LMN Q;  2VNU D;  2GVA A;  1SE8 A;  3F1Z A;  4A3F G;  1Q8K A;  1U5K A;  4DKA C;  2V1C C;  3D31 A;  4QL5 A;  4L5T A;  2ALY B;  2CQO A;  4HJ7 A;  4JI8 L;  2IY5 B;  3PUX A;  4HJ5 A;  4A93 H;  3E9I A;  4GKK Q;  4OO1 I;  1L1O C;  4DV7 L;  2JA8 H;  2LXK A;  3A0J A;  4DR2 L;  1XTD A;  1X65 A;  3ZJY C;  2H5X A;  3I56 A;  3U58 A;  1K0R A;  4OX9 L;  3BZK A;  1QVC A;  4DV5 L;  1HH2 P;  1PH8 A;  4DR3 L;  4GS3 A;  5FLM H;  1I94 Q;  2VQF L;  1N33 L;  1E22 A;  1SMX A;  1VQD A;  1EFW A;  4GOP A;  2VY3 A;  2WAQ G;  1FL0 A;  1X56 A;  1VQN A;  2JA5 H;  1FJG L;  3EIV A;  2DGY A;  4AQY Q;  5ELO A;  2NVX H;  2ASB A;  2UXC L;  2Y0S E;  1YHA A;  3PGZ A;  4DV2 L;  1VQ7 A;  2Q2U A;  4DV6 L;  1CUK A;  5BR8 L;  1CKN A;  1E1T A;  3OTO Q;  1VQA A;  2HQL A;  4DV3 Q;  3TS0 A;  4DR6 L;  2E5L L;  4A3J H;  2JA6 H;  3HOZ G;  1CKO A;  5C4X G;  3GTK H;  1Y1V H;  2AHO B;  4DUZ Q;  1N32 Q;  1VCI A;  3CMA A;  4QIW E;  1J5E Q;  1XNQ L;  3I4N H;  4TQU S;  3G4S A;  1XNR Q;  3S14 H;  4DR5 Q;  3AFP A;  1MJE A;  4X65 Q;  3RZD H;  4LFB L;  1IBL Q;  3Q8D A;  3I55 A;  3HFZ B;  1K73 C;  2UXB Q;  1JJG A;  2YTY A;  1NBW A;  4LFC L;  4GLX A;  1IXR A;  3CQZ H;  4LFA Q;  4C3I H;  3HKS A;  4PZ8 A;  3KDF B;  3OW2 A;  1J6Q A;  1UEB A;  4A3M G;  3HOU G;  2RCN A;  5ELN A;  5JJI A;  3I4M H;  1PVO A;  1CSQ A;  4DPG A;  3PF4 A;  3STB D;  1KRS A;  5IYB H;  2OTL A;  2NVY H;  4HJ9 A;  1Q1B A;  1M90 C;  5IYC G;  2ZTE A;  5IY0 A;  1HNW Q;  4C3H H;  1RL2 A;  3JAM i;  3AQQ A;  3AEV A;  5GAD C;  4JI7 Q;  1YEZ A;  2N3S A;  5GQO A;  4X64 Q;  4A3I G;  2GVB A;  2PQA A;  4UP8 A;  1WFQ A;  4OWT B;  2R7Z H;  4DK6 C;  3G71 A;  4B3T L;  3HOW H;  4AYB E;  1EUJ A;  1JT8 A;  1Q46 A;  1N8R C;  3GD7 A;  3PUV A;  4POF A;  4LUZ A;  3M3Y H;  2E2J H;  2WB1 E;  4IO9 A;  2E2H H;  3KFU A;  3FP9 A;  1JJ2 A;  4JI6 Q;  2QGQ A;  2ATW A;  3J7Z C;  2QA4 A;  3H0G G;  4DR7 L;  5FJ8 H;  3RNU A;  2LSS A;  3GTL H;  2KCT A;  1A0I A;  2CWP A;  1VQ4 A;  3RN5 A;  4R4C A;  1E7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...