4LWCA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
b'GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lwcA00
4A76A 1N9WA 2EXDA 4QJFA 4JI5Q 3PUYA 1QVFA 1UE5A 3TS2A 2ALYB 4IFDI 3G71A 1LUZA 4B3SQ 3I2ZA 1NBWA 4B3ML 4RMFA 4Y52H 3S1QH 5JEAJ 3BU2A 5FLMH 1JMCA 4A3BG 4A3CH 4P74A 4DV6L 1GO3E 1VQCA 1KQSA 4DV3Q 5C4JH 4NXNQ 1YNXA 1YJ9A 3PUWA 1VQMA 4BY1H 4QQBX 3RNUA 2HHHL 2K4KA 2H5XA 2VQEL 1E3PA 3CMAA 4A3EH 3CPWA 1QVGA 2IX0A 2Y0SE 3H3VH 1IYJB 1V1QA 3CD6A 3S1NH 1V9PA 5DLQE 4ALPA 2YTVA 4PZ6A 1CSQA 2Z6KA 2K14A 3D31A 4X65L 4GLVB 3HOXH 4BBSH 3GTGH 4KHPQ 3ZJYC 2I0QA 4A3LH 3K80C 1X9NA 2K50A 5IP9G 1XMQL 1MJEA 3VDYA 1Q46A 4DV2L 3A0JA 1GD7A 3OTOQ 3A5UA 4DV4Q 1XMQQ 2F4VQ 4DV7Q 2BH8A 5M5YH 3S14H 2UXDL 3U4ZA 2GN5A 3FHWA 1OXSC 1JT8A 1LM0A 3KJPA 2JEAI 5IP7H 3I4NG 5GADC 4DAMA 2WFWA 4JI1L 1SN8A 4APVA 1Z9FA 4MTNA 4A3DH 2ZTEA 4JI1Q 5FJ8G 2Y0SG 3PUXA 3PSIA 4JYAQ 4JC0A 3PO2G 2ES2A 3TEHB 3A5ZB 3STBC 4A3FG 1CKOA 1W2BA 1HNZL 4OONA 4YWLA 3OW2A 4XTCS 1D8LA 1X6OA 1HJPA 4NB3A 3ICEA 4JI7L 4IFDG 3UE1A 2HQLA 4YWMA 1X65A 1UE7A 1LYLA 1VQBA 3FKIH 4JOIA 3S15H 5LMUL 4DKAC 1N36L 3ERSX 1G51A 2HIVA 4LUZA 3NEMA 1EIYB 5M3MG 4GNXC 3D0FA 4DR5L 4LFBQ 4LF5L 2KBNA 1I94Q 1QZGA 4GLAC 4HJAA 3BZKA 3L0OA 2IY5B 5IWAL 3STBD 5GAHC 2VW9A 4TVAB 3I56A 1QZHA 4BXXG 1MJCA 4YWKA 4DR4Q 4DR2L 4LFAL 1GVPA 2D62A 4DR3L 3GTQH 3T1YL 4L5QA 4A3EG 1I50H 4A3IH 3NELA 4DR2Q 3RZOH 5JJKA 1OXVA 3S1RH 1HZ9A 3S2DH 1Q1BA 3PF5A 1Y1WH 2PNHA 5LMNL 3BJUA 4BBSG 4OX9L 1LTLA 1V43A 4JI3L 1PH6A 3HOVG 4DR6L 3B6YA 5LMNQ 2QA4A 4MNOA 3E9IA 2I5LX 3UDXA 1PH4A 1YBYA 1IBML 2UUAL 1N34L 2UUBQ 1HNXL 2LXJA 3M3YH 1IBMQ 2CWPA 1A62A 2JK8A 4KLKA 3RLFA 3T1HL 1B7YB 3GTMH 2EIFA 4OO1I 4AQYL 1HNXQ 1KD1C 1GKHA 3GDEA 1FJGL 3T1HQ 3U58A 4JI0Q 1AE2A 2E5LL 5LMNW 5BR8Q 4YCUA 1MKHA 5EAYA 2OTJA 2KHIA 1ASYA 3DM3A 2A1AA 5GAEC 1E24A 1E22A 3GO5A 4DPGA 3CCQA 2YTYA 4LF7Q 2B63H 3CF5A 4B3TL 2JA6G 1EQRA 1PH7A 2NN6G 4YY3L 2ZTDA 1K83H 1UWVA 2CFMA 2PQAA 5HGQA 4IO9A 3G48A 4LF6Q 2EQSA 3HOWG 3F1ZA 4IFDJ 1PYBA 1JE5A 3LGJA 2E2JH 2AWNA 3CC4A 4K0KQ 4LF9L 1WJJA 2R7DA 2KCTA 5C44G 4X64L 4PMWA 3S24A 4Y7NH 4LF9Q 4XIGS 3EN2A 2N78A 3GTLH 2PQAB 4IOAA 4A93G 4GKKL 4EX5A 2JA8G 3I4MG 3K0XA 2NZOA 4RG1A 4QIWE 1XPRA 3K7UC 4DR1Q 4DV1L 2R93H 5K36G 1JJGA 3M4OH 5JJIA 5AJ3L 4UY8C 3U4VA 5IY0A 2ZJPA 2UXBL 1D7QA 3RLNA 1E1OA 2UU9L 1A63A 2ASBA 4DUYL 3HOYG 4DR7L 1K8GA 4LUOA 1JB7A 3HOUH 3J7ZC 3BZCA 5C0XG 3PO3G 4HIMA 3UDIA 4A3GH 1T9HA 1U0LA 4LFCL 4A4IA 3J81c 4B3MQ 1IL2A 1HNWL 2R6GA 1VS0A 2VZAA 1VQOA 1NJIC 4GOPC 4DV6Q 1SLJA 1VQHA 1FL0A 3CMEA 1VQ7A 5C4XG 2KCMA 5M3FH 4HJ8A 4DNIA 3J7A5 2JA5G 1VQGA 2E8GA 2R7ZG 3HOZH 4FDBA 1Z47A 1PH1A 2HHHQ 3PIPA 2VQEQ 2ZJQA 2GVBA 2Q2IA 1O7IA 2WB1E 4A3MG 1BBWA 4P75A 2JJQA 3ULLA 4X65Q 2NVQH 4JI2L 5IYBG 2NVXH 5JJLA 1N33L 4A3JG 4P71A 4DV2Q 4HJ9A 3CC2A 4P73A 4JBMA 2R92H 1VQJA 2ZTCA 1HZAA 2HT1A 2PMZE 1WCMG 2GVAA 3CPFA 2JQOA 4IPCA 2MO0A 3M7NA 2UXDQ 4DV5L 1OXTA 3ULPA 1UEBA 1E7ZA 1L1OC 3I4OA 3KJOA 1H95A 1YI2A 3A74A 3RR5A 3TRZA 1VCIA 1WI5A 4C2MH 1HNZQ 4R4TA 3J81j 1XTDA 2YU9H 1TWCH 1N32L 1YZ6A 2KENA 4JI7Q 4J15A 1P8LA 2VY3A 4KHZA 5FLMG 4A3CG 5LMUQ 5GAGC 1N36Q 2VUMH 2MQHA 1EWIA 3PIOA 2Q2HA 3GTJH 1KC8C 4DR5Q 4LF5Q 1W3SA 4BY1G 5IWAQ 3HOZG 4JI6L 1TXYA 3CCUA 1CKMA 4ME3A 1VQPA 1OTCA 4LFAQ 1EQQA 2NZHA 2V1CC 4OWTB 4DR3Q 1PFSA 5HY6A 3T1YQ 1KL9A 4DUZL 4WJ3M 1FVIA 3HOXG 3AEVA 4A3LG 3KYHC 1I5FA 4HIOA 2VS1A 2I5MX 2UXCL 3OYYA 3H15A 4LF8L 1K3RA 3IRBA 5H1SE 1PV4A 4JI3Q 4OX9Q 3S17H 4DR6Q 2UUAQ 4LF8Q 2N8NA 3KDFA 1XJVA 1TWHH 2AHOB 1N34Q 3GTPH 4JG2A 4BY7H 4JI8L 1EIFA 3CCSA 4JCVE 1PH2A 2E2IH 2JEBI 4R1JA 2D0PA 4H02A 4YCWA 5IP7G 4JI8Q 4AQYQ 4X66L 3M4PA 4IPHA 1Q81C 1FJGQ 2E5LQ 1HR0L 4A3DG 4X66Q 3M85A 1YEZA 4JBWA 1M1KC 3S16H 5IYDH 1M90C 1IXRA 4IPDA 5M5XH 3CQZH 5IYCH 1YJNA 1YJWA 1RL2A 5GQOA 3E0EA 1IBLL 3HKSA 1A8VA 3KDFB 1Q86C 1NMFA 2BA1A 2XGTA 3F8TA 1FGUA 3CC7A 1QUQA 2IHFA 4AH6A 4P72A 4AYBE 4A3KH 2UUCL 3FKIG 2OQKA 2OQ0A 3KLWA 3TREA 2B3GA 3F2DA 1VQ8A 4B3TQ 4NXML 1C7YA 3W1BA 4OWWB 3WWVA 5JEAG 4YY3Q 1XNRL 4X6AH 3S2HH 2Z6KC 1HR0W 2LSSA 2A8VA 2PI2A 1VQFA 2IHEA 4LF4L 1XNRQ 4JV5L 1PH8A 2RHSB 1XPOA 4IJHA 3GD7A 2C35B 2R7FA 4A3BH 1OXUA 1QUQB 4C3JH 2VNUD 2F52A 4A3IG 4GLXA 4X64Q 4YHHL 4C3HH 1Y1WG 1X56A 1I3QH 1J5EL 3I7FA 2ZM6L 1TWGH 2YYZA 2N3SA 4HJ5A 2JA9A 3UE0A 1J5EQ 4GKKQ 2VQFL 1SROA 4GS3A 3CP0A 1WOCA 3AFPA 3EIVA 1B8AA 2NN6I 4X62L 4DV1Q 1XNQL 4GNXA 1K8AC 1YVCA 2CQOA 3F2CA 1Y1VH 5AJ3Q 4JOIC 2DGYA 5IP9H 3J80c 3U50C 4R4OA 2ATWA 2UXBQ 1VQ5A 2UU9Q 4QY7A 4HIKA 3JAMc 2QEXA 2WAQE 4DUYQ 1XMOL 4DR7Q 4BBRH 2JE6I 4GN5A 1KRSA 4LW1A 3RZDH 4JI4L 4GKJL 1X55A 2K5VA 3EBEA 4B3RL 4OWXB 2B63G 4AIMA 2IX1A 1C0AA 3I4NH 4O0AA 4L5RC 4LFCQ 1HNWQ 1CSPA 1DGSA 4A3KG 1A0IA 4R4QA 3CCRA 2I5HA 3JAMi 2KHJA 1X54A 2MFIA 1UE1A 2K5NA 4GN3B 4JI5L 5FJ8H 1N8RC 3PO2H 1HZCA 1L2FA 4A3FH 4MZ9A 3J81i 2OWOA 5E7NA 4BA1I 3PUVA 1GM5A 1KIXA 4B3SL 1X3GA 3CCLA 1PH3A 2FXQA 4L5TA 5C3EH 3CCMA 2WAQG 2RCNA 1YITA 1IBKL 1EYGA 2ZJRA 4A75A 1PH9A 4DV3L 1S72A 5M3MH 1K0RA 1IBKQ 4NXNL 1Y14B 4JI2Q 2RF4A 4C3IH 5C0XI 1VQDA 1N33Q 4BXXH 2BH2A 1VQKA 2Q2TA 1NE3A 1C9OA 3DLLA 1PH5A 3M4QA 3PGZA 4DV5Q 2R93G 3GTOH 4KHPL 1E1TA 2D0OA 3NBHB 4R4CA 3CCJA 1VQ9A 4HJ7A 2OTLA 2L15A 4JBKA 1Y1VG 3OTOL 3HOVH 2WB1G 3HOUG 1HZBA 1SRUA 3KF8B 2F3IA 4DV4L 4DV7L 2OCEA 1K9MC 2E2HH 2F4VL 4HIDA 4DV0L 4BBRG 4GN4B 1YHAA 1Q7YC 3GTKH 4A3GG 1CUKA 2WP8J 1KRTA 4JBJA 1N32Q 4DV0Q 1G291 2VL6A 3FP9A 1VQIA 3M9BA 1TWAH 3CXCA 1SMXA 1X3EA 3HFZB 3PUZA 1NTGA 3PF4A 2HIXA 3CCEA 5C0XJ 4JYAL 2YV5A 5M3FG 2Q2UA 1S3OA 3G6EA 3H0GH 1L0WA 3L7ZC 2N49A 3PCOB 4EQ5A 1VQNA 1P16A 5IT9c 1JJ2A 1S40A 1IZ6A 2YTXA 2Z0SA 4JI6Q 4KI0A 1K73C 2JA6H 3UDFA 3MXNB 4OO1G 1PHJA 2BA0A 5C3EG 3MEFA 3E9HA 4DUZQ 3S1MH 4IPGA 4NPSA 2MNAA 1SFOH 4LFBL 1AH9A 1PA6A 1I94L 3CAMA 3ULJA 1QVCA 2PI2E 2UXCQ 2B29A 2R92G 3HOWH 1B70B 1BKBA 5ELOA 3TQYA 4DR4L 1PVOA 5M5WH 1MIUA 1YIJA 1G6PA 4GOPA 1EUJA 1SE8A 2AKWB 3ER0A 1UE6A 5C44H 4LNQA 4IOCA 3K8AA 2JA7H 4R4IA 4PZ7A 1RIPA 4WJ4A 1EOVA 4PG3A 4LUVA 4DK3C 1HR0Q 1EFWA 4A93H 1BVSA 1NY4A 3I55A 1VQLA 2JA8H 3I4MH 1WFQA 2UUBL 2A19A 1CKNA 3H3VI 4QL5A 3G4SA 3RN5A 1IBLQ 3K7AH 4LWCA 4DAYB 4BA2I 3RLOA 4GOPB 3AQQA 4IJLA 2UUCQ 4JI0L 5J3BA 4NXMQ 1KXLA 1J6QA 1U5KA 3W1GA 5BR8L 3RN2A 2CWAA 5ELNA 2VUMG 3HOYH 4JV5Q 1KHIA 4LF4Q 2NVTH 2K75A 1X3FA 4PZ8A 3L2PA 2CCZA 3PO3H 2K5HA 1VQEA 4O2DA 3PV0A 2IT1A 1SR3A 4UP7A 1JJCB 2ID0A 3H0GG 1CKNB 3NENA 3SGIA 4LF7L 3KF6A 1L1OA 3HKZE 2DUDA 4L5SA 5FLXc 1I6HH 1NMGA 4UP8A 1BBUA 4UPAA 5C4XH 4YHHQ 2MO1A 3JC66 4AYBG 3TS0A 4TQUS 2JA5H 1Q8KA 4LF6L 2R7ZH 2ZM6Q 1XPUA 1AE3A 2XTIA 4OXPA 3W5OA 2VQFQ 1VQAA 5GROA 4BY7G 4K0KL 2CKZB 3K81C 1Q12A 4UP9A 3CW2C 4POFA 3KFUA 1WYDA 3KOJA 3KF6B 1L1OB 4DK6C 3Q8DA 4A3MH 4X62Q 1YHBA 4QGUA 1XNQQ 2LXKA 2K52A 3F2BA 2AWOA 5IYBH 1Q82C 2JA7G 1YHQA 4A3JH 1VQ6A 5IYDG 3HKZG 1XMOQ 2NVYH 1VQ4A 5IYCG 1KAWA 1WCMH 3AFQA 4DR1L 3UDGA 4JI4Q 4GKJQ 3CCVA 2RHQB 4B3RQ 5IE8A 1Q1EA 4GNXB 3J80i 1R9TH 1ASZA 4YCVA 4POGA 1PYSB 1OXXK 2AMCB 1HH2P 1TWFH 3AYHB 2QGQA
chains in the Genus database with same CATH superfamily
1N9WA 3KLSA 1F77A 1PTOF 3S9WA 2ALYB 4B3SQ 1NBWA 5D14A 1SNCA 2ENBA 1RJTA 3S1QH 5FLMH 4RGOS 2L4NA 1EIGA 3D4WA 3K7AB 4IUNA 1KDCA 1YJ9A 3PUWA 1VQMA 4QQBX 3RNUA 2HHHL 2K4KA 4KN4C 4ZKCB 3Q0AA 2J0TD 1IYJB 4PZ6A 5I6WA 4GLVB 3GTGH 1PFMA 4A3LH 2I0QA 5IP9G 2C5CA 2WACA 5KEEA 3VDYA 1Q46A 1M8AA 1MHWC 4DV2L 3OTOQ 3A5UA 3MEHA 4S3SA 4DV7Q 1EY8A 2BH8A 1A2UA 1B53A 3S14H 3U4ZA 2UXDL 2HQEA 5C4XB 3FHWA 2JA5B 3I4LA 3DUZA 4LK1C 4JI1L 2BCOA 1SN8A 1Y8NB 4APVA 1Z9FA 3MWYW 4DU9A 2VXWA 3C3LA 5AFWA 4HCEA 4XT3B 4JI1Q 3NTHA 2K05A 3PO2G 1W2BA 1HNZL 1X6OA 2EY6A 2RSNA 3KBGA 3UE1A 4L6TB 5FO7B 3FKIH 3BDLA 4WRDA 3ERSX 4R8IA 1G51A 3QG1A 5JEAH 1EIYB 3C2PA 4JK1C 1I94Q 1QZGA 3OSOA 4C3IG 3L0OA 2IY5B 2PPBC 4BXXG 4TVAB 2WKCA 4YWKA 4RH6A 5E1FA 1PFNA 3R3OA 1YNNC 1B9NA 3BJUA 2SDFA 2MUYA 2QA4A 3UDXA 1YBYA 1SAPA 5KNDA 3O13A 2LXJA 1E2ZA 1FNVA 1B7YB 1A6XA 1GKHA 2IWHA 3HOZB 3QOJA 4TRDA 1AE2A 1STHA 1YNND 4YCUA 5EAYA 5C0XH 2E76C 1MD2D 1ASYA 3HOXB 4BBSB 2ZXPA 1SE2A 4K6DA 3CCQA 2F4IA 2B63H 1LTID 1TU2B 5DM73 2IJ0A 1WVLA 1EQRA 2NN6G 2K28A 4RGTA 4HN7A 1PLFA 1O7LA 2HD3A 5HGQA 3T13A 3G48A 4KY6A 2KA7A 3LGJA 3H94A 1BCPC 3C46A 4Y7NH 3NQTA 4XIGS 3ND8A 4IURA 3VYSA 1LT3D 1D5MC 1K8MA 3S15B 4A93G 4V0BA 4GKKL 3I4MG 4FF3A 2B39A 1SNDA 5K36G 3M4OH 5AJ3L 1BCPD 4M8AA 3A7LA 2ASBA 4DUYL 1UAPA 3HOYG 4DR7L 3E0JA 2N88A 4H0LC 3BZCA 1STGA 1CZGA 1EZ8A 4C1NK 4B3MQ 4G57A 4DV6Q 2O2LD 3CMEA 3R2IA 4DNIA 2E8GA 3KLSX 3HOZH 2KCCA 1CM9A 2KOLA 3PIPA 1GJXA 3GV3A 3QR8A 4A3MG 3P75A 4X65Q 5M5XB 2NVQH 4TKOB 5IYBG 3OHXC 4K8JA 4R8NA 4HJ9A 3CC2A 4JBMA 1WCMG 4IPCA 3M7NA 4ZYSA 1E7ZA 1L1OC 3KJOA 2L9HA 4DN4M 2A5HA 2Q8RE 5T1IA 2WAQB 1SYFA 1XWEA 2F0WA 1JWMD 1S5DD 1SNQA 1XTDA 1PRTF 2X6GA 4JI7Q 1II3A 4A3CG 1XXGA 5E4WC 2F0HA 3GTJH 4OIKA 2F0JA 4DR5Q 1E0BA 2F0NA 4JI6L 3CCUA 4K5WA 4ME3A 1VQPA 2V1CC 3T1YQ 4WJ3M 4K2KA 2F3WA 3A8KE 2VS1A 2I5MX 1WTOA 1GUWA 3IRBA 2PZTA 2SOBA 3S17H 1NAPA 2UUAQ 1IKLA 1XJVA 2AHOB 4BY7H 4JI8L 5M3FB 2E2IH 5ELEA 2JEBI 2D0PA 4H02A 4JI8Q 3A55A 1PYWD 2F03A 4X66L 4IPHA 4A3DG 4X66Q 1M1KC 3VYTA 3S16H 5IYDH 1IXRA 4IPDA 5M5XH 2QEJC 3CQZH 4B08A 1A8VA 1NMFA 2XGTA 4FNFA 1G8ZD 4AYBE 2UUCL 2B3GA 3VR4A 4RGNA 4YY3Q 1HR0W 4JV5L 1VQFA 5I9PA 4LF4L 3A8JE 1B3QA 1XPOA 2R7FA 1QUQB 2F52A 4GLXA 4C2MB 3IKJA 1Y1WG 1TWCB 3J81L 2B2YA 3CKIB 5CBAE 1I4GA 4HJ5A 2JA9A 2XRSD 2F0UA 1F9QA 3CP0A 2EJMA 4XT1B 4GNXA 1U4PA 5CV6A 5IP9H 3OOCA 2UU9Q 4RHRA 2F3VA 1EL0A 2JE6I 4GN5A 2D9UA 3RZDH 1V1PB 1K3BC 4AYBB 1B9MA 2K5DA 4OWXB 4LFCQ 1CSPA 2WKDA 2QILA 1H9RA 3CCRA 2I5HA 5CV8A 3QIAA 2MFIA 3DEOA 4JI5L 3H3VC 3PO2H 1EQVA 4MZ9A 2OWOA 4ZLTF 3PUVA 1KIXA 3TP7A 1KLUD 5JJZA 3VR6A 2BE5C 3CCMA 1EYGA 2ZJRA 4DV3L 2KECA 3MXPA 2DY8A 3HRZC 1GUNA 1I6VC 3MC0B 4C3IH 2A6HC 3BVGA 5J22A 4BXXH 1Q3LA 2M9VA 2MPMA 1YNJC 4ULLA 2Q2TA 4H44C 1C9OA 3DLLA 3EFXD 3M4QA 3PGZA 2R93G 2BE5D 4R4CA 1AP0A 1CK1A 2WB1G 1HZBA 3KF8B 3K5MA 2K7VA 2OCEA 1K9MC 1SNMA 2A6HD 4HIDA 4BBRG 1ZXTA 1I3QB 1CUKA 1YNJD 1N32Q 1TWGB 1VQIA 3K6OA 3M9BA 2EJFC 1BOSA 4L8JA 1NTGA 3R2TA 5C0XJ 2Q2UA 4KHVA 4FXDA 2AQ2B 1PZKD 1Y1VB 3SK8A 1ZEQX 1P16A 5IODA 1SEBD 4KI0A 1K73C 3SDZA 3MXNB 3SXHA 2NN6H 2F0KA 1PHJA 5JAVA 5C3EG 3A8IE 3S1MH 2XSCA 2MNAA 4LFBL 3I4NB 2KJXA 1F2LA 5ELOA 4DR4L 4RFBA 5M5WH 5I2XA 1YIJA 1G6PA 2Y0SB 4RGMA 4Z9CB 3ER0A 1UE6A 4PQXA 4A3FB 2JA7H 4PZ7A 1RIPA 4DGZA 3D3RA 4DFAA 4WJ4A 1I4HA 4RA8A 1VMPA 4A93H 1BVSA 1U9RA 3I55A 3I4MH 4RKBA 4QL5A 2BDOA 5KIXA 1IBLQ 2A73B 4DAYB 4BA2I 5K36H 1ZKOA 3U9SA 4IJLA 2BOSA 3W1GA 5BR8L 3HOYH 2IW3A 4B9XA 1KNEA 2NVTH 4PZ8A 4O2DA 3PV0A 2IT1A 3J80L 1AFPA 2ID0A 3H0GG 2E2HB 1F2MA 1BBUA 4KD4A 4TQUS 4LF6L 2ZM6Q 1XPUA 1TWAB 2DNCA 5EGTA 2VQFQ 4KK7A 1V1OA 4K0KL 2CKZB 4UP9A 2X6LA 1GOZA 1WYDA 1HQMC 4DK6C 4A3MH 1XNQQ 5FOBB 3ITPA 5I6YA 5EKIA 1HA5A 5IYBH 3F2BA 1IW7C 2JA6B 2F0OA 4KJOA 1JQYD 4IUUA 1WCMH 4JI4Q 4GKJQ 1SFOB 5IE8A 2RVLA 4QB4A 1DYQA 1STNA 1E2WA 3BG3A 1TY2A 2QGQA 4KJNA 1WTQA 1SNOA 1IW7D 1J9OA 1RF2D 4QJFA 1BBXC 1J8IA 1QVFA 3TS2A 1NSNS 3G71A 4N8X1 4Y52H 1SYCA 4ZAIA 4A3CH 4C3JG 2V4DA 2F0MA 5C4JH 4NXNQ 4ZUIA 2VQEL 1E3PA 3DXJC 3VA5A 1TVXA 3H3VH 4QF4A 3S1NH 2PCFB 5DLQE 2EZVA 2YTVA 3I8ZA 3D31A 2K14A 2E2JB 1XMQL 2F0VA 3A0JA 1PZID 1XMQQ 2F4VQ 1JORA 1OXSC 1QILA 2JEAI 2EYOA 2JN4A 5GADC 5CORA 1D6EC 4A3DH 2H1EA 1HUNA 5FJ8G 3PUXA 3FPUB 4JC0A 4JYAQ 1SSOA 2B2YC 1CKOA 4M1UB 4OONA 3DWPA 4XTCS 1WTHA 5JOBA 1VDZA 4IFDG 3K57A 1G91A 1BF4A 2NWGA 2NVYB 5LMUL 1N36L 3K5OA 2HIVA 3MA2B 4GNXC 3D0FA 1I4XA 4DK1A 4DXGA 1R9TB 4GLAC 4HJAA 5IWAL 4J6HA 2VW9A 1QZHA 1TWFB 4OIJA 4LFAL 2JP1A 3GTQH 1H9SB 4L5QA 4A3EG 1I50H 3RZOH 1OXVA 4XYQA 3S2DH 2EVBA 1M4VA 3PF5A 1Y1WH 5LMNL 2F0SA 5D3DA 4BBSG 4OX9L 1V43A 5IIFA 3S1QB 5FLXL 5JVG3 5LMNQ 3E9IA 4DAPA 2K33A 5M9OA 4IFDI 2CWPA 3GTMH 4IZ8A 3K5NA 3GDEA 4JI0Q 2HDLA 2EE1A 2E5LL 4PV1C 1MKHA 3Q24A 2KHIA 1BDOA 1E24A 1E22A 3GTGB 2YTYA 3CF5A 2XIWA 2PQEA 3BVMA 1F9RA 4UDUC 2ZTDA 3QWNA 3S14B 1TIID 5L37A 4IO9A 3HOWG 3HP3A 4K2LA 3SK6A 1JWSD 1ENFA 4H7BA 2KCTA 5C44G 4X64L 4KV6A 1F9SA 3EN2A 3FKIB 2PQAB 5EKKA 2JA8G 1V1PA 1QNUA 4QIWE 3TZUA 3K7UC 1QG7A 4DR1Q 1O78A 4DV1L 1AZPA 2R93H 4U68A 2NBFA 2F0FA 3U4VA 5IY0A 2UXBL 2DJGC 3QOLA 4UAIA 1B1ZA 1JB7A 1SXTA 2PYKA 3PO3G 2RSOA 4A4IA 3J81c 1HNWL 4JPBW 2R6GA 1VS0A 4RHSA 1G2TA 1QB5D 2XWBB 1VQ7A 2AUKA 2K5QA 4ZCKA 3KBXA 1RKNA 2R7ZG 3X3MA 2FFKB 3H6MA 2HHHQ 3EJIA 2ZJQA 3P20A 1CA5A 2GVBA 2K6AA 1B3AA 3BS1A 4RWSC 2KEEA 4JI2L 1IKMA 1XX8A 2B63B 2NVXH 5JJLA 1N33L 4A3JG 4DV2Q 4A3KB 4P73A 4QIWB 3PIP3 2ZTCA 3D8GA 2PMZE 3CPFA 2GVAA 1KDBA 1STAA 2UXDQ 4G7ZC 1EY0A 1OXTA 3ULPA 1KABA 3R8BA 1WTXA 1CA6A 1SMYC 1HNZQ 4Y7NB 1C8CA 2KENA 5EBDA 4J15A 2VY3A 1DOLA 1FNWA 2KEDA 2ZXOA 2MQHA 2Q2HA 1LTAD 1TY0A 3M4OB 1RCVD 4BY1G 4BWGB 1SMYD 4O42A 1TXYA 1GUSA 3NSWA 1OTCA 4OWTB 3URYA 1DD2A 5HY6A 3AEVA 4QUCA 4CKBA 3IAYA 5CV5A 2RCFA 2F0PA 2PMZB 2N8NA 1TWHH 2QCPX 1ENCA 1F2ZA 1EIFA 3LX0A 3CCSA 1PH2A 5IP7G 3D4DA 1KNAA 1YEZA 4JBWA 1M90C 1YJWA 3CU7A 3HKSA 3KDFB 1Q86C 2NVQB 1PH4A 1D7QA 3BYTB 4A3KH 2IHFA 1CT1D 4P72A 3ND9A 3KLWA 4NXML 4OWWB 2MGSA 3WWVA 4C1NI 3S2HH 4IN3A 1PH8A 2RHSB 4IJHA 5J39A 4C3JH 4KY7A 4C56C 3MFYA 4A3IG 1TR5A 4ID6A 4YHHL 1X56A 1NR4A 3UE0A 4H13C 1H9KA 1PTOC 4GKKQ 1SROA 4GS3A 1JR0D 2Z4HA 3D6CA 1CFMA 5JVH3 3GTJB 2NN6I 3I72A 2CQOA 5AJ3Q 1RD9D 2RDGA 3J80c 3U50C 4R4OA 1VQ5A 1XMOL 2QEXA 2WAQE 4DUYQ 4DR7Q 3V96A 2F0IA 1BUVT 1KRSA 4FF2A 1PTOD 2K5VA 2OF1A 4B3RL 3FPPA 4G7OC 1S4ZA 2MP1A 4O0AA 5CC4A 4L5RC 3S17B 4CJ1B 1A0IA 4R4QA 4BY7B 3K59A 1X54A 2ZXRA 2KCNA 2K5NA 2Q8TA 5FJ8H 1N8RC 2E2IB 5COYA 1L2FA 2I46A 1JE4A 5CR3A 5E7NA 3P7JA 2XVSA 2M00A 1X3GA 5CYUA 4IFDH 1PH3A 3S16B 3HKZB 2RCNA 3CQZB 4XQJA 3CHBD 2RF4A 1VQKA 1S5ED 3AU7A 1SJED 4MHEA 4KHPL 1E1TA 3TMEA 3NBHB 1VQ9A 2OTLA 4HJ7A 3BZDB 4HEDA 1Y1VG 1HXYD 1STBA 3GV6A 4DV4L 3HOUG 1Q7YC 4A3GG 2WP8J 3A54A 1KRTA 2L5TA 4IUQA 3PUZA 3I73A 1G6ZA 2HIXA 1TQOA 1ET9A 2KHSA 4CJ2C 1LACA 3Q6SA 1L0WA 1HRJA 2QF7A 2DY7A 3MXUA 1S40A 1IZ6A 1KDAA 4JI6Q 1BCPB 3VA7A 3UDFA 3FDTA 1D1KA 4OO1G 2QKIC 3NHHA 3RZDB 4ZQ3A 3OMGA 2LS01 5FO8B 1SE4A 3D4RA 1AH9A 2B8GA 1QVCA 4CBVA 2IL8A 2B29A 2R92G 3HOWH 5CBEE 3VR5A 3BDOA 4I7AA 3K58A 1EEID 1SE3A 5CGKA 4GOPA 3PO2B 5C44H 4IOCA 1X3QA 5DEHA 4R4IA 4PG3A 5IGCA 1DM0B 1NY4A 2JA8H 4I7ZC 2UUBL 2A19A 4B9WA 3H3VI 3G4SA 5BN5A 4C3IB 2UUCQ 5J3BA 1PFBA 2K01A 1J6QA 2VUMG 2CWAA 5ELNA 4JV5Q 4F88A 1KHIA 3DWQA 4LF4Q 1ET6A 5K5PA 3L2PA 3PO3H 1D5ZC 2K5HA 4HMIA 4UP7A 1SR3A 4LF7L 1CKNB 3SGIA 3JAML 5LL6S 3KF6A 5FLXc 1Y8PB 1I6HH 1NMGA 4UP8A 2PW5A 5KYIA 4ZK9B 2MO1A 2LFNA 1RHPA 2R7ZH 1Q8KA 5IOCA 2VB3X 4OXPA 1BXTA 2OXPA 1VQAA 3W5OA 5GROA 1IYVA 4KKUA 1Q12A 1L1OB 1EQTA 2J7ZA 3Q23A 3W2DA 4RAUC 1G2SA 2K1BA 4A3JH 5IYCG 1KAWA 3AFQA 3UDGA 3S1MB 4XYOA 2C9OA 3NQIA 3CCVA 2RHQB 1PTOH 3HG9A 1OXXK 4IQZA 1CQFA 5M5WB 3L7ZC 3ONAB 3OPOA 4A76A 2EXDA 4JI5Q 1HFGA 3SVMA 3X3NA 1UE5A 2E74C 2JA7B 1LUZA 3I2ZA 3VR3A 4RMFA 5BN3A 4A93B 5JEAJ 1D1IA 3BU2A 3R93A 5EPLA 1JMCA 4P74A 4A3BG 1JCKB 3I4MB 1H9MA 1GO3E 1KQSA 4DV3Q 4C3HG 1YNXA 4BY1H 2H5XA 3CMAA 3HOYB 1VMCA 3CPWA 1QVGA 2IX0A 2Y0SE 4CJ0B 1PRTC 1V9PA 4ALPA 2R3ZA 2NVTB 1CSQA 2Z6KA 5IT9L 1X9NA 1I4RA 2PO4A 1QOHA 1GD7A 1BQQT 5M5YH 2GN5A 4P2CB 1JT8A 1S5CD 1PRTD 2L55A 5IP7H 2RA4A 2WFWA 1TS2A 4MTNA 2ZTEA 3MHBA 3PSIA 4A3MB 3TEHB 2MJ8A 2H4OA 2K04A 3NUCA 3OW2A 1D8LA 1HJPA 4NB3A 1O7ZA 4RKLA 4YWMA 1X65A 1UE7A 5KNBA 2OEOA 1WCMB 3NEMA 5G3LF 5M3MG 2JSOA 5D65A 3W3AA 4LFBQ 4X3TA 4LF5L 1EY4A 5GAHC 4Q5VA 3I56A 1LT5D 1MJCA 1IHZA 4J8QA 4DR4Q 1HUMA 4DR2L 1GVPA 1EY9A 4DR3L 4MN3A 4A3IH 5JJKA 3NELA 4DR2Q 3TBIB 3S1RH 1HZ9A 1Q1BA 2PNHA 1GUTA 3VR2A 2TMPA 4DR6L 2L12A 4JI3L 3HOVG 3CRLC 3N6RA 1N34L 4CDDC 1HNXL 3M3YH 2JK8A 1A62A 1UNSA 4KLKA 5C4JB 2IPKD 1TS5A 4XDXA 2EIFA 3T1HL 4AQYL 1HNXQ 1TKWB 1FJGL 3T1HQ 1R4PB 5TSSA 5BR8Q 3ZYYX 3S1NB 1VF5C 3DM3A 2DJFC 1QWYA 2A1AA 2A68C 5GAEC 1EIHA 3M4YA 4GZYC 3SEBA 2B2VA 4B3TL 3QB3A 1EOTA 5I2YA 4MTKA 2EOTA 2NTTA 1PH7A 1ILPA 1K83H 1UWVA 2XN9C 2CFMA 1U4MA 1T5EA 4LF6Q 3NWSA 2LMCB 3SE0A 3F1ZA 4IFDJ 2A68D 1X3PA 4A3DB 1PYBA 1JE5A 3J7YW 3CC4A 3RUZA 4K0KQ 2R7DA 5D3IB 2EPBA 3S24A 3FRPB 1HHVA 3GTLH 3FMCA 2HUGA 2NZOA 4RG1A 3TP5A 1JICA 1LV9A 5HURA 3DWAA 4RCNA 3Q22A 5E3FA 4ZKBB 1O80A 1MGSA 2A6EC 3RLNA 1E1OA 1PZJD 2J4XA 5A2QE 3MTSA 3NWTA 4EVOA 1Y69U 3HOUH 3GTQB 1I50B 3RZOB 5C0XG 3S2DB 1Y1WB 4NW2A 3UDIA 4V190 4A3GH 4TSSA 1LTBD 1EU4A 3QO2A 4LAAA 2VZAA 2Z1CA 2PNRC 5EPJA 4GOPC 1VQOA 1VQHA 4KKTA 1ENAA 2A6ED 5C4XG 2KCMA 4IALA 4HJ8A 3GTMB 2WIIB 3J7A5 2JA5G 1VQGA 1Z47A 2K32A 1PH1A 4OHJA 2VQEQ 4WFN3 5LHY1 2WB1E 1CI3M 1EZ6A 2JJQA 4IUTA 3ULLA 3NK9A 1XTCD 1PXUA 4EQPA 2R92H 1ILQA 4CKCA 2HT1A 2B2TA 2JQOA 2E75C 1HCZA 4DV5L 2L1BA 3I4OA 3A74A 4F7XA 3P1HA 3RR5A 1VCIA 4DNTB 4DNRB 1SYDA 4R4TA 2YU9H 3F2UA 5I4DA 1P8LA 4DXFA 3OMCA 5LMUQ 5GAGC 1N36Q 2VUMH 5DAUA 1EWIA 1KC8C 2R93B 4HMJA 1W3SA 1W6JA 5IWAQ 3HOZG 4E6IA 2WB1B 4LFAQ 1PFSA 3V05A 4DUZL 3HOXG 1AW7A 3KYHC 1I5FA 4HIOA 4FO2A 2B2UA 2UXCL 3OYYA 2KUMA 2CH4W 1LLRD 1PV4A 4OX9Q 3M7GA 3SHLA 1S5BD 3TDQA 5JPNC 5EKLA 4XXEA 3GTPH 5F2DA 4JCVE 4R1JA 2F0EA 3OWEB 1MBYA 2F1MA 4YCWA 1UEAB 5C5MA 2E5LQ 1HR0L 4DK0A 1LT6D 1U4LA 5IYCH 5C3EB 5GQOA 1B2TA 3CC7A 2NVXB 4CHTB 1QUQA 2Z6BA 1WD0A 2OQKA 3F2DA 3A7AB 4IUPA 1XNRL 1C7YA 4X6AH 1HPCA 2Z6KC 4FVMA 2LSSA 2A8VA 1XNRQ 2RBMA 3EQLC 3GD7A 5IGEA 4K5VA 4K14A 4YIJA 4A3BH 1STYA 1EEFD 4X64Q 4C3HH 3BDCA 1STEA 1A3VA 3I7FA 1CHQD 2YYZA 3MFGA 2N3SA 5EPKA 1VF7A 2RQXA 1B8AA 1EY7A 5HGTA 4X62L 4DV1Q 4G7HC 1WTRA 3F2CA 1ML0D 2K5WA 3K0YA 5A35A 3H0GB 2UXBQ 2ATWA 4QY7A 5KGUA 3JAMc 3DEPA 1JOQA 3H91A 4BBRH 1A15A 2CW0C 4LW1A 3NPPA 1WD1A 3EBEA 4CDCC 3G6JB 2CVRA 1O7YA 2IX1A 4AIMA 1C0AA 1BCPF 1XYIA 1HNWQ 1DGSA 2CQAA 1NNXA 1GXDC 1TWHB 3CRKC 2KHJA 3NTIA 5JPMC 1HZCA 2NTSA 4KY5A 2CW0D 4BA1I 4B3SL 4ABNA 3HEJA 2FXQA 4L5TA 5C3EH 2WAQG 1HQRD 1IBKL 4KN7C 4A75A 1PH9A 2O4XA 1S72A 5M3MH 3DHQA 1IBKQ 5FKAC 4JI2Q 5IGBA 3KF8A 1Q8IA 3HZXA 3TP6A 1N33Q 2BH2A 3S2HB 5EJWA 5EBCA 1NE3A 1EYAA 3NBIA 1EYDA 3GTOH 1LTSD 2B2VC 4JBKA 3OTOL 3HOVH 1SRUA 3MVVA 4C3JB 5CMDA 4DV7L 3I70A 2EYHA 1WTWA 3RMHA 1RDPD 2G9DA 4GN4B 3GTKH 2L11A 3MXNA 4JBJA 2NB0A 3TP8A 1MSGA 4EQOA 3HFZB 4NMZA 1K28A 3CCEA 5M3FG 3H0GH 3OW7A 3NXWA 5IT9c 1JJ2A 2Z0SA 2YTXA 2TSSA 3OIQA 2D5DA 2FHTA 2BA0A 3MEFA 2AUJD 3E9HA 4IPGA 1NCVA 1I94L 3ULJA 2G5DA 2PI2E 4ME5A 1QNKA 5ELFA 1BKBA 2JYOA 4DAYA 1KAAA 1LO5D 3IL8A 1A3TA 3K8AA 2HCCA 5DM63 1EOVA 4LUVA 4DK3C 1EFWA 1WFQA 3WOFA 1WTVA 4R9WA 3RN5A 3K7AH 4ZUJA 4LWCA 4NKLA 3AQQA 1HA6A 1SYEA 4NXMQ 1KXLA 1U5KA 1U4RA 4LJZC 2JXMB 3GP7A 4A3EB 2A69C 1X3FA 1I4QA 1PDQA 2WINB 1JJCB 3NENA 5ELDA 1FGBD 2B2TC 4OELB 1JOKA 1CZWA 3HKZE 4L5SA 1JWUD 1DONA 1PMRA 1TT2A 2EDGA 4WJWA 4ZRZA 5C4XH 4YHHQ 4AYBG 3JC66 3VYUA 2JA5H 4DA2A 4HAEA 1AE3A 2A69D 4LMQD 2XTIA 1GHJA 3CW2C 3L3OC 3HS0C 3KFUA 3KOJA 1JB3A 2I07B 2RDFA 2K52A 3C1FA 4CGYB 3MAQA 4U673 2JA7G 5BN4A 2NZ1D 1XMOQ 4HR7B 1VQ4A 4DAVA 1EWCA 2RKSA 4B3RQ 4KTAA 3J7AF 3DMUA 1MSHA 4FXGC 4YCVA 2SEBD 3HOWB 1QJOA 2AMCB 1HH2P 3PMFA 1A3UA 3SK4A 1ICFB 3PUYA 5C44B 3EVQA 2B2UC 1ONLA 5T1GA 1HTLD 1I4PA 2F0GA 1SYGA 4B3ML 4HTHA 4DV6L 2EYFA 2JA8B 2B2WA 1VQCA 2F0TA 1LTGD 2FMCA 1IL8A 1SNPA 2QDLA 2SNSA 5LL6X 3K5LA 1LABA 2FJ2A 4A3EH 2X69A 1OO9B 1V1QA 3CD6A 2QW7A 1NR2A 2RDHA 2EYMA 1D5XC 3PO3B 2OT2A 3HOXH 4X65L 4KHPQ 4BBSH 5I9OA 3ZJYC 3K80C 2K50A 1MJEA 4X3KA 1DZ1A 3QJYA 4DV4Q 1I6HB 1SBBB 2R7ZB 1LM0A 3KJPA 3I4NG 1GUGA 4DAMA 3FVQA 2EY1A 5C6AA 3JAME 2G9HD 2Y0SG 2ES2A 3A5ZB 3STBC 4A3FG 2KQ3A 3J81E 1BO0A 4YWLA 4CKEA 2DNEA 3ICEA 1CTMA 4JI7L 1H9SA 2HQLA 1LYLA 4A3JB 1VQBA 1Y8OB 4JOIA 4CDEC 3S15H 2WV6D 4DKAC 1CHPD 4LUZA 1IYUA 2EY5A 4DR5L 2KBNA 1PTOB 3BZKA 1EFID 1ICWA 3STBD 1SJHD 2D62A 3T1YL 1EWHA 2Q8IB 2QDBA 3PIO3 1ESRA 1LTLA 1PH6A 1E2VA 3B6YA 4JVZA 2UUAL 4MNOA 1DOMA 2I5LX 3FEWX 2DN8A 1C4QA 3MZ5A 3TZDA 1IBML 2UUBQ 1KLGD 1IBMQ 3RLFA 3NP8A 4OO1I 4FF4A 1JOOA 4BY1B 1KD1C 3U58A 4OL7A 5LMNW 1RTNA 5KYLA 2OTJA 5EQ0A 1DCZA 1SYBA 3GO5A 4DPGA 2O5IC 4X3SA 4LF7Q 3KLRA 2JA6G 4YY3L 1EYCA 5M5YB 4F87A 5FO9B 3TN2A 2EY2A 2PQAA 4G4KA 4FYDA 2EQSA 5IT9E 5FK9C 3UI2A 4PMBA 1F2YA 2AWNA 4LF9L 1WJJA 4PMWA 1MI2A 4XQNA 2EYLA 3OWFA 3RD4A 3E3XA 4LF9Q 3LWUA 1KTKA 4KKSA 2BDNA 2N78A 4IOAA 4EX5A 3K0XA 1XPRA 1JJGA 4OGQC 5JJIA 4UY8C 1QCBD 4KD3A 2ZJPA 2A74C 2UU9L 1A63A 1K8GA 1Z7TA 4LUOA 3SR1A 2EYPA 3J7ZC 4A3IB 1NUCA 3S1RB 2EYJA 4HIMA 4PMCA 1T9HA 1U0LA 4LFCL 1IL2A 1GUOA 1F9PA 2F0DA 1NJIC 1SLJA 1FL0A 4JW0A 3M3YB 5M3FH 4FDBA 4RCOA 3T56B 2Q2IA 1O7IA 2FMMA 1BBWA 1R4QB 4P75A 1DXMA 5C3XA 4HSPA 1QE6A 4P71A 1VQJA 1HZAA 1K83B 2GA4B 1B4OA 2MO0A 1AN8A 2XNAC 1BR9A 3J80E 1UEBA 2PZUA 3I91A 1H95A 1YI2A 3IFDA 3TRZA 1CQVA 4PNYA 1WI5A 4C2MH 3J81j 1EY5A 1TWCH 2ZT9C 1YZ6A 1N32L 1X32A 3GTLB 4KHZA 5FLMG 1JC7A 4WORA 2AQ3B 3PIOA 3T4AC 4LF5Q 2L0CA 1LT4D 4KMUC 1CKMA 3VYRA 4F8MA 3HOUB 1EQQA 2NZHA 4QUFA 4DR3Q 3L9AX 1KL9A 1FVIA 4XQQA 4NP5A 4A3LG 4A3GB 4LF8L 3H15A 1K3RA 5H1SE 5IGDA 1H9JA 4JI3Q 4DR6Q 4LF8Q 3KDFA 3KUPA 1N34Q 4J1MA 4JG2A 4HCSA 1HFNA 4AQYQ 3M4PA 1Q81C 1FJGQ 5DNFA 2B2WC 3M85A 1K0SA 3WDNA 5KNCA 1YJNA 1RL2A 1IBLL 3E0EA 2BA1A 3F8TA 1L0XB 2PZWA 1FGUA 1S5FD 4AH6A 3FKIG 3TREA 2OQ0A 4Q0FA 1VQ8A 4B3TQ 2R92B 2ICIA 3W1BA 5JEAG 2F0QA 1B50A 4DF7A 3OIPA 2PI2A 2IHEA 2IX3A 3T16A 3TSSA 1EU3A 1PRTB 2C35B 4QCLA 4FXKC 1LTRD 1OXUA 2VNUD 3ERQA 3BYYB 2YU9B 1I3QH 1J5EL 1W6KA 2ZM6L 1TWGH 2Z8LA 2AQ1B 1J5EQ 4FP5D 1ESFA 1DOKA 2VQFL 1FYCA 2VUMB 1V8QA 1WOCA 3AFPA 4BS9A 3EIVA 2XWJB 3E6ZX 1XNQL 2M2LA 1K8AC 1YVCA 4N9TA 1Y1VH 3I90A 4JOIC 2DGYA 1EY6A 4HIKA 4ODGA 4MIUA 4GKJL 4JI4L 1X55A 3AB9A 4L63B 2K03A 2FINB 5E4XA 3T53B 2B63G 3I4NH 4OEMB 4A3KG 3KK7A 3G7LA 2CHBD 1TS4A 1T5XD 2ICEC 3JAMi 1FNUA 4I65A 5IGGA 1UE1A 4GN3B 3GTPB 1AEXA 2HCIA 2Z9HA 3H09A 4K8IA 4A3FH 2SNMA 4UHVA 3J81i 1GM5A 1DJRD 5FLXE 2Z4IA 3CCLA 4OO1H 2EXZA 2E2DC 1YITA 3NBHA 3E5SA 1SDFA 3NTKA 1K0RA 3WOEA 4NXNL 1C48A 1Y14B 5C0XI 5KRUA 1VQDA 2CH4A 1GHKA 3DM1A 1PH5A 4DV5Q 2XRQD 2D0OA 3CCJA 3T51B 2L15A 2D2CC 4A3BB 1A2TA 1TS3A 2E2HH 2F4VL 2F3IA 4IUVA 4DV0L 2O5JC 4C3HB 1YHAA 2P5ZX 4DV0Q 1G291 2VL6A 3FP9A 4FF1A 1TWAH 3CXCA 2B8FA 1SMXA 1X3EA 3PF4A 3AMUA 5ISRA 5G3LD 1K8OA 4JYAL 2YV5A 2KVMA 3SK5A 1S3OA 3G6EA 2LKVA 2F0LA 3PCOB 2N49A 2R61A 3EROA 4EQ5A 1VQNA 3J7AV 5ELBA 2JA6H 4BBRB 5A2QL 3D6WA 2VB2X 4DUZQ 1SFOH 4NPSA 5C4ZA 1PA6A 4ILWA 1D2BA 3CAMA 2UXCQ 3C1EA 2PW7A 1UUPA 1B70B 3TQYA 1PVOA 1LTTD 1MIUA 4EQNA 1EUJA 1SE8A 2AKWB 1Q90A 4LNQA 5NUCA 1ZYRC 3HGBA 4N8FA 1L0YB 1HR0Q 1RTOA 1Z6HA 1WTPA 1VQLA 1CKNA 4X3UA 5M3MB 2NYZD 2LY7A 5ELCA 1HTPA 3LNNA 5J1ZA 3RLOA 4GOPB 5C4HA 4JI0L 1FD7D 3GQBA 1ZYRD 3RN2A 4QMGA 2N55A 2NUCA 3GTOB 2K75A 2CCZA 1VQEA 2E2JH 3IFTA 5CV7A 1L1OA 5C3WA 2DUDA 4HSVA 4EGVA 1B44D 3N52A 3HOVB 5C5LA 3PQIA 4K5XA 3V2TA 3GTKB 4UPAA 3I3CA 3MXGA 3NE5B 3TS0A 4O1NA 2MHVA 4CDFC 2HDMA 4N9PA 5CV4A 4NDXA 4BY7G 3K81C 1RODA 4POFA 3KF6B 3Q8DA 4X62Q 1YHBA 2EJGC 4QGUA 1AZQA 4K6LA 3BVZA 2LXKA 2AWOA 1Q82C 1YHQA 5CV9A 1VQ6A 5IYDG 3A56A 3HKZG 1BNZA 2NVYH 4DR1L 1Q1EA 4GNXB 3J80i 1R9TH 1ASZA 3U9OA 4POGA 1PYSB 3EA6A 5IGFA 1TWFH 3LWEA 3AYHB 1FR3A
chains in the Genus database with same CATH topology
4A76A 1N9WA 2EXDA 4QJFA 4JI5Q 3PUYA 1QVFA 1UE5A 3TS2A 2ALYB 4IFDI 3G71A 1LUZA 4B3SQ 3I2ZA 1NBWA 4B3ML 4RMFA 4Y52H 3S1QH 5JEAJ 3BU2A 5FLMH 1JMCA 4A3BG 4A3CH 4P74A 4DV6L 1GO3E 1VQCA 1KQSA 4DV3Q 5C4JH 4NXNQ 1YNXA 1YJ9A 3PUWA 1VQMA 4BY1H 4QQBX 3RNUA 2HHHL 2K4KA 2H5XA 2VQEL 1E3PA 3CMAA 4A3EH 3CPWA 1QVGA 2IX0A 2Y0SE 3H3VH 1IYJB 1V1QA 3CD6A 3S1NH 1V9PA 5DLQE 4ALPA 2YTVA 4PZ6A 1CSQA 2Z6KA 2K14A 3D31A 4X65L 4GLVB 3HOXH 4BBSH 3GTGH 4KHPQ 3ZJYC 2I0QA 4A3LH 3K80C 1X9NA 2K50A 5IP9G 1XMQL 1MJEA 3VDYA 1Q46A 4DV2L 3A0JA 1GD7A 3OTOQ 3A5UA 4DV4Q 1XMQQ 2F4VQ 4DV7Q 2BH8A 5M5YH 3S14H 2UXDL 3U4ZA 2GN5A 3FHWA 1OXSC 1JT8A 1LM0A 3KJPA 2JEAI 5IP7H 3I4NG 5GADC 4DAMA 2WFWA 4JI1L 1SN8A 4APVA 1Z9FA 4MTNA 4A3DH 2ZTEA 4JI1Q 5FJ8G 2Y0SG 3PUXA 3PSIA 4JYAQ 4JC0A 3PO2G 2ES2A 3TEHB 3A5ZB 3STBC 4A3FG 1CKOA 1W2BA 1HNZL 4OONA 4YWLA 3OW2A 4XTCS 1D8LA 1X6OA 1HJPA 4NB3A 3ICEA 4JI7L 4IFDG 3UE1A 2HQLA 4YWMA 1X65A 1UE7A 1LYLA 1VQBA 3FKIH 4JOIA 3S15H 5LMUL 4DKAC 1N36L 3ERSX 1G51A 2HIVA 4LUZA 3NEMA 1EIYB 5M3MG 4GNXC 3D0FA 4DR5L 4LFBQ 4LF5L 2KBNA 1I94Q 1QZGA 4GLAC 4HJAA 3BZKA 3L0OA 2IY5B 5IWAL 3STBD 5GAHC 2VW9A 4TVAB 3I56A 1QZHA 4BXXG 1MJCA 4YWKA 4DR4Q 4DR2L 4LFAL 1GVPA 2D62A 4DR3L 3GTQH 3T1YL 4L5QA 4A3EG 1I50H 4A3IH 3NELA 4DR2Q 3RZOH 5JJKA 1OXVA 3S1RH 1HZ9A 3S2DH 1Q1BA 3PF5A 1Y1WH 2PNHA 5LMNL 3BJUA 4BBSG 4OX9L 1LTLA 1V43A 4JI3L 1PH6A 3HOVG 4DR6L 3B6YA 5LMNQ 2QA4A 4MNOA 3E9IA 2I5LX 3UDXA 1PH4A 1YBYA 1IBML 2UUAL 1N34L 2UUBQ 1HNXL 2LXJA 3M3YH 1IBMQ 2CWPA 1A62A 2JK8A 4KLKA 3RLFA 3T1HL 1B7YB 3GTMH 2EIFA 4OO1I 4AQYL 1HNXQ 1KD1C 1GKHA 3GDEA 1FJGL 3T1HQ 3U58A 4JI0Q 1AE2A 2E5LL 5LMNW 5BR8Q 4YCUA 1MKHA 5EAYA 2OTJA 2KHIA 1ASYA 3DM3A 2A1AA 5GAEC 1E24A 1E22A 3GO5A 4DPGA 3CCQA 2YTYA 4LF7Q 2B63H 3CF5A 4B3TL 2JA6G 1EQRA 1PH7A 2NN6G 4YY3L 2ZTDA 1K83H 1UWVA 2CFMA 2PQAA 5HGQA 4IO9A 3G48A 4LF6Q 2EQSA 3HOWG 3F1ZA 4IFDJ 1PYBA 1JE5A 3LGJA 2E2JH 2AWNA 3CC4A 4K0KQ 4LF9L 1WJJA 2R7DA 2KCTA 5C44G 4X64L 4PMWA 3S24A 4Y7NH 4LF9Q 4XIGS 3EN2A 2N78A 3GTLH 2PQAB 4IOAA 4A93G 4GKKL 4EX5A 2JA8G 3I4MG 3K0XA 2NZOA 4RG1A 4QIWE 1XPRA 3K7UC 4DR1Q 4DV1L 2R93H 5K36G 1JJGA 3M4OH 5JJIA 5AJ3L 4UY8C 3U4VA 5IY0A 2ZJPA 2UXBL 1D7QA 3RLNA 1E1OA 2UU9L 1A63A 2ASBA 4DUYL 3HOYG 4DR7L 1K8GA 4LUOA 1JB7A 3HOUH 3J7ZC 3BZCA 5C0XG 3PO3G 4HIMA 3UDIA 4A3GH 1T9HA 1U0LA 4LFCL 4A4IA 3J81c 4B3MQ 1IL2A 1HNWL 2R6GA 1VS0A 2VZAA 1VQOA 1NJIC 4GOPC 4DV6Q 1SLJA 1VQHA 1FL0A 3CMEA 1VQ7A 5C4XG 2KCMA 5M3FH 4HJ8A 4DNIA 3J7A5 2JA5G 1VQGA 2E8GA 2R7ZG 3HOZH 4FDBA 1Z47A 1PH1A 2HHHQ 3PIPA 2VQEQ 2ZJQA 2GVBA 2Q2IA 1O7IA 2WB1E 4A3MG 1BBWA 4P75A 2JJQA 3ULLA 4X65Q 2NVQH 4JI2L 5IYBG 2NVXH 5JJLA 1N33L 4A3JG 4P71A 4DV2Q 4HJ9A 3CC2A 4P73A 4JBMA 2R92H 1VQJA 2ZTCA 1HZAA 2HT1A 2PMZE 1WCMG 2GVAA 3CPFA 2JQOA 4IPCA 2MO0A 3M7NA 2UXDQ 4DV5L 1OXTA 3ULPA 1UEBA 1E7ZA 1L1OC 3I4OA 3KJOA 1H95A 1YI2A 3A74A 3RR5A 3TRZA 1VCIA 1WI5A 4C2MH 1HNZQ 4R4TA 3J81j 1XTDA 2YU9H 1TWCH 1N32L 1YZ6A 2KENA 4JI7Q 4J15A 1P8LA 2VY3A 4KHZA 5FLMG 4A3CG 5LMUQ 5GAGC 1N36Q 2VUMH 2MQHA 1EWIA 3PIOA 2Q2HA 3GTJH 1KC8C 4DR5Q 4LF5Q 1W3SA 4BY1G 5IWAQ 3HOZG 4JI6L 1TXYA 3CCUA 1CKMA 4ME3A 1VQPA 1OTCA 4LFAQ 1EQQA 2NZHA 2V1CC 4OWTB 4DR3Q 1PFSA 5HY6A 3T1YQ 1KL9A 4DUZL 4WJ3M 1FVIA 3HOXG 3AEVA 4A3LG 3KYHC 1I5FA 4HIOA 2VS1A 2I5MX 2UXCL 3OYYA 3H15A 4LF8L 1K3RA 3IRBA 5H1SE 1PV4A 4JI3Q 4OX9Q 3S17H 4DR6Q 2UUAQ 4LF8Q 2N8NA 3KDFA 1XJVA 1TWHH 2AHOB 1N34Q 3GTPH 4JG2A 4BY7H 4JI8L 1EIFA 3CCSA 4JCVE 1PH2A 2E2IH 2JEBI 4R1JA 2D0PA 4H02A 4YCWA 5IP7G 4JI8Q 4AQYQ 4X66L 3M4PA 4IPHA 1Q81C 1FJGQ 2E5LQ 1HR0L 4A3DG 4X66Q 3M85A 1YEZA 4JBWA 1M1KC 3S16H 5IYDH 1M90C 1IXRA 4IPDA 5M5XH 3CQZH 5IYCH 1YJNA 1YJWA 1RL2A 5GQOA 3E0EA 1IBLL 3HKSA 1A8VA 3KDFB 1Q86C 1NMFA 2BA1A 2XGTA 3F8TA 1FGUA 3CC7A 1QUQA 2IHFA 4AH6A 4P72A 4AYBE 4A3KH 2UUCL 3FKIG 2OQKA 2OQ0A 3KLWA 3TREA 2B3GA 3F2DA 1VQ8A 4B3TQ 4NXML 1C7YA 3W1BA 4OWWB 3WWVA 5JEAG 4YY3Q 1XNRL 4X6AH 3S2HH 2Z6KC 1HR0W 2LSSA 2A8VA 2PI2A 1VQFA 2IHEA 4LF4L 1XNRQ 4JV5L 1PH8A 2RHSB 1XPOA 4IJHA 3GD7A 2C35B 2R7FA 4A3BH 1OXUA 1QUQB 4C3JH 2VNUD 2F52A 4A3IG 4GLXA 4X64Q 4YHHL 4C3HH 1Y1WG 1X56A 1I3QH 1J5EL 3I7FA 2ZM6L 1TWGH 2YYZA 2N3SA 4HJ5A 2JA9A 3UE0A 1J5EQ 4GKKQ 2VQFL 1SROA 4GS3A 3CP0A 1WOCA 3AFPA 3EIVA 1B8AA 2NN6I 4X62L 4DV1Q 1XNQL 4GNXA 1K8AC 1YVCA 2CQOA 3F2CA 1Y1VH 5AJ3Q 4JOIC 2DGYA 5IP9H 3J80c 3U50C 4R4OA 2ATWA 2UXBQ 1VQ5A 2UU9Q 4QY7A 4HIKA 3JAMc 2QEXA 2WAQE 4DUYQ 1XMOL 4DR7Q 4BBRH 2JE6I 4GN5A 1KRSA 4LW1A 3RZDH 4JI4L 4GKJL 1X55A 2K5VA 3EBEA 4B3RL 4OWXB 2B63G 4AIMA 2IX1A 1C0AA 3I4NH 4O0AA 4L5RC 4LFCQ 1HNWQ 1CSPA 1DGSA 4A3KG 1A0IA 4R4QA 3CCRA 2I5HA 3JAMi 2KHJA 1X54A 2MFIA 1UE1A 2K5NA 4GN3B 4JI5L 5FJ8H 1N8RC 3PO2H 1HZCA 1L2FA 4A3FH 4MZ9A 3J81i 2OWOA 5E7NA 4BA1I 3PUVA 1GM5A 1KIXA 4B3SL 1X3GA 3CCLA 1PH3A 2FXQA 4L5TA 5C3EH 3CCMA 2WAQG 2RCNA 1YITA 1IBKL 1EYGA 2ZJRA 4A75A 1PH9A 4DV3L 1S72A 5M3MH 1K0RA 1IBKQ 4NXNL 1Y14B 4JI2Q 2RF4A 4C3IH 5C0XI 1VQDA 1N33Q 4BXXH 2BH2A 1VQKA 2Q2TA 1NE3A 1C9OA 3DLLA 1PH5A 3M4QA 3PGZA 4DV5Q 2R93G 3GTOH 4KHPL 1E1TA 2D0OA 3NBHB 4R4CA 3CCJA 1VQ9A 4HJ7A 2OTLA 2L15A 4JBKA 1Y1VG 3OTOL 3HOVH 2WB1G 3HOUG 1HZBA 1SRUA 3KF8B 2F3IA 4DV4L 4DV7L 2OCEA 1K9MC 2E2HH 2F4VL 4HIDA 4DV0L 4BBRG 4GN4B 1YHAA 1Q7YC 3GTKH 4A3GG 1CUKA 2WP8J 1KRTA 4JBJA 1N32Q 4DV0Q 1G291 2VL6A 3FP9A 1VQIA 3M9BA 1TWAH 3CXCA 1SMXA 1X3EA 3HFZB 3PUZA 1NTGA 3PF4A 2HIXA 3CCEA 5C0XJ 4JYAL 2YV5A 5M3FG 2Q2UA 1S3OA 3G6EA 3H0GH 1L0WA 3L7ZC 2N49A 3PCOB 4EQ5A 1VQNA 1P16A 5IT9c 1JJ2A 1S40A 1IZ6A 2YTXA 2Z0SA 4JI6Q 4KI0A 1K73C 2JA6H 3UDFA 3MXNB 4OO1G 1PHJA 2BA0A 5C3EG 3MEFA 3E9HA 4DUZQ 3S1MH 4IPGA 4NPSA 2MNAA 1SFOH 4LFBL 1AH9A 1PA6A 1I94L 3CAMA 3ULJA 1QVCA 2PI2E 2UXCQ 2B29A 2R92G 3HOWH 1B70B 1BKBA 5ELOA 3TQYA 4DR4L 1PVOA 5M5WH 1MIUA 1YIJA 1G6PA 4GOPA 1EUJA 1SE8A 2AKWB 3ER0A 1UE6A 5C44H 4LNQA 4IOCA 3K8AA 2JA7H 4R4IA 4PZ7A 1RIPA 4WJ4A 1EOVA 4PG3A 4LUVA 4DK3C 1HR0Q 1EFWA 4A93H 1BVSA 1NY4A 3I55A 1VQLA 2JA8H 3I4MH 1WFQA 2UUBL 2A19A 1CKNA 3H3VI 4QL5A 3G4SA 3RN5A 1IBLQ 3K7AH 4LWCA 4DAYB 4BA2I 3RLOA 4GOPB 3AQQA 4IJLA 2UUCQ 4JI0L 5J3BA 4NXMQ 1KXLA 1J6QA 1U5KA 3W1GA 5BR8L 3RN2A 2CWAA 5ELNA 2VUMG 3HOYH 4JV5Q 1KHIA 4LF4Q 2NVTH 2K75A 1X3FA 4PZ8A 3L2PA 2CCZA 3PO3H 2K5HA 1VQEA 4O2DA 3PV0A 2IT1A 1SR3A 4UP7A 1JJCB 2ID0A 3H0GG 1CKNB 3NENA 3SGIA 4LF7L 3KF6A 1L1OA 3HKZE 2DUDA 4L5SA 5FLXc 1I6HH 1NMGA 4UP8A 1BBUA 4UPAA 5C4XH 4YHHQ 2MO1A 3JC66 4AYBG 3TS0A 4TQUS 2JA5H 1Q8KA 4LF6L 2R7ZH 2ZM6Q 1XPUA 1AE3A 2XTIA 4OXPA 3W5OA 2VQFQ 1VQAA 5GROA 4BY7G 4K0KL 2CKZB 3K81C 1Q12A 4UP9A 3CW2C 4POFA 3KFUA 1WYDA 3KOJA 3KF6B 1L1OB 4DK6C 3Q8DA 4A3MH 4X62Q 1YHBA 4QGUA 1XNQQ 2LXKA 2K52A 3F2BA 2AWOA 5IYBH 1Q82C 2JA7G 1YHQA 4A3JH 1VQ6A 5IYDG 3HKZG 1XMOQ 2NVYH 1VQ4A 5IYCG 1KAWA 1WCMH 3AFQA 4DR1L 3UDGA 4JI4Q 4GKJQ 3CCVA 2RHQB 4B3RQ 5IE8A 1Q1EA 4GNXB 3J80i 1R9TH 1ASZA 4YCVA 4POGA 1PYSB 1OXXK 2AMCB 1HH2P 1TWFH 3AYHB 2QGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A76 A;  1N9W A;  2EXD A;  4QJF A;  4JI5 Q;  3PUY A;  1QVF A;  1UE5 A;  3TS2 A;  2ALY B;  4IFD I;  3G71 A;  1LUZ A;  4B3S Q;  3I2Z A;  1NBW A;  4B3M L;  4RMF A;  4Y52 H;  3S1Q H;  5JEA J;  3BU2 A;  5FLM H;  1JMC A;  4A3B G;  4A3C H;  4P74 A;  4DV6 L;  1GO3 E;  1VQC A;  1KQS A;  4DV3 Q;  5C4J H;  4NXN Q;  1YNX A;  1YJ9 A;  3PUW A;  1VQM A;  4BY1 H;  4QQB X;  3RNU A;  2HHH L;  2K4K A;  2H5X A;  2VQE L;  1E3P A;  3CMA A;  4A3E H;  3CPW A;  1QVG A;  2IX0 A;  2Y0S E;  3H3V H;  1IYJ B;  1V1Q A;  3CD6 A;  3S1N H;  1V9P A;  5DLQ E;  4ALP A;  2YTV A;  4PZ6 A;  1CSQ A;  2Z6K A;  2K14 A;  3D31 A;  4X65 L;  4GLV B;  3HOX H;  4BBS H;  3GTG H;  4KHP Q;  3ZJY C;  2I0Q A;  4A3L H;  3K80 C;  1X9N A;  2K50 A;  5IP9 G;  1XMQ L;  1MJE A;  3VDY A;  1Q46 A;  4DV2 L;  3A0J A;  1GD7 A;  3OTO Q;  3A5U A;  4DV4 Q;  1XMQ Q;  2F4V Q;  4DV7 Q;  2BH8 A;  5M5Y H;  3S14 H;  2UXD L;  3U4Z A;  2GN5 A;  3FHW A;  1OXS C;  1JT8 A;  1LM0 A;  3KJP A;  2JEA I;  5IP7 H;  3I4N G;  5GAD C;  4DAM A;  2WFW A;  4JI1 L;  1SN8 A;  4APV A;  1Z9F A;  4MTN A;  4A3D H;  2ZTE A;  4JI1 Q;  5FJ8 G;  2Y0S G;  3PUX A;  3PSI A;  4JYA Q;  4JC0 A;  3PO2 G;  2ES2 A;  3TEH B;  3A5Z B;  3STB C;  4A3F G;  1CKO A;  1W2B A;  1HNZ L;  4OON A;  4YWL A;  3OW2 A;  4XTC S;  1D8L A;  1X6O A;  1HJP A;  4NB3 A;  3ICE A;  4JI7 L;  4IFD G;  3UE1 A;  2HQL A;  4YWM A;  1X65 A;  1UE7 A;  1LYL A;  1VQB A;  3FKI H;  4JOI A;  3S15 H;  5LMU L;  4DKA C;  1N36 L;  3ERS X;  1G51 A;  2HIV A;  4LUZ A;  3NEM A;  1EIY B;  5M3M G;  4GNX C;  3D0F A;  4DR5 L;  4LFB Q;  4LF5 L;  2KBN A;  1I94 Q;  1QZG A;  4GLA C;  4HJA A;  3BZK A;  3L0O A;  2IY5 B;  5IWA L;  3STB D;  5GAH C;  2VW9 A;  4TVA B;  3I56 A;  1QZH A;  4BXX G;  1MJC A;  4YWK A;  4DR4 Q;  4DR2 L;  4LFA L;  1GVP A;  2D62 A;  4DR3 L;  3GTQ H;  3T1Y L;  4L5Q A;  4A3E G;  1I50 H;  4A3I H;  3NEL A;  4DR2 Q;  3RZO H;  5JJK A;  1OXV A;  3S1R H;  1HZ9 A;  3S2D H;  1Q1B A;  3PF5 A;  1Y1W H;  2PNH A;  5LMN L;  3BJU A;  4BBS G;  4OX9 L;  1LTL A;  1V43 A;  4JI3 L;  1PH6 A;  3HOV G;  4DR6 L;  3B6Y A;  5LMN Q;  2QA4 A;  4MNO A;  3E9I A;  2I5L X;  3UDX A;  1PH4 A;  1YBY A;  1IBM L;  2UUA L;  1N34 L;  2UUB Q;  1HNX L;  2LXJ A;  3M3Y H;  1IBM Q;  2CWP A;  1A62 A;  2JK8 A;  4KLK A;  3RLF A;  3T1H L;  1B7Y B;  3GTM H;  2EIF A;  4OO1 I;  4AQY L;  1HNX Q;  1KD1 C;  1GKH A;  3GDE A;  1FJG L;  3T1H Q;  3U58 A;  4JI0 Q;  1AE2 A;  2E5L L;  5LMN W;  5BR8 Q;  4YCU A;  1MKH A;  5EAY A;  2OTJ A;  2KHI A;  1ASY A;  3DM3 A;  2A1A A;  5GAE C;  1E24 A;  1E22 A;  3GO5 A;  4DPG A;  3CCQ A;  2YTY A;  4LF7 Q;  2B63 H;  3CF5 A;  4B3T L;  2JA6 G;  1EQR A;  1PH7 A;  2NN6 G;  4YY3 L;  2ZTD A;  1K83 H;  1UWV A;  2CFM A;  2PQA A;  5HGQ A;  4IO9 A;  3G48 A;  4LF6 Q;  2EQS A;  3HOW G;  3F1Z A;  4IFD J;  1PYB A;  1JE5 A;  3LGJ A;  2E2J H;  2AWN A;  3CC4 A;  4K0K Q;  4LF9 L;  1WJJ A;  2R7D A;  2KCT A;  5C44 G;  4X64 L;  4PMW A;  3S24 A;  4Y7N H;  4LF9 Q;  4XIG S;  3EN2 A;  2N78 A;  3GTL H;  2PQA B;  4IOA A;  4A93 G;  4GKK L;  4EX5 A;  2JA8 G;  3I4M G;  3K0X A;  2NZO A;  4RG1 A;  4QIW E;  1XPR A;  3K7U C;  4DR1 Q;  4DV1 L;  2R93 H;  5K36 G;  1JJG A;  3M4O H;  5JJI A;  5AJ3 L;  4UY8 C;  3U4V A;  5IY0 A;  2ZJP A;  2UXB L;  1D7Q A;  3RLN A;  1E1O A;  2UU9 L;  1A63 A;  2ASB A;  4DUY L;  3HOY G;  4DR7 L;  1K8G A;  4LUO A;  1JB7 A;  3HOU H;  3J7Z C;  3BZC A;  5C0X G;  3PO3 G;  4HIM A;  3UDI A;  4A3G H;  1T9H A;  1U0L A;  4LFC L;  4A4I A;  3J81 c;  4B3M Q;  1IL2 A;  1HNW L;  2R6G A;  1VS0 A;  2VZA A;  1VQO A;  1NJI C;  4GOP C;  4DV6 Q;  1SLJ A;  1VQH A;  1FL0 A;  3CME A;  1VQ7 A;  5C4X G;  2KCM A;  5M3F H;  4HJ8 A;  4DNI A;  3J7A 5;  2JA5 G;  1VQG A;  2E8G A;  2R7Z G;  3HOZ H;  4FDB A;  1Z47 A;  1PH1 A;  2HHH Q;  3PIP A;  2VQE Q;  2ZJQ A;  2GVB A;  2Q2I A;  1O7I A;  2WB1 E;  4A3M G;  1BBW A;  4P75 A;  2JJQ A;  3ULL A;  4X65 Q;  2NVQ H;  4JI2 L;  5IYB G;  2NVX H;  5JJL A;  1N33 L;  4A3J G;  4P71 A;  4DV2 Q;  4HJ9 A;  3CC2 A;  4P73 A;  4JBM A;  2R92 H;  1VQJ A;  2ZTC A;  1HZA A;  2HT1 A;  2PMZ E;  1WCM G;  2GVA A;  3CPF A;  2JQO A;  4IPC A;  2MO0 A;  3M7N A;  2UXD Q;  4DV5 L;  1OXT A;  3ULP A;  1UEB A;  1E7Z A;  1L1O C;  3I4O A;  3KJO A;  1H95 A;  1YI2 A;  3A74 A;  3RR5 A;  3TRZ A;  1VCI A;  1WI5 A;  4C2M H;  1HNZ Q;  4R4T A;  3J81 j;  1XTD A;  2YU9 H;  1TWC H;  1N32 L;  1YZ6 A;  2KEN A;  4JI7 Q;  4J15 A;  1P8L A;  2VY3 A;  4KHZ A;  5FLM G;  4A3C G;  5LMU Q;  5GAG C;  1N36 Q;  2VUM H;  2MQH A;  1EWI A;  3PIO A;  2Q2H A;  3GTJ H;  1KC8 C;  4DR5 Q;  4LF5 Q;  1W3S A;  4BY1 G;  5IWA Q;  3HOZ G;  4JI6 L;  1TXY A;  3CCU A;  1CKM A;  4ME3 A;  1VQP A;  1OTC A;  4LFA Q;  1EQQ A;  2NZH A;  2V1C C;  4OWT B;  4DR3 Q;  1PFS A;  5HY6 A;  3T1Y Q;  1KL9 A;  4DUZ L;  4WJ3 M;  1FVI A;  3HOX G;  3AEV A;  4A3L G;  3KYH C;  1I5F A;  4HIO A;  2VS1 A;  2I5M X;  2UXC L;  3OYY A;  3H15 A;  4LF8 L;  1K3R A;  3IRB A;  5H1S E;  1PV4 A;  4JI3 Q;  4OX9 Q;  3S17 H;  4DR6 Q;  2UUA Q;  4LF8 Q;  2N8N A;  3KDF A;  1XJV A;  1TWH H;  2AHO B;  1N34 Q;  3GTP H;  4JG2 A;  4BY7 H;  4JI8 L;  1EIF A;  3CCS A;  4JCV E;  1PH2 A;  2E2I H;  2JEB I;  4R1J A;  2D0P A;  4H02 A;  4YCW A;  5IP7 G;  4JI8 Q;  4AQY Q;  4X66 L;  3M4P A;  4IPH A;  1Q81 C;  1FJG Q;  2E5L Q;  1HR0 L;  4A3D G;  4X66 Q;  3M85 A;  1YEZ A;  4JBW A;  1M1K C;  3S16 H;  5IYD H;  1M90 C;  1IXR A;  4IPD A;  5M5X H;  3CQZ H;  5IYC H;  1YJN A;  1YJW A;  1RL2 A;  5GQO A;  3E0E A;  1IBL L;  3HKS A;  1A8V A;  3KDF B;  1Q86 C;  1NMF A;  2BA1 A;  2XGT A;  3F8T A;  1FGU A;  3CC7 A;  1QUQ A;  2IHF A;  4AH6 A;  4P72 A;  4AYB E;  4A3K H;  2UUC L;  3FKI G;  2OQK A;  2OQ0 A;  3KLW A;  3TRE A;  2B3G A;  3F2D A;  1VQ8 A;  4B3T Q;  4NXM L;  1C7Y A;  3W1B A;  4OWW B;  3WWV A;  5JEA G;  4YY3 Q;  1XNR L;  4X6A H;  3S2H H;  2Z6K C;  1HR0 W;  2LSS A;  2A8V A;  2PI2 A;  1VQF A;  2IHE A;  4LF4 L;  1XNR Q;  4JV5 L;  1PH8 A;  2RHS B;  1XPO A;  4IJH A;  3GD7 A;  2C35 B;  2R7F A;  4A3B H;  1OXU A;  1QUQ B;  4C3J H;  2VNU D;  2F52 A;  4A3I G;  4GLX A;  4X64 Q;  4YHH L;  4C3H H;  1Y1W G;  1X56 A;  1I3Q H;  1J5E L;  3I7F A;  2ZM6 L;  1TWG H;  2YYZ A;  2N3S A;  4HJ5 A;  2JA9 A;  3UE0 A;  1J5E Q;  4GKK Q;  2VQF L;  1SRO A;  4GS3 A;  3CP0 A;  1WOC A;  3AFP A;  3EIV A;  1B8A A;  2NN6 I;  4X62 L;  4DV1 Q;  1XNQ L;  4GNX A;  1K8A C;  1YVC A;  2CQO A;  3F2C A;  1Y1V H;  5AJ3 Q;  4JOI C;  2DGY A;  5IP9 H;  3J80 c;  3U50 C;  4R4O A;  2ATW A;  2UXB Q;  1VQ5 A;  2UU9 Q;  4QY7 A;  4HIK A;  3JAM c;  2QEX A;  2WAQ E;  4DUY Q;  1XMO L;  4DR7 Q;  4BBR H;  2JE6 I;  4GN5 A;  1KRS A;  4LW1 A;  3RZD H;  4JI4 L;  4GKJ L;  1X55 A;  2K5V A;  3EBE A;  4B3R L;  4OWX B;  2B63 G;  4AIM A;  2IX1 A;  1C0A A;  3I4N H;  4O0A A;  4L5R C;  4LFC Q;  1HNW Q;  1CSP A;  1DGS A;  4A3K G;  1A0I A;  4R4Q A;  3CCR A;  2I5H A;  3JAM i;  2KHJ A;  1X54 A;  2MFI A;  1UE1 A;  2K5N A;  4GN3 B;  4JI5 L;  5FJ8 H;  1N8R C;  3PO2 H;  1HZC A;  1L2F A;  4A3F H;  4MZ9 A;  3J81 i;  2OWO A;  5E7N A;  4BA1 I;  3PUV A;  1GM5 A;  1KIX A;  4B3S L;  1X3G A;  3CCL A;  1PH3 A;  2FXQ A;  4L5T A;  5C3E H;  3CCM A;  2WAQ G;  2RCN A;  1YIT A;  1IBK L;  1EYG A;  2ZJR A;  4A75 A;  1PH9 A;  4DV3 L;  1S72 A;  5M3M H;  1K0R A;  1IBK Q;  4NXN L;  1Y14 B;  4JI2 Q;  2RF4 A;  4C3I H;  5C0X I;  1VQD A;  1N33 Q;  4BXX H;  2BH2 A;  1VQK A;  2Q2T A;  1NE3 A;  1C9O A;  3DLL A;  1PH5 A;  3M4Q A;  3PGZ A;  4DV5 Q;  2R93 G;  3GTO H;  4KHP L;  1E1T A;  2D0O A;  3NBH B;  4R4C A;  3CCJ A;  1VQ9 A;  4HJ7 A;  2OTL A;  2L15 A;  4JBK A;  1Y1V G;  3OTO L;  3HOV H;  2WB1 G;  3HOU G;  1HZB A;  1SRU A;  3KF8 B;  2F3I A;  4DV4 L;  4DV7 L;  2OCE A;  1K9M C;  2E2H H;  2F4V L;  4HID A;  4DV0 L;  4BBR G;  4GN4 B;  1YHA A;  1Q7Y C;  3GTK H;  4A3G G;  1CUK A;  2WP8 J;  1KRT A;  4JBJ A;  1N32 Q;  4DV0 Q;  1G29 1;  2VL6 A;  3FP9 A;  1VQI A;  3M9B A;  1TWA H;  3CXC A;  1SMX A;  1X3E A;  3HFZ B;  3PUZ A;  1NTG A;  3PF4 A;  2HIX A;  3CCE A;  5C0X J;  4JYA L;  2YV5 A;  5M3F G;  2Q2U A;  1S3O A;  3G6E A;  3H0G H;  1L0W A;  3L7Z C;  2N49 A;  3PCO B;  4EQ5 A;  1VQN A;  1P16 A;  5IT9 c;  1JJ2 A;  1S40 A;  1IZ6 A;  2YTX A;  2Z0S A;  4JI6 Q;  4KI0 A;  1K73 C;  2JA6 H;  3UDF A;  3MXN B;  4OO1 G;  1PHJ A;  2BA0 A;  5C3E G;  3MEF A;  3E9H A;  4DUZ Q;  3S1M H;  4IPG A;  4NPS A;  2MNA A;  1SFO H;  4LFB L;  1AH9 A;  1PA6 A;  1I94 L;  3CAM A;  3ULJ A;  1QVC A;  2PI2 E;  2UXC Q;  2B29 A;  2R92 G;  3HOW H;  1B70 B;  1BKB A;  5ELO A;  3TQY A;  4DR4 L;  1PVO A;  5M5W H;  1MIU A;  1YIJ A;  1G6P A;  4GOP A;  1EUJ A;  1SE8 A;  2AKW B;  3ER0 A;  1UE6 A;  5C44 H;  4LNQ A;  4IOC A;  3K8A A;  2JA7 H;  4R4I A;  4PZ7 A;  1RIP A;  4WJ4 A;  1EOV A;  4PG3 A;  4LUV A;  4DK3 C;  1HR0 Q;  1EFW A;  4A93 H;  1BVS A;  1NY4 A;  3I55 A;  1VQL A;  2JA8 H;  3I4M H;  1WFQ A;  2UUB L;  2A19 A;  1CKN A;  3H3V I;  4QL5 A;  3G4S A;  3RN5 A;  1IBL Q;  3K7A H;  4LWC A;  4DAY B;  4BA2 I;  3RLO A;  4GOP B;  3AQQ A;  4IJL A;  2UUC Q;  4JI0 L;  5J3B A;  4NXM Q;  1KXL A;  1J6Q A;  1U5K A;  3W1G A;  5BR8 L;  3RN2 A;  2CWA A;  5ELN A;  2VUM G;  3HOY H;  4JV5 Q;  1KHI A;  4LF4 Q;  2NVT H;  2K75 A;  1X3F A;  4PZ8 A;  3L2P A;  2CCZ A;  3PO3 H;  2K5H A;  1VQE A;  4O2D A;  3PV0 A;  2IT1 A;  1SR3 A;  4UP7 A;  1JJC B;  2ID0 A;  3H0G G;  1CKN B;  3NEN A;  3SGI A;  4LF7 L;  3KF6 A;  1L1O A;  3HKZ E;  2DUD A;  4L5S A;  5FLX c;  1I6H H;  1NMG A;  4UP8 A;  1BBU A;  4UPA A;  5C4X H;  4YHH Q;  2MO1 A;  3JC6 6;  4AYB G;  3TS0 A;  4TQU S;  2JA5 H;  1Q8K A;  4LF6 L;  2R7Z H;  2ZM6 Q;  1XPU A;  1AE3 A;  2XTI A;  4OXP A;  3W5O A;  2VQF Q;  1VQA A;  5GRO A;  4BY7 G;  4K0K L;  2CKZ B;  3K81 C;  1Q12 A;  4UP9 A;  3CW2 C;  4POF A;  3KFU A;  1WYD A;  3KOJ A;  3KF6 B;  1L1O B;  4DK6 C;  3Q8D A;  4A3M H;  4X62 Q;  1YHB A;  4QGU A;  1XNQ Q;  2LXK A;  2K52 A;  3F2B A;  2AWO A;  5IYB H;  1Q82 C;  2JA7 G;  1YHQ A;  4A3J H;  1VQ6 A;  5IYD G;  3HKZ G;  1XMO Q;  2NVY H;  1VQ4 A;  5IYC G;  1KAW A;  1WCM H;  3AFQ A;  4DR1 L;  3UDG A;  4JI4 Q;  4GKJ Q;  3CCV A;  2RHQ B;  4B3R Q;  5IE8 A;  1Q1E A;  4GNX B;  3J80 i;  1R9T H;  1ASZ A;  4YCV A;  4POG A;  1PYS B;  1OXX K;  2AMC B;  1HH2 P;  1TWF H;  3AYH B;  2QGQ A; 
#chains in the Genus database with same CATH topology
 1N9W A;  3KLS A;  1F77 A;  1PTO F;  3S9W A;  2ALY B;  4B3S Q;  1NBW A;  5D14 A;  1SNC A;  2ENB A;  1RJT A;  3S1Q H;  5FLM H;  4RGO S;  2L4N A;  1EIG A;  3D4W A;  3K7A B;  4IUN A;  1KDC A;  1YJ9 A;  3PUW A;  1VQM A;  4QQB X;  3RNU A;  2HHH L;  2K4K A;  4KN4 C;  4ZKC B;  3Q0A A;  2J0T D;  1IYJ B;  4PZ6 A;  5I6W A;  4GLV B;  3GTG H;  1PFM A;  4A3L H;  2I0Q A;  5IP9 G;  2C5C A;  2WAC A;  5KEE A;  3VDY A;  1Q46 A;  1M8A A;  1MHW C;  4DV2 L;  3OTO Q;  3A5U A;  3MEH A;  4S3S A;  4DV7 Q;  1EY8 A;  2BH8 A;  1A2U A;  1B53 A;  3S14 H;  3U4Z A;  2UXD L;  2HQE A;  5C4X B;  3FHW A;  2JA5 B;  3I4L A;  3DUZ A;  4LK1 C;  4JI1 L;  2BCO A;  1SN8 A;  1Y8N B;  4APV A;  1Z9F A;  3MWY W;  4DU9 A;  2VXW A;  3C3L A;  5AFW A;  4HCE A;  4XT3 B;  4JI1 Q;  3NTH A;  2K05 A;  3PO2 G;  1W2B A;  1HNZ L;  1X6O A;  2EY6 A;  2RSN A;  3KBG A;  3UE1 A;  4L6T B;  5FO7 B;  3FKI H;  3BDL A;  4WRD A;  3ERS X;  4R8I A;  1G51 A;  3QG1 A;  5JEA H;  1EIY B;  3C2P A;  4JK1 C;  1I94 Q;  1QZG A;  3OSO A;  4C3I G;  3L0O A;  2IY5 B;  2PPB C;  4BXX G;  4TVA B;  2WKC A;  4YWK A;  4RH6 A;  5E1F A;  1PFN A;  3R3O A;  1YNN C;  1B9N A;  3BJU A;  2SDF A;  2MUY A;  2QA4 A;  3UDX A;  1YBY A;  1SAP A;  5KND A;  3O13 A;  2LXJ A;  1E2Z A;  1FNV A;  1B7Y B;  1A6X A;  1GKH A;  2IWH A;  3HOZ B;  3QOJ A;  4TRD A;  1AE2 A;  1STH A;  1YNN D;  4YCU A;  5EAY A;  5C0X H;  2E76 C;  1MD2 D;  1ASY A;  3HOX B;  4BBS B;  2ZXP A;  1SE2 A;  4K6D A;  3CCQ A;  2F4I A;  2B63 H;  1LTI D;  1TU2 B;  5DM7 3;  2IJ0 A;  1WVL A;  1EQR A;  2NN6 G;  2K28 A;  4RGT A;  4HN7 A;  1PLF A;  1O7L A;  2HD3 A;  5HGQ A;  3T13 A;  3G48 A;  4KY6 A;  2KA7 A;  3LGJ A;  3H94 A;  1BCP C;  3C46 A;  4Y7N H;  3NQT A;  4XIG S;  3ND8 A;  4IUR A;  3VYS A;  1LT3 D;  1D5M C;  1K8M A;  3S15 B;  4A93 G;  4V0B A;  4GKK L;  3I4M G;  4FF3 A;  2B39 A;  1SND A;  5K36 G;  3M4O H;  5AJ3 L;  1BCP D;  4M8A A;  3A7L A;  2ASB A;  4DUY L;  1UAP A;  3HOY G;  4DR7 L;  3E0J A;  2N88 A;  4H0L C;  3BZC A;  1STG A;  1CZG A;  1EZ8 A;  4C1N K;  4B3M Q;  4G57 A;  4DV6 Q;  2O2L D;  3CME A;  3R2I A;  4DNI A;  2E8G A;  3KLS X;  3HOZ H;  2KCC A;  1CM9 A;  2KOL A;  3PIP A;  1GJX A;  3GV3 A;  3QR8 A;  4A3M G;  3P75 A;  4X65 Q;  5M5X B;  2NVQ H;  4TKO B;  5IYB G;  3OHX C;  4K8J A;  4R8N A;  4HJ9 A;  3CC2 A;  4JBM A;  1WCM G;  4IPC A;  3M7N A;  4ZYS A;  1E7Z A;  1L1O C;  3KJO A;  2L9H A;  4DN4 M;  2A5H A;  2Q8R E;  5T1I A;  2WAQ B;  1SYF A;  1XWE A;  2F0W A;  1JWM D;  1S5D D;  1SNQ A;  1XTD A;  1PRT F;  2X6G A;  4JI7 Q;  1II3 A;  4A3C G;  1XXG A;  5E4W C;  2F0H A;  3GTJ H;  4OIK A;  2F0J A;  4DR5 Q;  1E0B A;  2F0N A;  4JI6 L;  3CCU A;  4K5W A;  4ME3 A;  1VQP A;  2V1C C;  3T1Y Q;  4WJ3 M;  4K2K A;  2F3W A;  3A8K E;  2VS1 A;  2I5M X;  1WTO A;  1GUW A;  3IRB A;  2PZT A;  2SOB A;  3S17 H;  1NAP A;  2UUA Q;  1IKL A;  1XJV A;  2AHO B;  4BY7 H;  4JI8 L;  5M3F B;  2E2I H;  5ELE A;  2JEB I;  2D0P A;  4H02 A;  4JI8 Q;  3A55 A;  1PYW D;  2F03 A;  4X66 L;  4IPH A;  4A3D G;  4X66 Q;  1M1K C;  3VYT A;  3S16 H;  5IYD H;  1IXR A;  4IPD A;  5M5X H;  2QEJ C;  3CQZ H;  4B08 A;  1A8V A;  1NMF A;  2XGT A;  4FNF A;  1G8Z D;  4AYB E;  2UUC L;  2B3G A;  3VR4 A;  4RGN A;  4YY3 Q;  1HR0 W;  4JV5 L;  1VQF A;  5I9P A;  4LF4 L;  3A8J E;  1B3Q A;  1XPO A;  2R7F A;  1QUQ B;  2F52 A;  4GLX A;  4C2M B;  3IKJ A;  1Y1W G;  1TWC B;  3J81 L;  2B2Y A;  3CKI B;  5CBA E;  1I4G A;  4HJ5 A;  2JA9 A;  2XRS D;  2F0U A;  1F9Q A;  3CP0 A;  2EJM A;  4XT1 B;  4GNX A;  1U4P A;  5CV6 A;  5IP9 H;  3OOC A;  2UU9 Q;  4RHR A;  2F3V A;  1EL0 A;  2JE6 I;  4GN5 A;  2D9U A;  3RZD H;  1V1P B;  1K3B C;  4AYB B;  1B9M A;  2K5D A;  4OWX B;  4LFC Q;  1CSP A;  2WKD A;  2QIL A;  1H9R A;  3CCR A;  2I5H A;  5CV8 A;  3QIA A;  2MFI A;  3DEO A;  4JI5 L;  3H3V C;  3PO2 H;  1EQV A;  4MZ9 A;  2OWO A;  4ZLT F;  3PUV A;  1KIX A;  3TP7 A;  1KLU D;  5JJZ A;  3VR6 A;  2BE5 C;  3CCM A;  1EYG A;  2ZJR A;  4DV3 L;  2KEC A;  3MXP A;  2DY8 A;  3HRZ C;  1GUN A;  1I6V C;  3MC0 B;  4C3I H;  2A6H C;  3BVG A;  5J22 A;  4BXX H;  1Q3L A;  2M9V A;  2MPM A;  1YNJ C;  4ULL A;  2Q2T A;  4H44 C;  1C9O A;  3DLL A;  3EFX D;  3M4Q A;  3PGZ A;  2R93 G;  2BE5 D;  4R4C A;  1AP0 A;  1CK1 A;  2WB1 G;  1HZB A;  3KF8 B;  3K5M A;  2K7V A;  2OCE A;  1K9M C;  1SNM A;  2A6H D;  4HID A;  4BBR G;  1ZXT A;  1I3Q B;  1CUK A;  1YNJ D;  1N32 Q;  1TWG B;  1VQI A;  3K6O A;  3M9B A;  2EJF C;  1BOS A;  4L8J A;  1NTG A;  3R2T A;  5C0X J;  2Q2U A;  4KHV A;  4FXD A;  2AQ2 B;  1PZK D;  1Y1V B;  3SK8 A;  1ZEQ X;  1P16 A;  5IOD A;  1SEB D;  4KI0 A;  1K73 C;  3SDZ A;  3MXN B;  3SXH A;  2NN6 H;  2F0K A;  1PHJ A;  5JAV A;  5C3E G;  3A8I E;  3S1M H;  2XSC A;  2MNA A;  4LFB L;  3I4N B;  2KJX A;  1F2L A;  5ELO A;  4DR4 L;  4RFB A;  5M5W H;  5I2X A;  1YIJ A;  1G6P A;  2Y0S B;  4RGM A;  4Z9C B;  3ER0 A;  1UE6 A;  4PQX A;  4A3F B;  2JA7 H;  4PZ7 A;  1RIP A;  4DGZ A;  3D3R A;  4DFA A;  4WJ4 A;  1I4H A;  4RA8 A;  1VMP A;  4A93 H;  1BVS A;  1U9R A;  3I55 A;  3I4M H;  4RKB A;  4QL5 A;  2BDO A;  5KIX A;  1IBL Q;  2A73 B;  4DAY B;  4BA2 I;  5K36 H;  1ZKO A;  3U9S A;  4IJL A;  2BOS A;  3W1G A;  5BR8 L;  3HOY H;  2IW3 A;  4B9X A;  1KNE A;  2NVT H;  4PZ8 A;  4O2D A;  3PV0 A;  2IT1 A;  3J80 L;  1AFP A;  2ID0 A;  3H0G G;  2E2H B;  1F2M A;  1BBU A;  4KD4 A;  4TQU S;  4LF6 L;  2ZM6 Q;  1XPU A;  1TWA B;  2DNC A;  5EGT A;  2VQF Q;  4KK7 A;  1V1O A;  4K0K L;  2CKZ B;  4UP9 A;  2X6L A;  1GOZ A;  1WYD A;  1HQM C;  4DK6 C;  4A3M H;  1XNQ Q;  5FOB B;  3ITP A;  5I6Y A;  5EKI A;  1HA5 A;  5IYB H;  3F2B A;  1IW7 C;  2JA6 B;  2F0O A;  4KJO A;  1JQY D;  4IUU A;  1WCM H;  4JI4 Q;  4GKJ Q;  1SFO B;  5IE8 A;  2RVL A;  4QB4 A;  1DYQ A;  1STN A;  1E2W A;  3BG3 A;  1TY2 A;  2QGQ A;  4KJN A;  1WTQ A;  1SNO A;  1IW7 D;  1J9O A;  1RF2 D;  4QJF A;  1BBX C;  1J8I A;  1QVF A;  3TS2 A;  1NSN S;  3G71 A;  4N8X 1;  4Y52 H;  1SYC A;  4ZAI A;  4A3C H;  4C3J G;  2V4D A;  2F0M A;  5C4J H;  4NXN Q;  4ZUI A;  2VQE L;  1E3P A;  3DXJ C;  3VA5 A;  1TVX A;  3H3V H;  4QF4 A;  3S1N H;  2PCF B;  5DLQ E;  2EZV A;  2YTV A;  3I8Z A;  3D31 A;  2K14 A;  2E2J B;  1XMQ L;  2F0V A;  3A0J A;  1PZI D;  1XMQ Q;  2F4V Q;  1JOR A;  1OXS C;  1QIL A;  2JEA I;  2EYO A;  2JN4 A;  5GAD C;  5COR A;  1D6E C;  4A3D H;  2H1E A;  1HUN A;  5FJ8 G;  3PUX A;  3FPU B;  4JC0 A;  4JYA Q;  1SSO A;  2B2Y C;  1CKO A;  4M1U B;  4OON A;  3DWP A;  4XTC S;  1WTH A;  5JOB A;  1VDZ A;  4IFD G;  3K57 A;  1G91 A;  1BF4 A;  2NWG A;  2NVY B;  5LMU L;  1N36 L;  3K5O A;  2HIV A;  3MA2 B;  4GNX C;  3D0F A;  1I4X A;  4DK1 A;  4DXG A;  1R9T B;  4GLA C;  4HJA A;  5IWA L;  4J6H A;  2VW9 A;  1QZH A;  1TWF B;  4OIJ A;  4LFA L;  2JP1 A;  3GTQ H;  1H9S B;  4L5Q A;  4A3E G;  1I50 H;  3RZO H;  1OXV A;  4XYQ A;  3S2D H;  2EVB A;  1M4V A;  3PF5 A;  1Y1W H;  5LMN L;  2F0S A;  5D3D A;  4BBS G;  4OX9 L;  1V43 A;  5IIF A;  3S1Q B;  5FLX L;  5JVG 3;  5LMN Q;  3E9I A;  4DAP A;  2K33 A;  5M9O A;  4IFD I;  2CWP A;  3GTM H;  4IZ8 A;  3K5N A;  3GDE A;  4JI0 Q;  2HDL A;  2EE1 A;  2E5L L;  4PV1 C;  1MKH A;  3Q24 A;  2KHI A;  1BDO A;  1E24 A;  1E22 A;  3GTG B;  2YTY A;  3CF5 A;  2XIW A;  2PQE A;  3BVM A;  1F9R A;  4UDU C;  2ZTD A;  3QWN A;  3S14 B;  1TII D;  5L37 A;  4IO9 A;  3HOW G;  3HP3 A;  4K2L A;  3SK6 A;  1JWS D;  1ENF A;  4H7B A;  2KCT A;  5C44 G;  4X64 L;  4KV6 A;  1F9S A;  3EN2 A;  3FKI B;  2PQA B;  5EKK A;  2JA8 G;  1V1P A;  1QNU A;  4QIW E;  3TZU A;  3K7U C;  1QG7 A;  4DR1 Q;  1O78 A;  4DV1 L;  1AZP A;  2R93 H;  4U68 A;  2NBF A;  2F0F A;  3U4V A;  5IY0 A;  2UXB L;  2DJG C;  3QOL A;  4UAI A;  1B1Z A;  1JB7 A;  1SXT A;  2PYK A;  3PO3 G;  2RSO A;  4A4I A;  3J81 c;  1HNW L;  4JPB W;  2R6G A;  1VS0 A;  4RHS A;  1G2T A;  1QB5 D;  2XWB B;  1VQ7 A;  2AUK A;  2K5Q A;  4ZCK A;  3KBX A;  1RKN A;  2R7Z G;  3X3M A;  2FFK B;  3H6M A;  2HHH Q;  3EJI A;  2ZJQ A;  3P20 A;  1CA5 A;  2GVB A;  2K6A A;  1B3A A;  3BS1 A;  4RWS C;  2KEE A;  4JI2 L;  1IKM A;  1XX8 A;  2B63 B;  2NVX H;  5JJL A;  1N33 L;  4A3J G;  4DV2 Q;  4A3K B;  4P73 A;  4QIW B;  3PIP 3;  2ZTC A;  3D8G A;  2PMZ E;  3CPF A;  2GVA A;  1KDB A;  1STA A;  2UXD Q;  4G7Z C;  1EY0 A;  1OXT A;  3ULP A;  1KAB A;  3R8B A;  1WTX A;  1CA6 A;  1SMY C;  1HNZ Q;  4Y7N B;  1C8C A;  2KEN A;  5EBD A;  4J15 A;  2VY3 A;  1DOL A;  1FNW A;  2KED A;  2ZXO A;  2MQH A;  2Q2H A;  1LTA D;  1TY0 A;  3M4O B;  1RCV D;  4BY1 G;  4BWG B;  1SMY D;  4O42 A;  1TXY A;  1GUS A;  3NSW A;  1OTC A;  4OWT B;  3URY A;  1DD2 A;  5HY6 A;  3AEV A;  4QUC A;  4CKB A;  3IAY A;  5CV5 A;  2RCF A;  2F0P A;  2PMZ B;  2N8N A;  1TWH H;  2QCP X;  1ENC A;  1F2Z A;  1EIF A;  3LX0 A;  3CCS A;  1PH2 A;  5IP7 G;  3D4D A;  1KNA A;  1YEZ A;  4JBW A;  1M90 C;  1YJW A;  3CU7 A;  3HKS A;  3KDF B;  1Q86 C;  2NVQ B;  1PH4 A;  1D7Q A;  3BYT B;  4A3K H;  2IHF A;  1CT1 D;  4P72 A;  3ND9 A;  3KLW A;  4NXM L;  4OWW B;  2MGS A;  3WWV A;  4C1N I;  3S2H H;  4IN3 A;  1PH8 A;  2RHS B;  4IJH A;  5J39 A;  4C3J H;  4KY7 A;  4C56 C;  3MFY A;  4A3I G;  1TR5 A;  4ID6 A;  4YHH L;  1X56 A;  1NR4 A;  3UE0 A;  4H13 C;  1H9K A;  1PTO C;  4GKK Q;  1SRO A;  4GS3 A;  1JR0 D;  2Z4H A;  3D6C A;  1CFM A;  5JVH 3;  3GTJ B;  2NN6 I;  3I72 A;  2CQO A;  5AJ3 Q;  1RD9 D;  2RDG A;  3J80 c;  3U50 C;  4R4O A;  1VQ5 A;  1XMO L;  2QEX A;  2WAQ E;  4DUY Q;  4DR7 Q;  3V96 A;  2F0I A;  1BUV T;  1KRS A;  4FF2 A;  1PTO D;  2K5V A;  2OF1 A;  4B3R L;  3FPP A;  4G7O C;  1S4Z A;  2MP1 A;  4O0A A;  5CC4 A;  4L5R C;  3S17 B;  4CJ1 B;  1A0I A;  4R4Q A;  4BY7 B;  3K59 A;  1X54 A;  2ZXR A;  2KCN A;  2K5N A;  2Q8T A;  5FJ8 H;  1N8R C;  2E2I B;  5COY A;  1L2F A;  2I46 A;  1JE4 A;  5CR3 A;  5E7N A;  3P7J A;  2XVS A;  2M00 A;  1X3G A;  5CYU A;  4IFD H;  1PH3 A;  3S16 B;  3HKZ B;  2RCN A;  3CQZ B;  4XQJ A;  3CHB D;  2RF4 A;  1VQK A;  1S5E D;  3AU7 A;  1SJE D;  4MHE A;  4KHP L;  1E1T A;  3TME A;  3NBH B;  1VQ9 A;  2OTL A;  4HJ7 A;  3BZD B;  4HED A;  1Y1V G;  1HXY D;  1STB A;  3GV6 A;  4DV4 L;  3HOU G;  1Q7Y C;  4A3G G;  2WP8 J;  3A54 A;  1KRT A;  2L5T A;  4IUQ A;  3PUZ A;  3I73 A;  1G6Z A;  2HIX A;  1TQO A;  1ET9 A;  2KHS A;  4CJ2 C;  1LAC A;  3Q6S A;  1L0W A;  1HRJ A;  2QF7 A;  2DY7 A;  3MXU A;  1S40 A;  1IZ6 A;  1KDA A;  4JI6 Q;  1BCP B;  3VA7 A;  3UDF A;  3FDT A;  1D1K A;  4OO1 G;  2QKI C;  3NHH A;  3RZD B;  4ZQ3 A;  3OMG A;  2LS0 1;  5FO8 B;  1SE4 A;  3D4R A;  1AH9 A;  2B8G A;  1QVC A;  4CBV A;  2IL8 A;  2B29 A;  2R92 G;  3HOW H;  5CBE E;  3VR5 A;  3BDO A;  4I7A A;  3K58 A;  1EEI D;  1SE3 A;  5CGK A;  4GOP A;  3PO2 B;  5C44 H;  4IOC A;  1X3Q A;  5DEH A;  4R4I A;  4PG3 A;  5IGC A;  1DM0 B;  1NY4 A;  2JA8 H;  4I7Z C;  2UUB L;  2A19 A;  4B9W A;  3H3V I;  3G4S A;  5BN5 A;  4C3I B;  2UUC Q;  5J3B A;  1PFB A;  2K01 A;  1J6Q A;  2VUM G;  2CWA A;  5ELN A;  4JV5 Q;  4F88 A;  1KHI A;  3DWQ A;  4LF4 Q;  1ET6 A;  5K5P A;  3L2P A;  3PO3 H;  1D5Z C;  2K5H A;  4HMI A;  4UP7 A;  1SR3 A;  4LF7 L;  1CKN B;  3SGI A;  3JAM L;  5LL6 S;  3KF6 A;  5FLX c;  1Y8P B;  1I6H H;  1NMG A;  4UP8 A;  2PW5 A;  5KYI A;  4ZK9 B;  2MO1 A;  2LFN A;  1RHP A;  2R7Z H;  1Q8K A;  5IOC A;  2VB3 X;  4OXP A;  1BXT A;  2OXP A;  1VQA A;  3W5O A;  5GRO A;  1IYV A;  4KKU A;  1Q12 A;  1L1O B;  1EQT A;  2J7Z A;  3Q23 A;  3W2D A;  4RAU C;  1G2S A;  2K1B A;  4A3J H;  5IYC G;  1KAW A;  3AFQ A;  3UDG A;  3S1M B;  4XYO A;  2C9O A;  3NQI A;  3CCV A;  2RHQ B;  1PTO H;  3HG9 A;  1OXX K;  4IQZ A;  1CQF A;  5M5W B;  3L7Z C;  3ONA B;  3OPO A;  4A76 A;  2EXD A;  4JI5 Q;  1HFG A;  3SVM A;  3X3N A;  1UE5 A;  2E74 C;  2JA7 B;  1LUZ A;  3I2Z A;  3VR3 A;  4RMF A;  5BN3 A;  4A93 B;  5JEA J;  1D1I A;  3BU2 A;  3R93 A;  5EPL A;  1JMC A;  4P74 A;  4A3B G;  1JCK B;  3I4M B;  1H9M A;  1GO3 E;  1KQS A;  4DV3 Q;  4C3H G;  1YNX A;  4BY1 H;  2H5X A;  3CMA A;  3HOY B;  1VMC A;  3CPW A;  1QVG A;  2IX0 A;  2Y0S E;  4CJ0 B;  1PRT C;  1V9P A;  4ALP A;  2R3Z A;  2NVT B;  1CSQ A;  2Z6K A;  5IT9 L;  1X9N A;  1I4R A;  2PO4 A;  1QOH A;  1GD7 A;  1BQQ T;  5M5Y H;  2GN5 A;  4P2C B;  1JT8 A;  1S5C D;  1PRT D;  2L55 A;  5IP7 H;  2RA4 A;  2WFW A;  1TS2 A;  4MTN A;  2ZTE A;  3MHB A;  3PSI A;  4A3M B;  3TEH B;  2MJ8 A;  2H4O A;  2K04 A;  3NUC A;  3OW2 A;  1D8L A;  1HJP A;  4NB3 A;  1O7Z A;  4RKL A;  4YWM A;  1X65 A;  1UE7 A;  5KNB A;  2OEO A;  1WCM B;  3NEM A;  5G3L F;  5M3M G;  2JSO A;  5D65 A;  3W3A A;  4LFB Q;  4X3T A;  4LF5 L;  1EY4 A;  5GAH C;  4Q5V A;  3I56 A;  1LT5 D;  1MJC A;  1IHZ A;  4J8Q A;  4DR4 Q;  1HUM A;  4DR2 L;  1GVP A;  1EY9 A;  4DR3 L;  4MN3 A;  4A3I H;  5JJK A;  3NEL A;  4DR2 Q;  3TBI B;  3S1R H;  1HZ9 A;  1Q1B A;  2PNH A;  1GUT A;  3VR2 A;  2TMP A;  4DR6 L;  2L12 A;  4JI3 L;  3HOV G;  3CRL C;  3N6R A;  1N34 L;  4CDD C;  1HNX L;  3M3Y H;  2JK8 A;  1A62 A;  1UNS A;  4KLK A;  5C4J B;  2IPK D;  1TS5 A;  4XDX A;  2EIF A;  3T1H L;  4AQY L;  1HNX Q;  1TKW B;  1FJG L;  3T1H Q;  1R4P B;  5TSS A;  5BR8 Q;  3ZYY X;  3S1N B;  1VF5 C;  3DM3 A;  2DJF C;  1QWY A;  2A1A A;  2A68 C;  5GAE C;  1EIH A;  3M4Y A;  4GZY C;  3SEB A;  2B2V A;  4B3T L;  3QB3 A;  1EOT A;  5I2Y A;  4MTK A;  2EOT A;  2NTT A;  1PH7 A;  1ILP A;  1K83 H;  1UWV A;  2XN9 C;  2CFM A;  1U4M A;  1T5E A;  4LF6 Q;  3NWS A;  2LMC B;  3SE0 A;  3F1Z A;  4IFD J;  2A68 D;  1X3P A;  4A3D B;  1PYB A;  1JE5 A;  3J7Y W;  3CC4 A;  3RUZ A;  4K0K Q;  2R7D A;  5D3I B;  2EPB A;  3S24 A;  3FRP B;  1HHV A;  3GTL H;  3FMC A;  2HUG A;  2NZO A;  4RG1 A;  3TP5 A;  1JIC A;  1LV9 A;  5HUR A;  3DWA A;  4RCN A;  3Q22 A;  5E3F A;  4ZKB B;  1O80 A;  1MGS A;  2A6E C;  3RLN A;  1E1O A;  1PZJ D;  2J4X A;  5A2Q E;  3MTS A;  3NWT A;  4EVO A;  1Y69 U;  3HOU H;  3GTQ B;  1I50 B;  3RZO B;  5C0X G;  3S2D B;  1Y1W B;  4NW2 A;  3UDI A;  4V19 0;  4A3G H;  4TSS A;  1LTB D;  1EU4 A;  3QO2 A;  4LAA A;  2VZA A;  2Z1C A;  2PNR C;  5EPJ A;  4GOP C;  1VQO A;  1VQH A;  4KKT A;  1ENA A;  2A6E D;  5C4X G;  2KCM A;  4IAL A;  4HJ8 A;  3GTM B;  2WII B;  3J7A 5;  2JA5 G;  1VQG A;  1Z47 A;  2K32 A;  1PH1 A;  4OHJ A;  2VQE Q;  4WFN 3;  5LHY 1;  2WB1 E;  1CI3 M;  1EZ6 A;  2JJQ A;  4IUT A;  3ULL A;  3NK9 A;  1XTC D;  1PXU A;  4EQP A;  2R92 H;  1ILQ A;  4CKC A;  2HT1 A;  2B2T A;  2JQO A;  2E75 C;  1HCZ A;  4DV5 L;  2L1B A;  3I4O A;  3A74 A;  4F7X A;  3P1H A;  3RR5 A;  1VCI A;  4DNT B;  4DNR B;  1SYD A;  4R4T A;  2YU9 H;  3F2U A;  5I4D A;  1P8L A;  4DXF A;  3OMC A;  5LMU Q;  5GAG C;  1N36 Q;  2VUM H;  5DAU A;  1EWI A;  1KC8 C;  2R93 B;  4HMJ A;  1W3S A;  1W6J A;  5IWA Q;  3HOZ G;  4E6I A;  2WB1 B;  4LFA Q;  1PFS A;  3V05 A;  4DUZ L;  3HOX G;  1AW7 A;  3KYH C;  1I5F A;  4HIO A;  4FO2 A;  2B2U A;  2UXC L;  3OYY A;  2KUM A;  2CH4 W;  1LLR D;  1PV4 A;  4OX9 Q;  3M7G A;  3SHL A;  1S5B D;  3TDQ A;  5JPN C;  5EKL A;  4XXE A;  3GTP H;  5F2D A;  4JCV E;  4R1J A;  2F0E A;  3OWE B;  1MBY A;  2F1M A;  4YCW A;  1UEA B;  5C5M A;  2E5L Q;  1HR0 L;  4DK0 A;  1LT6 D;  1U4L A;  5IYC H;  5C3E B;  5GQO A;  1B2T A;  3CC7 A;  2NVX B;  4CHT B;  1QUQ A;  2Z6B A;  1WD0 A;  2OQK A;  3F2D A;  3A7A B;  4IUP A;  1XNR L;  1C7Y A;  4X6A H;  1HPC A;  2Z6K C;  4FVM A;  2LSS A;  2A8V A;  1XNR Q;  2RBM A;  3EQL C;  3GD7 A;  5IGE A;  4K5V A;  4K14 A;  4YIJ A;  4A3B H;  1STY A;  1EEF D;  4X64 Q;  4C3H H;  3BDC A;  1STE A;  1A3V A;  3I7F A;  1CHQ D;  2YYZ A;  3MFG A;  2N3S A;  5EPK A;  1VF7 A;  2RQX A;  1B8A A;  1EY7 A;  5HGT A;  4X62 L;  4DV1 Q;  4G7H C;  1WTR A;  3F2C A;  1ML0 D;  2K5W A;  3K0Y A;  5A35 A;  3H0G B;  2UXB Q;  2ATW A;  4QY7 A;  5KGU A;  3JAM c;  3DEP A;  1JOQ A;  3H91 A;  4BBR H;  1A15 A;  2CW0 C;  4LW1 A;  3NPP A;  1WD1 A;  3EBE A;  4CDC C;  3G6J B;  2CVR A;  1O7Y A;  2IX1 A;  4AIM A;  1C0A A;  1BCP F;  1XYI A;  1HNW Q;  1DGS A;  2CQA A;  1NNX A;  1GXD C;  1TWH B;  3CRK C;  2KHJ A;  3NTI A;  5JPM C;  1HZC A;  2NTS A;  4KY5 A;  2CW0 D;  4BA1 I;  4B3S L;  4ABN A;  3HEJ A;  2FXQ A;  4L5T A;  5C3E H;  2WAQ G;  1HQR D;  1IBK L;  4KN7 C;  4A75 A;  1PH9 A;  2O4X A;  1S72 A;  5M3M H;  3DHQ A;  1IBK Q;  5FKA C;  4JI2 Q;  5IGB A;  3KF8 A;  1Q8I A;  3HZX A;  3TP6 A;  1N33 Q;  2BH2 A;  3S2H B;  5EJW A;  5EBC A;  1NE3 A;  1EYA A;  3NBI A;  1EYD A;  3GTO H;  1LTS D;  2B2V C;  4JBK A;  3OTO L;  3HOV H;  1SRU A;  3MVV A;  4C3J B;  5CMD A;  4DV7 L;  3I70 A;  2EYH A;  1WTW A;  3RMH A;  1RDP D;  2G9D A;  4GN4 B;  3GTK H;  2L11 A;  3MXN A;  4JBJ A;  2NB0 A;  3TP8 A;  1MSG A;  4EQO A;  3HFZ B;  4NMZ A;  1K28 A;  3CCE A;  5M3F G;  3H0G H;  3OW7 A;  3NXW A;  5IT9 c;  1JJ2 A;  2Z0S A;  2YTX A;  2TSS A;  3OIQ A;  2D5D A;  2FHT A;  2BA0 A;  3MEF A;  2AUJ D;  3E9H A;  4IPG A;  1NCV A;  1I94 L;  3ULJ A;  2G5D A;  2PI2 E;  4ME5 A;  1QNK A;  5ELF A;  1BKB A;  2JYO A;  4DAY A;  1KAA A;  1LO5 D;  3IL8 A;  1A3T A;  3K8A A;  2HCC A;  5DM6 3;  1EOV A;  4LUV A;  4DK3 C;  1EFW A;  1WFQ A;  3WOF A;  1WTV A;  4R9W A;  3RN5 A;  3K7A H;  4ZUJ A;  4LWC A;  4NKL A;  3AQQ A;  1HA6 A;  1SYE A;  4NXM Q;  1KXL A;  1U5K A;  1U4R A;  4LJZ C;  2JXM B;  3GP7 A;  4A3E B;  2A69 C;  1X3F A;  1I4Q A;  1PDQ A;  2WIN B;  1JJC B;  3NEN A;  5ELD A;  1FGB D;  2B2T C;  4OEL B;  1JOK A;  1CZW A;  3HKZ E;  4L5S A;  1JWU D;  1DON A;  1PMR A;  1TT2 A;  2EDG A;  4WJW A;  4ZRZ A;  5C4X H;  4YHH Q;  4AYB G;  3JC6 6;  3VYU A;  2JA5 H;  4DA2 A;  4HAE A;  1AE3 A;  2A69 D;  4LMQ D;  2XTI A;  1GHJ A;  3CW2 C;  3L3O C;  3HS0 C;  3KFU A;  3KOJ A;  1JB3 A;  2I07 B;  2RDF A;  2K52 A;  3C1F A;  4CGY B;  3MAQ A;  4U67 3;  2JA7 G;  5BN4 A;  2NZ1 D;  1XMO Q;  4HR7 B;  1VQ4 A;  4DAV A;  1EWC A;  2RKS A;  4B3R Q;  4KTA A;  3J7A F;  3DMU A;  1MSH A;  4FXG C;  4YCV A;  2SEB D;  3HOW B;  1QJO A;  2AMC B;  1HH2 P;  3PMF A;  1A3U A;  3SK4 A;  1ICF B;  3PUY A;  5C44 B;  3EVQ A;  2B2U C;  1ONL A;  5T1G A;  1HTL D;  1I4P A;  2F0G A;  1SYG A;  4B3M L;  4HTH A;  4DV6 L;  2EYF A;  2JA8 B;  2B2W A;  1VQC A;  2F0T A;  1LTG D;  2FMC A;  1IL8 A;  1SNP A;  2QDL A;  2SNS A;  5LL6 X;  3K5L A;  1LAB A;  2FJ2 A;  4A3E H;  2X69 A;  1OO9 B;  1V1Q A;  3CD6 A;  2QW7 A;  1NR2 A;  2RDH A;  2EYM A;  1D5X C;  3PO3 B;  2OT2 A;  3HOX H;  4X65 L;  4KHP Q;  4BBS H;  5I9O A;  3ZJY C;  3K80 C;  2K50 A;  1MJE A;  4X3K A;  1DZ1 A;  3QJY A;  4DV4 Q;  1I6H B;  1SBB B;  2R7Z B;  1LM0 A;  3KJP A;  3I4N G;  1GUG A;  4DAM A;  3FVQ A;  2EY1 A;  5C6A A;  3JAM E;  2G9H D;  2Y0S G;  2ES2 A;  3A5Z B;  3STB C;  4A3F G;  2KQ3 A;  3J81 E;  1BO0 A;  4YWL A;  4CKE A;  2DNE A;  3ICE A;  1CTM A;  4JI7 L;  1H9S A;  2HQL A;  1LYL A;  4A3J B;  1VQB A;  1Y8O B;  4JOI A;  4CDE C;  3S15 H;  2WV6 D;  4DKA C;  1CHP D;  4LUZ A;  1IYU A;  2EY5 A;  4DR5 L;  2KBN A;  1PTO B;  3BZK A;  1EFI D;  1ICW A;  3STB D;  1SJH D;  2D62 A;  3T1Y L;  1EWH A;  2Q8I B;  2QDB A;  3PIO 3;  1ESR A;  1LTL A;  1PH6 A;  1E2V A;  3B6Y A;  4JVZ A;  2UUA L;  4MNO A;  1DOM A;  2I5L X;  3FEW X;  2DN8 A;  1C4Q A;  3MZ5 A;  3TZD A;  1IBM L;  2UUB Q;  1KLG D;  1IBM Q;  3RLF A;  3NP8 A;  4OO1 I;  4FF4 A;  1JOO A;  4BY1 B;  1KD1 C;  3U58 A;  4OL7 A;  5LMN W;  1RTN A;  5KYL A;  2OTJ A;  5EQ0 A;  1DCZ A;  1SYB A;  3GO5 A;  4DPG A;  2O5I C;  4X3S A;  4LF7 Q;  3KLR A;  2JA6 G;  4YY3 L;  1EYC A;  5M5Y B;  4F87 A;  5FO9 B;  3TN2 A;  2EY2 A;  2PQA A;  4G4K A;  4FYD A;  2EQS A;  5IT9 E;  5FK9 C;  3UI2 A;  4PMB A;  1F2Y A;  2AWN A;  4LF9 L;  1WJJ A;  4PMW A;  1MI2 A;  4XQN A;  2EYL A;  3OWF A;  3RD4 A;  3E3X A;  4LF9 Q;  3LWU A;  1KTK A;  4KKS A;  2BDN A;  2N78 A;  4IOA A;  4EX5 A;  3K0X A;  1XPR A;  1JJG A;  4OGQ C;  5JJI A;  4UY8 C;  1QCB D;  4KD3 A;  2ZJP A;  2A74 C;  2UU9 L;  1A63 A;  1K8G A;  1Z7T A;  4LUO A;  3SR1 A;  2EYP A;  3J7Z C;  4A3I B;  1NUC A;  3S1R B;  2EYJ A;  4HIM A;  4PMC A;  1T9H A;  1U0L A;  4LFC L;  1IL2 A;  1GUO A;  1F9P A;  2F0D A;  1NJI C;  1SLJ A;  1FL0 A;  4JW0 A;  3M3Y B;  5M3F H;  4FDB A;  4RCO A;  3T56 B;  2Q2I A;  1O7I A;  2FMM A;  1BBW A;  1R4Q B;  4P75 A;  1DXM A;  5C3X A;  4HSP A;  1QE6 A;  4P71 A;  1VQJ A;  1HZA A;  1K83 B;  2GA4 B;  1B4O A;  2MO0 A;  1AN8 A;  2XNA C;  1BR9 A;  3J80 E;  1UEB A;  2PZU A;  3I91 A;  1H95 A;  1YI2 A;  3IFD A;  3TRZ A;  1CQV A;  4PNY A;  1WI5 A;  4C2M H;  3J81 j;  1EY5 A;  1TWC H;  2ZT9 C;  1YZ6 A;  1N32 L;  1X32 A;  3GTL B;  4KHZ A;  5FLM G;  1JC7 A;  4WOR A;  2AQ3 B;  3PIO A;  3T4A C;  4LF5 Q;  2L0C A;  1LT4 D;  4KMU C;  1CKM A;  3VYR A;  4F8M A;  3HOU B;  1EQQ A;  2NZH A;  4QUF A;  4DR3 Q;  3L9A X;  1KL9 A;  1FVI A;  4XQQ A;  4NP5 A;  4A3L G;  4A3G B;  4LF8 L;  3H15 A;  1K3R A;  5H1S E;  5IGD A;  1H9J A;  4JI3 Q;  4DR6 Q;  4LF8 Q;  3KDF A;  3KUP A;  1N34 Q;  4J1M A;  4JG2 A;  4HCS A;  1HFN A;  4AQY Q;  3M4P A;  1Q81 C;  1FJG Q;  5DNF A;  2B2W C;  3M85 A;  1K0S A;  3WDN A;  5KNC A;  1YJN A;  1RL2 A;  1IBL L;  3E0E A;  2BA1 A;  3F8T A;  1L0X B;  2PZW A;  1FGU A;  1S5F D;  4AH6 A;  3FKI G;  3TRE A;  2OQ0 A;  4Q0F A;  1VQ8 A;  4B3T Q;  2R92 B;  2ICI A;  3W1B A;  5JEA G;  2F0Q A;  1B50 A;  4DF7 A;  3OIP A;  2PI2 A;  2IHE A;  2IX3 A;  3T16 A;  3TSS A;  1EU3 A;  1PRT B;  2C35 B;  4QCL A;  4FXK C;  1LTR D;  1OXU A;  2VNU D;  3ERQ A;  3BYY B;  2YU9 B;  1I3Q H;  1J5E L;  1W6K A;  2ZM6 L;  1TWG H;  2Z8L A;  2AQ1 B;  1J5E Q;  4FP5 D;  1ESF A;  1DOK A;  2VQF L;  1FYC A;  2VUM B;  1V8Q A;  1WOC A;  3AFP A;  4BS9 A;  3EIV A;  2XWJ B;  3E6Z X;  1XNQ L;  2M2L A;  1K8A C;  1YVC A;  4N9T A;  1Y1V H;  3I90 A;  4JOI C;  2DGY A;  1EY6 A;  4HIK A;  4ODG A;  4MIU A;  4GKJ L;  4JI4 L;  1X55 A;  3AB9 A;  4L63 B;  2K03 A;  2FIN B;  5E4X A;  3T53 B;  2B63 G;  3I4N H;  4OEM B;  4A3K G;  3KK7 A;  3G7L A;  2CHB D;  1TS4 A;  1T5X D;  2ICE C;  3JAM i;  1FNU A;  4I65 A;  5IGG A;  1UE1 A;  4GN3 B;  3GTP B;  1AEX A;  2HCI A;  2Z9H A;  3H09 A;  4K8I A;  4A3F H;  2SNM A;  4UHV A;  3J81 i;  1GM5 A;  1DJR D;  5FLX E;  2Z4I A;  3CCL A;  4OO1 H;  2EXZ A;  2E2D C;  1YIT A;  3NBH A;  3E5S A;  1SDF A;  3NTK A;  1K0R A;  3WOE A;  4NXN L;  1C48 A;  1Y14 B;  5C0X I;  5KRU A;  1VQD A;  2CH4 A;  1GHK A;  3DM1 A;  1PH5 A;  4DV5 Q;  2XRQ D;  2D0O A;  3CCJ A;  3T51 B;  2L15 A;  2D2C C;  4A3B B;  1A2T A;  1TS3 A;  2E2H H;  2F4V L;  2F3I A;  4IUV A;  4DV0 L;  2O5J C;  4C3H B;  1YHA A;  2P5Z X;  4DV0 Q;  1G29 1;  2VL6 A;  3FP9 A;  4FF1 A;  1TWA H;  3CXC A;  2B8F A;  1SMX A;  1X3E A;  3PF4 A;  3AMU A;  5ISR A;  5G3L D;  1K8O A;  4JYA L;  2YV5 A;  2KVM A;  3SK5 A;  1S3O A;  3G6E A;  2LKV A;  2F0L A;  3PCO B;  2N49 A;  2R61 A;  3ERO A;  4EQ5 A;  1VQN A;  3J7A V;  5ELB A;  2JA6 H;  4BBR B;  5A2Q L;  3D6W A;  2VB2 X;  4DUZ Q;  1SFO H;  4NPS A;  5C4Z A;  1PA6 A;  4ILW A;  1D2B A;  3CAM A;  2UXC Q;  3C1E A;  2PW7 A;  1UUP A;  1B70 B;  3TQY A;  1PVO A;  1LTT D;  1MIU A;  4EQN A;  1EUJ A;  1SE8 A;  2AKW B;  1Q90 A;  4LNQ A;  5NUC A;  1ZYR C;  3HGB A;  4N8F A;  1L0Y B;  1HR0 Q;  1RTO A;  1Z6H A;  1WTP A;  1VQL A;  1CKN A;  4X3U A;  5M3M B;  2NYZ D;  2LY7 A;  5ELC A;  1HTP A;  3LNN A;  5J1Z A;  3RLO A;  4GOP B;  5C4H A;  4JI0 L;  1FD7 D;  3GQB A;  1ZYR D;  3RN2 A;  4QMG A;  2N55 A;  2NUC A;  3GTO B;  2K75 A;  2CCZ A;  1VQE A;  2E2J H;  3IFT A;  5CV7 A;  1L1O A;  5C3W A;  2DUD A;  4HSV A;  4EGV A;  1B44 D;  3N52 A;  3HOV B;  5C5L A;  3PQI A;  4K5X A;  3V2T A;  3GTK B;  4UPA A;  3I3C A;  3MXG A;  3NE5 B;  3TS0 A;  4O1N A;  2MHV A;  4CDF C;  2HDM A;  4N9P A;  5CV4 A;  4NDX A;  4BY7 G;  3K81 C;  1ROD A;  4POF A;  3KF6 B;  3Q8D A;  4X62 Q;  1YHB A;  2EJG C;  4QGU A;  1AZQ A;  4K6L A;  3BVZ A;  2LXK A;  2AWO A;  1Q82 C;  1YHQ A;  5CV9 A;  1VQ6 A;  5IYD G;  3A56 A;  3HKZ G;  1BNZ A;  2NVY H;  4DR1 L;  1Q1E A;  4GNX B;  3J80 i;  1R9T H;  1ASZ A;  3U9O A;  4POG A;  1PYS B;  3EA6 A;  5IGF A;  1TWF H;  3LWE A;  3AYH B;  1FR3 A; 
#chains in the Genus database with same CATH homology
 4A76 A;  1N9W A;  2EXD A;  4QJF A;  4JI5 Q;  3PUY A;  1QVF A;  1UE5 A;  3TS2 A;  2ALY B;  4IFD I;  3G71 A;  1LUZ A;  4B3S Q;  3I2Z A;  1NBW A;  4B3M L;  4RMF A;  4Y52 H;  3S1Q H;  5JEA J;  3BU2 A;  5FLM H;  1JMC A;  4A3B G;  4A3C H;  4P74 A;  4DV6 L;  1GO3 E;  1VQC A;  1KQS A;  4DV3 Q;  5C4J H;  4NXN Q;  1YNX A;  1YJ9 A;  3PUW A;  1VQM A;  4BY1 H;  4QQB X;  3RNU A;  2HHH L;  2K4K A;  2H5X A;  2VQE L;  1E3P A;  3CMA A;  4A3E H;  3CPW A;  1QVG A;  2IX0 A;  2Y0S E;  3H3V H;  1IYJ B;  1V1Q A;  3CD6 A;  3S1N H;  1V9P A;  5DLQ E;  4ALP A;  2YTV A;  4PZ6 A;  1CSQ A;  2Z6K A;  2K14 A;  3D31 A;  4X65 L;  4GLV B;  3HOX H;  4BBS H;  3GTG H;  4KHP Q;  3ZJY C;  2I0Q A;  4A3L H;  3K80 C;  1X9N A;  2K50 A;  5IP9 G;  1XMQ L;  1MJE A;  3VDY A;  1Q46 A;  4DV2 L;  3A0J A;  1GD7 A;  3OTO Q;  3A5U A;  4DV4 Q;  1XMQ Q;  2F4V Q;  4DV7 Q;  2BH8 A;  5M5Y H;  3S14 H;  2UXD L;  3U4Z A;  2GN5 A;  3FHW A;  1OXS C;  1JT8 A;  1LM0 A;  3KJP A;  2JEA I;  5IP7 H;  3I4N G;  5GAD C;  4DAM A;  2WFW A;  4JI1 L;  1SN8 A;  4APV A;  1Z9F A;  4MTN A;  4A3D H;  2ZTE A;  4JI1 Q;  5FJ8 G;  2Y0S G;  3PUX A;  3PSI A;  4JYA Q;  4JC0 A;  3PO2 G;  2ES2 A;  3TEH B;  3A5Z B;  3STB C;  4A3F G;  1CKO A;  1W2B A;  1HNZ L;  4OON A;  4YWL A;  3OW2 A;  4XTC S;  1D8L A;  1X6O A;  1HJP A;  4NB3 A;  3ICE A;  4JI7 L;  4IFD G;  3UE1 A;  2HQL A;  4YWM A;  1X65 A;  1UE7 A;  1LYL A;  1VQB A;  3FKI H;  4JOI A;  3S15 H;  5LMU L;  4DKA C;  1N36 L;  3ERS X;  1G51 A;  2HIV A;  4LUZ A;  3NEM A;  1EIY B;  5M3M G;  4GNX C;  3D0F A;  4DR5 L;  4LFB Q;  4LF5 L;  2KBN A;  1I94 Q;  1QZG A;  4GLA C;  4HJA A;  3BZK A;  3L0O A;  2IY5 B;  5IWA L;  3STB D;  5GAH C;  2VW9 A;  4TVA B;  3I56 A;  1QZH A;  4BXX G;  1MJC A;  4YWK A;  4DR4 Q;  4DR2 L;  4LFA L;  1GVP A;  2D62 A;  4DR3 L;  3GTQ H;  3T1Y L;  4L5Q A;  4A3E G;  1I50 H;  4A3I H;  3NEL A;  4DR2 Q;  3RZO H;  5JJK A;  1OXV A;  3S1R H;  1HZ9 A;  3S2D H;  1Q1B A;  3PF5 A;  1Y1W H;  2PNH A;  5LMN L;  3BJU A;  4BBS G;  4OX9 L;  1LTL A;  1V43 A;  4JI3 L;  1PH6 A;  3HOV G;  4DR6 L;  3B6Y A;  5LMN Q;  2QA4 A;  4MNO A;  3E9I A;  2I5L X;  3UDX A;  1PH4 A;  1YBY A;  1IBM L;  2UUA L;  1N34 L;  2UUB Q;  1HNX L;  2LXJ A;  3M3Y H;  1IBM Q;  2CWP A;  1A62 A;  2JK8 A;  4KLK A;  3RLF A;  3T1H L;  1B7Y B;  3GTM H;  2EIF A;  4OO1 I;  4AQY L;  1HNX Q;  1KD1 C;  1GKH A;  3GDE A;  1FJG L;  3T1H Q;  3U58 A;  4JI0 Q;  1AE2 A;  2E5L L;  5LMN W;  5BR8 Q;  4YCU A;  1MKH A;  5EAY A;  2OTJ A;  2KHI A;  1ASY A;  3DM3 A;  2A1A A;  5GAE C;  1E24 A;  1E22 A;  3GO5 A;  4DPG A;  3CCQ A;  2YTY A;  4LF7 Q;  2B63 H;  3CF5 A;  4B3T L;  2JA6 G;  1EQR A;  1PH7 A;  2NN6 G;  4YY3 L;  2ZTD A;  1K83 H;  1UWV A;  2CFM A;  2PQA A;  5HGQ A;  4IO9 A;  3G48 A;  4LF6 Q;  2EQS A;  3HOW G;  3F1Z A;  4IFD J;  1PYB A;  1JE5 A;  3LGJ A;  2E2J H;  2AWN A;  3CC4 A;  4K0K Q;  4LF9 L;  1WJJ A;  2R7D A;  2KCT A;  5C44 G;  4X64 L;  4PMW A;  3S24 A;  4Y7N H;  4LF9 Q;  4XIG S;  3EN2 A;  2N78 A;  3GTL H;  2PQA B;  4IOA A;  4A93 G;  4GKK L;  4EX5 A;  2JA8 G;  3I4M G;  3K0X A;  2NZO A;  4RG1 A;  4QIW E;  1XPR A;  3K7U C;  4DR1 Q;  4DV1 L;  2R93 H;  5K36 G;  1JJG A;  3M4O H;  5JJI A;  5AJ3 L;  4UY8 C;  3U4V A;  5IY0 A;  2ZJP A;  2UXB L;  1D7Q A;  3RLN A;  1E1O A;  2UU9 L;  1A63 A;  2ASB A;  4DUY L;  3HOY G;  4DR7 L;  1K8G A;  4LUO A;  1JB7 A;  3HOU H;  3J7Z C;  3BZC A;  5C0X G;  3PO3 G;  4HIM A;  3UDI A;  4A3G H;  1T9H A;  1U0L A;  4LFC L;  4A4I A;  3J81 c;  4B3M Q;  1IL2 A;  1HNW L;  2R6G A;  1VS0 A;  2VZA A;  1VQO A;  1NJI C;  4GOP C;  4DV6 Q;  1SLJ A;  1VQH A;  1FL0 A;  3CME A;  1VQ7 A;  5C4X G;  2KCM A;  5M3F H;  4HJ8 A;  4DNI A;  3J7A 5;  2JA5 G;  1VQG A;  2E8G A;  2R7Z G;  3HOZ H;  4FDB A;  1Z47 A;  1PH1 A;  2HHH Q;  3PIP A;  2VQE Q;  2ZJQ A;  2GVB A;  2Q2I A;  1O7I A;  2WB1 E;  4A3M G;  1BBW A;  4P75 A;  2JJQ A;  3ULL A;  4X65 Q;  2NVQ H;  4JI2 L;  5IYB G;  2NVX H;  5JJL A;  1N33 L;  4A3J G;  4P71 A;  4DV2 Q;  4HJ9 A;  3CC2 A;  4P73 A;  4JBM A;  2R92 H;  1VQJ A;  2ZTC A;  1HZA A;  2HT1 A;  2PMZ E;  1WCM G;  2GVA A;  3CPF A;  2JQO A;  4IPC A;  2MO0 A;  3M7N A;  2UXD Q;  4DV5 L;  1OXT A;  3ULP A;  1UEB A;  1E7Z A;  1L1O C;  3I4O A;  3KJO A;  1H95 A;  1YI2 A;  3A74 A;  3RR5 A;  3TRZ A;  1VCI A;  1WI5 A;  4C2M H;  1HNZ Q;  4R4T A;  3J81 j;  1XTD A;  2YU9 H;  1TWC H;  1N32 L;  1YZ6 A;  2KEN A;  4JI7 Q;  4J15 A;  1P8L A;  2VY3 A;  4KHZ A;  5FLM G;  4A3C G;  5LMU Q;  5GAG C;  1N36 Q;  2VUM H;  2MQH A;  1EWI A;  3PIO A;  2Q2H A;  3GTJ H;  1KC8 C;  4DR5 Q;  4LF5 Q;  1W3S A;  4BY1 G;  5IWA Q;  3HOZ G;  4JI6 L;  1TXY A;  3CCU A;  1CKM A;  4ME3 A;  1VQP A;  1OTC A;  4LFA Q;  1EQQ A;  2NZH A;  2V1C C;  4OWT B;  4DR3 Q;  1PFS A;  5HY6 A;  3T1Y Q;  1KL9 A;  4DUZ L;  4WJ3 M;  1FVI A;  3HOX G;  3AEV A;  4A3L G;  3KYH C;  1I5F A;  4HIO A;  2VS1 A;  2I5M X;  2UXC L;  3OYY A;  3H15 A;  4LF8 L;  1K3R A;  3IRB A;  5H1S E;  1PV4 A;  4JI3 Q;  4OX9 Q;  3S17 H;  4DR6 Q;  2UUA Q;  4LF8 Q;  2N8N A;  3KDF A;  1XJV A;  1TWH H;  2AHO B;  1N34 Q;  3GTP H;  4JG2 A;  4BY7 H;  4JI8 L;  1EIF A;  3CCS A;  4JCV E;  1PH2 A;  2E2I H;  2JEB I;  4R1J A;  2D0P A;  4H02 A;  4YCW A;  5IP7 G;  4JI8 Q;  4AQY Q;  4X66 L;  3M4P A;  4IPH A;  1Q81 C;  1FJG Q;  2E5L Q;  1HR0 L;  4A3D G;  4X66 Q;  3M85 A;  1YEZ A;  4JBW A;  1M1K C;  3S16 H;  5IYD H;  1M90 C;  1IXR A;  4IPD A;  5M5X H;  3CQZ H;  5IYC H;  1YJN A;  1YJW A;  1RL2 A;  5GQO A;  3E0E A;  1IBL L;  3HKS A;  1A8V A;  3KDF B;  1Q86 C;  1NMF A;  2BA1 A;  2XGT A;  3F8T A;  1FGU A;  3CC7 A;  1QUQ A;  2IHF A;  4AH6 A;  4P72 A;  4AYB E;  4A3K H;  2UUC L;  3FKI G;  2OQK A;  2OQ0 A;  3KLW A;  3TRE A;  2B3G A;  3F2D A;  1VQ8 A;  4B3T Q;  4NXM L;  1C7Y A;  3W1B A;  4OWW B;  3WWV A;  5JEA G;  4YY3 Q;  1XNR L;  4X6A H;  3S2H H;  2Z6K C;  1HR0 W;  2LSS A;  2A8V A;  2PI2 A;  1VQF A;  2IHE A;  4LF4 L;  1XNR Q;  4JV5 L;  1PH8 A;  2RHS B;  1XPO A;  4IJH A;  3GD7 A;  2C35 B;  2R7F A;  4A3B H;  1OXU A;  1QUQ B;  4C3J H;  2VNU D;  2F52 A;  4A3I G;  4GLX A;  4X64 Q;  4YHH L;  4C3H H;  1Y1W G;  1X56 A;  1I3Q H;  1J5E L;  3I7F A;  2ZM6 L;  1TWG H;  2YYZ A;  2N3S A;  4HJ5 A;  2JA9 A;  3UE0 A;  1J5E Q;  4GKK Q;  2VQF L;  1SRO A;  4GS3 A;  3CP0 A;  1WOC A;  3AFP A;  3EIV A;  1B8A A;  2NN6 I;  4X62 L;  4DV1 Q;  1XNQ L;  4GNX A;  1K8A C;  1YVC A;  2CQO A;  3F2C A;  1Y1V H;  5AJ3 Q;  4JOI C;  2DGY A;  5IP9 H;  3J80 c;  3U50 C;  4R4O A;  2ATW A;  2UXB Q;  1VQ5 A;  2UU9 Q;  4QY7 A;  4HIK A;  3JAM c;  2QEX A;  2WAQ E;  4DUY Q;  1XMO L;  4DR7 Q;  4BBR H;  2JE6 I;  4GN5 A;  1KRS A;  4LW1 A;  3RZD H;  4JI4 L;  4GKJ L;  1X55 A;  2K5V A;  3EBE A;  4B3R L;  4OWX B;  2B63 G;  4AIM A;  2IX1 A;  1C0A A;  3I4N H;  4O0A A;  4L5R C;  4LFC Q;  1HNW Q;  1CSP A;  1DGS A;  4A3K G;  1A0I A;  4R4Q A;  3CCR A;  2I5H A;  3JAM i;  2KHJ A;  1X54 A;  2MFI A;  1UE1 A;  2K5N A;  4GN3 B;  4JI5 L;  5FJ8 H;  1N8R C;  3PO2 H;  1HZC A;  1L2F A;  4A3F H;  4MZ9 A;  3J81 i;  2OWO A;  5E7N A;  4BA1 I;  3PUV A;  1GM5 A;  1KIX A;  4B3S L;  1X3G A;  3CCL A;  1PH3 A;  2FXQ A;  4L5T A;  5C3E H;  3CCM A;  2WAQ G;  2RCN A;  1YIT A;  1IBK L;  1EYG A;  2ZJR A;  4A75 A;  1PH9 A;  4DV3 L;  1S72 A;  5M3M H;  1K0R A;  1IBK Q;  4NXN L;  1Y14 B;  4JI2 Q;  2RF4 A;  4C3I H;  5C0X I;  1VQD A;  1N33 Q;  4BXX H;  2BH2 A;  1VQK A;  2Q2T A;  1NE3 A;  1C9O A;  3DLL A;  1PH5 A;  3M4Q A;  3PGZ A;  4DV5 Q;  2R93 G;  3GTO H;  4KHP L;  1E1T A;  2D0O A;  3NBH B;  4R4C A;  3CCJ A;  1VQ9 A;  4HJ7 A;  2OTL A;  2L15 A;  4JBK A;  1Y1V G;  3OTO L;  3HOV H;  2WB1 G;  3HOU G;  1HZB A;  1SRU A;  3KF8 B;  2F3I A;  4DV4 L;  4DV7 L;  2OCE A;  1K9M C;  2E2H H;  2F4V L;  4HID A;  4DV0 L;  4BBR G;  4GN4 B;  1YHA A;  1Q7Y C;  3GTK H;  4A3G G;  1CUK A;  2WP8 J;  1KRT A;  4JBJ A;  1N32 Q;  4DV0 Q;  1G29 1;  2VL6 A;  3FP9 A;  1VQI A;  3M9B A;  1TWA H;  3CXC A;  1SMX A;  1X3E A;  3HFZ B;  3PUZ A;  1NTG A;  3PF4 A;  2HIX A;  3CCE A;  5C0X J;  4JYA L;  2YV5 A;  5M3F G;  2Q2U A;  1S3O A;  3G6E A;  3H0G H;  1L0W A;  3L7Z C;  2N49 A;  3PCO B;  4EQ5 A;  1VQN A;  1P16 A;  5IT9 c;  1JJ2 A;  1S40 A;  1IZ6 A;  2YTX A;  2Z0S A;  4JI6 Q;  4KI0 A;  1K73 C;  2JA6 H;  3UDF A;  3MXN B;  4OO1 G;  1PHJ A;  2BA0 A;  5C3E G;  3MEF A;  3E9H A;  4DUZ Q;  3S1M H;  4IPG A;  4NPS A;  2MNA A;  1SFO H;  4LFB L;  1AH9 A;  1PA6 A;  1I94 L;  3CAM A;  3ULJ A;  1QVC A;  2PI2 E;  2UXC Q;  2B29 A;  2R92 G;  3HOW H;  1B70 B;  1BKB A;  5ELO A;  3TQY A;  4DR4 L;  1PVO A;  5M5W H;  1MIU A;  1YIJ A;  1G6P A;  4GOP A;  1EUJ A;  1SE8 A;  2AKW B;  3ER0 A;  1UE6 A;  5C44 H;  4LNQ A;  4IOC A;  3K8A A;  2JA7 H;  4R4I A;  4PZ7 A;  1RIP A;  4WJ4 A;  1EOV A;  4PG3 A;  4LUV A;  4DK3 C;  1HR0 Q;  1EFW A;  4A93 H;  1BVS A;  1NY4 A;  3I55 A;  1VQL A;  2JA8 H;  3I4M H;  1WFQ A;  2UUB L;  2A19 A;  1CKN A;  3H3V I;  4QL5 A;  3G4S A;  3RN5 A;  1IBL Q;  3K7A H;  4LWC A;  4DAY B;  4BA2 I;  3RLO A;  4GOP B;  3AQQ A;  4IJL A;  2UUC Q;  4JI0 L;  5J3B A;  4NXM Q;  1KXL A;  1J6Q A;  1U5K A;  3W1G A;  5BR8 L;  3RN2 A;  2CWA A;  5ELN A;  2VUM G;  3HOY H;  4JV5 Q;  1KHI A;  4LF4 Q;  2NVT H;  2K75 A;  1X3F A;  4PZ8 A;  3L2P A;  2CCZ A;  3PO3 H;  2K5H A;  1VQE A;  4O2D A;  3PV0 A;  2IT1 A;  1SR3 A;  4UP7 A;  1JJC B;  2ID0 A;  3H0G G;  1CKN B;  3NEN A;  3SGI A;  4LF7 L;  3KF6 A;  1L1O A;  3HKZ E;  2DUD A;  4L5S A;  5FLX c;  1I6H H;  1NMG A;  4UP8 A;  1BBU A;  4UPA A;  5C4X H;  4YHH Q;  2MO1 A;  3JC6 6;  4AYB G;  3TS0 A;  4TQU S;  2JA5 H;  1Q8K A;  4LF6 L;  2R7Z H;  2ZM6 Q;  1XPU A;  1AE3 A;  2XTI A;  4OXP A;  3W5O A;  2VQF Q;  1VQA A;  5GRO A;  4BY7 G;  4K0K L;  2CKZ B;  3K81 C;  1Q12 A;  4UP9 A;  3CW2 C;  4POF A;  3KFU A;  1WYD A;  3KOJ A;  3KF6 B;  1L1O B;  4DK6 C;  3Q8D A;  4A3M H;  4X62 Q;  1YHB A;  4QGU A;  1XNQ Q;  2LXK A;  2K52 A;  3F2B A;  2AWO A;  5IYB H;  1Q82 C;  2JA7 G;  1YHQ A;  4A3J H;  1VQ6 A;  5IYD G;  3HKZ G;  1XMO Q;  2NVY H;  1VQ4 A;  5IYC G;  1KAW A;  1WCM H;  3AFQ A;  4DR1 L;  3UDG A;  4JI4 Q;  4GKJ Q;  3CCV A;  2RHQ B;  4B3R Q;  5IE8 A;  1Q1E A;  4GNX B;  3J80 i;  1R9T H;  1ASZ A;  4YCV A;  4POG A;  1PYS B;  1OXX K;  2AMC B;  1HH2 P;  1TWF H;  3AYH B;  2QGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...