4LWCA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lwcA00
5LMNW 1XMQL 1V9PA 4DUYL 4DV3L 1N8RC 3BZCA 4IJHA 2NN6G 2EIFA 4TQUS 1SMXA 4KHPL 2Z0SA 4H02A 2JA6G 2PQAB 1SN8A 3K80C 1FVIA 1EOVA 1CKNA 1W3SA 2Z6KA 1YHQA 1IBKQ 1D7QA 1I94Q 5HGQA 1Y14B 2K5VA 5FJ8G 3KJPA 4JYAQ 3CAMA 4OXPA 1IBKL 1L2FA 5IYDH 1WJJA 4MNOA 1KAWA 5BR8L 3M4OH 4DV2Q 4IO9A 1PH6A 5DLQE 5IYDG 4HIKA 4HIOA 4DV5Q 4YHHQ 1P8LA 4GOPA 3CCEA 3I2ZA 4X64L 3W1BA 3BJUA 2IX0A 4DR5L 4B3TL 3HOYH 1XMQQ 4NXML 1X54A 3JC66 3PUXA 5JEAG 1X3FA 4DR5Q 2HIXA 5C0XJ 1QUQA 1EQQA 3ULPA 3TREA 1Q81C 1QVGA 4KHPQ 2D62A 1ASYA 4IFDG 4DV7L 1X65A 1K0RA 4R4OA 3J80c 1K8GA 1HNWL 2HHHQ 4R4TA 4AQYL 3EIVA 2MO1A 3GTKH 2F3IA 4DR1L 1PFSA 4JI7Q 2WAQG 4GKKL 1X3EA 2JEAI 4LW1A 3F2BA 4RMFA 4GOPC 3NBHB 1IBML 4A3FH 1GD7A 4AIMA 1QZHA 3U58A 4JI1Q 3I4NG 5M3FH 3U50C 4X65Q 3TQYA 1AH9A 1SR3A 2K14A 2UUBQ 1L1OC 5IT9c 1CKMA 4P72A 3H15A 1TWCH 3G71A 1S72A 1VQ7A 2ES2A 1GO3E 5M5WH 1E1TA 4BA1I 3NEMA 1GM5A 2DUDA 4DR3Q 1EQRA 4C3HH 5M3MG 3PF5A 4JI5L 1PH2A 3H3VH 3PV0A 2E2HH 5C4XG 4QGUA 1PHJA 4DNIA 4RG1A 2UXCL 4IOAA 4NPSA 4HJ9A 3LGJA 5IY0A 1EIYB 1S3OA 4O2DA 4POGA 2BA0A 1VQHA 3D0FA 2CKZB 1YITA 1PH1A 2VQEQ 3RLNA 3BZKA 3G4SA 4X65L 4TVAB 4UP8A 1PH3A 2CFMA 3CXCA 1M90C 2E2IH 1KC8C 2ZTEA 1BBUA 3RNUA 3U4VA 3A5UA 1SROA 1B70B 1AE3A 2K50A 3HOZG 1PV4A 4A3GH 4BBRG 2F4VL 1N34L 5IWAL 3GDEA 2NVXH 1Y1VH 1WCMH 1VQDA 4K0KL 1DGSA 1MJCA 4LF9Q 5C44H 3IRBA 4DR6L 1TXYA 4JI5Q 1N34Q 3HOVG 1TWFH 3KOJA 3HOUH 2VY3A 4JC0A 4BA2I 1VQCA 3CCUA 4PZ6A 5J3BA 1Q8KA 4DV4L 3PIPA 2VS1A 4JI8Q 4JBJA 1VQPA 1YZ6A 4KI0A 2UXBQ 4LF7L 3S2DH 4L5QA 2OTJA 2JE6I 2H5XA 2Z6KC 1BBWA 3SGIA 1M1KC 2NVQH 4IJLA 4P73A 2CQOA 4DR7L 3H0GG 2JJQA 2VNUD 4OWXB 2MFIA 1HNZQ 2QA4A 4QQBX 1VQNA 4UY8C 5LMNQ 1J6QA 1Y1WH 5GQOA 4A3KG 1XNRL 2HIVA 3L2PA 1C9OA 1MJEA 1QVCA 1JJGA 1SE8A 4HJAA 3CC7A 1PH5A 1IBLL 1Q12A 2VUMH 4C2MH 1Q7YC 4HJ5A 3PUVA 1VQKA 2ASBA 2JEBI 2JA7H 4OWWB 1CKOA 3I4MH 1GVPA 2Q2HA 1A8VA 4AYBG 3FKIG 1VQ5A 3KDFA 4LFCL 1K8AC 4B3MQ 4DR4Q 3CCLA 3GTJH 1UEBA 2ZJPA 2R7ZH 2R7DA 1WI5A 2UUAL 4DPGA 3K8AA 1EFWA 4GNXB 4QIWE 2XGTA 1XTDA 2PQAA 2YTYA 4PZ7A 2K75A 3F1ZA 3S1QH 2EQSA 4BY1H 4JI7L 1VQFA 3RN5A 2OTLA 3GTOH 1Q46A 3CCVA 2EXDA 2N8NA 1XNRQ 1SRUA 2LSSA 5GROA 2E5LL 3NENA 5GAHC 3PF4A 4GS3A 1N32Q 2KHIA 3B6YA 1IZ6A 4OX9L 4LFBQ 1HZBA 1JE5A 3HKZE 5M5XH 2B63G 4LF5Q 2Q2IA 2JQOA 2IX1A 4DR4L 4PMWA 4EX5A 4A93G 1QZGA 1RIPA 2WP8J 4LF5L 1K83H 1MIUA 3OW2A 3PO3H 3K0XA 1Q82C 1KRSA 2D0OA 3RLFA 2NZOA 3HOWH 4PG3A 3FKIH 2V1CC 3EN2A 2N49A 2UXDQ 1V1QA 1PH9A 1JJCB 1YIJA 5IYCH 1YEZA 3HOVH 4R1JA 4BXXH 1E7ZA 2GVBA 1UE1A 4AQYQ 2UUCL 4KHZA 1L0WA 1N36L 3UDFA 4KLKA 5IP7H 5FLMG 4OWTB 1GKHA 1VQ8A 1BVSA 1XNQL 4JI0L 4DR2Q 1HR0Q 2OWOA 4L5SA 3E9IA 1K73C 3TRZA 4YWLA 2VQFQ 5IWAQ 1JB7A 2I0QA 4A3LG 4JI3Q 4BBSH 1TWAH 3H0GH 5C0XI 1HNXL 1XPUA 2I5MX 1JMCA 2VQFL 2A8VA 2JA9A 1UE5A 1YNXA 1CUKA 3G48A 4DV4Q 3CCJA 2YU9H 2YYZA 1YHBA 3BU2A 4BY7G 4HJ8A 3NELA 2YTXA 4IPGA 5C44G 3OTOQ 4A93H 3HKZG 3MEFA 1V43A 5H1SE 4WJ3M 2PNHA 3M4PA 1IBMQ 1OXTA 3HOUG 3HOWG 4DV1Q 2DGYA 3CCSA 3PO2G 2ATWA 3A5ZB 2MNAA 4JI6L 4LF8L 1UE6A 1HR0W 2Q2UA 1D8LA 2JA8G 3CMEA 1WCMG 1OXUA 3W5OA 4LUZA 5FJ8H 4A3JG 2N78A 4QY7A 1W2BA 2R92H 4LF6L 4HIMA 1X3GA 1J5EQ 1HH2P 4P75A 1NE3A 2RF4A 4JI3L 1EWIA 4X62Q 4DK3C 1LTLA 4ME3A 3TEHB 3GTLH 5C4JH 3I55A 4A3JH 1Q1EA 4K0KQ 4A3LH 3CQZH 4L5TA 4UP7A 3J81i 2VW9A 3S17H 1L1OB 5GADC 4YY3Q 5AJ3Q 1FJGQ 1EYGA 1VQOA 4IFDJ 3KF6B 3STBC 1RL2A 4JG2A 4JI4L 3EBEA 5JJIA 1KQSA 1YJWA 5IE8A 2R93H 4JI2Q 3KJOA 4NXMQ 1YHAA 4XTCS 4X66L 2JA7G 2XTIA 4YWKA 1VQGA 4YCWA 2IY5B 3E0EA 3M7NA 1Y1VG 4MZ9A 1HZCA 3PSIA 1K3RA 1NJIC 1Q86C 3PUWA 1HNZL 2GN5A 3CCMA 4GNXC 3T1YL 1X9NA 5M3FG 1OXSC 3M9BA 3RZOH 1LUZA 3TS0A 2ZJRA 4A3DG 2OQ0A 4LUOA 4QL5A 1VQBA 3ZJYC 2K52A 2UU9Q 1L1OA 4X6AH 5IYBG 4UP9A 1TWGH 4LFBL 3STBD 3M3YH 2B29A 4ALPA 2ZM6L 1X6OA 1HZ9A 5LMUQ 3GO5A 5IP7G 2L15A 3U4ZA 1OXVA 1R9TH 3CCRA 1XMOQ 5E7NA 2I5LX 4P71A 2ZM6Q 1PA6A 3VDYA 4GLXA 3A0JA 4DK6C 4A3CG 4BY1G 3RZDH 2JA5H 3CW2C 4DKAC 3KFUA 3GD7A 1KL9A 2WAQE 4A3MG 1ASZA 2B3GA 3OYYA 2OCEA 2K5NA 3FHWA 4C3JH 1S40A 3T1YQ 1G291 3PO3G 3DM3A 5JJKA 4GN4B 1I94L 4JYAL 3CF5A 4A3MH 3PGZA 2D0PA 3RLOA 3OTOL 4DUZL 3S1MH 4DV0Q 3K81C 2K5HA 2HHHL 1LM0A 2AWNA 4DV1L 4A76A 3I4MG 3S16H 2VZAA 1HR0L 3RN2A 1IXRA 2KCTA 4LNQA 4DAMA 2HQLA 1UWVA 3K7UC 3ULJA 1PYBA 4X64Q 1OTCA 4B3TQ 3L7ZC 1YJ9A 4JV5Q 5C3EH 2N3SA 1A0IA 2R7FA 1WYDA 3J80i 3D31A 4X62L 1PVOA 5FLXc 4LF4L 1C0AA 5ELNA 1E1OA 5C3EG 3S2HH 3HOYG 2Q2TA 2BH8A 2VL6A 3ER0A 2CCZA 1LYLA 2AMCB 5GAGC 4MTNA 1YVCA 2E5LQ 4B3SQ 4GLVB 4GN5A 2NVYH 2Y0SE 4R4IA 1NY4A 5GAEC 4DUZQ 4A3EH 3CCQA 4YCVA 2C35B 2UXCQ 1KIXA 4B3SL 3GTMH 1H95A 1YJNA 3PO2H 4DR7Q 1IYJB 2UUBL 1G6PA 2Y0SG 2RHSB 4APVA 1VQMA 4JI0Q 1CKNB 2E8GA 2NN6I 3RR5A 3AEVA 1VQ6A 2LXKA 3I4NH 3CPFA 3KLWA 5LMNL 1X56A 3CD6A 4LF4Q 4A3BG 1E3PA 1O7IA 4NB3A 4P74A 4GKJQ 2PI2E 3F2CA 3T1HL 5C0XG 1B7YB 1AE2A 2K4KA 3A74A 3J7ZC 2IT1A 3DLLA 4A3BH 4WJ4A 1Q1BA 4GKJL 5M5YH 3CMAA 2WB1E 3PUYA 1U5KA 3GTPH 5C4XH 4X66Q 2ALYB 5IP9H 5LMUL 1Z9FA 1NBWA 4YWMA 4DR2L 1FL0A 2IHFA 3ERSX 4JBMA 1Z47A 1VQIA 2OQKA 2UXBL 4DAYB 1K9MC 2YTVA 2BH2A 1VCIA 2R93G 3TS2A 1PH4A 2KCMA 1E22A 2KHJA 4A75A 1TWHH 1VQLA 2MO0A 2PMZE 5JEAJ 2F4VQ 4B3RQ 3G6EA 3I7FA 2ZJQA 1HNWQ 4DV6L 1WFQA 2ID0A 4C3IH 1CSPA 3JAMc 4OO1G 4A3GG 4GKKQ 1SFOH 3J81j 1YI2A 1N32L 4OONA 1I6HH 3AFPA 4B3ML 4XIGS 1I50H 4OX9Q 2AKWB 4LUVA 4JI1L 1HZAA 1XPOA 2ZTCA 4J15A 2QEXA 3GTQH 5IYBH 3W1GA 2JA5G 2CWPA 1PH7A 4LF7Q 4FDBA 1VS0A 5JJLA 1QUQB 1T9HA 4JOIA 4HIDA 1FGUA 4LF6Q 4Y52H 3L0OA 3Q8DA 4R4QA 4DV7Q 3CP0A 2BA1A 3MXNB 4A3DH 1MKHA 2PI2A 3E9HA 4LFAL 1B8AA 2MQHA 3UDIA 2R7ZG 5M3MH 3K7AH 4NXNL 3KDFB 1QVFA 2HT1A 1VQ4A 4POFA 1XJVA 4O0AA 1FJGL 3F8TA 4Y7NH 1VQAA 4A3IG 1N33L 3S14H 1IBLQ 2F52A 4PZ8A 4JI4Q 1G51A 1U0LA 2KBNA 3UE1A 3KF6A 3KYHC 4A3EG 2VQEL 5BR8Q 2UU9L 4JOIC 4A3KH 4A3CH 4DUYQ 4DV3Q 4A3FG 3J81c 5EAYA 2VUMG 4LWCA 2JA6H 1HNXQ 4JBKA 1I5FA 3M85A 1XMOL 1KD1C 1KHIA 1PYSB 5ELOA 3GTGH 4LF9L 4R4CA 3CC4A 2A19A 3AQQA 3S1NH 1SLJA 1VQEA 2KENA 2ZTDA 5FLMH 1VQJA 3AFQA 1A62A 3J7A5 2FXQA 3AYHB 4DR1Q 4JI6Q 4DV2L 4LF8Q 1HJPA 4L5RC 1IL2A 4BXXG 1NTGA 5HY6A 4DV5L 2RCNA 3HOXG 1BKBA 4IPCA 4JCVE 2YV5A 1OXXK 4A3IH 3S15H 2JK8A 2LXJA 2WFWA 2R6GA 3HFZB 1CSQA 2CWAA 3PUZA 4DR6Q 3I56A 1PH8A 3CC2A 4BY7H 1WOCA 2AHOB 4B3RL 4QJFA 4YCUA 1KRTA 3HOZH 2B63H 4BBRH 5K36G 4BBSG 4UPAA 2RHQB 3UDXA 3JAMi 1E24A 4DR3L 2WB1G 3UDGA 4JI8L 1Y1WG 4IPDA 4YY3L 5AJ3L 2NVTH 2UXDL 3HKSA 4HJ7A 4OO1I 4GLAC 4EQ5A 1YBYA 4DV0L 2E2JH 2NZHA 2UUCQ 1N9WA 3CPWA 1EIFA 1X55A 3M4QA 3KF8B 1N36Q 4AH6A 2R92G 1JT8A 1NMGA 1I3QH 1NMFA 2QGQA 3I4OA 5IYCG 1J5EL 1XNQQ 2IHEA 1A63A 3H3VI 4JV5L 4GN3B 3PCOB 4IOCA 4GNXA 1KXLA 3UE0A 2AWOA 2UUAQ 4JBWA 3WWVA 2I5HA 2JA8H 3F2DA 4DV6Q 4GOPB 4A4IA 4LFAQ 3HOXH 1JJ2A 1P16A 1VQ9A 3S24A 4NXNQ 1EUJA 2GVAA 3FP9A 3ICEA 1XPRA 5IP9G 1N33Q 3T1HQ 4JI2L 1UE7A 3ULLA 4AYBE 1C7YA 3S1RH 3PIOA 4LFCQ 4IPHA 4YHHL 2A1AA 4IFDI
chains in the Genus database with same CATH superfamily
3IFTA 3T4AC 4A3JB 3GTOB 1QILA 3P75A 3VYSA 5IODA 4KHPL 2B2WA 1QE6A 3K80C 4FP5D 5CYUA 3H0GB 1CKNA 1EQVA 1D7QA 1TWCB 4Z9CB 1Y14B 2K5VA 3KJPA 1DOKA 1KAWA 2MHVA 2Q8RE 3M4OB 4K8JA 4V0BA 4YHHQ 2JA5G 1HTLD 3W1BA 4X64L 4B3TL 4BY1B 1F9QA 4NXML 4KN7C 2H4OA 3KLSX 4TSSA 1ZYRD 1EQQA 1QUQA 3ULPA 2XRQD 1BCPC 1SDFA 1K0RA 2ICIA 4CKEA 1SE3A 2HHHQ 4R4TA 1HHVA 1ICWA 3EIVA 2MO1A 1HUNA 1F2LA 3E6ZX 3V96A 4DU9A 2WV6D 1EY4A 1QZHA 3U50C 3D4WA 3EA6A 1F9SA 1L1OC 5IT9c 1VQ7A 2ES2A 4C1NI 4WFN3 1GO3E 1NSNS 1E1TA 3OWEB 1GM5A 5NUCA 4DR3Q 1EQRA 1PH2A 3H3VH 2R61A 2E2HH 2BDNA 2IX3A 2L4NA 4XXEA 1PHJA 5DNFA 3NTKA 3Q0AA 3I90A 4ZUJA 4HJ9A 4XT1B 2L55A 1VQHA 1PH1A 2E2IB 1YITA 4I7AA 3BZKA 5EPLA 4UP8A 2CFMA 4H44C 3RNUA 1U4LA 4LMQD 1DJRD 1B70B 5I6WA 2RQXA 1JICA 1MJCA 3HOUH 4BA2I 1VQCA 3I4LA 4JBJA 1YZ6A 4QUCA 3S2DH 3GTJB 1BXTA 4P73A 3H0GG 3Q24A 5E1FA 4QQBX 1JOKA 2A5HA 5LMNQ 1J6QA 2EY6A 1QOHA 5GQOA 4OIKA 1PH5A 1PRTB 1Q12A 5A2QE 3PUVA 1Y8PB 3I4MH 1LABA 1A8VA 1HFNA 1NAPA 3KDFA 1K8AC 1EWCA 1IHZA 1GUTA 2J4XA 2N88A 1XTDA 3F1ZA 4JI7L 3GTOH 4FXDA 2EXDA 3EROA 1XNRQ 1IKMA 5GAHC 4GS3A 2KHIA 1FNVA 5CC4A 4A3GB 4OX9L 3HKZE 2DY7A 3SR1A 2Q2IA 1JWUD 2A74C 4PMWA 4A3DB 2Z8LA 1QZGA 5M5WB 3DWQA 1AZPA 1MIUA 3OW2A 1KRSA 3RLFA 2NZOA 1BOSA 1I4QA 2IJ0A 3FKIH 4L6TB 3T53B 1EIHA 5IYCH 3OSOA 4BXXH 2GVBA 4KMUC 2IPKD 4KHZA 1L0WA 1N36L 2KQ3A 3FRPB 3UDFA 3MZ5A 4MIUA 1BVSA 1XNQL 4KTAA 4DR2Q 1K73C 4HSPA 3TDQA 2VQFQ 3H0GH 2Q8TA 5C0XI 2HDMA 1XPUA 2I5MX 1JMCA 1XTCD 2A8VA 1JB3A 2EY1A 4WJWA 1CT1D 1PRTF 2EY2A 3V05A 2EDGA 1CA6A 2ENBA 1H9JA 4HJ8A 4IPGA 3OTOQ 3J80E 4PNYA 4A3MB 1TY0A 4EQNA 1IBMQ 3HOWG 4WJ3M 2B2TC 4DV1Q 3A5ZB 5BN4A 4DXGA 4BBRB 4C1NK 1WCMG 5FJ8H 4FNFA 2J7ZA 1J5EQ 2DNEA 5JAVA 4ME3A 3TEHB 3I55A 4OGQC 1EY9A 2VW9A 4G57A 3RZDB 5J39A 4KD4A 3STBC 4JG2A 3MHBA 4HMIA 1WTQA 1TKWB 4JI2Q 1PDQA 3KJOA 4XTCS 2XTIA 1VQGA 2Z4HA 3E0EA 2EYJA 3M7NA 4XQJA 1HZCA 1K3RA 1B50A 2GN5A 3RZOH 1SSOA 1OXSC 2P5ZX 3M9BA 5KNDA 3KK7A 3VR5A 5C4JB 4CJ1B 2K52A 1L1OA 4X6AH 4UP9A 4LFBL 3AB9A 3SE0A 3J7AV 1HZ9A 1PFBA 1GJXA 1OXVA 3RD4A 4FXKC 4X3SA 2ZM6Q 4P71A 3KUPA 4BY1G 2CW0C 3C3LA 4HSVA 3KFUA 3HOWB 1ASZA 2WAQE 5DEHA 3HP3A 3OYYA 2FMCA 2K6AA 5JVH3 1M8AA 2G9HD 3T1YQ 3PO3G 4A3MH 3RLOA 1SBBB 4DV0Q 2K5HA 3A7LA 1LM0A 3FKIB 3NBHA 4JPBW 3I4MG 1GUOA 1IXRA 5G3LD 5KYLA 3GQBA 3K7UC 4RWSC 4JV5Q 3CHBD 2WACA 2N3SA 2WINB 3SVMA 2R7FA 1WYDA 3J80i 4X62L 1PRTC 1PVOA 4LF4L 3EVQA 1E1OA 2KEEA 1EY7A 4CHTB 5C3EG 3S2HH 3P1HA 3HOYG 2VL6A 3ER0A 3ND9A 5G3LF 4MTNA 4GLVB 4R4IA 4DXFA 5LL6X 4YCVA 2UXCQ 2TSSA 2D9UA 2SDFA 2B8FA 1HUMA 1YJNA 1VQMA 2RHSB 2K7VA 2DJGC 3RR5A 2NN6I 4ZKBB 3AEVA 1A6XA 2K5WA 1U4MA 4X3UA 1PRTD 3KLWA 1CZWA 3CD6A 4OHJA 1E3PA 3ITPA 3KF8A 2PI2E 3T1HL 5KRUA 4WJ4A 3J7ZC 3TN2A 4A3BH 3Q22A 2BOSA 1C4QA 5M5YH 3CMAA 1WTWA 3GTPH 5LMUL 3TMEA 1NBWA 1QCBD 2IHFA 1QNUA 5M3FB 2OQKA 4DAYB 1JORA 2R93G 1A3UA 1JR0D 1PH4A 1SEBD 3C2PA 2PMZE 5JJZA 4ZAIA 5C5LA 5A35A 4RHRA 5ELDA 3G6EA 2WKDA 5ELBA 2A69D 1WFQA 1CSPA 5IGDA 4A3GG 3QR8A 1SFOH 3P20A 3A8IE 1N32L 1TS3A 4C3IB 1ENFA 5EJWA 5KNCA 1X3PA 5ELCA 1AFPA 4R9WA 5C0XH 3K5LA 1PZKD 3T56B 1QUQB 4HIDA 1L0XB 1WTXA 4UAIA 1RD9D 4LF6Q 3L0OA 3Q8DA 1EEID 2PPBC 3CP0A 3MXNB 1O7YA 1R4QB 1GUGA 3Q6SA 2R7ZG 5M3MH 1WD0A 1PFNA 3K7AH 2KEDA 1MBYA 2IW3A 4NXNL 5IGEA 1QVFA 2HT1A 2B2YA 2KUMA 4BS9A 4KJNA 1ICFB 3HOYB 1QG7A 4Y7NH 1N33L 2JXMB 1D5MC 4FVMA 1IBLQ 1G51A 1U0LA 5BR8Q 4JOIC 4KD3A 4A3CH 4DV3Q 4A3FG 3MFYA 3VR3A 5C6AA 5EAYA 1S5DD 2JA6H 1HNXQ 1JCKB 3BYTB 3M85A 2B2TA 3GTGH 3K59A 1MSHA 2AQ3B 3MEHA 1EYCA 5FLMH 2EJFC 4XT3B 5HURA 3J7A5 4CJ0B 5FO9B 2I46A 1K8MA 4JI6Q 1IL2A 4DV5L 1UNSA 2K04A 3J81L 3R2IA 2LXJA 2R6GA 3HFZB 1VMPA 4DR6Q 2AHOB 4G4KA 2E75C 3O13A 3HZXA 5K36G 1Y1WG 2F0SA 4IPDA 5CBAE 3NXWA 1EFID 2G5DA 2F0HA 3MC0B 2E2JH 4DV0L 1AN8A 2UUCQ 1EYDA 2VXWA 3CPWA 3EJIA 1G6ZA 1LO5D 1B9NA 3D3RA 2IHEA 5IGBA 2JA5B 3H3VI 4JV5L 1WTOA 1RTOA 1SNCA 4GN3B 2F03A 3UE0A 2AWOA 1LT5D 4JBWA 3WWVA 4DAVA 2F4IA 4GOPB 4A4IA 3P7JA 1VQ9A 4PMBA 3ICEA 4NMZA 3T1HQ 2NUCA 1KLGD 5FK9C 5JOBA 1ENAA 3S1RH 4LFCQ 4YHHL 3FPUB 1WTRA 2A1AA 1K0SA 1V9PA 1S5FD 4DUYL 1N8RC 2OXPA 3BZCA 2NN6G 2EIFA 2Z0SA 2JA6G 1BCPD 3MVVA 1EOVA 2C9OA 1I94Q 5FJ8G 2M9VA 1Y69U 2J0TD 5T1GA 1WJJA 2XSCA 5BR8L 4Y7NB 2PYKA 5I6YA 4IO9A 2RCFA 1B3AA 5IYDG 4HIOA 1SFOB 3BJUA 4DR5L 2XWJB 2R92B 1I6HB 1X54A 1TU2B 3PUXA 4R8NA 4DR5Q 2HIXA 4R4OA 1K8GA 2NVTB 3K5NA 4FYDA 2DNCA 2F3IA 4DR1L 4GKKL 3AU7A 2CH4W 1UUPA 4LK1C 4GOPC 3F2BA 4RMFA 1FGBD 2B39A 3NK9A 2H1EA 3I4NG 5EBDA 4RHSA 4G7OC 4C3HG 1KAAA 5M3MB 3U9SA 3S15B 3K5OA 2PO4A 4DAYA 2WKCA 4C3HH 5M3MG 4RKBA 4C56C 3PF5A 2EYMA 1RJTA 5C4XG 5ELFA 3D4DA 4RG1A 4KY7A 3SK6A 4IOAA 1D5ZC 3LGJA 1EIYB 4IURA 1S3OA 4O2DA 3D6CA 2WB1B 3IKJA 3RLNA 3G4SA 1B53A 4IUUA 4X65L 1M90C 4KKTA 3CXCA 2E2IH 1KC8C 2FMMA 3U4VA 3A5UA 1SROA 2NBFA 2NVYB 3HOZG 1R9TB 1PV4A 3TZUA 2NVXH 1WCMH 1JOOA 1T5EA 4LF9Q 2E2DC 3IRBA 1Y1VB 4DR6L 3VYRA 3HOVG 2XN9C 1TWFH 4JC0A 3CCUA 2IL8A 5CR3A 1F77A 1YNND 1HCZA 2L1BA 4LF7L 2H5XA 2PCFB 1KDBA 3QIAA 5C5MA 2VNUD 4F88A 2A6HC 4UY8C 5CMDA 1EEFD 5CV5A 2FHTA 1NR2A 1XNRL 3PMFA 3I8ZA 2ICEC 1MJEA 1QVCA 1SE8A 2VUMH 3CC7A 1YNNC 4C2MH 1VQKA 2F0JA 4HJ5A 1PTOB 2ASBA 2JA7H 2NVXB 1GVPA 1Q3LA 3FKIG 3KBGA 4N9TA 5C44B 4B3MQ 3I4MB 4DR4Q 4U68A 1NUCA 2ZJPA 2R7DA 5CV4A 3K8AA 4QIWE 4PZ7A 2PQAA 2YTYA 1ONLA 1HFGA 4DGZA 1B3QA 2OTLA 1B2TA 1Q46A 2A69C 1A2UA 1EY0A 1EU4A 4X3KA 2LSSA 3NENA 3E0JA 3HG9A 1WTHA 3B6YA 5EKIA 1HZBA 1JE5A 2N55A 3D8GA 1SE2A 5M5XH 1H9KA 1GOZA 2XWBB 2F0GA 4DR4L 4FF4A 2IX1A 2OT2A 1A3VA 4A93G 2F0OA 1GUNA 1LT3D 1STYA 3PO3H 3K0XA 3HOWH 1FNWA 4OIJA 1NCVA 4PG3A 4A93B 1AEXA 2N49A 2UXDQ 1S4ZA 1JJCB 1YIJA 3HOVH 1BDOA 4RAUC 1UE1A 2B2YC 4KLKA 5IP7H 5FLMG 1GKHA 1VQ8A 4OELB 5COYA 2OWOA 1HR0Q 1DCZA 3TRZA 1NR4A 2F0WA 4YWLA 1JB7A 1TY2A 2O2LD 4JI3Q 4BBSH 1TWAH 1A3TA 2QCPX 3TP6A 5EKKA 2VQFL 3R93A 2JA9A 1UE5A 3C1EA 1CUKA 2EOTA 2EZVA 3BU2A 3TP5A 3NELA 4J1MA 3VYTA 5H1SE 1BBXC 1D6EC 3M4PA 3HOUG 2DGYA 3C1FA 3CCSA 3VYUA 2MNAA 1UE6A 2KVMA 5I4DA 2JA8G 1K28A 2QW7A 2R7ZB 3MWYW 1D1KA 3MAQA 4A3KB 4A3JG 4BY7B 4RCNA 2PNRC 1ZXTA 1HH2P 2RF4A 4JI3L 5J22A 1EWIA 3GTLH 2QKIC 1Q1EA 4TKOB 4A3LH 4UP7A 4WRDA 5EKLA 4YY3Q 1F2ZA 2M00A 5AJ3Q 1BR9A 4C3IG 1KABA 4ZKCB 2OEOA 5FLXL 1K3BC 1ZEQX 5IE8A 1LT4D 2R93H 1TVXA 5I9PA 3FEWX 4NXMQ 1YHAA 4X66L 4YWKA 4YCWA 2CHBD 4I7ZC 1Q8IA 4MZ9A 1DXMA 1LTID 1NJIC 3DHQA 2PW5A 4O42A 2ZT9C 4GNXC 3T1YL 2IWHA 5M3FG 4U673 4IQZA 2QEJC 2OQ0A 4LUOA 2ZJRA 4A3DG 2HD3A 1FNUA 2UU9Q 3F2UA 2AUJD 4G7HC 3M3YH 2FFKB 5JVG3 4ALPA 1IW7C 1X6OA 4MTKA 5IOCA 3W2DA 5IP7G 2L15A 4OL7A 3QO2A 3Q23A 2AQ2B 2I5LX 2ZXRA 3VDYA 3A0JA 4DK6C 2A6ED 4A3CG 3GD7A 2M2LA 2OCEA 4KY5A 4NKLA 5CORA 3RUZA 2F0KA 3DXJC 2KHSA 1G291 3DM3A 3EQLC 3PGZA 2D0PA 4ZYSA 2HHHL 1JQYD 2DY8A 3DWAA 4IUVA 4DAMA 4ODGA 3SEBA 2HQLA 2X6LA 2Q8IB 2F0VA 3ULJA 1PYBA 2MP1A 4H13C 1OTCA 3UI2A 1I4XA 1A0IA 2A6EC 2EYPA 4B9XA 3GTLB 5ELNA 3K58A 4FF2A 2DN8A 3K5MA 1JWSD 1KDCA 3LX0A 2KOLA 2NVYH 2Y0SE 5GAEC 4DUZQ 3CCQA 4C3JG 3GTMH 2F3VA 1I6VC 4B9WA 4DR7Q 1IYJB 2UUBL 1G6PA 2Y0SG 3MXNA 3CPFA 2PZWA 1X56A 4F7XA 1PTOD 5E4XA 2NVQB 3C46A 1O7IA 5KGUA 3T16A 5AFWA 4GKJQ 3F2CA 2F0UA 5C0XG 5EBCA 2K4KA 4Q0FA 4X3TA 3PUYA 1SXTA 4X66Q 1MD2D 5IP9H 4HR7B 1Z9FA 2KJXA 1KNEA 4DR2L 3PQIA 4UDUC 4JBMA 4AYBB 1VQIA 2PZUA 3S14B 1TWHB 3TS2A 1GHKA 1TWHH 1VQLA 2PMZB 3ND8A 1C8CA 1HNWQ 2ID0A 1YI2A 3QOJA 1I6HH 1DOLA 3NWSA 4OX9Q 2AKWB 4JI1L 3BDCA 1XPOA 2QEXA 1TT2A 5IYBH 3GTQB 4FDBA 4JVZA 1KNAA 1T9HA 5D3DA 4CDEC 4CKBA 1D5XC 1GUSA 1MKHA 3E9HA 4LFAL 2PQEA 4QIWB 2VB3X 5IGGA 2NTSA 1VQ4A 4POFA 4K2LA 1TQOA 2K5DA 2F52A 3J81E 2K03A 3KF6A 2VQEL 4DNTB 4RGTA 2VUMG 4LWCA 1I5FA 4ZRZA 1JE4A 3NQTA 5ELOA 3E3XA 4HEDA 1BUVT 3CC4A 1QB5D 1F2MA 1IYUA 1SLJA 2KENA 2ZTDA 1VQJA 3AFQA 1A62A 3VA5A 3FDTA 5DAUA 1S5BD 2B2UA 1HJPA 4L5RC 1M4VA 5HY6A 1BCPF 1SYFA 2YV5A 2HDLA 1OXXK 1F9RA 2JK8A 1TWFB 1PZID 1CSQA 3HOZB 2R3ZA 3RMHA 4BY7H 4B3RL 3I73A 4QJFA 4YCUA 1KRTA 4UPAA 2RHQB 3UDGA 4JW0A 4JI8L 3I3CA 1SJHD 3R8BA 2E76C 1LLRD 2G9DA 1YBYA 2NZHA 2EYOA 1N36Q 1V1PA 3KF8B 4RH6A 3I4OA 1XX8A 1Z7TA 2CH4A 1J5EL 1XNQQ 3S17B 1EY6A 3S1NB 3TP7A 1F2YA 5C4HA 2JSOA 4K6DA 1HA5A 2PW7A 4IN3A 1JJ2A 1P16A 1HQMC 1XWEA 1VMCA 4NXNQ 3QB3A 3S2DB 2R93B 1EUJA 3FP9A 1O78A 1XPRA 4JI2L 1UE7A 3HRZC 3ULLA 4AYBE 2JA6B 1B4OA 5D3IB 4IJHA 4TQUS 2RDGA 2EVBA 3WOFA 4H02A 2AUKA 4FF1A 1SN8A 4OO1H 2CVRA 3TBIB 1W3SA 1SNOA 5TSSA 4JYAQ 5HGQA 1PTOF 3CAMA 1LTGD 1L2FA 1EOTA 1BCPB 1MI2A 3FPPA 4MNOA 4DV2Q 2HCCA 1PH6A 4DFAA 4HIKA 1P8LA 4GOPA 1S5CD 4EQOA 4ZLTF 2KA7A 4A3IB 3HOYH 1G2TA 3IAYA 3NUCA 5JEAG 3DEPA 4J6HA 5C0XJ 1QVGA 2F0FA 3LWUA 4IFDG 3J7YW 1KTKA 3J80c 1Y1WB 1HNWL 5FKAC 4AQYL 3E5SA 1PFSA 1IYVA 1X3EA 3SK8A 2O4XA 4KJOA 4A3FH 1GD7A 3U58A 4JI1Q 1U9RA 5M3FH 4X65Q 1SR3A 1HA6A 1TR5A 3BS1A 1W6JA 3G71A 1S72A 4DAPA 1D1IA 3D4RA 1UAPA 4CJ2C 4BA1I 4N8X1 2DUDA 2X69A 3TP8A 4JI5L 1BQQT 1I50B 2JP1A 4OEMB 1RHPA 3DM1A 5IY0A 2CKZB 4HN7A 2VQEQ 4TVAB 1PH3A 3VR2A 4XQQA 1MHWC 1WCMB 3KLRA 1CHQD 1AE3A 4A3GH 1YNJD 4BBRG 2F4VL 1N34L 5IWAL 3GDEA 1VQDA 5M5XB 1RCVD 1DGSA 3J7AF 5C44H 2OF1A 4JI5Q 4KN4C 4PZ6A 2F0DA 5J3BA 1Q8KA 4DV4L 4JI8Q 4KI0A 2UXBQ 1HRJA 2OTJA 3LWEA 3L3OC 2D2CC 5DM73 2JJQA 1SYGA 4OWXB 1HNZQ 1SNMA 2QA4A 4H7BA 3N52A 5JEAH 3BG3A 1VQNA 3S2HB 1FD7D 5K5PA 2HIVA 1QWYA 5JPMC 2BE5C 4HJAA 1IBLL 4N9PA 3VA7A 2AQ1B 1Q7YC 5FO7B 2JEBI 4OWWB 1EL0A 1O7LA 1FR3A 3SK5A 4LFCL 1VQ5A 3G7LA 2EPBA 3GTJH 2B2VA 2R7ZH 1WI5A 2K75A 1SNPA 2F0MA 3S1QH 2EQSA 2EXZA 1SRUA 2BE5D 2E5LL 3PF4A 3OMCA 1N32Q 1TS4A 5L37A 4M1UB 5CBEE 3MA2B 1HXYD 3OWFA 3SDZA 3HS0C 4LF5Q 4BBSB 3K7AB 2QDBA 1R4PB 3S9WA 2L9HA 2WIIB 1ET9A 4EX5A 5DM63 3KBXA 4RFBA 1RIPA 1K83H 1Q82C 4FF3A 2D0OA 2V1CC 2EYLA 3EN2A 3QOLA 1STEA 5ELEA 1V1QA 4NP5A 2E2HB 2RA4A 5LHY1 1YEZA 1RTNA 4PQXA 2K1BA 3GV6A 3ERQA 3M7GA 2UUCL 1QJOA 4RA8A 5IGFA 1TWGB 1KDAA 4JI0L 2K33A 3S1QB 3E9IA 4A3BB 4A3LG 2I0QA 4S3SA 2O5IC 3BYYB 3G48A 1OO9B 4DV4Q 3CCJA 1YHBA 4BY7G 2O5JC 4A93H 2YTXA 3GP7A 3HKZG 2PNHA 3KLSA 4LF8L 2L5TA 4KK7A 1HR0W 1S5ED 2QILA 1H9SA 3CMEA 2B2UC 1OXUA 4LUZA 2N78A 4QY7A 3JAML 2R92H 1X3GA 1RODA 1FYCA 3A8JE 4P75A 4X62Q 4DK3C 3OPOA 5CGKA 3CQZH 4L5TA 3J81i 3S17H 2EJMA 1FJGQ 1EYGA 2RSOA 5KEEA 4KKSA 3EBEA 3LNNA 1IW7D 4NDXA 1YJWA 1KQSA 1B1ZA 4JI4L 4RGOS 1EU3A 3TSSA 1GHJA 2SOBA 2JA7G 2IY5B 1ZYRC 3PSIA 1EIGA 1H9RA 3PUWA 1CA5A 3CCMA 1X9NA 2CQAA 1V1PB 1VQBA 4G7ZC 3ZJYC 5IYBG 2B63B 2NWGA 3CRKC 5LMUQ 3GO5A 1R9TH 4L63B 1CFMA 2K5QA 2JA5H 5IGCA 5EQ0A 4DKAC 4A3MG 2B3GA 3A54A 5C3XA 4C3JH 1S40A 5JJKA 1HTPA 1I94L 3CF5A 3OTOL 4DUZL 5I2YA 4I65A 3R3OA 3K81C 3ZYYX 4DV1L 3S16H 2VZAA 1HR0L 4LJZC 2KCTA 1B9MA 1UWVA 4X64Q 4B3TQ 3L7ZC 5C3EH 1AP0A 5LL6S 1BF4A 2KECA 5FLXc 4XQNA 4EQPA 4ZQ3A 1ET6A 4QUFA 2Q2TA 2BH8A 4IALA 1LYLA 5GAGC 4B3SQ 1SMYC 4PMCA 2E5LQ 1IL8A 4GN5A 4KHVA 3HKZB 3J80L 1NY4A 3H6MA 4A3EH 2LY7A 4B3SL 1DZ1A 3PO2H 4APVA 1VQ6A 2KCNA 1STBA 2LXKA 4K5WA 1H9MA 1PFMA 3HOVB 5LMNL 4L8JA 4CBVA 4A3BG 4NB3A 4P74A 1B7YB 4F87A 3A74A 3A56A 5FO8B 3DLLA 2JYOA 1AZQA 3OIQA 1Q1BA 4GKJL 1I4PA 2WB1E 4TRDA 2B2VC 1NNXA 4K14A 2ALYB 1FL0A 1ML0D 1RF2D 1Z47A 1K9MC 2YTVA 1VCIA 4C2MB 3MXUA 1YNJC 1E22A 2KCMA 2KHJA 4A75A 3NTIA 1IKLA 5JEAJ 2RDFA 4DV6L 2X6GA 4C3IH 3JAMc 4OO1G 3J81j 3K6OA 4OONA 4MHEA 3PIP3 1I50H 4LUVA 3M3YB 1HZAA 1X32A 1LT6D 3GTKB 4LF7Q 3W1GA 2CWPA 1PH7A 3BDOA 1VS0A 3H3VC 2DJFC 2HUGA 5JJLA 2VUMB 4JOIA 5EPKA 4ULLA 1FGUA 4Y52H 2F0PA 4DV7Q 5KNBA 4QB4A 2BA1A 4A3DH 5EGTA 2PI2A 2FINB 2MQHA 1JWMD 3KDFB 1WTPA 4FXGC 1ZKOA 2B2WC 4BWGB 2KBNA 2UU9L 3UE1A 1UEAB 4A3EG 1K8OA 4DUYQ 3MXGA 1JOQA 3MXPA 2ZXPA 1A15A 1B44D 3K57A 1W6KA 1PLFA 3OIPA 2XRSD 3NP8A 2A19A 2XNAC 3AMUA 2NZ1D 4H0LC 1LTTD 4EVOA 1HQRD 2FXQA 3M4YA 1E0BA 1MGSA 1RDPD 4F8MA 4BXXG 5E4WC 2SEBD 2RCNA 3BVMA 3HOXG 4IPCA 4JCVE 2F0IA 4A3IH 3HOUB 1X3QA 3PUZA 2JN4A 3IFDA 3I56A 3CC2A 4E6IA 4BBRH 3JAMi 4DR3L 3UDXA 1XJVA 2RSNA 4RGNA 1V1OA 2NVTH 4YY3L 5AJ3L 1C48A 2UXDL 4HJ7A 4OO1I 1STAA 1EIFA 2HCIA 1NMGA 1NMFA 5IYCG 4GNXA 3X3NA 2UUAQ 2I5HA 3HGBA 4DK1A 3F2DA 4DV6Q 1CZGA 1STGA 3W3AA 4O1NA 5IP9G 1N33Q 3TZDA 3PIOA 3RZOB 1SNQA 4GN4B 5LMNW 1XMQL 4IFDH 4DV3L 1SJED 3MTSA 1G2SA 4J8QA 3URYA 5J1ZA 1SMXA 2GA4B 1E2VA 4ZK9B 2PQAB 4DA2A 5JPNC 3GV3A 1FVIA 3H91A 1TWAB 1IBKQ 2Z6KA 1YHQA 3ONAB 1RKNA 4CDCC 4OXPA 1IBKL 5IYDH 1DOMA 3BZDB 3M4OH 1G91A 1PTOH 2MJ8A 5DLQE 2B8GA 2NB0A 4DV5Q 3CCEA 3I2ZA 3K0YA 3S1RB 2IX0A 4RCOA 2EYHA 5M9OA 1XMQQ 4CDFC 3JC66 2LS01 4FO2A 1X3FA 1Q81C 4KHPQ 3TREA 2Z6BA 2D62A 1ASYA 4DV7L 1X65A 3HEJA 3GTKH 4JI7Q 2WAQG 2JEAI 4LW1A 1IBML 3NBHB 5CV7A 4AIMA 2A73B 1V8QA 1SNDA 3TQYA 3BVZA 1AH9A 2K14A 4NW2A 4K5VA 1CM9A 2UUBQ 4HCEA 1CKMA 1LTRD 5C4XB 3QJYA 4P72A 1TWCH 5CV9A 3H15A 1BNZA 4ME5A 1STNA 5M5WH 2RVLA 3NEMA 3DWPA 3PV0A 3T13A 1T5XD 2C5CA 4QGUA 4DNIA 2UXCL 4IUNA 3I4NB 4NPSA 5KIXA 4POGA 2BA0A 3D0FA 2KCCA 4K8IA 2Z1CA 4YIJA 2ZTEA 1BBUA 2BCOA 1DM0B 2K50A 5HGTA 4IUQA 2JA8B 1Y1VH 4K0KL 1PXUA 2K05A 3PO2B 1TXYA 2V4DA 2HQEA 5CV8A 1N34Q 3KOJA 2VY3A 1SMYD 1I4HA 3PIPA 2VS1A 1BO0A 2FJ2A 1VQPA 5A2QL 3NE5B 4XDXA 4L5QA 1Y8NB 4K2KA 2JE6I 1M1KC 2Z6KC 1BBWA 3SGIA 4DK0A 2NVQH 1E2ZA 4IJLA 3QG1A 2CQOA 4DR7L 3FVQA 2MFIA 1STHA 2PZTA 2Z9HA 5C3EB 1PTOC 2L11A 1Y1WH 2LKVA 4A3KG 3NQIA 3G6JB 1L0YB 3L2PA 1C9OA 4DF7A 5IT9L 1JJGA 1SE4A 4V190 1I4RA 1CKOA 2Q2HA 4AYBG 3MFGA 3CCLA 1UEBA 2UUAL 4DPGA 1EFWA 2MGSA 4GNXB 2XGTA 1CQVA 3T51B 4BY1H 1EY5A 1VQFA 3RN5A 2E74C 5BN3A 4R8IA 3CCVA 2MPMA 2N8NA 5GROA 1SYDA 3CRLC 5T1IA 2A68D 1IZ6A 4KKUA 1G8ZD 4DN4M 4LFBQ 4XYOA 2Y0SB 2B63G 1QNKA 5EPJA 1SYBA 1J8IA 2JQOA 4C3JB 1GXDC 4PV1C 2RDHA 2WP8J 3NHHA 4LF5L 5C4ZA 2F0QA 5C3WA 1EWHA 1Z6HA 1TS5A 1PH9A 4HMJA 4UHVA 4R1JA 5I9OA 1E7ZA 1CK1A 4AQYQ 5BN5A 2A68C 4OWTB 1F9PA 3CQZB 4L5SA 3OW7A 2F3WA 3R2TA 5IWAQ 3A7AB 1HNXL 1EZ6A 2K28A 4Q5VA 2LMCB 3OMGA 2YU9B 1CI3M 1YNXA 1CTMA 1H9SB 2BDOA 4LAAA 1I3QB 2YU9H 2YYZA 2EYFA 1ILQA 1II3A 3CU7A 5C44G 3MEFA 1V43A 2EE1A 1OXTA 1VF7A 3PO2G 2ATWA 4JI6L 1LTSD 2XVSA 5D65A 3HOXB 4MN3A 3SK4A 1ENCA 3A55A 2Q2UA 1D8LA 3WDNA 3BDLA 3I91A 4KV6A 3W5OA 3NSWA 1W2BA 4LF6L 4HIMA 3GTGB 1NE3A 2SNMA 4QCLA 1JC7A 1LTLA 1ESRA 5C4JH 4A3JH 2F1MA 4K0KQ 5F2DA 1L1OB 5GADC 4ZUIA 3D6WA 1VQOA 4IFDJ 3KF6B 1RL2A 2D5DA 2XIWA 4IUPA 5IIFA 4KY6A 5JJIA 5K36H 1LTBD 4A3FB 5I2XA 1XXGA 3DUZA 1WD1A 2F0NA 4C3HB 1Y1VG 1J9OA 1Q86C 1HNZL 3I72A 1LUZA 3CKIB 3TS0A 5FLXE 4QL5A 5ISRA 1MSGA 1TWGH 4N8FA 3STBD 1LV9A 2B29A 2NTTA 5CV6A 2ZM6L 5E3FA 1D2BA 1SAPA 3BVGA 3U4ZA 2L0CA 4IZ8A 3CCRA 2RKSA 1XMOQ 5E7NA 1PA6A 4RKLA 4GLXA 3RZDH 3SXHA 3CW2C 1XYIA 1KL9A 3OHXC 1K83B 4ID6A 1CQFA 2K5NA 1VF5C 3FHWA 3WOEA 2EY5A 1DONA 5KYIA 4JYAL 4K6LA 2L12A 3S1MH 4HAEA 2AWNA 4A76A 3RN2A 4LNQA 3DEOA 3L9AX 3V2TA 1YJ9A 1EZ8A 1CHPD 4M8AA 2CW0D 3D31A 1GUWA 4CKCA 1C0AA 1LTAD 4HTHA 1O80A 1SYCA 2CCZA 5D14A 1Q90A 2AMCB 1YVCA 4WORA 2K01A 2Z4IA 2C35B 1KIXA 3PO3B 1H95A 3FMCA 4CDDC 1ILPA 4JI0Q 5IT9E 1CKNB 2E8GA 3DMUA 3I4NH 1WTVA 2F0LA 2A6HD 4XYQA 4LF4Q 1DYQA 2ZXOA 2TMPA 1AE2A 2IT1A 1EQTA 2QF7A 3GTPB 4P2CB 2E2JB 3EFXD 1U5KA 3N6RA 2F0TA 3NPPA 5C4XH 4QF4A 1O7ZA 4YWMA 3ERSX 3NWTA 2UXBL 2BH2A 2MO0A 4B3RQ 2F4VQ 4CGYB 4GZYC 2JA7B 3I70A 3I7FA 2ZJQA 2RBMA 1Y8OB 4GKKQ 5FOBB 4ILWA 3AFPA 3H94A 4XIGS 4B3ML 3GTQH 2NN6H 1KLUD 2ZTCA 4J15A 4K5XA 1U4RA 1ESFA 3X3MA 1I4GA 2SNSA 3QWNA 2MUYA 4R4QA 1AW7A 4QMGA 4A3EB 1B8AA 3UDIA 4DNRB 2LFNA 4EGVA 3S1MB 4O0AA 2F0EA 1FJGL 3F8TA 1VQAA 4A3IG 3S14H 2EJGC 4PZ8A 4JI4Q 4IUTA 3KYHC 3U9OA 4A3KH 1PMRA 4ZCKA 3VR6A 3J81c 4RGMA 1TIID 1U4PA 4JBKA 1XMOL 1KD1C 1KHIA 1PYSB 2K32A 2I07B 2VB2X 4LF9L 4R4CA 3AQQA 3S1NH 3NBIA 1VQEA 3NTHA 3A8KE 3AYHB 4DR1Q 4LF8Q 4DV2L 1PZJD 1VDZA 3IL8A 1NTGA 3GTMB 1BKBA 1EY8A 3H09A 3S15H 3VR4A 2WFWA 3S16B 1HPCA 2CWAA 1PH8A 2QDLA 1WOCA 1DD2A 2WAQB 3HOZH 2B63H 4BBSG 1E24A 2WB1G 1EYAA 3HKSA 4GLAC 4EQ5A 1LACA 5M5YB 1N9WA 1X55A 3M4QA 3PIO3 4JK1C 4AH6A 2R92G 1JT8A 1I3QH 2QGQA 3JAME 1E2WA 1A63A 4B08A 4ABNA 3PCOB 1SYEA 4IOCA 1KXLA 1WVLA 2JA8H 1PYWD 4LFAQ 3HOXH 1TS2A 3S24A 4HCSA 3SHLA 2GVAA 1C7YA 2NYZD 4IPHA 1A2TA 3OOCA 4IFDI
chains in the Genus database with same CATH topology
5LMNW 1XMQL 1V9PA 4DUYL 4DV3L 1N8RC 3BZCA 4IJHA 2NN6G 2EIFA 4TQUS 1SMXA 4KHPL 2Z0SA 4H02A 2JA6G 2PQAB 1SN8A 3K80C 1FVIA 1EOVA 1CKNA 1W3SA 2Z6KA 1YHQA 1IBKQ 1D7QA 1I94Q 5HGQA 1Y14B 2K5VA 5FJ8G 3KJPA 4JYAQ 3CAMA 4OXPA 1IBKL 1L2FA 5IYDH 1WJJA 4MNOA 1KAWA 5BR8L 3M4OH 4DV2Q 4IO9A 1PH6A 5DLQE 5IYDG 4HIKA 4HIOA 4DV5Q 4YHHQ 1P8LA 4GOPA 3CCEA 3I2ZA 4X64L 3W1BA 3BJUA 2IX0A 4DR5L 4B3TL 3HOYH 1XMQQ 4NXML 1X54A 3JC66 3PUXA 5JEAG 1X3FA 4DR5Q 2HIXA 5C0XJ 1QUQA 1EQQA 3ULPA 3TREA 1Q81C 1QVGA 4KHPQ 2D62A 1ASYA 4IFDG 4DV7L 1X65A 1K0RA 4R4OA 3J80c 1K8GA 1HNWL 2HHHQ 4R4TA 4AQYL 3EIVA 2MO1A 3GTKH 2F3IA 4DR1L 1PFSA 4JI7Q 2WAQG 4GKKL 1X3EA 2JEAI 4LW1A 3F2BA 4RMFA 4GOPC 3NBHB 1IBML 4A3FH 1GD7A 4AIMA 1QZHA 3U58A 4JI1Q 3I4NG 5M3FH 3U50C 4X65Q 3TQYA 1AH9A 1SR3A 2K14A 2UUBQ 1L1OC 5IT9c 1CKMA 4P72A 3H15A 1TWCH 3G71A 1S72A 1VQ7A 2ES2A 1GO3E 5M5WH 1E1TA 4BA1I 3NEMA 1GM5A 2DUDA 4DR3Q 1EQRA 4C3HH 5M3MG 3PF5A 4JI5L 1PH2A 3H3VH 3PV0A 2E2HH 5C4XG 4QGUA 1PHJA 4DNIA 4RG1A 2UXCL 4IOAA 4NPSA 4HJ9A 3LGJA 5IY0A 1EIYB 1S3OA 4O2DA 4POGA 2BA0A 1VQHA 3D0FA 2CKZB 1YITA 1PH1A 2VQEQ 3RLNA 3BZKA 3G4SA 4X65L 4TVAB 4UP8A 1PH3A 2CFMA 3CXCA 1M90C 2E2IH 1KC8C 2ZTEA 1BBUA 3RNUA 3U4VA 3A5UA 1SROA 1B70B 1AE3A 2K50A 3HOZG 1PV4A 4A3GH 4BBRG 2F4VL 1N34L 5IWAL 3GDEA 2NVXH 1Y1VH 1WCMH 1VQDA 4K0KL 1DGSA 1MJCA 4LF9Q 5C44H 3IRBA 4DR6L 1TXYA 4JI5Q 1N34Q 3HOVG 1TWFH 3KOJA 3HOUH 2VY3A 4JC0A 4BA2I 1VQCA 3CCUA 4PZ6A 5J3BA 1Q8KA 4DV4L 3PIPA 2VS1A 4JI8Q 4JBJA 1VQPA 1YZ6A 4KI0A 2UXBQ 4LF7L 3S2DH 4L5QA 2OTJA 2JE6I 2H5XA 2Z6KC 1BBWA 3SGIA 1M1KC 2NVQH 4IJLA 4P73A 2CQOA 4DR7L 3H0GG 2JJQA 2VNUD 4OWXB 2MFIA 1HNZQ 2QA4A 4QQBX 1VQNA 4UY8C 5LMNQ 1J6QA 1Y1WH 5GQOA 4A3KG 1XNRL 2HIVA 3L2PA 1C9OA 1MJEA 1QVCA 1JJGA 1SE8A 4HJAA 3CC7A 1PH5A 1IBLL 1Q12A 2VUMH 4C2MH 1Q7YC 4HJ5A 3PUVA 1VQKA 2ASBA 2JEBI 2JA7H 4OWWB 1CKOA 3I4MH 1GVPA 2Q2HA 1A8VA 4AYBG 3FKIG 1VQ5A 3KDFA 4LFCL 1K8AC 4B3MQ 4DR4Q 3CCLA 3GTJH 1UEBA 2ZJPA 2R7ZH 2R7DA 1WI5A 2UUAL 4DPGA 3K8AA 1EFWA 4GNXB 4QIWE 2XGTA 1XTDA 2PQAA 2YTYA 4PZ7A 2K75A 3F1ZA 3S1QH 2EQSA 4BY1H 4JI7L 1VQFA 3RN5A 2OTLA 3GTOH 1Q46A 3CCVA 2EXDA 2N8NA 1XNRQ 1SRUA 2LSSA 5GROA 2E5LL 3NENA 5GAHC 3PF4A 4GS3A 1N32Q 2KHIA 3B6YA 1IZ6A 4OX9L 4LFBQ 1HZBA 1JE5A 3HKZE 5M5XH 2B63G 4LF5Q 2Q2IA 2JQOA 2IX1A 4DR4L 4PMWA 4EX5A 4A93G 1QZGA 1RIPA 2WP8J 4LF5L 1K83H 1MIUA 3OW2A 3PO3H 3K0XA 1Q82C 1KRSA 2D0OA 3RLFA 2NZOA 3HOWH 4PG3A 3FKIH 2V1CC 3EN2A 2N49A 2UXDQ 1V1QA 1PH9A 1JJCB 1YIJA 5IYCH 1YEZA 3HOVH 4R1JA 4BXXH 1E7ZA 2GVBA 1UE1A 4AQYQ 2UUCL 4KHZA 1L0WA 1N36L 3UDFA 4KLKA 5IP7H 5FLMG 4OWTB 1GKHA 1VQ8A 1BVSA 1XNQL 4JI0L 4DR2Q 1HR0Q 2OWOA 4L5SA 3E9IA 1K73C 3TRZA 4YWLA 2VQFQ 5IWAQ 1JB7A 2I0QA 4A3LG 4JI3Q 4BBSH 1TWAH 3H0GH 5C0XI 1HNXL 1XPUA 2I5MX 1JMCA 2VQFL 2A8VA 2JA9A 1UE5A 1YNXA 1CUKA 3G48A 4DV4Q 3CCJA 2YU9H 2YYZA 1YHBA 3BU2A 4BY7G 4HJ8A 3NELA 2YTXA 4IPGA 5C44G 3OTOQ 4A93H 3HKZG 3MEFA 1V43A 5H1SE 4WJ3M 2PNHA 3M4PA 1IBMQ 1OXTA 3HOUG 3HOWG 4DV1Q 2DGYA 3CCSA 3PO2G 2ATWA 3A5ZB 2MNAA 4JI6L 4LF8L 1UE6A 1HR0W 2Q2UA 1D8LA 2JA8G 3CMEA 1WCMG 1OXUA 3W5OA 4LUZA 5FJ8H 4A3JG 2N78A 4QY7A 1W2BA 2R92H 4LF6L 4HIMA 1X3GA 1J5EQ 1HH2P 4P75A 1NE3A 2RF4A 4JI3L 1EWIA 4X62Q 4DK3C 1LTLA 4ME3A 3TEHB 3GTLH 5C4JH 3I55A 4A3JH 1Q1EA 4K0KQ 4A3LH 3CQZH 4L5TA 4UP7A 3J81i 2VW9A 3S17H 1L1OB 5GADC 4YY3Q 5AJ3Q 1FJGQ 1EYGA 1VQOA 4IFDJ 3KF6B 3STBC 1RL2A 4JG2A 4JI4L 3EBEA 5JJIA 1KQSA 1YJWA 5IE8A 2R93H 4JI2Q 3KJOA 4NXMQ 1YHAA 4XTCS 4X66L 2JA7G 2XTIA 4YWKA 1VQGA 4YCWA 2IY5B 3E0EA 3M7NA 1Y1VG 4MZ9A 1HZCA 3PSIA 1K3RA 1NJIC 1Q86C 3PUWA 1HNZL 2GN5A 3CCMA 4GNXC 3T1YL 1X9NA 5M3FG 1OXSC 3M9BA 3RZOH 1LUZA 3TS0A 2ZJRA 4A3DG 2OQ0A 4LUOA 4QL5A 1VQBA 3ZJYC 2K52A 2UU9Q 1L1OA 4X6AH 5IYBG 4UP9A 1TWGH 4LFBL 3STBD 3M3YH 2B29A 4ALPA 2ZM6L 1X6OA 1HZ9A 5LMUQ 3GO5A 5IP7G 2L15A 3U4ZA 1OXVA 1R9TH 3CCRA 1XMOQ 5E7NA 2I5LX 4P71A 2ZM6Q 1PA6A 3VDYA 4GLXA 3A0JA 4DK6C 4A3CG 4BY1G 3RZDH 2JA5H 3CW2C 4DKAC 3KFUA 3GD7A 1KL9A 2WAQE 4A3MG 1ASZA 2B3GA 3OYYA 2OCEA 2K5NA 3FHWA 4C3JH 1S40A 3T1YQ 1G291 3PO3G 3DM3A 5JJKA 4GN4B 1I94L 4JYAL 3CF5A 4A3MH 3PGZA 2D0PA 3RLOA 3OTOL 4DUZL 3S1MH 4DV0Q 3K81C 2K5HA 2HHHL 1LM0A 2AWNA 4DV1L 4A76A 3I4MG 3S16H 2VZAA 1HR0L 3RN2A 1IXRA 2KCTA 4LNQA 4DAMA 2HQLA 1UWVA 3K7UC 3ULJA 1PYBA 4X64Q 1OTCA 4B3TQ 3L7ZC 1YJ9A 4JV5Q 5C3EH 2N3SA 1A0IA 2R7FA 1WYDA 3J80i 3D31A 4X62L 1PVOA 5FLXc 4LF4L 1C0AA 5ELNA 1E1OA 5C3EG 3S2HH 3HOYG 2Q2TA 2BH8A 2VL6A 3ER0A 2CCZA 1LYLA 2AMCB 5GAGC 4MTNA 1YVCA 2E5LQ 4B3SQ 4GLVB 4GN5A 2NVYH 2Y0SE 4R4IA 1NY4A 5GAEC 4DUZQ 4A3EH 3CCQA 4YCVA 2C35B 2UXCQ 1KIXA 4B3SL 3GTMH 1H95A 1YJNA 3PO2H 4DR7Q 1IYJB 2UUBL 1G6PA 2Y0SG 2RHSB 4APVA 1VQMA 4JI0Q 1CKNB 2E8GA 2NN6I 3RR5A 3AEVA 1VQ6A 2LXKA 3I4NH 3CPFA 3KLWA 5LMNL 1X56A 3CD6A 4LF4Q 4A3BG 1E3PA 1O7IA 4NB3A 4P74A 4GKJQ 2PI2E 3F2CA 3T1HL 5C0XG 1B7YB 1AE2A 2K4KA 3A74A 3J7ZC 2IT1A 3DLLA 4A3BH 4WJ4A 1Q1BA 4GKJL 5M5YH 3CMAA 2WB1E 3PUYA 1U5KA 3GTPH 5C4XH 4X66Q 2ALYB 5IP9H 5LMUL 1Z9FA 1NBWA 4YWMA 4DR2L 1FL0A 2IHFA 3ERSX 4JBMA 1Z47A 1VQIA 2OQKA 2UXBL 4DAYB 1K9MC 2YTVA 2BH2A 1VCIA 2R93G 3TS2A 1PH4A 2KCMA 1E22A 2KHJA 4A75A 1TWHH 1VQLA 2MO0A 2PMZE 5JEAJ 2F4VQ 4B3RQ 3G6EA 3I7FA 2ZJQA 1HNWQ 4DV6L 1WFQA 2ID0A 4C3IH 1CSPA 3JAMc 4OO1G 4A3GG 4GKKQ 1SFOH 3J81j 1YI2A 1N32L 4OONA 1I6HH 3AFPA 4B3ML 4XIGS 1I50H 4OX9Q 2AKWB 4LUVA 4JI1L 1HZAA 1XPOA 2ZTCA 4J15A 2QEXA 3GTQH 5IYBH 3W1GA 2JA5G 2CWPA 1PH7A 4LF7Q 4FDBA 1VS0A 5JJLA 1QUQB 1T9HA 4JOIA 4HIDA 1FGUA 4LF6Q 4Y52H 3L0OA 3Q8DA 4R4QA 4DV7Q 3CP0A 2BA1A 3MXNB 4A3DH 1MKHA 2PI2A 3E9HA 4LFAL 1B8AA 2MQHA 3UDIA 2R7ZG 5M3MH 3K7AH 4NXNL 3KDFB 1QVFA 2HT1A 1VQ4A 4POFA 1XJVA 4O0AA 1FJGL 3F8TA 4Y7NH 1VQAA 4A3IG 1N33L 3S14H 1IBLQ 2F52A 4PZ8A 4JI4Q 1G51A 1U0LA 2KBNA 3UE1A 3KF6A 3KYHC 4A3EG 2VQEL 5BR8Q 2UU9L 4JOIC 4A3KH 4A3CH 4DUYQ 4DV3Q 4A3FG 3J81c 5EAYA 2VUMG 4LWCA 2JA6H 1HNXQ 4JBKA 1I5FA 3M85A 1XMOL 1KD1C 1KHIA 1PYSB 5ELOA 3GTGH 4LF9L 4R4CA 3CC4A 2A19A 3AQQA 3S1NH 1SLJA 1VQEA 2KENA 2ZTDA 5FLMH 1VQJA 3AFQA 1A62A 3J7A5 2FXQA 3AYHB 4DR1Q 4JI6Q 4DV2L 4LF8Q 1HJPA 4L5RC 1IL2A 4BXXG 1NTGA 5HY6A 4DV5L 2RCNA 3HOXG 1BKBA 4IPCA 4JCVE 2YV5A 1OXXK 4A3IH 3S15H 2JK8A 2LXJA 2WFWA 2R6GA 3HFZB 1CSQA 2CWAA 3PUZA 4DR6Q 3I56A 1PH8A 3CC2A 4BY7H 1WOCA 2AHOB 4B3RL 4QJFA 4YCUA 1KRTA 3HOZH 2B63H 4BBRH 5K36G 4BBSG 4UPAA 2RHQB 3UDXA 3JAMi 1E24A 4DR3L 2WB1G 3UDGA 4JI8L 1Y1WG 4IPDA 4YY3L 5AJ3L 2NVTH 2UXDL 3HKSA 4HJ7A 4OO1I 4GLAC 4EQ5A 1YBYA 4DV0L 2E2JH 2NZHA 2UUCQ 1N9WA 3CPWA 1EIFA 1X55A 3M4QA 3KF8B 1N36Q 4AH6A 2R92G 1JT8A 1NMGA 1I3QH 1NMFA 2QGQA 3I4OA 5IYCG 1J5EL 1XNQQ 2IHEA 1A63A 3H3VI 4JV5L 4GN3B 3PCOB 4IOCA 4GNXA 1KXLA 3UE0A 2AWOA 2UUAQ 4JBWA 3WWVA 2I5HA 2JA8H 3F2DA 4DV6Q 4GOPB 4A4IA 4LFAQ 3HOXH 1JJ2A 1P16A 1VQ9A 3S24A 4NXNQ 1EUJA 2GVAA 3FP9A 3ICEA 1XPRA 5IP9G 1N33Q 3T1HQ 4JI2L 1UE7A 3ULLA 4AYBE 1C7YA 3S1RH 3PIOA 4LFCQ 4IPHA 4YHHL 2A1AA 4IFDI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN W;  1XMQ L;  1V9P A;  4DUY L;  4DV3 L;  1N8R C;  3BZC A;  4IJH A;  2NN6 G;  2EIF A;  4TQU S;  1SMX A;  4KHP L;  2Z0S A;  4H02 A;  2JA6 G;  2PQA B;  1SN8 A;  3K80 C;  1FVI A;  1EOV A;  1CKN A;  1W3S A;  2Z6K A;  1YHQ A;  1IBK Q;  1D7Q A;  1I94 Q;  5HGQ A;  1Y14 B;  2K5V A;  5FJ8 G;  3KJP A;  4JYA Q;  3CAM A;  4OXP A;  1IBK L;  1L2F A;  5IYD H;  1WJJ A;  4MNO A;  1KAW A;  5BR8 L;  3M4O H;  4DV2 Q;  4IO9 A;  1PH6 A;  5DLQ E;  5IYD G;  4HIK A;  4HIO A;  4DV5 Q;  4YHH Q;  1P8L A;  4GOP A;  3CCE A;  3I2Z A;  4X64 L;  3W1B A;  3BJU A;  2IX0 A;  4DR5 L;  4B3T L;  3HOY H;  1XMQ Q;  4NXM L;  1X54 A;  3JC6 6;  3PUX A;  5JEA G;  1X3F A;  4DR5 Q;  2HIX A;  5C0X J;  1QUQ A;  1EQQ A;  3ULP A;  3TRE A;  1Q81 C;  1QVG A;  4KHP Q;  2D62 A;  1ASY A;  4IFD G;  4DV7 L;  1X65 A;  1K0R A;  4R4O A;  3J80 c;  1K8G A;  1HNW L;  2HHH Q;  4R4T A;  4AQY L;  3EIV A;  2MO1 A;  3GTK H;  2F3I A;  4DR1 L;  1PFS A;  4JI7 Q;  2WAQ G;  4GKK L;  1X3E A;  2JEA I;  4LW1 A;  3F2B A;  4RMF A;  4GOP C;  3NBH B;  1IBM L;  4A3F H;  1GD7 A;  4AIM A;  1QZH A;  3U58 A;  4JI1 Q;  3I4N G;  5M3F H;  3U50 C;  4X65 Q;  3TQY A;  1AH9 A;  1SR3 A;  2K14 A;  2UUB Q;  1L1O C;  5IT9 c;  1CKM A;  4P72 A;  3H15 A;  1TWC H;  3G71 A;  1S72 A;  1VQ7 A;  2ES2 A;  1GO3 E;  5M5W H;  1E1T A;  4BA1 I;  3NEM A;  1GM5 A;  2DUD A;  4DR3 Q;  1EQR A;  4C3H H;  5M3M G;  3PF5 A;  4JI5 L;  1PH2 A;  3H3V H;  3PV0 A;  2E2H H;  5C4X G;  4QGU A;  1PHJ A;  4DNI A;  4RG1 A;  2UXC L;  4IOA A;  4NPS A;  4HJ9 A;  3LGJ A;  5IY0 A;  1EIY B;  1S3O A;  4O2D A;  4POG A;  2BA0 A;  1VQH A;  3D0F A;  2CKZ B;  1YIT A;  1PH1 A;  2VQE Q;  3RLN A;  3BZK A;  3G4S A;  4X65 L;  4TVA B;  4UP8 A;  1PH3 A;  2CFM A;  3CXC A;  1M90 C;  2E2I H;  1KC8 C;  2ZTE A;  1BBU A;  3RNU A;  3U4V A;  3A5U A;  1SRO A;  1B70 B;  1AE3 A;  2K50 A;  3HOZ G;  1PV4 A;  4A3G H;  4BBR G;  2F4V L;  1N34 L;  5IWA L;  3GDE A;  2NVX H;  1Y1V H;  1WCM H;  1VQD A;  4K0K L;  1DGS A;  1MJC A;  4LF9 Q;  5C44 H;  3IRB A;  4DR6 L;  1TXY A;  4JI5 Q;  1N34 Q;  3HOV G;  1TWF H;  3KOJ A;  3HOU H;  2VY3 A;  4JC0 A;  4BA2 I;  1VQC A;  3CCU A;  4PZ6 A;  5J3B A;  1Q8K A;  4DV4 L;  3PIP A;  2VS1 A;  4JI8 Q;  4JBJ A;  1VQP A;  1YZ6 A;  4KI0 A;  2UXB Q;  4LF7 L;  3S2D H;  4L5Q A;  2OTJ A;  2JE6 I;  2H5X A;  2Z6K C;  1BBW A;  3SGI A;  1M1K C;  2NVQ H;  4IJL A;  4P73 A;  2CQO A;  4DR7 L;  3H0G G;  2JJQ A;  2VNU D;  4OWX B;  2MFI A;  1HNZ Q;  2QA4 A;  4QQB X;  1VQN A;  4UY8 C;  5LMN Q;  1J6Q A;  1Y1W H;  5GQO A;  4A3K G;  1XNR L;  2HIV A;  3L2P A;  1C9O A;  1MJE A;  1QVC A;  1JJG A;  1SE8 A;  4HJA A;  3CC7 A;  1PH5 A;  1IBL L;  1Q12 A;  2VUM H;  4C2M H;  1Q7Y C;  4HJ5 A;  3PUV A;  1VQK A;  2ASB A;  2JEB I;  2JA7 H;  4OWW B;  1CKO A;  3I4M H;  1GVP A;  2Q2H A;  1A8V A;  4AYB G;  3FKI G;  1VQ5 A;  3KDF A;  4LFC L;  1K8A C;  4B3M Q;  4DR4 Q;  3CCL A;  3GTJ H;  1UEB A;  2ZJP A;  2R7Z H;  2R7D A;  1WI5 A;  2UUA L;  4DPG A;  3K8A A;  1EFW A;  4GNX B;  4QIW E;  2XGT A;  1XTD A;  2PQA A;  2YTY A;  4PZ7 A;  2K75 A;  3F1Z A;  3S1Q H;  2EQS A;  4BY1 H;  4JI7 L;  1VQF A;  3RN5 A;  2OTL A;  3GTO H;  1Q46 A;  3CCV A;  2EXD A;  2N8N A;  1XNR Q;  1SRU A;  2LSS A;  5GRO A;  2E5L L;  3NEN A;  5GAH C;  3PF4 A;  4GS3 A;  1N32 Q;  2KHI A;  3B6Y A;  1IZ6 A;  4OX9 L;  4LFB Q;  1HZB A;  1JE5 A;  3HKZ E;  5M5X H;  2B63 G;  4LF5 Q;  2Q2I A;  2JQO A;  2IX1 A;  4DR4 L;  4PMW A;  4EX5 A;  4A93 G;  1QZG A;  1RIP A;  2WP8 J;  4LF5 L;  1K83 H;  1MIU A;  3OW2 A;  3PO3 H;  3K0X A;  1Q82 C;  1KRS A;  2D0O A;  3RLF A;  2NZO A;  3HOW H;  4PG3 A;  3FKI H;  2V1C C;  3EN2 A;  2N49 A;  2UXD Q;  1V1Q A;  1PH9 A;  1JJC B;  1YIJ A;  5IYC H;  1YEZ A;  3HOV H;  4R1J A;  4BXX H;  1E7Z A;  2GVB A;  1UE1 A;  4AQY Q;  2UUC L;  4KHZ A;  1L0W A;  1N36 L;  3UDF A;  4KLK A;  5IP7 H;  5FLM G;  4OWT B;  1GKH A;  1VQ8 A;  1BVS A;  1XNQ L;  4JI0 L;  4DR2 Q;  1HR0 Q;  2OWO A;  4L5S A;  3E9I A;  1K73 C;  3TRZ A;  4YWL A;  2VQF Q;  5IWA Q;  1JB7 A;  2I0Q A;  4A3L G;  4JI3 Q;  4BBS H;  1TWA H;  3H0G H;  5C0X I;  1HNX L;  1XPU A;  2I5M X;  1JMC A;  2VQF L;  2A8V A;  2JA9 A;  1UE5 A;  1YNX A;  1CUK A;  3G48 A;  4DV4 Q;  3CCJ A;  2YU9 H;  2YYZ A;  1YHB A;  3BU2 A;  4BY7 G;  4HJ8 A;  3NEL A;  2YTX A;  4IPG A;  5C44 G;  3OTO Q;  4A93 H;  3HKZ G;  3MEF A;  1V43 A;  5H1S E;  4WJ3 M;  2PNH A;  3M4P A;  1IBM Q;  1OXT A;  3HOU G;  3HOW G;  4DV1 Q;  2DGY A;  3CCS A;  3PO2 G;  2ATW A;  3A5Z B;  2MNA A;  4JI6 L;  4LF8 L;  1UE6 A;  1HR0 W;  2Q2U A;  1D8L A;  2JA8 G;  3CME A;  1WCM G;  1OXU A;  3W5O A;  4LUZ A;  5FJ8 H;  4A3J G;  2N78 A;  4QY7 A;  1W2B A;  2R92 H;  4LF6 L;  4HIM A;  1X3G A;  1J5E Q;  1HH2 P;  4P75 A;  1NE3 A;  2RF4 A;  4JI3 L;  1EWI A;  4X62 Q;  4DK3 C;  1LTL A;  4ME3 A;  3TEH B;  3GTL H;  5C4J H;  3I55 A;  4A3J H;  1Q1E A;  4K0K Q;  4A3L H;  3CQZ H;  4L5T A;  4UP7 A;  3J81 i;  2VW9 A;  3S17 H;  1L1O B;  5GAD C;  4YY3 Q;  5AJ3 Q;  1FJG Q;  1EYG A;  1VQO A;  4IFD J;  3KF6 B;  3STB C;  1RL2 A;  4JG2 A;  4JI4 L;  3EBE A;  5JJI A;  1KQS A;  1YJW A;  5IE8 A;  2R93 H;  4JI2 Q;  3KJO A;  4NXM Q;  1YHA A;  4XTC S;  4X66 L;  2JA7 G;  2XTI A;  4YWK A;  1VQG A;  4YCW A;  2IY5 B;  3E0E A;  3M7N A;  1Y1V G;  4MZ9 A;  1HZC A;  3PSI A;  1K3R A;  1NJI C;  1Q86 C;  3PUW A;  1HNZ L;  2GN5 A;  3CCM A;  4GNX C;  3T1Y L;  1X9N A;  5M3F G;  1OXS C;  3M9B A;  3RZO H;  1LUZ A;  3TS0 A;  2ZJR A;  4A3D G;  2OQ0 A;  4LUO A;  4QL5 A;  1VQB A;  3ZJY C;  2K52 A;  2UU9 Q;  1L1O A;  4X6A H;  5IYB G;  4UP9 A;  1TWG H;  4LFB L;  3STB D;  3M3Y H;  2B29 A;  4ALP A;  2ZM6 L;  1X6O A;  1HZ9 A;  5LMU Q;  3GO5 A;  5IP7 G;  2L15 A;  3U4Z A;  1OXV A;  1R9T H;  3CCR A;  1XMO Q;  5E7N A;  2I5L X;  4P71 A;  2ZM6 Q;  1PA6 A;  3VDY A;  4GLX A;  3A0J A;  4DK6 C;  4A3C G;  4BY1 G;  3RZD H;  2JA5 H;  3CW2 C;  4DKA C;  3KFU A;  3GD7 A;  1KL9 A;  2WAQ E;  4A3M G;  1ASZ A;  2B3G A;  3OYY A;  2OCE A;  2K5N A;  3FHW A;  4C3J H;  1S40 A;  3T1Y Q;  1G29 1;  3PO3 G;  3DM3 A;  5JJK A;  4GN4 B;  1I94 L;  4JYA L;  3CF5 A;  4A3M H;  3PGZ A;  2D0P A;  3RLO A;  3OTO L;  4DUZ L;  3S1M H;  4DV0 Q;  3K81 C;  2K5H A;  2HHH L;  1LM0 A;  2AWN A;  4DV1 L;  4A76 A;  3I4M G;  3S16 H;  2VZA A;  1HR0 L;  3RN2 A;  1IXR A;  2KCT A;  4LNQ A;  4DAM A;  2HQL A;  1UWV A;  3K7U C;  3ULJ A;  1PYB A;  4X64 Q;  1OTC A;  4B3T Q;  3L7Z C;  1YJ9 A;  4JV5 Q;  5C3E H;  2N3S A;  1A0I A;  2R7F A;  1WYD A;  3J80 i;  3D31 A;  4X62 L;  1PVO A;  5FLX c;  4LF4 L;  1C0A A;  5ELN A;  1E1O A;  5C3E G;  3S2H H;  3HOY G;  2Q2T A;  2BH8 A;  2VL6 A;  3ER0 A;  2CCZ A;  1LYL A;  2AMC B;  5GAG C;  4MTN A;  1YVC A;  2E5L Q;  4B3S Q;  4GLV B;  4GN5 A;  2NVY H;  2Y0S E;  4R4I A;  1NY4 A;  5GAE C;  4DUZ Q;  4A3E H;  3CCQ A;  4YCV A;  2C35 B;  2UXC Q;  1KIX A;  4B3S L;  3GTM H;  1H95 A;  1YJN A;  3PO2 H;  4DR7 Q;  1IYJ B;  2UUB L;  1G6P A;  2Y0S G;  2RHS B;  4APV A;  1VQM A;  4JI0 Q;  1CKN B;  2E8G A;  2NN6 I;  3RR5 A;  3AEV A;  1VQ6 A;  2LXK A;  3I4N H;  3CPF A;  3KLW A;  5LMN L;  1X56 A;  3CD6 A;  4LF4 Q;  4A3B G;  1E3P A;  1O7I A;  4NB3 A;  4P74 A;  4GKJ Q;  2PI2 E;  3F2C A;  3T1H L;  5C0X G;  1B7Y B;  1AE2 A;  2K4K A;  3A74 A;  3J7Z C;  2IT1 A;  3DLL A;  4A3B H;  4WJ4 A;  1Q1B A;  4GKJ L;  5M5Y H;  3CMA A;  2WB1 E;  3PUY A;  1U5K A;  3GTP H;  5C4X H;  4X66 Q;  2ALY B;  5IP9 H;  5LMU L;  1Z9F A;  1NBW A;  4YWM A;  4DR2 L;  1FL0 A;  2IHF A;  3ERS X;  4JBM A;  1Z47 A;  1VQI A;  2OQK A;  2UXB L;  4DAY B;  1K9M C;  2YTV A;  2BH2 A;  1VCI A;  2R93 G;  3TS2 A;  1PH4 A;  2KCM A;  1E22 A;  2KHJ A;  4A75 A;  1TWH H;  1VQL A;  2MO0 A;  2PMZ E;  5JEA J;  2F4V Q;  4B3R Q;  3G6E A;  3I7F A;  2ZJQ A;  1HNW Q;  4DV6 L;  1WFQ A;  2ID0 A;  4C3I H;  1CSP A;  3JAM c;  4OO1 G;  4A3G G;  4GKK Q;  1SFO H;  3J81 j;  1YI2 A;  1N32 L;  4OON A;  1I6H H;  3AFP A;  4B3M L;  4XIG S;  1I50 H;  4OX9 Q;  2AKW B;  4LUV A;  4JI1 L;  1HZA A;  1XPO A;  2ZTC A;  4J15 A;  2QEX A;  3GTQ H;  5IYB H;  3W1G A;  2JA5 G;  2CWP A;  1PH7 A;  4LF7 Q;  4FDB A;  1VS0 A;  5JJL A;  1QUQ B;  1T9H A;  4JOI A;  4HID A;  1FGU A;  4LF6 Q;  4Y52 H;  3L0O A;  3Q8D A;  4R4Q A;  4DV7 Q;  3CP0 A;  2BA1 A;  3MXN B;  4A3D H;  1MKH A;  2PI2 A;  3E9H A;  4LFA L;  1B8A A;  2MQH A;  3UDI A;  2R7Z G;  5M3M H;  3K7A H;  4NXN L;  3KDF B;  1QVF A;  2HT1 A;  1VQ4 A;  4POF A;  1XJV A;  4O0A A;  1FJG L;  3F8T A;  4Y7N H;  1VQA A;  4A3I G;  1N33 L;  3S14 H;  1IBL Q;  2F52 A;  4PZ8 A;  4JI4 Q;  1G51 A;  1U0L A;  2KBN A;  3UE1 A;  3KF6 A;  3KYH C;  4A3E G;  2VQE L;  5BR8 Q;  2UU9 L;  4JOI C;  4A3K H;  4A3C H;  4DUY Q;  4DV3 Q;  4A3F G;  3J81 c;  5EAY A;  2VUM G;  4LWC A;  2JA6 H;  1HNX Q;  4JBK A;  1I5F A;  3M85 A;  1XMO L;  1KD1 C;  1KHI A;  1PYS B;  5ELO A;  3GTG H;  4LF9 L;  4R4C A;  3CC4 A;  2A19 A;  3AQQ A;  3S1N H;  1SLJ A;  1VQE A;  2KEN A;  2ZTD A;  5FLM H;  1VQJ A;  3AFQ A;  1A62 A;  3J7A 5;  2FXQ A;  3AYH B;  4DR1 Q;  4JI6 Q;  4DV2 L;  4LF8 Q;  1HJP A;  4L5R C;  1IL2 A;  4BXX G;  1NTG A;  5HY6 A;  4DV5 L;  2RCN A;  3HOX G;  1BKB A;  4IPC A;  4JCV E;  2YV5 A;  1OXX K;  4A3I H;  3S15 H;  2JK8 A;  2LXJ A;  2WFW A;  2R6G A;  3HFZ B;  1CSQ A;  2CWA A;  3PUZ A;  4DR6 Q;  3I56 A;  1PH8 A;  3CC2 A;  4BY7 H;  1WOC A;  2AHO B;  4B3R L;  4QJF A;  4YCU A;  1KRT A;  3HOZ H;  2B63 H;  4BBR H;  5K36 G;  4BBS G;  4UPA A;  2RHQ B;  3UDX A;  3JAM i;  1E24 A;  4DR3 L;  2WB1 G;  3UDG A;  4JI8 L;  1Y1W G;  4IPD A;  4YY3 L;  5AJ3 L;  2NVT H;  2UXD L;  3HKS A;  4HJ7 A;  4OO1 I;  4GLA C;  4EQ5 A;  1YBY A;  4DV0 L;  2E2J H;  2NZH A;  2UUC Q;  1N9W A;  3CPW A;  1EIF A;  1X55 A;  3M4Q A;  3KF8 B;  1N36 Q;  4AH6 A;  2R92 G;  1JT8 A;  1NMG A;  1I3Q H;  1NMF A;  2QGQ A;  3I4O A;  5IYC G;  1J5E L;  1XNQ Q;  2IHE A;  1A63 A;  3H3V I;  4JV5 L;  4GN3 B;  3PCO B;  4IOC A;  4GNX A;  1KXL A;  3UE0 A;  2AWO A;  2UUA Q;  4JBW A;  3WWV A;  2I5H A;  2JA8 H;  3F2D A;  4DV6 Q;  4GOP B;  4A4I A;  4LFA Q;  3HOX H;  1JJ2 A;  1P16 A;  1VQ9 A;  3S24 A;  4NXN Q;  1EUJ A;  2GVA A;  3FP9 A;  3ICE A;  1XPR A;  5IP9 G;  1N33 Q;  3T1H Q;  4JI2 L;  1UE7 A;  3ULL A;  4AYB E;  1C7Y A;  3S1R H;  3PIO A;  4LFC Q;  4IPH A;  4YHH L;  2A1A A;  4IFD I; 
#chains in the Genus database with same CATH topology
 3IFT A;  3T4A C;  4A3J B;  3GTO B;  1QIL A;  3P75 A;  3VYS A;  5IOD A;  4KHP L;  2B2W A;  1QE6 A;  3K80 C;  4FP5 D;  5CYU A;  3H0G B;  1CKN A;  1EQV A;  1D7Q A;  1TWC B;  4Z9C B;  1Y14 B;  2K5V A;  3KJP A;  1DOK A;  1KAW A;  2MHV A;  2Q8R E;  3M4O B;  4K8J A;  4V0B A;  4YHH Q;  2JA5 G;  1HTL D;  3W1B A;  4X64 L;  4B3T L;  4BY1 B;  1F9Q A;  4NXM L;  4KN7 C;  2H4O A;  3KLS X;  4TSS A;  1ZYR D;  1EQQ A;  1QUQ A;  3ULP A;  2XRQ D;  1BCP C;  1SDF A;  1K0R A;  2ICI A;  4CKE A;  1SE3 A;  2HHH Q;  4R4T A;  1HHV A;  1ICW A;  3EIV A;  2MO1 A;  1HUN A;  1F2L A;  3E6Z X;  3V96 A;  4DU9 A;  2WV6 D;  1EY4 A;  1QZH A;  3U50 C;  3D4W A;  3EA6 A;  1F9S A;  1L1O C;  5IT9 c;  1VQ7 A;  2ES2 A;  4C1N I;  4WFN 3;  1GO3 E;  1NSN S;  1E1T A;  3OWE B;  1GM5 A;  5NUC A;  4DR3 Q;  1EQR A;  1PH2 A;  3H3V H;  2R61 A;  2E2H H;  2BDN A;  2IX3 A;  2L4N A;  4XXE A;  1PHJ A;  5DNF A;  3NTK A;  3Q0A A;  3I90 A;  4ZUJ A;  4HJ9 A;  4XT1 B;  2L55 A;  1VQH A;  1PH1 A;  2E2I B;  1YIT A;  4I7A A;  3BZK A;  5EPL A;  4UP8 A;  2CFM A;  4H44 C;  3RNU A;  1U4L A;  4LMQ D;  1DJR D;  1B70 B;  5I6W A;  2RQX A;  1JIC A;  1MJC A;  3HOU H;  4BA2 I;  1VQC A;  3I4L A;  4JBJ A;  1YZ6 A;  4QUC A;  3S2D H;  3GTJ B;  1BXT A;  4P73 A;  3H0G G;  3Q24 A;  5E1F A;  4QQB X;  1JOK A;  2A5H A;  5LMN Q;  1J6Q A;  2EY6 A;  1QOH A;  5GQO A;  4OIK A;  1PH5 A;  1PRT B;  1Q12 A;  5A2Q E;  3PUV A;  1Y8P B;  3I4M H;  1LAB A;  1A8V A;  1HFN A;  1NAP A;  3KDF A;  1K8A C;  1EWC A;  1IHZ A;  1GUT A;  2J4X A;  2N88 A;  1XTD A;  3F1Z A;  4JI7 L;  3GTO H;  4FXD A;  2EXD A;  3ERO A;  1XNR Q;  1IKM A;  5GAH C;  4GS3 A;  2KHI A;  1FNV A;  5CC4 A;  4A3G B;  4OX9 L;  3HKZ E;  2DY7 A;  3SR1 A;  2Q2I A;  1JWU D;  2A74 C;  4PMW A;  4A3D B;  2Z8L A;  1QZG A;  5M5W B;  3DWQ A;  1AZP A;  1MIU A;  3OW2 A;  1KRS A;  3RLF A;  2NZO A;  1BOS A;  1I4Q A;  2IJ0 A;  3FKI H;  4L6T B;  3T53 B;  1EIH A;  5IYC H;  3OSO A;  4BXX H;  2GVB A;  4KMU C;  2IPK D;  4KHZ A;  1L0W A;  1N36 L;  2KQ3 A;  3FRP B;  3UDF A;  3MZ5 A;  4MIU A;  1BVS A;  1XNQ L;  4KTA A;  4DR2 Q;  1K73 C;  4HSP A;  3TDQ A;  2VQF Q;  3H0G H;  2Q8T A;  5C0X I;  2HDM A;  1XPU A;  2I5M X;  1JMC A;  1XTC D;  2A8V A;  1JB3 A;  2EY1 A;  4WJW A;  1CT1 D;  1PRT F;  2EY2 A;  3V05 A;  2EDG A;  1CA6 A;  2ENB A;  1H9J A;  4HJ8 A;  4IPG A;  3OTO Q;  3J80 E;  4PNY A;  4A3M B;  1TY0 A;  4EQN A;  1IBM Q;  3HOW G;  4WJ3 M;  2B2T C;  4DV1 Q;  3A5Z B;  5BN4 A;  4DXG A;  4BBR B;  4C1N K;  1WCM G;  5FJ8 H;  4FNF A;  2J7Z A;  1J5E Q;  2DNE A;  5JAV A;  4ME3 A;  3TEH B;  3I55 A;  4OGQ C;  1EY9 A;  2VW9 A;  4G57 A;  3RZD B;  5J39 A;  4KD4 A;  3STB C;  4JG2 A;  3MHB A;  4HMI A;  1WTQ A;  1TKW B;  4JI2 Q;  1PDQ A;  3KJO A;  4XTC S;  2XTI A;  1VQG A;  2Z4H A;  3E0E A;  2EYJ A;  3M7N A;  4XQJ A;  1HZC A;  1K3R A;  1B50 A;  2GN5 A;  3RZO H;  1SSO A;  1OXS C;  2P5Z X;  3M9B A;  5KND A;  3KK7 A;  3VR5 A;  5C4J B;  4CJ1 B;  2K52 A;  1L1O A;  4X6A H;  4UP9 A;  4LFB L;  3AB9 A;  3SE0 A;  3J7A V;  1HZ9 A;  1PFB A;  1GJX A;  1OXV A;  3RD4 A;  4FXK C;  4X3S A;  2ZM6 Q;  4P71 A;  3KUP A;  4BY1 G;  2CW0 C;  3C3L A;  4HSV A;  3KFU A;  3HOW B;  1ASZ A;  2WAQ E;  5DEH A;  3HP3 A;  3OYY A;  2FMC A;  2K6A A;  5JVH 3;  1M8A A;  2G9H D;  3T1Y Q;  3PO3 G;  4A3M H;  3RLO A;  1SBB B;  4DV0 Q;  2K5H A;  3A7L A;  1LM0 A;  3FKI B;  3NBH A;  4JPB W;  3I4M G;  1GUO A;  1IXR A;  5G3L D;  5KYL A;  3GQB A;  3K7U C;  4RWS C;  4JV5 Q;  3CHB D;  2WAC A;  2N3S A;  2WIN B;  3SVM A;  2R7F A;  1WYD A;  3J80 i;  4X62 L;  1PRT C;  1PVO A;  4LF4 L;  3EVQ A;  1E1O A;  2KEE A;  1EY7 A;  4CHT B;  5C3E G;  3S2H H;  3P1H A;  3HOY G;  2VL6 A;  3ER0 A;  3ND9 A;  5G3L F;  4MTN A;  4GLV B;  4R4I A;  4DXF A;  5LL6 X;  4YCV A;  2UXC Q;  2TSS A;  2D9U A;  2SDF A;  2B8F A;  1HUM A;  1YJN A;  1VQM A;  2RHS B;  2K7V A;  2DJG C;  3RR5 A;  2NN6 I;  4ZKB B;  3AEV A;  1A6X A;  2K5W A;  1U4M A;  4X3U A;  1PRT D;  3KLW A;  1CZW A;  3CD6 A;  4OHJ A;  1E3P A;  3ITP A;  3KF8 A;  2PI2 E;  3T1H L;  5KRU A;  4WJ4 A;  3J7Z C;  3TN2 A;  4A3B H;  3Q22 A;  2BOS A;  1C4Q A;  5M5Y H;  3CMA A;  1WTW A;  3GTP H;  5LMU L;  3TME A;  1NBW A;  1QCB D;  2IHF A;  1QNU A;  5M3F B;  2OQK A;  4DAY B;  1JOR A;  2R93 G;  1A3U A;  1JR0 D;  1PH4 A;  1SEB D;  3C2P A;  2PMZ E;  5JJZ A;  4ZAI A;  5C5L A;  5A35 A;  4RHR A;  5ELD A;  3G6E A;  2WKD A;  5ELB A;  2A69 D;  1WFQ A;  1CSP A;  5IGD A;  4A3G G;  3QR8 A;  1SFO H;  3P20 A;  3A8I E;  1N32 L;  1TS3 A;  4C3I B;  1ENF A;  5EJW A;  5KNC A;  1X3P A;  5ELC A;  1AFP A;  4R9W A;  5C0X H;  3K5L A;  1PZK D;  3T56 B;  1QUQ B;  4HID A;  1L0X B;  1WTX A;  4UAI A;  1RD9 D;  4LF6 Q;  3L0O A;  3Q8D A;  1EEI D;  2PPB C;  3CP0 A;  3MXN B;  1O7Y A;  1R4Q B;  1GUG A;  3Q6S A;  2R7Z G;  5M3M H;  1WD0 A;  1PFN A;  3K7A H;  2KED A;  1MBY A;  2IW3 A;  4NXN L;  5IGE A;  1QVF A;  2HT1 A;  2B2Y A;  2KUM A;  4BS9 A;  4KJN A;  1ICF B;  3HOY B;  1QG7 A;  4Y7N H;  1N33 L;  2JXM B;  1D5M C;  4FVM A;  1IBL Q;  1G51 A;  1U0L A;  5BR8 Q;  4JOI C;  4KD3 A;  4A3C H;  4DV3 Q;  4A3F G;  3MFY A;  3VR3 A;  5C6A A;  5EAY A;  1S5D D;  2JA6 H;  1HNX Q;  1JCK B;  3BYT B;  3M85 A;  2B2T A;  3GTG H;  3K59 A;  1MSH A;  2AQ3 B;  3MEH A;  1EYC A;  5FLM H;  2EJF C;  4XT3 B;  5HUR A;  3J7A 5;  4CJ0 B;  5FO9 B;  2I46 A;  1K8M A;  4JI6 Q;  1IL2 A;  4DV5 L;  1UNS A;  2K04 A;  3J81 L;  3R2I A;  2LXJ A;  2R6G A;  3HFZ B;  1VMP A;  4DR6 Q;  2AHO B;  4G4K A;  2E75 C;  3O13 A;  3HZX A;  5K36 G;  1Y1W G;  2F0S A;  4IPD A;  5CBA E;  3NXW A;  1EFI D;  2G5D A;  2F0H A;  3MC0 B;  2E2J H;  4DV0 L;  1AN8 A;  2UUC Q;  1EYD A;  2VXW A;  3CPW A;  3EJI A;  1G6Z A;  1LO5 D;  1B9N A;  3D3R A;  2IHE A;  5IGB A;  2JA5 B;  3H3V I;  4JV5 L;  1WTO A;  1RTO A;  1SNC A;  4GN3 B;  2F03 A;  3UE0 A;  2AWO A;  1LT5 D;  4JBW A;  3WWV A;  4DAV A;  2F4I A;  4GOP B;  4A4I A;  3P7J A;  1VQ9 A;  4PMB A;  3ICE A;  4NMZ A;  3T1H Q;  2NUC A;  1KLG D;  5FK9 C;  5JOB A;  1ENA A;  3S1R H;  4LFC Q;  4YHH L;  3FPU B;  1WTR A;  2A1A A;  1K0S A;  1V9P A;  1S5F D;  4DUY L;  1N8R C;  2OXP A;  3BZC A;  2NN6 G;  2EIF A;  2Z0S A;  2JA6 G;  1BCP D;  3MVV A;  1EOV A;  2C9O A;  1I94 Q;  5FJ8 G;  2M9V A;  1Y69 U;  2J0T D;  5T1G A;  1WJJ A;  2XSC A;  5BR8 L;  4Y7N B;  2PYK A;  5I6Y A;  4IO9 A;  2RCF A;  1B3A A;  5IYD G;  4HIO A;  1SFO B;  3BJU A;  4DR5 L;  2XWJ B;  2R92 B;  1I6H B;  1X54 A;  1TU2 B;  3PUX A;  4R8N A;  4DR5 Q;  2HIX A;  4R4O A;  1K8G A;  2NVT B;  3K5N A;  4FYD A;  2DNC A;  2F3I A;  4DR1 L;  4GKK L;  3AU7 A;  2CH4 W;  1UUP A;  4LK1 C;  4GOP C;  3F2B A;  4RMF A;  1FGB D;  2B39 A;  3NK9 A;  2H1E A;  3I4N G;  5EBD A;  4RHS A;  4G7O C;  4C3H G;  1KAA A;  5M3M B;  3U9S A;  3S15 B;  3K5O A;  2PO4 A;  4DAY A;  2WKC A;  4C3H H;  5M3M G;  4RKB A;  4C56 C;  3PF5 A;  2EYM A;  1RJT A;  5C4X G;  5ELF A;  3D4D A;  4RG1 A;  4KY7 A;  3SK6 A;  4IOA A;  1D5Z C;  3LGJ A;  1EIY B;  4IUR A;  1S3O A;  4O2D A;  3D6C A;  2WB1 B;  3IKJ A;  3RLN A;  3G4S A;  1B53 A;  4IUU A;  4X65 L;  1M90 C;  4KKT A;  3CXC A;  2E2I H;  1KC8 C;  2FMM A;  3U4V A;  3A5U A;  1SRO A;  2NBF A;  2NVY B;  3HOZ G;  1R9T B;  1PV4 A;  3TZU A;  2NVX H;  1WCM H;  1JOO A;  1T5E A;  4LF9 Q;  2E2D C;  3IRB A;  1Y1V B;  4DR6 L;  3VYR A;  3HOV G;  2XN9 C;  1TWF H;  4JC0 A;  3CCU A;  2IL8 A;  5CR3 A;  1F77 A;  1YNN D;  1HCZ A;  2L1B A;  4LF7 L;  2H5X A;  2PCF B;  1KDB A;  3QIA A;  5C5M A;  2VNU D;  4F88 A;  2A6H C;  4UY8 C;  5CMD A;  1EEF D;  5CV5 A;  2FHT A;  1NR2 A;  1XNR L;  3PMF A;  3I8Z A;  2ICE C;  1MJE A;  1QVC A;  1SE8 A;  2VUM H;  3CC7 A;  1YNN C;  4C2M H;  1VQK A;  2F0J A;  4HJ5 A;  1PTO B;  2ASB A;  2JA7 H;  2NVX B;  1GVP A;  1Q3L A;  3FKI G;  3KBG A;  4N9T A;  5C44 B;  4B3M Q;  3I4M B;  4DR4 Q;  4U68 A;  1NUC A;  2ZJP A;  2R7D A;  5CV4 A;  3K8A A;  4QIW E;  4PZ7 A;  2PQA A;  2YTY A;  1ONL A;  1HFG A;  4DGZ A;  1B3Q A;  2OTL A;  1B2T A;  1Q46 A;  2A69 C;  1A2U A;  1EY0 A;  1EU4 A;  4X3K A;  2LSS A;  3NEN A;  3E0J A;  3HG9 A;  1WTH A;  3B6Y A;  5EKI A;  1HZB A;  1JE5 A;  2N55 A;  3D8G A;  1SE2 A;  5M5X H;  1H9K A;  1GOZ A;  2XWB B;  2F0G A;  4DR4 L;  4FF4 A;  2IX1 A;  2OT2 A;  1A3V A;  4A93 G;  2F0O A;  1GUN A;  1LT3 D;  1STY A;  3PO3 H;  3K0X A;  3HOW H;  1FNW A;  4OIJ A;  1NCV A;  4PG3 A;  4A93 B;  1AEX A;  2N49 A;  2UXD Q;  1S4Z A;  1JJC B;  1YIJ A;  3HOV H;  1BDO A;  4RAU C;  1UE1 A;  2B2Y C;  4KLK A;  5IP7 H;  5FLM G;  1GKH A;  1VQ8 A;  4OEL B;  5COY A;  2OWO A;  1HR0 Q;  1DCZ A;  3TRZ A;  1NR4 A;  2F0W A;  4YWL A;  1JB7 A;  1TY2 A;  2O2L D;  4JI3 Q;  4BBS H;  1TWA H;  1A3T A;  2QCP X;  3TP6 A;  5EKK A;  2VQF L;  3R93 A;  2JA9 A;  1UE5 A;  3C1E A;  1CUK A;  2EOT A;  2EZV A;  3BU2 A;  3TP5 A;  3NEL A;  4J1M A;  3VYT A;  5H1S E;  1BBX C;  1D6E C;  3M4P A;  3HOU G;  2DGY A;  3C1F A;  3CCS A;  3VYU A;  2MNA A;  1UE6 A;  2KVM A;  5I4D A;  2JA8 G;  1K28 A;  2QW7 A;  2R7Z B;  3MWY W;  1D1K A;  3MAQ A;  4A3K B;  4A3J G;  4BY7 B;  4RCN A;  2PNR C;  1ZXT A;  1HH2 P;  2RF4 A;  4JI3 L;  5J22 A;  1EWI A;  3GTL H;  2QKI C;  1Q1E A;  4TKO B;  4A3L H;  4UP7 A;  4WRD A;  5EKL A;  4YY3 Q;  1F2Z A;  2M00 A;  5AJ3 Q;  1BR9 A;  4C3I G;  1KAB A;  4ZKC B;  2OEO A;  5FLX L;  1K3B C;  1ZEQ X;  5IE8 A;  1LT4 D;  2R93 H;  1TVX A;  5I9P A;  3FEW X;  4NXM Q;  1YHA A;  4X66 L;  4YWK A;  4YCW A;  2CHB D;  4I7Z C;  1Q8I A;  4MZ9 A;  1DXM A;  1LTI D;  1NJI C;  3DHQ A;  2PW5 A;  4O42 A;  2ZT9 C;  4GNX C;  3T1Y L;  2IWH A;  5M3F G;  4U67 3;  4IQZ A;  2QEJ C;  2OQ0 A;  4LUO A;  2ZJR A;  4A3D G;  2HD3 A;  1FNU A;  2UU9 Q;  3F2U A;  2AUJ D;  4G7H C;  3M3Y H;  2FFK B;  5JVG 3;  4ALP A;  1IW7 C;  1X6O A;  4MTK A;  5IOC A;  3W2D A;  5IP7 G;  2L15 A;  4OL7 A;  3QO2 A;  3Q23 A;  2AQ2 B;  2I5L X;  2ZXR A;  3VDY A;  3A0J A;  4DK6 C;  2A6E D;  4A3C G;  3GD7 A;  2M2L A;  2OCE A;  4KY5 A;  4NKL A;  5COR A;  3RUZ A;  2F0K A;  3DXJ C;  2KHS A;  1G29 1;  3DM3 A;  3EQL C;  3PGZ A;  2D0P A;  4ZYS A;  2HHH L;  1JQY D;  2DY8 A;  3DWA A;  4IUV A;  4DAM A;  4ODG A;  3SEB A;  2HQL A;  2X6L A;  2Q8I B;  2F0V A;  3ULJ A;  1PYB A;  2MP1 A;  4H13 C;  1OTC A;  3UI2 A;  1I4X A;  1A0I A;  2A6E C;  2EYP A;  4B9X A;  3GTL B;  5ELN A;  3K58 A;  4FF2 A;  2DN8 A;  3K5M A;  1JWS D;  1KDC A;  3LX0 A;  2KOL A;  2NVY H;  2Y0S E;  5GAE C;  4DUZ Q;  3CCQ A;  4C3J G;  3GTM H;  2F3V A;  1I6V C;  4B9W A;  4DR7 Q;  1IYJ B;  2UUB L;  1G6P A;  2Y0S G;  3MXN A;  3CPF A;  2PZW A;  1X56 A;  4F7X A;  1PTO D;  5E4X A;  2NVQ B;  3C46 A;  1O7I A;  5KGU A;  3T16 A;  5AFW A;  4GKJ Q;  3F2C A;  2F0U A;  5C0X G;  5EBC A;  2K4K A;  4Q0F A;  4X3T A;  3PUY A;  1SXT A;  4X66 Q;  1MD2 D;  5IP9 H;  4HR7 B;  1Z9F A;  2KJX A;  1KNE A;  4DR2 L;  3PQI A;  4UDU C;  4JBM A;  4AYB B;  1VQI A;  2PZU A;  3S14 B;  1TWH B;  3TS2 A;  1GHK A;  1TWH H;  1VQL A;  2PMZ B;  3ND8 A;  1C8C A;  1HNW Q;  2ID0 A;  1YI2 A;  3QOJ A;  1I6H H;  1DOL A;  3NWS A;  4OX9 Q;  2AKW B;  4JI1 L;  3BDC A;  1XPO A;  2QEX A;  1TT2 A;  5IYB H;  3GTQ B;  4FDB A;  4JVZ A;  1KNA A;  1T9H A;  5D3D A;  4CDE C;  4CKB A;  1D5X C;  1GUS A;  1MKH A;  3E9H A;  4LFA L;  2PQE A;  4QIW B;  2VB3 X;  5IGG A;  2NTS A;  1VQ4 A;  4POF A;  4K2L A;  1TQO A;  2K5D A;  2F52 A;  3J81 E;  2K03 A;  3KF6 A;  2VQE L;  4DNT B;  4RGT A;  2VUM G;  4LWC A;  1I5F A;  4ZRZ A;  1JE4 A;  3NQT A;  5ELO A;  3E3X A;  4HED A;  1BUV T;  3CC4 A;  1QB5 D;  1F2M A;  1IYU A;  1SLJ A;  2KEN A;  2ZTD A;  1VQJ A;  3AFQ A;  1A62 A;  3VA5 A;  3FDT A;  5DAU A;  1S5B D;  2B2U A;  1HJP A;  4L5R C;  1M4V A;  5HY6 A;  1BCP F;  1SYF A;  2YV5 A;  2HDL A;  1OXX K;  1F9R A;  2JK8 A;  1TWF B;  1PZI D;  1CSQ A;  3HOZ B;  2R3Z A;  3RMH A;  4BY7 H;  4B3R L;  3I73 A;  4QJF A;  4YCU A;  1KRT A;  4UPA A;  2RHQ B;  3UDG A;  4JW0 A;  4JI8 L;  3I3C A;  1SJH D;  3R8B A;  2E76 C;  1LLR D;  2G9D A;  1YBY A;  2NZH A;  2EYO A;  1N36 Q;  1V1P A;  3KF8 B;  4RH6 A;  3I4O A;  1XX8 A;  1Z7T A;  2CH4 A;  1J5E L;  1XNQ Q;  3S17 B;  1EY6 A;  3S1N B;  3TP7 A;  1F2Y A;  5C4H A;  2JSO A;  4K6D A;  1HA5 A;  2PW7 A;  4IN3 A;  1JJ2 A;  1P16 A;  1HQM C;  1XWE A;  1VMC A;  4NXN Q;  3QB3 A;  3S2D B;  2R93 B;  1EUJ A;  3FP9 A;  1O78 A;  1XPR A;  4JI2 L;  1UE7 A;  3HRZ C;  3ULL A;  4AYB E;  2JA6 B;  1B4O A;  5D3I B;  4IJH A;  4TQU S;  2RDG A;  2EVB A;  3WOF A;  4H02 A;  2AUK A;  4FF1 A;  1SN8 A;  4OO1 H;  2CVR A;  3TBI B;  1W3S A;  1SNO A;  5TSS A;  4JYA Q;  5HGQ A;  1PTO F;  3CAM A;  1LTG D;  1L2F A;  1EOT A;  1BCP B;  1MI2 A;  3FPP A;  4MNO A;  4DV2 Q;  2HCC A;  1PH6 A;  4DFA A;  4HIK A;  1P8L A;  4GOP A;  1S5C D;  4EQO A;  4ZLT F;  2KA7 A;  4A3I B;  3HOY H;  1G2T A;  3IAY A;  3NUC A;  5JEA G;  3DEP A;  4J6H A;  5C0X J;  1QVG A;  2F0F A;  3LWU A;  4IFD G;  3J7Y W;  1KTK A;  3J80 c;  1Y1W B;  1HNW L;  5FKA C;  4AQY L;  3E5S A;  1PFS A;  1IYV A;  1X3E A;  3SK8 A;  2O4X A;  4KJO A;  4A3F H;  1GD7 A;  3U58 A;  4JI1 Q;  1U9R A;  5M3F H;  4X65 Q;  1SR3 A;  1HA6 A;  1TR5 A;  3BS1 A;  1W6J A;  3G71 A;  1S72 A;  4DAP A;  1D1I A;  3D4R A;  1UAP A;  4CJ2 C;  4BA1 I;  4N8X 1;  2DUD A;  2X69 A;  3TP8 A;  4JI5 L;  1BQQ T;  1I50 B;  2JP1 A;  4OEM B;  1RHP A;  3DM1 A;  5IY0 A;  2CKZ B;  4HN7 A;  2VQE Q;  4TVA B;  1PH3 A;  3VR2 A;  4XQQ A;  1MHW C;  1WCM B;  3KLR A;  1CHQ D;  1AE3 A;  4A3G H;  1YNJ D;  4BBR G;  2F4V L;  1N34 L;  5IWA L;  3GDE A;  1VQD A;  5M5X B;  1RCV D;  1DGS A;  3J7A F;  5C44 H;  2OF1 A;  4JI5 Q;  4KN4 C;  4PZ6 A;  2F0D A;  5J3B A;  1Q8K A;  4DV4 L;  4JI8 Q;  4KI0 A;  2UXB Q;  1HRJ A;  2OTJ A;  3LWE A;  3L3O C;  2D2C C;  5DM7 3;  2JJQ A;  1SYG A;  4OWX B;  1HNZ Q;  1SNM A;  2QA4 A;  4H7B A;  3N52 A;  5JEA H;  3BG3 A;  1VQN A;  3S2H B;  1FD7 D;  5K5P A;  2HIV A;  1QWY A;  5JPM C;  2BE5 C;  4HJA A;  1IBL L;  4N9P A;  3VA7 A;  2AQ1 B;  1Q7Y C;  5FO7 B;  2JEB I;  4OWW B;  1EL0 A;  1O7L A;  1FR3 A;  3SK5 A;  4LFC L;  1VQ5 A;  3G7L A;  2EPB A;  3GTJ H;  2B2V A;  2R7Z H;  1WI5 A;  2K75 A;  1SNP A;  2F0M A;  3S1Q H;  2EQS A;  2EXZ A;  1SRU A;  2BE5 D;  2E5L L;  3PF4 A;  3OMC A;  1N32 Q;  1TS4 A;  5L37 A;  4M1U B;  5CBE E;  3MA2 B;  1HXY D;  3OWF A;  3SDZ A;  3HS0 C;  4LF5 Q;  4BBS B;  3K7A B;  2QDB A;  1R4P B;  3S9W A;  2L9H A;  2WII B;  1ET9 A;  4EX5 A;  5DM6 3;  3KBX A;  4RFB A;  1RIP A;  1K83 H;  1Q82 C;  4FF3 A;  2D0O A;  2V1C C;  2EYL A;  3EN2 A;  3QOL A;  1STE A;  5ELE A;  1V1Q A;  4NP5 A;  2E2H B;  2RA4 A;  5LHY 1;  1YEZ A;  1RTN A;  4PQX A;  2K1B A;  3GV6 A;  3ERQ A;  3M7G A;  2UUC L;  1QJO A;  4RA8 A;  5IGF A;  1TWG B;  1KDA A;  4JI0 L;  2K33 A;  3S1Q B;  3E9I A;  4A3B B;  4A3L G;  2I0Q A;  4S3S A;  2O5I C;  3BYY B;  3G48 A;  1OO9 B;  4DV4 Q;  3CCJ A;  1YHB A;  4BY7 G;  2O5J C;  4A93 H;  2YTX A;  3GP7 A;  3HKZ G;  2PNH A;  3KLS A;  4LF8 L;  2L5T A;  4KK7 A;  1HR0 W;  1S5E D;  2QIL A;  1H9S A;  3CME A;  2B2U C;  1OXU A;  4LUZ A;  2N78 A;  4QY7 A;  3JAM L;  2R92 H;  1X3G A;  1ROD A;  1FYC A;  3A8J E;  4P75 A;  4X62 Q;  4DK3 C;  3OPO A;  5CGK A;  3CQZ H;  4L5T A;  3J81 i;  3S17 H;  2EJM A;  1FJG Q;  1EYG A;  2RSO A;  5KEE A;  4KKS A;  3EBE A;  3LNN A;  1IW7 D;  4NDX A;  1YJW A;  1KQS A;  1B1Z A;  4JI4 L;  4RGO S;  1EU3 A;  3TSS A;  1GHJ A;  2SOB A;  2JA7 G;  2IY5 B;  1ZYR C;  3PSI A;  1EIG A;  1H9R A;  3PUW A;  1CA5 A;  3CCM A;  1X9N A;  2CQA A;  1V1P B;  1VQB A;  4G7Z C;  3ZJY C;  5IYB G;  2B63 B;  2NWG A;  3CRK C;  5LMU Q;  3GO5 A;  1R9T H;  4L63 B;  1CFM A;  2K5Q A;  2JA5 H;  5IGC A;  5EQ0 A;  4DKA C;  4A3M G;  2B3G A;  3A54 A;  5C3X A;  4C3J H;  1S40 A;  5JJK A;  1HTP A;  1I94 L;  3CF5 A;  3OTO L;  4DUZ L;  5I2Y A;  4I65 A;  3R3O A;  3K81 C;  3ZYY X;  4DV1 L;  3S16 H;  2VZA A;  1HR0 L;  4LJZ C;  2KCT A;  1B9M A;  1UWV A;  4X64 Q;  4B3T Q;  3L7Z C;  5C3E H;  1AP0 A;  5LL6 S;  1BF4 A;  2KEC A;  5FLX c;  4XQN A;  4EQP A;  4ZQ3 A;  1ET6 A;  4QUF A;  2Q2T A;  2BH8 A;  4IAL A;  1LYL A;  5GAG C;  4B3S Q;  1SMY C;  4PMC A;  2E5L Q;  1IL8 A;  4GN5 A;  4KHV A;  3HKZ B;  3J80 L;  1NY4 A;  3H6M A;  4A3E H;  2LY7 A;  4B3S L;  1DZ1 A;  3PO2 H;  4APV A;  1VQ6 A;  2KCN A;  1STB A;  2LXK A;  4K5W A;  1H9M A;  1PFM A;  3HOV B;  5LMN L;  4L8J A;  4CBV A;  4A3B G;  4NB3 A;  4P74 A;  1B7Y B;  4F87 A;  3A74 A;  3A56 A;  5FO8 B;  3DLL A;  2JYO A;  1AZQ A;  3OIQ A;  1Q1B A;  4GKJ L;  1I4P A;  2WB1 E;  4TRD A;  2B2V C;  1NNX A;  4K14 A;  2ALY B;  1FL0 A;  1ML0 D;  1RF2 D;  1Z47 A;  1K9M C;  2YTV A;  1VCI A;  4C2M B;  3MXU A;  1YNJ C;  1E22 A;  2KCM A;  2KHJ A;  4A75 A;  3NTI A;  1IKL A;  5JEA J;  2RDF A;  4DV6 L;  2X6G A;  4C3I H;  3JAM c;  4OO1 G;  3J81 j;  3K6O A;  4OON A;  4MHE A;  3PIP 3;  1I50 H;  4LUV A;  3M3Y B;  1HZA A;  1X32 A;  1LT6 D;  3GTK B;  4LF7 Q;  3W1G A;  2CWP A;  1PH7 A;  3BDO A;  1VS0 A;  3H3V C;  2DJF C;  2HUG A;  5JJL A;  2VUM B;  4JOI A;  5EPK A;  4ULL A;  1FGU A;  4Y52 H;  2F0P A;  4DV7 Q;  5KNB A;  4QB4 A;  2BA1 A;  4A3D H;  5EGT A;  2PI2 A;  2FIN B;  2MQH A;  1JWM D;  3KDF B;  1WTP A;  4FXG C;  1ZKO A;  2B2W C;  4BWG B;  2KBN A;  2UU9 L;  3UE1 A;  1UEA B;  4A3E G;  1K8O A;  4DUY Q;  3MXG A;  1JOQ A;  3MXP A;  2ZXP A;  1A15 A;  1B44 D;  3K57 A;  1W6K A;  1PLF A;  3OIP A;  2XRS D;  3NP8 A;  2A19 A;  2XNA C;  3AMU A;  2NZ1 D;  4H0L C;  1LTT D;  4EVO A;  1HQR D;  2FXQ A;  3M4Y A;  1E0B A;  1MGS A;  1RDP D;  4F8M A;  4BXX G;  5E4W C;  2SEB D;  2RCN A;  3BVM A;  3HOX G;  4IPC A;  4JCV E;  2F0I A;  4A3I H;  3HOU B;  1X3Q A;  3PUZ A;  2JN4 A;  3IFD A;  3I56 A;  3CC2 A;  4E6I A;  4BBR H;  3JAM i;  4DR3 L;  3UDX A;  1XJV A;  2RSN A;  4RGN A;  1V1O A;  2NVT H;  4YY3 L;  5AJ3 L;  1C48 A;  2UXD L;  4HJ7 A;  4OO1 I;  1STA A;  1EIF A;  2HCI A;  1NMG A;  1NMF A;  5IYC G;  4GNX A;  3X3N A;  2UUA Q;  2I5H A;  3HGB A;  4DK1 A;  3F2D A;  4DV6 Q;  1CZG A;  1STG A;  3W3A A;  4O1N A;  5IP9 G;  1N33 Q;  3TZD A;  3PIO A;  3RZO B;  1SNQ A;  4GN4 B;  5LMN W;  1XMQ L;  4IFD H;  4DV3 L;  1SJE D;  3MTS A;  1G2S A;  4J8Q A;  3URY A;  5J1Z A;  1SMX A;  2GA4 B;  1E2V A;  4ZK9 B;  2PQA B;  4DA2 A;  5JPN C;  3GV3 A;  1FVI A;  3H91 A;  1TWA B;  1IBK Q;  2Z6K A;  1YHQ A;  3ONA B;  1RKN A;  4CDC C;  4OXP A;  1IBK L;  5IYD H;  1DOM A;  3BZD B;  3M4O H;  1G91 A;  1PTO H;  2MJ8 A;  5DLQ E;  2B8G A;  2NB0 A;  4DV5 Q;  3CCE A;  3I2Z A;  3K0Y A;  3S1R B;  2IX0 A;  4RCO A;  2EYH A;  5M9O A;  1XMQ Q;  4CDF C;  3JC6 6;  2LS0 1;  4FO2 A;  1X3F A;  1Q81 C;  4KHP Q;  3TRE A;  2Z6B A;  2D62 A;  1ASY A;  4DV7 L;  1X65 A;  3HEJ A;  3GTK H;  4JI7 Q;  2WAQ G;  2JEA I;  4LW1 A;  1IBM L;  3NBH B;  5CV7 A;  4AIM A;  2A73 B;  1V8Q A;  1SND A;  3TQY A;  3BVZ A;  1AH9 A;  2K14 A;  4NW2 A;  4K5V A;  1CM9 A;  2UUB Q;  4HCE A;  1CKM A;  1LTR D;  5C4X B;  3QJY A;  4P72 A;  1TWC H;  5CV9 A;  3H15 A;  1BNZ A;  4ME5 A;  1STN A;  5M5W H;  2RVL A;  3NEM A;  3DWP A;  3PV0 A;  3T13 A;  1T5X D;  2C5C A;  4QGU A;  4DNI A;  2UXC L;  4IUN A;  3I4N B;  4NPS A;  5KIX A;  4POG A;  2BA0 A;  3D0F A;  2KCC A;  4K8I A;  2Z1C A;  4YIJ A;  2ZTE A;  1BBU A;  2BCO A;  1DM0 B;  2K50 A;  5HGT A;  4IUQ A;  2JA8 B;  1Y1V H;  4K0K L;  1PXU A;  2K05 A;  3PO2 B;  1TXY A;  2V4D A;  2HQE A;  5CV8 A;  1N34 Q;  3KOJ A;  2VY3 A;  1SMY D;  1I4H A;  3PIP A;  2VS1 A;  1BO0 A;  2FJ2 A;  1VQP A;  5A2Q L;  3NE5 B;  4XDX A;  4L5Q A;  1Y8N B;  4K2K A;  2JE6 I;  1M1K C;  2Z6K C;  1BBW A;  3SGI A;  4DK0 A;  2NVQ H;  1E2Z A;  4IJL A;  3QG1 A;  2CQO A;  4DR7 L;  3FVQ A;  2MFI A;  1STH A;  2PZT A;  2Z9H A;  5C3E B;  1PTO C;  2L11 A;  1Y1W H;  2LKV A;  4A3K G;  3NQI A;  3G6J B;  1L0Y B;  3L2P A;  1C9O A;  4DF7 A;  5IT9 L;  1JJG A;  1SE4 A;  4V19 0;  1I4R A;  1CKO A;  2Q2H A;  4AYB G;  3MFG A;  3CCL A;  1UEB A;  2UUA L;  4DPG A;  1EFW A;  2MGS A;  4GNX B;  2XGT A;  1CQV A;  3T51 B;  4BY1 H;  1EY5 A;  1VQF A;  3RN5 A;  2E74 C;  5BN3 A;  4R8I A;  3CCV A;  2MPM A;  2N8N A;  5GRO A;  1SYD A;  3CRL C;  5T1I A;  2A68 D;  1IZ6 A;  4KKU A;  1G8Z D;  4DN4 M;  4LFB Q;  4XYO A;  2Y0S B;  2B63 G;  1QNK A;  5EPJ A;  1SYB A;  1J8I A;  2JQO A;  4C3J B;  1GXD C;  4PV1 C;  2RDH A;  2WP8 J;  3NHH A;  4LF5 L;  5C4Z A;  2F0Q A;  5C3W A;  1EWH A;  1Z6H A;  1TS5 A;  1PH9 A;  4HMJ A;  4UHV A;  4R1J A;  5I9O A;  1E7Z A;  1CK1 A;  4AQY Q;  5BN5 A;  2A68 C;  4OWT B;  1F9P A;  3CQZ B;  4L5S A;  3OW7 A;  2F3W A;  3R2T A;  5IWA Q;  3A7A B;  1HNX L;  1EZ6 A;  2K28 A;  4Q5V A;  2LMC B;  3OMG A;  2YU9 B;  1CI3 M;  1YNX A;  1CTM A;  1H9S B;  2BDO A;  4LAA A;  1I3Q B;  2YU9 H;  2YYZ A;  2EYF A;  1ILQ A;  1II3 A;  3CU7 A;  5C44 G;  3MEF A;  1V43 A;  2EE1 A;  1OXT A;  1VF7 A;  3PO2 G;  2ATW A;  4JI6 L;  1LTS D;  2XVS A;  5D65 A;  3HOX B;  4MN3 A;  3SK4 A;  1ENC A;  3A55 A;  2Q2U A;  1D8L A;  3WDN A;  3BDL A;  3I91 A;  4KV6 A;  3W5O A;  3NSW A;  1W2B A;  4LF6 L;  4HIM A;  3GTG B;  1NE3 A;  2SNM A;  4QCL A;  1JC7 A;  1LTL A;  1ESR A;  5C4J H;  4A3J H;  2F1M A;  4K0K Q;  5F2D A;  1L1O B;  5GAD C;  4ZUI A;  3D6W A;  1VQO A;  4IFD J;  3KF6 B;  1RL2 A;  2D5D A;  2XIW A;  4IUP A;  5IIF A;  4KY6 A;  5JJI A;  5K36 H;  1LTB D;  4A3F B;  5I2X A;  1XXG A;  3DUZ A;  1WD1 A;  2F0N A;  4C3H B;  1Y1V G;  1J9O A;  1Q86 C;  1HNZ L;  3I72 A;  1LUZ A;  3CKI B;  3TS0 A;  5FLX E;  4QL5 A;  5ISR A;  1MSG A;  1TWG H;  4N8F A;  3STB D;  1LV9 A;  2B29 A;  2NTT A;  5CV6 A;  2ZM6 L;  5E3F A;  1D2B A;  1SAP A;  3BVG A;  3U4Z A;  2L0C A;  4IZ8 A;  3CCR A;  2RKS A;  1XMO Q;  5E7N A;  1PA6 A;  4RKL A;  4GLX A;  3RZD H;  3SXH A;  3CW2 C;  1XYI A;  1KL9 A;  3OHX C;  1K83 B;  4ID6 A;  1CQF A;  2K5N A;  1VF5 C;  3FHW A;  3WOE A;  2EY5 A;  1DON A;  5KYI A;  4JYA L;  4K6L A;  2L12 A;  3S1M H;  4HAE A;  2AWN A;  4A76 A;  3RN2 A;  4LNQ A;  3DEO A;  3L9A X;  3V2T A;  1YJ9 A;  1EZ8 A;  1CHP D;  4M8A A;  2CW0 D;  3D31 A;  1GUW A;  4CKC A;  1C0A A;  1LTA D;  4HTH A;  1O80 A;  1SYC A;  2CCZ A;  5D14 A;  1Q90 A;  2AMC B;  1YVC A;  4WOR A;  2K01 A;  2Z4I A;  2C35 B;  1KIX A;  3PO3 B;  1H95 A;  3FMC A;  4CDD C;  1ILP A;  4JI0 Q;  5IT9 E;  1CKN B;  2E8G A;  3DMU A;  3I4N H;  1WTV A;  2F0L A;  2A6H D;  4XYQ A;  4LF4 Q;  1DYQ A;  2ZXO A;  2TMP A;  1AE2 A;  2IT1 A;  1EQT A;  2QF7 A;  3GTP B;  4P2C B;  2E2J B;  3EFX D;  1U5K A;  3N6R A;  2F0T A;  3NPP A;  5C4X H;  4QF4 A;  1O7Z A;  4YWM A;  3ERS X;  3NWT A;  2UXB L;  2BH2 A;  2MO0 A;  4B3R Q;  2F4V Q;  4CGY B;  4GZY C;  2JA7 B;  3I70 A;  3I7F A;  2ZJQ A;  2RBM A;  1Y8O B;  4GKK Q;  5FOB B;  4ILW A;  3AFP A;  3H94 A;  4XIG S;  4B3M L;  3GTQ H;  2NN6 H;  1KLU D;  2ZTC A;  4J15 A;  4K5X A;  1U4R A;  1ESF A;  3X3M A;  1I4G A;  2SNS A;  3QWN A;  2MUY A;  4R4Q A;  1AW7 A;  4QMG A;  4A3E B;  1B8A A;  3UDI A;  4DNR B;  2LFN A;  4EGV A;  3S1M B;  4O0A A;  2F0E A;  1FJG L;  3F8T A;  1VQA A;  4A3I G;  3S14 H;  2EJG C;  4PZ8 A;  4JI4 Q;  4IUT A;  3KYH C;  3U9O A;  4A3K H;  1PMR A;  4ZCK A;  3VR6 A;  3J81 c;  4RGM A;  1TII D;  1U4P A;  4JBK A;  1XMO L;  1KD1 C;  1KHI A;  1PYS B;  2K32 A;  2I07 B;  2VB2 X;  4LF9 L;  4R4C A;  3AQQ A;  3S1N H;  3NBI A;  1VQE A;  3NTH A;  3A8K E;  3AYH B;  4DR1 Q;  4LF8 Q;  4DV2 L;  1PZJ D;  1VDZ A;  3IL8 A;  1NTG A;  3GTM B;  1BKB A;  1EY8 A;  3H09 A;  3S15 H;  3VR4 A;  2WFW A;  3S16 B;  1HPC A;  2CWA A;  1PH8 A;  2QDL A;  1WOC A;  1DD2 A;  2WAQ B;  3HOZ H;  2B63 H;  4BBS G;  1E24 A;  2WB1 G;  1EYA A;  3HKS A;  4GLA C;  4EQ5 A;  1LAC A;  5M5Y B;  1N9W A;  1X55 A;  3M4Q A;  3PIO 3;  4JK1 C;  4AH6 A;  2R92 G;  1JT8 A;  1I3Q H;  2QGQ A;  3JAM E;  1E2W A;  1A63 A;  4B08 A;  4ABN A;  3PCO B;  1SYE A;  4IOC A;  1KXL A;  1WVL A;  2JA8 H;  1PYW D;  4LFA Q;  3HOX H;  1TS2 A;  3S24 A;  4HCS A;  3SHL A;  2GVA A;  1C7Y A;  2NYZ D;  4IPH A;  1A2T A;  3OOC A;  4IFD I; 
#chains in the Genus database with same CATH homology
 5LMN W;  1XMQ L;  1V9P A;  4DUY L;  4DV3 L;  1N8R C;  3BZC A;  4IJH A;  2NN6 G;  2EIF A;  4TQU S;  1SMX A;  4KHP L;  2Z0S A;  4H02 A;  2JA6 G;  2PQA B;  1SN8 A;  3K80 C;  1FVI A;  1EOV A;  1CKN A;  1W3S A;  2Z6K A;  1YHQ A;  1IBK Q;  1D7Q A;  1I94 Q;  5HGQ A;  1Y14 B;  2K5V A;  5FJ8 G;  3KJP A;  4JYA Q;  3CAM A;  4OXP A;  1IBK L;  1L2F A;  5IYD H;  1WJJ A;  4MNO A;  1KAW A;  5BR8 L;  3M4O H;  4DV2 Q;  4IO9 A;  1PH6 A;  5DLQ E;  5IYD G;  4HIK A;  4HIO A;  4DV5 Q;  4YHH Q;  1P8L A;  4GOP A;  3CCE A;  3I2Z A;  4X64 L;  3W1B A;  3BJU A;  2IX0 A;  4DR5 L;  4B3T L;  3HOY H;  1XMQ Q;  4NXM L;  1X54 A;  3JC6 6;  3PUX A;  5JEA G;  1X3F A;  4DR5 Q;  2HIX A;  5C0X J;  1QUQ A;  1EQQ A;  3ULP A;  3TRE A;  1Q81 C;  1QVG A;  4KHP Q;  2D62 A;  1ASY A;  4IFD G;  4DV7 L;  1X65 A;  1K0R A;  4R4O A;  3J80 c;  1K8G A;  1HNW L;  2HHH Q;  4R4T A;  4AQY L;  3EIV A;  2MO1 A;  3GTK H;  2F3I A;  4DR1 L;  1PFS A;  4JI7 Q;  2WAQ G;  4GKK L;  1X3E A;  2JEA I;  4LW1 A;  3F2B A;  4RMF A;  4GOP C;  3NBH B;  1IBM L;  4A3F H;  1GD7 A;  4AIM A;  1QZH A;  3U58 A;  4JI1 Q;  3I4N G;  5M3F H;  3U50 C;  4X65 Q;  3TQY A;  1AH9 A;  1SR3 A;  2K14 A;  2UUB Q;  1L1O C;  5IT9 c;  1CKM A;  4P72 A;  3H15 A;  1TWC H;  3G71 A;  1S72 A;  1VQ7 A;  2ES2 A;  1GO3 E;  5M5W H;  1E1T A;  4BA1 I;  3NEM A;  1GM5 A;  2DUD A;  4DR3 Q;  1EQR A;  4C3H H;  5M3M G;  3PF5 A;  4JI5 L;  1PH2 A;  3H3V H;  3PV0 A;  2E2H H;  5C4X G;  4QGU A;  1PHJ A;  4DNI A;  4RG1 A;  2UXC L;  4IOA A;  4NPS A;  4HJ9 A;  3LGJ A;  5IY0 A;  1EIY B;  1S3O A;  4O2D A;  4POG A;  2BA0 A;  1VQH A;  3D0F A;  2CKZ B;  1YIT A;  1PH1 A;  2VQE Q;  3RLN A;  3BZK A;  3G4S A;  4X65 L;  4TVA B;  4UP8 A;  1PH3 A;  2CFM A;  3CXC A;  1M90 C;  2E2I H;  1KC8 C;  2ZTE A;  1BBU A;  3RNU A;  3U4V A;  3A5U A;  1SRO A;  1B70 B;  1AE3 A;  2K50 A;  3HOZ G;  1PV4 A;  4A3G H;  4BBR G;  2F4V L;  1N34 L;  5IWA L;  3GDE A;  2NVX H;  1Y1V H;  1WCM H;  1VQD A;  4K0K L;  1DGS A;  1MJC A;  4LF9 Q;  5C44 H;  3IRB A;  4DR6 L;  1TXY A;  4JI5 Q;  1N34 Q;  3HOV G;  1TWF H;  3KOJ A;  3HOU H;  2VY3 A;  4JC0 A;  4BA2 I;  1VQC A;  3CCU A;  4PZ6 A;  5J3B A;  1Q8K A;  4DV4 L;  3PIP A;  2VS1 A;  4JI8 Q;  4JBJ A;  1VQP A;  1YZ6 A;  4KI0 A;  2UXB Q;  4LF7 L;  3S2D H;  4L5Q A;  2OTJ A;  2JE6 I;  2H5X A;  2Z6K C;  1BBW A;  3SGI A;  1M1K C;  2NVQ H;  4IJL A;  4P73 A;  2CQO A;  4DR7 L;  3H0G G;  2JJQ A;  2VNU D;  4OWX B;  2MFI A;  1HNZ Q;  2QA4 A;  4QQB X;  1VQN A;  4UY8 C;  5LMN Q;  1J6Q A;  1Y1W H;  5GQO A;  4A3K G;  1XNR L;  2HIV A;  3L2P A;  1C9O A;  1MJE A;  1QVC A;  1JJG A;  1SE8 A;  4HJA A;  3CC7 A;  1PH5 A;  1IBL L;  1Q12 A;  2VUM H;  4C2M H;  1Q7Y C;  4HJ5 A;  3PUV A;  1VQK A;  2ASB A;  2JEB I;  2JA7 H;  4OWW B;  1CKO A;  3I4M H;  1GVP A;  2Q2H A;  1A8V A;  4AYB G;  3FKI G;  1VQ5 A;  3KDF A;  4LFC L;  1K8A C;  4B3M Q;  4DR4 Q;  3CCL A;  3GTJ H;  1UEB A;  2ZJP A;  2R7Z H;  2R7D A;  1WI5 A;  2UUA L;  4DPG A;  3K8A A;  1EFW A;  4GNX B;  4QIW E;  2XGT A;  1XTD A;  2PQA A;  2YTY A;  4PZ7 A;  2K75 A;  3F1Z A;  3S1Q H;  2EQS A;  4BY1 H;  4JI7 L;  1VQF A;  3RN5 A;  2OTL A;  3GTO H;  1Q46 A;  3CCV A;  2EXD A;  2N8N A;  1XNR Q;  1SRU A;  2LSS A;  5GRO A;  2E5L L;  3NEN A;  5GAH C;  3PF4 A;  4GS3 A;  1N32 Q;  2KHI A;  3B6Y A;  1IZ6 A;  4OX9 L;  4LFB Q;  1HZB A;  1JE5 A;  3HKZ E;  5M5X H;  2B63 G;  4LF5 Q;  2Q2I A;  2JQO A;  2IX1 A;  4DR4 L;  4PMW A;  4EX5 A;  4A93 G;  1QZG A;  1RIP A;  2WP8 J;  4LF5 L;  1K83 H;  1MIU A;  3OW2 A;  3PO3 H;  3K0X A;  1Q82 C;  1KRS A;  2D0O A;  3RLF A;  2NZO A;  3HOW H;  4PG3 A;  3FKI H;  2V1C C;  3EN2 A;  2N49 A;  2UXD Q;  1V1Q A;  1PH9 A;  1JJC B;  1YIJ A;  5IYC H;  1YEZ A;  3HOV H;  4R1J A;  4BXX H;  1E7Z A;  2GVB A;  1UE1 A;  4AQY Q;  2UUC L;  4KHZ A;  1L0W A;  1N36 L;  3UDF A;  4KLK A;  5IP7 H;  5FLM G;  4OWT B;  1GKH A;  1VQ8 A;  1BVS A;  1XNQ L;  4JI0 L;  4DR2 Q;  1HR0 Q;  2OWO A;  4L5S A;  3E9I A;  1K73 C;  3TRZ A;  4YWL A;  2VQF Q;  5IWA Q;  1JB7 A;  2I0Q A;  4A3L G;  4JI3 Q;  4BBS H;  1TWA H;  3H0G H;  5C0X I;  1HNX L;  1XPU A;  2I5M X;  1JMC A;  2VQF L;  2A8V A;  2JA9 A;  1UE5 A;  1YNX A;  1CUK A;  3G48 A;  4DV4 Q;  3CCJ A;  2YU9 H;  2YYZ A;  1YHB A;  3BU2 A;  4BY7 G;  4HJ8 A;  3NEL A;  2YTX A;  4IPG A;  5C44 G;  3OTO Q;  4A93 H;  3HKZ G;  3MEF A;  1V43 A;  5H1S E;  4WJ3 M;  2PNH A;  3M4P A;  1IBM Q;  1OXT A;  3HOU G;  3HOW G;  4DV1 Q;  2DGY A;  3CCS A;  3PO2 G;  2ATW A;  3A5Z B;  2MNA A;  4JI6 L;  4LF8 L;  1UE6 A;  1HR0 W;  2Q2U A;  1D8L A;  2JA8 G;  3CME A;  1WCM G;  1OXU A;  3W5O A;  4LUZ A;  5FJ8 H;  4A3J G;  2N78 A;  4QY7 A;  1W2B A;  2R92 H;  4LF6 L;  4HIM A;  1X3G A;  1J5E Q;  1HH2 P;  4P75 A;  1NE3 A;  2RF4 A;  4JI3 L;  1EWI A;  4X62 Q;  4DK3 C;  1LTL A;  4ME3 A;  3TEH B;  3GTL H;  5C4J H;  3I55 A;  4A3J H;  1Q1E A;  4K0K Q;  4A3L H;  3CQZ H;  4L5T A;  4UP7 A;  3J81 i;  2VW9 A;  3S17 H;  1L1O B;  5GAD C;  4YY3 Q;  5AJ3 Q;  1FJG Q;  1EYG A;  1VQO A;  4IFD J;  3KF6 B;  3STB C;  1RL2 A;  4JG2 A;  4JI4 L;  3EBE A;  5JJI A;  1KQS A;  1YJW A;  5IE8 A;  2R93 H;  4JI2 Q;  3KJO A;  4NXM Q;  1YHA A;  4XTC S;  4X66 L;  2JA7 G;  2XTI A;  4YWK A;  1VQG A;  4YCW A;  2IY5 B;  3E0E A;  3M7N A;  1Y1V G;  4MZ9 A;  1HZC A;  3PSI A;  1K3R A;  1NJI C;  1Q86 C;  3PUW A;  1HNZ L;  2GN5 A;  3CCM A;  4GNX C;  3T1Y L;  1X9N A;  5M3F G;  1OXS C;  3M9B A;  3RZO H;  1LUZ A;  3TS0 A;  2ZJR A;  4A3D G;  2OQ0 A;  4LUO A;  4QL5 A;  1VQB A;  3ZJY C;  2K52 A;  2UU9 Q;  1L1O A;  4X6A H;  5IYB G;  4UP9 A;  1TWG H;  4LFB L;  3STB D;  3M3Y H;  2B29 A;  4ALP A;  2ZM6 L;  1X6O A;  1HZ9 A;  5LMU Q;  3GO5 A;  5IP7 G;  2L15 A;  3U4Z A;  1OXV A;  1R9T H;  3CCR A;  1XMO Q;  5E7N A;  2I5L X;  4P71 A;  2ZM6 Q;  1PA6 A;  3VDY A;  4GLX A;  3A0J A;  4DK6 C;  4A3C G;  4BY1 G;  3RZD H;  2JA5 H;  3CW2 C;  4DKA C;  3KFU A;  3GD7 A;  1KL9 A;  2WAQ E;  4A3M G;  1ASZ A;  2B3G A;  3OYY A;  2OCE A;  2K5N A;  3FHW A;  4C3J H;  1S40 A;  3T1Y Q;  1G29 1;  3PO3 G;  3DM3 A;  5JJK A;  4GN4 B;  1I94 L;  4JYA L;  3CF5 A;  4A3M H;  3PGZ A;  2D0P A;  3RLO A;  3OTO L;  4DUZ L;  3S1M H;  4DV0 Q;  3K81 C;  2K5H A;  2HHH L;  1LM0 A;  2AWN A;  4DV1 L;  4A76 A;  3I4M G;  3S16 H;  2VZA A;  1HR0 L;  3RN2 A;  1IXR A;  2KCT A;  4LNQ A;  4DAM A;  2HQL A;  1UWV A;  3K7U C;  3ULJ A;  1PYB A;  4X64 Q;  1OTC A;  4B3T Q;  3L7Z C;  1YJ9 A;  4JV5 Q;  5C3E H;  2N3S A;  1A0I A;  2R7F A;  1WYD A;  3J80 i;  3D31 A;  4X62 L;  1PVO A;  5FLX c;  4LF4 L;  1C0A A;  5ELN A;  1E1O A;  5C3E G;  3S2H H;  3HOY G;  2Q2T A;  2BH8 A;  2VL6 A;  3ER0 A;  2CCZ A;  1LYL A;  2AMC B;  5GAG C;  4MTN A;  1YVC A;  2E5L Q;  4B3S Q;  4GLV B;  4GN5 A;  2NVY H;  2Y0S E;  4R4I A;  1NY4 A;  5GAE C;  4DUZ Q;  4A3E H;  3CCQ A;  4YCV A;  2C35 B;  2UXC Q;  1KIX A;  4B3S L;  3GTM H;  1H95 A;  1YJN A;  3PO2 H;  4DR7 Q;  1IYJ B;  2UUB L;  1G6P A;  2Y0S G;  2RHS B;  4APV A;  1VQM A;  4JI0 Q;  1CKN B;  2E8G A;  2NN6 I;  3RR5 A;  3AEV A;  1VQ6 A;  2LXK A;  3I4N H;  3CPF A;  3KLW A;  5LMN L;  1X56 A;  3CD6 A;  4LF4 Q;  4A3B G;  1E3P A;  1O7I A;  4NB3 A;  4P74 A;  4GKJ Q;  2PI2 E;  3F2C A;  3T1H L;  5C0X G;  1B7Y B;  1AE2 A;  2K4K A;  3A74 A;  3J7Z C;  2IT1 A;  3DLL A;  4A3B H;  4WJ4 A;  1Q1B A;  4GKJ L;  5M5Y H;  3CMA A;  2WB1 E;  3PUY A;  1U5K A;  3GTP H;  5C4X H;  4X66 Q;  2ALY B;  5IP9 H;  5LMU L;  1Z9F A;  1NBW A;  4YWM A;  4DR2 L;  1FL0 A;  2IHF A;  3ERS X;  4JBM A;  1Z47 A;  1VQI A;  2OQK A;  2UXB L;  4DAY B;  1K9M C;  2YTV A;  2BH2 A;  1VCI A;  2R93 G;  3TS2 A;  1PH4 A;  2KCM A;  1E22 A;  2KHJ A;  4A75 A;  1TWH H;  1VQL A;  2MO0 A;  2PMZ E;  5JEA J;  2F4V Q;  4B3R Q;  3G6E A;  3I7F A;  2ZJQ A;  1HNW Q;  4DV6 L;  1WFQ A;  2ID0 A;  4C3I H;  1CSP A;  3JAM c;  4OO1 G;  4A3G G;  4GKK Q;  1SFO H;  3J81 j;  1YI2 A;  1N32 L;  4OON A;  1I6H H;  3AFP A;  4B3M L;  4XIG S;  1I50 H;  4OX9 Q;  2AKW B;  4LUV A;  4JI1 L;  1HZA A;  1XPO A;  2ZTC A;  4J15 A;  2QEX A;  3GTQ H;  5IYB H;  3W1G A;  2JA5 G;  2CWP A;  1PH7 A;  4LF7 Q;  4FDB A;  1VS0 A;  5JJL A;  1QUQ B;  1T9H A;  4JOI A;  4HID A;  1FGU A;  4LF6 Q;  4Y52 H;  3L0O A;  3Q8D A;  4R4Q A;  4DV7 Q;  3CP0 A;  2BA1 A;  3MXN B;  4A3D H;  1MKH A;  2PI2 A;  3E9H A;  4LFA L;  1B8A A;  2MQH A;  3UDI A;  2R7Z G;  5M3M H;  3K7A H;  4NXN L;  3KDF B;  1QVF A;  2HT1 A;  1VQ4 A;  4POF A;  1XJV A;  4O0A A;  1FJG L;  3F8T A;  4Y7N H;  1VQA A;  4A3I G;  1N33 L;  3S14 H;  1IBL Q;  2F52 A;  4PZ8 A;  4JI4 Q;  1G51 A;  1U0L A;  2KBN A;  3UE1 A;  3KF6 A;  3KYH C;  4A3E G;  2VQE L;  5BR8 Q;  2UU9 L;  4JOI C;  4A3K H;  4A3C H;  4DUY Q;  4DV3 Q;  4A3F G;  3J81 c;  5EAY A;  2VUM G;  4LWC A;  2JA6 H;  1HNX Q;  4JBK A;  1I5F A;  3M85 A;  1XMO L;  1KD1 C;  1KHI A;  1PYS B;  5ELO A;  3GTG H;  4LF9 L;  4R4C A;  3CC4 A;  2A19 A;  3AQQ A;  3S1N H;  1SLJ A;  1VQE A;  2KEN A;  2ZTD A;  5FLM H;  1VQJ A;  3AFQ A;  1A62 A;  3J7A 5;  2FXQ A;  3AYH B;  4DR1 Q;  4JI6 Q;  4DV2 L;  4LF8 Q;  1HJP A;  4L5R C;  1IL2 A;  4BXX G;  1NTG A;  5HY6 A;  4DV5 L;  2RCN A;  3HOX G;  1BKB A;  4IPC A;  4JCV E;  2YV5 A;  1OXX K;  4A3I H;  3S15 H;  2JK8 A;  2LXJ A;  2WFW A;  2R6G A;  3HFZ B;  1CSQ A;  2CWA A;  3PUZ A;  4DR6 Q;  3I56 A;  1PH8 A;  3CC2 A;  4BY7 H;  1WOC A;  2AHO B;  4B3R L;  4QJF A;  4YCU A;  1KRT A;  3HOZ H;  2B63 H;  4BBR H;  5K36 G;  4BBS G;  4UPA A;  2RHQ B;  3UDX A;  3JAM i;  1E24 A;  4DR3 L;  2WB1 G;  3UDG A;  4JI8 L;  1Y1W G;  4IPD A;  4YY3 L;  5AJ3 L;  2NVT H;  2UXD L;  3HKS A;  4HJ7 A;  4OO1 I;  4GLA C;  4EQ5 A;  1YBY A;  4DV0 L;  2E2J H;  2NZH A;  2UUC Q;  1N9W A;  3CPW A;  1EIF A;  1X55 A;  3M4Q A;  3KF8 B;  1N36 Q;  4AH6 A;  2R92 G;  1JT8 A;  1NMG A;  1I3Q H;  1NMF A;  2QGQ A;  3I4O A;  5IYC G;  1J5E L;  1XNQ Q;  2IHE A;  1A63 A;  3H3V I;  4JV5 L;  4GN3 B;  3PCO B;  4IOC A;  4GNX A;  1KXL A;  3UE0 A;  2AWO A;  2UUA Q;  4JBW A;  3WWV A;  2I5H A;  2JA8 H;  3F2D A;  4DV6 Q;  4GOP B;  4A4I A;  4LFA Q;  3HOX H;  1JJ2 A;  1P16 A;  1VQ9 A;  3S24 A;  4NXN Q;  1EUJ A;  2GVA A;  3FP9 A;  3ICE A;  1XPR A;  5IP9 G;  1N33 Q;  3T1H Q;  4JI2 L;  1UE7 A;  3ULL A;  4AYB E;  1C7Y A;  3S1R H;  3PIO A;  4LFC Q;  4IPH A;  4YHH L;  2A1A A;  4IFD I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...