4LWCA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/inhibitor
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lwcA00
1S40A 2NZHA 2K52A 3S1RH 2OWOA 2D0PA 2ZTDA 3TREA 5M3FH 1I5FA 4R4IA 1VQKA 2K14A 2OQKA 4LF5L 4OX9Q 5GROA 4DR7L 3T1YQ 2K5VA 1W3SA 1Y1WH 1PH2A 2E8GA 3L0OA 1XMQL 2PQAB 3U4ZA 1SR3A 1PYBA 1MIUA 1YIJA 2LXKA 1KRSA 2QEXA 4JI0L 1KQSA 4LF4Q 3PUZA 5M5XH 1OXSC 4HJ5A 1EUJA 3K0XA 1EQRA 4WJ3M 1PVOA 3PO3H 4DV1Q 2UXBQ 4GOPA 3GTPH 3F1ZA 1L1OB 4DV3Q 1IBKL 3A5ZB 3CXCA 2UUBQ 3RR5A 4A4IA 3K7UC 2D0OA 5BR8Q 4L5TA 3OTOQ 2JA9A 1HZBA 1TWCH 5EAYA 4EX5A 1K9MC 4HIDA 1P8LA 3DM3A 2RF4A 4EQ5A 1EQQA 4GKKQ 4IOAA 4OWTB 5JJLA 4LF8L 3HOYH 2R7DA 3M85A 2PNHA 4O0AA 4DV2Q 4A3DG 2ZM6Q 2VY3A 3PIPA 1Q46A 3CCJA 1E3PA 5FLMH 5LMUQ 5IE8A 4HJ7A 2FXQA 2DUDA 3S15H 2F52A 1IL2A 3BZKA 2HHHQ 4JBMA 3AFQA 4A3KH 1VQMA 1XJVA 3CC2A 2ZTEA 4IFDJ 4PZ7A 2Z6KA 3MEFA 4A76A 1AH9A 5IYBG 5IYCH 1L1OC 4DAMA 4HJ8A 1IZ6A 4DPGA 1VQHA 2HIXA 4UY8C 1FVIA 4R4QA 1PH7A 1KAWA 2RHSB 4A3CH 1CKNA 1VQFA 3S17H 4DK3C 3M4PA 3PSIA 1PH1A 1X55A 4C3HH 3KFUA 1A62A 3NBHB 1TWFH 4B3SL 4B3MQ 2UXDQ 2BH2A 2HQLA 2IHEA 2OTJA 1SMXA 5FLXc 3CCVA 4LWCA 4XTCS 3F2CA 4BBRG 1PH8A 4X64L 4B3RQ 3D31A 4LFCQ 4IPDA 4YCVA 1HNWQ 4JI7Q 5GAHC 4NXMQ 2JK8A 4LNQA 4AYBG 4GN3B 4LF9L 5IP9G 2GVBA 5GAEC 1S3OA 1E7ZA 3TEHB 1J5EQ 2R7FA 2UXCQ 3JAMi 1UE6A 4X62Q 2B3GA 4GNXB 4JV5Q 1KD1C 1KRTA 1PHJA 1V9PA 2NVXH 4JI4Q 1FL0A 3RLFA 2NVTH 1NTGA 1Q1EA 4DV6L 1T9HA 3A5UA 2B63G 3KDFB 2AKWB 3AQQA 4HIKA 1GD7A 3PUVA 1N9WA 4KLKA 3KF6B 3I4MG 1UE5A 4MNOA 4QQBX 1HR0L 3M4OH 1HR0W 2Y0SG 4AQYQ 1N32L 4YWLA 2JEAI 4A3IG 2UUAQ 2YTVA 3ICEA 3AFPA 4L5QA 5GADC 3NELA 1XNRL 3PCOB 3HOZG 4A3DH 1CKOA 1PH6A 3J80i 3CCMA 2VNUD 1EOVA 2IX0A 1LUZA 4GNXC 2PI2A 3K81C 1WYDA 3KOJA 1B8AA 1KIXA 3CP0A 1N33L 1K83H 2MQHA 2VQFL 4BBSG 2Z0SA 1X56A 1X54A 1KHIA 4GLAC 4DUYL 2Q2UA 5IYBH 2CQOA 4QY7A 2JQOA 2VQEQ 1IBML 2UU9L 3JC66 1GM5A 1XPUA 3AYHB 4X66Q 4P71A 4LUVA 4A3MG 2CWPA 4P73A 4A3FG 3BU2A 5AJ3Q 4JI2L 1MKHA 3UDXA 4X65L 4DV7Q 4A93G 1M1KC 1CSPA 3I2ZA 4AIMA 3E9IA 2RHQB 4JI8Q 2H5XA 5IP7G 1N34L 4TQUS 4DAYB 4YCWA 3M4QA 2CCZA 3F2DA 3FHWA 4BBRH 3GTKH 4YWMA 4IFDI 4KHPQ 3CQZH 2WP8J 4DV4L 4JG2A 2JA5G 4DR4L 1G291 1HH2P 5IP9H 1QUQB 1VQGA 4UP9A 4DR1L 2F4VL 1SRUA 5C44G 4ALPA 1PV4A 4OWWB 3FP9A 1YHBA 4PMWA 4DR3Q 1QVGA 1Q8KA 1VS0A 3M3YH 1JJGA 1LYLA 4KI0A 1X3EA 3KYHC 1YI2A 4LF5Q 1L2FA 1PYSB 2IT1A 1TXYA 2B63H 1Q81C 4Y52H 4POGA 4Y7NH 4YHHL 4GKJL 4JI6L 3I4MH 2HIVA 1LTLA 3J81i 4NXNL 1PH9A 3KJPA 3RNUA 4A3IH 4LUOA 1JE5A 1YHAA 2ID0A 4JI0Q 1XNQL 2D62A 3HOZH 1TWHH 2BA0A 5J3BA 3TQYA 1SE8A 1YVCA 3I56A 3E9HA 3D0FA 5GQOA 3L7ZC 4GN4B 3KF8B 3PO2G 4WJ4A 3I55A 2XTIA 1K73C 4C3IH 1IBKQ 2Q2TA 1X65A 1VQDA 4JBJA 4RG1A 2KHIA 4BBSH 4POFA 1LM0A 4XIGS 1C7YA 1VQAA 1EFWA 4YWKA 2Q2IA 4JI1L 3S2DH 1E24A 1NY4A 1U5KA 1V1QA 2V1CC 4LF8Q 1Y14B 2YTYA 3IRBA 4LFBL 1DGSA 1I6HH 2UUCQ 4A3MH 3Q8DA 5C0XJ 4A3FH 2E5LL 1BBWA 4LF6Q 4A93H 1I94L 5ELOA 1X3GA 1G6PA 1OTCA 1UE7A 2CKZB 5IP7H 1VQ8A 4JI5Q 4DK6C 2A19A 3ULJA 2JA7G 2VS1A 4O2DA 3S1NH 4UP7A 5E7NA 1QVCA 1Q1BA 2JA5H 3HOVG 3CMEA 4AYBE 5C0XG 1YITA 4A3BG 1PH3A 4DV1L 1XMOQ 4JOIC 2N78A 2JEBI 5C44H 2KHJA 2UUBL 1VQ6A 3ER0A 1PH4A 4B3TQ 4B3SQ 4QGUA 2IY5B 1D7QA 2WB1G 3H15A 1K8AC 2JA8G 1IBLQ 4IFDG 1Y1VG 5C4XG 1HZCA 4QJFA 4DV2L 2L15A 4PZ6A 1G51A 4YY3L 2NVQH 4JBWA 3RN2A 3S16H 4BXXG 2Y0SE 4LF9Q 1GKHA 3J7A5 3HKZG 2VW9A 1QZGA 3GO5A 2I0QA 3PF5A 1AE2A 3WWVA 1VQPA 3OYYA 5JEAJ 1QVFA 3AEVA 3RLNA 3CMAA 4A3GG 2MNAA 3T1HQ 3HOUG 4LFAL 1SN8A 4GOPB 3PO2H 4NB3A 4LW1A 4DV6Q 3H0GG 3STBC 1PFSA 3A0JA 1VQ4A 2GN5A 2GVAA 4DNIA 4L5SA 1HR0Q 3HOXG 1N32Q 5HGQA 1YHQA 4JCVE 2MO1A 1Z9FA 5JEAG 5M3MG 1UE1A 2KBNA 4DV5Q 4OO1I 1XTDA 4UP8A 1Q86C 1I3QH 4GLXA 4LF7L 1XNRQ 2AHOB 1OXUA 3KLWA 4B3RL 2PMZE 4LFCL 2KCMA 1NJIC 4GLVB 4PZ8A 1HNWL 1NMGA 1VQIA 3BZCA 4P74A 1N33Q 2OTLA 4J15A 3RLOA 3GTJH 2K50A 2VQFQ 1J5EL 2I5LX 3GTGH 2R93G 4X62L 4DUYQ 4GOPC 1Z47A 4A3EG 2JA7H 1PH5A 1V43A 1IBMQ 3HOVH 1N36L 3GD7A 3A74A 3U50C 2ZJRA 4HIOA 1CKNB 4A3BH 3E0EA 3CCSA 4DR2L 4JI2Q 1VQ7A 2K5NA 4R4CA 5C0XI 1CSQA 5JJKA 4X65Q 2EXDA 3L2PA 3F2BA 3ULLA 4DR5L 1HNZQ 4BY1G 2ES2A 4C3JH 1BVSA 4GS3A 4AQYL 2JA8H 1N34Q 2YTXA 1WFQA 3CAMA 3G4SA 3GTMH 1Y1VH 5C4XH 1VQ5A 3S14H 4JI3L 2VZAA 2PQAA 4IO9A 1FJGL 4DV4Q 4DR4Q 3CW2C 4BXXH 4K0KL 3K80C 1U0LA 4BA1I 4DR6L 3W1BA 4DUZL 4IPCA 1WJJA 1UEBA 2Z6KC 1NE3A 4R1JA 2F4VQ 2Q2HA 1OXVA 3HOWG 4MZ9A 3S24A 3EN2A 1JJ2A 4DV0L 2WAQG 5LMNL 1L1OA 4A3GH 5LMNW 3CCEA 3HOUH 3PUWA 1YJWA 3J7ZC 1TWGH 2IHFA 3H0GH 3PUYA 2ZTCA 3GTOH 3S2HH 4HJAA 3S1QH 4AH6A 4YHHQ 2JA6G 4BY7G 4GKJQ 2MFIA 2N8NA 5H1SE 3RZDH 3W5OA 4DR7Q 4NXNQ 5FLMG 1YZ6A 3HOXH 1R9TH 1HNXL 1C0AA 4H02A 1HJPA 5JJIA 4OXPA 1C9OA 4TVAB 3ZJYC 2N3SA 5M3MH 2ZJQA 2R7ZG 1XMQQ 3CCUA 4L5RC 4JI8L 2E2HH 1Q12A 1P16A 3UE0A 3B6YA 1KC8C 1B70B 1YBYA 5DLQE 1I50H 3W1GA 1JT8A 2BH8A 4YCUA 3DLLA 3M7NA 4JYAL 4IPHA 4FDBA 3BJUA 2R93H 2VL6A 1A63A 4C2MH 5IWAL 1YEZA 3CCQA 4A3EH 3MXNB 4JI1Q 2QA4A 3U58A 3H3VI 4DR3L 4LFBQ 4OO1G 3SGIA 5FJ8G 1HZ9A 1W2BA 1QZHA 1CKMA 1RL2A 1TWAH 1WCMG 3CF5A 2NZOA 1K0RA 4A3JG 2E5LQ 2F3IA 1Q82C 5C3EG 1NBWA 1VQBA 5M5YH 2YV5A 3KJOA 2WB1E 1I94Q 4BY1H 4OX9L 4KHZA 2R6GA 1KXLA 5HY6A 2VUMG 3T1YL 4JBKA 3I4NG 4IJHA 3UE1A 4R4TA 1ASYA 4X6AH 1VQNA 3J81j 2AMCB 2EQSA 1K8GA 5ELNA 1PA6A 2NN6I 1VQCA 4GNXA 4LF4L 1IYJB 5IY0A 1E1TA 4NPSA 3HKZE 4QL5A 3HOWH 3CCRA 2UXBL 4DKAC 2KENA 1EWIA 2B29A 3TS0A 3PF4A 4MTNA 4DV3L 3KDFA 1GVPA 3G6EA 3PGZA 2QGQA 1E22A 5BR8L 3UDIA 3KF6A 3OTOL 1O7IA 1K3RA 3TS2A 3ULPA 2UUCL 2JA6H 4BY7H 2RCNA 4GKKL 1BBUA 3FKIG 4YY3Q 1KL9A 1B7YB 4X64Q 3PUXA 1S72A 4RMFA 3HFZB 1MJCA 2E2JH 4LF6L 2ZM6L 4A3LG 1A0IA 1VCIA 5LMUL 4P72A 2R7ZH 3UDFA 4PG3A 3U4VA 1SLJA 2EIFA 1H95A 4GN5A 4JI5L 5IYDG 2C35B 4HJ9A 2HHHL 2BA1A 1AE3A 3JAMc 4JC0A 4LFAQ 2LSSA 3TRZA 3EBEA 2K4KA 1XMOL 1WI5A 1CUKA 4OONA 4B3TL 1NMFA 1RIPA 3CPFA 1VQJA 2MO0A 4IJLA 4QIWE 4IPGA 5FJ8H 2K75A 5GAGC 3CC7A 1IBLL 2R92G 4P75A 2I5HA 4HIMA 4B3ML 4LF7Q 2UXDL 1WCMH 1WOCA 3ERSX 4A3JH 1E1OA 2YYZA 4OWXB 2K5HA 1MJEA 5C3EH 2IX1A 3NEMA 2NVYH 5M5WH 3J80c 1A8VA 1VQOA 1XPOA 5IT9c 4JI7L 4NXML 2VUMH 3I4NH 2OCEA 1SROA 2UXCL 4IOCA 1QUQA 1N36Q 3T1HL 4JV5L 1OXXK 3CD6A 1HZAA 2UU9Q 4JI4L 5M3FG 1YNXA 4DR2Q 2YU9H 2ALYB 2CWAA 2JJQA 3STBD 4DR5Q 2WAQE 3HKSA 2HT1A 2WFWA 2AWOA 3F8TA 4BA2I 1VQEA 3M9BA 1Y1WG 3CC4A 4DV5L 1ASZA 4JI3Q 2ZJPA 1FJGQ 1YJNA 2PI2E 3NENA 2E2IH 4K0KQ 3FKIH 2UUAL 3CCLA 3RZOH 2NN6G 1SFOH 4DR6Q 4DUZQ 3UDGA 1J6QA 3EIVA 4A3LH 1D8LA 3CPWA 3PO3G 1JJCB 2AWNA 3GTQH 4DR1Q 5IYDH 1YJ9A 1IXRA 4DV0Q 5LMNQ 2A1AA 1OXTA 1EIYB 2ATWA 1X3FA 3G48A 3I4OA 3K8AA 2DGYA 2OQ0A 5K36G 3G71A 3PV0A 3GTLH 1X9NA 4JOIA 2VQEL 4LUZA 3RN5A 5C4JH 4X66L 3HOYG 1HNXQ 3S1MH 4JI6Q 1HNZL 4UPAA 2A8VA 1BKBA 1M90C 5AJ3L 1X6OA 3K7AH 3GDEA 3OW2A 3J81c 2JE6I 1JB7A 3I7FA 2R92H 4DV7L 2N49A 1Q7YC 1L0WA 4A3KG 1EIFA 2CFMA 1VQLA 1XNQQ 4A75A 1FGUA 1GO3E 2I5MX 3PIOA 2XGTA 3VDYA 4KHPL 4APVA 1EYGA 4JYAQ 5IYCG 1UWVA 2LXJA 1XPRA 4ME3A 1N8RC 1JMCA 5IWAQ 4R4OA 2KCTA 4A3CG 2ASBA 1VQ9A 3H3VH 3LGJA
chains in the Genus database with same CATH superfamily
1S40A 3S15B 1F2ZA 4S3SA 1VDZA 1KNAA 4FYDA 2OWOA 2D0PA 2K5QA 1BCPD 4RKBA 2KEEA 4R4IA 1CQFA 2RKSA 3OIPA 3NUCA 5FO7B 3T1YQ 1W3SA 4RH6A 2QEJC 1PYBA 3VYSA 2QF7A 5C3XA 1KRSA 1AH9A 2RDHA 3SK5A 1EUJA 3K0XA 1PVOA 4GOPA 3J81L 1L1OB 4DV3Q 1IBKL 2UUBQ 3C1FA 3NPPA 3RR5A 3K7UC 2I07B 2L11A 5CBEE 1D2BA 4L5TA 3OTOQ 1S5FD 2JA9A 1P8LA 4GKKQ 1EQQA 1KLGD 3J7AF 5TSSA 5DAUA 2R7DA 2L5TA 1EQTA 3M85A 2VY3A 5LMUQ 1Q46A 4OIJA 5FLMH 2FXQA 1O7ZA 3X3NA 1IL2A 1CZGA 1D5XC 3M4OB 2EYJA 2ZTEA 1QNKA 2JP1A 4PZ7A 3MEFA 5IYBG 4HJ8A 3QG1A 4DPGA 1VQHA 1HQMC 1PH7A 1KAWA 5E3FA 1CKNA 1RHPA 3P7JA 4J1MA 2OT2A 1IL8A 3SK8A 1K83B 3NBHB 2UXDQ 1KLUD 1ICFB 4ZAIA 2HQEA 2HQLA 4A3BB 4LWCA 4BBRG 4B3RQ 4IPDA 4YCVA 5GAHC 1AW7A 4LNQA 4WORA 1E7ZA 1KABA 3JAMi 4J6HA 3D4RA 1SE4A 2EY5A 4JV5Q 2A68C 1SYCA 4DXGA 1V9PA 4V0BA 4HEDA 1Q1EA 4RFBA 1LT3D 4DV6L 3A5UA 1PZID 1QILA 2AKWB 2XN9C 1GD7A 4KLKA 3E0JA 3R8BA 1BUVT 3K0YA 1HR0W 3WDNA 1N32L 1PTOC 3BYTB 4YWLA 2FMMA 1PFBA 2O5JC 3ICEA 2WACA 1G91A 1HFNA 1MHWC 1CKOA 3A7LA 2B63B 1PH6A 3FVQA 2F0HA 2IX0A 4Y7NB 4C3IG 2PI2A 3CP0A 2MQHA 4BBSG 3FRPB 1X56A 1X54A 5FLXL 4A3IB 2A68D 1LTAD 5IYBH 4QY7A 3MXNA 2JQOA 5EKIA 1IBML 3AYHB 1D1IA 4X66Q 3C2PA 3TMEA 2F0KA 2SNSA 2CWPA 5AJ3Q 2IX3A 4DV7Q 4RAUC 4XYOA 4QIWB 1G6ZA 4TSSA 1S5BD 1NR4A 5KRUA 4BBRH 3GTKH 5CR3A 4DV4L 4MHEA 4H44C 2F3VA 3GV3A 4JW0A 2PMZB 4A93B 1SRUA 1EZ6A 5D3IB 1YNJD 3M3YH 3BDLA 4KI0A 2XNAC 1YI2A 3KYHC 5C4ZA 2PNRC 5IGGA 4KY6A 4POGA 4JI6L 4ABNA 2Q8RE 3J81i 4NXNL 3V2TA 1A3TA 2EOTA 2F0WA 4IUQA 2F0DA 1XNQL 5J3BA 4X3SA 5GQOA 4N8FA 1KDCA 3KF8B 2Q2TA 1AZQA 4C3IH 5KYIA 1IBKQ 4DA2A 5FOBB 2R7ZB 4K2KA 4BBSH 1LM0A 1TKWB 1B3AA 1B2TA 4YWKA 4JI1L 3S2DH 1E24A 5CV5A 1V1QA 3IRBA 1BO0A 3NE5B 4B08A 4K6DA 3I91A 4L6TB 2DNEA 3K58A 1Y8PB 5ELOA 1X3GA 1G6PA 1UE7A 4HTHA 2KCNA 5E7NA 1Q1BA 3HOVG 5I6WA 5C0XG 1YITA 4A3BG 4EQOA 4JOIC 2N78A 2JEBI 1CM9A 3N52A 4B3TQ 1MGSA 1D7QA 3GTGB 2JA7B 2BDOA 4QJFA 1K3BC 1HUMA 3S16H 1QCBD 3OWFA 4CKBA 3TP8A 1HUNA 4B9XA 2WB1B 3OYYA 3AEVA 2F0VA 4LFAL 1SN8A 4DV6Q 3ONAB 3STBC 4IUVA 1VQ4A 2A69C 1N32Q 2VXWA 1LABA 3OIQA 1STHA 4CJ1B 1Q86C 4LF7L 3L3OC 3GTOB 3KLWA 2F03A 4LFCL 1B4OA 2KCMA 2WIIB 3T4AC 1HNWL 4GLVB 4PZ8A 3S1MB 1M4VA 3RZDB 2OTLA 3HOXB 4X62L 3V05A 3AB9A 4FXKC 1IBMQ 4NW2A 3HOVH 2ZJRA 2K01A 4A3BH 5CV9A 4DR2L 5KNBA 5LL6X 1S4ZA 4R4CA 2A69D 2EXDA 3D8GA 2R93B 2K5WA 4C2MB 4GS3A 2PO4A 2VZAA 1X3QA 4DV4Q 1J9OA 3CW2C 4DK0A 3K80C 1U0LA 2SEBD 3DWQA 1UEBA 2PZTA 1NE3A 4B9WA 1XWEA 2Q2HA 3MVVA 3EN2A 3E5SA 4RA8A 5LMNW 1YJWA 5F2DA 2DN8A 2F0MA 5ELDA 5M5XB 4HJAA 4ZKBB 2KVMA 4AH6A 3LNNA 2N8NA 4HMIA 4ULLA 3W5OA 4NXNQ 4LJZC 1R9TH 1C0AA 1V8QA 2ZJQA 1LV9A 2R7ZG 1XMQQ 3CCUA 4JI8L 1EEID 4QUFA 4XT3B 4CDDC 2E2HH 1Q12A 1KC8C 1G2SA 2JA6B 3W1GA 1PRTF 3DLLA 4YCUA 3C1EA 3FPUB 3DHQA 2SOBA 3M4YA 5IWAL 5IGEA 4FF4A 4JI1Q 4A3KB 3U58A 3SGIA 1F77A 1STEA 4CJ2C 1CKMA 2AUJD 1QZHA 1RL2A 1TY0A 1QG7A 1TWAH 2CH4A 2NZOA 1K0RA 4A3JG 1A2UA 2FMCA 5HY6A 3FEWX 3I4NG 1ASYA 1OO9B 1TR5A 4ODGA 2AMCB 1K8GA 4DNRB 1ESRA 3IKJA 4LF4L 4KMUC 3KUPA 4NPSA 1U4LA 3HKZE 5C3EB 4QL5A 5IIFA 4U673 2B29A 4BS9A 3NTKA 4PMCA 3UDIA 1F2MA 1RODA 1SMYC 4XXEA 1B50A 3FKIG 1H9KA 3HFZB 4P72A 2R7ZH 3UDFA 3HG9A 1SEBD 4PG3A 4GN5A 4JI5L 2HHHL 2Z6BA 4LFAQ 2NBFA 5CV6A 2KA7A 3U9OA 1JOOA 3NQTA 4H0LC 3MC0B 1BBXC 2LMCB 4OONA 1NMFA 1DXMA 3CC7A 5GAGC 1IBLL 1SMYD 4LF7Q 4HIMA 3RMHA 4A3JH 1WTHA 4Q0FA 2KUMA 3BDCA 3I90A 5CBAE 1VQOA 1RDPD 3I4NH 4EGVA 2OCEA 2C9OA 4IOCA 2F0EA 2F0IA 2HCIA 2L12A 4JI4L 5M3FG 2MJ8A 1ONLA 4DR2Q 2ALYB 2CWAA 1ML0D 2WAQE 1GUOA 2EYMA 1TT2A 1B9NA 5BN4A 3FKIH 2UUAL 2F0SA 1EYCA 1JC7A 3GTQH 1F9QA 1Y8NB 4F8MA 1OXTA 3NP8A 2RCFA 1PFNA 1X3FA 2PPBC 2K04A 5K36G 4JOIA 3J7AV 3J80L 5IT9L 3RD4A 3S1MH 1EYDA 3OW2A 2Z9HA 1Q7YC 1SNQA 1L0WA 4A3KG 2K7VA 3MHBA 1FGUA 1JE4A 2I5MX 3PIOA 4KHPL 4QQBX 2F0JA 2K1BA 2LXJA 4ME3A 4FF2A 5IWAQ 1RCVD 2ASBA 2NZHA 2K52A 2F0LA 1AZPA 3BYYB 1DM0B 3TREA 5M3FH 2JA5B 5JOBA 4P2CB 1XYIA 3TP5A 3L0OA 4J8QA 2PQAB 1D6EC 1SR3A 3JAME 1G8ZD 1XTCD 1KQSA 4LF4Q 5M5XH 1OXSC 4HJ5A 4FXGC 2ZXOA 4DV1Q 1J8IA 3F1ZA 4IALA 3A5ZB 4F88A 2K6AA 1Z7TA 4N8X1 3URYA 1EYAA 4A4IA 2RBMA 5EAYA 1XXGA 5K36H 4IOAA 4OWTB 4LF8L 4O0AA 4C1NI 3C46A 4DV2Q 1E3PA 1II3A 2F0UA 5IE8A 2MP1A 2DUDA 4IZ8A 2HHHQ 1PDQA 4JBMA 4A3KH 1XJVA 4IFDJ 4CJ0B 2CQAA 3OSOA 1I4RA 4R9WA 1BXTA 4R4QA 1SJHD 1ENFA 1O7LA 4DK3C 3PSIA 3I8ZA 3KFUA 1LO5D 4UAIA 3G7LA 3I3CA 2BH2A 5JPNC 3F2CA 1PH8A 3Q22A 4X64L 2JK8A 4ID6A 4AYBG 4GN3B 4LF9L 5IP9G 1S3OA 3TEHB 4HR7B 2R7FA 1IHZA 2B3GA 4GNXB 2KCCA 5C4XB 3CRKC 1SYBA 2NVXH 4JI4Q 3NWTA 1EWHA 4BBRB 2NVTH 4FNFA 1NTGA 2M2LA 5EGTA 3PUVA 1V1PB 3KF6B 5ELEA 2E74C 4MNOA 2BOSA 1HR0L 3J81E 1JWUD 2E75C 2Y0SG 3HEJA 4AQYQ 4O42A 1DOKA 2UUAQ 2YTVA 1TVXA 5C3WA 1ET9A 3SVMA 3M3YB 4L5QA 3NELA 1XNRL 3HOZG 1HA5A 2L1BA 2Z1CA 1GUTA 1H9MA 1A3UA 1SE3A 3J80i 1MBYA 2MHVA 2ZXRA 3K81C 2VQFL 2Z0SA 4DUYL 1DJRD 3MWYW 4IUUA 2CQOA 5DNFA 2L0CA 2UU9L 1TQOA 2KEDA 3X3MA 4P71A 2NTSA 4RGOS 1TY2A 4A3MG 3VR2A 5FKAC 3BU2A 4A3FG 4JI2L 4X65L 4BBSB 1M1KC 1CSPA 2P5ZX 3VYRA 4TQUS 2CW0C 2NB0A 3M4QA 4DAYB 3F2DA 3FHWA 4X3UA 4IFDI 3S2DB 3MA2B 2FJ2A 3CQZH 3IL8A 4KHPQ 2JA5G 3TDQA 4DR4L 2EYLA 1CT1D 5IP9H 1QUQB 3DXJC 4NDXA 4DR1L 2F4VL 2Z8LA 5EQ0A 2BCOA 5C44G 1EY5A 1PXUA 4ALPA 1PV4A 4OWWB 3FP9A 4PMWA 1VS0A 5G3LD 1JJGA 3NWSA 1AN8A 4Y52H 4NMZA 1Q81C 4GZYC 4CDFC 3TN2A 2DY8A 4YHHL 2HIVA 2EDGA 1PH9A 3KJPA 3RNUA 4RCNA 4LUOA 1ZKOA 1YHAA 5ELCA 3KBXA 4PNYA 4I65A 4R8IA 2B8GA 3E6ZX 2D62A 3HOZH 2BA0A 4DK1A 1SE8A 2WKDA 3D0FA 3L7ZC 3H09A 1SJED 1ENAA 2F0QA 4KD3A 3S16B 4JBJA 2KHIA 2G9DA 4POFA 1L0XB 3RUZA 4XIGS 5EPLA 2WV6D 1U9RA 4LF8Q 2HUGA 5FLXE 1I6HH 1U4RA 4A3MH 5C0XJ 4ZK9B 4G7HC 1CHQD 4A3FH 3OOCA 5HGTA 2KHSA 4LF6Q 1I94L 1GHJA 1BDOA 2XIWA 2FINB 1SNDA 4R8NA 1WCMB 4UP7A 1QVCA 3SHLA 2JA5H 4RHRA 1TIID 1BCPF 5J22A 1XMOQ 3BS1A 3BVGA 4RKLA 2KHJA 5C44H 2K5DA 1PH4A 2IY5B 4C3JG 3R3OA 1KNEA 3BVZA 3TSSA 1LTTD 4O1NA 4IFDG 3I72A 5C4XG 3HOVB 1HZCA 4KKTA 4PZ6A 4BXXG 1G51A 2NWGA 4YY3L 3EVQA 4JBWA 3RN2A 1DD2A 4LF9Q 2I0QA 1QZGA 3K59A 4A3GG 1I4QA 1YNNC 4HSPA 3HOUG 4GOPB 4NB3A 2CVRA 5NUCA 1EU3A 1F9PA 2GVAA 4DNIA 4L5SA 3H6MA 1HR0Q 1ILQA 3PMFA 5HGQA 1UE1A 2B2WC 2WKCA 3KLRA 2EXZA 1XNRQ 1OXUA 2KQ3A 2RQXA 1FR3A 2PMZE 1NJIC 1NMGA 1HFGA 4HCSA 4J15A 3RLOA 3GTJH 2K50A 2VQFQ 1R9TB 2I5LX 1J5EL 2R92B 4DUYQ 1Z47A 1KTKA 3NTIA 1KAAA 2E2HB 4HIOA 1EY9A 1CKNB 4FF3A 2Q8TA 4JI2Q 3G6JB 4G57A 1VQ7A 3OMGA 1EOTA 5C0XI 4X65Q 1HNZQ 1ICWA 4BY1G 2ES2A 4C3JH 1F9RA 2YTXA 3TP7A 1WFQA 3G4SA 4IFDH 4HCEA 1PTOD 5C4XH 5J39A 4DR4Q 4BXXH 1NCVA 1TWAB 4DUZL 1UAPA 2Z6KC 2F4VQ 5DM73 3SDZA 3HOWG 1JJ2A 3AMUA 4DV0L 1JQYD 4IURA 5LMNL 4A3GH 3HOUH 5LL6S 4KN7C 1TWGH 1SYDA 3PUYA 5FK9C 4OELB 3S1QH 4YHHQ 3A8KE 4BY7G 3H3VC 1HPCA 3GTPB 5A2QL 3WOEA 3IAYA 1C9OA 2N3SA 1JOQA 1VMPA 3QOJA 1P16A 3UE0A 3B6YA 1TS5A 1HQRD 1I50H 3HZXA 1Q3LA 1JT8A 4FDBA 2QCPX 3BJUA 2VL6A 1EY7A 4LK1C 3MXNB 5A35A 2QA4A 5L37A 4EQPA 4DR3L 2EJGC 2N88A 1WCMG 3CF5A 4OX9L 1NBWA 1HCZA 1VQBA 2YV5A 1I94Q 1QWYA 2WB1E 4BY1H 1IKLA 1KXLA 2A5HA 1WTRA 3K5OA 4JBKA 4DN4M 1BR9A 1U4MA 3VR3A 5ELNA 1HHVA 2NN6I 4A3JB 3UI2A 4WRDA 3HOWH 2UXBL 2CHBD 3I4NB 3KDFA 1GVPA 1EY0A 1SNMA 1JICA 5BR8L 3TS2A 3ULPA 2UUCL 4BY7H 1SBBB 4YY3Q 1B7YB 3PUXA 4X3TA 1A0IA 1VCIA 5I4DA 1H95A 5IYDG 3P1HA 2C35B 4JC0A 2J4XA 3FKIB 1WI5A 1CUKA 1NUCA 1V1OA 2EVBA 1GJXA 5EBDA 3CPFA 3GTQB 3SR1A 4F7XA 4PMBA 2R92G 4RGMA 1WCMH 3ERSX 2K03A 4C56C 2K5HA 3NEMA 1K8OA 1XPOA 4NXML 2X69A 2UXCL 4TRDA 1PRTC 3MAQA 5IGBA 3T1HL 1NR2A 3CD6A 1UUPA 2C5CA 1HZAA 2L55A 1YNXA 2YU9H 5C0XH 4OGQC 2JN4A 5T1IA 3STBD 1BCPB 4DXFA 1H9JA 2DJFC 3HKSA 1RJTA 1WTQA 1F2LA 2WFWA 2NYZD 4JK1C 1Y1WG 3SXHA 4DV5L 1ASZA 4RGTA 5FO9B 3FPPA 3NHHA 1YJNA 3RZOH 1PYWD 2NN6G 5M3FB 4DUZQ 1SYFA 3EIVA 3CRLC 1D8LA 2XRSD 1JJCB 1STBA 5IYDH 1YJ9A 4DV0Q 5LMNQ 1EIYB 1S5DD 3G48A 3DUZA 3I4OA 1Q8IA 3GTLH 2VQEL 5T1GA 3RN5A 4JI6Q 1A2TA 1FYCA 2A8VA 2EYHA 3D6WA 1JB7A 1W6KA 2R92H 3TZDA 2N49A 1VQLA 1EIFA 1C4QA 1XNQQ 4A75A 5ELBA 4K6LA 2O5IC 1JMCA 1N8RC 1CA5A 1U4PA 4IQZA 4R4OA 2R3ZA 2MGSA 4ZRZA 5DM63 3LGJA 2B2VC 5KYLA 1F2YA 4DF7A 1SNCA 1RF2D 2QILA 2OQKA 3ERQA 4OX9Q 4KY5A 3HS0C 4DR7L 2LY7A 3VA5A 3D3RA 2B2WA 1Y1WH 2E8GA 5C4HA 3U4ZA 1CQVA 1MIUA 4IUPA 2NN6H 4DNTB 3KLSX 2EJFC 1O78A 4WJ3M 3DEOA 1EQRA 4CKCA 1MI2A 1NNXA 1QNUA 5CC4A 1E2VA 4XQJA 3GTPH 2UXBQ 1B1ZA 1TS3A 4K5VA 3LX0A 5BR8Q 4EX5A 1QB5D 5KIXA 4HIDA 1T5XD 3NXWA 3PO2B 5JJLA 2NVXB 1SE2A 2NVTB 3PIPA 3CCJA 4HJ7A 3J80E 5IT9E 3BZKA 4PQXA 4WJWA 4XT1B 3CC2A 4DFAA 2Z6KA 1PMRA 4A76A 1L1OC 1IZ6A 4UY8C 1FVIA 3S17H 1VQFA 3M4PA 1PH1A 3QIAA 3P20A 1A62A 4B3SL 1TWFH 3A55A 1A3VA 2OTJA 4PV1C 1PTOB 2PCFB 4LFCQ 1HNWQ 5D65A 4KN4C 4NXMQ 4FO2A 2GVBA 5GAEC 2UXCQ 3LWUA 1UE6A 4X62Q 3GTMB 1LACA 2ICIA 2XVSA 3MEHA 2O2LD 1AEXA 1FL0A 2EYPA 3RLFA 1EEFD 3CQZB 1T9HA 3HKZB 4AYBB 1EY4A 3I4MG 1WD0A 2JEAI 2PW5A 3S2HB 4JPBW 3PCOB 4N9TA 1HA6A 4CDEC 2HDMA 3CCMA 2VNUD 1EOVA 3EJIA 1LUZA 3L9AX 1WYDA 1KIXA 5M3MB 2J7ZA 2Y0SB 5EKKA 4GLAC 1WTPA 2VQEQ 5I2XA 1ZXTA 4FP5D 3HOZB 2EY2A 3PIP3 2D5DA 5JVG3 1MKHA 4K8IA 4A3EB 3UDXA 1PLFA 3E9IA 2RHQB 4JI8Q 2OEOA 1N34L 2F0FA 2PZUA 3OPOA 4YCWA 3IFTA 4JG2A 1I6HB 4DAVA 1G291 3TP6A 1HH2P 1DCZA 2B2TC 4A3MB 1M8AA 4A3FB 2EYOA 3ND9A 2HDLA 1VQGA 1WVLA 3DEPA 1LYLA 3CU7A 3QB3A 1L2FA 2IT1A 1TXYA 1H9SA 1ENCA 1RTNA 5IOCA 2X6LA 4GKJL 3I4MH 4HAEA 1LTLA 2MUYA 4ZYSA 2WAQB 5C44B 5CV4A 1IYVA 3H91A 1VF5C 2HD3A 4JVZA 1TWHH 3TQYA 3I56A 1YVCA 3E9HA 4OEMB 4QF4A 3PO2G 3I55A 2XTIA 2F0GA 1X65A 1VQDA 4ZQ3A 2H4OA 3CKIB 1EFWA 2Q2IA 4NP5A 3PQIA 4LFBL 2V1CC 1Y14B 2YTYA 4ZCKA 3Q8DA 5E1FA 1GUGA 1BBWA 4TKOB 4JI5Q 4DK6C 1ET6A 3E3XA 2VS1A 4O2DA 1I4XA 1WTWA 3CMEA 2NVYB 4ZKCB 1E2ZA 4RCOA 3J7YW 2UUBL 2K33A 3ER0A 4B3SQ 5KEEA 3GTJB 3H15A 5K5PA 2JA8G 2KOLA 1CTMA 2M00A 3QR8A 1IBLQ 3D4DA 2JSOA 1Y1VG 2FHTA 5E4WC 2NVQH 1GKHA 1PFMA 4K14A 3HKZG 5COYA 2VW9A 3GO5A 4C3JB 1QVFA 3RLNA 4I7ZC 1GUNA 2MNAA 1SFOB 3PO2H 2DY7A 4WFN3 1FD7D 3H0GG 4CBVA 1RTOA 2GN5A 1EY8A 1I4PA 2B2VA 4CKEA 1ZYRC 4DU9A 1TS2A 2MO1A 1Z9FA 5JEAG 5M3MG 2ENBA 3O13A 4A3GB 4OO1I 4UP8A 4G7ZC 3HOUB 1I3QH 3R2IA 4GLXA 2AHOB 3A7AB 1D1KA 1TWGB 4B3RL 5LHY1 4KY7A 3S1QB 1SSOA 2A6EC 3BZCA 1D5ZC 2CH4W 1Z6HA 5EBCA 4A3EG 1E2WA 5EJWA 1N36L 3A74A 5EPJA 1PTOH 2EPBA 4C1NK 3A56A 2AQ3B 1I50B 5JJKA 2K5NA 3NBIA 4V190 2Z4HA 4K5WA 5J1ZA 3ULLA 1B44D 1BVSA 2JA8H 1N34Q 3CAMA 3GTMH 3S1RB 1Y1VH 1VQ5A 3S14H 2D2CC 4IPCA 1WJJA 4ZUJA 2F4IA 1OXVA 4OL7A 4BY1B 1LTBD 1DZ1A 2WAQG 1L1OA 3CCEA 3PUWA 3DWAA 3NSWA 3S2HH 3H0GH 3GQBA 3QOLA 2IWHA 4GKJQ 3PO3B 2MFIA 5CMDA 5H1SE 5FLMG 1LT5D 4RWSC 1HNXL 5JJIA 3HOWB 1HJPA 4OXPA 5JEAH 5M3MH 1LT6D 1TWCB 1XX8A 4DGZA 3Q6SA 5D14A 2CW0D 3R93A 1B70B 1YBYA 4BY7B 1I4HA 2B2YC 4IPHA 1GUWA 1A63A 1JWSD 4A3EH 3CCQA 4EVOA 4LFBQ 4OO1G 5FJ8G 1SYEA 1E0BA 3NBHA 3ITPA 1SNPA 2F3IA 4X3KA 1AFPA 2VUMG 4C3HB 3BDOA 4IJHA 3UE1A 4X6AH 1MSHA 1VQNA 3J81j 1NAPA 5KNCA 1IYJB 5IY0A 4Q5VA 5G3LF 2KECA 4DKAC 1EWIA 3TS0A 4MTNA 2ICEC 1A6XA 3G6EA 1NSNS 2EYFA 3PGZA 2QGQA 3R2TA 1A15A 5AFWA 1BBUA 1KL9A 4X64Q 2YU9B 4RMFA 2E2JH 1MJCA 2ZM6L 4A3LG 3EFXD 3VYUA 4LMQD 1SLJA 2EIFA 3U4VA 5A2QE 4HJ9A 1AE3A 3JAMc 2B2TA 3TRZA 3EBEA 4A3DB 2B39A 4E6IA 3RZOB 2JYOA 4OIKA 3DMUA 2K32A 4B3TL 1RIPA 1VQJA 2MO0A 4QIWE 4IPGA 4FVMA 2L4NA 4OO1H 5FJ8H 4P75A 2I5HA 4B3ML 1SAPA 1E1OA 3IFDA 3GTLB 2IX1A 1I6VC 5KNDA 2NVYH 1CI3M 5M5WH 4RGNA 1EZ8A 3AU7A 2VUMH 4JI7L 3FMCA 1SROA 2RSOA 5BN3A 2NTTA 2A6HC 1Y69U 2BE5C 1N36Q 3MTSA 1YNND 2UU9Q 1HXYD 3F2UA 5EKLA 5CV7A 2F1MA 2HT1A 1HTLD 2ZXPA 2AWOA 3F8TA 4XQQA 1VQEA 3M9BA 2PI2E 2TMPA 3NENA 3N6RA 1SFOH 1J6QA 1FNVA 4A3LH 5BN5A 5FO8B 3PO3G 3MZ5A 4DR1Q 3MFGA 3DM1A 3KF8A 1IXRA 2J0TD 2XRQD 4QB4A 1AP0A 1Y1WB 1B9MA 1YNJC 2A6HD 2BE5D 2F3WA 2DGYA 2OQ0A 3G71A 2R61A 1KDAA 3KLSA 1EFID 5JJZA 5M9OA 2F0OA 1PZKD 3D4WA 1TU2B 3QWNA 4MTKA 3HOYG 1HNXQ 4UPAA 1JORA 1M90C 1X6OA 3K7AH 3GDEA 3J81c 2JE6I 5I9PA 4LAAA 2HCCA 2PYKA 3A54A 1H9RA 3SK6A 3P75A 3K6OA 4KKSA 1EYGA 5IYCG 1UWVA 1XPRA 4K2LA 1L0YB 1O7YA 4A3CG 1VQ9A 1HRJA 4L8JA 1EU4A 3HRZC 2Q8IB 4C3HG 3HGBA 3S1RH 3S1NB 2ZTDA 1T5EA 4KTAA 1I5FA 3QO2A 4CHTB 1VQKA 2K14A 4LF5L 1PTOF 5GROA 2F0TA 1BOSA 2EY6A 3S17B 2K5VA 1PH2A 1RKNA 4XDXA 5C5MA 1XMQL 5JAVA 5IGDA 2Z4IA 1TWFB 4KK7A 1CHPD 1YIJA 2KJXA 2LXKA 2QEXA 4JI0L 3PUZA 1BNZA 1FNWA 3PO3H 2A74C 3NQIA 3CXCA 1LTRD 3C3LA 2D0OA 1K9MC 1HZBA 1TWCH 4IUTA 2PW7A 1K28A 3DM3A 2RF4A 4EQ5A 1EQVA 3VR5A 3HOYH 1SNOA 2PNHA 5C6AA 4A3DG 2ZM6Q 5CYUA 1MSGA 2ZT9C 5ELFA 2F52A 3S15H 3AFQA 1VQMA 2JXMB 1JR0D 5JVH3 2M9VA 4Z9CB 4M1UB 5IYCH 4DAMA 2HIXA 4MIUA 2RHSB 1LTSD 4A3CH 1GUSA 4CDCC 1X55A 4C3HH 1STAA 5EPKA 4B3MQ 5IODA 2IHEA 4YIJA 1SMXA 5FLXc 3CCVA 4XTCS 2IL8A 1DONA 3D31A 1CZWA 1VMCA 4JI7Q 3H94A 5E4XA 3MXUA 3K57A 1J5EQ 1LT4D 2K05A 2XWJB 3TZUA 4DAPA 1WTOA 1KD1C 1KRTA 1PHJA 2B2YA 2N55A 1GXDC 1STNA 2B63G 2H1EA 3KDFB 3AQQA 3BZDB 3T56B 4HIKA 3BG3A 3EROA 3VR4A 1N9WA 1UE5A 3M4OH 1LLRD 2OXPA 4A3IG 5CGKA 5HURA 3AFPA 5GADC 4A3DH 1BQQT 1JB3A 1SYGA 1SXTA 2IW3A 3I4MB 4GNXC 4KJOA 3KOJA 1B8AA 4ILWA 1B3QA 1N33L 1K83H 1DOMA 1KHIA 2Q2UA 1PRTD 3JC66 1TWHB 1GM5A 1XPUA 4BWGB 4LUVA 4P73A 1F9SA 4NKLA 4A93G 4N9PA 3I2ZA 4AIMA 1JCKB 1JOKA 2H5XA 5IP7G 2FFKB 2RA4A 2CCZA 1S5ED 4YWMA 2WP8J 1FGBD 1DOLA 1ZEQX 1DYQA 3NTHA 5M5YB 4UP9A 3T53B 2IJ0A 1YHBA 2EE1A 4DR3Q 1QVGA 1Q8KA 1EL0A 1X3EA 4LF5Q 1PYSB 2B63H 1S5CD 1CK1A 2RSNA 4Y7NH 5IGFA 5C5LA 4KJNA 3VR6A 4A3IH 2NUCA 1JE5A 3Q24A 2ID0A 4JI0Q 3CHBD 4GN4B 4WJ4A 1K73C 2NVQB 2K28A 2LS01 4RG1A 3EQLC 3Q23A 1C7YA 1VQAA 2VB3X 1GOZA 1U5KA 1NY4A 3I70A 2D9UA 3TBIB 1WTVA 1DGSA 2UUCQ 2B2UC 4KHVA 2E5LL 4A93H 5IGCA 1OTCA 2CKZB 5IP7H 1VQ8A 2DNCA 2A19A 3ULJA 2JA7G 2I46A 3S1NH 4HN7A 1W6JA 3OHXC 1I3QB 3KBGA 4IUNA 3ND8A 4AYBE 4EQNA 1PH3A 4DV1L 4CGYB 1MD2D 3U9SA 1VQ6A 3GV6A 4QGUA 2WB1G 4XYQA 1K8AC 2E76C 2PQEA 3NK9A 4H7BA 4QCLA 4DV2L 2L15A 2EZVA 2X6GA 2AQ1B 2Y0SE 3KK7A 3LWEA 3Q0AA 3J7A5 2SNMA 5KGUA 1WTXA 4OHJA 1K8MA 4F87A 3PF5A 4MN3A 1AE2A 2XWBB 3WWVA 3OWEB 5JEAJ 1VQPA 2JA8B 2NZ1D 3CMAA 2E2IB 1Y1VB 3T1HQ 2BDNA 3S14B 4LW1A 1PFSA 3A0JA 2GA4B 2QKIC 4UDUC 4K8JA 1I4GA 2F0PA 5I9OA 5DEHA 3HOXG 1YHQA 4JCVE 3SE0A 2KBNA 4DV5Q 1XTDA 1EY6A 3H0GB 5C4JB 3A8IE 1VQIA 4P74A 1N33Q 4G7OC 2R93G 3GTGH 4GOPC 2JA7H 4FXDA 1CA6A 1PH5A 1V43A 3GD7A 1D5MC 3U50C 1TS4A 3E0EA 3CCSA 1QJOA 4QMGA 3BVMA 4KV6A 1CSQA 3L2PA 3F2BA 1R4QB 4DR5L 4AQYL 2E2DC 2LKVA 5D3DA 4JI3L 1QOHA 2PQAA 4IO9A 1FJGL 4K0KL 2A73B 4DR6L 4BA1I 3W1BA 3K5LA 4R1JA 2QW7A 4U68A 2IPKD 2DJGC 4MZ9A 3S9WA 3S24A 1EIGA 1UNSA 2LFNA 4KD4A 4M8AA 3J7ZC 3GTOH 2IHFA 2ZTCA 1UEAB 2JA6G 1K0SA 3RZDH 4DR7Q 1YZ6A 1ESFA 2RVLA 3HOXH 4H02A 4TVAB 3ZJYC 4ZLTF 3MXPA 4L5RC 1Q90A 1G2TA 1STGA 1FNUA 2RDFA 2AUKA 5DLQE 2BH8A 3M7NA 3K5MA 1B53A 4JYAL 2R93H 2E2JB 4C2MH 1YEZA 1ILPA 3H3VI 1IW7C 1W2BA 1HZ9A 4I7AA 2AQ2B 2QDBA 3OW7A 2WINB 2E5LQ 2B8FA 1Q82C 5C3EG 2G5DA 5M5YH 3KJOA 4KHZA 2R6GA 2RDGA 3T1YL 1EIHA 4R4TA 1VF7A 3W2DA 1O80A 2EQSA 1PA6A 2PZWA 3MFYA 4RHSA 4ZUIA 1VQCA 3HP3A 4GNXA 1E1TA 5M5WB 3CCRA 2L9HA 2KENA 3PF4A 4L63B 1HTPA 5I2YA 2G9HD 4DV3L 4FF1A 2VUMB 3MXGA 4KKUA 1E22A 1IW7D 2O4XA 3T16A 1V1PA 1H9SB 3KF6A 3OTOL 1O7IA 1K3RA 1IKMA 5CORA 2JA6H 4GKKL 2RCNA 5CV8A 3W3AA 1S72A 1X32A 4LF6L 5LMUL 2EJMA 1EWCA 3M7GA 3T51B 3ZYYX 2BA1A 2LSSA 1LTID 5ISRA 4K5XA 1KDBA 3V96A 1PRTB 5JPMC 2K4KA 1XMOL 1C8CA 3T13A 3A8JE 1SDFA 1STYA 4IJLA 1QE6A 3I4LA 3DWPA 2K75A 3VYTA 1LTGD 2V4DA 4IN3A 2UXDL 3GP7A 3PIO3 1WOCA 2YYZA 4OWXB 1MJEA 5C3EH 4DAYA 2F0NA 1JWMD 3J80c 1A8VA 5IT9c 2EY1A 4ME5A 3SK4A 1IYUA 3K7AB 2QDLA 1QUQA 3VA7A 3GTKB 4JV5L 1OXXK 2JJQA 1GHKA 4DR5Q 3D6CA 2MPMA 3JAML 4BA2I 3CC4A 1ZYRD 4JI3Q 2ZJPA 1FJGQ 2B2UA 2E2IH 4K0KQ 3CCLA 2VB2X 4DR6Q 4UHVA 1PZJD 2OF1A 3EA6A 4H13C 3SEBA 3UDGA 3CPWA 2AWNA 2A6ED 1C48A 1X3PA 2A1AA 4HMJA 2ATWA 4G4KA 4HSVA 3I73A 3K8AA 2XSCA 3PV0A 1BCPC 1X9NA 4LUZA 5C4JH 4X66L 4C3IB 1WD1A 1HNZL 1CFMA 1BKBA 4XQNA 5AJ3L 3FDTA 1R4PB 3I7FA 4QUCA 4DV7L 3QJYA 2CFMA 1GO3E 3OMCA 1Y8OB 3VDYA 2XGTA 3K5NA 4APVA 4JYAQ 3HOYB 5I6YA 3WOFA 2SDFA 2TSSA 2KCTA 1BF4A 1RD9D 3H3VH
chains in the Genus database with same CATH topology
1S40A 2NZHA 2K52A 3S1RH 2OWOA 2D0PA 2ZTDA 3TREA 5M3FH 1I5FA 4R4IA 1VQKA 2K14A 2OQKA 4LF5L 4OX9Q 5GROA 4DR7L 3T1YQ 2K5VA 1W3SA 1Y1WH 1PH2A 2E8GA 3L0OA 1XMQL 2PQAB 3U4ZA 1SR3A 1PYBA 1MIUA 1YIJA 2LXKA 1KRSA 2QEXA 4JI0L 1KQSA 4LF4Q 3PUZA 5M5XH 1OXSC 4HJ5A 1EUJA 3K0XA 1EQRA 4WJ3M 1PVOA 3PO3H 4DV1Q 2UXBQ 4GOPA 3GTPH 3F1ZA 1L1OB 4DV3Q 1IBKL 3A5ZB 3CXCA 2UUBQ 3RR5A 4A4IA 3K7UC 2D0OA 5BR8Q 4L5TA 3OTOQ 2JA9A 1HZBA 1TWCH 5EAYA 4EX5A 1K9MC 4HIDA 1P8LA 3DM3A 2RF4A 4EQ5A 1EQQA 4GKKQ 4IOAA 4OWTB 5JJLA 4LF8L 3HOYH 2R7DA 3M85A 2PNHA 4O0AA 4DV2Q 4A3DG 2ZM6Q 2VY3A 3PIPA 1Q46A 3CCJA 1E3PA 5FLMH 5LMUQ 5IE8A 4HJ7A 2FXQA 2DUDA 3S15H 2F52A 1IL2A 3BZKA 2HHHQ 4JBMA 3AFQA 4A3KH 1VQMA 1XJVA 3CC2A 2ZTEA 4IFDJ 4PZ7A 2Z6KA 3MEFA 4A76A 1AH9A 5IYBG 5IYCH 1L1OC 4DAMA 4HJ8A 1IZ6A 4DPGA 1VQHA 2HIXA 4UY8C 1FVIA 4R4QA 1PH7A 1KAWA 2RHSB 4A3CH 1CKNA 1VQFA 3S17H 4DK3C 3M4PA 3PSIA 1PH1A 1X55A 4C3HH 3KFUA 1A62A 3NBHB 1TWFH 4B3SL 4B3MQ 2UXDQ 2BH2A 2HQLA 2IHEA 2OTJA 1SMXA 5FLXc 3CCVA 4LWCA 4XTCS 3F2CA 4BBRG 1PH8A 4X64L 4B3RQ 3D31A 4LFCQ 4IPDA 4YCVA 1HNWQ 4JI7Q 5GAHC 4NXMQ 2JK8A 4LNQA 4AYBG 4GN3B 4LF9L 5IP9G 2GVBA 5GAEC 1S3OA 1E7ZA 3TEHB 1J5EQ 2R7FA 2UXCQ 3JAMi 1UE6A 4X62Q 2B3GA 4GNXB 4JV5Q 1KD1C 1KRTA 1PHJA 1V9PA 2NVXH 4JI4Q 1FL0A 3RLFA 2NVTH 1NTGA 1Q1EA 4DV6L 1T9HA 3A5UA 2B63G 3KDFB 2AKWB 3AQQA 4HIKA 1GD7A 3PUVA 1N9WA 4KLKA 3KF6B 3I4MG 1UE5A 4MNOA 4QQBX 1HR0L 3M4OH 1HR0W 2Y0SG 4AQYQ 1N32L 4YWLA 2JEAI 4A3IG 2UUAQ 2YTVA 3ICEA 3AFPA 4L5QA 5GADC 3NELA 1XNRL 3PCOB 3HOZG 4A3DH 1CKOA 1PH6A 3J80i 3CCMA 2VNUD 1EOVA 2IX0A 1LUZA 4GNXC 2PI2A 3K81C 1WYDA 3KOJA 1B8AA 1KIXA 3CP0A 1N33L 1K83H 2MQHA 2VQFL 4BBSG 2Z0SA 1X56A 1X54A 1KHIA 4GLAC 4DUYL 2Q2UA 5IYBH 2CQOA 4QY7A 2JQOA 2VQEQ 1IBML 2UU9L 3JC66 1GM5A 1XPUA 3AYHB 4X66Q 4P71A 4LUVA 4A3MG 2CWPA 4P73A 4A3FG 3BU2A 5AJ3Q 4JI2L 1MKHA 3UDXA 4X65L 4DV7Q 4A93G 1M1KC 1CSPA 3I2ZA 4AIMA 3E9IA 2RHQB 4JI8Q 2H5XA 5IP7G 1N34L 4TQUS 4DAYB 4YCWA 3M4QA 2CCZA 3F2DA 3FHWA 4BBRH 3GTKH 4YWMA 4IFDI 4KHPQ 3CQZH 2WP8J 4DV4L 4JG2A 2JA5G 4DR4L 1G291 1HH2P 5IP9H 1QUQB 1VQGA 4UP9A 4DR1L 2F4VL 1SRUA 5C44G 4ALPA 1PV4A 4OWWB 3FP9A 1YHBA 4PMWA 4DR3Q 1QVGA 1Q8KA 1VS0A 3M3YH 1JJGA 1LYLA 4KI0A 1X3EA 3KYHC 1YI2A 4LF5Q 1L2FA 1PYSB 2IT1A 1TXYA 2B63H 1Q81C 4Y52H 4POGA 4Y7NH 4YHHL 4GKJL 4JI6L 3I4MH 2HIVA 1LTLA 3J81i 4NXNL 1PH9A 3KJPA 3RNUA 4A3IH 4LUOA 1JE5A 1YHAA 2ID0A 4JI0Q 1XNQL 2D62A 3HOZH 1TWHH 2BA0A 5J3BA 3TQYA 1SE8A 1YVCA 3I56A 3E9HA 3D0FA 5GQOA 3L7ZC 4GN4B 3KF8B 3PO2G 4WJ4A 3I55A 2XTIA 1K73C 4C3IH 1IBKQ 2Q2TA 1X65A 1VQDA 4JBJA 4RG1A 2KHIA 4BBSH 4POFA 1LM0A 4XIGS 1C7YA 1VQAA 1EFWA 4YWKA 2Q2IA 4JI1L 3S2DH 1E24A 1NY4A 1U5KA 1V1QA 2V1CC 4LF8Q 1Y14B 2YTYA 3IRBA 4LFBL 1DGSA 1I6HH 2UUCQ 4A3MH 3Q8DA 5C0XJ 4A3FH 2E5LL 1BBWA 4LF6Q 4A93H 1I94L 5ELOA 1X3GA 1G6PA 1OTCA 1UE7A 2CKZB 5IP7H 1VQ8A 4JI5Q 4DK6C 2A19A 3ULJA 2JA7G 2VS1A 4O2DA 3S1NH 4UP7A 5E7NA 1QVCA 1Q1BA 2JA5H 3HOVG 3CMEA 4AYBE 5C0XG 1YITA 4A3BG 1PH3A 4DV1L 1XMOQ 4JOIC 2N78A 2JEBI 5C44H 2KHJA 2UUBL 1VQ6A 3ER0A 1PH4A 4B3TQ 4B3SQ 4QGUA 2IY5B 1D7QA 2WB1G 3H15A 1K8AC 2JA8G 1IBLQ 4IFDG 1Y1VG 5C4XG 1HZCA 4QJFA 4DV2L 2L15A 4PZ6A 1G51A 4YY3L 2NVQH 4JBWA 3RN2A 3S16H 4BXXG 2Y0SE 4LF9Q 1GKHA 3J7A5 3HKZG 2VW9A 1QZGA 3GO5A 2I0QA 3PF5A 1AE2A 3WWVA 1VQPA 3OYYA 5JEAJ 1QVFA 3AEVA 3RLNA 3CMAA 4A3GG 2MNAA 3T1HQ 3HOUG 4LFAL 1SN8A 4GOPB 3PO2H 4NB3A 4LW1A 4DV6Q 3H0GG 3STBC 1PFSA 3A0JA 1VQ4A 2GN5A 2GVAA 4DNIA 4L5SA 1HR0Q 3HOXG 1N32Q 5HGQA 1YHQA 4JCVE 2MO1A 1Z9FA 5JEAG 5M3MG 1UE1A 2KBNA 4DV5Q 4OO1I 1XTDA 4UP8A 1Q86C 1I3QH 4GLXA 4LF7L 1XNRQ 2AHOB 1OXUA 3KLWA 4B3RL 2PMZE 4LFCL 2KCMA 1NJIC 4GLVB 4PZ8A 1HNWL 1NMGA 1VQIA 3BZCA 4P74A 1N33Q 2OTLA 4J15A 3RLOA 3GTJH 2K50A 2VQFQ 1J5EL 2I5LX 3GTGH 2R93G 4X62L 4DUYQ 4GOPC 1Z47A 4A3EG 2JA7H 1PH5A 1V43A 1IBMQ 3HOVH 1N36L 3GD7A 3A74A 3U50C 2ZJRA 4HIOA 1CKNB 4A3BH 3E0EA 3CCSA 4DR2L 4JI2Q 1VQ7A 2K5NA 4R4CA 5C0XI 1CSQA 5JJKA 4X65Q 2EXDA 3L2PA 3F2BA 3ULLA 4DR5L 1HNZQ 4BY1G 2ES2A 4C3JH 1BVSA 4GS3A 4AQYL 2JA8H 1N34Q 2YTXA 1WFQA 3CAMA 3G4SA 3GTMH 1Y1VH 5C4XH 1VQ5A 3S14H 4JI3L 2VZAA 2PQAA 4IO9A 1FJGL 4DV4Q 4DR4Q 3CW2C 4BXXH 4K0KL 3K80C 1U0LA 4BA1I 4DR6L 3W1BA 4DUZL 4IPCA 1WJJA 1UEBA 2Z6KC 1NE3A 4R1JA 2F4VQ 2Q2HA 1OXVA 3HOWG 4MZ9A 3S24A 3EN2A 1JJ2A 4DV0L 2WAQG 5LMNL 1L1OA 4A3GH 5LMNW 3CCEA 3HOUH 3PUWA 1YJWA 3J7ZC 1TWGH 2IHFA 3H0GH 3PUYA 2ZTCA 3GTOH 3S2HH 4HJAA 3S1QH 4AH6A 4YHHQ 2JA6G 4BY7G 4GKJQ 2MFIA 2N8NA 5H1SE 3RZDH 3W5OA 4DR7Q 4NXNQ 5FLMG 1YZ6A 3HOXH 1R9TH 1HNXL 1C0AA 4H02A 1HJPA 5JJIA 4OXPA 1C9OA 4TVAB 3ZJYC 2N3SA 5M3MH 2ZJQA 2R7ZG 1XMQQ 3CCUA 4L5RC 4JI8L 2E2HH 1Q12A 1P16A 3UE0A 3B6YA 1KC8C 1B70B 1YBYA 5DLQE 1I50H 3W1GA 1JT8A 2BH8A 4YCUA 3DLLA 3M7NA 4JYAL 4IPHA 4FDBA 3BJUA 2R93H 2VL6A 1A63A 4C2MH 5IWAL 1YEZA 3CCQA 4A3EH 3MXNB 4JI1Q 2QA4A 3U58A 3H3VI 4DR3L 4LFBQ 4OO1G 3SGIA 5FJ8G 1HZ9A 1W2BA 1QZHA 1CKMA 1RL2A 1TWAH 1WCMG 3CF5A 2NZOA 1K0RA 4A3JG 2E5LQ 2F3IA 1Q82C 5C3EG 1NBWA 1VQBA 5M5YH 2YV5A 3KJOA 2WB1E 1I94Q 4BY1H 4OX9L 4KHZA 2R6GA 1KXLA 5HY6A 2VUMG 3T1YL 4JBKA 3I4NG 4IJHA 3UE1A 4R4TA 1ASYA 4X6AH 1VQNA 3J81j 2AMCB 2EQSA 1K8GA 5ELNA 1PA6A 2NN6I 1VQCA 4GNXA 4LF4L 1IYJB 5IY0A 1E1TA 4NPSA 3HKZE 4QL5A 3HOWH 3CCRA 2UXBL 4DKAC 2KENA 1EWIA 2B29A 3TS0A 3PF4A 4MTNA 4DV3L 3KDFA 1GVPA 3G6EA 3PGZA 2QGQA 1E22A 5BR8L 3UDIA 3KF6A 3OTOL 1O7IA 1K3RA 3TS2A 3ULPA 2UUCL 2JA6H 4BY7H 2RCNA 4GKKL 1BBUA 3FKIG 4YY3Q 1KL9A 1B7YB 4X64Q 3PUXA 1S72A 4RMFA 3HFZB 1MJCA 2E2JH 4LF6L 2ZM6L 4A3LG 1A0IA 1VCIA 5LMUL 4P72A 2R7ZH 3UDFA 4PG3A 3U4VA 1SLJA 2EIFA 1H95A 4GN5A 4JI5L 5IYDG 2C35B 4HJ9A 2HHHL 2BA1A 1AE3A 3JAMc 4JC0A 4LFAQ 2LSSA 3TRZA 3EBEA 2K4KA 1XMOL 1WI5A 1CUKA 4OONA 4B3TL 1NMFA 1RIPA 3CPFA 1VQJA 2MO0A 4IJLA 4QIWE 4IPGA 5FJ8H 2K75A 5GAGC 3CC7A 1IBLL 2R92G 4P75A 2I5HA 4HIMA 4B3ML 4LF7Q 2UXDL 1WCMH 1WOCA 3ERSX 4A3JH 1E1OA 2YYZA 4OWXB 2K5HA 1MJEA 5C3EH 2IX1A 3NEMA 2NVYH 5M5WH 3J80c 1A8VA 1VQOA 1XPOA 5IT9c 4JI7L 4NXML 2VUMH 3I4NH 2OCEA 1SROA 2UXCL 4IOCA 1QUQA 1N36Q 3T1HL 4JV5L 1OXXK 3CD6A 1HZAA 2UU9Q 4JI4L 5M3FG 1YNXA 4DR2Q 2YU9H 2ALYB 2CWAA 2JJQA 3STBD 4DR5Q 2WAQE 3HKSA 2HT1A 2WFWA 2AWOA 3F8TA 4BA2I 1VQEA 3M9BA 1Y1WG 3CC4A 4DV5L 1ASZA 4JI3Q 2ZJPA 1FJGQ 1YJNA 2PI2E 3NENA 2E2IH 4K0KQ 3FKIH 2UUAL 3CCLA 3RZOH 2NN6G 1SFOH 4DR6Q 4DUZQ 3UDGA 1J6QA 3EIVA 4A3LH 1D8LA 3CPWA 3PO3G 1JJCB 2AWNA 3GTQH 4DR1Q 5IYDH 1YJ9A 1IXRA 4DV0Q 5LMNQ 2A1AA 1OXTA 1EIYB 2ATWA 1X3FA 3G48A 3I4OA 3K8AA 2DGYA 2OQ0A 5K36G 3G71A 3PV0A 3GTLH 1X9NA 4JOIA 2VQEL 4LUZA 3RN5A 5C4JH 4X66L 3HOYG 1HNXQ 3S1MH 4JI6Q 1HNZL 4UPAA 2A8VA 1BKBA 1M90C 5AJ3L 1X6OA 3K7AH 3GDEA 3OW2A 3J81c 2JE6I 1JB7A 3I7FA 2R92H 4DV7L 2N49A 1Q7YC 1L0WA 4A3KG 1EIFA 2CFMA 1VQLA 1XNQQ 4A75A 1FGUA 1GO3E 2I5MX 3PIOA 2XGTA 3VDYA 4KHPL 4APVA 1EYGA 4JYAQ 5IYCG 1UWVA 2LXJA 1XPRA 4ME3A 1N8RC 1JMCA 5IWAQ 4R4OA 2KCTA 4A3CG 2ASBA 1VQ9A 3H3VH 3LGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S40 A;  2NZH A;  2K52 A;  3S1R H;  2OWO A;  2D0P A;  2ZTD A;  3TRE A;  5M3F H;  1I5F A;  4R4I A;  1VQK A;  2K14 A;  2OQK A;  4LF5 L;  4OX9 Q;  5GRO A;  4DR7 L;  3T1Y Q;  2K5V A;  1W3S A;  1Y1W H;  1PH2 A;  2E8G A;  3L0O A;  1XMQ L;  2PQA B;  3U4Z A;  1SR3 A;  1PYB A;  1MIU A;  1YIJ A;  2LXK A;  1KRS A;  2QEX A;  4JI0 L;  1KQS A;  4LF4 Q;  3PUZ A;  5M5X H;  1OXS C;  4HJ5 A;  1EUJ A;  3K0X A;  1EQR A;  4WJ3 M;  1PVO A;  3PO3 H;  4DV1 Q;  2UXB Q;  4GOP A;  3GTP H;  3F1Z A;  1L1O B;  4DV3 Q;  1IBK L;  3A5Z B;  3CXC A;  2UUB Q;  3RR5 A;  4A4I A;  3K7U C;  2D0O A;  5BR8 Q;  4L5T A;  3OTO Q;  2JA9 A;  1HZB A;  1TWC H;  5EAY A;  4EX5 A;  1K9M C;  4HID A;  1P8L A;  3DM3 A;  2RF4 A;  4EQ5 A;  1EQQ A;  4GKK Q;  4IOA A;  4OWT B;  5JJL A;  4LF8 L;  3HOY H;  2R7D A;  3M85 A;  2PNH A;  4O0A A;  4DV2 Q;  4A3D G;  2ZM6 Q;  2VY3 A;  3PIP A;  1Q46 A;  3CCJ A;  1E3P A;  5FLM H;  5LMU Q;  5IE8 A;  4HJ7 A;  2FXQ A;  2DUD A;  3S15 H;  2F52 A;  1IL2 A;  3BZK A;  2HHH Q;  4JBM A;  3AFQ A;  4A3K H;  1VQM A;  1XJV A;  3CC2 A;  2ZTE A;  4IFD J;  4PZ7 A;  2Z6K A;  3MEF A;  4A76 A;  1AH9 A;  5IYB G;  5IYC H;  1L1O C;  4DAM A;  4HJ8 A;  1IZ6 A;  4DPG A;  1VQH A;  2HIX A;  4UY8 C;  1FVI A;  4R4Q A;  1PH7 A;  1KAW A;  2RHS B;  4A3C H;  1CKN A;  1VQF A;  3S17 H;  4DK3 C;  3M4P A;  3PSI A;  1PH1 A;  1X55 A;  4C3H H;  3KFU A;  1A62 A;  3NBH B;  1TWF H;  4B3S L;  4B3M Q;  2UXD Q;  2BH2 A;  2HQL A;  2IHE A;  2OTJ A;  1SMX A;  5FLX c;  3CCV A;  4LWC A;  4XTC S;  3F2C A;  4BBR G;  1PH8 A;  4X64 L;  4B3R Q;  3D31 A;  4LFC Q;  4IPD A;  4YCV A;  1HNW Q;  4JI7 Q;  5GAH C;  4NXM Q;  2JK8 A;  4LNQ A;  4AYB G;  4GN3 B;  4LF9 L;  5IP9 G;  2GVB A;  5GAE C;  1S3O A;  1E7Z A;  3TEH B;  1J5E Q;  2R7F A;  2UXC Q;  3JAM i;  1UE6 A;  4X62 Q;  2B3G A;  4GNX B;  4JV5 Q;  1KD1 C;  1KRT A;  1PHJ A;  1V9P A;  2NVX H;  4JI4 Q;  1FL0 A;  3RLF A;  2NVT H;  1NTG A;  1Q1E A;  4DV6 L;  1T9H A;  3A5U A;  2B63 G;  3KDF B;  2AKW B;  3AQQ A;  4HIK A;  1GD7 A;  3PUV A;  1N9W A;  4KLK A;  3KF6 B;  3I4M G;  1UE5 A;  4MNO A;  4QQB X;  1HR0 L;  3M4O H;  1HR0 W;  2Y0S G;  4AQY Q;  1N32 L;  4YWL A;  2JEA I;  4A3I G;  2UUA Q;  2YTV A;  3ICE A;  3AFP A;  4L5Q A;  5GAD C;  3NEL A;  1XNR L;  3PCO B;  3HOZ G;  4A3D H;  1CKO A;  1PH6 A;  3J80 i;  3CCM A;  2VNU D;  1EOV A;  2IX0 A;  1LUZ A;  4GNX C;  2PI2 A;  3K81 C;  1WYD A;  3KOJ A;  1B8A A;  1KIX A;  3CP0 A;  1N33 L;  1K83 H;  2MQH A;  2VQF L;  4BBS G;  2Z0S A;  1X56 A;  1X54 A;  1KHI A;  4GLA C;  4DUY L;  2Q2U A;  5IYB H;  2CQO A;  4QY7 A;  2JQO A;  2VQE Q;  1IBM L;  2UU9 L;  3JC6 6;  1GM5 A;  1XPU A;  3AYH B;  4X66 Q;  4P71 A;  4LUV A;  4A3M G;  2CWP A;  4P73 A;  4A3F G;  3BU2 A;  5AJ3 Q;  4JI2 L;  1MKH A;  3UDX A;  4X65 L;  4DV7 Q;  4A93 G;  1M1K C;  1CSP A;  3I2Z A;  4AIM A;  3E9I A;  2RHQ B;  4JI8 Q;  2H5X A;  5IP7 G;  1N34 L;  4TQU S;  4DAY B;  4YCW A;  3M4Q A;  2CCZ A;  3F2D A;  3FHW A;  4BBR H;  3GTK H;  4YWM A;  4IFD I;  4KHP Q;  3CQZ H;  2WP8 J;  4DV4 L;  4JG2 A;  2JA5 G;  4DR4 L;  1G29 1;  1HH2 P;  5IP9 H;  1QUQ B;  1VQG A;  4UP9 A;  4DR1 L;  2F4V L;  1SRU A;  5C44 G;  4ALP A;  1PV4 A;  4OWW B;  3FP9 A;  1YHB A;  4PMW A;  4DR3 Q;  1QVG A;  1Q8K A;  1VS0 A;  3M3Y H;  1JJG A;  1LYL A;  4KI0 A;  1X3E A;  3KYH C;  1YI2 A;  4LF5 Q;  1L2F A;  1PYS B;  2IT1 A;  1TXY A;  2B63 H;  1Q81 C;  4Y52 H;  4POG A;  4Y7N H;  4YHH L;  4GKJ L;  4JI6 L;  3I4M H;  2HIV A;  1LTL A;  3J81 i;  4NXN L;  1PH9 A;  3KJP A;  3RNU A;  4A3I H;  4LUO A;  1JE5 A;  1YHA A;  2ID0 A;  4JI0 Q;  1XNQ L;  2D62 A;  3HOZ H;  1TWH H;  2BA0 A;  5J3B A;  3TQY A;  1SE8 A;  1YVC A;  3I56 A;  3E9H A;  3D0F A;  5GQO A;  3L7Z C;  4GN4 B;  3KF8 B;  3PO2 G;  4WJ4 A;  3I55 A;  2XTI A;  1K73 C;  4C3I H;  1IBK Q;  2Q2T A;  1X65 A;  1VQD A;  4JBJ A;  4RG1 A;  2KHI A;  4BBS H;  4POF A;  1LM0 A;  4XIG S;  1C7Y A;  1VQA A;  1EFW A;  4YWK A;  2Q2I A;  4JI1 L;  3S2D H;  1E24 A;  1NY4 A;  1U5K A;  1V1Q A;  2V1C C;  4LF8 Q;  1Y14 B;  2YTY A;  3IRB A;  4LFB L;  1DGS A;  1I6H H;  2UUC Q;  4A3M H;  3Q8D A;  5C0X J;  4A3F H;  2E5L L;  1BBW A;  4LF6 Q;  4A93 H;  1I94 L;  5ELO A;  1X3G A;  1G6P A;  1OTC A;  1UE7 A;  2CKZ B;  5IP7 H;  1VQ8 A;  4JI5 Q;  4DK6 C;  2A19 A;  3ULJ A;  2JA7 G;  2VS1 A;  4O2D A;  3S1N H;  4UP7 A;  5E7N A;  1QVC A;  1Q1B A;  2JA5 H;  3HOV G;  3CME A;  4AYB E;  5C0X G;  1YIT A;  4A3B G;  1PH3 A;  4DV1 L;  1XMO Q;  4JOI C;  2N78 A;  2JEB I;  5C44 H;  2KHJ A;  2UUB L;  1VQ6 A;  3ER0 A;  1PH4 A;  4B3T Q;  4B3S Q;  4QGU A;  2IY5 B;  1D7Q A;  2WB1 G;  3H15 A;  1K8A C;  2JA8 G;  1IBL Q;  4IFD G;  1Y1V G;  5C4X G;  1HZC A;  4QJF A;  4DV2 L;  2L15 A;  4PZ6 A;  1G51 A;  4YY3 L;  2NVQ H;  4JBW A;  3RN2 A;  3S16 H;  4BXX G;  2Y0S E;  4LF9 Q;  1GKH A;  3J7A 5;  3HKZ G;  2VW9 A;  1QZG A;  3GO5 A;  2I0Q A;  3PF5 A;  1AE2 A;  3WWV A;  1VQP A;  3OYY A;  5JEA J;  1QVF A;  3AEV A;  3RLN A;  3CMA A;  4A3G G;  2MNA A;  3T1H Q;  3HOU G;  4LFA L;  1SN8 A;  4GOP B;  3PO2 H;  4NB3 A;  4LW1 A;  4DV6 Q;  3H0G G;  3STB C;  1PFS A;  3A0J A;  1VQ4 A;  2GN5 A;  2GVA A;  4DNI A;  4L5S A;  1HR0 Q;  3HOX G;  1N32 Q;  5HGQ A;  1YHQ A;  4JCV E;  2MO1 A;  1Z9F A;  5JEA G;  5M3M G;  1UE1 A;  2KBN A;  4DV5 Q;  4OO1 I;  1XTD A;  4UP8 A;  1Q86 C;  1I3Q H;  4GLX A;  4LF7 L;  1XNR Q;  2AHO B;  1OXU A;  3KLW A;  4B3R L;  2PMZ E;  4LFC L;  2KCM A;  1NJI C;  4GLV B;  4PZ8 A;  1HNW L;  1NMG A;  1VQI A;  3BZC A;  4P74 A;  1N33 Q;  2OTL A;  4J15 A;  3RLO A;  3GTJ H;  2K50 A;  2VQF Q;  1J5E L;  2I5L X;  3GTG H;  2R93 G;  4X62 L;  4DUY Q;  4GOP C;  1Z47 A;  4A3E G;  2JA7 H;  1PH5 A;  1V43 A;  1IBM Q;  3HOV H;  1N36 L;  3GD7 A;  3A74 A;  3U50 C;  2ZJR A;  4HIO A;  1CKN B;  4A3B H;  3E0E A;  3CCS A;  4DR2 L;  4JI2 Q;  1VQ7 A;  2K5N A;  4R4C A;  5C0X I;  1CSQ A;  5JJK A;  4X65 Q;  2EXD A;  3L2P A;  3F2B A;  3ULL A;  4DR5 L;  1HNZ Q;  4BY1 G;  2ES2 A;  4C3J H;  1BVS A;  4GS3 A;  4AQY L;  2JA8 H;  1N34 Q;  2YTX A;  1WFQ A;  3CAM A;  3G4S A;  3GTM H;  1Y1V H;  5C4X H;  1VQ5 A;  3S14 H;  4JI3 L;  2VZA A;  2PQA A;  4IO9 A;  1FJG L;  4DV4 Q;  4DR4 Q;  3CW2 C;  4BXX H;  4K0K L;  3K80 C;  1U0L A;  4BA1 I;  4DR6 L;  3W1B A;  4DUZ L;  4IPC A;  1WJJ A;  1UEB A;  2Z6K C;  1NE3 A;  4R1J A;  2F4V Q;  2Q2H A;  1OXV A;  3HOW G;  4MZ9 A;  3S24 A;  3EN2 A;  1JJ2 A;  4DV0 L;  2WAQ G;  5LMN L;  1L1O A;  4A3G H;  5LMN W;  3CCE A;  3HOU H;  3PUW A;  1YJW A;  3J7Z C;  1TWG H;  2IHF A;  3H0G H;  3PUY A;  2ZTC A;  3GTO H;  3S2H H;  4HJA A;  3S1Q H;  4AH6 A;  4YHH Q;  2JA6 G;  4BY7 G;  4GKJ Q;  2MFI A;  2N8N A;  5H1S E;  3RZD H;  3W5O A;  4DR7 Q;  4NXN Q;  5FLM G;  1YZ6 A;  3HOX H;  1R9T H;  1HNX L;  1C0A A;  4H02 A;  1HJP A;  5JJI A;  4OXP A;  1C9O A;  4TVA B;  3ZJY C;  2N3S A;  5M3M H;  2ZJQ A;  2R7Z G;  1XMQ Q;  3CCU A;  4L5R C;  4JI8 L;  2E2H H;  1Q12 A;  1P16 A;  3UE0 A;  3B6Y A;  1KC8 C;  1B70 B;  1YBY A;  5DLQ E;  1I50 H;  3W1G A;  1JT8 A;  2BH8 A;  4YCU A;  3DLL A;  3M7N A;  4JYA L;  4IPH A;  4FDB A;  3BJU A;  2R93 H;  2VL6 A;  1A63 A;  4C2M H;  5IWA L;  1YEZ A;  3CCQ A;  4A3E H;  3MXN B;  4JI1 Q;  2QA4 A;  3U58 A;  3H3V I;  4DR3 L;  4LFB Q;  4OO1 G;  3SGI A;  5FJ8 G;  1HZ9 A;  1W2B A;  1QZH A;  1CKM A;  1RL2 A;  1TWA H;  1WCM G;  3CF5 A;  2NZO A;  1K0R A;  4A3J G;  2E5L Q;  2F3I A;  1Q82 C;  5C3E G;  1NBW A;  1VQB A;  5M5Y H;  2YV5 A;  3KJO A;  2WB1 E;  1I94 Q;  4BY1 H;  4OX9 L;  4KHZ A;  2R6G A;  1KXL A;  5HY6 A;  2VUM G;  3T1Y L;  4JBK A;  3I4N G;  4IJH A;  3UE1 A;  4R4T A;  1ASY A;  4X6A H;  1VQN A;  3J81 j;  2AMC B;  2EQS A;  1K8G A;  5ELN A;  1PA6 A;  2NN6 I;  1VQC A;  4GNX A;  4LF4 L;  1IYJ B;  5IY0 A;  1E1T A;  4NPS A;  3HKZ E;  4QL5 A;  3HOW H;  3CCR A;  2UXB L;  4DKA C;  2KEN A;  1EWI A;  2B29 A;  3TS0 A;  3PF4 A;  4MTN A;  4DV3 L;  3KDF A;  1GVP A;  3G6E A;  3PGZ A;  2QGQ A;  1E22 A;  5BR8 L;  3UDI A;  3KF6 A;  3OTO L;  1O7I A;  1K3R A;  3TS2 A;  3ULP A;  2UUC L;  2JA6 H;  4BY7 H;  2RCN A;  4GKK L;  1BBU A;  3FKI G;  4YY3 Q;  1KL9 A;  1B7Y B;  4X64 Q;  3PUX A;  1S72 A;  4RMF A;  3HFZ B;  1MJC A;  2E2J H;  4LF6 L;  2ZM6 L;  4A3L G;  1A0I A;  1VCI A;  5LMU L;  4P72 A;  2R7Z H;  3UDF A;  4PG3 A;  3U4V A;  1SLJ A;  2EIF A;  1H95 A;  4GN5 A;  4JI5 L;  5IYD G;  2C35 B;  4HJ9 A;  2HHH L;  2BA1 A;  1AE3 A;  3JAM c;  4JC0 A;  4LFA Q;  2LSS A;  3TRZ A;  3EBE A;  2K4K A;  1XMO L;  1WI5 A;  1CUK A;  4OON A;  4B3T L;  1NMF A;  1RIP A;  3CPF A;  1VQJ A;  2MO0 A;  4IJL A;  4QIW E;  4IPG A;  5FJ8 H;  2K75 A;  5GAG C;  3CC7 A;  1IBL L;  2R92 G;  4P75 A;  2I5H A;  4HIM A;  4B3M L;  4LF7 Q;  2UXD L;  1WCM H;  1WOC A;  3ERS X;  4A3J H;  1E1O A;  2YYZ A;  4OWX B;  2K5H A;  1MJE A;  5C3E H;  2IX1 A;  3NEM A;  2NVY H;  5M5W H;  3J80 c;  1A8V A;  1VQO A;  1XPO A;  5IT9 c;  4JI7 L;  4NXM L;  2VUM H;  3I4N H;  2OCE A;  1SRO A;  2UXC L;  4IOC A;  1QUQ A;  1N36 Q;  3T1H L;  4JV5 L;  1OXX K;  3CD6 A;  1HZA A;  2UU9 Q;  4JI4 L;  5M3F G;  1YNX A;  4DR2 Q;  2YU9 H;  2ALY B;  2CWA A;  2JJQ A;  3STB D;  4DR5 Q;  2WAQ E;  3HKS A;  2HT1 A;  2WFW A;  2AWO A;  3F8T A;  4BA2 I;  1VQE A;  3M9B A;  1Y1W G;  3CC4 A;  4DV5 L;  1ASZ A;  4JI3 Q;  2ZJP A;  1FJG Q;  1YJN A;  2PI2 E;  3NEN A;  2E2I H;  4K0K Q;  3FKI H;  2UUA L;  3CCL A;  3RZO H;  2NN6 G;  1SFO H;  4DR6 Q;  4DUZ Q;  3UDG A;  1J6Q A;  3EIV A;  4A3L H;  1D8L A;  3CPW A;  3PO3 G;  1JJC B;  2AWN A;  3GTQ H;  4DR1 Q;  5IYD H;  1YJ9 A;  1IXR A;  4DV0 Q;  5LMN Q;  2A1A A;  1OXT A;  1EIY B;  2ATW A;  1X3F A;  3G48 A;  3I4O A;  3K8A A;  2DGY A;  2OQ0 A;  5K36 G;  3G71 A;  3PV0 A;  3GTL H;  1X9N A;  4JOI A;  2VQE L;  4LUZ A;  3RN5 A;  5C4J H;  4X66 L;  3HOY G;  1HNX Q;  3S1M H;  4JI6 Q;  1HNZ L;  4UPA A;  2A8V A;  1BKB A;  1M90 C;  5AJ3 L;  1X6O A;  3K7A H;  3GDE A;  3OW2 A;  3J81 c;  2JE6 I;  1JB7 A;  3I7F A;  2R92 H;  4DV7 L;  2N49 A;  1Q7Y C;  1L0W A;  4A3K G;  1EIF A;  2CFM A;  1VQL A;  1XNQ Q;  4A75 A;  1FGU A;  1GO3 E;  2I5M X;  3PIO A;  2XGT A;  3VDY A;  4KHP L;  4APV A;  1EYG A;  4JYA Q;  5IYC G;  1UWV A;  2LXJ A;  1XPR A;  4ME3 A;  1N8R C;  1JMC A;  5IWA Q;  4R4O A;  2KCT A;  4A3C G;  2ASB A;  1VQ9 A;  3H3V H;  3LGJ A; 
#chains in the Genus database with same CATH topology
 1S40 A;  3S15 B;  1F2Z A;  4S3S A;  1VDZ A;  1KNA A;  4FYD A;  2OWO A;  2D0P A;  2K5Q A;  1BCP D;  4RKB A;  2KEE A;  4R4I A;  1CQF A;  2RKS A;  3OIP A;  3NUC A;  5FO7 B;  3T1Y Q;  1W3S A;  4RH6 A;  2QEJ C;  1PYB A;  3VYS A;  2QF7 A;  5C3X A;  1KRS A;  1AH9 A;  2RDH A;  3SK5 A;  1EUJ A;  3K0X A;  1PVO A;  4GOP A;  3J81 L;  1L1O B;  4DV3 Q;  1IBK L;  2UUB Q;  3C1F A;  3NPP A;  3RR5 A;  3K7U C;  2I07 B;  2L11 A;  5CBE E;  1D2B A;  4L5T A;  3OTO Q;  1S5F D;  2JA9 A;  1P8L A;  4GKK Q;  1EQQ A;  1KLG D;  3J7A F;  5TSS A;  5DAU A;  2R7D A;  2L5T A;  1EQT A;  3M85 A;  2VY3 A;  5LMU Q;  1Q46 A;  4OIJ A;  5FLM H;  2FXQ A;  1O7Z A;  3X3N A;  1IL2 A;  1CZG A;  1D5X C;  3M4O B;  2EYJ A;  2ZTE A;  1QNK A;  2JP1 A;  4PZ7 A;  3MEF A;  5IYB G;  4HJ8 A;  3QG1 A;  4DPG A;  1VQH A;  1HQM C;  1PH7 A;  1KAW A;  5E3F A;  1CKN A;  1RHP A;  3P7J A;  4J1M A;  2OT2 A;  1IL8 A;  3SK8 A;  1K83 B;  3NBH B;  2UXD Q;  1KLU D;  1ICF B;  4ZAI A;  2HQE A;  2HQL A;  4A3B B;  4LWC A;  4BBR G;  4B3R Q;  4IPD A;  4YCV A;  5GAH C;  1AW7 A;  4LNQ A;  4WOR A;  1E7Z A;  1KAB A;  3JAM i;  4J6H A;  3D4R A;  1SE4 A;  2EY5 A;  4JV5 Q;  2A68 C;  1SYC A;  4DXG A;  1V9P A;  4V0B A;  4HED A;  1Q1E A;  4RFB A;  1LT3 D;  4DV6 L;  3A5U A;  1PZI D;  1QIL A;  2AKW B;  2XN9 C;  1GD7 A;  4KLK A;  3E0J A;  3R8B A;  1BUV T;  3K0Y A;  1HR0 W;  3WDN A;  1N32 L;  1PTO C;  3BYT B;  4YWL A;  2FMM A;  1PFB A;  2O5J C;  3ICE A;  2WAC A;  1G91 A;  1HFN A;  1MHW C;  1CKO A;  3A7L A;  2B63 B;  1PH6 A;  3FVQ A;  2F0H A;  2IX0 A;  4Y7N B;  4C3I G;  2PI2 A;  3CP0 A;  2MQH A;  4BBS G;  3FRP B;  1X56 A;  1X54 A;  5FLX L;  4A3I B;  2A68 D;  1LTA D;  5IYB H;  4QY7 A;  3MXN A;  2JQO A;  5EKI A;  1IBM L;  3AYH B;  1D1I A;  4X66 Q;  3C2P A;  3TME A;  2F0K A;  2SNS A;  2CWP A;  5AJ3 Q;  2IX3 A;  4DV7 Q;  4RAU C;  4XYO A;  4QIW B;  1G6Z A;  4TSS A;  1S5B D;  1NR4 A;  5KRU A;  4BBR H;  3GTK H;  5CR3 A;  4DV4 L;  4MHE A;  4H44 C;  2F3V A;  3GV3 A;  4JW0 A;  2PMZ B;  4A93 B;  1SRU A;  1EZ6 A;  5D3I B;  1YNJ D;  3M3Y H;  3BDL A;  4KI0 A;  2XNA C;  1YI2 A;  3KYH C;  5C4Z A;  2PNR C;  5IGG A;  4KY6 A;  4POG A;  4JI6 L;  4ABN A;  2Q8R E;  3J81 i;  4NXN L;  3V2T A;  1A3T A;  2EOT A;  2F0W A;  4IUQ A;  2F0D A;  1XNQ L;  5J3B A;  4X3S A;  5GQO A;  4N8F A;  1KDC A;  3KF8 B;  2Q2T A;  1AZQ A;  4C3I H;  5KYI A;  1IBK Q;  4DA2 A;  5FOB B;  2R7Z B;  4K2K A;  4BBS H;  1LM0 A;  1TKW B;  1B3A A;  1B2T A;  4YWK A;  4JI1 L;  3S2D H;  1E24 A;  5CV5 A;  1V1Q A;  3IRB A;  1BO0 A;  3NE5 B;  4B08 A;  4K6D A;  3I91 A;  4L6T B;  2DNE A;  3K58 A;  1Y8P B;  5ELO A;  1X3G A;  1G6P A;  1UE7 A;  4HTH A;  2KCN A;  5E7N A;  1Q1B A;  3HOV G;  5I6W A;  5C0X G;  1YIT A;  4A3B G;  4EQO A;  4JOI C;  2N78 A;  2JEB I;  1CM9 A;  3N52 A;  4B3T Q;  1MGS A;  1D7Q A;  3GTG B;  2JA7 B;  2BDO A;  4QJF A;  1K3B C;  1HUM A;  3S16 H;  1QCB D;  3OWF A;  4CKB A;  3TP8 A;  1HUN A;  4B9X A;  2WB1 B;  3OYY A;  3AEV A;  2F0V A;  4LFA L;  1SN8 A;  4DV6 Q;  3ONA B;  3STB C;  4IUV A;  1VQ4 A;  2A69 C;  1N32 Q;  2VXW A;  1LAB A;  3OIQ A;  1STH A;  4CJ1 B;  1Q86 C;  4LF7 L;  3L3O C;  3GTO B;  3KLW A;  2F03 A;  4LFC L;  1B4O A;  2KCM A;  2WII B;  3T4A C;  1HNW L;  4GLV B;  4PZ8 A;  3S1M B;  1M4V A;  3RZD B;  2OTL A;  3HOX B;  4X62 L;  3V05 A;  3AB9 A;  4FXK C;  1IBM Q;  4NW2 A;  3HOV H;  2ZJR A;  2K01 A;  4A3B H;  5CV9 A;  4DR2 L;  5KNB A;  5LL6 X;  1S4Z A;  4R4C A;  2A69 D;  2EXD A;  3D8G A;  2R93 B;  2K5W A;  4C2M B;  4GS3 A;  2PO4 A;  2VZA A;  1X3Q A;  4DV4 Q;  1J9O A;  3CW2 C;  4DK0 A;  3K80 C;  1U0L A;  2SEB D;  3DWQ A;  1UEB A;  2PZT A;  1NE3 A;  4B9W A;  1XWE A;  2Q2H A;  3MVV A;  3EN2 A;  3E5S A;  4RA8 A;  5LMN W;  1YJW A;  5F2D A;  2DN8 A;  2F0M A;  5ELD A;  5M5X B;  4HJA A;  4ZKB B;  2KVM A;  4AH6 A;  3LNN A;  2N8N A;  4HMI A;  4ULL A;  3W5O A;  4NXN Q;  4LJZ C;  1R9T H;  1C0A A;  1V8Q A;  2ZJQ A;  1LV9 A;  2R7Z G;  1XMQ Q;  3CCU A;  4JI8 L;  1EEI D;  4QUF A;  4XT3 B;  4CDD C;  2E2H H;  1Q12 A;  1KC8 C;  1G2S A;  2JA6 B;  3W1G A;  1PRT F;  3DLL A;  4YCU A;  3C1E A;  3FPU B;  3DHQ A;  2SOB A;  3M4Y A;  5IWA L;  5IGE A;  4FF4 A;  4JI1 Q;  4A3K B;  3U58 A;  3SGI A;  1F77 A;  1STE A;  4CJ2 C;  1CKM A;  2AUJ D;  1QZH A;  1RL2 A;  1TY0 A;  1QG7 A;  1TWA H;  2CH4 A;  2NZO A;  1K0R A;  4A3J G;  1A2U A;  2FMC A;  5HY6 A;  3FEW X;  3I4N G;  1ASY A;  1OO9 B;  1TR5 A;  4ODG A;  2AMC B;  1K8G A;  4DNR B;  1ESR A;  3IKJ A;  4LF4 L;  4KMU C;  3KUP A;  4NPS A;  1U4L A;  3HKZ E;  5C3E B;  4QL5 A;  5IIF A;  4U67 3;  2B29 A;  4BS9 A;  3NTK A;  4PMC A;  3UDI A;  1F2M A;  1ROD A;  1SMY C;  4XXE A;  1B50 A;  3FKI G;  1H9K A;  3HFZ B;  4P72 A;  2R7Z H;  3UDF A;  3HG9 A;  1SEB D;  4PG3 A;  4GN5 A;  4JI5 L;  2HHH L;  2Z6B A;  4LFA Q;  2NBF A;  5CV6 A;  2KA7 A;  3U9O A;  1JOO A;  3NQT A;  4H0L C;  3MC0 B;  1BBX C;  2LMC B;  4OON A;  1NMF A;  1DXM A;  3CC7 A;  5GAG C;  1IBL L;  1SMY D;  4LF7 Q;  4HIM A;  3RMH A;  4A3J H;  1WTH A;  4Q0F A;  2KUM A;  3BDC A;  3I90 A;  5CBA E;  1VQO A;  1RDP D;  3I4N H;  4EGV A;  2OCE A;  2C9O A;  4IOC A;  2F0E A;  2F0I A;  2HCI A;  2L12 A;  4JI4 L;  5M3F G;  2MJ8 A;  1ONL A;  4DR2 Q;  2ALY B;  2CWA A;  1ML0 D;  2WAQ E;  1GUO A;  2EYM A;  1TT2 A;  1B9N A;  5BN4 A;  3FKI H;  2UUA L;  2F0S A;  1EYC A;  1JC7 A;  3GTQ H;  1F9Q A;  1Y8N B;  4F8M A;  1OXT A;  3NP8 A;  2RCF A;  1PFN A;  1X3F A;  2PPB C;  2K04 A;  5K36 G;  4JOI A;  3J7A V;  3J80 L;  5IT9 L;  3RD4 A;  3S1M H;  1EYD A;  3OW2 A;  2Z9H A;  1Q7Y C;  1SNQ A;  1L0W A;  4A3K G;  2K7V A;  3MHB A;  1FGU A;  1JE4 A;  2I5M X;  3PIO A;  4KHP L;  4QQB X;  2F0J A;  2K1B A;  2LXJ A;  4ME3 A;  4FF2 A;  5IWA Q;  1RCV D;  2ASB A;  2NZH A;  2K52 A;  2F0L A;  1AZP A;  3BYY B;  1DM0 B;  3TRE A;  5M3F H;  2JA5 B;  5JOB A;  4P2C B;  1XYI A;  3TP5 A;  3L0O A;  4J8Q A;  2PQA B;  1D6E C;  1SR3 A;  3JAM E;  1G8Z D;  1XTC D;  1KQS A;  4LF4 Q;  5M5X H;  1OXS C;  4HJ5 A;  4FXG C;  2ZXO A;  4DV1 Q;  1J8I A;  3F1Z A;  4IAL A;  3A5Z B;  4F88 A;  2K6A A;  1Z7T A;  4N8X 1;  3URY A;  1EYA A;  4A4I A;  2RBM A;  5EAY A;  1XXG A;  5K36 H;  4IOA A;  4OWT B;  4LF8 L;  4O0A A;  4C1N I;  3C46 A;  4DV2 Q;  1E3P A;  1II3 A;  2F0U A;  5IE8 A;  2MP1 A;  2DUD A;  4IZ8 A;  2HHH Q;  1PDQ A;  4JBM A;  4A3K H;  1XJV A;  4IFD J;  4CJ0 B;  2CQA A;  3OSO A;  1I4R A;  4R9W A;  1BXT A;  4R4Q A;  1SJH D;  1ENF A;  1O7L A;  4DK3 C;  3PSI A;  3I8Z A;  3KFU A;  1LO5 D;  4UAI A;  3G7L A;  3I3C A;  2BH2 A;  5JPN C;  3F2C A;  1PH8 A;  3Q22 A;  4X64 L;  2JK8 A;  4ID6 A;  4AYB G;  4GN3 B;  4LF9 L;  5IP9 G;  1S3O A;  3TEH B;  4HR7 B;  2R7F A;  1IHZ A;  2B3G A;  4GNX B;  2KCC A;  5C4X B;  3CRK C;  1SYB A;  2NVX H;  4JI4 Q;  3NWT A;  1EWH A;  4BBR B;  2NVT H;  4FNF A;  1NTG A;  2M2L A;  5EGT A;  3PUV A;  1V1P B;  3KF6 B;  5ELE A;  2E74 C;  4MNO A;  2BOS A;  1HR0 L;  3J81 E;  1JWU D;  2E75 C;  2Y0S G;  3HEJ A;  4AQY Q;  4O42 A;  1DOK A;  2UUA Q;  2YTV A;  1TVX A;  5C3W A;  1ET9 A;  3SVM A;  3M3Y B;  4L5Q A;  3NEL A;  1XNR L;  3HOZ G;  1HA5 A;  2L1B A;  2Z1C A;  1GUT A;  1H9M A;  1A3U A;  1SE3 A;  3J80 i;  1MBY A;  2MHV A;  2ZXR A;  3K81 C;  2VQF L;  2Z0S A;  4DUY L;  1DJR D;  3MWY W;  4IUU A;  2CQO A;  5DNF A;  2L0C A;  2UU9 L;  1TQO A;  2KED A;  3X3M A;  4P71 A;  2NTS A;  4RGO S;  1TY2 A;  4A3M G;  3VR2 A;  5FKA C;  3BU2 A;  4A3F G;  4JI2 L;  4X65 L;  4BBS B;  1M1K C;  1CSP A;  2P5Z X;  3VYR A;  4TQU S;  2CW0 C;  2NB0 A;  3M4Q A;  4DAY B;  3F2D A;  3FHW A;  4X3U A;  4IFD I;  3S2D B;  3MA2 B;  2FJ2 A;  3CQZ H;  3IL8 A;  4KHP Q;  2JA5 G;  3TDQ A;  4DR4 L;  2EYL A;  1CT1 D;  5IP9 H;  1QUQ B;  3DXJ C;  4NDX A;  4DR1 L;  2F4V L;  2Z8L A;  5EQ0 A;  2BCO A;  5C44 G;  1EY5 A;  1PXU A;  4ALP A;  1PV4 A;  4OWW B;  3FP9 A;  4PMW A;  1VS0 A;  5G3L D;  1JJG A;  3NWS A;  1AN8 A;  4Y52 H;  4NMZ A;  1Q81 C;  4GZY C;  4CDF C;  3TN2 A;  2DY8 A;  4YHH L;  2HIV A;  2EDG A;  1PH9 A;  3KJP A;  3RNU A;  4RCN A;  4LUO A;  1ZKO A;  1YHA A;  5ELC A;  3KBX A;  4PNY A;  4I65 A;  4R8I A;  2B8G A;  3E6Z X;  2D62 A;  3HOZ H;  2BA0 A;  4DK1 A;  1SE8 A;  2WKD A;  3D0F A;  3L7Z C;  3H09 A;  1SJE D;  1ENA A;  2F0Q A;  4KD3 A;  3S16 B;  4JBJ A;  2KHI A;  2G9D A;  4POF A;  1L0X B;  3RUZ A;  4XIG S;  5EPL A;  2WV6 D;  1U9R A;  4LF8 Q;  2HUG A;  5FLX E;  1I6H H;  1U4R A;  4A3M H;  5C0X J;  4ZK9 B;  4G7H C;  1CHQ D;  4A3F H;  3OOC A;  5HGT A;  2KHS A;  4LF6 Q;  1I94 L;  1GHJ A;  1BDO A;  2XIW A;  2FIN B;  1SND A;  4R8N A;  1WCM B;  4UP7 A;  1QVC A;  3SHL A;  2JA5 H;  4RHR A;  1TII D;  1BCP F;  5J22 A;  1XMO Q;  3BS1 A;  3BVG A;  4RKL A;  2KHJ A;  5C44 H;  2K5D A;  1PH4 A;  2IY5 B;  4C3J G;  3R3O A;  1KNE A;  3BVZ A;  3TSS A;  1LTT D;  4O1N A;  4IFD G;  3I72 A;  5C4X G;  3HOV B;  1HZC A;  4KKT A;  4PZ6 A;  4BXX G;  1G51 A;  2NWG A;  4YY3 L;  3EVQ A;  4JBW A;  3RN2 A;  1DD2 A;  4LF9 Q;  2I0Q A;  1QZG A;  3K59 A;  4A3G G;  1I4Q A;  1YNN C;  4HSP A;  3HOU G;  4GOP B;  4NB3 A;  2CVR A;  5NUC A;  1EU3 A;  1F9P A;  2GVA A;  4DNI A;  4L5S A;  3H6M A;  1HR0 Q;  1ILQ A;  3PMF A;  5HGQ A;  1UE1 A;  2B2W C;  2WKC A;  3KLR A;  2EXZ A;  1XNR Q;  1OXU A;  2KQ3 A;  2RQX A;  1FR3 A;  2PMZ E;  1NJI C;  1NMG A;  1HFG A;  4HCS A;  4J15 A;  3RLO A;  3GTJ H;  2K50 A;  2VQF Q;  1R9T B;  2I5L X;  1J5E L;  2R92 B;  4DUY Q;  1Z47 A;  1KTK A;  3NTI A;  1KAA A;  2E2H B;  4HIO A;  1EY9 A;  1CKN B;  4FF3 A;  2Q8T A;  4JI2 Q;  3G6J B;  4G57 A;  1VQ7 A;  3OMG A;  1EOT A;  5C0X I;  4X65 Q;  1HNZ Q;  1ICW A;  4BY1 G;  2ES2 A;  4C3J H;  1F9R A;  2YTX A;  3TP7 A;  1WFQ A;  3G4S A;  4IFD H;  4HCE A;  1PTO D;  5C4X H;  5J39 A;  4DR4 Q;  4BXX H;  1NCV A;  1TWA B;  4DUZ L;  1UAP A;  2Z6K C;  2F4V Q;  5DM7 3;  3SDZ A;  3HOW G;  1JJ2 A;  3AMU A;  4DV0 L;  1JQY D;  4IUR A;  5LMN L;  4A3G H;  3HOU H;  5LL6 S;  4KN7 C;  1TWG H;  1SYD A;  3PUY A;  5FK9 C;  4OEL B;  3S1Q H;  4YHH Q;  3A8K E;  4BY7 G;  3H3V C;  1HPC A;  3GTP B;  5A2Q L;  3WOE A;  3IAY A;  1C9O A;  2N3S A;  1JOQ A;  1VMP A;  3QOJ A;  1P16 A;  3UE0 A;  3B6Y A;  1TS5 A;  1HQR D;  1I50 H;  3HZX A;  1Q3L A;  1JT8 A;  4FDB A;  2QCP X;  3BJU A;  2VL6 A;  1EY7 A;  4LK1 C;  3MXN B;  5A35 A;  2QA4 A;  5L37 A;  4EQP A;  4DR3 L;  2EJG C;  2N88 A;  1WCM G;  3CF5 A;  4OX9 L;  1NBW A;  1HCZ A;  1VQB A;  2YV5 A;  1I94 Q;  1QWY A;  2WB1 E;  4BY1 H;  1IKL A;  1KXL A;  2A5H A;  1WTR A;  3K5O A;  4JBK A;  4DN4 M;  1BR9 A;  1U4M A;  3VR3 A;  5ELN A;  1HHV A;  2NN6 I;  4A3J B;  3UI2 A;  4WRD A;  3HOW H;  2UXB L;  2CHB D;  3I4N B;  3KDF A;  1GVP A;  1EY0 A;  1SNM A;  1JIC A;  5BR8 L;  3TS2 A;  3ULP A;  2UUC L;  4BY7 H;  1SBB B;  4YY3 Q;  1B7Y B;  3PUX A;  4X3T A;  1A0I A;  1VCI A;  5I4D A;  1H95 A;  5IYD G;  3P1H A;  2C35 B;  4JC0 A;  2J4X A;  3FKI B;  1WI5 A;  1CUK A;  1NUC A;  1V1O A;  2EVB A;  1GJX A;  5EBD A;  3CPF A;  3GTQ B;  3SR1 A;  4F7X A;  4PMB A;  2R92 G;  4RGM A;  1WCM H;  3ERS X;  2K03 A;  4C56 C;  2K5H A;  3NEM A;  1K8O A;  1XPO A;  4NXM L;  2X69 A;  2UXC L;  4TRD A;  1PRT C;  3MAQ A;  5IGB A;  3T1H L;  1NR2 A;  3CD6 A;  1UUP A;  2C5C A;  1HZA A;  2L55 A;  1YNX A;  2YU9 H;  5C0X H;  4OGQ C;  2JN4 A;  5T1I A;  3STB D;  1BCP B;  4DXF A;  1H9J A;  2DJF C;  3HKS A;  1RJT A;  1WTQ A;  1F2L A;  2WFW A;  2NYZ D;  4JK1 C;  1Y1W G;  3SXH A;  4DV5 L;  1ASZ A;  4RGT A;  5FO9 B;  3FPP A;  3NHH A;  1YJN A;  3RZO H;  1PYW D;  2NN6 G;  5M3F B;  4DUZ Q;  1SYF A;  3EIV A;  3CRL C;  1D8L A;  2XRS D;  1JJC B;  1STB A;  5IYD H;  1YJ9 A;  4DV0 Q;  5LMN Q;  1EIY B;  1S5D D;  3G48 A;  3DUZ A;  3I4O A;  1Q8I A;  3GTL H;  2VQE L;  5T1G A;  3RN5 A;  4JI6 Q;  1A2T A;  1FYC A;  2A8V A;  2EYH A;  3D6W A;  1JB7 A;  1W6K A;  2R92 H;  3TZD A;  2N49 A;  1VQL A;  1EIF A;  1C4Q A;  1XNQ Q;  4A75 A;  5ELB A;  4K6L A;  2O5I C;  1JMC A;  1N8R C;  1CA5 A;  1U4P A;  4IQZ A;  4R4O A;  2R3Z A;  2MGS A;  4ZRZ A;  5DM6 3;  3LGJ A;  2B2V C;  5KYL A;  1F2Y A;  4DF7 A;  1SNC A;  1RF2 D;  2QIL A;  2OQK A;  3ERQ A;  4OX9 Q;  4KY5 A;  3HS0 C;  4DR7 L;  2LY7 A;  3VA5 A;  3D3R A;  2B2W A;  1Y1W H;  2E8G A;  5C4H A;  3U4Z A;  1CQV A;  1MIU A;  4IUP A;  2NN6 H;  4DNT B;  3KLS X;  2EJF C;  1O78 A;  4WJ3 M;  3DEO A;  1EQR A;  4CKC A;  1MI2 A;  1NNX A;  1QNU A;  5CC4 A;  1E2V A;  4XQJ A;  3GTP H;  2UXB Q;  1B1Z A;  1TS3 A;  4K5V A;  3LX0 A;  5BR8 Q;  4EX5 A;  1QB5 D;  5KIX A;  4HID A;  1T5X D;  3NXW A;  3PO2 B;  5JJL A;  2NVX B;  1SE2 A;  2NVT B;  3PIP A;  3CCJ A;  4HJ7 A;  3J80 E;  5IT9 E;  3BZK A;  4PQX A;  4WJW A;  4XT1 B;  3CC2 A;  4DFA A;  2Z6K A;  1PMR A;  4A76 A;  1L1O C;  1IZ6 A;  4UY8 C;  1FVI A;  3S17 H;  1VQF A;  3M4P A;  1PH1 A;  3QIA A;  3P20 A;  1A62 A;  4B3S L;  1TWF H;  3A55 A;  1A3V A;  2OTJ A;  4PV1 C;  1PTO B;  2PCF B;  4LFC Q;  1HNW Q;  5D65 A;  4KN4 C;  4NXM Q;  4FO2 A;  2GVB A;  5GAE C;  2UXC Q;  3LWU A;  1UE6 A;  4X62 Q;  3GTM B;  1LAC A;  2ICI A;  2XVS A;  3MEH A;  2O2L D;  1AEX A;  1FL0 A;  2EYP A;  3RLF A;  1EEF D;  3CQZ B;  1T9H A;  3HKZ B;  4AYB B;  1EY4 A;  3I4M G;  1WD0 A;  2JEA I;  2PW5 A;  3S2H B;  4JPB W;  3PCO B;  4N9T A;  1HA6 A;  4CDE C;  2HDM A;  3CCM A;  2VNU D;  1EOV A;  3EJI A;  1LUZ A;  3L9A X;  1WYD A;  1KIX A;  5M3M B;  2J7Z A;  2Y0S B;  5EKK A;  4GLA C;  1WTP A;  2VQE Q;  5I2X A;  1ZXT A;  4FP5 D;  3HOZ B;  2EY2 A;  3PIP 3;  2D5D A;  5JVG 3;  1MKH A;  4K8I A;  4A3E B;  3UDX A;  1PLF A;  3E9I A;  2RHQ B;  4JI8 Q;  2OEO A;  1N34 L;  2F0F A;  2PZU A;  3OPO A;  4YCW A;  3IFT A;  4JG2 A;  1I6H B;  4DAV A;  1G29 1;  3TP6 A;  1HH2 P;  1DCZ A;  2B2T C;  4A3M B;  1M8A A;  4A3F B;  2EYO A;  3ND9 A;  2HDL A;  1VQG A;  1WVL A;  3DEP A;  1LYL A;  3CU7 A;  3QB3 A;  1L2F A;  2IT1 A;  1TXY A;  1H9S A;  1ENC A;  1RTN A;  5IOC A;  2X6L A;  4GKJ L;  3I4M H;  4HAE A;  1LTL A;  2MUY A;  4ZYS A;  2WAQ B;  5C44 B;  5CV4 A;  1IYV A;  3H91 A;  1VF5 C;  2HD3 A;  4JVZ A;  1TWH H;  3TQY A;  3I56 A;  1YVC A;  3E9H A;  4OEM B;  4QF4 A;  3PO2 G;  3I55 A;  2XTI A;  2F0G A;  1X65 A;  1VQD A;  4ZQ3 A;  2H4O A;  3CKI B;  1EFW A;  2Q2I A;  4NP5 A;  3PQI A;  4LFB L;  2V1C C;  1Y14 B;  2YTY A;  4ZCK A;  3Q8D A;  5E1F A;  1GUG A;  1BBW A;  4TKO B;  4JI5 Q;  4DK6 C;  1ET6 A;  3E3X A;  2VS1 A;  4O2D A;  1I4X A;  1WTW A;  3CME A;  2NVY B;  4ZKC B;  1E2Z A;  4RCO A;  3J7Y W;  2UUB L;  2K33 A;  3ER0 A;  4B3S Q;  5KEE A;  3GTJ B;  3H15 A;  5K5P A;  2JA8 G;  2KOL A;  1CTM A;  2M00 A;  3QR8 A;  1IBL Q;  3D4D A;  2JSO A;  1Y1V G;  2FHT A;  5E4W C;  2NVQ H;  1GKH A;  1PFM A;  4K14 A;  3HKZ G;  5COY A;  2VW9 A;  3GO5 A;  4C3J B;  1QVF A;  3RLN A;  4I7Z C;  1GUN A;  2MNA A;  1SFO B;  3PO2 H;  2DY7 A;  4WFN 3;  1FD7 D;  3H0G G;  4CBV A;  1RTO A;  2GN5 A;  1EY8 A;  1I4P A;  2B2V A;  4CKE A;  1ZYR C;  4DU9 A;  1TS2 A;  2MO1 A;  1Z9F A;  5JEA G;  5M3M G;  2ENB A;  3O13 A;  4A3G B;  4OO1 I;  4UP8 A;  4G7Z C;  3HOU B;  1I3Q H;  3R2I A;  4GLX A;  2AHO B;  3A7A B;  1D1K A;  1TWG B;  4B3R L;  5LHY 1;  4KY7 A;  3S1Q B;  1SSO A;  2A6E C;  3BZC A;  1D5Z C;  2CH4 W;  1Z6H A;  5EBC A;  4A3E G;  1E2W A;  5EJW A;  1N36 L;  3A74 A;  5EPJ A;  1PTO H;  2EPB A;  4C1N K;  3A56 A;  2AQ3 B;  1I50 B;  5JJK A;  2K5N A;  3NBI A;  4V19 0;  2Z4H A;  4K5W A;  5J1Z A;  3ULL A;  1B44 D;  1BVS A;  2JA8 H;  1N34 Q;  3CAM A;  3GTM H;  3S1R B;  1Y1V H;  1VQ5 A;  3S14 H;  2D2C C;  4IPC A;  1WJJ A;  4ZUJ A;  2F4I A;  1OXV A;  4OL7 A;  4BY1 B;  1LTB D;  1DZ1 A;  2WAQ G;  1L1O A;  3CCE A;  3PUW A;  3DWA A;  3NSW A;  3S2H H;  3H0G H;  3GQB A;  3QOL A;  2IWH A;  4GKJ Q;  3PO3 B;  2MFI A;  5CMD A;  5H1S E;  5FLM G;  1LT5 D;  4RWS C;  1HNX L;  5JJI A;  3HOW B;  1HJP A;  4OXP A;  5JEA H;  5M3M H;  1LT6 D;  1TWC B;  1XX8 A;  4DGZ A;  3Q6S A;  5D14 A;  2CW0 D;  3R93 A;  1B70 B;  1YBY A;  4BY7 B;  1I4H A;  2B2Y C;  4IPH A;  1GUW A;  1A63 A;  1JWS D;  4A3E H;  3CCQ A;  4EVO A;  4LFB Q;  4OO1 G;  5FJ8 G;  1SYE A;  1E0B A;  3NBH A;  3ITP A;  1SNP A;  2F3I A;  4X3K A;  1AFP A;  2VUM G;  4C3H B;  3BDO A;  4IJH A;  3UE1 A;  4X6A H;  1MSH A;  1VQN A;  3J81 j;  1NAP A;  5KNC A;  1IYJ B;  5IY0 A;  4Q5V A;  5G3L F;  2KEC A;  4DKA C;  1EWI A;  3TS0 A;  4MTN A;  2ICE C;  1A6X A;  3G6E A;  1NSN S;  2EYF A;  3PGZ A;  2QGQ A;  3R2T A;  1A15 A;  5AFW A;  1BBU A;  1KL9 A;  4X64 Q;  2YU9 B;  4RMF A;  2E2J H;  1MJC A;  2ZM6 L;  4A3L G;  3EFX D;  3VYU A;  4LMQ D;  1SLJ A;  2EIF A;  3U4V A;  5A2Q E;  4HJ9 A;  1AE3 A;  3JAM c;  2B2T A;  3TRZ A;  3EBE A;  4A3D B;  2B39 A;  4E6I A;  3RZO B;  2JYO A;  4OIK A;  3DMU A;  2K32 A;  4B3T L;  1RIP A;  1VQJ A;  2MO0 A;  4QIW E;  4IPG A;  4FVM A;  2L4N A;  4OO1 H;  5FJ8 H;  4P75 A;  2I5H A;  4B3M L;  1SAP A;  1E1O A;  3IFD A;  3GTL B;  2IX1 A;  1I6V C;  5KND A;  2NVY H;  1CI3 M;  5M5W H;  4RGN A;  1EZ8 A;  3AU7 A;  2VUM H;  4JI7 L;  3FMC A;  1SRO A;  2RSO A;  5BN3 A;  2NTT A;  2A6H C;  1Y69 U;  2BE5 C;  1N36 Q;  3MTS A;  1YNN D;  2UU9 Q;  1HXY D;  3F2U A;  5EKL A;  5CV7 A;  2F1M A;  2HT1 A;  1HTL D;  2ZXP A;  2AWO A;  3F8T A;  4XQQ A;  1VQE A;  3M9B A;  2PI2 E;  2TMP A;  3NEN A;  3N6R A;  1SFO H;  1J6Q A;  1FNV A;  4A3L H;  5BN5 A;  5FO8 B;  3PO3 G;  3MZ5 A;  4DR1 Q;  3MFG A;  3DM1 A;  3KF8 A;  1IXR A;  2J0T D;  2XRQ D;  4QB4 A;  1AP0 A;  1Y1W B;  1B9M A;  1YNJ C;  2A6H D;  2BE5 D;  2F3W A;  2DGY A;  2OQ0 A;  3G71 A;  2R61 A;  1KDA A;  3KLS A;  1EFI D;  5JJZ A;  5M9O A;  2F0O A;  1PZK D;  3D4W A;  1TU2 B;  3QWN A;  4MTK A;  3HOY G;  1HNX Q;  4UPA A;  1JOR A;  1M90 C;  1X6O A;  3K7A H;  3GDE A;  3J81 c;  2JE6 I;  5I9P A;  4LAA A;  2HCC A;  2PYK A;  3A54 A;  1H9R A;  3SK6 A;  3P75 A;  3K6O A;  4KKS A;  1EYG A;  5IYC G;  1UWV A;  1XPR A;  4K2L A;  1L0Y B;  1O7Y A;  4A3C G;  1VQ9 A;  1HRJ A;  4L8J A;  1EU4 A;  3HRZ C;  2Q8I B;  4C3H G;  3HGB A;  3S1R H;  3S1N B;  2ZTD A;  1T5E A;  4KTA A;  1I5F A;  3QO2 A;  4CHT B;  1VQK A;  2K14 A;  4LF5 L;  1PTO F;  5GRO A;  2F0T A;  1BOS A;  2EY6 A;  3S17 B;  2K5V A;  1PH2 A;  1RKN A;  4XDX A;  5C5M A;  1XMQ L;  5JAV A;  5IGD A;  2Z4I A;  1TWF B;  4KK7 A;  1CHP D;  1YIJ A;  2KJX A;  2LXK A;  2QEX A;  4JI0 L;  3PUZ A;  1BNZ A;  1FNW A;  3PO3 H;  2A74 C;  3NQI A;  3CXC A;  1LTR D;  3C3L A;  2D0O A;  1K9M C;  1HZB A;  1TWC H;  4IUT A;  2PW7 A;  1K28 A;  3DM3 A;  2RF4 A;  4EQ5 A;  1EQV A;  3VR5 A;  3HOY H;  1SNO A;  2PNH A;  5C6A A;  4A3D G;  2ZM6 Q;  5CYU A;  1MSG A;  2ZT9 C;  5ELF A;  2F52 A;  3S15 H;  3AFQ A;  1VQM A;  2JXM B;  1JR0 D;  5JVH 3;  2M9V A;  4Z9C B;  4M1U B;  5IYC H;  4DAM A;  2HIX A;  4MIU A;  2RHS B;  1LTS D;  4A3C H;  1GUS A;  4CDC C;  1X55 A;  4C3H H;  1STA A;  5EPK A;  4B3M Q;  5IOD A;  2IHE A;  4YIJ A;  1SMX A;  5FLX c;  3CCV A;  4XTC S;  2IL8 A;  1DON A;  3D31 A;  1CZW A;  1VMC A;  4JI7 Q;  3H94 A;  5E4X A;  3MXU A;  3K57 A;  1J5E Q;  1LT4 D;  2K05 A;  2XWJ B;  3TZU A;  4DAP A;  1WTO A;  1KD1 C;  1KRT A;  1PHJ A;  2B2Y A;  2N55 A;  1GXD C;  1STN A;  2B63 G;  2H1E A;  3KDF B;  3AQQ A;  3BZD B;  3T56 B;  4HIK A;  3BG3 A;  3ERO A;  3VR4 A;  1N9W A;  1UE5 A;  3M4O H;  1LLR D;  2OXP A;  4A3I G;  5CGK A;  5HUR A;  3AFP A;  5GAD C;  4A3D H;  1BQQ T;  1JB3 A;  1SYG A;  1SXT A;  2IW3 A;  3I4M B;  4GNX C;  4KJO A;  3KOJ A;  1B8A A;  4ILW A;  1B3Q A;  1N33 L;  1K83 H;  1DOM A;  1KHI A;  2Q2U A;  1PRT D;  3JC6 6;  1TWH B;  1GM5 A;  1XPU A;  4BWG B;  4LUV A;  4P73 A;  1F9S A;  4NKL A;  4A93 G;  4N9P A;  3I2Z A;  4AIM A;  1JCK B;  1JOK A;  2H5X A;  5IP7 G;  2FFK B;  2RA4 A;  2CCZ A;  1S5E D;  4YWM A;  2WP8 J;  1FGB D;  1DOL A;  1ZEQ X;  1DYQ A;  3NTH A;  5M5Y B;  4UP9 A;  3T53 B;  2IJ0 A;  1YHB A;  2EE1 A;  4DR3 Q;  1QVG A;  1Q8K A;  1EL0 A;  1X3E A;  4LF5 Q;  1PYS B;  2B63 H;  1S5C D;  1CK1 A;  2RSN A;  4Y7N H;  5IGF A;  5C5L A;  4KJN A;  3VR6 A;  4A3I H;  2NUC A;  1JE5 A;  3Q24 A;  2ID0 A;  4JI0 Q;  3CHB D;  4GN4 B;  4WJ4 A;  1K73 C;  2NVQ B;  2K28 A;  2LS0 1;  4RG1 A;  3EQL C;  3Q23 A;  1C7Y A;  1VQA A;  2VB3 X;  1GOZ A;  1U5K A;  1NY4 A;  3I70 A;  2D9U A;  3TBI B;  1WTV A;  1DGS A;  2UUC Q;  2B2U C;  4KHV A;  2E5L L;  4A93 H;  5IGC A;  1OTC A;  2CKZ B;  5IP7 H;  1VQ8 A;  2DNC A;  2A19 A;  3ULJ A;  2JA7 G;  2I46 A;  3S1N H;  4HN7 A;  1W6J A;  3OHX C;  1I3Q B;  3KBG A;  4IUN A;  3ND8 A;  4AYB E;  4EQN A;  1PH3 A;  4DV1 L;  4CGY B;  1MD2 D;  3U9S A;  1VQ6 A;  3GV6 A;  4QGU A;  2WB1 G;  4XYQ A;  1K8A C;  2E76 C;  2PQE A;  3NK9 A;  4H7B A;  4QCL A;  4DV2 L;  2L15 A;  2EZV A;  2X6G A;  2AQ1 B;  2Y0S E;  3KK7 A;  3LWE A;  3Q0A A;  3J7A 5;  2SNM A;  5KGU A;  1WTX A;  4OHJ A;  1K8M A;  4F87 A;  3PF5 A;  4MN3 A;  1AE2 A;  2XWB B;  3WWV A;  3OWE B;  5JEA J;  1VQP A;  2JA8 B;  2NZ1 D;  3CMA A;  2E2I B;  1Y1V B;  3T1H Q;  2BDN A;  3S14 B;  4LW1 A;  1PFS A;  3A0J A;  2GA4 B;  2QKI C;  4UDU C;  4K8J A;  1I4G A;  2F0P A;  5I9O A;  5DEH A;  3HOX G;  1YHQ A;  4JCV E;  3SE0 A;  2KBN A;  4DV5 Q;  1XTD A;  1EY6 A;  3H0G B;  5C4J B;  3A8I E;  1VQI A;  4P74 A;  1N33 Q;  4G7O C;  2R93 G;  3GTG H;  4GOP C;  2JA7 H;  4FXD A;  1CA6 A;  1PH5 A;  1V43 A;  3GD7 A;  1D5M C;  3U50 C;  1TS4 A;  3E0E A;  3CCS A;  1QJO A;  4QMG A;  3BVM A;  4KV6 A;  1CSQ A;  3L2P A;  3F2B A;  1R4Q B;  4DR5 L;  4AQY L;  2E2D C;  2LKV A;  5D3D A;  4JI3 L;  1QOH A;  2PQA A;  4IO9 A;  1FJG L;  4K0K L;  2A73 B;  4DR6 L;  4BA1 I;  3W1B A;  3K5L A;  4R1J A;  2QW7 A;  4U68 A;  2IPK D;  2DJG C;  4MZ9 A;  3S9W A;  3S24 A;  1EIG A;  1UNS A;  2LFN A;  4KD4 A;  4M8A A;  3J7Z C;  3GTO H;  2IHF A;  2ZTC A;  1UEA B;  2JA6 G;  1K0S A;  3RZD H;  4DR7 Q;  1YZ6 A;  1ESF A;  2RVL A;  3HOX H;  4H02 A;  4TVA B;  3ZJY C;  4ZLT F;  3MXP A;  4L5R C;  1Q90 A;  1G2T A;  1STG A;  1FNU A;  2RDF A;  2AUK A;  5DLQ E;  2BH8 A;  3M7N A;  3K5M A;  1B53 A;  4JYA L;  2R93 H;  2E2J B;  4C2M H;  1YEZ A;  1ILP A;  3H3V I;  1IW7 C;  1W2B A;  1HZ9 A;  4I7A A;  2AQ2 B;  2QDB A;  3OW7 A;  2WIN B;  2E5L Q;  2B8F A;  1Q82 C;  5C3E G;  2G5D A;  5M5Y H;  3KJO A;  4KHZ A;  2R6G A;  2RDG A;  3T1Y L;  1EIH A;  4R4T A;  1VF7 A;  3W2D A;  1O80 A;  2EQS A;  1PA6 A;  2PZW A;  3MFY A;  4RHS A;  4ZUI A;  1VQC A;  3HP3 A;  4GNX A;  1E1T A;  5M5W B;  3CCR A;  2L9H A;  2KEN A;  3PF4 A;  4L63 B;  1HTP A;  5I2Y A;  2G9H D;  4DV3 L;  4FF1 A;  2VUM B;  3MXG A;  4KKU A;  1E22 A;  1IW7 D;  2O4X A;  3T16 A;  1V1P A;  1H9S B;  3KF6 A;  3OTO L;  1O7I A;  1K3R A;  1IKM A;  5COR A;  2JA6 H;  4GKK L;  2RCN A;  5CV8 A;  3W3A A;  1S72 A;  1X32 A;  4LF6 L;  5LMU L;  2EJM A;  1EWC A;  3M7G A;  3T51 B;  3ZYY X;  2BA1 A;  2LSS A;  1LTI D;  5ISR A;  4K5X A;  1KDB A;  3V96 A;  1PRT B;  5JPM C;  2K4K A;  1XMO L;  1C8C A;  3T13 A;  3A8J E;  1SDF A;  1STY A;  4IJL A;  1QE6 A;  3I4L A;  3DWP A;  2K75 A;  3VYT A;  1LTG D;  2V4D A;  4IN3 A;  2UXD L;  3GP7 A;  3PIO 3;  1WOC A;  2YYZ A;  4OWX B;  1MJE A;  5C3E H;  4DAY A;  2F0N A;  1JWM D;  3J80 c;  1A8V A;  5IT9 c;  2EY1 A;  4ME5 A;  3SK4 A;  1IYU A;  3K7A B;  2QDL A;  1QUQ A;  3VA7 A;  3GTK B;  4JV5 L;  1OXX K;  2JJQ A;  1GHK A;  4DR5 Q;  3D6C A;  2MPM A;  3JAM L;  4BA2 I;  3CC4 A;  1ZYR D;  4JI3 Q;  2ZJP A;  1FJG Q;  2B2U A;  2E2I H;  4K0K Q;  3CCL A;  2VB2 X;  4DR6 Q;  4UHV A;  1PZJ D;  2OF1 A;  3EA6 A;  4H13 C;  3SEB A;  3UDG A;  3CPW A;  2AWN A;  2A6E D;  1C48 A;  1X3P A;  2A1A A;  4HMJ A;  2ATW A;  4G4K A;  4HSV A;  3I73 A;  3K8A A;  2XSC A;  3PV0 A;  1BCP C;  1X9N A;  4LUZ A;  5C4J H;  4X66 L;  4C3I B;  1WD1 A;  1HNZ L;  1CFM A;  1BKB A;  4XQN A;  5AJ3 L;  3FDT A;  1R4P B;  3I7F A;  4QUC A;  4DV7 L;  3QJY A;  2CFM A;  1GO3 E;  3OMC A;  1Y8O B;  3VDY A;  2XGT A;  3K5N A;  4APV A;  4JYA Q;  3HOY B;  5I6Y A;  3WOF A;  2SDF A;  2TSS A;  2KCT A;  1BF4 A;  1RD9 D;  3H3V H; 
#chains in the Genus database with same CATH homology
 1S40 A;  2NZH A;  2K52 A;  3S1R H;  2OWO A;  2D0P A;  2ZTD A;  3TRE A;  5M3F H;  1I5F A;  4R4I A;  1VQK A;  2K14 A;  2OQK A;  4LF5 L;  4OX9 Q;  5GRO A;  4DR7 L;  3T1Y Q;  2K5V A;  1W3S A;  1Y1W H;  1PH2 A;  2E8G A;  3L0O A;  1XMQ L;  2PQA B;  3U4Z A;  1SR3 A;  1PYB A;  1MIU A;  1YIJ A;  2LXK A;  1KRS A;  2QEX A;  4JI0 L;  1KQS A;  4LF4 Q;  3PUZ A;  5M5X H;  1OXS C;  4HJ5 A;  1EUJ A;  3K0X A;  1EQR A;  4WJ3 M;  1PVO A;  3PO3 H;  4DV1 Q;  2UXB Q;  4GOP A;  3GTP H;  3F1Z A;  1L1O B;  4DV3 Q;  1IBK L;  3A5Z B;  3CXC A;  2UUB Q;  3RR5 A;  4A4I A;  3K7U C;  2D0O A;  5BR8 Q;  4L5T A;  3OTO Q;  2JA9 A;  1HZB A;  1TWC H;  5EAY A;  4EX5 A;  1K9M C;  4HID A;  1P8L A;  3DM3 A;  2RF4 A;  4EQ5 A;  1EQQ A;  4GKK Q;  4IOA A;  4OWT B;  5JJL A;  4LF8 L;  3HOY H;  2R7D A;  3M85 A;  2PNH A;  4O0A A;  4DV2 Q;  4A3D G;  2ZM6 Q;  2VY3 A;  3PIP A;  1Q46 A;  3CCJ A;  1E3P A;  5FLM H;  5LMU Q;  5IE8 A;  4HJ7 A;  2FXQ A;  2DUD A;  3S15 H;  2F52 A;  1IL2 A;  3BZK A;  2HHH Q;  4JBM A;  3AFQ A;  4A3K H;  1VQM A;  1XJV A;  3CC2 A;  2ZTE A;  4IFD J;  4PZ7 A;  2Z6K A;  3MEF A;  4A76 A;  1AH9 A;  5IYB G;  5IYC H;  1L1O C;  4DAM A;  4HJ8 A;  1IZ6 A;  4DPG A;  1VQH A;  2HIX A;  4UY8 C;  1FVI A;  4R4Q A;  1PH7 A;  1KAW A;  2RHS B;  4A3C H;  1CKN A;  1VQF A;  3S17 H;  4DK3 C;  3M4P A;  3PSI A;  1PH1 A;  1X55 A;  4C3H H;  3KFU A;  1A62 A;  3NBH B;  1TWF H;  4B3S L;  4B3M Q;  2UXD Q;  2BH2 A;  2HQL A;  2IHE A;  2OTJ A;  1SMX A;  5FLX c;  3CCV A;  4LWC A;  4XTC S;  3F2C A;  4BBR G;  1PH8 A;  4X64 L;  4B3R Q;  3D31 A;  4LFC Q;  4IPD A;  4YCV A;  1HNW Q;  4JI7 Q;  5GAH C;  4NXM Q;  2JK8 A;  4LNQ A;  4AYB G;  4GN3 B;  4LF9 L;  5IP9 G;  2GVB A;  5GAE C;  1S3O A;  1E7Z A;  3TEH B;  1J5E Q;  2R7F A;  2UXC Q;  3JAM i;  1UE6 A;  4X62 Q;  2B3G A;  4GNX B;  4JV5 Q;  1KD1 C;  1KRT A;  1PHJ A;  1V9P A;  2NVX H;  4JI4 Q;  1FL0 A;  3RLF A;  2NVT H;  1NTG A;  1Q1E A;  4DV6 L;  1T9H A;  3A5U A;  2B63 G;  3KDF B;  2AKW B;  3AQQ A;  4HIK A;  1GD7 A;  3PUV A;  1N9W A;  4KLK A;  3KF6 B;  3I4M G;  1UE5 A;  4MNO A;  4QQB X;  1HR0 L;  3M4O H;  1HR0 W;  2Y0S G;  4AQY Q;  1N32 L;  4YWL A;  2JEA I;  4A3I G;  2UUA Q;  2YTV A;  3ICE A;  3AFP A;  4L5Q A;  5GAD C;  3NEL A;  1XNR L;  3PCO B;  3HOZ G;  4A3D H;  1CKO A;  1PH6 A;  3J80 i;  3CCM A;  2VNU D;  1EOV A;  2IX0 A;  1LUZ A;  4GNX C;  2PI2 A;  3K81 C;  1WYD A;  3KOJ A;  1B8A A;  1KIX A;  3CP0 A;  1N33 L;  1K83 H;  2MQH A;  2VQF L;  4BBS G;  2Z0S A;  1X56 A;  1X54 A;  1KHI A;  4GLA C;  4DUY L;  2Q2U A;  5IYB H;  2CQO A;  4QY7 A;  2JQO A;  2VQE Q;  1IBM L;  2UU9 L;  3JC6 6;  1GM5 A;  1XPU A;  3AYH B;  4X66 Q;  4P71 A;  4LUV A;  4A3M G;  2CWP A;  4P73 A;  4A3F G;  3BU2 A;  5AJ3 Q;  4JI2 L;  1MKH A;  3UDX A;  4X65 L;  4DV7 Q;  4A93 G;  1M1K C;  1CSP A;  3I2Z A;  4AIM A;  3E9I A;  2RHQ B;  4JI8 Q;  2H5X A;  5IP7 G;  1N34 L;  4TQU S;  4DAY B;  4YCW A;  3M4Q A;  2CCZ A;  3F2D A;  3FHW A;  4BBR H;  3GTK H;  4YWM A;  4IFD I;  4KHP Q;  3CQZ H;  2WP8 J;  4DV4 L;  4JG2 A;  2JA5 G;  4DR4 L;  1G29 1;  1HH2 P;  5IP9 H;  1QUQ B;  1VQG A;  4UP9 A;  4DR1 L;  2F4V L;  1SRU A;  5C44 G;  4ALP A;  1PV4 A;  4OWW B;  3FP9 A;  1YHB A;  4PMW A;  4DR3 Q;  1QVG A;  1Q8K A;  1VS0 A;  3M3Y H;  1JJG A;  1LYL A;  4KI0 A;  1X3E A;  3KYH C;  1YI2 A;  4LF5 Q;  1L2F A;  1PYS B;  2IT1 A;  1TXY A;  2B63 H;  1Q81 C;  4Y52 H;  4POG A;  4Y7N H;  4YHH L;  4GKJ L;  4JI6 L;  3I4M H;  2HIV A;  1LTL A;  3J81 i;  4NXN L;  1PH9 A;  3KJP A;  3RNU A;  4A3I H;  4LUO A;  1JE5 A;  1YHA A;  2ID0 A;  4JI0 Q;  1XNQ L;  2D62 A;  3HOZ H;  1TWH H;  2BA0 A;  5J3B A;  3TQY A;  1SE8 A;  1YVC A;  3I56 A;  3E9H A;  3D0F A;  5GQO A;  3L7Z C;  4GN4 B;  3KF8 B;  3PO2 G;  4WJ4 A;  3I55 A;  2XTI A;  1K73 C;  4C3I H;  1IBK Q;  2Q2T A;  1X65 A;  1VQD A;  4JBJ A;  4RG1 A;  2KHI A;  4BBS H;  4POF A;  1LM0 A;  4XIG S;  1C7Y A;  1VQA A;  1EFW A;  4YWK A;  2Q2I A;  4JI1 L;  3S2D H;  1E24 A;  1NY4 A;  1U5K A;  1V1Q A;  2V1C C;  4LF8 Q;  1Y14 B;  2YTY A;  3IRB A;  4LFB L;  1DGS A;  1I6H H;  2UUC Q;  4A3M H;  3Q8D A;  5C0X J;  4A3F H;  2E5L L;  1BBW A;  4LF6 Q;  4A93 H;  1I94 L;  5ELO A;  1X3G A;  1G6P A;  1OTC A;  1UE7 A;  2CKZ B;  5IP7 H;  1VQ8 A;  4JI5 Q;  4DK6 C;  2A19 A;  3ULJ A;  2JA7 G;  2VS1 A;  4O2D A;  3S1N H;  4UP7 A;  5E7N A;  1QVC A;  1Q1B A;  2JA5 H;  3HOV G;  3CME A;  4AYB E;  5C0X G;  1YIT A;  4A3B G;  1PH3 A;  4DV1 L;  1XMO Q;  4JOI C;  2N78 A;  2JEB I;  5C44 H;  2KHJ A;  2UUB L;  1VQ6 A;  3ER0 A;  1PH4 A;  4B3T Q;  4B3S Q;  4QGU A;  2IY5 B;  1D7Q A;  2WB1 G;  3H15 A;  1K8A C;  2JA8 G;  1IBL Q;  4IFD G;  1Y1V G;  5C4X G;  1HZC A;  4QJF A;  4DV2 L;  2L15 A;  4PZ6 A;  1G51 A;  4YY3 L;  2NVQ H;  4JBW A;  3RN2 A;  3S16 H;  4BXX G;  2Y0S E;  4LF9 Q;  1GKH A;  3J7A 5;  3HKZ G;  2VW9 A;  1QZG A;  3GO5 A;  2I0Q A;  3PF5 A;  1AE2 A;  3WWV A;  1VQP A;  3OYY A;  5JEA J;  1QVF A;  3AEV A;  3RLN A;  3CMA A;  4A3G G;  2MNA A;  3T1H Q;  3HOU G;  4LFA L;  1SN8 A;  4GOP B;  3PO2 H;  4NB3 A;  4LW1 A;  4DV6 Q;  3H0G G;  3STB C;  1PFS A;  3A0J A;  1VQ4 A;  2GN5 A;  2GVA A;  4DNI A;  4L5S A;  1HR0 Q;  3HOX G;  1N32 Q;  5HGQ A;  1YHQ A;  4JCV E;  2MO1 A;  1Z9F A;  5JEA G;  5M3M G;  1UE1 A;  2KBN A;  4DV5 Q;  4OO1 I;  1XTD A;  4UP8 A;  1Q86 C;  1I3Q H;  4GLX A;  4LF7 L;  1XNR Q;  2AHO B;  1OXU A;  3KLW A;  4B3R L;  2PMZ E;  4LFC L;  2KCM A;  1NJI C;  4GLV B;  4PZ8 A;  1HNW L;  1NMG A;  1VQI A;  3BZC A;  4P74 A;  1N33 Q;  2OTL A;  4J15 A;  3RLO A;  3GTJ H;  2K50 A;  2VQF Q;  1J5E L;  2I5L X;  3GTG H;  2R93 G;  4X62 L;  4DUY Q;  4GOP C;  1Z47 A;  4A3E G;  2JA7 H;  1PH5 A;  1V43 A;  1IBM Q;  3HOV H;  1N36 L;  3GD7 A;  3A74 A;  3U50 C;  2ZJR A;  4HIO A;  1CKN B;  4A3B H;  3E0E A;  3CCS A;  4DR2 L;  4JI2 Q;  1VQ7 A;  2K5N A;  4R4C A;  5C0X I;  1CSQ A;  5JJK A;  4X65 Q;  2EXD A;  3L2P A;  3F2B A;  3ULL A;  4DR5 L;  1HNZ Q;  4BY1 G;  2ES2 A;  4C3J H;  1BVS A;  4GS3 A;  4AQY L;  2JA8 H;  1N34 Q;  2YTX A;  1WFQ A;  3CAM A;  3G4S A;  3GTM H;  1Y1V H;  5C4X H;  1VQ5 A;  3S14 H;  4JI3 L;  2VZA A;  2PQA A;  4IO9 A;  1FJG L;  4DV4 Q;  4DR4 Q;  3CW2 C;  4BXX H;  4K0K L;  3K80 C;  1U0L A;  4BA1 I;  4DR6 L;  3W1B A;  4DUZ L;  4IPC A;  1WJJ A;  1UEB A;  2Z6K C;  1NE3 A;  4R1J A;  2F4V Q;  2Q2H A;  1OXV A;  3HOW G;  4MZ9 A;  3S24 A;  3EN2 A;  1JJ2 A;  4DV0 L;  2WAQ G;  5LMN L;  1L1O A;  4A3G H;  5LMN W;  3CCE A;  3HOU H;  3PUW A;  1YJW A;  3J7Z C;  1TWG H;  2IHF A;  3H0G H;  3PUY A;  2ZTC A;  3GTO H;  3S2H H;  4HJA A;  3S1Q H;  4AH6 A;  4YHH Q;  2JA6 G;  4BY7 G;  4GKJ Q;  2MFI A;  2N8N A;  5H1S E;  3RZD H;  3W5O A;  4DR7 Q;  4NXN Q;  5FLM G;  1YZ6 A;  3HOX H;  1R9T H;  1HNX L;  1C0A A;  4H02 A;  1HJP A;  5JJI A;  4OXP A;  1C9O A;  4TVA B;  3ZJY C;  2N3S A;  5M3M H;  2ZJQ A;  2R7Z G;  1XMQ Q;  3CCU A;  4L5R C;  4JI8 L;  2E2H H;  1Q12 A;  1P16 A;  3UE0 A;  3B6Y A;  1KC8 C;  1B70 B;  1YBY A;  5DLQ E;  1I50 H;  3W1G A;  1JT8 A;  2BH8 A;  4YCU A;  3DLL A;  3M7N A;  4JYA L;  4IPH A;  4FDB A;  3BJU A;  2R93 H;  2VL6 A;  1A63 A;  4C2M H;  5IWA L;  1YEZ A;  3CCQ A;  4A3E H;  3MXN B;  4JI1 Q;  2QA4 A;  3U58 A;  3H3V I;  4DR3 L;  4LFB Q;  4OO1 G;  3SGI A;  5FJ8 G;  1HZ9 A;  1W2B A;  1QZH A;  1CKM A;  1RL2 A;  1TWA H;  1WCM G;  3CF5 A;  2NZO A;  1K0R A;  4A3J G;  2E5L Q;  2F3I A;  1Q82 C;  5C3E G;  1NBW A;  1VQB A;  5M5Y H;  2YV5 A;  3KJO A;  2WB1 E;  1I94 Q;  4BY1 H;  4OX9 L;  4KHZ A;  2R6G A;  1KXL A;  5HY6 A;  2VUM G;  3T1Y L;  4JBK A;  3I4N G;  4IJH A;  3UE1 A;  4R4T A;  1ASY A;  4X6A H;  1VQN A;  3J81 j;  2AMC B;  2EQS A;  1K8G A;  5ELN A;  1PA6 A;  2NN6 I;  1VQC A;  4GNX A;  4LF4 L;  1IYJ B;  5IY0 A;  1E1T A;  4NPS A;  3HKZ E;  4QL5 A;  3HOW H;  3CCR A;  2UXB L;  4DKA C;  2KEN A;  1EWI A;  2B29 A;  3TS0 A;  3PF4 A;  4MTN A;  4DV3 L;  3KDF A;  1GVP A;  3G6E A;  3PGZ A;  2QGQ A;  1E22 A;  5BR8 L;  3UDI A;  3KF6 A;  3OTO L;  1O7I A;  1K3R A;  3TS2 A;  3ULP A;  2UUC L;  2JA6 H;  4BY7 H;  2RCN A;  4GKK L;  1BBU A;  3FKI G;  4YY3 Q;  1KL9 A;  1B7Y B;  4X64 Q;  3PUX A;  1S72 A;  4RMF A;  3HFZ B;  1MJC A;  2E2J H;  4LF6 L;  2ZM6 L;  4A3L G;  1A0I A;  1VCI A;  5LMU L;  4P72 A;  2R7Z H;  3UDF A;  4PG3 A;  3U4V A;  1SLJ A;  2EIF A;  1H95 A;  4GN5 A;  4JI5 L;  5IYD G;  2C35 B;  4HJ9 A;  2HHH L;  2BA1 A;  1AE3 A;  3JAM c;  4JC0 A;  4LFA Q;  2LSS A;  3TRZ A;  3EBE A;  2K4K A;  1XMO L;  1WI5 A;  1CUK A;  4OON A;  4B3T L;  1NMF A;  1RIP A;  3CPF A;  1VQJ A;  2MO0 A;  4IJL A;  4QIW E;  4IPG A;  5FJ8 H;  2K75 A;  5GAG C;  3CC7 A;  1IBL L;  2R92 G;  4P75 A;  2I5H A;  4HIM A;  4B3M L;  4LF7 Q;  2UXD L;  1WCM H;  1WOC A;  3ERS X;  4A3J H;  1E1O A;  2YYZ A;  4OWX B;  2K5H A;  1MJE A;  5C3E H;  2IX1 A;  3NEM A;  2NVY H;  5M5W H;  3J80 c;  1A8V A;  1VQO A;  1XPO A;  5IT9 c;  4JI7 L;  4NXM L;  2VUM H;  3I4N H;  2OCE A;  1SRO A;  2UXC L;  4IOC A;  1QUQ A;  1N36 Q;  3T1H L;  4JV5 L;  1OXX K;  3CD6 A;  1HZA A;  2UU9 Q;  4JI4 L;  5M3F G;  1YNX A;  4DR2 Q;  2YU9 H;  2ALY B;  2CWA A;  2JJQ A;  3STB D;  4DR5 Q;  2WAQ E;  3HKS A;  2HT1 A;  2WFW A;  2AWO A;  3F8T A;  4BA2 I;  1VQE A;  3M9B A;  1Y1W G;  3CC4 A;  4DV5 L;  1ASZ A;  4JI3 Q;  2ZJP A;  1FJG Q;  1YJN A;  2PI2 E;  3NEN A;  2E2I H;  4K0K Q;  3FKI H;  2UUA L;  3CCL A;  3RZO H;  2NN6 G;  1SFO H;  4DR6 Q;  4DUZ Q;  3UDG A;  1J6Q A;  3EIV A;  4A3L H;  1D8L A;  3CPW A;  3PO3 G;  1JJC B;  2AWN A;  3GTQ H;  4DR1 Q;  5IYD H;  1YJ9 A;  1IXR A;  4DV0 Q;  5LMN Q;  2A1A A;  1OXT A;  1EIY B;  2ATW A;  1X3F A;  3G48 A;  3I4O A;  3K8A A;  2DGY A;  2OQ0 A;  5K36 G;  3G71 A;  3PV0 A;  3GTL H;  1X9N A;  4JOI A;  2VQE L;  4LUZ A;  3RN5 A;  5C4J H;  4X66 L;  3HOY G;  1HNX Q;  3S1M H;  4JI6 Q;  1HNZ L;  4UPA A;  2A8V A;  1BKB A;  1M90 C;  5AJ3 L;  1X6O A;  3K7A H;  3GDE A;  3OW2 A;  3J81 c;  2JE6 I;  1JB7 A;  3I7F A;  2R92 H;  4DV7 L;  2N49 A;  1Q7Y C;  1L0W A;  4A3K G;  1EIF A;  2CFM A;  1VQL A;  1XNQ Q;  4A75 A;  1FGU A;  1GO3 E;  2I5M X;  3PIO A;  2XGT A;  3VDY A;  4KHP L;  4APV A;  1EYG A;  4JYA Q;  5IYC G;  1UWV A;  2LXJ A;  1XPR A;  4ME3 A;  1N8R C;  1JMC A;  5IWA Q;  4R4O A;  2KCT A;  4A3C G;  2ASB A;  1VQ9 A;  3H3V H;  3LGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...