3V96A

Complex of matrix metalloproteinase-10 catalytic domain (mmp-10cd) with tissue inhibitor of metalloproteinases-1 (timp-1)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
178
structure length
164
Chain Sequence
CTCVPPHPQTAFCNSDLVIRAKFVQTTLYQRYEIKMTKMYKGFIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Metalloproteinase inhibitor 1
publication title Matrix metalloproteinase-10 (MMP-10) interaction with tissue inhibitors of metalloproteinases TIMP-1 and TIMP-2: binding studies and crystal structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 164
sequence length 178
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3v96A02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 3v96A01
1BR9A 4FXKC 3HS0C 4FXGC 3V96A 3FRPB 1JC7A 3CU7A 1D2BA 3HRZC 2WINB 5FOBB 1PXUA 5FO8B 2TMPA 3OHXC 3CKIB 2ICEC 3T4AC 5JPNC 2QKIC 5FO7B 2B39A 3L3OC 2A73B 3MA2B 3G6JB 2J0TD 2I07B 2E2DC 1BUVT 4ILWA 1UEAB 1BQQT 5FO9B 1JB3A 1GXDC 1UAPA 5JPMC 1OO9B 2WIIB 2XWBB 2XWJB 3KLSA 2A74C 1XWEA 3I70A
chains in the Genus database with same CATH superfamily
3V96A 4DV0Q 5IGCA 2EPBA 5JJZA 1O78A 4RA8A 4POGA 2A73B 4KHZA 2K75A 4RH6A 3CF5A 2NN6I 2F0HA 5EPKA 1PRTB 4BS9A 5FLXL 4LF7Q 1SRUA 5CMDA 3MTSA 3GP7A 4KKSA 5CBAE 5KYLA 2WIIB 1YI2A 1FNVA 2P5ZX 1SLJA 1IBLQ 5C4XB 5ELNA 3A74A 4NPSA 3PIPA 2XVSA 1NSNS 3CU7A 2RDFA 4DV5L 1WVLA 2K5DA 3L7ZC 3OSOA 2AQ1B 1VQ6A 2D62A 4A75A 4C56C 4IFDI 3KBGA 5DEHA 1AP0A 1DOMA 1PFBA 1W6JA 3GTMH 2KEDA 2F0JA 4CDEC 1L1OA 1S3OA 2F0IA 2L55A 3CCSA 2EY5A 4EX5A 5KEEA 3HKZG 1ONLA 2ZTDA 1BNZA 1SEBD 1PH5A 1I50H 3A55A 2Q8IB 2RHSB 3KF6B 3CKIB 3HP3A 4EQPA 1PFMA 1Q7YC 2RQXA 2VB2X 4RGNA 1YNNC 3B6YA 5JJLA 1Y1VH 4POFA 2V4DA 1TY2A 2RCFA 3P20A 2KUMA 1MJCA 2M00A 3H94A 2A1AA 1ENFA 5CYUA 1M8AA 2VB3X 3HKZB 3T1YL 4A3FG 2N3SA 2WV6D 1M90C 4LFCL 1EWIA 2FXQA 1E2ZA 4GOPB 2Z6KA 1YNJD 1J5EL 1I94L 3GV3A 5D65A 3C3LA 3S2HH 1X6OA 1D5XC 3L3OC 3FPPA 3GQBA 5M5XH 4K5XA 1VQNA 4V0BA 3T53B 5ELFA 2F0VA 1NMGA 1Q3LA 4JOIA 1FNUA 5C4ZA 5AFWA 1X3QA 2XWJB 1VQ9A 4DV1Q 1YZ6A 5M5YB 1TS4A 4A3FB 3NTHA 4JBWA 5IP9G 1ILPA 2UUBQ 1YHQA 2NWGA 2WFWA 3S1NH 1EQTA 2ICIA 4A3KG 3S14B 1D7QA 4QB4A 4MIUA 3QWNA 1M1KC 4DR3L 5IYDH 1PLFA 2BE5C 4DUZL 3J81j 1IKLA 1CKNB 2NB0A 2XRQD 3D31A 2AKWB 3GTQB 4YCWA 2E2IH 4IUNA 2HIXA 1VQ7A 4LAAA 2ATWA 1L0WA 2DJGC 1S5BD 3D6WA 4DR4Q 2Q2HA 2R93G 5ELDA 1IXRA 1C48A 3X3NA 4DUYL 4JI7Q 4A3KB 5FK9C 1AH9A 2QW7A 1VQCA 2YU9B 3D4RA 3G71A 1LO5D 2GA4B 4I7AA 1DOKA 3RMHA 5A35A 4L5SA 4OGQC 1SXTA 2F1MA 4XYOA 1PTOH 3C2PA 5E4WC 3UDIA 4AYBG 5D3DA 1SNPA 2QA4A 2R93B 1ASZA 2A6ED 3PUZA 2F0KA 2E74C 3CCVA 1WCMH 1SMXA 3ICEA 3F2BA 2F3VA 2E75C 3RUZA 1TWGH 3MXNA 5M3MG 2KCCA 4ZK9B 2XNAC 2I07B 3OW7A 2D2CC 4JI8Q 1TU2B 3S1RH 2CKZB 2I0QA 4LF4L 1PFSA 3TREA 4AYBB 1UE5A 5CV8A 2M9VA 1Z9FA 1F2YA 1CA6A 1L0YB 2HT1A 2BE5D 3K0YA 2NZOA 2VQFL 1Y8PB 3R2IA 2UXBQ 3OWFA 1EUJA 2JQOA 4ME3A 3TP5A 2ZJPA 1S72A 5T1GA 5M3MB 4Q0FA 2B63G 1SNMA 4BBSG 1OXSC 2MO1A 4P71A 3RNUA 3W2DA 5I2XA 5GAEC 2SEBD 3CD6A 1G91A 1VQBA 2IW3A 2FMCA 2MPMA 1B44D 2NVXH 5LL6S 3FKIH 4ZRZA 1S5ED 1S5DD 4OXPA 1MKHA 3KLWA 2HHHQ 3HGBA 1BBXC 5EAYA 3J80c 1XPOA 4NW2A 1KHIA 1NAPA 3I70A 4FXGC 3Q0AA 2AHOB 4XXEA 2B63B 2JJQA 5M5WB 4BBSB 1BCPD 1TR5A 3K0XA 1TWFH 1VQPA 5CR3A 1IL8A 1L1OB 3PUWA 4H44C 3NXWA 1E2WA 1Q1BA 3SXHA 1MSHA 1QUQA 4IALA 4FP5D 5M3FH 2LFNA 1OXTA 3K7AB 1TWAH 3AYHB 2KQ3A 3M4PA 4RCOA 3QOJA 4XIGS 3EFXD 1STBA 1Y1WH 2HDMA 2KJXA 4KY5A 3A7AB 4OWTB 1U4RA 3IRBA 3TRZA 3G7LA 1VQFA 2JXMB 1BUVT 4K6LA 4Z9CB 4B3ML 4ILWA 3NENA 3N6RA 2N88A 3RLFA 4K0KL 1UAPA 4LF5L 5J22A 3JAMc 1NE3A 2A68C 3J81L 2E2JB 4N8X1 1GKHA 2I46A 2L4NA 4IPHA 5G3LF 4DK3C 1QG7A 4GLAC 4B3RQ 3OHXC 3HOWG 3QR8A 1HR0L 3HOXH 2XSCA 2EYMA 1HCZA 5BN4A 1LTBD 4DV6Q 4GNXA 1RIPA 2B2YA 3F2DA 2OXPA 3SVMA 4FF2A 4PZ6A 1H95A 2Z4IA 4XQJA 5IYCH 1U9RA 4DV2Q 4M8AA 2KENA 3BJUA 5ELEA 1B7YB 2ZXRA 2JSOA 4G7HC 5EPLA 2PZWA 2KHJA 2G9HD 3RR5A 1PH9A 5KRUA 5KNDA 3T51B 3HOWB 3GD7A 3I91A 1Q46A 3EQLC 1C8CA 4R4TA 3T4AC 1PRTD 4KLKA 2F0PA 4GOPC 1EIYB 2OQKA 3RN5A 2PMZB 4KN7C 2RSNA 3FPUB 2M2LA 4NKLA 5TSSA 3I3CA 3K5LA 4DR1Q 1W2BA 4OWXB 3J80i 1GUOA 3RZDB 1U4PA 3PO3H 1N32Q 1I3QH 2A6HD 5IGEA 2VQEQ 5DM63 2Z8LA 4GKJL 1D2BA 1ZYRD 3D6CA 1CQVA 4HIMA 2MGSA 3KLRA 5C5MA 1MBYA 5IP7G 4A93G 1JWSD 1Y8OB 1WTWA 2F52A 2UXDL 5EKIA 1OO9B 1HUMA 3D0FA 1HR0W 2DUDA 5LMUL 1XMOL 4TQUS 2JA5H 3I4NH 3DWQA 1B3QA 1G2SA 3GTGB 4OELB 1VQMA 1B70B 1Q12A 4KHPL 3KK7A 4GN5A 1QWYA 1V8QA 3JC66 4A3MG 1SMYC 3NBHA 1XNQL 2ASBA 1CM9A 4QUCA 1EQQA 2JA7G 4A93B 4QY7A 4DU9A 1YIJA 2HCCA 2PQAA 4DFAA 4AH6A 1SE8A 5CV7A 2LMCB 2PNHA 1HQRD 4LFBQ 1JJGA 1B4OA 2SNSA 4P72A 1NJIC 3ZJYC 3HOYG 1STHA 1EWCA 2XTIA 5A2QE 3DM3A 4A3MB 4K5WA 3S16B 2JA7B 4C3HH 3SEBA 1BF4A 3MHBA 3NP8A 5HY6A 4FO2A 3WOEA 1E1OA 3CAMA 2VNUD 1N34L 1PTOF 4X3KA 1CA5A 4L6TB 3GTPH 4IPGA 4IJLA 3HOYB 4JYAL 4CJ0B 1VQ8A 3OOCA 1HJPA 3TP8A 2NVTH 5ISRA 1SNOA 4YY3L 3D3RA 4TRDA 2KVMA 2EYOA 3P75A 2HQLA 3BYYB 3NELA 1DONA 5E3FA 5C4JH 2E8GA 2NZHA 5IT9L 4KD4A 4LF8L 2CVRA 2NVYH 2AMCB 3S1MH 3C1EA 4X62L 3VDYA 2NYZD 2XIWA 3FRPB 3J7YW 1T5EA 3GTKH 1O7ZA 3Q8DA 1KC8C 1EU4A 2UUCQ 4DAPA 4DR5Q 5KNCA 3MFYA 4JI3Q 1LT6D 4A3DH 5LMNQ 1L0XB 3OTOQ 2JA8H 5GROA 2YTVA 3J7AF 2ALYB 1L1OC 2HDLA 4EVOA 3CCRA 1Y1VG 3HOUH 3GTMB 1G291 1PH4A 1VF5C 2UUAL 3CC2A 3U9OA 3TP7A 2YTYA 1NBWA 1HNZL 2EY2A 4PV1C 5C44H 1I50B 1EY7A 1YEZA 5J39A 4JI6L 4HN7A 1HTLD 1X3EA 4DK1A 3BS1A 1I94Q 1E3PA 1HZ9A 1U4LA 1Y1VB 2LKVA 5GAGC 2G5DA 3PGZA 1EYAA 4LF9Q 1BKBA 2AWOA 1SFOH 4HMIA 1RTOA 1PVOA 4RKLA 3R93A 1K0RA 4RGMA 2IX1A 3BG3A 1QILA 3E5SA 1N33L 2Z6KC 5M9OA 5BN5A 1JQYD 3Q6SA 1A3UA 4JG2A 5EKLA 1SYDA 4HCSA 2JE6I 3W1GA 5IYDG 3S2HB 1EFWA 4DR3Q 4DF7A 5M5XB 4G4KA 1KIXA 2K50A 1IZ6A 2C5CA 2K1BA 2RCNA 4YHHL 1SSOA 4HSVA 2RSOA 4NXMQ 3S1QH 5I4DA 1XTDA 4GLVB 2B8GA 2Q2IA 2EYHA 4MTKA 1H9SA 3P1HA 5JPNC 3PIP3 4IZ8A 4JI0L 2PZUA 4B3TL 3MXUA 1TY0A 4L63B 3S1NB 1LABA 2IT1A 3WDNA 1VF7A 1SR3A 4H02A 1GHJA 4LJZC 4DK6C 5HURA 5E4XA 4DR6Q 2E2IB 1B8AA 2WKCA 3BVZA 3HKSA 5AJ3L 3NBHB 3Q24A 4S3SA 5K5PA 3SHLA 5KYIA 1KRSA 3OWEB 2JEAI 1XXGA 1JOOA 1T5XD 4BA2I 3CCMA 2PQAB 1RCVD 3T1HQ 1CQFA 1WCMG 4R9WA 2JN4A 4LK1C 3UE0A 1HQMC 4KKUA 5J1ZA 4HSPA 1E0BA 4NP5A 1C4QA 4R4QA 5GQOA 1IBKQ 1FVIA 3IFTA 5JEAH 1ZEQX 4JI2L 1PTOB 4DXGA 2K5QA 5NUCA 4LNQA 4LW1A 1PXUA 1CZGA 1SNDA 2KEEA 4F7XA 4X65Q 3DEPA 2ZM6L 2VQFQ 2K05A 1WCMB 4IUQA 4WJ3M 1X3PA 4WORA 1EEID 4CDFC 1TWGB 1D5ZC 1KAAA 1MGSA 4DR2L 1UWVA 3C1FA 2NZ1D 1LACA 2RDGA 4FF3A 4HJ7A 3S1RB 5EGTA 5COYA 3UDFA 1GUNA 1JICA 3BDLA 4DAVA 1FJGQ 1AE2A 3FKIG 1AW7A 4H0LC 3H3VH 1Q1EA 1H9RA 3M7GA 3D4WA 3SGIA 1FYCA 3KF8A 2PYKA 5K36H 5DLQE 2KBNA 4A3EH 2CQAA 1UEAB 5ELOA 1ML0D 2PQEA 3NK9A 5DNFA 2EJMA 4BY1G 1F2ZA 3VR5A 4CDCC 2VXWA 4AQYL 4WFN3 4C2MH 2NVXB 1CFMA 4JCVE 4CDDC 4DV7L 3OYYA 3FKIB 2EXZA 3HOVH 4K8JA 5IYBH 1BBUA 4R4CA 1EFID 5M3FG 4KN4C 2FJ2A 2KECA 3E9IA 3EA6A 1XMQQ 1MI2A 1SDFA 4HIDA 3IL8A 4BY1B 2HD3A 1SJED 4JI1Q 3GTOH 1PH1A 1Y1WG 1JB3A 1SYFA 1TWFB 4R8NA 2RA4A 1ICWA 4RGOS 2RKSA 5E7NA 1HNXQ 2YTXA 4FDBA 4X3UA 3CCUA 1P8LA 4K6DA 1C7YA 3HZXA 1I4HA 4B9XA 5M3FB 2EJGC 3A56A 4UP8A 2UXCL 2R61A 1TWAB 5EJWA 2E5LQ 3S15H 4EQ5A 1N8RC 2OT2A 3G48A 1SYBA 3ULPA 2XGTA 1Y1WB 3BZKA 3A8KE 4C3IH 3HOXG 1I4XA 3NE5B 1Q8IA 4EQNA 3T16A 4X6AH 3W1BA 5HGQA 4DV4Q 2F4VL 2MFIA 4DV3Q 2JA9A 4WJWA 5C6AA 3F1ZA 1PZJD 1JE4A 5C3EH 5IYCG 2TMPA 1NCVA 3UI2A 1OTCA 4OHJA 2F3IA 1FGUA 2WAQE 4GNXC 3HOXB 5FO9B 2H4OA 2B2YC 1Q86C 1IW7C 3NQIA 2NBFA 4C1NI 1N36L 4JI4L 3KYHC 1KD1C 1VQEA 1YNND 4HEDA 2R92H 1YVCA 5D14A 1Q8KA 5LL6X 3W3AA 3J80L 1H9SB 1X56A 4JC0A 3Q22A 2KA7A 5JEAJ 4P73A 1BO0A 3PO3G 1WTPA 1PDQA 3GV6A 4BXXH 1F9RA 1QCBD 5IWAQ 2J0TD 4PMBA 3CQZH 1WTXA 2O4XA 5LMNW 1Y14B 3OIQA 4X64Q 1GJXA 2RVLA 4HJAA 4DXFA 2UU9L 2Z0SA 1ENCA 1BDOA 3K58A 3O13A 2X69A 3STBC 3OIPA 2K01A 3PO2H 2I5HA 4JV5L 1I4GA 5FO8B 1YJ9A 5T1IA 1V1OA 1VQAA 3PCOB 4UHVA 3PO3B 2PW5A 1CZWA 1H9MA 1I3QB 2F0QA 2JA5G 5FLXE 3I4NG 1B2TA 1DJRD 3ITPA 4KD3A 2K4KA 1HZAA 2D0OA 5IIFA 2EZVA 4HR7B 4PQXA 4FF4A 3CMEA 4GLXA 2X6GA 1V43A 3JAML 1GD7A 2JYOA 2K5WA 4FXDA 2F0NA 4A3LG 1STGA 1SYGA 4LF6L 3HRZC 4J6HA 2R7ZH 4O42A 3LGJA 2JA5B 4QMGA 3I4NB 1NY4A 1PYBA 1VQGA 3H6MA 1F2LA 3MXGA 1RL2A 3TMEA 5C4XH 3FMCA 4GKKL 1XTCD 1BQQT 2O5IC 2FFKB 4C3HG 2EYJA 4YWLA 4CKBA 3DWPA 1A3VA 4DV0L 1QB5D 5BR8Q 2BA1A 3HG9A 1YHAA 4XT3B 4PZ8A 4QIWE 1EYGA 4OX9Q 3ND8A 3T13A 3KJOA 4LF7L 4I65A 2ENBA 4RHRA 1PMRA 5IGGA 1EYCA 4A4IA 1K9MC 4IURA 1E2VA 3BU2A 1YITA 1PTOC 1IBLL 2E76C 3K5OA 5J3BA 1D6EC 3MC0B 2K5HA 3BZDB 4BBRH 2NUCA 4C3HB 2Z1CA 1VS0A 3I2ZA 1I4QA 1A3TA 3S2DH 5HGTA 2JK8A 2R3ZA 1O7LA 3GTPB 1HNWL 1DCZA 1IYVA 4UP9A 2AWNA 1G6ZA 4K2KA 2RBMA 2D0PA 3VR3A 3CP0A 4UAIA 1BVSA 2ZXPA 3E0EA 4DN4M 4X62Q 4JVZA 4OIJA 2L0CA 2EYLA 4ZAIA 2NVTB 4B3SL 2BH8A 1KDBA 3PUYA 5L37A 3BVMA 3VR4A 3VA7A 3A7LA 3HOZH 3TEHB 4HJ5A 3AMUA 1TKWB 2PI2E 1WFQA 2KCMA 1FD7D 3KDFA 5C4JB 2VY3A 5IGBA 4A3JH 1QZGA 4A3DG 1JORA 2NVYB 2JA8G 1L2FA 3DXJC 2AQ2B 3NQTA 2D5DA 3HOUG 2H5XA 2IL8A 2NTTA 3AQQA 3N52A 4XTCS 2UUAQ 2FMMA 2N49A 3GTKB 1ESFA 2F0GA 1XNRQ 1HRJA 4QJFA 4HIKA 1QE6A 5JVG3 3FEWX 2L5TA 2B2UA 1PTOD 2RF4A 1D1KA 5C44G 4A3DB 2QDLA 2JA8B 1EY8A 3FDTA 2LS01 2C35B 1EY0A 1HFNA 4N9TA 2V1CC 3HOUB 2EYFA 4DV1L 1EY9A 3TS0A 4LFAL 3ND9A 1MSGA 2A19A 3MA2B 4O0AA 3VA5A 2UUBL 1KNAA 4A3IH 2Z9HA 5GAHC 3CW2C 2EIFA 1X65A 3RZOH 1GVPA 4A3BH 5C44B 1S5CD 3U4ZA 1EIFA 1TWCH 3J7ZC 5DM73 1MHWC 1GM5A 2F3WA 1K83H 1TVXA 3I4LA 4HJ8A 4DR4L 2A68D 3QOLA 1R9TH 1SFOB 2K7VA 4YHHQ 3K7UC 2FINB 4IQZA 4CJ1B 4JI7L 2CH4A 1EIGA 1SE2A 1F9PA 2WACA 4DKAC 2OF1A 4DR7Q 4ABNA 4B3TQ 1WTOA 3MAQA 2C9OA 1AFPA 1YJNA 1EEFD 2Q8RE 1PH3A 2Y0SE 1QOHA 1X54A 4J8QA 1G2TA 4NB3A 2KHSA 3MXNB 5C3WA 3TDQA 2LY7A 2QEJC 4X66L 3S1QB 3R2TA 3W5OA 4O1NA 1I4PA 1G51A 1GUTA 2GVBA 5FLMH 1EOTA 1B3AA 1CK1A 2EVBA 1PH2A 4JI8L 1PFNA 1E1TA 1SAPA 4TVAB 1JE5A 2ZT9C 4FXKC 4IN3A 2WB1G 4JI5Q 1XX8A 2PO4A 3I90A 4L5QA 1MIUA 2VW9A 3U50C 2F0TA 4PZ7A 4YCUA 3DEOA 1DOLA 2BA0A 1R4QB 3K5NA 2UXBL 4JI2Q 2VS1A 4MTNA 1R4PB 2DNCA 3SK6A 3M4YA 3ULJA 3PIOA 1J6QA 3DMUA 5EQ0A 4RKBA 1FR3A 2BOSA 4G57A 1KLGD 2HIVA 2L1BA 1IKMA 1JJ2A 4A3CH 2WB1B 5H1SE 4RHSA 1HHVA 3R3OA 1AZQA 1S5FD 1LT5D 4QQBX 5FJ8H 4DNIA 3GTLH 3PUXA 1W6KA 3P7JA 2HHHL 4A3GH 2K33A 2F0UA 2QGQA 3QJYA 4J15A 3V2TA 3J81E 3I7FA 4XQNA 1QUQB 1JWMD 4WRDA 4DV5Q 4RGTA 5K36G 1ET6A 1SMYD 2I5LX 4J1MA 1ZKOA 2PNRC 2B8FA 1PRTF 2K6AA 4A3EG 1GUWA 2R6GA 4CJ2C 4JBKA 3TZDA 3K57A 1G6PA 2F0SA 4NDXA 2Q2TA 3OMCA 4IOCA 1RKNA 1X3FA 1U0LA 3HOVG 5EBCA 3SK8A 2IX3A 3M4OH 1ET9A 1WI5A 4HIOA 1LTAD 1PYWD 4MZ9A 3TSSA 3MEHA 5C3XA 3ERQA 3H91A 4NMZA 2AUJD 3GO5A 1VQLA 1LYLA 4IPDA 4A3EB 2EQSA 4X3SA 2EY6A 3RD4A 4UY8C 2OQ0A 4CKEA 5LHY1 1CTMA 3I55A 1EU3A 4C2MB 4BA1I 4R1JA 3KF6A 3PV0A 2SOBA 2BDOA 4GNXB 3T1YQ 3HOVB 3I72A 1CSQA 3J81i 1JJCB 4LFCQ 1KQSA 4KMUC 3EN2A 4PMCA 1HA5A 3U9SA 4B3RL 3TN2A 2IWHA 5E1FA 1CSPA 1TWHH 3I4MH 1J5EQ 2A69C 4Y7NH 4CBVA 3IFDA 4DV6L 4P2CB 1KAWA 1A6XA 3GTOB 3AFPA 1KNEA 4C3IG 3S9WA 5FOBB 1TIID 4DV2L 1HA6A 2JP1A 1S4ZA 5FO7B 4R4OA 5GADC 3A8JE 4HCEA 5C3EG 2ZJQA 3C46A 1TS5A 1DM0B 3KBXA 3KJPA 3S15B 4DUZQ 4H7BA 3PF4A 4C1NK 1NTGA 3OW2A 4C3IB 1UEBA 3J7A5 3EVQA 2IY5B 4DR1L 1B9NA 3SE0A 1F9SA 1Z7TA 2DJFC 2K5VA 4OL7A 2F0LA 1AE3A 2B2WC 3S17H 1N32L 2B2TA 2R92G 5C3EB 2IHFA 4H13C 2VQEL 2JA6H 3MZ5A 2N8NA 1CHQD 1K3BC 4DUYQ 1YHBA 1Z47A 2F4IA 2BH2A 4XQQA 3FVQA 3EJIA 1SBBB 4BXXG 5IY0A 3L9AX 1JMCA 1NMFA 3TZUA 1HXYD 3CPFA 2QF7A 1STNA 1O7YA 1EZ6A 3HS0C 1K0SA 1QJOA 5D3IB 2CW0C 3E9HA 2B2VC 3LWUA 3I56A 1ICFB 2R92B 1JWUD 1VQDA 3A8IE 4DPGA 3PO2G 1E7ZA 4RAUC 3LNNA 4IPCA 2IHEA 1JOQA 4FVMA 5CORA 1F77A 5I9PA 2A5HA 4M1UB 1QVGA 1RTNA 4RMFA 2F0DA 1IYUA 3CQZB 3FHWA 2XRSD 4MNOA 2IJ0A 2E2HH 4LF4Q 1RODA 4IUUA 1KLUD 3UDGA 3TBIB 2SNMA 4LFBL 3AEVA 1XJVA 1LTGD 1KABA 3U4VA 3G4SA 3PO2B 5IT9E 3G6JB 5FKAC 5CV5A 4KTAA 3CCLA 3J7AV 2R7ZG 1QNUA 4K2LA 5ELCA 1LTLA 5KNBA 4OO1H 1LT4D 1YNXA 1W3SA 2EJFC 4K8IA 4ZLTF 5CBEE 5C4XG 4HMJA 2B29A 4GKKQ 3NWSA 4I7ZC 2H1EA 1HZBA 1WTHA 5DAUA 3EBEA 2ID0A 4OONA 2MJ8A 4UP7A 3A0JA 2XN9C 4UPAA 4KV6A 4YIJA 3WWVA 5KGUA 3K80C 2JEBI 1G8ZD 2R7ZB 1Q90A 1TS3A 1YNJC 2CW0D 4L8JA 2CQOA 1RD9D 2EY1A 3S24A 4QUFA 1U4MA 1AEXA 3FP9A 4BBRG 3KUPA 5IGFA 2HCIA 4Y52H 1EY6A 4OWWB 3BYTB 1EWHA 2F0MA 4BY7H 1HNWQ 1V1QA 1EIHA 1NNXA 1SROA 4YCVA 3VYRA 3MEFA 2UUCL 4DR5L 3M7NA 1Y8NB 4BBRB 1TS2A 4B3SQ 1RF2D 4JI3L 5CV9A 5IOCA 1MJEA 3MFGA 1Q82C 1EY5A 4B3MQ 5LMNL 5CV4A 3HOZG 4KJNA 3OTOL 3S2DB 3GDEA 2CFMA 3HKZE 1IHZA 1RJTA 4LF5Q 4K0KQ 3ER0A 1J8IA 2HQEA 2B39A 2CCZA 4A3JG 4UDUC 2NVQH 1STAA 1SJHD 2L9HA 1HZCA 2PI2A 3PF5A 1QVFA 1HR0Q 2DY7A 1PZKD 3H3VC 1IBML 2VZAA 4ODGA 3BDCA 2OTJA 1DD2A 3HOZB 1DGSA 1F9QA 1XYIA 2A6EC 4C3JH 2B2WA 1KDAA 4ZQ3A 5FLXc 1WTQA 4A3JB 2WAQG 4LF9L 1X55A 3VR2A 1E24A 3TQYA 2EE1A 2BCOA 3F8TA 1PH8A 4GZYC 2RHQB 4OEMB 1F2MA 4TSSA 3QO2A 2VUMH 4LFAQ 1TXYA 2B2UC 4A3IG 3F2UA 1OXUA 2F0WA 5C0XH 1EQRA 4A3BG 1KTKA 4ZKCB 1D5MC 1A2UA 1Z6HA 4YWKA 4FF1A 2PCFB 1K8OA 2B2VA 2WAQB 1PA6A 1DXMA 4HTHA 3M3YH 3GTJH 1UE1A 1I6HH 1VMCA 2TSSA 3NHHA 3ZYYX 2F03A 4NXML 4GKJQ 3NPPA 1LM0A 4R4IA 5JPMC 1LV9A 1EY4A 4RCNA 3KLSA 5C4HA 4A3IB 2WP8J 4ZUJA 1BBWA 3H0GH 3RZOB 4PMWA 1KL9A 4A3BB 1I6VC 2F0EA 2PW7A 1WJJA 1UE7A 4LUVA 2UXDQ 1TWCB 2J7ZA 3CCEA 1XPUA 2D9UA 5LMUQ 1XMOQ 3SK4A 4DR6L 1X32A 4MN3A 2MP1A 5G3LD 4KK7A 1K83B 4B08A 2NN6H 4KHPQ 4KY6A 1MD2D 4NXNL 1VCIA 2EYPA 1R9TB 1BCPC 5KIXA 1XNQQ 1JCKB 4X66Q 1HH2P 3E6ZX 4AYBE 3T1HL 5BN3A 4XT1B 2KHIA 5FLMG 3H15A 2LXJA 1HTPA 2OEOA 1B1ZA 3CCQA 1IW7D 2ES2A 4DAYA 1STYA 4IFDH 2L11A 1VMPA 4QL5A 5F2DA 1IBKL 3DWAA 1EOVA 1JB7A 3ONAB 2K14A 4IOAA 1WYDA 4X65L 1A0IA 2Q2UA 2DGYA 3NTKA 4F87A 2IX0A 4GN4B 1SE3A 4ULLA 1VQJA 2GN5A 1LTID 1N34Q 4DNRB 4V190 5C5LA 3KF8B 2CWPA 4N8FA 1LTSD 1ZXTA 1SN8A 2R7FA 3A5ZB 3E0JA 4CKCA 3CCJA 1WTRA 3VYTA 3M4QA 1ESRA 4A3CG 2K04A 4JYAQ 1UNSA 4RWSC 3STBD 1FJGL 2G9DA 1QVCA 3AFQA 1V1PA 1A8VA 3QG1A 4QIWB 3X3MA 5FJ8G 4YY3Q 4A3GG 1O7IA 3NTIA 3TP6A 1CKOA 4ALPA 1KXLA 5IODA 4IUTA 3VR6A 2QCPX 4BY1H 4LF8Q 4IUPA 1K28A 3DM1A 5A2QL 4KHVA 3NEMA 1LTRD 4RG1A 3OMGA 3K59A 4GS3A 3GTLB 2CHBD 4A3GB 2YV5A 2IPKD 2WKDA 1K73C 4P75A 1LTTD 1PRTC 3V05A 3A54A 1XMQL 1GHKA 1CKMA 4R8IA 2F0FA 4JI1L 2Z6BA 4K5VA 3A5UA 3S1MB 4K14A 4ID6A 5C0XJ 2QKIC 3PMFA 1HNXL 2A6HC 2E2DC 1A62A 5M5YH 2HUGA 4A3FH 1KRTA 4JBJA 1ZYRC 3IAYA 5JAVA 2EOTA 3HFZB 2ZTCA 3UE1A 1HNZQ 4O2DA 2XWBB 3L2PA 4RFBA 3SK5A 3J80E 3S14H 2E5LL 3M4OB 1O80A 3WOFA 2ZJRA 4JI6Q 3GTQH 1K8GA 2KCNA 4Q5VA 4N9PA 3LX0A 3PQIA 3I4MG 3RLNA 1FNWA 4DNTB 1SYEA 4DV4L 5I9OA 2BDNA 4DAMA 1ENAA 3BDOA 4DV3L 4L5TA 5IP9H 3I73A 1BXTA 2J4XA 4WJ4A 3CMAA 2QDBA 2K32A 3UDXA 4A3KH 1II3A 1N33Q 3RN2A 1KDCA 2PMZE 3AB9A 2MNAA 1SNCA 3H09A 4CGYB 3PIO3 2YU9H 1VQ5A 4HJ9A 5EKKA 1TWHB 4FNFA 3I4MB 2R7DA 3DHQA 3MXPA 4Y7NB 2K52A 2ICEC 2EDGA 5IE8A 1C0AA 1IL2A 3G6EA 2DY8A 1N9WA 2R93H 2CWAA 1PV4A 1YJWA 3EROA 1U5KA 5JOBA 4IFDJ 1EYDA 3JAME 2MO0A 1PHJA 1JOKA 4LUOA 2Y0SG 4ZYSA 2AUKA 4JI0Q 5IWAL 1T9HA 2QEXA 1LT3D 1BCPF 2JA6G 3TS2A 1PH6A 1A2TA 4X64L 1WD1A 3RLOA 4ZCKA 4MHEA 2GVAA 4JPBW 4BWGB 3KLSX 5JJKA 3LWEA 3R8BA 3NUCA 3KOJA 3VYUA 3Q23A 1NR4A 5EBDA 2B2TC 5AJ3Q 3J81c 3DLLA 1VQ4A 1XPRA 4DGZA 2Y0SB 3S17B 1Q81C 3AU7A 2JA6B 1K3RA 5M3MH 4PNYA 3URYA 4XDXA 1S40A 4KI0A 1ILQA 1FL0A 2O5JC 2DN8A 2K28A 2WINB 4DAYB 4F88A 3EIVA 3F2CA 3U58A 3M85A 1DYQA 5JEAG 4A3LH 1NR2A 2LSSA 3JAMi 4AIMA 4ZUIA 2N78A 4PG3A 3BZCA 1FGBD 2B63H 5JJIA 2ZM6Q 4CHTB 5M5WH 4BBSH 2K5NA 1X3GA 4XYQA 1A63A 4LUZA 1BR9A 4U673 2N55A 2RDHA 4OO1G 4JK1C 4DR2Q 1B9MA 2WB1E 1B50A 5BR8L 5I6WA 3VYSA 1V1PB 2E2HB 4OX9L 1EQVA 3T56B 1J9OA 1K8MA 3IKJA 2OWOA 1VQOA 3BVGA 3K7AH 4DK0A 4HAEA 3SR1A 2SDFA 1IYJB 1SE4A 1VQHA 5CV6A 4IJHA 3K5MA 1GUSA 3NSWA 4E6IA 1RHPA 2MHVA 4ME5A 1DZ1A 5CC4A 2LXKA 1JC7A 4KY7A 4IUVA 1Y69U 1X9NA 3MWYW 3E3XA 4G7ZC 5ELBA 1AN8A 4AQYQ 3M9BA 1WTVA 2Q8TA 3D4DA 2A8VA 1UE6A 2X6LA 4DV7Q 1QZHA 2E2JH 1K8AC 2CH4W 1GUGA 1NUCA 4DA2A 5IYBG 3NBIA 4OO1I 2ZXOA 1V9PA 2L15A 3MVVA 4BY7G 1PZID 3KDFB 4L5RC 3K6OA 3I8ZA 3CC7A 1B53A 2OTLA 3H3VI 1D1IA 3SDZA 1TT2A 2QILA 1YBYA 1LLRD 4X3TA 1PYSB 2OCEA 3CPWA 1AZPA 2PPBC 3HEJA 1P16A 1D8LA 2KOLA 4BY7B 1JT8A 2F0OA 3HOWH 1CT1D 3DUZA 4A76A 2UXCQ 1HFGA 5EPJA 4LMQD 2L12A 1C9OA 1M4VA 1I5FA 5JVH3 1XNRL 4EGVA 1SNQA 3K81C 1IBMQ 3PUVA 2FHTA 1CI3M 2MUYA 4GOPA 4G7OC 2F4VQ 3RZDH 2I5MX 2B3GA 4APVA 1OXVA 1EZ8A 4U68A 4C3JG 4JBMA 3CRLC 2NVQB 1OXXK 1ASYA 4ZKBB 1VDZA 4GN3B 1E22A 4TKOB 1VQKA 1RDPD 3KFUA 5I6YA 2VUMG 4B9WA 2K03A 1N36Q 4JI4Q 5IT9c 1BCPB 3I4OA 3CHBD 5C0XG 1GO3E 1CKNA 3GTGH 2NTSA 4OIKA 1HUNA 4JOIC 3L0OA 4C3JB 1BOSA 2EXDA 1GOZA 3QB3A 4EQOA 4KJOA 1A15A 4FYDA 2KCTA 4QCLA 2A74C 3NWTA 1XWEA 1WD0A 1PH7A 4A93H 5IP7H 1EL0A 1SYCA 2DNEA 3ERSX 2VUMB 1WOCA 1STEA 1LUZA 2UU9Q 1HPCA 4QGUA 4DR7L 3CRKC 2A69D 3H0GG 2VL6A 3CC4A 1VQIA 4KKTA 1CHPD 3PSIA 1UUPA 4JV5Q 4LWCA 1QNKA 1TQOA 2PZTA 1GXDC 3M3YB 4F8MA 3GTJB 3D8GA 4A3MH 3ULLA 3S16H 4P74A 1I6HB 2JA7H 1CUKA 5CGKA 2NN6G 2Z4HA 5IGDA 4YWMA 3K8AA 5C0XI 4NXNQ 1H9KA 2O2LD 3QIAA 3H0GB 2AQ3B 1I4RA 4JW0A 3HOYH 4JI5L 4LF6Q 3OPOA 3CXCA 4IO9A 4QF4A 2MQHA 2YYZA 4IFDG 1JR0D 1H9JA 2ZTEA 5I2YA
chains in the Genus database with same CATH topology
3V96A 5IGCA 2EPBA 5JJZA 1O78A 4RA8A 2A73B 4KHZA 4RH6A 2NN6I 2F0HA 5EPKA 1PRTB 4BS9A 5FLXL 5CMDA 3MTSA 3GP7A 4KKSA 5CBAE 5KYLA 2WIIB 1FNVA 5C4XB 2XVSA 1NSNS 3CU7A 2RDFA 1WVLA 2K5DA 3L7ZC 3OSOA 2AQ1B 2D62A 4C56C 4IFDI 3KBGA 5DEHA 1AP0A 1DOMA 1PFBA 1W6JA 2KEDA 2F0JA 2F0IA 2L55A 2EY5A 5KEEA 1ONLA 1BNZA 1SEBD 3A55A 2Q8IB 3CKIB 3HP3A 4EQPA 1PFMA 2RQXA 2VB2X 4RGNA 1YNNC 2V4DA 1TY2A 3P20A 2KUMA 2M00A 3H94A 1ENFA 5CYUA 1M8AA 2VB3X 3HKZB 2WV6D 1E2ZA 1YNJD 3GV3A 5D65A 3C3LA 1D5XC 3L3OC 3FPPA 3GQBA 4K5XA 4V0BA 3T53B 5ELFA 2F0VA 1Q3LA 1FNUA 5C4ZA 5AFWA 1X3QA 2XWJB 5M5YB 1TS4A 4A3FB 3NTHA 4JBWA 1ILPA 2NWGA 1EQTA 2ICIA 3S14B 4QB4A 4MIUA 3QWNA 1PLFA 2BE5C 1IKLA 2NB0A 2XRQD 3D31A 3GTQB 4IUNA 4LAAA 1S5BD 3D6WA 5ELDA 1C48A 3X3NA 4A3KB 5FK9C 2YU9B 3D4RA 1LO5D 2GA4B 1DOKA 3RMHA 5A35A 4OGQC 1SXTA 2F1MA 4XYOA 1PTOH 3C2PA 5E4WC 5D3DA 1SNPA 2R93B 2A6ED 3PUZA 2F0KA 2E74C 2F3VA 2E75C 3RUZA 3MXNA 2KCCA 4ZK9B 2XNAC 2I07B 3OW7A 2D2CC 1TU2B 4AYBB 5CV8A 2M9VA 1F2YA 1CA6A 1L0YB 2BE5D 3K0YA 1Y8PB 3R2IA 3OWFA 3TP5A 5T1GA 5M3MB 4Q0FA 1SNMA 1OXSC 3W2DA 5I2XA 2SEBD 1G91A 2IW3A 2FMCA 2MPMA 1B44D 5LL6S 4ZRZA 1S5ED 1S5DD 3HGBA 1BBXC 4NW2A 1NAPA 3I70A 4FXGC 3Q0AA 4XXEA 2B63B 5M5WB 4BBSB 1BCPD 1TR5A 5CR3A 1IL8A 3PUWA 4H44C 3NXWA 1E2WA 1Q1BA 3SXHA 1MSHA 4IALA 4FP5D 2LFNA 1OXTA 3K7AB 2KQ3A 4RCOA 3QOJA 4XIGS 3EFXD 1STBA 2HDMA 2KJXA 4KY5A 3A7AB 1U4RA 3G7LA 2JXMB 1BUVT 4K6LA 4Z9CB 4ILWA 3N6RA 2N88A 3RLFA 1UAPA 5J22A 2A68C 3J81L 2E2JB 2I46A 2L4NA 5G3LF 1QG7A 3OHXC 2XSCA 2EYMA 1HCZA 5BN4A 1LTBD 2B2YA 2OXPA 3SVMA 4FF2A 2Z4IA 4XQJA 1U9RA 4M8AA 5ELEA 4G7HC 2ZXRA 2JSOA 5EPLA 2PZWA 2G9HD 5KRUA 5KNDA 3T51B 3HOWB 3GD7A 3I91A 3EQLC 1C8CA 3T4AC 1PRTD 2F0PA 2PMZB 4KN7C 2RSNA 3FPUB 2M2LA 4NKLA 5TSSA 3I3CA 3K5LA 1GUOA 3RZDB 1U4PA 2A6HD 5IGEA 5DM63 2Z8LA 1D2BA 1ZYRD 3D6CA 1CQVA 2MGSA 3KLRA 5C5MA 1MBYA 1JWSD 1Y8OB 1WTWA 5EKIA 1OO9B 1HUMA 4TQUS 3DWQA 1G2SA 3GTGB 1Q12A 3KK7A 1QWYA 1V8QA 1SMYC 3NBHA 1CM9A 4QUCA 4A93B 4DU9A 2HCCA 4DFAA 5CV7A 2LMCB 1HQRD 1B4OA 2SNSA 1STHA 1EWCA 5A2QE 4A3MB 4K5WA 3S16B 2JA7B 1BF4A 3SEBA 3MHBA 3NP8A 4FO2A 3WOEA 2VNUD 1PTOF 4X3KA 1CA5A 4L6TB 3HOYB 4CJ0B 3OOCA 3TP8A 5ISRA 1SNOA 3D3RA 4TRDA 2KVMA 2EYOA 3P75A 3BYYB 1DONA 5E3FA 5IT9L 4KD4A 2CVRA 3C1EA 2NYZD 2XIWA 3FRPB 3J7YW 1T5EA 1O7ZA 1EU4A 4DAPA 5KNCA 3MFYA 1LT6D 1L0XB 3J7AF 2HDLA 4EVOA 3GTMB 1G291 1VF5C 3U9OA 3TP7A 2EY2A 4PV1C 1I50B 1EY7A 5J39A 4HN7A 1HTLD 4DK1A 3BS1A 1U4LA 1Y1VB 2LKVA 1EYAA 2AWOA 4HMIA 1RTOA 4RKLA 3R93A 4RGMA 2IX1A 3BG3A 1QILA 3E5SA 5M9OA 5BN5A 1JQYD 3Q6SA 1A3UA 5EKLA 1SYDA 4HCSA 2JE6I 3S2HB 4DF7A 5M5XB 4G4KA 2C5CA 2K1BA 1SSOA 4HSVA 2RSOA 5I4DA 2B8GA 2EYHA 1H9SA 3P1HA 5JPNC 3PIP3 4IZ8A 2PZUA 3MXUA 1TY0A 4L63B 3S1NB 1LABA 2IT1A 3WDNA 1VF7A 1GHJA 4LJZC 5HURA 5E4XA 2E2IB 2WKCA 3BVZA 3Q24A 4S3SA 5K5PA 3SHLA 5KYIA 3OWEB 2JEAI 1XXGA 1JOOA 1T5XD 4BA2I 1RCVD 1CQFA 4R9WA 4LK1C 1HQMC 4KKUA 5J1ZA 4HSPA 1E0BA 4NP5A 1C4QA 3IFTA 5JEAH 1ZEQX 1PTOB 4DXGA 2K5QA 5NUCA 1PXUA 1CZGA 1SNDA 2KEEA 4F7XA 3DEPA 2K05A 1WCMB 4IUQA 1X3PA 4WORA 1EEID 1TWGB 1D5ZC 1KAAA 1MGSA 3C1FA 2NZ1D 1LACA 2RDGA 4FF3A 3S1RB 5EGTA 5COYA 1GUNA 1JICA 3BDLA 4DAVA 1AW7A 4H0LC 1Q1EA 1H9RA 3M7GA 3D4WA 1FYCA 3KF8A 2PYKA 5K36H 2CQAA 1UEAB 1ML0D 2PQEA 3NK9A 5DNFA 2EJMA 3VR5A 1F2ZA 2VXWA 4WFN3 2NVXB 1CFMA 3FKIB 2EXZA 4K8JA 1EFID 4KN4C 2FJ2A 2KECA 3EA6A 1MI2A 1SDFA 3IL8A 4BY1B 1SJED 1JB3A 1SYFA 1TWFB 4R8NA 2RA4A 1ICWA 4RGOS 2RKSA 4X3UA 4K6DA 3HZXA 1I4HA 4B9XA 5M3FB 2EJGC 3A56A 2R61A 1TWAB 5EJWA 2OT2A 1SYBA 1Y1WB 3A8KE 1I4XA 3NE5B 1Q8IA 4EQNA 3T16A 4WJWA 5C6AA 1PZJD 1JE4A 2TMPA 1NCVA 3UI2A 4OHJA 3HOXB 5FO9B 2H4OA 2B2YC 1IW7C 3NQIA 2NBFA 4C1NI 1YNND 4HEDA 5D14A 5LL6X 3W3AA 3J80L 1H9SB 3Q22A 2KA7A 5JEAJ 1BO0A 1WTPA 1PDQA 3GV6A 1F9RA 1QCBD 2J0TD 4PMBA 1WTXA 2O4XA 3OIQA 1GJXA 2RVLA 4DXFA 1ENCA 1BDOA 3K58A 3O13A 2X69A 3OIPA 2K01A 1I4GA 5FO8B 5T1IA 1V1OA 3PO3B 2PW5A 1CZWA 1H9MA 1I3QB 2F0QA 5FLXE 1B2TA 1DJRD 3ITPA 4KD3A 5IIFA 2EZVA 4HR7B 4PQXA 4FF4A 2X6GA 1V43A 3JAML 2JYOA 2K5WA 4FXDA 2F0NA 1STGA 1SYGA 3HRZC 4J6HA 4O42A 2JA5B 4QMGA 3I4NB 3H6MA 1F2LA 3MXGA 3TMEA 3FMCA 1XTCD 1BQQT 2O5IC 2FFKB 4C3HG 2EYJA 4CKBA 3DWPA 1A3VA 1QB5D 2BA1A 3HG9A 4XT3B 3ND8A 3T13A 4I65A 2ENBA 4RHRA 1PMRA 5IGGA 1EYCA 4IURA 1E2VA 1PTOC 2E76C 3K5OA 1D6EC 3MC0B 3BZDB 2NUCA 4C3HB 2Z1CA 1I4QA 1A3TA 5HGTA 2R3ZA 1O7LA 3GTPB 1IYVA 1DCZA 2AWNA 1G6ZA 4K2KA 2RBMA 3VR3A 4UAIA 2ZXPA 4DN4M 4OIJA 2L0CA 2EYLA 4ZAIA 2NVTB 1KDBA 3PUYA 3BVMA 3VR4A 3VA7A 3A7LA 3AMUA 1TKWB 1FD7D 5C4JB 5IGBA 1JORA 2NVYB 3DXJC 2AQ2B 3NQTA 2D5DA 2IL8A 2NTTA 3N52A 4XTCS 2FMMA 3GTKB 1ESFA 2F0GA 1HRJA 1QE6A 5JVG3 3FEWX 2L5TA 2B2UA 1PTOD 1D1KA 4A3DB 2JA8B 1EY8A 3FDTA 2LS01 1EY0A 1HFNA 4N9TA 3HOUB 2EYFA 1EY9A 3ND9A 1MSGA 3MA2B 3VA5A 1KNAA 5C44B 1S5CD 5DM73 2F3WA 1TVXA 3I4LA 2A68D 3QOLA 1SFOB 2K7VA 2FINB 4IQZA 4CJ1B 1EIGA 1SE2A 1F9PA 2WACA 2OF1A 4ABNA 1WTOA 3MAQA 2C9OA 1AFPA 1EEFD 2Q8RE 1QOHA 4J8QA 1G2TA 2KHSA 5C3WA 3TDQA 2LY7A 2QEJC 3S1QB 3R2TA 4O1NA 1I4PA 1GUTA 1EOTA 1B3AA 1CK1A 2EVBA 1PFNA 1SAPA 2ZT9C 4FXKC 4IN3A 1XX8A 2PO4A 3I90A 2F0TA 3DEOA 1DOLA 2BA0A 1R4QB 3K5NA 1R4PB 2DNCA 3SK6A 3M4YA 3DMUA 5EQ0A 4RKBA 1FR3A 2BOSA 4G57A 1KLGD 2L1BA 1IKMA 2WB1B 4RHSA 1HHVA 3R3OA 1AZQA 1S5FD 1LT5D 3PUXA 1W6KA 3P7JA 2K33A 2F0UA 3QJYA 3V2TA 3J81E 4XQNA 1JWMD 4WRDA 4RGTA 5K36G 1ET6A 1SMYD 4J1MA 1ZKOA 2PNRC 2B8FA 1PRTF 2K6AA 1GUWA 2R6GA 4CJ2C 3TZDA 3K57A 2F0SA 4NDXA 3OMCA 1RKNA 5EBCA 3SK8A 2IX3A 1ET9A 1LTAD 1PYWD 3TSSA 3MEHA 5C3XA 3ERQA 3H91A 4NMZA 2AUJD 3GO5A 4A3EB 4X3SA 2EY6A 3RD4A 4CKEA 5LHY1 1CTMA 1EU3A 4C2MB 4BA1I 3PV0A 2SOBA 2BDOA 3HOVB 3I72A 4KMUC 4PMCA 1HA5A 3U9SA 3TN2A 2IWHA 5E1FA 2A69C 4CBVA 3IFDA 4P2CB 1A6XA 3GTOB 1KNEA 4C3IG 3S9WA 5FOBB 1TIID 1HA6A 2JP1A 1S4ZA 5FO7B 3A8JE 4HCEA 3C46A 1TS5A 1DM0B 3KBXA 3S15B 4H7BA 4C1NK 4C3IB 3EVQA 1B9NA 3SE0A 1F9SA 1Z7TA 4OL7A 2F0LA 2B2WC 2B2TA 5C3EB 4H13C 3MZ5A 1CHQD 1Z47A 2F4IA 4XQQA 3FVQA 3EJIA 1SBBB 3L9AX 3TZUA 1HXYD 2QF7A 1STNA 1O7YA 1EZ6A 3HS0C 1QJOA 5D3IB 2CW0C 2B2VC 3LWUA 2R92B 1JWUD 3A8IE 4RAUC 3LNNA 1JOQA 4FVMA 5CORA 1F77A 5I9PA 2A5HA 4M1UB 1RTNA 2F0DA 1IYUA 3CQZB 2XRSD 2IJ0A 1RODA 4IUUA 1KLUD 3TBIB 2SNMA 1LTGD 1KABA 3PO2B 5IT9E 3G6JB 5FKAC 5CV5A 4KTAA 3J7AV 1QNUA 4K2LA 5ELCA 5KNBA 4OO1H 1LT4D 2EJFC 4K8IA 4ZLTF 5CBEE 4HMJA 3NWSA 4I7ZC 2H1EA 5DAUA 2ID0A 2MJ8A 2XN9C 4KV6A 4YIJA 5KGUA 2JEBI 1G8ZD 2R7ZB 1Q90A 1TS3A 1YNJC 2CW0D 4L8JA 1RD9D 2EY1A 4QUFA 1U4MA 1AEXA 3KUPA 5IGFA 2HCIA 1EY6A 3BYTB 1EWHA 2F0MA 1EIHA 3VYRA 3M7NA 1Y8NB 4BBRB 1TS2A 1RF2D 5CV9A 5IOCA 3MFGA 1EY5A 5CV4A 4KJNA 3S2DB 1IHZA 1RJTA 1J8IA 2HQEA 2B39A 4UDUC 1STAA 1SJHD 2L9HA 2DY7A 1PZKD 3H3VC 4ODGA 3BDCA 1DD2A 3HOZB 1F9QA 1XYIA 2A6EC 2B2WA 1KDAA 4ZQ3A 1WTQA 4A3JB 3VR2A 2EE1A 2BCOA 4GZYC 1F2MA 4TSSA 3QO2A 2B2UC 3F2UA 1OXUA 2F0WA 5C0XH 1KTKA 4ZKCB 1D5MC 1A2UA 1Z6HA 4FF1A 2PCFB 1K8OA 2B2VA 2WAQB 1DXMA 4HTHA 1VMCA 2TSSA 3NHHA 3ZYYX 2F03A 3NPPA 5JPMC 1LV9A 1EY4A 4RCNA 3KLSA 5C4HA 4A3IB 2WP8J 4ZUJA 3RZOB 4PMWA 4A3BB 1I6VC 2F0EA 2PW7A 1TWCB 2J7ZA 2D9UA 3SK4A 1X32A 4MN3A 2MP1A 5G3LD 4KK7A 1K83B 4B08A 2NN6H 4KY6A 1MD2D 1VCIA 2EYPA 1R9TB 1BCPC 5KIXA 1JCKB 3E6ZX 5BN3A 4XT1B 1HTPA 2OEOA 1B1ZA 1IW7D 4DAYA 1STYA 4IFDH 2L11A 1VMPA 5F2DA 3DWAA 3ONAB 3NTKA 4F87A 2IX0A 1SE3A 4ULLA 1LTID 4DNRB 4V190 5C5LA 1LTSD 1ZXTA 3E0JA 4CKCA 1WTRA 3VYTA 1ESRA 2K04A 1UNSA 4RWSC 2G9DA 1V1PA 3QG1A 4QIWB 3X3MA 3NTIA 3TP6A 5IODA 4IUTA 3VR6A 2QCPX 4IUPA 3DM1A 5A2QL 4KHVA 1LTRD 3OMGA 3K59A 3GTLB 2CHBD 4A3GB 2IPKD 2WKDA 1LTTD 1PRTC 3V05A 3A54A 1GHKA 4R8IA 2F0FA 4K5VA 3S1MB 4K14A 4ID6A 5C0XJ 2QKIC 3PMFA 2A6HC 2E2DC 2HUGA 1ZYRC 3IAYA 5JAVA 2EOTA 2XWBB 4RFBA 3SK5A 3J80E 3M4OB 1O80A 3WOFA 2KCNA 4Q5VA 4N9PA 3LX0A 1FNWA 4DNTB 1SYEA 5I9OA 2BDNA 1ENAA 3BDOA 3I73A 1BXTA 2J4XA 2QDBA 2K32A 1II3A 1KDCA 3AB9A 1SNCA 3H09A 4CGYB 3PIO3 5EKKA 1TWHB 4FNFA 3I4MB 3DHQA 3MXPA 4Y7NB 2ICEC 2EDGA 2DY8A 3EROA 5JOBA 4IFDJ 1EYDA 3JAME 1JOKA 4ZYSA 2AUKA 1LT3D 1BCPF 1A2TA 1WD1A 4MHEA 4BWGB 3KLSX 3LWEA 3R8BA 3NUCA 3VYUA 3Q23A 1NR4A 5EBDA 2B2TC 4DGZA 2Y0SB 3S17B 3AU7A 2JA6B 4PNYA 3URYA 4XDXA 4KI0A 1ILQA 2O5JC 2DN8A 2K28A 2WINB 4F88A 3M85A 1DYQA 5JEAG 1NR2A 4ZUIA 1FGBD 4CHTB 4XYQA 1BR9A 4U673 2N55A 2RDHA 4OO1G 4JK1C 1B9MA 1B50A 5I6WA 3VYSA 1V1PB 2E2HB 3T56B 1EQVA 1J9OA 1K8MA 3IKJA 3BVGA 4DK0A 3SR1A 4HAEA 2SDFA 1SE4A 5CV6A 3K5MA 1GUSA 3NSWA 4E6IA 1RHPA 2MHVA 4ME5A 1DZ1A 5CC4A 1JC7A 4KY7A 4IUVA 1Y69U 3MWYW 4G7ZC 5ELBA 1AN8A 1WTVA 2Q8TA 3D4DA 2X6LA 1GUGA 1NUCA 4DA2A 3NBIA 4OO1I 2ZXOA 3MVVA 1PZID 3K6OA 3I8ZA 1B53A 1D1IA 3SDZA 1TT2A 2QILA 1LLRD 4X3TA 1AZPA 2PPBC 3HEJA 2KOLA 4BY7B 2F0OA 1CT1D 3DUZA 1HFGA 5EPJA 4LMQD 2L12A 1M4VA 5JVH3 4EGVA 1SNQA 3PUVA 2FHTA 1CI3M 2MUYA 4G7OC 1OXVA 1EZ8A 4U68A 4C3JG 3CRLC 2NVQB 1OXXK 4ZKBB 1VDZA 4TKOB 1RDPD 5I6YA 4B9WA 2K03A 1BCPB 3CHBD 5C0XG 2NTSA 4OIKA 1HUNA 4C3JB 1BOSA 1GOZA 3QB3A 4EQOA 4KJOA 1A15A 4FYDA 4QCLA 2A74C 3NWTA 1XWEA 1WD0A 1EL0A 1SYCA 2DNEA 2VUMB 1STEA 1HPCA 3CRKC 2A69D 4KKTA 1CHPD 1UUPA 1QNKA 1TQOA 2PZTA 1GXDC 3M3YB 4F8MA 3GTJB 3D8GA 1I6HB 5CGKA 2NN6G 2Z4HA 5IGDA 5C0XI 1H9KA 2O2LD 3QIAA 3H0GB 2AQ3B 1I4RA 3OPOA 4QF4A 2YYZA 4IFDG 1JR0D 1H9JA 5I2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BR9 A;  4FXK C;  3HS0 C;  4FXG C;  3V96 A;  3FRP B;  1JC7 A;  3CU7 A;  1D2B A;  3HRZ C;  2WIN B;  5FOB B;  1PXU A;  5FO8 B;  2TMP A;  3OHX C;  3CKI B;  2ICE C;  3T4A C;  5JPN C;  2QKI C;  5FO7 B;  2B39 A;  3L3O C;  2A73 B;  3MA2 B;  3G6J B;  2J0T D;  2I07 B;  2E2D C;  1BUV T;  4ILW A;  1UEA B;  1BQQ T;  5FO9 B;  1JB3 A;  1GXD C;  1UAP A;  5JPM C;  1OO9 B;  2WII B;  2XWB B;  2XWJ B;  3KLS A;  2A74 C;  1XWE A;  3I70 A; 
#chains in the Genus database with same CATH topology
 3V96 A;  4DV0 Q;  5IGC A;  2EPB A;  5JJZ A;  1O78 A;  4RA8 A;  4POG A;  2A73 B;  4KHZ A;  2K75 A;  4RH6 A;  3CF5 A;  2NN6 I;  2F0H A;  5EPK A;  1PRT B;  4BS9 A;  5FLX L;  4LF7 Q;  1SRU A;  5CMD A;  3MTS A;  3GP7 A;  4KKS A;  5CBA E;  5KYL A;  2WII B;  1YI2 A;  1FNV A;  2P5Z X;  1SLJ A;  1IBL Q;  5C4X B;  5ELN A;  3A74 A;  4NPS A;  3PIP A;  2XVS A;  1NSN S;  3CU7 A;  2RDF A;  4DV5 L;  1WVL A;  2K5D A;  3L7Z C;  3OSO A;  2AQ1 B;  1VQ6 A;  2D62 A;  4A75 A;  4C56 C;  4IFD I;  3KBG A;  5DEH A;  1AP0 A;  1DOM A;  1PFB A;  1W6J A;  3GTM H;  2KED A;  2F0J A;  4CDE C;  1L1O A;  1S3O A;  2F0I A;  2L55 A;  3CCS A;  2EY5 A;  4EX5 A;  5KEE A;  3HKZ G;  1ONL A;  2ZTD A;  1BNZ A;  1SEB D;  1PH5 A;  1I50 H;  3A55 A;  2Q8I B;  2RHS B;  3KF6 B;  3CKI B;  3HP3 A;  4EQP A;  1PFM A;  1Q7Y C;  2RQX A;  2VB2 X;  4RGN A;  1YNN C;  3B6Y A;  5JJL A;  1Y1V H;  4POF A;  2V4D A;  1TY2 A;  2RCF A;  3P20 A;  2KUM A;  1MJC A;  2M00 A;  3H94 A;  2A1A A;  1ENF A;  5CYU A;  1M8A A;  2VB3 X;  3HKZ B;  3T1Y L;  4A3F G;  2N3S A;  2WV6 D;  1M90 C;  4LFC L;  1EWI A;  2FXQ A;  1E2Z A;  4GOP B;  2Z6K A;  1YNJ D;  1J5E L;  1I94 L;  3GV3 A;  5D65 A;  3C3L A;  3S2H H;  1X6O A;  1D5X C;  3L3O C;  3FPP A;  3GQB A;  5M5X H;  4K5X A;  1VQN A;  4V0B A;  3T53 B;  5ELF A;  2F0V A;  1NMG A;  1Q3L A;  4JOI A;  1FNU A;  5C4Z A;  5AFW A;  1X3Q A;  2XWJ B;  1VQ9 A;  4DV1 Q;  1YZ6 A;  5M5Y B;  1TS4 A;  4A3F B;  3NTH A;  4JBW A;  5IP9 G;  1ILP A;  2UUB Q;  1YHQ A;  2NWG A;  2WFW A;  3S1N H;  1EQT A;  2ICI A;  4A3K G;  3S14 B;  1D7Q A;  4QB4 A;  4MIU A;  3QWN A;  1M1K C;  4DR3 L;  5IYD H;  1PLF A;  2BE5 C;  4DUZ L;  3J81 j;  1IKL A;  1CKN B;  2NB0 A;  2XRQ D;  3D31 A;  2AKW B;  3GTQ B;  4YCW A;  2E2I H;  4IUN A;  2HIX A;  1VQ7 A;  4LAA A;  2ATW A;  1L0W A;  2DJG C;  1S5B D;  3D6W A;  4DR4 Q;  2Q2H A;  2R93 G;  5ELD A;  1IXR A;  1C48 A;  3X3N A;  4DUY L;  4JI7 Q;  4A3K B;  5FK9 C;  1AH9 A;  2QW7 A;  1VQC A;  2YU9 B;  3D4R A;  3G71 A;  1LO5 D;  2GA4 B;  4I7A A;  1DOK A;  3RMH A;  5A35 A;  4L5S A;  4OGQ C;  1SXT A;  2F1M A;  4XYO A;  1PTO H;  3C2P A;  5E4W C;  3UDI A;  4AYB G;  5D3D A;  1SNP A;  2QA4 A;  2R93 B;  1ASZ A;  2A6E D;  3PUZ A;  2F0K A;  2E74 C;  3CCV A;  1WCM H;  1SMX A;  3ICE A;  3F2B A;  2F3V A;  2E75 C;  3RUZ A;  1TWG H;  3MXN A;  5M3M G;  2KCC A;  4ZK9 B;  2XNA C;  2I07 B;  3OW7 A;  2D2C C;  4JI8 Q;  1TU2 B;  3S1R H;  2CKZ B;  2I0Q A;  4LF4 L;  1PFS A;  3TRE A;  4AYB B;  1UE5 A;  5CV8 A;  2M9V A;  1Z9F A;  1F2Y A;  1CA6 A;  1L0Y B;  2HT1 A;  2BE5 D;  3K0Y A;  2NZO A;  2VQF L;  1Y8P B;  3R2I A;  2UXB Q;  3OWF A;  1EUJ A;  2JQO A;  4ME3 A;  3TP5 A;  2ZJP A;  1S72 A;  5T1G A;  5M3M B;  4Q0F A;  2B63 G;  1SNM A;  4BBS G;  1OXS C;  2MO1 A;  4P71 A;  3RNU A;  3W2D A;  5I2X A;  5GAE C;  2SEB D;  3CD6 A;  1G91 A;  1VQB A;  2IW3 A;  2FMC A;  2MPM A;  1B44 D;  2NVX H;  5LL6 S;  3FKI H;  4ZRZ A;  1S5E D;  1S5D D;  4OXP A;  1MKH A;  3KLW A;  2HHH Q;  3HGB A;  1BBX C;  5EAY A;  3J80 c;  1XPO A;  4NW2 A;  1KHI A;  1NAP A;  3I70 A;  4FXG C;  3Q0A A;  2AHO B;  4XXE A;  2B63 B;  2JJQ A;  5M5W B;  4BBS B;  1BCP D;  1TR5 A;  3K0X A;  1TWF H;  1VQP A;  5CR3 A;  1IL8 A;  1L1O B;  3PUW A;  4H44 C;  3NXW A;  1E2W A;  1Q1B A;  3SXH A;  1MSH A;  1QUQ A;  4IAL A;  4FP5 D;  5M3F H;  2LFN A;  1OXT A;  3K7A B;  1TWA H;  3AYH B;  2KQ3 A;  3M4P A;  4RCO A;  3QOJ A;  4XIG S;  3EFX D;  1STB A;  1Y1W H;  2HDM A;  2KJX A;  4KY5 A;  3A7A B;  4OWT B;  1U4R A;  3IRB A;  3TRZ A;  3G7L A;  1VQF A;  2JXM B;  1BUV T;  4K6L A;  4Z9C B;  4B3M L;  4ILW A;  3NEN A;  3N6R A;  2N88 A;  3RLF A;  4K0K L;  1UAP A;  4LF5 L;  5J22 A;  3JAM c;  1NE3 A;  2A68 C;  3J81 L;  2E2J B;  4N8X 1;  1GKH A;  2I46 A;  2L4N A;  4IPH A;  5G3L F;  4DK3 C;  1QG7 A;  4GLA C;  4B3R Q;  3OHX C;  3HOW G;  3QR8 A;  1HR0 L;  3HOX H;  2XSC A;  2EYM A;  1HCZ A;  5BN4 A;  1LTB D;  4DV6 Q;  4GNX A;  1RIP A;  2B2Y A;  3F2D A;  2OXP A;  3SVM A;  4FF2 A;  4PZ6 A;  1H95 A;  2Z4I A;  4XQJ A;  5IYC H;  1U9R A;  4DV2 Q;  4M8A A;  2KEN A;  3BJU A;  5ELE A;  1B7Y B;  2ZXR A;  2JSO A;  4G7H C;  5EPL A;  2PZW A;  2KHJ A;  2G9H D;  3RR5 A;  1PH9 A;  5KRU A;  5KND A;  3T51 B;  3HOW B;  3GD7 A;  3I91 A;  1Q46 A;  3EQL C;  1C8C A;  4R4T A;  3T4A C;  1PRT D;  4KLK A;  2F0P A;  4GOP C;  1EIY B;  2OQK A;  3RN5 A;  2PMZ B;  4KN7 C;  2RSN A;  3FPU B;  2M2L A;  4NKL A;  5TSS A;  3I3C A;  3K5L A;  4DR1 Q;  1W2B A;  4OWX B;  3J80 i;  1GUO A;  3RZD B;  1U4P A;  3PO3 H;  1N32 Q;  1I3Q H;  2A6H D;  5IGE A;  2VQE Q;  5DM6 3;  2Z8L A;  4GKJ L;  1D2B A;  1ZYR D;  3D6C A;  1CQV A;  4HIM A;  2MGS A;  3KLR A;  5C5M A;  1MBY A;  5IP7 G;  4A93 G;  1JWS D;  1Y8O B;  1WTW A;  2F52 A;  2UXD L;  5EKI A;  1OO9 B;  1HUM A;  3D0F A;  1HR0 W;  2DUD A;  5LMU L;  1XMO L;  4TQU S;  2JA5 H;  3I4N H;  3DWQ A;  1B3Q A;  1G2S A;  3GTG B;  4OEL B;  1VQM A;  1B70 B;  1Q12 A;  4KHP L;  3KK7 A;  4GN5 A;  1QWY A;  1V8Q A;  3JC6 6;  4A3M G;  1SMY C;  3NBH A;  1XNQ L;  2ASB A;  1CM9 A;  4QUC A;  1EQQ A;  2JA7 G;  4A93 B;  4QY7 A;  4DU9 A;  1YIJ A;  2HCC A;  2PQA A;  4DFA A;  4AH6 A;  1SE8 A;  5CV7 A;  2LMC B;  2PNH A;  1HQR D;  4LFB Q;  1JJG A;  1B4O A;  2SNS A;  4P72 A;  1NJI C;  3ZJY C;  3HOY G;  1STH A;  1EWC A;  2XTI A;  5A2Q E;  3DM3 A;  4A3M B;  4K5W A;  3S16 B;  2JA7 B;  4C3H H;  3SEB A;  1BF4 A;  3MHB A;  3NP8 A;  5HY6 A;  4FO2 A;  3WOE A;  1E1O A;  3CAM A;  2VNU D;  1N34 L;  1PTO F;  4X3K A;  1CA5 A;  4L6T B;  3GTP H;  4IPG A;  4IJL A;  3HOY B;  4JYA L;  4CJ0 B;  1VQ8 A;  3OOC A;  1HJP A;  3TP8 A;  2NVT H;  5ISR A;  1SNO A;  4YY3 L;  3D3R A;  4TRD A;  2KVM A;  2EYO A;  3P75 A;  2HQL A;  3BYY B;  3NEL A;  1DON A;  5E3F A;  5C4J H;  2E8G A;  2NZH A;  5IT9 L;  4KD4 A;  4LF8 L;  2CVR A;  2NVY H;  2AMC B;  3S1M H;  3C1E A;  4X62 L;  3VDY A;  2NYZ D;  2XIW A;  3FRP B;  3J7Y W;  1T5E A;  3GTK H;  1O7Z A;  3Q8D A;  1KC8 C;  1EU4 A;  2UUC Q;  4DAP A;  4DR5 Q;  5KNC A;  3MFY A;  4JI3 Q;  1LT6 D;  4A3D H;  5LMN Q;  1L0X B;  3OTO Q;  2JA8 H;  5GRO A;  2YTV A;  3J7A F;  2ALY B;  1L1O C;  2HDL A;  4EVO A;  3CCR A;  1Y1V G;  3HOU H;  3GTM B;  1G29 1;  1PH4 A;  1VF5 C;  2UUA L;  3CC2 A;  3U9O A;  3TP7 A;  2YTY A;  1NBW A;  1HNZ L;  2EY2 A;  4PV1 C;  5C44 H;  1I50 B;  1EY7 A;  1YEZ A;  5J39 A;  4JI6 L;  4HN7 A;  1HTL D;  1X3E A;  4DK1 A;  3BS1 A;  1I94 Q;  1E3P A;  1HZ9 A;  1U4L A;  1Y1V B;  2LKV A;  5GAG C;  2G5D A;  3PGZ A;  1EYA A;  4LF9 Q;  1BKB A;  2AWO A;  1SFO H;  4HMI A;  1RTO A;  1PVO A;  4RKL A;  3R93 A;  1K0R A;  4RGM A;  2IX1 A;  3BG3 A;  1QIL A;  3E5S A;  1N33 L;  2Z6K C;  5M9O A;  5BN5 A;  1JQY D;  3Q6S A;  1A3U A;  4JG2 A;  5EKL A;  1SYD A;  4HCS A;  2JE6 I;  3W1G A;  5IYD G;  3S2H B;  1EFW A;  4DR3 Q;  4DF7 A;  5M5X B;  4G4K A;  1KIX A;  2K50 A;  1IZ6 A;  2C5C A;  2K1B A;  2RCN A;  4YHH L;  1SSO A;  4HSV A;  2RSO A;  4NXM Q;  3S1Q H;  5I4D A;  1XTD A;  4GLV B;  2B8G A;  2Q2I A;  2EYH A;  4MTK A;  1H9S A;  3P1H A;  5JPN C;  3PIP 3;  4IZ8 A;  4JI0 L;  2PZU A;  4B3T L;  3MXU A;  1TY0 A;  4L63 B;  3S1N B;  1LAB A;  2IT1 A;  3WDN A;  1VF7 A;  1SR3 A;  4H02 A;  1GHJ A;  4LJZ C;  4DK6 C;  5HUR A;  5E4X A;  4DR6 Q;  2E2I B;  1B8A A;  2WKC A;  3BVZ A;  3HKS A;  5AJ3 L;  3NBH B;  3Q24 A;  4S3S A;  5K5P A;  3SHL A;  5KYI A;  1KRS A;  3OWE B;  2JEA I;  1XXG A;  1JOO A;  1T5X D;  4BA2 I;  3CCM A;  2PQA B;  1RCV D;  3T1H Q;  1CQF A;  1WCM G;  4R9W A;  2JN4 A;  4LK1 C;  3UE0 A;  1HQM C;  4KKU A;  5J1Z A;  4HSP A;  1E0B A;  4NP5 A;  1C4Q A;  4R4Q A;  5GQO A;  1IBK Q;  1FVI A;  3IFT A;  5JEA H;  1ZEQ X;  4JI2 L;  1PTO B;  4DXG A;  2K5Q A;  5NUC A;  4LNQ A;  4LW1 A;  1PXU A;  1CZG A;  1SND A;  2KEE A;  4F7X A;  4X65 Q;  3DEP A;  2ZM6 L;  2VQF Q;  2K05 A;  1WCM B;  4IUQ A;  4WJ3 M;  1X3P A;  4WOR A;  1EEI D;  4CDF C;  1TWG B;  1D5Z C;  1KAA A;  1MGS A;  4DR2 L;  1UWV A;  3C1F A;  2NZ1 D;  1LAC A;  2RDG A;  4FF3 A;  4HJ7 A;  3S1R B;  5EGT A;  5COY A;  3UDF A;  1GUN A;  1JIC A;  3BDL A;  4DAV A;  1FJG Q;  1AE2 A;  3FKI G;  1AW7 A;  4H0L C;  3H3V H;  1Q1E A;  1H9R A;  3M7G A;  3D4W A;  3SGI A;  1FYC A;  3KF8 A;  2PYK A;  5K36 H;  5DLQ E;  2KBN A;  4A3E H;  2CQA A;  1UEA B;  5ELO A;  1ML0 D;  2PQE A;  3NK9 A;  5DNF A;  2EJM A;  4BY1 G;  1F2Z A;  3VR5 A;  4CDC C;  2VXW A;  4AQY L;  4WFN 3;  4C2M H;  2NVX B;  1CFM A;  4JCV E;  4CDD C;  4DV7 L;  3OYY A;  3FKI B;  2EXZ A;  3HOV H;  4K8J A;  5IYB H;  1BBU A;  4R4C A;  1EFI D;  5M3F G;  4KN4 C;  2FJ2 A;  2KEC A;  3E9I A;  3EA6 A;  1XMQ Q;  1MI2 A;  1SDF A;  4HID A;  3IL8 A;  4BY1 B;  2HD3 A;  1SJE D;  4JI1 Q;  3GTO H;  1PH1 A;  1Y1W G;  1JB3 A;  1SYF A;  1TWF B;  4R8N A;  2RA4 A;  1ICW A;  4RGO S;  2RKS A;  5E7N A;  1HNX Q;  2YTX A;  4FDB A;  4X3U A;  3CCU A;  1P8L A;  4K6D A;  1C7Y A;  3HZX A;  1I4H A;  4B9X A;  5M3F B;  2EJG C;  3A56 A;  4UP8 A;  2UXC L;  2R61 A;  1TWA B;  5EJW A;  2E5L Q;  3S15 H;  4EQ5 A;  1N8R C;  2OT2 A;  3G48 A;  1SYB A;  3ULP A;  2XGT A;  1Y1W B;  3BZK A;  3A8K E;  4C3I H;  3HOX G;  1I4X A;  3NE5 B;  1Q8I A;  4EQN A;  3T16 A;  4X6A H;  3W1B A;  5HGQ A;  4DV4 Q;  2F4V L;  2MFI A;  4DV3 Q;  2JA9 A;  4WJW A;  5C6A A;  3F1Z A;  1PZJ D;  1JE4 A;  5C3E H;  5IYC G;  2TMP A;  1NCV A;  3UI2 A;  1OTC A;  4OHJ A;  2F3I A;  1FGU A;  2WAQ E;  4GNX C;  3HOX B;  5FO9 B;  2H4O A;  2B2Y C;  1Q86 C;  1IW7 C;  3NQI A;  2NBF A;  4C1N I;  1N36 L;  4JI4 L;  3KYH C;  1KD1 C;  1VQE A;  1YNN D;  4HED A;  2R92 H;  1YVC A;  5D14 A;  1Q8K A;  5LL6 X;  3W3A A;  3J80 L;  1H9S B;  1X56 A;  4JC0 A;  3Q22 A;  2KA7 A;  5JEA J;  4P73 A;  1BO0 A;  3PO3 G;  1WTP A;  1PDQ A;  3GV6 A;  4BXX H;  1F9R A;  1QCB D;  5IWA Q;  2J0T D;  4PMB A;  3CQZ H;  1WTX A;  2O4X A;  5LMN W;  1Y14 B;  3OIQ A;  4X64 Q;  1GJX A;  2RVL A;  4HJA A;  4DXF A;  2UU9 L;  2Z0S A;  1ENC A;  1BDO A;  3K58 A;  3O13 A;  2X69 A;  3STB C;  3OIP A;  2K01 A;  3PO2 H;  2I5H A;  4JV5 L;  1I4G A;  5FO8 B;  1YJ9 A;  5T1I A;  1V1O A;  1VQA A;  3PCO B;  4UHV A;  3PO3 B;  2PW5 A;  1CZW A;  1H9M A;  1I3Q B;  2F0Q A;  2JA5 G;  5FLX E;  3I4N G;  1B2T A;  1DJR D;  3ITP A;  4KD3 A;  2K4K A;  1HZA A;  2D0O A;  5IIF A;  2EZV A;  4HR7 B;  4PQX A;  4FF4 A;  3CME A;  4GLX A;  2X6G A;  1V43 A;  3JAM L;  1GD7 A;  2JYO A;  2K5W A;  4FXD A;  2F0N A;  4A3L G;  1STG A;  1SYG A;  4LF6 L;  3HRZ C;  4J6H A;  2R7Z H;  4O42 A;  3LGJ A;  2JA5 B;  4QMG A;  3I4N B;  1NY4 A;  1PYB A;  1VQG A;  3H6M A;  1F2L A;  3MXG A;  1RL2 A;  3TME A;  5C4X H;  3FMC A;  4GKK L;  1XTC D;  1BQQ T;  2O5I C;  2FFK B;  4C3H G;  2EYJ A;  4YWL A;  4CKB A;  3DWP A;  1A3V A;  4DV0 L;  1QB5 D;  5BR8 Q;  2BA1 A;  3HG9 A;  1YHA A;  4XT3 B;  4PZ8 A;  4QIW E;  1EYG A;  4OX9 Q;  3ND8 A;  3T13 A;  3KJO A;  4LF7 L;  4I65 A;  2ENB A;  4RHR A;  1PMR A;  5IGG A;  1EYC A;  4A4I A;  1K9M C;  4IUR A;  1E2V A;  3BU2 A;  1YIT A;  1PTO C;  1IBL L;  2E76 C;  3K5O A;  5J3B A;  1D6E C;  3MC0 B;  2K5H A;  3BZD B;  4BBR H;  2NUC A;  4C3H B;  2Z1C A;  1VS0 A;  3I2Z A;  1I4Q A;  1A3T A;  3S2D H;  5HGT A;  2JK8 A;  2R3Z A;  1O7L A;  3GTP B;  1HNW L;  1DCZ A;  1IYV A;  4UP9 A;  2AWN A;  1G6Z A;  4K2K A;  2RBM A;  2D0P A;  3VR3 A;  3CP0 A;  4UAI A;  1BVS A;  2ZXP A;  3E0E A;  4DN4 M;  4X62 Q;  4JVZ A;  4OIJ A;  2L0C A;  2EYL A;  4ZAI A;  2NVT B;  4B3S L;  2BH8 A;  1KDB A;  3PUY A;  5L37 A;  3BVM A;  3VR4 A;  3VA7 A;  3A7L A;  3HOZ H;  3TEH B;  4HJ5 A;  3AMU A;  1TKW B;  2PI2 E;  1WFQ A;  2KCM A;  1FD7 D;  3KDF A;  5C4J B;  2VY3 A;  5IGB A;  4A3J H;  1QZG A;  4A3D G;  1JOR A;  2NVY B;  2JA8 G;  1L2F A;  3DXJ C;  2AQ2 B;  3NQT A;  2D5D A;  3HOU G;  2H5X A;  2IL8 A;  2NTT A;  3AQQ A;  3N52 A;  4XTC S;  2UUA Q;  2FMM A;  2N49 A;  3GTK B;  1ESF A;  2F0G A;  1XNR Q;  1HRJ A;  4QJF A;  4HIK A;  1QE6 A;  5JVG 3;  3FEW X;  2L5T A;  2B2U A;  1PTO D;  2RF4 A;  1D1K A;  5C44 G;  4A3D B;  2QDL A;  2JA8 B;  1EY8 A;  3FDT A;  2LS0 1;  2C35 B;  1EY0 A;  1HFN A;  4N9T A;  2V1C C;  3HOU B;  2EYF A;  4DV1 L;  1EY9 A;  3TS0 A;  4LFA L;  3ND9 A;  1MSG A;  2A19 A;  3MA2 B;  4O0A A;  3VA5 A;  2UUB L;  1KNA A;  4A3I H;  2Z9H A;  5GAH C;  3CW2 C;  2EIF A;  1X65 A;  3RZO H;  1GVP A;  4A3B H;  5C44 B;  1S5C D;  3U4Z A;  1EIF A;  1TWC H;  3J7Z C;  5DM7 3;  1MHW C;  1GM5 A;  2F3W A;  1K83 H;  1TVX A;  3I4L A;  4HJ8 A;  4DR4 L;  2A68 D;  3QOL A;  1R9T H;  1SFO B;  2K7V A;  4YHH Q;  3K7U C;  2FIN B;  4IQZ A;  4CJ1 B;  4JI7 L;  2CH4 A;  1EIG A;  1SE2 A;  1F9P A;  2WAC A;  4DKA C;  2OF1 A;  4DR7 Q;  4ABN A;  4B3T Q;  1WTO A;  3MAQ A;  2C9O A;  1AFP A;  1YJN A;  1EEF D;  2Q8R E;  1PH3 A;  2Y0S E;  1QOH A;  1X54 A;  4J8Q A;  1G2T A;  4NB3 A;  2KHS A;  3MXN B;  5C3W A;  3TDQ A;  2LY7 A;  2QEJ C;  4X66 L;  3S1Q B;  3R2T A;  3W5O A;  4O1N A;  1I4P A;  1G51 A;  1GUT A;  2GVB A;  5FLM H;  1EOT A;  1B3A A;  1CK1 A;  2EVB A;  1PH2 A;  4JI8 L;  1PFN A;  1E1T A;  1SAP A;  4TVA B;  1JE5 A;  2ZT9 C;  4FXK C;  4IN3 A;  2WB1 G;  4JI5 Q;  1XX8 A;  2PO4 A;  3I90 A;  4L5Q A;  1MIU A;  2VW9 A;  3U50 C;  2F0T A;  4PZ7 A;  4YCU A;  3DEO A;  1DOL A;  2BA0 A;  1R4Q B;  3K5N A;  2UXB L;  4JI2 Q;  2VS1 A;  4MTN A;  1R4P B;  2DNC A;  3SK6 A;  3M4Y A;  3ULJ A;  3PIO A;  1J6Q A;  3DMU A;  5EQ0 A;  4RKB A;  1FR3 A;  2BOS A;  4G57 A;  1KLG D;  2HIV A;  2L1B A;  1IKM A;  1JJ2 A;  4A3C H;  2WB1 B;  5H1S E;  4RHS A;  1HHV A;  3R3O A;  1AZQ A;  1S5F D;  1LT5 D;  4QQB X;  5FJ8 H;  4DNI A;  3GTL H;  3PUX A;  1W6K A;  3P7J A;  2HHH L;  4A3G H;  2K33 A;  2F0U A;  2QGQ A;  3QJY A;  4J15 A;  3V2T A;  3J81 E;  3I7F A;  4XQN A;  1QUQ B;  1JWM D;  4WRD A;  4DV5 Q;  4RGT A;  5K36 G;  1ET6 A;  1SMY D;  2I5L X;  4J1M A;  1ZKO A;  2PNR C;  2B8F A;  1PRT F;  2K6A A;  4A3E G;  1GUW A;  2R6G A;  4CJ2 C;  4JBK A;  3TZD A;  3K57 A;  1G6P A;  2F0S A;  4NDX A;  2Q2T A;  3OMC A;  4IOC A;  1RKN A;  1X3F A;  1U0L A;  3HOV G;  5EBC A;  3SK8 A;  2IX3 A;  3M4O H;  1ET9 A;  1WI5 A;  4HIO A;  1LTA D;  1PYW D;  4MZ9 A;  3TSS A;  3MEH A;  5C3X A;  3ERQ A;  3H91 A;  4NMZ A;  2AUJ D;  3GO5 A;  1VQL A;  1LYL A;  4IPD A;  4A3E B;  2EQS A;  4X3S A;  2EY6 A;  3RD4 A;  4UY8 C;  2OQ0 A;  4CKE A;  5LHY 1;  1CTM A;  3I55 A;  1EU3 A;  4C2M B;  4BA1 I;  4R1J A;  3KF6 A;  3PV0 A;  2SOB A;  2BDO A;  4GNX B;  3T1Y Q;  3HOV B;  3I72 A;  1CSQ A;  3J81 i;  1JJC B;  4LFC Q;  1KQS A;  4KMU C;  3EN2 A;  4PMC A;  1HA5 A;  3U9S A;  4B3R L;  3TN2 A;  2IWH A;  5E1F A;  1CSP A;  1TWH H;  3I4M H;  1J5E Q;  2A69 C;  4Y7N H;  4CBV A;  3IFD A;  4DV6 L;  4P2C B;  1KAW A;  1A6X A;  3GTO B;  3AFP A;  1KNE A;  4C3I G;  3S9W A;  5FOB B;  1TII D;  4DV2 L;  1HA6 A;  2JP1 A;  1S4Z A;  5FO7 B;  4R4O A;  5GAD C;  3A8J E;  4HCE A;  5C3E G;  2ZJQ A;  3C46 A;  1TS5 A;  1DM0 B;  3KBX A;  3KJP A;  3S15 B;  4DUZ Q;  4H7B A;  3PF4 A;  4C1N K;  1NTG A;  3OW2 A;  4C3I B;  1UEB A;  3J7A 5;  3EVQ A;  2IY5 B;  4DR1 L;  1B9N A;  3SE0 A;  1F9S A;  1Z7T A;  2DJF C;  2K5V A;  4OL7 A;  2F0L A;  1AE3 A;  2B2W C;  3S17 H;  1N32 L;  2B2T A;  2R92 G;  5C3E B;  2IHF A;  4H13 C;  2VQE L;  2JA6 H;  3MZ5 A;  2N8N A;  1CHQ D;  1K3B C;  4DUY Q;  1YHB A;  1Z47 A;  2F4I A;  2BH2 A;  4XQQ A;  3FVQ A;  3EJI A;  1SBB B;  4BXX G;  5IY0 A;  3L9A X;  1JMC A;  1NMF A;  3TZU A;  1HXY D;  3CPF A;  2QF7 A;  1STN A;  1O7Y A;  1EZ6 A;  3HS0 C;  1K0S A;  1QJO A;  5D3I B;  2CW0 C;  3E9H A;  2B2V C;  3LWU A;  3I56 A;  1ICF B;  2R92 B;  1JWU D;  1VQD A;  3A8I E;  4DPG A;  3PO2 G;  1E7Z A;  4RAU C;  3LNN A;  4IPC A;  2IHE A;  1JOQ A;  4FVM A;  5COR A;  1F77 A;  5I9P A;  2A5H A;  4M1U B;  1QVG A;  1RTN A;  4RMF A;  2F0D A;  1IYU A;  3CQZ B;  3FHW A;  2XRS D;  4MNO A;  2IJ0 A;  2E2H H;  4LF4 Q;  1ROD A;  4IUU A;  1KLU D;  3UDG A;  3TBI B;  2SNM A;  4LFB L;  3AEV A;  1XJV A;  1LTG D;  1KAB A;  3U4V A;  3G4S A;  3PO2 B;  5IT9 E;  3G6J B;  5FKA C;  5CV5 A;  4KTA A;  3CCL A;  3J7A V;  2R7Z G;  1QNU A;  4K2L A;  5ELC A;  1LTL A;  5KNB A;  4OO1 H;  1LT4 D;  1YNX A;  1W3S A;  2EJF C;  4K8I A;  4ZLT F;  5CBE E;  5C4X G;  4HMJ A;  2B29 A;  4GKK Q;  3NWS A;  4I7Z C;  2H1E A;  1HZB A;  1WTH A;  5DAU A;  3EBE A;  2ID0 A;  4OON A;  2MJ8 A;  4UP7 A;  3A0J A;  2XN9 C;  4UPA A;  4KV6 A;  4YIJ A;  3WWV A;  5KGU A;  3K80 C;  2JEB I;  1G8Z D;  2R7Z B;  1Q90 A;  1TS3 A;  1YNJ C;  2CW0 D;  4L8J A;  2CQO A;  1RD9 D;  2EY1 A;  3S24 A;  4QUF A;  1U4M A;  1AEX A;  3FP9 A;  4BBR G;  3KUP A;  5IGF A;  2HCI A;  4Y52 H;  1EY6 A;  4OWW B;  3BYT B;  1EWH A;  2F0M A;  4BY7 H;  1HNW Q;  1V1Q A;  1EIH A;  1NNX A;  1SRO A;  4YCV A;  3VYR A;  3MEF A;  2UUC L;  4DR5 L;  3M7N A;  1Y8N B;  4BBR B;  1TS2 A;  4B3S Q;  1RF2 D;  4JI3 L;  5CV9 A;  5IOC A;  1MJE A;  3MFG A;  1Q82 C;  1EY5 A;  4B3M Q;  5LMN L;  5CV4 A;  3HOZ G;  4KJN A;  3OTO L;  3S2D B;  3GDE A;  2CFM A;  3HKZ E;  1IHZ A;  1RJT A;  4LF5 Q;  4K0K Q;  3ER0 A;  1J8I A;  2HQE A;  2B39 A;  2CCZ A;  4A3J G;  4UDU C;  2NVQ H;  1STA A;  1SJH D;  2L9H A;  1HZC A;  2PI2 A;  3PF5 A;  1QVF A;  1HR0 Q;  2DY7 A;  1PZK D;  3H3V C;  1IBM L;  2VZA A;  4ODG A;  3BDC A;  2OTJ A;  1DD2 A;  3HOZ B;  1DGS A;  1F9Q A;  1XYI A;  2A6E C;  4C3J H;  2B2W A;  1KDA A;  4ZQ3 A;  5FLX c;  1WTQ A;  4A3J B;  2WAQ G;  4LF9 L;  1X55 A;  3VR2 A;  1E24 A;  3TQY A;  2EE1 A;  2BCO A;  3F8T A;  1PH8 A;  4GZY C;  2RHQ B;  4OEM B;  1F2M A;  4TSS A;  3QO2 A;  2VUM H;  4LFA Q;  1TXY A;  2B2U C;  4A3I G;  3F2U A;  1OXU A;  2F0W A;  5C0X H;  1EQR A;  4A3B G;  1KTK A;  4ZKC B;  1D5M C;  1A2U A;  1Z6H A;  4YWK A;  4FF1 A;  2PCF B;  1K8O A;  2B2V A;  2WAQ B;  1PA6 A;  1DXM A;  4HTH A;  3M3Y H;  3GTJ H;  1UE1 A;  1I6H H;  1VMC A;  2TSS A;  3NHH A;  3ZYY X;  2F03 A;  4NXM L;  4GKJ Q;  3NPP A;  1LM0 A;  4R4I A;  5JPM C;  1LV9 A;  1EY4 A;  4RCN A;  3KLS A;  5C4H A;  4A3I B;  2WP8 J;  4ZUJ A;  1BBW A;  3H0G H;  3RZO B;  4PMW A;  1KL9 A;  4A3B B;  1I6V C;  2F0E A;  2PW7 A;  1WJJ A;  1UE7 A;  4LUV A;  2UXD Q;  1TWC B;  2J7Z A;  3CCE A;  1XPU A;  2D9U A;  5LMU Q;  1XMO Q;  3SK4 A;  4DR6 L;  1X32 A;  4MN3 A;  2MP1 A;  5G3L D;  4KK7 A;  1K83 B;  4B08 A;  2NN6 H;  4KHP Q;  4KY6 A;  1MD2 D;  4NXN L;  1VCI A;  2EYP A;  1R9T B;  1BCP C;  5KIX A;  1XNQ Q;  1JCK B;  4X66 Q;  1HH2 P;  3E6Z X;  4AYB E;  3T1H L;  5BN3 A;  4XT1 B;  2KHI A;  5FLM G;  3H15 A;  2LXJ A;  1HTP A;  2OEO A;  1B1Z A;  3CCQ A;  1IW7 D;  2ES2 A;  4DAY A;  1STY A;  4IFD H;  2L11 A;  1VMP A;  4QL5 A;  5F2D A;  1IBK L;  3DWA A;  1EOV A;  1JB7 A;  3ONA B;  2K14 A;  4IOA A;  1WYD A;  4X65 L;  1A0I A;  2Q2U A;  2DGY A;  3NTK A;  4F87 A;  2IX0 A;  4GN4 B;  1SE3 A;  4ULL A;  1VQJ A;  2GN5 A;  1LTI D;  1N34 Q;  4DNR B;  4V19 0;  5C5L A;  3KF8 B;  2CWP A;  4N8F A;  1LTS D;  1ZXT A;  1SN8 A;  2R7F A;  3A5Z B;  3E0J A;  4CKC A;  3CCJ A;  1WTR A;  3VYT A;  3M4Q A;  1ESR A;  4A3C G;  2K04 A;  4JYA Q;  1UNS A;  4RWS C;  3STB D;  1FJG L;  2G9D A;  1QVC A;  3AFQ A;  1V1P A;  1A8V A;  3QG1 A;  4QIW B;  3X3M A;  5FJ8 G;  4YY3 Q;  4A3G G;  1O7I A;  3NTI A;  3TP6 A;  1CKO A;  4ALP A;  1KXL A;  5IOD A;  4IUT A;  3VR6 A;  2QCP X;  4BY1 H;  4LF8 Q;  4IUP A;  1K28 A;  3DM1 A;  5A2Q L;  4KHV A;  3NEM A;  1LTR D;  4RG1 A;  3OMG A;  3K59 A;  4GS3 A;  3GTL B;  2CHB D;  4A3G B;  2YV5 A;  2IPK D;  2WKD A;  1K73 C;  4P75 A;  1LTT D;  1PRT C;  3V05 A;  3A54 A;  1XMQ L;  1GHK A;  1CKM A;  4R8I A;  2F0F A;  4JI1 L;  2Z6B A;  4K5V A;  3A5U A;  3S1M B;  4K14 A;  4ID6 A;  5C0X J;  2QKI C;  3PMF A;  1HNX L;  2A6H C;  2E2D C;  1A62 A;  5M5Y H;  2HUG A;  4A3F H;  1KRT A;  4JBJ A;  1ZYR C;  3IAY A;  5JAV A;  2EOT A;  3HFZ B;  2ZTC A;  3UE1 A;  1HNZ Q;  4O2D A;  2XWB B;  3L2P A;  4RFB A;  3SK5 A;  3J80 E;  3S14 H;  2E5L L;  3M4O B;  1O80 A;  3WOF A;  2ZJR A;  4JI6 Q;  3GTQ H;  1K8G A;  2KCN A;  4Q5V A;  4N9P A;  3LX0 A;  3PQI A;  3I4M G;  3RLN A;  1FNW A;  4DNT B;  1SYE A;  4DV4 L;  5I9O A;  2BDN A;  4DAM A;  1ENA A;  3BDO A;  4DV3 L;  4L5T A;  5IP9 H;  3I73 A;  1BXT A;  2J4X A;  4WJ4 A;  3CMA A;  2QDB A;  2K32 A;  3UDX A;  4A3K H;  1II3 A;  1N33 Q;  3RN2 A;  1KDC A;  2PMZ E;  3AB9 A;  2MNA A;  1SNC A;  3H09 A;  4CGY B;  3PIO 3;  2YU9 H;  1VQ5 A;  4HJ9 A;  5EKK A;  1TWH B;  4FNF A;  3I4M B;  2R7D A;  3DHQ A;  3MXP A;  4Y7N B;  2K52 A;  2ICE C;  2EDG A;  5IE8 A;  1C0A A;  1IL2 A;  3G6E A;  2DY8 A;  1N9W A;  2R93 H;  2CWA A;  1PV4 A;  1YJW A;  3ERO A;  1U5K A;  5JOB A;  4IFD J;  1EYD A;  3JAM E;  2MO0 A;  1PHJ A;  1JOK A;  4LUO A;  2Y0S G;  4ZYS A;  2AUK A;  4JI0 Q;  5IWA L;  1T9H A;  2QEX A;  1LT3 D;  1BCP F;  2JA6 G;  3TS2 A;  1PH6 A;  1A2T A;  4X64 L;  1WD1 A;  3RLO A;  4ZCK A;  4MHE A;  2GVA A;  4JPB W;  4BWG B;  3KLS X;  5JJK A;  3LWE A;  3R8B A;  3NUC A;  3KOJ A;  3VYU A;  3Q23 A;  1NR4 A;  5EBD A;  2B2T C;  5AJ3 Q;  3J81 c;  3DLL A;  1VQ4 A;  1XPR A;  4DGZ A;  2Y0S B;  3S17 B;  1Q81 C;  3AU7 A;  2JA6 B;  1K3R A;  5M3M H;  4PNY A;  3URY A;  4XDX A;  1S40 A;  4KI0 A;  1ILQ A;  1FL0 A;  2O5J C;  2DN8 A;  2K28 A;  2WIN B;  4DAY B;  4F88 A;  3EIV A;  3F2C A;  3U58 A;  3M85 A;  1DYQ A;  5JEA G;  4A3L H;  1NR2 A;  2LSS A;  3JAM i;  4AIM A;  4ZUI A;  2N78 A;  4PG3 A;  3BZC A;  1FGB D;  2B63 H;  5JJI A;  2ZM6 Q;  4CHT B;  5M5W H;  4BBS H;  2K5N A;  1X3G A;  4XYQ A;  1A63 A;  4LUZ A;  1BR9 A;  4U67 3;  2N55 A;  2RDH A;  4OO1 G;  4JK1 C;  4DR2 Q;  1B9M A;  2WB1 E;  1B50 A;  5BR8 L;  5I6W A;  3VYS A;  1V1P B;  2E2H B;  4OX9 L;  1EQV A;  3T56 B;  1J9O A;  1K8M A;  3IKJ A;  2OWO A;  1VQO A;  3BVG A;  3K7A H;  4DK0 A;  4HAE A;  3SR1 A;  2SDF A;  1IYJ B;  1SE4 A;  1VQH A;  5CV6 A;  4IJH A;  3K5M A;  1GUS A;  3NSW A;  4E6I A;  1RHP A;  2MHV A;  4ME5 A;  1DZ1 A;  5CC4 A;  2LXK A;  1JC7 A;  4KY7 A;  4IUV A;  1Y69 U;  1X9N A;  3MWY W;  3E3X A;  4G7Z C;  5ELB A;  1AN8 A;  4AQY Q;  3M9B A;  1WTV A;  2Q8T A;  3D4D A;  2A8V A;  1UE6 A;  2X6L A;  4DV7 Q;  1QZH A;  2E2J H;  1K8A C;  2CH4 W;  1GUG A;  1NUC A;  4DA2 A;  5IYB G;  3NBI A;  4OO1 I;  2ZXO A;  1V9P A;  2L15 A;  3MVV A;  4BY7 G;  1PZI D;  3KDF B;  4L5R C;  3K6O A;  3I8Z A;  3CC7 A;  1B53 A;  2OTL A;  3H3V I;  1D1I A;  3SDZ A;  1TT2 A;  2QIL A;  1YBY A;  1LLR D;  4X3T A;  1PYS B;  2OCE A;  3CPW A;  1AZP A;  2PPB C;  3HEJ A;  1P16 A;  1D8L A;  2KOL A;  4BY7 B;  1JT8 A;  2F0O A;  3HOW H;  1CT1 D;  3DUZ A;  4A76 A;  2UXC Q;  1HFG A;  5EPJ A;  4LMQ D;  2L12 A;  1C9O A;  1M4V A;  1I5F A;  5JVH 3;  1XNR L;  4EGV A;  1SNQ A;  3K81 C;  1IBM Q;  3PUV A;  2FHT A;  1CI3 M;  2MUY A;  4GOP A;  4G7O C;  2F4V Q;  3RZD H;  2I5M X;  2B3G A;  4APV A;  1OXV A;  1EZ8 A;  4U68 A;  4C3J G;  4JBM A;  3CRL C;  2NVQ B;  1OXX K;  1ASY A;  4ZKB B;  1VDZ A;  4GN3 B;  1E22 A;  4TKO B;  1VQK A;  1RDP D;  3KFU A;  5I6Y A;  2VUM G;  4B9W A;  2K03 A;  1N36 Q;  4JI4 Q;  5IT9 c;  1BCP B;  3I4O A;  3CHB D;  5C0X G;  1GO3 E;  1CKN A;  3GTG H;  2NTS A;  4OIK A;  1HUN A;  4JOI C;  3L0O A;  4C3J B;  1BOS A;  2EXD A;  1GOZ A;  3QB3 A;  4EQO A;  4KJO A;  1A15 A;  4FYD A;  2KCT A;  4QCL A;  2A74 C;  3NWT A;  1XWE A;  1WD0 A;  1PH7 A;  4A93 H;  5IP7 H;  1EL0 A;  1SYC A;  2DNE A;  3ERS X;  2VUM B;  1WOC A;  1STE A;  1LUZ A;  2UU9 Q;  1HPC A;  4QGU A;  4DR7 L;  3CRK C;  2A69 D;  3H0G G;  2VL6 A;  3CC4 A;  1VQI A;  4KKT A;  1CHP D;  3PSI A;  1UUP A;  4JV5 Q;  4LWC A;  1QNK A;  1TQO A;  2PZT A;  1GXD C;  3M3Y B;  4F8M A;  3GTJ B;  3D8G A;  4A3M H;  3ULL A;  3S16 H;  4P74 A;  1I6H B;  2JA7 H;  1CUK A;  5CGK A;  2NN6 G;  2Z4H A;  5IGD A;  4YWM A;  3K8A A;  5C0X I;  4NXN Q;  1H9K A;  2O2L D;  3QIA A;  3H0G B;  2AQ3 B;  1I4R A;  4JW0 A;  3HOY H;  4JI5 L;  4LF6 Q;  3OPO A;  3CXC A;  4IO9 A;  4QF4 A;  2MQH A;  2YYZ A;  4IFD G;  1JR0 D;  1H9J A;  2ZTE A;  5I2Y A; 
#chains in the Genus database with same CATH homology
 3V96 A;  5IGC A;  2EPB A;  5JJZ A;  1O78 A;  4RA8 A;  2A73 B;  4KHZ A;  4RH6 A;  2NN6 I;  2F0H A;  5EPK A;  1PRT B;  4BS9 A;  5FLX L;  5CMD A;  3MTS A;  3GP7 A;  4KKS A;  5CBA E;  5KYL A;  2WII B;  1FNV A;  5C4X B;  2XVS A;  1NSN S;  3CU7 A;  2RDF A;  1WVL A;  2K5D A;  3L7Z C;  3OSO A;  2AQ1 B;  2D62 A;  4C56 C;  4IFD I;  3KBG A;  5DEH A;  1AP0 A;  1DOM A;  1PFB A;  1W6J A;  2KED A;  2F0J A;  2F0I A;  2L55 A;  2EY5 A;  5KEE A;  1ONL A;  1BNZ A;  1SEB D;  3A55 A;  2Q8I B;  3CKI B;  3HP3 A;  4EQP A;  1PFM A;  2RQX A;  2VB2 X;  4RGN A;  1YNN C;  2V4D A;  1TY2 A;  3P20 A;  2KUM A;  2M00 A;  3H94 A;  1ENF A;  5CYU A;  1M8A A;  2VB3 X;  3HKZ B;  2WV6 D;  1E2Z A;  1YNJ D;  3GV3 A;  5D65 A;  3C3L A;  1D5X C;  3L3O C;  3FPP A;  3GQB A;  4K5X A;  4V0B A;  3T53 B;  5ELF A;  2F0V A;  1Q3L A;  1FNU A;  5C4Z A;  5AFW A;  1X3Q A;  2XWJ B;  5M5Y B;  1TS4 A;  4A3F B;  3NTH A;  4JBW A;  1ILP A;  2NWG A;  1EQT A;  2ICI A;  3S14 B;  4QB4 A;  4MIU A;  3QWN A;  1PLF A;  2BE5 C;  1IKL A;  2NB0 A;  2XRQ D;  3D31 A;  3GTQ B;  4IUN A;  4LAA A;  1S5B D;  3D6W A;  5ELD A;  1C48 A;  3X3N A;  4A3K B;  5FK9 C;  2YU9 B;  3D4R A;  1LO5 D;  2GA4 B;  1DOK A;  3RMH A;  5A35 A;  4OGQ C;  1SXT A;  2F1M A;  4XYO A;  1PTO H;  3C2P A;  5E4W C;  5D3D A;  1SNP A;  2R93 B;  2A6E D;  3PUZ A;  2F0K A;  2E74 C;  2F3V A;  2E75 C;  3RUZ A;  3MXN A;  2KCC A;  4ZK9 B;  2XNA C;  2I07 B;  3OW7 A;  2D2C C;  1TU2 B;  4AYB B;  5CV8 A;  2M9V A;  1F2Y A;  1CA6 A;  1L0Y B;  2BE5 D;  3K0Y A;  1Y8P B;  3R2I A;  3OWF A;  3TP5 A;  5T1G A;  5M3M B;  4Q0F A;  1SNM A;  1OXS C;  3W2D A;  5I2X A;  2SEB D;  1G91 A;  2IW3 A;  2FMC A;  2MPM A;  1B44 D;  5LL6 S;  4ZRZ A;  1S5E D;  1S5D D;  3HGB A;  1BBX C;  4NW2 A;  1NAP A;  3I70 A;  4FXG C;  3Q0A A;  4XXE A;  2B63 B;  5M5W B;  4BBS B;  1BCP D;  1TR5 A;  5CR3 A;  1IL8 A;  3PUW A;  4H44 C;  3NXW A;  1E2W A;  1Q1B A;  3SXH A;  1MSH A;  4IAL A;  4FP5 D;  2LFN A;  1OXT A;  3K7A B;  2KQ3 A;  4RCO A;  3QOJ A;  4XIG S;  3EFX D;  1STB A;  2HDM A;  2KJX A;  4KY5 A;  3A7A B;  1U4R A;  3G7L A;  2JXM B;  1BUV T;  4K6L A;  4Z9C B;  4ILW A;  3N6R A;  2N88 A;  3RLF A;  1UAP A;  5J22 A;  2A68 C;  3J81 L;  2E2J B;  2I46 A;  2L4N A;  5G3L F;  1QG7 A;  3OHX C;  2XSC A;  2EYM A;  1HCZ A;  5BN4 A;  1LTB D;  2B2Y A;  2OXP A;  3SVM A;  4FF2 A;  2Z4I A;  4XQJ A;  1U9R A;  4M8A A;  5ELE A;  4G7H C;  2ZXR A;  2JSO A;  5EPL A;  2PZW A;  2G9H D;  5KRU A;  5KND A;  3T51 B;  3HOW B;  3GD7 A;  3I91 A;  3EQL C;  1C8C A;  3T4A C;  1PRT D;  2F0P A;  2PMZ B;  4KN7 C;  2RSN A;  3FPU B;  2M2L A;  4NKL A;  5TSS A;  3I3C A;  3K5L A;  1GUO A;  3RZD B;  1U4P A;  2A6H D;  5IGE A;  5DM6 3;  2Z8L A;  1D2B A;  1ZYR D;  3D6C A;  1CQV A;  2MGS A;  3KLR A;  5C5M A;  1MBY A;  1JWS D;  1Y8O B;  1WTW A;  5EKI A;  1OO9 B;  1HUM A;  4TQU S;  3DWQ A;  1G2S A;  3GTG B;  1Q12 A;  3KK7 A;  1QWY A;  1V8Q A;  1SMY C;  3NBH A;  1CM9 A;  4QUC A;  4A93 B;  4DU9 A;  2HCC A;  4DFA A;  5CV7 A;  2LMC B;  1HQR D;  1B4O A;  2SNS A;  1STH A;  1EWC A;  5A2Q E;  4A3M B;  4K5W A;  3S16 B;  2JA7 B;  1BF4 A;  3SEB A;  3MHB A;  3NP8 A;  4FO2 A;  3WOE A;  2VNU D;  1PTO F;  4X3K A;  1CA5 A;  4L6T B;  3HOY B;  4CJ0 B;  3OOC A;  3TP8 A;  5ISR A;  1SNO A;  3D3R A;  4TRD A;  2KVM A;  2EYO A;  3P75 A;  3BYY B;  1DON A;  5E3F A;  5IT9 L;  4KD4 A;  2CVR A;  3C1E A;  2NYZ D;  2XIW A;  3FRP B;  3J7Y W;  1T5E A;  1O7Z A;  1EU4 A;  4DAP A;  5KNC A;  3MFY A;  1LT6 D;  1L0X B;  3J7A F;  2HDL A;  4EVO A;  3GTM B;  1G29 1;  1VF5 C;  3U9O A;  3TP7 A;  2EY2 A;  4PV1 C;  1I50 B;  1EY7 A;  5J39 A;  4HN7 A;  1HTL D;  4DK1 A;  3BS1 A;  1U4L A;  1Y1V B;  2LKV A;  1EYA A;  2AWO A;  4HMI A;  1RTO A;  4RKL A;  3R93 A;  4RGM A;  2IX1 A;  3BG3 A;  1QIL A;  3E5S A;  5M9O A;  5BN5 A;  1JQY D;  3Q6S A;  1A3U A;  5EKL A;  1SYD A;  4HCS A;  2JE6 I;  3S2H B;  4DF7 A;  5M5X B;  4G4K A;  2C5C A;  2K1B A;  1SSO A;  4HSV A;  2RSO A;  5I4D A;  2B8G A;  2EYH A;  1H9S A;  3P1H A;  5JPN C;  3PIP 3;  4IZ8 A;  2PZU A;  3MXU A;  1TY0 A;  4L63 B;  3S1N B;  1LAB A;  2IT1 A;  3WDN A;  1VF7 A;  1GHJ A;  4LJZ C;  5HUR A;  5E4X A;  2E2I B;  2WKC A;  3BVZ A;  3Q24 A;  4S3S A;  5K5P A;  3SHL A;  5KYI A;  3OWE B;  2JEA I;  1XXG A;  1JOO A;  1T5X D;  4BA2 I;  1RCV D;  1CQF A;  4R9W A;  4LK1 C;  1HQM C;  4KKU A;  5J1Z A;  4HSP A;  1E0B A;  4NP5 A;  1C4Q A;  3IFT A;  5JEA H;  1ZEQ X;  1PTO B;  4DXG A;  2K5Q A;  5NUC A;  1PXU A;  1CZG A;  1SND A;  2KEE A;  4F7X A;  3DEP A;  2K05 A;  1WCM B;  4IUQ A;  1X3P A;  4WOR A;  1EEI D;  1TWG B;  1D5Z C;  1KAA A;  1MGS A;  3C1F A;  2NZ1 D;  1LAC A;  2RDG A;  4FF3 A;  3S1R B;  5EGT A;  5COY A;  1GUN A;  1JIC A;  3BDL A;  4DAV A;  1AW7 A;  4H0L C;  1Q1E A;  1H9R A;  3M7G A;  3D4W A;  1FYC A;  3KF8 A;  2PYK A;  5K36 H;  2CQA A;  1UEA B;  1ML0 D;  2PQE A;  3NK9 A;  5DNF A;  2EJM A;  3VR5 A;  1F2Z A;  2VXW A;  4WFN 3;  2NVX B;  1CFM A;  3FKI B;  2EXZ A;  4K8J A;  1EFI D;  4KN4 C;  2FJ2 A;  2KEC A;  3EA6 A;  1MI2 A;  1SDF A;  3IL8 A;  4BY1 B;  1SJE D;  1JB3 A;  1SYF A;  1TWF B;  4R8N A;  2RA4 A;  1ICW A;  4RGO S;  2RKS A;  4X3U A;  4K6D A;  3HZX A;  1I4H A;  4B9X A;  5M3F B;  2EJG C;  3A56 A;  2R61 A;  1TWA B;  5EJW A;  2OT2 A;  1SYB A;  1Y1W B;  3A8K E;  1I4X A;  3NE5 B;  1Q8I A;  4EQN A;  3T16 A;  4WJW A;  5C6A A;  1PZJ D;  1JE4 A;  2TMP A;  1NCV A;  3UI2 A;  4OHJ A;  3HOX B;  5FO9 B;  2H4O A;  2B2Y C;  1IW7 C;  3NQI A;  2NBF A;  4C1N I;  1YNN D;  4HED A;  5D14 A;  5LL6 X;  3W3A A;  3J80 L;  1H9S B;  3Q22 A;  2KA7 A;  5JEA J;  1BO0 A;  1WTP A;  1PDQ A;  3GV6 A;  1F9R A;  1QCB D;  2J0T D;  4PMB A;  1WTX A;  2O4X A;  3OIQ A;  1GJX A;  2RVL A;  4DXF A;  1ENC A;  1BDO A;  3K58 A;  3O13 A;  2X69 A;  3OIP A;  2K01 A;  1I4G A;  5FO8 B;  5T1I A;  1V1O A;  3PO3 B;  2PW5 A;  1CZW A;  1H9M A;  1I3Q B;  2F0Q A;  5FLX E;  1B2T A;  1DJR D;  3ITP A;  4KD3 A;  5IIF A;  2EZV A;  4HR7 B;  4PQX A;  4FF4 A;  2X6G A;  1V43 A;  3JAM L;  2JYO A;  2K5W A;  4FXD A;  2F0N A;  1STG A;  1SYG A;  3HRZ C;  4J6H A;  4O42 A;  2JA5 B;  4QMG A;  3I4N B;  3H6M A;  1F2L A;  3MXG A;  3TME A;  3FMC A;  1XTC D;  1BQQ T;  2O5I C;  2FFK B;  4C3H G;  2EYJ A;  4CKB A;  3DWP A;  1A3V A;  1QB5 D;  2BA1 A;  3HG9 A;  4XT3 B;  3ND8 A;  3T13 A;  4I65 A;  2ENB A;  4RHR A;  1PMR A;  5IGG A;  1EYC A;  4IUR A;  1E2V A;  1PTO C;  2E76 C;  3K5O A;  1D6E C;  3MC0 B;  3BZD B;  2NUC A;  4C3H B;  2Z1C A;  1I4Q A;  1A3T A;  5HGT A;  2R3Z A;  1O7L A;  3GTP B;  1IYV A;  1DCZ A;  2AWN A;  1G6Z A;  4K2K A;  2RBM A;  3VR3 A;  4UAI A;  2ZXP A;  4DN4 M;  4OIJ A;  2L0C A;  2EYL A;  4ZAI A;  2NVT B;  1KDB A;  3PUY A;  3BVM A;  3VR4 A;  3VA7 A;  3A7L A;  3AMU A;  1TKW B;  1FD7 D;  5C4J B;  5IGB A;  1JOR A;  2NVY B;  3DXJ C;  2AQ2 B;  3NQT A;  2D5D A;  2IL8 A;  2NTT A;  3N52 A;  4XTC S;  2FMM A;  3GTK B;  1ESF A;  2F0G A;  1HRJ A;  1QE6 A;  5JVG 3;  3FEW X;  2L5T A;  2B2U A;  1PTO D;  1D1K A;  4A3D B;  2JA8 B;  1EY8 A;  3FDT A;  2LS0 1;  1EY0 A;  1HFN A;  4N9T A;  3HOU B;  2EYF A;  1EY9 A;  3ND9 A;  1MSG A;  3MA2 B;  3VA5 A;  1KNA A;  5C44 B;  1S5C D;  5DM7 3;  2F3W A;  1TVX A;  3I4L A;  2A68 D;  3QOL A;  1SFO B;  2K7V A;  2FIN B;  4IQZ A;  4CJ1 B;  1EIG A;  1SE2 A;  1F9P A;  2WAC A;  2OF1 A;  4ABN A;  1WTO A;  3MAQ A;  2C9O A;  1AFP A;  1EEF D;  2Q8R E;  1QOH A;  4J8Q A;  1G2T A;  2KHS A;  5C3W A;  3TDQ A;  2LY7 A;  2QEJ C;  3S1Q B;  3R2T A;  4O1N A;  1I4P A;  1GUT A;  1EOT A;  1B3A A;  1CK1 A;  2EVB A;  1PFN A;  1SAP A;  2ZT9 C;  4FXK C;  4IN3 A;  1XX8 A;  2PO4 A;  3I90 A;  2F0T A;  3DEO A;  1DOL A;  2BA0 A;  1R4Q B;  3K5N A;  1R4P B;  2DNC A;  3SK6 A;  3M4Y A;  3DMU A;  5EQ0 A;  4RKB A;  1FR3 A;  2BOS A;  4G57 A;  1KLG D;  2L1B A;  1IKM A;  2WB1 B;  4RHS A;  1HHV A;  3R3O A;  1AZQ A;  1S5F D;  1LT5 D;  3PUX A;  1W6K A;  3P7J A;  2K33 A;  2F0U A;  3QJY A;  3V2T A;  3J81 E;  4XQN A;  1JWM D;  4WRD A;  4RGT A;  5K36 G;  1ET6 A;  1SMY D;  4J1M A;  1ZKO A;  2PNR C;  2B8F A;  1PRT F;  2K6A A;  1GUW A;  2R6G A;  4CJ2 C;  3TZD A;  3K57 A;  2F0S A;  4NDX A;  3OMC A;  1RKN A;  5EBC A;  3SK8 A;  2IX3 A;  1ET9 A;  1LTA D;  1PYW D;  3TSS A;  3MEH A;  5C3X A;  3ERQ A;  3H91 A;  4NMZ A;  2AUJ D;  3GO5 A;  4A3E B;  4X3S A;  2EY6 A;  3RD4 A;  4CKE A;  5LHY 1;  1CTM A;  1EU3 A;  4C2M B;  4BA1 I;  3PV0 A;  2SOB A;  2BDO A;  3HOV B;  3I72 A;  4KMU C;  4PMC A;  1HA5 A;  3U9S A;  3TN2 A;  2IWH A;  5E1F A;  2A69 C;  4CBV A;  3IFD A;  4P2C B;  1A6X A;  3GTO B;  1KNE A;  4C3I G;  3S9W A;  5FOB B;  1TII D;  1HA6 A;  2JP1 A;  1S4Z A;  5FO7 B;  3A8J E;  4HCE A;  3C46 A;  1TS5 A;  1DM0 B;  3KBX A;  3S15 B;  4H7B A;  4C1N K;  4C3I B;  3EVQ A;  1B9N A;  3SE0 A;  1F9S A;  1Z7T A;  4OL7 A;  2F0L A;  2B2W C;  2B2T A;  5C3E B;  4H13 C;  3MZ5 A;  1CHQ D;  1Z47 A;  2F4I A;  4XQQ A;  3FVQ A;  3EJI A;  1SBB B;  3L9A X;  3TZU A;  1HXY D;  2QF7 A;  1STN A;  1O7Y A;  1EZ6 A;  3HS0 C;  1QJO A;  5D3I B;  2CW0 C;  2B2V C;  3LWU A;  2R92 B;  1JWU D;  3A8I E;  4RAU C;  3LNN A;  1JOQ A;  4FVM A;  5COR A;  1F77 A;  5I9P A;  2A5H A;  4M1U B;  1RTN A;  2F0D A;  1IYU A;  3CQZ B;  2XRS D;  2IJ0 A;  1ROD A;  4IUU A;  1KLU D;  3TBI B;  2SNM A;  1LTG D;  1KAB A;  3PO2 B;  5IT9 E;  3G6J B;  5FKA C;  5CV5 A;  4KTA A;  3J7A V;  1QNU A;  4K2L A;  5ELC A;  5KNB A;  4OO1 H;  1LT4 D;  2EJF C;  4K8I A;  4ZLT F;  5CBE E;  4HMJ A;  3NWS A;  4I7Z C;  2H1E A;  5DAU A;  2ID0 A;  2MJ8 A;  2XN9 C;  4KV6 A;  4YIJ A;  5KGU A;  2JEB I;  1G8Z D;  2R7Z B;  1Q90 A;  1TS3 A;  1YNJ C;  2CW0 D;  4L8J A;  1RD9 D;  2EY1 A;  4QUF A;  1U4M A;  1AEX A;  3KUP A;  5IGF A;  2HCI A;  1EY6 A;  3BYT B;  1EWH A;  2F0M A;  1EIH A;  3VYR A;  3M7N A;  1Y8N B;  4BBR B;  1TS2 A;  1RF2 D;  5CV9 A;  5IOC A;  3MFG A;  1EY5 A;  5CV4 A;  4KJN A;  3S2D B;  1IHZ A;  1RJT A;  1J8I A;  2HQE A;  2B39 A;  4UDU C;  1STA A;  1SJH D;  2L9H A;  2DY7 A;  1PZK D;  3H3V C;  4ODG A;  3BDC A;  1DD2 A;  3HOZ B;  1F9Q A;  1XYI A;  2A6E C;  2B2W A;  1KDA A;  4ZQ3 A;  1WTQ A;  4A3J B;  3VR2 A;  2EE1 A;  2BCO A;  4GZY C;  1F2M A;  4TSS A;  3QO2 A;  2B2U C;  3F2U A;  1OXU A;  2F0W A;  5C0X H;  1KTK A;  4ZKC B;  1D5M C;  1A2U A;  1Z6H A;  4FF1 A;  2PCF B;  1K8O A;  2B2V A;  2WAQ B;  1DXM A;  4HTH A;  1VMC A;  2TSS A;  3NHH A;  3ZYY X;  2F03 A;  3NPP A;  5JPM C;  1LV9 A;  1EY4 A;  4RCN A;  3KLS A;  5C4H A;  4A3I B;  2WP8 J;  4ZUJ A;  3RZO B;  4PMW A;  4A3B B;  1I6V C;  2F0E A;  2PW7 A;  1TWC B;  2J7Z A;  2D9U A;  3SK4 A;  1X32 A;  4MN3 A;  2MP1 A;  5G3L D;  4KK7 A;  1K83 B;  4B08 A;  2NN6 H;  4KY6 A;  1MD2 D;  1VCI A;  2EYP A;  1R9T B;  1BCP C;  5KIX A;  1JCK B;  3E6Z X;  5BN3 A;  4XT1 B;  1HTP A;  2OEO A;  1B1Z A;  1IW7 D;  4DAY A;  1STY A;  4IFD H;  2L11 A;  1VMP A;  5F2D A;  3DWA A;  3ONA B;  3NTK A;  4F87 A;  2IX0 A;  1SE3 A;  4ULL A;  1LTI D;  4DNR B;  4V19 0;  5C5L A;  1LTS D;  1ZXT A;  3E0J A;  4CKC A;  1WTR A;  3VYT A;  1ESR A;  2K04 A;  1UNS A;  4RWS C;  2G9D A;  1V1P A;  3QG1 A;  4QIW B;  3X3M A;  3NTI A;  3TP6 A;  5IOD A;  4IUT A;  3VR6 A;  2QCP X;  4IUP A;  3DM1 A;  5A2Q L;  4KHV A;  1LTR D;  3OMG A;  3K59 A;  3GTL B;  2CHB D;  4A3G B;  2IPK D;  2WKD A;  1LTT D;  1PRT C;  3V05 A;  3A54 A;  1GHK A;  4R8I A;  2F0F A;  4K5V A;  3S1M B;  4K14 A;  4ID6 A;  5C0X J;  2QKI C;  3PMF A;  2A6H C;  2E2D C;  2HUG A;  1ZYR C;  3IAY A;  5JAV A;  2EOT A;  2XWB B;  4RFB A;  3SK5 A;  3J80 E;  3M4O B;  1O80 A;  3WOF A;  2KCN A;  4Q5V A;  4N9P A;  3LX0 A;  1FNW A;  4DNT B;  1SYE A;  5I9O A;  2BDN A;  1ENA A;  3BDO A;  3I73 A;  1BXT A;  2J4X A;  2QDB A;  2K32 A;  1II3 A;  1KDC A;  3AB9 A;  1SNC A;  3H09 A;  4CGY B;  3PIO 3;  5EKK A;  1TWH B;  4FNF A;  3I4M B;  3DHQ A;  3MXP A;  4Y7N B;  2ICE C;  2EDG A;  2DY8 A;  3ERO A;  5JOB A;  4IFD J;  1EYD A;  3JAM E;  1JOK A;  4ZYS A;  2AUK A;  1LT3 D;  1BCP F;  1A2T A;  1WD1 A;  4MHE A;  4BWG B;  3KLS X;  3LWE A;  3R8B A;  3NUC A;  3VYU A;  3Q23 A;  1NR4 A;  5EBD A;  2B2T C;  4DGZ A;  2Y0S B;  3S17 B;  3AU7 A;  2JA6 B;  4PNY A;  3URY A;  4XDX A;  4KI0 A;  1ILQ A;  2O5J C;  2DN8 A;  2K28 A;  2WIN B;  4F88 A;  3M85 A;  1DYQ A;  5JEA G;  1NR2 A;  4ZUI A;  1FGB D;  4CHT B;  4XYQ A;  1BR9 A;  4U67 3;  2N55 A;  2RDH A;  4OO1 G;  4JK1 C;  1B9M A;  1B50 A;  5I6W A;  3VYS A;  1V1P B;  2E2H B;  3T56 B;  1EQV A;  1J9O A;  1K8M A;  3IKJ A;  3BVG A;  4DK0 A;  3SR1 A;  4HAE A;  2SDF A;  1SE4 A;  5CV6 A;  3K5M A;  1GUS A;  3NSW A;  4E6I A;  1RHP A;  2MHV A;  4ME5 A;  1DZ1 A;  5CC4 A;  1JC7 A;  4KY7 A;  4IUV A;  1Y69 U;  3MWY W;  4G7Z C;  5ELB A;  1AN8 A;  1WTV A;  2Q8T A;  3D4D A;  2X6L A;  1GUG A;  1NUC A;  4DA2 A;  3NBI A;  4OO1 I;  2ZXO A;  3MVV A;  1PZI D;  3K6O A;  3I8Z A;  1B53 A;  1D1I A;  3SDZ A;  1TT2 A;  2QIL A;  1LLR D;  4X3T A;  1AZP A;  2PPB C;  3HEJ A;  2KOL A;  4BY7 B;  2F0O A;  1CT1 D;  3DUZ A;  1HFG A;  5EPJ A;  4LMQ D;  2L12 A;  1M4V A;  5JVH 3;  4EGV A;  1SNQ A;  3PUV A;  2FHT A;  1CI3 M;  2MUY A;  4G7O C;  1OXV A;  1EZ8 A;  4U68 A;  4C3J G;  3CRL C;  2NVQ B;  1OXX K;  4ZKB B;  1VDZ A;  4TKO B;  1RDP D;  5I6Y A;  4B9W A;  2K03 A;  1BCP B;  3CHB D;  5C0X G;  2NTS A;  4OIK A;  1HUN A;  4C3J B;  1BOS A;  1GOZ A;  3QB3 A;  4EQO A;  4KJO A;  1A15 A;  4FYD A;  4QCL A;  2A74 C;  3NWT A;  1XWE A;  1WD0 A;  1EL0 A;  1SYC A;  2DNE A;  2VUM B;  1STE A;  1HPC A;  3CRK C;  2A69 D;  4KKT A;  1CHP D;  1UUP A;  1QNK A;  1TQO A;  2PZT A;  1GXD C;  3M3Y B;  4F8M A;  3GTJ B;  3D8G A;  1I6H B;  5CGK A;  2NN6 G;  2Z4H A;  5IGD A;  5C0X I;  1H9K A;  2O2L D;  3QIA A;  3H0G B;  2AQ3 B;  1I4R A;  3OPO A;  4QF4 A;  2YYZ A;  4IFD G;  1JR0 D;  1H9J A;  5I2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...