3V96A

Complex of matrix metalloproteinase-10 catalytic domain (mmp-10cd) with tissue inhibitor of metalloproteinases-1 (timp-1)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
178
structure length
164
Chain Sequence
CTCVPPHPQTAFCNSDLVIRAKFVQTTLYQRYEIKMTKMYKGFIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Matrix metalloproteinase-10 (MMP-10) interaction with tissue inhibitors of metalloproteinases TIMP-1 and TIMP-2: binding studies and crystal structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Metalloproteinase inhibitor 1
total genus 39
structure length 164
sequence length 178
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3v96A02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 3v96A01
2XWJB 3HS0C 1UAPA 1PXUA 3T4AC 3L3OC 5JPNC 3I70A 1JB3A 2WIIB 5FOBB 3OHXC 1XWEA 5FO7B 4FXGC 1JC7A 3V96A 2E2DC 2J0TD 3CU7A 1UEAB 3CKIB 5FO9B 1D2BA 1BUVT 3HRZC 3MA2B 1GXDC 1BQQT 2WINB 3KLSA 1OO9B 1BR9A 5JPMC 5FO8B 2QKIC 3G6JB 2XWBB 2B39A 2A73B 2ICEC 4ILWA 2I07B 2TMPA 3FRPB 4FXKC 2A74C
chains in the Genus database with same CATH superfamily
3OW2A 1I5FA 1F9QA 4DNTB 1N32L 1SFOB 4DR4Q 3WWVA 4IOAA 4CDFC 5FO7B 2DNEA 3NWSA 4POGA 3CU7A 1GHJA 4QIWE 4F8MA 2ZJRA 2JQOA 4DAYA 1Q46A 1ZYRC 1EIFA 1CZWA 3NK9A 2QA4A 2K05A 4JI8L 1PRTF 4AIMA 1ENFA 2B2VC 1PZKD 4K5VA 4JV5L 3A54A 3NTHA 1BXTA 3TRZA 5IGFA 3JAMi 4ZKBB 1I6HH 4OXPA 3NBIA 3QOLA 4NXMQ 4PMWA 4JI6Q 1YIJA 1AE3A 4KTAA 3T16A 1N34Q 1GUSA 1I4PA 3L9AX 1S72A 1XNQL 2LY7A 2R92H 1XNRL 2R93B 1HCZA 3K59A 1KTKA 1KRTA 5I4DA 4J15A 3NHHA 5IOCA 1I94L 3PF5A 3GTPH 5M3MG 3MTSA 3PV0A 2WIIB 2EJFC 3GTMB 3MWYW 1A3VA 1DD2A 3LNNA 1HZCA 4X66Q 1Q82C 1Q3LA 3R3OA 3DM1A 1XX8A 3AYHB 3DUZA 1SR3A 1WTXA 2RCNA 3MFYA 2Z6BA 3VR3A 1D8LA 2JA7B 2X69A 1VQ5A 4JI4Q 1EQTA 1F9SA 1PTOF 4WJWA 3BU2A 3PF4A 2KJXA 1WCMH 4LMQD 4C1NK 4S3SA 2BE5C 1Y69U 1XNQQ 5FLMG 2UXBQ 3GQBA 4B3RQ 1DM0B 3GTJH 4IURA 3HOUB 5EBCA 5JEAH 1PA6A 1C4QA 3UDFA 1Q7YC 3KK7A 2E2IH 2DUDA 2MGSA 3M85A 4A3LH 4MZ9A 1SNMA 4OO1G 4KKTA 5H1SE 4MN3A 4A3MG 1H95A 1I50B 3BG3A 4HJ9A 4BY1G 4G4KA 3CP0A 2UXDL 2ZJPA 3FDTA 4Y52H 2EQSA 4JYAL 3I4MH 2PZTA 3ERSX 4NXNL 1KXLA 3DWQA 5C5MA 3T1HQ 5FOBB 1PFBA 2E76C 2B3GA 2KBNA 4QUCA 2PYKA 4CDCC 5A2QL 2PW7A 5IYDG 1I6VC 3IFDA 4C3JB 2HQLA 3J81j 3QIAA 3X3NA 1TKWB 1WCMB 3BJUA 2I46A 4PZ6A 2QCPX 2QDLA 1ENCA 4LF8Q 2NVTB 2SDFA 5EJWA 3HOZG 3F2DA 3HOZH 1STNA 1Y1VH 2WB1E 2EY5A 3L3OC 3NPPA 3I8ZA 3VDYA 4ALPA 1SE2A 1N33Q 4N8X1 3NBHB 2I0QA 2UUCL 5J22A 4OL7A 4AYBE 5KGUA 3SK8A 4KHPQ 3A5UA 4R4CA 4L5TA 1KC8C 3A8IE 4JI0L 1F9RA 1PH4A 4LF6Q 2F3VA 2GVAA 1QOHA 3SE0A 1Q1EA 3BDLA 4K6DA 2ATWA 3RZOH 3BZKA 1B7YB 1EY8A 3U9SA 2OTLA 3G48A 4JBKA 2ENBA 4IJLA 1EU3A 1ONLA 1AN8A 2HUGA 5D14A 1YHQA 2F03A 3BZCA 3PQIA 1A62A 1YHAA 2ICEC 4X3SA 4PZ8A 4GNXA 4ZQ3A 2Z6KC 4B08A 1EWHA 1XNRQ 2R7FA 1C9OA 1FVIA 2MO0A 3VYRA 1F2MA 1MJCA 2BA1A 3KOJA 3EJIA 1TS3A 1VQKA 1I4RA 4GLAC 5M3FG 4DV4L 5GQOA 5IP9G 3EIVA 2ES2A 4A93B 3PIOA 4GLXA 1LYLA 4LFCQ 4GS3A 3GTLH 1QCBD 4A3MH 3UDXA 1VQ8A 3GTOB 3H0GG 3GP7A 1K8GA 2L12A 1TQOA 1LTTD 3T4AC 1QG7A 2RA4A 1RTNA 4QUFA 3HFZB 4ABNA 1KHIA 3K5LA 4LF5Q 1LTAD 2JYOA 4Z9CB 4FP5D 2IPKD 4JW0A 1YNNC 4A3JH 4QY7A 1JJGA 1X9NA 3S2DH 1VQIA 1NAPA 3U58A 4PV1C 2K32A 4IUTA 2TSSA 1B9MA 4RGNA 5IYCG 1Y8PB 5A2QE 1VQHA 4A3FB 4FF3A 4KD4A 2P5ZX 2C5CA 3I70A 3CPWA 1C0AA 1EWCA 5LL6X 3J81E 2PMZE 1UEAB 1A3UA 2XIWA 1WTWA 4IUNA 2M00A 4GOPC 4UP9A 1L1OB 4CKBA 2F4VL 3NEMA 4L6TB 1S5ED 3C1FA 4MTKA 2KVMA 4X62L 1SROA 1LTSD 4HIDA 4BY1B 1YJNA 1W2BA 3HZXA 4DAPA 3FHWA 1JJCB 4ZCKA 1SN8A 1TR5A 2PQAA 3TP5A 5C4XB 3TS2A 5DM63 2C35B 5IIFA 4LF6L 1CSQA 2Q8RE 4KV6A 4XYOA 5BR8Q 4CDDC 4Q5VA 4R4QA 4X65L 4R9WA 1K8AC 2L1BA 5D3IB 1SNDA 2B2YA 3MVVA 3I2ZA 5J1ZA 3HG9A 1NMGA 2R61A 2KCNA 1Z6HA 1XWEA 2N78A 3J7YW 5CBAE 3S9WA 2EY2A 3K5NA 3E3XA 3L2PA 1HR0L 2A69C 2L0CA 2EIFA 2B2TA 4A3JG 5IWAQ 4NKLA 4U673 3ND9A 4O0AA 1VCIA 3VA5A 2R92G 2XRSD 3PO3H 5JAVA 2RVLA 2AWNA 1HQMC 1Q81C 3GTGH 3HS0C 2NVYH 4HJ8A 1D5XC 4ZK9B 4KI0A 4KY5A 3A56A 4DNIA 1SYCA 1SRUA 3H6MA 4A3DB 1EYCA 1J9OA 4GN4B 1HA5A 3GTQH 4DR4L 4X3TA 1W6KA 4KD3A 1FNVA 2A5HA 3MHBA 3RUZA 3PSIA 4LW1A 1MJEA 1LT4D 1C48A 1OXVA 1IYJB 3WDNA 1NUCA 1QILA 3J7AV 2NUCA 4PQXA 2O2LD 2XRQD 1ASZA 2LSSA 3S1MB 2K5DA 2JA7G 4XXEA 3HKSA 3S14B 4TQUS 5FLXc 1SNCA 5M3FH 1BVSA 1CA5A 2B2UA 5E4XA 1YITA 1SJED 2L55A 1UWVA 3H3VI 1MGSA 1O78A 4RHSA 1CTMA 5C4ZA 1SBBB 1VMCA 3VR4A 1XMOL 5CV4A 4A3CG 1H9SA 1S3OA 1RL2A 1IBMQ 1V1PB 1HA6A 2B2VA 3GO5A 1KNEA 4DAMA 4UP8A 5I9PA 4R1JA 2ICIA 1JWUD 4DUYQ 1FJGL 5JJZA 1HNZQ 4HN7A 1PMRA 1RODA 1U4RA 3TP7A 2K5HA 5I2YA 1K9MC 1Q90A 1GUNA 2Z8LA 1EY9A 5EPKA 3CCEA 3RZDB 1TXYA 5KNDA 1VQNA 2AQ2B 1SDFA 1PH6A 1MKHA 3RN2A 4APVA 3HOZB 4LFCL 5GADC 4G7OC 3J81c 3SHLA 3OWEB 2VQFQ 4NDXA 4IPGA 1K28A 2XGTA 4EQNA 2VUMG 3NELA 3I4LA 4OO1I 1SJHD 1PFMA 4I7ZC 1NCVA 2A19A 2N88A 1BBWA 1E22A 3F2BA 2NTTA 3M4OB 2K7VA 1UE5A 1SYDA 3CW2C 3HGBA 4HCEA 4DUYL 3CC2A 1QUQA 3PCOB 4DV1L 1II3A 1NSNS 2K28A 1R4QB 1R9TH 1XPRA 1YZ6A 1V1QA 4OWWB 1K8OA 1NBWA 4IUQA 3OSOA 4A3EH 1YNJD 3RZOB 2B2WC 3TZDA 1GD7A 3FRPB 2HCIA 2UUBQ 4DPGA 3S16H 1PFSA 2JE6I 1AFPA 4HMJA 1XYIA 4RCOA 3HOWG 3HOWB 1K0SA 2UUCQ 2PQEA 4A3LG 3M7GA 1ET9A 2R6GA 3DWPA 5M5XH 2FHTA 3KBGA 3D6CA 3P7JA 2KECA 3GTKB 4LF4L 4YIJA 4IUPA 2RBMA 2L9HA 2B63B 4CDEC 1HUMA 4X3KA 5I9OA 1H9KA 1CKNB 1JWMD 2K50A 3T1HL 4BBRH 1VQPA 1F77A 1A8VA 1O7LA 1TWCB 3GTMH 1MSGA 1OXXK 2R93G 2A68D 3KDFA 4LF8L 2MPMA 2J7ZA 2Y0SG 3MXUA 4OWTB 2K75A 4AH6A 5JOBA 4RKLA 3KJPA 1E7ZA 2G9DA 3JC66 3OIPA 5IY0A 4FYDA 1WTQA 2O5IC 2QKIC 4PMBA 1C7YA 2A73B 1MHWC 1VQJA 1BBXC 3J81i 4A3FG 3W2DA 1VF5C 3K0YA 1C8CA 1UAPA 1S4ZA 2A6HC 1V9PA 1VMPA 2F0MA 1JJ2A 2KEDA 4ZKCB 3I91A 1Q8KA 5M5YH 4X64Q 2QEXA 3E9IA 1CT1D 4ME3A 2JEBI 4BS9A 3K5OA 5COYA 4BY7H 1YNXA 1LM0A 1YJ9A 1M1KC 2NN6H 2UXCL 4P72A 2QEJC 4DK3C 3CQZH 1TS2A 1SMYC 5BN3A 3CC4A 5CV8A 4FXKC 4DR2Q 4A3IG 1I3QB 2EXDA 3K57A 3J81L 1K73C 4DR1L 1X56A 1Y8NB 1RKNA 2K5WA 2VQEL 1NR2A 1U9RA 5IGGA 1JC7A 3GTOH 1EU4A 5M5WH 2ZJQA 1B4OA 1EEID 4GNXC 2RF4A 1BNZA 1X54A 2Z6KA 3V2TA 3MA2B 4QQBX 3E6ZX 5CGKA 4QIWB 2NVXH 1WD1A 5JPMC 4JI5L 1HFNA 4QMGA 4C3JH 1VF7A 1K3RA 1SLJA 1Z9FA 2LKVA 2NVYB 4P73A 2EY1A 2Q8TA 3EA6A 2AUKA 4NP5A 3R93A 3UDGA 3URYA 4X62Q 1EY0A 4C1NI 3W5OA 1N9WA 4AYBB 1QNKA 4WRDA 5CV9A 1QZGA 4HCSA 3S1QB 1KAWA 2EE1A 1PZID 3CF5A 1IYVA 1NJIC 1SE4A 1GXDC 5JJKA 1TWGB 2AWOA 1STEA 3R2IA 5FJ8G 2EPBA 1BCPF 5EKKA 2XWBB 2IX1A 1EOTA 4HJ7A 3CD6A 1FL0A 5G3LF 4JBMA 4WJ3M 3BDCA 4RFBA 1DZ1A 4WFN3 3PO3G 3ERQA 1E2VA 4B9XA 4A3MB 1U4PA 3BVMA 5IT9c 1O7YA 2KHIA 3SEBA 4JV5Q 4RGOS 1B3AA 1SYGA 4EQ5A 4OELB 4MHEA 2C9OA 4JI8Q 3NUCA 3TEHB 5C44B 4GOPB 3QOJA 3KLSA 4TSSA 1BR9A 1PTOH 2VL6A 2YV5A 3PUZA 1MBYA 1WTVA 4A3EB 1PFNA 3E0JA 3X3MA 3CQZB 1VQ6A 4JCVE 4IFDJ 2Z1CA 3MC0B 3R8BA 3IL8A 5CORA 1EY5A 4IO9A 3OHXC 5EKLA 3K7AB 4F7XA 2CCZA 2Q2HA 4XQNA 5C4JB 2K5NA 4DUZL 5HURA 2J0TD 1CM9A 3LGJA 2JA6G 5GAEC 1IBLQ 2VB3X 2MHVA 4QL5A 1L0WA 5KRUA 1STBA 2KHSA 5IT9L 3AMUA 4XIGS 5TSSA 3TN2A 1TY0A 4LNQA 1D5ZC 2PPBC 1HZ9A 1Y1WG 1KAAA 1LV9A 1VQ9A 3DEOA 4A3EG 3G71A 3KLWA 2OEOA 5ISRA 2MP1A 2PMZB 3FPPA 4IALA 4A3BH 3S1RB 1DOMA 1W3SA 1UE7A 2BA0A 4QCLA 2WINB 3A8KE 4EQOA 1OTCA 3A55A 1LABA 2KUMA 1EFID 3HOUG 4HTHA 2JSOA 3I4NB 1OXTA 1YI2A 1QVGA 3GTKH 4C2MB 4DV6Q 1RIPA 3CCRA 1B70B 2JA9A 3BYYB 1E1TA 5M5XB 2JA7H 1CA6A 4CKEA 1EY7A 4KHPL 2BE5D 2UU9Q 3TMEA 3EVQA 4OIJA 1PLFA 1HNWL 1NTGA 4HIKA 2ZXRA 3NQIA 3IAYA 4DV7Q 4A3GH 1AE2A 5T1IA 1Z47A 3CCUA 4K6LA 3GDEA 4DV0Q 1KABA 5IE8A 4DK0A 1JB7A 3FPUB 3MEFA 3CXCA 4LJZC 4GLVB 4L8JA 5C0XJ 2F0NA 1LLRD 1SEBD 5DLQE 1ZKOA 4DR7Q 3R2TA 5E3FA 1T9HA 2KCMA 4POFA 4MNOA 4H44C 1KRSA 1QVFA 4LF7Q 1JOKA 4K8IA 2DY8A 4O1NA 5FO8B 2BDNA 3S15H 4B9WA 1I4HA 5T1GA 4M1UB 5EKIA 3AEVA 1STHA 3DMUA 4KLKA 1UEBA 2IL8A 2B2UC 2Y0SE 3I3CA 2IHEA 2YYZA 3W3AA 1K83B 2ALYB 3HOVB 1U4MA 1VQCA 1PDQA 3K7AH 3FKIH 2EYMA 3CMEA 4PNYA 2UXDQ 4C2MH 5FO9B 2RDGA 3D4WA 1HTPA 3KLSX 2F0IA 2WAQB 2LFNA 5FLXL 4X66L 1EL0A 1Y8OB 1HQRD 2K1BA 4DAVA 3CHBD 4DV3Q 1JE4A 2PI2E 1U4LA 3SDZA 2KEEA 3TREA 2MNAA 3S1NH 1P16A 5IYCH 1SNOA 2K04A 3M4QA 4M8AA 4J8QA 4DK6C 3K8AA 1A6XA 4B3SQ 1LTLA 4Y7NB 3NBHA 1ESFA 1O80A 1TWHH 3FVQA 3T51B 2ZM6Q 1VS0A 1M8AA 2VUMB 1TWGH 4H7BA 1F2LA 2Z4IA 3S2HB 3A5ZB 3TSSA 5C0XH 5AJ3Q 4LFAL 1A15A 2IX3A 4C3HG 2UUAL 1KIXA 4HSPA 3P1HA 5EPJA 1ASYA 1CQVA 3TQYA 2F3IA 2NVQB 2K52A 1D5MC 1J5EL 4A3JB 2BH8A 2MJ8A 5CV6A 4YY3Q 4KY6A 2OQ0A 2CQAA 4JBJA 5ELDA 2H4OA 2D0OA 1EOVA 3M3YB 3PIO3 2H5XA 5IT9E 2D0PA 4GNXB 1UE6A 1GJXA 2F0OA 4RKBA 3PUXA 2KCTA 5ELNA 1FJGQ 2E5LQ 4A3CH 3FKIB 5C4HA 1E3PA 4RAUC 2MFIA 4XT1B 1DYQA 5M9OA 2M9VA 2IX0A 4O42A 1RCVD 2E2DC 2KCCA 3CPFA 5CYUA 4EVOA 2B2WA 4HMIA 4R4TA 2YU9H 5E4WC 3SGIA 3MAQA 4K2KA 1HUNA 5C3EG 2NTSA 1VQ4A 1TWFB 3S17B 4DUZQ 1ESRA 1CSPA 1B1ZA 2F4VQ 1DONA 1K0RA 1EZ8A 1V43A 5D3DA 4EQPA 4B3ML 1MIUA 1TWFH 3UE0A 5CV5A 2WAQG 2LXJA 2BOSA 4FNFA 1ML0D 2F0HA 3D31A 1ZYRD 4V0BA 1Y14B 5FK9C 2Q8IB 5CR3A 2MUYA 2PW5A 2WV6D 5E7NA 1XTDA 1JOOA 3WOEA 4IFDH 3FP9A 2Y0SB 4CHTB 1J8IA 4IPDA 4KKUA 4IPCA 1NY4A 5KIXA 4G7HC 4N8FA 1XPOA 1EFWA 5C4XH 1KDAA 3ICEA 1EQQA 1DOKA 1LT3D 1SNQA 1EYGA 4G7ZC 4RH6A 1AEXA 3ULLA 1UUPA 4P71A 1SYEA 4L5QA 5IGDA 1H9RA 5J3BA 1FNUA 2SNMA 1CI3M 1PRTB 1ZEQX 3TP6A 4IUVA 4DV5L 4NXNQ 2KQ3A 5KNBA 1M90C 2B29A 4C3IB 1WFQA 1J5EQ 2Q2UA 1IL8A 1VDZA 2HDLA 1PXUA 4OWXB 3NE5B 1X3QA 4DV4Q 2IWHA 1A3TA 4A3KB 2JA5B 4DAYB 2F0EA 2EXZA 1E1OA 1X3EA 4ZUJA 5AJ3L 1HH2P 4YCWA 4HEDA 1DJRD 4DF7A 1IHZA 3U9OA 4YCUA 4YWMA 4DA2A 3D0FA 2CVRA 5C4JH 4AQYL 1HNZL 1IL2A 3S1QH 3Q6SA 2VQEQ 3I4MB 2QF7A 4DR1Q 3KF6B 5GAHC 4B3TL 2JK8A 2YTVA 1I4QA 1PTOB 2Z9HA 1W6JA 5JJIA 1YHBA 4B3TQ 3VYUA 3U4VA 2WFWA 5I6WA 4A3BG 4MIUA 2AHOB 4TVAB 5C44H 1RHPA 2EYJA 1Z7TA 2WB1G 1K83H 3HOVH 3OOCA 4OGQC 4LK1C 3UDIA 3FMCA 3PIPA 3GTLB 2QGQA 3ZJYC 4RWSC 4DR2L 1N33L 3CCQA 4DU9A 1EYAA 4XDXA 1TS4A 1IW7C 3VYTA 2E2HB 4Q0FA 5IP9H 3E0EA 5DNFA 4LUZA 2F0KA 1QZHA 2NVQH 3KF8B 5JEAJ 2H1EA 3FEWX 2VZAA 2JN4A 1R9TB 5ELBA 4DR7L 2LXKA 5K36H 4NMZA 5K36G 2M2LA 4HJAA 1HR0W 4A3KG 2A68C 2JA8H 3N6RA 1YVCA 2A6EC 3MZ5A 1L1OA 2DGYA 3NP8A 4L5RC 2VXWA 1G291 2HQEA 3V96A 3RLFA 1EQVA 3B6YA 3K0XA 2VNUD 1T5EA 2F3WA 1Q1BA 1BF4A 5IYBH 5F2DA 1VQFA 2F4IA 2I5LX 3H0GH 5DEHA 1G2TA 1MI2A 5IWAL 5M3FB 1KNAA 1PVOA 1AP0A 3STBD 1U5KA 1IBKL 3J7ZC 3QO2A 2R3ZA 3EROA 1CKOA 2NZHA 4K0KQ 2N8NA 1ILPA 2IW3A 4JVZA 1BO0A 4KN7C 1EEFD 4DKAC 2OQKA 2JA6H 3I55A 1B50A 1E2ZA 1RJTA 3S1RH 4LF9L 4H0LC 2A8VA 3GTPB 1G6ZA 4KN4C 3QB3A 4PMCA 1AW7A 5LMUQ 5LMNW 4DR6L 4X65Q 1HPCA 4A93H 1RF2D 2ZT9C 3NENA 5BR8L 1D1IA 1PRTD 1A0IA 3PUWA 2EZVA 2K4KA 2XVSA 4HSVA 2SEBD 3T13A 5K5PA 1DCZA 1HNXQ 3V05A 3ZYYX 2E2JH 5HY6A 4KHVA 4R4IA 2HCCA 2F0JA 4QB4A 3RR5A 2JA5G 2VQFL 1BQQT 2HHHQ 2OWOA 2WP8J 2I07B 1TWCH 1X3FA 1RD9D 1PYBA 4OIKA 4IQZA 3ND8A 3AU7A 3TZUA 1IYUA 1PH9A 3FKIG 4KHZA 2PI2A 3S1MH 1GM5A 4YY3L 3GTJB 1SAPA 1Q12A 2YU9B 1WJJA 4KK7A 2B63H 3LWUA 2KOLA 1DGSA 2OTJA 3DHQA 1N8RC 4ULLA 1GVPA 2EYLA 4G57A 4A3GG 4K2LA 3AFQA 4JI1L 1CHPD 1D6EC 1YEZA 5ELOA 2R7ZH 3SXHA 4BBSB 1D7QA 5IP7G 1G51A 1FD7D 2PZUA 2RSOA 3D4RA 4N9PA 4JBWA 3VYSA 4C3JG 3I4MG 2SOBA 3MXNB 1YBYA 2A6ED 2XTIA 3WOFA 1B9NA 2ZXOA 5EGTA 3I7FA 1SYBA 1WTPA 1WYDA 3BVZA 4DNRB 3OMCA 2Z4HA 4BY7B 1ILQA 4PG3A 3CC7A 4JYAQ 3KJOA 5G3LD 5A35A 1QJOA 1GHKA 3S2HH 2RKSA 1AZPA 5GAGC 4UDUC 3KDFB 4O2DA 1UE1A 5FLMH 2R92B 2R93H 2EY6A 4F87A 3GD7A 3I72A 1D2BA 5BN5A 3HRZC 4DR5Q 1CK1A 1I6HB 1AZQA 2PQAB 2PCFB 4BXXH 2K6AA 3VR2A 2CW0C 1TWAB 2NB0A 5IGBA 4HIOA 2PNRC 5C5LA 2YTYA 1TIID 1DXMA 4P2CB 3SR1A 1FGBD 5HGQA 2FMCA 3N52A 5LMNQ 1FR3A 1EYDA 3M7NA 3J7A5 3RLNA 2E75C 1N36L 3PO2H 4JI5Q 3M4PA 1BUVT 1X6OA 4RMFA 2DNCA 2ZTCA 1JICA 4NW2A 3T1YL 1I94Q 4GKJQ 1STAA 2SNSA 4A75A 2A1AA 2XSCA 1BBUA 3QR8A 2RHQB 1HR0Q 1Y1WH 4X64L 2R7ZG 2D62A 2CWAA 4HJ5A 3MFGA 5CMDA 1JORA 5JJLA 1A63A 4RCNA 3PMFA 2JXMB 3K5MA 4FF1A 4Y7NH 1I4GA 2GN5A 3A7LA 3H09A 2BDOA 2L11A 4RA8A 1EWIA 2N49A 2L4NA 3ER0A 3H3VC 5LHY1 1WTRA 3PO3B 1YNND 1O7ZA 4K8JA 1SXTA 4DXGA 2FMMA 2CH4W 5CBEE 4A76A 1N36Q 4JI3Q 1EY6A 2YTXA 4XQQA 3M4OH 3BVGA 2JJQA 1PH2A 3NWTA 1PH7A 2F0PA 2NWGA 3NXWA 1X3PA 4KJOA 5FLXE 2IT1A 2ASBA 4FDBA 1PHJA 2NVXB 4YHHL 1PTOD 1X65A 4LFBL 4IOCA 3OW7A 4OO1H 3T1YQ 3VR6A 3GTQB 1L2FA 1CKNA 1E2WA 2DJFC 2AQ1B 2F0DA 5KNCA 2F0GA 5ELEA 1KL9A 5C3EH 5E1FA 4DN4M 4P75A 4UPAA 1RTOA 2K01A 5IODA 1JE5A 5LL6S 1B8AA 3CCVA 1L0XB 4IFDI 3DEPA 3SK5A 5L37A 4C3HB 1ET6A 2CFMA 3NQTA 1BCPC 3A7AB 2GVBA 2MQHA 1B44D 3QG1A 3C1EA 4JI2L 2FXQA 5C3WA 2B63G 2UXBL 1HFGA 1H9SB 3OTOQ 3HKZG 2V4DA 5IGEA 4A3BB 3EQLC 4RHRA 1L0YB 3HOXB 4JI7Q 3VR5A 1TU2B 4DV1Q 1CZGA 1TY2A 2F0WA 2WACA 2E2JB 2XWJB 4I7AA 1LTID 2PNHA 2E74C 4FXGC 1JOQA 4A3KH 2VS1A 2JA8G 4F88A 5I2XA 1GUWA 3KFUA 1NR4A 2VB2X 1GUTA 3J80i 3J80L 5I6YA 3S1NB 5AFWA 4IJHA 4P74A 5C44G 2ID0A 2F0FA 2I5HA 2RCFA 3DXJC 1HHVA 1I50H 4CJ2C 1RDPD 4CJ0B 2L15A 2FINB 2CKZB 2CH4A 2LS01 1KLUD 1F2YA 3A8JE 1X3GA 1QVCA 1IW7D 2AKWB 1ZXTA 3K7UC 4JI1Q 1V1OA 3SK6A 1VQBA 3P75A 3TBIB 4DV6L 2VY3A 1Q8IA 3I4OA 5KYLA 4FF4A 2RQXA 3SVMA 1LO5D 5FJ8H 5DM73 1QUQB 1KDBA 1VQAA 3L0OA 3TDQA 5C0XI 4A3FH 4A3DH 1A2UA 3QWNA 2CHBD 4DGZA 3K6OA 4PZ7A 3GTGB 5CC4A 1EUJA 3BS1A 2OXPA 2O5JC 3HOYH 4ME5A 3EN2A 1WCMG 5LMUL 2HHHL 1XMQL 2NN6I 2JEAI 4GKKL 2QW7A 3H94A 4DV3L 3OYYA 4R8NA 1ICWA 2F0UA 4BBRB 2QDBA 4ILWA 4JI2Q 1IBML 1TVXA 1JR0D 4JK1C 4JI0Q 4OHJA 2N3SA 2R7ZB 4UY8C 1K8MA 2FJ2A 3UI2A 2K03A 2K5QA 4JOIC 1LTGD 3J80E 3HOWH 3ULPA 1VQOA 1G6PA 5EQ0A 1DOLA 5IGCA 2B8GA 1TS5A 4LF9Q 2WB1B 3T53B 1GUGA 2F1MA 3CMAA 1T5XD 4N9TA 1L1OC 2F0SA 4LFBQ 5EPLA 3G4SA 1U0LA 1S5DD 3H15A 3PO2B 1AH9A 1JCKB 4CJ1B 5DAUA 4BBRG 2EVBA 1B2TA 1GO3E 4DR3L 1HTLD 4LUOA 1JB3A 4OX9Q 3ITPA 1FGUA 1WOCA 5JEAG 5ELCA 3NTKA 3PGZA 1XTCD 3G7LA 1EY4A 1TWAH 4DR3Q 3BDOA 3HOVG 2F52A 2EYHA 3IFTA 5D65A 5C3XA 2VUMH 4ZYSA 2DY7A 3HP3A 1NE3A 4HIMA 3KF6A 2VW9A 3F8TA 1STYA 1VQDA 3HKZB 2Z0SA 4ID6A 1BKBA 1V8QA 3EBEA 1EIYB 2ZXPA 1MSHA 2Q2IA 1G2SA 4RGMA 4JI3L 3W1GA 5KEEA 3T56B 1WD0A 3C46A 1SE8A 5EBDA 4R8IA 3RZDH 3S17H 1V1PA 4FVMA 1OO9B 3ONAB 1IXRA 4IZ8A 3PIP3 2JA6B 2ZTEA 4CKCA 1G8ZD 5LMNL 4A3IH 4A93G 4BY1H 1BCPD 1EZ6A 4GKKQ 3C3LA 1XMQQ 3Q22A 4BA1I 3NTIA 1PH3A 4J1MA 3RMHA 4V190 4BBSH 2QILA 5JVH3 4H02A 3AFPA 1BOSA 1S5FD 1M4VA 2HIVA 3U50C 3G6EA 5IYDH 4RG1A 1MD2D 4YCVA 4DR5L 2IHFA 2RSNA 3I4NH 1E0BA 1LTBD 5C6AA 4NB3A 4L5SA 3K81C 1EIGA 2PZWA 3DWAA 4RGTA 1SMYD 2A74C 3D6WA 1LT6D 2HDMA 4EX5A 2UXCQ 1D1KA 1JWSD 3W1BA 4IUUA 1IBLL 4QGUA 1VQGA 2NYZD 1LTRD 5FKAC 2FFKB 3HOXH 3CCMA 2I5MX 4QJFA 4BA2I 1WTOA 4AQYQ 3CKIB 1G91A 1PTOC 1X32A 1S5BD 4KKSA 1IZ6A 2D9UA 3AQQA 4MTNA 2JP1A 3MXGA 1OXSC 3PUVA 5IYBG 1YNJC 1J6QA 2G5DA 3JAMc 1N34L 4C3HH 1TWHB 3F1ZA 4AYBG 2AMCB 2F0TA 4LF7L 3LWEA 5BN4A 3J7AF 3ULJA 3Q8DA 4GN3B 3TP8A 1QWYA 3E9HA 3UE1A 4DXFA 1GUOA 3D3RA 1B3QA 2GA4B 2EJGC 3RN5A 4NPSA 4DV5Q 4OX9L 1STGA 1KDCA 1JT8A 4C3IH 1X55A 1FYCA 2OT2A 2LMCB 1XMOQ 1E24A 4LF5L 1I4XA 2EJMA 1VQMA 3LX0A 3M3YH 4KMUC 4DV0L 1SYFA 2A6HD 3A74A 3BYTB 1N32Q 1Y1VB 2CWPA 2EYFA 4DV7L 4HAEA 1HRJA 3RD4A 1XPUA 4C56C 1JQYD 2A69D 3H0GB 3JAML 5CV7A 1GOZA 1PV4A 3HOYB 3HOYG 3F2CA 4CBVA 3KBXA 2KA7A 2UUBL 3E5SA 3K80C 4YWKA 2X6GA 4K14A 3HEJA 2WKCA 2BCOA 1Q86C 3SK4A 2NN6G 1HXYD 1OXUA 2XN9C 1HNXL 3M4YA 1HZAA 2E8GA 1Y1WB 4B3MQ 4ZUIA 3F2UA 5J39A 2JA8B 3K58A 2RDFA 1B53A 3C2PA 4L63B 3I90A 5JVG3 4LWCA 4H13C 3S14H 4BBSG 1JMCA 2CW0D 5GROA 2DN8A 2RDHA 2KHJA 1H9MA 1SE3A 4A3GB 4K0KL 1EIHA 4IN3A 1BDOA 2E2HH 1IBKQ 2D2CC 4K5XA 2Q2TA 3MXNA 1PZJD 2L5TA 1GKHA 5M5WB 1A2TA 3OPOA 3OIQA 2E5LL 2R7DA 2K14A 2EYOA 2OF1A 1FNWA 1QNUA 2WAQE 3O13A 1EQRA 5M3MB 2K33A 4C3IG 2ZM6L 3S16B 4OEMB 1IKMA 3D8GA 4A3IB 2HD3A 3S15B 3IRBA 4DFAA 4JPBW 4B3SL 2B8FA 2RHSB 1LUZA 1PH8A 3J80c 4A4IA 5IP7H 4IFDG 3DLLA 3OWFA 2UUAQ 4OONA 2EYPA 4LFAQ 1PH5A 2AUJD 1BCPB 3EFXD 1CFMA 4K5WA 4WORA 2IY5B 3PUYA 1KQSA 3KYHC 4DV2L 1PH1A 4I65A 1HZBA 2F0QA 2WKDA 3MXPA 3PO2G 2E2IB 2EDGA 1VQ7A 3H3VH 4QF4A 4CGYB 1NNXA 4ZLTF 2B39A 3CRLC 3MEHA 4B3RL 4UP7A 5EAYA 1VQEA 3VA7A 5C3EB 2IJ0A 2MO1A 3P20A 5JPNC 1K3BC 3HOXG 4JI4L 1S40A 5HGTA 1SSOA 1WI5A 3GV3A 4ZRZA 3I4NG 3BZDB 1YJWA 3Q24A 4ZAIA 3CRKC 1IKLA 4BXXG 4FO2A 4X6AH 1VQLA 1CKMA 4GOPA 4R4OA 2J4XA 1KD1C 4LUVA 3STBC 2DJGC 2NVTH 5KYIA 4TRDA 2PO4A 3HKZE 1PRTC 4YHHQ 3AB9A 2F0LA 1CHQD 4XYQA 4UHVA 3Q0AA 1UNSA 1PYWD 3OMGA 1R4PB 2X6LA 4XT3B 4DV2Q 4XTCS 1CQFA 2G9HD 4BWGB 1H9JA 1HNWQ 2JA5H 3CCSA 4X3UA 4ODGA 4NXML 3RLOA 3RNUA 5C0XG 1WVLA 2NZ1D 3QJYA 1NMFA 4LAAA 5ELFA 1XJVA 4KY7A 3CCLA 2HT1A 5C4XG 2B2YC 4EGVA 1S5CD 2O4XA 3S24A 3KUPA 1PYSB 4WJ4A 1SMXA 4DK1A 3A0JA 2EOTA 4YWLA 3GV6A 2OCEA 1ENAA 3U4ZA 4BY7G 1LT5D 3G6JB 1SFOH 1Y1VG 2UU9L 2N55A 4JI6L 5M3MH 3DM3A 3Q23A 2B2TC 4GKJL 3I73A 3CAMA 5NUCA 3JAME 1TT2A 2XNAC 1QE6A 3NSWA 2CQOA 1ICFB 3KF8A 1I3QH 3I56A 1KLGD 2KENA 3M9BA 2K5VA 3KLRA 3IKJA 2D5DA 4E6IA 1O7IA 4HR7B 4DR6Q 3TS0A 2V1CC 4LF4Q 4JG2A 4JOIA 4A3DG 1F9PA 3D4DA 2TMPA 2NZOA 4GN5A 1XXGA 1CUKA 4JI7L 2BH2A 3S2DB 2ZTDA 4GZYC 3OTOL 5M5YB 1QB5D 3CCJA 1P8LA 3H91A 4J6HA 4IPHA 1F2ZA 1SNPA 3L7ZC 4TKOB 2NBFA 2F0VA 4XQJA 2AQ3B 4KJNA 3HOUH 4U68A 4FXDA 1WTHA 4JC0A 2HIXA 1HJPA 4FF2A 1LACA 4UAIA
chains in the Genus database with same CATH topology
1F9QA 4DNTB 1SFOB 5FO7B 2DNEA 3NWSA 3CU7A 1GHJA 4F8MA 4DAYA 1ZYRC 1CZWA 3NK9A 2K05A 1PRTF 1ENFA 2B2VC 1PZKD 4K5VA 3A54A 3NTHA 1BXTA 5IGFA 4ZKBB 3NBIA 3QOLA 4PMWA 4KTAA 3T16A 1GUSA 1I4PA 3L9AX 2LY7A 2R93B 1HCZA 3K59A 1KTKA 5I4DA 3NHHA 5IOCA 3MTSA 3PV0A 2WIIB 2EJFC 3GTMB 3MWYW 1A3VA 1DD2A 3LNNA 1Q3LA 3R3OA 3DM1A 1XX8A 3DUZA 1WTXA 3MFYA 3VR3A 2JA7B 2X69A 1EQTA 1F9SA 1PTOF 4WJWA 2KJXA 4LMQD 4C1NK 4S3SA 2BE5C 1Y69U 3GQBA 1DM0B 4IURA 3HOUB 5EBCA 5JEAH 1C4QA 3KK7A 2MGSA 3M85A 1SNMA 4OO1G 4KKTA 4MN3A 1I50B 3BG3A 4G4KA 3FDTA 2PZTA 3DWQA 5C5MA 5FOBB 1PFBA 2E76C 4QUCA 2PYKA 5A2QL 2PW7A 1I6VC 3IFDA 4C3JB 3QIAA 3X3NA 1TKWB 1WCMB 2I46A 2QCPX 1ENCA 2NVTB 2SDFA 5EJWA 1STNA 2EY5A 3L3OC 3NPPA 3I8ZA 1SE2A 5J22A 4OL7A 5KGUA 3SK8A 3A8IE 1F9RA 2F3VA 1QOHA 3SE0A 1Q1EA 3BDLA 4K6DA 1EY8A 3U9SA 2ENBA 1EU3A 1ONLA 1AN8A 2HUGA 5D14A 2F03A 2ICEC 4X3SA 4ZQ3A 4B08A 1EWHA 3VYRA 1F2MA 2BA1A 3EJIA 1TS3A 1I4RA 4A93B 1QCBD 3GTOB 3GP7A 2L12A 1TQOA 1LTTD 3T4AC 1QG7A 2RA4A 1RTNA 4QUFA 4ABNA 3K5LA 1LTAD 2JYOA 4Z9CB 4FP5D 2IPKD 1YNNC 1NAPA 4PV1C 2K32A 4IUTA 2TSSA 1B9MA 4RGNA 1Y8PB 4FF3A 5A2QE 4A3FB 4KD4A 2C5CA 3I70A 1EWCA 5LL6X 3J81E 1UEAB 1A3UA 2XIWA 1WTWA 4IUNA 2M00A 4CKBA 4L6TB 1S5ED 3C1FA 2KVMA 1LTSD 4BY1B 3HZXA 4DAPA 1TR5A 5C4XB 3TP5A 5DM63 5IIFA 2Q8RE 4KV6A 4XYOA 4Q5VA 4R9WA 2L1BA 5D3IB 1SNDA 2B2YA 3MVVA 5J1ZA 3HG9A 2R61A 2KCNA 1Z6HA 1XWEA 3J7YW 5CBAE 3S9WA 2EY2A 3K5NA 2A69C 2L0CA 2B2TA 4NKLA 4U673 3ND9A 3VA5A 1VCIA 2XRSD 5JAVA 2RVLA 2AWNA 1HQMC 3HS0C 1D5XC 4ZK9B 4KI0A 4KY5A 3A56A 1SYCA 3H6MA 4A3DB 1EYCA 1J9OA 1HA5A 4X3TA 1W6KA 3RUZA 1FNVA 2A5HA 3MHBA 4KD3A 1LT4D 1C48A 1OXVA 3WDNA 1NUCA 1QILA 3J7AV 2NUCA 4PQXA 2O2LD 2XRQD 3S1MB 2K5DA 4XXEA 3S14B 4TQUS 1SNCA 1CA5A 2B2UA 5E4XA 1SJED 2L55A 1MGSA 1O78A 4RHSA 1CTMA 5C4ZA 1SBBB 1VMCA 3VR4A 5CV4A 1H9SA 1V1PB 1HA6A 2B2VA 3GO5A 1KNEA 5I9PA 2ICIA 1JWUD 5JJZA 4HN7A 1PMRA 1RODA 1U4RA 3TP7A 5I2YA 1Q90A 1GUNA 2Z8LA 1EY9A 5EPKA 3RZDB 5KNDA 2AQ2B 1SDFA 3HOZB 4G7OC 3SHLA 3OWEB 4NDXA 4EQNA 3I4LA 4OO1I 1SJHD 1PFMA 4I7ZC 1NCVA 2N88A 2NTTA 3M4OB 2K7VA 1SYDA 3HGBA 4HCEA 1II3A 1NSNS 2K28A 1R4QB 1K8OA 4IUQA 3OSOA 1YNJD 3RZOB 2B2WC 3TZDA 3FRPB 2HCIA 2JE6I 1AFPA 4HMJA 1XYIA 4RCOA 3HOWB 2PQEA 3M7GA 1ET9A 2R6GA 3DWPA 2FHTA 3KBGA 3D6CA 3P7JA 2KECA 3GTKB 4YIJA 4IUPA 2RBMA 2L9HA 2B63B 1HUMA 4X3KA 5I9OA 1H9KA 1JWMD 1F77A 1O7LA 1TWCB 1MSGA 1OXXK 2A68D 2MPMA 2J7ZA 3MXUA 5JOBA 4RKLA 2G9DA 3OIPA 4FYDA 1WTQA 2O5IC 2QKIC 4PMBA 2A73B 1BBXC 3W2DA 1VF5C 3K0YA 1C8CA 1UAPA 1S4ZA 2A6HC 2F0MA 1VMPA 2KEDA 4ZKCB 3I91A 1CT1D 2JEBI 4BS9A 3K5OA 5COYA 2NN6H 2QEJC 1TS2A 1SMYC 5BN3A 5CV8A 4FXKC 1I3QB 3K57A 3J81L 1Y8NB 1RKNA 2K5WA 1NR2A 1U9RA 5IGGA 1JC7A 1EU4A 1B4OA 1EEID 1BNZA 3V2TA 3MA2B 3E6ZX 5CGKA 4QIWB 1WD1A 5JPMC 1HFNA 4QMGA 1VF7A 2LKVA 2NVYB 2EY1A 2Q8TA 3EA6A 2AUKA 4NP5A 3R93A 3URYA 1EY0A 4C1NI 4AYBB 1QNKA 4WRDA 5CV9A 4HCSA 3S1QB 2EE1A 1PZID 1IYVA 1SE4A 1GXDC 1TWGB 2AWOA 1STEA 3R2IA 2EPBA 1BCPF 5EKKA 2XWBB 2IX1A 1EOTA 5G3LF 3BDCA 4RFBA 1DZ1A 4WFN3 3ERQA 1E2VA 4B9XA 4A3MB 1U4PA 3BVMA 1O7YA 3SEBA 4RGOS 1B3AA 1SYGA 4MHEA 2C9OA 3NUCA 5C44B 3QOJA 3KLSA 4TSSA 1BR9A 1PTOH 3PUZA 1MBYA 1WTVA 4A3EB 1PFNA 3E0JA 3X3MA 3CQZB 4IFDJ 2Z1CA 3MC0B 3R8BA 3IL8A 5CORA 1EY5A 3OHXC 5EKLA 3K7AB 4F7XA 4XQNA 5C4JB 5HURA 2J0TD 1CM9A 2VB3X 2MHVA 5KRUA 1STBA 2KHSA 5IT9L 3AMUA 4XIGS 5TSSA 3TN2A 1TY0A 1D5ZC 2PPBC 1KAAA 1LV9A 3DEOA 2OEOA 5ISRA 2MP1A 2PMZB 3FPPA 4IALA 3S1RB 1DOMA 2BA0A 4QCLA 2WINB 3A8KE 4EQOA 3A55A 1LABA 2KUMA 1EFID 4HTHA 2JSOA 3I4NB 1OXTA 4C2MB 3BYYB 5M5XB 1CA6A 4CKEA 1EY7A 2BE5D 3TMEA 3EVQA 4OIJA 1PLFA 2ZXRA 3NQIA 3IAYA 5T1IA 1Z47A 4K6LA 1KABA 4DK0A 3FPUB 4LJZC 4L8JA 5C0XJ 2F0NA 1LLRD 1SEBD 1ZKOA 3R2TA 5E3FA 4H44C 1JOKA 4K8IA 2DY8A 4O1NA 5FO8B 2BDNA 4B9WA 5T1GA 1I4HA 4M1UB 5EKIA 1STHA 3DMUA 2IL8A 2B2UC 3I3CA 2YYZA 3W3AA 3HOVB 1K83B 1U4MA 1PDQA 2EYMA 4PNYA 5FO9B 2RDGA 3D4WA 1HTPA 3KLSX 2F0IA 2WAQB 2LFNA 5FLXL 1EL0A 1Y8OB 1HQRD 2K1BA 4DAVA 3CHBD 1JE4A 1U4LA 3SDZA 2KEEA 1SNOA 2K04A 4M8AA 4J8QA 1A6XA 4Y7NB 3NBHA 1ESFA 1O80A 3FVQA 3T51B 2VUMB 1M8AA 4H7BA 1F2LA 2Z4IA 3S2HB 3TSSA 5C0XH 1A15A 2IX3A 4C3HG 4HSPA 3P1HA 5EPJA 1CQVA 2NVQB 1D5MC 4A3JB 2MJ8A 5CV6A 4KY6A 2CQAA 5ELDA 2H4OA 3M3YB 3PIO3 5IT9E 1GJXA 2F0OA 4RKBA 3PUXA 3FKIB 5C4HA 4RAUC 5M9OA 4XT1B 1DYQA 2M9VA 2IX0A 4O42A 1RCVD 2E2DC 2KCCA 5CYUA 4EVOA 2B2WA 4HMIA 5E4WC 3MAQA 4K2KA 1HUNA 2NTSA 1TWFB 3S17B 1ESRA 1B1ZA 1DONA 1EZ8A 1V43A 5D3DA 4EQPA 5CV5A 2BOSA 4FNFA 1ML0D 2F0HA 3D31A 1ZYRD 4V0BA 5FK9C 2Q8IB 5CR3A 2MUYA 2PW5A 2WV6D 1JOOA 3WOEA 4IFDH 2Y0SB 4CHTB 1J8IA 4KKUA 5KIXA 4G7HC 1KDAA 1DOKA 1LT3D 1SNQA 4G7ZC 4RH6A 1AEXA 1UUPA 1SYEA 5IGDA 1H9RA 1FNUA 1PRTB 1CI3M 1ZEQX 2SNMA 3TP6A 4IUVA 2KQ3A 5KNBA 4C3IB 1IL8A 1VDZA 2HDLA 1PXUA 3NE5B 1X3QA 2IWHA 1A3TA 4A3KB 2JA5B 2F0EA 2EXZA 4ZUJA 4HEDA 1DJRD 4DF7A 1IHZA 3U9OA 4DA2A 2CVRA 3Q6SA 3I4MB 2QF7A 1I4QA 1PTOB 1W6JA 3VYUA 5I6WA 4MIUA 1RHPA 2EYJA 1Z7TA 3OOCA 4OGQC 4LK1C 3FMCA 3GTLB 4RWSC 4DU9A 1EYAA 4XDXA 1TS4A 1IW7C 3VYTA 2E2HB 4Q0FA 5DNFA 2F0KA 5JEAJ 2H1EA 3FEWX 1R9TB 5ELBA 5K36H 4NMZA 5K36G 2M2LA 2A68C 3N6RA 2A6EC 3MZ5A 3NP8A 2VXWA 1G291 2HQEA 3V96A 3RLFA 1EQVA 2VNUD 1T5EA 2F3WA 1Q1BA 1BF4A 5F2DA 2F4IA 5DEHA 1G2TA 1MI2A 5M3FB 1KNAA 1AP0A 3QO2A 2R3ZA 3EROA 1ILPA 2IW3A 1BO0A 4KN7C 1EEFD 1B50A 1E2ZA 1RJTA 4H0LC 3GTPB 1G6ZA 4KN4C 3QB3A 4PMCA 1AW7A 1HPCA 1RF2D 2ZT9C 1D1IA 1PRTD 3PUWA 2EZVA 2XVSA 4HSVA 2SEBD 3T13A 5K5PA 1DCZA 3V05A 3ZYYX 4KHVA 2HCCA 2F0JA 4QB4A 1BQQT 2WP8J 2I07B 1RD9D 4OIKA 4IQZA 3ND8A 3AU7A 3TZUA 1IYUA 4KHZA 3GTJB 1SAPA 1Q12A 2YU9B 4KK7A 3LWUA 2KOLA 3DHQA 4ULLA 2EYLA 4G57A 4K2LA 1CHPD 1D6EC 3SXHA 4BBSB 4JBWA 1FD7D 2PZUA 2RSOA 3D4RA 4N9PA 3VYSA 4C3JG 2SOBA 2A6ED 3WOFA 1B9NA 2ZXOA 5EGTA 1SYBA 1WTPA 3BVZA 4DNRB 3OMCA 2Z4HA 4BY7B 1ILQA 5G3LD 5A35A 1QJOA 1GHKA 2RKSA 1AZPA 4UDUC 2R92B 2EY6A 4F87A 3GD7A 3I72A 1D2BA 5BN5A 3HRZC 1CK1A 1I6HB 1AZQA 2PCFB 2K6AA 3VR2A 2CW0C 1TWAB 2NB0A 5IGBA 2PNRC 5C5LA 1TIID 1DXMA 4P2CB 3SR1A 1FGBD 2FMCA 3N52A 1FR3A 1EYDA 3M7NA 2E75C 1BUVT 2DNCA 1JICA 4NW2A 1STAA 2SNSA 2XSCA 2D62A 3MFGA 5CMDA 1JORA 4RCNA 3PMFA 2JXMB 3K5MA 4FF1A 1I4GA 3A7LA 3H09A 2BDOA 2L11A 4RA8A 2L4NA 3H3VC 5LHY1 1WTRA 3PO3B 1YNND 1O7ZA 4K8JA 1SXTA 4DXGA 2FMMA 5CBEE 1EY6A 4XQQA 3BVGA 3NWTA 2F0PA 2NWGA 3NXWA 1X3PA 4KJOA 5FLXE 2IT1A 2NVXB 1PTOD 3OW7A 4OO1H 3GTQB 3VR6A 1E2WA 2AQ1B 2F0DA 5KNCA 2F0GA 5ELEA 5E1FA 4DN4M 1RTOA 2K01A 5IODA 5LL6S 1L0XB 4IFDI 3DEPA 3SK5A 4C3HB 1ET6A 3NQTA 1BCPC 3A7AB 1B44D 3QG1A 3C1EA 5C3WA 1HFGA 1H9SB 2V4DA 5IGEA 4A3BB 3EQLC 4RHRA 1L0YB 3HOXB 3VR5A 1TU2B 1CZGA 1TY2A 2F0WA 2WACA 2E2JB 2XWJB 1LTID 2E74C 4FXGC 1JOQA 4F88A 5I2XA 1GUWA 1NR4A 2VB2X 1GUTA 3J80L 5I6YA 3S1NB 5AFWA 2ID0A 2F0FA 3DXJC 1HHVA 4CJ2C 1RDPD 4CJ0B 2FINB 2LS01 1KLUD 1F2YA 3A8JE 1IW7D 1ZXTA 1V1OA 3SK6A 3P75A 3TBIB 1Q8IA 5KYLA 4FF4A 2RQXA 3SVMA 1LO5D 5DM73 1KDBA 3TDQA 5C0XI 1A2UA 3QWNA 2CHBD 4DGZA 3K6OA 3GTGB 5CC4A 3BS1A 2OXPA 2O5JC 4ME5A 2NN6I 2JEAI 3H94A 4R8NA 1ICWA 2F0UA 4BBRB 2QDBA 4ILWA 1TVXA 1JR0D 4JK1C 4OHJA 2R7ZB 1K8MA 2FJ2A 3UI2A 2K03A 2K5QA 1LTGD 3J80E 5EQ0A 1DOLA 5IGCA 2B8GA 1TS5A 2WB1B 3T53B 1GUGA 2F1MA 1T5XD 4N9TA 2F0SA 5EPLA 1S5DD 3PO2B 1JCKB 4CJ1B 5DAUA 2EVBA 1B2TA 1HTLD 1JB3A 3ITPA 5JEAG 5ELCA 3NTKA 1XTCD 3G7LA 1EY4A 3BDOA 2EYHA 3IFTA 5D65A 5C3XA 4ZYSA 2DY7A 3HP3A 1STYA 3HKZB 4ID6A 1V8QA 2ZXPA 1MSHA 1G2SA 4RGMA 5KEEA 1WD0A 3C46A 3T56B 5EBDA 4R8IA 1V1PA 4FVMA 1OO9B 3ONAB 4IZ8A 3PIP3 2JA6B 4CKCA 1G8ZD 1BCPD 1EZ6A 3C3LA 3Q22A 4BA1I 3NTIA 4J1MA 3RMHA 4V190 2QILA 5JVH3 1BOSA 1S5FD 1M4VA 1MD2D 2RSNA 1E0BA 1LTBD 5C6AA 1EIGA 2PZWA 3DWAA 4RGTA 1SMYD 2A74C 3D6WA 1LT6D 2HDMA 1D1KA 1JWSD 4IUUA 2NYZD 5FKAC 1LTRD 2FFKB 4BA2I 1WTOA 3CKIB 1G91A 1PTOC 1X32A 1S5BD 4KKSA 2D9UA 2JP1A 3MXGA 1OXSC 3PUVA 1YNJC 1TWHB 2F0TA 3LWEA 5BN4A 3J7AF 3TP8A 1QWYA 4DXFA 1GUOA 3D3RA 2GA4B 2EJGC 1STGA 1KDCA 1FYCA 2OT2A 2LMCB 1I4XA 2EJMA 3LX0A 4KMUC 1SYFA 2A6HD 3BYTB 1Y1VB 2EYFA 1HRJA 4HAEA 3RD4A 4C56C 1JQYD 2A69D 3H0GB 3JAML 5CV7A 1GOZA 3HOYB 4CBVA 3KBXA 2KA7A 3E5SA 2X6GA 4K14A 3HEJA 2WKCA 2BCOA 3SK4A 2NN6G 1HXYD 1OXUA 2XN9C 3M4YA 1Y1WB 4ZUIA 3F2UA 5J39A 2JA8B 3K58A 2RDFA 1B53A 3C2PA 4L63B 3I90A 5JVG3 4H13C 2CW0D 2DN8A 2RDHA 1H9MA 1SE3A 4A3GB 1EIHA 4IN3A 1BDOA 2D2CC 4K5XA 3MXNA 1PZJD 2L5TA 5M5WB 1A2TA 3OPOA 3OIQA 2EYOA 2OF1A 1FNWA 1QNUA 3O13A 5M3MB 2K33A 4C3IG 3S16B 1IKMA 3D8GA 4A3IB 3S15B 4DFAA 2B8FA 4IFDG 3OWFA 2EYPA 2AUJD 1BCPB 3EFXD 1CFMA 4K5WA 4WORA 3PUYA 4I65A 2F0QA 2WKDA 3MXPA 2E2IB 2EDGA 4QF4A 4CGYB 4ZLTF 2B39A 3CRLC 3MEHA 3VA7A 5C3EB 2IJ0A 3P20A 5JPNC 5HGTA 1SSOA 3GV3A 4ZRZA 3BZDB 3Q24A 4ZAIA 3CRKC 1IKLA 4FO2A 2J4XA 5KYIA 4TRDA 2PO4A 1PRTC 3AB9A 2F0LA 1CHQD 4XYQA 3Q0AA 1UNSA 1PYWD 3OMGA 1R4PB 2X6LA 4XT3B 4XTCS 1CQFA 2G9HD 4BWGB 1H9JA 4X3UA 4ODGA 5C0XG 1WVLA 2NZ1D 3QJYA 4LAAA 5ELFA 4KY7A 2B2YC 4EGVA 1S5CD 2O4XA 3KUPA 4DK1A 2EOTA 3GV6A 1ENAA 1LT5D 3G6JB 2N55A 3Q23A 2B2TC 3I73A 5NUCA 3JAME 1TT2A 2XNAC 1QE6A 3NSWA 3KF8A 1KLGD 3KLRA 3IKJA 2D5DA 4E6IA 4HR7B 1F9PA 3D4DA 2TMPA 1XXGA 3S2DB 4GZYC 5M5YB 1QB5D 3H91A 4J6HA 1F2ZA 1SNPA 3L7ZC 4TKOB 2NBFA 2F0VA 4XQJA 2AQ3B 4KJNA 4U68A 4FXDA 4FF2A 1LACA 4UAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWJ B;  3HS0 C;  1UAP A;  1PXU A;  3T4A C;  3L3O C;  5JPN C;  3I70 A;  1JB3 A;  2WII B;  5FOB B;  3OHX C;  1XWE A;  5FO7 B;  4FXG C;  1JC7 A;  3V96 A;  2E2D C;  2J0T D;  3CU7 A;  1UEA B;  3CKI B;  5FO9 B;  1D2B A;  1BUV T;  3HRZ C;  3MA2 B;  1GXD C;  1BQQ T;  2WIN B;  3KLS A;  1OO9 B;  1BR9 A;  5JPM C;  5FO8 B;  2QKI C;  3G6J B;  2XWB B;  2B39 A;  2A73 B;  2ICE C;  4ILW A;  2I07 B;  2TMP A;  3FRP B;  4FXK C;  2A74 C; 
#chains in the Genus database with same CATH topology
 3OW2 A;  1I5F A;  1F9Q A;  4DNT B;  1N32 L;  1SFO B;  4DR4 Q;  3WWV A;  4IOA A;  4CDF C;  5FO7 B;  2DNE A;  3NWS A;  4POG A;  3CU7 A;  1GHJ A;  4QIW E;  4F8M A;  2ZJR A;  2JQO A;  4DAY A;  1Q46 A;  1ZYR C;  1EIF A;  1CZW A;  3NK9 A;  2QA4 A;  2K05 A;  4JI8 L;  1PRT F;  4AIM A;  1ENF A;  2B2V C;  1PZK D;  4K5V A;  4JV5 L;  3A54 A;  3NTH A;  1BXT A;  3TRZ A;  5IGF A;  3JAM i;  4ZKB B;  1I6H H;  4OXP A;  3NBI A;  3QOL A;  4NXM Q;  4PMW A;  4JI6 Q;  1YIJ A;  1AE3 A;  4KTA A;  3T16 A;  1N34 Q;  1GUS A;  1I4P A;  3L9A X;  1S72 A;  1XNQ L;  2LY7 A;  2R92 H;  1XNR L;  2R93 B;  1HCZ A;  3K59 A;  1KTK A;  1KRT A;  5I4D A;  4J15 A;  3NHH A;  5IOC A;  1I94 L;  3PF5 A;  3GTP H;  5M3M G;  3MTS A;  3PV0 A;  2WII B;  2EJF C;  3GTM B;  3MWY W;  1A3V A;  1DD2 A;  3LNN A;  1HZC A;  4X66 Q;  1Q82 C;  1Q3L A;  3R3O A;  3DM1 A;  1XX8 A;  3AYH B;  3DUZ A;  1SR3 A;  1WTX A;  2RCN A;  3MFY A;  2Z6B A;  3VR3 A;  1D8L A;  2JA7 B;  2X69 A;  1VQ5 A;  4JI4 Q;  1EQT A;  1F9S A;  1PTO F;  4WJW A;  3BU2 A;  3PF4 A;  2KJX A;  1WCM H;  4LMQ D;  4C1N K;  4S3S A;  2BE5 C;  1Y69 U;  1XNQ Q;  5FLM G;  2UXB Q;  3GQB A;  4B3R Q;  1DM0 B;  3GTJ H;  4IUR A;  3HOU B;  5EBC A;  5JEA H;  1PA6 A;  1C4Q A;  3UDF A;  1Q7Y C;  3KK7 A;  2E2I H;  2DUD A;  2MGS A;  3M85 A;  4A3L H;  4MZ9 A;  1SNM A;  4OO1 G;  4KKT A;  5H1S E;  4MN3 A;  4A3M G;  1H95 A;  1I50 B;  3BG3 A;  4HJ9 A;  4BY1 G;  4G4K A;  3CP0 A;  2UXD L;  2ZJP A;  3FDT A;  4Y52 H;  2EQS A;  4JYA L;  3I4M H;  2PZT A;  3ERS X;  4NXN L;  1KXL A;  3DWQ A;  5C5M A;  3T1H Q;  5FOB B;  1PFB A;  2E76 C;  2B3G A;  2KBN A;  4QUC A;  2PYK A;  4CDC C;  5A2Q L;  2PW7 A;  5IYD G;  1I6V C;  3IFD A;  4C3J B;  2HQL A;  3J81 j;  3QIA A;  3X3N A;  1TKW B;  1WCM B;  3BJU A;  2I46 A;  4PZ6 A;  2QCP X;  2QDL A;  1ENC A;  4LF8 Q;  2NVT B;  2SDF A;  5EJW A;  3HOZ G;  3F2D A;  3HOZ H;  1STN A;  1Y1V H;  2WB1 E;  2EY5 A;  3L3O C;  3NPP A;  3I8Z A;  3VDY A;  4ALP A;  1SE2 A;  1N33 Q;  4N8X 1;  3NBH B;  2I0Q A;  2UUC L;  5J22 A;  4OL7 A;  4AYB E;  5KGU A;  3SK8 A;  4KHP Q;  3A5U A;  4R4C A;  4L5T A;  1KC8 C;  3A8I E;  4JI0 L;  1F9R A;  1PH4 A;  4LF6 Q;  2F3V A;  2GVA A;  1QOH A;  3SE0 A;  1Q1E A;  3BDL A;  4K6D A;  2ATW A;  3RZO H;  3BZK A;  1B7Y B;  1EY8 A;  3U9S A;  2OTL A;  3G48 A;  4JBK A;  2ENB A;  4IJL A;  1EU3 A;  1ONL A;  1AN8 A;  2HUG A;  5D14 A;  1YHQ A;  2F03 A;  3BZC A;  3PQI A;  1A62 A;  1YHA A;  2ICE C;  4X3S A;  4PZ8 A;  4GNX A;  4ZQ3 A;  2Z6K C;  4B08 A;  1EWH A;  1XNR Q;  2R7F A;  1C9O A;  1FVI A;  2MO0 A;  3VYR A;  1F2M A;  1MJC A;  2BA1 A;  3KOJ A;  3EJI A;  1TS3 A;  1VQK A;  1I4R A;  4GLA C;  5M3F G;  4DV4 L;  5GQO A;  5IP9 G;  3EIV A;  2ES2 A;  4A93 B;  3PIO A;  4GLX A;  1LYL A;  4LFC Q;  4GS3 A;  3GTL H;  1QCB D;  4A3M H;  3UDX A;  1VQ8 A;  3GTO B;  3H0G G;  3GP7 A;  1K8G A;  2L12 A;  1TQO A;  1LTT D;  3T4A C;  1QG7 A;  2RA4 A;  1RTN A;  4QUF A;  3HFZ B;  4ABN A;  1KHI A;  3K5L A;  4LF5 Q;  1LTA D;  2JYO A;  4Z9C B;  4FP5 D;  2IPK D;  4JW0 A;  1YNN C;  4A3J H;  4QY7 A;  1JJG A;  1X9N A;  3S2D H;  1VQI A;  1NAP A;  3U58 A;  4PV1 C;  2K32 A;  4IUT A;  2TSS A;  1B9M A;  4RGN A;  5IYC G;  1Y8P B;  5A2Q E;  1VQH A;  4A3F B;  4FF3 A;  4KD4 A;  2P5Z X;  2C5C A;  3I70 A;  3CPW A;  1C0A A;  1EWC A;  5LL6 X;  3J81 E;  2PMZ E;  1UEA B;  1A3U A;  2XIW A;  1WTW A;  4IUN A;  2M00 A;  4GOP C;  4UP9 A;  1L1O B;  4CKB A;  2F4V L;  3NEM A;  4L6T B;  1S5E D;  3C1F A;  4MTK A;  2KVM A;  4X62 L;  1SRO A;  1LTS D;  4HID A;  4BY1 B;  1YJN A;  1W2B A;  3HZX A;  4DAP A;  3FHW A;  1JJC B;  4ZCK A;  1SN8 A;  1TR5 A;  2PQA A;  3TP5 A;  5C4X B;  3TS2 A;  5DM6 3;  2C35 B;  5IIF A;  4LF6 L;  1CSQ A;  2Q8R E;  4KV6 A;  4XYO A;  5BR8 Q;  4CDD C;  4Q5V A;  4R4Q A;  4X65 L;  4R9W A;  1K8A C;  2L1B A;  5D3I B;  1SND A;  2B2Y A;  3MVV A;  3I2Z A;  5J1Z A;  3HG9 A;  1NMG A;  2R61 A;  2KCN A;  1Z6H A;  1XWE A;  2N78 A;  3J7Y W;  5CBA E;  3S9W A;  2EY2 A;  3K5N A;  3E3X A;  3L2P A;  1HR0 L;  2A69 C;  2L0C A;  2EIF A;  2B2T A;  4A3J G;  5IWA Q;  4NKL A;  4U67 3;  3ND9 A;  4O0A A;  1VCI A;  3VA5 A;  2R92 G;  2XRS D;  3PO3 H;  5JAV A;  2RVL A;  2AWN A;  1HQM C;  1Q81 C;  3GTG H;  3HS0 C;  2NVY H;  4HJ8 A;  1D5X C;  4ZK9 B;  4KI0 A;  4KY5 A;  3A56 A;  4DNI A;  1SYC A;  1SRU A;  3H6M A;  4A3D B;  1EYC A;  1J9O A;  4GN4 B;  1HA5 A;  3GTQ H;  4DR4 L;  4X3T A;  1W6K A;  4KD3 A;  1FNV A;  2A5H A;  3MHB A;  3RUZ A;  3PSI A;  4LW1 A;  1MJE A;  1LT4 D;  1C48 A;  1OXV A;  1IYJ B;  3WDN A;  1NUC A;  1QIL A;  3J7A V;  2NUC A;  4PQX A;  2O2L D;  2XRQ D;  1ASZ A;  2LSS A;  3S1M B;  2K5D A;  2JA7 G;  4XXE A;  3HKS A;  3S14 B;  4TQU S;  5FLX c;  1SNC A;  5M3F H;  1BVS A;  1CA5 A;  2B2U A;  5E4X A;  1YIT A;  1SJE D;  2L55 A;  1UWV A;  3H3V I;  1MGS A;  1O78 A;  4RHS A;  1CTM A;  5C4Z A;  1SBB B;  1VMC A;  3VR4 A;  1XMO L;  5CV4 A;  4A3C G;  1H9S A;  1S3O A;  1RL2 A;  1IBM Q;  1V1P B;  1HA6 A;  2B2V A;  3GO5 A;  1KNE A;  4DAM A;  4UP8 A;  5I9P A;  4R1J A;  2ICI A;  1JWU D;  4DUY Q;  1FJG L;  5JJZ A;  1HNZ Q;  4HN7 A;  1PMR A;  1ROD A;  1U4R A;  3TP7 A;  2K5H A;  5I2Y A;  1K9M C;  1Q90 A;  1GUN A;  2Z8L A;  1EY9 A;  5EPK A;  3CCE A;  3RZD B;  1TXY A;  5KND A;  1VQN A;  2AQ2 B;  1SDF A;  1PH6 A;  1MKH A;  3RN2 A;  4APV A;  3HOZ B;  4LFC L;  5GAD C;  4G7O C;  3J81 c;  3SHL A;  3OWE B;  2VQF Q;  4NDX A;  4IPG A;  1K28 A;  2XGT A;  4EQN A;  2VUM G;  3NEL A;  3I4L A;  4OO1 I;  1SJH D;  1PFM A;  4I7Z C;  1NCV A;  2A19 A;  2N88 A;  1BBW A;  1E22 A;  3F2B A;  2NTT A;  3M4O B;  2K7V A;  1UE5 A;  1SYD A;  3CW2 C;  3HGB A;  4HCE A;  4DUY L;  3CC2 A;  1QUQ A;  3PCO B;  4DV1 L;  1II3 A;  1NSN S;  2K28 A;  1R4Q B;  1R9T H;  1XPR A;  1YZ6 A;  1V1Q A;  4OWW B;  1K8O A;  1NBW A;  4IUQ A;  3OSO A;  4A3E H;  1YNJ D;  3RZO B;  2B2W C;  3TZD A;  1GD7 A;  3FRP B;  2HCI A;  2UUB Q;  4DPG A;  3S16 H;  1PFS A;  2JE6 I;  1AFP A;  4HMJ A;  1XYI A;  4RCO A;  3HOW G;  3HOW B;  1K0S A;  2UUC Q;  2PQE A;  4A3L G;  3M7G A;  1ET9 A;  2R6G A;  3DWP A;  5M5X H;  2FHT A;  3KBG A;  3D6C A;  3P7J A;  2KEC A;  3GTK B;  4LF4 L;  4YIJ A;  4IUP A;  2RBM A;  2L9H A;  2B63 B;  4CDE C;  1HUM A;  4X3K A;  5I9O A;  1H9K A;  1CKN B;  1JWM D;  2K50 A;  3T1H L;  4BBR H;  1VQP A;  1F77 A;  1A8V A;  1O7L A;  1TWC B;  3GTM H;  1MSG A;  1OXX K;  2R93 G;  2A68 D;  3KDF A;  4LF8 L;  2MPM A;  2J7Z A;  2Y0S G;  3MXU A;  4OWT B;  2K75 A;  4AH6 A;  5JOB A;  4RKL A;  3KJP A;  1E7Z A;  2G9D A;  3JC6 6;  3OIP A;  5IY0 A;  4FYD A;  1WTQ A;  2O5I C;  2QKI C;  4PMB A;  1C7Y A;  2A73 B;  1MHW C;  1VQJ A;  1BBX C;  3J81 i;  4A3F G;  3W2D A;  1VF5 C;  3K0Y A;  1C8C A;  1UAP A;  1S4Z A;  2A6H C;  1V9P A;  1VMP A;  2F0M A;  1JJ2 A;  2KED A;  4ZKC B;  3I91 A;  1Q8K A;  5M5Y H;  4X64 Q;  2QEX A;  3E9I A;  1CT1 D;  4ME3 A;  2JEB I;  4BS9 A;  3K5O A;  5COY A;  4BY7 H;  1YNX A;  1LM0 A;  1YJ9 A;  1M1K C;  2NN6 H;  2UXC L;  4P72 A;  2QEJ C;  4DK3 C;  3CQZ H;  1TS2 A;  1SMY C;  5BN3 A;  3CC4 A;  5CV8 A;  4FXK C;  4DR2 Q;  4A3I G;  1I3Q B;  2EXD A;  3K57 A;  3J81 L;  1K73 C;  4DR1 L;  1X56 A;  1Y8N B;  1RKN A;  2K5W A;  2VQE L;  1NR2 A;  1U9R A;  5IGG A;  1JC7 A;  3GTO H;  1EU4 A;  5M5W H;  2ZJQ A;  1B4O A;  1EEI D;  4GNX C;  2RF4 A;  1BNZ A;  1X54 A;  2Z6K A;  3V2T A;  3MA2 B;  4QQB X;  3E6Z X;  5CGK A;  4QIW B;  2NVX H;  1WD1 A;  5JPM C;  4JI5 L;  1HFN A;  4QMG A;  4C3J H;  1VF7 A;  1K3R A;  1SLJ A;  1Z9F A;  2LKV A;  2NVY B;  4P73 A;  2EY1 A;  2Q8T A;  3EA6 A;  2AUK A;  4NP5 A;  3R93 A;  3UDG A;  3URY A;  4X62 Q;  1EY0 A;  4C1N I;  3W5O A;  1N9W A;  4AYB B;  1QNK A;  4WRD A;  5CV9 A;  1QZG A;  4HCS A;  3S1Q B;  1KAW A;  2EE1 A;  1PZI D;  3CF5 A;  1IYV A;  1NJI C;  1SE4 A;  1GXD C;  5JJK A;  1TWG B;  2AWO A;  1STE A;  3R2I A;  5FJ8 G;  2EPB A;  1BCP F;  5EKK A;  2XWB B;  2IX1 A;  1EOT A;  4HJ7 A;  3CD6 A;  1FL0 A;  5G3L F;  4JBM A;  4WJ3 M;  3BDC A;  4RFB A;  1DZ1 A;  4WFN 3;  3PO3 G;  3ERQ A;  1E2V A;  4B9X A;  4A3M B;  1U4P A;  3BVM A;  5IT9 c;  1O7Y A;  2KHI A;  3SEB A;  4JV5 Q;  4RGO S;  1B3A A;  1SYG A;  4EQ5 A;  4OEL B;  4MHE A;  2C9O A;  4JI8 Q;  3NUC A;  3TEH B;  5C44 B;  4GOP B;  3QOJ A;  3KLS A;  4TSS A;  1BR9 A;  1PTO H;  2VL6 A;  2YV5 A;  3PUZ A;  1MBY A;  1WTV A;  4A3E B;  1PFN A;  3E0J A;  3X3M A;  3CQZ B;  1VQ6 A;  4JCV E;  4IFD J;  2Z1C A;  3MC0 B;  3R8B A;  3IL8 A;  5COR A;  1EY5 A;  4IO9 A;  3OHX C;  5EKL A;  3K7A B;  4F7X A;  2CCZ A;  2Q2H A;  4XQN A;  5C4J B;  2K5N A;  4DUZ L;  5HUR A;  2J0T D;  1CM9 A;  3LGJ A;  2JA6 G;  5GAE C;  1IBL Q;  2VB3 X;  2MHV A;  4QL5 A;  1L0W A;  5KRU A;  1STB A;  2KHS A;  5IT9 L;  3AMU A;  4XIG S;  5TSS A;  3TN2 A;  1TY0 A;  4LNQ A;  1D5Z C;  2PPB C;  1HZ9 A;  1Y1W G;  1KAA A;  1LV9 A;  1VQ9 A;  3DEO A;  4A3E G;  3G71 A;  3KLW A;  2OEO A;  5ISR A;  2MP1 A;  2PMZ B;  3FPP A;  4IAL A;  4A3B H;  3S1R B;  1DOM A;  1W3S A;  1UE7 A;  2BA0 A;  4QCL A;  2WIN B;  3A8K E;  4EQO A;  1OTC A;  3A55 A;  1LAB A;  2KUM A;  1EFI D;  3HOU G;  4HTH A;  2JSO A;  3I4N B;  1OXT A;  1YI2 A;  1QVG A;  3GTK H;  4C2M B;  4DV6 Q;  1RIP A;  3CCR A;  1B70 B;  2JA9 A;  3BYY B;  1E1T A;  5M5X B;  2JA7 H;  1CA6 A;  4CKE A;  1EY7 A;  4KHP L;  2BE5 D;  2UU9 Q;  3TME A;  3EVQ A;  4OIJ A;  1PLF A;  1HNW L;  1NTG A;  4HIK A;  2ZXR A;  3NQI A;  3IAY A;  4DV7 Q;  4A3G H;  1AE2 A;  5T1I A;  1Z47 A;  3CCU A;  4K6L A;  3GDE A;  4DV0 Q;  1KAB A;  5IE8 A;  4DK0 A;  1JB7 A;  3FPU B;  3MEF A;  3CXC A;  4LJZ C;  4GLV B;  4L8J A;  5C0X J;  2F0N A;  1LLR D;  1SEB D;  5DLQ E;  1ZKO A;  4DR7 Q;  3R2T A;  5E3F A;  1T9H A;  2KCM A;  4POF A;  4MNO A;  4H44 C;  1KRS A;  1QVF A;  4LF7 Q;  1JOK A;  4K8I A;  2DY8 A;  4O1N A;  5FO8 B;  2BDN A;  3S15 H;  4B9W A;  1I4H A;  5T1G A;  4M1U B;  5EKI A;  3AEV A;  1STH A;  3DMU A;  4KLK A;  1UEB A;  2IL8 A;  2B2U C;  2Y0S E;  3I3C A;  2IHE A;  2YYZ A;  3W3A A;  1K83 B;  2ALY B;  3HOV B;  1U4M A;  1VQC A;  1PDQ A;  3K7A H;  3FKI H;  2EYM A;  3CME A;  4PNY A;  2UXD Q;  4C2M H;  5FO9 B;  2RDG A;  3D4W A;  1HTP A;  3KLS X;  2F0I A;  2WAQ B;  2LFN A;  5FLX L;  4X66 L;  1EL0 A;  1Y8O B;  1HQR D;  2K1B A;  4DAV A;  3CHB D;  4DV3 Q;  1JE4 A;  2PI2 E;  1U4L A;  3SDZ A;  2KEE A;  3TRE A;  2MNA A;  3S1N H;  1P16 A;  5IYC H;  1SNO A;  2K04 A;  3M4Q A;  4M8A A;  4J8Q A;  4DK6 C;  3K8A A;  1A6X A;  4B3S Q;  1LTL A;  4Y7N B;  3NBH A;  1ESF A;  1O80 A;  1TWH H;  3FVQ A;  3T51 B;  2ZM6 Q;  1VS0 A;  1M8A A;  2VUM B;  1TWG H;  4H7B A;  1F2L A;  2Z4I A;  3S2H B;  3A5Z B;  3TSS A;  5C0X H;  5AJ3 Q;  4LFA L;  1A15 A;  2IX3 A;  4C3H G;  2UUA L;  1KIX A;  4HSP A;  3P1H A;  5EPJ A;  1ASY A;  1CQV A;  3TQY A;  2F3I A;  2NVQ B;  2K52 A;  1D5M C;  1J5E L;  4A3J B;  2BH8 A;  2MJ8 A;  5CV6 A;  4YY3 Q;  4KY6 A;  2OQ0 A;  2CQA A;  4JBJ A;  5ELD A;  2H4O A;  2D0O A;  1EOV A;  3M3Y B;  3PIO 3;  2H5X A;  5IT9 E;  2D0P A;  4GNX B;  1UE6 A;  1GJX A;  2F0O A;  4RKB A;  3PUX A;  2KCT A;  5ELN A;  1FJG Q;  2E5L Q;  4A3C H;  3FKI B;  5C4H A;  1E3P A;  4RAU C;  2MFI A;  4XT1 B;  1DYQ A;  5M9O A;  2M9V A;  2IX0 A;  4O42 A;  1RCV D;  2E2D C;  2KCC A;  3CPF A;  5CYU A;  4EVO A;  2B2W A;  4HMI A;  4R4T A;  2YU9 H;  5E4W C;  3SGI A;  3MAQ A;  4K2K A;  1HUN A;  5C3E G;  2NTS A;  1VQ4 A;  1TWF B;  3S17 B;  4DUZ Q;  1ESR A;  1CSP A;  1B1Z A;  2F4V Q;  1DON A;  1K0R A;  1EZ8 A;  1V43 A;  5D3D A;  4EQP A;  4B3M L;  1MIU A;  1TWF H;  3UE0 A;  5CV5 A;  2WAQ G;  2LXJ A;  2BOS A;  4FNF A;  1ML0 D;  2F0H A;  3D31 A;  1ZYR D;  4V0B A;  1Y14 B;  5FK9 C;  2Q8I B;  5CR3 A;  2MUY A;  2PW5 A;  2WV6 D;  5E7N A;  1XTD A;  1JOO A;  3WOE A;  4IFD H;  3FP9 A;  2Y0S B;  4CHT B;  1J8I A;  4IPD A;  4KKU A;  4IPC A;  1NY4 A;  5KIX A;  4G7H C;  4N8F A;  1XPO A;  1EFW A;  5C4X H;  1KDA A;  3ICE A;  1EQQ A;  1DOK A;  1LT3 D;  1SNQ A;  1EYG A;  4G7Z C;  4RH6 A;  1AEX A;  3ULL A;  1UUP A;  4P71 A;  1SYE A;  4L5Q A;  5IGD A;  1H9R A;  5J3B A;  1FNU A;  2SNM A;  1CI3 M;  1PRT B;  1ZEQ X;  3TP6 A;  4IUV A;  4DV5 L;  4NXN Q;  2KQ3 A;  5KNB A;  1M90 C;  2B29 A;  4C3I B;  1WFQ A;  1J5E Q;  2Q2U A;  1IL8 A;  1VDZ A;  2HDL A;  1PXU A;  4OWX B;  3NE5 B;  1X3Q A;  4DV4 Q;  2IWH A;  1A3T A;  4A3K B;  2JA5 B;  4DAY B;  2F0E A;  2EXZ A;  1E1O A;  1X3E A;  4ZUJ A;  5AJ3 L;  1HH2 P;  4YCW A;  4HED A;  1DJR D;  4DF7 A;  1IHZ A;  3U9O A;  4YCU A;  4YWM A;  4DA2 A;  3D0F A;  2CVR A;  5C4J H;  4AQY L;  1HNZ L;  1IL2 A;  3S1Q H;  3Q6S A;  2VQE Q;  3I4M B;  2QF7 A;  4DR1 Q;  3KF6 B;  5GAH C;  4B3T L;  2JK8 A;  2YTV A;  1I4Q A;  1PTO B;  2Z9H A;  1W6J A;  5JJI A;  1YHB A;  4B3T Q;  3VYU A;  3U4V A;  2WFW A;  5I6W A;  4A3B G;  4MIU A;  2AHO B;  4TVA B;  5C44 H;  1RHP A;  2EYJ A;  1Z7T A;  2WB1 G;  1K83 H;  3HOV H;  3OOC A;  4OGQ C;  4LK1 C;  3UDI A;  3FMC A;  3PIP A;  3GTL B;  2QGQ A;  3ZJY C;  4RWS C;  4DR2 L;  1N33 L;  3CCQ A;  4DU9 A;  1EYA A;  4XDX A;  1TS4 A;  1IW7 C;  3VYT A;  2E2H B;  4Q0F A;  5IP9 H;  3E0E A;  5DNF A;  4LUZ A;  2F0K A;  1QZH A;  2NVQ H;  3KF8 B;  5JEA J;  2H1E A;  3FEW X;  2VZA A;  2JN4 A;  1R9T B;  5ELB A;  4DR7 L;  2LXK A;  5K36 H;  4NMZ A;  5K36 G;  2M2L A;  4HJA A;  1HR0 W;  4A3K G;  2A68 C;  2JA8 H;  3N6R A;  1YVC A;  2A6E C;  3MZ5 A;  1L1O A;  2DGY A;  3NP8 A;  4L5R C;  2VXW A;  1G29 1;  2HQE A;  3V96 A;  3RLF A;  1EQV A;  3B6Y A;  3K0X A;  2VNU D;  1T5E A;  2F3W A;  1Q1B A;  1BF4 A;  5IYB H;  5F2D A;  1VQF A;  2F4I A;  2I5L X;  3H0G H;  5DEH A;  1G2T A;  1MI2 A;  5IWA L;  5M3F B;  1KNA A;  1PVO A;  1AP0 A;  3STB D;  1U5K A;  1IBK L;  3J7Z C;  3QO2 A;  2R3Z A;  3ERO A;  1CKO A;  2NZH A;  4K0K Q;  2N8N A;  1ILP A;  2IW3 A;  4JVZ A;  1BO0 A;  4KN7 C;  1EEF D;  4DKA C;  2OQK A;  2JA6 H;  3I55 A;  1B50 A;  1E2Z A;  1RJT A;  3S1R H;  4LF9 L;  4H0L C;  2A8V A;  3GTP B;  1G6Z A;  4KN4 C;  3QB3 A;  4PMC A;  1AW7 A;  5LMU Q;  5LMN W;  4DR6 L;  4X65 Q;  1HPC A;  4A93 H;  1RF2 D;  2ZT9 C;  3NEN A;  5BR8 L;  1D1I A;  1PRT D;  1A0I A;  3PUW A;  2EZV A;  2K4K A;  2XVS A;  4HSV A;  2SEB D;  3T13 A;  5K5P A;  1DCZ A;  1HNX Q;  3V05 A;  3ZYY X;  2E2J H;  5HY6 A;  4KHV A;  4R4I A;  2HCC A;  2F0J A;  4QB4 A;  3RR5 A;  2JA5 G;  2VQF L;  1BQQ T;  2HHH Q;  2OWO A;  2WP8 J;  2I07 B;  1TWC H;  1X3F A;  1RD9 D;  1PYB A;  4OIK A;  4IQZ A;  3ND8 A;  3AU7 A;  3TZU A;  1IYU A;  1PH9 A;  3FKI G;  4KHZ A;  2PI2 A;  3S1M H;  1GM5 A;  4YY3 L;  3GTJ B;  1SAP A;  1Q12 A;  2YU9 B;  1WJJ A;  4KK7 A;  2B63 H;  3LWU A;  2KOL A;  1DGS A;  2OTJ A;  3DHQ A;  1N8R C;  4ULL A;  1GVP A;  2EYL A;  4G57 A;  4A3G G;  4K2L A;  3AFQ A;  4JI1 L;  1CHP D;  1D6E C;  1YEZ A;  5ELO A;  2R7Z H;  3SXH A;  4BBS B;  1D7Q A;  5IP7 G;  1G51 A;  1FD7 D;  2PZU A;  2RSO A;  3D4R A;  4N9P A;  4JBW A;  3VYS A;  4C3J G;  3I4M G;  2SOB A;  3MXN B;  1YBY A;  2A6E D;  2XTI A;  3WOF A;  1B9N A;  2ZXO A;  5EGT A;  3I7F A;  1SYB A;  1WTP A;  1WYD A;  3BVZ A;  4DNR B;  3OMC A;  2Z4H A;  4BY7 B;  1ILQ A;  4PG3 A;  3CC7 A;  4JYA Q;  3KJO A;  5G3L D;  5A35 A;  1QJO A;  1GHK A;  3S2H H;  2RKS A;  1AZP A;  5GAG C;  4UDU C;  3KDF B;  4O2D A;  1UE1 A;  5FLM H;  2R92 B;  2R93 H;  2EY6 A;  4F87 A;  3GD7 A;  3I72 A;  1D2B A;  5BN5 A;  3HRZ C;  4DR5 Q;  1CK1 A;  1I6H B;  1AZQ A;  2PQA B;  2PCF B;  4BXX H;  2K6A A;  3VR2 A;  2CW0 C;  1TWA B;  2NB0 A;  5IGB A;  4HIO A;  2PNR C;  5C5L A;  2YTY A;  1TII D;  1DXM A;  4P2C B;  3SR1 A;  1FGB D;  5HGQ A;  2FMC A;  3N52 A;  5LMN Q;  1FR3 A;  1EYD A;  3M7N A;  3J7A 5;  3RLN A;  2E75 C;  1N36 L;  3PO2 H;  4JI5 Q;  3M4P A;  1BUV T;  1X6O A;  4RMF A;  2DNC A;  2ZTC A;  1JIC A;  4NW2 A;  3T1Y L;  1I94 Q;  4GKJ Q;  1STA A;  2SNS A;  4A75 A;  2A1A A;  2XSC A;  1BBU A;  3QR8 A;  2RHQ B;  1HR0 Q;  1Y1W H;  4X64 L;  2R7Z G;  2D62 A;  2CWA A;  4HJ5 A;  3MFG A;  5CMD A;  1JOR A;  5JJL A;  1A63 A;  4RCN A;  3PMF A;  2JXM B;  3K5M A;  4FF1 A;  4Y7N H;  1I4G A;  2GN5 A;  3A7L A;  3H09 A;  2BDO A;  2L11 A;  4RA8 A;  1EWI A;  2N49 A;  2L4N A;  3ER0 A;  3H3V C;  5LHY 1;  1WTR A;  3PO3 B;  1YNN D;  1O7Z A;  4K8J A;  1SXT A;  4DXG A;  2FMM A;  2CH4 W;  5CBE E;  4A76 A;  1N36 Q;  4JI3 Q;  1EY6 A;  2YTX A;  4XQQ A;  3M4O H;  3BVG A;  2JJQ A;  1PH2 A;  3NWT A;  1PH7 A;  2F0P A;  2NWG A;  3NXW A;  1X3P A;  4KJO A;  5FLX E;  2IT1 A;  2ASB A;  4FDB A;  1PHJ A;  2NVX B;  4YHH L;  1PTO D;  1X65 A;  4LFB L;  4IOC A;  3OW7 A;  4OO1 H;  3T1Y Q;  3VR6 A;  3GTQ B;  1L2F A;  1CKN A;  1E2W A;  2DJF C;  2AQ1 B;  2F0D A;  5KNC A;  2F0G A;  5ELE A;  1KL9 A;  5C3E H;  5E1F A;  4DN4 M;  4P75 A;  4UPA A;  1RTO A;  2K01 A;  5IOD A;  1JE5 A;  5LL6 S;  1B8A A;  3CCV A;  1L0X B;  4IFD I;  3DEP A;  3SK5 A;  5L37 A;  4C3H B;  1ET6 A;  2CFM A;  3NQT A;  1BCP C;  3A7A B;  2GVB A;  2MQH A;  1B44 D;  3QG1 A;  3C1E A;  4JI2 L;  2FXQ A;  5C3W A;  2B63 G;  2UXB L;  1HFG A;  1H9S B;  3OTO Q;  3HKZ G;  2V4D A;  5IGE A;  4A3B B;  3EQL C;  4RHR A;  1L0Y B;  3HOX B;  4JI7 Q;  3VR5 A;  1TU2 B;  4DV1 Q;  1CZG A;  1TY2 A;  2F0W A;  2WAC A;  2E2J B;  2XWJ B;  4I7A A;  1LTI D;  2PNH A;  2E74 C;  4FXG C;  1JOQ A;  4A3K H;  2VS1 A;  2JA8 G;  4F88 A;  5I2X A;  1GUW A;  3KFU A;  1NR4 A;  2VB2 X;  1GUT A;  3J80 i;  3J80 L;  5I6Y A;  3S1N B;  5AFW A;  4IJH A;  4P74 A;  5C44 G;  2ID0 A;  2F0F A;  2I5H A;  2RCF A;  3DXJ C;  1HHV A;  1I50 H;  4CJ2 C;  1RDP D;  4CJ0 B;  2L15 A;  2FIN B;  2CKZ B;  2CH4 A;  2LS0 1;  1KLU D;  1F2Y A;  3A8J E;  1X3G A;  1QVC A;  1IW7 D;  2AKW B;  1ZXT A;  3K7U C;  4JI1 Q;  1V1O A;  3SK6 A;  1VQB A;  3P75 A;  3TBI B;  4DV6 L;  2VY3 A;  1Q8I A;  3I4O A;  5KYL A;  4FF4 A;  2RQX A;  3SVM A;  1LO5 D;  5FJ8 H;  5DM7 3;  1QUQ B;  1KDB A;  1VQA A;  3L0O A;  3TDQ A;  5C0X I;  4A3F H;  4A3D H;  1A2U A;  3QWN A;  2CHB D;  4DGZ A;  3K6O A;  4PZ7 A;  3GTG B;  5CC4 A;  1EUJ A;  3BS1 A;  2OXP A;  2O5J C;  3HOY H;  4ME5 A;  3EN2 A;  1WCM G;  5LMU L;  2HHH L;  1XMQ L;  2NN6 I;  2JEA I;  4GKK L;  2QW7 A;  3H94 A;  4DV3 L;  3OYY A;  4R8N A;  1ICW A;  2F0U A;  4BBR B;  2QDB A;  4ILW A;  4JI2 Q;  1IBM L;  1TVX A;  1JR0 D;  4JK1 C;  4JI0 Q;  4OHJ A;  2N3S A;  2R7Z B;  4UY8 C;  1K8M A;  2FJ2 A;  3UI2 A;  2K03 A;  2K5Q A;  4JOI C;  1LTG D;  3J80 E;  3HOW H;  3ULP A;  1VQO A;  1G6P A;  5EQ0 A;  1DOL A;  5IGC A;  2B8G A;  1TS5 A;  4LF9 Q;  2WB1 B;  3T53 B;  1GUG A;  2F1M A;  3CMA A;  1T5X D;  4N9T A;  1L1O C;  2F0S A;  4LFB Q;  5EPL A;  3G4S A;  1U0L A;  1S5D D;  3H15 A;  3PO2 B;  1AH9 A;  1JCK B;  4CJ1 B;  5DAU A;  4BBR G;  2EVB A;  1B2T A;  1GO3 E;  4DR3 L;  1HTL D;  4LUO A;  1JB3 A;  4OX9 Q;  3ITP A;  1FGU A;  1WOC A;  5JEA G;  5ELC A;  3NTK A;  3PGZ A;  1XTC D;  3G7L A;  1EY4 A;  1TWA H;  4DR3 Q;  3BDO A;  3HOV G;  2F52 A;  2EYH A;  3IFT A;  5D65 A;  5C3X A;  2VUM H;  4ZYS A;  2DY7 A;  3HP3 A;  1NE3 A;  4HIM A;  3KF6 A;  2VW9 A;  3F8T A;  1STY A;  1VQD A;  3HKZ B;  2Z0S A;  4ID6 A;  1BKB A;  1V8Q A;  3EBE A;  1EIY B;  2ZXP A;  1MSH A;  2Q2I A;  1G2S A;  4RGM A;  4JI3 L;  3W1G A;  5KEE A;  3T56 B;  1WD0 A;  3C46 A;  1SE8 A;  5EBD A;  4R8I A;  3RZD H;  3S17 H;  1V1P A;  4FVM A;  1OO9 B;  3ONA B;  1IXR A;  4IZ8 A;  3PIP 3;  2JA6 B;  2ZTE A;  4CKC A;  1G8Z D;  5LMN L;  4A3I H;  4A93 G;  4BY1 H;  1BCP D;  1EZ6 A;  4GKK Q;  3C3L A;  1XMQ Q;  3Q22 A;  4BA1 I;  3NTI A;  1PH3 A;  4J1M A;  3RMH A;  4V19 0;  4BBS H;  2QIL A;  5JVH 3;  4H02 A;  3AFP A;  1BOS A;  1S5F D;  1M4V A;  2HIV A;  3U50 C;  3G6E A;  5IYD H;  4RG1 A;  1MD2 D;  4YCV A;  4DR5 L;  2IHF A;  2RSN A;  3I4N H;  1E0B A;  1LTB D;  5C6A A;  4NB3 A;  4L5S A;  3K81 C;  1EIG A;  2PZW A;  3DWA A;  4RGT A;  1SMY D;  2A74 C;  3D6W A;  1LT6 D;  2HDM A;  4EX5 A;  2UXC Q;  1D1K A;  1JWS D;  3W1B A;  4IUU A;  1IBL L;  4QGU A;  1VQG A;  2NYZ D;  1LTR D;  5FKA C;  2FFK B;  3HOX H;  3CCM A;  2I5M X;  4QJF A;  4BA2 I;  1WTO A;  4AQY Q;  3CKI B;  1G91 A;  1PTO C;  1X32 A;  1S5B D;  4KKS A;  1IZ6 A;  2D9U A;  3AQQ A;  4MTN A;  2JP1 A;  3MXG A;  1OXS C;  3PUV A;  5IYB G;  1YNJ C;  1J6Q A;  2G5D A;  3JAM c;  1N34 L;  4C3H H;  1TWH B;  3F1Z A;  4AYB G;  2AMC B;  2F0T A;  4LF7 L;  3LWE A;  5BN4 A;  3J7A F;  3ULJ A;  3Q8D A;  4GN3 B;  3TP8 A;  1QWY A;  3E9H A;  3UE1 A;  4DXF A;  1GUO A;  3D3R A;  1B3Q A;  2GA4 B;  2EJG C;  3RN5 A;  4NPS A;  4DV5 Q;  4OX9 L;  1STG A;  1KDC A;  1JT8 A;  4C3I H;  1X55 A;  1FYC A;  2OT2 A;  2LMC B;  1XMO Q;  1E24 A;  4LF5 L;  1I4X A;  2EJM A;  1VQM A;  3LX0 A;  3M3Y H;  4KMU C;  4DV0 L;  1SYF A;  2A6H D;  3A74 A;  3BYT B;  1N32 Q;  1Y1V B;  2CWP A;  2EYF A;  4DV7 L;  4HAE A;  1HRJ A;  3RD4 A;  1XPU A;  4C56 C;  1JQY D;  2A69 D;  3H0G B;  3JAM L;  5CV7 A;  1GOZ A;  1PV4 A;  3HOY B;  3HOY G;  3F2C A;  4CBV A;  3KBX A;  2KA7 A;  2UUB L;  3E5S A;  3K80 C;  4YWK A;  2X6G A;  4K14 A;  3HEJ A;  2WKC A;  2BCO A;  1Q86 C;  3SK4 A;  2NN6 G;  1HXY D;  1OXU A;  2XN9 C;  1HNX L;  3M4Y A;  1HZA A;  2E8G A;  1Y1W B;  4B3M Q;  4ZUI A;  3F2U A;  5J39 A;  2JA8 B;  3K58 A;  2RDF A;  1B53 A;  3C2P A;  4L63 B;  3I90 A;  5JVG 3;  4LWC A;  4H13 C;  3S14 H;  4BBS G;  1JMC A;  2CW0 D;  5GRO A;  2DN8 A;  2RDH A;  2KHJ A;  1H9M A;  1SE3 A;  4A3G B;  4K0K L;  1EIH A;  4IN3 A;  1BDO A;  2E2H H;  1IBK Q;  2D2C C;  4K5X A;  2Q2T A;  3MXN A;  1PZJ D;  2L5T A;  1GKH A;  5M5W B;  1A2T A;  3OPO A;  3OIQ A;  2E5L L;  2R7D A;  2K14 A;  2EYO A;  2OF1 A;  1FNW A;  1QNU A;  2WAQ E;  3O13 A;  1EQR A;  5M3M B;  2K33 A;  4C3I G;  2ZM6 L;  3S16 B;  4OEM B;  1IKM A;  3D8G A;  4A3I B;  2HD3 A;  3S15 B;  3IRB A;  4DFA A;  4JPB W;  4B3S L;  2B8F A;  2RHS B;  1LUZ A;  1PH8 A;  3J80 c;  4A4I A;  5IP7 H;  4IFD G;  3DLL A;  3OWF A;  2UUA Q;  4OON A;  2EYP A;  4LFA Q;  1PH5 A;  2AUJ D;  1BCP B;  3EFX D;  1CFM A;  4K5W A;  4WOR A;  2IY5 B;  3PUY A;  1KQS A;  3KYH C;  4DV2 L;  1PH1 A;  4I65 A;  1HZB A;  2F0Q A;  2WKD A;  3MXP A;  3PO2 G;  2E2I B;  2EDG A;  1VQ7 A;  3H3V H;  4QF4 A;  4CGY B;  1NNX A;  4ZLT F;  2B39 A;  3CRL C;  3MEH A;  4B3R L;  4UP7 A;  5EAY A;  1VQE A;  3VA7 A;  5C3E B;  2IJ0 A;  2MO1 A;  3P20 A;  5JPN C;  1K3B C;  3HOX G;  4JI4 L;  1S40 A;  5HGT A;  1SSO A;  1WI5 A;  3GV3 A;  4ZRZ A;  3I4N G;  3BZD B;  1YJW A;  3Q24 A;  4ZAI A;  3CRK C;  1IKL A;  4BXX G;  4FO2 A;  4X6A H;  1VQL A;  1CKM A;  4GOP A;  4R4O A;  2J4X A;  1KD1 C;  4LUV A;  3STB C;  2DJG C;  2NVT H;  5KYI A;  4TRD A;  2PO4 A;  3HKZ E;  1PRT C;  4YHH Q;  3AB9 A;  2F0L A;  1CHQ D;  4XYQ A;  4UHV A;  3Q0A A;  1UNS A;  1PYW D;  3OMG A;  1R4P B;  2X6L A;  4XT3 B;  4DV2 Q;  4XTC S;  1CQF A;  2G9H D;  4BWG B;  1H9J A;  1HNW Q;  2JA5 H;  3CCS A;  4X3U A;  4ODG A;  4NXM L;  3RLO A;  3RNU A;  5C0X G;  1WVL A;  2NZ1 D;  3QJY A;  1NMF A;  4LAA A;  5ELF A;  1XJV A;  4KY7 A;  3CCL A;  2HT1 A;  5C4X G;  2B2Y C;  4EGV A;  1S5C D;  2O4X A;  3S24 A;  3KUP A;  1PYS B;  4WJ4 A;  1SMX A;  4DK1 A;  3A0J A;  2EOT A;  4YWL A;  3GV6 A;  2OCE A;  1ENA A;  3U4Z A;  4BY7 G;  1LT5 D;  3G6J B;  1SFO H;  1Y1V G;  2UU9 L;  2N55 A;  4JI6 L;  5M3M H;  3DM3 A;  3Q23 A;  2B2T C;  4GKJ L;  3I73 A;  3CAM A;  5NUC A;  3JAM E;  1TT2 A;  2XNA C;  1QE6 A;  3NSW A;  2CQO A;  1ICF B;  3KF8 A;  1I3Q H;  3I56 A;  1KLG D;  2KEN A;  3M9B A;  2K5V A;  3KLR A;  3IKJ A;  2D5D A;  4E6I A;  1O7I A;  4HR7 B;  4DR6 Q;  3TS0 A;  2V1C C;  4LF4 Q;  4JG2 A;  4JOI A;  4A3D G;  1F9P A;  3D4D A;  2TMP A;  2NZO A;  4GN5 A;  1XXG A;  1CUK A;  4JI7 L;  2BH2 A;  3S2D B;  2ZTD A;  4GZY C;  3OTO L;  5M5Y B;  1QB5 D;  3CCJ A;  1P8L A;  3H91 A;  4J6H A;  4IPH A;  1F2Z A;  1SNP A;  3L7Z C;  4TKO B;  2NBF A;  2F0V A;  4XQJ A;  2AQ3 B;  4KJN A;  3HOU H;  4U68 A;  4FXD A;  1WTH A;  4JC0 A;  2HIX A;  1HJP A;  4FF2 A;  1LAC A;  4UAI A; 
#chains in the Genus database with same CATH homology
 1F9Q A;  4DNT B;  1SFO B;  5FO7 B;  2DNE A;  3NWS A;  3CU7 A;  1GHJ A;  4F8M A;  4DAY A;  1ZYR C;  1CZW A;  3NK9 A;  2K05 A;  1PRT F;  1ENF A;  2B2V C;  1PZK D;  4K5V A;  3A54 A;  3NTH A;  1BXT A;  5IGF A;  4ZKB B;  3NBI A;  3QOL A;  4PMW A;  4KTA A;  3T16 A;  1GUS A;  1I4P A;  3L9A X;  2LY7 A;  2R93 B;  1HCZ A;  3K59 A;  1KTK A;  5I4D A;  3NHH A;  5IOC A;  3MTS A;  3PV0 A;  2WII B;  2EJF C;  3GTM B;  3MWY W;  1A3V A;  1DD2 A;  3LNN A;  1Q3L A;  3R3O A;  3DM1 A;  1XX8 A;  3DUZ A;  1WTX A;  3MFY A;  3VR3 A;  2JA7 B;  2X69 A;  1EQT A;  1F9S A;  1PTO F;  4WJW A;  2KJX A;  4LMQ D;  4C1N K;  4S3S A;  2BE5 C;  1Y69 U;  3GQB A;  1DM0 B;  4IUR A;  3HOU B;  5EBC A;  5JEA H;  1C4Q A;  3KK7 A;  2MGS A;  3M85 A;  1SNM A;  4OO1 G;  4KKT A;  4MN3 A;  1I50 B;  3BG3 A;  4G4K A;  3FDT A;  2PZT A;  3DWQ A;  5C5M A;  5FOB B;  1PFB A;  2E76 C;  4QUC A;  2PYK A;  5A2Q L;  2PW7 A;  1I6V C;  3IFD A;  4C3J B;  3QIA A;  3X3N A;  1TKW B;  1WCM B;  2I46 A;  2QCP X;  1ENC A;  2NVT B;  2SDF A;  5EJW A;  1STN A;  2EY5 A;  3L3O C;  3NPP A;  3I8Z A;  1SE2 A;  5J22 A;  4OL7 A;  5KGU A;  3SK8 A;  3A8I E;  1F9R A;  2F3V A;  1QOH A;  3SE0 A;  1Q1E A;  3BDL A;  4K6D A;  1EY8 A;  3U9S A;  2ENB A;  1EU3 A;  1ONL A;  1AN8 A;  2HUG A;  5D14 A;  2F03 A;  2ICE C;  4X3S A;  4ZQ3 A;  4B08 A;  1EWH A;  3VYR A;  1F2M A;  2BA1 A;  3EJI A;  1TS3 A;  1I4R A;  4A93 B;  1QCB D;  3GTO B;  3GP7 A;  2L12 A;  1TQO A;  1LTT D;  3T4A C;  1QG7 A;  2RA4 A;  1RTN A;  4QUF A;  4ABN A;  3K5L A;  1LTA D;  2JYO A;  4Z9C B;  4FP5 D;  2IPK D;  1YNN C;  1NAP A;  4PV1 C;  2K32 A;  4IUT A;  2TSS A;  1B9M A;  4RGN A;  1Y8P B;  4FF3 A;  5A2Q E;  4A3F B;  4KD4 A;  2C5C A;  3I70 A;  1EWC A;  5LL6 X;  3J81 E;  1UEA B;  1A3U A;  2XIW A;  1WTW A;  4IUN A;  2M00 A;  4CKB A;  4L6T B;  1S5E D;  3C1F A;  2KVM A;  1LTS D;  4BY1 B;  3HZX A;  4DAP A;  1TR5 A;  5C4X B;  3TP5 A;  5DM6 3;  5IIF A;  2Q8R E;  4KV6 A;  4XYO A;  4Q5V A;  4R9W A;  2L1B A;  5D3I B;  1SND A;  2B2Y A;  3MVV A;  5J1Z A;  3HG9 A;  2R61 A;  2KCN A;  1Z6H A;  1XWE A;  3J7Y W;  5CBA E;  3S9W A;  2EY2 A;  3K5N A;  2A69 C;  2L0C A;  2B2T A;  4NKL A;  4U67 3;  3ND9 A;  3VA5 A;  1VCI A;  2XRS D;  5JAV A;  2RVL A;  2AWN A;  1HQM C;  3HS0 C;  1D5X C;  4ZK9 B;  4KI0 A;  4KY5 A;  3A56 A;  1SYC A;  3H6M A;  4A3D B;  1EYC A;  1J9O A;  1HA5 A;  4X3T A;  1W6K A;  3RUZ A;  1FNV A;  2A5H A;  3MHB A;  4KD3 A;  1LT4 D;  1C48 A;  1OXV A;  3WDN A;  1NUC A;  1QIL A;  3J7A V;  2NUC A;  4PQX A;  2O2L D;  2XRQ D;  3S1M B;  2K5D A;  4XXE A;  3S14 B;  4TQU S;  1SNC A;  1CA5 A;  2B2U A;  5E4X A;  1SJE D;  2L55 A;  1MGS A;  1O78 A;  4RHS A;  1CTM A;  5C4Z A;  1SBB B;  1VMC A;  3VR4 A;  5CV4 A;  1H9S A;  1V1P B;  1HA6 A;  2B2V A;  3GO5 A;  1KNE A;  5I9P A;  2ICI A;  1JWU D;  5JJZ A;  4HN7 A;  1PMR A;  1ROD A;  1U4R A;  3TP7 A;  5I2Y A;  1Q90 A;  1GUN A;  2Z8L A;  1EY9 A;  5EPK A;  3RZD B;  5KND A;  2AQ2 B;  1SDF A;  3HOZ B;  4G7O C;  3SHL A;  3OWE B;  4NDX A;  4EQN A;  3I4L A;  4OO1 I;  1SJH D;  1PFM A;  4I7Z C;  1NCV A;  2N88 A;  2NTT A;  3M4O B;  2K7V A;  1SYD A;  3HGB A;  4HCE A;  1II3 A;  1NSN S;  2K28 A;  1R4Q B;  1K8O A;  4IUQ A;  3OSO A;  1YNJ D;  3RZO B;  2B2W C;  3TZD A;  3FRP B;  2HCI A;  2JE6 I;  1AFP A;  4HMJ A;  1XYI A;  4RCO A;  3HOW B;  2PQE A;  3M7G A;  1ET9 A;  2R6G A;  3DWP A;  2FHT A;  3KBG A;  3D6C A;  3P7J A;  2KEC A;  3GTK B;  4YIJ A;  4IUP A;  2RBM A;  2L9H A;  2B63 B;  1HUM A;  4X3K A;  5I9O A;  1H9K A;  1JWM D;  1F77 A;  1O7L A;  1TWC B;  1MSG A;  1OXX K;  2A68 D;  2MPM A;  2J7Z A;  3MXU A;  5JOB A;  4RKL A;  2G9D A;  3OIP A;  4FYD A;  1WTQ A;  2O5I C;  2QKI C;  4PMB A;  2A73 B;  1BBX C;  3W2D A;  1VF5 C;  3K0Y A;  1C8C A;  1UAP A;  1S4Z A;  2A6H C;  2F0M A;  1VMP A;  2KED A;  4ZKC B;  3I91 A;  1CT1 D;  2JEB I;  4BS9 A;  3K5O A;  5COY A;  2NN6 H;  2QEJ C;  1TS2 A;  1SMY C;  5BN3 A;  5CV8 A;  4FXK C;  1I3Q B;  3K57 A;  3J81 L;  1Y8N B;  1RKN A;  2K5W A;  1NR2 A;  1U9R A;  5IGG A;  1JC7 A;  1EU4 A;  1B4O A;  1EEI D;  1BNZ A;  3V2T A;  3MA2 B;  3E6Z X;  5CGK A;  4QIW B;  1WD1 A;  5JPM C;  1HFN A;  4QMG A;  1VF7 A;  2LKV A;  2NVY B;  2EY1 A;  2Q8T A;  3EA6 A;  2AUK A;  4NP5 A;  3R93 A;  3URY A;  1EY0 A;  4C1N I;  4AYB B;  1QNK A;  4WRD A;  5CV9 A;  4HCS A;  3S1Q B;  2EE1 A;  1PZI D;  1IYV A;  1SE4 A;  1GXD C;  1TWG B;  2AWO A;  1STE A;  3R2I A;  2EPB A;  1BCP F;  5EKK A;  2XWB B;  2IX1 A;  1EOT A;  5G3L F;  3BDC A;  4RFB A;  1DZ1 A;  4WFN 3;  3ERQ A;  1E2V A;  4B9X A;  4A3M B;  1U4P A;  3BVM A;  1O7Y A;  3SEB A;  4RGO S;  1B3A A;  1SYG A;  4MHE A;  2C9O A;  3NUC A;  5C44 B;  3QOJ A;  3KLS A;  4TSS A;  1BR9 A;  1PTO H;  3PUZ A;  1MBY A;  1WTV A;  4A3E B;  1PFN A;  3E0J A;  3X3M A;  3CQZ B;  4IFD J;  2Z1C A;  3MC0 B;  3R8B A;  3IL8 A;  5COR A;  1EY5 A;  3OHX C;  5EKL A;  3K7A B;  4F7X A;  4XQN A;  5C4J B;  5HUR A;  2J0T D;  1CM9 A;  2VB3 X;  2MHV A;  5KRU A;  1STB A;  2KHS A;  5IT9 L;  3AMU A;  4XIG S;  5TSS A;  3TN2 A;  1TY0 A;  1D5Z C;  2PPB C;  1KAA A;  1LV9 A;  3DEO A;  2OEO A;  5ISR A;  2MP1 A;  2PMZ B;  3FPP A;  4IAL A;  3S1R B;  1DOM A;  2BA0 A;  4QCL A;  2WIN B;  3A8K E;  4EQO A;  3A55 A;  1LAB A;  2KUM A;  1EFI D;  4HTH A;  2JSO A;  3I4N B;  1OXT A;  4C2M B;  3BYY B;  5M5X B;  1CA6 A;  4CKE A;  1EY7 A;  2BE5 D;  3TME A;  3EVQ A;  4OIJ A;  1PLF A;  2ZXR A;  3NQI A;  3IAY A;  5T1I A;  1Z47 A;  4K6L A;  1KAB A;  4DK0 A;  3FPU B;  4LJZ C;  4L8J A;  5C0X J;  2F0N A;  1LLR D;  1SEB D;  1ZKO A;  3R2T A;  5E3F A;  4H44 C;  1JOK A;  4K8I A;  2DY8 A;  4O1N A;  5FO8 B;  2BDN A;  4B9W A;  5T1G A;  1I4H A;  4M1U B;  5EKI A;  1STH A;  3DMU A;  2IL8 A;  2B2U C;  3I3C A;  2YYZ A;  3W3A A;  3HOV B;  1K83 B;  1U4M A;  1PDQ A;  2EYM A;  4PNY A;  5FO9 B;  2RDG A;  3D4W A;  1HTP A;  3KLS X;  2F0I A;  2WAQ B;  2LFN A;  5FLX L;  1EL0 A;  1Y8O B;  1HQR D;  2K1B A;  4DAV A;  3CHB D;  1JE4 A;  1U4L A;  3SDZ A;  2KEE A;  1SNO A;  2K04 A;  4M8A A;  4J8Q A;  1A6X A;  4Y7N B;  3NBH A;  1ESF A;  1O80 A;  3FVQ A;  3T51 B;  2VUM B;  1M8A A;  4H7B A;  1F2L A;  2Z4I A;  3S2H B;  3TSS A;  5C0X H;  1A15 A;  2IX3 A;  4C3H G;  4HSP A;  3P1H A;  5EPJ A;  1CQV A;  2NVQ B;  1D5M C;  4A3J B;  2MJ8 A;  5CV6 A;  4KY6 A;  2CQA A;  5ELD A;  2H4O A;  3M3Y B;  3PIO 3;  5IT9 E;  1GJX A;  2F0O A;  4RKB A;  3PUX A;  3FKI B;  5C4H A;  4RAU C;  5M9O A;  4XT1 B;  1DYQ A;  2M9V A;  2IX0 A;  4O42 A;  1RCV D;  2E2D C;  2KCC A;  5CYU A;  4EVO A;  2B2W A;  4HMI A;  5E4W C;  3MAQ A;  4K2K A;  1HUN A;  2NTS A;  1TWF B;  3S17 B;  1ESR A;  1B1Z A;  1DON A;  1EZ8 A;  1V43 A;  5D3D A;  4EQP A;  5CV5 A;  2BOS A;  4FNF A;  1ML0 D;  2F0H A;  3D31 A;  1ZYR D;  4V0B A;  5FK9 C;  2Q8I B;  5CR3 A;  2MUY A;  2PW5 A;  2WV6 D;  1JOO A;  3WOE A;  4IFD H;  2Y0S B;  4CHT B;  1J8I A;  4KKU A;  5KIX A;  4G7H C;  1KDA A;  1DOK A;  1LT3 D;  1SNQ A;  4G7Z C;  4RH6 A;  1AEX A;  1UUP A;  1SYE A;  5IGD A;  1H9R A;  1FNU A;  1PRT B;  1CI3 M;  1ZEQ X;  2SNM A;  3TP6 A;  4IUV A;  2KQ3 A;  5KNB A;  4C3I B;  1IL8 A;  1VDZ A;  2HDL A;  1PXU A;  3NE5 B;  1X3Q A;  2IWH A;  1A3T A;  4A3K B;  2JA5 B;  2F0E A;  2EXZ A;  4ZUJ A;  4HED A;  1DJR D;  4DF7 A;  1IHZ A;  3U9O A;  4DA2 A;  2CVR A;  3Q6S A;  3I4M B;  2QF7 A;  1I4Q A;  1PTO B;  1W6J A;  3VYU A;  5I6W A;  4MIU A;  1RHP A;  2EYJ A;  1Z7T A;  3OOC A;  4OGQ C;  4LK1 C;  3FMC A;  3GTL B;  4RWS C;  4DU9 A;  1EYA A;  4XDX A;  1TS4 A;  1IW7 C;  3VYT A;  2E2H B;  4Q0F A;  5DNF A;  2F0K A;  5JEA J;  2H1E A;  3FEW X;  1R9T B;  5ELB A;  5K36 H;  4NMZ A;  5K36 G;  2M2L A;  2A68 C;  3N6R A;  2A6E C;  3MZ5 A;  3NP8 A;  2VXW A;  1G29 1;  2HQE A;  3V96 A;  3RLF A;  1EQV A;  2VNU D;  1T5E A;  2F3W A;  1Q1B A;  1BF4 A;  5F2D A;  2F4I A;  5DEH A;  1G2T A;  1MI2 A;  5M3F B;  1KNA A;  1AP0 A;  3QO2 A;  2R3Z A;  3ERO A;  1ILP A;  2IW3 A;  1BO0 A;  4KN7 C;  1EEF D;  1B50 A;  1E2Z A;  1RJT A;  4H0L C;  3GTP B;  1G6Z A;  4KN4 C;  3QB3 A;  4PMC A;  1AW7 A;  1HPC A;  1RF2 D;  2ZT9 C;  1D1I A;  1PRT D;  3PUW A;  2EZV A;  2XVS A;  4HSV A;  2SEB D;  3T13 A;  5K5P A;  1DCZ A;  3V05 A;  3ZYY X;  4KHV A;  2HCC A;  2F0J A;  4QB4 A;  1BQQ T;  2WP8 J;  2I07 B;  1RD9 D;  4OIK A;  4IQZ A;  3ND8 A;  3AU7 A;  3TZU A;  1IYU A;  4KHZ A;  3GTJ B;  1SAP A;  1Q12 A;  2YU9 B;  4KK7 A;  3LWU A;  2KOL A;  3DHQ A;  4ULL A;  2EYL A;  4G57 A;  4K2L A;  1CHP D;  1D6E C;  3SXH A;  4BBS B;  4JBW A;  1FD7 D;  2PZU A;  2RSO A;  3D4R A;  4N9P A;  3VYS A;  4C3J G;  2SOB A;  2A6E D;  3WOF A;  1B9N A;  2ZXO A;  5EGT A;  1SYB A;  1WTP A;  3BVZ A;  4DNR B;  3OMC A;  2Z4H A;  4BY7 B;  1ILQ A;  5G3L D;  5A35 A;  1QJO A;  1GHK A;  2RKS A;  1AZP A;  4UDU C;  2R92 B;  2EY6 A;  4F87 A;  3GD7 A;  3I72 A;  1D2B A;  5BN5 A;  3HRZ C;  1CK1 A;  1I6H B;  1AZQ A;  2PCF B;  2K6A A;  3VR2 A;  2CW0 C;  1TWA B;  2NB0 A;  5IGB A;  2PNR C;  5C5L A;  1TII D;  1DXM A;  4P2C B;  3SR1 A;  1FGB D;  2FMC A;  3N52 A;  1FR3 A;  1EYD A;  3M7N A;  2E75 C;  1BUV T;  2DNC A;  1JIC A;  4NW2 A;  1STA A;  2SNS A;  2XSC A;  2D62 A;  3MFG A;  5CMD A;  1JOR A;  4RCN A;  3PMF A;  2JXM B;  3K5M A;  4FF1 A;  1I4G A;  3A7L A;  3H09 A;  2BDO A;  2L11 A;  4RA8 A;  2L4N A;  3H3V C;  5LHY 1;  1WTR A;  3PO3 B;  1YNN D;  1O7Z A;  4K8J A;  1SXT A;  4DXG A;  2FMM A;  5CBE E;  1EY6 A;  4XQQ A;  3BVG A;  3NWT A;  2F0P A;  2NWG A;  3NXW A;  1X3P A;  4KJO A;  5FLX E;  2IT1 A;  2NVX B;  1PTO D;  3OW7 A;  4OO1 H;  3GTQ B;  3VR6 A;  1E2W A;  2AQ1 B;  2F0D A;  5KNC A;  2F0G A;  5ELE A;  5E1F A;  4DN4 M;  1RTO A;  2K01 A;  5IOD A;  5LL6 S;  1L0X B;  4IFD I;  3DEP A;  3SK5 A;  4C3H B;  1ET6 A;  3NQT A;  1BCP C;  3A7A B;  1B44 D;  3QG1 A;  3C1E A;  5C3W A;  1HFG A;  1H9S B;  2V4D A;  5IGE A;  4A3B B;  3EQL C;  4RHR A;  1L0Y B;  3HOX B;  3VR5 A;  1TU2 B;  1CZG A;  1TY2 A;  2F0W A;  2WAC A;  2E2J B;  2XWJ B;  1LTI D;  2E74 C;  4FXG C;  1JOQ A;  4F88 A;  5I2X A;  1GUW A;  1NR4 A;  2VB2 X;  1GUT A;  3J80 L;  5I6Y A;  3S1N B;  5AFW A;  2ID0 A;  2F0F A;  3DXJ C;  1HHV A;  4CJ2 C;  1RDP D;  4CJ0 B;  2FIN B;  2LS0 1;  1KLU D;  1F2Y A;  3A8J E;  1IW7 D;  1ZXT A;  1V1O A;  3SK6 A;  3P75 A;  3TBI B;  1Q8I A;  5KYL A;  4FF4 A;  2RQX A;  3SVM A;  1LO5 D;  5DM7 3;  1KDB A;  3TDQ A;  5C0X I;  1A2U A;  3QWN A;  2CHB D;  4DGZ A;  3K6O A;  3GTG B;  5CC4 A;  3BS1 A;  2OXP A;  2O5J C;  4ME5 A;  2NN6 I;  2JEA I;  3H94 A;  4R8N A;  1ICW A;  2F0U A;  4BBR B;  2QDB A;  4ILW A;  1TVX A;  1JR0 D;  4JK1 C;  4OHJ A;  2R7Z B;  1K8M A;  2FJ2 A;  3UI2 A;  2K03 A;  2K5Q A;  1LTG D;  3J80 E;  5EQ0 A;  1DOL A;  5IGC A;  2B8G A;  1TS5 A;  2WB1 B;  3T53 B;  1GUG A;  2F1M A;  1T5X D;  4N9T A;  2F0S A;  5EPL A;  1S5D D;  3PO2 B;  1JCK B;  4CJ1 B;  5DAU A;  2EVB A;  1B2T A;  1HTL D;  1JB3 A;  3ITP A;  5JEA G;  5ELC A;  3NTK A;  1XTC D;  3G7L A;  1EY4 A;  3BDO A;  2EYH A;  3IFT A;  5D65 A;  5C3X A;  4ZYS A;  2DY7 A;  3HP3 A;  1STY A;  3HKZ B;  4ID6 A;  1V8Q A;  2ZXP A;  1MSH A;  1G2S A;  4RGM A;  5KEE A;  1WD0 A;  3C46 A;  3T56 B;  5EBD A;  4R8I A;  1V1P A;  4FVM A;  1OO9 B;  3ONA B;  4IZ8 A;  3PIP 3;  2JA6 B;  4CKC A;  1G8Z D;  1BCP D;  1EZ6 A;  3C3L A;  3Q22 A;  4BA1 I;  3NTI A;  4J1M A;  3RMH A;  4V19 0;  2QIL A;  5JVH 3;  1BOS A;  1S5F D;  1M4V A;  1MD2 D;  2RSN A;  1E0B A;  1LTB D;  5C6A A;  1EIG A;  2PZW A;  3DWA A;  4RGT A;  1SMY D;  2A74 C;  3D6W A;  1LT6 D;  2HDM A;  1D1K A;  1JWS D;  4IUU A;  2NYZ D;  5FKA C;  1LTR D;  2FFK B;  4BA2 I;  1WTO A;  3CKI B;  1G91 A;  1PTO C;  1X32 A;  1S5B D;  4KKS A;  2D9U A;  2JP1 A;  3MXG A;  1OXS C;  3PUV A;  1YNJ C;  1TWH B;  2F0T A;  3LWE A;  5BN4 A;  3J7A F;  3TP8 A;  1QWY A;  4DXF A;  1GUO A;  3D3R A;  2GA4 B;  2EJG C;  1STG A;  1KDC A;  1FYC A;  2OT2 A;  2LMC B;  1I4X A;  2EJM A;  3LX0 A;  4KMU C;  1SYF A;  2A6H D;  3BYT B;  1Y1V B;  2EYF A;  1HRJ A;  4HAE A;  3RD4 A;  4C56 C;  1JQY D;  2A69 D;  3H0G B;  3JAM L;  5CV7 A;  1GOZ A;  3HOY B;  4CBV A;  3KBX A;  2KA7 A;  3E5S A;  2X6G A;  4K14 A;  3HEJ A;  2WKC A;  2BCO A;  3SK4 A;  2NN6 G;  1HXY D;  1OXU A;  2XN9 C;  3M4Y A;  1Y1W B;  4ZUI A;  3F2U A;  5J39 A;  2JA8 B;  3K58 A;  2RDF A;  1B53 A;  3C2P A;  4L63 B;  3I90 A;  5JVG 3;  4H13 C;  2CW0 D;  2DN8 A;  2RDH A;  1H9M A;  1SE3 A;  4A3G B;  1EIH A;  4IN3 A;  1BDO A;  2D2C C;  4K5X A;  3MXN A;  1PZJ D;  2L5T A;  5M5W B;  1A2T A;  3OPO A;  3OIQ A;  2EYO A;  2OF1 A;  1FNW A;  1QNU A;  3O13 A;  5M3M B;  2K33 A;  4C3I G;  3S16 B;  1IKM A;  3D8G A;  4A3I B;  3S15 B;  4DFA A;  2B8F A;  4IFD G;  3OWF A;  2EYP A;  2AUJ D;  1BCP B;  3EFX D;  1CFM A;  4K5W A;  4WOR A;  3PUY A;  4I65 A;  2F0Q A;  2WKD A;  3MXP A;  2E2I B;  2EDG A;  4QF4 A;  4CGY B;  4ZLT F;  2B39 A;  3CRL C;  3MEH A;  3VA7 A;  5C3E B;  2IJ0 A;  3P20 A;  5JPN C;  5HGT A;  1SSO A;  3GV3 A;  4ZRZ A;  3BZD B;  3Q24 A;  4ZAI A;  3CRK C;  1IKL A;  4FO2 A;  2J4X A;  5KYI A;  4TRD A;  2PO4 A;  1PRT C;  3AB9 A;  2F0L A;  1CHQ D;  4XYQ A;  3Q0A A;  1UNS A;  1PYW D;  3OMG A;  1R4P B;  2X6L A;  4XT3 B;  4XTC S;  1CQF A;  2G9H D;  4BWG B;  1H9J A;  4X3U A;  4ODG A;  5C0X G;  1WVL A;  2NZ1 D;  3QJY A;  4LAA A;  5ELF A;  4KY7 A;  2B2Y C;  4EGV A;  1S5C D;  2O4X A;  3KUP A;  4DK1 A;  2EOT A;  3GV6 A;  1ENA A;  1LT5 D;  3G6J B;  2N55 A;  3Q23 A;  2B2T C;  3I73 A;  5NUC A;  3JAM E;  1TT2 A;  2XNA C;  1QE6 A;  3NSW A;  3KF8 A;  1KLG D;  3KLR A;  3IKJ A;  2D5D A;  4E6I A;  4HR7 B;  1F9P A;  3D4D A;  2TMP A;  1XXG A;  3S2D B;  4GZY C;  5M5Y B;  1QB5 D;  3H91 A;  4J6H A;  1F2Z A;  1SNP A;  3L7Z C;  4TKO B;  2NBF A;  2F0V A;  4XQJ A;  2AQ3 B;  4KJN A;  4U68 A;  4FXD A;  4FF2 A;  1LAC A;  4UAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...