3TQYA

Structure of a single-stranded dna-binding protein (ssb), from coxiella burnetii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
110
structure length
110
Chain Sequence
MARGVNKVILIGNLGQDPEVRYTPNGNAVANVTLATSTTWRDKQTGELQERTEWHRIAFFNRLAEIVGEYLRKGSKIYIEGSLRTRKWQDKNGVDRYTTEIIANEMHMLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Single-stranded DNA-binding protein
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
total genus 20
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3tqyA00
4HJ7A 2YU9H 4DR4Q 1W3SA 2N8NA 3CCJA 1LUZA 3NEMA 4A3EG 2A19A 2ZM6L 3TREA 2OCEA 1HNZL 4LF4L 3PO2H 2C35B 1BBUA 4DV3Q 4JYAL 2JA7H 3T1HQ 1S72A 1CSPA 3KJOA 1X3EA 1HR0L 4GLAC 4H02A 4JI2L 4JI3L 3BZKA 2I0QA 4P72A 1PYBA 4TVAB 4POGA 5C4XH 5ELOA 1MJEA 1OXTA 3M9BA 1A0IA 1O7IA 4DV6L 5IYBG 4Y7NH 3UDGA 1EQRA 1KHIA 1B8AA 5JEAJ 3UDIA 3EN2A 2ZJPA 4LF9Q 3HKSA 1U5KA 1G51A 1FJGQ 2KHJA 1UE1A 1HR0W 4GNXB 4DK3C 5BR8L 5IE8A 2DGYA 4DR7L 1HZCA 1P16A 3TS2A 4A93H 1NMGA 2R93H 2RF4A 4LNQA 3GO5A 1XPUA 4YWKA 4KHPQ 3A74A 2K75A 2PQAB 3BJUA 4JI4L 2OWOA 1HZAA 2QEXA 4QIWE 4AQYQ 1E24A 2Y0SG 1G6PA 2WAQE 4DAYB 5LMNL 4BA2I 1B7YB 3HOVH 4P71A 2AHOB 5LMUL 2PI2E 4NXML 4P75A 4APVA 1NE3A 2RCNA 2LXJA 4B3RQ 1RL2A 4TQUS 4DV4Q 3M3YH 1BBWA 3A5UA 2D0OA 3HOYH 4K0KQ 3HKZG 4P73A 3WWVA 2QGQA 2UXDL 4BY1H 3J7ZC 3AFQA 3STBC 1K8GA 4HIOA 3KOJA 4DKAC 4LF7L 3AYHB 3KJPA 1PYSB 2VW9A 2UXBQ 3T1HL 4A3BH 3JAMc 2OTLA 2I5MX 1J5EQ 2JA5H 5IP7H 2HHHQ 2WP8J 5M3MH 4JOIC 4X6AH 3HOXH 1VQ4A 5AJ3L 2JA6G 4X62Q 3S1NH 4QY7A 4A3EH 1VQCA 2HIXA 4DR2Q 1PH1A 3PF5A 5IY0A 2B3GA 4JI1Q 1WFQA 4EQ5A 1FJGL 2R7ZH 3PGZA 3RLFA 4OXPA 1Z9FA 4YCWA 1C0AA 4HJ8A 4LFAL 4DNIA 5IWAL 4LF5L 3I4MG 4ALPA 4LF5Q 1L1OB 5IYBH 2BH2A 3NENA 4IFDG 2JK8A 3CCEA 3RLOA 3KF6B 3ICEA 5JEAG 2UUCL 3HOZG 2JQOA 3I4NG 3BZCA 4DAMA 3AQQA 2E5LL 4QQBX 4DV0Q 3EBEA 4DV4L 4HIKA 4C3IH 1YBYA 3KDFB 4L5QA 4JI7Q 4JI5Q 2AWNA 1GD7A 1EUJA 1VQGA 3CF5A 4A3CG 1TWGH 3PUZA 3G6EA 3PUWA 4LF4Q 1PH4A 4GLVB 2MNAA 2UXBL 3E0EA 3RLNA 4JYAQ 4GOPB 3J80c 5M3FG 1HJPA 3I4OA 5GROA 4JI2Q 2QA4A 4IOAA 2NN6G 4JI3Q 1VQ7A 5GQOA 4NPSA 3F2CA 3CMEA 4X62L 3H0GH 1IYJB 1YHBA 4DV6Q 2MQHA 2WB1G 1V9PA 3W1BA 3M7NA 3S1QH 2E2JH 4L5TA 2LXKA 1WI5A 4DR1L 2PI2A 4LF8Q 2Z0SA 2ALYB 1WOCA 3S17H 4IPCA 5BR8Q 4HJ5A 1GM5A 1ASZA 2NVXH 4IFDI 4DR7Q 1CKOA 1QUQA 1YHAA 2K5HA 3GDEA 2JA6H 4GN4B 4A3JH 2N49A 3ERSX 3ULLA 4LUVA 4X65L 3G4SA 3S2HH 4ME3A 3ZJYC 1OXVA 3KF8B 3S1RH 5M5WH 3RZDH 2B63G 2YV5A 5DLQE 1YVCA 2YTVA 2UUAQ 2IY5B 4JBMA 1X65A 1I94L 4B3SQ 2F52A 4A75A 1S40A 4O2DA 4NXMQ 3I4MH 1PVOA 2EXDA 1EYGA 5JJKA 4JBKA 1SLJA 1VQHA 1E3PA 2LSSA 4MZ9A 4OWWB 2BA0A 3CD6A 4JBWA 1L1OC 4DK6C 2K5NA 4JI5L 1AE2A 5IYCG 3T1YL 2UXDQ 3HOZH 4A3LG 3FKIG 5C0XJ 5H1SE 1H95A 1Y1VG 1EWIA 5C44G 3H15A 3F2DA 2OQKA 4LF7Q 1OXXK 2A8VA 1TWAH 1AE3A 3HOUG 1Q7YC 4JI0L 2BA1A 2K50A 3NBHB 1N34L 4BXXG 2MO1A 4R4QA 5AJ3Q 4PZ8A 1EFWA 4A3CH 1PH5A 5HGQA 4UP7A 4IPHA 1SRUA 1N32L 4GN5A 3TQYA 2PMZE 3HFZB 2UXCL 1CKMA 1XNQL 1E22A 1XPRA 4LF8L 5M3FH 1VQBA 2CFMA 2GN5A 2CQOA 3L0OA 4GOPC 2R7FA 2ZTCA 4RG1A 4OO1I 1VQPA 3CCVA 4LFAQ 3JAMi 5IWAQ 4LWCA 4EX5A 2JEAI 1K83H 1QVCA 1CKNA 1SROA 3D0FA 1G291 5C0XI 5C4JH 1J6QA 4A4IA 2UUCQ 1TWFH 1WCMG 2UUAL 3TEHB 1I3QH 2KHIA 3L2PA 3F8TA 1SFOH 4B3SL 2Q2IA 2R92G 4GNXA 2E5LQ 2ZTEA 2L15A 3UE1A 2NVYH 1HZBA 4GLXA 2RHQB 3RN5A 5LMNW 2DUDA 1KRSA 2PQAA 4NB3A 2R7DA 1L0WA 1XMQL 2B63H 2BH8A 1IBMQ 4LFBL 5JJLA 2Z6KA 5IT9c 1UE5A 2H5XA 1SN8A 3GTGH 1I50H 4R1JA 1VQMA 2ATWA 4C3HH 4HJAA 1PH3A 3RN2A 2I5HA 1Q82C 4IO9A 4YWLA 4OO1G 4FDBA 2Y0SE 3I55A 1JJGA 4YY3L 4DV2L 1K8AC 3E9HA 1LM0A 5IYCH 2Q2TA 3A5ZB 1C9OA 3Q8DA 4A3LH 3FKIH 3GTQH 1Y1VH 5C44H 2FXQA 2K5VA 4XIGS 5C0XG 2XGTA 1EOVA 3GTJH 4BBSG 3CC2A 3HOUH 4JBJA 4DR1Q 2EIFA 4L5SA 1A8VA 2NZHA 3HKZE 4YWMA 1V43A 1U0LA 2NN6I 4JC0A 3CC7A 4BXXH 3J80i 2VUMG 4HJ9A 5IP9G 2ZJQA 3I7FA 1GO3E 2MO0A 4JI6L 3IRBA 4X65Q 1OXSC 2V1CC 4A3MG 3PIPA 4B3ML 2IX1A 1UWVA 1KC8C 4KLKA 3PIOA 2K4KA 2ZJRA 4OX9L 4DR6Q 2HT1A 1IBLL 3PF4A 4UP9A 1Q1BA 1I94Q 4PMWA 1OXUA 2HIVA 3UDFA 3CMAA 1NJIC 1IL2A 4AYBG 4JI8Q 1M90C 1UEBA 4BBRG 4DV1Q 3KFUA 2VZAA 4A3KG 2AMCB 1XMOL 3T1YQ 2A1AA 1YITA 2I5LX 2K52A 1IBML 1WCMH 2JEBI 3UDXA 5GAEC 4YCUA 4OWTB 1PH9A 1PV4A 3GTLH 2R92H 1JE5A 4R4OA 5K36G 4LW1A 1YJWA 2JJQA 1VQKA 1FVIA 4P74A 1JJCB 1KAWA 3PUVA 3U4VA 4JI0Q 4UY8C 4MTNA 1LTLA 4A3FG 1N34Q 3KDFA 1YJNA 1PH8A 1HH2P 3K80C 1RIPA 3K81C 1N32Q 3CCMA 1VQIA 1Q86C 5J3BA 4C3JH 3CAMA 4A3IG 1XNQQ 1N33L 2UXCQ 1VS0A 1VQ9A 2UU9L 1JT8A 5GAGC 1QVFA 5ELNA 2IX0A 4HIDA 3KLWA 4IPGA 1D8LA 3J81c 1K73C 1HZ9A 2GVAA 1KL9A 2OQ0A 1EIFA 1KIXA 1X6OA 3K0XA 1EIYB 3M4PA 3U58A 2IT1A 4DV5Q 3VDYA 1X56A 3CQZH 4BBSH 4DR6L 4YHHL 3TRZA 2R93G 1K0RA 2E8GA 1Q12A 1SR3A 2E2IH 1NY4A 1MKHA 1UE7A 2JA8G 1X3FA 1QZGA 4JG2A 2VUMH 5IP9H 4JI8L 1YIJA 3OTOQ 1YHQA 4DV1L 2Q2UA 4KHZA 5EAYA 4POFA 4DR5L 2VQEQ 4A3MH 4IJHA 2N78A 1PH2A 1Q1EA 1YNXA 1XMQQ 4LFBQ 1YI2A 3I4NH 1MJCA 4DUYL 1M1KC 4B3TL 3GTPH 2NZOA 4A3DG 3CCUA 4JV5Q 3CP0A 4BBRH 4LFCQ 3G71A 2KCTA 1QZHA 4YY3Q 2XTIA 4DV2Q 4A3KH 4JOIA 3H3VI 4RMFA 4GS3A 4BA1I 1OTCA 1TXYA 3M85A 3I2ZA 1K3RA 3CC4A 3SGIA 4WJ4A 2KCMA 4YCVA 3S16H 5FJ8G 1XPOA 4JCVE 2CWAA 1HNXL 1I6HH 3CCLA 4WJ3M 1ASYA 1NTGA 5HY6A 1JJ2A 2OTJA 3CPWA 4A3FH 1LYLA 4LF6L 1HNWQ 4UPAA 1FGUA 4O0AA 1KD1C 4JI6Q 2R6GA 3GTMH 2R7ZG 1E7ZA 1Q46A 2WAQG 4B3MQ 4DV5L 2PNHA 4A3IH 4GKKQ 1D7QA 4OX9Q 1VQNA 2AKWB 1WYDA 1IBLQ 4BY7G 4DV7Q 1CKNB 1UE6A 3F2BA 1N36Q 1MIUA 3STBD 1VQ6A 3OTOL 3L7ZC 1DGSA 2N3SA 4PG3A 3S2DH 4DR3Q 1PFSA 1VQ8A 2VQEL 2AWOA 1XMOQ 3U50C 1KQSA 3FP9A 3M4QA 4PZ7A 4IOCA 4QL5A 3OYYA 2KENA 1Y14B 2JA8H 1S3OA 4J15A 4OONA 3PO3G 2F4VL 4JV5L 2UUBQ 4LFCL 1Q81C 4PZ6A 5JJIA 2D0PA 3I56A 2JE6I 3RZOH 3LGJA 4LUOA 1JMCA 2CWPA 2MFIA 3GD7A 1VCIA 5FLMG 3HOWG 2GVBA 2RHSB 3PCOB 2D62A 1V1QA 3AEVA 5M5YH 4A3DH 1BVSA 5E7NA 1I5FA 3DLLA 1PH7A 1N33Q 3J81j 1C7YA 1KXLA 2UU9Q 4X66L 4DR4L 2WFWA 3TS0A 2NVQH 3H0GG 4QJFA 3CXCA 1SMXA 4IJLA 1SE8A 2IHFA 1HNWL 1TWCH 2ZTDA 3UE0A 4DPGA 2B29A 2KBNA 4AIMA 1AH9A 4UP8A 4GN3B 4DV3L 1EQQA 1VQEA 3OW2A 2CKZB 2F3IA 3GTKH 5C3EG 2VQFQ 4GKKL 5FJ8H 4NXNQ 2VL6A 4YHHQ 3ER0A 4DV7L 1BKBA 5GAHC 1IZ6A 1VQFA 3A0JA 4A3JG 2K14A 4QGUA 1Y1WG 3F1ZA 1XJVA 1N36L 1XNRQ 1GKHA 1E1TA 4DUZQ 4LF9L 1GVPA 1N8RC 4DR3L 1YEZA 2IHEA 1YZ6A 2ID0A 4DR5Q 1NBWA 1PHJA 1L1OA 3J81i 1IBKQ 2YTYA 2HQLA 2EQSA 5M5XH 4BY7H 3KF6A 3U4ZA 4DUYQ 2YYZA 1X9NA 3AFPA 4B3TQ 4KHPL 1X3GA 3PUYA 4AQYL 1N9WA 4KI0A 1PH6A 2UUBL 1XTDA 5IYDG 3CPFA 2CCZA 1VQAA 4R4IA 3H3VH 1CUKA 3W1GA 1VQOA 4GNXC 3K8AA 1PA6A 3PO2G 1B70B 4XTCS 3RR5A 4IFDJ 2JA7G 4X64Q 4AYBE 4B3RL 4GKJQ 1A62A 3MXNB 5FLXc 3PV0A 3PO3H 4A3GG 4Y52H 3ULPA 1CSQA 1W2BA 4K0KL 5C4XG 4L5RC 1HNXQ 4A3GH 2Z6KC 4GOPA 1Q8KA 1TWHH 3DM3A 1HNZQ 1E1OA 2ZM6Q 3PSIA 1K9MC 4LF6Q 4C2MH 5FLMH 2VNUD 3HOWH 2JA9A 3CCRA 2E2HH 3S1MH 3D31A 1QUQB 1J5EL 3KYHC 2VQFL 1JB7A 1HR0Q 2HHHL 4NXNL 2VY3A 5GADC 4A93G 3S24A 4IPDA 3G48A 3MEFA 1XNRL 3CCQA 2YTXA 1KRTA 4DR2L 3CCSA 2WB1E 2Q2HA 4DUZL 1R9TH 3B6YA 4LUZA 4JI1L 1NMFA 4R4TA 4R4CA 1VQ5A 3S14H 1X55A 4AH6A 3HOVG 3ULJA 1A63A 1FL0A 5C3EH 3NELA 1IBKL 3M4OH 4OWXB 1VQJA 3JC66 1YJ9A 1T9HA 1VQDA 1VQLA 3CW2C 4MNOA 1Y1WH 2ES2A 1Z47A 3K7UC 1L2FA 4JI4Q 2NVTH 3EIVA 3J7A5 2F4VQ 3HOYG 2ASBA 1QVGA 3S15H 3FHWA 4BY1G 1X54A 5LMNQ 4HIMA 4A76A 1IXRA 3PUXA 5LMUQ 3RNUA 4X64L 4A3BG 3BU2A 4DV0L 1P8LA 4GKJL 3E9IA 2JA5G 3K7AH 3GTOH 2VS1A 5IP7G 1WJJA 4JI7L 5M3MG 3HOXG 3W5OA 5IYDH 4X66Q
chains in the Genus database with same CATH superfamily
4HJ7A 3NEMA 2AUJD 2A19A 2OCEA 2RQXA 4KKSA 2AQ3B 3PO2H 2C35B 2XRSD 3NBHA 4DV3Q 3T56B 2BOSA 1HR0L 4GLAC 4HSPA 2I0QA 3VR6A 1PYBA 4TVAB 3BDLA 2NTTA 3M9BA 1A2UA 5JEAJ 3VR5A 3S16B 5I9OA 1FJGQ 2FINB 2KHJA 1UE1A 4GNXB 4DK3C 4ZCKA 3TS2A 3IL8A 1NMGA 2L9HA 1XPUA 2CH4A 1JOQA 2M00A 5CV5A 2K75A 2L55A 4JI4L 2IWHA 1I4RA 1XXGA 2Y0SG 1G6PA 3BDCA 5C4XB 1FGBD 3R8BA 5I6YA 2AHOB 3NTKA 5LMUL 4MHEA 4Q5VA 1NNXA 1RL2A 3M3YH 1BBWA 2CHBD 5LL6S 4CDCC 4DKAC 2CVRA 3KJPA 2VW9A 1CA6A 2UXBQ 3T1HL 3JAMc 5CC4A 1J5EQ 2JA5H 1SXTA 3PIO3 1HFNA 1B2TA 2K32A 2JA6G 3S1NH 4ZKCB 1XYIA 2HIXA 1PH1A 1IKMA 5IY0A 2HDMA 2B3GA 2PW7A 4E6IA 1TS3A 1G91A 1LTTD 1CI3M 4OXPA 4HAEA 4HJ8A 1TWCB 5FLXL 5IWAL 2F0OA 2EYLA 2BH2A 3NENA 3MWYW 1V1PB 5C4ZA 3ICEA 3NQIA 5JEAG 2JQOA 2MHVA 1O80A 4DAMA 4ZLTF 5IGCA 3AQQA 4A3EB 1GJXA 2TSSA 2F0DA 4QQBX 4DV0Q 3EBEA 1AFPA 1YBYA 4KJNA 4JI5Q 1GD7A 4JK1C 5M5XB 5FLXE 1TY0A 1EU4A 2PZWA 4LF4Q 2MNAA 3E0EA 2KEDA 4H0LC 4IUUA 3J80c 3I4OA 4GOPB 5GROA 3FEWX 4LK1C 2QA4A 1VQ7A 3F2CA 1EQTA 3H0GH 1IYJB 1PFNA 4O1NA 1QILA 4L5TA 2LXKA 2Z0SA 4IPCA 1GM5A 1ASZA 2OT2A 1EYAA 3ERSX 3ULLA 1STAA 3G4SA 1RTOA 3MFGA 1FR3A 1O7YA 2EYPA 5M5WH 1IYUA 5JPNC 1YVCA 2UUAQ 3SK4A 1X65A 4B3SQ 4NDXA 4C3HG 1S40A 4O2DA 1R9TB 3K5OA 1PVOA 4IUVA 5JJKA 2FJ2A 1SLJA 4OWWB 2BA0A 3S17B 4JBWA 4DK6C 5C3WA 3D3RA 1F9RA 1LACA 3HOZH 3VR3A 4V190 3H15A 2F0MA 3F2DA 3PMFA 2OQKA 3D4DA 2A8VA 1Q7YC 2BA1A 4PMCA 1W6JA 3DM1A 2K50A 5AJ3Q 4L63B 4PZ8A 4FXDA 1SNMA 4K2LA 1SRUA 1N32L 4GN5A 2BE5D 2PMZE 5KNBA 1E22A 3Q0AA 1PZJD 4HCSA 1PFBA 1A15A 1VQPA 3MC0B 3CCVA 4LFAQ 3JAMi 3TP6A 5IIFA 1B1ZA 1TWAB 1AN8A 1CKNA 1SROA 3J7YW 1K3BC 5G3LF 4JPBW 1S5CD 5FO9B 2Q2IA 4Y7NB 3UI2A 2ZTEA 3HRZC 4PQXA 5I6WA 2RDGA 2RHQB 2FFKB 1KRSA 5JJLA 1I6VC 4A93B 3GTGH 1UE5A 1SN8A 1ZEQX 4R1JA 3E0JA 5CV9A 1B9MA 4HJAA 4HMJA 3RN2A 4XYOA 3A7AB 4IO9A 5DM73 3I55A 1JJGA 3MHBA 4YY3L 5CV7A 1LM0A 5IYCH 3EA6A 3CRKC 3GTQH 5C6AA 5L37A 5C44H 2K5VA 2E74C 3GTJH 3VYRA 3CC2A 4DR1Q 3HKZE 1EU3A 1LO5D 3D8GA 3CC7A 1I50B 3J80i 1HFGA 3I7FA 4RWSC 3IRBA 2KEEA 1TS4A 2V1CC 3QO2A 3KBXA 4LAAA 2QF7A 1KC8C 1VMPA 2K4KA 2DN8A 5M3MB 4OX9L 1TS5A 1BO0A 3PF4A 2QDLA 1BCPD 3UDFA 1IL2A 1V1OA 3SXHA 1M90C 1U4RA 4A3KG 4DK0A 2QEJC 2AMCB 1DZ1A 4R8IA 2JEBI 3A8KE 3UDXA 4IUQA 1PH9A 2LFNA 2JJQA 3Q23A 1FVIA 4CKEA 1C4QA 4FP5D 4RAUC 1Q8IA 4A3FG 3KDFA 3DUZA 1BR9A 4CJ2C 1HH2P 2EZVA 2IX3A 3A8IE 3CCMA 1Q86C 5DM63 2F0SA 4C3JH 1XNQQ 1VQ9A 1QVFA 4QUCA 1TWGB 1PTOB 1SE3A 3EQLC 4IPGA 3T13A 1SBBB 4C56C 3T16A 1WD0A 3M4PA 3U58A 2IT1A 1EIYB 4BBSH 3CQZH 2R93G 1JCKB 1K0RA 4KKTA 4KJOA 2VUMH 4JG2A 1YIJA 2Z9HA 5HGTA 5EAYA 4DR5L 3VR2A 1D5ZC 1AW7A 1NR4A 1MJCA 1QE6A 4DUYL 4B3TL 2EYFA 3CP0A 3WDNA 3G71A 1QZHA 4DV2Q 3LNNA 3H3VI 3QIAA 4GS3A 1TXYA 4PV1C 3M85A 4OHJA 3SGIA 2KCMA 4ZQ3A 1SYBA 3S16H 4DXGA 1RDPD 2F3WA 4A3MB 5BN5A 2GA4B 2CWAA 2DNEA 3CCLA 1ASYA 4ME5A 5HY6A 3CPWA 1LYLA 1HNWQ 2F0WA 5KEEA 4JI6Q 1QNUA 1DD2A 4DV5L 1D7QA 4GKKQ 1EL0A 3SK8A 1IBLQ 1S5DD 5C4HA 4HTHA 4KN4C 1N36Q 4PG3A 4QF4A 1VQ8A 2VQEL 3P75A 4KMUC 2EPBA 3M4QA 1F2LA 2A69C 4UAIA 1CK1A 3NTIA 4J15A 4OONA 4LFCL 2D0PA 2RCFA 3I56A 1WTQA 2RA4A 5COYA 1JMCA 2CWPA 1I4XA 1ENFA 3PCOB 3G6JB 2D62A 1V1QA 1PH7A 1C7YA 2JSOA 3TS0A 4QUFA 4ZK9B 1TWCH 4FXKC 2B29A 2KBNA 2K5QA 1AH9A 4DV3L 1F2ZA 4GN3B 1VQEA 2XSCA 3OW2A 2L0CA 1SDFA 3GTKH 2NWGA 3HGBA 4V0BA 2VL6A 4DV7L 3HS0C 1XJVA 4A3JG 1XNRQ 2PCFB 1KNAA 1YEZA 5KIXA 2K01A 3G7LA 3NXWA 2NVQB 2YTYA 5M5XH 1SEBD 3KF6A 3U4ZA 2YYZA 3ITPA 3C3LA 1JB3A 4KI0A 1PH6A 2UUBL 3OW7A 1KNEA 2JN4A 2VB2X 1GUNA 1TU2B 1CUKA 3W1GA 2D9UA 1S4ZA 4XTCS 4AYBE 2B2UC 2SDFA 2HD3A 5FLXc 3MXNB 3PO3H 5JVH3 5C4XG 5EBDA 2OF1A 4BY7B 1HQRD 1K9MC 1K8OA 4C2MH 5FLMH 2VNUD 2M9VA 3CCRA 2KVMA 1VDZA 1QUQB 1J5EL 5A2QL 1WTWA 2A68C 1EYDA 4C1NK 1AEXA 1HQMC 2WB1E 1R9TH 3B6YA 2Z4IA 5JPMC 1X55A 4AH6A 4DAPA 4RGOS 5C3EH 4C1NI 3IFDA 4OIJA 4RKBA 1TWHB 3KF8A 3HOWB 4MNOA 1F77A 4PNYA 3EIVA 5A2QE 2F0FA 2C5CA 1QVGA 1A3UA 3DWPA 5LMNQ 1X32A 1LT5D 5CBAE 1IXRA 2K04A 3NHHA 1GUWA 3RD4A 2IPKD 1Y69U 2G5DA 5DEHA 4DV0L 3E9IA 5E1FA 2IJ0A 5IP7G 1I4GA 4DFAA 2CW0D 2HCIA 1LUZA 5EKKA 4A3EG 4KV6A 2ZM6L 1HTPA 2HDLA 5T1IA 1HNZL 4LF4L 1LTBD 3EVQA 3GTPB 3GQBA 4F8MA 4RCNA 2JA7H 2F0HA 1S72A 3KJOA 1F9SA 2RVLA 4A3GH 4A3KB 1MJEA 1Q90A 1A0IA 3UDGA 4Y7NH 1KHIA 1SSOA 4LF9Q 3VYSA 3HKSA 2MUYA 1G51A 4HR7B 2YU9B 2XIWA 1HZCA 4A93H 2BE5C 3R2IA 5LHY1 2EY5A 1EIHA 4IN3A 3GO5A 4KHPQ 3A74A 5FO7B 3BJUA 3C1FA 2WAQE 4DAYB 4BA2I 4FXGC 2G9DA 2PI2E 4H7BA 4APVA 1I4PA 4B3RQ 3S2DB 4DV4Q 2EVBA 3HOYH 3WWVA 3VA7A 2R93B 3STBC 5ELEA 4N8X1 3KOJA 1QCBD 3IFTA 3K0YA 2RKSA 5CV4A 1IYVA 2HHHQ 2WP8J 2PQEA 5M3MH 3QOJA 3HOXH 4CHTB 5AJ3L 1VQCA 2F0QA 4KTAA 1WFQA 2R7ZH 3PGZA 3OPOA 4BY1B 3RLFA 5I4DA 1A3TA 4LFAL 4DNIA 5BN3A 2E76C 1B9NA 2OXPA 1HCZA 5CBEE 4A3BB 2R3ZA 2PMZB 1TY2A 1SNQA 2JK8A 3TMEA 3CCEA 3J7AV 4XT3B 1JOKA 1CHPD 2KHSA 2NTSA 4J6HA 3I4NG 2JYOA 1KTKA 1BQQT 1ET6A 1ML0D 1KABA 3Q24A 2AWNA 1VQGA 2L11A 5D3DA 4A3CG 1QOHA 1ILPA 1PMRA 5JJZA 1TWGH 3PUZA 3G6EA 3RLNA 3DXJC 1HJPA 2NN6G 3U9SA 5GQOA 4NPSA 3CMEA 4X62L 4IURA 1V9PA 2MQHA 2WB1G 3W1BA 2E2JH 1HA6A 4DR1L 2ALYB 1WOCA 1CT1D 1LT6D 1D1IA 3D6CA 2JA6H 1HRJA 4ME3A 2AQ1B 3ZJYC 4FNFA 1STHA 3S1RH 2DJGC 1HUMA 2XNAC 3HKZB 3QWNA 3TBIB 2F52A 4K5XA 3S1QB 4MZ9A 3TN2A 2EYHA 2UXDQ 5JEAH 4A3LG 3FKIG 3SE0A 1PRTB 4A3JB 2EY1A 4LF7Q 1LT3D 5ELBA 3R93A 3HOUG 1CZGA 3RZDB 5C5MA 3NBHB 3BYYB 1EFWA 2EE1A 5HGQA 1ICFB 1S5ED 3I4MB 3ND8A 5ELFA 2A69D 1CKMA 1XNQL 4LF8L 3WOFA 2GN5A 2CFMA 2BDNA 2FMCA 3L0OA 4OO1I 2R7FA 4RG1A 1EYCA 4U68A 2N88A 4CKCA 2JEAI 3D0FA 1G291 5C4JH 1KDBA 1J6QA 4A4IA 1TWFH 1WCMG 3L2PA 2KHIA 3F8TA 4WORA 1LT4D 1RODA 4GNXA 2EYOA 2X6GA 2E5LQ 4GLXA 3RN5A 4NB3A 2R7DA 4OELB 5FKAC 2BH8A 1IBMQ 2H5XA 1VQMA 4HN7A 4C3HH 1K83B 3WOEA 1VF7A 2I5HA 4OO1G 5EPKA 3NSWA 4DV2L 3E9HA 1I3QB 3TZUA 1XTCD 1KDAA 2Q2TA 1SFOB 2VXWA 1EEID 3Q8DA 4N9TA 1PTOF 1D6EC 3NUCA 3QB3A 2C9OA 4L5SA 2QCPX 3MXPA 2NZHA 2B63B 2ZXPA 1U0LA 1H9JA 1VF5C 1Y8OB 4DGZA 5IP9G 1GUGA 4JI6L 2D2CC 1OXSC 2F0UA 4A3MG 1BDOA 4TKOB 4KLKA 3PIOA 2ZJRA 4DR6Q 1IBLL 5CV6A 5KNDA 3A54A 4UP9A 1Q1BA 2HIVA 3CMAA 4ZAIA 1EOTA 1UEBA 4BBRG 4DV1Q 3KFUA 2VZAA 3T1YQ 1YITA 2QILA 1V1PA 4OWTB 4RHRA 2A68D 1CHQD 1Q3LA 5K36G 4R4OA 5EKLA 1NUCA 1JJCB 1W6KA 1KAWA 2LS01 1D5MC 3PUVA 3U4VA 4JI0Q 1JWUD 3DHQA 2G9HD 1JWSD 1N34Q 2K5WA 1WTPA 1U9RA 4X3TA 4U673 2FHTA 1ET9A 5J3BA 3CAMA 5I9PA 4DF7A 5ISRA 3QR8A 1D8LA 2OQ0A 1EIFA 1H9SA 1SNDA 2SNMA 2B2YA 1DOMA 3AU7A 4MTKA 3NP8A 2E2IH 1MKHA 1UE7A 2JA8G 2O4XA 1NCVA 1SYGA 3MVVA 4JI8L 3OTOQ 2A6HC 2TMPA 2A73B 2K28A 4IJHA 3BZDB 2HUGA 1PH2A 4CJ0B 4XQJA 1YNXA 4LFBQ 5T1GA 3GTPH 4KD3A 3S2HB 3K58A 4JV5Q 1QNKA 1GHKA 5KRUA 4A3KH 2RDHA 1J8IA 4X3SA 4JOIA 4RMFA 2NB0A 1OTCA 1K3RA 2ZXOA 4OL7A 5D65A 4BS9A 5FJ8G 4JCVE 4RFBA 1LTAD 3D4RA 4WJ3M 1JJ2A 3I4NB 2OTJA 4A3FH 1BF4A 2CW0C 4AYBB 2PNRC 3P20A 4B3MQ 2PO4A 2KCNA 2CQAA 3NWSA 5JAVA 4BY7G 2F0EA 1CKNB 4I7ZC 1BBXC 3STBD 2WIIB 1VQ6A 3L7ZC 1Y8NB 3S2DH 1PFSA 4XDXA 1I4HA 1B44D 1XMOQ 1I6HB 3U50C 2QDBA 4OGQC 4MN3A 4IOCA 1F2MA 2WINB 4FF3A 3TZDA 4P2CB 2WB1B 1S3OA 4FYDA 5IT9E 1B53A 2O5JC 4KY7A 3LGJA 4LUOA 4CJ1B 1MBYA 3GD7A 2MFIA 1RKNA 3HOWG 5CYUA 2RHSB 3I3CA 3AEVA 3ZYYX 2UU9Q 1TR5A 3H0GG 4QJFA 3MXGA 4IJLA 2XVSA 3BYTB 4DPGA 2ZTDA 3BS1A 3GV3A 4G7OC 4UP8A 4OIKA 5JOBA 1L0YB 2F0IA 2CKZB 3L3OC 2VQFQ 2NYZD 2ENBA 1MGSA 4YHHQ 3OOCA 3FKIB 1GKHA 4NP5A 4DU9A 3I73A 4DUZQ 4LF9L 3J7AF 3BVZA 3VYUA 4DR3L 3HOUB 2ID0A 3OWEB 4FO2A 1L1OA 1PXUA 3T53B 3W3AA 2HQLA 2EQSA 2XWJB 1X9NA 3DEOA 4KHPL 3AFPA 2F0GA 4Z9CB 5IGGA 3CPFA 3J81L 1KAAA 3H3VH 4GNXC 1B70B 4IFDJ 3H6MA 2A5HA 1CTMA 1KDCA 5DNFA 4B3RL 3PV0A 2WAQB 1WCMB 4IUTA 1MD2D 5CORA 5K5PA 3DM3A 1E1OA 1JR0D 3ERQA 2E2HH 1GUOA 3D31A 3J81E 1HR0Q 3N52A 2HHHL 4NXNL 4N9PA 4CGYB 3G48A 1FNWA 3EFXD 3CCQA 1SMYD 2Q2HA 1L0XB 2EY2A 1JWMD 1UAPA 5BN4A 3S14H 1LV9A 3HOVG 1A63A 1IBKL 3M4OH 5D3IB 1VQJA 2WKCA 3FRPB 4F87A 4IUNA 4EQOA 1VQLA 2ES2A 3S1MB 4JI4Q 3J7A5 1A2TA 5G3LD 3E6ZX 4CKBA 4X3KA 3FHWA 2F4IA 4BY1G 1LTID 3T4AC 4A76A 3X3MA 3PUXA 5LMUQ 2IL8A 3M7GA 4X64L 4A3BG 2B8GA 1P8LA 4GKJL 1WJJA 4K2KA 2KECA 5J22A 2F0VA 3CCJA 1SYDA 3TREA 1MSGA 1C48A 1Y1WB 1BBUA 1DYQA 3T1HQ 4BBRB 4ULLA 3S15B 1DXMA 4IFDG 4POGA 1ZYRD 1QB5D 5C4XH 5ELOA 3QG1A 1O7IA 5IYBG 1SNPA 2L5TA 3EN2A 2ZJPA 1SJHD 1DCZA 1SYFA 2O2LD 4R9WA 1FD7D 4WJWA 3N6RA 5IE8A 2Q8RE 4WFN3 3PO2B 4YWKA 2PQAB 4S3SA 3FMCA 4C3IG 2ZXRA 1BCPB 4QIWE 2QEXA 1E24A 2B2YC 2RSOA 1AP0A 1GHJA 3A8JE 1IW7C 3FPPA 1X3PA 1KLUD 1ESFA 3LWUA 2RCNA 4TQUS 3GV6A 2D0OA 2DY8A 3HKZG 4P73A 2QGQA 2UXDL 1EEFD 3J7ZC 3AFQA 1JE4A 1K8GA 3MAQA 4LF7L 2JA8B 4DK1A 1DOLA 3AYHB 1PYSB 3DMUA 1RD9D 1D2BA 2OTLA 2I5MX 1D1KA 3PIP3 5IP7H 1STGA 3RZOB 4JOIC 4A3EH 5M5YB 1YNJD 3NTHA 4JI1Q 3M3YB 1R4PB 4EQ5A 1FJGL 1T5XD 2F0PA 2F0LA 1IHZA 4YCWA 1Z9FA 3I4MG 4K8JA 4ALPA 1GXDC 2JA5B 3KF6B 4IQZA 2F0TA 2CH4W 4IUPA 1PRTF 3S1NB 1K28A 2E5LL 4RA8A 4HIKA 5JVG3 1EY5A 1SNOA 4DXFA 5E4WC 2ICEC 2UXBL 4JYAQ 3O13A 1EQVA 4NKLA 5EBCA 5M3FG 3KLSX 4JI2Q 4JI3Q 2A6HD 2KOLA 3MXNA 4DV6Q 5CGKA 4XQQA 3E5SA 2H4OA 3VYTA 4DNTB 1WI5A 1DM0B 3S17H 1OO9B 5BR8Q 5LL6X 1HHVA 4XXEA 4DR7Q 1CKOA 1QUQA 1YHAA 1TT2A 2K5HA 4GN4B 2N49A 4LUVA 5IGDA 4XT1B 5CV8A 3S2HH 3KF8B 1FNUA 1G2SA 3MXUA 1VMCA 3D4WA 2B63G 2YV5A 2IY5B 3H0GB 1GUSA 3K5MA 4A75A 2LY7A 4NXMQ 3SEBA 1LLRD 4K14A 2B2WA 1L1OC 1RJTA 2K5NA 4FF2A 4JI5L 3T1YL 3NK9A 2B8FA 5C0XJ 1Y1VG 1MHWC 5M9OA 1TWAH 4L6TB 5M5WB 1BNZA 4JI0L 2K7VA 2H1EA 4H44C 1N34L 4ID6A 4BXXG 2MO1A 2KQ3A 4A3CH 1ICWA 1SYEA 2KA7A 4UP7A 4IPHA 4KD4A 3HFZB 4MIUA 1XPRA 1II3A 1VQBA 2CQOA 5KNCA 1I4QA 2NN6H 2FMMA 2ZTCA 2JP1A 3IAYA 3BG3A 1CQVA 2F0NA 2M2LA 4ZKBB 2SEBD 1EY7A 5C0XI 2UUCQ 1RTNA 2UUAL 1PYWD 1U4MA 4B3SL 2R92G 1XWEA 3UE1A 1V8QA 2DUDA 1U4PA 5EPJA 4LJZC 4LFBL 5IT9c 1I50H 4B9XA 2L4NA 2MJ8A 3QOLA 4FDBA 2Y0SE 2RBMA 1K8AC 3HOVB 2WV6D 4A3LH 1G8ZD 3FKIH 2RDFA 5C0XG 4ZYSA 3SVMA 3HOUH 4JBJA 2EIFA 1JORA 1A8VA 2MGSA 2EY6A 4FVMA 2NN6I 1EZ8A 4HJ9A 2MO0A 4X65Q 1D5XC 1TKWB 1ENCA 4K5VA 4DAVA 1UWVA 3OIPA 4O42A 4B3ML 2HT1A 3ND9A 3GTQB 1I94Q 1G6ZA 4PMWA 1OXUA 2Z8LA 5EJWA 1NJIC 4AYBG 4FF4A 3C46A 2I07B 3AMUA 1XMOL 1SYCA 1WCMH 4YCUA 1PV4A 1PTOH 1SAPA 4LW1A 1VQKA 4P74A 1EWHA 4MTNA 2DJFC 1LTLA 1PLFA 1YJNA 3K80C 1LTSD 2IW3A 1VQIA 4C3IB 4A3IG 2UXCQ 1VS0A 2UU9L 1R4QB 5GAGC 4OO1H 3VR4A 5ELNA 2IX0A 1WTVA 3KLWA 1K73C 3J81c 1B3QA 1TIID 5DAUA 1KL9A 1KIXA 3K0XA 1WD1A 4M1UB 4DV5Q 5E3FA 3VDYA 4YHHL 2XRQD 2E8GA 1Q12A 1NY4A 1EY4A 3KLRA 5IP9H 4KHZA 2PPBC 2VQEQ 4A3MH 2NVXB 1Q1EA 1SMYC 1XMQQ 1YI2A 4IZ8A 5IODA 4RHSA 4A3DG 3CCUA 4ODGA 4BBRH 4LFCQ 3CQZB 1KLGD 1YNNC 2KCTA 3MTSA 4B9WA 5KYIA 2VUMB 3CC4A 4WJ4A 3SK5A 4YCVA 3V05A 2NZ1D 4B08A 3S9WA 5K36H 1XPOA 4PMBA 1IW7D 1K8MA 2KCCA 4J8QA 4UPAA 1KD1C 5EKIA 2R7ZG 1E7ZA 2PZUA 2WAQG 2AKWB 1SNCA 1WYDA 1UUPA 4DV7Q 1UE6A 3F2BA 2PW5A 3I4LA 1ZYRC 1STBA 5M3FB 2AWOA 4JW0A 3E3XA 4PZ7A 1PDQA 2KENA 2L1BA 5I2YA 2JA8H 1SJED 2UUBQ 5JJIA 4ZUIA 4PZ6A 1G2TA 3OMGA 3RZOH 1VCIA 2B39A 1NR2A 2GVBA 3BDOA 5M5YH 2NVYB 3OSOA 2B2WC 1BVSA 5E7NA 1I5FA 2LMCB 1N33Q 1KXLA 2WFWA 2NVQH 2MP1A 1SMXA 1SE8A 2IHFA 1HNWL 5ELDA 4AIMA 1EQQA 1HTLD 4CBVA 3R2TA 3NBIA 4GKKL 1O7ZA 5FJ8H 2K33A 3ER0A 2HCCA 3D6WA 1BKBA 5GAHC 1IZ6A 1VQFA 1Y1VB 2K14A 4QGUA 1Y1WG 3F1ZA 1N36L 4X3UA 2EJMA 1E0BA 1GVPA 1N8RC 1STNA 1YZ6A 3J81i 1DJRD 1YNJC 2N55A 4BY7H 5F2DA 1X3GA 3PUYA 1DONA 3TP5A 2AUKA 1PZKD 3GTKB 1XTDA 5IYDG 2X6LA 1ESRA 3I91A 1VQAA 4R4IA 2CCZA 4H13C 3H94A 5J1ZA 1AZQA 1VQOA 3K8AA 1PA6A 3PO2G 3RR5A 5I2XA 1TQOA 1A62A 4QIWB 4RKLA 3FDTA 4L5RC 1HNXQ 2EDGA 4I65A 1RHPA 4GOPA 1Q8KA 1TWHH 1HNZQ 3GTLB 2ZM6Q 3PSIA 4LF6Q 2R92B 3HOWH 2JA9A 4UHVA 3TP8A 5GADC 2F03A 4IPDA 2L12A 1H9SB 1XNRL 1KRTA 4G57A 4LMQD 3K59A 4LUZA 4JI1L 4J1MA 1NMFA 1VQ5A 3PO3B 1BCPF 2Z6BA 3ULJA 1FL0A 1ILQA 2PYKA 4C2MB 3KLSA 1T9HA 3CW2C 1O7LA 2F4VQ 5IGFA 1GUTA 1CM9A 1Z7TA 3K57A 5E4XA 4HCEA 3RNUA 1HUNA 4KY6A 4DNRB 2JA5G 2VS1A 2X69A 4N8FA 5C3EB 4X66Q 4DR4Q 2YU9H 1W3SA 2N8NA 2Z1CA 4F7XA 2Z4HA 2KUMA 4JYAL 2DNCA 3HG9A 1CSPA 3VA5A 4CDDC 5FOBB 1X3EA 5IT9L 4H02A 4JI2L 4JI3L 3BZKA 1PTOD 4P72A 1OXTA 1WTXA 4DV6L 1EQRA 1B8AA 3UDIA 2K6AA 1DOKA 1U5KA 3TSSA 3K6OA 1HR0W 5BR8L 2DGYA 4DR7L 1P16A 1RCVD 2R93H 1S5FD 1JICA 2RF4A 4LNQA 3H3VC 4HSVA 2JA7B 3RMHA 3GTMB 2OWOA 1HZAA 4AQYQ 3NE5B 4TRDA 4A3IB 4A3GB 3P7JA 5LMNL 1B7YB 3HOVH 4P71A 1BUVT 4NXML 3I8ZA 4P75A 3FVQA 1NE3A 1M4VA 2LXJA 3CKIB 3T51B 2B2UA 3A5UA 4K0KQ 2E75C 4BY1H 3LWEA 1EY8A 3SK6A 4HIOA 4NW2A 1IKLA 3URYA 4A3BH 2Q8TA 1LTGD 3KK7A 4X6AH 3L9AX 1VQ4A 4X62Q 4QY7A 4DR2Q 3PF5A 1PRTC 4A3DB 3W2DA 3HOYB 4EGVA 4IFDH 4UDUC 1A3VA 2EYJA 3DWAA 4GZYC 1C0AA 4R8NA 1M8AA 1E2VA 1MSHA 1IL8A 3IKJA 1BOSA 4LF5Q 1L1OB 4WRDA 2K05A 3A55A 5IYBH 1B4OA 2R61A 3RLOA 2V4DA 4CDFC 2UUCL 3HOZG 3HOXB 3BZCA 2HQEA 1EIGA 3NWTA 5HURA 5CR3A 1B50A 3C1EA 4DV4L 2R7ZB 4C3IH 1CA5A 3KDFB 4L5QA 4JI7Q 3OMCA 1J9OA 3CF5A 1EUJA 4RCOA 3TDQA 2D5DA 5EPLA 2KJXA 3PUWA 1PH4A 4GLVB 3TP7A 1PFMA 4IOAA 2EJFC 2E2DC 1A6XA 1YHBA 2J4XA 3M7NA 1JQYD 3S1QH 1AZPA 4RGNA 4LF8Q 2PI2A 2Y0SB 4HJ5A 2NVXH 4IFDI 3OWFA 1YNND 2A6ED 4I7AA 2B2VA 3GDEA 1Z6HA 2ZT9C 3KBGA 3ONAB 4A3JH 4X65L 1OXVA 1HPCA 1WTHA 3RZDH 4NMZA 2B2TA 5DLQE 2YTVA 4JBMA 1I94L 5KGUA 2JXMB 3I4MH 2EXDA 1EYGA 2E2JB 3NPPA 4JBKA 1VQHA 1E3PA 2LSSA 5D14A 5IGBA 3CD6A 1AE2A 5IYCG 1F2YA 3CHBD 1H95A 5H1SE 2JA6B 1EWIA 5C44G 2NVTB 5IGEA 1OXXK 1AE3A 2EJGC 4KK7A 3S1RB 1S5BD 1QG7A 1STEA 3PQIA 2PZTA 4R4QA 3OIQA 1PH5A 4G7HC 3TQYA 3K7AB 3GTOB 2UXCL 4ILWA 5M3FH 4GOPC 1ZKOA 5IWAQ 4K6DA 4LWCA 4EX5A 1K83H 1QVCA 1C8CA 2P5ZX 3TEHB 1I3QH 1SFOH 3JAML 1FNVA 1QJOA 4F88A 2L15A 1ZXTA 2NVYH 1HZBA 3MA2B 5LMNW 2PQAA 3I90A 1L0WA 1XMQL 2B63H 2K03A 1Y8PB 5ELCA 1ONLA 2Z6KA 4JVZA 2ATWA 1PH3A 4C3JG 1F9QA 2MPMA 4G4KA 3BVGA 4YWLA 5C4JB 1Q82C 1QWYA 4FF1A 2J0TD 1TWFB 3R3OA 2EOTA 3A5ZB 1C9OA 3JAME 1CZWA 4DN4M 1Y1VH 2FXQA 4XIGS 4YIJA 1HXYD 5C5LA 3FPUB 1H9RA 1EOVA 2BDOA 2XGTA 4BBSG 4L8JA 1F9PA 4YWMA 1V43A 4JC0A 3V96A 3OHXC 4BXXH 2VUMG 2ZJQA 4C3HB 1GO3E 3HZXA 3Q22A 4RGTA 3PIPA 2IX1A 1SE4A 1LTRD 4DA2A 1UNSA 1T5EA 3MEHA 1O78A 3J80L 1WVLA 4JI8Q 2K5DA 1EZ6A 1JOOA 2SOBA 3M4YA 2A1AA 2I5LX 2K52A 1IBML 5GAEC 3GTLH 2Q8IB 1U4LA 1JE5A 1SE2A 2R92H 1YJWA 3BVMA 1TVXA 1EY0A 4EQNA 3I72A 3EJIA 3CU7A 4UY8C 1B3AA 1K0SA 3J80E 1PH8A 2F1MA 1X3QA 1RIPA 1BXTA 1PZID 3K81C 1N32Q 3F2UA 1JT8A 1N33L 3H91A 3H09A 4HIDA 1HZ9A 2GVAA 2LKVA 3RUZA 1E2WA 1X6OA 5C0XH 1CFMA 4ZRZA 1X56A 4DR6L 3TRZA 2ICIA 2O5IC 1SR3A 3I70A 1X3FA 1QZGA 3X3NA 5CMDA 2Q2UA 1YHQA 4DV1L 4POFA 1TS2A 2N78A 4QMGA 5EQ0A 2I46A 3AB9A 3I4NH 1M1KC 4KKUA 4K6LA 5C3XA 2NZOA 4HEDA 2OEOA 2VB3X 1LABA 1UEAB 2XTIA 4YY3Q 2F0JA 2E2IB 5IOCA 4BA1I 3I2ZA 1CQFA 4QB4A 1HNXL 3HOZB 1I6HH 1NTGA 4M8AA 4RH6A 3A7LA 3DWQA 4KHVA 2K1BA 3HP3A 5AFWA 5FK9C 5TSSA 4LF6L 1FGUA 3HEJA 4O0AA 2R6GA 3GTMH 3P1HA 2BCOA 1Q46A 3EROA 3SR1A 4A3IH 2PNHA 4OX9Q 2F0KA 1VQNA 1ENAA 1H9MA 3DEPA 1MIUA 1PTOC 1EFID 1DGSA 2N3SA 3QJYA 4Q0FA 3OTOL 4DR3Q 3SHLA 4XQNA 3K5NA 1KQSA 4KN7C 2B2VC 3FP9A 4A3FB 4QL5A 3OYYA 4DAYA 4QCLA 1Y14B 3PO3G 3CRLC 4JV5L 2F4VL 1Q81C 2XWBB 1PRTD 4OEMB 2B2TC 2JE6I 1WTRA 5FLMG 2NBFA 2J7ZA 2EYMA 4A3DH 1XX8A 3DLLA 3J81j 4X66L 4DR4L 3CXCA 3GTGB 1H9KA 3UE0A 5KYLA 1JC7A 2EXZA 1HA5A 2QKIC 2F3IA 5A35A 4K8IA 5C3EG 5J39A 4NXNQ 4KY5A 2WACA 3A0JA 3U9OA 4ABNA 5C44B 2AQ2B 1E1TA 3GTJB 2IHEA 4DR5Q 1NBWA 1PHJA 2F3VA 2SNSA 3V2TA 1IBKQ 3C2PA 3MZ5A 4DUYQ 4B3TQ 4HMIA 4AQYL 1N9WA 2WKDA 1EY6A 4TSSA 3M4OB 4EVOA 4IALA 1EY9A 2QW7A 5NUCA 2A74C 2JA7G 4X64Q 1WTOA 4GKJQ 4G7ZC 4A3GG 4Y52H 3ULPA 1CSQA 1W2BA 4K0KL 4ZUJA 1BCPC 1GOZA 2Z6KC 3SDZA 3S1MH 3A56A 3KYHC 2VQFL 2RSNA 1JB7A 1E2ZA 4K5WA 1EWCA 2VY3A 4A93G 3S24A 5EGTA 3LX0A 3Q6SA 4RGMA 3MEFA 2YTXA 2DY7A 1FYCA 4XYQA 3NQTA 3CCSA 4DR2L 5FO8B 4DUZL 4C3JB 4R4TA 4R4CA 3K5LA 3NELA 4OWXB 4EQPA 4BWGB 3JC66 4CDEC 1YJ9A 1VQDA 4LF5L 3KUPA 1Y1WH 2E2HB 2NVTH 1Z47A 3K7UC 1L2FA 3HOYG 2ASBA 3S15H 4BBSB 2A6EC 1X54A 4HIMA 1MI2A 1RF2D 1STYA 2XN9C 3BU2A 1NSNS 3GTOH 3K7AH 3S14B 1NAPA 3GP7A 4JI7L 5M3MG 3MFYA 3HOXG 2NUCA 3W5OA 5IYDH
chains in the Genus database with same CATH topology
4HJ7A 2YU9H 4DR4Q 1W3SA 2N8NA 3CCJA 1LUZA 3NEMA 4A3EG 2A19A 2ZM6L 3TREA 2OCEA 1HNZL 4LF4L 3PO2H 2C35B 1BBUA 4DV3Q 4JYAL 2JA7H 3T1HQ 1S72A 1CSPA 3KJOA 1X3EA 1HR0L 4GLAC 4H02A 4JI2L 4JI3L 3BZKA 2I0QA 4P72A 1PYBA 4TVAB 4POGA 5C4XH 5ELOA 1MJEA 1OXTA 3M9BA 1A0IA 1O7IA 4DV6L 5IYBG 4Y7NH 3UDGA 1EQRA 1KHIA 1B8AA 5JEAJ 3UDIA 3EN2A 2ZJPA 4LF9Q 3HKSA 1U5KA 1G51A 1FJGQ 2KHJA 1UE1A 1HR0W 4GNXB 4DK3C 5BR8L 5IE8A 2DGYA 4DR7L 1HZCA 1P16A 3TS2A 4A93H 1NMGA 2R93H 2RF4A 4LNQA 3GO5A 1XPUA 4YWKA 4KHPQ 3A74A 2K75A 2PQAB 3BJUA 4JI4L 2OWOA 1HZAA 2QEXA 4QIWE 4AQYQ 1E24A 2Y0SG 1G6PA 2WAQE 4DAYB 5LMNL 4BA2I 1B7YB 3HOVH 4P71A 2AHOB 5LMUL 2PI2E 4NXML 4P75A 4APVA 1NE3A 2RCNA 2LXJA 4B3RQ 1RL2A 4TQUS 4DV4Q 3M3YH 1BBWA 3A5UA 2D0OA 3HOYH 4K0KQ 3HKZG 4P73A 3WWVA 2QGQA 2UXDL 4BY1H 3J7ZC 3AFQA 3STBC 1K8GA 4HIOA 3KOJA 4DKAC 4LF7L 3AYHB 3KJPA 1PYSB 2VW9A 2UXBQ 3T1HL 4A3BH 3JAMc 2OTLA 2I5MX 1J5EQ 2JA5H 5IP7H 2HHHQ 2WP8J 5M3MH 4JOIC 4X6AH 3HOXH 1VQ4A 5AJ3L 2JA6G 4X62Q 3S1NH 4QY7A 4A3EH 1VQCA 2HIXA 4DR2Q 1PH1A 3PF5A 5IY0A 2B3GA 4JI1Q 1WFQA 4EQ5A 1FJGL 2R7ZH 3PGZA 3RLFA 4OXPA 1Z9FA 4YCWA 1C0AA 4HJ8A 4LFAL 4DNIA 5IWAL 4LF5L 3I4MG 4ALPA 4LF5Q 1L1OB 5IYBH 2BH2A 3NENA 4IFDG 2JK8A 3CCEA 3RLOA 3KF6B 3ICEA 5JEAG 2UUCL 3HOZG 2JQOA 3I4NG 3BZCA 4DAMA 3AQQA 2E5LL 4QQBX 4DV0Q 3EBEA 4DV4L 4HIKA 4C3IH 1YBYA 3KDFB 4L5QA 4JI7Q 4JI5Q 2AWNA 1GD7A 1EUJA 1VQGA 3CF5A 4A3CG 1TWGH 3PUZA 3G6EA 3PUWA 4LF4Q 1PH4A 4GLVB 2MNAA 2UXBL 3E0EA 3RLNA 4JYAQ 4GOPB 3J80c 5M3FG 1HJPA 3I4OA 5GROA 4JI2Q 2QA4A 4IOAA 2NN6G 4JI3Q 1VQ7A 5GQOA 4NPSA 3F2CA 3CMEA 4X62L 3H0GH 1IYJB 1YHBA 4DV6Q 2MQHA 2WB1G 1V9PA 3W1BA 3M7NA 3S1QH 2E2JH 4L5TA 2LXKA 1WI5A 4DR1L 2PI2A 4LF8Q 2Z0SA 2ALYB 1WOCA 3S17H 4IPCA 5BR8Q 4HJ5A 1GM5A 1ASZA 2NVXH 4IFDI 4DR7Q 1CKOA 1QUQA 1YHAA 2K5HA 3GDEA 2JA6H 4GN4B 4A3JH 2N49A 3ERSX 3ULLA 4LUVA 4X65L 3G4SA 3S2HH 4ME3A 3ZJYC 1OXVA 3KF8B 3S1RH 5M5WH 3RZDH 2B63G 2YV5A 5DLQE 1YVCA 2YTVA 2UUAQ 2IY5B 4JBMA 1X65A 1I94L 4B3SQ 2F52A 4A75A 1S40A 4O2DA 4NXMQ 3I4MH 1PVOA 2EXDA 1EYGA 5JJKA 4JBKA 1SLJA 1VQHA 1E3PA 2LSSA 4MZ9A 4OWWB 2BA0A 3CD6A 4JBWA 1L1OC 4DK6C 2K5NA 4JI5L 1AE2A 5IYCG 3T1YL 2UXDQ 3HOZH 4A3LG 3FKIG 5C0XJ 5H1SE 1H95A 1Y1VG 1EWIA 5C44G 3H15A 3F2DA 2OQKA 4LF7Q 1OXXK 2A8VA 1TWAH 1AE3A 3HOUG 1Q7YC 4JI0L 2BA1A 2K50A 3NBHB 1N34L 4BXXG 2MO1A 4R4QA 5AJ3Q 4PZ8A 1EFWA 4A3CH 1PH5A 5HGQA 4UP7A 4IPHA 1SRUA 1N32L 4GN5A 3TQYA 2PMZE 3HFZB 2UXCL 1CKMA 1XNQL 1E22A 1XPRA 4LF8L 5M3FH 1VQBA 2CFMA 2GN5A 2CQOA 3L0OA 4GOPC 2R7FA 2ZTCA 4RG1A 4OO1I 1VQPA 3CCVA 4LFAQ 3JAMi 5IWAQ 4LWCA 4EX5A 2JEAI 1K83H 1QVCA 1CKNA 1SROA 3D0FA 1G291 5C0XI 5C4JH 1J6QA 4A4IA 2UUCQ 1TWFH 1WCMG 2UUAL 3TEHB 1I3QH 2KHIA 3L2PA 3F8TA 1SFOH 4B3SL 2Q2IA 2R92G 4GNXA 2E5LQ 2ZTEA 2L15A 3UE1A 2NVYH 1HZBA 4GLXA 2RHQB 3RN5A 5LMNW 2DUDA 1KRSA 2PQAA 4NB3A 2R7DA 1L0WA 1XMQL 2B63H 2BH8A 1IBMQ 4LFBL 5JJLA 2Z6KA 5IT9c 1UE5A 2H5XA 1SN8A 3GTGH 1I50H 4R1JA 1VQMA 2ATWA 4C3HH 4HJAA 1PH3A 3RN2A 2I5HA 1Q82C 4IO9A 4YWLA 4OO1G 4FDBA 2Y0SE 3I55A 1JJGA 4YY3L 4DV2L 1K8AC 3E9HA 1LM0A 5IYCH 2Q2TA 3A5ZB 1C9OA 3Q8DA 4A3LH 3FKIH 3GTQH 1Y1VH 5C44H 2FXQA 2K5VA 4XIGS 5C0XG 2XGTA 1EOVA 3GTJH 4BBSG 3CC2A 3HOUH 4JBJA 4DR1Q 2EIFA 4L5SA 1A8VA 2NZHA 3HKZE 4YWMA 1V43A 1U0LA 2NN6I 4JC0A 3CC7A 4BXXH 3J80i 2VUMG 4HJ9A 5IP9G 2ZJQA 3I7FA 1GO3E 2MO0A 4JI6L 3IRBA 4X65Q 1OXSC 2V1CC 4A3MG 3PIPA 4B3ML 2IX1A 1UWVA 1KC8C 4KLKA 3PIOA 2K4KA 2ZJRA 4OX9L 4DR6Q 2HT1A 1IBLL 3PF4A 4UP9A 1Q1BA 1I94Q 4PMWA 1OXUA 2HIVA 3UDFA 3CMAA 1NJIC 1IL2A 4AYBG 4JI8Q 1M90C 1UEBA 4BBRG 4DV1Q 3KFUA 2VZAA 4A3KG 2AMCB 1XMOL 3T1YQ 2A1AA 1YITA 2I5LX 2K52A 1IBML 1WCMH 2JEBI 3UDXA 5GAEC 4YCUA 4OWTB 1PH9A 1PV4A 3GTLH 2R92H 1JE5A 4R4OA 5K36G 4LW1A 1YJWA 2JJQA 1VQKA 1FVIA 4P74A 1JJCB 1KAWA 3PUVA 3U4VA 4JI0Q 4UY8C 4MTNA 1LTLA 4A3FG 1N34Q 3KDFA 1YJNA 1PH8A 1HH2P 3K80C 1RIPA 3K81C 1N32Q 3CCMA 1VQIA 1Q86C 5J3BA 4C3JH 3CAMA 4A3IG 1XNQQ 1N33L 2UXCQ 1VS0A 1VQ9A 2UU9L 1JT8A 5GAGC 1QVFA 5ELNA 2IX0A 4HIDA 3KLWA 4IPGA 1D8LA 3J81c 1K73C 1HZ9A 2GVAA 1KL9A 2OQ0A 1EIFA 1KIXA 1X6OA 3K0XA 1EIYB 3M4PA 3U58A 2IT1A 4DV5Q 3VDYA 1X56A 3CQZH 4BBSH 4DR6L 4YHHL 3TRZA 2R93G 1K0RA 2E8GA 1Q12A 1SR3A 2E2IH 1NY4A 1MKHA 1UE7A 2JA8G 1X3FA 1QZGA 4JG2A 2VUMH 5IP9H 4JI8L 1YIJA 3OTOQ 1YHQA 4DV1L 2Q2UA 4KHZA 5EAYA 4POFA 4DR5L 2VQEQ 4A3MH 4IJHA 2N78A 1PH2A 1Q1EA 1YNXA 1XMQQ 4LFBQ 1YI2A 3I4NH 1MJCA 4DUYL 1M1KC 4B3TL 3GTPH 2NZOA 4A3DG 3CCUA 4JV5Q 3CP0A 4BBRH 4LFCQ 3G71A 2KCTA 1QZHA 4YY3Q 2XTIA 4DV2Q 4A3KH 4JOIA 3H3VI 4RMFA 4GS3A 4BA1I 1OTCA 1TXYA 3M85A 3I2ZA 1K3RA 3CC4A 3SGIA 4WJ4A 2KCMA 4YCVA 3S16H 5FJ8G 1XPOA 4JCVE 2CWAA 1HNXL 1I6HH 3CCLA 4WJ3M 1ASYA 1NTGA 5HY6A 1JJ2A 2OTJA 3CPWA 4A3FH 1LYLA 4LF6L 1HNWQ 4UPAA 1FGUA 4O0AA 1KD1C 4JI6Q 2R6GA 3GTMH 2R7ZG 1E7ZA 1Q46A 2WAQG 4B3MQ 4DV5L 2PNHA 4A3IH 4GKKQ 1D7QA 4OX9Q 1VQNA 2AKWB 1WYDA 1IBLQ 4BY7G 4DV7Q 1CKNB 1UE6A 3F2BA 1N36Q 1MIUA 3STBD 1VQ6A 3OTOL 3L7ZC 1DGSA 2N3SA 4PG3A 3S2DH 4DR3Q 1PFSA 1VQ8A 2VQEL 2AWOA 1XMOQ 3U50C 1KQSA 3FP9A 3M4QA 4PZ7A 4IOCA 4QL5A 3OYYA 2KENA 1Y14B 2JA8H 1S3OA 4J15A 4OONA 3PO3G 2F4VL 4JV5L 2UUBQ 4LFCL 1Q81C 4PZ6A 5JJIA 2D0PA 3I56A 2JE6I 3RZOH 3LGJA 4LUOA 1JMCA 2CWPA 2MFIA 3GD7A 1VCIA 5FLMG 3HOWG 2GVBA 2RHSB 3PCOB 2D62A 1V1QA 3AEVA 5M5YH 4A3DH 1BVSA 5E7NA 1I5FA 3DLLA 1PH7A 1N33Q 3J81j 1C7YA 1KXLA 2UU9Q 4X66L 4DR4L 2WFWA 3TS0A 2NVQH 3H0GG 4QJFA 3CXCA 1SMXA 4IJLA 1SE8A 2IHFA 1HNWL 1TWCH 2ZTDA 3UE0A 4DPGA 2B29A 2KBNA 4AIMA 1AH9A 4UP8A 4GN3B 4DV3L 1EQQA 1VQEA 3OW2A 2CKZB 2F3IA 3GTKH 5C3EG 2VQFQ 4GKKL 5FJ8H 4NXNQ 2VL6A 4YHHQ 3ER0A 4DV7L 1BKBA 5GAHC 1IZ6A 1VQFA 3A0JA 4A3JG 2K14A 4QGUA 1Y1WG 3F1ZA 1XJVA 1N36L 1XNRQ 1GKHA 1E1TA 4DUZQ 4LF9L 1GVPA 1N8RC 4DR3L 1YEZA 2IHEA 1YZ6A 2ID0A 4DR5Q 1NBWA 1PHJA 1L1OA 3J81i 1IBKQ 2YTYA 2HQLA 2EQSA 5M5XH 4BY7H 3KF6A 3U4ZA 4DUYQ 2YYZA 1X9NA 3AFPA 4B3TQ 4KHPL 1X3GA 3PUYA 4AQYL 1N9WA 4KI0A 1PH6A 2UUBL 1XTDA 5IYDG 3CPFA 2CCZA 1VQAA 4R4IA 3H3VH 1CUKA 3W1GA 1VQOA 4GNXC 3K8AA 1PA6A 3PO2G 1B70B 4XTCS 3RR5A 4IFDJ 2JA7G 4X64Q 4AYBE 4B3RL 4GKJQ 1A62A 3MXNB 5FLXc 3PV0A 3PO3H 4A3GG 4Y52H 3ULPA 1CSQA 1W2BA 4K0KL 5C4XG 4L5RC 1HNXQ 4A3GH 2Z6KC 4GOPA 1Q8KA 1TWHH 3DM3A 1HNZQ 1E1OA 2ZM6Q 3PSIA 1K9MC 4LF6Q 4C2MH 5FLMH 2VNUD 3HOWH 2JA9A 3CCRA 2E2HH 3S1MH 3D31A 1QUQB 1J5EL 3KYHC 2VQFL 1JB7A 1HR0Q 2HHHL 4NXNL 2VY3A 5GADC 4A93G 3S24A 4IPDA 3G48A 3MEFA 1XNRL 3CCQA 2YTXA 1KRTA 4DR2L 3CCSA 2WB1E 2Q2HA 4DUZL 1R9TH 3B6YA 4LUZA 4JI1L 1NMFA 4R4TA 4R4CA 1VQ5A 3S14H 1X55A 4AH6A 3HOVG 3ULJA 1A63A 1FL0A 5C3EH 3NELA 1IBKL 3M4OH 4OWXB 1VQJA 3JC66 1YJ9A 1T9HA 1VQDA 1VQLA 3CW2C 4MNOA 1Y1WH 2ES2A 1Z47A 3K7UC 1L2FA 4JI4Q 2NVTH 3EIVA 3J7A5 2F4VQ 3HOYG 2ASBA 1QVGA 3S15H 3FHWA 4BY1G 1X54A 5LMNQ 4HIMA 4A76A 1IXRA 3PUXA 5LMUQ 3RNUA 4X64L 4A3BG 3BU2A 4DV0L 1P8LA 4GKJL 3E9IA 2JA5G 3K7AH 3GTOH 2VS1A 5IP7G 1WJJA 4JI7L 5M3MG 3HOXG 3W5OA 5IYDH 4X66Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJ7 A;  2YU9 H;  4DR4 Q;  1W3S A;  2N8N A;  3CCJ A;  1LUZ A;  3NEM A;  4A3E G;  2A19 A;  2ZM6 L;  3TRE A;  2OCE A;  1HNZ L;  4LF4 L;  3PO2 H;  2C35 B;  1BBU A;  4DV3 Q;  4JYA L;  2JA7 H;  3T1H Q;  1S72 A;  1CSP A;  3KJO A;  1X3E A;  1HR0 L;  4GLA C;  4H02 A;  4JI2 L;  4JI3 L;  3BZK A;  2I0Q A;  4P72 A;  1PYB A;  4TVA B;  4POG A;  5C4X H;  5ELO A;  1MJE A;  1OXT A;  3M9B A;  1A0I A;  1O7I A;  4DV6 L;  5IYB G;  4Y7N H;  3UDG A;  1EQR A;  1KHI A;  1B8A A;  5JEA J;  3UDI A;  3EN2 A;  2ZJP A;  4LF9 Q;  3HKS A;  1U5K A;  1G51 A;  1FJG Q;  2KHJ A;  1UE1 A;  1HR0 W;  4GNX B;  4DK3 C;  5BR8 L;  5IE8 A;  2DGY A;  4DR7 L;  1HZC A;  1P16 A;  3TS2 A;  4A93 H;  1NMG A;  2R93 H;  2RF4 A;  4LNQ A;  3GO5 A;  1XPU A;  4YWK A;  4KHP Q;  3A74 A;  2K75 A;  2PQA B;  3BJU A;  4JI4 L;  2OWO A;  1HZA A;  2QEX A;  4QIW E;  4AQY Q;  1E24 A;  2Y0S G;  1G6P A;  2WAQ E;  4DAY B;  5LMN L;  4BA2 I;  1B7Y B;  3HOV H;  4P71 A;  2AHO B;  5LMU L;  2PI2 E;  4NXM L;  4P75 A;  4APV A;  1NE3 A;  2RCN A;  2LXJ A;  4B3R Q;  1RL2 A;  4TQU S;  4DV4 Q;  3M3Y H;  1BBW A;  3A5U A;  2D0O A;  3HOY H;  4K0K Q;  3HKZ G;  4P73 A;  3WWV A;  2QGQ A;  2UXD L;  4BY1 H;  3J7Z C;  3AFQ A;  3STB C;  1K8G A;  4HIO A;  3KOJ A;  4DKA C;  4LF7 L;  3AYH B;  3KJP A;  1PYS B;  2VW9 A;  2UXB Q;  3T1H L;  4A3B H;  3JAM c;  2OTL A;  2I5M X;  1J5E Q;  2JA5 H;  5IP7 H;  2HHH Q;  2WP8 J;  5M3M H;  4JOI C;  4X6A H;  3HOX H;  1VQ4 A;  5AJ3 L;  2JA6 G;  4X62 Q;  3S1N H;  4QY7 A;  4A3E H;  1VQC A;  2HIX A;  4DR2 Q;  1PH1 A;  3PF5 A;  5IY0 A;  2B3G A;  4JI1 Q;  1WFQ A;  4EQ5 A;  1FJG L;  2R7Z H;  3PGZ A;  3RLF A;  4OXP A;  1Z9F A;  4YCW A;  1C0A A;  4HJ8 A;  4LFA L;  4DNI A;  5IWA L;  4LF5 L;  3I4M G;  4ALP A;  4LF5 Q;  1L1O B;  5IYB H;  2BH2 A;  3NEN A;  4IFD G;  2JK8 A;  3CCE A;  3RLO A;  3KF6 B;  3ICE A;  5JEA G;  2UUC L;  3HOZ G;  2JQO A;  3I4N G;  3BZC A;  4DAM A;  3AQQ A;  2E5L L;  4QQB X;  4DV0 Q;  3EBE A;  4DV4 L;  4HIK A;  4C3I H;  1YBY A;  3KDF B;  4L5Q A;  4JI7 Q;  4JI5 Q;  2AWN A;  1GD7 A;  1EUJ A;  1VQG A;  3CF5 A;  4A3C G;  1TWG H;  3PUZ A;  3G6E A;  3PUW A;  4LF4 Q;  1PH4 A;  4GLV B;  2MNA A;  2UXB L;  3E0E A;  3RLN A;  4JYA Q;  4GOP B;  3J80 c;  5M3F G;  1HJP A;  3I4O A;  5GRO A;  4JI2 Q;  2QA4 A;  4IOA A;  2NN6 G;  4JI3 Q;  1VQ7 A;  5GQO A;  4NPS A;  3F2C A;  3CME A;  4X62 L;  3H0G H;  1IYJ B;  1YHB A;  4DV6 Q;  2MQH A;  2WB1 G;  1V9P A;  3W1B A;  3M7N A;  3S1Q H;  2E2J H;  4L5T A;  2LXK A;  1WI5 A;  4DR1 L;  2PI2 A;  4LF8 Q;  2Z0S A;  2ALY B;  1WOC A;  3S17 H;  4IPC A;  5BR8 Q;  4HJ5 A;  1GM5 A;  1ASZ A;  2NVX H;  4IFD I;  4DR7 Q;  1CKO A;  1QUQ A;  1YHA A;  2K5H A;  3GDE A;  2JA6 H;  4GN4 B;  4A3J H;  2N49 A;  3ERS X;  3ULL A;  4LUV A;  4X65 L;  3G4S A;  3S2H H;  4ME3 A;  3ZJY C;  1OXV A;  3KF8 B;  3S1R H;  5M5W H;  3RZD H;  2B63 G;  2YV5 A;  5DLQ E;  1YVC A;  2YTV A;  2UUA Q;  2IY5 B;  4JBM A;  1X65 A;  1I94 L;  4B3S Q;  2F52 A;  4A75 A;  1S40 A;  4O2D A;  4NXM Q;  3I4M H;  1PVO A;  2EXD A;  1EYG A;  5JJK A;  4JBK A;  1SLJ A;  1VQH A;  1E3P A;  2LSS A;  4MZ9 A;  4OWW B;  2BA0 A;  3CD6 A;  4JBW A;  1L1O C;  4DK6 C;  2K5N A;  4JI5 L;  1AE2 A;  5IYC G;  3T1Y L;  2UXD Q;  3HOZ H;  4A3L G;  3FKI G;  5C0X J;  5H1S E;  1H95 A;  1Y1V G;  1EWI A;  5C44 G;  3H15 A;  3F2D A;  2OQK A;  4LF7 Q;  1OXX K;  2A8V A;  1TWA H;  1AE3 A;  3HOU G;  1Q7Y C;  4JI0 L;  2BA1 A;  2K50 A;  3NBH B;  1N34 L;  4BXX G;  2MO1 A;  4R4Q A;  5AJ3 Q;  4PZ8 A;  1EFW A;  4A3C H;  1PH5 A;  5HGQ A;  4UP7 A;  4IPH A;  1SRU A;  1N32 L;  4GN5 A;  3TQY A;  2PMZ E;  3HFZ B;  2UXC L;  1CKM A;  1XNQ L;  1E22 A;  1XPR A;  4LF8 L;  5M3F H;  1VQB A;  2CFM A;  2GN5 A;  2CQO A;  3L0O A;  4GOP C;  2R7F A;  2ZTC A;  4RG1 A;  4OO1 I;  1VQP A;  3CCV A;  4LFA Q;  3JAM i;  5IWA Q;  4LWC A;  4EX5 A;  2JEA I;  1K83 H;  1QVC A;  1CKN A;  1SRO A;  3D0F A;  1G29 1;  5C0X I;  5C4J H;  1J6Q A;  4A4I A;  2UUC Q;  1TWF H;  1WCM G;  2UUA L;  3TEH B;  1I3Q H;  2KHI A;  3L2P A;  3F8T A;  1SFO H;  4B3S L;  2Q2I A;  2R92 G;  4GNX A;  2E5L Q;  2ZTE A;  2L15 A;  3UE1 A;  2NVY H;  1HZB A;  4GLX A;  2RHQ B;  3RN5 A;  5LMN W;  2DUD A;  1KRS A;  2PQA A;  4NB3 A;  2R7D A;  1L0W A;  1XMQ L;  2B63 H;  2BH8 A;  1IBM Q;  4LFB L;  5JJL A;  2Z6K A;  5IT9 c;  1UE5 A;  2H5X A;  1SN8 A;  3GTG H;  1I50 H;  4R1J A;  1VQM A;  2ATW A;  4C3H H;  4HJA A;  1PH3 A;  3RN2 A;  2I5H A;  1Q82 C;  4IO9 A;  4YWL A;  4OO1 G;  4FDB A;  2Y0S E;  3I55 A;  1JJG A;  4YY3 L;  4DV2 L;  1K8A C;  3E9H A;  1LM0 A;  5IYC H;  2Q2T A;  3A5Z B;  1C9O A;  3Q8D A;  4A3L H;  3FKI H;  3GTQ H;  1Y1V H;  5C44 H;  2FXQ A;  2K5V A;  4XIG S;  5C0X G;  2XGT A;  1EOV A;  3GTJ H;  4BBS G;  3CC2 A;  3HOU H;  4JBJ A;  4DR1 Q;  2EIF A;  4L5S A;  1A8V A;  2NZH A;  3HKZ E;  4YWM A;  1V43 A;  1U0L A;  2NN6 I;  4JC0 A;  3CC7 A;  4BXX H;  3J80 i;  2VUM G;  4HJ9 A;  5IP9 G;  2ZJQ A;  3I7F A;  1GO3 E;  2MO0 A;  4JI6 L;  3IRB A;  4X65 Q;  1OXS C;  2V1C C;  4A3M G;  3PIP A;  4B3M L;  2IX1 A;  1UWV A;  1KC8 C;  4KLK A;  3PIO A;  2K4K A;  2ZJR A;  4OX9 L;  4DR6 Q;  2HT1 A;  1IBL L;  3PF4 A;  4UP9 A;  1Q1B A;  1I94 Q;  4PMW A;  1OXU A;  2HIV A;  3UDF A;  3CMA A;  1NJI C;  1IL2 A;  4AYB G;  4JI8 Q;  1M90 C;  1UEB A;  4BBR G;  4DV1 Q;  3KFU A;  2VZA A;  4A3K G;  2AMC B;  1XMO L;  3T1Y Q;  2A1A A;  1YIT A;  2I5L X;  2K52 A;  1IBM L;  1WCM H;  2JEB I;  3UDX A;  5GAE C;  4YCU A;  4OWT B;  1PH9 A;  1PV4 A;  3GTL H;  2R92 H;  1JE5 A;  4R4O A;  5K36 G;  4LW1 A;  1YJW A;  2JJQ A;  1VQK A;  1FVI A;  4P74 A;  1JJC B;  1KAW A;  3PUV A;  3U4V A;  4JI0 Q;  4UY8 C;  4MTN A;  1LTL A;  4A3F G;  1N34 Q;  3KDF A;  1YJN A;  1PH8 A;  1HH2 P;  3K80 C;  1RIP A;  3K81 C;  1N32 Q;  3CCM A;  1VQI A;  1Q86 C;  5J3B A;  4C3J H;  3CAM A;  4A3I G;  1XNQ Q;  1N33 L;  2UXC Q;  1VS0 A;  1VQ9 A;  2UU9 L;  1JT8 A;  5GAG C;  1QVF A;  5ELN A;  2IX0 A;  4HID A;  3KLW A;  4IPG A;  1D8L A;  3J81 c;  1K73 C;  1HZ9 A;  2GVA A;  1KL9 A;  2OQ0 A;  1EIF A;  1KIX A;  1X6O A;  3K0X A;  1EIY B;  3M4P A;  3U58 A;  2IT1 A;  4DV5 Q;  3VDY A;  1X56 A;  3CQZ H;  4BBS H;  4DR6 L;  4YHH L;  3TRZ A;  2R93 G;  1K0R A;  2E8G A;  1Q12 A;  1SR3 A;  2E2I H;  1NY4 A;  1MKH A;  1UE7 A;  2JA8 G;  1X3F A;  1QZG A;  4JG2 A;  2VUM H;  5IP9 H;  4JI8 L;  1YIJ A;  3OTO Q;  1YHQ A;  4DV1 L;  2Q2U A;  4KHZ A;  5EAY A;  4POF A;  4DR5 L;  2VQE Q;  4A3M H;  4IJH A;  2N78 A;  1PH2 A;  1Q1E A;  1YNX A;  1XMQ Q;  4LFB Q;  1YI2 A;  3I4N H;  1MJC A;  4DUY L;  1M1K C;  4B3T L;  3GTP H;  2NZO A;  4A3D G;  3CCU A;  4JV5 Q;  3CP0 A;  4BBR H;  4LFC Q;  3G71 A;  2KCT A;  1QZH A;  4YY3 Q;  2XTI A;  4DV2 Q;  4A3K H;  4JOI A;  3H3V I;  4RMF A;  4GS3 A;  4BA1 I;  1OTC A;  1TXY A;  3M85 A;  3I2Z A;  1K3R A;  3CC4 A;  3SGI A;  4WJ4 A;  2KCM A;  4YCV A;  3S16 H;  5FJ8 G;  1XPO A;  4JCV E;  2CWA A;  1HNX L;  1I6H H;  3CCL A;  4WJ3 M;  1ASY A;  1NTG A;  5HY6 A;  1JJ2 A;  2OTJ A;  3CPW A;  4A3F H;  1LYL A;  4LF6 L;  1HNW Q;  4UPA A;  1FGU A;  4O0A A;  1KD1 C;  4JI6 Q;  2R6G A;  3GTM H;  2R7Z G;  1E7Z A;  1Q46 A;  2WAQ G;  4B3M Q;  4DV5 L;  2PNH A;  4A3I H;  4GKK Q;  1D7Q A;  4OX9 Q;  1VQN A;  2AKW B;  1WYD A;  1IBL Q;  4BY7 G;  4DV7 Q;  1CKN B;  1UE6 A;  3F2B A;  1N36 Q;  1MIU A;  3STB D;  1VQ6 A;  3OTO L;  3L7Z C;  1DGS A;  2N3S A;  4PG3 A;  3S2D H;  4DR3 Q;  1PFS A;  1VQ8 A;  2VQE L;  2AWO A;  1XMO Q;  3U50 C;  1KQS A;  3FP9 A;  3M4Q A;  4PZ7 A;  4IOC A;  4QL5 A;  3OYY A;  2KEN A;  1Y14 B;  2JA8 H;  1S3O A;  4J15 A;  4OON A;  3PO3 G;  2F4V L;  4JV5 L;  2UUB Q;  4LFC L;  1Q81 C;  4PZ6 A;  5JJI A;  2D0P A;  3I56 A;  2JE6 I;  3RZO H;  3LGJ A;  4LUO A;  1JMC A;  2CWP A;  2MFI A;  3GD7 A;  1VCI A;  5FLM G;  3HOW G;  2GVB A;  2RHS B;  3PCO B;  2D62 A;  1V1Q A;  3AEV A;  5M5Y H;  4A3D H;  1BVS A;  5E7N A;  1I5F A;  3DLL A;  1PH7 A;  1N33 Q;  3J81 j;  1C7Y A;  1KXL A;  2UU9 Q;  4X66 L;  4DR4 L;  2WFW A;  3TS0 A;  2NVQ H;  3H0G G;  4QJF A;  3CXC A;  1SMX A;  4IJL A;  1SE8 A;  2IHF A;  1HNW L;  1TWC H;  2ZTD A;  3UE0 A;  4DPG A;  2B29 A;  2KBN A;  4AIM A;  1AH9 A;  4UP8 A;  4GN3 B;  4DV3 L;  1EQQ A;  1VQE A;  3OW2 A;  2CKZ B;  2F3I A;  3GTK H;  5C3E G;  2VQF Q;  4GKK L;  5FJ8 H;  4NXN Q;  2VL6 A;  4YHH Q;  3ER0 A;  4DV7 L;  1BKB A;  5GAH C;  1IZ6 A;  1VQF A;  3A0J A;  4A3J G;  2K14 A;  4QGU A;  1Y1W G;  3F1Z A;  1XJV A;  1N36 L;  1XNR Q;  1GKH A;  1E1T A;  4DUZ Q;  4LF9 L;  1GVP A;  1N8R C;  4DR3 L;  1YEZ A;  2IHE A;  1YZ6 A;  2ID0 A;  4DR5 Q;  1NBW A;  1PHJ A;  1L1O A;  3J81 i;  1IBK Q;  2YTY A;  2HQL A;  2EQS A;  5M5X H;  4BY7 H;  3KF6 A;  3U4Z A;  4DUY Q;  2YYZ A;  1X9N A;  3AFP A;  4B3T Q;  4KHP L;  1X3G A;  3PUY A;  4AQY L;  1N9W A;  4KI0 A;  1PH6 A;  2UUB L;  1XTD A;  5IYD G;  3CPF A;  2CCZ A;  1VQA A;  4R4I A;  3H3V H;  1CUK A;  3W1G A;  1VQO A;  4GNX C;  3K8A A;  1PA6 A;  3PO2 G;  1B70 B;  4XTC S;  3RR5 A;  4IFD J;  2JA7 G;  4X64 Q;  4AYB E;  4B3R L;  4GKJ Q;  1A62 A;  3MXN B;  5FLX c;  3PV0 A;  3PO3 H;  4A3G G;  4Y52 H;  3ULP A;  1CSQ A;  1W2B A;  4K0K L;  5C4X G;  4L5R C;  1HNX Q;  4A3G H;  2Z6K C;  4GOP A;  1Q8K A;  1TWH H;  3DM3 A;  1HNZ Q;  1E1O A;  2ZM6 Q;  3PSI A;  1K9M C;  4LF6 Q;  4C2M H;  5FLM H;  2VNU D;  3HOW H;  2JA9 A;  3CCR A;  2E2H H;  3S1M H;  3D31 A;  1QUQ B;  1J5E L;  3KYH C;  2VQF L;  1JB7 A;  1HR0 Q;  2HHH L;  4NXN L;  2VY3 A;  5GAD C;  4A93 G;  3S24 A;  4IPD A;  3G48 A;  3MEF A;  1XNR L;  3CCQ A;  2YTX A;  1KRT A;  4DR2 L;  3CCS A;  2WB1 E;  2Q2H A;  4DUZ L;  1R9T H;  3B6Y A;  4LUZ A;  4JI1 L;  1NMF A;  4R4T A;  4R4C A;  1VQ5 A;  3S14 H;  1X55 A;  4AH6 A;  3HOV G;  3ULJ A;  1A63 A;  1FL0 A;  5C3E H;  3NEL A;  1IBK L;  3M4O H;  4OWX B;  1VQJ A;  3JC6 6;  1YJ9 A;  1T9H A;  1VQD A;  1VQL A;  3CW2 C;  4MNO A;  1Y1W H;  2ES2 A;  1Z47 A;  3K7U C;  1L2F A;  4JI4 Q;  2NVT H;  3EIV A;  3J7A 5;  2F4V Q;  3HOY G;  2ASB A;  1QVG A;  3S15 H;  3FHW A;  4BY1 G;  1X54 A;  5LMN Q;  4HIM A;  4A76 A;  1IXR A;  3PUX A;  5LMU Q;  3RNU A;  4X64 L;  4A3B G;  3BU2 A;  4DV0 L;  1P8L A;  4GKJ L;  3E9I A;  2JA5 G;  3K7A H;  3GTO H;  2VS1 A;  5IP7 G;  1WJJ A;  4JI7 L;  5M3M G;  3HOX G;  3W5O A;  5IYD H;  4X66 Q; 
#chains in the Genus database with same CATH topology
 4HJ7 A;  3NEM A;  2AUJ D;  2A19 A;  2OCE A;  2RQX A;  4KKS A;  2AQ3 B;  3PO2 H;  2C35 B;  2XRS D;  3NBH A;  4DV3 Q;  3T56 B;  2BOS A;  1HR0 L;  4GLA C;  4HSP A;  2I0Q A;  3VR6 A;  1PYB A;  4TVA B;  3BDL A;  2NTT A;  3M9B A;  1A2U A;  5JEA J;  3VR5 A;  3S16 B;  5I9O A;  1FJG Q;  2FIN B;  2KHJ A;  1UE1 A;  4GNX B;  4DK3 C;  4ZCK A;  3TS2 A;  3IL8 A;  1NMG A;  2L9H A;  1XPU A;  2CH4 A;  1JOQ A;  2M00 A;  5CV5 A;  2K75 A;  2L55 A;  4JI4 L;  2IWH A;  1I4R A;  1XXG A;  2Y0S G;  1G6P A;  3BDC A;  5C4X B;  1FGB D;  3R8B A;  5I6Y A;  2AHO B;  3NTK A;  5LMU L;  4MHE A;  4Q5V A;  1NNX A;  1RL2 A;  3M3Y H;  1BBW A;  2CHB D;  5LL6 S;  4CDC C;  4DKA C;  2CVR A;  3KJP A;  2VW9 A;  1CA6 A;  2UXB Q;  3T1H L;  3JAM c;  5CC4 A;  1J5E Q;  2JA5 H;  1SXT A;  3PIO 3;  1HFN A;  1B2T A;  2K32 A;  2JA6 G;  3S1N H;  4ZKC B;  1XYI A;  2HIX A;  1PH1 A;  1IKM A;  5IY0 A;  2HDM A;  2B3G A;  2PW7 A;  4E6I A;  1TS3 A;  1G91 A;  1LTT D;  1CI3 M;  4OXP A;  4HAE A;  4HJ8 A;  1TWC B;  5FLX L;  5IWA L;  2F0O A;  2EYL A;  2BH2 A;  3NEN A;  3MWY W;  1V1P B;  5C4Z A;  3ICE A;  3NQI A;  5JEA G;  2JQO A;  2MHV A;  1O80 A;  4DAM A;  4ZLT F;  5IGC A;  3AQQ A;  4A3E B;  1GJX A;  2TSS A;  2F0D A;  4QQB X;  4DV0 Q;  3EBE A;  1AFP A;  1YBY A;  4KJN A;  4JI5 Q;  1GD7 A;  4JK1 C;  5M5X B;  5FLX E;  1TY0 A;  1EU4 A;  2PZW A;  4LF4 Q;  2MNA A;  3E0E A;  2KED A;  4H0L C;  4IUU A;  3J80 c;  3I4O A;  4GOP B;  5GRO A;  3FEW X;  4LK1 C;  2QA4 A;  1VQ7 A;  3F2C A;  1EQT A;  3H0G H;  1IYJ B;  1PFN A;  4O1N A;  1QIL A;  4L5T A;  2LXK A;  2Z0S A;  4IPC A;  1GM5 A;  1ASZ A;  2OT2 A;  1EYA A;  3ERS X;  3ULL A;  1STA A;  3G4S A;  1RTO A;  3MFG A;  1FR3 A;  1O7Y A;  2EYP A;  5M5W H;  1IYU A;  5JPN C;  1YVC A;  2UUA Q;  3SK4 A;  1X65 A;  4B3S Q;  4NDX A;  4C3H G;  1S40 A;  4O2D A;  1R9T B;  3K5O A;  1PVO A;  4IUV A;  5JJK A;  2FJ2 A;  1SLJ A;  4OWW B;  2BA0 A;  3S17 B;  4JBW A;  4DK6 C;  5C3W A;  3D3R A;  1F9R A;  1LAC A;  3HOZ H;  3VR3 A;  4V19 0;  3H15 A;  2F0M A;  3F2D A;  3PMF A;  2OQK A;  3D4D A;  2A8V A;  1Q7Y C;  2BA1 A;  4PMC A;  1W6J A;  3DM1 A;  2K50 A;  5AJ3 Q;  4L63 B;  4PZ8 A;  4FXD A;  1SNM A;  4K2L A;  1SRU A;  1N32 L;  4GN5 A;  2BE5 D;  2PMZ E;  5KNB A;  1E22 A;  3Q0A A;  1PZJ D;  4HCS A;  1PFB A;  1A15 A;  1VQP A;  3MC0 B;  3CCV A;  4LFA Q;  3JAM i;  3TP6 A;  5IIF A;  1B1Z A;  1TWA B;  1AN8 A;  1CKN A;  1SRO A;  3J7Y W;  1K3B C;  5G3L F;  4JPB W;  1S5C D;  5FO9 B;  2Q2I A;  4Y7N B;  3UI2 A;  2ZTE A;  3HRZ C;  4PQX A;  5I6W A;  2RDG A;  2RHQ B;  2FFK B;  1KRS A;  5JJL A;  1I6V C;  4A93 B;  3GTG H;  1UE5 A;  1SN8 A;  1ZEQ X;  4R1J A;  3E0J A;  5CV9 A;  1B9M A;  4HJA A;  4HMJ A;  3RN2 A;  4XYO A;  3A7A B;  4IO9 A;  5DM7 3;  3I55 A;  1JJG A;  3MHB A;  4YY3 L;  5CV7 A;  1LM0 A;  5IYC H;  3EA6 A;  3CRK C;  3GTQ H;  5C6A A;  5L37 A;  5C44 H;  2K5V A;  2E74 C;  3GTJ H;  3VYR A;  3CC2 A;  4DR1 Q;  3HKZ E;  1EU3 A;  1LO5 D;  3D8G A;  3CC7 A;  1I50 B;  3J80 i;  1HFG A;  3I7F A;  4RWS C;  3IRB A;  2KEE A;  1TS4 A;  2V1C C;  3QO2 A;  3KBX A;  4LAA A;  2QF7 A;  1KC8 C;  1VMP A;  2K4K A;  2DN8 A;  5M3M B;  4OX9 L;  1TS5 A;  1BO0 A;  3PF4 A;  2QDL A;  1BCP D;  3UDF A;  1IL2 A;  1V1O A;  3SXH A;  1M90 C;  1U4R A;  4A3K G;  4DK0 A;  2QEJ C;  2AMC B;  1DZ1 A;  4R8I A;  2JEB I;  3A8K E;  3UDX A;  4IUQ A;  1PH9 A;  2LFN A;  2JJQ A;  3Q23 A;  1FVI A;  4CKE A;  1C4Q A;  4FP5 D;  4RAU C;  1Q8I A;  4A3F G;  3KDF A;  3DUZ A;  1BR9 A;  4CJ2 C;  1HH2 P;  2EZV A;  2IX3 A;  3A8I E;  3CCM A;  1Q86 C;  5DM6 3;  2F0S A;  4C3J H;  1XNQ Q;  1VQ9 A;  1QVF A;  4QUC A;  1TWG B;  1PTO B;  1SE3 A;  3EQL C;  4IPG A;  3T13 A;  1SBB B;  4C56 C;  3T16 A;  1WD0 A;  3M4P A;  3U58 A;  2IT1 A;  1EIY B;  4BBS H;  3CQZ H;  2R93 G;  1JCK B;  1K0R A;  4KKT A;  4KJO A;  2VUM H;  4JG2 A;  1YIJ A;  2Z9H A;  5HGT A;  5EAY A;  4DR5 L;  3VR2 A;  1D5Z C;  1AW7 A;  1NR4 A;  1MJC A;  1QE6 A;  4DUY L;  4B3T L;  2EYF A;  3CP0 A;  3WDN A;  3G71 A;  1QZH A;  4DV2 Q;  3LNN A;  3H3V I;  3QIA A;  4GS3 A;  1TXY A;  4PV1 C;  3M85 A;  4OHJ A;  3SGI A;  2KCM A;  4ZQ3 A;  1SYB A;  3S16 H;  4DXG A;  1RDP D;  2F3W A;  4A3M B;  5BN5 A;  2GA4 B;  2CWA A;  2DNE A;  3CCL A;  1ASY A;  4ME5 A;  5HY6 A;  3CPW A;  1LYL A;  1HNW Q;  2F0W A;  5KEE A;  4JI6 Q;  1QNU A;  1DD2 A;  4DV5 L;  1D7Q A;  4GKK Q;  1EL0 A;  3SK8 A;  1IBL Q;  1S5D D;  5C4H A;  4HTH A;  4KN4 C;  1N36 Q;  4PG3 A;  4QF4 A;  1VQ8 A;  2VQE L;  3P75 A;  4KMU C;  2EPB A;  3M4Q A;  1F2L A;  2A69 C;  4UAI A;  1CK1 A;  3NTI A;  4J15 A;  4OON A;  4LFC L;  2D0P A;  2RCF A;  3I56 A;  1WTQ A;  2RA4 A;  5COY A;  1JMC A;  2CWP A;  1I4X A;  1ENF A;  3PCO B;  3G6J B;  2D62 A;  1V1Q A;  1PH7 A;  1C7Y A;  2JSO A;  3TS0 A;  4QUF A;  4ZK9 B;  1TWC H;  4FXK C;  2B29 A;  2KBN A;  2K5Q A;  1AH9 A;  4DV3 L;  1F2Z A;  4GN3 B;  1VQE A;  2XSC A;  3OW2 A;  2L0C A;  1SDF A;  3GTK H;  2NWG A;  3HGB A;  4V0B A;  2VL6 A;  4DV7 L;  3HS0 C;  1XJV A;  4A3J G;  1XNR Q;  2PCF B;  1KNA A;  1YEZ A;  5KIX A;  2K01 A;  3G7L A;  3NXW A;  2NVQ B;  2YTY A;  5M5X H;  1SEB D;  3KF6 A;  3U4Z A;  2YYZ A;  3ITP A;  3C3L A;  1JB3 A;  4KI0 A;  1PH6 A;  2UUB L;  3OW7 A;  1KNE A;  2JN4 A;  2VB2 X;  1GUN A;  1TU2 B;  1CUK A;  3W1G A;  2D9U A;  1S4Z A;  4XTC S;  4AYB E;  2B2U C;  2SDF A;  2HD3 A;  5FLX c;  3MXN B;  3PO3 H;  5JVH 3;  5C4X G;  5EBD A;  2OF1 A;  4BY7 B;  1HQR D;  1K9M C;  1K8O A;  4C2M H;  5FLM H;  2VNU D;  2M9V A;  3CCR A;  2KVM A;  1VDZ A;  1QUQ B;  1J5E L;  5A2Q L;  1WTW A;  2A68 C;  1EYD A;  4C1N K;  1AEX A;  1HQM C;  2WB1 E;  1R9T H;  3B6Y A;  2Z4I A;  5JPM C;  1X55 A;  4AH6 A;  4DAP A;  4RGO S;  5C3E H;  4C1N I;  3IFD A;  4OIJ A;  4RKB A;  1TWH B;  3KF8 A;  3HOW B;  4MNO A;  1F77 A;  4PNY A;  3EIV A;  5A2Q E;  2F0F A;  2C5C A;  1QVG A;  1A3U A;  3DWP A;  5LMN Q;  1X32 A;  1LT5 D;  5CBA E;  1IXR A;  2K04 A;  3NHH A;  1GUW A;  3RD4 A;  2IPK D;  1Y69 U;  2G5D A;  5DEH A;  4DV0 L;  3E9I A;  5E1F A;  2IJ0 A;  5IP7 G;  1I4G A;  4DFA A;  2CW0 D;  2HCI A;  1LUZ A;  5EKK A;  4A3E G;  4KV6 A;  2ZM6 L;  1HTP A;  2HDL A;  5T1I A;  1HNZ L;  4LF4 L;  1LTB D;  3EVQ A;  3GTP B;  3GQB A;  4F8M A;  4RCN A;  2JA7 H;  2F0H A;  1S72 A;  3KJO A;  1F9S A;  2RVL A;  4A3G H;  4A3K B;  1MJE A;  1Q90 A;  1A0I A;  3UDG A;  4Y7N H;  1KHI A;  1SSO A;  4LF9 Q;  3VYS A;  3HKS A;  2MUY A;  1G51 A;  4HR7 B;  2YU9 B;  2XIW A;  1HZC A;  4A93 H;  2BE5 C;  3R2I A;  5LHY 1;  2EY5 A;  1EIH A;  4IN3 A;  3GO5 A;  4KHP Q;  3A74 A;  5FO7 B;  3BJU A;  3C1F A;  2WAQ E;  4DAY B;  4BA2 I;  4FXG C;  2G9D A;  2PI2 E;  4H7B A;  4APV A;  1I4P A;  4B3R Q;  3S2D B;  4DV4 Q;  2EVB A;  3HOY H;  3WWV A;  3VA7 A;  2R93 B;  3STB C;  5ELE A;  4N8X 1;  3KOJ A;  1QCB D;  3IFT A;  3K0Y A;  2RKS A;  5CV4 A;  1IYV A;  2HHH Q;  2WP8 J;  2PQE A;  5M3M H;  3QOJ A;  3HOX H;  4CHT B;  5AJ3 L;  1VQC A;  2F0Q A;  4KTA A;  1WFQ A;  2R7Z H;  3PGZ A;  3OPO A;  4BY1 B;  3RLF A;  5I4D A;  1A3T A;  4LFA L;  4DNI A;  5BN3 A;  2E76 C;  1B9N A;  2OXP A;  1HCZ A;  5CBE E;  4A3B B;  2R3Z A;  2PMZ B;  1TY2 A;  1SNQ A;  2JK8 A;  3TME A;  3CCE A;  3J7A V;  4XT3 B;  1JOK A;  1CHP D;  2KHS A;  2NTS A;  4J6H A;  3I4N G;  2JYO A;  1KTK A;  1BQQ T;  1ET6 A;  1ML0 D;  1KAB A;  3Q24 A;  2AWN A;  1VQG A;  2L11 A;  5D3D A;  4A3C G;  1QOH A;  1ILP A;  1PMR A;  5JJZ A;  1TWG H;  3PUZ A;  3G6E A;  3RLN A;  3DXJ C;  1HJP A;  2NN6 G;  3U9S A;  5GQO A;  4NPS A;  3CME A;  4X62 L;  4IUR A;  1V9P A;  2MQH A;  2WB1 G;  3W1B A;  2E2J H;  1HA6 A;  4DR1 L;  2ALY B;  1WOC A;  1CT1 D;  1LT6 D;  1D1I A;  3D6C A;  2JA6 H;  1HRJ A;  4ME3 A;  2AQ1 B;  3ZJY C;  4FNF A;  1STH A;  3S1R H;  2DJG C;  1HUM A;  2XNA C;  3HKZ B;  3QWN A;  3TBI B;  2F52 A;  4K5X A;  3S1Q B;  4MZ9 A;  3TN2 A;  2EYH A;  2UXD Q;  5JEA H;  4A3L G;  3FKI G;  3SE0 A;  1PRT B;  4A3J B;  2EY1 A;  4LF7 Q;  1LT3 D;  5ELB A;  3R93 A;  3HOU G;  1CZG A;  3RZD B;  5C5M A;  3NBH B;  3BYY B;  1EFW A;  2EE1 A;  5HGQ A;  1ICF B;  1S5E D;  3I4M B;  3ND8 A;  5ELF A;  2A69 D;  1CKM A;  1XNQ L;  4LF8 L;  3WOF A;  2GN5 A;  2CFM A;  2BDN A;  2FMC A;  3L0O A;  4OO1 I;  2R7F A;  4RG1 A;  1EYC A;  4U68 A;  2N88 A;  4CKC A;  2JEA I;  3D0F A;  1G29 1;  5C4J H;  1KDB A;  1J6Q A;  4A4I A;  1TWF H;  1WCM G;  3L2P A;  2KHI A;  3F8T A;  4WOR A;  1LT4 D;  1ROD A;  4GNX A;  2EYO A;  2X6G A;  2E5L Q;  4GLX A;  3RN5 A;  4NB3 A;  2R7D A;  4OEL B;  5FKA C;  2BH8 A;  1IBM Q;  2H5X A;  1VQM A;  4HN7 A;  4C3H H;  1K83 B;  3WOE A;  1VF7 A;  2I5H A;  4OO1 G;  5EPK A;  3NSW A;  4DV2 L;  3E9H A;  1I3Q B;  3TZU A;  1XTC D;  1KDA A;  2Q2T A;  1SFO B;  2VXW A;  1EEI D;  3Q8D A;  4N9T A;  1PTO F;  1D6E C;  3NUC A;  3QB3 A;  2C9O A;  4L5S A;  2QCP X;  3MXP A;  2NZH A;  2B63 B;  2ZXP A;  1U0L A;  1H9J A;  1VF5 C;  1Y8O B;  4DGZ A;  5IP9 G;  1GUG A;  4JI6 L;  2D2C C;  1OXS C;  2F0U A;  4A3M G;  1BDO A;  4TKO B;  4KLK A;  3PIO A;  2ZJR A;  4DR6 Q;  1IBL L;  5CV6 A;  5KND A;  3A54 A;  4UP9 A;  1Q1B A;  2HIV A;  3CMA A;  4ZAI A;  1EOT A;  1UEB A;  4BBR G;  4DV1 Q;  3KFU A;  2VZA A;  3T1Y Q;  1YIT A;  2QIL A;  1V1P A;  4OWT B;  4RHR A;  2A68 D;  1CHQ D;  1Q3L A;  5K36 G;  4R4O A;  5EKL A;  1NUC A;  1JJC B;  1W6K A;  1KAW A;  2LS0 1;  1D5M C;  3PUV A;  3U4V A;  4JI0 Q;  1JWU D;  3DHQ A;  2G9H D;  1JWS D;  1N34 Q;  2K5W A;  1WTP A;  1U9R A;  4X3T A;  4U67 3;  2FHT A;  1ET9 A;  5J3B A;  3CAM A;  5I9P A;  4DF7 A;  5ISR A;  3QR8 A;  1D8L A;  2OQ0 A;  1EIF A;  1H9S A;  1SND A;  2SNM A;  2B2Y A;  1DOM A;  3AU7 A;  4MTK A;  3NP8 A;  2E2I H;  1MKH A;  1UE7 A;  2JA8 G;  2O4X A;  1NCV A;  1SYG A;  3MVV A;  4JI8 L;  3OTO Q;  2A6H C;  2TMP A;  2A73 B;  2K28 A;  4IJH A;  3BZD B;  2HUG A;  1PH2 A;  4CJ0 B;  4XQJ A;  1YNX A;  4LFB Q;  5T1G A;  3GTP H;  4KD3 A;  3S2H B;  3K58 A;  4JV5 Q;  1QNK A;  1GHK A;  5KRU A;  4A3K H;  2RDH A;  1J8I A;  4X3S A;  4JOI A;  4RMF A;  2NB0 A;  1OTC A;  1K3R A;  2ZXO A;  4OL7 A;  5D65 A;  4BS9 A;  5FJ8 G;  4JCV E;  4RFB A;  1LTA D;  3D4R A;  4WJ3 M;  1JJ2 A;  3I4N B;  2OTJ A;  4A3F H;  1BF4 A;  2CW0 C;  4AYB B;  2PNR C;  3P20 A;  4B3M Q;  2PO4 A;  2KCN A;  2CQA A;  3NWS A;  5JAV A;  4BY7 G;  2F0E A;  1CKN B;  4I7Z C;  1BBX C;  3STB D;  2WII B;  1VQ6 A;  3L7Z C;  1Y8N B;  3S2D H;  1PFS A;  4XDX A;  1I4H A;  1B44 D;  1XMO Q;  1I6H B;  3U50 C;  2QDB A;  4OGQ C;  4MN3 A;  4IOC A;  1F2M A;  2WIN B;  4FF3 A;  3TZD A;  4P2C B;  2WB1 B;  1S3O A;  4FYD A;  5IT9 E;  1B53 A;  2O5J C;  4KY7 A;  3LGJ A;  4LUO A;  4CJ1 B;  1MBY A;  3GD7 A;  2MFI A;  1RKN A;  3HOW G;  5CYU A;  2RHS B;  3I3C A;  3AEV A;  3ZYY X;  2UU9 Q;  1TR5 A;  3H0G G;  4QJF A;  3MXG A;  4IJL A;  2XVS A;  3BYT B;  4DPG A;  2ZTD A;  3BS1 A;  3GV3 A;  4G7O C;  4UP8 A;  4OIK A;  5JOB A;  1L0Y B;  2F0I A;  2CKZ B;  3L3O C;  2VQF Q;  2NYZ D;  2ENB A;  1MGS A;  4YHH Q;  3OOC A;  3FKI B;  1GKH A;  4NP5 A;  4DU9 A;  3I73 A;  4DUZ Q;  4LF9 L;  3J7A F;  3BVZ A;  3VYU A;  4DR3 L;  3HOU B;  2ID0 A;  3OWE B;  4FO2 A;  1L1O A;  1PXU A;  3T53 B;  3W3A A;  2HQL A;  2EQS A;  2XWJ B;  1X9N A;  3DEO A;  4KHP L;  3AFP A;  2F0G A;  4Z9C B;  5IGG A;  3CPF A;  3J81 L;  1KAA A;  3H3V H;  4GNX C;  1B70 B;  4IFD J;  3H6M A;  2A5H A;  1CTM A;  1KDC A;  5DNF A;  4B3R L;  3PV0 A;  2WAQ B;  1WCM B;  4IUT A;  1MD2 D;  5COR A;  5K5P A;  3DM3 A;  1E1O A;  1JR0 D;  3ERQ A;  2E2H H;  1GUO A;  3D31 A;  3J81 E;  1HR0 Q;  3N52 A;  2HHH L;  4NXN L;  4N9P A;  4CGY B;  3G48 A;  1FNW A;  3EFX D;  3CCQ A;  1SMY D;  2Q2H A;  1L0X B;  2EY2 A;  1JWM D;  1UAP A;  5BN4 A;  3S14 H;  1LV9 A;  3HOV G;  1A63 A;  1IBK L;  3M4O H;  5D3I B;  1VQJ A;  2WKC A;  3FRP B;  4F87 A;  4IUN A;  4EQO A;  1VQL A;  2ES2 A;  3S1M B;  4JI4 Q;  3J7A 5;  1A2T A;  5G3L D;  3E6Z X;  4CKB A;  4X3K A;  3FHW A;  2F4I A;  4BY1 G;  1LTI D;  3T4A C;  4A76 A;  3X3M A;  3PUX A;  5LMU Q;  2IL8 A;  3M7G A;  4X64 L;  4A3B G;  2B8G A;  1P8L A;  4GKJ L;  1WJJ A;  4K2K A;  2KEC A;  5J22 A;  2F0V A;  3CCJ A;  1SYD A;  3TRE A;  1MSG A;  1C48 A;  1Y1W B;  1BBU A;  1DYQ A;  3T1H Q;  4BBR B;  4ULL A;  3S15 B;  1DXM A;  4IFD G;  4POG A;  1ZYR D;  1QB5 D;  5C4X H;  5ELO A;  3QG1 A;  1O7I A;  5IYB G;  1SNP A;  2L5T A;  3EN2 A;  2ZJP A;  1SJH D;  1DCZ A;  1SYF A;  2O2L D;  4R9W A;  1FD7 D;  4WJW A;  3N6R A;  5IE8 A;  2Q8R E;  4WFN 3;  3PO2 B;  4YWK A;  2PQA B;  4S3S A;  3FMC A;  4C3I G;  2ZXR A;  1BCP B;  4QIW E;  2QEX A;  1E24 A;  2B2Y C;  2RSO A;  1AP0 A;  1GHJ A;  3A8J E;  1IW7 C;  3FPP A;  1X3P A;  1KLU D;  1ESF A;  3LWU A;  2RCN A;  4TQU S;  3GV6 A;  2D0O A;  2DY8 A;  3HKZ G;  4P73 A;  2QGQ A;  2UXD L;  1EEF D;  3J7Z C;  3AFQ A;  1JE4 A;  1K8G A;  3MAQ A;  4LF7 L;  2JA8 B;  4DK1 A;  1DOL A;  3AYH B;  1PYS B;  3DMU A;  1RD9 D;  1D2B A;  2OTL A;  2I5M X;  1D1K A;  3PIP 3;  5IP7 H;  1STG A;  3RZO B;  4JOI C;  4A3E H;  5M5Y B;  1YNJ D;  3NTH A;  4JI1 Q;  3M3Y B;  1R4P B;  4EQ5 A;  1FJG L;  1T5X D;  2F0P A;  2F0L A;  1IHZ A;  4YCW A;  1Z9F A;  3I4M G;  4K8J A;  4ALP A;  1GXD C;  2JA5 B;  3KF6 B;  4IQZ A;  2F0T A;  2CH4 W;  4IUP A;  1PRT F;  3S1N B;  1K28 A;  2E5L L;  4RA8 A;  4HIK A;  5JVG 3;  1EY5 A;  1SNO A;  4DXF A;  5E4W C;  2ICE C;  2UXB L;  4JYA Q;  3O13 A;  1EQV A;  4NKL A;  5EBC A;  5M3F G;  3KLS X;  4JI2 Q;  4JI3 Q;  2A6H D;  2KOL A;  3MXN A;  4DV6 Q;  5CGK A;  4XQQ A;  3E5S A;  2H4O A;  3VYT A;  4DNT B;  1WI5 A;  1DM0 B;  3S17 H;  1OO9 B;  5BR8 Q;  5LL6 X;  1HHV A;  4XXE A;  4DR7 Q;  1CKO A;  1QUQ A;  1YHA A;  1TT2 A;  2K5H A;  4GN4 B;  2N49 A;  4LUV A;  5IGD A;  4XT1 B;  5CV8 A;  3S2H H;  3KF8 B;  1FNU A;  1G2S A;  3MXU A;  1VMC A;  3D4W A;  2B63 G;  2YV5 A;  2IY5 B;  3H0G B;  1GUS A;  3K5M A;  4A75 A;  2LY7 A;  4NXM Q;  3SEB A;  1LLR D;  4K14 A;  2B2W A;  1L1O C;  1RJT A;  2K5N A;  4FF2 A;  4JI5 L;  3T1Y L;  3NK9 A;  2B8F A;  5C0X J;  1Y1V G;  1MHW C;  5M9O A;  1TWA H;  4L6T B;  5M5W B;  1BNZ A;  4JI0 L;  2K7V A;  2H1E A;  4H44 C;  1N34 L;  4ID6 A;  4BXX G;  2MO1 A;  2KQ3 A;  4A3C H;  1ICW A;  1SYE A;  2KA7 A;  4UP7 A;  4IPH A;  4KD4 A;  3HFZ B;  4MIU A;  1XPR A;  1II3 A;  1VQB A;  2CQO A;  5KNC A;  1I4Q A;  2NN6 H;  2FMM A;  2ZTC A;  2JP1 A;  3IAY A;  3BG3 A;  1CQV A;  2F0N A;  2M2L A;  4ZKB B;  2SEB D;  1EY7 A;  5C0X I;  2UUC Q;  1RTN A;  2UUA L;  1PYW D;  1U4M A;  4B3S L;  2R92 G;  1XWE A;  3UE1 A;  1V8Q A;  2DUD A;  1U4P A;  5EPJ A;  4LJZ C;  4LFB L;  5IT9 c;  1I50 H;  4B9X A;  2L4N A;  2MJ8 A;  3QOL A;  4FDB A;  2Y0S E;  2RBM A;  1K8A C;  3HOV B;  2WV6 D;  4A3L H;  1G8Z D;  3FKI H;  2RDF A;  5C0X G;  4ZYS A;  3SVM A;  3HOU H;  4JBJ A;  2EIF A;  1JOR A;  1A8V A;  2MGS A;  2EY6 A;  4FVM A;  2NN6 I;  1EZ8 A;  4HJ9 A;  2MO0 A;  4X65 Q;  1D5X C;  1TKW B;  1ENC A;  4K5V A;  4DAV A;  1UWV A;  3OIP A;  4O42 A;  4B3M L;  2HT1 A;  3ND9 A;  3GTQ B;  1I94 Q;  1G6Z A;  4PMW A;  1OXU A;  2Z8L A;  5EJW A;  1NJI C;  4AYB G;  4FF4 A;  3C46 A;  2I07 B;  3AMU A;  1XMO L;  1SYC A;  1WCM H;  4YCU A;  1PV4 A;  1PTO H;  1SAP A;  4LW1 A;  1VQK A;  4P74 A;  1EWH A;  4MTN A;  2DJF C;  1LTL A;  1PLF A;  1YJN A;  3K80 C;  1LTS D;  2IW3 A;  1VQI A;  4C3I B;  4A3I G;  2UXC Q;  1VS0 A;  2UU9 L;  1R4Q B;  5GAG C;  4OO1 H;  3VR4 A;  5ELN A;  2IX0 A;  1WTV A;  3KLW A;  1K73 C;  3J81 c;  1B3Q A;  1TII D;  5DAU A;  1KL9 A;  1KIX A;  3K0X A;  1WD1 A;  4M1U B;  4DV5 Q;  5E3F A;  3VDY A;  4YHH L;  2XRQ D;  2E8G A;  1Q12 A;  1NY4 A;  1EY4 A;  3KLR A;  5IP9 H;  4KHZ A;  2PPB C;  2VQE Q;  4A3M H;  2NVX B;  1Q1E A;  1SMY C;  1XMQ Q;  1YI2 A;  4IZ8 A;  5IOD A;  4RHS A;  4A3D G;  3CCU A;  4ODG A;  4BBR H;  4LFC Q;  3CQZ B;  1KLG D;  1YNN C;  2KCT A;  3MTS A;  4B9W A;  5KYI A;  2VUM B;  3CC4 A;  4WJ4 A;  3SK5 A;  4YCV A;  3V05 A;  2NZ1 D;  4B08 A;  3S9W A;  5K36 H;  1XPO A;  4PMB A;  1IW7 D;  1K8M A;  2KCC A;  4J8Q A;  4UPA A;  1KD1 C;  5EKI A;  2R7Z G;  1E7Z A;  2PZU A;  2WAQ G;  2AKW B;  1SNC A;  1WYD A;  1UUP A;  4DV7 Q;  1UE6 A;  3F2B A;  2PW5 A;  3I4L A;  1ZYR C;  1STB A;  5M3F B;  2AWO A;  4JW0 A;  3E3X A;  4PZ7 A;  1PDQ A;  2KEN A;  2L1B A;  5I2Y A;  2JA8 H;  1SJE D;  2UUB Q;  5JJI A;  4ZUI A;  4PZ6 A;  1G2T A;  3OMG A;  3RZO H;  1VCI A;  2B39 A;  1NR2 A;  2GVB A;  3BDO A;  5M5Y H;  2NVY B;  3OSO A;  2B2W C;  1BVS A;  5E7N A;  1I5F A;  2LMC B;  1N33 Q;  1KXL A;  2WFW A;  2NVQ H;  2MP1 A;  1SMX A;  1SE8 A;  2IHF A;  1HNW L;  5ELD A;  4AIM A;  1EQQ A;  1HTL D;  4CBV A;  3R2T A;  3NBI A;  4GKK L;  1O7Z A;  5FJ8 H;  2K33 A;  3ER0 A;  2HCC A;  3D6W A;  1BKB A;  5GAH C;  1IZ6 A;  1VQF A;  1Y1V B;  2K14 A;  4QGU A;  1Y1W G;  3F1Z A;  1N36 L;  4X3U A;  2EJM A;  1E0B A;  1GVP A;  1N8R C;  1STN A;  1YZ6 A;  3J81 i;  1DJR D;  1YNJ C;  2N55 A;  4BY7 H;  5F2D A;  1X3G A;  3PUY A;  1DON A;  3TP5 A;  2AUK A;  1PZK D;  3GTK B;  1XTD A;  5IYD G;  2X6L A;  1ESR A;  3I91 A;  1VQA A;  4R4I A;  2CCZ A;  4H13 C;  3H94 A;  5J1Z A;  1AZQ A;  1VQO A;  3K8A A;  1PA6 A;  3PO2 G;  3RR5 A;  5I2X A;  1TQO A;  1A62 A;  4QIW B;  4RKL A;  3FDT A;  4L5R C;  1HNX Q;  2EDG A;  4I65 A;  1RHP A;  4GOP A;  1Q8K A;  1TWH H;  1HNZ Q;  3GTL B;  2ZM6 Q;  3PSI A;  4LF6 Q;  2R92 B;  3HOW H;  2JA9 A;  4UHV A;  3TP8 A;  5GAD C;  2F03 A;  4IPD A;  2L12 A;  1H9S B;  1XNR L;  1KRT A;  4G57 A;  4LMQ D;  3K59 A;  4LUZ A;  4JI1 L;  4J1M A;  1NMF A;  1VQ5 A;  3PO3 B;  1BCP F;  2Z6B A;  3ULJ A;  1FL0 A;  1ILQ A;  2PYK A;  4C2M B;  3KLS A;  1T9H A;  3CW2 C;  1O7L A;  2F4V Q;  5IGF A;  1GUT A;  1CM9 A;  1Z7T A;  3K57 A;  5E4X A;  4HCE A;  3RNU A;  1HUN A;  4KY6 A;  4DNR B;  2JA5 G;  2VS1 A;  2X69 A;  4N8F A;  5C3E B;  4X66 Q;  4DR4 Q;  2YU9 H;  1W3S A;  2N8N A;  2Z1C A;  4F7X A;  2Z4H A;  2KUM A;  4JYA L;  2DNC A;  3HG9 A;  1CSP A;  3VA5 A;  4CDD C;  5FOB B;  1X3E A;  5IT9 L;  4H02 A;  4JI2 L;  4JI3 L;  3BZK A;  1PTO D;  4P72 A;  1OXT A;  1WTX A;  4DV6 L;  1EQR A;  1B8A A;  3UDI A;  2K6A A;  1DOK A;  1U5K A;  3TSS A;  3K6O A;  1HR0 W;  5BR8 L;  2DGY A;  4DR7 L;  1P16 A;  1RCV D;  2R93 H;  1S5F D;  1JIC A;  2RF4 A;  4LNQ A;  3H3V C;  4HSV A;  2JA7 B;  3RMH A;  3GTM B;  2OWO A;  1HZA A;  4AQY Q;  3NE5 B;  4TRD A;  4A3I B;  4A3G B;  3P7J A;  5LMN L;  1B7Y B;  3HOV H;  4P71 A;  1BUV T;  4NXM L;  3I8Z A;  4P75 A;  3FVQ A;  1NE3 A;  1M4V A;  2LXJ A;  3CKI B;  3T51 B;  2B2U A;  3A5U A;  4K0K Q;  2E75 C;  4BY1 H;  3LWE A;  1EY8 A;  3SK6 A;  4HIO A;  4NW2 A;  1IKL A;  3URY A;  4A3B H;  2Q8T A;  1LTG D;  3KK7 A;  4X6A H;  3L9A X;  1VQ4 A;  4X62 Q;  4QY7 A;  4DR2 Q;  3PF5 A;  1PRT C;  4A3D B;  3W2D A;  3HOY B;  4EGV A;  4IFD H;  4UDU C;  1A3V A;  2EYJ A;  3DWA A;  4GZY C;  1C0A A;  4R8N A;  1M8A A;  1E2V A;  1MSH A;  1IL8 A;  3IKJ A;  1BOS A;  4LF5 Q;  1L1O B;  4WRD A;  2K05 A;  3A55 A;  5IYB H;  1B4O A;  2R61 A;  3RLO A;  2V4D A;  4CDF C;  2UUC L;  3HOZ G;  3HOX B;  3BZC A;  2HQE A;  1EIG A;  3NWT A;  5HUR A;  5CR3 A;  1B50 A;  3C1E A;  4DV4 L;  2R7Z B;  4C3I H;  1CA5 A;  3KDF B;  4L5Q A;  4JI7 Q;  3OMC A;  1J9O A;  3CF5 A;  1EUJ A;  4RCO A;  3TDQ A;  2D5D A;  5EPL A;  2KJX A;  3PUW A;  1PH4 A;  4GLV B;  3TP7 A;  1PFM A;  4IOA A;  2EJF C;  2E2D C;  1A6X A;  1YHB A;  2J4X A;  3M7N A;  1JQY D;  3S1Q H;  1AZP A;  4RGN A;  4LF8 Q;  2PI2 A;  2Y0S B;  4HJ5 A;  2NVX H;  4IFD I;  3OWF A;  1YNN D;  2A6E D;  4I7A A;  2B2V A;  3GDE A;  1Z6H A;  2ZT9 C;  3KBG A;  3ONA B;  4A3J H;  4X65 L;  1OXV A;  1HPC A;  1WTH A;  3RZD H;  4NMZ A;  2B2T A;  5DLQ E;  2YTV A;  4JBM A;  1I94 L;  5KGU A;  2JXM B;  3I4M H;  2EXD A;  1EYG A;  2E2J B;  3NPP A;  4JBK A;  1VQH A;  1E3P A;  2LSS A;  5D14 A;  5IGB A;  3CD6 A;  1AE2 A;  5IYC G;  1F2Y A;  3CHB D;  1H95 A;  5H1S E;  2JA6 B;  1EWI A;  5C44 G;  2NVT B;  5IGE A;  1OXX K;  1AE3 A;  2EJG C;  4KK7 A;  3S1R B;  1S5B D;  1QG7 A;  1STE A;  3PQI A;  2PZT A;  4R4Q A;  3OIQ A;  1PH5 A;  4G7H C;  3TQY A;  3K7A B;  3GTO B;  2UXC L;  4ILW A;  5M3F H;  4GOP C;  1ZKO A;  5IWA Q;  4K6D A;  4LWC A;  4EX5 A;  1K83 H;  1QVC A;  1C8C A;  2P5Z X;  3TEH B;  1I3Q H;  1SFO H;  3JAM L;  1FNV A;  1QJO A;  4F88 A;  2L15 A;  1ZXT A;  2NVY H;  1HZB A;  3MA2 B;  5LMN W;  2PQA A;  3I90 A;  1L0W A;  1XMQ L;  2B63 H;  2K03 A;  1Y8P B;  5ELC A;  1ONL A;  2Z6K A;  4JVZ A;  2ATW A;  1PH3 A;  4C3J G;  1F9Q A;  2MPM A;  4G4K A;  3BVG A;  4YWL A;  5C4J B;  1Q82 C;  1QWY A;  4FF1 A;  2J0T D;  1TWF B;  3R3O A;  2EOT A;  3A5Z B;  1C9O A;  3JAM E;  1CZW A;  4DN4 M;  1Y1V H;  2FXQ A;  4XIG S;  4YIJ A;  1HXY D;  5C5L A;  3FPU B;  1H9R A;  1EOV A;  2BDO A;  2XGT A;  4BBS G;  4L8J A;  1F9P A;  4YWM A;  1V43 A;  4JC0 A;  3V96 A;  3OHX C;  4BXX H;  2VUM G;  2ZJQ A;  4C3H B;  1GO3 E;  3HZX A;  3Q22 A;  4RGT A;  3PIP A;  2IX1 A;  1SE4 A;  1LTR D;  4DA2 A;  1UNS A;  1T5E A;  3MEH A;  1O78 A;  3J80 L;  1WVL A;  4JI8 Q;  2K5D A;  1EZ6 A;  1JOO A;  2SOB A;  3M4Y A;  2A1A A;  2I5L X;  2K52 A;  1IBM L;  5GAE C;  3GTL H;  2Q8I B;  1U4L A;  1JE5 A;  1SE2 A;  2R92 H;  1YJW A;  3BVM A;  1TVX A;  1EY0 A;  4EQN A;  3I72 A;  3EJI A;  3CU7 A;  4UY8 C;  1B3A A;  1K0S A;  3J80 E;  1PH8 A;  2F1M A;  1X3Q A;  1RIP A;  1BXT A;  1PZI D;  3K81 C;  1N32 Q;  3F2U A;  1JT8 A;  1N33 L;  3H91 A;  3H09 A;  4HID A;  1HZ9 A;  2GVA A;  2LKV A;  3RUZ A;  1E2W A;  1X6O A;  5C0X H;  1CFM A;  4ZRZ A;  1X56 A;  4DR6 L;  3TRZ A;  2ICI A;  2O5I C;  1SR3 A;  3I70 A;  1X3F A;  1QZG A;  3X3N A;  5CMD A;  2Q2U A;  1YHQ A;  4DV1 L;  4POF A;  1TS2 A;  2N78 A;  4QMG A;  5EQ0 A;  2I46 A;  3AB9 A;  3I4N H;  1M1K C;  4KKU A;  4K6L A;  5C3X A;  2NZO A;  4HED A;  2OEO A;  2VB3 X;  1LAB A;  1UEA B;  2XTI A;  4YY3 Q;  2F0J A;  2E2I B;  5IOC A;  4BA1 I;  3I2Z A;  1CQF A;  4QB4 A;  1HNX L;  3HOZ B;  1I6H H;  1NTG A;  4M8A A;  4RH6 A;  3A7L A;  3DWQ A;  4KHV A;  2K1B A;  3HP3 A;  5AFW A;  5FK9 C;  5TSS A;  4LF6 L;  1FGU A;  3HEJ A;  4O0A A;  2R6G A;  3GTM H;  3P1H A;  2BCO A;  1Q46 A;  3ERO A;  3SR1 A;  4A3I H;  2PNH A;  4OX9 Q;  2F0K A;  1VQN A;  1ENA A;  1H9M A;  3DEP A;  1MIU A;  1PTO C;  1EFI D;  1DGS A;  2N3S A;  3QJY A;  4Q0F A;  3OTO L;  4DR3 Q;  3SHL A;  4XQN A;  3K5N A;  1KQS A;  4KN7 C;  2B2V C;  3FP9 A;  4A3F B;  4QL5 A;  3OYY A;  4DAY A;  4QCL A;  1Y14 B;  3PO3 G;  3CRL C;  4JV5 L;  2F4V L;  1Q81 C;  2XWB B;  1PRT D;  4OEM B;  2B2T C;  2JE6 I;  1WTR A;  5FLM G;  2NBF A;  2J7Z A;  2EYM A;  4A3D H;  1XX8 A;  3DLL A;  3J81 j;  4X66 L;  4DR4 L;  3CXC A;  3GTG B;  1H9K A;  3UE0 A;  5KYL A;  1JC7 A;  2EXZ A;  1HA5 A;  2QKI C;  2F3I A;  5A35 A;  4K8I A;  5C3E G;  5J39 A;  4NXN Q;  4KY5 A;  2WAC A;  3A0J A;  3U9O A;  4ABN A;  5C44 B;  2AQ2 B;  1E1T A;  3GTJ B;  2IHE A;  4DR5 Q;  1NBW A;  1PHJ A;  2F3V A;  2SNS A;  3V2T A;  1IBK Q;  3C2P A;  3MZ5 A;  4DUY Q;  4B3T Q;  4HMI A;  4AQY L;  1N9W A;  2WKD A;  1EY6 A;  4TSS A;  3M4O B;  4EVO A;  4IAL A;  1EY9 A;  2QW7 A;  5NUC A;  2A74 C;  2JA7 G;  4X64 Q;  1WTO A;  4GKJ Q;  4G7Z C;  4A3G G;  4Y52 H;  3ULP A;  1CSQ A;  1W2B A;  4K0K L;  4ZUJ A;  1BCP C;  1GOZ A;  2Z6K C;  3SDZ A;  3S1M H;  3A56 A;  3KYH C;  2VQF L;  2RSN A;  1JB7 A;  1E2Z A;  4K5W A;  1EWC A;  2VY3 A;  4A93 G;  3S24 A;  5EGT A;  3LX0 A;  3Q6S A;  4RGM A;  3MEF A;  2YTX A;  2DY7 A;  1FYC A;  4XYQ A;  3NQT A;  3CCS A;  4DR2 L;  5FO8 B;  4DUZ L;  4C3J B;  4R4T A;  4R4C A;  3K5L A;  3NEL A;  4OWX B;  4EQP A;  4BWG B;  3JC6 6;  4CDE C;  1YJ9 A;  1VQD A;  4LF5 L;  3KUP A;  1Y1W H;  2E2H B;  2NVT H;  1Z47 A;  3K7U C;  1L2F A;  3HOY G;  2ASB A;  3S15 H;  4BBS B;  2A6E C;  1X54 A;  4HIM A;  1MI2 A;  1RF2 D;  1STY A;  2XN9 C;  3BU2 A;  1NSN S;  3GTO H;  3K7A H;  3S14 B;  1NAP A;  3GP7 A;  4JI7 L;  5M3M G;  3MFY A;  3HOX G;  2NUC A;  3W5O A;  5IYD H; 
#chains in the Genus database with same CATH homology
 4HJ7 A;  2YU9 H;  4DR4 Q;  1W3S A;  2N8N A;  3CCJ A;  1LUZ A;  3NEM A;  4A3E G;  2A19 A;  2ZM6 L;  3TRE A;  2OCE A;  1HNZ L;  4LF4 L;  3PO2 H;  2C35 B;  1BBU A;  4DV3 Q;  4JYA L;  2JA7 H;  3T1H Q;  1S72 A;  1CSP A;  3KJO A;  1X3E A;  1HR0 L;  4GLA C;  4H02 A;  4JI2 L;  4JI3 L;  3BZK A;  2I0Q A;  4P72 A;  1PYB A;  4TVA B;  4POG A;  5C4X H;  5ELO A;  1MJE A;  1OXT A;  3M9B A;  1A0I A;  1O7I A;  4DV6 L;  5IYB G;  4Y7N H;  3UDG A;  1EQR A;  1KHI A;  1B8A A;  5JEA J;  3UDI A;  3EN2 A;  2ZJP A;  4LF9 Q;  3HKS A;  1U5K A;  1G51 A;  1FJG Q;  2KHJ A;  1UE1 A;  1HR0 W;  4GNX B;  4DK3 C;  5BR8 L;  5IE8 A;  2DGY A;  4DR7 L;  1HZC A;  1P16 A;  3TS2 A;  4A93 H;  1NMG A;  2R93 H;  2RF4 A;  4LNQ A;  3GO5 A;  1XPU A;  4YWK A;  4KHP Q;  3A74 A;  2K75 A;  2PQA B;  3BJU A;  4JI4 L;  2OWO A;  1HZA A;  2QEX A;  4QIW E;  4AQY Q;  1E24 A;  2Y0S G;  1G6P A;  2WAQ E;  4DAY B;  5LMN L;  4BA2 I;  1B7Y B;  3HOV H;  4P71 A;  2AHO B;  5LMU L;  2PI2 E;  4NXM L;  4P75 A;  4APV A;  1NE3 A;  2RCN A;  2LXJ A;  4B3R Q;  1RL2 A;  4TQU S;  4DV4 Q;  3M3Y H;  1BBW A;  3A5U A;  2D0O A;  3HOY H;  4K0K Q;  3HKZ G;  4P73 A;  3WWV A;  2QGQ A;  2UXD L;  4BY1 H;  3J7Z C;  3AFQ A;  3STB C;  1K8G A;  4HIO A;  3KOJ A;  4DKA C;  4LF7 L;  3AYH B;  3KJP A;  1PYS B;  2VW9 A;  2UXB Q;  3T1H L;  4A3B H;  3JAM c;  2OTL A;  2I5M X;  1J5E Q;  2JA5 H;  5IP7 H;  2HHH Q;  2WP8 J;  5M3M H;  4JOI C;  4X6A H;  3HOX H;  1VQ4 A;  5AJ3 L;  2JA6 G;  4X62 Q;  3S1N H;  4QY7 A;  4A3E H;  1VQC A;  2HIX A;  4DR2 Q;  1PH1 A;  3PF5 A;  5IY0 A;  2B3G A;  4JI1 Q;  1WFQ A;  4EQ5 A;  1FJG L;  2R7Z H;  3PGZ A;  3RLF A;  4OXP A;  1Z9F A;  4YCW A;  1C0A A;  4HJ8 A;  4LFA L;  4DNI A;  5IWA L;  4LF5 L;  3I4M G;  4ALP A;  4LF5 Q;  1L1O B;  5IYB H;  2BH2 A;  3NEN A;  4IFD G;  2JK8 A;  3CCE A;  3RLO A;  3KF6 B;  3ICE A;  5JEA G;  2UUC L;  3HOZ G;  2JQO A;  3I4N G;  3BZC A;  4DAM A;  3AQQ A;  2E5L L;  4QQB X;  4DV0 Q;  3EBE A;  4DV4 L;  4HIK A;  4C3I H;  1YBY A;  3KDF B;  4L5Q A;  4JI7 Q;  4JI5 Q;  2AWN A;  1GD7 A;  1EUJ A;  1VQG A;  3CF5 A;  4A3C G;  1TWG H;  3PUZ A;  3G6E A;  3PUW A;  4LF4 Q;  1PH4 A;  4GLV B;  2MNA A;  2UXB L;  3E0E A;  3RLN A;  4JYA Q;  4GOP B;  3J80 c;  5M3F G;  1HJP A;  3I4O A;  5GRO A;  4JI2 Q;  2QA4 A;  4IOA A;  2NN6 G;  4JI3 Q;  1VQ7 A;  5GQO A;  4NPS A;  3F2C A;  3CME A;  4X62 L;  3H0G H;  1IYJ B;  1YHB A;  4DV6 Q;  2MQH A;  2WB1 G;  1V9P A;  3W1B A;  3M7N A;  3S1Q H;  2E2J H;  4L5T A;  2LXK A;  1WI5 A;  4DR1 L;  2PI2 A;  4LF8 Q;  2Z0S A;  2ALY B;  1WOC A;  3S17 H;  4IPC A;  5BR8 Q;  4HJ5 A;  1GM5 A;  1ASZ A;  2NVX H;  4IFD I;  4DR7 Q;  1CKO A;  1QUQ A;  1YHA A;  2K5H A;  3GDE A;  2JA6 H;  4GN4 B;  4A3J H;  2N49 A;  3ERS X;  3ULL A;  4LUV A;  4X65 L;  3G4S A;  3S2H H;  4ME3 A;  3ZJY C;  1OXV A;  3KF8 B;  3S1R H;  5M5W H;  3RZD H;  2B63 G;  2YV5 A;  5DLQ E;  1YVC A;  2YTV A;  2UUA Q;  2IY5 B;  4JBM A;  1X65 A;  1I94 L;  4B3S Q;  2F52 A;  4A75 A;  1S40 A;  4O2D A;  4NXM Q;  3I4M H;  1PVO A;  2EXD A;  1EYG A;  5JJK A;  4JBK A;  1SLJ A;  1VQH A;  1E3P A;  2LSS A;  4MZ9 A;  4OWW B;  2BA0 A;  3CD6 A;  4JBW A;  1L1O C;  4DK6 C;  2K5N A;  4JI5 L;  1AE2 A;  5IYC G;  3T1Y L;  2UXD Q;  3HOZ H;  4A3L G;  3FKI G;  5C0X J;  5H1S E;  1H95 A;  1Y1V G;  1EWI A;  5C44 G;  3H15 A;  3F2D A;  2OQK A;  4LF7 Q;  1OXX K;  2A8V A;  1TWA H;  1AE3 A;  3HOU G;  1Q7Y C;  4JI0 L;  2BA1 A;  2K50 A;  3NBH B;  1N34 L;  4BXX G;  2MO1 A;  4R4Q A;  5AJ3 Q;  4PZ8 A;  1EFW A;  4A3C H;  1PH5 A;  5HGQ A;  4UP7 A;  4IPH A;  1SRU A;  1N32 L;  4GN5 A;  3TQY A;  2PMZ E;  3HFZ B;  2UXC L;  1CKM A;  1XNQ L;  1E22 A;  1XPR A;  4LF8 L;  5M3F H;  1VQB A;  2CFM A;  2GN5 A;  2CQO A;  3L0O A;  4GOP C;  2R7F A;  2ZTC A;  4RG1 A;  4OO1 I;  1VQP A;  3CCV A;  4LFA Q;  3JAM i;  5IWA Q;  4LWC A;  4EX5 A;  2JEA I;  1K83 H;  1QVC A;  1CKN A;  1SRO A;  3D0F A;  1G29 1;  5C0X I;  5C4J H;  1J6Q A;  4A4I A;  2UUC Q;  1TWF H;  1WCM G;  2UUA L;  3TEH B;  1I3Q H;  2KHI A;  3L2P A;  3F8T A;  1SFO H;  4B3S L;  2Q2I A;  2R92 G;  4GNX A;  2E5L Q;  2ZTE A;  2L15 A;  3UE1 A;  2NVY H;  1HZB A;  4GLX A;  2RHQ B;  3RN5 A;  5LMN W;  2DUD A;  1KRS A;  2PQA A;  4NB3 A;  2R7D A;  1L0W A;  1XMQ L;  2B63 H;  2BH8 A;  1IBM Q;  4LFB L;  5JJL A;  2Z6K A;  5IT9 c;  1UE5 A;  2H5X A;  1SN8 A;  3GTG H;  1I50 H;  4R1J A;  1VQM A;  2ATW A;  4C3H H;  4HJA A;  1PH3 A;  3RN2 A;  2I5H A;  1Q82 C;  4IO9 A;  4YWL A;  4OO1 G;  4FDB A;  2Y0S E;  3I55 A;  1JJG A;  4YY3 L;  4DV2 L;  1K8A C;  3E9H A;  1LM0 A;  5IYC H;  2Q2T A;  3A5Z B;  1C9O A;  3Q8D A;  4A3L H;  3FKI H;  3GTQ H;  1Y1V H;  5C44 H;  2FXQ A;  2K5V A;  4XIG S;  5C0X G;  2XGT A;  1EOV A;  3GTJ H;  4BBS G;  3CC2 A;  3HOU H;  4JBJ A;  4DR1 Q;  2EIF A;  4L5S A;  1A8V A;  2NZH A;  3HKZ E;  4YWM A;  1V43 A;  1U0L A;  2NN6 I;  4JC0 A;  3CC7 A;  4BXX H;  3J80 i;  2VUM G;  4HJ9 A;  5IP9 G;  2ZJQ A;  3I7F A;  1GO3 E;  2MO0 A;  4JI6 L;  3IRB A;  4X65 Q;  1OXS C;  2V1C C;  4A3M G;  3PIP A;  4B3M L;  2IX1 A;  1UWV A;  1KC8 C;  4KLK A;  3PIO A;  2K4K A;  2ZJR A;  4OX9 L;  4DR6 Q;  2HT1 A;  1IBL L;  3PF4 A;  4UP9 A;  1Q1B A;  1I94 Q;  4PMW A;  1OXU A;  2HIV A;  3UDF A;  3CMA A;  1NJI C;  1IL2 A;  4AYB G;  4JI8 Q;  1M90 C;  1UEB A;  4BBR G;  4DV1 Q;  3KFU A;  2VZA A;  4A3K G;  2AMC B;  1XMO L;  3T1Y Q;  2A1A A;  1YIT A;  2I5L X;  2K52 A;  1IBM L;  1WCM H;  2JEB I;  3UDX A;  5GAE C;  4YCU A;  4OWT B;  1PH9 A;  1PV4 A;  3GTL H;  2R92 H;  1JE5 A;  4R4O A;  5K36 G;  4LW1 A;  1YJW A;  2JJQ A;  1VQK A;  1FVI A;  4P74 A;  1JJC B;  1KAW A;  3PUV A;  3U4V A;  4JI0 Q;  4UY8 C;  4MTN A;  1LTL A;  4A3F G;  1N34 Q;  3KDF A;  1YJN A;  1PH8 A;  1HH2 P;  3K80 C;  1RIP A;  3K81 C;  1N32 Q;  3CCM A;  1VQI A;  1Q86 C;  5J3B A;  4C3J H;  3CAM A;  4A3I G;  1XNQ Q;  1N33 L;  2UXC Q;  1VS0 A;  1VQ9 A;  2UU9 L;  1JT8 A;  5GAG C;  1QVF A;  5ELN A;  2IX0 A;  4HID A;  3KLW A;  4IPG A;  1D8L A;  3J81 c;  1K73 C;  1HZ9 A;  2GVA A;  1KL9 A;  2OQ0 A;  1EIF A;  1KIX A;  1X6O A;  3K0X A;  1EIY B;  3M4P A;  3U58 A;  2IT1 A;  4DV5 Q;  3VDY A;  1X56 A;  3CQZ H;  4BBS H;  4DR6 L;  4YHH L;  3TRZ A;  2R93 G;  1K0R A;  2E8G A;  1Q12 A;  1SR3 A;  2E2I H;  1NY4 A;  1MKH A;  1UE7 A;  2JA8 G;  1X3F A;  1QZG A;  4JG2 A;  2VUM H;  5IP9 H;  4JI8 L;  1YIJ A;  3OTO Q;  1YHQ A;  4DV1 L;  2Q2U A;  4KHZ A;  5EAY A;  4POF A;  4DR5 L;  2VQE Q;  4A3M H;  4IJH A;  2N78 A;  1PH2 A;  1Q1E A;  1YNX A;  1XMQ Q;  4LFB Q;  1YI2 A;  3I4N H;  1MJC A;  4DUY L;  1M1K C;  4B3T L;  3GTP H;  2NZO A;  4A3D G;  3CCU A;  4JV5 Q;  3CP0 A;  4BBR H;  4LFC Q;  3G71 A;  2KCT A;  1QZH A;  4YY3 Q;  2XTI A;  4DV2 Q;  4A3K H;  4JOI A;  3H3V I;  4RMF A;  4GS3 A;  4BA1 I;  1OTC A;  1TXY A;  3M85 A;  3I2Z A;  1K3R A;  3CC4 A;  3SGI A;  4WJ4 A;  2KCM A;  4YCV A;  3S16 H;  5FJ8 G;  1XPO A;  4JCV E;  2CWA A;  1HNX L;  1I6H H;  3CCL A;  4WJ3 M;  1ASY A;  1NTG A;  5HY6 A;  1JJ2 A;  2OTJ A;  3CPW A;  4A3F H;  1LYL A;  4LF6 L;  1HNW Q;  4UPA A;  1FGU A;  4O0A A;  1KD1 C;  4JI6 Q;  2R6G A;  3GTM H;  2R7Z G;  1E7Z A;  1Q46 A;  2WAQ G;  4B3M Q;  4DV5 L;  2PNH A;  4A3I H;  4GKK Q;  1D7Q A;  4OX9 Q;  1VQN A;  2AKW B;  1WYD A;  1IBL Q;  4BY7 G;  4DV7 Q;  1CKN B;  1UE6 A;  3F2B A;  1N36 Q;  1MIU A;  3STB D;  1VQ6 A;  3OTO L;  3L7Z C;  1DGS A;  2N3S A;  4PG3 A;  3S2D H;  4DR3 Q;  1PFS A;  1VQ8 A;  2VQE L;  2AWO A;  1XMO Q;  3U50 C;  1KQS A;  3FP9 A;  3M4Q A;  4PZ7 A;  4IOC A;  4QL5 A;  3OYY A;  2KEN A;  1Y14 B;  2JA8 H;  1S3O A;  4J15 A;  4OON A;  3PO3 G;  2F4V L;  4JV5 L;  2UUB Q;  4LFC L;  1Q81 C;  4PZ6 A;  5JJI A;  2D0P A;  3I56 A;  2JE6 I;  3RZO H;  3LGJ A;  4LUO A;  1JMC A;  2CWP A;  2MFI A;  3GD7 A;  1VCI A;  5FLM G;  3HOW G;  2GVB A;  2RHS B;  3PCO B;  2D62 A;  1V1Q A;  3AEV A;  5M5Y H;  4A3D H;  1BVS A;  5E7N A;  1I5F A;  3DLL A;  1PH7 A;  1N33 Q;  3J81 j;  1C7Y A;  1KXL A;  2UU9 Q;  4X66 L;  4DR4 L;  2WFW A;  3TS0 A;  2NVQ H;  3H0G G;  4QJF A;  3CXC A;  1SMX A;  4IJL A;  1SE8 A;  2IHF A;  1HNW L;  1TWC H;  2ZTD A;  3UE0 A;  4DPG A;  2B29 A;  2KBN A;  4AIM A;  1AH9 A;  4UP8 A;  4GN3 B;  4DV3 L;  1EQQ A;  1VQE A;  3OW2 A;  2CKZ B;  2F3I A;  3GTK H;  5C3E G;  2VQF Q;  4GKK L;  5FJ8 H;  4NXN Q;  2VL6 A;  4YHH Q;  3ER0 A;  4DV7 L;  1BKB A;  5GAH C;  1IZ6 A;  1VQF A;  3A0J A;  4A3J G;  2K14 A;  4QGU A;  1Y1W G;  3F1Z A;  1XJV A;  1N36 L;  1XNR Q;  1GKH A;  1E1T A;  4DUZ Q;  4LF9 L;  1GVP A;  1N8R C;  4DR3 L;  1YEZ A;  2IHE A;  1YZ6 A;  2ID0 A;  4DR5 Q;  1NBW A;  1PHJ A;  1L1O A;  3J81 i;  1IBK Q;  2YTY A;  2HQL A;  2EQS A;  5M5X H;  4BY7 H;  3KF6 A;  3U4Z A;  4DUY Q;  2YYZ A;  1X9N A;  3AFP A;  4B3T Q;  4KHP L;  1X3G A;  3PUY A;  4AQY L;  1N9W A;  4KI0 A;  1PH6 A;  2UUB L;  1XTD A;  5IYD G;  3CPF A;  2CCZ A;  1VQA A;  4R4I A;  3H3V H;  1CUK A;  3W1G A;  1VQO A;  4GNX C;  3K8A A;  1PA6 A;  3PO2 G;  1B70 B;  4XTC S;  3RR5 A;  4IFD J;  2JA7 G;  4X64 Q;  4AYB E;  4B3R L;  4GKJ Q;  1A62 A;  3MXN B;  5FLX c;  3PV0 A;  3PO3 H;  4A3G G;  4Y52 H;  3ULP A;  1CSQ A;  1W2B A;  4K0K L;  5C4X G;  4L5R C;  1HNX Q;  4A3G H;  2Z6K C;  4GOP A;  1Q8K A;  1TWH H;  3DM3 A;  1HNZ Q;  1E1O A;  2ZM6 Q;  3PSI A;  1K9M C;  4LF6 Q;  4C2M H;  5FLM H;  2VNU D;  3HOW H;  2JA9 A;  3CCR A;  2E2H H;  3S1M H;  3D31 A;  1QUQ B;  1J5E L;  3KYH C;  2VQF L;  1JB7 A;  1HR0 Q;  2HHH L;  4NXN L;  2VY3 A;  5GAD C;  4A93 G;  3S24 A;  4IPD A;  3G48 A;  3MEF A;  1XNR L;  3CCQ A;  2YTX A;  1KRT A;  4DR2 L;  3CCS A;  2WB1 E;  2Q2H A;  4DUZ L;  1R9T H;  3B6Y A;  4LUZ A;  4JI1 L;  1NMF A;  4R4T A;  4R4C A;  1VQ5 A;  3S14 H;  1X55 A;  4AH6 A;  3HOV G;  3ULJ A;  1A63 A;  1FL0 A;  5C3E H;  3NEL A;  1IBK L;  3M4O H;  4OWX B;  1VQJ A;  3JC6 6;  1YJ9 A;  1T9H A;  1VQD A;  1VQL A;  3CW2 C;  4MNO A;  1Y1W H;  2ES2 A;  1Z47 A;  3K7U C;  1L2F A;  4JI4 Q;  2NVT H;  3EIV A;  3J7A 5;  2F4V Q;  3HOY G;  2ASB A;  1QVG A;  3S15 H;  3FHW A;  4BY1 G;  1X54 A;  5LMN Q;  4HIM A;  4A76 A;  1IXR A;  3PUX A;  5LMU Q;  3RNU A;  4X64 L;  4A3B G;  3BU2 A;  4DV0 L;  1P8L A;  4GKJ L;  3E9I A;  2JA5 G;  3K7A H;  3GTO H;  2VS1 A;  5IP7 G;  1WJJ A;  4JI7 L;  5M3M G;  3HOX G;  3W5O A;  5IYD H;  4X66 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...