3TQYA

Structure of a single-stranded dna-binding protein (ssb), from coxiella burnetii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
110
structure length
110
Chain Sequence
MARGVNKVILIGNLGQDPEVRYTPNGNAVANVTLATSTTWRDKQTGELQERTEWHRIAFFNRLAEIVGEYLRKGSKIYIEGSLRTRKWQDKNGVDRYTTEIIANEMHMLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transferase
molecule keywords Single-stranded DNA-binding protein
total genus 20
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3tqyA00
2Q2TA 2VQEQ 3I7FA 5IYDH 3Q8DA 2JA9A 1OXUA 4OWTB 2E2HH 2BA1A 1KC8C 2R7ZG 3ERSX 1XMOQ 3AYHB 1UE5A 3LGJA 1IBML 1I94L 4JI8L 2EQSA 2JA7G 1K9MC 3RNUA 3B6YA 3G71A 4GLAC 4JI5L 1JT8A 3SGIA 1VQKA 4LF7L 2DUDA 4BBRH 5C4XH 4DUYL 4AQYQ 1MIUA 1XNRL 5LMNQ 2B63H 3J80i 1PFSA 5JJLA 2ASBA 4A3MH 2JA8H 3CP0A 3KF8B 5HY6A 3CCQA 1FJGQ 4JBJA 3I56A 4X62Q 1K0RA 1GO3E 4JC0A 4A3JH 2CKZB 4DKAC 3RN5A 3KJPA 2BA0A 3S17H 1VQMA 4AYBE 3AEVA 1IBMQ 1VQOA 3KFUA 4GKJQ 3ICEA 1G51A 2KENA 2E2IH 1CSQA 1VQ6A 2MO0A 1EIYB 2MFIA 2UUAQ 3HOWH 4A3GH 4K0KQ 1YBYA 3WWVA 2A8VA 1HNXL 4BY7G 4IOAA 1CKMA 3A0JA 1E3PA 1BBWA 5BR8L 3JC66 5E7NA 5HGQA 4YHHQ 3F8TA 4IOCA 1TWGH 3OW2A 1JJCB 4KHZA 4GLXA 1BKBA 5C3EG 1HZ9A 1RL2A 1U5KA 1YHAA 2AHOB 3K7AH 5C3EH 3KJOA 1UE7A 3A74A 2F52A 2D0PA 3HOYH 1PH2A 4IJLA 1B7YB 1PHJA 2LSSA 1N34Q 4UY8C 5M3MH 4IJHA 1SRUA 1MKHA 1FVIA 4MNOA 2WFWA 3I4MH 2HIXA 4DPGA 1GM5A 1HR0L 5JJIA 5IP7H 3UE0A 3ULPA 3CAMA 3KF6B 1EQQA 1E1TA 1ASYA 4L5RC 3RLOA 4BA2I 1GVPA 4LUVA 1VQIA 2K5VA 4DV7L 5GAEC 2ZTEA 4BY1G 4C2MH 2NVQH 4YHHL 3S24A 4POGA 4OO1G 1HZAA 1UE1A 3FKIG 3HKSA 4JYAQ 1EFWA 4DR5L 1CKNA 1Q86C 3CCSA 3S15H 1N34L 5K36G 1PA6A 4JI2L 4B3RL 1N36Q 4XIGS 1WYDA 2B63G 2ALYB 4R4TA 1VQEA 1GD7A 4H02A 1N32L 4LFCL 4JBWA 4DUZQ 2Z6KC 2UUCQ 1KHIA 5C0XG 1IXRA 2LXKA 4BXXG 4IPHA 1XPRA 2VL6A 3KDFA 3ULJA 4AIMA 4C3JH 4GOPC 1GKHA 1O7IA 2K52A 3TEHB 4GKKL 2VQEL 1AE3A 1I50H 1VQAA 4JV5L 3UDGA 2JEBI 2Q2HA 2VUMG 4JI5Q 3CPWA 4JI6L 4LF7Q 2UXBL 1X3FA 4GOPA 1IBLQ 4QGUA 2IX1A 1N32Q 1V9PA 1I94Q 1YZ6A 4PZ6A 5C44G 1I5FA 4GN3B 4Y7NH 4DV2Q 4LF8L 1FJGL 1I6HH 2UXDL 4IPGA 1VQBA 4RMFA 5FLMG 2K5NA 5AJ3L 2I0QA 1YIJA 1XNQL 1OXSC 3ZJYC 2ZTCA 4UPAA 2MO1A 4JV5Q 3GTJH 3TREA 3GTKH 4GKKQ 4R4IA 2R93G 1E22A 1N33L 3U4VA 3PSIA 4UP7A 4DR4Q 1HNWL 4QQBX 1HNZL 4IO9A 4DV5Q 2ZJQA 4R4CA 4JI7L 4Y52H 3G48A 5M5WH 1PH8A 1SMXA 2JA6H 5C4JH 3K0XA 3D0FA 1NJIC 3PUVA 2LXJA 4JI3L 4YCUA 5EAYA 4UP8A 4DR6L 3E0EA 2K14A 5GAHC 4PZ7A 1IZ6A 2OTJA 3I2ZA 4LFAQ 5M5YH 4GOPB 4JI0Q 4R1JA 4UP9A 1PYSB 1UWVA 3FKIH 4JI1L 4OWWB 2Z6KA 1VQPA 4HJ9A 1Q12A 2CCZA 2BH8A 3M4PA 1U0LA 5BR8Q 4L5QA 3J7ZC 3CCVA 4DR3L 2OWOA 4A93H 1C9OA 1L1OC 3A5ZB 4LUZA 1CKNB 2AMCB 3T1YL 2BH2A 4DR4L 1VQHA 4X66Q 1HNWQ 2L15A 3F2DA 4ALPA 4JBMA 1X3GA 2JJQA 2VY3A 4A3LG 1G291 3AQQA 3M9BA 1J6QA 4JCVE 1KRTA 4DV0Q 1IBKQ 4JI3Q 2F4VL 2YTVA 3M4QA 1WOCA 1XTDA 3E9IA 5M3MG 2R92G 1PH3A 3S16H 4DK6C 1X54A 1YJ9A 1S72A 3PF4A 3BZKA 3I55A 4HJ7A 4HJ5A 3KDFB 3W5OA 3CCMA 4L5SA 3HOYG 2JE6I 1N9WA 3I4NG 3K80C 1Q7YC 3KLWA 2WB1E 4C3IH 1KD1C 2VUMH 5LMNW 3M7NA 2ZJRA 4JG2A 4POFA 3CC7A 1OTCA 4DR7L 4A3BH 4HJAA 1VQNA 2UUAL 3BJUA 4J15A 2IT1A 4HIDA 1XMQL 1SR3A 4B3TL 2UXCQ 2E8GA 3CPFA 3CMAA 4LF4L 4IPCA 3M4OH 2AWNA 3PF5A 4JOIA 3W1GA 3PUXA 1KAWA 5GROA 2IX0A 3MXNB 4GN4B 4IPDA 5JEAG 4LFCQ 2E2JH 1A63A 3J80c 1K8GA 5C0XJ 1PH4A 2R7ZH 5JEAJ 2CWAA 1CSPA 4HIMA 4LW1A 3TRZA 5FLMH 2Q2IA 3HKZG 4DR7Q 3GTOH 4HJ8A 4IFDG 5C44H 3F2CA 4DR3Q 2Y0SE 3J81i 3T1HQ 3S2DH 4KHPQ 4DV2L 4KI0A 4LFBL 3PUWA 1LUZA 3OYYA 4A3CH 1MJCA 1L1OA 1I3QH 3CC4A 3S1RH 3RN2A 2JA7H 4NB3A 3CF5A 2D62A 1IBLL 1KRSA 3H3VI 5M3FH 4DNIA 5FLXc 1Q82C 4A3KG 4DV3L 4LNQA 3M3YH 1E7ZA 1B8AA 4A3IG 1YJWA 3MEFA 1PYBA 2RCNA 2YTYA 3STBC 1VQ4A 4A93G 2OQKA 1WFQA 3KYHC 1LYLA 1H95A 3DLLA 1UE6A 4X65L 4JI4Q 1X55A 3U50C 1YI2A 2H5XA 2JA5G 1XJVA 2JA5H 3CD6A 1SROA 2UUCL 1X9NA 4A3EH 5H1SE 1Q1BA 2KHJA 1HR0Q 2NZHA 1Q46A 1IYJB 1NBWA 1UEBA 1XMQQ 1QZHA 4BY7H 3CW2C 1P8LA 1SLJA 2GN5A 1WJJA 3GDEA 4OO1I 4QJFA 5IT9c 3J81j 2VZAA 4JI6Q 2UXBQ 3L7ZC 1TWFH 1PV4A 1KIXA 2GVAA 4P71A 3ULLA 5LMUQ 2CWPA 4DV1Q 4LF6Q 2N49A 3I4MG 1EUJA 3S1NH 3PUZA 3CXCA 1CUKA 5AJ3Q 1MJEA 4LF5L 3GTGH 4BBSG 4YCWA 1VQ9A 2AKWB 2NN6G 1IL2A 2CQOA 3BZCA 1YHQA 3CCJA 1Q1EA 1W2BA 2UU9Q 1T9HA 2V1CC 4A76A 5IWAL 4DV4Q 2PI2A 4QL5A 1VQJA 1Y14B 3VDYA 1J5EL 2D0OA 4P75A 2E5LQ 2R7FA 3KOJA 4YCVA 4DAYB 1JJGA 3E9HA 1XMOL 1HH2P 2RHQB 5JJKA 2JK8A 5IYDG 1L0WA 2K5HA 4NXNL 4B3SL 2WP8J 4IFDJ 3H0GH 4EX5A 1C0AA 2A19A 2GVBA 3K81C 4TVAB 3TS0A 4JOIC 1OXTA 4DR1Q 1NY4A 1YITA 4HIKA 2R92H 1VQFA 2NVYH 1V43A 2PI2E 1LTLA 4AH6A 2OQ0A 2PNHA 4JI2Q 1A0IA 1R9TH 1OXVA 2F4VQ 5M5XH 3GTQH 4BBSH 4OX9Q 4P72A 3G6EA 4HIOA 2N8NA 1VQ7A 3HOVH 3S1QH 2F3IA 3RLFA 1KL9A 2ES2A 1HZCA 4YWMA 4BY1H 3PIOA 4B3MQ 1FGUA 1Q8KA 1E1OA 3PO2G 3PO2H 2HT1A 4QIWE 4NXML 1HNXQ 1WI5A 1N36L 4YWKA 3S2HH 3HOVG 4FDBA 5GQOA 1TXYA 3H3VH 1M1KC 2K50A 1HR0W 2UU9L 2B3GA 4P74A 3H15A 4X64Q 4GKJL 3W1BA 5IY0A 1PH5A 1VQ8A 4GS3A 1EOVA 4A3LH 3JAMc 4GN5A 1PVOA 1HZBA 1QUQB 4DAMA 4B3ML 2WAQE 3PGZA 2AWOA 4DR2L 3PO3G 1N8RC 1P16A 1OXXK 3GTMH 4ME3A 2IY5B 4YY3Q 1YNXA 2Y0SG 3BU2A 2C35B 1W3SA 4K0KL 5IYCH 4C3HH 5DLQE 2CFMA 3HFZB 4PG3A 4QY7A 1C7YA 4A3KH 4A3FG 4JI8Q 2PQAB 3OTOL 4DR1L 1YJNA 2RF4A 4JI7Q 2UUBL 3AFQA 1HNZQ 1JMCA 4WJ4A 4MTNA 3J7A5 2OTLA 1AE2A 3RLNA 2ZJPA 4LUOA 3GTPH 4DV1L 1DGSA 2OCEA 4LF6L 3HOUH 4WJ3M 5J3BA 2KHIA 1SFOH 1TWCH 2YV5A 1XNRQ 4LF8Q 4AYBG 4BXXH 5LMNL 2UXDQ 2JQOA 4DUYQ 4AQYL 1Z9FA 4PZ8A 2VQFL 1NMFA 3CC2A 5IYBG 5IYBH 5IWAQ 3F2BA 4NPSA 2YTXA 3STBD 1FL0A 5IP9G 4X62L 3OTOQ 4DV4L 2I5LX 4A3FH 3IRBA 4PMWA 3T1HL 1QVFA 1SE8A 2RHSB 4LFBQ 4DR5Q 3F1ZA 5C0XI 3J81c 4DV0L 2YYZA 1K73C 3K7UC 3NELA 4EQ5A 1SN8A 3U4ZA 4X6AH 4DR2Q 4A3EG 1BVSA 4X66L 3JAMi 1KXLA 2I5HA 2N78A 3HKZE 2I5MX 4DUZL 1NMGA 3A5UA 1EIFA 1L2FA 3GD7A 1D8LA 3L2PA 4JI1Q 3EN2A 4DV6Q 2JEAI 3S14H 5FJ8G 2ZM6Q 2HIVA 1TWHH 3NBHB 1ASZA 1S40A 1M90C 3HOZH 5IE8A 3T1YQ 1PH1A 2Q2UA 1NTGA 1Z47A 3NEMA 1QVCA 1K83H 1EYGA 1QUQA 1K8AC 2MNAA 3PO3H 3CQZH 3CCUA 4LF9Q 2QGQA 1J5EQ 4JI4L 2K75A 4YWLA 1N33Q 2EIFA 2Z0SA 4OWXB 2QA4A 3CCRA 1A62A 5IP7G 1VQLA 2WB1G 3FP9A 3CCEA 4A75A 1XNQQ 5M3FG 2XTIA 1LM0A 4DV6L 2NVTH 3G4SA 5ELOA 1NE3A 3GTLH 1YVCA 1Y1WH 4OONA 3FHWA 3RR5A 4A3DG 2KCTA 4O0AA 4A3JG 1A8VA 1WCMG 3HOXG 4APVA 3TS2A 3H0GG 4B3TQ 2DGYA 1VCIA 2A1AA 4LF9L 4IFDI 1Y1VG 1X6OA 1AH9A 4GNXC 4A3MG 2KCMA 2JA8G 2HQLA 2PMZE 2R93H 2XGTA 3ER0A 4O2DA 4DV3Q 2EXDA 4P73A 1V1QA 5FJ8H 1VQCA 1X56A 3UDXA 1JB7A 4JI0L 1YEZA 3D31A 4OX9L 3HOWG 1JJ2A 1BBUA 4LFAL 4A3BG 4A3GG 3UDFA 1VQDA 3PIPA 2K4KA 4MZ9A 1L1OB 4TQUS 1CKOA 1YHBA 2HHHQ 1PH9A 3U58A 2ZTDA 4DV7Q 3I4NH 2B29A 3DM3A 3PV0A 3UE1A 5IP9H 4RG1A 3K8AA 4GNXA 4A3CG 4XTCS 2UUBQ 4KHPL 4A4IA 2VNUD 1Y1WG 1PH7A 2YU9H 2ATWA 2UXCL 4B3SQ 3M85A 1K3RA 1IBKL 4NXNQ 1VQ5A 3KF6A 5GAGC 3CMEA 4B3RQ 1X65A 1EQRA 4NXMQ 4BBRG 3EIVA 5C4XG 1WCMH 3HOXH 1D7QA 1S3OA 3EBEA 2FXQA 4DK3C 4A3DH 2HHHL 3PUYA 5GADC 1G6PA 2WAQG 4L5TA 4LF4Q 2VQFQ 1X3EA 1VQGA 2R6GA 1B70B 3NENA 2ID0A 3HOUG 3HOZG 4BA1I 1KQSA 4KLKA 4LF5Q 1Y1VH 4GNXB 1E24A 2VS1A 3L0OA 2N3SA 2NZOA 1TWAH 5LMUL 1JE5A 3I4OA 1PH6A 2IHEA 3RZDH 1Q81C 2QEXA 2MQHA 2NN6I 3AFPA 4X64L 4OXPA 4R4QA 2KBNA 4A3IH 2VW9A 1XPOA 1QZGA 1XPUA 2NVXH 5IYCG 4R4OA 3TQYA 1HJPA 3CCLA 3GO5A 3PCOB 3S1MH 4GLVB 2ZM6L 5ELNA 2PQAA 4LWCA 4JYAL 1QVGA 4DR6Q 4YY3L 2E5LL 2JA6G 2R7DA 1VS0A 1EWIA 1RIPA 3RZOH 4DV5L 3UDIA 2IHFA 4X65Q 4JBKA
chains in the Genus database with same CATH superfamily
2Q2TA 2VQEQ 4HCSA 2A6ED 4FVMA 4DXFA 5G3LD 1AZPA 3S14B 3ERSX 2B39A 2K33A 4HMIA 1S4ZA 4JI8L 3Q6SA 2EQSA 4I65A 4BWGB 2JA7G 3RNUA 1F9QA 1JT8A 1VQKA 4LF7L 5C4XH 1HPCA 5LMNQ 2EY2A 1PFSA 2ASBA 1RODA 2JA8H 3CP0A 3CCQA 4A3JH 2CKZB 3RN5A 4A3EB 1IBMQ 4TSSA 1TU2B 5IIFA 1TS2A 2KENA 1EIYB 4K0KQ 2CH4W 2DN8A 1U4RA 5KYLA 3A7AB 5BR8L 5HGQA 3F8TA 1SAPA 2OEOA 1STHA 1RL2A 2AHOB 2DY7A 3HOYH 1UE7A 2F52A 2D0PA 4OELB 2LSSA 1N34Q 1VMCA 2OXPA 1HUNA 4N9PA 5JJIA 3UE0A 3CAMA 1EQQA 1ASYA 1GVPA 4LUVA 5GAEC 4BY1G 2E2JB 4ME5A 3S24A 1HZAA 3R2IA 1EFWA 5E4WC 2X6GA 3CCSA 1CK1A 1N34L 2ZT9C 3GTOB 3S15H 2NTSA 3MXGA 4ZLTF 1AEXA 4G7HC 1WYDA 4C1NI 4ZKCB 2B63G 1HFNA 1GD7A 1MSHA 1N32L 1IW7C 2WINB 4IUPA 4JBWA 3KLRA 1KHIA 4B9XA 4BXXG 3ULJA 3I73A 4AIMA 4GOPC 1SYBA 2K52A 1TKWB 4GKKL 1AE3A 4A3IB 1VQAA 4JV5L 3R3OA 2NVXB 2UXBL 4LF7Q 3GTLB 3PO2B 1WTOA 2LFNA 2JP1A 2IX1A 1N32Q 1I94Q 1U4PA 1CHQD 1I5FA 4IFDH 3T4AC 4ZQ3A 2K5NA 5AJ3L 1DOLA 4UPAA 4JV5Q 4GKKQ 4R4IA 1PYWD 2A5HA 5ELCA 4UP7A 1FD7D 4IO9A 4CJ1B 5M5WH 3NTHA 1CM9A 5C4JH 3K0XA 4J1MA 1NJIC 4JI3L 3GTGB 4PZ7A 1IZ6A 4CKEA 1Y69U 2I07B 1B9NA 4UP9A 1A15A 3FKIH 3LX0A 1SNOA 1CZWA 3HOXB 2OT2A 3QIAA 3SEBA 4L5QA 2RSNA 4K5XA 2AMCB 3T1YL 4DR4L 2QDLA 4X66Q 2KEEA 4A3LG 3HKZB 1X3GA 1QG7A 2VY3A 1O7YA 1F2ZA 4UDUC 4DV0Q 1ET9A 1HRJA 1BNZA 1F77A 1PTOD 1ENCA 3QOJA 3CCMA 1FNWA 1FNVA 3NE5B 3KBGA 1IHZA 5LMNW 2ZJRA 4JG2A 2D2CC 1LTGD 2NYZD 4HJAA 1VQNA 3BJUA 4HIDA 2E8GA 1XWEA 4LF4L 4IPCA 3M4OH 2AWNA 2F0QA 1EQTA 1U4MA 1KLGD 3W1GA 3RZOB 4ID6A 5FKAC 3MXNB 2F0LA 1Z6HA 2NVQB 1DZ1A 1RTOA 1PH4A 4C1NK 3D4RA 3TRZA 3EROA 1EIHA 2B2YC 4MHEA 2A68C 4HJ8A 4A3LH 2Y0SE 3J81i 1JWMD 3PUWA 2VB2X 3CC4A 2JA7H 1D2BA 3MXUA 3CF5A 1U4LA 3G6JB 4DNIA 5M3FH 3HP3A 1Q82C 4DV3L 3M3YH 3TMEA 1EU4A 1B8AA 2PNRC 3OIPA 1I50B 2RCNA 2MPMA 2YTYA 1II3A 4XQNA 3DLLA 4RGOS 1UE6A 1I6VC 4K6LA 5EBDA 1XJVA 1SROA 4IURA 2MGSA 3T51B 2UUCL 4A3EH 1STGA 5H1SE 1SYEA 1CFMA 1I6HB 1QZHA 3I90A 1BCPF 3CW2C 3TP7A 1TT2A 3GDEA 1CA5A 4OO1I 3J81j 5DEHA 1B2TA 1PV4A 2XNAC 1PRTF 1KIXA 2IWHA 1RJTA 2XRQD 1EUJA 3E6ZX 3CXCA 5AJ3Q 4BBSG 2D5DA 4ULLA 4YCWA 2AKWB 4M1UB 1YHQA 1W2BA 3CCJA 1Q1EA 1T9HA 4A76A 4NP5A 2AQ3B 1B4OA 4RAUC 1UAPA 3V2TA 1XMOL 1HH2P 4I7AA 3K58A 3BYTB 3U9OA 1TWAB 4B3SL 5IGFA 1E2WA 2WP8J 4IFDJ 3DUZA 2A19A 4HTHA 3C46A 1NY4A 3J80L 1YITA 3NPPA 2PI2E 1GUTA 2OQ0A 4KKSA 3A8IE 3GTQH 2F4VQ 2B2TC 3H94A 2O2LD 2K01A 1O7ZA 1VQ7A 2VXWA 5DNFA 3PO2H 2A68D 1EIGA 3H91A 4KD4A 1WI5A 1JORA 2H4OA 4XDXA 3H3VH 1M1KC 2K50A 1HR0W 1ZYRC 2XIWA 4X64Q 4GKJL 1QWYA 4RA8A 1G2SA 4IQZA 5IY0A 3S2DB 5CV9A 1J8IA 3DEOA 3S1RB 1OXXK 4ME3A 4YY3Q 1YNXA 5C4JB 4IUUA 1W3SA 4K0KL 5IYCH 4C3HH 3HFZB 5EBCA 4A3FG 5CBAE 3OTOL 4DR1L 1A2TA 3S17B 3A8JE 4MTNA 3J7A5 4FF2A 1GHJA 2E2IB 1JWSD 2ZJPA 1YNNC 4DV1L 4LF6L 1EYCA 2F0IA 1IW7D 2KHIA 1S5BD 3P1HA 4BXXH 4DUYQ 2EJMA 5C3EB 2VQFL 1I4RA 1ONLA 5IYBG 5IWAQ 4DV4L 2A6HC 1TQOA 4PMWA 3MAQA 1EY7A 4FF4A 3BS1A 5C0XI 4DV0L 2YYZA 4PV1C 3K7UC 4OO1H 4X66L 1KXLA 3HKZE 1QOHA 1B3QA 2JEAI 3S14H 2XN9C 3DMUA 2F0NA 1RF2D 3T1YQ 3J7YW 1WD1A 1BO0A 1PH1A 4JVZA 3A55A 4DA2A 1EU3A 1FYCA 5C4XB 4K8JA 2Z0SA 5DM73 2QA4A 3CCRA 2K5DA 1SYCA 3VA7A 3WDNA 5IP7G 5M3FB 3FP9A 3CCEA 3M3YB 4UAIA 2XTIA 4DV6L 1UEAB 4OONA 4HSVA 1XXGA 1SEBD 2QKIC 2KCTA 4O0AA 1WCMG 2F0GA 2JA8G 2XWBB 2EXDA 3KUPA 4RHRA 5FJ8H 1VQCA 4JI0L 1YEZA 4A3GG 2KJXA 1O80A 1JC7A 3H09A 1JJ2A 4LFAL 4ODGA 3UDFA 4DK0A 4EQPA 4TQUS 3FEWX 1H9RA 1QJOA 3Q22A 2HHHQ 1HHVA 4IZ8A 3HOYB 5HURA 4A3CG 5EJWA 2F0KA 4BS9A 2EYOA 2H1EA 1H9JA 1IYVA 4NXNQ 1IBKL 3CMEA 2XWJB 2QW7A 5F2DA 1EQRA 2XSCA 4BBRG 3MTSA 4HAEA 1D7QA 2WAQG 4PMBA 1LABA 2R6GA 5K5PA 3EA6A 3C1EA 1KTKA 2EYJA 4GNXB 3L0OA 2N3SA 2NZOA 1TWAH 5CV4A 1PH6A 5KYIA 4ZYSA 2QF7A 4G57A 5C4HA 3AFPA 4OXPA 4A3BB 2KBNA 2EDGA 4A3IH 2NVXH 4R4OA 3A8KE 1BOSA 3PCOB 3S1MH 3GTQB 5ELNA 1GUNA 2MP1A 1JE4A 4DR6Q 1KDAA 4EGVA 4DV5L 4KN4C 3OHXC 4ABNA 1KDCA 3NBHA 3PMFA 4F88A 2JA9A 1OXUA 4OWTB 1KC8C 4YIJA 5IGGA 4H13C 4G4KA 1K9MC 3CQZB 1EQVA 3B6YA 3D4WA 2KCNA 3RUZA 2PQEA 5JJLA 5HY6A 1FJGQ 3FKIB 4JBJA 2SOBA 3I56A 4X62Q 5J1ZA 1VDZA 3T16A 3S17H 1VQMA 4AYBE 3AEVA 1VQOA 1V1PA 4H7BA 1LT5D 3ICEA 2E2IH 2UUAQ 3ND9A 1YBYA 4IOAA 1CKMA 1BBWA 4X3UA 3OW2A 4YHHQ 4L63B 2E74C 4WJWA 1JJCB 4KHZA 1F9PA 4IOCA 4GLXA 1F2LA 5C3EG 5C3EH 1PH2A 4IJLA 1B7YB 1PHJA 4UY8C 1ZXTA 4LMQD 4IJHA 1MHWC 1FVIA 3OW7A 1W6KA 1HR0L 4DPGA 4L5RC 4DV7L 4MTKA 4OL7A 2ZTEA 2NVQH 1CKNA 1D5ZC 1PA6A 1N36Q 4XIGS 1PZJD 3H0GB 1LTID 2ALYB 1VQEA 4R4TA 3Q23A 2DY8A 2JA7B 3ZYYX 1RHPA 1TY2A 3BVGA 2Z6KC 3DM1A 2CW0D 5C0XG 1DONA 4V190 1WTRA 1XPRA 2VL6A 3KDFA 4C56C 1O7IA 1I50H 5EPJA 3P20A 3SVMA 2J7ZA 2VUMG 4JI5Q 3CPWA 5JVG3 3QR8A 1IBLQ 4DGZA 4DV2Q 4GN3B 1I6HH 4LF8L 3O13A 4RMFA 1YIJA 1XNQL 1OXSC 3ZJYC 2HDMA 2ZTCA 3TREA 1KLUD 3GTKH 1LT4D 3U4VA 2MJ8A 3PSIA 4QQBX 1JICA 1MSGA 1SMXA 5EPLA 3MHBA 1F2YA 4N8X1 2CW0C 4YCUA 5EAYA 2B63B 3E0EA 5ELEA 2OTJA 4LFAQ 4A3KB 4JI0Q 4A3MB 2LS01 1PYSB 1QILA 4JI1L 1A6XA 4OWWB 4FF3A 2B2UC 1Q12A 3CCVA 5CV7A 1T5XD 1S5CD 1VQHA 4N9TA 2JJQA 1G291 3AQQA 3DEPA 3N52A 4JCVE 2B2WA 2B2VA 3M9BA 5I6WA 2L12A 2YTVA 4WRDA 1NNXA 2QDBA 2R92G 1HA6A 2F4IA 1YJ9A 5A2QL 3I55A 3W5OA 2QILA 2Q8RE 4L5SA 1D1KA 1Q7YC 3KLWA 3K7AB 4C3IH 4POFA 1OTCA 4A3BH 1RCVD 4R9WA 2UUAL 4NW2A 4J15A 4B3TL 2F0MA 3S1MB 2UXCQ 3PF5A 3OOCA 1IL8A 4CGYB 1BXTA 5DAUA 1KAWA 4C2MB 5JEAJ 2PYKA 3FPUB 1CSPA 1D5MC 2Q2IA 4DR7Q 1PLFA 1T5EA 4KHPQ 3S2DH 4CDDC 3T1HQ 4JW0A 4DV2L 4KI0A 5LL6S 4A3CH 2IX3A 2I46A 1M4VA 3S1RH 2EVBA 1NUCA 4WORA 1TS4A 2EZVA 3NQTA 1IKLA 1WVLA 1KRSA 5AFWA 3R8BA 2B2YA 4ZCKA 4LNQA 1EYAA 3D6WA 4A3IG 3MEFA 5KGUA 4RGTA 1PYBA 3TZUA 4ZKBB 1WFQA 4QUCA 1H95A 1R4PB 2MHVA 4FNFA 3ERQA 2CHBD 1X55A 3U50C 5C6AA 2H5XA 1SE3A 4JI4Q 3CD6A 4R8IA 1KNEA 2K05A 1Q1BA 1TS3A 1HR0Q 1EY6A 4BY7H 3HS0C 1WJJA 5CV5A 5BN3A 3Q24A 1SYGA 1PXUA 1S5ED 1NAPA 4ILWA 5KRUA 5IT9E 4Z9CB 2UXBQ 3ONAB 3L7ZC 1JOQA 2QEJC 4P71A 2EY1A 3IL8A 5LMUQ 5IOCA 3OWEB 3PUZA 2WB1B 1CUKA 4CDEC 3RD4A 3K5LA 3RMHA 2NN6G 1IL2A 3QJYA 2V1CC 3VYTA 4QL5A 3K5NA 3VDYA 1J5EL 1SBBB 2D0OA 4P75A 1PFNA 2R7FA 3KOJA 4DAYB 1CA6A 4L6TB 1EY0A 2GA4B 2F0TA 3QG1A 4HSPA 4G7ZC 2RHQB 4QCLA 5JJKA 3FDTA 1L0WA 4NXNL 3H0GH 2L4NA 5FO8B 1WTVA 2EPBA 1V43A 1BQQT 1LTLA 4AH6A 1J9OA 1BBXC 4JI2Q 1OXVA 1YNJD 5C3WA 4HIOA 3SE0A 2B2VC 2ES2A 1DD2A 4K5WA 4YWMA 4BY1H 1E1OA 3SXHA 3PO2G 2HT1A 4NXML 2M2LA 1N36L 4FDBA 1TXYA 2NWGA 4F8MA 3T56B 2EJGC 4ZK9B 4P74A 3WOEA 1PH5A 1K3BC 4GS3A 3NTKA 1PVOA 4GN5A 1HZBA 1K28A 4DAMA 3PGZA 3H6MA 2IY5B 1EZ6A 2C35B 3KF8A 5DLQE 1SE2A 4PG3A 2NB0A 3G7LA 4A3KH 4JI8Q 1YJNA 3E3XA 4XQQA 4JI7Q 5KNBA 3AFQA 1HNZQ 1JMCA 2JA5B 1PMRA 2K04A 2AQ2B 1LTSD 1F9SA 5EGTA 4XQJA 1FR3A 2OCEA 3MFGA 4FP5D 4WJ3M 2UXDQ 3E5SA 1V1OA 4MIUA 1QB5D 3LWUA 3CC2A 2KVMA 3VR2A 4X62L 1TWFB 2I5LX 1WTHA 1EY5A 1XX8A 2J4XA 4RFBA 1SE8A 4EQOA 3HGBA 5A35A 3J81c 1B50A 1SN8A 5IT9L 3U4ZA 4DR2Q 4IUNA 1HTLD 2I5HA 2N78A 2I5MX 1KABA 2PW7A 2EY6A 1GUOA 3IAYA 1EIFA 3GD7A 1ICFB 1EEFD 5FJ8G 2HIVA 1ASZA 2Q2UA 1Z47A 3NEMA 4XT1B 2CH4A 1K83H 5I2YA 1QUQA 5NUCA 2MNAA 3PO3H 3CQZH 4UHVA 4DXGA 3CCUA 1X3QA 4JI4L 3BDOA 2K75A 4YWLA 1V8QA 5JOBA 2Z8LA 1N33Q 3I4LA 1K8OA 2NVYB 1GUGA 1AP0A 1Q3LA 5CBEE 2F0HA 4CKBA 4EQNA 1WD0A 3HOVB 3FHWA 3S1QB 2KOLA 1ET6A 5J22A 3OSOA 3HOXG 4B3TQ 2KQ3A 2DGYA 2VB3X 1AH9A 1SMYD 4BY7B 1BCPC 4OX9L 3HOWG 3J81E 1SSOA 2JN4A 2Z9HA 4QIWB 1CKOA 3U58A 5EPKA 3K6OA 4XTCS 3SK8A 2TMPA 4A4IA 1C8CA 2VNUD 1PH7A 2YU9H 2UXCL 3TSSA 4B3SQ 1K3RA 4KKUA 1VQ5A 3KF6A 3NK9A 2RQXA 4XYOA 2QCPX 4PMCA 4NXMQ 2AUJD 4ZUJA 2FXQA 4DK3C 4A3DH 2HHHL 4L5TA 4FF1A 2VQFQ 1X3EA 3I70A 1VQGA 2NZ1D 4IUTA 1JWUD 5CV8A 1KQSA 4EVOA 4KLKA 5G3LF 4LF5Q 1E24A 1HXYD 1BCPD 2HDLA 4RCNA 3NHHA 2MQHA 2L55A 2NN6I 2F0JA 4X64L 1DYQA 1EWHA 4R4QA 1BUVT 2A73B 1MBYA 3P7JA 2VW9A 1XPOA 5C5LA 2KCCA 4LWCA 2PQAA 4JYAL 1HTPA 4YY3L 1UUPA 3FVQA 2JA6G 1VS0A 4V0BA 3W2DA 3UDIA 1YNJC 5ELBA 3I7FA 5IYDH 1K8MA 3GTKB 1XMOQ 1IBML 2RBMA 2PPBC 3T13A 4GLAC 4JI5L 3J80E 2B63H 4BBRH 1XNRL 4DUYL 5FO7B 3J80i 4C3HG 3OMCA 4A3MH 1ZYRD 4RKBA 3A7LA 3E0JA 3K57A 5JEAH 1I4QA 2BA0A 3KFUA 4GKJQ 1JQYD 2EJFC 1CSQA 5K36H 1VQ6A 1ML0D 2MFIA 4A3GH 2PO4A 1GJXA 4BY7G 2DJFC 2R3ZA 1E2ZA 3A0JA 1E3PA 4RHSA 3TZDA 3JC66 2WV6D 5CYUA 3R93A 1BKBA 4RKLA 1B44D 4R8NA 1U5KA 3K7AH 3KK7A 4C3IB 3KJOA 3I4NB 5M3MH 1SRUA 4MNOA 1PRTD 2HIXA 5JPMC 1DM0B 4OIKA 5IP7H 3ULPA 4BA2I 3MVVA 2G9DA 4G7OC 1UNSA 1AZQA 2K5VA 4C2MH 5I9OA 1GUSA 2M00A 4DU9A 2K1BA 4YHHL 1QNUA 4POGA 4OO1G 3FKIG 3HKSA 4JYAQ 4B3RL 2X69A 5KIXA 3HZXA 1LTTD 1Y1VB 4H02A 1K83B 2B8GA 1MD2D 3PO3B 1IXRA 5ISRA 1DJRD 2BCOA 4C3JH 1B1ZA 1GKHA 2P5ZX 3PQIA 1EZ8A 1GUWA 2B2WC 4GZYC 3N6RA 1DXMA 1X3FA 4GOPA 1V9PA 4OGQC 4PZ6A 1TR5A 1VQBA 4OIJA 2R93G 2SDFA 1MI2A 4DR4Q 4DV5Q 4Y52H 2KUMA 3KBXA 1PH8A 3I3CA 3D0FA 2LXJA 4UP8A 1E2VA 2K14A 5GAHC 1BF4A 1STNA 3I2ZA 5M5YH 1G91A 4GOPB 4KMUC 4R1JA 1RTNA 1G6ZA 1UWVA 5J39A 3HRZC 2K28A 1TY0A 4HJ9A 2CCZA 2BH8A 3J7ZC 4WJ4A 2WIIB 4A93G 2K5QA 4CJ2C 2OWOA 4A3DB 2EE1A 3A5ZB 1CKNB 2BH2A 2F0WA 1CI3M 2FMCA 2L15A 2NTTA 1IBKQ 2F4VL 4JI3Q 1ENFA 1JOKA 2B8FA 1DOKA 1WOCA 2HQEA 3E9IA 4TKOB 3BG3A 5M3MG 3LWEA 4K5VA 1LV9A 1PH3A 4DK6C 1X54A 3S16H 5JJZA 3BZKA 3V05A 4HJ7A 4HJ5A 1C48A 3HOYG 1TS5A 2JE6I 1N9WA 3K80C 2WB1E 2VUMH 3M7NA 3W3AA 3CC7A 2RDFA 1A3TA 3VYSA 4FYDA 1OO9B 1XMQL 4BY1B 1SJED 3CMAA 3LNNA 1G2TA 4JOIA 3WOFA 2F1MA 3PUXA 2HCCA 4HMJA 4GN4B 2RCFA 5JEAG 1A63A 4DF7A 3SHLA 1V1PB 2CWAA 1FGBD 4HIMA 4WFN3 1JOOA 4IFDG 4ZRZA 3F2CA 4DR3Q 4LFBL 1MJCA 1L1OA 4HN7A 4QUFA 3GP7A 3RN2A 3X3NA 2D62A 1IBLL 3H3VI 2F03A 1R4QB 1D6EC 3SK6A 2KEDA 3C3LA 4A3KG 1CTMA 1EWCA 2E76C 3BVZA 3VR4A 4XXEA 2DNEA 3STBC 3KYHC 5CORA 4DNTB 3S9WA 4X65L 3AB9A 2WKCA 2RVLA 2JA5G 2JA5H 1SJHD 2JSOA 1STBA 2KHJA 2NZHA 1B53A 1Q46A 1IYJB 1UEBA 4Y7NB 1SLJA 4QJFA 5IT9c 2VZAA 2C5CA 4JI6Q 1L0XB 2L0CA 5C4ZA 1TWFH 3TBIB 2AQ1B 3ULLA 1SXTA 2CWPA 4DV1Q 4LF6Q 2N49A 2ICIA 1BDOA 2M9VA 2PCFB 1X32A 4OHJA 1MJEA 4LF5L 3JAME 4RGMA 4LAAA 3BZCA 1PFBA 2UU9Q 2NUCA 5IWAL 4DV4Q 2ZXPA 2PI2A 2ZXRA 4DAYA 4YCVA 4A93B 2EOTA 3E9HA 1HUMA 1H9SB 3BZDB 3GQBA 2JK8A 1SNPA 3BDLA 2DNCA 2SEBD 1PDQA 3DWPA 5C0XH 1ICWA 3UI2A 5IGEA 3TS0A 4JOIC 1OXTA 4DR1Q 2A6EC 2NVYH 2PNHA 2MUYA 4C3JB 4N8FA 2JXMB 1W6JA 3SR1A 4OX9Q 4P72A 1FNUA 3G6EA 3HOVH 3S1QH 4FXGC 2V4DA 4DAPA 2F3IA 1KL9A 1LT6D 4U68A 4K14A 1Q8KA 1EY8A 3MFYA 5D3IB 1HNXQ 3OMGA 4YWKA 5GQOA 1D1IA 2R7ZB 3MXNA 4CKCA 3OIQA 3EFXD 3W1BA 1VQ8A 1PRTB 1EOVA 2F0SA 1QUQB 5TSSA 5L37A 3PO3G 4DR2L 2YU9B 5BN5A 1N8RC 1P16A 2B2UA 5C3XA 3BU2A 4KN7C 4OEMB 2Y0SB 1TIID 4DK1A 3M4YA 3V96A 1C7YA 5M5YB 1PTOH 2PQAB 5D3DA 1EL0A 2JYOA 1AE2A 4QF4A 3RLNA 1VF5C 2G9HD 3GTPH 1DGSA 4RGNA 1MGSA 3HOUH 1F9RA 1NR2A 3K0YA 4K8IA 5IGCA 1XNRQ 4MN3A 1TWGB 5LMNL 3J7AV 3QO2A 3J81L 3FMCA 2IL8A 1SYDA 2C9OA 3F2BA 4QMGA 4NPSA 3IRBA 3T1HL 3D6CA 1QVFA 2CQAA 2F0DA 1QE6A 3L3OC 1IYUA 5KNCA 1K73C 3A54A 2A74C 4O42A 1NR4A 4K6DA 1BVSA 4ZAIA 1DOMA 4DUZL 1NCVA 3MA2B 1L2FA 3HEJA 2X6LA 3EN2A 4X3KA 1LT3D 3GV3A 5ELDA 3MEHA 2ZM6Q 1SYFA 5JPNC 3NBHB 1S40A 1M90C 5IE8A 1NTGA 1EYDA 5CR3A 4FXDA 2XVSA 2BOSA 4FXKC 1J5EQ 4BBRB 4OWXB 1O7LA 5KNDA 1VQLA 2WB1G 3FRPB 4Q5VA 4B08A 5M3FG 2Z1CA 2TSSA 3G4SA 5JVH3 1NE3A 1YVCA 3RR5A 3VR5A 3DHQA 4A3JG 3L9AX 3TS2A 1U9RA 3H0GG 3QWNA 1CQFA 4IFDI 1Y1VG 2EYHA 4GNXC 4A3MG 2KCMA 2HQLA 2ICEC 2PMZE 4A3GB 4O2DA 4P73A 4S3SA 1X56A 3VYUA 3D31A 4A3BG 1JCKB 1ILQA 1BBUA 2PZTA 1HCZA 1L1OB 3I4NH 5JAVA 5EKKA 2BE5D 2UUBQ 2HCIA 4KHPL 1Y8NB 3VYRA 1Y1WG 3D4DA 5M3MB 3M85A 4B3RQ 1X65A 3CRKC 3PIP3 5C4XG 2WAQB 1WCMH 3EBEA 3CU7A 1G6PA 1ZKOA 3EVQA 2N55A 1EOTA 3CRLC 1B70B 3NENA 2ID0A 3HOZG 1KDBA 5COYA 4BA1I 3I72A 4O1NA 1Y1VH 3DWAA 1SFOB 5LMUL 1JE5A 3I4OA 2IHEA 3RZDH 1Q81C 2QEXA 5FLXL 2L5TA 3IFTA 4A3FB 2F0OA 3TQYA 3CCLA 1EY9A 3GO5A 3QOLA 5I2XA 5BN4A 2R7DA 3IFDA 2F0PA 1RIPA 2BDNA 5LHY1 1HFGA 3T53B 1E0BA 1BR9A 3KLSA 2EXZA 1WTQA 3Q8DA 3R2TA 2EYMA 2E2HH 2BA1A 2R7ZG 3NP8A 3PIO3 2PMZB 3TP8A 2PZUA 3AMUA 1QCBD 3AYHB 1UE5A 2SNSA 1I3QB 3LGJA 1I94L 2F0FA 4KD3A 2E2DC 3G71A 3SGIA 2DUDA 4AQYQ 1MIUA 2KHSA 2LKVA 1LO5D 3KF8B 1SNQA 1K0RA 1GO3E 4NDXA 2NVTB 1PTOB 4JC0A 4F7XA 3NXWA 2BDOA 4DKAC 3KJPA 1G8ZD 1LTAD 1G51A 2MO0A 3HOWH 3GTPB 3WWVA 2A8VA 3S16B 4B9WA 1HNXL 3HOUB 5M9OA 5A2QE 2HUGA 5E7NA 4M8AA 1KNAA 2WKDA 3DXJC 1TWGH 4C3IG 1HZ9A 1YHAA 4HR7B 4LJZC 3A74A 2VUMB 4K2KA 2NN6H 1A3VA 4QB4A 1S5FD 1MKHA 2WFWA 1BCPB 3I4MH 5E4XA 1GM5A 5EQ0A 2DJGC 3KF6B 1E1TA 1A2UA 3RLOA 1VQIA 1LACA 3ITPA 2Z4HA 1Q90A 5EKLA 3IKJA 5FLXE 1UE1A 3HG9A 5FOBB 2CVRA 2WACA 4DR5L 2N88A 1Q86C 3MXPA 5K36G 4JI2L 4HCEA 4JPBW 5CC4A 4LFCL 4NMZA 3SK4A 4DUZQ 5IODA 2UUCQ 2R92B 2LXKA 4IPHA 1SDFA 1R9TB 4DAVA 3TEHB 5M5XB 4BBSB 1AN8A 2VQEL 4KKTA 1GXDC 1ZEQX 4KY5A 1CQVA 3UDGA 2JEBI 2Q2HA 1K0SA 4F87A 2KA7A 3X3MA 4JI6L 4CBVA 5CMDA 1WTWA 2PZWA 3AU7A 4QGUA 5D14A 4IUVA 3S2HB 1YZ6A 5C44G 4Y7NH 1FJGL 2UXDL 1RD9D 4IPGA 5E1FA 4XT3B 1CHPD 5FLMG 2I0QA 5KEEA 4DFAA 2MO1A 3GTJH 3OWFA 3P75A 1E22A 1N33L 1HNWL 1HNZL 2ZJQA 4R4CA 4JI7L 3GTMB 3G48A 1YNND 2JA6H 2ENBA 3PUVA 1M8AA 4DR6L 1SE4A 1I4PA 1SMYC 2JA8B 2EYLA 5FK9C 1SNDA 2Z6KA 1VQPA 4Q0FA 1WCMB 3M4PA 1U0LA 5BR8Q 4DR3L 3A56A 4A3JB 4A93H 1C9OA 1L1OC 4LUZA 1STYA 1HNWQ 2IJ0A 2F0UA 2B2TA 3F2DA 4ALPA 4JBMA 1XTCD 1KRTA 1J6QA 2Z6BA 2O5JC 1IKMA 1TWCB 5ELFA 3M4QA 2O5IC 1XTDA 1KAAA 2K03A 3PF4A 1S72A 4KY6A 3C2PA 3KDFB 2K6AA 3I91A 3RZDB 3I4NG 1KD1C 1SNCA 1AW7A 2RKSA 4DR7L 1STAA 2J0TD 2IT1A 1SR3A 4C3JG 3CPFA 1TVXA 4KTAA 1WTXA 3TP5A 2FFKB 1H9KA 2K7VA 5GROA 2IX0A 1I4GA 4IPDA 2L11A 4LFCQ 3J7AF 2E2JH 3J80c 1K8GA 5C0XJ 2R7ZH 1TWHB 3HOZB 4LW1A 2F3WA 5FLMH 2FINB 5T1IA 2E2HB 3HKZG 3GTOH 5C44H 1LUZA 1S5DD 3OYYA 5T1GA 2XRSD 1I3QH 4NB3A 3NTIA 5FLXc 5C5MA 1E7ZA 1YJWA 1ESFA 3MC0B 2A6HD 1VQ4A 1Y1WB 2OQKA 3VR3A 1ILPA 1LYLA 2NBFA 4ZUIA 1WTPA 1YI2A 4KJNA 1XYIA 1LTBD 1B3AA 1X9NA 2R93B 1PZID 1NBWA 4K2LA 3NSWA 1XMQQ 1P8LA 1ENAA 2GN5A 4PQXA 3HOWB 3K59A 2RSOA 4NKLA 4PNYA 1ESRA 2K32A 4X3SA 3TDQA 4JK1C 4TRDA 1EFID 4IALA 2GVAA 4KY7A 1SNMA 2SNMA 3NBIA 2G5DA 3I4MG 3S1NH 1PFMA 5D65A 3GTGH 1VQ9A 2CQOA 2F3VA 3EQLC 2R61A 3I8ZA 3CHBD 1EEID 2FJ2A 1VQJA 1Y14B 2IPKD 2E5LQ 3K5MA 1Z7TA 1JJGA 1PZKD 3QB3A 5IYDG 2K5HA 1D5XC 4EX5A 1Y8PB 3NWTA 1C0AA 1HQMC 2A69C 2GVBA 3K81C 4LK1C 4TVAB 4HIKA 2R92H 1VQFA 2BE5C 1A0IA 1R9TH 5M5XH 4BBSH 2N8NA 5EKIA 4KJOA 3RLFA 2RA4A 1HZCA 3PIOA 4B3MQ 1FGUA 3M4OB 1H9SA 4QIWE 3ND8A 4U673 3S2HH 4CDFC 5DM63 3HOVG 1EY4A 4AYBB 2UU9L 4X3TA 3KLSX 5IGBA 2B3GA 3H15A 1Q8IA 1DCZA 1L0YB 3GTJB 1JB3A 1A3UA 3JAMc 5CGKA 4B3ML 2KECA 2WAQE 2AWOA 2F0EA 3GTMH 1GHKA 2JA6B 3BVMA 3VA5A 2Y0SG 1B9MA 1LLRD 1QNKA 2CFMA 1VMPA 4DNRB 4QY7A 1JR0D 2RF4A 2UUBL 2L1BA 3F2UA 1Y8OB 3NQIA 2OTLA 5IGDA 4LUOA 3DWQA 1H9MA 5J3BA 1SFOH 1GOZA 1TWCH 2YV5A 4J8QA 4LF8Q 4AYBG 2Q8TA 2JQOA 4AQYL 1Z9FA 3CKIB 4PZ8A 1NMFA 5IYBH 3STBD 2YTXA 5IP9G 1FL0A 1RKNA 3OTOQ 4A3FH 2RHSB 2FMMA 4LFBQ 3NWSA 4KV6A 5HGTA 3M7GA 4DR5Q 3F1ZA 3H3VC 4EQ5A 3NELA 4I7ZC 2D9UA 1O78A 4X6AH 1I4XA 4A3EG 3JAMi 2F0VA 3SK5A 1PTOF 1I4HA 2RDHA 1CT1D 1NMGA 3A5UA 3L2PA 1D8LA 2A69D 2E75C 2FHTA 4JI1Q 4RCOA 3SDZA 4DV6Q 3S15B 1TWHH 3HOZH 1RDPD 2EYPA 1QVCA 1EYGA 5C44B 2L9HA 1LTRD 1K8AC 4LF9Q 5I4DA 2QGQA 4KK7A 3U9SA 3NUCA 2EIFA 3MZ5A 1A62A 3TP6A 3JAML 2OF1A 2LMCB 2EYFA 4A75A 1XNQQ 1LM0A 3EJIA 2NVTH 5ELOA 3GTLH 1Y1WH 3D8GA 4E6IA 4A3DG 1A8VA 4H0LC 3TN2A 4APVA 3MWYW 4DN4M 1VCIA 2A1AA 4LF9L 4CHTB 2LY7A 3URYA 1X6OA 2R93H 3VR6A 2XGTA 1F2MA 3ER0A 2O4XA 4DV3Q 1JB7A 1HA5A 1V1QA 3UDXA 1HQRD 2Z4IA 1VQDA 3PIPA 2K4KA 4MZ9A 1YHBA 3D3RA 5FO9B 1PH9A 2ZTDA 4DV7Q 2B29A 3DM3A 3K5OA 3PV0A 3UE1A 5IP9H 5M5WB 4IUQA 3K8AA 4RG1A 4GNXA 2EY5A 4KHVA 2ATWA 1NSNS 3BDCA 2Q8IB 3I4MB 3S1NB 5GAGC 2HD3A 4C3HB 4CDCC 3EIVA 5CV6A 3HOXH 1PRTC 1S3OA 3PUYA 5GADC 3Q0AA 2AUKA 1AFPA 4LF4Q 4FO2A 1C4QA 2RDGA 1PTOC 2IW3A 3HOUG 4H44C 1X3PA 3OPOA 4L8JA 2VS1A 4J6HA 5I9PA 5I6YA 5LL6X 4CJ0B 1XPUA 1QZGA 3C1FA 3BYYB 3FPPA 5IYCG 1HJPA 1VF7A 5E3FA 2PW5A 4XYQA 4GLVB 2ZM6L 3GV6A 1QVGA 4HEDA 2E5LL 2K5WA 1EWIA 2ZXOA 4RWSC 3RZOH 4RH6A 4P2CB 1CZGA 4IN3A 2IHFA 4X65Q 1STEA 4JBKA
chains in the Genus database with same CATH topology
2Q2TA 2VQEQ 3I7FA 5IYDH 3Q8DA 2JA9A 1OXUA 4OWTB 2E2HH 2BA1A 1KC8C 2R7ZG 3ERSX 1XMOQ 3AYHB 1UE5A 3LGJA 1IBML 1I94L 4JI8L 2EQSA 2JA7G 1K9MC 3RNUA 3B6YA 3G71A 4GLAC 4JI5L 1JT8A 3SGIA 1VQKA 4LF7L 2DUDA 4BBRH 5C4XH 4DUYL 4AQYQ 1MIUA 1XNRL 5LMNQ 2B63H 3J80i 1PFSA 5JJLA 2ASBA 4A3MH 2JA8H 3CP0A 3KF8B 5HY6A 3CCQA 1FJGQ 4JBJA 3I56A 4X62Q 1K0RA 1GO3E 4JC0A 4A3JH 2CKZB 4DKAC 3RN5A 3KJPA 2BA0A 3S17H 1VQMA 4AYBE 3AEVA 1IBMQ 1VQOA 3KFUA 4GKJQ 3ICEA 1G51A 2KENA 2E2IH 1CSQA 1VQ6A 2MO0A 1EIYB 2MFIA 2UUAQ 3HOWH 4A3GH 4K0KQ 1YBYA 3WWVA 2A8VA 1HNXL 4BY7G 4IOAA 1CKMA 3A0JA 1E3PA 1BBWA 5BR8L 3JC66 5E7NA 5HGQA 4YHHQ 3F8TA 4IOCA 1TWGH 3OW2A 1JJCB 4KHZA 4GLXA 1BKBA 5C3EG 1HZ9A 1RL2A 1U5KA 1YHAA 2AHOB 3K7AH 5C3EH 3KJOA 1UE7A 3A74A 2F52A 2D0PA 3HOYH 1PH2A 4IJLA 1B7YB 1PHJA 2LSSA 1N34Q 4UY8C 5M3MH 4IJHA 1SRUA 1MKHA 1FVIA 4MNOA 2WFWA 3I4MH 2HIXA 4DPGA 1GM5A 1HR0L 5JJIA 5IP7H 3UE0A 3ULPA 3CAMA 3KF6B 1EQQA 1E1TA 1ASYA 4L5RC 3RLOA 4BA2I 1GVPA 4LUVA 1VQIA 2K5VA 4DV7L 5GAEC 2ZTEA 4BY1G 4C2MH 2NVQH 4YHHL 3S24A 4POGA 4OO1G 1HZAA 1UE1A 3FKIG 3HKSA 4JYAQ 1EFWA 4DR5L 1CKNA 1Q86C 3CCSA 3S15H 1N34L 5K36G 1PA6A 4JI2L 4B3RL 1N36Q 4XIGS 1WYDA 2B63G 2ALYB 4R4TA 1VQEA 1GD7A 4H02A 1N32L 4LFCL 4JBWA 4DUZQ 2Z6KC 2UUCQ 1KHIA 5C0XG 1IXRA 2LXKA 4BXXG 4IPHA 1XPRA 2VL6A 3KDFA 3ULJA 4AIMA 4C3JH 4GOPC 1GKHA 1O7IA 2K52A 3TEHB 4GKKL 2VQEL 1AE3A 1I50H 1VQAA 4JV5L 3UDGA 2JEBI 2Q2HA 2VUMG 4JI5Q 3CPWA 4JI6L 4LF7Q 2UXBL 1X3FA 4GOPA 1IBLQ 4QGUA 2IX1A 1N32Q 1V9PA 1I94Q 1YZ6A 4PZ6A 5C44G 1I5FA 4GN3B 4Y7NH 4DV2Q 4LF8L 1FJGL 1I6HH 2UXDL 4IPGA 1VQBA 4RMFA 5FLMG 2K5NA 5AJ3L 2I0QA 1YIJA 1XNQL 1OXSC 3ZJYC 2ZTCA 4UPAA 2MO1A 4JV5Q 3GTJH 3TREA 3GTKH 4GKKQ 4R4IA 2R93G 1E22A 1N33L 3U4VA 3PSIA 4UP7A 4DR4Q 1HNWL 4QQBX 1HNZL 4IO9A 4DV5Q 2ZJQA 4R4CA 4JI7L 4Y52H 3G48A 5M5WH 1PH8A 1SMXA 2JA6H 5C4JH 3K0XA 3D0FA 1NJIC 3PUVA 2LXJA 4JI3L 4YCUA 5EAYA 4UP8A 4DR6L 3E0EA 2K14A 5GAHC 4PZ7A 1IZ6A 2OTJA 3I2ZA 4LFAQ 5M5YH 4GOPB 4JI0Q 4R1JA 4UP9A 1PYSB 1UWVA 3FKIH 4JI1L 4OWWB 2Z6KA 1VQPA 4HJ9A 1Q12A 2CCZA 2BH8A 3M4PA 1U0LA 5BR8Q 4L5QA 3J7ZC 3CCVA 4DR3L 2OWOA 4A93H 1C9OA 1L1OC 3A5ZB 4LUZA 1CKNB 2AMCB 3T1YL 2BH2A 4DR4L 1VQHA 4X66Q 1HNWQ 2L15A 3F2DA 4ALPA 4JBMA 1X3GA 2JJQA 2VY3A 4A3LG 1G291 3AQQA 3M9BA 1J6QA 4JCVE 1KRTA 4DV0Q 1IBKQ 4JI3Q 2F4VL 2YTVA 3M4QA 1WOCA 1XTDA 3E9IA 5M3MG 2R92G 1PH3A 3S16H 4DK6C 1X54A 1YJ9A 1S72A 3PF4A 3BZKA 3I55A 4HJ7A 4HJ5A 3KDFB 3W5OA 3CCMA 4L5SA 3HOYG 2JE6I 1N9WA 3I4NG 3K80C 1Q7YC 3KLWA 2WB1E 4C3IH 1KD1C 2VUMH 5LMNW 3M7NA 2ZJRA 4JG2A 4POFA 3CC7A 1OTCA 4DR7L 4A3BH 4HJAA 1VQNA 2UUAL 3BJUA 4J15A 2IT1A 4HIDA 1XMQL 1SR3A 4B3TL 2UXCQ 2E8GA 3CPFA 3CMAA 4LF4L 4IPCA 3M4OH 2AWNA 3PF5A 4JOIA 3W1GA 3PUXA 1KAWA 5GROA 2IX0A 3MXNB 4GN4B 4IPDA 5JEAG 4LFCQ 2E2JH 1A63A 3J80c 1K8GA 5C0XJ 1PH4A 2R7ZH 5JEAJ 2CWAA 1CSPA 4HIMA 4LW1A 3TRZA 5FLMH 2Q2IA 3HKZG 4DR7Q 3GTOH 4HJ8A 4IFDG 5C44H 3F2CA 4DR3Q 2Y0SE 3J81i 3T1HQ 3S2DH 4KHPQ 4DV2L 4KI0A 4LFBL 3PUWA 1LUZA 3OYYA 4A3CH 1MJCA 1L1OA 1I3QH 3CC4A 3S1RH 3RN2A 2JA7H 4NB3A 3CF5A 2D62A 1IBLL 1KRSA 3H3VI 5M3FH 4DNIA 5FLXc 1Q82C 4A3KG 4DV3L 4LNQA 3M3YH 1E7ZA 1B8AA 4A3IG 1YJWA 3MEFA 1PYBA 2RCNA 2YTYA 3STBC 1VQ4A 4A93G 2OQKA 1WFQA 3KYHC 1LYLA 1H95A 3DLLA 1UE6A 4X65L 4JI4Q 1X55A 3U50C 1YI2A 2H5XA 2JA5G 1XJVA 2JA5H 3CD6A 1SROA 2UUCL 1X9NA 4A3EH 5H1SE 1Q1BA 2KHJA 1HR0Q 2NZHA 1Q46A 1IYJB 1NBWA 1UEBA 1XMQQ 1QZHA 4BY7H 3CW2C 1P8LA 1SLJA 2GN5A 1WJJA 3GDEA 4OO1I 4QJFA 5IT9c 3J81j 2VZAA 4JI6Q 2UXBQ 3L7ZC 1TWFH 1PV4A 1KIXA 2GVAA 4P71A 3ULLA 5LMUQ 2CWPA 4DV1Q 4LF6Q 2N49A 3I4MG 1EUJA 3S1NH 3PUZA 3CXCA 1CUKA 5AJ3Q 1MJEA 4LF5L 3GTGH 4BBSG 4YCWA 1VQ9A 2AKWB 2NN6G 1IL2A 2CQOA 3BZCA 1YHQA 3CCJA 1Q1EA 1W2BA 2UU9Q 1T9HA 2V1CC 4A76A 5IWAL 4DV4Q 2PI2A 4QL5A 1VQJA 1Y14B 3VDYA 1J5EL 2D0OA 4P75A 2E5LQ 2R7FA 3KOJA 4YCVA 4DAYB 1JJGA 3E9HA 1XMOL 1HH2P 2RHQB 5JJKA 2JK8A 5IYDG 1L0WA 2K5HA 4NXNL 4B3SL 2WP8J 4IFDJ 3H0GH 4EX5A 1C0AA 2A19A 2GVBA 3K81C 4TVAB 3TS0A 4JOIC 1OXTA 4DR1Q 1NY4A 1YITA 4HIKA 2R92H 1VQFA 2NVYH 1V43A 2PI2E 1LTLA 4AH6A 2OQ0A 2PNHA 4JI2Q 1A0IA 1R9TH 1OXVA 2F4VQ 5M5XH 3GTQH 4BBSH 4OX9Q 4P72A 3G6EA 4HIOA 2N8NA 1VQ7A 3HOVH 3S1QH 2F3IA 3RLFA 1KL9A 2ES2A 1HZCA 4YWMA 4BY1H 3PIOA 4B3MQ 1FGUA 1Q8KA 1E1OA 3PO2G 3PO2H 2HT1A 4QIWE 4NXML 1HNXQ 1WI5A 1N36L 4YWKA 3S2HH 3HOVG 4FDBA 5GQOA 1TXYA 3H3VH 1M1KC 2K50A 1HR0W 2UU9L 2B3GA 4P74A 3H15A 4X64Q 4GKJL 3W1BA 5IY0A 1PH5A 1VQ8A 4GS3A 1EOVA 4A3LH 3JAMc 4GN5A 1PVOA 1HZBA 1QUQB 4DAMA 4B3ML 2WAQE 3PGZA 2AWOA 4DR2L 3PO3G 1N8RC 1P16A 1OXXK 3GTMH 4ME3A 2IY5B 4YY3Q 1YNXA 2Y0SG 3BU2A 2C35B 1W3SA 4K0KL 5IYCH 4C3HH 5DLQE 2CFMA 3HFZB 4PG3A 4QY7A 1C7YA 4A3KH 4A3FG 4JI8Q 2PQAB 3OTOL 4DR1L 1YJNA 2RF4A 4JI7Q 2UUBL 3AFQA 1HNZQ 1JMCA 4WJ4A 4MTNA 3J7A5 2OTLA 1AE2A 3RLNA 2ZJPA 4LUOA 3GTPH 4DV1L 1DGSA 2OCEA 4LF6L 3HOUH 4WJ3M 5J3BA 2KHIA 1SFOH 1TWCH 2YV5A 1XNRQ 4LF8Q 4AYBG 4BXXH 5LMNL 2UXDQ 2JQOA 4DUYQ 4AQYL 1Z9FA 4PZ8A 2VQFL 1NMFA 3CC2A 5IYBG 5IYBH 5IWAQ 3F2BA 4NPSA 2YTXA 3STBD 1FL0A 5IP9G 4X62L 3OTOQ 4DV4L 2I5LX 4A3FH 3IRBA 4PMWA 3T1HL 1QVFA 1SE8A 2RHSB 4LFBQ 4DR5Q 3F1ZA 5C0XI 3J81c 4DV0L 2YYZA 1K73C 3K7UC 3NELA 4EQ5A 1SN8A 3U4ZA 4X6AH 4DR2Q 4A3EG 1BVSA 4X66L 3JAMi 1KXLA 2I5HA 2N78A 3HKZE 2I5MX 4DUZL 1NMGA 3A5UA 1EIFA 1L2FA 3GD7A 1D8LA 3L2PA 4JI1Q 3EN2A 4DV6Q 2JEAI 3S14H 5FJ8G 2ZM6Q 2HIVA 1TWHH 3NBHB 1ASZA 1S40A 1M90C 3HOZH 5IE8A 3T1YQ 1PH1A 2Q2UA 1NTGA 1Z47A 3NEMA 1QVCA 1K83H 1EYGA 1QUQA 1K8AC 2MNAA 3PO3H 3CQZH 3CCUA 4LF9Q 2QGQA 1J5EQ 4JI4L 2K75A 4YWLA 1N33Q 2EIFA 2Z0SA 4OWXB 2QA4A 3CCRA 1A62A 5IP7G 1VQLA 2WB1G 3FP9A 3CCEA 4A75A 1XNQQ 5M3FG 2XTIA 1LM0A 4DV6L 2NVTH 3G4SA 5ELOA 1NE3A 3GTLH 1YVCA 1Y1WH 4OONA 3FHWA 3RR5A 4A3DG 2KCTA 4O0AA 4A3JG 1A8VA 1WCMG 3HOXG 4APVA 3TS2A 3H0GG 4B3TQ 2DGYA 1VCIA 2A1AA 4LF9L 4IFDI 1Y1VG 1X6OA 1AH9A 4GNXC 4A3MG 2KCMA 2JA8G 2HQLA 2PMZE 2R93H 2XGTA 3ER0A 4O2DA 4DV3Q 2EXDA 4P73A 1V1QA 5FJ8H 1VQCA 1X56A 3UDXA 1JB7A 4JI0L 1YEZA 3D31A 4OX9L 3HOWG 1JJ2A 1BBUA 4LFAL 4A3BG 4A3GG 3UDFA 1VQDA 3PIPA 2K4KA 4MZ9A 1L1OB 4TQUS 1CKOA 1YHBA 2HHHQ 1PH9A 3U58A 2ZTDA 4DV7Q 3I4NH 2B29A 3DM3A 3PV0A 3UE1A 5IP9H 4RG1A 3K8AA 4GNXA 4A3CG 4XTCS 2UUBQ 4KHPL 4A4IA 2VNUD 1Y1WG 1PH7A 2YU9H 2ATWA 2UXCL 4B3SQ 3M85A 1K3RA 1IBKL 4NXNQ 1VQ5A 3KF6A 5GAGC 3CMEA 4B3RQ 1X65A 1EQRA 4NXMQ 4BBRG 3EIVA 5C4XG 1WCMH 3HOXH 1D7QA 1S3OA 3EBEA 2FXQA 4DK3C 4A3DH 2HHHL 3PUYA 5GADC 1G6PA 2WAQG 4L5TA 4LF4Q 2VQFQ 1X3EA 1VQGA 2R6GA 1B70B 3NENA 2ID0A 3HOUG 3HOZG 4BA1I 1KQSA 4KLKA 4LF5Q 1Y1VH 4GNXB 1E24A 2VS1A 3L0OA 2N3SA 2NZOA 1TWAH 5LMUL 1JE5A 3I4OA 1PH6A 2IHEA 3RZDH 1Q81C 2QEXA 2MQHA 2NN6I 3AFPA 4X64L 4OXPA 4R4QA 2KBNA 4A3IH 2VW9A 1XPOA 1QZGA 1XPUA 2NVXH 5IYCG 4R4OA 3TQYA 1HJPA 3CCLA 3GO5A 3PCOB 3S1MH 4GLVB 2ZM6L 5ELNA 2PQAA 4LWCA 4JYAL 1QVGA 4DR6Q 4YY3L 2E5LL 2JA6G 2R7DA 1VS0A 1EWIA 1RIPA 3RZOH 4DV5L 3UDIA 2IHFA 4X65Q 4JBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2T A;  2VQE Q;  3I7F A;  5IYD H;  3Q8D A;  2JA9 A;  1OXU A;  4OWT B;  2E2H H;  2BA1 A;  1KC8 C;  2R7Z G;  3ERS X;  1XMO Q;  3AYH B;  1UE5 A;  3LGJ A;  1IBM L;  1I94 L;  4JI8 L;  2EQS A;  2JA7 G;  1K9M C;  3RNU A;  3B6Y A;  3G71 A;  4GLA C;  4JI5 L;  1JT8 A;  3SGI A;  1VQK A;  4LF7 L;  2DUD A;  4BBR H;  5C4X H;  4DUY L;  4AQY Q;  1MIU A;  1XNR L;  5LMN Q;  2B63 H;  3J80 i;  1PFS A;  5JJL A;  2ASB A;  4A3M H;  2JA8 H;  3CP0 A;  3KF8 B;  5HY6 A;  3CCQ A;  1FJG Q;  4JBJ A;  3I56 A;  4X62 Q;  1K0R A;  1GO3 E;  4JC0 A;  4A3J H;  2CKZ B;  4DKA C;  3RN5 A;  3KJP A;  2BA0 A;  3S17 H;  1VQM A;  4AYB E;  3AEV A;  1IBM Q;  1VQO A;  3KFU A;  4GKJ Q;  3ICE A;  1G51 A;  2KEN A;  2E2I H;  1CSQ A;  1VQ6 A;  2MO0 A;  1EIY B;  2MFI A;  2UUA Q;  3HOW H;  4A3G H;  4K0K Q;  1YBY A;  3WWV A;  2A8V A;  1HNX L;  4BY7 G;  4IOA A;  1CKM A;  3A0J A;  1E3P A;  1BBW A;  5BR8 L;  3JC6 6;  5E7N A;  5HGQ A;  4YHH Q;  3F8T A;  4IOC A;  1TWG H;  3OW2 A;  1JJC B;  4KHZ A;  4GLX A;  1BKB A;  5C3E G;  1HZ9 A;  1RL2 A;  1U5K A;  1YHA A;  2AHO B;  3K7A H;  5C3E H;  3KJO A;  1UE7 A;  3A74 A;  2F52 A;  2D0P A;  3HOY H;  1PH2 A;  4IJL A;  1B7Y B;  1PHJ A;  2LSS A;  1N34 Q;  4UY8 C;  5M3M H;  4IJH A;  1SRU A;  1MKH A;  1FVI A;  4MNO A;  2WFW A;  3I4M H;  2HIX A;  4DPG A;  1GM5 A;  1HR0 L;  5JJI A;  5IP7 H;  3UE0 A;  3ULP A;  3CAM A;  3KF6 B;  1EQQ A;  1E1T A;  1ASY A;  4L5R C;  3RLO A;  4BA2 I;  1GVP A;  4LUV A;  1VQI A;  2K5V A;  4DV7 L;  5GAE C;  2ZTE A;  4BY1 G;  4C2M H;  2NVQ H;  4YHH L;  3S24 A;  4POG A;  4OO1 G;  1HZA A;  1UE1 A;  3FKI G;  3HKS A;  4JYA Q;  1EFW A;  4DR5 L;  1CKN A;  1Q86 C;  3CCS A;  3S15 H;  1N34 L;  5K36 G;  1PA6 A;  4JI2 L;  4B3R L;  1N36 Q;  4XIG S;  1WYD A;  2B63 G;  2ALY B;  4R4T A;  1VQE A;  1GD7 A;  4H02 A;  1N32 L;  4LFC L;  4JBW A;  4DUZ Q;  2Z6K C;  2UUC Q;  1KHI A;  5C0X G;  1IXR A;  2LXK A;  4BXX G;  4IPH A;  1XPR A;  2VL6 A;  3KDF A;  3ULJ A;  4AIM A;  4C3J H;  4GOP C;  1GKH A;  1O7I A;  2K52 A;  3TEH B;  4GKK L;  2VQE L;  1AE3 A;  1I50 H;  1VQA A;  4JV5 L;  3UDG A;  2JEB I;  2Q2H A;  2VUM G;  4JI5 Q;  3CPW A;  4JI6 L;  4LF7 Q;  2UXB L;  1X3F A;  4GOP A;  1IBL Q;  4QGU A;  2IX1 A;  1N32 Q;  1V9P A;  1I94 Q;  1YZ6 A;  4PZ6 A;  5C44 G;  1I5F A;  4GN3 B;  4Y7N H;  4DV2 Q;  4LF8 L;  1FJG L;  1I6H H;  2UXD L;  4IPG A;  1VQB A;  4RMF A;  5FLM G;  2K5N A;  5AJ3 L;  2I0Q A;  1YIJ A;  1XNQ L;  1OXS C;  3ZJY C;  2ZTC A;  4UPA A;  2MO1 A;  4JV5 Q;  3GTJ H;  3TRE A;  3GTK H;  4GKK Q;  4R4I A;  2R93 G;  1E22 A;  1N33 L;  3U4V A;  3PSI A;  4UP7 A;  4DR4 Q;  1HNW L;  4QQB X;  1HNZ L;  4IO9 A;  4DV5 Q;  2ZJQ A;  4R4C A;  4JI7 L;  4Y52 H;  3G48 A;  5M5W H;  1PH8 A;  1SMX A;  2JA6 H;  5C4J H;  3K0X A;  3D0F A;  1NJI C;  3PUV A;  2LXJ A;  4JI3 L;  4YCU A;  5EAY A;  4UP8 A;  4DR6 L;  3E0E A;  2K14 A;  5GAH C;  4PZ7 A;  1IZ6 A;  2OTJ A;  3I2Z A;  4LFA Q;  5M5Y H;  4GOP B;  4JI0 Q;  4R1J A;  4UP9 A;  1PYS B;  1UWV A;  3FKI H;  4JI1 L;  4OWW B;  2Z6K A;  1VQP A;  4HJ9 A;  1Q12 A;  2CCZ A;  2BH8 A;  3M4P A;  1U0L A;  5BR8 Q;  4L5Q A;  3J7Z C;  3CCV A;  4DR3 L;  2OWO A;  4A93 H;  1C9O A;  1L1O C;  3A5Z B;  4LUZ A;  1CKN B;  2AMC B;  3T1Y L;  2BH2 A;  4DR4 L;  1VQH A;  4X66 Q;  1HNW Q;  2L15 A;  3F2D A;  4ALP A;  4JBM A;  1X3G A;  2JJQ A;  2VY3 A;  4A3L G;  1G29 1;  3AQQ A;  3M9B A;  1J6Q A;  4JCV E;  1KRT A;  4DV0 Q;  1IBK Q;  4JI3 Q;  2F4V L;  2YTV A;  3M4Q A;  1WOC A;  1XTD A;  3E9I A;  5M3M G;  2R92 G;  1PH3 A;  3S16 H;  4DK6 C;  1X54 A;  1YJ9 A;  1S72 A;  3PF4 A;  3BZK A;  3I55 A;  4HJ7 A;  4HJ5 A;  3KDF B;  3W5O A;  3CCM A;  4L5S A;  3HOY G;  2JE6 I;  1N9W A;  3I4N G;  3K80 C;  1Q7Y C;  3KLW A;  2WB1 E;  4C3I H;  1KD1 C;  2VUM H;  5LMN W;  3M7N A;  2ZJR A;  4JG2 A;  4POF A;  3CC7 A;  1OTC A;  4DR7 L;  4A3B H;  4HJA A;  1VQN A;  2UUA L;  3BJU A;  4J15 A;  2IT1 A;  4HID A;  1XMQ L;  1SR3 A;  4B3T L;  2UXC Q;  2E8G A;  3CPF A;  3CMA A;  4LF4 L;  4IPC A;  3M4O H;  2AWN A;  3PF5 A;  4JOI A;  3W1G A;  3PUX A;  1KAW A;  5GRO A;  2IX0 A;  3MXN B;  4GN4 B;  4IPD A;  5JEA G;  4LFC Q;  2E2J H;  1A63 A;  3J80 c;  1K8G A;  5C0X J;  1PH4 A;  2R7Z H;  5JEA J;  2CWA A;  1CSP A;  4HIM A;  4LW1 A;  3TRZ A;  5FLM H;  2Q2I A;  3HKZ G;  4DR7 Q;  3GTO H;  4HJ8 A;  4IFD G;  5C44 H;  3F2C A;  4DR3 Q;  2Y0S E;  3J81 i;  3T1H Q;  3S2D H;  4KHP Q;  4DV2 L;  4KI0 A;  4LFB L;  3PUW A;  1LUZ A;  3OYY A;  4A3C H;  1MJC A;  1L1O A;  1I3Q H;  3CC4 A;  3S1R H;  3RN2 A;  2JA7 H;  4NB3 A;  3CF5 A;  2D62 A;  1IBL L;  1KRS A;  3H3V I;  5M3F H;  4DNI A;  5FLX c;  1Q82 C;  4A3K G;  4DV3 L;  4LNQ A;  3M3Y H;  1E7Z A;  1B8A A;  4A3I G;  1YJW A;  3MEF A;  1PYB A;  2RCN A;  2YTY A;  3STB C;  1VQ4 A;  4A93 G;  2OQK A;  1WFQ A;  3KYH C;  1LYL A;  1H95 A;  3DLL A;  1UE6 A;  4X65 L;  4JI4 Q;  1X55 A;  3U50 C;  1YI2 A;  2H5X A;  2JA5 G;  1XJV A;  2JA5 H;  3CD6 A;  1SRO A;  2UUC L;  1X9N A;  4A3E H;  5H1S E;  1Q1B A;  2KHJ A;  1HR0 Q;  2NZH A;  1Q46 A;  1IYJ B;  1NBW A;  1UEB A;  1XMQ Q;  1QZH A;  4BY7 H;  3CW2 C;  1P8L A;  1SLJ A;  2GN5 A;  1WJJ A;  3GDE A;  4OO1 I;  4QJF A;  5IT9 c;  3J81 j;  2VZA A;  4JI6 Q;  2UXB Q;  3L7Z C;  1TWF H;  1PV4 A;  1KIX A;  2GVA A;  4P71 A;  3ULL A;  5LMU Q;  2CWP A;  4DV1 Q;  4LF6 Q;  2N49 A;  3I4M G;  1EUJ A;  3S1N H;  3PUZ A;  3CXC A;  1CUK A;  5AJ3 Q;  1MJE A;  4LF5 L;  3GTG H;  4BBS G;  4YCW A;  1VQ9 A;  2AKW B;  2NN6 G;  1IL2 A;  2CQO A;  3BZC A;  1YHQ A;  3CCJ A;  1Q1E A;  1W2B A;  2UU9 Q;  1T9H A;  2V1C C;  4A76 A;  5IWA L;  4DV4 Q;  2PI2 A;  4QL5 A;  1VQJ A;  1Y14 B;  3VDY A;  1J5E L;  2D0O A;  4P75 A;  2E5L Q;  2R7F A;  3KOJ A;  4YCV A;  4DAY B;  1JJG A;  3E9H A;  1XMO L;  1HH2 P;  2RHQ B;  5JJK A;  2JK8 A;  5IYD G;  1L0W A;  2K5H A;  4NXN L;  4B3S L;  2WP8 J;  4IFD J;  3H0G H;  4EX5 A;  1C0A A;  2A19 A;  2GVB A;  3K81 C;  4TVA B;  3TS0 A;  4JOI C;  1OXT A;  4DR1 Q;  1NY4 A;  1YIT A;  4HIK A;  2R92 H;  1VQF A;  2NVY H;  1V43 A;  2PI2 E;  1LTL A;  4AH6 A;  2OQ0 A;  2PNH A;  4JI2 Q;  1A0I A;  1R9T H;  1OXV A;  2F4V Q;  5M5X H;  3GTQ H;  4BBS H;  4OX9 Q;  4P72 A;  3G6E A;  4HIO A;  2N8N A;  1VQ7 A;  3HOV H;  3S1Q H;  2F3I A;  3RLF A;  1KL9 A;  2ES2 A;  1HZC A;  4YWM A;  4BY1 H;  3PIO A;  4B3M Q;  1FGU A;  1Q8K A;  1E1O A;  3PO2 G;  3PO2 H;  2HT1 A;  4QIW E;  4NXM L;  1HNX Q;  1WI5 A;  1N36 L;  4YWK A;  3S2H H;  3HOV G;  4FDB A;  5GQO A;  1TXY A;  3H3V H;  1M1K C;  2K50 A;  1HR0 W;  2UU9 L;  2B3G A;  4P74 A;  3H15 A;  4X64 Q;  4GKJ L;  3W1B A;  5IY0 A;  1PH5 A;  1VQ8 A;  4GS3 A;  1EOV A;  4A3L H;  3JAM c;  4GN5 A;  1PVO A;  1HZB A;  1QUQ B;  4DAM A;  4B3M L;  2WAQ E;  3PGZ A;  2AWO A;  4DR2 L;  3PO3 G;  1N8R C;  1P16 A;  1OXX K;  3GTM H;  4ME3 A;  2IY5 B;  4YY3 Q;  1YNX A;  2Y0S G;  3BU2 A;  2C35 B;  1W3S A;  4K0K L;  5IYC H;  4C3H H;  5DLQ E;  2CFM A;  3HFZ B;  4PG3 A;  4QY7 A;  1C7Y A;  4A3K H;  4A3F G;  4JI8 Q;  2PQA B;  3OTO L;  4DR1 L;  1YJN A;  2RF4 A;  4JI7 Q;  2UUB L;  3AFQ A;  1HNZ Q;  1JMC A;  4WJ4 A;  4MTN A;  3J7A 5;  2OTL A;  1AE2 A;  3RLN A;  2ZJP A;  4LUO A;  3GTP H;  4DV1 L;  1DGS A;  2OCE A;  4LF6 L;  3HOU H;  4WJ3 M;  5J3B A;  2KHI A;  1SFO H;  1TWC H;  2YV5 A;  1XNR Q;  4LF8 Q;  4AYB G;  4BXX H;  5LMN L;  2UXD Q;  2JQO A;  4DUY Q;  4AQY L;  1Z9F A;  4PZ8 A;  2VQF L;  1NMF A;  3CC2 A;  5IYB G;  5IYB H;  5IWA Q;  3F2B A;  4NPS A;  2YTX A;  3STB D;  1FL0 A;  5IP9 G;  4X62 L;  3OTO Q;  4DV4 L;  2I5L X;  4A3F H;  3IRB A;  4PMW A;  3T1H L;  1QVF A;  1SE8 A;  2RHS B;  4LFB Q;  4DR5 Q;  3F1Z A;  5C0X I;  3J81 c;  4DV0 L;  2YYZ A;  1K73 C;  3K7U C;  3NEL A;  4EQ5 A;  1SN8 A;  3U4Z A;  4X6A H;  4DR2 Q;  4A3E G;  1BVS A;  4X66 L;  3JAM i;  1KXL A;  2I5H A;  2N78 A;  3HKZ E;  2I5M X;  4DUZ L;  1NMG A;  3A5U A;  1EIF A;  1L2F A;  3GD7 A;  1D8L A;  3L2P A;  4JI1 Q;  3EN2 A;  4DV6 Q;  2JEA I;  3S14 H;  5FJ8 G;  2ZM6 Q;  2HIV A;  1TWH H;  3NBH B;  1ASZ A;  1S40 A;  1M90 C;  3HOZ H;  5IE8 A;  3T1Y Q;  1PH1 A;  2Q2U A;  1NTG A;  1Z47 A;  3NEM A;  1QVC A;  1K83 H;  1EYG A;  1QUQ A;  1K8A C;  2MNA A;  3PO3 H;  3CQZ H;  3CCU A;  4LF9 Q;  2QGQ A;  1J5E Q;  4JI4 L;  2K75 A;  4YWL A;  1N33 Q;  2EIF A;  2Z0S A;  4OWX B;  2QA4 A;  3CCR A;  1A62 A;  5IP7 G;  1VQL A;  2WB1 G;  3FP9 A;  3CCE A;  4A75 A;  1XNQ Q;  5M3F G;  2XTI A;  1LM0 A;  4DV6 L;  2NVT H;  3G4S A;  5ELO A;  1NE3 A;  3GTL H;  1YVC A;  1Y1W H;  4OON A;  3FHW A;  3RR5 A;  4A3D G;  2KCT A;  4O0A A;  4A3J G;  1A8V A;  1WCM G;  3HOX G;  4APV A;  3TS2 A;  3H0G G;  4B3T Q;  2DGY A;  1VCI A;  2A1A A;  4LF9 L;  4IFD I;  1Y1V G;  1X6O A;  1AH9 A;  4GNX C;  4A3M G;  2KCM A;  2JA8 G;  2HQL A;  2PMZ E;  2R93 H;  2XGT A;  3ER0 A;  4O2D A;  4DV3 Q;  2EXD A;  4P73 A;  1V1Q A;  5FJ8 H;  1VQC A;  1X56 A;  3UDX A;  1JB7 A;  4JI0 L;  1YEZ A;  3D31 A;  4OX9 L;  3HOW G;  1JJ2 A;  1BBU A;  4LFA L;  4A3B G;  4A3G G;  3UDF A;  1VQD A;  3PIP A;  2K4K A;  4MZ9 A;  1L1O B;  4TQU S;  1CKO A;  1YHB A;  2HHH Q;  1PH9 A;  3U58 A;  2ZTD A;  4DV7 Q;  3I4N H;  2B29 A;  3DM3 A;  3PV0 A;  3UE1 A;  5IP9 H;  4RG1 A;  3K8A A;  4GNX A;  4A3C G;  4XTC S;  2UUB Q;  4KHP L;  4A4I A;  2VNU D;  1Y1W G;  1PH7 A;  2YU9 H;  2ATW A;  2UXC L;  4B3S Q;  3M85 A;  1K3R A;  1IBK L;  4NXN Q;  1VQ5 A;  3KF6 A;  5GAG C;  3CME A;  4B3R Q;  1X65 A;  1EQR A;  4NXM Q;  4BBR G;  3EIV A;  5C4X G;  1WCM H;  3HOX H;  1D7Q A;  1S3O A;  3EBE A;  2FXQ A;  4DK3 C;  4A3D H;  2HHH L;  3PUY A;  5GAD C;  1G6P A;  2WAQ G;  4L5T A;  4LF4 Q;  2VQF Q;  1X3E A;  1VQG A;  2R6G A;  1B70 B;  3NEN A;  2ID0 A;  3HOU G;  3HOZ G;  4BA1 I;  1KQS A;  4KLK A;  4LF5 Q;  1Y1V H;  4GNX B;  1E24 A;  2VS1 A;  3L0O A;  2N3S A;  2NZO A;  1TWA H;  5LMU L;  1JE5 A;  3I4O A;  1PH6 A;  2IHE A;  3RZD H;  1Q81 C;  2QEX A;  2MQH A;  2NN6 I;  3AFP A;  4X64 L;  4OXP A;  4R4Q A;  2KBN A;  4A3I H;  2VW9 A;  1XPO A;  1QZG A;  1XPU A;  2NVX H;  5IYC G;  4R4O A;  3TQY A;  1HJP A;  3CCL A;  3GO5 A;  3PCO B;  3S1M H;  4GLV B;  2ZM6 L;  5ELN A;  2PQA A;  4LWC A;  4JYA L;  1QVG A;  4DR6 Q;  4YY3 L;  2E5L L;  2JA6 G;  2R7D A;  1VS0 A;  1EWI A;  1RIP A;  3RZO H;  4DV5 L;  3UDI A;  2IHF A;  4X65 Q;  4JBK A; 
#chains in the Genus database with same CATH topology
 2Q2T A;  2VQE Q;  4HCS A;  2A6E D;  4FVM A;  4DXF A;  5G3L D;  1AZP A;  3S14 B;  3ERS X;  2B39 A;  2K33 A;  4HMI A;  1S4Z A;  4JI8 L;  3Q6S A;  2EQS A;  4I65 A;  4BWG B;  2JA7 G;  3RNU A;  1F9Q A;  1JT8 A;  1VQK A;  4LF7 L;  5C4X H;  1HPC A;  5LMN Q;  2EY2 A;  1PFS A;  2ASB A;  1ROD A;  2JA8 H;  3CP0 A;  3CCQ A;  4A3J H;  2CKZ B;  3RN5 A;  4A3E B;  1IBM Q;  4TSS A;  1TU2 B;  5IIF A;  1TS2 A;  2KEN A;  1EIY B;  4K0K Q;  2CH4 W;  2DN8 A;  1U4R A;  5KYL A;  3A7A B;  5BR8 L;  5HGQ A;  3F8T A;  1SAP A;  2OEO A;  1STH A;  1RL2 A;  2AHO B;  2DY7 A;  3HOY H;  1UE7 A;  2F52 A;  2D0P A;  4OEL B;  2LSS A;  1N34 Q;  1VMC A;  2OXP A;  1HUN A;  4N9P A;  5JJI A;  3UE0 A;  3CAM A;  1EQQ A;  1ASY A;  1GVP A;  4LUV A;  5GAE C;  4BY1 G;  2E2J B;  4ME5 A;  3S24 A;  1HZA A;  3R2I A;  1EFW A;  5E4W C;  2X6G A;  3CCS A;  1CK1 A;  1N34 L;  2ZT9 C;  3GTO B;  3S15 H;  2NTS A;  3MXG A;  4ZLT F;  1AEX A;  4G7H C;  1WYD A;  4C1N I;  4ZKC B;  2B63 G;  1HFN A;  1GD7 A;  1MSH A;  1N32 L;  1IW7 C;  2WIN B;  4IUP A;  4JBW A;  3KLR A;  1KHI A;  4B9X A;  4BXX G;  3ULJ A;  3I73 A;  4AIM A;  4GOP C;  1SYB A;  2K52 A;  1TKW B;  4GKK L;  1AE3 A;  4A3I B;  1VQA A;  4JV5 L;  3R3O A;  2NVX B;  2UXB L;  4LF7 Q;  3GTL B;  3PO2 B;  1WTO A;  2LFN A;  2JP1 A;  2IX1 A;  1N32 Q;  1I94 Q;  1U4P A;  1CHQ D;  1I5F A;  4IFD H;  3T4A C;  4ZQ3 A;  2K5N A;  5AJ3 L;  1DOL A;  4UPA A;  4JV5 Q;  4GKK Q;  4R4I A;  1PYW D;  2A5H A;  5ELC A;  4UP7 A;  1FD7 D;  4IO9 A;  4CJ1 B;  5M5W H;  3NTH A;  1CM9 A;  5C4J H;  3K0X A;  4J1M A;  1NJI C;  4JI3 L;  3GTG B;  4PZ7 A;  1IZ6 A;  4CKE A;  1Y69 U;  2I07 B;  1B9N A;  4UP9 A;  1A15 A;  3FKI H;  3LX0 A;  1SNO A;  1CZW A;  3HOX B;  2OT2 A;  3QIA A;  3SEB A;  4L5Q A;  2RSN A;  4K5X A;  2AMC B;  3T1Y L;  4DR4 L;  2QDL A;  4X66 Q;  2KEE A;  4A3L G;  3HKZ B;  1X3G A;  1QG7 A;  2VY3 A;  1O7Y A;  1F2Z A;  4UDU C;  4DV0 Q;  1ET9 A;  1HRJ A;  1BNZ A;  1F77 A;  1PTO D;  1ENC A;  3QOJ A;  3CCM A;  1FNW A;  1FNV A;  3NE5 B;  3KBG A;  1IHZ A;  5LMN W;  2ZJR A;  4JG2 A;  2D2C C;  1LTG D;  2NYZ D;  4HJA A;  1VQN A;  3BJU A;  4HID A;  2E8G A;  1XWE A;  4LF4 L;  4IPC A;  3M4O H;  2AWN A;  2F0Q A;  1EQT A;  1U4M A;  1KLG D;  3W1G A;  3RZO B;  4ID6 A;  5FKA C;  3MXN B;  2F0L A;  1Z6H A;  2NVQ B;  1DZ1 A;  1RTO A;  1PH4 A;  4C1N K;  3D4R A;  3TRZ A;  3ERO A;  1EIH A;  2B2Y C;  4MHE A;  2A68 C;  4HJ8 A;  4A3L H;  2Y0S E;  3J81 i;  1JWM D;  3PUW A;  2VB2 X;  3CC4 A;  2JA7 H;  1D2B A;  3MXU A;  3CF5 A;  1U4L A;  3G6J B;  4DNI A;  5M3F H;  3HP3 A;  1Q82 C;  4DV3 L;  3M3Y H;  3TME A;  1EU4 A;  1B8A A;  2PNR C;  3OIP A;  1I50 B;  2RCN A;  2MPM A;  2YTY A;  1II3 A;  4XQN A;  3DLL A;  4RGO S;  1UE6 A;  1I6V C;  4K6L A;  5EBD A;  1XJV A;  1SRO A;  4IUR A;  2MGS A;  3T51 B;  2UUC L;  4A3E H;  1STG A;  5H1S E;  1SYE A;  1CFM A;  1I6H B;  1QZH A;  3I90 A;  1BCP F;  3CW2 C;  3TP7 A;  1TT2 A;  3GDE A;  1CA5 A;  4OO1 I;  3J81 j;  5DEH A;  1B2T A;  1PV4 A;  2XNA C;  1PRT F;  1KIX A;  2IWH A;  1RJT A;  2XRQ D;  1EUJ A;  3E6Z X;  3CXC A;  5AJ3 Q;  4BBS G;  2D5D A;  4ULL A;  4YCW A;  2AKW B;  4M1U B;  1YHQ A;  1W2B A;  3CCJ A;  1Q1E A;  1T9H A;  4A76 A;  4NP5 A;  2AQ3 B;  1B4O A;  4RAU C;  1UAP A;  3V2T A;  1XMO L;  1HH2 P;  4I7A A;  3K58 A;  3BYT B;  3U9O A;  1TWA B;  4B3S L;  5IGF A;  1E2W A;  2WP8 J;  4IFD J;  3DUZ A;  2A19 A;  4HTH A;  3C46 A;  1NY4 A;  3J80 L;  1YIT A;  3NPP A;  2PI2 E;  1GUT A;  2OQ0 A;  4KKS A;  3A8I E;  3GTQ H;  2F4V Q;  2B2T C;  3H94 A;  2O2L D;  2K01 A;  1O7Z A;  1VQ7 A;  2VXW A;  5DNF A;  3PO2 H;  2A68 D;  1EIG A;  3H91 A;  4KD4 A;  1WI5 A;  1JOR A;  2H4O A;  4XDX A;  3H3V H;  1M1K C;  2K50 A;  1HR0 W;  1ZYR C;  2XIW A;  4X64 Q;  4GKJ L;  1QWY A;  4RA8 A;  1G2S A;  4IQZ A;  5IY0 A;  3S2D B;  5CV9 A;  1J8I A;  3DEO A;  3S1R B;  1OXX K;  4ME3 A;  4YY3 Q;  1YNX A;  5C4J B;  4IUU A;  1W3S A;  4K0K L;  5IYC H;  4C3H H;  3HFZ B;  5EBC A;  4A3F G;  5CBA E;  3OTO L;  4DR1 L;  1A2T A;  3S17 B;  3A8J E;  4MTN A;  3J7A 5;  4FF2 A;  1GHJ A;  2E2I B;  1JWS D;  2ZJP A;  1YNN C;  4DV1 L;  4LF6 L;  1EYC A;  2F0I A;  1IW7 D;  2KHI A;  1S5B D;  3P1H A;  4BXX H;  4DUY Q;  2EJM A;  5C3E B;  2VQF L;  1I4R A;  1ONL A;  5IYB G;  5IWA Q;  4DV4 L;  2A6H C;  1TQO A;  4PMW A;  3MAQ A;  1EY7 A;  4FF4 A;  3BS1 A;  5C0X I;  4DV0 L;  2YYZ A;  4PV1 C;  3K7U C;  4OO1 H;  4X66 L;  1KXL A;  3HKZ E;  1QOH A;  1B3Q A;  2JEA I;  3S14 H;  2XN9 C;  3DMU A;  2F0N A;  1RF2 D;  3T1Y Q;  3J7Y W;  1WD1 A;  1BO0 A;  1PH1 A;  4JVZ A;  3A55 A;  4DA2 A;  1EU3 A;  1FYC A;  5C4X B;  4K8J A;  2Z0S A;  5DM7 3;  2QA4 A;  3CCR A;  2K5D A;  1SYC A;  3VA7 A;  3WDN A;  5IP7 G;  5M3F B;  3FP9 A;  3CCE A;  3M3Y B;  4UAI A;  2XTI A;  4DV6 L;  1UEA B;  4OON A;  4HSV A;  1XXG A;  1SEB D;  2QKI C;  2KCT A;  4O0A A;  1WCM G;  2F0G A;  2JA8 G;  2XWB B;  2EXD A;  3KUP A;  4RHR A;  5FJ8 H;  1VQC A;  4JI0 L;  1YEZ A;  4A3G G;  2KJX A;  1O80 A;  1JC7 A;  3H09 A;  1JJ2 A;  4LFA L;  4ODG A;  3UDF A;  4DK0 A;  4EQP A;  4TQU S;  3FEW X;  1H9R A;  1QJO A;  3Q22 A;  2HHH Q;  1HHV A;  4IZ8 A;  3HOY B;  5HUR A;  4A3C G;  5EJW A;  2F0K A;  4BS9 A;  2EYO A;  2H1E A;  1H9J A;  1IYV A;  4NXN Q;  1IBK L;  3CME A;  2XWJ B;  2QW7 A;  5F2D A;  1EQR A;  2XSC A;  4BBR G;  3MTS A;  4HAE A;  1D7Q A;  2WAQ G;  4PMB A;  1LAB A;  2R6G A;  5K5P A;  3EA6 A;  3C1E A;  1KTK A;  2EYJ A;  4GNX B;  3L0O A;  2N3S A;  2NZO A;  1TWA H;  5CV4 A;  1PH6 A;  5KYI A;  4ZYS A;  2QF7 A;  4G57 A;  5C4H A;  3AFP A;  4OXP A;  4A3B B;  2KBN A;  2EDG A;  4A3I H;  2NVX H;  4R4O A;  3A8K E;  1BOS A;  3PCO B;  3S1M H;  3GTQ B;  5ELN A;  1GUN A;  2MP1 A;  1JE4 A;  4DR6 Q;  1KDA A;  4EGV A;  4DV5 L;  4KN4 C;  3OHX C;  4ABN A;  1KDC A;  3NBH A;  3PMF A;  4F88 A;  2JA9 A;  1OXU A;  4OWT B;  1KC8 C;  4YIJ A;  5IGG A;  4H13 C;  4G4K A;  1K9M C;  3CQZ B;  1EQV A;  3B6Y A;  3D4W A;  2KCN A;  3RUZ A;  2PQE A;  5JJL A;  5HY6 A;  1FJG Q;  3FKI B;  4JBJ A;  2SOB A;  3I56 A;  4X62 Q;  5J1Z A;  1VDZ A;  3T16 A;  3S17 H;  1VQM A;  4AYB E;  3AEV A;  1VQO A;  1V1P A;  4H7B A;  1LT5 D;  3ICE A;  2E2I H;  2UUA Q;  3ND9 A;  1YBY A;  4IOA A;  1CKM A;  1BBW A;  4X3U A;  3OW2 A;  4YHH Q;  4L63 B;  2E74 C;  4WJW A;  1JJC B;  4KHZ A;  1F9P A;  4IOC A;  4GLX A;  1F2L A;  5C3E G;  5C3E H;  1PH2 A;  4IJL A;  1B7Y B;  1PHJ A;  4UY8 C;  1ZXT A;  4LMQ D;  4IJH A;  1MHW C;  1FVI A;  3OW7 A;  1W6K A;  1HR0 L;  4DPG A;  4L5R C;  4DV7 L;  4MTK A;  4OL7 A;  2ZTE A;  2NVQ H;  1CKN A;  1D5Z C;  1PA6 A;  1N36 Q;  4XIG S;  1PZJ D;  3H0G B;  1LTI D;  2ALY B;  1VQE A;  4R4T A;  3Q23 A;  2DY8 A;  2JA7 B;  3ZYY X;  1RHP A;  1TY2 A;  3BVG A;  2Z6K C;  3DM1 A;  2CW0 D;  5C0X G;  1DON A;  4V19 0;  1WTR A;  1XPR A;  2VL6 A;  3KDF A;  4C56 C;  1O7I A;  1I50 H;  5EPJ A;  3P20 A;  3SVM A;  2J7Z A;  2VUM G;  4JI5 Q;  3CPW A;  5JVG 3;  3QR8 A;  1IBL Q;  4DGZ A;  4DV2 Q;  4GN3 B;  1I6H H;  4LF8 L;  3O13 A;  4RMF A;  1YIJ A;  1XNQ L;  1OXS C;  3ZJY C;  2HDM A;  2ZTC A;  3TRE A;  1KLU D;  3GTK H;  1LT4 D;  3U4V A;  2MJ8 A;  3PSI A;  4QQB X;  1JIC A;  1MSG A;  1SMX A;  5EPL A;  3MHB A;  1F2Y A;  4N8X 1;  2CW0 C;  4YCU A;  5EAY A;  2B63 B;  3E0E A;  5ELE A;  2OTJ A;  4LFA Q;  4A3K B;  4JI0 Q;  4A3M B;  2LS0 1;  1PYS B;  1QIL A;  4JI1 L;  1A6X A;  4OWW B;  4FF3 A;  2B2U C;  1Q12 A;  3CCV A;  5CV7 A;  1T5X D;  1S5C D;  1VQH A;  4N9T A;  2JJQ A;  1G29 1;  3AQQ A;  3DEP A;  3N52 A;  4JCV E;  2B2W A;  2B2V A;  3M9B A;  5I6W A;  2L12 A;  2YTV A;  4WRD A;  1NNX A;  2QDB A;  2R92 G;  1HA6 A;  2F4I A;  1YJ9 A;  5A2Q L;  3I55 A;  3W5O A;  2QIL A;  2Q8R E;  4L5S A;  1D1K A;  1Q7Y C;  3KLW A;  3K7A B;  4C3I H;  4POF A;  1OTC A;  4A3B H;  1RCV D;  4R9W A;  2UUA L;  4NW2 A;  4J15 A;  4B3T L;  2F0M A;  3S1M B;  2UXC Q;  3PF5 A;  3OOC A;  1IL8 A;  4CGY B;  1BXT A;  5DAU A;  1KAW A;  4C2M B;  5JEA J;  2PYK A;  3FPU B;  1CSP A;  1D5M C;  2Q2I A;  4DR7 Q;  1PLF A;  1T5E A;  4KHP Q;  3S2D H;  4CDD C;  3T1H Q;  4JW0 A;  4DV2 L;  4KI0 A;  5LL6 S;  4A3C H;  2IX3 A;  2I46 A;  1M4V A;  3S1R H;  2EVB A;  1NUC A;  4WOR A;  1TS4 A;  2EZV A;  3NQT A;  1IKL A;  1WVL A;  1KRS A;  5AFW A;  3R8B A;  2B2Y A;  4ZCK A;  4LNQ A;  1EYA A;  3D6W A;  4A3I G;  3MEF A;  5KGU A;  4RGT A;  1PYB A;  3TZU A;  4ZKB B;  1WFQ A;  4QUC A;  1H95 A;  1R4P B;  2MHV A;  4FNF A;  3ERQ A;  2CHB D;  1X55 A;  3U50 C;  5C6A A;  2H5X A;  1SE3 A;  4JI4 Q;  3CD6 A;  4R8I A;  1KNE A;  2K05 A;  1Q1B A;  1TS3 A;  1HR0 Q;  1EY6 A;  4BY7 H;  3HS0 C;  1WJJ A;  5CV5 A;  5BN3 A;  3Q24 A;  1SYG A;  1PXU A;  1S5E D;  1NAP A;  4ILW A;  5KRU A;  5IT9 E;  4Z9C B;  2UXB Q;  3ONA B;  3L7Z C;  1JOQ A;  2QEJ C;  4P71 A;  2EY1 A;  3IL8 A;  5LMU Q;  5IOC A;  3OWE B;  3PUZ A;  2WB1 B;  1CUK A;  4CDE C;  3RD4 A;  3K5L A;  3RMH A;  2NN6 G;  1IL2 A;  3QJY A;  2V1C C;  3VYT A;  4QL5 A;  3K5N A;  3VDY A;  1J5E L;  1SBB B;  2D0O A;  4P75 A;  1PFN A;  2R7F A;  3KOJ A;  4DAY B;  1CA6 A;  4L6T B;  1EY0 A;  2GA4 B;  2F0T A;  3QG1 A;  4HSP A;  4G7Z C;  2RHQ B;  4QCL A;  5JJK A;  3FDT A;  1L0W A;  4NXN L;  3H0G H;  2L4N A;  5FO8 B;  1WTV A;  2EPB A;  1V43 A;  1BQQ T;  1LTL A;  4AH6 A;  1J9O A;  1BBX C;  4JI2 Q;  1OXV A;  1YNJ D;  5C3W A;  4HIO A;  3SE0 A;  2B2V C;  2ES2 A;  1DD2 A;  4K5W A;  4YWM A;  4BY1 H;  1E1O A;  3SXH A;  3PO2 G;  2HT1 A;  4NXM L;  2M2L A;  1N36 L;  4FDB A;  1TXY A;  2NWG A;  4F8M A;  3T56 B;  2EJG C;  4ZK9 B;  4P74 A;  3WOE A;  1PH5 A;  1K3B C;  4GS3 A;  3NTK A;  1PVO A;  4GN5 A;  1HZB A;  1K28 A;  4DAM A;  3PGZ A;  3H6M A;  2IY5 B;  1EZ6 A;  2C35 B;  3KF8 A;  5DLQ E;  1SE2 A;  4PG3 A;  2NB0 A;  3G7L A;  4A3K H;  4JI8 Q;  1YJN A;  3E3X A;  4XQQ A;  4JI7 Q;  5KNB A;  3AFQ A;  1HNZ Q;  1JMC A;  2JA5 B;  1PMR A;  2K04 A;  2AQ2 B;  1LTS D;  1F9S A;  5EGT A;  4XQJ A;  1FR3 A;  2OCE A;  3MFG A;  4FP5 D;  4WJ3 M;  2UXD Q;  3E5S A;  1V1O A;  4MIU A;  1QB5 D;  3LWU A;  3CC2 A;  2KVM A;  3VR2 A;  4X62 L;  1TWF B;  2I5L X;  1WTH A;  1EY5 A;  1XX8 A;  2J4X A;  4RFB A;  1SE8 A;  4EQO A;  3HGB A;  5A35 A;  3J81 c;  1B50 A;  1SN8 A;  5IT9 L;  3U4Z A;  4DR2 Q;  4IUN A;  1HTL D;  2I5H A;  2N78 A;  2I5M X;  1KAB A;  2PW7 A;  2EY6 A;  1GUO A;  3IAY A;  1EIF A;  3GD7 A;  1ICF B;  1EEF D;  5FJ8 G;  2HIV A;  1ASZ A;  2Q2U A;  1Z47 A;  3NEM A;  4XT1 B;  2CH4 A;  1K83 H;  5I2Y A;  1QUQ A;  5NUC A;  2MNA A;  3PO3 H;  3CQZ H;  4UHV A;  4DXG A;  3CCU A;  1X3Q A;  4JI4 L;  3BDO A;  2K75 A;  4YWL A;  1V8Q A;  5JOB A;  2Z8L A;  1N33 Q;  3I4L A;  1K8O A;  2NVY B;  1GUG A;  1AP0 A;  1Q3L A;  5CBE E;  2F0H A;  4CKB A;  4EQN A;  1WD0 A;  3HOV B;  3FHW A;  3S1Q B;  2KOL A;  1ET6 A;  5J22 A;  3OSO A;  3HOX G;  4B3T Q;  2KQ3 A;  2DGY A;  2VB3 X;  1AH9 A;  1SMY D;  4BY7 B;  1BCP C;  4OX9 L;  3HOW G;  3J81 E;  1SSO A;  2JN4 A;  2Z9H A;  4QIW B;  1CKO A;  3U58 A;  5EPK A;  3K6O A;  4XTC S;  3SK8 A;  2TMP A;  4A4I A;  1C8C A;  2VNU D;  1PH7 A;  2YU9 H;  2UXC L;  3TSS A;  4B3S Q;  1K3R A;  4KKU A;  1VQ5 A;  3KF6 A;  3NK9 A;  2RQX A;  4XYO A;  2QCP X;  4PMC A;  4NXM Q;  2AUJ D;  4ZUJ A;  2FXQ A;  4DK3 C;  4A3D H;  2HHH L;  4L5T A;  4FF1 A;  2VQF Q;  1X3E A;  3I70 A;  1VQG A;  2NZ1 D;  4IUT A;  1JWU D;  5CV8 A;  1KQS A;  4EVO A;  4KLK A;  5G3L F;  4LF5 Q;  1E24 A;  1HXY D;  1BCP D;  2HDL A;  4RCN A;  3NHH A;  2MQH A;  2L55 A;  2NN6 I;  2F0J A;  4X64 L;  1DYQ A;  1EWH A;  4R4Q A;  1BUV T;  2A73 B;  1MBY A;  3P7J A;  2VW9 A;  1XPO A;  5C5L A;  2KCC A;  4LWC A;  2PQA A;  4JYA L;  1HTP A;  4YY3 L;  1UUP A;  3FVQ A;  2JA6 G;  1VS0 A;  4V0B A;  3W2D A;  3UDI A;  1YNJ C;  5ELB A;  3I7F A;  5IYD H;  1K8M A;  3GTK B;  1XMO Q;  1IBM L;  2RBM A;  2PPB C;  3T13 A;  4GLA C;  4JI5 L;  3J80 E;  2B63 H;  4BBR H;  1XNR L;  4DUY L;  5FO7 B;  3J80 i;  4C3H G;  3OMC A;  4A3M H;  1ZYR D;  4RKB A;  3A7L A;  3E0J A;  3K57 A;  5JEA H;  1I4Q A;  2BA0 A;  3KFU A;  4GKJ Q;  1JQY D;  2EJF C;  1CSQ A;  5K36 H;  1VQ6 A;  1ML0 D;  2MFI A;  4A3G H;  2PO4 A;  1GJX A;  4BY7 G;  2DJF C;  2R3Z A;  1E2Z A;  3A0J A;  1E3P A;  4RHS A;  3TZD A;  3JC6 6;  2WV6 D;  5CYU A;  3R93 A;  1BKB A;  4RKL A;  1B44 D;  4R8N A;  1U5K A;  3K7A H;  3KK7 A;  4C3I B;  3KJO A;  3I4N B;  5M3M H;  1SRU A;  4MNO A;  1PRT D;  2HIX A;  5JPM C;  1DM0 B;  4OIK A;  5IP7 H;  3ULP A;  4BA2 I;  3MVV A;  2G9D A;  4G7O C;  1UNS A;  1AZQ A;  2K5V A;  4C2M H;  5I9O A;  1GUS A;  2M00 A;  4DU9 A;  2K1B A;  4YHH L;  1QNU A;  4POG A;  4OO1 G;  3FKI G;  3HKS A;  4JYA Q;  4B3R L;  2X69 A;  5KIX A;  3HZX A;  1LTT D;  1Y1V B;  4H02 A;  1K83 B;  2B8G A;  1MD2 D;  3PO3 B;  1IXR A;  5ISR A;  1DJR D;  2BCO A;  4C3J H;  1B1Z A;  1GKH A;  2P5Z X;  3PQI A;  1EZ8 A;  1GUW A;  2B2W C;  4GZY C;  3N6R A;  1DXM A;  1X3F A;  4GOP A;  1V9P A;  4OGQ C;  4PZ6 A;  1TR5 A;  1VQB A;  4OIJ A;  2R93 G;  2SDF A;  1MI2 A;  4DR4 Q;  4DV5 Q;  4Y52 H;  2KUM A;  3KBX A;  1PH8 A;  3I3C A;  3D0F A;  2LXJ A;  4UP8 A;  1E2V A;  2K14 A;  5GAH C;  1BF4 A;  1STN A;  3I2Z A;  5M5Y H;  1G91 A;  4GOP B;  4KMU C;  4R1J A;  1RTN A;  1G6Z A;  1UWV A;  5J39 A;  3HRZ C;  2K28 A;  1TY0 A;  4HJ9 A;  2CCZ A;  2BH8 A;  3J7Z C;  4WJ4 A;  2WII B;  4A93 G;  2K5Q A;  4CJ2 C;  2OWO A;  4A3D B;  2EE1 A;  3A5Z B;  1CKN B;  2BH2 A;  2F0W A;  1CI3 M;  2FMC A;  2L15 A;  2NTT A;  1IBK Q;  2F4V L;  4JI3 Q;  1ENF A;  1JOK A;  2B8F A;  1DOK A;  1WOC A;  2HQE A;  3E9I A;  4TKO B;  3BG3 A;  5M3M G;  3LWE A;  4K5V A;  1LV9 A;  1PH3 A;  4DK6 C;  1X54 A;  3S16 H;  5JJZ A;  3BZK A;  3V05 A;  4HJ7 A;  4HJ5 A;  1C48 A;  3HOY G;  1TS5 A;  2JE6 I;  1N9W A;  3K80 C;  2WB1 E;  2VUM H;  3M7N A;  3W3A A;  3CC7 A;  2RDF A;  1A3T A;  3VYS A;  4FYD A;  1OO9 B;  1XMQ L;  4BY1 B;  1SJE D;  3CMA A;  3LNN A;  1G2T A;  4JOI A;  3WOF A;  2F1M A;  3PUX A;  2HCC A;  4HMJ A;  4GN4 B;  2RCF A;  5JEA G;  1A63 A;  4DF7 A;  3SHL A;  1V1P B;  2CWA A;  1FGB D;  4HIM A;  4WFN 3;  1JOO A;  4IFD G;  4ZRZ A;  3F2C A;  4DR3 Q;  4LFB L;  1MJC A;  1L1O A;  4HN7 A;  4QUF A;  3GP7 A;  3RN2 A;  3X3N A;  2D62 A;  1IBL L;  3H3V I;  2F03 A;  1R4Q B;  1D6E C;  3SK6 A;  2KED A;  3C3L A;  4A3K G;  1CTM A;  1EWC A;  2E76 C;  3BVZ A;  3VR4 A;  4XXE A;  2DNE A;  3STB C;  3KYH C;  5COR A;  4DNT B;  3S9W A;  4X65 L;  3AB9 A;  2WKC A;  2RVL A;  2JA5 G;  2JA5 H;  1SJH D;  2JSO A;  1STB A;  2KHJ A;  2NZH A;  1B53 A;  1Q46 A;  1IYJ B;  1UEB A;  4Y7N B;  1SLJ A;  4QJF A;  5IT9 c;  2VZA A;  2C5C A;  4JI6 Q;  1L0X B;  2L0C A;  5C4Z A;  1TWF H;  3TBI B;  2AQ1 B;  3ULL A;  1SXT A;  2CWP A;  4DV1 Q;  4LF6 Q;  2N49 A;  2ICI A;  1BDO A;  2M9V A;  2PCF B;  1X32 A;  4OHJ A;  1MJE A;  4LF5 L;  3JAM E;  4RGM A;  4LAA A;  3BZC A;  1PFB A;  2UU9 Q;  2NUC A;  5IWA L;  4DV4 Q;  2ZXP A;  2PI2 A;  2ZXR A;  4DAY A;  4YCV A;  4A93 B;  2EOT A;  3E9H A;  1HUM A;  1H9S B;  3BZD B;  3GQB A;  2JK8 A;  1SNP A;  3BDL A;  2DNC A;  2SEB D;  1PDQ A;  3DWP A;  5C0X H;  1ICW A;  3UI2 A;  5IGE A;  3TS0 A;  4JOI C;  1OXT A;  4DR1 Q;  2A6E C;  2NVY H;  2PNH A;  2MUY A;  4C3J B;  4N8F A;  2JXM B;  1W6J A;  3SR1 A;  4OX9 Q;  4P72 A;  1FNU A;  3G6E A;  3HOV H;  3S1Q H;  4FXG C;  2V4D A;  4DAP A;  2F3I A;  1KL9 A;  1LT6 D;  4U68 A;  4K14 A;  1Q8K A;  1EY8 A;  3MFY A;  5D3I B;  1HNX Q;  3OMG A;  4YWK A;  5GQO A;  1D1I A;  2R7Z B;  3MXN A;  4CKC A;  3OIQ A;  3EFX D;  3W1B A;  1VQ8 A;  1PRT B;  1EOV A;  2F0S A;  1QUQ B;  5TSS A;  5L37 A;  3PO3 G;  4DR2 L;  2YU9 B;  5BN5 A;  1N8R C;  1P16 A;  2B2U A;  5C3X A;  3BU2 A;  4KN7 C;  4OEM B;  2Y0S B;  1TII D;  4DK1 A;  3M4Y A;  3V96 A;  1C7Y A;  5M5Y B;  1PTO H;  2PQA B;  5D3D A;  1EL0 A;  2JYO A;  1AE2 A;  4QF4 A;  3RLN A;  1VF5 C;  2G9H D;  3GTP H;  1DGS A;  4RGN A;  1MGS A;  3HOU H;  1F9R A;  1NR2 A;  3K0Y A;  4K8I A;  5IGC A;  1XNR Q;  4MN3 A;  1TWG B;  5LMN L;  3J7A V;  3QO2 A;  3J81 L;  3FMC A;  2IL8 A;  1SYD A;  2C9O A;  3F2B A;  4QMG A;  4NPS A;  3IRB A;  3T1H L;  3D6C A;  1QVF A;  2CQA A;  2F0D A;  1QE6 A;  3L3O C;  1IYU A;  5KNC A;  1K73 C;  3A54 A;  2A74 C;  4O42 A;  1NR4 A;  4K6D A;  1BVS A;  4ZAI A;  1DOM A;  4DUZ L;  1NCV A;  3MA2 B;  1L2F A;  3HEJ A;  2X6L A;  3EN2 A;  4X3K A;  1LT3 D;  3GV3 A;  5ELD A;  3MEH A;  2ZM6 Q;  1SYF A;  5JPN C;  3NBH B;  1S40 A;  1M90 C;  5IE8 A;  1NTG A;  1EYD A;  5CR3 A;  4FXD A;  2XVS A;  2BOS A;  4FXK C;  1J5E Q;  4BBR B;  4OWX B;  1O7L A;  5KND A;  1VQL A;  2WB1 G;  3FRP B;  4Q5V A;  4B08 A;  5M3F G;  2Z1C A;  2TSS A;  3G4S A;  5JVH 3;  1NE3 A;  1YVC A;  3RR5 A;  3VR5 A;  3DHQ A;  4A3J G;  3L9A X;  3TS2 A;  1U9R A;  3H0G G;  3QWN A;  1CQF A;  4IFD I;  1Y1V G;  2EYH A;  4GNX C;  4A3M G;  2KCM A;  2HQL A;  2ICE C;  2PMZ E;  4A3G B;  4O2D A;  4P73 A;  4S3S A;  1X56 A;  3VYU A;  3D31 A;  4A3B G;  1JCK B;  1ILQ A;  1BBU A;  2PZT A;  1HCZ A;  1L1O B;  3I4N H;  5JAV A;  5EKK A;  2BE5 D;  2UUB Q;  2HCI A;  4KHP L;  1Y8N B;  3VYR A;  1Y1W G;  3D4D A;  5M3M B;  3M85 A;  4B3R Q;  1X65 A;  3CRK C;  3PIP 3;  5C4X G;  2WAQ B;  1WCM H;  3EBE A;  3CU7 A;  1G6P A;  1ZKO A;  3EVQ A;  2N55 A;  1EOT A;  3CRL C;  1B70 B;  3NEN A;  2ID0 A;  3HOZ G;  1KDB A;  5COY A;  4BA1 I;  3I72 A;  4O1N A;  1Y1V H;  3DWA A;  1SFO B;  5LMU L;  1JE5 A;  3I4O A;  2IHE A;  3RZD H;  1Q81 C;  2QEX A;  5FLX L;  2L5T A;  3IFT A;  4A3F B;  2F0O A;  3TQY A;  3CCL A;  1EY9 A;  3GO5 A;  3QOL A;  5I2X A;  5BN4 A;  2R7D A;  3IFD A;  2F0P A;  1RIP A;  2BDN A;  5LHY 1;  1HFG A;  3T53 B;  1E0B A;  1BR9 A;  3KLS A;  2EXZ A;  1WTQ A;  3Q8D A;  3R2T A;  2EYM A;  2E2H H;  2BA1 A;  2R7Z G;  3NP8 A;  3PIO 3;  2PMZ B;  3TP8 A;  2PZU A;  3AMU A;  1QCB D;  3AYH B;  1UE5 A;  2SNS A;  1I3Q B;  3LGJ A;  1I94 L;  2F0F A;  4KD3 A;  2E2D C;  3G71 A;  3SGI A;  2DUD A;  4AQY Q;  1MIU A;  2KHS A;  2LKV A;  1LO5 D;  3KF8 B;  1SNQ A;  1K0R A;  1GO3 E;  4NDX A;  2NVT B;  1PTO B;  4JC0 A;  4F7X A;  3NXW A;  2BDO A;  4DKA C;  3KJP A;  1G8Z D;  1LTA D;  1G51 A;  2MO0 A;  3HOW H;  3GTP B;  3WWV A;  2A8V A;  3S16 B;  4B9W A;  1HNX L;  3HOU B;  5M9O A;  5A2Q E;  2HUG A;  5E7N A;  4M8A A;  1KNA A;  2WKD A;  3DXJ C;  1TWG H;  4C3I G;  1HZ9 A;  1YHA A;  4HR7 B;  4LJZ C;  3A74 A;  2VUM B;  4K2K A;  2NN6 H;  1A3V A;  4QB4 A;  1S5F D;  1MKH A;  2WFW A;  1BCP B;  3I4M H;  5E4X A;  1GM5 A;  5EQ0 A;  2DJG C;  3KF6 B;  1E1T A;  1A2U A;  3RLO A;  1VQI A;  1LAC A;  3ITP A;  2Z4H A;  1Q90 A;  5EKL A;  3IKJ A;  5FLX E;  1UE1 A;  3HG9 A;  5FOB B;  2CVR A;  2WAC A;  4DR5 L;  2N88 A;  1Q86 C;  3MXP A;  5K36 G;  4JI2 L;  4HCE A;  4JPB W;  5CC4 A;  4LFC L;  4NMZ A;  3SK4 A;  4DUZ Q;  5IOD A;  2UUC Q;  2R92 B;  2LXK A;  4IPH A;  1SDF A;  1R9T B;  4DAV A;  3TEH B;  5M5X B;  4BBS B;  1AN8 A;  2VQE L;  4KKT A;  1GXD C;  1ZEQ X;  4KY5 A;  1CQV A;  3UDG A;  2JEB I;  2Q2H A;  1K0S A;  4F87 A;  2KA7 A;  3X3M A;  4JI6 L;  4CBV A;  5CMD A;  1WTW A;  2PZW A;  3AU7 A;  4QGU A;  5D14 A;  4IUV A;  3S2H B;  1YZ6 A;  5C44 G;  4Y7N H;  1FJG L;  2UXD L;  1RD9 D;  4IPG A;  5E1F A;  4XT3 B;  1CHP D;  5FLM G;  2I0Q A;  5KEE A;  4DFA A;  2MO1 A;  3GTJ H;  3OWF A;  3P75 A;  1E22 A;  1N33 L;  1HNW L;  1HNZ L;  2ZJQ A;  4R4C A;  4JI7 L;  3GTM B;  3G48 A;  1YNN D;  2JA6 H;  2ENB A;  3PUV A;  1M8A A;  4DR6 L;  1SE4 A;  1I4P A;  1SMY C;  2JA8 B;  2EYL A;  5FK9 C;  1SND A;  2Z6K A;  1VQP A;  4Q0F A;  1WCM B;  3M4P A;  1U0L A;  5BR8 Q;  4DR3 L;  3A56 A;  4A3J B;  4A93 H;  1C9O A;  1L1O C;  4LUZ A;  1STY A;  1HNW Q;  2IJ0 A;  2F0U A;  2B2T A;  3F2D A;  4ALP A;  4JBM A;  1XTC D;  1KRT A;  1J6Q A;  2Z6B A;  2O5J C;  1IKM A;  1TWC B;  5ELF A;  3M4Q A;  2O5I C;  1XTD A;  1KAA A;  2K03 A;  3PF4 A;  1S72 A;  4KY6 A;  3C2P A;  3KDF B;  2K6A A;  3I91 A;  3RZD B;  3I4N G;  1KD1 C;  1SNC A;  1AW7 A;  2RKS A;  4DR7 L;  1STA A;  2J0T D;  2IT1 A;  1SR3 A;  4C3J G;  3CPF A;  1TVX A;  4KTA A;  1WTX A;  3TP5 A;  2FFK B;  1H9K A;  2K7V A;  5GRO A;  2IX0 A;  1I4G A;  4IPD A;  2L11 A;  4LFC Q;  3J7A F;  2E2J H;  3J80 c;  1K8G A;  5C0X J;  2R7Z H;  1TWH B;  3HOZ B;  4LW1 A;  2F3W A;  5FLM H;  2FIN B;  5T1I A;  2E2H B;  3HKZ G;  3GTO H;  5C44 H;  1LUZ A;  1S5D D;  3OYY A;  5T1G A;  2XRS D;  1I3Q H;  4NB3 A;  3NTI A;  5FLX c;  5C5M A;  1E7Z A;  1YJW A;  1ESF A;  3MC0 B;  2A6H D;  1VQ4 A;  1Y1W B;  2OQK A;  3VR3 A;  1ILP A;  1LYL A;  2NBF A;  4ZUI A;  1WTP A;  1YI2 A;  4KJN A;  1XYI A;  1LTB D;  1B3A A;  1X9N A;  2R93 B;  1PZI D;  1NBW A;  4K2L A;  3NSW A;  1XMQ Q;  1P8L A;  1ENA A;  2GN5 A;  4PQX A;  3HOW B;  3K59 A;  2RSO A;  4NKL A;  4PNY A;  1ESR A;  2K32 A;  4X3S A;  3TDQ A;  4JK1 C;  4TRD A;  1EFI D;  4IAL A;  2GVA A;  4KY7 A;  1SNM A;  2SNM A;  3NBI A;  2G5D A;  3I4M G;  3S1N H;  1PFM A;  5D65 A;  3GTG H;  1VQ9 A;  2CQO A;  2F3V A;  3EQL C;  2R61 A;  3I8Z A;  3CHB D;  1EEI D;  2FJ2 A;  1VQJ A;  1Y14 B;  2IPK D;  2E5L Q;  3K5M A;  1Z7T A;  1JJG A;  1PZK D;  3QB3 A;  5IYD G;  2K5H A;  1D5X C;  4EX5 A;  1Y8P B;  3NWT A;  1C0A A;  1HQM C;  2A69 C;  2GVB A;  3K81 C;  4LK1 C;  4TVA B;  4HIK A;  2R92 H;  1VQF A;  2BE5 C;  1A0I A;  1R9T H;  5M5X H;  4BBS H;  2N8N A;  5EKI A;  4KJO A;  3RLF A;  2RA4 A;  1HZC A;  3PIO A;  4B3M Q;  1FGU A;  3M4O B;  1H9S A;  4QIW E;  3ND8 A;  4U67 3;  3S2H H;  4CDF C;  5DM6 3;  3HOV G;  1EY4 A;  4AYB B;  2UU9 L;  4X3T A;  3KLS X;  5IGB A;  2B3G A;  3H15 A;  1Q8I A;  1DCZ A;  1L0Y B;  3GTJ B;  1JB3 A;  1A3U A;  3JAM c;  5CGK A;  4B3M L;  2KEC A;  2WAQ E;  2AWO A;  2F0E A;  3GTM H;  1GHK A;  2JA6 B;  3BVM A;  3VA5 A;  2Y0S G;  1B9M A;  1LLR D;  1QNK A;  2CFM A;  1VMP A;  4DNR B;  4QY7 A;  1JR0 D;  2RF4 A;  2UUB L;  2L1B A;  3F2U A;  1Y8O B;  3NQI A;  2OTL A;  5IGD A;  4LUO A;  3DWQ A;  1H9M A;  5J3B A;  1SFO H;  1GOZ A;  1TWC H;  2YV5 A;  4J8Q A;  4LF8 Q;  4AYB G;  2Q8T A;  2JQO A;  4AQY L;  1Z9F A;  3CKI B;  4PZ8 A;  1NMF A;  5IYB H;  3STB D;  2YTX A;  5IP9 G;  1FL0 A;  1RKN A;  3OTO Q;  4A3F H;  2RHS B;  2FMM A;  4LFB Q;  3NWS A;  4KV6 A;  5HGT A;  3M7G A;  4DR5 Q;  3F1Z A;  3H3V C;  4EQ5 A;  3NEL A;  4I7Z C;  2D9U A;  1O78 A;  4X6A H;  1I4X A;  4A3E G;  3JAM i;  2F0V A;  3SK5 A;  1PTO F;  1I4H A;  2RDH A;  1CT1 D;  1NMG A;  3A5U A;  3L2P A;  1D8L A;  2A69 D;  2E75 C;  2FHT A;  4JI1 Q;  4RCO A;  3SDZ A;  4DV6 Q;  3S15 B;  1TWH H;  3HOZ H;  1RDP D;  2EYP A;  1QVC A;  1EYG A;  5C44 B;  2L9H A;  1LTR D;  1K8A C;  4LF9 Q;  5I4D A;  2QGQ A;  4KK7 A;  3U9S A;  3NUC A;  2EIF A;  3MZ5 A;  1A62 A;  3TP6 A;  3JAM L;  2OF1 A;  2LMC B;  2EYF A;  4A75 A;  1XNQ Q;  1LM0 A;  3EJI A;  2NVT H;  5ELO A;  3GTL H;  1Y1W H;  3D8G A;  4E6I A;  4A3D G;  1A8V A;  4H0L C;  3TN2 A;  4APV A;  3MWY W;  4DN4 M;  1VCI A;  2A1A A;  4LF9 L;  4CHT B;  2LY7 A;  3URY A;  1X6O A;  2R93 H;  3VR6 A;  2XGT A;  1F2M A;  3ER0 A;  2O4X A;  4DV3 Q;  1JB7 A;  1HA5 A;  1V1Q A;  3UDX A;  1HQR D;  2Z4I A;  1VQD A;  3PIP A;  2K4K A;  4MZ9 A;  1YHB A;  3D3R A;  5FO9 B;  1PH9 A;  2ZTD A;  4DV7 Q;  2B29 A;  3DM3 A;  3K5O A;  3PV0 A;  3UE1 A;  5IP9 H;  5M5W B;  4IUQ A;  3K8A A;  4RG1 A;  4GNX A;  2EY5 A;  4KHV A;  2ATW A;  1NSN S;  3BDC A;  2Q8I B;  3I4M B;  3S1N B;  5GAG C;  2HD3 A;  4C3H B;  4CDC C;  3EIV A;  5CV6 A;  3HOX H;  1PRT C;  1S3O A;  3PUY A;  5GAD C;  3Q0A A;  2AUK A;  1AFP A;  4LF4 Q;  4FO2 A;  1C4Q A;  2RDG A;  1PTO C;  2IW3 A;  3HOU G;  4H44 C;  1X3P A;  3OPO A;  4L8J A;  2VS1 A;  4J6H A;  5I9P A;  5I6Y A;  5LL6 X;  4CJ0 B;  1XPU A;  1QZG A;  3C1F A;  3BYY B;  3FPP A;  5IYC G;  1HJP A;  1VF7 A;  5E3F A;  2PW5 A;  4XYQ A;  4GLV B;  2ZM6 L;  3GV6 A;  1QVG A;  4HED A;  2E5L L;  2K5W A;  1EWI A;  2ZXO A;  4RWS C;  3RZO H;  4RH6 A;  4P2C B;  1CZG A;  4IN3 A;  2IHF A;  4X65 Q;  1STE A;  4JBK A; 
#chains in the Genus database with same CATH homology
 2Q2T A;  2VQE Q;  3I7F A;  5IYD H;  3Q8D A;  2JA9 A;  1OXU A;  4OWT B;  2E2H H;  2BA1 A;  1KC8 C;  2R7Z G;  3ERS X;  1XMO Q;  3AYH B;  1UE5 A;  3LGJ A;  1IBM L;  1I94 L;  4JI8 L;  2EQS A;  2JA7 G;  1K9M C;  3RNU A;  3B6Y A;  3G71 A;  4GLA C;  4JI5 L;  1JT8 A;  3SGI A;  1VQK A;  4LF7 L;  2DUD A;  4BBR H;  5C4X H;  4DUY L;  4AQY Q;  1MIU A;  1XNR L;  5LMN Q;  2B63 H;  3J80 i;  1PFS A;  5JJL A;  2ASB A;  4A3M H;  2JA8 H;  3CP0 A;  3KF8 B;  5HY6 A;  3CCQ A;  1FJG Q;  4JBJ A;  3I56 A;  4X62 Q;  1K0R A;  1GO3 E;  4JC0 A;  4A3J H;  2CKZ B;  4DKA C;  3RN5 A;  3KJP A;  2BA0 A;  3S17 H;  1VQM A;  4AYB E;  3AEV A;  1IBM Q;  1VQO A;  3KFU A;  4GKJ Q;  3ICE A;  1G51 A;  2KEN A;  2E2I H;  1CSQ A;  1VQ6 A;  2MO0 A;  1EIY B;  2MFI A;  2UUA Q;  3HOW H;  4A3G H;  4K0K Q;  1YBY A;  3WWV A;  2A8V A;  1HNX L;  4BY7 G;  4IOA A;  1CKM A;  3A0J A;  1E3P A;  1BBW A;  5BR8 L;  3JC6 6;  5E7N A;  5HGQ A;  4YHH Q;  3F8T A;  4IOC A;  1TWG H;  3OW2 A;  1JJC B;  4KHZ A;  4GLX A;  1BKB A;  5C3E G;  1HZ9 A;  1RL2 A;  1U5K A;  1YHA A;  2AHO B;  3K7A H;  5C3E H;  3KJO A;  1UE7 A;  3A74 A;  2F52 A;  2D0P A;  3HOY H;  1PH2 A;  4IJL A;  1B7Y B;  1PHJ A;  2LSS A;  1N34 Q;  4UY8 C;  5M3M H;  4IJH A;  1SRU A;  1MKH A;  1FVI A;  4MNO A;  2WFW A;  3I4M H;  2HIX A;  4DPG A;  1GM5 A;  1HR0 L;  5JJI A;  5IP7 H;  3UE0 A;  3ULP A;  3CAM A;  3KF6 B;  1EQQ A;  1E1T A;  1ASY A;  4L5R C;  3RLO A;  4BA2 I;  1GVP A;  4LUV A;  1VQI A;  2K5V A;  4DV7 L;  5GAE C;  2ZTE A;  4BY1 G;  4C2M H;  2NVQ H;  4YHH L;  3S24 A;  4POG A;  4OO1 G;  1HZA A;  1UE1 A;  3FKI G;  3HKS A;  4JYA Q;  1EFW A;  4DR5 L;  1CKN A;  1Q86 C;  3CCS A;  3S15 H;  1N34 L;  5K36 G;  1PA6 A;  4JI2 L;  4B3R L;  1N36 Q;  4XIG S;  1WYD A;  2B63 G;  2ALY B;  4R4T A;  1VQE A;  1GD7 A;  4H02 A;  1N32 L;  4LFC L;  4JBW A;  4DUZ Q;  2Z6K C;  2UUC Q;  1KHI A;  5C0X G;  1IXR A;  2LXK A;  4BXX G;  4IPH A;  1XPR A;  2VL6 A;  3KDF A;  3ULJ A;  4AIM A;  4C3J H;  4GOP C;  1GKH A;  1O7I A;  2K52 A;  3TEH B;  4GKK L;  2VQE L;  1AE3 A;  1I50 H;  1VQA A;  4JV5 L;  3UDG A;  2JEB I;  2Q2H A;  2VUM G;  4JI5 Q;  3CPW A;  4JI6 L;  4LF7 Q;  2UXB L;  1X3F A;  4GOP A;  1IBL Q;  4QGU A;  2IX1 A;  1N32 Q;  1V9P A;  1I94 Q;  1YZ6 A;  4PZ6 A;  5C44 G;  1I5F A;  4GN3 B;  4Y7N H;  4DV2 Q;  4LF8 L;  1FJG L;  1I6H H;  2UXD L;  4IPG A;  1VQB A;  4RMF A;  5FLM G;  2K5N A;  5AJ3 L;  2I0Q A;  1YIJ A;  1XNQ L;  1OXS C;  3ZJY C;  2ZTC A;  4UPA A;  2MO1 A;  4JV5 Q;  3GTJ H;  3TRE A;  3GTK H;  4GKK Q;  4R4I A;  2R93 G;  1E22 A;  1N33 L;  3U4V A;  3PSI A;  4UP7 A;  4DR4 Q;  1HNW L;  4QQB X;  1HNZ L;  4IO9 A;  4DV5 Q;  2ZJQ A;  4R4C A;  4JI7 L;  4Y52 H;  3G48 A;  5M5W H;  1PH8 A;  1SMX A;  2JA6 H;  5C4J H;  3K0X A;  3D0F A;  1NJI C;  3PUV A;  2LXJ A;  4JI3 L;  4YCU A;  5EAY A;  4UP8 A;  4DR6 L;  3E0E A;  2K14 A;  5GAH C;  4PZ7 A;  1IZ6 A;  2OTJ A;  3I2Z A;  4LFA Q;  5M5Y H;  4GOP B;  4JI0 Q;  4R1J A;  4UP9 A;  1PYS B;  1UWV A;  3FKI H;  4JI1 L;  4OWW B;  2Z6K A;  1VQP A;  4HJ9 A;  1Q12 A;  2CCZ A;  2BH8 A;  3M4P A;  1U0L A;  5BR8 Q;  4L5Q A;  3J7Z C;  3CCV A;  4DR3 L;  2OWO A;  4A93 H;  1C9O A;  1L1O C;  3A5Z B;  4LUZ A;  1CKN B;  2AMC B;  3T1Y L;  2BH2 A;  4DR4 L;  1VQH A;  4X66 Q;  1HNW Q;  2L15 A;  3F2D A;  4ALP A;  4JBM A;  1X3G A;  2JJQ A;  2VY3 A;  4A3L G;  1G29 1;  3AQQ A;  3M9B A;  1J6Q A;  4JCV E;  1KRT A;  4DV0 Q;  1IBK Q;  4JI3 Q;  2F4V L;  2YTV A;  3M4Q A;  1WOC A;  1XTD A;  3E9I A;  5M3M G;  2R92 G;  1PH3 A;  3S16 H;  4DK6 C;  1X54 A;  1YJ9 A;  1S72 A;  3PF4 A;  3BZK A;  3I55 A;  4HJ7 A;  4HJ5 A;  3KDF B;  3W5O A;  3CCM A;  4L5S A;  3HOY G;  2JE6 I;  1N9W A;  3I4N G;  3K80 C;  1Q7Y C;  3KLW A;  2WB1 E;  4C3I H;  1KD1 C;  2VUM H;  5LMN W;  3M7N A;  2ZJR A;  4JG2 A;  4POF A;  3CC7 A;  1OTC A;  4DR7 L;  4A3B H;  4HJA A;  1VQN A;  2UUA L;  3BJU A;  4J15 A;  2IT1 A;  4HID A;  1XMQ L;  1SR3 A;  4B3T L;  2UXC Q;  2E8G A;  3CPF A;  3CMA A;  4LF4 L;  4IPC A;  3M4O H;  2AWN A;  3PF5 A;  4JOI A;  3W1G A;  3PUX A;  1KAW A;  5GRO A;  2IX0 A;  3MXN B;  4GN4 B;  4IPD A;  5JEA G;  4LFC Q;  2E2J H;  1A63 A;  3J80 c;  1K8G A;  5C0X J;  1PH4 A;  2R7Z H;  5JEA J;  2CWA A;  1CSP A;  4HIM A;  4LW1 A;  3TRZ A;  5FLM H;  2Q2I A;  3HKZ G;  4DR7 Q;  3GTO H;  4HJ8 A;  4IFD G;  5C44 H;  3F2C A;  4DR3 Q;  2Y0S E;  3J81 i;  3T1H Q;  3S2D H;  4KHP Q;  4DV2 L;  4KI0 A;  4LFB L;  3PUW A;  1LUZ A;  3OYY A;  4A3C H;  1MJC A;  1L1O A;  1I3Q H;  3CC4 A;  3S1R H;  3RN2 A;  2JA7 H;  4NB3 A;  3CF5 A;  2D62 A;  1IBL L;  1KRS A;  3H3V I;  5M3F H;  4DNI A;  5FLX c;  1Q82 C;  4A3K G;  4DV3 L;  4LNQ A;  3M3Y H;  1E7Z A;  1B8A A;  4A3I G;  1YJW A;  3MEF A;  1PYB A;  2RCN A;  2YTY A;  3STB C;  1VQ4 A;  4A93 G;  2OQK A;  1WFQ A;  3KYH C;  1LYL A;  1H95 A;  3DLL A;  1UE6 A;  4X65 L;  4JI4 Q;  1X55 A;  3U50 C;  1YI2 A;  2H5X A;  2JA5 G;  1XJV A;  2JA5 H;  3CD6 A;  1SRO A;  2UUC L;  1X9N A;  4A3E H;  5H1S E;  1Q1B A;  2KHJ A;  1HR0 Q;  2NZH A;  1Q46 A;  1IYJ B;  1NBW A;  1UEB A;  1XMQ Q;  1QZH A;  4BY7 H;  3CW2 C;  1P8L A;  1SLJ A;  2GN5 A;  1WJJ A;  3GDE A;  4OO1 I;  4QJF A;  5IT9 c;  3J81 j;  2VZA A;  4JI6 Q;  2UXB Q;  3L7Z C;  1TWF H;  1PV4 A;  1KIX A;  2GVA A;  4P71 A;  3ULL A;  5LMU Q;  2CWP A;  4DV1 Q;  4LF6 Q;  2N49 A;  3I4M G;  1EUJ A;  3S1N H;  3PUZ A;  3CXC A;  1CUK A;  5AJ3 Q;  1MJE A;  4LF5 L;  3GTG H;  4BBS G;  4YCW A;  1VQ9 A;  2AKW B;  2NN6 G;  1IL2 A;  2CQO A;  3BZC A;  1YHQ A;  3CCJ A;  1Q1E A;  1W2B A;  2UU9 Q;  1T9H A;  2V1C C;  4A76 A;  5IWA L;  4DV4 Q;  2PI2 A;  4QL5 A;  1VQJ A;  1Y14 B;  3VDY A;  1J5E L;  2D0O A;  4P75 A;  2E5L Q;  2R7F A;  3KOJ A;  4YCV A;  4DAY B;  1JJG A;  3E9H A;  1XMO L;  1HH2 P;  2RHQ B;  5JJK A;  2JK8 A;  5IYD G;  1L0W A;  2K5H A;  4NXN L;  4B3S L;  2WP8 J;  4IFD J;  3H0G H;  4EX5 A;  1C0A A;  2A19 A;  2GVB A;  3K81 C;  4TVA B;  3TS0 A;  4JOI C;  1OXT A;  4DR1 Q;  1NY4 A;  1YIT A;  4HIK A;  2R92 H;  1VQF A;  2NVY H;  1V43 A;  2PI2 E;  1LTL A;  4AH6 A;  2OQ0 A;  2PNH A;  4JI2 Q;  1A0I A;  1R9T H;  1OXV A;  2F4V Q;  5M5X H;  3GTQ H;  4BBS H;  4OX9 Q;  4P72 A;  3G6E A;  4HIO A;  2N8N A;  1VQ7 A;  3HOV H;  3S1Q H;  2F3I A;  3RLF A;  1KL9 A;  2ES2 A;  1HZC A;  4YWM A;  4BY1 H;  3PIO A;  4B3M Q;  1FGU A;  1Q8K A;  1E1O A;  3PO2 G;  3PO2 H;  2HT1 A;  4QIW E;  4NXM L;  1HNX Q;  1WI5 A;  1N36 L;  4YWK A;  3S2H H;  3HOV G;  4FDB A;  5GQO A;  1TXY A;  3H3V H;  1M1K C;  2K50 A;  1HR0 W;  2UU9 L;  2B3G A;  4P74 A;  3H15 A;  4X64 Q;  4GKJ L;  3W1B A;  5IY0 A;  1PH5 A;  1VQ8 A;  4GS3 A;  1EOV A;  4A3L H;  3JAM c;  4GN5 A;  1PVO A;  1HZB A;  1QUQ B;  4DAM A;  4B3M L;  2WAQ E;  3PGZ A;  2AWO A;  4DR2 L;  3PO3 G;  1N8R C;  1P16 A;  1OXX K;  3GTM H;  4ME3 A;  2IY5 B;  4YY3 Q;  1YNX A;  2Y0S G;  3BU2 A;  2C35 B;  1W3S A;  4K0K L;  5IYC H;  4C3H H;  5DLQ E;  2CFM A;  3HFZ B;  4PG3 A;  4QY7 A;  1C7Y A;  4A3K H;  4A3F G;  4JI8 Q;  2PQA B;  3OTO L;  4DR1 L;  1YJN A;  2RF4 A;  4JI7 Q;  2UUB L;  3AFQ A;  1HNZ Q;  1JMC A;  4WJ4 A;  4MTN A;  3J7A 5;  2OTL A;  1AE2 A;  3RLN A;  2ZJP A;  4LUO A;  3GTP H;  4DV1 L;  1DGS A;  2OCE A;  4LF6 L;  3HOU H;  4WJ3 M;  5J3B A;  2KHI A;  1SFO H;  1TWC H;  2YV5 A;  1XNR Q;  4LF8 Q;  4AYB G;  4BXX H;  5LMN L;  2UXD Q;  2JQO A;  4DUY Q;  4AQY L;  1Z9F A;  4PZ8 A;  2VQF L;  1NMF A;  3CC2 A;  5IYB G;  5IYB H;  5IWA Q;  3F2B A;  4NPS A;  2YTX A;  3STB D;  1FL0 A;  5IP9 G;  4X62 L;  3OTO Q;  4DV4 L;  2I5L X;  4A3F H;  3IRB A;  4PMW A;  3T1H L;  1QVF A;  1SE8 A;  2RHS B;  4LFB Q;  4DR5 Q;  3F1Z A;  5C0X I;  3J81 c;  4DV0 L;  2YYZ A;  1K73 C;  3K7U C;  3NEL A;  4EQ5 A;  1SN8 A;  3U4Z A;  4X6A H;  4DR2 Q;  4A3E G;  1BVS A;  4X66 L;  3JAM i;  1KXL A;  2I5H A;  2N78 A;  3HKZ E;  2I5M X;  4DUZ L;  1NMG A;  3A5U A;  1EIF A;  1L2F A;  3GD7 A;  1D8L A;  3L2P A;  4JI1 Q;  3EN2 A;  4DV6 Q;  2JEA I;  3S14 H;  5FJ8 G;  2ZM6 Q;  2HIV A;  1TWH H;  3NBH B;  1ASZ A;  1S40 A;  1M90 C;  3HOZ H;  5IE8 A;  3T1Y Q;  1PH1 A;  2Q2U A;  1NTG A;  1Z47 A;  3NEM A;  1QVC A;  1K83 H;  1EYG A;  1QUQ A;  1K8A C;  2MNA A;  3PO3 H;  3CQZ H;  3CCU A;  4LF9 Q;  2QGQ A;  1J5E Q;  4JI4 L;  2K75 A;  4YWL A;  1N33 Q;  2EIF A;  2Z0S A;  4OWX B;  2QA4 A;  3CCR A;  1A62 A;  5IP7 G;  1VQL A;  2WB1 G;  3FP9 A;  3CCE A;  4A75 A;  1XNQ Q;  5M3F G;  2XTI A;  1LM0 A;  4DV6 L;  2NVT H;  3G4S A;  5ELO A;  1NE3 A;  3GTL H;  1YVC A;  1Y1W H;  4OON A;  3FHW A;  3RR5 A;  4A3D G;  2KCT A;  4O0A A;  4A3J G;  1A8V A;  1WCM G;  3HOX G;  4APV A;  3TS2 A;  3H0G G;  4B3T Q;  2DGY A;  1VCI A;  2A1A A;  4LF9 L;  4IFD I;  1Y1V G;  1X6O A;  1AH9 A;  4GNX C;  4A3M G;  2KCM A;  2JA8 G;  2HQL A;  2PMZ E;  2R93 H;  2XGT A;  3ER0 A;  4O2D A;  4DV3 Q;  2EXD A;  4P73 A;  1V1Q A;  5FJ8 H;  1VQC A;  1X56 A;  3UDX A;  1JB7 A;  4JI0 L;  1YEZ A;  3D31 A;  4OX9 L;  3HOW G;  1JJ2 A;  1BBU A;  4LFA L;  4A3B G;  4A3G G;  3UDF A;  1VQD A;  3PIP A;  2K4K A;  4MZ9 A;  1L1O B;  4TQU S;  1CKO A;  1YHB A;  2HHH Q;  1PH9 A;  3U58 A;  2ZTD A;  4DV7 Q;  3I4N H;  2B29 A;  3DM3 A;  3PV0 A;  3UE1 A;  5IP9 H;  4RG1 A;  3K8A A;  4GNX A;  4A3C G;  4XTC S;  2UUB Q;  4KHP L;  4A4I A;  2VNU D;  1Y1W G;  1PH7 A;  2YU9 H;  2ATW A;  2UXC L;  4B3S Q;  3M85 A;  1K3R A;  1IBK L;  4NXN Q;  1VQ5 A;  3KF6 A;  5GAG C;  3CME A;  4B3R Q;  1X65 A;  1EQR A;  4NXM Q;  4BBR G;  3EIV A;  5C4X G;  1WCM H;  3HOX H;  1D7Q A;  1S3O A;  3EBE A;  2FXQ A;  4DK3 C;  4A3D H;  2HHH L;  3PUY A;  5GAD C;  1G6P A;  2WAQ G;  4L5T A;  4LF4 Q;  2VQF Q;  1X3E A;  1VQG A;  2R6G A;  1B70 B;  3NEN A;  2ID0 A;  3HOU G;  3HOZ G;  4BA1 I;  1KQS A;  4KLK A;  4LF5 Q;  1Y1V H;  4GNX B;  1E24 A;  2VS1 A;  3L0O A;  2N3S A;  2NZO A;  1TWA H;  5LMU L;  1JE5 A;  3I4O A;  1PH6 A;  2IHE A;  3RZD H;  1Q81 C;  2QEX A;  2MQH A;  2NN6 I;  3AFP A;  4X64 L;  4OXP A;  4R4Q A;  2KBN A;  4A3I H;  2VW9 A;  1XPO A;  1QZG A;  1XPU A;  2NVX H;  5IYC G;  4R4O A;  3TQY A;  1HJP A;  3CCL A;  3GO5 A;  3PCO B;  3S1M H;  4GLV B;  2ZM6 L;  5ELN A;  2PQA A;  4LWC A;  4JYA L;  1QVG A;  4DR6 Q;  4YY3 L;  2E5L L;  2JA6 G;  2R7D A;  1VS0 A;  1EWI A;  1RIP A;  3RZO H;  4DV5 L;  3UDI A;  2IHF A;  4X65 Q;  4JBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...