3TQYA

Structure of a single-stranded dna-binding protein (ssb), from coxiella burnetii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
110
structure length
110
Chain Sequence
b'MARGVNKVILIGNLGQDPEVRYTPNGNAVANVTLATSTTWRDKQTGELQERTEWHRIAFFNRLAEIVGEYLRKGSKIYIEGSLRTRKWQDKNGVDRYTTEIIANEMHMLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transferase
total genus 20
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3tqyA00
4A3FG 2E5LQ 2UUCL 4BY1H 2JEAI 4LUVA 4MZ9A 3ER0A 4NXMQ 3GTOH 4BXXH 2MNAA 2JA8G 2IT1A 1UE1A 1Y1VG 3L0OA 3STBD 3U50C 4DR2Q 4KI0A 3RLOA 2ZTCA 4JBWA 4JI0Q 2ASBA 1QVCA 4KLKA 5C0XI 3Q8DA 1FJGL 2I5MX 3CC4A 1C0AA 4JYAQ 4A3CG 5ELNA 2UXDL 3OTOQ 1BBUA 1SMXA 4JI7Q 3RNUA 2R7DA 3S24A 1U5KA 2JA5H 3S1NH 1VQDA 4GN5A 3HOUG 2VNUD 1TXYA 2KHJA 3CCVA 2A1AA 3K0XA 4JC0A 2LSSA 4YY3L 4BY1G 2A19A 5C0XG 3T1HQ 3KF6A 1VQAA 1JJCB 2CWAA 4BXXG 4GS3A 1CUKA 1ASYA 1SE8A 1V43A 4B3ML 4JI1Q 4Y7NH 4IOAA 2OQKA 4GKJQ 1HH2P 1S3OA 2RF4A 4YCWA 1Q1BA 1P8LA 2UXBQ 3UDXA 2ZTEA 4HJ8A 3PGZA 2Z6KC 4LF5L 1HNWL 5BR8Q 1VS0A 3J81j 4QGUA 5J3BA 5IYBH 1TWHH 2WB1G 4BBSH 2JE6I 1J6QA 1KAWA 3KOJA 4O0AA 3KJPA 2AWOA 1VQMA 4DK6C 1IBLQ 2OWOA 2F3IA 4IPGA 3TRZA 4DV1Q 1YNXA 4JV5L 1C9OA 1KRSA 3JAMc 3RLFA 1HR0L 2VW9A 2PI2E 5H1SE 1IBKL 2R93G 4IOCA 1M1KC 1C7YA 2D0PA 2E2HH 1QVGA 4LF7Q 4LF6Q 1YHAA 1XMQQ 2Q2IA 1L2FA 4JI5L 1EYGA 3PUWA 1PYSB 4X64Q 2ID0A 4OWXB 2EXDA 1UE7A 4LNQA 3H3VH 4JI6Q 3S1MH 1EUJA 4DV0Q 1GVPA 3GTLH 4LW1A 2KHIA 2AWNA 5IYBG 2MFIA 3GTMH 4BBSG 4DR2L 1AE3A 3J7A5 5GADC 4JOIC 3L2PA 4JI0L 1S40A 4R4IA 4L5RC 2IX1A 1XNRQ 2DGYA 3CPFA 3M4QA 4JYAL 2PNHA 1P16A 3K81C 3OTOL 3RN5A 3AEVA 1JE5A 3HOXH 4JI7L 3CD6A 4DR7L 4AYBG 5LMNL 2ALYB 1HNXQ 4LFBQ 2N3SA 4R4QA 4KHZA 3I55A 3PUZA 4HIDA 3JAMi 2YTYA 3PO2H 1SFOH 2UUCQ 2RCNA 3NBHB 3SGIA 3PUVA 5LMNW 1IL2A 1EFWA 4A3LH 3FP9A 2K14A 4AQYQ 4YCUA 3ULJA 4JI1L 3UDIA 5LMUQ 5GAEC 5JJKA 4QIWE 2Z6KA 2WB1E 2YU9H 4IFDJ 1GO3E 4HJ5A 1N32Q 4GN3B 3CCQA 5M5YH 1YITA 3W1BA 1E22A 2UXDQ 4O2DA 2VS1A 1O7IA 2MO1A 2E2JH 3CCRA 5BR8L 4RMFA 4LF9L 4HIMA 5GQOA 4OO1I 1N9WA 1HZCA 3VDYA 4UPAA 1JJ2A 3S17H 2Q2HA 3S1RH 4YWKA 1VQEA 1WJJA 4JBJA 2R92G 4DR6Q 4APVA 4A3IH 1A63A 4IFDG 2F52A 2VUMH 1AH9A 4DV1L 4A3LG 1PH4A 4HJAA 1PH2A 4YWMA 3PIOA 2H5XA 1BVSA 1OXXK 2K5HA 4P75A 2VL6A 4B3MQ 4GKKL 5JEAJ 4X6AH 1I3QH 1E1TA 1A0IA 2B29A 4LF7L 4DV6Q 3FHWA 4QJFA 3K8AA 1DGSA 4JG2A 4X64L 1FVIA 1PH9A 4JOIA 2IY5B 1L1OB 1N34Q 1Q1EA 2D62A 4B3SL 1SN8A 1GKHA 1RIPA 3DM3A 3AFQA 3RZOH 1NE3A 1XTDA 5JEAG 2UU9L 5C3EH 1PH3A 3AQQA 3CQZH 5JJLA 1QUQA 1I5FA 4GOPC 2VUMG 4DR4Q 1XNRL 3G48A 2IHEA 4LFAQ 1V9PA 1OXVA 3HOVG 5GAHC 1CKOA 1R9TH 1IBKQ 4BY7H 2K4KA 4L5SA 5HY6A 1HNXL 4B3RQ 2A8VA 1A8VA 1CKNA 2NVYH 4L5TA 4LFBL 3S16H 1G6PA 1XPRA 4YHHL 3CCUA 1QZGA 1OTCA 4JI5Q 3MXNB 1X55A 3KF6B 3M4OH 1YZ6A 2E2IH 3HFZB 3OW2A 3AFPA 3FKIH 3J81c 3S1QH 4B3TL 4AQYL 1N36L 1JB7A 3PCOB 5LMUL 2JA7H 1PH6A 2ATWA 4HIKA 3UE0A 2YV5A 4DPGA 1X65A 4J15A 3RLNA 1N32L 3I2ZA 3MEFA 3A5UA 2JK8A 2JJQA 1Y1WG 3TQYA 5IYDG 3T1YL 2HHHQ 4QQBX 1VQ7A 4P72A 2BH8A 4AIMA 4NPSA 4DR7Q 2NN6G 3WWVA 5LMNQ 1W2BA 2QA4A 4DUZQ 2PQAA 2NZHA 1KC8C 1UWVA 1KL9A 1HZBA 4JCVE 4DR6L 2DUDA 1N8RC 2JQOA 2CCZA 1D7QA 1K8GA 3KLWA 2E8GA 1EQRA 1K8AC 1YHQA 1Q7YC 2MQHA 1B8AA 3CCMA 2JA7G 2ZJRA 3CMEA 1Q82C 4IJLA 1K3RA 3CF5A 4DV6L 3KDFB 4PZ7A 3J81i 4TVAB 1KHIA 5K36G 2N49A 2K5NA 3G6EA 1M90C 3G4SA 4GOPA 1N34L 1WCMH 5FLMH 4LF9Q 2JA5G 1SRUA 1SROA 1VQFA 3H15A 2PMZE 1YJWA 4ME3A 1NMGA 1IZ6A 4DR4L 4DV5L 4LFAL 1NMFA 4BBRH 1E7ZA 3B6YA 3CP0A 3HOYH 3D0FA 4R4OA 4GKKQ 2D0OA 4A3GH 4B3RL 3TS0A 1BKBA 3GTKH 1ASZA 3S15H 4A3DH 4H02A 1JMCA 1VQ9A 2K52A 3HKSA 1WFQA 2YYZA 3ULLA 5FLMG 4B3SQ 5IP7H 1XPUA 1KQSA 2C35B 1YBYA 2JA6H 2HT1A 2UU9Q 2B63H 1K0RA 2R7FA 1LUZA 4QY7A 1G291 4C3JH 5AJ3Q 3GTPH 1XMOQ 4BA1I 4LWCA 3H3VI 2KENA 2Z0SA 5IYCH 4BBRG 5IT9c 2HHHL 3GTQH 1KXLA 5E7NA 2GVBA 4JI3Q 3RN2A 1X3FA 4DUZL 1XJVA 1W3SA 3NENA 1K73C 3I4OA 3HKZG 3KF8B 2CWPA 4YHHQ 2AKWB 3S2DH 4A4IA 2KCTA 3L7ZC 1PH1A 4R4TA 4AH6A 1X56A 1XNQQ 4B3TQ 2XTIA 1N36Q 1PVOA 1PHJA 2JA6G 4KHPL 4C2MH 1CKMA 3EN2A 4IPDA 4IFDI 1HNZQ 1VQIA 1WYDA 4OXPA 5DLQE 3T1YQ 4LF4Q 2F4VQ 3I4MH 3U4VA 3BZKA 5GAGC 3HOXG 2VZAA 4DV3Q 1GD7A 5IP9H 2N8NA 1LTLA 4ALPA 1GM5A 4A3BH 3PV0A 2LXKA 4OWTB 1SLJA 2V1CC 1VQ6A 3PO2G 1JT8A 4OX9Q 1IYJB 3W5OA 1D8LA 1S72A 1K9MC 2I5LX 3RZDH 2KBNA 3CAMA 3K7AH 3OYYA 3CCJA 4HJ7A 4FDBA 3EBEA 3M3YH 1CKNB 1YVCA 4XIGS 2RHSB 3M4PA 1Q8KA 2R7ZH 3BU2A 4RG1A 1VQCA 2BA0A 3TREA 3CC7A 4GNXC 3STBC 2YTXA 4A3BG 1Z47A 4PZ6A 4GLAC 1QZHA 1Q81C 3M85A 4JBKA 1PV4A 3BZCA 1HZAA 3JC66 4A3IG 3HKZE 3H0GH 5AJ3L 1YI2A 1XMOL 5C44H 4DV5Q 2UXCL 2GVAA 2OTJA 3I7FA 4NXNQ 2Q2UA 4NB3A 2ZJQA 3CW2C 5ELOA 5IE8A 2PQAB 2GN5A 4JI3L 3ERSX 2N78A 2FXQA 4WJ3M 4DR3L 1WI5A 1I94Q 2VY3A 4EX5A 4A3FH 3HOWH 4DV2L 1G51A 3A0JA 4IPCA 4XTCS 1XNQL 3PF4A 1H95A 2NN6I 2WAQE 2ES2A 3A5ZB 4GLVB 1X54A 3W1GA 1YIJA 1NJIC 1LYLA 1UEBA 4R4CA 1Y1VH 4C3HH 1EWIA 2KCMA 2Q2TA 1VQJA 3TEHB 5C3EG 1MJCA 4HJ9A 4TQUS 1N33L 3E9HA 1PYBA 1HNZL 1EOVA 1RL2A 1WOCA 2WP8J 3LGJA 5C4XH 5M5WH 4LF4L 4LFCL 2VQEQ 4GOPB 2NVXH 4DV7Q 4DV3L 2F4VL 3CCEA 4BY7G 4A3CH 1KRTA 1EQQA 3K7UC 4K0KL 1VCIA 1J5EL 3HOUH 4DK3C 4OX9L 2QGQA 4WJ4A 1CSPA 3HOWG 1SR3A 2Y0SE 1L0WA 1EIFA 2VQFQ 1OXUA 3FKIG 1VQKA 2EQSA 2BH2A 3ZJYC 2R6GA 1E3PA 1FL0A 1L1OA 2BA1A 3J7ZC 4GNXA 4IO9A 4LF8Q 4OWWB 3PUYA 4KHPQ 5M3MH 4DUYL 2RHQB 5C0XJ 1X9NA 3NELA 3CCSA 4GLXA 2ZM6Q 3I56A 5C4XG 4DR5L 3F8TA 4P74A 1PH8A 2UUAQ 1IXRA 1PH5A 3S14H 2UUBQ 4QL5A 1VQNA 4UP8A 4A3JH 3PF5A 3S2HH 3F2DA 2NVQH 2XGTA 4JBMA 1BBWA 5C4JH 1Z9FA 4NXNL 2I0QA 2R93H 1YEZA 4HIOA 1E24A 5M3MG 1IBMQ 4DV4L 3EIVA 3U4ZA 1I94L 2CQOA 3GDEA 3IRBA 4A3KH 3PSIA 4JI8Q 1TWCH 2LXJA 4P73A 4JI2Q 2EIFA 3KFUA 1WCMG 1VQBA 4POGA 4LUOA 5FJ8H 4PZ8A 4A3JG 1AE2A 1HZ9A 1NTGA 3UE1A 3CCLA 3HOZH 1UE6A 4X65L 2UXCQ 2NVTH 1A62A 1PFSA 4PG3A 1Y14B 2L15A 1VQHA 2YTVA 2IHFA 4X62L 3A74A 2VQEL 2B3GA 4DV7L 4DR1Q 2K50A 3CXCA 4A3GG 3GO5A 4R1JA 3ICEA 3ULPA 1VQOA 4DR3Q 3RR5A 4A3DG 3KDFA 1UE5A 3I4NH 4PMWA 4A3KG 4EQ5A 1HR0W 2E5LL 3AYHB 3HOYG 1MJEA 2OTLA 1VQ5A 4DV2Q 1B7YB 2IX0A 2PI2A 3KJOA 2VQFL 4NXML 3PO3H 1MIUA 5IP7G 5FJ8G 1YJ9A 4X66Q 4A3EH 4LF8L 1OXSC 5M3FH 4POFA 2B63G 3F1ZA 1Q86C 3HOZG 2K5VA 2ZTDA 3NEMA 1LM0A 1N33Q 1TWFH 4JI4Q 5JJIA 2ZM6L 1B70B 2OCEA 1MKHA 3M9BA 5IWAQ 3PUXA 5IYCG 4LFCQ 1U0LA 4A3MH 2WAQG 3F2BA 4P71A 4K0KQ 1V1QA 3DLLA 2UUAL 2AHOB 5FLXc 1CSQA 3CPWA 1J5EQ 2UUBL 3GTGH 3I4NG 4BA2I 1E1OA 1QUQB 2R92H 1TWAH 3CMAA 3T1HL 3PO3G 1NBWA 2JEBI 3M7NA 4A3EG 2OQ0A 1KD1C 5M3FG 4UP7A 3PIPA 1T9HA 3GTJH 3G71A 4GKJL 1IBML 4YWLA 4DUYQ 1VQ8A 1VQGA 1KIXA 4DKAC 5EAYA 4YCVA 3CC2A 1QVFA 1FJGQ 2Y0SG 4JI8L 4GN4B 1L1OC 5IY0A 4DR5Q 2UXBL 2CKZB 4A3MG 3I4MG 3U58A 3UDGA 3K80C 4JI2L 4UY8C 2HIXA 2HIVA 3E0EA 5IP9G 3E9IA 2I5HA 1Q12A 1TWGH 4DAMA 4C3IH 3J80c 1PH7A 2ZJPA 3GD7A 1IBLL 4YY3Q 1I6HH 4MTNA 1VQ4A 2CFMA 3KYHC 1I50H 4DNIA 2WFWA 3TS2A 4A93H 3BJUA 4DR1L 3HOVH 1HJPA 1YJNA 4OO1G 1OXTA 5GROA 4DV4Q 1VQPA 2NZOA 4LF6L 1K83H 2R7ZG 4A75A 3UDFA 1XMQL 2QEXA 5M5XH 1XPOA 1VQLA 4IPHA 4JI6L 4LUZA 4LF5Q 4DV0L 4IJHA 1X3EA 2MO0A 4GNXB 2JA8H 1HNWQ 4X66L 1FGUA 1Q46A 4L5QA 5HGQA 4AYBE 1X6OA 2AMCB 4Y52H 1JJGA 1YHBA 3H0GG 4X65Q 5C44G 1EIYB 4JI4L 2HQLA 4DAYB 4UP9A 5IWAL 1Y1WH 4A76A 1X3GA 3J80i 4JV5Q 1HR0Q 4A93G 4X62Q 5IYDH 2JA9A 1NY4A 1PA6A 2K75A 4OONA 3D31A 3F2CA 4MNOA
chains in the Genus database with same CATH superfamily
4FO2A 1KLUD 3ER0A 2DJGC 3G7LA 4X3KA 3U9OA 3U50C 1KDBA 2F0EA 3QR8A 4JBWA 1QVCA 5C0XI 2I5MX 1C0AA 4FF4A 4A3CG 1LABA 2E2JB 5ELNA 1BBUA 4JI7Q 1AN8A 2R7DA 2V4DA 2PYKA 4F87A 3S1NH 3CCVA 3K0XA 2VUMB 3R3OA 4BY1G 1E2WA 3KF6A 1I4PA 1JJCB 4K2LA 2CWAA 1S5CD 4GS3A 1CUKA 4BXXG 1V43A 2CQAA 4ZQ3A 4JI1Q 2OQKA 1PTOH 1SDFA 2F0HA 4KMUC 3WOEA 2CVRA 4K14A 3MFYA 2A6HC 1S5FD 5KEEA 1S5DD 3KBGA 2O2LD 4O0AA 5ISRA 2F0MA 3TRZA 3P7JA 4JV5L 1KRSA 1HR0L 1MBYA 2PI2E 4IOCA 1C7YA 5IT9L 3QOJA 4LF7Q 5JVG3 5IOCA 3QO2A 1XMQQ 4FXKC 1L2FA 4MN3A 3CU7A 3A56A 2X6LA 3QOLA 4BBSG 4EQPA 5GADC 4JOIC 1DXMA 1S40A 1PMRA 2E75C 3M4QA 2L55A 3K81C 3S1NB 2K5WA 1IKMA 1JE5A 4QIWB 3D8GA 3I55A 4UDUC 4HIDA 2Q8TA 3JAMi 4LJZC 2HCIA 3NBHB 3SGIA 1IL2A 3FP9A 1PTOB 3F2UA 3ULJA 3I8ZA 5CV4A 4XQQA 1K28A 1STNA 2YU9H 1YITA 3IKJA 2UXDQ 1CHPD 2VS1A 3QJYA 2MO1A 4LF9L 5BR8L 5K36G 4HIMA 2EYHA 3S17H 4UPAA 2XRSD 5ELBA 4DR6Q 3IAYA 2IJ0A 2PQEA 2RKSA 2F52A 4IFDG 4ILWA 1AH9A 1A3TA 1SE2A 4P75A 4B3MQ 4GKKL 1M8AA 1E1TA 3HKZB 1NR4A 5C6AA 1FD7D 1PH9A 4JOIA 2RCFA 4CDDC 2JA6B 1I6VC 1K3BC 2UU9L 1EY5A 4RCNA 1I5FA 2O5IC 4ZK9B 1DOKA 4DU9A 1OXVA 5GAHC 1CQFA 1CHQD 4L5SA 4KY5A 5HY6A 2A8VA 1CKNA 2NVYH 1TS2A 1VDZA 3CCUA 1LT5D 5G3LF 4IUNA 3M4OH 1X55A 3KF6B 3HFZB 3ITPA 3K5NA 4IN3A 1N36L 3BVGA 2YU9B 3PCOB 2JA7H 3MVVA 4KY7A 1SAPA 4DPGA 3RLNA 1N32L 2AQ1B 3I2ZA 1LTTD 3TQYA 3T16A 5IYDG 4A3BB 1VQ7A 4DR7Q 1XXGA 1UWVA 3RZDB 1FR3A 1SNMA 3CRLC 4JCVE 2DUDA 1N8RC 4S3SA 1K8GA 3K5LA 1EY6A 1F2MA 2MQHA 3CCMA 1K3RA 2NBFA 4RFBA 4DV6L 4BWGB 3J81i 4TVAB 5DAUA 1SYGA 3QB3A 4RHRA 5FO7B 1SNOA 2JA5G 1LO5D 3IFTA 1SROA 1L0YB 1O7ZA 1PXUA 2XNAC 3B6YA 2F0QA 1YNND 1J9OA 2A6EC 2NYZD 3BDLA 4X3TA 4F7XA 3M4OB 3HOWB 1ASZA 4A3DH 1VF5C 1VQ9A 2RSOA 2YYZA 4B3SQ 5IP7H 1XPUA 1HQMC 2HDLA 2B63H 1K0RA 1KDCA 1LUZA 2R7FA 4C3JH 1EEID 3GTPH 1XMOQ 4BA1I 2Z0SA 5IYCH 2HHHL 2Z9HA 1E0BA 3RN2A 1XJVA 1F77A 1SYFA 3N52A 5KYIA 3S2DH 3L7ZC 2M00A 2FJ2A 2NTTA 3JAME 3D6WA 4B3TQ 2IX3A 1PVOA 5E1FA 4C2MH 4KHVA 2Z4HA 4ZKBB 1F9QA 3SK4A 3VYUA 4LF4Q 1LTAD 3U4VA 5JOBA 5GAGC 3HOXG 3DWQA 4DV3Q 5IP9H 2N8NA 1LTLA 4A3JB 1HTPA 2EE1A 1EY7A 2I07B 3URYA 2A6ED 2KBNA 3NHHA 3DEPA 4HJ7A 3AB9A 1SBBB 1CKNB 2M9VA 3M3YH 4XIGS 4A3DB 4RG1A 3E0JA 3OWFA 1VQCA 4GNXC 4DK1A 3STBC 2F1MA 1SNQA 2B63B 1GUSA 4GLAC 4C3JB 1QZHA 1KDAA 1LTBD 2UXCL 4DV5Q 5DEHA 2Z4IA 4NB3A 1B9MA 5ELOA 1KLGD 2N78A 1D1IA 3I4NB 4H7BA 1STAA 5TSSA 1I94Q 1IW7D 2H4OA 4OL7A 1EU3A 4DV2L 3A0JA 4J1MA 3PF4A 2WAQE 1HFNA 3ND8A 4GLVB 3W1GA 1NJIC 4R4CA 2O5JC 1Y1VH 3AU7A 3FRPB 4HJ9A 3SHLA 3TEHB 4R9WA 4TQUS 2BE5D 5J39A 1HNZL 1VMCA 2WP8J 2A73B 2NVXH 2MP1A 4BY7G 2HDMA 1EQQA 3K7UC 3TN2A 1VCIA 1CSPA 1ESRA 2Y0SE 1EIFA 3R8BA 1OXUA 2R6GA 3GTJB 3J7ZC 4GNXA 4KHPQ 3NXWA 4LAAA 2B2VC 4DUYL 2RHQB 4CJ0B 2JSOA 1JB3A 1GOZA 5C4XG 3F8TA 3EVQA 3J81E 1E2VA 1Y8NB 1HUMA 1PH8A 3BS1A 2K05A 2C5CA 3NBIA 2UUBQ 4QL5A 4UP8A 1I4GA 3PF5A 4U68A 3L3OC 4RAUC 4A93B 5C4JH 1STBA 4NXNL 2K28A 2I0QA 4HSPA 3UI2A 4DV4L 4LK1C 1A3VA 4CKBA 1FNWA 4FVMA 2CQOA 2RDHA 4ODGA 2JA8B 4JI2Q 2EIFA 1WCMG 5FJ8H 1Y1VB 5JPNC 2JYOA 3CCLA 1EU4A 2A68D 1WTRA 1XYIA 3HOZH 3O13A 1UE6A 2NVXB 1STYA 1CI3M 2KOLA 1Y14B 5IGGA 3G6JB 3EJIA 2FINB 2K50A 1DJRD 4HCSA 3ICEA 3ULPA 5J1ZA 1JOQA 3KDFA 3QIAA 4A3KG 4EQ5A 1HR0W 2B2VA 4PMBA 1YJ9A 4G7ZC 2SNSA 2ZTDA 1D5ZC 2EY2A 4RGOS 4G7HC 5G3LD 1KNAA 2ZM6L 1SMYD 3M9BA 1U0LA 2WAQG 3F2BA 3MHBA 5FO9B 2EYJA 3DLLA 3TDQA 4I7ZC 1CSQA 3CPWA 4KD3A 1QUQB 1KTKA 2CW0C 5C4JB 3PO3G 5IT9E 1GUNA 5EQ0A 1SE3A 3M7NA 4A3EG 2B2UC 1KD1C 5M3FG 3G71A 4WORA 1KIXA 5EAYA 1FJGQ 2Y0SG 4GN4B 4A3MG 3I4MG 4UY8C 3E0EA 3R93A 1EWCA 1Q12A 1PH7A 5JEAH 2ZJPA 1ZYRD 1VQ4A 3TS2A 2PZUA 1YJNA 5T1IA 1OXTA 2NZOA 3W3AA 1K83H 4A75A 1XMQL 2QEXA 2PCFB 2EZVA 4HN7A 2WV6D 3S1MB 1VQLA 1TS5A 4LF5Q 4IJHA 4GNXB 2MO0A 3A54A 4H44C 1HNWQ 1Q46A 4C3IG 2F4IA 2EYMA 4Y52H 3TSSA 1JJGA 4X65Q 1H9RA 1EIYB 2HQLA 1KNEA 5IWAL 2D5DA 4A76A 1Y1WH 3J80i 2SNMA 1B3AA 1PA6A 1HCZA 4FF2A 1FNUA 4XDXA 2NN6H 2RDGA 4NDXA 3F2CA 1XX8A 2B2UA 1HA6A 2BOSA 3KLRA 2JEAI 3NTIA 3DMUA 2RSNA 1B44D 2PW5A 1UE1A 4DR2Q 5M5YB 3TP6A 4JI0Q 1ONLA 4RCOA 4JYAQ 2K01A 2UXDL 4KKTA 5KRUA 3RNUA 2JN4A 4R8IA 3S24A 1VQDA 3HOUG 2VNUD 2LSSA 2VB3X 5EJWA 4YY3L 3I90A 4TKOB 2A19A 4RWSC 2HQEA 1ASYA 1SE8A 4B3ML 1U4RA 4IOAA 3MC0B 3JAML 3SVMA 1U9RA 4J8QA 4HMIA 2MUYA 4UHVA 2UXBQ 2C9OA 3UDXA 1TY2A 2ZTEA 1VS0A 3J81j 2EJGC 4QGUA 1TWHH 3NQIA 2LS01 3D6CA 2JE6I 1KAWA 3KOJA 3KJPA 1IBLQ 2AWOA 1Y1WB 2OWOA 2F3IA 3C2PA 4IPGA 1C9OA 3RLFA 2VW9A 2IL8A 1BR9A 2L12A 2E2HH 4FP5D 2KQ3A 1YHAA 2Q2IA 3MZ5A 5HGTA 1EYGA 3PUWA 4X64Q 4H0LC 4OWXB 4V0BA 4JI6Q 3P1HA 3NE5B 1GVPA 2MFIA 3J7A5 1AE3A 3L2PA 3ONAB 4L5RC 1KAAA 1XNRQ 3CPFA 1P16A 3OTOL 3RN5A 3AEVA 3RMHA 4DR7L 4C1NK 2DNEA 3C1FA 2N3SA 4LFBQ 2RCNA 5FK9C 2F0SA 1Y69U 4WRDA 1L0XB 1O78A 5LMNW 1IKLA 3N6RA 5EKKA 4A3LH 2K14A 3IFDA 4YCUA 1JWSD 2MGSA 5E4WC 3P20A 1X3PA 2BDNA 1TWHB 2E2JH 3CCRA 1BUVT 4RMFA 2K03A 4OO1I 1N9WA 1HZCA 1JJ2A 2Q2HA 1TKWB 1VQEA 1WJJA 4APVA 4A3IH 3NQTA 1IYVA 3FEWX 2VUMH 4BBRB 4DV1L 4HJAA 3Q0AA 1PH2A 3PIOA 2E2HB 2H5XA 2R61A 3SXHA 1PTOD 1A0IA 4KKUA 1R4PB 2JP1A 2AUKA 1DGSA 1TIID 3K8AA 3OIPA 3LWUA 4RGNA 5F2DA 1LTRD 1ZXTA 1N34Q 4B3SL 1SNDA 1SN8A 4QUCA 1RIPA 3J81L 3AFQA 1PH3A 3AQQA 3CQZH 5FOBB 4JVZA 4GOPC 3GTQB 4DR4Q 4IALA 3G48A 4ULLA 4CGYB 1V9PA 1O80A 3HOVG 1CKOA 1IBKQ 2K4KA 1HNXL 3J80E 1A8VA 4NW2A 4DAVA 4ZUJA 1XPRA 4JI5Q 2ZXPA 3PIO3 3MFGA 2F0TA 3OW2A 3FKIH 3S1QH 4B3TL 4AQYL 4DNRB 1ICFB 1XWEA 5LMUL 1EZ8A 4HIKA 1JC7A 2YV5A 5JPMC 4C56C 2JK8A 2JJQA 4QQBX 5I2XA 4P72A 2BH8A 2KEDA 2Z1CA 4NPSA 2DN8A 3EROA 1W6KA 2PQAA 4HR7B 2B8GA 3C3LA 1KC8C 4A3IB 5I9OA 1HA5A 2L0CA 3KLWA 4J6HA 1YHQA 4M1UB 1T5EA 2JA7G 1Q82C 1C4QA 2HD3A 1B53A 3H6MA 4H13C 1BNZA 2KECA 2K5NA 3G6EA 5DNFA 5CV6A 4GOPA 3BYTB 5BN5A 1SRUA 3CQZB 3H15A 2PMZE 3QWNA 4DV5L 4LFAL 1NMFA 5IGBA 3CP0A 4IUVA 4A3GH 1I4XA 4B3RL 3BZDB 3S15H 3IL8A 4H02A 3T56B 5C3XA 5A2QE 3HP3A 2DY8A 3FKIB 3NK9A 5IGCA 1JMCA 3S1QB 3T4AC 3M4YA 3MTSA 4QB4A 3ULLA 1YBYA 1TU2B 2JA6H 5CR3A 2LY7A 3NWSA 1G291 4DAPA 5JAVA 4LWCA 1JE4A 2KENA 1LTID 4FXGC 2L5TA 1S5ED 1QG7A 5E7NA 4JI3Q 1X3FA 5KNCA 4K5XA 4DUZL 2EPBA 3E5SA 1FYCA 3NENA 1K73C 3I4OA 1CTMA 4YHHQ 1T5XD 4RHSA 4A4IA 3SK8A 1W6JA 2KCTA 3K6OA 1XNQQ 2HCCA 2XTIA 1PHJA 5M3MB 4KHPL 2A6HD 3EN2A 3MEHA 2MJ8A 1DOMA 1VQIA 3HZXA 1WYDA 3T1YQ 1EY9A 4ALPA 4A3BH 1VQ6A 1SLJA 3PO2G 4OX9Q 1IYJB 1GUOA 2J4XA 3RZDH 5EKLA 1WD1A 4A3GB 1BO0A 3EBEA 1GHKA 2L1BA 3S15B 1YVCA 1ILPA 4HAEA 3H3VC 3M4PA 5ELDA 4DXGA 3BU2A 4GZYC 2KUMA 2YTXA 3U9SA 1KABA 1Z47A 1EY0A 3SK5A 4NKLA 3JC66 1BOSA 5AJ3L 5C44H 4KK7A 5EPLA 3I7FA 3OIQA 1WTXA 1H9SA 3FMCA 2Q2UA 2SOBA 3CW2C 5IE8A 2PQAB 4PQXA 1WI5A 1GUTA 2VY3A 1GXDC 3HOWH 1TY0A 3BYYB 1NNXA 3MXGA 4IPCA 1H95A 1FNVA 1YIJA 2G5DA 1HPCA 2Q2TA 5E3FA 5C3EG 4L63B 3E9HA 2B8FA 4K6DA 3LGJA 4GOPB 4A3CH 4MHEA 2F4VL 2IY5B 4JPBW 4YIJA 3EQLC 1MGSA 3I70A 4DK3C 4WJ4A 1SR3A 5C4HA 5JJZA 2EQSA 5M9OA 1L1OA 2MHVA 4XT3B 4PNYA 2PO4A 1X9NA 3CCSA 4IUPA 4GLXA 4DAYA 1TR5A 4P74A 4QCLA 4LMQD 2UUAQ 1TWGB 3DWAA 2RDFA 4XQNA 4A3JH 1VQNA 5C44B 1I6HB 3F2DA 2NVQH 1CM9A 2XGTA 3M7GA 3MXNA 1BBWA 2I46A 3EIVA 2HUGA 3PSIA 4DGZA 1IL8A 4P73A 1RTNA 4LUOA 1D2BA 4PZ8A 1NTGA 3UE1A 2TMPA 4X65L 5J22A 1EFID 5I6WA 1A62A 2WIIB 3VR3A 2VQEL 3HOYG 4DV7L 2IHFA 4DR1Q 1JWUD 3VR6A 3CXCA 4R1JA 4DR3Q 4P2CB 4BY1B 1UE5A 3I4NH 1A3UA 1MJEA 4CJ2C 2OTLA 4UAIA 1B7YB 2VQFL 2PI2A 1CZGA 5FJ8G 1BQQT 5NUCA 4X66Q 2KVMA 4LF8L 2F0DA 1Q86C 3HOZG 1JWMD 1TWFH 4JI4Q 1B70B 2OCEA 5D14A 1ICWA 4P71A 4K0KQ 5CV7A 4CKCA 1JQYD 5K36H 1CQVA 5FLXc 1J5EQ 2NVQB 4G7OC 2XIWA 3J80L 5KNDA 3CMAA 1TS3A 4IFDH 1O7YA 1H9SB 1NBWA 1F2ZA 1II3A 4UP7A 3TP8A 1D5XC 2Q8IB 3GTJH 1IBML 2EVBA 1B4OA 3X3MA 4DKAC 4YCVA 2OT2A 4JI8L 4DR5Q 5CV9A 2UXBL 4FNFA 2HIVA 4BBSB 3HEJA 1AZQA 2G9DA 3E9IA 1PZID 1IBLL 3CKIB 4MTNA 1I50H 4N8FA 4DNIA 2FHTA 4A93H 1PRTC 1QWYA 1CA5A 4OO1G 5GROA 2R7ZG 1AW7A 2IWHA 3H94A 4I7AA 1PZKD 3K5OA 3OW7A 4JI6L 3VYSA 3GTMB 2JA8H 1GUGA 1DOLA 4AYBE 4IQZA 2NB0A 1TWFB 2AMCB 1AZPA 1K0SA 3H0GG 4DAYB 4UP9A 1X3GA 4JV5Q 5IYDH 1HR0Q 4X62Q 2JA9A 1Q3LA 4A3FG 2E5LQ 3MA2B 4MZ9A 3GTOH 4DF7A 5A2QL 4KV6A 1EIHA 3L0OA 4C3HG 3STBD 4KI0A 3RLOA 4ZAIA 3SK6A 4G57A 2NTSA 3Q8DA 2O4XA 1Q8IA 2DJFC 1SMXA 1WTWA 2JA5H 2KHJA 1PFBA 2A1AA 1U4LA 4JC0A 3QG1A 1I50B 3T53B 2N88A 5C0XG 3T1HQ 5DM73 1TT2A 3MXUA 4Y7NH 3FVQA 4R8NA 4FF1A 1S3OA 2RF4A 1LTGD 3EA6A 1B1ZA 1F9SA 2WINB 4RA8A 1H9JA 2Z6KC 5BR8Q 2FMMA 5HURA 5J3BA 5IYBH 2WB1G 2B2TC 3C1EA 4ABNA 2HT1A 3MAQA 4DK6C 1ML0D 1YNXA 3J7AF 2N55A 5H1SE 2WACA 1IBKL 2R93G 3EFXD 3I72A 1M1KC 1JOKA 3NP8A 3S16B 1QVGA 3LX0A 2EYPA 5D3DA 4JI5L 3GTOB 1M4VA 2K33A 4LNQA 3S1MH 1EUJA 3GTLH 1EZ6A 2AWNA 2KHIA 2XN9C 3H91A 1A2UA 3D4WA 2EJFC 5L37A 1SYDA 4R4IA 2DGYA 2PZTA 2PNHA 2JA5B 3HOXH 4JI7L 4DA2A 4AYBG 2ALYB 4XQJA 1UNSA 1BCPF 4ZCKA 1SFOH 4XYOA 2UUCQ 2AUJD 3WOFA 4Y7NB 1RTOA 3RUZA 4JI1L 3S9WA 2RVLA 1Y8OB 3NUCA 4IUQA 3OPOA 4QIWE 1YNJC 2Z6KA 4DNTB 4HJ5A 1N32Q 4GN3B 4QUFA 5M5YH 3W1BA 2B2TA 1E22A 1DM0B 2QDLA 1O7IA 1WTOA 4K8IA 2SEBD 5GQOA 3VDYA 4YWKA 2R92G 2EYFA 1A63A 3KF8A 4A3LG 1SE4A 1STHA 2VL6A 4ZKCB 5JEAJ 1I3QH 2B29A 4LF7L 3GTKB 1A6XA 4DV6Q 3FHWA 2EDGA 4EQNA 5E4XA 3GTLB 1DD2A 5COYA 2RA4A 1UAPA 1MSHA 3RZOH 1XTDA 4DXFA 3K58A 5JJLA 4HMJA 2VUMG 3TMEA 5BN3A 3HOXB 2CW0D 1HRJA 5EPKA 4BY7H 1PRTB 1EWHA 1SFOB 1G6PA 2F0LA 4L5TA 4YHHL 2VXWA 1RDPD 1RD9D 1G6ZA 2EYOA 4TRDA 3BDOA 3NTKA 2EY6A 1X65A 4J15A 1V1OA 3MEFA 3TBIB 3T1YL 2QILA 2HHHQ 4AIMA 5LMNQ 3DUZA 2NZHA 1KL9A 1HZBA 4DR6L 2CCZA 1D7QA 4N8X1 3NWTA 2E8GA 1EQRA 4XXEA 5CMDA 1I3QB 1B8AA 2ZJRA 2LKVA 3CMEA 1QE6A 4G4KA 3KDFB 4PZ7A 2ZT9C 3PQIA 5KIXA 2CH4A 1KHIA 2KCNA 1FGBD 2N49A 1LLRD 5ELFA 1WCMH 5FLMH 3RZOB 2X6GA 3AMUA 3E3XA 1YJWA 4O42A 1TVXA 2Q8RE 1IZ6A 2FFKB 2QDBA 4BY7B 3Q24A 4BBRH 2J0TD 4HCEA 3DM1A 1AFPA 3D0FA 3BVZA 2D0OA 5EKIA 4TSSA 3R2IA 2OEOA 1LV9A 1DCZA 1BXTA 3HKSA 1KQSA 1HHVA 3H09A 4IZ8A 4QY7A 5C4XB 3GTQH 2GVBA 1RHPA 1W3SA 2K04A 3HKZG 3KF8B 5FLXL 4IUUA 4B9WA 4R4TA 3CRKC 2JA6G 1CKMA 3K0YA 1HNZQ 5ELEA 5DLQE 3I91A 1WCMB 2BCOA 2F0FA 2KCCA 3I4MH 3BZKA 4KN7C 2QW7A 2OXPA 2LXKA 4OWTB 2V1CC 4X3UA 4ZUIA 1Z6HA 3W5OA 1S72A 1EQVA 2I5LX 1EYCA 4ZRZA 4Q5VA 4FDBA 3CHBD 5C3WA 3D4RA 3T51B 3W2DA 4A3KB 1Q8KA 2J7ZA 1QNUA 2NWGA 1GHJA 1B2TA 3CC7A 3NTHA 4F8MA 4A3BG 1BCPC 4PZ6A 5I6YA 2F0JA 3M85A 3BZCA 4JK1C 5CBEE 2Z8LA 4RGTA 1XMOL 2GVAA 2WAQB 2OTJA 4NXNQ 4IUTA 1PZJD 2ZJQA 3ERSX 3VA5A 2RQXA 2FXQA 1MD2D 4WJ3M 4DR3L 5I2YA 4EX5A 3PO3B 2E74C 4EQOA 4DK0A 5AFWA 4A3EB 3A8KE 5M3FB 2NN6I 2QCPX 2ES2A 1WTVA 1X54A 1LYLA 1UEBA 1EWIA 2KCMA 4QF4A 4RH6A 2Y0SB 4A3MB 3I4MB 1EOVA 1RL2A 1WOCA 2AQ3B 3X3NA 5M5WH 4LF4L 4DV3L 4K0KL 1J5EL 3HOUH 2R92B 1TWAB 5D65A 3A8JE 2QGQA 1JR0D 3HOWG 2L4NA 2BH2A 2A5HA 1E3PA 3BG3A 4OWWB 3PUYA 1EQTA 5M3MH 3ND9A 4KD4A 1BCPD 1PYWD 1EL0A 2ZM6Q 4DR5L 1ZKOA 3FPUB 1SYCA 2QEJC 1V1PA 1PH5A 5KYLA 4C3IB 3S14H 2VB2X 4OGQC 4OELB 1HUNA 3I4LA 4JBMA 1Z9FA 4K8JA 5C5LA 2GA4B 2IW3A 4HIOA 1E24A 1I94L 2G9HD 2K7VA 3IRBA 2LMCB 2LXJA 2CHBD 2F0NA 5JVH3 1SXTA 1NAPA 1ZEQX 3KFUA 1VQBA 4POGA 1BF4A 3OHXC 1JOOA 2NZ1D 4A3JG 2WKCA 1AE2A 1WTPA 4CJ1B 5M5WB 1MI2A 4I65A 2NVTH 3C46A 1NSNS 5IIFA 1AP0A 2NUCA 2SDFA 4PG3A 4X62L 4K5VA 2B3GA 3HOUB 1VQOA 2EYLA 3RR5A 4A3DG 4PMWA 3DEOA 2F0OA 2E5LL 5IODA 1X32A 2IX0A 5IP7G 5BN4A 1OXSC 3Q23A 4POFA 1PRTF 2B63G 2K5VA 1QJOA 3GV3A 3KBXA 4C3JG 1LM0A 1N33Q 1HFGA 5IWAQ 5IYCG 4LFCQ 4OIKA 4WJWA 3S14B 4IURA 1RJTA 4OEMB 3V05A 2UUBL 4KJOA 3I4NG 4BA2I 4JW0A 1LACA 3K57A 1EYAA 5T1GA 3T1HL 1SNPA 2JEBI 3D4DA 3FPPA 4DFAA 2OQ0A 3E6ZX 1A2TA 2KEEA 1VQ8A 1L1OC 4KTAA 3K80C 4JI2L 5A35A 5IP9G 1DONA 1B9NA 1G8ZD 1H9MA 1TWGH 2ICEC 4MTKA 4DAMA 2NVTB 2F3VA 2B2WC 4M8AA 4YY3Q 3V96A 1I6HH 2CFMA 2PZWA 3VYRA 3BJUA 3HOVH 3PMFA 4ZYSA 2E76C 1HXYD 5M5XH 1XPOA 4IPHA 1F9PA 3KLSX 1HQRD 2K5DA 2AQ2B 1JICA 1FGUA 2EY5A 1QCBD 1I4RA 3HG9A 2ZXRA 4CBVA 1BCPB 5LHY1 4A93G 1V1PB 1NY4A 4OONA 1VF7A 3DHQA 2JXMB 1EY4A 4FXDA 5D3IB 2UUCL 4BY1H 4LUVA 1YNNC 4NXMQ 4BXXH 1ET6A 2MNAA 2JA8G 2IT1A 3LNNA 4XYQA 1Y1VG 1DYQA 2ZTCA 1WD0A 2ASBA 1SYBA 4KLKA 1FJGL 3CC4A 1EOTA 2B2WA 5EBCA 1PLFA 3BVMA 1LT4D 3OTOQ 3S17B 1E2ZA 4F88A 3ZYYX 1WVLA 1U5KA 4GN5A 1TXYA 1GUWA 2WKDA 3HOVB 1VQAA 2F3WA 1CA6A 4GKJQ 1HH2P 5M5XB 4YCWA 3NSWA 3GV6A 5CV8A 1Q1BA 1P8LA 1ILQA 1H9KA 1X3QA 4HJ8A 3PGZA 4LF5L 1HNWL 4EGVA 2X69A 4BBSH 3R2TA 1J8IA 1VQMA 1J6QA 2QKIC 5IGFA 4X3SA 4DV1Q 4K6LA 3TZUA 3JAMc 4NMZA 2NVYB 2D0PA 4LF6Q 2XVSA 2F0IA 1PYSB 2ID0A 4L6TB 5C5MA 2EXDA 3KLSA 1UE7A 3H3VH 1LT6D 4DV0Q 2JA7B 4LW1A 5IYBG 3GTMH 4DR2L 2F0GA 4JI0L 2A69C 2IX1A 4JYAL 2EY1A 3OMGA 3VR5A 3CD6A 1F2LA 3MWYW 5LMNL 1V8QA 1HNXQ 4R4QA 2B39A 2FMCA 4KHZA 3PUZA 3VYTA 3PO2H 2YTYA 1SNCA 1NR2A 3PUVA 4C1NI 1EFWA 1Y8PB 4KN4C 4ID6A 4AQYQ 3UDIA 5LMUQ 5GAEC 1IW7C 3L9AX 2PPBC 5JJKA 2WB1E 3OMCA 4IFDJ 1GO3E 1SEBD 3CCQA 1ENFA 4Q0FA 4O2DA 3V2TA 4QMGA 1U4PA 2XSCA 5K5PA 5LL6S 2BE5C 3S1RH 5I4DA 2PNRC 4JBJA 4CKEA 1PH4A 4YWMA 3SR1A 1BVSA 1OXXK 2K5HA 4CDEC 5FLXE 1BDOA 4X6AH 3K5MA 4QJFA 3I73A 4JG2A 5CORA 4X64L 1FVIA 2CH4W 2A69D 1L1OB 1Q1EA 2D62A 3KUPA 1GKHA 3DM3A 1NE3A 5JEAG 3GTPB 1K8OA 4CDFC 5C3EH 1QUQA 1ENAA 3TP5A 1XNRL 2IHEA 4LFAQ 5I9PA 1SJHD 1R9TH 5EGTA 1VMPA 3PO2B 4B3RQ 4LFBL 1UEAB 3S2DB 3S16H 3DWPA 1XTCD 1QZGA 1OTCA 3A8IE 3MXNB 3BDCA 1NUCA 1YZ6A 2E2IH 2B2YC 3AFPA 4OIJA 3J81c 4WFN3 3WDNA 4C2MB 1JB7A 3HGBA 1PH6A 2ATWA 3UE0A 3A5UA 1Y1WG 4L8JA 1I4QA 1C8CA 2A68C 2NN6G 4KY6A 3WWVA 3S1RB 2QA4A 4DUZQ 1W2BA 1PRTD 2XWJB 1LTSD 5ELCA 4FF3A 2JQOA 5KNBA 1RKNA 4E6IA 1K8AC 3M3YB 1Q7YC 4HSVA 1O7LA 3TZDA 2PMZB 4IJLA 3CF5A 4BS9A 3VA7A 2XRQD 1WTHA 1M90C 3G4SA 1N34L 4LF9Q 1PTOF 3VR4A 5C3EB 1VQFA 1SMYC 1BBXC 4ME3A 1NMGA 1QILA 3A7LA 3GP7A 1G91A 4DR4L 1RF2D 2RBMA 1R9TB 5IGDA 1E7ZA 2MPMA 1EEFD 3HOYH 4R4OA 4GKKQ 2B2YA 3K59A 5EPJA 3TS0A 1BKBA 3GTKH 2E2IB 3A55A 2F0KA 1A15A 2K52A 1WFQA 5FLMG 5FO8B 1GJXA 2C35B 4KKSA 4V190 3NPPA 2UU9Q 2PW7A 5AJ3Q 3H3VI 3J7AV 2ENBA 4RKBA 4BBRG 5IT9c 1QOHA 1KXLA 1ZYRC 2TSSA 1EYDA 2CWPA 2AKWB 3DXJC 3D3RA 1QNKA 1PH1A 1AEXA 3SDZA 4AH6A 1X56A 2KJXA 1TS4A 1N36Q 1MSGA 4NP5A 4K2KA 1SYEA 4N9PA 4RKLA 1B50A 3HRZC 2L11A 4IPDA 4IFDI 1DZ1A 5KGUA 4OXPA 1EIGA 1STEA 2F4VQ 2VZAA 1GD7A 1GM5A 3PV0A 4MIUA 3A7AB 1JT8A 4ZLTF 1JORA 1D8LA 1K9MC 1ENCA 3CAMA 3HOYB 3K7AH 1LT3D 3OYYA 3RD4A 3CCJA 5CGKA 2K1BA 4CDCC 3LWEA 2DNCA 2KA7A 2RHSB 4OO1H 1CFMA 2R7ZH 4FYDA 2BA0A 3TREA 1Q90A 1C48A 5CBAE 3HOZB 1Q81C 2KHSA 1RCVD 4JBKA 1PV4A 1HZAA 1F2YA 4A3IG 1U4MA 3HKZE 3H0GH 1YI2A 4B9XA 1S4ZA 5FKAC 2GN5A 2K6AA 3OSOA 4JI3L 3MXPA 2K32A 2EXZA 1IYUA 4A3FH 1SJED 1YNJD 4U673 2D9UA 1G51A 4XTCS 2IPKD 1XNQL 3A5ZB 4C3HH 1VQJA 1MJCA 2DY7A 3VR2A 1N33L 1PYBA 1RODA 2E2DC 5C4XH 4LFCL 2VQEQ 4DV7Q 3CCEA 1KRTA 5DM63 2LFNA 1S5BD 4ME5A 4OX9L 1QB5D 4OHJA 3K7AB 2QF7A 5C0XH 1L0WA 1VQKA 2A74C 2VQFQ 3FKIG 1TQOA 3ZJYC 1FL0A 4IO9A 4LF8Q 2BA1A 3OOCA 4CHTB 2R7ZB 1HTLD 5C0XJ 3NELA 3I56A 5C4ZA 2ZXOA 2F0PA 3TP7A 1G2SA 1SSOA 3I3CA 1IXRA 1D6EC 3T13A 3SEBA 1D1KA 1UUPA 5CC4A 4RGMA 3H0GB 2ICIA 3S2HH 5LL6X 4K5WA 2R93H 1YEZA 1K83B 5M3MG 1IBMQ 4A3FB 1EY8A 4HTHA 3U4ZA 3GDEA 4A3KH 4JI8Q 1TWCH 4C3HB 4B08A 1HZ9A 2P5ZX 3J7YW 2UXCQ 1JCKB 1PFSA 3FDTA 1MHWC 2F0VA 1VQHA 2L15A 2YTVA 3A74A 3KK7A 4A3GG 3GO5A 2EJMA 1ET9A 4DN4M 3AYHB 1PTOC 4DV2Q 5EBDA 2M2LA 3KJOA 1VQ5A 4NXML 3PO3H 4N9TA 1MIUA 3ERQA 4A3EH 1NCVA 5M3FH 3OWEB 4HEDA 5CYUA 4PV1C 3F1ZA 2L9HA 3SE0A 2K5QA 3NEMA 5JJIA 1MKHA 1WTQA 1D5MC 3PUXA 4PMCA 4A3MH 2XWBB 1V1QA 2WB1B 1B3QA 1CZWA 2AHOB 2UUAL 3S2HB 3GTGH 3Q6SA 1E1OA 1K8MA 5IGEA 1CK1A 4O1NA 2R92H 1I4HA 1TWAH 2F0WA 2R93B 1ESFA 1PFMA 2F0UA 2BDOA 3PIPA 1T9HA 4GKJL 4YWLA 1R4QB 1OO9B 4DUYQ 1VQGA 4XT1B 1TWCB 3CC2A 1QVFA 5IY0A 4EVOA 2CKZB 3HS0C 3U58A 3UDGA 2HIXA 1Z7TA 2I5HA 1CT1D 3J80c 4C3IH 5CV5A 3GD7A 3P75A 2D2CC 1G2TA 1STGA 3KYHC 3NBHA 2WFWA 4AYBB 4DR1L 1HJPA 1F9RA 4LF6L 4DV4Q 1VQPA 2R3ZA 3UDFA 2EOTA 1PDQA 3GQBA 1PFNA 1IHZA 4LUZA 3PIP3 4DV0L 1X3EA 4X66L 4L5QA 5HGQA 1X6OA 1YHBA 4Z9CB 5C44G 4JI4L 4KJNA 2H1EA 3Q22A 2K75A 3GTGB 2OF1A 3D31A 2F03A 4MNOA 2Z6BA
chains in the Genus database with same CATH topology
4A3FG 2E5LQ 2UUCL 4BY1H 2JEAI 4LUVA 4MZ9A 3ER0A 4NXMQ 3GTOH 4BXXH 2MNAA 2JA8G 2IT1A 1UE1A 1Y1VG 3L0OA 3STBD 3U50C 4DR2Q 4KI0A 3RLOA 2ZTCA 4JBWA 4JI0Q 2ASBA 1QVCA 4KLKA 5C0XI 3Q8DA 1FJGL 2I5MX 3CC4A 1C0AA 4JYAQ 4A3CG 5ELNA 2UXDL 3OTOQ 1BBUA 1SMXA 4JI7Q 3RNUA 2R7DA 3S24A 1U5KA 2JA5H 3S1NH 1VQDA 4GN5A 3HOUG 2VNUD 1TXYA 2KHJA 3CCVA 2A1AA 3K0XA 4JC0A 2LSSA 4YY3L 4BY1G 2A19A 5C0XG 3T1HQ 3KF6A 1VQAA 1JJCB 2CWAA 4BXXG 4GS3A 1CUKA 1ASYA 1SE8A 1V43A 4B3ML 4JI1Q 4Y7NH 4IOAA 2OQKA 4GKJQ 1HH2P 1S3OA 2RF4A 4YCWA 1Q1BA 1P8LA 2UXBQ 3UDXA 2ZTEA 4HJ8A 3PGZA 2Z6KC 4LF5L 1HNWL 5BR8Q 1VS0A 3J81j 4QGUA 5J3BA 5IYBH 1TWHH 2WB1G 4BBSH 2JE6I 1J6QA 1KAWA 3KOJA 4O0AA 3KJPA 2AWOA 1VQMA 4DK6C 1IBLQ 2OWOA 2F3IA 4IPGA 3TRZA 4DV1Q 1YNXA 4JV5L 1C9OA 1KRSA 3JAMc 3RLFA 1HR0L 2VW9A 2PI2E 5H1SE 1IBKL 2R93G 4IOCA 1M1KC 1C7YA 2D0PA 2E2HH 1QVGA 4LF7Q 4LF6Q 1YHAA 1XMQQ 2Q2IA 1L2FA 4JI5L 1EYGA 3PUWA 1PYSB 4X64Q 2ID0A 4OWXB 2EXDA 1UE7A 4LNQA 3H3VH 4JI6Q 3S1MH 1EUJA 4DV0Q 1GVPA 3GTLH 4LW1A 2KHIA 2AWNA 5IYBG 2MFIA 3GTMH 4BBSG 4DR2L 1AE3A 3J7A5 5GADC 4JOIC 3L2PA 4JI0L 1S40A 4R4IA 4L5RC 2IX1A 1XNRQ 2DGYA 3CPFA 3M4QA 4JYAL 2PNHA 1P16A 3K81C 3OTOL 3RN5A 3AEVA 1JE5A 3HOXH 4JI7L 3CD6A 4DR7L 4AYBG 5LMNL 2ALYB 1HNXQ 4LFBQ 2N3SA 4R4QA 4KHZA 3I55A 3PUZA 4HIDA 3JAMi 2YTYA 3PO2H 1SFOH 2UUCQ 2RCNA 3NBHB 3SGIA 3PUVA 5LMNW 1IL2A 1EFWA 4A3LH 3FP9A 2K14A 4AQYQ 4YCUA 3ULJA 4JI1L 3UDIA 5LMUQ 5GAEC 5JJKA 4QIWE 2Z6KA 2WB1E 2YU9H 4IFDJ 1GO3E 4HJ5A 1N32Q 4GN3B 3CCQA 5M5YH 1YITA 3W1BA 1E22A 2UXDQ 4O2DA 2VS1A 1O7IA 2MO1A 2E2JH 3CCRA 5BR8L 4RMFA 4LF9L 4HIMA 5GQOA 4OO1I 1N9WA 1HZCA 3VDYA 4UPAA 1JJ2A 3S17H 2Q2HA 3S1RH 4YWKA 1VQEA 1WJJA 4JBJA 2R92G 4DR6Q 4APVA 4A3IH 1A63A 4IFDG 2F52A 2VUMH 1AH9A 4DV1L 4A3LG 1PH4A 4HJAA 1PH2A 4YWMA 3PIOA 2H5XA 1BVSA 1OXXK 2K5HA 4P75A 2VL6A 4B3MQ 4GKKL 5JEAJ 4X6AH 1I3QH 1E1TA 1A0IA 2B29A 4LF7L 4DV6Q 3FHWA 4QJFA 3K8AA 1DGSA 4JG2A 4X64L 1FVIA 1PH9A 4JOIA 2IY5B 1L1OB 1N34Q 1Q1EA 2D62A 4B3SL 1SN8A 1GKHA 1RIPA 3DM3A 3AFQA 3RZOH 1NE3A 1XTDA 5JEAG 2UU9L 5C3EH 1PH3A 3AQQA 3CQZH 5JJLA 1QUQA 1I5FA 4GOPC 2VUMG 4DR4Q 1XNRL 3G48A 2IHEA 4LFAQ 1V9PA 1OXVA 3HOVG 5GAHC 1CKOA 1R9TH 1IBKQ 4BY7H 2K4KA 4L5SA 5HY6A 1HNXL 4B3RQ 2A8VA 1A8VA 1CKNA 2NVYH 4L5TA 4LFBL 3S16H 1G6PA 1XPRA 4YHHL 3CCUA 1QZGA 1OTCA 4JI5Q 3MXNB 1X55A 3KF6B 3M4OH 1YZ6A 2E2IH 3HFZB 3OW2A 3AFPA 3FKIH 3J81c 3S1QH 4B3TL 4AQYL 1N36L 1JB7A 3PCOB 5LMUL 2JA7H 1PH6A 2ATWA 4HIKA 3UE0A 2YV5A 4DPGA 1X65A 4J15A 3RLNA 1N32L 3I2ZA 3MEFA 3A5UA 2JK8A 2JJQA 1Y1WG 3TQYA 5IYDG 3T1YL 2HHHQ 4QQBX 1VQ7A 4P72A 2BH8A 4AIMA 4NPSA 4DR7Q 2NN6G 3WWVA 5LMNQ 1W2BA 2QA4A 4DUZQ 2PQAA 2NZHA 1KC8C 1UWVA 1KL9A 1HZBA 4JCVE 4DR6L 2DUDA 1N8RC 2JQOA 2CCZA 1D7QA 1K8GA 3KLWA 2E8GA 1EQRA 1K8AC 1YHQA 1Q7YC 2MQHA 1B8AA 3CCMA 2JA7G 2ZJRA 3CMEA 1Q82C 4IJLA 1K3RA 3CF5A 4DV6L 3KDFB 4PZ7A 3J81i 4TVAB 1KHIA 5K36G 2N49A 2K5NA 3G6EA 1M90C 3G4SA 4GOPA 1N34L 1WCMH 5FLMH 4LF9Q 2JA5G 1SRUA 1SROA 1VQFA 3H15A 2PMZE 1YJWA 4ME3A 1NMGA 1IZ6A 4DR4L 4DV5L 4LFAL 1NMFA 4BBRH 1E7ZA 3B6YA 3CP0A 3HOYH 3D0FA 4R4OA 4GKKQ 2D0OA 4A3GH 4B3RL 3TS0A 1BKBA 3GTKH 1ASZA 3S15H 4A3DH 4H02A 1JMCA 1VQ9A 2K52A 3HKSA 1WFQA 2YYZA 3ULLA 5FLMG 4B3SQ 5IP7H 1XPUA 1KQSA 2C35B 1YBYA 2JA6H 2HT1A 2UU9Q 2B63H 1K0RA 2R7FA 1LUZA 4QY7A 1G291 4C3JH 5AJ3Q 3GTPH 1XMOQ 4BA1I 4LWCA 3H3VI 2KENA 2Z0SA 5IYCH 4BBRG 5IT9c 2HHHL 3GTQH 1KXLA 5E7NA 2GVBA 4JI3Q 3RN2A 1X3FA 4DUZL 1XJVA 1W3SA 3NENA 1K73C 3I4OA 3HKZG 3KF8B 2CWPA 4YHHQ 2AKWB 3S2DH 4A4IA 2KCTA 3L7ZC 1PH1A 4R4TA 4AH6A 1X56A 1XNQQ 4B3TQ 2XTIA 1N36Q 1PVOA 1PHJA 2JA6G 4KHPL 4C2MH 1CKMA 3EN2A 4IPDA 4IFDI 1HNZQ 1VQIA 1WYDA 4OXPA 5DLQE 3T1YQ 4LF4Q 2F4VQ 3I4MH 3U4VA 3BZKA 5GAGC 3HOXG 2VZAA 4DV3Q 1GD7A 5IP9H 2N8NA 1LTLA 4ALPA 1GM5A 4A3BH 3PV0A 2LXKA 4OWTB 1SLJA 2V1CC 1VQ6A 3PO2G 1JT8A 4OX9Q 1IYJB 3W5OA 1D8LA 1S72A 1K9MC 2I5LX 3RZDH 2KBNA 3CAMA 3K7AH 3OYYA 3CCJA 4HJ7A 4FDBA 3EBEA 3M3YH 1CKNB 1YVCA 4XIGS 2RHSB 3M4PA 1Q8KA 2R7ZH 3BU2A 4RG1A 1VQCA 2BA0A 3TREA 3CC7A 4GNXC 3STBC 2YTXA 4A3BG 1Z47A 4PZ6A 4GLAC 1QZHA 1Q81C 3M85A 4JBKA 1PV4A 3BZCA 1HZAA 3JC66 4A3IG 3HKZE 3H0GH 5AJ3L 1YI2A 1XMOL 5C44H 4DV5Q 2UXCL 2GVAA 2OTJA 3I7FA 4NXNQ 2Q2UA 4NB3A 2ZJQA 3CW2C 5ELOA 5IE8A 2PQAB 2GN5A 4JI3L 3ERSX 2N78A 2FXQA 4WJ3M 4DR3L 1WI5A 1I94Q 2VY3A 4EX5A 4A3FH 3HOWH 4DV2L 1G51A 3A0JA 4IPCA 4XTCS 1XNQL 3PF4A 1H95A 2NN6I 2WAQE 2ES2A 3A5ZB 4GLVB 1X54A 3W1GA 1YIJA 1NJIC 1LYLA 1UEBA 4R4CA 1Y1VH 4C3HH 1EWIA 2KCMA 2Q2TA 1VQJA 3TEHB 5C3EG 1MJCA 4HJ9A 4TQUS 1N33L 3E9HA 1PYBA 1HNZL 1EOVA 1RL2A 1WOCA 2WP8J 3LGJA 5C4XH 5M5WH 4LF4L 4LFCL 2VQEQ 4GOPB 2NVXH 4DV7Q 4DV3L 2F4VL 3CCEA 4BY7G 4A3CH 1KRTA 1EQQA 3K7UC 4K0KL 1VCIA 1J5EL 3HOUH 4DK3C 4OX9L 2QGQA 4WJ4A 1CSPA 3HOWG 1SR3A 2Y0SE 1L0WA 1EIFA 2VQFQ 1OXUA 3FKIG 1VQKA 2EQSA 2BH2A 3ZJYC 2R6GA 1E3PA 1FL0A 1L1OA 2BA1A 3J7ZC 4GNXA 4IO9A 4LF8Q 4OWWB 3PUYA 4KHPQ 5M3MH 4DUYL 2RHQB 5C0XJ 1X9NA 3NELA 3CCSA 4GLXA 2ZM6Q 3I56A 5C4XG 4DR5L 3F8TA 4P74A 1PH8A 2UUAQ 1IXRA 1PH5A 3S14H 2UUBQ 4QL5A 1VQNA 4UP8A 4A3JH 3PF5A 3S2HH 3F2DA 2NVQH 2XGTA 4JBMA 1BBWA 5C4JH 1Z9FA 4NXNL 2I0QA 2R93H 1YEZA 4HIOA 1E24A 5M3MG 1IBMQ 4DV4L 3EIVA 3U4ZA 1I94L 2CQOA 3GDEA 3IRBA 4A3KH 3PSIA 4JI8Q 1TWCH 2LXJA 4P73A 4JI2Q 2EIFA 3KFUA 1WCMG 1VQBA 4POGA 4LUOA 5FJ8H 4PZ8A 4A3JG 1AE2A 1HZ9A 1NTGA 3UE1A 3CCLA 3HOZH 1UE6A 4X65L 2UXCQ 2NVTH 1A62A 1PFSA 4PG3A 1Y14B 2L15A 1VQHA 2YTVA 2IHFA 4X62L 3A74A 2VQEL 2B3GA 4DV7L 4DR1Q 2K50A 3CXCA 4A3GG 3GO5A 4R1JA 3ICEA 3ULPA 1VQOA 4DR3Q 3RR5A 4A3DG 3KDFA 1UE5A 3I4NH 4PMWA 4A3KG 4EQ5A 1HR0W 2E5LL 3AYHB 3HOYG 1MJEA 2OTLA 1VQ5A 4DV2Q 1B7YB 2IX0A 2PI2A 3KJOA 2VQFL 4NXML 3PO3H 1MIUA 5IP7G 5FJ8G 1YJ9A 4X66Q 4A3EH 4LF8L 1OXSC 5M3FH 4POFA 2B63G 3F1ZA 1Q86C 3HOZG 2K5VA 2ZTDA 3NEMA 1LM0A 1N33Q 1TWFH 4JI4Q 5JJIA 2ZM6L 1B70B 2OCEA 1MKHA 3M9BA 5IWAQ 3PUXA 5IYCG 4LFCQ 1U0LA 4A3MH 2WAQG 3F2BA 4P71A 4K0KQ 1V1QA 3DLLA 2UUAL 2AHOB 5FLXc 1CSQA 3CPWA 1J5EQ 2UUBL 3GTGH 3I4NG 4BA2I 1E1OA 1QUQB 2R92H 1TWAH 3CMAA 3T1HL 3PO3G 1NBWA 2JEBI 3M7NA 4A3EG 2OQ0A 1KD1C 5M3FG 4UP7A 3PIPA 1T9HA 3GTJH 3G71A 4GKJL 1IBML 4YWLA 4DUYQ 1VQ8A 1VQGA 1KIXA 4DKAC 5EAYA 4YCVA 3CC2A 1QVFA 1FJGQ 2Y0SG 4JI8L 4GN4B 1L1OC 5IY0A 4DR5Q 2UXBL 2CKZB 4A3MG 3I4MG 3U58A 3UDGA 3K80C 4JI2L 4UY8C 2HIXA 2HIVA 3E0EA 5IP9G 3E9IA 2I5HA 1Q12A 1TWGH 4DAMA 4C3IH 3J80c 1PH7A 2ZJPA 3GD7A 1IBLL 4YY3Q 1I6HH 4MTNA 1VQ4A 2CFMA 3KYHC 1I50H 4DNIA 2WFWA 3TS2A 4A93H 3BJUA 4DR1L 3HOVH 1HJPA 1YJNA 4OO1G 1OXTA 5GROA 4DV4Q 1VQPA 2NZOA 4LF6L 1K83H 2R7ZG 4A75A 3UDFA 1XMQL 2QEXA 5M5XH 1XPOA 1VQLA 4IPHA 4JI6L 4LUZA 4LF5Q 4DV0L 4IJHA 1X3EA 2MO0A 4GNXB 2JA8H 1HNWQ 4X66L 1FGUA 1Q46A 4L5QA 5HGQA 4AYBE 1X6OA 2AMCB 4Y52H 1JJGA 1YHBA 3H0GG 4X65Q 5C44G 1EIYB 4JI4L 2HQLA 4DAYB 4UP9A 5IWAL 1Y1WH 4A76A 1X3GA 3J80i 4JV5Q 1HR0Q 4A93G 4X62Q 5IYDH 2JA9A 1NY4A 1PA6A 2K75A 4OONA 3D31A 3F2CA 4MNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3F G;  2E5L Q;  2UUC L;  4BY1 H;  2JEA I;  4LUV A;  4MZ9 A;  3ER0 A;  4NXM Q;  3GTO H;  4BXX H;  2MNA A;  2JA8 G;  2IT1 A;  1UE1 A;  1Y1V G;  3L0O A;  3STB D;  3U50 C;  4DR2 Q;  4KI0 A;  3RLO A;  2ZTC A;  4JBW A;  4JI0 Q;  2ASB A;  1QVC A;  4KLK A;  5C0X I;  3Q8D A;  1FJG L;  2I5M X;  3CC4 A;  1C0A A;  4JYA Q;  4A3C G;  5ELN A;  2UXD L;  3OTO Q;  1BBU A;  1SMX A;  4JI7 Q;  3RNU A;  2R7D A;  3S24 A;  1U5K A;  2JA5 H;  3S1N H;  1VQD A;  4GN5 A;  3HOU G;  2VNU D;  1TXY A;  2KHJ A;  3CCV A;  2A1A A;  3K0X A;  4JC0 A;  2LSS A;  4YY3 L;  4BY1 G;  2A19 A;  5C0X G;  3T1H Q;  3KF6 A;  1VQA A;  1JJC B;  2CWA A;  4BXX G;  4GS3 A;  1CUK A;  1ASY A;  1SE8 A;  1V43 A;  4B3M L;  4JI1 Q;  4Y7N H;  4IOA A;  2OQK A;  4GKJ Q;  1HH2 P;  1S3O A;  2RF4 A;  4YCW A;  1Q1B A;  1P8L A;  2UXB Q;  3UDX A;  2ZTE A;  4HJ8 A;  3PGZ A;  2Z6K C;  4LF5 L;  1HNW L;  5BR8 Q;  1VS0 A;  3J81 j;  4QGU A;  5J3B A;  5IYB H;  1TWH H;  2WB1 G;  4BBS H;  2JE6 I;  1J6Q A;  1KAW A;  3KOJ A;  4O0A A;  3KJP A;  2AWO A;  1VQM A;  4DK6 C;  1IBL Q;  2OWO A;  2F3I A;  4IPG A;  3TRZ A;  4DV1 Q;  1YNX A;  4JV5 L;  1C9O A;  1KRS A;  3JAM c;  3RLF A;  1HR0 L;  2VW9 A;  2PI2 E;  5H1S E;  1IBK L;  2R93 G;  4IOC A;  1M1K C;  1C7Y A;  2D0P A;  2E2H H;  1QVG A;  4LF7 Q;  4LF6 Q;  1YHA A;  1XMQ Q;  2Q2I A;  1L2F A;  4JI5 L;  1EYG A;  3PUW A;  1PYS B;  4X64 Q;  2ID0 A;  4OWX B;  2EXD A;  1UE7 A;  4LNQ A;  3H3V H;  4JI6 Q;  3S1M H;  1EUJ A;  4DV0 Q;  1GVP A;  3GTL H;  4LW1 A;  2KHI A;  2AWN A;  5IYB G;  2MFI A;  3GTM H;  4BBS G;  4DR2 L;  1AE3 A;  3J7A 5;  5GAD C;  4JOI C;  3L2P A;  4JI0 L;  1S40 A;  4R4I A;  4L5R C;  2IX1 A;  1XNR Q;  2DGY A;  3CPF A;  3M4Q A;  4JYA L;  2PNH A;  1P16 A;  3K81 C;  3OTO L;  3RN5 A;  3AEV A;  1JE5 A;  3HOX H;  4JI7 L;  3CD6 A;  4DR7 L;  4AYB G;  5LMN L;  2ALY B;  1HNX Q;  4LFB Q;  2N3S A;  4R4Q A;  4KHZ A;  3I55 A;  3PUZ A;  4HID A;  3JAM i;  2YTY A;  3PO2 H;  1SFO H;  2UUC Q;  2RCN A;  3NBH B;  3SGI A;  3PUV A;  5LMN W;  1IL2 A;  1EFW A;  4A3L H;  3FP9 A;  2K14 A;  4AQY Q;  4YCU A;  3ULJ A;  4JI1 L;  3UDI A;  5LMU Q;  5GAE C;  5JJK A;  4QIW E;  2Z6K A;  2WB1 E;  2YU9 H;  4IFD J;  1GO3 E;  4HJ5 A;  1N32 Q;  4GN3 B;  3CCQ A;  5M5Y H;  1YIT A;  3W1B A;  1E22 A;  2UXD Q;  4O2D A;  2VS1 A;  1O7I A;  2MO1 A;  2E2J H;  3CCR A;  5BR8 L;  4RMF A;  4LF9 L;  4HIM A;  5GQO A;  4OO1 I;  1N9W A;  1HZC A;  3VDY A;  4UPA A;  1JJ2 A;  3S17 H;  2Q2H A;  3S1R H;  4YWK A;  1VQE A;  1WJJ A;  4JBJ A;  2R92 G;  4DR6 Q;  4APV A;  4A3I H;  1A63 A;  4IFD G;  2F52 A;  2VUM H;  1AH9 A;  4DV1 L;  4A3L G;  1PH4 A;  4HJA A;  1PH2 A;  4YWM A;  3PIO A;  2H5X A;  1BVS A;  1OXX K;  2K5H A;  4P75 A;  2VL6 A;  4B3M Q;  4GKK L;  5JEA J;  4X6A H;  1I3Q H;  1E1T A;  1A0I A;  2B29 A;  4LF7 L;  4DV6 Q;  3FHW A;  4QJF A;  3K8A A;  1DGS A;  4JG2 A;  4X64 L;  1FVI A;  1PH9 A;  4JOI A;  2IY5 B;  1L1O B;  1N34 Q;  1Q1E A;  2D62 A;  4B3S L;  1SN8 A;  1GKH A;  1RIP A;  3DM3 A;  3AFQ A;  3RZO H;  1NE3 A;  1XTD A;  5JEA G;  2UU9 L;  5C3E H;  1PH3 A;  3AQQ A;  3CQZ H;  5JJL A;  1QUQ A;  1I5F A;  4GOP C;  2VUM G;  4DR4 Q;  1XNR L;  3G48 A;  2IHE A;  4LFA Q;  1V9P A;  1OXV A;  3HOV G;  5GAH C;  1CKO A;  1R9T H;  1IBK Q;  4BY7 H;  2K4K A;  4L5S A;  5HY6 A;  1HNX L;  4B3R Q;  2A8V A;  1A8V A;  1CKN A;  2NVY H;  4L5T A;  4LFB L;  3S16 H;  1G6P A;  1XPR A;  4YHH L;  3CCU A;  1QZG A;  1OTC A;  4JI5 Q;  3MXN B;  1X55 A;  3KF6 B;  3M4O H;  1YZ6 A;  2E2I H;  3HFZ B;  3OW2 A;  3AFP A;  3FKI H;  3J81 c;  3S1Q H;  4B3T L;  4AQY L;  1N36 L;  1JB7 A;  3PCO B;  5LMU L;  2JA7 H;  1PH6 A;  2ATW A;  4HIK A;  3UE0 A;  2YV5 A;  4DPG A;  1X65 A;  4J15 A;  3RLN A;  1N32 L;  3I2Z A;  3MEF A;  3A5U A;  2JK8 A;  2JJQ A;  1Y1W G;  3TQY A;  5IYD G;  3T1Y L;  2HHH Q;  4QQB X;  1VQ7 A;  4P72 A;  2BH8 A;  4AIM A;  4NPS A;  4DR7 Q;  2NN6 G;  3WWV A;  5LMN Q;  1W2B A;  2QA4 A;  4DUZ Q;  2PQA A;  2NZH A;  1KC8 C;  1UWV A;  1KL9 A;  1HZB A;  4JCV E;  4DR6 L;  2DUD A;  1N8R C;  2JQO A;  2CCZ A;  1D7Q A;  1K8G A;  3KLW A;  2E8G A;  1EQR A;  1K8A C;  1YHQ A;  1Q7Y C;  2MQH A;  1B8A A;  3CCM A;  2JA7 G;  2ZJR A;  3CME A;  1Q82 C;  4IJL A;  1K3R A;  3CF5 A;  4DV6 L;  3KDF B;  4PZ7 A;  3J81 i;  4TVA B;  1KHI A;  5K36 G;  2N49 A;  2K5N A;  3G6E A;  1M90 C;  3G4S A;  4GOP A;  1N34 L;  1WCM H;  5FLM H;  4LF9 Q;  2JA5 G;  1SRU A;  1SRO A;  1VQF A;  3H15 A;  2PMZ E;  1YJW A;  4ME3 A;  1NMG A;  1IZ6 A;  4DR4 L;  4DV5 L;  4LFA L;  1NMF A;  4BBR H;  1E7Z A;  3B6Y A;  3CP0 A;  3HOY H;  3D0F A;  4R4O A;  4GKK Q;  2D0O A;  4A3G H;  4B3R L;  3TS0 A;  1BKB A;  3GTK H;  1ASZ A;  3S15 H;  4A3D H;  4H02 A;  1JMC A;  1VQ9 A;  2K52 A;  3HKS A;  1WFQ A;  2YYZ A;  3ULL A;  5FLM G;  4B3S Q;  5IP7 H;  1XPU A;  1KQS A;  2C35 B;  1YBY A;  2JA6 H;  2HT1 A;  2UU9 Q;  2B63 H;  1K0R A;  2R7F A;  1LUZ A;  4QY7 A;  1G29 1;  4C3J H;  5AJ3 Q;  3GTP H;  1XMO Q;  4BA1 I;  4LWC A;  3H3V I;  2KEN A;  2Z0S A;  5IYC H;  4BBR G;  5IT9 c;  2HHH L;  3GTQ H;  1KXL A;  5E7N A;  2GVB A;  4JI3 Q;  3RN2 A;  1X3F A;  4DUZ L;  1XJV A;  1W3S A;  3NEN A;  1K73 C;  3I4O A;  3HKZ G;  3KF8 B;  2CWP A;  4YHH Q;  2AKW B;  3S2D H;  4A4I A;  2KCT A;  3L7Z C;  1PH1 A;  4R4T A;  4AH6 A;  1X56 A;  1XNQ Q;  4B3T Q;  2XTI A;  1N36 Q;  1PVO A;  1PHJ A;  2JA6 G;  4KHP L;  4C2M H;  1CKM A;  3EN2 A;  4IPD A;  4IFD I;  1HNZ Q;  1VQI A;  1WYD A;  4OXP A;  5DLQ E;  3T1Y Q;  4LF4 Q;  2F4V Q;  3I4M H;  3U4V A;  3BZK A;  5GAG C;  3HOX G;  2VZA A;  4DV3 Q;  1GD7 A;  5IP9 H;  2N8N A;  1LTL A;  4ALP A;  1GM5 A;  4A3B H;  3PV0 A;  2LXK A;  4OWT B;  1SLJ A;  2V1C C;  1VQ6 A;  3PO2 G;  1JT8 A;  4OX9 Q;  1IYJ B;  3W5O A;  1D8L A;  1S72 A;  1K9M C;  2I5L X;  3RZD H;  2KBN A;  3CAM A;  3K7A H;  3OYY A;  3CCJ A;  4HJ7 A;  4FDB A;  3EBE A;  3M3Y H;  1CKN B;  1YVC A;  4XIG S;  2RHS B;  3M4P A;  1Q8K A;  2R7Z H;  3BU2 A;  4RG1 A;  1VQC A;  2BA0 A;  3TRE A;  3CC7 A;  4GNX C;  3STB C;  2YTX A;  4A3B G;  1Z47 A;  4PZ6 A;  4GLA C;  1QZH A;  1Q81 C;  3M85 A;  4JBK A;  1PV4 A;  3BZC A;  1HZA A;  3JC6 6;  4A3I G;  3HKZ E;  3H0G H;  5AJ3 L;  1YI2 A;  1XMO L;  5C44 H;  4DV5 Q;  2UXC L;  2GVA A;  2OTJ A;  3I7F A;  4NXN Q;  2Q2U A;  4NB3 A;  2ZJQ A;  3CW2 C;  5ELO A;  5IE8 A;  2PQA B;  2GN5 A;  4JI3 L;  3ERS X;  2N78 A;  2FXQ A;  4WJ3 M;  4DR3 L;  1WI5 A;  1I94 Q;  2VY3 A;  4EX5 A;  4A3F H;  3HOW H;  4DV2 L;  1G51 A;  3A0J A;  4IPC A;  4XTC S;  1XNQ L;  3PF4 A;  1H95 A;  2NN6 I;  2WAQ E;  2ES2 A;  3A5Z B;  4GLV B;  1X54 A;  3W1G A;  1YIJ A;  1NJI C;  1LYL A;  1UEB A;  4R4C A;  1Y1V H;  4C3H H;  1EWI A;  2KCM A;  2Q2T A;  1VQJ A;  3TEH B;  5C3E G;  1MJC A;  4HJ9 A;  4TQU S;  1N33 L;  3E9H A;  1PYB A;  1HNZ L;  1EOV A;  1RL2 A;  1WOC A;  2WP8 J;  3LGJ A;  5C4X H;  5M5W H;  4LF4 L;  4LFC L;  2VQE Q;  4GOP B;  2NVX H;  4DV7 Q;  4DV3 L;  2F4V L;  3CCE A;  4BY7 G;  4A3C H;  1KRT A;  1EQQ A;  3K7U C;  4K0K L;  1VCI A;  1J5E L;  3HOU H;  4DK3 C;  4OX9 L;  2QGQ A;  4WJ4 A;  1CSP A;  3HOW G;  1SR3 A;  2Y0S E;  1L0W A;  1EIF A;  2VQF Q;  1OXU A;  3FKI G;  1VQK A;  2EQS A;  2BH2 A;  3ZJY C;  2R6G A;  1E3P A;  1FL0 A;  1L1O A;  2BA1 A;  3J7Z C;  4GNX A;  4IO9 A;  4LF8 Q;  4OWW B;  3PUY A;  4KHP Q;  5M3M H;  4DUY L;  2RHQ B;  5C0X J;  1X9N A;  3NEL A;  3CCS A;  4GLX A;  2ZM6 Q;  3I56 A;  5C4X G;  4DR5 L;  3F8T A;  4P74 A;  1PH8 A;  2UUA Q;  1IXR A;  1PH5 A;  3S14 H;  2UUB Q;  4QL5 A;  1VQN A;  4UP8 A;  4A3J H;  3PF5 A;  3S2H H;  3F2D A;  2NVQ H;  2XGT A;  4JBM A;  1BBW A;  5C4J H;  1Z9F A;  4NXN L;  2I0Q A;  2R93 H;  1YEZ A;  4HIO A;  1E24 A;  5M3M G;  1IBM Q;  4DV4 L;  3EIV A;  3U4Z A;  1I94 L;  2CQO A;  3GDE A;  3IRB A;  4A3K H;  3PSI A;  4JI8 Q;  1TWC H;  2LXJ A;  4P73 A;  4JI2 Q;  2EIF A;  3KFU A;  1WCM G;  1VQB A;  4POG A;  4LUO A;  5FJ8 H;  4PZ8 A;  4A3J G;  1AE2 A;  1HZ9 A;  1NTG A;  3UE1 A;  3CCL A;  3HOZ H;  1UE6 A;  4X65 L;  2UXC Q;  2NVT H;  1A62 A;  1PFS A;  4PG3 A;  1Y14 B;  2L15 A;  1VQH A;  2YTV A;  2IHF A;  4X62 L;  3A74 A;  2VQE L;  2B3G A;  4DV7 L;  4DR1 Q;  2K50 A;  3CXC A;  4A3G G;  3GO5 A;  4R1J A;  3ICE A;  3ULP A;  1VQO A;  4DR3 Q;  3RR5 A;  4A3D G;  3KDF A;  1UE5 A;  3I4N H;  4PMW A;  4A3K G;  4EQ5 A;  1HR0 W;  2E5L L;  3AYH B;  3HOY G;  1MJE A;  2OTL A;  1VQ5 A;  4DV2 Q;  1B7Y B;  2IX0 A;  2PI2 A;  3KJO A;  2VQF L;  4NXM L;  3PO3 H;  1MIU A;  5IP7 G;  5FJ8 G;  1YJ9 A;  4X66 Q;  4A3E H;  4LF8 L;  1OXS C;  5M3F H;  4POF A;  2B63 G;  3F1Z A;  1Q86 C;  3HOZ G;  2K5V A;  2ZTD A;  3NEM A;  1LM0 A;  1N33 Q;  1TWF H;  4JI4 Q;  5JJI A;  2ZM6 L;  1B70 B;  2OCE A;  1MKH A;  3M9B A;  5IWA Q;  3PUX A;  5IYC G;  4LFC Q;  1U0L A;  4A3M H;  2WAQ G;  3F2B A;  4P71 A;  4K0K Q;  1V1Q A;  3DLL A;  2UUA L;  2AHO B;  5FLX c;  1CSQ A;  3CPW A;  1J5E Q;  2UUB L;  3GTG H;  3I4N G;  4BA2 I;  1E1O A;  1QUQ B;  2R92 H;  1TWA H;  3CMA A;  3T1H L;  3PO3 G;  1NBW A;  2JEB I;  3M7N A;  4A3E G;  2OQ0 A;  1KD1 C;  5M3F G;  4UP7 A;  3PIP A;  1T9H A;  3GTJ H;  3G71 A;  4GKJ L;  1IBM L;  4YWL A;  4DUY Q;  1VQ8 A;  1VQG A;  1KIX A;  4DKA C;  5EAY A;  4YCV A;  3CC2 A;  1QVF A;  1FJG Q;  2Y0S G;  4JI8 L;  4GN4 B;  1L1O C;  5IY0 A;  4DR5 Q;  2UXB L;  2CKZ B;  4A3M G;  3I4M G;  3U58 A;  3UDG A;  3K80 C;  4JI2 L;  4UY8 C;  2HIX A;  2HIV A;  3E0E A;  5IP9 G;  3E9I A;  2I5H A;  1Q12 A;  1TWG H;  4DAM A;  4C3I H;  3J80 c;  1PH7 A;  2ZJP A;  3GD7 A;  1IBL L;  4YY3 Q;  1I6H H;  4MTN A;  1VQ4 A;  2CFM A;  3KYH C;  1I50 H;  4DNI A;  2WFW A;  3TS2 A;  4A93 H;  3BJU A;  4DR1 L;  3HOV H;  1HJP A;  1YJN A;  4OO1 G;  1OXT A;  5GRO A;  4DV4 Q;  1VQP A;  2NZO A;  4LF6 L;  1K83 H;  2R7Z G;  4A75 A;  3UDF A;  1XMQ L;  2QEX A;  5M5X H;  1XPO A;  1VQL A;  4IPH A;  4JI6 L;  4LUZ A;  4LF5 Q;  4DV0 L;  4IJH A;  1X3E A;  2MO0 A;  4GNX B;  2JA8 H;  1HNW Q;  4X66 L;  1FGU A;  1Q46 A;  4L5Q A;  5HGQ A;  4AYB E;  1X6O A;  2AMC B;  4Y52 H;  1JJG A;  1YHB A;  3H0G G;  4X65 Q;  5C44 G;  1EIY B;  4JI4 L;  2HQL A;  4DAY B;  4UP9 A;  5IWA L;  1Y1W H;  4A76 A;  1X3G A;  3J80 i;  4JV5 Q;  1HR0 Q;  4A93 G;  4X62 Q;  5IYD H;  2JA9 A;  1NY4 A;  1PA6 A;  2K75 A;  4OON A;  3D31 A;  3F2C A;  4MNO A; 
#chains in the Genus database with same CATH topology
 4FO2 A;  1KLU D;  3ER0 A;  2DJG C;  3G7L A;  4X3K A;  3U9O A;  3U50 C;  1KDB A;  2F0E A;  3QR8 A;  4JBW A;  1QVC A;  5C0X I;  2I5M X;  1C0A A;  4FF4 A;  4A3C G;  1LAB A;  2E2J B;  5ELN A;  1BBU A;  4JI7 Q;  1AN8 A;  2R7D A;  2V4D A;  2PYK A;  4F87 A;  3S1N H;  3CCV A;  3K0X A;  2VUM B;  3R3O A;  4BY1 G;  1E2W A;  3KF6 A;  1I4P A;  1JJC B;  4K2L A;  2CWA A;  1S5C D;  4GS3 A;  1CUK A;  4BXX G;  1V43 A;  2CQA A;  4ZQ3 A;  4JI1 Q;  2OQK A;  1PTO H;  1SDF A;  2F0H A;  4KMU C;  3WOE A;  2CVR A;  4K14 A;  3MFY A;  2A6H C;  1S5F D;  5KEE A;  1S5D D;  3KBG A;  2O2L D;  4O0A A;  5ISR A;  2F0M A;  3TRZ A;  3P7J A;  4JV5 L;  1KRS A;  1HR0 L;  1MBY A;  2PI2 E;  4IOC A;  1C7Y A;  5IT9 L;  3QOJ A;  4LF7 Q;  5JVG 3;  5IOC A;  3QO2 A;  1XMQ Q;  4FXK C;  1L2F A;  4MN3 A;  3CU7 A;  3A56 A;  2X6L A;  3QOL A;  4BBS G;  4EQP A;  5GAD C;  4JOI C;  1DXM A;  1S40 A;  1PMR A;  2E75 C;  3M4Q A;  2L55 A;  3K81 C;  3S1N B;  2K5W A;  1IKM A;  1JE5 A;  4QIW B;  3D8G A;  3I55 A;  4UDU C;  4HID A;  2Q8T A;  3JAM i;  4LJZ C;  2HCI A;  3NBH B;  3SGI A;  1IL2 A;  3FP9 A;  1PTO B;  3F2U A;  3ULJ A;  3I8Z A;  5CV4 A;  4XQQ A;  1K28 A;  1STN A;  2YU9 H;  1YIT A;  3IKJ A;  2UXD Q;  1CHP D;  2VS1 A;  3QJY A;  2MO1 A;  4LF9 L;  5BR8 L;  5K36 G;  4HIM A;  2EYH A;  3S17 H;  4UPA A;  2XRS D;  5ELB A;  4DR6 Q;  3IAY A;  2IJ0 A;  2PQE A;  2RKS A;  2F52 A;  4IFD G;  4ILW A;  1AH9 A;  1A3T A;  1SE2 A;  4P75 A;  4B3M Q;  4GKK L;  1M8A A;  1E1T A;  3HKZ B;  1NR4 A;  5C6A A;  1FD7 D;  1PH9 A;  4JOI A;  2RCF A;  4CDD C;  2JA6 B;  1I6V C;  1K3B C;  2UU9 L;  1EY5 A;  4RCN A;  1I5F A;  2O5I C;  4ZK9 B;  1DOK A;  4DU9 A;  1OXV A;  5GAH C;  1CQF A;  1CHQ D;  4L5S A;  4KY5 A;  5HY6 A;  2A8V A;  1CKN A;  2NVY H;  1TS2 A;  1VDZ A;  3CCU A;  1LT5 D;  5G3L F;  4IUN A;  3M4O H;  1X55 A;  3KF6 B;  3HFZ B;  3ITP A;  3K5N A;  4IN3 A;  1N36 L;  3BVG A;  2YU9 B;  3PCO B;  2JA7 H;  3MVV A;  4KY7 A;  1SAP A;  4DPG A;  3RLN A;  1N32 L;  2AQ1 B;  3I2Z A;  1LTT D;  3TQY A;  3T16 A;  5IYD G;  4A3B B;  1VQ7 A;  4DR7 Q;  1XXG A;  1UWV A;  3RZD B;  1FR3 A;  1SNM A;  3CRL C;  4JCV E;  2DUD A;  1N8R C;  4S3S A;  1K8G A;  3K5L A;  1EY6 A;  1F2M A;  2MQH A;  3CCM A;  1K3R A;  2NBF A;  4RFB A;  4DV6 L;  4BWG B;  3J81 i;  4TVA B;  5DAU A;  1SYG A;  3QB3 A;  4RHR A;  5FO7 B;  1SNO A;  2JA5 G;  1LO5 D;  3IFT A;  1SRO A;  1L0Y B;  1O7Z A;  1PXU A;  2XNA C;  3B6Y A;  2F0Q A;  1YNN D;  1J9O A;  2A6E C;  2NYZ D;  3BDL A;  4X3T A;  4F7X A;  3M4O B;  3HOW B;  1ASZ A;  4A3D H;  1VF5 C;  1VQ9 A;  2RSO A;  2YYZ A;  4B3S Q;  5IP7 H;  1XPU A;  1HQM C;  2HDL A;  2B63 H;  1K0R A;  1KDC A;  1LUZ A;  2R7F A;  4C3J H;  1EEI D;  3GTP H;  1XMO Q;  4BA1 I;  2Z0S A;  5IYC H;  2HHH L;  2Z9H A;  1E0B A;  3RN2 A;  1XJV A;  1F77 A;  1SYF A;  3N52 A;  5KYI A;  3S2D H;  3L7Z C;  2M00 A;  2FJ2 A;  2NTT A;  3JAM E;  3D6W A;  4B3T Q;  2IX3 A;  1PVO A;  5E1F A;  4C2M H;  4KHV A;  2Z4H A;  4ZKB B;  1F9Q A;  3SK4 A;  3VYU A;  4LF4 Q;  1LTA D;  3U4V A;  5JOB A;  5GAG C;  3HOX G;  3DWQ A;  4DV3 Q;  5IP9 H;  2N8N A;  1LTL A;  4A3J B;  1HTP A;  2EE1 A;  1EY7 A;  2I07 B;  3URY A;  2A6E D;  2KBN A;  3NHH A;  3DEP A;  4HJ7 A;  3AB9 A;  1SBB B;  1CKN B;  2M9V A;  3M3Y H;  4XIG S;  4A3D B;  4RG1 A;  3E0J A;  3OWF A;  1VQC A;  4GNX C;  4DK1 A;  3STB C;  2F1M A;  1SNQ A;  2B63 B;  1GUS A;  4GLA C;  4C3J B;  1QZH A;  1KDA A;  1LTB D;  2UXC L;  4DV5 Q;  5DEH A;  2Z4I A;  4NB3 A;  1B9M A;  5ELO A;  1KLG D;  2N78 A;  1D1I A;  3I4N B;  4H7B A;  1STA A;  5TSS A;  1I94 Q;  1IW7 D;  2H4O A;  4OL7 A;  1EU3 A;  4DV2 L;  3A0J A;  4J1M A;  3PF4 A;  2WAQ E;  1HFN A;  3ND8 A;  4GLV B;  3W1G A;  1NJI C;  4R4C A;  2O5J C;  1Y1V H;  3AU7 A;  3FRP B;  4HJ9 A;  3SHL A;  3TEH B;  4R9W A;  4TQU S;  2BE5 D;  5J39 A;  1HNZ L;  1VMC A;  2WP8 J;  2A73 B;  2NVX H;  2MP1 A;  4BY7 G;  2HDM A;  1EQQ A;  3K7U C;  3TN2 A;  1VCI A;  1CSP A;  1ESR A;  2Y0S E;  1EIF A;  3R8B A;  1OXU A;  2R6G A;  3GTJ B;  3J7Z C;  4GNX A;  4KHP Q;  3NXW A;  4LAA A;  2B2V C;  4DUY L;  2RHQ B;  4CJ0 B;  2JSO A;  1JB3 A;  1GOZ A;  5C4X G;  3F8T A;  3EVQ A;  3J81 E;  1E2V A;  1Y8N B;  1HUM A;  1PH8 A;  3BS1 A;  2K05 A;  2C5C A;  3NBI A;  2UUB Q;  4QL5 A;  4UP8 A;  1I4G A;  3PF5 A;  4U68 A;  3L3O C;  4RAU C;  4A93 B;  5C4J H;  1STB A;  4NXN L;  2K28 A;  2I0Q A;  4HSP A;  3UI2 A;  4DV4 L;  4LK1 C;  1A3V A;  4CKB A;  1FNW A;  4FVM A;  2CQO A;  2RDH A;  4ODG A;  2JA8 B;  4JI2 Q;  2EIF A;  1WCM G;  5FJ8 H;  1Y1V B;  5JPN C;  2JYO A;  3CCL A;  1EU4 A;  2A68 D;  1WTR A;  1XYI A;  3HOZ H;  3O13 A;  1UE6 A;  2NVX B;  1STY A;  1CI3 M;  2KOL A;  1Y14 B;  5IGG A;  3G6J B;  3EJI A;  2FIN B;  2K50 A;  1DJR D;  4HCS A;  3ICE A;  3ULP A;  5J1Z A;  1JOQ A;  3KDF A;  3QIA A;  4A3K G;  4EQ5 A;  1HR0 W;  2B2V A;  4PMB A;  1YJ9 A;  4G7Z C;  2SNS A;  2ZTD A;  1D5Z C;  2EY2 A;  4RGO S;  4G7H C;  5G3L D;  1KNA A;  2ZM6 L;  1SMY D;  3M9B A;  1U0L A;  2WAQ G;  3F2B A;  3MHB A;  5FO9 B;  2EYJ A;  3DLL A;  3TDQ A;  4I7Z C;  1CSQ A;  3CPW A;  4KD3 A;  1QUQ B;  1KTK A;  2CW0 C;  5C4J B;  3PO3 G;  5IT9 E;  1GUN A;  5EQ0 A;  1SE3 A;  3M7N A;  4A3E G;  2B2U C;  1KD1 C;  5M3F G;  3G71 A;  4WOR A;  1KIX A;  5EAY A;  1FJG Q;  2Y0S G;  4GN4 B;  4A3M G;  3I4M G;  4UY8 C;  3E0E A;  3R93 A;  1EWC A;  1Q12 A;  1PH7 A;  5JEA H;  2ZJP A;  1ZYR D;  1VQ4 A;  3TS2 A;  2PZU A;  1YJN A;  5T1I A;  1OXT A;  2NZO A;  3W3A A;  1K83 H;  4A75 A;  1XMQ L;  2QEX A;  2PCF B;  2EZV A;  4HN7 A;  2WV6 D;  3S1M B;  1VQL A;  1TS5 A;  4LF5 Q;  4IJH A;  4GNX B;  2MO0 A;  3A54 A;  4H44 C;  1HNW Q;  1Q46 A;  4C3I G;  2F4I A;  2EYM A;  4Y52 H;  3TSS A;  1JJG A;  4X65 Q;  1H9R A;  1EIY B;  2HQL A;  1KNE A;  5IWA L;  2D5D A;  4A76 A;  1Y1W H;  3J80 i;  2SNM A;  1B3A A;  1PA6 A;  1HCZ A;  4FF2 A;  1FNU A;  4XDX A;  2NN6 H;  2RDG A;  4NDX A;  3F2C A;  1XX8 A;  2B2U A;  1HA6 A;  2BOS A;  3KLR A;  2JEA I;  3NTI A;  3DMU A;  2RSN A;  1B44 D;  2PW5 A;  1UE1 A;  4DR2 Q;  5M5Y B;  3TP6 A;  4JI0 Q;  1ONL A;  4RCO A;  4JYA Q;  2K01 A;  2UXD L;  4KKT A;  5KRU A;  3RNU A;  2JN4 A;  4R8I A;  3S24 A;  1VQD A;  3HOU G;  2VNU D;  2LSS A;  2VB3 X;  5EJW A;  4YY3 L;  3I90 A;  4TKO B;  2A19 A;  4RWS C;  2HQE A;  1ASY A;  1SE8 A;  4B3M L;  1U4R A;  4IOA A;  3MC0 B;  3JAM L;  3SVM A;  1U9R A;  4J8Q A;  4HMI A;  2MUY A;  4UHV A;  2UXB Q;  2C9O A;  3UDX A;  1TY2 A;  2ZTE A;  1VS0 A;  3J81 j;  2EJG C;  4QGU A;  1TWH H;  3NQI A;  2LS0 1;  3D6C A;  2JE6 I;  1KAW A;  3KOJ A;  3KJP A;  1IBL Q;  2AWO A;  1Y1W B;  2OWO A;  2F3I A;  3C2P A;  4IPG A;  1C9O A;  3RLF A;  2VW9 A;  2IL8 A;  1BR9 A;  2L12 A;  2E2H H;  4FP5 D;  2KQ3 A;  1YHA A;  2Q2I A;  3MZ5 A;  5HGT A;  1EYG A;  3PUW A;  4X64 Q;  4H0L C;  4OWX B;  4V0B A;  4JI6 Q;  3P1H A;  3NE5 B;  1GVP A;  2MFI A;  3J7A 5;  1AE3 A;  3L2P A;  3ONA B;  4L5R C;  1KAA A;  1XNR Q;  3CPF A;  1P16 A;  3OTO L;  3RN5 A;  3AEV A;  3RMH A;  4DR7 L;  4C1N K;  2DNE A;  3C1F A;  2N3S A;  4LFB Q;  2RCN A;  5FK9 C;  2F0S A;  1Y69 U;  4WRD A;  1L0X B;  1O78 A;  5LMN W;  1IKL A;  3N6R A;  5EKK A;  4A3L H;  2K14 A;  3IFD A;  4YCU A;  1JWS D;  2MGS A;  5E4W C;  3P20 A;  1X3P A;  2BDN A;  1TWH B;  2E2J H;  3CCR A;  1BUV T;  4RMF A;  2K03 A;  4OO1 I;  1N9W A;  1HZC A;  1JJ2 A;  2Q2H A;  1TKW B;  1VQE A;  1WJJ A;  4APV A;  4A3I H;  3NQT A;  1IYV A;  3FEW X;  2VUM H;  4BBR B;  4DV1 L;  4HJA A;  3Q0A A;  1PH2 A;  3PIO A;  2E2H B;  2H5X A;  2R61 A;  3SXH A;  1PTO D;  1A0I A;  4KKU A;  1R4P B;  2JP1 A;  2AUK A;  1DGS A;  1TII D;  3K8A A;  3OIP A;  3LWU A;  4RGN A;  5F2D A;  1LTR D;  1ZXT A;  1N34 Q;  4B3S L;  1SND A;  1SN8 A;  4QUC A;  1RIP A;  3J81 L;  3AFQ A;  1PH3 A;  3AQQ A;  3CQZ H;  5FOB B;  4JVZ A;  4GOP C;  3GTQ B;  4DR4 Q;  4IAL A;  3G48 A;  4ULL A;  4CGY B;  1V9P A;  1O80 A;  3HOV G;  1CKO A;  1IBK Q;  2K4K A;  1HNX L;  3J80 E;  1A8V A;  4NW2 A;  4DAV A;  4ZUJ A;  1XPR A;  4JI5 Q;  2ZXP A;  3PIO 3;  3MFG A;  2F0T A;  3OW2 A;  3FKI H;  3S1Q H;  4B3T L;  4AQY L;  4DNR B;  1ICF B;  1XWE A;  5LMU L;  1EZ8 A;  4HIK A;  1JC7 A;  2YV5 A;  5JPM C;  4C56 C;  2JK8 A;  2JJQ A;  4QQB X;  5I2X A;  4P72 A;  2BH8 A;  2KED A;  2Z1C A;  4NPS A;  2DN8 A;  3ERO A;  1W6K A;  2PQA A;  4HR7 B;  2B8G A;  3C3L A;  1KC8 C;  4A3I B;  5I9O A;  1HA5 A;  2L0C A;  3KLW A;  4J6H A;  1YHQ A;  4M1U B;  1T5E A;  2JA7 G;  1Q82 C;  1C4Q A;  2HD3 A;  1B53 A;  3H6M A;  4H13 C;  1BNZ A;  2KEC A;  2K5N A;  3G6E A;  5DNF A;  5CV6 A;  4GOP A;  3BYT B;  5BN5 A;  1SRU A;  3CQZ B;  3H15 A;  2PMZ E;  3QWN A;  4DV5 L;  4LFA L;  1NMF A;  5IGB A;  3CP0 A;  4IUV A;  4A3G H;  1I4X A;  4B3R L;  3BZD B;  3S15 H;  3IL8 A;  4H02 A;  3T56 B;  5C3X A;  5A2Q E;  3HP3 A;  2DY8 A;  3FKI B;  3NK9 A;  5IGC A;  1JMC A;  3S1Q B;  3T4A C;  3M4Y A;  3MTS A;  4QB4 A;  3ULL A;  1YBY A;  1TU2 B;  2JA6 H;  5CR3 A;  2LY7 A;  3NWS A;  1G29 1;  4DAP A;  5JAV A;  4LWC A;  1JE4 A;  2KEN A;  1LTI D;  4FXG C;  2L5T A;  1S5E D;  1QG7 A;  5E7N A;  4JI3 Q;  1X3F A;  5KNC A;  4K5X A;  4DUZ L;  2EPB A;  3E5S A;  1FYC A;  3NEN A;  1K73 C;  3I4O A;  1CTM A;  4YHH Q;  1T5X D;  4RHS A;  4A4I A;  3SK8 A;  1W6J A;  2KCT A;  3K6O A;  1XNQ Q;  2HCC A;  2XTI A;  1PHJ A;  5M3M B;  4KHP L;  2A6H D;  3EN2 A;  3MEH A;  2MJ8 A;  1DOM A;  1VQI A;  3HZX A;  1WYD A;  3T1Y Q;  1EY9 A;  4ALP A;  4A3B H;  1VQ6 A;  1SLJ A;  3PO2 G;  4OX9 Q;  1IYJ B;  1GUO A;  2J4X A;  3RZD H;  5EKL A;  1WD1 A;  4A3G B;  1BO0 A;  3EBE A;  1GHK A;  2L1B A;  3S15 B;  1YVC A;  1ILP A;  4HAE A;  3H3V C;  3M4P A;  5ELD A;  4DXG A;  3BU2 A;  4GZY C;  2KUM A;  2YTX A;  3U9S A;  1KAB A;  1Z47 A;  1EY0 A;  3SK5 A;  4NKL A;  3JC6 6;  1BOS A;  5AJ3 L;  5C44 H;  4KK7 A;  5EPL A;  3I7F A;  3OIQ A;  1WTX A;  1H9S A;  3FMC A;  2Q2U A;  2SOB A;  3CW2 C;  5IE8 A;  2PQA B;  4PQX A;  1WI5 A;  1GUT A;  2VY3 A;  1GXD C;  3HOW H;  1TY0 A;  3BYY B;  1NNX A;  3MXG A;  4IPC A;  1H95 A;  1FNV A;  1YIJ A;  2G5D A;  1HPC A;  2Q2T A;  5E3F A;  5C3E G;  4L63 B;  3E9H A;  2B8F A;  4K6D A;  3LGJ A;  4GOP B;  4A3C H;  4MHE A;  2F4V L;  2IY5 B;  4JPB W;  4YIJ A;  3EQL C;  1MGS A;  3I70 A;  4DK3 C;  4WJ4 A;  1SR3 A;  5C4H A;  5JJZ A;  2EQS A;  5M9O A;  1L1O A;  2MHV A;  4XT3 B;  4PNY A;  2PO4 A;  1X9N A;  3CCS A;  4IUP A;  4GLX A;  4DAY A;  1TR5 A;  4P74 A;  4QCL A;  4LMQ D;  2UUA Q;  1TWG B;  3DWA A;  2RDF A;  4XQN A;  4A3J H;  1VQN A;  5C44 B;  1I6H B;  3F2D A;  2NVQ H;  1CM9 A;  2XGT A;  3M7G A;  3MXN A;  1BBW A;  2I46 A;  3EIV A;  2HUG A;  3PSI A;  4DGZ A;  1IL8 A;  4P73 A;  1RTN A;  4LUO A;  1D2B A;  4PZ8 A;  1NTG A;  3UE1 A;  2TMP A;  4X65 L;  5J22 A;  1EFI D;  5I6W A;  1A62 A;  2WII B;  3VR3 A;  2VQE L;  3HOY G;  4DV7 L;  2IHF A;  4DR1 Q;  1JWU D;  3VR6 A;  3CXC A;  4R1J A;  4DR3 Q;  4P2C B;  4BY1 B;  1UE5 A;  3I4N H;  1A3U A;  1MJE A;  4CJ2 C;  2OTL A;  4UAI A;  1B7Y B;  2VQF L;  2PI2 A;  1CZG A;  5FJ8 G;  1BQQ T;  5NUC A;  4X66 Q;  2KVM A;  4LF8 L;  2F0D A;  1Q86 C;  3HOZ G;  1JWM D;  1TWF H;  4JI4 Q;  1B70 B;  2OCE A;  5D14 A;  1ICW A;  4P71 A;  4K0K Q;  5CV7 A;  4CKC A;  1JQY D;  5K36 H;  1CQV A;  5FLX c;  1J5E Q;  2NVQ B;  4G7O C;  2XIW A;  3J80 L;  5KND A;  3CMA A;  1TS3 A;  4IFD H;  1O7Y A;  1H9S B;  1NBW A;  1F2Z A;  1II3 A;  4UP7 A;  3TP8 A;  1D5X C;  2Q8I B;  3GTJ H;  1IBM L;  2EVB A;  1B4O A;  3X3M A;  4DKA C;  4YCV A;  2OT2 A;  4JI8 L;  4DR5 Q;  5CV9 A;  2UXB L;  4FNF A;  2HIV A;  4BBS B;  3HEJ A;  1AZQ A;  2G9D A;  3E9I A;  1PZI D;  1IBL L;  3CKI B;  4MTN A;  1I50 H;  4N8F A;  4DNI A;  2FHT A;  4A93 H;  1PRT C;  1QWY A;  1CA5 A;  4OO1 G;  5GRO A;  2R7Z G;  1AW7 A;  2IWH A;  3H94 A;  4I7A A;  1PZK D;  3K5O A;  3OW7 A;  4JI6 L;  3VYS A;  3GTM B;  2JA8 H;  1GUG A;  1DOL A;  4AYB E;  4IQZ A;  2NB0 A;  1TWF B;  2AMC B;  1AZP A;  1K0S A;  3H0G G;  4DAY B;  4UP9 A;  1X3G A;  4JV5 Q;  5IYD H;  1HR0 Q;  4X62 Q;  2JA9 A;  1Q3L A;  4A3F G;  2E5L Q;  3MA2 B;  4MZ9 A;  3GTO H;  4DF7 A;  5A2Q L;  4KV6 A;  1EIH A;  3L0O A;  4C3H G;  3STB D;  4KI0 A;  3RLO A;  4ZAI A;  3SK6 A;  4G57 A;  2NTS A;  3Q8D A;  2O4X A;  1Q8I A;  2DJF C;  1SMX A;  1WTW A;  2JA5 H;  2KHJ A;  1PFB A;  2A1A A;  1U4L A;  4JC0 A;  3QG1 A;  1I50 B;  3T53 B;  2N88 A;  5C0X G;  3T1H Q;  5DM7 3;  1TT2 A;  3MXU A;  4Y7N H;  3FVQ A;  4R8N A;  4FF1 A;  1S3O A;  2RF4 A;  1LTG D;  3EA6 A;  1B1Z A;  1F9S A;  2WIN B;  4RA8 A;  1H9J A;  2Z6K C;  5BR8 Q;  2FMM A;  5HUR A;  5J3B A;  5IYB H;  2WB1 G;  2B2T C;  3C1E A;  4ABN A;  2HT1 A;  3MAQ A;  4DK6 C;  1ML0 D;  1YNX A;  3J7A F;  2N55 A;  5H1S E;  2WAC A;  1IBK L;  2R93 G;  3EFX D;  3I72 A;  1M1K C;  1JOK A;  3NP8 A;  3S16 B;  1QVG A;  3LX0 A;  2EYP A;  5D3D A;  4JI5 L;  3GTO B;  1M4V A;  2K33 A;  4LNQ A;  3S1M H;  1EUJ A;  3GTL H;  1EZ6 A;  2AWN A;  2KHI A;  2XN9 C;  3H91 A;  1A2U A;  3D4W A;  2EJF C;  5L37 A;  1SYD A;  4R4I A;  2DGY A;  2PZT A;  2PNH A;  2JA5 B;  3HOX H;  4JI7 L;  4DA2 A;  4AYB G;  2ALY B;  4XQJ A;  1UNS A;  1BCP F;  4ZCK A;  1SFO H;  4XYO A;  2UUC Q;  2AUJ D;  3WOF A;  4Y7N B;  1RTO A;  3RUZ A;  4JI1 L;  3S9W A;  2RVL A;  1Y8O B;  3NUC A;  4IUQ A;  3OPO A;  4QIW E;  1YNJ C;  2Z6K A;  4DNT B;  4HJ5 A;  1N32 Q;  4GN3 B;  4QUF A;  5M5Y H;  3W1B A;  2B2T A;  1E22 A;  1DM0 B;  2QDL A;  1O7I A;  1WTO A;  4K8I A;  2SEB D;  5GQO A;  3VDY A;  4YWK A;  2R92 G;  2EYF A;  1A63 A;  3KF8 A;  4A3L G;  1SE4 A;  1STH A;  2VL6 A;  4ZKC B;  5JEA J;  1I3Q H;  2B29 A;  4LF7 L;  3GTK B;  1A6X A;  4DV6 Q;  3FHW A;  2EDG A;  4EQN A;  5E4X A;  3GTL B;  1DD2 A;  5COY A;  2RA4 A;  1UAP A;  1MSH A;  3RZO H;  1XTD A;  4DXF A;  3K58 A;  5JJL A;  4HMJ A;  2VUM G;  3TME A;  5BN3 A;  3HOX B;  2CW0 D;  1HRJ A;  5EPK A;  4BY7 H;  1PRT B;  1EWH A;  1SFO B;  1G6P A;  2F0L A;  4L5T A;  4YHH L;  2VXW A;  1RDP D;  1RD9 D;  1G6Z A;  2EYO A;  4TRD A;  3BDO A;  3NTK A;  2EY6 A;  1X65 A;  4J15 A;  1V1O A;  3MEF A;  3TBI B;  3T1Y L;  2QIL A;  2HHH Q;  4AIM A;  5LMN Q;  3DUZ A;  2NZH A;  1KL9 A;  1HZB A;  4DR6 L;  2CCZ A;  1D7Q A;  4N8X 1;  3NWT A;  2E8G A;  1EQR A;  4XXE A;  5CMD A;  1I3Q B;  1B8A A;  2ZJR A;  2LKV A;  3CME A;  1QE6 A;  4G4K A;  3KDF B;  4PZ7 A;  2ZT9 C;  3PQI A;  5KIX A;  2CH4 A;  1KHI A;  2KCN A;  1FGB D;  2N49 A;  1LLR D;  5ELF A;  1WCM H;  5FLM H;  3RZO B;  2X6G A;  3AMU A;  3E3X A;  1YJW A;  4O42 A;  1TVX A;  2Q8R E;  1IZ6 A;  2FFK B;  2QDB A;  4BY7 B;  3Q24 A;  4BBR H;  2J0T D;  4HCE A;  3DM1 A;  1AFP A;  3D0F A;  3BVZ A;  2D0O A;  5EKI A;  4TSS A;  3R2I A;  2OEO A;  1LV9 A;  1DCZ A;  1BXT A;  3HKS A;  1KQS A;  1HHV A;  3H09 A;  4IZ8 A;  4QY7 A;  5C4X B;  3GTQ H;  2GVB A;  1RHP A;  1W3S A;  2K04 A;  3HKZ G;  3KF8 B;  5FLX L;  4IUU A;  4B9W A;  4R4T A;  3CRK C;  2JA6 G;  1CKM A;  3K0Y A;  1HNZ Q;  5ELE A;  5DLQ E;  3I91 A;  1WCM B;  2BCO A;  2F0F A;  2KCC A;  3I4M H;  3BZK A;  4KN7 C;  2QW7 A;  2OXP A;  2LXK A;  4OWT B;  2V1C C;  4X3U A;  4ZUI A;  1Z6H A;  3W5O A;  1S72 A;  1EQV A;  2I5L X;  1EYC A;  4ZRZ A;  4Q5V A;  4FDB A;  3CHB D;  5C3W A;  3D4R A;  3T51 B;  3W2D A;  4A3K B;  1Q8K A;  2J7Z A;  1QNU A;  2NWG A;  1GHJ A;  1B2T A;  3CC7 A;  3NTH A;  4F8M A;  4A3B G;  1BCP C;  4PZ6 A;  5I6Y A;  2F0J A;  3M85 A;  3BZC A;  4JK1 C;  5CBE E;  2Z8L A;  4RGT A;  1XMO L;  2GVA A;  2WAQ B;  2OTJ A;  4NXN Q;  4IUT A;  1PZJ D;  2ZJQ A;  3ERS X;  3VA5 A;  2RQX A;  2FXQ A;  1MD2 D;  4WJ3 M;  4DR3 L;  5I2Y A;  4EX5 A;  3PO3 B;  2E74 C;  4EQO A;  4DK0 A;  5AFW A;  4A3E B;  3A8K E;  5M3F B;  2NN6 I;  2QCP X;  2ES2 A;  1WTV A;  1X54 A;  1LYL A;  1UEB A;  1EWI A;  2KCM A;  4QF4 A;  4RH6 A;  2Y0S B;  4A3M B;  3I4M B;  1EOV A;  1RL2 A;  1WOC A;  2AQ3 B;  3X3N A;  5M5W H;  4LF4 L;  4DV3 L;  4K0K L;  1J5E L;  3HOU H;  2R92 B;  1TWA B;  5D65 A;  3A8J E;  2QGQ A;  1JR0 D;  3HOW G;  2L4N A;  2BH2 A;  2A5H A;  1E3P A;  3BG3 A;  4OWW B;  3PUY A;  1EQT A;  5M3M H;  3ND9 A;  4KD4 A;  1BCP D;  1PYW D;  1EL0 A;  2ZM6 Q;  4DR5 L;  1ZKO A;  3FPU B;  1SYC A;  2QEJ C;  1V1P A;  1PH5 A;  5KYL A;  4C3I B;  3S14 H;  2VB2 X;  4OGQ C;  4OEL B;  1HUN A;  3I4L A;  4JBM A;  1Z9F A;  4K8J A;  5C5L A;  2GA4 B;  2IW3 A;  4HIO A;  1E24 A;  1I94 L;  2G9H D;  2K7V A;  3IRB A;  2LMC B;  2LXJ A;  2CHB D;  2F0N A;  5JVH 3;  1SXT A;  1NAP A;  1ZEQ X;  3KFU A;  1VQB A;  4POG A;  1BF4 A;  3OHX C;  1JOO A;  2NZ1 D;  4A3J G;  2WKC A;  1AE2 A;  1WTP A;  4CJ1 B;  5M5W B;  1MI2 A;  4I65 A;  2NVT H;  3C46 A;  1NSN S;  5IIF A;  1AP0 A;  2NUC A;  2SDF A;  4PG3 A;  4X62 L;  4K5V A;  2B3G A;  3HOU B;  1VQO A;  2EYL A;  3RR5 A;  4A3D G;  4PMW A;  3DEO A;  2F0O A;  2E5L L;  5IOD A;  1X32 A;  2IX0 A;  5IP7 G;  5BN4 A;  1OXS C;  3Q23 A;  4POF A;  1PRT F;  2B63 G;  2K5V A;  1QJO A;  3GV3 A;  3KBX A;  4C3J G;  1LM0 A;  1N33 Q;  1HFG A;  5IWA Q;  5IYC G;  4LFC Q;  4OIK A;  4WJW A;  3S14 B;  4IUR A;  1RJT A;  4OEM B;  3V05 A;  2UUB L;  4KJO A;  3I4N G;  4BA2 I;  4JW0 A;  1LAC A;  3K57 A;  1EYA A;  5T1G A;  3T1H L;  1SNP A;  2JEB I;  3D4D A;  3FPP A;  4DFA A;  2OQ0 A;  3E6Z X;  1A2T A;  2KEE A;  1VQ8 A;  1L1O C;  4KTA A;  3K80 C;  4JI2 L;  5A35 A;  5IP9 G;  1DON A;  1B9N A;  1G8Z D;  1H9M A;  1TWG H;  2ICE C;  4MTK A;  4DAM A;  2NVT B;  2F3V A;  2B2W C;  4M8A A;  4YY3 Q;  3V96 A;  1I6H H;  2CFM A;  2PZW A;  3VYR A;  3BJU A;  3HOV H;  3PMF A;  4ZYS A;  2E76 C;  1HXY D;  5M5X H;  1XPO A;  4IPH A;  1F9P A;  3KLS X;  1HQR D;  2K5D A;  2AQ2 B;  1JIC A;  1FGU A;  2EY5 A;  1QCB D;  1I4R A;  3HG9 A;  2ZXR A;  4CBV A;  1BCP B;  5LHY 1;  4A93 G;  1V1P B;  1NY4 A;  4OON A;  1VF7 A;  3DHQ A;  2JXM B;  1EY4 A;  4FXD A;  5D3I B;  2UUC L;  4BY1 H;  4LUV A;  1YNN C;  4NXM Q;  4BXX H;  1ET6 A;  2MNA A;  2JA8 G;  2IT1 A;  3LNN A;  4XYQ A;  1Y1V G;  1DYQ A;  2ZTC A;  1WD0 A;  2ASB A;  1SYB A;  4KLK A;  1FJG L;  3CC4 A;  1EOT A;  2B2W A;  5EBC A;  1PLF A;  3BVM A;  1LT4 D;  3OTO Q;  3S17 B;  1E2Z A;  4F88 A;  3ZYY X;  1WVL A;  1U5K A;  4GN5 A;  1TXY A;  1GUW A;  2WKD A;  3HOV B;  1VQA A;  2F3W A;  1CA6 A;  4GKJ Q;  1HH2 P;  5M5X B;  4YCW A;  3NSW A;  3GV6 A;  5CV8 A;  1Q1B A;  1P8L A;  1ILQ A;  1H9K A;  1X3Q A;  4HJ8 A;  3PGZ A;  4LF5 L;  1HNW L;  4EGV A;  2X69 A;  4BBS H;  3R2T A;  1J8I A;  1VQM A;  1J6Q A;  2QKI C;  5IGF A;  4X3S A;  4DV1 Q;  4K6L A;  3TZU A;  3JAM c;  4NMZ A;  2NVY B;  2D0P A;  4LF6 Q;  2XVS A;  2F0I A;  1PYS B;  2ID0 A;  4L6T B;  5C5M A;  2EXD A;  3KLS A;  1UE7 A;  3H3V H;  1LT6 D;  4DV0 Q;  2JA7 B;  4LW1 A;  5IYB G;  3GTM H;  4DR2 L;  2F0G A;  4JI0 L;  2A69 C;  2IX1 A;  4JYA L;  2EY1 A;  3OMG A;  3VR5 A;  3CD6 A;  1F2L A;  3MWY W;  5LMN L;  1V8Q A;  1HNX Q;  4R4Q A;  2B39 A;  2FMC A;  4KHZ A;  3PUZ A;  3VYT A;  3PO2 H;  2YTY A;  1SNC A;  1NR2 A;  3PUV A;  4C1N I;  1EFW A;  1Y8P B;  4KN4 C;  4ID6 A;  4AQY Q;  3UDI A;  5LMU Q;  5GAE C;  1IW7 C;  3L9A X;  2PPB C;  5JJK A;  2WB1 E;  3OMC A;  4IFD J;  1GO3 E;  1SEB D;  3CCQ A;  1ENF A;  4Q0F A;  4O2D A;  3V2T A;  4QMG A;  1U4P A;  2XSC A;  5K5P A;  5LL6 S;  2BE5 C;  3S1R H;  5I4D A;  2PNR C;  4JBJ A;  4CKE A;  1PH4 A;  4YWM A;  3SR1 A;  1BVS A;  1OXX K;  2K5H A;  4CDE C;  5FLX E;  1BDO A;  4X6A H;  3K5M A;  4QJF A;  3I73 A;  4JG2 A;  5COR A;  4X64 L;  1FVI A;  2CH4 W;  2A69 D;  1L1O B;  1Q1E A;  2D62 A;  3KUP A;  1GKH A;  3DM3 A;  1NE3 A;  5JEA G;  3GTP B;  1K8O A;  4CDF C;  5C3E H;  1QUQ A;  1ENA A;  3TP5 A;  1XNR L;  2IHE A;  4LFA Q;  5I9P A;  1SJH D;  1R9T H;  5EGT A;  1VMP A;  3PO2 B;  4B3R Q;  4LFB L;  1UEA B;  3S2D B;  3S16 H;  3DWP A;  1XTC D;  1QZG A;  1OTC A;  3A8I E;  3MXN B;  3BDC A;  1NUC A;  1YZ6 A;  2E2I H;  2B2Y C;  3AFP A;  4OIJ A;  3J81 c;  4WFN 3;  3WDN A;  4C2M B;  1JB7 A;  3HGB A;  1PH6 A;  2ATW A;  3UE0 A;  3A5U A;  1Y1W G;  4L8J A;  1I4Q A;  1C8C A;  2A68 C;  2NN6 G;  4KY6 A;  3WWV A;  3S1R B;  2QA4 A;  4DUZ Q;  1W2B A;  1PRT D;  2XWJ B;  1LTS D;  5ELC A;  4FF3 A;  2JQO A;  5KNB A;  1RKN A;  4E6I A;  1K8A C;  3M3Y B;  1Q7Y C;  4HSV A;  1O7L A;  3TZD A;  2PMZ B;  4IJL A;  3CF5 A;  4BS9 A;  3VA7 A;  2XRQ D;  1WTH A;  1M90 C;  3G4S A;  1N34 L;  4LF9 Q;  1PTO F;  3VR4 A;  5C3E B;  1VQF A;  1SMY C;  1BBX C;  4ME3 A;  1NMG A;  1QIL A;  3A7L A;  3GP7 A;  1G91 A;  4DR4 L;  1RF2 D;  2RBM A;  1R9T B;  5IGD A;  1E7Z A;  2MPM A;  1EEF D;  3HOY H;  4R4O A;  4GKK Q;  2B2Y A;  3K59 A;  5EPJ A;  3TS0 A;  1BKB A;  3GTK H;  2E2I B;  3A55 A;  2F0K A;  1A15 A;  2K52 A;  1WFQ A;  5FLM G;  5FO8 B;  1GJX A;  2C35 B;  4KKS A;  4V19 0;  3NPP A;  2UU9 Q;  2PW7 A;  5AJ3 Q;  3H3V I;  3J7A V;  2ENB A;  4RKB A;  4BBR G;  5IT9 c;  1QOH A;  1KXL A;  1ZYR C;  2TSS A;  1EYD A;  2CWP A;  2AKW B;  3DXJ C;  3D3R A;  1QNK A;  1PH1 A;  1AEX A;  3SDZ A;  4AH6 A;  1X56 A;  2KJX A;  1TS4 A;  1N36 Q;  1MSG A;  4NP5 A;  4K2K A;  1SYE A;  4N9P A;  4RKL A;  1B50 A;  3HRZ C;  2L11 A;  4IPD A;  4IFD I;  1DZ1 A;  5KGU A;  4OXP A;  1EIG A;  1STE A;  2F4V Q;  2VZA A;  1GD7 A;  1GM5 A;  3PV0 A;  4MIU A;  3A7A B;  1JT8 A;  4ZLT F;  1JOR A;  1D8L A;  1K9M C;  1ENC A;  3CAM A;  3HOY B;  3K7A H;  1LT3 D;  3OYY A;  3RD4 A;  3CCJ A;  5CGK A;  2K1B A;  4CDC C;  3LWE A;  2DNC A;  2KA7 A;  2RHS B;  4OO1 H;  1CFM A;  2R7Z H;  4FYD A;  2BA0 A;  3TRE A;  1Q90 A;  1C48 A;  5CBA E;  3HOZ B;  1Q81 C;  2KHS A;  1RCV D;  4JBK A;  1PV4 A;  1HZA A;  1F2Y A;  4A3I G;  1U4M A;  3HKZ E;  3H0G H;  1YI2 A;  4B9X A;  1S4Z A;  5FKA C;  2GN5 A;  2K6A A;  3OSO A;  4JI3 L;  3MXP A;  2K32 A;  2EXZ A;  1IYU A;  4A3F H;  1SJE D;  1YNJ D;  4U67 3;  2D9U A;  1G51 A;  4XTC S;  2IPK D;  1XNQ L;  3A5Z B;  4C3H H;  1VQJ A;  1MJC A;  2DY7 A;  3VR2 A;  1N33 L;  1PYB A;  1ROD A;  2E2D C;  5C4X H;  4LFC L;  2VQE Q;  4DV7 Q;  3CCE A;  1KRT A;  5DM6 3;  2LFN A;  1S5B D;  4ME5 A;  4OX9 L;  1QB5 D;  4OHJ A;  3K7A B;  2QF7 A;  5C0X H;  1L0W A;  1VQK A;  2A74 C;  2VQF Q;  3FKI G;  1TQO A;  3ZJY C;  1FL0 A;  4IO9 A;  4LF8 Q;  2BA1 A;  3OOC A;  4CHT B;  2R7Z B;  1HTL D;  5C0X J;  3NEL A;  3I56 A;  5C4Z A;  2ZXO A;  2F0P A;  3TP7 A;  1G2S A;  1SSO A;  3I3C A;  1IXR A;  1D6E C;  3T13 A;  3SEB A;  1D1K A;  1UUP A;  5CC4 A;  4RGM A;  3H0G B;  2ICI A;  3S2H H;  5LL6 X;  4K5W A;  2R93 H;  1YEZ A;  1K83 B;  5M3M G;  1IBM Q;  4A3F B;  1EY8 A;  4HTH A;  3U4Z A;  3GDE A;  4A3K H;  4JI8 Q;  1TWC H;  4C3H B;  4B08 A;  1HZ9 A;  2P5Z X;  3J7Y W;  2UXC Q;  1JCK B;  1PFS A;  3FDT A;  1MHW C;  2F0V A;  1VQH A;  2L15 A;  2YTV A;  3A74 A;  3KK7 A;  4A3G G;  3GO5 A;  2EJM A;  1ET9 A;  4DN4 M;  3AYH B;  1PTO C;  4DV2 Q;  5EBD A;  2M2L A;  3KJO A;  1VQ5 A;  4NXM L;  3PO3 H;  4N9T A;  1MIU A;  3ERQ A;  4A3E H;  1NCV A;  5M3F H;  3OWE B;  4HED A;  5CYU A;  4PV1 C;  3F1Z A;  2L9H A;  3SE0 A;  2K5Q A;  3NEM A;  5JJI A;  1MKH A;  1WTQ A;  1D5M C;  3PUX A;  4PMC A;  4A3M H;  2XWB B;  1V1Q A;  2WB1 B;  1B3Q A;  1CZW A;  2AHO B;  2UUA L;  3S2H B;  3GTG H;  3Q6S A;  1E1O A;  1K8M A;  5IGE A;  1CK1 A;  4O1N A;  2R92 H;  1I4H A;  1TWA H;  2F0W A;  2R93 B;  1ESF A;  1PFM A;  2F0U A;  2BDO A;  3PIP A;  1T9H A;  4GKJ L;  4YWL A;  1R4Q B;  1OO9 B;  4DUY Q;  1VQG A;  4XT1 B;  1TWC B;  3CC2 A;  1QVF A;  5IY0 A;  4EVO A;  2CKZ B;  3HS0 C;  3U58 A;  3UDG A;  2HIX A;  1Z7T A;  2I5H A;  1CT1 D;  3J80 c;  4C3I H;  5CV5 A;  3GD7 A;  3P75 A;  2D2C C;  1G2T A;  1STG A;  3KYH C;  3NBH A;  2WFW A;  4AYB B;  4DR1 L;  1HJP A;  1F9R A;  4LF6 L;  4DV4 Q;  1VQP A;  2R3Z A;  3UDF A;  2EOT A;  1PDQ A;  3GQB A;  1PFN A;  1IHZ A;  4LUZ A;  3PIP 3;  4DV0 L;  1X3E A;  4X66 L;  4L5Q A;  5HGQ A;  1X6O A;  1YHB A;  4Z9C B;  5C44 G;  4JI4 L;  4KJN A;  2H1E A;  3Q22 A;  2K75 A;  3GTG B;  2OF1 A;  3D31 A;  2F03 A;  4MNO A;  2Z6B A; 
#chains in the Genus database with same CATH homology
 4A3F G;  2E5L Q;  2UUC L;  4BY1 H;  2JEA I;  4LUV A;  4MZ9 A;  3ER0 A;  4NXM Q;  3GTO H;  4BXX H;  2MNA A;  2JA8 G;  2IT1 A;  1UE1 A;  1Y1V G;  3L0O A;  3STB D;  3U50 C;  4DR2 Q;  4KI0 A;  3RLO A;  2ZTC A;  4JBW A;  4JI0 Q;  2ASB A;  1QVC A;  4KLK A;  5C0X I;  3Q8D A;  1FJG L;  2I5M X;  3CC4 A;  1C0A A;  4JYA Q;  4A3C G;  5ELN A;  2UXD L;  3OTO Q;  1BBU A;  1SMX A;  4JI7 Q;  3RNU A;  2R7D A;  3S24 A;  1U5K A;  2JA5 H;  3S1N H;  1VQD A;  4GN5 A;  3HOU G;  2VNU D;  1TXY A;  2KHJ A;  3CCV A;  2A1A A;  3K0X A;  4JC0 A;  2LSS A;  4YY3 L;  4BY1 G;  2A19 A;  5C0X G;  3T1H Q;  3KF6 A;  1VQA A;  1JJC B;  2CWA A;  4BXX G;  4GS3 A;  1CUK A;  1ASY A;  1SE8 A;  1V43 A;  4B3M L;  4JI1 Q;  4Y7N H;  4IOA A;  2OQK A;  4GKJ Q;  1HH2 P;  1S3O A;  2RF4 A;  4YCW A;  1Q1B A;  1P8L A;  2UXB Q;  3UDX A;  2ZTE A;  4HJ8 A;  3PGZ A;  2Z6K C;  4LF5 L;  1HNW L;  5BR8 Q;  1VS0 A;  3J81 j;  4QGU A;  5J3B A;  5IYB H;  1TWH H;  2WB1 G;  4BBS H;  2JE6 I;  1J6Q A;  1KAW A;  3KOJ A;  4O0A A;  3KJP A;  2AWO A;  1VQM A;  4DK6 C;  1IBL Q;  2OWO A;  2F3I A;  4IPG A;  3TRZ A;  4DV1 Q;  1YNX A;  4JV5 L;  1C9O A;  1KRS A;  3JAM c;  3RLF A;  1HR0 L;  2VW9 A;  2PI2 E;  5H1S E;  1IBK L;  2R93 G;  4IOC A;  1M1K C;  1C7Y A;  2D0P A;  2E2H H;  1QVG A;  4LF7 Q;  4LF6 Q;  1YHA A;  1XMQ Q;  2Q2I A;  1L2F A;  4JI5 L;  1EYG A;  3PUW A;  1PYS B;  4X64 Q;  2ID0 A;  4OWX B;  2EXD A;  1UE7 A;  4LNQ A;  3H3V H;  4JI6 Q;  3S1M H;  1EUJ A;  4DV0 Q;  1GVP A;  3GTL H;  4LW1 A;  2KHI A;  2AWN A;  5IYB G;  2MFI A;  3GTM H;  4BBS G;  4DR2 L;  1AE3 A;  3J7A 5;  5GAD C;  4JOI C;  3L2P A;  4JI0 L;  1S40 A;  4R4I A;  4L5R C;  2IX1 A;  1XNR Q;  2DGY A;  3CPF A;  3M4Q A;  4JYA L;  2PNH A;  1P16 A;  3K81 C;  3OTO L;  3RN5 A;  3AEV A;  1JE5 A;  3HOX H;  4JI7 L;  3CD6 A;  4DR7 L;  4AYB G;  5LMN L;  2ALY B;  1HNX Q;  4LFB Q;  2N3S A;  4R4Q A;  4KHZ A;  3I55 A;  3PUZ A;  4HID A;  3JAM i;  2YTY A;  3PO2 H;  1SFO H;  2UUC Q;  2RCN A;  3NBH B;  3SGI A;  3PUV A;  5LMN W;  1IL2 A;  1EFW A;  4A3L H;  3FP9 A;  2K14 A;  4AQY Q;  4YCU A;  3ULJ A;  4JI1 L;  3UDI A;  5LMU Q;  5GAE C;  5JJK A;  4QIW E;  2Z6K A;  2WB1 E;  2YU9 H;  4IFD J;  1GO3 E;  4HJ5 A;  1N32 Q;  4GN3 B;  3CCQ A;  5M5Y H;  1YIT A;  3W1B A;  1E22 A;  2UXD Q;  4O2D A;  2VS1 A;  1O7I A;  2MO1 A;  2E2J H;  3CCR A;  5BR8 L;  4RMF A;  4LF9 L;  4HIM A;  5GQO A;  4OO1 I;  1N9W A;  1HZC A;  3VDY A;  4UPA A;  1JJ2 A;  3S17 H;  2Q2H A;  3S1R H;  4YWK A;  1VQE A;  1WJJ A;  4JBJ A;  2R92 G;  4DR6 Q;  4APV A;  4A3I H;  1A63 A;  4IFD G;  2F52 A;  2VUM H;  1AH9 A;  4DV1 L;  4A3L G;  1PH4 A;  4HJA A;  1PH2 A;  4YWM A;  3PIO A;  2H5X A;  1BVS A;  1OXX K;  2K5H A;  4P75 A;  2VL6 A;  4B3M Q;  4GKK L;  5JEA J;  4X6A H;  1I3Q H;  1E1T A;  1A0I A;  2B29 A;  4LF7 L;  4DV6 Q;  3FHW A;  4QJF A;  3K8A A;  1DGS A;  4JG2 A;  4X64 L;  1FVI A;  1PH9 A;  4JOI A;  2IY5 B;  1L1O B;  1N34 Q;  1Q1E A;  2D62 A;  4B3S L;  1SN8 A;  1GKH A;  1RIP A;  3DM3 A;  3AFQ A;  3RZO H;  1NE3 A;  1XTD A;  5JEA G;  2UU9 L;  5C3E H;  1PH3 A;  3AQQ A;  3CQZ H;  5JJL A;  1QUQ A;  1I5F A;  4GOP C;  2VUM G;  4DR4 Q;  1XNR L;  3G48 A;  2IHE A;  4LFA Q;  1V9P A;  1OXV A;  3HOV G;  5GAH C;  1CKO A;  1R9T H;  1IBK Q;  4BY7 H;  2K4K A;  4L5S A;  5HY6 A;  1HNX L;  4B3R Q;  2A8V A;  1A8V A;  1CKN A;  2NVY H;  4L5T A;  4LFB L;  3S16 H;  1G6P A;  1XPR A;  4YHH L;  3CCU A;  1QZG A;  1OTC A;  4JI5 Q;  3MXN B;  1X55 A;  3KF6 B;  3M4O H;  1YZ6 A;  2E2I H;  3HFZ B;  3OW2 A;  3AFP A;  3FKI H;  3J81 c;  3S1Q H;  4B3T L;  4AQY L;  1N36 L;  1JB7 A;  3PCO B;  5LMU L;  2JA7 H;  1PH6 A;  2ATW A;  4HIK A;  3UE0 A;  2YV5 A;  4DPG A;  1X65 A;  4J15 A;  3RLN A;  1N32 L;  3I2Z A;  3MEF A;  3A5U A;  2JK8 A;  2JJQ A;  1Y1W G;  3TQY A;  5IYD G;  3T1Y L;  2HHH Q;  4QQB X;  1VQ7 A;  4P72 A;  2BH8 A;  4AIM A;  4NPS A;  4DR7 Q;  2NN6 G;  3WWV A;  5LMN Q;  1W2B A;  2QA4 A;  4DUZ Q;  2PQA A;  2NZH A;  1KC8 C;  1UWV A;  1KL9 A;  1HZB A;  4JCV E;  4DR6 L;  2DUD A;  1N8R C;  2JQO A;  2CCZ A;  1D7Q A;  1K8G A;  3KLW A;  2E8G A;  1EQR A;  1K8A C;  1YHQ A;  1Q7Y C;  2MQH A;  1B8A A;  3CCM A;  2JA7 G;  2ZJR A;  3CME A;  1Q82 C;  4IJL A;  1K3R A;  3CF5 A;  4DV6 L;  3KDF B;  4PZ7 A;  3J81 i;  4TVA B;  1KHI A;  5K36 G;  2N49 A;  2K5N A;  3G6E A;  1M90 C;  3G4S A;  4GOP A;  1N34 L;  1WCM H;  5FLM H;  4LF9 Q;  2JA5 G;  1SRU A;  1SRO A;  1VQF A;  3H15 A;  2PMZ E;  1YJW A;  4ME3 A;  1NMG A;  1IZ6 A;  4DR4 L;  4DV5 L;  4LFA L;  1NMF A;  4BBR H;  1E7Z A;  3B6Y A;  3CP0 A;  3HOY H;  3D0F A;  4R4O A;  4GKK Q;  2D0O A;  4A3G H;  4B3R L;  3TS0 A;  1BKB A;  3GTK H;  1ASZ A;  3S15 H;  4A3D H;  4H02 A;  1JMC A;  1VQ9 A;  2K52 A;  3HKS A;  1WFQ A;  2YYZ A;  3ULL A;  5FLM G;  4B3S Q;  5IP7 H;  1XPU A;  1KQS A;  2C35 B;  1YBY A;  2JA6 H;  2HT1 A;  2UU9 Q;  2B63 H;  1K0R A;  2R7F A;  1LUZ A;  4QY7 A;  1G29 1;  4C3J H;  5AJ3 Q;  3GTP H;  1XMO Q;  4BA1 I;  4LWC A;  3H3V I;  2KEN A;  2Z0S A;  5IYC H;  4BBR G;  5IT9 c;  2HHH L;  3GTQ H;  1KXL A;  5E7N A;  2GVB A;  4JI3 Q;  3RN2 A;  1X3F A;  4DUZ L;  1XJV A;  1W3S A;  3NEN A;  1K73 C;  3I4O A;  3HKZ G;  3KF8 B;  2CWP A;  4YHH Q;  2AKW B;  3S2D H;  4A4I A;  2KCT A;  3L7Z C;  1PH1 A;  4R4T A;  4AH6 A;  1X56 A;  1XNQ Q;  4B3T Q;  2XTI A;  1N36 Q;  1PVO A;  1PHJ A;  2JA6 G;  4KHP L;  4C2M H;  1CKM A;  3EN2 A;  4IPD A;  4IFD I;  1HNZ Q;  1VQI A;  1WYD A;  4OXP A;  5DLQ E;  3T1Y Q;  4LF4 Q;  2F4V Q;  3I4M H;  3U4V A;  3BZK A;  5GAG C;  3HOX G;  2VZA A;  4DV3 Q;  1GD7 A;  5IP9 H;  2N8N A;  1LTL A;  4ALP A;  1GM5 A;  4A3B H;  3PV0 A;  2LXK A;  4OWT B;  1SLJ A;  2V1C C;  1VQ6 A;  3PO2 G;  1JT8 A;  4OX9 Q;  1IYJ B;  3W5O A;  1D8L A;  1S72 A;  1K9M C;  2I5L X;  3RZD H;  2KBN A;  3CAM A;  3K7A H;  3OYY A;  3CCJ A;  4HJ7 A;  4FDB A;  3EBE A;  3M3Y H;  1CKN B;  1YVC A;  4XIG S;  2RHS B;  3M4P A;  1Q8K A;  2R7Z H;  3BU2 A;  4RG1 A;  1VQC A;  2BA0 A;  3TRE A;  3CC7 A;  4GNX C;  3STB C;  2YTX A;  4A3B G;  1Z47 A;  4PZ6 A;  4GLA C;  1QZH A;  1Q81 C;  3M85 A;  4JBK A;  1PV4 A;  3BZC A;  1HZA A;  3JC6 6;  4A3I G;  3HKZ E;  3H0G H;  5AJ3 L;  1YI2 A;  1XMO L;  5C44 H;  4DV5 Q;  2UXC L;  2GVA A;  2OTJ A;  3I7F A;  4NXN Q;  2Q2U A;  4NB3 A;  2ZJQ A;  3CW2 C;  5ELO A;  5IE8 A;  2PQA B;  2GN5 A;  4JI3 L;  3ERS X;  2N78 A;  2FXQ A;  4WJ3 M;  4DR3 L;  1WI5 A;  1I94 Q;  2VY3 A;  4EX5 A;  4A3F H;  3HOW H;  4DV2 L;  1G51 A;  3A0J A;  4IPC A;  4XTC S;  1XNQ L;  3PF4 A;  1H95 A;  2NN6 I;  2WAQ E;  2ES2 A;  3A5Z B;  4GLV B;  1X54 A;  3W1G A;  1YIJ A;  1NJI C;  1LYL A;  1UEB A;  4R4C A;  1Y1V H;  4C3H H;  1EWI A;  2KCM A;  2Q2T A;  1VQJ A;  3TEH B;  5C3E G;  1MJC A;  4HJ9 A;  4TQU S;  1N33 L;  3E9H A;  1PYB A;  1HNZ L;  1EOV A;  1RL2 A;  1WOC A;  2WP8 J;  3LGJ A;  5C4X H;  5M5W H;  4LF4 L;  4LFC L;  2VQE Q;  4GOP B;  2NVX H;  4DV7 Q;  4DV3 L;  2F4V L;  3CCE A;  4BY7 G;  4A3C H;  1KRT A;  1EQQ A;  3K7U C;  4K0K L;  1VCI A;  1J5E L;  3HOU H;  4DK3 C;  4OX9 L;  2QGQ A;  4WJ4 A;  1CSP A;  3HOW G;  1SR3 A;  2Y0S E;  1L0W A;  1EIF A;  2VQF Q;  1OXU A;  3FKI G;  1VQK A;  2EQS A;  2BH2 A;  3ZJY C;  2R6G A;  1E3P A;  1FL0 A;  1L1O A;  2BA1 A;  3J7Z C;  4GNX A;  4IO9 A;  4LF8 Q;  4OWW B;  3PUY A;  4KHP Q;  5M3M H;  4DUY L;  2RHQ B;  5C0X J;  1X9N A;  3NEL A;  3CCS A;  4GLX A;  2ZM6 Q;  3I56 A;  5C4X G;  4DR5 L;  3F8T A;  4P74 A;  1PH8 A;  2UUA Q;  1IXR A;  1PH5 A;  3S14 H;  2UUB Q;  4QL5 A;  1VQN A;  4UP8 A;  4A3J H;  3PF5 A;  3S2H H;  3F2D A;  2NVQ H;  2XGT A;  4JBM A;  1BBW A;  5C4J H;  1Z9F A;  4NXN L;  2I0Q A;  2R93 H;  1YEZ A;  4HIO A;  1E24 A;  5M3M G;  1IBM Q;  4DV4 L;  3EIV A;  3U4Z A;  1I94 L;  2CQO A;  3GDE A;  3IRB A;  4A3K H;  3PSI A;  4JI8 Q;  1TWC H;  2LXJ A;  4P73 A;  4JI2 Q;  2EIF A;  3KFU A;  1WCM G;  1VQB A;  4POG A;  4LUO A;  5FJ8 H;  4PZ8 A;  4A3J G;  1AE2 A;  1HZ9 A;  1NTG A;  3UE1 A;  3CCL A;  3HOZ H;  1UE6 A;  4X65 L;  2UXC Q;  2NVT H;  1A62 A;  1PFS A;  4PG3 A;  1Y14 B;  2L15 A;  1VQH A;  2YTV A;  2IHF A;  4X62 L;  3A74 A;  2VQE L;  2B3G A;  4DV7 L;  4DR1 Q;  2K50 A;  3CXC A;  4A3G G;  3GO5 A;  4R1J A;  3ICE A;  3ULP A;  1VQO A;  4DR3 Q;  3RR5 A;  4A3D G;  3KDF A;  1UE5 A;  3I4N H;  4PMW A;  4A3K G;  4EQ5 A;  1HR0 W;  2E5L L;  3AYH B;  3HOY G;  1MJE A;  2OTL A;  1VQ5 A;  4DV2 Q;  1B7Y B;  2IX0 A;  2PI2 A;  3KJO A;  2VQF L;  4NXM L;  3PO3 H;  1MIU A;  5IP7 G;  5FJ8 G;  1YJ9 A;  4X66 Q;  4A3E H;  4LF8 L;  1OXS C;  5M3F H;  4POF A;  2B63 G;  3F1Z A;  1Q86 C;  3HOZ G;  2K5V A;  2ZTD A;  3NEM A;  1LM0 A;  1N33 Q;  1TWF H;  4JI4 Q;  5JJI A;  2ZM6 L;  1B70 B;  2OCE A;  1MKH A;  3M9B A;  5IWA Q;  3PUX A;  5IYC G;  4LFC Q;  1U0L A;  4A3M H;  2WAQ G;  3F2B A;  4P71 A;  4K0K Q;  1V1Q A;  3DLL A;  2UUA L;  2AHO B;  5FLX c;  1CSQ A;  3CPW A;  1J5E Q;  2UUB L;  3GTG H;  3I4N G;  4BA2 I;  1E1O A;  1QUQ B;  2R92 H;  1TWA H;  3CMA A;  3T1H L;  3PO3 G;  1NBW A;  2JEB I;  3M7N A;  4A3E G;  2OQ0 A;  1KD1 C;  5M3F G;  4UP7 A;  3PIP A;  1T9H A;  3GTJ H;  3G71 A;  4GKJ L;  1IBM L;  4YWL A;  4DUY Q;  1VQ8 A;  1VQG A;  1KIX A;  4DKA C;  5EAY A;  4YCV A;  3CC2 A;  1QVF A;  1FJG Q;  2Y0S G;  4JI8 L;  4GN4 B;  1L1O C;  5IY0 A;  4DR5 Q;  2UXB L;  2CKZ B;  4A3M G;  3I4M G;  3U58 A;  3UDG A;  3K80 C;  4JI2 L;  4UY8 C;  2HIX A;  2HIV A;  3E0E A;  5IP9 G;  3E9I A;  2I5H A;  1Q12 A;  1TWG H;  4DAM A;  4C3I H;  3J80 c;  1PH7 A;  2ZJP A;  3GD7 A;  1IBL L;  4YY3 Q;  1I6H H;  4MTN A;  1VQ4 A;  2CFM A;  3KYH C;  1I50 H;  4DNI A;  2WFW A;  3TS2 A;  4A93 H;  3BJU A;  4DR1 L;  3HOV H;  1HJP A;  1YJN A;  4OO1 G;  1OXT A;  5GRO A;  4DV4 Q;  1VQP A;  2NZO A;  4LF6 L;  1K83 H;  2R7Z G;  4A75 A;  3UDF A;  1XMQ L;  2QEX A;  5M5X H;  1XPO A;  1VQL A;  4IPH A;  4JI6 L;  4LUZ A;  4LF5 Q;  4DV0 L;  4IJH A;  1X3E A;  2MO0 A;  4GNX B;  2JA8 H;  1HNW Q;  4X66 L;  1FGU A;  1Q46 A;  4L5Q A;  5HGQ A;  4AYB E;  1X6O A;  2AMC B;  4Y52 H;  1JJG A;  1YHB A;  3H0G G;  4X65 Q;  5C44 G;  1EIY B;  4JI4 L;  2HQL A;  4DAY B;  4UP9 A;  5IWA L;  1Y1W H;  4A76 A;  1X3G A;  3J80 i;  4JV5 Q;  1HR0 Q;  4A93 G;  4X62 Q;  5IYD H;  2JA9 A;  1NY4 A;  1PA6 A;  2K75 A;  4OON A;  3D31 A;  3F2C A;  4MNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...