4CDDC

Human dpp1 in complex with (2s)-n-((1s)-1-cyano-2-(4-(4-cyanophenyl) phenyl)ethyl)piperidine-2-carboxamide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 68
sequence length 68
chains with identical sequence F
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4cddC00
2DJFC 1MHWC 2DJGC 4CDEC 4CDFC 4OEMB 1K3BC 4CDCC 4CDDC 1ICFB 4OELB
chains in the Genus database with same CATH superfamily
1TWGB 1VDZA 3H6MA 1ONLA 3PIP3 4KJNA 1VQJA 3TSSA 1STEA 4DV7L 1IL8A 1VMCA 1CZGA 3I4OA 2UUAL 1TWCH 3G6EA 4LMQD 4LWCA 1F2YA 2A8VA 1KDAA 5M3FG 1VQIA 5M5XH 5JEAG 2A69D 4JK1C 2EY5A 3NXWA 4L5QA 5ELNA 1PH2A 3CCMA 1E22A 2YU9B 1TVXA 2Z9HA 3MAQA 4H02A 3VR5A 3ZJYC 4DV4L 4YIJA 4G7HC 3PO3G 2PW7A 5CV5A 1LT5D 2H1EA 2NVXB 1XXGA 1CHQD 3S1RH 2QDBA 1NAPA 1PYSB 1B50A 4YY3L 1JOKA 3E6ZX 4JI1Q 3DM1A 3EVQA 3SGIA 4EX5A 1PTOD 5IYDG 5IYBG 1BDOA 1HTLD 5EBCA 2F52A 4YWKA 1UAPA 2VUMG 2AMCB 2JA8B 4O1NA 2JA5G 3NP8A 4FO2A 3H3VI 1WOCA 3G48A 1PFSA 2F0TA 2F0EA 1PYWD 5E1FA 3RZDH 3MFYA 4C3JH 4X62Q 3C1FA 3FPPA 3P1HA 4FDBA 4J1MA 1SN8A 4DR7Q 5E4XA 3K7UC 1TWFB 5JEAJ 1YJ9A 2DGYA 2LY7A 1PFNA 1BOSA 1KNAA 2EQSA 2AUKA 2B8GA 2K28A 1NE3A 3T53B 1YJNA 1V8QA 1K8AC 4IOAA 1B9MA 3K81C 2VB2X 1QILA 1XTCD 1Y1WH 3GTGB 4RCOA 2R7ZG 4LW1A 1KTKA 5DNFA 5JJIA 3MHBA 3WDNA 3F2DA 5CORA 3KF8B 2QILA 2JYOA 1HNXL 1ENFA 1SFOB 4LF4L 1IBKQ 2YTYA 1E24A 2DJFC 1I94L 1XMOQ 1EIFA 2JN4A 4GS3A 4NXMQ 1H9MA 2L5TA 5KNCA 3VYRA 1AN8A 1R4QB 3S14H 2HQEA 1MD2D 2ZT9C 1ET9A 4X64L 2I5MX 1Y8OB 1H9SB 1G6ZA 2RCFA 2HDMA 1X54A 3HOVB 1C4QA 2VNUD 2D5DA 1WJJA 2PO4A 4JPBW 2FMMA 3A54A 3KJOA 1QVFA 4A3JB 1WTOA 1TY2A 2XWJB 4OX9Q 4GN4B 2WB1E 1T5EA 4L5RC 3NUCA 3Q0AA 1NMGA 1CK1A 2CKZB 3OWFA 2EJGC 4LAAA 1WFQA 1KAAA 2WAQG 2R6GA 2E2IH 1BQQT 4JBMA 3U4VA 4LFAL 4DUZL 2KHIA 2E75C 4CKBA 1PH3A 3L9AX 1OXXK 3HOYG 3I4MH 4XQJA 2RSNA 1U0LA 4WRDA 1B3AA 5IP7H 1ENAA 1A3VA 3BU2A 1X3PA 3EQLC 5KRUA 1YITA 3SDZA 1E2VA 1F9RA 1G6PA 4K5XA 1FVIA 4RHRA 1HA5A 2A6ED 2M9VA 3AB9A 1O80A 4RFBA 2B2TC 3P7JA 5IGCA 4G7ZC 4C3IB 5ELCA 2CQAA 4LJZC 5CV9A 3M3YH 3J80c 4JVZA 3MTSA 1UWVA 5M9OA 2KEDA 3MXUA 1RJTA 1BBXC 2CH4W 2VY3A 3MEHA 1RHPA 1PTOH 3X3MA 3S17H 1X55A 4DV5Q 1EOVA 1SYDA 2WV6D 5FLXL 4UY8C 3I4NH 2EPBA 4ME3A 4QL5A 4FXDA 2A73B 4L5SA 4IPGA 3CD6A 4OEMB 4X66Q 1PXUA 1MI2A 1PH9A 1ASYA 1PH8A 2IT1A 2H5XA 5C4XH 1UE5A 3F8TA 3ITPA 4CKEA 3V2TA 5KGUA 1S72A 4QJFA 2ZXPA 1R9TH 1EQRA 2IWHA 1B44D 1ZKOA 2B2VC 3UDIA 2KHSA 4WJ4A 3PMFA 1ZYRC 3CCJA 1CSQA 3A55A 4F7XA 1V1PB 5IP9G 2CQOA 1I3QH 2XTIA 2NUCA 1V1OA 2L11A 1PRTB 4DAVA 2DUDA 1I4PA 3UDGA 2UXCL 4YWLA 4DF7A 3HOXB 3KK7A 1OXUA 1W6JA 5JAVA 1CA6A 1CI3M 4Q5VA 3Q6SA 4AQYQ 5LMNQ 1CHPD 2EYLA 4B3TL 2WB1B 2F0UA 3PIO3 4DV3Q 3KLSX 3T1HQ 2B8FA 3N6RA 4V0BA 2SOBA 2NZOA 3J7YW 2UXBQ 3VYSA 2RF4A 4ZLTF 1X9NA 2F0MA 1GOZA 4DAYA 4NXML 3S2DH 1JC7A 3PO2H 1EYAA 1O7ZA 2KJXA 1YNJD 2AHOB 4HIOA 3QOJA 1LT6D 1BCPB 1U4RA 1L0WA 1XTDA 4JV5Q 1CA5A 1GVPA 1IW7D 1NY4A 1F9PA 3S15B 4HSPA 4OO1G 1SNDA 2JA7B 3GTQH 2HT1A 1TWHH 1QWYA 1DONA 3A5UA 1GUWA 4DA2A 3NK9A 4DV2Q 3PF4A 3OWEB 1D7QA 2O2LD 3I73A 3S1MH 2KECA 1QUQA 1K83B 1B53A 3KYHC 2XVSA 3HOVG 2PYKA 4JW0A 4PZ6A 1N32Q 4A3JG 1GUSA 1F9SA 3MA2B 3K5OA 1ML0D 4CJ1B 2AQ3B 1B1ZA 2LXKA 2NZHA 3GQBA 1A2UA 1S5FD 2B2UA 4XTCS 3RLFA 1UE7A 3S1QB 3LWUA 3GDEA 1X6OA 4NPSA 5J3BA 1CFMA 5L37A 4N9TA 4FNFA 3RZOH 1PHJA 3KFUA 4GKJQ 1J9OA 2BOSA 4ULLA 3HOWG 5EAYA 5K5PA 1BCPC 1O7LA 4H44C 2ICEC 1NJIC 4HJ5A 3S1NH 1N9WA 1WYDA 1B9NA 3K0YA 2RSOA 3K5LA 5LMUL 4JI4L 5H1SE 2VQEL 5KEEA 1S5DD 1Q86C 5I2XA 1BKBA 4R8IA 4L6TB 1ZEQX 5EKKA 2MO1A 5C0XJ 2VL6A 1OXSC 3ULLA 4LF9Q 4L63B 2E76C 1FGUA 3L7ZC 4KHVA 1N34Q 3BZCA 2Z6KA 4HMIA 1PDQA 3OSOA 4XYQA 4C3IG 1VS0A 4PG3A 1HZ9A 1XJVA 4MHEA 5ELEA 3P75A 2UUCQ 3IFDA 3VYUA 1HZAA 4GN3B 1HJPA 2R7FA 3A8KE 3MXPA 4LUVA 4KI0A 5TSSA 4DXGA 1S40A 2QEXA 5JJZA 4K0KL 1K73C 1K8GA 2N88A 4HJAA 4A3KH 1HNWQ 2R92B 5LL6S 2AUJD 2D9UA 4DR1L 2PPBC 2EYPA 4DGZA 2F0JA 2GN5A 3QO2A 2B2YC 5DM63 5BN3A 5EJWA 1F2ZA 1GD7A 1IKMA 4P74A 2E2JB 4FYDA 2WAQE 5KYIA 3CW2C 5IWAL 1VF7A 1DXMA 4DV1L 1AZQA 3H0GH 3M4OH 5I4DA 3BVMA 4LF6L 3JAMc 4RMFA 2NB0A 1ILQA 3RLOA 3KLWA 5I9PA 2Q8TA 5LMNL 3OMGA 1GXDC 2YTVA 5DAUA 1LUZA 4F8MA 2C5CA 1EU3A 3DWAA 2ES2A 1ZYRD 2F0FA 3TQYA 4B3ML 2UU9L 1VF5C 2HQLA 5LL6X 3NBHB 4JI5Q 2WINB 1HR0W 1FR3A 4JOIA 2RA4A 2F4VL 1K28A 2ZXOA 2RHQB 3RN5A 4APVA 2K4KA 4Y52H 3HOXG 1VQNA 1SYBA 1J5EQ 3D6WA 3SK8A 1V9PA 1SXTA 1UUPA 1SNPA 4B3RL 2Z4HA 1M90C 3M4PA 2WB1G 4LF5L 3P20A 1S3OA 2K33A 4IPDA 1NBWA 2BDNA 1HR0L 1CSPA 1Q1BA 3U4ZA 1PH5A 4DV2L 2E2DC 3TEHB 5CMDA 3VYTA 4DR2Q 1K3BC 1R4PB 2JA6B 5C44H 2IPKD 1VQFA 2B63H 1PRTF 2F3WA 4DUYL 2E5LQ 1CTMA 2NVYH 3MWYW 4JYAL 3RD4A 4IUUA 3QJYA 3S16B 1VMPA 2JA7G 1HA6A 3VR4A 4GOPA 4DR6L 4JI7Q 5I9OA 3T13A 2PI2A 3T1YQ 1ILPA 4LFCL 3K58A 1VQLA 3M4YA 3J81L 1NR4A 1MSHA 2GVBA 3C1EA 5CV6A 4FP5D 1SMYC 1JB7A 2YTXA 1HH2P 4R4TA 1PV4A 4JI8L 1X3GA 2K01A 4XQNA 1QZGA 5DEHA 1BBWA 1HCZA 4BXXH 1G2TA 1RTOA 5JPMC 4BY1B 2IX0A 1DM0B 4NXNQ 1BNZA 1KQSA 4MN3A 1BCPF 5K36G 4OONA 1JT8A 5BN5A 3I3CA 1LLRD 3GV3A 4AH6A 1CKNA 3BG3A 1FJGL 4BBRB 4DN4M 1EIHA 4K6LA 2XNAC 1XYIA 5A35A 5GROA 4LF9L 2UXDQ 2RVLA 3HRZC 5C5MA 1A15A 2D0PA 3O13A 3IRBA 3OTOQ 5M5WH 1IYJB 2XRSD 1M8AA 1WTPA 1PYBA 4LFBL 2OTLA 3VDYA 3CP0A 4HEDA 4QY7A 1SLJA 3DWQA 3CC2A 1GHJA 1YZ6A 2BA1A 3BDOA 3G7LA 3CCRA 2CHBD 3TDQA 4EQNA 1ESFA 3CRLC 3IL8A 1IBLL 2CFMA 4GNXA 1WTXA 1I6HH 2MPMA 3BJUA 4B9WA 4X65L 2LXJA 2F0QA 2MQHA 2OEOA 1RL2A 4A3IH 5COYA 5J39A 3M85A 5CC4A 4DV0Q 1WTRA 4RWSC 1LT3D 5IT9c 1WD1A 4BBSB 3KUPA 4Y7NB 1EU4A 5GADC 3CCSA 4A3FH 3FKIB 2R92G 2AQ1B 3IKJA 5IE8A 4K6DA 4DR3L 4C2MH 4Q0FA 2IL8A 2KCMA 2A6HC 2PCFB 1HUNA 4LK1C 4A93H 2R3ZA 2AQ2B 4A3DH 1F2LA 3M7GA 5IYCH 1QCBD 1LTRD 1NMFA 2F3VA 3NTKA 1F77A 4RAUC 5J1ZA 4A4IA 4IFDH 2ZM6L 1PFMA 1QVCA 2M00A 3M9BA 1UEAB 2R93B 1NSNS 5KNBA 3N52A 4A3EH 2C9OA 4GLVB 3HKZE 2Z8LA 4ODGA 1J5EL 4BWGB 3GTOH 1KD1C 2Z1CA 1I4RA 2AKWB 1DGSA 2NZ1D 1SYEA 4JI3L 3F1ZA 4DXFA 4YHHQ 3CC7A 2NYZD 2BDOA 2VZAA 3K7AH 1SE8A 1RODA 3W1GA 1ZXTA 2Z6BA 4KLKA 1KLUD 1UE1A 1XNRL 4A3LH 3D4DA 2L15A 3J80E 4JCVE 2EY1A 4HIDA 2A19A 1YBYA 1VQAA 3CAMA 4JBWA 3VR3A 2GVAA 3T16A 3PUZA 4NB3A 3TS0A 2DNCA 5CV4A 1IBMQ 4BA1I 2C35B 4HCEA 1RDPD 1HUMA 3VA5A 4NP5A 2JXMB 2TSSA 4JI6L 3TN2A 1K0RA 4YCWA 1L0XB 3NHHA 4EVOA 2JA6G 3HOZH 2NTTA 2VXWA 2Z0SA 2JA9A 1HZCA 4TKOB 3SE0A 5FLXE 4DU9A 5C3EB 2KA7A 1OO9B 4DPGA 1XNQL 3M4QA 5CBEE 2Y0SE 4DAMA 3QIAA 1LM0A 2CVRA 1H95A 3NWSA 4QMGA 4RH6A 2L9HA 1AH9A 1MKHA 1V43A 1PZJD 1AE2A 2B39A 1MGSA 4BY1G 3V96A 2F0SA 4NMZA 1SMYD 3I7FA 1K8MA 4IOCA 4FVMA 2Q2HA 1H9RA 5FJ8H 3TS2A 5FLMH 2N3SA 3NSWA 1WCMB 2CW0C 2EY2A 1X32A 1O7YA 3HOUH 4BBRG 1JB3A 3SK4A 4A3BH 2WACA 4ABNA 1EY4A 4OIKA 4C1NK 1YIJA 3GV6A 3H91A 4QCLA 3R93A 4A3MH 1PH6A 3TP8A 5BR8L 2PNRC 3I55A 2K5QA 4J6HA 4A3CG 2QF7A 3V05A 3ND9A 4HN7A 1Y69U 3GTJB 1KDBA 5FK9C 4YCUA 4LF7Q 1L1OB 2EDGA 4ZQ3A 2L12A 4A3GH 1FL0A 4OL7A 2A74C 3A7LA 1D5XC 1GM5A 1JWMD 5M3MH 3HKZB 3FEWX 3QOLA 1TQOA 3JAMi 1KIXA 3GTMB 2PZTA 3QB3A 1TWAH 3G4SA 1QG7A 4YCVA 1N33L 4PV1C 3HOWB 2QEJC 3NWTA 1SE3A 1VQKA 1AEXA 4KV6A 3CMAA 1VQPA 4HJ8A 4RGNA 1MJCA 4FF2A 2NVTB 2MJ8A 1UNSA 1KNEA 1STYA 4J15A 2ICIA 5C4JB 4HJ7A 2PQAA 2GA4B 1Q12A 2NTSA 4BY7B 4BBSG 4N8X1 5C4HA 2NN6G 2VQFQ 1XPRA 1K8OA 2K03A 4PZ7A 4BS9A 1VCIA 3CQZB 3DXJC 1Y1VB 3FKIG 5NUCA 1TS3A 2OWOA 4GLAC 4V190 3A74A 2F0IA 1ESRA 2B2TA 3W1BA 2F0DA 1Z9FA 1PH1A 1HRJA 4LF8Q 4JG2A 4GN5A 4B3SQ 4DV6Q 4OWWB 2Z4IA 1STBA 1JWSD 4M1UB 2N55A 2A6HD 2BE5C 4JI1L 4UP8A 1I6VC 1TWCB 2ZTEA 2NVQH 1CUKA 2R93G 1L1OC 3NTIA 4K2KA 4JI2Q 5M5XB 4A75A 4KMUC 2JP1A 4RHSA 4X62L 4R4QA 2BH2A 4F87A 2Y0SB 2UUBQ 4EQOA 3NQIA 4KK7A 3GTLH 1I4QA 2P5ZX 4DR7L 5M5YH 5FLXc 3S1RB 2SEBD 3K5NA 2XN9C 1GKHA 1SJHD 1EIGA 3GTPH 3TZDA 1E3PA 2B2VA 3GO5A 3TP6A 1D5ZC 1TXYA 1Y8NB 4PMCA 2KBNA 5JJLA 1XMQQ 3FDTA 4GKKQ 5M3FH 3PUVA 3H3VC 2KOLA 5JEAH 3RZDB 5ELBA 3J7AV 4C3JB 4JI0Q 3A8JE 3KOJA 4IURA 2ZJPA 4FF4A 1QJOA 2JEBI 3BVGA 1VQCA 3EIVA 3DEOA 4C3HG 5FOBB 2EYHA 1LTGD 1VQOA 3OPOA 1IKLA 4WFN3 1FNVA 4C1NI 1STAA 2EYMA 4IUNA 2R7DA 1JE5A 3PO3H 1VQ8A 2JSOA 4ZKBB 2CCZA 3FRPB 2HCIA 3Q23A 1IBKL 3I90A 1I5FA 3TRZA 5C3EG 1AFPA 4DKAC 1XMOL 2K32A 5IYDH 5IYBH 4CBVA 2FINB 3E9IA 4OWXB 3JAME 3KDFA 2VUMH 1YHQA 5FO8B 4UPAA 2JA5H 3T56B 5IGDA 1Y1WB 3NENA 1PVOA 1EQVA 2KUMA 4HTHA 4PMWA 1EY9A 5ISRA 1SROA 2PQEA 1KDCA 3D4RA 3R3OA 3NPPA 4KHPQ 4OX9L 4UP7A 1SAPA 2O5JC 1JCKB 2B2WC 2EYOA 3PGZA 4GLXA 4K5VA 1V1PA 1DD2A 4MTKA 1WCMG 4XT1B 4DAPA 2Q8IB 1TR5A 2KCCA 3S14B 4IUPA 4B08A 5IGEA 4FXKC 5C0XG 2NWGA 1PRTC 1ICFB 4N8FA 1YI2A 2CW0D 1JOQA 1HPCA 4RGTA 3S2HH 3I56A 2K5HA 2R7ZH 1JE4A 1MSGA 1HNZQ 1SNOA 3J7AF 1I50H 3G6JB 5JOBA 3PF5A 2A1AA 2EXZA 3D3RA 3TP7A 2IHEA 1EQQA 3K59A 4HSVA 3HKZG 4XXEA 2E2IB 2HDLA 4X3SA 4P2CB 4KN7C 3IFTA 4DNTB 2V4DA 3I4MB 3EA6A 3F2BA 1B7YB 4RCNA 1ENCA 2KEEA 1YNXA 5IODA 2WFWA 3NELA 3D6CA 5AJ3Q 3UE0A 2A68C 4DV5L 4KKUA 1YEZA 1IYUA 4ZUIA 4BY7G 1EY0A 4RKLA 2DY7A 1KRTA 1HQRD 4N9PA 3PIOA 4DR4Q 4HJ9A 2R61A 1Y1VG 4DK3C 2Q8RE 4HMJA 1EL0A 1STNA 4M8AA 4P72A 5KYLA 3GTKH 4X66L 4NKLA 2HHHQ 5EBDA 1Z7TA 3M3YB 2AWNA 2KQ3A 4QIWE 2DNEA 3A0JA 3HOYH 4QB4A 3Q22A 1VQGA 1PTOB 2CWPA 3S17B 1FNUA 5E4WC 4KKSA 3CC4A 5EPKA 2BE5D 1JICA 5D3IB 1D1IA 1O7IA 2JJQA 3QWNA 2EZVA 1A6XA 4IPHA 5LMNW 2N8NA 3I4NB 2B2YA 1SE2A 1E1OA 2QDLA 2Y0SG 2E2HH 2I5LX 1O78A 2NBFA 5JVH3 4DR5Q 4K8JA 1SJED 1X56A 2XWBB 5C4XB 1DYQA 1SRUA 1K0SA 3OYYA 2VS1A 1TWGH 3BYTB 4AQYL 1VQBA 1R9TB 4A3LG 3KBXA 1Q82C 4HCSA 1FYCA 5HGQA 1JMCA 4DV3L 4UP9A 5IT9E 3SK5A 4PNYA 3T1HL 1NR2A 2A69C 4AYBB 1M4VA 2N78A 1WTVA 2UXBL 4K8IA 1NCVA 1TU2B 1I3QB 4C3JG 5HURA 1IL2A 1Q81C 2I46A 2K1BA 2K7VA 4CJ2C 5E3FA 2YU9H 3B6YA 3DLLA 2YYZA 3I2ZA 4KY5A 3WWVA 4A76A 4JV5L 2B29A 1TY0A 1BUVT 2ASBA 1EZ6A 1EIYB 1BO0A 1WD0A 2ENBA 2NVXH 1WI5A 4DV7Q 3JC66 5ELDA 1WVLA 2XGTA 5J22A 2WIIB 4KKTA 3I8ZA 1T9HA 4QUFA 1TKWB 2UUAQ 3A7AB 3KF6A 3S2DB 2JA8H 3PO2B 1ASZA 1Y1WG 4CGYB 5IP9H 3DEPA 1EYCA 1XWEA 4MIUA 3Q24A 1CKNB 1CKMA 4DV4Q 1N32L 1YJWA 2X69A 2F0HA 2K05A 4EQPA 3GTQB 1VQ5A 3L2PA 1TWFH 1TWHB 3TP5A 2KCTA 1EOTA 4YY3Q 1D6EC 4OHJA 4OGQC 1DOKA 5CGKA 3D31A 4NW2A 4R8NA 3HGBA 4GKJL 4ALPA 4ZK9B 2F0LA 2PMZB 4TVAB 3S1MB 2G5DA 3TZUA 3A8IE 1B4OA 1TS5A 3J81c 2ID0A 1U4MA 4OELB 3SHLA 3ULJA 1MIUA 3GP7A 3GTGH 3PSIA 1PRTD 3R8BA 5T1GA 1WTHA 2PW5A 2D2CC 3EFXD 4QIWB 1G51A 3SR1A 1E2WA 1IHZA 5EKIA 3RMHA 3EJIA 2EJMA 4GNXB 4PMBA 1SFOH 4XYOA 4OO1H 1KL9A 2F0PA 4LUOA 1OTCA 4HAEA 2K75A 1N34L 3RZOB 4ZRZA 5ELFA 5F2DA 3I4MG 5ELOA 4R4CA 5G3LF 1CQVA 2UUCL 1Q7YC 1W2BA 1GHKA 3S1NB 1VQHA 3AEVA 5IP7G 3HP3A 3MZ5A 5EGTA 1BCPD 1SDFA 3CMEA 1SYGA 3HOVH 1F2MA 2KENA 4GZYC 1HNXQ 4A3JH 3C2PA 1HNWL 4G7OC 1EEFD 1QOHA 4LF4Q 1LV9A 3C3LA 4H0LC 2A68D 4NDXA 2K5WA 5CBAE 1I94Q 2M2LA 1PH4A 1C0AA 2EIFA 1TS2A 3W3AA 2JE6I 2X6GA 1RIPA 2ZTDA 2BH8A 4MNOA 1EUJA 3PUWA 1Q1EA 1OXTA 4X64Q 4CHTB 1KRSA 3HZXA 3E5SA 2LSSA 4OO1I 3MXNA 4GNXC 4A3KB 1LTAD 4XDXA 1A3UA 1EY5A 1CZWA 2QGQA 3K8AA 1A2TA 1XX8A 2A5HA 2RDFA 3PV0A 1DJRD 3I4NG 3ER0A 4QF4A 1HFGA 3FPUB 3HS0C 4JI5L 4U673 4LFAQ 4R1JA 1K9MC 1A0IA 4DUZQ 5C4XG 2TMPA 4C3IH 1U5KA 4DNIA 3H0GB 1I4XA 1H9JA 2F0KA 3M4OB 2OQ0A 3ERQA 4DK6C 1KXLA 1PTOF 5IGBA 3LX0A 4IO9A 4QGUA 2HIXA 2Q2TA 4DK1A 4AYBG 1IXRA 4RG1A 5AFWA 1DZ1A 4IJLA 5C3WA 1C7YA 5IGFA 2SNSA 4DR2L 1K3RA 3RLNA 5CV8A 1KAWA 4RKBA 3EROA 3BZDB 4I65A 2RCNA 1QNKA 2E5LL 1LTSD 1P8LA 3CHBD 3HKSA 1ICWA 1Y8PB 1G91A 1GUTA 2F1MA 3MC0B 2ZXRA 3BYYB 1AE3A 1E1TA 5IY0A 1GUOA 1SNCA 4JI7L 3T1YL 1GUNA 2RKSA 3DUZA 4L5TA 4P75A 1FD7D 2RDGA 1S5ED 3G71A 3HFZB 4C3HB 4POFA 4K2LA 1Z6HA 4KN4C 4IFDI 3FVQA 3PO2G 4U68A 2LKVA 3TMEA 5I6YA 1Y14B 1ET6A 3I70A 2F3IA 1WTQA 5C44B 2B63B 3UE1A 1VQ9A 2JQOA 4NXNL 1L2FA 3SK6A 2Q2UA 1SSOA 2NVYB 1D1KA 1XPUA 4G57A 1G8ZD 1STHA 5GQOA 1WTWA 1II3A 2H4OA 2PZUA 2FXQA 4DNRB 3VR6A 3HOXH 4ZYSA 1SE4A 2EYJA 3LNNA 1S4ZA 1IZ6A 3CPWA 3KBGA 3PQIA 1BXTA 4TSSA 5DM73 2UXDL 2F0VA 4CDEC 3U9OA 3PIPA 3OW7A 1V1QA 1CKOA 4B9XA 2RDHA 1N36Q 2XSCA 5JJKA 2FHTA 1VQ4A 1SNQA 1YNJC 3OTOL 5FKAC 1QVGA 2N49A 4X3UA 2OF1A 3HEJA 4IUVA 1IW7C 3UDXA 2UXCQ 1D2BA 1RD9D 1FGBD 2EY6A 1MJEA 3K5MA 2BA0A 2JA7H 3S15H 2OT2A 1RF2D 2EYFA 1QE6A 1PZID 1VQDA 4B3TQ 3L3OC 3RN2A 5CV7A 2PQAB 2K5DA 4H7BA 1W6KA 5M5WB 1AP0A 5A2QL 1W3SA 4UHVA 1KLGD 3ERSX 4DV0L 2MGSA 1YHAA 1Q8KA 1K83H 3CCVA 5CYUA 4IZ8A 1A3TA 3AU7A 3H09A 4MTNA 5E7NA 2OQKA 5K36H 1JJGA 4K5WA 3VA7A 4O0AA 2J0TD 1B70B 5IOCA 3WOFA 3QG1A 3KF8A 3S1QH 3X3NA 1P16A 1X3FA 2ZJQA 1I6HB 2IY5B 1EWIA 4OWTB 5C6AA 3DMUA 4A3IB 1X3EA 2MO0A 3BZKA 3MFGA 1EYGA 4EGVA 3T4AC 4A3FB 1XPOA 1LTLA 5DLQE 1TT2A 4EQ5A 5GAEC 2CWAA 3OW2A 4A3KG 1H9SA 4C2MB 4YHHL 3K6OA 2RHSB 2LFNA 5KIXA 1EFWA 4XT3B 4A93B 2SNMA 4A3DB 5C3XA 3BVZA 2PNHA 3J80L 1UEBA 2SDFA 3MXGA 2IJ0A 4KD3A 1LO5D 1L1OA 2PZWA 4A3EB 3H0GG 3GTOB 4R9WA 4CDFC 2K5VA 2RQXA 4G4KA 1IBML 2K6AA 1FNWA 3LWEA 3K57A 4FF3A 3AFQA 4O42A 1HTPA 2MHVA 5LMUQ 4CDCC 4JI4Q 1OXVA 2VQEQ 4KD4A 3K7AB 1U4PA 2R92H 1AW7A 3UI2A 4DK0A 2AWOA 4OXPA 1LTBD 5JPNC 3E0EA 1E7ZA 4DAYB 5FO9B 2I5HA 3CCLA 1HQMC 1C48A 2G9HD 3KDFB 3J81i 1JORA 4KY6A 3ICEA 5D14A 4DFAA 2F0WA 1BR9A 1EYDA 2E2JH 3S9WA 5I6WA 3MEFA 1SEBD 1X3QA 1LTID 5EPJA 4K0KQ 1JJ2A 3TBIB 2ZJRA 3PUXA 3CCUA 3M7NA 4IJHA 1JJCB 2IX1A 3CRKC 2WP8J 1LYLA 4TRDA 2JA8G 2L55A 5D3DA 3LGJA 4DR1Q 1GUGA 1SYCA 2I07B 3A56A 3HOZB 1N36L 5C44G 1LT4D 2B63G 1EY7A 1I4GA 4QQBX 5BN4A 4P73A 1BBUA 3CPFA 2B3GA 1EFID 2LS01 4I7AA 2K50A 3VR2A 2VW9A 1PH7A 3NE5B 4TQUS 5GAGC 4J8QA 1QUQB 2ALYB 4ZAIA 3PCOB 2XIWA 3W2DA 1E2ZA 2K52A 5IWAQ 5CR3A 4KTAA 3WOEA 4DV1Q 1KABA 1GO3E 2CH4A 3OOCA 1EZ8A 2E74C 3DM3A 3OHXC 4CDDC 2HIVA 4LF6Q 1HXYD 2FFKB 1NNXA 2EXDA 3AFPA 4RGOS 1CQFA 2K04A 2MP1A 1MHWC 4BXXG 5EPLA 1SR3A 2HCCA 3FHWA 4B3MQ 4AYBE 2UU9Q 2QW7A 1I4HA 1TIID 4LF7L 2YV5A 1C9OA 1NUCA 3ND8A 2B2WA 2JA6H 3FMCA 1PLFA 2HD3A 2F4VQ 2EOTA 4MZ9A 3HOUB 1HZBA 3S16H 2PI2E 4A3BB 1LABA 4B3RQ 1UE6A 4LF5Q 2G9DA 5IGGA 1JR0D 1YVCA 2QA4A 4A3MB 1HR0Q 1SMXA 2QKIC 1JWUD 4ZKCB 1H9KA 3STBC 4KY7A 3CCQA 2X6LA 1EQTA 3PUYA 2D0OA 4IQZA 3CU7A 5D65A 1S5CD 2VQFL 4A3GB 4BY1H 3DHQA 4DUYQ 1B8AA 2O5IC 2BCOA 5M3MB 4JYAQ 4Z9CB 1TWAB 3ULPA 3U9SA 2F4IA 4L8JA 4DR6Q 5HGTA 2B2UC 4LF8L 4R4IA 4LFCQ 4BBRH 4B3SL 2E8GA 2F0OA 4DV6L 1X65A 2KHJA 4ID6A 4XQQA 1F9QA 4A3IG 5JVG3 4ILWA 4WJWA 3T51B 4JI8Q 1Q8IA 3J81E 4E6IA 1D8LA 3E0JA 4JI2L 4A3CH 4A3FG 1KC8C 1HHVA 2K14A 1EWCA 2PMZE 4FF1A 3NBIA 3CXCA 5GAHC 2V1CC 1AZPA 2I0QA 4X6AH 3BDCA 1B2TA 1YNNC 2UUBL 3I72A 3DWPA 5KNDA 1IYVA 4A93G 1SYFA 1FJGQ 4A3DG 2F03A 5HY6A 5IYCG 5EQ0A 3FP9A 1G2SA 3K0XA 2J4XA 3ONAB 2KCNA 4IFDG 3C46A 1Q46A 3KLSA 1Z47A 2DN8A 2NVQB 3D8GA 4YWMA 2Z6KC 1STGA 4IUTA 4A3EG 3GD7A 4P71A 3U50C 1MBYA 1XMQL 3R2IA 5EKLA 4F88A 2L4NA 4GKKL 1QZHA 4KHZA 3QR8A 1G291 3W5OA 4BBSH 4LFBQ 4Y7NH 2NN6H 3NEMA 4JI0L 1D5MC 1RKNA 4LUZA 1L0YB 3A5ZB 3GTLB 3FKIH 3U58A 1A62A 1PZKD 5M5YB 4JBJA 2JK8A 4HIKA 1EY8A 3RR5A 1EEID 4HR7B 4WORA 1IBLQ 3KLRA 3NTHA 1VQ7A 3GTPB 1JOOA 5C5LA 4FXGC 2LMCB 3KF6B 2XRQD 2RBMA 4X65Q 1PMRA 5T1IA 3JAML 2MNAA 5IIFA 1VQMA 2R93H 3AQQA 1EWHA 5M3FB 1DOMA 4JC0A 3J7ZC 3S24A 2IHFA 1PFBA 4GOPB 4IFDJ 2EJFC 1QNUA 3OMCA 4C56C 2MFIA 4DR3Q 4XIGS 3EBEA 1SBBB 1E0BA 3CF5A 2ATWA 3HOZG 5LHY1 4KHPL 3PO3B 2OCEA 3K80C 1PTOC 2O4XA 1A8VA 1HFNA 5I2YA 4PZ8A 4ZCKA 1VQEA 3HG9A 4JOIC 4R4OA 1TS4A 2ZM6Q 2NN6I 1C8CA 4UAIA 2VUMB 4O2DA 2WKCA 2HUGA 2JA5B 4X3TA 3H15A 1GJXA 3OIPA 4H13C 1PA6A 1KHIA 4JI3Q 3UDFA 2FJ2A 4KJOA 3TREA 3NQTA 2EVBA 3EN2A 3H94A 5FO7B 1LTTD 4C3HH 1HNZL 4I7ZC 1U4LA 4WJ3M 4QUCA 1XNRQ 4RA8A 3SVMA 3D0FA 5FJ8G 1CM9A 5FLMG 3HOUG 3RNUA 5C3EH 2OXPA 5C4ZA 3NBHA 4A3BG 4GOPC 1NTGA 3I4LA 4ME5A 3MVVA 4A3MG 3S2HB 4OIJA 2QCPX 1BF4A 2R7ZB 2MUYA 4IALA 1LACA 1BVSA 2DY8A 5AJ3L 3J7A5 1J8IA 1I50B 4CJ0B 3URYA 3OIQA 4JI6Q 3R2TA 2ZTCA 3SXHA 3CKIB 2F0GA 4RGMA 4A3GG 4DR4L 3STBD 4S3SA 5M3MG 3F2CA 3J80i 1T5XD 1XNQQ 2K5NA 1WCMH 3D4WA 2HHHL 2JEAI 2L0CA 1S5BD 3F2UA 1Q3LA 3MXNB 5C0XH 3AMUA 3E9HA 3BDLA 1B3QA 3BS1A 3KJPA 2WKDA 1DOLA 3E3XA 4HIMA 4IPCA 4CKCA 1RCVD 3CCEA 3J81j 1SNMA 3GTJH 2IW3A 1RTNA 4PQXA 3AYHB 1CT1D 2WAQB 3IAYA 3ZYYX 3GTKB 3L0OA 4UDUC 1YHBA 3GTMH 1A63A 4DR5L 1EY6A 2DJGC 4POGA 2KVMA 1VQ6A 3HOWH 1YNND 5G3LD 2FMCA 3RUZA 3HOYB 2J7ZA 1N8RC 5IT9L 2EE1A 1J6QA 1JQYD 1DCZA 2NVTH 2D62A 4JBKA 4ZUJA 5BR8Q 2A6EC 4X3KA 4IUQA 5C4JH 1QB5D 2IX3A 3SEBA 4LNQA 2OTJA 3I91A 1U9RA 2L1BA 4BY7H 4BA2I 2Q2IA 1M1KC 4IN3A 2F0NA 2E2HB 2VB3X 5C0XI 1Q90A 5A2QE 3CQZH 1Y1VH 3H3VH 1N33Q 4AIMA 3Q8DA 4K14A
chains in the Genus database with same CATH topology
2DJFC 1MHWC 2DJGC 4CDEC 4CDFC 4OEMB 1K3BC 4CDCC 4CDDC 1ICFB 4OELB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJF C;  1MHW C;  2DJG C;  4CDE C;  4CDF C;  4OEM B;  1K3B C;  4CDC C;  4CDD C;  1ICF B;  4OEL B; 
#chains in the Genus database with same CATH topology
 1TWG B;  1VDZ A;  3H6M A;  1ONL A;  3PIP 3;  4KJN A;  1VQJ A;  3TSS A;  1STE A;  4DV7 L;  1IL8 A;  1VMC A;  1CZG A;  3I4O A;  2UUA L;  1TWC H;  3G6E A;  4LMQ D;  4LWC A;  1F2Y A;  2A8V A;  1KDA A;  5M3F G;  1VQI A;  5M5X H;  5JEA G;  2A69 D;  4JK1 C;  2EY5 A;  3NXW A;  4L5Q A;  5ELN A;  1PH2 A;  3CCM A;  1E22 A;  2YU9 B;  1TVX A;  2Z9H A;  3MAQ A;  4H02 A;  3VR5 A;  3ZJY C;  4DV4 L;  4YIJ A;  4G7H C;  3PO3 G;  2PW7 A;  5CV5 A;  1LT5 D;  2H1E A;  2NVX B;  1XXG A;  1CHQ D;  3S1R H;  2QDB A;  1NAP A;  1PYS B;  1B50 A;  4YY3 L;  1JOK A;  3E6Z X;  4JI1 Q;  3DM1 A;  3EVQ A;  3SGI A;  4EX5 A;  1PTO D;  5IYD G;  5IYB G;  1BDO A;  1HTL D;  5EBC A;  2F52 A;  4YWK A;  1UAP A;  2VUM G;  2AMC B;  2JA8 B;  4O1N A;  2JA5 G;  3NP8 A;  4FO2 A;  3H3V I;  1WOC A;  3G48 A;  1PFS A;  2F0T A;  2F0E A;  1PYW D;  5E1F A;  3RZD H;  3MFY A;  4C3J H;  4X62 Q;  3C1F A;  3FPP A;  3P1H A;  4FDB A;  4J1M A;  1SN8 A;  4DR7 Q;  5E4X A;  3K7U C;  1TWF B;  5JEA J;  1YJ9 A;  2DGY A;  2LY7 A;  1PFN A;  1BOS A;  1KNA A;  2EQS A;  2AUK A;  2B8G A;  2K28 A;  1NE3 A;  3T53 B;  1YJN A;  1V8Q A;  1K8A C;  4IOA A;  1B9M A;  3K81 C;  2VB2 X;  1QIL A;  1XTC D;  1Y1W H;  3GTG B;  4RCO A;  2R7Z G;  4LW1 A;  1KTK A;  5DNF A;  5JJI A;  3MHB A;  3WDN A;  3F2D A;  5COR A;  3KF8 B;  2QIL A;  2JYO A;  1HNX L;  1ENF A;  1SFO B;  4LF4 L;  1IBK Q;  2YTY A;  1E24 A;  2DJF C;  1I94 L;  1XMO Q;  1EIF A;  2JN4 A;  4GS3 A;  4NXM Q;  1H9M A;  2L5T A;  5KNC A;  3VYR A;  1AN8 A;  1R4Q B;  3S14 H;  2HQE A;  1MD2 D;  2ZT9 C;  1ET9 A;  4X64 L;  2I5M X;  1Y8O B;  1H9S B;  1G6Z A;  2RCF A;  2HDM A;  1X54 A;  3HOV B;  1C4Q A;  2VNU D;  2D5D A;  1WJJ A;  2PO4 A;  4JPB W;  2FMM A;  3A54 A;  3KJO A;  1QVF A;  4A3J B;  1WTO A;  1TY2 A;  2XWJ B;  4OX9 Q;  4GN4 B;  2WB1 E;  1T5E A;  4L5R C;  3NUC A;  3Q0A A;  1NMG A;  1CK1 A;  2CKZ B;  3OWF A;  2EJG C;  4LAA A;  1WFQ A;  1KAA A;  2WAQ G;  2R6G A;  2E2I H;  1BQQ T;  4JBM A;  3U4V A;  4LFA L;  4DUZ L;  2KHI A;  2E75 C;  4CKB A;  1PH3 A;  3L9A X;  1OXX K;  3HOY G;  3I4M H;  4XQJ A;  2RSN A;  1U0L A;  4WRD A;  1B3A A;  5IP7 H;  1ENA A;  1A3V A;  3BU2 A;  1X3P A;  3EQL C;  5KRU A;  1YIT A;  3SDZ A;  1E2V A;  1F9R A;  1G6P A;  4K5X A;  1FVI A;  4RHR A;  1HA5 A;  2A6E D;  2M9V A;  3AB9 A;  1O80 A;  4RFB A;  2B2T C;  3P7J A;  5IGC A;  4G7Z C;  4C3I B;  5ELC A;  2CQA A;  4LJZ C;  5CV9 A;  3M3Y H;  3J80 c;  4JVZ A;  3MTS A;  1UWV A;  5M9O A;  2KED A;  3MXU A;  1RJT A;  1BBX C;  2CH4 W;  2VY3 A;  3MEH A;  1RHP A;  1PTO H;  3X3M A;  3S17 H;  1X55 A;  4DV5 Q;  1EOV A;  1SYD A;  2WV6 D;  5FLX L;  4UY8 C;  3I4N H;  2EPB A;  4ME3 A;  4QL5 A;  4FXD A;  2A73 B;  4L5S A;  4IPG A;  3CD6 A;  4OEM B;  4X66 Q;  1PXU A;  1MI2 A;  1PH9 A;  1ASY A;  1PH8 A;  2IT1 A;  2H5X A;  5C4X H;  1UE5 A;  3F8T A;  3ITP A;  4CKE A;  3V2T A;  5KGU A;  1S72 A;  4QJF A;  2ZXP A;  1R9T H;  1EQR A;  2IWH A;  1B44 D;  1ZKO A;  2B2V C;  3UDI A;  2KHS A;  4WJ4 A;  3PMF A;  1ZYR C;  3CCJ A;  1CSQ A;  3A55 A;  4F7X A;  1V1P B;  5IP9 G;  2CQO A;  1I3Q H;  2XTI A;  2NUC A;  1V1O A;  2L11 A;  1PRT B;  4DAV A;  2DUD A;  1I4P A;  3UDG A;  2UXC L;  4YWL A;  4DF7 A;  3HOX B;  3KK7 A;  1OXU A;  1W6J A;  5JAV A;  1CA6 A;  1CI3 M;  4Q5V A;  3Q6S A;  4AQY Q;  5LMN Q;  1CHP D;  2EYL A;  4B3T L;  2WB1 B;  2F0U A;  3PIO 3;  4DV3 Q;  3KLS X;  3T1H Q;  2B8F A;  3N6R A;  4V0B A;  2SOB A;  2NZO A;  3J7Y W;  2UXB Q;  3VYS A;  2RF4 A;  4ZLT F;  1X9N A;  2F0M A;  1GOZ A;  4DAY A;  4NXM L;  3S2D H;  1JC7 A;  3PO2 H;  1EYA A;  1O7Z A;  2KJX A;  1YNJ D;  2AHO B;  4HIO A;  3QOJ A;  1LT6 D;  1BCP B;  1U4R A;  1L0W A;  1XTD A;  4JV5 Q;  1CA5 A;  1GVP A;  1IW7 D;  1NY4 A;  1F9P A;  3S15 B;  4HSP A;  4OO1 G;  1SND A;  2JA7 B;  3GTQ H;  2HT1 A;  1TWH H;  1QWY A;  1DON A;  3A5U A;  1GUW A;  4DA2 A;  3NK9 A;  4DV2 Q;  3PF4 A;  3OWE B;  1D7Q A;  2O2L D;  3I73 A;  3S1M H;  2KEC A;  1QUQ A;  1K83 B;  1B53 A;  3KYH C;  2XVS A;  3HOV G;  2PYK A;  4JW0 A;  4PZ6 A;  1N32 Q;  4A3J G;  1GUS A;  1F9S A;  3MA2 B;  3K5O A;  1ML0 D;  4CJ1 B;  2AQ3 B;  1B1Z A;  2LXK A;  2NZH A;  3GQB A;  1A2U A;  1S5F D;  2B2U A;  4XTC S;  3RLF A;  1UE7 A;  3S1Q B;  3LWU A;  3GDE A;  1X6O A;  4NPS A;  5J3B A;  1CFM A;  5L37 A;  4N9T A;  4FNF A;  3RZO H;  1PHJ A;  3KFU A;  4GKJ Q;  1J9O A;  2BOS A;  4ULL A;  3HOW G;  5EAY A;  5K5P A;  1BCP C;  1O7L A;  4H44 C;  2ICE C;  1NJI C;  4HJ5 A;  3S1N H;  1N9W A;  1WYD A;  1B9N A;  3K0Y A;  2RSO A;  3K5L A;  5LMU L;  4JI4 L;  5H1S E;  2VQE L;  5KEE A;  1S5D D;  1Q86 C;  5I2X A;  1BKB A;  4R8I A;  4L6T B;  1ZEQ X;  5EKK A;  2MO1 A;  5C0X J;  2VL6 A;  1OXS C;  3ULL A;  4LF9 Q;  4L63 B;  2E76 C;  1FGU A;  3L7Z C;  4KHV A;  1N34 Q;  3BZC A;  2Z6K A;  4HMI A;  1PDQ A;  3OSO A;  4XYQ A;  4C3I G;  1VS0 A;  4PG3 A;  1HZ9 A;  1XJV A;  4MHE A;  5ELE A;  3P75 A;  2UUC Q;  3IFD A;  3VYU A;  1HZA A;  4GN3 B;  1HJP A;  2R7F A;  3A8K E;  3MXP A;  4LUV A;  4KI0 A;  5TSS A;  4DXG A;  1S40 A;  2QEX A;  5JJZ A;  4K0K L;  1K73 C;  1K8G A;  2N88 A;  4HJA A;  4A3K H;  1HNW Q;  2R92 B;  5LL6 S;  2AUJ D;  2D9U A;  4DR1 L;  2PPB C;  2EYP A;  4DGZ A;  2F0J A;  2GN5 A;  3QO2 A;  2B2Y C;  5DM6 3;  5BN3 A;  5EJW A;  1F2Z A;  1GD7 A;  1IKM A;  4P74 A;  2E2J B;  4FYD A;  2WAQ E;  5KYI A;  3CW2 C;  5IWA L;  1VF7 A;  1DXM A;  4DV1 L;  1AZQ A;  3H0G H;  3M4O H;  5I4D A;  3BVM A;  4LF6 L;  3JAM c;  4RMF A;  2NB0 A;  1ILQ A;  3RLO A;  3KLW A;  5I9P A;  2Q8T A;  5LMN L;  3OMG A;  1GXD C;  2YTV A;  5DAU A;  1LUZ A;  4F8M A;  2C5C A;  1EU3 A;  3DWA A;  2ES2 A;  1ZYR D;  2F0F A;  3TQY A;  4B3M L;  2UU9 L;  1VF5 C;  2HQL A;  5LL6 X;  3NBH B;  4JI5 Q;  2WIN B;  1HR0 W;  1FR3 A;  4JOI A;  2RA4 A;  2F4V L;  1K28 A;  2ZXO A;  2RHQ B;  3RN5 A;  4APV A;  2K4K A;  4Y52 H;  3HOX G;  1VQN A;  1SYB A;  1J5E Q;  3D6W A;  3SK8 A;  1V9P A;  1SXT A;  1UUP A;  1SNP A;  4B3R L;  2Z4H A;  1M90 C;  3M4P A;  2WB1 G;  4LF5 L;  3P20 A;  1S3O A;  2K33 A;  4IPD A;  1NBW A;  2BDN A;  1HR0 L;  1CSP A;  1Q1B A;  3U4Z A;  1PH5 A;  4DV2 L;  2E2D C;  3TEH B;  5CMD A;  3VYT A;  4DR2 Q;  1K3B C;  1R4P B;  2JA6 B;  5C44 H;  2IPK D;  1VQF A;  2B63 H;  1PRT F;  2F3W A;  4DUY L;  2E5L Q;  1CTM A;  2NVY H;  3MWY W;  4JYA L;  3RD4 A;  4IUU A;  3QJY A;  3S16 B;  1VMP A;  2JA7 G;  1HA6 A;  3VR4 A;  4GOP A;  4DR6 L;  4JI7 Q;  5I9O A;  3T13 A;  2PI2 A;  3T1Y Q;  1ILP A;  4LFC L;  3K58 A;  1VQL A;  3M4Y A;  3J81 L;  1NR4 A;  1MSH A;  2GVB A;  3C1E A;  5CV6 A;  4FP5 D;  1SMY C;  1JB7 A;  2YTX A;  1HH2 P;  4R4T A;  1PV4 A;  4JI8 L;  1X3G A;  2K01 A;  4XQN A;  1QZG A;  5DEH A;  1BBW A;  1HCZ A;  4BXX H;  1G2T A;  1RTO A;  5JPM C;  4BY1 B;  2IX0 A;  1DM0 B;  4NXN Q;  1BNZ A;  1KQS A;  4MN3 A;  1BCP F;  5K36 G;  4OON A;  1JT8 A;  5BN5 A;  3I3C A;  1LLR D;  3GV3 A;  4AH6 A;  1CKN A;  3BG3 A;  1FJG L;  4BBR B;  4DN4 M;  1EIH A;  4K6L A;  2XNA C;  1XYI A;  5A35 A;  5GRO A;  4LF9 L;  2UXD Q;  2RVL A;  3HRZ C;  5C5M A;  1A15 A;  2D0P A;  3O13 A;  3IRB A;  3OTO Q;  5M5W H;  1IYJ B;  2XRS D;  1M8A A;  1WTP A;  1PYB A;  4LFB L;  2OTL A;  3VDY A;  3CP0 A;  4HED A;  4QY7 A;  1SLJ A;  3DWQ A;  3CC2 A;  1GHJ A;  1YZ6 A;  2BA1 A;  3BDO A;  3G7L A;  3CCR A;  2CHB D;  3TDQ A;  4EQN A;  1ESF A;  3CRL C;  3IL8 A;  1IBL L;  2CFM A;  4GNX A;  1WTX A;  1I6H H;  2MPM A;  3BJU A;  4B9W A;  4X65 L;  2LXJ A;  2F0Q A;  2MQH A;  2OEO A;  1RL2 A;  4A3I H;  5COY A;  5J39 A;  3M85 A;  5CC4 A;  4DV0 Q;  1WTR A;  4RWS C;  1LT3 D;  5IT9 c;  1WD1 A;  4BBS B;  3KUP A;  4Y7N B;  1EU4 A;  5GAD C;  3CCS A;  4A3F H;  3FKI B;  2R92 G;  2AQ1 B;  3IKJ A;  5IE8 A;  4K6D A;  4DR3 L;  4C2M H;  4Q0F A;  2IL8 A;  2KCM A;  2A6H C;  2PCF B;  1HUN A;  4LK1 C;  4A93 H;  2R3Z A;  2AQ2 B;  4A3D H;  1F2L A;  3M7G A;  5IYC H;  1QCB D;  1LTR D;  1NMF A;  2F3V A;  3NTK A;  1F77 A;  4RAU C;  5J1Z A;  4A4I A;  4IFD H;  2ZM6 L;  1PFM A;  1QVC A;  2M00 A;  3M9B A;  1UEA B;  2R93 B;  1NSN S;  5KNB A;  3N52 A;  4A3E H;  2C9O A;  4GLV B;  3HKZ E;  2Z8L A;  4ODG A;  1J5E L;  4BWG B;  3GTO H;  1KD1 C;  2Z1C A;  1I4R A;  2AKW B;  1DGS A;  2NZ1 D;  1SYE A;  4JI3 L;  3F1Z A;  4DXF A;  4YHH Q;  3CC7 A;  2NYZ D;  2BDO A;  2VZA A;  3K7A H;  1SE8 A;  1ROD A;  3W1G A;  1ZXT A;  2Z6B A;  4KLK A;  1KLU D;  1UE1 A;  1XNR L;  4A3L H;  3D4D A;  2L15 A;  3J80 E;  4JCV E;  2EY1 A;  4HID A;  2A19 A;  1YBY A;  1VQA A;  3CAM A;  4JBW A;  3VR3 A;  2GVA A;  3T16 A;  3PUZ A;  4NB3 A;  3TS0 A;  2DNC A;  5CV4 A;  1IBM Q;  4BA1 I;  2C35 B;  4HCE A;  1RDP D;  1HUM A;  3VA5 A;  4NP5 A;  2JXM B;  2TSS A;  4JI6 L;  3TN2 A;  1K0R A;  4YCW A;  1L0X B;  3NHH A;  4EVO A;  2JA6 G;  3HOZ H;  2NTT A;  2VXW A;  2Z0S A;  2JA9 A;  1HZC A;  4TKO B;  3SE0 A;  5FLX E;  4DU9 A;  5C3E B;  2KA7 A;  1OO9 B;  4DPG A;  1XNQ L;  3M4Q A;  5CBE E;  2Y0S E;  4DAM A;  3QIA A;  1LM0 A;  2CVR A;  1H95 A;  3NWS A;  4QMG A;  4RH6 A;  2L9H A;  1AH9 A;  1MKH A;  1V43 A;  1PZJ D;  1AE2 A;  2B39 A;  1MGS A;  4BY1 G;  3V96 A;  2F0S A;  4NMZ A;  1SMY D;  3I7F A;  1K8M A;  4IOC A;  4FVM A;  2Q2H A;  1H9R A;  5FJ8 H;  3TS2 A;  5FLM H;  2N3S A;  3NSW A;  1WCM B;  2CW0 C;  2EY2 A;  1X32 A;  1O7Y A;  3HOU H;  4BBR G;  1JB3 A;  3SK4 A;  4A3B H;  2WAC A;  4ABN A;  1EY4 A;  4OIK A;  4C1N K;  1YIJ A;  3GV6 A;  3H91 A;  4QCL A;  3R93 A;  4A3M H;  1PH6 A;  3TP8 A;  5BR8 L;  2PNR C;  3I55 A;  2K5Q A;  4J6H A;  4A3C G;  2QF7 A;  3V05 A;  3ND9 A;  4HN7 A;  1Y69 U;  3GTJ B;  1KDB A;  5FK9 C;  4YCU A;  4LF7 Q;  1L1O B;  2EDG A;  4ZQ3 A;  2L12 A;  4A3G H;  1FL0 A;  4OL7 A;  2A74 C;  3A7L A;  1D5X C;  1GM5 A;  1JWM D;  5M3M H;  3HKZ B;  3FEW X;  3QOL A;  1TQO A;  3JAM i;  1KIX A;  3GTM B;  2PZT A;  3QB3 A;  1TWA H;  3G4S A;  1QG7 A;  4YCV A;  1N33 L;  4PV1 C;  3HOW B;  2QEJ C;  3NWT A;  1SE3 A;  1VQK A;  1AEX A;  4KV6 A;  3CMA A;  1VQP A;  4HJ8 A;  4RGN A;  1MJC A;  4FF2 A;  2NVT B;  2MJ8 A;  1UNS A;  1KNE A;  1STY A;  4J15 A;  2ICI A;  5C4J B;  4HJ7 A;  2PQA A;  2GA4 B;  1Q12 A;  2NTS A;  4BY7 B;  4BBS G;  4N8X 1;  5C4H A;  2NN6 G;  2VQF Q;  1XPR A;  1K8O A;  2K03 A;  4PZ7 A;  4BS9 A;  1VCI A;  3CQZ B;  3DXJ C;  1Y1V B;  3FKI G;  5NUC A;  1TS3 A;  2OWO A;  4GLA C;  4V19 0;  3A74 A;  2F0I A;  1ESR A;  2B2T A;  3W1B A;  2F0D A;  1Z9F A;  1PH1 A;  1HRJ A;  4LF8 Q;  4JG2 A;  4GN5 A;  4B3S Q;  4DV6 Q;  4OWW B;  2Z4I A;  1STB A;  1JWS D;  4M1U B;  2N55 A;  2A6H D;  2BE5 C;  4JI1 L;  4UP8 A;  1I6V C;  1TWC B;  2ZTE A;  2NVQ H;  1CUK A;  2R93 G;  1L1O C;  3NTI A;  4K2K A;  4JI2 Q;  5M5X B;  4A75 A;  4KMU C;  2JP1 A;  4RHS A;  4X62 L;  4R4Q A;  2BH2 A;  4F87 A;  2Y0S B;  2UUB Q;  4EQO A;  3NQI A;  4KK7 A;  3GTL H;  1I4Q A;  2P5Z X;  4DR7 L;  5M5Y H;  5FLX c;  3S1R B;  2SEB D;  3K5N A;  2XN9 C;  1GKH A;  1SJH D;  1EIG A;  3GTP H;  3TZD A;  1E3P A;  2B2V A;  3GO5 A;  3TP6 A;  1D5Z C;  1TXY A;  1Y8N B;  4PMC A;  2KBN A;  5JJL A;  1XMQ Q;  3FDT A;  4GKK Q;  5M3F H;  3PUV A;  3H3V C;  2KOL A;  5JEA H;  3RZD B;  5ELB A;  3J7A V;  4C3J B;  4JI0 Q;  3A8J E;  3KOJ A;  4IUR A;  2ZJP A;  4FF4 A;  1QJO A;  2JEB I;  3BVG A;  1VQC A;  3EIV A;  3DEO A;  4C3H G;  5FOB B;  2EYH A;  1LTG D;  1VQO A;  3OPO A;  1IKL A;  4WFN 3;  1FNV A;  4C1N I;  1STA A;  2EYM A;  4IUN A;  2R7D A;  1JE5 A;  3PO3 H;  1VQ8 A;  2JSO A;  4ZKB B;  2CCZ A;  3FRP B;  2HCI A;  3Q23 A;  1IBK L;  3I90 A;  1I5F A;  3TRZ A;  5C3E G;  1AFP A;  4DKA C;  1XMO L;  2K32 A;  5IYD H;  5IYB H;  4CBV A;  2FIN B;  3E9I A;  4OWX B;  3JAM E;  3KDF A;  2VUM H;  1YHQ A;  5FO8 B;  4UPA A;  2JA5 H;  3T56 B;  5IGD A;  1Y1W B;  3NEN A;  1PVO A;  1EQV A;  2KUM A;  4HTH A;  4PMW A;  1EY9 A;  5ISR A;  1SRO A;  2PQE A;  1KDC A;  3D4R A;  3R3O A;  3NPP A;  4KHP Q;  4OX9 L;  4UP7 A;  1SAP A;  2O5J C;  1JCK B;  2B2W C;  2EYO A;  3PGZ A;  4GLX A;  4K5V A;  1V1P A;  1DD2 A;  4MTK A;  1WCM G;  4XT1 B;  4DAP A;  2Q8I B;  1TR5 A;  2KCC A;  3S14 B;  4IUP A;  4B08 A;  5IGE A;  4FXK C;  5C0X G;  2NWG A;  1PRT C;  1ICF B;  4N8F A;  1YI2 A;  2CW0 D;  1JOQ A;  1HPC A;  4RGT A;  3S2H H;  3I56 A;  2K5H A;  2R7Z H;  1JE4 A;  1MSG A;  1HNZ Q;  1SNO A;  3J7A F;  1I50 H;  3G6J B;  5JOB A;  3PF5 A;  2A1A A;  2EXZ A;  3D3R A;  3TP7 A;  2IHE A;  1EQQ A;  3K59 A;  4HSV A;  3HKZ G;  4XXE A;  2E2I B;  2HDL A;  4X3S A;  4P2C B;  4KN7 C;  3IFT A;  4DNT B;  2V4D A;  3I4M B;  3EA6 A;  3F2B A;  1B7Y B;  4RCN A;  1ENC A;  2KEE A;  1YNX A;  5IOD A;  2WFW A;  3NEL A;  3D6C A;  5AJ3 Q;  3UE0 A;  2A68 C;  4DV5 L;  4KKU A;  1YEZ A;  1IYU A;  4ZUI A;  4BY7 G;  1EY0 A;  4RKL A;  2DY7 A;  1KRT A;  1HQR D;  4N9P A;  3PIO A;  4DR4 Q;  4HJ9 A;  2R61 A;  1Y1V G;  4DK3 C;  2Q8R E;  4HMJ A;  1EL0 A;  1STN A;  4M8A A;  4P72 A;  5KYL A;  3GTK H;  4X66 L;  4NKL A;  2HHH Q;  5EBD A;  1Z7T A;  3M3Y B;  2AWN A;  2KQ3 A;  4QIW E;  2DNE A;  3A0J A;  3HOY H;  4QB4 A;  3Q22 A;  1VQG A;  1PTO B;  2CWP A;  3S17 B;  1FNU A;  5E4W C;  4KKS A;  3CC4 A;  5EPK A;  2BE5 D;  1JIC A;  5D3I B;  1D1I A;  1O7I A;  2JJQ A;  3QWN A;  2EZV A;  1A6X A;  4IPH A;  5LMN W;  2N8N A;  3I4N B;  2B2Y A;  1SE2 A;  1E1O A;  2QDL A;  2Y0S G;  2E2H H;  2I5L X;  1O78 A;  2NBF A;  5JVH 3;  4DR5 Q;  4K8J A;  1SJE D;  1X56 A;  2XWB B;  5C4X B;  1DYQ A;  1SRU A;  1K0S A;  3OYY A;  2VS1 A;  1TWG H;  3BYT B;  4AQY L;  1VQB A;  1R9T B;  4A3L G;  3KBX A;  1Q82 C;  4HCS A;  1FYC A;  5HGQ A;  1JMC A;  4DV3 L;  4UP9 A;  5IT9 E;  3SK5 A;  4PNY A;  3T1H L;  1NR2 A;  2A69 C;  4AYB B;  1M4V A;  2N78 A;  1WTV A;  2UXB L;  4K8I A;  1NCV A;  1TU2 B;  1I3Q B;  4C3J G;  5HUR A;  1IL2 A;  1Q81 C;  2I46 A;  2K1B A;  2K7V A;  4CJ2 C;  5E3F A;  2YU9 H;  3B6Y A;  3DLL A;  2YYZ A;  3I2Z A;  4KY5 A;  3WWV A;  4A76 A;  4JV5 L;  2B29 A;  1TY0 A;  1BUV T;  2ASB A;  1EZ6 A;  1EIY B;  1BO0 A;  1WD0 A;  2ENB A;  2NVX H;  1WI5 A;  4DV7 Q;  3JC6 6;  5ELD A;  1WVL A;  2XGT A;  5J22 A;  2WII B;  4KKT A;  3I8Z A;  1T9H A;  4QUF A;  1TKW B;  2UUA Q;  3A7A B;  3KF6 A;  3S2D B;  2JA8 H;  3PO2 B;  1ASZ A;  1Y1W G;  4CGY B;  5IP9 H;  3DEP A;  1EYC A;  1XWE A;  4MIU A;  3Q24 A;  1CKN B;  1CKM A;  4DV4 Q;  1N32 L;  1YJW A;  2X69 A;  2F0H A;  2K05 A;  4EQP A;  3GTQ B;  1VQ5 A;  3L2P A;  1TWF H;  1TWH B;  3TP5 A;  2KCT A;  1EOT A;  4YY3 Q;  1D6E C;  4OHJ A;  4OGQ C;  1DOK A;  5CGK A;  3D31 A;  4NW2 A;  4R8N A;  3HGB A;  4GKJ L;  4ALP A;  4ZK9 B;  2F0L A;  2PMZ B;  4TVA B;  3S1M B;  2G5D A;  3TZU A;  3A8I E;  1B4O A;  1TS5 A;  3J81 c;  2ID0 A;  1U4M A;  4OEL B;  3SHL A;  3ULJ A;  1MIU A;  3GP7 A;  3GTG H;  3PSI A;  1PRT D;  3R8B A;  5T1G A;  1WTH A;  2PW5 A;  2D2C C;  3EFX D;  4QIW B;  1G51 A;  3SR1 A;  1E2W A;  1IHZ A;  5EKI A;  3RMH A;  3EJI A;  2EJM A;  4GNX B;  4PMB A;  1SFO H;  4XYO A;  4OO1 H;  1KL9 A;  2F0P A;  4LUO A;  1OTC A;  4HAE A;  2K75 A;  1N34 L;  3RZO B;  4ZRZ A;  5ELF A;  5F2D A;  3I4M G;  5ELO A;  4R4C A;  5G3L F;  1CQV A;  2UUC L;  1Q7Y C;  1W2B A;  1GHK A;  3S1N B;  1VQH A;  3AEV A;  5IP7 G;  3HP3 A;  3MZ5 A;  5EGT A;  1BCP D;  1SDF A;  3CME A;  1SYG A;  3HOV H;  1F2M A;  2KEN A;  4GZY C;  1HNX Q;  4A3J H;  3C2P A;  1HNW L;  4G7O C;  1EEF D;  1QOH A;  4LF4 Q;  1LV9 A;  3C3L A;  4H0L C;  2A68 D;  4NDX A;  2K5W A;  5CBA E;  1I94 Q;  2M2L A;  1PH4 A;  1C0A A;  2EIF A;  1TS2 A;  3W3A A;  2JE6 I;  2X6G A;  1RIP A;  2ZTD A;  2BH8 A;  4MNO A;  1EUJ A;  3PUW A;  1Q1E A;  1OXT A;  4X64 Q;  4CHT B;  1KRS A;  3HZX A;  3E5S A;  2LSS A;  4OO1 I;  3MXN A;  4GNX C;  4A3K B;  1LTA D;  4XDX A;  1A3U A;  1EY5 A;  1CZW A;  2QGQ A;  3K8A A;  1A2T A;  1XX8 A;  2A5H A;  2RDF A;  3PV0 A;  1DJR D;  3I4N G;  3ER0 A;  4QF4 A;  1HFG A;  3FPU B;  3HS0 C;  4JI5 L;  4U67 3;  4LFA Q;  4R1J A;  1K9M C;  1A0I A;  4DUZ Q;  5C4X G;  2TMP A;  4C3I H;  1U5K A;  4DNI A;  3H0G B;  1I4X A;  1H9J A;  2F0K A;  3M4O B;  2OQ0 A;  3ERQ A;  4DK6 C;  1KXL A;  1PTO F;  5IGB A;  3LX0 A;  4IO9 A;  4QGU A;  2HIX A;  2Q2T A;  4DK1 A;  4AYB G;  1IXR A;  4RG1 A;  5AFW A;  1DZ1 A;  4IJL A;  5C3W A;  1C7Y A;  5IGF A;  2SNS A;  4DR2 L;  1K3R A;  3RLN A;  5CV8 A;  1KAW A;  4RKB A;  3ERO A;  3BZD B;  4I65 A;  2RCN A;  1QNK A;  2E5L L;  1LTS D;  1P8L A;  3CHB D;  3HKS A;  1ICW A;  1Y8P B;  1G91 A;  1GUT A;  2F1M A;  3MC0 B;  2ZXR A;  3BYY B;  1AE3 A;  1E1T A;  5IY0 A;  1GUO A;  1SNC A;  4JI7 L;  3T1Y L;  1GUN A;  2RKS A;  3DUZ A;  4L5T A;  4P75 A;  1FD7 D;  2RDG A;  1S5E D;  3G71 A;  3HFZ B;  4C3H B;  4POF A;  4K2L A;  1Z6H A;  4KN4 C;  4IFD I;  3FVQ A;  3PO2 G;  4U68 A;  2LKV A;  3TME A;  5I6Y A;  1Y14 B;  1ET6 A;  3I70 A;  2F3I A;  1WTQ A;  5C44 B;  2B63 B;  3UE1 A;  1VQ9 A;  2JQO A;  4NXN L;  1L2F A;  3SK6 A;  2Q2U A;  1SSO A;  2NVY B;  1D1K A;  1XPU A;  4G57 A;  1G8Z D;  1STH A;  5GQO A;  1WTW A;  1II3 A;  2H4O A;  2PZU A;  2FXQ A;  4DNR B;  3VR6 A;  3HOX H;  4ZYS A;  1SE4 A;  2EYJ A;  3LNN A;  1S4Z A;  1IZ6 A;  3CPW A;  3KBG A;  3PQI A;  1BXT A;  4TSS A;  5DM7 3;  2UXD L;  2F0V A;  4CDE C;  3U9O A;  3PIP A;  3OW7 A;  1V1Q A;  1CKO A;  4B9X A;  2RDH A;  1N36 Q;  2XSC A;  5JJK A;  2FHT A;  1VQ4 A;  1SNQ A;  1YNJ C;  3OTO L;  5FKA C;  1QVG A;  2N49 A;  4X3U A;  2OF1 A;  3HEJ A;  4IUV A;  1IW7 C;  3UDX A;  2UXC Q;  1D2B A;  1RD9 D;  1FGB D;  2EY6 A;  1MJE A;  3K5M A;  2BA0 A;  2JA7 H;  3S15 H;  2OT2 A;  1RF2 D;  2EYF A;  1QE6 A;  1PZI D;  1VQD A;  4B3T Q;  3L3O C;  3RN2 A;  5CV7 A;  2PQA B;  2K5D A;  4H7B A;  1W6K A;  5M5W B;  1AP0 A;  5A2Q L;  1W3S A;  4UHV A;  1KLG D;  3ERS X;  4DV0 L;  2MGS A;  1YHA A;  1Q8K A;  1K83 H;  3CCV A;  5CYU A;  4IZ8 A;  1A3T A;  3AU7 A;  3H09 A;  4MTN A;  5E7N A;  2OQK A;  5K36 H;  1JJG A;  4K5W A;  3VA7 A;  4O0A A;  2J0T D;  1B70 B;  5IOC A;  3WOF A;  3QG1 A;  3KF8 A;  3S1Q H;  3X3N A;  1P16 A;  1X3F A;  2ZJQ A;  1I6H B;  2IY5 B;  1EWI A;  4OWT B;  5C6A A;  3DMU A;  4A3I B;  1X3E A;  2MO0 A;  3BZK A;  3MFG A;  1EYG A;  4EGV A;  3T4A C;  4A3F B;  1XPO A;  1LTL A;  5DLQ E;  1TT2 A;  4EQ5 A;  5GAE C;  2CWA A;  3OW2 A;  4A3K G;  1H9S A;  4C2M B;  4YHH L;  3K6O A;  2RHS B;  2LFN A;  5KIX A;  1EFW A;  4XT3 B;  4A93 B;  2SNM A;  4A3D B;  5C3X A;  3BVZ A;  2PNH A;  3J80 L;  1UEB A;  2SDF A;  3MXG A;  2IJ0 A;  4KD3 A;  1LO5 D;  1L1O A;  2PZW A;  4A3E B;  3H0G G;  3GTO B;  4R9W A;  4CDF C;  2K5V A;  2RQX A;  4G4K A;  1IBM L;  2K6A A;  1FNW A;  3LWE A;  3K57 A;  4FF3 A;  3AFQ A;  4O42 A;  1HTP A;  2MHV A;  5LMU Q;  4CDC C;  4JI4 Q;  1OXV A;  2VQE Q;  4KD4 A;  3K7A B;  1U4P A;  2R92 H;  1AW7 A;  3UI2 A;  4DK0 A;  2AWO A;  4OXP A;  1LTB D;  5JPN C;  3E0E A;  1E7Z A;  4DAY B;  5FO9 B;  2I5H A;  3CCL A;  1HQM C;  1C48 A;  2G9H D;  3KDF B;  3J81 i;  1JOR A;  4KY6 A;  3ICE A;  5D14 A;  4DFA A;  2F0W A;  1BR9 A;  1EYD A;  2E2J H;  3S9W A;  5I6W A;  3MEF A;  1SEB D;  1X3Q A;  1LTI D;  5EPJ A;  4K0K Q;  1JJ2 A;  3TBI B;  2ZJR A;  3PUX A;  3CCU A;  3M7N A;  4IJH A;  1JJC B;  2IX1 A;  3CRK C;  2WP8 J;  1LYL A;  4TRD A;  2JA8 G;  2L55 A;  5D3D A;  3LGJ A;  4DR1 Q;  1GUG A;  1SYC A;  2I07 B;  3A56 A;  3HOZ B;  1N36 L;  5C44 G;  1LT4 D;  2B63 G;  1EY7 A;  1I4G A;  4QQB X;  5BN4 A;  4P73 A;  1BBU A;  3CPF A;  2B3G A;  1EFI D;  2LS0 1;  4I7A A;  2K50 A;  3VR2 A;  2VW9 A;  1PH7 A;  3NE5 B;  4TQU S;  5GAG C;  4J8Q A;  1QUQ B;  2ALY B;  4ZAI A;  3PCO B;  2XIW A;  3W2D A;  1E2Z A;  2K52 A;  5IWA Q;  5CR3 A;  4KTA A;  3WOE A;  4DV1 Q;  1KAB A;  1GO3 E;  2CH4 A;  3OOC A;  1EZ8 A;  2E74 C;  3DM3 A;  3OHX C;  4CDD C;  2HIV A;  4LF6 Q;  1HXY D;  2FFK B;  1NNX A;  2EXD A;  3AFP A;  4RGO S;  1CQF A;  2K04 A;  2MP1 A;  1MHW C;  4BXX G;  5EPL A;  1SR3 A;  2HCC A;  3FHW A;  4B3M Q;  4AYB E;  2UU9 Q;  2QW7 A;  1I4H A;  1TII D;  4LF7 L;  2YV5 A;  1C9O A;  1NUC A;  3ND8 A;  2B2W A;  2JA6 H;  3FMC A;  1PLF A;  2HD3 A;  2F4V Q;  2EOT A;  4MZ9 A;  3HOU B;  1HZB A;  3S16 H;  2PI2 E;  4A3B B;  1LAB A;  4B3R Q;  1UE6 A;  4LF5 Q;  2G9D A;  5IGG A;  1JR0 D;  1YVC A;  2QA4 A;  4A3M B;  1HR0 Q;  1SMX A;  2QKI C;  1JWU D;  4ZKC B;  1H9K A;  3STB C;  4KY7 A;  3CCQ A;  2X6L A;  1EQT A;  3PUY A;  2D0O A;  4IQZ A;  3CU7 A;  5D65 A;  1S5C D;  2VQF L;  4A3G B;  4BY1 H;  3DHQ A;  4DUY Q;  1B8A A;  2O5I C;  2BCO A;  5M3M B;  4JYA Q;  4Z9C B;  1TWA B;  3ULP A;  3U9S A;  2F4I A;  4L8J A;  4DR6 Q;  5HGT A;  2B2U C;  4LF8 L;  4R4I A;  4LFC Q;  4BBR H;  4B3S L;  2E8G A;  2F0O A;  4DV6 L;  1X65 A;  2KHJ A;  4ID6 A;  4XQQ A;  1F9Q A;  4A3I G;  5JVG 3;  4ILW A;  4WJW A;  3T51 B;  4JI8 Q;  1Q8I A;  3J81 E;  4E6I A;  1D8L A;  3E0J A;  4JI2 L;  4A3C H;  4A3F G;  1KC8 C;  1HHV A;  2K14 A;  1EWC A;  2PMZ E;  4FF1 A;  3NBI A;  3CXC A;  5GAH C;  2V1C C;  1AZP A;  2I0Q A;  4X6A H;  3BDC A;  1B2T A;  1YNN C;  2UUB L;  3I72 A;  3DWP A;  5KND A;  1IYV A;  4A93 G;  1SYF A;  1FJG Q;  4A3D G;  2F03 A;  5HY6 A;  5IYC G;  5EQ0 A;  3FP9 A;  1G2S A;  3K0X A;  2J4X A;  3ONA B;  2KCN A;  4IFD G;  3C46 A;  1Q46 A;  3KLS A;  1Z47 A;  2DN8 A;  2NVQ B;  3D8G A;  4YWM A;  2Z6K C;  1STG A;  4IUT A;  4A3E G;  3GD7 A;  4P71 A;  3U50 C;  1MBY A;  1XMQ L;  3R2I A;  5EKL A;  4F88 A;  2L4N A;  4GKK L;  1QZH A;  4KHZ A;  3QR8 A;  1G29 1;  3W5O A;  4BBS H;  4LFB Q;  4Y7N H;  2NN6 H;  3NEM A;  4JI0 L;  1D5M C;  1RKN A;  4LUZ A;  1L0Y B;  3A5Z B;  3GTL B;  3FKI H;  3U58 A;  1A62 A;  1PZK D;  5M5Y B;  4JBJ A;  2JK8 A;  4HIK A;  1EY8 A;  3RR5 A;  1EEI D;  4HR7 B;  4WOR A;  1IBL Q;  3KLR A;  3NTH A;  1VQ7 A;  3GTP B;  1JOO A;  5C5L A;  4FXG C;  2LMC B;  3KF6 B;  2XRQ D;  2RBM A;  4X65 Q;  1PMR A;  5T1I A;  3JAM L;  2MNA A;  5IIF A;  1VQM A;  2R93 H;  3AQQ A;  1EWH A;  5M3F B;  1DOM A;  4JC0 A;  3J7Z C;  3S24 A;  2IHF A;  1PFB A;  4GOP B;  4IFD J;  2EJF C;  1QNU A;  3OMC A;  4C56 C;  2MFI A;  4DR3 Q;  4XIG S;  3EBE A;  1SBB B;  1E0B A;  3CF5 A;  2ATW A;  3HOZ G;  5LHY 1;  4KHP L;  3PO3 B;  2OCE A;  3K80 C;  1PTO C;  2O4X A;  1A8V A;  1HFN A;  5I2Y A;  4PZ8 A;  4ZCK A;  1VQE A;  3HG9 A;  4JOI C;  4R4O A;  1TS4 A;  2ZM6 Q;  2NN6 I;  1C8C A;  4UAI A;  2VUM B;  4O2D A;  2WKC A;  2HUG A;  2JA5 B;  4X3T A;  3H15 A;  1GJX A;  3OIP A;  4H13 C;  1PA6 A;  1KHI A;  4JI3 Q;  3UDF A;  2FJ2 A;  4KJO A;  3TRE A;  3NQT A;  2EVB A;  3EN2 A;  3H94 A;  5FO7 B;  1LTT D;  4C3H H;  1HNZ L;  4I7Z C;  1U4L A;  4WJ3 M;  4QUC A;  1XNR Q;  4RA8 A;  3SVM A;  3D0F A;  5FJ8 G;  1CM9 A;  5FLM G;  3HOU G;  3RNU A;  5C3E H;  2OXP A;  5C4Z A;  3NBH A;  4A3B G;  4GOP C;  1NTG A;  3I4L A;  4ME5 A;  3MVV A;  4A3M G;  3S2H B;  4OIJ A;  2QCP X;  1BF4 A;  2R7Z B;  2MUY A;  4IAL A;  1LAC A;  1BVS A;  2DY8 A;  5AJ3 L;  3J7A 5;  1J8I A;  1I50 B;  4CJ0 B;  3URY A;  3OIQ A;  4JI6 Q;  3R2T A;  2ZTC A;  3SXH A;  3CKI B;  2F0G A;  4RGM A;  4A3G G;  4DR4 L;  3STB D;  4S3S A;  5M3M G;  3F2C A;  3J80 i;  1T5X D;  1XNQ Q;  2K5N A;  1WCM H;  3D4W A;  2HHH L;  2JEA I;  2L0C A;  1S5B D;  3F2U A;  1Q3L A;  3MXN B;  5C0X H;  3AMU A;  3E9H A;  3BDL A;  1B3Q A;  3BS1 A;  3KJP A;  2WKD A;  1DOL A;  3E3X A;  4HIM A;  4IPC A;  4CKC A;  1RCV D;  3CCE A;  3J81 j;  1SNM A;  3GTJ H;  2IW3 A;  1RTN A;  4PQX A;  3AYH B;  1CT1 D;  2WAQ B;  3IAY A;  3ZYY X;  3GTK B;  3L0O A;  4UDU C;  1YHB A;  3GTM H;  1A63 A;  4DR5 L;  1EY6 A;  2DJG C;  4POG A;  2KVM A;  1VQ6 A;  3HOW H;  1YNN D;  5G3L D;  2FMC A;  3RUZ A;  3HOY B;  2J7Z A;  1N8R C;  5IT9 L;  2EE1 A;  1J6Q A;  1JQY D;  1DCZ A;  2NVT H;  2D62 A;  4JBK A;  4ZUJ A;  5BR8 Q;  2A6E C;  4X3K A;  4IUQ A;  5C4J H;  1QB5 D;  2IX3 A;  3SEB A;  4LNQ A;  2OTJ A;  3I91 A;  1U9R A;  2L1B A;  4BY7 H;  4BA2 I;  2Q2I A;  1M1K C;  4IN3 A;  2F0N A;  2E2H B;  2VB3 X;  5C0X I;  1Q90 A;  5A2Q E;  3CQZ H;  1Y1V H;  3H3V H;  1N33 Q;  4AIM A;  3Q8D A;  4K14 A; 
#chains in the Genus database with same CATH homology
 2DJF C;  1MHW C;  2DJG C;  4CDE C;  4CDF C;  4OEM B;  1K3B C;  4CDC C;  4CDD C;  1ICF B;  4OEL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...