4CDDC

Human dpp1 in complex with (2s)-n-((1s)-1-cyano-2-(4-(4-cyanophenyl) phenyl)ethyl)piperidine-2-carboxamide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
b'PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 7
structure length 68
sequence length 68
chains with identical sequence F
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4cddC00
1ICFB 2DJGC 4CDCC 4CDFC 1MHWC 4CDDC 2DJFC 4OELB 1K3BC 4OEMB 4CDEC
chains in the Genus database with same CATH superfamily
1WTVA 3V2TA 5F2DA 2YU9B 1VQNA 2F0DA 1QVCA 4GOPA 4DNRB 4U673 4A3MG 3K80C 2QEJC 2QA4A 1PFNA 3A0JA 3W1BA 1MD2D 1WD1A 1TWFB 3NSWA 4LF8L 2K50A 2KA7A 4G7HC 4A3BH 4A93H 3FDTA 5BR8Q 2PQAA 1JOOA 1E1OA 1ONLA 1V1QA 5C0XH 1K3BC 3HRZC 2ZJQA 1VCIA 2UUCQ 3A5ZB 1NCVA 3GO5A 4L5QA 4A3GB 2K7VA 4BY1H 3OPOA 3GV3A 1JJCB 2J0TD 1LM0A 3MFGA 3CC7A 1EYCA 5ELNA 4QY7A 1MIUA 1QVFA 2B2VA 1A3TA 4KMUC 1D5XC 1R4QB 2PMZE 3OTOQ 1O78A 4NMZA 2HHHL 3PO2G 1R9TH 2WB1G 4O42A 1Q90A 1H9SA 3VR5A 4H0LC 2K1BA 4C3JB 2I07B 3HOUH 3I4NH 1EEFD 2CW0D 1DD2A 2N3SA 4DFAA 4C3HB 2E2DC 4JI3Q 1TWGB 4DV7Q 2YTYA 3S2DB 3F2CA 3TBIB 2F3WA 5LL6S 2NTSA 1SJED 4CGYB 4BBSH 2KUMA 2L5TA 1BOSA 5JJIA 4EQ5A 5ELBA 5EGTA 1D1IA 1FVIA 2K75A 3NHHA 2XRQD 1EY8A 4IPGA 1VQDA 1XTCD 5IT9L 1PYWD 3S2HH 2EY1A 3GTJB 5D65A 3D6WA 3GTGB 4IPHA 2K04A 5D3DA 1IBMQ 5EJWA 1K0SA 3S1MB 5IWAL 2OWOA 1YNJD 1B70B 2KCCA 1H9JA 1PA6A 2JEAI 1PH8A 4DV5L 2HD3A 5FJ8H 3TQYA 3KDFB 4FF1A 5H1SE 4KTAA 2IJ0A 3PQIA 3PMFA 4M8AA 2PZUA 2O4XA 3NBHA 2B63H 3SK6A 2L55A 2X6LA 3SVMA 2V1CC 3U4ZA 2RBMA 3FVQA 2PZWA 1HPCA 1B44D 2MPMA 3CKIB 1X3QA 2KECA 4DV3L 1I6HH 1QCBD 1MJCA 2R7ZB 3V05A 2XSCA 5C4ZA 1SNCA 2EY5A 4X3KA 1ASYA 2LMCB 4JI8L 4RGTA 3VYRA 1CHPD 4K0KL 3F8TA 1Q1BA 5IP7H 2EY6A 1YNND 3NWSA 2K01A 5M3MG 4P2CB 2QKIC 3ER0A 4OX9Q 4YCVA 4BBRH 4OIJA 4A3IG 3WDNA 5DM63 4LF7L 3G6EA 2KHSA 1II3A 4CDEC 4JI5L 1OXSC 1JE4A 2XTIA 3FKIH 3KOJA 1J5EL 1HFGA 2F0IA 1KAWA 4ALPA 1HQRD 5I6WA 4KD4A 1RCVD 2HDLA 4DAPA 1E3PA 2TMPA 1CT1D 1F9SA 2D0OA 4DR2Q 1WTWA 2FMCA 1C7YA 5BR8L 4WFN3 5J22A 1AEXA 1NR4A 1HH2P 2F0TA 5EAYA 1EQVA 3I55A 2UUCL 3PUVA 1V9PA 3ZYYX 4MTKA 4HJ9A 1VQMA 4L5RC 1STBA 4DR1L 2A69D 2EXZA 3A5UA 2B2UC 3UI2A 1O7LA 4FF3A 4KJNA 4RKBA 4QIWE 4L5SA 4LFBQ 1A0IA 2ZTEA 1SNDA 4Q0FA 3CCUA 2B29A 2G5DA 2EYFA 3OTOL 1A3VA 1EYGA 2EIFA 1Y1VG 5FO7B 3BDCA 2B8FA 1BVSA 1OXUA 3K57A 2L9HA 5FLMG 1YHQA 3T1YL 3H6MA 4JI3L 3E9IA 1PRTD 2NN6G 3BVZA 2Z8LA 2G9DA 2E75C 3RLOA 1W3SA 2VY3A 1TWHH 2WAQB 3F2BA 4RGMA 3PF5A 3A54A 4OWWB 3C1FA 2OEOA 4BS9A 4UHVA 4G7OC 3TDQA 2F0OA 1JOKA 5M3FH 1VQOA 3BZCA 1PMRA 3H09A 1S72A 4DR7L 1G91A 3H3VI 1L0YB 1Y14B 3MWYW 4S3SA 4XQQA 3UE1A 2K5QA 5JOBA 2KBNA 3O13A 1QWYA 3VR2A 3N52A 1XPRA 2F0NA 1Q82C 1W6JA 4C3IB 2IPKD 3IKJA 5I2XA 4OGQC 2NN6I 4DXGA 3PUWA 1G51A 3IFDA 2GVBA 1EOVA 2HUGA 1X32A 5IE8A 4A93B 4A3BB 4BWGB 3BU2A 1JOQA 1EWIA 3CPFA 3U9SA 2D5DA 4A3IH 5DAUA 3AFQA 4UDUC 3RN2A 1E1TA 3GV6A 2GA4B 1JC7A 2JA9A 4MTNA 2MUYA 3K58A 1ENFA 3ULJA 4BY1B 4UPAA 2CH4A 3D4RA 3KFUA 3ULPA 3MFYA 1Q3LA 3I90A 4AYBB 4IALA 1AZQA 5C3XA 2LS01 3Q8DA 4DKAC 2C9OA 2DJFC 2NZHA 1JJGA 1IKMA 1EY0A 2ATWA 3S16H 2PW5A 4IUTA 3ND8A 3OMGA 4KKUA 3DEOA 3LGJA 5C44G 3HOXH 3SK4A 1BCPC 4UP8A 3HOUB 3EFXD 1XTDA 2RDHA 2OQ0A 3H0GB 1GOZA 5IGFA 5KYIA 5GAEC 4R8NA 1HCZA 4GN3B 3D4DA 2DJGC 4TKOB 4DR2L 1PTOH 3BVMA 4LNQA 1Q8KA 3DLLA 3R3OA 1N36Q 2WP8J 2G9HD 5CORA 1TS4A 1BF4A 3CD6A 4B3RL 3GTLH 2WFWA 1HNXQ 3S2HB 3GP7A 3OHXC 4C2MH 4ZUJA 1TWAH 3OWEB 2YTVA 1HA6A 2IHFA 2H1EA 4R9WA 3FEWX 4K6DA 1SBBB 5IYBG 4LW1A 4NB3A 4O1NA 4X64Q 4DV1Q 4H13C 4O0AA 1E2WA 1VQEA 4A3GG 3S17B 4OWTB 4FXDA 1RDPD 1KDCA 1WTRA 1C48A 1QNKA 3TP7A 4JV5Q 1AZPA 5A2QE 2MGSA 1LTTD 1T9HA 1SMYD 2ICEC 2RKSA 3G48A 4YWKA 2AUKA 3KJPA 3LNNA 2A8VA 1IZ6A 1SN8A 5D3IB 2GVAA 2MO1A 3AYHB 3T13A 1SR3A 1YVCA 2LSSA 1HA5A 1K8OA 1VS0A 4C3JG 3AQQA 4CKBA 1X3PA 5C4HA 4RMFA 2C5CA 3T56B 4C3HG 3Q23A 3SR1A 4BBRB 1SRUA 5CV4A 2PI2A 3CXCA 2PPBC 5K5PA 4AIMA 3S1QH 1IHZA 5KNDA 2EZVA 1CA6A 1GUGA 1A2UA 3FKIB 4DAYA 2R3ZA 1V8QA 3A8IE 4K2LA 4KHVA 2JP1A 2D9UA 2WINB 1CZGA 1LTLA 1VQIA 1I4HA 3J81i 1SE3A 1QNUA 1EYAA 3RZOH 1RKNA 3HKZE 4HSPA 2A6ED 1S5DD 1WJJA 3KF6B 4R4OA 5HGQA 2F0LA 5C4XG 1X54A 4NP5A 5IGGA 2B8GA 3C1EA 1KXLA 3PUXA 2NVXH 2K14A 4GKJQ 3Q0AA 3OW7A 2M2LA 2E2HH 1IKLA 3QG1A 5DLQE 3AEVA 2ZXRA 1ILPA 2A6HD 5KNCA 5M5XH 4K14A 1XMQQ 2NZ1D 3EVQA 2KHIA 3J81L 2R7ZG 4B3MQ 4B08A 1VDZA 4JG2A 2B2WA 2FJ2A 4Y52H 5J39A 3RD4A 1U9RA 1X56A 4R4TA 1TWHB 4X66L 3CCLA 2I5LX 1N36L 4LFAQ 4C56C 5M3FB 4R4QA 5COYA 1HNXL 5KEEA 5ELDA 1WTQA 3E0JA 3QWNA 1J8IA 4ZKBB 4APVA 2ES2A 2N49A 5CV8A 2I5MX 4HTHA 4F87A 3I7FA 3D4WA 3M7GA 4IZ8A 5EKLA 3KLWA 3I91A 1JWUD 1B4OA 1RHPA 1VQ8A 1TS3A 3CC2A 1BCPF 2XIWA 4X64L 1HZAA 4XTCS 4IFDG 3X3NA 5ELCA 4C3JH 2WIIB 2F0JA 2F0WA 1KNAA 4FP5D 4JV5L 4XQJA 4XXEA 3RR5A 5JAVA 1KD1C 4LFCL 1TWGH 3LWUA 2QCPX 1I4XA 2Z6BA 1ENCA 4UAIA 4ZK9B 3NENA 1JWMD 4WJ3M 1HR0W 3TEHB 5LMUQ 4J8QA 4DV2Q 1W2BA 1KLGD 1QE6A 1NNXA 3GTJH 4NXNQ 4HAEA 3S24A 4AH6A 2K5NA 2BH2A 4H44C 4DV4Q 3IFTA 4ZRZA 3S16B 3BG3A 1LV9A 2R6GA 3NELA 1D6EC 2IL8A 1SYBA 2ZTCA 3HOXB 2WAQG 5CC4A 2F0GA 1WD0A 3SE0A 4R4IA 4HMJA 5CBAE 3HS0C 2EOTA 1HR0L 3OIPA 2F0SA 4IFDJ 3RLNA 4JI7L 1PTOB 1AE3A 5K36G 1JB3A 5J1ZA 4DNTB 1UE5A 4JOIC 4KY7A 1EFWA 4C3IG 1JT8A 3BZKA 5CYUA 4GKJL 1SNPA 2I46A 4C2MB 1LTRD 4DAVA 1TWAB 2D0PA 2IX0A 2F4VQ 4A4IA 1MI2A 1HJPA 4A3BG 5C6AA 4A93G 2ENBA 4U68A 5C0XG 4PG3A 3PV0A 3MZ5A 1XNRQ 1O7YA 3QJYA 1XMQL 2A5HA 5FKAC 3BDLA 1SLJA 5LHY1 1EU3A 4PQXA 4BY1G 4FF2A 2DY7A 1D2BA 3JAMi 4A3LH 1BKBA 1N32L 2Z4HA 1S5BD 2RHSB 3BZDB 4K2KA 3OWFA 1PFBA 3S14B 3M4PA 4ILWA 4EQNA 3HOUG 3I4NG 3H0GG 5FOBB 5KYLA 2OXPA 5IP9H 2DNCA 1UWVA 1XWEA 1VQPA 2B2YC 1SNQA 1XJVA 2QW7A 2OCEA 3L7ZC 4JK1C 1KC8C 3H94A 2SDFA 5IWAQ 1MGSA 1PH2A 3QOLA 1G2SA 3SK8A 4PMCA 1OXVA 1UE1A 3GTPB 1EWCA 5C0XJ 1IYUA 2CQOA 3EIVA 1L0XB 1CI3M 3MVVA 2K28A 5J3BA 2E8GA 3R93A 3PIPA 1S5CD 3B6YA 1HUNA 4IOCA 3L9AX 5BN3A 3Q6SA 1P16A 1V1OA 2LFNA 1E7ZA 4L5TA 1Y8NB 3CRLC 4DV3Q 4H02A 2OTLA 1XNQL 4P73A 4KY6A 1DYQA 1SYEA 4HEDA 2NVXB 2BH8A 4A3KH 1CTMA 4GNXB 3C2PA 1PXUA 5FJ8G 2MJ8A 5CR3A 5LMUL 2UXBQ 5I4DA 1G8ZD 5I6YA 2AWNA 2FXQA 1ICFB 2XWBB 1JE5A 2B2UA 4L8JA 4LF7Q 5E7NA 5M5XB 4JBKA 5K36H 4DV4L 2RDFA 1DXMA 1K8AC 2P5ZX 5JJKA 1TS5A 1J5EQ 1WCMB 5I9PA 3D3RA 3MXPA 3P20A 4C3IH 3HOVH 5I2YA 2MFIA 1X55A 2O2LD 1PH1A 4BY7B 4CJ1B 5EPLA 5IP7G 3CF5A 1U0LA 2EY2A 1XXGA 3LX0A 3NP8A 4HCSA 1QUQA 3GTQB 1G2TA 4BBRG 2LKVA 3QO2A 3TS2A 3J7A5 2TSSA 1F2MA 2R7DA 2B39A 3FKIG 1XYIA 4DUYQ 3K5LA 4KK7A 1QZHA 2UU9Q 2UUAQ 1EZ8A 1I4QA 4OEMB 4DR1Q 1Y1WH 2K52A 1NAPA 1AN8A 3NK9A 4LAAA 5C5MA 4X3TA 3DM3A 1N34L 2F4VL 5C3EB 2PW7A 2FMMA 2HT1A 3J7AV 1ZKOA 2KEDA 3KYHC 2HQEA 3MXNB 1D8LA 4NKLA 3PGZA 3U58A 2K33A 1XNRL 1NE3A 4B9WA 4HIDA 3CC4A 4FF4A 1C0AA 3RUZA 2GN5A 4GKKQ 1LTID 3H0GH 4QUFA 4HJ7A 1RL2A 3T1YQ 5IGDA 5EQ0A 5FLXc 2J4XA 2PYKA 3EBEA 4JBJA 1D5ZC 4RCNA 3TRZA 4DK1A 2JA5B 2EVBA 1B7YB 1YHAA 5LL6X 4LJZC 1M90C 1E0BA 1D1KA 4DR7Q 2X69A 1HZBA 2A73B 1HNWQ 1Z47A 3N6RA 3CCJA 1K73C 4K5WA 4V0BA 4K8IA 2AMCB 1TWCH 3W3AA 2NB0A 2BA1A 1BCPD 4DNIA 3KBXA 5M3FG 3M7NA 1BXTA 3S17H 3TREA 1EQRA 2RDGA 4OO1G 3CHBD 5E3FA 3TZUA 2E76C 1QILA 2DGYA 3UDXA 1U4MA 3HG9A 5BN4A 3GD7A 4IUUA 2A1AA 4X3SA 1N8RC 2LXJA 1Q46A 2UXBL 4IO9A 3MA2B 2CWAA 5AJ3L 1VQHA 2VNUD 3T51B 4CKEA 4JI0L 1VQ4A 2PMZB 4HN7A 5C3WA 2CWPA 2F0KA 3D0FA 1LT4D 1L2FA 2EYJA 4K5VA 3FPPA 3K8AA 1J9OA 4R8IA 2F1MA 3BJUA 1MHWC 4GLAC 5HURA 1BUVT 3HEJA 1CK1A 5IGEA 4ZCKA 3DWAA 4OL7A 4DN4M 5A2QL 3HOXG 1U5KA 4DR6L 4B3RQ 4DUYL 2F0FA 1N33Q 2UU9L 2UUAL 3J80c 4ZLTF 2PI2E 3NE5B 5CGKA 1W6KA 4XIGS 1SE2A 2EDGA 2R93H 3HFZB 2Y0SB 3T4AC 2VQFQ 1LT6D 3ULLA 3NEMA 3R2IA 1PTOC 3P1HA 2L0CA 3URYA 2L15A 4BA1I 2NUCA 4DK3C 1TY2A 1E24A 4QMGA 4WORA 2VUMH 3VR3A 5NUCA 1STHA 5DNFA 4AQYQ 1KRSA 4G57A 4GKKL 4X3UA 3DWPA 3HOYH 5CBEE 1A8VA 1LTBD 1K83H 1SYGA 1FL0A 1E2VA 1DZ1A 1UEAB 2K03A 4A3KB 2BE5C 2AKWB 4LF5Q 3GTKH 1I50B 3PUZA 3MHBA 3STBD 3A56A 5BN5A 4RHSA 1L1OC 3CCSA 3J7ZC 1HNWL 1EQTA 3KDFA 5IYCH 4OO1H 2XVSA 1CKOA 4UP7A 3RLFA 2A19A 1A3UA 5FO8B 3HOVB 3GTOH 1EY9A 2HQLA 1GM5A 3HZXA 3I72A 2NYZD 4FXKC 4IOAA 1ESRA 4N8FA 4Y7NH 1DCZA 1TT2A 5TSSA 2ASBA 4A3FB 1LTGD 1YJ9A 2K5DA 2MP1A 5CV9A 4QJFA 4YHHQ 2KHJA 1Y1WB 3A55A 1EOTA 3EQLC 1PHJA 2EPBA 1VQ7A 5JPNC 5M5YH 1CUKA 3D31A 4PZ7A 3I4OA 3VA5A 5ISRA 1VQ9A 1B50A 1GUWA 4DV0L 1NMFA 3RMHA 3K59A 3HKSA 4J1MA 3WOFA 4QIWB 1HNZL 1WI5A 1F2YA 4ABNA 3T16A 1WTPA 4GNXC 1X65A 4WJ4A 4A76A 1LLRD 3K81C 4A3CH 3KF8B 4KLKA 3M3YB 2EJFC 5EBCA 4X66Q 4UY8C 3F1ZA 3I3CA 2HIVA 1Q86C 1WCMG 2EJGC 1GJXA 4P74A 1GUNA 3MXUA 1TIID 1WTOA 1N33L 3SGIA 4JBWA 1F2ZA 3FHWA 1E22A 3PCOB 2RSOA 3J7AF 2E2JB 3K0XA 1LUZA 1V1PB 1TWCB 1YJWA 2VQFL 2WB1E 2F0UA 4IPDA 1Q81C 3VA7A 1T5EA 3A7AB 3H3VH 3MC0B 3P7JA 1F2LA 2PZTA 1BDOA 4AQYL 2FHTA 4G4KA 2E2IB 4LFCQ 3I73A 4JVZA 1VQ5A 3MXGA 1SE8A 1DOMA 1ASZA 5T1IA 4YY3L 4EVOA 2NVTB 1SE4A 4PNYA 3E9HA 4IJLA 4JOIA 3S14H 2IY5B 4LF5L 3PO3B 1MKHA 2OF1A 4FXGC 4GN4B 3AFPA 4MZ9A 1PZKD 1PH5A 1EUJA 3ICEA 4H7BA 4A75A 3AB9A 2R92H 3FPUB 1JJ2A 1PTOF 1QOHA 1DOKA 1SAPA 2ZJRA 1GD7A 2JA5G 1H9KA 3ITPA 3P75A 1DJRD 3DUZA 3DM1A 2KQ3A 3JAMc 3GTPH 1WOCA 1HR0Q 2HDMA 1H95A 1DOLA 1EEID 2L4NA 4ME5A 2JA6H 3G6JB 4JI7Q 2RCNA 1JR0D 4UP9A 4YHHL 4YWMA 5IODA 3UE0A 1EIHA 3DWQA 2I5HA 2LY7A 3STBC 3CAMA 2F0MA 5IOCA 2B3GA 2R93B 1WFQA 2BA0A 1LTSD 1CZWA 3L3OC 4EQOA 1X3FA 2B2YA 5FK9C 4OWXB 2RF4A 1OO9B 3KF8A 4HJ5A 4FDBA 4OONA 2VUMB 2JXMB 1EQQA 1WCMH 3QB3A 1PZID 4DR5Q 3J80L 3NXWA 1YI2A 4BY7H 2AUJD 3VR4A 4N9PA 4DR3L 1N32Q 4QQBX 3HOYB 1K83B 1JWSD 3VDYA 3GTQH 3WWVA 4KN7C 1NY4A 3S15B 1A15A 1V1PA 2VL6A 1EIGA 4ZKCB 2QILA 2VXWA 1GHKA 3GTKB 4P72A 1O7IA 4ZYSA 2VZAA 4GN5A 3TZDA 1KL9A 1LT3D 2IHEA 2N78A 4A3LG 1ZXTA 1YIJA 3G7LA 4LF4Q 4Q5VA 2RVLA 2IX1A 3NBIA 4X65L 5C3EH 2ICIA 4YWLA 1UNSA 4ZUIA 5GAHC 2OQKA 1FNUA 3E3XA 3GTOB 1HZCA 3CU7A 3EJIA 5JVH3 1KAAA 1FD7D 3I4MH 4Y7NB 4K5XA 3M9BA 5IP9G 2CQAA 4HCEA 3NTKA 5E1FA 3ERQA 2O5JC 2Y0SG 1YHBA 4PZ8A 3HKZB 1I4GA 2WKCA 1XNQQ 1GO3E 5JEAH 2JA5H 3VR6A 3FRPB 5FLXE 2Z6KC 2QF7A 5D14A 5EPKA 5M5WH 2VB2X 1JCKB 2RSNA 5M5YB 3K7UC 1IL2A 3OMCA 1IL8A 5IT9c 4MNOA 2NVQB 5IYDH 1ICWA 1VMPA 3CMAA 4IFDI 1GHJA 1ZYRC 2Q2UA 1Y8PB 4IN3A 3SK5A 3KF6A 4KHPQ 4A3KG 2SNMA 2CH4W 1BBXC 1OXXK 3RZDH 4F8MA 4BA2I 2VW9A 1YITA 3U50C 4XQNA 2EYMA 4C1NI 4N9TA 5L37A 3M4OB 1VF5C 1F9RA 1Q8IA 1ML0D 3C3LA 5HGTA 1LO5D 3HOVG 2D62A 4CJ2C 1JORA 1S4ZA 3TP8A 1N34Q 1Z6HA 5CMDA 1B9MA 3M4YA 4A3FG 3GTMB 3NTHA 1HQMC 1K28A 2IW3A 4I7ZC 1UAPA 1PVOA 1AFPA 5E4XA 4JI1Q 1VQCA 4GOPB 3JC66 3BS1A 1EY4A 4A3JB 1Y1WG 1SYFA 2Q2HA 4CDFC 4DR5L 2M00A 1L1OB 4AYBG 1Z9FA 4QL5A 3NTIA 1CQFA 1RF2D 1IW7C 3CP0A 3PIP3 3QR8A 4NXML 4FNFA 1JICA 3OYYA 2ZJPA 3KLRA 4NPSA 1C9OA 4K8JA 1I5FA 1IBLQ 1WYDA 3PSIA 2ALYB 3W1GA 4QGUA 5C0XI 2UXCQ 5ELOA 3J7YW 4BXXH 4IPCA 2MHVA 1DGSA 4LF4L 5GAGC 1U4PA 1I4RA 2DN8A 2Q8IB 2R92B 3J80E 4HIKA 4ID6A 5C5LA 1VF7A 4X62L 4YIJA 1QG7A 2CKZB 1OXTA 4DV6Q 5LMNW 1B1ZA 2JA8H 1SMXA 4RG1A 1H9SB 1SDFA 2I0QA 5G3LD 2XN9C 4MHEA 2PNHA 3EA6A 2Z4IA 2JA6B 1GVPA 1RODA 2K5VA 1PDQA 3TP5A 1CM9A 3DXJC 1NSNS 3C46A 1VMCA 1SFOH 2YYZA 4YCUA 5LMNL 3I8ZA 2KENA 1UEBA 1SSOA 1I50H 1B53A 1FYCA 2UUBL 1IBKQ 2CFMA 1GKHA 1ESFA 5AJ3Q 2ZM6Q 1FGBD 3SXHA 4DAMA 1PTOD 4KI0A 1EWHA 1I3QH 1STEA 2QEXA 1VQKA 4JI0Q 4LMQD 1S40A 1B8AA 5C4JH 4KHPL 3PO3G 1Q7YC 4LUOA 5IIFA 3NBHB 1TU2B 2Z1CA 4A3FH 4JI4Q 4KY5A 3BYYB 1U4LA 2F03A 4CDCC 4DR6Q 1EIYB 4LF6L 5M9OA 3HOZB 2BE5D 4B9XA 3RNUA 3CPWA 1SROA 2EYOA 1VQAA 2C35B 1DM0B 1L1OA 1NMGA 1VQBA 1CA5A 2OTJA 2KVMA 3KLSA 3I4LA 4WJWA 4JCVE 4XYOA 4JI2L 2F3VA 4J6HA 1UE7A 4I7AA 4JYAQ 1X3GA 4JI1L 4TVAB 3SHLA 4EX5A 2B2TC 3I4MB 2E74C 1B3QA 2QGQA 4DXFA 2SNSA 2R93G 2PO4A 2PNRC 4KV6A 2FINB 5EKKA 1Y69U 4NW2A 3U9OA 1EL0A 3M3YH 3J81j 4RGNA 2F0VA 2LXKA 5FO9B 1Y8OB 2D2CC 2RA4A 1TY0A 4R1JA 1MBYA 5ELEA 4TQUS 2A68C 5M5WB 4RKLA 2VUMG 4QUCA 4CKCA 4LUVA 1IBLL 4I65A 3Q24A 2JSOA 4RGOS 5CV7A 2UXCL 3IAYA 3UDIA 1SYDA 4L6TB 1VQ6A 3HOYG 3TMEA 1PH3A 2E2JH 2HCIA 3AMUA 2L12A 1TVXA 3CCVA 2CHBD 1ILQA 4DV6L 5JPMC 4CDDC 1J6QA 4DR4L 1A62A 4MIUA 4FYDA 1KIXA 3GQBA 4V190 2NWGA 4YCWA 4RCOA 4POFA 3TS0A 3RZDB 3QIAA 2KOLA 2Q8TA 1PLFA 4GNXA 4XT1B 1U4RA 2Y0SE 4K6LA 5IYCG 2E2IH 5EKIA 1PRTB 1EY7A 4LWCA 4RWSC 3HOWH 5C4XB 3FP9A 1YBYA 2NVTH 1BO0A 5CV6A 2V4DA 4PV1C 4ODGA 3CCEA 3DMUA 5T1GA 1UUPA 4EGVA 3PO3H 4RAUC 1HFNA 2JQOA 3MTSA 2XWJB 1IBKL 4DV0Q 1CSQA 1I4PA 3CRKC 2R7FA 3NWTA 2WAQE 2ZM6L 3KUPA 1HNZQ 3HKZG 3MAQA 1B2TA 4DU9A 3TP6A 2MNAA 2IWHA 4OO1I 2UXDQ 2H4OA 2VQEQ 4A3MH 1BR9A 1TS2A 2BDOA 4KJOA 4DPGA 2MO0A 2WKDA 3JAME 2ZXOA 1S5ED 2NVYB 2Q2IA 2AWOA 3HP3A 2K5WA 3CCMA 4JI4L 1CQVA 3CMEA 2O5IC 4DK6C 3MXNA 4WRDA 1EU4A 2F3IA 1QZGA 4QF4A 1ENAA 1F9PA 2JEBI 1MJEA 1HTPA 1H9RA 3E5SA 1YJNA 4A3DB 1GUTA 1I6VC 4A3CG 4F88A 3MEFA 2K05A 2EXDA 4JW0A 1PH7A 4TRDA 3CCQA 4HIMA 3NQIA 2JA8B 4JPBW 4IUNA 1K0RA 1KTKA 3PO2H 2FFKB 3CQZB 4JYAL 4AYBE 1EIFA 2JA7B 3J81c 3KLSX 1CKMA 5JJLA 1ZEQX 2R61A 4B3SQ 1PFMA 4RH6A 4OHJA 2YV5A 3S9WA 3KJOA 1LTAD 1SFOB 4YY3Q 3EN2A 2QDBA 1Q12A 2XNAC 3S15H 1R4PB 2XGTA 3H3VC 4GOPC 5DEHA 4A3JG 3S1RH 4NDXA 1YZ6A 2NTTA 1BQQT 5KIXA 2OT2A 1A6XA 3L0OA 1PYSB 1RTOA 4TSSA 5IGBA 1I3QB 5I9OA 4DV7L 2K5HA 3K6OA 2DNEA 5C4JB 3NUCA 1QJOA 4RHRA 2NBFA 4A3EB 3CCRA 1F9QA 2QDLA 4P75A 2KCTA 1NJIC 3E6ZX 2F4IA 1HHVA 2R92G 1STNA 2B2VC 1F77A 2AHOB 3ZJYC 1IBML 3SDZA 1Z7TA 1NBWA 2IT1A 2KJXA 5HY6A 3GDEA 1MSGA 4HJ8A 1VQFA 3I56A 2M9VA 2RHQB 1G291 2CW0C 1PH4A 2JA6G 2NVQH 2AQ2B 5M3MH 1FNWA 4RA8A 2JYOA 3K7AH 2AQ1B 5GQOA 1LACA 5IT9E 1WTXA 1M4VA 3V96A 4DAYB 1HRJA 2Q8RE 2SOBA 1RTNA 2UXDL 2F0HA 1WTHA 1N9WA 2H5XA 4DR3Q 2EE1A 2VQEL 3F2UA 1STYA 4DA2A 4F7XA 3A7LA 2RQXA 1OTCA 1P8LA 1NTGA 3PUYA 3SEBA 4E6IA 1IYVA 1RD9D 2A74C 2MQHA 4OX9L 1YNJC 4GZYC 3M4OH 3D6CA 3W5OA 2VS1A 4RFBA 1R9TB 1RIPA 2F0QA 2Z6KA 4BY7G 1TR5A 3I4NB 3T1HQ 3NQTA 4IJHA 2IX3A 3U4VA 1KQSA 4KHZA 4X65Q 5FLXL 3OOCA 3K5MA 2JK8A 3GTMH 5JVG3 3S1NH 1ZYRD 1HXYD 4BBSB 1JQYD 1AW7A 1SNOA 4JBMA 5G3LF 5EPJA 2VB3X 3HOZG 4A3JH 1O80A 1L0WA 3TN2A 1Y1VH 1CHQD 3UDFA 3VYSA 1YNNC 4B3SL 4OXPA 2KEEA 1GUOA 5FLMH 1A63A 5C3EG 1QB5D 3HOWB 2NN6H 2WACA 4LFBL 3AU7A 3ERSX 4G7ZC 4IURA 4XDXA 2YTXA 1H9MA 4Z9CB 4CJ0B 3I4MG 4KD3A 3MEHA 4HJAA 1AE2A 1D5MC 2B63B 1PH9A 4LF9Q 1LT5D 1K3RA 1GXDC 1X3EA 2BCOA 3PIO3 5JEAG 3HGBA 1I6HB 3IL8A 4DF7A 1K8MA 1KRTA 4A3MB 2A69C 1YEZA 5KNBA 2PCFB 5JJZA 5IYDG 4GS3A 3J80i 2ZT9C 1IW7D 5IGCA 1E2ZA 2Z9HA 1KNEA 1EY5A 3Q22A 1GUSA 3BVGA 1YNXA 2EYPA 4FVMA 4LUZA 1NUCA 1FNVA 2CCZA 3CW2C 1CKNB 2BOSA 1K8GA 1VQLA 2E5LQ 3I2ZA 1FGUA 1KHIA 5ELFA 1PV4A 4N8X1 4JC0A 3PIOA 4M1UB 1PRTC 3A74A 4IUQA 4XYQA 3E0EA 1FJGQ 1PFSA 3FMCA 4B3TQ 3PO2B 4O2DA 3H15A 2WB1B 3ONAB 5C44H 1UE6A 1PZJD 2EJMA 1I94Q 5JEAJ 5DM73 3VYUA 4MN3A 4EQPA 1HUMA 3K5NA 4HMIA 2KCNA 1O7ZA 1C8CA 4NXMQ 1XPOA 1SEBD 4PZ6A 1CFMA 3BYTB 1Q1EA 3M4QA 1M1KC 1SNMA 4KN4C 1TXYA 1XPUA 2AQ3B 3S1RB 5KRUA 3HOZH 2YU9H 1G6ZA 1KDBA 2WV6D 3G71A 1AP0A 3KBGA 1XX8A 2K6AA 3T1HL 1T5XD 4HIOA 1PH6A 3X3MA 4X62Q 1TWFH 1M8AA 1X6OA 1S3OA 5IYBH 4KKSA 4A3GH 4BXXG 1RJTA 2K32A 4A3DG 4P71A 4IQZA 2ZXPA 2JA8G 5LMNQ 3QOJA 1LABA 2JE6I 5GADC 2JA7G 3G4SA 4DV1L 1EZ6A 2UUBQ 3WOEA 1S5FD 2SEBD 3D8GA 5M3MB 1QVGA 1STAA 4C3HH 4KKTA 2N55A 3K7AB 1IXRA 4LF9L 4PMWA 4A3IB 3T53B 1XMOQ 4DUZQ 5KGUA 3S2DH 4IUPA 1AH9A 2JN4A 1IYJB 2B2TA 3PF4A 4OELB 2F0EA 1C4QA 1B3AA 3GTGH 1CKNA 4CBVA 4HR7B 1HTLD 4JI6Q 1MSHA 4R4CA 5A35A 1EY6A 1VQJA 2X6GA 4LF6Q 3S1MH 5C4XH 4GLVB 3A8KE 2A68D 2KCMA 1TKWB 2CVRA 3BDOA 3NPPA 4X6AH 2N8NA 4A3EG 1JB7A 1A2TA 2E5LL 4L63B 3KK7A 2Q2TA 4LF8Q 3S1NB 3OW2A 4GLXA 1SMYC 1ET6A 2PQEA 4LK1C 4JI2Q 3K5OA 4OIKA 1FJGL 5EBDA 4B3TL 3W2DA 2EYLA 1G6PA 2N88A 3UDGA 2R7ZH 3GTLB 1Y1VB 1SJHD 1I94L 4ZAIA 1BBUA 1QUQB 4XT3B 2PQAB 1KLUD 4HSVA 2NVYH 1FR3A 2HHHQ 4QCLA 4ZQ3A 3H91A 5IY0A 1X9NA 3F2DA 1BBWA 3DEPA 4B3ML 1EFID 1EYDA 1V43A 3RN5A 2F52A 2ZTDA 4A3DH 1TQOA 5GROA 1KABA 2A6EC 1BNZA 1SXTA 1D7QA 1PRTF 2L11A 3OIQA 1WVLA 4DR4Q 2BDNA 2F0PA 3CQZH 3IRBA 4LFAL 2JA7H 1VQGA 4DGZA 4IFDH 3TSSA 1K9MC 4POGA 3DHQA 5CV5A 4J15A 1PYBA 1DONA 3J81E 2NZOA 2A6HC 3ND9A 3OSOA 3S1QB 1ET9A 4C1NK 4CHTB 4BBSG 2HIXA 1B9NA 3JAML 3VYTA 1STGA 4DV5Q 2EQSA 1HZ9A 3R2TA 3A8JE 3M85A 2B2WC 3L2PA 3RZOB 2K4KA 4QB4A 1SYCA 3K0YA 3HOWG 2DUDA 3EROA 4PMBA 5E4WC 1XMOL 2RCFA 4DUZL 5C44B 1BCPB 4DK0A 5AFWA 4FO2A 1NR2A 4JI8Q 2ID0A 2J7ZA 2L1BA 4A3EH 4K0KQ 2DY8A 2HCCA 3LWEA 2JJQA 4ULLA 2EYHA 4DV2L 4IUVA 2E2HB 2XRSD 3I70A 1CSPA 4NXNL 1KDAA 2B63G 1LYLA 4JI6L 4ME3A 1JMCA 3R8BA 4JI5Q 2Z0SA
chains in the Genus database with same CATH topology
1ICFB 2DJGC 4CDCC 4CDFC 1MHWC 4CDDC 2DJFC 4OELB 1K3BC 4OEMB 4CDEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICF B;  2DJG C;  4CDC C;  4CDF C;  1MHW C;  4CDD C;  2DJF C;  4OEL B;  1K3B C;  4OEM B;  4CDE C; 
#chains in the Genus database with same CATH topology
 1WTV A;  3V2T A;  5F2D A;  2YU9 B;  1VQN A;  2F0D A;  1QVC A;  4GOP A;  4DNR B;  4U67 3;  4A3M G;  3K80 C;  2QEJ C;  2QA4 A;  1PFN A;  3A0J A;  3W1B A;  1MD2 D;  1WD1 A;  1TWF B;  3NSW A;  4LF8 L;  2K50 A;  2KA7 A;  4G7H C;  4A3B H;  4A93 H;  3FDT A;  5BR8 Q;  2PQA A;  1JOO A;  1E1O A;  1ONL A;  1V1Q A;  5C0X H;  1K3B C;  3HRZ C;  2ZJQ A;  1VCI A;  2UUC Q;  3A5Z B;  1NCV A;  3GO5 A;  4L5Q A;  4A3G B;  2K7V A;  4BY1 H;  3OPO A;  3GV3 A;  1JJC B;  2J0T D;  1LM0 A;  3MFG A;  3CC7 A;  1EYC A;  5ELN A;  4QY7 A;  1MIU A;  1QVF A;  2B2V A;  1A3T A;  4KMU C;  1D5X C;  1R4Q B;  2PMZ E;  3OTO Q;  1O78 A;  4NMZ A;  2HHH L;  3PO2 G;  1R9T H;  2WB1 G;  4O42 A;  1Q90 A;  1H9S A;  3VR5 A;  4H0L C;  2K1B A;  4C3J B;  2I07 B;  3HOU H;  3I4N H;  1EEF D;  2CW0 D;  1DD2 A;  2N3S A;  4DFA A;  4C3H B;  2E2D C;  4JI3 Q;  1TWG B;  4DV7 Q;  2YTY A;  3S2D B;  3F2C A;  3TBI B;  2F3W A;  5LL6 S;  2NTS A;  1SJE D;  4CGY B;  4BBS H;  2KUM A;  2L5T A;  1BOS A;  5JJI A;  4EQ5 A;  5ELB A;  5EGT A;  1D1I A;  1FVI A;  2K75 A;  3NHH A;  2XRQ D;  1EY8 A;  4IPG A;  1VQD A;  1XTC D;  5IT9 L;  1PYW D;  3S2H H;  2EY1 A;  3GTJ B;  5D65 A;  3D6W A;  3GTG B;  4IPH A;  2K04 A;  5D3D A;  1IBM Q;  5EJW A;  1K0S A;  3S1M B;  5IWA L;  2OWO A;  1YNJ D;  1B70 B;  2KCC A;  1H9J A;  1PA6 A;  2JEA I;  1PH8 A;  4DV5 L;  2HD3 A;  5FJ8 H;  3TQY A;  3KDF B;  4FF1 A;  5H1S E;  4KTA A;  2IJ0 A;  3PQI A;  3PMF A;  4M8A A;  2PZU A;  2O4X A;  3NBH A;  2B63 H;  3SK6 A;  2L55 A;  2X6L A;  3SVM A;  2V1C C;  3U4Z A;  2RBM A;  3FVQ A;  2PZW A;  1HPC A;  1B44 D;  2MPM A;  3CKI B;  1X3Q A;  2KEC A;  4DV3 L;  1I6H H;  1QCB D;  1MJC A;  2R7Z B;  3V05 A;  2XSC A;  5C4Z A;  1SNC A;  2EY5 A;  4X3K A;  1ASY A;  2LMC B;  4JI8 L;  4RGT A;  3VYR A;  1CHP D;  4K0K L;  3F8T A;  1Q1B A;  5IP7 H;  2EY6 A;  1YNN D;  3NWS A;  2K01 A;  5M3M G;  4P2C B;  2QKI C;  3ER0 A;  4OX9 Q;  4YCV A;  4BBR H;  4OIJ A;  4A3I G;  3WDN A;  5DM6 3;  4LF7 L;  3G6E A;  2KHS A;  1II3 A;  4CDE C;  4JI5 L;  1OXS C;  1JE4 A;  2XTI A;  3FKI H;  3KOJ A;  1J5E L;  1HFG A;  2F0I A;  1KAW A;  4ALP A;  1HQR D;  5I6W A;  4KD4 A;  1RCV D;  2HDL A;  4DAP A;  1E3P A;  2TMP A;  1CT1 D;  1F9S A;  2D0O A;  4DR2 Q;  1WTW A;  2FMC A;  1C7Y A;  5BR8 L;  4WFN 3;  5J22 A;  1AEX A;  1NR4 A;  1HH2 P;  2F0T A;  5EAY A;  1EQV A;  3I55 A;  2UUC L;  3PUV A;  1V9P A;  3ZYY X;  4MTK A;  4HJ9 A;  1VQM A;  4L5R C;  1STB A;  4DR1 L;  2A69 D;  2EXZ A;  3A5U A;  2B2U C;  3UI2 A;  1O7L A;  4FF3 A;  4KJN A;  4RKB A;  4QIW E;  4L5S A;  4LFB Q;  1A0I A;  2ZTE A;  1SND A;  4Q0F A;  3CCU A;  2B29 A;  2G5D A;  2EYF A;  3OTO L;  1A3V A;  1EYG A;  2EIF A;  1Y1V G;  5FO7 B;  3BDC A;  2B8F A;  1BVS A;  1OXU A;  3K57 A;  2L9H A;  5FLM G;  1YHQ A;  3T1Y L;  3H6M A;  4JI3 L;  3E9I A;  1PRT D;  2NN6 G;  3BVZ A;  2Z8L A;  2G9D A;  2E75 C;  3RLO A;  1W3S A;  2VY3 A;  1TWH H;  2WAQ B;  3F2B A;  4RGM A;  3PF5 A;  3A54 A;  4OWW B;  3C1F A;  2OEO A;  4BS9 A;  4UHV A;  4G7O C;  3TDQ A;  2F0O A;  1JOK A;  5M3F H;  1VQO A;  3BZC A;  1PMR A;  3H09 A;  1S72 A;  4DR7 L;  1G91 A;  3H3V I;  1L0Y B;  1Y14 B;  3MWY W;  4S3S A;  4XQQ A;  3UE1 A;  2K5Q A;  5JOB A;  2KBN A;  3O13 A;  1QWY A;  3VR2 A;  3N52 A;  1XPR A;  2F0N A;  1Q82 C;  1W6J A;  4C3I B;  2IPK D;  3IKJ A;  5I2X A;  4OGQ C;  2NN6 I;  4DXG A;  3PUW A;  1G51 A;  3IFD A;  2GVB A;  1EOV A;  2HUG A;  1X32 A;  5IE8 A;  4A93 B;  4A3B B;  4BWG B;  3BU2 A;  1JOQ A;  1EWI A;  3CPF A;  3U9S A;  2D5D A;  4A3I H;  5DAU A;  3AFQ A;  4UDU C;  3RN2 A;  1E1T A;  3GV6 A;  2GA4 B;  1JC7 A;  2JA9 A;  4MTN A;  2MUY A;  3K58 A;  1ENF A;  3ULJ A;  4BY1 B;  4UPA A;  2CH4 A;  3D4R A;  3KFU A;  3ULP A;  3MFY A;  1Q3L A;  3I90 A;  4AYB B;  4IAL A;  1AZQ A;  5C3X A;  2LS0 1;  3Q8D A;  4DKA C;  2C9O A;  2DJF C;  2NZH A;  1JJG A;  1IKM A;  1EY0 A;  2ATW A;  3S16 H;  2PW5 A;  4IUT A;  3ND8 A;  3OMG A;  4KKU A;  3DEO A;  3LGJ A;  5C44 G;  3HOX H;  3SK4 A;  1BCP C;  4UP8 A;  3HOU B;  3EFX D;  1XTD A;  2RDH A;  2OQ0 A;  3H0G B;  1GOZ A;  5IGF A;  5KYI A;  5GAE C;  4R8N A;  1HCZ A;  4GN3 B;  3D4D A;  2DJG C;  4TKO B;  4DR2 L;  1PTO H;  3BVM A;  4LNQ A;  1Q8K A;  3DLL A;  3R3O A;  1N36 Q;  2WP8 J;  2G9H D;  5COR A;  1TS4 A;  1BF4 A;  3CD6 A;  4B3R L;  3GTL H;  2WFW A;  1HNX Q;  3S2H B;  3GP7 A;  3OHX C;  4C2M H;  4ZUJ A;  1TWA H;  3OWE B;  2YTV A;  1HA6 A;  2IHF A;  2H1E A;  4R9W A;  3FEW X;  4K6D A;  1SBB B;  5IYB G;  4LW1 A;  4NB3 A;  4O1N A;  4X64 Q;  4DV1 Q;  4H13 C;  4O0A A;  1E2W A;  1VQE A;  4A3G G;  3S17 B;  4OWT B;  4FXD A;  1RDP D;  1KDC A;  1WTR A;  1C48 A;  1QNK A;  3TP7 A;  4JV5 Q;  1AZP A;  5A2Q E;  2MGS A;  1LTT D;  1T9H A;  1SMY D;  2ICE C;  2RKS A;  3G48 A;  4YWK A;  2AUK A;  3KJP A;  3LNN A;  2A8V A;  1IZ6 A;  1SN8 A;  5D3I B;  2GVA A;  2MO1 A;  3AYH B;  3T13 A;  1SR3 A;  1YVC A;  2LSS A;  1HA5 A;  1K8O A;  1VS0 A;  4C3J G;  3AQQ A;  4CKB A;  1X3P A;  5C4H A;  4RMF A;  2C5C A;  3T56 B;  4C3H G;  3Q23 A;  3SR1 A;  4BBR B;  1SRU A;  5CV4 A;  2PI2 A;  3CXC A;  2PPB C;  5K5P A;  4AIM A;  3S1Q H;  1IHZ A;  5KND A;  2EZV A;  1CA6 A;  1GUG A;  1A2U A;  3FKI B;  4DAY A;  2R3Z A;  1V8Q A;  3A8I E;  4K2L A;  4KHV A;  2JP1 A;  2D9U A;  2WIN B;  1CZG A;  1LTL A;  1VQI A;  1I4H A;  3J81 i;  1SE3 A;  1QNU A;  1EYA A;  3RZO H;  1RKN A;  3HKZ E;  4HSP A;  2A6E D;  1S5D D;  1WJJ A;  3KF6 B;  4R4O A;  5HGQ A;  2F0L A;  5C4X G;  1X54 A;  4NP5 A;  5IGG A;  2B8G A;  3C1E A;  1KXL A;  3PUX A;  2NVX H;  2K14 A;  4GKJ Q;  3Q0A A;  3OW7 A;  2M2L A;  2E2H H;  1IKL A;  3QG1 A;  5DLQ E;  3AEV A;  2ZXR A;  1ILP A;  2A6H D;  5KNC A;  5M5X H;  4K14 A;  1XMQ Q;  2NZ1 D;  3EVQ A;  2KHI A;  3J81 L;  2R7Z G;  4B3M Q;  4B08 A;  1VDZ A;  4JG2 A;  2B2W A;  2FJ2 A;  4Y52 H;  5J39 A;  3RD4 A;  1U9R A;  1X56 A;  4R4T A;  1TWH B;  4X66 L;  3CCL A;  2I5L X;  1N36 L;  4LFA Q;  4C56 C;  5M3F B;  4R4Q A;  5COY A;  1HNX L;  5KEE A;  5ELD A;  1WTQ A;  3E0J A;  3QWN A;  1J8I A;  4ZKB B;  4APV A;  2ES2 A;  2N49 A;  5CV8 A;  2I5M X;  4HTH A;  4F87 A;  3I7F A;  3D4W A;  3M7G A;  4IZ8 A;  5EKL A;  3KLW A;  3I91 A;  1JWU D;  1B4O A;  1RHP A;  1VQ8 A;  1TS3 A;  3CC2 A;  1BCP F;  2XIW A;  4X64 L;  1HZA A;  4XTC S;  4IFD G;  3X3N A;  5ELC A;  4C3J H;  2WII B;  2F0J A;  2F0W A;  1KNA A;  4FP5 D;  4JV5 L;  4XQJ A;  4XXE A;  3RR5 A;  5JAV A;  1KD1 C;  4LFC L;  1TWG H;  3LWU A;  2QCP X;  1I4X A;  2Z6B A;  1ENC A;  4UAI A;  4ZK9 B;  3NEN A;  1JWM D;  4WJ3 M;  1HR0 W;  3TEH B;  5LMU Q;  4J8Q A;  4DV2 Q;  1W2B A;  1KLG D;  1QE6 A;  1NNX A;  3GTJ H;  4NXN Q;  4HAE A;  3S24 A;  4AH6 A;  2K5N A;  2BH2 A;  4H44 C;  4DV4 Q;  3IFT A;  4ZRZ A;  3S16 B;  3BG3 A;  1LV9 A;  2R6G A;  3NEL A;  1D6E C;  2IL8 A;  1SYB A;  2ZTC A;  3HOX B;  2WAQ G;  5CC4 A;  2F0G A;  1WD0 A;  3SE0 A;  4R4I A;  4HMJ A;  5CBA E;  3HS0 C;  2EOT A;  1HR0 L;  3OIP A;  2F0S A;  4IFD J;  3RLN A;  4JI7 L;  1PTO B;  1AE3 A;  5K36 G;  1JB3 A;  5J1Z A;  4DNT B;  1UE5 A;  4JOI C;  4KY7 A;  1EFW A;  4C3I G;  1JT8 A;  3BZK A;  5CYU A;  4GKJ L;  1SNP A;  2I46 A;  4C2M B;  1LTR D;  4DAV A;  1TWA B;  2D0P A;  2IX0 A;  2F4V Q;  4A4I A;  1MI2 A;  1HJP A;  4A3B G;  5C6A A;  4A93 G;  2ENB A;  4U68 A;  5C0X G;  4PG3 A;  3PV0 A;  3MZ5 A;  1XNR Q;  1O7Y A;  3QJY A;  1XMQ L;  2A5H A;  5FKA C;  3BDL A;  1SLJ A;  5LHY 1;  1EU3 A;  4PQX A;  4BY1 G;  4FF2 A;  2DY7 A;  1D2B A;  3JAM i;  4A3L H;  1BKB A;  1N32 L;  2Z4H A;  1S5B D;  2RHS B;  3BZD B;  4K2K A;  3OWF A;  1PFB A;  3S14 B;  3M4P A;  4ILW A;  4EQN A;  3HOU G;  3I4N G;  3H0G G;  5FOB B;  5KYL A;  2OXP A;  5IP9 H;  2DNC A;  1UWV A;  1XWE A;  1VQP A;  2B2Y C;  1SNQ A;  1XJV A;  2QW7 A;  2OCE A;  3L7Z C;  4JK1 C;  1KC8 C;  3H94 A;  2SDF A;  5IWA Q;  1MGS A;  1PH2 A;  3QOL A;  1G2S A;  3SK8 A;  4PMC A;  1OXV A;  1UE1 A;  3GTP B;  1EWC A;  5C0X J;  1IYU A;  2CQO A;  3EIV A;  1L0X B;  1CI3 M;  3MVV A;  2K28 A;  5J3B A;  2E8G A;  3R93 A;  3PIP A;  1S5C D;  3B6Y A;  1HUN A;  4IOC A;  3L9A X;  5BN3 A;  3Q6S A;  1P16 A;  1V1O A;  2LFN A;  1E7Z A;  4L5T A;  1Y8N B;  3CRL C;  4DV3 Q;  4H02 A;  2OTL A;  1XNQ L;  4P73 A;  4KY6 A;  1DYQ A;  1SYE A;  4HED A;  2NVX B;  2BH8 A;  4A3K H;  1CTM A;  4GNX B;  3C2P A;  1PXU A;  5FJ8 G;  2MJ8 A;  5CR3 A;  5LMU L;  2UXB Q;  5I4D A;  1G8Z D;  5I6Y A;  2AWN A;  2FXQ A;  1ICF B;  2XWB B;  1JE5 A;  2B2U A;  4L8J A;  4LF7 Q;  5E7N A;  5M5X B;  4JBK A;  5K36 H;  4DV4 L;  2RDF A;  1DXM A;  1K8A C;  2P5Z X;  5JJK A;  1TS5 A;  1J5E Q;  1WCM B;  5I9P A;  3D3R A;  3MXP A;  3P20 A;  4C3I H;  3HOV H;  5I2Y A;  2MFI A;  1X55 A;  2O2L D;  1PH1 A;  4BY7 B;  4CJ1 B;  5EPL A;  5IP7 G;  3CF5 A;  1U0L A;  2EY2 A;  1XXG A;  3LX0 A;  3NP8 A;  4HCS A;  1QUQ A;  3GTQ B;  1G2T A;  4BBR G;  2LKV A;  3QO2 A;  3TS2 A;  3J7A 5;  2TSS A;  1F2M A;  2R7D A;  2B39 A;  3FKI G;  1XYI A;  4DUY Q;  3K5L A;  4KK7 A;  1QZH A;  2UU9 Q;  2UUA Q;  1EZ8 A;  1I4Q A;  4OEM B;  4DR1 Q;  1Y1W H;  2K52 A;  1NAP A;  1AN8 A;  3NK9 A;  4LAA A;  5C5M A;  4X3T A;  3DM3 A;  1N34 L;  2F4V L;  5C3E B;  2PW7 A;  2FMM A;  2HT1 A;  3J7A V;  1ZKO A;  2KED A;  3KYH C;  2HQE A;  3MXN B;  1D8L A;  4NKL A;  3PGZ A;  3U58 A;  2K33 A;  1XNR L;  1NE3 A;  4B9W A;  4HID A;  3CC4 A;  4FF4 A;  1C0A A;  3RUZ A;  2GN5 A;  4GKK Q;  1LTI D;  3H0G H;  4QUF A;  4HJ7 A;  1RL2 A;  3T1Y Q;  5IGD A;  5EQ0 A;  5FLX c;  2J4X A;  2PYK A;  3EBE A;  4JBJ A;  1D5Z C;  4RCN A;  3TRZ A;  4DK1 A;  2JA5 B;  2EVB A;  1B7Y B;  1YHA A;  5LL6 X;  4LJZ C;  1M90 C;  1E0B A;  1D1K A;  4DR7 Q;  2X69 A;  1HZB A;  2A73 B;  1HNW Q;  1Z47 A;  3N6R A;  3CCJ A;  1K73 C;  4K5W A;  4V0B A;  4K8I A;  2AMC B;  1TWC H;  3W3A A;  2NB0 A;  2BA1 A;  1BCP D;  4DNI A;  3KBX A;  5M3F G;  3M7N A;  1BXT A;  3S17 H;  3TRE A;  1EQR A;  2RDG A;  4OO1 G;  3CHB D;  5E3F A;  3TZU A;  2E76 C;  1QIL A;  2DGY A;  3UDX A;  1U4M A;  3HG9 A;  5BN4 A;  3GD7 A;  4IUU A;  2A1A A;  4X3S A;  1N8R C;  2LXJ A;  1Q46 A;  2UXB L;  4IO9 A;  3MA2 B;  2CWA A;  5AJ3 L;  1VQH A;  2VNU D;  3T51 B;  4CKE A;  4JI0 L;  1VQ4 A;  2PMZ B;  4HN7 A;  5C3W A;  2CWP A;  2F0K A;  3D0F A;  1LT4 D;  1L2F A;  2EYJ A;  4K5V A;  3FPP A;  3K8A A;  1J9O A;  4R8I A;  2F1M A;  3BJU A;  1MHW C;  4GLA C;  5HUR A;  1BUV T;  3HEJ A;  1CK1 A;  5IGE A;  4ZCK A;  3DWA A;  4OL7 A;  4DN4 M;  5A2Q L;  3HOX G;  1U5K A;  4DR6 L;  4B3R Q;  4DUY L;  2F0F A;  1N33 Q;  2UU9 L;  2UUA L;  3J80 c;  4ZLT F;  2PI2 E;  3NE5 B;  5CGK A;  1W6K A;  4XIG S;  1SE2 A;  2EDG A;  2R93 H;  3HFZ B;  2Y0S B;  3T4A C;  2VQF Q;  1LT6 D;  3ULL A;  3NEM A;  3R2I A;  1PTO C;  3P1H A;  2L0C A;  3URY A;  2L15 A;  4BA1 I;  2NUC A;  4DK3 C;  1TY2 A;  1E24 A;  4QMG A;  4WOR A;  2VUM H;  3VR3 A;  5NUC A;  1STH A;  5DNF A;  4AQY Q;  1KRS A;  4G57 A;  4GKK L;  4X3U A;  3DWP A;  3HOY H;  5CBE E;  1A8V A;  1LTB D;  1K83 H;  1SYG A;  1FL0 A;  1E2V A;  1DZ1 A;  1UEA B;  2K03 A;  4A3K B;  2BE5 C;  2AKW B;  4LF5 Q;  3GTK H;  1I50 B;  3PUZ A;  3MHB A;  3STB D;  3A56 A;  5BN5 A;  4RHS A;  1L1O C;  3CCS A;  3J7Z C;  1HNW L;  1EQT A;  3KDF A;  5IYC H;  4OO1 H;  2XVS A;  1CKO A;  4UP7 A;  3RLF A;  2A19 A;  1A3U A;  5FO8 B;  3HOV B;  3GTO H;  1EY9 A;  2HQL A;  1GM5 A;  3HZX A;  3I72 A;  2NYZ D;  4FXK C;  4IOA A;  1ESR A;  4N8F A;  4Y7N H;  1DCZ A;  1TT2 A;  5TSS A;  2ASB A;  4A3F B;  1LTG D;  1YJ9 A;  2K5D A;  2MP1 A;  5CV9 A;  4QJF A;  4YHH Q;  2KHJ A;  1Y1W B;  3A55 A;  1EOT A;  3EQL C;  1PHJ A;  2EPB A;  1VQ7 A;  5JPN C;  5M5Y H;  1CUK A;  3D31 A;  4PZ7 A;  3I4O A;  3VA5 A;  5ISR A;  1VQ9 A;  1B50 A;  1GUW A;  4DV0 L;  1NMF A;  3RMH A;  3K59 A;  3HKS A;  4J1M A;  3WOF A;  4QIW B;  1HNZ L;  1WI5 A;  1F2Y A;  4ABN A;  3T16 A;  1WTP A;  4GNX C;  1X65 A;  4WJ4 A;  4A76 A;  1LLR D;  3K81 C;  4A3C H;  3KF8 B;  4KLK A;  3M3Y B;  2EJF C;  5EBC A;  4X66 Q;  4UY8 C;  3F1Z A;  3I3C A;  2HIV A;  1Q86 C;  1WCM G;  2EJG C;  1GJX A;  4P74 A;  1GUN A;  3MXU A;  1TII D;  1WTO A;  1N33 L;  3SGI A;  4JBW A;  1F2Z A;  3FHW A;  1E22 A;  3PCO B;  2RSO A;  3J7A F;  2E2J B;  3K0X A;  1LUZ A;  1V1P B;  1TWC B;  1YJW A;  2VQF L;  2WB1 E;  2F0U A;  4IPD A;  1Q81 C;  3VA7 A;  1T5E A;  3A7A B;  3H3V H;  3MC0 B;  3P7J A;  1F2L A;  2PZT A;  1BDO A;  4AQY L;  2FHT A;  4G4K A;  2E2I B;  4LFC Q;  3I73 A;  4JVZ A;  1VQ5 A;  3MXG A;  1SE8 A;  1DOM A;  1ASZ A;  5T1I A;  4YY3 L;  4EVO A;  2NVT B;  1SE4 A;  4PNY A;  3E9H A;  4IJL A;  4JOI A;  3S14 H;  2IY5 B;  4LF5 L;  3PO3 B;  1MKH A;  2OF1 A;  4FXG C;  4GN4 B;  3AFP A;  4MZ9 A;  1PZK D;  1PH5 A;  1EUJ A;  3ICE A;  4H7B A;  4A75 A;  3AB9 A;  2R92 H;  3FPU B;  1JJ2 A;  1PTO F;  1QOH A;  1DOK A;  1SAP A;  2ZJR A;  1GD7 A;  2JA5 G;  1H9K A;  3ITP A;  3P75 A;  1DJR D;  3DUZ A;  3DM1 A;  2KQ3 A;  3JAM c;  3GTP H;  1WOC A;  1HR0 Q;  2HDM A;  1H95 A;  1DOL A;  1EEI D;  2L4N A;  4ME5 A;  2JA6 H;  3G6J B;  4JI7 Q;  2RCN A;  1JR0 D;  4UP9 A;  4YHH L;  4YWM A;  5IOD A;  3UE0 A;  1EIH A;  3DWQ A;  2I5H A;  2LY7 A;  3STB C;  3CAM A;  2F0M A;  5IOC A;  2B3G A;  2R93 B;  1WFQ A;  2BA0 A;  1LTS D;  1CZW A;  3L3O C;  4EQO A;  1X3F A;  2B2Y A;  5FK9 C;  4OWX B;  2RF4 A;  1OO9 B;  3KF8 A;  4HJ5 A;  4FDB A;  4OON A;  2VUM B;  2JXM B;  1EQQ A;  1WCM H;  3QB3 A;  1PZI D;  4DR5 Q;  3J80 L;  3NXW A;  1YI2 A;  4BY7 H;  2AUJ D;  3VR4 A;  4N9P A;  4DR3 L;  1N32 Q;  4QQB X;  3HOY B;  1K83 B;  1JWS D;  3VDY A;  3GTQ H;  3WWV A;  4KN7 C;  1NY4 A;  3S15 B;  1A15 A;  1V1P A;  2VL6 A;  1EIG A;  4ZKC B;  2QIL A;  2VXW A;  1GHK A;  3GTK B;  4P72 A;  1O7I A;  4ZYS A;  2VZA A;  4GN5 A;  3TZD A;  1KL9 A;  1LT3 D;  2IHE A;  2N78 A;  4A3L G;  1ZXT A;  1YIJ A;  3G7L A;  4LF4 Q;  4Q5V A;  2RVL A;  2IX1 A;  3NBI A;  4X65 L;  5C3E H;  2ICI A;  4YWL A;  1UNS A;  4ZUI A;  5GAH C;  2OQK A;  1FNU A;  3E3X A;  3GTO B;  1HZC A;  3CU7 A;  3EJI A;  5JVH 3;  1KAA A;  1FD7 D;  3I4M H;  4Y7N B;  4K5X A;  3M9B A;  5IP9 G;  2CQA A;  4HCE A;  3NTK A;  5E1F A;  3ERQ A;  2O5J C;  2Y0S G;  1YHB A;  4PZ8 A;  3HKZ B;  1I4G A;  2WKC A;  1XNQ Q;  1GO3 E;  5JEA H;  2JA5 H;  3VR6 A;  3FRP B;  5FLX E;  2Z6K C;  2QF7 A;  5D14 A;  5EPK A;  5M5W H;  2VB2 X;  1JCK B;  2RSN A;  5M5Y B;  3K7U C;  1IL2 A;  3OMC A;  1IL8 A;  5IT9 c;  4MNO A;  2NVQ B;  5IYD H;  1ICW A;  1VMP A;  3CMA A;  4IFD I;  1GHJ A;  1ZYR C;  2Q2U A;  1Y8P B;  4IN3 A;  3SK5 A;  3KF6 A;  4KHP Q;  4A3K G;  2SNM A;  2CH4 W;  1BBX C;  1OXX K;  3RZD H;  4F8M A;  4BA2 I;  2VW9 A;  1YIT A;  3U50 C;  4XQN A;  2EYM A;  4C1N I;  4N9T A;  5L37 A;  3M4O B;  1VF5 C;  1F9R A;  1Q8I A;  1ML0 D;  3C3L A;  5HGT A;  1LO5 D;  3HOV G;  2D62 A;  4CJ2 C;  1JOR A;  1S4Z A;  3TP8 A;  1N34 Q;  1Z6H A;  5CMD A;  1B9M A;  3M4Y A;  4A3F G;  3GTM B;  3NTH A;  1HQM C;  1K28 A;  2IW3 A;  4I7Z C;  1UAP A;  1PVO A;  1AFP A;  5E4X A;  4JI1 Q;  1VQC A;  4GOP B;  3JC6 6;  3BS1 A;  1EY4 A;  4A3J B;  1Y1W G;  1SYF A;  2Q2H A;  4CDF C;  4DR5 L;  2M00 A;  1L1O B;  4AYB G;  1Z9F A;  4QL5 A;  3NTI A;  1CQF A;  1RF2 D;  1IW7 C;  3CP0 A;  3PIP 3;  3QR8 A;  4NXM L;  4FNF A;  1JIC A;  3OYY A;  2ZJP A;  3KLR A;  4NPS A;  1C9O A;  4K8J A;  1I5F A;  1IBL Q;  1WYD A;  3PSI A;  2ALY B;  3W1G A;  4QGU A;  5C0X I;  2UXC Q;  5ELO A;  3J7Y W;  4BXX H;  4IPC A;  2MHV A;  1DGS A;  4LF4 L;  5GAG C;  1U4P A;  1I4R A;  2DN8 A;  2Q8I B;  2R92 B;  3J80 E;  4HIK A;  4ID6 A;  5C5L A;  1VF7 A;  4X62 L;  4YIJ A;  1QG7 A;  2CKZ B;  1OXT A;  4DV6 Q;  5LMN W;  1B1Z A;  2JA8 H;  1SMX A;  4RG1 A;  1H9S B;  1SDF A;  2I0Q A;  5G3L D;  2XN9 C;  4MHE A;  2PNH A;  3EA6 A;  2Z4I A;  2JA6 B;  1GVP A;  1ROD A;  2K5V A;  1PDQ A;  3TP5 A;  1CM9 A;  3DXJ C;  1NSN S;  3C46 A;  1VMC A;  1SFO H;  2YYZ A;  4YCU A;  5LMN L;  3I8Z A;  2KEN A;  1UEB A;  1SSO A;  1I50 H;  1B53 A;  1FYC A;  2UUB L;  1IBK Q;  2CFM A;  1GKH A;  1ESF A;  5AJ3 Q;  2ZM6 Q;  1FGB D;  3SXH A;  4DAM A;  1PTO D;  4KI0 A;  1EWH A;  1I3Q H;  1STE A;  2QEX A;  1VQK A;  4JI0 Q;  4LMQ D;  1S40 A;  1B8A A;  5C4J H;  4KHP L;  3PO3 G;  1Q7Y C;  4LUO A;  5IIF A;  3NBH B;  1TU2 B;  2Z1C A;  4A3F H;  4JI4 Q;  4KY5 A;  3BYY B;  1U4L A;  2F03 A;  4CDC C;  4DR6 Q;  1EIY B;  4LF6 L;  5M9O A;  3HOZ B;  2BE5 D;  4B9X A;  3RNU A;  3CPW A;  1SRO A;  2EYO A;  1VQA A;  2C35 B;  1DM0 B;  1L1O A;  1NMG A;  1VQB A;  1CA5 A;  2OTJ A;  2KVM A;  3KLS A;  3I4L A;  4WJW A;  4JCV E;  4XYO A;  4JI2 L;  2F3V A;  4J6H A;  1UE7 A;  4I7A A;  4JYA Q;  1X3G A;  4JI1 L;  4TVA B;  3SHL A;  4EX5 A;  2B2T C;  3I4M B;  2E74 C;  1B3Q A;  2QGQ A;  4DXF A;  2SNS A;  2R93 G;  2PO4 A;  2PNR C;  4KV6 A;  2FIN B;  5EKK A;  1Y69 U;  4NW2 A;  3U9O A;  1EL0 A;  3M3Y H;  3J81 j;  4RGN A;  2F0V A;  2LXK A;  5FO9 B;  1Y8O B;  2D2C C;  2RA4 A;  1TY0 A;  4R1J A;  1MBY A;  5ELE A;  4TQU S;  2A68 C;  5M5W B;  4RKL A;  2VUM G;  4QUC A;  4CKC A;  4LUV A;  1IBL L;  4I65 A;  3Q24 A;  2JSO A;  4RGO S;  5CV7 A;  2UXC L;  3IAY A;  3UDI A;  1SYD A;  4L6T B;  1VQ6 A;  3HOY G;  3TME A;  1PH3 A;  2E2J H;  2HCI A;  3AMU A;  2L12 A;  1TVX A;  3CCV A;  2CHB D;  1ILQ A;  4DV6 L;  5JPM C;  4CDD C;  1J6Q A;  4DR4 L;  1A62 A;  4MIU A;  4FYD A;  1KIX A;  3GQB A;  4V19 0;  2NWG A;  4YCW A;  4RCO A;  4POF A;  3TS0 A;  3RZD B;  3QIA A;  2KOL A;  2Q8T A;  1PLF A;  4GNX A;  4XT1 B;  1U4R A;  2Y0S E;  4K6L A;  5IYC G;  2E2I H;  5EKI A;  1PRT B;  1EY7 A;  4LWC A;  4RWS C;  3HOW H;  5C4X B;  3FP9 A;  1YBY A;  2NVT H;  1BO0 A;  5CV6 A;  2V4D A;  4PV1 C;  4ODG A;  3CCE A;  3DMU A;  5T1G A;  1UUP A;  4EGV A;  3PO3 H;  4RAU C;  1HFN A;  2JQO A;  3MTS A;  2XWJ B;  1IBK L;  4DV0 Q;  1CSQ A;  1I4P A;  3CRK C;  2R7F A;  3NWT A;  2WAQ E;  2ZM6 L;  3KUP A;  1HNZ Q;  3HKZ G;  3MAQ A;  1B2T A;  4DU9 A;  3TP6 A;  2MNA A;  2IWH A;  4OO1 I;  2UXD Q;  2H4O A;  2VQE Q;  4A3M H;  1BR9 A;  1TS2 A;  2BDO A;  4KJO A;  4DPG A;  2MO0 A;  2WKD A;  3JAM E;  2ZXO A;  1S5E D;  2NVY B;  2Q2I A;  2AWO A;  3HP3 A;  2K5W A;  3CCM A;  4JI4 L;  1CQV A;  3CME A;  2O5I C;  4DK6 C;  3MXN A;  4WRD A;  1EU4 A;  2F3I A;  1QZG A;  4QF4 A;  1ENA A;  1F9P A;  2JEB I;  1MJE A;  1HTP A;  1H9R A;  3E5S A;  1YJN A;  4A3D B;  1GUT A;  1I6V C;  4A3C G;  4F88 A;  3MEF A;  2K05 A;  2EXD A;  4JW0 A;  1PH7 A;  4TRD A;  3CCQ A;  4HIM A;  3NQI A;  2JA8 B;  4JPB W;  4IUN A;  1K0R A;  1KTK A;  3PO2 H;  2FFK B;  3CQZ B;  4JYA L;  4AYB E;  1EIF A;  2JA7 B;  3J81 c;  3KLS X;  1CKM A;  5JJL A;  1ZEQ X;  2R61 A;  4B3S Q;  1PFM A;  4RH6 A;  4OHJ A;  2YV5 A;  3S9W A;  3KJO A;  1LTA D;  1SFO B;  4YY3 Q;  3EN2 A;  2QDB A;  1Q12 A;  2XNA C;  3S15 H;  1R4P B;  2XGT A;  3H3V C;  4GOP C;  5DEH A;  4A3J G;  3S1R H;  4NDX A;  1YZ6 A;  2NTT A;  1BQQ T;  5KIX A;  2OT2 A;  1A6X A;  3L0O A;  1PYS B;  1RTO A;  4TSS A;  5IGB A;  1I3Q B;  5I9O A;  4DV7 L;  2K5H A;  3K6O A;  2DNE A;  5C4J B;  3NUC A;  1QJO A;  4RHR A;  2NBF A;  4A3E B;  3CCR A;  1F9Q A;  2QDL A;  4P75 A;  2KCT A;  1NJI C;  3E6Z X;  2F4I A;  1HHV A;  2R92 G;  1STN A;  2B2V C;  1F77 A;  2AHO B;  3ZJY C;  1IBM L;  3SDZ A;  1Z7T A;  1NBW A;  2IT1 A;  2KJX A;  5HY6 A;  3GDE A;  1MSG A;  4HJ8 A;  1VQF A;  3I56 A;  2M9V A;  2RHQ B;  1G29 1;  2CW0 C;  1PH4 A;  2JA6 G;  2NVQ H;  2AQ2 B;  5M3M H;  1FNW A;  4RA8 A;  2JYO A;  3K7A H;  2AQ1 B;  5GQO A;  1LAC A;  5IT9 E;  1WTX A;  1M4V A;  3V96 A;  4DAY B;  1HRJ A;  2Q8R E;  2SOB A;  1RTN A;  2UXD L;  2F0H A;  1WTH A;  1N9W A;  2H5X A;  4DR3 Q;  2EE1 A;  2VQE L;  3F2U A;  1STY A;  4DA2 A;  4F7X A;  3A7L A;  2RQX A;  1OTC A;  1P8L A;  1NTG A;  3PUY A;  3SEB A;  4E6I A;  1IYV A;  1RD9 D;  2A74 C;  2MQH A;  4OX9 L;  1YNJ C;  4GZY C;  3M4O H;  3D6C A;  3W5O A;  2VS1 A;  4RFB A;  1R9T B;  1RIP A;  2F0Q A;  2Z6K A;  4BY7 G;  1TR5 A;  3I4N B;  3T1H Q;  3NQT A;  4IJH A;  2IX3 A;  3U4V A;  1KQS A;  4KHZ A;  4X65 Q;  5FLX L;  3OOC A;  3K5M A;  2JK8 A;  3GTM H;  5JVG 3;  3S1N H;  1ZYR D;  1HXY D;  4BBS B;  1JQY D;  1AW7 A;  1SNO A;  4JBM A;  5G3L F;  5EPJ A;  2VB3 X;  3HOZ G;  4A3J H;  1O80 A;  1L0W A;  3TN2 A;  1Y1V H;  1CHQ D;  3UDF A;  3VYS A;  1YNN C;  4B3S L;  4OXP A;  2KEE A;  1GUO A;  5FLM H;  1A63 A;  5C3E G;  1QB5 D;  3HOW B;  2NN6 H;  2WAC A;  4LFB L;  3AU7 A;  3ERS X;  4G7Z C;  4IUR A;  4XDX A;  2YTX A;  1H9M A;  4Z9C B;  4CJ0 B;  3I4M G;  4KD3 A;  3MEH A;  4HJA A;  1AE2 A;  1D5M C;  2B63 B;  1PH9 A;  4LF9 Q;  1LT5 D;  1K3R A;  1GXD C;  1X3E A;  2BCO A;  3PIO 3;  5JEA G;  3HGB A;  1I6H B;  3IL8 A;  4DF7 A;  1K8M A;  1KRT A;  4A3M B;  2A69 C;  1YEZ A;  5KNB A;  2PCF B;  5JJZ A;  5IYD G;  4GS3 A;  3J80 i;  2ZT9 C;  1IW7 D;  5IGC A;  1E2Z A;  2Z9H A;  1KNE A;  1EY5 A;  3Q22 A;  1GUS A;  3BVG A;  1YNX A;  2EYP A;  4FVM A;  4LUZ A;  1NUC A;  1FNV A;  2CCZ A;  3CW2 C;  1CKN B;  2BOS A;  1K8G A;  1VQL A;  2E5L Q;  3I2Z A;  1FGU A;  1KHI A;  5ELF A;  1PV4 A;  4N8X 1;  4JC0 A;  3PIO A;  4M1U B;  1PRT C;  3A74 A;  4IUQ A;  4XYQ A;  3E0E A;  1FJG Q;  1PFS A;  3FMC A;  4B3T Q;  3PO2 B;  4O2D A;  3H15 A;  2WB1 B;  3ONA B;  5C44 H;  1UE6 A;  1PZJ D;  2EJM A;  1I94 Q;  5JEA J;  5DM7 3;  3VYU A;  4MN3 A;  4EQP A;  1HUM A;  3K5N A;  4HMI A;  2KCN A;  1O7Z A;  1C8C A;  4NXM Q;  1XPO A;  1SEB D;  4PZ6 A;  1CFM A;  3BYT B;  1Q1E A;  3M4Q A;  1M1K C;  1SNM A;  4KN4 C;  1TXY A;  1XPU A;  2AQ3 B;  3S1R B;  5KRU A;  3HOZ H;  2YU9 H;  1G6Z A;  1KDB A;  2WV6 D;  3G71 A;  1AP0 A;  3KBG A;  1XX8 A;  2K6A A;  3T1H L;  1T5X D;  4HIO A;  1PH6 A;  3X3M A;  4X62 Q;  1TWF H;  1M8A A;  1X6O A;  1S3O A;  5IYB H;  4KKS A;  4A3G H;  4BXX G;  1RJT A;  2K32 A;  4A3D G;  4P71 A;  4IQZ A;  2ZXP A;  2JA8 G;  5LMN Q;  3QOJ A;  1LAB A;  2JE6 I;  5GAD C;  2JA7 G;  3G4S A;  4DV1 L;  1EZ6 A;  2UUB Q;  3WOE A;  1S5F D;  2SEB D;  3D8G A;  5M3M B;  1QVG A;  1STA A;  4C3H H;  4KKT A;  2N55 A;  3K7A B;  1IXR A;  4LF9 L;  4PMW A;  4A3I B;  3T53 B;  1XMO Q;  4DUZ Q;  5KGU A;  3S2D H;  4IUP A;  1AH9 A;  2JN4 A;  1IYJ B;  2B2T A;  3PF4 A;  4OEL B;  2F0E A;  1C4Q A;  1B3A A;  3GTG H;  1CKN A;  4CBV A;  4HR7 B;  1HTL D;  4JI6 Q;  1MSH A;  4R4C A;  5A35 A;  1EY6 A;  1VQJ A;  2X6G A;  4LF6 Q;  3S1M H;  5C4X H;  4GLV B;  3A8K E;  2A68 D;  2KCM A;  1TKW B;  2CVR A;  3BDO A;  3NPP A;  4X6A H;  2N8N A;  4A3E G;  1JB7 A;  1A2T A;  2E5L L;  4L63 B;  3KK7 A;  2Q2T A;  4LF8 Q;  3S1N B;  3OW2 A;  4GLX A;  1SMY C;  1ET6 A;  2PQE A;  4LK1 C;  4JI2 Q;  3K5O A;  4OIK A;  1FJG L;  5EBD A;  4B3T L;  3W2D A;  2EYL A;  1G6P A;  2N88 A;  3UDG A;  2R7Z H;  3GTL B;  1Y1V B;  1SJH D;  1I94 L;  4ZAI A;  1BBU A;  1QUQ B;  4XT3 B;  2PQA B;  1KLU D;  4HSV A;  2NVY H;  1FR3 A;  2HHH Q;  4QCL A;  4ZQ3 A;  3H91 A;  5IY0 A;  1X9N A;  3F2D A;  1BBW A;  3DEP A;  4B3M L;  1EFI D;  1EYD A;  1V43 A;  3RN5 A;  2F52 A;  2ZTD A;  4A3D H;  1TQO A;  5GRO A;  1KAB A;  2A6E C;  1BNZ A;  1SXT A;  1D7Q A;  1PRT F;  2L11 A;  3OIQ A;  1WVL A;  4DR4 Q;  2BDN A;  2F0P A;  3CQZ H;  3IRB A;  4LFA L;  2JA7 H;  1VQG A;  4DGZ A;  4IFD H;  3TSS A;  1K9M C;  4POG A;  3DHQ A;  5CV5 A;  4J15 A;  1PYB A;  1DON A;  3J81 E;  2NZO A;  2A6H C;  3ND9 A;  3OSO A;  3S1Q B;  1ET9 A;  4C1N K;  4CHT B;  4BBS G;  2HIX A;  1B9N A;  3JAM L;  3VYT A;  1STG A;  4DV5 Q;  2EQS A;  1HZ9 A;  3R2T A;  3A8J E;  3M85 A;  2B2W C;  3L2P A;  3RZO B;  2K4K A;  4QB4 A;  1SYC A;  3K0Y A;  3HOW G;  2DUD A;  3ERO A;  4PMB A;  5E4W C;  1XMO L;  2RCF A;  4DUZ L;  5C44 B;  1BCP B;  4DK0 A;  5AFW A;  4FO2 A;  1NR2 A;  4JI8 Q;  2ID0 A;  2J7Z A;  2L1B A;  4A3E H;  4K0K Q;  2DY8 A;  2HCC A;  3LWE A;  2JJQ A;  4ULL A;  2EYH A;  4DV2 L;  4IUV A;  2E2H B;  2XRS D;  3I70 A;  1CSP A;  4NXN L;  1KDA A;  2B63 G;  1LYL A;  4JI6 L;  4ME3 A;  1JMC A;  3R8B A;  4JI5 Q;  2Z0S A; 
#chains in the Genus database with same CATH homology
 1ICF B;  2DJG C;  4CDC C;  4CDF C;  1MHW C;  4CDD C;  2DJF C;  4OEL B;  1K3B C;  4OEM B;  4CDE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...