4CDDC

Human dpp1 in complex with (2s)-n-((1s)-1-cyano-2-(4-(4-cyanophenyl) phenyl)ethyl)piperidine-2-carboxamide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
total genus 7
structure length 68
sequence length 68
chains with identical sequence F
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4cddC00
1MHWC 4CDFC 4OEMB 2DJGC 1ICFB 4OELB 4CDDC 4CDCC 2DJFC 4CDEC 1K3BC
chains in the Genus database with same CATH superfamily
2Q2TA 1NCVA 3I2ZA 4HJ8A 4H44C 2KECA 1Q3LA 4JI1Q 1HRJA 1HHVA 1BQQT 3KF6B 1HUNA 1EYGA 4LWCA 5GAHC 3D3RA 3S1NB 5E7NA 1Q1BA 1PTOD 2N88A 4I65A 5JEAG 1K8GA 1WYDA 2BH8A 1JWSD 3OIPA 4RG1A 3WWVA 1JC7A 1H9SB 1Q7YC 4UP7A 3BDCA 1Y1VG 3C1EA 4WORA 5M5WB 3HOVB 1N9WA 1PFNA 4IO9A 1I4XA 1SXTA 1X55A 3PSIA 5FO7B 4CKEA 2R92G 1X3PA 2XNAC 1SNCA 4BA1I 4R1JA 2L5TA 4ALPA 2EYHA 2Z6KC 3CAMA 2XRSD 4KN7C 3BVMA 1XYIA 4JI1L 4I7ZC 3UDXA 2PI2A 3HFZB 2IPKD 5IIFA 5JPMC 3T16A 2JXMB 3TZDA 4A3KB 3HOXH 1K83H 5M5YB 5BN4A 4OWWB 1CHPD 4KHPQ 1V1QA 4FF4A 3K59A 2NTTA 4OWTB 2FMMA 1QILA 2F0IA 2Q8IB 1CFMA 2NBFA 3M4OB 1CKNB 3I4LA 2JJQA 5FLXL 1H9JA 3K5MA 1LT6D 4BY7B 1KC8C 4ZAIA 3T4AC 3EN2A 4JBKA 2N55A 5IE8A 2BCOA 2A68C 2O5IC 1XWEA 2PMZE 5M3FB 1BNZA 5CBAE 3SHLA 1BF4A 5A2QE 4WJ4A 1A15A 4KD3A 4BXXH 3UE1A 2PW7A 5ELDA 2A6HC 1ILQA 3MFGA 1Y1VH 4HMJA 2KCMA 1I50H 5FJ8H 3A8IE 4DF7A 5M5XH 1Y1WG 4ME5A 4A3EB 1SYBA 1N33Q 3AYHB 4APVA 1AN8A 1RF2D 4IPDA 4ZUJA 4P72A 1D1KA 2KEDA 2JA5H 2R93H 1VCIA 1I4GA 4CJ2C 1BCPD 4KKTA 2DY8A 3M4QA 2B39A 4JI3Q 1J8IA 1I6VC 4ZUIA 4B3RQ 3H3VC 1SYFA 1SDFA 1SAPA 5BN3A 2ZTEA 2NVYB 1DYQA 3S15B 3PO2H 3T1YQ 1K8OA 4XXEA 3H0GG 3NTIA 2HHHQ 4B9XA 1B2TA 1X32A 4BBSH 3PUZA 1STAA 2K01A 1R4PB 5TSSA 4LF9Q 2WINB 5ELCA 1JJ2A 1HZCA 2JA8G 2ZM6Q 4P73A 2VUMB 3E6ZX 4IJLA 3I8ZA 4B3TL 2F0QA 1UEBA 3K0XA 3MXUA 1Q82C 2RHSB 5IYBG 2J4XA 1H9MA 2L11A 1SEBD 5IT9c 4X64L 4RGNA 1JMCA 1B9MA 2I5LX 3EBEA 3KJOA 2A8VA 5AJ3Q 3MFYA 3KJPA 2TSSA 3GTPH 2R61A 2Z4HA 1D6EC 2N78A 4DV4Q 1UE6A 3U4VA 2RCFA 1HQRD 4A3IB 2TMPA 4RAUC 1CUKA 3RN5A 3MTSA 2ATWA 1CSPA 2EE1A 3NBHB 2EY2A 4ZK9B 1WCMG 2I0QA 1RJTA 3GTQH 2WP8J 4A3DB 3C1FA 5FKAC 3S17H 3ULJA 4Z9CB 1PLFA 2WAQG 3A7AB 4IUPA 2WKCA 3G48A 2NVQB 4NKLA 3NPPA 2HT1A 1RCVD 4G7ZC 2CKZB 2HUGA 3HKSA 4A3KH 4DK3C 1DOLA 5KYLA 2K32A 4EVOA 2K5DA 3S24A 1AP0A 1IXRA 1B1ZA 1IZ6A 4L5QA 4N8X1 4DR4L 1BBUA 4RMFA 2MUYA 4JV5Q 5JJKA 1HUMA 1U4PA 3CW2C 4OXPA 2HCCA 2OQ0A 2E74C 4CKBA 5HGQA 1GUNA 2KOLA 1XNQQ 1XPRA 3HKZE 1ESFA 4YCUA 2E2IB 3K0YA 1AE3A 1HTLD 1X3FA 4AYBG 4GNXC 2FJ2A 5C0XG 1XPUA 2CFMA 4NP5A 3SE0A 2OQKA 2JA5G 1Y1WB 4GKJL 1IBLL 4LF8Q 2L4NA 2I5HA 1B7YB 5EQ0A 1DJRD 5FLMH 1AZPA 2F3IA 2LS01 1ZKOA 2XSCA 2E75C 4OX9L 1LT4D 3FRPB 3VYTA 3I55A 2MNAA 1VQ4A 4H02A 3CC2A 3KBGA 1TR5A 2Y0SE 1RD9D 3MWYW 1R9TB 1S72A 5K36G 5CV7A 2Q2IA 5IOCA 1SMXA 5AFWA 3PIOA 1WI5A 4B3SL 4DUZL 2K75A 5LMUQ 1F9RA 1O80A 2VB3X 4K6LA 2NVTH 4X64Q 4XQQA 3BDLA 2NB0A 1B3QA 1EY4A 4C56C 3OMCA 5JEAH 3D4WA 2BE5D 4QY7A 1VS0A 3I7FA 2AMCB 3DWQA 1IBLQ 3HS0C 2HIXA 2NUCA 4B3ML 5IYDG 3H3VI 2ZTCA 3GV3A 1A3UA 1STYA 4OONA 3UI2A 2IHEA 2L0CA 4GOPB 4K5WA 5EKKA 1T5EA 5IYCG 1VQ7A 4JI2Q 1EYCA 1EY8A 2AUJD 2JEBI 1ZYRC 1STHA 4LUZA 1OXTA 4CHTB 1GOZA 1EZ8A 1HJPA 3LX0A 3D6CA 1JOKA 2YV5A 3J7A5 3N52A 3R2IA 4DAYB 1F77A 4Y52H 1QVGA 3AMUA 4X6AH 4A93H 2PQAA 1VQMA 3EJIA 1S40A 1LTLA 1YVCA 1YZ6A 4MTNA 3RZDH 4DR4Q 3EIVA 1ET6A 1SBBB 3A5UA 4JI5Q 1HPCA 1WCMB 3PF4A 3D31A 1YJNA 2JEAI 3GTMH 2PQAB 3MEFA 2B2UC 3AQQA 5LMNQ 4DAYA 4KHVA 1RTNA 2PQEA 3NE5B 1KAWA 1PTOB 2ICIA 1TWHH 1CKNA 4XTCS 4RCOA 4AYBE 4B3MQ 3QOLA 2E5LL 3W5OA 1JT8A 1IYUA 1PH5A 1X65A 3T51B 4YHHQ 3Q6SA 1YBYA 2M2LA 3NSWA 4HEDA 5IGDA 2DNCA 1EEFD 1S3OA 2K7VA 2G5DA 2OEOA 2PO4A 2LY7A 3RUZA 4K2LA 3VYRA 3KLSA 5EGTA 5IP9H 2KCTA 2QGQA 1PV4A 4ZCKA 3QWNA 1VQEA 1N33L 3HEJA 2DUDA 3T13A 5EKLA 3OPOA 3OOCA 3E3XA 2VW9A 1HNXL 1MHWC 3GTJH 1T9HA 5IYCH 4H7BA 3I4NH 4RKLA 5KRUA 2RDFA 1G8ZD 2EIFA 3K7AB 2WAQE 2LKVA 4QIWB 2DY7A 3TP7A 5LMNL 2AQ3B 2PMZB 1KL9A 4TRDA 2B63G 3K5OA 2X6LA 2F0FA 2JA7H 1QZHA 5COYA 4A3CH 4OWXB 4IURA 4K0KQ 4A3GB 1PXUA 1UWVA 1RIPA 4X66L 4U673 1GM5A 1JR0D 1J5EQ 5CYUA 1PH3A 2JA9A 4GN5A 4Q0FA 4LJZC 3W1BA 2DN8A 2HD3A 4RGMA 3H0GH 1D5XC 3CCEA 4FXKC 2B8GA 4CDCC 4LFCL 4QL5A 4BBSG 4RFBA 4PG3A 3RR5A 1BCPF 2PNHA 5IT9L 1F9SA 1NMGA 4LNQA 3CP0A 3BJUA 1VQ6A 1LTBD 1A3VA 3J81E 1ASYA 5CV4A 4X3UA 5EPLA 2FHTA 1MSHA 5CGKA 4KJNA 4R4CA 5IP9G 3K58A 1TWGH 1GKHA 4BY1G 3GTGB 5JJZA 2QA4A 3EFXD 2ZJQA 5A35A 1JB3A 1YNJC 4GKKQ 4DV4L 1QWYA 1FJGQ 1Y14B 1Q46A 2A6HD 1EWCA 2K28A 1J5EL 3TS2A 1FNVA 4K14A 5F2DA 1XJVA 1Q81C 4BBSB 3SK6A 1B44D 1EFID 1QJOA 3K5LA 4DR7L 2IX0A 2RKSA 5M3MG 1LABA 1KDAA 3KF8A 1FYCA 1HFGA 3NBHA 5BR8L 3TDQA 5DLQE 1GUTA 4IUUA 1AZQA 2GA4B 1KRTA 2CHBD 2O4XA 4N9TA 4C3JG 1SLJA 1MBYA 2F0OA 5I9OA 2B2WA 2JN4A 4IPGA 4DV6L 2WB1E 2RQXA 3BZCA 3BVZA 3S1RB 1TS5A 5EBDA 1JJGA 1TU2B 3DWPA 1KNAA 5KEEA 2R7FA 3OHXC 1K73C 4IOAA 2E76C 3D6WA 5E3FA 4U68A 1FNUA 2QEJC 3ONAB 3W3AA 4NXMQ 4FF1A 3S15H 2KVMA 3KUPA 3PO3H 4DR7Q 4DV2L 3T1HQ 1TWHB 3P20A 1EEID 4A3MG 3KDFB 4KN4C 1CSQA 4DK6C 1EY7A 1KDBA 3I56A 5DM63 3ITPA 1LACA 1SNDA 2QF7A 2R92H 2QKIC 2KHIA 1I3QB 1E0BA 1I6HH 4QF4A 3MVVA 1U4LA 1SFOB 2VB2X 2VUMH 1TWCB 3A0JA 1O7ZA 5G3LF 4LF6Q 3AEVA 1WJJA 4QCLA 2D9UA 2A73B 3GTGH 1HZAA 2ZT9C 2L1BA 1C8CA 2BDNA 1F9QA 1WD0A 3M4OH 5C0XJ 2KHJA 4DNTB 2DJGC 2F1MA 2D0PA 4IOCA 2C9OA 1K3BC 1BKBA 3CKIB 4C3HB 1QOHA 3OW7A 2E2HB 1C4QA 2BE5C 3PF5A 3OIQA 4C1NK 3QIAA 1Z6HA 1TXYA 4NMZA 1WTRA 4MNOA 1WTPA 3S1RH 5D3DA 3J80E 5D14A 1FJGL 2ID0A 1PRTF 2E8GA 2SEBD 4X62Q 1PHJA 1VQJA 3UDFA 4A3FH 1IBMQ 1Y69U 1VQ8A 1BUVT 2LXKA 1ASZA 1AEXA 1SYGA 3TEHB 3TMEA 1V1OA 1IYJB 2V4DA 1YHQA 3HOVH 2ZXOA 1PRTD 2NN6G 1NNXA 4JI2L 1MJCA 1DM0B 2L9HA 1NE3A 2UXBL 2PZTA 5BN5A 4P74A 1UAPA 4H13C 1HR0L 4HAEA 1K0SA 1SYEA 3OW2A 1Q8KA 3J81L 3SK8A 4DV5L 1SNOA 3URYA 5C5MA 4YCVA 3S1MH 1S5CD 4KK7A 5DAUA 4BBRG 1X3GA 4UAIA 3CCUA 5KIXA 2F4VL 1QNUA 3D4DA 4JC0A 3V05A 1NBWA 1HZ9A 5E1FA 5ELNA 2K50A 4L5RC 4IFDJ 4KY7A 3Q24A 2PYKA 4JI4Q 3W1GA 4DPGA 4DV7L 3STBD 2RHQB 3JAMc 1LV9A 4GN3B 1WD1A 4NXML 1A2UA 1XMQL 3BVGA 4IZ8A 2E5LQ 2H4OA 4WRDA 4DR2L 2HIVA 1JOOA 2R7ZB 2QILA 2NWGA 1SMYD 5CMDA 5JAVA 3CCVA 4IUTA 5I6WA 4K6DA 3SGIA 1MIUA 2IT1A 3AFQA 3TSSA 1LTID 1Y1VB 4Q5VA 4DV0L 3S2HB 1DCZA 1W2BA 5KGUA 2IHFA 4RH6A 2WV6D 3J7AV 2J0TD 5IYBH 1RDPD 2K1BA 2NN6H 4JV5L 3Q0AA 4AH6A 1H9RA 2KHSA 2UU9Q 1YNNC 1VQPA 2JA5B 1F2LA 1HR0W 2L12A 2CCZA 5C44G 1EY6A 4A3FB 3HRZC 1ICWA 4DV7Q 1IW7C 1N34Q 4BS9A 4QUFA 4DR1L 2EDGA 1Q8IA 2F0SA 1FNWA 3GTQB 3S2DB 5KNDA 5C4XH 2LMCB 4HCSA 2K14A 2B2YA 2EXDA 4DR3Q 1C0AA 2Z6BA 1JORA 4A3CG 1B3AA 4HIMA 4IPHA 3PO2B 1WVLA 4XIGS 2E2JH 2JA6H 2DGYA 5C3EB 2JA8B 1Z7TA 3E5SA 1E2VA 3IFTA 3P75A 3IKJA 1YI2A 4HJ9A 5GADC 3PO2G 1KLUD 2EJFC 1HCZA 3MEHA 4G7OC 3F2DA 2D0OA 2UXBQ 4EQNA 4ZQ3A 3L0OA 5L37A 1VQOA 1EIGA 4ZLTF 4AQYL 4A3BB 3HOWG 3SK4A 4FDBA 1UE7A 4KV6A 4A3FG 4UP8A 4ULLA 3G4SA 1N34L 2HDMA 3R8BA 5IP7G 3HOWB 3U4ZA 1L2FA 3PUWA 3S1QH 1FGUA 1CZGA 2MPMA 1ENAA 3E0EA 3S16B 2NZ1D 4LW1A 1XMOL 3MHBA 1PFMA 1NR4A 5FLXc 1Z9FA 2UUBQ 3ND9A 1KABA 1I50B 3OYYA 4R4OA 5ELEA 4BWGB 4DR2Q 1N36Q 2PI2E 4CGYB 1I4PA 3GTLH 1EQRA 3OTOQ 4XQJA 1TVXA 4PMWA 4LF9L 3SK5A 3E9HA 3J80L 4IQZA 1C7YA 4HIOA 1KIXA 4LFBL 1IBKL 2EYLA 4C3JB 1D5ZC 1PH1A 2PCFB 3BYTB 4HJAA 4NXNQ 3MZ5A 5C44B 3ERQA 1HNWQ 1N32L 4NB3A 4PZ8A 4XT3B 5M5YH 3S1MB 4O0AA 3TP5A 1U4MA 4A3MB 3I73A 4JI7Q 4JI0L 4B9WA 3M85A 2H1EA 2EOTA 3ERSX 5C4HA 1SNQA 1CKMA 1EY9A 3HOWH 2OTJA 3NELA 3PIPA 1TIID 4DR6Q 4PMCA 3K6OA 4GS3A 3QO2A 4WFN3 2B29A 4EQ5A 2B3GA 2JQOA 1BBXC 1E2ZA 3Q22A 3GTKH 4MN3A 1EU3A 3R2TA 5IWAQ 2XRQD 1LYLA 2O2LD 4LFBQ 1H95A 2HCIA 1S5BD 4KTAA 1BCPB 2Z9HA 3BDOA 4HJ7A 3QB3A 2WB1B 2WACA 2PPBC 1V8QA 2M9VA 1MGSA 1W6JA 1JQYD 1L0WA 1SMYC 5E4XA 3RD4A 2VQEL 4G57A 4HIKA 2WB1G 1HNXQ 1EIYB 1LTGD 2N8NA 3F2BA 1D2BA 2NTSA 1X6OA 3IL8A 1OXXK 4BBRB 5LMUL 4JI7L 3PUYA 4HR7B 4GOPA 1HQMC 2NZHA 3MXNA 4UPAA 1AFPA 5JVH3 4G7HC 1TT2A 1HFNA 4UP9A 5M5WH 2R93B 2KQ3A 5K36H 4MTKA 3E0JA 3GTLB 4JI8L 4FVMA 2XTIA 4DK1A 4GLXA 1ILPA 3VA7A 4DAPA 2MO0A 2WIIB 5CORA 2A6ED 5KNBA 4K8IA 2IL8A 1GJXA 5IWAL 3CQZH 3T56B 1KLGD 1HTPA 3K7UC 3H94A 4B3TQ 2JA8H 2MO1A 4GKJQ 3CCMA 1TWFB 3CRKC 1I94L 3J7AF 3MA2B 1H9SA 3A7LA 3SEBA 5FOBB 3QJYA 5CV9A 3EVQA 3CMEA 5FJ8G 1MSGA 1VQGA 4YCWA 1HR0Q 5EJWA 1E2WA 4ODGA 1HH2P 1AH9A 1PRTB 1MJEA 2JE6I 1UUPA 1SE2A 4FO2A 1JWMD 2F52A 5JOBA 2B63B 1ZYRD 4IPCA 4F88A 2E2IH 4BY7H 4MIUA 5C4ZA 3I4NG 2EJMA 4J1MA 1FL0A 2F0VA 3GO5A 1MD2D 3KLWA 3A55A 1QZGA 4JI4L 5HURA 4N9PA 4PMBA 1LTTD 2R7ZG 4BBRH 4A3GG 2AHOB 3NQIA 3S16H 1TWAH 1DD2A 3FPPA 3CCSA 1HA6A 4JBWA 4YIJA 1ML0D 2HHHL 2Y0SB 4YHHL 4RHRA 1N8RC 1YHAA 3DUZA 1D1IA 1F9PA 1V1PB 2Q8RE 4OO1I 4OO1G 4LMQD 2AQ1B 1D5MC 2EYPA 2Z4IA 2K4KA 4IFDI 1VQBA 1M4VA 2K5HA 4DN4M 1FGBD 1E22A 5CR3A 3H91A 1XPOA 2Q2HA 4QB4A 5M5XB 4DA2A 1D8LA 1TQOA 4C2MB 1BXTA 3DHQA 5D65A 2PZUA 3NP8A 1TWCH 3KFUA 1JE5A 4ZRZA 4KD4A 3M4YA 4PQXA 1VF5C 1KAAA 1WTXA 4BY1B 4KY6A 2F0EA 1YJWA 2VNUD 1DGSA 1L1OC 1KHIA 3CC7A 1E1OA 5IGCA 4JOIA 3KOJA 2J7ZA 3CRLC 4OHJA 2B2TC 2Z1CA 1YNND 5IGGA 2EYJA 1UE1A 3RZOH 3TN2A 2IX3A 4MZ9A 1OXUA 4ID6A 4Y7NH 2QW7A 5I6YA 3LGJA 2JA7B 2EYMA 4RCNA 4TVAB 3OMGA 2FFKB 3LWEA 4ILWA 4ZYSA 4A3GH 1KQSA 3Q23A 5FLXE 2D5DA 1QE6A 2CWPA 3HOYH 1E1TA 1PH8A 2RSOA 2JA6G 4RHSA 2HQLA 3S2HH 3SDZA 2VQFQ 3L2PA 2EY5A 4L5SA 2PW5A 2ZJPA 3CPFA 1STEA 3GV6A 1FR3A 1SE3A 4C3JH 1UNSA 1VQ5A 4POGA 1X56A 3NTKA 1EQQA 2UXDQ 1A6XA 2CVRA 3C2PA 2VY3A 4P75A 4YWLA 2B2TA 3KDFA 4I7AA 3NHHA 1CK1A 1EFWA 4BA2I 2NVTB 1SROA 3VA5A 2K5QA 4DV1L 1XNQL 4GNXA 3H09A 3UDIA 1G91A 4N8FA 3KYHC 4BXXG 1PTOC 1KRSA 1GD7A 1HNZQ 3I91A 2UUAL 2UUBL 2XIWA 4DGZA 2D62A 2E2JB 3TS0A 1T5XD 4QQBX 5E4WC 3F2CA 3SXHA 3HOUB 3RZOB 2UXCQ 2NVXB 1FD7D 4DU9A 4A3BG 1DZ1A 1PDQA 4DUYQ 4A75A 3T53B 4QIWE 2KEEA 2MJ8A 5M9OA 2Q2UA 4R4IA 2R7ZH 4JCVE 3OWFA 4OELB 1G2SA 3HOXG 2YU9B 5C3XA 1VQIA 2R93G 3MXGA 2UXDL 2I07B 4A76A 4LK1C 5EBCA 4FXGC 1Y8PB 4J15A 3VYUA 2F4VQ 1HNWL 1N32Q 4B08A 4DUZQ 4A93B 3HOYG 3S1NH 1BOSA 1WTHA 4POFA 4A3LH 2ENBA 2QDBA 1F2ZA 4XDXA 2F0DA 5C4JB 1CKOA 1PH7A 3I72A 3GTPB 4M8AA 2BA1A 3A56A 3NENA 1UEAB 3T1HL 1LLRD 4O42A 3CCRA 1SNPA 2MGSA 4XYOA 4YY3L 1SN8A 2ICEC 1WTOA 1I4HA 2A19A 1VMPA 2JA6B 4E6IA 4DXGA 5KYIA 4FNFA 4LUVA 5K5PA 4WJ3M 2I5MX 3ER0A 4S3SA 3A74A 4FF2A 3JAME 3I4MB 2A69C 3Q8DA 3FDTA 1VQDA 4JPBW 1P16A 3F2UA 1EUJA 1Q1EA 3N6RA 1R9TH 3J81i 2CW0D 1MKHA 1EWIA 2FINB 3SR1A 1I3QH 2WAQB 1I6HB 3HGBA 4KHZA 4L5TA 2VUMG 1K83B 3ZJYC 2B2VA 3M9BA 5JJLA 1TY2A 1QNKA 3JC66 2UUCL 1SNMA 4A93G 2YTVA 3C46A 5DM73 2JA7G 4C3HH 1QUQB 2NVYH 3PMFA 4AIMA 3HOZH 3J81j 1B53A 1DXMA 1EY5A 1EIHA 4X66Q 3RLNA 1JJCB 1NMFA 3A8KE 4DR3L 1L0XB 1BVSA 2IW3A 2PZWA 2SNSA 4OIKA 1CZWA 4CDEC 2SDFA 1HNZL 3CU7A 3VYSA 1S4ZA 1DOMA 4L6TB 5ELOA 1CTMA 3EQLC 3NXWA 2JSOA 2AUKA 2PNRC 4C3IH 4DNRB 2OT2A 4RA8A 5C3EG 1ET9A 3D4RA 4V190 1L0YB 1L1OB 2RDHA 3K5NA 4DUYL 3QR8A 4K8JA 1B9NA 1GUGA 4O1NA 2F0LA 1VDZA 4A3EH 2K05A 3B6YA 4LF6L 4ZKCB 2R6GA 2BOSA 1VQFA 4LF7L 1KNEA 5GROA 2R7DA 1ICFB 1SRUA 3FVQA 4K5XA 3ND8A 1JCKB 3KLRA 4QJFA 1PTOF 1AW7A 3CF5A 3ULPA 2FMCA 4A3DG 3RZDB 3NK9A 4FF3A 3MXNB 4EX5A 5H1SE 5GQOA 2DNEA 3OSOA 3DM3A 3TP8A 2F0NA 2XWJB 5ELBA 2A74C 2F3WA 3TBIB 2HDLA 1SE8A 3RLOA 3S17B 1AE2A 1XX8A 1PH6A 1PH4A 4V0BA 4YWMA 3CD6A 2JK8A 1DOKA 5C4XG 5FLMG 2XWBB 1PMRA 2B2WC 1CQVA 1PZJD 4LUOA 5LMNW 4C3HG 1BDOA 2Z6KA 5EPJA 3TREA 5C5LA 2AQ2B 3A8JE 4F8MA 4A3JH 3W2DA 3U50C 1IL8A 2NYZD 1YIJA 5FO8B 1G2TA 1EL0A 2RVLA 1GO3E 1VF7A 4KLKA 2KJXA 5M3FG 1TS4A 4A3KG 3ZYYX 5IGFA 5DEHA 3I90A 4KHPL 2AWOA 4LAAA 3IAYA 5KNCA 3D8GA 1GVPA 1XNRQ 1VQLA 2K03A 4RKBA 3CC4A 4JG2A 4B3RL 1LO5D 3L9AX 1BR9A 3GTOB 3CXCA 4G4KA 5GAEC 1P8LA 4CDDC 5HY6A 3U9OA 2K33A 1SYDA 2HQEA 1PFBA 3G6EA 1M8AA 4TKOB 5JEAJ 2EYFA 4OIJA 4XQNA 1A3TA 3H3VH 3BYYB 5IGEA 2GN5A 4PNYA 1CM9A 4K5VA 1BCPC 5CBEE 3G6JB 2P5ZX 1JB7A 3GDEA 4DR5L 3R3OA 4IFDG 4JYAL 3GD7A 1LT3D 4WJWA 2ZM6L 3M3YB 3E9IA 1F2MA 2F0WA 3WOFA 2VXWA 1SSOA 1PH9A 2MQHA 1I4RA 4GLVB 3CCLA 2NVXH 4LF8L 4DXFA 1XTDA 1WTVA 1G6PA 5BR8Q 5M3MH 1LUZA 1ZXTA 2BDOA 2OXPA 4OL7A 4A3IG 1SJHD 1QVCA 1V1PA 2SOBA 1UE5A 1K9MC 2VS1A 1B50A 3H15A 2F0MA 4IUNA 3VDYA 1G6ZA 4AQYQ 1S5FD 1YITA 2C5CA 3JAMi 3DWAA 1XXGA 3ICEA 1OO9B 5I2YA 2I46A 4R4QA 2CW0C 2B2VC 3TZUA 1J6QA 4DV1Q 2L55A 3F8TA 4JOIC 4EQOA 1XMOQ 3MC0B 4O2DA 4X62L 5A2QL 3NWTA 1KTKA 2FXQA 1V43A 4X3TA 1EQTA 1MI2A 3I4MG 4A3EG 1JWUD 4R4TA 4DR1Q 5C4JH 4A3JB 2B2UA 2KUMA 1RTOA 1CA5A 1DONA 4DFAA 3FKIH 4JK1C 1N36L 2Q8TA 3G7LA 4CBVA 2WFWA 3STBC 1ENFA 4FP5D 2CWAA 2KCNA 2N49A 2OTLA 3K81C 2A68D 4LFAL 1GHKA 1O78A 3RNUA 3I4OA 2XN9C 3HKZB 2V1CC 1Y1WH 1YJ9A 2A5HA 5DNFA 4IN3A 1IW7D 1IBKQ 5JPNC 2RF4A 4X65Q 1CQFA 1IHZA 2YYZA 1K8AC 1CHQD 1X54A 3PIP3 3L3OC 4P71A 4ABNA 1X3QA 1QCBD 1TS2A 2RSNA 3H6MA 4GZYC 1LTAD 4DNIA 2O5JC 5GAGC 1I4QA 1WCMH 2VL6A 4A3IH 2R3ZA 3TRZA 3GTMB 1E24A 4A3JG 5AJ3L 5I9PA 1VQCA 4JI5L 2KA7A 1VQKA 2K04A 2IJ0A 1RKNA 2EJGC 2LSSA 4PZ7A 3S2DH 4EQPA 2K5VA 2MP1A 4A3LG 1PZKD 3QOJA 1O7YA 1S5ED 1RHPA 1VMCA 5I4DA 1EY0A 3UE0A 1ENCA 2C35B 5CV8A 5J39A 4GOPC 1CI3M 4LFAQ 1GUSA 2Z8LA 2ASBA 2K6AA 1K3RA 1EYAA 2A69D 5JVG3 4DV3L 4C3IB 3J81c 4KKSA 4UHVA 4A4IA 5CC4A 2F3VA 3KBXA 1KXLA 4OGQC 3AU7A 1TY0A 3PGZA 3MAQA 3HOVG 1II3A 1NAPA 2YU9H 1SE4A 1GHJA 1G51A 1K8MA 2VQEQ 2H5XA 3M4PA 2UU9L 3NBIA 2F0JA 3GTJB 3I4NB 2B2YC 2EXZA 3RN2A 3RMHA 4IFDH 3K57A 2D2CC 5C0XH 3RLFA 2X69A 2VZAA 4QMGA 3GTOH 1OXSC 5CV6A 1KD1C 4R8IA 2A1AA 3A5ZB 1WOCA 4CJ0B 4XT1B 3CMAA 4JI3L 1XTCD 1U9RA 1PYSB 1S5DD 4JI0Q 3TP6A 5LHY1 3A54A 4NDXA 1JICA 2OF1A 3GP7A 4JI6Q 1STGA 3CCJA 1WFQA 2RA4A 3K8AA 4HIDA 2OCEA 3BU2A 1XMQQ 2CH4A 1F2YA 4DV3Q 2F0HA 3AFPA 1WTQA 3DLLA 2R92B 1Q86C 3CPWA 1I94Q 5JJIA 3CQZB 2K5NA 3I3CA 2CQAA 4CKCA 1EIFA 3R93A 5IT9E 5C3EH 2K52A 4NW2A 4DV0Q 3K80C 2EQSA 4HSPA 4X65L 1B8AA 4HN7A 4LFCQ 2LXJA 3MXPA 3CCQA 1PVOA 2ZTDA 4HTHA 3I70A 2NVQH 3AB9A 3KF8B 4DV6Q 4K2KA 4HSVA 3GQBA 4B3SQ 1TWGB 2F03A 5IP7H 4JVZA 4M1UB 3HZXA 3FP9A 3HOUG 5HGTA 4H0LC 1OTCA 2ES2A 1NY4A 1R4QB 3J80i 2Z0SA 3HKZG 4GKKL 5ELFA 4DV2Q 2RCNA 1W3SA 1W6KA 2N3SA 3BZKA 3LNNA 2QEXA 1A62A 1EOTA 5C0XI 2XVSA 2F0GA 2GVBA 5J3BA 3FKIB 3PUXA 4J6HA 4HMIA 2JYOA 1HZBA 4JBMA 1QVFA 3HOYB 1QB5D 1LT5D 3P1HA 2RDGA 5D3IB 3BS1A 1BO0A 4UY8C 1PRTC 3HOZG 1Y8OB 1U0LA 3DMUA 1IKLA 3CHBD 1E7ZA 4NXNL 4LF5L 4HCEA 2K5WA 1BBWA 2M00A 1B4OA 1WTWA 1ZEQX 1YEZA 2G9HD 1EWHA 4KI0A 2NZOA 5LL6X 2IY5B 3J80c 2E2DC 3U58A 3JAML 3DXJC 2B8FA 3C3LA 2ZXPA 1GXDC 3PO3B 4X3SA 4C2MH 4DAMA 1STNA 4IALA 4DR6L 3QG1A 1A0IA 3LWUA 5IODA 4LF4Q 3IRBA 3X3NA 1EU4A 5J22A 1HA5A 4YY3Q 2EY1A 3V2TA 3PO3G 1D7QA 4ZKBB 2QDLA 1M1KC 1A2TA 4A3DH 1K0RA 1J9OA 1NUCA 3V96A 1G291 4F87A 3SVMA 3J7YW 1EZ6A 4P2CB 3PCOB 2A6EC 4Y7NB 3O13A 3PV0A 1QUQA 2EVBA 3PIO3 2KBNA 3FHWA 3OTOL 3U9SA 4MHEA 4LF5Q 2XGTA 2QCPX 3D0FA 1YNXA 2VQFL 1C48A 1PH2A 3NWSA 2AKWB 3HG9A 4JW0A 1NR2A 1H9KA 2KCCA 3X3MA 4OX9Q 5NUCA 4PZ6A 1QG7A 5EKIA 4PV1C 3KF6A 3IFDA 3M7NA 1B70B 4DV5Q 4UDUC 3VR3A 1JE4A 1C9OA 2YTXA 5FO9B 3PUVA 2E2HH 2ZXRA 4IUQA 1K28A 4ME3A 2F4IA 3S1QB 5IGBA 1VQHA 4NPSA 3S14B 1YNJD 3EROA 1LM0A 1LTRD 3BG3A 1CA6A 4C1NI 3KLSX 5M3FH 1EOVA 4RWSC 2CH4W 3EA6A 3NUCA 2MFIA 2UUAQ 3T1YL 4QUCA 1CT1D 5CV5A 1LTSD 3HP3A 2ALYB 5EPKA 5G3LD 2JP1A 4GN4B 2IX1A 1STBA 1GUWA 4OEMB 2NN6I 3F1ZA 1PYWD 1KDCA 2UXCL 2EYOA 3I4MH 1PZID 1PYBA 1IBML 1RODA 3TQYA 3FKIG 1SFOH 1TS3A 4GNXB 5M3MB 3HOUH 1TWFH 3VR2A 4GLAC 4AYBB 1Y8NB 4XYQA 1EYDA 3HOXB 4LF7Q 1JOQA 3KK7A 1YHBA 1TKWB 4BY1H 1SYCA 1I5FA 3NEMA 4A3BH 4KJOA 5C6AA 4HJ5A 4TSSA 2EPBA 4TQUS 5C44H 2F0UA 3NQTA 4RGOS 4KMUC 4J8QA 1IYVA 4L63B 3DEPA 4BY7G 1SR3A 1Q90A 2B63H 4KKUA 3VR5A 1U4RA 2EY6A 3M7GA 5IY0A 2F0PA 4CJ1B 1O7LA 4IUVA 1RL2A 3FEWX 1A8VA 3K7AH 2ZJRA 1NJIC 2MHVA 4JI8Q 2X6GA 2EZVA 4LF4L 1PA6A 2OWOA 3S14H 4DKAC 1Q12A 1O7IA 1X3EA 5FK9C 4DK0A 3WOEA 3BZDB 3DEOA 1L1OA 5J1ZA 1TWAB 2AWNA 3DM1A 4EGVA 1ESRA 4OO1H 1NSNS 4R8NA 1HXYD 1PFSA 4DAVA 1GUOA 3PQIA 3GTKB 3M3YH 4C3IG 4KY5A 3VR4A 2WKDA 2BA0A 3FMCA 3VR6A 1ONLA 4CDFC 1VQAA 2F0KA 4QGUA 2DJFC 1OXVA 5LL6S 5C3WA 3J7ZC 1E3PA 3H0GB 2G9DA 2KENA 1Z47A 3FPUB 3P7JA 1V9PA 2CQOA 1XNRL 4F7XA 4R9WA 3OWEB 1A63A 3NTHA 5T1IA 1FVIA 4RGTA 2UUCQ 3G71A 2L15A 4X3KA 4FYDA 5IYDH 3S9WA 3WDNA 2Y0SG 1NTGA 2IWHA 1VQ9A 3L7ZC 2SNMA 2GVAA 4YWKA 4A3MH 3ULLA 3UDGA 2BH2A 1X9NA 5C4XB 1PTOH 1M90C 1IKMA 5EAYA 2LFNA 5ISRA 4JI6L 4L8JA 5T1GA 3HOZB 4K0KL 4DR5Q 4JYAQ 2F0TA 1VQNA 2RBMA 2YTYA 1IL2A 1EQVA 4IJHA 4FXDA 1SJED 1U5KA 5I2XA 4JBJA
chains in the Genus database with same CATH topology
1MHWC 4CDFC 4OEMB 2DJGC 1ICFB 4OELB 4CDDC 4CDCC 2DJFC 4CDEC 1K3BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHW C;  4CDF C;  4OEM B;  2DJG C;  1ICF B;  4OEL B;  4CDD C;  4CDC C;  2DJF C;  4CDE C;  1K3B C; 
#chains in the Genus database with same CATH topology
 2Q2T A;  1NCV A;  3I2Z A;  4HJ8 A;  4H44 C;  2KEC A;  1Q3L A;  4JI1 Q;  1HRJ A;  1HHV A;  1BQQ T;  3KF6 B;  1HUN A;  1EYG A;  4LWC A;  5GAH C;  3D3R A;  3S1N B;  5E7N A;  1Q1B A;  1PTO D;  2N88 A;  4I65 A;  5JEA G;  1K8G A;  1WYD A;  2BH8 A;  1JWS D;  3OIP A;  4RG1 A;  3WWV A;  1JC7 A;  1H9S B;  1Q7Y C;  4UP7 A;  3BDC A;  1Y1V G;  3C1E A;  4WOR A;  5M5W B;  3HOV B;  1N9W A;  1PFN A;  4IO9 A;  1I4X A;  1SXT A;  1X55 A;  3PSI A;  5FO7 B;  4CKE A;  2R92 G;  1X3P A;  2XNA C;  1SNC A;  4BA1 I;  4R1J A;  2L5T A;  4ALP A;  2EYH A;  2Z6K C;  3CAM A;  2XRS D;  4KN7 C;  3BVM A;  1XYI A;  4JI1 L;  4I7Z C;  3UDX A;  2PI2 A;  3HFZ B;  2IPK D;  5IIF A;  5JPM C;  3T16 A;  2JXM B;  3TZD A;  4A3K B;  3HOX H;  1K83 H;  5M5Y B;  5BN4 A;  4OWW B;  1CHP D;  4KHP Q;  1V1Q A;  4FF4 A;  3K59 A;  2NTT A;  4OWT B;  2FMM A;  1QIL A;  2F0I A;  2Q8I B;  1CFM A;  2NBF A;  3M4O B;  1CKN B;  3I4L A;  2JJQ A;  5FLX L;  1H9J A;  3K5M A;  1LT6 D;  4BY7 B;  1KC8 C;  4ZAI A;  3T4A C;  3EN2 A;  4JBK A;  2N55 A;  5IE8 A;  2BCO A;  2A68 C;  2O5I C;  1XWE A;  2PMZ E;  5M3F B;  1BNZ A;  5CBA E;  3SHL A;  1BF4 A;  5A2Q E;  4WJ4 A;  1A15 A;  4KD3 A;  4BXX H;  3UE1 A;  2PW7 A;  5ELD A;  2A6H C;  1ILQ A;  3MFG A;  1Y1V H;  4HMJ A;  2KCM A;  1I50 H;  5FJ8 H;  3A8I E;  4DF7 A;  5M5X H;  1Y1W G;  4ME5 A;  4A3E B;  1SYB A;  1N33 Q;  3AYH B;  4APV A;  1AN8 A;  1RF2 D;  4IPD A;  4ZUJ A;  4P72 A;  1D1K A;  2KED A;  2JA5 H;  2R93 H;  1VCI A;  1I4G A;  4CJ2 C;  1BCP D;  4KKT A;  2DY8 A;  3M4Q A;  2B39 A;  4JI3 Q;  1J8I A;  1I6V C;  4ZUI A;  4B3R Q;  3H3V C;  1SYF A;  1SDF A;  1SAP A;  5BN3 A;  2ZTE A;  2NVY B;  1DYQ A;  3S15 B;  3PO2 H;  3T1Y Q;  1K8O A;  4XXE A;  3H0G G;  3NTI A;  2HHH Q;  4B9X A;  1B2T A;  1X32 A;  4BBS H;  3PUZ A;  1STA A;  2K01 A;  1R4P B;  5TSS A;  4LF9 Q;  2WIN B;  5ELC A;  1JJ2 A;  1HZC A;  2JA8 G;  2ZM6 Q;  4P73 A;  2VUM B;  3E6Z X;  4IJL A;  3I8Z A;  4B3T L;  2F0Q A;  1UEB A;  3K0X A;  3MXU A;  1Q82 C;  2RHS B;  5IYB G;  2J4X A;  1H9M A;  2L11 A;  1SEB D;  5IT9 c;  4X64 L;  4RGN A;  1JMC A;  1B9M A;  2I5L X;  3EBE A;  3KJO A;  2A8V A;  5AJ3 Q;  3MFY A;  3KJP A;  2TSS A;  3GTP H;  2R61 A;  2Z4H A;  1D6E C;  2N78 A;  4DV4 Q;  1UE6 A;  3U4V A;  2RCF A;  1HQR D;  4A3I B;  2TMP A;  4RAU C;  1CUK A;  3RN5 A;  3MTS A;  2ATW A;  1CSP A;  2EE1 A;  3NBH B;  2EY2 A;  4ZK9 B;  1WCM G;  2I0Q A;  1RJT A;  3GTQ H;  2WP8 J;  4A3D B;  3C1F A;  5FKA C;  3S17 H;  3ULJ A;  4Z9C B;  1PLF A;  2WAQ G;  3A7A B;  4IUP A;  2WKC A;  3G48 A;  2NVQ B;  4NKL A;  3NPP A;  2HT1 A;  1RCV D;  4G7Z C;  2CKZ B;  2HUG A;  3HKS A;  4A3K H;  4DK3 C;  1DOL A;  5KYL A;  2K32 A;  4EVO A;  2K5D A;  3S24 A;  1AP0 A;  1IXR A;  1B1Z A;  1IZ6 A;  4L5Q A;  4N8X 1;  4DR4 L;  1BBU A;  4RMF A;  2MUY A;  4JV5 Q;  5JJK A;  1HUM A;  1U4P A;  3CW2 C;  4OXP A;  2HCC A;  2OQ0 A;  2E74 C;  4CKB A;  5HGQ A;  1GUN A;  2KOL A;  1XNQ Q;  1XPR A;  3HKZ E;  1ESF A;  4YCU A;  2E2I B;  3K0Y A;  1AE3 A;  1HTL D;  1X3F A;  4AYB G;  4GNX C;  2FJ2 A;  5C0X G;  1XPU A;  2CFM A;  4NP5 A;  3SE0 A;  2OQK A;  2JA5 G;  1Y1W B;  4GKJ L;  1IBL L;  4LF8 Q;  2L4N A;  2I5H A;  1B7Y B;  5EQ0 A;  1DJR D;  5FLM H;  1AZP A;  2F3I A;  2LS0 1;  1ZKO A;  2XSC A;  2E75 C;  4OX9 L;  1LT4 D;  3FRP B;  3VYT A;  3I55 A;  2MNA A;  1VQ4 A;  4H02 A;  3CC2 A;  3KBG A;  1TR5 A;  2Y0S E;  1RD9 D;  3MWY W;  1R9T B;  1S72 A;  5K36 G;  5CV7 A;  2Q2I A;  5IOC A;  1SMX A;  5AFW A;  3PIO A;  1WI5 A;  4B3S L;  4DUZ L;  2K75 A;  5LMU Q;  1F9R A;  1O80 A;  2VB3 X;  4K6L A;  2NVT H;  4X64 Q;  4XQQ A;  3BDL A;  2NB0 A;  1B3Q A;  1EY4 A;  4C56 C;  3OMC A;  5JEA H;  3D4W A;  2BE5 D;  4QY7 A;  1VS0 A;  3I7F A;  2AMC B;  3DWQ A;  1IBL Q;  3HS0 C;  2HIX A;  2NUC A;  4B3M L;  5IYD G;  3H3V I;  2ZTC A;  3GV3 A;  1A3U A;  1STY A;  4OON A;  3UI2 A;  2IHE A;  2L0C A;  4GOP B;  4K5W A;  5EKK A;  1T5E A;  5IYC G;  1VQ7 A;  4JI2 Q;  1EYC A;  1EY8 A;  2AUJ D;  2JEB I;  1ZYR C;  1STH A;  4LUZ A;  1OXT A;  4CHT B;  1GOZ A;  1EZ8 A;  1HJP A;  3LX0 A;  3D6C A;  1JOK A;  2YV5 A;  3J7A 5;  3N52 A;  3R2I A;  4DAY B;  1F77 A;  4Y52 H;  1QVG A;  3AMU A;  4X6A H;  4A93 H;  2PQA A;  1VQM A;  3EJI A;  1S40 A;  1LTL A;  1YVC A;  1YZ6 A;  4MTN A;  3RZD H;  4DR4 Q;  3EIV A;  1ET6 A;  1SBB B;  3A5U A;  4JI5 Q;  1HPC A;  1WCM B;  3PF4 A;  3D31 A;  1YJN A;  2JEA I;  3GTM H;  2PQA B;  3MEF A;  2B2U C;  3AQQ A;  5LMN Q;  4DAY A;  4KHV A;  1RTN A;  2PQE A;  3NE5 B;  1KAW A;  1PTO B;  2ICI A;  1TWH H;  1CKN A;  4XTC S;  4RCO A;  4AYB E;  4B3M Q;  3QOL A;  2E5L L;  3W5O A;  1JT8 A;  1IYU A;  1PH5 A;  1X65 A;  3T51 B;  4YHH Q;  3Q6S A;  1YBY A;  2M2L A;  3NSW A;  4HED A;  5IGD A;  2DNC A;  1EEF D;  1S3O A;  2K7V A;  2G5D A;  2OEO A;  2PO4 A;  2LY7 A;  3RUZ A;  4K2L A;  3VYR A;  3KLS A;  5EGT A;  5IP9 H;  2KCT A;  2QGQ A;  1PV4 A;  4ZCK A;  3QWN A;  1VQE A;  1N33 L;  3HEJ A;  2DUD A;  3T13 A;  5EKL A;  3OPO A;  3OOC A;  3E3X A;  2VW9 A;  1HNX L;  1MHW C;  3GTJ H;  1T9H A;  5IYC H;  4H7B A;  3I4N H;  4RKL A;  5KRU A;  2RDF A;  1G8Z D;  2EIF A;  3K7A B;  2WAQ E;  2LKV A;  4QIW B;  2DY7 A;  3TP7 A;  5LMN L;  2AQ3 B;  2PMZ B;  1KL9 A;  4TRD A;  2B63 G;  3K5O A;  2X6L A;  2F0F A;  2JA7 H;  1QZH A;  5COY A;  4A3C H;  4OWX B;  4IUR A;  4K0K Q;  4A3G B;  1PXU A;  1UWV A;  1RIP A;  4X66 L;  4U67 3;  1GM5 A;  1JR0 D;  1J5E Q;  5CYU A;  1PH3 A;  2JA9 A;  4GN5 A;  4Q0F A;  4LJZ C;  3W1B A;  2DN8 A;  2HD3 A;  4RGM A;  3H0G H;  1D5X C;  3CCE A;  4FXK C;  2B8G A;  4CDC C;  4LFC L;  4QL5 A;  4BBS G;  4RFB A;  4PG3 A;  3RR5 A;  1BCP F;  2PNH A;  5IT9 L;  1F9S A;  1NMG A;  4LNQ A;  3CP0 A;  3BJU A;  1VQ6 A;  1LTB D;  1A3V A;  3J81 E;  1ASY A;  5CV4 A;  4X3U A;  5EPL A;  2FHT A;  1MSH A;  5CGK A;  4KJN A;  4R4C A;  5IP9 G;  3K58 A;  1TWG H;  1GKH A;  4BY1 G;  3GTG B;  5JJZ A;  2QA4 A;  3EFX D;  2ZJQ A;  5A35 A;  1JB3 A;  1YNJ C;  4GKK Q;  4DV4 L;  1QWY A;  1FJG Q;  1Y14 B;  1Q46 A;  2A6H D;  1EWC A;  2K28 A;  1J5E L;  3TS2 A;  1FNV A;  4K14 A;  5F2D A;  1XJV A;  1Q81 C;  4BBS B;  3SK6 A;  1B44 D;  1EFI D;  1QJO A;  3K5L A;  4DR7 L;  2IX0 A;  2RKS A;  5M3M G;  1LAB A;  1KDA A;  3KF8 A;  1FYC A;  1HFG A;  3NBH A;  5BR8 L;  3TDQ A;  5DLQ E;  1GUT A;  4IUU A;  1AZQ A;  2GA4 B;  1KRT A;  2CHB D;  2O4X A;  4N9T A;  4C3J G;  1SLJ A;  1MBY A;  2F0O A;  5I9O A;  2B2W A;  2JN4 A;  4IPG A;  4DV6 L;  2WB1 E;  2RQX A;  3BZC A;  3BVZ A;  3S1R B;  1TS5 A;  5EBD A;  1JJG A;  1TU2 B;  3DWP A;  1KNA A;  5KEE A;  2R7F A;  3OHX C;  1K73 C;  4IOA A;  2E76 C;  3D6W A;  5E3F A;  4U68 A;  1FNU A;  2QEJ C;  3ONA B;  3W3A A;  4NXM Q;  4FF1 A;  3S15 H;  2KVM A;  3KUP A;  3PO3 H;  4DR7 Q;  4DV2 L;  3T1H Q;  1TWH B;  3P20 A;  1EEI D;  4A3M G;  3KDF B;  4KN4 C;  1CSQ A;  4DK6 C;  1EY7 A;  1KDB A;  3I56 A;  5DM6 3;  3ITP A;  1LAC A;  1SND A;  2QF7 A;  2R92 H;  2QKI C;  2KHI A;  1I3Q B;  1E0B A;  1I6H H;  4QF4 A;  3MVV A;  1U4L A;  1SFO B;  2VB2 X;  2VUM H;  1TWC B;  3A0J A;  1O7Z A;  5G3L F;  4LF6 Q;  3AEV A;  1WJJ A;  4QCL A;  2D9U A;  2A73 B;  3GTG H;  1HZA A;  2ZT9 C;  2L1B A;  1C8C A;  2BDN A;  1F9Q A;  1WD0 A;  3M4O H;  5C0X J;  2KHJ A;  4DNT B;  2DJG C;  2F1M A;  2D0P A;  4IOC A;  2C9O A;  1K3B C;  1BKB A;  3CKI B;  4C3H B;  1QOH A;  3OW7 A;  2E2H B;  1C4Q A;  2BE5 C;  3PF5 A;  3OIQ A;  4C1N K;  3QIA A;  1Z6H A;  1TXY A;  4NMZ A;  1WTR A;  4MNO A;  1WTP A;  3S1R H;  5D3D A;  3J80 E;  5D14 A;  1FJG L;  2ID0 A;  1PRT F;  2E8G A;  2SEB D;  4X62 Q;  1PHJ A;  1VQJ A;  3UDF A;  4A3F H;  1IBM Q;  1Y69 U;  1VQ8 A;  1BUV T;  2LXK A;  1ASZ A;  1AEX A;  1SYG A;  3TEH B;  3TME A;  1V1O A;  1IYJ B;  2V4D A;  1YHQ A;  3HOV H;  2ZXO A;  1PRT D;  2NN6 G;  1NNX A;  4JI2 L;  1MJC A;  1DM0 B;  2L9H A;  1NE3 A;  2UXB L;  2PZT A;  5BN5 A;  4P74 A;  1UAP A;  4H13 C;  1HR0 L;  4HAE A;  1K0S A;  1SYE A;  3OW2 A;  1Q8K A;  3J81 L;  3SK8 A;  4DV5 L;  1SNO A;  3URY A;  5C5M A;  4YCV A;  3S1M H;  1S5C D;  4KK7 A;  5DAU A;  4BBR G;  1X3G A;  4UAI A;  3CCU A;  5KIX A;  2F4V L;  1QNU A;  3D4D A;  4JC0 A;  3V05 A;  1NBW A;  1HZ9 A;  5E1F A;  5ELN A;  2K50 A;  4L5R C;  4IFD J;  4KY7 A;  3Q24 A;  2PYK A;  4JI4 Q;  3W1G A;  4DPG A;  4DV7 L;  3STB D;  2RHQ B;  3JAM c;  1LV9 A;  4GN3 B;  1WD1 A;  4NXM L;  1A2U A;  1XMQ L;  3BVG A;  4IZ8 A;  2E5L Q;  2H4O A;  4WRD A;  4DR2 L;  2HIV A;  1JOO A;  2R7Z B;  2QIL A;  2NWG A;  1SMY D;  5CMD A;  5JAV A;  3CCV A;  4IUT A;  5I6W A;  4K6D A;  3SGI A;  1MIU A;  2IT1 A;  3AFQ A;  3TSS A;  1LTI D;  1Y1V B;  4Q5V A;  4DV0 L;  3S2H B;  1DCZ A;  1W2B A;  5KGU A;  2IHF A;  4RH6 A;  2WV6 D;  3J7A V;  2J0T D;  5IYB H;  1RDP D;  2K1B A;  2NN6 H;  4JV5 L;  3Q0A A;  4AH6 A;  1H9R A;  2KHS A;  2UU9 Q;  1YNN C;  1VQP A;  2JA5 B;  1F2L A;  1HR0 W;  2L12 A;  2CCZ A;  5C44 G;  1EY6 A;  4A3F B;  3HRZ C;  1ICW A;  4DV7 Q;  1IW7 C;  1N34 Q;  4BS9 A;  4QUF A;  4DR1 L;  2EDG A;  1Q8I A;  2F0S A;  1FNW A;  3GTQ B;  3S2D B;  5KND A;  5C4X H;  2LMC B;  4HCS A;  2K14 A;  2B2Y A;  2EXD A;  4DR3 Q;  1C0A A;  2Z6B A;  1JOR A;  4A3C G;  1B3A A;  4HIM A;  4IPH A;  3PO2 B;  1WVL A;  4XIG S;  2E2J H;  2JA6 H;  2DGY A;  5C3E B;  2JA8 B;  1Z7T A;  3E5S A;  1E2V A;  3IFT A;  3P75 A;  3IKJ A;  1YI2 A;  4HJ9 A;  5GAD C;  3PO2 G;  1KLU D;  2EJF C;  1HCZ A;  3MEH A;  4G7O C;  3F2D A;  2D0O A;  2UXB Q;  4EQN A;  4ZQ3 A;  3L0O A;  5L37 A;  1VQO A;  1EIG A;  4ZLT F;  4AQY L;  4A3B B;  3HOW G;  3SK4 A;  4FDB A;  1UE7 A;  4KV6 A;  4A3F G;  4UP8 A;  4ULL A;  3G4S A;  1N34 L;  2HDM A;  3R8B A;  5IP7 G;  3HOW B;  3U4Z A;  1L2F A;  3PUW A;  3S1Q H;  1FGU A;  1CZG A;  2MPM A;  1ENA A;  3E0E A;  3S16 B;  2NZ1 D;  4LW1 A;  1XMO L;  3MHB A;  1PFM A;  1NR4 A;  5FLX c;  1Z9F A;  2UUB Q;  3ND9 A;  1KAB A;  1I50 B;  3OYY A;  4R4O A;  5ELE A;  4BWG B;  4DR2 Q;  1N36 Q;  2PI2 E;  4CGY B;  1I4P A;  3GTL H;  1EQR A;  3OTO Q;  4XQJ A;  1TVX A;  4PMW A;  4LF9 L;  3SK5 A;  3E9H A;  3J80 L;  4IQZ A;  1C7Y A;  4HIO A;  1KIX A;  4LFB L;  1IBK L;  2EYL A;  4C3J B;  1D5Z C;  1PH1 A;  2PCF B;  3BYT B;  4HJA A;  4NXN Q;  3MZ5 A;  5C44 B;  3ERQ A;  1HNW Q;  1N32 L;  4NB3 A;  4PZ8 A;  4XT3 B;  5M5Y H;  3S1M B;  4O0A A;  3TP5 A;  1U4M A;  4A3M B;  3I73 A;  4JI7 Q;  4JI0 L;  4B9W A;  3M85 A;  2H1E A;  2EOT A;  3ERS X;  5C4H A;  1SNQ A;  1CKM A;  1EY9 A;  3HOW H;  2OTJ A;  3NEL A;  3PIP A;  1TII D;  4DR6 Q;  4PMC A;  3K6O A;  4GS3 A;  3QO2 A;  4WFN 3;  2B29 A;  4EQ5 A;  2B3G A;  2JQO A;  1BBX C;  1E2Z A;  3Q22 A;  3GTK H;  4MN3 A;  1EU3 A;  3R2T A;  5IWA Q;  2XRQ D;  1LYL A;  2O2L D;  4LFB Q;  1H95 A;  2HCI A;  1S5B D;  4KTA A;  1BCP B;  2Z9H A;  3BDO A;  4HJ7 A;  3QB3 A;  2WB1 B;  2WAC A;  2PPB C;  1V8Q A;  2M9V A;  1MGS A;  1W6J A;  1JQY D;  1L0W A;  1SMY C;  5E4X A;  3RD4 A;  2VQE L;  4G57 A;  4HIK A;  2WB1 G;  1HNX Q;  1EIY B;  1LTG D;  2N8N A;  3F2B A;  1D2B A;  2NTS A;  1X6O A;  3IL8 A;  1OXX K;  4BBR B;  5LMU L;  4JI7 L;  3PUY A;  4HR7 B;  4GOP A;  1HQM C;  2NZH A;  3MXN A;  4UPA A;  1AFP A;  5JVH 3;  4G7H C;  1TT2 A;  1HFN A;  4UP9 A;  5M5W H;  2R93 B;  2KQ3 A;  5K36 H;  4MTK A;  3E0J A;  3GTL B;  4JI8 L;  4FVM A;  2XTI A;  4DK1 A;  4GLX A;  1ILP A;  3VA7 A;  4DAP A;  2MO0 A;  2WII B;  5COR A;  2A6E D;  5KNB A;  4K8I A;  2IL8 A;  1GJX A;  5IWA L;  3CQZ H;  3T56 B;  1KLG D;  1HTP A;  3K7U C;  3H94 A;  4B3T Q;  2JA8 H;  2MO1 A;  4GKJ Q;  3CCM A;  1TWF B;  3CRK C;  1I94 L;  3J7A F;  3MA2 B;  1H9S A;  3A7L A;  3SEB A;  5FOB B;  3QJY A;  5CV9 A;  3EVQ A;  3CME A;  5FJ8 G;  1MSG A;  1VQG A;  4YCW A;  1HR0 Q;  5EJW A;  1E2W A;  4ODG A;  1HH2 P;  1AH9 A;  1PRT B;  1MJE A;  2JE6 I;  1UUP A;  1SE2 A;  4FO2 A;  1JWM D;  2F52 A;  5JOB A;  2B63 B;  1ZYR D;  4IPC A;  4F88 A;  2E2I H;  4BY7 H;  4MIU A;  5C4Z A;  3I4N G;  2EJM A;  4J1M A;  1FL0 A;  2F0V A;  3GO5 A;  1MD2 D;  3KLW A;  3A55 A;  1QZG A;  4JI4 L;  5HUR A;  4N9P A;  4PMB A;  1LTT D;  2R7Z G;  4BBR H;  4A3G G;  2AHO B;  3NQI A;  3S16 H;  1TWA H;  1DD2 A;  3FPP A;  3CCS A;  1HA6 A;  4JBW A;  4YIJ A;  1ML0 D;  2HHH L;  2Y0S B;  4YHH L;  4RHR A;  1N8R C;  1YHA A;  3DUZ A;  1D1I A;  1F9P A;  1V1P B;  2Q8R E;  4OO1 I;  4OO1 G;  4LMQ D;  2AQ1 B;  1D5M C;  2EYP A;  2Z4I A;  2K4K A;  4IFD I;  1VQB A;  1M4V A;  2K5H A;  4DN4 M;  1FGB D;  1E22 A;  5CR3 A;  3H91 A;  1XPO A;  2Q2H A;  4QB4 A;  5M5X B;  4DA2 A;  1D8L A;  1TQO A;  4C2M B;  1BXT A;  3DHQ A;  5D65 A;  2PZU A;  3NP8 A;  1TWC H;  3KFU A;  1JE5 A;  4ZRZ A;  4KD4 A;  3M4Y A;  4PQX A;  1VF5 C;  1KAA A;  1WTX A;  4BY1 B;  4KY6 A;  2F0E A;  1YJW A;  2VNU D;  1DGS A;  1L1O C;  1KHI A;  3CC7 A;  1E1O A;  5IGC A;  4JOI A;  3KOJ A;  2J7Z A;  3CRL C;  4OHJ A;  2B2T C;  2Z1C A;  1YNN D;  5IGG A;  2EYJ A;  1UE1 A;  3RZO H;  3TN2 A;  2IX3 A;  4MZ9 A;  1OXU A;  4ID6 A;  4Y7N H;  2QW7 A;  5I6Y A;  3LGJ A;  2JA7 B;  2EYM A;  4RCN A;  4TVA B;  3OMG A;  2FFK B;  3LWE A;  4ILW A;  4ZYS A;  4A3G H;  1KQS A;  3Q23 A;  5FLX E;  2D5D A;  1QE6 A;  2CWP A;  3HOY H;  1E1T A;  1PH8 A;  2RSO A;  2JA6 G;  4RHS A;  2HQL A;  3S2H H;  3SDZ A;  2VQF Q;  3L2P A;  2EY5 A;  4L5S A;  2PW5 A;  2ZJP A;  3CPF A;  1STE A;  3GV6 A;  1FR3 A;  1SE3 A;  4C3J H;  1UNS A;  1VQ5 A;  4POG A;  1X56 A;  3NTK A;  1EQQ A;  2UXD Q;  1A6X A;  2CVR A;  3C2P A;  2VY3 A;  4P75 A;  4YWL A;  2B2T A;  3KDF A;  4I7A A;  3NHH A;  1CK1 A;  1EFW A;  4BA2 I;  2NVT B;  1SRO A;  3VA5 A;  2K5Q A;  4DV1 L;  1XNQ L;  4GNX A;  3H09 A;  3UDI A;  1G91 A;  4N8F A;  3KYH C;  4BXX G;  1PTO C;  1KRS A;  1GD7 A;  1HNZ Q;  3I91 A;  2UUA L;  2UUB L;  2XIW A;  4DGZ A;  2D62 A;  2E2J B;  3TS0 A;  1T5X D;  4QQB X;  5E4W C;  3F2C A;  3SXH A;  3HOU B;  3RZO B;  2UXC Q;  2NVX B;  1FD7 D;  4DU9 A;  4A3B G;  1DZ1 A;  1PDQ A;  4DUY Q;  4A75 A;  3T53 B;  4QIW E;  2KEE A;  2MJ8 A;  5M9O A;  2Q2U A;  4R4I A;  2R7Z H;  4JCV E;  3OWF A;  4OEL B;  1G2S A;  3HOX G;  2YU9 B;  5C3X A;  1VQI A;  2R93 G;  3MXG A;  2UXD L;  2I07 B;  4A76 A;  4LK1 C;  5EBC A;  4FXG C;  1Y8P B;  4J15 A;  3VYU A;  2F4V Q;  1HNW L;  1N32 Q;  4B08 A;  4DUZ Q;  4A93 B;  3HOY G;  3S1N H;  1BOS A;  1WTH A;  4POF A;  4A3L H;  2ENB A;  2QDB A;  1F2Z A;  4XDX A;  2F0D A;  5C4J B;  1CKO A;  1PH7 A;  3I72 A;  3GTP B;  4M8A A;  2BA1 A;  3A56 A;  3NEN A;  1UEA B;  3T1H L;  1LLR D;  4O42 A;  3CCR A;  1SNP A;  2MGS A;  4XYO A;  4YY3 L;  1SN8 A;  2ICE C;  1WTO A;  1I4H A;  2A19 A;  1VMP A;  2JA6 B;  4E6I A;  4DXG A;  5KYI A;  4FNF A;  4LUV A;  5K5P A;  4WJ3 M;  2I5M X;  3ER0 A;  4S3S A;  3A74 A;  4FF2 A;  3JAM E;  3I4M B;  2A69 C;  3Q8D A;  3FDT A;  1VQD A;  4JPB W;  1P16 A;  3F2U A;  1EUJ A;  1Q1E A;  3N6R A;  1R9T H;  3J81 i;  2CW0 D;  1MKH A;  1EWI A;  2FIN B;  3SR1 A;  1I3Q H;  2WAQ B;  1I6H B;  3HGB A;  4KHZ A;  4L5T A;  2VUM G;  1K83 B;  3ZJY C;  2B2V A;  3M9B A;  5JJL A;  1TY2 A;  1QNK A;  3JC6 6;  2UUC L;  1SNM A;  4A93 G;  2YTV A;  3C46 A;  5DM7 3;  2JA7 G;  4C3H H;  1QUQ B;  2NVY H;  3PMF A;  4AIM A;  3HOZ H;  3J81 j;  1B53 A;  1DXM A;  1EY5 A;  1EIH A;  4X66 Q;  3RLN A;  1JJC B;  1NMF A;  3A8K E;  4DR3 L;  1L0X B;  1BVS A;  2IW3 A;  2PZW A;  2SNS A;  4OIK A;  1CZW A;  4CDE C;  2SDF A;  1HNZ L;  3CU7 A;  3VYS A;  1S4Z A;  1DOM A;  4L6T B;  5ELO A;  1CTM A;  3EQL C;  3NXW A;  2JSO A;  2AUK A;  2PNR C;  4C3I H;  4DNR B;  2OT2 A;  4RA8 A;  5C3E G;  1ET9 A;  3D4R A;  4V19 0;  1L0Y B;  1L1O B;  2RDH A;  3K5N A;  4DUY L;  3QR8 A;  4K8J A;  1B9N A;  1GUG A;  4O1N A;  2F0L A;  1VDZ A;  4A3E H;  2K05 A;  3B6Y A;  4LF6 L;  4ZKC B;  2R6G A;  2BOS A;  1VQF A;  4LF7 L;  1KNE A;  5GRO A;  2R7D A;  1ICF B;  1SRU A;  3FVQ A;  4K5X A;  3ND8 A;  1JCK B;  3KLR A;  4QJF A;  1PTO F;  1AW7 A;  3CF5 A;  3ULP A;  2FMC A;  4A3D G;  3RZD B;  3NK9 A;  4FF3 A;  3MXN B;  4EX5 A;  5H1S E;  5GQO A;  2DNE A;  3OSO A;  3DM3 A;  3TP8 A;  2F0N A;  2XWJ B;  5ELB A;  2A74 C;  2F3W A;  3TBI B;  2HDL A;  1SE8 A;  3RLO A;  3S17 B;  1AE2 A;  1XX8 A;  1PH6 A;  1PH4 A;  4V0B A;  4YWM A;  3CD6 A;  2JK8 A;  1DOK A;  5C4X G;  5FLM G;  2XWB B;  1PMR A;  2B2W C;  1CQV A;  1PZJ D;  4LUO A;  5LMN W;  4C3H G;  1BDO A;  2Z6K A;  5EPJ A;  3TRE A;  5C5L A;  2AQ2 B;  3A8J E;  4F8M A;  4A3J H;  3W2D A;  3U50 C;  1IL8 A;  2NYZ D;  1YIJ A;  5FO8 B;  1G2T A;  1EL0 A;  2RVL A;  1GO3 E;  1VF7 A;  4KLK A;  2KJX A;  5M3F G;  1TS4 A;  4A3K G;  3ZYY X;  5IGF A;  5DEH A;  3I90 A;  4KHP L;  2AWO A;  4LAA A;  3IAY A;  5KNC A;  3D8G A;  1GVP A;  1XNR Q;  1VQL A;  2K03 A;  4RKB A;  3CC4 A;  4JG2 A;  4B3R L;  1LO5 D;  3L9A X;  1BR9 A;  3GTO B;  3CXC A;  4G4K A;  5GAE C;  1P8L A;  4CDD C;  5HY6 A;  3U9O A;  2K33 A;  1SYD A;  2HQE A;  1PFB A;  3G6E A;  1M8A A;  4TKO B;  5JEA J;  2EYF A;  4OIJ A;  4XQN A;  1A3T A;  3H3V H;  3BYY B;  5IGE A;  2GN5 A;  4PNY A;  1CM9 A;  4K5V A;  1BCP C;  5CBE E;  3G6J B;  2P5Z X;  1JB7 A;  3GDE A;  4DR5 L;  3R3O A;  4IFD G;  4JYA L;  3GD7 A;  1LT3 D;  4WJW A;  2ZM6 L;  3M3Y B;  3E9I A;  1F2M A;  2F0W A;  3WOF A;  2VXW A;  1SSO A;  1PH9 A;  2MQH A;  1I4R A;  4GLV B;  3CCL A;  2NVX H;  4LF8 L;  4DXF A;  1XTD A;  1WTV A;  1G6P A;  5BR8 Q;  5M3M H;  1LUZ A;  1ZXT A;  2BDO A;  2OXP A;  4OL7 A;  4A3I G;  1SJH D;  1QVC A;  1V1P A;  2SOB A;  1UE5 A;  1K9M C;  2VS1 A;  1B50 A;  3H15 A;  2F0M A;  4IUN A;  3VDY A;  1G6Z A;  4AQY Q;  1S5F D;  1YIT A;  2C5C A;  3JAM i;  3DWA A;  1XXG A;  3ICE A;  1OO9 B;  5I2Y A;  2I46 A;  4R4Q A;  2CW0 C;  2B2V C;  3TZU A;  1J6Q A;  4DV1 Q;  2L55 A;  3F8T A;  4JOI C;  4EQO A;  1XMO Q;  3MC0 B;  4O2D A;  4X62 L;  5A2Q L;  3NWT A;  1KTK A;  2FXQ A;  1V43 A;  4X3T A;  1EQT A;  1MI2 A;  3I4M G;  4A3E G;  1JWU D;  4R4T A;  4DR1 Q;  5C4J H;  4A3J B;  2B2U A;  2KUM A;  1RTO A;  1CA5 A;  1DON A;  4DFA A;  3FKI H;  4JK1 C;  1N36 L;  2Q8T A;  3G7L A;  4CBV A;  2WFW A;  3STB C;  1ENF A;  4FP5 D;  2CWA A;  2KCN A;  2N49 A;  2OTL A;  3K81 C;  2A68 D;  4LFA L;  1GHK A;  1O78 A;  3RNU A;  3I4O A;  2XN9 C;  3HKZ B;  2V1C C;  1Y1W H;  1YJ9 A;  2A5H A;  5DNF A;  4IN3 A;  1IW7 D;  1IBK Q;  5JPN C;  2RF4 A;  4X65 Q;  1CQF A;  1IHZ A;  2YYZ A;  1K8A C;  1CHQ D;  1X54 A;  3PIP 3;  3L3O C;  4P71 A;  4ABN A;  1X3Q A;  1QCB D;  1TS2 A;  2RSN A;  3H6M A;  4GZY C;  1LTA D;  4DNI A;  2O5J C;  5GAG C;  1I4Q A;  1WCM H;  2VL6 A;  4A3I H;  2R3Z A;  3TRZ A;  3GTM B;  1E24 A;  4A3J G;  5AJ3 L;  5I9P A;  1VQC A;  4JI5 L;  2KA7 A;  1VQK A;  2K04 A;  2IJ0 A;  1RKN A;  2EJG C;  2LSS A;  4PZ7 A;  3S2D H;  4EQP A;  2K5V A;  2MP1 A;  4A3L G;  1PZK D;  3QOJ A;  1O7Y A;  1S5E D;  1RHP A;  1VMC A;  5I4D A;  1EY0 A;  3UE0 A;  1ENC A;  2C35 B;  5CV8 A;  5J39 A;  4GOP C;  1CI3 M;  4LFA Q;  1GUS A;  2Z8L A;  2ASB A;  2K6A A;  1K3R A;  1EYA A;  2A69 D;  5JVG 3;  4DV3 L;  4C3I B;  3J81 c;  4KKS A;  4UHV A;  4A4I A;  5CC4 A;  2F3V A;  3KBX A;  1KXL A;  4OGQ C;  3AU7 A;  1TY0 A;  3PGZ A;  3MAQ A;  3HOV G;  1II3 A;  1NAP A;  2YU9 H;  1SE4 A;  1GHJ A;  1G51 A;  1K8M A;  2VQE Q;  2H5X A;  3M4P A;  2UU9 L;  3NBI A;  2F0J A;  3GTJ B;  3I4N B;  2B2Y C;  2EXZ A;  3RN2 A;  3RMH A;  4IFD H;  3K57 A;  2D2C C;  5C0X H;  3RLF A;  2X69 A;  2VZA A;  4QMG A;  3GTO H;  1OXS C;  5CV6 A;  1KD1 C;  4R8I A;  2A1A A;  3A5Z B;  1WOC A;  4CJ0 B;  4XT1 B;  3CMA A;  4JI3 L;  1XTC D;  1U9R A;  1PYS B;  1S5D D;  4JI0 Q;  3TP6 A;  5LHY 1;  3A54 A;  4NDX A;  1JIC A;  2OF1 A;  3GP7 A;  4JI6 Q;  1STG A;  3CCJ A;  1WFQ A;  2RA4 A;  3K8A A;  4HID A;  2OCE A;  3BU2 A;  1XMQ Q;  2CH4 A;  1F2Y A;  4DV3 Q;  2F0H A;  3AFP A;  1WTQ A;  3DLL A;  2R92 B;  1Q86 C;  3CPW A;  1I94 Q;  5JJI A;  3CQZ B;  2K5N A;  3I3C A;  2CQA A;  4CKC A;  1EIF A;  3R93 A;  5IT9 E;  5C3E H;  2K52 A;  4NW2 A;  4DV0 Q;  3K80 C;  2EQS A;  4HSP A;  4X65 L;  1B8A A;  4HN7 A;  4LFC Q;  2LXJ A;  3MXP A;  3CCQ A;  1PVO A;  2ZTD A;  4HTH A;  3I70 A;  2NVQ H;  3AB9 A;  3KF8 B;  4DV6 Q;  4K2K A;  4HSV A;  3GQB A;  4B3S Q;  1TWG B;  2F03 A;  5IP7 H;  4JVZ A;  4M1U B;  3HZX A;  3FP9 A;  3HOU G;  5HGT A;  4H0L C;  1OTC A;  2ES2 A;  1NY4 A;  1R4Q B;  3J80 i;  2Z0S A;  3HKZ G;  4GKK L;  5ELF A;  4DV2 Q;  2RCN A;  1W3S A;  1W6K A;  2N3S A;  3BZK A;  3LNN A;  2QEX A;  1A62 A;  1EOT A;  5C0X I;  2XVS A;  2F0G A;  2GVB A;  5J3B A;  3FKI B;  3PUX A;  4J6H A;  4HMI A;  2JYO A;  1HZB A;  4JBM A;  1QVF A;  3HOY B;  1QB5 D;  1LT5 D;  3P1H A;  2RDG A;  5D3I B;  3BS1 A;  1BO0 A;  4UY8 C;  1PRT C;  3HOZ G;  1Y8O B;  1U0L A;  3DMU A;  1IKL A;  3CHB D;  1E7Z A;  4NXN L;  4LF5 L;  4HCE A;  2K5W A;  1BBW A;  2M00 A;  1B4O A;  1WTW A;  1ZEQ X;  1YEZ A;  2G9H D;  1EWH A;  4KI0 A;  2NZO A;  5LL6 X;  2IY5 B;  3J80 c;  2E2D C;  3U58 A;  3JAM L;  3DXJ C;  2B8F A;  3C3L A;  2ZXP A;  1GXD C;  3PO3 B;  4X3S A;  4C2M H;  4DAM A;  1STN A;  4IAL A;  4DR6 L;  3QG1 A;  1A0I A;  3LWU A;  5IOD A;  4LF4 Q;  3IRB A;  3X3N A;  1EU4 A;  5J22 A;  1HA5 A;  4YY3 Q;  2EY1 A;  3V2T A;  3PO3 G;  1D7Q A;  4ZKB B;  2QDL A;  1M1K C;  1A2T A;  4A3D H;  1K0R A;  1J9O A;  1NUC A;  3V96 A;  1G29 1;  4F87 A;  3SVM A;  3J7Y W;  1EZ6 A;  4P2C B;  3PCO B;  2A6E C;  4Y7N B;  3O13 A;  3PV0 A;  1QUQ A;  2EVB A;  3PIO 3;  2KBN A;  3FHW A;  3OTO L;  3U9S A;  4MHE A;  4LF5 Q;  2XGT A;  2QCP X;  3D0F A;  1YNX A;  2VQF L;  1C48 A;  1PH2 A;  3NWS A;  2AKW B;  3HG9 A;  4JW0 A;  1NR2 A;  1H9K A;  2KCC A;  3X3M A;  4OX9 Q;  5NUC A;  4PZ6 A;  1QG7 A;  5EKI A;  4PV1 C;  3KF6 A;  3IFD A;  3M7N A;  1B70 B;  4DV5 Q;  4UDU C;  3VR3 A;  1JE4 A;  1C9O A;  2YTX A;  5FO9 B;  3PUV A;  2E2H H;  2ZXR A;  4IUQ A;  1K28 A;  4ME3 A;  2F4I A;  3S1Q B;  5IGB A;  1VQH A;  4NPS A;  3S14 B;  1YNJ D;  3ERO A;  1LM0 A;  1LTR D;  3BG3 A;  1CA6 A;  4C1N I;  3KLS X;  5M3F H;  1EOV A;  4RWS C;  2CH4 W;  3EA6 A;  3NUC A;  2MFI A;  2UUA Q;  3T1Y L;  4QUC A;  1CT1 D;  5CV5 A;  1LTS D;  3HP3 A;  2ALY B;  5EPK A;  5G3L D;  2JP1 A;  4GN4 B;  2IX1 A;  1STB A;  1GUW A;  4OEM B;  2NN6 I;  3F1Z A;  1PYW D;  1KDC A;  2UXC L;  2EYO A;  3I4M H;  1PZI D;  1PYB A;  1IBM L;  1ROD A;  3TQY A;  3FKI G;  1SFO H;  1TS3 A;  4GNX B;  5M3M B;  3HOU H;  1TWF H;  3VR2 A;  4GLA C;  4AYB B;  1Y8N B;  4XYQ A;  1EYD A;  3HOX B;  4LF7 Q;  1JOQ A;  3KK7 A;  1YHB A;  1TKW B;  4BY1 H;  1SYC A;  1I5F A;  3NEM A;  4A3B H;  4KJO A;  5C6A A;  4HJ5 A;  4TSS A;  2EPB A;  4TQU S;  5C44 H;  2F0U A;  3NQT A;  4RGO S;  4KMU C;  4J8Q A;  1IYV A;  4L63 B;  3DEP A;  4BY7 G;  1SR3 A;  1Q90 A;  2B63 H;  4KKU A;  3VR5 A;  1U4R A;  2EY6 A;  3M7G A;  5IY0 A;  2F0P A;  4CJ1 B;  1O7L A;  4IUV A;  1RL2 A;  3FEW X;  1A8V A;  3K7A H;  2ZJR A;  1NJI C;  2MHV A;  4JI8 Q;  2X6G A;  2EZV A;  4LF4 L;  1PA6 A;  2OWO A;  3S14 H;  4DKA C;  1Q12 A;  1O7I A;  1X3E A;  5FK9 C;  4DK0 A;  3WOE A;  3BZD B;  3DEO A;  1L1O A;  5J1Z A;  1TWA B;  2AWN A;  3DM1 A;  4EGV A;  1ESR A;  4OO1 H;  1NSN S;  4R8N A;  1HXY D;  1PFS A;  4DAV A;  1GUO A;  3PQI A;  3GTK B;  3M3Y H;  4C3I G;  4KY5 A;  3VR4 A;  2WKD A;  2BA0 A;  3FMC A;  3VR6 A;  1ONL A;  4CDF C;  1VQA A;  2F0K A;  4QGU A;  2DJF C;  1OXV A;  5LL6 S;  5C3W A;  3J7Z C;  1E3P A;  3H0G B;  2G9D A;  2KEN A;  1Z47 A;  3FPU B;  3P7J A;  1V9P A;  2CQO A;  1XNR L;  4F7X A;  4R9W A;  3OWE B;  1A63 A;  3NTH A;  5T1I A;  1FVI A;  4RGT A;  2UUC Q;  3G71 A;  2L15 A;  4X3K A;  4FYD A;  5IYD H;  3S9W A;  3WDN A;  2Y0S G;  1NTG A;  2IWH A;  1VQ9 A;  3L7Z C;  2SNM A;  2GVA A;  4YWK A;  4A3M H;  3ULL A;  3UDG A;  2BH2 A;  1X9N A;  5C4X B;  1PTO H;  1M90 C;  1IKM A;  5EAY A;  2LFN A;  5ISR A;  4JI6 L;  4L8J A;  5T1G A;  3HOZ B;  4K0K L;  4DR5 Q;  4JYA Q;  2F0T A;  1VQN A;  2RBM A;  2YTY A;  1IL2 A;  1EQV A;  4IJH A;  4FXD A;  1SJE D;  1U5K A;  5I2X A;  4JBJ A; 
#chains in the Genus database with same CATH homology
 1MHW C;  4CDF C;  4OEM B;  2DJG C;  1ICF B;  4OEL B;  4CDD C;  4CDC C;  2DJF C;  4CDE C;  1K3B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...