4CDDC

Human dpp1 in complex with (2s)-n-((1s)-1-cyano-2-(4-(4-cyanophenyl) phenyl)ethyl)piperidine-2-carboxamide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
total genus 7
structure length 68
sequence length 68
chains with identical sequence F
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4cddC00
1ICFB 4CDDC 4CDCC 4CDFC 4CDEC 2DJGC 2DJFC 4OEMB 1MHWC 4OELB 1K3BC
chains in the Genus database with same CATH superfamily
2ZTEA 2YV5A 1TXYA 2MUYA 2OEOA 2K50A 1HR0W 4R4CA 2G9HD 4X64Q 3IRBA 1VQ7A 1B50A 2UXDQ 1JWMD 1OXVA 2XGTA 1LTAD 3NXWA 2R61A 2OCEA 1GM5A 5CORA 4JI7Q 3NELA 1J6QA 3KJOA 1EUJA 2V1CC 3U50C 2IHFA 3UE0A 3P75A 1SXTA 1VQFA 4C1NK 4OWWB 1LTSD 1F2LA 2CWAA 4CGYB 1SMYD 2IW3A 3H3VC 3PO3G 1VQDA 3NPPA 4NXNQ 3S14B 1EIFA 4KY6A 4BY1G 1IW7D 2Y0SE 4KN4C 1SLJA 3WOEA 1CZWA 1TS5A 3KLSA 2R92G 4R4IA 2K52A 3M3YH 1R9TH 3Q0AA 1X32A 1SBBB 1WOCA 3TP8A 2A68C 4CJ1B 1G6ZA 4V190 3E0JA 3H15A 3KF6B 1X55A 3PMFA 3N6RA 3ND9A 2LY7A 4Z9CB 4DV5L 2VB2X 3PGZA 3CU7A 5FLXE 1FGBD 2GN5A 4DR1L 4GLXA 5E4WC 2Y0SG 3KFUA 3I90A 1W2BA 4IJLA 3K5LA 5NUCA 2NUCA 1MKHA 5CV8A 4HSVA 3SR1A 2ZJQA 1D5XC 1TWHB 1K0RA 1BVSA 5IYCG 2QCPX 3GTOH 2B2YC 2KEDA 3SK8A 2AHOB 1Z9FA 4HCEA 4B3TQ 3J80L 2H5XA 4KLKA 3EJIA 4FXGC 4CKEA 3FHWA 1LT5D 5LMNQ 1QNUA 2K32A 1YHAA 1SNPA 2RQXA 1VQHA 2QGQA 1ZKOA 5A2QL 3S17B 1LLRD 2FINB 1PH1A 2RVLA 4J8QA 5IP7H 5TSSA 5EKLA 1E3PA 3VR6A 2ZM6Q 5IGCA 3KF8A 4OL7A 3OIPA 3HOVG 2O2LD 4PV1C 5J3BA 1SJED 4OWTB 2PI2A 1XNRL 1MSGA 5EPKA 1HUMA 3T53B 1K0SA 1PMRA 2BH2A 2R93B 4A75A 2IX1A 1PTOH 1IZ6A 1LTGD 1GJXA 1GUWA 3S2DH 4JI3L 4DV6L 3MEFA 1BQQT 1Q12A 2CH4W 4B3TL 3VR4A 1HTPA 4DV7Q 1V1OA 1TWAB 5JVG3 4JI8L 1SAPA 4LNQA 1ICFB 2SDFA 4K8IA 2TSSA 1JWSD 2IL8A 1GUNA 1C0AA 1RF2D 3I56A 5FKAC 3HOYH 4LF4L 4KD4A 1C48A 1W6JA 4N8FA 2B2UC 3J81j 4QL5A 1EWHA 3CPWA 2F4IA 4I65A 4LF9L 1IL2A 1W3SA 3ND8A 1YNXA 4TSSA 2RSNA 4AH6A 1L1OB 1DCZA 2Z6KA 2VQEQ 2KUMA 1PZJD 1FNWA 3DM3A 3KUPA 1NY4A 3M9BA 4KKUA 4P2CB 3G6JB 4ZUJA 1SFOB 4KHZA 2PPBC 2F0IA 5LMNL 3R2IA 2F0QA 1EY8A 4ME3A 1N32L 1B1ZA 1UEAB 4NP5A 4X3SA 4GNXB 2OTJA 1IKLA 5FO7B 1B9MA 3B6YA 4DUYQ 1KD1C 2AQ1B 4CDFC 2B63H 2ENBA 1JE5A 2KQ3A 1TWFB 1WTWA 2X69A 1ASYA 4L5SA 5C0XJ 4RH6A 2D0PA 1PTOF 4JI0Q 1XMOL 3CC7A 2XNAC 4XIGS 4LFCL 3K5NA 2XRQD 3QJYA 2O5JC 2K5WA 1TQOA 3TREA 4C56C 3DEPA 2K33A 2L1BA 3GTQB 5M9OA 5C0XH 3PIOA 3J7YW 5J1ZA 5C3EH 3WDNA 1EL0A 2CH4A 1WFQA 5EGTA 2H4OA 2HCCA 2NN6G 3MAQA 1CQVA 1KAAA 1RL2A 3QOLA 4AIMA 3RN2A 1YNJC 4R1JA 1PRTD 4UHVA 5FLXc 4L5QA 4LF6Q 4JV5Q 1X3QA 4XTCS 3VA7A 1BCPC 4A3MB 4LF8Q 3K5OA 3V2TA 4JI6Q 4XDXA 3D4DA 5C6AA 3A0JA 1EWIA 5C4XG 1JB3A 2QDLA 2EYJA 1PH4A 2AUKA 2CFMA 3QWNA 1LTRD 2F3IA 1UUPA 2HDLA 1B70B 4U673 1YVCA 2F0VA 3DUZA 5ISRA 4GKKL 1Y1WB 5M5WH 2NVQB 2ZJPA 2RHQB 1U4LA 2EE1A 4RMFA 4X62L 4YY3L 2N88A 5ELFA 4NXMQ 3FKIG 4GLVB 2NVTH 2VZAA 3NTKA 4KHPL 5C4HA 2ZXOA 5C44B 1F9RA 1I6HB 4NKLA 4P74A 2EYFA 1DZ1A 3V05A 4HIMA 2B2VC 2BA0A 5C44H 3L2PA 2M2LA 3KLRA 2JA5H 1TVXA 3HOZG 2IHEA 4UPAA 3HOXH 4IJHA 3MC0B 4KN7C 1I50H 1XMOQ 3CP0A 2HIVA 4LFCQ 5EAYA 1PFMA 3ULLA 2EYLA 2KA7A 4IZ8A 2O5IC 2VQEL 5JPNC 4L8JA 2WAQG 3QG1A 1NNXA 3NBHB 1ICWA 4POGA 3A7AB 2R93G 5H1SE 1YHQA 1HQRD 1N32Q 5AFWA 1QUQA 3G6EA 2EJFC 5KNDA 4BS9A 1PH8A 3HOVB 2PMZB 3EIVA 4JBJA 1P16A 5JAVA 3VDYA 4J1MA 1II3A 3A8IE 3BVZA 2UU9Q 4L63B 3S17H 1H9MA 3J80i 1U0LA 3CQZB 4X64L 2I5MX 3HOWG 5D3IB 2FXQA 4S3SA 5ELBA 3BZCA 3C1FA 1KLGD 1B2TA 2C35B 4GOPC 3NUCA 2KECA 1BXTA 1KC8C 5C3EG 3I4NG 1XJVA 1G51A 4AQYL 1SYGA 2ZT9C 5F2DA 4HAEA 3U4VA 1WCMG 3RMHA 3D0FA 2JJQA 4K2KA 1A3TA 4O42A 1J5EQ 5IT9E 3S16B 2L0CA 4C2MB 4O2DA 5M5YB 2PCFB 3NE5B 1CKMA 2WP8J 1EYAA 4GOPB 5JPMC 3MA2B 4PQXA 2HQEA 3PIPA 2Q2UA 1TY0A 3MFYA 2WB1B 2DY8A 2B8GA 4YWLA 2JA6H 1PH9A 4P72A 2EYPA 4JI3Q 4B3RL 1ESFA 2A73B 4XQJA 2E8GA 4UP7A 3W1GA 4B3ML 3S24A 2EYMA 3NSWA 1E7ZA 2J7ZA 1JJ2A 1V9PA 4H13C 4WJ4A 2K03A 2B2TC 2I07B 1RDPD 2PZWA 4WFN3 2H1EA 1X9NA 3S1QB 1C8CA 2E2HB 1N34L 1XX8A 2L12A 1FJGL 1HUNA 2P5ZX 2F0EA 1IYVA 1SYCA 1JJCB 1N34Q 1FJGQ 4TRDA 3MHBA 4F87A 4NMZA 5KIXA 4OONA 5C4ZA 3G7LA 1IBKL 1NE3A 3JAMi 1EWCA 1VDZA 5ELEA 3U9OA 2L4NA 5J39A 2KEEA 3RNUA 1UE5A 2EY1A 4ODGA 5C0XI 4EQOA 1BBXC 3P7JA 4LFAQ 1TT2A 1EFID 3U58A 2WIIB 2JSOA 4FO2A 1FL0A 2KHJA 3D6CA 3I91A 1LACA 3K7AH 3SDZA 4DUYL 5C4XB 1JOOA 1EEFD 2E75C 3NQIA 3OYYA 1C7YA 3RUZA 2K1BA 4JYAQ 1B4OA 2RF4A 4FP5D 1HCZA 1WYDA 1HR0Q 1ET6A 4OXPA 3TEHB 1A63A 2JXMB 3PSIA 3EN2A 4FVMA 2I5HA 4BY1B 3CCMA 1YZ6A 2XN9C 1ML0D 4IUTA 2MGSA 3C3LA 4UP9A 4A3EH 1KDAA 1LM0A 3TP6A 4LJZC 4HJ7A 2E74C 3NBIA 1VQJA 1GOZA 1EZ8A 2Q2TA 1RODA 2WKDA 2RSOA 1TR5A 2BDOA 4BA1I 1QVGA 1EU3A 4EQPA 1AE3A 2F3VA 4RG1A 1M8AA 5GROA 1YITA 4X3TA 1X65A 4C3JG 1Q46A 2F0WA 3M7NA 2LKVA 4NDXA 2LFNA 3X3MA 2Y0SB 1YHBA 2F0JA 4P75A 4A3GG 2Z6KC 3GTPH 5DM63 1IYJB 1SE2A 3NTHA 5IP9H 3E3XA 5C3EB 2HHHL 1QCBD 1XPRA 2WAQE 4YIJA 4YWKA 2E2JH 4XYQA 1VS0A 4IFDG 3AMUA 4OIJA 1B9NA 1V1PA 1U4PA 3AFQA 2R6GA 3OTOQ 5CV6A 5E3FA 3E9IA 1Q8IA 1DXMA 3BU2A 1UE6A 2FMMA 1I6HH 2BH8A 3SHLA 1STGA 1HZBA 2OXPA 3H0GH 5IYBG 1MJEA 1E2WA 3H91A 3CCQA 1HHVA 1X3GA 1V1PB 3MXUA 5C3XA 4ZK9B 1T9HA 5C3WA 5KYLA 1CA5A 4QJFA 4DAMA 2I0QA 1KTKA 1VQPA 1IBML 5FLXL 2JEAI 4OO1H 4R8NA 5ELCA 3T1YL 3GD7A 4KD3A 4ZLTF 1G2TA 4C3HB 1IW7C 3CW2C 1MHWC 3BYTB 2B2YA 1Z6HA 1HXYD 2KHIA 1LTTD 2CWPA 4A3BG 2OWOA 3Q23A 1QZGA 1EQVA 3F8TA 2NBFA 2NVTB 4DV6Q 3TZUA 5C4XH 2NN6H 2HIXA 2K04A 3KK7A 4BBRH 4XQNA 1TWCH 4A3CG 3T51B 4ALPA 1KXLA 4P71A 1PH6A 3I4LA 4UP8A 3EA6A 1LTLA 2B2WC 1PTOC 4LF8L 5M3FH 2ZM6L 2V4DA 1S5CD 1E1OA 5HY6A 3J80c 4A3CH 4A3EG 3KYHC 4JC0A 1CKNB 1B3AA 4WJWA 3HP3A 4DR4Q 1C4QA 2A74C 4DR2L 4JI5Q 3BJUA 3HOYG 3I70A 1F9SA 4HN7A 4N9PA 4BXXG 2RDFA 1K8AC 1B8AA 3GTGB 4KJOA 1IHZA 5M5YH 4C1NI 1L0WA 1JMCA 1JORA 4ZKBB 4NXNL 1LT6D 1RD9D 1U9RA 5FOBB 5CV5A 1EEID 4GN3B 4YHHL 2DNEA 2KCCA 3AFPA 2EXDA 1TS2A 1Y1VG 1MD2D 1I6VC 5LMNW 1NAPA 2ZTDA 3GTLH 4FXKC 2Z1CA 3I4OA 3W1BA 2A6HD 3LWUA 4Q5VA 1SMYC 1IL8A 1H9JA 3NP8A 4PMBA 2EY5A 4RAUC 1GVPA 4WRDA 4DR2Q 4GN5A 2GVAA 4JI5L 3F2UA 4G7OC 1EYDA 1MBYA 2B2VA 3BDOA 1HPCA 2EJGC 3K7AB 1XPUA 3K8AA 4DK0A 3F2CA 2OF1A 1BO0A 3BVGA 5G3LF 4DR6L 1EZ6A 4BY7H 4QIWB 1Y69U 3CXCA 3SK4A 2WAQB 3QIAA 4DV7L 1E24A 2F0GA 1VQGA 2PI2E 4EGVA 3A5UA 4K5XA 4LF7L 5ELNA 4BWGB 4IOCA 2GVBA 2MQHA 5GAHC 3I72A 4ZQ3A 2RA4A 5DEHA 2KCTA 1VQMA 4MHEA 3PUWA 1CM9A 4GOPA 1N9WA 3ULPA 1IBLQ 3FRPB 1JOKA 3C2PA 1XTDA 3SE0A 3UDIA 1A0IA 3VYUA 4HTHA 2IWHA 2E5LL 4BBRB 5BN4A 3JC66 3K58A 1NR2A 1VF7A 5BR8Q 1D7QA 4JBKA 3MXNB 3WOFA 3SXHA 3H3VH 1HH2P 4IALA 4G7HC 3FKIB 4EQNA 3IAYA 1I94L 3SVMA 3NWSA 4DR6Q 3TQYA 4RKLA 4DU9A 1TKWB 2BE5D 3OPOA 3RD4A 4RHRA 1IXRA 1EY5A 2FFKB 1Y1WG 1CHQD 1CTMA 4LFBQ 1DYQA 3S2HB 4DAYA 4TVAB 4F8MA 3SGIA 2JA7H 4X65L 4LF5Q 3CCRA 1PH2A 4X3UA 3AEVA 4OIKA 3PO2G 1DD2A 3MVVA 1TWGB 5HURA 4GNXC 3FP9A 1PRTF 2RCFA 4FDBA 3TMEA 1JJGA 2QDBA 4A3DG 1SEBD 4A3MH 1PVOA 1BUVT 2MFIA 2JQOA 3PUVA 4CHTB 1AEXA 4FF2A 1Y14B 4WORA 3J7A5 4AYBE 4IN3A 4LF9Q 3MTSA 1SJHD 3CCEA 1JE4A 3CAMA 2F0LA 1CQFA 2LS01 2PZTA 4AQYQ 4Y52H 1Y1WH 3K0YA 4IUVA 3PO3B 1PZKD 3R3OA 3KBXA 1ASZA 1I4HA 1ZXTA 4TQUS 5E1FA 2B3GA 4HJ5A 2RCNA 1O78A 3GTOB 4A3JB 4CKBA 3NQTA 1VQLA 3E6ZX 2JEBI 4IPDA 3KOJA 3TP7A 1VMCA 1JWUD 2F0UA 1VQKA 1BOSA 3FKIH 1SRUA 3HEJA 4ILWA 2ID0A 4DA2A 4DV0L 3PV0A 2LSSA 1CSQA 1V8QA 1NMGA 5LL6X 3AQQA 1YJ9A 2JA6G 3I4MG 2PZUA 3G48A 4H7BA 2ES2A 3EROA 1EIHA 3R2TA 4KI0A 1W6KA 5DAUA 4DK6C 4IUNA 1YNNC 4OGQC 4XT1B 1EQQA 4CBVA 4BBSB 2OQ0A 2Q8RE 4X62Q 1D8LA 2HD3A 4JI1L 1LYLA 1V43A 2B63G 3GTPB 2EDGA 1D5MC 1CKNA 1VQ9A 1J8IA 1KNAA 3S14H 5IYDH 3A56A 2UUAQ 4N8X1 1PA6A 3RZOB 3J81c 2NVYH 3KDFB 1WD0A 1XPOA 4JI2L 3HOWH 4LW1A 1E22A 1XYIA 4BY7B 1JC7A 2F0SA 1PFNA 3TN2A 2UXBL 1JOQA 4IUUA 3SK5A 4K5VA 3CCLA 1DOMA 4CDDC 2UXBQ 5JOBA 1ESRA 3S1NH 5M5XB 4IFDJ 4DV4Q 1SYDA 5CV4A 3A55A 3PO2B 1HNWL 2TMPA 4OWXB 1WTXA 1XXGA 1F2ZA 2MP1A 3HS0C 3QR8A 5LMUL 1XMQQ 3I2ZA 3H6MA 5GQOA 5JJLA 3Q22A 2ICIA 5KGUA 5K36H 4B3SQ 2AUJD 1SNMA 4GZYC 3RN5A 1A62A 2PO4A 4M8AA 2XTIA 3T56B 4Y7NB 5IOCA 2UUAL 4FYDA 3O13A 1HZAA 2J0TD 2F4VQ 2R7ZH 4KY7A 2YTYA 3I8ZA 1YJNA 3OWEB 3M4OH 4YHHQ 2MPMA 4RCOA 2BE5C 1PFSA 2WFWA 1QNKA 5FLMG 3EBEA 4Q0FA 3M4OB 3KLWA 2EYOA 4JVZA 5CGKA 1HR0L 1CA6A 4DR1Q 1QE6A 3OSOA 1TY2A 2EIFA 2AQ3B 2X6LA 3STBC 1SE8A 2WB1E 4A3MG 3ICEA 5GADC 1YJWA 2PQAB 3DXJC 3H94A 1S3OA 4EQ5A 2ALYB 3MXGA 1D1KA 1X56A 4F7XA 4OO1I 1P8LA 1YNJD 4I7ZC 1PHJA 3TBIB 4DV1L 5KNBA 4B9WA 1UWVA 3HOUB 1D2BA 3A5ZB 3D31A 2K05A 3E5SA 2EZVA 5A2QE 1PYWD 5D14A 3GTLB 3DWAA 5JEAG 2B39A 2IX0A 2IT1A 2BDNA 1E2VA 4JI4Q 4IUPA 4A3IG 1YEZA 2R92B 2EOTA 3R93A 4JBWA 4QMGA 2AQ2B 4DNIA 4OX9Q 2BOSA 4LF4Q 4HMIA 3HOVH 3HKZG 3PF4A 1OXSC 1IBLL 4RHSA 3CPFA 2K7VA 1RJTA 3U4ZA 1Y8OB 3EVQA 1KDBA 4A3FG 4R9WA 2VNUD 3CHBD 1MI2A 1IBKQ 5BR8L 1QZHA 2NTTA 1Z7TA 3T1HQ 4ZYSA 3D8GA 2MNAA 2ZXRA 1BCPB 1DM0B 3JAME 2MJ8A 3IKJA 2A1AA 1SE3A 4LFAL 1GD7A 1SNQA 5IODA 1NCVA 4ZRZA 1I4QA 1K83H 3BDLA 1LTID 5EKIA 1HZCA 4JI8Q 1U4RA 1FYCA 1K83B 2Q2HA 2N8NA 1EY9A 2KBNA 5E7NA 4BA2I 3S1MH 3CMEA 3RZDH 1HJPA 1RCVD 3BG3A 3QOJA 3LWEA 4A3KG 3MFGA 2WKCA 3V96A 4KKSA 4EVOA 1PH3A 1YIJA 1HNXQ 1UE1A 1G8ZD 4KKTA 1OXTA 4HIKA 1TWFH 3S1NB 1STNA 2A69D 3S16H 4XQQA 1VQNA 4NPSA 3N52A 2CCZA 3L7ZC 2D62A 4LUZA 1KIXA 1NTGA 4RGNA 1DOKA 3T1HL 1KL9A 3HOYB 2MO1A 1WJJA 3VA5A 1R4PB 1B7YB 5ELOA 1PYBA 2R92H 4DNTB 3P20A 2A68D 2JA7B 1HFGA 3ZYYX 1CFMA 3SEBA 3E9HA 4DV2L 1EFWA 1GHKA 1A6XA 1LT4D 3K5MA 2B2TA 3MEHA 2CW0D 1HQMC 5C4JH 5JVH3 1RKNA 3TSSA 1NUCA 4PMCA 1D6EC 4BBSH 4UAIA 5LHY1 5IT9L 1STBA 4HCSA 2EPBA 3Q6SA 1Q86C 1Y8PB 3A7LA 2VUMH 3I4NH 4MIUA 2K5VA 5T1IA 1WTPA 2F03A 4DNRB 1M1KC 1PDQA 4HR7B 4CJ2C 2E2IH 4IPHA 2A8VA 3CC2A 2CVRA 1TWAH 3G71A 3W2DA 3PQIA 4UDUC 1QG7A 4K5WA 1KDCA 1HA5A 4QB4A 3J81i 2F3WA 4J6HA 2VQFQ 1K3RA 1ZYRD 1A8VA 3BDCA 3J7AF 1BKBA 1H9KA 2IJ0A 2PNHA 1LABA 1M4VA 1BR9A 4AYBB 4DR4L 1ENAA 4A3JG 2CQOA 4A3DH 1B3QA 3CCVA 1G2SA 4QQBX 1Y1VH 2L55A 4JCVE 4A3EB 4A3KB 2F0DA 5EJWA 1QWYA 3HKSA 5ELDA 4A3IB 3DLLA 3LNNA 4A3BH 1O80A 4C3JH 3CKIB 1SYFA 2QEXA 2A19A 1TWGH 4IO9A 3S1MB 4LUVA 1I94Q 3HFZB 3HOXG 2JA8G 2F0FA 3PO2H 1N36L 1CK1A 1GHJA 1NR4A 4XXEA 3J80E 4R4TA 2JA9A 4C2MH 2R3ZA 3WWVA 5CR3A 1BF4A 2XVSA 2D2CC 2RDGA 2WV6D 4KK7A 5IGDA 4LF7Q 2LXJA 1S5ED 4H02A 4JW0A 1IYUA 2CKZB 1KNEA 1CSPA 1VQCA 2PW5A 1BCPF 3K0XA 2B8FA 5KEEA 4LMQD 1KRTA 4A93G 4C3IG 1SFOH 3S15B 1CHPD 3CMAA 1I4XA 1YBYA 4E6IA 1O7IA 1XNRQ 2UUCL 3HG9A 3JAMc 3J7ZC 2IX3A 5D65A 1H9SA 3CQZH 2PQEA 4XYOA 4KMUC 1VQAA 3CF5A 4NB3A 3VYTA 4A3BB 3W3AA 3GTJB 2JK8A 3T13A 4NXML 2JA8H 2ATWA 4BBSG 2R93H 2BA1A 2EXZA 3M3YB 5JEAH 1ET9A 3PIO3 4XT3B 2Z4IA 2VQFL 1Q7YC 4A76A 1EYCA 4ZUIA 2EY6A 4Y7NH 3X3NA 1WI5A 1ZYRC 2PW7A 3GO5A 4R8IA 3DMUA 4A3FB 5IWAL 1JICA 1A3UA 1DGSA 3OW7A 4A3JH 1MSHA 1I5FA 1GUGA 2A69C 1O7YA 4K8JA 2KENA 4JI0L 1QVFA 1QB5D 1FGUA 4HMJA 1PTOB 1X3FA 3EQLC 1GKHA 2KVMA 2UXDL 2R7ZG 3BS1A 4JI4L 3D4WA 4DR5L 1SSOA 2OQKA 2KCNA 2FMCA 4X66Q 2QEJC 2VY3A 4PZ8A 4RGOS 1PTOD 2DUDA 1STEA 1PXUA 2Z8LA 3NBHA 4A3DB 2PQAA 4RFBA 4GLAC 5HGQA 3CRKC 4GNXA 1GUOA 3DEOA 1JCKB 3K6OA 4JBMA 2JN4A 1CT1D 1ENFA 1ONLA 2K5HA 5IYCH 2DNCA 4DR7Q 2KOLA 1VQ5A 1UNSA 4IPGA 2EY2A 2Q8IB 2UUCQ 2F0MA 1O7ZA 2RDHA 3MXPA 3I3CA 3AYHB 2AWOA 1X54A 1EU4A 3VYRA 2A6EC 1EQTA 1EOTA 1I4PA 1HNWQ 1Z47A 1VQIA 2ZXPA 4CDCC 2VS1A 4GKKQ 4X6AH 2JP1A 4HJ8A 3OW2A 4K2LA 3HRZC 1N36Q 4DUZL 4JPBW 3S1QH 3OIQA 2R7ZB 4LFBL 5I9OA 1CI3M 3M4PA 2HT1A 4KHPQ 1S5DD 3I4NB 3A8JE 1WTOA 5M3MG 4X3KA 2B63B 1A15A 3DWQA 3TRZA 2NZHA 1PH5A 4J15A 5CYUA 4JV5L 5I4DA 3TP5A 1VF5C 4OO1G 1C9OA 2M9VA 3A74A 4KV6A 1AW7A 1PZID 4RGMA 1FR3A 4DAVA 3S9WA 1HNZQ 4C3HH 3GTKH 5CV9A 4G57A 2F0NA 3FVQA 1OO9B 4K6LA 4R4OA 2J4XA 2NWGA 3GTKB 4U68A 4DV4L 1K8MA 4YCWA 4OX9L 3GV3A 4PNYA 2OT2A 1RTNA 3RLOA 5LL6S 1AH9A 1EY7A 4R4QA 1L1OC 3PUXA 1JQYD 4CDEC 1QVCA 4PMWA 5FLMH 1EQRA 1F2YA 1H9RA 1CKOA 4AYBG 3KF8B 4YCVA 3GV6A 1AZPA 1LTBD 2R7FA 1G291 2YTVA 3CC4A 1H95A 1HZ9A 3OHXC 3ITPA 4M1UB 3I7FA 3K80C 3KF6A 2F0OA 1XNQL 1STHA 4DV0Q 4A4IA 3F2DA 4B3MQ 3FMCA 1I3QB 4BBRG 3OTOL 4A3GH 2FHTA 4DV1Q 3HKZE 2LMCB 2K28A 4K0KL 4JOIC 5DM73 2N78A 2NTSA 1A2UA 3UDXA 1OTCA 5K36G 5GAGC 1SYBA 2E76C 2ASBA 4A3LG 2KCMA 2VUMB 1RHPA 3UDGA 2X6GA 3TS0A 1QILA 1OXXK 4DV3Q 1TU2B 1FNVA 3TS2A 1HFNA 2YU9H 1JT8A 2M00A 1I4GA 4L5TA 4OELB 5GAEC 1Q81C 3QO2A 5KNCA 3I4MB 1ENCA 3SK6A 3K59A 3W5OA 3S2DB 4HIOA 1Q82C 4FXDA 1WCMH 3BYYB 2F0HA 3L3OC 2E2HH 3HGBA 4BY1H 4IURA 4UY8C 1RTOA 1AN8A 2D0OA 1TIID 1LT3D 3BZDB 5I6WA 4PZ7A 1TWCB 3E0EA 4CJ0B 1CZGA 1QOHA 1EOVA 4JI7L 1HA6A 2EVBA 4JYAL 3KDFA 3GTMH 1YNND 1X6OA 4B3SL 4QGUA 4C3HG 2VUMG 3FPPA 4RGTA 4DR3L 1G91A 1F77A 3OMCA 3LGJA 3ZJYC 1DOLA 3D3RA 1BBUA 4B08A 2JE6I 4ULLA 2F52A 2NVXH 1Q1EA 2G9DA 5AJ3Q 4LAAA 1R9TB 4TKOB 2A6ED 4JI2Q 2ZJRA 2K5QA 3T4AC 4N9TA 2OTLA 3M85A 3L9AX 2QA4A 4DXGA 5C5LA 2XSCA 1T5XD 3GTGH 3VR5A 1PH7A 2DY7A 1KABA 3K57A 4G7ZC 1GUSA 5C5MA 3MXNA 1NMFA 1S40A 2Z4HA 2PYKA 3MZ5A 3VR3A 1X3PA 3P1HA 5IYDG 3FDTA 5COYA 2I46A 4EX5A 1BBWA 4H0LC 4JG2A 1LV9A 3C46A 5I9PA 4OEMB 4OHJA 2E2JB 1RIPA 2ZTCA 3T1YQ 1M90C 3AB9A 2XIWA 3FPUB 4DKAC 4QY7A 4LWCA 3AU7A 3K7UC 1B44D 5I2YA 3DHQA 4DR5Q 2JA6B 5G3LD 3Q8DA 1GO3E 1EY6A 2QF7A 4YWMA 2N55A 4P73A 1PLFA 3JAML 4C3JB 1NSNS 4BXXH 3L0OA 3OOCA 3H3VI 3F1ZA 5IE8A 4QUCA 1KQSA 2LXKA 5BN3A 5IY0A 2GA4B 1YI2A 4RWSC 2IPKD 1XWEA 3OWFA 3I73A 5IT9c 4RA8A 2K75A 1Q8KA 1GUTA 4DV5Q 3KJPA 4MZ9A 3GQBA 1EY4A 1VQ8A 2DGYA 1X3EA 4H44C 5I6YA 1PRTC 2RKSA 5M3MH 3ERQA 1Q90A 4C3IB 1GXDC 3D4RA 4MN3A 1F9QA 1SE4A 2K6AA 2E5LQ 3GP7A 1L1OA 1AFPA 2EYHA 4LUOA 2UXCQ 2E2DC 4A3IH 5KRUA 4RKBA 1WTHA 2UXCL 1N33L 4ID6A 4F88A 3IFTA 2ICEC 2QKIC 2HUGA 4O1NA 2HQLA 4MTKA 1K8OA 4JI6L 2HCIA 2F0TA 4A3LH 3GTQH 4KTAA 1K73C 1LO5D 2PMZE 4IUQA 3I4MH 1B53A 1LUZA 3M4YA 5CC4A 4C3IH 2N49A 2JA7G 3ERSX 3S15H 5IGEA 2B2WA 3M4QA 5IGFA 1A3VA 3HOXB 5JEAJ 5AJ3L 3IFDA 1KRSA 1PV4A 2L15A 4GS3A 1ZEQX 3PF5A 1HTLD 3T16A 4POFA 1V1QA 3H0GG 5IYBH 1N8RC 5EPJA 4K14A 1N33Q 2EJMA 2L5TA 2UUBL 1A2TA 1BCPD 2DJGC 1WTVA 1AZQA 1K3BC 2AKWB 4DK1A 3ONAB 5EQ0A 4I7AA 1K28A 4IOAA 1HRJA 3Q24A 2C9OA 2HDMA 4RCNA 2BCOA 2O4XA 1Q3LA 1UE7A 5IGGA 5IP9G 2KJXA 1G6PA 4K0KQ 4GKJL 1R4QB 1TS3A 4CKCA 3QB3A 5A35A 1U4MA 2AWNA 2G5DA 3OMGA 4DUZQ 3M7GA 4DF7A 2NN6I 1UEBA 3UDFA 1VQBA 3CCUA 4ZAIA 4DV3L 4X66L 3CCSA 4BY7G 2DJFC 2F0KA 1WCMB 1L2FA 1NJIC 2R7DA 1WTQA 4A93H 1S4ZA 3RLFA 1DJRD 3TZDA 2A6HC 2WINB 3BVMA 1D5ZC 5CMDA 2SNSA 5C44G 4ZKCB 1Y1VB 3NTIA 2D9UA 1SR3A 4LK1C 4DR7L 4DGZA 5L37A 4HSPA 1SNOA 3PUZA 2JA5B 3A54A 1MGSA 1PFBA 1EY0A 2VW9A 4IQZA 2CHBD 1BDOA 5EBCA 3GTMB 5IIFA 4GKJQ 3PCOB 2XRSD 4ZCKA 2QW7A 4KY5A 3FEWX 2K14A 3HZXA 1AE2A 2MHVA 2Q2IA 1I3QH 3F2BA 2VXWA 2K5DA 4YY3Q 2F0PA 1VQEA 1SMXA 3NHHA 2Z0SA 1D1IA 2XWJB 5FO8B 5D3DA 3KLSX 4LF5L 4K6DA 1OXUA 2I5LX 3LX0A 2SNMA 4PG3A 4GN4B 1H9SB 1L0XB 1IKMA 4ME5A 1TWHH 1UAPA 3RLNA 4DK3C 1I4RA 1FD7D 2L11A 2PNRC 5CBAE 5J22A 4IPCA 2YU9B 1QJOA 3DM1A 5FO9B 3J81L 1PRTB 4A3KH 4QCLA 2B2UA 3H09A 4QUFA 1SNCA 3TDQA 2FJ2A 3R8BA 5K5PA 3CD6A 1VMPA 5LMUQ 5M5WB 2NVQH 1K8GA 2F1MA 5M3MB 2CQAA 3D6WA 4DV2Q 2NZOA 5DLQE 1CUKA 1L0YB 3NENA 4JOIA 1FVIA 2HHHQ 4A3GB 1NBWA 4QF4A 5IGBA 2XWBB 1EYGA 3H0GB 5DNFA 5T1GA 2Q8TA 2AMCB 1T5EA 2QILA 2CW0C 3ER0A 4FF4A 3NWTA 3GDEA 2SEBD 4JK1C 2C5CA 1VQOA 4FF1A 4KJNA 1SDFA 2DN8A 4NW2A 1AP0A 1Q1BA 2NZ1D 3HKZB 5FJ8H 4G4KA 5EPLA 2IY5B 4IFDH 2JA5G 1SYEA 5E4XA 2JA8B 1EIGA 2NVXB 4L5RC 3HOWB 5FJ8G 3GTJH 1J9OA 1O7LA 3RZOH 1U5KA 2B29A 3RR5A 4JI1Q 4DR3Q 1J5EL 1E1TA 3HOZB 3VYSA 5KYIA 1S5FD 1JR0D 3J7AV 3UE1A 4X65Q 1WVLA 1SROA 3VR2A 2YTXA 3G4SA 5CV7A 2UU9L 2NB0A 4YCUA 4DN4M 1QUQB 1VCIA 4ABNA 2Z9HA 1KLUD 5IWAQ 1VQ4A 4HIDA 2JYOA 4V0BA 4IFDI 4HEDA 2K5NA 1SNDA 1ILPA 2RHSB 1XMQL 5JJKA 2N3SA 2NYZD 3U9SA 5I2XA 3RZDB 2VB3X 3HOZH 4HJ9A 1FNUA 4DAYB 5HGTA 2K4KA 3PIP3 3HOUH 3C1EA 1BNZA 4A3FH 4KHVA 3KBGA 1TS4A 4O0AA 2KHSA 1S5BD 1F2MA 3NK9A 1XTCD 5M3FB 4FNFA 3MWYW 3PO3H 5IP7G 1S72A 1JB7A 1Y8NB 2D5DA 2L9HA 4B9XA 1K9MC 3HOUG 3DWPA 5FK9C 4L6TB 1XNQQ 2F4VL 1STAA 2WACA 5JJIA 3BZKA 4HJAA 4B3RQ 1DONA 1HNZL 4FF3A 3A8KE 1PYSB 3J81E 2EQSA 3STBD 2WB1G 2K01A 3S1RB 2UUBQ 1EIYB 2A5HA 2SOBA 3NEMA 1WD1A 4APVA 3I55A 1ILQA 4A93B 5EBDA 1KHIA 1F9PA 1MJCA 2YYZA 1IBMQ 2VL6A 3PUYA 3S1RH 4WJ3M 2E2IB 3IL8A 3K81C 1WTRA 4MNOA 2Z6BA 4DAPA 1I50B 4PZ6A 1VQ6A 1MIUA 1E2ZA 1HNXL 3S2HH 4DFAA 5M5XH 1E0BA 3CRLC 4DPGA 3URYA 2MO0A 3EFXD 5JJZA 1SN8A 4LF6L 4QIWE 5CBEE 3ULJA 3CCJA 5EKKA 1STYA 5M3FG 3UI2A 4DXFA 2NVYB 5C0XG 5C4JB 4MTNA 5BN5A 1KAWA 2RBMA
chains in the Genus database with same CATH topology
1ICFB 4CDDC 4CDCC 4CDFC 4CDEC 2DJGC 2DJFC 4OEMB 1MHWC 4OELB 1K3BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICF B;  4CDD C;  4CDC C;  4CDF C;  4CDE C;  2DJG C;  2DJF C;  4OEM B;  1MHW C;  4OEL B;  1K3B C; 
#chains in the Genus database with same CATH topology
 2ZTE A;  2YV5 A;  1TXY A;  2MUY A;  2OEO A;  2K50 A;  1HR0 W;  4R4C A;  2G9H D;  4X64 Q;  3IRB A;  1VQ7 A;  1B50 A;  2UXD Q;  1JWM D;  1OXV A;  2XGT A;  1LTA D;  3NXW A;  2R61 A;  2OCE A;  1GM5 A;  5COR A;  4JI7 Q;  3NEL A;  1J6Q A;  3KJO A;  1EUJ A;  2V1C C;  3U50 C;  2IHF A;  3UE0 A;  3P75 A;  1SXT A;  1VQF A;  4C1N K;  4OWW B;  1LTS D;  1F2L A;  2CWA A;  4CGY B;  1SMY D;  2IW3 A;  3H3V C;  3PO3 G;  1VQD A;  3NPP A;  4NXN Q;  3S14 B;  1EIF A;  4KY6 A;  4BY1 G;  1IW7 D;  2Y0S E;  4KN4 C;  1SLJ A;  3WOE A;  1CZW A;  1TS5 A;  3KLS A;  2R92 G;  4R4I A;  2K52 A;  3M3Y H;  1R9T H;  3Q0A A;  1X32 A;  1SBB B;  1WOC A;  3TP8 A;  2A68 C;  4CJ1 B;  1G6Z A;  4V19 0;  3E0J A;  3H15 A;  3KF6 B;  1X55 A;  3PMF A;  3N6R A;  3ND9 A;  2LY7 A;  4Z9C B;  4DV5 L;  2VB2 X;  3PGZ A;  3CU7 A;  5FLX E;  1FGB D;  2GN5 A;  4DR1 L;  4GLX A;  5E4W C;  2Y0S G;  3KFU A;  3I90 A;  1W2B A;  4IJL A;  3K5L A;  5NUC A;  2NUC A;  1MKH A;  5CV8 A;  4HSV A;  3SR1 A;  2ZJQ A;  1D5X C;  1TWH B;  1K0R A;  1BVS A;  5IYC G;  2QCP X;  3GTO H;  2B2Y C;  2KED A;  3SK8 A;  2AHO B;  1Z9F A;  4HCE A;  4B3T Q;  3J80 L;  2H5X A;  4KLK A;  3EJI A;  4FXG C;  4CKE A;  3FHW A;  1LT5 D;  5LMN Q;  1QNU A;  2K32 A;  1YHA A;  1SNP A;  2RQX A;  1VQH A;  2QGQ A;  1ZKO A;  5A2Q L;  3S17 B;  1LLR D;  2FIN B;  1PH1 A;  2RVL A;  4J8Q A;  5IP7 H;  5TSS A;  5EKL A;  1E3P A;  3VR6 A;  2ZM6 Q;  5IGC A;  3KF8 A;  4OL7 A;  3OIP A;  3HOV G;  2O2L D;  4PV1 C;  5J3B A;  1SJE D;  4OWT B;  2PI2 A;  1XNR L;  1MSG A;  5EPK A;  1HUM A;  3T53 B;  1K0S A;  1PMR A;  2BH2 A;  2R93 B;  4A75 A;  2IX1 A;  1PTO H;  1IZ6 A;  1LTG D;  1GJX A;  1GUW A;  3S2D H;  4JI3 L;  4DV6 L;  3MEF A;  1BQQ T;  1Q12 A;  2CH4 W;  4B3T L;  3VR4 A;  1HTP A;  4DV7 Q;  1V1O A;  1TWA B;  5JVG 3;  4JI8 L;  1SAP A;  4LNQ A;  1ICF B;  2SDF A;  4K8I A;  2TSS A;  1JWS D;  2IL8 A;  1GUN A;  1C0A A;  1RF2 D;  3I56 A;  5FKA C;  3HOY H;  4LF4 L;  4KD4 A;  1C48 A;  1W6J A;  4N8F A;  2B2U C;  3J81 j;  4QL5 A;  1EWH A;  3CPW A;  2F4I A;  4I65 A;  4LF9 L;  1IL2 A;  1W3S A;  3ND8 A;  1YNX A;  4TSS A;  2RSN A;  4AH6 A;  1L1O B;  1DCZ A;  2Z6K A;  2VQE Q;  2KUM A;  1PZJ D;  1FNW A;  3DM3 A;  3KUP A;  1NY4 A;  3M9B A;  4KKU A;  4P2C B;  3G6J B;  4ZUJ A;  1SFO B;  4KHZ A;  2PPB C;  2F0I A;  5LMN L;  3R2I A;  2F0Q A;  1EY8 A;  4ME3 A;  1N32 L;  1B1Z A;  1UEA B;  4NP5 A;  4X3S A;  4GNX B;  2OTJ A;  1IKL A;  5FO7 B;  1B9M A;  3B6Y A;  4DUY Q;  1KD1 C;  2AQ1 B;  4CDF C;  2B63 H;  2ENB A;  1JE5 A;  2KQ3 A;  1TWF B;  1WTW A;  2X69 A;  1ASY A;  4L5S A;  5C0X J;  4RH6 A;  2D0P A;  1PTO F;  4JI0 Q;  1XMO L;  3CC7 A;  2XNA C;  4XIG S;  4LFC L;  3K5N A;  2XRQ D;  3QJY A;  2O5J C;  2K5W A;  1TQO A;  3TRE A;  4C56 C;  3DEP A;  2K33 A;  2L1B A;  3GTQ B;  5M9O A;  5C0X H;  3PIO A;  3J7Y W;  5J1Z A;  5C3E H;  3WDN A;  1EL0 A;  2CH4 A;  1WFQ A;  5EGT A;  2H4O A;  2HCC A;  2NN6 G;  3MAQ A;  1CQV A;  1KAA A;  1RL2 A;  3QOL A;  4AIM A;  3RN2 A;  1YNJ C;  4R1J A;  1PRT D;  4UHV A;  5FLX c;  4L5Q A;  4LF6 Q;  4JV5 Q;  1X3Q A;  4XTC S;  3VA7 A;  1BCP C;  4A3M B;  4LF8 Q;  3K5O A;  3V2T A;  4JI6 Q;  4XDX A;  3D4D A;  5C6A A;  3A0J A;  1EWI A;  5C4X G;  1JB3 A;  2QDL A;  2EYJ A;  1PH4 A;  2AUK A;  2CFM A;  3QWN A;  1LTR D;  2F3I A;  1UUP A;  2HDL A;  1B70 B;  4U67 3;  1YVC A;  2F0V A;  3DUZ A;  5ISR A;  4GKK L;  1Y1W B;  5M5W H;  2NVQ B;  2ZJP A;  2RHQ B;  1U4L A;  2EE1 A;  4RMF A;  4X62 L;  4YY3 L;  2N88 A;  5ELF A;  4NXM Q;  3FKI G;  4GLV B;  2NVT H;  2VZA A;  3NTK A;  4KHP L;  5C4H A;  2ZXO A;  5C44 B;  1F9R A;  1I6H B;  4NKL A;  4P74 A;  2EYF A;  1DZ1 A;  3V05 A;  4HIM A;  2B2V C;  2BA0 A;  5C44 H;  3L2P A;  2M2L A;  3KLR A;  2JA5 H;  1TVX A;  3HOZ G;  2IHE A;  4UPA A;  3HOX H;  4IJH A;  3MC0 B;  4KN7 C;  1I50 H;  1XMO Q;  3CP0 A;  2HIV A;  4LFC Q;  5EAY A;  1PFM A;  3ULL A;  2EYL A;  2KA7 A;  4IZ8 A;  2O5I C;  2VQE L;  5JPN C;  4L8J A;  2WAQ G;  3QG1 A;  1NNX A;  3NBH B;  1ICW A;  4POG A;  3A7A B;  2R93 G;  5H1S E;  1YHQ A;  1HQR D;  1N32 Q;  5AFW A;  1QUQ A;  3G6E A;  2EJF C;  5KND A;  4BS9 A;  1PH8 A;  3HOV B;  2PMZ B;  3EIV A;  4JBJ A;  1P16 A;  5JAV A;  3VDY A;  4J1M A;  1II3 A;  3A8I E;  3BVZ A;  2UU9 Q;  4L63 B;  3S17 H;  1H9M A;  3J80 i;  1U0L A;  3CQZ B;  4X64 L;  2I5M X;  3HOW G;  5D3I B;  2FXQ A;  4S3S A;  5ELB A;  3BZC A;  3C1F A;  1KLG D;  1B2T A;  2C35 B;  4GOP C;  3NUC A;  2KEC A;  1BXT A;  1KC8 C;  5C3E G;  3I4N G;  1XJV A;  1G51 A;  4AQY L;  1SYG A;  2ZT9 C;  5F2D A;  4HAE A;  3U4V A;  1WCM G;  3RMH A;  3D0F A;  2JJQ A;  4K2K A;  1A3T A;  4O42 A;  1J5E Q;  5IT9 E;  3S16 B;  2L0C A;  4C2M B;  4O2D A;  5M5Y B;  2PCF B;  3NE5 B;  1CKM A;  2WP8 J;  1EYA A;  4GOP B;  5JPM C;  3MA2 B;  4PQX A;  2HQE A;  3PIP A;  2Q2U A;  1TY0 A;  3MFY A;  2WB1 B;  2DY8 A;  2B8G A;  4YWL A;  2JA6 H;  1PH9 A;  4P72 A;  2EYP A;  4JI3 Q;  4B3R L;  1ESF A;  2A73 B;  4XQJ A;  2E8G A;  4UP7 A;  3W1G A;  4B3M L;  3S24 A;  2EYM A;  3NSW A;  1E7Z A;  2J7Z A;  1JJ2 A;  1V9P A;  4H13 C;  4WJ4 A;  2K03 A;  2B2T C;  2I07 B;  1RDP D;  2PZW A;  4WFN 3;  2H1E A;  1X9N A;  3S1Q B;  1C8C A;  2E2H B;  1N34 L;  1XX8 A;  2L12 A;  1FJG L;  1HUN A;  2P5Z X;  2F0E A;  1IYV A;  1SYC A;  1JJC B;  1N34 Q;  1FJG Q;  4TRD A;  3MHB A;  4F87 A;  4NMZ A;  5KIX A;  4OON A;  5C4Z A;  3G7L A;  1IBK L;  1NE3 A;  3JAM i;  1EWC A;  1VDZ A;  5ELE A;  3U9O A;  2L4N A;  5J39 A;  2KEE A;  3RNU A;  1UE5 A;  2EY1 A;  4ODG A;  5C0X I;  4EQO A;  1BBX C;  3P7J A;  4LFA Q;  1TT2 A;  1EFI D;  3U58 A;  2WII B;  2JSO A;  4FO2 A;  1FL0 A;  2KHJ A;  3D6C A;  3I91 A;  1LAC A;  3K7A H;  3SDZ A;  4DUY L;  5C4X B;  1JOO A;  1EEF D;  2E75 C;  3NQI A;  3OYY A;  1C7Y A;  3RUZ A;  2K1B A;  4JYA Q;  1B4O A;  2RF4 A;  4FP5 D;  1HCZ A;  1WYD A;  1HR0 Q;  1ET6 A;  4OXP A;  3TEH B;  1A63 A;  2JXM B;  3PSI A;  3EN2 A;  4FVM A;  2I5H A;  4BY1 B;  3CCM A;  1YZ6 A;  2XN9 C;  1ML0 D;  4IUT A;  2MGS A;  3C3L A;  4UP9 A;  4A3E H;  1KDA A;  1LM0 A;  3TP6 A;  4LJZ C;  4HJ7 A;  2E74 C;  3NBI A;  1VQJ A;  1GOZ A;  1EZ8 A;  2Q2T A;  1ROD A;  2WKD A;  2RSO A;  1TR5 A;  2BDO A;  4BA1 I;  1QVG A;  1EU3 A;  4EQP A;  1AE3 A;  2F3V A;  4RG1 A;  1M8A A;  5GRO A;  1YIT A;  4X3T A;  1X65 A;  4C3J G;  1Q46 A;  2F0W A;  3M7N A;  2LKV A;  4NDX A;  2LFN A;  3X3M A;  2Y0S B;  1YHB A;  2F0J A;  4P75 A;  4A3G G;  2Z6K C;  3GTP H;  5DM6 3;  1IYJ B;  1SE2 A;  3NTH A;  5IP9 H;  3E3X A;  5C3E B;  2HHH L;  1QCB D;  1XPR A;  2WAQ E;  4YIJ A;  4YWK A;  2E2J H;  4XYQ A;  1VS0 A;  4IFD G;  3AMU A;  4OIJ A;  1B9N A;  1V1P A;  1U4P A;  3AFQ A;  2R6G A;  3OTO Q;  5CV6 A;  5E3F A;  3E9I A;  1Q8I A;  1DXM A;  3BU2 A;  1UE6 A;  2FMM A;  1I6H H;  2BH8 A;  3SHL A;  1STG A;  1HZB A;  2OXP A;  3H0G H;  5IYB G;  1MJE A;  1E2W A;  3H91 A;  3CCQ A;  1HHV A;  1X3G A;  1V1P B;  3MXU A;  5C3X A;  4ZK9 B;  1T9H A;  5C3W A;  5KYL A;  1CA5 A;  4QJF A;  4DAM A;  2I0Q A;  1KTK A;  1VQP A;  1IBM L;  5FLX L;  2JEA I;  4OO1 H;  4R8N A;  5ELC A;  3T1Y L;  3GD7 A;  4KD3 A;  4ZLT F;  1G2T A;  4C3H B;  1IW7 C;  3CW2 C;  1MHW C;  3BYT B;  2B2Y A;  1Z6H A;  1HXY D;  2KHI A;  1LTT D;  2CWP A;  4A3B G;  2OWO A;  3Q23 A;  1QZG A;  1EQV A;  3F8T A;  2NBF A;  2NVT B;  4DV6 Q;  3TZU A;  5C4X H;  2NN6 H;  2HIX A;  2K04 A;  3KK7 A;  4BBR H;  4XQN A;  1TWC H;  4A3C G;  3T51 B;  4ALP A;  1KXL A;  4P71 A;  1PH6 A;  3I4L A;  4UP8 A;  3EA6 A;  1LTL A;  2B2W C;  1PTO C;  4LF8 L;  5M3F H;  2ZM6 L;  2V4D A;  1S5C D;  1E1O A;  5HY6 A;  3J80 c;  4A3C H;  4A3E G;  3KYH C;  4JC0 A;  1CKN B;  1B3A A;  4WJW A;  3HP3 A;  4DR4 Q;  1C4Q A;  2A74 C;  4DR2 L;  4JI5 Q;  3BJU A;  3HOY G;  3I70 A;  1F9S A;  4HN7 A;  4N9P A;  4BXX G;  2RDF A;  1K8A C;  1B8A A;  3GTG B;  4KJO A;  1IHZ A;  5M5Y H;  4C1N I;  1L0W A;  1JMC A;  1JOR A;  4ZKB B;  4NXN L;  1LT6 D;  1RD9 D;  1U9R A;  5FOB B;  5CV5 A;  1EEI D;  4GN3 B;  4YHH L;  2DNE A;  2KCC A;  3AFP A;  2EXD A;  1TS2 A;  1Y1V G;  1MD2 D;  1I6V C;  5LMN W;  1NAP A;  2ZTD A;  3GTL H;  4FXK C;  2Z1C A;  3I4O A;  3W1B A;  2A6H D;  3LWU A;  4Q5V A;  1SMY C;  1IL8 A;  1H9J A;  3NP8 A;  4PMB A;  2EY5 A;  4RAU C;  1GVP A;  4WRD A;  4DR2 Q;  4GN5 A;  2GVA A;  4JI5 L;  3F2U A;  4G7O C;  1EYD A;  1MBY A;  2B2V A;  3BDO A;  1HPC A;  2EJG C;  3K7A B;  1XPU A;  3K8A A;  4DK0 A;  3F2C A;  2OF1 A;  1BO0 A;  3BVG A;  5G3L F;  4DR6 L;  1EZ6 A;  4BY7 H;  4QIW B;  1Y69 U;  3CXC A;  3SK4 A;  2WAQ B;  3QIA A;  4DV7 L;  1E24 A;  2F0G A;  1VQG A;  2PI2 E;  4EGV A;  3A5U A;  4K5X A;  4LF7 L;  5ELN A;  4BWG B;  4IOC A;  2GVB A;  2MQH A;  5GAH C;  3I72 A;  4ZQ3 A;  2RA4 A;  5DEH A;  2KCT A;  1VQM A;  4MHE A;  3PUW A;  1CM9 A;  4GOP A;  1N9W A;  3ULP A;  1IBL Q;  3FRP B;  1JOK A;  3C2P A;  1XTD A;  3SE0 A;  3UDI A;  1A0I A;  3VYU A;  4HTH A;  2IWH A;  2E5L L;  4BBR B;  5BN4 A;  3JC6 6;  3K58 A;  1NR2 A;  1VF7 A;  5BR8 Q;  1D7Q A;  4JBK A;  3MXN B;  3WOF A;  3SXH A;  3H3V H;  1HH2 P;  4IAL A;  4G7H C;  3FKI B;  4EQN A;  3IAY A;  1I94 L;  3SVM A;  3NWS A;  4DR6 Q;  3TQY A;  4RKL A;  4DU9 A;  1TKW B;  2BE5 D;  3OPO A;  3RD4 A;  4RHR A;  1IXR A;  1EY5 A;  2FFK B;  1Y1W G;  1CHQ D;  1CTM A;  4LFB Q;  1DYQ A;  3S2H B;  4DAY A;  4TVA B;  4F8M A;  3SGI A;  2JA7 H;  4X65 L;  4LF5 Q;  3CCR A;  1PH2 A;  4X3U A;  3AEV A;  4OIK A;  3PO2 G;  1DD2 A;  3MVV A;  1TWG B;  5HUR A;  4GNX C;  3FP9 A;  1PRT F;  2RCF A;  4FDB A;  3TME A;  1JJG A;  2QDB A;  4A3D G;  1SEB D;  4A3M H;  1PVO A;  1BUV T;  2MFI A;  2JQO A;  3PUV A;  4CHT B;  1AEX A;  4FF2 A;  1Y14 B;  4WOR A;  3J7A 5;  4AYB E;  4IN3 A;  4LF9 Q;  3MTS A;  1SJH D;  3CCE A;  1JE4 A;  3CAM A;  2F0L A;  1CQF A;  2LS0 1;  2PZT A;  4AQY Q;  4Y52 H;  1Y1W H;  3K0Y A;  4IUV A;  3PO3 B;  1PZK D;  3R3O A;  3KBX A;  1ASZ A;  1I4H A;  1ZXT A;  4TQU S;  5E1F A;  2B3G A;  4HJ5 A;  2RCN A;  1O78 A;  3GTO B;  4A3J B;  4CKB A;  3NQT A;  1VQL A;  3E6Z X;  2JEB I;  4IPD A;  3KOJ A;  3TP7 A;  1VMC A;  1JWU D;  2F0U A;  1VQK A;  1BOS A;  3FKI H;  1SRU A;  3HEJ A;  4ILW A;  2ID0 A;  4DA2 A;  4DV0 L;  3PV0 A;  2LSS A;  1CSQ A;  1V8Q A;  1NMG A;  5LL6 X;  3AQQ A;  1YJ9 A;  2JA6 G;  3I4M G;  2PZU A;  3G48 A;  4H7B A;  2ES2 A;  3ERO A;  1EIH A;  3R2T A;  4KI0 A;  1W6K A;  5DAU A;  4DK6 C;  4IUN A;  1YNN C;  4OGQ C;  4XT1 B;  1EQQ A;  4CBV A;  4BBS B;  2OQ0 A;  2Q8R E;  4X62 Q;  1D8L A;  2HD3 A;  4JI1 L;  1LYL A;  1V43 A;  2B63 G;  3GTP B;  2EDG A;  1D5M C;  1CKN A;  1VQ9 A;  1J8I A;  1KNA A;  3S14 H;  5IYD H;  3A56 A;  2UUA Q;  4N8X 1;  1PA6 A;  3RZO B;  3J81 c;  2NVY H;  3KDF B;  1WD0 A;  1XPO A;  4JI2 L;  3HOW H;  4LW1 A;  1E22 A;  1XYI A;  4BY7 B;  1JC7 A;  2F0S A;  1PFN A;  3TN2 A;  2UXB L;  1JOQ A;  4IUU A;  3SK5 A;  4K5V A;  3CCL A;  1DOM A;  4CDD C;  2UXB Q;  5JOB A;  1ESR A;  3S1N H;  5M5X B;  4IFD J;  4DV4 Q;  1SYD A;  5CV4 A;  3A55 A;  3PO2 B;  1HNW L;  2TMP A;  4OWX B;  1WTX A;  1XXG A;  1F2Z A;  2MP1 A;  3HS0 C;  3QR8 A;  5LMU L;  1XMQ Q;  3I2Z A;  3H6M A;  5GQO A;  5JJL A;  3Q22 A;  2ICI A;  5KGU A;  5K36 H;  4B3S Q;  2AUJ D;  1SNM A;  4GZY C;  3RN5 A;  1A62 A;  2PO4 A;  4M8A A;  2XTI A;  3T56 B;  4Y7N B;  5IOC A;  2UUA L;  4FYD A;  3O13 A;  1HZA A;  2J0T D;  2F4V Q;  2R7Z H;  4KY7 A;  2YTY A;  3I8Z A;  1YJN A;  3OWE B;  3M4O H;  4YHH Q;  2MPM A;  4RCO A;  2BE5 C;  1PFS A;  2WFW A;  1QNK A;  5FLM G;  3EBE A;  4Q0F A;  3M4O B;  3KLW A;  2EYO A;  4JVZ A;  5CGK A;  1HR0 L;  1CA6 A;  4DR1 Q;  1QE6 A;  3OSO A;  1TY2 A;  2EIF A;  2AQ3 B;  2X6L A;  3STB C;  1SE8 A;  2WB1 E;  4A3M G;  3ICE A;  5GAD C;  1YJW A;  2PQA B;  3DXJ C;  3H94 A;  1S3O A;  4EQ5 A;  2ALY B;  3MXG A;  1D1K A;  1X56 A;  4F7X A;  4OO1 I;  1P8L A;  1YNJ D;  4I7Z C;  1PHJ A;  3TBI B;  4DV1 L;  5KNB A;  4B9W A;  1UWV A;  3HOU B;  1D2B A;  3A5Z B;  3D31 A;  2K05 A;  3E5S A;  2EZV A;  5A2Q E;  1PYW D;  5D14 A;  3GTL B;  3DWA A;  5JEA G;  2B39 A;  2IX0 A;  2IT1 A;  2BDN A;  1E2V A;  4JI4 Q;  4IUP A;  4A3I G;  1YEZ A;  2R92 B;  2EOT A;  3R93 A;  4JBW A;  4QMG A;  2AQ2 B;  4DNI A;  4OX9 Q;  2BOS A;  4LF4 Q;  4HMI A;  3HOV H;  3HKZ G;  3PF4 A;  1OXS C;  1IBL L;  4RHS A;  3CPF A;  2K7V A;  1RJT A;  3U4Z A;  1Y8O B;  3EVQ A;  1KDB A;  4A3F G;  4R9W A;  2VNU D;  3CHB D;  1MI2 A;  1IBK Q;  5BR8 L;  1QZH A;  2NTT A;  1Z7T A;  3T1H Q;  4ZYS A;  3D8G A;  2MNA A;  2ZXR A;  1BCP B;  1DM0 B;  3JAM E;  2MJ8 A;  3IKJ A;  2A1A A;  1SE3 A;  4LFA L;  1GD7 A;  1SNQ A;  5IOD A;  1NCV A;  4ZRZ A;  1I4Q A;  1K83 H;  3BDL A;  1LTI D;  5EKI A;  1HZC A;  4JI8 Q;  1U4R A;  1FYC A;  1K83 B;  2Q2H A;  2N8N A;  1EY9 A;  2KBN A;  5E7N A;  4BA2 I;  3S1M H;  3CME A;  3RZD H;  1HJP A;  1RCV D;  3BG3 A;  3QOJ A;  3LWE A;  4A3K G;  3MFG A;  2WKC A;  3V96 A;  4KKS A;  4EVO A;  1PH3 A;  1YIJ A;  1HNX Q;  1UE1 A;  1G8Z D;  4KKT A;  1OXT A;  4HIK A;  1TWF H;  3S1N B;  1STN A;  2A69 D;  3S16 H;  4XQQ A;  1VQN A;  4NPS A;  3N52 A;  2CCZ A;  3L7Z C;  2D62 A;  4LUZ A;  1KIX A;  1NTG A;  4RGN A;  1DOK A;  3T1H L;  1KL9 A;  3HOY B;  2MO1 A;  1WJJ A;  3VA5 A;  1R4P B;  1B7Y B;  5ELO A;  1PYB A;  2R92 H;  4DNT B;  3P20 A;  2A68 D;  2JA7 B;  1HFG A;  3ZYY X;  1CFM A;  3SEB A;  3E9H A;  4DV2 L;  1EFW A;  1GHK A;  1A6X A;  1LT4 D;  3K5M A;  2B2T A;  3MEH A;  2CW0 D;  1HQM C;  5C4J H;  5JVH 3;  1RKN A;  3TSS A;  1NUC A;  4PMC A;  1D6E C;  4BBS H;  4UAI A;  5LHY 1;  5IT9 L;  1STB A;  4HCS A;  2EPB A;  3Q6S A;  1Q86 C;  1Y8P B;  3A7L A;  2VUM H;  3I4N H;  4MIU A;  2K5V A;  5T1I A;  1WTP A;  2F03 A;  4DNR B;  1M1K C;  1PDQ A;  4HR7 B;  4CJ2 C;  2E2I H;  4IPH A;  2A8V A;  3CC2 A;  2CVR A;  1TWA H;  3G71 A;  3W2D A;  3PQI A;  4UDU C;  1QG7 A;  4K5W A;  1KDC A;  1HA5 A;  4QB4 A;  3J81 i;  2F3W A;  4J6H A;  2VQF Q;  1K3R A;  1ZYR D;  1A8V A;  3BDC A;  3J7A F;  1BKB A;  1H9K A;  2IJ0 A;  2PNH A;  1LAB A;  1M4V A;  1BR9 A;  4AYB B;  4DR4 L;  1ENA A;  4A3J G;  2CQO A;  4A3D H;  1B3Q A;  3CCV A;  1G2S A;  4QQB X;  1Y1V H;  2L55 A;  4JCV E;  4A3E B;  4A3K B;  2F0D A;  5EJW A;  1QWY A;  3HKS A;  5ELD A;  4A3I B;  3DLL A;  3LNN A;  4A3B H;  1O80 A;  4C3J H;  3CKI B;  1SYF A;  2QEX A;  2A19 A;  1TWG H;  4IO9 A;  3S1M B;  4LUV A;  1I94 Q;  3HFZ B;  3HOX G;  2JA8 G;  2F0F A;  3PO2 H;  1N36 L;  1CK1 A;  1GHJ A;  1NR4 A;  4XXE A;  3J80 E;  4R4T A;  2JA9 A;  4C2M H;  2R3Z A;  3WWV A;  5CR3 A;  1BF4 A;  2XVS A;  2D2C C;  2RDG A;  2WV6 D;  4KK7 A;  5IGD A;  4LF7 Q;  2LXJ A;  1S5E D;  4H02 A;  4JW0 A;  1IYU A;  2CKZ B;  1KNE A;  1CSP A;  1VQC A;  2PW5 A;  1BCP F;  3K0X A;  2B8F A;  5KEE A;  4LMQ D;  1KRT A;  4A93 G;  4C3I G;  1SFO H;  3S15 B;  1CHP D;  3CMA A;  1I4X A;  1YBY A;  4E6I A;  1O7I A;  1XNR Q;  2UUC L;  3HG9 A;  3JAM c;  3J7Z C;  2IX3 A;  5D65 A;  1H9S A;  3CQZ H;  2PQE A;  4XYO A;  4KMU C;  1VQA A;  3CF5 A;  4NB3 A;  3VYT A;  4A3B B;  3W3A A;  3GTJ B;  2JK8 A;  3T13 A;  4NXM L;  2JA8 H;  2ATW A;  4BBS G;  2R93 H;  2BA1 A;  2EXZ A;  3M3Y B;  5JEA H;  1ET9 A;  3PIO 3;  4XT3 B;  2Z4I A;  2VQF L;  1Q7Y C;  4A76 A;  1EYC A;  4ZUI A;  2EY6 A;  4Y7N H;  3X3N A;  1WI5 A;  1ZYR C;  2PW7 A;  3GO5 A;  4R8I A;  3DMU A;  4A3F B;  5IWA L;  1JIC A;  1A3U A;  1DGS A;  3OW7 A;  4A3J H;  1MSH A;  1I5F A;  1GUG A;  2A69 C;  1O7Y A;  4K8J A;  2KEN A;  4JI0 L;  1QVF A;  1QB5 D;  1FGU A;  4HMJ A;  1PTO B;  1X3F A;  3EQL C;  1GKH A;  2KVM A;  2UXD L;  2R7Z G;  3BS1 A;  4JI4 L;  3D4W A;  4DR5 L;  1SSO A;  2OQK A;  2KCN A;  2FMC A;  4X66 Q;  2QEJ C;  2VY3 A;  4PZ8 A;  4RGO S;  1PTO D;  2DUD A;  1STE A;  1PXU A;  2Z8L A;  3NBH A;  4A3D B;  2PQA A;  4RFB A;  4GLA C;  5HGQ A;  3CRK C;  4GNX A;  1GUO A;  3DEO A;  1JCK B;  3K6O A;  4JBM A;  2JN4 A;  1CT1 D;  1ENF A;  1ONL A;  2K5H A;  5IYC H;  2DNC A;  4DR7 Q;  2KOL A;  1VQ5 A;  1UNS A;  4IPG A;  2EY2 A;  2Q8I B;  2UUC Q;  2F0M A;  1O7Z A;  2RDH A;  3MXP A;  3I3C A;  3AYH B;  2AWO A;  1X54 A;  1EU4 A;  3VYR A;  2A6E C;  1EQT A;  1EOT A;  1I4P A;  1HNW Q;  1Z47 A;  1VQI A;  2ZXP A;  4CDC C;  2VS1 A;  4GKK Q;  4X6A H;  2JP1 A;  4HJ8 A;  3OW2 A;  4K2L A;  3HRZ C;  1N36 Q;  4DUZ L;  4JPB W;  3S1Q H;  3OIQ A;  2R7Z B;  4LFB L;  5I9O A;  1CI3 M;  3M4P A;  2HT1 A;  4KHP Q;  1S5D D;  3I4N B;  3A8J E;  1WTO A;  5M3M G;  4X3K A;  2B63 B;  1A15 A;  3DWQ A;  3TRZ A;  2NZH A;  1PH5 A;  4J15 A;  5CYU A;  4JV5 L;  5I4D A;  3TP5 A;  1VF5 C;  4OO1 G;  1C9O A;  2M9V A;  3A74 A;  4KV6 A;  1AW7 A;  1PZI D;  4RGM A;  1FR3 A;  4DAV A;  3S9W A;  1HNZ Q;  4C3H H;  3GTK H;  5CV9 A;  4G57 A;  2F0N A;  3FVQ A;  1OO9 B;  4K6L A;  4R4O A;  2J4X A;  2NWG A;  3GTK B;  4U68 A;  4DV4 L;  1K8M A;  4YCW A;  4OX9 L;  3GV3 A;  4PNY A;  2OT2 A;  1RTN A;  3RLO A;  5LL6 S;  1AH9 A;  1EY7 A;  4R4Q A;  1L1O C;  3PUX A;  1JQY D;  4CDE C;  1QVC A;  4PMW A;  5FLM H;  1EQR A;  1F2Y A;  1H9R A;  1CKO A;  4AYB G;  3KF8 B;  4YCV A;  3GV6 A;  1AZP A;  1LTB D;  2R7F A;  1G29 1;  2YTV A;  3CC4 A;  1H95 A;  1HZ9 A;  3OHX C;  3ITP A;  4M1U B;  3I7F A;  3K80 C;  3KF6 A;  2F0O A;  1XNQ L;  1STH A;  4DV0 Q;  4A4I A;  3F2D A;  4B3M Q;  3FMC A;  1I3Q B;  4BBR G;  3OTO L;  4A3G H;  2FHT A;  4DV1 Q;  3HKZ E;  2LMC B;  2K28 A;  4K0K L;  4JOI C;  5DM7 3;  2N78 A;  2NTS A;  1A2U A;  3UDX A;  1OTC A;  5K36 G;  5GAG C;  1SYB A;  2E76 C;  2ASB A;  4A3L G;  2KCM A;  2VUM B;  1RHP A;  3UDG A;  2X6G A;  3TS0 A;  1QIL A;  1OXX K;  4DV3 Q;  1TU2 B;  1FNV A;  3TS2 A;  1HFN A;  2YU9 H;  1JT8 A;  2M00 A;  1I4G A;  4L5T A;  4OEL B;  5GAE C;  1Q81 C;  3QO2 A;  5KNC A;  3I4M B;  1ENC A;  3SK6 A;  3K59 A;  3W5O A;  3S2D B;  4HIO A;  1Q82 C;  4FXD A;  1WCM H;  3BYY B;  2F0H A;  3L3O C;  2E2H H;  3HGB A;  4BY1 H;  4IUR A;  4UY8 C;  1RTO A;  1AN8 A;  2D0O A;  1TII D;  1LT3 D;  3BZD B;  5I6W A;  4PZ7 A;  1TWC B;  3E0E A;  4CJ0 B;  1CZG A;  1QOH A;  1EOV A;  4JI7 L;  1HA6 A;  2EVB A;  4JYA L;  3KDF A;  3GTM H;  1YNN D;  1X6O A;  4B3S L;  4QGU A;  4C3H G;  2VUM G;  3FPP A;  4RGT A;  4DR3 L;  1G91 A;  1F77 A;  3OMC A;  3LGJ A;  3ZJY C;  1DOL A;  3D3R A;  1BBU A;  4B08 A;  2JE6 I;  4ULL A;  2F52 A;  2NVX H;  1Q1E A;  2G9D A;  5AJ3 Q;  4LAA A;  1R9T B;  4TKO B;  2A6E D;  4JI2 Q;  2ZJR A;  2K5Q A;  3T4A C;  4N9T A;  2OTL A;  3M85 A;  3L9A X;  2QA4 A;  4DXG A;  5C5L A;  2XSC A;  1T5X D;  3GTG H;  3VR5 A;  1PH7 A;  2DY7 A;  1KAB A;  3K57 A;  4G7Z C;  1GUS A;  5C5M A;  3MXN A;  1NMF A;  1S40 A;  2Z4H A;  2PYK A;  3MZ5 A;  3VR3 A;  1X3P A;  3P1H A;  5IYD G;  3FDT A;  5COY A;  2I46 A;  4EX5 A;  1BBW A;  4H0L C;  4JG2 A;  1LV9 A;  3C46 A;  5I9P A;  4OEM B;  4OHJ A;  2E2J B;  1RIP A;  2ZTC A;  3T1Y Q;  1M90 C;  3AB9 A;  2XIW A;  3FPU B;  4DKA C;  4QY7 A;  4LWC A;  3AU7 A;  3K7U C;  1B44 D;  5I2Y A;  3DHQ A;  4DR5 Q;  2JA6 B;  5G3L D;  3Q8D A;  1GO3 E;  1EY6 A;  2QF7 A;  4YWM A;  2N55 A;  4P73 A;  1PLF A;  3JAM L;  4C3J B;  1NSN S;  4BXX H;  3L0O A;  3OOC A;  3H3V I;  3F1Z A;  5IE8 A;  4QUC A;  1KQS A;  2LXK A;  5BN3 A;  5IY0 A;  2GA4 B;  1YI2 A;  4RWS C;  2IPK D;  1XWE A;  3OWF A;  3I73 A;  5IT9 c;  4RA8 A;  2K75 A;  1Q8K A;  1GUT A;  4DV5 Q;  3KJP A;  4MZ9 A;  3GQB A;  1EY4 A;  1VQ8 A;  2DGY A;  1X3E A;  4H44 C;  5I6Y A;  1PRT C;  2RKS A;  5M3M H;  3ERQ A;  1Q90 A;  4C3I B;  1GXD C;  3D4R A;  4MN3 A;  1F9Q A;  1SE4 A;  2K6A A;  2E5L Q;  3GP7 A;  1L1O A;  1AFP A;  2EYH A;  4LUO A;  2UXC Q;  2E2D C;  4A3I H;  5KRU A;  4RKB A;  1WTH A;  2UXC L;  1N33 L;  4ID6 A;  4F88 A;  3IFT A;  2ICE C;  2QKI C;  2HUG A;  4O1N A;  2HQL A;  4MTK A;  1K8O A;  4JI6 L;  2HCI A;  2F0T A;  4A3L H;  3GTQ H;  4KTA A;  1K73 C;  1LO5 D;  2PMZ E;  4IUQ A;  3I4M H;  1B53 A;  1LUZ A;  3M4Y A;  5CC4 A;  4C3I H;  2N49 A;  2JA7 G;  3ERS X;  3S15 H;  5IGE A;  2B2W A;  3M4Q A;  5IGF A;  1A3V A;  3HOX B;  5JEA J;  5AJ3 L;  3IFD A;  1KRS A;  1PV4 A;  2L15 A;  4GS3 A;  1ZEQ X;  3PF5 A;  1HTL D;  3T16 A;  4POF A;  1V1Q A;  3H0G G;  5IYB H;  1N8R C;  5EPJ A;  4K14 A;  1N33 Q;  2EJM A;  2L5T A;  2UUB L;  1A2T A;  1BCP D;  2DJG C;  1WTV A;  1AZQ A;  1K3B C;  2AKW B;  4DK1 A;  3ONA B;  5EQ0 A;  4I7A A;  1K28 A;  4IOA A;  1HRJ A;  3Q24 A;  2C9O A;  2HDM A;  4RCN A;  2BCO A;  2O4X A;  1Q3L A;  1UE7 A;  5IGG A;  5IP9 G;  2KJX A;  1G6P A;  4K0K Q;  4GKJ L;  1R4Q B;  1TS3 A;  4CKC A;  3QB3 A;  5A35 A;  1U4M A;  2AWN A;  2G5D A;  3OMG A;  4DUZ Q;  3M7G A;  4DF7 A;  2NN6 I;  1UEB A;  3UDF A;  1VQB A;  3CCU A;  4ZAI A;  4DV3 L;  4X66 L;  3CCS A;  4BY7 G;  2DJF C;  2F0K A;  1WCM B;  1L2F A;  1NJI C;  2R7D A;  1WTQ A;  4A93 H;  1S4Z A;  3RLF A;  1DJR D;  3TZD A;  2A6H C;  2WIN B;  3BVM A;  1D5Z C;  5CMD A;  2SNS A;  5C44 G;  4ZKC B;  1Y1V B;  3NTI A;  2D9U A;  1SR3 A;  4LK1 C;  4DR7 L;  4DGZ A;  5L37 A;  4HSP A;  1SNO A;  3PUZ A;  2JA5 B;  3A54 A;  1MGS A;  1PFB A;  1EY0 A;  2VW9 A;  4IQZ A;  2CHB D;  1BDO A;  5EBC A;  3GTM B;  5IIF A;  4GKJ Q;  3PCO B;  2XRS D;  4ZCK A;  2QW7 A;  4KY5 A;  3FEW X;  2K14 A;  3HZX A;  1AE2 A;  2MHV A;  2Q2I A;  1I3Q H;  3F2B A;  2VXW A;  2K5D A;  4YY3 Q;  2F0P A;  1VQE A;  1SMX A;  3NHH A;  2Z0S A;  1D1I A;  2XWJ B;  5FO8 B;  5D3D A;  3KLS X;  4LF5 L;  4K6D A;  1OXU A;  2I5L X;  3LX0 A;  2SNM A;  4PG3 A;  4GN4 B;  1H9S B;  1L0X B;  1IKM A;  4ME5 A;  1TWH H;  1UAP A;  3RLN A;  4DK3 C;  1I4R A;  1FD7 D;  2L11 A;  2PNR C;  5CBA E;  5J22 A;  4IPC A;  2YU9 B;  1QJO A;  3DM1 A;  5FO9 B;  3J81 L;  1PRT B;  4A3K H;  4QCL A;  2B2U A;  3H09 A;  4QUF A;  1SNC A;  3TDQ A;  2FJ2 A;  3R8B A;  5K5P A;  3CD6 A;  1VMP A;  5LMU Q;  5M5W B;  2NVQ H;  1K8G A;  2F1M A;  5M3M B;  2CQA A;  3D6W A;  4DV2 Q;  2NZO A;  5DLQ E;  1CUK A;  1L0Y B;  3NEN A;  4JOI A;  1FVI A;  2HHH Q;  4A3G B;  1NBW A;  4QF4 A;  5IGB A;  2XWB B;  1EYG A;  3H0G B;  5DNF A;  5T1G A;  2Q8T A;  2AMC B;  1T5E A;  2QIL A;  2CW0 C;  3ER0 A;  4FF4 A;  3NWT A;  3GDE A;  2SEB D;  4JK1 C;  2C5C A;  1VQO A;  4FF1 A;  4KJN A;  1SDF A;  2DN8 A;  4NW2 A;  1AP0 A;  1Q1B A;  2NZ1 D;  3HKZ B;  5FJ8 H;  4G4K A;  5EPL A;  2IY5 B;  4IFD H;  2JA5 G;  1SYE A;  5E4X A;  2JA8 B;  1EIG A;  2NVX B;  4L5R C;  3HOW B;  5FJ8 G;  3GTJ H;  1J9O A;  1O7L A;  3RZO H;  1U5K A;  2B29 A;  3RR5 A;  4JI1 Q;  4DR3 Q;  1J5E L;  1E1T A;  3HOZ B;  3VYS A;  5KYI A;  1S5F D;  1JR0 D;  3J7A V;  3UE1 A;  4X65 Q;  1WVL A;  1SRO A;  3VR2 A;  2YTX A;  3G4S A;  5CV7 A;  2UU9 L;  2NB0 A;  4YCU A;  4DN4 M;  1QUQ B;  1VCI A;  4ABN A;  2Z9H A;  1KLU D;  5IWA Q;  1VQ4 A;  4HID A;  2JYO A;  4V0B A;  4IFD I;  4HED A;  2K5N A;  1SND A;  1ILP A;  2RHS B;  1XMQ L;  5JJK A;  2N3S A;  2NYZ D;  3U9S A;  5I2X A;  3RZD B;  2VB3 X;  3HOZ H;  4HJ9 A;  1FNU A;  4DAY B;  5HGT A;  2K4K A;  3PIP 3;  3HOU H;  3C1E A;  1BNZ A;  4A3F H;  4KHV A;  3KBG A;  1TS4 A;  4O0A A;  2KHS A;  1S5B D;  1F2M A;  3NK9 A;  1XTC D;  5M3F B;  4FNF A;  3MWY W;  3PO3 H;  5IP7 G;  1S72 A;  1JB7 A;  1Y8N B;  2D5D A;  2L9H A;  4B9X A;  1K9M C;  3HOU G;  3DWP A;  5FK9 C;  4L6T B;  1XNQ Q;  2F4V L;  1STA A;  2WAC A;  5JJI A;  3BZK A;  4HJA A;  4B3R Q;  1DON A;  1HNZ L;  4FF3 A;  3A8K E;  1PYS B;  3J81 E;  2EQS A;  3STB D;  2WB1 G;  2K01 A;  3S1R B;  2UUB Q;  1EIY B;  2A5H A;  2SOB A;  3NEM A;  1WD1 A;  4APV A;  3I55 A;  1ILQ A;  4A93 B;  5EBD A;  1KHI A;  1F9P A;  1MJC A;  2YYZ A;  1IBM Q;  2VL6 A;  3PUY A;  3S1R H;  4WJ3 M;  2E2I B;  3IL8 A;  3K81 C;  1WTR A;  4MNO A;  2Z6B A;  4DAP A;  1I50 B;  4PZ6 A;  1VQ6 A;  1MIU A;  1E2Z A;  1HNX L;  3S2H H;  4DFA A;  5M5X H;  1E0B A;  3CRL C;  4DPG A;  3URY A;  2MO0 A;  3EFX D;  5JJZ A;  1SN8 A;  4LF6 L;  4QIW E;  5CBE E;  3ULJ A;  3CCJ A;  5EKK A;  1STY A;  5M3F G;  3UI2 A;  4DXF A;  2NVY B;  5C0X G;  5C4J B;  4MTN A;  5BN5 A;  1KAW A;  2RBM A; 
#chains in the Genus database with same CATH homology
 1ICF B;  4CDD C;  4CDC C;  4CDF C;  4CDE C;  2DJG C;  2DJF C;  4OEM B;  1MHW C;  4OEL B;  1K3B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...