3AB9A

Crystal structure of lipoylated e. coli h-protein (reduced form)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
127
structure length
126
Chain Sequence
NVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Glycine cleavage system H protein
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
total genus 37
structure length 126
sequence length 127
ec nomenclature
pdb deposition date 2009-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ab9A00
2B8GA 1SMYC 1Y8NB 3EQLC 4PV1C 1YNJC 2O5JC 2PPBC 3GQBA 3T51B 1OXXK 2LMCB 2K33A 2A69C 2BA0A 1HPCA 5C0XG 4DK1A 3VA7A 1VDZA 3A7LA 1FYCA 5C0XH 3D31A 2A68C 4H13C 1IYUA 1B9MA 5KNBA 5BN3A 3NE5B 5JEAH 2JEAI 2D2CC 5KNCA 2D62A 3W3AA 1H9KA 2V4DA 5BN5A 4OO1G 1GUGA 1ONLA 2A69D 1VCIA 2BDOA 2DN8A 2KCCA 3L7ZC 3M4YA 3ND9A 3QIAA 2EVBA 3BDOA 1H9MA 3PUYA 3QG1A 1GHJA 1GUOA 1A6XA 2A68D 3VR3A 1ZYRC 3VR6A 1Q1EA 1H9JA 2DNEA 3I72A 2NN6H 2PNRC 1H9RA 3CRLC 1Q90A 3ND8A 3GD7A 2KA7A 2QF7A 3IKJA 3T53B 1GUNA 2L5TA 4H0LC 4TQUS 5KNDA 1T5EA 3M85A 4KHZA 1Q12A 2D5DA 3PV0A 1VF7A 3VR2A 1B9NA 3CRKC 2DNCA 1OXSC 4KKSA 3PUZA 1HTPA 4LK1C 2K32A 2E75C 4DNTB 5JEAG 4DNRB 1G291 2JEBI 5A35A 3M7NA 1V43A 1Q1BA 1Y8OB 2BE5C 3WDNA 3DXJC 4JK1C 1IW7C 2NN6I 1TU2B 3N6RA 3VR5A 1OXVA 1QJOA 2A6HC 1GJXA 1Z6HA 2YYZA 2F1MA 3MFYA 1K8MA 3MXUA 4I7ZC 4KN4C 1V8QA 3A8KE 3LWUA 5BN4A 2NN6G 3I73A 1E2WA 1LACA 2A6ED 2K7VA 3P20A 4G7OC 1E2ZA 1GHKA 1Y8PB 3H94A 3RLFA 3U9SA 3PUWA 1HCZA 2BE5D 4BA2I 4GZYC 1IW7D 3FPPA 3HGBA 1H9SA 4OGQC 4XIGS 3VR4A 1TKWB 4G7HC 2O5IC 3LNNA 2A6HD 1OXUA 4KKUA 4G7ZC 3A8JE 1O78A 1LABA 2E76C 1CI3M 2JXMB 3A7AB 2R6GA 3SE0A 3OW7A 2ZT9C 4KN7C 2EJFC 1CTMA 4KMUC 2A6EC 3T56B 4HR7B 3TZUA 4IFDH 5K36H 2CW0C 1Z7TA 2EJGC 2PCFB 4JBWA 2EDGA 4TKOB 1H9SB 1BDOA 1IYVA 1HQMC 1I6VC 2AWOA 2AUJD 4XTCS 1DCZA 2Q8IB 3KLRA 4IQZA 4L8JA 3I4LA 3PUVA 1Y69U 1O7LA 3OOCA 1FR3A 3AB9A 1GUSA 1CFMA 1K8OA 3SDZA 1DD2A 1EWHA 1DXMA 1OXTA 1GUTA 2B8FA 2IT1A 3FMCA 4RCNA 3IFTA 2E74C 2JE6I 4KI0A 3QJYA 4OO1H 1ZKOA 4IFDG 3OPOA 2EJMA 2AUKA 1YNNC 1VF5C 1E2VA 3PUXA 3BG3A 5K36G 1PMRA 2BA1A 4KKTA 3A8IE 4BA1I 3D4RA 4LJZC 4H44C 4DK0A
chains in the Genus database with same CATH superfamily
4FP5D 1Y8NB 5EKLA 1LYLA 5CR3A 1N33Q 2SNSA 3NWSA 2SNMA 1N36Q 4DK1A 2JN4A 2DUDA 3VA7A 3S16B 4A3DB 5M3FH 2F0MA 1K8AC 4A3EG 3DWPA 4FXGC 1LM0A 1KTKA 1HTLD 4G4KA 1PTOF 3CCLA 3V2TA 3QIAA 3C1EA 2E2JB 1D1IA 3S14B 1ZYRC 1HFGA 2NB0A 3AFQA 2A73B 1CQFA 3HKZG 3CP0A 1PYSB 3HRZC 4LFBQ 3DHQA 2MGSA 3C46A 1VQ8A 1PRTF 4R4TA 1PV4A 4RH6A 3FDTA 2ZTCA 2JA5B 5KYIA 4K0KQ 2NTTA 2B29A 2GA4B 3FHWA 2CWPA 5FO7B 4L5RC 3U9OA 3PQIA 2N8NA 1IBMQ 3N6RA 5D65A 2HDLA 2MUYA 1K8MA 3J7YW 4I7ZC 3Q6SA 4JBKA 4A3FH 4JC0A 1K28A 1DOMA 1XX8A 1B4OA 4EGVA 1AP0A 2HCCA 4C3IH 2X6LA 5C5LA 1QNKA 4WJWA 1EY4A 3BU2A 1WVLA 1O78A 2UUBL 2E76C 4IZ8A 1DJRD 4G57A 2JYOA 5C3XA 3K57A 5EQ0A 3T16A 1MD2D 1GVPA 4KN7C 4KMUC 3E0JA 4EQOA 5J3BA 1DGSA 3KYHC 3TZUA 4MNOA 1I50H 5HGTA 2M00A 4H7BA 2PCFB 5M5WB 2A19A 2KBNA 4EVOA 4PQXA 1BDOA 1GD7A 3G71A 4ZKBB 3H09A 5HURA 1KABA 4R8NA 1LTLA 1TWAH 4DV7L 3Q8DA 4A3KB 3IRBA 3PF5A 3AB9A 1IBLL 4XQQA 3H3VI 3EIVA 3ERSX 2QA4A 4GKJQ 1ICFB 2GVBA 1WYDA 1RKNA 1Y1VG 1NNXA 1ML0D 5M3FB 1WTQA 5K36G 1U4PA 3RD4A 1PRTD 1VQHA 1CQVA 2BA1A 1Z47A 3A5UA 5CGKA 4DF7A 5CV8A 5C5MA 1VQ7A 5E3FA 1HPCA 2F4VQ 2IHEA 3TP7A 1B70B 4DA2A 2B2VC 5M3MH 3BS1A 4DR2L 2D2CC 2F0FA 3GV3A 5KNCA 2RHSB 3MAQA 3CCEA 1LTBD 1BBWA 3ND9A 2EVBA 1GUOA 2R7DA 1EY0A 2EYMA 1NMGA 4FF2A 4R9WA 1CUKA 5ISRA 1V9PA 4RCOA 1T5EA 1YHAA 1KDAA 2HD3A 4A3FB 1A2UA 4BY1G 1FGBD 4A3BH 2RQXA 5ELDA 4JI6L 3GTGH 5JEAG 4C3IB 1KDCA 3Q22A 1IW7C 2NN6I 4RGMA 1EZ8A 2L0CA 1EZ6A 3VR5A 3MFYA 1VQFA 5IE8A 1XMOL 4JYAL 1WTPA 2ZM6L 3I73A 2VB3X 4DV1L 4OWTB 2BE5D 1SN8A 5KEEA 1I50B 4NKLA 1VQLA 1KL9A 5J22A 1GO3E 2VB2X 4HAEA 2N3SA 2EY1A 3FRPB 3N52A 3WOEA 3J81j 1STAA 2RDHA 2EY5A 1CKMA 3MFGA 1TWAB 2FMMA 3MWYW 2K5WA 2VUMG 1GOZA 1AH9A 1LTSD 4QUCA 5IP7G 1HQMC 1I6VC 4DR1L 1PZJD 2AWOA 1LTAD 2F0OA 2QEXA 4IQZA 4L8JA 4Q5VA 3CMEA 2K28A 3J80c 5G3LF 2WIIB 4A3MH 5T1GA 1X32A 3SDZA 1VQMA 1RL2A 4IFDI 2G9HD 5EKKA 4A3EH 2NVYH 3TZDA 1SAPA 2C9OA 1ENFA 1VS0A 2EJMA 1IBKL 4ZAIA 2CH4W 1CSQA 1PA6A 3H6MA 3I55A 2D0PA 3HOUB 5M3MB 4X66L 3KBGA 5I2XA 5M5YH 3W1BA 4K2LA 2DGYA 1SMYC 4RA8A 4X3TA 2SEBD 3T51B 1VQIA 2BA0A 2K33A 3J7A5 4Q0FA 1AEXA 4OO1I 2YU9H 4LF8Q 2D62A 4FF3A 1EUJA 1LUZA 5ELCA 3W3AA 1H9KA 1HUNA 3C3LA 3CCSA 2ICIA 1EQQA 1CK1A 2BH8A 4A3BB 1XTDA 3GTGB 2BOSA 2DNEA 2CVRA 2PNRC 5IGEA 4IURA 4JI7L 2VQFL 3BZKA 2WINB 3CKIB 2CQOA 1TVXA 5IYBG 2XN9C 3J7AV 2WAQB 4XQJA 2K32A 1A3UA 3P7JA 4A75A 1EU4A 5A35A 1P16A 4MIUA 3LGJA 1ZEQX 1TU2B 1OXVA 1QJOA 2PI2E 1EU3A 1Z6HA 2UUBQ 2QGQA 3MXUA 4GLXA 1M4VA 5IGCA 1R4QB 4K8JA 2NUCA 3HOVG 4CDDC 1EY5A 3GTPH 4DR3L 3ULPA 1KRSA 4G7HC 2SOBA 4KKUA 4RHRA 5GROA 4R4IA 4KHPL 4BBRG 5LL6S 4B3TL 2ES2A 5JOBA 3H91A 1HJPA 1X3GA 2F0PA 3I56A 2ZJRA 1YNXA 3VYUA 1HZBA 5M5XH 1D8LA 2XGTA 4A3MB 5K36H 4DV7Q 1YJNA 5CV5A 4A3EB 1B3QA 2ZXOA 2NVYB 3B6YA 1IYVA 1G6ZA 4RHSA 2AUJD 3ITPA 2QW7A 1S5CD 3O13A 4JBMA 1X9NA 2Q2HA 5C3EH 1XPOA 1PH2A 1Y69U 2PYKA 4IJHA 1GUSA 5AFWA 1ASYA 5M5YB 3HKZB 1UE1A 2M9VA 1KLUD 4WJ4A 2Z8LA 3U50C 4CJ1B 2YU9B 3V05A 1IKMA 1PMRA 4RGOS 2F0SA 1QZGA 1SE2A 1PVOA 1K8GA 5C0XI 4DR2Q 1YNJC 4DR5L 1JE4A 2F52A 3WWVA 2OF1A 4LUOA 4WJ3M 2A69C 1I4RA 4C3JG 2P5ZX 1QE6A 2EYOA 2NZHA 3FKIB 4UPAA 1XXGA 5C0XH 1N8RC 4BY1H 3CPWA 1UUPA 3TN2A 2IL8A 5JEAH 4GNXC 2DN8A 5C44G 3CW2C 3W2DA 2B2YA 2F4IA 2A68D 1QCBD 1J6QA 4P2CB 4Y7NH 4R4OA 2QF7A 4JI6Q 2XNAC 4H0LC 1SJED 1EIFA 1TWFH 2KCNA 3K7AH 1QVGA 3DWQA 2OQ0A 5C6AA 5TSSA 1SBBB 2MQHA 2R93H 2WFWA 2E75C 3CCQA 3GTPB 2ZM6Q 1ENAA 4DV1Q 3I8ZA 4EQ5A 2XWBB 3RLOA 2KHSA 4DV6L 2VUMH 4MZ9A 4U673 1C4QA 1SE4A 2F1MA 3E0EA 1W2BA 1BCPF 4KY5A 1JCKB 5M5XB 1Y8PB 2MJ8A 3U9SA 4E6IA 5IYDH 3VDYA 1TY0A 3GTJH 2H5XA 1LLRD 2F3VA 1S40A 2DJFC 3Q0AA 4ID6A 1CI3M 2JXMB 4JI2L 2Y0SE 2YTVA 4A3GG 3F1ZA 4DR1Q 4BXXH 5C3EB 4HR7B 3KLSX 5IYCG 1IKLA 2E5LL 5FKAC 5EJWA 1PDQA 3STBD 1FJGL 4KY6A 3GTLH 1XPUA 2K03A 4C2MH 4ZLTF 2RCNA 3L9AX 1A3TA 2DY8A 2K01A 1FGUA 1EYAA 1ENCA 3I90A 1QNUA 2K52A 3QOLA 1CFMA 5BR8L 2PW7A 1E22A 5LHY1 1GUTA 4X66Q 2E74C 1MHWC 2JE6I 2R7ZB 3RLNA 1SYFA 1XNRL 4BY1B 1J8IA 3OWFA 1BBXC 4AYBG 3JAMi 2BH2A 3D4RA 3J81E 5CMDA 4R8IA 4PV1C 1YITA 3RZOH 2B39A 4JOIC 3CCRA 2NTSA 3BZCA 2NWGA 4J15A 5IYBH 4Y7NB 3MA2B 1BCPD 4IPHA 3AFPA 4CHTB 1TWFB 1JR0D 1U4LA 3K7AB 4JI7Q 1SYDA 3QB3A 2L12A 2V4DA 2AWNA 1Q82C 2K5NA 4X3SA 2H1EA 2R93B 4QY7A 4YCUA 2FINB 4L5TA 1VQDA 4QMGA 4POFA 3HOVH 3IKJA 3MEFA 2L5TA 2RBMA 2HDMA 2VUMB 4RGTA 1YHBA 4GLAC 1X56A 2HQLA 1NBWA 4U68A 1VQOA 4BBRH 4DAVA 4O0AA 4QL5A 3GTJB 3IFDA 4M1UB 5NUCA 2AQ3B 4L6TB 5E4WC 4ZK9B 1EQVA 5I6WA 2CWAA 4DR3Q 4OIJA 1SSOA 2F4VL 5I2YA 3I70A 1LT4D 4QIWE 2AQ2B 1LACA 2A6ED 5KRUA 3PIPA 3GTMH 4KHPQ 1GHKA 4B3TQ 3L2PA 1QG7A 1SNCA 3AQQA 5JPMC 1KLGD 3GTLB 1B53A 3J80E 2GVAA 2PMZB 2J4XA 4C2MB 1AZQA 4KK7A 5ELNA 5JJIA 1B1ZA 2CQAA 3BZDB 3AMUA 4HJ9A 2KQ3A 1PYBA 1PYWD 4LMQD 4ZRZA 1E1OA 1VQEA 4LFCL 2JSOA 4A3JG 2N55A 3GTQH 4NP5A 4C3JH 3F8TA 2F0JA 1D7QA 2VQEL 1DD2A 1TWCH 4KTAA 3RZOB 3KK7A 4JI0Q 5C44H 1O7ZA 1S5ED 2F0TA 2N88A 2Z4IA 1S5FD 4YWLA 2L1BA 3IAYA 5HY6A 5I9PA 4B9XA 2RCFA 4TSSA 1A2TA 3DMUA 5C4HA 1F9SA 2MO1A 4DPGA 3EVQA 4DK6C 4YCVA 2JK8A 3FVQA 1HZ9A 4JBJA 2WV6D 3HOVB 3VYSA 3BJUA 3HOYG 3CCJA 4GN3B 2EXDA 1DONA 5LMNL 3SK4A 3PUYA 4F88A 2NZ1D 1SEBD 4BBRB 2F0UA 3AYHB 3E9IA 5KGUA 5EPKA 3AEVA 2PNHA 5C4JH 1NMFA 3T53B 3A54A 1I4QA 2EY2A 4KHZA 5CV6A 2D5DA 3PV0A 1B8AA 1UNSA 4DV6Q 3CF5A 3GTMB 4GKKL 3MZ5A 3KJPA 1PHJA 1W3SA 4HN7A 1SR3A 4GS3A 1LT5D 1U5KA 2YYZA 2UXBQ 4FXKC 1I5FA 4LF8L 4JI2Q 3SXHA 2F0EA 1Y1WG 4ZKCB 2ENBA 1GKHA 3SK5A 2FHTA 5J39A 3LNNA 2I0QA 1KHIA 3A8JE 1SNDA 2E5LQ 2A8VA 1FJGQ 1PH3A 4N8X1 3GTQB 4WORA 1UE5A 3T1YL 3K5MA 4PNYA 4C3JB 1C7YA 3FPUB 2VY3A 3A55A 1TWCB 4UAIA 1AW7A 4FF4A 4P74A 3PMFA 1X55A 2A74C 5BR8Q 1T5XD 3J7AF 4NXML 5GAEC 5C44B 2Z6KA 5CYUA 3CD6A 2LFNA 5EGTA 4P75A 2BCOA 3GTKH 2JJQA 1FR3A 1XNRQ 1TY2A 4IPDA 2B2VA 1EWHA 4KV6A 5JPNC 2WAQE 2F3IA 3S1MH 1WTVA 1X3FA 1UE7A 4KD3A 3E3XA 3PSIA 1WD0A 3NELA 1JWSD 4H44C 2VNUD 1ILPA 1SMXA 3V96A 4X3KA 3CC4A 3PO3G 1XNQL 2WP8J 2K5HA 3KJOA 2EYLA 4N9PA 4AH6A 1PTOD 5C4JB 2Q2IA 5IIFA 1B9MA 4PZ7A 3MXPA 1RCVD 1I4HA 3BVGA 3TQYA 2BDOA 1MJEA 3M4YA 5DNFA 3G7LA 3BDOA 3SVMA 2HHHL 1Q1EA 2IPKD 2RKSA 4DFAA 1H9RA 4CDFC 4UY8C 4OXPA 3PO2G 1SDFA 1Q86C 1UWVA 2Z6KC 2F0KA 3ONAB 5CV7A 2V1CC 5CBAE 3EFXD 4HSPA 1M90C 5KYLA 1MGSA 2R7FA 4PMWA 1PFBA 3KDFA 1S5BD 2EYFA 4K2KA 3S1QH 3F2CA 1V1OA 3J81L 3DXJC 2QDLA 5GQOA 5IT9E 1P8LA 1A15A 2RDGA 2YTYA 1G6PA 3NTKA 1FNWA 3FP9A 1MSHA 4G7OC 1CHQD 2OQKA 5EBCA 3J81c 4A3JH 2UXCL 4DXFA 2A6HD 2KECA 3KDFB 5FK9C 1HRJA 1MKHA 5ELFA 4DR4L 1X3EA 1DM0B 3K0YA 2XSCA 4LFCQ 1HA5A 1HZAA 1YZ6A 2KVMA 3GTKB 1T9HA 3HP3A 1X65A 1UE6A 1TWGH 2VZAA 2VQEQ 3S1MB 1NR4A 4A93G 2HIXA 5IP9G 1SNOA 2Q8IB 1VMCA 4WFN3 3KLRA 3PUVA 3CCVA 3DWAA 4C1NK 3PCOB 4RWSC 1QILA 3S1RH 1DXMA 5C3WA 4GN4B 4X3UA 2I5LX 2K05A 4KY7A 3E6ZX 2K04A 1VF5C 3PUXA 1WCMH 3E5SA 3J80L 4A3CG 2JA9A 4KKTA 1S72A 4UP8A 2R3ZA 4DAYA 1PLFA 2PW5A 4LJZC 3T13A 5GAHC 1Q81C 2IY5B 1F77A 4C56C 2KCTA 3RZDH 2AQ1B 1HA6A 5LMNQ 3M4PA 1F2YA 2IX3A 3CC7A 1UEBA 1UEAB 1TXYA 4DXGA 3MVVA 4V0BA 3IL8A 2PQEA 3I2ZA 1I4PA 3H0GG 4YWKA 5BN5A 1B7YB 4YY3Q 5GADC 2ASBA 4RGNA 1SE3A 4DAYB 1KIXA 4LF7L 4JI8L 4OIKA 3VR6A 2JA8G 4BY7G 1EY9A 4GKKQ 3S1QB 3ND8A 1Q90A 1Y1WH 3S2DH 3QR8A 4LFAL 3VR2A 4AIMA 1M8AA 3HOWG 1BBUA 3C2PA 2DY7A 2HT1A 4K5XA 3RN2A 4A3JB 3F2UA 4CJ2C 3X3NA 1EWCA 2BE5C 4JK1C 3TP6A 1K83H 3T4AC 1E2ZA 5FJ8G 1A63A 1H95A 3RLFA 3FPPA 2Q8RE 3HGBA 5HGQA 3T1YQ 1YJWA 1TWGB 1X3PA 2F03A 1JQYD 1DOKA 2JQOA 5DAUA 4K6DA 2FXQA 1JICA 3A74A 2EJFC 4NXMQ 1CTMA 2ZTDA 4ME3A 1NJIC 2EYJA 1TQOA 4JI3Q 4ABNA 1Z7TA 5G3LD 3S1RB 3HOXG 2PZUA 2WB1E 5CORA 2X6GA 3PO3H 4HMIA 1WCMB 1YVCA 4F8MA 1XJVA 4K5VA 2MO0A 4JVZA 1HNZL 1RDPD 3D4WA 1VQ6A 2WKCA 3ER0A 1I6HH 1XMQL 1CKNA 3RZDB 3SHLA 1WTOA 1SRUA 1JORA 4GNXA 1X6OA 3CC2A 3QJYA 4DV3L 1XNQQ 3OPOA 1TS2A 1RTOA 1Y1VH 4HSVA 2XIWA 3NQIA 5DEHA 1X54A 3RR5A 4DNIA 2ZJQA 3DUZA 3A8IE 3GTOH 4DK0A 3EQLC 2Z4HA 1JWUD 1BNZA 1CKNB 1VDZA 3A7LA 2HHHQ 4DN4M 4R4QA 2X69A 1GUWA 3SR1A 4GNXB 1C0AA 4UDUC 1Y1WB 1II3A 2XRSD 1SLJA 4QF4A 3S2DB 2PMZE 1LT6D 3TSSA 1GUGA 1L2FA 3OMGA 4FDBA 1BQQT 2R61A 1WI5A 4AQYQ 2Y0SG 2H4OA 4A3DG 5ELBA 2PQAA 2UU9L 2XWJB 4JI5L 1F2ZA 4MN3A 4DU9A 1WFQA 1W6JA 4JI0L 3NHHA 4QJFA 2C5CA 1DZ1A 2WACA 3M85A 1RHPA 1K83B 1STEA 1Q12A 4LF5L 1WTXA 4FNFA 3G6EA 4YHHL 4KKSA 3A5ZB 1HTPA 1EQRA 4O42A 1YBYA 1EY7A 2DJGC 1TS5A 3HKSA 1HXYD 1LV9A 3M7NA 2UXCQ 2PQAB 4TRDA 4C3HG 2KOLA 1GJXA 4DR4Q 3A8KE 3LWUA 4IFDJ 2IX1A 3P75A 4NXNL 5L37A 2JA5G 1D5ZC 2Z9HA 4RKLA 1K3BC 3LWEA 1OXUA 4I65A 4QCLA 3G6JB 3NEMA 4RFBA 3K5LA 2ID0A 2IJ0A 3ULJA 3PO3B 4P73A 2EXZA 2XTIA 4PZ6A 1CKOA 3D4DA 5I6YA 1CA5A 2HUGA 1I6HB 2KENA 2N78A 4KJNA 4A3CH 1CHPD 3PGZA 5IP7H 2F0LA 4B3SL 3NBIA 5JJZA 4JOIA 1Y1VB 3GV6A 4B3RL 1PFMA 1HR0L 3Q23A 2OEOA 3QOJA 4DUZL 3GTOB 5IT9L 2UXBL 3K59A 5I9OA 3TMEA 1D5XC 2KUMA 4RCNA 3IFTA 1OO9B 1G2SA 2B63G 2KJXA 2UUAL 1E2VA 5T1IA 4QQBX 5IT9c 2UUCL 4BY7H 4ZCKA 2MP1A 1IHZA 1YNND 2ZTEA 4I7AA 3J7ZC 4A76A 1A3VA 2LMCB 5IGGA 3K5OA 1NUCA 2Z6BA 5M3FG 1JOOA 2CCZA 4LF7Q 4JI8Q 1EFID 3MEHA 2A68C 5J1ZA 3R2IA 1E24A 2RDFA 2JEAI 3UDFA 2XRQD 4CJ0B 3CPFA 3M3YH 1KAAA 1HQRD 3M4QA 1RIPA 4OWWB 2EOTA 4LFAQ 4APVA 3U4VA 1JWMD 3UI2A 2F0VA 2D0OA 4DV4Q 1A0IA 1Q8IA 1K0RA 4BBSG 5FJ8H 2KA7A 4Z9CB 1GUNA 3NWTA 2E2HH 1OTCA 1VQCA 4PG3A 3RN5A 4CKEA 3WDNA 1G2TA 1KAWA 3HZXA 2ZXPA 2F0QA 2CH4A 1XPRA 3KFUA 4MTKA 1E2WA 2RSNA 1HCZA 1JB3A 4OHJA 5C4XG 2LKVA 1PH1A 3ICEA 4L63B 1D2BA 4IN3A 3TDQA 4BS9A 2K14A 4DAMA 4DR6Q 5IY0A 1DOLA 1U9RA 5C0XJ 5EPLA 4KD4A 4FF1A 5I4DA 4DGZA 2M2LA 4IJLA 4HJAA 5LMUL 3MHBA 1SYEA 2KEEA 3CU7A 5FLXE 5IGFA 4DV0L 1C8CA 1HNZQ 1ET6A 2KHIA 3D6WA 3L3OC 1NAPA 1XMQQ 4GOPC 1DYQA 2CFMA 2CW0D 2NZOA 3M9BA 5AJ3L 4DV3Q 3OOCA 3VA5A 2EIFA 4TVAB 4P72A 2AHOB 1HNWL 3DEOA 1QWYA 1A8VA 1JOKA 2NBFA 4LF6L 2XVSA 3NTHA 4KI0A 5JJLA 4A3IG 2O2LD 2L11A 1FNUA 2OTLA 4XYOA 2QCPX 4X62L 1HUMA 2NVQH 1EY6A 1BR9A 3I7FA 1E7ZA 3M3YB 4HTHA 1I4XA 3S17H 5A2QE 1AFPA 1LTTD 4FO2A 5M9OA 3LX0A 3HOUG 2UU9Q 2E2HB 4FYDA 4DV2L 2YV5A 4JI5Q 1NSNS 5IOCA 1ONLA 3CCUA 1AE2A 4C3HH 3NXWA 1EYGA 4LF5Q 4YHHQ 4X65L 4LUZA 4S3SA 3MXGA 4PMBA 4JV5Q 1ASZA 1ESRA 3K81C 2EPBA 2E2DC 1PXUA 4RMFA 3D8GA 1ZYRD 2HIVA 1NY4A 2B3GA 3URYA 1SJHD 3I4MG 2EY6A 4DNTB 1E3PA 2Q2TA 3K6OA 4NXNQ 1C9OA 1I94L 1QVCA 2I07B 2A1AA 1AN8A 2MHVA 3ERQA 1EYCA 2F3WA 1S5DD 1YI2A 2RHQB 4KN4C 3QWNA 2NN6G 3P20A 3UDIA 1RJTA 2K7VA 2WAQG 4BWGB 2FMCA 3PUWA 3OYYA 5EAYA 4YY3L 4G7ZC 1CZWA 1PH5A 3A56A 3KBXA 2MPMA 4KHVA 3SE0A 3ZYYX 3OW7A 4B3SQ 4A3GH 1O7IA 1HH2P 2K5VA 3U58A 2B63H 5K5PA 5JVH3 2O4XA 1HHVA 4B3RQ 5IYCH 1HR0Q 3D6CA 5DM73 4DUZQ 2TSSA 1GM5A 4X64L 5C4ZA 5DLQE 4NDXA 3CHBD 3OIQA 1PTOH 3HEJA 2Y0SB 2GN5A 5ELEA 4A3MG 2NVQB 2UUAQ 1JE5A 1IZ6A 1I3QH 2F0WA 3OIPA 1C48A 2UUCQ 4DR7L 3S17B 3BVMA 3MXNA 5DM63 3DM3A 4IFDG 4RG1A 2D9UA 2HQEA 1SROA 3BG3A 1ET9A 4ZUIA 3NUCA 3RNUA 1AZPA 4MHEA 3KLSA 4BA1I 2JP1A 4BBSH 5IWAL 1AE3A 1O80A 3K80C 5E1FA 4C3HB 1HNXL 4POGA 2PPBC 1VQNA 3A0JA 4JI3L 2NYZD 4IPCA 3SK8A 3MXNB 5H1SE 4UP7A 1N32L 1HR0W 4EQNA 2B2TC 4UHVA 1JMCA 4F87A 4OO1G 3L7ZC 1S3OA 1EWIA 2SDFA 4XT1B 3VR3A 2ALYB 3PIO3 3T1HQ 3FKIG 2F0NA 4K14A 4CDEC 3GD7A 1BOSA 3EA6A 3G48A 3C1FA 5CV4A 1XWEA 5KNDA 3SK6A 4WRDA 5C4XH 1A62A 4LWCA 4N8FA 1VF7A 1EL0A 3CRKC 2KCMA 3PUZA 1TWHH 1SNQA 4CBVA 4IUVA 4A4IA 1G291 1PZID 3K5NA 3TS2A 4XXEA 2TMPA 1PFNA 1BKBA 2QKIC 1JJGA 4ZYSA 1Q7YC 1PH6A 3MTSA 1G8ZD 4L5QA 1JB7A 4A3GB 2B63B 3TBIB 1IW7D 4XIGS 3VR4A 4QUFA 4LF9L 4FVMA 4K8IA 1Q8KA 4HCEA 5LMUQ 4AQYL 4JI4L 3K7UC 1STHA 4QB4A 2OWOA 2R6GA 3BVZA 4DV0Q 2ZT9C 1PTOB 2FFKB 1QOHA 3T56B 3H3VH 3HKZE 4QIWB 3F2BA 4A3IH 4O1NA 1I3QB 3D0FA 5AJ3Q 4TKOB 1LTID 3BDCA 4MTNA 1SNMA 1HNWQ 3I3CA 3HOZG 2PO4A 4R1JA 4LF6Q 3NQTA 2JA7G 1PRTB 5C3EG 2L55A 1O7LA 1KRTA 5JVG3 4K6LA 4AYBB 2EQSA 1MI2A 4X62Q 4BBSB 1F2LA 4DUYL 3S15H 3HOUH 4Y52H 1FD7D 1NR2A 4OWXB 4IUPA 1ZKOA 2RVLA 2Z0SA 2F0IA 1PTOC 1VQGA 2UXDL 1FL0A 4L5SA 2AKWB 1Q3LA 1ILQA 1EEID 2B8GA 2O5JC 3GDEA 4DV2Q 3CQZH 3M4OH 2R7ZG 4DKAC 4IUQA 2E2IH 1MBYA 5C0XG 1FYCA 2LXKA 3VYTA 3I4MH 2OCEA 3D31A 3TS0A 3I4NG 4X65Q 5FLXL 1PRTC 1SMYD 3HOYH 2PZTA 4YIJA 3TREA 2K5DA 5C4XB 3EBEA 1VCIA 5EPJA 3OTOQ 5IGDA 4HIDA 5FO8B 1NTGA 1H9MA 1TWHB 4FXDA 2RA4A 3I72A 5FLXc 2NN6H 1EEFD 4LUVA 2N49A 4ODGA 2NVXH 1RTNA 2OXPA 1I94Q 5D3DA 1D6EC 1KQSA 4JW0A 1BUVT 2JA6G 3M7GA 2R93G 5D3IB 3Q24A 1EIHA 3S1NH 2WB1G 4LK1C 1Q46A 3QO2A 4IUTA 4ZQ3A 2JEBI 1XYIA 3TRZA 1WJJA 5A2QL 4IOAA 2A6HC 3FEWX 1I4GA 4O2DA 3R2TA 4ULLA 4B08A 5BN4A 4HJ5A 1MJCA 5IYDG 3DEPA 3H94A 4DK3C 4A3IB 1CSPA 2F0HA 3S9WA 1WTWA 2OT2A 4DV4L 4B3ML 4X64Q 4HJ7A 4BXXG 2J0TD 1M1KC 1FNVA 1Y14B 4IFDH 1KXLA 3VYRA 4IOCA 4HIOA 3S15B 1J9OA 4YCWA 1PH7A 1BXTA 4DR7Q 1EYDA 1TT2A 1EQTA 5JAVA 3NENA 5LMNW 2K75A 1JT8A 4ILWA 1JC7A 2B2WA 1KD1C 1Z9FA 4HIKA 1RF2D 3JAML 3H3VC 1ESFA 3S2HH 1IL2A 1QVFA 1PZKD 2R92G 1LT3D 3BYTB 3CQZB 2B8FA 2IT1A 3KF8A 3M4OB 2A5HA 5IWAQ 1PH4A 4OX9L 1UAPA 3OSOA 3K0XA 4OO1H 2E2IB 1HNXQ 3TEHB 3JAMc 3I4MB 3W5OA 5CBEE 1S4ZA 1U4RA 1STBA 3HOYB 3FKIH 1N32Q 4DR6L 1L1OA 1CZGA 3UE0A 1L0WA 1VQKA 4NB3A 4JI1L 3GQBA 3EJIA 3CXCA 1O7YA 4LNQA 5FOBB 3KF8B 3I91A 3JC66 1NCVA 1B3AA 4H13C 1K73C 5BN3A 3NE5B 2NVXB 1YNJD 2IHFA 4B9WA 2A69D 1A6XA 3S1NB 1SXTA 3K58A 1L1OB 2EZVA 1F9QA 4A3LG 2KEDA 4J6HA 3U4ZA 3ULLA 2J7ZA 3DLLA 2ZXRA 1V1QA 4TQUS 4LF4L 3AU7A 3PO2H 3OMCA 3F2DA 4J1MA 1KDBA 2I46A 4HCSA 2B2WC 2DNCA 1OXSC 1WOCA 1IL8A 3KF6A 2K50A 4LF9Q 4JG2A 2KHJA 1L0XB 1NE3A 1RODA 4C1NI 1QZHA 1IBLQ 4JI4Q 1K9MC 2QEJC 2IWHA 1SFOH 4JCVE 4OEMB 1N34L 4OELB 2HCIA 4GZYC 2EYHA 3DM1A 5GAGC 3HOZH 4ZUJA 1H9SA 1L1OC 1VQBA 2JA7H 3J81i 4CKBA 4V190 1LABA 3KF6B 2B2UA 3CCMA 4F7XA 1SE8A 4JV5L 1QUQA 2L15A 3S2HB 1U0LA 2I5HA 4OONA 4CKCA 1H9SB 1QB5D 4DV5L 1VQJA 4DUYQ 1EOTA 1LTRD 3L0OA 5FLMG 1K3RA 4IO9A 4A93H 5IP9H 2R7ZH 1MSGA 3TP8A 1G51A 3PF4A 1QUQB 1SYBA 2UXDQ 2LXJA 3I4NH 3UDXA 2G5DA 4IUUA 3H15A 3KUPA 2AUKA 1BO0A 5CC4A 2CKZB 5EKIA 4HJ8A 1FVIA 2BDNA 3OWEB 2Q2UA 1J5EL 5LL6X 2K5QA 2MFIA 3SGIA 4EQPA 1KNAA 3NPPA 1OXXK 2JA6H 3HG9A 1XMOQ 4JYAQ 2IX0A 1D5MC 1IYUA 3J80i 5E4XA 5KNBA 2EYPA 2B2UC 4IPGA 3PO2B 4X6AH 5IGBA 1F9RA 1VQ5A 1N33L 2KCCA 3H0GH 1N36L 4PZ8A 1R9TH 2WKDA 1WTHA 3QG1A 3NTIA 4NW2A 2CHBD 2K6AA 3UE1A 3KOJA 1STYA 4A3KG 2JA8H 1ICWA 3NBHA 3CRLC 1N9WA 1E0BA 1EOVA 1F9PA 2VW9A 4RAUC 1SFOB 1B9NA 1E1TA 1EIGA 2C35B 4R4CA 3HOWH 3HOZB 3CMAA 1PH8A 1RD9D 2PZWA 2JA7B 4LFBL 1Q1BA 1TS4A 3GO5A 2E8GA 3NBHB 2B2YC 5E7NA 1CM9A 1SYCA 4KJOA 1U4MA 4K0KL 1W6KA 2LY7A 3K8AA 4B3MQ 2O5IC 4GOPA 4DAPA 1IBML 1TKWB 2ATWA 1IBKQ 2VS1A 3R8BA 1YIJA 4JPBW 3T1HL 2R92H 1GXDC 4A93B 1VQ4A 1EIYB 1JOQA 4GLVB 3HFZB 2EJGC 4P71A 2PI2A 4LW1A 3I4NB 2EDGA 5FO9B 2Z1CA 4XDXA 3HOXH 2LSSA 4GOPB 4A3FG 1YJ9A 3P1HA 4XTCS 1YHQA 1VQPA 1DCZA 1HFNA 3HS0C 4C3IG 4KLKA 4OX9Q 1SYGA 3I4LA 3BDLA 1VMPA 2MNAA 3STBC 1CT1D 1OXTA 4IUNA 2F0GA 3GP7A 2VQFQ 1EFWA 4M8AA 3MC0B 2F0DA 3EROA 4YWMA 2JA6B 4ME5A 1YNNC 2IW3A 4JI1Q 2NVTH 5JEAJ 1BCPB 2WB1B 1CA6A 3I4OA 1PH9A 3UDGA 1HZCA 4OL7A 4GKJL 1B44D 4A3LH 3H0GB 1B2TA 1R9TB 2QILA 5F2DA 4ALPA 1STNA 1STGA 4N9TA 5JJKA 1F2MA 5KIXA 2JA8B 2G9DA 4BY7B 1LO5D 3KLWA 1ZXTA 3EN2A 2EE1A 1IXRA 3E9HA 4NMZA 2VXWA 4XYQA 1XTCD 1VQAA 1BVSA 1SNPA 4LF4Q 1TIID 1GHJA 3HOWB 2L4NA 1H9JA 1V1PA 3S16H 1BF4A 4A3DH 1MIUA 2K4KA 1BCPC 1X3QA 4NPSA 3RMHA 2RSOA 4HEDA 5CV9A 5COYA 3TP5A 2E2JH 3NP8A 3S14H 2L9HA 2YTXA 4AYBE 5M3MG 1N34Q 4DNRB 1V43A 1Y8OB 2QDBA 1WTRA 2OTJA 1V1PB 3D3RA 4H02A 4HIMA 4PMCA 2VL6A 2R92B 2K1BA 4UP9A 2I5MX 1V8QA 1WD1A 3SEBA 3OHXC 4BA2I 2JA5H 5FLMH 4OGQC 3RUZA 2RF4A 2AMCB 3OTOL 1TR5A 4XT3B 2ICEC 1D1KA 1KC8C 3X3MA 4EX5A 3OW2A 3HOXB 4K5WA 3A7AB 1G91A 3BYYB 4A3BG 5D14A 1JJ2A 3G4SA 1IYJB 4DV5Q 3W1GA 1VQ9A 1B50A 1LTGD 2A6EC 3CAMA 4DR5Q 4XQNA 4J8QA 3JAME 1R4PB 4CDCC 2CW0C 2ZJPA 1JJCB 4JBWA 5ELOA 4QGUA 3S24A 5EBDA 3PIOA 2Q8TA 1K0SA 2NVTB 1KNEA 4LAAA 4HMJA 3ZJYC 1TS3A 2FJ2A 1PFSA 1K8OA 3WOFA 5M5WH 4IALA 5IODA 2B2TA 1EY8A 3FMCA 4CGYB 3NSWA 1J5EQ 3R93A 4RKBA 2LS01 1WCMG 3R3OA 3PIP3 4A3KH 1YEZA 3NK9A 1L0YB 4GN5A
chains in the Genus database with same CATH topology
4FP5D 1Y8NB 5EKLA 5CR3A 2SNSA 3NWSA 2SNMA 4DK1A 3VA7A 3S16B 4A3DB 2F0MA 3DWPA 4FXGC 1KTKA 1HTLD 4G4KA 1PTOF 3V2TA 3QIAA 3C1EA 2E2JB 1D1IA 3S14B 1ZYRC 1HFGA 2NB0A 2A73B 1CQFA 3HRZC 3DHQA 2MGSA 3C46A 1PRTF 4RH6A 3FDTA 2JA5B 5KYIA 2NTTA 2GA4B 5FO7B 3U9OA 3N6RA 5D65A 2HDLA 2MUYA 1K8MA 3J7YW 4I7ZC 3Q6SA 1DOMA 1XX8A 1B4OA 4EGVA 1AP0A 2HCCA 2X6LA 5C5LA 1QNKA 4WJWA 1EY4A 1WVLA 1O78A 2E76C 4IZ8A 1DJRD 4G57A 2JYOA 5C3XA 3K57A 5EQ0A 3T16A 1MD2D 4KN7C 4KMUC 3E0JA 4EQOA 3TZUA 5HGTA 2M00A 4H7BA 2PCFB 5M5WB 4EVOA 4PQXA 1BDOA 4ZKBB 3H09A 5HURA 1KABA 4R8NA 4A3KB 3AB9A 4XQQA 1RKNA 1WTQA 1ML0D 5M3FB 5K36G 1U4PA 3RD4A 1PRTD 2BA1A 1CQVA 1Z47A 5CGKA 4DF7A 5CV8A 5C5MA 5E3FA 1HPCA 3TP7A 4DA2A 2B2VC 3BS1A 2D2CC 2F0FA 3GV3A 5KNCA 3MAQA 1LTBD 3ND9A 2EVBA 1GUOA 1EY0A 2EYMA 4FF2A 4R9WA 5ISRA 4RCOA 1T5EA 1KDAA 4A3FB 1A2UA 1FGBD 2RQXA 5ELDA 5JEAG 4C3IB 1KDCA 3Q22A 1IW7C 2NN6I 4RGMA 1EZ8A 2L0CA 1EZ6A 3VR5A 3MFYA 1WTPA 3I73A 2VB3X 2BE5D 5KEEA 1I50B 4NKLA 5J22A 2VB2X 4HAEA 2EY1A 3FRPB 3N52A 3WOEA 1STAA 2RDHA 2EY5A 3MWYW 3MFGA 1TWAB 2FMMA 2K5WA 1GOZA 1LTSD 4QUCA 1HQMC 1I6VC 1PZJD 2AWOA 1LTAD 2F0OA 4IQZA 4L8JA 4Q5VA 2K28A 5G3LF 2WIIB 5T1GA 1X32A 3SDZA 4IFDI 2G9HD 5EKKA 3TZDA 1SAPA 2C9OA 1ENFA 2EJMA 4ZAIA 3H6MA 3HOUB 5M3MB 3KBGA 5I2XA 4K2LA 1SMYC 4RA8A 4X3TA 2SEBD 3T51B 2K33A 2BA0A 4Q0FA 1AEXA 4OO1I 2D62A 4FF3A 5ELCA 3W3AA 1H9KA 1HUNA 3C3LA 2ICIA 1CK1A 4A3BB 3GTGB 2BOSA 2DNEA 2CVRA 2PNRC 5IGEA 4IURA 2WINB 3CKIB 1TVXA 2XN9C 3J7AV 2WAQB 4XQJA 2K32A 1A3UA 3P7JA 1EU4A 5A35A 4MIUA 1ZEQX 1TU2B 1OXVA 1QJOA 1EU3A 1Z6HA 3MXUA 1M4VA 5IGCA 1R4QB 4K8JA 2NUCA 1EY5A 4G7HC 2SOBA 4KKUA 4RHRA 5LL6S 5JOBA 3H91A 2F0PA 3VYUA 4A3MB 5K36H 5CV5A 4A3EB 2ZXOA 2NVYB 1IYVA 1G6ZA 4RHSA 2AUJD 3ITPA 1S5CD 3O13A 1Y69U 2PYKA 1GUSA 5AFWA 5M5YB 3HKZB 2M9VA 1KLUD 2Z8LA 4CJ1B 2YU9B 3V05A 1IKMA 1PMRA 4RGOS 2F0SA 1SE2A 5C0XI 1YNJC 1JE4A 2OF1A 2A69C 1I4RA 4C3JG 1QE6A 2EYOA 3FKIB 5C0XH 1XXGA 1UUPA 3TN2A 2IL8A 5JEAH 2DN8A 3W2DA 2B2YA 2F4IA 2A68D 1QCBD 4P2CB 2QF7A 2XNAC 4H0LC 1SJED 2KCNA 3DWQA 5C6AA 5TSSA 1SBBB 2E75C 3GTPB 1ENAA 3I8ZA 2XWBB 2KHSA 4U673 1C4QA 1SE4A 2F1MA 1BCPF 4KY5A 1JCKB 5M5XB 1Y8PB 2MJ8A 3U9SA 4E6IA 1TY0A 1LLRD 2F3VA 3Q0AA 4ID6A 1CI3M 2JXMB 5C3EB 4HR7B 3KLSX 1IKLA 5FKAC 5EJWA 1PDQA 4KY6A 2K03A 4ZLTF 3L9AX 1A3TA 2DY8A 2K01A 1EYAA 1ENCA 3I90A 1QNUA 3QOLA 1CFMA 2PW7A 5LHY1 1GUTA 2E74C 2JE6I 2R7ZB 1SYFA 4BY1B 1J8IA 3OWFA 1BBXC 3D4RA 3J81E 5CMDA 4R8IA 4PV1C 2B39A 2NTSA 2NWGA 4Y7NB 3MA2B 1BCPD 4CHTB 1TWFB 1JR0D 1U4LA 3K7AB 1SYDA 3QB3A 2L12A 2V4DA 2AWNA 4X3SA 2H1EA 2R93B 2FINB 4QMGA 3IKJA 2L5TA 2RBMA 2HDMA 2VUMB 4RGTA 4U68A 4DAVA 3GTJB 3IFDA 4M1UB 5NUCA 2AQ3B 4L6TB 5E4WC 4ZK9B 1EQVA 5I6WA 4OIJA 1SSOA 5I2YA 3I70A 1LT4D 2AQ2B 1LACA 2A6ED 5KRUA 1GHKA 1QG7A 1SNCA 5JPMC 1KLGD 3GTLB 1B53A 3J80E 2PMZB 2J4XA 4C2MB 1AZQA 4KK7A 1B1ZA 2CQAA 3BZDB 3AMUA 2KQ3A 1PYWD 4LMQD 4ZRZA 2JSOA 2N55A 4NP5A 2F0JA 1DD2A 4KTAA 3RZOB 3KK7A 1O7ZA 1S5ED 2F0TA 2N88A 2Z4IA 1S5FD 2L1BA 3IAYA 5I9PA 4B9XA 4TSSA 5C4HA 1A2TA 3DMUA 1F9SA 3EVQA 3FVQA 2WV6D 3HOVB 3VYSA 1DONA 3SK4A 3PUYA 4F88A 2NZ1D 1SEBD 4BBRB 2F0UA 5KGUA 5EPKA 3T53B 3A54A 1I4QA 2EY2A 4KHZA 5CV6A 2D5DA 3PV0A 1UNSA 3GTMB 3MZ5A 4HN7A 1LT5D 2YYZA 4FXKC 3SXHA 2F0EA 4ZKCB 2ENBA 3SK5A 2FHTA 5J39A 3LNNA 3A8JE 1SNDA 3GTQB 4WORA 3K5MA 4PNYA 4C3JB 3FPUB 3A55A 1TWCB 4UAIA 1AW7A 4FF4A 3PMFA 2A74C 1T5XD 3J7AF 5C44B 5CYUA 2LFNA 5EGTA 2BCOA 1FR3A 1TY2A 2B2VA 1EWHA 4KV6A 5JPNC 1WTVA 4KD3A 1WD0A 1ILPA 1JWSD 4H44C 2VNUD 3V96A 4X3KA 2WP8J 2EYLA 4N9PA 1PTOD 5C4JB 5IIFA 1B9MA 3MXPA 1RCVD 1I4HA 3BVGA 2BDOA 3M4YA 5DNFA 3G7LA 3BDOA 3SVMA 1Q1EA 2IPKD 2RKSA 4DFAA 1H9RA 1SDFA 2F0KA 3ONAB 5CV7A 5CBAE 3EFXD 4HSPA 5KYLA 1MGSA 4PMWA 1PFBA 1S5BD 2EYFA 4K2KA 1V1OA 3J81L 3DXJC 5IT9E 1A15A 2RDGA 3NTKA 1FNWA 1MSHA 4G7OC 1CHQD 5EBCA 4DXFA 2A6HD 2KECA 5FK9C 1HRJA 5ELFA 1DM0B 3K0YA 2XSCA 1HA5A 2KVMA 3GTKB 3HP3A 3S1MB 1NR4A 1SNOA 2Q8IB 1VMCA 4WFN3 3KLRA 3PUVA 3DWAA 4C1NK 4RWSC 1QILA 1DXMA 5C3WA 4X3UA 2K05A 4KY7A 3E6ZX 2K04A 1VF5C 3PUXA 3E5SA 3J80L 4KKTA 2R3ZA 4DAYA 1PLFA 2PW5A 4LJZC 3T13A 1F77A 4C56C 2AQ1B 1HA6A 1F2YA 2IX3A 1UEAB 4DXGA 3MVVA 4V0BA 3IL8A 2PQEA 1I4PA 5BN5A 4RGNA 1SE3A 4OIKA 3VR6A 1EY9A 3S1QB 3ND8A 1Q90A 3VR2A 1M8AA 3C2PA 2DY7A 4K5XA 4A3JB 3F2UA 4CJ2C 3X3NA 1EWCA 2BE5C 4JK1C 3TP6A 3T4AC 1E2ZA 3RLFA 3FPPA 2Q8RE 3HGBA 1TWGB 1X3PA 2F03A 1JQYD 1DOKA 5DAUA 4K6DA 1JICA 2EJFC 1CTMA 2EYJA 1TQOA 4ABNA 1Z7TA 5G3LD 3S1RB 2PZUA 5CORA 2X6GA 4HMIA 1WCMB 4F8MA 4K5VA 1RDPD 3D4WA 2WKCA 3RZDB 3SHLA 1WTOA 1JORA 3QJYA 3OPOA 1TS2A 1RTOA 4HSVA 2XIWA 3NQIA 5DEHA 3DUZA 3A8IE 4DK0A 3EQLC 2Z4HA 1JWUD 1BNZA 1VDZA 3A7LA 4DN4M 2X69A 1GUWA 3SR1A 4UDUC 1Y1WB 1II3A 2XRSD 4QF4A 3S2DB 1LT6D 3TSSA 1GUGA 3OMGA 1BQQT 2R61A 2H4OA 5ELBA 2XWJB 1F2ZA 4MN3A 4DU9A 1W6JA 3NHHA 2C5CA 1DZ1A 2WACA 3M85A 1RHPA 1K83B 1STEA 1Q12A 1WTXA 4FNFA 4KKSA 1HTPA 4O42A 1EY7A 1TS5A 1HXYD 1LV9A 3M7NA 4TRDA 4C3HG 2KOLA 1GJXA 3A8KE 3LWUA 4IFDJ 2IX1A 3P75A 1D5ZC 4RKLA 3LWEA 1OXUA 4I65A 4QCLA 3G6JB 3K5LA 4RFBA 2ID0A 2IJ0A 3PO3B 2EXZA 3D4DA 5I6YA 1CA5A 2HUGA 1I6HB 4KJNA 1CHPD 2F0LA 3NBIA 5JJZA 1Y1VB 3GV6A 1PFMA 3Q23A 2OEOA 3QOJA 3GTOB 5IT9L 3K59A 5I9OA 3TMEA 1D5XC 2KUMA 4RCNA 3IFTA 1OO9B 1G2SA 2KJXA 1E2VA 5T1IA 2MP1A 1IHZA 1YNND 1A3VA 2LMCB 5IGGA 3K5OA 1NUCA 1JOOA 1EFID 3MEHA 2A68C 5J1ZA 3R2IA 2RDFA 2JEAI 2XRQD 4CJ0B 1KAAA 1HQRD 2EOTA 1JWMD 3UI2A 2F0VA 1Q8IA 2KA7A 4Z9CB 1GUNA 3NWTA 4CKEA 3WDNA 1G2TA 3HZXA 2ZXPA 2F0QA 1E2WA 2RSNA 1HCZA 1JB3A 4OHJA 2LKVA 4L63B 1D2BA 4IN3A 3TDQA 4BS9A 1DOLA 1U9RA 5C0XJ 5EPLA 4KD4A 4FF1A 5I4DA 4DGZA 2M2LA 3MHBA 1SYEA 2KEEA 3CU7A 5FLXE 5IGFA 1C8CA 1ET6A 3D6WA 3L3OC 1NAPA 1DYQA 2CW0D 3OOCA 3VA5A 3DEOA 1QWYA 1JOKA 2NBFA 2XVSA 3NTHA 4KI0A 2O2LD 2L11A 1FNUA 4XYOA 2QCPX 1HUMA 1EY6A 1BR9A 3M3YB 4HTHA 1I4XA 5A2QE 1AFPA 1LTTD 4FO2A 5M9OA 3LX0A 2E2HB 4FYDA 1NSNS 5IOCA 1ONLA 3NXWA 4S3SA 3MXGA 4PMBA 1ESRA 2EPBA 2E2DC 1PXUA 3D8GA 1ZYRD 3URYA 1SJHD 2EY6A 4DNTB 3K6OA 2I07B 1AN8A 2MHVA 3ERQA 1EYCA 2F3WA 1S5DD 4KN4C 3QWNA 2NN6G 3P20A 1RJTA 2K7VA 4BWGB 2FMCA 3PUWA 4G7ZC 1CZWA 3A56A 3KBXA 2MPMA 4KHVA 3SE0A 3ZYYX 3OW7A 5K5PA 5JVH3 2O4XA 1HHVA 3D6CA 5DM73 2TSSA 5C4ZA 4NDXA 3CHBD 3OIQA 1PTOH 3HEJA 2Y0SB 5ELEA 2NVQB 2F0WA 3OIPA 1C48A 3S17B 3BVMA 3MXNA 5DM63 4IFDG 2D9UA 2HQEA 3BG3A 1ET9A 4ZUIA 3NUCA 1AZPA 4BA1I 4MHEA 3KLSA 2JP1A 1O80A 5E1FA 4C3HB 2PPBC 2NYZD 3SK8A 4EQNA 2B2TC 4F87A 4OO1G 3L7ZC 2SDFA 4XT1B 3VR3A 3PIO3 2F0NA 4K14A 3GD7A 1BOSA 3EA6A 3C1FA 5CV4A 1XWEA 5KNDA 3SK6A 4WRDA 1VF7A 1EL0A 3CRKC 3PUZA 1SNQA 4CBVA 4IUVA 1G291 1PZID 3K5NA 4XXEA 2TMPA 1PFNA 2QKIC 4ZYSA 3MTSA 1G8ZD 4A3GB 2B63B 3TBIB 1IW7D 4XIGS 4QUFA 3VR4A 4FVMA 4K8IA 4HCEA 1STHA 4QB4A 2R6GA 3BVZA 2ZT9C 1PTOB 2FFKB 1QOHA 3T56B 4QIWB 4O1NA 1I3QB 4TKOB 1LTID 3BDCA 1SNMA 3I3CA 2PO4A 3NQTA 1PRTB 2L55A 1O7LA 5JVG3 4K6LA 4AYBB 1MI2A 4BBSB 1F2LA 1FD7D 1NR2A 4IUPA 1ZKOA 2RVLA 2F0IA 1PTOC 1Q3LA 1ILQA 1EEID 2B8GA 2O5JC 4IUQA 1MBYA 5C0XG 1FYCA 3VYTA 3D31A 5FLXL 1PRTC 1SMYD 2PZTA 4YIJA 2K5DA 5C4XB 1VCIA 5EPJA 5IGDA 5FO8B 1H9MA 1TWHB 4FXDA 2RA4A 3I72A 2NN6H 1EEFD 4ODGA 1RTNA 2OXPA 5D3DA 1D6EC 1BUVT 3M7GA 5D3IB 3Q24A 1EIHA 4LK1C 3QO2A 4IUTA 4ZQ3A 2JEBI 1XYIA 5A2QL 2A6HC 3FEWX 1I4GA 3R2TA 4ULLA 4B08A 5BN4A 3DEPA 3H94A 4A3IB 2F0HA 3S9WA 1WTWA 2OT2A 2J0TD 1FNVA 4IFDH 3VYRA 3S15B 1J9OA 1BXTA 1EYDA 1TT2A 1EQTA 5JAVA 4ILWA 1JC7A 2B2WA 1RF2D 3JAML 3H3VC 1ESFA 1PZKD 1LT3D 3BYTB 3CQZB 2B8FA 2IT1A 3KF8A 3M4OB 2A5HA 1UAPA 3OSOA 2E2IB 4OO1H 3I4MB 5CBEE 1S4ZA 1U4RA 1STBA 3HOYB 1CZGA 3GQBA 3EJIA 1O7YA 5FOBB 3I91A 1NCVA 1B3AA 4H13C 5BN3A 3NE5B 2NVXB 1YNJD 4B9WA 2A69D 1A6XA 3S1NB 1SXTA 3K58A 2EZVA 1F9QA 2KEDA 4J6HA 2J7ZA 2ZXRA 4TQUS 3AU7A 3OMCA 4J1MA 1KDBA 2I46A 4HCSA 2B2WC 2DNCA 1OXSC 1IL8A 1L0XB 1RODA 4C1NI 2QEJC 2IWHA 2HCIA 4GZYC 2EYHA 3DM1A 4ZUJA 1H9SA 4CKBA 4V190 1LABA 2B2UA 4F7XA 3S2HB 4CKCA 1H9SB 1QB5D 1EOTA 1LTRD 1MSGA 3TP8A 1SYBA 4IUUA 3KUPA 2AUKA 1BO0A 5CC4A 5EKIA 2BDNA 3OWEB 5LL6X 2K5QA 4EQPA 1KNAA 3NPPA 1OXXK 3HG9A 2IX0A 1D5MC 1IYUA 5E4XA 5KNBA 2EYPA 2B2UC 3PO2B 5IGBA 1F9RA 2KCCA 2WKDA 3QG1A 3NTIA 4NW2A 2CHBD 2K6AA 1STYA 1ICWA 3NBHA 3CRLC 1E0BA 1F9PA 4RAUC 1SFOB 1B9NA 1EIGA 3HOZB 1RD9D 2PZWA 2JA7B 1Q1BA 1TS4A 3GO5A 2B2YC 1CM9A 1SYCA 4KJOA 1U4MA 1W6KA 2LY7A 2O5IC 4DAPA 1TKWB 3R8BA 4A93B 1GXDC 1JOQA 2EJGC 3I4NB 2EDGA 5FO9B 2Z1CA 4XDXA 4XTCS 3P1HA 1DCZA 1HFNA 3HS0C 4C3IG 1SYGA 3I4LA 3BDLA 1VMPA 1CT1D 1OXTA 4IUNA 2F0GA 3GP7A 4M8AA 3MC0B 2F0DA 3EROA 2JA6B 4ME5A 1YNNC 2IW3A 5JEAJ 1BCPB 2WB1B 1CA6A 4OL7A 1B44D 3H0GB 1B2TA 1R9TB 2QILA 5F2DA 1STNA 1STGA 4N9TA 1F2MA 5KIXA 2JA8B 2G9DA 4BY7B 1LO5D 1ZXTA 2EE1A 4NMZA 2VXWA 4XYQA 1XTCD 1SNPA 1TIID 1GHJA 3HOWB 2L4NA 1H9JA 1V1PA 1BF4A 1BCPC 1X3QA 3RMHA 2RSOA 4HEDA 5CV9A 5COYA 3TP5A 3NP8A 2L9HA 4DNRB 1V43A 1Y8OB 2QDBA 1WTRA 1V1PB 3D3RA 4PMCA 2R92B 2K1BA 1V8QA 1WD1A 3SEBA 3OHXC 4BA2I 4OGQC 3RUZA 1TR5A 4XT3B 2ICEC 1D1KA 3X3MA 3HOXB 4K5WA 3A7AB 1G91A 3BYYB 5D14A 1B50A 1LTGD 2A6EC 4XQNA 4J8QA 3JAME 1R4PB 2CW0C 4JBWA 5EBDA 2Q8TA 2NVTB 1KNEA 4LAAA 4HMJA 1TS3A 2FJ2A 1K8OA 3WOFA 5IODA 4IALA 2B2TA 1EY8A 3FMCA 4CGYB 3NSWA 3R93A 4RKBA 2LS01 3R3OA 3PIP3 3NK9A 1L0YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8G A;  1SMY C;  1Y8N B;  3EQL C;  4PV1 C;  1YNJ C;  2O5J C;  2PPB C;  3GQB A;  3T51 B;  1OXX K;  2LMC B;  2K33 A;  2A69 C;  2BA0 A;  1HPC A;  5C0X G;  4DK1 A;  3VA7 A;  1VDZ A;  3A7L A;  1FYC A;  5C0X H;  3D31 A;  2A68 C;  4H13 C;  1IYU A;  1B9M A;  5KNB A;  5BN3 A;  3NE5 B;  5JEA H;  2JEA I;  2D2C C;  5KNC A;  2D62 A;  3W3A A;  1H9K A;  2V4D A;  5BN5 A;  4OO1 G;  1GUG A;  1ONL A;  2A69 D;  1VCI A;  2BDO A;  2DN8 A;  2KCC A;  3L7Z C;  3M4Y A;  3ND9 A;  3QIA A;  2EVB A;  3BDO A;  1H9M A;  3PUY A;  3QG1 A;  1GHJ A;  1GUO A;  1A6X A;  2A68 D;  3VR3 A;  1ZYR C;  3VR6 A;  1Q1E A;  1H9J A;  2DNE A;  3I72 A;  2NN6 H;  2PNR C;  1H9R A;  3CRL C;  1Q90 A;  3ND8 A;  3GD7 A;  2KA7 A;  2QF7 A;  3IKJ A;  3T53 B;  1GUN A;  2L5T A;  4H0L C;  4TQU S;  5KND A;  1T5E A;  3M85 A;  4KHZ A;  1Q12 A;  2D5D A;  3PV0 A;  1VF7 A;  3VR2 A;  1B9N A;  3CRK C;  2DNC A;  1OXS C;  4KKS A;  3PUZ A;  1HTP A;  4LK1 C;  2K32 A;  2E75 C;  4DNT B;  5JEA G;  4DNR B;  1G29 1;  2JEB I;  5A35 A;  3M7N A;  1V43 A;  1Q1B A;  1Y8O B;  2BE5 C;  3WDN A;  3DXJ C;  4JK1 C;  1IW7 C;  2NN6 I;  1TU2 B;  3N6R A;  3VR5 A;  1OXV A;  1QJO A;  2A6H C;  1GJX A;  1Z6H A;  2YYZ A;  2F1M A;  3MFY A;  1K8M A;  3MXU A;  4I7Z C;  4KN4 C;  1V8Q A;  3A8K E;  3LWU A;  5BN4 A;  2NN6 G;  3I73 A;  1E2W A;  1LAC A;  2A6E D;  2K7V A;  3P20 A;  4G7O C;  1E2Z A;  1GHK A;  1Y8P B;  3H94 A;  3RLF A;  3U9S A;  3PUW A;  1HCZ A;  2BE5 D;  4BA2 I;  4GZY C;  1IW7 D;  3FPP A;  3HGB A;  1H9S A;  4OGQ C;  4XIG S;  3VR4 A;  1TKW B;  4G7H C;  2O5I C;  3LNN A;  2A6H D;  1OXU A;  4KKU A;  4G7Z C;  3A8J E;  1O78 A;  1LAB A;  2E76 C;  1CI3 M;  2JXM B;  3A7A B;  2R6G A;  3SE0 A;  3OW7 A;  2ZT9 C;  4KN7 C;  2EJF C;  1CTM A;  4KMU C;  2A6E C;  3T56 B;  4HR7 B;  3TZU A;  4IFD H;  5K36 H;  2CW0 C;  1Z7T A;  2EJG C;  2PCF B;  4JBW A;  2EDG A;  4TKO B;  1H9S B;  1BDO A;  1IYV A;  1HQM C;  1I6V C;  2AWO A;  2AUJ D;  4XTC S;  1DCZ A;  2Q8I B;  3KLR A;  4IQZ A;  4L8J A;  3I4L A;  3PUV A;  1Y69 U;  1O7L A;  3OOC A;  1FR3 A;  3AB9 A;  1GUS A;  1CFM A;  1K8O A;  3SDZ A;  1DD2 A;  1EWH A;  1DXM A;  1OXT A;  1GUT A;  2B8F A;  2IT1 A;  3FMC A;  4RCN A;  3IFT A;  2E74 C;  2JE6 I;  4KI0 A;  3QJY A;  4OO1 H;  1ZKO A;  4IFD G;  3OPO A;  2EJM A;  2AUK A;  1YNN C;  1VF5 C;  1E2V A;  3PUX A;  3BG3 A;  5K36 G;  1PMR A;  2BA1 A;  4KKT A;  3A8I E;  4BA1 I;  3D4R A;  4LJZ C;  4H44 C;  4DK0 A; 
#chains in the Genus database with same CATH topology
 4FP5 D;  1Y8N B;  5EKL A;  1LYL A;  5CR3 A;  1N33 Q;  2SNS A;  3NWS A;  2SNM A;  1N36 Q;  4DK1 A;  2JN4 A;  2DUD A;  3VA7 A;  3S16 B;  4A3D B;  5M3F H;  2F0M A;  1K8A C;  4A3E G;  3DWP A;  4FXG C;  1LM0 A;  1KTK A;  1HTL D;  4G4K A;  1PTO F;  3CCL A;  3V2T A;  3QIA A;  3C1E A;  2E2J B;  1D1I A;  3S14 B;  1ZYR C;  1HFG A;  2NB0 A;  3AFQ A;  2A73 B;  1CQF A;  3HKZ G;  3CP0 A;  1PYS B;  3HRZ C;  4LFB Q;  3DHQ A;  2MGS A;  3C46 A;  1VQ8 A;  1PRT F;  4R4T A;  1PV4 A;  4RH6 A;  3FDT A;  2ZTC A;  2JA5 B;  5KYI A;  4K0K Q;  2NTT A;  2B29 A;  2GA4 B;  3FHW A;  2CWP A;  5FO7 B;  4L5R C;  3U9O A;  3PQI A;  2N8N A;  1IBM Q;  3N6R A;  5D65 A;  2HDL A;  2MUY A;  1K8M A;  3J7Y W;  4I7Z C;  3Q6S A;  4JBK A;  4A3F H;  4JC0 A;  1K28 A;  1DOM A;  1XX8 A;  1B4O A;  4EGV A;  1AP0 A;  2HCC A;  4C3I H;  2X6L A;  5C5L A;  1QNK A;  4WJW A;  1EY4 A;  3BU2 A;  1WVL A;  1O78 A;  2UUB L;  2E76 C;  4IZ8 A;  1DJR D;  4G57 A;  2JYO A;  5C3X A;  3K57 A;  5EQ0 A;  3T16 A;  1MD2 D;  1GVP A;  4KN7 C;  4KMU C;  3E0J A;  4EQO A;  5J3B A;  1DGS A;  3KYH C;  3TZU A;  4MNO A;  1I50 H;  5HGT A;  2M00 A;  4H7B A;  2PCF B;  5M5W B;  2A19 A;  2KBN A;  4EVO A;  4PQX A;  1BDO A;  1GD7 A;  3G71 A;  4ZKB B;  3H09 A;  5HUR A;  1KAB A;  4R8N A;  1LTL A;  1TWA H;  4DV7 L;  3Q8D A;  4A3K B;  3IRB A;  3PF5 A;  3AB9 A;  1IBL L;  4XQQ A;  3H3V I;  3EIV A;  3ERS X;  2QA4 A;  4GKJ Q;  1ICF B;  2GVB A;  1WYD A;  1RKN A;  1Y1V G;  1NNX A;  1ML0 D;  5M3F B;  1WTQ A;  5K36 G;  1U4P A;  3RD4 A;  1PRT D;  1VQH A;  1CQV A;  2BA1 A;  1Z47 A;  3A5U A;  5CGK A;  4DF7 A;  5CV8 A;  5C5M A;  1VQ7 A;  5E3F A;  1HPC A;  2F4V Q;  2IHE A;  3TP7 A;  1B70 B;  4DA2 A;  2B2V C;  5M3M H;  3BS1 A;  4DR2 L;  2D2C C;  2F0F A;  3GV3 A;  5KNC A;  2RHS B;  3MAQ A;  3CCE A;  1LTB D;  1BBW A;  3ND9 A;  2EVB A;  1GUO A;  2R7D A;  1EY0 A;  2EYM A;  1NMG A;  4FF2 A;  4R9W A;  1CUK A;  5ISR A;  1V9P A;  4RCO A;  1T5E A;  1YHA A;  1KDA A;  2HD3 A;  4A3F B;  1A2U A;  4BY1 G;  1FGB D;  4A3B H;  2RQX A;  5ELD A;  4JI6 L;  3GTG H;  5JEA G;  4C3I B;  1KDC A;  3Q22 A;  1IW7 C;  2NN6 I;  4RGM A;  1EZ8 A;  2L0C A;  1EZ6 A;  3VR5 A;  3MFY A;  1VQF A;  5IE8 A;  1XMO L;  4JYA L;  1WTP A;  2ZM6 L;  3I73 A;  2VB3 X;  4DV1 L;  4OWT B;  2BE5 D;  1SN8 A;  5KEE A;  1I50 B;  4NKL A;  1VQL A;  1KL9 A;  5J22 A;  1GO3 E;  2VB2 X;  4HAE A;  2N3S A;  2EY1 A;  3FRP B;  3N52 A;  3WOE A;  3J81 j;  1STA A;  2RDH A;  2EY5 A;  1CKM A;  3MFG A;  1TWA B;  2FMM A;  3MWY W;  2K5W A;  2VUM G;  1GOZ A;  1AH9 A;  1LTS D;  4QUC A;  5IP7 G;  1HQM C;  1I6V C;  4DR1 L;  1PZJ D;  2AWO A;  1LTA D;  2F0O A;  2QEX A;  4IQZ A;  4L8J A;  4Q5V A;  3CME A;  2K28 A;  3J80 c;  5G3L F;  2WII B;  4A3M H;  5T1G A;  1X32 A;  3SDZ A;  1VQM A;  1RL2 A;  4IFD I;  2G9H D;  5EKK A;  4A3E H;  2NVY H;  3TZD A;  1SAP A;  2C9O A;  1ENF A;  1VS0 A;  2EJM A;  1IBK L;  4ZAI A;  2CH4 W;  1CSQ A;  1PA6 A;  3H6M A;  3I55 A;  2D0P A;  3HOU B;  5M3M B;  4X66 L;  3KBG A;  5I2X A;  5M5Y H;  3W1B A;  4K2L A;  2DGY A;  1SMY C;  4RA8 A;  4X3T A;  2SEB D;  3T51 B;  1VQI A;  2BA0 A;  2K33 A;  3J7A 5;  4Q0F A;  1AEX A;  4OO1 I;  2YU9 H;  4LF8 Q;  2D62 A;  4FF3 A;  1EUJ A;  1LUZ A;  5ELC A;  3W3A A;  1H9K A;  1HUN A;  3C3L A;  3CCS A;  2ICI A;  1EQQ A;  1CK1 A;  2BH8 A;  4A3B B;  1XTD A;  3GTG B;  2BOS A;  2DNE A;  2CVR A;  2PNR C;  5IGE A;  4IUR A;  4JI7 L;  2VQF L;  3BZK A;  2WIN B;  3CKI B;  2CQO A;  1TVX A;  5IYB G;  2XN9 C;  3J7A V;  2WAQ B;  4XQJ A;  2K32 A;  1A3U A;  3P7J A;  4A75 A;  1EU4 A;  5A35 A;  1P16 A;  4MIU A;  3LGJ A;  1ZEQ X;  1TU2 B;  1OXV A;  1QJO A;  2PI2 E;  1EU3 A;  1Z6H A;  2UUB Q;  2QGQ A;  3MXU A;  4GLX A;  1M4V A;  5IGC A;  1R4Q B;  4K8J A;  2NUC A;  3HOV G;  4CDD C;  1EY5 A;  3GTP H;  4DR3 L;  3ULP A;  1KRS A;  4G7H C;  2SOB A;  4KKU A;  4RHR A;  5GRO A;  4R4I A;  4KHP L;  4BBR G;  5LL6 S;  4B3T L;  2ES2 A;  5JOB A;  3H91 A;  1HJP A;  1X3G A;  2F0P A;  3I56 A;  2ZJR A;  1YNX A;  3VYU A;  1HZB A;  5M5X H;  1D8L A;  2XGT A;  4A3M B;  5K36 H;  4DV7 Q;  1YJN A;  5CV5 A;  4A3E B;  1B3Q A;  2ZXO A;  2NVY B;  3B6Y A;  1IYV A;  1G6Z A;  4RHS A;  2AUJ D;  3ITP A;  2QW7 A;  1S5C D;  3O13 A;  4JBM A;  1X9N A;  2Q2H A;  5C3E H;  1XPO A;  1PH2 A;  1Y69 U;  2PYK A;  4IJH A;  1GUS A;  5AFW A;  1ASY A;  5M5Y B;  3HKZ B;  1UE1 A;  2M9V A;  1KLU D;  4WJ4 A;  2Z8L A;  3U50 C;  4CJ1 B;  2YU9 B;  3V05 A;  1IKM A;  1PMR A;  4RGO S;  2F0S A;  1QZG A;  1SE2 A;  1PVO A;  1K8G A;  5C0X I;  4DR2 Q;  1YNJ C;  4DR5 L;  1JE4 A;  2F52 A;  3WWV A;  2OF1 A;  4LUO A;  4WJ3 M;  2A69 C;  1I4R A;  4C3J G;  2P5Z X;  1QE6 A;  2EYO A;  2NZH A;  3FKI B;  4UPA A;  1XXG A;  5C0X H;  1N8R C;  4BY1 H;  3CPW A;  1UUP A;  3TN2 A;  2IL8 A;  5JEA H;  4GNX C;  2DN8 A;  5C44 G;  3CW2 C;  3W2D A;  2B2Y A;  2F4I A;  2A68 D;  1QCB D;  1J6Q A;  4P2C B;  4Y7N H;  4R4O A;  2QF7 A;  4JI6 Q;  2XNA C;  4H0L C;  1SJE D;  1EIF A;  1TWF H;  2KCN A;  3K7A H;  1QVG A;  3DWQ A;  2OQ0 A;  5C6A A;  5TSS A;  1SBB B;  2MQH A;  2R93 H;  2WFW A;  2E75 C;  3CCQ A;  3GTP B;  2ZM6 Q;  1ENA A;  4DV1 Q;  3I8Z A;  4EQ5 A;  2XWB B;  3RLO A;  2KHS A;  4DV6 L;  2VUM H;  4MZ9 A;  4U67 3;  1C4Q A;  1SE4 A;  2F1M A;  3E0E A;  1W2B A;  1BCP F;  4KY5 A;  1JCK B;  5M5X B;  1Y8P B;  2MJ8 A;  3U9S A;  4E6I A;  5IYD H;  3VDY A;  1TY0 A;  3GTJ H;  2H5X A;  1LLR D;  2F3V A;  1S40 A;  2DJF C;  3Q0A A;  4ID6 A;  1CI3 M;  2JXM B;  4JI2 L;  2Y0S E;  2YTV A;  4A3G G;  3F1Z A;  4DR1 Q;  4BXX H;  5C3E B;  4HR7 B;  3KLS X;  5IYC G;  1IKL A;  2E5L L;  5FKA C;  5EJW A;  1PDQ A;  3STB D;  1FJG L;  4KY6 A;  3GTL H;  1XPU A;  2K03 A;  4C2M H;  4ZLT F;  2RCN A;  3L9A X;  1A3T A;  2DY8 A;  2K01 A;  1FGU A;  1EYA A;  1ENC A;  3I90 A;  1QNU A;  2K52 A;  3QOL A;  1CFM A;  5BR8 L;  2PW7 A;  1E22 A;  5LHY 1;  1GUT A;  4X66 Q;  2E74 C;  1MHW C;  2JE6 I;  2R7Z B;  3RLN A;  1SYF A;  1XNR L;  4BY1 B;  1J8I A;  3OWF A;  1BBX C;  4AYB G;  3JAM i;  2BH2 A;  3D4R A;  3J81 E;  5CMD A;  4R8I A;  4PV1 C;  1YIT A;  3RZO H;  2B39 A;  4JOI C;  3CCR A;  2NTS A;  3BZC A;  2NWG A;  4J15 A;  5IYB H;  4Y7N B;  3MA2 B;  1BCP D;  4IPH A;  3AFP A;  4CHT B;  1TWF B;  1JR0 D;  1U4L A;  3K7A B;  4JI7 Q;  1SYD A;  3QB3 A;  2L12 A;  2V4D A;  2AWN A;  1Q82 C;  2K5N A;  4X3S A;  2H1E A;  2R93 B;  4QY7 A;  4YCU A;  2FIN B;  4L5T A;  1VQD A;  4QMG A;  4POF A;  3HOV H;  3IKJ A;  3MEF A;  2L5T A;  2RBM A;  2HDM A;  2VUM B;  4RGT A;  1YHB A;  4GLA C;  1X56 A;  2HQL A;  1NBW A;  4U68 A;  1VQO A;  4BBR H;  4DAV A;  4O0A A;  4QL5 A;  3GTJ B;  3IFD A;  4M1U B;  5NUC A;  2AQ3 B;  4L6T B;  5E4W C;  4ZK9 B;  1EQV A;  5I6W A;  2CWA A;  4DR3 Q;  4OIJ A;  1SSO A;  2F4V L;  5I2Y A;  3I70 A;  1LT4 D;  4QIW E;  2AQ2 B;  1LAC A;  2A6E D;  5KRU A;  3PIP A;  3GTM H;  4KHP Q;  1GHK A;  4B3T Q;  3L2P A;  1QG7 A;  1SNC A;  3AQQ A;  5JPM C;  1KLG D;  3GTL B;  1B53 A;  3J80 E;  2GVA A;  2PMZ B;  2J4X A;  4C2M B;  1AZQ A;  4KK7 A;  5ELN A;  5JJI A;  1B1Z A;  2CQA A;  3BZD B;  3AMU A;  4HJ9 A;  2KQ3 A;  1PYB A;  1PYW D;  4LMQ D;  4ZRZ A;  1E1O A;  1VQE A;  4LFC L;  2JSO A;  4A3J G;  2N55 A;  3GTQ H;  4NP5 A;  4C3J H;  3F8T A;  2F0J A;  1D7Q A;  2VQE L;  1DD2 A;  1TWC H;  4KTA A;  3RZO B;  3KK7 A;  4JI0 Q;  5C44 H;  1O7Z A;  1S5E D;  2F0T A;  2N88 A;  2Z4I A;  1S5F D;  4YWL A;  2L1B A;  3IAY A;  5HY6 A;  5I9P A;  4B9X A;  2RCF A;  4TSS A;  1A2T A;  3DMU A;  5C4H A;  1F9S A;  2MO1 A;  4DPG A;  3EVQ A;  4DK6 C;  4YCV A;  2JK8 A;  3FVQ A;  1HZ9 A;  4JBJ A;  2WV6 D;  3HOV B;  3VYS A;  3BJU A;  3HOY G;  3CCJ A;  4GN3 B;  2EXD A;  1DON A;  5LMN L;  3SK4 A;  3PUY A;  4F88 A;  2NZ1 D;  1SEB D;  4BBR B;  2F0U A;  3AYH B;  3E9I A;  5KGU A;  5EPK A;  3AEV A;  2PNH A;  5C4J H;  1NMF A;  3T53 B;  3A54 A;  1I4Q A;  2EY2 A;  4KHZ A;  5CV6 A;  2D5D A;  3PV0 A;  1B8A A;  1UNS A;  4DV6 Q;  3CF5 A;  3GTM B;  4GKK L;  3MZ5 A;  3KJP A;  1PHJ A;  1W3S A;  4HN7 A;  1SR3 A;  4GS3 A;  1LT5 D;  1U5K A;  2YYZ A;  2UXB Q;  4FXK C;  1I5F A;  4LF8 L;  4JI2 Q;  3SXH A;  2F0E A;  1Y1W G;  4ZKC B;  2ENB A;  1GKH A;  3SK5 A;  2FHT A;  5J39 A;  3LNN A;  2I0Q A;  1KHI A;  3A8J E;  1SND A;  2E5L Q;  2A8V A;  1FJG Q;  1PH3 A;  4N8X 1;  3GTQ B;  4WOR A;  1UE5 A;  3T1Y L;  3K5M A;  4PNY A;  4C3J B;  1C7Y A;  3FPU B;  2VY3 A;  3A55 A;  1TWC B;  4UAI A;  1AW7 A;  4FF4 A;  4P74 A;  3PMF A;  1X55 A;  2A74 C;  5BR8 Q;  1T5X D;  3J7A F;  4NXM L;  5GAE C;  5C44 B;  2Z6K A;  5CYU A;  3CD6 A;  2LFN A;  5EGT A;  4P75 A;  2BCO A;  3GTK H;  2JJQ A;  1FR3 A;  1XNR Q;  1TY2 A;  4IPD A;  2B2V A;  1EWH A;  4KV6 A;  5JPN C;  2WAQ E;  2F3I A;  3S1M H;  1WTV A;  1X3F A;  1UE7 A;  4KD3 A;  3E3X A;  3PSI A;  1WD0 A;  3NEL A;  1JWS D;  4H44 C;  2VNU D;  1ILP A;  1SMX A;  3V96 A;  4X3K A;  3CC4 A;  3PO3 G;  1XNQ L;  2WP8 J;  2K5H A;  3KJO A;  2EYL A;  4N9P A;  4AH6 A;  1PTO D;  5C4J B;  2Q2I A;  5IIF A;  1B9M A;  4PZ7 A;  3MXP A;  1RCV D;  1I4H A;  3BVG A;  3TQY A;  2BDO A;  1MJE A;  3M4Y A;  5DNF A;  3G7L A;  3BDO A;  3SVM A;  2HHH L;  1Q1E A;  2IPK D;  2RKS A;  4DFA A;  1H9R A;  4CDF C;  4UY8 C;  4OXP A;  3PO2 G;  1SDF A;  1Q86 C;  1UWV A;  2Z6K C;  2F0K A;  3ONA B;  5CV7 A;  2V1C C;  5CBA E;  3EFX D;  4HSP A;  1M90 C;  5KYL A;  1MGS A;  2R7F A;  4PMW A;  1PFB A;  3KDF A;  1S5B D;  2EYF A;  4K2K A;  3S1Q H;  3F2C A;  1V1O A;  3J81 L;  3DXJ C;  2QDL A;  5GQO A;  5IT9 E;  1P8L A;  1A15 A;  2RDG A;  2YTY A;  1G6P A;  3NTK A;  1FNW A;  3FP9 A;  1MSH A;  4G7O C;  1CHQ D;  2OQK A;  5EBC A;  3J81 c;  4A3J H;  2UXC L;  4DXF A;  2A6H D;  2KEC A;  3KDF B;  5FK9 C;  1HRJ A;  1MKH A;  5ELF A;  4DR4 L;  1X3E A;  1DM0 B;  3K0Y A;  2XSC A;  4LFC Q;  1HA5 A;  1HZA A;  1YZ6 A;  2KVM A;  3GTK B;  1T9H A;  3HP3 A;  1X65 A;  1UE6 A;  1TWG H;  2VZA A;  2VQE Q;  3S1M B;  1NR4 A;  4A93 G;  2HIX A;  5IP9 G;  1SNO A;  2Q8I B;  1VMC A;  4WFN 3;  3KLR A;  3PUV A;  3CCV A;  3DWA A;  4C1N K;  3PCO B;  4RWS C;  1QIL A;  3S1R H;  1DXM A;  5C3W A;  4GN4 B;  4X3U A;  2I5L X;  2K05 A;  4KY7 A;  3E6Z X;  2K04 A;  1VF5 C;  3PUX A;  1WCM H;  3E5S A;  3J80 L;  4A3C G;  2JA9 A;  4KKT A;  1S72 A;  4UP8 A;  2R3Z A;  4DAY A;  1PLF A;  2PW5 A;  4LJZ C;  3T13 A;  5GAH C;  1Q81 C;  2IY5 B;  1F77 A;  4C56 C;  2KCT A;  3RZD H;  2AQ1 B;  1HA6 A;  5LMN Q;  3M4P A;  1F2Y A;  2IX3 A;  3CC7 A;  1UEB A;  1UEA B;  1TXY A;  4DXG A;  3MVV A;  4V0B A;  3IL8 A;  2PQE A;  3I2Z A;  1I4P A;  3H0G G;  4YWK A;  5BN5 A;  1B7Y B;  4YY3 Q;  5GAD C;  2ASB A;  4RGN A;  1SE3 A;  4DAY B;  1KIX A;  4LF7 L;  4JI8 L;  4OIK A;  3VR6 A;  2JA8 G;  4BY7 G;  1EY9 A;  4GKK Q;  3S1Q B;  3ND8 A;  1Q90 A;  1Y1W H;  3S2D H;  3QR8 A;  4LFA L;  3VR2 A;  4AIM A;  1M8A A;  3HOW G;  1BBU A;  3C2P A;  2DY7 A;  2HT1 A;  4K5X A;  3RN2 A;  4A3J B;  3F2U A;  4CJ2 C;  3X3N A;  1EWC A;  2BE5 C;  4JK1 C;  3TP6 A;  1K83 H;  3T4A C;  1E2Z A;  5FJ8 G;  1A63 A;  1H95 A;  3RLF A;  3FPP A;  2Q8R E;  3HGB A;  5HGQ A;  3T1Y Q;  1YJW A;  1TWG B;  1X3P A;  2F03 A;  1JQY D;  1DOK A;  2JQO A;  5DAU A;  4K6D A;  2FXQ A;  1JIC A;  3A74 A;  2EJF C;  4NXM Q;  1CTM A;  2ZTD A;  4ME3 A;  1NJI C;  2EYJ A;  1TQO A;  4JI3 Q;  4ABN A;  1Z7T A;  5G3L D;  3S1R B;  3HOX G;  2PZU A;  2WB1 E;  5COR A;  2X6G A;  3PO3 H;  4HMI A;  1WCM B;  1YVC A;  4F8M A;  1XJV A;  4K5V A;  2MO0 A;  4JVZ A;  1HNZ L;  1RDP D;  3D4W A;  1VQ6 A;  2WKC A;  3ER0 A;  1I6H H;  1XMQ L;  1CKN A;  3RZD B;  3SHL A;  1WTO A;  1SRU A;  1JOR A;  4GNX A;  1X6O A;  3CC2 A;  3QJY A;  4DV3 L;  1XNQ Q;  3OPO A;  1TS2 A;  1RTO A;  1Y1V H;  4HSV A;  2XIW A;  3NQI A;  5DEH A;  1X54 A;  3RR5 A;  4DNI A;  2ZJQ A;  3DUZ A;  3A8I E;  3GTO H;  4DK0 A;  3EQL C;  2Z4H A;  1JWU D;  1BNZ A;  1CKN B;  1VDZ A;  3A7L A;  2HHH Q;  4DN4 M;  4R4Q A;  2X69 A;  1GUW A;  3SR1 A;  4GNX B;  1C0A A;  4UDU C;  1Y1W B;  1II3 A;  2XRS D;  1SLJ A;  4QF4 A;  3S2D B;  2PMZ E;  1LT6 D;  3TSS A;  1GUG A;  1L2F A;  3OMG A;  4FDB A;  1BQQ T;  2R61 A;  1WI5 A;  4AQY Q;  2Y0S G;  2H4O A;  4A3D G;  5ELB A;  2PQA A;  2UU9 L;  2XWJ B;  4JI5 L;  1F2Z A;  4MN3 A;  4DU9 A;  1WFQ A;  1W6J A;  4JI0 L;  3NHH A;  4QJF A;  2C5C A;  1DZ1 A;  2WAC A;  3M85 A;  1RHP A;  1K83 B;  1STE A;  1Q12 A;  4LF5 L;  1WTX A;  4FNF A;  3G6E A;  4YHH L;  4KKS A;  3A5Z B;  1HTP A;  1EQR A;  4O42 A;  1YBY A;  1EY7 A;  2DJG C;  1TS5 A;  3HKS A;  1HXY D;  1LV9 A;  3M7N A;  2UXC Q;  2PQA B;  4TRD A;  4C3H G;  2KOL A;  1GJX A;  4DR4 Q;  3A8K E;  3LWU A;  4IFD J;  2IX1 A;  3P75 A;  4NXN L;  5L37 A;  2JA5 G;  1D5Z C;  2Z9H A;  4RKL A;  1K3B C;  3LWE A;  1OXU A;  4I65 A;  4QCL A;  3G6J B;  3NEM A;  4RFB A;  3K5L A;  2ID0 A;  2IJ0 A;  3ULJ A;  3PO3 B;  4P73 A;  2EXZ A;  2XTI A;  4PZ6 A;  1CKO A;  3D4D A;  5I6Y A;  1CA5 A;  2HUG A;  1I6H B;  2KEN A;  2N78 A;  4KJN A;  4A3C H;  1CHP D;  3PGZ A;  5IP7 H;  2F0L A;  4B3S L;  3NBI A;  5JJZ A;  4JOI A;  1Y1V B;  3GV6 A;  4B3R L;  1PFM A;  1HR0 L;  3Q23 A;  2OEO A;  3QOJ A;  4DUZ L;  3GTO B;  5IT9 L;  2UXB L;  3K59 A;  5I9O A;  3TME A;  1D5X C;  2KUM A;  4RCN A;  3IFT A;  1OO9 B;  1G2S A;  2B63 G;  2KJX A;  2UUA L;  1E2V A;  5T1I A;  4QQB X;  5IT9 c;  2UUC L;  4BY7 H;  4ZCK A;  2MP1 A;  1IHZ A;  1YNN D;  2ZTE A;  4I7A A;  3J7Z C;  4A76 A;  1A3V A;  2LMC B;  5IGG A;  3K5O A;  1NUC A;  2Z6B A;  5M3F G;  1JOO A;  2CCZ A;  4LF7 Q;  4JI8 Q;  1EFI D;  3MEH A;  2A68 C;  5J1Z A;  3R2I A;  1E24 A;  2RDF A;  2JEA I;  3UDF A;  2XRQ D;  4CJ0 B;  3CPF A;  3M3Y H;  1KAA A;  1HQR D;  3M4Q A;  1RIP A;  4OWW B;  2EOT A;  4LFA Q;  4APV A;  3U4V A;  1JWM D;  3UI2 A;  2F0V A;  2D0O A;  4DV4 Q;  1A0I A;  1Q8I A;  1K0R A;  4BBS G;  5FJ8 H;  2KA7 A;  4Z9C B;  1GUN A;  3NWT A;  2E2H H;  1OTC A;  1VQC A;  4PG3 A;  3RN5 A;  4CKE A;  3WDN A;  1G2T A;  1KAW A;  3HZX A;  2ZXP A;  2F0Q A;  2CH4 A;  1XPR A;  3KFU A;  4MTK A;  1E2W A;  2RSN A;  1HCZ A;  1JB3 A;  4OHJ A;  5C4X G;  2LKV A;  1PH1 A;  3ICE A;  4L63 B;  1D2B A;  4IN3 A;  3TDQ A;  4BS9 A;  2K14 A;  4DAM A;  4DR6 Q;  5IY0 A;  1DOL A;  1U9R A;  5C0X J;  5EPL A;  4KD4 A;  4FF1 A;  5I4D A;  4DGZ A;  2M2L A;  4IJL A;  4HJA A;  5LMU L;  3MHB A;  1SYE A;  2KEE A;  3CU7 A;  5FLX E;  5IGF A;  4DV0 L;  1C8C A;  1HNZ Q;  1ET6 A;  2KHI A;  3D6W A;  3L3O C;  1NAP A;  1XMQ Q;  4GOP C;  1DYQ A;  2CFM A;  2CW0 D;  2NZO A;  3M9B A;  5AJ3 L;  4DV3 Q;  3OOC A;  3VA5 A;  2EIF A;  4TVA B;  4P72 A;  2AHO B;  1HNW L;  3DEO A;  1QWY A;  1A8V A;  1JOK A;  2NBF A;  4LF6 L;  2XVS A;  3NTH A;  4KI0 A;  5JJL A;  4A3I G;  2O2L D;  2L11 A;  1FNU A;  2OTL A;  4XYO A;  2QCP X;  4X62 L;  1HUM A;  2NVQ H;  1EY6 A;  1BR9 A;  3I7F A;  1E7Z A;  3M3Y B;  4HTH A;  1I4X A;  3S17 H;  5A2Q E;  1AFP A;  1LTT D;  4FO2 A;  5M9O A;  3LX0 A;  3HOU G;  2UU9 Q;  2E2H B;  4FYD A;  4DV2 L;  2YV5 A;  4JI5 Q;  1NSN S;  5IOC A;  1ONL A;  3CCU A;  1AE2 A;  4C3H H;  3NXW A;  1EYG A;  4LF5 Q;  4YHH Q;  4X65 L;  4LUZ A;  4S3S A;  3MXG A;  4PMB A;  4JV5 Q;  1ASZ A;  1ESR A;  3K81 C;  2EPB A;  2E2D C;  1PXU A;  4RMF A;  3D8G A;  1ZYR D;  2HIV A;  1NY4 A;  2B3G A;  3URY A;  1SJH D;  3I4M G;  2EY6 A;  4DNT B;  1E3P A;  2Q2T A;  3K6O A;  4NXN Q;  1C9O A;  1I94 L;  1QVC A;  2I07 B;  2A1A A;  1AN8 A;  2MHV A;  3ERQ A;  1EYC A;  2F3W A;  1S5D D;  1YI2 A;  2RHQ B;  4KN4 C;  3QWN A;  2NN6 G;  3P20 A;  3UDI A;  1RJT A;  2K7V A;  2WAQ G;  4BWG B;  2FMC A;  3PUW A;  3OYY A;  5EAY A;  4YY3 L;  4G7Z C;  1CZW A;  1PH5 A;  3A56 A;  3KBX A;  2MPM A;  4KHV A;  3SE0 A;  3ZYY X;  3OW7 A;  4B3S Q;  4A3G H;  1O7I A;  1HH2 P;  2K5V A;  3U58 A;  2B63 H;  5K5P A;  5JVH 3;  2O4X A;  1HHV A;  4B3R Q;  5IYC H;  1HR0 Q;  3D6C A;  5DM7 3;  4DUZ Q;  2TSS A;  1GM5 A;  4X64 L;  5C4Z A;  5DLQ E;  4NDX A;  3CHB D;  3OIQ A;  1PTO H;  3HEJ A;  2Y0S B;  2GN5 A;  5ELE A;  4A3M G;  2NVQ B;  2UUA Q;  1JE5 A;  1IZ6 A;  1I3Q H;  2F0W A;  3OIP A;  1C48 A;  2UUC Q;  4DR7 L;  3S17 B;  3BVM A;  3MXN A;  5DM6 3;  3DM3 A;  4IFD G;  4RG1 A;  2D9U A;  2HQE A;  1SRO A;  3BG3 A;  1ET9 A;  4ZUI A;  3NUC A;  3RNU A;  1AZP A;  4MHE A;  3KLS A;  4BA1 I;  2JP1 A;  4BBS H;  5IWA L;  1AE3 A;  1O80 A;  3K80 C;  5E1F A;  4C3H B;  1HNX L;  4POG A;  2PPB C;  1VQN A;  3A0J A;  4JI3 L;  2NYZ D;  4IPC A;  3SK8 A;  3MXN B;  5H1S E;  4UP7 A;  1N32 L;  1HR0 W;  4EQN A;  2B2T C;  4UHV A;  1JMC A;  4F87 A;  4OO1 G;  3L7Z C;  1S3O A;  1EWI A;  2SDF A;  4XT1 B;  3VR3 A;  2ALY B;  3PIO 3;  3T1H Q;  3FKI G;  2F0N A;  4K14 A;  4CDE C;  3GD7 A;  1BOS A;  3EA6 A;  3G48 A;  3C1F A;  5CV4 A;  1XWE A;  5KND A;  3SK6 A;  4WRD A;  5C4X H;  1A62 A;  4LWC A;  4N8F A;  1VF7 A;  1EL0 A;  3CRK C;  2KCM A;  3PUZ A;  1TWH H;  1SNQ A;  4CBV A;  4IUV A;  4A4I A;  1G29 1;  1PZI D;  3K5N A;  3TS2 A;  4XXE A;  2TMP A;  1PFN A;  1BKB A;  2QKI C;  1JJG A;  4ZYS A;  1Q7Y C;  1PH6 A;  3MTS A;  1G8Z D;  4L5Q A;  1JB7 A;  4A3G B;  2B63 B;  3TBI B;  1IW7 D;  4XIG S;  3VR4 A;  4QUF A;  4LF9 L;  4FVM A;  4K8I A;  1Q8K A;  4HCE A;  5LMU Q;  4AQY L;  4JI4 L;  3K7U C;  1STH A;  4QB4 A;  2OWO A;  2R6G A;  3BVZ A;  4DV0 Q;  2ZT9 C;  1PTO B;  2FFK B;  1QOH A;  3T56 B;  3H3V H;  3HKZ E;  4QIW B;  3F2B A;  4A3I H;  4O1N A;  1I3Q B;  3D0F A;  5AJ3 Q;  4TKO B;  1LTI D;  3BDC A;  4MTN A;  1SNM A;  1HNW Q;  3I3C A;  3HOZ G;  2PO4 A;  4R1J A;  4LF6 Q;  3NQT A;  2JA7 G;  1PRT B;  5C3E G;  2L55 A;  1O7L A;  1KRT A;  5JVG 3;  4K6L A;  4AYB B;  2EQS A;  1MI2 A;  4X62 Q;  4BBS B;  1F2L A;  4DUY L;  3S15 H;  3HOU H;  4Y52 H;  1FD7 D;  1NR2 A;  4OWX B;  4IUP A;  1ZKO A;  2RVL A;  2Z0S A;  2F0I A;  1PTO C;  1VQG A;  2UXD L;  1FL0 A;  4L5S A;  2AKW B;  1Q3L A;  1ILQ A;  1EEI D;  2B8G A;  2O5J C;  3GDE A;  4DV2 Q;  3CQZ H;  3M4O H;  2R7Z G;  4DKA C;  4IUQ A;  2E2I H;  1MBY A;  5C0X G;  1FYC A;  2LXK A;  3VYT A;  3I4M H;  2OCE A;  3D31 A;  3TS0 A;  3I4N G;  4X65 Q;  5FLX L;  1PRT C;  1SMY D;  3HOY H;  2PZT A;  4YIJ A;  3TRE A;  2K5D A;  5C4X B;  3EBE A;  1VCI A;  5EPJ A;  3OTO Q;  5IGD A;  4HID A;  5FO8 B;  1NTG A;  1H9M A;  1TWH B;  4FXD A;  2RA4 A;  3I72 A;  5FLX c;  2NN6 H;  1EEF D;  4LUV A;  2N49 A;  4ODG A;  2NVX H;  1RTN A;  2OXP A;  1I94 Q;  5D3D A;  1D6E C;  1KQS A;  4JW0 A;  1BUV T;  2JA6 G;  3M7G A;  2R93 G;  5D3I B;  3Q24 A;  1EIH A;  3S1N H;  2WB1 G;  4LK1 C;  1Q46 A;  3QO2 A;  4IUT A;  4ZQ3 A;  2JEB I;  1XYI A;  3TRZ A;  1WJJ A;  5A2Q L;  4IOA A;  2A6H C;  3FEW X;  1I4G A;  4O2D A;  3R2T A;  4ULL A;  4B08 A;  5BN4 A;  4HJ5 A;  1MJC A;  5IYD G;  3DEP A;  3H94 A;  4DK3 C;  4A3I B;  1CSP A;  2F0H A;  3S9W A;  1WTW A;  2OT2 A;  4DV4 L;  4B3M L;  4X64 Q;  4HJ7 A;  4BXX G;  2J0T D;  1M1K C;  1FNV A;  1Y14 B;  4IFD H;  1KXL A;  3VYR A;  4IOC A;  4HIO A;  3S15 B;  1J9O A;  4YCW A;  1PH7 A;  1BXT A;  4DR7 Q;  1EYD A;  1TT2 A;  1EQT A;  5JAV A;  3NEN A;  5LMN W;  2K75 A;  1JT8 A;  4ILW A;  1JC7 A;  2B2W A;  1KD1 C;  1Z9F A;  4HIK A;  1RF2 D;  3JAM L;  3H3V C;  1ESF A;  3S2H H;  1IL2 A;  1QVF A;  1PZK D;  2R92 G;  1LT3 D;  3BYT B;  3CQZ B;  2B8F A;  2IT1 A;  3KF8 A;  3M4O B;  2A5H A;  5IWA Q;  1PH4 A;  4OX9 L;  1UAP A;  3OSO A;  3K0X A;  4OO1 H;  2E2I B;  1HNX Q;  3TEH B;  3JAM c;  3I4M B;  3W5O A;  5CBE E;  1S4Z A;  1U4R A;  1STB A;  3HOY B;  3FKI H;  1N32 Q;  4DR6 L;  1L1O A;  1CZG A;  3UE0 A;  1L0W A;  1VQK A;  4NB3 A;  4JI1 L;  3GQB A;  3EJI A;  3CXC A;  1O7Y A;  4LNQ A;  5FOB B;  3KF8 B;  3I91 A;  3JC6 6;  1NCV A;  1B3A A;  4H13 C;  1K73 C;  5BN3 A;  3NE5 B;  2NVX B;  1YNJ D;  2IHF A;  4B9W A;  2A69 D;  1A6X A;  3S1N B;  1SXT A;  3K58 A;  1L1O B;  2EZV A;  1F9Q A;  4A3L G;  2KED A;  4J6H A;  3U4Z A;  3ULL A;  2J7Z A;  3DLL A;  2ZXR A;  1V1Q A;  4TQU S;  4LF4 L;  3AU7 A;  3PO2 H;  3OMC A;  3F2D A;  4J1M A;  1KDB A;  2I46 A;  4HCS A;  2B2W C;  2DNC A;  1OXS C;  1WOC A;  1IL8 A;  3KF6 A;  2K50 A;  4LF9 Q;  4JG2 A;  2KHJ A;  1L0X B;  1NE3 A;  1ROD A;  4C1N I;  1QZH A;  1IBL Q;  4JI4 Q;  1K9M C;  2QEJ C;  2IWH A;  1SFO H;  4JCV E;  4OEM B;  1N34 L;  4OEL B;  2HCI A;  4GZY C;  2EYH A;  3DM1 A;  5GAG C;  3HOZ H;  4ZUJ A;  1H9S A;  1L1O C;  1VQB A;  2JA7 H;  3J81 i;  4CKB A;  4V19 0;  1LAB A;  3KF6 B;  2B2U A;  3CCM A;  4F7X A;  1SE8 A;  4JV5 L;  1QUQ A;  2L15 A;  3S2H B;  1U0L A;  2I5H A;  4OON A;  4CKC A;  1H9S B;  1QB5 D;  4DV5 L;  1VQJ A;  4DUY Q;  1EOT A;  1LTR D;  3L0O A;  5FLM G;  1K3R A;  4IO9 A;  4A93 H;  5IP9 H;  2R7Z H;  1MSG A;  3TP8 A;  1G51 A;  3PF4 A;  1QUQ B;  1SYB A;  2UXD Q;  2LXJ A;  3I4N H;  3UDX A;  2G5D A;  4IUU A;  3H15 A;  3KUP A;  2AUK A;  1BO0 A;  5CC4 A;  2CKZ B;  5EKI A;  4HJ8 A;  1FVI A;  2BDN A;  3OWE B;  2Q2U A;  1J5E L;  5LL6 X;  2K5Q A;  2MFI A;  3SGI A;  4EQP A;  1KNA A;  3NPP A;  1OXX K;  2JA6 H;  3HG9 A;  1XMO Q;  4JYA Q;  2IX0 A;  1D5M C;  1IYU A;  3J80 i;  5E4X A;  5KNB A;  2EYP A;  2B2U C;  4IPG A;  3PO2 B;  4X6A H;  5IGB A;  1F9R A;  1VQ5 A;  1N33 L;  2KCC A;  3H0G H;  1N36 L;  4PZ8 A;  1R9T H;  2WKD A;  1WTH A;  3QG1 A;  3NTI A;  4NW2 A;  2CHB D;  2K6A A;  3UE1 A;  3KOJ A;  1STY A;  4A3K G;  2JA8 H;  1ICW A;  3NBH A;  3CRL C;  1N9W A;  1E0B A;  1EOV A;  1F9P A;  2VW9 A;  4RAU C;  1SFO B;  1B9N A;  1E1T A;  1EIG A;  2C35 B;  4R4C A;  3HOW H;  3HOZ B;  3CMA A;  1PH8 A;  1RD9 D;  2PZW A;  2JA7 B;  4LFB L;  1Q1B A;  1TS4 A;  3GO5 A;  2E8G A;  3NBH B;  2B2Y C;  5E7N A;  1CM9 A;  1SYC A;  4KJO A;  1U4M A;  4K0K L;  1W6K A;  2LY7 A;  3K8A A;  4B3M Q;  2O5I C;  4GOP A;  4DAP A;  1IBM L;  1TKW B;  2ATW A;  1IBK Q;  2VS1 A;  3R8B A;  1YIJ A;  4JPB W;  3T1H L;  2R92 H;  1GXD C;  4A93 B;  1VQ4 A;  1EIY B;  1JOQ A;  4GLV B;  3HFZ B;  2EJG C;  4P71 A;  2PI2 A;  4LW1 A;  3I4N B;  2EDG A;  5FO9 B;  2Z1C A;  4XDX A;  3HOX H;  2LSS A;  4GOP B;  4A3F G;  1YJ9 A;  3P1H A;  4XTC S;  1YHQ A;  1VQP A;  1DCZ A;  1HFN A;  3HS0 C;  4C3I G;  4KLK A;  4OX9 Q;  1SYG A;  3I4L A;  3BDL A;  1VMP A;  2MNA A;  3STB C;  1CT1 D;  1OXT A;  4IUN A;  2F0G A;  3GP7 A;  2VQF Q;  1EFW A;  4M8A A;  3MC0 B;  2F0D A;  3ERO A;  4YWM A;  2JA6 B;  4ME5 A;  1YNN C;  2IW3 A;  4JI1 Q;  2NVT H;  5JEA J;  1BCP B;  2WB1 B;  1CA6 A;  3I4O A;  1PH9 A;  3UDG A;  1HZC A;  4OL7 A;  4GKJ L;  1B44 D;  4A3L H;  3H0G B;  1B2T A;  1R9T B;  2QIL A;  5F2D A;  4ALP A;  1STN A;  1STG A;  4N9T A;  5JJK A;  1F2M A;  5KIX A;  2JA8 B;  2G9D A;  4BY7 B;  1LO5 D;  3KLW A;  1ZXT A;  3EN2 A;  2EE1 A;  1IXR A;  3E9H A;  4NMZ A;  2VXW A;  4XYQ A;  1XTC D;  1VQA A;  1BVS A;  1SNP A;  4LF4 Q;  1TII D;  1GHJ A;  3HOW B;  2L4N A;  1H9J A;  1V1P A;  3S16 H;  1BF4 A;  4A3D H;  1MIU A;  2K4K A;  1BCP C;  1X3Q A;  4NPS A;  3RMH A;  2RSO A;  4HED A;  5CV9 A;  5COY A;  3TP5 A;  2E2J H;  3NP8 A;  3S14 H;  2L9H A;  2YTX A;  4AYB E;  5M3M G;  1N34 Q;  4DNR B;  1V43 A;  1Y8O B;  2QDB A;  1WTR A;  2OTJ A;  1V1P B;  3D3R A;  4H02 A;  4HIM A;  4PMC A;  2VL6 A;  2R92 B;  2K1B A;  4UP9 A;  2I5M X;  1V8Q A;  1WD1 A;  3SEB A;  3OHX C;  4BA2 I;  2JA5 H;  5FLM H;  4OGQ C;  3RUZ A;  2RF4 A;  2AMC B;  3OTO L;  1TR5 A;  4XT3 B;  2ICE C;  1D1K A;  1KC8 C;  3X3M A;  4EX5 A;  3OW2 A;  3HOX B;  4K5W A;  3A7A B;  1G91 A;  3BYY B;  4A3B G;  5D14 A;  1JJ2 A;  3G4S A;  1IYJ B;  4DV5 Q;  3W1G A;  1VQ9 A;  1B50 A;  1LTG D;  2A6E C;  3CAM A;  4DR5 Q;  4XQN A;  4J8Q A;  3JAM E;  1R4P B;  4CDC C;  2CW0 C;  2ZJP A;  1JJC B;  4JBW A;  5ELO A;  4QGU A;  3S24 A;  5EBD A;  3PIO A;  2Q8T A;  1K0S A;  2NVT B;  1KNE A;  4LAA A;  4HMJ A;  3ZJY C;  1TS3 A;  2FJ2 A;  1PFS A;  1K8O A;  3WOF A;  5M5W H;  4IAL A;  5IOD A;  2B2T A;  1EY8 A;  3FMC A;  4CGY B;  3NSW A;  1J5E Q;  3R93 A;  4RKB A;  2LS0 1;  1WCM G;  3R3O A;  3PIP 3;  4A3K H;  1YEZ A;  3NK9 A;  1L0Y B;  4GN5 A; 
#chains in the Genus database with same CATH homology
 4FP5 D;  1Y8N B;  5EKL A;  5CR3 A;  2SNS A;  3NWS A;  2SNM A;  4DK1 A;  3VA7 A;  3S16 B;  4A3D B;  2F0M A;  3DWP A;  4FXG C;  1KTK A;  1HTL D;  4G4K A;  1PTO F;  3V2T A;  3QIA A;  3C1E A;  2E2J B;  1D1I A;  3S14 B;  1ZYR C;  1HFG A;  2NB0 A;  2A73 B;  1CQF A;  3HRZ C;  3DHQ A;  2MGS A;  3C46 A;  1PRT F;  4RH6 A;  3FDT A;  2JA5 B;  5KYI A;  2NTT A;  2GA4 B;  5FO7 B;  3U9O A;  3N6R A;  5D65 A;  2HDL A;  2MUY A;  1K8M A;  3J7Y W;  4I7Z C;  3Q6S A;  1DOM A;  1XX8 A;  1B4O A;  4EGV A;  1AP0 A;  2HCC A;  2X6L A;  5C5L A;  1QNK A;  4WJW A;  1EY4 A;  1WVL A;  1O78 A;  2E76 C;  4IZ8 A;  1DJR D;  4G57 A;  2JYO A;  5C3X A;  3K57 A;  5EQ0 A;  3T16 A;  1MD2 D;  4KN7 C;  4KMU C;  3E0J A;  4EQO A;  3TZU A;  5HGT A;  2M00 A;  4H7B A;  2PCF B;  5M5W B;  4EVO A;  4PQX A;  1BDO A;  4ZKB B;  3H09 A;  5HUR A;  1KAB A;  4R8N A;  4A3K B;  3AB9 A;  4XQQ A;  1RKN A;  1WTQ A;  1ML0 D;  5M3F B;  5K36 G;  1U4P A;  3RD4 A;  1PRT D;  2BA1 A;  1CQV A;  1Z47 A;  5CGK A;  4DF7 A;  5CV8 A;  5C5M A;  5E3F A;  1HPC A;  3TP7 A;  4DA2 A;  2B2V C;  3BS1 A;  2D2C C;  2F0F A;  3GV3 A;  5KNC A;  3MAQ A;  1LTB D;  3ND9 A;  2EVB A;  1GUO A;  1EY0 A;  2EYM A;  4FF2 A;  4R9W A;  5ISR A;  4RCO A;  1T5E A;  1KDA A;  4A3F B;  1A2U A;  1FGB D;  2RQX A;  5ELD A;  5JEA G;  4C3I B;  1KDC A;  3Q22 A;  1IW7 C;  2NN6 I;  4RGM A;  1EZ8 A;  2L0C A;  1EZ6 A;  3VR5 A;  3MFY A;  1WTP A;  3I73 A;  2VB3 X;  2BE5 D;  5KEE A;  1I50 B;  4NKL A;  5J22 A;  2VB2 X;  4HAE A;  2EY1 A;  3FRP B;  3N52 A;  3WOE A;  1STA A;  2RDH A;  2EY5 A;  3MWY W;  3MFG A;  1TWA B;  2FMM A;  2K5W A;  1GOZ A;  1LTS D;  4QUC A;  1HQM C;  1I6V C;  1PZJ D;  2AWO A;  1LTA D;  2F0O A;  4IQZ A;  4L8J A;  4Q5V A;  2K28 A;  5G3L F;  2WII B;  5T1G A;  1X32 A;  3SDZ A;  4IFD I;  2G9H D;  5EKK A;  3TZD A;  1SAP A;  2C9O A;  1ENF A;  2EJM A;  4ZAI A;  3H6M A;  3HOU B;  5M3M B;  3KBG A;  5I2X A;  4K2L A;  1SMY C;  4RA8 A;  4X3T A;  2SEB D;  3T51 B;  2K33 A;  2BA0 A;  4Q0F A;  1AEX A;  4OO1 I;  2D62 A;  4FF3 A;  5ELC A;  3W3A A;  1H9K A;  1HUN A;  3C3L A;  2ICI A;  1CK1 A;  4A3B B;  3GTG B;  2BOS A;  2DNE A;  2CVR A;  2PNR C;  5IGE A;  4IUR A;  2WIN B;  3CKI B;  1TVX A;  2XN9 C;  3J7A V;  2WAQ B;  4XQJ A;  2K32 A;  1A3U A;  3P7J A;  1EU4 A;  5A35 A;  4MIU A;  1ZEQ X;  1TU2 B;  1OXV A;  1QJO A;  1EU3 A;  1Z6H A;  3MXU A;  1M4V A;  5IGC A;  1R4Q B;  4K8J A;  2NUC A;  1EY5 A;  4G7H C;  2SOB A;  4KKU A;  4RHR A;  5LL6 S;  5JOB A;  3H91 A;  2F0P A;  3VYU A;  4A3M B;  5K36 H;  5CV5 A;  4A3E B;  2ZXO A;  2NVY B;  1IYV A;  1G6Z A;  4RHS A;  2AUJ D;  3ITP A;  1S5C D;  3O13 A;  1Y69 U;  2PYK A;  1GUS A;  5AFW A;  5M5Y B;  3HKZ B;  2M9V A;  1KLU D;  2Z8L A;  4CJ1 B;  2YU9 B;  3V05 A;  1IKM A;  1PMR A;  4RGO S;  2F0S A;  1SE2 A;  5C0X I;  1YNJ C;  1JE4 A;  2OF1 A;  2A69 C;  1I4R A;  4C3J G;  1QE6 A;  2EYO A;  3FKI B;  5C0X H;  1XXG A;  1UUP A;  3TN2 A;  2IL8 A;  5JEA H;  2DN8 A;  3W2D A;  2B2Y A;  2F4I A;  2A68 D;  1QCB D;  4P2C B;  2QF7 A;  2XNA C;  4H0L C;  1SJE D;  2KCN A;  3DWQ A;  5C6A A;  5TSS A;  1SBB B;  2E75 C;  3GTP B;  1ENA A;  3I8Z A;  2XWB B;  2KHS A;  4U67 3;  1C4Q A;  1SE4 A;  2F1M A;  1BCP F;  4KY5 A;  1JCK B;  5M5X B;  1Y8P B;  2MJ8 A;  3U9S A;  4E6I A;  1TY0 A;  1LLR D;  2F3V A;  3Q0A A;  4ID6 A;  1CI3 M;  2JXM B;  5C3E B;  4HR7 B;  3KLS X;  1IKL A;  5FKA C;  5EJW A;  1PDQ A;  4KY6 A;  2K03 A;  4ZLT F;  3L9A X;  1A3T A;  2DY8 A;  2K01 A;  1EYA A;  1ENC A;  3I90 A;  1QNU A;  3QOL A;  1CFM A;  2PW7 A;  5LHY 1;  1GUT A;  2E74 C;  2JE6 I;  2R7Z B;  1SYF A;  4BY1 B;  1J8I A;  3OWF A;  1BBX C;  3D4R A;  3J81 E;  5CMD A;  4R8I A;  4PV1 C;  2B39 A;  2NTS A;  2NWG A;  4Y7N B;  3MA2 B;  1BCP D;  4CHT B;  1TWF B;  1JR0 D;  1U4L A;  3K7A B;  1SYD A;  3QB3 A;  2L12 A;  2V4D A;  2AWN A;  4X3S A;  2H1E A;  2R93 B;  2FIN B;  4QMG A;  3IKJ A;  2L5T A;  2RBM A;  2HDM A;  2VUM B;  4RGT A;  4U68 A;  4DAV A;  3GTJ B;  3IFD A;  4M1U B;  5NUC A;  2AQ3 B;  4L6T B;  5E4W C;  4ZK9 B;  1EQV A;  5I6W A;  4OIJ A;  1SSO A;  5I2Y A;  3I70 A;  1LT4 D;  2AQ2 B;  1LAC A;  2A6E D;  5KRU A;  1GHK A;  1QG7 A;  1SNC A;  5JPM C;  1KLG D;  3GTL B;  1B53 A;  3J80 E;  2PMZ B;  2J4X A;  4C2M B;  1AZQ A;  4KK7 A;  1B1Z A;  2CQA A;  3BZD B;  3AMU A;  2KQ3 A;  1PYW D;  4LMQ D;  4ZRZ A;  2JSO A;  2N55 A;  4NP5 A;  2F0J A;  1DD2 A;  4KTA A;  3RZO B;  3KK7 A;  1O7Z A;  1S5E D;  2F0T A;  2N88 A;  2Z4I A;  1S5F D;  2L1B A;  3IAY A;  5I9P A;  4B9X A;  4TSS A;  5C4H A;  1A2T A;  3DMU A;  1F9S A;  3EVQ A;  3FVQ A;  2WV6 D;  3HOV B;  3VYS A;  1DON A;  3SK4 A;  3PUY A;  4F88 A;  2NZ1 D;  1SEB D;  4BBR B;  2F0U A;  5KGU A;  5EPK A;  3T53 B;  3A54 A;  1I4Q A;  2EY2 A;  4KHZ A;  5CV6 A;  2D5D A;  3PV0 A;  1UNS A;  3GTM B;  3MZ5 A;  4HN7 A;  1LT5 D;  2YYZ A;  4FXK C;  3SXH A;  2F0E A;  4ZKC B;  2ENB A;  3SK5 A;  2FHT A;  5J39 A;  3LNN A;  3A8J E;  1SND A;  3GTQ B;  4WOR A;  3K5M A;  4PNY A;  4C3J B;  3FPU B;  3A55 A;  1TWC B;  4UAI A;  1AW7 A;  4FF4 A;  3PMF A;  2A74 C;  1T5X D;  3J7A F;  5C44 B;  5CYU A;  2LFN A;  5EGT A;  2BCO A;  1FR3 A;  1TY2 A;  2B2V A;  1EWH A;  4KV6 A;  5JPN C;  1WTV A;  4KD3 A;  1WD0 A;  1ILP A;  1JWS D;  4H44 C;  2VNU D;  3V96 A;  4X3K A;  2WP8 J;  2EYL A;  4N9P A;  1PTO D;  5C4J B;  5IIF A;  1B9M A;  3MXP A;  1RCV D;  1I4H A;  3BVG A;  2BDO A;  3M4Y A;  5DNF A;  3G7L A;  3BDO A;  3SVM A;  1Q1E A;  2IPK D;  2RKS A;  4DFA A;  1H9R A;  1SDF A;  2F0K A;  3ONA B;  5CV7 A;  5CBA E;  3EFX D;  4HSP A;  5KYL A;  1MGS A;  4PMW A;  1PFB A;  1S5B D;  2EYF A;  4K2K A;  1V1O A;  3J81 L;  3DXJ C;  5IT9 E;  1A15 A;  2RDG A;  3NTK A;  1FNW A;  1MSH A;  4G7O C;  1CHQ D;  5EBC A;  4DXF A;  2A6H D;  2KEC A;  5FK9 C;  1HRJ A;  5ELF A;  1DM0 B;  3K0Y A;  2XSC A;  1HA5 A;  2KVM A;  3GTK B;  3HP3 A;  3S1M B;  1NR4 A;  1SNO A;  2Q8I B;  1VMC A;  4WFN 3;  3KLR A;  3PUV A;  3DWA A;  4C1N K;  4RWS C;  1QIL A;  1DXM A;  5C3W A;  4X3U A;  2K05 A;  4KY7 A;  3E6Z X;  2K04 A;  1VF5 C;  3PUX A;  3E5S A;  3J80 L;  4KKT A;  2R3Z A;  4DAY A;  1PLF A;  2PW5 A;  4LJZ C;  3T13 A;  1F77 A;  4C56 C;  2AQ1 B;  1HA6 A;  1F2Y A;  2IX3 A;  1UEA B;  4DXG A;  3MVV A;  4V0B A;  3IL8 A;  2PQE A;  1I4P A;  5BN5 A;  4RGN A;  1SE3 A;  4OIK A;  3VR6 A;  1EY9 A;  3S1Q B;  3ND8 A;  1Q90 A;  3VR2 A;  1M8A A;  3C2P A;  2DY7 A;  4K5X A;  4A3J B;  3F2U A;  4CJ2 C;  3X3N A;  1EWC A;  2BE5 C;  4JK1 C;  3TP6 A;  3T4A C;  1E2Z A;  3RLF A;  3FPP A;  2Q8R E;  3HGB A;  1TWG B;  1X3P A;  2F03 A;  1JQY D;  1DOK A;  5DAU A;  4K6D A;  1JIC A;  2EJF C;  1CTM A;  2EYJ A;  1TQO A;  4ABN A;  1Z7T A;  5G3L D;  3S1R B;  2PZU A;  5COR A;  2X6G A;  4HMI A;  1WCM B;  4F8M A;  4K5V A;  1RDP D;  3D4W A;  2WKC A;  3RZD B;  3SHL A;  1WTO A;  1JOR A;  3QJY A;  3OPO A;  1TS2 A;  1RTO A;  4HSV A;  2XIW A;  3NQI A;  5DEH A;  3DUZ A;  3A8I E;  4DK0 A;  3EQL C;  2Z4H A;  1JWU D;  1BNZ A;  1VDZ A;  3A7L A;  4DN4 M;  2X69 A;  1GUW A;  3SR1 A;  4UDU C;  1Y1W B;  1II3 A;  2XRS D;  4QF4 A;  3S2D B;  1LT6 D;  3TSS A;  1GUG A;  3OMG A;  1BQQ T;  2R61 A;  2H4O A;  5ELB A;  2XWJ B;  1F2Z A;  4MN3 A;  4DU9 A;  1W6J A;  3NHH A;  2C5C A;  1DZ1 A;  2WAC A;  3M85 A;  1RHP A;  1K83 B;  1STE A;  1Q12 A;  1WTX A;  4FNF A;  4KKS A;  1HTP A;  4O42 A;  1EY7 A;  1TS5 A;  1HXY D;  1LV9 A;  3M7N A;  4TRD A;  4C3H G;  2KOL A;  1GJX A;  3A8K E;  3LWU A;  4IFD J;  2IX1 A;  3P75 A;  1D5Z C;  4RKL A;  3LWE A;  1OXU A;  4I65 A;  4QCL A;  3G6J B;  3K5L A;  4RFB A;  2ID0 A;  2IJ0 A;  3PO3 B;  2EXZ A;  3D4D A;  5I6Y A;  1CA5 A;  2HUG A;  1I6H B;  4KJN A;  1CHP D;  2F0L A;  3NBI A;  5JJZ A;  1Y1V B;  3GV6 A;  1PFM A;  3Q23 A;  2OEO A;  3QOJ A;  3GTO B;  5IT9 L;  3K59 A;  5I9O A;  3TME A;  1D5X C;  2KUM A;  4RCN A;  3IFT A;  1OO9 B;  1G2S A;  2KJX A;  1E2V A;  5T1I A;  2MP1 A;  1IHZ A;  1YNN D;  1A3V A;  2LMC B;  5IGG A;  3K5O A;  1NUC A;  1JOO A;  1EFI D;  3MEH A;  2A68 C;  5J1Z A;  3R2I A;  2RDF A;  2JEA I;  2XRQ D;  4CJ0 B;  1KAA A;  1HQR D;  2EOT A;  1JWM D;  3UI2 A;  2F0V A;  1Q8I A;  2KA7 A;  4Z9C B;  1GUN A;  3NWT A;  4CKE A;  3WDN A;  1G2T A;  3HZX A;  2ZXP A;  2F0Q A;  1E2W A;  2RSN A;  1HCZ A;  1JB3 A;  4OHJ A;  2LKV A;  4L63 B;  1D2B A;  4IN3 A;  3TDQ A;  4BS9 A;  1DOL A;  1U9R A;  5C0X J;  5EPL A;  4KD4 A;  4FF1 A;  5I4D A;  4DGZ A;  2M2L A;  3MHB A;  1SYE A;  2KEE A;  3CU7 A;  5FLX E;  5IGF A;  1C8C A;  1ET6 A;  3D6W A;  3L3O C;  1NAP A;  1DYQ A;  2CW0 D;  3OOC A;  3VA5 A;  3DEO A;  1QWY A;  1JOK A;  2NBF A;  2XVS A;  3NTH A;  4KI0 A;  2O2L D;  2L11 A;  1FNU A;  4XYO A;  2QCP X;  1HUM A;  1EY6 A;  1BR9 A;  3M3Y B;  4HTH A;  1I4X A;  5A2Q E;  1AFP A;  1LTT D;  4FO2 A;  5M9O A;  3LX0 A;  2E2H B;  4FYD A;  1NSN S;  5IOC A;  1ONL A;  3NXW A;  4S3S A;  3MXG A;  4PMB A;  1ESR A;  2EPB A;  2E2D C;  1PXU A;  3D8G A;  1ZYR D;  3URY A;  1SJH D;  2EY6 A;  4DNT B;  3K6O A;  2I07 B;  1AN8 A;  2MHV A;  3ERQ A;  1EYC A;  2F3W A;  1S5D D;  4KN4 C;  3QWN A;  2NN6 G;  3P20 A;  1RJT A;  2K7V A;  4BWG B;  2FMC A;  3PUW A;  4G7Z C;  1CZW A;  3A56 A;  3KBX A;  2MPM A;  4KHV A;  3SE0 A;  3ZYY X;  3OW7 A;  5K5P A;  5JVH 3;  2O4X A;  1HHV A;  3D6C A;  5DM7 3;  2TSS A;  5C4Z A;  4NDX A;  3CHB D;  3OIQ A;  1PTO H;  3HEJ A;  2Y0S B;  5ELE A;  2NVQ B;  2F0W A;  3OIP A;  1C48 A;  3S17 B;  3BVM A;  3MXN A;  5DM6 3;  4IFD G;  2D9U A;  2HQE A;  3BG3 A;  1ET9 A;  4ZUI A;  3NUC A;  1AZP A;  4BA1 I;  4MHE A;  3KLS A;  2JP1 A;  1O80 A;  5E1F A;  4C3H B;  2PPB C;  2NYZ D;  3SK8 A;  4EQN A;  2B2T C;  4F87 A;  4OO1 G;  3L7Z C;  2SDF A;  4XT1 B;  3VR3 A;  3PIO 3;  2F0N A;  4K14 A;  3GD7 A;  1BOS A;  3EA6 A;  3C1F A;  5CV4 A;  1XWE A;  5KND A;  3SK6 A;  4WRD A;  1VF7 A;  1EL0 A;  3CRK C;  3PUZ A;  1SNQ A;  4CBV A;  4IUV A;  1G29 1;  1PZI D;  3K5N A;  4XXE A;  2TMP A;  1PFN A;  2QKI C;  4ZYS A;  3MTS A;  1G8Z D;  4A3G B;  2B63 B;  3TBI B;  1IW7 D;  4XIG S;  4QUF A;  3VR4 A;  4FVM A;  4K8I A;  4HCE A;  1STH A;  4QB4 A;  2R6G A;  3BVZ A;  2ZT9 C;  1PTO B;  2FFK B;  1QOH A;  3T56 B;  4QIW B;  4O1N A;  1I3Q B;  4TKO B;  1LTI D;  3BDC A;  1SNM A;  3I3C A;  2PO4 A;  3NQT A;  1PRT B;  2L55 A;  1O7L A;  5JVG 3;  4K6L A;  4AYB B;  1MI2 A;  4BBS B;  1F2L A;  1FD7 D;  1NR2 A;  4IUP A;  1ZKO A;  2RVL A;  2F0I A;  1PTO C;  1Q3L A;  1ILQ A;  1EEI D;  2B8G A;  2O5J C;  4IUQ A;  1MBY A;  5C0X G;  1FYC A;  3VYT A;  3D31 A;  5FLX L;  1PRT C;  1SMY D;  2PZT A;  4YIJ A;  2K5D A;  5C4X B;  1VCI A;  5EPJ A;  5IGD A;  5FO8 B;  1H9M A;  1TWH B;  4FXD A;  2RA4 A;  3I72 A;  2NN6 H;  1EEF D;  4ODG A;  1RTN A;  2OXP A;  5D3D A;  1D6E C;  1BUV T;  3M7G A;  5D3I B;  3Q24 A;  1EIH A;  4LK1 C;  3QO2 A;  4IUT A;  4ZQ3 A;  2JEB I;  1XYI A;  5A2Q L;  2A6H C;  3FEW X;  1I4G A;  3R2T A;  4ULL A;  4B08 A;  5BN4 A;  3DEP A;  3H94 A;  4A3I B;  2F0H A;  3S9W A;  1WTW A;  2OT2 A;  2J0T D;  1FNV A;  4IFD H;  3VYR A;  3S15 B;  1J9O A;  1BXT A;  1EYD A;  1TT2 A;  1EQT A;  5JAV A;  4ILW A;  1JC7 A;  2B2W A;  1RF2 D;  3JAM L;  3H3V C;  1ESF A;  1PZK D;  1LT3 D;  3BYT B;  3CQZ B;  2B8F A;  2IT1 A;  3KF8 A;  3M4O B;  2A5H A;  1UAP A;  3OSO A;  2E2I B;  4OO1 H;  3I4M B;  5CBE E;  1S4Z A;  1U4R A;  1STB A;  3HOY B;  1CZG A;  3GQB A;  3EJI A;  1O7Y A;  5FOB B;  3I91 A;  1NCV A;  1B3A A;  4H13 C;  5BN3 A;  3NE5 B;  2NVX B;  1YNJ D;  4B9W A;  2A69 D;  1A6X A;  3S1N B;  1SXT A;  3K58 A;  2EZV A;  1F9Q A;  2KED A;  4J6H A;  2J7Z A;  2ZXR A;  4TQU S;  3AU7 A;  3OMC A;  4J1M A;  1KDB A;  2I46 A;  4HCS A;  2B2W C;  2DNC A;  1OXS C;  1IL8 A;  1L0X B;  1ROD A;  4C1N I;  2QEJ C;  2IWH A;  2HCI A;  4GZY C;  2EYH A;  3DM1 A;  4ZUJ A;  1H9S A;  4CKB A;  4V19 0;  1LAB A;  2B2U A;  4F7X A;  3S2H B;  4CKC A;  1H9S B;  1QB5 D;  1EOT A;  1LTR D;  1MSG A;  3TP8 A;  1SYB A;  4IUU A;  3KUP A;  2AUK A;  1BO0 A;  5CC4 A;  5EKI A;  2BDN A;  3OWE B;  5LL6 X;  2K5Q A;  4EQP A;  1KNA A;  3NPP A;  1OXX K;  3HG9 A;  2IX0 A;  1D5M C;  1IYU A;  5E4X A;  5KNB A;  2EYP A;  2B2U C;  3PO2 B;  5IGB A;  1F9R A;  2KCC A;  2WKD A;  3QG1 A;  3NTI A;  4NW2 A;  2CHB D;  2K6A A;  1STY A;  1ICW A;  3NBH A;  3CRL C;  1E0B A;  1F9P A;  4RAU C;  1SFO B;  1B9N A;  1EIG A;  3HOZ B;  1RD9 D;  2PZW A;  2JA7 B;  1Q1B A;  1TS4 A;  3GO5 A;  2B2Y C;  1CM9 A;  1SYC A;  4KJO A;  1U4M A;  1W6K A;  2LY7 A;  2O5I C;  4DAP A;  1TKW B;  3R8B A;  4A93 B;  1GXD C;  1JOQ A;  2EJG C;  3I4N B;  2EDG A;  5FO9 B;  2Z1C A;  4XDX A;  4XTC S;  3P1H A;  1DCZ A;  1HFN A;  3HS0 C;  4C3I G;  1SYG A;  3I4L A;  3BDL A;  1VMP A;  1CT1 D;  1OXT A;  4IUN A;  2F0G A;  3GP7 A;  4M8A A;  3MC0 B;  2F0D A;  3ERO A;  2JA6 B;  4ME5 A;  1YNN C;  2IW3 A;  5JEA J;  1BCP B;  2WB1 B;  1CA6 A;  4OL7 A;  1B44 D;  3H0G B;  1B2T A;  1R9T B;  2QIL A;  5F2D A;  1STN A;  1STG A;  4N9T A;  1F2M A;  5KIX A;  2JA8 B;  2G9D A;  4BY7 B;  1LO5 D;  1ZXT A;  2EE1 A;  4NMZ A;  2VXW A;  4XYQ A;  1XTC D;  1SNP A;  1TII D;  1GHJ A;  3HOW B;  2L4N A;  1H9J A;  1V1P A;  1BF4 A;  1BCP C;  1X3Q A;  3RMH A;  2RSO A;  4HED A;  5CV9 A;  5COY A;  3TP5 A;  3NP8 A;  2L9H A;  4DNR B;  1V43 A;  1Y8O B;  2QDB A;  1WTR A;  1V1P B;  3D3R A;  4PMC A;  2R92 B;  2K1B A;  1V8Q A;  1WD1 A;  3SEB A;  3OHX C;  4BA2 I;  4OGQ C;  3RUZ A;  1TR5 A;  4XT3 B;  2ICE C;  1D1K A;  3X3M A;  3HOX B;  4K5W A;  3A7A B;  1G91 A;  3BYY B;  5D14 A;  1B50 A;  1LTG D;  2A6E C;  4XQN A;  4J8Q A;  3JAM E;  1R4P B;  2CW0 C;  4JBW A;  5EBD A;  2Q8T A;  2NVT B;  1KNE A;  4LAA A;  4HMJ A;  1TS3 A;  2FJ2 A;  1K8O A;  3WOF A;  5IOD A;  4IAL A;  2B2T A;  1EY8 A;  3FMC A;  4CGY B;  3NSW A;  3R93 A;  4RKB A;  2LS0 1;  3R3O A;  3PIP 3;  3NK9 A;  1L0Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...