3AB9A

Crystal structure of lipoylated e. coli h-protein (reduced form)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
127
structure length
126
Chain Sequence
NVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Glycine cleavage system H protein
total genus 37
structure length 126
sequence length 127
ec nomenclature
pdb deposition date 2009-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ab9A00
2DNEA 2A69C 3DXJC 2BE5D 1T5EA 4H0LC 4DK0A 3N6RA 1GHKA 3D31A 3T53B 4RCNA 1H9MA 2E75C 3OOCA 3BDOA 3CRKC 2BDOA 3M4YA 2EVBA 3RLFA 1IW7D 1B9MA 2KA7A 2PNRC 3SE0A 1Q1EA 1LACA 1ZYRC 4H13C 2R6GA 4KMUC 2PPBC 1TU2B 1DD2A 1V43A 3PUXA 4BA2I 2NN6H 1A6XA 3CRLC 1Z7TA 4IFDH 1E2VA 2YYZA 3I72A 3OW7A 4OGQC 4DK1A 1GUOA 1VDZA 2EJGC 3QG1A 1H9SA 2KCCA 5KNBA 2O5JC 4JK1C 3A7LA 4GZYC 5K36G 3T56B 3PV0A 2O5IC 1LABA 3WDNA 3A8JE 3LWUA 5JEAG 3T51B 4BA1I 3M7NA 1HPCA 3D4RA 3GQBA 1Q1BA 1PMRA 2L5TA 2CW0C 1DCZA 1K8OA 3AB9A 5A35A 2BA1A 1OXUA 3VR3A 1Y8OB 3BG3A 1BDOA 2A6HC 2F1MA 1OXSC 3H94A 3P20A 1GUGA 3GD7A 1GUSA 1HQMC 2LMCB 3ND9A 3QJYA 4DNRB 5C0XH 2A6ED 5BN5A 3VA7A 3PUWA 1YNJC 4IQZA 3VR6A 3KLRA 2EJFC 4KN7C 2JEAI 5C0XG 4KI0A 3A8KE 3PUYA 1OXTA 3OPOA 4L8JA 3TZUA 5BN4A 2D5DA 2BE5C 2D62A 4LK1C 5K36H 4LJZC 2EJMA 1Q12A 2NN6I 5JEAH 4G7ZC 1CI3M 3PUZA 1I6VC 3NE5B 2A69D 2AUKA 4HR7B 3W3AA 4H44C 3L7ZC 1H9KA 3A8IE 1Y8NB 1ZKOA 3FMCA 2A6HD 4KN4C 4XTCS 1VF5C 3MFYA 4TQUS 1K8MA 1YNNC 1H9SB 2K7VA 3FPPA 2Q8IB 1Z6HA 5BN3A 4G7HC 4OO1G 3LNNA 2JEBI 2EDGA 3I73A 3ND8A 2D2CC 2B8FA 1SMYC 2E74C 2ZT9C 4OO1H 3IKJA 1VF7A 2A68D 2AWOA 1DXMA 2IT1A 3HGBA 1OXXK 3PUVA 4PV1C 2A6EC 1HCZA 2B8GA 3QIAA 3SDZA 5KNCA 1IYVA 1GJXA 2K33A 1FR3A 4DNTB 4XIGS 4JBWA 1B9NA 2PCFB 3U9SA 2E76C 1E2ZA 4G7OC 1H9RA 1O7LA 2JXMB 1QJOA 1HTPA 4KKTA 3M85A 1FYCA 1G291 2DNCA 3IFTA 3I4LA 2AUJD 4TKOB 1CFMA 1IW7C 1OXVA 4I7ZC 5KNDA 1V8QA 4KKUA 3VR4A 4IFDG 2V4DA 2K32A 3VR5A 1Y69U 4KKSA 2JE6I 3EQLC 1IYUA 1GUTA 1GHJA 1GUNA 1TKWB 1Y8PB 2QF7A 1VCIA 1CTMA 2BA0A 1ONLA 2NN6G 3MXUA 2A68C 4KHZA 2DN8A 1EWHA 3VR2A 1O78A 1E2WA 1H9JA 3A7AB 1Q90A
chains in the Genus database with same CATH superfamily
1V1PB 2F3IA 1Q82C 3DWPA 4RCNA 4CBVA 4UY8C 3S1QH 3BDOA 3M4YA 2KQ3A 1A3TA 3SE0A 5L37A 1FJGQ 2GA4B 4HCSA 1NCVA 1L0XB 1PH4A 2O4XA 5GAEC 2AWNA 2DUDA 1YHBA 2XRQD 5HGQA 1AZPA 4IFDH 2WKDA 1I6HB 3CMAA 4OELB 2K75A 2MPMA 3NWSA 3T56B 2UXDQ 2KCNA 4BA1I 3KFUA 5EPLA 3RN5A 2Q2IA 4JI7Q 1TWFB 3AFPA 3M4OB 2CW0C 1DCZA 4BY1B 4HIOA 2RSNA 4RHRA 4ZAIA 4DR4L 1U4LA 1DZ1A 4IALA 4A3EH 1QILA 2BDNA 5IP7G 1JR0D 2VZAA 2F1MA 1OXSC 4CKCA 2HIXA 4DK3C 2MO1A 1BBWA 4DR3Q 3D6CA 3MC0B 1KRTA 1S4ZA 4C3IB 3HEJA 3SXHA 4A3JH 1C7YA 2Q2TA 3CCEA 3T16A 3EVQA 4L8JA 1B2TA 1SYGA 3HKZE 3PUZA 3FRPB 4DV3L 3K7UC 5JJIA 1AFPA 4UP8A 2R7ZH 3PIO3 4V0BA 4KN4C 4DR1L 3NQIA 2IX3A 4EQ5A 4GNXC 3AQQA 4RAUC 1RODA 1WI5A 1XMOL 1XPOA 2SEBD 3H6MA 3S2HH 4A93H 3FVQA 1QZGA 2N49A 1KNEA 2Z9HA 1DXMA 4PV1C 2FXQA 1CHQD 4HSVA 1PH9A 5FKAC 4AQYQ 4DV4L 1DOLA 2NVQB 1UAPA 4NKLA 4DV1L 2LKVA 5DLQE 2EQSA 1LYLA 4CKEA 1UE5A 4X3UA 2WV6D 3TS0A 1N34L 4APVA 4K0KL 3OTOQ 1IBKL 3H3VH 1V8QA 4IFDG 4YY3L 1GUTA 1TKWB 1BF4A 2BH2A 1Y1VH 1MSGA 4Q0FA 3I91A 3KDFB 1KDBA 4HEDA 3I56A 3BU2A 2VY3A 1A62A 3K6OA 3I4MB 3C1FA 3I4MG 4DR4Q 1ET9A 5M3MB 1XNRL 2CFMA 1Q8IA 3T1HL 1CT1D 2X6GA 3HOXG 1AZQA 2CQOA 3HS0C 1CHPD 1PHJA 4M8AA 2Z4HA 5ELNA 1GUOA 2EJGC 1DOKA 4DAYA 1H9SA 1PV4A 1WCMH 5EBCA 1HPCA 3DWQA 2IX1A 2FMMA 1YJNA 4TVAB 3S17H 4IPHA 4A3MG 1IBLL 5EKLA 2K4KA 4CDCC 1QNUA 2M2LA 2LMCB 4EVOA 5HURA 2VQEQ 4IO9A 3HOWB 1GD7A 1TIID 1N33Q 4JI6L 1ET6A 5IGCA 4GOPB 1EIYB 5IYDG 4A3BG 1PH8A 1TWGB 5C44B 4X6AH 1YIJA 5COYA 1HUNA 3I2ZA 4PG3A 3EIVA 2OWOA 4L5SA 3I7FA 4KJOA 4X3TA 3TREA 4QGUA 4FXDA 4YY3Q 2L1BA 2EYMA 4J15A 3UE1A 3QWNA 1LV9A 2RA4A 2A8VA 2HHHL 2D9UA 3HP3A 4BS9A 4JBWA 4DR6Q 4H02A 4S3SA 3ZYYX 2WIIB 3TP7A 1AE3A 1RIPA 2PQAA 1HA5A 2XNAC 1M1KC 4JV5Q 5IIFA 3CP0A 1J5EL 1B3AA 4P72A 1YNND 1FL0A 1STNA 2ZJPA 1EYGA 3M3YB 1GHJA 3M4OH 4DR5Q 4A3CH 2ICEC 1G6ZA 4LF9L 3MAQA 1YNJD 2IW3A 4XT3B 1PRTC 1IL2A 4OX9L 5D65A 4H0LC 4DV0Q 3GTJB 2VB2X 4U68A 1SNOA 3VYRA 1NAPA 4LAAA 2JP1A 3KLSX 1JJCB 4JYAQ 1X3EA 4LF5L 1QG7A 2B2UC 2PZTA 2NB0A 2R7DA 4JI0L 5IP7H 2G9DA 1D8LA 5LL6S 1TS4A 3RN2A 1IBMQ 4DAVA 1STYA 5FJ8H 4E6IA 5ELDA 3J81L 4A3JG 4O0AA 1C4QA 2HT1A 1IXRA 1KTKA 4ULLA 4JK1C 4UDUC 4GZYC 1PFSA 3PV0A 4DPGA 1UEAB 4AQYL 4LF8L 3LGJA 2RKSA 2XN9C 3AFQA 4BBRB 5I9PA 1O80A 4LFCL 3EBEA 5M3FH 3NP8A 4J6HA 1OXUA 3J7A5 1HNWL 1BO0A 1TWHB 4NPSA 1S5DD 1GUSA 2N3SA 5KYLA 1CM9A 4DUZL 4IUVA 1VQGA 5CC4A 1D1IA 1ENAA 3IAYA 4PMCA 1B70B 5J22A 4B9XA 3CCLA 3GV3A 5TSSA 5BN4A 1ESFA 4IUPA 4LJZC 2EJMA 4AYBB 3GTKB 4DV2Q 4XDXA 3KJOA 5IE8A 1JOKA 3OWEB 3GTLH 4XQNA 4R1JA 3RZOB 3G71A 2PO4A 2MP1A 4A3CG 4IFDI 2HCIA 2D2CC 1PH6A 2IT1A 3M4PA 3GTQB 1LUZA 1EOTA 1HZCA 4NP5A 3ICEA 1BBUA 1K28A 1QOHA 1UE6A 4DNTB 5LHY1 4MN3A 2RHQB 4J1MA 1BBXC 3GTGH 3L0OA 3GTPH 1HA6A 1SYBA 3MTSA 1EQQA 1GXDC 3M85A 3BJUA 1JJGA 4LF7Q 1TWFH 3UI2A 1L1OA 2H4OA 1K83H 5C3EH 1S40A 1GUNA 1I6HH 5T1IA 4JG2A 5C4XH 3S15B 5IT9c 4FDBA 2NVYB 4ME3A 1EY7A 4P2CB 3AMUA 1H9JA 4JOIA 1Q90A 3S16B 1DONA 2IJ0A 2HIVA 4C3HH 1G91A 1I94Q 1LTTD 1YITA 4XXEA 4ZK9B 1QB5D 2ZJQA 3C2PA 3S16H 4N9TA 2JA8G 4B3MQ 1Q7YC 5C4XB 5C5MA 4KHPQ 4EQPA 5IGGA 2VW9A 5D14A 1K8OA 4NB3A 1HFNA 1EY9A 4C3JB 2A6HC 2KHSA 3P20A 3OWFA 1GO3E 4CJ0B 1MD2D 2B2VC 3P7JA 3GTGB 2WP8J 2NVXB 1KAWA 4LK1C 2WFWA 1Q12A 3TN2A 1PXUA 1TR5A 3D8GA 1W2BA 2L12A 4LW1A 4JPBW 3J81i 4ZLTF 1PYBA 2C35B 1E1TA 3HOUB 3NENA 1PLFA 3TDQA 5C4ZA 1V1PA 5FK9C 3S2DB 2R3ZA 1CKNA 1VQ9A 2A6EC 2B2VA 4I65A 2M00A 3SDZA 4WORA 4MIUA 5LMUQ 4KY7A 4F87A 3E9IA 4HIDA 3OHXC 3WWVA 1QE6A 3RLOA 1JCKB 2CH4A 5FLXc 3HOVB 4IUUA 3JAMi 4HN7A 4OIKA 1A63A 3ULPA 5FLMG 2B29A 1JOQA 4QB4A 3OW2A 1X65A 1UUPA 1Y8PB 1XJVA 2UUBL 2K50A 5ELCA 1HXYD 1HUMA 1WVLA 1O78A 5C5LA 4A3LH 1MSHA 4JI2L 1S3OA 2EOTA 2VQFQ 1E24A 2BE5D 4RGMA 3T53B 5I6YA 2CHBD 4XQJA 4QUCA 3VA5A 3GTOB 4Y7NB 2MFIA 4CDDC 1JMCA 4ZCKA 2PPBC 1Z47A 4WRDA 3PO2B 4LWCA 3MXNB 1C0AA 3OW7A 2J7ZA 4NXNQ 2YTXA 5C3EB 1Q3LA 3K5LA 3I3CA 4IUQA 1TS2A 3T51B 1Q86C 1EZ8A 4ME5A 1IKLA 1I50B 1V1QA 3BZDB 1NBWA 4ODGA 4RCOA 4PZ6A 2QDBA 1SNQA 2A5HA 2F3VA 2MO0A 5BR8Q 3OTOL 1LTID 4RFBA 1K0SA 3H0GG 1TWAB 1PVOA 2NBFA 3VA7A 2EYOA 2JK8A 3OPOA 2BE5C 1TT2A 3FKIG 3Q6SA 4Q5VA 1F2LA 1GUWA 4DV4Q 3W2DA 2ZM6Q 1U4PA 2K14A 4HR7B 3W3AA 3RZOH 1MIUA 2A6HD 2DY7A 2VL6A 5GADC 4G7HC 1IBKQ 3GTKH 1PRTF 4HIMA 4DR3L 1HNZQ 3T1YQ 2J4XA 1NNXA 2B8GA 1IL8A 4GLAC 5E1FA 4AYBE 1IYVA 1VMPA 3NTHA 1ZXTA 5C44H 1TWGH 3KJPA 1EU3A 1G51A 1R4QB 3FHWA 4DR6L 4QIWE 2E76C 2D0PA 2CWAA 2KCTA 4JI2Q 3J7YW 1H9RA 1VQJA 1ML0D 2DNCA 4BBRH 1LT6D 1U0LA 3I4LA 1R9TB 2JA6G 2N55A 1VS0A 1WFQA 2X69A 4KKUA 2UXCQ 2AKWB 3S17B 3VR5A 1TY2A 2JE6I 4HJ8A 2KCMA 2QF7A 1VCIA 1E22A 1A0IA 3Q22A 3BZKA 4DAYB 1Q46A 3KDFA 2FMCA 4X62L 3K58A 4B3RQ 2JA8H 1N8RC 3QOLA 2AMCB 1MI2A 3R8BA 3HOWG 4K5VA 3HZXA 4KK7A 1X54A 1HH2P 1IW7D 3RMHA 2HQLA 2F0UA 4L5TA 1LACA 3MEFA 2R6GA 5CV6A 1WTWA 4BA2I 4NMZA 2VUMH 4DKAC 4OXPA 5M5YB 3DHQA 3I72A 2R93B 4DK1A 1VQOA 2XVSA 3A74A 4A76A 2NTTA 2L4NA 4NXMQ 5LMUL 1SE2A 5JAVA 2A1AA 3DM1A 3PGZA 4B3TQ 4KHPL 4P71A 2E2JH 1CKNB 4IOCA 1PA6A 2A73B 3P75A 4LFBL 1DM0B 1HHVA 2WACA 2Z8LA 1FJGL 3HOZB 2F0PA 3V2TA 2O2LD 2BH8A 4RGOS 5EAYA 2K03A 2R61A 1VMCA 4IQZA 2RDFA 5C0XG 2JA5G 1PFMA 4YCWA 2RCFA 4OX9Q 3MXGA 5IY0A 4G7ZC 1KHIA 3RR5A 4BBRG 4QIWB 5E7NA 2FINB 4F8MA 4WJ4A 3DEPA 4C56C 1EY8A 4NDXA 2PQAB 4A93B 2NVTB 1TWCH 1VF5C 2CH4W 3QO2A 2K7VA 1S5BD 2DGYA 2EDGA 3T1HQ 4BY7G 2E74C 1PFBA 2EYFA 3FEWX 4OO1H 2OEOA 4KD3A 1EUJA 1I4HA 3TP8A 5C6AA 5E4XA 2UU9L 1RCVD 5J39A 3HOWH 2TSSA 2PCFB 2NTSA 3H15A 2EE1A 3H0GB 1WD0A 1SSOA 4C3IH 1ILQA 1TS5A 3NHHA 3FDTA 3BVZA 3JAMc 1EY5A 1TWAH 4U673 3HOYH 4JI5Q 1UE1A 3UDXA 3K0YA 2BOSA 4A3MB 1IW7C 4DV6L 1NJIC 1BKBA 4HSPA 5M5WB 1KABA 1TQOA 1X56A 1STHA 4RH6A 4LNQA 2ZXRA 4K5WA 1ONLA 1II3A 1A3VA 2DN8A 1HTLD 2RVLA 2HHHQ 1G8ZD 1E2WA 4IPGA 1EYCA 3E9HA 4K2KA 3CCJA 2ZTDA 3OIQA 4G57A 2J0TD 1U5KA 2K1BA 3PF5A 5ISRA 5EJWA 1J6QA 3RLFA 5IGFA 4LFBQ 5C4JB 2OTLA 1J5EQ 2F0QA 2B2YA 1EOVA 3G48A 2UUCL 3PUXA 1MKHA 4IUNA 2NN6H 1B3QA 1STAA 3SK5A 4DA2A 3I55A 3S1QB 1H95A 2KJXA 4OGQC 1SE4A 4RKLA 4M1UB 3SR1A 2P5ZX 3ITPA 5KNBA 1FNVA 3A0JA 2FFKB 4N9PA 3S14B 1PZJD 5CBEE 1RD9D 4FXGC 1W6JA 1PMRA 4ZRZA 4L5RC 1SYDA 1HR0Q 4WJ3M 3GDEA 3VR3A 4BY7H 2XRSD 4EQOA 3X3NA 1EY6A 4CJ1B 5IP9G 2NVQH 4CDEC 1NR2A 4OONA 1KIXA 1CA6A 1K3BC 4UPAA 1Y1VG 4L63B 4PNYA 3QOJA 2ZJRA 2K5QA 4LFAQ 2LSSA 2NN6I 1WTXA 5IWAQ 4FYDA 3MWYW 1F9SA 1DJRD 3RZDB 3TS2A 2A69D 2VB3X 3DWAA 4DFAA 3HOUG 2PW5A 4XTCS 2AQ3B 4MTNA 4YWMA 5BN3A 5IT9E 3TRZA 1IBML 3URYA 5I9OA 3MXPA 3UDFA 2AWOA 2EY5A 3RLNA 4A3JB 4YHHQ 4DV5L 1HCZA 4GKJL 3EJIA 1WCMG 5IGBA 3TZDA 1B9NA 4KHVA 3U9SA 1Y1WG 4IFDJ 2ZXOA 3EA6A 4A3EB 2ZM6L 2KEEA 4BBSG 5D3DA 1O7ZA 1G291 4QJFA 3PO3H 1EIHA 3M7GA 2AUJD 4BWGB 4B3SQ 3J81j 4I7AA 1FNWA 4C3JH 3VR4A 3S1RH 2L15A 1F9PA 1G2SA 3DLLA 2VUMG 5A35A 2WKCA 1D7QA 4KHZA 1W6KA 4ID6A 2KHJA 3WOFA 3KBXA 3J81c 1QVCA 1GHKA 4Y7NH 3GTOH 5JJLA 3SK4A 2N88A 1A8VA 3HG9A 2NUCA 4GNXB 5DEHA 4JI1Q 3LX0A 4WFN3 1B1ZA 2EIFA 4KY6A 2EZVA 4FF4A 1F2ZA 3J7AV 1IHZA 1WTHA 2Q2HA 3S1NH 4ALPA 4C3HB 4JBJA 4LUVA 1SYCA 1J8IA 2O5IC 2F52A 5DNFA 1HJPA 1CKOA 2V1CC 2XWBB 4MNOA 3L9AX 5GAHC 1SN8A 3GQBA 4LF6L 4HCEA 1ENCA 5CBAE 1D6EC 1PTOB 3AB9A 5EKIA 3H3VI 4CJ2C 1RDPD 1JE5A 2QW7A 2GVAA 5KEEA 1SNMA 3QJYA 4POFA 3PO3B 3JAML 3CW2C 1C48A 1Y1WB 4R4IA 2ES2A 2UUAQ 1N32L 1YNJC 1XMQL 4V190 1YVCA 4PZ7A 3J81E 3E0EA 4C1NI 1T5XD 5JEAH 2I5HA 1XTCD 3VDYA 3PO3G 3SHLA 4R8IA 2EYJA 4JI4Q 3K80C 2B2WA 2G5DA 1KLUD 1B44D 5HY6A 2K5DA 4F7XA 5EKKA 3MFYA 1HNWQ 3D6WA 1YNNC 3DM3A 2I5LX 3HRZC 2F0IA 4GN3B 2JQOA 4QF4A 2N78A 5E3FA 2E5LQ 4RMFA 2H1EA 1ICFB 4LUOA 5T1GA 4XIGS 3R93A 2L55A 3JAME 2ASBA 5JJZA 2YU9H 5A2QE 3ZJYC 5M3FG 1QJOA 5IYCG 2A74C 4UP7A 1PTOH 3GP7A 3CQZB 1KRSA 4JI0Q 1YZ6A 3G4SA 2EYHA 2DY8A 3S1MH 4I7ZC 5JEAJ 3TQYA 2R7FA 4KV6A 3PF4A 1KDCA 4KKSA 4GKKL 4X64L 1SFOH 3OMCA 5M3FB 2RCNA 2NN6G 1CTMA 4POGA 1BR9A 1PZKD 1O7YA 4YCUA 1YHQA 2F0TA 3S14H 1VQ6A 3PIPA 1HR0W 4LF9Q 2UU9Q 2UXBL 1G6PA 1CUKA 3A56A 1K9MC 1I4XA 2KHIA 4DK0A 5LMNQ 2MHVA 3N6RA 4C2MH 1PH7A 1QUQA 3U9OA 1OTCA 2L0CA 1TS3A 4DU9A 4XQQA 1B9MA 3T13A 1VQ4A 3FKIB 1AW7A 5FO8B 1QVGA 1KC8C 1HNZL 2HDMA 2WB1E 3S15H 1EYAA 1X3GA 2EXDA 3K59A 4HAEA 4ABNA 4JBKA 1K83B 1XYIA 3WDNA 2QGQA 3F2BA 1SE8A 3D4RA 1V1OA 1Q1BA 2QEXA 2WB1G 3M3YH 1PH5A 2WB1B 2PYKA 3FP9A 3ULLA 1S5ED 1BCPB 2K04A 1RF2D 5M5WH 4DR7L 2R93G 5F2DA 5C3XA 4HJ9A 3HKZB 3K5MA 3HKZG 4B3SL 1CSPA 4A3KB 4LF4L 4A3EG 1YBYA 5ELFA 4PMBA 1SMYD 1CA5A 2UUBQ 1L1OB 4GS3A 3U50C 3V05A 1RTOA 1ZEQX 4FO2A 5KGUA 1VQPA 3STBC 5IYBH 2IL8A 3L7ZC 1K8AC 4KJNA 1UEBA 4A93G 3CD6A 3RZDH 2K01A 4XYOA 1K8MA 3H3VC 1EL0A 2Q8TA 3KK7A 2A68D 3HGBA 4A3FB 4N8X1 1VQHA 3NSWA 4A3FG 3QB3A 3SEBA 3A54A 2NZHA 1JJ2A 1LTSD 5EPKA 4JOIC 2F0NA 2KVMA 4EQNA 1AE2A 4BY7B 2PMZB 2JXMB 4R4QA 4IJHA 1X9NA 3D3RA 3BVMA 3D0FA 1CFMA 3TP6A 1QCBD 4DV6Q 2F3WA 1HZAA 2UUAL 2EYPA 4QMGA 2RQXA 3I90A 4HMJA 2OXPA 2Y0SE 3VR2A 1WYDA 1IZ6A 1WCMB 5FO9B 2B3GA 2XGTA 3I8ZA 2UXDL 2CVRA 2F0FA 1B50A 3CCSA 2R93H 3GO5A 1K73C 5C4JH 5M5YH 1RHPA 1X55A 3OOCA 3U58A 1BXTA 2VUMB 1F9QA 2K6AA 5C4HA 1M4VA 1VQBA 1I4QA 1A2UA 3K81C 4F88A 1C8CA 1ZYRC 1A15A 2F4VQ 4KMUC 4JVZA 4OEMB 4YWKA 2SNMA 3JC66 3O13A 3I4MH 2H5XA 5ELEA 2CWPA 5AFWA 1CKMA 1VQFA 1S5FD 4O1NA 3CRLC 1A6XA 3L2PA 2IY5B 2JA7B 1GOZA 3I4NG 2JA8B 3I4NB 3KYHC 4YIJA 1PDQA 3U4ZA 5JEAG 3CXCA 2I5MX 4A3MH 2HD3A 4JC0A 4UHVA 1YNXA 4DN4M 3CC2A 4LF5Q 1Q8KA 1BQQT 2KEDA 2VXWA 3BYYB 3BG3A 1BDOA 2R92B 5JVH3 1VQLA 3PO2G 1I4RA 4GN5A 2I0QA 5FLXL 5IYDH 4GKKQ 2A6ED 4YHHL 1BCPD 1SROA 4GOPC 4GKJQ 2YTYA 1F2MA 4A3LG 2F0EA 2D5DA 2EY1A 3KF8B 4FVMA 4CHTB 1SYFA 4LMQD 4A3BH 3SK8A 5G3LF 4DV1Q 2NVTH 1F2YA 1H9KA 1G2TA 4J8QA 1RTNA 3KBGA 4A3BB 4GN4B 2GN5A 4QY7A 2E2IB 3CPFA 2F0SA 5GQOA 1DYQA 4A3GG 4O42A 2QILA 1J9OA 2FHTA 2R7ZB 1JQYD 4GOPA 1B8AA 4IOAA 1EU4A 2KOLA 4UAIA 3ULJA 3A5UA 3QIAA 3NUCA 3CF5A 2M9VA 2K33A 1SBBB 2VQFL 4G7OC 4X3KA 4MTKA 4K8JA 1P16A 1FVIA 1X32A 3NBIA 3TBIB 4A3KH 5C0XJ 1S72A 1PTOD 4A75A 2RSOA 3OIPA 1YJWA 1ZYRD 3I4NH 1VQDA 2B63G 1D2BA 5IGEA 4BBSB 4NXNL 2GVBA 2SDFA 4B3RL 4DAMA 1YHAA 1SJED 2OCEA 3R2IA 3MA2B 2A69C 2PZWA 1XTDA 4LF6Q 1CQVA 1EFID 1H9MA 3CRKC 1JICA 3K7AB 2PI2A 3PO2H 3DMUA 1FGUA 5FJ8G 3GTMB 4R9WA 3S24A 4JCVE 4H13C 4AYBG 1XXGA 3NBHB 1KLGD 1DD2A 2F03A 4EX5A 1E7ZA 1N32Q 1Y1VB 4DXFA 1LTLA 1YEZA 4OWTB 2E2HB 1ESRA 1T9HA 1CZWA 2ID0A 5LMNL 1R9TH 4IJLA 1S5CD 1UE7A 2VS1A 3BYTB 4FF1A 2NYZD 2BA1A 1PFNA 1U4MA 4AIMA 3NXWA 1GVPA 3ND9A 1HQMC 1XNQQ 3F8TA 3HOVH 2YU9B 4TSSA 4A3FH 3KLRA 2JEAI 1BCPC 2PI2E 5EPJA 3E0JA 5CV8A 3TZUA 4DUYL 5K36H 3KF8A 4K2LA 1ASYA 2IWHA 1I6VC 3WOEA 4A3KG 1K8GA 1Y14B 3FPUB 3BDLA 4K6DA 2B63B 4DAPA 1W3SA 3FMCA 5EBDA 3N52A 3PIOA 1LT4D 3Q23A 3X3MA 2AQ2B 1KXLA 2K28A 3NK9A 2QDLA 4X64Q 4LF4Q 3T1YL 4IURA 2HQEA 3W1GA 4RHSA 3VYSA 2PQEA 2Z6KC 1HZ9A 2OQ0A 2MJ8A 1ENFA 3PQIA 3PSIA 5EQ0A 1AP0A 2F0MA 1YI2A 4QUFA 3MVVA 4DR1Q 2B2UA 1XWEA 1LT5D 1I50H 4TKOB 4JI8Q 3CCQA 1PYWD 5KNDA 3K5OA 2DJFC 4ZYSA 4R4OA 5CV5A 3E3XA 2A68C 4C3HG 1SLJA 5C3EG 2PW7A 2DNEA 1U4RA 5C4XG 1VQEA 4JI4L 4ZUIA 3S1NB 2E75C 3F2CA 1SE3A 3T4AC 2EVBA 3H91A 4C2MB 1CZGA 2DJGC 2PNRC 1WTPA 3G6JB 5A2QL 3AYHB 1CK1A 2E5LL 2TMPA 3J80i 1E2VA 1VDZA 2KCCA 1VQIA 2L9HA 3A7LA 3CPWA 1DGSA 2MUYA 2NVYH 1B53A 3A8JE 3S1MB 1F77A 3W5OA 1EIGA 4XYQA 4C3IG 1PH2A 3CQZH 1X3FA 2LFNA 4IN3A 3H09A 3S1RB 4DR7Q 4P73A 1SNDA 3J80c 4HJ5A 1AEXA 3S9WA 2UUCQ 1GUGA 3E6ZX 1JT8A 4DNRB 3VYUA 3NEMA 4X65Q 3GTPB 1I3QB 1HRJA 1MHWC 4KI0A 1OXTA 3S2DH 4RG1A 1QVFA 3GTQH 4HTHA 4JI5L 1BOSA 4DGZA 5BR8L 3A5ZB 1H9SB 2JJQA 2CKZB 5EGTA 2XIWA 4JI8L 1K0RA 1AN8A 2OQKA 2KECA 3LNNA 5ELBA 4JI1L 3OSOA 2NVXH 3K5NA 2B63H 1X3QA 3PUVA 4DV7Q 1EYDA 5D3IB 3I4OA 1GJXA 2FJ2A 4C1NK 4MZ9A 3CCRA 4CKBA 1NY4A 2RDGA 3F2UA 1SEBD 5IWAL 2C5CA 2QKIC 1KNAA 5I6WA 5IGDA 4JV5L 2B2YC 2KENA 1VQKA 1OO9B 5IP9H 5J3BA 3ERQA 1EIFA 4X66Q 4HIKA 1OXVA 1IKMA 3J80E 1ASZA 2X6LA 2EPBA 1FNUA 4WJWA 3J7ZC 2F0HA 4R4CA 3RD4A 4RGNA 1JWUD 4ZUJA 4A3GB 1RKNA 2PMZE 4DV3Q 3D31A 1WTRA 4UP9A 2Q8RE 3P1HA 1WJJA 2IHEA 1XPRA 2IX0A 4PQXA 1NR4A 4L5QA 1EEID 5CR3A 1N36Q 2LXJA 1FD7D 2F0DA 2QEJC 3F1ZA 2JA7G 3HOVG 1Z7TA 5IOCA 4MHEA 4OO1I 2O5JC 1B4OA 1SMXA 3C1EA 5K36G 1HNXL 1BNZA 1PRTB 4FF3A 4EGVA 1XPUA 1CQFA 3K57A 4BBSH 1LTAD 2CCZA 4LUZA 4GNXA 1K3RA 1EEFD 1SNCA 1Y8OB 4YCVA 1IYJB 3CMEA 2KBNA 3MEHA 3H94A 4ILWA 3HOYB 3K8AA 4OL7A 4P74A 1VQAA 3GV6A 5BN5A 3PIP3 1BUVT 1JB7A 5IT9L 5M9OA 1LO5D 3H0GH 4N8FA 4YWLA 3MZ5A 4DV2L 3EROA 2SOBA 5CMDA 2IPKD 4BXXG 1UWVA 4Y52H 1KAAA 2E2IH 2ZTEA 1SMYC 2YTVA 1QUQB 3IKJA 4KTAA 4HJ7A 3KF6B 2OTJA 3A55A 3KF6A 4A3IB 2ENBA 1PRTD 4K14A 5KNCA 3SGIA 4GLXA 1FR3A 2MQHA 4DUYQ 2WAQG 2Y0SB 1E2ZA 5FLXE 1I4PA 1QZHA 4IPDA 3J80L 2I46A 5K5PA 1UNSA 4TRDA 1STEA 1Q81C 1PH1A 3HOZH 1AH9A 1WTQA 2R92H 2LS01 3DUZA 1NMFA 3KOJA 1LM0A 4RA8A 4AH6A 1SAPA 2Z1CA 5AJ3L 3Q0AA 2BA0A 2JYOA 3RNUA 2Z0SA 4X65L 4DF7A 4DR2L 3ERSX 2UXBQ 4XT1B 1RL2A 4LFAL 3CU7A 1U9RA 1L0YB 1EQVA 5GAGC 5CGKA 2ATWA 3GTMH 1I94L 3K7AH 1EY4A 1DOMA 1L2FA 2KA7A 3IRBA 4LF7L 3GTJH 5M3MH 1Q1EA 1P8LA 3HKSA 5KYIA 1VQNA 1PTOF 3RUZA 1JORA 4DV5Q 3NPPA 2YYZA 1LT3D 5FO7B 1GKHA 3HFZB 1JWSD 3BVGA 1VQ5A 2I07B 1SRUA 2ICIA 3F2DA 1LABA 2XWJB 5IODA 3M7NA 1FGBD 4K6LA 2B2TA 5IYCH 4OIJA 1XX8A 4ZQ3A 2F0WA 1BCPF 2F4VL 1A3UA 2WINB 1JOOA 2EY6A 4K8IA 5C0XH 2EJFC 3QR8A 3PUYA 5JJKA 1JE4A 1KDAA 2K5VA 5JOBA 3L3OC 3C46A 2JA5H 4R8NA 4A3IH 3HOZG 1TWCB 3B6YA 5I2XA 4CGYB 4IUTA 1NUCA 3S2HB 3VYTA 2F0GA 4DXGA 2A19A 3AEVA 4OO1G 3G7LA 2JA5B 1Z6HA 4CDFC 3I73A 2B39A 2VQEL 5LMNW 1WTOA 1XNRQ 1KQSA 4NW2A 1PYSB 1VF7A 3CCMA 4PZ8A 3R3OA 1PH3A 4JBMA 4QCLA 2EYLA 2OF1A 1SDFA 5JVG3 1PZID 1SJHD 1VQ8A 2ZTCA 3W1BA 4KKTA 3TSSA 1A2TA 1MBYA 2BCOA 3SVMA 3UE0A 2E2JB 1LTGD 3NTKA 4Z9CB 1X3PA 2JSOA 4P75A 4JW0A 2K5NA 3HOYG 1STBA 1B7YB 1SYEA 2K32A 2V4DA 3MHBA 1VQ7A 4BY1H 4H7BA 4A3DG 3BS1A 2JA7H 2PNHA 2K5WA 3MXUA 1EZ6A 1L0WA 2NWGA 4L6TB 1STGA 1JWMD 3A7AB 3CC7A 4FNFA 3DXJC 3TP5A 1T5EA 1TY0A 5CV7A 5IYBG 1TXYA 5CV4A 1Z9FA 5DM63 2L11A 4IPCA 2F0LA 5KRUA 1L1OC 5JPNC 4RGTA 1VQCA 3KLWA 1TVXA 2SNSA 2WAQE 4K0KQ 1TU2B 1M8AA 2NZ1D 5ELOA 3Q24A 3NQTA 1V43A 4PMWA 1N36L 3OYYA 4DUZQ 1MJCA 2F0OA 2RBMA 4A3IG 1YJ9A 1BVSA 1I5FA 4B3ML 2XSCA 3LWUA 2E2DC 3TMEA 3K0XA 4FXKC 1EWCA 2KUMA 1SFOB 2HDLA 4BXXH 3NWTA 4G4KA 1D5XC 4FP5D 5H1SE 3KUPA 1XMOQ 5C0XI 4K5XA 4R4TA 1NSNS 5FLMH 3LWEA 4DK6C 4DV7L 3PUWA 3ONAB 1O7IA 4KN7C 2QA4A 4HJAA 3A8KE 4DR2Q 2D62A 3AU7A 2F0JA 2RF4A 1CI3M 3IL8A 1C9OA 1LLRD 4OWXB 1KD1C 3NE5B 5DAUA 1HFGA 2Q2UA 2AUKA 1D5ZC 4H44C 4A3DB 4A4IA 1SNPA 5CYUA 3CCUA 3A8IE 1EWIA 1N34Q 4HMIA 4TQUS 1IBLQ 3PCOB 1WTVA 2R92G 3HOUH 2JEBI 3ND8A 1X6OA 1XNQL 1VQMA 2Z4IA 2ZT9C 4RKBA 1WD1A 3I70A 1XMQQ 4JI6Q 5GROA 2JA9A 3E5SA 3V96A 1QNKA 3TEHB 1HQRD 3NBHA 3CKIB 1E1OA 1I3QH 2B2TC 4JI7L 4B3TL 2PZUA 1HTPA 2EXZA 2AHOB 2R7ZG 2MGSA 2RHSB 3HOXB 1Y1WH 4C3JG 4IZ8A 3IFTA 2F4IA 2YV5A 3D4DA 5M3MG 2JA6B 4KD4A 5I2YA 2AQ1B 1ILPA 1WOCA 3MFGA 4OWWB 3M4QA 1F9RA 1LTBD 1M90C 5E4WC 4GLVB 4QQBX 5FOBB 4X62Q 1HNXQ 4QL5A 1MGSA 3FKIH 4DV0L 2IHFA 5KIXA 5LL6X 3BZCA 2XTIA 2F0VA 5CV9A 2D0OA 2LY7A 2BDOA 2VNUD 3CC4A 1HR0L 4X3SA 5J1ZA 3J7AF 4A3GH 2UXCL 4KY5A 1SR3A 1JC7A 1NMGA 3QG1A 1RJTA 1I4GA 4JI3L 5C44G 4LF8Q 1EY0A 1CSQA 3DEOA 5JPMC 2CW0D 2K05A 4LFCQ 1LTRD 2L5TA 2B2WC 4DNIA 3IFDA 3EFXD 1QWYA 4JYAL 1E0BA 3Q8DA 4X66L 1NE3A 2JA6H 1EFWA 3PMFA 3NELA 2K5HA 3M9BA 3GD7A 3OMGA 3SK6A 3HOXH 3C3LA 1D1KA 1EQRA 1GM5A 4O2DA 3VR6A 2OT2A 5G3LD 1V9PA 3CHBD 1NTGA 1R4PB 3G6EA 2F0KA 3R2TA 2K52A 4OHJA 5M5XB 4FF2A 3CAMA 4ZKCB 3MXNA 1PTOC 4B08A 2QCPX 1Y8NB 1ZKOA 2CQAA 3KLSA 2Q8IB 5NUCA 4B9WA 3FPPA 1E3PA 5HGTA 5M5XH 2G9HD 1HZBA 2B8FA 4RWSC 1D5MC 2EY2A 2E8GA 4BY1G 3D4WA 5AJ3Q 3GTLB 4A3DH 1OXXK 3UDIA 5I4DA 2MNAA 3CCVA 3STBD 5DM73 2Z6KA 1JB3A 2NZOA 2RDHA 3NTIA 2C9OA 1O7LA 3BDCA 1KL9A 3U4VA 2ALYB 1MJEA 1FYCA 1N9WA 3UDGA 4ZKBB 2HCCA 2LXKA 2ZXPA 1TWHH 2WAQB 2Y0SG 4KLKA 1N33L 1Y69U 5C3WA 3EQLC 5CORA 1IYUA 1SXTA 1ICWA 3ER0A 4DR5L 1EQTA 1EWHA 2JN4A 3EN2A 2Z6BA 4NXML 2HUGA 2N8NA 2E2HH 4JI3Q
chains in the Genus database with same CATH topology
1V1PB 3DWPA 4RCNA 4CBVA 3BDOA 3M4YA 2KQ3A 1A3TA 3SE0A 2GA4B 4HCSA 1NCVA 1L0XB 2O4XA 2AWNA 2XRQD 1AZPA 4IFDH 2WKDA 1I6HB 2MPMA 3NWSA 3T56B 2KCNA 4BA1I 5EPLA 1TWFB 3M4OB 2CW0C 1DCZA 4BY1B 2RSNA 4RHRA 4ZAIA 1DZ1A 1U4LA 4IALA 1QILA 2BDNA 1JR0D 2F1MA 1OXSC 4CKCA 3D6CA 3MC0B 1S4ZA 4C3IB 3HEJA 3SXHA 3T16A 3EVQA 4L8JA 1B2TA 1SYGA 3PUZA 3FRPB 1AFPA 3PIO3 4V0BA 4KN4C 3NQIA 2IX3A 4RAUC 1RODA 2SEBD 3H6MA 3FVQA 1KNEA 1DXMA 4PV1C 1CHQD 4HSVA 5FKAC 1DOLA 2NVQB 1UAPA 4NKLA 2LKVA 4CKEA 4X3UA 2WV6D 1V8QA 4IFDG 1GUTA 1TKWB 1BF4A 1MSGA 4Q0FA 3I91A 1KDBA 4HEDA 3K6OA 3I4MB 3C1FA 1ET9A 5M3MB 1Q8IA 1CT1D 2X6GA 1AZQA 3HS0C 1CHPD 4M8AA 2Z4HA 1GUOA 2EJGC 1DOKA 4DAYA 1H9SA 5EBCA 1HPCA 3DWQA 2IX1A 2FMMA 5EKLA 1QNUA 2M2LA 2LMCB 4EVOA 5HURA 3HOWB 1TIID 1ET6A 5IGCA 1TWGB 5C44B 5COYA 1HUNA 4KJOA 4X3TA 4FXDA 2L1BA 2EYMA 3QWNA 1LV9A 2RA4A 2D9UA 3HP3A 4BS9A 4JBWA 4S3SA 3ZYYX 2WIIB 3TP7A 1HA5A 2XNAC 5IIFA 1B3AA 1YNND 1STNA 3M3YB 1GHJA 2ICEC 1G6ZA 3MAQA 1YNJD 2IW3A 4XT3B 1PRTC 5D65A 4H0LC 3GTJB 2VB2X 4U68A 1SNOA 3VYRA 1NAPA 4LAAA 2JP1A 3KLSX 1QG7A 2B2UC 2PZTA 2NB0A 2G9DA 5LL6S 1TS4A 4DAVA 1STYA 4E6IA 5ELDA 3J81L 1C4QA 1KTKA 4ULLA 4JK1C 4UDUC 4GZYC 3PV0A 1UEAB 2RKSA 2XN9C 4BBRB 5I9PA 1O80A 3NP8A 4J6HA 1OXUA 1BO0A 1TWHB 1S5DD 1GUSA 5KYLA 1CM9A 4IUVA 5CC4A 1D1IA 1ENAA 3IAYA 4PMCA 5J22A 4B9XA 5BN4A 3GV3A 5TSSA 1ESFA 4IUPA 4LJZC 2EJMA 4AYBB 3GTKB 4XDXA 1JOKA 3OWEB 4XQNA 3RZOB 2PO4A 2MP1A 4IFDI 2HCIA 2D2CC 2IT1A 3GTQB 1EOTA 4NP5A 1QOHA 4DNTB 5LHY1 4MN3A 4J1MA 1BBXC 1HA6A 1SYBA 3MTSA 1GXDC 3M85A 3UI2A 2H4OA 1GUNA 5T1IA 3S15B 2NVYB 1EY7A 4P2CB 3AMUA 1H9JA 3S16B 1Q90A 1DONA 2IJ0A 1G91A 1LTTD 4XXEA 4ZK9B 1QB5D 3C2PA 4N9TA 5C4XB 5C5MA 4EQPA 5IGGA 5D14A 1K8OA 1HFNA 1EY9A 4C3JB 2A6HC 2KHSA 3P20A 3OWFA 4CJ0B 1MD2D 2B2VC 3P7JA 3GTGB 2WP8J 2NVXB 4LK1C 3TN2A 1Q12A 1PXUA 1TR5A 3D8GA 2L12A 4ZLTF 3HOUB 1PLFA 3TDQA 5C4ZA 1V1PA 5FK9C 3S2DB 2R3ZA 2A6EC 2B2VA 4I65A 2M00A 3SDZA 4WORA 4MIUA 4KY7A 4F87A 3OHXC 1QE6A 1JCKB 3HOVB 4IUUA 4HN7A 4OIKA 1JOQA 4QB4A 1UUPA 1Y8PB 5ELCA 1HXYD 1HUMA 1WVLA 1O78A 5C5LA 1MSHA 2EOTA 2BE5D 4RGMA 3T53B 5I6YA 2CHBD 4XQJA 4QUCA 3VA5A 3GTOB 4Y7NB 2PPBC 3PO2B 1Z47A 4WRDA 3OW7A 2J7ZA 5C3EB 1Q3LA 3K5LA 3I3CA 4IUQA 1TS2A 3T51B 1EZ8A 4ME5A 1IKLA 1I50B 3BZDB 4ODGA 4RCOA 2QDBA 1SNQA 2A5HA 2F3VA 1LTID 4RFBA 1TWAB 2NBFA 3VA7A 2EYOA 3OPOA 2BE5C 1TT2A 4Q5VA 3Q6SA 1GUWA 1F2LA 3W2DA 1U4PA 4HR7B 3W3AA 2A6HD 2DY7A 4G7HC 1PRTF 2J4XA 2B8GA 1IL8A 5E1FA 1IYVA 1VMPA 3NTHA 1ZXTA 1EU3A 1R4QB 2E76C 3J7YW 1H9RA 1ML0D 2DNCA 1LT6D 3I4LA 1R9TB 2N55A 2X69A 4KKUA 3S17B 3VR5A 1TY2A 2JE6I 2QF7A 1VCIA 3Q22A 3K58A 2FMCA 3QOLA 1MI2A 3R8BA 4K5VA 3HZXA 4KK7A 1IW7D 3RMHA 2F0UA 1LACA 2R6GA 5CV6A 1WTWA 4BA2I 4NMZA 5M5YB 3DHQA 3I72A 2R93B 4DK1A 2XVSA 2NTTA 2L4NA 1SE2A 5JAVA 3DM1A 2A73B 3P75A 1DM0B 1HHVA 2WACA 2Z8LA 3HOZB 2F0PA 3V2TA 2O2LD 4RGOS 2K03A 2R61A 1VMCA 4IQZA 2RDFA 5C0XG 1PFMA 3MXGA 4G7ZC 4QIWB 2FINB 4F8MA 3DEPA 4C56C 1EY8A 4NDXA 4A93B 2NVTB 1VF5C 3QO2A 2K7VA 1S5BD 2EDGA 2E74C 1PFBA 2EYFA 3FEWX 4OO1H 2OEOA 4KD3A 1I4HA 3TP8A 5C6AA 5E4XA 1RCVD 5J39A 2TSSA 2PCFB 2NTSA 2EE1A 3H0GB 1WD0A 1SSOA 1ILQA 1TS5A 3BVZA 3FDTA 3NHHA 4U673 1EY5A 3K0YA 2BOSA 4A3MB 1IW7C 4HSPA 5M5WB 1KABA 1TQOA 1STHA 4RH6A 2ZXRA 4K5WA 1ONLA 1II3A 1A3VA 2DN8A 1HTLD 2RVLA 1G8ZD 1E2WA 1EYCA 4K2KA 3OIQA 4G57A 2J0TD 2K1BA 5ISRA 5EJWA 3RLFA 5IGFA 5C4JB 2F0QA 2B2YA 3PUXA 4IUNA 2NN6H 4DA2A 1STAA 3SK5A 3S1QB 2KJXA 4OGQC 1SE4A 4RKLA 4M1UB 3SR1A 3ITPA 5KNBA 1FNVA 2FFKB 4N9PA 3S14B 1PZJD 5CBEE 1RD9D 1W6JA 1PMRA 4FXGC 4ZRZA 1SYDA 3VR3A 2XRSD 4EQOA 3X3NA 1EY6A 4CJ1B 1NR2A 1CA6A 4L63B 4PNYA 3QOJA 2K5QA 2NN6I 1WTXA 4FYDA 3MWYW 1F9SA 1DJRD 3RZDB 2A69D 2VB3X 3DWAA 4DFAA 2PW5A 4XTCS 2AQ3B 5BN3A 5IT9E 3URYA 5I9OA 3MXPA 2AWOA 2EY5A 4A3JB 1HCZA 3EJIA 5IGBA 3TZDA 1B9NA 4KHVA 3U9SA 4IFDJ 2ZXOA 3EA6A 4A3EB 2KEEA 5D3DA 1O7ZA 1G291 1EIHA 3M7GA 2AUJD 4BWGB 1FNWA 3VR4A 1F9PA 1G2SA 5A35A 2WKCA 4KHZA 1W6KA 4ID6A 3WOFA 3KBXA 1GHKA 3SK4A 2N88A 3HG9A 2NUCA 5DEHA 3LX0A 4WFN3 1B1ZA 2EZVA 4KY6A 3J7AV 4FF4A 1F2ZA 1IHZA 4C3HB 1SYCA 1J8IA 2O5IC 5DNFA 2XWBB 3L9AX 3GQBA 4HCEA 1ENCA 5CBAE 1D6EC 1PTOB 3AB9A 5EKIA 4CJ2C 1RDPD 5KEEA 1SNMA 3QJYA 3PO3B 3JAML 1C48A 1Y1WB 1YNJC 4V190 3J81E 4C1NI 1T5XD 5JEAH 1XTCD 3SHLA 4R8IA 2EYJA 2B2WA 1KLUD 1B44D 2K5DA 4F7XA 5EKKA 3MFYA 3D6WA 1YNNC 3HRZC 2F0IA 4QF4A 5E3FA 2H1EA 5T1GA 4XIGS 3R93A 2L55A 3JAME 5JJZA 5A2QE 1QJOA 2A74C 1PTOH 3GP7A 3CQZB 2EYHA 2DY8A 4I7ZC 5JEAJ 4KV6A 1KDCA 4KKSA 3OMCA 5M3FB 2NN6G 1CTMA 1BR9A 1O7YA 1PZKD 2F0TA 3A56A 1I4XA 4DK0A 2MHVA 3N6RA 3U9OA 2L0CA 1TS3A 4DU9A 4XQQA 1B9MA 3T13A 3FKIB 1AW7A 5FO8B 2HDMA 1EYAA 3K59A 4HAEA 4ABNA 1K83B 1XYIA 3WDNA 3D4RA 1V1OA 1Q1BA 2WB1B 2PYKA 1S5ED 1BCPB 2K04A 1RF2D 5F2DA 5C3XA 3HKZB 3K5MA 4A3KB 5ELFA 4PMBA 1SMYD 1CA5A 3V05A 1RTOA 1ZEQX 4FO2A 5KGUA 2IL8A 3L7ZC 4KJNA 2K01A 4XYOA 1K8MA 3H3VC 1EL0A 2Q8TA 3KK7A 2A68D 3HGBA 4A3FB 3NSWA 3SEBA 3QB3A 3A54A 1LTSD 5EPKA 2F0NA 2KVMA 4EQNA 4BY7B 2PMZB 2JXMB 3D3RA 3BVMA 1CFMA 3TP6A 1QCBD 2F3WA 2EYPA 4QMGA 2RQXA 3I90A 4HMJA 2OXPA 3VR2A 1WCMB 5FO9B 3I8ZA 2CVRA 2F0FA 1B50A 3GO5A 1RHPA 3OOCA 1BXTA 2VUMB 1F9QA 2K6AA 5C4HA 1M4VA 1I4QA 1A2UA 4F88A 1C8CA 1ZYRC 1A15A 4KMUC 2SNMA 3O13A 5ELEA 5AFWA 4O1NA 1S5FD 1A6XA 3CRLC 2JA7B 1GOZA 2JA8B 3I4NB 4YIJA 1PDQA 5JEAG 4DN4M 1BQQT 2KEDA 2VXWA 3BYYB 3BG3A 1BDOA 2R92B 5JVH3 1I4RA 5FLXL 2A6ED 1BCPD 1F2MA 2F0EA 2D5DA 2EY1A 4FVMA 4CHTB 1SYFA 4LMQD 3SK8A 5G3LF 1F2YA 1H9KA 1G2TA 4J8QA 1RTNA 3KBGA 4A3BB 2E2IB 2F0SA 1DYQA 4O42A 2QILA 1J9OA 2FHTA 2R7ZB 1JQYD 1EU4A 2KOLA 4UAIA 3QIAA 3NUCA 2M9VA 2K33A 1SBBB 4G7OC 4X3KA 4K8JA 1X32A 3NBIA 3TBIB 5C0XJ 1PTOD 2RSOA 3OIPA 1ZYRD 1D2BA 5IGEA 4BBSB 2SDFA 1SJED 3R2IA 3MA2B 2A69C 2PZWA 1CQVA 1EFID 1H9MA 3CRKC 1JICA 3K7AB 3DMUA 3GTMB 4R9WA 4H13C 1XXGA 1KLGD 1DD2A 2F03A 1Y1VB 4DXFA 2E2HB 1ESRA 1CZWA 2ID0A 1S5CD 4FF1A 3BYTB 2NYZD 2BA1A 1U4MA 1PFNA 3NXWA 3ND9A 1HQMC 2YU9B 4TSSA 2JEAI 3KLRA 1BCPC 5EPJA 3E0JA 5CV8A 3TZUA 5K36H 3KF8A 4K2LA 2IWHA 3WOEA 1I6VC 3FPUB 3BDLA 4K6DA 2B63B 4DAPA 3FMCA 5EBDA 3N52A 1LT4D 3Q23A 3X3MA 2AQ2B 2K28A 3NK9A 4IURA 2HQEA 4RHSA 3VYSA 2PQEA 2MJ8A 1ENFA 5EQ0A 1AP0A 2F0MA 4QUFA 3MVVA 2B2UA 1XWEA 1LT5D 4TKOB 1PYWD 5KNDA 3K5OA 4ZYSA 5CV5A 2A68C 4C3HG 2PW7A 2DNEA 1U4RA 4ZUIA 3S1NB 2E75C 1SE3A 3T4AC 2EVBA 3H91A 4C2MB 1CZGA 2PNRC 1WTPA 3G6JB 5A2QL 1CK1A 2TMPA 1E2VA 1VDZA 2KCCA 2L9HA 3A7LA 2MUYA 1B53A 3A8JE 3S1MB 1F77A 1EIGA 4XYQA 4C3IG 2LFNA 4IN3A 3H09A 3S1RB 1SNDA 1AEXA 3S9WA 1GUGA 3E6ZX 4DNRB 3VYUA 3GTPB 1I3QB 1HRJA 4KI0A 1OXTA 4HTHA 1BOSA 4DGZA 1H9SB 5EGTA 2XIWA 3LNNA 1AN8A 2KECA 5ELBA 3OSOA 3K5NA 1X3QA 3PUVA 1EYDA 5D3IB 1GJXA 2FJ2A 4C1NK 4CKBA 2RDGA 3F2UA 1SEBD 2C5CA 2QKIC 1KNAA 5I6WA 5IGDA 2B2YC 1OO9B 3ERQA 1OXVA 1IKMA 3J80E 2X6LA 2EPBA 1FNUA 4WJWA 2F0HA 3RD4A 4RGNA 1JWUD 4ZUJA 4A3GB 1RKNA 3D31A 1WTRA 2Q8RE 3P1HA 2IX0A 4PQXA 1NR4A 1EEID 5CR3A 1FD7D 2F0DA 2QEJC 1Z7TA 5IOCA 4MHEA 4OO1I 2O5JC 1B4OA 3C1EA 5K36G 1BNZA 1PRTB 4FF3A 4EGVA 1CQFA 3K57A 1LTAD 1EEFD 1SNCA 1Y8OB 3MEHA 3H94A 4ILWA 3HOYB 4OL7A 3GV6A 5BN5A 3PIP3 1BUVT 5IT9L 5M9OA 1LO5D 3MZ5A 3EROA 2SOBA 5CMDA 2IPKD 1KAAA 1SMYC 3IKJA 4KTAA 3A55A 4A3IB 2ENBA 1PRTD 4K14A 5KNCA 1FR3A 2Y0SB 1E2ZA 5FLXE 1I4PA 3J80L 2I46A 5K5PA 1UNSA 4TRDA 1STEA 1WTQA 2LS01 3DUZA 4RA8A 1SAPA 2Z1CA 3Q0AA 2BA0A 2JYOA 4DF7A 4XT1B 3CU7A 1U9RA 1L0YB 1EQVA 5CGKA 1EY4A 1DOMA 2KA7A 1Q1EA 5KYIA 1PTOF 3RUZA 1JORA 3NPPA 2YYZA 1LT3D 5FO7B 1JWSD 3BVGA 2I07B 2ICIA 1LABA 2XWJB 5IODA 3M7NA 1FGBD 4K6LA 2B2TA 4OIJA 1XX8A 4ZQ3A 2F0WA 1BCPF 1A3UA 2WINB 1JOOA 2EY6A 4K8IA 5C0XH 2EJFC 3PUYA 1JE4A 1KDAA 5JOBA 3L3OC 3C46A 4R8NA 1TWCB 5I2XA 4CGYB 4IUTA 1NUCA 3S2HB 3VYTA 2F0GA 4DXGA 4OO1G 3G7LA 2JA5B 1Z6HA 3I73A 2B39A 1WTOA 4NW2A 1VF7A 3R3OA 4QCLA 2EYLA 2OF1A 1SDFA 5JVG3 1PZID 1SJHD 4KKTA 3TSSA 1A2TA 1MBYA 2BCOA 3SVMA 2E2JB 1LTGD 3NTKA 4Z9CB 1X3PA 2JSOA 1STBA 1SYEA 2V4DA 2K32A 3MHBA 4H7BA 3BS1A 2K5WA 3MXUA 1EZ6A 2NWGA 4L6TB 1STGA 1JWMD 3A7AB 3TP5A 3DXJC 4FNFA 1T5EA 1TY0A 5CV7A 5CV4A 5DM63 2L11A 2F0LA 5KRUA 5JPNC 4RGTA 1TVXA 2SNSA 1TU2B 1M8AA 2NZ1D 3Q24A 3NQTA 1V43A 4PMWA 2F0OA 2RBMA 2XSCA 3LWUA 2E2DC 3TMEA 4FXKC 1EWCA 2KUMA 1SFOB 2HDLA 3NWTA 4G4KA 1D5XC 4FP5D 3KUPA 5C0XI 4K5XA 1NSNS 3LWEA 3PUWA 3ONAB 4KN7C 3A8KE 2D62A 3AU7A 2F0JA 1CI3M 3IL8A 1LLRD 3NE5B 5DAUA 1HFGA 2AUKA 1D5ZC 4H44C 4A3DB 1SNPA 5CYUA 3A8IE 4HMIA 4TQUS 1WTVA 2JEBI 3ND8A 2Z4IA 2ZT9C 4RKBA 1WD1A 3I70A 3E5SA 3V96A 1QNKA 1HQRD 3NBHA 3CKIB 2B2TC 2PZUA 1HTPA 2EXZA 2MGSA 3HOXB 4C3JG 4IZ8A 3IFTA 2F4IA 3D4DA 2JA6B 4KD4A 5I2YA 2AQ1B 1ILPA 3MFGA 1F9RA 1LTBD 5E4WC 5FOBB 1MGSA 5KIXA 5LL6X 2F0VA 5CV9A 2LY7A 2BDOA 2VNUD 4X3SA 5J1ZA 3J7AF 4KY5A 1JC7A 3QG1A 1RJTA 1I4GA 1EY0A 3DEOA 5JPMC 2CW0D 2K05A 1LTRD 2L5TA 2B2WC 3IFDA 3EFXD 1QWYA 1E0BA 3PMFA 3GD7A 3OMGA 3SK6A 3C3LA 1D1KA 3VR6A 2OT2A 5G3LD 3CHBD 1R4PB 2F0KA 3R2TA 4OHJA 5M5XB 4FF2A 4ZKCB 3MXNA 1PTOC 4B08A 2QCPX 1Y8NB 1ZKOA 2CQAA 3KLSA 4B9WA 5NUCA 2Q8IB 3FPPA 5HGTA 2G9HD 2B8FA 4RWSC 1D5MC 2EY2A 3D4WA 3GTLB 1OXXK 5I4DA 5DM73 1JB3A 2RDHA 3NTIA 2C9OA 1O7LA 3BDCA 1FYCA 4ZKBB 2HCCA 2ZXPA 2WAQB 1Y69U 5C3WA 3EQLC 5CORA 1IYUA 1SXTA 1ICWA 1EQTA 1EWHA 2HUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNE A;  2A69 C;  3DXJ C;  2BE5 D;  1T5E A;  4H0L C;  4DK0 A;  3N6R A;  1GHK A;  3D31 A;  3T53 B;  4RCN A;  1H9M A;  2E75 C;  3OOC A;  3BDO A;  3CRK C;  2BDO A;  3M4Y A;  2EVB A;  3RLF A;  1IW7 D;  1B9M A;  2KA7 A;  2PNR C;  3SE0 A;  1Q1E A;  1LAC A;  1ZYR C;  4H13 C;  2R6G A;  4KMU C;  2PPB C;  1TU2 B;  1DD2 A;  1V43 A;  3PUX A;  4BA2 I;  2NN6 H;  1A6X A;  3CRL C;  1Z7T A;  4IFD H;  1E2V A;  2YYZ A;  3I72 A;  3OW7 A;  4OGQ C;  4DK1 A;  1GUO A;  1VDZ A;  2EJG C;  3QG1 A;  1H9S A;  2KCC A;  5KNB A;  2O5J C;  4JK1 C;  3A7L A;  4GZY C;  5K36 G;  3T56 B;  3PV0 A;  2O5I C;  1LAB A;  3WDN A;  3A8J E;  3LWU A;  5JEA G;  3T51 B;  4BA1 I;  3M7N A;  1HPC A;  3D4R A;  3GQB A;  1Q1B A;  1PMR A;  2L5T A;  2CW0 C;  1DCZ A;  1K8O A;  3AB9 A;  5A35 A;  2BA1 A;  1OXU A;  3VR3 A;  1Y8O B;  3BG3 A;  1BDO A;  2A6H C;  2F1M A;  1OXS C;  3H94 A;  3P20 A;  1GUG A;  3GD7 A;  1GUS A;  1HQM C;  2LMC B;  3ND9 A;  3QJY A;  4DNR B;  5C0X H;  2A6E D;  5BN5 A;  3VA7 A;  3PUW A;  1YNJ C;  4IQZ A;  3VR6 A;  3KLR A;  2EJF C;  4KN7 C;  2JEA I;  5C0X G;  4KI0 A;  3A8K E;  3PUY A;  1OXT A;  3OPO A;  4L8J A;  3TZU A;  5BN4 A;  2D5D A;  2BE5 C;  2D62 A;  4LK1 C;  5K36 H;  4LJZ C;  2EJM A;  1Q12 A;  2NN6 I;  5JEA H;  4G7Z C;  1CI3 M;  3PUZ A;  1I6V C;  3NE5 B;  2A69 D;  2AUK A;  4HR7 B;  3W3A A;  4H44 C;  3L7Z C;  1H9K A;  3A8I E;  1Y8N B;  1ZKO A;  3FMC A;  2A6H D;  4KN4 C;  4XTC S;  1VF5 C;  3MFY A;  4TQU S;  1K8M A;  1YNN C;  1H9S B;  2K7V A;  3FPP A;  2Q8I B;  1Z6H A;  5BN3 A;  4G7H C;  4OO1 G;  3LNN A;  2JEB I;  2EDG A;  3I73 A;  3ND8 A;  2D2C C;  2B8F A;  1SMY C;  2E74 C;  2ZT9 C;  4OO1 H;  3IKJ A;  1VF7 A;  2A68 D;  2AWO A;  1DXM A;  2IT1 A;  3HGB A;  1OXX K;  3PUV A;  4PV1 C;  2A6E C;  1HCZ A;  2B8G A;  3QIA A;  3SDZ A;  5KNC A;  1IYV A;  1GJX A;  2K33 A;  1FR3 A;  4DNT B;  4XIG S;  4JBW A;  1B9N A;  2PCF B;  3U9S A;  2E76 C;  1E2Z A;  4G7O C;  1H9R A;  1O7L A;  2JXM B;  1QJO A;  1HTP A;  4KKT A;  3M85 A;  1FYC A;  1G29 1;  2DNC A;  3IFT A;  3I4L A;  2AUJ D;  4TKO B;  1CFM A;  1IW7 C;  1OXV A;  4I7Z C;  5KND A;  1V8Q A;  4KKU A;  3VR4 A;  4IFD G;  2V4D A;  2K32 A;  3VR5 A;  1Y69 U;  4KKS A;  2JE6 I;  3EQL C;  1IYU A;  1GUT A;  1GHJ A;  1GUN A;  1TKW B;  1Y8P B;  2QF7 A;  1VCI A;  1CTM A;  2BA0 A;  1ONL A;  2NN6 G;  3MXU A;  2A68 C;  4KHZ A;  2DN8 A;  1EWH A;  3VR2 A;  1O78 A;  1E2W A;  1H9J A;  3A7A B;  1Q90 A; 
#chains in the Genus database with same CATH topology
 1V1P B;  2F3I A;  1Q82 C;  3DWP A;  4RCN A;  4CBV A;  4UY8 C;  3S1Q H;  3BDO A;  3M4Y A;  2KQ3 A;  1A3T A;  3SE0 A;  5L37 A;  1FJG Q;  2GA4 B;  4HCS A;  1NCV A;  1L0X B;  1PH4 A;  2O4X A;  5GAE C;  2AWN A;  2DUD A;  1YHB A;  2XRQ D;  5HGQ A;  1AZP A;  4IFD H;  2WKD A;  1I6H B;  3CMA A;  4OEL B;  2K75 A;  2MPM A;  3NWS A;  3T56 B;  2UXD Q;  2KCN A;  4BA1 I;  3KFU A;  5EPL A;  3RN5 A;  2Q2I A;  4JI7 Q;  1TWF B;  3AFP A;  3M4O B;  2CW0 C;  1DCZ A;  4BY1 B;  4HIO A;  2RSN A;  4RHR A;  4ZAI A;  4DR4 L;  1U4L A;  1DZ1 A;  4IAL A;  4A3E H;  1QIL A;  2BDN A;  5IP7 G;  1JR0 D;  2VZA A;  2F1M A;  1OXS C;  4CKC A;  2HIX A;  4DK3 C;  2MO1 A;  1BBW A;  4DR3 Q;  3D6C A;  3MC0 B;  1KRT A;  1S4Z A;  4C3I B;  3HEJ A;  3SXH A;  4A3J H;  1C7Y A;  2Q2T A;  3CCE A;  3T16 A;  3EVQ A;  4L8J A;  1B2T A;  1SYG A;  3HKZ E;  3PUZ A;  3FRP B;  4DV3 L;  3K7U C;  5JJI A;  1AFP A;  4UP8 A;  2R7Z H;  3PIO 3;  4V0B A;  4KN4 C;  4DR1 L;  3NQI A;  2IX3 A;  4EQ5 A;  4GNX C;  3AQQ A;  4RAU C;  1ROD A;  1WI5 A;  1XMO L;  1XPO A;  2SEB D;  3H6M A;  3S2H H;  4A93 H;  3FVQ A;  1QZG A;  2N49 A;  1KNE A;  2Z9H A;  1DXM A;  4PV1 C;  2FXQ A;  1CHQ D;  4HSV A;  1PH9 A;  5FKA C;  4AQY Q;  4DV4 L;  1DOL A;  2NVQ B;  1UAP A;  4NKL A;  4DV1 L;  2LKV A;  5DLQ E;  2EQS A;  1LYL A;  4CKE A;  1UE5 A;  4X3U A;  2WV6 D;  3TS0 A;  1N34 L;  4APV A;  4K0K L;  3OTO Q;  1IBK L;  3H3V H;  1V8Q A;  4IFD G;  4YY3 L;  1GUT A;  1TKW B;  1BF4 A;  2BH2 A;  1Y1V H;  1MSG A;  4Q0F A;  3I91 A;  3KDF B;  1KDB A;  4HED A;  3I56 A;  3BU2 A;  2VY3 A;  1A62 A;  3K6O A;  3I4M B;  3C1F A;  3I4M G;  4DR4 Q;  1ET9 A;  5M3M B;  1XNR L;  2CFM A;  1Q8I A;  3T1H L;  1CT1 D;  2X6G A;  3HOX G;  1AZQ A;  2CQO A;  3HS0 C;  1CHP D;  1PHJ A;  4M8A A;  2Z4H A;  5ELN A;  1GUO A;  2EJG C;  1DOK A;  4DAY A;  1H9S A;  1PV4 A;  1WCM H;  5EBC A;  1HPC A;  3DWQ A;  2IX1 A;  2FMM A;  1YJN A;  4TVA B;  3S17 H;  4IPH A;  4A3M G;  1IBL L;  5EKL A;  2K4K A;  4CDC C;  1QNU A;  2M2L A;  2LMC B;  4EVO A;  5HUR A;  2VQE Q;  4IO9 A;  3HOW B;  1GD7 A;  1TII D;  1N33 Q;  4JI6 L;  1ET6 A;  5IGC A;  4GOP B;  1EIY B;  5IYD G;  4A3B G;  1PH8 A;  1TWG B;  5C44 B;  4X6A H;  1YIJ A;  5COY A;  1HUN A;  3I2Z A;  4PG3 A;  3EIV A;  2OWO A;  4L5S A;  3I7F A;  4KJO A;  4X3T A;  3TRE A;  4QGU A;  4FXD A;  4YY3 Q;  2L1B A;  2EYM A;  4J15 A;  3UE1 A;  3QWN A;  1LV9 A;  2RA4 A;  2A8V A;  2HHH L;  2D9U A;  3HP3 A;  4BS9 A;  4JBW A;  4DR6 Q;  4H02 A;  4S3S A;  3ZYY X;  2WII B;  3TP7 A;  1AE3 A;  1RIP A;  2PQA A;  1HA5 A;  2XNA C;  1M1K C;  4JV5 Q;  5IIF A;  3CP0 A;  1J5E L;  1B3A A;  4P72 A;  1YNN D;  1FL0 A;  1STN A;  2ZJP A;  1EYG A;  3M3Y B;  1GHJ A;  3M4O H;  4DR5 Q;  4A3C H;  2ICE C;  1G6Z A;  4LF9 L;  3MAQ A;  1YNJ D;  2IW3 A;  4XT3 B;  1PRT C;  1IL2 A;  4OX9 L;  5D65 A;  4H0L C;  4DV0 Q;  3GTJ B;  2VB2 X;  4U68 A;  1SNO A;  3VYR A;  1NAP A;  4LAA A;  2JP1 A;  3KLS X;  1JJC B;  4JYA Q;  1X3E A;  4LF5 L;  1QG7 A;  2B2U C;  2PZT A;  2NB0 A;  2R7D A;  4JI0 L;  5IP7 H;  2G9D A;  1D8L A;  5LL6 S;  1TS4 A;  3RN2 A;  1IBM Q;  4DAV A;  1STY A;  5FJ8 H;  4E6I A;  5ELD A;  3J81 L;  4A3J G;  4O0A A;  1C4Q A;  2HT1 A;  1IXR A;  1KTK A;  4ULL A;  4JK1 C;  4UDU C;  4GZY C;  1PFS A;  3PV0 A;  4DPG A;  1UEA B;  4AQY L;  4LF8 L;  3LGJ A;  2RKS A;  2XN9 C;  3AFQ A;  4BBR B;  5I9P A;  1O80 A;  4LFC L;  3EBE A;  5M3F H;  3NP8 A;  4J6H A;  1OXU A;  3J7A 5;  1HNW L;  1BO0 A;  1TWH B;  4NPS A;  1S5D D;  1GUS A;  2N3S A;  5KYL A;  1CM9 A;  4DUZ L;  4IUV A;  1VQG A;  5CC4 A;  1D1I A;  1ENA A;  3IAY A;  4PMC A;  1B70 B;  5J22 A;  4B9X A;  3CCL A;  3GV3 A;  5TSS A;  5BN4 A;  1ESF A;  4IUP A;  4LJZ C;  2EJM A;  4AYB B;  3GTK B;  4DV2 Q;  4XDX A;  3KJO A;  5IE8 A;  1JOK A;  3OWE B;  3GTL H;  4XQN A;  4R1J A;  3RZO B;  3G71 A;  2PO4 A;  2MP1 A;  4A3C G;  4IFD I;  2HCI A;  2D2C C;  1PH6 A;  2IT1 A;  3M4P A;  3GTQ B;  1LUZ A;  1EOT A;  1HZC A;  4NP5 A;  3ICE A;  1BBU A;  1K28 A;  1QOH A;  1UE6 A;  4DNT B;  5LHY 1;  4MN3 A;  2RHQ B;  4J1M A;  1BBX C;  3GTG H;  3L0O A;  3GTP H;  1HA6 A;  1SYB A;  3MTS A;  1EQQ A;  1GXD C;  3M85 A;  3BJU A;  1JJG A;  4LF7 Q;  1TWF H;  3UI2 A;  1L1O A;  2H4O A;  1K83 H;  5C3E H;  1S40 A;  1GUN A;  1I6H H;  5T1I A;  4JG2 A;  5C4X H;  3S15 B;  5IT9 c;  4FDB A;  2NVY B;  4ME3 A;  1EY7 A;  4P2C B;  3AMU A;  1H9J A;  4JOI A;  1Q90 A;  3S16 B;  1DON A;  2IJ0 A;  2HIV A;  4C3H H;  1G91 A;  1I94 Q;  1LTT D;  1YIT A;  4XXE A;  4ZK9 B;  1QB5 D;  2ZJQ A;  3C2P A;  3S16 H;  4N9T A;  2JA8 G;  4B3M Q;  1Q7Y C;  5C4X B;  5C5M A;  4KHP Q;  4EQP A;  5IGG A;  2VW9 A;  5D14 A;  1K8O A;  4NB3 A;  1HFN A;  1EY9 A;  4C3J B;  2A6H C;  2KHS A;  3P20 A;  3OWF A;  1GO3 E;  4CJ0 B;  1MD2 D;  2B2V C;  3P7J A;  3GTG B;  2WP8 J;  2NVX B;  1KAW A;  4LK1 C;  2WFW A;  1Q12 A;  3TN2 A;  1PXU A;  1TR5 A;  3D8G A;  1W2B A;  2L12 A;  4LW1 A;  4JPB W;  3J81 i;  4ZLT F;  1PYB A;  2C35 B;  1E1T A;  3HOU B;  3NEN A;  1PLF A;  3TDQ A;  5C4Z A;  1V1P A;  5FK9 C;  3S2D B;  2R3Z A;  1CKN A;  1VQ9 A;  2A6E C;  2B2V A;  4I65 A;  2M00 A;  3SDZ A;  4WOR A;  4MIU A;  5LMU Q;  4KY7 A;  4F87 A;  3E9I A;  4HID A;  3OHX C;  3WWV A;  1QE6 A;  3RLO A;  1JCK B;  2CH4 A;  5FLX c;  3HOV B;  4IUU A;  3JAM i;  4HN7 A;  4OIK A;  1A63 A;  3ULP A;  5FLM G;  2B29 A;  1JOQ A;  4QB4 A;  3OW2 A;  1X65 A;  1UUP A;  1Y8P B;  1XJV A;  2UUB L;  2K50 A;  5ELC A;  1HXY D;  1HUM A;  1WVL A;  1O78 A;  5C5L A;  4A3L H;  1MSH A;  4JI2 L;  1S3O A;  2EOT A;  2VQF Q;  1E24 A;  2BE5 D;  4RGM A;  3T53 B;  5I6Y A;  2CHB D;  4XQJ A;  4QUC A;  3VA5 A;  3GTO B;  4Y7N B;  2MFI A;  4CDD C;  1JMC A;  4ZCK A;  2PPB C;  1Z47 A;  4WRD A;  3PO2 B;  4LWC A;  3MXN B;  1C0A A;  3OW7 A;  2J7Z A;  4NXN Q;  2YTX A;  5C3E B;  1Q3L A;  3K5L A;  3I3C A;  4IUQ A;  1TS2 A;  3T51 B;  1Q86 C;  1EZ8 A;  4ME5 A;  1IKL A;  1I50 B;  1V1Q A;  3BZD B;  1NBW A;  4ODG A;  4RCO A;  4PZ6 A;  2QDB A;  1SNQ A;  2A5H A;  2F3V A;  2MO0 A;  5BR8 Q;  3OTO L;  1LTI D;  4RFB A;  1K0S A;  3H0G G;  1TWA B;  1PVO A;  2NBF A;  3VA7 A;  2EYO A;  2JK8 A;  3OPO A;  2BE5 C;  1TT2 A;  3FKI G;  3Q6S A;  4Q5V A;  1F2L A;  1GUW A;  4DV4 Q;  3W2D A;  2ZM6 Q;  1U4P A;  2K14 A;  4HR7 B;  3W3A A;  3RZO H;  1MIU A;  2A6H D;  2DY7 A;  2VL6 A;  5GAD C;  4G7H C;  1IBK Q;  3GTK H;  1PRT F;  4HIM A;  4DR3 L;  1HNZ Q;  3T1Y Q;  2J4X A;  1NNX A;  2B8G A;  1IL8 A;  4GLA C;  5E1F A;  4AYB E;  1IYV A;  1VMP A;  3NTH A;  1ZXT A;  5C44 H;  1TWG H;  3KJP A;  1EU3 A;  1G51 A;  1R4Q B;  3FHW A;  4DR6 L;  4QIW E;  2E76 C;  2D0P A;  2CWA A;  2KCT A;  4JI2 Q;  3J7Y W;  1H9R A;  1VQJ A;  1ML0 D;  2DNC A;  4BBR H;  1LT6 D;  1U0L A;  3I4L A;  1R9T B;  2JA6 G;  2N55 A;  1VS0 A;  1WFQ A;  2X69 A;  4KKU A;  2UXC Q;  2AKW B;  3S17 B;  3VR5 A;  1TY2 A;  2JE6 I;  4HJ8 A;  2KCM A;  2QF7 A;  1VCI A;  1E22 A;  1A0I A;  3Q22 A;  3BZK A;  4DAY B;  1Q46 A;  3KDF A;  2FMC A;  4X62 L;  3K58 A;  4B3R Q;  2JA8 H;  1N8R C;  3QOL A;  2AMC B;  1MI2 A;  3R8B A;  3HOW G;  4K5V A;  3HZX A;  4KK7 A;  1X54 A;  1HH2 P;  1IW7 D;  3RMH A;  2HQL A;  2F0U A;  4L5T A;  1LAC A;  3MEF A;  2R6G A;  5CV6 A;  1WTW A;  4BA2 I;  4NMZ A;  2VUM H;  4DKA C;  4OXP A;  5M5Y B;  3DHQ A;  3I72 A;  2R93 B;  4DK1 A;  1VQO A;  2XVS A;  3A74 A;  4A76 A;  2NTT A;  2L4N A;  4NXM Q;  5LMU L;  1SE2 A;  5JAV A;  2A1A A;  3DM1 A;  3PGZ A;  4B3T Q;  4KHP L;  4P71 A;  2E2J H;  1CKN B;  4IOC A;  1PA6 A;  2A73 B;  3P75 A;  4LFB L;  1DM0 B;  1HHV A;  2WAC A;  2Z8L A;  1FJG L;  3HOZ B;  2F0P A;  3V2T A;  2O2L D;  2BH8 A;  4RGO S;  5EAY A;  2K03 A;  2R61 A;  1VMC A;  4IQZ A;  2RDF A;  5C0X G;  2JA5 G;  1PFM A;  4YCW A;  2RCF A;  4OX9 Q;  3MXG A;  5IY0 A;  4G7Z C;  1KHI A;  3RR5 A;  4BBR G;  4QIW B;  5E7N A;  2FIN B;  4F8M A;  4WJ4 A;  3DEP A;  4C56 C;  1EY8 A;  4NDX A;  2PQA B;  4A93 B;  2NVT B;  1TWC H;  1VF5 C;  2CH4 W;  3QO2 A;  2K7V A;  1S5B D;  2DGY A;  2EDG A;  3T1H Q;  4BY7 G;  2E74 C;  1PFB A;  2EYF A;  3FEW X;  4OO1 H;  2OEO A;  4KD3 A;  1EUJ A;  1I4H A;  3TP8 A;  5C6A A;  5E4X A;  2UU9 L;  1RCV D;  5J39 A;  3HOW H;  2TSS A;  2PCF B;  2NTS A;  3H15 A;  2EE1 A;  3H0G B;  1WD0 A;  1SSO A;  4C3I H;  1ILQ A;  1TS5 A;  3NHH A;  3FDT A;  3BVZ A;  3JAM c;  1EY5 A;  1TWA H;  4U67 3;  3HOY H;  4JI5 Q;  1UE1 A;  3UDX A;  3K0Y A;  2BOS A;  4A3M B;  1IW7 C;  4DV6 L;  1NJI C;  1BKB A;  4HSP A;  5M5W B;  1KAB A;  1TQO A;  1X56 A;  1STH A;  4RH6 A;  4LNQ A;  2ZXR A;  4K5W A;  1ONL A;  1II3 A;  1A3V A;  2DN8 A;  1HTL D;  2RVL A;  2HHH Q;  1G8Z D;  1E2W A;  4IPG A;  1EYC A;  3E9H A;  4K2K A;  3CCJ A;  2ZTD A;  3OIQ A;  4G57 A;  2J0T D;  1U5K A;  2K1B A;  3PF5 A;  5ISR A;  5EJW A;  1J6Q A;  3RLF A;  5IGF A;  4LFB Q;  5C4J B;  2OTL A;  1J5E Q;  2F0Q A;  2B2Y A;  1EOV A;  3G48 A;  2UUC L;  3PUX A;  1MKH A;  4IUN A;  2NN6 H;  1B3Q A;  1STA A;  3SK5 A;  4DA2 A;  3I55 A;  3S1Q B;  1H95 A;  2KJX A;  4OGQ C;  1SE4 A;  4RKL A;  4M1U B;  3SR1 A;  2P5Z X;  3ITP A;  5KNB A;  1FNV A;  3A0J A;  2FFK B;  4N9P A;  3S14 B;  1PZJ D;  5CBE E;  1RD9 D;  4FXG C;  1W6J A;  1PMR A;  4ZRZ A;  4L5R C;  1SYD A;  1HR0 Q;  4WJ3 M;  3GDE A;  3VR3 A;  4BY7 H;  2XRS D;  4EQO A;  3X3N A;  1EY6 A;  4CJ1 B;  5IP9 G;  2NVQ H;  4CDE C;  1NR2 A;  4OON A;  1KIX A;  1CA6 A;  1K3B C;  4UPA A;  1Y1V G;  4L63 B;  4PNY A;  3QOJ A;  2ZJR A;  2K5Q A;  4LFA Q;  2LSS A;  2NN6 I;  1WTX A;  5IWA Q;  4FYD A;  3MWY W;  1F9S A;  1DJR D;  3RZD B;  3TS2 A;  2A69 D;  2VB3 X;  3DWA A;  4DFA A;  3HOU G;  2PW5 A;  4XTC S;  2AQ3 B;  4MTN A;  4YWM A;  5BN3 A;  5IT9 E;  3TRZ A;  1IBM L;  3URY A;  5I9O A;  3MXP A;  3UDF A;  2AWO A;  2EY5 A;  3RLN A;  4A3J B;  4YHH Q;  4DV5 L;  1HCZ A;  4GKJ L;  3EJI A;  1WCM G;  5IGB A;  3TZD A;  1B9N A;  4KHV A;  3U9S A;  1Y1W G;  4IFD J;  2ZXO A;  3EA6 A;  4A3E B;  2ZM6 L;  2KEE A;  4BBS G;  5D3D A;  1O7Z A;  1G29 1;  4QJF A;  3PO3 H;  1EIH A;  3M7G A;  2AUJ D;  4BWG B;  4B3S Q;  3J81 j;  4I7A A;  1FNW A;  4C3J H;  3VR4 A;  3S1R H;  2L15 A;  1F9P A;  1G2S A;  3DLL A;  2VUM G;  5A35 A;  2WKC A;  1D7Q A;  4KHZ A;  1W6K A;  4ID6 A;  2KHJ A;  3WOF A;  3KBX A;  3J81 c;  1QVC A;  1GHK A;  4Y7N H;  3GTO H;  5JJL A;  3SK4 A;  2N88 A;  1A8V A;  3HG9 A;  2NUC A;  4GNX B;  5DEH A;  4JI1 Q;  3LX0 A;  4WFN 3;  1B1Z A;  2EIF A;  4KY6 A;  2EZV A;  4FF4 A;  1F2Z A;  3J7A V;  1IHZ A;  1WTH A;  2Q2H A;  3S1N H;  4ALP A;  4C3H B;  4JBJ A;  4LUV A;  1SYC A;  1J8I A;  2O5I C;  2F52 A;  5DNF A;  1HJP A;  1CKO A;  2V1C C;  2XWB B;  4MNO A;  3L9A X;  5GAH C;  1SN8 A;  3GQB A;  4LF6 L;  4HCE A;  1ENC A;  5CBA E;  1D6E C;  1PTO B;  3AB9 A;  5EKI A;  3H3V I;  4CJ2 C;  1RDP D;  1JE5 A;  2QW7 A;  2GVA A;  5KEE A;  1SNM A;  3QJY A;  4POF A;  3PO3 B;  3JAM L;  3CW2 C;  1C48 A;  1Y1W B;  4R4I A;  2ES2 A;  2UUA Q;  1N32 L;  1YNJ C;  1XMQ L;  4V19 0;  1YVC A;  4PZ7 A;  3J81 E;  3E0E A;  4C1N I;  1T5X D;  5JEA H;  2I5H A;  1XTC D;  3VDY A;  3PO3 G;  3SHL A;  4R8I A;  2EYJ A;  4JI4 Q;  3K80 C;  2B2W A;  2G5D A;  1KLU D;  1B44 D;  5HY6 A;  2K5D A;  4F7X A;  5EKK A;  3MFY A;  1HNW Q;  3D6W A;  1YNN C;  3DM3 A;  2I5L X;  3HRZ C;  2F0I A;  4GN3 B;  2JQO A;  4QF4 A;  2N78 A;  5E3F A;  2E5L Q;  4RMF A;  2H1E A;  1ICF B;  4LUO A;  5T1G A;  4XIG S;  3R93 A;  2L55 A;  3JAM E;  2ASB A;  5JJZ A;  2YU9 H;  5A2Q E;  3ZJY C;  5M3F G;  1QJO A;  5IYC G;  2A74 C;  4UP7 A;  1PTO H;  3GP7 A;  3CQZ B;  1KRS A;  4JI0 Q;  1YZ6 A;  3G4S A;  2EYH A;  2DY8 A;  3S1M H;  4I7Z C;  5JEA J;  3TQY A;  2R7F A;  4KV6 A;  3PF4 A;  1KDC A;  4KKS A;  4GKK L;  4X64 L;  1SFO H;  3OMC A;  5M3F B;  2RCN A;  2NN6 G;  1CTM A;  4POG A;  1BR9 A;  1PZK D;  1O7Y A;  4YCU A;  1YHQ A;  2F0T A;  3S14 H;  1VQ6 A;  3PIP A;  1HR0 W;  4LF9 Q;  2UU9 Q;  2UXB L;  1G6P A;  1CUK A;  3A56 A;  1K9M C;  1I4X A;  2KHI A;  4DK0 A;  5LMN Q;  2MHV A;  3N6R A;  4C2M H;  1PH7 A;  1QUQ A;  3U9O A;  1OTC A;  2L0C A;  1TS3 A;  4DU9 A;  4XQQ A;  1B9M A;  3T13 A;  1VQ4 A;  3FKI B;  1AW7 A;  5FO8 B;  1QVG A;  1KC8 C;  1HNZ L;  2HDM A;  2WB1 E;  3S15 H;  1EYA A;  1X3G A;  2EXD A;  3K59 A;  4HAE A;  4ABN A;  4JBK A;  1K83 B;  1XYI A;  3WDN A;  2QGQ A;  3F2B A;  1SE8 A;  3D4R A;  1V1O A;  1Q1B A;  2QEX A;  2WB1 G;  3M3Y H;  1PH5 A;  2WB1 B;  2PYK A;  3FP9 A;  3ULL A;  1S5E D;  1BCP B;  2K04 A;  1RF2 D;  5M5W H;  4DR7 L;  2R93 G;  5F2D A;  5C3X A;  4HJ9 A;  3HKZ B;  3K5M A;  3HKZ G;  4B3S L;  1CSP A;  4A3K B;  4LF4 L;  4A3E G;  1YBY A;  5ELF A;  4PMB A;  1SMY D;  1CA5 A;  2UUB Q;  1L1O B;  4GS3 A;  3U50 C;  3V05 A;  1RTO A;  1ZEQ X;  4FO2 A;  5KGU A;  1VQP A;  3STB C;  5IYB H;  2IL8 A;  3L7Z C;  1K8A C;  4KJN A;  1UEB A;  4A93 G;  3CD6 A;  3RZD H;  2K01 A;  4XYO A;  1K8M A;  3H3V C;  1EL0 A;  2Q8T A;  3KK7 A;  2A68 D;  3HGB A;  4A3F B;  4N8X 1;  1VQH A;  3NSW A;  4A3F G;  3QB3 A;  3SEB A;  3A54 A;  2NZH A;  1JJ2 A;  1LTS D;  5EPK A;  4JOI C;  2F0N A;  2KVM A;  4EQN A;  1AE2 A;  4BY7 B;  2PMZ B;  2JXM B;  4R4Q A;  4IJH A;  1X9N A;  3D3R A;  3BVM A;  3D0F A;  1CFM A;  3TP6 A;  1QCB D;  4DV6 Q;  2F3W A;  1HZA A;  2UUA L;  2EYP A;  4QMG A;  2RQX A;  3I90 A;  4HMJ A;  2OXP A;  2Y0S E;  3VR2 A;  1WYD A;  1IZ6 A;  1WCM B;  5FO9 B;  2B3G A;  2XGT A;  3I8Z A;  2UXD L;  2CVR A;  2F0F A;  1B50 A;  3CCS A;  2R93 H;  3GO5 A;  1K73 C;  5C4J H;  5M5Y H;  1RHP A;  1X55 A;  3OOC A;  3U58 A;  1BXT A;  2VUM B;  1F9Q A;  2K6A A;  5C4H A;  1M4V A;  1VQB A;  1I4Q A;  1A2U A;  3K81 C;  4F88 A;  1C8C A;  1ZYR C;  1A15 A;  2F4V Q;  4KMU C;  4JVZ A;  4OEM B;  4YWK A;  2SNM A;  3JC6 6;  3O13 A;  3I4M H;  2H5X A;  5ELE A;  2CWP A;  5AFW A;  1CKM A;  1VQF A;  1S5F D;  4O1N A;  3CRL C;  1A6X A;  3L2P A;  2IY5 B;  2JA7 B;  1GOZ A;  3I4N G;  2JA8 B;  3I4N B;  3KYH C;  4YIJ A;  1PDQ A;  3U4Z A;  5JEA G;  3CXC A;  2I5M X;  4A3M H;  2HD3 A;  4JC0 A;  4UHV A;  1YNX A;  4DN4 M;  3CC2 A;  4LF5 Q;  1Q8K A;  1BQQ T;  2KED A;  2VXW A;  3BYY B;  3BG3 A;  1BDO A;  2R92 B;  5JVH 3;  1VQL A;  3PO2 G;  1I4R A;  4GN5 A;  2I0Q A;  5FLX L;  5IYD H;  4GKK Q;  2A6E D;  4YHH L;  1BCP D;  1SRO A;  4GOP C;  4GKJ Q;  2YTY A;  1F2M A;  4A3L G;  2F0E A;  2D5D A;  2EY1 A;  3KF8 B;  4FVM A;  4CHT B;  1SYF A;  4LMQ D;  4A3B H;  3SK8 A;  5G3L F;  4DV1 Q;  2NVT H;  1F2Y A;  1H9K A;  1G2T A;  4J8Q A;  1RTN A;  3KBG A;  4A3B B;  4GN4 B;  2GN5 A;  4QY7 A;  2E2I B;  3CPF A;  2F0S A;  5GQO A;  1DYQ A;  4A3G G;  4O42 A;  2QIL A;  1J9O A;  2FHT A;  2R7Z B;  1JQY D;  4GOP A;  1B8A A;  4IOA A;  1EU4 A;  2KOL A;  4UAI A;  3ULJ A;  3A5U A;  3QIA A;  3NUC A;  3CF5 A;  2M9V A;  2K33 A;  1SBB B;  2VQF L;  4G7O C;  4X3K A;  4MTK A;  4K8J A;  1P16 A;  1FVI A;  1X32 A;  3NBI A;  3TBI B;  4A3K H;  5C0X J;  1S72 A;  1PTO D;  4A75 A;  2RSO A;  3OIP A;  1YJW A;  1ZYR D;  3I4N H;  1VQD A;  2B63 G;  1D2B A;  5IGE A;  4BBS B;  4NXN L;  2GVB A;  2SDF A;  4B3R L;  4DAM A;  1YHA A;  1SJE D;  2OCE A;  3R2I A;  3MA2 B;  2A69 C;  2PZW A;  1XTD A;  4LF6 Q;  1CQV A;  1EFI D;  1H9M A;  3CRK C;  1JIC A;  3K7A B;  2PI2 A;  3PO2 H;  3DMU A;  1FGU A;  5FJ8 G;  3GTM B;  4R9W A;  3S24 A;  4JCV E;  4H13 C;  4AYB G;  1XXG A;  3NBH B;  1KLG D;  1DD2 A;  2F03 A;  4EX5 A;  1E7Z A;  1N32 Q;  1Y1V B;  4DXF A;  1LTL A;  1YEZ A;  4OWT B;  2E2H B;  1ESR A;  1T9H A;  1CZW A;  2ID0 A;  5LMN L;  1R9T H;  4IJL A;  1S5C D;  1UE7 A;  2VS1 A;  3BYT B;  4FF1 A;  2NYZ D;  2BA1 A;  1PFN A;  1U4M A;  4AIM A;  3NXW A;  1GVP A;  3ND9 A;  1HQM C;  1XNQ Q;  3F8T A;  3HOV H;  2YU9 B;  4TSS A;  4A3F H;  3KLR A;  2JEA I;  1BCP C;  2PI2 E;  5EPJ A;  3E0J A;  5CV8 A;  3TZU A;  4DUY L;  5K36 H;  3KF8 A;  4K2L A;  1ASY A;  2IWH A;  1I6V C;  3WOE A;  4A3K G;  1K8G A;  1Y14 B;  3FPU B;  3BDL A;  4K6D A;  2B63 B;  4DAP A;  1W3S A;  3FMC A;  5EBD A;  3N52 A;  3PIO A;  1LT4 D;  3Q23 A;  3X3M A;  2AQ2 B;  1KXL A;  2K28 A;  3NK9 A;  2QDL A;  4X64 Q;  4LF4 Q;  3T1Y L;  4IUR A;  2HQE A;  3W1G A;  4RHS A;  3VYS A;  2PQE A;  2Z6K C;  1HZ9 A;  2OQ0 A;  2MJ8 A;  1ENF A;  3PQI A;  3PSI A;  5EQ0 A;  1AP0 A;  2F0M A;  1YI2 A;  4QUF A;  3MVV A;  4DR1 Q;  2B2U A;  1XWE A;  1LT5 D;  1I50 H;  4TKO B;  4JI8 Q;  3CCQ A;  1PYW D;  5KND A;  3K5O A;  2DJF C;  4ZYS A;  4R4O A;  5CV5 A;  3E3X A;  2A68 C;  4C3H G;  1SLJ A;  5C3E G;  2PW7 A;  2DNE A;  1U4R A;  5C4X G;  1VQE A;  4JI4 L;  4ZUI A;  3S1N B;  2E75 C;  3F2C A;  1SE3 A;  3T4A C;  2EVB A;  3H91 A;  4C2M B;  1CZG A;  2DJG C;  2PNR C;  1WTP A;  3G6J B;  5A2Q L;  3AYH B;  1CK1 A;  2E5L L;  2TMP A;  3J80 i;  1E2V A;  1VDZ A;  2KCC A;  1VQI A;  2L9H A;  3A7L A;  3CPW A;  1DGS A;  2MUY A;  2NVY H;  1B53 A;  3A8J E;  3S1M B;  1F77 A;  3W5O A;  1EIG A;  4XYQ A;  4C3I G;  1PH2 A;  3CQZ H;  1X3F A;  2LFN A;  4IN3 A;  3H09 A;  3S1R B;  4DR7 Q;  4P73 A;  1SND A;  3J80 c;  4HJ5 A;  1AEX A;  3S9W A;  2UUC Q;  1GUG A;  3E6Z X;  1JT8 A;  4DNR B;  3VYU A;  3NEM A;  4X65 Q;  3GTP B;  1I3Q B;  1HRJ A;  1MHW C;  4KI0 A;  1OXT A;  3S2D H;  4RG1 A;  1QVF A;  3GTQ H;  4HTH A;  4JI5 L;  1BOS A;  4DGZ A;  5BR8 L;  3A5Z B;  1H9S B;  2JJQ A;  2CKZ B;  5EGT A;  2XIW A;  4JI8 L;  1K0R A;  1AN8 A;  2OQK A;  2KEC A;  3LNN A;  5ELB A;  4JI1 L;  3OSO A;  2NVX H;  3K5N A;  2B63 H;  1X3Q A;  3PUV A;  4DV7 Q;  1EYD A;  5D3I B;  3I4O A;  1GJX A;  2FJ2 A;  4C1N K;  4MZ9 A;  3CCR A;  4CKB A;  1NY4 A;  2RDG A;  3F2U A;  1SEB D;  5IWA L;  2C5C A;  2QKI C;  1KNA A;  5I6W A;  5IGD A;  4JV5 L;  2B2Y C;  2KEN A;  1VQK A;  1OO9 B;  5IP9 H;  5J3B A;  3ERQ A;  1EIF A;  4X66 Q;  4HIK A;  1OXV A;  1IKM A;  3J80 E;  1ASZ A;  2X6L A;  2EPB A;  1FNU A;  4WJW A;  3J7Z C;  2F0H A;  4R4C A;  3RD4 A;  4RGN A;  1JWU D;  4ZUJ A;  4A3G B;  1RKN A;  2PMZ E;  4DV3 Q;  3D31 A;  1WTR A;  4UP9 A;  2Q8R E;  3P1H A;  1WJJ A;  2IHE A;  1XPR A;  2IX0 A;  4PQX A;  1NR4 A;  4L5Q A;  1EEI D;  5CR3 A;  1N36 Q;  2LXJ A;  1FD7 D;  2F0D A;  2QEJ C;  3F1Z A;  2JA7 G;  3HOV G;  1Z7T A;  5IOC A;  4MHE A;  4OO1 I;  2O5J C;  1B4O A;  1SMX A;  3C1E A;  5K36 G;  1HNX L;  1BNZ A;  1PRT B;  4FF3 A;  4EGV A;  1XPU A;  1CQF A;  3K57 A;  4BBS H;  1LTA D;  2CCZ A;  4LUZ A;  4GNX A;  1K3R A;  1EEF D;  1SNC A;  1Y8O B;  4YCV A;  1IYJ B;  3CME A;  2KBN A;  3MEH A;  3H94 A;  4ILW A;  3HOY B;  3K8A A;  4OL7 A;  4P74 A;  1VQA A;  3GV6 A;  5BN5 A;  3PIP 3;  1BUV T;  1JB7 A;  5IT9 L;  5M9O A;  1LO5 D;  3H0G H;  4N8F A;  4YWL A;  3MZ5 A;  4DV2 L;  3ERO A;  2SOB A;  5CMD A;  2IPK D;  4BXX G;  1UWV A;  4Y52 H;  1KAA A;  2E2I H;  2ZTE A;  1SMY C;  2YTV A;  1QUQ B;  3IKJ A;  4KTA A;  4HJ7 A;  3KF6 B;  2OTJ A;  3A55 A;  3KF6 A;  4A3I B;  2ENB A;  1PRT D;  4K14 A;  5KNC A;  3SGI A;  4GLX A;  1FR3 A;  2MQH A;  4DUY Q;  2WAQ G;  2Y0S B;  1E2Z A;  5FLX E;  1I4P A;  1QZH A;  4IPD A;  3J80 L;  2I46 A;  5K5P A;  1UNS A;  4TRD A;  1STE A;  1Q81 C;  1PH1 A;  3HOZ H;  1AH9 A;  1WTQ A;  2R92 H;  2LS0 1;  3DUZ A;  1NMF A;  3KOJ A;  1LM0 A;  4RA8 A;  4AH6 A;  1SAP A;  2Z1C A;  5AJ3 L;  3Q0A A;  2BA0 A;  2JYO A;  3RNU A;  2Z0S A;  4X65 L;  4DF7 A;  4DR2 L;  3ERS X;  2UXB Q;  4XT1 B;  1RL2 A;  4LFA L;  3CU7 A;  1U9R A;  1L0Y B;  1EQV A;  5GAG C;  5CGK A;  2ATW A;  3GTM H;  1I94 L;  3K7A H;  1EY4 A;  1DOM A;  1L2F A;  2KA7 A;  3IRB A;  4LF7 L;  3GTJ H;  5M3M H;  1Q1E A;  1P8L A;  3HKS A;  5KYI A;  1VQN A;  1PTO F;  3RUZ A;  1JOR A;  4DV5 Q;  3NPP A;  2YYZ A;  1LT3 D;  5FO7 B;  1GKH A;  3HFZ B;  1JWS D;  3BVG A;  1VQ5 A;  2I07 B;  1SRU A;  2ICI A;  3F2D A;  1LAB A;  2XWJ B;  5IOD A;  3M7N A;  1FGB D;  4K6L A;  2B2T A;  5IYC H;  4OIJ A;  1XX8 A;  4ZQ3 A;  2F0W A;  1BCP F;  2F4V L;  1A3U A;  2WIN B;  1JOO A;  2EY6 A;  4K8I A;  5C0X H;  2EJF C;  3QR8 A;  3PUY A;  5JJK A;  1JE4 A;  1KDA A;  2K5V A;  5JOB A;  3L3O C;  3C46 A;  2JA5 H;  4R8N A;  4A3I H;  3HOZ G;  1TWC B;  3B6Y A;  5I2X A;  4CGY B;  4IUT A;  1NUC A;  3S2H B;  3VYT A;  2F0G A;  4DXG A;  2A19 A;  3AEV A;  4OO1 G;  3G7L A;  2JA5 B;  1Z6H A;  4CDF C;  3I73 A;  2B39 A;  2VQE L;  5LMN W;  1WTO A;  1XNR Q;  1KQS A;  4NW2 A;  1PYS B;  1VF7 A;  3CCM A;  4PZ8 A;  3R3O A;  1PH3 A;  4JBM A;  4QCL A;  2EYL A;  2OF1 A;  1SDF A;  5JVG 3;  1PZI D;  1SJH D;  1VQ8 A;  2ZTC A;  3W1B A;  4KKT A;  3TSS A;  1A2T A;  1MBY A;  2BCO A;  3SVM A;  3UE0 A;  2E2J B;  1LTG D;  3NTK A;  4Z9C B;  1X3P A;  2JSO A;  4P75 A;  4JW0 A;  2K5N A;  3HOY G;  1STB A;  1B7Y B;  1SYE A;  2K32 A;  2V4D A;  3MHB A;  1VQ7 A;  4BY1 H;  4H7B A;  4A3D G;  3BS1 A;  2JA7 H;  2PNH A;  2K5W A;  3MXU A;  1EZ6 A;  1L0W A;  2NWG A;  4L6T B;  1STG A;  1JWM D;  3A7A B;  3CC7 A;  4FNF A;  3DXJ C;  3TP5 A;  1T5E A;  1TY0 A;  5CV7 A;  5IYB G;  1TXY A;  5CV4 A;  1Z9F A;  5DM6 3;  2L11 A;  4IPC A;  2F0L A;  5KRU A;  1L1O C;  5JPN C;  4RGT A;  1VQC A;  3KLW A;  1TVX A;  2SNS A;  2WAQ E;  4K0K Q;  1TU2 B;  1M8A A;  2NZ1 D;  5ELO A;  3Q24 A;  3NQT A;  1V43 A;  4PMW A;  1N36 L;  3OYY A;  4DUZ Q;  1MJC A;  2F0O A;  2RBM A;  4A3I G;  1YJ9 A;  1BVS A;  1I5F A;  4B3M L;  2XSC A;  3LWU A;  2E2D C;  3TME A;  3K0X A;  4FXK C;  1EWC A;  2KUM A;  1SFO B;  2HDL A;  4BXX H;  3NWT A;  4G4K A;  1D5X C;  4FP5 D;  5H1S E;  3KUP A;  1XMO Q;  5C0X I;  4K5X A;  4R4T A;  1NSN S;  5FLM H;  3LWE A;  4DK6 C;  4DV7 L;  3PUW A;  3ONA B;  1O7I A;  4KN7 C;  2QA4 A;  4HJA A;  3A8K E;  4DR2 Q;  2D62 A;  3AU7 A;  2F0J A;  2RF4 A;  1CI3 M;  3IL8 A;  1C9O A;  1LLR D;  4OWX B;  1KD1 C;  3NE5 B;  5DAU A;  1HFG A;  2Q2U A;  2AUK A;  1D5Z C;  4H44 C;  4A3D B;  4A4I A;  1SNP A;  5CYU A;  3CCU A;  3A8I E;  1EWI A;  1N34 Q;  4HMI A;  4TQU S;  1IBL Q;  3PCO B;  1WTV A;  2R92 G;  3HOU H;  2JEB I;  3ND8 A;  1X6O A;  1XNQ L;  1VQM A;  2Z4I A;  2ZT9 C;  4RKB A;  1WD1 A;  3I70 A;  1XMQ Q;  4JI6 Q;  5GRO A;  2JA9 A;  3E5S A;  3V96 A;  1QNK A;  3TEH B;  1HQR D;  3NBH A;  3CKI B;  1E1O A;  1I3Q H;  2B2T C;  4JI7 L;  4B3T L;  2PZU A;  1HTP A;  2EXZ A;  2AHO B;  2R7Z G;  2MGS A;  2RHS B;  3HOX B;  1Y1W H;  4C3J G;  4IZ8 A;  3IFT A;  2F4I A;  2YV5 A;  3D4D A;  5M3M G;  2JA6 B;  4KD4 A;  5I2Y A;  2AQ1 B;  1ILP A;  1WOC A;  3MFG A;  4OWW B;  3M4Q A;  1F9R A;  1LTB D;  1M90 C;  5E4W C;  4GLV B;  4QQB X;  5FOB B;  4X62 Q;  1HNX Q;  4QL5 A;  1MGS A;  3FKI H;  4DV0 L;  2IHF A;  5KIX A;  5LL6 X;  3BZC A;  2XTI A;  2F0V A;  5CV9 A;  2D0O A;  2LY7 A;  2BDO A;  2VNU D;  3CC4 A;  1HR0 L;  4X3S A;  5J1Z A;  3J7A F;  4A3G H;  2UXC L;  4KY5 A;  1SR3 A;  1JC7 A;  1NMG A;  3QG1 A;  1RJT A;  1I4G A;  4JI3 L;  5C44 G;  4LF8 Q;  1EY0 A;  1CSQ A;  3DEO A;  5JPM C;  2CW0 D;  2K05 A;  4LFC Q;  1LTR D;  2L5T A;  2B2W C;  4DNI A;  3IFD A;  3EFX D;  1QWY A;  4JYA L;  1E0B A;  3Q8D A;  4X66 L;  1NE3 A;  2JA6 H;  1EFW A;  3PMF A;  3NEL A;  2K5H A;  3M9B A;  3GD7 A;  3OMG A;  3SK6 A;  3HOX H;  3C3L A;  1D1K A;  1EQR A;  1GM5 A;  4O2D A;  3VR6 A;  2OT2 A;  5G3L D;  1V9P A;  3CHB D;  1NTG A;  1R4P B;  3G6E A;  2F0K A;  3R2T A;  2K52 A;  4OHJ A;  5M5X B;  4FF2 A;  3CAM A;  4ZKC B;  3MXN A;  1PTO C;  4B08 A;  2QCP X;  1Y8N B;  1ZKO A;  2CQA A;  3KLS A;  2Q8I B;  5NUC A;  4B9W A;  3FPP A;  1E3P A;  5HGT A;  5M5X H;  2G9H D;  1HZB A;  2B8F A;  4RWS C;  1D5M C;  2EY2 A;  2E8G A;  4BY1 G;  3D4W A;  5AJ3 Q;  3GTL B;  4A3D H;  1OXX K;  3UDI A;  5I4D A;  2MNA A;  3CCV A;  3STB D;  5DM7 3;  2Z6K A;  1JB3 A;  2NZO A;  2RDH A;  3NTI A;  2C9O A;  1O7L A;  3BDC A;  1KL9 A;  3U4V A;  2ALY B;  1MJE A;  1FYC A;  1N9W A;  3UDG A;  4ZKB B;  2HCC A;  2LXK A;  2ZXP A;  1TWH H;  2WAQ B;  2Y0S G;  4KLK A;  1N33 L;  1Y69 U;  5C3W A;  3EQL C;  5COR A;  1IYU A;  1SXT A;  1ICW A;  3ER0 A;  4DR5 L;  1EQT A;  1EWH A;  2JN4 A;  3EN2 A;  2Z6B A;  4NXM L;  2HUG A;  2N8N A;  2E2H H;  4JI3 Q; 
#chains in the Genus database with same CATH homology
 1V1P B;  3DWP A;  4RCN A;  4CBV A;  3BDO A;  3M4Y A;  2KQ3 A;  1A3T A;  3SE0 A;  2GA4 B;  4HCS A;  1NCV A;  1L0X B;  2O4X A;  2AWN A;  2XRQ D;  1AZP A;  4IFD H;  2WKD A;  1I6H B;  2MPM A;  3NWS A;  3T56 B;  2KCN A;  4BA1 I;  5EPL A;  1TWF B;  3M4O B;  2CW0 C;  1DCZ A;  4BY1 B;  2RSN A;  4RHR A;  4ZAI A;  1DZ1 A;  1U4L A;  4IAL A;  1QIL A;  2BDN A;  1JR0 D;  2F1M A;  1OXS C;  4CKC A;  3D6C A;  3MC0 B;  1S4Z A;  4C3I B;  3HEJ A;  3SXH A;  3T16 A;  3EVQ A;  4L8J A;  1B2T A;  1SYG A;  3PUZ A;  3FRP B;  1AFP A;  3PIO 3;  4V0B A;  4KN4 C;  3NQI A;  2IX3 A;  4RAU C;  1ROD A;  2SEB D;  3H6M A;  3FVQ A;  1KNE A;  1DXM A;  4PV1 C;  1CHQ D;  4HSV A;  5FKA C;  1DOL A;  2NVQ B;  1UAP A;  4NKL A;  2LKV A;  4CKE A;  4X3U A;  2WV6 D;  1V8Q A;  4IFD G;  1GUT A;  1TKW B;  1BF4 A;  1MSG A;  4Q0F A;  3I91 A;  1KDB A;  4HED A;  3K6O A;  3I4M B;  3C1F A;  1ET9 A;  5M3M B;  1Q8I A;  1CT1 D;  2X6G A;  1AZQ A;  3HS0 C;  1CHP D;  4M8A A;  2Z4H A;  1GUO A;  2EJG C;  1DOK A;  4DAY A;  1H9S A;  5EBC A;  1HPC A;  3DWQ A;  2IX1 A;  2FMM A;  5EKL A;  1QNU A;  2M2L A;  2LMC B;  4EVO A;  5HUR A;  3HOW B;  1TII D;  1ET6 A;  5IGC A;  1TWG B;  5C44 B;  5COY A;  1HUN A;  4KJO A;  4X3T A;  4FXD A;  2L1B A;  2EYM A;  3QWN A;  1LV9 A;  2RA4 A;  2D9U A;  3HP3 A;  4BS9 A;  4JBW A;  4S3S A;  3ZYY X;  2WII B;  3TP7 A;  1HA5 A;  2XNA C;  5IIF A;  1B3A A;  1YNN D;  1STN A;  3M3Y B;  1GHJ A;  2ICE C;  1G6Z A;  3MAQ A;  1YNJ D;  2IW3 A;  4XT3 B;  1PRT C;  5D65 A;  4H0L C;  3GTJ B;  2VB2 X;  4U68 A;  1SNO A;  3VYR A;  1NAP A;  4LAA A;  2JP1 A;  3KLS X;  1QG7 A;  2B2U C;  2PZT A;  2NB0 A;  2G9D A;  5LL6 S;  1TS4 A;  4DAV A;  1STY A;  4E6I A;  5ELD A;  3J81 L;  1C4Q A;  1KTK A;  4ULL A;  4JK1 C;  4UDU C;  4GZY C;  3PV0 A;  1UEA B;  2RKS A;  2XN9 C;  4BBR B;  5I9P A;  1O80 A;  3NP8 A;  4J6H A;  1OXU A;  1BO0 A;  1TWH B;  1S5D D;  1GUS A;  5KYL A;  1CM9 A;  4IUV A;  5CC4 A;  1D1I A;  1ENA A;  3IAY A;  4PMC A;  5J22 A;  4B9X A;  5BN4 A;  3GV3 A;  5TSS A;  1ESF A;  4IUP A;  4LJZ C;  2EJM A;  4AYB B;  3GTK B;  4XDX A;  1JOK A;  3OWE B;  4XQN A;  3RZO B;  2PO4 A;  2MP1 A;  4IFD I;  2HCI A;  2D2C C;  2IT1 A;  3GTQ B;  1EOT A;  4NP5 A;  1QOH A;  4DNT B;  5LHY 1;  4MN3 A;  4J1M A;  1BBX C;  1HA6 A;  1SYB A;  3MTS A;  1GXD C;  3M85 A;  3UI2 A;  2H4O A;  1GUN A;  5T1I A;  3S15 B;  2NVY B;  1EY7 A;  4P2C B;  3AMU A;  1H9J A;  3S16 B;  1Q90 A;  1DON A;  2IJ0 A;  1G91 A;  1LTT D;  4XXE A;  4ZK9 B;  1QB5 D;  3C2P A;  4N9T A;  5C4X B;  5C5M A;  4EQP A;  5IGG A;  5D14 A;  1K8O A;  1HFN A;  1EY9 A;  4C3J B;  2A6H C;  2KHS A;  3P20 A;  3OWF A;  4CJ0 B;  1MD2 D;  2B2V C;  3P7J A;  3GTG B;  2WP8 J;  2NVX B;  4LK1 C;  3TN2 A;  1Q12 A;  1PXU A;  1TR5 A;  3D8G A;  2L12 A;  4ZLT F;  3HOU B;  1PLF A;  3TDQ A;  5C4Z A;  1V1P A;  5FK9 C;  3S2D B;  2R3Z A;  2A6E C;  2B2V A;  4I65 A;  2M00 A;  3SDZ A;  4WOR A;  4MIU A;  4KY7 A;  4F87 A;  3OHX C;  1QE6 A;  1JCK B;  3HOV B;  4IUU A;  4HN7 A;  4OIK A;  1JOQ A;  4QB4 A;  1UUP A;  1Y8P B;  5ELC A;  1HXY D;  1HUM A;  1WVL A;  1O78 A;  5C5L A;  1MSH A;  2EOT A;  2BE5 D;  4RGM A;  3T53 B;  5I6Y A;  2CHB D;  4XQJ A;  4QUC A;  3VA5 A;  3GTO B;  4Y7N B;  2PPB C;  3PO2 B;  1Z47 A;  4WRD A;  3OW7 A;  2J7Z A;  5C3E B;  1Q3L A;  3K5L A;  3I3C A;  4IUQ A;  1TS2 A;  3T51 B;  1EZ8 A;  4ME5 A;  1IKL A;  1I50 B;  3BZD B;  4ODG A;  4RCO A;  2QDB A;  1SNQ A;  2A5H A;  2F3V A;  1LTI D;  4RFB A;  1TWA B;  2NBF A;  3VA7 A;  2EYO A;  3OPO A;  2BE5 C;  1TT2 A;  4Q5V A;  3Q6S A;  1GUW A;  1F2L A;  3W2D A;  1U4P A;  4HR7 B;  3W3A A;  2A6H D;  2DY7 A;  4G7H C;  1PRT F;  2J4X A;  2B8G A;  1IL8 A;  5E1F A;  1IYV A;  1VMP A;  3NTH A;  1ZXT A;  1EU3 A;  1R4Q B;  2E76 C;  3J7Y W;  1H9R A;  1ML0 D;  2DNC A;  1LT6 D;  3I4L A;  1R9T B;  2N55 A;  2X69 A;  4KKU A;  3S17 B;  3VR5 A;  1TY2 A;  2JE6 I;  2QF7 A;  1VCI A;  3Q22 A;  3K58 A;  2FMC A;  3QOL A;  1MI2 A;  3R8B A;  4K5V A;  3HZX A;  4KK7 A;  1IW7 D;  3RMH A;  2F0U A;  1LAC A;  2R6G A;  5CV6 A;  1WTW A;  4BA2 I;  4NMZ A;  5M5Y B;  3DHQ A;  3I72 A;  2R93 B;  4DK1 A;  2XVS A;  2NTT A;  2L4N A;  1SE2 A;  5JAV A;  3DM1 A;  2A73 B;  3P75 A;  1DM0 B;  1HHV A;  2WAC A;  2Z8L A;  3HOZ B;  2F0P A;  3V2T A;  2O2L D;  4RGO S;  2K03 A;  2R61 A;  1VMC A;  4IQZ A;  2RDF A;  5C0X G;  1PFM A;  3MXG A;  4G7Z C;  4QIW B;  2FIN B;  4F8M A;  3DEP A;  4C56 C;  1EY8 A;  4NDX A;  4A93 B;  2NVT B;  1VF5 C;  3QO2 A;  2K7V A;  1S5B D;  2EDG A;  2E74 C;  1PFB A;  2EYF A;  3FEW X;  4OO1 H;  2OEO A;  4KD3 A;  1I4H A;  3TP8 A;  5C6A A;  5E4X A;  1RCV D;  5J39 A;  2TSS A;  2PCF B;  2NTS A;  2EE1 A;  3H0G B;  1WD0 A;  1SSO A;  1ILQ A;  1TS5 A;  3BVZ A;  3FDT A;  3NHH A;  4U67 3;  1EY5 A;  3K0Y A;  2BOS A;  4A3M B;  1IW7 C;  4HSP A;  5M5W B;  1KAB A;  1TQO A;  1STH A;  4RH6 A;  2ZXR A;  4K5W A;  1ONL A;  1II3 A;  1A3V A;  2DN8 A;  1HTL D;  2RVL A;  1G8Z D;  1E2W A;  1EYC A;  4K2K A;  3OIQ A;  4G57 A;  2J0T D;  2K1B A;  5ISR A;  5EJW A;  3RLF A;  5IGF A;  5C4J B;  2F0Q A;  2B2Y A;  3PUX A;  4IUN A;  2NN6 H;  4DA2 A;  1STA A;  3SK5 A;  3S1Q B;  2KJX A;  4OGQ C;  1SE4 A;  4RKL A;  4M1U B;  3SR1 A;  3ITP A;  5KNB A;  1FNV A;  2FFK B;  4N9P A;  3S14 B;  1PZJ D;  5CBE E;  1RD9 D;  1W6J A;  1PMR A;  4FXG C;  4ZRZ A;  1SYD A;  3VR3 A;  2XRS D;  4EQO A;  3X3N A;  1EY6 A;  4CJ1 B;  1NR2 A;  1CA6 A;  4L63 B;  4PNY A;  3QOJ A;  2K5Q A;  2NN6 I;  1WTX A;  4FYD A;  3MWY W;  1F9S A;  1DJR D;  3RZD B;  2A69 D;  2VB3 X;  3DWA A;  4DFA A;  2PW5 A;  4XTC S;  2AQ3 B;  5BN3 A;  5IT9 E;  3URY A;  5I9O A;  3MXP A;  2AWO A;  2EY5 A;  4A3J B;  1HCZ A;  3EJI A;  5IGB A;  3TZD A;  1B9N A;  4KHV A;  3U9S A;  4IFD J;  2ZXO A;  3EA6 A;  4A3E B;  2KEE A;  5D3D A;  1O7Z A;  1G29 1;  1EIH A;  3M7G A;  2AUJ D;  4BWG B;  1FNW A;  3VR4 A;  1F9P A;  1G2S A;  5A35 A;  2WKC A;  4KHZ A;  1W6K A;  4ID6 A;  3WOF A;  3KBX A;  1GHK A;  3SK4 A;  2N88 A;  3HG9 A;  2NUC A;  5DEH A;  3LX0 A;  4WFN 3;  1B1Z A;  2EZV A;  4KY6 A;  3J7A V;  4FF4 A;  1F2Z A;  1IHZ A;  4C3H B;  1SYC A;  1J8I A;  2O5I C;  5DNF A;  2XWB B;  3L9A X;  3GQB A;  4HCE A;  1ENC A;  5CBA E;  1D6E C;  1PTO B;  3AB9 A;  5EKI A;  4CJ2 C;  1RDP D;  5KEE A;  1SNM A;  3QJY A;  3PO3 B;  3JAM L;  1C48 A;  1Y1W B;  1YNJ C;  4V19 0;  3J81 E;  4C1N I;  1T5X D;  5JEA H;  1XTC D;  3SHL A;  4R8I A;  2EYJ A;  2B2W A;  1KLU D;  1B44 D;  2K5D A;  4F7X A;  5EKK A;  3MFY A;  3D6W A;  1YNN C;  3HRZ C;  2F0I A;  4QF4 A;  5E3F A;  2H1E A;  5T1G A;  4XIG S;  3R93 A;  2L55 A;  3JAM E;  5JJZ A;  5A2Q E;  1QJO A;  2A74 C;  1PTO H;  3GP7 A;  3CQZ B;  2EYH A;  2DY8 A;  4I7Z C;  5JEA J;  4KV6 A;  1KDC A;  4KKS A;  3OMC A;  5M3F B;  2NN6 G;  1CTM A;  1BR9 A;  1O7Y A;  1PZK D;  2F0T A;  3A56 A;  1I4X A;  4DK0 A;  2MHV A;  3N6R A;  3U9O A;  2L0C A;  1TS3 A;  4DU9 A;  4XQQ A;  1B9M A;  3T13 A;  3FKI B;  1AW7 A;  5FO8 B;  2HDM A;  1EYA A;  3K59 A;  4HAE A;  4ABN A;  1K83 B;  1XYI A;  3WDN A;  3D4R A;  1V1O A;  1Q1B A;  2WB1 B;  2PYK A;  1S5E D;  1BCP B;  2K04 A;  1RF2 D;  5F2D A;  5C3X A;  3HKZ B;  3K5M A;  4A3K B;  5ELF A;  4PMB A;  1SMY D;  1CA5 A;  3V05 A;  1RTO A;  1ZEQ X;  4FO2 A;  5KGU A;  2IL8 A;  3L7Z C;  4KJN A;  2K01 A;  4XYO A;  1K8M A;  3H3V C;  1EL0 A;  2Q8T A;  3KK7 A;  2A68 D;  3HGB A;  4A3F B;  3NSW A;  3SEB A;  3QB3 A;  3A54 A;  1LTS D;  5EPK A;  2F0N A;  2KVM A;  4EQN A;  4BY7 B;  2PMZ B;  2JXM B;  3D3R A;  3BVM A;  1CFM A;  3TP6 A;  1QCB D;  2F3W A;  2EYP A;  4QMG A;  2RQX A;  3I90 A;  4HMJ A;  2OXP A;  3VR2 A;  1WCM B;  5FO9 B;  3I8Z A;  2CVR A;  2F0F A;  1B50 A;  3GO5 A;  1RHP A;  3OOC A;  1BXT A;  2VUM B;  1F9Q A;  2K6A A;  5C4H A;  1M4V A;  1I4Q A;  1A2U A;  4F88 A;  1C8C A;  1ZYR C;  1A15 A;  4KMU C;  2SNM A;  3O13 A;  5ELE A;  5AFW A;  4O1N A;  1S5F D;  1A6X A;  3CRL C;  2JA7 B;  1GOZ A;  2JA8 B;  3I4N B;  4YIJ A;  1PDQ A;  5JEA G;  4DN4 M;  1BQQ T;  2KED A;  2VXW A;  3BYY B;  3BG3 A;  1BDO A;  2R92 B;  5JVH 3;  1I4R A;  5FLX L;  2A6E D;  1BCP D;  1F2M A;  2F0E A;  2D5D A;  2EY1 A;  4FVM A;  4CHT B;  1SYF A;  4LMQ D;  3SK8 A;  5G3L F;  1F2Y A;  1H9K A;  1G2T A;  4J8Q A;  1RTN A;  3KBG A;  4A3B B;  2E2I B;  2F0S A;  1DYQ A;  4O42 A;  2QIL A;  1J9O A;  2FHT A;  2R7Z B;  1JQY D;  1EU4 A;  2KOL A;  4UAI A;  3QIA A;  3NUC A;  2M9V A;  2K33 A;  1SBB B;  4G7O C;  4X3K A;  4K8J A;  1X32 A;  3NBI A;  3TBI B;  5C0X J;  1PTO D;  2RSO A;  3OIP A;  1ZYR D;  1D2B A;  5IGE A;  4BBS B;  2SDF A;  1SJE D;  3R2I A;  3MA2 B;  2A69 C;  2PZW A;  1CQV A;  1EFI D;  1H9M A;  3CRK C;  1JIC A;  3K7A B;  3DMU A;  3GTM B;  4R9W A;  4H13 C;  1XXG A;  1KLG D;  1DD2 A;  2F03 A;  1Y1V B;  4DXF A;  2E2H B;  1ESR A;  1CZW A;  2ID0 A;  1S5C D;  4FF1 A;  3BYT B;  2NYZ D;  2BA1 A;  1U4M A;  1PFN A;  3NXW A;  3ND9 A;  1HQM C;  2YU9 B;  4TSS A;  2JEA I;  3KLR A;  1BCP C;  5EPJ A;  3E0J A;  5CV8 A;  3TZU A;  5K36 H;  3KF8 A;  4K2L A;  2IWH A;  3WOE A;  1I6V C;  3FPU B;  3BDL A;  4K6D A;  2B63 B;  4DAP A;  3FMC A;  5EBD A;  3N52 A;  1LT4 D;  3Q23 A;  3X3M A;  2AQ2 B;  2K28 A;  3NK9 A;  4IUR A;  2HQE A;  4RHS A;  3VYS A;  2PQE A;  2MJ8 A;  1ENF A;  5EQ0 A;  1AP0 A;  2F0M A;  4QUF A;  3MVV A;  2B2U A;  1XWE A;  1LT5 D;  4TKO B;  1PYW D;  5KND A;  3K5O A;  4ZYS A;  5CV5 A;  2A68 C;  4C3H G;  2PW7 A;  2DNE A;  1U4R A;  4ZUI A;  3S1N B;  2E75 C;  1SE3 A;  3T4A C;  2EVB A;  3H91 A;  4C2M B;  1CZG A;  2PNR C;  1WTP A;  3G6J B;  5A2Q L;  1CK1 A;  2TMP A;  1E2V A;  1VDZ A;  2KCC A;  2L9H A;  3A7L A;  2MUY A;  1B53 A;  3A8J E;  3S1M B;  1F77 A;  1EIG A;  4XYQ A;  4C3I G;  2LFN A;  4IN3 A;  3H09 A;  3S1R B;  1SND A;  1AEX A;  3S9W A;  1GUG A;  3E6Z X;  4DNR B;  3VYU A;  3GTP B;  1I3Q B;  1HRJ A;  4KI0 A;  1OXT A;  4HTH A;  1BOS A;  4DGZ A;  1H9S B;  5EGT A;  2XIW A;  3LNN A;  1AN8 A;  2KEC A;  5ELB A;  3OSO A;  3K5N A;  1X3Q A;  3PUV A;  1EYD A;  5D3I B;  1GJX A;  2FJ2 A;  4C1N K;  4CKB A;  2RDG A;  3F2U A;  1SEB D;  2C5C A;  2QKI C;  1KNA A;  5I6W A;  5IGD A;  2B2Y C;  1OO9 B;  3ERQ A;  1OXV A;  1IKM A;  3J80 E;  2X6L A;  2EPB A;  1FNU A;  4WJW A;  2F0H A;  3RD4 A;  4RGN A;  1JWU D;  4ZUJ A;  4A3G B;  1RKN A;  3D31 A;  1WTR A;  2Q8R E;  3P1H A;  2IX0 A;  4PQX A;  1NR4 A;  1EEI D;  5CR3 A;  1FD7 D;  2F0D A;  2QEJ C;  1Z7T A;  5IOC A;  4MHE A;  4OO1 I;  2O5J C;  1B4O A;  3C1E A;  5K36 G;  1BNZ A;  1PRT B;  4FF3 A;  4EGV A;  1CQF A;  3K57 A;  1LTA D;  1EEF D;  1SNC A;  1Y8O B;  3MEH A;  3H94 A;  4ILW A;  3HOY B;  4OL7 A;  3GV6 A;  5BN5 A;  3PIP 3;  1BUV T;  5IT9 L;  5M9O A;  1LO5 D;  3MZ5 A;  3ERO A;  2SOB A;  5CMD A;  2IPK D;  1KAA A;  1SMY C;  3IKJ A;  4KTA A;  3A55 A;  4A3I B;  2ENB A;  1PRT D;  4K14 A;  5KNC A;  1FR3 A;  2Y0S B;  1E2Z A;  5FLX E;  1I4P A;  3J80 L;  2I46 A;  5K5P A;  1UNS A;  4TRD A;  1STE A;  1WTQ A;  2LS0 1;  3DUZ A;  4RA8 A;  1SAP A;  2Z1C A;  3Q0A A;  2BA0 A;  2JYO A;  4DF7 A;  4XT1 B;  3CU7 A;  1U9R A;  1L0Y B;  1EQV A;  5CGK A;  1EY4 A;  1DOM A;  2KA7 A;  1Q1E A;  5KYI A;  1PTO F;  3RUZ A;  1JOR A;  3NPP A;  2YYZ A;  1LT3 D;  5FO7 B;  1JWS D;  3BVG A;  2I07 B;  2ICI A;  1LAB A;  2XWJ B;  5IOD A;  3M7N A;  1FGB D;  4K6L A;  2B2T A;  4OIJ A;  1XX8 A;  4ZQ3 A;  2F0W A;  1BCP F;  1A3U A;  2WIN B;  1JOO A;  2EY6 A;  4K8I A;  5C0X H;  2EJF C;  3PUY A;  1JE4 A;  1KDA A;  5JOB A;  3L3O C;  3C46 A;  4R8N A;  1TWC B;  5I2X A;  4CGY B;  4IUT A;  1NUC A;  3S2H B;  3VYT A;  2F0G A;  4DXG A;  4OO1 G;  3G7L A;  2JA5 B;  1Z6H A;  3I73 A;  2B39 A;  1WTO A;  4NW2 A;  1VF7 A;  3R3O A;  4QCL A;  2EYL A;  2OF1 A;  1SDF A;  5JVG 3;  1PZI D;  1SJH D;  4KKT A;  3TSS A;  1A2T A;  1MBY A;  2BCO A;  3SVM A;  2E2J B;  1LTG D;  3NTK A;  4Z9C B;  1X3P A;  2JSO A;  1STB A;  1SYE A;  2V4D A;  2K32 A;  3MHB A;  4H7B A;  3BS1 A;  2K5W A;  3MXU A;  1EZ6 A;  2NWG A;  4L6T B;  1STG A;  1JWM D;  3A7A B;  3TP5 A;  3DXJ C;  4FNF A;  1T5E A;  1TY0 A;  5CV7 A;  5CV4 A;  5DM6 3;  2L11 A;  2F0L A;  5KRU A;  5JPN C;  4RGT A;  1TVX A;  2SNS A;  1TU2 B;  1M8A A;  2NZ1 D;  3Q24 A;  3NQT A;  1V43 A;  4PMW A;  2F0O A;  2RBM A;  2XSC A;  3LWU A;  2E2D C;  3TME A;  4FXK C;  1EWC A;  2KUM A;  1SFO B;  2HDL A;  3NWT A;  4G4K A;  1D5X C;  4FP5 D;  3KUP A;  5C0X I;  4K5X A;  1NSN S;  3LWE A;  3PUW A;  3ONA B;  4KN7 C;  3A8K E;  2D62 A;  3AU7 A;  2F0J A;  1CI3 M;  3IL8 A;  1LLR D;  3NE5 B;  5DAU A;  1HFG A;  2AUK A;  1D5Z C;  4H44 C;  4A3D B;  1SNP A;  5CYU A;  3A8I E;  4HMI A;  4TQU S;  1WTV A;  2JEB I;  3ND8 A;  2Z4I A;  2ZT9 C;  4RKB A;  1WD1 A;  3I70 A;  3E5S A;  3V96 A;  1QNK A;  1HQR D;  3NBH A;  3CKI B;  2B2T C;  2PZU A;  1HTP A;  2EXZ A;  2MGS A;  3HOX B;  4C3J G;  4IZ8 A;  3IFT A;  2F4I A;  3D4D A;  2JA6 B;  4KD4 A;  5I2Y A;  2AQ1 B;  1ILP A;  3MFG A;  1F9R A;  1LTB D;  5E4W C;  5FOB B;  1MGS A;  5KIX A;  5LL6 X;  2F0V A;  5CV9 A;  2LY7 A;  2BDO A;  2VNU D;  4X3S A;  5J1Z A;  3J7A F;  4KY5 A;  1JC7 A;  3QG1 A;  1RJT A;  1I4G A;  1EY0 A;  3DEO A;  5JPM C;  2CW0 D;  2K05 A;  1LTR D;  2L5T A;  2B2W C;  3IFD A;  3EFX D;  1QWY A;  1E0B A;  3PMF A;  3GD7 A;  3OMG A;  3SK6 A;  3C3L A;  1D1K A;  3VR6 A;  2OT2 A;  5G3L D;  3CHB D;  1R4P B;  2F0K A;  3R2T A;  4OHJ A;  5M5X B;  4FF2 A;  4ZKC B;  3MXN A;  1PTO C;  4B08 A;  2QCP X;  1Y8N B;  1ZKO A;  2CQA A;  3KLS A;  4B9W A;  5NUC A;  2Q8I B;  3FPP A;  5HGT A;  2G9H D;  2B8F A;  4RWS C;  1D5M C;  2EY2 A;  3D4W A;  3GTL B;  1OXX K;  5I4D A;  5DM7 3;  1JB3 A;  2RDH A;  3NTI A;  2C9O A;  1O7L A;  3BDC A;  1FYC A;  4ZKB B;  2HCC A;  2ZXP A;  2WAQ B;  1Y69 U;  5C3W A;  3EQL C;  5COR A;  1IYU A;  1SXT A;  1ICW A;  1EQT A;  1EWH A;  2HUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...