3AB9A

Crystal structure of lipoylated e. coli h-protein (reduced form)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
127
structure length
126
Chain Sequence
NVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine cleavage system H protein
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 37
structure length 126
sequence length 127
ec nomenclature
pdb deposition date 2009-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ab9A00
2IT1A 3OPOA 4LK1C 1IW7C 4XTCS 3HGBA 2B8GA 5C0XG 1SMYC 1B9NA 5C0XH 2JXMB 3PUXA 3A8IE 3A7LA 4IFDG 3N6RA 1TKWB 1H9SB 3D31A 3OOCA 5KNDA 2EJMA 2DNCA 3I4LA 1H9JA 3PV0A 1VF5C 2A69D 1GUOA 2A6EC 3LNNA 3EQLC 3VR2A 2KA7A 2BE5C 3A7AB 3GD7A 2EJGC 4TKOB 3PUVA 1Z7TA 2F1MA 1Q90A 4G7ZC 3A8KE 2A68D 1DCZA 3PUYA 4H13C 5A35A 5KNBA 2D2CC 1H9SA 1ZKOA 2BA1A 1H9KA 2EVBA 2JEBI 3VR3A 3VR4A 3D4RA 3KLRA 4GZYC 4BA1I 1GUGA 3M7NA 5K36H 3QIAA 3SE0A 4DNRB 1OXUA 1OXSC 3W3AA 4KMUC 4RCNA 4LJZC 4H44C 1ZYRC 1BDOA 4DK1A 1GHKA 3AB9A 3M4YA 1LACA 3U9SA 1CI3M 1E2ZA 3WDNA 1YNNC 5KNCA 4IFDH 2AUKA 3I72A 3QJYA 2E76C 3ND9A 4OO1G 1OXVA 3A8JE 2D62A 3ND8A 1G291 1IYUA 1Z6HA 1GUTA 3PUWA 2A69C 2L5TA 3M85A 2A6HC 2AWOA 2R6GA 1PMRA 2NN6G 4I7ZC 2NN6H 1Q1EA 3CRLC 3VR6A 1IYVA 3OW7A 4TQUS 2O5JC 2LMCB 1H9MA 1H9RA 4KHZA 3DXJC 1Y8OB 5JEAG 2E74C 2BA0A 4G7OC 3MFYA 2Q8IB 1TU2B 3T56B 3BG3A 1DD2A 1YNJC 1E2VA 2B8FA 3GQBA 1GUNA 2K7VA 2CW0C 1B9MA 2DN8A 1HQMC 1O7LA 1VCIA 2A6ED 2D5DA 1CFMA 4G7HC 2JEAI 2BE5D 1E2WA 1T5EA 3TZUA 3NE5B 2EDGA 4OGQC 1VF7A 3IKJA 4OO1H 1K8OA 4KKSA 5BN4A 1LABA 4KKUA 1FR3A 1V43A 4KN4C 3VA7A 3BDOA 2NN6I 2BDOA 1VDZA 2EJFC 2KCCA 2JE6I 4JBWA 1I6VC 4XIGS 1A6XA 3IFTA 1DXMA 2K33A 5BN5A 2A68C 1GUSA 1HCZA 1IW7D 1FYCA 3T51B 2PCFB 1K8MA 3H94A 1ONLA 4IQZA 4DNTB 5JEAH 1GJXA 2ZT9C 2YYZA 1GHJA 2PPBC 1OXTA 4KN7C 4DK0A 2K32A 4KI0A 1HPCA 3CRKC 1OXXK 1CTMA 1HTPA 1Q12A 1V8QA 3LWUA 3SDZA 2PNRC 3P20A 3L7ZC 3FMCA 3PUZA 2AUJD 2QF7A 4JK1C 2V4DA 2A6HD 3I73A 1EWHA 3QG1A 3VR5A 5BN3A 1Y8PB 1Y8NB 4KKTA 3RLFA 2DNEA 2O5IC 1Q1BA 3MXUA 3T53B 1QJOA 4HR7B 3FPPA 5K36G 1O78A 1Y69U 4PV1C 4L8JA 2E75C 4H0LC 4BA2I
chains in the Genus database with same CATH superfamily
1LM0A 2QEXA 1QNUA 5IGCA 4JV5L 3MZ5A 4A3FH 1WCMH 4LFCL 4DR7Q 3N6RA 1H9SB 3K7UC 1D7QA 3RZDB 3PO3H 3S24A 1BCPF 4R4OA 1SBBB 2J4XA 1Q90A 1WTQA 2EVBA 5CV7A 1L0XB 4ZUIA 3M7NA 4KY7A 2PW7A 1CA6A 1U9RA 1GO3E 4RCNA 1J8IA 1BDOA 5J3BA 1WD1A 5IYCH 1RKNA 4IFDI 1JWMD 3C1FA 1CI3M 4LUVA 4B08A 3Q22A 4DR3L 3V2TA 1G51A 2F0MA 4CKBA 4A3FB 2R7ZH 1WCMB 1MIUA 4LWCA 1N9WA 2WACA 1NR2A 2NBFA 3BVZA 2MUYA 3PO3B 2L15A 4XT1B 3DLLA 2AHOB 4HIDA 3TEHB 4X66L 3E6ZX 5DM73 1X56A 2M9VA 2K75A 5GADC 1CSPA 3HOZG 1JB7A 3GTPH 2DY7A 1PHJA 1V1QA 5IT9E 5IGBA 1TWCH 2IX1A 1L0YB 2KCMA 4HN7A 4C3JG 2RDGA 1CQFA 4B3SQ 1GVPA 1LABA 4DUYL 4KKUA 1M90C 3GTOH 1VMPA 1VQLA 2R7ZB 4A3GG 1EY4A 4JBWA 2ZTEA 2C5CA 3OMCA 1XNRL 2V1CC 1BCPC 3G71A 1KNEA 3FKIH 2QCPX 2XWJB 3W1GA 3J7ZC 2B63H 5M5XH 1EY6A 2EXDA 1C8CA 1UAPA 3HOVH 1HNWQ 1SYDA 3MXGA 1MSGA 3GTPB 1YZ6A 2QF7A 3W1BA 3M9BA 1TWCB 1S3OA 3K0XA 1I94Q 1QE6A 1RDPD 2F0DA 3T53B 4IPGA 3CQZH 4O1NA 2ZJRA 2JA5G 2EPBA 3DXJC 3GTKH 4A3IG 2R92H 3GTOB 2FJ2A 2R93G 4XTCS 3NBHA 3HGBA 2L4NA 5C0XH 3NXWA 4HCEA 1I4PA 3NSWA 3FKIB 3H3VH 4L5TA 3OW2A 4IO9A 1VF5C 1KC8C 2B63B 2B2WC 5M5XB 3PO3G 2LXKA 1F2LA 4DV2Q 3HOVB 3E3XA 4H7BA 1SR3A 2D2CC 2JEBI 2BA1A 1JOQA 3BJUA 5FLXc 3M7GA 4LF5L 4K2KA 3BDCA 3ZYYX 1R9TH 4PNYA 1PH6A 2UUCL 3S1MH 3CQZB 5IYCG 2ES2A 3QO2A 3GTKB 2R92B 1I6HH 3KBXA 2K52A 2KHJA 1RL2A 1PTOF 1IYUA 1V1OA 1X6OA 4CJ2C 2QEJC 5M3FG 5JVH3 5C4XH 1LLRD 2R6GA 3JAMc 2D0OA 4A3DG 3OW7A 1FNWA 3P1HA 5I9PA 4OL7A 2Q2UA 3VYUA 2Q8IB 4X64Q 4M1UB 4YCWA 1HQRD 4NXMQ 2FFKB 4WRDA 1R9TB 1MBYA 1VQKA 3S1MB 2IHEA 4UP7A 4JI2Q 3TZDA 2EXZA 4CKCA 1Z47A 4DUZQ 1KNAA 1WD0A 3I4MG 5BN4A 1ASZA 5FKAC 4XYOA 1I6HB 2OF1A 4HTHA 5C5LA 4JI8Q 2VS1A 1K9MC 2RKSA 4A3LH 1HFGA 4DR7L 4ILWA 4DXGA 1G91A 1EIGA 2Y0SE 3FKIG 5C4XB 1ONLA 4CGYB 1LTID 1SNMA 1TT2A 1D5MC 2B63G 3HOWH 1GHJA 2PPBC 5D14A 4FNFA 4R4TA 1VQ4A 4RGTA 3WWVA 3LWUA 2I46A 2HUGA 4RGOS 3NPPA 3M4PA 4ME3A 2XGTA 4C3HH 4BBSH 4LF4Q 2M00A 4JI5Q 2WAQG 2K04A 3RLFA 3ULJA 4B3RQ 3X3MA 1LTAD 1A63A 2KEEA 1KDBA 5IE8A 1PTOC 1HA5A 5FLXE 2IWHA 3PSIA 2VB2X 1ENFA 3CW2C 4EX5A 4LFAQ 5C0XG 4QY7A 5J39A 1VQDA 4A3CH 3A7LA 1EWCA 1RODA 2KEDA 3D31A 3ULLA 1HJPA 2EJMA 4TVAB 3SK5A 3V96A 3HOWB 2FMCA 3LNNA 3IL8A 1A3UA 1VQEA 2XRSD 4KJOA 1A8VA 4G7ZC 4P74A 4IALA 4F7XA 5KNBA 3JAME 4C3HB 4BBSB 1PXUA 1BCPD 3CAMA 1N32Q 3D6WA 3SE0A 2AQ2B 3W3AA 1XPRA 4B9XA 2F0LA 4B3SL 2F03A 3A56A 5GROA 4QUFA 1WTOA 3NHHA 4KY6A 5CV6A 1PA6A 1HNXQ 3FEWX 3T1HQ 5IODA 4JI4Q 1PH1A 1KDCA 4XQJA 2UXCQ 3UE0A 1V9PA 2QILA 1SYBA 5E4XA 2WB1E 1O7YA 3L9AX 1VQGA 1HNWL 5C44H 4X65Q 3VYTA 4JI7Q 1PFBA 2G9HD 3IRBA 1UUPA 1G6PA 1E3PA 1I4HA 4G4KA 4DR6Q 1ENCA 1QVGA 1GUNA 4OEMB 3ITPA 3PIO3 1O7LA 1I94L 5IOCA 3OHXC 1CKMA 1E2WA 1VQ8A 3NE5B 2EDGA 1VQMA 4JVZA 1FGBD 1VF7A 3D4WA 3R2IA 3D6CA 5M5WH 1EYDA 2RCNA 2FHTA 3J80c 1WTWA 2NN6I 5E1FA 4A3LG 4HJ5A 2ZTDA 2K33A 1HR0W 3OTOQ 2HIXA 3I4NH 4GKKQ 4IUNA 1AP0A 4IJLA 5ELOA 4DV2L 4P75A 5C44B 4FYDA 1HPCA 2A1AA 3CCQA 3EN2A 3NENA 3PUZA 4JK1C 2UXBQ 1IKMA 4R4QA 1O80A 4ID6A 1GD7A 1LTSD 2J0TD 3D8GA 4DGZA 3STBC 2VNUD 4FXKC 2PZWA 1QJOA 4A3MG 4IUQA 1Y69U 5M5WB 4QCLA 2KCNA 2TSSA 5DEHA 4K14A 1WTPA 5H1SE 1JOOA 4GS3A 1HTLD 3PUXA 4IPHA 1N33Q 3K0YA 3I4NB 1A3TA 1UE1A 1TKWB 1Y1VH 5CV8A 1QG7A 3CC7A 5GAEC 4AH6A 2DNCA 3PV0A 2VQFQ 1SNCA 3DWQA 4WJWA 3I55A 4IOCA 3EQLC 4KV6A 2Q2TA 2JN4A 2N55A 4X64L 1U0LA 1XPUA 3ERSX 3I4OA 1A2TA 4GZYC 4NXML 4MZ9A 1QVCA 3NTKA 4JI2L 2RHQB 1VQCA 4J15A 4LJZC 4DUZL 1WVLA 2VQEQ 1BBUA 2RVLA 4V0BA 4JI8L 2YTVA 3CKIB 4OO1G 2I0QA 4JOIC 3DMUA 1Y1VB 2GN5A 3J80E 1MI2A 2EYFA 4F87A 2AWOA 1PTOD 1SFOH 4FXDA 1PMRA 3VR6A 3CRLC 4JC0A 3BU2A 3PIP3 2ICEC 1DD2A 4LF4L 3TDQA 4JI5L 1U4PA 4B3RL 5CV9A 1CM9A 5IYDH 4DXFA 3IKJA 3L2PA 3PMFA 4X62Q 2PI2E 1FR3A 4AYBG 2Q2HA 1TY2A 1AZQA 3ONAB 3BDOA 4LFAL 4K5XA 5DM63 4DAPA 4XIGS 2PZUA 4I65A 4DA2A 5DNFA 1DXMA 1DOLA 1FL0A 1B8AA 2IHFA 3H3VC 4QMGA 1F9PA 1PZKD 4C1NK 1X3EA 4P71A 4PZ7A 2F0FA 4JCVE 4C56C 2AUJD 3GTLH 1EWHA 1N32L 4HJAA 4CDEC 4DV5Q 4A3JG 5M3MG 3I56A 3K81C 3MXUA 4J8QA 5GQOA 5LL6S 1EFWA 4JI3Q 1HNXL 4X6AH 1MGSA 3T1HL 2RDHA 5C3WA 1A0IA 1HZCA 4JI4L 3HKZB 5T1GA 4A4IA 2IX0A 4YCUA 1VQPA 4IFDG 2UXCL 4X3KA 4PG3A 1SN8A 3DEOA 1SNOA 3VYSA 4BS9A 2A69D 1GUOA 4X65L 3CCVA 4JI7L 2EIFA 3TMEA 4H13C 2B2TC 4H02A 3GTLB 4QJFA 4DR6L 2RA4A 2PZTA 1SEBD 1F9RA 4MNOA 5KRUA 1PH2A 5AJ3Q 3J7A5 2GVBA 2J7ZA 1D1IA 2DUDA 5CYUA 2WV6D 4Q5VA 1YJ9A 3B6YA 4K0KQ 4LUZA 4RGMA 3AFQA 3OTOL 3PUWA 3STBD 4GKKL 5I2YA 4DAMA 1XTCD 4GLXA 3HOYH 3J81j 2K28A 5ELNA 2F0PA 2HCCA 1K73C 3BDLA 4WFN3 1I4QA 2B39A 1IYVA 2G9DA 1MKHA 1Q3LA 2F0JA 2PMZB 3HG9A 4DNIA 1XMQQ 1TS5A 3J7AF 1E0BA 2EYOA 2OTLA 1F9QA 5KGUA 2AQ1B 2UXBL 1SJHD 2K6AA 5C0XJ 2L11A 2PQEA 4HIOA 2LFNA 1QB5D 5LMNW 4IUPA 2GA4B 3W2DA 1EZ6A 1LTTD 3HKZG 1A6XA 2JE6I 1Q86C 1N33L 2KUMA 2ID0A 1LTGD 3V05A 3HOYB 3CCEA 4KJNA 4DV6Q 3TRZA 1VQJA 1KAAA 2VQFL 2NZOA 2JP1A 3HOZH 4QIWB 3RUZA 5EKKA 2WKCA 3D0FA 4NXNQ 2UUBQ 3J81c 4RKLA 1KRTA 1HTPA 3KDFB 2PNRC 3L0OA 3RR5A 3T1YQ 3NWTA 1L2FA 2R7FA 3DHQA 3VR5A 1JJ2A 4RGNA 5IGFA 3WOFA 3ZJYC 1SE4A 3FVQA 2KBNA 2VQEL 4A3GH 4QGUA 2F0HA 2PO4A 1GOZA 2TMPA 3Q24A 1O7IA 3PGZA 2QA4A 4JPBW 4FF1A 4ZAIA 1E1TA 4QUCA 2DGYA 1DYQA 1JC7A 3HOZB 1D6EC 2XSCA 2A6EC 4JI6Q 2L12A 1NSNS 4TSSA 4WORA 3PUVA 2X69A 5FO7B 2KCTA 2B2TA 3TQYA 2HDLA 4A3KG 2JA5H 1YNJD 4HJ8A 4A3IH 4KMUC 1K83H 2LY7A 2R93H 3S1NH 4A3GB 4X62L 4E6IA 2RCFA 2DY8A 5C4HA 1LYLA 4ZKBB 3TP6A 1MJCA 3S17H 1A15A 4LF6Q 1PYBA 1SNQA 3ULPA 1W2BA 3HOYG 2RBMA 4DF7A 4Y7NH 1YJWA 3I3CA 3H15A 1XX8A 2F0QA 5C3XA 2NN6H 2B2VA 4FF4A 2P5ZX 1HFNA 1K3RA 4BXXG 3OYYA 3MXNA 4OXPA 1NR4A 1B3AA 3DEPA 2MP1A 3J81E 2K7VA 3GTQH 4DV5L 2JA5B 5FK9C 4A3IB 1K83B 2OWOA 1AE3A 3G7LA 2R93B 3S1NB 4HMIA 3J7AV 4KKSA 3E9HA 4JI3L 1PH9A 4BBRH 4NMZA 1SYGA 3AQQA 5M3FH 1G8ZD 3S17B 1SDFA 5J1ZA 2DJFC 5C3EH 2NTTA 2XN9C 2D9UA 1SXTA 2A68C 4A3DH 4Y7NB 3T51B 3GV6A 1KL9A 2PCFB 4DNTB 4ZKCB 4CKEA 1WYDA 3NQIA 4KI0A 5IP9G 4RMFA 1CTMA 1STBA 3P20A 1UEBA 3L7ZC 5CORA 1KD1C 3CPFA 3K6OA 1E7ZA 4DN4M 5CR3A 3GTQB 1NTGA 3I4MH 2DNEA 4R1JA 5AJ3L 3UDIA 1J9OA 1CHQD 4HR7B 2K5WA 1NJIC 4K0KL 5CMDA 4BBRB 3J80i 2AQ3B 1RCVD 2PQAA 5M3FB 1YIJA 2JA7G 1G6ZA 1I4RA 5C3EB 1SNPA 4A3DB 3QOLA 2MGSA 2Z9HA 5TSSA 5LHY1 4K6DA 2LS01 1XWEA 1G2TA 4ULLA 4DAVA 1XMQL 1QOHA 1GXDC 2EYMA 2KA7A 2KOLA 3S1QH 4ALPA 1Q8IA 5A35A 1PH3A 2KHIA 5JJIA 3MHBA 4K8IA 2EYHA 2FMMA 3RD4A 1PRTB 4BA1I 3I4MB 2KHSA 3P75A 3Q8DA 1RD9D 2ZM6Q 3E9IA 1IYJB 4XXEA 3PCOB 4UY8C 3MEFA 1SNDA 1E2ZA 2F3VA 1YNNC 3T13A 2EQSA 3K8AA 4DR4Q 2OTJA 1CZWA 3I72A 4KLKA 1VQ7A 4DV6L 3UDGA 5I6WA 4CDFC 2Q8RE 2NN6G 1DZ1A 3O13A 4NXNL 1T5XD 2UUBL 2DJGC 4FXGC 4P72A 1IBKQ 3S1QB 1UWVA 2WAQB 3KYHC 3T1YL 1C0AA 3MFYA 1TWHH 2B8FA 3SHLA 2KVMA 2L9HA 4IFDJ 2CW0C 1TWAH 2A6ED 3M3YH 2EOTA 4ME5A 4S3SA 4B3MQ 3PF4A 1I50H 4FDBA 4R4IA 1PH8A 1UNSA 3A74A 3KJPA 4BBRG 1DOMA 1X3PA 1X54A 4P73A 2C9OA 1PH5A 2EJFC 2KCCA 5C3EG 4WJ4A 4RH6A 1AFPA 2HD3A 4LMQD 2GVAA 1K8MA 4IQZA 3F2DA 3MFGA 4JI6L 5C5MA 1SE3A 1CQVA 3CRKC 2HHHQ 1B70B 5F2DA 2K05A 1TWHB 2WIIB 1F2MA 1KQSA 2EY1A 1NCVA 1TWAB 3M3YB 4I7AA 2HQLA 2F0EA 1I50B 1O7ZA 5LMUQ 5K36G 1ENAA 4NP5A 4L8JA 1W6KA 2F0WA 5I4DA 2F4VQ 4RHRA 1WTRA 2JYOA 1U5KA 4PZ8A 3RLOA 4LF6L 1IL2A 1EL0A 1CA5A 4N9TA 3Q6SA 2QGQA 3SGIA 4LF8Q 2BE5C 2LSSA 1LT3D 3F2UA 2A19A 2A68D 5FJ8H 1QVFA 1LV9A 2MPMA 3KLRA 4A3MH 5HGQA 3QIAA 3K7AH 3U4ZA 3NTIA 1PDQA 1STGA 2BH8A 3WDNA 1HHVA 3KF6B 4YWKA 3F1ZA 3CCSA 3F8TA 1ZXTA 2Q2IA 4O2DA 1J5EQ 3CC4A 5CBAE 4YHHQ 1QWYA 3R3OA 3MXNB 2YTXA 3VYRA 1D1KA 1Q1EA 4DK6C 2NTSA 1H9MA 4OELB 1YITA 1HH2P 1X32A 1SMXA 2N49A 3D3RA 4RHSA 1SROA 4HAEA 1SE8A 2OQKA 3TP7A 5EPLA 4A3MB 3U50C 3OWEB 5C4JH 3EVQA 3HOUH 3K7AB 3G4SA 4ZK9B 1U4LA 1M1KC 3GP7A 1STAA 2IJ0A 3I90A 4C2MH 1T9HA 2ATWA 4OO1H 3D4DA 2MHVA 1SAPA 1PV4A 3SK4A 1KLUD 5IT9L 2F3WA 1HNZQ 3F2CA 2Q8TA 1GUSA 2N78A 1M8AA 3H0GH 1BF4A 5EKIA 1EEID 3K5OA 3K5NA 1YNND 3AU7A 4KN7C 4A3BB 3CHBD 2YTYA 3TS0A 1KIXA 1Q12A 1FVIA 1EY9A 3BZKA 3TREA 1C9OA 2PNHA 3DWAA 2ENBA 4C3IG 1RJTA 2X6GA 5C4JB 1CKOA 2PQAB 4XT3B 5I9OA 4A3EG 2ZM6L 3HOUB 2O5IC 3CCRA 4C2MB 1D5XC 1C7YA 3P7JA 1NMGA 1PRTF 5E4WC 4V190 4DR4L 2IT1A 3A0JA 4JBMA 1BBXC 2CW0D 2EY6A 4LK1C 1B50A 1K8AC 2CFMA 1DM0B 4DR2Q 2UU9Q 3CC2A 1BBWA 3H0GB 2F0IA 2N88A 3SK8A 1HUNA 2JA8H 3J81i 2F0KA 1IBKL 1FJGQ 5ELDA 3UI2A 1Z7TA 2F1MA 3H91A 5FJ8G 2CH4A 4A3JH 4FF2A 1ZEQX 5M3MH 2F0GA 3KDFA 3CCJA 4KK7A 1UEAB 4AYBB 2UUAQ 1S4ZA 2ICIA 4B3ML 1QZHA 3C3LA 1YHBA 5EPJA 4BY7G 1XXGA 5KNCA 4IFDH 1QUQA 1TWGB 5COYA 2E5LQ 3ND9A 5JVG3 3A8JE 3FHWA 1YHAA 5C4ZA 4DV3Q 1G291 2SEBD 3IFDA 4YWMA 4RWSC 5FLMG 1JQYD 2JA8B 3UE1A 1E24A 4LAAA 2HQEA 1PYWD 4JI0Q 4A3BG 2HHHL 5JEAG 2CVRA 4AQYQ 4A3JB 3KK7A 2NVQB 5M3MB 2IL8A 3I91A 1JR0D 1U4RA 3HOUG 3H6MA 2XIWA 2HDMA 1PRTC 1HZBA 3CMAA 2BE5D 3NWSA 4DK3C 5LMUL 1OTCA 3NK9A 2F4VL 4DAYB 1I5FA 4JI1Q 4MN3A 1IHZA 4CHTB 5A2QE 4IUUA 3H09A 5KYLA 1JMCA 3BZCA 5BN5A 3W5OA 3H0GG 1JB3A 2FINB 1QILA 2F0OA 5JJZA 4IN3A 2I5HA 3DWPA 4LF8L 1STHA 2BH2A 2KECA 4O42A 3J7YW 1OXXK 4RAUC 2E2DC 3FMCA 1WTHA 2AMCB 1Y1WG 3MAQA 1ICWA 1I3QH 4DFAA 5DLQE 1E22A 2LKVA 1I4XA 3CCMA 1QZGA 3ER0A 3SXHA 3GTJH 1EOVA 3E0EA 2HCIA 2ZTCA 1NUCA 3AFPA 4BA2I 1E1OA 2VW9A 1XTDA 2F0SA 1IW7C 1EEFD 1J5EL 2B3GA 1LTLA 3A8IE 3NP8A 2ASBA 4YHHL 2X6LA 2H1EA 5FLXL 2JA8G 3C46A 1XPOA 1BCPB 2IX3A 3A7AB 1EU4A 1EIYB 3ERQA 2H4OA 4OWXB 1LT5D 1KXLA 4F8MA 1I3QB 1WFQA 1S5CD 4FF3A 1RF2D 3VA5A 1F2ZA 5EKLA 3GTJB 4GN3B 5EGTA 1HA6A 3JAML 1II3A 2BCOA 2MJ8A 2N8NA 3AEVA 3MXPA 4B3TQ 4N8FA 1HNZL 4UPAA 5K5PA 1YEZA 1TY0A 5J22A 4XYQA 1TXYA 1N8RC 3LWEA 1W3SA 5EAYA 4I7ZC 1VQAA 5D65A 1WTXA 1EYCA 4IJHA 1YBYA 2XRQD 1JJCB 4DV1Q 3C2PA 2NB0A 4A3KH 4AIMA 3EROA 5AFWA 3HEJA 2VXWA 1SYEA 4QF4A 3HOXB 2WAQE 2LXJA 1VQ9A 3TZUA 4DR5Q 5KEEA 3S15H 4JW0A 4PZ6A 1D5ZC 3KBGA 2K5DA 1CK1A 2Z0SA 2B2VC 4DR2L 2JQOA 3EBEA 2UU9L 1ESRA 4UP9A 1HXYD 2XNAC 1MSHA 3RMHA 1IBMQ 2FXQA 1DJRD 4NKLA 4POFA 4BXXH 1NBWA 2ZT9C 3E0JA 1FJGL 1S5ED 3DM1A 4OHJA 2YU9H 1EIFA 3Q23A 1QNKA 3KLSA 4A3KB 2A5HA 3I73A 2MNAA 1PZJD 2Z6KA 2NZHA 2I07B 2VUMH 1YHQA 2UUAL 4RCOA 3N52A 4HMJA 3S15B 4CJ0B 1B7YB 4KD3A 1S5BD 4K6LA 2B2YA 3HP3A 3SEBA 3ICEA 1B3QA 2E5LL 1G2SA 1PTOH 4DV3L 1PRTD 1TS3A 2Y0SG 4LW1A 1C4QA 3UDXA 3I7FA 5IP9H 2WB1B 1KHIA 3BZDB 4JI0L 3MVVA 4Z9CB 3K57A 2K50A 2OT2A 2YU9B 4GN4B 3PF5A 3NELA 4AQYL 1DCZA 3PUYA 1Q7YC 4GOPA 2E2JH 4RKBA 4WJ3M 2VUMB 1DONA 1QUQB 3TSSA 4DR1Q 3C1EA 3HOXG 2JA7H 4H44C 1H95A 3G6EA 4DK1A 4JI1L 3M4YA 1L1OA 4HEDA 1PTOB 1WOCA 2IY5B 2Z4IA 4CDCC 2A8VA 5D3IB 1HR0Q 2A74C 4GKJQ 5CBEE 3AMUA 1WI5A 2IPKD 4NB3A 1XNQQ 2B2UA 2MFIA 3J80L 3BG3A 3M4QA 1JE4A 2HIVA 3CMEA 2E2JB 2XVSA 4LFBQ 2ZXPA 2JA9A 5IT9c 3CF5A 2KENA 4KY5A 3DUZA 4PMWA 4B9WA 1T5EA 3CU7A 4MIUA 2JA7B 4OIJA 1D8LA 3QOJA 4IOAA 4A93H 4YCVA 1CUKA 4FP5D 3KF6A 2RSNA 3EIVA 3IAYA 1X3GA 2WB1G 2CQOA 1KDAA 1LUZA 3HFZB 3S1RH 4MTKA 4DPGA 3BVMA 1Y8NB 4KHVA 2VUMG 2CH4W 5JJKA 4IPDA 1ICFB 4K2LA 4GLAC 1N36Q 1X65A 2WP8J 5JEAJ 1VQNA 4YIJA 4A93B 4B3TL 2SOBA 3U58A 4RG1A 1XMOQ 3SK6A 2CQAA 4PMCA 4LF7Q 5IY0A 1UE5A 3OOCA 5KNDA 1N34Q 3KLWA 1B44D 5IP7G 2NVXH 1STYA 4OIKA 1R4QB 2JA6H 1R4PB 1ML0D 1ILQA 4KD4A 1LTRD 3S1RB 4DV1L 1RTNA 3A8KE 3OIPA 5ELFA 4DV4Q 1KTKA 4ZQ3A 1GUGA 5IYBG 5EBDA 3LX0A 2UXDQ 2OQ0A 5K36H 1LO5D 4DNRB 1CZGA 4DR5L 5GAHC 5KYIA 3MC0B 1JE5A 1UE7A 4IURA 1SYCA 1LACA 4IZ8A 2F4IA 2WINB 1STEA 4AYBE 2E76C 5HGTA 3NQTA 3A5UA 3VDYA 1GUTA 4K8JA 1IBML 2Z8LA 3M85A 4NW2A 4PQXA 1PVOA 1EQRA 2JA6B 1K3BC 2NVXB 4HIMA 4TQUS 1QCBD 4KHPQ 4ZRZA 4FO2A 2E74C 3BYTB 3T56B 3KJOA 1AW7A 4UAIA 1GM5A 3S14H 1S72A 3KLSX 4G7HC 4HIKA 3KUPA 2M2LA 1PZID 3CXCA 4OGQC 1EUJA 3AYHB 3KFUA 5BR8Q 3T16A 1EY0A 2VY3A 4KN4C 4A93G 1TQOA 1P8LA 4EVOA 3IFTA 1BNZA 1HCZA 1FYCA 1EY8A 1SYFA 5ELCA 3KF8A 1ET6A 5IGDA 2EY2A 4A3FG 2HT1A 1WCMG 4LUOA 3HKSA 2ZXRA 1CKNB 3OWFA 4ZUJA 2Z1CA 3SDZA 1HRJA 1JWUD 1IZ6A 2KQ3A 3S2HH 1Q8KA 3QG1A 1FGUA 1F2YA 5BN3A 1Y8PB 1A62A 3S14B 4DR1L 4HSPA 1PFMA 4GNXB 3U9OA 1BO0A 3I70A 5ELEA 4R4CA 4DAYA 1X3QA 1SMYC 1B9NA 1X9NA 4ZYSA 4PMBA 1TS2A 1HR0L 3Q0AA 2L0CA 4GKJL 4GOPB 1GKHA 2R7ZG 3R8BA 2SNMA 2JA6G 4HSVA 4A76A 1XNQL 1STNA 4C3IH 4TKOB 1BOSA 4X3SA 5ISRA 1B2TA 4A3EH 4OX9Q 1PFNA 2Z4HA 3S2HB 3VR3A 1ZKOA 4A75A 4LFBL 3A55A 3K5MA 1L1OB 1HZ9A 3PIOA 1A2UA 1YVCA 1OXUA 4ODGA 1MD2D 3MWYW 4J1MA 3PQIA 4LNQA 3AB9A 4IUVA 3G6JB 1K0SA 2E8GA 5LMNQ 1XYIA 3RZOH 1TS4A 5JPNC 4IPCA 3URYA 5L37A 2ZJPA 1Z6HA 3HKZE 1KRSA 1IBLQ 1LT6D 4L6TB 1EY7A 5FO9B 3M4OH 5JPMC 2VB3X 4C3IB 4XDXA 1IL8A 4A3EB 3K80C 3BVGA 1CT1D 1JICA 1E2VA 1VQ5A 3NBIA 3HOVG 3SVMA 5GAGC 2CKZB 1FNUA 4R8NA 4BY7H 5JAVA 1CSQA 3TP8A 2AKWB 4NDXA 1EYGA 5T1IA 1N36L 2MQHA 5FO8B 3RZOB 5IWAQ 3J81L 2K5VA 4O0AA 2F0UA 1XMOL 4U673 1V1PA 3K59A 3TS2A 2QDBA 5FLMH 2NVTH 5FOBB 1CHPD 1I6VC 2E2IH 4LF7L 2R92G 4TRDA 4A3BH 1N34L 3RLNA 1UE6A 5JEAH 3M4OB 2D0PA 1EQTA 5EPKA 2R7DA 2PMZE 2QW7A 4EQOA 1HUMA 5D3DA 4DV4L 2B2WA 4KKTA 3CP0A 2UXDL 1JCKB 4BY7B 3X3NA 2K01A 4CDDC 4G57A 1BXTA 4DV7Q 1K8GA 3EJIA 4YY3Q 5NUCA 1AZPA 3OSOA 1D2BA 2E75C 1HZAA 4K5WA 2I5MX 2I5LX 2NVTB 1NNXA 1EZ8A 2B8GA 2E2IB 2NWGA 4C1NI 4CJ1B 3GDEA 1K28A 1AH9A 5EJWA 2NYZD 1J6QA 2VZAA 2F52A 3I4LA 1H9JA 3VR2A 4KHPL 5CC4A 1Y1WH 4QIWE 5JOBA 1BVSA 3GD7A 3PIPA 2EJGC 1W6JA 5C4XG 1PLFA 2Z6BA 1FD7D 1SSOA 3KOJA 2L1BA 2SDFA 3QR8A 1P16A 3EFXD 3D4RA 2F0NA 2RQXA 3BS1A 5IGGA 4U68A 4OONA 4GLVB 2F0TA 2K5QA 3FRPB 3FPUB 3K58A 5HURA 1TWGH 1ZYRC 5BR8L 3TN2A 2IW3A 4LF9Q 1ET9A 4DV0Q 2AUKA 4L5QA 2JJQA 3QJYA 3E5SA 1OO9B 1VQIA 3NUCA 1X3FA 2QDLA 5M5YH 2A69C 2KJXA 1EFID 1NY4A 1Z9FA 1JWSD 3RN2A 2NVQH 1EQVA 3FDTA 1B1ZA 5ELBA 1Y1WB 2O5JC 2O2LD 1H9RA 2K5NA 4HJ7A 1Y8OB 1SMYD 2A73B 2BA0A 3HOWG 4G7OC 1TU2B 3NTHA 2VL6A 4Y52H 4BY1H 2JSOA 4NPSA 2DN8A 5E7NA 1VCIA 4XQQA 3MTSA 1BUVT 4C3HG 4BBSG 2CCZA 4M8AA 5I2XA 1K8OA 3KF8B 3NBHB 5KIXA 1V43A 2QKIC 3VA7A 2RF4A 4JYAQ 4K5VA 2XWBB 1YJNA 1EQQA 1RTOA 1VDZA 5M5YB 4L63B 3S16H 4X3TA 3H94A 1GJXA 4DU9A 1EWIA 4GN5A 1JT8A 5G3LF 4A3CG 2F0VA 3L3OC 1DOKA 5IGEA 2N3SA 2F3IA 1V8QA 4OX9L 3CCLA 4BY1B 1PFSA 4JBKA 4L5RC 4UDUC 1Y14B 1MJEA 5M9OA 3DM3A 4OWWB 4CBVA 4F88A 2G5DA 3LGJA 4RFBA 5LMNL 1S40A 4Q0FA 2RDFA 4H0LC 3R93A 2SNSA 2PYKA 2ALYB 3OPOA 2BDNA 4JBJA 4L5SA 1ESFA 1PYSB 4P2CB 3T4AC 1SRUA 4R8IA 1Q81C 1NMFA 3S16B 1IBLL 4ZCKA 1A3VA 5E3FA 4APVA 2Z6KC 2B29A 1NE3A 1H9SA 5C44G 2RHSB 4MTNA 1WJJA 4FVMA 2B2YC 3CCUA 2EY5A 4KTAA 1XJVA 4UP8A 4OWTB 3A5ZB 5C0XI 5C6AA 4R9WA 3TP5A 4GNXC 5IWAL 3H3VI 3CPWA 2RSOA 4JV5Q 2MO1A 2D62A 3ND8A 4LFCQ 3WOEA 2BOSA 2L5TA 3JC66 1SLJA 2A6HC 1GUWA 4N9PA 1LT4D 4GOPC 1AEXA 3TBIB 3I4NG 1PH4A 4KHZA 1SFOB 1BQQT 4EQPA 1JJGA 3I2ZA 3OMGA 1C48A 3HOXH 1SE2A 1S5FD 1YNJC 1VQ6A 4BY1G 3GO5A 4QL5A 1B9MA 1HQMC 1V1PB 4YWLA 1CFMA 3OIQA 4DV7L 1L1OC 1TR5A 2OCEA 1RIPA 2K5HA 2NZ1D 4YY3L 3HZXA 2R61A 3I8ZA 1EOTA 2ZXOA 2Y0SB 1YI2A 4DR3Q 2PI2A 4X3UA 3GTMH 1MHWC 2BDOA 3G48A 3GTGH 4POGA 2K03A 3GV3A 3FP9A 1VS0A 2B2UC 1ZYRD 1SJED 2CWPA 3QB3A 5CV4A 5IIFA 2K14A 1OXTA 1Y1VG 1JORA 1Q46A 1KLGD 4X66Q 3PO2H 1EU3A 1FNVA 3RNUA 2WKDA 4N8X1 1IKLA 1S5DD 3U4VA 2E2HH 1EY5A 4QB4A 2CWAA 4BWGB 2JK8A 4PV1C 5EBCA 4LF9L 2AWNA 5LL6X 4DV0L 4DUYQ 2NVYH 3GTMB 1TIID 5HY6A 5CV5A 1TWFH 5I6YA 1YNXA 2OEOA 3GTGB 2JXMB 1XNRQ 1WTVA 4EQNA 1JOKA 3EA6A 2OXPA 2WFWA 2EZVA 1ILPA 4UHVA 1RHPA 2R3ZA 2CHBD 4JOIA 5CGKA 3PO2B 3S9WA 1CKNA 1I4GA 2NUCA 2EYLA 4IUTA 1M4VA 2XTIA 1H9KA 1EYAA 3VR4A 4EQ5A 1X55A 5JJLA 3NEMA 2E2HB 3MA2B 2PW5A 1OXSC 1TVXA 1NAPA 4QQBX 4HJ9A 2L55A 1GHKA 5DAUA 3U9SA 1B4OA 4JYAL 2NVYB 4DKAC 1VQFA 5IYDG 4GNXA 1AN8A 2O4XA 2EE1A 2H5XA 1TWFB 1OXVA 1PH7A 1L0WA 3QWNA 5IP7H 1KAWA 1U4MA 3R2TA 1B53A 1IXRA 4RA8A 4EGVA 3RN5A 3HRZC 2LMCB 1ASYA 1VQHA 4HCSA 5IYBH 3JAMi 1F77A 3HS0C 1VQBA 3A54A 4MHEA 3GQBA 3S2DH 2D5DA 4LF5Q 1BR9A 2JEAI 1VMCA 2UUCQ 4OO1I 4C3JH 3BYYB 1EIHA 4JG2A 2MO0A 3CD6A 4ZLTF 4J6HA 1AE2A 2ZJQA 4ABNA 1IW7D 2C35B 1VQOA 3RZDH 2EYJA 5A2QL 2YYZA 2EYPA 3MEHA 4DK0A 2K32A 1F9SA 3PO2G 5EQ0A 3F2BA 1BKBA 3K5LA 5G3LD 2K4KA 2V4DA 2A6HD 2YV5A 1KABA 3S2DB 1K0RA 1DGSA 1Q1BA 4XQNA 3UDFA 4C3JB 3FPPA 1LTBD 1O78A 2K1BA 3SR1A 1Q82C
chains in the Genus database with same CATH topology
1QNUA 5IGCA 3MZ5A 3N6RA 1H9SB 3RZDB 1BCPF 1SBBB 2J4XA 1Q90A 1WTQA 2EVBA 5CV7A 1L0XB 4ZUIA 3M7NA 4KY7A 2PW7A 1CA6A 1U9RA 4RCNA 1J8IA 1BDOA 1WD1A 1RKNA 4IFDI 1JWMD 3C1FA 1CI3M 4B08A 3Q22A 3V2TA 2F0MA 4CKBA 4A3FB 1WCMB 2WACA 1NR2A 2NBFA 3BVZA 2MUYA 3PO3B 4XT1B 5DM73 3E6ZX 2M9VA 2DY7A 5IT9E 5IGBA 2IX1A 1L0YB 4HN7A 4C3JG 2RDGA 1CQFA 1LABA 4KKUA 1VMPA 2R7ZB 1EY4A 4JBWA 2C5CA 3OMCA 1BCPC 1KNEA 2QCPX 2XWJB 1EY6A 1C8CA 1UAPA 1SYDA 3MXGA 1MSGA 3GTPB 2QF7A 1TWCB 1QE6A 1RDPD 2F0DA 3T53B 4O1NA 2EPBA 3DXJC 3GTOB 2FJ2A 4XTCS 3NBHA 3HGBA 2L4NA 5C0XH 3NXWA 4HCEA 1I4PA 3NSWA 3FKIB 1VF5C 2B63B 2B2WC 5M5XB 1F2LA 3HOVB 4H7BA 2D2CC 2JEBI 2BA1A 1JOQA 3M7GA 4K2KA 3BDCA 3ZYYX 4PNYA 3CQZB 3QO2A 3GTKB 2R92B 3KBXA 1PTOF 1IYUA 1V1OA 4CJ2C 2QEJC 5JVH3 1LLRD 2R6GA 3OW7A 1FNWA 3P1HA 5I9PA 4OL7A 3VYUA 2Q8IB 4M1UB 1HQRD 2FFKB 4WRDA 1R9TB 1MBYA 3S1MB 3TZDA 2EXZA 4CKCA 1Z47A 1KNAA 1WD0A 5BN4A 5FKAC 4XYOA 1I6HB 2OF1A 4HTHA 5C5LA 2RKSA 1HFGA 4ILWA 4DXGA 1G91A 1EIGA 5C4XB 1ONLA 4CGYB 1LTID 1SNMA 1TT2A 1D5MC 1GHJA 2PPBC 5D14A 4FNFA 4RGTA 3LWUA 2I46A 2HUGA 4RGOS 3NPPA 2M00A 2K04A 3RLFA 3X3MA 1LTAD 2KEEA 1KDBA 1PTOC 1HA5A 5FLXE 2IWHA 2VB2X 1ENFA 5C0XG 5J39A 3A7LA 1EWCA 1RODA 2KEDA 3D31A 2EJMA 3SK5A 3V96A 3HOWB 2FMCA 3LNNA 3IL8A 1A3UA 2XRSD 4KJOA 4G7ZC 4IALA 4F7XA 5KNBA 3JAME 4C3HB 4BBSB 1PXUA 1BCPD 3D6WA 3SE0A 2AQ2B 3W3AA 4B9XA 2F0LA 2F03A 3A56A 4QUFA 1WTOA 3NHHA 4KY6A 5CV6A 3FEWX 5IODA 1KDCA 4XQJA 2QILA 1SYBA 5E4XA 1O7YA 3L9AX 3VYTA 1PFBA 2G9HD 1UUPA 1I4HA 4G4KA 1ENCA 1GUNA 3ITPA 3PIO3 1O7LA 5IOCA 3OHXC 1E2WA 3NE5B 2EDGA 1FGBD 1VF7A 3D4WA 3R2IA 3D6CA 1EYDA 2FHTA 1WTWA 2NN6I 5E1FA 2K33A 4IUNA 1AP0A 5C44B 4FYDA 1HPCA 3PUZA 4JK1C 1IKMA 1O80A 4ID6A 1LTSD 3D8GA 2J0TD 4DGZA 2VNUD 4FXKC 2PZWA 1QJOA 4IUQA 1Y69U 5M5WB 4QCLA 2KCNA 2TSSA 5DEHA 4K14A 1WTPA 1JOOA 1HTLD 3PUXA 3K0YA 3I4NB 1A3TA 1TKWB 5CV8A 1QG7A 2DNCA 3PV0A 1SNCA 3DWQA 4WJWA 3EQLC 4KV6A 2N55A 1A2TA 4GZYC 3NTKA 4LJZC 1WVLA 2RVLA 4V0BA 3CKIB 4OO1G 3DMUA 1Y1VB 3J80E 1MI2A 2EYFA 4F87A 2AWOA 1PTOD 4FXDA 1PMRA 3VR6A 3CRLC 3PIP3 2ICEC 1DD2A 3TDQA 1U4PA 5CV9A 1CM9A 4DXFA 3IKJA 3PMFA 1FR3A 1TY2A 1AZQA 3ONAB 3BDOA 4K5XA 5DM63 4DAPA 4XIGS 2PZUA 4I65A 4DA2A 5DNFA 1DXMA 1DOLA 3H3VC 4QMGA 1F9PA 1PZKD 4C1NK 2F0FA 4C56C 2AUJD 1EWHA 3MXUA 4J8QA 5LL6S 1MGSA 2RDHA 5C3WA 3HKZB 5T1GA 2IX0A 4IFDG 4X3KA 3DEOA 1SNOA 3VYSA 4BS9A 2A69D 1GUOA 3TMEA 4H13C 2B2TC 3GTLB 2RA4A 2PZTA 1SEBD 1F9RA 5KRUA 2J7ZA 1D1IA 5CYUA 2WV6D 4Q5VA 4RGMA 3PUWA 5I2YA 1XTCD 2K28A 2F0PA 2HCCA 3BDLA 4WFN3 1I4QA 2B39A 1IYVA 2G9DA 1Q3LA 3HG9A 2F0JA 2PMZB 1TS5A 3J7AF 1E0BA 2EYOA 1F9QA 5KGUA 2AQ1B 1SJHD 2K6AA 5C0XJ 2L11A 2PQEA 2LFNA 1QB5D 4IUPA 2GA4B 3W2DA 1EZ6A 1LTTD 1A6XA 2JE6I 2KUMA 2ID0A 1LTGD 3V05A 3HOYB 4KJNA 1KAAA 2JP1A 4QIWB 3RUZA 5EKKA 2WKCA 4RKLA 1HTPA 2PNRC 3NWTA 3DHQA 3VR5A 4RGNA 5IGFA 3WOFA 1SE4A 3FVQA 2F0HA 2PO4A 1GOZA 2TMPA 3Q24A 4FF1A 4ZAIA 4QUCA 1DYQA 1JC7A 3HOZB 1D6EC 2XSCA 2A6EC 2L12A 1NSNS 4TSSA 4WORA 3PUVA 2X69A 5FO7B 2B2TA 2HDLA 1YNJD 4KMUC 2LY7A 4A3GB 4E6IA 2DY8A 5C4HA 4ZKBB 3TP6A 1A15A 1SNQA 2RBMA 4DF7A 3I3CA 1XX8A 2F0QA 5C3XA 2NN6H 2B2VA 4FF4A 1HFNA 3MXNA 1NR4A 1B3AA 3DEPA 2MP1A 3J81E 2K7VA 2JA5B 5FK9C 4A3IB 1K83B 3G7LA 2R93B 3S1NB 4HMIA 3J7AV 4KKSA 4NMZA 1SYGA 1G8ZD 3S17B 1SDFA 5J1ZA 2NTTA 2XN9C 2D9UA 1SXTA 2A68C 4Y7NB 3T51B 3GV6A 2PCFB 4DNTB 4ZKCB 4CKEA 3NQIA 4KI0A 1CTMA 1STBA 3P20A 3L7ZC 5CORA 3K6OA 4DN4M 5CR3A 3GTQB 2DNEA 1J9OA 1CHQD 4HR7B 2K5WA 5CMDA 4BBRB 2AQ3B 1RCVD 5M3FB 1G6ZA 1I4RA 5C3EB 1SNPA 4A3DB 3QOLA 2MGSA 5TSSA 5LHY1 4K6DA 2LS01 1XWEA 1G2TA 4ULLA 4DAVA 1QOHA 1GXDC 2EYMA 2KA7A 2KOLA 1Q8IA 5A35A 3MHBA 4K8IA 2EYHA 2FMMA 3RD4A 1PRTB 4BA1I 3I4MB 2KHSA 3P75A 1RD9D 4XXEA 1SNDA 1E2ZA 2F3VA 1YNNC 3T13A 1CZWA 3I72A 5I6WA 2Q8RE 2NN6G 1DZ1A 3O13A 1T5XD 4FXGC 3S1QB 2WAQB 3MFYA 2B8FA 3SHLA 2KVMA 2L9HA 4IFDJ 2CW0C 2A6ED 2EOTA 4ME5A 4S3SA 1UNSA 1DOMA 1X3PA 2C9OA 2EJFC 2KCCA 4RH6A 1AFPA 4LMQD 1K8MA 4IQZA 3MFGA 5C5MA 1SE3A 1CQVA 3CRKC 5F2DA 2K05A 1TWHB 2WIIB 1F2MA 2EY1A 1NCVA 1TWAB 3M3YB 2F0EA 1I50B 1O7ZA 5K36G 1ENAA 4NP5A 4L8JA 1W6KA 2F0WA 5I4DA 4RHRA 1WTRA 2JYOA 1EL0A 1CA5A 4N9TA 3Q6SA 2BE5C 1LT3D 3F2UA 2A68D 1LV9A 2MPMA 3KLRA 3QIAA 3NTIA 1PDQA 1STGA 3WDNA 1HHVA 1ZXTA 5CBAE 1QWYA 3R3OA 3VYRA 1D1KA 1Q1EA 2NTSA 1H9MA 1X32A 4RHSA 3D3RA 4HAEA 3TP7A 5EPLA 4A3MB 3OWEB 3EVQA 3K7AB 4ZK9B 1U4LA 3GP7A 1STAA 2IJ0A 3I90A 4OO1H 3D4DA 2MHVA 1SAPA 3SK4A 1KLUD 5IT9L 2F3WA 2Q8TA 1GUSA 1M8AA 1BF4A 5EKIA 1EEID 3K5OA 3K5NA 1YNND 3AU7A 4KN7C 4A3BB 3CHBD 1Q12A 1EY9A 3DWAA 2ENBA 4C3IG 1RJTA 2X6GA 5C4JB 3HOUB 4XT3B 5I9OA 2O5IC 4C2MB 1D5XC 3P7JA 1PRTF 5E4WC 4V190 2IT1A 1BBXC 2CW0D 2EY6A 4LK1C 1B50A 1DM0B 3H0GB 2F0IA 2N88A 3SK8A 1HUNA 2F0KA 5ELDA 3UI2A 1Z7TA 2F1MA 3H91A 4FF2A 1ZEQX 2F0GA 4KK7A 1UEAB 4AYBB 1S4ZA 2ICIA 3C3LA 5EPJA 1XXGA 5KNCA 4IFDH 1TWGB 5COYA 3ND9A 5JVG3 3A8JE 5C4ZA 1G291 2SEBD 3IFDA 4RWSC 1JQYD 2JA8B 4LAAA 2HQEA 1PYWD 5JEAG 2CVRA 4A3JB 3KK7A 2NVQB 5M3MB 2IL8A 3I91A 1JR0D 1U4RA 3H6MA 2XIWA 2HDMA 1PRTC 2BE5D 3NWSA 3NK9A 4MN3A 1IHZA 4CHTB 5A2QE 4IUUA 3H09A 5KYLA 5BN5A 1JB3A 2FINB 1QILA 2F0OA 5JJZA 4IN3A 3DWPA 1STHA 2KECA 4O42A 3J7YW 1OXXK 4RAUC 2E2DC 3FMCA 3MAQA 1ICWA 4DFAA 2LKVA 1I4XA 3SXHA 2HCIA 1NUCA 4BA2I 2F0SA 1IW7C 1EEFD 3A8IE 3NP8A 2X6LA 2H1EA 5FLXL 3C46A 1BCPB 2IX3A 3A7AB 1EU4A 3ERQA 2H4OA 1LT5D 4F8MA 1I3QB 1S5CD 4FF3A 1RF2D 3VA5A 1F2ZA 5EKLA 3GTJB 5EGTA 1HA6A 3JAML 1II3A 2BCOA 2MJ8A 3MXPA 5K5PA 1TY0A 5J22A 4XYQA 3LWEA 4I7ZC 5D65A 1WTXA 1EYCA 2XRQD 3C2PA 2NB0A 3EROA 5AFWA 3HEJA 2VXWA 1SYEA 4QF4A 3HOXB 3TZUA 5KEEA 1D5ZC 3KBGA 2K5DA 1CK1A 2B2VC 1ESRA 1HXYD 2XNAC 1MSHA 3RMHA 4NKLA 1DJRD 2ZT9C 3E0JA 1S5ED 3DM1A 4OHJA 3Q23A 1QNKA 3KLSA 4A3KB 2A5HA 3I73A 1PZJD 2I07B 4RCOA 3N52A 4HMJA 3S15B 4CJ0B 4KD3A 1S5BD 4K6LA 2B2YA 3HP3A 3SEBA 1G2SA 1PTOH 1PRTD 1TS3A 1C4QA 2WB1B 3BZDB 3MVVA 4Z9CB 3K57A 2OT2A 2YU9B 1DCZA 3PUYA 4RKBA 2VUMB 1DONA 3TSSA 3C1EA 4H44C 4DK1A 3M4YA 4HEDA 1PTOB 2Z4IA 5D3IB 2A74C 5CBEE 3AMUA 2IPKD 2B2UA 3J80L 3BG3A 1JE4A 2E2JB 2XVSA 2ZXPA 4KY5A 3DUZA 4PMWA 4B9WA 1T5EA 3CU7A 4MIUA 2JA7B 4OIJA 3QOJA 4FP5D 2RSNA 3IAYA 1KDAA 3BVMA 1Y8NB 4KHVA 4K2LA 2WP8J 5JEAJ 4YIJA 4A93B 2SOBA 3SK6A 2CQAA 4PMCA 3OOCA 5KNDA 1B44D 1STYA 4OIKA 1R4QB 1R4PB 1ML0D 1ILQA 4KD4A 1LTRD 3S1RB 1RTNA 3A8KE 3OIPA 5ELFA 1KTKA 4ZQ3A 1GUGA 5K36H 5EBDA 3LX0A 1LO5D 4DNRB 1CZGA 5KYIA 3MC0B 4IURA 1SYCA 1LACA 4IZ8A 2F4IA 2WINB 1STEA 2E76C 5HGTA 3NQTA 1GUTA 4K8JA 2Z8LA 3M85A 4NW2A 4PQXA 2JA6B 2NVXB 4TQUS 1QCBD 4ZRZA 4FO2A 2E74C 3BYTB 3T56B 1AW7A 4UAIA 3KLSX 4G7HC 3KUPA 2M2LA 1PZID 4OGQC 3T16A 1EY0A 4KN4C 1TQOA 4EVOA 3IFTA 1BNZA 1HCZA 1FYCA 1EY8A 1SYFA 5ELCA 3KF8A 1ET6A 5IGDA 2EY2A 2ZXRA 3OWFA 4ZUJA 2Z1CA 3SDZA 1HRJA 1JWUD 2KQ3A 3QG1A 1F2YA 5BN3A 1Y8PB 3S14B 4HSPA 1PFMA 3U9OA 1BO0A 3I70A 5ELEA 4DAYA 1X3QA 1SMYC 1B9NA 4ZYSA 4PMBA 1TS2A 3Q0AA 2L0CA 3R8BA 2SNMA 4HSVA 1STNA 4TKOB 1BOSA 4X3SA 5ISRA 1B2TA 1PFNA 2Z4HA 3S2HB 3VR3A 1ZKOA 3A55A 3K5MA 1A2UA 1OXUA 4ODGA 1MD2D 3MWYW 4J1MA 3AB9A 4IUVA 3G6JB 1XYIA 1TS4A 5JPNC 3URYA 1Z6HA 1LT6D 4L6TB 1EY7A 5FO9B 5JPMC 2VB3X 4C3IB 4XDXA 1IL8A 4A3EB 3BVGA 1CT1D 1JICA 1E2VA 3NBIA 3SVMA 1FNUA 4R8NA 5JAVA 3TP8A 4NDXA 5T1IA 5FO8B 3RZOB 3J81L 2F0UA 4U673 1V1PA 3K59A 2QDBA 5FOBB 1CHPD 1I6VC 4TRDA 3M4OB 5JEAH 1EQTA 5EPKA 4EQOA 1HUMA 5D3DA 2B2WA 4KKTA 1JCKB 4BY7B 3X3NA 2K01A 4G57A 1BXTA 3EJIA 5NUCA 1AZPA 3OSOA 1D2BA 2E75C 4K5WA 2NVTB 1EZ8A 2B8GA 2E2IB 2NWGA 4C1NI 4CJ1B 5EJWA 2NYZD 3I4LA 1H9JA 3VR2A 5CC4A 5JOBA 3GD7A 2EJGC 1W6JA 1PLFA 1FD7D 1SSOA 2L1BA 2SDFA 3EFXD 3D4RA 2F0NA 2RQXA 3BS1A 5IGGA 4U68A 2F0TA 2K5QA 3FRPB 3FPUB 3K58A 5HURA 1ZYRC 3TN2A 2IW3A 1ET9A 2AUKA 3QJYA 3E5SA 1OO9B 3NUCA 2A69C 2KJXA 1EFID 1JWSD 1EQVA 3FDTA 1B1ZA 5ELBA 1Y1WB 2O5JC 2O2LD 1H9RA 1Y8OB 1SMYD 2A73B 2BA0A 4G7OC 1TU2B 3NTHA 2JSOA 2DN8A 1VCIA 4XQQA 3MTSA 1BUVT 4C3HG 4M8AA 5I2XA 1K8OA 5KIXA 1V43A 2QKIC 3VA7A 4K5VA 2XWBB 1RTOA 1VDZA 5M5YB 4L63B 4X3TA 3H94A 1GJXA 4DU9A 5G3LF 2F0VA 3L3OC 1DOKA 5IGEA 1V8QA 4BY1B 4UDUC 5M9OA 4CBVA 4F88A 4RFBA 4Q0FA 2RDFA 4H0LC 3R93A 2SNSA 2PYKA 2BDNA 3OPOA 1ESFA 4P2CB 3T4AC 4R8IA 3S16B 1A3VA 5E3FA 1H9SA 4FVMA 2B2YC 2EY5A 4KTAA 5C0XI 5C6AA 4R9WA 3TP5A 2RSOA 2D62A 3ND8A 3WOEA 2BOSA 2L5TA 2A6HC 1GUWA 4N9PA 1LT4D 1AEXA 3TBIB 4KHZA 1SFOB 1BQQT 4EQPA 3OMGA 1C48A 1SE2A 1S5FD 1YNJC 3GO5A 1B9MA 1HQMC 1V1PB 1CFMA 3OIQA 1TR5A 2NZ1D 3HZXA 2R61A 3I8ZA 1EOTA 2ZXOA 2Y0SB 4X3UA 2BDOA 2K03A 3GV3A 2B2UC 1ZYRD 1SJED 3QB3A 5CV4A 5IIFA 1OXTA 1JORA 1KLGD 1EU3A 1FNVA 2WKDA 1IKLA 1S5DD 1EY5A 4QB4A 4BWGB 4PV1C 5EBCA 2AWNA 5LL6X 3GTMB 1TIID 5CV5A 5I6YA 2OEOA 3GTGB 2JXMB 1WTVA 4EQNA 1JOKA 3EA6A 2OXPA 1ILPA 2EZVA 1RHPA 2R3ZA 2CHBD 5CGKA 3PO2B 3S9WA 1I4GA 2NUCA 2EYLA 4IUTA 1M4VA 1H9KA 1EYAA 3VR4A 2E2HB 3MA2B 2PW5A 1OXSC 1TVXA 1NAPA 2L55A 1GHKA 5DAUA 3U9SA 1B4OA 2NVYB 1AN8A 2O4XA 2EE1A 1TWFB 1OXVA 3QWNA 1U4MA 3R2TA 1B53A 4RA8A 4EGVA 3HRZC 2LMCB 4HCSA 1F77A 3HS0C 3A54A 4MHEA 3GQBA 2D5DA 1BR9A 2JEAI 1VMCA 4OO1I 3BYYB 1EIHA 4ZLTF 4J6HA 4ABNA 1IW7D 2EYJA 5A2QL 2YYZA 2EYPA 3MEHA 4DK0A 2K32A 1F9SA 5EQ0A 3K5LA 5G3LD 2V4DA 2A6HD 1KABA 3S2DB 1Q1BA 4XQNA 4C3JB 3FPPA 1LTBD 1O78A 2K1BA 3SR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IT1 A;  3OPO A;  4LK1 C;  1IW7 C;  4XTC S;  3HGB A;  2B8G A;  5C0X G;  1SMY C;  1B9N A;  5C0X H;  2JXM B;  3PUX A;  3A8I E;  3A7L A;  4IFD G;  3N6R A;  1TKW B;  1H9S B;  3D31 A;  3OOC A;  5KND A;  2EJM A;  2DNC A;  3I4L A;  1H9J A;  3PV0 A;  1VF5 C;  2A69 D;  1GUO A;  2A6E C;  3LNN A;  3EQL C;  3VR2 A;  2KA7 A;  2BE5 C;  3A7A B;  3GD7 A;  2EJG C;  4TKO B;  3PUV A;  1Z7T A;  2F1M A;  1Q90 A;  4G7Z C;  3A8K E;  2A68 D;  1DCZ A;  3PUY A;  4H13 C;  5A35 A;  5KNB A;  2D2C C;  1H9S A;  1ZKO A;  2BA1 A;  1H9K A;  2EVB A;  2JEB I;  3VR3 A;  3VR4 A;  3D4R A;  3KLR A;  4GZY C;  4BA1 I;  1GUG A;  3M7N A;  5K36 H;  3QIA A;  3SE0 A;  4DNR B;  1OXU A;  1OXS C;  3W3A A;  4KMU C;  4RCN A;  4LJZ C;  4H44 C;  1ZYR C;  1BDO A;  4DK1 A;  1GHK A;  3AB9 A;  3M4Y A;  1LAC A;  3U9S A;  1CI3 M;  1E2Z A;  3WDN A;  1YNN C;  5KNC A;  4IFD H;  2AUK A;  3I72 A;  3QJY A;  2E76 C;  3ND9 A;  4OO1 G;  1OXV A;  3A8J E;  2D62 A;  3ND8 A;  1G29 1;  1IYU A;  1Z6H A;  1GUT A;  3PUW A;  2A69 C;  2L5T A;  3M85 A;  2A6H C;  2AWO A;  2R6G A;  1PMR A;  2NN6 G;  4I7Z C;  2NN6 H;  1Q1E A;  3CRL C;  3VR6 A;  1IYV A;  3OW7 A;  4TQU S;  2O5J C;  2LMC B;  1H9M A;  1H9R A;  4KHZ A;  3DXJ C;  1Y8O B;  5JEA G;  2E74 C;  2BA0 A;  4G7O C;  3MFY A;  2Q8I B;  1TU2 B;  3T56 B;  3BG3 A;  1DD2 A;  1YNJ C;  1E2V A;  2B8F A;  3GQB A;  1GUN A;  2K7V A;  2CW0 C;  1B9M A;  2DN8 A;  1HQM C;  1O7L A;  1VCI A;  2A6E D;  2D5D A;  1CFM A;  4G7H C;  2JEA I;  2BE5 D;  1E2W A;  1T5E A;  3TZU A;  3NE5 B;  2EDG A;  4OGQ C;  1VF7 A;  3IKJ A;  4OO1 H;  1K8O A;  4KKS A;  5BN4 A;  1LAB A;  4KKU A;  1FR3 A;  1V43 A;  4KN4 C;  3VA7 A;  3BDO A;  2NN6 I;  2BDO A;  1VDZ A;  2EJF C;  2KCC A;  2JE6 I;  4JBW A;  1I6V C;  4XIG S;  1A6X A;  3IFT A;  1DXM A;  2K33 A;  5BN5 A;  2A68 C;  1GUS A;  1HCZ A;  1IW7 D;  1FYC A;  3T51 B;  2PCF B;  1K8M A;  3H94 A;  1ONL A;  4IQZ A;  4DNT B;  5JEA H;  1GJX A;  2ZT9 C;  2YYZ A;  1GHJ A;  2PPB C;  1OXT A;  4KN7 C;  4DK0 A;  2K32 A;  4KI0 A;  1HPC A;  3CRK C;  1OXX K;  1CTM A;  1HTP A;  1Q12 A;  1V8Q A;  3LWU A;  3SDZ A;  2PNR C;  3P20 A;  3L7Z C;  3FMC A;  3PUZ A;  2AUJ D;  2QF7 A;  4JK1 C;  2V4D A;  2A6H D;  3I73 A;  1EWH A;  3QG1 A;  3VR5 A;  5BN3 A;  1Y8P B;  1Y8N B;  4KKT A;  3RLF A;  2DNE A;  2O5I C;  1Q1B A;  3MXU A;  3T53 B;  1QJO A;  4HR7 B;  3FPP A;  5K36 G;  1O78 A;  1Y69 U;  4PV1 C;  4L8J A;  2E75 C;  4H0L C;  4BA2 I; 
#chains in the Genus database with same CATH topology
 1LM0 A;  2QEX A;  1QNU A;  5IGC A;  4JV5 L;  3MZ5 A;  4A3F H;  1WCM H;  4LFC L;  4DR7 Q;  3N6R A;  1H9S B;  3K7U C;  1D7Q A;  3RZD B;  3PO3 H;  3S24 A;  1BCP F;  4R4O A;  1SBB B;  2J4X A;  1Q90 A;  1WTQ A;  2EVB A;  5CV7 A;  1L0X B;  4ZUI A;  3M7N A;  4KY7 A;  2PW7 A;  1CA6 A;  1U9R A;  1GO3 E;  4RCN A;  1J8I A;  1BDO A;  5J3B A;  1WD1 A;  5IYC H;  1RKN A;  4IFD I;  1JWM D;  3C1F A;  1CI3 M;  4LUV A;  4B08 A;  3Q22 A;  4DR3 L;  3V2T A;  1G51 A;  2F0M A;  4CKB A;  4A3F B;  2R7Z H;  1WCM B;  1MIU A;  4LWC A;  1N9W A;  2WAC A;  1NR2 A;  2NBF A;  3BVZ A;  2MUY A;  3PO3 B;  2L15 A;  4XT1 B;  3DLL A;  2AHO B;  4HID A;  3TEH B;  4X66 L;  3E6Z X;  5DM7 3;  1X56 A;  2M9V A;  2K75 A;  5GAD C;  1CSP A;  3HOZ G;  1JB7 A;  3GTP H;  2DY7 A;  1PHJ A;  1V1Q A;  5IT9 E;  5IGB A;  1TWC H;  2IX1 A;  1L0Y B;  2KCM A;  4HN7 A;  4C3J G;  2RDG A;  1CQF A;  4B3S Q;  1GVP A;  1LAB A;  4DUY L;  4KKU A;  1M90 C;  3GTO H;  1VMP A;  1VQL A;  2R7Z B;  4A3G G;  1EY4 A;  4JBW A;  2ZTE A;  2C5C A;  3OMC A;  1XNR L;  2V1C C;  1BCP C;  3G71 A;  1KNE A;  3FKI H;  2QCP X;  2XWJ B;  3W1G A;  3J7Z C;  2B63 H;  5M5X H;  1EY6 A;  2EXD A;  1C8C A;  1UAP A;  3HOV H;  1HNW Q;  1SYD A;  3MXG A;  1MSG A;  3GTP B;  1YZ6 A;  2QF7 A;  3W1B A;  3M9B A;  1TWC B;  1S3O A;  3K0X A;  1I94 Q;  1QE6 A;  1RDP D;  2F0D A;  3T53 B;  4IPG A;  3CQZ H;  4O1N A;  2ZJR A;  2JA5 G;  2EPB A;  3DXJ C;  3GTK H;  4A3I G;  2R92 H;  3GTO B;  2FJ2 A;  2R93 G;  4XTC S;  3NBH A;  3HGB A;  2L4N A;  5C0X H;  3NXW A;  4HCE A;  1I4P A;  3NSW A;  3FKI B;  3H3V H;  4L5T A;  3OW2 A;  4IO9 A;  1VF5 C;  1KC8 C;  2B63 B;  2B2W C;  5M5X B;  3PO3 G;  2LXK A;  1F2L A;  4DV2 Q;  3HOV B;  3E3X A;  4H7B A;  1SR3 A;  2D2C C;  2JEB I;  2BA1 A;  1JOQ A;  3BJU A;  5FLX c;  3M7G A;  4LF5 L;  4K2K A;  3BDC A;  3ZYY X;  1R9T H;  4PNY A;  1PH6 A;  2UUC L;  3S1M H;  3CQZ B;  5IYC G;  2ES2 A;  3QO2 A;  3GTK B;  2R92 B;  1I6H H;  3KBX A;  2K52 A;  2KHJ A;  1RL2 A;  1PTO F;  1IYU A;  1V1O A;  1X6O A;  4CJ2 C;  2QEJ C;  5M3F G;  5JVH 3;  5C4X H;  1LLR D;  2R6G A;  3JAM c;  2D0O A;  4A3D G;  3OW7 A;  1FNW A;  3P1H A;  5I9P A;  4OL7 A;  2Q2U A;  3VYU A;  2Q8I B;  4X64 Q;  4M1U B;  4YCW A;  1HQR D;  4NXM Q;  2FFK B;  4WRD A;  1R9T B;  1MBY A;  1VQK A;  3S1M B;  2IHE A;  4UP7 A;  4JI2 Q;  3TZD A;  2EXZ A;  4CKC A;  1Z47 A;  4DUZ Q;  1KNA A;  1WD0 A;  3I4M G;  5BN4 A;  1ASZ A;  5FKA C;  4XYO A;  1I6H B;  2OF1 A;  4HTH A;  5C5L A;  4JI8 Q;  2VS1 A;  1K9M C;  2RKS A;  4A3L H;  1HFG A;  4DR7 L;  4ILW A;  4DXG A;  1G91 A;  1EIG A;  2Y0S E;  3FKI G;  5C4X B;  1ONL A;  4CGY B;  1LTI D;  1SNM A;  1TT2 A;  1D5M C;  2B63 G;  3HOW H;  1GHJ A;  2PPB C;  5D14 A;  4FNF A;  4R4T A;  1VQ4 A;  4RGT A;  3WWV A;  3LWU A;  2I46 A;  2HUG A;  4RGO S;  3NPP A;  3M4P A;  4ME3 A;  2XGT A;  4C3H H;  4BBS H;  4LF4 Q;  2M00 A;  4JI5 Q;  2WAQ G;  2K04 A;  3RLF A;  3ULJ A;  4B3R Q;  3X3M A;  1LTA D;  1A63 A;  2KEE A;  1KDB A;  5IE8 A;  1PTO C;  1HA5 A;  5FLX E;  2IWH A;  3PSI A;  2VB2 X;  1ENF A;  3CW2 C;  4EX5 A;  4LFA Q;  5C0X G;  4QY7 A;  5J39 A;  1VQD A;  4A3C H;  3A7L A;  1EWC A;  1ROD A;  2KED A;  3D31 A;  3ULL A;  1HJP A;  2EJM A;  4TVA B;  3SK5 A;  3V96 A;  3HOW B;  2FMC A;  3LNN A;  3IL8 A;  1A3U A;  1VQE A;  2XRS D;  4KJO A;  1A8V A;  4G7Z C;  4P74 A;  4IAL A;  4F7X A;  5KNB A;  3JAM E;  4C3H B;  4BBS B;  1PXU A;  1BCP D;  3CAM A;  1N32 Q;  3D6W A;  3SE0 A;  2AQ2 B;  3W3A A;  1XPR A;  4B9X A;  2F0L A;  4B3S L;  2F03 A;  3A56 A;  5GRO A;  4QUF A;  1WTO A;  3NHH A;  4KY6 A;  5CV6 A;  1PA6 A;  1HNX Q;  3FEW X;  3T1H Q;  5IOD A;  4JI4 Q;  1PH1 A;  1KDC A;  4XQJ A;  2UXC Q;  3UE0 A;  1V9P A;  2QIL A;  1SYB A;  5E4X A;  2WB1 E;  1O7Y A;  3L9A X;  1VQG A;  1HNW L;  5C44 H;  4X65 Q;  3VYT A;  4JI7 Q;  1PFB A;  2G9H D;  3IRB A;  1UUP A;  1G6P A;  1E3P A;  1I4H A;  4G4K A;  4DR6 Q;  1ENC A;  1QVG A;  1GUN A;  4OEM B;  3ITP A;  3PIO 3;  1O7L A;  1I94 L;  5IOC A;  3OHX C;  1CKM A;  1E2W A;  1VQ8 A;  3NE5 B;  2EDG A;  1VQM A;  4JVZ A;  1FGB D;  1VF7 A;  3D4W A;  3R2I A;  3D6C A;  5M5W H;  1EYD A;  2RCN A;  2FHT A;  3J80 c;  1WTW A;  2NN6 I;  5E1F A;  4A3L G;  4HJ5 A;  2ZTD A;  2K33 A;  1HR0 W;  3OTO Q;  2HIX A;  3I4N H;  4GKK Q;  4IUN A;  1AP0 A;  4IJL A;  5ELO A;  4DV2 L;  4P75 A;  5C44 B;  4FYD A;  1HPC A;  2A1A A;  3CCQ A;  3EN2 A;  3NEN A;  3PUZ A;  4JK1 C;  2UXB Q;  1IKM A;  4R4Q A;  1O80 A;  4ID6 A;  1GD7 A;  1LTS D;  2J0T D;  3D8G A;  4DGZ A;  3STB C;  2VNU D;  4FXK C;  2PZW A;  1QJO A;  4A3M G;  4IUQ A;  1Y69 U;  5M5W B;  4QCL A;  2KCN A;  2TSS A;  5DEH A;  4K14 A;  1WTP A;  5H1S E;  1JOO A;  4GS3 A;  1HTL D;  3PUX A;  4IPH A;  1N33 Q;  3K0Y A;  3I4N B;  1A3T A;  1UE1 A;  1TKW B;  1Y1V H;  5CV8 A;  1QG7 A;  3CC7 A;  5GAE C;  4AH6 A;  2DNC A;  3PV0 A;  2VQF Q;  1SNC A;  3DWQ A;  4WJW A;  3I55 A;  4IOC A;  3EQL C;  4KV6 A;  2Q2T A;  2JN4 A;  2N55 A;  4X64 L;  1U0L A;  1XPU A;  3ERS X;  3I4O A;  1A2T A;  4GZY C;  4NXM L;  4MZ9 A;  1QVC A;  3NTK A;  4JI2 L;  2RHQ B;  1VQC A;  4J15 A;  4LJZ C;  4DUZ L;  1WVL A;  2VQE Q;  1BBU A;  2RVL A;  4V0B A;  4JI8 L;  2YTV A;  3CKI B;  4OO1 G;  2I0Q A;  4JOI C;  3DMU A;  1Y1V B;  2GN5 A;  3J80 E;  1MI2 A;  2EYF A;  4F87 A;  2AWO A;  1PTO D;  1SFO H;  4FXD A;  1PMR A;  3VR6 A;  3CRL C;  4JC0 A;  3BU2 A;  3PIP 3;  2ICE C;  1DD2 A;  4LF4 L;  3TDQ A;  4JI5 L;  1U4P A;  4B3R L;  5CV9 A;  1CM9 A;  5IYD H;  4DXF A;  3IKJ A;  3L2P A;  3PMF A;  4X62 Q;  2PI2 E;  1FR3 A;  4AYB G;  2Q2H A;  1TY2 A;  1AZQ A;  3ONA B;  3BDO A;  4LFA L;  4K5X A;  5DM6 3;  4DAP A;  4XIG S;  2PZU A;  4I65 A;  4DA2 A;  5DNF A;  1DXM A;  1DOL A;  1FL0 A;  1B8A A;  2IHF A;  3H3V C;  4QMG A;  1F9P A;  1PZK D;  4C1N K;  1X3E A;  4P71 A;  4PZ7 A;  2F0F A;  4JCV E;  4C56 C;  2AUJ D;  3GTL H;  1EWH A;  1N32 L;  4HJA A;  4CDE C;  4DV5 Q;  4A3J G;  5M3M G;  3I56 A;  3K81 C;  3MXU A;  4J8Q A;  5GQO A;  5LL6 S;  1EFW A;  4JI3 Q;  1HNX L;  4X6A H;  1MGS A;  3T1H L;  2RDH A;  5C3W A;  1A0I A;  1HZC A;  4JI4 L;  3HKZ B;  5T1G A;  4A4I A;  2IX0 A;  4YCU A;  1VQP A;  4IFD G;  2UXC L;  4X3K A;  4PG3 A;  1SN8 A;  3DEO A;  1SNO A;  3VYS A;  4BS9 A;  2A69 D;  1GUO A;  4X65 L;  3CCV A;  4JI7 L;  2EIF A;  3TME A;  4H13 C;  2B2T C;  4H02 A;  3GTL B;  4QJF A;  4DR6 L;  2RA4 A;  2PZT A;  1SEB D;  1F9R A;  4MNO A;  5KRU A;  1PH2 A;  5AJ3 Q;  3J7A 5;  2GVB A;  2J7Z A;  1D1I A;  2DUD A;  5CYU A;  2WV6 D;  4Q5V A;  1YJ9 A;  3B6Y A;  4K0K Q;  4LUZ A;  4RGM A;  3AFQ A;  3OTO L;  3PUW A;  3STB D;  4GKK L;  5I2Y A;  4DAM A;  1XTC D;  4GLX A;  3HOY H;  3J81 j;  2K28 A;  5ELN A;  2F0P A;  2HCC A;  1K73 C;  3BDL A;  4WFN 3;  1I4Q A;  2B39 A;  1IYV A;  2G9D A;  1MKH A;  1Q3L A;  2F0J A;  2PMZ B;  3HG9 A;  4DNI A;  1XMQ Q;  1TS5 A;  3J7A F;  1E0B A;  2EYO A;  2OTL A;  1F9Q A;  5KGU A;  2AQ1 B;  2UXB L;  1SJH D;  2K6A A;  5C0X J;  2L11 A;  2PQE A;  4HIO A;  2LFN A;  1QB5 D;  5LMN W;  4IUP A;  2GA4 B;  3W2D A;  1EZ6 A;  1LTT D;  3HKZ G;  1A6X A;  2JE6 I;  1Q86 C;  1N33 L;  2KUM A;  2ID0 A;  1LTG D;  3V05 A;  3HOY B;  3CCE A;  4KJN A;  4DV6 Q;  3TRZ A;  1VQJ A;  1KAA A;  2VQF L;  2NZO A;  2JP1 A;  3HOZ H;  4QIW B;  3RUZ A;  5EKK A;  2WKC A;  3D0F A;  4NXN Q;  2UUB Q;  3J81 c;  4RKL A;  1KRT A;  1HTP A;  3KDF B;  2PNR C;  3L0O A;  3RR5 A;  3T1Y Q;  3NWT A;  1L2F A;  2R7F A;  3DHQ A;  3VR5 A;  1JJ2 A;  4RGN A;  5IGF A;  3WOF A;  3ZJY C;  1SE4 A;  3FVQ A;  2KBN A;  2VQE L;  4A3G H;  4QGU A;  2F0H A;  2PO4 A;  1GOZ A;  2TMP A;  3Q24 A;  1O7I A;  3PGZ A;  2QA4 A;  4JPB W;  4FF1 A;  4ZAI A;  1E1T A;  4QUC A;  2DGY A;  1DYQ A;  1JC7 A;  3HOZ B;  1D6E C;  2XSC A;  2A6E C;  4JI6 Q;  2L12 A;  1NSN S;  4TSS A;  4WOR A;  3PUV A;  2X69 A;  5FO7 B;  2KCT A;  2B2T A;  3TQY A;  2HDL A;  4A3K G;  2JA5 H;  1YNJ D;  4HJ8 A;  4A3I H;  4KMU C;  1K83 H;  2LY7 A;  2R93 H;  3S1N H;  4A3G B;  4X62 L;  4E6I A;  2RCF A;  2DY8 A;  5C4H A;  1LYL A;  4ZKB B;  3TP6 A;  1MJC A;  3S17 H;  1A15 A;  4LF6 Q;  1PYB A;  1SNQ A;  3ULP A;  1W2B A;  3HOY G;  2RBM A;  4DF7 A;  4Y7N H;  1YJW A;  3I3C A;  3H15 A;  1XX8 A;  2F0Q A;  5C3X A;  2NN6 H;  2B2V A;  4FF4 A;  2P5Z X;  1HFN A;  1K3R A;  4BXX G;  3OYY A;  3MXN A;  4OXP A;  1NR4 A;  1B3A A;  3DEP A;  2MP1 A;  3J81 E;  2K7V A;  3GTQ H;  4DV5 L;  2JA5 B;  5FK9 C;  4A3I B;  1K83 B;  2OWO A;  1AE3 A;  3G7L A;  2R93 B;  3S1N B;  4HMI A;  3J7A V;  4KKS A;  3E9H A;  4JI3 L;  1PH9 A;  4BBR H;  4NMZ A;  1SYG A;  3AQQ A;  5M3F H;  1G8Z D;  3S17 B;  1SDF A;  5J1Z A;  2DJF C;  5C3E H;  2NTT A;  2XN9 C;  2D9U A;  1SXT A;  2A68 C;  4A3D H;  4Y7N B;  3T51 B;  3GV6 A;  1KL9 A;  2PCF B;  4DNT B;  4ZKC B;  4CKE A;  1WYD A;  3NQI A;  4KI0 A;  5IP9 G;  4RMF A;  1CTM A;  1STB A;  3P20 A;  1UEB A;  3L7Z C;  5COR A;  1KD1 C;  3CPF A;  3K6O A;  1E7Z A;  4DN4 M;  5CR3 A;  3GTQ B;  1NTG A;  3I4M H;  2DNE A;  4R1J A;  5AJ3 L;  3UDI A;  1J9O A;  1CHQ D;  4HR7 B;  2K5W A;  1NJI C;  4K0K L;  5CMD A;  4BBR B;  3J80 i;  2AQ3 B;  1RCV D;  2PQA A;  5M3F B;  1YIJ A;  2JA7 G;  1G6Z A;  1I4R A;  5C3E B;  1SNP A;  4A3D B;  3QOL A;  2MGS A;  2Z9H A;  5TSS A;  5LHY 1;  4K6D A;  2LS0 1;  1XWE A;  1G2T A;  4ULL A;  4DAV A;  1XMQ L;  1QOH A;  1GXD C;  2EYM A;  2KA7 A;  2KOL A;  3S1Q H;  4ALP A;  1Q8I A;  5A35 A;  1PH3 A;  2KHI A;  5JJI A;  3MHB A;  4K8I A;  2EYH A;  2FMM A;  3RD4 A;  1PRT B;  4BA1 I;  3I4M B;  2KHS A;  3P75 A;  3Q8D A;  1RD9 D;  2ZM6 Q;  3E9I A;  1IYJ B;  4XXE A;  3PCO B;  4UY8 C;  3MEF A;  1SND A;  1E2Z A;  2F3V A;  1YNN C;  3T13 A;  2EQS A;  3K8A A;  4DR4 Q;  2OTJ A;  1CZW A;  3I72 A;  4KLK A;  1VQ7 A;  4DV6 L;  3UDG A;  5I6W A;  4CDF C;  2Q8R E;  2NN6 G;  1DZ1 A;  3O13 A;  4NXN L;  1T5X D;  2UUB L;  2DJG C;  4FXG C;  4P72 A;  1IBK Q;  3S1Q B;  1UWV A;  2WAQ B;  3KYH C;  3T1Y L;  1C0A A;  3MFY A;  1TWH H;  2B8F A;  3SHL A;  2KVM A;  2L9H A;  4IFD J;  2CW0 C;  1TWA H;  2A6E D;  3M3Y H;  2EOT A;  4ME5 A;  4S3S A;  4B3M Q;  3PF4 A;  1I50 H;  4FDB A;  4R4I A;  1PH8 A;  1UNS A;  3A74 A;  3KJP A;  4BBR G;  1DOM A;  1X3P A;  1X54 A;  4P73 A;  2C9O A;  1PH5 A;  2EJF C;  2KCC A;  5C3E G;  4WJ4 A;  4RH6 A;  1AFP A;  2HD3 A;  4LMQ D;  2GVA A;  1K8M A;  4IQZ A;  3F2D A;  3MFG A;  4JI6 L;  5C5M A;  1SE3 A;  1CQV A;  3CRK C;  2HHH Q;  1B70 B;  5F2D A;  2K05 A;  1TWH B;  2WII B;  1F2M A;  1KQS A;  2EY1 A;  1NCV A;  1TWA B;  3M3Y B;  4I7A A;  2HQL A;  2F0E A;  1I50 B;  1O7Z A;  5LMU Q;  5K36 G;  1ENA A;  4NP5 A;  4L8J A;  1W6K A;  2F0W A;  5I4D A;  2F4V Q;  4RHR A;  1WTR A;  2JYO A;  1U5K A;  4PZ8 A;  3RLO A;  4LF6 L;  1IL2 A;  1EL0 A;  1CA5 A;  4N9T A;  3Q6S A;  2QGQ A;  3SGI A;  4LF8 Q;  2BE5 C;  2LSS A;  1LT3 D;  3F2U A;  2A19 A;  2A68 D;  5FJ8 H;  1QVF A;  1LV9 A;  2MPM A;  3KLR A;  4A3M H;  5HGQ A;  3QIA A;  3K7A H;  3U4Z A;  3NTI A;  1PDQ A;  1STG A;  2BH8 A;  3WDN A;  1HHV A;  3KF6 B;  4YWK A;  3F1Z A;  3CCS A;  3F8T A;  1ZXT A;  2Q2I A;  4O2D A;  1J5E Q;  3CC4 A;  5CBA E;  4YHH Q;  1QWY A;  3R3O A;  3MXN B;  2YTX A;  3VYR A;  1D1K A;  1Q1E A;  4DK6 C;  2NTS A;  1H9M A;  4OEL B;  1YIT A;  1HH2 P;  1X32 A;  1SMX A;  2N49 A;  3D3R A;  4RHS A;  1SRO A;  4HAE A;  1SE8 A;  2OQK A;  3TP7 A;  5EPL A;  4A3M B;  3U50 C;  3OWE B;  5C4J H;  3EVQ A;  3HOU H;  3K7A B;  3G4S A;  4ZK9 B;  1U4L A;  1M1K C;  3GP7 A;  1STA A;  2IJ0 A;  3I90 A;  4C2M H;  1T9H A;  2ATW A;  4OO1 H;  3D4D A;  2MHV A;  1SAP A;  1PV4 A;  3SK4 A;  1KLU D;  5IT9 L;  2F3W A;  1HNZ Q;  3F2C A;  2Q8T A;  1GUS A;  2N78 A;  1M8A A;  3H0G H;  1BF4 A;  5EKI A;  1EEI D;  3K5O A;  3K5N A;  1YNN D;  3AU7 A;  4KN7 C;  4A3B B;  3CHB D;  2YTY A;  3TS0 A;  1KIX A;  1Q12 A;  1FVI A;  1EY9 A;  3BZK A;  3TRE A;  1C9O A;  2PNH A;  3DWA A;  2ENB A;  4C3I G;  1RJT A;  2X6G A;  5C4J B;  1CKO A;  2PQA B;  4XT3 B;  5I9O A;  4A3E G;  2ZM6 L;  3HOU B;  2O5I C;  3CCR A;  4C2M B;  1D5X C;  1C7Y A;  3P7J A;  1NMG A;  1PRT F;  5E4W C;  4V19 0;  4DR4 L;  2IT1 A;  3A0J A;  4JBM A;  1BBX C;  2CW0 D;  2EY6 A;  4LK1 C;  1B50 A;  1K8A C;  2CFM A;  1DM0 B;  4DR2 Q;  2UU9 Q;  3CC2 A;  1BBW A;  3H0G B;  2F0I A;  2N88 A;  3SK8 A;  1HUN A;  2JA8 H;  3J81 i;  2F0K A;  1IBK L;  1FJG Q;  5ELD A;  3UI2 A;  1Z7T A;  2F1M A;  3H91 A;  5FJ8 G;  2CH4 A;  4A3J H;  4FF2 A;  1ZEQ X;  5M3M H;  2F0G A;  3KDF A;  3CCJ A;  4KK7 A;  1UEA B;  4AYB B;  2UUA Q;  1S4Z A;  2ICI A;  4B3M L;  1QZH A;  3C3L A;  1YHB A;  5EPJ A;  4BY7 G;  1XXG A;  5KNC A;  4IFD H;  1QUQ A;  1TWG B;  5COY A;  2E5L Q;  3ND9 A;  5JVG 3;  3A8J E;  3FHW A;  1YHA A;  5C4Z A;  4DV3 Q;  1G29 1;  2SEB D;  3IFD A;  4YWM A;  4RWS C;  5FLM G;  1JQY D;  2JA8 B;  3UE1 A;  1E24 A;  4LAA A;  2HQE A;  1PYW D;  4JI0 Q;  4A3B G;  2HHH L;  5JEA G;  2CVR A;  4AQY Q;  4A3J B;  3KK7 A;  2NVQ B;  5M3M B;  2IL8 A;  3I91 A;  1JR0 D;  1U4R A;  3HOU G;  3H6M A;  2XIW A;  2HDM A;  1PRT C;  1HZB A;  3CMA A;  2BE5 D;  3NWS A;  4DK3 C;  5LMU L;  1OTC A;  3NK9 A;  2F4V L;  4DAY B;  1I5F A;  4JI1 Q;  4MN3 A;  1IHZ A;  4CHT B;  5A2Q E;  4IUU A;  3H09 A;  5KYL A;  1JMC A;  3BZC A;  5BN5 A;  3W5O A;  3H0G G;  1JB3 A;  2FIN B;  1QIL A;  2F0O A;  5JJZ A;  4IN3 A;  2I5H A;  3DWP A;  4LF8 L;  1STH A;  2BH2 A;  2KEC A;  4O42 A;  3J7Y W;  1OXX K;  4RAU C;  2E2D C;  3FMC A;  1WTH A;  2AMC B;  1Y1W G;  3MAQ A;  1ICW A;  1I3Q H;  4DFA A;  5DLQ E;  1E22 A;  2LKV A;  1I4X A;  3CCM A;  1QZG A;  3ER0 A;  3SXH A;  3GTJ H;  1EOV A;  3E0E A;  2HCI A;  2ZTC A;  1NUC A;  3AFP A;  4BA2 I;  1E1O A;  2VW9 A;  1XTD A;  2F0S A;  1IW7 C;  1EEF D;  1J5E L;  2B3G A;  1LTL A;  3A8I E;  3NP8 A;  2ASB A;  4YHH L;  2X6L A;  2H1E A;  5FLX L;  2JA8 G;  3C46 A;  1XPO A;  1BCP B;  2IX3 A;  3A7A B;  1EU4 A;  1EIY B;  3ERQ A;  2H4O A;  4OWX B;  1LT5 D;  1KXL A;  4F8M A;  1I3Q B;  1WFQ A;  1S5C D;  4FF3 A;  1RF2 D;  3VA5 A;  1F2Z A;  5EKL A;  3GTJ B;  4GN3 B;  5EGT A;  1HA6 A;  3JAM L;  1II3 A;  2BCO A;  2MJ8 A;  2N8N A;  3AEV A;  3MXP A;  4B3T Q;  4N8F A;  1HNZ L;  4UPA A;  5K5P A;  1YEZ A;  1TY0 A;  5J22 A;  4XYQ A;  1TXY A;  1N8R C;  3LWE A;  1W3S A;  5EAY A;  4I7Z C;  1VQA A;  5D65 A;  1WTX A;  1EYC A;  4IJH A;  1YBY A;  2XRQ D;  1JJC B;  4DV1 Q;  3C2P A;  2NB0 A;  4A3K H;  4AIM A;  3ERO A;  5AFW A;  3HEJ A;  2VXW A;  1SYE A;  4QF4 A;  3HOX B;  2WAQ E;  2LXJ A;  1VQ9 A;  3TZU A;  4DR5 Q;  5KEE A;  3S15 H;  4JW0 A;  4PZ6 A;  1D5Z C;  3KBG A;  2K5D A;  1CK1 A;  2Z0S A;  2B2V C;  4DR2 L;  2JQO A;  3EBE A;  2UU9 L;  1ESR A;  4UP9 A;  1HXY D;  2XNA C;  1MSH A;  3RMH A;  1IBM Q;  2FXQ A;  1DJR D;  4NKL A;  4POF A;  4BXX H;  1NBW A;  2ZT9 C;  3E0J A;  1FJG L;  1S5E D;  3DM1 A;  4OHJ A;  2YU9 H;  1EIF A;  3Q23 A;  1QNK A;  3KLS A;  4A3K B;  2A5H A;  3I73 A;  2MNA A;  1PZJ D;  2Z6K A;  2NZH A;  2I07 B;  2VUM H;  1YHQ A;  2UUA L;  4RCO A;  3N52 A;  4HMJ A;  3S15 B;  4CJ0 B;  1B7Y B;  4KD3 A;  1S5B D;  4K6L A;  2B2Y A;  3HP3 A;  3SEB A;  3ICE A;  1B3Q A;  2E5L L;  1G2S A;  1PTO H;  4DV3 L;  1PRT D;  1TS3 A;  2Y0S G;  4LW1 A;  1C4Q A;  3UDX A;  3I7F A;  5IP9 H;  2WB1 B;  1KHI A;  3BZD B;  4JI0 L;  3MVV A;  4Z9C B;  3K57 A;  2K50 A;  2OT2 A;  2YU9 B;  4GN4 B;  3PF5 A;  3NEL A;  4AQY L;  1DCZ A;  3PUY A;  1Q7Y C;  4GOP A;  2E2J H;  4RKB A;  4WJ3 M;  2VUM B;  1DON A;  1QUQ B;  3TSS A;  4DR1 Q;  3C1E A;  3HOX G;  2JA7 H;  4H44 C;  1H95 A;  3G6E A;  4DK1 A;  4JI1 L;  3M4Y A;  1L1O A;  4HED A;  1PTO B;  1WOC A;  2IY5 B;  2Z4I A;  4CDC C;  2A8V A;  5D3I B;  1HR0 Q;  2A74 C;  4GKJ Q;  5CBE E;  3AMU A;  1WI5 A;  2IPK D;  4NB3 A;  1XNQ Q;  2B2U A;  2MFI A;  3J80 L;  3BG3 A;  3M4Q A;  1JE4 A;  2HIV A;  3CME A;  2E2J B;  2XVS A;  4LFB Q;  2ZXP A;  2JA9 A;  5IT9 c;  3CF5 A;  2KEN A;  4KY5 A;  3DUZ A;  4PMW A;  4B9W A;  1T5E A;  3CU7 A;  4MIU A;  2JA7 B;  4OIJ A;  1D8L A;  3QOJ A;  4IOA A;  4A93 H;  4YCV A;  1CUK A;  4FP5 D;  3KF6 A;  2RSN A;  3EIV A;  3IAY A;  1X3G A;  2WB1 G;  2CQO A;  1KDA A;  1LUZ A;  3HFZ B;  3S1R H;  4MTK A;  4DPG A;  3BVM A;  1Y8N B;  4KHV A;  2VUM G;  2CH4 W;  5JJK A;  4IPD A;  1ICF B;  4K2L A;  4GLA C;  1N36 Q;  1X65 A;  2WP8 J;  5JEA J;  1VQN A;  4YIJ A;  4A93 B;  4B3T L;  2SOB A;  3U58 A;  4RG1 A;  1XMO Q;  3SK6 A;  2CQA A;  4PMC A;  4LF7 Q;  5IY0 A;  1UE5 A;  3OOC A;  5KND A;  1N34 Q;  3KLW A;  1B44 D;  5IP7 G;  2NVX H;  1STY A;  4OIK A;  1R4Q B;  2JA6 H;  1R4P B;  1ML0 D;  1ILQ A;  4KD4 A;  1LTR D;  3S1R B;  4DV1 L;  1RTN A;  3A8K E;  3OIP A;  5ELF A;  4DV4 Q;  1KTK A;  4ZQ3 A;  1GUG A;  5IYB G;  5EBD A;  3LX0 A;  2UXD Q;  2OQ0 A;  5K36 H;  1LO5 D;  4DNR B;  1CZG A;  4DR5 L;  5GAH C;  5KYI A;  3MC0 B;  1JE5 A;  1UE7 A;  4IUR A;  1SYC A;  1LAC A;  4IZ8 A;  2F4I A;  2WIN B;  1STE A;  4AYB E;  2E76 C;  5HGT A;  3NQT A;  3A5U A;  3VDY A;  1GUT A;  4K8J A;  1IBM L;  2Z8L A;  3M85 A;  4NW2 A;  4PQX A;  1PVO A;  1EQR A;  2JA6 B;  1K3B C;  2NVX B;  4HIM A;  4TQU S;  1QCB D;  4KHP Q;  4ZRZ A;  4FO2 A;  2E74 C;  3BYT B;  3T56 B;  3KJO A;  1AW7 A;  4UAI A;  1GM5 A;  3S14 H;  1S72 A;  3KLS X;  4G7H C;  4HIK A;  3KUP A;  2M2L A;  1PZI D;  3CXC A;  4OGQ C;  1EUJ A;  3AYH B;  3KFU A;  5BR8 Q;  3T16 A;  1EY0 A;  2VY3 A;  4KN4 C;  4A93 G;  1TQO A;  1P8L A;  4EVO A;  3IFT A;  1BNZ A;  1HCZ A;  1FYC A;  1EY8 A;  1SYF A;  5ELC A;  3KF8 A;  1ET6 A;  5IGD A;  2EY2 A;  4A3F G;  2HT1 A;  1WCM G;  4LUO A;  3HKS A;  2ZXR A;  1CKN B;  3OWF A;  4ZUJ A;  2Z1C A;  3SDZ A;  1HRJ A;  1JWU D;  1IZ6 A;  2KQ3 A;  3S2H H;  1Q8K A;  3QG1 A;  1FGU A;  1F2Y A;  5BN3 A;  1Y8P B;  1A62 A;  3S14 B;  4DR1 L;  4HSP A;  1PFM A;  4GNX B;  3U9O A;  1BO0 A;  3I70 A;  5ELE A;  4R4C A;  4DAY A;  1X3Q A;  1SMY C;  1B9N A;  1X9N A;  4ZYS A;  4PMB A;  1TS2 A;  1HR0 L;  3Q0A A;  2L0C A;  4GKJ L;  4GOP B;  1GKH A;  2R7Z G;  3R8B A;  2SNM A;  2JA6 G;  4HSV A;  4A76 A;  1XNQ L;  1STN A;  4C3I H;  4TKO B;  1BOS A;  4X3S A;  5ISR A;  1B2T A;  4A3E H;  4OX9 Q;  1PFN A;  2Z4H A;  3S2H B;  3VR3 A;  1ZKO A;  4A75 A;  4LFB L;  3A55 A;  3K5M A;  1L1O B;  1HZ9 A;  3PIO A;  1A2U A;  1YVC A;  1OXU A;  4ODG A;  1MD2 D;  3MWY W;  4J1M A;  3PQI A;  4LNQ A;  3AB9 A;  4IUV A;  3G6J B;  1K0S A;  2E8G A;  5LMN Q;  1XYI A;  3RZO H;  1TS4 A;  5JPN C;  4IPC A;  3URY A;  5L37 A;  2ZJP A;  1Z6H A;  3HKZ E;  1KRS A;  1IBL Q;  1LT6 D;  4L6T B;  1EY7 A;  5FO9 B;  3M4O H;  5JPM C;  2VB3 X;  4C3I B;  4XDX A;  1IL8 A;  4A3E B;  3K80 C;  3BVG A;  1CT1 D;  1JIC A;  1E2V A;  1VQ5 A;  3NBI A;  3HOV G;  3SVM A;  5GAG C;  2CKZ B;  1FNU A;  4R8N A;  4BY7 H;  5JAV A;  1CSQ A;  3TP8 A;  2AKW B;  4NDX A;  1EYG A;  5T1I A;  1N36 L;  2MQH A;  5FO8 B;  3RZO B;  5IWA Q;  3J81 L;  2K5V A;  4O0A A;  2F0U A;  1XMO L;  4U67 3;  1V1P A;  3K59 A;  3TS2 A;  2QDB A;  5FLM H;  2NVT H;  5FOB B;  1CHP D;  1I6V C;  2E2I H;  4LF7 L;  2R92 G;  4TRD A;  4A3B H;  1N34 L;  3RLN A;  1UE6 A;  5JEA H;  3M4O B;  2D0P A;  1EQT A;  5EPK A;  2R7D A;  2PMZ E;  2QW7 A;  4EQO A;  1HUM A;  5D3D A;  4DV4 L;  2B2W A;  4KKT A;  3CP0 A;  2UXD L;  1JCK B;  4BY7 B;  3X3N A;  2K01 A;  4CDD C;  4G57 A;  1BXT A;  4DV7 Q;  1K8G A;  3EJI A;  4YY3 Q;  5NUC A;  1AZP A;  3OSO A;  1D2B A;  2E75 C;  1HZA A;  4K5W A;  2I5M X;  2I5L X;  2NVT B;  1NNX A;  1EZ8 A;  2B8G A;  2E2I B;  2NWG A;  4C1N I;  4CJ1 B;  3GDE A;  1K28 A;  1AH9 A;  5EJW A;  2NYZ D;  1J6Q A;  2VZA A;  2F52 A;  3I4L A;  1H9J A;  3VR2 A;  4KHP L;  5CC4 A;  1Y1W H;  4QIW E;  5JOB A;  1BVS A;  3GD7 A;  3PIP A;  2EJG C;  1W6J A;  5C4X G;  1PLF A;  2Z6B A;  1FD7 D;  1SSO A;  3KOJ A;  2L1B A;  2SDF A;  3QR8 A;  1P16 A;  3EFX D;  3D4R A;  2F0N A;  2RQX A;  3BS1 A;  5IGG A;  4U68 A;  4OON A;  4GLV B;  2F0T A;  2K5Q A;  3FRP B;  3FPU B;  3K58 A;  5HUR A;  1TWG H;  1ZYR C;  5BR8 L;  3TN2 A;  2IW3 A;  4LF9 Q;  1ET9 A;  4DV0 Q;  2AUK A;  4L5Q A;  2JJQ A;  3QJY A;  3E5S A;  1OO9 B;  1VQI A;  3NUC A;  1X3F A;  2QDL A;  5M5Y H;  2A69 C;  2KJX A;  1EFI D;  1NY4 A;  1Z9F A;  1JWS D;  3RN2 A;  2NVQ H;  1EQV A;  3FDT A;  1B1Z A;  5ELB A;  1Y1W B;  2O5J C;  2O2L D;  1H9R A;  2K5N A;  4HJ7 A;  1Y8O B;  1SMY D;  2A73 B;  2BA0 A;  3HOW G;  4G7O C;  1TU2 B;  3NTH A;  2VL6 A;  4Y52 H;  4BY1 H;  2JSO A;  4NPS A;  2DN8 A;  5E7N A;  1VCI A;  4XQQ A;  3MTS A;  1BUV T;  4C3H G;  4BBS G;  2CCZ A;  4M8A A;  5I2X A;  1K8O A;  3KF8 B;  3NBH B;  5KIX A;  1V43 A;  2QKI C;  3VA7 A;  2RF4 A;  4JYA Q;  4K5V A;  2XWB B;  1YJN A;  1EQQ A;  1RTO A;  1VDZ A;  5M5Y B;  4L63 B;  3S16 H;  4X3T A;  3H94 A;  1GJX A;  4DU9 A;  1EWI A;  4GN5 A;  1JT8 A;  5G3L F;  4A3C G;  2F0V A;  3L3O C;  1DOK A;  5IGE A;  2N3S A;  2F3I A;  1V8Q A;  4OX9 L;  3CCL A;  4BY1 B;  1PFS A;  4JBK A;  4L5R C;  4UDU C;  1Y14 B;  1MJE A;  5M9O A;  3DM3 A;  4OWW B;  4CBV A;  4F88 A;  2G5D A;  3LGJ A;  4RFB A;  5LMN L;  1S40 A;  4Q0F A;  2RDF A;  4H0L C;  3R93 A;  2SNS A;  2PYK A;  2ALY B;  3OPO A;  2BDN A;  4JBJ A;  4L5S A;  1ESF A;  1PYS B;  4P2C B;  3T4A C;  1SRU A;  4R8I A;  1Q81 C;  1NMF A;  3S16 B;  1IBL L;  4ZCK A;  1A3V A;  5E3F A;  4APV A;  2Z6K C;  2B29 A;  1NE3 A;  1H9S A;  5C44 G;  2RHS B;  4MTN A;  1WJJ A;  4FVM A;  2B2Y C;  3CCU A;  2EY5 A;  4KTA A;  1XJV A;  4UP8 A;  4OWT B;  3A5Z B;  5C0X I;  5C6A A;  4R9W A;  3TP5 A;  4GNX C;  5IWA L;  3H3V I;  3CPW A;  2RSO A;  4JV5 Q;  2MO1 A;  2D62 A;  3ND8 A;  4LFC Q;  3WOE A;  2BOS A;  2L5T A;  3JC6 6;  1SLJ A;  2A6H C;  1GUW A;  4N9P A;  1LT4 D;  4GOP C;  1AEX A;  3TBI B;  3I4N G;  1PH4 A;  4KHZ A;  1SFO B;  1BQQ T;  4EQP A;  1JJG A;  3I2Z A;  3OMG A;  1C48 A;  3HOX H;  1SE2 A;  1S5F D;  1YNJ C;  1VQ6 A;  4BY1 G;  3GO5 A;  4QL5 A;  1B9M A;  1HQM C;  1V1P B;  4YWL A;  1CFM A;  3OIQ A;  4DV7 L;  1L1O C;  1TR5 A;  2OCE A;  1RIP A;  2K5H A;  2NZ1 D;  4YY3 L;  3HZX A;  2R61 A;  3I8Z A;  1EOT A;  2ZXO A;  2Y0S B;  1YI2 A;  4DR3 Q;  2PI2 A;  4X3U A;  3GTM H;  1MHW C;  2BDO A;  3G48 A;  3GTG H;  4POG A;  2K03 A;  3GV3 A;  3FP9 A;  1VS0 A;  2B2U C;  1ZYR D;  1SJE D;  2CWP A;  3QB3 A;  5CV4 A;  5IIF A;  2K14 A;  1OXT A;  1Y1V G;  1JOR A;  1Q46 A;  1KLG D;  4X66 Q;  3PO2 H;  1EU3 A;  1FNV A;  3RNU A;  2WKD A;  4N8X 1;  1IKL A;  1S5D D;  3U4V A;  2E2H H;  1EY5 A;  4QB4 A;  2CWA A;  4BWG B;  2JK8 A;  4PV1 C;  5EBC A;  4LF9 L;  2AWN A;  5LL6 X;  4DV0 L;  4DUY Q;  2NVY H;  3GTM B;  1TII D;  5HY6 A;  5CV5 A;  1TWF H;  5I6Y A;  1YNX A;  2OEO A;  3GTG B;  2JXM B;  1XNR Q;  1WTV A;  4EQN A;  1JOK A;  3EA6 A;  2OXP A;  2WFW A;  2EZV A;  1ILP A;  4UHV A;  1RHP A;  2R3Z A;  2CHB D;  4JOI A;  5CGK A;  3PO2 B;  3S9W A;  1CKN A;  1I4G A;  2NUC A;  2EYL A;  4IUT A;  1M4V A;  2XTI A;  1H9K A;  1EYA A;  3VR4 A;  4EQ5 A;  1X55 A;  5JJL A;  3NEM A;  2E2H B;  3MA2 B;  2PW5 A;  1OXS C;  1TVX A;  1NAP A;  4QQB X;  4HJ9 A;  2L55 A;  1GHK A;  5DAU A;  3U9S A;  1B4O A;  4JYA L;  2NVY B;  4DKA C;  1VQF A;  5IYD G;  4GNX A;  1AN8 A;  2O4X A;  2EE1 A;  2H5X A;  1TWF B;  1OXV A;  1PH7 A;  1L0W A;  3QWN A;  5IP7 H;  1KAW A;  1U4M A;  3R2T A;  1B53 A;  1IXR A;  4RA8 A;  4EGV A;  3RN5 A;  3HRZ C;  2LMC B;  1ASY A;  1VQH A;  4HCS A;  5IYB H;  3JAM i;  1F77 A;  3HS0 C;  1VQB A;  3A54 A;  4MHE A;  3GQB A;  3S2D H;  2D5D A;  4LF5 Q;  1BR9 A;  2JEA I;  1VMC A;  2UUC Q;  4OO1 I;  4C3J H;  3BYY B;  1EIH A;  4JG2 A;  2MO0 A;  3CD6 A;  4ZLT F;  4J6H A;  1AE2 A;  2ZJQ A;  4ABN A;  1IW7 D;  2C35 B;  1VQO A;  3RZD H;  2EYJ A;  5A2Q L;  2YYZ A;  2EYP A;  3MEH A;  4DK0 A;  2K32 A;  1F9S A;  3PO2 G;  5EQ0 A;  3F2B A;  1BKB A;  3K5L A;  5G3L D;  2K4K A;  2V4D A;  2A6H D;  2YV5 A;  1KAB A;  3S2D B;  1K0R A;  1DGS A;  1Q1B A;  4XQN A;  3UDF A;  4C3J B;  3FPP A;  1LTB D;  1O78 A;  2K1B A;  3SR1 A;  1Q82 C; 
#chains in the Genus database with same CATH homology
 1QNU A;  5IGC A;  3MZ5 A;  3N6R A;  1H9S B;  3RZD B;  1BCP F;  1SBB B;  2J4X A;  1Q90 A;  1WTQ A;  2EVB A;  5CV7 A;  1L0X B;  4ZUI A;  3M7N A;  4KY7 A;  2PW7 A;  1CA6 A;  1U9R A;  4RCN A;  1J8I A;  1BDO A;  1WD1 A;  1RKN A;  4IFD I;  1JWM D;  3C1F A;  1CI3 M;  4B08 A;  3Q22 A;  3V2T A;  2F0M A;  4CKB A;  4A3F B;  1WCM B;  2WAC A;  1NR2 A;  2NBF A;  3BVZ A;  2MUY A;  3PO3 B;  4XT1 B;  5DM7 3;  3E6Z X;  2M9V A;  2DY7 A;  5IT9 E;  5IGB A;  2IX1 A;  1L0Y B;  4HN7 A;  4C3J G;  2RDG A;  1CQF A;  1LAB A;  4KKU A;  1VMP A;  2R7Z B;  1EY4 A;  4JBW A;  2C5C A;  3OMC A;  1BCP C;  1KNE A;  2QCP X;  2XWJ B;  1EY6 A;  1C8C A;  1UAP A;  1SYD A;  3MXG A;  1MSG A;  3GTP B;  2QF7 A;  1TWC B;  1QE6 A;  1RDP D;  2F0D A;  3T53 B;  4O1N A;  2EPB A;  3DXJ C;  3GTO B;  2FJ2 A;  4XTC S;  3NBH A;  3HGB A;  2L4N A;  5C0X H;  3NXW A;  4HCE A;  1I4P A;  3NSW A;  3FKI B;  1VF5 C;  2B63 B;  2B2W C;  5M5X B;  1F2L A;  3HOV B;  4H7B A;  2D2C C;  2JEB I;  2BA1 A;  1JOQ A;  3M7G A;  4K2K A;  3BDC A;  3ZYY X;  4PNY A;  3CQZ B;  3QO2 A;  3GTK B;  2R92 B;  3KBX A;  1PTO F;  1IYU A;  1V1O A;  4CJ2 C;  2QEJ C;  5JVH 3;  1LLR D;  2R6G A;  3OW7 A;  1FNW A;  3P1H A;  5I9P A;  4OL7 A;  3VYU A;  2Q8I B;  4M1U B;  1HQR D;  2FFK B;  4WRD A;  1R9T B;  1MBY A;  3S1M B;  3TZD A;  2EXZ A;  4CKC A;  1Z47 A;  1KNA A;  1WD0 A;  5BN4 A;  5FKA C;  4XYO A;  1I6H B;  2OF1 A;  4HTH A;  5C5L A;  2RKS A;  1HFG A;  4ILW A;  4DXG A;  1G91 A;  1EIG A;  5C4X B;  1ONL A;  4CGY B;  1LTI D;  1SNM A;  1TT2 A;  1D5M C;  1GHJ A;  2PPB C;  5D14 A;  4FNF A;  4RGT A;  3LWU A;  2I46 A;  2HUG A;  4RGO S;  3NPP A;  2M00 A;  2K04 A;  3RLF A;  3X3M A;  1LTA D;  2KEE A;  1KDB A;  1PTO C;  1HA5 A;  5FLX E;  2IWH A;  2VB2 X;  1ENF A;  5C0X G;  5J39 A;  3A7L A;  1EWC A;  1ROD A;  2KED A;  3D31 A;  2EJM A;  3SK5 A;  3V96 A;  3HOW B;  2FMC A;  3LNN A;  3IL8 A;  1A3U A;  2XRS D;  4KJO A;  4G7Z C;  4IAL A;  4F7X A;  5KNB A;  3JAM E;  4C3H B;  4BBS B;  1PXU A;  1BCP D;  3D6W A;  3SE0 A;  2AQ2 B;  3W3A A;  4B9X A;  2F0L A;  2F03 A;  3A56 A;  4QUF A;  1WTO A;  3NHH A;  4KY6 A;  5CV6 A;  3FEW X;  5IOD A;  1KDC A;  4XQJ A;  2QIL A;  1SYB A;  5E4X A;  1O7Y A;  3L9A X;  3VYT A;  1PFB A;  2G9H D;  1UUP A;  1I4H A;  4G4K A;  1ENC A;  1GUN A;  3ITP A;  3PIO 3;  1O7L A;  5IOC A;  3OHX C;  1E2W A;  3NE5 B;  2EDG A;  1FGB D;  1VF7 A;  3D4W A;  3R2I A;  3D6C A;  1EYD A;  2FHT A;  1WTW A;  2NN6 I;  5E1F A;  2K33 A;  4IUN A;  1AP0 A;  5C44 B;  4FYD A;  1HPC A;  3PUZ A;  4JK1 C;  1IKM A;  1O80 A;  4ID6 A;  1LTS D;  3D8G A;  2J0T D;  4DGZ A;  2VNU D;  4FXK C;  2PZW A;  1QJO A;  4IUQ A;  1Y69 U;  5M5W B;  4QCL A;  2KCN A;  2TSS A;  5DEH A;  4K14 A;  1WTP A;  1JOO A;  1HTL D;  3PUX A;  3K0Y A;  3I4N B;  1A3T A;  1TKW B;  5CV8 A;  1QG7 A;  2DNC A;  3PV0 A;  1SNC A;  3DWQ A;  4WJW A;  3EQL C;  4KV6 A;  2N55 A;  1A2T A;  4GZY C;  3NTK A;  4LJZ C;  1WVL A;  2RVL A;  4V0B A;  3CKI B;  4OO1 G;  3DMU A;  1Y1V B;  3J80 E;  1MI2 A;  2EYF A;  4F87 A;  2AWO A;  1PTO D;  4FXD A;  1PMR A;  3VR6 A;  3CRL C;  3PIP 3;  2ICE C;  1DD2 A;  3TDQ A;  1U4P A;  5CV9 A;  1CM9 A;  4DXF A;  3IKJ A;  3PMF A;  1FR3 A;  1TY2 A;  1AZQ A;  3ONA B;  3BDO A;  4K5X A;  5DM6 3;  4DAP A;  4XIG S;  2PZU A;  4I65 A;  4DA2 A;  5DNF A;  1DXM A;  1DOL A;  3H3V C;  4QMG A;  1F9P A;  1PZK D;  4C1N K;  2F0F A;  4C56 C;  2AUJ D;  1EWH A;  3MXU A;  4J8Q A;  5LL6 S;  1MGS A;  2RDH A;  5C3W A;  3HKZ B;  5T1G A;  2IX0 A;  4IFD G;  4X3K A;  3DEO A;  1SNO A;  3VYS A;  4BS9 A;  2A69 D;  1GUO A;  3TME A;  4H13 C;  2B2T C;  3GTL B;  2RA4 A;  2PZT A;  1SEB D;  1F9R A;  5KRU A;  2J7Z A;  1D1I A;  5CYU A;  2WV6 D;  4Q5V A;  4RGM A;  3PUW A;  5I2Y A;  1XTC D;  2K28 A;  2F0P A;  2HCC A;  3BDL A;  4WFN 3;  1I4Q A;  2B39 A;  1IYV A;  2G9D A;  1Q3L A;  3HG9 A;  2F0J A;  2PMZ B;  1TS5 A;  3J7A F;  1E0B A;  2EYO A;  1F9Q A;  5KGU A;  2AQ1 B;  1SJH D;  2K6A A;  5C0X J;  2L11 A;  2PQE A;  2LFN A;  1QB5 D;  4IUP A;  2GA4 B;  3W2D A;  1EZ6 A;  1LTT D;  1A6X A;  2JE6 I;  2KUM A;  2ID0 A;  1LTG D;  3V05 A;  3HOY B;  4KJN A;  1KAA A;  2JP1 A;  4QIW B;  3RUZ A;  5EKK A;  2WKC A;  4RKL A;  1HTP A;  2PNR C;  3NWT A;  3DHQ A;  3VR5 A;  4RGN A;  5IGF A;  3WOF A;  1SE4 A;  3FVQ A;  2F0H A;  2PO4 A;  1GOZ A;  2TMP A;  3Q24 A;  4FF1 A;  4ZAI A;  4QUC A;  1DYQ A;  1JC7 A;  3HOZ B;  1D6E C;  2XSC A;  2A6E C;  2L12 A;  1NSN S;  4TSS A;  4WOR A;  3PUV A;  2X69 A;  5FO7 B;  2B2T A;  2HDL A;  1YNJ D;  4KMU C;  2LY7 A;  4A3G B;  4E6I A;  2DY8 A;  5C4H A;  4ZKB B;  3TP6 A;  1A15 A;  1SNQ A;  2RBM A;  4DF7 A;  3I3C A;  1XX8 A;  2F0Q A;  5C3X A;  2NN6 H;  2B2V A;  4FF4 A;  1HFN A;  3MXN A;  1NR4 A;  1B3A A;  3DEP A;  2MP1 A;  3J81 E;  2K7V A;  2JA5 B;  5FK9 C;  4A3I B;  1K83 B;  3G7L A;  2R93 B;  3S1N B;  4HMI A;  3J7A V;  4KKS A;  4NMZ A;  1SYG A;  1G8Z D;  3S17 B;  1SDF A;  5J1Z A;  2NTT A;  2XN9 C;  2D9U A;  1SXT A;  2A68 C;  4Y7N B;  3T51 B;  3GV6 A;  2PCF B;  4DNT B;  4ZKC B;  4CKE A;  3NQI A;  4KI0 A;  1CTM A;  1STB A;  3P20 A;  3L7Z C;  5COR A;  3K6O A;  4DN4 M;  5CR3 A;  3GTQ B;  2DNE A;  1J9O A;  1CHQ D;  4HR7 B;  2K5W A;  5CMD A;  4BBR B;  2AQ3 B;  1RCV D;  5M3F B;  1G6Z A;  1I4R A;  5C3E B;  1SNP A;  4A3D B;  3QOL A;  2MGS A;  5TSS A;  5LHY 1;  4K6D A;  2LS0 1;  1XWE A;  1G2T A;  4ULL A;  4DAV A;  1QOH A;  1GXD C;  2EYM A;  2KA7 A;  2KOL A;  1Q8I A;  5A35 A;  3MHB A;  4K8I A;  2EYH A;  2FMM A;  3RD4 A;  1PRT B;  4BA1 I;  3I4M B;  2KHS A;  3P75 A;  1RD9 D;  4XXE A;  1SND A;  1E2Z A;  2F3V A;  1YNN C;  3T13 A;  1CZW A;  3I72 A;  5I6W A;  2Q8R E;  2NN6 G;  1DZ1 A;  3O13 A;  1T5X D;  4FXG C;  3S1Q B;  2WAQ B;  3MFY A;  2B8F A;  3SHL A;  2KVM A;  2L9H A;  4IFD J;  2CW0 C;  2A6E D;  2EOT A;  4ME5 A;  4S3S A;  1UNS A;  1DOM A;  1X3P A;  2C9O A;  2EJF C;  2KCC A;  4RH6 A;  1AFP A;  4LMQ D;  1K8M A;  4IQZ A;  3MFG A;  5C5M A;  1SE3 A;  1CQV A;  3CRK C;  5F2D A;  2K05 A;  1TWH B;  2WII B;  1F2M A;  2EY1 A;  1NCV A;  1TWA B;  3M3Y B;  2F0E A;  1I50 B;  1O7Z A;  5K36 G;  1ENA A;  4NP5 A;  4L8J A;  1W6K A;  2F0W A;  5I4D A;  4RHR A;  1WTR A;  2JYO A;  1EL0 A;  1CA5 A;  4N9T A;  3Q6S A;  2BE5 C;  1LT3 D;  3F2U A;  2A68 D;  1LV9 A;  2MPM A;  3KLR A;  3QIA A;  3NTI A;  1PDQ A;  1STG A;  3WDN A;  1HHV A;  1ZXT A;  5CBA E;  1QWY A;  3R3O A;  3VYR A;  1D1K A;  1Q1E A;  2NTS A;  1H9M A;  1X32 A;  4RHS A;  3D3R A;  4HAE A;  3TP7 A;  5EPL A;  4A3M B;  3OWE B;  3EVQ A;  3K7A B;  4ZK9 B;  1U4L A;  3GP7 A;  1STA A;  2IJ0 A;  3I90 A;  4OO1 H;  3D4D A;  2MHV A;  1SAP A;  3SK4 A;  1KLU D;  5IT9 L;  2F3W A;  2Q8T A;  1GUS A;  1M8A A;  1BF4 A;  5EKI A;  1EEI D;  3K5O A;  3K5N A;  1YNN D;  3AU7 A;  4KN7 C;  4A3B B;  3CHB D;  1Q12 A;  1EY9 A;  3DWA A;  2ENB A;  4C3I G;  1RJT A;  2X6G A;  5C4J B;  3HOU B;  4XT3 B;  5I9O A;  2O5I C;  4C2M B;  1D5X C;  3P7J A;  1PRT F;  5E4W C;  4V19 0;  2IT1 A;  1BBX C;  2CW0 D;  2EY6 A;  4LK1 C;  1B50 A;  1DM0 B;  3H0G B;  2F0I A;  2N88 A;  3SK8 A;  1HUN A;  2F0K A;  5ELD A;  3UI2 A;  1Z7T A;  2F1M A;  3H91 A;  4FF2 A;  1ZEQ X;  2F0G A;  4KK7 A;  1UEA B;  4AYB B;  1S4Z A;  2ICI A;  3C3L A;  5EPJ A;  1XXG A;  5KNC A;  4IFD H;  1TWG B;  5COY A;  3ND9 A;  5JVG 3;  3A8J E;  5C4Z A;  1G29 1;  2SEB D;  3IFD A;  4RWS C;  1JQY D;  2JA8 B;  4LAA A;  2HQE A;  1PYW D;  5JEA G;  2CVR A;  4A3J B;  3KK7 A;  2NVQ B;  5M3M B;  2IL8 A;  3I91 A;  1JR0 D;  1U4R A;  3H6M A;  2XIW A;  2HDM A;  1PRT C;  2BE5 D;  3NWS A;  3NK9 A;  4MN3 A;  1IHZ A;  4CHT B;  5A2Q E;  4IUU A;  3H09 A;  5KYL A;  5BN5 A;  1JB3 A;  2FIN B;  1QIL A;  2F0O A;  5JJZ A;  4IN3 A;  3DWP A;  1STH A;  2KEC A;  4O42 A;  3J7Y W;  1OXX K;  4RAU C;  2E2D C;  3FMC A;  3MAQ A;  1ICW A;  4DFA A;  2LKV A;  1I4X A;  3SXH A;  2HCI A;  1NUC A;  4BA2 I;  2F0S A;  1IW7 C;  1EEF D;  3A8I E;  3NP8 A;  2X6L A;  2H1E A;  5FLX L;  3C46 A;  1BCP B;  2IX3 A;  3A7A B;  1EU4 A;  3ERQ A;  2H4O A;  1LT5 D;  4F8M A;  1I3Q B;  1S5C D;  4FF3 A;  1RF2 D;  3VA5 A;  1F2Z A;  5EKL A;  3GTJ B;  5EGT A;  1HA6 A;  3JAM L;  1II3 A;  2BCO A;  2MJ8 A;  3MXP A;  5K5P A;  1TY0 A;  5J22 A;  4XYQ A;  3LWE A;  4I7Z C;  5D65 A;  1WTX A;  1EYC A;  2XRQ D;  3C2P A;  2NB0 A;  3ERO A;  5AFW A;  3HEJ A;  2VXW A;  1SYE A;  4QF4 A;  3HOX B;  3TZU A;  5KEE A;  1D5Z C;  3KBG A;  2K5D A;  1CK1 A;  2B2V C;  1ESR A;  1HXY D;  2XNA C;  1MSH A;  3RMH A;  4NKL A;  1DJR D;  2ZT9 C;  3E0J A;  1S5E D;  3DM1 A;  4OHJ A;  3Q23 A;  1QNK A;  3KLS A;  4A3K B;  2A5H A;  3I73 A;  1PZJ D;  2I07 B;  4RCO A;  3N52 A;  4HMJ A;  3S15 B;  4CJ0 B;  4KD3 A;  1S5B D;  4K6L A;  2B2Y A;  3HP3 A;  3SEB A;  1G2S A;  1PTO H;  1PRT D;  1TS3 A;  1C4Q A;  2WB1 B;  3BZD B;  3MVV A;  4Z9C B;  3K57 A;  2OT2 A;  2YU9 B;  1DCZ A;  3PUY A;  4RKB A;  2VUM B;  1DON A;  3TSS A;  3C1E A;  4H44 C;  4DK1 A;  3M4Y A;  4HED A;  1PTO B;  2Z4I A;  5D3I B;  2A74 C;  5CBE E;  3AMU A;  2IPK D;  2B2U A;  3J80 L;  3BG3 A;  1JE4 A;  2E2J B;  2XVS A;  2ZXP A;  4KY5 A;  3DUZ A;  4PMW A;  4B9W A;  1T5E A;  3CU7 A;  4MIU A;  2JA7 B;  4OIJ A;  3QOJ A;  4FP5 D;  2RSN A;  3IAY A;  1KDA A;  3BVM A;  1Y8N B;  4KHV A;  4K2L A;  2WP8 J;  5JEA J;  4YIJ A;  4A93 B;  2SOB A;  3SK6 A;  2CQA A;  4PMC A;  3OOC A;  5KND A;  1B44 D;  1STY A;  4OIK A;  1R4Q B;  1R4P B;  1ML0 D;  1ILQ A;  4KD4 A;  1LTR D;  3S1R B;  1RTN A;  3A8K E;  3OIP A;  5ELF A;  1KTK A;  4ZQ3 A;  1GUG A;  5K36 H;  5EBD A;  3LX0 A;  1LO5 D;  4DNR B;  1CZG A;  5KYI A;  3MC0 B;  4IUR A;  1SYC A;  1LAC A;  4IZ8 A;  2F4I A;  2WIN B;  1STE A;  2E76 C;  5HGT A;  3NQT A;  1GUT A;  4K8J A;  2Z8L A;  3M85 A;  4NW2 A;  4PQX A;  2JA6 B;  2NVX B;  4TQU S;  1QCB D;  4ZRZ A;  4FO2 A;  2E74 C;  3BYT B;  3T56 B;  1AW7 A;  4UAI A;  3KLS X;  4G7H C;  3KUP A;  2M2L A;  1PZI D;  4OGQ C;  3T16 A;  1EY0 A;  4KN4 C;  1TQO A;  4EVO A;  3IFT A;  1BNZ A;  1HCZ A;  1FYC A;  1EY8 A;  1SYF A;  5ELC A;  3KF8 A;  1ET6 A;  5IGD A;  2EY2 A;  2ZXR A;  3OWF A;  4ZUJ A;  2Z1C A;  3SDZ A;  1HRJ A;  1JWU D;  2KQ3 A;  3QG1 A;  1F2Y A;  5BN3 A;  1Y8P B;  3S14 B;  4HSP A;  1PFM A;  3U9O A;  1BO0 A;  3I70 A;  5ELE A;  4DAY A;  1X3Q A;  1SMY C;  1B9N A;  4ZYS A;  4PMB A;  1TS2 A;  3Q0A A;  2L0C A;  3R8B A;  2SNM A;  4HSV A;  1STN A;  4TKO B;  1BOS A;  4X3S A;  5ISR A;  1B2T A;  1PFN A;  2Z4H A;  3S2H B;  3VR3 A;  1ZKO A;  3A55 A;  3K5M A;  1A2U A;  1OXU A;  4ODG A;  1MD2 D;  3MWY W;  4J1M A;  3AB9 A;  4IUV A;  3G6J B;  1XYI A;  1TS4 A;  5JPN C;  3URY A;  1Z6H A;  1LT6 D;  4L6T B;  1EY7 A;  5FO9 B;  5JPM C;  2VB3 X;  4C3I B;  4XDX A;  1IL8 A;  4A3E B;  3BVG A;  1CT1 D;  1JIC A;  1E2V A;  3NBI A;  3SVM A;  1FNU A;  4R8N A;  5JAV A;  3TP8 A;  4NDX A;  5T1I A;  5FO8 B;  3RZO B;  3J81 L;  2F0U A;  4U67 3;  1V1P A;  3K59 A;  2QDB A;  5FOB B;  1CHP D;  1I6V C;  4TRD A;  3M4O B;  5JEA H;  1EQT A;  5EPK A;  4EQO A;  1HUM A;  5D3D A;  2B2W A;  4KKT A;  1JCK B;  4BY7 B;  3X3N A;  2K01 A;  4G57 A;  1BXT A;  3EJI A;  5NUC A;  1AZP A;  3OSO A;  1D2B A;  2E75 C;  4K5W A;  2NVT B;  1EZ8 A;  2B8G A;  2E2I B;  2NWG A;  4C1N I;  4CJ1 B;  5EJW A;  2NYZ D;  3I4L A;  1H9J A;  3VR2 A;  5CC4 A;  5JOB A;  3GD7 A;  2EJG C;  1W6J A;  1PLF A;  1FD7 D;  1SSO A;  2L1B A;  2SDF A;  3EFX D;  3D4R A;  2F0N A;  2RQX A;  3BS1 A;  5IGG A;  4U68 A;  2F0T A;  2K5Q A;  3FRP B;  3FPU B;  3K58 A;  5HUR A;  1ZYR C;  3TN2 A;  2IW3 A;  1ET9 A;  2AUK A;  3QJY A;  3E5S A;  1OO9 B;  3NUC A;  2A69 C;  2KJX A;  1EFI D;  1JWS D;  1EQV A;  3FDT A;  1B1Z A;  5ELB A;  1Y1W B;  2O5J C;  2O2L D;  1H9R A;  1Y8O B;  1SMY D;  2A73 B;  2BA0 A;  4G7O C;  1TU2 B;  3NTH A;  2JSO A;  2DN8 A;  1VCI A;  4XQQ A;  3MTS A;  1BUV T;  4C3H G;  4M8A A;  5I2X A;  1K8O A;  5KIX A;  1V43 A;  2QKI C;  3VA7 A;  4K5V A;  2XWB B;  1RTO A;  1VDZ A;  5M5Y B;  4L63 B;  4X3T A;  3H94 A;  1GJX A;  4DU9 A;  5G3L F;  2F0V A;  3L3O C;  1DOK A;  5IGE A;  1V8Q A;  4BY1 B;  4UDU C;  5M9O A;  4CBV A;  4F88 A;  4RFB A;  4Q0F A;  2RDF A;  4H0L C;  3R93 A;  2SNS A;  2PYK A;  2BDN A;  3OPO A;  1ESF A;  4P2C B;  3T4A C;  4R8I A;  3S16 B;  1A3V A;  5E3F A;  1H9S A;  4FVM A;  2B2Y C;  2EY5 A;  4KTA A;  5C0X I;  5C6A A;  4R9W A;  3TP5 A;  2RSO A;  2D62 A;  3ND8 A;  3WOE A;  2BOS A;  2L5T A;  2A6H C;  1GUW A;  4N9P A;  1LT4 D;  1AEX A;  3TBI B;  4KHZ A;  1SFO B;  1BQQ T;  4EQP A;  3OMG A;  1C48 A;  1SE2 A;  1S5F D;  1YNJ C;  3GO5 A;  1B9M A;  1HQM C;  1V1P B;  1CFM A;  3OIQ A;  1TR5 A;  2NZ1 D;  3HZX A;  2R61 A;  3I8Z A;  1EOT A;  2ZXO A;  2Y0S B;  4X3U A;  2BDO A;  2K03 A;  3GV3 A;  2B2U C;  1ZYR D;  1SJE D;  3QB3 A;  5CV4 A;  5IIF A;  1OXT A;  1JOR A;  1KLG D;  1EU3 A;  1FNV A;  2WKD A;  1IKL A;  1S5D D;  1EY5 A;  4QB4 A;  4BWG B;  4PV1 C;  5EBC A;  2AWN A;  5LL6 X;  3GTM B;  1TII D;  5CV5 A;  5I6Y A;  2OEO A;  3GTG B;  2JXM B;  1WTV A;  4EQN A;  1JOK A;  3EA6 A;  2OXP A;  1ILP A;  2EZV A;  1RHP A;  2R3Z A;  2CHB D;  5CGK A;  3PO2 B;  3S9W A;  1I4G A;  2NUC A;  2EYL A;  4IUT A;  1M4V A;  1H9K A;  1EYA A;  3VR4 A;  2E2H B;  3MA2 B;  2PW5 A;  1OXS C;  1TVX A;  1NAP A;  2L55 A;  1GHK A;  5DAU A;  3U9S A;  1B4O A;  2NVY B;  1AN8 A;  2O4X A;  2EE1 A;  1TWF B;  1OXV A;  3QWN A;  1U4M A;  3R2T A;  1B53 A;  4RA8 A;  4EGV A;  3HRZ C;  2LMC B;  4HCS A;  1F77 A;  3HS0 C;  3A54 A;  4MHE A;  3GQB A;  2D5D A;  1BR9 A;  2JEA I;  1VMC A;  4OO1 I;  3BYY B;  1EIH A;  4ZLT F;  4J6H A;  4ABN A;  1IW7 D;  2EYJ A;  5A2Q L;  2YYZ A;  2EYP A;  3MEH A;  4DK0 A;  2K32 A;  1F9S A;  5EQ0 A;  3K5L A;  5G3L D;  2V4D A;  2A6H D;  1KAB A;  3S2D B;  1Q1B A;  4XQN A;  4C3J B;  3FPP A;  1LTB D;  1O78 A;  2K1B A;  3SR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...