4DV0L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv0L00
3IRBA 4DUZL 2ZTDA 3PUXA 4HJAA 1VQ8A 4LF6Q 2JA7H 3F1ZA 4AYBE 4C3JH 5C0XG 3OTOL 5HGQA 1UE6A 3NBHB 3RZDH 1PHJA 3CP0A 2KHJA 2UUCL 5ELNA 5JJIA 4OX9Q 3TRZA 2ATWA 2MQHA 1U0LA 3AQQA 3W1GA 4JBWA 1J5EL 4QJFA 4LF7L 4POGA 1YNXA 2UXBL 3GDEA 1MKHA 1VCIA 1Q82C 2Q2IA 2BH8A 1U5KA 3HOVH 2A8VA 3AYHB 4DV4L 5HY6A 4X66Q 1VQ6A 2CWAA 1Q7YC 2UUAL 5JJKA 2AWOA 4BBRG 1N36Q 3CCMA 1IXRA 4HIKA 2UXDL 4A3GG 3H0GH 3EIVA 2Q2HA 1A8VA 3BU2A 4YWLA 1MJEA 1IBMQ 1IL2A 3PO3H 3T1YQ 4GOPB 3CCUA 1NBWA 2PI2A 1L1OC 3U4VA 4DV3Q 1PH9A 4Y7NH 3CC7A 2F4VL 3PCOB 4JI0L 3M3YH 3S16H 5IP9G 3ZJYC 1CKNA 2Y0SE 3UDFA 4OWTB 4LF5L 1X3FA 1YBYA 1VQ5A 3I4NG 1OXUA 3L0OA 3J81j 1K73C 2JJQA 4A4IA 2ZJRA 2RHQB 2A19A 4YWMA 4JCVE 2YTYA 3K7AH 1IYJB 4DV2L 2E5LL 2CQOA 1Q81C 1IBLL 1BVSA 5DLQE 4JI1Q 4DPGA 3D0FA 3W5OA 4DV1Q 2VUMH 4OO1I 2JA5H 2VQEQ 1P8LA 1CSPA 4JG2A 4B3TL 2AMCB 4A3KH 4JC0A 4DAYB 4JI3Q 2VY3A 4IPDA 3KFUA 4X62Q 2KHIA 4KLKA 1A0IA 2D0PA 4DV6Q 1VQAA 3GO5A 1JJ2A 3I4MG 4KI0A 1PH2A 4C3IH 4DUZQ 2CCZA 3AEVA 4WJ3M 4R4CA 2R92H 2V1CC 3OTOQ 5IYDH 2VQFL 2N78A 2UUCQ 2N8NA 3WWVA 5IP7G 3CCJA 4A3JG 4A3CG 4LF7Q 1J6QA 1X3EA 1J5EQ 4LF6L 4BY7G 1WCMG 1MJCA 2XGTA 3PIOA 1XPUA 4A93G 2IY5B 5IY0A 4R4TA 3UDGA 2IX0A 3OYYA 4OX9L 4YCWA 5JJLA 1H95A 1RIPA 4DV4Q 1D8LA 2K4KA 5GAEC 1VS0A 5FLXc 1FVIA 3GTOH 1VQBA 3W1BA 4BA2I 1VQGA 3OW2A 3CC4A 2UXDQ 5M5XH 4P72A 3I55A 4A76A 1X55A 4LWCA 4DV7L 3LGJA 4IJLA 1N36L 4AQYQ 4GOPA 1W2BA 2E2HH 1NMFA 4NXMQ 1Q8KA 2AHOB 2OCEA 2KENA 3S15H 5FJ8G 4LUVA 4PG3A 4HJ5A 2F4VQ 1I3QH 1IBML 2NZHA 2B3GA 3PUWA 1LYLA 3T1YL 2IHEA 4OWWB 2A1AA 1NJIC 1EFWA 4JI6L 2LXKA 3M4QA 1PH3A 1P16A 1X9NA 3CCLA 3GTGH 5GAGC 3GD7A 5E7NA 3AFQA 3RLOA 4DV2Q 2E5LQ 3BZKA 1IBLQ 2JA8H 1M90C 3KYHC 4NXNQ 1VQ9A 1QVFA 2JA9A 2F52A 2N3SA 1JJGA 4DV0L 1TWFH 4A3EG 4DR6Q 4DR7L 4DR1L 3TS0A 2ZTCA 1Q12A 3HOXG 4DV1L 1Y1WG 1YZ6A 4JYAQ 5C4XG 1YJ9A 1VQNA 2VQEL 1OTCA 3CF5A 4LFCQ 2JA6H 3PGZA 2H5XA 4LF4L 3KF8B 1Q1EA 3JC66 4JI2Q 4BBSH 3RN2A 4IFDG 1UEBA 1V43A 4X62L 5M5YH 2VQFQ 4R4QA 3J80c 1KC8C 4HJ9A 3KDFB 4BBRH 4DV6L 1PYBA 2PNHA 2YU9H 3MXNB 3G6EA 3FHWA 1HNXQ 4NB3A 4GN3B 3CPWA 4GLXA 3GTJH 4L5SA 4A3GH 1PH4A 2XTIA 1Q86C 1W3SA 2L15A 4JOIA 1WJJA 1EUJA 2WFWA 3PSIA 3HOWG 4A3BG 2RCNA 4PZ8A 4BY1G 3RNUA 1HNZQ 3RR5A 4A75A 4LUZA 1T9HA 2NVQH 1Y1VG 5C3EG 4WJ4A 2HIXA 2R7ZG 1FGUA 1QUQB 3CQZH 1VQIA 4L5TA 4TVAB 5IP9H 1PV4A 2PMZE 2OWOA 3F8TA 1TXYA 1CUKA 1NMGA 1WFQA 3E9IA 4EQ5A 4DV7Q 4XTCS 2I5HA 2E8GA 5GAHC 3RZOH 2VL6A 2PI2E 4IOCA 4A3MG 1XJVA 2VW9A 4OXPA 3FKIH 3J80i 3K81C 4AQYL 4NXML 1N32L 1N8RC 3S1MH 3KJPA 4JI6Q 3K7UC 4NPSA 3HKZG 3CCVA 1G51A 1C7YA 4LNQA 1RL2A 1V9PA 4UP8A 2R93H 1I6HH 2VZAA 3HOUG 4A3DH 4KHPL 1PVOA 1XNQL 1A63A 1K3RA 1HZCA 4LFBL 1UWVA 3DM3A 4B3SL 3S17H 1AH9A 4OONA 3I4OA 4L5RC 1FJGQ 1PA6A 2HQLA 2R7DA 2Z0SA 3E9HA 1KHIA 3H3VH 4DV0Q 4HIOA 4RG1A 1VQ4A 1M1KC 1YHAA 3BZCA 1YIJA 1GM5A 4DR7Q 1I50H 4DR1Q 5LMNQ 1GD7A 4NXNL 2B63H 1X54A 1JJCB 4GN5A 3SGIA 4A93H 5H1SE 4DR6L 4LF4Q 1G291 1L2FA 1WYDA 2E2IH 1K0RA 1HZBA 3CAMA 5IYBH 4JI4Q 4TQUS 5LMUQ 4A3FG 2UXBQ 4K0KQ 2MFIA 3KDFA 4LFCL 1PH1A 4GOPC 4JI2L 3J81c 1PH6A 3GTPH 3S14H 4GNXB 2C35B 1SR3A 2QEXA 3S1QH 1DGSA 1CKMA 3A0JA 1WI5A 3H0GG 4YY3L 3M85A 2Z6KA 2Q2TA 4JBMA 4JI5Q 3GTLH 1HNXL 3PO3G 1VQMA 1YJWA 1C9OA 5JEAJ 1HZ9A 5FJ8H 2R6GA 4UPAA 3RN5A 4X64L 1K8GA 1QUQA 4HJ8A 1VQLA 1UE5A 3ICEA 4A3IG 1XNRQ 3A5UA 2OTLA 3HOYH 1EYGA 1HNZL 4A3LH 1VQ7A 1VQFA 1L0WA 4RMFA 1OXTA 1EOVA 3UE1A 3EN2A 4PZ7A 3HOZG 1KAWA 4P71A 1EIYB 1A62A 2NN6I 3T1HL 4GS3A 4YCVA 3H15A 1B70B 1PH7A 3CD6A 3U50C 3M4OH 2LSSA 4OO1G 2NVYH 3KJOA 3PO2H 1AE2A 2JA5G 1QVCA 3NENA 2IHFA 4DAMA 4HIMA 3CCEA 1X56A 4A3KG 5M3MH 1Y1WH 3ULPA 3F2BA 4JBKA 2KBNA 2GVBA 2R7FA 5C4XH 4MTNA 4KHPQ 1XNQQ 1V1QA 2PQAB 4LFBQ 2HIVA 2JK8A 4B3SQ 2ASBA 3S2HH 1E1OA 3MEFA 1PH8A 3GTQH 2I0QA 4GKKL 1S3OA 4BXXG 4JI8L 4JOIC 5FLMH 5LMNW 2QGQA 3U4ZA 4UP7A 1CSQA 2E2JH 1D7QA 1FJGL 2OTJA 4GKJL 1KRTA 3A74A 2BA0A 3J7ZC 4IPHA 1K9MC 1UE7A 2I5MX 4ME3A 3L7ZC 2K5HA 3RLNA 5IYCG 5C0XI 4APVA 5LMNL 3U58A 3EBEA 1B8AA 1OXVA 3I7FA 1EQQA 4LW1A 2D0OA 2UUBQ 3HOWH 1PH5A 1X6OA 4PZ6A 2NZOA 2OQKA 4P74A 5C3EH 1YJNA 5ELOA 5BR8L 2R7ZH 4P75A 4L5QA 4R4OA 4R4IA 1IZ6A 4GNXA 1QZGA 3TS2A 1XPOA 2NVXH 5J3BA 4DR3L 4JI4L 4B3RL 5LMUL 1GO3E 1HNWQ 4DUYL 4HIDA 1VQDA 4IPCA 3CXCA 2MNAA 4YY3Q 4YCUA 4FDBA 3PV0A 4K0KL 5IWAQ 4DKAC 1KL9A 5C44G 1YHBA 2EIFA 3PUYA 2HHHQ 1O7IA 2MO1A 3TQYA 1FL0A 4C3HH 4A3MH 4R1JA 4JI7L 4JI5L 4X64Q 1ASYA 1X65A 2DGYA 5GROA 3A5ZB 4LFAQ 2NVTH 4DV5Q 1QVGA 2WAQG 1EWIA 3HOUH 1NY4A 3TEHB 1YI2A 3T1HQ 1XNRL 3S2DH 5C0XJ 1PYSB 4P73A 3I4NH 2I5LX 1L1OB 2K50A 1I94Q 2JA8G 3I56A 4POFA 4C2MH 1Q46A 2YTXA 3Q8DA 4DR4L 1I5FA 2RF4A 4A3LG 2OQ0A 1HH2P 2FXQA 4DK3C 1SMXA 5M3FG 2GVAA 2JQOA 2WAQE 1SFOH 2YV5A 3J7A5 2PQAA 4IOAA 1KXLA 4X6AH 3ULJA 1BBUA 3S24A 2JA6G 4O0AA 4YWKA 4GKKQ 4YHHQ 4UP9A 2CKZB 4BBSG 5IT9c 1BBWA 4JI8Q 4A3FH 1SN8A 4GN4B 4B3ML 2Z6KC 3FP9A 1SRUA 2EXDA 3I4MH 1X3GA 3CMEA 5C4JH 4GLVB 1JT8A 4GKJQ 4DR5Q 1BKBA 4LUOA 2YYZA 2Y0SG 1G6PA 1XMOL 3D31A 1E1TA 2JA7G 3ULLA 3H3VI 4J15A 2K52A 1E3PA 2LXJA 3HKZE 5IP7H 4A3JH 2ZJQA 2ZJPA 4A3CH 3CCRA 1MIUA 2UU9L 2UXCQ 4BY7H 2ALYB 1WCMH 1K83H 3PF4A 3BJUA 4MNOA 1XMQL 1HR0W 5BR8Q 1OXXK 4JV5L 1ASZA 3UE0A 4X65L 5AJ3L 2UUBL 1N34Q 4A3IH 4B3RQ 3NEMA 4DR3Q 4UY8C 1UE1A 4DUYQ 3HOVG 3K8AA 4AH6A 2ID0A 1TWHH 4JYAL 2RHSB 1QZHA 2YTVA 4KHZA 1VQOA 1HR0L 2VS1A 2GN5A 1YVCA 3HOZH 1LTLA 2DUDA 4BA1I 3G71A 1SE8A 3S1RH 4IO9A 1HNWL 5K36G 3JAMc 4JI7Q 3KF6B 4OWXB 5M5WH 4DR2Q 2CFMA 3UDIA 3FKIG 5IWAL 1OXSC 3M9BA 1VQJA 2HHHL 1N33Q 4QQBX 4QIWE 4IPGA 1EQRA 1S72A 2IT1A 3DLLA 4QL5A 4LF8L 2IX1A 1C0AA 1JB7A 2R93G 1SROA 1IBKQ 4GLAC 4LFAL 5JEAG 4A3DG 1L1OA 1Q1BA 4DV5L 2JEAI 3K80C 4QGUA 4BXXH 1LUZA 2MO0A 2N49A 1NTGA 4XIGS 4HJ7A 1YITA 4LF9L 2ZM6L 1KIXA 4DR4Q 4DK6C 3GTKH 1LM0A 3HKSA 4H02A 4QY7A 3HOYG 2K75A 2ZTEA 3PUZA 4JBJA 1I94L 2WP8J 1GVPA 1KD1C 2JEBI 2VUMG 3J81i 2B63G 4A3EH 3CMAA 1E22A 3M4PA 3I2ZA 3S1NH 3F2CA 5IYCH 3JAMi 1Y14B 3HOXH 3NELA 5GQOA 4GNXC 4ALPA 1PFSA 1GKHA 3STBD 3UDXA 4B3MQ 3CCQA 1NE3A 2BA1A 5IYBG 3CW2C 5IE8A 1VQKA 2WB1G 2UUAQ 1YEZA 1HJPA 1VQCA 2HT1A 2VNUD 2ES2A 4YHHL 1VQPA 2B29A 1XMOQ 4PMWA 2R92G 4IFDI 5IYDG 1EIFA 1XTDA 3PUVA 4X66L 1YHQA 4DNIA 3CPFA 3K0XA 3RLFA 1VQEA 1TWAH 3STBC 5C44H 4DR5L 1VQHA 2UU9Q 3CC2A 1XMQQ 4JV5Q 1E7ZA 2D62A 2WB1E 4X65Q 5AJ3Q 1TWCH 4JI0Q 4A3BH 2QA4A 4BY1H 2UXCL 3PF5A 1E24A 1JMCA 4LF5Q 1S40A 1KQSA 4DV3L 1Y1VH 2KCMA 5GADC 1CKOA 2K5VA 1K8AC 2AKWB 3G48A 5EAYA 3TREA 1HR0Q 2NN6G 1N34L 1AE3A 1CKNB 3CCSA 2BH2A 2K5NA 1HZAA 3KF6A 4MZ9A 2KCTA 3E0EA 4O2DA 3F2DA 2EQSA 2AWNA 3HFZB 3KLWA 3PO2G 1KRSA 2CWPA 4LF8Q 4B3TQ 3PIPA 3GTMH 2K14A 4DR2L 1B7YB 4IJHA 4JI1L 3ERSX 5M3MG 5M3FH 4IFDJ 2JE6I 3L2PA 4AYBG 1N33L 1JE5A 2F3IA 4Y52H 3KOJA 3G4SA 3ER0A 1N32Q 4JI3L 4EX5A 1R9TH 4LF9Q 1Z47A 3AFPA 1N9WA 1Z9FA 4AIMA 1TWGH 2ZM6Q 1IBKL 3VDYA 3B6YA 2Q2UA 5FLMG 1SLJA 1WOCA 1XPRA 3M7NA
chains in the Genus database with same CATH superfamily
4HSVA 4LF6Q 3E3XA 4AYBE 3OTOL 1H9SB 3RZDH 1PHJA 3CP0A 2KHJA 3CKIB 1K3BC 3I90A 1Q8IA 1BCPF 1LTGD 3AQQA 1RHPA 4JBWA 4QJFA 1F2YA 1MKHA 1U5KA 1WTHA 4ODGA 1LLRD 1EFID 1I6HB 3AYHB 4DV4L 1EYCA 4HTHA 3I4MB 3S17B 3M7GA 5C4JB 2SNSA 4HIKA 1WTOA 4A3GG 3EIVA 1ZXTA 1IL2A 3CCUA 2RDHA 4BY7B 4HMJA 3VR6A 2F4VL 4JI0L 3M3YH 2AUKA 3ZJYC 2WIIB 2A69C 1BOSA 3UDFA 3MWYW 4LF5L 1X3FA 1YBYA 3I4NG 1XX8A 4N9TA 2ZJRA 1VMPA 4G7HC 3S14B 2E5LL 1IYJB 1GUGA 4V190 1BVSA 1T5EA 5M5WB 4DV1Q 2QW7A 2VQEQ 1I4QA 4JG2A 4B3TL 2AMCB 4JC0A 3PQIA 3NUCA 5EGTA 3TP7A 4G7OC 4IPDA 3H3VC 2B8GA 3KFUA 1TR5A 3ERQA 4LJZC 1JJ2A 1G91A 4KI0A 5ELDA 5D14A 2CCZA 4P2CB 4XYOA 3GV3A 4R4CA 2WACA 3MAQA 5I9PA 4UAIA 2KHSA 2N78A 4IUTA 5G3LF 5IP7G 1JWSD 4IQZA 4LF7Q 1J5EQ 1WCMG 1DXMA 4U673 4A93G 5IY0A 3S1NB 2F0FA 2IX0A 3OYYA 4OX9L 4YCWA 1RIPA 2QDBA 3JAML 3MHBA 2MHVA 1FVIA 5C5MA 1VQGA 3W2DA 4DXGA 2KCCA 2D5DA 5M5XH 5TSSA 1X55A 4LWCA 4KN7C 3J81E 4DV7L 3LGJA 1VMCA 4GOPA 2KENA 2K5DA 2BDNA 2RA4A 3H6MA 1I3QH 3KLRA 4J8QA 3WOFA 1LYLA 3T1YL 1TWCB 2BE5C 1NJIC 1EFWA 3C3LA 3M4QA 3GTGH 4DV2Q 3AFQA 1MBYA 3FPPA 3P1HA 1TT2A 2N3SA 4DV0L 5LL6S 2XWBB 4DR6Q 1V1PB 3GTMB 4DR1L 1SYCA 5C4XG 1OTCA 2NVTB 4LFCQ 2JA6H 2EXZA 2H5XA 1Q1EA 3JC66 2HDLA 4IFDG 1V8QA 3FPUB 3HOUB 5CR3A 5M5YH 4UHVA 4X62L 1EZ8A 1TWGB 3NWSA 4DV6L 4MTKA 3G6EA 5KNCA 4QUFA 1SNQA 4GN3B 3CPWA 1O7LA 1Q86C 2L15A 1EUJA 1A2TA 1HNZQ 1BF4A 3F8TA 3VR5A 4QCLA 4OIJA 1LTBD 2I5HA 3VYRA 1DYQA 1ENAA 2E8GA 4U68A 2F0LA 5BN3A 4QF4A 4A3MG 2JXMB 3H0GB 4O1NA 4XQQA 4QB4A 4NXML 3PO3B 1N8RC 3NWTA 3K7UC 1QB5D 4KD4A 2R93H 5I9OA 4A3DH 3S16B 1XNQL 4KHPL 1A63A 1HZCA 3FVQA 2IJ0A 4IALA 2HQLA 1PA6A 4HCEA 3HOZB 3DM1A 1PLFA 3ITPA 1HFGA 3A55A 1VQ4A 3IFDA 1M1KC 3OWEB 4DR7Q 4RCOA 5LMNQ 2XIWA 1GD7A 4CDDC 1XWEA 1UAPA 2JA5B 5C3XA 5EKLA 3KF8A 3O13A 1SBBB 1ESRA 2HCIA 3OMCA 3J81c 1J8IA 4C3IB 5JPMC 1DGSA 1CKMA 4YY3L 1SAPA 1HNXL 2PW5A 1VQMA 4CJ2C 1STGA 1TY0A 3T13A 2ZXPA 3SK4A 5FJ8H 4DNRB 3LWUA 4UPAA 5E1FA 2XWJB 3RN5A 3ICEA 2F0PA 3H91A 1VQ7A 1Z7TA 1CTMA 1EOVA 2X69A 4DU9A 1KAWA 3GTOB 1DONA 3K0YA 4FNFA 3H15A 1M8AA 1B70B 2A5HA 5FO9B 1JOOA 1CA6A 3CU7A 2LSSA 4R8NA 3NSWA 3NENA 1WTWA 4Q0FA 3RMHA 3CCEA 5M3MH 4JBKA 2EYLA 2PQAB 2JK8A 2ASBA 3S2HH 1EWCA 3ND8A 3RUZA 3NE5B 3E5SA 1PH8A 2E2DC 3VA5A 2OF1A 2WAQB 4XT1B 4BXXG 1SNCA 1ET6A 1YNJC 5FLMH 3VR2A 4UP7A 1D7QA 2JA8B 1FJGL 1KNEA 5A2QL 1CI3M 2I5MX 2QKIC 5FLXL 2K5HA 5EQ0A 3HOWH 1OXVA 1EQQA 4LW1A 3KUPA 1CZGA 2BCOA 1YJNA 2R7ZH 1IZ6A 2B2TC 4RWSC 4BBSB 1HNWQ 1IKLA 5LMUL 1GO3E 3ND9A 2D9UA 4IPCA 4J1MA 3CXCA 2MNAA 1SE2A 4DUYL 2UXBL 2F0NA 3V05A 5IWAQ 5C44G 5I6YA 2Y0SB 4C3HH 1FL0A 1RODA 1HA5A 3HZXA 1K8MA 4DGZA 2B2YC 4FP5D 3BZDB 2NVQB 2F0IA 3T1HQ 2EYFA 4I7ZC 3F2UA 5KNDA 1J9OA 4PNYA 1SMYD 2ZT9C 1I5FA 4H44C 3L3OC 4H13C 1IW7C 4F87A 1SNMA 1NUCA 4X6AH 3P75A 2JA6G 4LMQD 2OT2A 3M3YB 1BBWA 4Z9CB 4JI8Q 4A3FH 4B3ML 2Z6KC 1RF2D 1SRUA 1HUMA 3FP9A 3I4MH 4IUUA 5C4JH 4GLVB 5LL6X 4GKJQ 3OSOA 2A69D 3ULLA 1B3QA 4J15A 3MXUA 1Y8OB 3HKZE 2PZTA 4BWGB 3CHBD 1EY5A 4BY7H 1K83H 4OELB 2B63B 1HQMC 2RCFA 3T53B 3UE0A 1WTVA 1N34Q 3D6CA 3NEMA 4DR3Q 2E2IB 4UY8C 3HOVG 1B9MA 4DAVA 3NTHA 1LT6D 4X3SA 2VS1A 1BNZA 1SE8A 3BG3A 4IO9A 3GTPB 1A3UA 3KF6B 5M5WH 3S1QB 2X6GA 1D6EC 1EQRA 2R93G 2F1MA 3PIO3 5JEAG 1QG7A 5JJZA 4A3DG 3DEPA 5NUCA 1EY7A 4DV5L 2JEAI 3K80C 1O7YA 4ZAIA 1YITA 3IAYA 1SSOA 3HKSA 4CKCA 2K75A 3PUZA 1H9JA 1B1ZA 2VUMG 1S5FD 4LK1C 2NVYB 3S1NH 5IYCH 3JAMi 4PMBA 3HS0C 4GNXC 2B2UC 3STBD 2BA1A 1IYUA 3A8KE 5IE8A 3K6OA 1VQCA 1XMOQ 2R92G 5IOCA 3EQLC 4IFDI 2BE5D 5IYDG 2DN8A 1NR2A 3PUVA 2J4XA 3K0XA 3RLFA 3A8IE 2LY7A 1U9RA 2E76C 3CC2A 2J0TD 1E7ZA 1A2UA 4OL7A 1Y8NB 4JI0Q 1TWCH 1JICA 2UXCL 1JMCA 4LF5Q 2KCMA 4JYAQ 3R2TA 3G48A 3V2TA 1HR0Q 2MUYA 1AE3A 5CV8A 3SEBA 1EIGA 4FO2A 2BH2A 3NTKA 1HZAA 5M5YB 1RKNA 2KCTA 2RDFA 3A7AB 1IKMA 2WKDA 5IGCA 3PMFA 5DNFA 4CDEC 3N52A 1KRSA 2CWPA 5E4XA 4B3TQ 4LF8Q 3GTMH 1PRTD 2K14A 1B7YB 1BXTA 1CM9A 2SDFA 5M3MG 5J1ZA 4IFDJ 4OHJA 1JE5A 2F3IA 1N32Q 4KTAA 4JI3L 4EX5A 4LF9Q 2F0JA 1TWGH 2L12A 5C3WA 1M4VA 2TSSA 5FLMG 1WOCA 2CW0D 1PFBA 3IRBA 2CHBD 1H9KA 5ELBA 4DUZL 2JA7H 3NBHB 1E2VA 5ELNA 4OX9Q 3TRZA 3AU7A 2ATWA 1U0LA 3W1GA 4POGA 1YNXA 2NTSA 1Q3LA 5HY6A 4X66Q 2UUAL 5JJKA 2AWOA 4BBRG 5K36H 4J6HA 1I4HA 3EVQA 4L63B 4C3HG 3H0GH 2Q2HA 1MJEA 3PO3H 3T1YQ 4A3JB 2CH4A 5C4HA 3U4VA 1F77A 1L1OC 4DV3Q 4K6LA 3CC7A 1PH9A 2DNEA 4HAEA 1PTOC 3S16H 5IP9G 2F3WA 4CHTB 2XN9C 2EYPA 1VQ5A 1OXUA 3L0OA 1K73C 2JJQA 2RHQB 2F0TA 5CV5A 3NTIA 3S1RB 2CQOA 1Q81C 1IBLL 1E0BA 1XXGA 2JA5H 4JVZA 4R9WA 3ZYYX 4X62Q 3QWNA 1GHJA 2D0PA 4DV6Q 1VQAA 3I4MG 1NR4A 2XRQD 1OO9B 4C3IH 2LFNA 2VQFL 4B9XA 1CFMA 2UUCQ 3K5MA 3EJIA 3CCJA 4BY7G 4RGMA 1MJCA 4WORA 2XGTA 3PIOA 1SYEA 4A3EB 4R4TA 4HR7B 3UDGA 4ZQ3A 3TBIB 3OOCA 4L8JA 2LS01 4RGTA 2NN6H 3GTOH 1BCPC 1EOTA 5IGFA 2UXDQ 1GUOA 4A76A 1ICWA 5J39A 1K8OA 1N36L 4IJLA 4FF1A 3JAME 4NXMQ 1NMFA 2EVBA 2FFKB 2NZHA 2B3GA 1LT4D 1F9SA 1O80A 4K14A 1H9RA 2B2VC 1WD0A 2LXKA 1PH3A 5CORA 1F2ZA 5JOBA 1X9NA 3CCLA 1Y69U 3RLOA 5E7NA 1ZYRD 1CQVA 3I73A 2JA8H 3FEWX 3LWEA 5IGBA 2NB0A 3K5NA 1ILQA 3SVMA 2EY5A 3K57A 3QO2A 1JQYD 3TP6A 1V1OA 4LF4L 3A56A 4BBSH 3J80c 2MP1A 1SEBD 3KDFB 2PNHA 1HNXQ 1QJOA 3FHWA 4L5SA 4RHRA 5CMDA 4JOIA 4KY5A 3TP8A 1NSNS 1PMRA 2IW3A 4PZ8A 3TZDA 4LUZA 2NVQH 5C3EG 2FHTA 1AN8A 1IW7D 3E6ZX 5ELCA 1VQIA 4L5TA 1BUVT 1LTID 4KN4C 1TXYA 3SK6A 4A3FB 2PCFB 4I65A 2NUCA 1KLGD 5I2YA 3K81C 2QCPX 3DHQA 2EJGC 1RDPD 1K83B 4JI6Q 4LNQA 3NK9A 1V9PA 1NCVA 3HOUG 1MI2A 2RSOA 1UWVA 3DM3A 5EJWA 4B3SL 1AH9A 3MC0B 1FJGQ 2Z0SA 1G2SA 3H3VH 4HIOA 4MHEA 4RG1A 1YHAA 3MEHA 3K7AB 1YIJA 1T5XD 1A3TA 1XYIA 5C4ZA 1G6ZA 1LABA 2B63H 1GUNA 5C6AA 1JJCB 1O7ZA 2ICEC 3RD4A 1L2FA 1WYDA 2E2IH 1K0RA 1EIHA 1JOQA 5LMUQ 4F8MA 4C1NI 2UXBQ 2L9HA 3SXHA 1PH1A 5IT9E 4GOPC 1X3PA 3MXNA 4JI2L 3GTPH 4GNXB 3Q6SA 1SR3A 3TP5A 2QEXA 3S1QH 3A0JA 1STAA 3H0GG 1AEXA 1HPCA 3PO3G 3OMGA 4X3TA 1KNAA 2H1EA 3C1FA 5JEAJ 1K8GA 1QUQA 3KK7A 4HJ8A 1DCZA 2K01A 4A3IG 3SE0A 2Z6BA 4A3LH 1VQFA 1GJXA 3HOZG 1QCBD 5LHY1 1A62A 4G4KA 1EQVA 1PZKD 2RDGA 3CD6A 3U50C 5FO8B 4OO1G 2NVYH 1AE2A 4QUCA 2JA5G 1QVCA 2IHFA 3BDLA 4XYQA 4IZ8A 1Y1WH 2R7FA 1V1QA 4LFBQ 1FNUA 1ZKOA 3GTQH 4IUPA 2I0QA 4H7BA 4GKKL 4YIJA 3C46A 4C3IG 2Z4IA 4ILWA 3R8BA 2QGQA 3U4ZA 3A74A 3J7ZC 4IPHA 1K9MC 2F0QA 4FXGC 4ME3A 3RLNA 3S2DH 2K05A 1PH5A 4PZ6A 2NZOA 2OEOA 2KQ3A 5BR8L 2NTTA 2B8FA 5A2QE 4R4OA 2PO4A 4R4IA 1QZGA 4B3RL 2XNAC 4JI4L 2AUJD 5FLXE 4HIDA 4K0KL 2A6EC 4JPBW 3PV0A 1KL9A 1STHA 1YHBA 2YU9B 3PUYA 1O7IA 1HXYD 5CBAE 3K58A 3GTJB 4JI7L 2JA7B 4JI5L 4X64Q 5GROA 1UNSA 5J22A 4WRDA 2F0SA 5EPKA 4CGYB 2N88A 2QILA 4DV5Q 1TIID 4HEDA 2WAQG 1U4LA 2L11A 3CQZB 1EY9A 3T51B 1PYSB 3HEJA 4P73A 2I5LX 2V4DA 1L1OB 2G5DA 4KV6A 3WDNA 2JA8G 4POFA 3OHXC 1BDOA 1PTOB 4O42A 3RZOB 4DR4L 2OQ0A 2FXQA 4DK1A 2WAQE 1JWUD 1TS3A 2C5CA 2YV5A 3J7A5 3ULJA 1BBUA 3S24A 4IUQA 3S1MB 4O0AA 2CKZB 4BBSG 5IT9c 4GN4B 2TMPA 2Z1CA 3G7LA 3R93A 1BKBA 4LUOA 1PTOD 2Y0SG 1G6PA 3D31A 2A68D 1E1TA 4A3JH 2LXJA 2ZJQA 4KMUC 2UXCQ 2L4NA 3PF4A 3EFXD 2RSNA 4JV5L 4A93B 5AJ3L 1KLUD 1STEA 2AQ3B 3K8AA 3TN2A 2ID0A 2BOSA 5EBCA 2RHSB 5IODA 3Q0AA 1VQOA 1YVCA 2DUDA 3G71A 3S1RH 1EWHA 1X32A 2G9DA 4MN3A 2CFMA 3M9BA 1SYDA 4QIWE 3QOJA 1PRTF 2IT1A 1I4RA 4QL5A 1IHZA 5KYLA 1AZPA 1JB7A 4LFAL 1BR9A 5BN4A 2RBMA 2VB3X 3HOYB 1II3A 1Y8PB 2N49A 5CYUA 5CV4A 2ZM6L 1KIXA 5D3IB 2ZTEA 1I94L 4PMCA 1SNPA 2JEBI 1TKWB 1FGBD 2B63G 4A3EH 3CMAA 3I2ZA 2M2LA 3A54A 1FR3A 4HMIA 4ALPA 1PFSA 1SYFA 1HTPA 5C4XB 3BVMA 2WB1G 4F7XA 4I7AA 2UUAQ 5D3DA 4YHHL 1VQPA 4IUVA 1ESFA 4N8FA 4OIKA 3HRZC 2K03A 3CPFA 4TRDA 1HTLD 2UU9Q 1CK1A 1TY2A 1XMQQ 2D62A 2WB1E 4X65Q 1KQSA 4A3LG 5EBDA 5EAYA 3Q22A 2R61A 2NVXB 4IURA 1GOZA 4ZKBB 2EQSA 3SK5A 1WTQA 1JB3A 4DR2L 4IJHA 3DWPA 5M3FH 5EKIA 2JE6I 2F0GA 1DOMA 4OGQC 4TKOB 1ILPA 3NP8A 1JC7A 1FNWA 3MA2B 1RJTA 1SLJA 1LTSD 1XPRA 3M7NA 2EJMA 5G3LD 1YNNC 3NQIA 4C2MB 3F1ZA 4C3JH 1UE6A 2J7ZA 4NMZA 5JJIA 5T1IA 2E75C 2MQHA 4LF7L 1J5EL 4H0LC 1SFOB 4JK1C 1DJRD 1Q82C 1B44D 2A8VA 5DM73 2CWAA 1Q7YC 1N36Q 1Z6HA 3BYYB 5IGGA 3U9OA 1GUTA 4FVMA 1O78A 5D65A 3DXJC 4YWLA 1LV9A 4GOPB 2PZWA 1DOKA 1CKNA 4OWTB 3OPOA 3J81j 1TWHB 4TSSA 4JCVE 2L5TA 3K7AH 1Q90A 4DV2L 3FDTA 1LO5D 4JI1Q 3D0FA 3W5OA 1D5MC 1S5ED 4OO1I 1ENFA 4DN4M 1P8LA 2EY2A 4CJ0B 1R4PB 4DAYB 2VY3A 1VDZA 4CKBA 2IX3A 2KHIA 4KLKA 2QDLA 3GO5A 2K32A 4M1UB 4B9WA 2M00A 3OTOQ 1H9SA 1KAAA 2N8NA 4A3JG 1NNXA 1J6QA 1X3EA 4XT3B 4KK7A 5JJLA 1Y1WB 3HOXB 5COYA 3EROA 4DV4Q 4MIUA 3NQTA 5GAEC 1VS0A 1VQBA 3GTQB 1TS5A 2EDGA 4CDFC 4P72A 5CGKA 2O5IC 1CZWA 5K5PA 2E2HH 1W2BA 4ZKCB 1TWAB 3NBIA 4ME5A 1EY6A 5FJ8G 4PG3A 4HJ5A 2F4VQ 1IBML 2IHEA 5EKKA 3S2DB 1PZID 4OWWB 2A1AA 4A3BB 4BY1B 1Y1VB 1B53A 3IFTA 2X6LA 2O5JC 3GD7A 2E5LQ 1PDQA 2KEDA 1M90C 1VQ9A 3I70A 2F52A 3A8JE 1TWFH 5FK9C 4A3EG 4RKLA 4DR7L 3TS0A 2ZTCA 1Q12A 2EY1A 1YJ9A 1VQNA 2FMMA 1EYAA 4NP5A 3A7LA 3BVGA 3PGZA 1CT1D 3H09A 3KF8B 3HKZB 2F0UA 4JI2Q 1UEBA 1R9TB 1A6XA 2MGSA 4R4QA 1KC8C 1KDBA 2YU9H 1DD2A 1S5BD 4NB3A 3KBGA 3H94A 3GTJH 4FXKC 2G9HD 4GLXA 4A3GH 1WD1A 1W3SA 3HG9A 2KOLA 1SYBA 3PSIA 3HOWG 2EE1A 2RCNA 1VF7A 3RR5A 2SNMA 4WJ4A 3Q24A 1FGUA 2R7ZG 1PYWD 1I4GA 3CQZH 1PV4A 1ONLA 2PMZE 2OWOA 1WFQA 4EQ5A 4DV7Q 1SJED 2DY7A 1B9NA 1PTOH 3MFYA 5GAHC 5I6WA 3RZOH 1IL8A 2VL6A 4IOCA 3I91A 4X3UA 1XJVA 2VW9A 1QNUA 3AMUA 1EY4A 2IPKD 2WKCA 4AQYL 2P5ZX 3S1MH 4RFBA 3VA7A 5CBEE 3KJPA 4NPSA 4Y7NB 1HHVA 1G51A 1NAPA 1PVOA 3K59A 2K7VA 1K3RA 1SJHD 1C4QA 3E9HA 4DV0Q 1STYA 1GM5A 1V1PA 1I50H 4DR1Q 2C9OA 4NXNL 2VUMB 4GN5A 3SGIA 4A93H 2O2LD 5H1SE 1G291 4A3KB 1CQFA 1HZBA 4JI4Q 2EJFC 4A3FG 4K0KQ 4KJOA 2NBFA 1PXUA 1WI5A 3GQBA 3M85A 4ULLA 3TZUA 2F0OA 2Q2TA 4JBMA 2LKVA 4JI5Q 2IWHA 1YJWA 1MHWC 3D4DA 3MTSA 1UE5A 1BBXC 3HOYH 2WV6D 2JN4A 4PZ7A 2M9VA 4RAUC 1EIYB 3T1HL 1KTKA 5HGTA 1EEFD 4GS3A 4YCVA 2Q8RE 1U4RA 2XVSA 1PH7A 2A6HC 3M4OH 1EL0A 2MJ8A 1B50A 3D3RA 3MVVA 1STBA 1YNJD 4HIMA 3S15B 2A73B 3ULPA 3F2BA 2KBNA 2GVBA 3OIQA 5C4XH 4KHPQ 1MD2D 1XNQQ 1QNKA 2WINB 2HIVA 3KLSA 3QIAA 1SDFA 2H4OA 1HRJA 2EYJA 4IFDH 1S3OA 4RCNA 4JI8L 5KNBA 4JOIC 1CSQA 2OTJA 4GKJL 1KRTA 2CVRA 3TSSA 5C0XH 1UE7A 1FNVA 1MSHA 2GA4B 5IYCG 3U58A 3EBEA 2D0OA 5M3FB 3PIP3 1X6OA 4ZYSA 3GV6A 5ELOA 4P75A 4L5QA 2O4XA 3D6WA 3TS2A 2NVXH 4DR3L 2JP1A 1VQDA 4YY3Q 4YCUA 1U4MA 1TS4A 4FDBA 5JVH3 4N8X1 4BBRB 2EIFA 5I2XA 1H9MA 3I72A 2MO1A 1JORA 4A3MH 1TU2B 5EPLA 4C3JB 1X65A 4L6TB 1VF5C 4LFAQ 3QB3A 1AFPA 2K28A 4RKBA 1QVGA 1NY4A 3G6JB 3TEHB 1YI2A 1XNRL 2B2WA 3TMEA 1I94Q 3I56A 4C2MH 2YTXA 5L37A 1TVXA 4IN3A 3Q8DA 1SXTA 1KDCA 4DK3C 1MSGA 3FKIB 2GVAA 1EZ6A 2JQOA 3J80L 1SFOH 2PQAA 1EQTA 4QMGA 4YWKA 4K2KA 2QEJC 4YHHQ 4UP9A 1SNDA 1SMYC 3AB9A 1HFNA 1SN8A 2EXDA 2YYZA 5KIXA 2NWGA 1XMOL 2ZXRA 2JA7G 3MZ5A 4ID6A 2K52A 1E3PA 3T56B 3I8ZA 4A3CH 2CQAA 1MIUA 4FF4A 5CV7A 4FF3A 4RGNA 2E74C 3BJUA 4MNOA 1HR0W 5A35A 1OXXK 1LTTD 1AW7A 2F0MA 3SR1A 4KD3A 2UUBL 2EPBA 2Z9HA 4DUYQ 1TWHH 3NXWA 4JYAL 2YTVA 1HR0L 1ML0D 4PQXA 1LTLA 5K36G 3JAMc 2Q8TA 5JAVA 1QOHA 2F0WA 4OWXB 4DR2Q 3UDIA 1EYDA 5FO7B 4ZK9B 3GTLB 2HHHL 1S72A 3EA6A 3DLLA 4LF8L 2IX1A 5M9OA 5ELFA 4GLAC 1F9RA 4JW0A 1UEAB 5FOBB 1Q1BA 3SK8A 1N32L 4QGUA 4BXXH 2MO0A 4HJ7A 4LF9L 5ELEA 1LM0A 4QY7A 4JBJA 3I3CA 1GVPA 1KD1C 1JR0D 2E2HB 3PO2B 1WVLA 1E22A 3F2CA 3HOXH 1QWYA 1GKHA 2KJXA 2L0CA 3UDXA 1NE3A 4B3MQ 5ISRA 4KKTA 4AYBB 3CW2C 1VQKA 1YEZA 1HJPA 2VNUD 3QR8A 4PMWA 2K5WA 4KKSA 1EIFA 1XTDA 4X66L 4DNIA 2D2CC 5CC4A 1R4QB 1A3VA 1TWAH 3STBC 3K5OA 2HDMA 5C44H 4DR5L 2E2JB 4OEMB 1JWMD 1CA5A 5CV6A 2DJGC 1TWFB 4KJNA 1PZJD 2QA4A 4BY1H 4A3BH 1E24A 5DAUA 3ONAB 1S40A 3HOYG 4DV3L 1Y1VH 1K8AC 2K5VA 4KKUA 1B2TA 3T4AC 5C3EB 4C56C 2NN6G 1ENCA 3CCSA 1DM0B 1S5DD 2K5NA 3KF6A 2K5QA 3E0EA 4O2DA 4E6IA 2AWNA 1G2TA 3PIPA 4A3GB 3U9SA 4DAYA 3DEOA 3ERSX 2KA7A 1N33L 1KDAA 5AFWA 1C48A 3L9AX 3KOJA 3ER0A 4F88A 1R9TH 3AFPA 1N9WA 1Z9FA 1IBKL 4N9PA 4KY6A 1GXDC 1PRTC 2Q2UA 3I4NB 2R3ZA 3IL8A 1SE3A 2ZTDA 3PUXA 2CH4W 4HJAA 1VQ8A 5C0XG 5HGQA 2UUCL 3I4LA 3T16A 2K33A 3GDEA 1VCIA 2CW0C 2Q2IA 1EY0A 2BH8A 5IGDA 3R3OA 3HOVH 1VQ6A 2F3VA 2RVLA 3BDOA 3CCMA 4RHSA 3FRPB 4XQJA 1IXRA 4HN7A 2UXDL 3HGBA 1A8VA 3BU2A 1IBMQ 5E3FA 1I50B 1NBWA 2PI2A 4Y7NH 1WCMB 5IIFA 1C8CA 3PCOB 4K8JA 5JEAH 2Y0SE 4A3IB 4UDUC 4A4IA 4FYDA 2A19A 2KCNA 4YWMA 2YTYA 4BS9A 1UUPA 4WFN3 4KY7A 5DLQE 4DPGA 1D5XC 5IT9L 2VUMH 2FMCA 1W6KA 1BCPB 4ZCKA 1CSPA 4CKEA 2XSCA 3C2PA 4A3KH 1SYGA 4JI3Q 3DMUA 2PNRC 1A0IA 1PH2A 4DUZQ 3AEVA 4WJ3M 2R92H 2V1CC 5IYDH 3NBHA 5KYIA 2EZVA 3GTKB 3WWVA 2ZXOA 3M4OB 4A3CG 1BCPD 1EEID 4LF6L 1D1IA 3VR3A 1XPUA 2IY5B 3J81L 1LT3D 1B4OA 4DF7A 3D4WA 2A6HD 1TQOA 3MXGA 1H95A 1A15A 1D8LA 2N55A 4M8AA 4X3KA 3QJYA 2K4KA 3DWQA 2JYOA 3SHLA 4PV1C 5EPJA 5FLXc 3W1BA 4BA2I 1F9QA 3OW2A 3CC4A 3I55A 2F0HA 1DZ1A 2PYKA 4AQYQ 2PZUA 5KGUA 4XQNA 1JCKB 1Q8KA 2AHOB 2DNCA 2OCEA 3S15H 1CHQD 4LUVA 1EU4A 3PUWA 2ICIA 4NDXA 2AQ2B 2KEEA 2OXPA 2F0EA 4JI6L 1RTNA 2EYOA 1P16A 3X3NA 5GAGC 3C1EA 3J7AF 4FF2A 3BZKA 1RTOA 1IBLQ 3KYHC 4NXNQ 1QVFA 2JA9A 1JJGA 1I4XA 4A3MB 1MGSA 1ICFB 1Y1WG 3HOXG 4DV1L 1YZ6A 1ZYRC 2VQEL 1F2LA 3CF5A 4DXFA 5C5LA 2K6AA 3RN2A 1RD9D 1V43A 2VQFQ 4HJ9A 1GUWA 4BBRH 1PYBA 1LACA 3MXNB 1WTRA 4V0BA 3UI2A 3W3AA 1PH4A 1F2MA 2XTIA 1WJJA 2HQEA 3RZDB 2WFWA 4A3BG 4BY1G 3RNUA 4A75A 3QG1A 1T9HA 1Y1VG 1FD7D 1PFMA 2HIXA 3VYTA 1QUQB 4TVAB 5IP9H 5DEHA 4QIWB 1CUKA 1NMGA 3E9IA 1X3QA 4XTCS 4ZUJA 1I4PA 2RQXA 2B2TA 2KECA 1QILA 2PI2E 4OXPA 1S5CD 3FKIH 3J80i 4ZLTF 1STNA 3HKZG 3CCVA 1C7YA 1RL2A 4UP8A 3S9WA 1I6HH 2VZAA 3E0JA 4LFBL 4DNTB 3S17H 2EYMA 4OONA 3I4OA 4L5RC 2B2YA 2R7DA 1KHIA 4K6DA 3BZCA 2F4IA 4CDCC 3J7AV 2K04A 3R2IA 1X54A 1QE6A 4G57A 3QOLA 4DR6L 4LF4Q 1IYVA 3OIPA 3CAMA 5IYBH 4TQUS 5T1GA 2MFIA 3KDFA 4LFCL 3BDCA 2WB1B 1AZQA 1HCZA 3S14H 1PH6A 1S4ZA 2NZ1D 2VXWA 4NKLA 4CJ1B 2C35B 1ET9A 4FXDA 2Z6KA 1W6JA 3GTLH 4DA2A 3X3MA 1C9OA 5F2DA 1PFNA 3OWFA 1HZ9A 2B39A 2R6GA 1LT5D 1JE4A 4X64L 1TS2A 1VQLA 2XRSD 1XNRQ 3A5UA 2F0DA 2OTLA 1EYGA 1HNZL 1I6VC 1L0WA 4LAAA 1OXTA 1D1KA 4RMFA 3UE1A 3EN2A 4P71A 2NN6I 2L55A 5M5XB 3M4YA 3KJOA 3PO2H 5C44B 3DWAA 3VR4A 4DAMA 4DFAA 1X56A 4A3KG 1I3QB 4MTNA 4K2LA 3OW7A 3BYTB 3GP7A 4NW2A 2Q8IB 3VYSA 4G7ZC 4B3SQ 1E1OA 3MEFA 1U4PA 1LTRD 1RCVD 1KABA 2Z8LA 3GTGB 1FYCA 5LMNW 1EY8A 2E2JH 2KVMA 2BA0A 5JVG3 4EVOA 2A6ED 5C0XI 3L7ZC 5LMNL 1PRTB 2DJFC 4APVA 1B8AA 3I7FA 2UUBQ 2ENBA 3IKJA 2OQKA 4P74A 2IL8A 5C3EH 1GUSA 4EQPA 2HCCA 3MXPA 5IGEA 2JA6B 4GNXA 1XPOA 2B2UA 5J3BA 3TDQA 3P20A 2SEBD 2Z4HA 4DKAC 5E4WC 2HHHQ 3TQYA 4R1JA 1ASYA 5DM63 2DGYA 4GZYC 3P7JA 3A5ZB 2NVTH 3CRKC 1HA6A 1GHKA 3K5LA 1XTCD 3CRLC 1EWIA 3HOUH 5FKAC 5C0XJ 5CV9A 3I4NH 3HOVB 2EYHA 2K50A 1WTPA 1Q46A 1AP0A 4K8IA 3BVZA 2RF4A 1HH2P 1CHPD 1SMXA 5M3FG 5JPNC 4RA8A 1KXLA 4IOAA 3LX0A 4GKKQ 2F0KA 2FJ2A 2R93B 1HQRD 2F03A 4A3DB 4RH6A 1X3GA 3CMEA 1JT8A 1E2ZA 4DR5Q 3J80E 1SE4A 4K5VA 3SDZA 4C3JG 4EGVA 3H3VI 1WTXA 4K5WA 2KUMA 3HP3A 5IP7H 3MFGA 4IUNA 2ZJPA 3CCRA 4HCSA 2UU9L 2FINB 2ALYB 1WCMH 1ZEQX 1XMQL 5BR8Q 2JSOA 4DAPA 4DK0A 3KLSX 1ASZA 4X65L 4B3RQ 4A3IH 1L0XB 2A68C 1UE1A 1SNOA 4RGOS 4AH6A 1QZHA 1JOKA 3N6RA 4KHZA 2HD3A 3HOZH 2GN5A 1DOLA 4KHVA 5BN5A 4BA1I 5HURA 3URYA 2SOBA 5KEEA 4ZRZA 1HNWL 2R92B 4JI7Q 2I46A 3DUZA 4OO1H 5I4DA 3FKIG 5IWAL 1HUNA 1K28A 3BS1A 4ABNA 1OXSC 1VQJA 1N33Q 4EQOA 4QQBX 4IPGA 2PQEA 1F9PA 1C0AA 3VYUA 1SROA 1IBKQ 2VB2X 3LNNA 1L1OA 2BDOA 4HSPA 2AQ1B 1G8ZD 1LUZA 1NTGA 4XIGS 3J7YW 2PPBC 3KBXA 1E2WA 4DK6C 3GTKH 4DR4Q 4H02A 2WP8J 2EY6A 3D4RA 3J81i 3M4PA 2PW7A 2HUGA 4K5XA 1Y14B 3NELA 5GQOA 3NHHA 5M3MB 2K1BA 3CCQA 2A74C 5IYBG 4XDXA 2MPMA 3S2HB 2HT1A 5KRUA 2ES2A 3V96A 2B29A 2NYZD 1BQQT 2F0VA 1YHQA 4B08A 2LMCB 1PTOF 4R8IA 1VQEA 1B3AA 4S3SA 1VQHA 2PMZB 1EU3A 3NPPA 1BO0A 4JV5Q 2RKSA 4Q5VA 5AJ3Q 4CBVA 3WOEA 1L0YB 3PF5A 3HOWB 2B2WC 4ZUIA 5GADC 2L1BA 1CKOA 2AKWB 3TREA 2R7ZB 1N34L 1D5ZC 1CKNB 1K0SA 2QF7A 4EQNA 4MZ9A 2EOTA 4C1NK 4WJWA 3F2DA 3KLWA 3HFZB 3PO2G 1LTAD 4C3HB 4JI1L 2DY8A 4XXEA 1YNND 3L2PA 4AYBG 2I07B 3Q23A 4Y52H 3G4SA 3FMCA 1Z47A 4AIMA 2ZM6Q 3VDYA 3B6YA 2B2VA 1D2BA 3D8GA
chains in the Genus database with same CATH topology
3IRBA 4DUZL 2ZTDA 3PUXA 4HJAA 1VQ8A 4LF6Q 2JA7H 3F1ZA 4AYBE 4C3JH 5C0XG 3OTOL 5HGQA 1UE6A 3NBHB 3RZDH 1PHJA 3CP0A 2KHJA 2UUCL 5ELNA 5JJIA 4OX9Q 3TRZA 2ATWA 2MQHA 1U0LA 3AQQA 3W1GA 4JBWA 1J5EL 4QJFA 4LF7L 4POGA 1YNXA 2UXBL 3GDEA 1MKHA 1VCIA 1Q82C 2Q2IA 2BH8A 1U5KA 3HOVH 2A8VA 3AYHB 4DV4L 5HY6A 4X66Q 1VQ6A 2CWAA 1Q7YC 2UUAL 5JJKA 2AWOA 4BBRG 1N36Q 3CCMA 1IXRA 4HIKA 2UXDL 4A3GG 3H0GH 3EIVA 2Q2HA 1A8VA 3BU2A 4YWLA 1MJEA 1IBMQ 1IL2A 3PO3H 3T1YQ 4GOPB 3CCUA 1NBWA 2PI2A 1L1OC 3U4VA 4DV3Q 1PH9A 4Y7NH 3CC7A 2F4VL 3PCOB 4JI0L 3M3YH 3S16H 5IP9G 3ZJYC 1CKNA 2Y0SE 3UDFA 4OWTB 4LF5L 1X3FA 1YBYA 1VQ5A 3I4NG 1OXUA 3L0OA 3J81j 1K73C 2JJQA 4A4IA 2ZJRA 2RHQB 2A19A 4YWMA 4JCVE 2YTYA 3K7AH 1IYJB 4DV2L 2E5LL 2CQOA 1Q81C 1IBLL 1BVSA 5DLQE 4JI1Q 4DPGA 3D0FA 3W5OA 4DV1Q 2VUMH 4OO1I 2JA5H 2VQEQ 1P8LA 1CSPA 4JG2A 4B3TL 2AMCB 4A3KH 4JC0A 4DAYB 4JI3Q 2VY3A 4IPDA 3KFUA 4X62Q 2KHIA 4KLKA 1A0IA 2D0PA 4DV6Q 1VQAA 3GO5A 1JJ2A 3I4MG 4KI0A 1PH2A 4C3IH 4DUZQ 2CCZA 3AEVA 4WJ3M 4R4CA 2R92H 2V1CC 3OTOQ 5IYDH 2VQFL 2N78A 2UUCQ 2N8NA 3WWVA 5IP7G 3CCJA 4A3JG 4A3CG 4LF7Q 1J6QA 1X3EA 1J5EQ 4LF6L 4BY7G 1WCMG 1MJCA 2XGTA 3PIOA 1XPUA 4A93G 2IY5B 5IY0A 4R4TA 3UDGA 2IX0A 3OYYA 4OX9L 4YCWA 5JJLA 1H95A 1RIPA 4DV4Q 1D8LA 2K4KA 5GAEC 1VS0A 5FLXc 1FVIA 3GTOH 1VQBA 3W1BA 4BA2I 1VQGA 3OW2A 3CC4A 2UXDQ 5M5XH 4P72A 3I55A 4A76A 1X55A 4LWCA 4DV7L 3LGJA 4IJLA 1N36L 4AQYQ 4GOPA 1W2BA 2E2HH 1NMFA 4NXMQ 1Q8KA 2AHOB 2OCEA 2KENA 3S15H 5FJ8G 4LUVA 4PG3A 4HJ5A 2F4VQ 1I3QH 1IBML 2NZHA 2B3GA 3PUWA 1LYLA 3T1YL 2IHEA 4OWWB 2A1AA 1NJIC 1EFWA 4JI6L 2LXKA 3M4QA 1PH3A 1P16A 1X9NA 3CCLA 3GTGH 5GAGC 3GD7A 5E7NA 3AFQA 3RLOA 4DV2Q 2E5LQ 3BZKA 1IBLQ 2JA8H 1M90C 3KYHC 4NXNQ 1VQ9A 1QVFA 2JA9A 2F52A 2N3SA 1JJGA 4DV0L 1TWFH 4A3EG 4DR6Q 4DR7L 4DR1L 3TS0A 2ZTCA 1Q12A 3HOXG 4DV1L 1Y1WG 1YZ6A 4JYAQ 5C4XG 1YJ9A 1VQNA 2VQEL 1OTCA 3CF5A 4LFCQ 2JA6H 3PGZA 2H5XA 4LF4L 3KF8B 1Q1EA 3JC66 4JI2Q 4BBSH 3RN2A 4IFDG 1UEBA 1V43A 4X62L 5M5YH 2VQFQ 4R4QA 3J80c 1KC8C 4HJ9A 3KDFB 4BBRH 4DV6L 1PYBA 2PNHA 2YU9H 3MXNB 3G6EA 3FHWA 1HNXQ 4NB3A 4GN3B 3CPWA 4GLXA 3GTJH 4L5SA 4A3GH 1PH4A 2XTIA 1Q86C 1W3SA 2L15A 4JOIA 1WJJA 1EUJA 2WFWA 3PSIA 3HOWG 4A3BG 2RCNA 4PZ8A 4BY1G 3RNUA 1HNZQ 3RR5A 4A75A 4LUZA 1T9HA 2NVQH 1Y1VG 5C3EG 4WJ4A 2HIXA 2R7ZG 1FGUA 1QUQB 3CQZH 1VQIA 4L5TA 4TVAB 5IP9H 1PV4A 2PMZE 2OWOA 3F8TA 1TXYA 1CUKA 1NMGA 1WFQA 3E9IA 4EQ5A 4DV7Q 4XTCS 2I5HA 2E8GA 5GAHC 3RZOH 2VL6A 2PI2E 4IOCA 4A3MG 1XJVA 2VW9A 4OXPA 3FKIH 3J80i 3K81C 4AQYL 4NXML 1N32L 1N8RC 3S1MH 3KJPA 4JI6Q 3K7UC 4NPSA 3HKZG 3CCVA 1G51A 1C7YA 4LNQA 1RL2A 1V9PA 4UP8A 2R93H 1I6HH 2VZAA 3HOUG 4A3DH 4KHPL 1PVOA 1XNQL 1A63A 1K3RA 1HZCA 4LFBL 1UWVA 3DM3A 4B3SL 3S17H 1AH9A 4OONA 3I4OA 4L5RC 1FJGQ 1PA6A 2HQLA 2R7DA 2Z0SA 3E9HA 1KHIA 3H3VH 4DV0Q 4HIOA 4RG1A 1VQ4A 1M1KC 1YHAA 3BZCA 1YIJA 1GM5A 4DR7Q 1I50H 4DR1Q 5LMNQ 1GD7A 4NXNL 2B63H 1X54A 1JJCB 4GN5A 3SGIA 4A93H 5H1SE 4DR6L 4LF4Q 1G291 1L2FA 1WYDA 2E2IH 1K0RA 1HZBA 3CAMA 5IYBH 4JI4Q 4TQUS 5LMUQ 4A3FG 2UXBQ 4K0KQ 2MFIA 3KDFA 4LFCL 1PH1A 4GOPC 4JI2L 3J81c 1PH6A 3GTPH 3S14H 4GNXB 2C35B 1SR3A 2QEXA 3S1QH 1DGSA 1CKMA 3A0JA 1WI5A 3H0GG 4YY3L 3M85A 2Z6KA 2Q2TA 4JBMA 4JI5Q 3GTLH 1HNXL 3PO3G 1VQMA 1YJWA 1C9OA 5JEAJ 1HZ9A 5FJ8H 2R6GA 4UPAA 3RN5A 4X64L 1K8GA 1QUQA 4HJ8A 1VQLA 1UE5A 3ICEA 4A3IG 1XNRQ 3A5UA 2OTLA 3HOYH 1EYGA 1HNZL 4A3LH 1VQ7A 1VQFA 1L0WA 4RMFA 1OXTA 1EOVA 3UE1A 3EN2A 4PZ7A 3HOZG 1KAWA 4P71A 1EIYB 1A62A 2NN6I 3T1HL 4GS3A 4YCVA 3H15A 1B70B 1PH7A 3CD6A 3U50C 3M4OH 2LSSA 4OO1G 2NVYH 3KJOA 3PO2H 1AE2A 2JA5G 1QVCA 3NENA 2IHFA 4DAMA 4HIMA 3CCEA 1X56A 4A3KG 5M3MH 1Y1WH 3ULPA 3F2BA 4JBKA 2KBNA 2GVBA 2R7FA 5C4XH 4MTNA 4KHPQ 1XNQQ 1V1QA 2PQAB 4LFBQ 2HIVA 2JK8A 4B3SQ 2ASBA 3S2HH 1E1OA 3MEFA 1PH8A 3GTQH 2I0QA 4GKKL 1S3OA 4BXXG 4JI8L 4JOIC 5FLMH 5LMNW 2QGQA 3U4ZA 4UP7A 1CSQA 2E2JH 1D7QA 1FJGL 2OTJA 4GKJL 1KRTA 3A74A 2BA0A 3J7ZC 4IPHA 1K9MC 1UE7A 2I5MX 4ME3A 3L7ZC 2K5HA 3RLNA 5IYCG 5C0XI 4APVA 5LMNL 3U58A 3EBEA 1B8AA 1OXVA 3I7FA 1EQQA 4LW1A 2D0OA 2UUBQ 3HOWH 1PH5A 1X6OA 4PZ6A 2NZOA 2OQKA 4P74A 5C3EH 1YJNA 5ELOA 5BR8L 2R7ZH 4P75A 4L5QA 4R4OA 4R4IA 1IZ6A 4GNXA 1QZGA 3TS2A 1XPOA 2NVXH 5J3BA 4DR3L 4JI4L 4B3RL 5LMUL 1GO3E 1HNWQ 4DUYL 4HIDA 1VQDA 4IPCA 3CXCA 2MNAA 4YY3Q 4YCUA 4FDBA 3PV0A 4K0KL 5IWAQ 4DKAC 1KL9A 5C44G 1YHBA 2EIFA 3PUYA 2HHHQ 1O7IA 2MO1A 3TQYA 1FL0A 4C3HH 4A3MH 4R1JA 4JI7L 4JI5L 4X64Q 1ASYA 1X65A 2DGYA 5GROA 3A5ZB 4LFAQ 2NVTH 4DV5Q 1QVGA 2WAQG 1EWIA 3HOUH 1NY4A 3TEHB 1YI2A 3T1HQ 1XNRL 3S2DH 5C0XJ 1PYSB 4P73A 3I4NH 2I5LX 1L1OB 2K50A 1I94Q 2JA8G 3I56A 4POFA 4C2MH 1Q46A 2YTXA 3Q8DA 4DR4L 1I5FA 2RF4A 4A3LG 2OQ0A 1HH2P 2FXQA 4DK3C 1SMXA 5M3FG 2GVAA 2JQOA 2WAQE 1SFOH 2YV5A 3J7A5 2PQAA 4IOAA 1KXLA 4X6AH 3ULJA 1BBUA 3S24A 2JA6G 4O0AA 4YWKA 4GKKQ 4YHHQ 4UP9A 2CKZB 4BBSG 5IT9c 1BBWA 4JI8Q 4A3FH 1SN8A 4GN4B 4B3ML 2Z6KC 3FP9A 1SRUA 2EXDA 3I4MH 1X3GA 3CMEA 5C4JH 4GLVB 1JT8A 4GKJQ 4DR5Q 1BKBA 4LUOA 2YYZA 2Y0SG 1G6PA 1XMOL 3D31A 1E1TA 2JA7G 3ULLA 3H3VI 4J15A 2K52A 1E3PA 2LXJA 3HKZE 5IP7H 4A3JH 2ZJQA 2ZJPA 4A3CH 3CCRA 1MIUA 2UU9L 2UXCQ 4BY7H 2ALYB 1WCMH 1K83H 3PF4A 3BJUA 4MNOA 1XMQL 1HR0W 5BR8Q 1OXXK 4JV5L 1ASZA 3UE0A 4X65L 5AJ3L 2UUBL 1N34Q 4A3IH 4B3RQ 3NEMA 4DR3Q 4UY8C 1UE1A 4DUYQ 3HOVG 3K8AA 4AH6A 2ID0A 1TWHH 4JYAL 2RHSB 1QZHA 2YTVA 4KHZA 1VQOA 1HR0L 2VS1A 2GN5A 1YVCA 3HOZH 1LTLA 2DUDA 4BA1I 3G71A 1SE8A 3S1RH 4IO9A 1HNWL 5K36G 3JAMc 4JI7Q 3KF6B 4OWXB 5M5WH 4DR2Q 2CFMA 3UDIA 3FKIG 5IWAL 1OXSC 3M9BA 1VQJA 2HHHL 1N33Q 4QQBX 4QIWE 4IPGA 1EQRA 1S72A 2IT1A 3DLLA 4QL5A 4LF8L 2IX1A 1C0AA 1JB7A 2R93G 1SROA 1IBKQ 4GLAC 4LFAL 5JEAG 4A3DG 1L1OA 1Q1BA 4DV5L 2JEAI 3K80C 4QGUA 4BXXH 1LUZA 2MO0A 2N49A 1NTGA 4XIGS 4HJ7A 1YITA 4LF9L 2ZM6L 1KIXA 4DR4Q 4DK6C 3GTKH 1LM0A 3HKSA 4H02A 4QY7A 3HOYG 2K75A 2ZTEA 3PUZA 4JBJA 1I94L 2WP8J 1GVPA 1KD1C 2JEBI 2VUMG 3J81i 2B63G 4A3EH 3CMAA 1E22A 3M4PA 3I2ZA 3S1NH 3F2CA 5IYCH 3JAMi 1Y14B 3HOXH 3NELA 5GQOA 4GNXC 4ALPA 1PFSA 1GKHA 3STBD 3UDXA 4B3MQ 3CCQA 1NE3A 2BA1A 5IYBG 3CW2C 5IE8A 1VQKA 2WB1G 2UUAQ 1YEZA 1HJPA 1VQCA 2HT1A 2VNUD 2ES2A 4YHHL 1VQPA 2B29A 1XMOQ 4PMWA 2R92G 4IFDI 5IYDG 1EIFA 1XTDA 3PUVA 4X66L 1YHQA 4DNIA 3CPFA 3K0XA 3RLFA 1VQEA 1TWAH 3STBC 5C44H 4DR5L 1VQHA 2UU9Q 3CC2A 1XMQQ 4JV5Q 1E7ZA 2D62A 2WB1E 4X65Q 5AJ3Q 1TWCH 4JI0Q 4A3BH 2QA4A 4BY1H 2UXCL 3PF5A 1E24A 1JMCA 4LF5Q 1S40A 1KQSA 4DV3L 1Y1VH 2KCMA 5GADC 1CKOA 2K5VA 1K8AC 2AKWB 3G48A 5EAYA 3TREA 1HR0Q 2NN6G 1N34L 1AE3A 1CKNB 3CCSA 2BH2A 2K5NA 1HZAA 3KF6A 4MZ9A 2KCTA 3E0EA 4O2DA 3F2DA 2EQSA 2AWNA 3HFZB 3KLWA 3PO2G 1KRSA 2CWPA 4LF8Q 4B3TQ 3PIPA 3GTMH 2K14A 4DR2L 1B7YB 4IJHA 4JI1L 3ERSX 5M3MG 5M3FH 4IFDJ 2JE6I 3L2PA 4AYBG 1N33L 1JE5A 2F3IA 4Y52H 3KOJA 3G4SA 3ER0A 1N32Q 4JI3L 4EX5A 1R9TH 4LF9Q 1Z47A 3AFPA 1N9WA 1Z9FA 4AIMA 1TWGH 2ZM6Q 1IBKL 3VDYA 3B6YA 2Q2UA 5FLMG 1SLJA 1WOCA 1XPRA 3M7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IRB A;  4DUZ L;  2ZTD A;  3PUX A;  4HJA A;  1VQ8 A;  4LF6 Q;  2JA7 H;  3F1Z A;  4AYB E;  4C3J H;  5C0X G;  3OTO L;  5HGQ A;  1UE6 A;  3NBH B;  3RZD H;  1PHJ A;  3CP0 A;  2KHJ A;  2UUC L;  5ELN A;  5JJI A;  4OX9 Q;  3TRZ A;  2ATW A;  2MQH A;  1U0L A;  3AQQ A;  3W1G A;  4JBW A;  1J5E L;  4QJF A;  4LF7 L;  4POG A;  1YNX A;  2UXB L;  3GDE A;  1MKH A;  1VCI A;  1Q82 C;  2Q2I A;  2BH8 A;  1U5K A;  3HOV H;  2A8V A;  3AYH B;  4DV4 L;  5HY6 A;  4X66 Q;  1VQ6 A;  2CWA A;  1Q7Y C;  2UUA L;  5JJK A;  2AWO A;  4BBR G;  1N36 Q;  3CCM A;  1IXR A;  4HIK A;  2UXD L;  4A3G G;  3H0G H;  3EIV A;  2Q2H A;  1A8V A;  3BU2 A;  4YWL A;  1MJE A;  1IBM Q;  1IL2 A;  3PO3 H;  3T1Y Q;  4GOP B;  3CCU A;  1NBW A;  2PI2 A;  1L1O C;  3U4V A;  4DV3 Q;  1PH9 A;  4Y7N H;  3CC7 A;  2F4V L;  3PCO B;  4JI0 L;  3M3Y H;  3S16 H;  5IP9 G;  3ZJY C;  1CKN A;  2Y0S E;  3UDF A;  4OWT B;  4LF5 L;  1X3F A;  1YBY A;  1VQ5 A;  3I4N G;  1OXU A;  3L0O A;  3J81 j;  1K73 C;  2JJQ A;  4A4I A;  2ZJR A;  2RHQ B;  2A19 A;  4YWM A;  4JCV E;  2YTY A;  3K7A H;  1IYJ B;  4DV2 L;  2E5L L;  2CQO A;  1Q81 C;  1IBL L;  1BVS A;  5DLQ E;  4JI1 Q;  4DPG A;  3D0F A;  3W5O A;  4DV1 Q;  2VUM H;  4OO1 I;  2JA5 H;  2VQE Q;  1P8L A;  1CSP A;  4JG2 A;  4B3T L;  2AMC B;  4A3K H;  4JC0 A;  4DAY B;  4JI3 Q;  2VY3 A;  4IPD A;  3KFU A;  4X62 Q;  2KHI A;  4KLK A;  1A0I A;  2D0P A;  4DV6 Q;  1VQA A;  3GO5 A;  1JJ2 A;  3I4M G;  4KI0 A;  1PH2 A;  4C3I H;  4DUZ Q;  2CCZ A;  3AEV A;  4WJ3 M;  4R4C A;  2R92 H;  2V1C C;  3OTO Q;  5IYD H;  2VQF L;  2N78 A;  2UUC Q;  2N8N A;  3WWV A;  5IP7 G;  3CCJ A;  4A3J G;  4A3C G;  4LF7 Q;  1J6Q A;  1X3E A;  1J5E Q;  4LF6 L;  4BY7 G;  1WCM G;  1MJC A;  2XGT A;  3PIO A;  1XPU A;  4A93 G;  2IY5 B;  5IY0 A;  4R4T A;  3UDG A;  2IX0 A;  3OYY A;  4OX9 L;  4YCW A;  5JJL A;  1H95 A;  1RIP A;  4DV4 Q;  1D8L A;  2K4K A;  5GAE C;  1VS0 A;  5FLX c;  1FVI A;  3GTO H;  1VQB A;  3W1B A;  4BA2 I;  1VQG A;  3OW2 A;  3CC4 A;  2UXD Q;  5M5X H;  4P72 A;  3I55 A;  4A76 A;  1X55 A;  4LWC A;  4DV7 L;  3LGJ A;  4IJL A;  1N36 L;  4AQY Q;  4GOP A;  1W2B A;  2E2H H;  1NMF A;  4NXM Q;  1Q8K A;  2AHO B;  2OCE A;  2KEN A;  3S15 H;  5FJ8 G;  4LUV A;  4PG3 A;  4HJ5 A;  2F4V Q;  1I3Q H;  1IBM L;  2NZH A;  2B3G A;  3PUW A;  1LYL A;  3T1Y L;  2IHE A;  4OWW B;  2A1A A;  1NJI C;  1EFW A;  4JI6 L;  2LXK A;  3M4Q A;  1PH3 A;  1P16 A;  1X9N A;  3CCL A;  3GTG H;  5GAG C;  3GD7 A;  5E7N A;  3AFQ A;  3RLO A;  4DV2 Q;  2E5L Q;  3BZK A;  1IBL Q;  2JA8 H;  1M90 C;  3KYH C;  4NXN Q;  1VQ9 A;  1QVF A;  2JA9 A;  2F52 A;  2N3S A;  1JJG A;  4DV0 L;  1TWF H;  4A3E G;  4DR6 Q;  4DR7 L;  4DR1 L;  3TS0 A;  2ZTC A;  1Q12 A;  3HOX G;  4DV1 L;  1Y1W G;  1YZ6 A;  4JYA Q;  5C4X G;  1YJ9 A;  1VQN A;  2VQE L;  1OTC A;  3CF5 A;  4LFC Q;  2JA6 H;  3PGZ A;  2H5X A;  4LF4 L;  3KF8 B;  1Q1E A;  3JC6 6;  4JI2 Q;  4BBS H;  3RN2 A;  4IFD G;  1UEB A;  1V43 A;  4X62 L;  5M5Y H;  2VQF Q;  4R4Q A;  3J80 c;  1KC8 C;  4HJ9 A;  3KDF B;  4BBR H;  4DV6 L;  1PYB A;  2PNH A;  2YU9 H;  3MXN B;  3G6E A;  3FHW A;  1HNX Q;  4NB3 A;  4GN3 B;  3CPW A;  4GLX A;  3GTJ H;  4L5S A;  4A3G H;  1PH4 A;  2XTI A;  1Q86 C;  1W3S A;  2L15 A;  4JOI A;  1WJJ A;  1EUJ A;  2WFW A;  3PSI A;  3HOW G;  4A3B G;  2RCN A;  4PZ8 A;  4BY1 G;  3RNU A;  1HNZ Q;  3RR5 A;  4A75 A;  4LUZ A;  1T9H A;  2NVQ H;  1Y1V G;  5C3E G;  4WJ4 A;  2HIX A;  2R7Z G;  1FGU A;  1QUQ B;  3CQZ H;  1VQI A;  4L5T A;  4TVA B;  5IP9 H;  1PV4 A;  2PMZ E;  2OWO A;  3F8T A;  1TXY A;  1CUK A;  1NMG A;  1WFQ A;  3E9I A;  4EQ5 A;  4DV7 Q;  4XTC S;  2I5H A;  2E8G A;  5GAH C;  3RZO H;  2VL6 A;  2PI2 E;  4IOC A;  4A3M G;  1XJV A;  2VW9 A;  4OXP A;  3FKI H;  3J80 i;  3K81 C;  4AQY L;  4NXM L;  1N32 L;  1N8R C;  3S1M H;  3KJP A;  4JI6 Q;  3K7U C;  4NPS A;  3HKZ G;  3CCV A;  1G51 A;  1C7Y A;  4LNQ A;  1RL2 A;  1V9P A;  4UP8 A;  2R93 H;  1I6H H;  2VZA A;  3HOU G;  4A3D H;  4KHP L;  1PVO A;  1XNQ L;  1A63 A;  1K3R A;  1HZC A;  4LFB L;  1UWV A;  3DM3 A;  4B3S L;  3S17 H;  1AH9 A;  4OON A;  3I4O A;  4L5R C;  1FJG Q;  1PA6 A;  2HQL A;  2R7D A;  2Z0S A;  3E9H A;  1KHI A;  3H3V H;  4DV0 Q;  4HIO A;  4RG1 A;  1VQ4 A;  1M1K C;  1YHA A;  3BZC A;  1YIJ A;  1GM5 A;  4DR7 Q;  1I50 H;  4DR1 Q;  5LMN Q;  1GD7 A;  4NXN L;  2B63 H;  1X54 A;  1JJC B;  4GN5 A;  3SGI A;  4A93 H;  5H1S E;  4DR6 L;  4LF4 Q;  1G29 1;  1L2F A;  1WYD A;  2E2I H;  1K0R A;  1HZB A;  3CAM A;  5IYB H;  4JI4 Q;  4TQU S;  5LMU Q;  4A3F G;  2UXB Q;  4K0K Q;  2MFI A;  3KDF A;  4LFC L;  1PH1 A;  4GOP C;  4JI2 L;  3J81 c;  1PH6 A;  3GTP H;  3S14 H;  4GNX B;  2C35 B;  1SR3 A;  2QEX A;  3S1Q H;  1DGS A;  1CKM A;  3A0J A;  1WI5 A;  3H0G G;  4YY3 L;  3M85 A;  2Z6K A;  2Q2T A;  4JBM A;  4JI5 Q;  3GTL H;  1HNX L;  3PO3 G;  1VQM A;  1YJW A;  1C9O A;  5JEA J;  1HZ9 A;  5FJ8 H;  2R6G A;  4UPA A;  3RN5 A;  4X64 L;  1K8G A;  1QUQ A;  4HJ8 A;  1VQL A;  1UE5 A;  3ICE A;  4A3I G;  1XNR Q;  3A5U A;  2OTL A;  3HOY H;  1EYG A;  1HNZ L;  4A3L H;  1VQ7 A;  1VQF A;  1L0W A;  4RMF A;  1OXT A;  1EOV A;  3UE1 A;  3EN2 A;  4PZ7 A;  3HOZ G;  1KAW A;  4P71 A;  1EIY B;  1A62 A;  2NN6 I;  3T1H L;  4GS3 A;  4YCV A;  3H15 A;  1B70 B;  1PH7 A;  3CD6 A;  3U50 C;  3M4O H;  2LSS A;  4OO1 G;  2NVY H;  3KJO A;  3PO2 H;  1AE2 A;  2JA5 G;  1QVC A;  3NEN A;  2IHF A;  4DAM A;  4HIM A;  3CCE A;  1X56 A;  4A3K G;  5M3M H;  1Y1W H;  3ULP A;  3F2B A;  4JBK A;  2KBN A;  2GVB A;  2R7F A;  5C4X H;  4MTN A;  4KHP Q;  1XNQ Q;  1V1Q A;  2PQA B;  4LFB Q;  2HIV A;  2JK8 A;  4B3S Q;  2ASB A;  3S2H H;  1E1O A;  3MEF A;  1PH8 A;  3GTQ H;  2I0Q A;  4GKK L;  1S3O A;  4BXX G;  4JI8 L;  4JOI C;  5FLM H;  5LMN W;  2QGQ A;  3U4Z A;  4UP7 A;  1CSQ A;  2E2J H;  1D7Q A;  1FJG L;  2OTJ A;  4GKJ L;  1KRT A;  3A74 A;  2BA0 A;  3J7Z C;  4IPH A;  1K9M C;  1UE7 A;  2I5M X;  4ME3 A;  3L7Z C;  2K5H A;  3RLN A;  5IYC G;  5C0X I;  4APV A;  5LMN L;  3U58 A;  3EBE A;  1B8A A;  1OXV A;  3I7F A;  1EQQ A;  4LW1 A;  2D0O A;  2UUB Q;  3HOW H;  1PH5 A;  1X6O A;  4PZ6 A;  2NZO A;  2OQK A;  4P74 A;  5C3E H;  1YJN A;  5ELO A;  5BR8 L;  2R7Z H;  4P75 A;  4L5Q A;  4R4O A;  4R4I A;  1IZ6 A;  4GNX A;  1QZG A;  3TS2 A;  1XPO A;  2NVX H;  5J3B A;  4DR3 L;  4JI4 L;  4B3R L;  5LMU L;  1GO3 E;  1HNW Q;  4DUY L;  4HID A;  1VQD A;  4IPC A;  3CXC A;  2MNA A;  4YY3 Q;  4YCU A;  4FDB A;  3PV0 A;  4K0K L;  5IWA Q;  4DKA C;  1KL9 A;  5C44 G;  1YHB A;  2EIF A;  3PUY A;  2HHH Q;  1O7I A;  2MO1 A;  3TQY A;  1FL0 A;  4C3H H;  4A3M H;  4R1J A;  4JI7 L;  4JI5 L;  4X64 Q;  1ASY A;  1X65 A;  2DGY A;  5GRO A;  3A5Z B;  4LFA Q;  2NVT H;  4DV5 Q;  1QVG A;  2WAQ G;  1EWI A;  3HOU H;  1NY4 A;  3TEH B;  1YI2 A;  3T1H Q;  1XNR L;  3S2D H;  5C0X J;  1PYS B;  4P73 A;  3I4N H;  2I5L X;  1L1O B;  2K50 A;  1I94 Q;  2JA8 G;  3I56 A;  4POF A;  4C2M H;  1Q46 A;  2YTX A;  3Q8D A;  4DR4 L;  1I5F A;  2RF4 A;  4A3L G;  2OQ0 A;  1HH2 P;  2FXQ A;  4DK3 C;  1SMX A;  5M3F G;  2GVA A;  2JQO A;  2WAQ E;  1SFO H;  2YV5 A;  3J7A 5;  2PQA A;  4IOA A;  1KXL A;  4X6A H;  3ULJ A;  1BBU A;  3S24 A;  2JA6 G;  4O0A A;  4YWK A;  4GKK Q;  4YHH Q;  4UP9 A;  2CKZ B;  4BBS G;  5IT9 c;  1BBW A;  4JI8 Q;  4A3F H;  1SN8 A;  4GN4 B;  4B3M L;  2Z6K C;  3FP9 A;  1SRU A;  2EXD A;  3I4M H;  1X3G A;  3CME A;  5C4J H;  4GLV B;  1JT8 A;  4GKJ Q;  4DR5 Q;  1BKB A;  4LUO A;  2YYZ A;  2Y0S G;  1G6P A;  1XMO L;  3D31 A;  1E1T A;  2JA7 G;  3ULL A;  3H3V I;  4J15 A;  2K52 A;  1E3P A;  2LXJ A;  3HKZ E;  5IP7 H;  4A3J H;  2ZJQ A;  2ZJP A;  4A3C H;  3CCR A;  1MIU A;  2UU9 L;  2UXC Q;  4BY7 H;  2ALY B;  1WCM H;  1K83 H;  3PF4 A;  3BJU A;  4MNO A;  1XMQ L;  1HR0 W;  5BR8 Q;  1OXX K;  4JV5 L;  1ASZ A;  3UE0 A;  4X65 L;  5AJ3 L;  2UUB L;  1N34 Q;  4A3I H;  4B3R Q;  3NEM A;  4DR3 Q;  4UY8 C;  1UE1 A;  4DUY Q;  3HOV G;  3K8A A;  4AH6 A;  2ID0 A;  1TWH H;  4JYA L;  2RHS B;  1QZH A;  2YTV A;  4KHZ A;  1VQO A;  1HR0 L;  2VS1 A;  2GN5 A;  1YVC A;  3HOZ H;  1LTL A;  2DUD A;  4BA1 I;  3G71 A;  1SE8 A;  3S1R H;  4IO9 A;  1HNW L;  5K36 G;  3JAM c;  4JI7 Q;  3KF6 B;  4OWX B;  5M5W H;  4DR2 Q;  2CFM A;  3UDI A;  3FKI G;  5IWA L;  1OXS C;  3M9B A;  1VQJ A;  2HHH L;  1N33 Q;  4QQB X;  4QIW E;  4IPG A;  1EQR A;  1S72 A;  2IT1 A;  3DLL A;  4QL5 A;  4LF8 L;  2IX1 A;  1C0A A;  1JB7 A;  2R93 G;  1SRO A;  1IBK Q;  4GLA C;  4LFA L;  5JEA G;  4A3D G;  1L1O A;  1Q1B A;  4DV5 L;  2JEA I;  3K80 C;  4QGU A;  4BXX H;  1LUZ A;  2MO0 A;  2N49 A;  1NTG A;  4XIG S;  4HJ7 A;  1YIT A;  4LF9 L;  2ZM6 L;  1KIX A;  4DR4 Q;  4DK6 C;  3GTK H;  1LM0 A;  3HKS A;  4H02 A;  4QY7 A;  3HOY G;  2K75 A;  2ZTE A;  3PUZ A;  4JBJ A;  1I94 L;  2WP8 J;  1GVP A;  1KD1 C;  2JEB I;  2VUM G;  3J81 i;  2B63 G;  4A3E H;  3CMA A;  1E22 A;  3M4P A;  3I2Z A;  3S1N H;  3F2C A;  5IYC H;  3JAM i;  1Y14 B;  3HOX H;  3NEL A;  5GQO A;  4GNX C;  4ALP A;  1PFS A;  1GKH A;  3STB D;  3UDX A;  4B3M Q;  3CCQ A;  1NE3 A;  2BA1 A;  5IYB G;  3CW2 C;  5IE8 A;  1VQK A;  2WB1 G;  2UUA Q;  1YEZ A;  1HJP A;  1VQC A;  2HT1 A;  2VNU D;  2ES2 A;  4YHH L;  1VQP A;  2B29 A;  1XMO Q;  4PMW A;  2R92 G;  4IFD I;  5IYD G;  1EIF A;  1XTD A;  3PUV A;  4X66 L;  1YHQ A;  4DNI A;  3CPF A;  3K0X A;  3RLF A;  1VQE A;  1TWA H;  3STB C;  5C44 H;  4DR5 L;  1VQH A;  2UU9 Q;  3CC2 A;  1XMQ Q;  4JV5 Q;  1E7Z A;  2D62 A;  2WB1 E;  4X65 Q;  5AJ3 Q;  1TWC H;  4JI0 Q;  4A3B H;  2QA4 A;  4BY1 H;  2UXC L;  3PF5 A;  1E24 A;  1JMC A;  4LF5 Q;  1S40 A;  1KQS A;  4DV3 L;  1Y1V H;  2KCM A;  5GAD C;  1CKO A;  2K5V A;  1K8A C;  2AKW B;  3G48 A;  5EAY A;  3TRE A;  1HR0 Q;  2NN6 G;  1N34 L;  1AE3 A;  1CKN B;  3CCS A;  2BH2 A;  2K5N A;  1HZA A;  3KF6 A;  4MZ9 A;  2KCT A;  3E0E A;  4O2D A;  3F2D A;  2EQS A;  2AWN A;  3HFZ B;  3KLW A;  3PO2 G;  1KRS A;  2CWP A;  4LF8 Q;  4B3T Q;  3PIP A;  3GTM H;  2K14 A;  4DR2 L;  1B7Y B;  4IJH A;  4JI1 L;  3ERS X;  5M3M G;  5M3F H;  4IFD J;  2JE6 I;  3L2P A;  4AYB G;  1N33 L;  1JE5 A;  2F3I A;  4Y52 H;  3KOJ A;  3G4S A;  3ER0 A;  1N32 Q;  4JI3 L;  4EX5 A;  1R9T H;  4LF9 Q;  1Z47 A;  3AFP A;  1N9W A;  1Z9F A;  4AIM A;  1TWG H;  2ZM6 Q;  1IBK L;  3VDY A;  3B6Y A;  2Q2U A;  5FLM G;  1SLJ A;  1WOC A;  1XPR A;  3M7N A; 
#chains in the Genus database with same CATH topology
 4HSV A;  4LF6 Q;  3E3X A;  4AYB E;  3OTO L;  1H9S B;  3RZD H;  1PHJ A;  3CP0 A;  2KHJ A;  3CKI B;  1K3B C;  3I90 A;  1Q8I A;  1BCP F;  1LTG D;  3AQQ A;  1RHP A;  4JBW A;  4QJF A;  1F2Y A;  1MKH A;  1U5K A;  1WTH A;  4ODG A;  1LLR D;  1EFI D;  1I6H B;  3AYH B;  4DV4 L;  1EYC A;  4HTH A;  3I4M B;  3S17 B;  3M7G A;  5C4J B;  2SNS A;  4HIK A;  1WTO A;  4A3G G;  3EIV A;  1ZXT A;  1IL2 A;  3CCU A;  2RDH A;  4BY7 B;  4HMJ A;  3VR6 A;  2F4V L;  4JI0 L;  3M3Y H;  2AUK A;  3ZJY C;  2WII B;  2A69 C;  1BOS A;  3UDF A;  3MWY W;  4LF5 L;  1X3F A;  1YBY A;  3I4N G;  1XX8 A;  4N9T A;  2ZJR A;  1VMP A;  4G7H C;  3S14 B;  2E5L L;  1IYJ B;  1GUG A;  4V19 0;  1BVS A;  1T5E A;  5M5W B;  4DV1 Q;  2QW7 A;  2VQE Q;  1I4Q A;  4JG2 A;  4B3T L;  2AMC B;  4JC0 A;  3PQI A;  3NUC A;  5EGT A;  3TP7 A;  4G7O C;  4IPD A;  3H3V C;  2B8G A;  3KFU A;  1TR5 A;  3ERQ A;  4LJZ C;  1JJ2 A;  1G91 A;  4KI0 A;  5ELD A;  5D14 A;  2CCZ A;  4P2C B;  4XYO A;  3GV3 A;  4R4C A;  2WAC A;  3MAQ A;  5I9P A;  4UAI A;  2KHS A;  2N78 A;  4IUT A;  5G3L F;  5IP7 G;  1JWS D;  4IQZ A;  4LF7 Q;  1J5E Q;  1WCM G;  1DXM A;  4U67 3;  4A93 G;  5IY0 A;  3S1N B;  2F0F A;  2IX0 A;  3OYY A;  4OX9 L;  4YCW A;  1RIP A;  2QDB A;  3JAM L;  3MHB A;  2MHV A;  1FVI A;  5C5M A;  1VQG A;  3W2D A;  4DXG A;  2KCC A;  2D5D A;  5M5X H;  5TSS A;  1X55 A;  4LWC A;  4KN7 C;  3J81 E;  4DV7 L;  3LGJ A;  1VMC A;  4GOP A;  2KEN A;  2K5D A;  2BDN A;  2RA4 A;  3H6M A;  1I3Q H;  3KLR A;  4J8Q A;  3WOF A;  1LYL A;  3T1Y L;  1TWC B;  2BE5 C;  1NJI C;  1EFW A;  3C3L A;  3M4Q A;  3GTG H;  4DV2 Q;  3AFQ A;  1MBY A;  3FPP A;  3P1H A;  1TT2 A;  2N3S A;  4DV0 L;  5LL6 S;  2XWB B;  4DR6 Q;  1V1P B;  3GTM B;  4DR1 L;  1SYC A;  5C4X G;  1OTC A;  2NVT B;  4LFC Q;  2JA6 H;  2EXZ A;  2H5X A;  1Q1E A;  3JC6 6;  2HDL A;  4IFD G;  1V8Q A;  3FPU B;  3HOU B;  5CR3 A;  5M5Y H;  4UHV A;  4X62 L;  1EZ8 A;  1TWG B;  3NWS A;  4DV6 L;  4MTK A;  3G6E A;  5KNC A;  4QUF A;  1SNQ A;  4GN3 B;  3CPW A;  1O7L A;  1Q86 C;  2L15 A;  1EUJ A;  1A2T A;  1HNZ Q;  1BF4 A;  3F8T A;  3VR5 A;  4QCL A;  4OIJ A;  1LTB D;  2I5H A;  3VYR A;  1DYQ A;  1ENA A;  2E8G A;  4U68 A;  2F0L A;  5BN3 A;  4QF4 A;  4A3M G;  2JXM B;  3H0G B;  4O1N A;  4XQQ A;  4QB4 A;  4NXM L;  3PO3 B;  1N8R C;  3NWT A;  3K7U C;  1QB5 D;  4KD4 A;  2R93 H;  5I9O A;  4A3D H;  3S16 B;  1XNQ L;  4KHP L;  1A63 A;  1HZC A;  3FVQ A;  2IJ0 A;  4IAL A;  2HQL A;  1PA6 A;  4HCE A;  3HOZ B;  3DM1 A;  1PLF A;  3ITP A;  1HFG A;  3A55 A;  1VQ4 A;  3IFD A;  1M1K C;  3OWE B;  4DR7 Q;  4RCO A;  5LMN Q;  2XIW A;  1GD7 A;  4CDD C;  1XWE A;  1UAP A;  2JA5 B;  5C3X A;  5EKL A;  3KF8 A;  3O13 A;  1SBB B;  1ESR A;  2HCI A;  3OMC A;  3J81 c;  1J8I A;  4C3I B;  5JPM C;  1DGS A;  1CKM A;  4YY3 L;  1SAP A;  1HNX L;  2PW5 A;  1VQM A;  4CJ2 C;  1STG A;  1TY0 A;  3T13 A;  2ZXP A;  3SK4 A;  5FJ8 H;  4DNR B;  3LWU A;  4UPA A;  5E1F A;  2XWJ B;  3RN5 A;  3ICE A;  2F0P A;  3H91 A;  1VQ7 A;  1Z7T A;  1CTM A;  1EOV A;  2X69 A;  4DU9 A;  1KAW A;  3GTO B;  1DON A;  3K0Y A;  4FNF A;  3H15 A;  1M8A A;  1B70 B;  2A5H A;  5FO9 B;  1JOO A;  1CA6 A;  3CU7 A;  2LSS A;  4R8N A;  3NSW A;  3NEN A;  1WTW A;  4Q0F A;  3RMH A;  3CCE A;  5M3M H;  4JBK A;  2EYL A;  2PQA B;  2JK8 A;  2ASB A;  3S2H H;  1EWC A;  3ND8 A;  3RUZ A;  3NE5 B;  3E5S A;  1PH8 A;  2E2D C;  3VA5 A;  2OF1 A;  2WAQ B;  4XT1 B;  4BXX G;  1SNC A;  1ET6 A;  1YNJ C;  5FLM H;  3VR2 A;  4UP7 A;  1D7Q A;  2JA8 B;  1FJG L;  1KNE A;  5A2Q L;  1CI3 M;  2I5M X;  2QKI C;  5FLX L;  2K5H A;  5EQ0 A;  3HOW H;  1OXV A;  1EQQ A;  4LW1 A;  3KUP A;  1CZG A;  2BCO A;  1YJN A;  2R7Z H;  1IZ6 A;  2B2T C;  4RWS C;  4BBS B;  1HNW Q;  1IKL A;  5LMU L;  1GO3 E;  3ND9 A;  2D9U A;  4IPC A;  4J1M A;  3CXC A;  2MNA A;  1SE2 A;  4DUY L;  2UXB L;  2F0N A;  3V05 A;  5IWA Q;  5C44 G;  5I6Y A;  2Y0S B;  4C3H H;  1FL0 A;  1ROD A;  1HA5 A;  3HZX A;  1K8M A;  4DGZ A;  2B2Y C;  4FP5 D;  3BZD B;  2NVQ B;  2F0I A;  3T1H Q;  2EYF A;  4I7Z C;  3F2U A;  5KND A;  1J9O A;  4PNY A;  1SMY D;  2ZT9 C;  1I5F A;  4H44 C;  3L3O C;  4H13 C;  1IW7 C;  4F87 A;  1SNM A;  1NUC A;  4X6A H;  3P75 A;  2JA6 G;  4LMQ D;  2OT2 A;  3M3Y B;  1BBW A;  4Z9C B;  4JI8 Q;  4A3F H;  4B3M L;  2Z6K C;  1RF2 D;  1SRU A;  1HUM A;  3FP9 A;  3I4M H;  4IUU A;  5C4J H;  4GLV B;  5LL6 X;  4GKJ Q;  3OSO A;  2A69 D;  3ULL A;  1B3Q A;  4J15 A;  3MXU A;  1Y8O B;  3HKZ E;  2PZT A;  4BWG B;  3CHB D;  1EY5 A;  4BY7 H;  1K83 H;  4OEL B;  2B63 B;  1HQM C;  2RCF A;  3T53 B;  3UE0 A;  1WTV A;  1N34 Q;  3D6C A;  3NEM A;  4DR3 Q;  2E2I B;  4UY8 C;  3HOV G;  1B9M A;  4DAV A;  3NTH A;  1LT6 D;  4X3S A;  2VS1 A;  1BNZ A;  1SE8 A;  3BG3 A;  4IO9 A;  3GTP B;  1A3U A;  3KF6 B;  5M5W H;  3S1Q B;  2X6G A;  1D6E C;  1EQR A;  2R93 G;  2F1M A;  3PIO 3;  5JEA G;  1QG7 A;  5JJZ A;  4A3D G;  3DEP A;  5NUC A;  1EY7 A;  4DV5 L;  2JEA I;  3K80 C;  1O7Y A;  4ZAI A;  1YIT A;  3IAY A;  1SSO A;  3HKS A;  4CKC A;  2K75 A;  3PUZ A;  1H9J A;  1B1Z A;  2VUM G;  1S5F D;  4LK1 C;  2NVY B;  3S1N H;  5IYC H;  3JAM i;  4PMB A;  3HS0 C;  4GNX C;  2B2U C;  3STB D;  2BA1 A;  1IYU A;  3A8K E;  5IE8 A;  3K6O A;  1VQC A;  1XMO Q;  2R92 G;  5IOC A;  3EQL C;  4IFD I;  2BE5 D;  5IYD G;  2DN8 A;  1NR2 A;  3PUV A;  2J4X A;  3K0X A;  3RLF A;  3A8I E;  2LY7 A;  1U9R A;  2E76 C;  3CC2 A;  2J0T D;  1E7Z A;  1A2U A;  4OL7 A;  1Y8N B;  4JI0 Q;  1TWC H;  1JIC A;  2UXC L;  1JMC A;  4LF5 Q;  2KCM A;  4JYA Q;  3R2T A;  3G48 A;  3V2T A;  1HR0 Q;  2MUY A;  1AE3 A;  5CV8 A;  3SEB A;  1EIG A;  4FO2 A;  2BH2 A;  3NTK A;  1HZA A;  5M5Y B;  1RKN A;  2KCT A;  2RDF A;  3A7A B;  1IKM A;  2WKD A;  5IGC A;  3PMF A;  5DNF A;  4CDE C;  3N52 A;  1KRS A;  2CWP A;  5E4X A;  4B3T Q;  4LF8 Q;  3GTM H;  1PRT D;  2K14 A;  1B7Y B;  1BXT A;  1CM9 A;  2SDF A;  5M3M G;  5J1Z A;  4IFD J;  4OHJ A;  1JE5 A;  2F3I A;  1N32 Q;  4KTA A;  4JI3 L;  4EX5 A;  4LF9 Q;  2F0J A;  1TWG H;  2L12 A;  5C3W A;  1M4V A;  2TSS A;  5FLM G;  1WOC A;  2CW0 D;  1PFB A;  3IRB A;  2CHB D;  1H9K A;  5ELB A;  4DUZ L;  2JA7 H;  3NBH B;  1E2V A;  5ELN A;  4OX9 Q;  3TRZ A;  3AU7 A;  2ATW A;  1U0L A;  3W1G A;  4POG A;  1YNX A;  2NTS A;  1Q3L A;  5HY6 A;  4X66 Q;  2UUA L;  5JJK A;  2AWO A;  4BBR G;  5K36 H;  4J6H A;  1I4H A;  3EVQ A;  4L63 B;  4C3H G;  3H0G H;  2Q2H A;  1MJE A;  3PO3 H;  3T1Y Q;  4A3J B;  2CH4 A;  5C4H A;  3U4V A;  1F77 A;  1L1O C;  4DV3 Q;  4K6L A;  3CC7 A;  1PH9 A;  2DNE A;  4HAE A;  1PTO C;  3S16 H;  5IP9 G;  2F3W A;  4CHT B;  2XN9 C;  2EYP A;  1VQ5 A;  1OXU A;  3L0O A;  1K73 C;  2JJQ A;  2RHQ B;  2F0T A;  5CV5 A;  3NTI A;  3S1R B;  2CQO A;  1Q81 C;  1IBL L;  1E0B A;  1XXG A;  2JA5 H;  4JVZ A;  4R9W A;  3ZYY X;  4X62 Q;  3QWN A;  1GHJ A;  2D0P A;  4DV6 Q;  1VQA A;  3I4M G;  1NR4 A;  2XRQ D;  1OO9 B;  4C3I H;  2LFN A;  2VQF L;  4B9X A;  1CFM A;  2UUC Q;  3K5M A;  3EJI A;  3CCJ A;  4BY7 G;  4RGM A;  1MJC A;  4WOR A;  2XGT A;  3PIO A;  1SYE A;  4A3E B;  4R4T A;  4HR7 B;  3UDG A;  4ZQ3 A;  3TBI B;  3OOC A;  4L8J A;  2LS0 1;  4RGT A;  2NN6 H;  3GTO H;  1BCP C;  1EOT A;  5IGF A;  2UXD Q;  1GUO A;  4A76 A;  1ICW A;  5J39 A;  1K8O A;  1N36 L;  4IJL A;  4FF1 A;  3JAM E;  4NXM Q;  1NMF A;  2EVB A;  2FFK B;  2NZH A;  2B3G A;  1LT4 D;  1F9S A;  1O80 A;  4K14 A;  1H9R A;  2B2V C;  1WD0 A;  2LXK A;  1PH3 A;  5COR A;  1F2Z A;  5JOB A;  1X9N A;  3CCL A;  1Y69 U;  3RLO A;  5E7N A;  1ZYR D;  1CQV A;  3I73 A;  2JA8 H;  3FEW X;  3LWE A;  5IGB A;  2NB0 A;  3K5N A;  1ILQ A;  3SVM A;  2EY5 A;  3K57 A;  3QO2 A;  1JQY D;  3TP6 A;  1V1O A;  4LF4 L;  3A56 A;  4BBS H;  3J80 c;  2MP1 A;  1SEB D;  3KDF B;  2PNH A;  1HNX Q;  1QJO A;  3FHW A;  4L5S A;  4RHR A;  5CMD A;  4JOI A;  4KY5 A;  3TP8 A;  1NSN S;  1PMR A;  2IW3 A;  4PZ8 A;  3TZD A;  4LUZ A;  2NVQ H;  5C3E G;  2FHT A;  1AN8 A;  1IW7 D;  3E6Z X;  5ELC A;  1VQI A;  4L5T A;  1BUV T;  1LTI D;  4KN4 C;  1TXY A;  3SK6 A;  4A3F B;  2PCF B;  4I65 A;  2NUC A;  1KLG D;  5I2Y A;  3K81 C;  2QCP X;  3DHQ A;  2EJG C;  1RDP D;  1K83 B;  4JI6 Q;  4LNQ A;  3NK9 A;  1V9P A;  1NCV A;  3HOU G;  1MI2 A;  2RSO A;  1UWV A;  3DM3 A;  5EJW A;  4B3S L;  1AH9 A;  3MC0 B;  1FJG Q;  2Z0S A;  1G2S A;  3H3V H;  4HIO A;  4MHE A;  4RG1 A;  1YHA A;  3MEH A;  3K7A B;  1YIJ A;  1T5X D;  1A3T A;  1XYI A;  5C4Z A;  1G6Z A;  1LAB A;  2B63 H;  1GUN A;  5C6A A;  1JJC B;  1O7Z A;  2ICE C;  3RD4 A;  1L2F A;  1WYD A;  2E2I H;  1K0R A;  1EIH A;  1JOQ A;  5LMU Q;  4F8M A;  4C1N I;  2UXB Q;  2L9H A;  3SXH A;  1PH1 A;  5IT9 E;  4GOP C;  1X3P A;  3MXN A;  4JI2 L;  3GTP H;  4GNX B;  3Q6S A;  1SR3 A;  3TP5 A;  2QEX A;  3S1Q H;  3A0J A;  1STA A;  3H0G G;  1AEX A;  1HPC A;  3PO3 G;  3OMG A;  4X3T A;  1KNA A;  2H1E A;  3C1F A;  5JEA J;  1K8G A;  1QUQ A;  3KK7 A;  4HJ8 A;  1DCZ A;  2K01 A;  4A3I G;  3SE0 A;  2Z6B A;  4A3L H;  1VQF A;  1GJX A;  3HOZ G;  1QCB D;  5LHY 1;  1A62 A;  4G4K A;  1EQV A;  1PZK D;  2RDG A;  3CD6 A;  3U50 C;  5FO8 B;  4OO1 G;  2NVY H;  1AE2 A;  4QUC A;  2JA5 G;  1QVC A;  2IHF A;  3BDL A;  4XYQ A;  4IZ8 A;  1Y1W H;  2R7F A;  1V1Q A;  4LFB Q;  1FNU A;  1ZKO A;  3GTQ H;  4IUP A;  2I0Q A;  4H7B A;  4GKK L;  4YIJ A;  3C46 A;  4C3I G;  2Z4I A;  4ILW A;  3R8B A;  2QGQ A;  3U4Z A;  3A74 A;  3J7Z C;  4IPH A;  1K9M C;  2F0Q A;  4FXG C;  4ME3 A;  3RLN A;  3S2D H;  2K05 A;  1PH5 A;  4PZ6 A;  2NZO A;  2OEO A;  2KQ3 A;  5BR8 L;  2NTT A;  2B8F A;  5A2Q E;  4R4O A;  2PO4 A;  4R4I A;  1QZG A;  4B3R L;  2XNA C;  4JI4 L;  2AUJ D;  5FLX E;  4HID A;  4K0K L;  2A6E C;  4JPB W;  3PV0 A;  1KL9 A;  1STH A;  1YHB A;  2YU9 B;  3PUY A;  1O7I A;  1HXY D;  5CBA E;  3K58 A;  3GTJ B;  4JI7 L;  2JA7 B;  4JI5 L;  4X64 Q;  5GRO A;  1UNS A;  5J22 A;  4WRD A;  2F0S A;  5EPK A;  4CGY B;  2N88 A;  2QIL A;  4DV5 Q;  1TII D;  4HED A;  2WAQ G;  1U4L A;  2L11 A;  3CQZ B;  1EY9 A;  3T51 B;  1PYS B;  3HEJ A;  4P73 A;  2I5L X;  2V4D A;  1L1O B;  2G5D A;  4KV6 A;  3WDN A;  2JA8 G;  4POF A;  3OHX C;  1BDO A;  1PTO B;  4O42 A;  3RZO B;  4DR4 L;  2OQ0 A;  2FXQ A;  4DK1 A;  2WAQ E;  1JWU D;  1TS3 A;  2C5C A;  2YV5 A;  3J7A 5;  3ULJ A;  1BBU A;  3S24 A;  4IUQ A;  3S1M B;  4O0A A;  2CKZ B;  4BBS G;  5IT9 c;  4GN4 B;  2TMP A;  2Z1C A;  3G7L A;  3R93 A;  1BKB A;  4LUO A;  1PTO D;  2Y0S G;  1G6P A;  3D31 A;  2A68 D;  1E1T A;  4A3J H;  2LXJ A;  2ZJQ A;  4KMU C;  2UXC Q;  2L4N A;  3PF4 A;  3EFX D;  2RSN A;  4JV5 L;  4A93 B;  5AJ3 L;  1KLU D;  1STE A;  2AQ3 B;  3K8A A;  3TN2 A;  2ID0 A;  2BOS A;  5EBC A;  2RHS B;  5IOD A;  3Q0A A;  1VQO A;  1YVC A;  2DUD A;  3G71 A;  3S1R H;  1EWH A;  1X32 A;  2G9D A;  4MN3 A;  2CFM A;  3M9B A;  1SYD A;  4QIW E;  3QOJ A;  1PRT F;  2IT1 A;  1I4R A;  4QL5 A;  1IHZ A;  5KYL A;  1AZP A;  1JB7 A;  4LFA L;  1BR9 A;  5BN4 A;  2RBM A;  2VB3 X;  3HOY B;  1II3 A;  1Y8P B;  2N49 A;  5CYU A;  5CV4 A;  2ZM6 L;  1KIX A;  5D3I B;  2ZTE A;  1I94 L;  4PMC A;  1SNP A;  2JEB I;  1TKW B;  1FGB D;  2B63 G;  4A3E H;  3CMA A;  3I2Z A;  2M2L A;  3A54 A;  1FR3 A;  4HMI A;  4ALP A;  1PFS A;  1SYF A;  1HTP A;  5C4X B;  3BVM A;  2WB1 G;  4F7X A;  4I7A A;  2UUA Q;  5D3D A;  4YHH L;  1VQP A;  4IUV A;  1ESF A;  4N8F A;  4OIK A;  3HRZ C;  2K03 A;  3CPF A;  4TRD A;  1HTL D;  2UU9 Q;  1CK1 A;  1TY2 A;  1XMQ Q;  2D62 A;  2WB1 E;  4X65 Q;  1KQS A;  4A3L G;  5EBD A;  5EAY A;  3Q22 A;  2R61 A;  2NVX B;  4IUR A;  1GOZ A;  4ZKB B;  2EQS A;  3SK5 A;  1WTQ A;  1JB3 A;  4DR2 L;  4IJH A;  3DWP A;  5M3F H;  5EKI A;  2JE6 I;  2F0G A;  1DOM A;  4OGQ C;  4TKO B;  1ILP A;  3NP8 A;  1JC7 A;  1FNW A;  3MA2 B;  1RJT A;  1SLJ A;  1LTS D;  1XPR A;  3M7N A;  2EJM A;  5G3L D;  1YNN C;  3NQI A;  4C2M B;  3F1Z A;  4C3J H;  1UE6 A;  2J7Z A;  4NMZ A;  5JJI A;  5T1I A;  2E75 C;  2MQH A;  4LF7 L;  1J5E L;  4H0L C;  1SFO B;  4JK1 C;  1DJR D;  1Q82 C;  1B44 D;  2A8V A;  5DM7 3;  2CWA A;  1Q7Y C;  1N36 Q;  1Z6H A;  3BYY B;  5IGG A;  3U9O A;  1GUT A;  4FVM A;  1O78 A;  5D65 A;  3DXJ C;  4YWL A;  1LV9 A;  4GOP B;  2PZW A;  1DOK A;  1CKN A;  4OWT B;  3OPO A;  3J81 j;  1TWH B;  4TSS A;  4JCV E;  2L5T A;  3K7A H;  1Q90 A;  4DV2 L;  3FDT A;  1LO5 D;  4JI1 Q;  3D0F A;  3W5O A;  1D5M C;  1S5E D;  4OO1 I;  1ENF A;  4DN4 M;  1P8L A;  2EY2 A;  4CJ0 B;  1R4P B;  4DAY B;  2VY3 A;  1VDZ A;  4CKB A;  2IX3 A;  2KHI A;  4KLK A;  2QDL A;  3GO5 A;  2K32 A;  4M1U B;  4B9W A;  2M00 A;  3OTO Q;  1H9S A;  1KAA A;  2N8N A;  4A3J G;  1NNX A;  1J6Q A;  1X3E A;  4XT3 B;  4KK7 A;  5JJL A;  1Y1W B;  3HOX B;  5COY A;  3ERO A;  4DV4 Q;  4MIU A;  3NQT A;  5GAE C;  1VS0 A;  1VQB A;  3GTQ B;  1TS5 A;  2EDG A;  4CDF C;  4P72 A;  5CGK A;  2O5I C;  1CZW A;  5K5P A;  2E2H H;  1W2B A;  4ZKC B;  1TWA B;  3NBI A;  4ME5 A;  1EY6 A;  5FJ8 G;  4PG3 A;  4HJ5 A;  2F4V Q;  1IBM L;  2IHE A;  5EKK A;  3S2D B;  1PZI D;  4OWW B;  2A1A A;  4A3B B;  4BY1 B;  1Y1V B;  1B53 A;  3IFT A;  2X6L A;  2O5J C;  3GD7 A;  2E5L Q;  1PDQ A;  2KED A;  1M90 C;  1VQ9 A;  3I70 A;  2F52 A;  3A8J E;  1TWF H;  5FK9 C;  4A3E G;  4RKL A;  4DR7 L;  3TS0 A;  2ZTC A;  1Q12 A;  2EY1 A;  1YJ9 A;  1VQN A;  2FMM A;  1EYA A;  4NP5 A;  3A7L A;  3BVG A;  3PGZ A;  1CT1 D;  3H09 A;  3KF8 B;  3HKZ B;  2F0U A;  4JI2 Q;  1UEB A;  1R9T B;  1A6X A;  2MGS A;  4R4Q A;  1KC8 C;  1KDB A;  2YU9 H;  1DD2 A;  1S5B D;  4NB3 A;  3KBG A;  3H94 A;  3GTJ H;  4FXK C;  2G9H D;  4GLX A;  4A3G H;  1WD1 A;  1W3S A;  3HG9 A;  2KOL A;  1SYB A;  3PSI A;  3HOW G;  2EE1 A;  2RCN A;  1VF7 A;  3RR5 A;  2SNM A;  4WJ4 A;  3Q24 A;  1FGU A;  2R7Z G;  1PYW D;  1I4G A;  3CQZ H;  1PV4 A;  1ONL A;  2PMZ E;  2OWO A;  1WFQ A;  4EQ5 A;  4DV7 Q;  1SJE D;  2DY7 A;  1B9N A;  1PTO H;  3MFY A;  5GAH C;  5I6W A;  3RZO H;  1IL8 A;  2VL6 A;  4IOC A;  3I91 A;  4X3U A;  1XJV A;  2VW9 A;  1QNU A;  3AMU A;  1EY4 A;  2IPK D;  2WKC A;  4AQY L;  2P5Z X;  3S1M H;  4RFB A;  3VA7 A;  5CBE E;  3KJP A;  4NPS A;  4Y7N B;  1HHV A;  1G51 A;  1NAP A;  1PVO A;  3K59 A;  2K7V A;  1K3R A;  1SJH D;  1C4Q A;  3E9H A;  4DV0 Q;  1STY A;  1GM5 A;  1V1P A;  1I50 H;  4DR1 Q;  2C9O A;  4NXN L;  2VUM B;  4GN5 A;  3SGI A;  4A93 H;  2O2L D;  5H1S E;  1G29 1;  4A3K B;  1CQF A;  1HZB A;  4JI4 Q;  2EJF C;  4A3F G;  4K0K Q;  4KJO A;  2NBF A;  1PXU A;  1WI5 A;  3GQB A;  3M85 A;  4ULL A;  3TZU A;  2F0O A;  2Q2T A;  4JBM A;  2LKV A;  4JI5 Q;  2IWH A;  1YJW A;  1MHW C;  3D4D A;  3MTS A;  1UE5 A;  1BBX C;  3HOY H;  2WV6 D;  2JN4 A;  4PZ7 A;  2M9V A;  4RAU C;  1EIY B;  3T1H L;  1KTK A;  5HGT A;  1EEF D;  4GS3 A;  4YCV A;  2Q8R E;  1U4R A;  2XVS A;  1PH7 A;  2A6H C;  3M4O H;  1EL0 A;  2MJ8 A;  1B50 A;  3D3R A;  3MVV A;  1STB A;  1YNJ D;  4HIM A;  3S15 B;  2A73 B;  3ULP A;  3F2B A;  2KBN A;  2GVB A;  3OIQ A;  5C4X H;  4KHP Q;  1MD2 D;  1XNQ Q;  1QNK A;  2WIN B;  2HIV A;  3KLS A;  3QIA A;  1SDF A;  2H4O A;  1HRJ A;  2EYJ A;  4IFD H;  1S3O A;  4RCN A;  4JI8 L;  5KNB A;  4JOI C;  1CSQ A;  2OTJ A;  4GKJ L;  1KRT A;  2CVR A;  3TSS A;  5C0X H;  1UE7 A;  1FNV A;  1MSH A;  2GA4 B;  5IYC G;  3U58 A;  3EBE A;  2D0O A;  5M3F B;  3PIP 3;  1X6O A;  4ZYS A;  3GV6 A;  5ELO A;  4P75 A;  4L5Q A;  2O4X A;  3D6W A;  3TS2 A;  2NVX H;  4DR3 L;  2JP1 A;  1VQD A;  4YY3 Q;  4YCU A;  1U4M A;  1TS4 A;  4FDB A;  5JVH 3;  4N8X 1;  4BBR B;  2EIF A;  5I2X A;  1H9M A;  3I72 A;  2MO1 A;  1JOR A;  4A3M H;  1TU2 B;  5EPL A;  4C3J B;  1X65 A;  4L6T B;  1VF5 C;  4LFA Q;  3QB3 A;  1AFP A;  2K28 A;  4RKB A;  1QVG A;  1NY4 A;  3G6J B;  3TEH B;  1YI2 A;  1XNR L;  2B2W A;  3TME A;  1I94 Q;  3I56 A;  4C2M H;  2YTX A;  5L37 A;  1TVX A;  4IN3 A;  3Q8D A;  1SXT A;  1KDC A;  4DK3 C;  1MSG A;  3FKI B;  2GVA A;  1EZ6 A;  2JQO A;  3J80 L;  1SFO H;  2PQA A;  1EQT A;  4QMG A;  4YWK A;  4K2K A;  2QEJ C;  4YHH Q;  4UP9 A;  1SND A;  1SMY C;  3AB9 A;  1HFN A;  1SN8 A;  2EXD A;  2YYZ A;  5KIX A;  2NWG A;  1XMO L;  2ZXR A;  2JA7 G;  3MZ5 A;  4ID6 A;  2K52 A;  1E3P A;  3T56 B;  3I8Z A;  4A3C H;  2CQA A;  1MIU A;  4FF4 A;  5CV7 A;  4FF3 A;  4RGN A;  2E74 C;  3BJU A;  4MNO A;  1HR0 W;  5A35 A;  1OXX K;  1LTT D;  1AW7 A;  2F0M A;  3SR1 A;  4KD3 A;  2UUB L;  2EPB A;  2Z9H A;  4DUY Q;  1TWH H;  3NXW A;  4JYA L;  2YTV A;  1HR0 L;  1ML0 D;  4PQX A;  1LTL A;  5K36 G;  3JAM c;  2Q8T A;  5JAV A;  1QOH A;  2F0W A;  4OWX B;  4DR2 Q;  3UDI A;  1EYD A;  5FO7 B;  4ZK9 B;  3GTL B;  2HHH L;  1S72 A;  3EA6 A;  3DLL A;  4LF8 L;  2IX1 A;  5M9O A;  5ELF A;  4GLA C;  1F9R A;  4JW0 A;  1UEA B;  5FOB B;  1Q1B A;  3SK8 A;  1N32 L;  4QGU A;  4BXX H;  2MO0 A;  4HJ7 A;  4LF9 L;  5ELE A;  1LM0 A;  4QY7 A;  4JBJ A;  3I3C A;  1GVP A;  1KD1 C;  1JR0 D;  2E2H B;  3PO2 B;  1WVL A;  1E22 A;  3F2C A;  3HOX H;  1QWY A;  1GKH A;  2KJX A;  2L0C A;  3UDX A;  1NE3 A;  4B3M Q;  5ISR A;  4KKT A;  4AYB B;  3CW2 C;  1VQK A;  1YEZ A;  1HJP A;  2VNU D;  3QR8 A;  4PMW A;  2K5W A;  4KKS A;  1EIF A;  1XTD A;  4X66 L;  4DNI A;  2D2C C;  5CC4 A;  1R4Q B;  1A3V A;  1TWA H;  3STB C;  3K5O A;  2HDM A;  5C44 H;  4DR5 L;  2E2J B;  4OEM B;  1JWM D;  1CA5 A;  5CV6 A;  2DJG C;  1TWF B;  4KJN A;  1PZJ D;  2QA4 A;  4BY1 H;  4A3B H;  1E24 A;  5DAU A;  3ONA B;  1S40 A;  3HOY G;  4DV3 L;  1Y1V H;  1K8A C;  2K5V A;  4KKU A;  1B2T A;  3T4A C;  5C3E B;  4C56 C;  2NN6 G;  1ENC A;  3CCS A;  1DM0 B;  1S5D D;  2K5N A;  3KF6 A;  2K5Q A;  3E0E A;  4O2D A;  4E6I A;  2AWN A;  1G2T A;  3PIP A;  4A3G B;  3U9S A;  4DAY A;  3DEO A;  3ERS X;  2KA7 A;  1N33 L;  1KDA A;  5AFW A;  1C48 A;  3L9A X;  3KOJ A;  3ER0 A;  4F88 A;  1R9T H;  3AFP A;  1N9W A;  1Z9F A;  1IBK L;  4N9P A;  4KY6 A;  1GXD C;  1PRT C;  2Q2U A;  3I4N B;  2R3Z A;  3IL8 A;  1SE3 A;  2ZTD A;  3PUX A;  2CH4 W;  4HJA A;  1VQ8 A;  5C0X G;  5HGQ A;  2UUC L;  3I4L A;  3T16 A;  2K33 A;  3GDE A;  1VCI A;  2CW0 C;  2Q2I A;  1EY0 A;  2BH8 A;  5IGD A;  3R3O A;  3HOV H;  1VQ6 A;  2F3V A;  2RVL A;  3BDO A;  3CCM A;  4RHS A;  3FRP B;  4XQJ A;  1IXR A;  4HN7 A;  2UXD L;  3HGB A;  1A8V A;  3BU2 A;  1IBM Q;  5E3F A;  1I50 B;  1NBW A;  2PI2 A;  4Y7N H;  1WCM B;  5IIF A;  1C8C A;  3PCO B;  4K8J A;  5JEA H;  2Y0S E;  4A3I B;  4UDU C;  4A4I A;  4FYD A;  2A19 A;  2KCN A;  4YWM A;  2YTY A;  4BS9 A;  1UUP A;  4WFN 3;  4KY7 A;  5DLQ E;  4DPG A;  1D5X C;  5IT9 L;  2VUM H;  2FMC A;  1W6K A;  1BCP B;  4ZCK A;  1CSP A;  4CKE A;  2XSC A;  3C2P A;  4A3K H;  1SYG A;  4JI3 Q;  3DMU A;  2PNR C;  1A0I A;  1PH2 A;  4DUZ Q;  3AEV A;  4WJ3 M;  2R92 H;  2V1C C;  5IYD H;  3NBH A;  5KYI A;  2EZV A;  3GTK B;  3WWV A;  2ZXO A;  3M4O B;  4A3C G;  1BCP D;  1EEI D;  4LF6 L;  1D1I A;  3VR3 A;  1XPU A;  2IY5 B;  3J81 L;  1LT3 D;  1B4O A;  4DF7 A;  3D4W A;  2A6H D;  1TQO A;  3MXG A;  1H95 A;  1A15 A;  1D8L A;  2N55 A;  4M8A A;  4X3K A;  3QJY A;  2K4K A;  3DWQ A;  2JYO A;  3SHL A;  4PV1 C;  5EPJ A;  5FLX c;  3W1B A;  4BA2 I;  1F9Q A;  3OW2 A;  3CC4 A;  3I55 A;  2F0H A;  1DZ1 A;  2PYK A;  4AQY Q;  2PZU A;  5KGU A;  4XQN A;  1JCK B;  1Q8K A;  2AHO B;  2DNC A;  2OCE A;  3S15 H;  1CHQ D;  4LUV A;  1EU4 A;  3PUW A;  2ICI A;  4NDX A;  2AQ2 B;  2KEE A;  2OXP A;  2F0E A;  4JI6 L;  1RTN A;  2EYO A;  1P16 A;  3X3N A;  5GAG C;  3C1E A;  3J7A F;  4FF2 A;  3BZK A;  1RTO A;  1IBL Q;  3KYH C;  4NXN Q;  1QVF A;  2JA9 A;  1JJG A;  1I4X A;  4A3M B;  1MGS A;  1ICF B;  1Y1W G;  3HOX G;  4DV1 L;  1YZ6 A;  1ZYR C;  2VQE L;  1F2L A;  3CF5 A;  4DXF A;  5C5L A;  2K6A A;  3RN2 A;  1RD9 D;  1V43 A;  2VQF Q;  4HJ9 A;  1GUW A;  4BBR H;  1PYB A;  1LAC A;  3MXN B;  1WTR A;  4V0B A;  3UI2 A;  3W3A A;  1PH4 A;  1F2M A;  2XTI A;  1WJJ A;  2HQE A;  3RZD B;  2WFW A;  4A3B G;  4BY1 G;  3RNU A;  4A75 A;  3QG1 A;  1T9H A;  1Y1V G;  1FD7 D;  1PFM A;  2HIX A;  3VYT A;  1QUQ B;  4TVA B;  5IP9 H;  5DEH A;  4QIW B;  1CUK A;  1NMG A;  3E9I A;  1X3Q A;  4XTC S;  4ZUJ A;  1I4P A;  2RQX A;  2B2T A;  2KEC A;  1QIL A;  2PI2 E;  4OXP A;  1S5C D;  3FKI H;  3J80 i;  4ZLT F;  1STN A;  3HKZ G;  3CCV A;  1C7Y A;  1RL2 A;  4UP8 A;  3S9W A;  1I6H H;  2VZA A;  3E0J A;  4LFB L;  4DNT B;  3S17 H;  2EYM A;  4OON A;  3I4O A;  4L5R C;  2B2Y A;  2R7D A;  1KHI A;  4K6D A;  3BZC A;  2F4I A;  4CDC C;  3J7A V;  2K04 A;  3R2I A;  1X54 A;  1QE6 A;  4G57 A;  3QOL A;  4DR6 L;  4LF4 Q;  1IYV A;  3OIP A;  3CAM A;  5IYB H;  4TQU S;  5T1G A;  2MFI A;  3KDF A;  4LFC L;  3BDC A;  2WB1 B;  1AZQ A;  1HCZ A;  3S14 H;  1PH6 A;  1S4Z A;  2NZ1 D;  2VXW A;  4NKL A;  4CJ1 B;  2C35 B;  1ET9 A;  4FXD A;  2Z6K A;  1W6J A;  3GTL H;  4DA2 A;  3X3M A;  1C9O A;  5F2D A;  1PFN A;  3OWF A;  1HZ9 A;  2B39 A;  2R6G A;  1LT5 D;  1JE4 A;  4X64 L;  1TS2 A;  1VQL A;  2XRS D;  1XNR Q;  3A5U A;  2F0D A;  2OTL A;  1EYG A;  1HNZ L;  1I6V C;  1L0W A;  4LAA A;  1OXT A;  1D1K A;  4RMF A;  3UE1 A;  3EN2 A;  4P71 A;  2NN6 I;  2L55 A;  5M5X B;  3M4Y A;  3KJO A;  3PO2 H;  5C44 B;  3DWA A;  3VR4 A;  4DAM A;  4DFA A;  1X56 A;  4A3K G;  1I3Q B;  4MTN A;  4K2L A;  3OW7 A;  3BYT B;  3GP7 A;  4NW2 A;  2Q8I B;  3VYS A;  4G7Z C;  4B3S Q;  1E1O A;  3MEF A;  1U4P A;  1LTR D;  1RCV D;  1KAB A;  2Z8L A;  3GTG B;  1FYC A;  5LMN W;  1EY8 A;  2E2J H;  2KVM A;  2BA0 A;  5JVG 3;  4EVO A;  2A6E D;  5C0X I;  3L7Z C;  5LMN L;  1PRT B;  2DJF C;  4APV A;  1B8A A;  3I7F A;  2UUB Q;  2ENB A;  3IKJ A;  2OQK A;  4P74 A;  2IL8 A;  5C3E H;  1GUS A;  4EQP A;  2HCC A;  3MXP A;  5IGE A;  2JA6 B;  4GNX A;  1XPO A;  2B2U A;  5J3B A;  3TDQ A;  3P20 A;  2SEB D;  2Z4H A;  4DKA C;  5E4W C;  2HHH Q;  3TQY A;  4R1J A;  1ASY A;  5DM6 3;  2DGY A;  4GZY C;  3P7J A;  3A5Z B;  2NVT H;  3CRK C;  1HA6 A;  1GHK A;  3K5L A;  1XTC D;  3CRL C;  1EWI A;  3HOU H;  5FKA C;  5C0X J;  5CV9 A;  3I4N H;  3HOV B;  2EYH A;  2K50 A;  1WTP A;  1Q46 A;  1AP0 A;  4K8I A;  3BVZ A;  2RF4 A;  1HH2 P;  1CHP D;  1SMX A;  5M3F G;  5JPN C;  4RA8 A;  1KXL A;  4IOA A;  3LX0 A;  4GKK Q;  2F0K A;  2FJ2 A;  2R93 B;  1HQR D;  2F03 A;  4A3D B;  4RH6 A;  1X3G A;  3CME A;  1JT8 A;  1E2Z A;  4DR5 Q;  3J80 E;  1SE4 A;  4K5V A;  3SDZ A;  4C3J G;  4EGV A;  3H3V I;  1WTX A;  4K5W A;  2KUM A;  3HP3 A;  5IP7 H;  3MFG A;  4IUN A;  2ZJP A;  3CCR A;  4HCS A;  2UU9 L;  2FIN B;  2ALY B;  1WCM H;  1ZEQ X;  1XMQ L;  5BR8 Q;  2JSO A;  4DAP A;  4DK0 A;  3KLS X;  1ASZ A;  4X65 L;  4B3R Q;  4A3I H;  1L0X B;  2A68 C;  1UE1 A;  1SNO A;  4RGO S;  4AH6 A;  1QZH A;  1JOK A;  3N6R A;  4KHZ A;  2HD3 A;  3HOZ H;  2GN5 A;  1DOL A;  4KHV A;  5BN5 A;  4BA1 I;  5HUR A;  3URY A;  2SOB A;  5KEE A;  4ZRZ A;  1HNW L;  2R92 B;  4JI7 Q;  2I46 A;  3DUZ A;  4OO1 H;  5I4D A;  3FKI G;  5IWA L;  1HUN A;  1K28 A;  3BS1 A;  4ABN A;  1OXS C;  1VQJ A;  1N33 Q;  4EQO A;  4QQB X;  4IPG A;  2PQE A;  1F9P A;  1C0A A;  3VYU A;  1SRO A;  1IBK Q;  2VB2 X;  3LNN A;  1L1O A;  2BDO A;  4HSP A;  2AQ1 B;  1G8Z D;  1LUZ A;  1NTG A;  4XIG S;  3J7Y W;  2PPB C;  3KBX A;  1E2W A;  4DK6 C;  3GTK H;  4DR4 Q;  4H02 A;  2WP8 J;  2EY6 A;  3D4R A;  3J81 i;  3M4P A;  2PW7 A;  2HUG A;  4K5X A;  1Y14 B;  3NEL A;  5GQO A;  3NHH A;  5M3M B;  2K1B A;  3CCQ A;  2A74 C;  5IYB G;  4XDX A;  2MPM A;  3S2H B;  2HT1 A;  5KRU A;  2ES2 A;  3V96 A;  2B29 A;  2NYZ D;  1BQQ T;  2F0V A;  1YHQ A;  4B08 A;  2LMC B;  1PTO F;  4R8I A;  1VQE A;  1B3A A;  4S3S A;  1VQH A;  2PMZ B;  1EU3 A;  3NPP A;  1BO0 A;  4JV5 Q;  2RKS A;  4Q5V A;  5AJ3 Q;  4CBV A;  3WOE A;  1L0Y B;  3PF5 A;  3HOW B;  2B2W C;  4ZUI A;  5GAD C;  2L1B A;  1CKO A;  2AKW B;  3TRE A;  2R7Z B;  1N34 L;  1D5Z C;  1CKN B;  1K0S A;  2QF7 A;  4EQN A;  4MZ9 A;  2EOT A;  4C1N K;  4WJW A;  3F2D A;  3KLW A;  3HFZ B;  3PO2 G;  1LTA D;  4C3H B;  4JI1 L;  2DY8 A;  4XXE A;  1YNN D;  3L2P A;  4AYB G;  2I07 B;  3Q23 A;  4Y52 H;  3G4S A;  3FMC A;  1Z47 A;  4AIM A;  2ZM6 Q;  3VDY A;  3B6Y A;  2B2V A;  1D2B A;  3D8G A; 
#chains in the Genus database with same CATH homology
 3IRB A;  4DUZ L;  2ZTD A;  3PUX A;  4HJA A;  1VQ8 A;  4LF6 Q;  2JA7 H;  3F1Z A;  4AYB E;  4C3J H;  5C0X G;  3OTO L;  5HGQ A;  1UE6 A;  3NBH B;  3RZD H;  1PHJ A;  3CP0 A;  2KHJ A;  2UUC L;  5ELN A;  5JJI A;  4OX9 Q;  3TRZ A;  2ATW A;  2MQH A;  1U0L A;  3AQQ A;  3W1G A;  4JBW A;  1J5E L;  4QJF A;  4LF7 L;  4POG A;  1YNX A;  2UXB L;  3GDE A;  1MKH A;  1VCI A;  1Q82 C;  2Q2I A;  2BH8 A;  1U5K A;  3HOV H;  2A8V A;  3AYH B;  4DV4 L;  5HY6 A;  4X66 Q;  1VQ6 A;  2CWA A;  1Q7Y C;  2UUA L;  5JJK A;  2AWO A;  4BBR G;  1N36 Q;  3CCM A;  1IXR A;  4HIK A;  2UXD L;  4A3G G;  3H0G H;  3EIV A;  2Q2H A;  1A8V A;  3BU2 A;  4YWL A;  1MJE A;  1IBM Q;  1IL2 A;  3PO3 H;  3T1Y Q;  4GOP B;  3CCU A;  1NBW A;  2PI2 A;  1L1O C;  3U4V A;  4DV3 Q;  1PH9 A;  4Y7N H;  3CC7 A;  2F4V L;  3PCO B;  4JI0 L;  3M3Y H;  3S16 H;  5IP9 G;  3ZJY C;  1CKN A;  2Y0S E;  3UDF A;  4OWT B;  4LF5 L;  1X3F A;  1YBY A;  1VQ5 A;  3I4N G;  1OXU A;  3L0O A;  3J81 j;  1K73 C;  2JJQ A;  4A4I A;  2ZJR A;  2RHQ B;  2A19 A;  4YWM A;  4JCV E;  2YTY A;  3K7A H;  1IYJ B;  4DV2 L;  2E5L L;  2CQO A;  1Q81 C;  1IBL L;  1BVS A;  5DLQ E;  4JI1 Q;  4DPG A;  3D0F A;  3W5O A;  4DV1 Q;  2VUM H;  4OO1 I;  2JA5 H;  2VQE Q;  1P8L A;  1CSP A;  4JG2 A;  4B3T L;  2AMC B;  4A3K H;  4JC0 A;  4DAY B;  4JI3 Q;  2VY3 A;  4IPD A;  3KFU A;  4X62 Q;  2KHI A;  4KLK A;  1A0I A;  2D0P A;  4DV6 Q;  1VQA A;  3GO5 A;  1JJ2 A;  3I4M G;  4KI0 A;  1PH2 A;  4C3I H;  4DUZ Q;  2CCZ A;  3AEV A;  4WJ3 M;  4R4C A;  2R92 H;  2V1C C;  3OTO Q;  5IYD H;  2VQF L;  2N78 A;  2UUC Q;  2N8N A;  3WWV A;  5IP7 G;  3CCJ A;  4A3J G;  4A3C G;  4LF7 Q;  1J6Q A;  1X3E A;  1J5E Q;  4LF6 L;  4BY7 G;  1WCM G;  1MJC A;  2XGT A;  3PIO A;  1XPU A;  4A93 G;  2IY5 B;  5IY0 A;  4R4T A;  3UDG A;  2IX0 A;  3OYY A;  4OX9 L;  4YCW A;  5JJL A;  1H95 A;  1RIP A;  4DV4 Q;  1D8L A;  2K4K A;  5GAE C;  1VS0 A;  5FLX c;  1FVI A;  3GTO H;  1VQB A;  3W1B A;  4BA2 I;  1VQG A;  3OW2 A;  3CC4 A;  2UXD Q;  5M5X H;  4P72 A;  3I55 A;  4A76 A;  1X55 A;  4LWC A;  4DV7 L;  3LGJ A;  4IJL A;  1N36 L;  4AQY Q;  4GOP A;  1W2B A;  2E2H H;  1NMF A;  4NXM Q;  1Q8K A;  2AHO B;  2OCE A;  2KEN A;  3S15 H;  5FJ8 G;  4LUV A;  4PG3 A;  4HJ5 A;  2F4V Q;  1I3Q H;  1IBM L;  2NZH A;  2B3G A;  3PUW A;  1LYL A;  3T1Y L;  2IHE A;  4OWW B;  2A1A A;  1NJI C;  1EFW A;  4JI6 L;  2LXK A;  3M4Q A;  1PH3 A;  1P16 A;  1X9N A;  3CCL A;  3GTG H;  5GAG C;  3GD7 A;  5E7N A;  3AFQ A;  3RLO A;  4DV2 Q;  2E5L Q;  3BZK A;  1IBL Q;  2JA8 H;  1M90 C;  3KYH C;  4NXN Q;  1VQ9 A;  1QVF A;  2JA9 A;  2F52 A;  2N3S A;  1JJG A;  4DV0 L;  1TWF H;  4A3E G;  4DR6 Q;  4DR7 L;  4DR1 L;  3TS0 A;  2ZTC A;  1Q12 A;  3HOX G;  4DV1 L;  1Y1W G;  1YZ6 A;  4JYA Q;  5C4X G;  1YJ9 A;  1VQN A;  2VQE L;  1OTC A;  3CF5 A;  4LFC Q;  2JA6 H;  3PGZ A;  2H5X A;  4LF4 L;  3KF8 B;  1Q1E A;  3JC6 6;  4JI2 Q;  4BBS H;  3RN2 A;  4IFD G;  1UEB A;  1V43 A;  4X62 L;  5M5Y H;  2VQF Q;  4R4Q A;  3J80 c;  1KC8 C;  4HJ9 A;  3KDF B;  4BBR H;  4DV6 L;  1PYB A;  2PNH A;  2YU9 H;  3MXN B;  3G6E A;  3FHW A;  1HNX Q;  4NB3 A;  4GN3 B;  3CPW A;  4GLX A;  3GTJ H;  4L5S A;  4A3G H;  1PH4 A;  2XTI A;  1Q86 C;  1W3S A;  2L15 A;  4JOI A;  1WJJ A;  1EUJ A;  2WFW A;  3PSI A;  3HOW G;  4A3B G;  2RCN A;  4PZ8 A;  4BY1 G;  3RNU A;  1HNZ Q;  3RR5 A;  4A75 A;  4LUZ A;  1T9H A;  2NVQ H;  1Y1V G;  5C3E G;  4WJ4 A;  2HIX A;  2R7Z G;  1FGU A;  1QUQ B;  3CQZ H;  1VQI A;  4L5T A;  4TVA B;  5IP9 H;  1PV4 A;  2PMZ E;  2OWO A;  3F8T A;  1TXY A;  1CUK A;  1NMG A;  1WFQ A;  3E9I A;  4EQ5 A;  4DV7 Q;  4XTC S;  2I5H A;  2E8G A;  5GAH C;  3RZO H;  2VL6 A;  2PI2 E;  4IOC A;  4A3M G;  1XJV A;  2VW9 A;  4OXP A;  3FKI H;  3J80 i;  3K81 C;  4AQY L;  4NXM L;  1N32 L;  1N8R C;  3S1M H;  3KJP A;  4JI6 Q;  3K7U C;  4NPS A;  3HKZ G;  3CCV A;  1G51 A;  1C7Y A;  4LNQ A;  1RL2 A;  1V9P A;  4UP8 A;  2R93 H;  1I6H H;  2VZA A;  3HOU G;  4A3D H;  4KHP L;  1PVO A;  1XNQ L;  1A63 A;  1K3R A;  1HZC A;  4LFB L;  1UWV A;  3DM3 A;  4B3S L;  3S17 H;  1AH9 A;  4OON A;  3I4O A;  4L5R C;  1FJG Q;  1PA6 A;  2HQL A;  2R7D A;  2Z0S A;  3E9H A;  1KHI A;  3H3V H;  4DV0 Q;  4HIO A;  4RG1 A;  1VQ4 A;  1M1K C;  1YHA A;  3BZC A;  1YIJ A;  1GM5 A;  4DR7 Q;  1I50 H;  4DR1 Q;  5LMN Q;  1GD7 A;  4NXN L;  2B63 H;  1X54 A;  1JJC B;  4GN5 A;  3SGI A;  4A93 H;  5H1S E;  4DR6 L;  4LF4 Q;  1G29 1;  1L2F A;  1WYD A;  2E2I H;  1K0R A;  1HZB A;  3CAM A;  5IYB H;  4JI4 Q;  4TQU S;  5LMU Q;  4A3F G;  2UXB Q;  4K0K Q;  2MFI A;  3KDF A;  4LFC L;  1PH1 A;  4GOP C;  4JI2 L;  3J81 c;  1PH6 A;  3GTP H;  3S14 H;  4GNX B;  2C35 B;  1SR3 A;  2QEX A;  3S1Q H;  1DGS A;  1CKM A;  3A0J A;  1WI5 A;  3H0G G;  4YY3 L;  3M85 A;  2Z6K A;  2Q2T A;  4JBM A;  4JI5 Q;  3GTL H;  1HNX L;  3PO3 G;  1VQM A;  1YJW A;  1C9O A;  5JEA J;  1HZ9 A;  5FJ8 H;  2R6G A;  4UPA A;  3RN5 A;  4X64 L;  1K8G A;  1QUQ A;  4HJ8 A;  1VQL A;  1UE5 A;  3ICE A;  4A3I G;  1XNR Q;  3A5U A;  2OTL A;  3HOY H;  1EYG A;  1HNZ L;  4A3L H;  1VQ7 A;  1VQF A;  1L0W A;  4RMF A;  1OXT A;  1EOV A;  3UE1 A;  3EN2 A;  4PZ7 A;  3HOZ G;  1KAW A;  4P71 A;  1EIY B;  1A62 A;  2NN6 I;  3T1H L;  4GS3 A;  4YCV A;  3H15 A;  1B70 B;  1PH7 A;  3CD6 A;  3U50 C;  3M4O H;  2LSS A;  4OO1 G;  2NVY H;  3KJO A;  3PO2 H;  1AE2 A;  2JA5 G;  1QVC A;  3NEN A;  2IHF A;  4DAM A;  4HIM A;  3CCE A;  1X56 A;  4A3K G;  5M3M H;  1Y1W H;  3ULP A;  3F2B A;  4JBK A;  2KBN A;  2GVB A;  2R7F A;  5C4X H;  4MTN A;  4KHP Q;  1XNQ Q;  1V1Q A;  2PQA B;  4LFB Q;  2HIV A;  2JK8 A;  4B3S Q;  2ASB A;  3S2H H;  1E1O A;  3MEF A;  1PH8 A;  3GTQ H;  2I0Q A;  4GKK L;  1S3O A;  4BXX G;  4JI8 L;  4JOI C;  5FLM H;  5LMN W;  2QGQ A;  3U4Z A;  4UP7 A;  1CSQ A;  2E2J H;  1D7Q A;  1FJG L;  2OTJ A;  4GKJ L;  1KRT A;  3A74 A;  2BA0 A;  3J7Z C;  4IPH A;  1K9M C;  1UE7 A;  2I5M X;  4ME3 A;  3L7Z C;  2K5H A;  3RLN A;  5IYC G;  5C0X I;  4APV A;  5LMN L;  3U58 A;  3EBE A;  1B8A A;  1OXV A;  3I7F A;  1EQQ A;  4LW1 A;  2D0O A;  2UUB Q;  3HOW H;  1PH5 A;  1X6O A;  4PZ6 A;  2NZO A;  2OQK A;  4P74 A;  5C3E H;  1YJN A;  5ELO A;  5BR8 L;  2R7Z H;  4P75 A;  4L5Q A;  4R4O A;  4R4I A;  1IZ6 A;  4GNX A;  1QZG A;  3TS2 A;  1XPO A;  2NVX H;  5J3B A;  4DR3 L;  4JI4 L;  4B3R L;  5LMU L;  1GO3 E;  1HNW Q;  4DUY L;  4HID A;  1VQD A;  4IPC A;  3CXC A;  2MNA A;  4YY3 Q;  4YCU A;  4FDB A;  3PV0 A;  4K0K L;  5IWA Q;  4DKA C;  1KL9 A;  5C44 G;  1YHB A;  2EIF A;  3PUY A;  2HHH Q;  1O7I A;  2MO1 A;  3TQY A;  1FL0 A;  4C3H H;  4A3M H;  4R1J A;  4JI7 L;  4JI5 L;  4X64 Q;  1ASY A;  1X65 A;  2DGY A;  5GRO A;  3A5Z B;  4LFA Q;  2NVT H;  4DV5 Q;  1QVG A;  2WAQ G;  1EWI A;  3HOU H;  1NY4 A;  3TEH B;  1YI2 A;  3T1H Q;  1XNR L;  3S2D H;  5C0X J;  1PYS B;  4P73 A;  3I4N H;  2I5L X;  1L1O B;  2K50 A;  1I94 Q;  2JA8 G;  3I56 A;  4POF A;  4C2M H;  1Q46 A;  2YTX A;  3Q8D A;  4DR4 L;  1I5F A;  2RF4 A;  4A3L G;  2OQ0 A;  1HH2 P;  2FXQ A;  4DK3 C;  1SMX A;  5M3F G;  2GVA A;  2JQO A;  2WAQ E;  1SFO H;  2YV5 A;  3J7A 5;  2PQA A;  4IOA A;  1KXL A;  4X6A H;  3ULJ A;  1BBU A;  3S24 A;  2JA6 G;  4O0A A;  4YWK A;  4GKK Q;  4YHH Q;  4UP9 A;  2CKZ B;  4BBS G;  5IT9 c;  1BBW A;  4JI8 Q;  4A3F H;  1SN8 A;  4GN4 B;  4B3M L;  2Z6K C;  3FP9 A;  1SRU A;  2EXD A;  3I4M H;  1X3G A;  3CME A;  5C4J H;  4GLV B;  1JT8 A;  4GKJ Q;  4DR5 Q;  1BKB A;  4LUO A;  2YYZ A;  2Y0S G;  1G6P A;  1XMO L;  3D31 A;  1E1T A;  2JA7 G;  3ULL A;  3H3V I;  4J15 A;  2K52 A;  1E3P A;  2LXJ A;  3HKZ E;  5IP7 H;  4A3J H;  2ZJQ A;  2ZJP A;  4A3C H;  3CCR A;  1MIU A;  2UU9 L;  2UXC Q;  4BY7 H;  2ALY B;  1WCM H;  1K83 H;  3PF4 A;  3BJU A;  4MNO A;  1XMQ L;  1HR0 W;  5BR8 Q;  1OXX K;  4JV5 L;  1ASZ A;  3UE0 A;  4X65 L;  5AJ3 L;  2UUB L;  1N34 Q;  4A3I H;  4B3R Q;  3NEM A;  4DR3 Q;  4UY8 C;  1UE1 A;  4DUY Q;  3HOV G;  3K8A A;  4AH6 A;  2ID0 A;  1TWH H;  4JYA L;  2RHS B;  1QZH A;  2YTV A;  4KHZ A;  1VQO A;  1HR0 L;  2VS1 A;  2GN5 A;  1YVC A;  3HOZ H;  1LTL A;  2DUD A;  4BA1 I;  3G71 A;  1SE8 A;  3S1R H;  4IO9 A;  1HNW L;  5K36 G;  3JAM c;  4JI7 Q;  3KF6 B;  4OWX B;  5M5W H;  4DR2 Q;  2CFM A;  3UDI A;  3FKI G;  5IWA L;  1OXS C;  3M9B A;  1VQJ A;  2HHH L;  1N33 Q;  4QQB X;  4QIW E;  4IPG A;  1EQR A;  1S72 A;  2IT1 A;  3DLL A;  4QL5 A;  4LF8 L;  2IX1 A;  1C0A A;  1JB7 A;  2R93 G;  1SRO A;  1IBK Q;  4GLA C;  4LFA L;  5JEA G;  4A3D G;  1L1O A;  1Q1B A;  4DV5 L;  2JEA I;  3K80 C;  4QGU A;  4BXX H;  1LUZ A;  2MO0 A;  2N49 A;  1NTG A;  4XIG S;  4HJ7 A;  1YIT A;  4LF9 L;  2ZM6 L;  1KIX A;  4DR4 Q;  4DK6 C;  3GTK H;  1LM0 A;  3HKS A;  4H02 A;  4QY7 A;  3HOY G;  2K75 A;  2ZTE A;  3PUZ A;  4JBJ A;  1I94 L;  2WP8 J;  1GVP A;  1KD1 C;  2JEB I;  2VUM G;  3J81 i;  2B63 G;  4A3E H;  3CMA A;  1E22 A;  3M4P A;  3I2Z A;  3S1N H;  3F2C A;  5IYC H;  3JAM i;  1Y14 B;  3HOX H;  3NEL A;  5GQO A;  4GNX C;  4ALP A;  1PFS A;  1GKH A;  3STB D;  3UDX A;  4B3M Q;  3CCQ A;  1NE3 A;  2BA1 A;  5IYB G;  3CW2 C;  5IE8 A;  1VQK A;  2WB1 G;  2UUA Q;  1YEZ A;  1HJP A;  1VQC A;  2HT1 A;  2VNU D;  2ES2 A;  4YHH L;  1VQP A;  2B29 A;  1XMO Q;  4PMW A;  2R92 G;  4IFD I;  5IYD G;  1EIF A;  1XTD A;  3PUV A;  4X66 L;  1YHQ A;  4DNI A;  3CPF A;  3K0X A;  3RLF A;  1VQE A;  1TWA H;  3STB C;  5C44 H;  4DR5 L;  1VQH A;  2UU9 Q;  3CC2 A;  1XMQ Q;  4JV5 Q;  1E7Z A;  2D62 A;  2WB1 E;  4X65 Q;  5AJ3 Q;  1TWC H;  4JI0 Q;  4A3B H;  2QA4 A;  4BY1 H;  2UXC L;  3PF5 A;  1E24 A;  1JMC A;  4LF5 Q;  1S40 A;  1KQS A;  4DV3 L;  1Y1V H;  2KCM A;  5GAD C;  1CKO A;  2K5V A;  1K8A C;  2AKW B;  3G48 A;  5EAY A;  3TRE A;  1HR0 Q;  2NN6 G;  1N34 L;  1AE3 A;  1CKN B;  3CCS A;  2BH2 A;  2K5N A;  1HZA A;  3KF6 A;  4MZ9 A;  2KCT A;  3E0E A;  4O2D A;  3F2D A;  2EQS A;  2AWN A;  3HFZ B;  3KLW A;  3PO2 G;  1KRS A;  2CWP A;  4LF8 Q;  4B3T Q;  3PIP A;  3GTM H;  2K14 A;  4DR2 L;  1B7Y B;  4IJH A;  4JI1 L;  3ERS X;  5M3M G;  5M3F H;  4IFD J;  2JE6 I;  3L2P A;  4AYB G;  1N33 L;  1JE5 A;  2F3I A;  4Y52 H;  3KOJ A;  3G4S A;  3ER0 A;  1N32 Q;  4JI3 L;  4EX5 A;  1R9T H;  4LF9 Q;  1Z47 A;  3AFP A;  1N9W A;  1Z9F A;  4AIM A;  1TWG H;  2ZM6 Q;  1IBK L;  3VDY A;  3B6Y A;  2Q2U A;  5FLM G;  1SLJ A;  1WOC A;  1XPR A;  3M7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...