2I5MX

Crystal structure of bacillus subtilis cold shock protein cspb variant a46k s48r
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQKVRFEIVEGNRGPQAANVTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock protein cspB
publication title Optimized variants of the cold shock protein from in vitro selection: structural basis of their high thermostability.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2i5mX00
5C0XG 1A62A 3RLOA 1X9NA 3M4QA 5M5XH 1NMGA 3HKZE 4L5RC 3HOUH 1YVCA 2A19A 4PZ6A 4JI5Q 2F3IA 2KENA 3I4OA 4ALPA 5FJ8H 4JOIA 2VL6A 1VQ9A 5E7NA 2ATWA 1MJCA 1KXLA 4YHHL 4BBRH 4A3GG 4L5QA 3PV0A 3CW2C 5IWAL 4LF5Q 1K9MC 1L1OC 1AE3A 1A8VA 1VQGA 1IBLQ 3I4MG 3UDFA 4HJ8A 1X3EA 4IO9A 4HIDA 1EWIA 1OTCA 3L0OA 4OWXB 4JBMA 3TREA 2R7ZH 5C4JH 3KJPA 1N8RC 5LMNQ 1XMOQ 1KD1C 4DUZQ 1RIPA 4MNOA 3GTPH 3CF5A 3L2PA 3T1YQ 5HGQA 3ULLA 3AEVA 3TS2A 2QA4A 4DR6L 1WOCA 3HOXG 1Y1VG 4LUOA 4GLXA 2WAQG 3S1QH 1OXTA 1VQOA 1K8AC 3J7ZC 4PG3A 4JBWA 1SROA 4DR3Q 3M3YH 4GLAC 2VS1A 3I55A 1C7YA 2ES2A 2JA5H 5IYDG 1X54A 4NXNL 4DR1L 4A93H 4LW1A 3GTMH 1Q8KA 2JQOA 2R7FA 1TWGH 1L1OB 1O7IA 4JBJA 2F4VQ 5C3EH 1VQ8A 1Q12A 1D8LA 2MNAA 1IBKQ 1VQBA 1YJNA 1TWFH 4RMFA 4DR5Q 3LGJA 2JEBI 5FLXc 3PO2H 4LF6L 2BA1A 1HZ9A 4LFAL 3U58A 3OYYA 1Y1WH 1HNWL 1YHAA 2Q2HA 2ZTCA 4YCWA 3F2CA 1SFOH 1I94Q 1UEBA 5FLMH 3L7ZC 1OXXK 5LMUL 2YTVA 2Y0SG 4LNQA 2HQLA 2Q2UA 1LTLA 3I2ZA 3HOVG 3MEFA 3RLNA 4APVA 4A3MG 2JA7H 2WB1E 4DR2L 4IFDJ 4DV6Q 1VQ4A 2A1AA 3ZJYC 3KF6A 2B63H 5IP9H 4HJAA 1HR0Q 3D31A 2E2JH 1C0AA 1IL2A 4JI2Q 1IZ6A 4JI0L 2OQ0A 3NEMA 3IRBA 4YY3Q 1FVIA 5IYBH 4K0KL 4DV3L 1S3OA 2GVBA 4UPAA 4BY1H 4JI1Q 5C44G 3FKIG 2WP8J 1SR3A 1VQ7A 2VQEL 4GN3B 1K83H 2ZTDA 4L5TA 1YJWA 4DUYL 1XPUA 1IBML 3PGZA 4PZ7A 4DK6C 4JYAL 1N33Q 4DAYB 3KOJA 3HOUG 3UDXA 4LF8L 2JA6G 4Y52H 2WFWA 2NVTH 4A3CH 4GOPA 2Z0SA 3JAMc 4BBRG 1OXSC 2MO0A 1X3GA 4QL5A 3HOZH 1WI5A 2OQKA 2NN6I 4UP8A 4A3KH 4GKKQ 3HOYH 2R93H 4A75A 1NY4A 3M85A 1CKMA 1HZBA 4JI4L 2JA8H 3A74A 4DR4L 2I0QA 2NVQH 3PO3H 1YITA 2N8NA 1E24A 3CC7A 2R6GA 1X65A 1U0LA 2I5LX 2JA9A 2BH2A 5GAGC 2IX1A 1B8AA 2K14A 5BR8Q 4A3BH 4DV4L 2VW9A 1HNZL 1MKHA 3TQYA 1JE5A 3EIVA 5IYCH 2C35B 2XTIA 4X64L 4DV0L 2ALYB 3GDEA 4IFDI 4LF4L 2NN6G 1SRUA 1X55A 1GKHA 3K7UC 5C4XH 3G71A 3OW2A 1Q46A 2JA5G 3OTOQ 3S14H 1PH9A 1KRTA 4A93G 1XTDA 2N3SA 4KHZA 3GTKH 1P8LA 3J81c 1VQNA 3S1MH 4GOPC 1HNXL 4P72A 1FJGL 2V1CC 5C3EG 4JV5Q 4A3IG 4IJLA 1L1OA 3KLWA 4DV7Q 3T1HQ 1K0RA 3DLLA 2IHEA 3PO2G 4BXXH 2UUBQ 1E1TA 4IFDG 3M4OH 4BBSH 1Y1WG 4P74A 3F2BA 5M3FH 4GKJL 1VQKA 4GS3A 5FLMG 3NENA 2E2IH 1YJ9A 1XJVA 1PH2A 1VQIA 3AFQA 1XNQL 4A3DH 4HIMA 4DR7L 2A8VA 3E0EA 2JA7G 2H5XA 1CSQA 3CC4A 4JI7Q 3S1NH 1Q82C 4X6AH 1E1OA 2B63G 1YBYA 2E8GA 1B7YB 4PZ8A 4XIGS 5GROA 5IP9G 3H3VH 4OO1I 4JBKA 4C3IH 1PH4A 5GADC 1E22A 5JEAJ 5IP7H 4WJ3M 1D7QA 4GOPB 4BY1G 4R4CA 2NVXH 4B3RL 3S24A 4IPDA 1N32L 1GM5A 1BVSA 2LXJA 2K5VA 4B3TL 4B3ML 1TWAH 2KBNA 3WWVA 4AYBE 2UUCQ 1GD7A 1YHBA 1CKNB 1X6OA 1SN8A 3K8AA 4YWKA 4R4IA 1JB7A 2AMCB 4LFBQ 2VNUD 4OO1G 3EN2A 3H0GH 4JI6Q 4LFAQ 2BH8A 1VQFA 1JJ2A 2YV5A 3S2HH 1VQMA 2AHOB 4DV1Q 1XMQL 4A3CG 3GO5A 2CKZB 4JC0A 1CUKA 3RZOH 2VY3A 4NPSA 3HOZG 4A3KG 3HOYG 2QEXA 1PH6A 3KFUA 1J5EQ 3CP0A 2JA8G 3MXNB 4DAMA 4KHPL 4X62Q 2YTYA 3PO3G 3ULJA 1UWVA 4DPGA 3PUZA 5AJ3Q 2K5HA 3UDIA 2MFIA 3G6EA 4OWWB 4NXML 4A3BG 2AWNA 1C9OA 2PI2E 4R4QA 3PF5A 4OX9L 2YTXA 5IYCG 4X66L 4X65L 2VQFL 3A5ZB 1N36Q 4EQ5A 2UXBL 5C4XG 2CQOA 2RF4A 3HKZG 4KLKA 2UU9L 4LWCA 2ID0A 2QGQA 5EAYA 3CCUA 2ZM6Q 2K50A 5J3BA 2K4KA 1EUJA 3CPWA 1LM0A 4JI5L 4A3FH 4HJ7A 2R92G 3S16H 4POGA 2OCEA 3DM3A 1BKBA 2ZJRA 3H3VI 3NELA 1PFSA 1L0WA 4HJ9A 2JE6I 1Q1BA 4AH6A 1Q81C 1PH3A 5M3MH 1OXVA 1G291 4J15A 2HHHQ 4LF5L 4C3HH 4BBSG 3CAMA 1KQSA 1IBLL 2IX0A 4OXPA 4JI8Q 1S40A 4GNXA 2HT1A 1B70B 1S72A 4YCUA 3CCQA 1CSPA 5LMNL 1XMOL 4DUZL 5JEAG 4WJ4A 3M4PA 4QGUA 3T1YL 1XNRQ 4A3DG 2L15A 3E9HA 1N34Q 3A5UA 1SLJA 1NTGA 3FHWA 1I5FA 2UXDQ 1G6PA 2I5HA 1PV4A 1EQQA 4A3JH 1MJEA 3Q8DA 3S1RH 4DR3L 3BU2A 3CCSA 2RHSB 3CCLA 4DV5Q 5FJ8G 4DV2Q 1DGSA 3RZDH 4B3SQ 5JJLA 1SE8A 1VCIA 1YEZA 3F1ZA 4LFCQ 5H1SE 3ER0A 2N49A 1EOVA 4IOAA 5LMNW 1JJCB 4JI3Q 2F4VL 4OWTB 4AQYQ 1XPRA 5JJIA 2R7ZG 1IBKL 4A3EH 2Q2TA 3CCEA 2UUAQ 1X56A 3FP9A 1CKNA 2HIVA 3H0GG 4DR5L 4GNXC 3HFZB 4A3GH 1VQJA 3TS0A 5IE8A 1V43A 1KHIA 1K3RA 3W1BA 1UE5A 2UXCQ 2WB1G 4LF7Q 1I94L 3D0FA 4R4TA 2LXKA 1Y14B 1G51A 1NMFA 1KIXA 1E3PA 2VZAA 3HOWH 3BJUA 1X3FA 2B3GA 1Z47A 4YWLA 1E7ZA 4DV6L 1PH5A 1NE3A 4HIKA 1M1KC 1QVGA 4DKAC 3AYHB 1HR0L 1AH9A 1FGUA 4JI2L 2VUMH 4YY3L 1YNXA 4POFA 4LF9L 3GTOH 4KI0A 5IYDH 4L5SA 4JI1L 3K7AH 3PSIA 3SGIA 3KJOA 3KYHC 3BZCA 4YHHQ 4IPCA 1K73C 5K36G 1MIUA 1GO3E 2GVAA 4UP7A 5IWAQ 3BZKA 4GNXB 2FXQA 2KCTA 4YWMA 3J7A5 1TWHH 2D62A 1VQAA 4O0AA 2D0OA 4P75A 3RLFA 1QZGA 1N33L 2PMZE 4Y7NH 4A3FG 2Z6KA 4A76A 3TEHB 4MZ9A 4EX5A 3S17H 2CWPA 1HR0W 4DR6Q 3F8TA 2MQHA 4ME3A 4HJ5A 1EIYB 4HIOA 5M3MG 1K8GA 3KDFA 1HJPA 4QQBX 4GKKL 3G48A 3CPFA 5IYBG 3G4SA 1VQHA 1I3QH 2WAQE 1KRSA 1PYSB 4DR1Q 4NXNQ 4BY7H 1CKOA 5BR8L 1XPOA 3U4VA 3JAMi 2OTJA 2NZOA 1I50H 4C3JH 3AFPA 4A3JG 1VQDA 3J81j 3ERSX 3ULPA 2E5LL 4LF6Q 3UE1A 3OTOL 1HNWQ 4RG1A 2N78A 1YI2A 2XGTA 3U50C 5LMUQ 2F52A 2Z6KC 4YCVA 1YIJA 2R93G 3EBEA 2LSSA 1PH7A 4TVAB 2JA6H 1EIFA 1HZAA 2HIXA 4DR2Q 5M5YH 4JV5L 4DK3C 4A3EG 1I6HH 4UP9A 3RR5A 4DV7L 3T1HL 2Y0SE 5M5WH 2OTLA 3CCVA 4QY7A 2UUBL 1V1QA 4JI0Q 4QIWE 1KAWA 4GN4B 3STBC 3J80c 4C2MH 2JEAI 4DV3Q 3I7FA 4K0KQ 2ZJQA 4JCVE 3RN2A 4P71A 2VQEQ 1YHQA 2AWOA 3J81i 1OXUA 1VQEA 4DUYQ 3HOWG 1PA6A 3STBD 1WFQA 1IBMQ 2NZHA 4JI7L 1L2FA 4IPGA 1YZ6A 2E2HH 3GTQH 4JYAQ 1H95A 4PMWA 4BA1I 2YU9H 4IPHA 2VUMG 1N9WA 4LF8Q 3I4NH 3CCRA 2K5NA 3PIOA 4AYBG 2B29A 5GAEC 3PUYA 2JK8A 1BBWA 3KDFB 1PH8A 4AIMA 3PIPA 1QVFA 4JOIC 1IXRA 2CFMA 3JC66 4BXXG 2JJQA 2DUDA 3ICEA 1AE2A 2UUCL 5GQOA 1JJGA 1LYLA 4OONA 4A3IH 4JI4Q 1JT8A 4DR4Q 5M3FG 2BA0A 4LFBL 4A3LG 1QUQA 2IT1A 4UY8C 1WCMH 1VQLA 4JI6L 4TQUS 4DV1L 4DV4Q 1HNZQ 3PUWA 1U5KA 1R9TH 1EQRA 4DV0Q 4X64Q 1EFWA 1WJJA 4LF4Q 2Q2IA 5IP7G 2K75A 1J5EL 1TWCH 4A3LH 2KHJA 1HH2P 2RHQB 1Q1EA 2YYZA 2IHFA 1UE1A 1WYDA 4X62L 3GD7A 3GTJH 1GVPA 1NBWA 2PQAA 5AJ3L 1VQCA 3CXCA 4BY7G 3KF8B 2EQSA 1HNXQ 2I5MX 4LF9Q 4R1JA 2K52A 4IOCA 3I56A 1FJGQ 1QVCA 4IJHA 2KHIA 3AQQA 2CCZA 2ASBA 2IY5B 2KCMA 5C0XJ 2ZTEA 2GN5A 1N36L 1SMXA 4GLVB 5GAHC 3PUVA 4GN5A 3RNUA 4XTCS 3M9BA 3VDYA 1J6QA 3GTGH 3I4MH 4BA2I 4JG2A 3CD6A 4GKJQ 2ZM6L 5DLQE 2EIFA 1M90C 1XNQQ 4DR7Q 3J80i 1V9PA 3W1GA 1UE7A 1NJIC 2RCNA 1PYBA 3NBHB 4FDBA 1UE6A 1VQ6A 3PF4A 3HOXH 4QJFA 1Y1VH 3PUXA 2NVYH 3M7NA 1T9HA 1P16A 5JJKA 2HHHL 3CCJA 3UDGA 3B6YA 4JI8L 3HKSA 3E9IA 4LUVA 4B3RQ 1Z9FA 2AKWB 1A0IA 3W5OA 1PHJA 1N32Q 1KC8C 1VS0A 4B3TQ 4B3MQ 2ZJPA 3F2DA 2R7DA 1XNRL 4MTNA 3U4ZA 4A4IA 3S2DH 1N34L 1QUQB 2UXDL 4R4OA 2CWAA 1IYJB 5ELOA 2E5LQ 3I4NG 3RN5A 1QZHA 2MO1A 4DNIA 1HZCA 5IT9c 1PH1A 3TRZA 4P73A 4DV5L 1XMQQ 1W2BA 4DV2L 4H02A 1BBUA 1EYGA 4B3SL 3S15H 3K80C 1FL0A 2EXDA 4LFCL 3CCMA 1W3SA 2OWOA 2R92H 2PNHA 3KF6B 4JI3L 5C0XI 4A3MH 4AQYL 3HOVH 4KHPQ 2PQAB 3A0JA 3K0XA 1RL2A 3CMEA 1WCMG 1VQ5A 2UUAL 5ELNA 2DGYA 3CC2A 1Q7YC 5HY6A 3PCOB 3CQZH 4O2DA 4LUZA 2PI2A 5IY0A 4NXMQ 1Q86C 3H15A 4OX9Q 3K81C 5C44H 4LF7L 2UXCL 1TXYA 3FKIH 4X65Q 3UE0A 2D0PA 4X66Q 2VQFQ 1JMCA 3CMAA 2UXBQ 1KL9A 1A63A 4NB3A 1ASYA 2UU9Q 1ASZA 3GTLH 1VQPA 1PVOA 1LUZA
chains in the Genus database with same CATH superfamily
3GTGB 2PMZB 1X9NA 2KEDA 2XRQD 3VYUA 5M5XH 1NMGA 3H09A 4IUQA 2RCFA 1Y1VB 4L5QA 5ELDA 2WAQB 1LABA 1K9MC 1AE3A 1VQGA 2RDHA 4S3SA 2QEJC 3VR5A 1IBLQ 1G8ZD 1RCVD 1TKWB 3WOEA 3L0OA 1OTCA 4JBMA 1VDZA 1XMOQ 1KD1C 2IX3A 3DM1A 5HGQA 4EQNA 1AN8A 1LTSD 3MTSA 4K8JA 4DR6L 3HOXG 3S1QH 2X69A 2NTSA 3HP3A 3J7ZC 4DR3Q 5IGCA 2EY6A 1C7YA 3MAQA 1PLFA 3GTMH 3S15B 2JQOA 5LHY1 2BDOA 4CDCC 1O7IA 4JBJA 2F4VQ 1D8LA 4QIWB 1IBKQ 1VQBA 4G57A 3K5LA 2OEOA 3SVMA 4DR5Q 2R61A 5FLXc 1B2TA 1PFMA 1YHAA 4YCWA 2DY8A 1SFOH 3FPUB 3OPOA 3IFTA 1WVLA 4I7ZC 2BE5D 3GP7A 3MEFA 4APVA 4A3MG 2JA7H 3GTLB 4DR2L 1EY8A 1TR5A 4DV6Q 3KF6A 1C0AA 5M5XB 1HR0Q 1IL2A 2FJ2A 3IRBA 1FVIA 4BY1H 2GVBA 3K5NA 5C44G 4KHVA 1PTOH 3F2UA 4RCOA 3AU7A 4KTAA 2SNSA 4L5TA 4G7HC 2NUCA 1LTBD 4C2MB 4JYAL 3KLRA 1N33Q 3HOUG 5JPMC 3NSWA 1ESFA 3BDOA 4LF8L 2ICEC 2JA6G 2F0IA 4Y52H 2WFWA 4A3CH 4BBRG 3HOZH 3S1QB 2R93H 3S9WA 3BDLA 4A75A 3X3MA 2RDFA 3CKIB 2PZUA 1F2ZA 1X65A 2JA9A 2K5QA 5BR8Q 2R3ZA 1MKHA 3TQYA 1PTOC 1JE5A 4ZK9B 2EJMA 3GDEA 4LF4L 2NN6G 1SRUA 1X55A 1GKHA 4UDUC 1W6KA 2JA5G 3S14H 1O7ZA 4RHRA 1PTOD 4KHZA 5DM73 1SFOB 3J81c 3PMFA 4QUFA 4P72A 2QW7A 5C3EG 4JV5Q 5DM63 4IJLA 2JA7B 2IHEA 1Q90A 4BY1B 1MBYA 1YJ9A 1XJVA 1PTOB 2KA7A 1VQIA 3AFQA 4KY7A 4NKLA 1XNQL 2O5IC 2A8VA 1AW7A 5IIFA 4JI7Q 1E1OA 1T5EA 2E8GA 1D7QA 5GADC 4K5WA 1CFMA 4IPDA 4XT1B 1BVSA 1QG7A 5IGDA 4PV1C 4B3ML 4QCLA 3HOZB 5IGGA 3WWVA 2UUCQ 1GD7A 4JK1C 1HFGA 3Q6SA 3K8AA 3VR6A 5HURA 1X3QA 1IYVA 1F77A 2VB3X 2KCCA 1TT2A 1JJ2A 1VQMA 4I65A 3QG1A 2EYFA 3R2TA 3RZOH 2KEEA 4A3KG 1CK1A 2F4IA 3S14B 3PO3G 1PRTF 3VR3A 1PZKD 4L63B 3RMHA 3UDIA 1IL8A 2AWNA 1EY4A 4OX9L 2YTXA 2F0HA 2VQFL 4X65L 1A6XA 2RF4A 4KJNA 2K32A 1U9RA 2K4KA 1A3VA 3EFXD 2ICIA 4F8MA 4POGA 1PMRA 1BKBA 2ZJRA 3NELA 1Q81C 1OXVA 4K2KA 1EYCA 1XXGA 4LF5L 1KQSA 3EA6A 4CGYB 2IX0A 1L0XB 2K1BA 4R8IA 3CCQA 3FVQA 1CSPA 4DUZL 5JEAG 3V96A 3M4PA 3T1YL 4HAEA 1E2WA 4A3DG 1H9JA 1SLJA 5D3IB 1ET6A 4RH6A 3WOFA 3Q8DA 3S1RH 3NE5B 3BU2A 2RHSB 3NQIA 3H91A 1FGBD 3H94A 4B3SQ 1STBA 1F9SA 1SE8A 1EYDA 3RZOB 1KDAA 4JI3Q 1ENAA 2KJXA 5CV6A 4A3GH 1CKNA 3QB3A 1RTNA 5IE8A 4OHJA 4LF7Q 2FMCA 4R4TA 2LXKA 5DEHA 1Y14B 1GOZA 1TWFB 1S5CD 1MHWC 2B3GA 1PH5A 4IURA 4HIKA 1QVGA 1FGUA 4B08A 2BDNA 4LF9L 1SNQA 5CV7A 1NR2A 1EZ8A 4DF7A 5IYDH 3K7AH 3PSIA 3KYHC 2JN4A 2XSCA 4IPCA 3T51B 1SNPA 1UNSA 2KCTA 1TWHH 1TIID 1TS3A 4P75A 1QZGA 3DUZA 3R93A 2Z6KA 3S17H 1JCKB 3OWFA 4DR6Q 2MQHA 1EIYB 2NZ1D 4QUCA 3G48A 5ELBA 1VQHA 5C4HA 2NWGA 4FF4A 5K5PA 3GV3A 4BY7H 3KBGA 3HG9A 1V8QA 4NW2A 1HTPA 2A69C 2NZOA 4OGQC 3AFPA 4WFN3 1K8MA 3DXJC 5KGUA 1IW7C 3T53B 1DM0B 2A74C 4RG1A 1JOKA 2N78A 4F88A 2F0WA 2XGTA 2A69D 3U50C 2Z6KC 4HN7A 2R93G 1HQMC 2LSSA 4L8JA 1A3UA 3J80E 1IW7D 2HIXA 5T1IA 2F0KA 1SJED 5J22A 4DR2Q 4DK3C 4UP9A 2SNMA 1S5BD 3T1HL 2E75C 4QY7A 2UUBL 1V1QA 1ICFB 3I73A 4U68A 2A6EC 3I7FA 2ZJQA 4JCVE 4OIKA 5LL6S 2O2LD 3K7AB 2AWOA 5E3FA 1OXUA 1PZID 2G5DA 2MJ8A 5D3DA 5I9OA 1PA6A 1WFQA 4LK1C 2A6ED 1L2FA 1TWHB 4IPGA 4JYAQ 2K01A 4PMWA 4BA1I 2YU9H 3SE0A 1N9WA 4LF8Q 3I4NH 4AYBG 2B29A 3MVVA 2BCOA 3JAML 1PH8A 3S17B 4ABNA 3JC66 2JJQA 2D9UA 1JOQA 4H44C 5GQOA 4OONA 4A3IH 1K3BC 4Q0FA 3MXGA 4UY8C 3SK5A 4ME5A 4XQJA 4RKLA 4BY7B 3NUCA 4TQUS 1IYUA 3A7LA 5DNFA 5EKKA 5COYA 2K04A 4LF4Q 3HEJA 2D2CC 1E2ZA 1SYBA 1LO5D 2K28A 2PQAA 1VQCA 1WTRA 5A2QE 4IOCA 2A6HC 2E76C 2GN5A 1SMXA 3P7JA 3QOJA 3M9BA 4BA2I 5M9OA 5FO9B 4ZAIA 4CBVA 5FKAC 3KK7A 5CYUA 2Z4IA 1XNQQ 3J80i 1LLRD 3PF4A 3NBHB 3HOXH 1MGSA 1K0SA 2Z8LA 2F0EA 1P16A 1X3PA 3Q23A 1D5ZC 5I4DA 3I4NB 1Z9FA 1JOOA 4J8QA 1SYCA 1KC8C 4B3MQ 1JWMD 3F2DA 1B3AA 4MTNA 2UXDL 3MFYA 5ELOA 1SBBB 3TRZA 2MO1A 5IT9c 2LFNA 2J7ZA 1A2TA 1BBUA 1SYDA 4DV2L 1JORA 4RGTA 3ND9A 2EXDA 1STGA 1NUCA 2B2WA 3OWEB 3CCMA 2OWOA 1A15A 1V1OA 1Q8IA 2SOBA 4HSPA 2PNHA 4A3MH 4J1MA 2PQAB 3A0JA 2EXZA 1RL2A 3MHBA 3RZDB 2UUAL 3PCOB 3D4WA 4LUZA 3R8BA 4BS9A 3U9SA 3H15A 4OX9Q 5C44H 1I6HH 2VQFQ 4X65Q 2D0PA 1Y69U 1KL9A 1EY5A 1PVOA 1VQPA 1D1IA 1KAAA 1PYWD 1CHPD 2F0FA 4PQXA 1A2UA 3CHBD 3D6CA 2Q8RE 2HUGA 1HPCA 3HOUH 1YVCA 2F3IA 5FJ8H 2VL6A 4DXGA 1VQ9A 3HOXB 4BBRH 4A3GG 3PV0A 4LF5Q 1LTAD 2K5DA 3I4MG 1A8VA 2LS01 2R7ZH 5C4JH 1N8RC 4DUZQ 1RIPA 4MNOA 3T1YQ 1LT4D 3AEVA 3TS2A 2Z9HA 2QA4A 2ZXOA 3OOCA 1WOCA 3BDCA 4G7ZC 1OXTA 2SEBD 3DHQA 4MN3A 4DXFA 4L6TB 2NN6H 4GLAC 2JA5H 5IYDG 1X54A 4LW1A 3A8KE 2R7FA 5FLXE 1I4QA 3MWYW 1RDPD 3TP6A 4IZ8A 3NPPA 5C3EH 3VR4A 2MNAA 4A3MB 4RAUC 1A3TA 1YJNA 3X3NA 4JPBW 4B9XA 4LF6L 4DAPA 1QWYA 3E6ZX 1T5XD 3U9OA 3U58A 5ELFA 5EJWA 5CBAE 2ZTCA 5CV4A 1K28A 2B2YA 4K8IA 5LMUL 3L7ZC 1F9RA 5C44B 1GUGA 3RLNA 1FR3A 1BXTA 3DWAA 2E2JH 2OXPA 3HOUB 2OQ0A 1PRTC 3NEMA 5IODA 3RUZA 2JA6B 4N9TA 1SR3A 2VQEL 1FYCA 4ZKCB 4GN3B 4BBRB 1K83H 1YJWA 1PRTD 2F0DA 1XPUA 5I2YA 1IBML 3V05A 1I4RA 4DK6C 1II3A 3BYYB 4WJWA 3KOJA 5C4JB 1CT1D 4O42A 2B2YC 5T1GA 4GOPA 1C4QA 1SEBD 1UEAB 2AQ2B 4QL5A 4KY5A 2OQKA 2NN6I 4A3KH 1B9MA 1PRTB 4JI4L 2JA5B 2I0QA 3PO3H 1JC7A 1EU3A 1VMPA 1CM9A 2DJGC 2N8NA 1YITA 3CC7A 2BH2A 1ICWA 1B8AA 1ILQA 1U4MA 4DV4L 5C3EB 4LJZC 4CKBA 3OW2A 3FPPA 1Q46A 3DEPA 4MHEA 4A93G 1SE4A 1J9OA 1Z7TA 2N3SA 3MXNA 3GTKH 1P8LA 3S1MH 1PFNA 4GOPC 3AMUA 1RTOA 5J1ZA 1FJGL 2V1CC 4A3IG 3TP7A 1AZPA 3T1HQ 1K0RA 3PO2G 2UUBQ 2E2JB 1JB3A 3J80L 3E3XA 4KMUC 5EBDA 4P74A 5C6AA 4GKJL 1ENCA 4GS3A 5JEAH 4A3DH 4HIMA 1B4OA 1K83B 1SE2A 2H5XA 3S1NH 4X6AH 2RDGA 2Z4HA 2B63G 1YBYA 4FXDA 4XIGS 4JBKA 5JEAJ 3MFGA 2MPMA 4DGZA 4GOPB 4R4CA 4B3RL 3VYSA 1ENFA 4KKTA 4H0LC 2HDMA 1TWAH 4NDXA 4AYBE 1SMYC 3HZXA 4ZCKA 4A3KB 4O1NA 4UAIA 2XWBB 2XWJB 4YWKA 2VNUD 4R4IA 3PO3B 1SMYD 3S2HH 2AHOB 3GO5A 1RHPA 2OT2A 5KEEA 1SE3A 2VY3A 4NPSA 1MSHA 3HOYG 5A35A 3MXNB 5CV5A 4DAMA 2YTYA 4DPGA 2MFIA 3S1MB 3I3CA 3MA2B 4NXML 1EQTA 2WKCA 2XVSA 5ELEA 5IYCG 2UXBL 4DFAA 3A5ZB 1YNJC 1RJTA 5A2QL 2UU9L 4LWCA 2ZXPA 2MHVA 3OIQA 3OW7A 4XYQA 4KK7A 2K50A 5J3BA 1LM0A 1YNJD 1BO0A 4A3DB 3K5OA 1L0WA 3S1NB 3MZ5A 4GZYC 1JWUD 4FYDA 2F0UA 1G291 4BBSG 4F87A 4GNXA 1S72A 5LMNL 4RFBA 1SNMA 1TWAB 2L15A 2WV6D 3FRPB 3E9HA 3JAME 1I5FA 2UXDQ 1G6PA 1PV4A 4P2CB 1V1PA 5FJ8G 1CA6A 4DV2Q 4HSVA 3F1ZA 5H1SE 3N6RA 1SNOA 1EY6A 4OWTB 1XPRA 1IKLA 2R7ZG 2UUAQ 1X56A 2PCFB 4GNXC 3GTMB 1CZWA 1K3RA 3D0FA 1I4PA 2L1BA 5CBEE 3WDNA 1RODA 1KIXA 1X3FA 1CA5A 1Z47A 1CQVA 1E7ZA 3P20A 2JXMB 4DKAC 2HQEA 4JI2L 1FD7D 3NXWA 4YY3L 3GTOH 4KI0A 3L9AX 3SHLA 4L5SA 1WTVA 3BYTB 1VF5C 2V4DA 3BZCA 5K36G 3NBIA 1HQRD 1DOLA 3BZKA 4GNXB 2FXQA 1NAPA 2D62A 2KVMA 1SNDA 1W6JA 4O0AA 2L11A 2EY1A 3RLFA 4A3FG 1AEXA 4EX5A 2IWHA 2CWPA 1HR0W 3P1HA 4N8X1 1K8GA 3KDFA 1V1PB 1S5FD 2FMMA 3T4AC 4KKUA 1PYSB 1L0YB 2VXWA 2TSSA 1HCZA 2R93B 1CKOA 1XPOA 3U4VA 1J8IA 3JAMi 4F7XA 2OTJA 1I50H 5FLXL 3ULPA 2RQXA 4LF6Q 3UE1A 4RWSC 5LMUQ 1TVXA 1PH7A 4DNTB 1B9NA 4A3EG 4XQNA 3STBC 4DK1A 1KLGD 3GTOB 4AYBB 1BOSA 2VQEQ 4HMJA 5I9PA 1GHKA 2B2VA 1HRJA 3HOWG 1OO9B 3STBD 1IBMQ 1YZ6A 3DWPA 4FVMA 4FXKC 2E2HH 1H95A 1KABA 2VUMG 1F2YA 3P75A 1S5DD 1SSOA 2JK8A 1BBWA 3KDFB 4JOIC 4N9PA 1QB5D 4JI4Q 3C3LA 1STHA 2DY7A 2BA0A 4LFBL 2PZWA 1QUQA 5EKLA 1U4RA 3IL8A 4JI6L 4DV1L 4DV4Q 1H9RA 3PUWA 1U5KA 2B2VC 1R9TH 1D2BA 1I50B 1EFWA 3J7AV 2EYLA 2Q2IA 2K75A 3D6WA 1J5EL 1Q1EA 4ZUJA 4X62L 3GTJH 1GVPA 5AJ3L 4QB4A 4OL7A 2I5MX 2K52A 1FJGQ 1O7LA 3I56A 1AP0A 1QVCA 5ELCA 3AQQA 2CCZA 2IY5B 2KCMA 1EIGA 4C3JG 4Q5VA 1RF2D 1N36L 4GLVB 3VDYA 3I4MH 3BZDB 1BNZA 4K6DA 4GKJQ 1QJOA 2NB0A 1WTXA 3QO2A 4IUPA 1EEID 1JQYD 4CJ1B 1UE6A 4QJFA 1BCPF 4RGNA 1TS2A 2E2HB 2NVYH 1T9HA 2HHHL 5I2XA 1GXDC 3CCJA 3B6YA 3UDGA 3HKSA 4B3RQ 2AKWB 1PHJA 2AQ1B 1R4QB 1BF4A 2ZJPA 4A4IA 3S2DH 1AZQA 1N34L 1QUQB 2CWAA 3TZDA 3RN5A 3M4YA 3T13A 1PH1A 5I6YA 4P73A 1DD2A 4H02A 1FL0A 4NP5A 4QF4A 2CHBD 3J7YW 1W3SA 2R92H 3S1RB 4AQYL 1ZKOA 4IUTA 3QOLA 1H9MA 2LY7A 1VQ5A 1WCMG 5ELNA 2DGYA 2MP1A 1KDCA 5HY6A 5HGTA 2B2UA 3CQZH 4NXMQ 2C9OA 3DMUA 4KJOA 1B53A 1Q86C 1NCVA 1QNKA 1TXYA 2UXBQ 3CMAA 2F0MA 3UI2A 5KRUA 2UU9Q 1ASZA 4A3LG 4A3GB 3I4MB 3RLOA 3D3RA 4YIJA 3V2TA 3A8JE 2K05A 1EY9A 5I6WA 4L5RC 1G2SA 2A19A 1CHQD 2KENA 3I4OA 4TKOB 4ALPA 4HR7B 3QJYA 5KNCA 3CRKC 2ATWA 1GHJA 2NVYB 1L1OC 2PYKA 4TSSA 3UDFA 4EQOA 4IO9A 2PW7A 4HIDA 3KJPA 3EJIA 5LMNQ 3GTPH 2B2UC 3CF5A 4U673 4DAYA 3ULLA 5CORA 2Q8TA 1DXMA 3S2DB 4GLXA 2CW0C 3NBHA 1VQOA 1IHZA 3LWEA 1SROA 3NQTA 2EPBA 5EPKA 3C1EA 2VS1A 2F0VA 3I55A 4HCSA 2RKSA 3GV6A 4DR1L 2WKDA 4A93H 5BN5A 1LT6D 1L1OB 3LNNA 3TN2A 4KY6A 2F0GA 2J4XA 4RMFA 3LGJA 3PO2H 1HZ9A 3Q24A 1HNWL 3CQZB 2Q2HA 3F2CA 5JVG3 1OXXK 2YTVA 2Y0SG 4LNQA 2Q2UA 3TP8A 1LTID 1LTLA 3I2ZA 3HOVG 3I8ZA 2A1AA 2B63H 1ET9A 2RBMA 4XYOA 4CJ2C 3SR1A 4JI2Q 1WTWA 4YY3Q 4K0KL 1C48A 1S3OA 1NNXA 3FKIG 2F0SA 2WP8J 3ITPA 1VQ7A 4RA8A 4ZLTF 1TQOA 2QDLA 4DUYL 1JWSD 2A6HD 3PGZA 2GA4B 4PZ7A 2F03A 4DAYB 1U4PA 1SYFA 3GTPB 1ZYRC 3NTKA 2K5WA 3IKJA 2G9DA 2DN8A 2K03A 1X3GA 1WI5A 4UP8A 3HOYH 4DAVA 1H9SA 2YU9B 3M85A 2EJGC 2EYPA 2NVQH 1ILPA 1E24A 4A93B 2Z1CA 1U0LA 4ZRZA 2IX1A 1BR9A 5CV9A 2VW9A 1HNZL 4A3IB 3EIVA 5IYCH 2C35B 2XTIA 3N52A 1EU4A 3G71A 3PO2B 1CI3M 4EGVA 1BUVT 1PH9A 1XTDA 1B50A 1DONA 1VQNA 1HNXL 2KOLA 4C1NK 4XT3B 1Y8NB 3DLLA 4X3SA 1EQVA 1MI2A 2B63B 4BXXH 4IFDG 2D5DA 4BBSH 2DJFC 1Y1WG 3NTHA 3F2BA 1VQKA 5FLMG 3TBIB 1F2LA 3ND8A 4FF1A 4DR7L 3E0EA 2F1MA 1FNWA 2CH4W 4PZ8A 3H3VH 5GROA 5IP9G 2EE1A 3NWSA 4DNRB 3GQBA 1PH4A 1BBXC 1HUNA 1N32L 1GM5A 2J0TD 2LXJA 2K5VA 1H9SB 3MC0B 2KBNA 1YHBA 3HOYB 3R3OA 1X6OA 1SN8A 4LFBQ 4OO1G 2NVQB 4DU9A 1B3QA 2E74C 1SDFA 5EBCA 4NMZA 2BH8A 4JW0A 1VQFA 4LFAQ 4JI6Q 2YV5A 4DV1Q 2IW3A 2PO4A 3PQIA 1TS5A 2XRSD 2QEXA 5NUCA 5JPNC 1J5EQ 2JA8G 3OSOA 1QILA 1D5MC 3ZYYX 4X62Q 2AQ3B 3TP5A 1WTHA 3H3VC 3PUZA 5AJ3Q 3G6EA 3K59A 4KD3A 3I90A 2B39A 3HGBA 4A3BG 1ZXTA 2PI2E 3EQLC 4RKBA 3PF5A 1N36Q 5K36H 1WTPA 5C4XG 2CQOA 2EY5A 3HKZG 2F3VA 2F0JA 2F0PA 2ID0A 4X3KA 5IOCA 4BBSB 3CCUA 2JP1A 3NK9A 4CKEA 1I6HB 4JI5L 4A3FH 4HJ7A 2R92G 3DM3A 3FMCA 3H3VI 1PFSA 2QF7A 4AH6A 4IUNA 4K5XA 2HHHQ 4N8FA 1SXTA 4OXPA 1S40A 2HT1A 4CDEC 3OMGA 3A56A 3G7LA 1N34Q 3A54A 2I5HA 1MJEA 3SK6A 1EQQA 2R7ZB 4C3IG 3CCSA 5KNDA 1JICA 3CCLA 2NYZD 4WORA 3W3AA 1VCIA 4IOAA 1EOVA 1JJCB 4AQYQ 5JJIA 4A3EH 4ZUIA 3CCEA 3FP9A 2HIVA 3H0GG 3R2IA 2L12A 3TS0A 1STYA 1F9PA 4KN4C 1V43A 3T56B 1KHIA 3E0JA 3W1BA 2WB1G 1I94L 1Y8OB 3J81E 1CQFA 1E3PA 2VZAA 4V190 3HOWH 1GUNA 1VMCA 5CV8A 1GJXA 3TMEA 1NE3A 1HFNA 4HMIA 3AYHB 3VA5A 1ONLA 2VUMH 1YNXA 3CU7A 4RHSA 4POFA 4A3FB 5DAUA 1FNUA 4JI1L 1K73C 5KYIA 5EPJA 1GO3E 2GVAA 2PNRC 3BVMA 4YWMA 1VQAA 2B2TA 2D0OA 3K0YA 1YNNC 2QILA 3TEHB 5D65A 2RSNA 3F8TA 4ME3A 5M3MG 3K6OA 4C3HG 4GKKL 1YNND 1BCPC 4EVOA 3G4SA 2KHSA 4DR1Q 1EYAA 3EROA 2AUKA 5C5LA 2XN9C 1BCPD 4R8NA 3KUPA 5G3LF 1G6ZA 1B44D 4C3JH 4A3JG 1VQDA 4A3EB 3IAYA 4JVZA 2MGSA 5E1FA 2B2TC 5KNBA 3OTOL 1HNWQ 5D14A 4ZYSA 2H1EA 4YCVA 1STEA 1EOTA 4TVAB 1BCPB 1EIFA 2IJ0A 3KF8A 5M5YH 3HOWB 4IUVA 3RR5A 3IFDA 4DV7L 1JR0D 2Y0SE 2B8FA 3CCVA 4LMQD 3GTKB 1KAWA 4GN4B 4C2MH 2JEAI 4K0KQ 2VUMB 3NHHA 1SNCA 4P71A 3RN2A 2HDLA 3J81i 4DUYQ 1GUOA 4ZKBB 3VR2A 2FINB 3GTQH 1CZGA 1LTRD 4IPHA 3E5SA 1UUPA 1RD9D 3PIOA 3CCRA 5GAEC 2SDFA 4AIMA 3OIPA 4CKCA 3PIPA 1QVFA 2QCPX 4B9WA 4DN4M 1IXRA 1GUTA 4BXXG 2DUDA 3ICEA 1AE2A 4X3TA 2B8GA 1STNA 5JOBA 2O5JC 2EYJA 5EPLA 1STAA 2IT1A 1WCMH 4M1UB 5ISRA 4WRDA 2BE5C 3CRLC 2KCNA 5IGFA 5J39A 1FNVA 2H4OA 1HNZQ 1EQRA 1EL0A 4C3JB 1I6VC 4A3LH 1TWCH 4H7BA 1HH2P 2YYZA 3D4DA 1Q3LA 1WYDA 1ZEQX 3S2HB 3KF8B 2EQSA 1HNXQ 4R1JA 2RSOA 2ASBA 1ESRA 5M5YB 2JSOA 2ZTEA 2TMPA 3HRZC 3KBXA 3PUVA 4X3UA 4GN5A 4XTCS 1J6QA 4DA2A 1LT3D 2OF1A 4JG2A 3CD6A 1EEFD 2F0TA 3RD4A 2ZM6L 5DLQE 2EIFA 4DR7Q 1G91A 1UE7A 1VQ6A 1PYBA 2ENBA 4FDBA 2A68C 2L4NA 3PUXA 1DJRD 5CGKA 3GTQB 1HHVA 5JJKA 3NWTA 2Z6BA 4JI8L 4LUVA 1DOKA 4C1NI 1S4ZA 1N32Q 2A68D 1G2TA 2DNCA 1XNRL 2WINB 2ZT9C 4CJ0B 5E4XA 5EGTA 1TY0A 2E5LQ 1IYJB 1QZHA 5CC4A 1WCMB 4DNIA 5CR3A 4DV5L 1EYGA 3MEHA 4LFCL 3D4RA 3KF6B 3HOVH 2KUMA 1TU2B 1TWCB 2HCIA 1EWCA 5C3XA 3CMEA 2K6AA 2ZXRA 5IY0A 4CDDC 1R4PB 2QKIC 3HS0C 2UXCL 5JAVA 3FKIH 3UE0A 5EKIA 1JE4A 2WACA 2NBFA 4NB3A 1ASYA 1LUZA 5C0XG 1A62A 2QDBA 3M4QA 5FOBB 3HKZE 4PZ6A 4JI5Q 1HA5A 5JJZA 2K33A 3BG3A 3LWUA 4JOIA 3SK8A 5E7NA 3KLSX 1MJCA 1KXLA 3LX0A 4YHHL 4ULLA 3CW2C 5IWAL 1UAPA 1EWHA 4HJ8A 1X3EA 1EWIA 4OWXB 3TREA 3L2PA 2L55A 1SAPA 1Y1VG 4LUOA 2L5TA 2WAQG 1I4GA 1K8AC 4PG3A 4JBWA 3M3YH 2EYOA 3AB9A 2ES2A 1O80A 4NXNL 5LL6X 1Q8KA 5C5MA 1TWGH 4RGMA 2Y0SB 3SK4A 4R9WA 1VQ8A 1Q12A 2A73B 2I46A 3HOVB 1TWFH 2N55A 4QMGA 5C3WA 2JEBI 1SYEA 3PIO3 2BA1A 4IFDH 4LFAL 3OYYA 2CQAA 1Y1WH 3T16A 3PIP3 1I94Q 1UEBA 5FLMH 3FKIB 1PXUA 4TRDA 2HQLA 4IFDJ 2WB1E 1QNUA 1VQ4A 3ZJYC 3MXUA 5BN3A 5IP9H 4HJAA 3J7AF 3D31A 3J81L 2E2DC 1IZ6A 4JI0L 5IYBH 1PDQA 2XIWA 4DV3L 4KV6A 4OIJA 4UPAA 4JI1Q 1SJHD 2KQ3A 2ZTDA 2PW5A 1VF7A 3NP8A 4RGOS 1GUSA 4OO1H 1PZJD 2BOSA 3UDXA 2NVTH 4HEDA 1BDOA 2Z0SA 3JAMc 1KNEA 1OXSC 2MO0A 4OELB 3Q0AA 1F2MA 4GKKQ 1IKMA 1NY4A 1O7YA 3M3YB 1CKMA 1HZBA 4CHTB 2JA8H 3A74A 4DR4L 3W2DA 2O4XA 2RVLA 3M7GA 1XTCD 2R6GA 2I5LX 5IT9E 5GAGC 1TWGB 2K14A 4A3BH 4DV0L 3OHXC 4X64L 2ALYB 4IFDI 3I70A 5C4XH 3K7UC 4ID6A 3OTOQ 1Z6HA 1KRTA 1GUWA 3FEWX 1Y1WB 2KECA 4G7OC 1PFBA 2MUYA 1R9TB 2F0LA 1L1OA 3KLWA 4DV7Q 1EZ6A 2K7VA 1E1TA 2Q8IB 3GTJB 3M4OH 1MD2D 1DZ1A 5M3FH 2E2IH 3NENA 4K14A 2EVBA 1PH2A 2M9VA 3NTIA 2JA7G 1CSQA 3CC4A 1Q82C 1I4XA 5KIXA 3SEBA 1B7YB 4OO1I 4C3IH 4WJ3M 3L3OC 1E22A 5IP7H 4BY1G 2NVXH 3S24A 2FFKB 2NVTB 1EIHA 4B3TL 3VYRA 1CKNB 2JA8B 3ERQA 1JB7A 2AMCB 3EN2A 3H0GH 1XMQL 4A3CG 1ML0D 4A3BB 2CKZB 4JC0A 1CUKA 3HOZG 5CMDA 1PH6A 2L9HA 3KFUA 5C4XB 3CP0A 3I91A 3HKZB 3DEOA 4KHPL 5JVH3 3BVGA 3ULJA 1UWVA 2CW0D 2K5HA 4J6HA 4OWWB 4Z9CB 2R92B 1C9OA 2L0CA 4IN3A 4R4QA 2A5HA 4PMBA 4X66L 1D6EC 4EQ5A 1LV9A 4KLKA 5KYLA 2P5ZX 2QGQA 3M4OB 5EAYA 2NTTA 5IGEA 2ZM6Q 1SYGA 2F0QA 4OEMB 3CPWA 1EUJA 3QWNA 4HTHA 5M3FB 2E2IB 4C56C 5G3LD 1D5XC 2WIIB 3S16H 2OCEA 5BN4A 4HJ9A 1PH3A 2JE6I 1Q1BA 3A7AB 5M3MH 1D1KA 4J15A 3ONAB 4C3HH 3CAMA 4C3IB 1IBLL 4JI8Q 2JYOA 1B70B 4YCUA 5L37A 1QCBD 2NVXB 1DCZA 4CDFC 1XMOL 4WJ4A 4QGUA 1XNRQ 4XXEA 1PTOF 2LKVA 4ODGA 3A5UA 4EQPA 1NTGA 3FHWA 2AUJD 2HD3A 4A3JH 2EDGA 2HCCA 4DR3L 4G4KA 1KNAA 3H0GB 4DV5Q 1DGSA 4ILWA 3RZDH 1M4VA 5JJLA 1I4HA 4K6LA 1YEZA 3O13A 4LFCQ 2WB1B 3ER0A 3Q22A 1ZYRD 2N49A 5LMNW 2F4VL 5FO8B 1IBKL 1RKNA 2Q2TA 2IL8A 4DR5L 3HFZB 1VQJA 5E4WC 4PNYA 2VB2X 2EYHA 1NSNS 1UE5A 2PPBC 2UXCQ 1AFPA 3C1FA 1G51A 1EFID 1NMFA 3BJUA 4YWLA 4DV6L 4LAAA 4I7AA 3I4LA 1M1KC 3QIAA 1O78A 1HR0L 1AH9A 3URYA 2EZVA 1E2VA 4FF3A 5AFWA 3S16B 4KKSA 3SGIA 3KJOA 4YHHQ 1LACA 1MIUA 3A55A 4UP7A 5M3MB 5IWAQ 4KN7C 4C3HB 3J7A5 2EJFC 3VYTA 3OMCA 1N33L 2EY2A 5FO7B 2PMZE 4Y7NH 1E0BA 4A76A 4MZ9A 1XYIA 4HJ5A 2F0OA 4HIOA 1HJPA 4ZQ3A 4QQBX 1WTOA 4A3JB 1HA6A 3CPFA 5IYBG 3K58A 2N88A 1I3QH 2WAQE 4MTKA 1KRSA 4NXNQ 3D8GA 3KLSA 1NR4A 5BR8L 4FXGC 4BWGB 3J81j 3ERSX 4IALA 2E5LL 1MSGA 1YI2A 1LT5D 1HUMA 2F52A 1YIJA 3EBEA 2JA6H 1QE6A 1HZAA 2B2WC 1U4LA 2G9HD 2FHTA 4JV5L 4IUUA 3A8IE 1Y8PB 5M5WH 2OTLA 4PMCA 1M8AA 4JI0Q 4QIWE 5FK9C 1EY0A 3J80c 1KTKA 4DV3Q 2M2LA 1DYQA 1YHQA 4RCNA 1VQEA 2NZHA 3K5MA 4JI7L 2K5NA 3BS1A 4Y7NB 3PUYA 1EY7A 4HCEA 4M8AA 1TY2A 2CFMA 3TSSA 2UUCL 2IPKD 4IQZA 1JJGA 5EQ0A 1LYLA 1JT8A 4DR4Q 5M3FG 1I3QB 3I72A 2DNEA 3H6MA 1LTGD 3SDZA 1VQLA 2X6LA 4V0BA 1HTLD 5F2DA 4DV0Q 4X64Q 1WJJA 1CTMA 5IT9L 5IP7G 4K5VA 2KHJA 2RHQB 2IHFA 3VA7A 1UE1A 2I07B 5C0XH 1C8CA 3GD7A 1B1ZA 1NBWA 4XDXA 3CXCA 4BY7G 4LF9Q 4FO2A 1QOHA 4IJHA 2KHIA 2XNAC 3SXHA 3C2PA 1TS4A 4XQQA 1F9QA 5C0XJ 2X6GA 1K8OA 5GAHC 3TZUA 5M5WB 3RNUA 3TDQA 2C5CA 3GTGH 2F3WA 2PQEA 4FP5D 3FDTA 4E6IA 1S5ED 1LTTD 1M90C 5TSSA 4FNFA 1V9PA 4UHVA 3W1GA 1NJIC 2RCNA 1Y1VH 1DOMA 3QR8A 3M7NA 2M00A 4K2LA 1HXYD 4H13C 3E9IA 4KD4A 1A0IA 3W5OA 1KDBA 3MXPA 3K57A 1VS0A 4B3TQ 2EOTA 3DWQA 2EYMA 2R7DA 1XWEA 3U4ZA 3G6JB 4MIUA 4R4OA 2CH4A 1X32A 1BQQT 3I4NG 2PZTA 1HZCA 1XMQQ 1W2BA 4FF2A 4B3SL 3S15H 3K80C 1KLUD 5IGBA 1H9KA 4JI3L 5C0XI 3EVQA 4KHPQ 1WD0A 3K0XA 1WTQA 1WD1A 5C4ZA 3CC2A 1XX8A 1Q7YC 3BVZA 4O2DA 2PI2A 3C46A 2LMCB 3K81C 4LF7L 2CVRA 4X66Q 1A63A 2F0NA 1JMCA 2RA4A 3GTLH 4DK0A
chains in the Genus database with same CATH topology
5C0XG 1A62A 3RLOA 1X9NA 3M4QA 5M5XH 1NMGA 3HKZE 4L5RC 3HOUH 1YVCA 2A19A 4PZ6A 4JI5Q 2F3IA 2KENA 3I4OA 4ALPA 5FJ8H 4JOIA 2VL6A 1VQ9A 5E7NA 2ATWA 1MJCA 1KXLA 4YHHL 4BBRH 4A3GG 4L5QA 3PV0A 3CW2C 5IWAL 4LF5Q 1K9MC 1L1OC 1AE3A 1A8VA 1VQGA 1IBLQ 3I4MG 3UDFA 4HJ8A 1X3EA 4IO9A 4HIDA 1EWIA 1OTCA 3L0OA 4OWXB 4JBMA 3TREA 2R7ZH 5C4JH 3KJPA 1N8RC 5LMNQ 1XMOQ 1KD1C 4DUZQ 1RIPA 4MNOA 3GTPH 3CF5A 3L2PA 3T1YQ 5HGQA 3ULLA 3AEVA 3TS2A 2QA4A 4DR6L 1WOCA 3HOXG 1Y1VG 4LUOA 4GLXA 2WAQG 3S1QH 1OXTA 1VQOA 1K8AC 3J7ZC 4PG3A 4JBWA 1SROA 4DR3Q 3M3YH 4GLAC 2VS1A 3I55A 1C7YA 2ES2A 2JA5H 5IYDG 1X54A 4NXNL 4DR1L 4A93H 4LW1A 3GTMH 1Q8KA 2JQOA 2R7FA 1TWGH 1L1OB 1O7IA 4JBJA 2F4VQ 5C3EH 1VQ8A 1Q12A 1D8LA 2MNAA 1IBKQ 1VQBA 1YJNA 1TWFH 4RMFA 4DR5Q 3LGJA 2JEBI 5FLXc 3PO2H 4LF6L 2BA1A 1HZ9A 4LFAL 3U58A 3OYYA 1Y1WH 1HNWL 1YHAA 2Q2HA 2ZTCA 4YCWA 3F2CA 1SFOH 1I94Q 1UEBA 5FLMH 3L7ZC 1OXXK 5LMUL 2YTVA 2Y0SG 4LNQA 2HQLA 2Q2UA 1LTLA 3I2ZA 3HOVG 3MEFA 3RLNA 4APVA 4A3MG 2JA7H 2WB1E 4DR2L 4IFDJ 4DV6Q 1VQ4A 2A1AA 3ZJYC 3KF6A 2B63H 5IP9H 4HJAA 1HR0Q 3D31A 2E2JH 1C0AA 1IL2A 4JI2Q 1IZ6A 4JI0L 2OQ0A 3NEMA 3IRBA 4YY3Q 1FVIA 5IYBH 4K0KL 4DV3L 1S3OA 2GVBA 4UPAA 4BY1H 4JI1Q 5C44G 3FKIG 2WP8J 1SR3A 1VQ7A 2VQEL 4GN3B 1K83H 2ZTDA 4L5TA 1YJWA 4DUYL 1XPUA 1IBML 3PGZA 4PZ7A 4DK6C 4JYAL 1N33Q 4DAYB 3KOJA 3HOUG 3UDXA 4LF8L 2JA6G 4Y52H 2WFWA 2NVTH 4A3CH 4GOPA 2Z0SA 3JAMc 4BBRG 1OXSC 2MO0A 1X3GA 4QL5A 3HOZH 1WI5A 2OQKA 2NN6I 4UP8A 4A3KH 4GKKQ 3HOYH 2R93H 4A75A 1NY4A 3M85A 1CKMA 1HZBA 4JI4L 2JA8H 3A74A 4DR4L 2I0QA 2NVQH 3PO3H 1YITA 2N8NA 1E24A 3CC7A 2R6GA 1X65A 1U0LA 2I5LX 2JA9A 2BH2A 5GAGC 2IX1A 1B8AA 2K14A 5BR8Q 4A3BH 4DV4L 2VW9A 1HNZL 1MKHA 3TQYA 1JE5A 3EIVA 5IYCH 2C35B 2XTIA 4X64L 4DV0L 2ALYB 3GDEA 4IFDI 4LF4L 2NN6G 1SRUA 1X55A 1GKHA 3K7UC 5C4XH 3G71A 3OW2A 1Q46A 2JA5G 3OTOQ 3S14H 1PH9A 1KRTA 4A93G 1XTDA 2N3SA 4KHZA 3GTKH 1P8LA 3J81c 1VQNA 3S1MH 4GOPC 1HNXL 4P72A 1FJGL 2V1CC 5C3EG 4JV5Q 4A3IG 4IJLA 1L1OA 3KLWA 4DV7Q 3T1HQ 1K0RA 3DLLA 2IHEA 3PO2G 4BXXH 2UUBQ 1E1TA 4IFDG 3M4OH 4BBSH 1Y1WG 4P74A 3F2BA 5M3FH 4GKJL 1VQKA 4GS3A 5FLMG 3NENA 2E2IH 1YJ9A 1XJVA 1PH2A 1VQIA 3AFQA 1XNQL 4A3DH 4HIMA 4DR7L 2A8VA 3E0EA 2JA7G 2H5XA 1CSQA 3CC4A 4JI7Q 3S1NH 1Q82C 4X6AH 1E1OA 2B63G 1YBYA 2E8GA 1B7YB 4PZ8A 4XIGS 5GROA 5IP9G 3H3VH 4OO1I 4JBKA 4C3IH 1PH4A 5GADC 1E22A 5JEAJ 5IP7H 4WJ3M 1D7QA 4GOPB 4BY1G 4R4CA 2NVXH 4B3RL 3S24A 4IPDA 1N32L 1GM5A 1BVSA 2LXJA 2K5VA 4B3TL 4B3ML 1TWAH 2KBNA 3WWVA 4AYBE 2UUCQ 1GD7A 1YHBA 1CKNB 1X6OA 1SN8A 3K8AA 4YWKA 4R4IA 1JB7A 2AMCB 4LFBQ 2VNUD 4OO1G 3EN2A 3H0GH 4JI6Q 4LFAQ 2BH8A 1VQFA 1JJ2A 2YV5A 3S2HH 1VQMA 2AHOB 4DV1Q 1XMQL 4A3CG 3GO5A 2CKZB 4JC0A 1CUKA 3RZOH 2VY3A 4NPSA 3HOZG 4A3KG 3HOYG 2QEXA 1PH6A 3KFUA 1J5EQ 3CP0A 2JA8G 3MXNB 4DAMA 4KHPL 4X62Q 2YTYA 3PO3G 3ULJA 1UWVA 4DPGA 3PUZA 5AJ3Q 2K5HA 3UDIA 2MFIA 3G6EA 4OWWB 4NXML 4A3BG 2AWNA 1C9OA 2PI2E 4R4QA 3PF5A 4OX9L 2YTXA 5IYCG 4X66L 4X65L 2VQFL 3A5ZB 1N36Q 4EQ5A 2UXBL 5C4XG 2CQOA 2RF4A 3HKZG 4KLKA 2UU9L 4LWCA 2ID0A 2QGQA 5EAYA 3CCUA 2ZM6Q 2K50A 5J3BA 2K4KA 1EUJA 3CPWA 1LM0A 4JI5L 4A3FH 4HJ7A 2R92G 3S16H 4POGA 2OCEA 3DM3A 1BKBA 2ZJRA 3H3VI 3NELA 1PFSA 1L0WA 4HJ9A 2JE6I 1Q1BA 4AH6A 1Q81C 1PH3A 5M3MH 1OXVA 1G291 4J15A 2HHHQ 4LF5L 4C3HH 4BBSG 3CAMA 1KQSA 1IBLL 2IX0A 4OXPA 4JI8Q 1S40A 4GNXA 2HT1A 1B70B 1S72A 4YCUA 3CCQA 1CSPA 5LMNL 1XMOL 4DUZL 5JEAG 4WJ4A 3M4PA 4QGUA 3T1YL 1XNRQ 4A3DG 2L15A 3E9HA 1N34Q 3A5UA 1SLJA 1NTGA 3FHWA 1I5FA 2UXDQ 1G6PA 2I5HA 1PV4A 1EQQA 4A3JH 1MJEA 3Q8DA 3S1RH 4DR3L 3BU2A 3CCSA 2RHSB 3CCLA 4DV5Q 5FJ8G 4DV2Q 1DGSA 3RZDH 4B3SQ 5JJLA 1SE8A 1VCIA 1YEZA 3F1ZA 4LFCQ 5H1SE 3ER0A 2N49A 1EOVA 4IOAA 5LMNW 1JJCB 4JI3Q 2F4VL 4OWTB 4AQYQ 1XPRA 5JJIA 2R7ZG 1IBKL 4A3EH 2Q2TA 3CCEA 2UUAQ 1X56A 3FP9A 1CKNA 2HIVA 3H0GG 4DR5L 4GNXC 3HFZB 4A3GH 1VQJA 3TS0A 5IE8A 1V43A 1KHIA 1K3RA 3W1BA 1UE5A 2UXCQ 2WB1G 4LF7Q 1I94L 3D0FA 4R4TA 2LXKA 1Y14B 1G51A 1NMFA 1KIXA 1E3PA 2VZAA 3HOWH 3BJUA 1X3FA 2B3GA 1Z47A 4YWLA 1E7ZA 4DV6L 1PH5A 1NE3A 4HIKA 1M1KC 1QVGA 4DKAC 3AYHB 1HR0L 1AH9A 1FGUA 4JI2L 2VUMH 4YY3L 1YNXA 4POFA 4LF9L 3GTOH 4KI0A 5IYDH 4L5SA 4JI1L 3K7AH 3PSIA 3SGIA 3KJOA 3KYHC 3BZCA 4YHHQ 4IPCA 1K73C 5K36G 1MIUA 1GO3E 2GVAA 4UP7A 5IWAQ 3BZKA 4GNXB 2FXQA 2KCTA 4YWMA 3J7A5 1TWHH 2D62A 1VQAA 4O0AA 2D0OA 4P75A 3RLFA 1QZGA 1N33L 2PMZE 4Y7NH 4A3FG 2Z6KA 4A76A 3TEHB 4MZ9A 4EX5A 3S17H 2CWPA 1HR0W 4DR6Q 3F8TA 2MQHA 4ME3A 4HJ5A 1EIYB 4HIOA 5M3MG 1K8GA 3KDFA 1HJPA 4QQBX 4GKKL 3G48A 3CPFA 5IYBG 3G4SA 1VQHA 1I3QH 2WAQE 1KRSA 1PYSB 4DR1Q 4NXNQ 4BY7H 1CKOA 5BR8L 1XPOA 3U4VA 3JAMi 2OTJA 2NZOA 1I50H 4C3JH 3AFPA 4A3JG 1VQDA 3J81j 3ERSX 3ULPA 2E5LL 4LF6Q 3UE1A 3OTOL 1HNWQ 4RG1A 2N78A 1YI2A 2XGTA 3U50C 5LMUQ 2F52A 2Z6KC 4YCVA 1YIJA 2R93G 3EBEA 2LSSA 1PH7A 4TVAB 2JA6H 1EIFA 1HZAA 2HIXA 4DR2Q 5M5YH 4JV5L 4DK3C 4A3EG 1I6HH 4UP9A 3RR5A 4DV7L 3T1HL 2Y0SE 5M5WH 2OTLA 3CCVA 4QY7A 2UUBL 1V1QA 4JI0Q 4QIWE 1KAWA 4GN4B 3STBC 3J80c 4C2MH 2JEAI 4DV3Q 3I7FA 4K0KQ 2ZJQA 4JCVE 3RN2A 4P71A 2VQEQ 1YHQA 2AWOA 3J81i 1OXUA 1VQEA 4DUYQ 3HOWG 1PA6A 3STBD 1WFQA 1IBMQ 2NZHA 4JI7L 1L2FA 4IPGA 1YZ6A 2E2HH 3GTQH 4JYAQ 1H95A 4PMWA 4BA1I 2YU9H 4IPHA 2VUMG 1N9WA 4LF8Q 3I4NH 3CCRA 2K5NA 3PIOA 4AYBG 2B29A 5GAEC 3PUYA 2JK8A 1BBWA 3KDFB 1PH8A 4AIMA 3PIPA 1QVFA 4JOIC 1IXRA 2CFMA 3JC66 4BXXG 2JJQA 2DUDA 3ICEA 1AE2A 2UUCL 5GQOA 1JJGA 1LYLA 4OONA 4A3IH 4JI4Q 1JT8A 4DR4Q 5M3FG 2BA0A 4LFBL 4A3LG 1QUQA 2IT1A 4UY8C 1WCMH 1VQLA 4JI6L 4TQUS 4DV1L 4DV4Q 1HNZQ 3PUWA 1U5KA 1R9TH 1EQRA 4DV0Q 4X64Q 1EFWA 1WJJA 4LF4Q 2Q2IA 5IP7G 2K75A 1J5EL 1TWCH 4A3LH 2KHJA 1HH2P 2RHQB 1Q1EA 2YYZA 2IHFA 1UE1A 1WYDA 4X62L 3GD7A 3GTJH 1GVPA 1NBWA 2PQAA 5AJ3L 1VQCA 3CXCA 4BY7G 3KF8B 2EQSA 1HNXQ 2I5MX 4LF9Q 4R1JA 2K52A 4IOCA 3I56A 1FJGQ 1QVCA 4IJHA 2KHIA 3AQQA 2CCZA 2ASBA 2IY5B 2KCMA 5C0XJ 2ZTEA 2GN5A 1N36L 1SMXA 4GLVB 5GAHC 3PUVA 4GN5A 3RNUA 4XTCS 3M9BA 3VDYA 1J6QA 3GTGH 3I4MH 4BA2I 4JG2A 3CD6A 4GKJQ 2ZM6L 5DLQE 2EIFA 1M90C 1XNQQ 4DR7Q 3J80i 1V9PA 3W1GA 1UE7A 1NJIC 2RCNA 1PYBA 3NBHB 4FDBA 1UE6A 1VQ6A 3PF4A 3HOXH 4QJFA 1Y1VH 3PUXA 2NVYH 3M7NA 1T9HA 1P16A 5JJKA 2HHHL 3CCJA 3UDGA 3B6YA 4JI8L 3HKSA 3E9IA 4LUVA 4B3RQ 1Z9FA 2AKWB 1A0IA 3W5OA 1PHJA 1N32Q 1KC8C 1VS0A 4B3TQ 4B3MQ 2ZJPA 3F2DA 2R7DA 1XNRL 4MTNA 3U4ZA 4A4IA 3S2DH 1N34L 1QUQB 2UXDL 4R4OA 2CWAA 1IYJB 5ELOA 2E5LQ 3I4NG 3RN5A 1QZHA 2MO1A 4DNIA 1HZCA 5IT9c 1PH1A 3TRZA 4P73A 4DV5L 1XMQQ 1W2BA 4DV2L 4H02A 1BBUA 1EYGA 4B3SL 3S15H 3K80C 1FL0A 2EXDA 4LFCL 3CCMA 1W3SA 2OWOA 2R92H 2PNHA 3KF6B 4JI3L 5C0XI 4A3MH 4AQYL 3HOVH 4KHPQ 2PQAB 3A0JA 3K0XA 1RL2A 3CMEA 1WCMG 1VQ5A 2UUAL 5ELNA 2DGYA 3CC2A 1Q7YC 5HY6A 3PCOB 3CQZH 4O2DA 4LUZA 2PI2A 5IY0A 4NXMQ 1Q86C 3H15A 4OX9Q 3K81C 5C44H 4LF7L 2UXCL 1TXYA 3FKIH 4X65Q 3UE0A 2D0PA 4X66Q 2VQFQ 1JMCA 3CMAA 2UXBQ 1KL9A 1A63A 4NB3A 1ASYA 2UU9Q 1ASZA 3GTLH 1VQPA 1PVOA 1LUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X G;  1A62 A;  3RLO A;  1X9N A;  3M4Q A;  5M5X H;  1NMG A;  3HKZ E;  4L5R C;  3HOU H;  1YVC A;  2A19 A;  4PZ6 A;  4JI5 Q;  2F3I A;  2KEN A;  3I4O A;  4ALP A;  5FJ8 H;  4JOI A;  2VL6 A;  1VQ9 A;  5E7N A;  2ATW A;  1MJC A;  1KXL A;  4YHH L;  4BBR H;  4A3G G;  4L5Q A;  3PV0 A;  3CW2 C;  5IWA L;  4LF5 Q;  1K9M C;  1L1O C;  1AE3 A;  1A8V A;  1VQG A;  1IBL Q;  3I4M G;  3UDF A;  4HJ8 A;  1X3E A;  4IO9 A;  4HID A;  1EWI A;  1OTC A;  3L0O A;  4OWX B;  4JBM A;  3TRE A;  2R7Z H;  5C4J H;  3KJP A;  1N8R C;  5LMN Q;  1XMO Q;  1KD1 C;  4DUZ Q;  1RIP A;  4MNO A;  3GTP H;  3CF5 A;  3L2P A;  3T1Y Q;  5HGQ A;  3ULL A;  3AEV A;  3TS2 A;  2QA4 A;  4DR6 L;  1WOC A;  3HOX G;  1Y1V G;  4LUO A;  4GLX A;  2WAQ G;  3S1Q H;  1OXT A;  1VQO A;  1K8A C;  3J7Z C;  4PG3 A;  4JBW A;  1SRO A;  4DR3 Q;  3M3Y H;  4GLA C;  2VS1 A;  3I55 A;  1C7Y A;  2ES2 A;  2JA5 H;  5IYD G;  1X54 A;  4NXN L;  4DR1 L;  4A93 H;  4LW1 A;  3GTM H;  1Q8K A;  2JQO A;  2R7F A;  1TWG H;  1L1O B;  1O7I A;  4JBJ A;  2F4V Q;  5C3E H;  1VQ8 A;  1Q12 A;  1D8L A;  2MNA A;  1IBK Q;  1VQB A;  1YJN A;  1TWF H;  4RMF A;  4DR5 Q;  3LGJ A;  2JEB I;  5FLX c;  3PO2 H;  4LF6 L;  2BA1 A;  1HZ9 A;  4LFA L;  3U58 A;  3OYY A;  1Y1W H;  1HNW L;  1YHA A;  2Q2H A;  2ZTC A;  4YCW A;  3F2C A;  1SFO H;  1I94 Q;  1UEB A;  5FLM H;  3L7Z C;  1OXX K;  5LMU L;  2YTV A;  2Y0S G;  4LNQ A;  2HQL A;  2Q2U A;  1LTL A;  3I2Z A;  3HOV G;  3MEF A;  3RLN A;  4APV A;  4A3M G;  2JA7 H;  2WB1 E;  4DR2 L;  4IFD J;  4DV6 Q;  1VQ4 A;  2A1A A;  3ZJY C;  3KF6 A;  2B63 H;  5IP9 H;  4HJA A;  1HR0 Q;  3D31 A;  2E2J H;  1C0A A;  1IL2 A;  4JI2 Q;  1IZ6 A;  4JI0 L;  2OQ0 A;  3NEM A;  3IRB A;  4YY3 Q;  1FVI A;  5IYB H;  4K0K L;  4DV3 L;  1S3O A;  2GVB A;  4UPA A;  4BY1 H;  4JI1 Q;  5C44 G;  3FKI G;  2WP8 J;  1SR3 A;  1VQ7 A;  2VQE L;  4GN3 B;  1K83 H;  2ZTD A;  4L5T A;  1YJW A;  4DUY L;  1XPU A;  1IBM L;  3PGZ A;  4PZ7 A;  4DK6 C;  4JYA L;  1N33 Q;  4DAY B;  3KOJ A;  3HOU G;  3UDX A;  4LF8 L;  2JA6 G;  4Y52 H;  2WFW A;  2NVT H;  4A3C H;  4GOP A;  2Z0S A;  3JAM c;  4BBR G;  1OXS C;  2MO0 A;  1X3G A;  4QL5 A;  3HOZ H;  1WI5 A;  2OQK A;  2NN6 I;  4UP8 A;  4A3K H;  4GKK Q;  3HOY H;  2R93 H;  4A75 A;  1NY4 A;  3M85 A;  1CKM A;  1HZB A;  4JI4 L;  2JA8 H;  3A74 A;  4DR4 L;  2I0Q A;  2NVQ H;  3PO3 H;  1YIT A;  2N8N A;  1E24 A;  3CC7 A;  2R6G A;  1X65 A;  1U0L A;  2I5L X;  2JA9 A;  2BH2 A;  5GAG C;  2IX1 A;  1B8A A;  2K14 A;  5BR8 Q;  4A3B H;  4DV4 L;  2VW9 A;  1HNZ L;  1MKH A;  3TQY A;  1JE5 A;  3EIV A;  5IYC H;  2C35 B;  2XTI A;  4X64 L;  4DV0 L;  2ALY B;  3GDE A;  4IFD I;  4LF4 L;  2NN6 G;  1SRU A;  1X55 A;  1GKH A;  3K7U C;  5C4X H;  3G71 A;  3OW2 A;  1Q46 A;  2JA5 G;  3OTO Q;  3S14 H;  1PH9 A;  1KRT A;  4A93 G;  1XTD A;  2N3S A;  4KHZ A;  3GTK H;  1P8L A;  3J81 c;  1VQN A;  3S1M H;  4GOP C;  1HNX L;  4P72 A;  1FJG L;  2V1C C;  5C3E G;  4JV5 Q;  4A3I G;  4IJL A;  1L1O A;  3KLW A;  4DV7 Q;  3T1H Q;  1K0R A;  3DLL A;  2IHE A;  3PO2 G;  4BXX H;  2UUB Q;  1E1T A;  4IFD G;  3M4O H;  4BBS H;  1Y1W G;  4P74 A;  3F2B A;  5M3F H;  4GKJ L;  1VQK A;  4GS3 A;  5FLM G;  3NEN A;  2E2I H;  1YJ9 A;  1XJV A;  1PH2 A;  1VQI A;  3AFQ A;  1XNQ L;  4A3D H;  4HIM A;  4DR7 L;  2A8V A;  3E0E A;  2JA7 G;  2H5X A;  1CSQ A;  3CC4 A;  4JI7 Q;  3S1N H;  1Q82 C;  4X6A H;  1E1O A;  2B63 G;  1YBY A;  2E8G A;  1B7Y B;  4PZ8 A;  4XIG S;  5GRO A;  5IP9 G;  3H3V H;  4OO1 I;  4JBK A;  4C3I H;  1PH4 A;  5GAD C;  1E22 A;  5JEA J;  5IP7 H;  4WJ3 M;  1D7Q A;  4GOP B;  4BY1 G;  4R4C A;  2NVX H;  4B3R L;  3S24 A;  4IPD A;  1N32 L;  1GM5 A;  1BVS A;  2LXJ A;  2K5V A;  4B3T L;  4B3M L;  1TWA H;  2KBN A;  3WWV A;  4AYB E;  2UUC Q;  1GD7 A;  1YHB A;  1CKN B;  1X6O A;  1SN8 A;  3K8A A;  4YWK A;  4R4I A;  1JB7 A;  2AMC B;  4LFB Q;  2VNU D;  4OO1 G;  3EN2 A;  3H0G H;  4JI6 Q;  4LFA Q;  2BH8 A;  1VQF A;  1JJ2 A;  2YV5 A;  3S2H H;  1VQM A;  2AHO B;  4DV1 Q;  1XMQ L;  4A3C G;  3GO5 A;  2CKZ B;  4JC0 A;  1CUK A;  3RZO H;  2VY3 A;  4NPS A;  3HOZ G;  4A3K G;  3HOY G;  2QEX A;  1PH6 A;  3KFU A;  1J5E Q;  3CP0 A;  2JA8 G;  3MXN B;  4DAM A;  4KHP L;  4X62 Q;  2YTY A;  3PO3 G;  3ULJ A;  1UWV A;  4DPG A;  3PUZ A;  5AJ3 Q;  2K5H A;  3UDI A;  2MFI A;  3G6E A;  4OWW B;  4NXM L;  4A3B G;  2AWN A;  1C9O A;  2PI2 E;  4R4Q A;  3PF5 A;  4OX9 L;  2YTX A;  5IYC G;  4X66 L;  4X65 L;  2VQF L;  3A5Z B;  1N36 Q;  4EQ5 A;  2UXB L;  5C4X G;  2CQO A;  2RF4 A;  3HKZ G;  4KLK A;  2UU9 L;  4LWC A;  2ID0 A;  2QGQ A;  5EAY A;  3CCU A;  2ZM6 Q;  2K50 A;  5J3B A;  2K4K A;  1EUJ A;  3CPW A;  1LM0 A;  4JI5 L;  4A3F H;  4HJ7 A;  2R92 G;  3S16 H;  4POG A;  2OCE A;  3DM3 A;  1BKB A;  2ZJR A;  3H3V I;  3NEL A;  1PFS A;  1L0W A;  4HJ9 A;  2JE6 I;  1Q1B A;  4AH6 A;  1Q81 C;  1PH3 A;  5M3M H;  1OXV A;  1G29 1;  4J15 A;  2HHH Q;  4LF5 L;  4C3H H;  4BBS G;  3CAM A;  1KQS A;  1IBL L;  2IX0 A;  4OXP A;  4JI8 Q;  1S40 A;  4GNX A;  2HT1 A;  1B70 B;  1S72 A;  4YCU A;  3CCQ A;  1CSP A;  5LMN L;  1XMO L;  4DUZ L;  5JEA G;  4WJ4 A;  3M4P A;  4QGU A;  3T1Y L;  1XNR Q;  4A3D G;  2L15 A;  3E9H A;  1N34 Q;  3A5U A;  1SLJ A;  1NTG A;  3FHW A;  1I5F A;  2UXD Q;  1G6P A;  2I5H A;  1PV4 A;  1EQQ A;  4A3J H;  1MJE A;  3Q8D A;  3S1R H;  4DR3 L;  3BU2 A;  3CCS A;  2RHS B;  3CCL A;  4DV5 Q;  5FJ8 G;  4DV2 Q;  1DGS A;  3RZD H;  4B3S Q;  5JJL A;  1SE8 A;  1VCI A;  1YEZ A;  3F1Z A;  4LFC Q;  5H1S E;  3ER0 A;  2N49 A;  1EOV A;  4IOA A;  5LMN W;  1JJC B;  4JI3 Q;  2F4V L;  4OWT B;  4AQY Q;  1XPR A;  5JJI A;  2R7Z G;  1IBK L;  4A3E H;  2Q2T A;  3CCE A;  2UUA Q;  1X56 A;  3FP9 A;  1CKN A;  2HIV A;  3H0G G;  4DR5 L;  4GNX C;  3HFZ B;  4A3G H;  1VQJ A;  3TS0 A;  5IE8 A;  1V43 A;  1KHI A;  1K3R A;  3W1B A;  1UE5 A;  2UXC Q;  2WB1 G;  4LF7 Q;  1I94 L;  3D0F A;  4R4T A;  2LXK A;  1Y14 B;  1G51 A;  1NMF A;  1KIX A;  1E3P A;  2VZA A;  3HOW H;  3BJU A;  1X3F A;  2B3G A;  1Z47 A;  4YWL A;  1E7Z A;  4DV6 L;  1PH5 A;  1NE3 A;  4HIK A;  1M1K C;  1QVG A;  4DKA C;  3AYH B;  1HR0 L;  1AH9 A;  1FGU A;  4JI2 L;  2VUM H;  4YY3 L;  1YNX A;  4POF A;  4LF9 L;  3GTO H;  4KI0 A;  5IYD H;  4L5S A;  4JI1 L;  3K7A H;  3PSI A;  3SGI A;  3KJO A;  3KYH C;  3BZC A;  4YHH Q;  4IPC A;  1K73 C;  5K36 G;  1MIU A;  1GO3 E;  2GVA A;  4UP7 A;  5IWA Q;  3BZK A;  4GNX B;  2FXQ A;  2KCT A;  4YWM A;  3J7A 5;  1TWH H;  2D62 A;  1VQA A;  4O0A A;  2D0O A;  4P75 A;  3RLF A;  1QZG A;  1N33 L;  2PMZ E;  4Y7N H;  4A3F G;  2Z6K A;  4A76 A;  3TEH B;  4MZ9 A;  4EX5 A;  3S17 H;  2CWP A;  1HR0 W;  4DR6 Q;  3F8T A;  2MQH A;  4ME3 A;  4HJ5 A;  1EIY B;  4HIO A;  5M3M G;  1K8G A;  3KDF A;  1HJP A;  4QQB X;  4GKK L;  3G48 A;  3CPF A;  5IYB G;  3G4S A;  1VQH A;  1I3Q H;  2WAQ E;  1KRS A;  1PYS B;  4DR1 Q;  4NXN Q;  4BY7 H;  1CKO A;  5BR8 L;  1XPO A;  3U4V A;  3JAM i;  2OTJ A;  2NZO A;  1I50 H;  4C3J H;  3AFP A;  4A3J G;  1VQD A;  3J81 j;  3ERS X;  3ULP A;  2E5L L;  4LF6 Q;  3UE1 A;  3OTO L;  1HNW Q;  4RG1 A;  2N78 A;  1YI2 A;  2XGT A;  3U50 C;  5LMU Q;  2F52 A;  2Z6K C;  4YCV A;  1YIJ A;  2R93 G;  3EBE A;  2LSS A;  1PH7 A;  4TVA B;  2JA6 H;  1EIF A;  1HZA A;  2HIX A;  4DR2 Q;  5M5Y H;  4JV5 L;  4DK3 C;  4A3E G;  1I6H H;  4UP9 A;  3RR5 A;  4DV7 L;  3T1H L;  2Y0S E;  5M5W H;  2OTL A;  3CCV A;  4QY7 A;  2UUB L;  1V1Q A;  4JI0 Q;  4QIW E;  1KAW A;  4GN4 B;  3STB C;  3J80 c;  4C2M H;  2JEA I;  4DV3 Q;  3I7F A;  4K0K Q;  2ZJQ A;  4JCV E;  3RN2 A;  4P71 A;  2VQE Q;  1YHQ A;  2AWO A;  3J81 i;  1OXU A;  1VQE A;  4DUY Q;  3HOW G;  1PA6 A;  3STB D;  1WFQ A;  1IBM Q;  2NZH A;  4JI7 L;  1L2F A;  4IPG A;  1YZ6 A;  2E2H H;  3GTQ H;  4JYA Q;  1H95 A;  4PMW A;  4BA1 I;  2YU9 H;  4IPH A;  2VUM G;  1N9W A;  4LF8 Q;  3I4N H;  3CCR A;  2K5N A;  3PIO A;  4AYB G;  2B29 A;  5GAE C;  3PUY A;  2JK8 A;  1BBW A;  3KDF B;  1PH8 A;  4AIM A;  3PIP A;  1QVF A;  4JOI C;  1IXR A;  2CFM A;  3JC6 6;  4BXX G;  2JJQ A;  2DUD A;  3ICE A;  1AE2 A;  2UUC L;  5GQO A;  1JJG A;  1LYL A;  4OON A;  4A3I H;  4JI4 Q;  1JT8 A;  4DR4 Q;  5M3F G;  2BA0 A;  4LFB L;  4A3L G;  1QUQ A;  2IT1 A;  4UY8 C;  1WCM H;  1VQL A;  4JI6 L;  4TQU S;  4DV1 L;  4DV4 Q;  1HNZ Q;  3PUW A;  1U5K A;  1R9T H;  1EQR A;  4DV0 Q;  4X64 Q;  1EFW A;  1WJJ A;  4LF4 Q;  2Q2I A;  5IP7 G;  2K75 A;  1J5E L;  1TWC H;  4A3L H;  2KHJ A;  1HH2 P;  2RHQ B;  1Q1E A;  2YYZ A;  2IHF A;  1UE1 A;  1WYD A;  4X62 L;  3GD7 A;  3GTJ H;  1GVP A;  1NBW A;  2PQA A;  5AJ3 L;  1VQC A;  3CXC A;  4BY7 G;  3KF8 B;  2EQS A;  1HNX Q;  2I5M X;  4LF9 Q;  4R1J A;  2K52 A;  4IOC A;  3I56 A;  1FJG Q;  1QVC A;  4IJH A;  2KHI A;  3AQQ A;  2CCZ A;  2ASB A;  2IY5 B;  2KCM A;  5C0X J;  2ZTE A;  2GN5 A;  1N36 L;  1SMX A;  4GLV B;  5GAH C;  3PUV A;  4GN5 A;  3RNU A;  4XTC S;  3M9B A;  3VDY A;  1J6Q A;  3GTG H;  3I4M H;  4BA2 I;  4JG2 A;  3CD6 A;  4GKJ Q;  2ZM6 L;  5DLQ E;  2EIF A;  1M90 C;  1XNQ Q;  4DR7 Q;  3J80 i;  1V9P A;  3W1G A;  1UE7 A;  1NJI C;  2RCN A;  1PYB A;  3NBH B;  4FDB A;  1UE6 A;  1VQ6 A;  3PF4 A;  3HOX H;  4QJF A;  1Y1V H;  3PUX A;  2NVY H;  3M7N A;  1T9H A;  1P16 A;  5JJK A;  2HHH L;  3CCJ A;  3UDG A;  3B6Y A;  4JI8 L;  3HKS A;  3E9I A;  4LUV A;  4B3R Q;  1Z9F A;  2AKW B;  1A0I A;  3W5O A;  1PHJ A;  1N32 Q;  1KC8 C;  1VS0 A;  4B3T Q;  4B3M Q;  2ZJP A;  3F2D A;  2R7D A;  1XNR L;  4MTN A;  3U4Z A;  4A4I A;  3S2D H;  1N34 L;  1QUQ B;  2UXD L;  4R4O A;  2CWA A;  1IYJ B;  5ELO A;  2E5L Q;  3I4N G;  3RN5 A;  1QZH A;  2MO1 A;  4DNI A;  1HZC A;  5IT9 c;  1PH1 A;  3TRZ A;  4P73 A;  4DV5 L;  1XMQ Q;  1W2B A;  4DV2 L;  4H02 A;  1BBU A;  1EYG A;  4B3S L;  3S15 H;  3K80 C;  1FL0 A;  2EXD A;  4LFC L;  3CCM A;  1W3S A;  2OWO A;  2R92 H;  2PNH A;  3KF6 B;  4JI3 L;  5C0X I;  4A3M H;  4AQY L;  3HOV H;  4KHP Q;  2PQA B;  3A0J A;  3K0X A;  1RL2 A;  3CME A;  1WCM G;  1VQ5 A;  2UUA L;  5ELN A;  2DGY A;  3CC2 A;  1Q7Y C;  5HY6 A;  3PCO B;  3CQZ H;  4O2D A;  4LUZ A;  2PI2 A;  5IY0 A;  4NXM Q;  1Q86 C;  3H15 A;  4OX9 Q;  3K81 C;  5C44 H;  4LF7 L;  2UXC L;  1TXY A;  3FKI H;  4X65 Q;  3UE0 A;  2D0P A;  4X66 Q;  2VQF Q;  1JMC A;  3CMA A;  2UXB Q;  1KL9 A;  1A63 A;  4NB3 A;  1ASY A;  2UU9 Q;  1ASZ A;  3GTL H;  1VQP A;  1PVO A;  1LUZ A; 
#chains in the Genus database with same CATH topology
 3GTG B;  2PMZ B;  1X9N A;  2KED A;  2XRQ D;  3VYU A;  5M5X H;  1NMG A;  3H09 A;  4IUQ A;  2RCF A;  1Y1V B;  4L5Q A;  5ELD A;  2WAQ B;  1LAB A;  1K9M C;  1AE3 A;  1VQG A;  2RDH A;  4S3S A;  2QEJ C;  3VR5 A;  1IBL Q;  1G8Z D;  1RCV D;  1TKW B;  3WOE A;  3L0O A;  1OTC A;  4JBM A;  1VDZ A;  1XMO Q;  1KD1 C;  2IX3 A;  3DM1 A;  5HGQ A;  4EQN A;  1AN8 A;  1LTS D;  3MTS A;  4K8J A;  4DR6 L;  3HOX G;  3S1Q H;  2X69 A;  2NTS A;  3HP3 A;  3J7Z C;  4DR3 Q;  5IGC A;  2EY6 A;  1C7Y A;  3MAQ A;  1PLF A;  3GTM H;  3S15 B;  2JQO A;  5LHY 1;  2BDO A;  4CDC C;  1O7I A;  4JBJ A;  2F4V Q;  1D8L A;  4QIW B;  1IBK Q;  1VQB A;  4G57 A;  3K5L A;  2OEO A;  3SVM A;  4DR5 Q;  2R61 A;  5FLX c;  1B2T A;  1PFM A;  1YHA A;  4YCW A;  2DY8 A;  1SFO H;  3FPU B;  3OPO A;  3IFT A;  1WVL A;  4I7Z C;  2BE5 D;  3GP7 A;  3MEF A;  4APV A;  4A3M G;  2JA7 H;  3GTL B;  4DR2 L;  1EY8 A;  1TR5 A;  4DV6 Q;  3KF6 A;  1C0A A;  5M5X B;  1HR0 Q;  1IL2 A;  2FJ2 A;  3IRB A;  1FVI A;  4BY1 H;  2GVB A;  3K5N A;  5C44 G;  4KHV A;  1PTO H;  3F2U A;  4RCO A;  3AU7 A;  4KTA A;  2SNS A;  4L5T A;  4G7H C;  2NUC A;  1LTB D;  4C2M B;  4JYA L;  3KLR A;  1N33 Q;  3HOU G;  5JPM C;  3NSW A;  1ESF A;  3BDO A;  4LF8 L;  2ICE C;  2JA6 G;  2F0I A;  4Y52 H;  2WFW A;  4A3C H;  4BBR G;  3HOZ H;  3S1Q B;  2R93 H;  3S9W A;  3BDL A;  4A75 A;  3X3M A;  2RDF A;  3CKI B;  2PZU A;  1F2Z A;  1X65 A;  2JA9 A;  2K5Q A;  5BR8 Q;  2R3Z A;  1MKH A;  3TQY A;  1PTO C;  1JE5 A;  4ZK9 B;  2EJM A;  3GDE A;  4LF4 L;  2NN6 G;  1SRU A;  1X55 A;  1GKH A;  4UDU C;  1W6K A;  2JA5 G;  3S14 H;  1O7Z A;  4RHR A;  1PTO D;  4KHZ A;  5DM7 3;  1SFO B;  3J81 c;  3PMF A;  4QUF A;  4P72 A;  2QW7 A;  5C3E G;  4JV5 Q;  5DM6 3;  4IJL A;  2JA7 B;  2IHE A;  1Q90 A;  4BY1 B;  1MBY A;  1YJ9 A;  1XJV A;  1PTO B;  2KA7 A;  1VQI A;  3AFQ A;  4KY7 A;  4NKL A;  1XNQ L;  2O5I C;  2A8V A;  1AW7 A;  5IIF A;  4JI7 Q;  1E1O A;  1T5E A;  2E8G A;  1D7Q A;  5GAD C;  4K5W A;  1CFM A;  4IPD A;  4XT1 B;  1BVS A;  1QG7 A;  5IGD A;  4PV1 C;  4B3M L;  4QCL A;  3HOZ B;  5IGG A;  3WWV A;  2UUC Q;  1GD7 A;  4JK1 C;  1HFG A;  3Q6S A;  3K8A A;  3VR6 A;  5HUR A;  1X3Q A;  1IYV A;  1F77 A;  2VB3 X;  2KCC A;  1TT2 A;  1JJ2 A;  1VQM A;  4I65 A;  3QG1 A;  2EYF A;  3R2T A;  3RZO H;  2KEE A;  4A3K G;  1CK1 A;  2F4I A;  3S14 B;  3PO3 G;  1PRT F;  3VR3 A;  1PZK D;  4L63 B;  3RMH A;  3UDI A;  1IL8 A;  2AWN A;  1EY4 A;  4OX9 L;  2YTX A;  2F0H A;  2VQF L;  4X65 L;  1A6X A;  2RF4 A;  4KJN A;  2K32 A;  1U9R A;  2K4K A;  1A3V A;  3EFX D;  2ICI A;  4F8M A;  4POG A;  1PMR A;  1BKB A;  2ZJR A;  3NEL A;  1Q81 C;  1OXV A;  4K2K A;  1EYC A;  1XXG A;  4LF5 L;  1KQS A;  3EA6 A;  4CGY B;  2IX0 A;  1L0X B;  2K1B A;  4R8I A;  3CCQ A;  3FVQ A;  1CSP A;  4DUZ L;  5JEA G;  3V96 A;  3M4P A;  3T1Y L;  4HAE A;  1E2W A;  4A3D G;  1H9J A;  1SLJ A;  5D3I B;  1ET6 A;  4RH6 A;  3WOF A;  3Q8D A;  3S1R H;  3NE5 B;  3BU2 A;  2RHS B;  3NQI A;  3H91 A;  1FGB D;  3H94 A;  4B3S Q;  1STB A;  1F9S A;  1SE8 A;  1EYD A;  3RZO B;  1KDA A;  4JI3 Q;  1ENA A;  2KJX A;  5CV6 A;  4A3G H;  1CKN A;  3QB3 A;  1RTN A;  5IE8 A;  4OHJ A;  4LF7 Q;  2FMC A;  4R4T A;  2LXK A;  5DEH A;  1Y14 B;  1GOZ A;  1TWF B;  1S5C D;  1MHW C;  2B3G A;  1PH5 A;  4IUR A;  4HIK A;  1QVG A;  1FGU A;  4B08 A;  2BDN A;  4LF9 L;  1SNQ A;  5CV7 A;  1NR2 A;  1EZ8 A;  4DF7 A;  5IYD H;  3K7A H;  3PSI A;  3KYH C;  2JN4 A;  2XSC A;  4IPC A;  3T51 B;  1SNP A;  1UNS A;  2KCT A;  1TWH H;  1TII D;  1TS3 A;  4P75 A;  1QZG A;  3DUZ A;  3R93 A;  2Z6K A;  3S17 H;  1JCK B;  3OWF A;  4DR6 Q;  2MQH A;  1EIY B;  2NZ1 D;  4QUC A;  3G48 A;  5ELB A;  1VQH A;  5C4H A;  2NWG A;  4FF4 A;  5K5P A;  3GV3 A;  4BY7 H;  3KBG A;  3HG9 A;  1V8Q A;  4NW2 A;  1HTP A;  2A69 C;  2NZO A;  4OGQ C;  3AFP A;  4WFN 3;  1K8M A;  3DXJ C;  5KGU A;  1IW7 C;  3T53 B;  1DM0 B;  2A74 C;  4RG1 A;  1JOK A;  2N78 A;  4F88 A;  2F0W A;  2XGT A;  2A69 D;  3U50 C;  2Z6K C;  4HN7 A;  2R93 G;  1HQM C;  2LSS A;  4L8J A;  1A3U A;  3J80 E;  1IW7 D;  2HIX A;  5T1I A;  2F0K A;  1SJE D;  5J22 A;  4DR2 Q;  4DK3 C;  4UP9 A;  2SNM A;  1S5B D;  3T1H L;  2E75 C;  4QY7 A;  2UUB L;  1V1Q A;  1ICF B;  3I73 A;  4U68 A;  2A6E C;  3I7F A;  2ZJQ A;  4JCV E;  4OIK A;  5LL6 S;  2O2L D;  3K7A B;  2AWO A;  5E3F A;  1OXU A;  1PZI D;  2G5D A;  2MJ8 A;  5D3D A;  5I9O A;  1PA6 A;  1WFQ A;  4LK1 C;  2A6E D;  1L2F A;  1TWH B;  4IPG A;  4JYA Q;  2K01 A;  4PMW A;  4BA1 I;  2YU9 H;  3SE0 A;  1N9W A;  4LF8 Q;  3I4N H;  4AYB G;  2B29 A;  3MVV A;  2BCO A;  3JAM L;  1PH8 A;  3S17 B;  4ABN A;  3JC6 6;  2JJQ A;  2D9U A;  1JOQ A;  4H44 C;  5GQO A;  4OON A;  4A3I H;  1K3B C;  4Q0F A;  3MXG A;  4UY8 C;  3SK5 A;  4ME5 A;  4XQJ A;  4RKL A;  4BY7 B;  3NUC A;  4TQU S;  1IYU A;  3A7L A;  5DNF A;  5EKK A;  5COY A;  2K04 A;  4LF4 Q;  3HEJ A;  2D2C C;  1E2Z A;  1SYB A;  1LO5 D;  2K28 A;  2PQA A;  1VQC A;  1WTR A;  5A2Q E;  4IOC A;  2A6H C;  2E76 C;  2GN5 A;  1SMX A;  3P7J A;  3QOJ A;  3M9B A;  4BA2 I;  5M9O A;  5FO9 B;  4ZAI A;  4CBV A;  5FKA C;  3KK7 A;  5CYU A;  2Z4I A;  1XNQ Q;  3J80 i;  1LLR D;  3PF4 A;  3NBH B;  3HOX H;  1MGS A;  1K0S A;  2Z8L A;  2F0E A;  1P16 A;  1X3P A;  3Q23 A;  1D5Z C;  5I4D A;  3I4N B;  1Z9F A;  1JOO A;  4J8Q A;  1SYC A;  1KC8 C;  4B3M Q;  1JWM D;  3F2D A;  1B3A A;  4MTN A;  2UXD L;  3MFY A;  5ELO A;  1SBB B;  3TRZ A;  2MO1 A;  5IT9 c;  2LFN A;  2J7Z A;  1A2T A;  1BBU A;  1SYD A;  4DV2 L;  1JOR A;  4RGT A;  3ND9 A;  2EXD A;  1STG A;  1NUC A;  2B2W A;  3OWE B;  3CCM A;  2OWO A;  1A15 A;  1V1O A;  1Q8I A;  2SOB A;  4HSP A;  2PNH A;  4A3M H;  4J1M A;  2PQA B;  3A0J A;  2EXZ A;  1RL2 A;  3MHB A;  3RZD B;  2UUA L;  3PCO B;  3D4W A;  4LUZ A;  3R8B A;  4BS9 A;  3U9S A;  3H15 A;  4OX9 Q;  5C44 H;  1I6H H;  2VQF Q;  4X65 Q;  2D0P A;  1Y69 U;  1KL9 A;  1EY5 A;  1PVO A;  1VQP A;  1D1I A;  1KAA A;  1PYW D;  1CHP D;  2F0F A;  4PQX A;  1A2U A;  3CHB D;  3D6C A;  2Q8R E;  2HUG A;  1HPC A;  3HOU H;  1YVC A;  2F3I A;  5FJ8 H;  2VL6 A;  4DXG A;  1VQ9 A;  3HOX B;  4BBR H;  4A3G G;  3PV0 A;  4LF5 Q;  1LTA D;  2K5D A;  3I4M G;  1A8V A;  2LS0 1;  2R7Z H;  5C4J H;  1N8R C;  4DUZ Q;  1RIP A;  4MNO A;  3T1Y Q;  1LT4 D;  3AEV A;  3TS2 A;  2Z9H A;  2QA4 A;  2ZXO A;  3OOC A;  1WOC A;  3BDC A;  4G7Z C;  1OXT A;  2SEB D;  3DHQ A;  4MN3 A;  4DXF A;  4L6T B;  2NN6 H;  4GLA C;  2JA5 H;  5IYD G;  1X54 A;  4LW1 A;  3A8K E;  2R7F A;  5FLX E;  1I4Q A;  3MWY W;  1RDP D;  3TP6 A;  4IZ8 A;  3NPP A;  5C3E H;  3VR4 A;  2MNA A;  4A3M B;  4RAU C;  1A3T A;  1YJN A;  3X3N A;  4JPB W;  4B9X A;  4LF6 L;  4DAP A;  1QWY A;  3E6Z X;  1T5X D;  3U9O A;  3U58 A;  5ELF A;  5EJW A;  5CBA E;  2ZTC A;  5CV4 A;  1K28 A;  2B2Y A;  4K8I A;  5LMU L;  3L7Z C;  1F9R A;  5C44 B;  1GUG A;  3RLN A;  1FR3 A;  1BXT A;  3DWA A;  2E2J H;  2OXP A;  3HOU B;  2OQ0 A;  1PRT C;  3NEM A;  5IOD A;  3RUZ A;  2JA6 B;  4N9T A;  1SR3 A;  2VQE L;  1FYC A;  4ZKC B;  4GN3 B;  4BBR B;  1K83 H;  1YJW A;  1PRT D;  2F0D A;  1XPU A;  5I2Y A;  1IBM L;  3V05 A;  1I4R A;  4DK6 C;  1II3 A;  3BYY B;  4WJW A;  3KOJ A;  5C4J B;  1CT1 D;  4O42 A;  2B2Y C;  5T1G A;  4GOP A;  1C4Q A;  1SEB D;  1UEA B;  2AQ2 B;  4QL5 A;  4KY5 A;  2OQK A;  2NN6 I;  4A3K H;  1B9M A;  1PRT B;  4JI4 L;  2JA5 B;  2I0Q A;  3PO3 H;  1JC7 A;  1EU3 A;  1VMP A;  1CM9 A;  2DJG C;  2N8N A;  1YIT A;  3CC7 A;  2BH2 A;  1ICW A;  1B8A A;  1ILQ A;  1U4M A;  4DV4 L;  5C3E B;  4LJZ C;  4CKB A;  3OW2 A;  3FPP A;  1Q46 A;  3DEP A;  4MHE A;  4A93 G;  1SE4 A;  1J9O A;  1Z7T A;  2N3S A;  3MXN A;  3GTK H;  1P8L A;  3S1M H;  1PFN A;  4GOP C;  3AMU A;  1RTO A;  5J1Z A;  1FJG L;  2V1C C;  4A3I G;  3TP7 A;  1AZP A;  3T1H Q;  1K0R A;  3PO2 G;  2UUB Q;  2E2J B;  1JB3 A;  3J80 L;  3E3X A;  4KMU C;  5EBD A;  4P74 A;  5C6A A;  4GKJ L;  1ENC A;  4GS3 A;  5JEA H;  4A3D H;  4HIM A;  1B4O A;  1K83 B;  1SE2 A;  2H5X A;  3S1N H;  4X6A H;  2RDG A;  2Z4H A;  2B63 G;  1YBY A;  4FXD A;  4XIG S;  4JBK A;  5JEA J;  3MFG A;  2MPM A;  4DGZ A;  4GOP B;  4R4C A;  4B3R L;  3VYS A;  1ENF A;  4KKT A;  4H0L C;  2HDM A;  1TWA H;  4NDX A;  4AYB E;  1SMY C;  3HZX A;  4ZCK A;  4A3K B;  4O1N A;  4UAI A;  2XWB B;  2XWJ B;  4YWK A;  2VNU D;  4R4I A;  3PO3 B;  1SMY D;  3S2H H;  2AHO B;  3GO5 A;  1RHP A;  2OT2 A;  5KEE A;  1SE3 A;  2VY3 A;  4NPS A;  1MSH A;  3HOY G;  5A35 A;  3MXN B;  5CV5 A;  4DAM A;  2YTY A;  4DPG A;  2MFI A;  3S1M B;  3I3C A;  3MA2 B;  4NXM L;  1EQT A;  2WKC A;  2XVS A;  5ELE A;  5IYC G;  2UXB L;  4DFA A;  3A5Z B;  1YNJ C;  1RJT A;  5A2Q L;  2UU9 L;  4LWC A;  2ZXP A;  2MHV A;  3OIQ A;  3OW7 A;  4XYQ A;  4KK7 A;  2K50 A;  5J3B A;  1LM0 A;  1YNJ D;  1BO0 A;  4A3D B;  3K5O A;  1L0W A;  3S1N B;  3MZ5 A;  4GZY C;  1JWU D;  4FYD A;  2F0U A;  1G29 1;  4BBS G;  4F87 A;  4GNX A;  1S72 A;  5LMN L;  4RFB A;  1SNM A;  1TWA B;  2L15 A;  2WV6 D;  3FRP B;  3E9H A;  3JAM E;  1I5F A;  2UXD Q;  1G6P A;  1PV4 A;  4P2C B;  1V1P A;  5FJ8 G;  1CA6 A;  4DV2 Q;  4HSV A;  3F1Z A;  5H1S E;  3N6R A;  1SNO A;  1EY6 A;  4OWT B;  1XPR A;  1IKL A;  2R7Z G;  2UUA Q;  1X56 A;  2PCF B;  4GNX C;  3GTM B;  1CZW A;  1K3R A;  3D0F A;  1I4P A;  2L1B A;  5CBE E;  3WDN A;  1ROD A;  1KIX A;  1X3F A;  1CA5 A;  1Z47 A;  1CQV A;  1E7Z A;  3P20 A;  2JXM B;  4DKA C;  2HQE A;  4JI2 L;  1FD7 D;  3NXW A;  4YY3 L;  3GTO H;  4KI0 A;  3L9A X;  3SHL A;  4L5S A;  1WTV A;  3BYT B;  1VF5 C;  2V4D A;  3BZC A;  5K36 G;  3NBI A;  1HQR D;  1DOL A;  3BZK A;  4GNX B;  2FXQ A;  1NAP A;  2D62 A;  2KVM A;  1SND A;  1W6J A;  4O0A A;  2L11 A;  2EY1 A;  3RLF A;  4A3F G;  1AEX A;  4EX5 A;  2IWH A;  2CWP A;  1HR0 W;  3P1H A;  4N8X 1;  1K8G A;  3KDF A;  1V1P B;  1S5F D;  2FMM A;  3T4A C;  4KKU A;  1PYS B;  1L0Y B;  2VXW A;  2TSS A;  1HCZ A;  2R93 B;  1CKO A;  1XPO A;  3U4V A;  1J8I A;  3JAM i;  4F7X A;  2OTJ A;  1I50 H;  5FLX L;  3ULP A;  2RQX A;  4LF6 Q;  3UE1 A;  4RWS C;  5LMU Q;  1TVX A;  1PH7 A;  4DNT B;  1B9N A;  4A3E G;  4XQN A;  3STB C;  4DK1 A;  1KLG D;  3GTO B;  4AYB B;  1BOS A;  2VQE Q;  4HMJ A;  5I9P A;  1GHK A;  2B2V A;  1HRJ A;  3HOW G;  1OO9 B;  3STB D;  1IBM Q;  1YZ6 A;  3DWP A;  4FVM A;  4FXK C;  2E2H H;  1H95 A;  1KAB A;  2VUM G;  1F2Y A;  3P75 A;  1S5D D;  1SSO A;  2JK8 A;  1BBW A;  3KDF B;  4JOI C;  4N9P A;  1QB5 D;  4JI4 Q;  3C3L A;  1STH A;  2DY7 A;  2BA0 A;  4LFB L;  2PZW A;  1QUQ A;  5EKL A;  1U4R A;  3IL8 A;  4JI6 L;  4DV1 L;  4DV4 Q;  1H9R A;  3PUW A;  1U5K A;  2B2V C;  1R9T H;  1D2B A;  1I50 B;  1EFW A;  3J7A V;  2EYL A;  2Q2I A;  2K75 A;  3D6W A;  1J5E L;  1Q1E A;  4ZUJ A;  4X62 L;  3GTJ H;  1GVP A;  5AJ3 L;  4QB4 A;  4OL7 A;  2I5M X;  2K52 A;  1FJG Q;  1O7L A;  3I56 A;  1AP0 A;  1QVC A;  5ELC A;  3AQQ A;  2CCZ A;  2IY5 B;  2KCM A;  1EIG A;  4C3J G;  4Q5V A;  1RF2 D;  1N36 L;  4GLV B;  3VDY A;  3I4M H;  3BZD B;  1BNZ A;  4K6D A;  4GKJ Q;  1QJO A;  2NB0 A;  1WTX A;  3QO2 A;  4IUP A;  1EEI D;  1JQY D;  4CJ1 B;  1UE6 A;  4QJF A;  1BCP F;  4RGN A;  1TS2 A;  2E2H B;  2NVY H;  1T9H A;  2HHH L;  5I2X A;  1GXD C;  3CCJ A;  3B6Y A;  3UDG A;  3HKS A;  4B3R Q;  2AKW B;  1PHJ A;  2AQ1 B;  1R4Q B;  1BF4 A;  2ZJP A;  4A4I A;  3S2D H;  1AZQ A;  1N34 L;  1QUQ B;  2CWA A;  3TZD A;  3RN5 A;  3M4Y A;  3T13 A;  1PH1 A;  5I6Y A;  4P73 A;  1DD2 A;  4H02 A;  1FL0 A;  4NP5 A;  4QF4 A;  2CHB D;  3J7Y W;  1W3S A;  2R92 H;  3S1R B;  4AQY L;  1ZKO A;  4IUT A;  3QOL A;  1H9M A;  2LY7 A;  1VQ5 A;  1WCM G;  5ELN A;  2DGY A;  2MP1 A;  1KDC A;  5HY6 A;  5HGT A;  2B2U A;  3CQZ H;  4NXM Q;  2C9O A;  3DMU A;  4KJO A;  1B53 A;  1Q86 C;  1NCV A;  1QNK A;  1TXY A;  2UXB Q;  3CMA A;  2F0M A;  3UI2 A;  5KRU A;  2UU9 Q;  1ASZ A;  4A3L G;  4A3G B;  3I4M B;  3RLO A;  3D3R A;  4YIJ A;  3V2T A;  3A8J E;  2K05 A;  1EY9 A;  5I6W A;  4L5R C;  1G2S A;  2A19 A;  1CHQ D;  2KEN A;  3I4O A;  4TKO B;  4ALP A;  4HR7 B;  3QJY A;  5KNC A;  3CRK C;  2ATW A;  1GHJ A;  2NVY B;  1L1O C;  2PYK A;  4TSS A;  3UDF A;  4EQO A;  4IO9 A;  2PW7 A;  4HID A;  3KJP A;  3EJI A;  5LMN Q;  3GTP H;  2B2U C;  3CF5 A;  4U67 3;  4DAY A;  3ULL A;  5COR A;  2Q8T A;  1DXM A;  3S2D B;  4GLX A;  2CW0 C;  3NBH A;  1VQO A;  1IHZ A;  3LWE A;  1SRO A;  3NQT A;  2EPB A;  5EPK A;  3C1E A;  2VS1 A;  2F0V A;  3I55 A;  4HCS A;  2RKS A;  3GV6 A;  4DR1 L;  2WKD A;  4A93 H;  5BN5 A;  1LT6 D;  1L1O B;  3LNN A;  3TN2 A;  4KY6 A;  2F0G A;  2J4X A;  4RMF A;  3LGJ A;  3PO2 H;  1HZ9 A;  3Q24 A;  1HNW L;  3CQZ B;  2Q2H A;  3F2C A;  5JVG 3;  1OXX K;  2YTV A;  2Y0S G;  4LNQ A;  2Q2U A;  3TP8 A;  1LTI D;  1LTL A;  3I2Z A;  3HOV G;  3I8Z A;  2A1A A;  2B63 H;  1ET9 A;  2RBM A;  4XYO A;  4CJ2 C;  3SR1 A;  4JI2 Q;  1WTW A;  4YY3 Q;  4K0K L;  1C48 A;  1S3O A;  1NNX A;  3FKI G;  2F0S A;  2WP8 J;  3ITP A;  1VQ7 A;  4RA8 A;  4ZLT F;  1TQO A;  2QDL A;  4DUY L;  1JWS D;  2A6H D;  3PGZ A;  2GA4 B;  4PZ7 A;  2F03 A;  4DAY B;  1U4P A;  1SYF A;  3GTP B;  1ZYR C;  3NTK A;  2K5W A;  3IKJ A;  2G9D A;  2DN8 A;  2K03 A;  1X3G A;  1WI5 A;  4UP8 A;  3HOY H;  4DAV A;  1H9S A;  2YU9 B;  3M85 A;  2EJG C;  2EYP A;  2NVQ H;  1ILP A;  1E24 A;  4A93 B;  2Z1C A;  1U0L A;  4ZRZ A;  2IX1 A;  1BR9 A;  5CV9 A;  2VW9 A;  1HNZ L;  4A3I B;  3EIV A;  5IYC H;  2C35 B;  2XTI A;  3N52 A;  1EU4 A;  3G71 A;  3PO2 B;  1CI3 M;  4EGV A;  1BUV T;  1PH9 A;  1XTD A;  1B50 A;  1DON A;  1VQN A;  1HNX L;  2KOL A;  4C1N K;  4XT3 B;  1Y8N B;  3DLL A;  4X3S A;  1EQV A;  1MI2 A;  2B63 B;  4BXX H;  4IFD G;  2D5D A;  4BBS H;  2DJF C;  1Y1W G;  3NTH A;  3F2B A;  1VQK A;  5FLM G;  3TBI B;  1F2L A;  3ND8 A;  4FF1 A;  4DR7 L;  3E0E A;  2F1M A;  1FNW A;  2CH4 W;  4PZ8 A;  3H3V H;  5GRO A;  5IP9 G;  2EE1 A;  3NWS A;  4DNR B;  3GQB A;  1PH4 A;  1BBX C;  1HUN A;  1N32 L;  1GM5 A;  2J0T D;  2LXJ A;  2K5V A;  1H9S B;  3MC0 B;  2KBN A;  1YHB A;  3HOY B;  3R3O A;  1X6O A;  1SN8 A;  4LFB Q;  4OO1 G;  2NVQ B;  4DU9 A;  1B3Q A;  2E74 C;  1SDF A;  5EBC A;  4NMZ A;  2BH8 A;  4JW0 A;  1VQF A;  4LFA Q;  4JI6 Q;  2YV5 A;  4DV1 Q;  2IW3 A;  2PO4 A;  3PQI A;  1TS5 A;  2XRS D;  2QEX A;  5NUC A;  5JPN C;  1J5E Q;  2JA8 G;  3OSO A;  1QIL A;  1D5M C;  3ZYY X;  4X62 Q;  2AQ3 B;  3TP5 A;  1WTH A;  3H3V C;  3PUZ A;  5AJ3 Q;  3G6E A;  3K59 A;  4KD3 A;  3I90 A;  2B39 A;  3HGB A;  4A3B G;  1ZXT A;  2PI2 E;  3EQL C;  4RKB A;  3PF5 A;  1N36 Q;  5K36 H;  1WTP A;  5C4X G;  2CQO A;  2EY5 A;  3HKZ G;  2F3V A;  2F0J A;  2F0P A;  2ID0 A;  4X3K A;  5IOC A;  4BBS B;  3CCU A;  2JP1 A;  3NK9 A;  4CKE A;  1I6H B;  4JI5 L;  4A3F H;  4HJ7 A;  2R92 G;  3DM3 A;  3FMC A;  3H3V I;  1PFS A;  2QF7 A;  4AH6 A;  4IUN A;  4K5X A;  2HHH Q;  4N8F A;  1SXT A;  4OXP A;  1S40 A;  2HT1 A;  4CDE C;  3OMG A;  3A56 A;  3G7L A;  1N34 Q;  3A54 A;  2I5H A;  1MJE A;  3SK6 A;  1EQQ A;  2R7Z B;  4C3I G;  3CCS A;  5KND A;  1JIC A;  3CCL A;  2NYZ D;  4WOR A;  3W3A A;  1VCI A;  4IOA A;  1EOV A;  1JJC B;  4AQY Q;  5JJI A;  4A3E H;  4ZUI A;  3CCE A;  3FP9 A;  2HIV A;  3H0G G;  3R2I A;  2L12 A;  3TS0 A;  1STY A;  1F9P A;  4KN4 C;  1V43 A;  3T56 B;  1KHI A;  3E0J A;  3W1B A;  2WB1 G;  1I94 L;  1Y8O B;  3J81 E;  1CQF A;  1E3P A;  2VZA A;  4V19 0;  3HOW H;  1GUN A;  1VMC A;  5CV8 A;  1GJX A;  3TME A;  1NE3 A;  1HFN A;  4HMI A;  3AYH B;  3VA5 A;  1ONL A;  2VUM H;  1YNX A;  3CU7 A;  4RHS A;  4POF A;  4A3F B;  5DAU A;  1FNU A;  4JI1 L;  1K73 C;  5KYI A;  5EPJ A;  1GO3 E;  2GVA A;  2PNR C;  3BVM A;  4YWM A;  1VQA A;  2B2T A;  2D0O A;  3K0Y A;  1YNN C;  2QIL A;  3TEH B;  5D65 A;  2RSN A;  3F8T A;  4ME3 A;  5M3M G;  3K6O A;  4C3H G;  4GKK L;  1YNN D;  1BCP C;  4EVO A;  3G4S A;  2KHS A;  4DR1 Q;  1EYA A;  3ERO A;  2AUK A;  5C5L A;  2XN9 C;  1BCP D;  4R8N A;  3KUP A;  5G3L F;  1G6Z A;  1B44 D;  4C3J H;  4A3J G;  1VQD A;  4A3E B;  3IAY A;  4JVZ A;  2MGS A;  5E1F A;  2B2T C;  5KNB A;  3OTO L;  1HNW Q;  5D14 A;  4ZYS A;  2H1E A;  4YCV A;  1STE A;  1EOT A;  4TVA B;  1BCP B;  1EIF A;  2IJ0 A;  3KF8 A;  5M5Y H;  3HOW B;  4IUV A;  3RR5 A;  3IFD A;  4DV7 L;  1JR0 D;  2Y0S E;  2B8F A;  3CCV A;  4LMQ D;  3GTK B;  1KAW A;  4GN4 B;  4C2M H;  2JEA I;  4K0K Q;  2VUM B;  3NHH A;  1SNC A;  4P71 A;  3RN2 A;  2HDL A;  3J81 i;  4DUY Q;  1GUO A;  4ZKB B;  3VR2 A;  2FIN B;  3GTQ H;  1CZG A;  1LTR D;  4IPH A;  3E5S A;  1UUP A;  1RD9 D;  3PIO A;  3CCR A;  5GAE C;  2SDF A;  4AIM A;  3OIP A;  4CKC A;  3PIP A;  1QVF A;  2QCP X;  4B9W A;  4DN4 M;  1IXR A;  1GUT A;  4BXX G;  2DUD A;  3ICE A;  1AE2 A;  4X3T A;  2B8G A;  1STN A;  5JOB A;  2O5J C;  2EYJ A;  5EPL A;  1STA A;  2IT1 A;  1WCM H;  4M1U B;  5ISR A;  4WRD A;  2BE5 C;  3CRL C;  2KCN A;  5IGF A;  5J39 A;  1FNV A;  2H4O A;  1HNZ Q;  1EQR A;  1EL0 A;  4C3J B;  1I6V C;  4A3L H;  1TWC H;  4H7B A;  1HH2 P;  2YYZ A;  3D4D A;  1Q3L A;  1WYD A;  1ZEQ X;  3S2H B;  3KF8 B;  2EQS A;  1HNX Q;  4R1J A;  2RSO A;  2ASB A;  1ESR A;  5M5Y B;  2JSO A;  2ZTE A;  2TMP A;  3HRZ C;  3KBX A;  3PUV A;  4X3U A;  4GN5 A;  4XTC S;  1J6Q A;  4DA2 A;  1LT3 D;  2OF1 A;  4JG2 A;  3CD6 A;  1EEF D;  2F0T A;  3RD4 A;  2ZM6 L;  5DLQ E;  2EIF A;  4DR7 Q;  1G91 A;  1UE7 A;  1VQ6 A;  1PYB A;  2ENB A;  4FDB A;  2A68 C;  2L4N A;  3PUX A;  1DJR D;  5CGK A;  3GTQ B;  1HHV A;  5JJK A;  3NWT A;  2Z6B A;  4JI8 L;  4LUV A;  1DOK A;  4C1N I;  1S4Z A;  1N32 Q;  2A68 D;  1G2T A;  2DNC A;  1XNR L;  2WIN B;  2ZT9 C;  4CJ0 B;  5E4X A;  5EGT A;  1TY0 A;  2E5L Q;  1IYJ B;  1QZH A;  5CC4 A;  1WCM B;  4DNI A;  5CR3 A;  4DV5 L;  1EYG A;  3MEH A;  4LFC L;  3D4R A;  3KF6 B;  3HOV H;  2KUM A;  1TU2 B;  1TWC B;  2HCI A;  1EWC A;  5C3X A;  3CME A;  2K6A A;  2ZXR A;  5IY0 A;  4CDD C;  1R4P B;  2QKI C;  3HS0 C;  2UXC L;  5JAV A;  3FKI H;  3UE0 A;  5EKI A;  1JE4 A;  2WAC A;  2NBF A;  4NB3 A;  1ASY A;  1LUZ A;  5C0X G;  1A62 A;  2QDB A;  3M4Q A;  5FOB B;  3HKZ E;  4PZ6 A;  4JI5 Q;  1HA5 A;  5JJZ A;  2K33 A;  3BG3 A;  3LWU A;  4JOI A;  3SK8 A;  5E7N A;  3KLS X;  1MJC A;  1KXL A;  3LX0 A;  4YHH L;  4ULL A;  3CW2 C;  5IWA L;  1UAP A;  1EWH A;  4HJ8 A;  1X3E A;  1EWI A;  4OWX B;  3TRE A;  3L2P A;  2L55 A;  1SAP A;  1Y1V G;  4LUO A;  2L5T A;  2WAQ G;  1I4G A;  1K8A C;  4PG3 A;  4JBW A;  3M3Y H;  2EYO A;  3AB9 A;  2ES2 A;  1O80 A;  4NXN L;  5LL6 X;  1Q8K A;  5C5M A;  1TWG H;  4RGM A;  2Y0S B;  3SK4 A;  4R9W A;  1VQ8 A;  1Q12 A;  2A73 B;  2I46 A;  3HOV B;  1TWF H;  2N55 A;  4QMG A;  5C3W A;  2JEB I;  1SYE A;  3PIO 3;  2BA1 A;  4IFD H;  4LFA L;  3OYY A;  2CQA A;  1Y1W H;  3T16 A;  3PIP 3;  1I94 Q;  1UEB A;  5FLM H;  3FKI B;  1PXU A;  4TRD A;  2HQL A;  4IFD J;  2WB1 E;  1QNU A;  1VQ4 A;  3ZJY C;  3MXU A;  5BN3 A;  5IP9 H;  4HJA A;  3J7A F;  3D31 A;  3J81 L;  2E2D C;  1IZ6 A;  4JI0 L;  5IYB H;  1PDQ A;  2XIW A;  4DV3 L;  4KV6 A;  4OIJ A;  4UPA A;  4JI1 Q;  1SJH D;  2KQ3 A;  2ZTD A;  2PW5 A;  1VF7 A;  3NP8 A;  4RGO S;  1GUS A;  4OO1 H;  1PZJ D;  2BOS A;  3UDX A;  2NVT H;  4HED A;  1BDO A;  2Z0S A;  3JAM c;  1KNE A;  1OXS C;  2MO0 A;  4OEL B;  3Q0A A;  1F2M A;  4GKK Q;  1IKM A;  1NY4 A;  1O7Y A;  3M3Y B;  1CKM A;  1HZB A;  4CHT B;  2JA8 H;  3A74 A;  4DR4 L;  3W2D A;  2O4X A;  2RVL A;  3M7G A;  1XTC D;  2R6G A;  2I5L X;  5IT9 E;  5GAG C;  1TWG B;  2K14 A;  4A3B H;  4DV0 L;  3OHX C;  4X64 L;  2ALY B;  4IFD I;  3I70 A;  5C4X H;  3K7U C;  4ID6 A;  3OTO Q;  1Z6H A;  1KRT A;  1GUW A;  3FEW X;  1Y1W B;  2KEC A;  4G7O C;  1PFB A;  2MUY A;  1R9T B;  2F0L A;  1L1O A;  3KLW A;  4DV7 Q;  1EZ6 A;  2K7V A;  1E1T A;  2Q8I B;  3GTJ B;  3M4O H;  1MD2 D;  1DZ1 A;  5M3F H;  2E2I H;  3NEN A;  4K14 A;  2EVB A;  1PH2 A;  2M9V A;  3NTI A;  2JA7 G;  1CSQ A;  3CC4 A;  1Q82 C;  1I4X A;  5KIX A;  3SEB A;  1B7Y B;  4OO1 I;  4C3I H;  4WJ3 M;  3L3O C;  1E22 A;  5IP7 H;  4BY1 G;  2NVX H;  3S24 A;  2FFK B;  2NVT B;  1EIH A;  4B3T L;  3VYR A;  1CKN B;  2JA8 B;  3ERQ A;  1JB7 A;  2AMC B;  3EN2 A;  3H0G H;  1XMQ L;  4A3C G;  1ML0 D;  4A3B B;  2CKZ B;  4JC0 A;  1CUK A;  3HOZ G;  5CMD A;  1PH6 A;  2L9H A;  3KFU A;  5C4X B;  3CP0 A;  3I91 A;  3HKZ B;  3DEO A;  4KHP L;  5JVH 3;  3BVG A;  3ULJ A;  1UWV A;  2CW0 D;  2K5H A;  4J6H A;  4OWW B;  4Z9C B;  2R92 B;  1C9O A;  2L0C A;  4IN3 A;  4R4Q A;  2A5H A;  4PMB A;  4X66 L;  1D6E C;  4EQ5 A;  1LV9 A;  4KLK A;  5KYL A;  2P5Z X;  2QGQ A;  3M4O B;  5EAY A;  2NTT A;  5IGE A;  2ZM6 Q;  1SYG A;  2F0Q A;  4OEM B;  3CPW A;  1EUJ A;  3QWN A;  4HTH A;  5M3F B;  2E2I B;  4C56 C;  5G3L D;  1D5X C;  2WII B;  3S16 H;  2OCE A;  5BN4 A;  4HJ9 A;  1PH3 A;  2JE6 I;  1Q1B A;  3A7A B;  5M3M H;  1D1K A;  4J15 A;  3ONA B;  4C3H H;  3CAM A;  4C3I B;  1IBL L;  4JI8 Q;  2JYO A;  1B70 B;  4YCU A;  5L37 A;  1QCB D;  2NVX B;  1DCZ A;  4CDF C;  1XMO L;  4WJ4 A;  4QGU A;  1XNR Q;  4XXE A;  1PTO F;  2LKV A;  4ODG A;  3A5U A;  4EQP A;  1NTG A;  3FHW A;  2AUJ D;  2HD3 A;  4A3J H;  2EDG A;  2HCC A;  4DR3 L;  4G4K A;  1KNA A;  3H0G B;  4DV5 Q;  1DGS A;  4ILW A;  3RZD H;  1M4V A;  5JJL A;  1I4H A;  4K6L A;  1YEZ A;  3O13 A;  4LFC Q;  2WB1 B;  3ER0 A;  3Q22 A;  1ZYR D;  2N49 A;  5LMN W;  2F4V L;  5FO8 B;  1IBK L;  1RKN A;  2Q2T A;  2IL8 A;  4DR5 L;  3HFZ B;  1VQJ A;  5E4W C;  4PNY A;  2VB2 X;  2EYH A;  1NSN S;  1UE5 A;  2PPB C;  2UXC Q;  1AFP A;  3C1F A;  1G51 A;  1EFI D;  1NMF A;  3BJU A;  4YWL A;  4DV6 L;  4LAA A;  4I7A A;  3I4L A;  1M1K C;  3QIA A;  1O78 A;  1HR0 L;  1AH9 A;  3URY A;  2EZV A;  1E2V A;  4FF3 A;  5AFW A;  3S16 B;  4KKS A;  3SGI A;  3KJO A;  4YHH Q;  1LAC A;  1MIU A;  3A55 A;  4UP7 A;  5M3M B;  5IWA Q;  4KN7 C;  4C3H B;  3J7A 5;  2EJF C;  3VYT A;  3OMC A;  1N33 L;  2EY2 A;  5FO7 B;  2PMZ E;  4Y7N H;  1E0B A;  4A76 A;  4MZ9 A;  1XYI A;  4HJ5 A;  2F0O A;  4HIO A;  1HJP A;  4ZQ3 A;  4QQB X;  1WTO A;  4A3J B;  1HA6 A;  3CPF A;  5IYB G;  3K58 A;  2N88 A;  1I3Q H;  2WAQ E;  4MTK A;  1KRS A;  4NXN Q;  3D8G A;  3KLS A;  1NR4 A;  5BR8 L;  4FXG C;  4BWG B;  3J81 j;  3ERS X;  4IAL A;  2E5L L;  1MSG A;  1YI2 A;  1LT5 D;  1HUM A;  2F52 A;  1YIJ A;  3EBE A;  2JA6 H;  1QE6 A;  1HZA A;  2B2W C;  1U4L A;  2G9H D;  2FHT A;  4JV5 L;  4IUU A;  3A8I E;  1Y8P B;  5M5W H;  2OTL A;  4PMC A;  1M8A A;  4JI0 Q;  4QIW E;  5FK9 C;  1EY0 A;  3J80 c;  1KTK A;  4DV3 Q;  2M2L A;  1DYQ A;  1YHQ A;  4RCN A;  1VQE A;  2NZH A;  3K5M A;  4JI7 L;  2K5N A;  3BS1 A;  4Y7N B;  3PUY A;  1EY7 A;  4HCE A;  4M8A A;  1TY2 A;  2CFM A;  3TSS A;  2UUC L;  2IPK D;  4IQZ A;  1JJG A;  5EQ0 A;  1LYL A;  1JT8 A;  4DR4 Q;  5M3F G;  1I3Q B;  3I72 A;  2DNE A;  3H6M A;  1LTG D;  3SDZ A;  1VQL A;  2X6L A;  4V0B A;  1HTL D;  5F2D A;  4DV0 Q;  4X64 Q;  1WJJ A;  1CTM A;  5IT9 L;  5IP7 G;  4K5V A;  2KHJ A;  2RHQ B;  2IHF A;  3VA7 A;  1UE1 A;  2I07 B;  5C0X H;  1C8C A;  3GD7 A;  1B1Z A;  1NBW A;  4XDX A;  3CXC A;  4BY7 G;  4LF9 Q;  4FO2 A;  1QOH A;  4IJH A;  2KHI A;  2XNA C;  3SXH A;  3C2P A;  1TS4 A;  4XQQ A;  1F9Q A;  5C0X J;  2X6G A;  1K8O A;  5GAH C;  3TZU A;  5M5W B;  3RNU A;  3TDQ A;  2C5C A;  3GTG H;  2F3W A;  2PQE A;  4FP5 D;  3FDT A;  4E6I A;  1S5E D;  1LTT D;  1M90 C;  5TSS A;  4FNF A;  1V9P A;  4UHV A;  3W1G A;  1NJI C;  2RCN A;  1Y1V H;  1DOM A;  3QR8 A;  3M7N A;  2M00 A;  4K2L A;  1HXY D;  4H13 C;  3E9I A;  4KD4 A;  1A0I A;  3W5O A;  1KDB A;  3MXP A;  3K57 A;  1VS0 A;  4B3T Q;  2EOT A;  3DWQ A;  2EYM A;  2R7D A;  1XWE A;  3U4Z A;  3G6J B;  4MIU A;  4R4O A;  2CH4 A;  1X32 A;  1BQQ T;  3I4N G;  2PZT A;  1HZC A;  1XMQ Q;  1W2B A;  4FF2 A;  4B3S L;  3S15 H;  3K80 C;  1KLU D;  5IGB A;  1H9K A;  4JI3 L;  5C0X I;  3EVQ A;  4KHP Q;  1WD0 A;  3K0X A;  1WTQ A;  1WD1 A;  5C4Z A;  3CC2 A;  1XX8 A;  1Q7Y C;  3BVZ A;  4O2D A;  2PI2 A;  3C46 A;  2LMC B;  3K81 C;  4LF7 L;  2CVR A;  4X66 Q;  1A63 A;  2F0N A;  1JMC A;  2RA4 A;  3GTL H;  4DK0 A; 
#chains in the Genus database with same CATH homology
 5C0X G;  1A62 A;  3RLO A;  1X9N A;  3M4Q A;  5M5X H;  1NMG A;  3HKZ E;  4L5R C;  3HOU H;  1YVC A;  2A19 A;  4PZ6 A;  4JI5 Q;  2F3I A;  2KEN A;  3I4O A;  4ALP A;  5FJ8 H;  4JOI A;  2VL6 A;  1VQ9 A;  5E7N A;  2ATW A;  1MJC A;  1KXL A;  4YHH L;  4BBR H;  4A3G G;  4L5Q A;  3PV0 A;  3CW2 C;  5IWA L;  4LF5 Q;  1K9M C;  1L1O C;  1AE3 A;  1A8V A;  1VQG A;  1IBL Q;  3I4M G;  3UDF A;  4HJ8 A;  1X3E A;  4IO9 A;  4HID A;  1EWI A;  1OTC A;  3L0O A;  4OWX B;  4JBM A;  3TRE A;  2R7Z H;  5C4J H;  3KJP A;  1N8R C;  5LMN Q;  1XMO Q;  1KD1 C;  4DUZ Q;  1RIP A;  4MNO A;  3GTP H;  3CF5 A;  3L2P A;  3T1Y Q;  5HGQ A;  3ULL A;  3AEV A;  3TS2 A;  2QA4 A;  4DR6 L;  1WOC A;  3HOX G;  1Y1V G;  4LUO A;  4GLX A;  2WAQ G;  3S1Q H;  1OXT A;  1VQO A;  1K8A C;  3J7Z C;  4PG3 A;  4JBW A;  1SRO A;  4DR3 Q;  3M3Y H;  4GLA C;  2VS1 A;  3I55 A;  1C7Y A;  2ES2 A;  2JA5 H;  5IYD G;  1X54 A;  4NXN L;  4DR1 L;  4A93 H;  4LW1 A;  3GTM H;  1Q8K A;  2JQO A;  2R7F A;  1TWG H;  1L1O B;  1O7I A;  4JBJ A;  2F4V Q;  5C3E H;  1VQ8 A;  1Q12 A;  1D8L A;  2MNA A;  1IBK Q;  1VQB A;  1YJN A;  1TWF H;  4RMF A;  4DR5 Q;  3LGJ A;  2JEB I;  5FLX c;  3PO2 H;  4LF6 L;  2BA1 A;  1HZ9 A;  4LFA L;  3U58 A;  3OYY A;  1Y1W H;  1HNW L;  1YHA A;  2Q2H A;  2ZTC A;  4YCW A;  3F2C A;  1SFO H;  1I94 Q;  1UEB A;  5FLM H;  3L7Z C;  1OXX K;  5LMU L;  2YTV A;  2Y0S G;  4LNQ A;  2HQL A;  2Q2U A;  1LTL A;  3I2Z A;  3HOV G;  3MEF A;  3RLN A;  4APV A;  4A3M G;  2JA7 H;  2WB1 E;  4DR2 L;  4IFD J;  4DV6 Q;  1VQ4 A;  2A1A A;  3ZJY C;  3KF6 A;  2B63 H;  5IP9 H;  4HJA A;  1HR0 Q;  3D31 A;  2E2J H;  1C0A A;  1IL2 A;  4JI2 Q;  1IZ6 A;  4JI0 L;  2OQ0 A;  3NEM A;  3IRB A;  4YY3 Q;  1FVI A;  5IYB H;  4K0K L;  4DV3 L;  1S3O A;  2GVB A;  4UPA A;  4BY1 H;  4JI1 Q;  5C44 G;  3FKI G;  2WP8 J;  1SR3 A;  1VQ7 A;  2VQE L;  4GN3 B;  1K83 H;  2ZTD A;  4L5T A;  1YJW A;  4DUY L;  1XPU A;  1IBM L;  3PGZ A;  4PZ7 A;  4DK6 C;  4JYA L;  1N33 Q;  4DAY B;  3KOJ A;  3HOU G;  3UDX A;  4LF8 L;  2JA6 G;  4Y52 H;  2WFW A;  2NVT H;  4A3C H;  4GOP A;  2Z0S A;  3JAM c;  4BBR G;  1OXS C;  2MO0 A;  1X3G A;  4QL5 A;  3HOZ H;  1WI5 A;  2OQK A;  2NN6 I;  4UP8 A;  4A3K H;  4GKK Q;  3HOY H;  2R93 H;  4A75 A;  1NY4 A;  3M85 A;  1CKM A;  1HZB A;  4JI4 L;  2JA8 H;  3A74 A;  4DR4 L;  2I0Q A;  2NVQ H;  3PO3 H;  1YIT A;  2N8N A;  1E24 A;  3CC7 A;  2R6G A;  1X65 A;  1U0L A;  2I5L X;  2JA9 A;  2BH2 A;  5GAG C;  2IX1 A;  1B8A A;  2K14 A;  5BR8 Q;  4A3B H;  4DV4 L;  2VW9 A;  1HNZ L;  1MKH A;  3TQY A;  1JE5 A;  3EIV A;  5IYC H;  2C35 B;  2XTI A;  4X64 L;  4DV0 L;  2ALY B;  3GDE A;  4IFD I;  4LF4 L;  2NN6 G;  1SRU A;  1X55 A;  1GKH A;  3K7U C;  5C4X H;  3G71 A;  3OW2 A;  1Q46 A;  2JA5 G;  3OTO Q;  3S14 H;  1PH9 A;  1KRT A;  4A93 G;  1XTD A;  2N3S A;  4KHZ A;  3GTK H;  1P8L A;  3J81 c;  1VQN A;  3S1M H;  4GOP C;  1HNX L;  4P72 A;  1FJG L;  2V1C C;  5C3E G;  4JV5 Q;  4A3I G;  4IJL A;  1L1O A;  3KLW A;  4DV7 Q;  3T1H Q;  1K0R A;  3DLL A;  2IHE A;  3PO2 G;  4BXX H;  2UUB Q;  1E1T A;  4IFD G;  3M4O H;  4BBS H;  1Y1W G;  4P74 A;  3F2B A;  5M3F H;  4GKJ L;  1VQK A;  4GS3 A;  5FLM G;  3NEN A;  2E2I H;  1YJ9 A;  1XJV A;  1PH2 A;  1VQI A;  3AFQ A;  1XNQ L;  4A3D H;  4HIM A;  4DR7 L;  2A8V A;  3E0E A;  2JA7 G;  2H5X A;  1CSQ A;  3CC4 A;  4JI7 Q;  3S1N H;  1Q82 C;  4X6A H;  1E1O A;  2B63 G;  1YBY A;  2E8G A;  1B7Y B;  4PZ8 A;  4XIG S;  5GRO A;  5IP9 G;  3H3V H;  4OO1 I;  4JBK A;  4C3I H;  1PH4 A;  5GAD C;  1E22 A;  5JEA J;  5IP7 H;  4WJ3 M;  1D7Q A;  4GOP B;  4BY1 G;  4R4C A;  2NVX H;  4B3R L;  3S24 A;  4IPD A;  1N32 L;  1GM5 A;  1BVS A;  2LXJ A;  2K5V A;  4B3T L;  4B3M L;  1TWA H;  2KBN A;  3WWV A;  4AYB E;  2UUC Q;  1GD7 A;  1YHB A;  1CKN B;  1X6O A;  1SN8 A;  3K8A A;  4YWK A;  4R4I A;  1JB7 A;  2AMC B;  4LFB Q;  2VNU D;  4OO1 G;  3EN2 A;  3H0G H;  4JI6 Q;  4LFA Q;  2BH8 A;  1VQF A;  1JJ2 A;  2YV5 A;  3S2H H;  1VQM A;  2AHO B;  4DV1 Q;  1XMQ L;  4A3C G;  3GO5 A;  2CKZ B;  4JC0 A;  1CUK A;  3RZO H;  2VY3 A;  4NPS A;  3HOZ G;  4A3K G;  3HOY G;  2QEX A;  1PH6 A;  3KFU A;  1J5E Q;  3CP0 A;  2JA8 G;  3MXN B;  4DAM A;  4KHP L;  4X62 Q;  2YTY A;  3PO3 G;  3ULJ A;  1UWV A;  4DPG A;  3PUZ A;  5AJ3 Q;  2K5H A;  3UDI A;  2MFI A;  3G6E A;  4OWW B;  4NXM L;  4A3B G;  2AWN A;  1C9O A;  2PI2 E;  4R4Q A;  3PF5 A;  4OX9 L;  2YTX A;  5IYC G;  4X66 L;  4X65 L;  2VQF L;  3A5Z B;  1N36 Q;  4EQ5 A;  2UXB L;  5C4X G;  2CQO A;  2RF4 A;  3HKZ G;  4KLK A;  2UU9 L;  4LWC A;  2ID0 A;  2QGQ A;  5EAY A;  3CCU A;  2ZM6 Q;  2K50 A;  5J3B A;  2K4K A;  1EUJ A;  3CPW A;  1LM0 A;  4JI5 L;  4A3F H;  4HJ7 A;  2R92 G;  3S16 H;  4POG A;  2OCE A;  3DM3 A;  1BKB A;  2ZJR A;  3H3V I;  3NEL A;  1PFS A;  1L0W A;  4HJ9 A;  2JE6 I;  1Q1B A;  4AH6 A;  1Q81 C;  1PH3 A;  5M3M H;  1OXV A;  1G29 1;  4J15 A;  2HHH Q;  4LF5 L;  4C3H H;  4BBS G;  3CAM A;  1KQS A;  1IBL L;  2IX0 A;  4OXP A;  4JI8 Q;  1S40 A;  4GNX A;  2HT1 A;  1B70 B;  1S72 A;  4YCU A;  3CCQ A;  1CSP A;  5LMN L;  1XMO L;  4DUZ L;  5JEA G;  4WJ4 A;  3M4P A;  4QGU A;  3T1Y L;  1XNR Q;  4A3D G;  2L15 A;  3E9H A;  1N34 Q;  3A5U A;  1SLJ A;  1NTG A;  3FHW A;  1I5F A;  2UXD Q;  1G6P A;  2I5H A;  1PV4 A;  1EQQ A;  4A3J H;  1MJE A;  3Q8D A;  3S1R H;  4DR3 L;  3BU2 A;  3CCS A;  2RHS B;  3CCL A;  4DV5 Q;  5FJ8 G;  4DV2 Q;  1DGS A;  3RZD H;  4B3S Q;  5JJL A;  1SE8 A;  1VCI A;  1YEZ A;  3F1Z A;  4LFC Q;  5H1S E;  3ER0 A;  2N49 A;  1EOV A;  4IOA A;  5LMN W;  1JJC B;  4JI3 Q;  2F4V L;  4OWT B;  4AQY Q;  1XPR A;  5JJI A;  2R7Z G;  1IBK L;  4A3E H;  2Q2T A;  3CCE A;  2UUA Q;  1X56 A;  3FP9 A;  1CKN A;  2HIV A;  3H0G G;  4DR5 L;  4GNX C;  3HFZ B;  4A3G H;  1VQJ A;  3TS0 A;  5IE8 A;  1V43 A;  1KHI A;  1K3R A;  3W1B A;  1UE5 A;  2UXC Q;  2WB1 G;  4LF7 Q;  1I94 L;  3D0F A;  4R4T A;  2LXK A;  1Y14 B;  1G51 A;  1NMF A;  1KIX A;  1E3P A;  2VZA A;  3HOW H;  3BJU A;  1X3F A;  2B3G A;  1Z47 A;  4YWL A;  1E7Z A;  4DV6 L;  1PH5 A;  1NE3 A;  4HIK A;  1M1K C;  1QVG A;  4DKA C;  3AYH B;  1HR0 L;  1AH9 A;  1FGU A;  4JI2 L;  2VUM H;  4YY3 L;  1YNX A;  4POF A;  4LF9 L;  3GTO H;  4KI0 A;  5IYD H;  4L5S A;  4JI1 L;  3K7A H;  3PSI A;  3SGI A;  3KJO A;  3KYH C;  3BZC A;  4YHH Q;  4IPC A;  1K73 C;  5K36 G;  1MIU A;  1GO3 E;  2GVA A;  4UP7 A;  5IWA Q;  3BZK A;  4GNX B;  2FXQ A;  2KCT A;  4YWM A;  3J7A 5;  1TWH H;  2D62 A;  1VQA A;  4O0A A;  2D0O A;  4P75 A;  3RLF A;  1QZG A;  1N33 L;  2PMZ E;  4Y7N H;  4A3F G;  2Z6K A;  4A76 A;  3TEH B;  4MZ9 A;  4EX5 A;  3S17 H;  2CWP A;  1HR0 W;  4DR6 Q;  3F8T A;  2MQH A;  4ME3 A;  4HJ5 A;  1EIY B;  4HIO A;  5M3M G;  1K8G A;  3KDF A;  1HJP A;  4QQB X;  4GKK L;  3G48 A;  3CPF A;  5IYB G;  3G4S A;  1VQH A;  1I3Q H;  2WAQ E;  1KRS A;  1PYS B;  4DR1 Q;  4NXN Q;  4BY7 H;  1CKO A;  5BR8 L;  1XPO A;  3U4V A;  3JAM i;  2OTJ A;  2NZO A;  1I50 H;  4C3J H;  3AFP A;  4A3J G;  1VQD A;  3J81 j;  3ERS X;  3ULP A;  2E5L L;  4LF6 Q;  3UE1 A;  3OTO L;  1HNW Q;  4RG1 A;  2N78 A;  1YI2 A;  2XGT A;  3U50 C;  5LMU Q;  2F52 A;  2Z6K C;  4YCV A;  1YIJ A;  2R93 G;  3EBE A;  2LSS A;  1PH7 A;  4TVA B;  2JA6 H;  1EIF A;  1HZA A;  2HIX A;  4DR2 Q;  5M5Y H;  4JV5 L;  4DK3 C;  4A3E G;  1I6H H;  4UP9 A;  3RR5 A;  4DV7 L;  3T1H L;  2Y0S E;  5M5W H;  2OTL A;  3CCV A;  4QY7 A;  2UUB L;  1V1Q A;  4JI0 Q;  4QIW E;  1KAW A;  4GN4 B;  3STB C;  3J80 c;  4C2M H;  2JEA I;  4DV3 Q;  3I7F A;  4K0K Q;  2ZJQ A;  4JCV E;  3RN2 A;  4P71 A;  2VQE Q;  1YHQ A;  2AWO A;  3J81 i;  1OXU A;  1VQE A;  4DUY Q;  3HOW G;  1PA6 A;  3STB D;  1WFQ A;  1IBM Q;  2NZH A;  4JI7 L;  1L2F A;  4IPG A;  1YZ6 A;  2E2H H;  3GTQ H;  4JYA Q;  1H95 A;  4PMW A;  4BA1 I;  2YU9 H;  4IPH A;  2VUM G;  1N9W A;  4LF8 Q;  3I4N H;  3CCR A;  2K5N A;  3PIO A;  4AYB G;  2B29 A;  5GAE C;  3PUY A;  2JK8 A;  1BBW A;  3KDF B;  1PH8 A;  4AIM A;  3PIP A;  1QVF A;  4JOI C;  1IXR A;  2CFM A;  3JC6 6;  4BXX G;  2JJQ A;  2DUD A;  3ICE A;  1AE2 A;  2UUC L;  5GQO A;  1JJG A;  1LYL A;  4OON A;  4A3I H;  4JI4 Q;  1JT8 A;  4DR4 Q;  5M3F G;  2BA0 A;  4LFB L;  4A3L G;  1QUQ A;  2IT1 A;  4UY8 C;  1WCM H;  1VQL A;  4JI6 L;  4TQU S;  4DV1 L;  4DV4 Q;  1HNZ Q;  3PUW A;  1U5K A;  1R9T H;  1EQR A;  4DV0 Q;  4X64 Q;  1EFW A;  1WJJ A;  4LF4 Q;  2Q2I A;  5IP7 G;  2K75 A;  1J5E L;  1TWC H;  4A3L H;  2KHJ A;  1HH2 P;  2RHQ B;  1Q1E A;  2YYZ A;  2IHF A;  1UE1 A;  1WYD A;  4X62 L;  3GD7 A;  3GTJ H;  1GVP A;  1NBW A;  2PQA A;  5AJ3 L;  1VQC A;  3CXC A;  4BY7 G;  3KF8 B;  2EQS A;  1HNX Q;  2I5M X;  4LF9 Q;  4R1J A;  2K52 A;  4IOC A;  3I56 A;  1FJG Q;  1QVC A;  4IJH A;  2KHI A;  3AQQ A;  2CCZ A;  2ASB A;  2IY5 B;  2KCM A;  5C0X J;  2ZTE A;  2GN5 A;  1N36 L;  1SMX A;  4GLV B;  5GAH C;  3PUV A;  4GN5 A;  3RNU A;  4XTC S;  3M9B A;  3VDY A;  1J6Q A;  3GTG H;  3I4M H;  4BA2 I;  4JG2 A;  3CD6 A;  4GKJ Q;  2ZM6 L;  5DLQ E;  2EIF A;  1M90 C;  1XNQ Q;  4DR7 Q;  3J80 i;  1V9P A;  3W1G A;  1UE7 A;  1NJI C;  2RCN A;  1PYB A;  3NBH B;  4FDB A;  1UE6 A;  1VQ6 A;  3PF4 A;  3HOX H;  4QJF A;  1Y1V H;  3PUX A;  2NVY H;  3M7N A;  1T9H A;  1P16 A;  5JJK A;  2HHH L;  3CCJ A;  3UDG A;  3B6Y A;  4JI8 L;  3HKS A;  3E9I A;  4LUV A;  4B3R Q;  1Z9F A;  2AKW B;  1A0I A;  3W5O A;  1PHJ A;  1N32 Q;  1KC8 C;  1VS0 A;  4B3T Q;  4B3M Q;  2ZJP A;  3F2D A;  2R7D A;  1XNR L;  4MTN A;  3U4Z A;  4A4I A;  3S2D H;  1N34 L;  1QUQ B;  2UXD L;  4R4O A;  2CWA A;  1IYJ B;  5ELO A;  2E5L Q;  3I4N G;  3RN5 A;  1QZH A;  2MO1 A;  4DNI A;  1HZC A;  5IT9 c;  1PH1 A;  3TRZ A;  4P73 A;  4DV5 L;  1XMQ Q;  1W2B A;  4DV2 L;  4H02 A;  1BBU A;  1EYG A;  4B3S L;  3S15 H;  3K80 C;  1FL0 A;  2EXD A;  4LFC L;  3CCM A;  1W3S A;  2OWO A;  2R92 H;  2PNH A;  3KF6 B;  4JI3 L;  5C0X I;  4A3M H;  4AQY L;  3HOV H;  4KHP Q;  2PQA B;  3A0J A;  3K0X A;  1RL2 A;  3CME A;  1WCM G;  1VQ5 A;  2UUA L;  5ELN A;  2DGY A;  3CC2 A;  1Q7Y C;  5HY6 A;  3PCO B;  3CQZ H;  4O2D A;  4LUZ A;  2PI2 A;  5IY0 A;  4NXM Q;  1Q86 C;  3H15 A;  4OX9 Q;  3K81 C;  5C44 H;  4LF7 L;  2UXC L;  1TXY A;  3FKI H;  4X65 Q;  3UE0 A;  2D0P A;  4X66 Q;  2VQF Q;  1JMC A;  3CMA A;  2UXB Q;  1KL9 A;  1A63 A;  4NB3 A;  1ASY A;  2UU9 Q;  1ASZ A;  3GTL H;  1VQP A;  1PVO A;  1LUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...