2I5MX

Crystal structure of bacillus subtilis cold shock protein cspb variant a46k s48r
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQKVRFEIVEGNRGPQAANVTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Cold shock protein cspB
publication title Optimized variants of the cold shock protein from in vitro selection: structural basis of their high thermostability.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2i5mX00
3CCUA 4GKJQ 4NXNL 2EQSA 4B3ML 2ATWA 1D7QA 4JI0Q 4DR7L 1HNWQ 2R93G 2NN6I 2YTXA 4UP8A 1VQMA 1X3EA 1NMGA 3HOXG 2WAQE 5LMNW 2UUAL 3AYHB 4PZ7A 1UE1A 1Q1EA 4DV6Q 4DNIA 3OW2A 1IBKL 4JI5L 2CQOA 3M4PA 2B63G 1Q8KA 3RNUA 4A3GH 4K0KQ 4HJ7A 1IXRA 3UE1A 3AEVA 3S17H 4C2MH 2N49A 4HIOA 4A3JH 2EIFA 4BY7G 4GKKQ 1D8LA 4R1JA 3CCSA 4KHZA 4BBSG 4OONA 2HHHL 3J7ZC 4J15A 3EIVA 1UEBA 1WCMG 2E2HH 4DR2L 2D0OA 1YHQA 5IY0A 5C0XG 3PGZA 2JA7H 4YHHQ 2ZJPA 2I5LX 5C3EH 3KDFA 4IPDA 4OO1G 4KLKA 1J5EL 4P71A 1A0IA 4JI8L 3CW2C 3CCEA 1ASYA 3HOVG 5E7NA 1N32Q 4DUYQ 4JC0A 4UP7A 2UXDQ 2N78A 4HIDA 4A3KH 2OCEA 2BA1A 4ME3A 3K81C 5C44G 3ICEA 2OTLA 4JOIC 1L1OC 1X54A 4L5QA 1HNZL 4A93H 4LF8Q 4DR4L 1OXXK 1ASZA 2UXBQ 2BH2A 1Y1WH 4QQBX 3S16H 4DV4L 4DV3L 3RN5A 2YU9H 2GN5A 1CKNB 3D31A 3ZJYC 1M1KC 1P16A 1U0LA 4DKAC 3HKSA 4DK6C 5LMUQ 3S1RH 2F52A 2JQOA 4TVAB 1VQ4A 4OX9L 2CCZA 4C3JH 2E2JH 2VUMG 1SRUA 3GTLH 2VQFQ 3PSIA 1G291 3FKIG 2UXCQ 4LFAL 3A74A 2ZM6Q 3H15A 1LYLA 3CC4A 2PI2A 4LFBL 4GN3B 2K5VA 1HNWL 1A63A 1SE8A 3K8AA 3PUWA 3J7A5 4A3LH 3STBD 3STBC 1VQ5A 2JEBI 3RR5A 2R92G 3M3YH 3TS2A 2CWAA 1Q12A 1A8VA 3KJOA 1KIXA 1JJ2A 4LF7L 3IRBA 4A3IG 4RG1A 2AHOB 4JBWA 3S2DH 3I55A 5IYDH 1Z47A 3KF6A 4K0KL 4QIWE 1UE7A 3G4SA 1N36Q 1V43A 3S15H 4A3EH 1Q46A 4GOPC 2UUCL 4GKKL 4DV7Q 2NVYH 3OTOL 5C4XG 1QVCA 1VQCA 1VS0A 3RLFA 3UDIA 4HJ9A 5IT9c 4A4IA 2JA9A 3KJPA 1SMXA 3CCQA 3I4MG 4A3GG 2AMCB 4IFDG 2L15A 5M3FG 1W3SA 1WOCA 1PVOA 3GTMH 4A3JG 4IOCA 1VQHA 3KYHC 1YJ9A 4B3TL 2UUBL 2YYZA 2N3SA 1HZBA 1KHIA 4L5SA 2HIXA 2HT1A 4A93G 1XMOL 3W1GA 1BKBA 3U50C 2EXDA 1Y1VH 4JYAL 1Q86C 4C3HH 4DV5L 2VL6A 1Z9FA 2UXBL 4LF8L 3RZOH 2D62A 5C4JH 2JEAI 1PH5A 2N8NA 4IO9A 3BZCA 1DGSA 4QL5A 4XTCS 4JI2Q 2OQ0A 4A3DG 1QUQB 1TWGH 5LMUL 4DV1Q 4A3MH 2KBNA 2MNAA 1EQQA 3JAMi 4POGA 1YBYA 2PQAA 3LGJA 1PH3A 2K14A 1PYSB 3K0XA 4QGUA 4R4IA 4C3IH 3J80c 3NEMA 5GAEC 1JMCA 5IYBH 2ZM6L 3H0GG 2BH8A 2JA6H 2ES2A 3HKZE 4JCVE 5M3MH 1TWCH 1VQOA 2E8GA 2I5MX 1P8LA 4PZ8A 4UY8C 3OYYA 1NJIC 1WJJA 4LF4L 4LF9L 1WI5A 4GN5A 3I4NH 4DR1Q 1A62A 4AIMA 3RLNA 3PUYA 3M7NA 3CP0A 4DAYB 1K9MC 1CKMA 3F2BA 5FJ8G 4JV5L 1CKOA 4LFCQ 4Y52H 1N33L 4YCVA 1IZ6A 4KI0A 5IYCH 4JI6Q 2R7ZH 2K52A 1K83H 1QVGA 5FLMG 4DV7L 3CC7A 4R4TA 4JBKA 4X65Q 1XJVA 4IJLA 3M4QA 5EAYA 3HOWH 2RCNA 5H1SE 5HY6A 4MNOA 3JC66 3M9BA 4ALPA 4A3EG 2NZHA 2NVQH 4A3BH 4BA1I 4KHPL 4X66Q 4X6AH 3HOYH 4GS3A 1N34Q 3GTQH 2WB1E 2BA0A 4DV0L 1KXLA 5IP7H 4A3CH 4A3FH 2R7DA 1TWHH 5M5WH 3U4VA 3F8TA 1MKHA 1L1OB 1HR0L 4JI3Q 4LF6Q 2QGQA 1IBMQ 2JA8G 2NVTH 2WAQG 1TWFH 3PUVA 1E3PA 3GTGH 1NBWA 3G6EA 4HJAA 4GNXA 4A3LG 2HQLA 1E1TA 4DR3Q 5AJ3Q 4RMFA 2KCTA 5GROA 5IP9G 1K8GA 1KC8C 4DR6L 2CKZB 4BBRG 4JI2L 1VQ8A 2JA5G 4AYBE 4DV1L 2JK8A 2VQEQ 1LTLA 4BY1H 1GVPA 3K7AH 1VQDA 1YI2A 1Y1VG 3M85A 1S40A 3DM3A 1L0WA 1U5KA 1KAWA 1UE5A 3BJUA 4DR5L 3GTKH 3PO3H 2K5HA 1KD1C 5M5YH 3EBEA 1NY4A 4JI1Q 5LMNL 4L5RC 2AWNA 2F3IA 4PG3A 3TREA 3CMEA 1OXUA 3T1YL 1VCIA 1G6PA 2A19A 3KOJA 4A3MG 1T9HA 1C7YA 5FLXc 3HOZG 5K36G 4DUZQ 4GKJL 2K4KA 3G71A 3A5ZB 1LM0A 1BBWA 5BR8Q 4DR1L 4JI0L 4NXMQ 5IYBG 4OWTB 3HOZH 2JA6G 3G48A 3T1HQ 2LXJA 5M3MG 1PHJA 1VQJA 5IE8A 1I94Q 4IOAA 3HOUG 4GOPB 1PFSA 3UDXA 4B3SQ 4JI7Q 2F4VQ 1EFWA 1PH7A 3F2DA 1YHBA 4DV6L 4WJ3M 4BXXH 3PIOA 2PMZE 3J80i 4OO1I 1XMQQ 4JBMA 1CSQA 1FL0A 4P74A 1E24A 3H3VI 1VQLA 1AH9A 4X64Q 1VQNA 1JT8A 3J81c 3CCLA 4X65L 3GD7A 1EUJA 2Y0SE 1QVFA 3HFZB 4MTNA 2R93H 2MFIA 1KQSA 1YZ6A 1YJNA 1Q81C 2K50A 1SLJA 1W2BA 2R7ZG 2KENA 2GVAA 5ELOA 4X66L 2ID0A 1Q82C 1NE3A 1CKNA 1J6QA 1HJPA 5JEAJ 4YHHL 3F1ZA 4A76A 2JJQA 2B63H 4BA2I 4JI4Q 3HOWG 1IBML 3E0EA 1KRTA 1YIJA 5JJLA 4A3BG 1N32L 4DUYL 4YWKA 4BY7H 3UE0A 1X6OA 1YVCA 2UXDL 4APVA 3F2CA 3CPWA 1S3OA 2JA7G 1WCMH 1GO3E 1HZAA 5C3EG 2I5HA 3TRZA 2VQEL 1VQIA 3RLOA 4LUOA 4L5TA 1CUKA 2VNUD 2CWPA 1Q7YC 4OXPA 5JJIA 3H3VH 2R6GA 3CCVA 4A3KG 2NN6G 1IYJB 3L0OA 4DK3C 4LF5Q 2HHHQ 3PF4A 1FJGQ 1VQ7A 1EIFA 4GLAC 3ULLA 2VQFL 1X3GA 3NELA 3CAMA 4BY1G 5M5XH 4Y7NH 4DR2Q 1SR3A 3PIPA 1Y1WG 3K7UC 1X9NA 3PO2H 4OWXB 3L2PA 4B3RQ 2Z6KA 1PYBA 1VQ9A 2LSSA 4JI8Q 3FHWA 3T1HL 3W1BA 3RZDH 2QEXA 1VQKA 3S1NH 3ULPA 4TQUS 2MQHA 1RL2A 3MEFA 4JI7L 1OXTA 2E2IH 4UP9A 3ER0A 3CD6A 4IFDI 4DR4Q 1HNZQ 2NVXH 3FKIH 1V9PA 2MO0A 3GO5A 1XMQL 4LNQA 1I50H 4X62Q 4JBJA 1OXVA 3EN2A 4UPAA 4AQYQ 2VW9A 4DV4Q 1VQEA 4DV3Q 1UE6A 1NTGA 4X64L 1YJWA 1QZGA 3TEHB 1N36L 1K8AC 2E5LQ 2FXQA 1Q1BA 1HNXQ 1JJGA 2YTYA 3A5UA 1IBLQ 1EYGA 2UUBQ 2A1AA 1YITA 1PH9A 1N8RC 1E22A 4QJFA 1CSPA 2KHJA 1JE5A 3KDFB 4LWCA 2I0QA 4OX9Q 3SGIA 3Q8DA 3I7FA 2HIVA 1PH8A 1Y14B 4QY7A 4PZ6A 4LFAQ 5IYDG 3RN2A 4A3IH 2ZJQA 2RHQB 2ASBA 3KF8B 1QUQA 4YWMA 4DAMA 1XPRA 1SN8A 4LFBQ 1MJEA 2ALYB 2UU9Q 4JI4L 1XPOA 2JE6I 3CMAA 1K0RA 1PH2A 3TQYA 1R9TH 2MO1A 3S24A 4GNXC 2OTJA 2VS1A 5C0XJ 4LF7Q 1GKHA 4FDBA 5C4XH 2IY5B 5GAHC 1X65A 4LUZA 5IWAQ 3J81i 5GQOA 3I2ZA 1MIUA 1RIPA 3VDYA 1VQ6A 4GN4B 1VQAA 3NENA 3I4MH 2Z0SA 5M3FH 2Q2UA 4GLVB 3S14H 1I5FA 2V1CC 3GTJH 3NBHB 2UUCQ 3UDFA 4DV2Q 4P75A 3OTOQ 3PCOB 4XIGS 4LF5L 2Q2IA 2H5XA 2ZTEA 1I6HH 1FJGL 1EOVA 1NMFA 2A8VA 3JAMc 3J81j 4IPGA 4LW1A 1HZCA 3GTPH 4B3RL 3S1MH 2WB1G 1X3FA 1QZHA 1H95A 1JB7A 4B3TQ 1VQGA 1TWAH 2IHEA 1YNXA 4IPCA 3GDEA 3A0JA 3KF6B 1X55A 1G51A 2Q2HA 5DLQE 4POFA 3CC2A 3D0FA 4A3DH 4YCWA 2UXCL 1XMOQ 3DLLA 2QA4A 1OXSC 2DUDA 4JYAQ 4DV5Q 4PMWA 3PO2G 4O2DA 3KFUA 1E7ZA 1X56A 1YEZA 5JJKA 3AQQA 1N9WA 3H0GH 3L7ZC 3K80C 4X62L 1XNRL 4EX5A 4LFCL 1FVIA 4AQYL 4AYBG 1S72A 5C0XI 3W5OA 3AFQA 4JOIA 1L1OA 4P73A 2E5LL 4JI6L 1HH2P 2CFMA 2WFWA 3KLWA 1HNXL 1IBLL 1PH4A 1UWVA 4O0AA 3I4NG 4HIMA 3M4OH 1B8AA 3CCRA 4YY3Q 2RHSB 1FGUA 1PH6A 1C0AA 3BZKA 3PUXA 3PUZA 1KRSA 5ELNA 4GLXA 4YWLA 1XNQQ 2DGYA 1PH1A 2OQKA 4P72A 1BBUA 1B7YB 5IYCG 2KHIA 5FJ8H 2YV5A 3HOXH 2D0PA 3E9IA 2UU9L 4YCUA 3S1QH 1WFQA 3GTOH 3ERSX 2PI2E 2ZTCA 1JJCB 3CCMA 3PF5A 1N34L 1XPUA 4LF4Q 4LF9Q 4NXNQ 4B3MQ 4HJ8A 5FLMH 1LUZA 1XNRQ 4DR7Q 4JI3L 3B6YA 4R4OA 4HIKA 4LF6L 2IX0A 5GADC 1TXYA 1WYDA 3I56A 4IFDJ 5IWAL 2XGTA 2K5NA 2K75A 3CF5A 4HJ5A 2PQAB 1PA6A 4JV5Q 3CPFA 4DR3L 2IT1A 3E9HA 5AJ3L 2UUAQ 1N33Q 2IX1A 2GVBA 3BU2A 3FP9A 4IPHA 4MZ9A 1GM5A 1IBKQ 1B70B 2YTVA 4JI5Q 3HOYG 4BBSH 1O7IA 1GD7A 5IP7G 4A3CG 2B3GA 4A3FG 4DV2L 4EQ5A 2Y0SG 1VQBA 4GOPA 5JEAG 4AH6A 2WP8J 1EWIA 1EIYB 2NZOA 2JA8H 1EQRA 4IJHA 1M90C 4JI1L 4LUVA 1AE3A 4R4QA 3HOVH 2PNHA 2AKWB 1SROA 4KHPQ 1PV4A 2Z6KC 1VQPA 3I4OA 5IP9H 2XTIA 4BBRH 5C44H 4DV0Q 4A75A 1MJCA 2R7FA 4R4CA 4DUZL 2JA5H 1E1OA 4OWWB 3PO3G 1HR0Q 1L2FA 5BR8L 4NXML 3MXNB 1J5EQ 1C9OA 2LXKA 2B29A 2ZJRA 1KL9A 1BVSA 1I94L 1K3RA 4B3SL 4DPGA 2KCMA 4H02A 2F4VL 4DR6Q 2VZAA 3AFPA 1K73C 1YHAA 3CCJA 4WJ4A 2VUMH 2C35B 2RF4A 5J3BA 3U4ZA 3CXCA 4NPSA 2AWOA 1VQFA 5HGQA 3U58A 4DR5Q 3ULJA 4NB3A 1OTCA 1HZ9A 4YY3L 1XTDA 3TS0A 2OWOA 1HR0W 3S2HH 1XNQL 2ZTDA 1SFOH 5LMNQ 1IL2A 1V1QA 3CQZH 3PV0A 3WWVA 3T1YQ 1AE2A 1I3QH 2R92H 4JG2A 3HOUH 4BXXG 5GAGC 2IHFA 2Q2TA 4GNXB 3HKZG 3UDGA 2VY3A
chains in the Genus database with same CATH superfamily
1I3QB 4NXNL 4CDFC 2L0CA 1D7QA 4DR7L 4X3KA 1HHVA 2EY6A 5ELDA 1FNVA 1NMGA 2F0GA 3HOXG 5LMNW 2WACA 1UE1A 4KN7C 3T53B 3M4PA 4XQNA 1Q8KA 2M9VA 4UHVA 1EZ8A 5BN4A 1TKWB 1IXRA 5G3LD 1WTQA 3S17H 1A3UA 1MI2A 4C2MH 5I6WA 4HIOA 4BY7G 1Q8IA 4QMGA 4R1JA 3QOJA 4CBVA 4KHZA 4BBSG 4OHJA 4DR2L 1YHQA 5IY0A 3PGZA 4HMIA 4N8FA 3KDFA 4CDCC 4OO1G 4EQPA 2PQEA 5E1FA 4QUCA 2B2TA 4QIWB 2ICIA 3CHBD 3KF8A 2UXDQ 1QNUA 4A3KH 4G7ZC 1Q3LA 1SE2A 4DR4L 1OXXK 5C6AA 1BCPB 1U4MA 2O2LD 4DV4L 4DV3L 5FO9B 3NHHA 1CKNB 3D31A 4DK1A 3HKSA 4DK6C 3S1RH 3NTHA 4OX9L 4MIUA 2KOLA 4CHTB 3EFXD 3FMCA 2VQFQ 1G291 2ZM6Q 2B39A 4C3JB 3GTLB 3H15A 1G2TA 2PI2A 5IGBA 1LLRD 3D3RA 3J7A5 4A3LH 3STBD 1R4PB 3MVVA 1IW7D 4ZUJA 2SEBD 3HOZB 1Q12A 5JAVA 1STGA 4A3IG 4RG1A 3S2DH 5IYDH 1A2TA 1Z47A 4DAPA 2H1EA 5ELEA 2CVRA 4A3EH 3FPUB 1NR4A 1QVCA 2F0JA 1B50A 3UDIA 4HJ9A 1SBBB 3QWNA 3VR2A 5IT9c 3KJPA 1SMXA 1ZEQX 3CCQA 2WKCA 3V05A 4DXGA 4FF1A 4IFDG 1WOCA 2Q8RE 3KYHC 4OIKA 4XYOA 2N3SA 1HZBA 4CKEA 2FMMA 1QCBD 1ZYRC 5CV9A 1BKBA 4JYAL 4DV5L 1LTTD 3FVQA 5C4JH 5E4XA 2N8NA 3C1EA 1RTNA 1DGSA 4XTCS 5EQ0A 2OQ0A 4OELB 1QUQB 3TZDA 2KBNA 1IKMA 3KLRA 2WB1B 5KYIA 1KNEA 3NEMA 2ZM6L 3HKZE 1EL0A 5M3MH 3VYUA 4H44C 1HFGA 2I5MX 3KUPA 1P8LA 5M9OA 5EGTA 4AYBB 3TBIB 3RZDB 3PUYA 2B2VC 1UUPA 1U4LA 3A54A 1CKMA 3URYA 4RCNA 1NNXA 1IZ6A 5IYCH 1A6XA 1I50B 2EYHA 1EYCA 3MXNA 2K52A 4XQQA 4ID6A 1NCVA 3CC7A 4R4TA 4IJLA 2A73B 5JPMC 3JC66 3M9BA 4X6AH 1QE6A 1N34Q 3HOYH 4DV0L 4KMUC 1ICWA 5M5WH 4LF6Q 1KLUD 3F8TA 1PTOD 2NVTH 4J8QA 2WAQG 2A5HA 3GTGH 4HJAA 1JE4A 1S5BD 1I4HA 1E1TA 4DR3Q 1TWFB 1MSHA 2KCTA 1K8GA 3SXHA 2CKZB 4BBRG 2B2UC 2Z8LA 3GV3A 1GVPA 3K7AH 1PFMA 1O7ZA 1Y1VG 3S14B 1U5KA 1UE5A 3BJUA 3DXJC 3M7GA 5IGEA 3GTKH 4FNFA 2L5TA 4JI1Q 2NTSA 2AWNA 2F3IA 4G7OC 1BF4A 1VCIA 3O13A 5FLXc 3S1MB 4KD4A 1H9MA 4NXMQ 1RF2D 5IYBG 3ONAB 4OWTB 1T5EA 4A3DB 1ET6A 1VQJA 1B9MA 4B08A 2PZUA 3F2DA 1AEXA 1CFMA 5AFWA 2A74C 3DWQA 4EQNA 4P74A 1E24A 1VQLA 2Y0SE 3M4OB 3HFZB 1B44D 4MTNA 1YJNA 3PQIA 1SLJA 2R7ZG 5ELOA 3NWSA 3OMCA 1AZQA 1Q82C 3L3OC 1CKNA 3MXPA 3J81L 1HQMC 5CBAE 4E6IA 4JI4Q 1Y69U 3HOWG 5IOCA 4RA8A 1KRTA 1A3TA 1A15A 1PYWD 4RCOA 5JJLA 4L6TB 4BY7H 5D14A 1S5CD 1HZAA 4K5WA 1VQIA 4PMBA 3RLOA 4L5TA 2B2YC 2B8GA 1WCMB 1SYDA 4OO1H 1TS5A 3H3VH 4P2CB 2M2LA 3L0OA 1FJGQ 1VQ7A 3QR8A 1X3GA 3EJIA 3CAMA 4OIJA 4Y7NH 3HOVB 3PO2H 1SNQA 2Z6KA 1IHZA 4YIJA 4IUNA 1KDBA 1AP0A 1WTOA 5KIXA 1DXMA 3LNNA 5FOBB 2E2IH 1UEAB 3CD6A 2E76C 5D3IB 4R8NA 1HNZQ 3GO5A 2VUMB 1F2ZA 3FKIB 1K8AC 1O7YA 2E5LQ 1JJGA 4RGTA 3NP8A 2G9DA 4MN3A 2PZWA 1E22A 2I0QA 3M4YA 1SFOB 1V1PB 4QY7A 1EY6A 4LFAQ 4A3IH 2Z1CA 1PXUA 1LTRD 1SJHD 1QUQA 2KJXA 1LACA 2RBMA 4KKSA 3U9OA 4JI4L 1C48A 5IGFA 3J81E 4KY5A 3CMAA 1GUNA 3TQYA 2MO1A 4LF7Q 4FDBA 2IY5B 2TSSA 4CKCA 5ELFA 5IWAQ 1UAPA 1RIPA 1SYFA 3BVMA 3QOLA 4GN4B 2WIIB 3K58A 4IFDH 1G8ZD 2Q2UA 3I4MB 1CZWA 4GLVB 3NK9A 2Z6BA 4N9TA 3GTJH 3NBHB 3NUCA 4Q5VA 4DV2Q 4HTHA 4P75A 3S17B 1FJGL 1NMFA 2K01A 4ZUIA 3JAMc 4DK0A 2ZXRA 4MTKA 4K8JA 1X3FA 3CKIB 1JB7A 1VQGA 1TWAH 2IHEA 1YNXA 5CV5A 3GDEA 3KF6B 2UUBQ 1X55A 2Q2HA 1OXSC 4HAEA 2VXWA 1FNUA 2LKVA 3L7ZC 1PRTF 5K5PA 4EX5A 4JOIA 5A2QL 2E5LL 4JI6L 3QB3A 3KLWA 3TP5A 3K59A 3NQIA 4EGVA 5T1GA 3J7AF 1PH6A 5ELNA 1KRSA 4K8IA 2MUYA 1GUTA 1U4PA 3E9IA 1Y8OB 4KN4C 4LF4Q 4LF9Q 1A3VA 2E2DC 2QDLA 4HJ8A 1RD9D 4HIKA 4R4OA 2IX0A 1TXYA 1STNA 5IWAL 4HJ5A 2PQAB 2UUAQ 2ENBA 2IT1A 3TDQA 5AJ3L 2IX1A 1ENAA 3S2DB 2K1BA 2YTVA 5E3FA 2D5DA 2B3GA 4A3EB 4DV2L 1VQBA 1GUWA 2AQ1B 1EIYB 4IJHA 1M90C 1JCKB 1AE3A 4R4QA 1I4XA 1PV4A 1VQPA 3OWEB 5COYA 4BBRH 1CM9A 4QUFA 4A75A 4DUZL 1E1OA 1RJTA 4FF3A 5EJWA 1HR0Q 5BR8L 2B29A 3MFGA 1I94L 2FINB 2PPBC 2F3WA 1SYGA 2FJ2A 3DWPA 3DM1A 4H02A 4DPGA 4B3SL 2F4VL 4DR6Q 4WJ4A 5EPJA 2CH4W 2K05A 4C1NK 2AWOA 3U58A 3ULJA 4NB3A 5CBEE 1XTDA 4X3UA 4I7AA 2Z4IA 1IL2A 2I46A 3CQZH 2R92H 3X3NA 2K28A 5GAGC 5F2DA 3DHQA 3HKZG 2A6ED 5M3MB 1YNND 5I9PA 2EQSA 4JI0Q 2R93G 2NN6I 2YTXA 1X3EA 4GZYC 2WAQE 4DXFA 2UUAL 4PZ7A 2BDNA 4DNIA 1QB5D 3BYYB 3F2UA 3RNUA 4A3GH 4K0KQ 1SMYC 3C1FA 3AEVA 1D5XC 4GKKQ 5CV4A 1SSOA 3CCSA 3EIVA 2E2HH 1PDQA 1XTCD 2D0OA 4XQJA 2L4NA 2BE5C 3HOYB 1VF5C 3N6RA 2JA7B 2IPKD 2QW7A 2XNAC 5CGKA 1V1PA 2R61A 1UNSA 4JI8L 5C3EB 5KRUA 3CCEA 2N78A 4HIDA 3GTGB 5JVG3 5C44G 2OTLA 1L1OC 4LF8Q 2BH2A 3KLSX 3RN5A 2M00A 4A93B 1Y1WB 3A55A 4KY6A 1M1KC 4DKAC 4JK1C 2F52A 2CCZA 4F8MA 1BCPD 5FKAC 2HQEA 5BN3A 1SXTA 2E2JB 3NBHA 1LYLA 4LFBL 2K5VA 1QILA 1W6KA 4LAAA 4QF4A 3TS2A 3PMFA 1JJ2A 3IRBA 3K5MA 3QG1A 3BS1A 1VMPA 3LX0A 4HEDA 3KF6A 1Z6HA 1D5ZC 4K0KL 1XYIA 1V43A 1N36Q 1XWEA 5KYLA 2HD3A 5DM63 2UUCL 4GKKL 3MAQA 4F87A 3HRZC 1VQCA 2EOTA 2EY1A 4XYQA 2F0VA 3RLFA 2RDGA 1PZID 4A4IA 2JA9A 4RFBA 5IGGA 1SDFA 5M3FG 4G4KA 4A3JG 1PRTC 4B3TL 1LTID 2F03A 5IT9L 2HT1A 3W1GA 3U50C 1LTGD 4ILWA 4C3HH 1NSNS 3TMEA 1Q86C 4DGZA 2B2WC 4LF8L 4FF2A 4K5XA 3RZOH 3KBGA 4IUUA 3ZYYX 3UI2A 4N8X1 4DV1Q 4A3MH 1LV9A 2Z4HA 1RODA 3LGJA 2PQAA 2SDFA 2K14A 3K0XA 1TWGB 3J80c 5GAEC 1JMCA 3I8ZA 4IURA 5EKLA 2A69C 2JA6H 2AUJD 3HEJA 4JCVE 4Y7NB 1TWCH 1VQOA 2E8GA 3PO2B 4KY7A 4PZ8A 3H3VC 1HFNA 3OYYA 1WJJA 1WI5A 1BBXC 2JYOA 3RLNA 1DOLA 3NQTA 2VB3X 4JV5L 4LFCQ 4YCVA 3MC0B 2IWHA 1K83H 3OOCA 5FLMG 4N9PA 2X6GA 4JBKA 3NTIA 5HY6A 4ALPA 3MXUA 2NZHA 4JW0A 4A3IB 2NVQH 4BA1I 4A3BH 4X66Q 1WD1A 4GS3A 5J22A 3GTQH 2O5JC 1KXLA 4K6DA 3I72A 1IBMQ 1CI3M 3R93A 3P75A 1E3PA 5KGUA 5IT9E 3G6EA 2EYPA 2HQLA 2GA4B 1EYAA 4RMFA 1ENCA 5GROA 5IP9G 1KC8C 2JA5G 1IKLA 3QJYA 2JK8A 4DV1L 4BY1H 4LJZC 5C5MA 1L0WA 1II3A 3GTJB 2PZTA 4NDXA 5M5YH 2EJMA 5EPLA 1NY4A 4X3SA 3PO3B 2KEEA 1OXUA 2TMPA 3NSWA 3T1YL 1A2UA 1T9HA 1GHKA 4OL7A 5C4ZA 3G71A 1EY7A 5JOBA 2EYOA 2PYKA 1Y8PB 4L63B 5IE8A 2E74C 4FVMA 3UDXA 4JI7Q 2QEJC 1EFWA 1PH7A 1HUNA 2Q8IB 2PMZE 3J80i 1CSQA 4I7ZC 1SNCA 1O78A 1AH9A 1JWUD 4X64Q 1VQNA 4PNYA 3GD7A 2R93H 2MFIA 1Q81C 2K50A 1PZJD 2KENA 5CMDA 1DJRD 1FD7D 4X66L 2ID0A 4IN3A 4TSSA 2NWGA 2CH4A 5JEAJ 1ILPA 3DEOA 1EWCA 1IBML 3E0EA 4IUVA 2B63B 1S5FD 2UXDL 4APVA 4M1UB 3F2CA 1HUMA 3CPWA 1S3OA 4J1MA 3IKJA 5IIFA 3TRZA 1CUKA 3LWEA 2CWPA 1LTAD 4OXPA 2A6HD 4DU9A 3D4RA 3CCVA 2NN6G 4FF4A 1IYJB 4DK3C 2HHHQ 5J39A 4IQZA 4GLAC 2VQFL 1K73C 5EKKA 1OTCA 1SR3A 4RKBA 3L2PA 1NUCA 2ZXPA 4BBRB 2J4XA 1B3QA 4K2LA 3FHWA 3Q22A 2QEXA 2F0TA 3OWFA 3A7AB 4C3JG 2H4OA 4JI7L 1OXTA 4UP9A 2K03A 3K6OA 4HSVA 5FLXE 1EIHA 4LNQA 2KECA 4UPAA 1QZGA 3HOZG 1YJWA 1UE6A 2NVXB 1EEFD 5CV7A 4X64L 1JORA 1D2BA 2FXQA 3WDNA 1YITA 4S3SA 3MHBA 2RCFA 1K8MA 4LWCA 1TQOA 3SGIA 3Q8DA 3I7FA 1EQTA 1Y14B 2E75C 3CQZB 4PZ6A 3MEHA 2EJGC 5CV8A 2R92B 1EFID 2A68D 3TSSA 4DFAA 4DAMA 3DWAA 1XPOA 1G2SA 2ZT9C 3T13A 1R9TH 4GNXC 5C0XJ 4ME5A 1MD2D 4LUZA 2F0DA 5GQOA 5JJZA 4XDXA 3VDYA 1SYEA 1VQ6A 5C4XB 1BQQT 1CQFA 5M3FH 3D4DA 2V1CC 4A3GB 3UDFA 2OEOA 4NP5A 4R8IA 3P20A 3OTOQ 2Q2IA 2H5XA 2VB2X 2ZTEA 1DM0B 1EOVA 1SJED 3P7JA 2A8VA 1MBYA 1HZCA 1WVLA 2WB1G 1QZHA 1I4PA 3E6ZX 1H95A 3V96A 1PZKD 3SK8A 3OIQA 4POFA 4YCWA 1XMOQ 4C3IG 2QA4A 3A8KE 4O2DA 3KFUA 5JJKA 3K80C 1STEA 4RWSC 4AYBG 3BDCA 2F0PA 4P73A 4RAUC 1XPUA 1HH2P 2CFMA 3H0GB 1UWVA 4O0AA 3I4NG 4RKLA 2CHBD 1B8AA 3CCRA 3BZKA 1XNQQ 4DF7A 1DD2A 1E2VA 4F88A 2OQKA 1YNJD 1B7YB 4KD3A 3S1QH 3HOXH 3PIO3 1WFQA 3GTOH 1SNDA 2PI2E 2ZTCA 1JJCB 1STHA 3CCMA 1N34L 1IW7C 1X3QA 4B3MQ 2NUCA 5FLMH 1LUZA 4ZQ3A 2XWJB 3B6YA 4LF6L 1OO9B 1BOSA 1GUGA 5GADC 4PV1C 2K75A 3DMUA 2RSNA 3CF5A 1BDOA 2EY5A 4DR3L 1N33Q 3M7NA 2GVBA 1IBKQ 2L55A 4JI5Q 2XVSA 4BBSH 1O7IA 3GQBA 3NE5B 3ND9A 4A3CG 3R2TA 2WV6D 3Q0AA 4A3FG 4KJOA 4XT1B 4EQ5A 5C3WA 5JEAG 1EWIA 2MJ8A 2NZOA 1L0YB 1CHPD 3FRPB 4ZKBB 4JI1L 1CTMA 4NKLA 2JA8B 3CRLC 4KHPQ 5D65A 5IP9H 1RDPD 2AUKA 2R7FA 2JA5H 2G5DA 1HTLD 4NXML 2K5QA 1C9OA 2LXKA 4ULLA 4EVOA 2F0HA 3JAME 1KL9A 1BVSA 2RDHA 4C3HB 2RSOA 2OTJA 2KCMA 2MPMA 1QJOA 3CCJA 3RZOB 5FO8B 2F0IA 2RF4A 4IUQA 3CXCA 4NPSA 2IX3A 4JPBW 1VQFA 1PFNA 4DR5Q 1KDAA 3SK6A 2QCPX 4MHEA 4A3MB 3OHXC 1XNQL 5LMNQ 2LMCB 1K8OA 3PV0A 3WWVA 1I3QH 1E2WA 1RHPA 1W6JA 3TZUA 2JA6B 2IHFA 2ICEC 5C5LA 2KCCA 4GKJQ 2MHVA 4B3ML 1J8IA 1LT4D 1EEID 3FPPA 2EYMA 1VQMA 2K5DA 3TP6A 4RGMA 3AYHB 1Q1EA 2C9OA 4DV6Q 2B2VA 1IBKL 4JI5L 2CQOA 5I9OA 2B8FA 2X6LA 1TS2A 1XX8A 4HJ7A 1SMYD 3Q23A 3T56B 3UE1A 3D6CA 4FP5D 2ZXOA 3VYRA 2JSOA 4OONA 4C2MB 3KBXA 3VR3A 1UEBA 1WCMG 3HP3A 5C0XG 4A3BB 1R4QB 2NVQB 4YHHQ 2ZJPA 3G6JB 1EOTA 5LL6X 3GTQB 1PTOC 5J1ZA 5ELBA 4KLKA 4P71A 1SNPA 2BDOA 1V8QA 1ASYA 3HOVG 5E7NA 3U9SA 4DUYQ 1N32Q 3ERQA 4UP7A 5ELCA 2JP1A 2LY7A 4K2KA 2NN6H 2BA1A 1S4ZA 3ICEA 1LT3D 2QILA 1HNZL 4A3KB 2UXBQ 1H9SB 3SHLA 2B2UA 2YU9H 3ZJYC 4BY1B 1U0LA 5LMUQ 2NB0A 4RH6A 2JQOA 3OPOA 1BO0A 4C3JH 3GTLH 2VUMG 1SRUA 4U68A 3PSIA 3FKIG 3S1RB 2UXCQ 4LFAL 3A74A 4H7BA 3CC4A 1A63A 5C3XA 3K8AA 4CJ1B 1STYA 2RDFA 3IFTA 2JEBI 1HA5A 3OMGA 2NTTA 3OIPA 2NZ1D 3M3YH 1M4VA 1KIXA 4LF7L 5DM73 3I55A 1F2MA 4QIWE 3HKZB 4JVZA 1GUOA 4GOPC 1L0XB 5ISRA 2R93B 1VS0A 1JOOA 3I4MG 5E4WC 4ODGA 2AMCB 1CK1A 1W3SA 1PVOA 3SVMA 4IOCA 1PRTD 5CV6A 2YYZA 1GUSA 2UUBL 3X3MA 1KHIA 4L5SA 5A35A 2XIWA 1Y1VH 4Q0FA 4H0LC 1Z9FA 2UXBL 2D62A 2JEAI 5I4DA 2NBFA 1PH5A 2K33A 2QKIC 3E5SA 5C4JB 3BZCA 1CQVA 4JI2Q 4UDUC 1ILQA 5LMUL 1EQQA 2B2YA 3JAMi 1PH3A 3E0JA 4C3IH 5IYBH 2A69D 2IJ0A 2D9UA 3HG9A 2F0EA 1Q90A 1F77A 4UY8C 1TR5A 2L11A 3J80L 4LF4L 4LF9L 3I4NH 3L9AX 1JQYD 4AIMA 2F0QA 3CP0A 1D5MC 4DAYB 1K9MC 3F2BA 3EA6A 1CKOA 4QCLA 4KTAA 4KI0A 2R7ZH 1QVGA 1AN8A 1PLFA 1LO5D 2F0KA 4X65Q 2F0WA 3HOWH 3MZ5A 2RCNA 3MA2B 5H1SE 2F0MA 3VR5A 4A3EG 1WD0A 1NR2A 2WB1E 2BA0A 2B2TC 4ZLTF 4A3CH 4A3FH 2R7DA 1TWHH 4JI3Q 1GOZA 3U4VA 1MKHA 1L1OB 1SEBD 1HR0L 2QGQA 4WRDA 2MGSA 1HQRD 1TWFH 5JEAH 1GHJA 5M5WB 2Y0SB 2NVTB 1F9PA 3A8JE 2DY7A 4DR6L 5IGCA 1I4QA 1KAAA 1VQ8A 4AYBE 4JI2L 5IGDA 2VQEQ 3HS0C 1JOKA 1VQDA 3DM3A 1KAWA 1M8AA 2I07B 2K5HA 1KD1C 3K7AB 4L5RC 3GTKB 4PG3A 3TREA 3T16A 2KCNA 1C7YA 3K5OA 2JN4A 2K4KA 3A5ZB 1LM0A 1BBWA 4JI0L 3BVZA 1TS3A 1B1ZA 3K0YA 1AZPA 3J80E 3G48A 3T1HQ 2LXJA 5M3MG 3HOUG 1D6EC 5FK9C 1FR3A 1J9OA 3PIOA 1XMQQ 3T51B 1E2ZA 1FL0A 4LK1C 1X3PA 5CC4A 4L8JA 3OSOA 1WTVA 3CCLA 4X65L 2O5IC 3QO2A 1YZ6A 1H9SA 1PRTB 2GVAA 4NMZA 1LT5D 2C5CA 1KTKA 1STAA 1J6QA 1NE3A 3VA7A 3HOXB 3Q6SA 5KNCA 2P5ZX 4A76A 2JJQA 1B9NA 2CQAA 3D6WA 1FGBD 1ZYRD 1ET9A 3J7YW 1RCVD 2EJFC 2JA7G 4BY7B 1WCMH 3C3LA 5C3EG 2VQEL 3I73A 4BBSB 4LUOA 2SNSA 4BWGB 5JJIA 2R6GA 2LFNA 2KUMA 1JICA 4LF5Q 4XXEA 4DR2Q 5M5XH 1GXDC 4A93G 3I70A 3KK7A 3KLSA 1CA6A 1Y1WG 1TS4A 4FXKC 2F0NA 5G3LF 1PYBA 2KVMA 4U673 2LSSA 3T1HL 3W1BA 3S1NH 1EWHA 3IAYA 3C46A 1TVXA 2MQHA 1RL2A 3MEFA 4NW2A 3ER0A 3K5NA 1EY0A 4LMQD 4DR4Q 1VDZA 3FKIH 2E2IB 1XMQL 4JBJA 4RGOS 1XNRQ 1ONLA 4AQYQ 2QDBA 2VW9A 1VQEA 3GP7A 1SE4A 1NTGA 4DV3Q 4DV4Q 1G91A 1N36L 4H13C 2XRQD 1Q1BA 2YTYA 3A5UA 1IBLQ 2DNEA 5HURA 1EYGA 1PH9A 4OX9Q 1CSPA 1JE5A 1RTOA 4V190 1AW7A 1PTOH 3NBIA 4HCEA 2HIVA 1PH8A 1K0SA 2A6EC 3RN2A 5BN5A 4TKOB 1YNNC 3EQLC 4YWMA 1XPRA 1SN8A 1BR9A 1LTSD 3SE0A 1MJEA 2ALYB 2JE6I 3BYTB 1K0RA 1PH2A 3DUZA 3S24A 2EYLA 2VS1A 3VR4A 2LS01 5GAHC 1X65A 5TSSA 2KEDA 4Z9CB 3I2ZA 5KNBA 1MIUA 3I4MH 2K32A 3NENA 1HTPA 2F1MA 5LL6S 4DAYA 1S5DD 4LF5L 1I6HH 4XT3B 3A56A 5CYUA 4DNTB 4LW1A 3GTPH 1JC7A 4IPCA 3A0JA 1JWMD 3CC2A 5DLQE 1G6ZA 4CDDC 1VMCA 1ESRA 3DLLA 4J6HA 1TWAB 2DUDA 4JYAQ 4DV5Q 4PMWA 3PO2G 1E7ZA 1YEZA 4FO2A 1VF7A 1B3AA 4DAVA 1S5ED 4AQYL 4LFCL 5FLXL 1XNRL 5C0XI 3W5OA 1O7LA 1L1OA 2WFWA 1IBLL 2XN9C 1WTRA 4G7HC 4B9WA 4HIMA 2YU9B 1ESFA 2X69A 2RHSB 1FGUA 1C0AA 1BCPC 3PUXA 4GLXA 2DGYA 3I3CA 3S9WA 3H6MA 2EE1A 2YV5A 2D0PA 1SAPA 1DYQA 3PF5A 4K14A 1Y8NB 1WYDA 3I56A 3M3YB 3HZXA 1HRJA 3CPFA 3TP7A 3E9HA 2DJFC 3BU2A 4IPHA 4MZ9A 1GM5A 1O80A 2CW0C 5IP7G 1QOHA 3FDTA 1EQRA 2FMCA 4LUVA 4DA2A 2AKWB 1SROA 2WAQB 2Z6KC 4ZK9B 5C44H 4DV0Q 1MJCA 1TU2B 4R4CA 3PO3G 1WTPA 2Q8TA 1L2FA 1J5EQ 3BDOA 2PCFB 1K28A 1Y1VB 1F9SA 2V4DA 5EPKA 4CJ0B 1ENFA 1YHAA 2L1BA 4IALA 3PIP3 2B2WA 5J3BA 3TN2A 1PTOF 3U4ZA 2N88A 5HGQA 4CDEC 3A7LA 1HZ9A 3NTKA 3J7AV 1HR0W 3S2HH 2ZTDA 2J7ZA 5JVH3 4C3IB 3FEWX 3HOUH 4BXXG 1EY5A 3V2TA 4GNXB 3UDGA 3H94A 3CCUA 1CHQD 2ATWA 4X3TA 1EU3A 1HNWQ 1H9KA 1TT2A 4UP8A 3I4NB 4BS9A 3LWUA 4I65A 3OW2A 1JOQA 1RKNA 2HUGA 3A8IE 3SEBA 2K5WA 2B63G 2R7ZB 1CT1D 3VYTA 2HDMA 5I2YA 2EYFA 2N49A 4A3JH 1EQVA 2EIFA 2F0OA 1D8LA 3HOWB 2HHHL 3J7ZC 3ND8A 4J15A 1DOKA 2JA7H 2I5LX 5C3EH 2E2HB 4IPDA 2L9HA 1J5EL 2RVLA 4HN7A 5IODA 4A3FB 1A0IA 3BG3A 1V1OA 1TWHB 3CW2C 4IUPA 1D1IA 4JC0A 5FO7B 2OCEA 3JAML 4ME3A 3K81C 1D1KA 4JOIC 1X54A 2PO4A 4L5QA 4A93H 1ASZA 1ICFB 1Y1WH 4QQBX 2XSCA 3S16H 2GN5A 1HPCA 3SK4A 1P16A 2J0TD 1VQ4A 4TVAB 2E2JH 2RQXA 4PQXA 1QWYA 3N52A 3EROA 2WINB 1EYDA 4RGNA 4GN3B 1WTWA 1HNWL 1SE8A 3PUWA 1I6VC 2BOSA 3STBC 1EY9A 1VQ5A 3RR5A 2R92G 3I91A 3K57A 2CWAA 1F9QA 3KJOA 1A8VA 3P1HA 2AHOB 4JBWA 3G4SA 1UE7A 3S15H 5JPNC 1Q46A 1HA6A 3BZDB 3H09A 4DV7Q 4FYDA 2NVYH 3OTOL 5C4XG 2HCIA 3NWTA 4A3GG 1QG7A 4FXDA 4HR7B 2RKSA 1B4OA 3GTMH 1ZKOA 3RD4A 1VQHA 3MTSA 1YJ9A 2FFKB 4KKUA 1HXYD 2K04A 5EBCA 2HIXA 1XMOL 2R3ZA 4RHSA 2EXDA 2AQ2B 2VL6A 4KJNA 1MHWC 2F0UA 2K7VA 1PMRA 4IO9A 4QL5A 2A6HC 4A3DG 1TWGH 4POGA 4PMCA 2MNAA 2G9HD 1YBYA 3AMUA 2F0SA 1PYSB 4QGUA 4R4IA 4CKBA 1DZ1A 3H0GG 1BNZA 2BH8A 3DEPA 2ES2A 2DJGC 1K3BC 3ITPA 1JB3A 5M5XB 3BVGA 1ML0D 3E3XA 4F7XA 1TWCB 1I4GA 1Z7TA 1NJIC 2EXZA 4GN5A 4DR1Q 3S1NB 1A62A 3AB9A 2O4XA 4C1NI 1IL8A 2PW5A 1F9RA 2WKDA 5FJ8G 4Y52H 1N33L 1TY0A 4JI6Q 2AQ3B 4K5VA 4DV7L 4OEMB 1K83B 1XJVA 3M4QA 5EAYA 1LTBD 2N55A 1PTOB 2A68C 4MNOA 3RMHA 4KHPL 1T5XD 4ABNA 4ZCKA 1QNKA 1STBA 5IP7H 4KK7A 2PMZB 2BE5D 2JA8G 3PUVA 2DY8A 1NBWA 4GNXA 4B9XA 4IUTA 1E0BA 3I90A 5AJ3Q 2KQ3A 3VR6A 4O1NA 1WTHA 1LTLA 1IYUA 1YI2A 3M85A 1S40A 4C3HG 4DR5L 3PO3H 2SNMA 3AU7A 5LHY1 3EBEA 1I6HB 4K6LA 5LMNL 1B53A 4ZKCB 3CMEA 1U4RA 5M5YB 1NAPA 1HCZA 2EDGA 3SR1A 3T4AC 3CU7A 1G6PA 2A19A 3KOJA 1ZXTA 4A3MG 2D2CC 3GTPB 1JWSD 5K36G 1AFPA 4DUZQ 3WOFA 2PW7A 4GKJL 5BR8Q 1BXTA 4DR1L 4ZAIA 3HOZH 2JA6G 4KKTA 5I6YA 1PHJA 1I94Q 4IOAA 1TY2A 4GOPB 4ZYSA 1PFSA 4B3SQ 2F4VQ 4WJ3M 1YHBA 4DV6L 4BXXH 4CGYB 5KEEA 4OO1I 3H3VI 5I2XA 3VA5A 1EIGA 4WJWA 3J81c 1JT8A 1EUJA 1QVFA 2KA7A 1KQSA 1DCZA 1YNJC 3MXGA 2Z9HA 1W2BA 3R2IA 4IZ8A 1HJPA 3GV6A 4YHHL 3F1ZA 3H91A 1KABA 3W3AA 3VYSA 3WOEA 2B63H 4HSPA 4BA2I 1DONA 1IYVA 1I4RA 1YIJA 1EY4A 3I4LA 3SDZA 4G57A 2F4IA 4A3BG 1N32L 4DUYL 4YWKA 2DN8A 3UE0A 1X6OA 1YVCA 1CA5A 1LT6D 3SK5A 2QF7A 1PFBA 1GO3E 2I5HA 3NPPA 4TRDA 1SE3A 2VNUD 1SNMA 1Q7YC 5KNDA 1JR0D 4A3KG 1MSGA 3PF4A 2IW3A 4M8AA 1EIFA 5EBDA 3ULLA 3NELA 1EY8A 4BY1G 2UXCL 2JXMB 3PIPA 1X9NA 3K7UC 1KNAA 4OWXB 4B3RQ 1SYCA 4R9WA 1VQ9A 5C44B 4DN4M 4JI8Q 1TIID 4UAIA 3W2DA 3RZDH 1VQKA 3ULPA 4TQUS 2DNCA 2FHTA 1LABA 3R3OA 4EQOA 2EVBA 4IFDI 3TP8A 2NVXH 1V9PA 2MO0A 4QB4A 1I50H 4X62Q 1H9JA 1OXVA 3EN2A 5A2QE 4DNRB 4A3LG 3TEHB 3QIAA 4OGQC 4O42A 1HNXQ 2A1AA 1N8RC 2EPBA 4QJFA 3KDFB 2KHJA 3S2HB 5IYDG 2ZJQA 2ASBA 2RHQB 3HOUB 3KF8B 1GJXA 4LFBQ 2RA4A 1MGSA 2UU9Q 1H9RA 2KHSA 1BCPF 1F2LA 1GKHA 4V0BA 5C4XH 1R9TB 3J81i 2XWBB 4RHRA 1VQAA 2L12A 5DEHA 2Z0SA 1XXGA 3S14H 1I5FA 5L37A 2UUCQ 5EKIA 5M3FB 3PCOB 4XIGS 4A3JB 1F2YA 3CRKC 4ZRZA 3J81j 2EZVA 2BCOA 4IPGA 4B3RL 1FNWA 3S1MH 2F3VA 4B3TQ 4JBMA 5DAUA 1BUVT 1G51A 4A3DH 2OXPA 3D0FA 1KDCA 2SOBA 5C4HA 4FXGC 5D3DA 1X56A 2K6AA 3AQQA 1N9WA 2HCCA 3H0GH 4X62L 1C8CA 1X32A 3R8BA 1FVIA 1S72A 3AFQA 3NXWA 1HNXL 1PH4A 3S16B 2EYJA 1B2TA 3K5LA 3M4OH 4YY3Q 2HDLA 3PUZA 4YWLA 2XRSD 1PH1A 3OW7A 4P72A 2OF1A 1BBUA 5IYCG 2KHIA 5FJ8H 2F0FA 2UU9L 4KV6A 4YCUA 3ERSX 1SYBA 3HGBA 3S1QB 4NXNQ 4HMJA 3GTOB 4DR7Q 4JI3L 4CJ2C 1KLGD 1CZGA 4IFDJ 3C2PA 2XGTA 2K5NA 1PA6A 4JV5Q 2OT2A 5DNFA 3FP9A 3HOYG 1B70B 2CW0D 1EZ6A 1GD7A 1SNOA 3IFDA 3S15B 5C0XH 2Y0SG 4GOPA 4AH6A 2WP8J 2JA8H 2NVYB 1U9RA 5CORA 1EU4A 3HOVH 2PNHA 3D8GA 5NUCA 3Q24A 3I4OA 2XTIA 5CR3A 2PNRC 3EVQA 4OWWB 3GTMB 3D4WA 3MXNB 3MWYW 2JA5B 2MP1A 4KHVA 2NYZD 2F0LA 2ZJRA 5T1IA 1K3RA 4WORA 2EY2A 5HGTA 1DOMA 2VZAA 3AFPA 3RUZA 2VUMH 1FYCA 2C35B 4C56C 4HCSA 4WFN3 5K36H 3IL8A 1WTXA 4YY3L 3TS0A 2IL8A 3G7LA 2OWOA 1SFOH 3BDLA 3MFYA 1V1QA 3T1YQ 1AE2A 4JG2A 1C4QA 2L15A 2Q2TA 2VY3A
chains in the Genus database with same CATH topology
3CCUA 4GKJQ 4NXNL 2EQSA 4B3ML 2ATWA 1D7QA 4JI0Q 4DR7L 1HNWQ 2R93G 2NN6I 2YTXA 4UP8A 1VQMA 1X3EA 1NMGA 3HOXG 2WAQE 5LMNW 2UUAL 3AYHB 4PZ7A 1UE1A 1Q1EA 4DV6Q 4DNIA 3OW2A 1IBKL 4JI5L 2CQOA 3M4PA 2B63G 1Q8KA 3RNUA 4A3GH 4K0KQ 4HJ7A 1IXRA 3UE1A 3AEVA 3S17H 4C2MH 2N49A 4HIOA 4A3JH 2EIFA 4BY7G 4GKKQ 1D8LA 4R1JA 3CCSA 4KHZA 4BBSG 4OONA 2HHHL 3J7ZC 4J15A 3EIVA 1UEBA 1WCMG 2E2HH 4DR2L 2D0OA 1YHQA 5IY0A 5C0XG 3PGZA 2JA7H 4YHHQ 2ZJPA 2I5LX 5C3EH 3KDFA 4IPDA 4OO1G 4KLKA 1J5EL 4P71A 1A0IA 4JI8L 3CW2C 3CCEA 1ASYA 3HOVG 5E7NA 1N32Q 4DUYQ 4JC0A 4UP7A 2UXDQ 2N78A 4HIDA 4A3KH 2OCEA 2BA1A 4ME3A 3K81C 5C44G 3ICEA 2OTLA 4JOIC 1L1OC 1X54A 4L5QA 1HNZL 4A93H 4LF8Q 4DR4L 1OXXK 1ASZA 2UXBQ 2BH2A 1Y1WH 4QQBX 3S16H 4DV4L 4DV3L 3RN5A 2YU9H 2GN5A 1CKNB 3D31A 3ZJYC 1M1KC 1P16A 1U0LA 4DKAC 3HKSA 4DK6C 5LMUQ 3S1RH 2F52A 2JQOA 4TVAB 1VQ4A 4OX9L 2CCZA 4C3JH 2E2JH 2VUMG 1SRUA 3GTLH 2VQFQ 3PSIA 1G291 3FKIG 2UXCQ 4LFAL 3A74A 2ZM6Q 3H15A 1LYLA 3CC4A 2PI2A 4LFBL 4GN3B 2K5VA 1HNWL 1A63A 1SE8A 3K8AA 3PUWA 3J7A5 4A3LH 3STBD 3STBC 1VQ5A 2JEBI 3RR5A 2R92G 3M3YH 3TS2A 2CWAA 1Q12A 1A8VA 3KJOA 1KIXA 1JJ2A 4LF7L 3IRBA 4A3IG 4RG1A 2AHOB 4JBWA 3S2DH 3I55A 5IYDH 1Z47A 3KF6A 4K0KL 4QIWE 1UE7A 3G4SA 1N36Q 1V43A 3S15H 4A3EH 1Q46A 4GOPC 2UUCL 4GKKL 4DV7Q 2NVYH 3OTOL 5C4XG 1QVCA 1VQCA 1VS0A 3RLFA 3UDIA 4HJ9A 5IT9c 4A4IA 2JA9A 3KJPA 1SMXA 3CCQA 3I4MG 4A3GG 2AMCB 4IFDG 2L15A 5M3FG 1W3SA 1WOCA 1PVOA 3GTMH 4A3JG 4IOCA 1VQHA 3KYHC 1YJ9A 4B3TL 2UUBL 2YYZA 2N3SA 1HZBA 1KHIA 4L5SA 2HIXA 2HT1A 4A93G 1XMOL 3W1GA 1BKBA 3U50C 2EXDA 1Y1VH 4JYAL 1Q86C 4C3HH 4DV5L 2VL6A 1Z9FA 2UXBL 4LF8L 3RZOH 2D62A 5C4JH 2JEAI 1PH5A 2N8NA 4IO9A 3BZCA 1DGSA 4QL5A 4XTCS 4JI2Q 2OQ0A 4A3DG 1QUQB 1TWGH 5LMUL 4DV1Q 4A3MH 2KBNA 2MNAA 1EQQA 3JAMi 4POGA 1YBYA 2PQAA 3LGJA 1PH3A 2K14A 1PYSB 3K0XA 4QGUA 4R4IA 4C3IH 3J80c 3NEMA 5GAEC 1JMCA 5IYBH 2ZM6L 3H0GG 2BH8A 2JA6H 2ES2A 3HKZE 4JCVE 5M3MH 1TWCH 1VQOA 2E8GA 2I5MX 1P8LA 4PZ8A 4UY8C 3OYYA 1NJIC 1WJJA 4LF4L 4LF9L 1WI5A 4GN5A 3I4NH 4DR1Q 1A62A 4AIMA 3RLNA 3PUYA 3M7NA 3CP0A 4DAYB 1K9MC 1CKMA 3F2BA 5FJ8G 4JV5L 1CKOA 4LFCQ 4Y52H 1N33L 4YCVA 1IZ6A 4KI0A 5IYCH 4JI6Q 2R7ZH 2K52A 1K83H 1QVGA 5FLMG 4DV7L 3CC7A 4R4TA 4JBKA 4X65Q 1XJVA 4IJLA 3M4QA 5EAYA 3HOWH 2RCNA 5H1SE 5HY6A 4MNOA 3JC66 3M9BA 4ALPA 4A3EG 2NZHA 2NVQH 4A3BH 4BA1I 4KHPL 4X66Q 4X6AH 3HOYH 4GS3A 1N34Q 3GTQH 2WB1E 2BA0A 4DV0L 1KXLA 5IP7H 4A3CH 4A3FH 2R7DA 1TWHH 5M5WH 3U4VA 3F8TA 1MKHA 1L1OB 1HR0L 4JI3Q 4LF6Q 2QGQA 1IBMQ 2JA8G 2NVTH 2WAQG 1TWFH 3PUVA 1E3PA 3GTGH 1NBWA 3G6EA 4HJAA 4GNXA 4A3LG 2HQLA 1E1TA 4DR3Q 5AJ3Q 4RMFA 2KCTA 5GROA 5IP9G 1K8GA 1KC8C 4DR6L 2CKZB 4BBRG 4JI2L 1VQ8A 2JA5G 4AYBE 4DV1L 2JK8A 2VQEQ 1LTLA 4BY1H 1GVPA 3K7AH 1VQDA 1YI2A 1Y1VG 3M85A 1S40A 3DM3A 1L0WA 1U5KA 1KAWA 1UE5A 3BJUA 4DR5L 3GTKH 3PO3H 2K5HA 1KD1C 5M5YH 3EBEA 1NY4A 4JI1Q 5LMNL 4L5RC 2AWNA 2F3IA 4PG3A 3TREA 3CMEA 1OXUA 3T1YL 1VCIA 1G6PA 2A19A 3KOJA 4A3MG 1T9HA 1C7YA 5FLXc 3HOZG 5K36G 4DUZQ 4GKJL 2K4KA 3G71A 3A5ZB 1LM0A 1BBWA 5BR8Q 4DR1L 4JI0L 4NXMQ 5IYBG 4OWTB 3HOZH 2JA6G 3G48A 3T1HQ 2LXJA 5M3MG 1PHJA 1VQJA 5IE8A 1I94Q 4IOAA 3HOUG 4GOPB 1PFSA 3UDXA 4B3SQ 4JI7Q 2F4VQ 1EFWA 1PH7A 3F2DA 1YHBA 4DV6L 4WJ3M 4BXXH 3PIOA 2PMZE 3J80i 4OO1I 1XMQQ 4JBMA 1CSQA 1FL0A 4P74A 1E24A 3H3VI 1VQLA 1AH9A 4X64Q 1VQNA 1JT8A 3J81c 3CCLA 4X65L 3GD7A 1EUJA 2Y0SE 1QVFA 3HFZB 4MTNA 2R93H 2MFIA 1KQSA 1YZ6A 1YJNA 1Q81C 2K50A 1SLJA 1W2BA 2R7ZG 2KENA 2GVAA 5ELOA 4X66L 2ID0A 1Q82C 1NE3A 1CKNA 1J6QA 1HJPA 5JEAJ 4YHHL 3F1ZA 4A76A 2JJQA 2B63H 4BA2I 4JI4Q 3HOWG 1IBML 3E0EA 1KRTA 1YIJA 5JJLA 4A3BG 1N32L 4DUYL 4YWKA 4BY7H 3UE0A 1X6OA 1YVCA 2UXDL 4APVA 3F2CA 3CPWA 1S3OA 2JA7G 1WCMH 1GO3E 1HZAA 5C3EG 2I5HA 3TRZA 2VQEL 1VQIA 3RLOA 4LUOA 4L5TA 1CUKA 2VNUD 2CWPA 1Q7YC 4OXPA 5JJIA 3H3VH 2R6GA 3CCVA 4A3KG 2NN6G 1IYJB 3L0OA 4DK3C 4LF5Q 2HHHQ 3PF4A 1FJGQ 1VQ7A 1EIFA 4GLAC 3ULLA 2VQFL 1X3GA 3NELA 3CAMA 4BY1G 5M5XH 4Y7NH 4DR2Q 1SR3A 3PIPA 1Y1WG 3K7UC 1X9NA 3PO2H 4OWXB 3L2PA 4B3RQ 2Z6KA 1PYBA 1VQ9A 2LSSA 4JI8Q 3FHWA 3T1HL 3W1BA 3RZDH 2QEXA 1VQKA 3S1NH 3ULPA 4TQUS 2MQHA 1RL2A 3MEFA 4JI7L 1OXTA 2E2IH 4UP9A 3ER0A 3CD6A 4IFDI 4DR4Q 1HNZQ 2NVXH 3FKIH 1V9PA 2MO0A 3GO5A 1XMQL 4LNQA 1I50H 4X62Q 4JBJA 1OXVA 3EN2A 4UPAA 4AQYQ 2VW9A 4DV4Q 1VQEA 4DV3Q 1UE6A 1NTGA 4X64L 1YJWA 1QZGA 3TEHB 1N36L 1K8AC 2E5LQ 2FXQA 1Q1BA 1HNXQ 1JJGA 2YTYA 3A5UA 1IBLQ 1EYGA 2UUBQ 2A1AA 1YITA 1PH9A 1N8RC 1E22A 4QJFA 1CSPA 2KHJA 1JE5A 3KDFB 4LWCA 2I0QA 4OX9Q 3SGIA 3Q8DA 3I7FA 2HIVA 1PH8A 1Y14B 4QY7A 4PZ6A 4LFAQ 5IYDG 3RN2A 4A3IH 2ZJQA 2RHQB 2ASBA 3KF8B 1QUQA 4YWMA 4DAMA 1XPRA 1SN8A 4LFBQ 1MJEA 2ALYB 2UU9Q 4JI4L 1XPOA 2JE6I 3CMAA 1K0RA 1PH2A 3TQYA 1R9TH 2MO1A 3S24A 4GNXC 2OTJA 2VS1A 5C0XJ 4LF7Q 1GKHA 4FDBA 5C4XH 2IY5B 5GAHC 1X65A 4LUZA 5IWAQ 3J81i 5GQOA 3I2ZA 1MIUA 1RIPA 3VDYA 1VQ6A 4GN4B 1VQAA 3NENA 3I4MH 2Z0SA 5M3FH 2Q2UA 4GLVB 3S14H 1I5FA 2V1CC 3GTJH 3NBHB 2UUCQ 3UDFA 4DV2Q 4P75A 3OTOQ 3PCOB 4XIGS 4LF5L 2Q2IA 2H5XA 2ZTEA 1I6HH 1FJGL 1EOVA 1NMFA 2A8VA 3JAMc 3J81j 4IPGA 4LW1A 1HZCA 3GTPH 4B3RL 3S1MH 2WB1G 1X3FA 1QZHA 1H95A 1JB7A 4B3TQ 1VQGA 1TWAH 2IHEA 1YNXA 4IPCA 3GDEA 3A0JA 3KF6B 1X55A 1G51A 2Q2HA 5DLQE 4POFA 3CC2A 3D0FA 4A3DH 4YCWA 2UXCL 1XMOQ 3DLLA 2QA4A 1OXSC 2DUDA 4JYAQ 4DV5Q 4PMWA 3PO2G 4O2DA 3KFUA 1E7ZA 1X56A 1YEZA 5JJKA 3AQQA 1N9WA 3H0GH 3L7ZC 3K80C 4X62L 1XNRL 4EX5A 4LFCL 1FVIA 4AQYL 4AYBG 1S72A 5C0XI 3W5OA 3AFQA 4JOIA 1L1OA 4P73A 2E5LL 4JI6L 1HH2P 2CFMA 2WFWA 3KLWA 1HNXL 1IBLL 1PH4A 1UWVA 4O0AA 3I4NG 4HIMA 3M4OH 1B8AA 3CCRA 4YY3Q 2RHSB 1FGUA 1PH6A 1C0AA 3BZKA 3PUXA 3PUZA 1KRSA 5ELNA 4GLXA 4YWLA 1XNQQ 2DGYA 1PH1A 2OQKA 4P72A 1BBUA 1B7YB 5IYCG 2KHIA 5FJ8H 2YV5A 3HOXH 2D0PA 3E9IA 2UU9L 4YCUA 3S1QH 1WFQA 3GTOH 3ERSX 2PI2E 2ZTCA 1JJCB 3CCMA 3PF5A 1N34L 1XPUA 4LF4Q 4LF9Q 4NXNQ 4B3MQ 4HJ8A 5FLMH 1LUZA 1XNRQ 4DR7Q 4JI3L 3B6YA 4R4OA 4HIKA 4LF6L 2IX0A 5GADC 1TXYA 1WYDA 3I56A 4IFDJ 5IWAL 2XGTA 2K5NA 2K75A 3CF5A 4HJ5A 2PQAB 1PA6A 4JV5Q 3CPFA 4DR3L 2IT1A 3E9HA 5AJ3L 2UUAQ 1N33Q 2IX1A 2GVBA 3BU2A 3FP9A 4IPHA 4MZ9A 1GM5A 1IBKQ 1B70B 2YTVA 4JI5Q 3HOYG 4BBSH 1O7IA 1GD7A 5IP7G 4A3CG 2B3GA 4A3FG 4DV2L 4EQ5A 2Y0SG 1VQBA 4GOPA 5JEAG 4AH6A 2WP8J 1EWIA 1EIYB 2NZOA 2JA8H 1EQRA 4IJHA 1M90C 4JI1L 4LUVA 1AE3A 4R4QA 3HOVH 2PNHA 2AKWB 1SROA 4KHPQ 1PV4A 2Z6KC 1VQPA 3I4OA 5IP9H 2XTIA 4BBRH 5C44H 4DV0Q 4A75A 1MJCA 2R7FA 4R4CA 4DUZL 2JA5H 1E1OA 4OWWB 3PO3G 1HR0Q 1L2FA 5BR8L 4NXML 3MXNB 1J5EQ 1C9OA 2LXKA 2B29A 2ZJRA 1KL9A 1BVSA 1I94L 1K3RA 4B3SL 4DPGA 2KCMA 4H02A 2F4VL 4DR6Q 2VZAA 3AFPA 1K73C 1YHAA 3CCJA 4WJ4A 2VUMH 2C35B 2RF4A 5J3BA 3U4ZA 3CXCA 4NPSA 2AWOA 1VQFA 5HGQA 3U58A 4DR5Q 3ULJA 4NB3A 1OTCA 1HZ9A 4YY3L 1XTDA 3TS0A 2OWOA 1HR0W 3S2HH 1XNQL 2ZTDA 1SFOH 5LMNQ 1IL2A 1V1QA 3CQZH 3PV0A 3WWVA 3T1YQ 1AE2A 1I3QH 2R92H 4JG2A 3HOUH 4BXXG 5GAGC 2IHFA 2Q2TA 4GNXB 3HKZG 3UDGA 2VY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU A;  4GKJ Q;  4NXN L;  2EQS A;  4B3M L;  2ATW A;  1D7Q A;  4JI0 Q;  4DR7 L;  1HNW Q;  2R93 G;  2NN6 I;  2YTX A;  4UP8 A;  1VQM A;  1X3E A;  1NMG A;  3HOX G;  2WAQ E;  5LMN W;  2UUA L;  3AYH B;  4PZ7 A;  1UE1 A;  1Q1E A;  4DV6 Q;  4DNI A;  3OW2 A;  1IBK L;  4JI5 L;  2CQO A;  3M4P A;  2B63 G;  1Q8K A;  3RNU A;  4A3G H;  4K0K Q;  4HJ7 A;  1IXR A;  3UE1 A;  3AEV A;  3S17 H;  4C2M H;  2N49 A;  4HIO A;  4A3J H;  2EIF A;  4BY7 G;  4GKK Q;  1D8L A;  4R1J A;  3CCS A;  4KHZ A;  4BBS G;  4OON A;  2HHH L;  3J7Z C;  4J15 A;  3EIV A;  1UEB A;  1WCM G;  2E2H H;  4DR2 L;  2D0O A;  1YHQ A;  5IY0 A;  5C0X G;  3PGZ A;  2JA7 H;  4YHH Q;  2ZJP A;  2I5L X;  5C3E H;  3KDF A;  4IPD A;  4OO1 G;  4KLK A;  1J5E L;  4P71 A;  1A0I A;  4JI8 L;  3CW2 C;  3CCE A;  1ASY A;  3HOV G;  5E7N A;  1N32 Q;  4DUY Q;  4JC0 A;  4UP7 A;  2UXD Q;  2N78 A;  4HID A;  4A3K H;  2OCE A;  2BA1 A;  4ME3 A;  3K81 C;  5C44 G;  3ICE A;  2OTL A;  4JOI C;  1L1O C;  1X54 A;  4L5Q A;  1HNZ L;  4A93 H;  4LF8 Q;  4DR4 L;  1OXX K;  1ASZ A;  2UXB Q;  2BH2 A;  1Y1W H;  4QQB X;  3S16 H;  4DV4 L;  4DV3 L;  3RN5 A;  2YU9 H;  2GN5 A;  1CKN B;  3D31 A;  3ZJY C;  1M1K C;  1P16 A;  1U0L A;  4DKA C;  3HKS A;  4DK6 C;  5LMU Q;  3S1R H;  2F52 A;  2JQO A;  4TVA B;  1VQ4 A;  4OX9 L;  2CCZ A;  4C3J H;  2E2J H;  2VUM G;  1SRU A;  3GTL H;  2VQF Q;  3PSI A;  1G29 1;  3FKI G;  2UXC Q;  4LFA L;  3A74 A;  2ZM6 Q;  3H15 A;  1LYL A;  3CC4 A;  2PI2 A;  4LFB L;  4GN3 B;  2K5V A;  1HNW L;  1A63 A;  1SE8 A;  3K8A A;  3PUW A;  3J7A 5;  4A3L H;  3STB D;  3STB C;  1VQ5 A;  2JEB I;  3RR5 A;  2R92 G;  3M3Y H;  3TS2 A;  2CWA A;  1Q12 A;  1A8V A;  3KJO A;  1KIX A;  1JJ2 A;  4LF7 L;  3IRB A;  4A3I G;  4RG1 A;  2AHO B;  4JBW A;  3S2D H;  3I55 A;  5IYD H;  1Z47 A;  3KF6 A;  4K0K L;  4QIW E;  1UE7 A;  3G4S A;  1N36 Q;  1V43 A;  3S15 H;  4A3E H;  1Q46 A;  4GOP C;  2UUC L;  4GKK L;  4DV7 Q;  2NVY H;  3OTO L;  5C4X G;  1QVC A;  1VQC A;  1VS0 A;  3RLF A;  3UDI A;  4HJ9 A;  5IT9 c;  4A4I A;  2JA9 A;  3KJP A;  1SMX A;  3CCQ A;  3I4M G;  4A3G G;  2AMC B;  4IFD G;  2L15 A;  5M3F G;  1W3S A;  1WOC A;  1PVO A;  3GTM H;  4A3J G;  4IOC A;  1VQH A;  3KYH C;  1YJ9 A;  4B3T L;  2UUB L;  2YYZ A;  2N3S A;  1HZB A;  1KHI A;  4L5S A;  2HIX A;  2HT1 A;  4A93 G;  1XMO L;  3W1G A;  1BKB A;  3U50 C;  2EXD A;  1Y1V H;  4JYA L;  1Q86 C;  4C3H H;  4DV5 L;  2VL6 A;  1Z9F A;  2UXB L;  4LF8 L;  3RZO H;  2D62 A;  5C4J H;  2JEA I;  1PH5 A;  2N8N A;  4IO9 A;  3BZC A;  1DGS A;  4QL5 A;  4XTC S;  4JI2 Q;  2OQ0 A;  4A3D G;  1QUQ B;  1TWG H;  5LMU L;  4DV1 Q;  4A3M H;  2KBN A;  2MNA A;  1EQQ A;  3JAM i;  4POG A;  1YBY A;  2PQA A;  3LGJ A;  1PH3 A;  2K14 A;  1PYS B;  3K0X A;  4QGU A;  4R4I A;  4C3I H;  3J80 c;  3NEM A;  5GAE C;  1JMC A;  5IYB H;  2ZM6 L;  3H0G G;  2BH8 A;  2JA6 H;  2ES2 A;  3HKZ E;  4JCV E;  5M3M H;  1TWC H;  1VQO A;  2E8G A;  2I5M X;  1P8L A;  4PZ8 A;  4UY8 C;  3OYY A;  1NJI C;  1WJJ A;  4LF4 L;  4LF9 L;  1WI5 A;  4GN5 A;  3I4N H;  4DR1 Q;  1A62 A;  4AIM A;  3RLN A;  3PUY A;  3M7N A;  3CP0 A;  4DAY B;  1K9M C;  1CKM A;  3F2B A;  5FJ8 G;  4JV5 L;  1CKO A;  4LFC Q;  4Y52 H;  1N33 L;  4YCV A;  1IZ6 A;  4KI0 A;  5IYC H;  4JI6 Q;  2R7Z H;  2K52 A;  1K83 H;  1QVG A;  5FLM G;  4DV7 L;  3CC7 A;  4R4T A;  4JBK A;  4X65 Q;  1XJV A;  4IJL A;  3M4Q A;  5EAY A;  3HOW H;  2RCN A;  5H1S E;  5HY6 A;  4MNO A;  3JC6 6;  3M9B A;  4ALP A;  4A3E G;  2NZH A;  2NVQ H;  4A3B H;  4BA1 I;  4KHP L;  4X66 Q;  4X6A H;  3HOY H;  4GS3 A;  1N34 Q;  3GTQ H;  2WB1 E;  2BA0 A;  4DV0 L;  1KXL A;  5IP7 H;  4A3C H;  4A3F H;  2R7D A;  1TWH H;  5M5W H;  3U4V A;  3F8T A;  1MKH A;  1L1O B;  1HR0 L;  4JI3 Q;  4LF6 Q;  2QGQ A;  1IBM Q;  2JA8 G;  2NVT H;  2WAQ G;  1TWF H;  3PUV A;  1E3P A;  3GTG H;  1NBW A;  3G6E A;  4HJA A;  4GNX A;  4A3L G;  2HQL A;  1E1T A;  4DR3 Q;  5AJ3 Q;  4RMF A;  2KCT A;  5GRO A;  5IP9 G;  1K8G A;  1KC8 C;  4DR6 L;  2CKZ B;  4BBR G;  4JI2 L;  1VQ8 A;  2JA5 G;  4AYB E;  4DV1 L;  2JK8 A;  2VQE Q;  1LTL A;  4BY1 H;  1GVP A;  3K7A H;  1VQD A;  1YI2 A;  1Y1V G;  3M85 A;  1S40 A;  3DM3 A;  1L0W A;  1U5K A;  1KAW A;  1UE5 A;  3BJU A;  4DR5 L;  3GTK H;  3PO3 H;  2K5H A;  1KD1 C;  5M5Y H;  3EBE A;  1NY4 A;  4JI1 Q;  5LMN L;  4L5R C;  2AWN A;  2F3I A;  4PG3 A;  3TRE A;  3CME A;  1OXU A;  3T1Y L;  1VCI A;  1G6P A;  2A19 A;  3KOJ A;  4A3M G;  1T9H A;  1C7Y A;  5FLX c;  3HOZ G;  5K36 G;  4DUZ Q;  4GKJ L;  2K4K A;  3G71 A;  3A5Z B;  1LM0 A;  1BBW A;  5BR8 Q;  4DR1 L;  4JI0 L;  4NXM Q;  5IYB G;  4OWT B;  3HOZ H;  2JA6 G;  3G48 A;  3T1H Q;  2LXJ A;  5M3M G;  1PHJ A;  1VQJ A;  5IE8 A;  1I94 Q;  4IOA A;  3HOU G;  4GOP B;  1PFS A;  3UDX A;  4B3S Q;  4JI7 Q;  2F4V Q;  1EFW A;  1PH7 A;  3F2D A;  1YHB A;  4DV6 L;  4WJ3 M;  4BXX H;  3PIO A;  2PMZ E;  3J80 i;  4OO1 I;  1XMQ Q;  4JBM A;  1CSQ A;  1FL0 A;  4P74 A;  1E24 A;  3H3V I;  1VQL A;  1AH9 A;  4X64 Q;  1VQN A;  1JT8 A;  3J81 c;  3CCL A;  4X65 L;  3GD7 A;  1EUJ A;  2Y0S E;  1QVF A;  3HFZ B;  4MTN A;  2R93 H;  2MFI A;  1KQS A;  1YZ6 A;  1YJN A;  1Q81 C;  2K50 A;  1SLJ A;  1W2B A;  2R7Z G;  2KEN A;  2GVA A;  5ELO A;  4X66 L;  2ID0 A;  1Q82 C;  1NE3 A;  1CKN A;  1J6Q A;  1HJP A;  5JEA J;  4YHH L;  3F1Z A;  4A76 A;  2JJQ A;  2B63 H;  4BA2 I;  4JI4 Q;  3HOW G;  1IBM L;  3E0E A;  1KRT A;  1YIJ A;  5JJL A;  4A3B G;  1N32 L;  4DUY L;  4YWK A;  4BY7 H;  3UE0 A;  1X6O A;  1YVC A;  2UXD L;  4APV A;  3F2C A;  3CPW A;  1S3O A;  2JA7 G;  1WCM H;  1GO3 E;  1HZA A;  5C3E G;  2I5H A;  3TRZ A;  2VQE L;  1VQI A;  3RLO A;  4LUO A;  4L5T A;  1CUK A;  2VNU D;  2CWP A;  1Q7Y C;  4OXP A;  5JJI A;  3H3V H;  2R6G A;  3CCV A;  4A3K G;  2NN6 G;  1IYJ B;  3L0O A;  4DK3 C;  4LF5 Q;  2HHH Q;  3PF4 A;  1FJG Q;  1VQ7 A;  1EIF A;  4GLA C;  3ULL A;  2VQF L;  1X3G A;  3NEL A;  3CAM A;  4BY1 G;  5M5X H;  4Y7N H;  4DR2 Q;  1SR3 A;  3PIP A;  1Y1W G;  3K7U C;  1X9N A;  3PO2 H;  4OWX B;  3L2P A;  4B3R Q;  2Z6K A;  1PYB A;  1VQ9 A;  2LSS A;  4JI8 Q;  3FHW A;  3T1H L;  3W1B A;  3RZD H;  2QEX A;  1VQK A;  3S1N H;  3ULP A;  4TQU S;  2MQH A;  1RL2 A;  3MEF A;  4JI7 L;  1OXT A;  2E2I H;  4UP9 A;  3ER0 A;  3CD6 A;  4IFD I;  4DR4 Q;  1HNZ Q;  2NVX H;  3FKI H;  1V9P A;  2MO0 A;  3GO5 A;  1XMQ L;  4LNQ A;  1I50 H;  4X62 Q;  4JBJ A;  1OXV A;  3EN2 A;  4UPA A;  4AQY Q;  2VW9 A;  4DV4 Q;  1VQE A;  4DV3 Q;  1UE6 A;  1NTG A;  4X64 L;  1YJW A;  1QZG A;  3TEH B;  1N36 L;  1K8A C;  2E5L Q;  2FXQ A;  1Q1B A;  1HNX Q;  1JJG A;  2YTY A;  3A5U A;  1IBL Q;  1EYG A;  2UUB Q;  2A1A A;  1YIT A;  1PH9 A;  1N8R C;  1E22 A;  4QJF A;  1CSP A;  2KHJ A;  1JE5 A;  3KDF B;  4LWC A;  2I0Q A;  4OX9 Q;  3SGI A;  3Q8D A;  3I7F A;  2HIV A;  1PH8 A;  1Y14 B;  4QY7 A;  4PZ6 A;  4LFA Q;  5IYD G;  3RN2 A;  4A3I H;  2ZJQ A;  2RHQ B;  2ASB A;  3KF8 B;  1QUQ A;  4YWM A;  4DAM A;  1XPR A;  1SN8 A;  4LFB Q;  1MJE A;  2ALY B;  2UU9 Q;  4JI4 L;  1XPO A;  2JE6 I;  3CMA A;  1K0R A;  1PH2 A;  3TQY A;  1R9T H;  2MO1 A;  3S24 A;  4GNX C;  2OTJ A;  2VS1 A;  5C0X J;  4LF7 Q;  1GKH A;  4FDB A;  5C4X H;  2IY5 B;  5GAH C;  1X65 A;  4LUZ A;  5IWA Q;  3J81 i;  5GQO A;  3I2Z A;  1MIU A;  1RIP A;  3VDY A;  1VQ6 A;  4GN4 B;  1VQA A;  3NEN A;  3I4M H;  2Z0S A;  5M3F H;  2Q2U A;  4GLV B;  3S14 H;  1I5F A;  2V1C C;  3GTJ H;  3NBH B;  2UUC Q;  3UDF A;  4DV2 Q;  4P75 A;  3OTO Q;  3PCO B;  4XIG S;  4LF5 L;  2Q2I A;  2H5X A;  2ZTE A;  1I6H H;  1FJG L;  1EOV A;  1NMF A;  2A8V A;  3JAM c;  3J81 j;  4IPG A;  4LW1 A;  1HZC A;  3GTP H;  4B3R L;  3S1M H;  2WB1 G;  1X3F A;  1QZH A;  1H95 A;  1JB7 A;  4B3T Q;  1VQG A;  1TWA H;  2IHE A;  1YNX A;  4IPC A;  3GDE A;  3A0J A;  3KF6 B;  1X55 A;  1G51 A;  2Q2H A;  5DLQ E;  4POF A;  3CC2 A;  3D0F A;  4A3D H;  4YCW A;  2UXC L;  1XMO Q;  3DLL A;  2QA4 A;  1OXS C;  2DUD A;  4JYA Q;  4DV5 Q;  4PMW A;  3PO2 G;  4O2D A;  3KFU A;  1E7Z A;  1X56 A;  1YEZ A;  5JJK A;  3AQQ A;  1N9W A;  3H0G H;  3L7Z C;  3K80 C;  4X62 L;  1XNR L;  4EX5 A;  4LFC L;  1FVI A;  4AQY L;  4AYB G;  1S72 A;  5C0X I;  3W5O A;  3AFQ A;  4JOI A;  1L1O A;  4P73 A;  2E5L L;  4JI6 L;  1HH2 P;  2CFM A;  2WFW A;  3KLW A;  1HNX L;  1IBL L;  1PH4 A;  1UWV A;  4O0A A;  3I4N G;  4HIM A;  3M4O H;  1B8A A;  3CCR A;  4YY3 Q;  2RHS B;  1FGU A;  1PH6 A;  1C0A A;  3BZK A;  3PUX A;  3PUZ A;  1KRS A;  5ELN A;  4GLX A;  4YWL A;  1XNQ Q;  2DGY A;  1PH1 A;  2OQK A;  4P72 A;  1BBU A;  1B7Y B;  5IYC G;  2KHI A;  5FJ8 H;  2YV5 A;  3HOX H;  2D0P A;  3E9I A;  2UU9 L;  4YCU A;  3S1Q H;  1WFQ A;  3GTO H;  3ERS X;  2PI2 E;  2ZTC A;  1JJC B;  3CCM A;  3PF5 A;  1N34 L;  1XPU A;  4LF4 Q;  4LF9 Q;  4NXN Q;  4B3M Q;  4HJ8 A;  5FLM H;  1LUZ A;  1XNR Q;  4DR7 Q;  4JI3 L;  3B6Y A;  4R4O A;  4HIK A;  4LF6 L;  2IX0 A;  5GAD C;  1TXY A;  1WYD A;  3I56 A;  4IFD J;  5IWA L;  2XGT A;  2K5N A;  2K75 A;  3CF5 A;  4HJ5 A;  2PQA B;  1PA6 A;  4JV5 Q;  3CPF A;  4DR3 L;  2IT1 A;  3E9H A;  5AJ3 L;  2UUA Q;  1N33 Q;  2IX1 A;  2GVB A;  3BU2 A;  3FP9 A;  4IPH A;  4MZ9 A;  1GM5 A;  1IBK Q;  1B70 B;  2YTV A;  4JI5 Q;  3HOY G;  4BBS H;  1O7I A;  1GD7 A;  5IP7 G;  4A3C G;  2B3G A;  4A3F G;  4DV2 L;  4EQ5 A;  2Y0S G;  1VQB A;  4GOP A;  5JEA G;  4AH6 A;  2WP8 J;  1EWI A;  1EIY B;  2NZO A;  2JA8 H;  1EQR A;  4IJH A;  1M90 C;  4JI1 L;  4LUV A;  1AE3 A;  4R4Q A;  3HOV H;  2PNH A;  2AKW B;  1SRO A;  4KHP Q;  1PV4 A;  2Z6K C;  1VQP A;  3I4O A;  5IP9 H;  2XTI A;  4BBR H;  5C44 H;  4DV0 Q;  4A75 A;  1MJC A;  2R7F A;  4R4C A;  4DUZ L;  2JA5 H;  1E1O A;  4OWW B;  3PO3 G;  1HR0 Q;  1L2F A;  5BR8 L;  4NXM L;  3MXN B;  1J5E Q;  1C9O A;  2LXK A;  2B29 A;  2ZJR A;  1KL9 A;  1BVS A;  1I94 L;  1K3R A;  4B3S L;  4DPG A;  2KCM A;  4H02 A;  2F4V L;  4DR6 Q;  2VZA A;  3AFP A;  1K73 C;  1YHA A;  3CCJ A;  4WJ4 A;  2VUM H;  2C35 B;  2RF4 A;  5J3B A;  3U4Z A;  3CXC A;  4NPS A;  2AWO A;  1VQF A;  5HGQ A;  3U58 A;  4DR5 Q;  3ULJ A;  4NB3 A;  1OTC A;  1HZ9 A;  4YY3 L;  1XTD A;  3TS0 A;  2OWO A;  1HR0 W;  3S2H H;  1XNQ L;  2ZTD A;  1SFO H;  5LMN Q;  1IL2 A;  1V1Q A;  3CQZ H;  3PV0 A;  3WWV A;  3T1Y Q;  1AE2 A;  1I3Q H;  2R92 H;  4JG2 A;  3HOU H;  4BXX G;  5GAG C;  2IHF A;  2Q2T A;  4GNX B;  3HKZ G;  3UDG A;  2VY3 A; 
#chains in the Genus database with same CATH topology
 1I3Q B;  4NXN L;  4CDF C;  2L0C A;  1D7Q A;  4DR7 L;  4X3K A;  1HHV A;  2EY6 A;  5ELD A;  1FNV A;  1NMG A;  2F0G A;  3HOX G;  5LMN W;  2WAC A;  1UE1 A;  4KN7 C;  3T53 B;  3M4P A;  4XQN A;  1Q8K A;  2M9V A;  4UHV A;  1EZ8 A;  5BN4 A;  1TKW B;  1IXR A;  5G3L D;  1WTQ A;  3S17 H;  1A3U A;  1MI2 A;  4C2M H;  5I6W A;  4HIO A;  4BY7 G;  1Q8I A;  4QMG A;  4R1J A;  3QOJ A;  4CBV A;  4KHZ A;  4BBS G;  4OHJ A;  4DR2 L;  1YHQ A;  5IY0 A;  3PGZ A;  4HMI A;  4N8F A;  3KDF A;  4CDC C;  4OO1 G;  4EQP A;  2PQE A;  5E1F A;  4QUC A;  2B2T A;  4QIW B;  2ICI A;  3CHB D;  3KF8 A;  2UXD Q;  1QNU A;  4A3K H;  4G7Z C;  1Q3L A;  1SE2 A;  4DR4 L;  1OXX K;  5C6A A;  1BCP B;  1U4M A;  2O2L D;  4DV4 L;  4DV3 L;  5FO9 B;  3NHH A;  1CKN B;  3D31 A;  4DK1 A;  3HKS A;  4DK6 C;  3S1R H;  3NTH A;  4OX9 L;  4MIU A;  2KOL A;  4CHT B;  3EFX D;  3FMC A;  2VQF Q;  1G29 1;  2ZM6 Q;  2B39 A;  4C3J B;  3GTL B;  3H15 A;  1G2T A;  2PI2 A;  5IGB A;  1LLR D;  3D3R A;  3J7A 5;  4A3L H;  3STB D;  1R4P B;  3MVV A;  1IW7 D;  4ZUJ A;  2SEB D;  3HOZ B;  1Q12 A;  5JAV A;  1STG A;  4A3I G;  4RG1 A;  3S2D H;  5IYD H;  1A2T A;  1Z47 A;  4DAP A;  2H1E A;  5ELE A;  2CVR A;  4A3E H;  3FPU B;  1NR4 A;  1QVC A;  2F0J A;  1B50 A;  3UDI A;  4HJ9 A;  1SBB B;  3QWN A;  3VR2 A;  5IT9 c;  3KJP A;  1SMX A;  1ZEQ X;  3CCQ A;  2WKC A;  3V05 A;  4DXG A;  4FF1 A;  4IFD G;  1WOC A;  2Q8R E;  3KYH C;  4OIK A;  4XYO A;  2N3S A;  1HZB A;  4CKE A;  2FMM A;  1QCB D;  1ZYR C;  5CV9 A;  1BKB A;  4JYA L;  4DV5 L;  1LTT D;  3FVQ A;  5C4J H;  5E4X A;  2N8N A;  3C1E A;  1RTN A;  1DGS A;  4XTC S;  5EQ0 A;  2OQ0 A;  4OEL B;  1QUQ B;  3TZD A;  2KBN A;  1IKM A;  3KLR A;  2WB1 B;  5KYI A;  1KNE A;  3NEM A;  2ZM6 L;  3HKZ E;  1EL0 A;  5M3M H;  3VYU A;  4H44 C;  1HFG A;  2I5M X;  3KUP A;  1P8L A;  5M9O A;  5EGT A;  4AYB B;  3TBI B;  3RZD B;  3PUY A;  2B2V C;  1UUP A;  1U4L A;  3A54 A;  1CKM A;  3URY A;  4RCN A;  1NNX A;  1IZ6 A;  5IYC H;  1A6X A;  1I50 B;  2EYH A;  1EYC A;  3MXN A;  2K52 A;  4XQQ A;  4ID6 A;  1NCV A;  3CC7 A;  4R4T A;  4IJL A;  2A73 B;  5JPM C;  3JC6 6;  3M9B A;  4X6A H;  1QE6 A;  1N34 Q;  3HOY H;  4DV0 L;  4KMU C;  1ICW A;  5M5W H;  4LF6 Q;  1KLU D;  3F8T A;  1PTO D;  2NVT H;  4J8Q A;  2WAQ G;  2A5H A;  3GTG H;  4HJA A;  1JE4 A;  1S5B D;  1I4H A;  1E1T A;  4DR3 Q;  1TWF B;  1MSH A;  2KCT A;  1K8G A;  3SXH A;  2CKZ B;  4BBR G;  2B2U C;  2Z8L A;  3GV3 A;  1GVP A;  3K7A H;  1PFM A;  1O7Z A;  1Y1V G;  3S14 B;  1U5K A;  1UE5 A;  3BJU A;  3DXJ C;  3M7G A;  5IGE A;  3GTK H;  4FNF A;  2L5T A;  4JI1 Q;  2NTS A;  2AWN A;  2F3I A;  4G7O C;  1BF4 A;  1VCI A;  3O13 A;  5FLX c;  3S1M B;  4KD4 A;  1H9M A;  4NXM Q;  1RF2 D;  5IYB G;  3ONA B;  4OWT B;  1T5E A;  4A3D B;  1ET6 A;  1VQJ A;  1B9M A;  4B08 A;  2PZU A;  3F2D A;  1AEX A;  1CFM A;  5AFW A;  2A74 C;  3DWQ A;  4EQN A;  4P74 A;  1E24 A;  1VQL A;  2Y0S E;  3M4O B;  3HFZ B;  1B44 D;  4MTN A;  1YJN A;  3PQI A;  1SLJ A;  2R7Z G;  5ELO A;  3NWS A;  3OMC A;  1AZQ A;  1Q82 C;  3L3O C;  1CKN A;  3MXP A;  3J81 L;  1HQM C;  5CBA E;  4E6I A;  4JI4 Q;  1Y69 U;  3HOW G;  5IOC A;  4RA8 A;  1KRT A;  1A3T A;  1A15 A;  1PYW D;  4RCO A;  5JJL A;  4L6T B;  4BY7 H;  5D14 A;  1S5C D;  1HZA A;  4K5W A;  1VQI A;  4PMB A;  3RLO A;  4L5T A;  2B2Y C;  2B8G A;  1WCM B;  1SYD A;  4OO1 H;  1TS5 A;  3H3V H;  4P2C B;  2M2L A;  3L0O A;  1FJG Q;  1VQ7 A;  3QR8 A;  1X3G A;  3EJI A;  3CAM A;  4OIJ A;  4Y7N H;  3HOV B;  3PO2 H;  1SNQ A;  2Z6K A;  1IHZ A;  4YIJ A;  4IUN A;  1KDB A;  1AP0 A;  1WTO A;  5KIX A;  1DXM A;  3LNN A;  5FOB B;  2E2I H;  1UEA B;  3CD6 A;  2E76 C;  5D3I B;  4R8N A;  1HNZ Q;  3GO5 A;  2VUM B;  1F2Z A;  3FKI B;  1K8A C;  1O7Y A;  2E5L Q;  1JJG A;  4RGT A;  3NP8 A;  2G9D A;  4MN3 A;  2PZW A;  1E22 A;  2I0Q A;  3M4Y A;  1SFO B;  1V1P B;  4QY7 A;  1EY6 A;  4LFA Q;  4A3I H;  2Z1C A;  1PXU A;  1LTR D;  1SJH D;  1QUQ A;  2KJX A;  1LAC A;  2RBM A;  4KKS A;  3U9O A;  4JI4 L;  1C48 A;  5IGF A;  3J81 E;  4KY5 A;  3CMA A;  1GUN A;  3TQY A;  2MO1 A;  4LF7 Q;  4FDB A;  2IY5 B;  2TSS A;  4CKC A;  5ELF A;  5IWA Q;  1UAP A;  1RIP A;  1SYF A;  3BVM A;  3QOL A;  4GN4 B;  2WII B;  3K58 A;  4IFD H;  1G8Z D;  2Q2U A;  3I4M B;  1CZW A;  4GLV B;  3NK9 A;  2Z6B A;  4N9T A;  3GTJ H;  3NBH B;  3NUC A;  4Q5V A;  4DV2 Q;  4HTH A;  4P75 A;  3S17 B;  1FJG L;  1NMF A;  2K01 A;  4ZUI A;  3JAM c;  4DK0 A;  2ZXR A;  4MTK A;  4K8J A;  1X3F A;  3CKI B;  1JB7 A;  1VQG A;  1TWA H;  2IHE A;  1YNX A;  5CV5 A;  3GDE A;  3KF6 B;  2UUB Q;  1X55 A;  2Q2H A;  1OXS C;  4HAE A;  2VXW A;  1FNU A;  2LKV A;  3L7Z C;  1PRT F;  5K5P A;  4EX5 A;  4JOI A;  5A2Q L;  2E5L L;  4JI6 L;  3QB3 A;  3KLW A;  3TP5 A;  3K59 A;  3NQI A;  4EGV A;  5T1G A;  3J7A F;  1PH6 A;  5ELN A;  1KRS A;  4K8I A;  2MUY A;  1GUT A;  1U4P A;  3E9I A;  1Y8O B;  4KN4 C;  4LF4 Q;  4LF9 Q;  1A3V A;  2E2D C;  2QDL A;  4HJ8 A;  1RD9 D;  4HIK A;  4R4O A;  2IX0 A;  1TXY A;  1STN A;  5IWA L;  4HJ5 A;  2PQA B;  2UUA Q;  2ENB A;  2IT1 A;  3TDQ A;  5AJ3 L;  2IX1 A;  1ENA A;  3S2D B;  2K1B A;  2YTV A;  5E3F A;  2D5D A;  2B3G A;  4A3E B;  4DV2 L;  1VQB A;  1GUW A;  2AQ1 B;  1EIY B;  4IJH A;  1M90 C;  1JCK B;  1AE3 A;  4R4Q A;  1I4X A;  1PV4 A;  1VQP A;  3OWE B;  5COY A;  4BBR H;  1CM9 A;  4QUF A;  4A75 A;  4DUZ L;  1E1O A;  1RJT A;  4FF3 A;  5EJW A;  1HR0 Q;  5BR8 L;  2B29 A;  3MFG A;  1I94 L;  2FIN B;  2PPB C;  2F3W A;  1SYG A;  2FJ2 A;  3DWP A;  3DM1 A;  4H02 A;  4DPG A;  4B3S L;  2F4V L;  4DR6 Q;  4WJ4 A;  5EPJ A;  2CH4 W;  2K05 A;  4C1N K;  2AWO A;  3U58 A;  3ULJ A;  4NB3 A;  5CBE E;  1XTD A;  4X3U A;  4I7A A;  2Z4I A;  1IL2 A;  2I46 A;  3CQZ H;  2R92 H;  3X3N A;  2K28 A;  5GAG C;  5F2D A;  3DHQ A;  3HKZ G;  2A6E D;  5M3M B;  1YNN D;  5I9P A;  2EQS A;  4JI0 Q;  2R93 G;  2NN6 I;  2YTX A;  1X3E A;  4GZY C;  2WAQ E;  4DXF A;  2UUA L;  4PZ7 A;  2BDN A;  4DNI A;  1QB5 D;  3BYY B;  3F2U A;  3RNU A;  4A3G H;  4K0K Q;  1SMY C;  3C1F A;  3AEV A;  1D5X C;  4GKK Q;  5CV4 A;  1SSO A;  3CCS A;  3EIV A;  2E2H H;  1PDQ A;  1XTC D;  2D0O A;  4XQJ A;  2L4N A;  2BE5 C;  3HOY B;  1VF5 C;  3N6R A;  2JA7 B;  2IPK D;  2QW7 A;  2XNA C;  5CGK A;  1V1P A;  2R61 A;  1UNS A;  4JI8 L;  5C3E B;  5KRU A;  3CCE A;  2N78 A;  4HID A;  3GTG B;  5JVG 3;  5C44 G;  2OTL A;  1L1O C;  4LF8 Q;  2BH2 A;  3KLS X;  3RN5 A;  2M00 A;  4A93 B;  1Y1W B;  3A55 A;  4KY6 A;  1M1K C;  4DKA C;  4JK1 C;  2F52 A;  2CCZ A;  4F8M A;  1BCP D;  5FKA C;  2HQE A;  5BN3 A;  1SXT A;  2E2J B;  3NBH A;  1LYL A;  4LFB L;  2K5V A;  1QIL A;  1W6K A;  4LAA A;  4QF4 A;  3TS2 A;  3PMF A;  1JJ2 A;  3IRB A;  3K5M A;  3QG1 A;  3BS1 A;  1VMP A;  3LX0 A;  4HED A;  3KF6 A;  1Z6H A;  1D5Z C;  4K0K L;  1XYI A;  1V43 A;  1N36 Q;  1XWE A;  5KYL A;  2HD3 A;  5DM6 3;  2UUC L;  4GKK L;  3MAQ A;  4F87 A;  3HRZ C;  1VQC A;  2EOT A;  2EY1 A;  4XYQ A;  2F0V A;  3RLF A;  2RDG A;  1PZI D;  4A4I A;  2JA9 A;  4RFB A;  5IGG A;  1SDF A;  5M3F G;  4G4K A;  4A3J G;  1PRT C;  4B3T L;  1LTI D;  2F03 A;  5IT9 L;  2HT1 A;  3W1G A;  3U50 C;  1LTG D;  4ILW A;  4C3H H;  1NSN S;  3TME A;  1Q86 C;  4DGZ A;  2B2W C;  4LF8 L;  4FF2 A;  4K5X A;  3RZO H;  3KBG A;  4IUU A;  3ZYY X;  3UI2 A;  4N8X 1;  4DV1 Q;  4A3M H;  1LV9 A;  2Z4H A;  1ROD A;  3LGJ A;  2PQA A;  2SDF A;  2K14 A;  3K0X A;  1TWG B;  3J80 c;  5GAE C;  1JMC A;  3I8Z A;  4IUR A;  5EKL A;  2A69 C;  2JA6 H;  2AUJ D;  3HEJ A;  4JCV E;  4Y7N B;  1TWC H;  1VQO A;  2E8G A;  3PO2 B;  4KY7 A;  4PZ8 A;  3H3V C;  1HFN A;  3OYY A;  1WJJ A;  1WI5 A;  1BBX C;  2JYO A;  3RLN A;  1DOL A;  3NQT A;  2VB3 X;  4JV5 L;  4LFC Q;  4YCV A;  3MC0 B;  2IWH A;  1K83 H;  3OOC A;  5FLM G;  4N9P A;  2X6G A;  4JBK A;  3NTI A;  5HY6 A;  4ALP A;  3MXU A;  2NZH A;  4JW0 A;  4A3I B;  2NVQ H;  4BA1 I;  4A3B H;  4X66 Q;  1WD1 A;  4GS3 A;  5J22 A;  3GTQ H;  2O5J C;  1KXL A;  4K6D A;  3I72 A;  1IBM Q;  1CI3 M;  3R93 A;  3P75 A;  1E3P A;  5KGU A;  5IT9 E;  3G6E A;  2EYP A;  2HQL A;  2GA4 B;  1EYA A;  4RMF A;  1ENC A;  5GRO A;  5IP9 G;  1KC8 C;  2JA5 G;  1IKL A;  3QJY A;  2JK8 A;  4DV1 L;  4BY1 H;  4LJZ C;  5C5M A;  1L0W A;  1II3 A;  3GTJ B;  2PZT A;  4NDX A;  5M5Y H;  2EJM A;  5EPL A;  1NY4 A;  4X3S A;  3PO3 B;  2KEE A;  1OXU A;  2TMP A;  3NSW A;  3T1Y L;  1A2U A;  1T9H A;  1GHK A;  4OL7 A;  5C4Z A;  3G71 A;  1EY7 A;  5JOB A;  2EYO A;  2PYK A;  1Y8P B;  4L63 B;  5IE8 A;  2E74 C;  4FVM A;  3UDX A;  4JI7 Q;  2QEJ C;  1EFW A;  1PH7 A;  1HUN A;  2Q8I B;  2PMZ E;  3J80 i;  1CSQ A;  4I7Z C;  1SNC A;  1O78 A;  1AH9 A;  1JWU D;  4X64 Q;  1VQN A;  4PNY A;  3GD7 A;  2R93 H;  2MFI A;  1Q81 C;  2K50 A;  1PZJ D;  2KEN A;  5CMD A;  1DJR D;  1FD7 D;  4X66 L;  2ID0 A;  4IN3 A;  4TSS A;  2NWG A;  2CH4 A;  5JEA J;  1ILP A;  3DEO A;  1EWC A;  1IBM L;  3E0E A;  4IUV A;  2B63 B;  1S5F D;  2UXD L;  4APV A;  4M1U B;  3F2C A;  1HUM A;  3CPW A;  1S3O A;  4J1M A;  3IKJ A;  5IIF A;  3TRZ A;  1CUK A;  3LWE A;  2CWP A;  1LTA D;  4OXP A;  2A6H D;  4DU9 A;  3D4R A;  3CCV A;  2NN6 G;  4FF4 A;  1IYJ B;  4DK3 C;  2HHH Q;  5J39 A;  4IQZ A;  4GLA C;  2VQF L;  1K73 C;  5EKK A;  1OTC A;  1SR3 A;  4RKB A;  3L2P A;  1NUC A;  2ZXP A;  4BBR B;  2J4X A;  1B3Q A;  4K2L A;  3FHW A;  3Q22 A;  2QEX A;  2F0T A;  3OWF A;  3A7A B;  4C3J G;  2H4O A;  4JI7 L;  1OXT A;  4UP9 A;  2K03 A;  3K6O A;  4HSV A;  5FLX E;  1EIH A;  4LNQ A;  2KEC A;  4UPA A;  1QZG A;  3HOZ G;  1YJW A;  1UE6 A;  2NVX B;  1EEF D;  5CV7 A;  4X64 L;  1JOR A;  1D2B A;  2FXQ A;  3WDN A;  1YIT A;  4S3S A;  3MHB A;  2RCF A;  1K8M A;  4LWC A;  1TQO A;  3SGI A;  3Q8D A;  3I7F A;  1EQT A;  1Y14 B;  2E75 C;  3CQZ B;  4PZ6 A;  3MEH A;  2EJG C;  5CV8 A;  2R92 B;  1EFI D;  2A68 D;  3TSS A;  4DFA A;  4DAM A;  3DWA A;  1XPO A;  1G2S A;  2ZT9 C;  3T13 A;  1R9T H;  4GNX C;  5C0X J;  4ME5 A;  1MD2 D;  4LUZ A;  2F0D A;  5GQO A;  5JJZ A;  4XDX A;  3VDY A;  1SYE A;  1VQ6 A;  5C4X B;  1BQQ T;  1CQF A;  5M3F H;  3D4D A;  2V1C C;  4A3G B;  3UDF A;  2OEO A;  4NP5 A;  4R8I A;  3P20 A;  3OTO Q;  2Q2I A;  2H5X A;  2VB2 X;  2ZTE A;  1DM0 B;  1EOV A;  1SJE D;  3P7J A;  2A8V A;  1MBY A;  1HZC A;  1WVL A;  2WB1 G;  1QZH A;  1I4P A;  3E6Z X;  1H95 A;  3V96 A;  1PZK D;  3SK8 A;  3OIQ A;  4POF A;  4YCW A;  1XMO Q;  4C3I G;  2QA4 A;  3A8K E;  4O2D A;  3KFU A;  5JJK A;  3K80 C;  1STE A;  4RWS C;  4AYB G;  3BDC A;  2F0P A;  4P73 A;  4RAU C;  1XPU A;  1HH2 P;  2CFM A;  3H0G B;  1UWV A;  4O0A A;  3I4N G;  4RKL A;  2CHB D;  1B8A A;  3CCR A;  3BZK A;  1XNQ Q;  4DF7 A;  1DD2 A;  1E2V A;  4F88 A;  2OQK A;  1YNJ D;  1B7Y B;  4KD3 A;  3S1Q H;  3HOX H;  3PIO 3;  1WFQ A;  3GTO H;  1SND A;  2PI2 E;  2ZTC A;  1JJC B;  1STH A;  3CCM A;  1N34 L;  1IW7 C;  1X3Q A;  4B3M Q;  2NUC A;  5FLM H;  1LUZ A;  4ZQ3 A;  2XWJ B;  3B6Y A;  4LF6 L;  1OO9 B;  1BOS A;  1GUG A;  5GAD C;  4PV1 C;  2K75 A;  3DMU A;  2RSN A;  3CF5 A;  1BDO A;  2EY5 A;  4DR3 L;  1N33 Q;  3M7N A;  2GVB A;  1IBK Q;  2L55 A;  4JI5 Q;  2XVS A;  4BBS H;  1O7I A;  3GQB A;  3NE5 B;  3ND9 A;  4A3C G;  3R2T A;  2WV6 D;  3Q0A A;  4A3F G;  4KJO A;  4XT1 B;  4EQ5 A;  5C3W A;  5JEA G;  1EWI A;  2MJ8 A;  2NZO A;  1L0Y B;  1CHP D;  3FRP B;  4ZKB B;  4JI1 L;  1CTM A;  4NKL A;  2JA8 B;  3CRL C;  4KHP Q;  5D65 A;  5IP9 H;  1RDP D;  2AUK A;  2R7F A;  2JA5 H;  2G5D A;  1HTL D;  4NXM L;  2K5Q A;  1C9O A;  2LXK A;  4ULL A;  4EVO A;  2F0H A;  3JAM E;  1KL9 A;  1BVS A;  2RDH A;  4C3H B;  2RSO A;  2OTJ A;  2KCM A;  2MPM A;  1QJO A;  3CCJ A;  3RZO B;  5FO8 B;  2F0I A;  2RF4 A;  4IUQ A;  3CXC A;  4NPS A;  2IX3 A;  4JPB W;  1VQF A;  1PFN A;  4DR5 Q;  1KDA A;  3SK6 A;  2QCP X;  4MHE A;  4A3M B;  3OHX C;  1XNQ L;  5LMN Q;  2LMC B;  1K8O A;  3PV0 A;  3WWV A;  1I3Q H;  1E2W A;  1RHP A;  1W6J A;  3TZU A;  2JA6 B;  2IHF A;  2ICE C;  5C5L A;  2KCC A;  4GKJ Q;  2MHV A;  4B3M L;  1J8I A;  1LT4 D;  1EEI D;  3FPP A;  2EYM A;  1VQM A;  2K5D A;  3TP6 A;  4RGM A;  3AYH B;  1Q1E A;  2C9O A;  4DV6 Q;  2B2V A;  1IBK L;  4JI5 L;  2CQO A;  5I9O A;  2B8F A;  2X6L A;  1TS2 A;  1XX8 A;  4HJ7 A;  1SMY D;  3Q23 A;  3T56 B;  3UE1 A;  3D6C A;  4FP5 D;  2ZXO A;  3VYR A;  2JSO A;  4OON A;  4C2M B;  3KBX A;  3VR3 A;  1UEB A;  1WCM G;  3HP3 A;  5C0X G;  4A3B B;  1R4Q B;  2NVQ B;  4YHH Q;  2ZJP A;  3G6J B;  1EOT A;  5LL6 X;  3GTQ B;  1PTO C;  5J1Z A;  5ELB A;  4KLK A;  4P71 A;  1SNP A;  2BDO A;  1V8Q A;  1ASY A;  3HOV G;  5E7N A;  3U9S A;  4DUY Q;  1N32 Q;  3ERQ A;  4UP7 A;  5ELC A;  2JP1 A;  2LY7 A;  4K2K A;  2NN6 H;  2BA1 A;  1S4Z A;  3ICE A;  1LT3 D;  2QIL A;  1HNZ L;  4A3K B;  2UXB Q;  1H9S B;  3SHL A;  2B2U A;  2YU9 H;  3ZJY C;  4BY1 B;  1U0L A;  5LMU Q;  2NB0 A;  4RH6 A;  2JQO A;  3OPO A;  1BO0 A;  4C3J H;  3GTL H;  2VUM G;  1SRU A;  4U68 A;  3PSI A;  3FKI G;  3S1R B;  2UXC Q;  4LFA L;  3A74 A;  4H7B A;  3CC4 A;  1A63 A;  5C3X A;  3K8A A;  4CJ1 B;  1STY A;  2RDF A;  3IFT A;  2JEB I;  1HA5 A;  3OMG A;  2NTT A;  3OIP A;  2NZ1 D;  3M3Y H;  1M4V A;  1KIX A;  4LF7 L;  5DM7 3;  3I55 A;  1F2M A;  4QIW E;  3HKZ B;  4JVZ A;  1GUO A;  4GOP C;  1L0X B;  5ISR A;  2R93 B;  1VS0 A;  1JOO A;  3I4M G;  5E4W C;  4ODG A;  2AMC B;  1CK1 A;  1W3S A;  1PVO A;  3SVM A;  4IOC A;  1PRT D;  5CV6 A;  2YYZ A;  1GUS A;  2UUB L;  3X3M A;  1KHI A;  4L5S A;  5A35 A;  2XIW A;  1Y1V H;  4Q0F A;  4H0L C;  1Z9F A;  2UXB L;  2D62 A;  2JEA I;  5I4D A;  2NBF A;  1PH5 A;  2K33 A;  2QKI C;  3E5S A;  5C4J B;  3BZC A;  1CQV A;  4JI2 Q;  4UDU C;  1ILQ A;  5LMU L;  1EQQ A;  2B2Y A;  3JAM i;  1PH3 A;  3E0J A;  4C3I H;  5IYB H;  2A69 D;  2IJ0 A;  2D9U A;  3HG9 A;  2F0E A;  1Q90 A;  1F77 A;  4UY8 C;  1TR5 A;  2L11 A;  3J80 L;  4LF4 L;  4LF9 L;  3I4N H;  3L9A X;  1JQY D;  4AIM A;  2F0Q A;  3CP0 A;  1D5M C;  4DAY B;  1K9M C;  3F2B A;  3EA6 A;  1CKO A;  4QCL A;  4KTA A;  4KI0 A;  2R7Z H;  1QVG A;  1AN8 A;  1PLF A;  1LO5 D;  2F0K A;  4X65 Q;  2F0W A;  3HOW H;  3MZ5 A;  2RCN A;  3MA2 B;  5H1S E;  2F0M A;  3VR5 A;  4A3E G;  1WD0 A;  1NR2 A;  2WB1 E;  2BA0 A;  2B2T C;  4ZLT F;  4A3C H;  4A3F H;  2R7D A;  1TWH H;  4JI3 Q;  1GOZ A;  3U4V A;  1MKH A;  1L1O B;  1SEB D;  1HR0 L;  2QGQ A;  4WRD A;  2MGS A;  1HQR D;  1TWF H;  5JEA H;  1GHJ A;  5M5W B;  2Y0S B;  2NVT B;  1F9P A;  3A8J E;  2DY7 A;  4DR6 L;  5IGC A;  1I4Q A;  1KAA A;  1VQ8 A;  4AYB E;  4JI2 L;  5IGD A;  2VQE Q;  3HS0 C;  1JOK A;  1VQD A;  3DM3 A;  1KAW A;  1M8A A;  2I07 B;  2K5H A;  1KD1 C;  3K7A B;  4L5R C;  3GTK B;  4PG3 A;  3TRE A;  3T16 A;  2KCN A;  1C7Y A;  3K5O A;  2JN4 A;  2K4K A;  3A5Z B;  1LM0 A;  1BBW A;  4JI0 L;  3BVZ A;  1TS3 A;  1B1Z A;  3K0Y A;  1AZP A;  3J80 E;  3G48 A;  3T1H Q;  2LXJ A;  5M3M G;  3HOU G;  1D6E C;  5FK9 C;  1FR3 A;  1J9O A;  3PIO A;  1XMQ Q;  3T51 B;  1E2Z A;  1FL0 A;  4LK1 C;  1X3P A;  5CC4 A;  4L8J A;  3OSO A;  1WTV A;  3CCL A;  4X65 L;  2O5I C;  3QO2 A;  1YZ6 A;  1H9S A;  1PRT B;  2GVA A;  4NMZ A;  1LT5 D;  2C5C A;  1KTK A;  1STA A;  1J6Q A;  1NE3 A;  3VA7 A;  3HOX B;  3Q6S A;  5KNC A;  2P5Z X;  4A76 A;  2JJQ A;  1B9N A;  2CQA A;  3D6W A;  1FGB D;  1ZYR D;  1ET9 A;  3J7Y W;  1RCV D;  2EJF C;  2JA7 G;  4BY7 B;  1WCM H;  3C3L A;  5C3E G;  2VQE L;  3I73 A;  4BBS B;  4LUO A;  2SNS A;  4BWG B;  5JJI A;  2R6G A;  2LFN A;  2KUM A;  1JIC A;  4LF5 Q;  4XXE A;  4DR2 Q;  5M5X H;  1GXD C;  4A93 G;  3I70 A;  3KK7 A;  3KLS A;  1CA6 A;  1Y1W G;  1TS4 A;  4FXK C;  2F0N A;  5G3L F;  1PYB A;  2KVM A;  4U67 3;  2LSS A;  3T1H L;  3W1B A;  3S1N H;  1EWH A;  3IAY A;  3C46 A;  1TVX A;  2MQH A;  1RL2 A;  3MEF A;  4NW2 A;  3ER0 A;  3K5N A;  1EY0 A;  4LMQ D;  4DR4 Q;  1VDZ A;  3FKI H;  2E2I B;  1XMQ L;  4JBJ A;  4RGO S;  1XNR Q;  1ONL A;  4AQY Q;  2QDB A;  2VW9 A;  1VQE A;  3GP7 A;  1SE4 A;  1NTG A;  4DV3 Q;  4DV4 Q;  1G91 A;  1N36 L;  4H13 C;  2XRQ D;  1Q1B A;  2YTY A;  3A5U A;  1IBL Q;  2DNE A;  5HUR A;  1EYG A;  1PH9 A;  4OX9 Q;  1CSP A;  1JE5 A;  1RTO A;  4V19 0;  1AW7 A;  1PTO H;  3NBI A;  4HCE A;  2HIV A;  1PH8 A;  1K0S A;  2A6E C;  3RN2 A;  5BN5 A;  4TKO B;  1YNN C;  3EQL C;  4YWM A;  1XPR A;  1SN8 A;  1BR9 A;  1LTS D;  3SE0 A;  1MJE A;  2ALY B;  2JE6 I;  3BYT B;  1K0R A;  1PH2 A;  3DUZ A;  3S24 A;  2EYL A;  2VS1 A;  3VR4 A;  2LS0 1;  5GAH C;  1X65 A;  5TSS A;  2KED A;  4Z9C B;  3I2Z A;  5KNB A;  1MIU A;  3I4M H;  2K32 A;  3NEN A;  1HTP A;  2F1M A;  5LL6 S;  4DAY A;  1S5D D;  4LF5 L;  1I6H H;  4XT3 B;  3A56 A;  5CYU A;  4DNT B;  4LW1 A;  3GTP H;  1JC7 A;  4IPC A;  3A0J A;  1JWM D;  3CC2 A;  5DLQ E;  1G6Z A;  4CDD C;  1VMC A;  1ESR A;  3DLL A;  4J6H A;  1TWA B;  2DUD A;  4JYA Q;  4DV5 Q;  4PMW A;  3PO2 G;  1E7Z A;  1YEZ A;  4FO2 A;  1VF7 A;  1B3A A;  4DAV A;  1S5E D;  4AQY L;  4LFC L;  5FLX L;  1XNR L;  5C0X I;  3W5O A;  1O7L A;  1L1O A;  2WFW A;  1IBL L;  2XN9 C;  1WTR A;  4G7H C;  4B9W A;  4HIM A;  2YU9 B;  1ESF A;  2X69 A;  2RHS B;  1FGU A;  1C0A A;  1BCP C;  3PUX A;  4GLX A;  2DGY A;  3I3C A;  3S9W A;  3H6M A;  2EE1 A;  2YV5 A;  2D0P A;  1SAP A;  1DYQ A;  3PF5 A;  4K14 A;  1Y8N B;  1WYD A;  3I56 A;  3M3Y B;  3HZX A;  1HRJ A;  3CPF A;  3TP7 A;  3E9H A;  2DJF C;  3BU2 A;  4IPH A;  4MZ9 A;  1GM5 A;  1O80 A;  2CW0 C;  5IP7 G;  1QOH A;  3FDT A;  1EQR A;  2FMC A;  4LUV A;  4DA2 A;  2AKW B;  1SRO A;  2WAQ B;  2Z6K C;  4ZK9 B;  5C44 H;  4DV0 Q;  1MJC A;  1TU2 B;  4R4C A;  3PO3 G;  1WTP A;  2Q8T A;  1L2F A;  1J5E Q;  3BDO A;  2PCF B;  1K28 A;  1Y1V B;  1F9S A;  2V4D A;  5EPK A;  4CJ0 B;  1ENF A;  1YHA A;  2L1B A;  4IAL A;  3PIP 3;  2B2W A;  5J3B A;  3TN2 A;  1PTO F;  3U4Z A;  2N88 A;  5HGQ A;  4CDE C;  3A7L A;  1HZ9 A;  3NTK A;  3J7A V;  1HR0 W;  3S2H H;  2ZTD A;  2J7Z A;  5JVH 3;  4C3I B;  3FEW X;  3HOU H;  4BXX G;  1EY5 A;  3V2T A;  4GNX B;  3UDG A;  3H94 A;  3CCU A;  1CHQ D;  2ATW A;  4X3T A;  1EU3 A;  1HNW Q;  1H9K A;  1TT2 A;  4UP8 A;  3I4N B;  4BS9 A;  3LWU A;  4I65 A;  3OW2 A;  1JOQ A;  1RKN A;  2HUG A;  3A8I E;  3SEB A;  2K5W A;  2B63 G;  2R7Z B;  1CT1 D;  3VYT A;  2HDM A;  5I2Y A;  2EYF A;  2N49 A;  4A3J H;  1EQV A;  2EIF A;  2F0O A;  1D8L A;  3HOW B;  2HHH L;  3J7Z C;  3ND8 A;  4J15 A;  1DOK A;  2JA7 H;  2I5L X;  5C3E H;  2E2H B;  4IPD A;  2L9H A;  1J5E L;  2RVL A;  4HN7 A;  5IOD A;  4A3F B;  1A0I A;  3BG3 A;  1V1O A;  1TWH B;  3CW2 C;  4IUP A;  1D1I A;  4JC0 A;  5FO7 B;  2OCE A;  3JAM L;  4ME3 A;  3K81 C;  1D1K A;  4JOI C;  1X54 A;  2PO4 A;  4L5Q A;  4A93 H;  1ASZ A;  1ICF B;  1Y1W H;  4QQB X;  2XSC A;  3S16 H;  2GN5 A;  1HPC A;  3SK4 A;  1P16 A;  2J0T D;  1VQ4 A;  4TVA B;  2E2J H;  2RQX A;  4PQX A;  1QWY A;  3N52 A;  3ERO A;  2WIN B;  1EYD A;  4RGN A;  4GN3 B;  1WTW A;  1HNW L;  1SE8 A;  3PUW A;  1I6V C;  2BOS A;  3STB C;  1EY9 A;  1VQ5 A;  3RR5 A;  2R92 G;  3I91 A;  3K57 A;  2CWA A;  1F9Q A;  3KJO A;  1A8V A;  3P1H A;  2AHO B;  4JBW A;  3G4S A;  1UE7 A;  3S15 H;  5JPN C;  1Q46 A;  1HA6 A;  3BZD B;  3H09 A;  4DV7 Q;  4FYD A;  2NVY H;  3OTO L;  5C4X G;  2HCI A;  3NWT A;  4A3G G;  1QG7 A;  4FXD A;  4HR7 B;  2RKS A;  1B4O A;  3GTM H;  1ZKO A;  3RD4 A;  1VQH A;  3MTS A;  1YJ9 A;  2FFK B;  4KKU A;  1HXY D;  2K04 A;  5EBC A;  2HIX A;  1XMO L;  2R3Z A;  4RHS A;  2EXD A;  2AQ2 B;  2VL6 A;  4KJN A;  1MHW C;  2F0U A;  2K7V A;  1PMR A;  4IO9 A;  4QL5 A;  2A6H C;  4A3D G;  1TWG H;  4POG A;  4PMC A;  2MNA A;  2G9H D;  1YBY A;  3AMU A;  2F0S A;  1PYS B;  4QGU A;  4R4I A;  4CKB A;  1DZ1 A;  3H0G G;  1BNZ A;  2BH8 A;  3DEP A;  2ES2 A;  2DJG C;  1K3B C;  3ITP A;  1JB3 A;  5M5X B;  3BVG A;  1ML0 D;  3E3X A;  4F7X A;  1TWC B;  1I4G A;  1Z7T A;  1NJI C;  2EXZ A;  4GN5 A;  4DR1 Q;  3S1N B;  1A62 A;  3AB9 A;  2O4X A;  4C1N I;  1IL8 A;  2PW5 A;  1F9R A;  2WKD A;  5FJ8 G;  4Y52 H;  1N33 L;  1TY0 A;  4JI6 Q;  2AQ3 B;  4K5V A;  4DV7 L;  4OEM B;  1K83 B;  1XJV A;  3M4Q A;  5EAY A;  1LTB D;  2N55 A;  1PTO B;  2A68 C;  4MNO A;  3RMH A;  4KHP L;  1T5X D;  4ABN A;  4ZCK A;  1QNK A;  1STB A;  5IP7 H;  4KK7 A;  2PMZ B;  2BE5 D;  2JA8 G;  3PUV A;  2DY8 A;  1NBW A;  4GNX A;  4B9X A;  4IUT A;  1E0B A;  3I90 A;  5AJ3 Q;  2KQ3 A;  3VR6 A;  4O1N A;  1WTH A;  1LTL A;  1IYU A;  1YI2 A;  3M85 A;  1S40 A;  4C3H G;  4DR5 L;  3PO3 H;  2SNM A;  3AU7 A;  5LHY 1;  3EBE A;  1I6H B;  4K6L A;  5LMN L;  1B53 A;  4ZKC B;  3CME A;  1U4R A;  5M5Y B;  1NAP A;  1HCZ A;  2EDG A;  3SR1 A;  3T4A C;  3CU7 A;  1G6P A;  2A19 A;  3KOJ A;  1ZXT A;  4A3M G;  2D2C C;  3GTP B;  1JWS D;  5K36 G;  1AFP A;  4DUZ Q;  3WOF A;  2PW7 A;  4GKJ L;  5BR8 Q;  1BXT A;  4DR1 L;  4ZAI A;  3HOZ H;  2JA6 G;  4KKT A;  5I6Y A;  1PHJ A;  1I94 Q;  4IOA A;  1TY2 A;  4GOP B;  4ZYS A;  1PFS A;  4B3S Q;  2F4V Q;  4WJ3 M;  1YHB A;  4DV6 L;  4BXX H;  4CGY B;  5KEE A;  4OO1 I;  3H3V I;  5I2X A;  3VA5 A;  1EIG A;  4WJW A;  3J81 c;  1JT8 A;  1EUJ A;  1QVF A;  2KA7 A;  1KQS A;  1DCZ A;  1YNJ C;  3MXG A;  2Z9H A;  1W2B A;  3R2I A;  4IZ8 A;  1HJP A;  3GV6 A;  4YHH L;  3F1Z A;  3H91 A;  1KAB A;  3W3A A;  3VYS A;  3WOE A;  2B63 H;  4HSP A;  4BA2 I;  1DON A;  1IYV A;  1I4R A;  1YIJ A;  1EY4 A;  3I4L A;  3SDZ A;  4G57 A;  2F4I A;  4A3B G;  1N32 L;  4DUY L;  4YWK A;  2DN8 A;  3UE0 A;  1X6O A;  1YVC A;  1CA5 A;  1LT6 D;  3SK5 A;  2QF7 A;  1PFB A;  1GO3 E;  2I5H A;  3NPP A;  4TRD A;  1SE3 A;  2VNU D;  1SNM A;  1Q7Y C;  5KND A;  1JR0 D;  4A3K G;  1MSG A;  3PF4 A;  2IW3 A;  4M8A A;  1EIF A;  5EBD A;  3ULL A;  3NEL A;  1EY8 A;  4BY1 G;  2UXC L;  2JXM B;  3PIP A;  1X9N A;  3K7U C;  1KNA A;  4OWX B;  4B3R Q;  1SYC A;  4R9W A;  1VQ9 A;  5C44 B;  4DN4 M;  4JI8 Q;  1TII D;  4UAI A;  3W2D A;  3RZD H;  1VQK A;  3ULP A;  4TQU S;  2DNC A;  2FHT A;  1LAB A;  3R3O A;  4EQO A;  2EVB A;  4IFD I;  3TP8 A;  2NVX H;  1V9P A;  2MO0 A;  4QB4 A;  1I50 H;  4X62 Q;  1H9J A;  1OXV A;  3EN2 A;  5A2Q E;  4DNR B;  4A3L G;  3TEH B;  3QIA A;  4OGQ C;  4O42 A;  1HNX Q;  2A1A A;  1N8R C;  2EPB A;  4QJF A;  3KDF B;  2KHJ A;  3S2H B;  5IYD G;  2ZJQ A;  2ASB A;  2RHQ B;  3HOU B;  3KF8 B;  1GJX A;  4LFB Q;  2RA4 A;  1MGS A;  2UU9 Q;  1H9R A;  2KHS A;  1BCP F;  1F2L A;  1GKH A;  4V0B A;  5C4X H;  1R9T B;  3J81 i;  2XWB B;  4RHR A;  1VQA A;  2L12 A;  5DEH A;  2Z0S A;  1XXG A;  3S14 H;  1I5F A;  5L37 A;  2UUC Q;  5EKI A;  5M3F B;  3PCO B;  4XIG S;  4A3J B;  1F2Y A;  3CRK C;  4ZRZ A;  3J81 j;  2EZV A;  2BCO A;  4IPG A;  4B3R L;  1FNW A;  3S1M H;  2F3V A;  4B3T Q;  4JBM A;  5DAU A;  1BUV T;  1G51 A;  4A3D H;  2OXP A;  3D0F A;  1KDC A;  2SOB A;  5C4H A;  4FXG C;  5D3D A;  1X56 A;  2K6A A;  3AQQ A;  1N9W A;  2HCC A;  3H0G H;  4X62 L;  1C8C A;  1X32 A;  3R8B A;  1FVI A;  1S72 A;  3AFQ A;  3NXW A;  1HNX L;  1PH4 A;  3S16 B;  2EYJ A;  1B2T A;  3K5L A;  3M4O H;  4YY3 Q;  2HDL A;  3PUZ A;  4YWL A;  2XRS D;  1PH1 A;  3OW7 A;  4P72 A;  2OF1 A;  1BBU A;  5IYC G;  2KHI A;  5FJ8 H;  2F0F A;  2UU9 L;  4KV6 A;  4YCU A;  3ERS X;  1SYB A;  3HGB A;  3S1Q B;  4NXN Q;  4HMJ A;  3GTO B;  4DR7 Q;  4JI3 L;  4CJ2 C;  1KLG D;  1CZG A;  4IFD J;  3C2P A;  2XGT A;  2K5N A;  1PA6 A;  4JV5 Q;  2OT2 A;  5DNF A;  3FP9 A;  3HOY G;  1B70 B;  2CW0 D;  1EZ6 A;  1GD7 A;  1SNO A;  3IFD A;  3S15 B;  5C0X H;  2Y0S G;  4GOP A;  4AH6 A;  2WP8 J;  2JA8 H;  2NVY B;  1U9R A;  5COR A;  1EU4 A;  3HOV H;  2PNH A;  3D8G A;  5NUC A;  3Q24 A;  3I4O A;  2XTI A;  5CR3 A;  2PNR C;  3EVQ A;  4OWW B;  3GTM B;  3D4W A;  3MXN B;  3MWY W;  2JA5 B;  2MP1 A;  4KHV A;  2NYZ D;  2F0L A;  2ZJR A;  5T1I A;  1K3R A;  4WOR A;  2EY2 A;  5HGT A;  1DOM A;  2VZA A;  3AFP A;  3RUZ A;  2VUM H;  1FYC A;  2C35 B;  4C56 C;  4HCS A;  4WFN 3;  5K36 H;  3IL8 A;  1WTX A;  4YY3 L;  3TS0 A;  2IL8 A;  3G7L A;  2OWO A;  1SFO H;  3BDL A;  3MFY A;  1V1Q A;  3T1Y Q;  1AE2 A;  4JG2 A;  1C4Q A;  2L15 A;  2Q2T A;  2VY3 A; 
#chains in the Genus database with same CATH homology
 3CCU A;  4GKJ Q;  4NXN L;  2EQS A;  4B3M L;  2ATW A;  1D7Q A;  4JI0 Q;  4DR7 L;  1HNW Q;  2R93 G;  2NN6 I;  2YTX A;  4UP8 A;  1VQM A;  1X3E A;  1NMG A;  3HOX G;  2WAQ E;  5LMN W;  2UUA L;  3AYH B;  4PZ7 A;  1UE1 A;  1Q1E A;  4DV6 Q;  4DNI A;  3OW2 A;  1IBK L;  4JI5 L;  2CQO A;  3M4P A;  2B63 G;  1Q8K A;  3RNU A;  4A3G H;  4K0K Q;  4HJ7 A;  1IXR A;  3UE1 A;  3AEV A;  3S17 H;  4C2M H;  2N49 A;  4HIO A;  4A3J H;  2EIF A;  4BY7 G;  4GKK Q;  1D8L A;  4R1J A;  3CCS A;  4KHZ A;  4BBS G;  4OON A;  2HHH L;  3J7Z C;  4J15 A;  3EIV A;  1UEB A;  1WCM G;  2E2H H;  4DR2 L;  2D0O A;  1YHQ A;  5IY0 A;  5C0X G;  3PGZ A;  2JA7 H;  4YHH Q;  2ZJP A;  2I5L X;  5C3E H;  3KDF A;  4IPD A;  4OO1 G;  4KLK A;  1J5E L;  4P71 A;  1A0I A;  4JI8 L;  3CW2 C;  3CCE A;  1ASY A;  3HOV G;  5E7N A;  1N32 Q;  4DUY Q;  4JC0 A;  4UP7 A;  2UXD Q;  2N78 A;  4HID A;  4A3K H;  2OCE A;  2BA1 A;  4ME3 A;  3K81 C;  5C44 G;  3ICE A;  2OTL A;  4JOI C;  1L1O C;  1X54 A;  4L5Q A;  1HNZ L;  4A93 H;  4LF8 Q;  4DR4 L;  1OXX K;  1ASZ A;  2UXB Q;  2BH2 A;  1Y1W H;  4QQB X;  3S16 H;  4DV4 L;  4DV3 L;  3RN5 A;  2YU9 H;  2GN5 A;  1CKN B;  3D31 A;  3ZJY C;  1M1K C;  1P16 A;  1U0L A;  4DKA C;  3HKS A;  4DK6 C;  5LMU Q;  3S1R H;  2F52 A;  2JQO A;  4TVA B;  1VQ4 A;  4OX9 L;  2CCZ A;  4C3J H;  2E2J H;  2VUM G;  1SRU A;  3GTL H;  2VQF Q;  3PSI A;  1G29 1;  3FKI G;  2UXC Q;  4LFA L;  3A74 A;  2ZM6 Q;  3H15 A;  1LYL A;  3CC4 A;  2PI2 A;  4LFB L;  4GN3 B;  2K5V A;  1HNW L;  1A63 A;  1SE8 A;  3K8A A;  3PUW A;  3J7A 5;  4A3L H;  3STB D;  3STB C;  1VQ5 A;  2JEB I;  3RR5 A;  2R92 G;  3M3Y H;  3TS2 A;  2CWA A;  1Q12 A;  1A8V A;  3KJO A;  1KIX A;  1JJ2 A;  4LF7 L;  3IRB A;  4A3I G;  4RG1 A;  2AHO B;  4JBW A;  3S2D H;  3I55 A;  5IYD H;  1Z47 A;  3KF6 A;  4K0K L;  4QIW E;  1UE7 A;  3G4S A;  1N36 Q;  1V43 A;  3S15 H;  4A3E H;  1Q46 A;  4GOP C;  2UUC L;  4GKK L;  4DV7 Q;  2NVY H;  3OTO L;  5C4X G;  1QVC A;  1VQC A;  1VS0 A;  3RLF A;  3UDI A;  4HJ9 A;  5IT9 c;  4A4I A;  2JA9 A;  3KJP A;  1SMX A;  3CCQ A;  3I4M G;  4A3G G;  2AMC B;  4IFD G;  2L15 A;  5M3F G;  1W3S A;  1WOC A;  1PVO A;  3GTM H;  4A3J G;  4IOC A;  1VQH A;  3KYH C;  1YJ9 A;  4B3T L;  2UUB L;  2YYZ A;  2N3S A;  1HZB A;  1KHI A;  4L5S A;  2HIX A;  2HT1 A;  4A93 G;  1XMO L;  3W1G A;  1BKB A;  3U50 C;  2EXD A;  1Y1V H;  4JYA L;  1Q86 C;  4C3H H;  4DV5 L;  2VL6 A;  1Z9F A;  2UXB L;  4LF8 L;  3RZO H;  2D62 A;  5C4J H;  2JEA I;  1PH5 A;  2N8N A;  4IO9 A;  3BZC A;  1DGS A;  4QL5 A;  4XTC S;  4JI2 Q;  2OQ0 A;  4A3D G;  1QUQ B;  1TWG H;  5LMU L;  4DV1 Q;  4A3M H;  2KBN A;  2MNA A;  1EQQ A;  3JAM i;  4POG A;  1YBY A;  2PQA A;  3LGJ A;  1PH3 A;  2K14 A;  1PYS B;  3K0X A;  4QGU A;  4R4I A;  4C3I H;  3J80 c;  3NEM A;  5GAE C;  1JMC A;  5IYB H;  2ZM6 L;  3H0G G;  2BH8 A;  2JA6 H;  2ES2 A;  3HKZ E;  4JCV E;  5M3M H;  1TWC H;  1VQO A;  2E8G A;  2I5M X;  1P8L A;  4PZ8 A;  4UY8 C;  3OYY A;  1NJI C;  1WJJ A;  4LF4 L;  4LF9 L;  1WI5 A;  4GN5 A;  3I4N H;  4DR1 Q;  1A62 A;  4AIM A;  3RLN A;  3PUY A;  3M7N A;  3CP0 A;  4DAY B;  1K9M C;  1CKM A;  3F2B A;  5FJ8 G;  4JV5 L;  1CKO A;  4LFC Q;  4Y52 H;  1N33 L;  4YCV A;  1IZ6 A;  4KI0 A;  5IYC H;  4JI6 Q;  2R7Z H;  2K52 A;  1K83 H;  1QVG A;  5FLM G;  4DV7 L;  3CC7 A;  4R4T A;  4JBK A;  4X65 Q;  1XJV A;  4IJL A;  3M4Q A;  5EAY A;  3HOW H;  2RCN A;  5H1S E;  5HY6 A;  4MNO A;  3JC6 6;  3M9B A;  4ALP A;  4A3E G;  2NZH A;  2NVQ H;  4A3B H;  4BA1 I;  4KHP L;  4X66 Q;  4X6A H;  3HOY H;  4GS3 A;  1N34 Q;  3GTQ H;  2WB1 E;  2BA0 A;  4DV0 L;  1KXL A;  5IP7 H;  4A3C H;  4A3F H;  2R7D A;  1TWH H;  5M5W H;  3U4V A;  3F8T A;  1MKH A;  1L1O B;  1HR0 L;  4JI3 Q;  4LF6 Q;  2QGQ A;  1IBM Q;  2JA8 G;  2NVT H;  2WAQ G;  1TWF H;  3PUV A;  1E3P A;  3GTG H;  1NBW A;  3G6E A;  4HJA A;  4GNX A;  4A3L G;  2HQL A;  1E1T A;  4DR3 Q;  5AJ3 Q;  4RMF A;  2KCT A;  5GRO A;  5IP9 G;  1K8G A;  1KC8 C;  4DR6 L;  2CKZ B;  4BBR G;  4JI2 L;  1VQ8 A;  2JA5 G;  4AYB E;  4DV1 L;  2JK8 A;  2VQE Q;  1LTL A;  4BY1 H;  1GVP A;  3K7A H;  1VQD A;  1YI2 A;  1Y1V G;  3M85 A;  1S40 A;  3DM3 A;  1L0W A;  1U5K A;  1KAW A;  1UE5 A;  3BJU A;  4DR5 L;  3GTK H;  3PO3 H;  2K5H A;  1KD1 C;  5M5Y H;  3EBE A;  1NY4 A;  4JI1 Q;  5LMN L;  4L5R C;  2AWN A;  2F3I A;  4PG3 A;  3TRE A;  3CME A;  1OXU A;  3T1Y L;  1VCI A;  1G6P A;  2A19 A;  3KOJ A;  4A3M G;  1T9H A;  1C7Y A;  5FLX c;  3HOZ G;  5K36 G;  4DUZ Q;  4GKJ L;  2K4K A;  3G71 A;  3A5Z B;  1LM0 A;  1BBW A;  5BR8 Q;  4DR1 L;  4JI0 L;  4NXM Q;  5IYB G;  4OWT B;  3HOZ H;  2JA6 G;  3G48 A;  3T1H Q;  2LXJ A;  5M3M G;  1PHJ A;  1VQJ A;  5IE8 A;  1I94 Q;  4IOA A;  3HOU G;  4GOP B;  1PFS A;  3UDX A;  4B3S Q;  4JI7 Q;  2F4V Q;  1EFW A;  1PH7 A;  3F2D A;  1YHB A;  4DV6 L;  4WJ3 M;  4BXX H;  3PIO A;  2PMZ E;  3J80 i;  4OO1 I;  1XMQ Q;  4JBM A;  1CSQ A;  1FL0 A;  4P74 A;  1E24 A;  3H3V I;  1VQL A;  1AH9 A;  4X64 Q;  1VQN A;  1JT8 A;  3J81 c;  3CCL A;  4X65 L;  3GD7 A;  1EUJ A;  2Y0S E;  1QVF A;  3HFZ B;  4MTN A;  2R93 H;  2MFI A;  1KQS A;  1YZ6 A;  1YJN A;  1Q81 C;  2K50 A;  1SLJ A;  1W2B A;  2R7Z G;  2KEN A;  2GVA A;  5ELO A;  4X66 L;  2ID0 A;  1Q82 C;  1NE3 A;  1CKN A;  1J6Q A;  1HJP A;  5JEA J;  4YHH L;  3F1Z A;  4A76 A;  2JJQ A;  2B63 H;  4BA2 I;  4JI4 Q;  3HOW G;  1IBM L;  3E0E A;  1KRT A;  1YIJ A;  5JJL A;  4A3B G;  1N32 L;  4DUY L;  4YWK A;  4BY7 H;  3UE0 A;  1X6O A;  1YVC A;  2UXD L;  4APV A;  3F2C A;  3CPW A;  1S3O A;  2JA7 G;  1WCM H;  1GO3 E;  1HZA A;  5C3E G;  2I5H A;  3TRZ A;  2VQE L;  1VQI A;  3RLO A;  4LUO A;  4L5T A;  1CUK A;  2VNU D;  2CWP A;  1Q7Y C;  4OXP A;  5JJI A;  3H3V H;  2R6G A;  3CCV A;  4A3K G;  2NN6 G;  1IYJ B;  3L0O A;  4DK3 C;  4LF5 Q;  2HHH Q;  3PF4 A;  1FJG Q;  1VQ7 A;  1EIF A;  4GLA C;  3ULL A;  2VQF L;  1X3G A;  3NEL A;  3CAM A;  4BY1 G;  5M5X H;  4Y7N H;  4DR2 Q;  1SR3 A;  3PIP A;  1Y1W G;  3K7U C;  1X9N A;  3PO2 H;  4OWX B;  3L2P A;  4B3R Q;  2Z6K A;  1PYB A;  1VQ9 A;  2LSS A;  4JI8 Q;  3FHW A;  3T1H L;  3W1B A;  3RZD H;  2QEX A;  1VQK A;  3S1N H;  3ULP A;  4TQU S;  2MQH A;  1RL2 A;  3MEF A;  4JI7 L;  1OXT A;  2E2I H;  4UP9 A;  3ER0 A;  3CD6 A;  4IFD I;  4DR4 Q;  1HNZ Q;  2NVX H;  3FKI H;  1V9P A;  2MO0 A;  3GO5 A;  1XMQ L;  4LNQ A;  1I50 H;  4X62 Q;  4JBJ A;  1OXV A;  3EN2 A;  4UPA A;  4AQY Q;  2VW9 A;  4DV4 Q;  1VQE A;  4DV3 Q;  1UE6 A;  1NTG A;  4X64 L;  1YJW A;  1QZG A;  3TEH B;  1N36 L;  1K8A C;  2E5L Q;  2FXQ A;  1Q1B A;  1HNX Q;  1JJG A;  2YTY A;  3A5U A;  1IBL Q;  1EYG A;  2UUB Q;  2A1A A;  1YIT A;  1PH9 A;  1N8R C;  1E22 A;  4QJF A;  1CSP A;  2KHJ A;  1JE5 A;  3KDF B;  4LWC A;  2I0Q A;  4OX9 Q;  3SGI A;  3Q8D A;  3I7F A;  2HIV A;  1PH8 A;  1Y14 B;  4QY7 A;  4PZ6 A;  4LFA Q;  5IYD G;  3RN2 A;  4A3I H;  2ZJQ A;  2RHQ B;  2ASB A;  3KF8 B;  1QUQ A;  4YWM A;  4DAM A;  1XPR A;  1SN8 A;  4LFB Q;  1MJE A;  2ALY B;  2UU9 Q;  4JI4 L;  1XPO A;  2JE6 I;  3CMA A;  1K0R A;  1PH2 A;  3TQY A;  1R9T H;  2MO1 A;  3S24 A;  4GNX C;  2OTJ A;  2VS1 A;  5C0X J;  4LF7 Q;  1GKH A;  4FDB A;  5C4X H;  2IY5 B;  5GAH C;  1X65 A;  4LUZ A;  5IWA Q;  3J81 i;  5GQO A;  3I2Z A;  1MIU A;  1RIP A;  3VDY A;  1VQ6 A;  4GN4 B;  1VQA A;  3NEN A;  3I4M H;  2Z0S A;  5M3F H;  2Q2U A;  4GLV B;  3S14 H;  1I5F A;  2V1C C;  3GTJ H;  3NBH B;  2UUC Q;  3UDF A;  4DV2 Q;  4P75 A;  3OTO Q;  3PCO B;  4XIG S;  4LF5 L;  2Q2I A;  2H5X A;  2ZTE A;  1I6H H;  1FJG L;  1EOV A;  1NMF A;  2A8V A;  3JAM c;  3J81 j;  4IPG A;  4LW1 A;  1HZC A;  3GTP H;  4B3R L;  3S1M H;  2WB1 G;  1X3F A;  1QZH A;  1H95 A;  1JB7 A;  4B3T Q;  1VQG A;  1TWA H;  2IHE A;  1YNX A;  4IPC A;  3GDE A;  3A0J A;  3KF6 B;  1X55 A;  1G51 A;  2Q2H A;  5DLQ E;  4POF A;  3CC2 A;  3D0F A;  4A3D H;  4YCW A;  2UXC L;  1XMO Q;  3DLL A;  2QA4 A;  1OXS C;  2DUD A;  4JYA Q;  4DV5 Q;  4PMW A;  3PO2 G;  4O2D A;  3KFU A;  1E7Z A;  1X56 A;  1YEZ A;  5JJK A;  3AQQ A;  1N9W A;  3H0G H;  3L7Z C;  3K80 C;  4X62 L;  1XNR L;  4EX5 A;  4LFC L;  1FVI A;  4AQY L;  4AYB G;  1S72 A;  5C0X I;  3W5O A;  3AFQ A;  4JOI A;  1L1O A;  4P73 A;  2E5L L;  4JI6 L;  1HH2 P;  2CFM A;  2WFW A;  3KLW A;  1HNX L;  1IBL L;  1PH4 A;  1UWV A;  4O0A A;  3I4N G;  4HIM A;  3M4O H;  1B8A A;  3CCR A;  4YY3 Q;  2RHS B;  1FGU A;  1PH6 A;  1C0A A;  3BZK A;  3PUX A;  3PUZ A;  1KRS A;  5ELN A;  4GLX A;  4YWL A;  1XNQ Q;  2DGY A;  1PH1 A;  2OQK A;  4P72 A;  1BBU A;  1B7Y B;  5IYC G;  2KHI A;  5FJ8 H;  2YV5 A;  3HOX H;  2D0P A;  3E9I A;  2UU9 L;  4YCU A;  3S1Q H;  1WFQ A;  3GTO H;  3ERS X;  2PI2 E;  2ZTC A;  1JJC B;  3CCM A;  3PF5 A;  1N34 L;  1XPU A;  4LF4 Q;  4LF9 Q;  4NXN Q;  4B3M Q;  4HJ8 A;  5FLM H;  1LUZ A;  1XNR Q;  4DR7 Q;  4JI3 L;  3B6Y A;  4R4O A;  4HIK A;  4LF6 L;  2IX0 A;  5GAD C;  1TXY A;  1WYD A;  3I56 A;  4IFD J;  5IWA L;  2XGT A;  2K5N A;  2K75 A;  3CF5 A;  4HJ5 A;  2PQA B;  1PA6 A;  4JV5 Q;  3CPF A;  4DR3 L;  2IT1 A;  3E9H A;  5AJ3 L;  2UUA Q;  1N33 Q;  2IX1 A;  2GVB A;  3BU2 A;  3FP9 A;  4IPH A;  4MZ9 A;  1GM5 A;  1IBK Q;  1B70 B;  2YTV A;  4JI5 Q;  3HOY G;  4BBS H;  1O7I A;  1GD7 A;  5IP7 G;  4A3C G;  2B3G A;  4A3F G;  4DV2 L;  4EQ5 A;  2Y0S G;  1VQB A;  4GOP A;  5JEA G;  4AH6 A;  2WP8 J;  1EWI A;  1EIY B;  2NZO A;  2JA8 H;  1EQR A;  4IJH A;  1M90 C;  4JI1 L;  4LUV A;  1AE3 A;  4R4Q A;  3HOV H;  2PNH A;  2AKW B;  1SRO A;  4KHP Q;  1PV4 A;  2Z6K C;  1VQP A;  3I4O A;  5IP9 H;  2XTI A;  4BBR H;  5C44 H;  4DV0 Q;  4A75 A;  1MJC A;  2R7F A;  4R4C A;  4DUZ L;  2JA5 H;  1E1O A;  4OWW B;  3PO3 G;  1HR0 Q;  1L2F A;  5BR8 L;  4NXM L;  3MXN B;  1J5E Q;  1C9O A;  2LXK A;  2B29 A;  2ZJR A;  1KL9 A;  1BVS A;  1I94 L;  1K3R A;  4B3S L;  4DPG A;  2KCM A;  4H02 A;  2F4V L;  4DR6 Q;  2VZA A;  3AFP A;  1K73 C;  1YHA A;  3CCJ A;  4WJ4 A;  2VUM H;  2C35 B;  2RF4 A;  5J3B A;  3U4Z A;  3CXC A;  4NPS A;  2AWO A;  1VQF A;  5HGQ A;  3U58 A;  4DR5 Q;  3ULJ A;  4NB3 A;  1OTC A;  1HZ9 A;  4YY3 L;  1XTD A;  3TS0 A;  2OWO A;  1HR0 W;  3S2H H;  1XNQ L;  2ZTD A;  1SFO H;  5LMN Q;  1IL2 A;  1V1Q A;  3CQZ H;  3PV0 A;  3WWV A;  3T1Y Q;  1AE2 A;  1I3Q H;  2R92 H;  4JG2 A;  3HOU H;  4BXX G;  5GAG C;  2IHF A;  2Q2T A;  4GNX B;  3HKZ G;  3UDG A;  2VY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...