2I5MX

Crystal structure of bacillus subtilis cold shock protein cspb variant a46k s48r
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQKVRFEIVEGNRGPQAANVTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimized variants of the cold shock protein from in vitro selection: structural basis of their high thermostability.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation
molecule keywords Cold shock protein cspB
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2i5mX00
4A3KH 3CCMA 3VDYA 1VQDA 1S3OA 4UP9A 4NXML 3I4MH 1E3PA 1YITA 5C4XH 3J81i 4OX9Q 1I6HH 1GD7A 3D0FA 4P74A 3UDIA 2ZM6L 1Q81C 2NVXH 1TWCH 1N33L 3ERSX 1L1OA 3G6EA 5LMUL 1VQAA 4NXNL 1VQHA 4YY3L 1IBLL 2K5NA 3J81c 4QJFA 1I50H 3I4NH 5FJ8G 2R93G 2HHHL 1G6PA 1I3QH 1W2BA 2B29A 1KC8C 2CWAA 4JI0L 2PMZE 1XTDA 1Q8KA 1IYJB 4AH6A 1LUZA 2ATWA 3EN2A 4WJ3M 2MQHA 4NPSA 4IPGA 1IBKQ 4KHPL 3J80c 3A0JA 5LMNW 4GOPB 3MEFA 3HOYG 1VQKA 4A3DH 3CCVA 4IO9A 4LFAL 4OONA 4LUVA 2R7FA 4BBRH 5IYDH 4DR6L 4YCVA 4JV5Q 3TS2A 4DV2L 3J80i 3PGZA 4JBKA 4KHZA 1K83H 4XTCS 3S15H 2YTXA 4DK3C 2PNHA 4JI2L 4DV2Q 4A3MG 3J7A5 1E7ZA 3AFPA 2E5LL 4DKAC 1XPUA 4JI5L 1GKHA 3FHWA 4PMWA 3TS0A 2PQAA 2NVTH 4DR1L 4DV5L 3PIOA 4A3JG 4A3FG 4AYBE 4IFDJ 2CQOA 3BJUA 4GLVB 5DLQE 1NJIC 3GTMH 4JV5L 1KIXA 1FL0A 3F2BA 2OTLA 1YHQA 1VQ7A 3L7ZC 1JJGA 1B7YB 1BBUA 3RZOH 4B3RQ 4LFAQ 1VQFA 1YVCA 4R4QA 1FJGL 2N8NA 4X66L 1PH9A 2N78A 4KHPQ 4RMFA 3S1QH 3HOUG 1WFQA 2JA8G 3AEVA 4A3EG 4GOPA 2F3IA 3CCQA 3CPFA 1PA6A 1PH7A 2ID0A 1PHJA 4JI0Q 3HOWH 2OWOA 4L5TA 2UXBQ 2KBNA 4O2DA 1X55A 4QIWE 4A3MH 1O7IA 4GN3B 3S14H 2KCMA 4DUZQ 1CKOA 3PV0A 1V1QA 5LMUQ 1KHIA 4LWCA 1HNXQ 2E2IH 2AWNA 3PUVA 4LFCL 4YWLA 4DR5L 4JI1L 2V1CC 3K7UC 5ELOA 1N36Q 1XNRL 1Q46A 1GO3E 2OTJA 1A62A 4IPCA 1HNWQ 1VQCA 2GVBA 3PCOB 2NVYH 1AH9A 2JEBI 1VQPA 1HR0L 3F1ZA 1D7QA 4JG2A 4HJ5A 2I0QA 3HOZG 2K5HA 4ME3A 1XNQL 4LFCQ 3PF4A 1N36L 3PO3H 1HJPA 1JB7A 2UXDL 4R4IA 5M5XH 1VQBA 5GQOA 4X66Q 4YCWA 4JC0A 3LGJA 3RN5A 4B3RL 1EOVA 4DV6Q 1PYBA 4MZ9A 1B8AA 3T1HL 1R9TH 1HH2P 2WB1E 4DV4L 1JMCA 2Q2UA 1YHAA 2BA0A 4IPDA 4DNIA 1Q82C 2OQ0A 5C4JH 4IOCA 2VQFQ 4BXXG 4DR1Q 3UE0A 4K0KL 3S1NH 4O0AA 5IY0A 1X6OA 2HIVA 4J15A 4LF7L 3PUWA 4R4CA 5K36G 1K8AC 4TQUS 5FJ8H 1VQGA 4PZ8A 4X64Q 2IY5B 1T9HA 2B3GA 2AHOB 2R7ZH 3EIVA 3UDGA 1G291 4DV5Q 1VQ6A 3M4PA 1EYGA 1N8RC 3FKIG 3TRZA 4DR6Q 5IWAL 2ZTEA 3GTJH 1LTLA 4AYBG 3CMEA 1I94L 5C44G 4LF8Q 1VQJA 1TWFH 4JI2Q 2UUCQ 1AE2A 3U58A 3CF5A 4POFA 4A93H 5GAEC 2K50A 4BY7G 4LNQA 4HIKA 1SN8A 3PO2G 2VY3A 5IE8A 1OXVA 2RHSB 3RLFA 4KLKA 4DR4Q 3BU2A 1YJWA 1X9NA 4DV6L 2MO1A 4B3SL 3GTQH 3A5UA 1KD1C 1OTCA 1KRSA 5LMNQ 1WYDA 1BKBA 1FVIA 3U50C 4A3KG 1PFSA 4AQYQ 1XNQQ 3I4MG 3CAMA 4A3DG 3S2DH 4A3JH 3S17H 2EIFA 1EWIA 3NELA 2CWPA 4JOIC 1EIFA 1I5FA 4DV0Q 1QUQB 4NXMQ 2R7ZG 4A3BH 4IFDI 1HNWL 1C7YA 3G48A 1Z47A 2QGQA 4A3CG 5JJLA 2WAQG 2EXDA 2I5HA 1HNZQ 4DR5Q 4GKKQ 1HZ9A 2NZOA 1LYLA 3PUZA 3CD6A 1JT8A 1W3SA 5M3MG 4DV7L 1YI2A 2VW9A 4OWWB 2JA8H 4DPGA 1N34L 2XGTA 3CPWA 4BY7H 4LF6L 2UXBL 1E1TA 2VNUD 3I2ZA 2R6GA 1UE7A 4GLXA 1NBWA 2ZJPA 1N32Q 1EUJA 2E8GA 4AIMA 5IYDG 1UE1A 4DV3L 1VQ4A 1PH4A 1TWAH 4LW1A 5J3BA 2K4KA 3S16H 1V43A 1YEZA 5M3FG 4QQBX 3KJOA 3HOXH 2UUAQ 5IP9H 5AJ3L 2BA1A 4GNXC 2HT1A 1IBML 3SGIA 2YU9H 1S72A 2VL6A 2IX1A 2IX0A 2KHJA 5FLMG 1D8LA 1J5EQ 4DV3Q 2E2HH 2UXCL 4LF5L 2MNAA 4IJLA 1SLJA 5GAGC 4Y7NH 1PH1A 3KJPA 1KL9A 3A5ZB 3W5OA 2HQLA 2Q2HA 2VQEL 3S1RH 2Q2TA 4JI6L 4R1JA 1M1KC 4A3IH 3DLLA 4X62L 4DR3L 1VQOA 4BBSH 3T1YQ 1QZHA 5BR8Q 1K9MC 3H0GG 4JYAQ 3GTPH 4YCUA 4YHHQ 1VQ5A 3RZDH 2NVQH 3GD7A 4GKKL 4PG3A 5JEAJ 1XJVA 3GDEA 1IXRA 1VQNA 1E22A 1WI5A 4JI4L 1DGSA 5M3FH 2UUBQ 1CKMA 2NN6G 3CCUA 3KLWA 5IYCG 1Y14B 3OTOL 3UE1A 2Y0SE 2IT1A 1IBKL 3KF8B 2PI2E 3CCLA 1ASZA 1PH8A 3PUYA 4Y52H 1WJJA 2N49A 1KXLA 4DK6C 4GLAC 1IBLQ 2I5MX 2IHEA 1RIPA 3OTOQ 2LXKA 4B3TL 4L5SA 4JOIA 3ULJA 4B3SQ 1RL2A 3NBHB 1V9PA 1VQMA 2R92H 2JA5G 4YY3Q 3GTLH 1Q1BA 1WCMG 1HR0W 4YWMA 3K0XA 3RR5A 2HIXA 1H95A 1XPRA 1SMXA 4A75A 4YHHL 5C0XJ 4JBWA 2I5LX 4BY1G 5JEAG 5C0XI 4POGA 2JA7H 3CQZH 3T1YL 3HOZH 1PH5A 1YIJA 3WWVA 4LF8L 1CKNA 2Q2IA 2DUDA 3KDFA 4LFBL 4KI0A 3UDXA 1EIYB 3CXCA 4LF9L 4P72A 3PO2H 4C3HH 4JI4Q 3BZKA 2ES2A 4A3LG 1Q1EA 1VS0A 2KCTA 1E24A 3J81j 1A0IA 3HFZB 3L2PA 4GKJQ 1CUKA 2ASBA 5H1SE 3B6YA 1SROA 3KF6A 2C35B 5IT9c 1HZBA 4LF7Q 3E9IA 1K3RA 3F8TA 3CCJA 1E1OA 4X65Q 3L0OA 2QA4A 4DV1Q 1L0WA 3U4ZA 1J5EL 1X56A 2LXJA 3HOYH 4DV1L 2RF4A 5GROA 3K8AA 1L1OC 2AKWB 2WB1G 4A3FH 4BY1H 2JA7G 3I4OA 1PH2A 2WFWA 1VQEA 4B3ML 2YTVA 1KQSA 4HIDA 4NB3A 2K52A 1OXSC 3CW2C 3TEHB 4JI3L 2UU9Q 1Y1WG 3PIPA 4DUYL 4A3GG 4GNXB 4DR7Q 1UEBA 1XMQQ 1L2FA 2JA6G 1JJCB 5GADC 5ELNA 3HOVH 1N9WA 1PYSB 4X65L 4A93G 4MNOA 4RG1A 3HOXG 1MIUA 3M4QA 4UP7A 5IP9G 4DR2L 1YJ9A 5C3EG 4GNXA 1GM5A 2CKZB 4DV7Q 4JI7Q 3MXNB 3BZCA 4WJ4A 3KYHC 5LMNL 3OYYA 4UY8C 1UWVA 2Z6KC 3CP0A 3RN2A 1YJNA 1XMOQ 1M90C 4LF4L 3CC2A 2F4VL 4LF9Q 4DR4L 4BA1I 4HJ9A 3KF6B 3M85A 1NE3A 3RNUA 4GS3A 4A3BG 1PH3A 2ZTCA 5C0XG 4A3IG 3S1MH 3M3YH 2D0PA 4BBSG 4A3EH 1BBWA 4AQYL 3HOWG 1HZAA 2D62A 3E9HA 1CSPA 3PSIA 3W1GA 1SFOH 3KFUA 4JI8L 1FJGQ 2JA6H 4DAMA 2AWOA 4GOPC 3HOVG 1QVGA 2KHIA 2ALYB 4EX5A 1JE5A 3FP9A 4C3IH 2FXQA 4IPHA 2WP8J 1P8LA 2VUMG 3M4OH 2K75A 3NENA 3PF5A 3GTOH 4JI7L 1KRTA 4X64L 1QZGA 3ICEA 3I4NG 4IFDG 4X62Q 4BXXH 1I94Q 1X3FA 3K7AH 1OXXK 4OWTB 3S24A 2VQEQ 1QVCA 2NN6I 4JBJA 2YV5A 1Z9FA 1MJEA 1OXTA 2E5LQ 4MTNA 3ULPA 1XMOL 4IJHA 4QY7A 1KAWA 2UXCQ 3DM3A 2JA5H 1Y1VG 2OCEA 1EQRA 4L5QA 3CC7A 1P16A 4DR7L 4ALPA 1EFWA 4APVA 3HKZG 4JYAL 2RHQB 4BBRG 1U5KA 2PI2A 3KDFB 4DR3Q 3CCRA 1X65A 3T1HQ 4DR2Q 1IZ6A 3KOJA 1IBMQ 1MKHA 2E2JH 4JI6Q 5E7NA 5EAYA 3JAMi 3S2HH 2YYZA 1A63A 1G51A 1TWGH 1YHBA 3PUXA 2GN5A 2BH8A 2YTYA 2ZJRA 3AQQA 1YNXA 4H02A 4UPAA 3STBC 4HJAA 1XMQL 1K8GA 3JAMc 4DUYQ 1QVFA 2JQOA 1NY4A 4R4TA 1S40A 4EQ5A 4HIMA 1C9OA 1UE6A 2HHHQ 1X54A 1EQQA 1X3GA 4B3MQ 1ASYA 3U4VA 4NXNQ 1IL2A 4L5RC 2R7DA 1HZCA 3H3VI 2Z0SA 2WAQE 1CSQA 4X6AH 3I7FA 3CMAA 2JA9A 4LUZA 2ZM6Q 3OW2A 5JJKA 1Y1VH 3GO5A 4DUZL 1NMGA 2R93H 1CKNB 1Q7YC 2KENA 1SR3A 4JBMA 2A19A 4LF6Q 4LFBQ 3G71A 2ZTDA 4XIGS 1PH6A 1N34Q 3ZJYC 2A1AA 3JC66 4A3CH 2DGYA 4JI1Q 3CCEA 1XNRQ 5GAHC 2N3SA 2R92G 4GKJL 2JEAI 1VQIA 4P75A 4A4IA 5IYBH 1U0LA 2JE6I 2OQKA 3IRBA 3Q8DA 4C3JH 1K73C 1HNZL 3F2CA 4TVAB 5M3MH 1PVOA 4JI8Q 3G4SA 3M7NA 4B3TQ 3H15A 1OXUA 2D0OA 4DV0L 3RLOA 4HIOA 4UP8A 5C3EH 3STBD 2Z6KA 5HY6A 4FDBA 2IHFA 1A8VA 3E0EA 4R4OA 4A3LH 1GVPA 3F2DA 1LM0A 3TREA 3H3VH 2CFMA 2K5VA 1JJ2A 4LF4Q 2F4VQ 2VS1A 3PO3G 1VQ9A 1X3EA 5M5YH 2CCZA 2F52A 3EBEA 2MFIA 1YBYA 3K80C 4GN5A 2B63H 3GTGH 2UUCL 5IP7H 1C0AA 5BR8L 1TXYA 3M9BA 1Q12A 4GN4B 5M5WH 5FLMH 2JK8A 4OWXB 4HJ8A 1SE8A 3CCSA 4JI5Q 1VQLA 1BVSA 5IYBG 4IOAA 1PV4A 2UUBL 3CC4A 5IWAQ 3UDFA 2L15A 3HKZE 4LF5Q 3HOUH 2ZJQA 4HJ7A 4OO1G 2XTIA 4OO1I 1L1OB 2K14A 4PZ7A 2VQFL 4QL5A 5JJIA 2Y0SG 5AJ3Q 1Y1WH 2VUMH 2LSSA 4C2MH 2UU9L 4JI3Q 4A3GH 1QUQA 3AFQA 1XPOA 1VCIA 3AYHB 5C4XG 1SRUA 3RLNA 3TQYA 1K0RA 4LUOA 3NEMA 5IYCH 1N33Q 2VZAA 4K0KQ 2H5XA 3FKIH 1FGUA 2MO0A 2GVAA 4YWKA 2JJQA 3J7ZC 1N32L 1VQ8A 3ULLA 1HR0Q 2B63G 5HGQA 5IP7G 2UUAL 4DV4Q 1TWHH 4A76A 1MJCA 4PZ6A 3HKSA 5C44H 4BA2I 3ER0A 1Q86C 4JCVE 1YZ6A 1B70B 3H0GH 1WOCA 2NZHA 3K81C 2EQSA 1NMFA 3D31A 3W1BA 4OXPA 1J6QA 4P71A 1NTGA 4DAYB 5FLXc 2QEXA 1WCMH 2AMCB 3I55A 1HNXL 2UXDQ 3A74A 2RCNA 1UE5A 2BH2A 3I56A 4OX9L 2A8VA 1AE3A 3GTKH 4P73A 4QGUA 2PQAB
chains in the Genus database with same CATH superfamily
5FLXE 1B3AA 1EYDA 3VDYA 4A3KH 3I70A 4NXML 4ZLTF 3E0JA 4OX9Q 1Q81C 1SE3A 1TWCH 1TVXA 3FPPA 3ERSX 2EJMA 2Z4HA 2J7ZA 2K5NA 3J81c 3I4NH 3NHHA 5EKIA 4HSVA 4WFN3 2R93G 2HHHL 1W2BA 5DEHA 3URYA 1PRTD 2CWAA 2B2UA 4AH6A 3TBIB 1LUZA 5DM73 2MQHA 1K83B 4KHPL 4X3SA 3J80c 3HOYG 3MEFA 1PRTF 1VQKA 1O7ZA 4LFAL 4IUTA 4BBRH 2C5CA 3TS2A 5F2DA 4KHZA 1VDZA 1JB3A 1IW7C 3QOJA 4AYBB 1WTVA 4G57A 4JI5L 1L0YB 2B2TA 2WIIB 4DR1L 4DV5L 3PIOA 4A3JG 4A3FG 1I6HB 4AYBE 4IFDJ 1K8MA 5DLQE 1NJIC 3F2BA 1ZKOA 1ILQA 1YHQA 3L7ZC 1BBUA 1VQFA 2N78A 4RMFA 1QE6A 2JA8G 5K5PA 2F3IA 3M3YB 1PA6A 1PH7A 2OWOA 2K1BA 2KBNA 4O2DA 1X55A 2Z1CA 4QIWE 4C3JG 3S14H 2KCMA 5M3MB 1CM9A 5I6WA 3OHXC 3AMUA 3DWPA 3NBIA 1Y1WB 3OPOA 1XNRL 2ZXOA 2OTJA 1ZYRC 1GO3E 2EYHA 1A62A 4IFDH 3V2TA 2GVBA 3TN2A 4EGVA 1AH9A 1VQPA 1HR0L 1V1PA 4OEMB 1D7QA 3CKIB 4JG2A 2K5HA 1XNQL 2F0UA 1JB7A 1STAA 1Y8NB 2HCCA 4HMJA 1B8AA 4RWSC 1HH2P 1A3TA 3KLRA 5C4JH 4IOCA 3TSSA 5M5YB 2CH4W 2CH4A 1CHQD 3S1NH 2NN6H 4O0AA 2HIVA 1UAPA 5BN5A 1WTXA 1VQGA 2XWBB 5IGFA 2B3GA 1HHVA 1EIGA 2R7ZH 3EIVA 4N9PA 1N8RC 3GP7A 3FKIG 5CGKA 1EY0A 5J39A 5FLXL 1DOKA 1LTLA 2K04A 1D5MC 1VQJA 1AE2A 4A93H 1Z7TA 4CDEC 5IE8A 3RLFA 4KLKA 4DR4Q 1X9NA 5JVG3 3UI2A 2F0LA 1KRSA 5KEEA 5KGUA 5EPKA 5CBAE 1EEID 3AU7A 3EFXD 1XNQQ 2F0SA 4JOIC 2A5HA 3NELA 2CWPA 4X3TA 5E3FA 1WTOA 3LX0A 1NCVA 1B4OA 2QGQA 4A3CG 1TY0A 2EXDA 2I5HA 4OHJA 2NZOA 4DV7L 2DJGC 4DPGA 1N34L 3CPWA 3KF8A 2ZJPA 3SR1A 1EUJA 1LT6D 2E8GA 1UE1A 2VB2X 1GHJA 3OWFA 3CQZB 4H0LC 2UUAQ 5IP9H 2F0PA 3IKJA 4A3GB 2XNAC 2IX1A 2JSOA 1GOZA 1RF2D 2IX0A 4XQQA 3R2IA 3VR2A 4EQOA 1Y8OB 2MNAA 3W5OA 4JI6L 4R1JA 1E2ZA 4NW2A 3A7LA 1K9MC 4CDFC 3H0GG 4YHHQ 2O5IC 3GD7A 1WI5A 4C3HG 5FOBB 4A3IB 2K03A 1CKMA 3D6WA 3DEOA 3PIP3 1RODA 3KLWA 1Y14B 3OTOL 3H3VC 3O13A 2IT1A 1JR0D 4Y52H 4ZCKA 2N49A 2EZVA 4XYOA 1KXLA 1RIPA 1STGA 1V1OA 5EJWA 1RL2A 2E2DC 3NBHB 4YWMA 3RR5A 2AUKA 4S3SA 1HTLD 4JBWA 4BY1G 5JEAG 1WTHA 2L55A 5C0XI 3HOZH 3WWVA 4A3KB 2R3ZA 3TP7A 1C48A 1Y1VB 3NUCA 2EYFA 3UDXA 4KKTA 4P72A 3K5OA 4C3HH 5CR3A 3GTGB 1EQTA 3T13A 3A8KE 1X3QA 1CUKA 5H1SE 3J81L 3B6YA 2PZTA 2C35B 5IT9c 3DWQA 4DA2A 3Q24A 1K3RA 3F8TA 1EEFD 4X65Q 4A3EB 1H9KA 4DV1Q 3U4ZA 1SYFA 1X56A 5EPJA 5L37A 2WB1G 2MHVA 4A3FH 2JA7G 1KLUD 2QF7A 1BXTA 4DK1A 1VQEA 4N9TA 2YTVA 1KQSA 3A8JE 1SMYC 4JI3L 1ENFA 1FNUA 3S2DB 2N55A 1QG7A 2JA6G 1K0SA 5ELNA 4X65L 4A93G 4H7BA 1KABA 2IW3A 4ZRZA 3MXNB 4IALA 3BZCA 3R8BA 3FDTA 4NP5A 5CV5A 4WJ4A 3KYHC 1D2BA 1LT5D 1A2UA 1LTID 1YJNA 3GTPB 3BVGA 3RD4A 1CA5A 1S4ZA 2B2VA 4BA1I 4HJ9A 1PTOC 4ME5A 1PH3A 3S1MH 3M3YH 4A3EH 3TDQA 1HZAA 3QO2A 1SFOH 5JPMC 4JI8L 4N8X1 2JA6H 2N88A 4DAMA 3S17B 5IOCA 2ALYB 3SEBA 3NWTA 4C3IH 1HUNA 2VUMG 5EBCA 2K75A 2JA5B 5IT9E 3J80L 3E6ZX 3ICEA 3NWSA 1F9PA 2NTTA 5J1ZA 1Z9FA 2ZXPA 1OXTA 2MGSA 4IUQA 3ULPA 2Y0SB 4QY7A 5JOBA 3SE0A 1SMYD 3DM3A 2JA5H 1EQRA 1TR5A 4ALPA 1EFWA 4APVA 1B3QA 2RHQB 4BBRG 2PI2A 1X65A 4O1NA 3T1HQ 3S2HH 4JI6Q 2YYZA 4XXEA 4P2CB 4A3DB 1TWGH 2QDBA 2E74C 5C5MA 2ZJRA 3S1NB 4H02A 1XMQL 3S1MB 4DUYQ 1BCPC 1QVFA 1NY4A 3K0YA 1C9OA 2HHHQ 4CJ2C 1KNEA 3HZXA 1ZYRD 3A54A 3U4VA 1IL2A 1F77A 4L5RC 2JN4A 2R7DA 2PZUA 3H3VI 3GTMB 2WAQE 1CSQA 3I7FA 5IGBA 5JJKA 2JA9A 2O2LD 4RGMA 3GO5A 4DUZL 2TSSA 1Q7YC 2KENA 2IJ0A 5BN3A 1K3BC 4LFBQ 4XIGS 2FINB 1N34Q 1GUOA 2A68D 3HOXB 1HA6A 4KV6A 4M1UB 3MC0B 4P75A 2DNCA 1U0LA 2JE6I 3L3OC 1SNDA 4C3JH 4I7ZC 4TVAB 3DXJC 4K14A 4NMZA 5HGTA 3EQLC 4UP8A 2L9HA 1CHPD 1TWGB 3T51B 3T16A 3E0EA 5C44B 2A6EC 1GVPA 1LM0A 2CFMA 2E2JB 1JJ2A 2F03A 1GUTA 2TMPA 2NVQB 1ML0D 3GTGH 5IP7H 5BR8L 2G9DA 1SE8A 1PTOD 1BVSA 2UUBL 1XXGA 3UDFA 3HKZE 4K8JA 1SNMA 1L1OB 1IHZA 3K6OA 4K6LA 4PZ7A 2VQFL 4X3UA 1M4VA 2F0TA 1XPOA 1G91A 5C4XG 2JXMB 4FVMA 1TWHB 4KMUC 4V0BA 4DF7A 3NEMA 2H5XA 3FKIH 1FGUA 2JJQA 3TZDA 4X3KA 5IP7G 1TWHH 1MJCA 5J22A 2RSOA 3ER0A 1G2TA 1EZ6A 2MPMA 4QB4A 1YZ6A 1B70B 4EQ5A 4GNXC 1PV4A 2EQSA 1J6QA 4P71A 1NTGA 4Z9CB 3A74A 3JAME 4MHEA 4RCNA 1EU3A 1BDOA 1YNND 2PQAB 2Z4IA 1NR4A 1S3OA 1VQDA 4UP9A 3I4MH 2F0HA 3J81i 5A2QL 2ZM6L 1SYGA 1JOOA 2CW0D 1TS5A 1L1OA 1VQAA 2R92B 1VQHA 1DZ1A 4QJFA 1I50H 5FJ8G 1I3QH 1KC8C 2PMZE 3G6JB 4ZUJA 1QNKA 1IYJB 4XQNA 1CZWA 2EY6A 2ATWA 3EN2A 4EVOA 3VA7A 4WJ3M 4IPGA 1DYQA 4G7OC 4IO9A 2EYPA 3EVQA 4LUVA 1S5FD 2LFNA 2NWGA 4QUCA 1H9RA 3PGZA 1K83H 3RMHA 3S15H 2YTXA 4KK7A 4A3MG 3NTHA 4RKBA 4KKSA 2OXPA 1T5EA 4RAUC 1LTTD 4DKAC 1XPUA 1GKHA 4PMWA 1FR3A 2PQAA 4HCSA 1LTSD 2LY7A 4FP5D 1SYBA 3BVZA 1VQ7A 3MXGA 5C3XA 1JJGA 3RZOH 4B3RQ 4LFAQ 5C3WA 2N8NA 4X66L 1PH9A 4KHPQ 1SYDA 3HOUG 4ABNA 5ELCA 1HQMC 4K5VA 3CCQA 3CPFA 3HOWH 5T1GA 1PHJA 5FK9C 2UXBQ 4DAVA 4GN3B 3K59A 4ZKBB 4DUZQ 1V1QA 1KHIA 4LWCA 2E2IH 2HDMA 5DNFA 3CU7A 2NZ1D 4IURA 4DR5L 4JI1L 2V1CC 3K7UC 5ELOA 1N36Q 1FNVA 3S1RB 1O7LA 4DK0A 3LWEA 4PMCA 3F1ZA 3HOZG 1I4HA 3PF4A 4LFCQ 1FYCA 1SEBD 4R9WA 2UXDL 3BYYB 1HA5A 3DUZA 4X66Q 3GTQB 3LGJA 4B3RL 1EOVA 1D6EC 1JQYD 2KEEA 3Q22A 3T1HL 2WB1E 4CKEA 5M5WB 5T1IA 2BA0A 4IPDA 1ILPA 2OQ0A 3GTLB 4K0KL 5CC4A 3T53B 1SJED 4IZ8A 1S5BD 1X6OA 3PUWA 2M00A 3H94A 1EY9A 4DN4M 5KNBA 1TT2A 4KHVA 4RGNA 1K8AC 4PZ8A 2PQEA 1WD1A 2IY5B 1T9HA 2AHOB 2QEJC 4ILWA 1G291 4FO2A 4OGQC 1EYGA 3NSWA 2CQAA 5IGDA 4U673 5IWAL 5C6AA 3I4NB 2XN9C 4AYBG 1I94L 1I4QA 1X32A 1FD7D 4JI2Q 2UUCQ 3QR8A 1F9RA 1F2ZA 2SNSA 2K50A 4BY7G 4LNQA 4HIKA 4TKOB 3PO3B 4Y7NB 2VY3A 1OXVA 1STEA 2RHSB 1EY8A 1YJWA 2MO1A 2NUCA 1SE2A 5DM63 3I4MG 1VF7A 2F0QA 2Q8TA 4N8FA 1EWIA 2R7ZG 4IFDI 1EIFA 2XRSD 1QUQB 3MTSA 1C7YA 4FXDA 1Z47A 5JJLA 2A68C 3P20A 3U9OA 1LYLA 3IFDA 3PUZA 5CMDA 5M3MG 1YI2A 2VW9A 2F0GA 4FF4A 1BO0A 1XTCD 2R6GA 5I4DA 2XRQD 5IYDG 3T4AC 4XQJA 2RDHA 1VF5C 1VQ4A 1TWAH 5M3FG 1YNJC 3HOXH 5CV7A 4CGYB 5AJ3L 2BA1A 5COYA 4QCLA 3SGIA 1GJXA 1H9SA 2YU9H 3OMGA 3GTKB 5CBEE 1KDAA 3H09A 5FLMG 1LTAD 2E2HH 1RD9D 2UXCL 2JP1A 3SK4A 1PH1A 3KJPA 3FRPB 1BCPB 2VQEL 1FNWA 4PMBA 1IYVA 3DLLA 4R8NA 4BBSH 5BR8Q 4YCUA 2PYKA 3LNNA 2NVQH 2K6AA 4LAAA 5M9OA 4PG3A 5JEAJ 2F3WA 1IXRA 1VQNA 1CZGA 3IL8A 1E22A 1PYWD 3M4YA 1LTGD 2FMMA 1V1PB 3KF8B 1NAPA 1IBKL 1ICWA 4DK6C 3WOFA 2I5MX 3OTOQ 2LXKA 4JOIA 4B3SQ 1VQMA 4YY3Q 1Q1BA 1HR0W 3K0XA 1H95A 2RCFA 1RDPD 1XPRA 1SMXA 4DGZA 1PZID 4YHHL 4A75A 3S16B 3H6MA 3GV3A 3SK8A 4RGTA 2Q2IA 2DUDA 4LFBL 4KI0A 2RA4A 2KHSA 3HG9A 2B63B 3BZKA 2ES2A 1JWSD 1E24A 1A0IA 4B9XA 2EOTA 1SROA 3KF6A 2PZWA 2I07B 3E9IA 1E1OA 1SYEA 5FKAC 3L0OA 3KUPA 2RF4A 4I65A 3ZYYX 4DAYA 1L1OC 2AKWB 3E5SA 1F2YA 1TS4A 5KNDA 1WD0A 4BY1H 3I4LA 1PH2A 5E4WC 4B3ML 1A3VA 3F2UA 2WKCA 2K52A 3CW2C 1I4GA 3CRLC 4A3GG 2R93B 1A6XA 1JJCB 5GADC 1A15A 2PCFB 4KJNA 4MNOA 5I2YA 4IN3A 2MP1A 5IP9G 4DR2L 3ONAB 4GNXA 1STBA 4JW0A 3OYYA 1Q3LA 3H0GB 4LJZC 3MFYA 1M90C 2Z6KC 1CTMA 2P5ZX 1XMOQ 4A3DH 4LF4L 3CC2A 2F4VL 4DR4L 2RVLA 4L8JA 2OEOA 1MI2A 5C0XG 2OF1A 4A3IG 2D0PA 1BBWA 1HUMA 4C1NI 3E9HA 4BWGB 1CSPA 3KBGA 3PSIA 2FHTA 1FJGQ 1IL8A 1QVGA 4EX5A 2NTSA 2KUMA 3M4OH 1U4LA 1EZ8A 2R61A 2KCCA 1KRTA 1QZGA 4X62Q 1I94Q 1X3FA 2NN6I 2DY8A 2YV5A 2E5LQ 1XMOL 3M4OB 2B2TC 3MXNA 1Y1VG 3K5MA 5KRUA 1TWAB 2F3VA 4ZKCB 3IAYA 1PLFA 4Q0FA 4DR2Q 1IBMQ 1MKHA 3OMCA 5E7NA 5EAYA 4C56C 2GA4B 1YHBA 1QNUA 1YNXA 4HJAA 3STBC 1K8GA 2EE1A 5KIXA 5G3LF 3IFTA 2K33A 4R4TA 3J7YW 1DONA 2L4NA 4KJOA 4GZYC 1K8OA 1X3GA 4B3MQ 3WOEA 2SNMA 4NXNQ 1LTBD 2RSNA 2EYJA 2ICEC 5D14A 3CMAA 1Y1VH 4DNRB 1EWHA 1NMGA 2R93H 4KY6A 5NUCA 1CQFA 1PH6A 1JWUD 4A3CH 4JI1Q 1JOKA 2DNEA 3SHLA 1PTOH 2JEAI 1VQIA 5IYBH 1U4PA 3I72A 1SYCA 1K73C 1HNZL 3R93A 1PVOA 1S5CD 1SE4A 3G4SA 3M7NA 3MXUA 2Z9HA 1BCPF 4DU9A 4DV0L 5C3EH 3SDZA 1PXUA 1EYAA 4R4OA 3CRKC 1MSHA 3MZ5A 3TREA 3H3VH 2BDNA 4K6DA 4QIWB 2HD3A 2QDLA 1RCVD 2VS1A 4K2KA 2F0VA 1X3EA 2F52A 5A2QE 2WV6D 3VR5A 1H9JA 4FF1A 1QJOA 3J80E 2BE5D 1Q12A 5FLMH 4IOAA 5IYBG 2NVTB 4KN7C 1Q8IA 4B08A 1KNAA 4DAPA 4CDDC 4OO1G 3Q6SA 4OO1I 2NVXB 1TQOA 2XIWA 4QL5A 3PMFA 2Y0SG 1Y1WH 2VUMH 2LSSA 2UU9L 4A3GH 4XT1B 1WCMB 1TY2A 1VCIA 2L5TA 3RLNA 2EY1A 4LUOA 2VZAA 2B2VC 1SFOB 2E76C 1BBXC 5I2XA 3J7ZC 3X3MA 1VQ8A 4ZAIA 2K7VA 2J0TD 4ID6A 1WTWA 1UUPA 1QCBD 3BZDB 4A76A 5AJ3Q 1WOCA 4CBVA 1MSGA 3W1BA 4OXPA 4DAYB 5FLXc 1J9OA 2QEXA 2AMCB 1HNXL 1TU2B 4WJWA 1I3QB 1MHWC 1UE5A 2EY2A 4DFAA 3I56A 2A8VA 1AE3A 2AUJD 2CW0C 4P73A 2L12A 2E2HB 3CCMA 1YITA 5C4XH 2FMCA 1KAAA 1KDBA 1GD7A 1LO5D 4P74A 1G8ZD 2LKVA 3M7GA 3G6EA 4TRDA 1WTPA 2IWHA 1XTDA 1Q8KA 3T56B 4K2LA 3BDLA 2O4XA 3A0JA 5C3EB 4GOPB 2K01A 4CKCA 3S14B 3CCVA 2R7FA 1DOLA 5IYDH 4DV2L 3D3RA 4CJ1B 4XTCS 3J7AV 1T5XD 2PNHA 4JI2L 4DV2Q 3J7A5 4A3BB 3AFPA 4K5XA 3D8GA 4V190 1C8CA 3TS0A 1SJHD 5LL6X 2B2YA 5M5XB 1W6KA 2SOBA 2CQOA 3BJUA 1XX8A 3QB3A 4JK1C 2PPBC 4JV5L 2F0EA 2PO4A 3QJYA 1DM0B 1KIXA 2Z8LA 1YVCA 1EY6A 3I90A 3S1QH 2F0OA 4A3EG 4GOPA 4JI0Q 2ID0A 1F2MA 2XSCA 4HR7B 4A3MH 3HKZB 3HS0C 2Q8IB 3PV0A 3V05A 5LMUQ 2DJFC 4IQZA 1HNXQ 3PUVA 4LFCL 5CV8A 3MHBA 4FXGC 1OO9B 1Q46A 5K36H 3TP5A 4IPCA 1HNWQ 1VQCA 2NVYH 3R3OA 2JEBI 2AQ1B 4KD4A 4HJ5A 2I0QA 3BS1A 2FFKB 2K5WA 4ME3A 3BVMA 3NK9A 4R4IA 1VQBA 1STYA 2F0DA 4YCWA 5GQOA 4JC0A 3RN5A 4DV6Q 1PYBA 4LMQD 4MZ9A 4CJ0B 4DV4L 4RH6A 1YHAA 4DNIA 1II3A 1YNJD 4DR1Q 3D4RA 1BCPD 5IGGA 5IY0A 4LF7L 4R4CA 5K36G 2VXWA 4X64Q 4HTHA 3UDGA 3M4PA 4ZQ3A 1J8IA 3GTJH 3CMEA 4LF8Q 5JJZA 3I73A 5D3IB 1SXTA 4KD3A 1JWMD 5IGCA 1SN8A 3PO2G 3BU2A 3ND8A 4DV6L 1OTCA 1BKBA 1HQRD 5G3LD 2RDFA 1B44D 3HRZC 3CAMA 4A3DG 3S2DH 4A3JH 3S17H 4NXMQ 3A56A 1HNWL 3SK6A 3G48A 2WAQG 1H9MA 3QOLA 4DXGA 4GKKQ 3VYSA 1JT8A 1D1IA 1W3SA 2JA8H 4UHVA 3TRZA 2K28A 4KN4C 3MXPA 2BOSA 4BY7H 4LF6L 5EKKA 4GLXA 1N32Q 1I50B 4AIMA 2KECA 3DEPA 4DV3L 1PH4A 4LW1A 4KY7A 5DAUA 5C5LA 3S16H 1V43A 1JOQA 4QQBX 3KJOA 2HT1A 1IBML 1GUNA 4C2MB 1S5DD 1QILA 3KBXA 4C3IB 4DV3Q 4LF5L 1Q90A 1SLJA 4Y7NH 2HQLA 3S1RH 2D9UA 2A69C 4X62L 4DR3L 1VQOA 3T1YQ 4JYAQ 4UAIA 4F7XA 4GKKL 3N6RA 4ODGA 1DGSA 5M3FH 2UUBQ 2H1EA 2NN6G 4BBSB 3HOWB 3UE1A 3P75A 3FPUB 3D4WA 3C46A 3P7JA 1PH8A 3PUYA 1SBBB 1B53A 1WJJA 3HOVB 3VR3A 2M2LA 4GLAC 2IHEA 1DJRD 4FXKC 1V9PA 1AFPA 3GTLH 4IUPA 1O80A 1TS2A 2HIXA 4ULLA 3VYUA 5C4XB 2I5LX 3OOCA 1PH5A 4LF8L 5EPLA 4F8MA 2EPBA 2PNRC 3KDFA 1WTRA 3VYTA 2J4XA 3CXCA 4LF9L 1MBYA 1ZEQX 4A3FB 1NNXA 1Q1EA 1VS0A 2KCTA 3J81j 3HFZB 1GUSA 1M8AA 5LHY1 4LF7Q 2B2UC 3CCJA 2JA8B 4U68A 2QA4A 3E3XA 3NQTA 3VR4A 2LXJA 2X6LA 3HOYH 4C3JB 3K8AA 5C4JB 2K5QA 5I9PA 4NKLA 4MN3A 2NB0A 4NB3A 2EDGA 3TEHB 2UU9Q 1Y1WG 4DUYL 1SSOA 4BS9A 4GNXB 1XMQQ 1L2FA 1O7YA 1NR2A 1N9WA 1PYSB 4TSSA 4RG1A 3M4QA 5D3DA 5CORA 4DV7Q 5FO7B 3VYRA 2CHBD 2OT2A 5LMNL 4RHSA 3NQIA 1UWVA 3CP0A 3RN2A 4FNFA 4LF9Q 1AW7A 5FO8B 5IODA 4A3MB 3M85A 1NE3A 3RNUA 4GS3A 1KTKA 2ZTCA 3BDCA 3NTIA 3OIPA 2LMCB 1YNNC 2NYZD 1LABA 1W6JA 4R8IA 2CVRA 1X3PA 2KHIA 1EIHA 1U9RA 2D5DA 1JE5A 1P8LA 3GTOH 4JI7L 5BN4A 4E6IA 3HOUB 3K7AH 1OXXK 2VQEQ 4JBJA 1VMPA 1MJEA 4MTNA 1PDQA 1HFNA 2UXCQ 2BE5C 2OCEA 2EVBA 4DR7L 4JYAL 1U5KA 1SNPA 2QW7A 3KDFB 4DR3Q 3CCRA 2E2JH 4RKLA 3JAMi 1A63A 1E2WA 3G7LA 2GN5A 3C2PA 2BH8A 2YTYA 3JAML 3NPPA 1GUGA 3I3CA 3FEWX 3JAMc 5E4XA 1DCZA 2JQOA 1S40A 5CV9A 1D5XC 4HIMA 1UE6A 2A74C 1X54A 5FO9B 3OSOA 1EFID 1JE4A 4RCOA 1HZCA 4HMIA 2Z0SA 4X6AH 2FJ2A 4LUZA 5KNCA 2IPKD 2B2WC 3FMCA 4DNTB 5C4HA 1CKNB 1SR3A 2A19A 4LF6Q 3G71A 1PFNA 2KCNA 3JC66 2A1AA 2DGYA 3CCEA 3A55A 1XNRQ 3OIQA 2N3SA 2AQ2B 1IKLA 3F2CA 2KOLA 5M3MH 4EQPA 3GQBA 1HCZA 1HXYD 4B3TQ 3H15A 4KY5A 4PV1C 3HOYB 2DY7A 3MEHA 1PRTB 3STBD 4A3LH 3OW7A 3S2HB 4LF4Q 2C9OA 2F4VQ 4G7ZC 3PO3G 1VQ9A 5M5YH 2F0MA 4PNYA 1YBYA 2K32A 3K80C 4GN5A 4C3HB 4OWXB 3CCSA 4JI5Q 1WTQA 1VQLA 3I4MB 1ICFB 4A3JB 1AP0A 2L15A 5EKLA 1ESRA 4HJ7A 2XTIA 2K14A 5JJIA 2EJFC 5ELFA 3AYHB 2NBFA 1SRUA 4BY1B 2BCOA 4IUUA 4C1NK 1K0RA 3J7AF 1N33Q 1PMRA 2MO0A 2EYLA 2GVAA 1BUVT 1I4XA 3Q23A 2KQ3A 3ULLA 2LS01 1U4RA 3VR6A 4L6TB 5HGQA 4DV4Q 2F0NA 5M3FB 3HKSA 4EQNA 4BA2I 1Q86C 1RKNA 3PF5A 3K81C 1N36L 1CA6A 1JICA 2UUAL 3D31A 4FYDA 1TKWB 3I55A 1G6ZA 2BH2A 5HURA 4OX9L 3GTKH 5CYUA 1KDCA 4QGUA 4H13C 1CQVA 2JYOA 5ELBA 1E3PA 2WB1B 1I6HH 2L1BA 3D0FA 3UDIA 5I6YA 2JA7B 5I9OA 2F1MA 2NVXH 1U4MA 1N33L 2PW7A 4XT3B 5LMUL 4YY3L 4RA8A 4NXNL 1IBLL 1S5ED 2B2WA 4HCEA 3KLSX 2SEBD 1G6PA 2JA6B 2B29A 4JI0L 1JC7A 3NE5B 4FF2A 4NPSA 2E2IB 1IBKQ 1EYCA 3W2DA 5LMNW 1XWEA 2L11A 4OONA 3NP8A 2IX3A 2F0IA 2Z6BA 1D1KA 5TSSA 4DR6L 1E0BA 4YCVA 1STNA 4JV5Q 3J80i 4JBKA 5D65A 1ET9A 2MJ8A 3FKIB 1R4PB 3BG3A 3QG1A 4DK3C 1E7ZA 2E5LL 3ND9A 1PZKD 3NBHA 1CFMA 1EY4A 3FHWA 2NVTH 4PQXA 5KYIA 2HUGA 2DN8A 2WKDA 4GLVB 1B9MA 3GTMH 1CI3M 1FL0A 1B7YB 1PRTC 3DM1A 4R4QA 1FJGL 3TP6A 4F88A 1WFQA 3AEVA 1A2TA 2PW5A 1Y8PB 4XDXA 1HTPA 4L5TA 5CV4A 5IIFA 4H44C 1O7IA 1CKOA 3MWYW 2B8GA 2AWNA 4RFBA 4YWLA 1EWCA 3K5LA 3I91A 4YIJA 3PCOB 1PTOF 1SNQA 1NSNS 2K5DA 1PFBA 3PO3H 5A35A 1HJPA 1LT3D 5M5XH 4HAEA 3K5NA 1R9TH 1LV9A 3MFGA 1JMCA 2Q2UA 3GTOB 1Q82C 4XYQA 2QKIC 2BDOA 2VQFQ 4I7AA 4UDUC 4BXXG 1FGBD 3UE0A 2E75C 5JVH3 1SAPA 4J15A 4OELB 4TQUS 5FJ8H 1TS3A 1LACA 4DV5Q 1VQ6A 4DR6Q 2A69D 4HSPA 4F87A 2ZTEA 4B9WA 4J1MA 1AZPA 1RHPA 1UEAB 1PFMA 5C44G 1TWFH 3U58A 1BOSA 3CF5A 4POFA 1HRJA 2EXZA 1I6VC 5GAEC 2A6ED 1H9SB 1SNCA 4B3SL 3GTQH 3A5UA 1KD1C 5IGEA 4QMGA 5LMNQ 1WYDA 1FVIA 2L0CA 3U50C 3S9WA 1EOTA 4A3KG 1PFSA 1NUCA 2ZT9C 4AQYQ 4Q5VA 3ERQA 5LL6S 2EIFA 5CV6A 4DV0Q 1I5FA 1ONLA 4A3BH 4MIUA 1HNZQ 4K8IA 4DR5Q 3EA6A 1HZ9A 1ZXTA 3CD6A 3HP3A 2MUYA 4OWWB 3J81E 1STHA 2XGTA 2ENBA 3V96A 2F4IA 2UXBL 1E1TA 2VNUD 3I2ZA 1UE7A 3KK7A 1NBWA 3SXHA 4OO1H 5J3BA 1EL0A 2K4KA 2VB3X 1YEZA 4WORA 3D6CA 2RBMA 2EYOA 3RZOB 3K57A 2B2YC 1BR9A 1S72A 2VL6A 4FF3A 1TWFB 2B39A 2KHJA 4A93B 2IL8A 1D8LA 1J5EQ 1GHKA 4IJLA 3H91A 3S15B 5GAGC 1KL9A 3A5ZB 2Q2TA 2Q2HA 1M1KC 4QF4A 2M9VA 5C0XH 4JPBW 4A3IH 3QWNA 2Q8RE 1QZHA 2V4DA 3GTPH 1LLRD 2RKSA 1VQ5A 3RZDH 3W3AA 1XJVA 3GDEA 1F2LA 1EU4A 4QUFA 4J8QA 4JI4L 3S1QB 1K28A 3EJIA 3CCUA 5IYCG 1BF4A 2Y0SE 2QCPX 4CDCC 3RZDB 2PI2E 1DXMA 3CCLA 1ASZA 2G9HD 3N52A 3TMEA 3AB9A 3X3NA 5EQ0A 3EROA 4B3TL 4L5SA 1R9TB 5JAVA 4RHRA 3ULJA 4DXFA 2VUMB 4ZK9B 4G7HC 2R92H 2JA5G 1WCMG 4CKBA 1VMCA 5C0XJ 2JA7H 4POGA 3CQZH 4IUVA 1B1ZA 1JCKB 3T1YL 5IT9L 1WVLA 1YIJA 1CKNA 1IKMA 1I4RA 1EIYB 3PO2H 4JI4Q 1JORA 4BBRB 1CK1A 3BDOA 4A3LG 1EQVA 1I4PA 3L9AX 2WAQB 4GKJQ 3L2PA 2ASBA 3NTKA 4L63B 1HZBA 1KLGD 1RJTA 2ICIA 3C3LA 4LK1C 1L0WA 1J5EL 4DV1L 5GROA 1PZJD 3I4OA 2WFWA 4HIDA 1CT1D 1OXSC 2F0KA 1D5ZC 3PIPA 5E1FA 4DR7Q 1DD2A 1UEBA 3HOVH 3K58A 5ELEA 5EBDA 3HOXG 1MIUA 4UP7A 4C3IG 1YJ9A 5C3EG 1GM5A 1RTOA 1C4QA 3DWAA 2CKZB 4JI7Q 2B8FA 3GTJB 2XVSA 1IYUA 4WRDA 4UY8C 4K5WA 4IUNA 1UNSA 1F9QA 1ESFA 3KF6B 4JVZA 3MAQA 4A3BG 3NXWA 3C1FA 4BBSG 4AQYL 1QB5D 2D62A 3HOWG 2O5JC 5ELDA 3W1GA 2HDLA 3KFUA 3SK5A 3VA5A 2AWOA 4GOPC 3HOVG 4KTAA 1B50A 1TIID 2A6HC 3HGBA 3KLSA 3FP9A 2FXQA 4IPHA 2WP8J 3NENA 1HPCA 4O42A 5AFWA 4X64L 3C1EA 3I4NG 2X69A 4IFDG 4BXXH 1Z6HA 4KKUA 4OWTB 3S24A 1QVCA 1SNOA 2G5DA 4IJHA 2KEDA 1KAWA 4BY7B 3TP8A 2F0WA 3CC7A 4L5QA 1P16A 2RDGA 2A73B 3HKZG 1LT4D 2KVMA 1ENAA 1MD2D 3ITPA 1HFGA 1IZ6A 3KOJA 2F0JA 1G51A 3PUXA 2R7ZB 1GUWA 3AQQA 1AEXA 4UPAA 2I46A 4G4KA 1PTOB 3PIO3 4RGOS 3P1HA 1EQQA 2EJGC 1L0XB 1ASYA 3PQIA 2WACA 1BNZA 3OWEB 1QOHA 1LTRD 2ZM6Q 3OW2A 3MVVA 3LWUA 4HEDA 3MA2B 4OIJA 1AN8A 1B9NA 3SVMA 4JBMA 3K7AB 2ZTDA 2RQXA 3U9SA 4ZYSA 2K05A 3A8IE 3ZJYC 1B2TA 1F9SA 5EGTA 5GAHC 1BQQT 4OL7A 2R92G 4GKJL 2H4OA 4A4IA 2YU9B 2OQKA 3Q8DA 3IRBA 1QWYA 1IW7D 2KJXA 2NVYB 5JEAH 1A3UA 5KYLA 1G2SA 4NDXA 2QILA 1EY7A 3DHQA 4JI8Q 1ENCA 1OXUA 2D2CC 2D0OA 3RLOA 4HIOA 3HEJA 2Z6KA 5HY6A 4ZUIA 4FDBA 2IHFA 1A8VA 3FVQA 3F2DA 2K5VA 2ZXRA 3PO2B 3GV6A 2CCZA 3EBEA 4HN7A 2MFIA 3QIAA 1V8QA 1TWCB 2B63H 2WINB 2UUCL 1C0AA 1TXYA 3M9BA 4GN4B 4CHTB 1EY5A 5M5WH 2JK8A 4HJ8A 4M8AA 4OIKA 1AZQA 3CC4A 2PMZB 5IWAQ 4LF5Q 3HOUH 2ZJQA 4MTKA 2EY5A 3I8ZA 3D4DA 3BYTB 2X6GA 3A7AB 4JI3Q 4C2MH 1QUQA 2KA7A 1MGSA 2HCIA 1SDFA 2A6HD 3AFQA 5ISRA 2XWJB 2AQ3B 3TQYA 1RTNA 4J6HA 3RUZA 3R2TA 2F0FA 5IYCH 2SDFA 4K0KQ 2EYMA 1R4QB 4YWKA 3TZUA 1XYIA 1N32L 3DMUA 1HR0Q 3WDNA 2B63G 1O78A 4PZ6A 5C44H 3CHBD 1GXDC 5JPNC 4JCVE 3H0GH 1IBLQ 2NZHA 2OTLA 1NMFA 1DOMA 1WCMH 2HQEA 1Y69U 2UXDQ 2RCNA 3Q0AA 5C4ZA 1E2VA 1ET6A 3HOZB
chains in the Genus database with same CATH topology
4A3KH 3CCMA 3VDYA 1VQDA 1S3OA 4UP9A 4NXML 3I4MH 1E3PA 1YITA 5C4XH 3J81i 4OX9Q 1I6HH 1GD7A 3D0FA 4P74A 3UDIA 2ZM6L 1Q81C 2NVXH 1TWCH 1N33L 3ERSX 1L1OA 3G6EA 5LMUL 1VQAA 4NXNL 1VQHA 4YY3L 1IBLL 2K5NA 3J81c 4QJFA 1I50H 3I4NH 5FJ8G 2R93G 2HHHL 1G6PA 1I3QH 1W2BA 2B29A 1KC8C 2CWAA 4JI0L 2PMZE 1XTDA 1Q8KA 1IYJB 4AH6A 1LUZA 2ATWA 3EN2A 4WJ3M 2MQHA 4NPSA 4IPGA 1IBKQ 4KHPL 3J80c 3A0JA 5LMNW 4GOPB 3MEFA 3HOYG 1VQKA 4A3DH 3CCVA 4IO9A 4LFAL 4OONA 4LUVA 2R7FA 4BBRH 5IYDH 4DR6L 4YCVA 4JV5Q 3TS2A 4DV2L 3J80i 3PGZA 4JBKA 4KHZA 1K83H 4XTCS 3S15H 2YTXA 4DK3C 2PNHA 4JI2L 4DV2Q 4A3MG 3J7A5 1E7ZA 3AFPA 2E5LL 4DKAC 1XPUA 4JI5L 1GKHA 3FHWA 4PMWA 3TS0A 2PQAA 2NVTH 4DR1L 4DV5L 3PIOA 4A3JG 4A3FG 4AYBE 4IFDJ 2CQOA 3BJUA 4GLVB 5DLQE 1NJIC 3GTMH 4JV5L 1KIXA 1FL0A 3F2BA 2OTLA 1YHQA 1VQ7A 3L7ZC 1JJGA 1B7YB 1BBUA 3RZOH 4B3RQ 4LFAQ 1VQFA 1YVCA 4R4QA 1FJGL 2N8NA 4X66L 1PH9A 2N78A 4KHPQ 4RMFA 3S1QH 3HOUG 1WFQA 2JA8G 3AEVA 4A3EG 4GOPA 2F3IA 3CCQA 3CPFA 1PA6A 1PH7A 2ID0A 1PHJA 4JI0Q 3HOWH 2OWOA 4L5TA 2UXBQ 2KBNA 4O2DA 1X55A 4QIWE 4A3MH 1O7IA 4GN3B 3S14H 2KCMA 4DUZQ 1CKOA 3PV0A 1V1QA 5LMUQ 1KHIA 4LWCA 1HNXQ 2E2IH 2AWNA 3PUVA 4LFCL 4YWLA 4DR5L 4JI1L 2V1CC 3K7UC 5ELOA 1N36Q 1XNRL 1Q46A 1GO3E 2OTJA 1A62A 4IPCA 1HNWQ 1VQCA 2GVBA 3PCOB 2NVYH 1AH9A 2JEBI 1VQPA 1HR0L 3F1ZA 1D7QA 4JG2A 4HJ5A 2I0QA 3HOZG 2K5HA 4ME3A 1XNQL 4LFCQ 3PF4A 1N36L 3PO3H 1HJPA 1JB7A 2UXDL 4R4IA 5M5XH 1VQBA 5GQOA 4X66Q 4YCWA 4JC0A 3LGJA 3RN5A 4B3RL 1EOVA 4DV6Q 1PYBA 4MZ9A 1B8AA 3T1HL 1R9TH 1HH2P 2WB1E 4DV4L 1JMCA 2Q2UA 1YHAA 2BA0A 4IPDA 4DNIA 1Q82C 2OQ0A 5C4JH 4IOCA 2VQFQ 4BXXG 4DR1Q 3UE0A 4K0KL 3S1NH 4O0AA 5IY0A 1X6OA 2HIVA 4J15A 4LF7L 3PUWA 4R4CA 5K36G 1K8AC 4TQUS 5FJ8H 1VQGA 4PZ8A 4X64Q 2IY5B 1T9HA 2B3GA 2AHOB 2R7ZH 3EIVA 3UDGA 1G291 4DV5Q 1VQ6A 3M4PA 1EYGA 1N8RC 3FKIG 3TRZA 4DR6Q 5IWAL 2ZTEA 3GTJH 1LTLA 4AYBG 3CMEA 1I94L 5C44G 4LF8Q 1VQJA 1TWFH 4JI2Q 2UUCQ 1AE2A 3U58A 3CF5A 4POFA 4A93H 5GAEC 2K50A 4BY7G 4LNQA 4HIKA 1SN8A 3PO2G 2VY3A 5IE8A 1OXVA 2RHSB 3RLFA 4KLKA 4DR4Q 3BU2A 1YJWA 1X9NA 4DV6L 2MO1A 4B3SL 3GTQH 3A5UA 1KD1C 1OTCA 1KRSA 5LMNQ 1WYDA 1BKBA 1FVIA 3U50C 4A3KG 1PFSA 4AQYQ 1XNQQ 3I4MG 3CAMA 4A3DG 3S2DH 4A3JH 3S17H 2EIFA 1EWIA 3NELA 2CWPA 4JOIC 1EIFA 1I5FA 4DV0Q 1QUQB 4NXMQ 2R7ZG 4A3BH 4IFDI 1HNWL 1C7YA 3G48A 1Z47A 2QGQA 4A3CG 5JJLA 2WAQG 2EXDA 2I5HA 1HNZQ 4DR5Q 4GKKQ 1HZ9A 2NZOA 1LYLA 3PUZA 3CD6A 1JT8A 1W3SA 5M3MG 4DV7L 1YI2A 2VW9A 4OWWB 2JA8H 4DPGA 1N34L 2XGTA 3CPWA 4BY7H 4LF6L 2UXBL 1E1TA 2VNUD 3I2ZA 2R6GA 1UE7A 4GLXA 1NBWA 2ZJPA 1N32Q 1EUJA 2E8GA 4AIMA 5IYDG 1UE1A 4DV3L 1VQ4A 1PH4A 1TWAH 4LW1A 5J3BA 2K4KA 3S16H 1V43A 1YEZA 5M3FG 4QQBX 3KJOA 3HOXH 2UUAQ 5IP9H 5AJ3L 2BA1A 4GNXC 2HT1A 1IBML 3SGIA 2YU9H 1S72A 2VL6A 2IX1A 2IX0A 2KHJA 5FLMG 1D8LA 1J5EQ 4DV3Q 2E2HH 2UXCL 4LF5L 2MNAA 4IJLA 1SLJA 5GAGC 4Y7NH 1PH1A 3KJPA 1KL9A 3A5ZB 3W5OA 2HQLA 2Q2HA 2VQEL 3S1RH 2Q2TA 4JI6L 4R1JA 1M1KC 4A3IH 3DLLA 4X62L 4DR3L 1VQOA 4BBSH 3T1YQ 1QZHA 5BR8Q 1K9MC 3H0GG 4JYAQ 3GTPH 4YCUA 4YHHQ 1VQ5A 3RZDH 2NVQH 3GD7A 4GKKL 4PG3A 5JEAJ 1XJVA 3GDEA 1IXRA 1VQNA 1E22A 1WI5A 4JI4L 1DGSA 5M3FH 2UUBQ 1CKMA 2NN6G 3CCUA 3KLWA 5IYCG 1Y14B 3OTOL 3UE1A 2Y0SE 2IT1A 1IBKL 3KF8B 2PI2E 3CCLA 1ASZA 1PH8A 3PUYA 4Y52H 1WJJA 2N49A 1KXLA 4DK6C 4GLAC 1IBLQ 2I5MX 2IHEA 1RIPA 3OTOQ 2LXKA 4B3TL 4L5SA 4JOIA 3ULJA 4B3SQ 1RL2A 3NBHB 1V9PA 1VQMA 2R92H 2JA5G 4YY3Q 3GTLH 1Q1BA 1WCMG 1HR0W 4YWMA 3K0XA 3RR5A 2HIXA 1H95A 1XPRA 1SMXA 4A75A 4YHHL 5C0XJ 4JBWA 2I5LX 4BY1G 5JEAG 5C0XI 4POGA 2JA7H 3CQZH 3T1YL 3HOZH 1PH5A 1YIJA 3WWVA 4LF8L 1CKNA 2Q2IA 2DUDA 3KDFA 4LFBL 4KI0A 3UDXA 1EIYB 3CXCA 4LF9L 4P72A 3PO2H 4C3HH 4JI4Q 3BZKA 2ES2A 4A3LG 1Q1EA 1VS0A 2KCTA 1E24A 3J81j 1A0IA 3HFZB 3L2PA 4GKJQ 1CUKA 2ASBA 5H1SE 3B6YA 1SROA 3KF6A 2C35B 5IT9c 1HZBA 4LF7Q 3E9IA 1K3RA 3F8TA 3CCJA 1E1OA 4X65Q 3L0OA 2QA4A 4DV1Q 1L0WA 3U4ZA 1J5EL 1X56A 2LXJA 3HOYH 4DV1L 2RF4A 5GROA 3K8AA 1L1OC 2AKWB 2WB1G 4A3FH 4BY1H 2JA7G 3I4OA 1PH2A 2WFWA 1VQEA 4B3ML 2YTVA 1KQSA 4HIDA 4NB3A 2K52A 1OXSC 3CW2C 3TEHB 4JI3L 2UU9Q 1Y1WG 3PIPA 4DUYL 4A3GG 4GNXB 4DR7Q 1UEBA 1XMQQ 1L2FA 2JA6G 1JJCB 5GADC 5ELNA 3HOVH 1N9WA 1PYSB 4X65L 4A93G 4MNOA 4RG1A 3HOXG 1MIUA 3M4QA 4UP7A 5IP9G 4DR2L 1YJ9A 5C3EG 4GNXA 1GM5A 2CKZB 4DV7Q 4JI7Q 3MXNB 3BZCA 4WJ4A 3KYHC 5LMNL 3OYYA 4UY8C 1UWVA 2Z6KC 3CP0A 3RN2A 1YJNA 1XMOQ 1M90C 4LF4L 3CC2A 2F4VL 4LF9Q 4DR4L 4BA1I 4HJ9A 3KF6B 3M85A 1NE3A 3RNUA 4GS3A 4A3BG 1PH3A 2ZTCA 5C0XG 4A3IG 3S1MH 3M3YH 2D0PA 4BBSG 4A3EH 1BBWA 4AQYL 3HOWG 1HZAA 2D62A 3E9HA 1CSPA 3PSIA 3W1GA 1SFOH 3KFUA 4JI8L 1FJGQ 2JA6H 4DAMA 2AWOA 4GOPC 3HOVG 1QVGA 2KHIA 2ALYB 4EX5A 1JE5A 3FP9A 4C3IH 2FXQA 4IPHA 2WP8J 1P8LA 2VUMG 3M4OH 2K75A 3NENA 3PF5A 3GTOH 4JI7L 1KRTA 4X64L 1QZGA 3ICEA 3I4NG 4IFDG 4X62Q 4BXXH 1I94Q 1X3FA 3K7AH 1OXXK 4OWTB 3S24A 2VQEQ 1QVCA 2NN6I 4JBJA 2YV5A 1Z9FA 1MJEA 1OXTA 2E5LQ 4MTNA 3ULPA 1XMOL 4IJHA 4QY7A 1KAWA 2UXCQ 3DM3A 2JA5H 1Y1VG 2OCEA 1EQRA 4L5QA 3CC7A 1P16A 4DR7L 4ALPA 1EFWA 4APVA 3HKZG 4JYAL 2RHQB 4BBRG 1U5KA 2PI2A 3KDFB 4DR3Q 3CCRA 1X65A 3T1HQ 4DR2Q 1IZ6A 3KOJA 1IBMQ 1MKHA 2E2JH 4JI6Q 5E7NA 5EAYA 3JAMi 3S2HH 2YYZA 1A63A 1G51A 1TWGH 1YHBA 3PUXA 2GN5A 2BH8A 2YTYA 2ZJRA 3AQQA 1YNXA 4H02A 4UPAA 3STBC 4HJAA 1XMQL 1K8GA 3JAMc 4DUYQ 1QVFA 2JQOA 1NY4A 4R4TA 1S40A 4EQ5A 4HIMA 1C9OA 1UE6A 2HHHQ 1X54A 1EQQA 1X3GA 4B3MQ 1ASYA 3U4VA 4NXNQ 1IL2A 4L5RC 2R7DA 1HZCA 3H3VI 2Z0SA 2WAQE 1CSQA 4X6AH 3I7FA 3CMAA 2JA9A 4LUZA 2ZM6Q 3OW2A 5JJKA 1Y1VH 3GO5A 4DUZL 1NMGA 2R93H 1CKNB 1Q7YC 2KENA 1SR3A 4JBMA 2A19A 4LF6Q 4LFBQ 3G71A 2ZTDA 4XIGS 1PH6A 1N34Q 3ZJYC 2A1AA 3JC66 4A3CH 2DGYA 4JI1Q 3CCEA 1XNRQ 5GAHC 2N3SA 2R92G 4GKJL 2JEAI 1VQIA 4P75A 4A4IA 5IYBH 1U0LA 2JE6I 2OQKA 3IRBA 3Q8DA 4C3JH 1K73C 1HNZL 3F2CA 4TVAB 5M3MH 1PVOA 4JI8Q 3G4SA 3M7NA 4B3TQ 3H15A 1OXUA 2D0OA 4DV0L 3RLOA 4HIOA 4UP8A 5C3EH 3STBD 2Z6KA 5HY6A 4FDBA 2IHFA 1A8VA 3E0EA 4R4OA 4A3LH 1GVPA 3F2DA 1LM0A 3TREA 3H3VH 2CFMA 2K5VA 1JJ2A 4LF4Q 2F4VQ 2VS1A 3PO3G 1VQ9A 1X3EA 5M5YH 2CCZA 2F52A 3EBEA 2MFIA 1YBYA 3K80C 4GN5A 2B63H 3GTGH 2UUCL 5IP7H 1C0AA 5BR8L 1TXYA 3M9BA 1Q12A 4GN4B 5M5WH 5FLMH 2JK8A 4OWXB 4HJ8A 1SE8A 3CCSA 4JI5Q 1VQLA 1BVSA 5IYBG 4IOAA 1PV4A 2UUBL 3CC4A 5IWAQ 3UDFA 2L15A 3HKZE 4LF5Q 3HOUH 2ZJQA 4HJ7A 4OO1G 2XTIA 4OO1I 1L1OB 2K14A 4PZ7A 2VQFL 4QL5A 5JJIA 2Y0SG 5AJ3Q 1Y1WH 2VUMH 2LSSA 4C2MH 2UU9L 4JI3Q 4A3GH 1QUQA 3AFQA 1XPOA 1VCIA 3AYHB 5C4XG 1SRUA 3RLNA 3TQYA 1K0RA 4LUOA 3NEMA 5IYCH 1N33Q 2VZAA 4K0KQ 2H5XA 3FKIH 1FGUA 2MO0A 2GVAA 4YWKA 2JJQA 3J7ZC 1N32L 1VQ8A 3ULLA 1HR0Q 2B63G 5HGQA 5IP7G 2UUAL 4DV4Q 1TWHH 4A76A 1MJCA 4PZ6A 3HKSA 5C44H 4BA2I 3ER0A 1Q86C 4JCVE 1YZ6A 1B70B 3H0GH 1WOCA 2NZHA 3K81C 2EQSA 1NMFA 3D31A 3W1BA 4OXPA 1J6QA 4P71A 1NTGA 4DAYB 5FLXc 2QEXA 1WCMH 2AMCB 3I55A 1HNXL 2UXDQ 3A74A 2RCNA 1UE5A 2BH2A 3I56A 4OX9L 2A8VA 1AE3A 3GTKH 4P73A 4QGUA 2PQAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3K H;  3CCM A;  3VDY A;  1VQD A;  1S3O A;  4UP9 A;  4NXM L;  3I4M H;  1E3P A;  1YIT A;  5C4X H;  3J81 i;  4OX9 Q;  1I6H H;  1GD7 A;  3D0F A;  4P74 A;  3UDI A;  2ZM6 L;  1Q81 C;  2NVX H;  1TWC H;  1N33 L;  3ERS X;  1L1O A;  3G6E A;  5LMU L;  1VQA A;  4NXN L;  1VQH A;  4YY3 L;  1IBL L;  2K5N A;  3J81 c;  4QJF A;  1I50 H;  3I4N H;  5FJ8 G;  2R93 G;  2HHH L;  1G6P A;  1I3Q H;  1W2B A;  2B29 A;  1KC8 C;  2CWA A;  4JI0 L;  2PMZ E;  1XTD A;  1Q8K A;  1IYJ B;  4AH6 A;  1LUZ A;  2ATW A;  3EN2 A;  4WJ3 M;  2MQH A;  4NPS A;  4IPG A;  1IBK Q;  4KHP L;  3J80 c;  3A0J A;  5LMN W;  4GOP B;  3MEF A;  3HOY G;  1VQK A;  4A3D H;  3CCV A;  4IO9 A;  4LFA L;  4OON A;  4LUV A;  2R7F A;  4BBR H;  5IYD H;  4DR6 L;  4YCV A;  4JV5 Q;  3TS2 A;  4DV2 L;  3J80 i;  3PGZ A;  4JBK A;  4KHZ A;  1K83 H;  4XTC S;  3S15 H;  2YTX A;  4DK3 C;  2PNH A;  4JI2 L;  4DV2 Q;  4A3M G;  3J7A 5;  1E7Z A;  3AFP A;  2E5L L;  4DKA C;  1XPU A;  4JI5 L;  1GKH A;  3FHW A;  4PMW A;  3TS0 A;  2PQA A;  2NVT H;  4DR1 L;  4DV5 L;  3PIO A;  4A3J G;  4A3F G;  4AYB E;  4IFD J;  2CQO A;  3BJU A;  4GLV B;  5DLQ E;  1NJI C;  3GTM H;  4JV5 L;  1KIX A;  1FL0 A;  3F2B A;  2OTL A;  1YHQ A;  1VQ7 A;  3L7Z C;  1JJG A;  1B7Y B;  1BBU A;  3RZO H;  4B3R Q;  4LFA Q;  1VQF A;  1YVC A;  4R4Q A;  1FJG L;  2N8N A;  4X66 L;  1PH9 A;  2N78 A;  4KHP Q;  4RMF A;  3S1Q H;  3HOU G;  1WFQ A;  2JA8 G;  3AEV A;  4A3E G;  4GOP A;  2F3I A;  3CCQ A;  3CPF A;  1PA6 A;  1PH7 A;  2ID0 A;  1PHJ A;  4JI0 Q;  3HOW H;  2OWO A;  4L5T A;  2UXB Q;  2KBN A;  4O2D A;  1X55 A;  4QIW E;  4A3M H;  1O7I A;  4GN3 B;  3S14 H;  2KCM A;  4DUZ Q;  1CKO A;  3PV0 A;  1V1Q A;  5LMU Q;  1KHI A;  4LWC A;  1HNX Q;  2E2I H;  2AWN A;  3PUV A;  4LFC L;  4YWL A;  4DR5 L;  4JI1 L;  2V1C C;  3K7U C;  5ELO A;  1N36 Q;  1XNR L;  1Q46 A;  1GO3 E;  2OTJ A;  1A62 A;  4IPC A;  1HNW Q;  1VQC A;  2GVB A;  3PCO B;  2NVY H;  1AH9 A;  2JEB I;  1VQP A;  1HR0 L;  3F1Z A;  1D7Q A;  4JG2 A;  4HJ5 A;  2I0Q A;  3HOZ G;  2K5H A;  4ME3 A;  1XNQ L;  4LFC Q;  3PF4 A;  1N36 L;  3PO3 H;  1HJP A;  1JB7 A;  2UXD L;  4R4I A;  5M5X H;  1VQB A;  5GQO A;  4X66 Q;  4YCW A;  4JC0 A;  3LGJ A;  3RN5 A;  4B3R L;  1EOV A;  4DV6 Q;  1PYB A;  4MZ9 A;  1B8A A;  3T1H L;  1R9T H;  1HH2 P;  2WB1 E;  4DV4 L;  1JMC A;  2Q2U A;  1YHA A;  2BA0 A;  4IPD A;  4DNI A;  1Q82 C;  2OQ0 A;  5C4J H;  4IOC A;  2VQF Q;  4BXX G;  4DR1 Q;  3UE0 A;  4K0K L;  3S1N H;  4O0A A;  5IY0 A;  1X6O A;  2HIV A;  4J15 A;  4LF7 L;  3PUW A;  4R4C A;  5K36 G;  1K8A C;  4TQU S;  5FJ8 H;  1VQG A;  4PZ8 A;  4X64 Q;  2IY5 B;  1T9H A;  2B3G A;  2AHO B;  2R7Z H;  3EIV A;  3UDG A;  1G29 1;  4DV5 Q;  1VQ6 A;  3M4P A;  1EYG A;  1N8R C;  3FKI G;  3TRZ A;  4DR6 Q;  5IWA L;  2ZTE A;  3GTJ H;  1LTL A;  4AYB G;  3CME A;  1I94 L;  5C44 G;  4LF8 Q;  1VQJ A;  1TWF H;  4JI2 Q;  2UUC Q;  1AE2 A;  3U58 A;  3CF5 A;  4POF A;  4A93 H;  5GAE C;  2K50 A;  4BY7 G;  4LNQ A;  4HIK A;  1SN8 A;  3PO2 G;  2VY3 A;  5IE8 A;  1OXV A;  2RHS B;  3RLF A;  4KLK A;  4DR4 Q;  3BU2 A;  1YJW A;  1X9N A;  4DV6 L;  2MO1 A;  4B3S L;  3GTQ H;  3A5U A;  1KD1 C;  1OTC A;  1KRS A;  5LMN Q;  1WYD A;  1BKB A;  1FVI A;  3U50 C;  4A3K G;  1PFS A;  4AQY Q;  1XNQ Q;  3I4M G;  3CAM A;  4A3D G;  3S2D H;  4A3J H;  3S17 H;  2EIF A;  1EWI A;  3NEL A;  2CWP A;  4JOI C;  1EIF A;  1I5F A;  4DV0 Q;  1QUQ B;  4NXM Q;  2R7Z G;  4A3B H;  4IFD I;  1HNW L;  1C7Y A;  3G48 A;  1Z47 A;  2QGQ A;  4A3C G;  5JJL A;  2WAQ G;  2EXD A;  2I5H A;  1HNZ Q;  4DR5 Q;  4GKK Q;  1HZ9 A;  2NZO A;  1LYL A;  3PUZ A;  3CD6 A;  1JT8 A;  1W3S A;  5M3M G;  4DV7 L;  1YI2 A;  2VW9 A;  4OWW B;  2JA8 H;  4DPG A;  1N34 L;  2XGT A;  3CPW A;  4BY7 H;  4LF6 L;  2UXB L;  1E1T A;  2VNU D;  3I2Z A;  2R6G A;  1UE7 A;  4GLX A;  1NBW A;  2ZJP A;  1N32 Q;  1EUJ A;  2E8G A;  4AIM A;  5IYD G;  1UE1 A;  4DV3 L;  1VQ4 A;  1PH4 A;  1TWA H;  4LW1 A;  5J3B A;  2K4K A;  3S16 H;  1V43 A;  1YEZ A;  5M3F G;  4QQB X;  3KJO A;  3HOX H;  2UUA Q;  5IP9 H;  5AJ3 L;  2BA1 A;  4GNX C;  2HT1 A;  1IBM L;  3SGI A;  2YU9 H;  1S72 A;  2VL6 A;  2IX1 A;  2IX0 A;  2KHJ A;  5FLM G;  1D8L A;  1J5E Q;  4DV3 Q;  2E2H H;  2UXC L;  4LF5 L;  2MNA A;  4IJL A;  1SLJ A;  5GAG C;  4Y7N H;  1PH1 A;  3KJP A;  1KL9 A;  3A5Z B;  3W5O A;  2HQL A;  2Q2H A;  2VQE L;  3S1R H;  2Q2T A;  4JI6 L;  4R1J A;  1M1K C;  4A3I H;  3DLL A;  4X62 L;  4DR3 L;  1VQO A;  4BBS H;  3T1Y Q;  1QZH A;  5BR8 Q;  1K9M C;  3H0G G;  4JYA Q;  3GTP H;  4YCU A;  4YHH Q;  1VQ5 A;  3RZD H;  2NVQ H;  3GD7 A;  4GKK L;  4PG3 A;  5JEA J;  1XJV A;  3GDE A;  1IXR A;  1VQN A;  1E22 A;  1WI5 A;  4JI4 L;  1DGS A;  5M3F H;  2UUB Q;  1CKM A;  2NN6 G;  3CCU A;  3KLW A;  5IYC G;  1Y14 B;  3OTO L;  3UE1 A;  2Y0S E;  2IT1 A;  1IBK L;  3KF8 B;  2PI2 E;  3CCL A;  1ASZ A;  1PH8 A;  3PUY A;  4Y52 H;  1WJJ A;  2N49 A;  1KXL A;  4DK6 C;  4GLA C;  1IBL Q;  2I5M X;  2IHE A;  1RIP A;  3OTO Q;  2LXK A;  4B3T L;  4L5S A;  4JOI A;  3ULJ A;  4B3S Q;  1RL2 A;  3NBH B;  1V9P A;  1VQM A;  2R92 H;  2JA5 G;  4YY3 Q;  3GTL H;  1Q1B A;  1WCM G;  1HR0 W;  4YWM A;  3K0X A;  3RR5 A;  2HIX A;  1H95 A;  1XPR A;  1SMX A;  4A75 A;  4YHH L;  5C0X J;  4JBW A;  2I5L X;  4BY1 G;  5JEA G;  5C0X I;  4POG A;  2JA7 H;  3CQZ H;  3T1Y L;  3HOZ H;  1PH5 A;  1YIJ A;  3WWV A;  4LF8 L;  1CKN A;  2Q2I A;  2DUD A;  3KDF A;  4LFB L;  4KI0 A;  3UDX A;  1EIY B;  3CXC A;  4LF9 L;  4P72 A;  3PO2 H;  4C3H H;  4JI4 Q;  3BZK A;  2ES2 A;  4A3L G;  1Q1E A;  1VS0 A;  2KCT A;  1E24 A;  3J81 j;  1A0I A;  3HFZ B;  3L2P A;  4GKJ Q;  1CUK A;  2ASB A;  5H1S E;  3B6Y A;  1SRO A;  3KF6 A;  2C35 B;  5IT9 c;  1HZB A;  4LF7 Q;  3E9I A;  1K3R A;  3F8T A;  3CCJ A;  1E1O A;  4X65 Q;  3L0O A;  2QA4 A;  4DV1 Q;  1L0W A;  3U4Z A;  1J5E L;  1X56 A;  2LXJ A;  3HOY H;  4DV1 L;  2RF4 A;  5GRO A;  3K8A A;  1L1O C;  2AKW B;  2WB1 G;  4A3F H;  4BY1 H;  2JA7 G;  3I4O A;  1PH2 A;  2WFW A;  1VQE A;  4B3M L;  2YTV A;  1KQS A;  4HID A;  4NB3 A;  2K52 A;  1OXS C;  3CW2 C;  3TEH B;  4JI3 L;  2UU9 Q;  1Y1W G;  3PIP A;  4DUY L;  4A3G G;  4GNX B;  4DR7 Q;  1UEB A;  1XMQ Q;  1L2F A;  2JA6 G;  1JJC B;  5GAD C;  5ELN A;  3HOV H;  1N9W A;  1PYS B;  4X65 L;  4A93 G;  4MNO A;  4RG1 A;  3HOX G;  1MIU A;  3M4Q A;  4UP7 A;  5IP9 G;  4DR2 L;  1YJ9 A;  5C3E G;  4GNX A;  1GM5 A;  2CKZ B;  4DV7 Q;  4JI7 Q;  3MXN B;  3BZC A;  4WJ4 A;  3KYH C;  5LMN L;  3OYY A;  4UY8 C;  1UWV A;  2Z6K C;  3CP0 A;  3RN2 A;  1YJN A;  1XMO Q;  1M90 C;  4LF4 L;  3CC2 A;  2F4V L;  4LF9 Q;  4DR4 L;  4BA1 I;  4HJ9 A;  3KF6 B;  3M85 A;  1NE3 A;  3RNU A;  4GS3 A;  4A3B G;  1PH3 A;  2ZTC A;  5C0X G;  4A3I G;  3S1M H;  3M3Y H;  2D0P A;  4BBS G;  4A3E H;  1BBW A;  4AQY L;  3HOW G;  1HZA A;  2D62 A;  3E9H A;  1CSP A;  3PSI A;  3W1G A;  1SFO H;  3KFU A;  4JI8 L;  1FJG Q;  2JA6 H;  4DAM A;  2AWO A;  4GOP C;  3HOV G;  1QVG A;  2KHI A;  2ALY B;  4EX5 A;  1JE5 A;  3FP9 A;  4C3I H;  2FXQ A;  4IPH A;  2WP8 J;  1P8L A;  2VUM G;  3M4O H;  2K75 A;  3NEN A;  3PF5 A;  3GTO H;  4JI7 L;  1KRT A;  4X64 L;  1QZG A;  3ICE A;  3I4N G;  4IFD G;  4X62 Q;  4BXX H;  1I94 Q;  1X3F A;  3K7A H;  1OXX K;  4OWT B;  3S24 A;  2VQE Q;  1QVC A;  2NN6 I;  4JBJ A;  2YV5 A;  1Z9F A;  1MJE A;  1OXT A;  2E5L Q;  4MTN A;  3ULP A;  1XMO L;  4IJH A;  4QY7 A;  1KAW A;  2UXC Q;  3DM3 A;  2JA5 H;  1Y1V G;  2OCE A;  1EQR A;  4L5Q A;  3CC7 A;  1P16 A;  4DR7 L;  4ALP A;  1EFW A;  4APV A;  3HKZ G;  4JYA L;  2RHQ B;  4BBR G;  1U5K A;  2PI2 A;  3KDF B;  4DR3 Q;  3CCR A;  1X65 A;  3T1H Q;  4DR2 Q;  1IZ6 A;  3KOJ A;  1IBM Q;  1MKH A;  2E2J H;  4JI6 Q;  5E7N A;  5EAY A;  3JAM i;  3S2H H;  2YYZ A;  1A63 A;  1G51 A;  1TWG H;  1YHB A;  3PUX A;  2GN5 A;  2BH8 A;  2YTY A;  2ZJR A;  3AQQ A;  1YNX A;  4H02 A;  4UPA A;  3STB C;  4HJA A;  1XMQ L;  1K8G A;  3JAM c;  4DUY Q;  1QVF A;  2JQO A;  1NY4 A;  4R4T A;  1S40 A;  4EQ5 A;  4HIM A;  1C9O A;  1UE6 A;  2HHH Q;  1X54 A;  1EQQ A;  1X3G A;  4B3M Q;  1ASY A;  3U4V A;  4NXN Q;  1IL2 A;  4L5R C;  2R7D A;  1HZC A;  3H3V I;  2Z0S A;  2WAQ E;  1CSQ A;  4X6A H;  3I7F A;  3CMA A;  2JA9 A;  4LUZ A;  2ZM6 Q;  3OW2 A;  5JJK A;  1Y1V H;  3GO5 A;  4DUZ L;  1NMG A;  2R93 H;  1CKN B;  1Q7Y C;  2KEN A;  1SR3 A;  4JBM A;  2A19 A;  4LF6 Q;  4LFB Q;  3G71 A;  2ZTD A;  4XIG S;  1PH6 A;  1N34 Q;  3ZJY C;  2A1A A;  3JC6 6;  4A3C H;  2DGY A;  4JI1 Q;  3CCE A;  1XNR Q;  5GAH C;  2N3S A;  2R92 G;  4GKJ L;  2JEA I;  1VQI A;  4P75 A;  4A4I A;  5IYB H;  1U0L A;  2JE6 I;  2OQK A;  3IRB A;  3Q8D A;  4C3J H;  1K73 C;  1HNZ L;  3F2C A;  4TVA B;  5M3M H;  1PVO A;  4JI8 Q;  3G4S A;  3M7N A;  4B3T Q;  3H15 A;  1OXU A;  2D0O A;  4DV0 L;  3RLO A;  4HIO A;  4UP8 A;  5C3E H;  3STB D;  2Z6K A;  5HY6 A;  4FDB A;  2IHF A;  1A8V A;  3E0E A;  4R4O A;  4A3L H;  1GVP A;  3F2D A;  1LM0 A;  3TRE A;  3H3V H;  2CFM A;  2K5V A;  1JJ2 A;  4LF4 Q;  2F4V Q;  2VS1 A;  3PO3 G;  1VQ9 A;  1X3E A;  5M5Y H;  2CCZ A;  2F52 A;  3EBE A;  2MFI A;  1YBY A;  3K80 C;  4GN5 A;  2B63 H;  3GTG H;  2UUC L;  5IP7 H;  1C0A A;  5BR8 L;  1TXY A;  3M9B A;  1Q12 A;  4GN4 B;  5M5W H;  5FLM H;  2JK8 A;  4OWX B;  4HJ8 A;  1SE8 A;  3CCS A;  4JI5 Q;  1VQL A;  1BVS A;  5IYB G;  4IOA A;  1PV4 A;  2UUB L;  3CC4 A;  5IWA Q;  3UDF A;  2L15 A;  3HKZ E;  4LF5 Q;  3HOU H;  2ZJQ A;  4HJ7 A;  4OO1 G;  2XTI A;  4OO1 I;  1L1O B;  2K14 A;  4PZ7 A;  2VQF L;  4QL5 A;  5JJI A;  2Y0S G;  5AJ3 Q;  1Y1W H;  2VUM H;  2LSS A;  4C2M H;  2UU9 L;  4JI3 Q;  4A3G H;  1QUQ A;  3AFQ A;  1XPO A;  1VCI A;  3AYH B;  5C4X G;  1SRU A;  3RLN A;  3TQY A;  1K0R A;  4LUO A;  3NEM A;  5IYC H;  1N33 Q;  2VZA A;  4K0K Q;  2H5X A;  3FKI H;  1FGU A;  2MO0 A;  2GVA A;  4YWK A;  2JJQ A;  3J7Z C;  1N32 L;  1VQ8 A;  3ULL A;  1HR0 Q;  2B63 G;  5HGQ A;  5IP7 G;  2UUA L;  4DV4 Q;  1TWH H;  4A76 A;  1MJC A;  4PZ6 A;  3HKS A;  5C44 H;  4BA2 I;  3ER0 A;  1Q86 C;  4JCV E;  1YZ6 A;  1B70 B;  3H0G H;  1WOC A;  2NZH A;  3K81 C;  2EQS A;  1NMF A;  3D31 A;  3W1B A;  4OXP A;  1J6Q A;  4P71 A;  1NTG A;  4DAY B;  5FLX c;  2QEX A;  1WCM H;  2AMC B;  3I55 A;  1HNX L;  2UXD Q;  3A74 A;  2RCN A;  1UE5 A;  2BH2 A;  3I56 A;  4OX9 L;  2A8V A;  1AE3 A;  3GTK H;  4P73 A;  4QGU A;  2PQA B; 
#chains in the Genus database with same CATH topology
 5FLX E;  1B3A A;  1EYD A;  3VDY A;  4A3K H;  3I70 A;  4NXM L;  4ZLT F;  3E0J A;  4OX9 Q;  1Q81 C;  1SE3 A;  1TWC H;  1TVX A;  3FPP A;  3ERS X;  2EJM A;  2Z4H A;  2J7Z A;  2K5N A;  3J81 c;  3I4N H;  3NHH A;  5EKI A;  4HSV A;  4WFN 3;  2R93 G;  2HHH L;  1W2B A;  5DEH A;  3URY A;  1PRT D;  2CWA A;  2B2U A;  4AH6 A;  3TBI B;  1LUZ A;  5DM7 3;  2MQH A;  1K83 B;  4KHP L;  4X3S A;  3J80 c;  3HOY G;  3MEF A;  1PRT F;  1VQK A;  1O7Z A;  4LFA L;  4IUT A;  4BBR H;  2C5C A;  3TS2 A;  5F2D A;  4KHZ A;  1VDZ A;  1JB3 A;  1IW7 C;  3QOJ A;  4AYB B;  1WTV A;  4G57 A;  4JI5 L;  1L0Y B;  2B2T A;  2WII B;  4DR1 L;  4DV5 L;  3PIO A;  4A3J G;  4A3F G;  1I6H B;  4AYB E;  4IFD J;  1K8M A;  5DLQ E;  1NJI C;  3F2B A;  1ZKO A;  1ILQ A;  1YHQ A;  3L7Z C;  1BBU A;  1VQF A;  2N78 A;  4RMF A;  1QE6 A;  2JA8 G;  5K5P A;  2F3I A;  3M3Y B;  1PA6 A;  1PH7 A;  2OWO A;  2K1B A;  2KBN A;  4O2D A;  1X55 A;  2Z1C A;  4QIW E;  4C3J G;  3S14 H;  2KCM A;  5M3M B;  1CM9 A;  5I6W A;  3OHX C;  3AMU A;  3DWP A;  3NBI A;  1Y1W B;  3OPO A;  1XNR L;  2ZXO A;  2OTJ A;  1ZYR C;  1GO3 E;  2EYH A;  1A62 A;  4IFD H;  3V2T A;  2GVB A;  3TN2 A;  4EGV A;  1AH9 A;  1VQP A;  1HR0 L;  1V1P A;  4OEM B;  1D7Q A;  3CKI B;  4JG2 A;  2K5H A;  1XNQ L;  2F0U A;  1JB7 A;  1STA A;  1Y8N B;  2HCC A;  4HMJ A;  1B8A A;  4RWS C;  1HH2 P;  1A3T A;  3KLR A;  5C4J H;  4IOC A;  3TSS A;  5M5Y B;  2CH4 W;  2CH4 A;  1CHQ D;  3S1N H;  2NN6 H;  4O0A A;  2HIV A;  1UAP A;  5BN5 A;  1WTX A;  1VQG A;  2XWB B;  5IGF A;  2B3G A;  1HHV A;  1EIG A;  2R7Z H;  3EIV A;  4N9P A;  1N8R C;  3GP7 A;  3FKI G;  5CGK A;  1EY0 A;  5J39 A;  5FLX L;  1DOK A;  1LTL A;  2K04 A;  1D5M C;  1VQJ A;  1AE2 A;  4A93 H;  1Z7T A;  4CDE C;  5IE8 A;  3RLF A;  4KLK A;  4DR4 Q;  1X9N A;  5JVG 3;  3UI2 A;  2F0L A;  1KRS A;  5KEE A;  5KGU A;  5EPK A;  5CBA E;  1EEI D;  3AU7 A;  3EFX D;  1XNQ Q;  2F0S A;  4JOI C;  2A5H A;  3NEL A;  2CWP A;  4X3T A;  5E3F A;  1WTO A;  3LX0 A;  1NCV A;  1B4O A;  2QGQ A;  4A3C G;  1TY0 A;  2EXD A;  2I5H A;  4OHJ A;  2NZO A;  4DV7 L;  2DJG C;  4DPG A;  1N34 L;  3CPW A;  3KF8 A;  2ZJP A;  3SR1 A;  1EUJ A;  1LT6 D;  2E8G A;  1UE1 A;  2VB2 X;  1GHJ A;  3OWF A;  3CQZ B;  4H0L C;  2UUA Q;  5IP9 H;  2F0P A;  3IKJ A;  4A3G B;  2XNA C;  2IX1 A;  2JSO A;  1GOZ A;  1RF2 D;  2IX0 A;  4XQQ A;  3R2I A;  3VR2 A;  4EQO A;  1Y8O B;  2MNA A;  3W5O A;  4JI6 L;  4R1J A;  1E2Z A;  4NW2 A;  3A7L A;  1K9M C;  4CDF C;  3H0G G;  4YHH Q;  2O5I C;  3GD7 A;  1WI5 A;  4C3H G;  5FOB B;  4A3I B;  2K03 A;  1CKM A;  3D6W A;  3DEO A;  3PIP 3;  1ROD A;  3KLW A;  1Y14 B;  3OTO L;  3H3V C;  3O13 A;  2IT1 A;  1JR0 D;  4Y52 H;  4ZCK A;  2N49 A;  2EZV A;  4XYO A;  1KXL A;  1RIP A;  1STG A;  1V1O A;  5EJW A;  1RL2 A;  2E2D C;  3NBH B;  4YWM A;  3RR5 A;  2AUK A;  4S3S A;  1HTL D;  4JBW A;  4BY1 G;  5JEA G;  1WTH A;  2L55 A;  5C0X I;  3HOZ H;  3WWV A;  4A3K B;  2R3Z A;  3TP7 A;  1C48 A;  1Y1V B;  3NUC A;  2EYF A;  3UDX A;  4KKT A;  4P72 A;  3K5O A;  4C3H H;  5CR3 A;  3GTG B;  1EQT A;  3T13 A;  3A8K E;  1X3Q A;  1CUK A;  5H1S E;  3J81 L;  3B6Y A;  2PZT A;  2C35 B;  5IT9 c;  3DWQ A;  4DA2 A;  3Q24 A;  1K3R A;  3F8T A;  1EEF D;  4X65 Q;  4A3E B;  1H9K A;  4DV1 Q;  3U4Z A;  1SYF A;  1X56 A;  5EPJ A;  5L37 A;  2WB1 G;  2MHV A;  4A3F H;  2JA7 G;  1KLU D;  2QF7 A;  1BXT A;  4DK1 A;  1VQE A;  4N9T A;  2YTV A;  1KQS A;  3A8J E;  1SMY C;  4JI3 L;  1ENF A;  1FNU A;  3S2D B;  2N55 A;  1QG7 A;  2JA6 G;  1K0S A;  5ELN A;  4X65 L;  4A93 G;  4H7B A;  1KAB A;  2IW3 A;  4ZRZ A;  3MXN B;  4IAL A;  3BZC A;  3R8B A;  3FDT A;  4NP5 A;  5CV5 A;  4WJ4 A;  3KYH C;  1D2B A;  1LT5 D;  1A2U A;  1LTI D;  1YJN A;  3GTP B;  3BVG A;  3RD4 A;  1CA5 A;  1S4Z A;  2B2V A;  4BA1 I;  4HJ9 A;  1PTO C;  4ME5 A;  1PH3 A;  3S1M H;  3M3Y H;  4A3E H;  3TDQ A;  1HZA A;  3QO2 A;  1SFO H;  5JPM C;  4JI8 L;  4N8X 1;  2JA6 H;  2N88 A;  4DAM A;  3S17 B;  5IOC A;  2ALY B;  3SEB A;  3NWT A;  4C3I H;  1HUN A;  2VUM G;  5EBC A;  2K75 A;  2JA5 B;  5IT9 E;  3J80 L;  3E6Z X;  3ICE A;  3NWS A;  1F9P A;  2NTT A;  5J1Z A;  1Z9F A;  2ZXP A;  1OXT A;  2MGS A;  4IUQ A;  3ULP A;  2Y0S B;  4QY7 A;  5JOB A;  3SE0 A;  1SMY D;  3DM3 A;  2JA5 H;  1EQR A;  1TR5 A;  4ALP A;  1EFW A;  4APV A;  1B3Q A;  2RHQ B;  4BBR G;  2PI2 A;  1X65 A;  4O1N A;  3T1H Q;  3S2H H;  4JI6 Q;  2YYZ A;  4XXE A;  4P2C B;  4A3D B;  1TWG H;  2QDB A;  2E74 C;  5C5M A;  2ZJR A;  3S1N B;  4H02 A;  1XMQ L;  3S1M B;  4DUY Q;  1BCP C;  1QVF A;  1NY4 A;  3K0Y A;  1C9O A;  2HHH Q;  4CJ2 C;  1KNE A;  3HZX A;  1ZYR D;  3A54 A;  3U4V A;  1IL2 A;  1F77 A;  4L5R C;  2JN4 A;  2R7D A;  2PZU A;  3H3V I;  3GTM B;  2WAQ E;  1CSQ A;  3I7F A;  5IGB A;  5JJK A;  2JA9 A;  2O2L D;  4RGM A;  3GO5 A;  4DUZ L;  2TSS A;  1Q7Y C;  2KEN A;  2IJ0 A;  5BN3 A;  1K3B C;  4LFB Q;  4XIG S;  2FIN B;  1N34 Q;  1GUO A;  2A68 D;  3HOX B;  1HA6 A;  4KV6 A;  4M1U B;  3MC0 B;  4P75 A;  2DNC A;  1U0L A;  2JE6 I;  3L3O C;  1SND A;  4C3J H;  4I7Z C;  4TVA B;  3DXJ C;  4K14 A;  4NMZ A;  5HGT A;  3EQL C;  4UP8 A;  2L9H A;  1CHP D;  1TWG B;  3T51 B;  3T16 A;  3E0E A;  5C44 B;  2A6E C;  1GVP A;  1LM0 A;  2CFM A;  2E2J B;  1JJ2 A;  2F03 A;  1GUT A;  2TMP A;  2NVQ B;  1ML0 D;  3GTG H;  5IP7 H;  5BR8 L;  2G9D A;  1SE8 A;  1PTO D;  1BVS A;  2UUB L;  1XXG A;  3UDF A;  3HKZ E;  4K8J A;  1SNM A;  1L1O B;  1IHZ A;  3K6O A;  4K6L A;  4PZ7 A;  2VQF L;  4X3U A;  1M4V A;  2F0T A;  1XPO A;  1G91 A;  5C4X G;  2JXM B;  4FVM A;  1TWH B;  4KMU C;  4V0B A;  4DF7 A;  3NEM A;  2H5X A;  3FKI H;  1FGU A;  2JJQ A;  3TZD A;  4X3K A;  5IP7 G;  1TWH H;  1MJC A;  5J22 A;  2RSO A;  3ER0 A;  1G2T A;  1EZ6 A;  2MPM A;  4QB4 A;  1YZ6 A;  1B70 B;  4EQ5 A;  4GNX C;  1PV4 A;  2EQS A;  1J6Q A;  4P71 A;  1NTG A;  4Z9C B;  3A74 A;  3JAM E;  4MHE A;  4RCN A;  1EU3 A;  1BDO A;  1YNN D;  2PQA B;  2Z4I A;  1NR4 A;  1S3O A;  1VQD A;  4UP9 A;  3I4M H;  2F0H A;  3J81 i;  5A2Q L;  2ZM6 L;  1SYG A;  1JOO A;  2CW0 D;  1TS5 A;  1L1O A;  1VQA A;  2R92 B;  1VQH A;  1DZ1 A;  4QJF A;  1I50 H;  5FJ8 G;  1I3Q H;  1KC8 C;  2PMZ E;  3G6J B;  4ZUJ A;  1QNK A;  1IYJ B;  4XQN A;  1CZW A;  2EY6 A;  2ATW A;  3EN2 A;  4EVO A;  3VA7 A;  4WJ3 M;  4IPG A;  1DYQ A;  4G7O C;  4IO9 A;  2EYP A;  3EVQ A;  4LUV A;  1S5F D;  2LFN A;  2NWG A;  4QUC A;  1H9R A;  3PGZ A;  1K83 H;  3RMH A;  3S15 H;  2YTX A;  4KK7 A;  4A3M G;  3NTH A;  4RKB A;  4KKS A;  2OXP A;  1T5E A;  4RAU C;  1LTT D;  4DKA C;  1XPU A;  1GKH A;  4PMW A;  1FR3 A;  2PQA A;  4HCS A;  1LTS D;  2LY7 A;  4FP5 D;  1SYB A;  3BVZ A;  1VQ7 A;  3MXG A;  5C3X A;  1JJG A;  3RZO H;  4B3R Q;  4LFA Q;  5C3W A;  2N8N A;  4X66 L;  1PH9 A;  4KHP Q;  1SYD A;  3HOU G;  4ABN A;  5ELC A;  1HQM C;  4K5V A;  3CCQ A;  3CPF A;  3HOW H;  5T1G A;  1PHJ A;  5FK9 C;  2UXB Q;  4DAV A;  4GN3 B;  3K59 A;  4ZKB B;  4DUZ Q;  1V1Q A;  1KHI A;  4LWC A;  2E2I H;  2HDM A;  5DNF A;  3CU7 A;  2NZ1 D;  4IUR A;  4DR5 L;  4JI1 L;  2V1C C;  3K7U C;  5ELO A;  1N36 Q;  1FNV A;  3S1R B;  1O7L A;  4DK0 A;  3LWE A;  4PMC A;  3F1Z A;  3HOZ G;  1I4H A;  3PF4 A;  4LFC Q;  1FYC A;  1SEB D;  4R9W A;  2UXD L;  3BYY B;  1HA5 A;  3DUZ A;  4X66 Q;  3GTQ B;  3LGJ A;  4B3R L;  1EOV A;  1D6E C;  1JQY D;  2KEE A;  3Q22 A;  3T1H L;  2WB1 E;  4CKE A;  5M5W B;  5T1I A;  2BA0 A;  4IPD A;  1ILP A;  2OQ0 A;  3GTL B;  4K0K L;  5CC4 A;  3T53 B;  1SJE D;  4IZ8 A;  1S5B D;  1X6O A;  3PUW A;  2M00 A;  3H94 A;  1EY9 A;  4DN4 M;  5KNB A;  1TT2 A;  4KHV A;  4RGN A;  1K8A C;  4PZ8 A;  2PQE A;  1WD1 A;  2IY5 B;  1T9H A;  2AHO B;  2QEJ C;  4ILW A;  1G29 1;  4FO2 A;  4OGQ C;  1EYG A;  3NSW A;  2CQA A;  5IGD A;  4U67 3;  5IWA L;  5C6A A;  3I4N B;  2XN9 C;  4AYB G;  1I94 L;  1I4Q A;  1X32 A;  1FD7 D;  4JI2 Q;  2UUC Q;  3QR8 A;  1F9R A;  1F2Z A;  2SNS A;  2K50 A;  4BY7 G;  4LNQ A;  4HIK A;  4TKO B;  3PO3 B;  4Y7N B;  2VY3 A;  1OXV A;  1STE A;  2RHS B;  1EY8 A;  1YJW A;  2MO1 A;  2NUC A;  1SE2 A;  5DM6 3;  3I4M G;  1VF7 A;  2F0Q A;  2Q8T A;  4N8F A;  1EWI A;  2R7Z G;  4IFD I;  1EIF A;  2XRS D;  1QUQ B;  3MTS A;  1C7Y A;  4FXD A;  1Z47 A;  5JJL A;  2A68 C;  3P20 A;  3U9O A;  1LYL A;  3IFD A;  3PUZ A;  5CMD A;  5M3M G;  1YI2 A;  2VW9 A;  2F0G A;  4FF4 A;  1BO0 A;  1XTC D;  2R6G A;  5I4D A;  2XRQ D;  5IYD G;  3T4A C;  4XQJ A;  2RDH A;  1VF5 C;  1VQ4 A;  1TWA H;  5M3F G;  1YNJ C;  3HOX H;  5CV7 A;  4CGY B;  5AJ3 L;  2BA1 A;  5COY A;  4QCL A;  3SGI A;  1GJX A;  1H9S A;  2YU9 H;  3OMG A;  3GTK B;  5CBE E;  1KDA A;  3H09 A;  5FLM G;  1LTA D;  2E2H H;  1RD9 D;  2UXC L;  2JP1 A;  3SK4 A;  1PH1 A;  3KJP A;  3FRP B;  1BCP B;  2VQE L;  1FNW A;  4PMB A;  1IYV A;  3DLL A;  4R8N A;  4BBS H;  5BR8 Q;  4YCU A;  2PYK A;  3LNN A;  2NVQ H;  2K6A A;  4LAA A;  5M9O A;  4PG3 A;  5JEA J;  2F3W A;  1IXR A;  1VQN A;  1CZG A;  3IL8 A;  1E22 A;  1PYW D;  3M4Y A;  1LTG D;  2FMM A;  1V1P B;  3KF8 B;  1NAP A;  1IBK L;  1ICW A;  4DK6 C;  3WOF A;  2I5M X;  3OTO Q;  2LXK A;  4JOI A;  4B3S Q;  1VQM A;  4YY3 Q;  1Q1B A;  1HR0 W;  3K0X A;  1H95 A;  2RCF A;  1RDP D;  1XPR A;  1SMX A;  4DGZ A;  1PZI D;  4YHH L;  4A75 A;  3S16 B;  3H6M A;  3GV3 A;  3SK8 A;  4RGT A;  2Q2I A;  2DUD A;  4LFB L;  4KI0 A;  2RA4 A;  2KHS A;  3HG9 A;  2B63 B;  3BZK A;  2ES2 A;  1JWS D;  1E24 A;  1A0I A;  4B9X A;  2EOT A;  1SRO A;  3KF6 A;  2PZW A;  2I07 B;  3E9I A;  1E1O A;  1SYE A;  5FKA C;  3L0O A;  3KUP A;  2RF4 A;  4I65 A;  3ZYY X;  4DAY A;  1L1O C;  2AKW B;  3E5S A;  1F2Y A;  1TS4 A;  5KND A;  1WD0 A;  4BY1 H;  3I4L A;  1PH2 A;  5E4W C;  4B3M L;  1A3V A;  3F2U A;  2WKC A;  2K52 A;  3CW2 C;  1I4G A;  3CRL C;  4A3G G;  2R93 B;  1A6X A;  1JJC B;  5GAD C;  1A15 A;  2PCF B;  4KJN A;  4MNO A;  5I2Y A;  4IN3 A;  2MP1 A;  5IP9 G;  4DR2 L;  3ONA B;  4GNX A;  1STB A;  4JW0 A;  3OYY A;  1Q3L A;  3H0G B;  4LJZ C;  3MFY A;  1M90 C;  2Z6K C;  1CTM A;  2P5Z X;  1XMO Q;  4A3D H;  4LF4 L;  3CC2 A;  2F4V L;  4DR4 L;  2RVL A;  4L8J A;  2OEO A;  1MI2 A;  5C0X G;  2OF1 A;  4A3I G;  2D0P A;  1BBW A;  1HUM A;  4C1N I;  3E9H A;  4BWG B;  1CSP A;  3KBG A;  3PSI A;  2FHT A;  1FJG Q;  1IL8 A;  1QVG A;  4EX5 A;  2NTS A;  2KUM A;  3M4O H;  1U4L A;  1EZ8 A;  2R61 A;  2KCC A;  1KRT A;  1QZG A;  4X62 Q;  1I94 Q;  1X3F A;  2NN6 I;  2DY8 A;  2YV5 A;  2E5L Q;  1XMO L;  3M4O B;  2B2T C;  3MXN A;  1Y1V G;  3K5M A;  5KRU A;  1TWA B;  2F3V A;  4ZKC B;  3IAY A;  1PLF A;  4Q0F A;  4DR2 Q;  1IBM Q;  1MKH A;  3OMC A;  5E7N A;  5EAY A;  4C56 C;  2GA4 B;  1YHB A;  1QNU A;  1YNX A;  4HJA A;  3STB C;  1K8G A;  2EE1 A;  5KIX A;  5G3L F;  3IFT A;  2K33 A;  4R4T A;  3J7Y W;  1DON A;  2L4N A;  4KJO A;  4GZY C;  1K8O A;  1X3G A;  4B3M Q;  3WOE A;  2SNM A;  4NXN Q;  1LTB D;  2RSN A;  2EYJ A;  2ICE C;  5D14 A;  3CMA A;  1Y1V H;  4DNR B;  1EWH A;  1NMG A;  2R93 H;  4KY6 A;  5NUC A;  1CQF A;  1PH6 A;  1JWU D;  4A3C H;  4JI1 Q;  1JOK A;  2DNE A;  3SHL A;  1PTO H;  2JEA I;  1VQI A;  5IYB H;  1U4P A;  3I72 A;  1SYC A;  1K73 C;  1HNZ L;  3R93 A;  1PVO A;  1S5C D;  1SE4 A;  3G4S A;  3M7N A;  3MXU A;  2Z9H A;  1BCP F;  4DU9 A;  4DV0 L;  5C3E H;  3SDZ A;  1PXU A;  1EYA A;  4R4O A;  3CRK C;  1MSH A;  3MZ5 A;  3TRE A;  3H3V H;  2BDN A;  4K6D A;  4QIW B;  2HD3 A;  2QDL A;  1RCV D;  2VS1 A;  4K2K A;  2F0V A;  1X3E A;  2F52 A;  5A2Q E;  2WV6 D;  3VR5 A;  1H9J A;  4FF1 A;  1QJO A;  3J80 E;  2BE5 D;  1Q12 A;  5FLM H;  4IOA A;  5IYB G;  2NVT B;  4KN7 C;  1Q8I A;  4B08 A;  1KNA A;  4DAP A;  4CDD C;  4OO1 G;  3Q6S A;  4OO1 I;  2NVX B;  1TQO A;  2XIW A;  4QL5 A;  3PMF A;  2Y0S G;  1Y1W H;  2VUM H;  2LSS A;  2UU9 L;  4A3G H;  4XT1 B;  1WCM B;  1TY2 A;  1VCI A;  2L5T A;  3RLN A;  2EY1 A;  4LUO A;  2VZA A;  2B2V C;  1SFO B;  2E76 C;  1BBX C;  5I2X A;  3J7Z C;  3X3M A;  1VQ8 A;  4ZAI A;  2K7V A;  2J0T D;  4ID6 A;  1WTW A;  1UUP A;  1QCB D;  3BZD B;  4A76 A;  5AJ3 Q;  1WOC A;  4CBV A;  1MSG A;  3W1B A;  4OXP A;  4DAY B;  5FLX c;  1J9O A;  2QEX A;  2AMC B;  1HNX L;  1TU2 B;  4WJW A;  1I3Q B;  1MHW C;  1UE5 A;  2EY2 A;  4DFA A;  3I56 A;  2A8V A;  1AE3 A;  2AUJ D;  2CW0 C;  4P73 A;  2L12 A;  2E2H B;  3CCM A;  1YIT A;  5C4X H;  2FMC A;  1KAA A;  1KDB A;  1GD7 A;  1LO5 D;  4P74 A;  1G8Z D;  2LKV A;  3M7G A;  3G6E A;  4TRD A;  1WTP A;  2IWH A;  1XTD A;  1Q8K A;  3T56 B;  4K2L A;  3BDL A;  2O4X A;  3A0J A;  5C3E B;  4GOP B;  2K01 A;  4CKC A;  3S14 B;  3CCV A;  2R7F A;  1DOL A;  5IYD H;  4DV2 L;  3D3R A;  4CJ1 B;  4XTC S;  3J7A V;  1T5X D;  2PNH A;  4JI2 L;  4DV2 Q;  3J7A 5;  4A3B B;  3AFP A;  4K5X A;  3D8G A;  4V19 0;  1C8C A;  3TS0 A;  1SJH D;  5LL6 X;  2B2Y A;  5M5X B;  1W6K A;  2SOB A;  2CQO A;  3BJU A;  1XX8 A;  3QB3 A;  4JK1 C;  2PPB C;  4JV5 L;  2F0E A;  2PO4 A;  3QJY A;  1DM0 B;  1KIX A;  2Z8L A;  1YVC A;  1EY6 A;  3I90 A;  3S1Q H;  2F0O A;  4A3E G;  4GOP A;  4JI0 Q;  2ID0 A;  1F2M A;  2XSC A;  4HR7 B;  4A3M H;  3HKZ B;  3HS0 C;  2Q8I B;  3PV0 A;  3V05 A;  5LMU Q;  2DJF C;  4IQZ A;  1HNX Q;  3PUV A;  4LFC L;  5CV8 A;  3MHB A;  4FXG C;  1OO9 B;  1Q46 A;  5K36 H;  3TP5 A;  4IPC A;  1HNW Q;  1VQC A;  2NVY H;  3R3O A;  2JEB I;  2AQ1 B;  4KD4 A;  4HJ5 A;  2I0Q A;  3BS1 A;  2FFK B;  2K5W A;  4ME3 A;  3BVM A;  3NK9 A;  4R4I A;  1VQB A;  1STY A;  2F0D A;  4YCW A;  5GQO A;  4JC0 A;  3RN5 A;  4DV6 Q;  1PYB A;  4LMQ D;  4MZ9 A;  4CJ0 B;  4DV4 L;  4RH6 A;  1YHA A;  4DNI A;  1II3 A;  1YNJ D;  4DR1 Q;  3D4R A;  1BCP D;  5IGG A;  5IY0 A;  4LF7 L;  4R4C A;  5K36 G;  2VXW A;  4X64 Q;  4HTH A;  3UDG A;  3M4P A;  4ZQ3 A;  1J8I A;  3GTJ H;  3CME A;  4LF8 Q;  5JJZ A;  3I73 A;  5D3I B;  1SXT A;  4KD3 A;  1JWM D;  5IGC A;  1SN8 A;  3PO2 G;  3BU2 A;  3ND8 A;  4DV6 L;  1OTC A;  1BKB A;  1HQR D;  5G3L D;  2RDF A;  1B44 D;  3HRZ C;  3CAM A;  4A3D G;  3S2D H;  4A3J H;  3S17 H;  4NXM Q;  3A56 A;  1HNW L;  3SK6 A;  3G48 A;  2WAQ G;  1H9M A;  3QOL A;  4DXG A;  4GKK Q;  3VYS A;  1JT8 A;  1D1I A;  1W3S A;  2JA8 H;  4UHV A;  3TRZ A;  2K28 A;  4KN4 C;  3MXP A;  2BOS A;  4BY7 H;  4LF6 L;  5EKK A;  4GLX A;  1N32 Q;  1I50 B;  4AIM A;  2KEC A;  3DEP A;  4DV3 L;  1PH4 A;  4LW1 A;  4KY7 A;  5DAU A;  5C5L A;  3S16 H;  1V43 A;  1JOQ A;  4QQB X;  3KJO A;  2HT1 A;  1IBM L;  1GUN A;  4C2M B;  1S5D D;  1QIL A;  3KBX A;  4C3I B;  4DV3 Q;  4LF5 L;  1Q90 A;  1SLJ A;  4Y7N H;  2HQL A;  3S1R H;  2D9U A;  2A69 C;  4X62 L;  4DR3 L;  1VQO A;  3T1Y Q;  4JYA Q;  4UAI A;  4F7X A;  4GKK L;  3N6R A;  4ODG A;  1DGS A;  5M3F H;  2UUB Q;  2H1E A;  2NN6 G;  4BBS B;  3HOW B;  3UE1 A;  3P75 A;  3FPU B;  3D4W A;  3C46 A;  3P7J A;  1PH8 A;  3PUY A;  1SBB B;  1B53 A;  1WJJ A;  3HOV B;  3VR3 A;  2M2L A;  4GLA C;  2IHE A;  1DJR D;  4FXK C;  1V9P A;  1AFP A;  3GTL H;  4IUP A;  1O80 A;  1TS2 A;  2HIX A;  4ULL A;  3VYU A;  5C4X B;  2I5L X;  3OOC A;  1PH5 A;  4LF8 L;  5EPL A;  4F8M A;  2EPB A;  2PNR C;  3KDF A;  1WTR A;  3VYT A;  2J4X A;  3CXC A;  4LF9 L;  1MBY A;  1ZEQ X;  4A3F B;  1NNX A;  1Q1E A;  1VS0 A;  2KCT A;  3J81 j;  3HFZ B;  1GUS A;  1M8A A;  5LHY 1;  4LF7 Q;  2B2U C;  3CCJ A;  2JA8 B;  4U68 A;  2QA4 A;  3E3X A;  3NQT A;  3VR4 A;  2LXJ A;  2X6L A;  3HOY H;  4C3J B;  3K8A A;  5C4J B;  2K5Q A;  5I9P A;  4NKL A;  4MN3 A;  2NB0 A;  4NB3 A;  2EDG A;  3TEH B;  2UU9 Q;  1Y1W G;  4DUY L;  1SSO A;  4BS9 A;  4GNX B;  1XMQ Q;  1L2F A;  1O7Y A;  1NR2 A;  1N9W A;  1PYS B;  4TSS A;  4RG1 A;  3M4Q A;  5D3D A;  5COR A;  4DV7 Q;  5FO7 B;  3VYR A;  2CHB D;  2OT2 A;  5LMN L;  4RHS A;  3NQI A;  1UWV A;  3CP0 A;  3RN2 A;  4FNF A;  4LF9 Q;  1AW7 A;  5FO8 B;  5IOD A;  4A3M B;  3M85 A;  1NE3 A;  3RNU A;  4GS3 A;  1KTK A;  2ZTC A;  3BDC A;  3NTI A;  3OIP A;  2LMC B;  1YNN C;  2NYZ D;  1LAB A;  1W6J A;  4R8I A;  2CVR A;  1X3P A;  2KHI A;  1EIH A;  1U9R A;  2D5D A;  1JE5 A;  1P8L A;  3GTO H;  4JI7 L;  5BN4 A;  4E6I A;  3HOU B;  3K7A H;  1OXX K;  2VQE Q;  4JBJ A;  1VMP A;  1MJE A;  4MTN A;  1PDQ A;  1HFN A;  2UXC Q;  2BE5 C;  2OCE A;  2EVB A;  4DR7 L;  4JYA L;  1U5K A;  1SNP A;  2QW7 A;  3KDF B;  4DR3 Q;  3CCR A;  2E2J H;  4RKL A;  3JAM i;  1A63 A;  1E2W A;  3G7L A;  2GN5 A;  3C2P A;  2BH8 A;  2YTY A;  3JAM L;  3NPP A;  1GUG A;  3I3C A;  3FEW X;  3JAM c;  5E4X A;  1DCZ A;  2JQO A;  1S40 A;  5CV9 A;  1D5X C;  4HIM A;  1UE6 A;  2A74 C;  1X54 A;  5FO9 B;  3OSO A;  1EFI D;  1JE4 A;  4RCO A;  1HZC A;  4HMI A;  2Z0S A;  4X6A H;  2FJ2 A;  4LUZ A;  5KNC A;  2IPK D;  2B2W C;  3FMC A;  4DNT B;  5C4H A;  1CKN B;  1SR3 A;  2A19 A;  4LF6 Q;  3G71 A;  1PFN A;  2KCN A;  3JC6 6;  2A1A A;  2DGY A;  3CCE A;  3A55 A;  1XNR Q;  3OIQ A;  2N3S A;  2AQ2 B;  1IKL A;  3F2C A;  2KOL A;  5M3M H;  4EQP A;  3GQB A;  1HCZ A;  1HXY D;  4B3T Q;  3H15 A;  4KY5 A;  4PV1 C;  3HOY B;  2DY7 A;  3MEH A;  1PRT B;  3STB D;  4A3L H;  3OW7 A;  3S2H B;  4LF4 Q;  2C9O A;  2F4V Q;  4G7Z C;  3PO3 G;  1VQ9 A;  5M5Y H;  2F0M A;  4PNY A;  1YBY A;  2K32 A;  3K80 C;  4GN5 A;  4C3H B;  4OWX B;  3CCS A;  4JI5 Q;  1WTQ A;  1VQL A;  3I4M B;  1ICF B;  4A3J B;  1AP0 A;  2L15 A;  5EKL A;  1ESR A;  4HJ7 A;  2XTI A;  2K14 A;  5JJI A;  2EJF C;  5ELF A;  3AYH B;  2NBF A;  1SRU A;  4BY1 B;  2BCO A;  4IUU A;  4C1N K;  1K0R A;  3J7A F;  1N33 Q;  1PMR A;  2MO0 A;  2EYL A;  2GVA A;  1BUV T;  1I4X A;  3Q23 A;  2KQ3 A;  3ULL A;  2LS0 1;  1U4R A;  3VR6 A;  4L6T B;  5HGQ A;  4DV4 Q;  2F0N A;  5M3F B;  3HKS A;  4EQN A;  4BA2 I;  1Q86 C;  1RKN A;  3PF5 A;  3K81 C;  1N36 L;  1CA6 A;  1JIC A;  2UUA L;  3D31 A;  4FYD A;  1TKW B;  3I55 A;  1G6Z A;  2BH2 A;  5HUR A;  4OX9 L;  3GTK H;  5CYU A;  1KDC A;  4QGU A;  4H13 C;  1CQV A;  2JYO A;  5ELB A;  1E3P A;  2WB1 B;  1I6H H;  2L1B A;  3D0F A;  3UDI A;  5I6Y A;  2JA7 B;  5I9O A;  2F1M A;  2NVX H;  1U4M A;  1N33 L;  2PW7 A;  4XT3 B;  5LMU L;  4YY3 L;  4RA8 A;  4NXN L;  1IBL L;  1S5E D;  2B2W A;  4HCE A;  3KLS X;  2SEB D;  1G6P A;  2JA6 B;  2B29 A;  4JI0 L;  1JC7 A;  3NE5 B;  4FF2 A;  4NPS A;  2E2I B;  1IBK Q;  1EYC A;  3W2D A;  5LMN W;  1XWE A;  2L11 A;  4OON A;  3NP8 A;  2IX3 A;  2F0I A;  2Z6B A;  1D1K A;  5TSS A;  4DR6 L;  1E0B A;  4YCV A;  1STN A;  4JV5 Q;  3J80 i;  4JBK A;  5D65 A;  1ET9 A;  2MJ8 A;  3FKI B;  1R4P B;  3BG3 A;  3QG1 A;  4DK3 C;  1E7Z A;  2E5L L;  3ND9 A;  1PZK D;  3NBH A;  1CFM A;  1EY4 A;  3FHW A;  2NVT H;  4PQX A;  5KYI A;  2HUG A;  2DN8 A;  2WKD A;  4GLV B;  1B9M A;  3GTM H;  1CI3 M;  1FL0 A;  1B7Y B;  1PRT C;  3DM1 A;  4R4Q A;  1FJG L;  3TP6 A;  4F88 A;  1WFQ A;  3AEV A;  1A2T A;  2PW5 A;  1Y8P B;  4XDX A;  1HTP A;  4L5T A;  5CV4 A;  5IIF A;  4H44 C;  1O7I A;  1CKO A;  3MWY W;  2B8G A;  2AWN A;  4RFB A;  4YWL A;  1EWC A;  3K5L A;  3I91 A;  4YIJ A;  3PCO B;  1PTO F;  1SNQ A;  1NSN S;  2K5D A;  1PFB A;  3PO3 H;  5A35 A;  1HJP A;  1LT3 D;  5M5X H;  4HAE A;  3K5N A;  1R9T H;  1LV9 A;  3MFG A;  1JMC A;  2Q2U A;  3GTO B;  1Q82 C;  4XYQ A;  2QKI C;  2BDO A;  2VQF Q;  4I7A A;  4UDU C;  4BXX G;  1FGB D;  3UE0 A;  2E75 C;  5JVH 3;  1SAP A;  4J15 A;  4OEL B;  4TQU S;  5FJ8 H;  1TS3 A;  1LAC A;  4DV5 Q;  1VQ6 A;  4DR6 Q;  2A69 D;  4HSP A;  4F87 A;  2ZTE A;  4B9W A;  4J1M A;  1AZP A;  1RHP A;  1UEA B;  1PFM A;  5C44 G;  1TWF H;  3U58 A;  1BOS A;  3CF5 A;  4POF A;  1HRJ A;  2EXZ A;  1I6V C;  5GAE C;  2A6E D;  1H9S B;  1SNC A;  4B3S L;  3GTQ H;  3A5U A;  1KD1 C;  5IGE A;  4QMG A;  5LMN Q;  1WYD A;  1FVI A;  2L0C A;  3U50 C;  3S9W A;  1EOT A;  4A3K G;  1PFS A;  1NUC A;  2ZT9 C;  4AQY Q;  4Q5V A;  3ERQ A;  5LL6 S;  2EIF A;  5CV6 A;  4DV0 Q;  1I5F A;  1ONL A;  4A3B H;  4MIU A;  1HNZ Q;  4K8I A;  4DR5 Q;  3EA6 A;  1HZ9 A;  1ZXT A;  3CD6 A;  3HP3 A;  2MUY A;  4OWW B;  3J81 E;  1STH A;  2XGT A;  2ENB A;  3V96 A;  2F4I A;  2UXB L;  1E1T A;  2VNU D;  3I2Z A;  1UE7 A;  3KK7 A;  1NBW A;  3SXH A;  4OO1 H;  5J3B A;  1EL0 A;  2K4K A;  2VB3 X;  1YEZ A;  4WOR A;  3D6C A;  2RBM A;  2EYO A;  3RZO B;  3K57 A;  2B2Y C;  1BR9 A;  1S72 A;  2VL6 A;  4FF3 A;  1TWF B;  2B39 A;  2KHJ A;  4A93 B;  2IL8 A;  1D8L A;  1J5E Q;  1GHK A;  4IJL A;  3H91 A;  3S15 B;  5GAG C;  1KL9 A;  3A5Z B;  2Q2T A;  2Q2H A;  1M1K C;  4QF4 A;  2M9V A;  5C0X H;  4JPB W;  4A3I H;  3QWN A;  2Q8R E;  1QZH A;  2V4D A;  3GTP H;  1LLR D;  2RKS A;  1VQ5 A;  3RZD H;  3W3A A;  1XJV A;  3GDE A;  1F2L A;  1EU4 A;  4QUF A;  4J8Q A;  4JI4 L;  3S1Q B;  1K28 A;  3EJI A;  3CCU A;  5IYC G;  1BF4 A;  2Y0S E;  2QCP X;  4CDC C;  3RZD B;  2PI2 E;  1DXM A;  3CCL A;  1ASZ A;  2G9H D;  3N52 A;  3TME A;  3AB9 A;  3X3N A;  5EQ0 A;  3ERO A;  4B3T L;  4L5S A;  1R9T B;  5JAV A;  4RHR A;  3ULJ A;  4DXF A;  2VUM B;  4ZK9 B;  4G7H C;  2R92 H;  2JA5 G;  1WCM G;  4CKB A;  1VMC A;  5C0X J;  2JA7 H;  4POG A;  3CQZ H;  4IUV A;  1B1Z A;  1JCK B;  3T1Y L;  5IT9 L;  1WVL A;  1YIJ A;  1CKN A;  1IKM A;  1I4R A;  1EIY B;  3PO2 H;  4JI4 Q;  1JOR A;  4BBR B;  1CK1 A;  3BDO A;  4A3L G;  1EQV A;  1I4P A;  3L9A X;  2WAQ B;  4GKJ Q;  3L2P A;  2ASB A;  3NTK A;  4L63 B;  1HZB A;  1KLG D;  1RJT A;  2ICI A;  3C3L A;  4LK1 C;  1L0W A;  1J5E L;  4DV1 L;  5GRO A;  1PZJ D;  3I4O A;  2WFW A;  4HID A;  1CT1 D;  1OXS C;  2F0K A;  1D5Z C;  3PIP A;  5E1F A;  4DR7 Q;  1DD2 A;  1UEB A;  3HOV H;  3K58 A;  5ELE A;  5EBD A;  3HOX G;  1MIU A;  4UP7 A;  4C3I G;  1YJ9 A;  5C3E G;  1GM5 A;  1RTO A;  1C4Q A;  3DWA A;  2CKZ B;  4JI7 Q;  2B8F A;  3GTJ B;  2XVS A;  1IYU A;  4WRD A;  4UY8 C;  4K5W A;  4IUN A;  1UNS A;  1F9Q A;  1ESF A;  3KF6 B;  4JVZ A;  3MAQ A;  4A3B G;  3NXW A;  3C1F A;  4BBS G;  4AQY L;  1QB5 D;  2D62 A;  3HOW G;  2O5J C;  5ELD A;  3W1G A;  2HDL A;  3KFU A;  3SK5 A;  3VA5 A;  2AWO A;  4GOP C;  3HOV G;  4KTA A;  1B50 A;  1TII D;  2A6H C;  3HGB A;  3KLS A;  3FP9 A;  2FXQ A;  4IPH A;  2WP8 J;  3NEN A;  1HPC A;  4O42 A;  5AFW A;  4X64 L;  3C1E A;  3I4N G;  2X69 A;  4IFD G;  4BXX H;  1Z6H A;  4KKU A;  4OWT B;  3S24 A;  1QVC A;  1SNO A;  2G5D A;  4IJH A;  2KED A;  1KAW A;  4BY7 B;  3TP8 A;  2F0W A;  3CC7 A;  4L5Q A;  1P16 A;  2RDG A;  2A73 B;  3HKZ G;  1LT4 D;  2KVM A;  1ENA A;  1MD2 D;  3ITP A;  1HFG A;  1IZ6 A;  3KOJ A;  2F0J A;  1G51 A;  3PUX A;  2R7Z B;  1GUW A;  3AQQ A;  1AEX A;  4UPA A;  2I46 A;  4G4K A;  1PTO B;  3PIO 3;  4RGO S;  3P1H A;  1EQQ A;  2EJG C;  1L0X B;  1ASY A;  3PQI A;  2WAC A;  1BNZ A;  3OWE B;  1QOH A;  1LTR D;  2ZM6 Q;  3OW2 A;  3MVV A;  3LWU A;  4HED A;  3MA2 B;  4OIJ A;  1AN8 A;  1B9N A;  3SVM A;  4JBM A;  3K7A B;  2ZTD A;  2RQX A;  3U9S A;  4ZYS A;  2K05 A;  3A8I E;  3ZJY C;  1B2T A;  1F9S A;  5EGT A;  5GAH C;  1BQQ T;  4OL7 A;  2R92 G;  4GKJ L;  2H4O A;  4A4I A;  2YU9 B;  2OQK A;  3Q8D A;  3IRB A;  1QWY A;  1IW7 D;  2KJX A;  2NVY B;  5JEA H;  1A3U A;  5KYL A;  1G2S A;  4NDX A;  2QIL A;  1EY7 A;  3DHQ A;  4JI8 Q;  1ENC A;  1OXU A;  2D2C C;  2D0O A;  3RLO A;  4HIO A;  3HEJ A;  2Z6K A;  5HY6 A;  4ZUI A;  4FDB A;  2IHF A;  1A8V A;  3FVQ A;  3F2D A;  2K5V A;  2ZXR A;  3PO2 B;  3GV6 A;  2CCZ A;  3EBE A;  4HN7 A;  2MFI A;  3QIA A;  1V8Q A;  1TWC B;  2B63 H;  2WIN B;  2UUC L;  1C0A A;  1TXY A;  3M9B A;  4GN4 B;  4CHT B;  1EY5 A;  5M5W H;  2JK8 A;  4HJ8 A;  4M8A A;  4OIK A;  1AZQ A;  3CC4 A;  2PMZ B;  5IWA Q;  4LF5 Q;  3HOU H;  2ZJQ A;  4MTK A;  2EY5 A;  3I8Z A;  3D4D A;  3BYT B;  2X6G A;  3A7A B;  4JI3 Q;  4C2M H;  1QUQ A;  2KA7 A;  1MGS A;  2HCI A;  1SDF A;  2A6H D;  3AFQ A;  5ISR A;  2XWJ B;  2AQ3 B;  3TQY A;  1RTN A;  4J6H A;  3RUZ A;  3R2T A;  2F0F A;  5IYC H;  2SDF A;  4K0K Q;  2EYM A;  1R4Q B;  4YWK A;  3TZU A;  1XYI A;  1N32 L;  3DMU A;  1HR0 Q;  3WDN A;  2B63 G;  1O78 A;  4PZ6 A;  5C44 H;  3CHB D;  1GXD C;  5JPN C;  4JCV E;  3H0G H;  1IBL Q;  2NZH A;  2OTL A;  1NMF A;  1DOM A;  1WCM H;  2HQE A;  1Y69 U;  2UXD Q;  2RCN A;  3Q0A A;  5C4Z A;  1E2V A;  1ET6 A;  3HOZ B; 
#chains in the Genus database with same CATH homology
 4A3K H;  3CCM A;  3VDY A;  1VQD A;  1S3O A;  4UP9 A;  4NXM L;  3I4M H;  1E3P A;  1YIT A;  5C4X H;  3J81 i;  4OX9 Q;  1I6H H;  1GD7 A;  3D0F A;  4P74 A;  3UDI A;  2ZM6 L;  1Q81 C;  2NVX H;  1TWC H;  1N33 L;  3ERS X;  1L1O A;  3G6E A;  5LMU L;  1VQA A;  4NXN L;  1VQH A;  4YY3 L;  1IBL L;  2K5N A;  3J81 c;  4QJF A;  1I50 H;  3I4N H;  5FJ8 G;  2R93 G;  2HHH L;  1G6P A;  1I3Q H;  1W2B A;  2B29 A;  1KC8 C;  2CWA A;  4JI0 L;  2PMZ E;  1XTD A;  1Q8K A;  1IYJ B;  4AH6 A;  1LUZ A;  2ATW A;  3EN2 A;  4WJ3 M;  2MQH A;  4NPS A;  4IPG A;  1IBK Q;  4KHP L;  3J80 c;  3A0J A;  5LMN W;  4GOP B;  3MEF A;  3HOY G;  1VQK A;  4A3D H;  3CCV A;  4IO9 A;  4LFA L;  4OON A;  4LUV A;  2R7F A;  4BBR H;  5IYD H;  4DR6 L;  4YCV A;  4JV5 Q;  3TS2 A;  4DV2 L;  3J80 i;  3PGZ A;  4JBK A;  4KHZ A;  1K83 H;  4XTC S;  3S15 H;  2YTX A;  4DK3 C;  2PNH A;  4JI2 L;  4DV2 Q;  4A3M G;  3J7A 5;  1E7Z A;  3AFP A;  2E5L L;  4DKA C;  1XPU A;  4JI5 L;  1GKH A;  3FHW A;  4PMW A;  3TS0 A;  2PQA A;  2NVT H;  4DR1 L;  4DV5 L;  3PIO A;  4A3J G;  4A3F G;  4AYB E;  4IFD J;  2CQO A;  3BJU A;  4GLV B;  5DLQ E;  1NJI C;  3GTM H;  4JV5 L;  1KIX A;  1FL0 A;  3F2B A;  2OTL A;  1YHQ A;  1VQ7 A;  3L7Z C;  1JJG A;  1B7Y B;  1BBU A;  3RZO H;  4B3R Q;  4LFA Q;  1VQF A;  1YVC A;  4R4Q A;  1FJG L;  2N8N A;  4X66 L;  1PH9 A;  2N78 A;  4KHP Q;  4RMF A;  3S1Q H;  3HOU G;  1WFQ A;  2JA8 G;  3AEV A;  4A3E G;  4GOP A;  2F3I A;  3CCQ A;  3CPF A;  1PA6 A;  1PH7 A;  2ID0 A;  1PHJ A;  4JI0 Q;  3HOW H;  2OWO A;  4L5T A;  2UXB Q;  2KBN A;  4O2D A;  1X55 A;  4QIW E;  4A3M H;  1O7I A;  4GN3 B;  3S14 H;  2KCM A;  4DUZ Q;  1CKO A;  3PV0 A;  1V1Q A;  5LMU Q;  1KHI A;  4LWC A;  1HNX Q;  2E2I H;  2AWN A;  3PUV A;  4LFC L;  4YWL A;  4DR5 L;  4JI1 L;  2V1C C;  3K7U C;  5ELO A;  1N36 Q;  1XNR L;  1Q46 A;  1GO3 E;  2OTJ A;  1A62 A;  4IPC A;  1HNW Q;  1VQC A;  2GVB A;  3PCO B;  2NVY H;  1AH9 A;  2JEB I;  1VQP A;  1HR0 L;  3F1Z A;  1D7Q A;  4JG2 A;  4HJ5 A;  2I0Q A;  3HOZ G;  2K5H A;  4ME3 A;  1XNQ L;  4LFC Q;  3PF4 A;  1N36 L;  3PO3 H;  1HJP A;  1JB7 A;  2UXD L;  4R4I A;  5M5X H;  1VQB A;  5GQO A;  4X66 Q;  4YCW A;  4JC0 A;  3LGJ A;  3RN5 A;  4B3R L;  1EOV A;  4DV6 Q;  1PYB A;  4MZ9 A;  1B8A A;  3T1H L;  1R9T H;  1HH2 P;  2WB1 E;  4DV4 L;  1JMC A;  2Q2U A;  1YHA A;  2BA0 A;  4IPD A;  4DNI A;  1Q82 C;  2OQ0 A;  5C4J H;  4IOC A;  2VQF Q;  4BXX G;  4DR1 Q;  3UE0 A;  4K0K L;  3S1N H;  4O0A A;  5IY0 A;  1X6O A;  2HIV A;  4J15 A;  4LF7 L;  3PUW A;  4R4C A;  5K36 G;  1K8A C;  4TQU S;  5FJ8 H;  1VQG A;  4PZ8 A;  4X64 Q;  2IY5 B;  1T9H A;  2B3G A;  2AHO B;  2R7Z H;  3EIV A;  3UDG A;  1G29 1;  4DV5 Q;  1VQ6 A;  3M4P A;  1EYG A;  1N8R C;  3FKI G;  3TRZ A;  4DR6 Q;  5IWA L;  2ZTE A;  3GTJ H;  1LTL A;  4AYB G;  3CME A;  1I94 L;  5C44 G;  4LF8 Q;  1VQJ A;  1TWF H;  4JI2 Q;  2UUC Q;  1AE2 A;  3U58 A;  3CF5 A;  4POF A;  4A93 H;  5GAE C;  2K50 A;  4BY7 G;  4LNQ A;  4HIK A;  1SN8 A;  3PO2 G;  2VY3 A;  5IE8 A;  1OXV A;  2RHS B;  3RLF A;  4KLK A;  4DR4 Q;  3BU2 A;  1YJW A;  1X9N A;  4DV6 L;  2MO1 A;  4B3S L;  3GTQ H;  3A5U A;  1KD1 C;  1OTC A;  1KRS A;  5LMN Q;  1WYD A;  1BKB A;  1FVI A;  3U50 C;  4A3K G;  1PFS A;  4AQY Q;  1XNQ Q;  3I4M G;  3CAM A;  4A3D G;  3S2D H;  4A3J H;  3S17 H;  2EIF A;  1EWI A;  3NEL A;  2CWP A;  4JOI C;  1EIF A;  1I5F A;  4DV0 Q;  1QUQ B;  4NXM Q;  2R7Z G;  4A3B H;  4IFD I;  1HNW L;  1C7Y A;  3G48 A;  1Z47 A;  2QGQ A;  4A3C G;  5JJL A;  2WAQ G;  2EXD A;  2I5H A;  1HNZ Q;  4DR5 Q;  4GKK Q;  1HZ9 A;  2NZO A;  1LYL A;  3PUZ A;  3CD6 A;  1JT8 A;  1W3S A;  5M3M G;  4DV7 L;  1YI2 A;  2VW9 A;  4OWW B;  2JA8 H;  4DPG A;  1N34 L;  2XGT A;  3CPW A;  4BY7 H;  4LF6 L;  2UXB L;  1E1T A;  2VNU D;  3I2Z A;  2R6G A;  1UE7 A;  4GLX A;  1NBW A;  2ZJP A;  1N32 Q;  1EUJ A;  2E8G A;  4AIM A;  5IYD G;  1UE1 A;  4DV3 L;  1VQ4 A;  1PH4 A;  1TWA H;  4LW1 A;  5J3B A;  2K4K A;  3S16 H;  1V43 A;  1YEZ A;  5M3F G;  4QQB X;  3KJO A;  3HOX H;  2UUA Q;  5IP9 H;  5AJ3 L;  2BA1 A;  4GNX C;  2HT1 A;  1IBM L;  3SGI A;  2YU9 H;  1S72 A;  2VL6 A;  2IX1 A;  2IX0 A;  2KHJ A;  5FLM G;  1D8L A;  1J5E Q;  4DV3 Q;  2E2H H;  2UXC L;  4LF5 L;  2MNA A;  4IJL A;  1SLJ A;  5GAG C;  4Y7N H;  1PH1 A;  3KJP A;  1KL9 A;  3A5Z B;  3W5O A;  2HQL A;  2Q2H A;  2VQE L;  3S1R H;  2Q2T A;  4JI6 L;  4R1J A;  1M1K C;  4A3I H;  3DLL A;  4X62 L;  4DR3 L;  1VQO A;  4BBS H;  3T1Y Q;  1QZH A;  5BR8 Q;  1K9M C;  3H0G G;  4JYA Q;  3GTP H;  4YCU A;  4YHH Q;  1VQ5 A;  3RZD H;  2NVQ H;  3GD7 A;  4GKK L;  4PG3 A;  5JEA J;  1XJV A;  3GDE A;  1IXR A;  1VQN A;  1E22 A;  1WI5 A;  4JI4 L;  1DGS A;  5M3F H;  2UUB Q;  1CKM A;  2NN6 G;  3CCU A;  3KLW A;  5IYC G;  1Y14 B;  3OTO L;  3UE1 A;  2Y0S E;  2IT1 A;  1IBK L;  3KF8 B;  2PI2 E;  3CCL A;  1ASZ A;  1PH8 A;  3PUY A;  4Y52 H;  1WJJ A;  2N49 A;  1KXL A;  4DK6 C;  4GLA C;  1IBL Q;  2I5M X;  2IHE A;  1RIP A;  3OTO Q;  2LXK A;  4B3T L;  4L5S A;  4JOI A;  3ULJ A;  4B3S Q;  1RL2 A;  3NBH B;  1V9P A;  1VQM A;  2R92 H;  2JA5 G;  4YY3 Q;  3GTL H;  1Q1B A;  1WCM G;  1HR0 W;  4YWM A;  3K0X A;  3RR5 A;  2HIX A;  1H95 A;  1XPR A;  1SMX A;  4A75 A;  4YHH L;  5C0X J;  4JBW A;  2I5L X;  4BY1 G;  5JEA G;  5C0X I;  4POG A;  2JA7 H;  3CQZ H;  3T1Y L;  3HOZ H;  1PH5 A;  1YIJ A;  3WWV A;  4LF8 L;  1CKN A;  2Q2I A;  2DUD A;  3KDF A;  4LFB L;  4KI0 A;  3UDX A;  1EIY B;  3CXC A;  4LF9 L;  4P72 A;  3PO2 H;  4C3H H;  4JI4 Q;  3BZK A;  2ES2 A;  4A3L G;  1Q1E A;  1VS0 A;  2KCT A;  1E24 A;  3J81 j;  1A0I A;  3HFZ B;  3L2P A;  4GKJ Q;  1CUK A;  2ASB A;  5H1S E;  3B6Y A;  1SRO A;  3KF6 A;  2C35 B;  5IT9 c;  1HZB A;  4LF7 Q;  3E9I A;  1K3R A;  3F8T A;  3CCJ A;  1E1O A;  4X65 Q;  3L0O A;  2QA4 A;  4DV1 Q;  1L0W A;  3U4Z A;  1J5E L;  1X56 A;  2LXJ A;  3HOY H;  4DV1 L;  2RF4 A;  5GRO A;  3K8A A;  1L1O C;  2AKW B;  2WB1 G;  4A3F H;  4BY1 H;  2JA7 G;  3I4O A;  1PH2 A;  2WFW A;  1VQE A;  4B3M L;  2YTV A;  1KQS A;  4HID A;  4NB3 A;  2K52 A;  1OXS C;  3CW2 C;  3TEH B;  4JI3 L;  2UU9 Q;  1Y1W G;  3PIP A;  4DUY L;  4A3G G;  4GNX B;  4DR7 Q;  1UEB A;  1XMQ Q;  1L2F A;  2JA6 G;  1JJC B;  5GAD C;  5ELN A;  3HOV H;  1N9W A;  1PYS B;  4X65 L;  4A93 G;  4MNO A;  4RG1 A;  3HOX G;  1MIU A;  3M4Q A;  4UP7 A;  5IP9 G;  4DR2 L;  1YJ9 A;  5C3E G;  4GNX A;  1GM5 A;  2CKZ B;  4DV7 Q;  4JI7 Q;  3MXN B;  3BZC A;  4WJ4 A;  3KYH C;  5LMN L;  3OYY A;  4UY8 C;  1UWV A;  2Z6K C;  3CP0 A;  3RN2 A;  1YJN A;  1XMO Q;  1M90 C;  4LF4 L;  3CC2 A;  2F4V L;  4LF9 Q;  4DR4 L;  4BA1 I;  4HJ9 A;  3KF6 B;  3M85 A;  1NE3 A;  3RNU A;  4GS3 A;  4A3B G;  1PH3 A;  2ZTC A;  5C0X G;  4A3I G;  3S1M H;  3M3Y H;  2D0P A;  4BBS G;  4A3E H;  1BBW A;  4AQY L;  3HOW G;  1HZA A;  2D62 A;  3E9H A;  1CSP A;  3PSI A;  3W1G A;  1SFO H;  3KFU A;  4JI8 L;  1FJG Q;  2JA6 H;  4DAM A;  2AWO A;  4GOP C;  3HOV G;  1QVG A;  2KHI A;  2ALY B;  4EX5 A;  1JE5 A;  3FP9 A;  4C3I H;  2FXQ A;  4IPH A;  2WP8 J;  1P8L A;  2VUM G;  3M4O H;  2K75 A;  3NEN A;  3PF5 A;  3GTO H;  4JI7 L;  1KRT A;  4X64 L;  1QZG A;  3ICE A;  3I4N G;  4IFD G;  4X62 Q;  4BXX H;  1I94 Q;  1X3F A;  3K7A H;  1OXX K;  4OWT B;  3S24 A;  2VQE Q;  1QVC A;  2NN6 I;  4JBJ A;  2YV5 A;  1Z9F A;  1MJE A;  1OXT A;  2E5L Q;  4MTN A;  3ULP A;  1XMO L;  4IJH A;  4QY7 A;  1KAW A;  2UXC Q;  3DM3 A;  2JA5 H;  1Y1V G;  2OCE A;  1EQR A;  4L5Q A;  3CC7 A;  1P16 A;  4DR7 L;  4ALP A;  1EFW A;  4APV A;  3HKZ G;  4JYA L;  2RHQ B;  4BBR G;  1U5K A;  2PI2 A;  3KDF B;  4DR3 Q;  3CCR A;  1X65 A;  3T1H Q;  4DR2 Q;  1IZ6 A;  3KOJ A;  1IBM Q;  1MKH A;  2E2J H;  4JI6 Q;  5E7N A;  5EAY A;  3JAM i;  3S2H H;  2YYZ A;  1A63 A;  1G51 A;  1TWG H;  1YHB A;  3PUX A;  2GN5 A;  2BH8 A;  2YTY A;  2ZJR A;  3AQQ A;  1YNX A;  4H02 A;  4UPA A;  3STB C;  4HJA A;  1XMQ L;  1K8G A;  3JAM c;  4DUY Q;  1QVF A;  2JQO A;  1NY4 A;  4R4T A;  1S40 A;  4EQ5 A;  4HIM A;  1C9O A;  1UE6 A;  2HHH Q;  1X54 A;  1EQQ A;  1X3G A;  4B3M Q;  1ASY A;  3U4V A;  4NXN Q;  1IL2 A;  4L5R C;  2R7D A;  1HZC A;  3H3V I;  2Z0S A;  2WAQ E;  1CSQ A;  4X6A H;  3I7F A;  3CMA A;  2JA9 A;  4LUZ A;  2ZM6 Q;  3OW2 A;  5JJK A;  1Y1V H;  3GO5 A;  4DUZ L;  1NMG A;  2R93 H;  1CKN B;  1Q7Y C;  2KEN A;  1SR3 A;  4JBM A;  2A19 A;  4LF6 Q;  4LFB Q;  3G71 A;  2ZTD A;  4XIG S;  1PH6 A;  1N34 Q;  3ZJY C;  2A1A A;  3JC6 6;  4A3C H;  2DGY A;  4JI1 Q;  3CCE A;  1XNR Q;  5GAH C;  2N3S A;  2R92 G;  4GKJ L;  2JEA I;  1VQI A;  4P75 A;  4A4I A;  5IYB H;  1U0L A;  2JE6 I;  2OQK A;  3IRB A;  3Q8D A;  4C3J H;  1K73 C;  1HNZ L;  3F2C A;  4TVA B;  5M3M H;  1PVO A;  4JI8 Q;  3G4S A;  3M7N A;  4B3T Q;  3H15 A;  1OXU A;  2D0O A;  4DV0 L;  3RLO A;  4HIO A;  4UP8 A;  5C3E H;  3STB D;  2Z6K A;  5HY6 A;  4FDB A;  2IHF A;  1A8V A;  3E0E A;  4R4O A;  4A3L H;  1GVP A;  3F2D A;  1LM0 A;  3TRE A;  3H3V H;  2CFM A;  2K5V A;  1JJ2 A;  4LF4 Q;  2F4V Q;  2VS1 A;  3PO3 G;  1VQ9 A;  1X3E A;  5M5Y H;  2CCZ A;  2F52 A;  3EBE A;  2MFI A;  1YBY A;  3K80 C;  4GN5 A;  2B63 H;  3GTG H;  2UUC L;  5IP7 H;  1C0A A;  5BR8 L;  1TXY A;  3M9B A;  1Q12 A;  4GN4 B;  5M5W H;  5FLM H;  2JK8 A;  4OWX B;  4HJ8 A;  1SE8 A;  3CCS A;  4JI5 Q;  1VQL A;  1BVS A;  5IYB G;  4IOA A;  1PV4 A;  2UUB L;  3CC4 A;  5IWA Q;  3UDF A;  2L15 A;  3HKZ E;  4LF5 Q;  3HOU H;  2ZJQ A;  4HJ7 A;  4OO1 G;  2XTI A;  4OO1 I;  1L1O B;  2K14 A;  4PZ7 A;  2VQF L;  4QL5 A;  5JJI A;  2Y0S G;  5AJ3 Q;  1Y1W H;  2VUM H;  2LSS A;  4C2M H;  2UU9 L;  4JI3 Q;  4A3G H;  1QUQ A;  3AFQ A;  1XPO A;  1VCI A;  3AYH B;  5C4X G;  1SRU A;  3RLN A;  3TQY A;  1K0R A;  4LUO A;  3NEM A;  5IYC H;  1N33 Q;  2VZA A;  4K0K Q;  2H5X A;  3FKI H;  1FGU A;  2MO0 A;  2GVA A;  4YWK A;  2JJQ A;  3J7Z C;  1N32 L;  1VQ8 A;  3ULL A;  1HR0 Q;  2B63 G;  5HGQ A;  5IP7 G;  2UUA L;  4DV4 Q;  1TWH H;  4A76 A;  1MJC A;  4PZ6 A;  3HKS A;  5C44 H;  4BA2 I;  3ER0 A;  1Q86 C;  4JCV E;  1YZ6 A;  1B70 B;  3H0G H;  1WOC A;  2NZH A;  3K81 C;  2EQS A;  1NMF A;  3D31 A;  3W1B A;  4OXP A;  1J6Q A;  4P71 A;  1NTG A;  4DAY B;  5FLX c;  2QEX A;  1WCM H;  2AMC B;  3I55 A;  1HNX L;  2UXD Q;  3A74 A;  2RCN A;  1UE5 A;  2BH2 A;  3I56 A;  4OX9 L;  2A8V A;  1AE3 A;  3GTK H;  4P73 A;  4QGU A;  2PQA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...