1S5FD

Cholera holotoxin, crystal form 2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase,toxin
molecule keywords Cholera enterotoxin, A chain
publication title Crystal structures of an intrinsically active cholera toxin mutant yield insight into the toxin activation mechanism
pubmed doi rcsb
source organism Vibrio cholerae
total genus 23
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1s5fD00
1V1PA 1CT1D 1CHPD 1LT5D 1TY0A 1LO5D 3BVMA 4RGNA 1PTOD 3BYTB 3R8BA 1KLGD 3W2DA 4L6TB 1LLRD 1ESFA 3OWEB 1I4RA 3BZDB 1MD2D 2TSSA 2XN9C 1TY2A 2QILA 1EU3A 2SEBD 3MFGA 4RHSA 1PYWD 4UDUC 1HXYD 1B1ZA 1FNWA 1I4XA 1KLUD 4RGOS 3V05A 5ELFA 1M4VA 1D6EC 5D3IB 4ZYSA 1SE2A 1UUPA 3SEBA 2IPKD 4O1NA 1EWCA 1T5XD 1LTSD 2AQ1B 1TS5A 1UNSA 2NTSA 1F77A 4DXGA 1RDPD 5ELDA 3EFXD 1L0YB 1S5FD 4TSSA 1CQVA 1LTTD 2QEJC 1V1OA 2Z8LA 4L63B 4RCOA 1PRTC 2XRQD 4RH6A 1BCPB 3URYA 3O13A 3GP7A 1CK1A 2IJ0A 1LT3D 1STEA 3DWPA 2WV6D 1I4GA 1PRTD 1I4HA 1GOZA 1TS4A 2J4XA 3TSSA 1FNUA 1ET9A 1LT6D 1PRTF 1JQYD 4OHJA 4RFBA 1SJHD 1SEBD 1ET6A 2AQ2B 2XRSD 1SE3A 1RCVD 4C56C 4K6LA 1JWUD 2RDGA 1LTID 1EEID 1LT4D 2CHBD 5ELEA 1V1PB 1RF2D 2G9HD 2R61A 5D3DA 1TS2A 1HTLD 3R2IA 1PTOB 1LTGD 1D5XC 1XXGA 1I4QA 2AQ3B 1S5DD 1LTBD 3EA6A 1PZKD 1PZID 2ICIA 1QILA 1EU4A 1HA5A 5I4DA 1EFID 1HQRD 1TS3A 3MC0B 1SE4A 1BCPC 1CHQD 5FKAC 2XNAC 3DWQA 3DWAA 1JWMD 3BVGA 5TSSA 1DYQA 1SBBB 1LTRD 4RHRA 1KTKA 2NTTA 5ELBA 4DXFA 1FNVA 1PTOH 1BCPD 1S5CD 1PTOF 1FGBD 1PZJD 1EEFD 1BCPF 1SJED 3KLSX 1L0XB 1B44D 1JR0D 1FD7D 4BWGB 1JCKB 4RGTA 4RGMA 4Z9CB 3BVZA 1AW7A 1SXTA 1D5ZC 5ELCA 2O2LD 1G8ZD 1RD9D 1D5MC 1ENFA 1LTAD 5FK9C 1AN8A 1DJRD 1I4PA 3BYYB 1PRTB 1PTOC 3R2TA 1XTCD 1BXTA 1S5BD 3CHBD 1JWSD 2RDHA 1S5ED
chains in the Genus database with same CATH superfamily
2B39A 3HFZB 1O80A 2I5LX 1OO9B 2NB0A 4LMQD 5E4XA 1A15A 1FJGQ 3HOXH 2ZTEA 3HOYG 4RMFA 3TP7A 1KAWA 1O7YA 4JPBW 1B1ZA 4WJ4A 2QF7A 4CJ0B 3PUVA 5D3IB 5C3EG 2SDFA 1HJPA 3CCVA 2JA6H 2EY1A 1EL0A 1L0YB 1HUNA 3G6EA 4KHPQ 4A3GH 5J1ZA 1SYDA 3FP9A 1RODA 1IBLQ 3PO3H 4FYDA 3UE1A 4XQNA 1Z47A 3ULPA 1E1OA 3K7AH 4B3TQ 1I4GA 5M5XB 3N6RA 1IYVA 2UXBL 2L0CA 5I2XA 5EKIA 5EQ0A 3NTIA 3MA2B 1R9TB 2UXDL 5DNFA 1RF2D 2UXCL 1KDCA 1Y1VH 3R2IA 4O0AA 3VYSA 4DAYB 2B63B 1SDFA 5IGCA 1LTGD 2A68D 2F03A 3TZUA 1S5DD 1NR4A 1PZID 3UDXA 2K75A 4DR3L 1GM5A 4DAPA 1EQTA 4JV5L 4UP9A 2K52A 1E3PA 1EYDA 1ZYRC 5C44B 4NP5A 1PFMA 2RKSA 2JA6G 1IXRA 2OEOA 4C3IH 2RHSB 4RAUC 4A3GG 4APVA 3RN5A 1BCPF 3QR8A 5LMNL 1Q7YC 4ZKCB 3OHXC 1A2UA 1JCKB 5CYUA 4JOIC 4AYBG 1H9JA 1X3QA 5ELCA 2EJGC 4LUOA 3HOUH 4HJ8A 1IW7D 2K28A 3VYTA 3CAMA 4KD3A 3BYYB 2E2HH 4PZ8A 4ZRZA 4QCLA 1I94Q 1NAPA 3KJOA 1QJOA 2O4XA 2AKWB 2RCNA 3L3OC 4QIWB 1MI2A 2UUAL 1MJCA 4DUZL 3E6ZX 1LT5D 3R8BA 3OTOQ 2PYKA 2F0LA 1Y1VG 4PMBA 2LXKA 3S1NB 2XN9C 1Z7TA 1SLJA 3C2PA 1X65A 1EY7A 2F0FA 4X3SA 3T56B 1H95A 4KD4A 3I4NH 4AQYQ 2K6AA 2V1CC 2ZJRA 1T5XD 1N32Q 1Y14B 3H09A 3S15B 5BN4A 1UWVA 1N33L 2VQEL 2KHSA 2Q2HA 5CBAE 3NWSA 3EN2A 3NWTA 3K5MA 2VZAA 4CDCC 3S16B 1WTWA 1K8MA 2FXQA 4LF6L 3GTKB 4RH6A 3I72A 3ND9A 2F4VQ 3VA5A 1YVCA 1P8LA 3OMGA 2OTJA 1EZ6A 3C1FA 3RZOH 3MEFA 2NWGA 1JE5A 5KEEA 3KBGA 2PZTA 1C9OA 3D31A 3CCJA 1CKMA 5EPKA 4N8FA 1QNUA 5GAHC 2IX0A 1CFMA 4HCEA 2KHIA 4FNFA 3GO5A 1Z6HA 2HHHL 4LAAA 5CV8A 4IUUA 2CHBD 5ELEA 4UP7A 1TS2A 4FF3A 4HIMA 1YHQA 3K0YA 1VQ4A 1OTCA 4HAEA 3QJYA 1HNZL 1LTBD 3S9WA 4QQBX 3GTOH 1MGSA 4X62Q 4A76A 4A3CH 3TN2A 5ELNA 1X56A 3H3VC 2K33A 5M5YH 4DF7A 4J6HA 1CTMA 3I70A 1K8AC 3M4YA 1VMPA 4OX9Q 1NY4A 2F0VA 3F8TA 2O5JC 1GJXA 2HUGA 1CM9A 2SNMA 3GTPH 2N49A 4OIJA 2ALYB 4LW1A 1YBYA 2PI2E 4ME3A 3NBIA 3PSIA 4G7OC 4KKSA 4EQOA 3LX0A 2B2VC 4K0KQ 3C1EA 4C1NK 2XGTA 3W2DA 3S17B 5EJWA 3BVMA 2ZJPA 2DY7A 2WKCA 3JAML 1K8OA 1I4RA 4RA8A 1B9MA 3WDNA 3HOYB 2R6GA 5FLXL 1XTDA 4JI8L 1O78A 3QO2A 2NZ1D 1WCMG 3ND8A 4A3CG 4C3JG 1K83H 2IPKD 3HOZG 5KNCA 1UNSA 1M1KC 3K8AA 5ELDA 1JJ2A 4IPHA 2NVXH 3EFXD 1NE3A 4NB3A 1V1OA 4C3HH 2FINB 3J80E 2XRQD 4DR5L 1UEAB 5E7NA 2J7ZA 2YTVA 3OIPA 1KNAA 1H9RA 4IUTA 1B53A 1TS4A 1PRTD 1GOZA 1STAA 3TSSA 3VR2A 2K4KA 4GOPC 4LJZC 1FGUA 1IYJB 1XNRL 3NEMA 3BG3A 2PI2A 4K14A 4KK7A 2A8VA 1BBWA 4A4IA 4IUQA 3GTMH 2F0DA 2UXDQ 1PTOB 1QE6A 1VQGA 1PXUA 1EIFA 1F2MA 1FYCA 4UPAA 3J7AF 2UXCQ 4PMWA 3HOXB 3CCUA 2Y0SG 3CC7A 3PF5A 1X54A 2ICIA 3UE0A 1BF4A 1HZAA 1HA5A 1P16A 3UDIA 4CJ1B 1NMFA 1QZHA 5D14A 5FLMH 3S2DB 3NPPA 5CV7A 4LF7L 2WKDA 4JOIA 2N55A 3DWQA 2JA8H 1IKMA 4DR3Q 2A6HD 1DYQA 3GD7A 3X3NA 1S72A 3AFQA 4QB4A 5KYIA 1PHJA 1F9SA 2JA6B 4FF2A 1JC7A 4XIGS 4A3GB 2WACA 1XMOL 3CD6A 1E7ZA 2AWNA 4K8JA 5IYCH 3LWEA 1IL2A 4KKUA 1CZWA 4LF4Q 3PO3B 4DR7L 3ZYYX 1SXTA 2LMCB 3K7AB 4DV7L 3J80c 1RD9D 2K32A 5DEHA 5DM63 5EBDA 3A7LA 2K04A 3R2TA 2EYHA 1YNNC 5LMUQ 1ENCA 3DLLA 5C3WA 1SMYC 1VF5C 4LUVA 3VYRA 5AFWA 1WYDA 2UUAQ 3AB9A 4DUZQ 1Y1VB 3ICEA 1JT8A 4JG2A 3PO2H 1YIJA 1ONLA 2L12A 4R4QA 3K81C 3BZKA 1QUQB 3NQTA 5C4ZA 5FLMG 3BS1A 2EDGA 3KFUA 2NVYH 2F0NA 4X64L 2NTSA 1I50B 2SOBA 5EKKA 2JA8G 5EGTA 1HRJA 1RHPA 1LTTD 1RL2A 1N33Q 4C3IB 2VQEQ 3OOCA 5A35A 1GUWA 5IP7H 1U4MA 2LXJA 3GP7A 4K5XA 4V190 1DGSA 1HNWL 4KV6A 1QVFA 1WTRA 4B3RQ 1E2ZA 1VF7A 2F3IA 3HOUB 1B4OA 3MTSA 3SXHA 4X6AH 2X6LA 3EBEA 1NJIC 4TQUS 4BY7G 2E2HB 2AQ2B 2HT1A 1SE3A 2XIWA 1HPCA 2OXPA 4DV5L 2QDBA 3EROA 4B9XA 2QW7A 1QOHA 4FF1A 3FHWA 2MGSA 3J81L 2HHHQ 1SYBA 5JPNC 1LACA 5FO8B 5C4XG 3WOFA 3EA6A 4OWTB 2DJFC 4JYAL 1EWIA 3VYUA 4WORA 2JSOA 4UP8A 1EFID 4S3SA 1HNZQ 2H4OA 4BA1I 4A3BH 5CMDA 3I4NB 4IUVA 2M00A 1N9WA 5I6WA 2TMPA 2R92G 4DR2L 1LABA 4QJFA 1ZYRD 3VR4A 4FF4A 4DV4L 4BBSH 5IP7G 2QDLA 2HIXA 4DV3L 2BDNA 3RZOB 3PIOA 2PZUA 1DJRD 4IPCA 2Z0SA 5IGGA 2HDLA 3EVQA 1KHIA 4P2CB 4PMCA 4CJ2C 4QGUA 2R7ZH 2KA7A 2F0JA 1EY4A 4IUNA 2PW7A 2RDHA 3RLOA 1CT1D 1KLGD 4XQJA 1XPOA 2BOSA 3I90A 2KEEA 5BR8L 1TWFB 4A3KH 2PNRC 1MD2D 2VS1A 3D4RA 3PUYA 4JI7Q 1HXYD 2E76C 4JK1C 1I4XA 1HFNA 3NTHA 3V05A 4DUYL 1M4VA 5NUCA 2E2JH 3S1QH 1WTQA 4ZCKA 3PV0A 4NMZA 2F4IA 4A75A 5JVG3 5M5YB 2MP1A 3PGZA 4NXML 1GVPA 4A3EB 1K3RA 4PNYA 4I65A 3NSWA 4IPGA 4P74A 3HZXA 3S24A 2RSNA 4A93H 3OYYA 2C9OA 2JA5H 1Y1WH 5IYDH 1VQJA 4DR5Q 1YZ6A 1I4HA 4J8QA 3KJPA 4IOAA 4IPDA 2PPBC 1A63A 1RIPA 2KVMA 3U50C 4IN3A 3WWVA 1IL8A 2MHVA 1EWHA 3I8ZA 5IODA 5E4WC 1Y69U 1PVOA 3OIQA 1D1KA 5D3DA 3TP5A 1XNRQ 3HOWH 4MZ9A 3C3LA 1VCIA 3D3RA 3NQIA 2CCZA 4A3KG 2ZTCA 4ZLTF 1SYGA 4OONA 1U5KA 2Y0SB 3FEWX 3KYHC 4EQNA 3K0XA 2DNCA 5CGKA 2B3GA 3W5OA 4HJAA 3DEPA 1K83B 2G5DA 3BVGA 3KF8B 4KLKA 4OEMB 1JB7A 3TMEA 1VQBA 4LF7Q 4FO2A 5M5WB 1FNVA 2NVQH 1SFOH 4RG1A 4C3HB 3SR1A 4V0BA 4BS9A 5GAEC 2WAQB 4A93G 2JA5G 3BVZA 1M90C 1XMOQ 1CKOA 2E2IB 2C5CA 3FPUB 4R1JA 4XYOA 4LF9L 4DR7Q 2R93H 1YEZA 3U58A 5C3EH 1WJJA 4DV7Q 2LS01 1HR0L 5EKLA 1LTLA 1S5ED 4A3IB 4DKAC 5GAGC 1O7LA 1A3VA 1FL0A 2PNHA 1NCVA 3HOWG 2F0KA 3SK4A 4N9TA 1TWCH 2B2UA 2QILA 2XWJB 1CUKA 3ONAB 1V9PA 5JVH3 1PDQA 3I55A 1MKHA 5GROA 4M1UB 4YCWA 3E0EA 5CV6A 4KHZA 1YI2A 2EY5A 3M4QA 2JA8B 2B2YA 3MXUA 3GTJB 1QNKA 4X64Q 3J80i 3DM3A 4X65L 2OTLA 2EJFC 1HFGA 5C4HA 2FMCA 4UHVA 5GQOA 5LHY1 3A8JE 3D6CA 3E3XA 3G48A 1YHBA 1KIXA 1IKLA 4TRDA 2R93G 4JBMA 4I7AA 1PFSA 2BH8A 1AE2A 4C56C 2KECA 2WB1E 2RDGA 2X69A 3OW2A 4WJ3M 4HSVA 3PMFA 4YCVA 1N34L 3N52A 4A3MH 2CH4W 4JI5L 1BO0A 4DV1L 2RHQB 2ZXOA 1U0LA 3BU2A 3K7UC 1I4QA 1EY0A 2HDMA 3PO2B 4B08A 1J6QA 3QOLA 1WD0A 4R4OA 2VQFQ 1EIHA 1CHQD 4JYAQ 2F0HA 1PH5A 2NVYB 3J7ZC 1NTGA 5ELBA 3CCSA 2IX3A 2B2TA 1S5CD 2E5LL 5JAVA 2EYPA 3NENA 4DR2Q 3D0FA 4CGYB 3QB3A 1CKNA 1AW7A 3CCRA 2K5QA 2A69C 4JW0A 1I4PA 4DV3Q 5BN3A 4FVMA 2L9HA 1B2TA 2NBFA 1BXTA 1MJEA 4LF8L 2F3WA 1GKHA 3W3AA 3W1GA 4FXDA 4TVAB 1CHPD 3FKIH 1LO5D 2IWHA 1YJ9A 1YHAA 2K01A 1LLRD 1YNND 4P73A 4E6IA 1PH9A 4A3MG 2ZM6Q 3D8GA 1BR9A 1K73C 2A6ED 4A3LG 1VQ6A 1SMYD 1Q1EA 5BR8Q 5L37A 1AFPA 3SK6A 1JJGA 1KAAA 2CW0C 2PO4A 5D65A 1VQDA 4C2MH 3A8IE 2JA7H 2WFWA 1SE2A 2KBNA 3KDFA 4DK1A 3CPFA 4A3BB 5JPMC 4JI0L 3SVMA 4DUYQ 3I7FA 2F0QA 1EYGA 5FO9B 1WTOA 1CQVA 3GTLH 1OXTA 4BY1G 1K28A 3KUPA 4A3DB 1EY8A 3P1HA 4NXMQ 1MSGA 4F87A 4BBSB 4R8NA 5AJ3L 5HURA 2KQ3A 2KCTA 1FNUA 1LT6D 4XT1B 1UE5A 4K2KA 4RFBA 4HSPA 5EAYA 1Q86C 3TS0A 2R7ZB 1ICWA 1RCVD 2F0IA 4GLVB 1AZQA 1VQ7A 2KCCA 4MTKA 1OXSC 3RMHA 1BBUA 2CWAA 3KLSA 1C8CA 3FKIG 1GHJA 2EXZA 3Q22A 2XTIA 4Y52H 5KNDA 3M4PA 1HQMC 2PW5A 4ZUIA 5KRUA 4B3SQ 1G2TA 4A3JB 2RVLA 1D5XC 1PZKD 5IWAL 5ISRA 1PLFA 3I2ZA 2YYZA 4OO1G 5C0XH 5IT9E 2JA7G 1VS0A 3S1RB 1SE4A 5M3MB 1HCZA 3IRBA 4EX5A 1NUCA 2DNEA 2K1BA 1N36L 3S1QB 4H0LC 2E2JB 3BJUA 5TSSA 1U4PA 1SBBB 1DXMA 4DXFA 3K5NA 2MQHA 3GV6A 1BUVT 3S2HH 3H3VH 1X3PA 4DK0A 1VQNA 1CZGA 4BWGB 2FJ2A 5FJ8H 2PCFB 2UUCQ 4RGTA 4LFAL 4OIKA 4OXPA 1Y1WB 3RUZA 2QKIC 4HIDA 3DXJC 2LSSA 1OXVA 3V2TA 1BDOA 4DV2L 1WCMH 1PRTB 2I07B 4KTAA 1J8IA 4C3JH 3A0JA 3HOZH 1A2TA 1MIUA 1XTCD 4LF9Q 3HS0C 2K5DA 3GDEA 1V1PA 3TZDA 4KJOA 1HR0Q 1X32A 4L6TB 3G71A 1ESFA 1T9HA 4GNXC 2UU9L 3HOWB 2ID0A 3CW2C 4KJNA 3CQZH 4Y7NH 3MFGA 2SEBD 1ML0D 4DFAA 1GUTA 3PF4A 3D6WA 1KLUD 5T1IA 2MJ8A 5C0XG 3IL8A 1NBWA 4DR4L 4IJHA 3HGBA 4RKLA 2F0GA 4TSSA 5J39A 5IT9c 4DA2A 3MXPA 4K8IA 2NVQB 5IGEA 1SFOB 4L5RC 4DR1Q 3CU7A 1KABA 2F0EA 2L4NA 1HA6A 4CKEA 5FJ8G 2NN6H 2WV6D 2EYOA 2PMZE 1EOTA 4WFN3 1ET9A 1GUSA 4WRDA 1B9NA 5JEAH 1M8AA 1UE1A 4XDXA 1A62A 3SHLA 3UDFA 5C3EB 3HKZG 4YWMA 1V1PB 2IW3A 2NYZD 4X66L 1VQMA 3QIAA 1NR2A 1WFQA 2D9UA 2OQ0A 2JA9A 4AIMA 2A73B 1Q8KA 1L1OC 3PQIA 3HOVH 1N34Q 1Q8IA 4B3ML 2RCFA 4JI5Q 4DV1Q 1EU4A 1J5EL 1QCBD 1Z9FA 2EZVA 3TEHB 1TS3A 4A3FH 4GLAC 1B3QA 4YIJA 4NDXA 2YU9H 1BCPC 2XNAC 4ZKBB 4HJ5A 3TP6A 4DNRB 1F2ZA 1W6KA 2UXBQ 1KDAA 2EY6A 3E5SA 3OSOA 1EYCA 4FXKC 2VY3A 4BA2I 2JE6I 2A19A 4NXNL 3AMUA 4GLXA 3BDCA 1JR0D 1KRTA 4M8AA 3CPWA 2E5LQ 1SNQA 1K0RA 4KHVA 2G9DA 4EGVA 2ZXPA 4YWLA 2NN6G 1UE7A 3G7LA 4LUZA 3Q6SA 4ILWA 3A56A 3R3OA 1XNQL 5JJLA 5JEAG 2EJMA 4J1MA 1JWSD 5M3FG 2J0TD 1TQOA 3KBXA 4H44C 4RGNA 4JV5Q 1K3BC 1X3EA 1SNCA 2F0OA 4MNOA 2Q2TA 3BZDB 2F0PA 3NK9A 1PH3A 2GVBA 2Z6KC 1W6JA 3HOVG 2CH4A 4AYBB 4RGOS 3M85A 2CVRA 5BN5A 1JOOA 4KN7C 5LMNQ 1GUOA 4QUCA 4A3FG 4BY7H 4BXXG 5A2QL 1LTSD 1PYSB 1O7IA 4L8JA 4DXGA 1WOCA 4JI3L 1SNMA 1XMQL 2QEJC 1PH4A 2Z8LA 1UAPA 4JI0Q 4WJWA 1VQOA 3SGIA 1STHA 2JXMB 3HKZE 2BA1A 5C4XH 1LT3D 3BZCA 3EJIA 3NE5B 4JI6L 2AMCB 1PRTF 2KHJA 1VQPA 3NTKA 3V96A 5AJ3Q 1D1IA 2V4DA 1ET6A 1TT2A 5EPJA 2EYMA 4DV0L 1LTID 3NELA 5M9OA 2R92H 1LT4D 3CMEA 3T1HL 1EOVA 3T1YL 1LM0A 3MXNA 1B8AA 1ILQA 1C7YA 2A1AA 4KY5A 3CCQA 1F9RA 3PIPA 1I6HH 2B8FA 2BDOA 5CC4A 3VDYA 3K59A 1QB5D 2JQOA 5KNBA 4LF6Q 5JJZA 2D5DA 2JA7B 1Y8PB 5FKAC 2C35B 1RJTA 4RCNA 1LTRD 1B70B 4CKBA 2L11A 1N36Q 1VQ8A 3SDZA 1VQFA 4EQPA 4FDBA 4XQQA 1FGBD 4P75A 3PIO3 1AZPA 3KF6A 2R7DA 4DPGA 4JBWA 3AU7A 4R9WA 4G7ZC 1U4LA 1G8ZD 4JCVE 1ENFA 4GNXA 4KN4C 4CBVA 4LFAQ 5IP9H 5K36H 3JAME 4KHPL 2KUMA 1GUNA 5GADC 2A69D 4ODGA 2K7VA 4DV2Q 3I91A 5FLXE 3DEOA 3CRKC 1TWAH 5KYLA 1FR3A 5I9PA 1HZ9A 2B2VA 5HGTA 4P71A 1KXLA 2A5HA 3EQLC 2BE5C 4IURA 1TWGH 3E9HA 1G51A 2UU9Q 3I73A 1SSOA 1QZGA 5ELFA 2WAQE 1D6EC 4ZK9B 1SMXA 1JORA 1H9SA 2UUBL 2F1MA 2CW0D 1F77A 2GN5A 4L5SA 1A3UA 2ICEC 2JP1A 1SN8A 4I7ZC 2YTXA 1WTVA 2F0TA 2B63G 3PCOB 3URYA 3S2HB 5EPLA 4KY7A 3GTGH 1U4RA 4G4KA 3STBC 2VB2X 1HTPA 3OWFA 2Z9HA 3P20A 4DN4M 3PUZA 2BA0A 3FMCA 4O2DA 3GTOB 3OPOA 1MSHA 2RA4A 1L1OA 5IP9G 1L0WA 1WCMB 4ULLA 5K36G 3G6JB 4JI8Q 4C3JB 5C44G 3HOZB 4PV1C 1RTNA 1R4PB 2Q8RE 2I5MX 4PQXA 3GTKH 4GOPA 2IT1A 1HHVA 3I56A 1EIYB 1Q82C 2VB3X 2N88A 4YCUA 3AYHB 2NVTH 4Y7NB 1G2SA 4X66Q 4DNIA 3GTPB 2OQKA 1Q3LA 3MZ5A 5J3BA 4NW2A 2LY7A 1V43A 2JEAI 4B3MQ 1X3FA 2HCIA 2M9VA 4IZ8A 5I6YA 1PH8A 1WTXA 3FDTA 1A3TA 4XYQA 1W3SA 1PH7A 4CDDC 1EY9A 5CV4A 4LF5L 1Q12A 4QL5A 2F0MA 2IX1A 3P7JA 5A2QE 1SYFA 3L9AX 5G3LD 1B44D 1F2YA 1BBXC 2EXDA 3IAYA 5IY0A 1JMCA 4NXNQ 1N32L 2WB1G 3NXWA 1G91A 2EPBA 3B6YA 4HJ9A 1HR0W 2ZXRA 4QUFA 2Z6KA 4X3UA 5C6AA 3A7AB 1XNQQ 4FP5D 2QCPX 3H0GH 3SK8A 2D2CC 2NVXB 1E2WA 2Q2IA 2WP8J 1ENAA 4GOPB 3M7NA 1CQFA 1CSQA 1KC8C 2ENBA 4UDUC 4N8X1 4X3TA 1I6VC 2Q2UA 2JEBI 2EYLA 3IKJA 3LNNA 3I4LA 5C0XJ 1TVXA 4HJ7A 2H1EA 1IBML 4HR7B 3S17H 4DR6L 2YU9B 4IFDH 1YNJC 3JC66 2A74C 2YTYA 4HTHA 3D4WA 5KIXA 4L63B 4JI3Q 3CCEA 1ZKOA 2K03A 5HY6A 3GTMB 1NNXA 1DOKA 1R4QB 2QA4A 3DM1A 1VQCA 1SAPA 1SYCA 4JI1L 3ZJYC 1QWYA 2I46A 4HMJA 3J81E 4F7XA 2XRSD 4JI6Q 1YJWA 1SNDA 2HIVA 1STBA 2B2WC 1G291 1JWUD 1V1QA 2F0UA 4IALA 3H0GG 1VQLA 1D7QA 4ZUJA 3CRLC 1JOKA 1KL9A 4QIWE 3T1HQ 5JJIA 1I5FA 1XXGA 2AQ3B 3OMCA 2VUMH 2OCEA 3VR5A 3CC4A 4JVZA 2K14A 2K5HA 5IE8A 1XYIA 5LL6X 1HNWQ 3PUXA 1QVCA 4BY7B 3DWAA 1C48A 2KJXA 4MHEA 4IFDG 1GD7A 1KTKA 4DK3C 2NTTA 4OL7A 1PTOH 4YWKA 1BCPD 2K50A 4DAYA 2HQEA 2MUYA 1S40A 2H5XA 3FPPA 3P75A 4DV5Q 2PZWA 4POGA 4A3LH 1NMGA 3M4OH 3F2BA 5C4XB 3DHQA 4JI2L 4AH6A 3S2DH 2OT2A 3MFYA 5FK9C 4GZYC 4GN5A 5JEAJ 5IOCA 1PTOC 2ZT9C 4G7HC 1EY5A 4QMGA 1GO3E 1XJVA 4F8MA 1Q1BA 1EFWA 3E0JA 3A55A 4YY3L 1SJED 1IHZA 3K5LA 1EQQA 2ATWA 2R92B 4BY1H 3J81c 1TKWB 2M2LA 5LMNW 3OWEB 2F0WA 1XPRA 4ID6A 2IL8A 2O5IC 3X3MA 5I2YA 5I9OA 1KQSA 3M3YH 1I6HB 3NP8A 5C0XI 1FNWA 4DAMA 2VUMG 4DV4Q 2XSCA 4L5TA 2HQLA 3MXGA 2F0SA 2RSOA 4J15A 4Q5VA 3Q24A 3H3VI 2UUBQ 1GHKA 4DNTB 1V8QA 1PV4A 2K05A 1YNXA 2PQEA 1F2LA 3O13A 3U9OA 3HOXG 2IY5B 3Q23A 1MHWC 3CCMA 2AUKA 2GVAA 1YITA 4O42A 2J4XA 5F2DA 1L2FA 3K57A 2L1BA 1PA6A 3RLNA 4OO1H 4R4IA 4RKBA 3J80L 1VQHA 1I50H 4H7BA 1SJHD 5C5LA 2L55A 1Y8OB 3S14H 1KRSA 1ICFB 1ZEQX 2PQAA 4X3KA 4LF4L 2B8GA 1WTHA 1TWAB 2G9HD 5DLQE 2KENA 4MN3A 1ASZA 3PO3G 3TP8A 2LFNA 4JI4L 1TWGB 3NBHA 3GTQH 5LMUL 1OXUA 1EY6A 4QY7A 1CKNB 4UY8C 1HQRD 3A5UA 4GS3A 3QG1A 3ERSX 1E0BA 2IHEA 1HZCA 1JB3A 4R4CA 3M7GA 5H1SE 1ASYA 4HN7A 5IGBA 1AE3A 1NSNS 2NN6I 4KMUC 1L0XB 4GN4B 1FD7D 4A3KB 3GTGB 4LF5Q 4Z9CB 4DU9A 5J22A 2VW9A 1RKNA 2WB1B 2EOTA 4NPSA 1HZBA 3AEVA 3JAMi 1OXXK 1B7YB 3HRZC 1HUMA 4IO9A 5DAUA 3KDFB 4CDEC 1B50A 2EY2A 1I3QH 2PQAB 3ER0A 4ALPA 2Z1CA 4C3IG 1PH2A 4B3RL 3L7ZC 3FVQA 1JJCB 1JOQA 2Q8TA 2DN8A 4MIUA 1BOSA 1TY2A 1EU3A 1UEBA 4RHSA 2NVTB 4A93B 3NBHB 2JA5B 2BE5D 2N8NA 3HOUG 1W2BA 1EQRA 3R93A 5CR3A 4ZYSA 2P5ZX 3K5OA 3S1MH 3TRZA 4O1NA 4GKJL 3MWYW 1TS5A 1HH2P 1RDPD 3ITPA 1GXDC 3T51B 2Q8IB 1IBMQ 5IGDA 4RWSC 2QGQA 4JC0A 4DR6Q 1TWFH 1PMRA 1Q90A 5E1FA 5C4JH 2GA4B 2B2WA 2IJ0A 4GKKL 3D4DA 1STEA 2EE1A 2FFKB 4K5VA 1QG7A 2Z4HA 3OW7A 4EQ5A 4JBJA 2D0PA 3FRPB 4JBKA 1WI5A 4LNQA 3I4NG 3STBD 2ZTDA 1E2VA 4JI1Q 1SEBD 1RTOA 4AYBE 5IYBH 1CI3M 3F2DA 4A3EH 4UAIA 3U4ZA 1WTPA 3HP3A 2R61A 5C3XA 1AEXA 3H0GB 1HTLD 2R3ZA 2I0QA 3VA7A 4HCSA 4KKTA 1U9RA 4X65Q 1T5EA 1EYAA 2F3VA 3DUZA 4B9WA 1UE6A 1QVGA 2D0OA 3MC0B 3RNUA 5CV5A 1IBKL 2R93B 3UDGA 3CMAA 1JWMD 4HMIA 4Q0FA 2MPMA 5M3FH 1E1TA 5CBEE 3F1ZA 1ZXTA 1STGA 1ESRA 1J9OA 4DGZA 4JI7L 4OGQC 1PZJD 3J7A5 3KLSX 1SYEA 2MFIA 1KNEA 3A74A 5KGUA 3CXCA 4RGMA 2HD3A 1TWCB 1D5ZC 1VQAA 1BNZA 1LTAD 4L5QA 4HIOA 3TREA 1K0SA 3RN2A 4JI2Q 4BXXH 1BKBA 4OWXB 5FOBB 3CC2A 5IYBG 5T1GA 1PFBA 5M5WH 1DONA 2NZHA 3T16A 3TS2A 3CF5A 4IOCA 1CSPA 4A3EG 4OELB 1F9QA 1KD1C 4YY3Q 2KCNA 2DUDA 1DZ1A 2E2IH 3CCLA 1G6ZA 2FMMA 4YHHL 1Q46A 2F52A 3K80C 3AQQA 2VUMB 4DV6L 4ABNA 1LYLA 2JJQA 1CA6A 4A3IH 3H15A 3J7YW 4PZ6A 3NHHA 3RZDH 1S5FD 3I4MH 3U4VA 4RCOA 4LF8Q 1PH1A 4GN3B 2BH2A 1YNJD 3ULLA 4A3MB 3NUCA 3H6MA 3M4OB 1QUQA 3A5ZB 3EIVA 4NKLA 3J81i 4BBRH 1TWHH 4OHJA 4K2LA 3VR3A 5LL6S 5C5MA 1H9KA 1N8RC 2OWOA 3GTJH 2D62A 2CQAA 3PIP3 2A68C 1X3GA 1EEID 1AP0A 1TR5A 4K6DA 1CA5A 2ASBA 4POFA 4C3HG 4G57A 2B29A 4BY1B 1BVSA 2DGYA 3I3CA 3IFDA 3Q8DA 2WAQG 4XXEA 5IGFA 2NZOA 2WINB 4ME5A 3M3YB 3TBIB 4QF4A 1Q81C 2WIIB 2BCOA 4IJLA 4JI4Q 5I4DA 4LFCL 2RBMA 3K6OA 1S3OA 1K9MC 4IFDJ 3H94A 4A3IG 4R4TA 1DM0B 3T53B 2A6EC 2QEXA 1EZ8A 1E24A 2AWOA 1STNA 2PMZB 3FKIB 3PUWA 3I4MG 3A54A 1EEFD 1IW7C 1K8GA 4LFBL 4XTCS 3I4OA 3T13A 5K5PA 2AUJD 2AHOB 5M5XH 3UI2A 2CKZB 4FXGC 4N9PA 1SNPA 1D5MC 4ZAIA 5HGQA 1BQQT 4C2MB 1HNXL 4BBRG 4H13C 5IWAQ 1R9TH 3S14B 2B2UC 1VQ9A 3M9BA 2OF1A 1FJGL 1TY0A 4F88A 2E74C 1PTOD 3BYTB 1JE4A 2B63H 1YJNA 1EQVA 1PFNA 3GTLB 2VXWA 5IYCG 1DOMA 2K5WA 2TSSA 3W1BA 3AFPA 2B2YC 1VMCA 1F9PA 3GTQB 3G4SA 1UUPA 2EQSA 3SEBA 1EWCA 2AQ1B 3U9SA 5C44H 2Y0SE 5CORA 3RD4A 3WOEA 2KOLA 1IBLL 4GKJQ 5JJKA 3IFTA 3MXNB 4B3TL 1KDBA 1TU2B 3PO2G 1CK1A 2VQFL 3HEJA 2L15A 1VQIA 1TIID 2MO0A 2VNUD 1X9NA 4GKKQ 2CFMA 1JQYD 4P72A 5DM73 3LGJA 3GQBA 2NUCA 3K58A 1VDZA 4LWCA 4DAVA 3MAQA 1STYA 2RF4A 3MVVA 3VR6A 5JOBA 2K5VA 2Z6BA 2MO1A 2L5TA 2CWPA 4U68A 4A3DH 4DR4Q 1SRUA 3T4AC 1IZ6A 2YV5A 1I3QB 3F2UA 4CHTB 3F2CA 3TDQA 3S1NH 3LWUA 1GUGA 3RLFA 2RDFA 3KF6B 2DY8A 1EIGA 2N78A 1X55A 2XVSA 4IFDI 2B2TC 5ELOA 1E22A 4GNXB 4MTNA 4K5WA 3S15H 4R8IA 4HIKA 3S1MB 4OWWB 3J7AV 4LK1C 3HKSA 2ZM6L 3HKZB 4IQZA 3L0OA 1IBKQ 3S16H 1DOLA 3JAMc 1PTOF 4A3JH 1S4ZA 4EVOA 5C4JB 5FLXc 3CQZB 3KK7A 2MNAA 1I94L 2O2LD 1C0AA 3S1RH 5M3MH 2Z4IA 2XWBB 4A3BG 3KF8A 1S5BD 2K5NA 3OTOL 3SE0A 3CHBD 1H9SB 1A0IA 1J5EQ 4PG3A 5CV9A 1XX8A 2ES2A 3BDOA 2I5HA 4A3DG 1XPUA 4BBSG 4PZ7A 1PH6A 1PYWD 2IHFA 4AQYL 2LKVA 4C1NI 1Y8NB 4XT3B 1FVIA 3DMUA 1B3AA 1XWEA 1SROA 2RQXA 3MEHA 3KLWA 3L2PA 2FHTA 3A8KE 3GV3A 1VQKA 4YHHQ 1A6XA 2R7ZG 1L1OB 3CKIB 4DV6Q 3QWNA 3SK5A 4B3SL 5M3FB 2F4VL 1LUZA 4TKOB 1VQ5A 2KEDA 1PRTC 5COYA 2E8GA 3MHBA 1BCPB 4A3JG 3TQYA 2JN4A 1JICA 1II3A 2JYOA 2ZJQA 3DWPA 3HOVB 2JK8A 3RR5A 5IIFA 4CKCA 1DCZA 4HEDA 3KLRA 5M3MG 2E75C 1SNOA 2R7FA 1D2BA 2X6GA 4A3FB 2EYFA 1PYBA 3QOJA 4KY6A 2E2DC 2SNSA 4K6LA 1H9MA 3J81j 1SE8A 3ERQA 1IYUA 2UUCL 2HCCA 1AH9A 4H02A 3BDLA 1TXYA 2EIFA 3HOYH 1DD2A 4X62L 1XMQQ 4U673 2KCMA 3Q0AA 1Y1WG 3KOJA 5EBCA 5IYDG 1G6PA 1QILA 2A6HC 2VL6A 3H91A 1SR3A 1O7ZA 1C4QA 1LV9A 4DK6C 4OX9L 2CQOA 2N3SA 2EVBA 1WD1A 4LFCQ 4RHRA 1MBYA 3C46A 3RZDB 5FO7B 5IT9L 3I4MB 4CDFC 3E9IA 4IUPA 4DV0Q 3HG9A 1WVLA 2EYJA 4ZQ3A 3CP0A 4OO1I 5G3LF 1A8VA 1X6OA 3T1YQ 2DJGC 1D8LA 1EUJA 1ILPA 1VQEA 4K0KL 4LFBQ 1AN8A 4BBRB 1TWHB 3ULJA 4KI0A 4DR1L 1HNXQ 5E3FA
chains in the Genus database with same CATH topology
2B39A 1O80A 1OO9B 2NB0A 4LMQD 5E4XA 1A15A 3TP7A 1O7YA 1B1ZA 2QF7A 4CJ0B 3PUVA 5D3IB 2SDFA 2EY1A 1EL0A 1L0YB 1HUNA 5J1ZA 1SYDA 1RODA 4FYDA 4XQNA 1Z47A 1I4GA 5M5XB 3N6RA 1IYVA 2L0CA 5I2XA 5EKIA 5EQ0A 3NTIA 3MA2B 1R9TB 5DNFA 1RF2D 1KDCA 3R2IA 3VYSA 2B63B 1SDFA 5IGCA 1LTGD 2A68D 2F03A 3TZUA 1S5DD 1NR4A 1PZID 4DAPA 1EQTA 1EYDA 1ZYRC 5C44B 4NP5A 1PFMA 2RKSA 2OEOA 4RAUC 1BCPF 4ZKCB 3OHXC 1A2UA 1JCKB 5CYUA 1H9JA 1X3QA 5ELCA 2EJGC 1IW7D 2K28A 3VYTA 4KD3A 3BYYB 4QCLA 4ZRZA 1NAPA 1QJOA 2O4XA 3L3OC 4QIWB 1MI2A 3E6ZX 1LT5D 3R8BA 2PYKA 2F0LA 4PMBA 3S1NB 2XN9C 1Z7TA 3C2PA 1EY7A 2F0FA 4X3SA 3T56B 4KD4A 2K6AA 1T5XD 3H09A 3S15B 5BN4A 2KHSA 5CBAE 3NWSA 3NWTA 3K5MA 3S16B 1WTWA 1K8MA 3GTKB 4RH6A 3I72A 3ND9A 3VA5A 3OMGA 1EZ6A 3C1FA 5KEEA 2NWGA 3KBGA 2PZTA 3D31A 5EPKA 1QNUA 2IX0A 1CFMA 4HCEA 4FNFA 3GO5A 1Z6HA 4LAAA 5CV8A 4IUUA 2CHBD 5ELEA 1TS2A 4FF3A 3K0YA 4HAEA 3QJYA 1LTBD 3S9WA 1MGSA 3TN2A 3H3VC 2K33A 4DF7A 4J6HA 1CTMA 3I70A 3M4YA 1VMPA 2F0VA 2O5JC 1GJXA 2HUGA 1CM9A 2SNMA 4OIJA 3NBIA 4G7OC 4KKSA 4EQOA 3LX0A 2B2VC 3C1EA 4C1NK 3W2DA 3S17B 5EJWA 3BVMA 2DY7A 2WKCA 3JAML 1K8OA 1I4RA 4RA8A 1B9MA 3WDNA 3HOYB 2R6GA 5FLXL 1O78A 3QO2A 2NZ1D 3ND8A 4C3JG 2IPKD 5KNCA 1UNSA 5ELDA 3EFXD 1V1OA 2FINB 3J80E 2XRQD 1UEAB 2J7ZA 3OIPA 1KNAA 1H9RA 4IUTA 1B53A 1TS4A 1PRTD 1GOZA 1STAA 3TSSA 3VR2A 4LJZC 3BG3A 4K14A 4KK7A 4IUQA 2F0DA 1PTOB 1QE6A 1PXUA 1F2MA 1FYCA 3J7AF 4PMWA 3HOXB 2ICIA 1BF4A 1HA5A 4CJ1B 5D14A 3S2DB 3NPPA 5CV7A 2WKDA 2N55A 3DWQA 1IKMA 2A6HD 1DYQA 3GD7A 3X3NA 4QB4A 5KYIA 1F9SA 2JA6B 4FF2A 1JC7A 4XIGS 4A3GB 2WACA 2AWNA 4K8JA 3LWEA 3PO3B 4KKUA 1CZWA 3ZYYX 1SXTA 2LMCB 3K7AB 1RD9D 2K32A 5DEHA 5DM63 5EBDA 3A7LA 2K04A 3R2TA 2EYHA 1YNNC 1ENCA 5C3WA 1SMYC 1VF5C 3VYRA 5AFWA 3AB9A 1Y1VB 1ONLA 2L12A 3NQTA 5C4ZA 3BS1A 2EDGA 2F0NA 2NTSA 1I50B 2SOBA 5EKKA 5EGTA 1HRJA 1RHPA 1LTTD 4C3IB 3OOCA 5A35A 1GUWA 1U4MA 3GP7A 4K5XA 4V190 4KV6A 1WTRA 1E2ZA 1VF7A 3HOUB 1B4OA 3MTSA 3SXHA 2X6LA 4TQUS 2E2HB 2AQ2B 1SE3A 2XIWA 1HPCA 2OXPA 2QDBA 3EROA 4B9XA 1QOHA 4FF1A 2MGSA 3J81L 1SYBA 5JPNC 1LACA 5FO8B 3WOFA 3EA6A 3VYUA 4WORA 2JSOA 1EFID 4S3SA 2H4OA 4BA1I 5CMDA 3I4NB 4IUVA 2M00A 5I6WA 2TMPA 1LABA 1ZYRD 3VR4A 4FF4A 2BDNA 3RZOB 2PZUA 1DJRD 5IGGA 2HDLA 3EVQA 4P2CB 4CJ2C 4PMCA 2KA7A 2F0JA 1EY4A 4IUNA 2PW7A 2RDHA 1CT1D 1KLGD 4XQJA 2BOSA 3I90A 2KEEA 1TWFB 2PNRC 1MD2D 3D4RA 3PUYA 1HXYD 2E76C 4JK1C 1I4XA 1HFNA 3NTHA 3V05A 1M4VA 5NUCA 1WTQA 3PV0A 4NMZA 2F4IA 5JVG3 5M5YB 2MP1A 4A3EB 4PNYA 4I65A 3NSWA 3HZXA 2RSNA 2C9OA 1I4HA 4J8QA 2PPBC 2KVMA 4IN3A 1IL8A 2MHVA 1EWHA 3I8ZA 5IODA 5E4WC 1Y69U 3OIQA 1D1KA 5D3DA 3TP5A 3C3LA 1VCIA 3D3RA 3NQIA 4ZLTF 1SYGA 2Y0SB 3FEWX 4EQNA 2DNCA 5CGKA 3DEPA 1K83B 3BVGA 3TMEA 4FO2A 5M5WB 1FNVA 4C3HB 3SR1A 4V0BA 4BS9A 2WAQB 3BVZA 2E2IB 2C5CA 3FPUB 4XYOA 2LS01 5EKLA 1S5ED 4A3IB 1O7LA 1A3VA 1NCVA 2F0KA 3SK4A 4N9TA 2B2UA 2QILA 2XWJB 5JVH3 3ONAB 1PDQA 4M1UB 5CV6A 4KHZA 2EY5A 2JA8B 2B2YA 3MXUA 3GTJB 1QNKA 2EJFC 1HFGA 5C4HA 2FMCA 5LHY1 3A8JE 3D6CA 1IKLA 4TRDA 4C56C 2KECA 2RDGA 2X69A 4HSVA 3PMFA 3N52A 1BO0A 2ZXOA 1I4QA 1EY0A 2HDMA 3PO2B 4B08A 3QOLA 1WD0A 1EIHA 1CHQD 2F0HA 2NVYB 5ELBA 2IX3A 2B2TA 1S5CD 5JAVA 2EYPA 4CGYB 3QB3A 1AW7A 2K5QA 2A69C 1I4PA 5BN3A 4FVMA 2L9HA 1B2TA 2NBFA 1BXTA 2F3WA 3W3AA 4FXDA 1CHPD 1LO5D 2IWHA 2K01A 1LLRD 1YNND 4E6IA 3D8GA 1BR9A 2A6ED 1SMYD 1Q1EA 1AFPA 3SK6A 1KAAA 2CW0C 2PO4A 5D65A 3A8IE 1SE2A 4DK1A 4A3BB 5JPMC 3SVMA 2F0QA 5FO9B 1WTOA 1CQVA 1OXTA 3KUPA 4A3DB 1EY8A 3P1HA 1MSGA 4F87A 4BBSB 4R8NA 5HURA 2KQ3A 1FNUA 1LT6D 4XT1B 4K2KA 4RFBA 4HSPA 2R7ZB 1ICWA 1RCVD 2F0IA 1AZQA 2KCCA 1OXSC 3RMHA 3KLSA 1C8CA 1GHJA 2EXZA 3Q22A 5KNDA 1HQMC 2PW5A 4ZUIA 5KRUA 1G2TA 4A3JB 2RVLA 1D5XC 1PZKD 5ISRA 1PLFA 2YYZA 4OO1G 5C0XH 5IT9E 3S1RB 1SE4A 5M3MB 1HCZA 2E2JB 1NUCA 2DNEA 2K1BA 3S1QB 4H0LC 5TSSA 1U4PA 1SBBB 1DXMA 4DXFA 3K5NA 3GV6A 1BUVT 1X3PA 4DK0A 1CZGA 4BWGB 2FJ2A 2PCFB 4RGTA 4OIKA 1Y1WB 3RUZA 2QKIC 3DXJC 1OXVA 3V2TA 1BDOA 1PRTB 2I07B 4KTAA 1J8IA 1A2TA 1XTCD 3HS0C 2K5DA 1V1PA 3TZDA 4KJOA 1X32A 4L6TB 1ESFA 3HOWB 2ID0A 4KJNA 3MFGA 2SEBD 1ML0D 4DFAA 1GUTA 3D6WA 1KLUD 5T1IA 2MJ8A 5C0XG 3IL8A 3HGBA 4RKLA 2F0GA 4TSSA 5J39A 4DA2A 3MXPA 4K8IA 2NVQB 5IGEA 1SFOB 3CU7A 1KABA 2F0EA 2L4NA 1HA6A 4CKEA 2NN6H 2WV6D 2EYOA 1EOTA 4WFN3 1ET9A 1GUSA 4WRDA 1B9NA 5JEAH 1M8AA 4XDXA 3SHLA 5C3EB 1V1PB 2IW3A 2NYZD 3QIAA 1NR2A 2D9UA 2A73B 1Q8IA 1EU4A 1QCBD 2EZVA 1TS3A 4YIJA 4NDXA 1BCPC 2XNAC 4ZKBB 3TP6A 4DNRB 1F2ZA 1W6KA 1KDAA 2EY6A 3E5SA 3OSOA 1EYCA 4FXKC 4BA2I 2JE6I 3AMUA 3BDCA 1JR0D 4M8AA 1SNQA 4KHVA 2G9DA 4EGVA 2ZXPA 2NN6G 3G7LA 3Q6SA 4ILWA 3A56A 3R3OA 5JEAG 2EJMA 4J1MA 1JWSD 2J0TD 1TQOA 3KBXA 4H44C 4RGNA 1SNCA 2F0OA 3BZDB 2F0PA 3NK9A 1W6JA 4AYBB 4RGOS 3M85A 2CVRA 5BN5A 1JOOA 4KN7C 1GUOA 4QUCA 5A2QL 1LTSD 4L8JA 4DXGA 1SNMA 2QEJC 2Z8LA 1UAPA 4WJWA 1STHA 2JXMB 2BA1A 1LT3D 3EJIA 3NE5B 1PRTF 3NTKA 3V96A 1D1IA 2V4DA 1ET6A 1TT2A 5EPJA 2EYMA 1LTID 5M9OA 1LT4D 3MXNA 1ILQA 4KY5A 1F9RA 2B8FA 2BDOA 5CC4A 3K59A 1QB5D 5KNBA 5JJZA 2D5DA 2JA7B 1Y8PB 5FKAC 1RJTA 4RCNA 1LTRD 4CKBA 2L11A 3SDZA 4EQPA 4XQQA 1FGBD 3PIO3 1AZPA 4JBWA 3AU7A 4R9WA 4G7ZC 1U4LA 1G8ZD 1ENFA 4KN4C 4CBVA 5K36H 3JAME 2KUMA 1GUNA 2A69D 4ODGA 2K7VA 3I91A 5FLXE 3DEOA 3CRKC 5KYLA 1FR3A 5I9PA 2B2VA 5HGTA 2A5HA 3EQLC 2BE5C 4IURA 3I73A 1SSOA 5ELFA 1D6EC 4ZK9B 1JORA 1H9SA 2F1MA 2CW0D 1F77A 1A3UA 2ICEC 2JP1A 4I7ZC 1WTVA 2F0TA 3URYA 3S2HB 5EPLA 4KY7A 1U4RA 4G4KA 2VB2X 1HTPA 3OWFA 3P20A 4DN4M 3PUZA 2BA0A 3FMCA 3GTOB 3OPOA 1MSHA 2RA4A 5K36G 1WCMB 4ULLA 3G6JB 4C3JB 3HOZB 4PV1C 1RTNA 1R4PB 2Q8RE 4PQXA 2IT1A 1HHVA 2VB3X 2N88A 4Y7NB 1G2SA 3GTPB 3MZ5A 1Q3LA 4NW2A 2LY7A 1V43A 2JEAI 2HCIA 2M9VA 4IZ8A 5I6YA 1WTXA 3FDTA 1A3TA 4XYQA 1EY9A 5CV4A 1Q12A 2F0MA 2IX1A 3P7JA 5A2QE 1SYFA 3L9AX 5G3LD 1B44D 1F2YA 1BBXC 3IAYA 3NXWA 1G91A 2EPBA 2ZXRA 4QUFA 4X3UA 5C6AA 3A7AB 4FP5D 2QCPX 3SK8A 2D2CC 2NVXB 1E2WA 2WP8J 1ENAA 3M7NA 1CQFA 2ENBA 4UDUC 4X3TA 1I6VC 2JEBI 2EYLA 3IKJA 3LNNA 3I4LA 5C0XJ 1TVXA 2H1EA 4HR7B 2YU9B 4IFDH 1YNJC 2A74C 4HTHA 3D4WA 5KIXA 4L63B 1ZKOA 2K03A 3GTMB 1DOKA 1R4QB 3DM1A 1SAPA 1SYCA 1QWYA 2I46A 4HMJA 3J81E 4F7XA 2XRSD 1SNDA 1STBA 2B2WC 1G291 1JWUD 2F0UA 4IALA 4ZUJA 3CRLC 1JOKA 1XXGA 2AQ3B 3OMCA 3VR5A 1XYIA 5LL6X 3PUXA 4BY7B 3DWAA 1C48A 2KJXA 4MHEA 4IFDG 1KTKA 2NTTA 4OL7A 1PTOH 4DAYA 1BCPD 2HQEA 2MUYA 3FPPA 3P75A 2PZWA 5C4XB 3DHQA 2OT2A 3MFYA 5FK9C 4GZYC 5JEAJ 5IOCA 1PTOC 2ZT9C 4G7HC 1EY5A 4QMGA 4F8MA 1Q1BA 3E0JA 3A55A 1SJED 1IHZA 3K5LA 2R92B 1TKWB 2M2LA 3OWEB 2F0WA 4ID6A 2IL8A 2O5IC 3X3MA 5I2YA 5I9OA 1I6HB 3NP8A 5C0XI 1FNWA 2XSCA 3MXGA 2F0SA 2RSOA 4Q5VA 3Q24A 1GHKA 4DNTB 1V8QA 2K05A 2PQEA 1F2LA 3O13A 3U9OA 3Q23A 2AUKA 4O42A 2J4XA 5F2DA 3K57A 2L1BA 4OO1H 4RKBA 3J80L 4H7BA 5C5LA 1SJHD 2L55A 1Y8OB 1ZEQX 4X3KA 2B8GA 2G9HD 1TWAB 4MN3A 3TP8A 2LFNA 1TWGB 3NBHA 1OXUA 1EY6A 1HQRD 3QG1A 1E0BA 1JB3A 3M7GA 4HN7A 5IGBA 1NSNS 2NN6I 4KMUC 1L0XB 1FD7D 4A3KB 3GTGB 4Z9CB 4DU9A 5J22A 1RKNA 2WB1B 2EOTA 1OXXK 3HRZC 1HUMA 5DAUA 1B50A 2EY2A 2Z1CA 4C3IG 3L7ZC 3FVQA 1JOQA 2Q8TA 2DN8A 4MIUA 1BOSA 1TY2A 1EU3A 2NVTB 4RHSA 4A93B 2JA5B 2BE5D 3R93A 5CR3A 4ZYSA 3K5OA 4O1NA 3MWYW 1TS5A 1RDPD 3ITPA 1GXDC 3T51B 2Q8IB 5IGDA 4RWSC 1PMRA 1Q90A 5E1FA 2GA4B 2B2WA 2IJ0A 3D4DA 1STEA 2EE1A 2FFKB 4K5VA 1QG7A 2Z4HA 3OW7A 3FRPB 1E2VA 1SEBD 1RTOA 1CI3M 4UAIA 1WTPA 3HP3A 2R61A 5C3XA 1AEXA 3H0GB 1HTLD 2R3ZA 3VA7A 4HCSA 4KKTA 1U9RA 1T5EA 1EYAA 2F3VA 3DUZA 4B9WA 3MC0B 5CV5A 2R93B 1JWMD 4HMIA 4Q0FA 2MPMA 5CBEE 1ZXTA 1STGA 1ESRA 1J9OA 4DGZA 4OGQC 1PZJD 3KLSX 1SYEA 1KNEA 5KGUA 4RGMA 1TWCB 1D5ZC 1BNZA 1LTAD 5FOBB 5T1GA 1PFBA 1DONA 3T16A 1F9QA 2KCNA 1DZ1A 1G6ZA 2FMMA 2VUMB 4ABNA 1CA6A 3J7YW 3NHHA 1S5FD 4RCOA 1YNJD 4A3MB 3NUCA 3H6MA 3M4OB 4NKLA 4OHJA 4K2LA 3VR3A 5LL6S 5C5MA 1H9KA 2D62A 2CQAA 3PIP3 2A68C 1EEID 1AP0A 1TR5A 4K6DA 1CA5A 4C3HG 4G57A 4BY1B 3I3CA 3IFDA 4XXEA 5IGFA 2WINB 4ME5A 3M3YB 3TBIB 4QF4A 2WIIB 2BCOA 5I4DA 2RBMA 3K6OA 4IFDJ 3H94A 1DM0B 3T53B 2A6EC 1EZ8A 2AWOA 1STNA 2PMZB 3FKIB 3PUWA 3A54A 1EEFD 1IW7C 4XTCS 3T13A 5K5PA 2AUJD 3UI2A 4FXGC 4N9PA 1SNPA 1D5MC 4ZAIA 1BQQT 4C2MB 4H13C 3S14B 2B2UC 2OF1A 4F88A 1TY0A 2E74C 1PTOD 3BYTB 1JE4A 1EQVA 1PFNA 3GTLB 2VXWA 1DOMA 2K5WA 2TSSA 2B2YC 1VMCA 1F9PA 3GTQB 1UUPA 3SEBA 1EWCA 2AQ1B 3U9SA 5CORA 3RD4A 3WOEA 2KOLA 3IFTA 1KDBA 1TU2B 1CK1A 3HEJA 1TIID 2VNUD 1JQYD 5DM73 3GQBA 2NUCA 3K58A 1VDZA 4DAVA 3MAQA 1STYA 3MVVA 3VR6A 5JOBA 2L5TA 4U68A 3T4AC 1I3QB 3F2UA 4CHTB 3TDQA 3LWUA 1GUGA 3RLFA 2RDFA 2DY8A 1EIGA 2XVSA 4IFDI 2B2TC 4K5WA 3S1MB 4R8IA 3J7AV 4LK1C 3HKZB 4IQZA 1DOLA 1PTOF 1S4ZA 4EVOA 5C4JB 3CQZB 3KK7A 2O2LD 2Z4IA 2XWBB 3KF8A 1S5BD 3SE0A 3CHBD 1H9SB 5CV9A 1XX8A 3BDOA 1PYWD 2LKVA 4C1NI 1Y8NB 4XT3B 3DMUA 1B3AA 1XWEA 2RQXA 3MEHA 2FHTA 3A8KE 3GV3A 1A6XA 3CKIB 3QWNA 3SK5A 5M3FB 4TKOB 2KEDA 1PRTC 5COYA 1BCPB 3MHBA 1JICA 1II3A 2JYOA 3DWPA 3HOVB 5IIFA 4CKCA 1DCZA 4HEDA 3KLRA 2E75C 1SNOA 1D2BA 2X6GA 4A3FB 2EYFA 3QOJA 4KY6A 2E2DC 2SNSA 4K6LA 1H9MA 3ERQA 1IYUA 2HCCA 3BDLA 1DD2A 4U673 3Q0AA 5EBCA 1QILA 2A6HC 3H91A 1O7ZA 1C4QA 1LV9A 2EVBA 1WD1A 4RHRA 1MBYA 3C46A 3RZDB 5FO7B 5IT9L 3I4MB 4IUPA 3HG9A 1WVLA 2EYJA 4ZQ3A 4OO1I 5G3LF 1ILPA 1AN8A 4BBRB 1TWHB 4KI0A 5E3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1P A;  1CT1 D;  1CHP D;  1LT5 D;  1TY0 A;  1LO5 D;  3BVM A;  4RGN A;  1PTO D;  3BYT B;  3R8B A;  1KLG D;  3W2D A;  4L6T B;  1LLR D;  1ESF A;  3OWE B;  1I4R A;  3BZD B;  1MD2 D;  2TSS A;  2XN9 C;  1TY2 A;  2QIL A;  1EU3 A;  2SEB D;  3MFG A;  4RHS A;  1PYW D;  4UDU C;  1HXY D;  1B1Z A;  1FNW A;  1I4X A;  1KLU D;  4RGO S;  3V05 A;  5ELF A;  1M4V A;  1D6E C;  5D3I B;  4ZYS A;  1SE2 A;  1UUP A;  3SEB A;  2IPK D;  4O1N A;  1EWC A;  1T5X D;  1LTS D;  2AQ1 B;  1TS5 A;  1UNS A;  2NTS A;  1F77 A;  4DXG A;  1RDP D;  5ELD A;  3EFX D;  1L0Y B;  1S5F D;  4TSS A;  1CQV A;  1LTT D;  2QEJ C;  1V1O A;  2Z8L A;  4L63 B;  4RCO A;  1PRT C;  2XRQ D;  4RH6 A;  1BCP B;  3URY A;  3O13 A;  3GP7 A;  1CK1 A;  2IJ0 A;  1LT3 D;  1STE A;  3DWP A;  2WV6 D;  1I4G A;  1PRT D;  1I4H A;  1GOZ A;  1TS4 A;  2J4X A;  3TSS A;  1FNU A;  1ET9 A;  1LT6 D;  1PRT F;  1JQY D;  4OHJ A;  4RFB A;  1SJH D;  1SEB D;  1ET6 A;  2AQ2 B;  2XRS D;  1SE3 A;  1RCV D;  4C56 C;  4K6L A;  1JWU D;  2RDG A;  1LTI D;  1EEI D;  1LT4 D;  2CHB D;  5ELE A;  1V1P B;  1RF2 D;  2G9H D;  2R61 A;  5D3D A;  1TS2 A;  1HTL D;  3R2I A;  1PTO B;  1LTG D;  1D5X C;  1XXG A;  1I4Q A;  2AQ3 B;  1S5D D;  1LTB D;  3EA6 A;  1PZK D;  1PZI D;  2ICI A;  1QIL A;  1EU4 A;  1HA5 A;  5I4D A;  1EFI D;  1HQR D;  1TS3 A;  3MC0 B;  1SE4 A;  1BCP C;  1CHQ D;  5FKA C;  2XNA C;  3DWQ A;  3DWA A;  1JWM D;  3BVG A;  5TSS A;  1DYQ A;  1SBB B;  1LTR D;  4RHR A;  1KTK A;  2NTT A;  5ELB A;  4DXF A;  1FNV A;  1PTO H;  1BCP D;  1S5C D;  1PTO F;  1FGB D;  1PZJ D;  1EEF D;  1BCP F;  1SJE D;  3KLS X;  1L0X B;  1B44 D;  1JR0 D;  1FD7 D;  4BWG B;  1JCK B;  4RGT A;  4RGM A;  4Z9C B;  3BVZ A;  1AW7 A;  1SXT A;  1D5Z C;  5ELC A;  2O2L D;  1G8Z D;  1RD9 D;  1D5M C;  1ENF A;  1LTA D;  5FK9 C;  1AN8 A;  1DJR D;  1I4P A;  3BYY B;  1PRT B;  1PTO C;  3R2T A;  1XTC D;  1BXT A;  1S5B D;  3CHB D;  1JWS D;  2RDH A;  1S5E D; 
#chains in the Genus database with same CATH topology
 2B39 A;  3HFZ B;  1O80 A;  2I5L X;  1OO9 B;  2NB0 A;  4LMQ D;  5E4X A;  1A15 A;  1FJG Q;  3HOX H;  2ZTE A;  3HOY G;  4RMF A;  3TP7 A;  1KAW A;  1O7Y A;  4JPB W;  1B1Z A;  4WJ4 A;  2QF7 A;  4CJ0 B;  3PUV A;  5D3I B;  5C3E G;  2SDF A;  1HJP A;  3CCV A;  2JA6 H;  2EY1 A;  1EL0 A;  1L0Y B;  1HUN A;  3G6E A;  4KHP Q;  4A3G H;  5J1Z A;  1SYD A;  3FP9 A;  1ROD A;  1IBL Q;  3PO3 H;  4FYD A;  3UE1 A;  4XQN A;  1Z47 A;  3ULP A;  1E1O A;  3K7A H;  4B3T Q;  1I4G A;  5M5X B;  3N6R A;  1IYV A;  2UXB L;  2L0C A;  5I2X A;  5EKI A;  5EQ0 A;  3NTI A;  3MA2 B;  1R9T B;  2UXD L;  5DNF A;  1RF2 D;  2UXC L;  1KDC A;  1Y1V H;  3R2I A;  4O0A A;  3VYS A;  4DAY B;  2B63 B;  1SDF A;  5IGC A;  1LTG D;  2A68 D;  2F03 A;  3TZU A;  1S5D D;  1NR4 A;  1PZI D;  3UDX A;  2K75 A;  4DR3 L;  1GM5 A;  4DAP A;  1EQT A;  4JV5 L;  4UP9 A;  2K52 A;  1E3P A;  1EYD A;  1ZYR C;  5C44 B;  4NP5 A;  1PFM A;  2RKS A;  2JA6 G;  1IXR A;  2OEO A;  4C3I H;  2RHS B;  4RAU C;  4A3G G;  4APV A;  3RN5 A;  1BCP F;  3QR8 A;  5LMN L;  1Q7Y C;  4ZKC B;  3OHX C;  1A2U A;  1JCK B;  5CYU A;  4JOI C;  4AYB G;  1H9J A;  1X3Q A;  5ELC A;  2EJG C;  4LUO A;  3HOU H;  4HJ8 A;  1IW7 D;  2K28 A;  3VYT A;  3CAM A;  4KD3 A;  3BYY B;  2E2H H;  4PZ8 A;  4ZRZ A;  4QCL A;  1I94 Q;  1NAP A;  3KJO A;  1QJO A;  2O4X A;  2AKW B;  2RCN A;  3L3O C;  4QIW B;  1MI2 A;  2UUA L;  1MJC A;  4DUZ L;  3E6Z X;  1LT5 D;  3R8B A;  3OTO Q;  2PYK A;  2F0L A;  1Y1V G;  4PMB A;  2LXK A;  3S1N B;  2XN9 C;  1Z7T A;  1SLJ A;  3C2P A;  1X65 A;  1EY7 A;  2F0F A;  4X3S A;  3T56 B;  1H95 A;  4KD4 A;  3I4N H;  4AQY Q;  2K6A A;  2V1C C;  2ZJR A;  1T5X D;  1N32 Q;  1Y14 B;  3H09 A;  3S15 B;  5BN4 A;  1UWV A;  1N33 L;  2VQE L;  2KHS A;  2Q2H A;  5CBA E;  3NWS A;  3EN2 A;  3NWT A;  3K5M A;  2VZA A;  4CDC C;  3S16 B;  1WTW A;  1K8M A;  2FXQ A;  4LF6 L;  3GTK B;  4RH6 A;  3I72 A;  3ND9 A;  2F4V Q;  3VA5 A;  1YVC A;  1P8L A;  3OMG A;  2OTJ A;  1EZ6 A;  3C1F A;  3RZO H;  3MEF A;  2NWG A;  1JE5 A;  5KEE A;  3KBG A;  2PZT A;  1C9O A;  3D31 A;  3CCJ A;  1CKM A;  5EPK A;  4N8F A;  1QNU A;  5GAH C;  2IX0 A;  1CFM A;  4HCE A;  2KHI A;  4FNF A;  3GO5 A;  1Z6H A;  2HHH L;  4LAA A;  5CV8 A;  4IUU A;  2CHB D;  5ELE A;  4UP7 A;  1TS2 A;  4FF3 A;  4HIM A;  1YHQ A;  3K0Y A;  1VQ4 A;  1OTC A;  4HAE A;  3QJY A;  1HNZ L;  1LTB D;  3S9W A;  4QQB X;  3GTO H;  1MGS A;  4X62 Q;  4A76 A;  4A3C H;  3TN2 A;  5ELN A;  1X56 A;  3H3V C;  2K33 A;  5M5Y H;  4DF7 A;  4J6H A;  1CTM A;  3I70 A;  1K8A C;  3M4Y A;  1VMP A;  4OX9 Q;  1NY4 A;  2F0V A;  3F8T A;  2O5J C;  1GJX A;  2HUG A;  1CM9 A;  2SNM A;  3GTP H;  2N49 A;  4OIJ A;  2ALY B;  4LW1 A;  1YBY A;  2PI2 E;  4ME3 A;  3NBI A;  3PSI A;  4G7O C;  4KKS A;  4EQO A;  3LX0 A;  2B2V C;  4K0K Q;  3C1E A;  4C1N K;  2XGT A;  3W2D A;  3S17 B;  5EJW A;  3BVM A;  2ZJP A;  2DY7 A;  2WKC A;  3JAM L;  1K8O A;  1I4R A;  4RA8 A;  1B9M A;  3WDN A;  3HOY B;  2R6G A;  5FLX L;  1XTD A;  4JI8 L;  1O78 A;  3QO2 A;  2NZ1 D;  1WCM G;  3ND8 A;  4A3C G;  4C3J G;  1K83 H;  2IPK D;  3HOZ G;  5KNC A;  1UNS A;  1M1K C;  3K8A A;  5ELD A;  1JJ2 A;  4IPH A;  2NVX H;  3EFX D;  1NE3 A;  4NB3 A;  1V1O A;  4C3H H;  2FIN B;  3J80 E;  2XRQ D;  4DR5 L;  1UEA B;  5E7N A;  2J7Z A;  2YTV A;  3OIP A;  1KNA A;  1H9R A;  4IUT A;  1B53 A;  1TS4 A;  1PRT D;  1GOZ A;  1STA A;  3TSS A;  3VR2 A;  2K4K A;  4GOP C;  4LJZ C;  1FGU A;  1IYJ B;  1XNR L;  3NEM A;  3BG3 A;  2PI2 A;  4K14 A;  4KK7 A;  2A8V A;  1BBW A;  4A4I A;  4IUQ A;  3GTM H;  2F0D A;  2UXD Q;  1PTO B;  1QE6 A;  1VQG A;  1PXU A;  1EIF A;  1F2M A;  1FYC A;  4UPA A;  3J7A F;  2UXC Q;  4PMW A;  3HOX B;  3CCU A;  2Y0S G;  3CC7 A;  3PF5 A;  1X54 A;  2ICI A;  3UE0 A;  1BF4 A;  1HZA A;  1HA5 A;  1P16 A;  3UDI A;  4CJ1 B;  1NMF A;  1QZH A;  5D14 A;  5FLM H;  3S2D B;  3NPP A;  5CV7 A;  4LF7 L;  2WKD A;  4JOI A;  2N55 A;  3DWQ A;  2JA8 H;  1IKM A;  4DR3 Q;  2A6H D;  1DYQ A;  3GD7 A;  3X3N A;  1S72 A;  3AFQ A;  4QB4 A;  5KYI A;  1PHJ A;  1F9S A;  2JA6 B;  4FF2 A;  1JC7 A;  4XIG S;  4A3G B;  2WAC A;  1XMO L;  3CD6 A;  1E7Z A;  2AWN A;  4K8J A;  5IYC H;  3LWE A;  1IL2 A;  4KKU A;  1CZW A;  4LF4 Q;  3PO3 B;  4DR7 L;  3ZYY X;  1SXT A;  2LMC B;  3K7A B;  4DV7 L;  3J80 c;  1RD9 D;  2K32 A;  5DEH A;  5DM6 3;  5EBD A;  3A7L A;  2K04 A;  3R2T A;  2EYH A;  1YNN C;  5LMU Q;  1ENC A;  3DLL A;  5C3W A;  1SMY C;  1VF5 C;  4LUV A;  3VYR A;  5AFW A;  1WYD A;  2UUA Q;  3AB9 A;  4DUZ Q;  1Y1V B;  3ICE A;  1JT8 A;  4JG2 A;  3PO2 H;  1YIJ A;  1ONL A;  2L12 A;  4R4Q A;  3K81 C;  3BZK A;  1QUQ B;  3NQT A;  5C4Z A;  5FLM G;  3BS1 A;  2EDG A;  3KFU A;  2NVY H;  2F0N A;  4X64 L;  2NTS A;  1I50 B;  2SOB A;  5EKK A;  2JA8 G;  5EGT A;  1HRJ A;  1RHP A;  1LTT D;  1RL2 A;  1N33 Q;  4C3I B;  2VQE Q;  3OOC A;  5A35 A;  1GUW A;  5IP7 H;  1U4M A;  2LXJ A;  3GP7 A;  4K5X A;  4V19 0;  1DGS A;  1HNW L;  4KV6 A;  1QVF A;  1WTR A;  4B3R Q;  1E2Z A;  1VF7 A;  2F3I A;  3HOU B;  1B4O A;  3MTS A;  3SXH A;  4X6A H;  2X6L A;  3EBE A;  1NJI C;  4TQU S;  4BY7 G;  2E2H B;  2AQ2 B;  2HT1 A;  1SE3 A;  2XIW A;  1HPC A;  2OXP A;  4DV5 L;  2QDB A;  3ERO A;  4B9X A;  2QW7 A;  1QOH A;  4FF1 A;  3FHW A;  2MGS A;  3J81 L;  2HHH Q;  1SYB A;  5JPN C;  1LAC A;  5FO8 B;  5C4X G;  3WOF A;  3EA6 A;  4OWT B;  2DJF C;  4JYA L;  1EWI A;  3VYU A;  4WOR A;  2JSO A;  4UP8 A;  1EFI D;  4S3S A;  1HNZ Q;  2H4O A;  4BA1 I;  4A3B H;  5CMD A;  3I4N B;  4IUV A;  2M00 A;  1N9W A;  5I6W A;  2TMP A;  2R92 G;  4DR2 L;  1LAB A;  4QJF A;  1ZYR D;  3VR4 A;  4FF4 A;  4DV4 L;  4BBS H;  5IP7 G;  2QDL A;  2HIX A;  4DV3 L;  2BDN A;  3RZO B;  3PIO A;  2PZU A;  1DJR D;  4IPC A;  2Z0S A;  5IGG A;  2HDL A;  3EVQ A;  1KHI A;  4P2C B;  4PMC A;  4CJ2 C;  4QGU A;  2R7Z H;  2KA7 A;  2F0J A;  1EY4 A;  4IUN A;  2PW7 A;  2RDH A;  3RLO A;  1CT1 D;  1KLG D;  4XQJ A;  1XPO A;  2BOS A;  3I90 A;  2KEE A;  5BR8 L;  1TWF B;  4A3K H;  2PNR C;  1MD2 D;  2VS1 A;  3D4R A;  3PUY A;  4JI7 Q;  1HXY D;  2E76 C;  4JK1 C;  1I4X A;  1HFN A;  3NTH A;  3V05 A;  4DUY L;  1M4V A;  5NUC A;  2E2J H;  3S1Q H;  1WTQ A;  4ZCK A;  3PV0 A;  4NMZ A;  2F4I A;  4A75 A;  5JVG 3;  5M5Y B;  2MP1 A;  3PGZ A;  4NXM L;  1GVP A;  4A3E B;  1K3R A;  4PNY A;  4I65 A;  3NSW A;  4IPG A;  4P74 A;  3HZX A;  3S24 A;  2RSN A;  4A93 H;  3OYY A;  2C9O A;  2JA5 H;  1Y1W H;  5IYD H;  1VQJ A;  4DR5 Q;  1YZ6 A;  1I4H A;  4J8Q A;  3KJP A;  4IOA A;  4IPD A;  2PPB C;  1A63 A;  1RIP A;  2KVM A;  3U50 C;  4IN3 A;  3WWV A;  1IL8 A;  2MHV A;  1EWH A;  3I8Z A;  5IOD A;  5E4W C;  1Y69 U;  1PVO A;  3OIQ A;  1D1K A;  5D3D A;  3TP5 A;  1XNR Q;  3HOW H;  4MZ9 A;  3C3L A;  1VCI A;  3D3R A;  3NQI A;  2CCZ A;  4A3K G;  2ZTC A;  4ZLT F;  1SYG A;  4OON A;  1U5K A;  2Y0S B;  3FEW X;  3KYH C;  4EQN A;  3K0X A;  2DNC A;  5CGK A;  2B3G A;  3W5O A;  4HJA A;  3DEP A;  1K83 B;  2G5D A;  3BVG A;  3KF8 B;  4KLK A;  4OEM B;  1JB7 A;  3TME A;  1VQB A;  4LF7 Q;  4FO2 A;  5M5W B;  1FNV A;  2NVQ H;  1SFO H;  4RG1 A;  4C3H B;  3SR1 A;  4V0B A;  4BS9 A;  5GAE C;  2WAQ B;  4A93 G;  2JA5 G;  3BVZ A;  1M90 C;  1XMO Q;  1CKO A;  2E2I B;  2C5C A;  3FPU B;  4R1J A;  4XYO A;  4LF9 L;  4DR7 Q;  2R93 H;  1YEZ A;  3U58 A;  5C3E H;  1WJJ A;  4DV7 Q;  2LS0 1;  1HR0 L;  5EKL A;  1LTL A;  1S5E D;  4A3I B;  4DKA C;  5GAG C;  1O7L A;  1A3V A;  1FL0 A;  2PNH A;  1NCV A;  3HOW G;  2F0K A;  3SK4 A;  4N9T A;  1TWC H;  2B2U A;  2QIL A;  2XWJ B;  1CUK A;  3ONA B;  1V9P A;  5JVH 3;  1PDQ A;  3I55 A;  1MKH A;  5GRO A;  4M1U B;  4YCW A;  3E0E A;  5CV6 A;  4KHZ A;  1YI2 A;  2EY5 A;  3M4Q A;  2JA8 B;  2B2Y A;  3MXU A;  3GTJ B;  1QNK A;  4X64 Q;  3J80 i;  3DM3 A;  4X65 L;  2OTL A;  2EJF C;  1HFG A;  5C4H A;  2FMC A;  4UHV A;  5GQO A;  5LHY 1;  3A8J E;  3D6C A;  3E3X A;  3G48 A;  1YHB A;  1KIX A;  1IKL A;  4TRD A;  2R93 G;  4JBM A;  4I7A A;  1PFS A;  2BH8 A;  1AE2 A;  4C56 C;  2KEC A;  2WB1 E;  2RDG A;  2X69 A;  3OW2 A;  4WJ3 M;  4HSV A;  3PMF A;  4YCV A;  1N34 L;  3N52 A;  4A3M H;  2CH4 W;  4JI5 L;  1BO0 A;  4DV1 L;  2RHQ B;  2ZXO A;  1U0L A;  3BU2 A;  3K7U C;  1I4Q A;  1EY0 A;  2HDM A;  3PO2 B;  4B08 A;  1J6Q A;  3QOL A;  1WD0 A;  4R4O A;  2VQF Q;  1EIH A;  1CHQ D;  4JYA Q;  2F0H A;  1PH5 A;  2NVY B;  3J7Z C;  1NTG A;  5ELB A;  3CCS A;  2IX3 A;  2B2T A;  1S5C D;  2E5L L;  5JAV A;  2EYP A;  3NEN A;  4DR2 Q;  3D0F A;  4CGY B;  3QB3 A;  1CKN A;  1AW7 A;  3CCR A;  2K5Q A;  2A69 C;  4JW0 A;  1I4P A;  4DV3 Q;  5BN3 A;  4FVM A;  2L9H A;  1B2T A;  2NBF A;  1BXT A;  1MJE A;  4LF8 L;  2F3W A;  1GKH A;  3W3A A;  3W1G A;  4FXD A;  4TVA B;  1CHP D;  3FKI H;  1LO5 D;  2IWH A;  1YJ9 A;  1YHA A;  2K01 A;  1LLR D;  1YNN D;  4P73 A;  4E6I A;  1PH9 A;  4A3M G;  2ZM6 Q;  3D8G A;  1BR9 A;  1K73 C;  2A6E D;  4A3L G;  1VQ6 A;  1SMY D;  1Q1E A;  5BR8 Q;  5L37 A;  1AFP A;  3SK6 A;  1JJG A;  1KAA A;  2CW0 C;  2PO4 A;  5D65 A;  1VQD A;  4C2M H;  3A8I E;  2JA7 H;  2WFW A;  1SE2 A;  2KBN A;  3KDF A;  4DK1 A;  3CPF A;  4A3B B;  5JPM C;  4JI0 L;  3SVM A;  4DUY Q;  3I7F A;  2F0Q A;  1EYG A;  5FO9 B;  1WTO A;  1CQV A;  3GTL H;  1OXT A;  4BY1 G;  1K28 A;  3KUP A;  4A3D B;  1EY8 A;  3P1H A;  4NXM Q;  1MSG A;  4F87 A;  4BBS B;  4R8N A;  5AJ3 L;  5HUR A;  2KQ3 A;  2KCT A;  1FNU A;  1LT6 D;  4XT1 B;  1UE5 A;  4K2K A;  4RFB A;  4HSP A;  5EAY A;  1Q86 C;  3TS0 A;  2R7Z B;  1ICW A;  1RCV D;  2F0I A;  4GLV B;  1AZQ A;  1VQ7 A;  2KCC A;  4MTK A;  1OXS C;  3RMH A;  1BBU A;  2CWA A;  3KLS A;  1C8C A;  3FKI G;  1GHJ A;  2EXZ A;  3Q22 A;  2XTI A;  4Y52 H;  5KND A;  3M4P A;  1HQM C;  2PW5 A;  4ZUI A;  5KRU A;  4B3S Q;  1G2T A;  4A3J B;  2RVL A;  1D5X C;  1PZK D;  5IWA L;  5ISR A;  1PLF A;  3I2Z A;  2YYZ A;  4OO1 G;  5C0X H;  5IT9 E;  2JA7 G;  1VS0 A;  3S1R B;  1SE4 A;  5M3M B;  1HCZ A;  3IRB A;  4EX5 A;  1NUC A;  2DNE A;  2K1B A;  1N36 L;  3S1Q B;  4H0L C;  2E2J B;  3BJU A;  5TSS A;  1U4P A;  1SBB B;  1DXM A;  4DXF A;  3K5N A;  2MQH A;  3GV6 A;  1BUV T;  3S2H H;  3H3V H;  1X3P A;  4DK0 A;  1VQN A;  1CZG A;  4BWG B;  2FJ2 A;  5FJ8 H;  2PCF B;  2UUC Q;  4RGT A;  4LFA L;  4OIK A;  4OXP A;  1Y1W B;  3RUZ A;  2QKI C;  4HID A;  3DXJ C;  2LSS A;  1OXV A;  3V2T A;  1BDO A;  4DV2 L;  1WCM H;  1PRT B;  2I07 B;  4KTA A;  1J8I A;  4C3J H;  3A0J A;  3HOZ H;  1A2T A;  1MIU A;  1XTC D;  4LF9 Q;  3HS0 C;  2K5D A;  3GDE A;  1V1P A;  3TZD A;  4KJO A;  1HR0 Q;  1X32 A;  4L6T B;  3G71 A;  1ESF A;  1T9H A;  4GNX C;  2UU9 L;  3HOW B;  2ID0 A;  3CW2 C;  4KJN A;  3CQZ H;  4Y7N H;  3MFG A;  2SEB D;  1ML0 D;  4DFA A;  1GUT A;  3PF4 A;  3D6W A;  1KLU D;  5T1I A;  2MJ8 A;  5C0X G;  3IL8 A;  1NBW A;  4DR4 L;  4IJH A;  3HGB A;  4RKL A;  2F0G A;  4TSS A;  5J39 A;  5IT9 c;  4DA2 A;  3MXP A;  4K8I A;  2NVQ B;  5IGE A;  1SFO B;  4L5R C;  4DR1 Q;  3CU7 A;  1KAB A;  2F0E A;  2L4N A;  1HA6 A;  4CKE A;  5FJ8 G;  2NN6 H;  2WV6 D;  2EYO A;  2PMZ E;  1EOT A;  4WFN 3;  1ET9 A;  1GUS A;  4WRD A;  1B9N A;  5JEA H;  1M8A A;  1UE1 A;  4XDX A;  1A62 A;  3SHL A;  3UDF A;  5C3E B;  3HKZ G;  4YWM A;  1V1P B;  2IW3 A;  2NYZ D;  4X66 L;  1VQM A;  3QIA A;  1NR2 A;  1WFQ A;  2D9U A;  2OQ0 A;  2JA9 A;  4AIM A;  2A73 B;  1Q8K A;  1L1O C;  3PQI A;  3HOV H;  1N34 Q;  1Q8I A;  4B3M L;  2RCF A;  4JI5 Q;  4DV1 Q;  1EU4 A;  1J5E L;  1QCB D;  1Z9F A;  2EZV A;  3TEH B;  1TS3 A;  4A3F H;  4GLA C;  1B3Q A;  4YIJ A;  4NDX A;  2YU9 H;  1BCP C;  2XNA C;  4ZKB B;  4HJ5 A;  3TP6 A;  4DNR B;  1F2Z A;  1W6K A;  2UXB Q;  1KDA A;  2EY6 A;  3E5S A;  3OSO A;  1EYC A;  4FXK C;  2VY3 A;  4BA2 I;  2JE6 I;  2A19 A;  4NXN L;  3AMU A;  4GLX A;  3BDC A;  1JR0 D;  1KRT A;  4M8A A;  3CPW A;  2E5L Q;  1SNQ A;  1K0R A;  4KHV A;  2G9D A;  4EGV A;  2ZXP A;  4YWL A;  2NN6 G;  1UE7 A;  3G7L A;  4LUZ A;  3Q6S A;  4ILW A;  3A56 A;  3R3O A;  1XNQ L;  5JJL A;  5JEA G;  2EJM A;  4J1M A;  1JWS D;  5M3F G;  2J0T D;  1TQO A;  3KBX A;  4H44 C;  4RGN A;  4JV5 Q;  1K3B C;  1X3E A;  1SNC A;  2F0O A;  4MNO A;  2Q2T A;  3BZD B;  2F0P A;  3NK9 A;  1PH3 A;  2GVB A;  2Z6K C;  1W6J A;  3HOV G;  2CH4 A;  4AYB B;  4RGO S;  3M85 A;  2CVR A;  5BN5 A;  1JOO A;  4KN7 C;  5LMN Q;  1GUO A;  4QUC A;  4A3F G;  4BY7 H;  4BXX G;  5A2Q L;  1LTS D;  1PYS B;  1O7I A;  4L8J A;  4DXG A;  1WOC A;  4JI3 L;  1SNM A;  1XMQ L;  2QEJ C;  1PH4 A;  2Z8L A;  1UAP A;  4JI0 Q;  4WJW A;  1VQO A;  3SGI A;  1STH A;  2JXM B;  3HKZ E;  2BA1 A;  5C4X H;  1LT3 D;  3BZC A;  3EJI A;  3NE5 B;  4JI6 L;  2AMC B;  1PRT F;  2KHJ A;  1VQP A;  3NTK A;  3V96 A;  5AJ3 Q;  1D1I A;  2V4D A;  1ET6 A;  1TT2 A;  5EPJ A;  2EYM A;  4DV0 L;  1LTI D;  3NEL A;  5M9O A;  2R92 H;  1LT4 D;  3CME A;  3T1H L;  1EOV A;  3T1Y L;  1LM0 A;  3MXN A;  1B8A A;  1ILQ A;  1C7Y A;  2A1A A;  4KY5 A;  3CCQ A;  1F9R A;  3PIP A;  1I6H H;  2B8F A;  2BDO A;  5CC4 A;  3VDY A;  3K59 A;  1QB5 D;  2JQO A;  5KNB A;  4LF6 Q;  5JJZ A;  2D5D A;  2JA7 B;  1Y8P B;  5FKA C;  2C35 B;  1RJT A;  4RCN A;  1LTR D;  1B70 B;  4CKB A;  2L11 A;  1N36 Q;  1VQ8 A;  3SDZ A;  1VQF A;  4EQP A;  4FDB A;  4XQQ A;  1FGB D;  4P75 A;  3PIO 3;  1AZP A;  3KF6 A;  2R7D A;  4DPG A;  4JBW A;  3AU7 A;  4R9W A;  4G7Z C;  1U4L A;  1G8Z D;  4JCV E;  1ENF A;  4GNX A;  4KN4 C;  4CBV A;  4LFA Q;  5IP9 H;  5K36 H;  3JAM E;  4KHP L;  2KUM A;  1GUN A;  5GAD C;  2A69 D;  4ODG A;  2K7V A;  4DV2 Q;  3I91 A;  5FLX E;  3DEO A;  3CRK C;  1TWA H;  5KYL A;  1FR3 A;  5I9P A;  1HZ9 A;  2B2V A;  5HGT A;  4P71 A;  1KXL A;  2A5H A;  3EQL C;  2BE5 C;  4IUR A;  1TWG H;  3E9H A;  1G51 A;  2UU9 Q;  3I73 A;  1SSO A;  1QZG A;  5ELF A;  2WAQ E;  1D6E C;  4ZK9 B;  1SMX A;  1JOR A;  1H9S A;  2UUB L;  2F1M A;  2CW0 D;  1F77 A;  2GN5 A;  4L5S A;  1A3U A;  2ICE C;  2JP1 A;  1SN8 A;  4I7Z C;  2YTX A;  1WTV A;  2F0T A;  2B63 G;  3PCO B;  3URY A;  3S2H B;  5EPL A;  4KY7 A;  3GTG H;  1U4R A;  4G4K A;  3STB C;  2VB2 X;  1HTP A;  3OWF A;  2Z9H A;  3P20 A;  4DN4 M;  3PUZ A;  2BA0 A;  3FMC A;  4O2D A;  3GTO B;  3OPO A;  1MSH A;  2RA4 A;  1L1O A;  5IP9 G;  1L0W A;  1WCM B;  4ULL A;  5K36 G;  3G6J B;  4JI8 Q;  4C3J B;  5C44 G;  3HOZ B;  4PV1 C;  1RTN A;  1R4P B;  2Q8R E;  2I5M X;  4PQX A;  3GTK H;  4GOP A;  2IT1 A;  1HHV A;  3I56 A;  1EIY B;  1Q82 C;  2VB3 X;  2N88 A;  4YCU A;  3AYH B;  2NVT H;  4Y7N B;  1G2S A;  4X66 Q;  4DNI A;  3GTP B;  2OQK A;  1Q3L A;  3MZ5 A;  5J3B A;  4NW2 A;  2LY7 A;  1V43 A;  2JEA I;  4B3M Q;  1X3F A;  2HCI A;  2M9V A;  4IZ8 A;  5I6Y A;  1PH8 A;  1WTX A;  3FDT A;  1A3T A;  4XYQ A;  1W3S A;  1PH7 A;  4CDD C;  1EY9 A;  5CV4 A;  4LF5 L;  1Q12 A;  4QL5 A;  2F0M A;  2IX1 A;  3P7J A;  5A2Q E;  1SYF A;  3L9A X;  5G3L D;  1B44 D;  1F2Y A;  1BBX C;  2EXD A;  3IAY A;  5IY0 A;  1JMC A;  4NXN Q;  1N32 L;  2WB1 G;  3NXW A;  1G91 A;  2EPB A;  3B6Y A;  4HJ9 A;  1HR0 W;  2ZXR A;  4QUF A;  2Z6K A;  4X3U A;  5C6A A;  3A7A B;  1XNQ Q;  4FP5 D;  2QCP X;  3H0G H;  3SK8 A;  2D2C C;  2NVX B;  1E2W A;  2Q2I A;  2WP8 J;  1ENA A;  4GOP B;  3M7N A;  1CQF A;  1CSQ A;  1KC8 C;  2ENB A;  4UDU C;  4N8X 1;  4X3T A;  1I6V C;  2Q2U A;  2JEB I;  2EYL A;  3IKJ A;  3LNN A;  3I4L A;  5C0X J;  1TVX A;  4HJ7 A;  2H1E A;  1IBM L;  4HR7 B;  3S17 H;  4DR6 L;  2YU9 B;  4IFD H;  1YNJ C;  3JC6 6;  2A74 C;  2YTY A;  4HTH A;  3D4W A;  5KIX A;  4L63 B;  4JI3 Q;  3CCE A;  1ZKO A;  2K03 A;  5HY6 A;  3GTM B;  1NNX A;  1DOK A;  1R4Q B;  2QA4 A;  3DM1 A;  1VQC A;  1SAP A;  1SYC A;  4JI1 L;  3ZJY C;  1QWY A;  2I46 A;  4HMJ A;  3J81 E;  4F7X A;  2XRS D;  4JI6 Q;  1YJW A;  1SND A;  2HIV A;  1STB A;  2B2W C;  1G29 1;  1JWU D;  1V1Q A;  2F0U A;  4IAL A;  3H0G G;  1VQL A;  1D7Q A;  4ZUJ A;  3CRL C;  1JOK A;  1KL9 A;  4QIW E;  3T1H Q;  5JJI A;  1I5F A;  1XXG A;  2AQ3 B;  3OMC A;  2VUM H;  2OCE A;  3VR5 A;  3CC4 A;  4JVZ A;  2K14 A;  2K5H A;  5IE8 A;  1XYI A;  5LL6 X;  1HNW Q;  3PUX A;  1QVC A;  4BY7 B;  3DWA A;  1C48 A;  2KJX A;  4MHE A;  4IFD G;  1GD7 A;  1KTK A;  4DK3 C;  2NTT A;  4OL7 A;  1PTO H;  4YWK A;  1BCP D;  2K50 A;  4DAY A;  2HQE A;  2MUY A;  1S40 A;  2H5X A;  3FPP A;  3P75 A;  4DV5 Q;  2PZW A;  4POG A;  4A3L H;  1NMG A;  3M4O H;  3F2B A;  5C4X B;  3DHQ A;  4JI2 L;  4AH6 A;  3S2D H;  2OT2 A;  3MFY A;  5FK9 C;  4GZY C;  4GN5 A;  5JEA J;  5IOC A;  1PTO C;  2ZT9 C;  4G7H C;  1EY5 A;  4QMG A;  1GO3 E;  1XJV A;  4F8M A;  1Q1B A;  1EFW A;  3E0J A;  3A55 A;  4YY3 L;  1SJE D;  1IHZ A;  3K5L A;  1EQQ A;  2ATW A;  2R92 B;  4BY1 H;  3J81 c;  1TKW B;  2M2L A;  5LMN W;  3OWE B;  2F0W A;  1XPR A;  4ID6 A;  2IL8 A;  2O5I C;  3X3M A;  5I2Y A;  5I9O A;  1KQS A;  3M3Y H;  1I6H B;  3NP8 A;  5C0X I;  1FNW A;  4DAM A;  2VUM G;  4DV4 Q;  2XSC A;  4L5T A;  2HQL A;  3MXG A;  2F0S A;  2RSO A;  4J15 A;  4Q5V A;  3Q24 A;  3H3V I;  2UUB Q;  1GHK A;  4DNT B;  1V8Q A;  1PV4 A;  2K05 A;  1YNX A;  2PQE A;  1F2L A;  3O13 A;  3U9O A;  3HOX G;  2IY5 B;  3Q23 A;  1MHW C;  3CCM A;  2AUK A;  2GVA A;  1YIT A;  4O42 A;  2J4X A;  5F2D A;  1L2F A;  3K57 A;  2L1B A;  1PA6 A;  3RLN A;  4OO1 H;  4R4I A;  4RKB A;  3J80 L;  1VQH A;  1I50 H;  4H7B A;  1SJH D;  5C5L A;  2L55 A;  1Y8O B;  3S14 H;  1KRS A;  1ICF B;  1ZEQ X;  2PQA A;  4X3K A;  4LF4 L;  2B8G A;  1WTH A;  1TWA B;  2G9H D;  5DLQ E;  2KEN A;  4MN3 A;  1ASZ A;  3PO3 G;  3TP8 A;  2LFN A;  4JI4 L;  1TWG B;  3NBH A;  3GTQ H;  5LMU L;  1OXU A;  1EY6 A;  4QY7 A;  1CKN B;  4UY8 C;  1HQR D;  3A5U A;  4GS3 A;  3QG1 A;  3ERS X;  1E0B A;  2IHE A;  1HZC A;  1JB3 A;  4R4C A;  3M7G A;  5H1S E;  1ASY A;  4HN7 A;  5IGB A;  1AE3 A;  1NSN S;  2NN6 I;  4KMU C;  1L0X B;  4GN4 B;  1FD7 D;  4A3K B;  3GTG B;  4LF5 Q;  4Z9C B;  4DU9 A;  5J22 A;  2VW9 A;  1RKN A;  2WB1 B;  2EOT A;  4NPS A;  1HZB A;  3AEV A;  3JAM i;  1OXX K;  1B7Y B;  3HRZ C;  1HUM A;  4IO9 A;  5DAU A;  3KDF B;  4CDE C;  1B50 A;  2EY2 A;  1I3Q H;  2PQA B;  3ER0 A;  4ALP A;  2Z1C A;  4C3I G;  1PH2 A;  4B3R L;  3L7Z C;  3FVQ A;  1JJC B;  1JOQ A;  2Q8T A;  2DN8 A;  4MIU A;  1BOS A;  1TY2 A;  1EU3 A;  1UEB A;  4RHS A;  2NVT B;  4A93 B;  3NBH B;  2JA5 B;  2BE5 D;  2N8N A;  3HOU G;  1W2B A;  1EQR A;  3R93 A;  5CR3 A;  4ZYS A;  2P5Z X;  3K5O A;  3S1M H;  3TRZ A;  4O1N A;  4GKJ L;  3MWY W;  1TS5 A;  1HH2 P;  1RDP D;  3ITP A;  1GXD C;  3T51 B;  2Q8I B;  1IBM Q;  5IGD A;  4RWS C;  2QGQ A;  4JC0 A;  4DR6 Q;  1TWF H;  1PMR A;  1Q90 A;  5E1F A;  5C4J H;  2GA4 B;  2B2W A;  2IJ0 A;  4GKK L;  3D4D A;  1STE A;  2EE1 A;  2FFK B;  4K5V A;  1QG7 A;  2Z4H A;  3OW7 A;  4EQ5 A;  4JBJ A;  2D0P A;  3FRP B;  4JBK A;  1WI5 A;  4LNQ A;  3I4N G;  3STB D;  2ZTD A;  1E2V A;  4JI1 Q;  1SEB D;  1RTO A;  4AYB E;  5IYB H;  1CI3 M;  3F2D A;  4A3E H;  4UAI A;  3U4Z A;  1WTP A;  3HP3 A;  2R61 A;  5C3X A;  1AEX A;  3H0G B;  1HTL D;  2R3Z A;  2I0Q A;  3VA7 A;  4HCS A;  4KKT A;  1U9R A;  4X65 Q;  1T5E A;  1EYA A;  2F3V A;  3DUZ A;  4B9W A;  1UE6 A;  1QVG A;  2D0O A;  3MC0 B;  3RNU A;  5CV5 A;  1IBK L;  2R93 B;  3UDG A;  3CMA A;  1JWM D;  4HMI A;  4Q0F A;  2MPM A;  5M3F H;  1E1T A;  5CBE E;  3F1Z A;  1ZXT A;  1STG A;  1ESR A;  1J9O A;  4DGZ A;  4JI7 L;  4OGQ C;  1PZJ D;  3J7A 5;  3KLS X;  1SYE A;  2MFI A;  1KNE A;  3A74 A;  5KGU A;  3CXC A;  4RGM A;  2HD3 A;  1TWC B;  1D5Z C;  1VQA A;  1BNZ A;  1LTA D;  4L5Q A;  4HIO A;  3TRE A;  1K0S A;  3RN2 A;  4JI2 Q;  4BXX H;  1BKB A;  4OWX B;  5FOB B;  3CC2 A;  5IYB G;  5T1G A;  1PFB A;  5M5W H;  1DON A;  2NZH A;  3T16 A;  3TS2 A;  3CF5 A;  4IOC A;  1CSP A;  4A3E G;  4OEL B;  1F9Q A;  1KD1 C;  4YY3 Q;  2KCN A;  2DUD A;  1DZ1 A;  2E2I H;  3CCL A;  1G6Z A;  2FMM A;  4YHH L;  1Q46 A;  2F52 A;  3K80 C;  3AQQ A;  2VUM B;  4DV6 L;  4ABN A;  1LYL A;  2JJQ A;  1CA6 A;  4A3I H;  3H15 A;  3J7Y W;  4PZ6 A;  3NHH A;  3RZD H;  1S5F D;  3I4M H;  3U4V A;  4RCO A;  4LF8 Q;  1PH1 A;  4GN3 B;  2BH2 A;  1YNJ D;  3ULL A;  4A3M B;  3NUC A;  3H6M A;  3M4O B;  1QUQ A;  3A5Z B;  3EIV A;  4NKL A;  3J81 i;  4BBR H;  1TWH H;  4OHJ A;  4K2L A;  3VR3 A;  5LL6 S;  5C5M A;  1H9K A;  1N8R C;  2OWO A;  3GTJ H;  2D62 A;  2CQA A;  3PIP 3;  2A68 C;  1X3G A;  1EEI D;  1AP0 A;  1TR5 A;  4K6D A;  1CA5 A;  2ASB A;  4POF A;  4C3H G;  4G57 A;  2B29 A;  4BY1 B;  1BVS A;  2DGY A;  3I3C A;  3IFD A;  3Q8D A;  2WAQ G;  4XXE A;  5IGF A;  2NZO A;  2WIN B;  4ME5 A;  3M3Y B;  3TBI B;  4QF4 A;  1Q81 C;  2WII B;  2BCO A;  4IJL A;  4JI4 Q;  5I4D A;  4LFC L;  2RBM A;  3K6O A;  1S3O A;  1K9M C;  4IFD J;  3H94 A;  4A3I G;  4R4T A;  1DM0 B;  3T53 B;  2A6E C;  2QEX A;  1EZ8 A;  1E24 A;  2AWO A;  1STN A;  2PMZ B;  3FKI B;  3PUW A;  3I4M G;  3A54 A;  1EEF D;  1IW7 C;  1K8G A;  4LFB L;  4XTC S;  3I4O A;  3T13 A;  5K5P A;  2AUJ D;  2AHO B;  5M5X H;  3UI2 A;  2CKZ B;  4FXG C;  4N9P A;  1SNP A;  1D5M C;  4ZAI A;  5HGQ A;  1BQQ T;  4C2M B;  1HNX L;  4BBR G;  4H13 C;  5IWA Q;  1R9T H;  3S14 B;  2B2U C;  1VQ9 A;  3M9B A;  2OF1 A;  1FJG L;  1TY0 A;  4F88 A;  2E74 C;  1PTO D;  3BYT B;  1JE4 A;  2B63 H;  1YJN A;  1EQV A;  1PFN A;  3GTL B;  2VXW A;  5IYC G;  1DOM A;  2K5W A;  2TSS A;  3W1B A;  3AFP A;  2B2Y C;  1VMC A;  1F9P A;  3GTQ B;  3G4S A;  1UUP A;  2EQS A;  3SEB A;  1EWC A;  2AQ1 B;  3U9S A;  5C44 H;  2Y0S E;  5COR A;  3RD4 A;  3WOE A;  2KOL A;  1IBL L;  4GKJ Q;  5JJK A;  3IFT A;  3MXN B;  4B3T L;  1KDB A;  1TU2 B;  3PO2 G;  1CK1 A;  2VQF L;  3HEJ A;  2L15 A;  1VQI A;  1TII D;  2MO0 A;  2VNU D;  1X9N A;  4GKK Q;  2CFM A;  1JQY D;  4P72 A;  5DM7 3;  3LGJ A;  3GQB A;  2NUC A;  3K58 A;  1VDZ A;  4LWC A;  4DAV A;  3MAQ A;  1STY A;  2RF4 A;  3MVV A;  3VR6 A;  5JOB A;  2K5V A;  2Z6B A;  2MO1 A;  2L5T A;  2CWP A;  4U68 A;  4A3D H;  4DR4 Q;  1SRU A;  3T4A C;  1IZ6 A;  2YV5 A;  1I3Q B;  3F2U A;  4CHT B;  3F2C A;  3TDQ A;  3S1N H;  3LWU A;  1GUG A;  3RLF A;  2RDF A;  3KF6 B;  2DY8 A;  1EIG A;  2N78 A;  1X55 A;  2XVS A;  4IFD I;  2B2T C;  5ELO A;  1E22 A;  4GNX B;  4MTN A;  4K5W A;  3S15 H;  4R8I A;  4HIK A;  3S1M B;  4OWW B;  3J7A V;  4LK1 C;  3HKS A;  2ZM6 L;  3HKZ B;  4IQZ A;  3L0O A;  1IBK Q;  3S16 H;  1DOL A;  3JAM c;  1PTO F;  4A3J H;  1S4Z A;  4EVO A;  5C4J B;  5FLX c;  3CQZ B;  3KK7 A;  2MNA A;  1I94 L;  2O2L D;  1C0A A;  3S1R H;  5M3M H;  2Z4I A;  2XWB B;  4A3B G;  3KF8 A;  1S5B D;  2K5N A;  3OTO L;  3SE0 A;  3CHB D;  1H9S B;  1A0I A;  1J5E Q;  4PG3 A;  5CV9 A;  1XX8 A;  2ES2 A;  3BDO A;  2I5H A;  4A3D G;  1XPU A;  4BBS G;  4PZ7 A;  1PH6 A;  1PYW D;  2IHF A;  4AQY L;  2LKV A;  4C1N I;  1Y8N B;  4XT3 B;  1FVI A;  3DMU A;  1B3A A;  1XWE A;  1SRO A;  2RQX A;  3MEH A;  3KLW A;  3L2P A;  2FHT A;  3A8K E;  3GV3 A;  1VQK A;  4YHH Q;  1A6X A;  2R7Z G;  1L1O B;  3CKI B;  4DV6 Q;  3QWN A;  3SK5 A;  4B3S L;  5M3F B;  2F4V L;  1LUZ A;  4TKO B;  1VQ5 A;  2KED A;  1PRT C;  5COY A;  2E8G A;  3MHB A;  1BCP B;  4A3J G;  3TQY A;  2JN4 A;  1JIC A;  1II3 A;  2JYO A;  2ZJQ A;  3DWP A;  3HOV B;  2JK8 A;  3RR5 A;  5IIF A;  4CKC A;  1DCZ A;  4HED A;  3KLR A;  5M3M G;  2E75 C;  1SNO A;  2R7F A;  1D2B A;  2X6G A;  4A3F B;  2EYF A;  1PYB A;  3QOJ A;  4KY6 A;  2E2D C;  2SNS A;  4K6L A;  1H9M A;  3J81 j;  1SE8 A;  3ERQ A;  1IYU A;  2UUC L;  2HCC A;  1AH9 A;  4H02 A;  3BDL A;  1TXY A;  2EIF A;  3HOY H;  1DD2 A;  4X62 L;  1XMQ Q;  4U67 3;  2KCM A;  3Q0A A;  1Y1W G;  3KOJ A;  5EBC A;  5IYD G;  1G6P A;  1QIL A;  2A6H C;  2VL6 A;  3H91 A;  1SR3 A;  1O7Z A;  1C4Q A;  1LV9 A;  4DK6 C;  4OX9 L;  2CQO A;  2N3S A;  2EVB A;  1WD1 A;  4LFC Q;  4RHR A;  1MBY A;  3C46 A;  3RZD B;  5FO7 B;  5IT9 L;  3I4M B;  4CDF C;  3E9I A;  4IUP A;  4DV0 Q;  3HG9 A;  1WVL A;  2EYJ A;  4ZQ3 A;  3CP0 A;  4OO1 I;  5G3L F;  1A8V A;  1X6O A;  3T1Y Q;  2DJG C;  1D8L A;  1EUJ A;  1ILP A;  1VQE A;  4K0K L;  4LFB Q;  1AN8 A;  4BBR B;  1TWH B;  3ULJ A;  4KI0 A;  4DR1 L;  1HNX Q;  5E3F A; 
#chains in the Genus database with same CATH homology
 2B39 A;  1O80 A;  1OO9 B;  2NB0 A;  4LMQ D;  5E4X A;  1A15 A;  3TP7 A;  1O7Y A;  1B1Z A;  2QF7 A;  4CJ0 B;  3PUV A;  5D3I B;  2SDF A;  2EY1 A;  1EL0 A;  1L0Y B;  1HUN A;  5J1Z A;  1SYD A;  1ROD A;  4FYD A;  4XQN A;  1Z47 A;  1I4G A;  5M5X B;  3N6R A;  1IYV A;  2L0C A;  5I2X A;  5EKI A;  5EQ0 A;  3NTI A;  3MA2 B;  1R9T B;  5DNF A;  1RF2 D;  1KDC A;  3R2I A;  3VYS A;  2B63 B;  1SDF A;  5IGC A;  1LTG D;  2A68 D;  2F03 A;  3TZU A;  1S5D D;  1NR4 A;  1PZI D;  4DAP A;  1EQT A;  1EYD A;  1ZYR C;  5C44 B;  4NP5 A;  1PFM A;  2RKS A;  2OEO A;  4RAU C;  1BCP F;  4ZKC B;  3OHX C;  1A2U A;  1JCK B;  5CYU A;  1H9J A;  1X3Q A;  5ELC A;  2EJG C;  1IW7 D;  2K28 A;  3VYT A;  4KD3 A;  3BYY B;  4QCL A;  4ZRZ A;  1NAP A;  1QJO A;  2O4X A;  3L3O C;  4QIW B;  1MI2 A;  3E6Z X;  1LT5 D;  3R8B A;  2PYK A;  2F0L A;  4PMB A;  3S1N B;  2XN9 C;  1Z7T A;  3C2P A;  1EY7 A;  2F0F A;  4X3S A;  3T56 B;  4KD4 A;  2K6A A;  1T5X D;  3H09 A;  3S15 B;  5BN4 A;  2KHS A;  5CBA E;  3NWS A;  3NWT A;  3K5M A;  3S16 B;  1WTW A;  1K8M A;  3GTK B;  4RH6 A;  3I72 A;  3ND9 A;  3VA5 A;  3OMG A;  1EZ6 A;  3C1F A;  5KEE A;  2NWG A;  3KBG A;  2PZT A;  3D31 A;  5EPK A;  1QNU A;  2IX0 A;  1CFM A;  4HCE A;  4FNF A;  3GO5 A;  1Z6H A;  4LAA A;  5CV8 A;  4IUU A;  2CHB D;  5ELE A;  1TS2 A;  4FF3 A;  3K0Y A;  4HAE A;  3QJY A;  1LTB D;  3S9W A;  1MGS A;  3TN2 A;  3H3V C;  2K33 A;  4DF7 A;  4J6H A;  1CTM A;  3I70 A;  3M4Y A;  1VMP A;  2F0V A;  2O5J C;  1GJX A;  2HUG A;  1CM9 A;  2SNM A;  4OIJ A;  3NBI A;  4G7O C;  4KKS A;  4EQO A;  3LX0 A;  2B2V C;  3C1E A;  4C1N K;  3W2D A;  3S17 B;  5EJW A;  3BVM A;  2DY7 A;  2WKC A;  3JAM L;  1K8O A;  1I4R A;  4RA8 A;  1B9M A;  3WDN A;  3HOY B;  2R6G A;  5FLX L;  1O78 A;  3QO2 A;  2NZ1 D;  3ND8 A;  4C3J G;  2IPK D;  5KNC A;  1UNS A;  5ELD A;  3EFX D;  1V1O A;  2FIN B;  3J80 E;  2XRQ D;  1UEA B;  2J7Z A;  3OIP A;  1KNA A;  1H9R A;  4IUT A;  1B53 A;  1TS4 A;  1PRT D;  1GOZ A;  1STA A;  3TSS A;  3VR2 A;  4LJZ C;  3BG3 A;  4K14 A;  4KK7 A;  4IUQ A;  2F0D A;  1PTO B;  1QE6 A;  1PXU A;  1F2M A;  1FYC A;  3J7A F;  4PMW A;  3HOX B;  2ICI A;  1BF4 A;  1HA5 A;  4CJ1 B;  5D14 A;  3S2D B;  3NPP A;  5CV7 A;  2WKD A;  2N55 A;  3DWQ A;  1IKM A;  2A6H D;  1DYQ A;  3GD7 A;  3X3N A;  4QB4 A;  5KYI A;  1F9S A;  2JA6 B;  4FF2 A;  1JC7 A;  4XIG S;  4A3G B;  2WAC A;  2AWN A;  4K8J A;  3LWE A;  3PO3 B;  4KKU A;  1CZW A;  3ZYY X;  1SXT A;  2LMC B;  3K7A B;  1RD9 D;  2K32 A;  5DEH A;  5DM6 3;  5EBD A;  3A7L A;  2K04 A;  3R2T A;  2EYH A;  1YNN C;  1ENC A;  5C3W A;  1SMY C;  1VF5 C;  3VYR A;  5AFW A;  3AB9 A;  1Y1V B;  1ONL A;  2L12 A;  3NQT A;  5C4Z A;  3BS1 A;  2EDG A;  2F0N A;  2NTS A;  1I50 B;  2SOB A;  5EKK A;  5EGT A;  1HRJ A;  1RHP A;  1LTT D;  4C3I B;  3OOC A;  5A35 A;  1GUW A;  1U4M A;  3GP7 A;  4K5X A;  4V19 0;  4KV6 A;  1WTR A;  1E2Z A;  1VF7 A;  3HOU B;  1B4O A;  3MTS A;  3SXH A;  2X6L A;  4TQU S;  2E2H B;  2AQ2 B;  1SE3 A;  2XIW A;  1HPC A;  2OXP A;  2QDB A;  3ERO A;  4B9X A;  1QOH A;  4FF1 A;  2MGS A;  3J81 L;  1SYB A;  5JPN C;  1LAC A;  5FO8 B;  3WOF A;  3EA6 A;  3VYU A;  4WOR A;  2JSO A;  1EFI D;  4S3S A;  2H4O A;  4BA1 I;  5CMD A;  3I4N B;  4IUV A;  2M00 A;  5I6W A;  2TMP A;  1LAB A;  1ZYR D;  3VR4 A;  4FF4 A;  2BDN A;  3RZO B;  2PZU A;  1DJR D;  5IGG A;  2HDL A;  3EVQ A;  4P2C B;  4CJ2 C;  4PMC A;  2KA7 A;  2F0J A;  1EY4 A;  4IUN A;  2PW7 A;  2RDH A;  1CT1 D;  1KLG D;  4XQJ A;  2BOS A;  3I90 A;  2KEE A;  1TWF B;  2PNR C;  1MD2 D;  3D4R A;  3PUY A;  1HXY D;  2E76 C;  4JK1 C;  1I4X A;  1HFN A;  3NTH A;  3V05 A;  1M4V A;  5NUC A;  1WTQ A;  3PV0 A;  4NMZ A;  2F4I A;  5JVG 3;  5M5Y B;  2MP1 A;  4A3E B;  4PNY A;  4I65 A;  3NSW A;  3HZX A;  2RSN A;  2C9O A;  1I4H A;  4J8Q A;  2PPB C;  2KVM A;  4IN3 A;  1IL8 A;  2MHV A;  1EWH A;  3I8Z A;  5IOD A;  5E4W C;  1Y69 U;  3OIQ A;  1D1K A;  5D3D A;  3TP5 A;  3C3L A;  1VCI A;  3D3R A;  3NQI A;  4ZLT F;  1SYG A;  2Y0S B;  3FEW X;  4EQN A;  2DNC A;  5CGK A;  3DEP A;  1K83 B;  3BVG A;  3TME A;  4FO2 A;  5M5W B;  1FNV A;  4C3H B;  3SR1 A;  4V0B A;  4BS9 A;  2WAQ B;  3BVZ A;  2E2I B;  2C5C A;  3FPU B;  4XYO A;  2LS0 1;  5EKL A;  1S5E D;  4A3I B;  1O7L A;  1A3V A;  1NCV A;  2F0K A;  3SK4 A;  4N9T A;  2B2U A;  2QIL A;  2XWJ B;  5JVH 3;  3ONA B;  1PDQ A;  4M1U B;  5CV6 A;  4KHZ A;  2EY5 A;  2JA8 B;  2B2Y A;  3MXU A;  3GTJ B;  1QNK A;  2EJF C;  1HFG A;  5C4H A;  2FMC A;  5LHY 1;  3A8J E;  3D6C A;  1IKL A;  4TRD A;  4C56 C;  2KEC A;  2RDG A;  2X69 A;  4HSV A;  3PMF A;  3N52 A;  1BO0 A;  2ZXO A;  1I4Q A;  1EY0 A;  2HDM A;  3PO2 B;  4B08 A;  3QOL A;  1WD0 A;  1EIH A;  1CHQ D;  2F0H A;  2NVY B;  5ELB A;  2IX3 A;  2B2T A;  1S5C D;  5JAV A;  2EYP A;  4CGY B;  3QB3 A;  1AW7 A;  2K5Q A;  2A69 C;  1I4P A;  5BN3 A;  4FVM A;  2L9H A;  1B2T A;  2NBF A;  1BXT A;  2F3W A;  3W3A A;  4FXD A;  1CHP D;  1LO5 D;  2IWH A;  2K01 A;  1LLR D;  1YNN D;  4E6I A;  3D8G A;  1BR9 A;  2A6E D;  1SMY D;  1Q1E A;  1AFP A;  3SK6 A;  1KAA A;  2CW0 C;  2PO4 A;  5D65 A;  3A8I E;  1SE2 A;  4DK1 A;  4A3B B;  5JPM C;  3SVM A;  2F0Q A;  5FO9 B;  1WTO A;  1CQV A;  1OXT A;  3KUP A;  4A3D B;  1EY8 A;  3P1H A;  1MSG A;  4F87 A;  4BBS B;  4R8N A;  5HUR A;  2KQ3 A;  1FNU A;  1LT6 D;  4XT1 B;  4K2K A;  4RFB A;  4HSP A;  2R7Z B;  1ICW A;  1RCV D;  2F0I A;  1AZQ A;  2KCC A;  1OXS C;  3RMH A;  3KLS A;  1C8C A;  1GHJ A;  2EXZ A;  3Q22 A;  5KND A;  1HQM C;  2PW5 A;  4ZUI A;  5KRU A;  1G2T A;  4A3J B;  2RVL A;  1D5X C;  1PZK D;  5ISR A;  1PLF A;  2YYZ A;  4OO1 G;  5C0X H;  5IT9 E;  3S1R B;  1SE4 A;  5M3M B;  1HCZ A;  2E2J B;  1NUC A;  2DNE A;  2K1B A;  3S1Q B;  4H0L C;  5TSS A;  1U4P A;  1SBB B;  1DXM A;  4DXF A;  3K5N A;  3GV6 A;  1BUV T;  1X3P A;  4DK0 A;  1CZG A;  4BWG B;  2FJ2 A;  2PCF B;  4RGT A;  4OIK A;  1Y1W B;  3RUZ A;  2QKI C;  3DXJ C;  1OXV A;  3V2T A;  1BDO A;  1PRT B;  2I07 B;  4KTA A;  1J8I A;  1A2T A;  1XTC D;  3HS0 C;  2K5D A;  1V1P A;  3TZD A;  4KJO A;  1X32 A;  4L6T B;  1ESF A;  3HOW B;  2ID0 A;  4KJN A;  3MFG A;  2SEB D;  1ML0 D;  4DFA A;  1GUT A;  3D6W A;  1KLU D;  5T1I A;  2MJ8 A;  5C0X G;  3IL8 A;  3HGB A;  4RKL A;  2F0G A;  4TSS A;  5J39 A;  4DA2 A;  3MXP A;  4K8I A;  2NVQ B;  5IGE A;  1SFO B;  3CU7 A;  1KAB A;  2F0E A;  2L4N A;  1HA6 A;  4CKE A;  2NN6 H;  2WV6 D;  2EYO A;  1EOT A;  4WFN 3;  1ET9 A;  1GUS A;  4WRD A;  1B9N A;  5JEA H;  1M8A A;  4XDX A;  3SHL A;  5C3E B;  1V1P B;  2IW3 A;  2NYZ D;  3QIA A;  1NR2 A;  2D9U A;  2A73 B;  1Q8I A;  1EU4 A;  1QCB D;  2EZV A;  1TS3 A;  4YIJ A;  4NDX A;  1BCP C;  2XNA C;  4ZKB B;  3TP6 A;  4DNR B;  1F2Z A;  1W6K A;  1KDA A;  2EY6 A;  3E5S A;  3OSO A;  1EYC A;  4FXK C;  4BA2 I;  2JE6 I;  3AMU A;  3BDC A;  1JR0 D;  4M8A A;  1SNQ A;  4KHV A;  2G9D A;  4EGV A;  2ZXP A;  2NN6 G;  3G7L A;  3Q6S A;  4ILW A;  3A56 A;  3R3O A;  5JEA G;  2EJM A;  4J1M A;  1JWS D;  2J0T D;  1TQO A;  3KBX A;  4H44 C;  4RGN A;  1SNC A;  2F0O A;  3BZD B;  2F0P A;  3NK9 A;  1W6J A;  4AYB B;  4RGO S;  3M85 A;  2CVR A;  5BN5 A;  1JOO A;  4KN7 C;  1GUO A;  4QUC A;  5A2Q L;  1LTS D;  4L8J A;  4DXG A;  1SNM A;  2QEJ C;  2Z8L A;  1UAP A;  4WJW A;  1STH A;  2JXM B;  2BA1 A;  1LT3 D;  3EJI A;  3NE5 B;  1PRT F;  3NTK A;  3V96 A;  1D1I A;  2V4D A;  1ET6 A;  1TT2 A;  5EPJ A;  2EYM A;  1LTI D;  5M9O A;  1LT4 D;  3MXN A;  1ILQ A;  4KY5 A;  1F9R A;  2B8F A;  2BDO A;  5CC4 A;  3K59 A;  1QB5 D;  5KNB A;  5JJZ A;  2D5D A;  2JA7 B;  1Y8P B;  5FKA C;  1RJT A;  4RCN A;  1LTR D;  4CKB A;  2L11 A;  3SDZ A;  4EQP A;  4XQQ A;  1FGB D;  3PIO 3;  1AZP A;  4JBW A;  3AU7 A;  4R9W A;  4G7Z C;  1U4L A;  1G8Z D;  1ENF A;  4KN4 C;  4CBV A;  5K36 H;  3JAM E;  2KUM A;  1GUN A;  2A69 D;  4ODG A;  2K7V A;  3I91 A;  5FLX E;  3DEO A;  3CRK C;  5KYL A;  1FR3 A;  5I9P A;  2B2V A;  5HGT A;  2A5H A;  3EQL C;  2BE5 C;  4IUR A;  3I73 A;  1SSO A;  5ELF A;  1D6E C;  4ZK9 B;  1JOR A;  1H9S A;  2F1M A;  2CW0 D;  1F77 A;  1A3U A;  2ICE C;  2JP1 A;  4I7Z C;  1WTV A;  2F0T A;  3URY A;  3S2H B;  5EPL A;  4KY7 A;  1U4R A;  4G4K A;  2VB2 X;  1HTP A;  3OWF A;  3P20 A;  4DN4 M;  3PUZ A;  2BA0 A;  3FMC A;  3GTO B;  3OPO A;  1MSH A;  2RA4 A;  5K36 G;  1WCM B;  4ULL A;  3G6J B;  4C3J B;  3HOZ B;  4PV1 C;  1RTN A;  1R4P B;  2Q8R E;  4PQX A;  2IT1 A;  1HHV A;  2VB3 X;  2N88 A;  4Y7N B;  1G2S A;  3GTP B;  3MZ5 A;  1Q3L A;  4NW2 A;  2LY7 A;  1V43 A;  2JEA I;  2HCI A;  2M9V A;  4IZ8 A;  5I6Y A;  1WTX A;  3FDT A;  1A3T A;  4XYQ A;  1EY9 A;  5CV4 A;  1Q12 A;  2F0M A;  2IX1 A;  3P7J A;  5A2Q E;  1SYF A;  3L9A X;  5G3L D;  1B44 D;  1F2Y A;  1BBX C;  3IAY A;  3NXW A;  1G91 A;  2EPB A;  2ZXR A;  4QUF A;  4X3U A;  5C6A A;  3A7A B;  4FP5 D;  2QCP X;  3SK8 A;  2D2C C;  2NVX B;  1E2W A;  2WP8 J;  1ENA A;  3M7N A;  1CQF A;  2ENB A;  4UDU C;  4X3T A;  1I6V C;  2JEB I;  2EYL A;  3IKJ A;  3LNN A;  3I4L A;  5C0X J;  1TVX A;  2H1E A;  4HR7 B;  2YU9 B;  4IFD H;  1YNJ C;  2A74 C;  4HTH A;  3D4W A;  5KIX A;  4L63 B;  1ZKO A;  2K03 A;  3GTM B;  1DOK A;  1R4Q B;  3DM1 A;  1SAP A;  1SYC A;  1QWY A;  2I46 A;  4HMJ A;  3J81 E;  4F7X A;  2XRS D;  1SND A;  1STB A;  2B2W C;  1G29 1;  1JWU D;  2F0U A;  4IAL A;  4ZUJ A;  3CRL C;  1JOK A;  1XXG A;  2AQ3 B;  3OMC A;  3VR5 A;  1XYI A;  5LL6 X;  3PUX A;  4BY7 B;  3DWA A;  1C48 A;  2KJX A;  4MHE A;  4IFD G;  1KTK A;  2NTT A;  4OL7 A;  1PTO H;  4DAY A;  1BCP D;  2HQE A;  2MUY A;  3FPP A;  3P75 A;  2PZW A;  5C4X B;  3DHQ A;  2OT2 A;  3MFY A;  5FK9 C;  4GZY C;  5JEA J;  5IOC A;  1PTO C;  2ZT9 C;  4G7H C;  1EY5 A;  4QMG A;  4F8M A;  1Q1B A;  3E0J A;  3A55 A;  1SJE D;  1IHZ A;  3K5L A;  2R92 B;  1TKW B;  2M2L A;  3OWE B;  2F0W A;  4ID6 A;  2IL8 A;  2O5I C;  3X3M A;  5I2Y A;  5I9O A;  1I6H B;  3NP8 A;  5C0X I;  1FNW A;  2XSC A;  3MXG A;  2F0S A;  2RSO A;  4Q5V A;  3Q24 A;  1GHK A;  4DNT B;  1V8Q A;  2K05 A;  2PQE A;  1F2L A;  3O13 A;  3U9O A;  3Q23 A;  2AUK A;  4O42 A;  2J4X A;  5F2D A;  3K57 A;  2L1B A;  4OO1 H;  4RKB A;  3J80 L;  4H7B A;  5C5L A;  1SJH D;  2L55 A;  1Y8O B;  1ZEQ X;  4X3K A;  2B8G A;  2G9H D;  1TWA B;  4MN3 A;  3TP8 A;  2LFN A;  1TWG B;  3NBH A;  1OXU A;  1EY6 A;  1HQR D;  3QG1 A;  1E0B A;  1JB3 A;  3M7G A;  4HN7 A;  5IGB A;  1NSN S;  2NN6 I;  4KMU C;  1L0X B;  1FD7 D;  4A3K B;  3GTG B;  4Z9C B;  4DU9 A;  5J22 A;  1RKN A;  2WB1 B;  2EOT A;  1OXX K;  3HRZ C;  1HUM A;  5DAU A;  1B50 A;  2EY2 A;  2Z1C A;  4C3I G;  3L7Z C;  3FVQ A;  1JOQ A;  2Q8T A;  2DN8 A;  4MIU A;  1BOS A;  1TY2 A;  1EU3 A;  2NVT B;  4RHS A;  4A93 B;  2JA5 B;  2BE5 D;  3R93 A;  5CR3 A;  4ZYS A;  3K5O A;  4O1N A;  3MWY W;  1TS5 A;  1RDP D;  3ITP A;  1GXD C;  3T51 B;  2Q8I B;  5IGD A;  4RWS C;  1PMR A;  1Q90 A;  5E1F A;  2GA4 B;  2B2W A;  2IJ0 A;  3D4D A;  1STE A;  2EE1 A;  2FFK B;  4K5V A;  1QG7 A;  2Z4H A;  3OW7 A;  3FRP B;  1E2V A;  1SEB D;  1RTO A;  1CI3 M;  4UAI A;  1WTP A;  3HP3 A;  2R61 A;  5C3X A;  1AEX A;  3H0G B;  1HTL D;  2R3Z A;  3VA7 A;  4HCS A;  4KKT A;  1U9R A;  1T5E A;  1EYA A;  2F3V A;  3DUZ A;  4B9W A;  3MC0 B;  5CV5 A;  2R93 B;  1JWM D;  4HMI A;  4Q0F A;  2MPM A;  5CBE E;  1ZXT A;  1STG A;  1ESR A;  1J9O A;  4DGZ A;  4OGQ C;  1PZJ D;  3KLS X;  1SYE A;  1KNE A;  5KGU A;  4RGM A;  1TWC B;  1D5Z C;  1BNZ A;  1LTA D;  5FOB B;  5T1G A;  1PFB A;  1DON A;  3T16 A;  1F9Q A;  2KCN A;  1DZ1 A;  1G6Z A;  2FMM A;  2VUM B;  4ABN A;  1CA6 A;  3J7Y W;  3NHH A;  1S5F D;  4RCO A;  1YNJ D;  4A3M B;  3NUC A;  3H6M A;  3M4O B;  4NKL A;  4OHJ A;  4K2L A;  3VR3 A;  5LL6 S;  5C5M A;  1H9K A;  2D62 A;  2CQA A;  3PIP 3;  2A68 C;  1EEI D;  1AP0 A;  1TR5 A;  4K6D A;  1CA5 A;  4C3H G;  4G57 A;  4BY1 B;  3I3C A;  3IFD A;  4XXE A;  5IGF A;  2WIN B;  4ME5 A;  3M3Y B;  3TBI B;  4QF4 A;  2WII B;  2BCO A;  5I4D A;  2RBM A;  3K6O A;  4IFD J;  3H94 A;  1DM0 B;  3T53 B;  2A6E C;  1EZ8 A;  2AWO A;  1STN A;  2PMZ B;  3FKI B;  3PUW A;  3A54 A;  1EEF D;  1IW7 C;  4XTC S;  3T13 A;  5K5P A;  2AUJ D;  3UI2 A;  4FXG C;  4N9P A;  1SNP A;  1D5M C;  4ZAI A;  1BQQ T;  4C2M B;  4H13 C;  3S14 B;  2B2U C;  2OF1 A;  4F88 A;  1TY0 A;  2E74 C;  1PTO D;  3BYT B;  1JE4 A;  1EQV A;  1PFN A;  3GTL B;  2VXW A;  1DOM A;  2K5W A;  2TSS A;  2B2Y C;  1VMC A;  1F9P A;  3GTQ B;  1UUP A;  3SEB A;  1EWC A;  2AQ1 B;  3U9S A;  5COR A;  3RD4 A;  3WOE A;  2KOL A;  3IFT A;  1KDB A;  1TU2 B;  1CK1 A;  3HEJ A;  1TII D;  2VNU D;  1JQY D;  5DM7 3;  3GQB A;  2NUC A;  3K58 A;  1VDZ A;  4DAV A;  3MAQ A;  1STY A;  3MVV A;  3VR6 A;  5JOB A;  2L5T A;  4U68 A;  3T4A C;  1I3Q B;  3F2U A;  4CHT B;  3TDQ A;  3LWU A;  1GUG A;  3RLF A;  2RDF A;  2DY8 A;  1EIG A;  2XVS A;  4IFD I;  2B2T C;  4K5W A;  3S1M B;  4R8I A;  3J7A V;  4LK1 C;  3HKZ B;  4IQZ A;  1DOL A;  1PTO F;  1S4Z A;  4EVO A;  5C4J B;  3CQZ B;  3KK7 A;  2O2L D;  2Z4I A;  2XWB B;  3KF8 A;  1S5B D;  3SE0 A;  3CHB D;  1H9S B;  5CV9 A;  1XX8 A;  3BDO A;  1PYW D;  2LKV A;  4C1N I;  1Y8N B;  4XT3 B;  3DMU A;  1B3A A;  1XWE A;  2RQX A;  3MEH A;  2FHT A;  3A8K E;  3GV3 A;  1A6X A;  3CKI B;  3QWN A;  3SK5 A;  5M3F B;  4TKO B;  2KED A;  1PRT C;  5COY A;  1BCP B;  3MHB A;  1JIC A;  1II3 A;  2JYO A;  3DWP A;  3HOV B;  5IIF A;  4CKC A;  1DCZ A;  4HED A;  3KLR A;  2E75 C;  1SNO A;  1D2B A;  2X6G A;  4A3F B;  2EYF A;  3QOJ A;  4KY6 A;  2E2D C;  2SNS A;  4K6L A;  1H9M A;  3ERQ A;  1IYU A;  2HCC A;  3BDL A;  1DD2 A;  4U67 3;  3Q0A A;  5EBC A;  1QIL A;  2A6H C;  3H91 A;  1O7Z A;  1C4Q A;  1LV9 A;  2EVB A;  1WD1 A;  4RHR A;  1MBY A;  3C46 A;  3RZD B;  5FO7 B;  5IT9 L;  3I4M B;  4IUP A;  3HG9 A;  1WVL A;  2EYJ A;  4ZQ3 A;  4OO1 I;  5G3L F;  1ILP A;  1AN8 A;  4BBR B;  1TWH B;  4KI0 A;  5E3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...