1S5FD

Cholera holotoxin, crystal form 2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
103
structure length
103
Chain Sequence
b'TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cholera enterotoxin, A chain
publication title Crystal structures of an intrinsically active cholera toxin mutant yield insight into the toxin activation mechanism
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transferase,toxin
total genus 23
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1s5fD00
1HXYD 4RHRA 1S5CD 1LO5D 3BVGA 4BWGB 5D3DA 1LTGD 1STEA 3BYYB 3DWAA 5TSSA 1PRTB 3TSSA 3BYTB 2J4XA 1D5MC 1M4VA 2AQ2B 1PRTF 3O13A 4C56C 1G8ZD 1RD9D 1LTRD 3R8BA 1EEID 1KTKA 3R2TA 2XRSD 3MC0B 1XXGA 4DXGA 1CT1D 1RCVD 1S5FD 1TS4A 2NTTA 1L0YB 1DJRD 1PZID 1I4HA 1ET9A 2O2LD 4RGOS 4RH6A 1I4GA 4RGMA 1PTOD 4RGNA 1I4QA 1CHQD 1ENFA 4RGTA 2TSSA 4UDUC 1FNVA 4Z9CB 1JQYD 3W2DA 2IJ0A 1LTAD 1JWSD 3V05A 1TS3A 1F77A 1PYWD 1LTBD 3DWQA 1PTOC 2XNAC 2SEBD 4OHJA 1PRTD 1EWCA 1SEBD 1V1PB 5ELFA 2QILA 1AN8A 1HTLD 1BCPD 1FNUA 1HA5A 1S5ED 2RDGA 4K6LA 4L63B 4RCOA 5ELDA 1SE2A 1DYQA 1JR0D 1CHPD 1D5XC 2Z8LA 1SXTA 1S5DD 3BVMA 4RFBA 5I4DA 1HQRD 1RDPD 1EU4A 1BXTA 1KLGD 1D5ZC 1SE4A 2G9HD 1SBBB 4TSSA 1ESFA 1PRTC 3EA6A 1EEFD 1I4PA 4L6TB 3SEBA 1AW7A 1BCPC 3R2IA 5ELEA 1TS5A 1XTCD 2AQ1B 1LT6D 1V1OA 1KLUD 2IPKD 1FD7D 1LTID 5ELCA 1TS2A 2RDHA 3DWPA 3CHBD 1EU3A 3BVZA 1I4XA 1RF2D 1UUPA 4O1NA 1FGBD 1TY0A 2ICIA 1SE3A 1B1ZA 1LTSD 3EFXD 1I4RA 1JWMD 1FNWA 1V1PA 5ELBA 1LT3D 4ZYSA 1QILA 1CQVA 1JCKB 4RHSA 1PZJD 1PTOH 1T5XD 1LTTD 2XN9C 1LLRD 1CK1A 5FKAC 1BCPB 1ET6A 1GOZA 1EFID 3BZDB 2NTSA 3MFGA 1BCPF 2CHBD 3OWEB 2WV6D 1S5BD 2XRQD 1UNSA 3GP7A 1LT5D 1PTOB 2QEJC 2AQ3B 3KLSX 4DXFA 5FK9C 1MD2D 1JWUD 1PTOF 1L0XB 1PZKD 2R61A 1D6EC 1SJHD 1SJED 3URYA 1B44D 5D3IB 1LT4D 1TY2A
chains in the Genus database with same CATH superfamily
1HXYD 1YVCA 2NWGA 3SK5A 1STEA 4ALPA 1EL0A 3BYTB 4AYBG 2Z6KA 4OONA 2F0JA 4DR6Q 3KOJA 4IZ8A 3S1RH 3A8KE 2UXDQ 1QVCA 2H4OA 5M5XH 3U9OA 1L1OC 3GTPB 4PZ7A 1HR0W 1WTOA 2EY5A 1TS4A 4XQQA 2B2YA 2C35B 3S15H 1I50B 4LF7Q 1WOCA 4RGNA 1CHQD 1W6KA 1YJNA 3RN5A 1ENFA 3MXUA 1HZBA 2LXJA 3KDFA 4QJFA 4I7AA 1DM0B 1KAWA 4KI0A 3EN2A 3TEHB 1XNQQ 1NR4A 4EVOA 3EIVA 2F0DA 2VL6A 3NHHA 3I3CA 3ND8A 1PRTD 3JC66 2QILA 3FKIH 3T1YQ 4JI4L 3G71A 4GLXA 1X55A 3I55A 3I7FA 5JJIA 2JP1A 3M4OH 3CCQA 1LABA 3K59A 1CKNB 2JEBI 4IPHA 1PVOA 5JJLA 1GUOA 2B2TC 1II3A 3CAMA 4OXPA 2AWNA 3F2DA 1WFQA 1XTDA 1LT6D 1CKOA 1HNZL 2N78A 1K3BC 2HDMA 2B2UC 4C3HG 1RF2D 2Q8IB 2FHTA 4IPCA 3QOLA 5A2QE 2B2WA 1V1PA 2R92B 4LFBL 2D0PA 1BBWA 3C2PA 4E6IA 4HJ9A 2ATWA 1Q8IA 3TBIB 5C44G 2UUAL 1DONA 4TRDA 5IYBG 4OO1I 1EOVA 2BOSA 1PH8A 2E2HB 3MFGA 3GTQH 1U4PA 4A3CG 2O5IC 1UNSA 2YTXA 1IBMQ 1NMFA 4LF4Q 1PZKD 1WI5A 4L5SA 3URYA 3KF8B 1Y8NB 4OIKA 5H1SE 1SR3A 2JA8G 2K28A 4A3IB 1GD7A 3BYYB 4WORA 4DAYA 1N32L 1M4VA 4R4QA 4WRDA 1G8ZD 4R9WA 2NVQB 1KHIA 1LTRD 1AE2A 3MZ5A 3NBHA 3MAQA 2E75C 2L0CA 3HS0C 4HJ7A 1G91A 1DJRD 1N33Q 3HOVH 3E9IA 2HQEA 3UDFA 1M8AA 2NZOA 4LFAL 3H09A 1LUZA 5EPKA 2L9HA 3FEWX 4GNXA 5IP7G 4BXXG 3W2DA 1V9PA 5M3FG 4OIJA 5CV4A 4DKAC 4MIUA 3OIQA 4DNTB 3L9AX 4Y52H 2FINB 2F0EA 3M7NA 1PTOC 1L1OB 4A3MH 1EIFA 4DR4Q 3HKZG 5IGBA 3MXPA 1BCPD 4A3JH 1EYCA 1DOLA 1SXTA 3BVMA 3HZXA 2Z6KC 2SNSA 4MN3A 1Y1WG 4JI7Q 1SAPA 3VA5A 1PH2A 2F1MA 2N55A 1Q3LA 4DV2Q 2R93G 4YWMA 1CFMA 3CHBD 3BVZA 3KYHC 4O1NA 3U50C 1SE3A 3J7AV 4ID6A 2K33A 3FDTA 2NZHA 5EKIA 2QW7A 2ZXPA 2R7ZH 1YNXA 1YNNC 4JC0A 3GTJB 4HCEA 2B8GA 3K58A 5CBEE 4B3RL 1LTTD 3MEHA 3A0JA 2JA6H 1KIXA 1IL2A 1PDQA 1HUNA 3I4NB 2WAQE 4CHTB 1YIJA 5E7NA 2E74C 4DA2A 2A68C 5IOCA 4S3SA 5C4ZA 3P7JA 1S4ZA 1CZWA 3N52A 4MZ9A 2IX1A 1D1KA 1SFOB 2Q2UA 5KGUA 1B2TA 1Y8PB 4BY7H 3JAMi 5JJKA 1H9KA 3OIPA 2EJMA 3HG9A 2F0PA 1TR5A 3NK9A 1M90C 3TSSA 3GD7A 3STBD 1K8AC 2J4XA 4P75A 1HZCA 2A6HC 5FO7B 2JA7H 5DEHA 3OW7A 4QGUA 2B63H 1W3SA 3S1QH 4I65A 2RSOA 1VQ6A 2B29A 5JPMC 3T13A 4CDFC 4IFDI 2B2WC 2K04A 4KLKA 2WB1G 3ER0A 2NUCA 4QB4A 1CKMA 1STYA 1WCMB 2MO1A 4QIWE 4JK1C 2MP1A 3PIPA 3PO2H 2OXPA 4HN7A 1N34L 2CW0C 2MNAA 4KD3A 1SMYD 1EY9A 2NB0A 1BQQT 3J80i 2K5VA 1EQTA 1GJXA 4C2MH 1QG7A 3GTLH 4KY6A 4Q0FA 4OHJA 5GROA 4AYBE 3OTOL 1SEBD 1HNZQ 1Y69U 1MHWC 2MGSA 1C9OA 5E4WC 1KRTA 5ELDA 4QUCA 4GLAC 4DNIA 3HOUH 4A3GH 1HFNA 3T53B 4KHVA 2BE5C 4KKUA 1QCBD 4LAAA 3K0YA 5IGGA 5CV7A 1SBBB 3LGJA 4R8IA 2EYHA 3D4RA 3EA6A 3ULPA 4LFBQ 1VQ8A 2E2JH 2DGYA 5LMNL 5LL6X 2UUAQ 4DGZA 2EY1A 1NCVA 3BS1A 1WTRA 1A15A 1QNKA 2B8FA 4V190 2HD3A 4BA1I 3SVMA 4TVAB 3A5UA 2R92G 5LL6S 1EIYB 1SLJA 1AH9A 2KENA 3CCEA 1DZ1A 2Q2IA 2NVXH 3ZJYC 3PUVA 4GKJL 2JXMB 5FLMH 3LX0A 1Q46A 4O2DA 1KAAA 4GS3A 1N32Q 1IYUA 1RTNA 3HOWH 5JEAH 1I94L 3QIAA 1PTOF 1PYSB 2JYOA 5KEEA 3I4LA 3KDFB 1S3OA 2VQEQ 4A3IG 2RBMA 1VQMA 1ML0D 1S5CD 4JOIC 4K6DA 4TQUS 2PI2A 1B9NA 3U9SA 2E2DC 4LFAQ 4A3FH 1A8VA 5C4XH 3RZDB 3J7ZC 5I9PA 3PIP3 1AFPA 1CTMA 4A3KH 1BOSA 4WJ4A 3NTHA 4DU9A 1NE3A 4KHPQ 1WTQA 5FOBB 1WD1A 1ET9A 4NDXA 3F8TA 3IKJA 3GTKH 2GVAA 3K81C 1X54A 1X56A 2BA1A 1O7YA 1SNOA 3E0JA 4ULLA 3IAYA 4BS9A 2IY5B 3S2DB 1Z47A 1UE7A 1QZHA 4RKLA 4DR2L 5C5LA 1H9MA 5IP9G 3GO5A 2LY7A 1BBXC 3GTMH 3J81c 4HIOA 1V1PB 3D3RA 4P73A 3AU7A 1VF7A 1FNUA 1HA5A 4B3ML 2VUMB 1SE2A 2R7DA 3Q24A 2A69C 2EIFA 4LW1A 1CHPD 3RNUA 2M9VA 4LJZC 1HA6A 2DUDA 3U4ZA 1PMRA 1RDPD 1VF5C 2CWPA 2N3SA 5J22A 2I5MX 4C3HH 3N6RA 4IALA 5C4JH 2ZTEA 4XXEA 1BUVT 2UXDL 1ASYA 5EQ0A 4XQJA 1HNXL 1NUCA 4NXML 1LTID 5ELCA 3VR2A 1F2MA 1EU3A 5C3EB 3GTOB 1TY0A 1I3QB 5C44H 5M5YB 1TVXA 5IYBH 1QE6A 4DAYB 3HOYB 4A3EH 5IGFA 4A3CH 4Y7NB 1XNQL 3I4NG 1MI2A 3HKZE 4LMQD 3UDIA 2F3IA 5G3LF 4N8X1 3NBHB 4IUNA 4JVZA 4IUQA 2I07B 3H6MA 1LT5D 3RUZA 3CKIB 2NZ1D 2MHVA 1E2WA 2DY8A 1VQOA 4LWCA 1FGUA 1STGA 3I2ZA 2EQSA 4GN3B 1TWGH 5IYDH 5C0XI 4GNXB 1RODA 1CQFA 2BA0A 1G291 1AZQA 4J1MA 3LWUA 1HUMA 4DAPA 2B3GA 1N34Q 4ZKCB 1OXVA 2FFKB 2DN8A 3RMHA 1VQJA 3VR3A 4K14A 3RZOH 3LNNA 2L12A 2IX3A 1RL2A 1WCMG 1GKHA 5IP7H 4BXXH 4CKBA 3K6OA 4DUZQ 3OTOQ 5FLXL 1IL8A 1AE3A 1SMXA 4H7BA 3H15A 2RSNA 4HMIA 2XVSA 2K50A 3D0FA 1WJJA 4H44C 4WFN3 1JB3A 2B2TA 3S14H 2O5JC 4LF4L 3VR5A 1V1QA 4IFDG 2L15A 5LMNQ 1K0SA 1LTLA 2K4KA 1BKBA 4A3BB 1PFMA 2PW5A 1Y1WH 3CXCA 1B9MA 3K5LA 2VQFQ 1DD2A 1BNZA 2HHHL 3I90A 3QO2A 3HOXB 5I4DA 2R93H 2KVMA 2A73B 1ESFA 2F52A 2WB1E 3PSIA 3SEBA 5CV9A 5I6WA 2RCFA 3FPUB 4NP5A 2AWOA 1UAPA 2F0HA 2X6GA 1GM5A 4GKJQ 2K52A 2YTYA 3HGBA 5IT9E 1C8CA 1K28A 2NN6I 3DM1A 2V4DA 1N33L 1YBYA 3VR6A 2OF1A 1DCZA 1XJVA 2PQEA 1A3VA 3OHXC 3ULJA 3UDGA 1ENAA 4BBSH 3LWEA 1ZYRD 5FKAC 1I6VC 3PIOA 2DJGC 4POGA 4DR4L 3S9WA 1W2BA 5FK9C 1MD2D 3MHBA 1GHKA 3BDLA 4IUTA 1VQAA 4K5XA 1R9TB 3FMCA 4M8AA 4JI7L 4FF1A 4K8JA 3DHQA 1WTHA 1HRJA 2K5QA 4ABNA 2PZWA 1KQSA 4DV2L 1K73C 4IOAA 5JVG3 4DN4M 5E4XA 4DV3L 1KABA 3O13A 4L5QA 4L5RC 2IL8A 1RD9D 5EBDA 1N36L 3GDEA 4DR2Q 4A3DB 5KNDA 1SNPA 3OMGA 1S5FD 2E2IH 2NTTA 4FDBA 1L0YB 2KJXA 1PV4A 1X3PA 2DNEA 4RGMA 3U58A 2RA4A 4B3MQ 1OXUA 3ERSX 1DOMA 1STBA 1F2YA 4UDUC 2BDOA 1VQ5A 2D0OA 1G6ZA 1GO3E 2MFIA 5IE8A 4XT1B 3DWQA 3E6ZX 3WOFA 5EKKA 1HNXQ 1HCZA 2F0FA 2JSOA 5F2DA 3K5MA 2VUMG 4NXMQ 3EQLC 3FP9A 3OSOA 2RDGA 1A3TA 4ZQ3A 2SOBA 4L5TA 1YJ9A 1U0LA 4RG1A 1ICWA 1STAA 3A54A 3F2BA 1Q82C 1STNA 1EU4A 2JN4A 4FF2A 1Q1BA 1IZ6A 1AW7A 3CCJA 3R2IA 4PG3A 1TS5A 1HZ9A 3RN2A 5C3EG 2R92H 3L0OA 2OTJA 4IPGA 2Z0SA 1CA5A 1JC7A 1FGBD 4KJNA 3EFXD 4CKCA 1TWCH 3HOZB 3PIO3 3HOYG 3NENA 3JAML 2E2HH 4HIKA 2KUMA 2EJFC 1SNCA 5LMNW 2RCNA 1R4QB 2F0OA 5K36H 4BY1H 1LM0A 5EKLA 1U4LA 1N8RC 1BCPF 3M4PA 3R93A 3J7AF 3VDYA 2JA5B 2O4XA 3CC7A 4QQBX 1O7ZA 1RKNA 3GP7A 2A8VA 1E2VA 1X6OA 4A3IH 1XYIA 5K5PA 1PH3A 1XNRL 2QDLA 4B9WA 2G5DA 4DV4L 3SK8A 5M9OA 3GQBA 3NELA 4PMCA 4JBKA 3M85A 2NVQH 2QGQA 1QVFA 3BVGA 2SDFA 1D7QA 3DEPA 1SNDA 2TMPA 3J80L 1TXYA 1VDZA 3ND9A 2KHIA 3S15B 4RA8A 2JJQA 1J6QA 3KLSA 4X3UA 1GUTA 2HCCA 2Q2TA 4KV6A 1ZXTA 3S1MB 4CDEC 3CC4A 2PZTA 4RGTA 2TSSA 2NBFA 5FJ8H 3J81i 2HHHQ 4Q5VA 3F2UA 5IGDA 1NTGA 1LTAD 1NNXA 3M4OB 3VYSA 1HQMC 1XWEA 5D65A 2SEBD 4DK6C 4A3BG 1O7LA 4MHEA 4KTAA 5CV6A 1J8IA 4P72A 1LV9A 4K6LA 2VQEL 5M5WB 4X62L 2A1AA 1X3EA 3HOXG 3GV6A 2FXQA 3MEFA 4IO9A 2OEOA 2EXDA 1VQLA 3J80E 2F0UA 4U673 1EEFD 2EYJA 3ZYYX 2ES2A 2RHQB 4DK0A 5IWAL 4FF4A 2ALYB 2DNCA 4K2LA 4A4IA 4GN4B 1UEBA 4KHPL 4H02A 1NSNS 4UP8A 3CP0A 1V43A 2BCOA 2ICIA 3ERQA 1G6PA 3MFYA 3V96A 4JV5L 4X6AH 1L0WA 3I4NH 1EQRA 1YHQA 1X32A 3KF6A 3ONAB 2RQXA 1C48A 3OWFA 2K01A 1NBWA 5COYA 4JI2L 4FXKC 4DV5L 4K5VA 4JI3L 1LLRD 4IFDJ 3CRKC 3PF4A 4ZCKA 2F03A 4JOIA 4OWWB 2L55A 3T1HQ 2HIXA 4LF9L 4OGQC 5LHY1 3I72A 4DV3Q 1W6JA 1K83H 2KCCA 3S16B 2R61A 2JK8A 1SJHD 1JMCA 2EY2A 1N36Q 1A3UA 5KNCA 2A6EC 2K32A 4DFAA 2F3WA 1JOQA 3IFTA 2AKWB 1R4PB 4X3TA 3DWAA 3IRBA 1FR3A 2KHSA 4J6HA 3NEMA 4NW2A 1U5KA 5CC4A 2KCTA 1KTKA 3R2TA 4RMFA 3K7AH 3PO3B 4A3DG 2PO4A 3MC0B 3S24A 1B4OA 4IURA 3KBGA 3E3XA 1ICFB 1TU2B 3SK6A 1I4HA 1EYGA 4C1NK 3ULLA 3VYUA 3HFZB 1WTWA 4A3MB 2BH2A 2C9OA 1CI3M 3UI2A 2B2VA 5J39A 1WVLA 1ILPA 1K0RA 2IJ0A 1MGSA 4IFDH 1CSQA 1PYWD 2SNMA 2K5WA 2IX0A 4UP9A 5GAHC 1S5ED 2KEDA 2R6GA 3AFQA 4F7XA 5KRUA 2AMCB 4APVA 4LUVA 2C5CA 5I2XA 2PZUA 2F0KA 4RKBA 2R7ZB 3A7LA 1CM9A 4BBRH 3RD4A 1ZEQX 4I7ZC 2XGTA 2AQ1B 1I5FA 3NUCA 1STHA 4IPDA 3OOCA 1F2LA 1IW7D 2JA6B 3P20A 2MUYA 1TWAH 2CWAA 3HOZG 4DUZL 3M3YB 1Z7TA 1LTSD 4KJOA 1SNQA 4G7HC 1Y1VB 2EVBA 2CCZA 1IHZA 1XNRQ 1FJGL 4DV4Q 1T5XD 3HP3A 2ZTDA 2D62A 4HEDA 2UUBL 2H1EA 2VNUD 5IIFA 2JA5G 5KIXA 4DR3L 1Q7YC 1OTCA 1PTOB 2I5HA 4DR1L 1EYDA 4DXFA 4KKSA 4KN7C 3BU2A 2VQFL 1YNJC 2JA7B 4AQYL 5IY0A 2KHJA 3CC2A 2B63B 3H94A 2UXCL 2Y0SB 4X64L 3S1QB 5DM63 1TY2A 1JICA 4QMGA 4HJ8A 3GV3A 4HAEA 1TWFB 3ITPA 1RTOA 4FP5D 4NPSA 1D5MC 3CF5A 5LMUQ 1XX8A 4HSVA 3G6EA 3AMUA 2F0LA 4V0BA 1EEID 1KNAA 4N9TA 5IYCH 3EBEA 4GOPC 1KC8C 3SHLA 2E8GA 4C3JB 5BN4A 1RCVD 2N8NA 5BN5A 1E2ZA 1EY6A 5C6AA 1QNUA 1VQ9A 4RGOS 5EAYA 2J0TD 3GTLB 2VZAA 4FO2A 1QZGA 5IT9c 3I56A 4X62Q 1K8GA 4DK3C 4LUOA 3TP7A 5KYIA 3VYRA 4Z9CB 2HT1A 3HOUB 4OO1G 3J7A5 3QG1A 3C1FA 3M4YA 1F77A 1IXRA 4DPGA 4EQ5A 2UU9L 1VQPA 4JW0A 5IWAQ 5EBCA 1UE1A 4DAVA 2ZM6L 4JBMA 1EWCA 2E2JB 4QUFA 4HJAA 3K8AA 2F0TA 4RCOA 4YCUA 1WD0A 1D2BA 3G48A 4PMBA 3I70A 2EYMA 4JV5Q 1IBKL 4LNQA 4RFBA 2Z9HA 3RR5A 4B3TL 3AEVA 1C0AA 1PH5A 4XIGS 1PRTC 5C3WA 4JI2Q 2F0NA 4DV5Q 5M5YH 4JI3Q 2KOLA 5GQOA 3I4OA 1NR2A 1CUKA 1KLUD 1NMGA 5C0XJ 2NVXB 1IKMA 2L1BA 3QWNA 4XT3B 3CMAA 2I5LX 3EVQA 3X3MA 2X69A 2K1BA 4LF9Q 2LSSA 1MJEA 2IHEA 3B6YA 3PGZA 1Q8KA 4NB3A 4ZYSA 2B2VC 1F9QA 3S2HH 3TMEA 4HSPA 3TZDA 2CQOA 4LFCL 1EFID 4HIMA 3TP5A 1RJTA 5DAUA 2WV6D 2K5DA 3S17B 3FVQA 1VQ4A 4JI8L 2K03A 2AQ3B 5DLQE 3GTGH 3M9BA 3MWYW 2NVYH 2PW7A 4A3FB 5C4XB 4YWKA 5JAVA 3I91A 2MO0A 2BDNA 5CMDA 1B3QA 1MBYA 5AFWA 4N8FA 4CJ1B 4A3KB 3ICEA 3D4DA 5TSSA 3C1EA 1X9NA 3RLFA 2XWBB 3GTKB 3PO3G 1ASZA 2BH8A 1X3GA 4K8IA 2AUJD 3P1HA 4RAUC 3S1NB 2UXBL 2JA8H 3OPOA 4MNOA 3P75A 2HUGA 4A3MG 3L2PA 3GTMB 3MXGA 1PTOD 1JJCB 4CBVA 2VW9A 5T1IA 3D4WA 4JI1L 2UUCQ 5ELOA 1EY0A 3Q23A 1GHJA 1LYLA 3KF6B 3DEOA 5C4JB 3H91A 3BDOA 4JI0L 1Q81C 1J5EQ 1JR0D 4B08A 4FNFA 1KDBA 5M3FH 2KA7A 1SE4A 4H13C 2R7ZG 2Q8RE 1TWHH 1FJGQ 1YNND 2F0SA 1MJCA 2H5XA 2F4VL 1BCPC 2EDGA 4ZUIA 1QUQA 1PH1A 1DXMA 2JA6G 4A3EB 1BVSA 2UUBQ 1RIPA 2CH4A 1FYCA 3KFUA 1I4RA 4DR3Q 1Y1VG 2HDLA 1JWMD 5JJZA 5JVH3 1FNWA 4DR1Q 1G2SA 3D6WA 2A68D 1GVPA 5ELBA 4EX5A 4EQOA 3A5ZB 1V8QA 4AQYQ 1EIGA 3I4MB 4X64Q 2UXCQ 3Q6SA 3IL8A 1TWGB 4C3IB 2EOTA 1GOZA 2YU9H 3VA7A 2XRQD 5I2YA 1YZ6A 2JA7G 5HGTA 5HURA 4X66Q 4X65L 2B63G 2A6HD 3TS0A 2Y0SG 3M7GA 1SJED 1YHBA 3OW2A 5FLXE 4KMUC 4K0KL 1MKHA 3RZOB 2PYKA 4DV6L 1RHPA 1I6HH 1MSHA 4YCWA 1EZ8A 3KLWA 3J81L 4A3DH 5IODA 5A35A 1PRTF 1A2UA 2PI2E 1EY7A 3NQTA 3H3VH 1SYFA 1JE5A 4JCVE 2CW0D 5G3LD 5JOBA 4B3SL 1QWYA 4C3JG 3CCRA 1OO9B 2IHFA 2VB3X 3STBC 2UU9Q 2DY7A 3S14B 1O80A 2G9DA 2ZM6Q 4DR7L 3PQIA 4LF8L 1VMPA 1I4QA 2EXZA 2LKVA 5CGKA 3HOUG 1K8MA 3NWTA 1PFNA 3T1HL 2V1CC 1XMOL 3D8GA 4G4KA 1IBKQ 3GTPH 2VY3A 3A56A 4DR5Q 4B3TQ 1A0IA 2BE5D 2RKSA 2D5DA 5KYLA 4NKLA 1I50H 4R1JA 1EWIA 5M3MB 3DMUA 2XIWA 1Q90A 1SMYC 2EY6A 3CCSA 3SXHA 1E1TA 1SDFA 4M1UB 1S72A 3DUZA 3R3OA 4R4TA 4ODGA 3QOJA 4JPBW 4O0AA 3H0GB 1SROA 2NVTB 1KD1C 1S5DD 1B53A 5HY6A 1CSPA 3CQZB 4L6TB 4LK1C 3F1ZA 1MIUA 1C7YA 4LF5Q 3HOZH 1WYDA 1SYDA 1XTCD 3CCLA 2E76C 4IJHA 4BBSB 1JOOA 2IPKD 1FD7D 3G6JB 2KBNA 4YY3L 4LUZA 4LFCQ 1JJGA 1PXUA 3QJYA 1Q1EA 3QR8A 4C1NI 4JI8Q 5JEAG 5E3FA 1PFBA 3PMFA 1LT3D 2JA5H 2EPBA 1PZJD 3UDXA 4UAIA 2XN9C 4O42A 1BCPB 2OCEA 3C46A 4DV1L 1KRSA 2ZXRA 3TS2A 3VR4A 1G2TA 1B8AA 3OWEB 5GADC 3SDZA 1EFWA 4A3FG 5C4XG 2M2LA 4EQPA 1NJIC 5A2QL 1JT8A 2WB1B 4FXDA 4HR7B 4PQXA 2ZTCA 1EIHA 4A3KG 4A93B 2UXBQ 1VQIA 2ZT9C 1PLFA 1H9SA 2OQ0A 4OWXB 2CFMA 2E2IB 4QCLA 3AQQA 1AZPA 2JEAI 3TP8A 4R4OA 4K5WA 2JQOA 3S1MH 1T5EA 2FMMA 4IJLA 4JI1Q 2PMZB 4BA2I 4DXGA 2RHSB 2KQ3A 1VQNA 1CT1D 5E1FA 2JA9A 4CJ0B 1F9PA 4OO1H 3S1RB 1OXXK 3T51B 3I8ZA 1X65A 4G7ZC 5M5XB 4JI0Q 4KN4C 3NWSA 3CCVA 1JQYD 2ENBA 4YWLA 3C3LA 1BR9A 1B50A 2A69D 5C3XA 3Q0AA 5M5WH 5ELNA 4PMWA 1WTPA 2F4VQ 1L2FA 5J1ZA 1SNMA 4AH6A 1JE4A 5ELFA 1AN8A 1HTLD 5CV8A 2PQAA 1DYQA 1U4MA 3JAME 5C0XG 2F0QA 4OX9L 3DLLA 2F0GA 4CDDC 2D2CC 1D5ZC 3E5SA 2WFWA 4WJWA 2G9HD 5LMUL 1TWCB 3FKIB 5IP9H 4R8NA 4A3EG 1HNWL 5AJ3L 1HZAA 5BN3A 1YJWA 3KLRA 4BY1B 2Z6BA 2KCNA 1I4XA 4R4IA 4YHHL 1EYAA 2F0MA 4H0LC 4JYAL 4ZAIA 3KK7A 1UWVA 3Q8DA 1A63A 2X6LA 3FHWA 1SRUA 4X65Q 1FL0A 3I4MG 3HRZC 4B9XA 1WTVA 5IYDG 4K0KQ 4C3IG 1CK1A 4GZYC 3S16H 2OWOA 4DV6Q 2GN5A 4PZ8A 1N9WA 3HKSA 1VMCA 2VXWA 2Z1CA 1E24A 3GTJH 1ZKOA 3A55A 4KKTA 2PNHA 4GLVB 3K80C 2ZXOA 1X3FA 3PUZA 2ZJQA 4B3SQ 2R3ZA 1EQQA 4GOPA 1B44D 3GTQB 1LT4D 4RCNA 4FYDA 4RHRA 1EY5A 2Q2HA 3T56B 2K5HA 3PO3H 4DR7Q 3MXNA 4JI5L 4LF8Q 5BR8L 3G7LA 2QCPX 1TQOA 1SFOH 2EYFA 1XMOQ 4DV7L 5EPLA 5C4HA 2QF7A 5EGTA 1IBLL 3BJUA 5DNFA 3CCMA 2NN6G 4FVMA 5FO9B 4CKEA 2R7FA 3NP8A 2IWHA 2A19A 1ILQA 1PZID 2ICEC 2P5ZX 4RH6A 1KL9A 3WDNA 1VCIA 4P71A 1QUQB 1MSGA 2VB2X 2Y0SE 4GKKL 3OMCA 3BZCA 4HIDA 5CYUA 3HOVB 3RLNA 1WCMH 2QA4A 5M3MG 5ISRA 2B2YC 1SSOA 1XPRA 4XDXA 1HH2P 1C4QA 1VQCA 4YY3Q 3H0GG 1PFSA 1IKLA 1F9SA 2HCIA 3EJIA 4J15A 3TDQA 3TRZA 2NYZD 2Z8LA 5CV5A 1HQRD 2K7VA 4TSSA 5D14A 1JORA 3M3YH 2E5LL 2GVBA 2YV5A 1K8OA 4BBSG 4A3JB 1Y1VH 3W5OA 1BO0A 1GUGA 4HJ5A 2F0WA 3FPPA 4DV1Q 4ZLTF 1Z6HA 2XTIA 3I73A 2FJ2A 1OXTA 3DM3A 1E3PA 4XYQA 1O7IA 1IYJB 1E1OA 4R4CA 4XQNA 4P74A 1CQVA 4DF7A 1K83B 1PTOH 4YIJA 2UUCL 3HEJA 2F0IA 1QVGA 3BZKA 3VYTA 5KNBA 2EYOA 3A74A 1U9RA 4ZK9B 4FF3A 4L8JA 2HQLA 1TWFH 1PH7A 1NY4A 1J5EL 1VQGA 4ZRZA 4POFA 1L0XB 3SE0A 3Q22A 3KUPA 1EZ6A 1ZYRC 4A93G 1FVIA 1HJPA 3K7AB 4UHVA 3KJPA 4JI4Q 1ONLA 4F88A 3PUXA 3NQIA 1A62A 5D3DA 1QJOA 1HR0L 2D9UA 2WIIB 4NXNL 1F9RA 3KBXA 4C3JH 3NBIA 4UP7A 2AQ2B 4A3LG 4BY7B 4C56C 4UPAA 1BBUA 3J81j 5JEAJ 2OQKA 4YCVA 2K05A 3K5OA 1SYBA 2RVLA 2DJFC 1XXGA 1F2ZA 1B7YB 4ZUJA 1XPOA 3PUYA 1YI2A 2O2LD 1VQKA 1H9JA 1PYBA 3CRLC 5FO8B 3RZDH 1SYGA 4DUYL 1XPUA 2AHOB 3NSWA 1D8LA 2I46A 4OX9Q 2K14A 1KDAA 5JPNC 2GA4B 1B3AA 3V05A 4KD4A 3PO2B 3SR1A 2CQAA 3A7AB 4CDCC 4X66L 4OELB 3TP6A 1HNWQ 3U4VA 5AJ3Q 4BBRB 3SK4A 1JOKA 1B70B 1TKWB 3S2DH 1EWHA 4C2MB 4YHHQ 2IW3A 4GNXC 2WAQB 1J9OA 1A2TA 4JYAQ 3CD6A 1TWAB 2KEEA 3K7UC 2I0QA 3FKIG 1BXTA 1KLGD 4IOCA 3FRPB 1CA6A 1Y8OB 1P8LA 3BG3A 3TQYA 5CORA 4A3GB 5ELEA 3SGIA 5FLXc 5K36G 2VUMH 1V1OA 4BY1G 2EYLA 5T1GA 3W1BA 1TS2A 2RDHA 4OEMB 3L7ZC 1EY4A 2K6AA 1UUPA 5GAEC 4G7OC 1GXDC 2LFNA 5IGCA 4JG2A 1H95A 1H9SB 3NPPA 1KNEA 2F0VA 4ME3A 1QILA 3S17H 1JCKB 4JI6L 2RF4A 4DR5L 5C3EH 3GTOH 1HPCA 3NTKA 3NXWA 3QB3A 4XYOA 1I3QH 4A75A 2F4IA 4DV0L 1CKNA 4J8QA 1KXLA 1GUNA 4JI5Q 3M4QA 4QIWB 5BR8Q 2QEJC 3PUWA 3HOYH 4Y7NH 4DV7Q 2CKZB 2EYPA 2LMCB 2LS01 1Y14B 5I6YA 3T16A 1IBLQ 4LF6L 2Z4IA 2Q8TA 2OTLA 3J7YW 3MTSA 4A76A 1PH6A 2B39A 3HOWB 1LO5D 4BWGB 3NE5B 4LF5L 3X3NA 3K0XA 3MVVA 2QKIC 1VQBA 1D1IA 2KCMA 4PV1C 4PZ6A 3S1NH 4AYBB 3EROA 1XMQL 4CGYB 1Z9FA 2CH4W 2L5TA 5FJ8G 4GKKQ 2HIVA 2A74C 2QEXA 3E0EA 2PQAB 1EQVA 4N9PA 1EUJA 5NUCA 4DNRB 2ZJPA 4QF4A 1QOHA 3WOEA 1ENCA 4TKOB 1I4GA 2YTVA 1AP0A 3KF8A 4X3SA 3L3OC 4DR6L 3BDCA 1FNVA 1E0BA 2N88A 1Q12A 4P2CB 3HOVG 4B3RQ 1PHJA 4IUVA 2L4NA 4ILWA 3UE1A 1PA6A 4IUUA 4KK7A 2E5LQ 3NTIA 5C0XH 2J7ZA 2OT2A 2XNAC 1CZGA 4GN5A 4IUPA 2WP8J 4ME5A 4LF7L 2EJGC 4EQNA 2WINB 4ZKBB 1BF4A 2LXKA 2Z4HA 4HMJA 2F3VA 1D5XC 1KDCA 1H9RA 3G4SA 5CR3A 4HTHA 1I4PA 4A3JG 2ASBA 4A3BH 1JB7A 1EOTA 2L11A 1VQFA 2EE1A 1UE5A 3S2HB 3T1YL 4GOPB 4C3HB 3HOXH 5EPJA 3I4MH 1B1ZA 5C5MA 1K9MC 3TZUA 1ESRA 3H3VC 1L1OA 4C3IH 4MTKA 3AYHB 3MXNB 3GTGB 4UY8C 1SYCA 4RHSA 4AIMA 5IGEA 4XTCS 5EJWA 2NVYB 1SN8A 3KJOA 5C44B 2VS1A 1ET6A 1A6XA 3OYYA 4JBJA 3IFDA 5DM73 3BZDB 2NTSA 1UE6A 1HR0Q 1S40A 2A6ED 3W1GA 4QY7A 2CHBD 3K5NA 1M1KC 4NXNQ 1NAPA 3T4AC 3CCUA 5IT9L 2WACA 3KLSX 2PPBC 1O78A 1PH4A 1JWUD 1YEZA 1HTPA 1D6EC 1UEAB 3RLOA 1G51A 2FMCA 1U4RA 3CU7A 4FXGC 5L37A 1LTGD 2WKDA 2JA8B 2MPMA 1PRTB 4BY7G 2XSCA 4MTNA 4PNYA 2NN6H 2MJ8A 3JAMc 1IBML 4KHZA 4DUYQ 1Q86C 2XWJB 2PNRC 1LACA 1R9TH 3A8JE 3R8BA 3CW2C 4JBWA 2XRSD 3K57A 2M00A 1VS0A 1VQEA 1E7ZA 1EY8A 2B2UA 1PH9A 3V2TA 3WWVA 1P16A 3TREA 2RDFA 2PCFB 3D31A 1QB5D 4F87A 1YHAA 1BDOA 2QDBA 1YITA 1VQDA 1HFGA 1VQHA 1DOKA 2EZVA 5M3MH 4KY5A 3AFPA 3PCOB 3PO2G 3F2CA 3AB9A 4CJ2C 1JWSD 1TS3A 3A8IE 3W3AA 4IN3A 5M3FB 1VQ7A 1LTBD 4HCSA 3H0GH 5J3BA 2NVTH 1IYVA 3D6CA 4BBRG 1GUSA 1TWHB 3J80c 4X3KA 1X3QA 3E9HA 3CQZH 1E22A 4L63B 1WTXA 3HKZB 2WAQG 4EGVA 2A5HA 1I94Q 4K2KA 2PMZE 4DK1A 1JJ2A 3PF5A 2JE6I 2ID0A 1K3RA 4U68A 4A3GG 1SYEA 4RWSC 3UE0A 5I9OA 1Y1WB 4JI6Q 2ZJRA 4G57A 3CMEA 1HHVA 1SE8A 4DAMA 1AEXA 3DWPA 2R93B 3CPWA 4DV0Q 2K75A 2IT1A 3H3VI 1TIID 3DXJC 3TN2A 2YU9B 4OL7A 5CBAE 2AUKA 4IQZA 2N49A 4OWTB 1GUWA 3MA2B 4WJ3M 1IW7C 2MQHA 1OXSC 4LF6Q 4F8MA 5HGQA 1YNJD 3J81E 2YYZA 1TT2A 4KY7A 2CVRA 2K5NA 1DGSA 4A93H 1I6HB 1S5BD 4QL5A 5GAGC 1XMQQ 3PV0A 5FLMG 1T9HA 4NMZA 3CPFA 2WKCA 5D3IB 5IYCG 3HOWG 4A3LH 2KECA
chains in the Genus database with same CATH topology
1HXYD 2NWGA 3SK5A 1STEA 1EL0A 3BYTB 2F0JA 4IZ8A 3A8KE 2H4OA 3U9OA 3GTPB 1WTOA 2EY5A 1TS4A 4XQQA 2B2YA 1I50B 4RGNA 1CHQD 1W6KA 1ENFA 3MXUA 1DM0B 4KI0A 1NR4A 4EVOA 2F0DA 3NHHA 3I3CA 3ND8A 1PRTD 2QILA 2JP1A 1LABA 3K59A 2JEBI 1GUOA 2B2TC 1II3A 2AWNA 1LT6D 2HDMA 2B2UC 4C3HG 1RF2D 2Q8IB 2FHTA 3QOLA 5A2QE 2B2WA 1V1PA 2R92B 3C2PA 4E6IA 1Q8IA 3TBIB 1DONA 4TRDA 4OO1I 2BOSA 2E2HB 3MFGA 1U4PA 2O5IC 1UNSA 1PZKD 3URYA 1Y8NB 4OIKA 2K28A 4A3IB 3BYYB 4WORA 4DAYA 1M4VA 4WRDA 1G8ZD 4R9WA 2NVQB 1LTRD 3MZ5A 3NBHA 3MAQA 2E75C 2L0CA 3HS0C 1G91A 1DJRD 2HQEA 1M8AA 3H09A 5EPKA 2L9HA 3FEWX 3W2DA 4OIJA 5CV4A 4MIUA 3OIQA 4DNTB 3L9AX 2FINB 2F0EA 3M7NA 1PTOC 5IGBA 3MXPA 1BCPD 1EYCA 1DOLA 1SXTA 3BVMA 3HZXA 2SNSA 4MN3A 1SAPA 3VA5A 2F1MA 2N55A 1Q3LA 1CFMA 3CHBD 3BVZA 4O1NA 1SE3A 3J7AV 4ID6A 2K33A 3FDTA 5EKIA 2ZXPA 1YNNC 3GTJB 4HCEA 2B8GA 3K58A 5CBEE 1LTTD 3MEHA 1PDQA 1HUNA 3I4NB 4CHTB 2E74C 4DA2A 2A68C 5IOCA 4S3SA 5C4ZA 3P7JA 1S4ZA 1CZWA 3N52A 2IX1A 1D1KA 1SFOB 5KGUA 1B2TA 1Y8PB 1H9KA 3OIPA 2EJMA 3HG9A 2F0PA 1TR5A 3NK9A 3TSSA 3GD7A 2J4XA 2A6HC 5FO7B 5DEHA 3OW7A 4I65A 2RSOA 5JPMC 3T13A 4IFDI 2B2WC 2K04A 2NUCA 4QB4A 1WCMB 1STYA 4JK1C 2MP1A 2OXPA 4HN7A 2CW0C 4KD3A 1SMYD 1EY9A 2NB0A 1BQQT 1EQTA 1GJXA 1QG7A 4KY6A 4Q0FA 4OHJA 1SEBD 1Y69U 2MGSA 5E4WC 5ELDA 4QUCA 1HFNA 3T53B 4KHVA 2BE5C 4KKUA 1QCBD 4LAAA 3K0YA 5IGGA 5CV7A 1SBBB 4R8IA 2EYHA 3D4RA 3EA6A 5LL6X 4DGZA 2EY1A 1NCVA 3BS1A 1WTRA 1A15A 1QNKA 2B8FA 4V190 4BA1I 3SVMA 5LL6S 1DZ1A 3PUVA 2JXMB 3LX0A 1KAAA 1IYUA 1RTNA 5JEAH 3QIAA 1PTOF 2JYOA 5KEEA 3I4LA 2RBMA 1ML0D 1S5CD 4K6DA 4TQUS 3U9SA 1B9NA 2E2DC 3RZDB 5I9PA 3PIP3 1AFPA 1CTMA 1BOSA 3NTHA 4DU9A 1WTQA 5FOBB 1WD1A 1ET9A 4NDXA 3IKJA 2BA1A 1O7YA 1SNOA 3E0JA 4ULLA 3IAYA 4BS9A 3S2DB 1Z47A 4RKLA 5C5LA 1H9MA 3GO5A 2LY7A 1BBXC 1V1PB 3D3RA 3AU7A 1VF7A 1FNUA 1HA5A 2VUMB 1SE2A 3Q24A 2A69C 1CHPD 2M9VA 4LJZC 1HA6A 1PMRA 1RDPD 1VF5C 5J22A 3N6RA 4IALA 4XXEA 1BUVT 5EQ0A 4XQJA 1NUCA 1LTID 5ELCA 3VR2A 1F2MA 1EU3A 5C3EB 3GTOB 1TY0A 1I3QB 5M5YB 1TVXA 1QE6A 3HOYB 5IGFA 4Y7NB 1MI2A 4LMQD 5G3LF 4IUNA 4IUQA 2I07B 3H6MA 1LT5D 3RUZA 3CKIB 2NZ1D 2MHVA 1E2WA 2DY8A 1STGA 5C0XI 1RODA 1CQFA 2BA0A 1G291 1AZQA 4J1MA 3LWUA 1HUMA 4DAPA 4ZKCB 1OXVA 2FFKB 2DN8A 3RMHA 3VR3A 4K14A 3LNNA 2L12A 2IX3A 4CKBA 3K6OA 5FLXL 1IL8A 4H7BA 2RSNA 4HMIA 2XVSA 4H44C 4WFN3 1JB3A 2B2TA 2O5JC 3VR5A 4IFDG 4A3BB 1PFMA 2PW5A 1B9MA 3K5LA 1DD2A 1BNZA 3I90A 3QO2A 3HOXB 5I4DA 2KVMA 2A73B 1ESFA 3SEBA 5CV9A 5I6WA 3FPUB 4NP5A 2AWOA 1UAPA 2F0HA 2X6GA 3HGBA 5IT9E 1C8CA 2NN6I 3DM1A 2V4DA 3VR6A 2OF1A 1DCZA 2PQEA 1A3VA 3OHXC 1ENAA 3LWEA 1ZYRD 5FKAC 1I6VC 3S9WA 5FK9C 1MD2D 3MHBA 1GHKA 3BDLA 4IUTA 4K5XA 1R9TB 3FMCA 4M8AA 4FF1A 4K8JA 3DHQA 1HRJA 2K5QA 4ABNA 2PZWA 5JVG3 4DN4M 5E4XA 1KABA 3O13A 2IL8A 1RD9D 5EBDA 4A3DB 5KNDA 1SNPA 3OMGA 1S5FD 2NTTA 1L0YB 2KJXA 1X3PA 2DNEA 4RGMA 2RA4A 1OXUA 1DOMA 1STBA 1F2YA 4UDUC 2BDOA 1G6ZA 4XT1B 3DWQA 3E6ZX 3WOFA 5EKKA 1HCZA 2F0FA 2JSOA 5F2DA 3K5MA 3EQLC 3OSOA 2RDGA 1A3TA 4ZQ3A 2SOBA 1ICWA 1STAA 3A54A 1STNA 1EU4A 4FF2A 1Q1BA 1AW7A 3R2IA 1TS5A 1CA5A 1JC7A 1FGBD 4KJNA 3EFXD 4CKCA 3HOZB 3PIO3 3JAML 2KUMA 2EJFC 1SNCA 1R4QB 2F0OA 5K36H 5EKLA 1U4LA 1BCPF 3R93A 3J7AF 2JA5B 2O4XA 1O7ZA 1RKNA 3GP7A 1E2VA 1XYIA 5K5PA 4B9WA 3SK8A 5M9OA 3GQBA 4PMCA 3M85A 3BVGA 2SDFA 3DEPA 1SNDA 2TMPA 3J80L 1VDZA 3ND9A 3S15B 4RA8A 3KLSA 4X3UA 1GUTA 2HCCA 4KV6A 1ZXTA 3S1MB 2PZTA 4RGTA 2TSSA 2NBFA 4Q5VA 3F2UA 5IGDA 1LTAD 3M4OB 3VYSA 1HQMC 1XWEA 5D65A 2SEBD 1O7LA 4MHEA 4KTAA 5CV6A 1J8IA 1LV9A 4K6LA 5M5WB 3GV6A 2OEOA 3J80E 2F0UA 4U673 1EEFD 2EYJA 3ZYYX 4DK0A 4FF4A 2DNCA 4K2LA 1NSNS 1V43A 2BCOA 2ICIA 3ERQA 3MFYA 3V96A 1X32A 3ONAB 2RQXA 1C48A 3OWFA 2K01A 5COYA 4FXKC 4K5VA 1LLRD 4IFDJ 3CRKC 2F03A 2L55A 4OGQC 5LHY1 3I72A 1W6JA 2KCCA 3S16B 2R61A 1SJHD 2EY2A 1A3UA 5KNCA 2A6EC 2K32A 4DFAA 2F3WA 1JOQA 3IFTA 1R4PB 4X3TA 3DWAA 1FR3A 2KHSA 4J6HA 4NW2A 5CC4A 1KTKA 3R2TA 3PO3B 2PO4A 3MC0B 1B4OA 4IURA 3KBGA 1TU2B 3SK6A 1I4HA 4C1NK 3VYUA 1WTWA 4A3MB 2C9OA 1CI3M 3UI2A 2B2VA 5J39A 1WVLA 1ILPA 2IJ0A 1MGSA 4IFDH 1PYWD 2SNMA 2K5WA 2IX0A 1S5ED 2KEDA 2R6GA 4F7XA 5KRUA 5I2XA 2C5CA 2PZUA 2F0KA 4RKBA 2R7ZB 3A7LA 1CM9A 3RD4A 1ZEQX 4I7ZC 2AQ1B 3NUCA 1STHA 3OOCA 1F2LA 1IW7D 2JA6B 3P20A 2MUYA 3M3YB 1Z7TA 1LTSD 4KJOA 1SNQA 4G7HC 1Y1VB 2EVBA 1IHZA 1T5XD 3HP3A 2D62A 4HEDA 2H1EA 2VNUD 5IIFA 5KIXA 1PTOB 1EYDA 4DXFA 4KKSA 4KN7C 1YNJC 2JA7B 2B63B 3H94A 2Y0SB 3S1QB 5DM63 1TY2A 1JICA 4QMGA 3GV3A 4HAEA 1TWFB 3ITPA 1RTOA 4FP5D 1D5MC 1XX8A 4HSVA 3AMUA 2F0LA 4V0BA 1EEID 1KNAA 4N9TA 3SHLA 4C3JB 5BN4A 1RCVD 5BN5A 1E2ZA 1EY6A 5C6AA 1QNUA 4RGOS 2J0TD 3GTLB 4FO2A 3TP7A 5KYIA 3VYRA 4Z9CB 3HOUB 4OO1G 3QG1A 3C1FA 3M4YA 1F77A 5EBCA 4DAVA 1EWCA 2E2JB 4QUFA 2F0TA 4RCOA 1WD0A 1D2BA 4PMBA 3I70A 2EYMA 4RFBA 4XIGS 1PRTC 5C3WA 2F0NA 2KOLA 1NR2A 1KLUD 5C0XJ 2NVXB 1IKMA 2L1BA 3QWNA 4XT3B 3EVQA 3X3MA 2X69A 2K1BA 4ZYSA 2B2VC 1F9QA 3TMEA 4HSPA 3TZDA 1EFID 3TP5A 1RJTA 5DAUA 2WV6D 2K5DA 3S17B 3FVQA 2K03A 2AQ3B 3MWYW 2PW7A 4A3FB 5C4XB 5JAVA 3I91A 2BDNA 5CMDA 1MBYA 5AFWA 4CJ1B 4A3KB 3D4DA 5TSSA 3C1EA 3RLFA 2XWBB 3GTKB 4K8IA 2AUJD 3P1HA 4RAUC 3S1NB 3OPOA 3P75A 2HUGA 3GTMB 3MXGA 1PTOD 4CBVA 5T1IA 3D4WA 3Q23A 1EY0A 1GHJA 3DEOA 5C4JB 3H91A 3BDOA 1JR0D 4B08A 4FNFA 1KDBA 2KA7A 1SE4A 4H13C 2Q8RE 1YNND 2F0SA 1BCPC 2EDGA 4ZUIA 1DXMA 4A3EB 1FYCA 1I4RA 2HDLA 1JWMD 5JJZA 5JVH3 1FNWA 1G2SA 3D6WA 2A68D 5ELBA 4EQOA 1V8QA 1EIGA 3I4MB 3Q6SA 3IL8A 1TWGB 4C3IB 2EOTA 1GOZA 3VA7A 2XRQD 5I2YA 5HGTA 5HURA 2A6HD 3M7GA 1SJED 5FLXE 4KMUC 3RZOB 2PYKA 1RHPA 1MSHA 1EZ8A 3J81L 5IODA 5A35A 1PRTF 1A2UA 3NQTA 1EY7A 1SYFA 2CW0D 5G3LD 5JOBA 1QWYA 4C3JG 1OO9B 2VB3X 2DY7A 3S14B 1O80A 2G9DA 1VMPA 1I4QA 2EXZA 2LKVA 5CGKA 1K8MA 3NWTA 1PFNA 3D8GA 4G4KA 3A56A 2BE5D 2RKSA 2D5DA 5KYLA 4NKLA 5M3MB 3DMUA 2XIWA 1Q90A 1SMYC 2EY6A 3SXHA 1SDFA 4M1UB 3DUZA 3R3OA 4ODGA 3QOJA 3H0GB 2NVTB 1S5DD 1B53A 3CQZB 4L6TB 4LK1C 1SYDA 1XTCD 2E76C 4BBSB 1JOOA 2IPKD 1FD7D 3G6JB 1PXUA 3QJYA 1Q1EA 4C1NI 5JEAG 5E3FA 1PFBA 3PMFA 1LT3D 2EPBA 1PZJD 4UAIA 2XN9C 4O42A 1BCPB 3C46A 2ZXRA 3VR4A 1G2TA 3OWEB 3SDZA 2M2LA 4EQPA 5A2QL 2WB1B 4FXDA 4HR7B 4PQXA 1EIHA 4A93B 2ZT9C 1PLFA 1H9SA 2E2IB 4QCLA 1AZPA 2JEAI 3TP8A 4K5WA 1T5EA 2FMMA 2PMZB 4BA2I 4DXGA 2KQ3A 1CT1D 5E1FA 4CJ0B 1F9PA 4OO1H 3S1RB 1OXXK 3T51B 3I8ZA 4G7ZC 5M5XB 4KN4C 3NWSA 1JQYD 2ENBA 3C3LA 1BR9A 1B50A 2A69D 5C3XA 3Q0AA 4PMWA 1WTPA 5J1ZA 1SNMA 1JE4A 5ELFA 1AN8A 1HTLD 5CV8A 1DYQA 1U4MA 3JAME 5C0XG 2F0QA 2F0GA 2D2CC 1D5ZC 3E5SA 4WJWA 2G9HD 1TWCB 3FKIB 4R8NA 5BN3A 3KLRA 4BY1B 2KCNA 1I4XA 1EYAA 2F0MA 4H0LC 4ZAIA 3KK7A 2X6LA 3HRZC 4B9XA 1WTVA 4C3IG 1CK1A 4GZYC 1VMCA 2VXWA 2Z1CA 1ZKOA 3A55A 4KKTA 2ZXOA 3PUZA 2R3ZA 1B44D 3GTQB 1LT4D 4RCNA 4FYDA 4RHRA 1EY5A 3T56B 3MXNA 3G7LA 2QCPX 1TQOA 2EYFA 5EPLA 5C4HA 2QF7A 5EGTA 5DNFA 2NN6G 4FVMA 5FO9B 4CKEA 3NP8A 2IWHA 1ILQA 1PZID 2ICEC 4RH6A 3WDNA 1VCIA 1MSGA 2VB2X 3OMCA 5CYUA 3HOVB 5ISRA 2B2YC 1SSOA 4XDXA 1C4QA 1IKLA 1F9SA 2HCIA 3EJIA 3TDQA 2NYZD 2Z8LA 5CV5A 1HQRD 2K7VA 4TSSA 5D14A 1JORA 1K8OA 4A3JB 1BO0A 1GUGA 2F0WA 3FPPA 4ZLTF 1Z6HA 3I73A 2FJ2A 1OXTA 4XYQA 4XQNA 1CQVA 4DF7A 1K83B 1PTOH 4YIJA 3HEJA 2F0IA 3VYTA 5KNBA 2EYOA 1U9RA 4ZK9B 4FF3A 4L8JA 4ZRZA 1L0XB 3SE0A 3Q22A 3KUPA 1EZ6A 1ZYRC 3K7AB 1ONLA 4F88A 3PUXA 3NQIA 5D3DA 1QJOA 2D9UA 2WIIB 1F9RA 3KBXA 3NBIA 2AQ2B 4BY7B 4C56C 5JEAJ 2K05A 3K5OA 1SYBA 2RVLA 1XXGA 1F2ZA 4ZUJA 3PUYA 2O2LD 1H9JA 3CRLC 5FO8B 1SYGA 3NSWA 2I46A 1KDAA 5JPNC 2GA4B 1B3AA 3V05A 4KD4A 3PO2B 3SR1A 2CQAA 3A7AB 3TP6A 4BBRB 3SK4A 1JOKA 1TKWB 1EWHA 4C2MB 2IW3A 2WAQB 1J9OA 1A2TA 1TWAB 2KEEA 1BXTA 1KLGD 3FRPB 1CA6A 1Y8OB 3BG3A 5CORA 4A3GB 5ELEA 5K36G 1V1OA 2EYLA 5T1GA 1TS2A 2RDHA 3L7ZC 1EY4A 2K6AA 1UUPA 4G7OC 1GXDC 2LFNA 5IGCA 1H9SB 3NPPA 1KNEA 2F0VA 1QILA 1JCKB 1HPCA 3NTKA 3NXWA 3QB3A 4XYOA 2F4IA 4J8QA 1GUNA 4QIWB 2QEJC 3PUWA 2LMCB 2EYPA 2LS01 5I6YA 3T16A 2Z4IA 2Q8TA 3J7YW 3MTSA 2B39A 3HOWB 1LO5D 4BWGB 3NE5B 3X3NA 3MVVA 2QKIC 1D1IA 4PV1C 4AYBB 3EROA 4CGYB 2L5TA 2A74C 1EQVA 4N9PA 5NUCA 4DNRB 4QF4A 1QOHA 3WOEA 1ENCA 4TKOB 1I4GA 1AP0A 3KF8A 4X3SA 3L3OC 3BDCA 1FNVA 1E0BA 2N88A 1Q12A 4P2CB 4IUVA 2L4NA 4ILWA 4IUUA 4KK7A 3NTIA 5C0XH 2J7ZA 2OT2A 2XNAC 1CZGA 4IUPA 2WP8J 4ME5A 2EJGC 4EQNA 2WINB 4ZKBB 1BF4A 2Z4HA 4HMJA 2F3VA 1D5XC 1KDCA 1H9RA 5CR3A 4HTHA 1I4PA 1EOTA 2L11A 2EE1A 3S2HB 4C3HB 5EPJA 1B1ZA 5C5MA 3TZUA 1ESRA 3H3VC 3GTGB 1SYCA 4RHSA 5IGEA 4XTCS 5EJWA 2NVYB 5C44B 1ET6A 1A6XA 3IFDA 5DM73 3BZDB 2NTSA 2A6ED 2CHBD 3K5NA 1NAPA 3T4AC 5IT9L 2WACA 3KLSX 2PPBC 1O78A 1JWUD 1HTPA 1D6EC 1UEAB 2FMCA 1U4RA 3CU7A 4FXGC 1LTGD 2WKDA 2JA8B 2MPMA 1PRTB 2XSCA 4PNYA 2NN6H 2MJ8A 4KHZA 2XWJB 2PNRC 1LACA 3A8JE 3R8BA 4JBWA 2XRSD 3K57A 2M00A 1EY8A 2B2UA 3V2TA 2RDFA 2PCFB 3D31A 1QB5D 4F87A 1BDOA 2QDBA 1HFGA 1DOKA 2EZVA 4KY5A 3AB9A 4CJ2C 1JWSD 1TS3A 3A8IE 3W3AA 4IN3A 5M3FB 1LTBD 4HCSA 1IYVA 3D6CA 1GUSA 1TWHB 4X3KA 1X3QA 4L63B 1WTXA 3HKZB 4EGVA 2A5HA 4K2KA 4DK1A 2JE6I 2ID0A 4U68A 1SYEA 4RWSC 5I9OA 1Y1WB 4G57A 1HHVA 1AEXA 3DWPA 2R93B 2IT1A 1TIID 3DXJC 3TN2A 2YU9B 4OL7A 5CBAE 2AUKA 4IQZA 1GUWA 3MA2B 1IW7C 1OXSC 4F8MA 1YNJD 3J81E 2YYZA 1TT2A 4KY7A 2CVRA 1I6HB 1S5BD 3PV0A 4NMZA 2WKCA 5D3IB 2KECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXY D;  4RHR A;  1S5C D;  1LO5 D;  3BVG A;  4BWG B;  5D3D A;  1LTG D;  1STE A;  3BYY B;  3DWA A;  5TSS A;  1PRT B;  3TSS A;  3BYT B;  2J4X A;  1D5M C;  1M4V A;  2AQ2 B;  1PRT F;  3O13 A;  4C56 C;  1G8Z D;  1RD9 D;  1LTR D;  3R8B A;  1EEI D;  1KTK A;  3R2T A;  2XRS D;  3MC0 B;  1XXG A;  4DXG A;  1CT1 D;  1RCV D;  1S5F D;  1TS4 A;  2NTT A;  1L0Y B;  1DJR D;  1PZI D;  1I4H A;  1ET9 A;  2O2L D;  4RGO S;  4RH6 A;  1I4G A;  4RGM A;  1PTO D;  4RGN A;  1I4Q A;  1CHQ D;  1ENF A;  4RGT A;  2TSS A;  4UDU C;  1FNV A;  4Z9C B;  1JQY D;  3W2D A;  2IJ0 A;  1LTA D;  1JWS D;  3V05 A;  1TS3 A;  1F77 A;  1PYW D;  1LTB D;  3DWQ A;  1PTO C;  2XNA C;  2SEB D;  4OHJ A;  1PRT D;  1EWC A;  1SEB D;  1V1P B;  5ELF A;  2QIL A;  1AN8 A;  1HTL D;  1BCP D;  1FNU A;  1HA5 A;  1S5E D;  2RDG A;  4K6L A;  4L63 B;  4RCO A;  5ELD A;  1SE2 A;  1DYQ A;  1JR0 D;  1CHP D;  1D5X C;  2Z8L A;  1SXT A;  1S5D D;  3BVM A;  4RFB A;  5I4D A;  1HQR D;  1RDP D;  1EU4 A;  1BXT A;  1KLG D;  1D5Z C;  1SE4 A;  2G9H D;  1SBB B;  4TSS A;  1ESF A;  1PRT C;  3EA6 A;  1EEF D;  1I4P A;  4L6T B;  3SEB A;  1AW7 A;  1BCP C;  3R2I A;  5ELE A;  1TS5 A;  1XTC D;  2AQ1 B;  1LT6 D;  1V1O A;  1KLU D;  2IPK D;  1FD7 D;  1LTI D;  5ELC A;  1TS2 A;  2RDH A;  3DWP A;  3CHB D;  1EU3 A;  3BVZ A;  1I4X A;  1RF2 D;  1UUP A;  4O1N A;  1FGB D;  1TY0 A;  2ICI A;  1SE3 A;  1B1Z A;  1LTS D;  3EFX D;  1I4R A;  1JWM D;  1FNW A;  1V1P A;  5ELB A;  1LT3 D;  4ZYS A;  1QIL A;  1CQV A;  1JCK B;  4RHS A;  1PZJ D;  1PTO H;  1T5X D;  1LTT D;  2XN9 C;  1LLR D;  1CK1 A;  5FKA C;  1BCP B;  1ET6 A;  1GOZ A;  1EFI D;  3BZD B;  2NTS A;  3MFG A;  1BCP F;  2CHB D;  3OWE B;  2WV6 D;  1S5B D;  2XRQ D;  1UNS A;  3GP7 A;  1LT5 D;  1PTO B;  2QEJ C;  2AQ3 B;  3KLS X;  4DXF A;  5FK9 C;  1MD2 D;  1JWU D;  1PTO F;  1L0X B;  1PZK D;  2R61 A;  1D6E C;  1SJH D;  1SJE D;  3URY A;  1B44 D;  5D3I B;  1LT4 D;  1TY2 A; 
#chains in the Genus database with same CATH topology
 1HXY D;  1YVC A;  2NWG A;  3SK5 A;  1STE A;  4ALP A;  1EL0 A;  3BYT B;  4AYB G;  2Z6K A;  4OON A;  2F0J A;  4DR6 Q;  3KOJ A;  4IZ8 A;  3S1R H;  3A8K E;  2UXD Q;  1QVC A;  2H4O A;  5M5X H;  3U9O A;  1L1O C;  3GTP B;  4PZ7 A;  1HR0 W;  1WTO A;  2EY5 A;  1TS4 A;  4XQQ A;  2B2Y A;  2C35 B;  3S15 H;  1I50 B;  4LF7 Q;  1WOC A;  4RGN A;  1CHQ D;  1W6K A;  1YJN A;  3RN5 A;  1ENF A;  3MXU A;  1HZB A;  2LXJ A;  3KDF A;  4QJF A;  4I7A A;  1DM0 B;  1KAW A;  4KI0 A;  3EN2 A;  3TEH B;  1XNQ Q;  1NR4 A;  4EVO A;  3EIV A;  2F0D A;  2VL6 A;  3NHH A;  3I3C A;  3ND8 A;  1PRT D;  3JC6 6;  2QIL A;  3FKI H;  3T1Y Q;  4JI4 L;  3G71 A;  4GLX A;  1X55 A;  3I55 A;  3I7F A;  5JJI A;  2JP1 A;  3M4O H;  3CCQ A;  1LAB A;  3K59 A;  1CKN B;  2JEB I;  4IPH A;  1PVO A;  5JJL A;  1GUO A;  2B2T C;  1II3 A;  3CAM A;  4OXP A;  2AWN A;  3F2D A;  1WFQ A;  1XTD A;  1LT6 D;  1CKO A;  1HNZ L;  2N78 A;  1K3B C;  2HDM A;  2B2U C;  4C3H G;  1RF2 D;  2Q8I B;  2FHT A;  4IPC A;  3QOL A;  5A2Q E;  2B2W A;  1V1P A;  2R92 B;  4LFB L;  2D0P A;  1BBW A;  3C2P A;  4E6I A;  4HJ9 A;  2ATW A;  1Q8I A;  3TBI B;  5C44 G;  2UUA L;  1DON A;  4TRD A;  5IYB G;  4OO1 I;  1EOV A;  2BOS A;  1PH8 A;  2E2H B;  3MFG A;  3GTQ H;  1U4P A;  4A3C G;  2O5I C;  1UNS A;  2YTX A;  1IBM Q;  1NMF A;  4LF4 Q;  1PZK D;  1WI5 A;  4L5S A;  3URY A;  3KF8 B;  1Y8N B;  4OIK A;  5H1S E;  1SR3 A;  2JA8 G;  2K28 A;  4A3I B;  1GD7 A;  3BYY B;  4WOR A;  4DAY A;  1N32 L;  1M4V A;  4R4Q A;  4WRD A;  1G8Z D;  4R9W A;  2NVQ B;  1KHI A;  1LTR D;  1AE2 A;  3MZ5 A;  3NBH A;  3MAQ A;  2E75 C;  2L0C A;  3HS0 C;  4HJ7 A;  1G91 A;  1DJR D;  1N33 Q;  3HOV H;  3E9I A;  2HQE A;  3UDF A;  1M8A A;  2NZO A;  4LFA L;  3H09 A;  1LUZ A;  5EPK A;  2L9H A;  3FEW X;  4GNX A;  5IP7 G;  4BXX G;  3W2D A;  1V9P A;  5M3F G;  4OIJ A;  5CV4 A;  4DKA C;  4MIU A;  3OIQ A;  4DNT B;  3L9A X;  4Y52 H;  2FIN B;  2F0E A;  3M7N A;  1PTO C;  1L1O B;  4A3M H;  1EIF A;  4DR4 Q;  3HKZ G;  5IGB A;  3MXP A;  1BCP D;  4A3J H;  1EYC A;  1DOL A;  1SXT A;  3BVM A;  3HZX A;  2Z6K C;  2SNS A;  4MN3 A;  1Y1W G;  4JI7 Q;  1SAP A;  3VA5 A;  1PH2 A;  2F1M A;  2N55 A;  1Q3L A;  4DV2 Q;  2R93 G;  4YWM A;  1CFM A;  3CHB D;  3BVZ A;  3KYH C;  4O1N A;  3U50 C;  1SE3 A;  3J7A V;  4ID6 A;  2K33 A;  3FDT A;  2NZH A;  5EKI A;  2QW7 A;  2ZXP A;  2R7Z H;  1YNX A;  1YNN C;  4JC0 A;  3GTJ B;  4HCE A;  2B8G A;  3K58 A;  5CBE E;  4B3R L;  1LTT D;  3MEH A;  3A0J A;  2JA6 H;  1KIX A;  1IL2 A;  1PDQ A;  1HUN A;  3I4N B;  2WAQ E;  4CHT B;  1YIJ A;  5E7N A;  2E74 C;  4DA2 A;  2A68 C;  5IOC A;  4S3S A;  5C4Z A;  3P7J A;  1S4Z A;  1CZW A;  3N52 A;  4MZ9 A;  2IX1 A;  1D1K A;  1SFO B;  2Q2U A;  5KGU A;  1B2T A;  1Y8P B;  4BY7 H;  3JAM i;  5JJK A;  1H9K A;  3OIP A;  2EJM A;  3HG9 A;  2F0P A;  1TR5 A;  3NK9 A;  1M90 C;  3TSS A;  3GD7 A;  3STB D;  1K8A C;  2J4X A;  4P75 A;  1HZC A;  2A6H C;  5FO7 B;  2JA7 H;  5DEH A;  3OW7 A;  4QGU A;  2B63 H;  1W3S A;  3S1Q H;  4I65 A;  2RSO A;  1VQ6 A;  2B29 A;  5JPM C;  3T13 A;  4CDF C;  4IFD I;  2B2W C;  2K04 A;  4KLK A;  2WB1 G;  3ER0 A;  2NUC A;  4QB4 A;  1CKM A;  1STY A;  1WCM B;  2MO1 A;  4QIW E;  4JK1 C;  2MP1 A;  3PIP A;  3PO2 H;  2OXP A;  4HN7 A;  1N34 L;  2CW0 C;  2MNA A;  4KD3 A;  1SMY D;  1EY9 A;  2NB0 A;  1BQQ T;  3J80 i;  2K5V A;  1EQT A;  1GJX A;  4C2M H;  1QG7 A;  3GTL H;  4KY6 A;  4Q0F A;  4OHJ A;  5GRO A;  4AYB E;  3OTO L;  1SEB D;  1HNZ Q;  1Y69 U;  1MHW C;  2MGS A;  1C9O A;  5E4W C;  1KRT A;  5ELD A;  4QUC A;  4GLA C;  4DNI A;  3HOU H;  4A3G H;  1HFN A;  3T53 B;  4KHV A;  2BE5 C;  4KKU A;  1QCB D;  4LAA A;  3K0Y A;  5IGG A;  5CV7 A;  1SBB B;  3LGJ A;  4R8I A;  2EYH A;  3D4R A;  3EA6 A;  3ULP A;  4LFB Q;  1VQ8 A;  2E2J H;  2DGY A;  5LMN L;  5LL6 X;  2UUA Q;  4DGZ A;  2EY1 A;  1NCV A;  3BS1 A;  1WTR A;  1A15 A;  1QNK A;  2B8F A;  4V19 0;  2HD3 A;  4BA1 I;  3SVM A;  4TVA B;  3A5U A;  2R92 G;  5LL6 S;  1EIY B;  1SLJ A;  1AH9 A;  2KEN A;  3CCE A;  1DZ1 A;  2Q2I A;  2NVX H;  3ZJY C;  3PUV A;  4GKJ L;  2JXM B;  5FLM H;  3LX0 A;  1Q46 A;  4O2D A;  1KAA A;  4GS3 A;  1N32 Q;  1IYU A;  1RTN A;  3HOW H;  5JEA H;  1I94 L;  3QIA A;  1PTO F;  1PYS B;  2JYO A;  5KEE A;  3I4L A;  3KDF B;  1S3O A;  2VQE Q;  4A3I G;  2RBM A;  1VQM A;  1ML0 D;  1S5C D;  4JOI C;  4K6D A;  4TQU S;  2PI2 A;  1B9N A;  3U9S A;  2E2D C;  4LFA Q;  4A3F H;  1A8V A;  5C4X H;  3RZD B;  3J7Z C;  5I9P A;  3PIP 3;  1AFP A;  1CTM A;  4A3K H;  1BOS A;  4WJ4 A;  3NTH A;  4DU9 A;  1NE3 A;  4KHP Q;  1WTQ A;  5FOB B;  1WD1 A;  1ET9 A;  4NDX A;  3F8T A;  3IKJ A;  3GTK H;  2GVA A;  3K81 C;  1X54 A;  1X56 A;  2BA1 A;  1O7Y A;  1SNO A;  3E0J A;  4ULL A;  3IAY A;  4BS9 A;  2IY5 B;  3S2D B;  1Z47 A;  1UE7 A;  1QZH A;  4RKL A;  4DR2 L;  5C5L A;  1H9M A;  5IP9 G;  3GO5 A;  2LY7 A;  1BBX C;  3GTM H;  3J81 c;  4HIO A;  1V1P B;  3D3R A;  4P73 A;  3AU7 A;  1VF7 A;  1FNU A;  1HA5 A;  4B3M L;  2VUM B;  1SE2 A;  2R7D A;  3Q24 A;  2A69 C;  2EIF A;  4LW1 A;  1CHP D;  3RNU A;  2M9V A;  4LJZ C;  1HA6 A;  2DUD A;  3U4Z A;  1PMR A;  1RDP D;  1VF5 C;  2CWP A;  2N3S A;  5J22 A;  2I5M X;  4C3H H;  3N6R A;  4IAL A;  5C4J H;  2ZTE A;  4XXE A;  1BUV T;  2UXD L;  1ASY A;  5EQ0 A;  4XQJ A;  1HNX L;  1NUC A;  4NXM L;  1LTI D;  5ELC A;  3VR2 A;  1F2M A;  1EU3 A;  5C3E B;  3GTO B;  1TY0 A;  1I3Q B;  5C44 H;  5M5Y B;  1TVX A;  5IYB H;  1QE6 A;  4DAY B;  3HOY B;  4A3E H;  5IGF A;  4A3C H;  4Y7N B;  1XNQ L;  3I4N G;  1MI2 A;  3HKZ E;  4LMQ D;  3UDI A;  2F3I A;  5G3L F;  4N8X 1;  3NBH B;  4IUN A;  4JVZ A;  4IUQ A;  2I07 B;  3H6M A;  1LT5 D;  3RUZ A;  3CKI B;  2NZ1 D;  2MHV A;  1E2W A;  2DY8 A;  1VQO A;  4LWC A;  1FGU A;  1STG A;  3I2Z A;  2EQS A;  4GN3 B;  1TWG H;  5IYD H;  5C0X I;  4GNX B;  1ROD A;  1CQF A;  2BA0 A;  1G29 1;  1AZQ A;  4J1M A;  3LWU A;  1HUM A;  4DAP A;  2B3G A;  1N34 Q;  4ZKC B;  1OXV A;  2FFK B;  2DN8 A;  3RMH A;  1VQJ A;  3VR3 A;  4K14 A;  3RZO H;  3LNN A;  2L12 A;  2IX3 A;  1RL2 A;  1WCM G;  1GKH A;  5IP7 H;  4BXX H;  4CKB A;  3K6O A;  4DUZ Q;  3OTO Q;  5FLX L;  1IL8 A;  1AE3 A;  1SMX A;  4H7B A;  3H15 A;  2RSN A;  4HMI A;  2XVS A;  2K50 A;  3D0F A;  1WJJ A;  4H44 C;  4WFN 3;  1JB3 A;  2B2T A;  3S14 H;  2O5J C;  4LF4 L;  3VR5 A;  1V1Q A;  4IFD G;  2L15 A;  5LMN Q;  1K0S A;  1LTL A;  2K4K A;  1BKB A;  4A3B B;  1PFM A;  2PW5 A;  1Y1W H;  3CXC A;  1B9M A;  3K5L A;  2VQF Q;  1DD2 A;  1BNZ A;  2HHH L;  3I90 A;  3QO2 A;  3HOX B;  5I4D A;  2R93 H;  2KVM A;  2A73 B;  1ESF A;  2F52 A;  2WB1 E;  3PSI A;  3SEB A;  5CV9 A;  5I6W A;  2RCF A;  3FPU B;  4NP5 A;  2AWO A;  1UAP A;  2F0H A;  2X6G A;  1GM5 A;  4GKJ Q;  2K52 A;  2YTY A;  3HGB A;  5IT9 E;  1C8C A;  1K28 A;  2NN6 I;  3DM1 A;  2V4D A;  1N33 L;  1YBY A;  3VR6 A;  2OF1 A;  1DCZ A;  1XJV A;  2PQE A;  1A3V A;  3OHX C;  3ULJ A;  3UDG A;  1ENA A;  4BBS H;  3LWE A;  1ZYR D;  5FKA C;  1I6V C;  3PIO A;  2DJG C;  4POG A;  4DR4 L;  3S9W A;  1W2B A;  5FK9 C;  1MD2 D;  3MHB A;  1GHK A;  3BDL A;  4IUT A;  1VQA A;  4K5X A;  1R9T B;  3FMC A;  4M8A A;  4JI7 L;  4FF1 A;  4K8J A;  3DHQ A;  1WTH A;  1HRJ A;  2K5Q A;  4ABN A;  2PZW A;  1KQS A;  4DV2 L;  1K73 C;  4IOA A;  5JVG 3;  4DN4 M;  5E4X A;  4DV3 L;  1KAB A;  3O13 A;  4L5Q A;  4L5R C;  2IL8 A;  1RD9 D;  5EBD A;  1N36 L;  3GDE A;  4DR2 Q;  4A3D B;  5KND A;  1SNP A;  3OMG A;  1S5F D;  2E2I H;  2NTT A;  4FDB A;  1L0Y B;  2KJX A;  1PV4 A;  1X3P A;  2DNE A;  4RGM A;  3U58 A;  2RA4 A;  4B3M Q;  1OXU A;  3ERS X;  1DOM A;  1STB A;  1F2Y A;  4UDU C;  2BDO A;  1VQ5 A;  2D0O A;  1G6Z A;  1GO3 E;  2MFI A;  5IE8 A;  4XT1 B;  3DWQ A;  3E6Z X;  3WOF A;  5EKK A;  1HNX Q;  1HCZ A;  2F0F A;  2JSO A;  5F2D A;  3K5M A;  2VUM G;  4NXM Q;  3EQL C;  3FP9 A;  3OSO A;  2RDG A;  1A3T A;  4ZQ3 A;  2SOB A;  4L5T A;  1YJ9 A;  1U0L A;  4RG1 A;  1ICW A;  1STA A;  3A54 A;  3F2B A;  1Q82 C;  1STN A;  1EU4 A;  2JN4 A;  4FF2 A;  1Q1B A;  1IZ6 A;  1AW7 A;  3CCJ A;  3R2I A;  4PG3 A;  1TS5 A;  1HZ9 A;  3RN2 A;  5C3E G;  2R92 H;  3L0O A;  2OTJ A;  4IPG A;  2Z0S A;  1CA5 A;  1JC7 A;  1FGB D;  4KJN A;  3EFX D;  4CKC A;  1TWC H;  3HOZ B;  3PIO 3;  3HOY G;  3NEN A;  3JAM L;  2E2H H;  4HIK A;  2KUM A;  2EJF C;  1SNC A;  5LMN W;  2RCN A;  1R4Q B;  2F0O A;  5K36 H;  4BY1 H;  1LM0 A;  5EKL A;  1U4L A;  1N8R C;  1BCP F;  3M4P A;  3R93 A;  3J7A F;  3VDY A;  2JA5 B;  2O4X A;  3CC7 A;  4QQB X;  1O7Z A;  1RKN A;  3GP7 A;  2A8V A;  1E2V A;  1X6O A;  4A3I H;  1XYI A;  5K5P A;  1PH3 A;  1XNR L;  2QDL A;  4B9W A;  2G5D A;  4DV4 L;  3SK8 A;  5M9O A;  3GQB A;  3NEL A;  4PMC A;  4JBK A;  3M85 A;  2NVQ H;  2QGQ A;  1QVF A;  3BVG A;  2SDF A;  1D7Q A;  3DEP A;  1SND A;  2TMP A;  3J80 L;  1TXY A;  1VDZ A;  3ND9 A;  2KHI A;  3S15 B;  4RA8 A;  2JJQ A;  1J6Q A;  3KLS A;  4X3U A;  1GUT A;  2HCC A;  2Q2T A;  4KV6 A;  1ZXT A;  3S1M B;  4CDE C;  3CC4 A;  2PZT A;  4RGT A;  2TSS A;  2NBF A;  5FJ8 H;  3J81 i;  2HHH Q;  4Q5V A;  3F2U A;  5IGD A;  1NTG A;  1LTA D;  1NNX A;  3M4O B;  3VYS A;  1HQM C;  1XWE A;  5D65 A;  2SEB D;  4DK6 C;  4A3B G;  1O7L A;  4MHE A;  4KTA A;  5CV6 A;  1J8I A;  4P72 A;  1LV9 A;  4K6L A;  2VQE L;  5M5W B;  4X62 L;  2A1A A;  1X3E A;  3HOX G;  3GV6 A;  2FXQ A;  3MEF A;  4IO9 A;  2OEO A;  2EXD A;  1VQL A;  3J80 E;  2F0U A;  4U67 3;  1EEF D;  2EYJ A;  3ZYY X;  2ES2 A;  2RHQ B;  4DK0 A;  5IWA L;  4FF4 A;  2ALY B;  2DNC A;  4K2L A;  4A4I A;  4GN4 B;  1UEB A;  4KHP L;  4H02 A;  1NSN S;  4UP8 A;  3CP0 A;  1V43 A;  2BCO A;  2ICI A;  3ERQ A;  1G6P A;  3MFY A;  3V96 A;  4JV5 L;  4X6A H;  1L0W A;  3I4N H;  1EQR A;  1YHQ A;  1X32 A;  3KF6 A;  3ONA B;  2RQX A;  1C48 A;  3OWF A;  2K01 A;  1NBW A;  5COY A;  4JI2 L;  4FXK C;  4DV5 L;  4K5V A;  4JI3 L;  1LLR D;  4IFD J;  3CRK C;  3PF4 A;  4ZCK A;  2F03 A;  4JOI A;  4OWW B;  2L55 A;  3T1H Q;  2HIX A;  4LF9 L;  4OGQ C;  5LHY 1;  3I72 A;  4DV3 Q;  1W6J A;  1K83 H;  2KCC A;  3S16 B;  2R61 A;  2JK8 A;  1SJH D;  1JMC A;  2EY2 A;  1N36 Q;  1A3U A;  5KNC A;  2A6E C;  2K32 A;  4DFA A;  2F3W A;  1JOQ A;  3IFT A;  2AKW B;  1R4P B;  4X3T A;  3DWA A;  3IRB A;  1FR3 A;  2KHS A;  4J6H A;  3NEM A;  4NW2 A;  1U5K A;  5CC4 A;  2KCT A;  1KTK A;  3R2T A;  4RMF A;  3K7A H;  3PO3 B;  4A3D G;  2PO4 A;  3MC0 B;  3S24 A;  1B4O A;  4IUR A;  3KBG A;  3E3X A;  1ICF B;  1TU2 B;  3SK6 A;  1I4H A;  1EYG A;  4C1N K;  3ULL A;  3VYU A;  3HFZ B;  1WTW A;  4A3M B;  2BH2 A;  2C9O A;  1CI3 M;  3UI2 A;  2B2V A;  5J39 A;  1WVL A;  1ILP A;  1K0R A;  2IJ0 A;  1MGS A;  4IFD H;  1CSQ A;  1PYW D;  2SNM A;  2K5W A;  2IX0 A;  4UP9 A;  5GAH C;  1S5E D;  2KED A;  2R6G A;  3AFQ A;  4F7X A;  5KRU A;  2AMC B;  4APV A;  4LUV A;  2C5C A;  5I2X A;  2PZU A;  2F0K A;  4RKB A;  2R7Z B;  3A7L A;  1CM9 A;  4BBR H;  3RD4 A;  1ZEQ X;  4I7Z C;  2XGT A;  2AQ1 B;  1I5F A;  3NUC A;  1STH A;  4IPD A;  3OOC A;  1F2L A;  1IW7 D;  2JA6 B;  3P20 A;  2MUY A;  1TWA H;  2CWA A;  3HOZ G;  4DUZ L;  3M3Y B;  1Z7T A;  1LTS D;  4KJO A;  1SNQ A;  4G7H C;  1Y1V B;  2EVB A;  2CCZ A;  1IHZ A;  1XNR Q;  1FJG L;  4DV4 Q;  1T5X D;  3HP3 A;  2ZTD A;  2D62 A;  4HED A;  2UUB L;  2H1E A;  2VNU D;  5IIF A;  2JA5 G;  5KIX A;  4DR3 L;  1Q7Y C;  1OTC A;  1PTO B;  2I5H A;  4DR1 L;  1EYD A;  4DXF A;  4KKS A;  4KN7 C;  3BU2 A;  2VQF L;  1YNJ C;  2JA7 B;  4AQY L;  5IY0 A;  2KHJ A;  3CC2 A;  2B63 B;  3H94 A;  2UXC L;  2Y0S B;  4X64 L;  3S1Q B;  5DM6 3;  1TY2 A;  1JIC A;  4QMG A;  4HJ8 A;  3GV3 A;  4HAE A;  1TWF B;  3ITP A;  1RTO A;  4FP5 D;  4NPS A;  1D5M C;  3CF5 A;  5LMU Q;  1XX8 A;  4HSV A;  3G6E A;  3AMU A;  2F0L A;  4V0B A;  1EEI D;  1KNA A;  4N9T A;  5IYC H;  3EBE A;  4GOP C;  1KC8 C;  3SHL A;  2E8G A;  4C3J B;  5BN4 A;  1RCV D;  2N8N A;  5BN5 A;  1E2Z A;  1EY6 A;  5C6A A;  1QNU A;  1VQ9 A;  4RGO S;  5EAY A;  2J0T D;  3GTL B;  2VZA A;  4FO2 A;  1QZG A;  5IT9 c;  3I56 A;  4X62 Q;  1K8G A;  4DK3 C;  4LUO A;  3TP7 A;  5KYI A;  3VYR A;  4Z9C B;  2HT1 A;  3HOU B;  4OO1 G;  3J7A 5;  3QG1 A;  3C1F A;  3M4Y A;  1F77 A;  1IXR A;  4DPG A;  4EQ5 A;  2UU9 L;  1VQP A;  4JW0 A;  5IWA Q;  5EBC A;  1UE1 A;  4DAV A;  2ZM6 L;  4JBM A;  1EWC A;  2E2J B;  4QUF A;  4HJA A;  3K8A A;  2F0T A;  4RCO A;  4YCU A;  1WD0 A;  1D2B A;  3G48 A;  4PMB A;  3I70 A;  2EYM A;  4JV5 Q;  1IBK L;  4LNQ A;  4RFB A;  2Z9H A;  3RR5 A;  4B3T L;  3AEV A;  1C0A A;  1PH5 A;  4XIG S;  1PRT C;  5C3W A;  4JI2 Q;  2F0N A;  4DV5 Q;  5M5Y H;  4JI3 Q;  2KOL A;  5GQO A;  3I4O A;  1NR2 A;  1CUK A;  1KLU D;  1NMG A;  5C0X J;  2NVX B;  1IKM A;  2L1B A;  3QWN A;  4XT3 B;  3CMA A;  2I5L X;  3EVQ A;  3X3M A;  2X69 A;  2K1B A;  4LF9 Q;  2LSS A;  1MJE A;  2IHE A;  3B6Y A;  3PGZ A;  1Q8K A;  4NB3 A;  4ZYS A;  2B2V C;  1F9Q A;  3S2H H;  3TME A;  4HSP A;  3TZD A;  2CQO A;  4LFC L;  1EFI D;  4HIM A;  3TP5 A;  1RJT A;  5DAU A;  2WV6 D;  2K5D A;  3S17 B;  3FVQ A;  1VQ4 A;  4JI8 L;  2K03 A;  2AQ3 B;  5DLQ E;  3GTG H;  3M9B A;  3MWY W;  2NVY H;  2PW7 A;  4A3F B;  5C4X B;  4YWK A;  5JAV A;  3I91 A;  2MO0 A;  2BDN A;  5CMD A;  1B3Q A;  1MBY A;  5AFW A;  4N8F A;  4CJ1 B;  4A3K B;  3ICE A;  3D4D A;  5TSS A;  3C1E A;  1X9N A;  3RLF A;  2XWB B;  3GTK B;  3PO3 G;  1ASZ A;  2BH8 A;  1X3G A;  4K8I A;  2AUJ D;  3P1H A;  4RAU C;  3S1N B;  2UXB L;  2JA8 H;  3OPO A;  4MNO A;  3P75 A;  2HUG A;  4A3M G;  3L2P A;  3GTM B;  3MXG A;  1PTO D;  1JJC B;  4CBV A;  2VW9 A;  5T1I A;  3D4W A;  4JI1 L;  2UUC Q;  5ELO A;  1EY0 A;  3Q23 A;  1GHJ A;  1LYL A;  3KF6 B;  3DEO A;  5C4J B;  3H91 A;  3BDO A;  4JI0 L;  1Q81 C;  1J5E Q;  1JR0 D;  4B08 A;  4FNF A;  1KDB A;  5M3F H;  2KA7 A;  1SE4 A;  4H13 C;  2R7Z G;  2Q8R E;  1TWH H;  1FJG Q;  1YNN D;  2F0S A;  1MJC A;  2H5X A;  2F4V L;  1BCP C;  2EDG A;  4ZUI A;  1QUQ A;  1PH1 A;  1DXM A;  2JA6 G;  4A3E B;  1BVS A;  2UUB Q;  1RIP A;  2CH4 A;  1FYC A;  3KFU A;  1I4R A;  4DR3 Q;  1Y1V G;  2HDL A;  1JWM D;  5JJZ A;  5JVH 3;  1FNW A;  4DR1 Q;  1G2S A;  3D6W A;  2A68 D;  1GVP A;  5ELB A;  4EX5 A;  4EQO A;  3A5Z B;  1V8Q A;  4AQY Q;  1EIG A;  3I4M B;  4X64 Q;  2UXC Q;  3Q6S A;  3IL8 A;  1TWG B;  4C3I B;  2EOT A;  1GOZ A;  2YU9 H;  3VA7 A;  2XRQ D;  5I2Y A;  1YZ6 A;  2JA7 G;  5HGT A;  5HUR A;  4X66 Q;  4X65 L;  2B63 G;  2A6H D;  3TS0 A;  2Y0S G;  3M7G A;  1SJE D;  1YHB A;  3OW2 A;  5FLX E;  4KMU C;  4K0K L;  1MKH A;  3RZO B;  2PYK A;  4DV6 L;  1RHP A;  1I6H H;  1MSH A;  4YCW A;  1EZ8 A;  3KLW A;  3J81 L;  4A3D H;  5IOD A;  5A35 A;  1PRT F;  1A2U A;  2PI2 E;  1EY7 A;  3NQT A;  3H3V H;  1SYF A;  1JE5 A;  4JCV E;  2CW0 D;  5G3L D;  5JOB A;  4B3S L;  1QWY A;  4C3J G;  3CCR A;  1OO9 B;  2IHF A;  2VB3 X;  3STB C;  2UU9 Q;  2DY7 A;  3S14 B;  1O80 A;  2G9D A;  2ZM6 Q;  4DR7 L;  3PQI A;  4LF8 L;  1VMP A;  1I4Q A;  2EXZ A;  2LKV A;  5CGK A;  3HOU G;  1K8M A;  3NWT A;  1PFN A;  3T1H L;  2V1C C;  1XMO L;  3D8G A;  4G4K A;  1IBK Q;  3GTP H;  2VY3 A;  3A56 A;  4DR5 Q;  4B3T Q;  1A0I A;  2BE5 D;  2RKS A;  2D5D A;  5KYL A;  4NKL A;  1I50 H;  4R1J A;  1EWI A;  5M3M B;  3DMU A;  2XIW A;  1Q90 A;  1SMY C;  2EY6 A;  3CCS A;  3SXH A;  1E1T A;  1SDF A;  4M1U B;  1S72 A;  3DUZ A;  3R3O A;  4R4T A;  4ODG A;  3QOJ A;  4JPB W;  4O0A A;  3H0G B;  1SRO A;  2NVT B;  1KD1 C;  1S5D D;  1B53 A;  5HY6 A;  1CSP A;  3CQZ B;  4L6T B;  4LK1 C;  3F1Z A;  1MIU A;  1C7Y A;  4LF5 Q;  3HOZ H;  1WYD A;  1SYD A;  1XTC D;  3CCL A;  2E76 C;  4IJH A;  4BBS B;  1JOO A;  2IPK D;  1FD7 D;  3G6J B;  2KBN A;  4YY3 L;  4LUZ A;  4LFC Q;  1JJG A;  1PXU A;  3QJY A;  1Q1E A;  3QR8 A;  4C1N I;  4JI8 Q;  5JEA G;  5E3F A;  1PFB A;  3PMF A;  1LT3 D;  2JA5 H;  2EPB A;  1PZJ D;  3UDX A;  4UAI A;  2XN9 C;  4O42 A;  1BCP B;  2OCE A;  3C46 A;  4DV1 L;  1KRS A;  2ZXR A;  3TS2 A;  3VR4 A;  1G2T A;  1B8A A;  3OWE B;  5GAD C;  3SDZ A;  1EFW A;  4A3F G;  5C4X G;  2M2L A;  4EQP A;  1NJI C;  5A2Q L;  1JT8 A;  2WB1 B;  4FXD A;  4HR7 B;  4PQX A;  2ZTC A;  1EIH A;  4A3K G;  4A93 B;  2UXB Q;  1VQI A;  2ZT9 C;  1PLF A;  1H9S A;  2OQ0 A;  4OWX B;  2CFM A;  2E2I B;  4QCL A;  3AQQ A;  1AZP A;  2JEA I;  3TP8 A;  4R4O A;  4K5W A;  2JQO A;  3S1M H;  1T5E A;  2FMM A;  4IJL A;  4JI1 Q;  2PMZ B;  4BA2 I;  4DXG A;  2RHS B;  2KQ3 A;  1VQN A;  1CT1 D;  5E1F A;  2JA9 A;  4CJ0 B;  1F9P A;  4OO1 H;  3S1R B;  1OXX K;  3T51 B;  3I8Z A;  1X65 A;  4G7Z C;  5M5X B;  4JI0 Q;  4KN4 C;  3NWS A;  3CCV A;  1JQY D;  2ENB A;  4YWL A;  3C3L A;  1BR9 A;  1B50 A;  2A69 D;  5C3X A;  3Q0A A;  5M5W H;  5ELN A;  4PMW A;  1WTP A;  2F4V Q;  1L2F A;  5J1Z A;  1SNM A;  4AH6 A;  1JE4 A;  5ELF A;  1AN8 A;  1HTL D;  5CV8 A;  2PQA A;  1DYQ A;  1U4M A;  3JAM E;  5C0X G;  2F0Q A;  4OX9 L;  3DLL A;  2F0G A;  4CDD C;  2D2C C;  1D5Z C;  3E5S A;  2WFW A;  4WJW A;  2G9H D;  5LMU L;  1TWC B;  3FKI B;  5IP9 H;  4R8N A;  4A3E G;  1HNW L;  5AJ3 L;  1HZA A;  5BN3 A;  1YJW A;  3KLR A;  4BY1 B;  2Z6B A;  2KCN A;  1I4X A;  4R4I A;  4YHH L;  1EYA A;  2F0M A;  4H0L C;  4JYA L;  4ZAI A;  3KK7 A;  1UWV A;  3Q8D A;  1A63 A;  2X6L A;  3FHW A;  1SRU A;  4X65 Q;  1FL0 A;  3I4M G;  3HRZ C;  4B9X A;  1WTV A;  5IYD G;  4K0K Q;  4C3I G;  1CK1 A;  4GZY C;  3S16 H;  2OWO A;  4DV6 Q;  2GN5 A;  4PZ8 A;  1N9W A;  3HKS A;  1VMC A;  2VXW A;  2Z1C A;  1E24 A;  3GTJ H;  1ZKO A;  3A55 A;  4KKT A;  2PNH A;  4GLV B;  3K80 C;  2ZXO A;  1X3F A;  3PUZ A;  2ZJQ A;  4B3S Q;  2R3Z A;  1EQQ A;  4GOP A;  1B44 D;  3GTQ B;  1LT4 D;  4RCN A;  4FYD A;  4RHR A;  1EY5 A;  2Q2H A;  3T56 B;  2K5H A;  3PO3 H;  4DR7 Q;  3MXN A;  4JI5 L;  4LF8 Q;  5BR8 L;  3G7L A;  2QCP X;  1TQO A;  1SFO H;  2EYF A;  1XMO Q;  4DV7 L;  5EPL A;  5C4H A;  2QF7 A;  5EGT A;  1IBL L;  3BJU A;  5DNF A;  3CCM A;  2NN6 G;  4FVM A;  5FO9 B;  4CKE A;  2R7F A;  3NP8 A;  2IWH A;  2A19 A;  1ILQ A;  1PZI D;  2ICE C;  2P5Z X;  4RH6 A;  1KL9 A;  3WDN A;  1VCI A;  4P71 A;  1QUQ B;  1MSG A;  2VB2 X;  2Y0S E;  4GKK L;  3OMC A;  3BZC A;  4HID A;  5CYU A;  3HOV B;  3RLN A;  1WCM H;  2QA4 A;  5M3M G;  5ISR A;  2B2Y C;  1SSO A;  1XPR A;  4XDX A;  1HH2 P;  1C4Q A;  1VQC A;  4YY3 Q;  3H0G G;  1PFS A;  1IKL A;  1F9S A;  2HCI A;  3EJI A;  4J15 A;  3TDQ A;  3TRZ A;  2NYZ D;  2Z8L A;  5CV5 A;  1HQR D;  2K7V A;  4TSS A;  5D14 A;  1JOR A;  3M3Y H;  2E5L L;  2GVB A;  2YV5 A;  1K8O A;  4BBS G;  4A3J B;  1Y1V H;  3W5O A;  1BO0 A;  1GUG A;  4HJ5 A;  2F0W A;  3FPP A;  4DV1 Q;  4ZLT F;  1Z6H A;  2XTI A;  3I73 A;  2FJ2 A;  1OXT A;  3DM3 A;  1E3P A;  4XYQ A;  1O7I A;  1IYJ B;  1E1O A;  4R4C A;  4XQN A;  4P74 A;  1CQV A;  4DF7 A;  1K83 B;  1PTO H;  4YIJ A;  2UUC L;  3HEJ A;  2F0I A;  1QVG A;  3BZK A;  3VYT A;  5KNB A;  2EYO A;  3A74 A;  1U9R A;  4ZK9 B;  4FF3 A;  4L8J A;  2HQL A;  1TWF H;  1PH7 A;  1NY4 A;  1J5E L;  1VQG A;  4ZRZ A;  4POF A;  1L0X B;  3SE0 A;  3Q22 A;  3KUP A;  1EZ6 A;  1ZYR C;  4A93 G;  1FVI A;  1HJP A;  3K7A B;  4UHV A;  3KJP A;  4JI4 Q;  1ONL A;  4F88 A;  3PUX A;  3NQI A;  1A62 A;  5D3D A;  1QJO A;  1HR0 L;  2D9U A;  2WII B;  4NXN L;  1F9R A;  3KBX A;  4C3J H;  3NBI A;  4UP7 A;  2AQ2 B;  4A3L G;  4BY7 B;  4C56 C;  4UPA A;  1BBU A;  3J81 j;  5JEA J;  2OQK A;  4YCV A;  2K05 A;  3K5O A;  1SYB A;  2RVL A;  2DJF C;  1XXG A;  1F2Z A;  1B7Y B;  4ZUJ A;  1XPO A;  3PUY A;  1YI2 A;  2O2L D;  1VQK A;  1H9J A;  1PYB A;  3CRL C;  5FO8 B;  3RZD H;  1SYG A;  4DUY L;  1XPU A;  2AHO B;  3NSW A;  1D8L A;  2I46 A;  4OX9 Q;  2K14 A;  1KDA A;  5JPN C;  2GA4 B;  1B3A A;  3V05 A;  4KD4 A;  3PO2 B;  3SR1 A;  2CQA A;  3A7A B;  4CDC C;  4X66 L;  4OEL B;  3TP6 A;  1HNW Q;  3U4V A;  5AJ3 Q;  4BBR B;  3SK4 A;  1JOK A;  1B70 B;  1TKW B;  3S2D H;  1EWH A;  4C2M B;  4YHH Q;  2IW3 A;  4GNX C;  2WAQ B;  1J9O A;  1A2T A;  4JYA Q;  3CD6 A;  1TWA B;  2KEE A;  3K7U C;  2I0Q A;  3FKI G;  1BXT A;  1KLG D;  4IOC A;  3FRP B;  1CA6 A;  1Y8O B;  1P8L A;  3BG3 A;  3TQY A;  5COR A;  4A3G B;  5ELE A;  3SGI A;  5FLX c;  5K36 G;  2VUM H;  1V1O A;  4BY1 G;  2EYL A;  5T1G A;  3W1B A;  1TS2 A;  2RDH A;  4OEM B;  3L7Z C;  1EY4 A;  2K6A A;  1UUP A;  5GAE C;  4G7O C;  1GXD C;  2LFN A;  5IGC A;  4JG2 A;  1H95 A;  1H9S B;  3NPP A;  1KNE A;  2F0V A;  4ME3 A;  1QIL A;  3S17 H;  1JCK B;  4JI6 L;  2RF4 A;  4DR5 L;  5C3E H;  3GTO H;  1HPC A;  3NTK A;  3NXW A;  3QB3 A;  4XYO A;  1I3Q H;  4A75 A;  2F4I A;  4DV0 L;  1CKN A;  4J8Q A;  1KXL A;  1GUN A;  4JI5 Q;  3M4Q A;  4QIW B;  5BR8 Q;  2QEJ C;  3PUW A;  3HOY H;  4Y7N H;  4DV7 Q;  2CKZ B;  2EYP A;  2LMC B;  2LS0 1;  1Y14 B;  5I6Y A;  3T16 A;  1IBL Q;  4LF6 L;  2Z4I A;  2Q8T A;  2OTL A;  3J7Y W;  3MTS A;  4A76 A;  1PH6 A;  2B39 A;  3HOW B;  1LO5 D;  4BWG B;  3NE5 B;  4LF5 L;  3X3N A;  3K0X A;  3MVV A;  2QKI C;  1VQB A;  1D1I A;  2KCM A;  4PV1 C;  4PZ6 A;  3S1N H;  4AYB B;  3ERO A;  1XMQ L;  4CGY B;  1Z9F A;  2CH4 W;  2L5T A;  5FJ8 G;  4GKK Q;  2HIV A;  2A74 C;  2QEX A;  3E0E A;  2PQA B;  1EQV A;  4N9P A;  1EUJ A;  5NUC A;  4DNR B;  2ZJP A;  4QF4 A;  1QOH A;  3WOE A;  1ENC A;  4TKO B;  1I4G A;  2YTV A;  1AP0 A;  3KF8 A;  4X3S A;  3L3O C;  4DR6 L;  3BDC A;  1FNV A;  1E0B A;  2N88 A;  1Q12 A;  4P2C B;  3HOV G;  4B3R Q;  1PHJ A;  4IUV A;  2L4N A;  4ILW A;  3UE1 A;  1PA6 A;  4IUU A;  4KK7 A;  2E5L Q;  3NTI A;  5C0X H;  2J7Z A;  2OT2 A;  2XNA C;  1CZG A;  4GN5 A;  4IUP A;  2WP8 J;  4ME5 A;  4LF7 L;  2EJG C;  4EQN A;  2WIN B;  4ZKB B;  1BF4 A;  2LXK A;  2Z4H A;  4HMJ A;  2F3V A;  1D5X C;  1KDC A;  1H9R A;  3G4S A;  5CR3 A;  4HTH A;  1I4P A;  4A3J G;  2ASB A;  4A3B H;  1JB7 A;  1EOT A;  2L11 A;  1VQF A;  2EE1 A;  1UE5 A;  3S2H B;  3T1Y L;  4GOP B;  4C3H B;  3HOX H;  5EPJ A;  3I4M H;  1B1Z A;  5C5M A;  1K9M C;  3TZU A;  1ESR A;  3H3V C;  1L1O A;  4C3I H;  4MTK A;  3AYH B;  3MXN B;  3GTG B;  4UY8 C;  1SYC A;  4RHS A;  4AIM A;  5IGE A;  4XTC S;  5EJW A;  2NVY B;  1SN8 A;  3KJO A;  5C44 B;  2VS1 A;  1ET6 A;  1A6X A;  3OYY A;  4JBJ A;  3IFD A;  5DM7 3;  3BZD B;  2NTS A;  1UE6 A;  1HR0 Q;  1S40 A;  2A6E D;  3W1G A;  4QY7 A;  2CHB D;  3K5N A;  1M1K C;  4NXN Q;  1NAP A;  3T4A C;  3CCU A;  5IT9 L;  2WAC A;  3KLS X;  2PPB C;  1O78 A;  1PH4 A;  1JWU D;  1YEZ A;  1HTP A;  1D6E C;  1UEA B;  3RLO A;  1G51 A;  2FMC A;  1U4R A;  3CU7 A;  4FXG C;  5L37 A;  1LTG D;  2WKD A;  2JA8 B;  2MPM A;  1PRT B;  4BY7 G;  2XSC A;  4MTN A;  4PNY A;  2NN6 H;  2MJ8 A;  3JAM c;  1IBM L;  4KHZ A;  4DUY Q;  1Q86 C;  2XWJ B;  2PNR C;  1LAC A;  1R9T H;  3A8J E;  3R8B A;  3CW2 C;  4JBW A;  2XRS D;  3K57 A;  2M00 A;  1VS0 A;  1VQE A;  1E7Z A;  1EY8 A;  2B2U A;  1PH9 A;  3V2T A;  3WWV A;  1P16 A;  3TRE A;  2RDF A;  2PCF B;  3D31 A;  1QB5 D;  4F87 A;  1YHA A;  1BDO A;  2QDB A;  1YIT A;  1VQD A;  1HFG A;  1VQH A;  1DOK A;  2EZV A;  5M3M H;  4KY5 A;  3AFP A;  3PCO B;  3PO2 G;  3F2C A;  3AB9 A;  4CJ2 C;  1JWS D;  1TS3 A;  3A8I E;  3W3A A;  4IN3 A;  5M3F B;  1VQ7 A;  1LTB D;  4HCS A;  3H0G H;  5J3B A;  2NVT H;  1IYV A;  3D6C A;  4BBR G;  1GUS A;  1TWH B;  3J80 c;  4X3K A;  1X3Q A;  3E9H A;  3CQZ H;  1E22 A;  4L63 B;  1WTX A;  3HKZ B;  2WAQ G;  4EGV A;  2A5H A;  1I94 Q;  4K2K A;  2PMZ E;  4DK1 A;  1JJ2 A;  3PF5 A;  2JE6 I;  2ID0 A;  1K3R A;  4U68 A;  4A3G G;  1SYE A;  4RWS C;  3UE0 A;  5I9O A;  1Y1W B;  4JI6 Q;  2ZJR A;  4G57 A;  3CME A;  1HHV A;  1SE8 A;  4DAM A;  1AEX A;  3DWP A;  2R93 B;  3CPW A;  4DV0 Q;  2K75 A;  2IT1 A;  3H3V I;  1TII D;  3DXJ C;  3TN2 A;  2YU9 B;  4OL7 A;  5CBA E;  2AUK A;  4IQZ A;  2N49 A;  4OWT B;  1GUW A;  3MA2 B;  4WJ3 M;  1IW7 C;  2MQH A;  1OXS C;  4LF6 Q;  4F8M A;  5HGQ A;  1YNJ D;  3J81 E;  2YYZ A;  1TT2 A;  4KY7 A;  2CVR A;  2K5N A;  1DGS A;  4A93 H;  1I6H B;  1S5B D;  4QL5 A;  5GAG C;  1XMQ Q;  3PV0 A;  5FLM G;  1T9H A;  4NMZ A;  3CPF A;  2WKC A;  5D3I B;  5IYC G;  3HOW G;  4A3L H;  2KEC A; 
#chains in the Genus database with same CATH homology
 1HXY D;  2NWG A;  3SK5 A;  1STE A;  1EL0 A;  3BYT B;  2F0J A;  4IZ8 A;  3A8K E;  2H4O A;  3U9O A;  3GTP B;  1WTO A;  2EY5 A;  1TS4 A;  4XQQ A;  2B2Y A;  1I50 B;  4RGN A;  1CHQ D;  1W6K A;  1ENF A;  3MXU A;  1DM0 B;  4KI0 A;  1NR4 A;  4EVO A;  2F0D A;  3NHH A;  3I3C A;  3ND8 A;  1PRT D;  2QIL A;  2JP1 A;  1LAB A;  3K59 A;  2JEB I;  1GUO A;  2B2T C;  1II3 A;  2AWN A;  1LT6 D;  2HDM A;  2B2U C;  4C3H G;  1RF2 D;  2Q8I B;  2FHT A;  3QOL A;  5A2Q E;  2B2W A;  1V1P A;  2R92 B;  3C2P A;  4E6I A;  1Q8I A;  3TBI B;  1DON A;  4TRD A;  4OO1 I;  2BOS A;  2E2H B;  3MFG A;  1U4P A;  2O5I C;  1UNS A;  1PZK D;  3URY A;  1Y8N B;  4OIK A;  2K28 A;  4A3I B;  3BYY B;  4WOR A;  4DAY A;  1M4V A;  4WRD A;  1G8Z D;  4R9W A;  2NVQ B;  1LTR D;  3MZ5 A;  3NBH A;  3MAQ A;  2E75 C;  2L0C A;  3HS0 C;  1G91 A;  1DJR D;  2HQE A;  1M8A A;  3H09 A;  5EPK A;  2L9H A;  3FEW X;  3W2D A;  4OIJ A;  5CV4 A;  4MIU A;  3OIQ A;  4DNT B;  3L9A X;  2FIN B;  2F0E A;  3M7N A;  1PTO C;  5IGB A;  3MXP A;  1BCP D;  1EYC A;  1DOL A;  1SXT A;  3BVM A;  3HZX A;  2SNS A;  4MN3 A;  1SAP A;  3VA5 A;  2F1M A;  2N55 A;  1Q3L A;  1CFM A;  3CHB D;  3BVZ A;  4O1N A;  1SE3 A;  3J7A V;  4ID6 A;  2K33 A;  3FDT A;  5EKI A;  2ZXP A;  1YNN C;  3GTJ B;  4HCE A;  2B8G A;  3K58 A;  5CBE E;  1LTT D;  3MEH A;  1PDQ A;  1HUN A;  3I4N B;  4CHT B;  2E74 C;  4DA2 A;  2A68 C;  5IOC A;  4S3S A;  5C4Z A;  3P7J A;  1S4Z A;  1CZW A;  3N52 A;  2IX1 A;  1D1K A;  1SFO B;  5KGU A;  1B2T A;  1Y8P B;  1H9K A;  3OIP A;  2EJM A;  3HG9 A;  2F0P A;  1TR5 A;  3NK9 A;  3TSS A;  3GD7 A;  2J4X A;  2A6H C;  5FO7 B;  5DEH A;  3OW7 A;  4I65 A;  2RSO A;  5JPM C;  3T13 A;  4IFD I;  2B2W C;  2K04 A;  2NUC A;  4QB4 A;  1WCM B;  1STY A;  4JK1 C;  2MP1 A;  2OXP A;  4HN7 A;  2CW0 C;  4KD3 A;  1SMY D;  1EY9 A;  2NB0 A;  1BQQ T;  1EQT A;  1GJX A;  1QG7 A;  4KY6 A;  4Q0F A;  4OHJ A;  1SEB D;  1Y69 U;  2MGS A;  5E4W C;  5ELD A;  4QUC A;  1HFN A;  3T53 B;  4KHV A;  2BE5 C;  4KKU A;  1QCB D;  4LAA A;  3K0Y A;  5IGG A;  5CV7 A;  1SBB B;  4R8I A;  2EYH A;  3D4R A;  3EA6 A;  5LL6 X;  4DGZ A;  2EY1 A;  1NCV A;  3BS1 A;  1WTR A;  1A15 A;  1QNK A;  2B8F A;  4V19 0;  4BA1 I;  3SVM A;  5LL6 S;  1DZ1 A;  3PUV A;  2JXM B;  3LX0 A;  1KAA A;  1IYU A;  1RTN A;  5JEA H;  3QIA A;  1PTO F;  2JYO A;  5KEE A;  3I4L A;  2RBM A;  1ML0 D;  1S5C D;  4K6D A;  4TQU S;  3U9S A;  1B9N A;  2E2D C;  3RZD B;  5I9P A;  3PIP 3;  1AFP A;  1CTM A;  1BOS A;  3NTH A;  4DU9 A;  1WTQ A;  5FOB B;  1WD1 A;  1ET9 A;  4NDX A;  3IKJ A;  2BA1 A;  1O7Y A;  1SNO A;  3E0J A;  4ULL A;  3IAY A;  4BS9 A;  3S2D B;  1Z47 A;  4RKL A;  5C5L A;  1H9M A;  3GO5 A;  2LY7 A;  1BBX C;  1V1P B;  3D3R A;  3AU7 A;  1VF7 A;  1FNU A;  1HA5 A;  2VUM B;  1SE2 A;  3Q24 A;  2A69 C;  1CHP D;  2M9V A;  4LJZ C;  1HA6 A;  1PMR A;  1RDP D;  1VF5 C;  5J22 A;  3N6R A;  4IAL A;  4XXE A;  1BUV T;  5EQ0 A;  4XQJ A;  1NUC A;  1LTI D;  5ELC A;  3VR2 A;  1F2M A;  1EU3 A;  5C3E B;  3GTO B;  1TY0 A;  1I3Q B;  5M5Y B;  1TVX A;  1QE6 A;  3HOY B;  5IGF A;  4Y7N B;  1MI2 A;  4LMQ D;  5G3L F;  4IUN A;  4IUQ A;  2I07 B;  3H6M A;  1LT5 D;  3RUZ A;  3CKI B;  2NZ1 D;  2MHV A;  1E2W A;  2DY8 A;  1STG A;  5C0X I;  1ROD A;  1CQF A;  2BA0 A;  1G29 1;  1AZQ A;  4J1M A;  3LWU A;  1HUM A;  4DAP A;  4ZKC B;  1OXV A;  2FFK B;  2DN8 A;  3RMH A;  3VR3 A;  4K14 A;  3LNN A;  2L12 A;  2IX3 A;  4CKB A;  3K6O A;  5FLX L;  1IL8 A;  4H7B A;  2RSN A;  4HMI A;  2XVS A;  4H44 C;  4WFN 3;  1JB3 A;  2B2T A;  2O5J C;  3VR5 A;  4IFD G;  4A3B B;  1PFM A;  2PW5 A;  1B9M A;  3K5L A;  1DD2 A;  1BNZ A;  3I90 A;  3QO2 A;  3HOX B;  5I4D A;  2KVM A;  2A73 B;  1ESF A;  3SEB A;  5CV9 A;  5I6W A;  3FPU B;  4NP5 A;  2AWO A;  1UAP A;  2F0H A;  2X6G A;  3HGB A;  5IT9 E;  1C8C A;  2NN6 I;  3DM1 A;  2V4D A;  3VR6 A;  2OF1 A;  1DCZ A;  2PQE A;  1A3V A;  3OHX C;  1ENA A;  3LWE A;  1ZYR D;  5FKA C;  1I6V C;  3S9W A;  5FK9 C;  1MD2 D;  3MHB A;  1GHK A;  3BDL A;  4IUT A;  4K5X A;  1R9T B;  3FMC A;  4M8A A;  4FF1 A;  4K8J A;  3DHQ A;  1HRJ A;  2K5Q A;  4ABN A;  2PZW A;  5JVG 3;  4DN4 M;  5E4X A;  1KAB A;  3O13 A;  2IL8 A;  1RD9 D;  5EBD A;  4A3D B;  5KND A;  1SNP A;  3OMG A;  1S5F D;  2NTT A;  1L0Y B;  2KJX A;  1X3P A;  2DNE A;  4RGM A;  2RA4 A;  1OXU A;  1DOM A;  1STB A;  1F2Y A;  4UDU C;  2BDO A;  1G6Z A;  4XT1 B;  3DWQ A;  3E6Z X;  3WOF A;  5EKK A;  1HCZ A;  2F0F A;  2JSO A;  5F2D A;  3K5M A;  3EQL C;  3OSO A;  2RDG A;  1A3T A;  4ZQ3 A;  2SOB A;  1ICW A;  1STA A;  3A54 A;  1STN A;  1EU4 A;  4FF2 A;  1Q1B A;  1AW7 A;  3R2I A;  1TS5 A;  1CA5 A;  1JC7 A;  1FGB D;  4KJN A;  3EFX D;  4CKC A;  3HOZ B;  3PIO 3;  3JAM L;  2KUM A;  2EJF C;  1SNC A;  1R4Q B;  2F0O A;  5K36 H;  5EKL A;  1U4L A;  1BCP F;  3R93 A;  3J7A F;  2JA5 B;  2O4X A;  1O7Z A;  1RKN A;  3GP7 A;  1E2V A;  1XYI A;  5K5P A;  4B9W A;  3SK8 A;  5M9O A;  3GQB A;  4PMC A;  3M85 A;  3BVG A;  2SDF A;  3DEP A;  1SND A;  2TMP A;  3J80 L;  1VDZ A;  3ND9 A;  3S15 B;  4RA8 A;  3KLS A;  4X3U A;  1GUT A;  2HCC A;  4KV6 A;  1ZXT A;  3S1M B;  2PZT A;  4RGT A;  2TSS A;  2NBF A;  4Q5V A;  3F2U A;  5IGD A;  1LTA D;  3M4O B;  3VYS A;  1HQM C;  1XWE A;  5D65 A;  2SEB D;  1O7L A;  4MHE A;  4KTA A;  5CV6 A;  1J8I A;  1LV9 A;  4K6L A;  5M5W B;  3GV6 A;  2OEO A;  3J80 E;  2F0U A;  4U67 3;  1EEF D;  2EYJ A;  3ZYY X;  4DK0 A;  4FF4 A;  2DNC A;  4K2L A;  1NSN S;  1V43 A;  2BCO A;  2ICI A;  3ERQ A;  3MFY A;  3V96 A;  1X32 A;  3ONA B;  2RQX A;  1C48 A;  3OWF A;  2K01 A;  5COY A;  4FXK C;  4K5V A;  1LLR D;  4IFD J;  3CRK C;  2F03 A;  2L55 A;  4OGQ C;  5LHY 1;  3I72 A;  1W6J A;  2KCC A;  3S16 B;  2R61 A;  1SJH D;  2EY2 A;  1A3U A;  5KNC A;  2A6E C;  2K32 A;  4DFA A;  2F3W A;  1JOQ A;  3IFT A;  1R4P B;  4X3T A;  3DWA A;  1FR3 A;  2KHS A;  4J6H A;  4NW2 A;  5CC4 A;  1KTK A;  3R2T A;  3PO3 B;  2PO4 A;  3MC0 B;  1B4O A;  4IUR A;  3KBG A;  1TU2 B;  3SK6 A;  1I4H A;  4C1N K;  3VYU A;  1WTW A;  4A3M B;  2C9O A;  1CI3 M;  3UI2 A;  2B2V A;  5J39 A;  1WVL A;  1ILP A;  2IJ0 A;  1MGS A;  4IFD H;  1PYW D;  2SNM A;  2K5W A;  2IX0 A;  1S5E D;  2KED A;  2R6G A;  4F7X A;  5KRU A;  5I2X A;  2C5C A;  2PZU A;  2F0K A;  4RKB A;  2R7Z B;  3A7L A;  1CM9 A;  3RD4 A;  1ZEQ X;  4I7Z C;  2AQ1 B;  3NUC A;  1STH A;  3OOC A;  1F2L A;  1IW7 D;  2JA6 B;  3P20 A;  2MUY A;  3M3Y B;  1Z7T A;  1LTS D;  4KJO A;  1SNQ A;  4G7H C;  1Y1V B;  2EVB A;  1IHZ A;  1T5X D;  3HP3 A;  2D62 A;  4HED A;  2H1E A;  2VNU D;  5IIF A;  5KIX A;  1PTO B;  1EYD A;  4DXF A;  4KKS A;  4KN7 C;  1YNJ C;  2JA7 B;  2B63 B;  3H94 A;  2Y0S B;  3S1Q B;  5DM6 3;  1TY2 A;  1JIC A;  4QMG A;  3GV3 A;  4HAE A;  1TWF B;  3ITP A;  1RTO A;  4FP5 D;  1D5M C;  1XX8 A;  4HSV A;  3AMU A;  2F0L A;  4V0B A;  1EEI D;  1KNA A;  4N9T A;  3SHL A;  4C3J B;  5BN4 A;  1RCV D;  5BN5 A;  1E2Z A;  1EY6 A;  5C6A A;  1QNU A;  4RGO S;  2J0T D;  3GTL B;  4FO2 A;  3TP7 A;  5KYI A;  3VYR A;  4Z9C B;  3HOU B;  4OO1 G;  3QG1 A;  3C1F A;  3M4Y A;  1F77 A;  5EBC A;  4DAV A;  1EWC A;  2E2J B;  4QUF A;  2F0T A;  4RCO A;  1WD0 A;  1D2B A;  4PMB A;  3I70 A;  2EYM A;  4RFB A;  4XIG S;  1PRT C;  5C3W A;  2F0N A;  2KOL A;  1NR2 A;  1KLU D;  5C0X J;  2NVX B;  1IKM A;  2L1B A;  3QWN A;  4XT3 B;  3EVQ A;  3X3M A;  2X69 A;  2K1B A;  4ZYS A;  2B2V C;  1F9Q A;  3TME A;  4HSP A;  3TZD A;  1EFI D;  3TP5 A;  1RJT A;  5DAU A;  2WV6 D;  2K5D A;  3S17 B;  3FVQ A;  2K03 A;  2AQ3 B;  3MWY W;  2PW7 A;  4A3F B;  5C4X B;  5JAV A;  3I91 A;  2BDN A;  5CMD A;  1MBY A;  5AFW A;  4CJ1 B;  4A3K B;  3D4D A;  5TSS A;  3C1E A;  3RLF A;  2XWB B;  3GTK B;  4K8I A;  2AUJ D;  3P1H A;  4RAU C;  3S1N B;  3OPO A;  3P75 A;  2HUG A;  3GTM B;  3MXG A;  1PTO D;  4CBV A;  5T1I A;  3D4W A;  3Q23 A;  1EY0 A;  1GHJ A;  3DEO A;  5C4J B;  3H91 A;  3BDO A;  1JR0 D;  4B08 A;  4FNF A;  1KDB A;  2KA7 A;  1SE4 A;  4H13 C;  2Q8R E;  1YNN D;  2F0S A;  1BCP C;  2EDG A;  4ZUI A;  1DXM A;  4A3E B;  1FYC A;  1I4R A;  2HDL A;  1JWM D;  5JJZ A;  5JVH 3;  1FNW A;  1G2S A;  3D6W A;  2A68 D;  5ELB A;  4EQO A;  1V8Q A;  1EIG A;  3I4M B;  3Q6S A;  3IL8 A;  1TWG B;  4C3I B;  2EOT A;  1GOZ A;  3VA7 A;  2XRQ D;  5I2Y A;  5HGT A;  5HUR A;  2A6H D;  3M7G A;  1SJE D;  5FLX E;  4KMU C;  3RZO B;  2PYK A;  1RHP A;  1MSH A;  1EZ8 A;  3J81 L;  5IOD A;  5A35 A;  1PRT F;  1A2U A;  3NQT A;  1EY7 A;  1SYF A;  2CW0 D;  5G3L D;  5JOB A;  1QWY A;  4C3J G;  1OO9 B;  2VB3 X;  2DY7 A;  3S14 B;  1O80 A;  2G9D A;  1VMP A;  1I4Q A;  2EXZ A;  2LKV A;  5CGK A;  1K8M A;  3NWT A;  1PFN A;  3D8G A;  4G4K A;  3A56 A;  2BE5 D;  2RKS A;  2D5D A;  5KYL A;  4NKL A;  5M3M B;  3DMU A;  2XIW A;  1Q90 A;  1SMY C;  2EY6 A;  3SXH A;  1SDF A;  4M1U B;  3DUZ A;  3R3O A;  4ODG A;  3QOJ A;  3H0G B;  2NVT B;  1S5D D;  1B53 A;  3CQZ B;  4L6T B;  4LK1 C;  1SYD A;  1XTC D;  2E76 C;  4BBS B;  1JOO A;  2IPK D;  1FD7 D;  3G6J B;  1PXU A;  3QJY A;  1Q1E A;  4C1N I;  5JEA G;  5E3F A;  1PFB A;  3PMF A;  1LT3 D;  2EPB A;  1PZJ D;  4UAI A;  2XN9 C;  4O42 A;  1BCP B;  3C46 A;  2ZXR A;  3VR4 A;  1G2T A;  3OWE B;  3SDZ A;  2M2L A;  4EQP A;  5A2Q L;  2WB1 B;  4FXD A;  4HR7 B;  4PQX A;  1EIH A;  4A93 B;  2ZT9 C;  1PLF A;  1H9S A;  2E2I B;  4QCL A;  1AZP A;  2JEA I;  3TP8 A;  4K5W A;  1T5E A;  2FMM A;  2PMZ B;  4BA2 I;  4DXG A;  2KQ3 A;  1CT1 D;  5E1F A;  4CJ0 B;  1F9P A;  4OO1 H;  3S1R B;  1OXX K;  3T51 B;  3I8Z A;  4G7Z C;  5M5X B;  4KN4 C;  3NWS A;  1JQY D;  2ENB A;  3C3L A;  1BR9 A;  1B50 A;  2A69 D;  5C3X A;  3Q0A A;  4PMW A;  1WTP A;  5J1Z A;  1SNM A;  1JE4 A;  5ELF A;  1AN8 A;  1HTL D;  5CV8 A;  1DYQ A;  1U4M A;  3JAM E;  5C0X G;  2F0Q A;  2F0G A;  2D2C C;  1D5Z C;  3E5S A;  4WJW A;  2G9H D;  1TWC B;  3FKI B;  4R8N A;  5BN3 A;  3KLR A;  4BY1 B;  2KCN A;  1I4X A;  1EYA A;  2F0M A;  4H0L C;  4ZAI A;  3KK7 A;  2X6L A;  3HRZ C;  4B9X A;  1WTV A;  4C3I G;  1CK1 A;  4GZY C;  1VMC A;  2VXW A;  2Z1C A;  1ZKO A;  3A55 A;  4KKT A;  2ZXO A;  3PUZ A;  2R3Z A;  1B44 D;  3GTQ B;  1LT4 D;  4RCN A;  4FYD A;  4RHR A;  1EY5 A;  3T56 B;  3MXN A;  3G7L A;  2QCP X;  1TQO A;  2EYF A;  5EPL A;  5C4H A;  2QF7 A;  5EGT A;  5DNF A;  2NN6 G;  4FVM A;  5FO9 B;  4CKE A;  3NP8 A;  2IWH A;  1ILQ A;  1PZI D;  2ICE C;  4RH6 A;  3WDN A;  1VCI A;  1MSG A;  2VB2 X;  3OMC A;  5CYU A;  3HOV B;  5ISR A;  2B2Y C;  1SSO A;  4XDX A;  1C4Q A;  1IKL A;  1F9S A;  2HCI A;  3EJI A;  3TDQ A;  2NYZ D;  2Z8L A;  5CV5 A;  1HQR D;  2K7V A;  4TSS A;  5D14 A;  1JOR A;  1K8O A;  4A3J B;  1BO0 A;  1GUG A;  2F0W A;  3FPP A;  4ZLT F;  1Z6H A;  3I73 A;  2FJ2 A;  1OXT A;  4XYQ A;  4XQN A;  1CQV A;  4DF7 A;  1K83 B;  1PTO H;  4YIJ A;  3HEJ A;  2F0I A;  3VYT A;  5KNB A;  2EYO A;  1U9R A;  4ZK9 B;  4FF3 A;  4L8J A;  4ZRZ A;  1L0X B;  3SE0 A;  3Q22 A;  3KUP A;  1EZ6 A;  1ZYR C;  3K7A B;  1ONL A;  4F88 A;  3PUX A;  3NQI A;  5D3D A;  1QJO A;  2D9U A;  2WII B;  1F9R A;  3KBX A;  3NBI A;  2AQ2 B;  4BY7 B;  4C56 C;  5JEA J;  2K05 A;  3K5O A;  1SYB A;  2RVL A;  1XXG A;  1F2Z A;  4ZUJ A;  3PUY A;  2O2L D;  1H9J A;  3CRL C;  5FO8 B;  1SYG A;  3NSW A;  2I46 A;  1KDA A;  5JPN C;  2GA4 B;  1B3A A;  3V05 A;  4KD4 A;  3PO2 B;  3SR1 A;  2CQA A;  3A7A B;  3TP6 A;  4BBR B;  3SK4 A;  1JOK A;  1TKW B;  1EWH A;  4C2M B;  2IW3 A;  2WAQ B;  1J9O A;  1A2T A;  1TWA B;  2KEE A;  1BXT A;  1KLG D;  3FRP B;  1CA6 A;  1Y8O B;  3BG3 A;  5COR A;  4A3G B;  5ELE A;  5K36 G;  1V1O A;  2EYL A;  5T1G A;  1TS2 A;  2RDH A;  3L7Z C;  1EY4 A;  2K6A A;  1UUP A;  4G7O C;  1GXD C;  2LFN A;  5IGC A;  1H9S B;  3NPP A;  1KNE A;  2F0V A;  1QIL A;  1JCK B;  1HPC A;  3NTK A;  3NXW A;  3QB3 A;  4XYO A;  2F4I A;  4J8Q A;  1GUN A;  4QIW B;  2QEJ C;  3PUW A;  2LMC B;  2EYP A;  2LS0 1;  5I6Y A;  3T16 A;  2Z4I A;  2Q8T A;  3J7Y W;  3MTS A;  2B39 A;  3HOW B;  1LO5 D;  4BWG B;  3NE5 B;  3X3N A;  3MVV A;  2QKI C;  1D1I A;  4PV1 C;  4AYB B;  3ERO A;  4CGY B;  2L5T A;  2A74 C;  1EQV A;  4N9P A;  5NUC A;  4DNR B;  4QF4 A;  1QOH A;  3WOE A;  1ENC A;  4TKO B;  1I4G A;  1AP0 A;  3KF8 A;  4X3S A;  3L3O C;  3BDC A;  1FNV A;  1E0B A;  2N88 A;  1Q12 A;  4P2C B;  4IUV A;  2L4N A;  4ILW A;  4IUU A;  4KK7 A;  3NTI A;  5C0X H;  2J7Z A;  2OT2 A;  2XNA C;  1CZG A;  4IUP A;  2WP8 J;  4ME5 A;  2EJG C;  4EQN A;  2WIN B;  4ZKB B;  1BF4 A;  2Z4H A;  4HMJ A;  2F3V A;  1D5X C;  1KDC A;  1H9R A;  5CR3 A;  4HTH A;  1I4P A;  1EOT A;  2L11 A;  2EE1 A;  3S2H B;  4C3H B;  5EPJ A;  1B1Z A;  5C5M A;  3TZU A;  1ESR A;  3H3V C;  3GTG B;  1SYC A;  4RHS A;  5IGE A;  4XTC S;  5EJW A;  2NVY B;  5C44 B;  1ET6 A;  1A6X A;  3IFD A;  5DM7 3;  3BZD B;  2NTS A;  2A6E D;  2CHB D;  3K5N A;  1NAP A;  3T4A C;  5IT9 L;  2WAC A;  3KLS X;  2PPB C;  1O78 A;  1JWU D;  1HTP A;  1D6E C;  1UEA B;  2FMC A;  1U4R A;  3CU7 A;  4FXG C;  1LTG D;  2WKD A;  2JA8 B;  2MPM A;  1PRT B;  2XSC A;  4PNY A;  2NN6 H;  2MJ8 A;  4KHZ A;  2XWJ B;  2PNR C;  1LAC A;  3A8J E;  3R8B A;  4JBW A;  2XRS D;  3K57 A;  2M00 A;  1EY8 A;  2B2U A;  3V2T A;  2RDF A;  2PCF B;  3D31 A;  1QB5 D;  4F87 A;  1BDO A;  2QDB A;  1HFG A;  1DOK A;  2EZV A;  4KY5 A;  3AB9 A;  4CJ2 C;  1JWS D;  1TS3 A;  3A8I E;  3W3A A;  4IN3 A;  5M3F B;  1LTB D;  4HCS A;  1IYV A;  3D6C A;  1GUS A;  1TWH B;  4X3K A;  1X3Q A;  4L63 B;  1WTX A;  3HKZ B;  4EGV A;  2A5H A;  4K2K A;  4DK1 A;  2JE6 I;  2ID0 A;  4U68 A;  1SYE A;  4RWS C;  5I9O A;  1Y1W B;  4G57 A;  1HHV A;  1AEX A;  3DWP A;  2R93 B;  2IT1 A;  1TII D;  3DXJ C;  3TN2 A;  2YU9 B;  4OL7 A;  5CBA E;  2AUK A;  4IQZ A;  1GUW A;  3MA2 B;  1IW7 C;  1OXS C;  4F8M A;  1YNJ D;  3J81 E;  2YYZ A;  1TT2 A;  4KY7 A;  2CVR A;  1I6H B;  1S5B D;  3PV0 A;  4NMZ A;  2WKC A;  5D3I B;  2KEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...