1S5FD

Cholera holotoxin, crystal form 2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an intrinsically active cholera toxin mutant yield insight into the toxin activation mechanism
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transferase,toxin
molecule keywords Cholera enterotoxin, A chain
total genus 23
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1s5fD00
4RGMA 1JCKB 1TY2A 1D5MC 4RGOS 1CQVA 3DWQA 3CHBD 1PRTF 1LLRD 5TSSA 1BCPF 1LTGD 1LT4D 1S5ED 4RCOA 1DJRD 2NTTA 4RGNA 1RD9D 1B44D 1UUPA 1I4RA 4BWGB 1STEA 5FK9C 4OHJA 3R8BA 4RFBA 1ENFA 1RF2D 1S5FD 2QILA 1V1PB 1EU4A 1HTLD 1AW7A 1DYQA 1L0YB 1M4VA 3BVZA 3TSSA 4ZYSA 2CHBD 1S5BD 1LTTD 1I4GA 1D5ZC 1LTSD 1TS2A 3SEBA 1PTOB 1JQYD 2XN9C 1RDPD 3EFXD 3OWEB 1BCPB 4DXGA 1FD7D 1JWUD 1S5CD 3DWPA 1JWSD 2XRSD 3BVMA 4K6LA 1D5XC 1PRTC 1G8ZD 1PTOF 3DWAA 5D3DA 4C56C 1TS4A 1LT5D 1KLUD 3V05A 1V1PA 1I4XA 1TS3A 2AQ1B 1CT1D 1L0XB 2Z8LA 3BYYB 4L63B 1I4HA 3BYTB 1UNSA 4UDUC 1KTKA 1HXYD 1LTRD 1LTID 1SXTA 1PZID 2J4XA 1V1OA 2QEJC 2SEBD 1ESFA 4L6TB 4DXFA 1FNUA 2IJ0A 1GOZA 1MD2D 1PYWD 2RDGA 1EU3A 5ELEA 2G9HD 3O13A 2NTSA 1PZJD 1ET9A 1PTOH 1LTAD 3URYA 3MC0B 1EEFD 3R2IA 1ET6A 1CHPD 1F77A 2AQ3B 2AQ2B 3GP7A 1TS5A 3KLSX 4RH6A 1LT3D 3BZDB 1TY0A 2XNAC 1EWCA 2RDHA 1JWMD 3BVGA 1XTCD 3EA6A 5D3IB 1KLGD 1D6EC 3R2TA 4RHRA 1QILA 2WV6D 1PRTD 2TSSA 4RHSA 1SJED 5ELCA 3MFGA 5ELBA 1BCPC 1I4QA 1SBBB 3W2DA 1PTOD 1PZKD 2ICIA 5ELDA 2O2LD 4Z9CB 1SE4A 1FNVA 1JR0D 1LTBD 1SE3A 1T5XD 4RGTA 1S5DD 2XRQD 1SEBD 1CHQD 1EFID 2IPKD 1I4PA 4TSSA 1SJHD 1B1ZA 1LO5D 4O1NA 1HA5A 1CK1A 1EEID 1AN8A 1FNWA 1FGBD 1BCPD 1BXTA 1RCVD 1XXGA 1PTOC 5FKAC 2R61A 1HQRD 1PRTB 1LT6D 5ELFA 1SE2A 5I4DA
chains in the Genus database with same CATH superfamily
3TREA 4I7ZC 5IYDG 2Y0SB 4DV2Q 1Q12A 2YU9B 2F0HA 1LLRD 1STHA 5G3LF 1C7YA 1IXRA 4KTAA 1IYJB 2BH8A 1D8LA 5EAYA 3TP6A 3GTMB 4DV0Q 4PMCA 2I5MX 1HNZQ 2AHOB 1SNOA 2OWOA 2A6HD 4DKAC 5M5WH 2IHEA 4JI8L 3M4PA 3M4QA 3S14B 1JMCA 3C3LA 4KKUA 4BY1G 4P2CB 3PO2H 2NZ1D 4UP7A 1TWHB 2F0FA 2EJFC 2NVTB 1B2TA 3I4NB 3BDLA 3RZOH 3KJPA 4DR2Q 1U4RA 1JICA 4DAYB 1R9TH 1EFWA 2BDNA 1PH4A 3V05A 5I9OA 3G48A 1V1PA 4WRDA 2VB2X 2WB1B 3OOCA 2F0SA 1MSGA 4RKLA 2L4NA 3SE0A 1EIFA 3M3YB 1PZID 5KNCA 3J81L 2R7ZG 5DEHA 1WFQA 3I55A 1N36Q 5ELEA 3GTQB 4UP9A 1S3OA 1KDBA 2L11A 2A6ED 1EIHA 3CCMA 1GVPA 2AQ3B 1F77A 2EYMA 3W3AA 3M85A 1KC8C 3D4WA 5CBAE 2UUAQ 1UWVA 1XPUA 3E0EA 4AQYL 4IALA 2KQ3A 1CI3M 3UDIA 4DR5Q 1T5EA 4ZKCB 1X54A 3HOXG 3NELA 3S1RB 1HCZA 5IGFA 2H1EA 4IFDG 5KRUA 5C3EH 1SE4A 4YY3Q 3SXHA 1EFID 2SDFA 1IHZA 2F0WA 2I07B 3CRLC 1SYGA 1HA5A 1ZXTA 1D1IA 4GLVB 5FO8B 1BXTA 3HG9A 4DV6L 1YVCA 1K83B 1WVLA 4Q0FA 3EBEA 3K57A 5I4DA 4GKKL 4HTHA 5EQ0A 3S1QH 3PF4A 1CQVA 3TMEA 1VQMA 1F2LA 2PNRC 1IBLQ 3S24A 3M9BA 1EY7A 4RGNA 4TKOB 4B9XA 4QQBX 2K5HA 4ZUJA 1STEA 3C46A 3NUCA 3R8BA 3FDTA 3Q0AA 1MI2A 1CM9A 4ME5A 3CCEA 3GTPB 5C0XG 1QZGA 1AW7A 4X64L 2KECA 2EYHA 2BA1A 1E2ZA 3H0GB 1Q8KA 1X55A 5JJZA 1CZGA 3BDOA 2R93H 2B63H 1FGUA 4R4TA 1D5ZC 3D3RA 4KN7C 2KHSA 4GNXC 1A0IA 2MO0A 4DXGA 4QGUA 1B3QA 4A3BH 2CH4W 4FO2A 1TS4A 3P75A 4A3MB 1KLUD 1X3FA 1YNJC 1JE4A 2CCZA 4PMBA 3NBIA 3QR8A 1E1OA 2NN6H 2VUMH 1X3GA 4OELB 1HXYD 5IYBG 2UUCQ 1TWFH 3QB3A 1OO9B 2HCCA 4X3UA 1K73C 2QF7A 1AE2A 4LF5Q 1A8VA 2KUMA 3DHQA 2B2VA 3IRBA 1H9SA 1LTAD 3GTJH 3OIPA 4IPDA 4DAPA 1RL2A 2CFMA 2UUAL 3BU2A 2EDGA 3I91A 3TZDA 1FJGQ 1LT3D 1EWCA 4C1NK 4Y7NH 3QIAA 4M1UB 4RAUC 2Q2IA 5K5PA 3J80c 3T1YL 1TWGH 2TSSA 3S1NH 4JOIA 5M5YB 3S2DB 2F0MA 1HHVA 1B70B 2EXDA 1BNZA 3CCRA 5I6YA 5M5XB 1G2TA 1J6QA 5IODA 2DJGC 1L1OA 3FKIH 1MKHA 2XRQD 1LM0A 1TQOA 4F7XA 2K05A 2ZM6Q 3RLOA 3NXWA 3E0JA 3QOLA 1I94L 1VQBA 1W2BA 3ITPA 3BZCA 2BE5C 2K5NA 4JK1C 1MBYA 3U9OA 3E9IA 2DN8A 1YHAA 4V190 4U68A 4N8FA 2ZJPA 4DU9A 1D7QA 1QUQA 1PFSA 2F0KA 4X62Q 3STBD 5EBCA 4IPHA 3EN2A 3A5UA 5IGEA 2XVSA 4LFCL 4DV5Q 5LL6X 4JCVE 4HAEA 1YEZA 4GOPA 2ZXPA 1S5ED 2NTTA 3HOWB 2JA7G 2F52A 1BVSA 3K59A 1B8AA 4IN3A 1RTNA 4P73A 4GNXB 3T1HQ 1DOMA 2WACA 3FPUB 2JK8A 2B8FA 2EOTA 1SNDA 1CFMA 3BVZA 4DV4Q 1AFPA 1EOTA 3W5OA 4JVZA 3TS2A 5FJ8H 3X3NA 4KHVA 3P7JA 2C5CA 2F0QA 2R3ZA 1PH1A 2QDBA 2LY7A 2B2TC 1KAAA 1STNA 5GAHC 3I4NH 2A19A 2JA6H 1JWUD 4B3TQ 4FVMA 2G5DA 1UEBA 2K33A 2I46A 1CUKA 2NWGA 1VMPA 4HIKA 5I2XA 2Z8LA 4R4OA 4UDUC 2FMMA 1BDOA 1SXTA 3HOVG 1PYWD 2RDGA 1EZ6A 1RIPA 2B2WA 1G6PA 1VQKA 2MJ8A 3E9HA 3PMFA 4Y52H 1A2TA 1J5EL 2JA6G 4JBJA 3H3VH 3URYA 2Z6KC 4UAIA 4BXXH 5F2DA 4EQPA 2VZAA 3QJYA 3J81j 3GTOH 2ZJRA 1IYVA 1TY0A 4EQ5A 5FLXc 1SFOB 1F2ZA 3HOUH 5A2QL 2VL6A 4RCNA 5CR3A 5IYCH 3DM1A 2EYFA 3PIP3 3S1QB 4KHPQ 1E22A 2ICIA 1PYSB 3MXNB 1EYDA 2N78A 4Z9CB 1AZPA 4BY7G 2QA4A 3SGIA 3J7YW 1YNNC 3F2DA 4QY7A 4DV3Q 4ZUIA 1KNEA 5EGTA 1M90C 2JN4A 1ZYRD 3VYTA 2B63B 1TY2A 3PV0A 1YNND 2Q2TA 2ZJQA 3TRZA 1Y1VB 2A68D 2NZHA 3T1HL 3E3XA 3NE5B 3RLNA 1N33L 5JPMC 4OGQC 4B3MQ 4RG1A 3Q24A 1EU4A 4DNTB 1SMXA 1UE5A 5H1SE 4BBSH 2Y0SE 4K0KL 2YTYA 1Q81C 1IBKL 2VQEQ 4HIOA 3MXNA 2UXCL 4B3RL 4BA1I 3TDQA 4L5SA 1Q8IA 4B3TL 2EIFA 4HJ5A 1O7YA 2E2DC 1DZ1A 2Q2HA 1QZHA 3DMUA 3OSOA 3R3OA 5ISRA 1NR4A 4PMWA 2PMZE 4ALPA 1XMQQ 4DK1A 3AYHB 1IZ6A 4IOAA 2K4KA 1R4PB 1L0XB 1KTKA 1C8CA 2JEAI 5FLXE 1GOZA 1H9RA 3HOYB 1IBLL 1EU3A 3O13A 2MUYA 1DXMA 3HOZG 2KJXA 3RZOB 1QVCA 4YWMA 4FF3A 1G6ZA 5EPKA 3PSIA 4DR3L 4RH6A 1RTOA 4JI1Q 4YHHL 4JI6Q 4DA2A 5D3IB 2ZTEA 4RHSA 1O7LA 2N49A 2FMCA 2GVAA 4FXDA 2UU9Q 1EQVA 1A3UA 2F0LA 3KDFB 2F0PA 1FYCA 4NP5A 1I6HB 2NVYB 2VUMG 1K9MC 1B9NA 4GLAC 4PV1C 4FXKC 3K0YA 4A3JH 1N34L 3NENA 5DAUA 4A3KG 2E2HB 1LT6D 1H95A 4RGMA 1X65A 1YZ6A 3MWYW 4IZ8A 1Z6HA 1CZWA 4OWTB 1D5MC 4KN4C 1EQTA 3DWQA 1S4ZA 4HJAA 2NUCA 1PLFA 3D4RA 1DJRD 2NVYH 1VQ5A 2XGTA 1I4RA 4FNFA 4IO9A 4G57A 3K6OA 3E6ZX 2QILA 1R4QB 1EY5A 3HOXH 3ND9A 4LF6L 4X3SA 5C4ZA 4BA2I 4DR7Q 2F0VA 4DK0A 2FXQA 1QVGA 4MTKA 2PI2A 2B8GA 5C6AA 3S15B 5JJLA 2EE1A 2OQ0A 3EROA 4CKBA 4DK3C 1ZYRC 2L1BA 2SNMA 1SSOA 4JI4L 2KHJA 3HKZG 1JWSD 1NMGA 4FXGC 1VQ8A 4I65A 4C56C 4LUOA 2DY7A 2D62A 4OWXB 4LNQA 1ZKOA 1YITA 2NVXH 1IL8A 4KV6A 4LF9L 2GA4B 3KUPA 4GS3A 1STGA 2D9UA 2NZOA 2RVLA 3LWUA 1IKMA 1BF4A 2K75A 4A3IG 2MNAA 2JJQA 1LV9A 3N6RA 4FDBA 4KI0A 4CDDC 4YHHQ 4JI6L 1X3QA 5IE8A 1VQAA 2WAQB 2OTLA 2BCOA 3BZDB 2XNAC 2B2TA 4L5RC 4POFA 2K14A 3R2TA 4H44C 3KLWA 3A74A 4BY1H 2NYZD 4LJZC 3H3VC 5M5XH 2EYLA 3JAMi 2JE6I 4KY7A 1BCPC 1HJPA 5CV4A 2XSCA 3OHXC 1XPOA 4H02A 3FEWX 4ZLTF 1ICFB 3SK6A 4RGTA 2EVBA 4ME3A 2MPMA 1YNJD 1EQRA 5IT9L 2ID0A 3CCUA 3TQYA 2R92H 5FLMH 3D31A 5GAEC 1K3RA 5JVH3 2F03A 1FGBD 2E75C 1VQ7A 3TN2A 5IYDH 1B50A 1BCPD 1PH8A 2UXDQ 4YWLA 2JQOA 4A3FB 2A69C 3I4MB 1TWCB 1U4LA 4LMQD 1GUGA 1OXXK 4A3KH 2VNUD 3QOJA 1SMYC 1U5KA 1GUTA 3ER0A 2Z6BA 2JA8B 4XT1B 1GHKA 1D2BA 3J80i 3NTHA 4ABNA 4DR4L 1I5FA 3PO2G 5LMUQ 4MNOA 2IY5B 1LT4D 2IT1A 2L5TA 3OTOQ 3DLLA 1A3TA 2R92B 5KGUA 2A6HC 4C3IG 4LF8Q 4DR7L 1UE7A 1NR2A 2WIIB 3RUZA 4GNXA 5KNBA 1VDZA 1MJEA 1HTLD 2HDMA 2WFWA 4LFAQ 3OPOA 2EY1A 4K6DA 2WAQE 1YJNA 3G4SA 2EY6A 3RD4A 1SN8A 4B3SL 3IKJA 1S5BD 1STYA 3FPPA 3SEBA 1EYAA 1WCMH 1RKNA 1SR3A 3GTGB 1LTLA 4LFBL 3OWEB 2A74C 2X69A 3DWPA 3HOWH 3FMCA 2D0PA 3HOZH 4A93H 1LT5D 1GM5A 2JEBI 3GO5A 1SAPA 3BYTB 4PZ7A 1JB7A 3IFTA 1WTOA 2RSOA 1Q1BA 1T9HA 4JBMA 2E8GA 1P8LA 2WB1G 4DUZQ 2DUDA 4V0BA 3Q22A 2PI2E 4DNRB 1U0LA 3PO3H 2F0UA 4NMZA 4DK6C 2N3SA 1VQPA 1Y14B 5IIFA 1QB5D 1TWAH 1L1OC 4QL5A 1VCIA 1EUJA 4S3SA 3KOJA 4C3JB 1K0RA 1JOOA 4KY6A 5G3LD 4NPSA 3S15H 4JV5L 2JA5H 5ELCA 1K83H 1Y8NB 4JI8Q 1G91A 2E2JB 1PTOD 1XTDA 2SNSA 1Z7TA 4KMUC 3VR2A 3EJIA 3K0XA 4DUYQ 1DGSA 5ELOA 1A2UA 2EYPA 2YTXA 4UY8C 1VQNA 2B2YA 3MXPA 1PDQA 4GKJL 1X6OA 4TQUS 3Q23A 4J6HA 4DR2L 5E4WC 2K5VA 3HOUB 1CK1A 1J9OA 1STAA 1AN8A 1SROA 5FOBB 1PTOC 3CQZB 3CCJA 2E76C 1QCBD 1SE2A 3T16A 3OTOL 1OXVA 3NK9A 4NW2A 5KYLA 3W1BA 1Y1VH 5NUCA 4KY5A 3T53B 3NQTA 1P16A 1BCPF 2RHSB 2YTVA 1TU2B 4NXNQ 4AIMA 3H09A 5FK9C 1HR0W 4A3BB 4BY7H 4DNIA 4WJ3M 1HTPA 3A8JE 4F87A 3S1NB 2IHFA 4NXMQ 3S14H 3KLRA 3C1FA 4OO1G 1U4PA 4P74A 2AUKA 1TWHH 1ILQA 3T4AC 3CPWA 4K14A 4AQYQ 4A3EB 2AWOA 3DEOA 4K5WA 2EZVA 3BG3A 2QKIC 4XT3B 1LTSD 4OONA 4QUFA 5IGBA 5E7NA 4A3DH 1SNCA 4X62L 4E6IA 1H9MA 2Z4IA 3MA2B 1PHJA 1GHJA 5COYA 2B2WC 5EPLA 2PQEA 2KBNA 3NQIA 2OCEA 3KF8A 1HQMC 1DCZA 2AQ1B 1K3BC 2Z6KA 4C2MB 4JI0L 4MN3A 4AH6A 3NP8A 3HOVH 1AP0A 4DUZL 4C3HB 5C5MA 4ZK9B 3AFQA 4GN3B 4XIGS 1K8MA 1BQQT 1FVIA 4XQNA 4A3DB 4FYDA 1ET9A 5EBDA 1PTOH 1KRTA 2F3WA 4K8JA 2H5XA 3I4NG 3K5MA 1ENCA 5DM73 3ERQA 3KLSX 4A75A 4X65L 2HCIA 1VQGA 2KA7A 2LSSA 2LMCB 2F0OA 1L2FA 4K8IA 2UUBL 1OXUA 3S2DH 4EQNA 4UP8A 1Y8OB 3MEHA 1ML0D 2E2IH 1FNVA 1T5XD 1JORA 2KEEA 3KDFA 4X6AH 4QCLA 4MIUA 1NCVA 4TVAB 5C4XB 3RN2A 1EIYB 3CD6A 3SK4A 1J5EQ 1FNWA 2L0CA 2A68C 4XXEA 5LMNL 3HS0C 3H3VI 2UXCQ 2CWAA 2EY5A 2WKDA 3H6MA 1PH3A 1KIXA 3K58A 5DLQE 2KEDA 1CQFA 1N32L 2AWNA 4ZCKA 4RGOS 2AUJD 2P5ZX 1WD1A 3LWEA 4IUUA 5TSSA 4PZ6A 1I6HH 4OIKA 4DV2L 3DEPA 3H15A 1Q1EA 5CV6A 1RODA 1BUVT 3HEJA 4XQJA 2K28A 5IP9H 4DR6L 3X3MA 2L12A 3PUXA 3M4YA 1KD1C 4A3GG 3RLFA 3F2BA 1I4GA 2ZTDA 3I4LA 5D65A 1JQYD 1XPRA 3J81c 2K6AA 2K03A 3EFXD 1XNRL 4N9PA 3UDXA 4X66Q 4LFAL 3GTGH 1QE6A 3A56A 4K6LA 5M3FB 5D3DA 3L9AX 4GN5A 3JAME 3KBXA 3F2CA 4HEDA 4YCWA 5C4HA 3ERSX 2JA8G 2QEJC 1UEAB 4J1MA 4L6TB 2IJ0A 4B3ML 3Q8DA 1A6XA 4LFBQ 3KLSA 3T1YQ 2E2HH 2NTSA 5IT9E 3L7ZC 3M7GA 3GTJB 2R92G 1E0BA 4FP5D 3EVQA 4HJ7A 1QVFA 1X32A 3GTKH 2BA0A 4DAYA 1VQEA 2EJMA 3G71A 1NY4A 5M3FH 3KF8B 2EPBA 1WD0A 3KF6A 4GZYC 1X56A 1AH9A 2XWJB 4RWSC 2NVQB 3CPFA 3TP7A 3EA6A 2R93G 4B3SQ 4CDFC 2VUMB 1EY4A 4KHZA 5I6WA 2K01A 1YIJA 3CC7A 5ELBA 5C0XH 1TWFB 3NWTA 2JA5B 4J8QA 3A0JA 4MZ9A 4WJ4A 3C2PA 1XNQL 2YU9H 2LS01 4JI2L 5IWAQ 1VF5C 3MZ5A 4DGZA 1X9NA 2PPBC 1JJCB 1O78A 4IUPA 5EPJA 1GD7A 3DM3A 4A3FH 1SDFA 2QCPX 3OW2A 2Z9HA 1Q86C 1BO0A 1IBMQ 5HY6A 1EZ8A 3S2HB 1Y1WH 1SNPA 1WTRA 4ID6A 4JI4Q 5JAVA 5C3WA 3MXGA 1KNAA 1HA6A 1QOHA 4CKCA 1GUWA 2K04A 2KOLA 2DNEA 3AQQA 1PRTF 1DD2A 5CV8A 4DV4L 1C4QA 3JAMc 3J7ZC 4RCOA 4DV7Q 3U58A 4UHVA 4OHJA 4RFBA 4JV5Q 2IX3A 4IFDH 1QNKA 1B4OA 1VQHA 1M1KC 1LABA 1A15A 3K5LA 3HKZB 1DYQA 5K36H 2OT2A 3F2UA 1L0YB 4DUYL 1BBWA 1N34Q 3D6CA 1Q46A 5CV7A 4JI3Q 3MTSA 3U9SA 3RN5A 5C4XH 4X66L 1VQFA 4BBRG 3GTQH 1WI5A 4LF4Q 2F4VQ 3S17B 2MQHA 1HR0L 1FD7D 3GTMH 2J0TD 3RNUA 2LXKA 5IOCA 2B3GA 4KD4A 1G8ZD 2K32A 1PH6A 4OX9Q 1CSQA 3C1EA 3CF5A 3IL8A 2VB3X 3I56A 2QW7A 2Y0SG 4KK7A 4JBWA 1G2SA 2PQAB 1SYCA 5CC4A 4APVA 4C3HH 1HFGA 1Z47A 1WCMB 2FHTA 3H91A 2JA8H 2PMZB 3TP8A 4GOPB 4KKSA 3CP0A 2AQ2B 2EJGC 4AYBE 3HOZB 2K7VA 4Q5VA 1GXDC 1HZ9A 1SYBA 5BN4A 1PH9A 5HGTA 1N33Q 1HNWQ 2ZT9C 3ULPA 1YJ9A 1CA6A 4HN7A 4G7HC 1TIID 3RMHA 1XNQQ 2VXWA 3HP3A 2VQEL 3GTLB 2HIXA 4ZAIA 2BOSA 3LX0A 2M00A 5JEAG 1JJGA 4NKLA 4WFN3 1XMQL 1SFOH 1HH2P 1MGSA 1RCVD 1XXGA 5FKAC 2R61A 1A62A 2WKCA 4C3IB 4JI7L 1HQRD 4HSPA 1CA5A 1JE5A 4HMIA 3H0GH 2G9DA 1VQ6A 5C4XG 5C4JH 1HZCA 1VQDA 4NB3A 4CDEC 4JYAQ 5C44G 3VYUA 2KCMA 3KJOA 2QGQA 1I3QB 1PH5A 3I72A 3CMEA 4UPAA 3ONAB 1K8OA 4BY7B 2F3IA 5K36G 4P75A 4B3RQ 4B08A 3A8IE 2A6EC 3J81i 2TMPA 4DAMA 3CKIB 3CQZH 4GN4B 1N32Q 3K7AH 1W3SA 3UE0A 3FRPB 3S1MB 1TVXA 4KJOA 5EKIA 1WTXA 1CSPA 3VR3A 5GQOA 2PZUA 4LF4L 2UXDL 1EL0A 3SVMA 1UAPA 2XN9C 3I90A 3UDFA 2RDFA 5JJKA 3RZDB 2DNCA 3PUVA 4CGYB 4OX9L 3BZKA 1PRTC 1JOQA 4HCEA 2ALYB 1I4XA 2B2UC 3BYYB 4Y7NB 1I50H 4LF8L 1SNMA 1LTID 1VQCA 5EJWA 4A3IB 1V1OA 2F0GA 4RA8A 3GDEA 5CYUA 2KCNA 1EY8A 3K5OA 1XNRQ 1V8QA 4C3JG 4BS9A 4GKJQ 2D5DA 2F0NA 3MHBA 5CORA 2F0DA 3MAQA 3VR6A 1PZJD 2Q8RE 1XJVA 1EEFD 3P1HA 1O7IA 1EIGA 2MP1A 2F0EA 3G7LA 2PYKA 3R93A 3KK7A 5IYCG 1ASZA 1ESRA 2B2YC 4IPCA 1QILA 1MJCA 2QEXA 1O7ZA 1VQLA 1SJED 3SK5A 2WAQG 3MFGA 3HOUG 4OIJA 1PZKD 1AEXA 4A3EH 3IFDA 1HZBA 1CTMA 4C1NI 1JR0D 1SE3A 4BXXG 5A35A 1S5DD 2I0QA 2CW0C 4IUVA 4OO1H 3A7LA 2B29A 5EKKA 5IGGA 1SJHD 1NJIC 3T13A 4R4IA 1UE6A 2L55A 4ULLA 1PH7A 2O5JC 4LF7Q 3K7UC 5I2YA 1ICWA 5IP7H 3PIPA 4GKKQ 3QG1A 4YCVA 3SHLA 5KIXA 3CC2A 3EQLC 1VQOA 2D0OA 5JEAJ 3PO2B 1Q3LA 2RKSA 2CW0D 3HOVB 4A3CH 1WOCA 3KBGA 2EYOA 4A3GH 1LTGD 5IP9G 2PCFB 3H94A 2XWBB 4JI0Q 2JA6B 2EY2A 5FJ8G 4HJ9A 1XYIA 3WOFA 2BH2A 1S5FD 1MIUA 2ZTCA 3ZJYC 3ICEA 4G7OC 1PXUA 1M4VA 2K1BA 2WB1E 4QUCA 3NBHB 2VW9A 1TS2A 5T1IA 4JI2Q 4POGA 1SMYD 1E7ZA 4HIDA 1XMOL 2D2CC 4R4QA 1BBXC 1IW7C 2MGSA 2IW3A 3KF6B 3PGZA 1K8GA 2NVXB 4PNYA 1YHQA 3B6YA 5M3MG 2O5IC 4A93B 2JYOA 1SE8A 3HOXB 1EY0A 1OXSC 2L9HA 3VA5A 2ES2A 2F4IA 1GUSA 5IT9c 2ATWA 4EQOA 1HR0Q 5C3EB 4OO1I 5J1ZA 1YJWA 2OXPA 5E1FA 2KCCA 1FJGL 1NE3A 2F0TA 3OYYA 2EYJA 1PA6A 2ENBA 3FKIG 3MC0B 3R2IA 5CGKA 1GJXA 2YV5A 3K7AB 3V96A 1D6EC 5GAGC 1E3PA 1PRTD 3TEHB 2QDLA 1WCMG 3GV6A 3FHWA 4JI1L 4JI3L 4EX5A 1E1TA 1G51A 1HZAA 1I4QA 3E5SA 1NNXA 2PQAA 1YBYA 3OIQA 3P20A 2UU9L 1STBA 3KYHC 2CQOA 4P72A 3PO3G 4H13C 5M3MH 1QWYA 2R7FA 4O2DA 4YWKA 5AFWA 2J7ZA 2V1CC 1E24A 1V43A 1GKHA 5IYBH 2MHVA 2V4DA 3UI2A 1N36L 2NN6G 1DONA 1PRTB 2RA4A 4IQZA 4QIWB 5L37A 4YY3L 4PQXA 5C44H 2N8NA 3K5NA 1DOKA 5IP7G 3VDYA 1G291 4K5VA 1RHPA 2IWHA 3T56B 4ILWA 1L1OB 4A3BG 1VMCA 2UUBQ 1F9SA 3BDCA 1II3A 3N52A 1KRSA 5BN3A 2HDLA 2OF1A 2K50A 1CKNB 3ULJA 4FF4A 1PVOA 4A3EG 2I5LX 1HNWL 1TWGB 1I50B 5E3FA 1Y1WB 1KAWA 3NHHA 1H9KA 5JJIA 2RQXA 1TWCH 3M4OH 4CJ2C 5C0XJ 4JW0A 2CHBD 4ZYSA 1C0AA 3K8AA 4IUNA 1PTOB 1JJ2A 2I5HA 3PCOB 2OTJA 4N8X1 5CBEE 2A1AA 3W1GA 5FLXL 2R6GA 2E5LQ 1EQQA 3D6WA 1S5CD 4XYQA 4DV6Q 2LKVA 1PTOF 3DWAA 4DV1Q 1KHIA 4A4IA 1EY9A 1YNXA 5M5WB 1CT1D 5LL6S 4YCUA 1UNSA 3M4OB 4RMFA 2Q8TA 4A3KB 3S9WA 2R7DA 4IJHA 2FFKB 5IWAL 4CJ0B 2XIWA 1NBWA 4DR6Q 4A3LG 1H9JA 3PUZA 3NWSA 3OMGA 1EWHA 2JA5G 4R1JA 1CHPD 1IBML 1OTCA 1NTGA 1SYEA 4LUZA 3J80L 4NXNL 4JI5Q 1PH2A 4CDCC 2WV6D 1ZEQX 2EXZA 2E2JH 3S16B 2IX0A 1VQ4A 2ICEC 3VYRA 2B2UA 3NBHA 4ODGA 3TS0A 5D14A 1BKBA 2B39A 1LTBD 1B7YB 1HNZL 1SEBD 1H9SB 3WOEA 3MEFA 1I4PA 1KABA 1M8AA 3DUZA 1AE3A 4PZ8A 3AMUA 4TRDA 1EEID 3L2PA 4MHEA 4HIMA 3HOYG 1VS0A 2DGYA 5ELFA 1O80A 3M3YH 3VA7A 3S1RH 1I3QH 3OWFA 1VQIA 3ZYYX 2RBMA 1RJTA 1X3PA 3CCSA 5M9OA 1GUOA 1PV4A 4LF7L 3CAMA 1QJOA 2CQAA 3FVQA 1E2WA 5LMUL 4JPBW 1OXTA 5A2QE 1ENFA 1FL0A 2VY3A 4A3JB 1IBKQ 4R8NA 4R9WA 3I7FA 1HUMA 1C9OA 2RSNA 3A8KE 4XDXA 3RR5A 2Q8IB 1LTTD 2ZM6L 2ASBA 2K52A 2N55A 4A3MG 3QO2A 3H0GG 3KFUA 4FF2A 1RDPD 4DV1L 3J80E 4J15A 4MTNA 4CBVA 3CXCA 2F3VA 2GN5A 3J7A5 1D5XC 2A69D 2Z4HA 4DR5L 4IUQA 2UXBL 2K5WA 4R4CA 1LUZA 4X3KA 1FR3A 4ZQ3A 2YYZA 4CKEA 5JEAH 1WTHA 4A3JG 1TT2A 4DXFA 4IPGA 4X65Q 1GUNA 4IJLA 3AB9A 4EGVA 3PIOA 1F2MA 1YI2A 3FP9A 4DR1Q 1EWIA 1QNUA 5BN5A 3AFPA 1SRUA 1PFNA 4F88A 1MSHA 4BBRH 4A3MH 1YHBA 5LHY1 2DJFC 2R7ZB 2CWPA 1TXYA 3D0FA 1HPCA 1GO3E 5KYIA 2A8VA 3ULLA 2Q2UA 5KEEA 3S2HH 1JT8A 2BDOA 1F9QA 1ENAA 3STBC 3AU7A 4C2MH 4G7ZC 2NN6I 4A3IH 3U4ZA 1SBBB 5LMNQ 3FKIB 3TBIB 5ELDA 2O2LD 4ZRZA 4C3HG 1CKMA 1VQJA 4QJFA 3S17H 1Y69U 4I7AA 4KD3A 3J81E 4IFDI 1B1ZA 1BR9A 1KL9A 4KLKA 1KQSA 4O1NA 2X6LA 5C0XI 4IFDJ 5BR8L 3CCLA 4WORA 2FJ2A 4R8IA 1K28A 4CJ1B 1V1QA 4PG3A 2A5HA 3HOYH 2HD3A 2BE5D 3A55A 3BS1A 4JBKA 1JCKB 4HJ8A 3HGBA 4H0LC 4AYBB 2E2IB 2C35B 1IL2A 4JC0A 2RCFA 3OW7A 3NPPA 5IGDA 1UUPA 2IX1A 1EYCA 3HKSA 3WWVA 5J39A 3GQBA 3VR5A 3K81C 4KHPL 4BBSG 4LF5L 2E74C 1NMFA 1N8RC 4NXML 2CH4A 3TSSA 4LAAA 1S72A 5AJ3Q 2KCTA 1DM0B 4OXPA 2VQFQ 4LWCA 3PO3B 1X3EA 2HT1A 1K0SA 1IKLA 1SNQA 4AYBG 1AZQA 1Y1WG 1TR5A 2XRSD 3I73A 1CKNA 1V9PA 5HGQA 4A3LH 3U4VA 5DM63 4A3FG 1R9TB 5JPNC 3I4MG 3HZXA 1TS3A 4DPGA 3CRKC 2OEOA 4O42A 2OQKA 2SEBD 5C4JB 1KDCA 2J4XA 4QF4A 1ESFA 1XX8A 1QG7A 1VQ9A 3PQIA 1LYLA 3VYSA 5EKLA 5I9PA 4DAVA 1I94Q 4X64Q 3EIVA 2HUGA 1CKOA 3GTOB 5LMNW 2F1MA 1U9RA 4FF1A 4DN4M 3F1ZA 1MHWC 1IYUA 1JB3A 1XTCD 1KLGD 5M3FG 2B2VC 4DV5L 4LFCQ 2EQSA 1PYBA 4IOCA 3U50C 1ONLA 1ILPA 1D1KA 3BJUA 3A7AB 2IL8A 3L0OA 2JA9A 2UUCL 2IPKD 5BR8Q 2CVRA 2F4VL 4XQQA 1NAPA 5ELNA 3Q6SA 2HQEA 2WINB 3JAML 2JA7H 4L5QA 4KJNA 1EYGA 1N9WA 5J22A 5C44B 2N88A 3GTPH 3WDNA 3NTKA 4ZKBB 1S40A 2JP1A 1J8IA 1XMOQ 2R93B 1HRJA 2PNHA 4DR4Q 3QWNA 2HQLA 4DF7A 4EVOA 4X3TA 5IY0A 1KDAA 3J7AV 1NSNS 2L15A 1JC7A 3UDGA 1Y8PB 4BWGB 2A73B 3TZUA 1HNXQ 1BOSA 4LK1C 4KKTA 4NDXA 1RF2D 4IUTA 4QIWE 3CCVA 4H7BA 3IAYA 4JG2A 3J7AF 2VQFL 4GOPC 4OWWB 2PZTA 1WJJA 4G4KA 3S1MH 1DOLA 3CCQA 2PW7A 3F8TA 3PF5A 3ND8A 2KVMA 5C3XA 5CV9A 1L0WA 4GLXA 3K80C 1HUNA 1Q90A 3G6EA 4CHTB 3CW2C 3UE1A 2CKZB 1WTPA 4LUVA 3A5ZB 3G6JB 4K2LA 3T51B 1LTRD 5IGCA 5M5YH 5C5LA 1FNUA 2FINB 1MD2D 4K2KA 1ASYA 2G9HD 3OMCA 4JI7Q 1TKWB 1VF7A 1SYFA 4A76A 4F8MA 5JVG3 3PIO3 4YIJA 2NVTH 2M2LA 2MFIA 1C48A 4JYAL 5CMDA 1KXLA 3CMAA 3LNNA 2UXBQ 1LACA 1ET6A 3HKZE 3LGJA 2HHHL 1PFMA 1TS5A 1F9PA 4LF9Q 1PFBA 3AEVA 4QB4A 4U673 1JWMD 3BVGA 2ZXRA 1BBUA 3S16H 1B3AA 1I6VC 5J3BA 2NBFA 4DFAA 1W6KA 4DR1L 2AKWB 4N9TA 3GV3A 1A3VA 1Z9FA 3W2DA 4HCSA 2XTIA 3GD7A 4P71A 3GTLH 2LFNA 4A3GB 2GVBA 3V2TA 1WTWA 2DY8A 3SDZA 2C9OA 5KNDA 1WTQA 3D4DA 1LO5D 1K8AC 4L8JA 4A3CG 2Z1CA 1B53A 4C3IH 2PW5A 3M7NA 3MVVA 1WTVA 2HIVA 5CV5A 4OEMB 1WYDA 3I4MH 4A3DG 2KENA 4M8AA 5DNFA 2SOBA 3CHBD 2VS1A 2RF4A 1HNXL 2PO4A 3SK8A 1RD9D 1UE1A 1F2YA 1B44D 3I4OA 5E4XA 4DV7L 2B63G 5FLMG 3NSWA 2JXMB 1V1PB 3PUWA 4DV0L 1EOVA 2M9VA 3I8ZA 3I2ZA 2JSOA 4HSVA 4DV3L 3HFZB 2Z0SA 1Y1VG 1IW7D 1E2VA 4DR3Q 1Q7YC 3SR1A 3MXUA 5M3MB 1BCPB 2ZXOA 4JOIC 4WJWA 3HRZC 1TWAB 2O4XA 3BVMA 4HR7B 5HURA 1A63A 2WP8J 3TP5A 4XYOA 4C3JH 2X6GA 1SLJA 2NVQH 4L63B 2AMCB 2F0IA 1I4HA 1U4MA 2H4OA 5FO7B 4XTCS 4OL7A 2LXJA 1Q82C 5GADC 2KHIA 1JOKA 2PZWA 5GROA 4A93G 4K0KQ 3DXJC 1F9RA 2HHHQ 3CC4A 3NEMA 2NB0A 5C3EG 3PUYA 1W6JA 3D8GA 2RHQB 3GP7A 1XWEA 4B9WA 2JA7B 4BBSB 2RDHA 5FO9B 4RKBA 1EY6A 2F0JA 2E5LL 2K5QA 4RHRA 5AJ3L 2RCNA 1SYDA 4LW1A 4IURA 3I70A 1QUQB 2MO1A 5T1GA 3VR4A 3GTKB 1PMRA 1CHQD 3CU7A 4K5XA 4QMGA 4BBRB 4LF6Q 4TSSA 1HFNA 5JOBA 4L5TA 1B9MA 3JC66 3RZDH 3NTIA 2K5DA 2R7ZH 3A54A 4O0AA 4BY1B 3HOWG 3I3CA 3L3OC 3MFYA 4HMJA 1NUCA 4JI5L
chains in the Genus database with same CATH topology
4I7ZC 2Y0SB 1Q12A 2YU9B 2F0HA 1LLRD 1STHA 5G3LF 4KTAA 3TP6A 3GTMB 4PMCA 1SNOA 2A6HD 3S14B 3C3LA 4KKUA 4P2CB 2NZ1D 1TWHB 2F0FA 2EJFC 2NVTB 1B2TA 3I4NB 3BDLA 1U4RA 1JICA 2BDNA 3V05A 5I9OA 1V1PA 4WRDA 2VB2X 2WB1B 3OOCA 2F0SA 1MSGA 4RKLA 2L4NA 3SE0A 3M3YB 1PZID 5KNCA 3J81L 5DEHA 5ELEA 3GTQB 1KDBA 2L11A 2A6ED 1EIHA 2AQ3B 1F77A 2EYMA 3W3AA 3M85A 3D4WA 5CBAE 4IALA 2KQ3A 1CI3M 1T5EA 4ZKCB 3S1RB 1HCZA 5IGFA 2H1EA 4IFDG 5KRUA 1SE4A 3SXHA 1EFID 2SDFA 1IHZA 2F0WA 2I07B 3CRLC 1SYGA 1HA5A 1ZXTA 1D1IA 5FO8B 1BXTA 3HG9A 1K83B 1WVLA 4Q0FA 3K57A 5I4DA 4HTHA 5EQ0A 1CQVA 3TMEA 1F2LA 2PNRC 1EY7A 4RGNA 4TKOB 4B9XA 4ZUJA 1STEA 3C46A 3NUCA 3R8BA 3FDTA 3Q0AA 1MI2A 1CM9A 4ME5A 3GTPB 5C0XG 1AW7A 2KECA 2EYHA 2BA1A 1E2ZA 3H0GB 5JJZA 1CZGA 3BDOA 1D5ZC 3D3RA 4KN7C 2KHSA 4DXGA 4FO2A 1TS4A 3P75A 4A3MB 1KLUD 1YNJC 1JE4A 4PMBA 3NBIA 2NN6H 1HXYD 3QB3A 1OO9B 2HCCA 4X3UA 2QF7A 2KUMA 3DHQA 2B2VA 1H9SA 1LTAD 3OIPA 4DAPA 2EDGA 3I91A 3TZDA 1LT3D 1EWCA 4C1NK 3QIAA 4M1UB 4RAUC 5K5PA 2TSSA 5M5YB 3S2DB 2F0MA 1HHVA 1BNZA 5I6YA 5M5XB 1G2TA 5IODA 2XRQD 1TQOA 4F7XA 2K05A 3NXWA 3E0JA 3QOLA 3ITPA 2BE5C 4JK1C 1MBYA 3U9OA 2DN8A 4V190 4U68A 4DU9A 2F0KA 5EBCA 5IGEA 2XVSA 5LL6X 4HAEA 2ZXPA 1S5ED 2NTTA 3HOWB 3K59A 4IN3A 1RTNA 1DOMA 2WACA 3FPUB 2B8FA 2EOTA 1SNDA 1CFMA 3BVZA 1AFPA 1EOTA 3X3NA 4KHVA 3P7JA 2C5CA 2F0QA 2R3ZA 2QDBA 2LY7A 2B2TC 1KAAA 1STNA 1JWUD 4FVMA 2K33A 2I46A 2NWGA 1VMPA 5I2XA 2Z8LA 4UDUC 2FMMA 1BDOA 1SXTA 1PYWD 2RDGA 1EZ6A 2B2WA 2MJ8A 3PMFA 1A2TA 3URYA 4UAIA 5F2DA 4EQPA 3QJYA 1IYVA 1TY0A 1SFOB 1F2ZA 5A2QL 4RCNA 5CR3A 3DM1A 2EYFA 3PIP3 3S1QB 2ICIA 1EYDA 4Z9CB 1AZPA 3J7YW 1YNNC 4ZUIA 1KNEA 5EGTA 1ZYRD 3VYTA 2B63B 1TY2A 3PV0A 1YNND 1Y1VB 2A68D 3NE5B 5JPMC 4OGQC 3Q24A 1EU4A 4DNTB 3MXNA 4BA1I 3TDQA 1Q8IA 1O7YA 2E2DC 1DZ1A 3DMUA 3OSOA 5ISRA 3R3OA 1NR4A 4PMWA 4DK1A 1R4PB 1L0XB 1KTKA 1C8CA 2JEAI 5FLXE 1GOZA 1H9RA 3HOYB 1EU3A 3O13A 2MUYA 1DXMA 2KJXA 3RZOB 4FF3A 1G6ZA 5EPKA 4RH6A 1RTOA 4DA2A 5D3IB 4RHSA 1O7LA 2FMCA 4FXDA 1EQVA 1A3UA 2F0LA 2F0PA 1FYCA 4NP5A 1I6HB 2NVYB 1B9NA 4PV1C 4FXKC 3K0YA 5DAUA 2E2HB 1LT6D 4RGMA 3MWYW 4IZ8A 1Z6HA 1CZWA 1D5MC 4KN4C 1EQTA 3DWQA 1S4ZA 2NUCA 1PLFA 3D4RA 1DJRD 1I4RA 4FNFA 4G57A 3K6OA 3E6ZX 2QILA 1R4QB 1EY5A 3ND9A 4X3SA 5C4ZA 4BA2I 2F0VA 4DK0A 2B8GA 5C6AA 3S15B 2EE1A 3EROA 4CKBA 1ZYRC 2L1BA 2SNMA 1SSOA 1JWSD 4FXGC 4I65A 4C56C 2DY7A 2D62A 1ZKOA 1IL8A 4KV6A 2GA4B 3KUPA 1STGA 2D9UA 2RVLA 3LWUA 1IKMA 1BF4A 1LV9A 3N6RA 4KI0A 1X3QA 2WAQB 2BCOA 3BZDB 2XNAC 2B2TA 4H44C 3R2TA 2NYZD 4LJZC 3H3VC 2EYLA 2JE6I 4KY7A 1BCPC 5CV4A 2XSCA 3OHXC 3FEWX 4ZLTF 3SK6A 4RGTA 2EVBA 2MPMA 1YNJD 5IT9L 2ID0A 3D31A 5JVH3 2F03A 1FGBD 2E75C 1B50A 3TN2A 1BCPD 4A3FB 2A69C 3I4MB 1TWCB 1U4LA 4LMQD 1GUGA 1OXXK 2VNUD 3QOJA 1SMYC 1GUTA 2JA8B 4XT1B 1GHKA 1D2BA 3NTHA 4ABNA 1LT4D 2IT1A 2L5TA 1A3TA 2R92B 5KGUA 2A6HC 4C3IG 1NR2A 2WIIB 3RUZA 5KNBA 1VDZA 1HTLD 2HDMA 3OPOA 2EY1A 4K6DA 2EY6A 3RD4A 3IKJA 1S5BD 1STYA 3FPPA 3SEBA 1EYAA 1RKNA 3GTGB 3OWEB 2A74C 2X69A 3DWPA 3FMCA 1LT5D 2JEBI 3GO5A 1SAPA 3BYTB 3IFTA 1WTOA 2RSOA 1Q1BA 4V0BA 3Q22A 4DNRB 2F0UA 4NMZA 5IIFA 1QB5D 1VCIA 4S3SA 4C3JB 1JOOA 4KY6A 5G3LD 5ELCA 1Y8NB 1G91A 2E2JB 1PTOD 2SNSA 1Z7TA 4KMUC 3VR2A 3EJIA 1A2UA 2EYPA 2B2YA 3MXPA 1PDQA 4TQUS 3Q23A 4J6HA 5E4WC 3HOUB 1CK1A 1J9OA 1STAA 1AN8A 5FOBB 1PTOC 3CQZB 2E76C 1QCBD 1SE2A 3T16A 1OXVA 3NK9A 4NW2A 5KYLA 5NUCA 4KY5A 3T53B 3NQTA 1BCPF 1TU2B 3H09A 5FK9C 4A3BB 1HTPA 3A8JE 4F87A 3S1NB 3KLRA 3C1FA 4OO1G 1U4PA 2AUKA 1ILQA 3T4AC 4K14A 4A3EB 2EZVA 2AWOA 3DEOA 4K5WA 3BG3A 2QKIC 4XT3B 1LTSD 4QUFA 5IGBA 1SNCA 4E6IA 1H9MA 2Z4IA 3MA2B 1GHJA 5COYA 2B2WC 5EPLA 2PQEA 3NQIA 3KF8A 1HQMC 1DCZA 2AQ1B 4C2MB 4MN3A 3NP8A 1AP0A 4C3HB 5C5MA 4ZK9B 4XIGS 1K8MA 1BQQT 4XQNA 4A3DB 4FYDA 1ET9A 5EBDA 1PTOH 2F3WA 4K8JA 3K5MA 1ENCA 5DM73 3ERQA 3KLSX 2HCIA 2KA7A 2LMCB 2F0OA 4K8IA 1OXUA 4EQNA 1Y8OB 3MEHA 1ML0D 1FNVA 1T5XD 1JORA 2KEEA 4QCLA 4MIUA 1NCVA 5C4XB 3SK4A 1FNWA 2L0CA 2A68C 4XXEA 3HS0C 2EY5A 2WKDA 3H6MA 3K58A 2KEDA 1CQFA 2AWNA 4RGOS 2AUJD 1WD1A 3LWEA 4IUUA 5TSSA 4OIKA 3DEPA 1Q1EA 5CV6A 1RODA 1BUVT 3HEJA 4XQJA 2K28A 3X3MA 2L12A 3PUXA 3M4YA 3RLFA 1I4GA 3I4LA 5D65A 1JQYD 2K6AA 2K03A 3EFXD 4N9PA 1QE6A 3A56A 4K6LA 5M3FB 5D3DA 3L9AX 3JAME 3KBXA 4HEDA 5C4HA 2QEJC 1UEAB 4J1MA 4L6TB 2IJ0A 1A6XA 3KLSA 2NTSA 5IT9E 3L7ZC 3M7GA 3GTJB 1E0BA 4FP5D 3EVQA 1X32A 2BA0A 4DAYA 2EJMA 2EPBA 1WD0A 4GZYC 2XWJB 4RWSC 2NVQB 3TP7A 3EA6A 2VUMB 1EY4A 4KHZA 5I6WA 2K01A 5ELBA 5C0XH 1TWFB 3NWTA 2JA5B 4J8QA 3C2PA 2LS01 1VF5C 3MZ5A 4DGZA 2PPBC 1O78A 4IUPA 5EPJA 1SDFA 2QCPX 1BO0A 1EZ8A 3S2HB 1SNPA 1WTRA 4ID6A 5JAVA 5C3WA 3MXGA 1KNAA 1HA6A 1QOHA 4CKCA 1GUWA 2K04A 2KOLA 2DNEA 1PRTF 1DD2A 5CV8A 1C4QA 4RCOA 4OHJA 4RFBA 2IX3A 4IFDH 1QNKA 1B4OA 1LABA 1A15A 3K5LA 3HKZB 1DYQA 5K36H 2OT2A 3F2UA 1L0YB 3D6CA 5CV7A 3MTSA 3U9SA 3S17B 1FD7D 2J0TD 5IOCA 4KD4A 1G8ZD 2K32A 3C1EA 3IL8A 2VB3X 4KK7A 4JBWA 1G2SA 1SYCA 5CC4A 1HFGA 1Z47A 1WCMB 2FHTA 3H91A 2PMZB 3TP8A 4KKSA 2AQ2B 2EJGC 3HOZB 2K7VA 4Q5VA 1GXDC 1SYBA 5BN4A 5HGTA 2ZT9C 1CA6A 4HN7A 4G7HC 1TIID 3RMHA 2VXWA 3HP3A 3GTLB 4ZAIA 2BOSA 3LX0A 2M00A 5JEAG 4NKLA 4WFN3 1MGSA 1RCVD 1XXGA 5FKAC 2R61A 2WKCA 4C3IB 1HQRD 4HSPA 1CA5A 4HMIA 2G9DA 3VYUA 1I3QB 3I72A 3ONAB 1K8OA 4BY7B 5K36G 4B08A 3A8IE 2A6EC 2TMPA 3CKIB 3FRPB 3S1MB 1TVXA 4KJOA 5EKIA 1WTXA 3VR3A 2PZUA 1EL0A 3SVMA 1UAPA 2XN9C 3I90A 2RDFA 3RZDB 2DNCA 3PUVA 4CGYB 1PRTC 1JOQA 4HCEA 1I4XA 2B2UC 3BYYB 4Y7NB 1SNMA 1LTID 5EJWA 4A3IB 1V1OA 2F0GA 4RA8A 5CYUA 2KCNA 1EY8A 3K5OA 1V8QA 4C3JG 4BS9A 2D5DA 2F0NA 3MHBA 5CORA 2F0DA 3MAQA 3VR6A 1PZJD 2Q8RE 1EEFD 3P1HA 2MP1A 1EIGA 2F0EA 3G7LA 2PYKA 3R93A 3KK7A 1ESRA 2B2YC 1QILA 1O7ZA 1SJED 3SK5A 3MFGA 4OIJA 1PZKD 1AEXA 3IFDA 4C1NI 1CTMA 1JR0D 1SE3A 5A35A 1S5DD 4OO1H 2CW0C 4IUVA 3A7LA 5EKKA 5IGGA 1SJHD 3T13A 2L55A 4ULLA 2O5JC 5I2YA 1ICWA 3QG1A 3SHLA 5KIXA 3EQLC 5JEAJ 3PO2B 1Q3LA 2RKSA 2CW0D 3HOVB 3KBGA 2EYOA 1LTGD 2PCFB 3H94A 2XWBB 2JA6B 2EY2A 1XYIA 3WOFA 1S5FD 4G7OC 1PXUA 1M4VA 2K1BA 4QUCA 1TS2A 5T1IA 1SMYD 2D2CC 1BBXC 1IW7C 2MGSA 2IW3A 2NVXB 4PNYA 2O5IC 4A93B 2JYOA 3HOXB 1EY0A 1OXSC 2L9HA 3VA5A 2F4IA 1GUSA 4EQOA 5C3EB 4OO1I 5J1ZA 2OXPA 5E1FA 2KCCA 2F0TA 2EYJA 2ENBA 3MC0B 3R2IA 5CGKA 1GJXA 3K7AB 3V96A 1D6EC 1PRTD 3GV6A 1I4QA 3E5SA 3OIQA 3P20A 1STBA 4H13C 1QWYA 5AFWA 2J7ZA 1V43A 2MHVA 2V4DA 3UI2A 1DONA 2NN6G 1PRTB 2RA4A 4IQZA 4QIWB 4PQXA 3K5NA 1DOKA 1G291 4K5VA 1RHPA 2IWHA 3T56B 4ILWA 1VMCA 1F9SA 3BDCA 1II3A 3N52A 5BN3A 2HDLA 2OF1A 4FF4A 1TWGB 1I50B 5E3FA 1Y1WB 3NHHA 1H9KA 2RQXA 4CJ2C 5C0XJ 4ZYSA 2CHBD 4IUNA 1PTOB 5CBEE 5FLXL 2R6GA 3D6WA 1S5CD 4XYQA 2LKVA 1PTOF 3DWAA 1EY9A 5M5WB 1CT1D 5LL6S 1UNSA 3M4OB 2Q8TA 4A3KB 3S9WA 2FFKB 4CJ0B 2XIWA 1H9JA 3PUZA 3NWSA 3OMGA 1EWHA 1CHPD 1SYEA 3J80L 2WV6D 1ZEQX 2EXZA 3S16B 2IX0A 2ICEC 3VYRA 2B2UA 3NBHA 4ODGA 5D14A 2B39A 1LTBD 1SEBD 1H9SB 3WOEA 1I4PA 1KABA 1M8AA 3DUZA 3AMUA 4TRDA 1EEID 4MHEA 5ELFA 1O80A 3VA7A 3OWFA 3ZYYX 2RBMA 1RJTA 1X3PA 5M9OA 1GUOA 1QJOA 2CQAA 3FVQA 1E2WA 1OXTA 5A2QE 1ENFA 4A3JB 4R8NA 4R9WA 1HUMA 2RSNA 3A8KE 4XDXA 2Q8IB 1LTTD 2N55A 3QO2A 4FF2A 1RDPD 3J80E 4CBVA 2F3VA 1D5XC 2A69D 2Z4HA 4IUQA 2K5WA 4X3KA 1FR3A 4ZQ3A 2YYZA 4CKEA 5JEAH 1TT2A 4DXFA 1GUNA 3AB9A 4EGVA 1F2MA 1QNUA 5BN5A 1PFNA 4F88A 1MSHA 5LHY1 2R7ZB 1HPCA 5KYIA 5KEEA 2BDOA 1F9QA 1ENAA 3AU7A 4G7ZC 2NN6I 1SBBB 3FKIB 3TBIB 5ELDA 2O2LD 4ZRZA 4C3HG 1Y69U 4KD3A 3J81E 4IFDI 1B1ZA 1BR9A 4O1NA 2X6LA 5C0XI 4IFDJ 4WORA 2FJ2A 4R8IA 4CJ1B 2A5HA 2BE5D 3A55A 3BS1A 1JCKB 3HGBA 4H0LC 4AYBB 2E2IB 3OW7A 3NPPA 5IGDA 1UUPA 2IX1A 1EYCA 5J39A 3GQBA 3VR5A 2E74C 3TSSA 4LAAA 1DM0B 3PO3B 1IKLA 1SNQA 1AZQA 1TR5A 2XRSD 3I73A 5DM63 1R9TB 5JPNC 3HZXA 1TS3A 3CRKC 2OEOA 4O42A 2SEBD 5C4JB 1KDCA 2J4XA 4QF4A 1ESFA 1XX8A 1QG7A 3VYSA 5EKLA 5I9PA 4DAVA 2HUGA 3GTOB 2F1MA 1U9RA 4FF1A 4DN4M 1IYUA 1JB3A 1XTCD 1KLGD 2B2VC 1ONLA 1ILPA 1D1KA 3A7AB 2IL8A 2IPKD 2CVRA 4XQQA 1NAPA 3Q6SA 2HQEA 2WINB 3JAML 4KJNA 5J22A 5C44B 2N88A 3WDNA 3NTKA 4ZKBB 1J8IA 2JP1A 2R93B 1HRJA 3QWNA 4DF7A 4EVOA 4X3TA 1KDAA 3J7AV 1NSNS 1JC7A 1Y8PB 4BWGB 2A73B 3TZUA 1BOSA 4LK1C 4KKTA 4NDXA 1RF2D 4IUTA 4H7BA 3IAYA 3J7AF 2PZTA 4G4KA 1DOLA 2PW7A 3ND8A 2KVMA 5C3XA 5CV9A 1HUNA 1Q90A 4CHTB 1WTPA 3G6JB 4K2LA 3T51B 1LTRD 5IGCA 5C5LA 1FNUA 2FINB 1MD2D 4K2KA 2G9HD 3OMCA 1TKWB 1VF7A 1SYFA 4F8MA 5JVG3 3PIO3 4YIJA 2M2LA 1C48A 5CMDA 3LNNA 1LACA 1ET6A 1PFMA 1TS5A 1F9PA 1PFBA 4QB4A 4U673 1JWMD 3BVGA 2ZXRA 1B3AA 1I6VC 4DFAA 2NBFA 1W6KA 4N9TA 3GV3A 1A3VA 3W2DA 4HCSA 3GD7A 2LFNA 4A3GB 3V2TA 1WTWA 2DY8A 3SDZA 2C9OA 5KNDA 1WTQA 3D4DA 1LO5D 4L8JA 2Z1CA 1B53A 2PW5A 3M7NA 3MVVA 1WTVA 5CV5A 4M8AA 5DNFA 2SOBA 3CHBD 2PO4A 3SK8A 1RD9D 1F2YA 1B44D 5E4XA 3NSWA 2JXMB 1V1PB 3PUWA 2M9VA 3I8ZA 2JSOA 4HSVA 1IW7D 1E2VA 3SR1A 3MXUA 5M3MB 1BCPB 2ZXOA 4WJWA 3HRZC 1TWAB 2O4XA 3BVMA 4HR7B 5HURA 2WP8J 3TP5A 4XYOA 2X6GA 4L63B 2F0IA 1I4HA 1U4MA 2H4OA 5FO7B 4XTCS 4OL7A 1JOKA 2PZWA 3DXJC 1F9RA 2NB0A 3PUYA 1W6JA 3D8GA 3GP7A 1XWEA 4B9WA 2JA7B 4BBSB 2RDHA 5FO9B 4RKBA 1EY6A 2F0JA 2K5QA 4RHRA 1SYDA 4IURA 3I70A 5T1GA 3VR4A 3GTKB 1PMRA 1CHQD 3CU7A 4K5XA 4QMGA 4BBRB 4TSSA 1HFNA 5JOBA 1B9MA 3NTIA 2K5DA 3A54A 4BY1B 3I3CA 3L3OC 3MFYA 4HMJA 1NUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RGM A;  1JCK B;  1TY2 A;  1D5M C;  4RGO S;  1CQV A;  3DWQ A;  3CHB D;  1PRT F;  1LLR D;  5TSS A;  1BCP F;  1LTG D;  1LT4 D;  1S5E D;  4RCO A;  1DJR D;  2NTT A;  4RGN A;  1RD9 D;  1B44 D;  1UUP A;  1I4R A;  4BWG B;  1STE A;  5FK9 C;  4OHJ A;  3R8B A;  4RFB A;  1ENF A;  1RF2 D;  1S5F D;  2QIL A;  1V1P B;  1EU4 A;  1HTL D;  1AW7 A;  1DYQ A;  1L0Y B;  1M4V A;  3BVZ A;  3TSS A;  4ZYS A;  2CHB D;  1S5B D;  1LTT D;  1I4G A;  1D5Z C;  1LTS D;  1TS2 A;  3SEB A;  1PTO B;  1JQY D;  2XN9 C;  1RDP D;  3EFX D;  3OWE B;  1BCP B;  4DXG A;  1FD7 D;  1JWU D;  1S5C D;  3DWP A;  1JWS D;  2XRS D;  3BVM A;  4K6L A;  1D5X C;  1PRT C;  1G8Z D;  1PTO F;  3DWA A;  5D3D A;  4C56 C;  1TS4 A;  1LT5 D;  1KLU D;  3V05 A;  1V1P A;  1I4X A;  1TS3 A;  2AQ1 B;  1CT1 D;  1L0X B;  2Z8L A;  3BYY B;  4L63 B;  1I4H A;  3BYT B;  1UNS A;  4UDU C;  1KTK A;  1HXY D;  1LTR D;  1LTI D;  1SXT A;  1PZI D;  2J4X A;  1V1O A;  2QEJ C;  2SEB D;  1ESF A;  4L6T B;  4DXF A;  1FNU A;  2IJ0 A;  1GOZ A;  1MD2 D;  1PYW D;  2RDG A;  1EU3 A;  5ELE A;  2G9H D;  3O13 A;  2NTS A;  1PZJ D;  1ET9 A;  1PTO H;  1LTA D;  3URY A;  3MC0 B;  1EEF D;  3R2I A;  1ET6 A;  1CHP D;  1F77 A;  2AQ3 B;  2AQ2 B;  3GP7 A;  1TS5 A;  3KLS X;  4RH6 A;  1LT3 D;  3BZD B;  1TY0 A;  2XNA C;  1EWC A;  2RDH A;  1JWM D;  3BVG A;  1XTC D;  3EA6 A;  5D3I B;  1KLG D;  1D6E C;  3R2T A;  4RHR A;  1QIL A;  2WV6 D;  1PRT D;  2TSS A;  4RHS A;  1SJE D;  5ELC A;  3MFG A;  5ELB A;  1BCP C;  1I4Q A;  1SBB B;  3W2D A;  1PTO D;  1PZK D;  2ICI A;  5ELD A;  2O2L D;  4Z9C B;  1SE4 A;  1FNV A;  1JR0 D;  1LTB D;  1SE3 A;  1T5X D;  4RGT A;  1S5D D;  2XRQ D;  1SEB D;  1CHQ D;  1EFI D;  2IPK D;  1I4P A;  4TSS A;  1SJH D;  1B1Z A;  1LO5 D;  4O1N A;  1HA5 A;  1CK1 A;  1EEI D;  1AN8 A;  1FNW A;  1FGB D;  1BCP D;  1BXT A;  1RCV D;  1XXG A;  1PTO C;  5FKA C;  2R61 A;  1HQR D;  1PRT B;  1LT6 D;  5ELF A;  1SE2 A;  5I4D A; 
#chains in the Genus database with same CATH topology
 3TRE A;  4I7Z C;  5IYD G;  2Y0S B;  4DV2 Q;  1Q12 A;  2YU9 B;  2F0H A;  1LLR D;  1STH A;  5G3L F;  1C7Y A;  1IXR A;  4KTA A;  1IYJ B;  2BH8 A;  1D8L A;  5EAY A;  3TP6 A;  3GTM B;  4DV0 Q;  4PMC A;  2I5M X;  1HNZ Q;  2AHO B;  1SNO A;  2OWO A;  2A6H D;  4DKA C;  5M5W H;  2IHE A;  4JI8 L;  3M4P A;  3M4Q A;  3S14 B;  1JMC A;  3C3L A;  4KKU A;  4BY1 G;  4P2C B;  3PO2 H;  2NZ1 D;  4UP7 A;  1TWH B;  2F0F A;  2EJF C;  2NVT B;  1B2T A;  3I4N B;  3BDL A;  3RZO H;  3KJP A;  4DR2 Q;  1U4R A;  1JIC A;  4DAY B;  1R9T H;  1EFW A;  2BDN A;  1PH4 A;  3V05 A;  5I9O A;  3G48 A;  1V1P A;  4WRD A;  2VB2 X;  2WB1 B;  3OOC A;  2F0S A;  1MSG A;  4RKL A;  2L4N A;  3SE0 A;  1EIF A;  3M3Y B;  1PZI D;  5KNC A;  3J81 L;  2R7Z G;  5DEH A;  1WFQ A;  3I55 A;  1N36 Q;  5ELE A;  3GTQ B;  4UP9 A;  1S3O A;  1KDB A;  2L11 A;  2A6E D;  1EIH A;  3CCM A;  1GVP A;  2AQ3 B;  1F77 A;  2EYM A;  3W3A A;  3M85 A;  1KC8 C;  3D4W A;  5CBA E;  2UUA Q;  1UWV A;  1XPU A;  3E0E A;  4AQY L;  4IAL A;  2KQ3 A;  1CI3 M;  3UDI A;  4DR5 Q;  1T5E A;  4ZKC B;  1X54 A;  3HOX G;  3NEL A;  3S1R B;  1HCZ A;  5IGF A;  2H1E A;  4IFD G;  5KRU A;  5C3E H;  1SE4 A;  4YY3 Q;  3SXH A;  1EFI D;  2SDF A;  1IHZ A;  2F0W A;  2I07 B;  3CRL C;  1SYG A;  1HA5 A;  1ZXT A;  1D1I A;  4GLV B;  5FO8 B;  1BXT A;  3HG9 A;  4DV6 L;  1YVC A;  1K83 B;  1WVL A;  4Q0F A;  3EBE A;  3K57 A;  5I4D A;  4GKK L;  4HTH A;  5EQ0 A;  3S1Q H;  3PF4 A;  1CQV A;  3TME A;  1VQM A;  1F2L A;  2PNR C;  1IBL Q;  3S24 A;  3M9B A;  1EY7 A;  4RGN A;  4TKO B;  4B9X A;  4QQB X;  2K5H A;  4ZUJ A;  1STE A;  3C46 A;  3NUC A;  3R8B A;  3FDT A;  3Q0A A;  1MI2 A;  1CM9 A;  4ME5 A;  3CCE A;  3GTP B;  5C0X G;  1QZG A;  1AW7 A;  4X64 L;  2KEC A;  2EYH A;  2BA1 A;  1E2Z A;  3H0G B;  1Q8K A;  1X55 A;  5JJZ A;  1CZG A;  3BDO A;  2R93 H;  2B63 H;  1FGU A;  4R4T A;  1D5Z C;  3D3R A;  4KN7 C;  2KHS A;  4GNX C;  1A0I A;  2MO0 A;  4DXG A;  4QGU A;  1B3Q A;  4A3B H;  2CH4 W;  4FO2 A;  1TS4 A;  3P75 A;  4A3M B;  1KLU D;  1X3F A;  1YNJ C;  1JE4 A;  2CCZ A;  4PMB A;  3NBI A;  3QR8 A;  1E1O A;  2NN6 H;  2VUM H;  1X3G A;  4OEL B;  1HXY D;  5IYB G;  2UUC Q;  1TWF H;  3QB3 A;  1OO9 B;  2HCC A;  4X3U A;  1K73 C;  2QF7 A;  1AE2 A;  4LF5 Q;  1A8V A;  2KUM A;  3DHQ A;  2B2V A;  3IRB A;  1H9S A;  1LTA D;  3GTJ H;  3OIP A;  4IPD A;  4DAP A;  1RL2 A;  2CFM A;  2UUA L;  3BU2 A;  2EDG A;  3I91 A;  3TZD A;  1FJG Q;  1LT3 D;  1EWC A;  4C1N K;  4Y7N H;  3QIA A;  4M1U B;  4RAU C;  2Q2I A;  5K5P A;  3J80 c;  3T1Y L;  1TWG H;  2TSS A;  3S1N H;  4JOI A;  5M5Y B;  3S2D B;  2F0M A;  1HHV A;  1B70 B;  2EXD A;  1BNZ A;  3CCR A;  5I6Y A;  5M5X B;  1G2T A;  1J6Q A;  5IOD A;  2DJG C;  1L1O A;  3FKI H;  1MKH A;  2XRQ D;  1LM0 A;  1TQO A;  4F7X A;  2K05 A;  2ZM6 Q;  3RLO A;  3NXW A;  3E0J A;  3QOL A;  1I94 L;  1VQB A;  1W2B A;  3ITP A;  3BZC A;  2BE5 C;  2K5N A;  4JK1 C;  1MBY A;  3U9O A;  3E9I A;  2DN8 A;  1YHA A;  4V19 0;  4U68 A;  4N8F A;  2ZJP A;  4DU9 A;  1D7Q A;  1QUQ A;  1PFS A;  2F0K A;  4X62 Q;  3STB D;  5EBC A;  4IPH A;  3EN2 A;  3A5U A;  5IGE A;  2XVS A;  4LFC L;  4DV5 Q;  5LL6 X;  4JCV E;  4HAE A;  1YEZ A;  4GOP A;  2ZXP A;  1S5E D;  2NTT A;  3HOW B;  2JA7 G;  2F52 A;  1BVS A;  3K59 A;  1B8A A;  4IN3 A;  1RTN A;  4P73 A;  4GNX B;  3T1H Q;  1DOM A;  2WAC A;  3FPU B;  2JK8 A;  2B8F A;  2EOT A;  1SND A;  1CFM A;  3BVZ A;  4DV4 Q;  1AFP A;  1EOT A;  3W5O A;  4JVZ A;  3TS2 A;  5FJ8 H;  3X3N A;  4KHV A;  3P7J A;  2C5C A;  2F0Q A;  2R3Z A;  1PH1 A;  2QDB A;  2LY7 A;  2B2T C;  1KAA A;  1STN A;  5GAH C;  3I4N H;  2A19 A;  2JA6 H;  1JWU D;  4B3T Q;  4FVM A;  2G5D A;  1UEB A;  2K33 A;  2I46 A;  1CUK A;  2NWG A;  1VMP A;  4HIK A;  5I2X A;  2Z8L A;  4R4O A;  4UDU C;  2FMM A;  1BDO A;  1SXT A;  3HOV G;  1PYW D;  2RDG A;  1EZ6 A;  1RIP A;  2B2W A;  1G6P A;  1VQK A;  2MJ8 A;  3E9H A;  3PMF A;  4Y52 H;  1A2T A;  1J5E L;  2JA6 G;  4JBJ A;  3H3V H;  3URY A;  2Z6K C;  4UAI A;  4BXX H;  5F2D A;  4EQP A;  2VZA A;  3QJY A;  3J81 j;  3GTO H;  2ZJR A;  1IYV A;  1TY0 A;  4EQ5 A;  5FLX c;  1SFO B;  1F2Z A;  3HOU H;  5A2Q L;  2VL6 A;  4RCN A;  5CR3 A;  5IYC H;  3DM1 A;  2EYF A;  3PIP 3;  3S1Q B;  4KHP Q;  1E22 A;  2ICI A;  1PYS B;  3MXN B;  1EYD A;  2N78 A;  4Z9C B;  1AZP A;  4BY7 G;  2QA4 A;  3SGI A;  3J7Y W;  1YNN C;  3F2D A;  4QY7 A;  4DV3 Q;  4ZUI A;  1KNE A;  5EGT A;  1M90 C;  2JN4 A;  1ZYR D;  3VYT A;  2B63 B;  1TY2 A;  3PV0 A;  1YNN D;  2Q2T A;  2ZJQ A;  3TRZ A;  1Y1V B;  2A68 D;  2NZH A;  3T1H L;  3E3X A;  3NE5 B;  3RLN A;  1N33 L;  5JPM C;  4OGQ C;  4B3M Q;  4RG1 A;  3Q24 A;  1EU4 A;  4DNT B;  1SMX A;  1UE5 A;  5H1S E;  4BBS H;  2Y0S E;  4K0K L;  2YTY A;  1Q81 C;  1IBK L;  2VQE Q;  4HIO A;  3MXN A;  2UXC L;  4B3R L;  4BA1 I;  3TDQ A;  4L5S A;  1Q8I A;  4B3T L;  2EIF A;  4HJ5 A;  1O7Y A;  2E2D C;  1DZ1 A;  2Q2H A;  1QZH A;  3DMU A;  3OSO A;  3R3O A;  5ISR A;  1NR4 A;  4PMW A;  2PMZ E;  4ALP A;  1XMQ Q;  4DK1 A;  3AYH B;  1IZ6 A;  4IOA A;  2K4K A;  1R4P B;  1L0X B;  1KTK A;  1C8C A;  2JEA I;  5FLX E;  1GOZ A;  1H9R A;  3HOY B;  1IBL L;  1EU3 A;  3O13 A;  2MUY A;  1DXM A;  3HOZ G;  2KJX A;  3RZO B;  1QVC A;  4YWM A;  4FF3 A;  1G6Z A;  5EPK A;  3PSI A;  4DR3 L;  4RH6 A;  1RTO A;  4JI1 Q;  4YHH L;  4JI6 Q;  4DA2 A;  5D3I B;  2ZTE A;  4RHS A;  1O7L A;  2N49 A;  2FMC A;  2GVA A;  4FXD A;  2UU9 Q;  1EQV A;  1A3U A;  2F0L A;  3KDF B;  2F0P A;  1FYC A;  4NP5 A;  1I6H B;  2NVY B;  2VUM G;  1K9M C;  1B9N A;  4GLA C;  4PV1 C;  4FXK C;  3K0Y A;  4A3J H;  1N34 L;  3NEN A;  5DAU A;  4A3K G;  2E2H B;  1LT6 D;  1H95 A;  4RGM A;  1X65 A;  1YZ6 A;  3MWY W;  4IZ8 A;  1Z6H A;  1CZW A;  4OWT B;  1D5M C;  4KN4 C;  1EQT A;  3DWQ A;  1S4Z A;  4HJA A;  2NUC A;  1PLF A;  3D4R A;  1DJR D;  2NVY H;  1VQ5 A;  2XGT A;  1I4R A;  4FNF A;  4IO9 A;  4G57 A;  3K6O A;  3E6Z X;  2QIL A;  1R4Q B;  1EY5 A;  3HOX H;  3ND9 A;  4LF6 L;  4X3S A;  5C4Z A;  4BA2 I;  4DR7 Q;  2F0V A;  4DK0 A;  2FXQ A;  1QVG A;  4MTK A;  2PI2 A;  2B8G A;  5C6A A;  3S15 B;  5JJL A;  2EE1 A;  2OQ0 A;  3ERO A;  4CKB A;  4DK3 C;  1ZYR C;  2L1B A;  2SNM A;  1SSO A;  4JI4 L;  2KHJ A;  3HKZ G;  1JWS D;  1NMG A;  4FXG C;  1VQ8 A;  4I65 A;  4C56 C;  4LUO A;  2DY7 A;  2D62 A;  4OWX B;  4LNQ A;  1ZKO A;  1YIT A;  2NVX H;  1IL8 A;  4KV6 A;  4LF9 L;  2GA4 B;  3KUP A;  4GS3 A;  1STG A;  2D9U A;  2NZO A;  2RVL A;  3LWU A;  1IKM A;  1BF4 A;  2K75 A;  4A3I G;  2MNA A;  2JJQ A;  1LV9 A;  3N6R A;  4FDB A;  4KI0 A;  4CDD C;  4YHH Q;  4JI6 L;  1X3Q A;  5IE8 A;  1VQA A;  2WAQ B;  2OTL A;  2BCO A;  3BZD B;  2XNA C;  2B2T A;  4L5R C;  4POF A;  2K14 A;  3R2T A;  4H44 C;  3KLW A;  3A74 A;  4BY1 H;  2NYZ D;  4LJZ C;  3H3V C;  5M5X H;  2EYL A;  3JAM i;  2JE6 I;  4KY7 A;  1BCP C;  1HJP A;  5CV4 A;  2XSC A;  3OHX C;  1XPO A;  4H02 A;  3FEW X;  4ZLT F;  1ICF B;  3SK6 A;  4RGT A;  2EVB A;  4ME3 A;  2MPM A;  1YNJ D;  1EQR A;  5IT9 L;  2ID0 A;  3CCU A;  3TQY A;  2R92 H;  5FLM H;  3D31 A;  5GAE C;  1K3R A;  5JVH 3;  2F03 A;  1FGB D;  2E75 C;  1VQ7 A;  3TN2 A;  5IYD H;  1B50 A;  1BCP D;  1PH8 A;  2UXD Q;  4YWL A;  2JQO A;  4A3F B;  2A69 C;  3I4M B;  1TWC B;  1U4L A;  4LMQ D;  1GUG A;  1OXX K;  4A3K H;  2VNU D;  3QOJ A;  1SMY C;  1U5K A;  1GUT A;  3ER0 A;  2Z6B A;  2JA8 B;  4XT1 B;  1GHK A;  1D2B A;  3J80 i;  3NTH A;  4ABN A;  4DR4 L;  1I5F A;  3PO2 G;  5LMU Q;  4MNO A;  2IY5 B;  1LT4 D;  2IT1 A;  2L5T A;  3OTO Q;  3DLL A;  1A3T A;  2R92 B;  5KGU A;  2A6H C;  4C3I G;  4LF8 Q;  4DR7 L;  1UE7 A;  1NR2 A;  2WII B;  3RUZ A;  4GNX A;  5KNB A;  1VDZ A;  1MJE A;  1HTL D;  2HDM A;  2WFW A;  4LFA Q;  3OPO A;  2EY1 A;  4K6D A;  2WAQ E;  1YJN A;  3G4S A;  2EY6 A;  3RD4 A;  1SN8 A;  4B3S L;  3IKJ A;  1S5B D;  1STY A;  3FPP A;  3SEB A;  1EYA A;  1WCM H;  1RKN A;  1SR3 A;  3GTG B;  1LTL A;  4LFB L;  3OWE B;  2A74 C;  2X69 A;  3DWP A;  3HOW H;  3FMC A;  2D0P A;  3HOZ H;  4A93 H;  1LT5 D;  1GM5 A;  2JEB I;  3GO5 A;  1SAP A;  3BYT B;  4PZ7 A;  1JB7 A;  3IFT A;  1WTO A;  2RSO A;  1Q1B A;  1T9H A;  4JBM A;  2E8G A;  1P8L A;  2WB1 G;  4DUZ Q;  2DUD A;  4V0B A;  3Q22 A;  2PI2 E;  4DNR B;  1U0L A;  3PO3 H;  2F0U A;  4NMZ A;  4DK6 C;  2N3S A;  1VQP A;  1Y14 B;  5IIF A;  1QB5 D;  1TWA H;  1L1O C;  4QL5 A;  1VCI A;  1EUJ A;  4S3S A;  3KOJ A;  4C3J B;  1K0R A;  1JOO A;  4KY6 A;  5G3L D;  4NPS A;  3S15 H;  4JV5 L;  2JA5 H;  5ELC A;  1K83 H;  1Y8N B;  4JI8 Q;  1G91 A;  2E2J B;  1PTO D;  1XTD A;  2SNS A;  1Z7T A;  4KMU C;  3VR2 A;  3EJI A;  3K0X A;  4DUY Q;  1DGS A;  5ELO A;  1A2U A;  2EYP A;  2YTX A;  4UY8 C;  1VQN A;  2B2Y A;  3MXP A;  1PDQ A;  4GKJ L;  1X6O A;  4TQU S;  3Q23 A;  4J6H A;  4DR2 L;  5E4W C;  2K5V A;  3HOU B;  1CK1 A;  1J9O A;  1STA A;  1AN8 A;  1SRO A;  5FOB B;  1PTO C;  3CQZ B;  3CCJ A;  2E76 C;  1QCB D;  1SE2 A;  3T16 A;  3OTO L;  1OXV A;  3NK9 A;  4NW2 A;  5KYL A;  3W1B A;  1Y1V H;  5NUC A;  4KY5 A;  3T53 B;  3NQT A;  1P16 A;  1BCP F;  2RHS B;  2YTV A;  1TU2 B;  4NXN Q;  4AIM A;  3H09 A;  5FK9 C;  1HR0 W;  4A3B B;  4BY7 H;  4DNI A;  4WJ3 M;  1HTP A;  3A8J E;  4F87 A;  3S1N B;  2IHF A;  4NXM Q;  3S14 H;  3KLR A;  3C1F A;  4OO1 G;  1U4P A;  4P74 A;  2AUK A;  1TWH H;  1ILQ A;  3T4A C;  3CPW A;  4K14 A;  4AQY Q;  4A3E B;  2AWO A;  3DEO A;  4K5W A;  2EZV A;  3BG3 A;  2QKI C;  4XT3 B;  1LTS D;  4OON A;  4QUF A;  5IGB A;  5E7N A;  4A3D H;  1SNC A;  4X62 L;  4E6I A;  1H9M A;  2Z4I A;  3MA2 B;  1PHJ A;  1GHJ A;  5COY A;  2B2W C;  5EPL A;  2PQE A;  2KBN A;  3NQI A;  2OCE A;  3KF8 A;  1HQM C;  1DCZ A;  2AQ1 B;  1K3B C;  2Z6K A;  4C2M B;  4JI0 L;  4MN3 A;  4AH6 A;  3NP8 A;  3HOV H;  1AP0 A;  4DUZ L;  4C3H B;  5C5M A;  4ZK9 B;  3AFQ A;  4GN3 B;  4XIG S;  1K8M A;  1BQQ T;  1FVI A;  4XQN A;  4A3D B;  4FYD A;  1ET9 A;  5EBD A;  1PTO H;  1KRT A;  2F3W A;  4K8J A;  2H5X A;  3I4N G;  3K5M A;  1ENC A;  5DM7 3;  3ERQ A;  3KLS X;  4A75 A;  4X65 L;  2HCI A;  1VQG A;  2KA7 A;  2LSS A;  2LMC B;  2F0O A;  1L2F A;  4K8I A;  2UUB L;  1OXU A;  3S2D H;  4EQN A;  4UP8 A;  1Y8O B;  3MEH A;  1ML0 D;  2E2I H;  1FNV A;  1T5X D;  1JOR A;  2KEE A;  3KDF A;  4X6A H;  4QCL A;  4MIU A;  1NCV A;  4TVA B;  5C4X B;  3RN2 A;  1EIY B;  3CD6 A;  3SK4 A;  1J5E Q;  1FNW A;  2L0C A;  2A68 C;  4XXE A;  5LMN L;  3HS0 C;  3H3V I;  2UXC Q;  2CWA A;  2EY5 A;  2WKD A;  3H6M A;  1PH3 A;  1KIX A;  3K58 A;  5DLQ E;  2KED A;  1CQF A;  1N32 L;  2AWN A;  4ZCK A;  4RGO S;  2AUJ D;  2P5Z X;  1WD1 A;  3LWE A;  4IUU A;  5TSS A;  4PZ6 A;  1I6H H;  4OIK A;  4DV2 L;  3DEP A;  3H15 A;  1Q1E A;  5CV6 A;  1ROD A;  1BUV T;  3HEJ A;  4XQJ A;  2K28 A;  5IP9 H;  4DR6 L;  3X3M A;  2L12 A;  3PUX A;  3M4Y A;  1KD1 C;  4A3G G;  3RLF A;  3F2B A;  1I4G A;  2ZTD A;  3I4L A;  5D65 A;  1JQY D;  1XPR A;  3J81 c;  2K6A A;  2K03 A;  3EFX D;  1XNR L;  4N9P A;  3UDX A;  4X66 Q;  4LFA L;  3GTG H;  1QE6 A;  3A56 A;  4K6L A;  5M3F B;  5D3D A;  3L9A X;  4GN5 A;  3JAM E;  3KBX A;  3F2C A;  4HED A;  4YCW A;  5C4H A;  3ERS X;  2JA8 G;  2QEJ C;  1UEA B;  4J1M A;  4L6T B;  2IJ0 A;  4B3M L;  3Q8D A;  1A6X A;  4LFB Q;  3KLS A;  3T1Y Q;  2E2H H;  2NTS A;  5IT9 E;  3L7Z C;  3M7G A;  3GTJ B;  2R92 G;  1E0B A;  4FP5 D;  3EVQ A;  4HJ7 A;  1QVF A;  1X32 A;  3GTK H;  2BA0 A;  4DAY A;  1VQE A;  2EJM A;  3G71 A;  1NY4 A;  5M3F H;  3KF8 B;  2EPB A;  1WD0 A;  3KF6 A;  4GZY C;  1X56 A;  1AH9 A;  2XWJ B;  4RWS C;  2NVQ B;  3CPF A;  3TP7 A;  3EA6 A;  2R93 G;  4B3S Q;  4CDF C;  2VUM B;  1EY4 A;  4KHZ A;  5I6W A;  2K01 A;  1YIJ A;  3CC7 A;  5ELB A;  5C0X H;  1TWF B;  3NWT A;  2JA5 B;  4J8Q A;  3A0J A;  4MZ9 A;  4WJ4 A;  3C2P A;  1XNQ L;  2YU9 H;  2LS0 1;  4JI2 L;  5IWA Q;  1VF5 C;  3MZ5 A;  4DGZ A;  1X9N A;  2PPB C;  1JJC B;  1O78 A;  4IUP A;  5EPJ A;  1GD7 A;  3DM3 A;  4A3F H;  1SDF A;  2QCP X;  3OW2 A;  2Z9H A;  1Q86 C;  1BO0 A;  1IBM Q;  5HY6 A;  1EZ8 A;  3S2H B;  1Y1W H;  1SNP A;  1WTR A;  4ID6 A;  4JI4 Q;  5JAV A;  5C3W A;  3MXG A;  1KNA A;  1HA6 A;  1QOH A;  4CKC A;  1GUW A;  2K04 A;  2KOL A;  2DNE A;  3AQQ A;  1PRT F;  1DD2 A;  5CV8 A;  4DV4 L;  1C4Q A;  3JAM c;  3J7Z C;  4RCO A;  4DV7 Q;  3U58 A;  4UHV A;  4OHJ A;  4RFB A;  4JV5 Q;  2IX3 A;  4IFD H;  1QNK A;  1B4O A;  1VQH A;  1M1K C;  1LAB A;  1A15 A;  3K5L A;  3HKZ B;  1DYQ A;  5K36 H;  2OT2 A;  3F2U A;  1L0Y B;  4DUY L;  1BBW A;  1N34 Q;  3D6C A;  1Q46 A;  5CV7 A;  4JI3 Q;  3MTS A;  3U9S A;  3RN5 A;  5C4X H;  4X66 L;  1VQF A;  4BBR G;  3GTQ H;  1WI5 A;  4LF4 Q;  2F4V Q;  3S17 B;  2MQH A;  1HR0 L;  1FD7 D;  3GTM H;  2J0T D;  3RNU A;  2LXK A;  5IOC A;  2B3G A;  4KD4 A;  1G8Z D;  2K32 A;  1PH6 A;  4OX9 Q;  1CSQ A;  3C1E A;  3CF5 A;  3IL8 A;  2VB3 X;  3I56 A;  2QW7 A;  2Y0S G;  4KK7 A;  4JBW A;  1G2S A;  2PQA B;  1SYC A;  5CC4 A;  4APV A;  4C3H H;  1HFG A;  1Z47 A;  1WCM B;  2FHT A;  3H91 A;  2JA8 H;  2PMZ B;  3TP8 A;  4GOP B;  4KKS A;  3CP0 A;  2AQ2 B;  2EJG C;  4AYB E;  3HOZ B;  2K7V A;  4Q5V A;  1GXD C;  1HZ9 A;  1SYB A;  5BN4 A;  1PH9 A;  5HGT A;  1N33 Q;  1HNW Q;  2ZT9 C;  3ULP A;  1YJ9 A;  1CA6 A;  4HN7 A;  4G7H C;  1TII D;  3RMH A;  1XNQ Q;  2VXW A;  3HP3 A;  2VQE L;  3GTL B;  2HIX A;  4ZAI A;  2BOS A;  3LX0 A;  2M00 A;  5JEA G;  1JJG A;  4NKL A;  4WFN 3;  1XMQ L;  1SFO H;  1HH2 P;  1MGS A;  1RCV D;  1XXG A;  5FKA C;  2R61 A;  1A62 A;  2WKC A;  4C3I B;  4JI7 L;  1HQR D;  4HSP A;  1CA5 A;  1JE5 A;  4HMI A;  3H0G H;  2G9D A;  1VQ6 A;  5C4X G;  5C4J H;  1HZC A;  1VQD A;  4NB3 A;  4CDE C;  4JYA Q;  5C44 G;  3VYU A;  2KCM A;  3KJO A;  2QGQ A;  1I3Q B;  1PH5 A;  3I72 A;  3CME A;  4UPA A;  3ONA B;  1K8O A;  4BY7 B;  2F3I A;  5K36 G;  4P75 A;  4B3R Q;  4B08 A;  3A8I E;  2A6E C;  3J81 i;  2TMP A;  4DAM A;  3CKI B;  3CQZ H;  4GN4 B;  1N32 Q;  3K7A H;  1W3S A;  3UE0 A;  3FRP B;  3S1M B;  1TVX A;  4KJO A;  5EKI A;  1WTX A;  1CSP A;  3VR3 A;  5GQO A;  2PZU A;  4LF4 L;  2UXD L;  1EL0 A;  3SVM A;  1UAP A;  2XN9 C;  3I90 A;  3UDF A;  2RDF A;  5JJK A;  3RZD B;  2DNC A;  3PUV A;  4CGY B;  4OX9 L;  3BZK A;  1PRT C;  1JOQ A;  4HCE A;  2ALY B;  1I4X A;  2B2U C;  3BYY B;  4Y7N B;  1I50 H;  4LF8 L;  1SNM A;  1LTI D;  1VQC A;  5EJW A;  4A3I B;  1V1O A;  2F0G A;  4RA8 A;  3GDE A;  5CYU A;  2KCN A;  1EY8 A;  3K5O A;  1XNR Q;  1V8Q A;  4C3J G;  4BS9 A;  4GKJ Q;  2D5D A;  2F0N A;  3MHB A;  5COR A;  2F0D A;  3MAQ A;  3VR6 A;  1PZJ D;  2Q8R E;  1XJV A;  1EEF D;  3P1H A;  1O7I A;  1EIG A;  2MP1 A;  2F0E A;  3G7L A;  2PYK A;  3R93 A;  3KK7 A;  5IYC G;  1ASZ A;  1ESR A;  2B2Y C;  4IPC A;  1QIL A;  1MJC A;  2QEX A;  1O7Z A;  1VQL A;  1SJE D;  3SK5 A;  2WAQ G;  3MFG A;  3HOU G;  4OIJ A;  1PZK D;  1AEX A;  4A3E H;  3IFD A;  1HZB A;  1CTM A;  4C1N I;  1JR0 D;  1SE3 A;  4BXX G;  5A35 A;  1S5D D;  2I0Q A;  2CW0 C;  4IUV A;  4OO1 H;  3A7L A;  2B29 A;  5EKK A;  5IGG A;  1SJH D;  1NJI C;  3T13 A;  4R4I A;  1UE6 A;  2L55 A;  4ULL A;  1PH7 A;  2O5J C;  4LF7 Q;  3K7U C;  5I2Y A;  1ICW A;  5IP7 H;  3PIP A;  4GKK Q;  3QG1 A;  4YCV A;  3SHL A;  5KIX A;  3CC2 A;  3EQL C;  1VQO A;  2D0O A;  5JEA J;  3PO2 B;  1Q3L A;  2RKS A;  2CW0 D;  3HOV B;  4A3C H;  1WOC A;  3KBG A;  2EYO A;  4A3G H;  1LTG D;  5IP9 G;  2PCF B;  3H94 A;  2XWB B;  4JI0 Q;  2JA6 B;  2EY2 A;  5FJ8 G;  4HJ9 A;  1XYI A;  3WOF A;  2BH2 A;  1S5F D;  1MIU A;  2ZTC A;  3ZJY C;  3ICE A;  4G7O C;  1PXU A;  1M4V A;  2K1B A;  2WB1 E;  4QUC A;  3NBH B;  2VW9 A;  1TS2 A;  5T1I A;  4JI2 Q;  4POG A;  1SMY D;  1E7Z A;  4HID A;  1XMO L;  2D2C C;  4R4Q A;  1BBX C;  1IW7 C;  2MGS A;  2IW3 A;  3KF6 B;  3PGZ A;  1K8G A;  2NVX B;  4PNY A;  1YHQ A;  3B6Y A;  5M3M G;  2O5I C;  4A93 B;  2JYO A;  1SE8 A;  3HOX B;  1EY0 A;  1OXS C;  2L9H A;  3VA5 A;  2ES2 A;  2F4I A;  1GUS A;  5IT9 c;  2ATW A;  4EQO A;  1HR0 Q;  5C3E B;  4OO1 I;  5J1Z A;  1YJW A;  2OXP A;  5E1F A;  2KCC A;  1FJG L;  1NE3 A;  2F0T A;  3OYY A;  2EYJ A;  1PA6 A;  2ENB A;  3FKI G;  3MC0 B;  3R2I A;  5CGK A;  1GJX A;  2YV5 A;  3K7A B;  3V96 A;  1D6E C;  5GAG C;  1E3P A;  1PRT D;  3TEH B;  2QDL A;  1WCM G;  3GV6 A;  3FHW A;  4JI1 L;  4JI3 L;  4EX5 A;  1E1T A;  1G51 A;  1HZA A;  1I4Q A;  3E5S A;  1NNX A;  2PQA A;  1YBY A;  3OIQ A;  3P20 A;  2UU9 L;  1STB A;  3KYH C;  2CQO A;  4P72 A;  3PO3 G;  4H13 C;  5M3M H;  1QWY A;  2R7F A;  4O2D A;  4YWK A;  5AFW A;  2J7Z A;  2V1C C;  1E24 A;  1V43 A;  1GKH A;  5IYB H;  2MHV A;  2V4D A;  3UI2 A;  1N36 L;  2NN6 G;  1DON A;  1PRT B;  2RA4 A;  4IQZ A;  4QIW B;  5L37 A;  4YY3 L;  4PQX A;  5C44 H;  2N8N A;  3K5N A;  1DOK A;  5IP7 G;  3VDY A;  1G29 1;  4K5V A;  1RHP A;  2IWH A;  3T56 B;  4ILW A;  1L1O B;  4A3B G;  1VMC A;  2UUB Q;  1F9S A;  3BDC A;  1II3 A;  3N52 A;  1KRS A;  5BN3 A;  2HDL A;  2OF1 A;  2K50 A;  1CKN B;  3ULJ A;  4FF4 A;  1PVO A;  4A3E G;  2I5L X;  1HNW L;  1TWG B;  1I50 B;  5E3F A;  1Y1W B;  1KAW A;  3NHH A;  1H9K A;  5JJI A;  2RQX A;  1TWC H;  3M4O H;  4CJ2 C;  5C0X J;  4JW0 A;  2CHB D;  4ZYS A;  1C0A A;  3K8A A;  4IUN A;  1PTO B;  1JJ2 A;  2I5H A;  3PCO B;  2OTJ A;  4N8X 1;  5CBE E;  2A1A A;  3W1G A;  5FLX L;  2R6G A;  2E5L Q;  1EQQ A;  3D6W A;  1S5C D;  4XYQ A;  4DV6 Q;  2LKV A;  1PTO F;  3DWA A;  4DV1 Q;  1KHI A;  4A4I A;  1EY9 A;  1YNX A;  5M5W B;  1CT1 D;  5LL6 S;  4YCU A;  1UNS A;  3M4O B;  4RMF A;  2Q8T A;  4A3K B;  3S9W A;  2R7D A;  4IJH A;  2FFK B;  5IWA L;  4CJ0 B;  2XIW A;  1NBW A;  4DR6 Q;  4A3L G;  1H9J A;  3PUZ A;  3NWS A;  3OMG A;  1EWH A;  2JA5 G;  4R1J A;  1CHP D;  1IBM L;  1OTC A;  1NTG A;  1SYE A;  4LUZ A;  3J80 L;  4NXN L;  4JI5 Q;  1PH2 A;  4CDC C;  2WV6 D;  1ZEQ X;  2EXZ A;  2E2J H;  3S16 B;  2IX0 A;  1VQ4 A;  2ICE C;  3VYR A;  2B2U A;  3NBH A;  4ODG A;  3TS0 A;  5D14 A;  1BKB A;  2B39 A;  1LTB D;  1B7Y B;  1HNZ L;  1SEB D;  1H9S B;  3WOE A;  3MEF A;  1I4P A;  1KAB A;  1M8A A;  3DUZ A;  1AE3 A;  4PZ8 A;  3AMU A;  4TRD A;  1EEI D;  3L2P A;  4MHE A;  4HIM A;  3HOY G;  1VS0 A;  2DGY A;  5ELF A;  1O80 A;  3M3Y H;  3VA7 A;  3S1R H;  1I3Q H;  3OWF A;  1VQI A;  3ZYY X;  2RBM A;  1RJT A;  1X3P A;  3CCS A;  5M9O A;  1GUO A;  1PV4 A;  4LF7 L;  3CAM A;  1QJO A;  2CQA A;  3FVQ A;  1E2W A;  5LMU L;  4JPB W;  1OXT A;  5A2Q E;  1ENF A;  1FL0 A;  2VY3 A;  4A3J B;  1IBK Q;  4R8N A;  4R9W A;  3I7F A;  1HUM A;  1C9O A;  2RSN A;  3A8K E;  4XDX A;  3RR5 A;  2Q8I B;  1LTT D;  2ZM6 L;  2ASB A;  2K52 A;  2N55 A;  4A3M G;  3QO2 A;  3H0G G;  3KFU A;  4FF2 A;  1RDP D;  4DV1 L;  3J80 E;  4J15 A;  4MTN A;  4CBV A;  3CXC A;  2F3V A;  2GN5 A;  3J7A 5;  1D5X C;  2A69 D;  2Z4H A;  4DR5 L;  4IUQ A;  2UXB L;  2K5W A;  4R4C A;  1LUZ A;  4X3K A;  1FR3 A;  4ZQ3 A;  2YYZ A;  4CKE A;  5JEA H;  1WTH A;  4A3J G;  1TT2 A;  4DXF A;  4IPG A;  4X65 Q;  1GUN A;  4IJL A;  3AB9 A;  4EGV A;  3PIO A;  1F2M A;  1YI2 A;  3FP9 A;  4DR1 Q;  1EWI A;  1QNU A;  5BN5 A;  3AFP A;  1SRU A;  1PFN A;  4F88 A;  1MSH A;  4BBR H;  4A3M H;  1YHB A;  5LHY 1;  2DJF C;  2R7Z B;  2CWP A;  1TXY A;  3D0F A;  1HPC A;  1GO3 E;  5KYI A;  2A8V A;  3ULL A;  2Q2U A;  5KEE A;  3S2H H;  1JT8 A;  2BDO A;  1F9Q A;  1ENA A;  3STB C;  3AU7 A;  4C2M H;  4G7Z C;  2NN6 I;  4A3I H;  3U4Z A;  1SBB B;  5LMN Q;  3FKI B;  3TBI B;  5ELD A;  2O2L D;  4ZRZ A;  4C3H G;  1CKM A;  1VQJ A;  4QJF A;  3S17 H;  1Y69 U;  4I7A A;  4KD3 A;  3J81 E;  4IFD I;  1B1Z A;  1BR9 A;  1KL9 A;  4KLK A;  1KQS A;  4O1N A;  2X6L A;  5C0X I;  4IFD J;  5BR8 L;  3CCL A;  4WOR A;  2FJ2 A;  4R8I A;  1K28 A;  4CJ1 B;  1V1Q A;  4PG3 A;  2A5H A;  3HOY H;  2HD3 A;  2BE5 D;  3A55 A;  3BS1 A;  4JBK A;  1JCK B;  4HJ8 A;  3HGB A;  4H0L C;  4AYB B;  2E2I B;  2C35 B;  1IL2 A;  4JC0 A;  2RCF A;  3OW7 A;  3NPP A;  5IGD A;  1UUP A;  2IX1 A;  1EYC A;  3HKS A;  3WWV A;  5J39 A;  3GQB A;  3VR5 A;  3K81 C;  4KHP L;  4BBS G;  4LF5 L;  2E74 C;  1NMF A;  1N8R C;  4NXM L;  2CH4 A;  3TSS A;  4LAA A;  1S72 A;  5AJ3 Q;  2KCT A;  1DM0 B;  4OXP A;  2VQF Q;  4LWC A;  3PO3 B;  1X3E A;  2HT1 A;  1K0S A;  1IKL A;  1SNQ A;  4AYB G;  1AZQ A;  1Y1W G;  1TR5 A;  2XRS D;  3I73 A;  1CKN A;  1V9P A;  5HGQ A;  4A3L H;  3U4V A;  5DM6 3;  4A3F G;  1R9T B;  5JPN C;  3I4M G;  3HZX A;  1TS3 A;  4DPG A;  3CRK C;  2OEO A;  4O42 A;  2OQK A;  2SEB D;  5C4J B;  1KDC A;  2J4X A;  4QF4 A;  1ESF A;  1XX8 A;  1QG7 A;  1VQ9 A;  3PQI A;  1LYL A;  3VYS A;  5EKL A;  5I9P A;  4DAV A;  1I94 Q;  4X64 Q;  3EIV A;  2HUG A;  1CKO A;  3GTO B;  5LMN W;  2F1M A;  1U9R A;  4FF1 A;  4DN4 M;  3F1Z A;  1MHW C;  1IYU A;  1JB3 A;  1XTC D;  1KLG D;  5M3F G;  2B2V C;  4DV5 L;  4LFC Q;  2EQS A;  1PYB A;  4IOC A;  3U50 C;  1ONL A;  1ILP A;  1D1K A;  3BJU A;  3A7A B;  2IL8 A;  3L0O A;  2JA9 A;  2UUC L;  2IPK D;  5BR8 Q;  2CVR A;  2F4V L;  4XQQ A;  1NAP A;  5ELN A;  3Q6S A;  2HQE A;  2WIN B;  3JAM L;  2JA7 H;  4L5Q A;  4KJN A;  1EYG A;  1N9W A;  5J22 A;  5C44 B;  2N88 A;  3GTP H;  3WDN A;  3NTK A;  4ZKB B;  1S40 A;  2JP1 A;  1J8I A;  1XMO Q;  2R93 B;  1HRJ A;  2PNH A;  4DR4 Q;  3QWN A;  2HQL A;  4DF7 A;  4EVO A;  4X3T A;  5IY0 A;  1KDA A;  3J7A V;  1NSN S;  2L15 A;  1JC7 A;  3UDG A;  1Y8P B;  4BWG B;  2A73 B;  3TZU A;  1HNX Q;  1BOS A;  4LK1 C;  4KKT A;  4NDX A;  1RF2 D;  4IUT A;  4QIW E;  3CCV A;  4H7B A;  3IAY A;  4JG2 A;  3J7A F;  2VQF L;  4GOP C;  4OWW B;  2PZT A;  1WJJ A;  4G4K A;  3S1M H;  1DOL A;  3CCQ A;  2PW7 A;  3F8T A;  3PF5 A;  3ND8 A;  2KVM A;  5C3X A;  5CV9 A;  1L0W A;  4GLX A;  3K80 C;  1HUN A;  1Q90 A;  3G6E A;  4CHT B;  3CW2 C;  3UE1 A;  2CKZ B;  1WTP A;  4LUV A;  3A5Z B;  3G6J B;  4K2L A;  3T51 B;  1LTR D;  5IGC A;  5M5Y H;  5C5L A;  1FNU A;  2FIN B;  1MD2 D;  4K2K A;  1ASY A;  2G9H D;  3OMC A;  4JI7 Q;  1TKW B;  1VF7 A;  1SYF A;  4A76 A;  4F8M A;  5JVG 3;  3PIO 3;  4YIJ A;  2NVT H;  2M2L A;  2MFI A;  1C48 A;  4JYA L;  5CMD A;  1KXL A;  3CMA A;  3LNN A;  2UXB Q;  1LAC A;  1ET6 A;  3HKZ E;  3LGJ A;  2HHH L;  1PFM A;  1TS5 A;  1F9P A;  4LF9 Q;  1PFB A;  3AEV A;  4QB4 A;  4U67 3;  1JWM D;  3BVG A;  2ZXR A;  1BBU A;  3S16 H;  1B3A A;  1I6V C;  5J3B A;  2NBF A;  4DFA A;  1W6K A;  4DR1 L;  2AKW B;  4N9T A;  3GV3 A;  1A3V A;  1Z9F A;  3W2D A;  4HCS A;  2XTI A;  3GD7 A;  4P71 A;  3GTL H;  2LFN A;  4A3G B;  2GVB A;  3V2T A;  1WTW A;  2DY8 A;  3SDZ A;  2C9O A;  5KND A;  1WTQ A;  3D4D A;  1LO5 D;  1K8A C;  4L8J A;  4A3C G;  2Z1C A;  1B53 A;  4C3I H;  2PW5 A;  3M7N A;  3MVV A;  1WTV A;  2HIV A;  5CV5 A;  4OEM B;  1WYD A;  3I4M H;  4A3D G;  2KEN A;  4M8A A;  5DNF A;  2SOB A;  3CHB D;  2VS1 A;  2RF4 A;  1HNX L;  2PO4 A;  3SK8 A;  1RD9 D;  1UE1 A;  1F2Y A;  1B44 D;  3I4O A;  5E4X A;  4DV7 L;  2B63 G;  5FLM G;  3NSW A;  2JXM B;  1V1P B;  3PUW A;  4DV0 L;  1EOV A;  2M9V A;  3I8Z A;  3I2Z A;  2JSO A;  4HSV A;  4DV3 L;  3HFZ B;  2Z0S A;  1Y1V G;  1IW7 D;  1E2V A;  4DR3 Q;  1Q7Y C;  3SR1 A;  3MXU A;  5M3M B;  1BCP B;  2ZXO A;  4JOI C;  4WJW A;  3HRZ C;  1TWA B;  2O4X A;  3BVM A;  4HR7 B;  5HUR A;  1A63 A;  2WP8 J;  3TP5 A;  4XYO A;  4C3J H;  2X6G A;  1SLJ A;  2NVQ H;  4L63 B;  2AMC B;  2F0I A;  1I4H A;  1U4M A;  2H4O A;  5FO7 B;  4XTC S;  4OL7 A;  2LXJ A;  1Q82 C;  5GAD C;  2KHI A;  1JOK A;  2PZW A;  5GRO A;  4A93 G;  4K0K Q;  3DXJ C;  1F9R A;  2HHH Q;  3CC4 A;  3NEM A;  2NB0 A;  5C3E G;  3PUY A;  1W6J A;  3D8G A;  2RHQ B;  3GP7 A;  1XWE A;  4B9W A;  2JA7 B;  4BBS B;  2RDH A;  5FO9 B;  4RKB A;  1EY6 A;  2F0J A;  2E5L L;  2K5Q A;  4RHR A;  5AJ3 L;  2RCN A;  1SYD A;  4LW1 A;  4IUR A;  3I70 A;  1QUQ B;  2MO1 A;  5T1G A;  3VR4 A;  3GTK B;  1PMR A;  1CHQ D;  3CU7 A;  4K5X A;  4QMG A;  4BBR B;  4LF6 Q;  4TSS A;  1HFN A;  5JOB A;  4L5T A;  1B9M A;  3JC6 6;  3RZD H;  3NTI A;  2K5D A;  2R7Z H;  3A54 A;  4O0A A;  4BY1 B;  3HOW G;  3I3C A;  3L3O C;  3MFY A;  4HMJ A;  1NUC A;  4JI5 L; 
#chains in the Genus database with same CATH homology
 4I7Z C;  2Y0S B;  1Q12 A;  2YU9 B;  2F0H A;  1LLR D;  1STH A;  5G3L F;  4KTA A;  3TP6 A;  3GTM B;  4PMC A;  1SNO A;  2A6H D;  3S14 B;  3C3L A;  4KKU A;  4P2C B;  2NZ1 D;  1TWH B;  2F0F A;  2EJF C;  2NVT B;  1B2T A;  3I4N B;  3BDL A;  1U4R A;  1JIC A;  2BDN A;  3V05 A;  5I9O A;  1V1P A;  4WRD A;  2VB2 X;  2WB1 B;  3OOC A;  2F0S A;  1MSG A;  4RKL A;  2L4N A;  3SE0 A;  3M3Y B;  1PZI D;  5KNC A;  3J81 L;  5DEH A;  5ELE A;  3GTQ B;  1KDB A;  2L11 A;  2A6E D;  1EIH A;  2AQ3 B;  1F77 A;  2EYM A;  3W3A A;  3M85 A;  3D4W A;  5CBA E;  4IAL A;  2KQ3 A;  1CI3 M;  1T5E A;  4ZKC B;  3S1R B;  1HCZ A;  5IGF A;  2H1E A;  4IFD G;  5KRU A;  1SE4 A;  3SXH A;  1EFI D;  2SDF A;  1IHZ A;  2F0W A;  2I07 B;  3CRL C;  1SYG A;  1HA5 A;  1ZXT A;  1D1I A;  5FO8 B;  1BXT A;  3HG9 A;  1K83 B;  1WVL A;  4Q0F A;  3K57 A;  5I4D A;  4HTH A;  5EQ0 A;  1CQV A;  3TME A;  1F2L A;  2PNR C;  1EY7 A;  4RGN A;  4TKO B;  4B9X A;  4ZUJ A;  1STE A;  3C46 A;  3NUC A;  3R8B A;  3FDT A;  3Q0A A;  1MI2 A;  1CM9 A;  4ME5 A;  3GTP B;  5C0X G;  1AW7 A;  2KEC A;  2EYH A;  2BA1 A;  1E2Z A;  3H0G B;  5JJZ A;  1CZG A;  3BDO A;  1D5Z C;  3D3R A;  4KN7 C;  2KHS A;  4DXG A;  4FO2 A;  1TS4 A;  3P75 A;  4A3M B;  1KLU D;  1YNJ C;  1JE4 A;  4PMB A;  3NBI A;  2NN6 H;  1HXY D;  3QB3 A;  1OO9 B;  2HCC A;  4X3U A;  2QF7 A;  2KUM A;  3DHQ A;  2B2V A;  1H9S A;  1LTA D;  3OIP A;  4DAP A;  2EDG A;  3I91 A;  3TZD A;  1LT3 D;  1EWC A;  4C1N K;  3QIA A;  4M1U B;  4RAU C;  5K5P A;  2TSS A;  5M5Y B;  3S2D B;  2F0M A;  1HHV A;  1BNZ A;  5I6Y A;  5M5X B;  1G2T A;  5IOD A;  2XRQ D;  1TQO A;  4F7X A;  2K05 A;  3NXW A;  3E0J A;  3QOL A;  3ITP A;  2BE5 C;  4JK1 C;  1MBY A;  3U9O A;  2DN8 A;  4V19 0;  4U68 A;  4DU9 A;  2F0K A;  5EBC A;  5IGE A;  2XVS A;  5LL6 X;  4HAE A;  2ZXP A;  1S5E D;  2NTT A;  3HOW B;  3K59 A;  4IN3 A;  1RTN A;  1DOM A;  2WAC A;  3FPU B;  2B8F A;  2EOT A;  1SND A;  1CFM A;  3BVZ A;  1AFP A;  1EOT A;  3X3N A;  4KHV A;  3P7J A;  2C5C A;  2F0Q A;  2R3Z A;  2QDB A;  2LY7 A;  2B2T C;  1KAA A;  1STN A;  1JWU D;  4FVM A;  2K33 A;  2I46 A;  2NWG A;  1VMP A;  5I2X A;  2Z8L A;  4UDU C;  2FMM A;  1BDO A;  1SXT A;  1PYW D;  2RDG A;  1EZ6 A;  2B2W A;  2MJ8 A;  3PMF A;  1A2T A;  3URY A;  4UAI A;  5F2D A;  4EQP A;  3QJY A;  1IYV A;  1TY0 A;  1SFO B;  1F2Z A;  5A2Q L;  4RCN A;  5CR3 A;  3DM1 A;  2EYF A;  3PIP 3;  3S1Q B;  2ICI A;  1EYD A;  4Z9C B;  1AZP A;  3J7Y W;  1YNN C;  4ZUI A;  1KNE A;  5EGT A;  1ZYR D;  3VYT A;  2B63 B;  1TY2 A;  3PV0 A;  1YNN D;  1Y1V B;  2A68 D;  3NE5 B;  5JPM C;  4OGQ C;  3Q24 A;  1EU4 A;  4DNT B;  3MXN A;  4BA1 I;  3TDQ A;  1Q8I A;  1O7Y A;  2E2D C;  1DZ1 A;  3DMU A;  3OSO A;  5ISR A;  3R3O A;  1NR4 A;  4PMW A;  4DK1 A;  1R4P B;  1L0X B;  1KTK A;  1C8C A;  2JEA I;  5FLX E;  1GOZ A;  1H9R A;  3HOY B;  1EU3 A;  3O13 A;  2MUY A;  1DXM A;  2KJX A;  3RZO B;  4FF3 A;  1G6Z A;  5EPK A;  4RH6 A;  1RTO A;  4DA2 A;  5D3I B;  4RHS A;  1O7L A;  2FMC A;  4FXD A;  1EQV A;  1A3U A;  2F0L A;  2F0P A;  1FYC A;  4NP5 A;  1I6H B;  2NVY B;  1B9N A;  4PV1 C;  4FXK C;  3K0Y A;  5DAU A;  2E2H B;  1LT6 D;  4RGM A;  3MWY W;  4IZ8 A;  1Z6H A;  1CZW A;  1D5M C;  4KN4 C;  1EQT A;  3DWQ A;  1S4Z A;  2NUC A;  1PLF A;  3D4R A;  1DJR D;  1I4R A;  4FNF A;  4G57 A;  3K6O A;  3E6Z X;  2QIL A;  1R4Q B;  1EY5 A;  3ND9 A;  4X3S A;  5C4Z A;  4BA2 I;  2F0V A;  4DK0 A;  2B8G A;  5C6A A;  3S15 B;  2EE1 A;  3ERO A;  4CKB A;  1ZYR C;  2L1B A;  2SNM A;  1SSO A;  1JWS D;  4FXG C;  4I65 A;  4C56 C;  2DY7 A;  2D62 A;  1ZKO A;  1IL8 A;  4KV6 A;  2GA4 B;  3KUP A;  1STG A;  2D9U A;  2RVL A;  3LWU A;  1IKM A;  1BF4 A;  1LV9 A;  3N6R A;  4KI0 A;  1X3Q A;  2WAQ B;  2BCO A;  3BZD B;  2XNA C;  2B2T A;  4H44 C;  3R2T A;  2NYZ D;  4LJZ C;  3H3V C;  2EYL A;  2JE6 I;  4KY7 A;  1BCP C;  5CV4 A;  2XSC A;  3OHX C;  3FEW X;  4ZLT F;  3SK6 A;  4RGT A;  2EVB A;  2MPM A;  1YNJ D;  5IT9 L;  2ID0 A;  3D31 A;  5JVH 3;  2F03 A;  1FGB D;  2E75 C;  1B50 A;  3TN2 A;  1BCP D;  4A3F B;  2A69 C;  3I4M B;  1TWC B;  1U4L A;  4LMQ D;  1GUG A;  1OXX K;  2VNU D;  3QOJ A;  1SMY C;  1GUT A;  2JA8 B;  4XT1 B;  1GHK A;  1D2B A;  3NTH A;  4ABN A;  1LT4 D;  2IT1 A;  2L5T A;  1A3T A;  2R92 B;  5KGU A;  2A6H C;  4C3I G;  1NR2 A;  2WII B;  3RUZ A;  5KNB A;  1VDZ A;  1HTL D;  2HDM A;  3OPO A;  2EY1 A;  4K6D A;  2EY6 A;  3RD4 A;  3IKJ A;  1S5B D;  1STY A;  3FPP A;  3SEB A;  1EYA A;  1RKN A;  3GTG B;  3OWE B;  2A74 C;  2X69 A;  3DWP A;  3FMC A;  1LT5 D;  2JEB I;  3GO5 A;  1SAP A;  3BYT B;  3IFT A;  1WTO A;  2RSO A;  1Q1B A;  4V0B A;  3Q22 A;  4DNR B;  2F0U A;  4NMZ A;  5IIF A;  1QB5 D;  1VCI A;  4S3S A;  4C3J B;  1JOO A;  4KY6 A;  5G3L D;  5ELC A;  1Y8N B;  1G91 A;  2E2J B;  1PTO D;  2SNS A;  1Z7T A;  4KMU C;  3VR2 A;  3EJI A;  1A2U A;  2EYP A;  2B2Y A;  3MXP A;  1PDQ A;  4TQU S;  3Q23 A;  4J6H A;  5E4W C;  3HOU B;  1CK1 A;  1J9O A;  1STA A;  1AN8 A;  5FOB B;  1PTO C;  3CQZ B;  2E76 C;  1QCB D;  1SE2 A;  3T16 A;  1OXV A;  3NK9 A;  4NW2 A;  5KYL A;  5NUC A;  4KY5 A;  3T53 B;  3NQT A;  1BCP F;  1TU2 B;  3H09 A;  5FK9 C;  4A3B B;  1HTP A;  3A8J E;  4F87 A;  3S1N B;  3KLR A;  3C1F A;  4OO1 G;  1U4P A;  2AUK A;  1ILQ A;  3T4A C;  4K14 A;  4A3E B;  2EZV A;  2AWO A;  3DEO A;  4K5W A;  3BG3 A;  2QKI C;  4XT3 B;  1LTS D;  4QUF A;  5IGB A;  1SNC A;  4E6I A;  1H9M A;  2Z4I A;  3MA2 B;  1GHJ A;  5COY A;  2B2W C;  5EPL A;  2PQE A;  3NQI A;  3KF8 A;  1HQM C;  1DCZ A;  2AQ1 B;  4C2M B;  4MN3 A;  3NP8 A;  1AP0 A;  4C3H B;  5C5M A;  4ZK9 B;  4XIG S;  1K8M A;  1BQQ T;  4XQN A;  4A3D B;  4FYD A;  1ET9 A;  5EBD A;  1PTO H;  2F3W A;  4K8J A;  3K5M A;  1ENC A;  5DM7 3;  3ERQ A;  3KLS X;  2HCI A;  2KA7 A;  2LMC B;  2F0O A;  4K8I A;  1OXU A;  4EQN A;  1Y8O B;  3MEH A;  1ML0 D;  1FNV A;  1T5X D;  1JOR A;  2KEE A;  4QCL A;  4MIU A;  1NCV A;  5C4X B;  3SK4 A;  1FNW A;  2L0C A;  2A68 C;  4XXE A;  3HS0 C;  2EY5 A;  2WKD A;  3H6M A;  3K58 A;  2KED A;  1CQF A;  2AWN A;  4RGO S;  2AUJ D;  1WD1 A;  3LWE A;  4IUU A;  5TSS A;  4OIK A;  3DEP A;  1Q1E A;  5CV6 A;  1ROD A;  1BUV T;  3HEJ A;  4XQJ A;  2K28 A;  3X3M A;  2L12 A;  3PUX A;  3M4Y A;  3RLF A;  1I4G A;  3I4L A;  5D65 A;  1JQY D;  2K6A A;  2K03 A;  3EFX D;  4N9P A;  1QE6 A;  3A56 A;  4K6L A;  5M3F B;  5D3D A;  3L9A X;  3JAM E;  3KBX A;  4HED A;  5C4H A;  2QEJ C;  1UEA B;  4J1M A;  4L6T B;  2IJ0 A;  1A6X A;  3KLS A;  2NTS A;  5IT9 E;  3L7Z C;  3M7G A;  3GTJ B;  1E0B A;  4FP5 D;  3EVQ A;  1X32 A;  2BA0 A;  4DAY A;  2EJM A;  2EPB A;  1WD0 A;  4GZY C;  2XWJ B;  4RWS C;  2NVQ B;  3TP7 A;  3EA6 A;  2VUM B;  1EY4 A;  4KHZ A;  5I6W A;  2K01 A;  5ELB A;  5C0X H;  1TWF B;  3NWT A;  2JA5 B;  4J8Q A;  3C2P A;  2LS0 1;  1VF5 C;  3MZ5 A;  4DGZ A;  2PPB C;  1O78 A;  4IUP A;  5EPJ A;  1SDF A;  2QCP X;  1BO0 A;  1EZ8 A;  3S2H B;  1SNP A;  1WTR A;  4ID6 A;  5JAV A;  5C3W A;  3MXG A;  1KNA A;  1HA6 A;  1QOH A;  4CKC A;  1GUW A;  2K04 A;  2KOL A;  2DNE A;  1PRT F;  1DD2 A;  5CV8 A;  1C4Q A;  4RCO A;  4OHJ A;  4RFB A;  2IX3 A;  4IFD H;  1QNK A;  1B4O A;  1LAB A;  1A15 A;  3K5L A;  3HKZ B;  1DYQ A;  5K36 H;  2OT2 A;  3F2U A;  1L0Y B;  3D6C A;  5CV7 A;  3MTS A;  3U9S A;  3S17 B;  1FD7 D;  2J0T D;  5IOC A;  4KD4 A;  1G8Z D;  2K32 A;  3C1E A;  3IL8 A;  2VB3 X;  4KK7 A;  4JBW A;  1G2S A;  1SYC A;  5CC4 A;  1HFG A;  1Z47 A;  1WCM B;  2FHT A;  3H91 A;  2PMZ B;  3TP8 A;  4KKS A;  2AQ2 B;  2EJG C;  3HOZ B;  2K7V A;  4Q5V A;  1GXD C;  1SYB A;  5BN4 A;  5HGT A;  2ZT9 C;  1CA6 A;  4HN7 A;  4G7H C;  1TII D;  3RMH A;  2VXW A;  3HP3 A;  3GTL B;  4ZAI A;  2BOS A;  3LX0 A;  2M00 A;  5JEA G;  4NKL A;  4WFN 3;  1MGS A;  1RCV D;  1XXG A;  5FKA C;  2R61 A;  2WKC A;  4C3I B;  1HQR D;  4HSP A;  1CA5 A;  4HMI A;  2G9D A;  3VYU A;  1I3Q B;  3I72 A;  3ONA B;  1K8O A;  4BY7 B;  5K36 G;  4B08 A;  3A8I E;  2A6E C;  2TMP A;  3CKI B;  3FRP B;  3S1M B;  1TVX A;  4KJO A;  5EKI A;  1WTX A;  3VR3 A;  2PZU A;  1EL0 A;  3SVM A;  1UAP A;  2XN9 C;  3I90 A;  2RDF A;  3RZD B;  2DNC A;  3PUV A;  4CGY B;  1PRT C;  1JOQ A;  4HCE A;  1I4X A;  2B2U C;  3BYY B;  4Y7N B;  1SNM A;  1LTI D;  5EJW A;  4A3I B;  1V1O A;  2F0G A;  4RA8 A;  5CYU A;  2KCN A;  1EY8 A;  3K5O A;  1V8Q A;  4C3J G;  4BS9 A;  2D5D A;  2F0N A;  3MHB A;  5COR A;  2F0D A;  3MAQ A;  3VR6 A;  1PZJ D;  2Q8R E;  1EEF D;  3P1H A;  2MP1 A;  1EIG A;  2F0E A;  3G7L A;  2PYK A;  3R93 A;  3KK7 A;  1ESR A;  2B2Y C;  1QIL A;  1O7Z A;  1SJE D;  3SK5 A;  3MFG A;  4OIJ A;  1PZK D;  1AEX A;  3IFD A;  4C1N I;  1CTM A;  1JR0 D;  1SE3 A;  5A35 A;  1S5D D;  4OO1 H;  2CW0 C;  4IUV A;  3A7L A;  5EKK A;  5IGG A;  1SJH D;  3T13 A;  2L55 A;  4ULL A;  2O5J C;  5I2Y A;  1ICW A;  3QG1 A;  3SHL A;  5KIX A;  3EQL C;  5JEA J;  3PO2 B;  1Q3L A;  2RKS A;  2CW0 D;  3HOV B;  3KBG A;  2EYO A;  1LTG D;  2PCF B;  3H94 A;  2XWB B;  2JA6 B;  2EY2 A;  1XYI A;  3WOF A;  1S5F D;  4G7O C;  1PXU A;  1M4V A;  2K1B A;  4QUC A;  1TS2 A;  5T1I A;  1SMY D;  2D2C C;  1BBX C;  1IW7 C;  2MGS A;  2IW3 A;  2NVX B;  4PNY A;  2O5I C;  4A93 B;  2JYO A;  3HOX B;  1EY0 A;  1OXS C;  2L9H A;  3VA5 A;  2F4I A;  1GUS A;  4EQO A;  5C3E B;  4OO1 I;  5J1Z A;  2OXP A;  5E1F A;  2KCC A;  2F0T A;  2EYJ A;  2ENB A;  3MC0 B;  3R2I A;  5CGK A;  1GJX A;  3K7A B;  3V96 A;  1D6E C;  1PRT D;  3GV6 A;  1I4Q A;  3E5S A;  3OIQ A;  3P20 A;  1STB A;  4H13 C;  1QWY A;  5AFW A;  2J7Z A;  1V43 A;  2MHV A;  2V4D A;  3UI2 A;  1DON A;  2NN6 G;  1PRT B;  2RA4 A;  4IQZ A;  4QIW B;  4PQX A;  3K5N A;  1DOK A;  1G29 1;  4K5V A;  1RHP A;  2IWH A;  3T56 B;  4ILW A;  1VMC A;  1F9S A;  3BDC A;  1II3 A;  3N52 A;  5BN3 A;  2HDL A;  2OF1 A;  4FF4 A;  1TWG B;  1I50 B;  5E3F A;  1Y1W B;  3NHH A;  1H9K A;  2RQX A;  4CJ2 C;  5C0X J;  4ZYS A;  2CHB D;  4IUN A;  1PTO B;  5CBE E;  5FLX L;  2R6G A;  3D6W A;  1S5C D;  4XYQ A;  2LKV A;  1PTO F;  3DWA A;  1EY9 A;  5M5W B;  1CT1 D;  5LL6 S;  1UNS A;  3M4O B;  2Q8T A;  4A3K B;  3S9W A;  2FFK B;  4CJ0 B;  2XIW A;  1H9J A;  3PUZ A;  3NWS A;  3OMG A;  1EWH A;  1CHP D;  1SYE A;  3J80 L;  2WV6 D;  1ZEQ X;  2EXZ A;  3S16 B;  2IX0 A;  2ICE C;  3VYR A;  2B2U A;  3NBH A;  4ODG A;  5D14 A;  2B39 A;  1LTB D;  1SEB D;  1H9S B;  3WOE A;  1I4P A;  1KAB A;  1M8A A;  3DUZ A;  3AMU A;  4TRD A;  1EEI D;  4MHE A;  5ELF A;  1O80 A;  3VA7 A;  3OWF A;  3ZYY X;  2RBM A;  1RJT A;  1X3P A;  5M9O A;  1GUO A;  1QJO A;  2CQA A;  3FVQ A;  1E2W A;  1OXT A;  5A2Q E;  1ENF A;  4A3J B;  4R8N A;  4R9W A;  1HUM A;  2RSN A;  3A8K E;  4XDX A;  2Q8I B;  1LTT D;  2N55 A;  3QO2 A;  4FF2 A;  1RDP D;  3J80 E;  4CBV A;  2F3V A;  1D5X C;  2A69 D;  2Z4H A;  4IUQ A;  2K5W A;  4X3K A;  1FR3 A;  4ZQ3 A;  2YYZ A;  4CKE A;  5JEA H;  1TT2 A;  4DXF A;  1GUN A;  3AB9 A;  4EGV A;  1F2M A;  1QNU A;  5BN5 A;  1PFN A;  4F88 A;  1MSH A;  5LHY 1;  2R7Z B;  1HPC A;  5KYI A;  5KEE A;  2BDO A;  1F9Q A;  1ENA A;  3AU7 A;  4G7Z C;  2NN6 I;  1SBB B;  3FKI B;  3TBI B;  5ELD A;  2O2L D;  4ZRZ A;  4C3H G;  1Y69 U;  4KD3 A;  3J81 E;  4IFD I;  1B1Z A;  1BR9 A;  4O1N A;  2X6L A;  5C0X I;  4IFD J;  4WOR A;  2FJ2 A;  4R8I A;  4CJ1 B;  2A5H A;  2BE5 D;  3A55 A;  3BS1 A;  1JCK B;  3HGB A;  4H0L C;  4AYB B;  2E2I B;  3OW7 A;  3NPP A;  5IGD A;  1UUP A;  2IX1 A;  1EYC A;  5J39 A;  3GQB A;  3VR5 A;  2E74 C;  3TSS A;  4LAA A;  1DM0 B;  3PO3 B;  1IKL A;  1SNQ A;  1AZQ A;  1TR5 A;  2XRS D;  3I73 A;  5DM6 3;  1R9T B;  5JPN C;  3HZX A;  1TS3 A;  3CRK C;  2OEO A;  4O42 A;  2SEB D;  5C4J B;  1KDC A;  2J4X A;  4QF4 A;  1ESF A;  1XX8 A;  1QG7 A;  3VYS A;  5EKL A;  5I9P A;  4DAV A;  2HUG A;  3GTO B;  2F1M A;  1U9R A;  4FF1 A;  4DN4 M;  1IYU A;  1JB3 A;  1XTC D;  1KLG D;  2B2V C;  1ONL A;  1ILP A;  1D1K A;  3A7A B;  2IL8 A;  2IPK D;  2CVR A;  4XQQ A;  1NAP A;  3Q6S A;  2HQE A;  2WIN B;  3JAM L;  4KJN A;  5J22 A;  5C44 B;  2N88 A;  3WDN A;  3NTK A;  4ZKB B;  1J8I A;  2JP1 A;  2R93 B;  1HRJ A;  3QWN A;  4DF7 A;  4EVO A;  4X3T A;  1KDA A;  3J7A V;  1NSN S;  1JC7 A;  1Y8P B;  4BWG B;  2A73 B;  3TZU A;  1BOS A;  4LK1 C;  4KKT A;  4NDX A;  1RF2 D;  4IUT A;  4H7B A;  3IAY A;  3J7A F;  2PZT A;  4G4K A;  1DOL A;  2PW7 A;  3ND8 A;  2KVM A;  5C3X A;  5CV9 A;  1HUN A;  1Q90 A;  4CHT B;  1WTP A;  3G6J B;  4K2L A;  3T51 B;  1LTR D;  5IGC A;  5C5L A;  1FNU A;  2FIN B;  1MD2 D;  4K2K A;  2G9H D;  3OMC A;  1TKW B;  1VF7 A;  1SYF A;  4F8M A;  5JVG 3;  3PIO 3;  4YIJ A;  2M2L A;  1C48 A;  5CMD A;  3LNN A;  1LAC A;  1ET6 A;  1PFM A;  1TS5 A;  1F9P A;  1PFB A;  4QB4 A;  4U67 3;  1JWM D;  3BVG A;  2ZXR A;  1B3A A;  1I6V C;  4DFA A;  2NBF A;  1W6K A;  4N9T A;  3GV3 A;  1A3V A;  3W2D A;  4HCS A;  3GD7 A;  2LFN A;  4A3G B;  3V2T A;  1WTW A;  2DY8 A;  3SDZ A;  2C9O A;  5KND A;  1WTQ A;  3D4D A;  1LO5 D;  4L8J A;  2Z1C A;  1B53 A;  2PW5 A;  3M7N A;  3MVV A;  1WTV A;  5CV5 A;  4M8A A;  5DNF A;  2SOB A;  3CHB D;  2PO4 A;  3SK8 A;  1RD9 D;  1F2Y A;  1B44 D;  5E4X A;  3NSW A;  2JXM B;  1V1P B;  3PUW A;  2M9V A;  3I8Z A;  2JSO A;  4HSV A;  1IW7 D;  1E2V A;  3SR1 A;  3MXU A;  5M3M B;  1BCP B;  2ZXO A;  4WJW A;  3HRZ C;  1TWA B;  2O4X A;  3BVM A;  4HR7 B;  5HUR A;  2WP8 J;  3TP5 A;  4XYO A;  2X6G A;  4L63 B;  2F0I A;  1I4H A;  1U4M A;  2H4O A;  5FO7 B;  4XTC S;  4OL7 A;  1JOK A;  2PZW A;  3DXJ C;  1F9R A;  2NB0 A;  3PUY A;  1W6J A;  3D8G A;  3GP7 A;  1XWE A;  4B9W A;  2JA7 B;  4BBS B;  2RDH A;  5FO9 B;  4RKB A;  1EY6 A;  2F0J A;  2K5Q A;  4RHR A;  1SYD A;  4IUR A;  3I70 A;  5T1G A;  3VR4 A;  3GTK B;  1PMR A;  1CHQ D;  3CU7 A;  4K5X A;  4QMG A;  4BBR B;  4TSS A;  1HFN A;  5JOB A;  1B9M A;  3NTI A;  2K5D A;  3A54 A;  4BY1 B;  3I3C A;  3L3O C;  3MFY A;  4HMJ A;  1NUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...