3PGZA

Crystal structure of a single strand binding protein (ssb) from bartonella henselae
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
109
Chain Sequence
AGSLNKVILIGNLGADPEIRRLNSGDQVANLRIATSESWRDRKERTEWHNIVIFNENLVKVVEQYLKKGSKIYIEGQLQTRKWQDQNGNDRYTTEIVLQKYRGELQMLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a single strand binding protein (SSB) from bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
total genus 21
structure length 109
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pgzA00
1FL0A 3FKIG 4DR2Q 2YTVA 2A1AA 1XNQQ 2KENA 3S17H 4R1JA 4DV1Q 3STBD 2CWAA 1HJPA 2LXJA 3ULLA 3T1HL 5LMUQ 1UWVA 4DR7L 3S1RH 3RLNA 3ICEA 4GS3A 4JBWA 1YEZA 3HKZE 4AYBG 1IXRA 1N36L 3J81j 1CKNB 2AWOA 3NENA 5M3MH 2PQAB 1N32L 4X64L 2VQEQ 2K4KA 2N3SA 2YU9H 5IP7G 1FJGL 5IYCG 2JE6I 3K7UC 1YI2A 1IBKQ 2UUCL 3PO2H 4O2DA 2JA7H 4B3RL 1TWGH 1VQIA 3KF6B 1WOCA 4A3JG 4B3MQ 2UXCQ 4P74A 1SLJA 4DV1L 1VQ7A 1PH4A 4X6AH 4AQYQ 4A3CH 3CC4A 4ME3A 4GOPB 4UP8A 2UUBL 1B70B 3CCQA 1EYGA 1JMCA 4DR4Q 4JYAL 4C3IH 4IPDA 4A3FG 4JI1L 4FDBA 4Y52H 2CQOA 3AEVA 1N32Q 1I6HH 1Q12A 1JJCB 4R4TA 3ULPA 2JA5G 1G6PA 2WB1E 1WCMG 2HHHQ 3PGZA 4IJLA 4YHHQ 4R4QA 2UXBQ 4LFAQ 1E22A 1KIXA 4LW1A 2K5VA 4UPAA 3CPWA 1VQBA 2QEXA 1EIYB 1P8LA 2PNHA 4JI7L 2KBNA 4JYAQ 3A74A 4HIMA 1VQEA 3BJUA 2VUMG 1PVOA 1B8AA 4DR4L 3PUWA 1GO3E 4KLKA 4QIWE 2K50A 2VQFL 1PH7A 5FLMH 1N34Q 2JA8H 1WJJA 3GTOH 1MJCA 1KC8C 3K7AH 4AH6A 1EFWA 1VQMA 1GM5A 1LTLA 2WAQE 3LGJA 2E2JH 1TWAH 4OXPA 1HZBA 1NMFA 3K80C 5C3EH 2PI2E 3M3YH 1A0IA 3PIOA 4YY3Q 1HNXQ 3A0JA 3UE1A 1JJ2A 1L2FA 5M3FG 4EX5A 2DUDA 2NZOA 1VQGA 1K3RA 4BY1G 4UY8C 2VQFQ 3AYHB 1KRTA 1N33Q 1YVCA 4JBKA 4DV7Q 2YYZA 4TVAB 3WWVA 1K73C 4DR5L 1QUQA 4JI4L 3S1MH 3UDGA 3VDYA 4LNQA 4HIDA 2IT1A 2ZTEA 3OW2A 1JJGA 4LF4L 2HQLA 3J7ZC 2A8VA 1A62A 3TS0A 5LMNQ 1X3FA 1M90C 3S2HH 2UU9L 2R7ZG 1CUKA 1LM0A 1VQOA 1XJVA 4JOIC 1KD1C 1VQPA 5JJLA 1Q81C 1HNWQ 4PZ7A 4RMFA 2ID0A 4POGA 4JG2A 1JB7A 2ZTDA 2DGYA 4A3FH 4DR7Q 3CCLA 4LF4Q 1YZ6A 4KHPL 3SGIA 4BY7H 3GTQH 1JT8A 2JK8A 4X62L 4JI2L 3H15A 3I4NG 1PH3A 3CW2C 3UDFA 1YHQA 3HFZB 1VQAA 2UUAL 2VL6A 3J81i 4A3CG 4K0KL 3DM3A 1PYSB 4OWXB 1FJGQ 1KL9A 2ATWA 1YBYA 2CCZA 3E9IA 4B3ML 4B3SL 1A8VA 1VQ4A 4X66Q 1XMQQ 1OXTA 4GOPA 2E5LQ 4L5RC 1VQ5A 2JA6G 1GD7A 2I5MX 4JI0Q 2R93H 5C0XI 4A75A 2NN6G 1VCIA 2B3GA 2OQKA 1IBML 4IFDG 2UUBQ 1HR0L 4JI1Q 1NBWA 4L5TA 3CF5A 3PF5A 3AQQA 2I0QA 3GTMH 4GKKL 3GTKH 1OXVA 1PH8A 1JE5A 1PFSA 2PQAA 3FHWA 4X66L 4JBJA 4XIGS 2E5LL 2E2HH 4YHHL 1SROA 2IHFA 3KYHC 1XPOA 4YCWA 4LWCA 3NEMA 5M3FH 1PH5A 3CC2A 4NXML 1IL2A 1VQ6A 2L15A 2UXBL 4YWKA 3ZJYC 1AE3A 1TWCH 3PIPA 4LFAL 4OO1G 1I3QH 2RHSB 3GDEA 3TREA 4DV2L 3J7A5 1TWHH 3I2ZA 4JV5Q 3EBEA 3M85A 4LF9Q 1TXYA 1OXXK 3CMAA 3S2DH 1XPRA 4GN4B 1HR0Q 1N34L 4BY1H 5C44G 5IYDG 1P16A 3Q8DA 2R92H 1G291 3U4VA 5FJ8H 1OXSC 1Y1VH 3H0GG 5E7NA 4QJFA 4IPGA 2Z0SA 4OWWB 1HZAA 4JI5L 2AKWB 4A3BG 3L7ZC 4A93G 1IYJB 4A3EH 2PI2A 4IPHA 2F4VQ 1HNXL 1X3EA 2R7ZH 1FVIA 3I4OA 4A3IH 1X54A 2D62A 4A3DG 5C4XG 3S14H 3RNUA 1UEBA 4YY3L 4LF9L 4PMWA 3KOJA 4GKJL 1PH1A 4DR5Q 1X56A 4JI4Q 4JI5Q 4LFBQ 2K14A 4DV7L 1AH9A 2E8GA 4YCUA 1BKBA 3FKIH 2AHOB 1RL2A 4C2MH 4JOIA 5IYDH 2BA1A 2JA6H 3BZKA 1FGUA 1X65A 2A19A 5FJ8G 5AJ3L 4LF5L 3GO5A 2V1CC 2MQHA 2UU9Q 2EQSA 4O0AA 4PZ6A 2B63G 2YV5A 2HIXA 2IY5B 3GD7A 1Q8KA 1PA6A 1L1OC 2OCEA 4BBRH 3PO2G 1C9OA 3RLFA 2HIVA 4GKJQ 2Q2HA 2ZTCA 4DR6L 1C7YA 4DV6L 4DUZQ 2ES2A 3STBC 5GAEC 2ZJQA 1Q1BA 2E2IH 1O7IA 1V43A 3RR5A 1I94Q 4L5SA 1V1QA 1XTDA 2RHQB 1CKMA 1HNZL 4LF8Q 3W1BA 2KHJA 1QZHA 4Y7NH 2ZM6Q 4B3TQ 2VUMH 4A4IA 2EXDA 2GVBA 4PG3A 1E1TA 1VQ8A 4B3SQ 4DR6Q 3CCVA 3K8AA 4IPCA 1XMQL 3GTGH 4DUZL 3PO3H 3KF6A 1UE5A 1PH2A 4JCVE 2BA0A 2R7FA 4A3LH 4HJAA 4B3TL 2R7DA 4EQ5A 1OTCA 3M4QA 1HNZQ 3W1GA 3HOYG 1E3PA 4QQBX 1G51A 2NVTH 5IWAQ 1NJIC 1IBKL 3M4OH 1T9HA 2K52A 1Z9FA 3BZCA 2XGTA 2WAQG 3HKSA 1KAWA 1XPUA 5C3EG 4GNXA 2LSSA 4P75A 4DK3C 3OYYA 3AFPA 2VW9A 4DV5L 2ALYB 2CWPA 4C3HH 3RN2A 1VQDA 2UXCL 3A5UA 3I4MH 3DLLA 2ZJPA 1D8LA 3MEFA 4DR1L 1SFOH 2WFWA 3TRZA 1Q82C 2PMZE 3M4PA 3NELA 1PYBA 4A3KG 4A3IG 3ERSX 2NN6I 1WI5A 4IFDI 5IYBG 1EQRA 3FP9A 4HJ9A 4ALPA 1QVCA 4DV5Q 4P72A 1QVFA 4OONA 1MJEA 2LXKA 4GN5A 4P71A 1PHJA 1IBLL 3CCMA 4JI7Q 2CFMA 1QZGA 1BVSA 1YJNA 2K5HA 1YJ9A 3HOZG 1VQ9A 3G4SA 2JJQA 2JA5H 4UP9A 4POFA 3U50C 2ZJRA 4LFBL 1RIPA 4R4OA 1VQKA 1HNWL 3HOXH 4LF7Q 5GADC 4JI3Q 3KLWA 1HH2P 3PO3G 1R9TH 4YCVA 4YWMA 1J6QA 4GLVB 3I56A 3G71A 3HOWG 4DV3L 4DR3Q 1Z47A 1K0RA 1XNRQ 3F1ZA 4A3KH 1EIFA 2JA8G 2OTLA 4X62Q 2BH2A 3M7NA 4QL5A 3HOVG 1KHIA 2Z6KA 4WJ4A 1KRSA 1U5KA 5M5XH 1S72A 1XMOQ 1N33L 1LYLA 3S15H 3F2CA 1TWFH 5ELOA 2BH8A 4DV6Q 5FLXc 2OWOA 2Q2UA 4DNIA 2R93G 1VS0A 4HJ7A 3PV0A 4JBMA 4YWLA 1HZ9A 1Y1WG 4QY7A 3F2BA 1WFQA 2NVYH 3UDIA 1SMXA 3KDFB 4A76A 3NBHB 1NY4A 1HR0W 1BBUA 4J15A 1MIUA 2AWNA 3T1HQ 3I4NH 5LMUL 1NMGA 3CPFA 5ELNA 3ULJA 3W5OA 2QA4A 3EN2A 4GNXC 1I50H 1VQNA 4GKKQ 5JJKA 4A3LG 5C44H 1VQLA 1CSPA 3I7FA 3HOUH 4IFDJ 3H3VH 4A3MG 2QGQA 4UP7A 4DV4Q 5IP7H 2VZAA 3E0EA 4MZ9A 3S16H 1X6OA 1CKNA 1E7ZA 1W3SA 1YHBA 3AFQA 2UUCQ 3KDFA 2YTYA 1MKHA 3GTJH 2FXQA 4DV2Q 4JV5L 1N8RC 1EWIA 3OTOQ 4NXNL 3CP0A 1X9NA 5C4XH 4GLXA 2UUAQ 4AIMA 1PH6A 4NB3A 3KJPA 1Q46A 4K0KQ 3S1NH 4DUYL 1E1OA 2I5LX 3EIVA 5IWAL 3F2DA 1W2BA 1YJWA 4BA2I 1UE6A 1BBWA 2VS1A 2JEAI 3HOXG 3CMEA 5H1SE 4DV4L 3T1YQ 4P73A 3OTOL 1IBMQ 1UE1A 4JI0L 2C35B 1X3GA 4DUYQ 5M5WH 3PF4A 5BR8L 5IP9G 2R92G 4IJHA 3HOZH 3MXNB 1ASYA 5IYCH 1SR3A 5IYBH 1LUZA 4DV0L 1AE2A 2GN5A 2UXDL 1YIJA 1PH9A 3K0XA 3A5ZB 2F52A 2I5HA 1IBLQ 1X55A 4HJ5A 4R4CA 3ER0A 1YNXA 1SRUA 5C0XJ 3CC7A 3JAMi 1Y1WH 4LFCQ 2GVAA 2WP8J 4MTNA 4NPSA 4AQYL 1VQCA 1M1KC 2KCMA 1GVPA 1DGSA 4BXXG 4DAYB 2OTJA 3H0GH 4TQUS 4JI3L 4LF7L 4A3BH 3KFUA 3GTPH 4A3MH 1J5EL 4A3EG 2N8NA 2HHHL 1YHAA 3L0OA 5GAGC 4GN3B 4H02A 1Q1EA 1XNRL 2IX1A 1XMOL 1L1OA 3CCEA 4LF8L 2CKZB 4DKAC 1N9WA 3U58A 3PCOB 2XTIA 2F3IA 5IP9H 5C0XG 4LF6Q 3UDXA 4OX9L 4XTCS 1EUJA 1NTGA 5IY0A 5HY6A 3HKZG 4AYBE 5K36G 2KHIA 3I55A 5FLMG 1VQFA 4JI8L 2ASBA 4DK6C 1UE7A 2JEBI 3RLOA 3F8TA 4GLAC 3S24A 1EQQA 1Y14B 4IO9A 2NZHA 3B6YA 3K81C 5AJ3Q 3JAMc 3CCUA 4LF5Q 2UXDQ 2OQ0A 1PV4A 4JI2Q 4OX9Q 4BBSH 2Q2IA 4KI0A 3PUYA 5IE8A 5M5YH 3RN5A 4LF6L 2JA9A 2JQOA 2KCTA 3I4MG 3CCRA 1D7QA 5JEAG 2H5XA 1SE8A 2IHEA 2MO1A 3CAMA 1I94L 4NXNQ 4BBRG 3PUXA 1L0WA 1ASZA 1HZCA 2VNUD 1OXUA 3CCSA 5JJIA 4DR1Q 1N36Q 4GNXB 2Q2TA 5GROA 3TQYA 1U0LA 4PZ8A 3UE0A 2VY3A 4A3GH 3HOYH 1VQHA 2HT1A 4NXMQ 2Y0SE 2R6GA 4WJ3M 1YITA 3TEHB 3T1YL 2NVXH 2RCNA 4BXXH 2YTXA 1H95A 4BBSG 4KHPQ 5M3MG 4DAMA 4B3RQ 4APVA 4L5QA 2RF4A 5LMNW 1QUQB 4HIOA 4OWTB 3RZDH 2B29A 2K5NA 5BR8Q 3PSIA 4BA1I 2NVQH 1QVGA 3J80c 4RG1A 4KHZA 4DV0Q 2MFIA 5DLQE 3S1QH 2Z6KC 4X65L 1SN8A 3CQZH 2F4VL 2D0OA 2Y0SG 5GQOA 4LFCL 4JC0A 5C4JH 1NE3A 1L1OB 1B7YB 4JI6L 4BY7G 4R4IA 4HIKA 4LUVA 4LUZA 4OO1I 3PUZA 3IRBA 4A3JH 4X65Q 1Q86C 1J5EQ 2AMCB 3JC66 1S40A 3H3VI 3BU2A 2MO0A 3TS2A 4DPGA 3PUVA 2IX0A 1V9PA 1E24A 3CCJA 4IOCA 3L2PA 3E9HA 5IT9c 3G48A 5EAYA 1K8GA 2JA7G 2N78A 2WB1G 3RZOH 3J80i 1A63A 3CXCA 4JI6Q 1KQSA 3M9BA 5JEAJ 1WYDA 1Q7YC 3HOVH 4A3DH 3D31A 1K83H 5J3BA 4C3JH 5GAHC 4QGUA 4DR2L 4A93H 4MNOA 1XNQL 4HJ8A 1CSQA 3CD6A 1VQJA 3HOWH 4IOAA 1IZ6A 1S3OA 5HGQA 4A3GG 4JI8Q 4LUOA 1CKOA 1Y1VG 1I5FA 2MNAA 1WCMH 2N49A 4DV3Q 2K75A 4DR3L 3J81c 2B63H 2D0PA 5LMNL 1KXLA 1EOVA 3D0FA 3U4ZA 3KJOA 3G6EA 4GOPC 2EIFA 3HOUG 1K9MC 1K8AC 3KF8B 4X64Q 1GKHA 2VQEL 1C0AA 3GTLH 2ZM6L
chains in the Genus database with same CATH superfamily
1SMYD 2F0GA 1XNQQ 2KENA 3S17H 5EKIA 4DK1A 2JA7B 1KTKA 3S1RH 4GS3A 1JOKA 2H4OA 3MXGA 3HKZE 4DU9A 3C3LA 1AZQA 1N36L 2PMZB 4A3GB 5IGEA 2K4KA 1H9RA 5IP7G 3K7UC 5D3DA 3PO2H 2JA7H 4B3RL 3D8GA 5EGTA 4DV1L 4G7OC 3L9AX 1G6ZA 1PXUA 4AQYQ 3CC4A 1JE4A 2KQ3A 1D5XC 2E2HB 4RGTA 4IPDA 4A3FG 4A3EB 2MUYA 5LHY1 1N32Q 4C3JG 1HPCA 1WVLA 1E22A 1SYCA 1EIYB 2QEXA 2PNHA 4JYAQ 3A74A 2K01A 1VQEA 2P5ZX 2F0JA 3BJUA 3MTSA 1PVOA 4OL7A 1DCZA 1RHPA 4QIWE 2K50A 5FLMH 1N34Q 3GTJB 2JA8H 4RWSC 3K7AH 1NAPA 4BS9A 4QUFA 2G5DA 2MGSA 1LTLA 3LGJA 1TWAH 5K36H 3QWNA 1HZBA 1NMFA 5C3EH 2PI2E 2TMPA 3PIOA 4WRDA 2EYJA 3UE1A 3PO2B 3HEJA 2DUDA 1HTLD 4UY8C 1N33Q 2VQFQ 2Z9HA 3AYHB 4TVAB 2FINB 4JI4L 1V1PA 1UNSA 2ZTEA 4U68A 1JJGA 1PRTF 1B3AA 5C5MA 3VYUA 3TS0A 1M90C 1X3PA 1VQPA 4PZ7A 4FF2A 1GHJA 4A3FH 4ZKBB 3CCLA 1QNKA 3SGIA 2F0MA 1Y1VB 2JK8A 4X62L 1IKLA 4JI2L 4HSPA 1LT3D 1EWHA 1YHQA 2UUAL 1B44D 1EEID 5EBCA 1PYSB 4Y7NB 1FJGQ 1KL9A 1YBYA 1SAPA 3D6WA 3G6JB 3QOJA 4B3ML 3KLRA 2E5LQ 2O5IC 4EQOA 2R93H 2R93B 2OQKA 2B3GA 2EYHA 1HR0L 4L5TA 3PF5A 3CF5A 2I0QA 4GKKL 1VF5C 1CQFA 1OXVA 3BVGA 3H94A 1CZWA 4XIGS 1SROA 2IHFA 5FO7B 4YCWA 4DXFA 3NEMA 5CC4A 2FJ2A 3CC2A 1VQ6A 1TWCB 2L15A 5M3MB 1I6VC 1AE3A 1TWCH 3PIPA 2RHSB 3GDEA 3J7A5 3P1HA 5CBAE 1KDAA 5BN5A 3VR5A 4GN4B 3NWTA 4M8AA 1HA5A 1P16A 1G291 5ISRA 1OXSC 3H0GG 1PZKD 1M4VA 2Z0SA 1HZAA 2A6EC 3A8KE 2ZXPA 5JJZA 2PI2A 4A3EH 2F4VQ 2DY8A 2Z8LA 3S2DB 4A3DG 4R8NA 4A3IH 2D62A 3RNUA 4LF9L 2K32A 2A6ED 2SNSA 1PH1A 4DR5Q 1X56A 4LFBQ 1AH9A 2E8GA 1BKBA 2IWHA 3SVMA 3FKIH 4J8QA 4C56C 5IYDH 2BA1A 4ZK9B 4XYOA 2JA6H 5FJ8G 2A19A 3TSSA 4O0AA 2YV5A 1Q8KA 2OCEA 2L1BA 1WTRA 4K8IA 2Q2HA 4DR6L 3TMEA 2SNMA 3ND9A 2ZJQA 2RSOA 5GAEC 3SE0A 2JN4A 1O7IA 4N8X1 1NNXA 1V1QA 1ET9A 1CKMA 1HNZL 3W1BA 4B3TQ 2ZM6Q 4C3HB 2NN6H 1VMCA 1E1TA 1B50A 1YNNC 2JSOA 4B3SQ 2OXPA 3K8AA 4IPCA 1DJRD 1J8IA 2PQEA 2B39A 4A3LH 4HJAA 4B3TL 1STBA 5HURA 2F0OA 1HNZQ 2K6AA 3OIPA 2NZ1D 4KJNA 1IBKL 3M7GA 1T9HA 2XGTA 4KD3A 4QMGA 4DK3C 4DV5L 4B08A 2CWPA 1HUMA 3E5SA 1H9MA 3A5UA 1U4LA 3Q0AA 3HKZB 5DM63 2PMZE 3NELA 4A3KG 2RA4A 2NN6I 5IYBG 2CQAA 4P72A 1RTNA 3HOVB 1B2TA 2LXKA 3TP8A 1ESFA 1PHJA 3A8JE 3NWSA 2A73B 3CCMA 1NCVA 2K5HA 2F0EA 2JA5H 4POFA 2J4XA 1HNWL 3PO3G 1R9TH 2AQ2B 3D6CA 2WV6D 4LJZC 3LNNA 3HOYB 1ICFB 1K0RA 1XNRQ 3F1ZA 1EIFA 1I4HA 2RQXA 1HRJA 1SE2A 2BH2A 1FNUA 2F3WA 2Z6KA 4GZYC 1XMOQ 1PFNA 5ELOA 2OWOA 2Q2UA 1IW7C 2B2WA 4HJ7A 4XYQA 4C3HG 1HZ9A 2X69A 4MIUA 3P7JA 1SMXA 3UDIA 4A76A 3NBHB 1Y8OB 1MIUA 5LMUL 5ELNA 3W5OA 4GKKQ 3OW7A 3NTKA 1VQLA 1ZXTA 3H3VH 1DOLA 1G2SA 3ND8A 1X6OA 4X3UA 1YHBA 1MKHA 3GTJH 2JA8B 3S2HB 4KMUC 4NXNL 3I4MB 3GP7A 4GLXA 5EJWA 5CYUA 2M9VA 1PH6A 3S1NH 3IAYA 1E1OA 3EIVA 3UI2A 3BVZA 3FPUB 1EFID 2VS1A 2JEAI 4RAUC 5EPKA 1ENCA 2EY6A 2B2TC 1TU2B 3M3YB 1X3GA 5C6AA 2RKSA 5IP9G 3MXNB 5D14A 5IYBH 5C3WA 5FLXL 4O1NA 1YIJA 1PH9A 3K0XA 1LTAD 2BE5D 2F0NA 2B8FA 1YNXA 2WP8J 4KK7A 1DGSA 5G3LD 3R8BA 5LL6X 1QJOA 4FXKC 1K3BC 3GTPH 1J5EL 1BDOA 3DHQA 3L0OA 4PMCA 1LTSD 2KECA 2CKZB 1S5CD 4WJWA 3K57A 1STEA 3NK9A 3QR8A 5C0XG 2K04A 4CBVA 5E4XA 5HY6A 3HKZG 2B8GA 1SNQA 3QB3A 1EY5A 2NZHA 3BVMA 1H9SB 3K81C 2AUJD 3CCUA 2OQ0A 1PV4A 4JI2Q 3VR3A 1LT6D 1BCPC 5JPMC 1HUNA 5IE8A 2JA9A 2JQOA 2PO4A 4CJ2C 3A8IE 4EGVA 2H5XA 3VA5A 2MO1A 1ASZA 2F0IA 3SK5A 1HZCA 2BDNA 3CCSA 4A3BB 1N36Q 4GNXB 4S3SA 2QILA 2ICIA 5L37A 1U0LA 3PMFA 5M5WB 3LX0A 3Q6SA 1A3VA 1PZID 1K28A 1VQHA 2HT1A 2E74C 3TEHB 2NVXH 2RCNA 1EY7A 3Q22A 4BBSG 5M3MG 4APVA 1XTCD 4NW2A 2C5CA 2B29A 3CRKC 1NR4A 4H13C 3J80c 4RG1A 2NVQB 2MFIA 5DLQE 4JK1C 2Z6KC 4RGNA 3CQZH 1PZJD 1LTBD 2D0OA 1TWHB 1L1OB 1NE3A 2XIWA 1R4PB 4JI6L 2F0TA 2DNEA 2L55A 2GA4B 1E0BA 5IGFA 1S40A 3MXPA 4PMBA 3G48A 5JVG3 5JEAJ 3J80L 1IYUA 1K83H 5GAHC 1I50B 4OEMB 1BUVT 4MNOA 1VQJA 3IFDA 4IOAA 1S3OA 4ZCKA 5KRUA 1PTOC 5DM73 5HGQA 3HOWB 1HFNA 1Y1VG 1I5FA 4TRDA 3M4OB 1WCMH 1KXLA 2F0DA 2MJ8A 3HOXB 3D0FA 2HDMA 3T13A 1GKHA 1C0AA 2F0HA 2YTVA 2A1AA 1C4QA 1PDQA 3STBD 1EEFD 1EYCA 3ULLA 3K59A 1LTGD 3NXWA 3K6OA 5T1IA 4AYBG 1IXRA 1OO9B 1FYCA 3J81j 4HSVA 1JORA 3NENA 1JOQA 3SR1A 1SNDA 1N32L 2N3SA 3OPOA 1FJGL 3EROA 3KLSA 2JE6I 1YI2A 5KNDA 1G2TA 5CV7A 4B3MQ 1F2ZA 1WOCA 4L8JA 4A93B 3K5MA 1VQ7A 4X6AH 4ME3A 4GOPB 4KY6A 4UP8A 1B70B 3CCQA 1EYGA 4DR4Q 4JYAL 2IL8A 2CQOA 2VB2X 5I2XA 3NBIA 1I6HH 2JA5G 1JJCB 1I3QB 3C1FA 2HHHQ 3PGZA 2UXBQ 3CPWA 5JOBA 1A15A 1P8LA 4HIMA 3VYSA 2VUMG 5C4HA 2CHBD 1STNA 1PH7A 3GTOH 1KC8C 1CHQD 1GM5A 3IKJA 4OELB 2E2JH 2QF7A 3NP8A 3RMHA 2KVMA 2LY7A 4YY3Q 1GUTA 1FD7D 2NWGA 1WD1A 1JJ2A 4J1MA 2Z4IA 4EX5A 3K7AB 1KNAA 2A6HD 4BY1G 1PRTC 1KRTA 2KEDA 4DV7Q 2PZTA 4JBKA 2YYZA 1K73C 3UDGA 3VDYA 4LNQA 3A7AB 3I73A 1TY2A 1A62A 2CH4W 5LMNQ 3S2HH 2R7ZG 1LT5D 4JOIC 1KD1C 1IL8A 4G4KA 4EQPA 1JB7A 3GTKB 2DGYA 2KCNA 3SXHA 3KLSX 3H0GB 3T16A 3GTQH 2B2TA 3I4NG 3CW2C 3UDFA 3OOCA 1D5ZC 1A3TA 3J81i 2XWBB 4RGMA 4A3CG 4OWXB 5DAUA 3VYRA 1XMQQ 3K5OA 3X3NA 2JA6G 2F0UA 1PMRA 3QJYA 1GD7A 4ZLTF 1GUNA 3EQLC 2DJFC 1BCPB 2NN6G 3MC0B 2HD3A 4C3JB 5J22A 3AMUA 1A6XA 3AQQA 4KY7A 5CV9A 1G8ZD 4H0LC 3FKIB 4Q0FA 4JBJA 2E2HH 3SK4A 3KYHC 2UXDQ 3W3AA 4LWCA 5M3FH 4YWKA 3L3OC 3GTPB 3ZJYC 4IUUA 4BBSB 1TWHH 3I2ZA 3EBEA 1OXXK 2V4DA 1EIHA 1XPRA 4BY1H 2XNAC 1DOMA 5C44G 5IYDG 4DXGA 3Q8DA 4NKLA 5FJ8H 5KNBA 4DAYA 5JAVA 1STGA 4QJFA 4A3DB 4IPGA 4JI5L 1T5XD 4IUTA 1EL0A 1HNXL 1X3EA 2R7ZH 1FVIA 3I4OA 3S14H 5KNCA 1DYQA 1AN8A 1PYWD 4PMWA 4RHRA 4RKLA 4JI5Q 4DV7L 4YCUA 3N52A 4YIJA 1ENFA 4C2MB 1F2YA 2AHOB 3OHXC 1DONA 4JOIA 1F9SA 1EOTA 2F03A 1FGUA 4NMZA 3S15B 2F0QA 1SNOA 2IY5B 1PA6A 1C9OA 3RLFA 4GKJQ 5IGGA 2ZTCA 5ELFA 1C7YA 1A2UA 2F0LA 4DUZQ 2ES2A 3K58A 4E6IA 3H09A 1Q1BA 4L5SA 3RR5A 1U4PA 1LTID 1XTDA 4RCNA 2KHJA 4Y7NH 3DWQA 1B53A 1O7LA 3VR4A 4A4IA 1BXTA 4IFDH 4V0BA 2X6GA 1QOHA 2L9HA 4CKEA 5KYIA 4IZ8A 3CCVA 1E2VA 1QB5D 1S5DD 4DUZL 1XMQL 1SJED 3GTGH 3GTGB 1GHKA 3NBHA 3I8ZA 5DNFA 3HOYG 3W1GA 4QQBX 1D6EC 2NUCA 5IWAQ 2EJMA 2K52A 3HKSA 3T53B 1KAWA 5A35A 4P75A 2VW9A 3AFPA 2AQ1B 2ALYB 2UXCL 3NTHA 2F0WA 5COYA 3MEFA 4DR1L 5IODA 3TRZA 3SEBA 1Q82C 5KGUA 1EZ8A 4G7HC 3FMCA 1QVCA 2IW3A 1XX8A 4GN5A 1CI3M 4P71A 1LTTD 1YJNA 4KHVA 4UP9A 2RCFA 3PO3B 4LFBL 4R4OA 5GADC 1GOZA 3KLWA 1HH2P 1R9TB 4YCVA 1K8OA 4YWMA 3G71A 4DV3L 1II3A 5CBEE 4DA2A 1MSHA 1AFPA 4WJ4A 1KHIA 2WKCA 1S72A 1DD2A 1TWFB 1ZKOA 1TWFH 2Q8IB 5M9OA 2BH8A 5FLXc 1SFOB 1KDBA 4DNIA 3PV0A 3U9OA 4IUNA 3F2BA 1WFQA 3KDFB 5LL6S 1HR0W 2ZXRA 1KLGD 2AWNA 1S4ZA 3ULJA 1VQNA 1I50H 4RCOA 4UHVA 1YNJC 1TQOA 3I7FA 2K1BA 1SEBD 1EY4A 2O4XA 5I9PA 3S9WA 4A3MG 4DV4Q 2KA7A 4O42A 5IP7H 2VZAA 4MZ9A 3S16H 2PPBC 3GTOB 4M1UB 1N8RC 3CP0A 1HQMC 1XYIA 3MA2B 2EY5A 2UUAQ 4KKUA 4KN4C 4NB3A 1GUGA 3KJPA 1Q46A 1HXYD 2I5LX 2L11A 3F2DA 1YJWA 1DOKA 5H1SE 2E76C 5I4DA 3MFGA 2N55A 1Y69U 1YNND 1UE1A 5C3EB 4DUYQ 3ITPA 1SYDA 4KKTA 2KJXA 2R92G 4IJHA 3HOZH 1ASYA 3LWEA 5IYCH 1I6HB 2R3ZA 2XWJB 1AE2A 1MD2D 2WIIB 1IBLQ 2I5HA 1X55A 4HJ5A 3ER0A 3HOUB 1U4RA 2JYOA 1GUWA 2A68C 1S5ED 2SDFA 4MTNA 4K6DA 1AEXA 5KEEA 1TS3A 3MVVA 5CR3A 2J0TD 1GVPA 4FYDA 4DAYB 3H0GH 3GTQB 4OIKA 4HR7B 4A3BH 3R93A 4A3MH 2HHHL 2N88A 5FK9C 5GAGC 2NVYB 3A7LA 1L1OA 3CCEA 4LF8L 3NSWA 4HCEA 4QUCA 5IP9H 1SMYC 4FNFA 3UDXA 4OX9L 3VYTA 1EUJA 1PFMA 2KHIA 2QW7A 4FXGC 3I55A 5FLMG 1VQFA 2ASBA 1UE7A 3RLOA 4AYBB 1EY8A 5AJ3Q 3JAMc 4G57A 3K5NA 4OX9Q 1D5MC 4H44C 1ZYRC 2Q2IA 3S17B 4IUQA 4RKBA 2KCTA 1EU3A 4FVMA 3CCRA 3I4MG 5JEAG 1I94L 1SE8A 1ENAA 2IHEA 1ZYRD 3QO2A 1L0WA 4BBRG 3MWYW 5JJIA 2Q2TA 5GROA 3TQYA 1NUCA 3MZ5A 3HOYH 1TWGB 2Y0SE 2R6GA 2RDFA 3NUCA 4WJ3M 4B9WA 4BXXH 2YU9B 3OMCA 4B3RQ 3JAML 2WB1B 2RF4A 1AP0A 4RA8A 4RFBA 2K5NA 2OT2A 4QCLA 1Z6HA 2DNCA 1RDPD 1UAPA 3HGBA 4WFN3 1SNCA 3GV3A 2NB0A 1BQQT 3CKIB 1B7YB 1LLRD 4R4IA 2E2DC 4HIKA 2NVTB 1WCMB 5EQ0A 1JB3A 3X3MA 4OO1I 4KJOA 4KV6A 4X65Q 1Q86C 1J5EQ 3JC66 4OGQC 5D65A 3BU2A 4F8MA 3TS2A 2EJFC 1F9PA 1V9PA 1E24A 3HOZB 2A69C 3E9HA 5IT9c 1F77A 5EAYA 4UDUC 1A63A 1KQSA 3M9BA 3HOVH 4A3DH 2PZWA 5IGDA 2F4IA 4DR2L 3GTLB 1CSQA 4XDXA 1TS4A 1IZ6A 3EA6A 4A3GG 1C8CA 1IW7D 4LUOA 4K14A 2KCCA 3QG1A 4JI8Q 2N49A 2VB3X 4DV3Q 3BDOA 1S5FD 4HTHA 2EIFA 4BBRB 1O7YA 3HOUG 1K9MC 3KF8B 2CW0D 4LK1C 4Q5VA 4ID6A 1FL0A 3SDZA 1CK1A 4ZYSA 2R92B 4A3KB 4R1JA 3D4WA 5J39A 4DV1Q 1EYDA 1HJPA 2LXJA 3T1HL 4DR7L 4IALA 5JVH3 3RLNA 2F0KA 4JBWA 1YEZA 5NUCA 4PV1C 4ZAIA 1UEAB 4K8JA 2AWOA 4X64L 2VQEQ 1WTWA 2FFKB 2RBMA 5IYCG 1IBKQ 2F3VA 4O2DA 3I4NB 1VQIA 5FLXE 2Z1CA 1Q90A 2UXCQ 1QILA 5KIXA 2SOBA 5EBDA 2PW5A 1L0XB 2UUBL 4CGYB 1JMCA 2JA5B 4C3IH 4JI1L 3AEVA 4R4TA 3BS1A 1WCMG 4IJLA 4R4QA 4LFAQ 4C1NK 3TDQA 2K5VA 4UPAA 1VQBA 2KBNA 4K5VA 1ILQA 4DAVA 3J80E 1GO3E 2TSSA 4KLKA 3H6MA 1EFWA 1GJXA 4QIWB 2WAQE 1MSGA 1R4QB 2XRQD 1EY0A 2NTSA 4OXPA 5E4WC 1A0IA 1HNXQ 3A0JA 1WTHA 1CQVA 2QKIC 5M3FG 1CA5A 1RJTA 2NZOA 1VQGA 1K3RA 1M8AA 1PRTD 4DR5L 2D2CC 4FF4A 1HTPA 4HIDA 3C2PA 4K6LA 2EYFA 4LF4L 1U4MA 3J7ZC 3IL8A 3I91A 4CDDC 1CZGA 1CUKA 1FNVA 1VQOA 4N8FA 1Q81C 3S1NB 2ID0A 2ICEC 3I70A 4DR7Q 1SYGA 4FP5D 1STYA 4LF4Q 3TN2A 1JC7A 1B4OA 4KHPL 3MXUA 1JT8A 4XT1B 3H15A 1RCVD 3DUZA 3HFZB 1VQAA 4KY5A 2EYLA 3KF8A 4QF4A 4K0KL 3DM3A 3VR6A 3M4YA 2CCZA 4B3SL 2EYOA 1A8VA 1VQ4A 1O80A 4BY7B 1S5BD 4GOPA 1H9SA 1LT4D 4H7BA 4L5RC 2I5MX 1F9RA 4JI0Q 2B2YA 5C0XI 4A75A 4MTKA 1SSOA 1VCIA 4IFDG 1K83B 2UUBQ 4JI1Q 1NBWA 3GTMH 4A3FB 1PH8A 1JE5A 1PFSA 2J7ZA 2E5LL 1B9MA 1IL2A 4NXML 3Q23A 2KOLA 4LFAL 3KBXA 4ZRZA 2HDLA 4DV2L 4JV5Q 4LF9Q 1TXYA 1WTQA 1CA6A 1HR0Q 1JWUD 1V8QA 1EQVA 4OWWB 2AKWB 1SDFA 5CMDA 1JOOA 1X54A 5C4XG 3RZDB 3KOJA 4ABNA 4GKJL 1TT2A 4JI4Q 1RTOA 3C1EA 1RL2A 4C2MH 3BZKA 5C4JB 2EZVA 2EPBA 1X65A 3R2IA 4LF5L 5FKAC 1BO0A 2QCPX 2B63G 1O78A 2HIXA 4BBRH 3U9SA 2F0FA 2ZT9C 2HIVA 4A3MB 3H91A 4DV6L 2H1EA 1V43A 1I94Q 1TS5A 2K5DA 2RHQB 2KUMA 1Y1WB 3R3OA 1HFGA 2FMCA 4RHSA 1SJHD 1EY6A 3NPPA 4DR6Q 4HN7A 2G9HD 1TVXA 1WTVA 3GV6A 3KF6A 4F7XA 4JCVE 2BA0A 2R7FA 2PCFB 3CQZB 2A5HA 5EKKA 4DNTB 1OTCA 3M4QA 5FO9B 1A2TA 3NQIA 1E3PA 2EJGC 2NVTH 1NJIC 4X3SA 1ILPA 3BZCA 2WAQG 4GNXA 3DWPA 2LSSA 1GXDC 2ZXOA 3S1RB 4C3HH 3RN2A 1VQDA 3NQTA 5C4XB 1D8LA 1SFOH 1W6KA 3M4PA 1PYBA 4A3IG 3ERSX 4FF1A 4HMJA 1WI5A 5IGCA 1LTRD 4DV5Q 3I72A 5I6YA 3J7YW 1QVFA 4ULLA 1IBLL 4JI7Q 2CFMA 3HOZG 1VQ9A 3G4SA 3N6RA 4XQJA 1RKNA 4TKOB 4QB4A 1ML0D 2PZUA 3HOXH 4L63B 3NTIA 3OWFA 2AQ3B 5BN3A 3HOWG 1Z47A 4A3KH 2L4NA 2OTLA 4X62Q 2IX3A 3D3RA 3M7NA 4QL5A 3HOVG 5M5XH 1G91A 4K5XA 4C1NI 4R8IA 4DV6Q 2R93G 2CH4A 4NP5A 4ME5A 4JBMA 4RH6A 4QY7A 3FVQA 4MN3A 1BBUA 2Q8RE 3KK7A 3CRLC 4BY7H 1X3QA 4A3LG 5C44H 5A2QL 4TSSA 2XSCA 1CSPA 1YNJD 3MXNA 3OSOA 2KHSA 5FOBB 5TSSA 2QGQA 4UP7A 4CDCC 3E0EA 1CKNA 1MHWC 1W3SA 5E1FA 1U9RA 2YTYA 1Q8IA 2FXQA 2L5TA 5K5PA 3MFYA 3DM1A 4CJ0B 4DUYL 5IWAL 1W2BA 4BA2I 1BBWA 3C46A 3HOXG 3CMEA 3T1YQ 4P73A 2WACA 4ZUJA 2EY2A 2DJGC 1IBMQ 4HMIA 3A54A 3URYA 2K5QA 5JPNC 4CDEC 3V2TA 5M5WH 2SEBD 2E2JB 2CVRA 4C3IG 1SR3A 1LUZA 4P2CB 3A5ZB 2F52A 5F2DA 4R4CA 5C0XJ 1F9QA 1SRUA 2K33A 4R9WA 3JAMi 3CC7A 4LFCQ 4AQYL 1VQCA 2B2WC 2A68D 3I90A 2KCMA 1BR9A 5CGKA 4BXXG 2M00A 4LAAA 4TQUS 4EVOA 3P20A 4A3EG 2HCCA 3RUZA 1YHAA 4GN3B 2WINB 4KD4A 1Q1EA 4ODGA 1XNRL 3U58A 3AB9A 3PCOB 2XTIA 5JEAH 2IJ0A 4IURA 4XTCS 1NTGA 1LACA 2VUMB 4DK6C 2JEBI 4L6TB 3S24A 3F8TA 4GLAC 5EKLA 2NVXB 3MHBA 2E75C 1Y14B 1EQQA 1A3UA 4LF5Q 3BZDB 4BBSH 1SE4A 5M5YH 1B1ZA 5IGBA 1NSNS 2VXWA 5M5YB 1CHPD 1D7QA 3E3XA 4XT3B 4NXNQ 3PUXA 1I4QA 5A2QE 2DN8A 4DR1Q 1O7ZA 4IUVA 4DF7A 1PLFA 2XN9C 1EWCA 4PZ8A 3UE0A 2WKDA 4A3GH 4DN4M 3NHHA 4NXMQ 2Z6BA 1FGBD 2F0VA 1CM9A 4I65A 1TR5A 1QNUA 2O5JC 1H95A 1IYVA 1PFBA 1X32A 3D4DA 4DAMA 1KABA 2OF1A 2FHTA 4L5QA 5LMNW 5IT9L 1MI2A 1BCPF 2L0CA 3RZDH 5BR8Q 1HQRD 2JP1A 4BA1I 2PW7A 1QVGA 5IOCA 4X65L 4CKBA 5CV6A 2B2UA 2Y0SG 1SXTA 3TZDA 5GQOA 4EQNA 4LFCL 2I46A 4HAEA 4JC0A 5C3XA 5C4JH 2PNRC 1JCKB 2WAQB 2EYMA 4LUZA 4LUVA 4DFAA 4A3JH 2AMCB 5I9OA 4K2KA 2BE5C 2MO0A 1WTOA 1E2ZA 4JW0A 3T51B 3IFTA 2IX0A 3CCJA 1SE3A 1V1OA 2JA7G 2N78A 2WB1G 3RZOH 3E6ZX 3J80i 3CXCA 3DEOA 3S1QB 1RODA 1B9NA 5M5XB 3R2TA 3D31A 5J3BA 4QGUA 4XQNA 3T56B 4A93H 3CD6A 1XNQL 1PTOB 3EVQA 1EQTA 3TP5A 2EYPA 2L12A 3A56A 5AFWA 4MHEA 2K75A 2B63H 3J81c 4CHTB 1EOVA 3U4ZA 2O2LD 3VR2A 1STAA 4CDFC 2QEJC 3SHLA 2RSNA 2JXMB 3TP7A 1K8AC 2K28A 3GTLH 2ZM6L 3FKIG 4OIJA 2G9DA 1I4XA 4DR2Q 3PIP3 2CWAA 1TKWB 5LMUQ 1UWVA 3ICEA 4LMQD 3DXJC 5IT9E 1TS2A 5G3LF 1CKNB 5M3MH 2PQAB 1LO5D 3FRPB 2YU9H 2EVBA 1SNPA 4G7ZC 3ERQA 2UUCL 1PTOF 1TWGH 4A3JG 3KF6B 2F0SA 1TIID 4I7AA 4P74A 1SLJA 1ICWA 3TZUA 1PH4A 1Z7TA 4A3CH 2MHVA 2Y0SB 2LS01 1BOSA 2B2YC 4FDBA 4DK0A 3I4LA 4Y52H 5ELDA 1RD9D 4F87A 1Q12A 3ULPA 1G6PA 2WB1E 4PNYA 4YHHQ 3VA7A 3Q24A 4DGZA 1KIXA 4LW1A 1ET6A 1D2BA 3DWAA 4JI7L 2E2IB 1EZ6A 1B8AA 4DR4L 1KLUD 3A55A 3PUWA 3MAQA 2VQFL 2Z4HA 1WJJA 3WOEA 1MJCA 4AH6A 1VQMA 3OIQA 3K80C 3M3YH 3TBIB 2X6LA 1H9JA 1L2FA 4JVZA 3SK6A 1EIGA 1Q3LA 1YVCA 3WDNA 1F2MA 3WWVA 3S1MH 2MP1A 1QUQA 3P75A 2KEEA 2IT1A 3OW2A 1BCPD 1BNZA 2DY7A 2HQLA 2HCIA 3W2DA 2A8VA 1X3FA 3DMUA 2UU9L 1LM0A 1XJVA 4I7ZC 5M3FB 5JJLA 2XVSA 1HNWQ 4B9XA 2QDBA 4RMFA 1NR2A 4POGA 4JG2A 2ZTDA 1Y8NB 1YZ6A 2D9UA 2K7VA 3MEHA 1D1IA 1DM0B 2EY1A 1EY9A 1PH3A 2VL6A 1C48A 2ATWA 2EXZA 3E9IA 4X66Q 1OXTA 2CW0C 1VQ5A 3RZOB 3WOFA 1IBML 5CV5A 5J1ZA 3GTKH 2PQAA 3FHWA 1VDZA 3OMGA 4X66L 3S16B 1H9KA 4C3IB 4YHHL 4XXEA 1EYAA 1XPOA 1MBYA 2Q8TA 1PH5A 2UXBL 1VMPA 2PYKA 4CKCA 4OO1G 1E2WA 1WTPA 1I3QH 3TREA 2FMMA 4N9PA 3M85A 3CMAA 3S2DH 1EU4A 1K8MA 1N34L 2R92H 3BDCA 3U4VA 2B2UC 1Y1VH 5E7NA 3K5LA 1HCZA 4A3BG 2NTTA 3L7ZC 4A93G 1IYJB 4IPHA 2I07B 1UEBA 4YY3L 5KYLA 5CV4A 2C9OA 2EDGA 2K14A 1HHVA 3OWEB 5AJ3L 3GO5A 2V1CC 2MQHA 1B3QA 2UU9Q 2EQSA 4PZ6A 2RDHA 3GD7A 3PO2G 1L1OC 2LFNA 4FXDA 2D5DA 2IPKD 3V05A 4HEDA 3STBC 3PIO3 2E2IH 1Y8PB 1J9OA 1ZEQX 4K2LA 1JICA 3FEWX 4LF8Q 3HZXA 1QZHA 1D1KA 2LKVA 2VUMH 2OEOA 1XWEA 2EXDA 2GVBA 4PG3A 3G7LA 1VQ8A 3CHBD 1STHA 3PO3H 1PH2A 1UE5A 1SYBA 4UAIA 5DEHA 2R7DA 4EQ5A 3F2UA 2JA6B 3J81E 1QCBD 1G51A 3GQBA 3M4OH 2NBFA 1Z9FA 2BDOA 5C3EG 1XPUA 4F88A 3OYYA 1K0SA 3O13A 4WORA 2EOTA 3I4MH 3DLLA 2ZJPA 1TWAB 2HUGA 1JQYD 2LMCB 2WFWA 3BYTB 4IFDI 4ALPA 1EQRA 3FP9A 4HJ9A 1I4RA 2XRSD 3AU7A 4OONA 1MJEA 2R7ZB 5C44B 3K0YA 1IKMA 3QOLA 1QZGA 1BVSA 2R61A 1YJ9A 2AUKA 2A6HC 2JJQA 3U50C 2ZJRA 1RIPA 4OHJA 3V96A 5CORA 1VQKA 4LF7Q 4JI3Q 4JPBW 1IHZA 1KDCA 3I56A 1J6QA 4GLVB 4DR3Q 4FO2A 5C5LA 2JA8G 5E3FA 4ZUIA 1JWMD 1KRSA 1U5KA 2K5WA 4KTAA 1N33L 1LYLA 3S15H 3CU7A 3F2CA 4N9TA 1ESRA 4K5WA 5C0XH 1VS0A 5BN4A 4CJ1B 2NYZD 4YWLA 1Y1WG 5ELEA 2NVYH 5IIFA 1UUPA 1NY4A 4J15A 3T1HQ 4ZKCB 1KAAA 3I4NH 1NMGA 3CPFA 3LWUA 4GNXC 2QA4A 3EN2A 5JJKA 3EJIA 3T4AC 5EPJA 1WTXA 3HOUH 4IFDJ 1DXMA 3HP3A 1PRTB 3PQIA 1E7ZA 3AFQA 1BBXC 2UUCQ 3KDFA 3JAME 4DV2Q 4JV5L 1XXGA 1EWIA 3OTOQ 1X9NA 5C4XH 4AIMA 3BDLA 4K0KQ 1KNEA 1UE6A 3ZYYX 3ONAB 5D3IB 4DV4L 4IQZA 1BF4A 3OTOL 1JR0D 2F1MA 1TY0A 4JI0L 2C35B 4X3TA 3FDTA 3BG3A 4ILWA 1F2LA 3PF4A 5BR8L 1V1PB 1FR3A 1SYEA 1SNMA 4DV0L 4A3IB 2GN5A 4J6HA 2UXDL 2ENBA 5EPLA 1DZ1A 3J7AV 3KBGA 4ZQ3A 1Y1WH 2GVAA 4NPSA 1M1KC 1L0YB 4XQQA 2OTJA 4JI3L 4LF7L 1AW7A 1LV9A 3KFUA 2RVLA 2N8NA 1MGSA 5ELBA 2A74C 1W6JA 4H02A 4Z9CB 2BCOA 2IX1A 1XMOL 4DKAC 1N9WA 4HCSA 1CT1D 1ONLA 2F3IA 1WD0A 5C4ZA 4LF6Q 2BOSA 4IUPA 5IY0A 4NDXA 3H3VC 4AYBE 5K36G 4JI8L 4FF3A 4IO9A 3B6YA 4PQXA 1FNWA 3D4RA 1I4PA 1CTMA 1T5EA 2MPMA 3HRZC 4KI0A 3PUYA 3S1MB 1SBBB 3GTMB 2K03A 3RN5A 4LF6L 4KKSA 3TP6A 1SYFA 3KUPA 5I2YA 3J7AF 3CAMA 3NE5B 1VF7A 2VNUD 1OXUA 4U673 1GUOA 3EFXD 3HS0C 2EE1A 3FPPA 2VY3A 4V190 4BY1B 1YITA 3T1YL 4BWGB 2YTXA 5HGTA 4KHPQ 4DNRB 3BYYB 1QUQB 3RD4A 3QIAA 1AZPA 4HIOA 4OWTB 1JWSD 3PSIA 3HG9A 3S14B 2NVQH 4KHZA 4DV0Q 3S1QH 2B63B 1SN8A 3SK8A 2F0PA 1LABA 2F4VL 4KN7C 4DAPA 3DEPA 1QE6A 5I6WA 5FO8B 4OO1H 1GUSA 2B2VC 4BY7G 3J81L 4RGOS 3PUZA 3IRBA 3H3VI 2M2LA 4DPGA 1HA6A 2A69D 3PUVA 3E0JA 2RDGA 5ELCA 3L2PA 4IOCA 1I4GA 4X3KA 1K8GA 1RF2D 4A3JB 4JI6Q 1WYDA 1Q7YC 1PTOD 4C3JH 4HJ8A 3HOWH 2QDLA 1QG7A 2K05A 1PTOH 2B2VA 1CKOA 3I3CA 2MNAA 1QWYA 5T1GA 4DR3L 2D0PA 5LMNL 2HQEA 3KJOA 3G6EA 4GOPC 1CFMA 5CV8A 4X64Q 4IN3A 2VQEL
chains in the Genus database with same CATH topology
1FL0A 3FKIG 4DR2Q 2YTVA 2A1AA 1XNQQ 2KENA 3S17H 4R1JA 4DV1Q 3STBD 2CWAA 1HJPA 2LXJA 3ULLA 3T1HL 5LMUQ 1UWVA 4DR7L 3S1RH 3RLNA 3ICEA 4GS3A 4JBWA 1YEZA 3HKZE 4AYBG 1IXRA 1N36L 3J81j 1CKNB 2AWOA 3NENA 5M3MH 2PQAB 1N32L 4X64L 2VQEQ 2K4KA 2N3SA 2YU9H 5IP7G 1FJGL 5IYCG 2JE6I 3K7UC 1YI2A 1IBKQ 2UUCL 3PO2H 4O2DA 2JA7H 4B3RL 1TWGH 1VQIA 3KF6B 1WOCA 4A3JG 4B3MQ 2UXCQ 4P74A 1SLJA 4DV1L 1VQ7A 1PH4A 4X6AH 4AQYQ 4A3CH 3CC4A 4ME3A 4GOPB 4UP8A 2UUBL 1B70B 3CCQA 1EYGA 1JMCA 4DR4Q 4JYAL 4C3IH 4IPDA 4A3FG 4JI1L 4FDBA 4Y52H 2CQOA 3AEVA 1N32Q 1I6HH 1Q12A 1JJCB 4R4TA 3ULPA 2JA5G 1G6PA 2WB1E 1WCMG 2HHHQ 3PGZA 4IJLA 4YHHQ 4R4QA 2UXBQ 4LFAQ 1E22A 1KIXA 4LW1A 2K5VA 4UPAA 3CPWA 1VQBA 2QEXA 1EIYB 1P8LA 2PNHA 4JI7L 2KBNA 4JYAQ 3A74A 4HIMA 1VQEA 3BJUA 2VUMG 1PVOA 1B8AA 4DR4L 3PUWA 1GO3E 4KLKA 4QIWE 2K50A 2VQFL 1PH7A 5FLMH 1N34Q 2JA8H 1WJJA 3GTOH 1MJCA 1KC8C 3K7AH 4AH6A 1EFWA 1VQMA 1GM5A 1LTLA 2WAQE 3LGJA 2E2JH 1TWAH 4OXPA 1HZBA 1NMFA 3K80C 5C3EH 2PI2E 3M3YH 1A0IA 3PIOA 4YY3Q 1HNXQ 3A0JA 3UE1A 1JJ2A 1L2FA 5M3FG 4EX5A 2DUDA 2NZOA 1VQGA 1K3RA 4BY1G 4UY8C 2VQFQ 3AYHB 1KRTA 1N33Q 1YVCA 4JBKA 4DV7Q 2YYZA 4TVAB 3WWVA 1K73C 4DR5L 1QUQA 4JI4L 3S1MH 3UDGA 3VDYA 4LNQA 4HIDA 2IT1A 2ZTEA 3OW2A 1JJGA 4LF4L 2HQLA 3J7ZC 2A8VA 1A62A 3TS0A 5LMNQ 1X3FA 1M90C 3S2HH 2UU9L 2R7ZG 1CUKA 1LM0A 1VQOA 1XJVA 4JOIC 1KD1C 1VQPA 5JJLA 1Q81C 1HNWQ 4PZ7A 4RMFA 2ID0A 4POGA 4JG2A 1JB7A 2ZTDA 2DGYA 4A3FH 4DR7Q 3CCLA 4LF4Q 1YZ6A 4KHPL 3SGIA 4BY7H 3GTQH 1JT8A 2JK8A 4X62L 4JI2L 3H15A 3I4NG 1PH3A 3CW2C 3UDFA 1YHQA 3HFZB 1VQAA 2UUAL 2VL6A 3J81i 4A3CG 4K0KL 3DM3A 1PYSB 4OWXB 1FJGQ 1KL9A 2ATWA 1YBYA 2CCZA 3E9IA 4B3ML 4B3SL 1A8VA 1VQ4A 4X66Q 1XMQQ 1OXTA 4GOPA 2E5LQ 4L5RC 1VQ5A 2JA6G 1GD7A 2I5MX 4JI0Q 2R93H 5C0XI 4A75A 2NN6G 1VCIA 2B3GA 2OQKA 1IBML 4IFDG 2UUBQ 1HR0L 4JI1Q 1NBWA 4L5TA 3CF5A 3PF5A 3AQQA 2I0QA 3GTMH 4GKKL 3GTKH 1OXVA 1PH8A 1JE5A 1PFSA 2PQAA 3FHWA 4X66L 4JBJA 4XIGS 2E5LL 2E2HH 4YHHL 1SROA 2IHFA 3KYHC 1XPOA 4YCWA 4LWCA 3NEMA 5M3FH 1PH5A 3CC2A 4NXML 1IL2A 1VQ6A 2L15A 2UXBL 4YWKA 3ZJYC 1AE3A 1TWCH 3PIPA 4LFAL 4OO1G 1I3QH 2RHSB 3GDEA 3TREA 4DV2L 3J7A5 1TWHH 3I2ZA 4JV5Q 3EBEA 3M85A 4LF9Q 1TXYA 1OXXK 3CMAA 3S2DH 1XPRA 4GN4B 1HR0Q 1N34L 4BY1H 5C44G 5IYDG 1P16A 3Q8DA 2R92H 1G291 3U4VA 5FJ8H 1OXSC 1Y1VH 3H0GG 5E7NA 4QJFA 4IPGA 2Z0SA 4OWWB 1HZAA 4JI5L 2AKWB 4A3BG 3L7ZC 4A93G 1IYJB 4A3EH 2PI2A 4IPHA 2F4VQ 1HNXL 1X3EA 2R7ZH 1FVIA 3I4OA 4A3IH 1X54A 2D62A 4A3DG 5C4XG 3S14H 3RNUA 1UEBA 4YY3L 4LF9L 4PMWA 3KOJA 4GKJL 1PH1A 4DR5Q 1X56A 4JI4Q 4JI5Q 4LFBQ 2K14A 4DV7L 1AH9A 2E8GA 4YCUA 1BKBA 3FKIH 2AHOB 1RL2A 4C2MH 4JOIA 5IYDH 2BA1A 2JA6H 3BZKA 1FGUA 1X65A 2A19A 5FJ8G 5AJ3L 4LF5L 3GO5A 2V1CC 2MQHA 2UU9Q 2EQSA 4O0AA 4PZ6A 2B63G 2YV5A 2HIXA 2IY5B 3GD7A 1Q8KA 1PA6A 1L1OC 2OCEA 4BBRH 3PO2G 1C9OA 3RLFA 2HIVA 4GKJQ 2Q2HA 2ZTCA 4DR6L 1C7YA 4DV6L 4DUZQ 2ES2A 3STBC 5GAEC 2ZJQA 1Q1BA 2E2IH 1O7IA 1V43A 3RR5A 1I94Q 4L5SA 1V1QA 1XTDA 2RHQB 1CKMA 1HNZL 4LF8Q 3W1BA 2KHJA 1QZHA 4Y7NH 2ZM6Q 4B3TQ 2VUMH 4A4IA 2EXDA 2GVBA 4PG3A 1E1TA 1VQ8A 4B3SQ 4DR6Q 3CCVA 3K8AA 4IPCA 1XMQL 3GTGH 4DUZL 3PO3H 3KF6A 1UE5A 1PH2A 4JCVE 2BA0A 2R7FA 4A3LH 4HJAA 4B3TL 2R7DA 4EQ5A 1OTCA 3M4QA 1HNZQ 3W1GA 3HOYG 1E3PA 4QQBX 1G51A 2NVTH 5IWAQ 1NJIC 1IBKL 3M4OH 1T9HA 2K52A 1Z9FA 3BZCA 2XGTA 2WAQG 3HKSA 1KAWA 1XPUA 5C3EG 4GNXA 2LSSA 4P75A 4DK3C 3OYYA 3AFPA 2VW9A 4DV5L 2ALYB 2CWPA 4C3HH 3RN2A 1VQDA 2UXCL 3A5UA 3I4MH 3DLLA 2ZJPA 1D8LA 3MEFA 4DR1L 1SFOH 2WFWA 3TRZA 1Q82C 2PMZE 3M4PA 3NELA 1PYBA 4A3KG 4A3IG 3ERSX 2NN6I 1WI5A 4IFDI 5IYBG 1EQRA 3FP9A 4HJ9A 4ALPA 1QVCA 4DV5Q 4P72A 1QVFA 4OONA 1MJEA 2LXKA 4GN5A 4P71A 1PHJA 1IBLL 3CCMA 4JI7Q 2CFMA 1QZGA 1BVSA 1YJNA 2K5HA 1YJ9A 3HOZG 1VQ9A 3G4SA 2JJQA 2JA5H 4UP9A 4POFA 3U50C 2ZJRA 4LFBL 1RIPA 4R4OA 1VQKA 1HNWL 3HOXH 4LF7Q 5GADC 4JI3Q 3KLWA 1HH2P 3PO3G 1R9TH 4YCVA 4YWMA 1J6QA 4GLVB 3I56A 3G71A 3HOWG 4DV3L 4DR3Q 1Z47A 1K0RA 1XNRQ 3F1ZA 4A3KH 1EIFA 2JA8G 2OTLA 4X62Q 2BH2A 3M7NA 4QL5A 3HOVG 1KHIA 2Z6KA 4WJ4A 1KRSA 1U5KA 5M5XH 1S72A 1XMOQ 1N33L 1LYLA 3S15H 3F2CA 1TWFH 5ELOA 2BH8A 4DV6Q 5FLXc 2OWOA 2Q2UA 4DNIA 2R93G 1VS0A 4HJ7A 3PV0A 4JBMA 4YWLA 1HZ9A 1Y1WG 4QY7A 3F2BA 1WFQA 2NVYH 3UDIA 1SMXA 3KDFB 4A76A 3NBHB 1NY4A 1HR0W 1BBUA 4J15A 1MIUA 2AWNA 3T1HQ 3I4NH 5LMUL 1NMGA 3CPFA 5ELNA 3ULJA 3W5OA 2QA4A 3EN2A 4GNXC 1I50H 1VQNA 4GKKQ 5JJKA 4A3LG 5C44H 1VQLA 1CSPA 3I7FA 3HOUH 4IFDJ 3H3VH 4A3MG 2QGQA 4UP7A 4DV4Q 5IP7H 2VZAA 3E0EA 4MZ9A 3S16H 1X6OA 1CKNA 1E7ZA 1W3SA 1YHBA 3AFQA 2UUCQ 3KDFA 2YTYA 1MKHA 3GTJH 2FXQA 4DV2Q 4JV5L 1N8RC 1EWIA 3OTOQ 4NXNL 3CP0A 1X9NA 5C4XH 4GLXA 2UUAQ 4AIMA 1PH6A 4NB3A 3KJPA 1Q46A 4K0KQ 3S1NH 4DUYL 1E1OA 2I5LX 3EIVA 5IWAL 3F2DA 1W2BA 1YJWA 4BA2I 1UE6A 1BBWA 2VS1A 2JEAI 3HOXG 3CMEA 5H1SE 4DV4L 3T1YQ 4P73A 3OTOL 1IBMQ 1UE1A 4JI0L 2C35B 1X3GA 4DUYQ 5M5WH 3PF4A 5BR8L 5IP9G 2R92G 4IJHA 3HOZH 3MXNB 1ASYA 5IYCH 1SR3A 5IYBH 1LUZA 4DV0L 1AE2A 2GN5A 2UXDL 1YIJA 1PH9A 3K0XA 3A5ZB 2F52A 2I5HA 1IBLQ 1X55A 4HJ5A 4R4CA 3ER0A 1YNXA 1SRUA 5C0XJ 3CC7A 3JAMi 1Y1WH 4LFCQ 2GVAA 2WP8J 4MTNA 4NPSA 4AQYL 1VQCA 1M1KC 2KCMA 1GVPA 1DGSA 4BXXG 4DAYB 2OTJA 3H0GH 4TQUS 4JI3L 4LF7L 4A3BH 3KFUA 3GTPH 4A3MH 1J5EL 4A3EG 2N8NA 2HHHL 1YHAA 3L0OA 5GAGC 4GN3B 4H02A 1Q1EA 1XNRL 2IX1A 1XMOL 1L1OA 3CCEA 4LF8L 2CKZB 4DKAC 1N9WA 3U58A 3PCOB 2XTIA 2F3IA 5IP9H 5C0XG 4LF6Q 3UDXA 4OX9L 4XTCS 1EUJA 1NTGA 5IY0A 5HY6A 3HKZG 4AYBE 5K36G 2KHIA 3I55A 5FLMG 1VQFA 4JI8L 2ASBA 4DK6C 1UE7A 2JEBI 3RLOA 3F8TA 4GLAC 3S24A 1EQQA 1Y14B 4IO9A 2NZHA 3B6YA 3K81C 5AJ3Q 3JAMc 3CCUA 4LF5Q 2UXDQ 2OQ0A 1PV4A 4JI2Q 4OX9Q 4BBSH 2Q2IA 4KI0A 3PUYA 5IE8A 5M5YH 3RN5A 4LF6L 2JA9A 2JQOA 2KCTA 3I4MG 3CCRA 1D7QA 5JEAG 2H5XA 1SE8A 2IHEA 2MO1A 3CAMA 1I94L 4NXNQ 4BBRG 3PUXA 1L0WA 1ASZA 1HZCA 2VNUD 1OXUA 3CCSA 5JJIA 4DR1Q 1N36Q 4GNXB 2Q2TA 5GROA 3TQYA 1U0LA 4PZ8A 3UE0A 2VY3A 4A3GH 3HOYH 1VQHA 2HT1A 4NXMQ 2Y0SE 2R6GA 4WJ3M 1YITA 3TEHB 3T1YL 2NVXH 2RCNA 4BXXH 2YTXA 1H95A 4BBSG 4KHPQ 5M3MG 4DAMA 4B3RQ 4APVA 4L5QA 2RF4A 5LMNW 1QUQB 4HIOA 4OWTB 3RZDH 2B29A 2K5NA 5BR8Q 3PSIA 4BA1I 2NVQH 1QVGA 3J80c 4RG1A 4KHZA 4DV0Q 2MFIA 5DLQE 3S1QH 2Z6KC 4X65L 1SN8A 3CQZH 2F4VL 2D0OA 2Y0SG 5GQOA 4LFCL 4JC0A 5C4JH 1NE3A 1L1OB 1B7YB 4JI6L 4BY7G 4R4IA 4HIKA 4LUVA 4LUZA 4OO1I 3PUZA 3IRBA 4A3JH 4X65Q 1Q86C 1J5EQ 2AMCB 3JC66 1S40A 3H3VI 3BU2A 2MO0A 3TS2A 4DPGA 3PUVA 2IX0A 1V9PA 1E24A 3CCJA 4IOCA 3L2PA 3E9HA 5IT9c 3G48A 5EAYA 1K8GA 2JA7G 2N78A 2WB1G 3RZOH 3J80i 1A63A 3CXCA 4JI6Q 1KQSA 3M9BA 5JEAJ 1WYDA 1Q7YC 3HOVH 4A3DH 3D31A 1K83H 5J3BA 4C3JH 5GAHC 4QGUA 4DR2L 4A93H 4MNOA 1XNQL 4HJ8A 1CSQA 3CD6A 1VQJA 3HOWH 4IOAA 1IZ6A 1S3OA 5HGQA 4A3GG 4JI8Q 4LUOA 1CKOA 1Y1VG 1I5FA 2MNAA 1WCMH 2N49A 4DV3Q 2K75A 4DR3L 3J81c 2B63H 2D0PA 5LMNL 1KXLA 1EOVA 3D0FA 3U4ZA 3KJOA 3G6EA 4GOPC 2EIFA 3HOUG 1K9MC 1K8AC 3KF8B 4X64Q 1GKHA 2VQEL 1C0AA 3GTLH 2ZM6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FL0 A;  3FKI G;  4DR2 Q;  2YTV A;  2A1A A;  1XNQ Q;  2KEN A;  3S17 H;  4R1J A;  4DV1 Q;  3STB D;  2CWA A;  1HJP A;  2LXJ A;  3ULL A;  3T1H L;  5LMU Q;  1UWV A;  4DR7 L;  3S1R H;  3RLN A;  3ICE A;  4GS3 A;  4JBW A;  1YEZ A;  3HKZ E;  4AYB G;  1IXR A;  1N36 L;  3J81 j;  1CKN B;  2AWO A;  3NEN A;  5M3M H;  2PQA B;  1N32 L;  4X64 L;  2VQE Q;  2K4K A;  2N3S A;  2YU9 H;  5IP7 G;  1FJG L;  5IYC G;  2JE6 I;  3K7U C;  1YI2 A;  1IBK Q;  2UUC L;  3PO2 H;  4O2D A;  2JA7 H;  4B3R L;  1TWG H;  1VQI A;  3KF6 B;  1WOC A;  4A3J G;  4B3M Q;  2UXC Q;  4P74 A;  1SLJ A;  4DV1 L;  1VQ7 A;  1PH4 A;  4X6A H;  4AQY Q;  4A3C H;  3CC4 A;  4ME3 A;  4GOP B;  4UP8 A;  2UUB L;  1B70 B;  3CCQ A;  1EYG A;  1JMC A;  4DR4 Q;  4JYA L;  4C3I H;  4IPD A;  4A3F G;  4JI1 L;  4FDB A;  4Y52 H;  2CQO A;  3AEV A;  1N32 Q;  1I6H H;  1Q12 A;  1JJC B;  4R4T A;  3ULP A;  2JA5 G;  1G6P A;  2WB1 E;  1WCM G;  2HHH Q;  3PGZ A;  4IJL A;  4YHH Q;  4R4Q A;  2UXB Q;  4LFA Q;  1E22 A;  1KIX A;  4LW1 A;  2K5V A;  4UPA A;  3CPW A;  1VQB A;  2QEX A;  1EIY B;  1P8L A;  2PNH A;  4JI7 L;  2KBN A;  4JYA Q;  3A74 A;  4HIM A;  1VQE A;  3BJU A;  2VUM G;  1PVO A;  1B8A A;  4DR4 L;  3PUW A;  1GO3 E;  4KLK A;  4QIW E;  2K50 A;  2VQF L;  1PH7 A;  5FLM H;  1N34 Q;  2JA8 H;  1WJJ A;  3GTO H;  1MJC A;  1KC8 C;  3K7A H;  4AH6 A;  1EFW A;  1VQM A;  1GM5 A;  1LTL A;  2WAQ E;  3LGJ A;  2E2J H;  1TWA H;  4OXP A;  1HZB A;  1NMF A;  3K80 C;  5C3E H;  2PI2 E;  3M3Y H;  1A0I A;  3PIO A;  4YY3 Q;  1HNX Q;  3A0J A;  3UE1 A;  1JJ2 A;  1L2F A;  5M3F G;  4EX5 A;  2DUD A;  2NZO A;  1VQG A;  1K3R A;  4BY1 G;  4UY8 C;  2VQF Q;  3AYH B;  1KRT A;  1N33 Q;  1YVC A;  4JBK A;  4DV7 Q;  2YYZ A;  4TVA B;  3WWV A;  1K73 C;  4DR5 L;  1QUQ A;  4JI4 L;  3S1M H;  3UDG A;  3VDY A;  4LNQ A;  4HID A;  2IT1 A;  2ZTE A;  3OW2 A;  1JJG A;  4LF4 L;  2HQL A;  3J7Z C;  2A8V A;  1A62 A;  3TS0 A;  5LMN Q;  1X3F A;  1M90 C;  3S2H H;  2UU9 L;  2R7Z G;  1CUK A;  1LM0 A;  1VQO A;  1XJV A;  4JOI C;  1KD1 C;  1VQP A;  5JJL A;  1Q81 C;  1HNW Q;  4PZ7 A;  4RMF A;  2ID0 A;  4POG A;  4JG2 A;  1JB7 A;  2ZTD A;  2DGY A;  4A3F H;  4DR7 Q;  3CCL A;  4LF4 Q;  1YZ6 A;  4KHP L;  3SGI A;  4BY7 H;  3GTQ H;  1JT8 A;  2JK8 A;  4X62 L;  4JI2 L;  3H15 A;  3I4N G;  1PH3 A;  3CW2 C;  3UDF A;  1YHQ A;  3HFZ B;  1VQA A;  2UUA L;  2VL6 A;  3J81 i;  4A3C G;  4K0K L;  3DM3 A;  1PYS B;  4OWX B;  1FJG Q;  1KL9 A;  2ATW A;  1YBY A;  2CCZ A;  3E9I A;  4B3M L;  4B3S L;  1A8V A;  1VQ4 A;  4X66 Q;  1XMQ Q;  1OXT A;  4GOP A;  2E5L Q;  4L5R C;  1VQ5 A;  2JA6 G;  1GD7 A;  2I5M X;  4JI0 Q;  2R93 H;  5C0X I;  4A75 A;  2NN6 G;  1VCI A;  2B3G A;  2OQK A;  1IBM L;  4IFD G;  2UUB Q;  1HR0 L;  4JI1 Q;  1NBW A;  4L5T A;  3CF5 A;  3PF5 A;  3AQQ A;  2I0Q A;  3GTM H;  4GKK L;  3GTK H;  1OXV A;  1PH8 A;  1JE5 A;  1PFS A;  2PQA A;  3FHW A;  4X66 L;  4JBJ A;  4XIG S;  2E5L L;  2E2H H;  4YHH L;  1SRO A;  2IHF A;  3KYH C;  1XPO A;  4YCW A;  4LWC A;  3NEM A;  5M3F H;  1PH5 A;  3CC2 A;  4NXM L;  1IL2 A;  1VQ6 A;  2L15 A;  2UXB L;  4YWK A;  3ZJY C;  1AE3 A;  1TWC H;  3PIP A;  4LFA L;  4OO1 G;  1I3Q H;  2RHS B;  3GDE A;  3TRE A;  4DV2 L;  3J7A 5;  1TWH H;  3I2Z A;  4JV5 Q;  3EBE A;  3M85 A;  4LF9 Q;  1TXY A;  1OXX K;  3CMA A;  3S2D H;  1XPR A;  4GN4 B;  1HR0 Q;  1N34 L;  4BY1 H;  5C44 G;  5IYD G;  1P16 A;  3Q8D A;  2R92 H;  1G29 1;  3U4V A;  5FJ8 H;  1OXS C;  1Y1V H;  3H0G G;  5E7N A;  4QJF A;  4IPG A;  2Z0S A;  4OWW B;  1HZA A;  4JI5 L;  2AKW B;  4A3B G;  3L7Z C;  4A93 G;  1IYJ B;  4A3E H;  2PI2 A;  4IPH A;  2F4V Q;  1HNX L;  1X3E A;  2R7Z H;  1FVI A;  3I4O A;  4A3I H;  1X54 A;  2D62 A;  4A3D G;  5C4X G;  3S14 H;  3RNU A;  1UEB A;  4YY3 L;  4LF9 L;  4PMW A;  3KOJ A;  4GKJ L;  1PH1 A;  4DR5 Q;  1X56 A;  4JI4 Q;  4JI5 Q;  4LFB Q;  2K14 A;  4DV7 L;  1AH9 A;  2E8G A;  4YCU A;  1BKB A;  3FKI H;  2AHO B;  1RL2 A;  4C2M H;  4JOI A;  5IYD H;  2BA1 A;  2JA6 H;  3BZK A;  1FGU A;  1X65 A;  2A19 A;  5FJ8 G;  5AJ3 L;  4LF5 L;  3GO5 A;  2V1C C;  2MQH A;  2UU9 Q;  2EQS A;  4O0A A;  4PZ6 A;  2B63 G;  2YV5 A;  2HIX A;  2IY5 B;  3GD7 A;  1Q8K A;  1PA6 A;  1L1O C;  2OCE A;  4BBR H;  3PO2 G;  1C9O A;  3RLF A;  2HIV A;  4GKJ Q;  2Q2H A;  2ZTC A;  4DR6 L;  1C7Y A;  4DV6 L;  4DUZ Q;  2ES2 A;  3STB C;  5GAE C;  2ZJQ A;  1Q1B A;  2E2I H;  1O7I A;  1V43 A;  3RR5 A;  1I94 Q;  4L5S A;  1V1Q A;  1XTD A;  2RHQ B;  1CKM A;  1HNZ L;  4LF8 Q;  3W1B A;  2KHJ A;  1QZH A;  4Y7N H;  2ZM6 Q;  4B3T Q;  2VUM H;  4A4I A;  2EXD A;  2GVB A;  4PG3 A;  1E1T A;  1VQ8 A;  4B3S Q;  4DR6 Q;  3CCV A;  3K8A A;  4IPC A;  1XMQ L;  3GTG H;  4DUZ L;  3PO3 H;  3KF6 A;  1UE5 A;  1PH2 A;  4JCV E;  2BA0 A;  2R7F A;  4A3L H;  4HJA A;  4B3T L;  2R7D A;  4EQ5 A;  1OTC A;  3M4Q A;  1HNZ Q;  3W1G A;  3HOY G;  1E3P A;  4QQB X;  1G51 A;  2NVT H;  5IWA Q;  1NJI C;  1IBK L;  3M4O H;  1T9H A;  2K52 A;  1Z9F A;  3BZC A;  2XGT A;  2WAQ G;  3HKS A;  1KAW A;  1XPU A;  5C3E G;  4GNX A;  2LSS A;  4P75 A;  4DK3 C;  3OYY A;  3AFP A;  2VW9 A;  4DV5 L;  2ALY B;  2CWP A;  4C3H H;  3RN2 A;  1VQD A;  2UXC L;  3A5U A;  3I4M H;  3DLL A;  2ZJP A;  1D8L A;  3MEF A;  4DR1 L;  1SFO H;  2WFW A;  3TRZ A;  1Q82 C;  2PMZ E;  3M4P A;  3NEL A;  1PYB A;  4A3K G;  4A3I G;  3ERS X;  2NN6 I;  1WI5 A;  4IFD I;  5IYB G;  1EQR A;  3FP9 A;  4HJ9 A;  4ALP A;  1QVC A;  4DV5 Q;  4P72 A;  1QVF A;  4OON A;  1MJE A;  2LXK A;  4GN5 A;  4P71 A;  1PHJ A;  1IBL L;  3CCM A;  4JI7 Q;  2CFM A;  1QZG A;  1BVS A;  1YJN A;  2K5H A;  1YJ9 A;  3HOZ G;  1VQ9 A;  3G4S A;  2JJQ A;  2JA5 H;  4UP9 A;  4POF A;  3U50 C;  2ZJR A;  4LFB L;  1RIP A;  4R4O A;  1VQK A;  1HNW L;  3HOX H;  4LF7 Q;  5GAD C;  4JI3 Q;  3KLW A;  1HH2 P;  3PO3 G;  1R9T H;  4YCV A;  4YWM A;  1J6Q A;  4GLV B;  3I56 A;  3G71 A;  3HOW G;  4DV3 L;  4DR3 Q;  1Z47 A;  1K0R A;  1XNR Q;  3F1Z A;  4A3K H;  1EIF A;  2JA8 G;  2OTL A;  4X62 Q;  2BH2 A;  3M7N A;  4QL5 A;  3HOV G;  1KHI A;  2Z6K A;  4WJ4 A;  1KRS A;  1U5K A;  5M5X H;  1S72 A;  1XMO Q;  1N33 L;  1LYL A;  3S15 H;  3F2C A;  1TWF H;  5ELO A;  2BH8 A;  4DV6 Q;  5FLX c;  2OWO A;  2Q2U A;  4DNI A;  2R93 G;  1VS0 A;  4HJ7 A;  3PV0 A;  4JBM A;  4YWL A;  1HZ9 A;  1Y1W G;  4QY7 A;  3F2B A;  1WFQ A;  2NVY H;  3UDI A;  1SMX A;  3KDF B;  4A76 A;  3NBH B;  1NY4 A;  1HR0 W;  1BBU A;  4J15 A;  1MIU A;  2AWN A;  3T1H Q;  3I4N H;  5LMU L;  1NMG A;  3CPF A;  5ELN A;  3ULJ A;  3W5O A;  2QA4 A;  3EN2 A;  4GNX C;  1I50 H;  1VQN A;  4GKK Q;  5JJK A;  4A3L G;  5C44 H;  1VQL A;  1CSP A;  3I7F A;  3HOU H;  4IFD J;  3H3V H;  4A3M G;  2QGQ A;  4UP7 A;  4DV4 Q;  5IP7 H;  2VZA A;  3E0E A;  4MZ9 A;  3S16 H;  1X6O A;  1CKN A;  1E7Z A;  1W3S A;  1YHB A;  3AFQ A;  2UUC Q;  3KDF A;  2YTY A;  1MKH A;  3GTJ H;  2FXQ A;  4DV2 Q;  4JV5 L;  1N8R C;  1EWI A;  3OTO Q;  4NXN L;  3CP0 A;  1X9N A;  5C4X H;  4GLX A;  2UUA Q;  4AIM A;  1PH6 A;  4NB3 A;  3KJP A;  1Q46 A;  4K0K Q;  3S1N H;  4DUY L;  1E1O A;  2I5L X;  3EIV A;  5IWA L;  3F2D A;  1W2B A;  1YJW A;  4BA2 I;  1UE6 A;  1BBW A;  2VS1 A;  2JEA I;  3HOX G;  3CME A;  5H1S E;  4DV4 L;  3T1Y Q;  4P73 A;  3OTO L;  1IBM Q;  1UE1 A;  4JI0 L;  2C35 B;  1X3G A;  4DUY Q;  5M5W H;  3PF4 A;  5BR8 L;  5IP9 G;  2R92 G;  4IJH A;  3HOZ H;  3MXN B;  1ASY A;  5IYC H;  1SR3 A;  5IYB H;  1LUZ A;  4DV0 L;  1AE2 A;  2GN5 A;  2UXD L;  1YIJ A;  1PH9 A;  3K0X A;  3A5Z B;  2F52 A;  2I5H A;  1IBL Q;  1X55 A;  4HJ5 A;  4R4C A;  3ER0 A;  1YNX A;  1SRU A;  5C0X J;  3CC7 A;  3JAM i;  1Y1W H;  4LFC Q;  2GVA A;  2WP8 J;  4MTN A;  4NPS A;  4AQY L;  1VQC A;  1M1K C;  2KCM A;  1GVP A;  1DGS A;  4BXX G;  4DAY B;  2OTJ A;  3H0G H;  4TQU S;  4JI3 L;  4LF7 L;  4A3B H;  3KFU A;  3GTP H;  4A3M H;  1J5E L;  4A3E G;  2N8N A;  2HHH L;  1YHA A;  3L0O A;  5GAG C;  4GN3 B;  4H02 A;  1Q1E A;  1XNR L;  2IX1 A;  1XMO L;  1L1O A;  3CCE A;  4LF8 L;  2CKZ B;  4DKA C;  1N9W A;  3U58 A;  3PCO B;  2XTI A;  2F3I A;  5IP9 H;  5C0X G;  4LF6 Q;  3UDX A;  4OX9 L;  4XTC S;  1EUJ A;  1NTG A;  5IY0 A;  5HY6 A;  3HKZ G;  4AYB E;  5K36 G;  2KHI A;  3I55 A;  5FLM G;  1VQF A;  4JI8 L;  2ASB A;  4DK6 C;  1UE7 A;  2JEB I;  3RLO A;  3F8T A;  4GLA C;  3S24 A;  1EQQ A;  1Y14 B;  4IO9 A;  2NZH A;  3B6Y A;  3K81 C;  5AJ3 Q;  3JAM c;  3CCU A;  4LF5 Q;  2UXD Q;  2OQ0 A;  1PV4 A;  4JI2 Q;  4OX9 Q;  4BBS H;  2Q2I A;  4KI0 A;  3PUY A;  5IE8 A;  5M5Y H;  3RN5 A;  4LF6 L;  2JA9 A;  2JQO A;  2KCT A;  3I4M G;  3CCR A;  1D7Q A;  5JEA G;  2H5X A;  1SE8 A;  2IHE A;  2MO1 A;  3CAM A;  1I94 L;  4NXN Q;  4BBR G;  3PUX A;  1L0W A;  1ASZ A;  1HZC A;  2VNU D;  1OXU A;  3CCS A;  5JJI A;  4DR1 Q;  1N36 Q;  4GNX B;  2Q2T A;  5GRO A;  3TQY A;  1U0L A;  4PZ8 A;  3UE0 A;  2VY3 A;  4A3G H;  3HOY H;  1VQH A;  2HT1 A;  4NXM Q;  2Y0S E;  2R6G A;  4WJ3 M;  1YIT A;  3TEH B;  3T1Y L;  2NVX H;  2RCN A;  4BXX H;  2YTX A;  1H95 A;  4BBS G;  4KHP Q;  5M3M G;  4DAM A;  4B3R Q;  4APV A;  4L5Q A;  2RF4 A;  5LMN W;  1QUQ B;  4HIO A;  4OWT B;  3RZD H;  2B29 A;  2K5N A;  5BR8 Q;  3PSI A;  4BA1 I;  2NVQ H;  1QVG A;  3J80 c;  4RG1 A;  4KHZ A;  4DV0 Q;  2MFI A;  5DLQ E;  3S1Q H;  2Z6K C;  4X65 L;  1SN8 A;  3CQZ H;  2F4V L;  2D0O A;  2Y0S G;  5GQO A;  4LFC L;  4JC0 A;  5C4J H;  1NE3 A;  1L1O B;  1B7Y B;  4JI6 L;  4BY7 G;  4R4I A;  4HIK A;  4LUV A;  4LUZ A;  4OO1 I;  3PUZ A;  3IRB A;  4A3J H;  4X65 Q;  1Q86 C;  1J5E Q;  2AMC B;  3JC6 6;  1S40 A;  3H3V I;  3BU2 A;  2MO0 A;  3TS2 A;  4DPG A;  3PUV A;  2IX0 A;  1V9P A;  1E24 A;  3CCJ A;  4IOC A;  3L2P A;  3E9H A;  5IT9 c;  3G48 A;  5EAY A;  1K8G A;  2JA7 G;  2N78 A;  2WB1 G;  3RZO H;  3J80 i;  1A63 A;  3CXC A;  4JI6 Q;  1KQS A;  3M9B A;  5JEA J;  1WYD A;  1Q7Y C;  3HOV H;  4A3D H;  3D31 A;  1K83 H;  5J3B A;  4C3J H;  5GAH C;  4QGU A;  4DR2 L;  4A93 H;  4MNO A;  1XNQ L;  4HJ8 A;  1CSQ A;  3CD6 A;  1VQJ A;  3HOW H;  4IOA A;  1IZ6 A;  1S3O A;  5HGQ A;  4A3G G;  4JI8 Q;  4LUO A;  1CKO A;  1Y1V G;  1I5F A;  2MNA A;  1WCM H;  2N49 A;  4DV3 Q;  2K75 A;  4DR3 L;  3J81 c;  2B63 H;  2D0P A;  5LMN L;  1KXL A;  1EOV A;  3D0F A;  3U4Z A;  3KJO A;  3G6E A;  4GOP C;  2EIF A;  3HOU G;  1K9M C;  1K8A C;  3KF8 B;  4X64 Q;  1GKH A;  2VQE L;  1C0A A;  3GTL H;  2ZM6 L; 
#chains in the Genus database with same CATH topology
 1SMY D;  2F0G A;  1XNQ Q;  2KEN A;  3S17 H;  5EKI A;  4DK1 A;  2JA7 B;  1KTK A;  3S1R H;  4GS3 A;  1JOK A;  2H4O A;  3MXG A;  3HKZ E;  4DU9 A;  3C3L A;  1AZQ A;  1N36 L;  2PMZ B;  4A3G B;  5IGE A;  2K4K A;  1H9R A;  5IP7 G;  3K7U C;  5D3D A;  3PO2 H;  2JA7 H;  4B3R L;  3D8G A;  5EGT A;  4DV1 L;  4G7O C;  3L9A X;  1G6Z A;  1PXU A;  4AQY Q;  3CC4 A;  1JE4 A;  2KQ3 A;  1D5X C;  2E2H B;  4RGT A;  4IPD A;  4A3F G;  4A3E B;  2MUY A;  5LHY 1;  1N32 Q;  4C3J G;  1HPC A;  1WVL A;  1E22 A;  1SYC A;  1EIY B;  2QEX A;  2PNH A;  4JYA Q;  3A74 A;  2K01 A;  1VQE A;  2P5Z X;  2F0J A;  3BJU A;  3MTS A;  1PVO A;  4OL7 A;  1DCZ A;  1RHP A;  4QIW E;  2K50 A;  5FLM H;  1N34 Q;  3GTJ B;  2JA8 H;  4RWS C;  3K7A H;  1NAP A;  4BS9 A;  4QUF A;  2G5D A;  2MGS A;  1LTL A;  3LGJ A;  1TWA H;  5K36 H;  3QWN A;  1HZB A;  1NMF A;  5C3E H;  2PI2 E;  2TMP A;  3PIO A;  4WRD A;  2EYJ A;  3UE1 A;  3PO2 B;  3HEJ A;  2DUD A;  1HTL D;  4UY8 C;  1N33 Q;  2VQF Q;  2Z9H A;  3AYH B;  4TVA B;  2FIN B;  4JI4 L;  1V1P A;  1UNS A;  2ZTE A;  4U68 A;  1JJG A;  1PRT F;  1B3A A;  5C5M A;  3VYU A;  3TS0 A;  1M90 C;  1X3P A;  1VQP A;  4PZ7 A;  4FF2 A;  1GHJ A;  4A3F H;  4ZKB B;  3CCL A;  1QNK A;  3SGI A;  2F0M A;  1Y1V B;  2JK8 A;  4X62 L;  1IKL A;  4JI2 L;  4HSP A;  1LT3 D;  1EWH A;  1YHQ A;  2UUA L;  1B44 D;  1EEI D;  5EBC A;  1PYS B;  4Y7N B;  1FJG Q;  1KL9 A;  1YBY A;  1SAP A;  3D6W A;  3G6J B;  3QOJ A;  4B3M L;  3KLR A;  2E5L Q;  2O5I C;  4EQO A;  2R93 H;  2R93 B;  2OQK A;  2B3G A;  2EYH A;  1HR0 L;  4L5T A;  3PF5 A;  3CF5 A;  2I0Q A;  4GKK L;  1VF5 C;  1CQF A;  1OXV A;  3BVG A;  3H94 A;  1CZW A;  4XIG S;  1SRO A;  2IHF A;  5FO7 B;  4YCW A;  4DXF A;  3NEM A;  5CC4 A;  2FJ2 A;  3CC2 A;  1VQ6 A;  1TWC B;  2L15 A;  5M3M B;  1I6V C;  1AE3 A;  1TWC H;  3PIP A;  2RHS B;  3GDE A;  3J7A 5;  3P1H A;  5CBA E;  1KDA A;  5BN5 A;  3VR5 A;  4GN4 B;  3NWT A;  4M8A A;  1HA5 A;  1P16 A;  1G29 1;  5ISR A;  1OXS C;  3H0G G;  1PZK D;  1M4V A;  2Z0S A;  1HZA A;  2A6E C;  3A8K E;  2ZXP A;  5JJZ A;  2PI2 A;  4A3E H;  2F4V Q;  2DY8 A;  2Z8L A;  3S2D B;  4A3D G;  4R8N A;  4A3I H;  2D62 A;  3RNU A;  4LF9 L;  2K32 A;  2A6E D;  2SNS A;  1PH1 A;  4DR5 Q;  1X56 A;  4LFB Q;  1AH9 A;  2E8G A;  1BKB A;  2IWH A;  3SVM A;  3FKI H;  4J8Q A;  4C56 C;  5IYD H;  2BA1 A;  4ZK9 B;  4XYO A;  2JA6 H;  5FJ8 G;  2A19 A;  3TSS A;  4O0A A;  2YV5 A;  1Q8K A;  2OCE A;  2L1B A;  1WTR A;  4K8I A;  2Q2H A;  4DR6 L;  3TME A;  2SNM A;  3ND9 A;  2ZJQ A;  2RSO A;  5GAE C;  3SE0 A;  2JN4 A;  1O7I A;  4N8X 1;  1NNX A;  1V1Q A;  1ET9 A;  1CKM A;  1HNZ L;  3W1B A;  4B3T Q;  2ZM6 Q;  4C3H B;  2NN6 H;  1VMC A;  1E1T A;  1B50 A;  1YNN C;  2JSO A;  4B3S Q;  2OXP A;  3K8A A;  4IPC A;  1DJR D;  1J8I A;  2PQE A;  2B39 A;  4A3L H;  4HJA A;  4B3T L;  1STB A;  5HUR A;  2F0O A;  1HNZ Q;  2K6A A;  3OIP A;  2NZ1 D;  4KJN A;  1IBK L;  3M7G A;  1T9H A;  2XGT A;  4KD3 A;  4QMG A;  4DK3 C;  4DV5 L;  4B08 A;  2CWP A;  1HUM A;  3E5S A;  1H9M A;  3A5U A;  1U4L A;  3Q0A A;  3HKZ B;  5DM6 3;  2PMZ E;  3NEL A;  4A3K G;  2RA4 A;  2NN6 I;  5IYB G;  2CQA A;  4P72 A;  1RTN A;  3HOV B;  1B2T A;  2LXK A;  3TP8 A;  1ESF A;  1PHJ A;  3A8J E;  3NWS A;  2A73 B;  3CCM A;  1NCV A;  2K5H A;  2F0E A;  2JA5 H;  4POF A;  2J4X A;  1HNW L;  3PO3 G;  1R9T H;  2AQ2 B;  3D6C A;  2WV6 D;  4LJZ C;  3LNN A;  3HOY B;  1ICF B;  1K0R A;  1XNR Q;  3F1Z A;  1EIF A;  1I4H A;  2RQX A;  1HRJ A;  1SE2 A;  2BH2 A;  1FNU A;  2F3W A;  2Z6K A;  4GZY C;  1XMO Q;  1PFN A;  5ELO A;  2OWO A;  2Q2U A;  1IW7 C;  2B2W A;  4HJ7 A;  4XYQ A;  4C3H G;  1HZ9 A;  2X69 A;  4MIU A;  3P7J A;  1SMX A;  3UDI A;  4A76 A;  3NBH B;  1Y8O B;  1MIU A;  5LMU L;  5ELN A;  3W5O A;  4GKK Q;  3OW7 A;  3NTK A;  1VQL A;  1ZXT A;  3H3V H;  1DOL A;  1G2S A;  3ND8 A;  1X6O A;  4X3U A;  1YHB A;  1MKH A;  3GTJ H;  2JA8 B;  3S2H B;  4KMU C;  4NXN L;  3I4M B;  3GP7 A;  4GLX A;  5EJW A;  5CYU A;  2M9V A;  1PH6 A;  3S1N H;  3IAY A;  1E1O A;  3EIV A;  3UI2 A;  3BVZ A;  3FPU B;  1EFI D;  2VS1 A;  2JEA I;  4RAU C;  5EPK A;  1ENC A;  2EY6 A;  2B2T C;  1TU2 B;  3M3Y B;  1X3G A;  5C6A A;  2RKS A;  5IP9 G;  3MXN B;  5D14 A;  5IYB H;  5C3W A;  5FLX L;  4O1N A;  1YIJ A;  1PH9 A;  3K0X A;  1LTA D;  2BE5 D;  2F0N A;  2B8F A;  1YNX A;  2WP8 J;  4KK7 A;  1DGS A;  5G3L D;  3R8B A;  5LL6 X;  1QJO A;  4FXK C;  1K3B C;  3GTP H;  1J5E L;  1BDO A;  3DHQ A;  3L0O A;  4PMC A;  1LTS D;  2KEC A;  2CKZ B;  1S5C D;  4WJW A;  3K57 A;  1STE A;  3NK9 A;  3QR8 A;  5C0X G;  2K04 A;  4CBV A;  5E4X A;  5HY6 A;  3HKZ G;  2B8G A;  1SNQ A;  3QB3 A;  1EY5 A;  2NZH A;  3BVM A;  1H9S B;  3K81 C;  2AUJ D;  3CCU A;  2OQ0 A;  1PV4 A;  4JI2 Q;  3VR3 A;  1LT6 D;  1BCP C;  5JPM C;  1HUN A;  5IE8 A;  2JA9 A;  2JQO A;  2PO4 A;  4CJ2 C;  3A8I E;  4EGV A;  2H5X A;  3VA5 A;  2MO1 A;  1ASZ A;  2F0I A;  3SK5 A;  1HZC A;  2BDN A;  3CCS A;  4A3B B;  1N36 Q;  4GNX B;  4S3S A;  2QIL A;  2ICI A;  5L37 A;  1U0L A;  3PMF A;  5M5W B;  3LX0 A;  3Q6S A;  1A3V A;  1PZI D;  1K28 A;  1VQH A;  2HT1 A;  2E74 C;  3TEH B;  2NVX H;  2RCN A;  1EY7 A;  3Q22 A;  4BBS G;  5M3M G;  4APV A;  1XTC D;  4NW2 A;  2C5C A;  2B29 A;  3CRK C;  1NR4 A;  4H13 C;  3J80 c;  4RG1 A;  2NVQ B;  2MFI A;  5DLQ E;  4JK1 C;  2Z6K C;  4RGN A;  3CQZ H;  1PZJ D;  1LTB D;  2D0O A;  1TWH B;  1L1O B;  1NE3 A;  2XIW A;  1R4P B;  4JI6 L;  2F0T A;  2DNE A;  2L55 A;  2GA4 B;  1E0B A;  5IGF A;  1S40 A;  3MXP A;  4PMB A;  3G48 A;  5JVG 3;  5JEA J;  3J80 L;  1IYU A;  1K83 H;  5GAH C;  1I50 B;  4OEM B;  1BUV T;  4MNO A;  1VQJ A;  3IFD A;  4IOA A;  1S3O A;  4ZCK A;  5KRU A;  1PTO C;  5DM7 3;  5HGQ A;  3HOW B;  1HFN A;  1Y1V G;  1I5F A;  4TRD A;  3M4O B;  1WCM H;  1KXL A;  2F0D A;  2MJ8 A;  3HOX B;  3D0F A;  2HDM A;  3T13 A;  1GKH A;  1C0A A;  2F0H A;  2YTV A;  2A1A A;  1C4Q A;  1PDQ A;  3STB D;  1EEF D;  1EYC A;  3ULL A;  3K59 A;  1LTG D;  3NXW A;  3K6O A;  5T1I A;  4AYB G;  1IXR A;  1OO9 B;  1FYC A;  3J81 j;  4HSV A;  1JOR A;  3NEN A;  1JOQ A;  3SR1 A;  1SND A;  1N32 L;  2N3S A;  3OPO A;  1FJG L;  3ERO A;  3KLS A;  2JE6 I;  1YI2 A;  5KND A;  1G2T A;  5CV7 A;  4B3M Q;  1F2Z A;  1WOC A;  4L8J A;  4A93 B;  3K5M A;  1VQ7 A;  4X6A H;  4ME3 A;  4GOP B;  4KY6 A;  4UP8 A;  1B70 B;  3CCQ A;  1EYG A;  4DR4 Q;  4JYA L;  2IL8 A;  2CQO A;  2VB2 X;  5I2X A;  3NBI A;  1I6H H;  2JA5 G;  1JJC B;  1I3Q B;  3C1F A;  2HHH Q;  3PGZ A;  2UXB Q;  3CPW A;  5JOB A;  1A15 A;  1P8L A;  4HIM A;  3VYS A;  2VUM G;  5C4H A;  2CHB D;  1STN A;  1PH7 A;  3GTO H;  1KC8 C;  1CHQ D;  1GM5 A;  3IKJ A;  4OEL B;  2E2J H;  2QF7 A;  3NP8 A;  3RMH A;  2KVM A;  2LY7 A;  4YY3 Q;  1GUT A;  1FD7 D;  2NWG A;  1WD1 A;  1JJ2 A;  4J1M A;  2Z4I A;  4EX5 A;  3K7A B;  1KNA A;  2A6H D;  4BY1 G;  1PRT C;  1KRT A;  2KED A;  4DV7 Q;  2PZT A;  4JBK A;  2YYZ A;  1K73 C;  3UDG A;  3VDY A;  4LNQ A;  3A7A B;  3I73 A;  1TY2 A;  1A62 A;  2CH4 W;  5LMN Q;  3S2H H;  2R7Z G;  1LT5 D;  4JOI C;  1KD1 C;  1IL8 A;  4G4K A;  4EQP A;  1JB7 A;  3GTK B;  2DGY A;  2KCN A;  3SXH A;  3KLS X;  3H0G B;  3T16 A;  3GTQ H;  2B2T A;  3I4N G;  3CW2 C;  3UDF A;  3OOC A;  1D5Z C;  1A3T A;  3J81 i;  2XWB B;  4RGM A;  4A3C G;  4OWX B;  5DAU A;  3VYR A;  1XMQ Q;  3K5O A;  3X3N A;  2JA6 G;  2F0U A;  1PMR A;  3QJY A;  1GD7 A;  4ZLT F;  1GUN A;  3EQL C;  2DJF C;  1BCP B;  2NN6 G;  3MC0 B;  2HD3 A;  4C3J B;  5J22 A;  3AMU A;  1A6X A;  3AQQ A;  4KY7 A;  5CV9 A;  1G8Z D;  4H0L C;  3FKI B;  4Q0F A;  4JBJ A;  2E2H H;  3SK4 A;  3KYH C;  2UXD Q;  3W3A A;  4LWC A;  5M3F H;  4YWK A;  3L3O C;  3GTP B;  3ZJY C;  4IUU A;  4BBS B;  1TWH H;  3I2Z A;  3EBE A;  1OXX K;  2V4D A;  1EIH A;  1XPR A;  4BY1 H;  2XNA C;  1DOM A;  5C44 G;  5IYD G;  4DXG A;  3Q8D A;  4NKL A;  5FJ8 H;  5KNB A;  4DAY A;  5JAV A;  1STG A;  4QJF A;  4A3D B;  4IPG A;  4JI5 L;  1T5X D;  4IUT A;  1EL0 A;  1HNX L;  1X3E A;  2R7Z H;  1FVI A;  3I4O A;  3S14 H;  5KNC A;  1DYQ A;  1AN8 A;  1PYW D;  4PMW A;  4RHR A;  4RKL A;  4JI5 Q;  4DV7 L;  4YCU A;  3N52 A;  4YIJ A;  1ENF A;  4C2M B;  1F2Y A;  2AHO B;  3OHX C;  1DON A;  4JOI A;  1F9S A;  1EOT A;  2F03 A;  1FGU A;  4NMZ A;  3S15 B;  2F0Q A;  1SNO A;  2IY5 B;  1PA6 A;  1C9O A;  3RLF A;  4GKJ Q;  5IGG A;  2ZTC A;  5ELF A;  1C7Y A;  1A2U A;  2F0L A;  4DUZ Q;  2ES2 A;  3K58 A;  4E6I A;  3H09 A;  1Q1B A;  4L5S A;  3RR5 A;  1U4P A;  1LTI D;  1XTD A;  4RCN A;  2KHJ A;  4Y7N H;  3DWQ A;  1B53 A;  1O7L A;  3VR4 A;  4A4I A;  1BXT A;  4IFD H;  4V0B A;  2X6G A;  1QOH A;  2L9H A;  4CKE A;  5KYI A;  4IZ8 A;  3CCV A;  1E2V A;  1QB5 D;  1S5D D;  4DUZ L;  1XMQ L;  1SJE D;  3GTG H;  3GTG B;  1GHK A;  3NBH A;  3I8Z A;  5DNF A;  3HOY G;  3W1G A;  4QQB X;  1D6E C;  2NUC A;  5IWA Q;  2EJM A;  2K52 A;  3HKS A;  3T53 B;  1KAW A;  5A35 A;  4P75 A;  2VW9 A;  3AFP A;  2AQ1 B;  2ALY B;  2UXC L;  3NTH A;  2F0W A;  5COY A;  3MEF A;  4DR1 L;  5IOD A;  3TRZ A;  3SEB A;  1Q82 C;  5KGU A;  1EZ8 A;  4G7H C;  3FMC A;  1QVC A;  2IW3 A;  1XX8 A;  4GN5 A;  1CI3 M;  4P71 A;  1LTT D;  1YJN A;  4KHV A;  4UP9 A;  2RCF A;  3PO3 B;  4LFB L;  4R4O A;  5GAD C;  1GOZ A;  3KLW A;  1HH2 P;  1R9T B;  4YCV A;  1K8O A;  4YWM A;  3G71 A;  4DV3 L;  1II3 A;  5CBE E;  4DA2 A;  1MSH A;  1AFP A;  4WJ4 A;  1KHI A;  2WKC A;  1S72 A;  1DD2 A;  1TWF B;  1ZKO A;  1TWF H;  2Q8I B;  5M9O A;  2BH8 A;  5FLX c;  1SFO B;  1KDB A;  4DNI A;  3PV0 A;  3U9O A;  4IUN A;  3F2B A;  1WFQ A;  3KDF B;  5LL6 S;  1HR0 W;  2ZXR A;  1KLG D;  2AWN A;  1S4Z A;  3ULJ A;  1VQN A;  1I50 H;  4RCO A;  4UHV A;  1YNJ C;  1TQO A;  3I7F A;  2K1B A;  1SEB D;  1EY4 A;  2O4X A;  5I9P A;  3S9W A;  4A3M G;  4DV4 Q;  2KA7 A;  4O42 A;  5IP7 H;  2VZA A;  4MZ9 A;  3S16 H;  2PPB C;  3GTO B;  4M1U B;  1N8R C;  3CP0 A;  1HQM C;  1XYI A;  3MA2 B;  2EY5 A;  2UUA Q;  4KKU A;  4KN4 C;  4NB3 A;  1GUG A;  3KJP A;  1Q46 A;  1HXY D;  2I5L X;  2L11 A;  3F2D A;  1YJW A;  1DOK A;  5H1S E;  2E76 C;  5I4D A;  3MFG A;  2N55 A;  1Y69 U;  1YNN D;  1UE1 A;  5C3E B;  4DUY Q;  3ITP A;  1SYD A;  4KKT A;  2KJX A;  2R92 G;  4IJH A;  3HOZ H;  1ASY A;  3LWE A;  5IYC H;  1I6H B;  2R3Z A;  2XWJ B;  1AE2 A;  1MD2 D;  2WII B;  1IBL Q;  2I5H A;  1X55 A;  4HJ5 A;  3ER0 A;  3HOU B;  1U4R A;  2JYO A;  1GUW A;  2A68 C;  1S5E D;  2SDF A;  4MTN A;  4K6D A;  1AEX A;  5KEE A;  1TS3 A;  3MVV A;  5CR3 A;  2J0T D;  1GVP A;  4FYD A;  4DAY B;  3H0G H;  3GTQ B;  4OIK A;  4HR7 B;  4A3B H;  3R93 A;  4A3M H;  2HHH L;  2N88 A;  5FK9 C;  5GAG C;  2NVY B;  3A7L A;  1L1O A;  3CCE A;  4LF8 L;  3NSW A;  4HCE A;  4QUC A;  5IP9 H;  1SMY C;  4FNF A;  3UDX A;  4OX9 L;  3VYT A;  1EUJ A;  1PFM A;  2KHI A;  2QW7 A;  4FXG C;  3I55 A;  5FLM G;  1VQF A;  2ASB A;  1UE7 A;  3RLO A;  4AYB B;  1EY8 A;  5AJ3 Q;  3JAM c;  4G57 A;  3K5N A;  4OX9 Q;  1D5M C;  4H44 C;  1ZYR C;  2Q2I A;  3S17 B;  4IUQ A;  4RKB A;  2KCT A;  1EU3 A;  4FVM A;  3CCR A;  3I4M G;  5JEA G;  1I94 L;  1SE8 A;  1ENA A;  2IHE A;  1ZYR D;  3QO2 A;  1L0W A;  4BBR G;  3MWY W;  5JJI A;  2Q2T A;  5GRO A;  3TQY A;  1NUC A;  3MZ5 A;  3HOY H;  1TWG B;  2Y0S E;  2R6G A;  2RDF A;  3NUC A;  4WJ3 M;  4B9W A;  4BXX H;  2YU9 B;  3OMC A;  4B3R Q;  3JAM L;  2WB1 B;  2RF4 A;  1AP0 A;  4RA8 A;  4RFB A;  2K5N A;  2OT2 A;  4QCL A;  1Z6H A;  2DNC A;  1RDP D;  1UAP A;  3HGB A;  4WFN 3;  1SNC A;  3GV3 A;  2NB0 A;  1BQQ T;  3CKI B;  1B7Y B;  1LLR D;  4R4I A;  2E2D C;  4HIK A;  2NVT B;  1WCM B;  5EQ0 A;  1JB3 A;  3X3M A;  4OO1 I;  4KJO A;  4KV6 A;  4X65 Q;  1Q86 C;  1J5E Q;  3JC6 6;  4OGQ C;  5D65 A;  3BU2 A;  4F8M A;  3TS2 A;  2EJF C;  1F9P A;  1V9P A;  1E24 A;  3HOZ B;  2A69 C;  3E9H A;  5IT9 c;  1F77 A;  5EAY A;  4UDU C;  1A63 A;  1KQS A;  3M9B A;  3HOV H;  4A3D H;  2PZW A;  5IGD A;  2F4I A;  4DR2 L;  3GTL B;  1CSQ A;  4XDX A;  1TS4 A;  1IZ6 A;  3EA6 A;  4A3G G;  1C8C A;  1IW7 D;  4LUO A;  4K14 A;  2KCC A;  3QG1 A;  4JI8 Q;  2N49 A;  2VB3 X;  4DV3 Q;  3BDO A;  1S5F D;  4HTH A;  2EIF A;  4BBR B;  1O7Y A;  3HOU G;  1K9M C;  3KF8 B;  2CW0 D;  4LK1 C;  4Q5V A;  4ID6 A;  1FL0 A;  3SDZ A;  1CK1 A;  4ZYS A;  2R92 B;  4A3K B;  4R1J A;  3D4W A;  5J39 A;  4DV1 Q;  1EYD A;  1HJP A;  2LXJ A;  3T1H L;  4DR7 L;  4IAL A;  5JVH 3;  3RLN A;  2F0K A;  4JBW A;  1YEZ A;  5NUC A;  4PV1 C;  4ZAI A;  1UEA B;  4K8J A;  2AWO A;  4X64 L;  2VQE Q;  1WTW A;  2FFK B;  2RBM A;  5IYC G;  1IBK Q;  2F3V A;  4O2D A;  3I4N B;  1VQI A;  5FLX E;  2Z1C A;  1Q90 A;  2UXC Q;  1QIL A;  5KIX A;  2SOB A;  5EBD A;  2PW5 A;  1L0X B;  2UUB L;  4CGY B;  1JMC A;  2JA5 B;  4C3I H;  4JI1 L;  3AEV A;  4R4T A;  3BS1 A;  1WCM G;  4IJL A;  4R4Q A;  4LFA Q;  4C1N K;  3TDQ A;  2K5V A;  4UPA A;  1VQB A;  2KBN A;  4K5V A;  1ILQ A;  4DAV A;  3J80 E;  1GO3 E;  2TSS A;  4KLK A;  3H6M A;  1EFW A;  1GJX A;  4QIW B;  2WAQ E;  1MSG A;  1R4Q B;  2XRQ D;  1EY0 A;  2NTS A;  4OXP A;  5E4W C;  1A0I A;  1HNX Q;  3A0J A;  1WTH A;  1CQV A;  2QKI C;  5M3F G;  1CA5 A;  1RJT A;  2NZO A;  1VQG A;  1K3R A;  1M8A A;  1PRT D;  4DR5 L;  2D2C C;  4FF4 A;  1HTP A;  4HID A;  3C2P A;  4K6L A;  2EYF A;  4LF4 L;  1U4M A;  3J7Z C;  3IL8 A;  3I91 A;  4CDD C;  1CZG A;  1CUK A;  1FNV A;  1VQO A;  4N8F A;  1Q81 C;  3S1N B;  2ID0 A;  2ICE C;  3I70 A;  4DR7 Q;  1SYG A;  4FP5 D;  1STY A;  4LF4 Q;  3TN2 A;  1JC7 A;  1B4O A;  4KHP L;  3MXU A;  1JT8 A;  4XT1 B;  3H15 A;  1RCV D;  3DUZ A;  3HFZ B;  1VQA A;  4KY5 A;  2EYL A;  3KF8 A;  4QF4 A;  4K0K L;  3DM3 A;  3VR6 A;  3M4Y A;  2CCZ A;  4B3S L;  2EYO A;  1A8V A;  1VQ4 A;  1O80 A;  4BY7 B;  1S5B D;  4GOP A;  1H9S A;  1LT4 D;  4H7B A;  4L5R C;  2I5M X;  1F9R A;  4JI0 Q;  2B2Y A;  5C0X I;  4A75 A;  4MTK A;  1SSO A;  1VCI A;  4IFD G;  1K83 B;  2UUB Q;  4JI1 Q;  1NBW A;  3GTM H;  4A3F B;  1PH8 A;  1JE5 A;  1PFS A;  2J7Z A;  2E5L L;  1B9M A;  1IL2 A;  4NXM L;  3Q23 A;  2KOL A;  4LFA L;  3KBX A;  4ZRZ A;  2HDL A;  4DV2 L;  4JV5 Q;  4LF9 Q;  1TXY A;  1WTQ A;  1CA6 A;  1HR0 Q;  1JWU D;  1V8Q A;  1EQV A;  4OWW B;  2AKW B;  1SDF A;  5CMD A;  1JOO A;  1X54 A;  5C4X G;  3RZD B;  3KOJ A;  4ABN A;  4GKJ L;  1TT2 A;  4JI4 Q;  1RTO A;  3C1E A;  1RL2 A;  4C2M H;  3BZK A;  5C4J B;  2EZV A;  2EPB A;  1X65 A;  3R2I A;  4LF5 L;  5FKA C;  1BO0 A;  2QCP X;  2B63 G;  1O78 A;  2HIX A;  4BBR H;  3U9S A;  2F0F A;  2ZT9 C;  2HIV A;  4A3M B;  3H91 A;  4DV6 L;  2H1E A;  1V43 A;  1I94 Q;  1TS5 A;  2K5D A;  2RHQ B;  2KUM A;  1Y1W B;  3R3O A;  1HFG A;  2FMC A;  4RHS A;  1SJH D;  1EY6 A;  3NPP A;  4DR6 Q;  4HN7 A;  2G9H D;  1TVX A;  1WTV A;  3GV6 A;  3KF6 A;  4F7X A;  4JCV E;  2BA0 A;  2R7F A;  2PCF B;  3CQZ B;  2A5H A;  5EKK A;  4DNT B;  1OTC A;  3M4Q A;  5FO9 B;  1A2T A;  3NQI A;  1E3P A;  2EJG C;  2NVT H;  1NJI C;  4X3S A;  1ILP A;  3BZC A;  2WAQ G;  4GNX A;  3DWP A;  2LSS A;  1GXD C;  2ZXO A;  3S1R B;  4C3H H;  3RN2 A;  1VQD A;  3NQT A;  5C4X B;  1D8L A;  1SFO H;  1W6K A;  3M4P A;  1PYB A;  4A3I G;  3ERS X;  4FF1 A;  4HMJ A;  1WI5 A;  5IGC A;  1LTR D;  4DV5 Q;  3I72 A;  5I6Y A;  3J7Y W;  1QVF A;  4ULL A;  1IBL L;  4JI7 Q;  2CFM A;  3HOZ G;  1VQ9 A;  3G4S A;  3N6R A;  4XQJ A;  1RKN A;  4TKO B;  4QB4 A;  1ML0 D;  2PZU A;  3HOX H;  4L63 B;  3NTI A;  3OWF A;  2AQ3 B;  5BN3 A;  3HOW G;  1Z47 A;  4A3K H;  2L4N A;  2OTL A;  4X62 Q;  2IX3 A;  3D3R A;  3M7N A;  4QL5 A;  3HOV G;  5M5X H;  1G91 A;  4K5X A;  4C1N I;  4R8I A;  4DV6 Q;  2R93 G;  2CH4 A;  4NP5 A;  4ME5 A;  4JBM A;  4RH6 A;  4QY7 A;  3FVQ A;  4MN3 A;  1BBU A;  2Q8R E;  3KK7 A;  3CRL C;  4BY7 H;  1X3Q A;  4A3L G;  5C44 H;  5A2Q L;  4TSS A;  2XSC A;  1CSP A;  1YNJ D;  3MXN A;  3OSO A;  2KHS A;  5FOB B;  5TSS A;  2QGQ A;  4UP7 A;  4CDC C;  3E0E A;  1CKN A;  1MHW C;  1W3S A;  5E1F A;  1U9R A;  2YTY A;  1Q8I A;  2FXQ A;  2L5T A;  5K5P A;  3MFY A;  3DM1 A;  4CJ0 B;  4DUY L;  5IWA L;  1W2B A;  4BA2 I;  1BBW A;  3C46 A;  3HOX G;  3CME A;  3T1Y Q;  4P73 A;  2WAC A;  4ZUJ A;  2EY2 A;  2DJG C;  1IBM Q;  4HMI A;  3A54 A;  3URY A;  2K5Q A;  5JPN C;  4CDE C;  3V2T A;  5M5W H;  2SEB D;  2E2J B;  2CVR A;  4C3I G;  1SR3 A;  1LUZ A;  4P2C B;  3A5Z B;  2F52 A;  5F2D A;  4R4C A;  5C0X J;  1F9Q A;  1SRU A;  2K33 A;  4R9W A;  3JAM i;  3CC7 A;  4LFC Q;  4AQY L;  1VQC A;  2B2W C;  2A68 D;  3I90 A;  2KCM A;  1BR9 A;  5CGK A;  4BXX G;  2M00 A;  4LAA A;  4TQU S;  4EVO A;  3P20 A;  4A3E G;  2HCC A;  3RUZ A;  1YHA A;  4GN3 B;  2WIN B;  4KD4 A;  1Q1E A;  4ODG A;  1XNR L;  3U58 A;  3AB9 A;  3PCO B;  2XTI A;  5JEA H;  2IJ0 A;  4IUR A;  4XTC S;  1NTG A;  1LAC A;  2VUM B;  4DK6 C;  2JEB I;  4L6T B;  3S24 A;  3F8T A;  4GLA C;  5EKL A;  2NVX B;  3MHB A;  2E75 C;  1Y14 B;  1EQQ A;  1A3U A;  4LF5 Q;  3BZD B;  4BBS H;  1SE4 A;  5M5Y H;  1B1Z A;  5IGB A;  1NSN S;  2VXW A;  5M5Y B;  1CHP D;  1D7Q A;  3E3X A;  4XT3 B;  4NXN Q;  3PUX A;  1I4Q A;  5A2Q E;  2DN8 A;  4DR1 Q;  1O7Z A;  4IUV A;  4DF7 A;  1PLF A;  2XN9 C;  1EWC A;  4PZ8 A;  3UE0 A;  2WKD A;  4A3G H;  4DN4 M;  3NHH A;  4NXM Q;  2Z6B A;  1FGB D;  2F0V A;  1CM9 A;  4I65 A;  1TR5 A;  1QNU A;  2O5J C;  1H95 A;  1IYV A;  1PFB A;  1X32 A;  3D4D A;  4DAM A;  1KAB A;  2OF1 A;  2FHT A;  4L5Q A;  5LMN W;  5IT9 L;  1MI2 A;  1BCP F;  2L0C A;  3RZD H;  5BR8 Q;  1HQR D;  2JP1 A;  4BA1 I;  2PW7 A;  1QVG A;  5IOC A;  4X65 L;  4CKB A;  5CV6 A;  2B2U A;  2Y0S G;  1SXT A;  3TZD A;  5GQO A;  4EQN A;  4LFC L;  2I46 A;  4HAE A;  4JC0 A;  5C3X A;  5C4J H;  2PNR C;  1JCK B;  2WAQ B;  2EYM A;  4LUZ A;  4LUV A;  4DFA A;  4A3J H;  2AMC B;  5I9O A;  4K2K A;  2BE5 C;  2MO0 A;  1WTO A;  1E2Z A;  4JW0 A;  3T51 B;  3IFT A;  2IX0 A;  3CCJ A;  1SE3 A;  1V1O A;  2JA7 G;  2N78 A;  2WB1 G;  3RZO H;  3E6Z X;  3J80 i;  3CXC A;  3DEO A;  3S1Q B;  1ROD A;  1B9N A;  5M5X B;  3R2T A;  3D31 A;  5J3B A;  4QGU A;  4XQN A;  3T56 B;  4A93 H;  3CD6 A;  1XNQ L;  1PTO B;  3EVQ A;  1EQT A;  3TP5 A;  2EYP A;  2L12 A;  3A56 A;  5AFW A;  4MHE A;  2K75 A;  2B63 H;  3J81 c;  4CHT B;  1EOV A;  3U4Z A;  2O2L D;  3VR2 A;  1STA A;  4CDF C;  2QEJ C;  3SHL A;  2RSN A;  2JXM B;  3TP7 A;  1K8A C;  2K28 A;  3GTL H;  2ZM6 L;  3FKI G;  4OIJ A;  2G9D A;  1I4X A;  4DR2 Q;  3PIP 3;  2CWA A;  1TKW B;  5LMU Q;  1UWV A;  3ICE A;  4LMQ D;  3DXJ C;  5IT9 E;  1TS2 A;  5G3L F;  1CKN B;  5M3M H;  2PQA B;  1LO5 D;  3FRP B;  2YU9 H;  2EVB A;  1SNP A;  4G7Z C;  3ERQ A;  2UUC L;  1PTO F;  1TWG H;  4A3J G;  3KF6 B;  2F0S A;  1TII D;  4I7A A;  4P74 A;  1SLJ A;  1ICW A;  3TZU A;  1PH4 A;  1Z7T A;  4A3C H;  2MHV A;  2Y0S B;  2LS0 1;  1BOS A;  2B2Y C;  4FDB A;  4DK0 A;  3I4L A;  4Y52 H;  5ELD A;  1RD9 D;  4F87 A;  1Q12 A;  3ULP A;  1G6P A;  2WB1 E;  4PNY A;  4YHH Q;  3VA7 A;  3Q24 A;  4DGZ A;  1KIX A;  4LW1 A;  1ET6 A;  1D2B A;  3DWA A;  4JI7 L;  2E2I B;  1EZ6 A;  1B8A A;  4DR4 L;  1KLU D;  3A55 A;  3PUW A;  3MAQ A;  2VQF L;  2Z4H A;  1WJJ A;  3WOE A;  1MJC A;  4AH6 A;  1VQM A;  3OIQ A;  3K80 C;  3M3Y H;  3TBI B;  2X6L A;  1H9J A;  1L2F A;  4JVZ A;  3SK6 A;  1EIG A;  1Q3L A;  1YVC A;  3WDN A;  1F2M A;  3WWV A;  3S1M H;  2MP1 A;  1QUQ A;  3P75 A;  2KEE A;  2IT1 A;  3OW2 A;  1BCP D;  1BNZ A;  2DY7 A;  2HQL A;  2HCI A;  3W2D A;  2A8V A;  1X3F A;  3DMU A;  2UU9 L;  1LM0 A;  1XJV A;  4I7Z C;  5M3F B;  5JJL A;  2XVS A;  1HNW Q;  4B9X A;  2QDB A;  4RMF A;  1NR2 A;  4POG A;  4JG2 A;  2ZTD A;  1Y8N B;  1YZ6 A;  2D9U A;  2K7V A;  3MEH A;  1D1I A;  1DM0 B;  2EY1 A;  1EY9 A;  1PH3 A;  2VL6 A;  1C48 A;  2ATW A;  2EXZ A;  3E9I A;  4X66 Q;  1OXT A;  2CW0 C;  1VQ5 A;  3RZO B;  3WOF A;  1IBM L;  5CV5 A;  5J1Z A;  3GTK H;  2PQA A;  3FHW A;  1VDZ A;  3OMG A;  4X66 L;  3S16 B;  1H9K A;  4C3I B;  4YHH L;  4XXE A;  1EYA A;  1XPO A;  1MBY A;  2Q8T A;  1PH5 A;  2UXB L;  1VMP A;  2PYK A;  4CKC A;  4OO1 G;  1E2W A;  1WTP A;  1I3Q H;  3TRE A;  2FMM A;  4N9P A;  3M85 A;  3CMA A;  3S2D H;  1EU4 A;  1K8M A;  1N34 L;  2R92 H;  3BDC A;  3U4V A;  2B2U C;  1Y1V H;  5E7N A;  3K5L A;  1HCZ A;  4A3B G;  2NTT A;  3L7Z C;  4A93 G;  1IYJ B;  4IPH A;  2I07 B;  1UEB A;  4YY3 L;  5KYL A;  5CV4 A;  2C9O A;  2EDG A;  2K14 A;  1HHV A;  3OWE B;  5AJ3 L;  3GO5 A;  2V1C C;  2MQH A;  1B3Q A;  2UU9 Q;  2EQS A;  4PZ6 A;  2RDH A;  3GD7 A;  3PO2 G;  1L1O C;  2LFN A;  4FXD A;  2D5D A;  2IPK D;  3V05 A;  4HED A;  3STB C;  3PIO 3;  2E2I H;  1Y8P B;  1J9O A;  1ZEQ X;  4K2L A;  1JIC A;  3FEW X;  4LF8 Q;  3HZX A;  1QZH A;  1D1K A;  2LKV A;  2VUM H;  2OEO A;  1XWE A;  2EXD A;  2GVB A;  4PG3 A;  3G7L A;  1VQ8 A;  3CHB D;  1STH A;  3PO3 H;  1PH2 A;  1UE5 A;  1SYB A;  4UAI A;  5DEH A;  2R7D A;  4EQ5 A;  3F2U A;  2JA6 B;  3J81 E;  1QCB D;  1G51 A;  3GQB A;  3M4O H;  2NBF A;  1Z9F A;  2BDO A;  5C3E G;  1XPU A;  4F88 A;  3OYY A;  1K0S A;  3O13 A;  4WOR A;  2EOT A;  3I4M H;  3DLL A;  2ZJP A;  1TWA B;  2HUG A;  1JQY D;  2LMC B;  2WFW A;  3BYT B;  4IFD I;  4ALP A;  1EQR A;  3FP9 A;  4HJ9 A;  1I4R A;  2XRS D;  3AU7 A;  4OON A;  1MJE A;  2R7Z B;  5C44 B;  3K0Y A;  1IKM A;  3QOL A;  1QZG A;  1BVS A;  2R61 A;  1YJ9 A;  2AUK A;  2A6H C;  2JJQ A;  3U50 C;  2ZJR A;  1RIP A;  4OHJ A;  3V96 A;  5COR A;  1VQK A;  4LF7 Q;  4JI3 Q;  4JPB W;  1IHZ A;  1KDC A;  3I56 A;  1J6Q A;  4GLV B;  4DR3 Q;  4FO2 A;  5C5L A;  2JA8 G;  5E3F A;  4ZUI A;  1JWM D;  1KRS A;  1U5K A;  2K5W A;  4KTA A;  1N33 L;  1LYL A;  3S15 H;  3CU7 A;  3F2C A;  4N9T A;  1ESR A;  4K5W A;  5C0X H;  1VS0 A;  5BN4 A;  4CJ1 B;  2NYZ D;  4YWL A;  1Y1W G;  5ELE A;  2NVY H;  5IIF A;  1UUP A;  1NY4 A;  4J15 A;  3T1H Q;  4ZKC B;  1KAA A;  3I4N H;  1NMG A;  3CPF A;  3LWU A;  4GNX C;  2QA4 A;  3EN2 A;  5JJK A;  3EJI A;  3T4A C;  5EPJ A;  1WTX A;  3HOU H;  4IFD J;  1DXM A;  3HP3 A;  1PRT B;  3PQI A;  1E7Z A;  3AFQ A;  1BBX C;  2UUC Q;  3KDF A;  3JAM E;  4DV2 Q;  4JV5 L;  1XXG A;  1EWI A;  3OTO Q;  1X9N A;  5C4X H;  4AIM A;  3BDL A;  4K0K Q;  1KNE A;  1UE6 A;  3ZYY X;  3ONA B;  5D3I B;  4DV4 L;  4IQZ A;  1BF4 A;  3OTO L;  1JR0 D;  2F1M A;  1TY0 A;  4JI0 L;  2C35 B;  4X3T A;  3FDT A;  3BG3 A;  4ILW A;  1F2L A;  3PF4 A;  5BR8 L;  1V1P B;  1FR3 A;  1SYE A;  1SNM A;  4DV0 L;  4A3I B;  2GN5 A;  4J6H A;  2UXD L;  2ENB A;  5EPL A;  1DZ1 A;  3J7A V;  3KBG A;  4ZQ3 A;  1Y1W H;  2GVA A;  4NPS A;  1M1K C;  1L0Y B;  4XQQ A;  2OTJ A;  4JI3 L;  4LF7 L;  1AW7 A;  1LV9 A;  3KFU A;  2RVL A;  2N8N A;  1MGS A;  5ELB A;  2A74 C;  1W6J A;  4H02 A;  4Z9C B;  2BCO A;  2IX1 A;  1XMO L;  4DKA C;  1N9W A;  4HCS A;  1CT1 D;  1ONL A;  2F3I A;  1WD0 A;  5C4Z A;  4LF6 Q;  2BOS A;  4IUP A;  5IY0 A;  4NDX A;  3H3V C;  4AYB E;  5K36 G;  4JI8 L;  4FF3 A;  4IO9 A;  3B6Y A;  4PQX A;  1FNW A;  3D4R A;  1I4P A;  1CTM A;  1T5E A;  2MPM A;  3HRZ C;  4KI0 A;  3PUY A;  3S1M B;  1SBB B;  3GTM B;  2K03 A;  3RN5 A;  4LF6 L;  4KKS A;  3TP6 A;  1SYF A;  3KUP A;  5I2Y A;  3J7A F;  3CAM A;  3NE5 B;  1VF7 A;  2VNU D;  1OXU A;  4U67 3;  1GUO A;  3EFX D;  3HS0 C;  2EE1 A;  3FPP A;  2VY3 A;  4V19 0;  4BY1 B;  1YIT A;  3T1Y L;  4BWG B;  2YTX A;  5HGT A;  4KHP Q;  4DNR B;  3BYY B;  1QUQ B;  3RD4 A;  3QIA A;  1AZP A;  4HIO A;  4OWT B;  1JWS D;  3PSI A;  3HG9 A;  3S14 B;  2NVQ H;  4KHZ A;  4DV0 Q;  3S1Q H;  2B63 B;  1SN8 A;  3SK8 A;  2F0P A;  1LAB A;  2F4V L;  4KN7 C;  4DAP A;  3DEP A;  1QE6 A;  5I6W A;  5FO8 B;  4OO1 H;  1GUS A;  2B2V C;  4BY7 G;  3J81 L;  4RGO S;  3PUZ A;  3IRB A;  3H3V I;  2M2L A;  4DPG A;  1HA6 A;  2A69 D;  3PUV A;  3E0J A;  2RDG A;  5ELC A;  3L2P A;  4IOC A;  1I4G A;  4X3K A;  1K8G A;  1RF2 D;  4A3J B;  4JI6 Q;  1WYD A;  1Q7Y C;  1PTO D;  4C3J H;  4HJ8 A;  3HOW H;  2QDL A;  1QG7 A;  2K05 A;  1PTO H;  2B2V A;  1CKO A;  3I3C A;  2MNA A;  1QWY A;  5T1G A;  4DR3 L;  2D0P A;  5LMN L;  2HQE A;  3KJO A;  3G6E A;  4GOP C;  1CFM A;  5CV8 A;  4X64 Q;  4IN3 A;  2VQE L; 
#chains in the Genus database with same CATH homology
 1FL0 A;  3FKI G;  4DR2 Q;  2YTV A;  2A1A A;  1XNQ Q;  2KEN A;  3S17 H;  4R1J A;  4DV1 Q;  3STB D;  2CWA A;  1HJP A;  2LXJ A;  3ULL A;  3T1H L;  5LMU Q;  1UWV A;  4DR7 L;  3S1R H;  3RLN A;  3ICE A;  4GS3 A;  4JBW A;  1YEZ A;  3HKZ E;  4AYB G;  1IXR A;  1N36 L;  3J81 j;  1CKN B;  2AWO A;  3NEN A;  5M3M H;  2PQA B;  1N32 L;  4X64 L;  2VQE Q;  2K4K A;  2N3S A;  2YU9 H;  5IP7 G;  1FJG L;  5IYC G;  2JE6 I;  3K7U C;  1YI2 A;  1IBK Q;  2UUC L;  3PO2 H;  4O2D A;  2JA7 H;  4B3R L;  1TWG H;  1VQI A;  3KF6 B;  1WOC A;  4A3J G;  4B3M Q;  2UXC Q;  4P74 A;  1SLJ A;  4DV1 L;  1VQ7 A;  1PH4 A;  4X6A H;  4AQY Q;  4A3C H;  3CC4 A;  4ME3 A;  4GOP B;  4UP8 A;  2UUB L;  1B70 B;  3CCQ A;  1EYG A;  1JMC A;  4DR4 Q;  4JYA L;  4C3I H;  4IPD A;  4A3F G;  4JI1 L;  4FDB A;  4Y52 H;  2CQO A;  3AEV A;  1N32 Q;  1I6H H;  1Q12 A;  1JJC B;  4R4T A;  3ULP A;  2JA5 G;  1G6P A;  2WB1 E;  1WCM G;  2HHH Q;  3PGZ A;  4IJL A;  4YHH Q;  4R4Q A;  2UXB Q;  4LFA Q;  1E22 A;  1KIX A;  4LW1 A;  2K5V A;  4UPA A;  3CPW A;  1VQB A;  2QEX A;  1EIY B;  1P8L A;  2PNH A;  4JI7 L;  2KBN A;  4JYA Q;  3A74 A;  4HIM A;  1VQE A;  3BJU A;  2VUM G;  1PVO A;  1B8A A;  4DR4 L;  3PUW A;  1GO3 E;  4KLK A;  4QIW E;  2K50 A;  2VQF L;  1PH7 A;  5FLM H;  1N34 Q;  2JA8 H;  1WJJ A;  3GTO H;  1MJC A;  1KC8 C;  3K7A H;  4AH6 A;  1EFW A;  1VQM A;  1GM5 A;  1LTL A;  2WAQ E;  3LGJ A;  2E2J H;  1TWA H;  4OXP A;  1HZB A;  1NMF A;  3K80 C;  5C3E H;  2PI2 E;  3M3Y H;  1A0I A;  3PIO A;  4YY3 Q;  1HNX Q;  3A0J A;  3UE1 A;  1JJ2 A;  1L2F A;  5M3F G;  4EX5 A;  2DUD A;  2NZO A;  1VQG A;  1K3R A;  4BY1 G;  4UY8 C;  2VQF Q;  3AYH B;  1KRT A;  1N33 Q;  1YVC A;  4JBK A;  4DV7 Q;  2YYZ A;  4TVA B;  3WWV A;  1K73 C;  4DR5 L;  1QUQ A;  4JI4 L;  3S1M H;  3UDG A;  3VDY A;  4LNQ A;  4HID A;  2IT1 A;  2ZTE A;  3OW2 A;  1JJG A;  4LF4 L;  2HQL A;  3J7Z C;  2A8V A;  1A62 A;  3TS0 A;  5LMN Q;  1X3F A;  1M90 C;  3S2H H;  2UU9 L;  2R7Z G;  1CUK A;  1LM0 A;  1VQO A;  1XJV A;  4JOI C;  1KD1 C;  1VQP A;  5JJL A;  1Q81 C;  1HNW Q;  4PZ7 A;  4RMF A;  2ID0 A;  4POG A;  4JG2 A;  1JB7 A;  2ZTD A;  2DGY A;  4A3F H;  4DR7 Q;  3CCL A;  4LF4 Q;  1YZ6 A;  4KHP L;  3SGI A;  4BY7 H;  3GTQ H;  1JT8 A;  2JK8 A;  4X62 L;  4JI2 L;  3H15 A;  3I4N G;  1PH3 A;  3CW2 C;  3UDF A;  1YHQ A;  3HFZ B;  1VQA A;  2UUA L;  2VL6 A;  3J81 i;  4A3C G;  4K0K L;  3DM3 A;  1PYS B;  4OWX B;  1FJG Q;  1KL9 A;  2ATW A;  1YBY A;  2CCZ A;  3E9I A;  4B3M L;  4B3S L;  1A8V A;  1VQ4 A;  4X66 Q;  1XMQ Q;  1OXT A;  4GOP A;  2E5L Q;  4L5R C;  1VQ5 A;  2JA6 G;  1GD7 A;  2I5M X;  4JI0 Q;  2R93 H;  5C0X I;  4A75 A;  2NN6 G;  1VCI A;  2B3G A;  2OQK A;  1IBM L;  4IFD G;  2UUB Q;  1HR0 L;  4JI1 Q;  1NBW A;  4L5T A;  3CF5 A;  3PF5 A;  3AQQ A;  2I0Q A;  3GTM H;  4GKK L;  3GTK H;  1OXV A;  1PH8 A;  1JE5 A;  1PFS A;  2PQA A;  3FHW A;  4X66 L;  4JBJ A;  4XIG S;  2E5L L;  2E2H H;  4YHH L;  1SRO A;  2IHF A;  3KYH C;  1XPO A;  4YCW A;  4LWC A;  3NEM A;  5M3F H;  1PH5 A;  3CC2 A;  4NXM L;  1IL2 A;  1VQ6 A;  2L15 A;  2UXB L;  4YWK A;  3ZJY C;  1AE3 A;  1TWC H;  3PIP A;  4LFA L;  4OO1 G;  1I3Q H;  2RHS B;  3GDE A;  3TRE A;  4DV2 L;  3J7A 5;  1TWH H;  3I2Z A;  4JV5 Q;  3EBE A;  3M85 A;  4LF9 Q;  1TXY A;  1OXX K;  3CMA A;  3S2D H;  1XPR A;  4GN4 B;  1HR0 Q;  1N34 L;  4BY1 H;  5C44 G;  5IYD G;  1P16 A;  3Q8D A;  2R92 H;  1G29 1;  3U4V A;  5FJ8 H;  1OXS C;  1Y1V H;  3H0G G;  5E7N A;  4QJF A;  4IPG A;  2Z0S A;  4OWW B;  1HZA A;  4JI5 L;  2AKW B;  4A3B G;  3L7Z C;  4A93 G;  1IYJ B;  4A3E H;  2PI2 A;  4IPH A;  2F4V Q;  1HNX L;  1X3E A;  2R7Z H;  1FVI A;  3I4O A;  4A3I H;  1X54 A;  2D62 A;  4A3D G;  5C4X G;  3S14 H;  3RNU A;  1UEB A;  4YY3 L;  4LF9 L;  4PMW A;  3KOJ A;  4GKJ L;  1PH1 A;  4DR5 Q;  1X56 A;  4JI4 Q;  4JI5 Q;  4LFB Q;  2K14 A;  4DV7 L;  1AH9 A;  2E8G A;  4YCU A;  1BKB A;  3FKI H;  2AHO B;  1RL2 A;  4C2M H;  4JOI A;  5IYD H;  2BA1 A;  2JA6 H;  3BZK A;  1FGU A;  1X65 A;  2A19 A;  5FJ8 G;  5AJ3 L;  4LF5 L;  3GO5 A;  2V1C C;  2MQH A;  2UU9 Q;  2EQS A;  4O0A A;  4PZ6 A;  2B63 G;  2YV5 A;  2HIX A;  2IY5 B;  3GD7 A;  1Q8K A;  1PA6 A;  1L1O C;  2OCE A;  4BBR H;  3PO2 G;  1C9O A;  3RLF A;  2HIV A;  4GKJ Q;  2Q2H A;  2ZTC A;  4DR6 L;  1C7Y A;  4DV6 L;  4DUZ Q;  2ES2 A;  3STB C;  5GAE C;  2ZJQ A;  1Q1B A;  2E2I H;  1O7I A;  1V43 A;  3RR5 A;  1I94 Q;  4L5S A;  1V1Q A;  1XTD A;  2RHQ B;  1CKM A;  1HNZ L;  4LF8 Q;  3W1B A;  2KHJ A;  1QZH A;  4Y7N H;  2ZM6 Q;  4B3T Q;  2VUM H;  4A4I A;  2EXD A;  2GVB A;  4PG3 A;  1E1T A;  1VQ8 A;  4B3S Q;  4DR6 Q;  3CCV A;  3K8A A;  4IPC A;  1XMQ L;  3GTG H;  4DUZ L;  3PO3 H;  3KF6 A;  1UE5 A;  1PH2 A;  4JCV E;  2BA0 A;  2R7F A;  4A3L H;  4HJA A;  4B3T L;  2R7D A;  4EQ5 A;  1OTC A;  3M4Q A;  1HNZ Q;  3W1G A;  3HOY G;  1E3P A;  4QQB X;  1G51 A;  2NVT H;  5IWA Q;  1NJI C;  1IBK L;  3M4O H;  1T9H A;  2K52 A;  1Z9F A;  3BZC A;  2XGT A;  2WAQ G;  3HKS A;  1KAW A;  1XPU A;  5C3E G;  4GNX A;  2LSS A;  4P75 A;  4DK3 C;  3OYY A;  3AFP A;  2VW9 A;  4DV5 L;  2ALY B;  2CWP A;  4C3H H;  3RN2 A;  1VQD A;  2UXC L;  3A5U A;  3I4M H;  3DLL A;  2ZJP A;  1D8L A;  3MEF A;  4DR1 L;  1SFO H;  2WFW A;  3TRZ A;  1Q82 C;  2PMZ E;  3M4P A;  3NEL A;  1PYB A;  4A3K G;  4A3I G;  3ERS X;  2NN6 I;  1WI5 A;  4IFD I;  5IYB G;  1EQR A;  3FP9 A;  4HJ9 A;  4ALP A;  1QVC A;  4DV5 Q;  4P72 A;  1QVF A;  4OON A;  1MJE A;  2LXK A;  4GN5 A;  4P71 A;  1PHJ A;  1IBL L;  3CCM A;  4JI7 Q;  2CFM A;  1QZG A;  1BVS A;  1YJN A;  2K5H A;  1YJ9 A;  3HOZ G;  1VQ9 A;  3G4S A;  2JJQ A;  2JA5 H;  4UP9 A;  4POF A;  3U50 C;  2ZJR A;  4LFB L;  1RIP A;  4R4O A;  1VQK A;  1HNW L;  3HOX H;  4LF7 Q;  5GAD C;  4JI3 Q;  3KLW A;  1HH2 P;  3PO3 G;  1R9T H;  4YCV A;  4YWM A;  1J6Q A;  4GLV B;  3I56 A;  3G71 A;  3HOW G;  4DV3 L;  4DR3 Q;  1Z47 A;  1K0R A;  1XNR Q;  3F1Z A;  4A3K H;  1EIF A;  2JA8 G;  2OTL A;  4X62 Q;  2BH2 A;  3M7N A;  4QL5 A;  3HOV G;  1KHI A;  2Z6K A;  4WJ4 A;  1KRS A;  1U5K A;  5M5X H;  1S72 A;  1XMO Q;  1N33 L;  1LYL A;  3S15 H;  3F2C A;  1TWF H;  5ELO A;  2BH8 A;  4DV6 Q;  5FLX c;  2OWO A;  2Q2U A;  4DNI A;  2R93 G;  1VS0 A;  4HJ7 A;  3PV0 A;  4JBM A;  4YWL A;  1HZ9 A;  1Y1W G;  4QY7 A;  3F2B A;  1WFQ A;  2NVY H;  3UDI A;  1SMX A;  3KDF B;  4A76 A;  3NBH B;  1NY4 A;  1HR0 W;  1BBU A;  4J15 A;  1MIU A;  2AWN A;  3T1H Q;  3I4N H;  5LMU L;  1NMG A;  3CPF A;  5ELN A;  3ULJ A;  3W5O A;  2QA4 A;  3EN2 A;  4GNX C;  1I50 H;  1VQN A;  4GKK Q;  5JJK A;  4A3L G;  5C44 H;  1VQL A;  1CSP A;  3I7F A;  3HOU H;  4IFD J;  3H3V H;  4A3M G;  2QGQ A;  4UP7 A;  4DV4 Q;  5IP7 H;  2VZA A;  3E0E A;  4MZ9 A;  3S16 H;  1X6O A;  1CKN A;  1E7Z A;  1W3S A;  1YHB A;  3AFQ A;  2UUC Q;  3KDF A;  2YTY A;  1MKH A;  3GTJ H;  2FXQ A;  4DV2 Q;  4JV5 L;  1N8R C;  1EWI A;  3OTO Q;  4NXN L;  3CP0 A;  1X9N A;  5C4X H;  4GLX A;  2UUA Q;  4AIM A;  1PH6 A;  4NB3 A;  3KJP A;  1Q46 A;  4K0K Q;  3S1N H;  4DUY L;  1E1O A;  2I5L X;  3EIV A;  5IWA L;  3F2D A;  1W2B A;  1YJW A;  4BA2 I;  1UE6 A;  1BBW A;  2VS1 A;  2JEA I;  3HOX G;  3CME A;  5H1S E;  4DV4 L;  3T1Y Q;  4P73 A;  3OTO L;  1IBM Q;  1UE1 A;  4JI0 L;  2C35 B;  1X3G A;  4DUY Q;  5M5W H;  3PF4 A;  5BR8 L;  5IP9 G;  2R92 G;  4IJH A;  3HOZ H;  3MXN B;  1ASY A;  5IYC H;  1SR3 A;  5IYB H;  1LUZ A;  4DV0 L;  1AE2 A;  2GN5 A;  2UXD L;  1YIJ A;  1PH9 A;  3K0X A;  3A5Z B;  2F52 A;  2I5H A;  1IBL Q;  1X55 A;  4HJ5 A;  4R4C A;  3ER0 A;  1YNX A;  1SRU A;  5C0X J;  3CC7 A;  3JAM i;  1Y1W H;  4LFC Q;  2GVA A;  2WP8 J;  4MTN A;  4NPS A;  4AQY L;  1VQC A;  1M1K C;  2KCM A;  1GVP A;  1DGS A;  4BXX G;  4DAY B;  2OTJ A;  3H0G H;  4TQU S;  4JI3 L;  4LF7 L;  4A3B H;  3KFU A;  3GTP H;  4A3M H;  1J5E L;  4A3E G;  2N8N A;  2HHH L;  1YHA A;  3L0O A;  5GAG C;  4GN3 B;  4H02 A;  1Q1E A;  1XNR L;  2IX1 A;  1XMO L;  1L1O A;  3CCE A;  4LF8 L;  2CKZ B;  4DKA C;  1N9W A;  3U58 A;  3PCO B;  2XTI A;  2F3I A;  5IP9 H;  5C0X G;  4LF6 Q;  3UDX A;  4OX9 L;  4XTC S;  1EUJ A;  1NTG A;  5IY0 A;  5HY6 A;  3HKZ G;  4AYB E;  5K36 G;  2KHI A;  3I55 A;  5FLM G;  1VQF A;  4JI8 L;  2ASB A;  4DK6 C;  1UE7 A;  2JEB I;  3RLO A;  3F8T A;  4GLA C;  3S24 A;  1EQQ A;  1Y14 B;  4IO9 A;  2NZH A;  3B6Y A;  3K81 C;  5AJ3 Q;  3JAM c;  3CCU A;  4LF5 Q;  2UXD Q;  2OQ0 A;  1PV4 A;  4JI2 Q;  4OX9 Q;  4BBS H;  2Q2I A;  4KI0 A;  3PUY A;  5IE8 A;  5M5Y H;  3RN5 A;  4LF6 L;  2JA9 A;  2JQO A;  2KCT A;  3I4M G;  3CCR A;  1D7Q A;  5JEA G;  2H5X A;  1SE8 A;  2IHE A;  2MO1 A;  3CAM A;  1I94 L;  4NXN Q;  4BBR G;  3PUX A;  1L0W A;  1ASZ A;  1HZC A;  2VNU D;  1OXU A;  3CCS A;  5JJI A;  4DR1 Q;  1N36 Q;  4GNX B;  2Q2T A;  5GRO A;  3TQY A;  1U0L A;  4PZ8 A;  3UE0 A;  2VY3 A;  4A3G H;  3HOY H;  1VQH A;  2HT1 A;  4NXM Q;  2Y0S E;  2R6G A;  4WJ3 M;  1YIT A;  3TEH B;  3T1Y L;  2NVX H;  2RCN A;  4BXX H;  2YTX A;  1H95 A;  4BBS G;  4KHP Q;  5M3M G;  4DAM A;  4B3R Q;  4APV A;  4L5Q A;  2RF4 A;  5LMN W;  1QUQ B;  4HIO A;  4OWT B;  3RZD H;  2B29 A;  2K5N A;  5BR8 Q;  3PSI A;  4BA1 I;  2NVQ H;  1QVG A;  3J80 c;  4RG1 A;  4KHZ A;  4DV0 Q;  2MFI A;  5DLQ E;  3S1Q H;  2Z6K C;  4X65 L;  1SN8 A;  3CQZ H;  2F4V L;  2D0O A;  2Y0S G;  5GQO A;  4LFC L;  4JC0 A;  5C4J H;  1NE3 A;  1L1O B;  1B7Y B;  4JI6 L;  4BY7 G;  4R4I A;  4HIK A;  4LUV A;  4LUZ A;  4OO1 I;  3PUZ A;  3IRB A;  4A3J H;  4X65 Q;  1Q86 C;  1J5E Q;  2AMC B;  3JC6 6;  1S40 A;  3H3V I;  3BU2 A;  2MO0 A;  3TS2 A;  4DPG A;  3PUV A;  2IX0 A;  1V9P A;  1E24 A;  3CCJ A;  4IOC A;  3L2P A;  3E9H A;  5IT9 c;  3G48 A;  5EAY A;  1K8G A;  2JA7 G;  2N78 A;  2WB1 G;  3RZO H;  3J80 i;  1A63 A;  3CXC A;  4JI6 Q;  1KQS A;  3M9B A;  5JEA J;  1WYD A;  1Q7Y C;  3HOV H;  4A3D H;  3D31 A;  1K83 H;  5J3B A;  4C3J H;  5GAH C;  4QGU A;  4DR2 L;  4A93 H;  4MNO A;  1XNQ L;  4HJ8 A;  1CSQ A;  3CD6 A;  1VQJ A;  3HOW H;  4IOA A;  1IZ6 A;  1S3O A;  5HGQ A;  4A3G G;  4JI8 Q;  4LUO A;  1CKO A;  1Y1V G;  1I5F A;  2MNA A;  1WCM H;  2N49 A;  4DV3 Q;  2K75 A;  4DR3 L;  3J81 c;  2B63 H;  2D0P A;  5LMN L;  1KXL A;  1EOV A;  3D0F A;  3U4Z A;  3KJO A;  3G6E A;  4GOP C;  2EIF A;  3HOU G;  1K9M C;  1K8A C;  3KF8 B;  4X64 Q;  1GKH A;  2VQE L;  1C0A A;  3GTL H;  2ZM6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...