3PGZA

Crystal structure of a single strand binding protein (ssb) from bartonella henselae
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
109
Chain Sequence
AGSLNKVILIGNLGADPEIRRLNSGDQVANLRIATSESWRDRKERTEWHNIVIFNENLVKVVEQYLKKGSKIYIEGQLQTRKWQDQNGNDRYTTEIVLQKYRGELQMLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
publication title Crystal structure of a single strand binding protein (SSB) from bartonella henselae
rcsb
source organism Bartonella henselae
total genus 21
structure length 109
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pgzA00
4DV1Q 2A8VA 2OQKA 3HOWH 2Z6KC 2UXBL 3PUYA 4JYAQ 3A5ZB 1IBMQ 1NE3A 1XNQQ 4YHHL 1XPOA 4DR7Q 1WJJA 4QIWE 3J81c 1KC8C 1LUZA 3CCSA 1IBKQ 1J5EL 4LUVA 3BU2A 1KD1C 1CSQA 4DV0Q 2PQAA 4A93H 3RR5A 3M3YH 1I50H 1G291 4HJ5A 4HJ9A 1I94Q 4OO1G 1S40A 4DR5L 4A3IH 2E2HH 1PYBA 2K5HA 4DUZL 2UXBQ 2A1AA 2PMZE 3RNUA 3L2PA 3UDXA 4IFDG 1QVFA 2JA7G 4YHHQ 4A3JG 1Q82C 3AFPA 4LF5L 2ID0A 1J5EQ 4A3FH 4X65Q 4YWLA 2LXJA 1HNZL 2UUAL 5C4XG 2BH2A 3NBHB 1EQQA 5M3FG 1VQDA 3BJUA 3PV0A 4DR5Q 1IXRA 1MIUA 3KF8B 2AHOB 4DUZQ 4JBMA 3KDFB 1HZ9A 2C35B 4J15A 2AKWB 4HJ8A 1ASZA 3H0GG 3S1NH 3H0GH 3TS2A 1AE2A 2QGQA 4LF5Q 4LF9L 1VQBA 2DGYA 1PH6A 4HIMA 1WFQA 3J80i 2EXDA 1K8AC 4IPCA 1VQ9A 5JJLA 3L7ZC 1VQFA 2BA1A 1HNZQ 2UUAQ 1VS0A 1BKBA 2D62A 2PNHA 4LWCA 3CCRA 5C0XG 4BY7H 2MO0A 4DK6C 2RHSB 2QEXA 1PFSA 1VQ5A 4DV7L 4RMFA 4A3CG 1SLJA 2N49A 4NXML 2IX1A 4YCUA 1QVGA 3ICEA 1N9WA 1B7YB 1YVCA 2HIXA 2NVYH 1UWVA 1XTDA 1Y1VH 4LF9Q 2VW9A 2ZJQA 4JBJA 3Q8DA 2XGTA 1M1KC 2RCNA 1BBUA 4DR6Q 4Y52H 1CKNB 1HH2P 2F52A 4LUZA 4KHZA 4POGA 1OXTA 4KLKA 2CWAA 3NEMA 2KHJA 1VQ4A 2VQFL 1N36L 5M3MH 2JA9A 3J7A5 4NXMQ 4OX9L 4L5RC 1EUJA 1YZ6A 2JK8A 4JOIC 5HGQA 2E5LL 4YCWA 3UE0A 3PUXA 4QL5A 1G6PA 1PHJA 2V1CC 4IPHA 2ES2A 2ZTEA 4DAYB 5C44H 2HT1A 4DR4L 1JMCA 5HY6A 2JA6H 4JI1L 4AQYL 2WB1G 2JA8G 1NBWA 4MZ9A 3T1HL 4BBSG 1R9TH 1X9NA 3J80c 1X55A 3F8TA 2ZM6L 2VQFQ 1PH4A 2CWPA 1N36Q 3KJPA 1Q86C 4OX9Q 2AWNA 3PO3G 2E5LQ 4QY7A 3CC2A 1Q12A 2R7FA 1VQ7A 4A3DG 2YTVA 2I5MX 5IP7G 1L1OB 4B3SL 4JV5L 3IRBA 4IFDJ 1HNWL 4P71A 4L5TA 3CCEA 1YNXA 4DR4Q 1GM5A 1X3GA 3I4OA 3LGJA 4JI1Q 4AQYQ 3T1HQ 1PV4A 1OXVA 2ZM6Q 4DNIA 4HJ7A 1K83H 1MJEA 2Y0SE 2K5NA 2F4VL 5C3EH 3TRZA 2VZAA 3SGIA 4P73A 1Y14B 4PZ8A 2PI2E 4B3SQ 3CAMA 2JEAI 4JV5Q 1HNWQ 4QJFA 5JEAG 4GNXC 2UXCL 1V1QA 1KRSA 4DPGA 3M4PA 4KI0A 3GD7A 5C0XJ 1YHBA 1B8AA 4PZ7A 2F4VQ 1KIXA 2ZJPA 1JJ2A 1UEBA 3KYHC 4PG3A 3W5OA 4JI7L 3HOVG 4MTNA 1T9HA 4A3LG 4A3LH 5GAGC 4P72A 1X54A 2CFMA 1WCMH 2ZJRA 1HR0L 2UXCQ 3HOWG 1U0LA 1HZBA 1EQRA 3GO5A 3K80C 1W3SA 3E9HA 4R4CA 1JE5A 4JCVE 4XIGS 5H1SE 1PH1A 3M4QA 1KQSA 3H3VI 3EIVA 5FJ8H 2Q2HA 2R7DA 5GQOA 3UDFA 4H02A 3CCQA 4GOPA 3NELA 4HIDA 1SFOH 3U4ZA 4A76A 2KHIA 2ZTDA 1WI5A 1NTGA 1GVPA 2JEBI 4X65L 4A93G 2ASBA 1XPUA 4JI7Q 1E3PA 1NY4A 3FKIH 1KL9A 1GD7A 4LF6L 4NB3A 5BR8L 4A3IG 3G4SA 3I55A 1HR0Q 4OO1I 1YJNA 4X6AH 3J81j 1K0RA 4IJHA 4DR1Q 4GN4B 2Q2UA 2I5LX 5GADC 2LXKA 3G6EA 3E9IA 4IFDI 4R4QA 1Y1WG 3A74A 4BBRG 2NZHA 4BBRH 3HOXH 1Y1WH 3DM3A 2Q2TA 2F3IA 3K7UC 4R4OA 2VL6A 5IYCH 1X65A 2KCTA 3KLWA 3I56A 1E22A 4A3FG 1YI2A 3FP9A 3GTQH 4OXPA 4MNOA 3I4MH 1FGUA 3VDYA 4LF6Q 4GLAC 2E2JH 2R92H 5BR8Q 1XNRL 1SE8A 1DGSA 4A75A 1FJGL 3GTKH 1D7QA 4JBKA 3TQYA 2K75A 1EOVA 1XMOL 4OWWB 3KF6B 2R93H 3GTLH 1QZHA 4LUOA 4QQBX 1KXLA 2HQLA 3CMAA 4JI2L 1PH5A 4P74A 4OWXB 3CF5A 3KDFA 1NJIC 4O2DA 3S1RH 4RG1A 3PUZA 3PIPA 4HIOA 1ASYA 3A5UA 4BY7G 2KBNA 1XNRQ 3PF4A 1JJGA 4C2MH 3F2DA 1TWFH 4A4IA 5C0XI 4LNQA 1FJGQ 1H95A 2D0OA 5JEAJ 2VY3A 2WP8J 1KRTA 1XMOQ 4LFCL 2GN5A 1Y1VG 2YTXA 5M5XH 1YBYA 3U4VA 3RN5A 4JI2Q 4GN5A 4BA1I 4JI8L 4R4TA 1AE3A 1GKHA 4TVAB 3ERSX 4UP8A 3KOJA 4HJAA 1N33L 3UDGA 4DV2L 3HOZH 2NN6G 1X3EA 5M3MG 5IYDG 5IYDH 5FLMH 3M7NA 4DKAC 1YEZA 4TQUS 1CKNA 4LFCQ 4DR2L 1VQAA 3AEVA 4NPSA 4OWTB 4ALPA 4B3ML 4JI4L 2BH8A 4DUYL 1NMFA 1AH9A 5C44G 4JI8Q 3GTJH 4A3EH 1HNXL 4QGUA 1TWHH 1A8VA 1IBLL 3K0XA 1BBWA 2JA6G 1PH7A 1UE1A 1N33Q 2YV5A 1E1OA 1TWAH 3CPWA 3PF5A 3HOYH 5GROA 4DV2Q 4JI6Q 1A62A 3RLNA 1E24A 1P16A 3S1MH 3GTPH 1TWCH 4YCVA 4UP7A 3PO2G 3PO2H 1KAWA 2K14A 3BZCA 2K50A 1J6QA 1JJCB 4DR2Q 2L15A 4B3MQ 3CPFA 3WWVA 4POFA 1E1TA 3K7AH 1KHIA 2MQHA 5IY0A 3DLLA 4DUYQ 4GLXA 1HR0W 4EQ5A 2N8NA 1HZCA 5GAEC 1YHQA 2RF4A 1PH3A 1HNXQ 3PSIA 1IBLQ 3S2DH 1Q1BA 2IHFA 3M9BA 4UP9A 4PMWA 3CMEA 4LW1A 4JI5L 1YJWA 3EN2A 4XTCS 1L1OA 3F1ZA 3NENA 4DV3L 2FXQA 1IL2A 2Y0SG 2ALYB 5C3EG 3CCUA 1EIFA 1VQ6A 4EX5A 1O7IA 2I0QA 1EIYB 2I5HA 1LM0A 1UE5A 4LF7L 1Q46A 1WYDA 2NZOA 1B70B 4A3MH 2VNUD 3F2CA 1MKHA 5ELOA 1Q8KA 1SROA 2B3GA 3KFUA 4JI5Q 3S16H 1CSPA 2A19A 2R7ZH 2B63H 3S14H 4DV3Q 4L5SA 4BA2I 4B3RL 1X56A 2WAQG 3M4OH 2VS1A 2WAQE 4A3GH 1E7ZA 1VQKA 4YY3L 1VQ8A 4DV4L 2Z0SA 3HKZE 4BY1H 5LMNL 3I4NH 4LF7Q 4DV6L 2Q2IA 5IYBH 2OCEA 3D31A 3H15A 4GNXB 1K73C 1WCMG 2GVAA 1K9MC 3A0JA 3FHWA 3CCMA 2H5XA 1C0AA 3GTMH 3OTOL 2JJQA 2IHEA 4GOPC 2NVXH 1SRUA 4WJ4A 4A3BH 3S24A 4DR1L 5FJ8G 3MXNB 2IT1A 4B3RQ 3CCJA 3PUVA 3G48A 5ELNA 1V9PA 2EQSA 5J3BA 2VQEL 4DAMA 1VQPA 2KCMA 1N8RC 1X3FA 4LF4L 2VUMG 2VUMH 4YY3Q 2E2IH 4DV4Q 1VQJA 4X64L 5LMNQ 3AQQA 2OTLA 4HIKA 3PGZA 4DV6Q 1U5KA 3G71A 3FKIG 1S3OA 2GVBA 1C7YA 2B29A 2CKZB 2PI2A 3OTOQ 1PH2A 2JA5H 2UUCL 1IYJB 2N3SA 4AYBE 3T1YL 1RIPA 4BBSH 1I5FA 3L0OA 5IP9H 2MO1A 3HFZB 3U58A 4O0AA 1VCIA 3PUWA 3J7ZC 3HOXG 2VQEQ 2UUBL 4LF4Q 4L5QA 2NVQH 3H3VH 5IYCG 3AYHB 2PQAB 4OONA 1YITA 3W1BA 2Z6KA 3D0FA 4JBWA 4X64Q 1CUKA 3I4MG 3JC66 3JAMi 1C9OA 3I2ZA 2HHHL 1UE7A 2R6GA 2R92G 3GDEA 4FDBA 3S2HH 5AJ3L 3S17H 2UUCQ 1MJCA 2BA0A 3U50C 2MNAA 3T1YQ 3STBD 3CCVA 1D8LA 2R93G 2UUBQ 3OYYA 4GKKL 1QVCA 3GTOH 3CXCA 1TXYA 4P75A 2JA7H 4A3JH 2D0PA 2K52A 1HJPA 1Q1EA 3K81C 5JJKA 2UXDL 3KF6A 3UE1A 2HHHQ 4BXXG 4BXXH 5JJIA 2LSSA 4GKJL 1Z9FA 5AJ3Q 1FL0A 5C4XH 3B6YA 4LFBL 5E7NA 5M3FH 4JI0L 5EAYA 1K8GA 1PVOA 3TS0A 1VQLA 3S1QH 4GKKQ 2RHQB 4AIMA 1OXSC 1SMXA 1VQGA 3TREA 4ME3A 5IE8A 1SR3A 1XPRA 3CD6A 3BZKA 2UXDQ 2E8GA 2EIFA 4IO9A 1P8LA 5IWAL 1PH9A 2CCZA 3F2BA 3KJOA 5LMUL 4GKJQ 5K36G 3CQZH 4JI4Q 4JI6L 3GTGH 3HOZG 3JAMc 1L2FA 5FLMG 3OW2A 1SN8A 4LF8L 2NN6I 1G51A 3PIOA 4LFBQ 1VQNA 4PZ6A 4JI0Q 2KENA 4GN3B 1JT8A 1EWIA 3ZJYC 1WOCA 1N34L 2UU9L 4A3CH 2YYZA 1UE6A 1PH8A 1CKOA 3E0EA 2QA4A 4IPDA 1NMGA 4A3EG 1K3RA 2YU9H 3RZOH 4APVA 1OXXK 2ZTCA 1OTCA 1Q81C 2AMCB 3ER0A 5M5YH 5IWAQ 3M85A 3HOYG 5LMUQ 4GLVB 4X66L 2XTIA 1YJ9A 5M5WH 4LF8Q 5LMNW 4UPAA 1VQOA 4AH6A 4DV7Q 1OXUA 4JC0A 1N34Q 1Q7YC 2UU9Q 1I6HH 3UDIA 4A3KG 4A3KH 2OQ0A 3CCLA 4K0KL 4YWMA 1L1OC 1CKMA 4C3IH 4JOIA 1IZ6A 4KHPL 4IOCA 1VQEA 3EBEA 3ULLA 4Y7NH 2IX0A 4WJ3M 3CP0A 3CW2C 1EYGA 1LTLA 1EFWA 4X66Q 5C4JH 1VQMA 2WB1E 2OWOA 2JA8H 1A63A 1S72A 1PA6A 1LYLA 1PYSB 1V43A 4DR3L 5DLQE 1BVSA 2CQOA 3W1GA 3S15H 3PO3H 4A3MG 2JE6I 4K0KQ 4A3DH 2AWOA 2DUDA 1HZAA 5IP7H 3RZDH 3TEHB 1N32L 3STBC 4KHPQ 2R7ZG 2B63G 2WFWA 1QUQB 3CC4A 4UY8C 2OTJA 4NXNL 1FVIA 1VQHA 2K4KA 3CC7A 1TWGH 1Z47A 1L0WA 1YIJA 4LFAL 3J81i 1RL2A 1XMQL 4JI3L 1YHAA 4A3GG 5FLXc 4B3TL 4R1JA 2K5VA 1VQIA 4DR3Q 1QUQA 3HKZG 2YTYA 4BY1G 1JB7A 3I4NG 5GAHC 2N78A 3HOUG 5IYBG 3HOUH 4GS3A 2JQOA 2ATWA 3PCOB 1N32Q 3AFQA 4R4IA 3MEFA 2HIVA 4A3BG 4DV5L 4NXNQ 2MFIA 4DK3C 5IT9c 3HKSA 1X6OA 4LFAQ 4X62L 4DR6L 4IOAA 4DV1L 1W2BA 4GNXA 1GO3E 1XMQQ 4JI3Q 1VQCA 4B3TQ 4JYAL 1IBML 1XNQL 4C3HH 3K8AA 4IPGA 2IY5B 4DR7L 4C3JH 1QZGA 1M90C 1IBKL 3RN2A 4IJLA 1I3QH 4YWKA 3RLFA 4JG2A 4DV0L 2JA5G 2NVTH 3HOVH 3ULJA 1XJVA 3RLOA 4GOPB 1I94L 3ULPA 1A0IA 4AYBG 4X62Q 4DV5Q 3I7FA 5IP9G
chains in the Genus database with same CATH superfamily
5FLXE 4DV1Q 2A8VA 2OQKA 3HOWH 4FF3A 2B2VA 3MXPA 3HKZB 2JP1A 1XPOA 4DR7Q 3PMFA 2HCIA 3HOUB 3CCSA 4F8MA 2HUGA 2HQEA 3TP5A 3EQLC 2A6HD 3BU2A 1KD1C 4DV0Q 3E3XA 1IW7C 1G291 5EGTA 1H9SB 1EQVA 3SE0A 1PTOC 4DUZL 1JE4A 4RGNA 3TBIB 2B2WA 1SNPA 4C3HB 2UXBQ 4HMJA 5I4DA 3UDXA 1QVFA 2JA7G 4YHHQ 1HA6A 4FXGC 3J7YW 1J5EQ 1JOKA 3HOVB 4YWLA 1RTNA 1HNZL 4AYBB 5K5PA 2UUAL 1HQMC 1EQQA 1VQDA 1IXRA 1IYVA 2K03A 4JBMA 4CDDC 1ASZA 4XYQA 3TS2A 1KABA 1AE2A 2QGQA 2DGYA 1BCPC 3KF8A 3SK8A 4HIMA 1RJTA 1WFQA 1K8AC 3X3MA 1I50B 2OF1A 3M3YB 2D62A 4HSPA 1WTPA 4LWCA 2WKDA 5C0XG 5C0XH 4DK6C 2QEXA 3CRLC 2IX1A 1YVCA 2XNAC 1UWVA 2CW0C 2ZJQA 2F0HA 4JBJA 2XGTA 3I73A 2NYZD 2RCNA 5C4XB 4Y52H 1EZ8A 2F52A 1STNA 1UNSA 1EWCA 4KHZA 1OXTA 5IODA 2KHJA 2JN4A 1N36L 2JA9A 2LS01 3J7A5 4HEDA 4JOIC 2JK8A 4YIJA 3UE0A 3PUXA 2SNSA 4IPHA 1F9SA 2ZTEA 5C44H 2AQ3B 2HT1A 2EPBA 1I4QA 2WB1G 1DM0B 2JA8G 1NBWA 5EPKA 5IGGA 3T1HL 1ET6A 1R4QB 2K5WA 4MHEA 2AUKA 2VQFQ 1QJOA 1PH4A 2CWPA 3NWTA 4OX9Q 1Y1VB 2A6HC 4QY7A 3EJIA 5IOCA 3BVGA 1HNWL 1XWEA 2FJ2A 2JSOA 2ENBA 1QWYA 3I4OA 3LGJA 3LWEA 4JI1Q 3UI2A 1LT3D 3SR1A 2ZM6Q 4HJ7A 3HRZC 1K83H 2Y0SE 3KLSX 2VZAA 2QDBA 5IGCA 2NB0A 3I8ZA 3R3OA 1S4ZA 4JV5Q 2FFKB 5CBAE 2BE5C 1O7ZA 4QJFA 4HSVA 4ID6A 3NTIA 5I2XA 3OIQA 4DPGA 5KRUA 2MGSA 1S5DD 1OO9B 4KI0A 2EDGA 3GD7A 1YHBA 2F3WA 4R9WA 5JVH3 3M7GA 1JJ2A 1UEBA 4A3LG 4A3LH 4MTNA 2KA7A 1LACA 3A8KE 4P72A 4IUTA 5G3LF 5GAGC 1X54A 5C5LA 1IL8A 1HR0L 1IYUA 2K6AA 1U0LA 4EQPA 3J7AV 1F2LA 4R4CA 4XIGS 1PH1A 2LKVA 5C3EB 2R7DA 3UDFA 5GQOA 3NELA 4A76A 4B08A 1QNKA 2ZTDA 1JWUD 2ASBA 5IGEA 4A3IG 3J81j 5C6AA 4IJHA 1L0XB 4DR1Q 5GADC 3OWFA 3R2TA 2KEEA 2J0TD 3A74A 2NZHA 1B9NA 2L9HA 4R4QA 1EEID 4R4OA 5IGFA 2KCTA 2ZXPA 1TS5A 2NVTB 3FP9A 4MNOA 3BS1A 1FGUA 2EYMA 1WVLA 3VDYA 3C3LA 2NTTA 5CV9A 1Z7TA 2R92H 3NP8A 3WOFA 4A75A 1AP0A 3GTKH 4KD3A 3RZOB 3TQYA 1XMOL 1GJXA 4X3KA 4TKOB 3H3VC 4QQBX 3MXUA 4JI2L 1PH5A 1KLGD 4Q0FA 4H13C 3S1RH 3PUZA 3A5UA 4E6IA 4XT3B 1JJGA 3F2DA 1TWFH 3P20A 5CORA 4LNQA 1Q90A 5CV7A 5JEAJ 5JAVA 1EY9A 1FJGQ 1H95A 2R61A 2WP8J 4FNFA 1IHZA 2DJFC 4BA1I 5FLXL 4XYOA 2C5CA 3GTQB 1GKHA 4TVAB 2E2JB 3UDGA 5K36H 3NPPA 4ZUJA 3VYUA 4DV2L 2RKSA 5EPLA 1BNZA 1MBYA 3QO2A 1ONLA 5M9OA 4LFCQ 2L4NA 2BH8A 3D3RA 4O42A 2L11A 3GTJH 3HZXA 1TWHH 1IBLL 1QCBD 3PF5A 1TWAH 1HFGA 2H4OA 3RLNA 3S1MH 4XQQA 2K14A 2PO4A 1J6QA 1HHVA 4IUNA 3DLLA 1HR0W 4DUYQ 4GLXA 5GAEC 2DY8A 4ZKBB 1Q1BA 2IHFA 3M9BA 4UP9A 3VYRA 2Z1CA 3NENA 4DV3L 5CYUA 3CCUA 4LMQD 4EX5A 1O7IA 1LM0A 1HPCA 1Q46A 1WYDA 4V190 4EGVA 3F2CA 5LL6X 5ELOA 1Q8KA 3KFUA 3T53B 2B63H 4XQJA 3QR8A 3PO2B 2O2LD 1X56A 2WAQG 4N9TA 4BY1H 2PNRC 3G7LA 3D31A 3OTOL 1SRUA 4A3BH 4U68A 4CKEA 5FJ8G 3MXNB 5I6WA 3AU7A 1HXYD 1I4XA 4KTAA 4YY3Q 3ITPA 5ELBA 1S3OA 2UUCL 1IYJB 1I5FA 1R4PB 5IP9H 2MO1A 1VCIA 3HOXG 2VQEQ 4L5QA 3AYHB 1X3QA 3I4MG 1J9OA 1GUGA 3KUPA 3AMUA 2HHHL 1UE7A 3TMEA 2EYJA 3P1HA 3RD4A 1MJCA 2R93G 3OYYA 1QVCA 1SAPA 1VF5C 5IGDA 2M00A 5D14A 2UXDL 1H9KA 1SJHD 3MC0B 2IX3A 5JJIA 1LT6D 4HMIA 5C4XH 1B3QA 5CGKA 1KDCA 1T5XD 1K8GA 2L0CA 3S1QH 4GKKQ 1SNDA 2G9HD 1OXSC 3OPOA 2F03A 1SR3A 3CD6A 2E8GA 1PH9A 2CCZA 1MD2D 2GA4B 3S17B 4JI6L 2NN6I 1GUTA 4QMGA 1VDZA 4JI0Q 4NP5A 4GN3B 1JT8A 1EWIA 1ML0D 1UE6A 2JA7B 4OIJA 3IKJA 1M4VA 4A3EG 2F0LA 1TIID 1OXXK 2G9DA 4APVA 1Q81C 1OTCA 3M85A 1DOMA 3HOYG 5LMUQ 4GLVB 1EQTA 2A68D 3QOJA 4CHTB 1Q7YC 3HP3A 3UDIA 5I6YA 1B50A 4PMBA 1VQEA 4ZAIA 3ULLA 4CDFC 2IX0A 3GTGB 3DEPA 3CW2C 4X66Q 5C4JH 1VQMA 2WB1E 2K33A 3IAYA 1PYSB 2KHSA 1V43A 2K7VA 1BVSA 3VR3A 1HZAA 3RZDH 5E1FA 2KQ3A 2R7ZG 1JORA 1QUQB 1F9RA 4UY8C 2OTJA 1STHA 1VQHA 2K4KA 5M5WB 3KLSA 1Z47A 3J81i 2QCPX 1EIHA 4JI3L 4A3GG 3OMCA 3I91A 4B3TL 3OSOA 1RTOA 1SYGA 1EY7A 3I4NG 4GS3A 3PCOB 4QCLA 3MEFA 2WB1B 4X62L 4DK3C 5IT9c 3HKSA 2JA8B 1XMQQ 1VQCA 3BYYB 1XNQL 2MJ8A 2DNEA 3MWYW 4TRDA 3URYA 2B2YA 4A3MB 3MXNA 3KBGA 1LLRD 1IBKL 4IJLA 1O78A 3RLFA 3S16B 4JG2A 2EJFC 4QUFA 2F0UA 2JA5G 2NVTH 1XJVA 2IL8A 3RLOA 3L9AX 4GOPB 4IZ8A 4DV5Q 1PRTF 4DR6Q 4KK7A 4JYAQ 3A5ZB 3K0YA 4XXEA 3W3AA 1WJJA 2L55A 2H1EA 1NCVA 2Q8RE 3C2PA 2A68C 3GTMB 1MGSA 1KNAA 4LUVA 1CSQA 2CH4A 1WD0A 4A93H 2NVXB 3QIAA 1I94Q 4OO1G 1S40A 1EU3A 1ILPA 4DR5L 4CJ1B 1PYBA 2A1AA 1KLUD 3RNUA 3L2PA 1LTTD 4RKBA 1Q82C 5HURA 3AFPA 1O7YA 1BQQT 3A56A 2ID0A 4WFN3 1SDFA 4BBSB 3NBHB 1E2VA 4CDEC 3BJUA 4DXGA 1WD1A 2NVQB 1MIUA 3KF8B 1JICA 5EKLA 3KDFB 1HZ9A 5EKKA 4F7XA 2AKWB 4LF5Q 4ZKCB 1LO5D 1ESFA 5JJLA 1VQFA 1STBA 4A3IB 3CCRA 2O4XA 2RHSB 1VQ5A 5E3FA 3VA7A 4DV7L 4RMFA 1SLJA 2N49A 4A3JB 1QVGA 3ICEA 3K6OA 2PW7A 4LF9Q 2QDLA 1QILA 3LX0A 1CQFA 1H9MA 1LT4D 3WOEA 1CKNB 4RGOS 5ELFA 5AFWA 3NEMA 3AB9A 4NMZA 5CR3A 2NN6H 5M3MH 3MVVA 4NXMQ 3H0GB 3SK6A 4XQNA 2D2CC 1EUJA 1YZ6A 2CHBD 4QL5A 1G6PA 1PHJA 2ES2A 1SYDA 4RCOA 3I4LA 2L1BA 4OL7A 3T13A 5IGBA 3JAME 1STYA 1WTHA 3EROA 2B2UC 3J80c 3F8TA 3NE5B 1PFNA 4DAYA 4DFAA 3PO3G 2E5LQ 3CC2A 2R7FA 2WKCA 2F0IA 2YTVA 5IP7G 2ICIA 1B9MA 1RD9D 4DR4Q 1GM5A 1X3GA 5DM63 2Q8IB 4AQYQ 1PV4A 2VB2X 1G91A 2D9UA 1EY4A 4P73A 4B3SQ 1LTBD 4Y7NB 5BN4A 5JEAG 4GNXC 1R9TB 3DUZA 1V1QA 1KRSA 3J80E 5D3DA 1A6XA 1Y8NB 3M4PA 4F87A 2BDOA 2F4VQ 1B8AA 4PZ7A 2ZJPA 4K8JA 4PG3A 3W5OA 2XRSD 4JI7L 2DJGC 5C3XA 1WCMH 2UXCQ 2HD3A 3HOWG 1HZBA 2NBFA 3SXHA 1KQSA 1UEAB 4N9PA 1BXTA 2Q2HA 3U9OA 3CCQA 4GOPA 1SNQA 1SFOH 5IIFA 4HIDA 3SDZA 3U4ZA 4L8JA 3FVQA 1WI5A 1NTGA 4X65L 1XPUA 1E3PA 4LF6L 3SK5A 4NB3A 5BN5A 3G4SA 3I55A 1PXUA 4FXKC 2J7ZA 4C3JB 4FF4A 2LXKA 3G6EA 4IFDI 4UAIA 2AUJD 2RSOA 2Q2TA 5IYCH 1PTOF 3KLWA 3TP8A 2IWHA 1WTXA 5CV5A 1EWHA 5BR8Q 1SE8A 1XNRL 2BE5D 3MHBA 1PTOB 4JBKA 5JJZA 1D5ZC 2F0MA 2K75A 1EOVA 2X6LA 3NBHA 1KXLA 1CI3M 2ZXOA 5A35A 3CF5A 5DM73 4CGYB 3KDFA 3MFGA 1NJIC 3C1FA 2F0DA 1SEBD 1SXTA 1ASYA 2KBNA 2EY6A 3D6WA 3HS0C 1HRJA 4A4IA 3GQBA 2VY3A 2WIIB 4DA2A 3SK4A 1Y1WB 4BBRB 2GN5A 2YTXA 3H09A 5M5XH 3IL8A 1YNJD 1BCPB 4A3FB 4LAAA 3I4MB 4JI8L 4R4TA 5C4ZA 4HJAA 5G3LD 4ZQ3A 3CU7A 3HOZH 1X3EA 2B8FA 4RWSC 5IYDG 2SNMA 1STAA 5FLMH 4H44C 3S1NB 5IYDH 3OWEB 2R93B 1CKNA 1MI2A 2F4IA 1K8OA 3AEVA 4NPSA 4OWTB 4ALPA 4JI4L 4KJNA 4FXDA 1AH9A 1NMFA 5C44G 5LHY1 1HFNA 1BBWA 1PH7A 1UE1A 1N33Q 4BY7B 2YV5A 1E1OA 4C2MB 1B1ZA 1EY5A 4JI6Q 3BVMA 1E24A 2NVYB 1EEFD 1KAWA 2QKIC 2K50A 1JJCB 4DR2Q 4HN7A 2L15A 2D5DA 4B3MQ 2L12A 1O7LA 1HNXQ 5E4WC 1HZCA 1DCZA 4ODGA 5KNDA 3CMEA 4XTCS 2EOTA 2FXQA 3A8IE 3A7AB 5FO9B 2ALYB 2A69D 3VYSA 3V96A 2Z9HA 5KIXA 2JA6B 4A3MH 2VNUD 1MKHA 4JI5Q 3S16H 1CSPA 2A19A 3R93A 3FDTA 5BN3A 3GTPB 3NBIA 3R8BA 2VS1A 1E7ZA 1C4QA 3K7AB 1PMRA 2E76C 4LF7Q 2K05A 3S2DB 1EYAA 1D6EC 1K9MC 3FHWA 3CCMA 1C0AA 3GTMH 2O5JC 2IHEA 2NVXH 3NQIA 1ESRA 1YNJC 1C48A 2Y0SB 4B3RQ 5ELNA 5KNCA 3JAML 4LF4L 4MTKA 5J3BA 3K5MA 4G57A 1Y69U 4IURA 1N8RC 2VUMG 3TSSA 4JPBW 1ENAA 2VUMH 2E2IH 4DV4Q 3V2TA 5LMNQ 4DV6Q 5JOBA 1C7YA 2CKZB 3SEBA 2R7ZB 1GUSA 3S14B 3C1EA 2F1MA 4BBSH 1GOZA 4A3GB 1DYQA 3A8JE 2NVQH 2PQAB 3I4NB 3W1BA 4RFBA 4X64Q 1TS3A 2J4XA 3JAMi 3IFDA 2R92G 2X6GA 3GDEA 1SNCA 4FDBA 3S2HH 1D1KA 5AJ3L 1EFID 2BA0A 3T1YQ 1CA6A 3STBD 2MUYA 2UUBQ 1BF4A 3GTOH 3CXCA 3J80L 4A3JH 2RQXA 2K52A 1HJPA 3FKIB 1ZYRD 1SE2A 1UUPA 1WTOA 2JA5B 4GKJL 1F9PA 1FL0A 2NTSA 2A69C 1WTWA 3NSWA 5E7NA 5M3FH 1T5EA 1PVOA 2RHQB 4ZLTF 2I46A 3TREA 5ELCA 2K01A 4IO9A 1PZID 5FKAC 1SSOA 4NKLA 5K36G 3CQZH 2ZXRA 3GV6A 3J7AF 3MAQA 5EJWA 1G51A 2B8GA 4LFBQ 4PZ6A 2KENA 4JK1C 4A3CH 2YYZA 2F0NA 2YU9H 3ER0A 5M5YH 5IWAQ 1M8AA 2QF7A 1H9RA 5T1GA 4LF8Q 4UPAA 1QNUA 3I3CA 4DV7Q 1OXUA 4JC0A 3Q23A 1N34Q 2UU9Q 4FF2A 1F2MA 3DEOA 1L1OC 4C3IG 4C3IH 4JOIA 4EQOA 1JB3A 4KHPL 4Y7NH 3DWAA 1EYGA 2A5HA 1A63A 1S72A 1FYCA 4DR3L 2MHVA 4M8AA 4ULLA 3O13A 1ZXTA 4K0KQ 4A3DH 2DUDA 3STBC 2B63G 2WFWA 4NXNL 1FVIA 3CC7A 1TWCB 1L0WA 1YIJA 3M4YA 4CKBA 1I6HB 2K5VA 4KHVA 1ZYRC 3HKZG 4BY1G 1JB7A 5FK9C 4A3KB 2EYFA 2F0PA 3HOUG 3HOUH 4I7AA 1JC7A 2SEBD 2JQOA 2ATWA 1HTLD 1N32Q 3AFQA 4R4IA 4QB4A 4A3BG 2MFIA 1RHPA 4LFAQ 4DV1L 5JPNC 2NUCA 1S5BD 4C3HH 3K8AA 4DR7L 3PO3B 3KLRA 4C3JH 1KDBA 1M90C 3A54A 4YWKA 4DV0L 3HOVH 3ULPA 4AYBG 3CMAA 1Q3LA 4M1UB 5IP9G 2UXBL 2Z6KC 5CMDA 3HGBA 1IBMQ 1NE3A 4YHHL 4QIWE 1KC8C 1LUZA 1I4PA 1J5EL 4KN7C 1B3AA 2PQAA 1SE4A 1A3TA 3M3YH 1I50H 4RKLA 4KJOA 2K5HA 1F9QA 2B2TC 2PMZE 2SOBA 1EOTA 4OGQC 1ICWA 4DK0A 3NUCA 1I3QB 1DJRD 5EBDA 4A3FH 5NUCA 4X65Q 3P7JA 5C4XG 2BH2A 3HOWB 1HUMA 3PV0A 4DUZQ 2AHOB 1Y8PB 2QILA 4ZRZA 4C1NI 3S1NH 3VYTA 4QIWB 4K14A 2XWJB 2EXDA 4IPCA 4CJ0B 1VQ9A 1A3UA 3DHQA 2BA1A 1HNZQ 2UUAQ 1Z6HA 4OEMB 1JWSD 1BKBA 4BY7H 1TY2A 2MO0A 1PFSA 2EJGC 4YCUA 1CFMA 1B7YB 3NTHA 2NVYH 1Y1VH 4TSSA 2V4DA 2C9OA 3Q8DA 1M1KC 4K6LA 4Z9CB 1FD7D 1HH2P 4LUZA 4POGA 1PRTD 2CWAA 3E5SA 1VQ4A 2VQFL 4OX9L 5HGQA 4WRDA 3K58A 2RCFA 2V1CC 1A15A 1BUVT 4PQXA 4DAYB 1II3A 5HY6A 3SHLA 1AW7A 4JI1L 2JA6H 3FEWX 4DGZA 4DN4M 1X9NA 2K5DA 4XT1B 1X55A 2ZM6L 2NWGA 1N36Q 4KMUC 3KJPA 4OIKA 1Q86C 2AQ2B 2AWNA 1VQ7A 2I5MX 4JV5L 1TU2B 4IFDJ 3ONAB 4P71A 3I72A 2WV6D 3PIP3 1W6KA 3T1HQ 1NNXA 1SJED 1OXVA 3C46A 5I9PA 3H94A 2K5NA 3FRPB 5C3EH 3TRZA 2K5QA 5D3IB 4PZ8A 1IKLA 5C44B 1HNWQ 2F0FA 1JQYD 1XYIA 2F0SA 2G5DA 4Q5VA 3K5NA 1KAAA 3S15B 5C4HA 2M9VA 1E2WA 1PZKD 3T4AC 3KYHC 4CKCA 1TWGB 1U4LA 2B2VC 2CFMA 5KEEA 2ZJRA 4MN3A 1EQRA 4J8QA 1AFPA 3K80C 3E9HA 4MIUA 1K83B 3RZOH 4ZUIA 4J6HA 1I6VC 3ERQA 1NSNS 2HDMA 1GVPA 2E2DC 2JEBI 1PRTC 1HUNA 1F2YA 4A93G 5IT9E 3FKIH 1KL9A 1GD7A 2B2WC 1VMCA 2TSSA 1HR0Q 2EY5A 1K0RA 4FP5D 2EY1A 1CM9A 3NK9A 3E9IA 2I07B 4X3UA 2VL6A 1YI2A 2AQ1B 3GTQH 2ICEC 4G7ZC 3I90A 2E2JH 1EL0A 1FJGL 1D7QA 1NR4A 2JYOA 3RMHA 1B2TA 4OHJA 2MPMA 1AN8A 1QZHA 4LUOA 2EE1A 1JWMD 2B2TA 1GXDC 1E0BA 4RG1A 2RSNA 4K5WA 3TP6A 2E2HB 5KGUA 5KNBA 5C0XI 1S5ED 3D4WA 1KRTA 1XMOQ 4LFCL 4WORA 1YBYA 4DNRB 3U4VA 1K0SA 4K2KA 4RGMA 4JI2Q 3H91A 4NW2A 1AE3A 1EY6A 3PQIA 3ERSX 1SYFA 4UP8A 4QF4A 1K28A 4HR7B 3GTKB 5T1IA 4HCEA 2NN6G 5M3MG 2Z8LA 4DKAC 4TQUS 1DOLA 4FYDA 2K04A 1DOKA 1SE3A 2EYLA 2RDFA 4DUYL 3S1RB 4QGUA 1H9JA 3T56B 1TWFB 1MSGA 5GROA 3TZUA 4DV2Q 4KD4A 3CKIB 1TWCH 4UP7A 3PO2G 3PO2H 1RF2D 3BZCA 3KK7A 1VF7A 1DXMA 3CPFA 3WWVA 1E1TA 5IY0A 1YHQA 1PH3A 1IBLQ 1CA5A 1MSHA 4L63B 2RDHA 3F1ZA 4J1MA 1WTQA 1V1PA 1S5CD 3BDOA 1AEXA 4EQNA 1NUCA 4S3SA 2I5HA 3GTJB 1TWHB 1B70B 2XRQD 4KY7A 3G6JB 1TWAB 1SROA 2Q8TA 3QJYA 1ZEQX 4DV3Q 4L5SA 2WAQE 1PLFA 1VQKA 4YY3L 2OEOA 2Z0SA 3HKZE 4FVMA 3P75A 3V05A 2Q2IA 1B44D 5IYBH 2OCEA 3H15A 4GNXB 1O80A 1WCMG 2GVAA 1K73C 3A0JA 2H5XA 5KYIA 2PW5A 4ILWA 4WJ4A 2EXZA 1CT1D 2N88A 3S24A 5JVG3 2IT1A 4B9XA 3CCJA 2OT2A 3G48A 1V9PA 3U9SA 2VQEL 1VQPA 1X3FA 2OXPA 2Z4IA 3BYTB 1VQJA 1SMYD 4LK1C 3AQQA 1LV9A 2OTLA 4HIKA 2F0GA 3PGZA 1B53A 2B29A 1EYCA 1ENCA 5F2DA 3OTOQ 5LL6S 1PH2A 1LT5D 4X3SA 2N3SA 4IQZA 4AYBE 1RIPA 2PYKA 2WACA 3L0OA 3U58A 2KJXA 2WAQB 3HFZB 4O0AA 3PUWA 3J7ZC 1EZ6A 1J8IA 1JOQA 1FR3A 4H0LC 5IYCG 4BY1B 1YITA 3D0FA 1TS2A 3I2ZA 3Q22A 2PQEA 1U4RA 3GV3A 4A3BB 3S17H 2UUCQ 3MFYA 1JCKB 1D8LA 3CCVA 2E75C 1HQRD 2N55A 2K32A 4GKKL 2F0VA 1NAPA 1TXYA 4P75A 3ZYYX 2JA7H 3K81C 2D0PA 4X3TA 3UE1A 2HHHQ 4O1NA 4BXXG 4BXXH 1PFMA 3Q6SA 1G2TA 1BCPF 2IW3A 5E4XA 3B6YA 4JI0L 2EZVA 3HOXB 4K6DA 3TS0A 1VQLA 1G8ZD 1IKMA 2L5TA 1SMXA 1VQGA 2Z4HA 4ME3A 5IE8A 2UXDQ 1P8LA 3T16A 3EVQA 3F2BA 3KJOA 5LMUL 3HOZG 3GTGH 1RODA 4R8NA 5FO7B 5FLMG 3OW2A 2FINB 3GTLB 5IT9L 2PZUA 3ZJYC 1CKOA 3E0EA 3QB3A 5J22A 4IUUA 2ZTCA 2DN8A 2AMCB 5ELEA 1MHWC 2LFNA 1WTRA 4X66L 2XTIA 1YJ9A 4K5VA 5M5WH 5KYLA 1B4OA 1SMYC 4AH6A 3S1QB 4DF7A 3DMUA 3DWPA 5CV6A 5C3WA 2BCOA 3FPUB 4RA8A 2OQ0A 3VR6A 4YWMA 1CKMA 2PZTA 1IZ6A 3EBEA 1TKWB 1EFWA 1LTAD 1QB5D 2JA8H 3X3NA 1PA6A 1LYLA 4KN4C 3VR5A 2B2UA 3WDNA 5DLQE 1FNUA 4KKSA 4A3EB 3S15H 3QOLA 4A3MG 2JE6I 1EIGA 3TEHB 1KDAA 3HOYB 3CC4A 1TWGH 1YNND 5FO8B 1XMQL 4R1JA 1VQIA 3HG9A 2E74C 4H7BA 1GHKA 3ND8A 4RHRA 2A6ED 2KEDA 1GUNA 2HIVA 1STEA 5C4JB 1BO0A 4DV5L 1X6OA 4DR6L 5A2QL 4GNXA 3FPPA 4JI3Q 4IUVA 4JYAL 4B3TQ 4IPGA 2HCCA 2BDNA 3RZDB 1SNOA 3ULJA 2F0TA 2DY7A 1I94L 4X62Q 1TS4A 1EIYB 4BBSG 3I7FA 1U4PA 1EU4A 3VR4A 2MP1A 3M4OB 4JW0A 4B9WA 3D4RA 3PUYA 1XNQQ 3T51B 4HCSA 3J81c 2ZT9C 2F0QA 1IBKQ 4FF1A 2KCNA 3TP7A 3RR5A 3MXGA 4HJ5A 4HJ9A 4A3IH 2E2HH 3NQTA 1NR2A 2F0KA 5I2YA 1WTVA 4IFDG 4IFDH 2EVBA 4A3JG 1RCVD 3W2DA 4LF5L 1H9SA 4DK1A 2K1BA 3MTSA 5DNFA 1CQVA 2LXJA 1F77A 5M3FG 4DR5Q 1F2ZA 2EYOA 3OIPA 4HAEA 4F88A 3LWUA 4J15A 2C35B 2KECA 4HJ8A 3H0GG 3J81E 3H0GH 3HEJA 4NDXA 4BWGB 4LF9L 1PYWD 4OELB 1VQBA 5CV8A 1PH6A 3J80i 4A93B 1YNNC 3EFXD 3L7ZC 3TZDA 1VS0A 1G2SA 2PNHA 5EKIA 4G7OC 4A3CG 3NHHA 2A6EC 4NXML 1N9WA 3BDCA 2HIXA 2XSCA 1AZQA 1XTDA 5CV4A 1QOHA 2VW9A 2WINB 4G4KA 1BBUA 3Q0AA 3BVZA 1HCZA 1JOOA 4KLKA 5D65A 3IFTA 3K5LA 4DAVA 4L5RC 2E5LL 1I4GA 4I7ZC 2LMCB 4YCWA 2LY7A 1TQOA 1SNMA 2XIWA 4DR4L 1JMCA 3K59A 1LTSD 3OMGA 4AQYL 4U673 4GZYC 3H6MA 4MZ9A 1FNVA 1R9TH 5L37A 3OOCA 1Q12A 2F0OA 4A3DG 2X69A 3EA6A 1L1OB 5EBCA 4B3SL 3IRBA 2SDFA 4L5TA 3CCEA 1YNXA 4P2CB 3K57A 1FNWA 5FOBB 5M3MB 4DNIA 2P5ZX 1KTKA 1E2ZA 1MJEA 2F4VL 1TT2A 3SGIA 1Y14B 2HDLA 2FHTA 1STGA 2PI2E 3CAMA 2JEAI 4KKTA 1G6ZA 3E6ZX 2QW7A 1CZWA 2UXCL 2O5IC 1BDOA 2B2YC 4C3HG 3VA5A 4C3JG 3BZDB 4RGTA 5C0XJ 1K3BC 1KIXA 4WJ3M 3HOVG 1T9HA 3GP7A 1TY0A 4RAUC 3GO5A 1PTOH 1W3SA 1JE5A 4JCVE 3E0JA 5H1SE 4BA2I 1HA5A 3M4QA 1C8CA 3EIVA 5FJ8H 3H3VI 4H02A 2KHIA 3QWNA 4KY5A 4I65A 2BOSA 3R2IA 4JI7Q 3MEHA 1NY4A 1ENFA 2PPBC 2XN9C 5BR8L 4OO1I 1YJNA 2A73B 1XTCD 4X6AH 1DZ1A 1QG7A 2FMMA 4GN4B 2Q2UA 2I5LX 1CK1A 1Y1WG 1Y1WH 3NWSA 4BBRG 4BBRH 3HOXH 3DM3A 2RA4A 4C1NK 2F3IA 3K7UC 5I9OA 1X65A 3I56A 1E22A 4A3FG 2CVRA 2M2LA 4OXPA 3I4MH 4FO2A 4CDCC 1GUWA 1WCMB 4LF6Q 4GLAC 1PDQA 1RKNA 1DGSA 2R3ZA 3MZ5A 1SFOB 4OWWB 1PZJD 2FMCA 3KF6B 2R93H 3GTLH 2NZ1D 2HQLA 4JVZA 4P74A 4OWXB 4O2DA 5CC4A 3PIPA 4HIOA 4BY7G 3PF4A 1XNRQ 4C2MH 2PMZB 2XVSA 1Q8IA 2D0OA 1S5FD 4K5XA 1Y1VG 3RN5A 4GN5A 3A55A 1AZPA 1DD2A 1ET9A 3KOJA 1N33L 4UDUC 2KCCA 1D5MC 3M7NA 2KVMA 1YEZA 3N52A 4RHSA 3N6RA 2JXMB 2RVLA 4DR2L 1VQAA 4B3ML 2EYPA 4JI8Q 4ME5A 4DXFA 4A3EH 1HNXL 5ELDA 1A8VA 3K0XA 2JA6G 3CPWA 3HOYH 2F0WA 1LABA 3NXWA 2B39A 5TSSA 1A62A 1P16A 3GTPH 4YCVA 5M5XB 1KNEA 1V8QA 4POFA 4JI4Q 3K7AH 1KHIA 2MQHA 1V1PB 1K8MA 1Y8OB 5C5MA 4EQ5A 2N8NA 2EJMA 3FMCA 3S2DH 2RF4A 2RBMA 2KUMA 3PSIA 4IALA 3J81L 4PMWA 1YJWA 1L0YB 4LW1A 4JI5L 3EN2A 1L1OA 3Q24A 4V0BA 3HOZB 2Z6BA 1IL2A 1SYBA 1HTPA 2TMPA 2Y0SG 4ZK9B 5C3EG 1EIFA 1VQ6A 2I0QA 4DU9A 1XXGA 4G7HC 1UE5A 4LF7L 2NZOA 1CZGA 3NTKA 4PMCA 4ZYSA 2B3GA 4HTHA 2R7ZH 3S14H 4B3RL 3M4OH 4A3GH 2F0EA 1A2TA 1VQ8A 4DV4L 4IUPA 3BG3A 5LMNL 3I4NH 4DV6L 2F0JA 4C56C 1XX8A 1X3PA 3SVMA 2JJQA 4K2LA 2F3VA 4GOPC 4DR1L 2A74C 3PUVA 1U9RA 3LNNA 2EQSA 2IPKD 4DAMA 2KCMA 4X64L 1VMPA 3CHBD 1I4RA 5DAUA 1U5KA 3G71A 3FKIG 2GVBA 2PI2A 2JA5H 2K28A 4R8IA 3T1YL 2DNCA 2UUBL 4LF4Q 3H3VH 4OONA 5EQ0A 1FGBD 2Z6KA 4JBWA 5JPMC 1CUKA 1PRTB 3JC66 1LTGD 1C9OA 1D1IA 1CHPD 4IUQA 4KV6A 2R6GA 4L6TB 3U50C 2MNAA 4OO1H 3OW7A 4RCNA 4BS9A 1BBXC 2PZWA 2VUMB 2E2IB 4ABNA 3F2UA 5JJKA 1Q1EA 1GUOA 1LTRD 1ICFB 1RDPD 3KF6A 3L3OC 1A2UA 3D8GA 1UAPA 2LSSA 1Z9FA 3QG1A 5AJ3Q 1GHJA 4WJWA 4LFBL 5EAYA 1SYCA 4AIMA 2QEJC 3D4DA 1XPRA 3BZKA 2R92B 2EIFA 1EY8A 4ZCKA 5IWAL 3S2HB 4GKJQ 3K5OA 3JAMc 1L2FA 3DWQA 4KKUA 1SN8A 3TN2A 4LF8L 3PIOA 2KOLA 1VQNA 2XWBB 4KY6A 3GTOB 1WOCA 1N34L 1ZKOA 2UU9L 1PH8A 1X32A 2QA4A 4IPDA 1D2BA 1NMGA 5A2QE 1K3RA 1ILQA 1TVXA 3A7LA 1QE6A 1SYEA 1LTID 1EY0A 3ND9A 5M3FB 1BR9A 5LMNW 1VQOA 4DAPA 1IW7D 2EY2A 1I6HH 4N8FA 1PTOD 4A3KG 4A3KH 4K0KL 3CCLA 1PFBA 4PV1C 1D5XC 2EYHA 4IOCA 4LJZC 1W6JA 3CQZB 3KBXA 4QUCA 3CP0A 1CHQD 1LTLA 4RH6A 2OWOA 3BDLA 1TR5A 1V1OA 2RDGA 2CQOA 3W1GA 4K8IA 3PO3H 2YU9B 5DEHA 4DNTB 2AWOA 3DXJC 2VB3X 5M5YB 4N8X1 5IP7H 1N32L 1SBBB 4KHPQ 1A3VA 1BCPD 5ISRA 3S1MB 4LFAL 1RL2A 3D6CA 1YHAA 5FLXc 3PIO3 4DR3Q 1QUQA 2PCFB 2YTYA 4CBVA 5COYA 4XDXA 3DM1A 4IN3A 5GAHC 2N78A 5IYBG 4C3IB 5J1ZA 3S9WA 1DONA 1JR0D 2CW0D 3CRKC 3I70A 5EPJA 5JEAH 4NXNQ 3VR2A 2IJ0A 3MA2B 4IOAA 1W2BA 1GO3E 5HGTA 5J39A 3RUZA 4CJ2C 1IBML 1EYDA 1CTMA 1U4MA 2IY5B 3TDQA 1QZGA 4A3DB 4PNYA 5CBEE 2CH4W 1I4HA 2VXWA 3RN2A 1I3QH 2CQAA 2B63B 3OHXC 4UHVA 1A0IA 1BOSA 4EVOA
chains in the Genus database with same CATH topology
4DV1Q 2A8VA 2OQKA 3HOWH 2Z6KC 2UXBL 3PUYA 4JYAQ 3A5ZB 1IBMQ 1NE3A 1XNQQ 4YHHL 1XPOA 4DR7Q 1WJJA 4QIWE 3J81c 1KC8C 1LUZA 3CCSA 1IBKQ 1J5EL 4LUVA 3BU2A 1KD1C 1CSQA 4DV0Q 2PQAA 4A93H 3RR5A 3M3YH 1I50H 1G291 4HJ5A 4HJ9A 1I94Q 4OO1G 1S40A 4DR5L 4A3IH 2E2HH 1PYBA 2K5HA 4DUZL 2UXBQ 2A1AA 2PMZE 3RNUA 3L2PA 3UDXA 4IFDG 1QVFA 2JA7G 4YHHQ 4A3JG 1Q82C 3AFPA 4LF5L 2ID0A 1J5EQ 4A3FH 4X65Q 4YWLA 2LXJA 1HNZL 2UUAL 5C4XG 2BH2A 3NBHB 1EQQA 5M3FG 1VQDA 3BJUA 3PV0A 4DR5Q 1IXRA 1MIUA 3KF8B 2AHOB 4DUZQ 4JBMA 3KDFB 1HZ9A 2C35B 4J15A 2AKWB 4HJ8A 1ASZA 3H0GG 3S1NH 3H0GH 3TS2A 1AE2A 2QGQA 4LF5Q 4LF9L 1VQBA 2DGYA 1PH6A 4HIMA 1WFQA 3J80i 2EXDA 1K8AC 4IPCA 1VQ9A 5JJLA 3L7ZC 1VQFA 2BA1A 1HNZQ 2UUAQ 1VS0A 1BKBA 2D62A 2PNHA 4LWCA 3CCRA 5C0XG 4BY7H 2MO0A 4DK6C 2RHSB 2QEXA 1PFSA 1VQ5A 4DV7L 4RMFA 4A3CG 1SLJA 2N49A 4NXML 2IX1A 4YCUA 1QVGA 3ICEA 1N9WA 1B7YB 1YVCA 2HIXA 2NVYH 1UWVA 1XTDA 1Y1VH 4LF9Q 2VW9A 2ZJQA 4JBJA 3Q8DA 2XGTA 1M1KC 2RCNA 1BBUA 4DR6Q 4Y52H 1CKNB 1HH2P 2F52A 4LUZA 4KHZA 4POGA 1OXTA 4KLKA 2CWAA 3NEMA 2KHJA 1VQ4A 2VQFL 1N36L 5M3MH 2JA9A 3J7A5 4NXMQ 4OX9L 4L5RC 1EUJA 1YZ6A 2JK8A 4JOIC 5HGQA 2E5LL 4YCWA 3UE0A 3PUXA 4QL5A 1G6PA 1PHJA 2V1CC 4IPHA 2ES2A 2ZTEA 4DAYB 5C44H 2HT1A 4DR4L 1JMCA 5HY6A 2JA6H 4JI1L 4AQYL 2WB1G 2JA8G 1NBWA 4MZ9A 3T1HL 4BBSG 1R9TH 1X9NA 3J80c 1X55A 3F8TA 2ZM6L 2VQFQ 1PH4A 2CWPA 1N36Q 3KJPA 1Q86C 4OX9Q 2AWNA 3PO3G 2E5LQ 4QY7A 3CC2A 1Q12A 2R7FA 1VQ7A 4A3DG 2YTVA 2I5MX 5IP7G 1L1OB 4B3SL 4JV5L 3IRBA 4IFDJ 1HNWL 4P71A 4L5TA 3CCEA 1YNXA 4DR4Q 1GM5A 1X3GA 3I4OA 3LGJA 4JI1Q 4AQYQ 3T1HQ 1PV4A 1OXVA 2ZM6Q 4DNIA 4HJ7A 1K83H 1MJEA 2Y0SE 2K5NA 2F4VL 5C3EH 3TRZA 2VZAA 3SGIA 4P73A 1Y14B 4PZ8A 2PI2E 4B3SQ 3CAMA 2JEAI 4JV5Q 1HNWQ 4QJFA 5JEAG 4GNXC 2UXCL 1V1QA 1KRSA 4DPGA 3M4PA 4KI0A 3GD7A 5C0XJ 1YHBA 1B8AA 4PZ7A 2F4VQ 1KIXA 2ZJPA 1JJ2A 1UEBA 3KYHC 4PG3A 3W5OA 4JI7L 3HOVG 4MTNA 1T9HA 4A3LG 4A3LH 5GAGC 4P72A 1X54A 2CFMA 1WCMH 2ZJRA 1HR0L 2UXCQ 3HOWG 1U0LA 1HZBA 1EQRA 3GO5A 3K80C 1W3SA 3E9HA 4R4CA 1JE5A 4JCVE 4XIGS 5H1SE 1PH1A 3M4QA 1KQSA 3H3VI 3EIVA 5FJ8H 2Q2HA 2R7DA 5GQOA 3UDFA 4H02A 3CCQA 4GOPA 3NELA 4HIDA 1SFOH 3U4ZA 4A76A 2KHIA 2ZTDA 1WI5A 1NTGA 1GVPA 2JEBI 4X65L 4A93G 2ASBA 1XPUA 4JI7Q 1E3PA 1NY4A 3FKIH 1KL9A 1GD7A 4LF6L 4NB3A 5BR8L 4A3IG 3G4SA 3I55A 1HR0Q 4OO1I 1YJNA 4X6AH 3J81j 1K0RA 4IJHA 4DR1Q 4GN4B 2Q2UA 2I5LX 5GADC 2LXKA 3G6EA 3E9IA 4IFDI 4R4QA 1Y1WG 3A74A 4BBRG 2NZHA 4BBRH 3HOXH 1Y1WH 3DM3A 2Q2TA 2F3IA 3K7UC 4R4OA 2VL6A 5IYCH 1X65A 2KCTA 3KLWA 3I56A 1E22A 4A3FG 1YI2A 3FP9A 3GTQH 4OXPA 4MNOA 3I4MH 1FGUA 3VDYA 4LF6Q 4GLAC 2E2JH 2R92H 5BR8Q 1XNRL 1SE8A 1DGSA 4A75A 1FJGL 3GTKH 1D7QA 4JBKA 3TQYA 2K75A 1EOVA 1XMOL 4OWWB 3KF6B 2R93H 3GTLH 1QZHA 4LUOA 4QQBX 1KXLA 2HQLA 3CMAA 4JI2L 1PH5A 4P74A 4OWXB 3CF5A 3KDFA 1NJIC 4O2DA 3S1RH 4RG1A 3PUZA 3PIPA 4HIOA 1ASYA 3A5UA 4BY7G 2KBNA 1XNRQ 3PF4A 1JJGA 4C2MH 3F2DA 1TWFH 4A4IA 5C0XI 4LNQA 1FJGQ 1H95A 2D0OA 5JEAJ 2VY3A 2WP8J 1KRTA 1XMOQ 4LFCL 2GN5A 1Y1VG 2YTXA 5M5XH 1YBYA 3U4VA 3RN5A 4JI2Q 4GN5A 4BA1I 4JI8L 4R4TA 1AE3A 1GKHA 4TVAB 3ERSX 4UP8A 3KOJA 4HJAA 1N33L 3UDGA 4DV2L 3HOZH 2NN6G 1X3EA 5M3MG 5IYDG 5IYDH 5FLMH 3M7NA 4DKAC 1YEZA 4TQUS 1CKNA 4LFCQ 4DR2L 1VQAA 3AEVA 4NPSA 4OWTB 4ALPA 4B3ML 4JI4L 2BH8A 4DUYL 1NMFA 1AH9A 5C44G 4JI8Q 3GTJH 4A3EH 1HNXL 4QGUA 1TWHH 1A8VA 1IBLL 3K0XA 1BBWA 2JA6G 1PH7A 1UE1A 1N33Q 2YV5A 1E1OA 1TWAH 3CPWA 3PF5A 3HOYH 5GROA 4DV2Q 4JI6Q 1A62A 3RLNA 1E24A 1P16A 3S1MH 3GTPH 1TWCH 4YCVA 4UP7A 3PO2G 3PO2H 1KAWA 2K14A 3BZCA 2K50A 1J6QA 1JJCB 4DR2Q 2L15A 4B3MQ 3CPFA 3WWVA 4POFA 1E1TA 3K7AH 1KHIA 2MQHA 5IY0A 3DLLA 4DUYQ 4GLXA 1HR0W 4EQ5A 2N8NA 1HZCA 5GAEC 1YHQA 2RF4A 1PH3A 1HNXQ 3PSIA 1IBLQ 3S2DH 1Q1BA 2IHFA 3M9BA 4UP9A 4PMWA 3CMEA 4LW1A 4JI5L 1YJWA 3EN2A 4XTCS 1L1OA 3F1ZA 3NENA 4DV3L 2FXQA 1IL2A 2Y0SG 2ALYB 5C3EG 3CCUA 1EIFA 1VQ6A 4EX5A 1O7IA 2I0QA 1EIYB 2I5HA 1LM0A 1UE5A 4LF7L 1Q46A 1WYDA 2NZOA 1B70B 4A3MH 2VNUD 3F2CA 1MKHA 5ELOA 1Q8KA 1SROA 2B3GA 3KFUA 4JI5Q 3S16H 1CSPA 2A19A 2R7ZH 2B63H 3S14H 4DV3Q 4L5SA 4BA2I 4B3RL 1X56A 2WAQG 3M4OH 2VS1A 2WAQE 4A3GH 1E7ZA 1VQKA 4YY3L 1VQ8A 4DV4L 2Z0SA 3HKZE 4BY1H 5LMNL 3I4NH 4LF7Q 4DV6L 2Q2IA 5IYBH 2OCEA 3D31A 3H15A 4GNXB 1K73C 1WCMG 2GVAA 1K9MC 3A0JA 3FHWA 3CCMA 2H5XA 1C0AA 3GTMH 3OTOL 2JJQA 2IHEA 4GOPC 2NVXH 1SRUA 4WJ4A 4A3BH 3S24A 4DR1L 5FJ8G 3MXNB 2IT1A 4B3RQ 3CCJA 3PUVA 3G48A 5ELNA 1V9PA 2EQSA 5J3BA 2VQEL 4DAMA 1VQPA 2KCMA 1N8RC 1X3FA 4LF4L 2VUMG 2VUMH 4YY3Q 2E2IH 4DV4Q 1VQJA 4X64L 5LMNQ 3AQQA 2OTLA 4HIKA 3PGZA 4DV6Q 1U5KA 3G71A 3FKIG 1S3OA 2GVBA 1C7YA 2B29A 2CKZB 2PI2A 3OTOQ 1PH2A 2JA5H 2UUCL 1IYJB 2N3SA 4AYBE 3T1YL 1RIPA 4BBSH 1I5FA 3L0OA 5IP9H 2MO1A 3HFZB 3U58A 4O0AA 1VCIA 3PUWA 3J7ZC 3HOXG 2VQEQ 2UUBL 4LF4Q 4L5QA 2NVQH 3H3VH 5IYCG 3AYHB 2PQAB 4OONA 1YITA 3W1BA 2Z6KA 3D0FA 4JBWA 4X64Q 1CUKA 3I4MG 3JC66 3JAMi 1C9OA 3I2ZA 2HHHL 1UE7A 2R6GA 2R92G 3GDEA 4FDBA 3S2HH 5AJ3L 3S17H 2UUCQ 1MJCA 2BA0A 3U50C 2MNAA 3T1YQ 3STBD 3CCVA 1D8LA 2R93G 2UUBQ 3OYYA 4GKKL 1QVCA 3GTOH 3CXCA 1TXYA 4P75A 2JA7H 4A3JH 2D0PA 2K52A 1HJPA 1Q1EA 3K81C 5JJKA 2UXDL 3KF6A 3UE1A 2HHHQ 4BXXG 4BXXH 5JJIA 2LSSA 4GKJL 1Z9FA 5AJ3Q 1FL0A 5C4XH 3B6YA 4LFBL 5E7NA 5M3FH 4JI0L 5EAYA 1K8GA 1PVOA 3TS0A 1VQLA 3S1QH 4GKKQ 2RHQB 4AIMA 1OXSC 1SMXA 1VQGA 3TREA 4ME3A 5IE8A 1SR3A 1XPRA 3CD6A 3BZKA 2UXDQ 2E8GA 2EIFA 4IO9A 1P8LA 5IWAL 1PH9A 2CCZA 3F2BA 3KJOA 5LMUL 4GKJQ 5K36G 3CQZH 4JI4Q 4JI6L 3GTGH 3HOZG 3JAMc 1L2FA 5FLMG 3OW2A 1SN8A 4LF8L 2NN6I 1G51A 3PIOA 4LFBQ 1VQNA 4PZ6A 4JI0Q 2KENA 4GN3B 1JT8A 1EWIA 3ZJYC 1WOCA 1N34L 2UU9L 4A3CH 2YYZA 1UE6A 1PH8A 1CKOA 3E0EA 2QA4A 4IPDA 1NMGA 4A3EG 1K3RA 2YU9H 3RZOH 4APVA 1OXXK 2ZTCA 1OTCA 1Q81C 2AMCB 3ER0A 5M5YH 5IWAQ 3M85A 3HOYG 5LMUQ 4GLVB 4X66L 2XTIA 1YJ9A 5M5WH 4LF8Q 5LMNW 4UPAA 1VQOA 4AH6A 4DV7Q 1OXUA 4JC0A 1N34Q 1Q7YC 2UU9Q 1I6HH 3UDIA 4A3KG 4A3KH 2OQ0A 3CCLA 4K0KL 4YWMA 1L1OC 1CKMA 4C3IH 4JOIA 1IZ6A 4KHPL 4IOCA 1VQEA 3EBEA 3ULLA 4Y7NH 2IX0A 4WJ3M 3CP0A 3CW2C 1EYGA 1LTLA 1EFWA 4X66Q 5C4JH 1VQMA 2WB1E 2OWOA 2JA8H 1A63A 1S72A 1PA6A 1LYLA 1PYSB 1V43A 4DR3L 5DLQE 1BVSA 2CQOA 3W1GA 3S15H 3PO3H 4A3MG 2JE6I 4K0KQ 4A3DH 2AWOA 2DUDA 1HZAA 5IP7H 3RZDH 3TEHB 1N32L 3STBC 4KHPQ 2R7ZG 2B63G 2WFWA 1QUQB 3CC4A 4UY8C 2OTJA 4NXNL 1FVIA 1VQHA 2K4KA 3CC7A 1TWGH 1Z47A 1L0WA 1YIJA 4LFAL 3J81i 1RL2A 1XMQL 4JI3L 1YHAA 4A3GG 5FLXc 4B3TL 4R1JA 2K5VA 1VQIA 4DR3Q 1QUQA 3HKZG 2YTYA 4BY1G 1JB7A 3I4NG 5GAHC 2N78A 3HOUG 5IYBG 3HOUH 4GS3A 2JQOA 2ATWA 3PCOB 1N32Q 3AFQA 4R4IA 3MEFA 2HIVA 4A3BG 4DV5L 4NXNQ 2MFIA 4DK3C 5IT9c 3HKSA 1X6OA 4LFAQ 4X62L 4DR6L 4IOAA 4DV1L 1W2BA 4GNXA 1GO3E 1XMQQ 4JI3Q 1VQCA 4B3TQ 4JYAL 1IBML 1XNQL 4C3HH 3K8AA 4IPGA 2IY5B 4DR7L 4C3JH 1QZGA 1M90C 1IBKL 3RN2A 4IJLA 1I3QH 4YWKA 3RLFA 4JG2A 4DV0L 2JA5G 2NVTH 3HOVH 3ULJA 1XJVA 3RLOA 4GOPB 1I94L 3ULPA 1A0IA 4AYBG 4X62Q 4DV5Q 3I7FA 5IP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 Q;  2A8V A;  2OQK A;  3HOW H;  2Z6K C;  2UXB L;  3PUY A;  4JYA Q;  3A5Z B;  1IBM Q;  1NE3 A;  1XNQ Q;  4YHH L;  1XPO A;  4DR7 Q;  1WJJ A;  4QIW E;  3J81 c;  1KC8 C;  1LUZ A;  3CCS A;  1IBK Q;  1J5E L;  4LUV A;  3BU2 A;  1KD1 C;  1CSQ A;  4DV0 Q;  2PQA A;  4A93 H;  3RR5 A;  3M3Y H;  1I50 H;  1G29 1;  4HJ5 A;  4HJ9 A;  1I94 Q;  4OO1 G;  1S40 A;  4DR5 L;  4A3I H;  2E2H H;  1PYB A;  2K5H A;  4DUZ L;  2UXB Q;  2A1A A;  2PMZ E;  3RNU A;  3L2P A;  3UDX A;  4IFD G;  1QVF A;  2JA7 G;  4YHH Q;  4A3J G;  1Q82 C;  3AFP A;  4LF5 L;  2ID0 A;  1J5E Q;  4A3F H;  4X65 Q;  4YWL A;  2LXJ A;  1HNZ L;  2UUA L;  5C4X G;  2BH2 A;  3NBH B;  1EQQ A;  5M3F G;  1VQD A;  3BJU A;  3PV0 A;  4DR5 Q;  1IXR A;  1MIU A;  3KF8 B;  2AHO B;  4DUZ Q;  4JBM A;  3KDF B;  1HZ9 A;  2C35 B;  4J15 A;  2AKW B;  4HJ8 A;  1ASZ A;  3H0G G;  3S1N H;  3H0G H;  3TS2 A;  1AE2 A;  2QGQ A;  4LF5 Q;  4LF9 L;  1VQB A;  2DGY A;  1PH6 A;  4HIM A;  1WFQ A;  3J80 i;  2EXD A;  1K8A C;  4IPC A;  1VQ9 A;  5JJL A;  3L7Z C;  1VQF A;  2BA1 A;  1HNZ Q;  2UUA Q;  1VS0 A;  1BKB A;  2D62 A;  2PNH A;  4LWC A;  3CCR A;  5C0X G;  4BY7 H;  2MO0 A;  4DK6 C;  2RHS B;  2QEX A;  1PFS A;  1VQ5 A;  4DV7 L;  4RMF A;  4A3C G;  1SLJ A;  2N49 A;  4NXM L;  2IX1 A;  4YCU A;  1QVG A;  3ICE A;  1N9W A;  1B7Y B;  1YVC A;  2HIX A;  2NVY H;  1UWV A;  1XTD A;  1Y1V H;  4LF9 Q;  2VW9 A;  2ZJQ A;  4JBJ A;  3Q8D A;  2XGT A;  1M1K C;  2RCN A;  1BBU A;  4DR6 Q;  4Y52 H;  1CKN B;  1HH2 P;  2F52 A;  4LUZ A;  4KHZ A;  4POG A;  1OXT A;  4KLK A;  2CWA A;  3NEM A;  2KHJ A;  1VQ4 A;  2VQF L;  1N36 L;  5M3M H;  2JA9 A;  3J7A 5;  4NXM Q;  4OX9 L;  4L5R C;  1EUJ A;  1YZ6 A;  2JK8 A;  4JOI C;  5HGQ A;  2E5L L;  4YCW A;  3UE0 A;  3PUX A;  4QL5 A;  1G6P A;  1PHJ A;  2V1C C;  4IPH A;  2ES2 A;  2ZTE A;  4DAY B;  5C44 H;  2HT1 A;  4DR4 L;  1JMC A;  5HY6 A;  2JA6 H;  4JI1 L;  4AQY L;  2WB1 G;  2JA8 G;  1NBW A;  4MZ9 A;  3T1H L;  4BBS G;  1R9T H;  1X9N A;  3J80 c;  1X55 A;  3F8T A;  2ZM6 L;  2VQF Q;  1PH4 A;  2CWP A;  1N36 Q;  3KJP A;  1Q86 C;  4OX9 Q;  2AWN A;  3PO3 G;  2E5L Q;  4QY7 A;  3CC2 A;  1Q12 A;  2R7F A;  1VQ7 A;  4A3D G;  2YTV A;  2I5M X;  5IP7 G;  1L1O B;  4B3S L;  4JV5 L;  3IRB A;  4IFD J;  1HNW L;  4P71 A;  4L5T A;  3CCE A;  1YNX A;  4DR4 Q;  1GM5 A;  1X3G A;  3I4O A;  3LGJ A;  4JI1 Q;  4AQY Q;  3T1H Q;  1PV4 A;  1OXV A;  2ZM6 Q;  4DNI A;  4HJ7 A;  1K83 H;  1MJE A;  2Y0S E;  2K5N A;  2F4V L;  5C3E H;  3TRZ A;  2VZA A;  3SGI A;  4P73 A;  1Y14 B;  4PZ8 A;  2PI2 E;  4B3S Q;  3CAM A;  2JEA I;  4JV5 Q;  1HNW Q;  4QJF A;  5JEA G;  4GNX C;  2UXC L;  1V1Q A;  1KRS A;  4DPG A;  3M4P A;  4KI0 A;  3GD7 A;  5C0X J;  1YHB A;  1B8A A;  4PZ7 A;  2F4V Q;  1KIX A;  2ZJP A;  1JJ2 A;  1UEB A;  3KYH C;  4PG3 A;  3W5O A;  4JI7 L;  3HOV G;  4MTN A;  1T9H A;  4A3L G;  4A3L H;  5GAG C;  4P72 A;  1X54 A;  2CFM A;  1WCM H;  2ZJR A;  1HR0 L;  2UXC Q;  3HOW G;  1U0L A;  1HZB A;  1EQR A;  3GO5 A;  3K80 C;  1W3S A;  3E9H A;  4R4C A;  1JE5 A;  4JCV E;  4XIG S;  5H1S E;  1PH1 A;  3M4Q A;  1KQS A;  3H3V I;  3EIV A;  5FJ8 H;  2Q2H A;  2R7D A;  5GQO A;  3UDF A;  4H02 A;  3CCQ A;  4GOP A;  3NEL A;  4HID A;  1SFO H;  3U4Z A;  4A76 A;  2KHI A;  2ZTD A;  1WI5 A;  1NTG A;  1GVP A;  2JEB I;  4X65 L;  4A93 G;  2ASB A;  1XPU A;  4JI7 Q;  1E3P A;  1NY4 A;  3FKI H;  1KL9 A;  1GD7 A;  4LF6 L;  4NB3 A;  5BR8 L;  4A3I G;  3G4S A;  3I55 A;  1HR0 Q;  4OO1 I;  1YJN A;  4X6A H;  3J81 j;  1K0R A;  4IJH A;  4DR1 Q;  4GN4 B;  2Q2U A;  2I5L X;  5GAD C;  2LXK A;  3G6E A;  3E9I A;  4IFD I;  4R4Q A;  1Y1W G;  3A74 A;  4BBR G;  2NZH A;  4BBR H;  3HOX H;  1Y1W H;  3DM3 A;  2Q2T A;  2F3I A;  3K7U C;  4R4O A;  2VL6 A;  5IYC H;  1X65 A;  2KCT A;  3KLW A;  3I56 A;  1E22 A;  4A3F G;  1YI2 A;  3FP9 A;  3GTQ H;  4OXP A;  4MNO A;  3I4M H;  1FGU A;  3VDY A;  4LF6 Q;  4GLA C;  2E2J H;  2R92 H;  5BR8 Q;  1XNR L;  1SE8 A;  1DGS A;  4A75 A;  1FJG L;  3GTK H;  1D7Q A;  4JBK A;  3TQY A;  2K75 A;  1EOV A;  1XMO L;  4OWW B;  3KF6 B;  2R93 H;  3GTL H;  1QZH A;  4LUO A;  4QQB X;  1KXL A;  2HQL A;  3CMA A;  4JI2 L;  1PH5 A;  4P74 A;  4OWX B;  3CF5 A;  3KDF A;  1NJI C;  4O2D A;  3S1R H;  4RG1 A;  3PUZ A;  3PIP A;  4HIO A;  1ASY A;  3A5U A;  4BY7 G;  2KBN A;  1XNR Q;  3PF4 A;  1JJG A;  4C2M H;  3F2D A;  1TWF H;  4A4I A;  5C0X I;  4LNQ A;  1FJG Q;  1H95 A;  2D0O A;  5JEA J;  2VY3 A;  2WP8 J;  1KRT A;  1XMO Q;  4LFC L;  2GN5 A;  1Y1V G;  2YTX A;  5M5X H;  1YBY A;  3U4V A;  3RN5 A;  4JI2 Q;  4GN5 A;  4BA1 I;  4JI8 L;  4R4T A;  1AE3 A;  1GKH A;  4TVA B;  3ERS X;  4UP8 A;  3KOJ A;  4HJA A;  1N33 L;  3UDG A;  4DV2 L;  3HOZ H;  2NN6 G;  1X3E A;  5M3M G;  5IYD G;  5IYD H;  5FLM H;  3M7N A;  4DKA C;  1YEZ A;  4TQU S;  1CKN A;  4LFC Q;  4DR2 L;  1VQA A;  3AEV A;  4NPS A;  4OWT B;  4ALP A;  4B3M L;  4JI4 L;  2BH8 A;  4DUY L;  1NMF A;  1AH9 A;  5C44 G;  4JI8 Q;  3GTJ H;  4A3E H;  1HNX L;  4QGU A;  1TWH H;  1A8V A;  1IBL L;  3K0X A;  1BBW A;  2JA6 G;  1PH7 A;  1UE1 A;  1N33 Q;  2YV5 A;  1E1O A;  1TWA H;  3CPW A;  3PF5 A;  3HOY H;  5GRO A;  4DV2 Q;  4JI6 Q;  1A62 A;  3RLN A;  1E24 A;  1P16 A;  3S1M H;  3GTP H;  1TWC H;  4YCV A;  4UP7 A;  3PO2 G;  3PO2 H;  1KAW A;  2K14 A;  3BZC A;  2K50 A;  1J6Q A;  1JJC B;  4DR2 Q;  2L15 A;  4B3M Q;  3CPF A;  3WWV A;  4POF A;  1E1T A;  3K7A H;  1KHI A;  2MQH A;  5IY0 A;  3DLL A;  4DUY Q;  4GLX A;  1HR0 W;  4EQ5 A;  2N8N A;  1HZC A;  5GAE C;  1YHQ A;  2RF4 A;  1PH3 A;  1HNX Q;  3PSI A;  1IBL Q;  3S2D H;  1Q1B A;  2IHF A;  3M9B A;  4UP9 A;  4PMW A;  3CME A;  4LW1 A;  4JI5 L;  1YJW A;  3EN2 A;  4XTC S;  1L1O A;  3F1Z A;  3NEN A;  4DV3 L;  2FXQ A;  1IL2 A;  2Y0S G;  2ALY B;  5C3E G;  3CCU A;  1EIF A;  1VQ6 A;  4EX5 A;  1O7I A;  2I0Q A;  1EIY B;  2I5H A;  1LM0 A;  1UE5 A;  4LF7 L;  1Q46 A;  1WYD A;  2NZO A;  1B70 B;  4A3M H;  2VNU D;  3F2C A;  1MKH A;  5ELO A;  1Q8K A;  1SRO A;  2B3G A;  3KFU A;  4JI5 Q;  3S16 H;  1CSP A;  2A19 A;  2R7Z H;  2B63 H;  3S14 H;  4DV3 Q;  4L5S A;  4BA2 I;  4B3R L;  1X56 A;  2WAQ G;  3M4O H;  2VS1 A;  2WAQ E;  4A3G H;  1E7Z A;  1VQK A;  4YY3 L;  1VQ8 A;  4DV4 L;  2Z0S A;  3HKZ E;  4BY1 H;  5LMN L;  3I4N H;  4LF7 Q;  4DV6 L;  2Q2I A;  5IYB H;  2OCE A;  3D31 A;  3H15 A;  4GNX B;  1K73 C;  1WCM G;  2GVA A;  1K9M C;  3A0J A;  3FHW A;  3CCM A;  2H5X A;  1C0A A;  3GTM H;  3OTO L;  2JJQ A;  2IHE A;  4GOP C;  2NVX H;  1SRU A;  4WJ4 A;  4A3B H;  3S24 A;  4DR1 L;  5FJ8 G;  3MXN B;  2IT1 A;  4B3R Q;  3CCJ A;  3PUV A;  3G48 A;  5ELN A;  1V9P A;  2EQS A;  5J3B A;  2VQE L;  4DAM A;  1VQP A;  2KCM A;  1N8R C;  1X3F A;  4LF4 L;  2VUM G;  2VUM H;  4YY3 Q;  2E2I H;  4DV4 Q;  1VQJ A;  4X64 L;  5LMN Q;  3AQQ A;  2OTL A;  4HIK A;  3PGZ A;  4DV6 Q;  1U5K A;  3G71 A;  3FKI G;  1S3O A;  2GVB A;  1C7Y A;  2B29 A;  2CKZ B;  2PI2 A;  3OTO Q;  1PH2 A;  2JA5 H;  2UUC L;  1IYJ B;  2N3S A;  4AYB E;  3T1Y L;  1RIP A;  4BBS H;  1I5F A;  3L0O A;  5IP9 H;  2MO1 A;  3HFZ B;  3U58 A;  4O0A A;  1VCI A;  3PUW A;  3J7Z C;  3HOX G;  2VQE Q;  2UUB L;  4LF4 Q;  4L5Q A;  2NVQ H;  3H3V H;  5IYC G;  3AYH B;  2PQA B;  4OON A;  1YIT A;  3W1B A;  2Z6K A;  3D0F A;  4JBW A;  4X64 Q;  1CUK A;  3I4M G;  3JC6 6;  3JAM i;  1C9O A;  3I2Z A;  2HHH L;  1UE7 A;  2R6G A;  2R92 G;  3GDE A;  4FDB A;  3S2H H;  5AJ3 L;  3S17 H;  2UUC Q;  1MJC A;  2BA0 A;  3U50 C;  2MNA A;  3T1Y Q;  3STB D;  3CCV A;  1D8L A;  2R93 G;  2UUB Q;  3OYY A;  4GKK L;  1QVC A;  3GTO H;  3CXC A;  1TXY A;  4P75 A;  2JA7 H;  4A3J H;  2D0P A;  2K52 A;  1HJP A;  1Q1E A;  3K81 C;  5JJK A;  2UXD L;  3KF6 A;  3UE1 A;  2HHH Q;  4BXX G;  4BXX H;  5JJI A;  2LSS A;  4GKJ L;  1Z9F A;  5AJ3 Q;  1FL0 A;  5C4X H;  3B6Y A;  4LFB L;  5E7N A;  5M3F H;  4JI0 L;  5EAY A;  1K8G A;  1PVO A;  3TS0 A;  1VQL A;  3S1Q H;  4GKK Q;  2RHQ B;  4AIM A;  1OXS C;  1SMX A;  1VQG A;  3TRE A;  4ME3 A;  5IE8 A;  1SR3 A;  1XPR A;  3CD6 A;  3BZK A;  2UXD Q;  2E8G A;  2EIF A;  4IO9 A;  1P8L A;  5IWA L;  1PH9 A;  2CCZ A;  3F2B A;  3KJO A;  5LMU L;  4GKJ Q;  5K36 G;  3CQZ H;  4JI4 Q;  4JI6 L;  3GTG H;  3HOZ G;  3JAM c;  1L2F A;  5FLM G;  3OW2 A;  1SN8 A;  4LF8 L;  2NN6 I;  1G51 A;  3PIO A;  4LFB Q;  1VQN A;  4PZ6 A;  4JI0 Q;  2KEN A;  4GN3 B;  1JT8 A;  1EWI A;  3ZJY C;  1WOC A;  1N34 L;  2UU9 L;  4A3C H;  2YYZ A;  1UE6 A;  1PH8 A;  1CKO A;  3E0E A;  2QA4 A;  4IPD A;  1NMG A;  4A3E G;  1K3R A;  2YU9 H;  3RZO H;  4APV A;  1OXX K;  2ZTC A;  1OTC A;  1Q81 C;  2AMC B;  3ER0 A;  5M5Y H;  5IWA Q;  3M85 A;  3HOY G;  5LMU Q;  4GLV B;  4X66 L;  2XTI A;  1YJ9 A;  5M5W H;  4LF8 Q;  5LMN W;  4UPA A;  1VQO A;  4AH6 A;  4DV7 Q;  1OXU A;  4JC0 A;  1N34 Q;  1Q7Y C;  2UU9 Q;  1I6H H;  3UDI A;  4A3K G;  4A3K H;  2OQ0 A;  3CCL A;  4K0K L;  4YWM A;  1L1O C;  1CKM A;  4C3I H;  4JOI A;  1IZ6 A;  4KHP L;  4IOC A;  1VQE A;  3EBE A;  3ULL A;  4Y7N H;  2IX0 A;  4WJ3 M;  3CP0 A;  3CW2 C;  1EYG A;  1LTL A;  1EFW A;  4X66 Q;  5C4J H;  1VQM A;  2WB1 E;  2OWO A;  2JA8 H;  1A63 A;  1S72 A;  1PA6 A;  1LYL A;  1PYS B;  1V43 A;  4DR3 L;  5DLQ E;  1BVS A;  2CQO A;  3W1G A;  3S15 H;  3PO3 H;  4A3M G;  2JE6 I;  4K0K Q;  4A3D H;  2AWO A;  2DUD A;  1HZA A;  5IP7 H;  3RZD H;  3TEH B;  1N32 L;  3STB C;  4KHP Q;  2R7Z G;  2B63 G;  2WFW A;  1QUQ B;  3CC4 A;  4UY8 C;  2OTJ A;  4NXN L;  1FVI A;  1VQH A;  2K4K A;  3CC7 A;  1TWG H;  1Z47 A;  1L0W A;  1YIJ A;  4LFA L;  3J81 i;  1RL2 A;  1XMQ L;  4JI3 L;  1YHA A;  4A3G G;  5FLX c;  4B3T L;  4R1J A;  2K5V A;  1VQI A;  4DR3 Q;  1QUQ A;  3HKZ G;  2YTY A;  4BY1 G;  1JB7 A;  3I4N G;  5GAH C;  2N78 A;  3HOU G;  5IYB G;  3HOU H;  4GS3 A;  2JQO A;  2ATW A;  3PCO B;  1N32 Q;  3AFQ A;  4R4I A;  3MEF A;  2HIV A;  4A3B G;  4DV5 L;  4NXN Q;  2MFI A;  4DK3 C;  5IT9 c;  3HKS A;  1X6O A;  4LFA Q;  4X62 L;  4DR6 L;  4IOA A;  4DV1 L;  1W2B A;  4GNX A;  1GO3 E;  1XMQ Q;  4JI3 Q;  1VQC A;  4B3T Q;  4JYA L;  1IBM L;  1XNQ L;  4C3H H;  3K8A A;  4IPG A;  2IY5 B;  4DR7 L;  4C3J H;  1QZG A;  1M90 C;  1IBK L;  3RN2 A;  4IJL A;  1I3Q H;  4YWK A;  3RLF A;  4JG2 A;  4DV0 L;  2JA5 G;  2NVT H;  3HOV H;  3ULJ A;  1XJV A;  3RLO A;  4GOP B;  1I94 L;  3ULP A;  1A0I A;  4AYB G;  4X62 Q;  4DV5 Q;  3I7F A;  5IP9 G; 
#chains in the Genus database with same CATH topology
 5FLX E;  4DV1 Q;  2A8V A;  2OQK A;  3HOW H;  4FF3 A;  2B2V A;  3MXP A;  3HKZ B;  2JP1 A;  1XPO A;  4DR7 Q;  3PMF A;  2HCI A;  3HOU B;  3CCS A;  4F8M A;  2HUG A;  2HQE A;  3TP5 A;  3EQL C;  2A6H D;  3BU2 A;  1KD1 C;  4DV0 Q;  3E3X A;  1IW7 C;  1G29 1;  5EGT A;  1H9S B;  1EQV A;  3SE0 A;  1PTO C;  4DUZ L;  1JE4 A;  4RGN A;  3TBI B;  2B2W A;  1SNP A;  4C3H B;  2UXB Q;  4HMJ A;  5I4D A;  3UDX A;  1QVF A;  2JA7 G;  4YHH Q;  1HA6 A;  4FXG C;  3J7Y W;  1J5E Q;  1JOK A;  3HOV B;  4YWL A;  1RTN A;  1HNZ L;  4AYB B;  5K5P A;  2UUA L;  1HQM C;  1EQQ A;  1VQD A;  1IXR A;  1IYV A;  2K03 A;  4JBM A;  4CDD C;  1ASZ A;  4XYQ A;  3TS2 A;  1KAB A;  1AE2 A;  2QGQ A;  2DGY A;  1BCP C;  3KF8 A;  3SK8 A;  4HIM A;  1RJT A;  1WFQ A;  1K8A C;  3X3M A;  1I50 B;  2OF1 A;  3M3Y B;  2D62 A;  4HSP A;  1WTP A;  4LWC A;  2WKD A;  5C0X G;  5C0X H;  4DK6 C;  2QEX A;  3CRL C;  2IX1 A;  1YVC A;  2XNA C;  1UWV A;  2CW0 C;  2ZJQ A;  2F0H A;  4JBJ A;  2XGT A;  3I73 A;  2NYZ D;  2RCN A;  5C4X B;  4Y52 H;  1EZ8 A;  2F52 A;  1STN A;  1UNS A;  1EWC A;  4KHZ A;  1OXT A;  5IOD A;  2KHJ A;  2JN4 A;  1N36 L;  2JA9 A;  2LS0 1;  3J7A 5;  4HED A;  4JOI C;  2JK8 A;  4YIJ A;  3UE0 A;  3PUX A;  2SNS A;  4IPH A;  1F9S A;  2ZTE A;  5C44 H;  2AQ3 B;  2HT1 A;  2EPB A;  1I4Q A;  2WB1 G;  1DM0 B;  2JA8 G;  1NBW A;  5EPK A;  5IGG A;  3T1H L;  1ET6 A;  1R4Q B;  2K5W A;  4MHE A;  2AUK A;  2VQF Q;  1QJO A;  1PH4 A;  2CWP A;  3NWT A;  4OX9 Q;  1Y1V B;  2A6H C;  4QY7 A;  3EJI A;  5IOC A;  3BVG A;  1HNW L;  1XWE A;  2FJ2 A;  2JSO A;  2ENB A;  1QWY A;  3I4O A;  3LGJ A;  3LWE A;  4JI1 Q;  3UI2 A;  1LT3 D;  3SR1 A;  2ZM6 Q;  4HJ7 A;  3HRZ C;  1K83 H;  2Y0S E;  3KLS X;  2VZA A;  2QDB A;  5IGC A;  2NB0 A;  3I8Z A;  3R3O A;  1S4Z A;  4JV5 Q;  2FFK B;  5CBA E;  2BE5 C;  1O7Z A;  4QJF A;  4HSV A;  4ID6 A;  3NTI A;  5I2X A;  3OIQ A;  4DPG A;  5KRU A;  2MGS A;  1S5D D;  1OO9 B;  4KI0 A;  2EDG A;  3GD7 A;  1YHB A;  2F3W A;  4R9W A;  5JVH 3;  3M7G A;  1JJ2 A;  1UEB A;  4A3L G;  4A3L H;  4MTN A;  2KA7 A;  1LAC A;  3A8K E;  4P72 A;  4IUT A;  5G3L F;  5GAG C;  1X54 A;  5C5L A;  1IL8 A;  1HR0 L;  1IYU A;  2K6A A;  1U0L A;  4EQP A;  3J7A V;  1F2L A;  4R4C A;  4XIG S;  1PH1 A;  2LKV A;  5C3E B;  2R7D A;  3UDF A;  5GQO A;  3NEL A;  4A76 A;  4B08 A;  1QNK A;  2ZTD A;  1JWU D;  2ASB A;  5IGE A;  4A3I G;  3J81 j;  5C6A A;  4IJH A;  1L0X B;  4DR1 Q;  5GAD C;  3OWF A;  3R2T A;  2KEE A;  2J0T D;  3A74 A;  2NZH A;  1B9N A;  2L9H A;  4R4Q A;  1EEI D;  4R4O A;  5IGF A;  2KCT A;  2ZXP A;  1TS5 A;  2NVT B;  3FP9 A;  4MNO A;  3BS1 A;  1FGU A;  2EYM A;  1WVL A;  3VDY A;  3C3L A;  2NTT A;  5CV9 A;  1Z7T A;  2R92 H;  3NP8 A;  3WOF A;  4A75 A;  1AP0 A;  3GTK H;  4KD3 A;  3RZO B;  3TQY A;  1XMO L;  1GJX A;  4X3K A;  4TKO B;  3H3V C;  4QQB X;  3MXU A;  4JI2 L;  1PH5 A;  1KLG D;  4Q0F A;  4H13 C;  3S1R H;  3PUZ A;  3A5U A;  4E6I A;  4XT3 B;  1JJG A;  3F2D A;  1TWF H;  3P20 A;  5COR A;  4LNQ A;  1Q90 A;  5CV7 A;  5JEA J;  5JAV A;  1EY9 A;  1FJG Q;  1H95 A;  2R61 A;  2WP8 J;  4FNF A;  1IHZ A;  2DJF C;  4BA1 I;  5FLX L;  4XYO A;  2C5C A;  3GTQ B;  1GKH A;  4TVA B;  2E2J B;  3UDG A;  5K36 H;  3NPP A;  4ZUJ A;  3VYU A;  4DV2 L;  2RKS A;  5EPL A;  1BNZ A;  1MBY A;  3QO2 A;  1ONL A;  5M9O A;  4LFC Q;  2L4N A;  2BH8 A;  3D3R A;  4O42 A;  2L11 A;  3GTJ H;  3HZX A;  1TWH H;  1IBL L;  1QCB D;  3PF5 A;  1TWA H;  1HFG A;  2H4O A;  3RLN A;  3S1M H;  4XQQ A;  2K14 A;  2PO4 A;  1J6Q A;  1HHV A;  4IUN A;  3DLL A;  1HR0 W;  4DUY Q;  4GLX A;  5GAE C;  2DY8 A;  4ZKB B;  1Q1B A;  2IHF A;  3M9B A;  4UP9 A;  3VYR A;  2Z1C A;  3NEN A;  4DV3 L;  5CYU A;  3CCU A;  4LMQ D;  4EX5 A;  1O7I A;  1LM0 A;  1HPC A;  1Q46 A;  1WYD A;  4V19 0;  4EGV A;  3F2C A;  5LL6 X;  5ELO A;  1Q8K A;  3KFU A;  3T53 B;  2B63 H;  4XQJ A;  3QR8 A;  3PO2 B;  2O2L D;  1X56 A;  2WAQ G;  4N9T A;  4BY1 H;  2PNR C;  3G7L A;  3D31 A;  3OTO L;  1SRU A;  4A3B H;  4U68 A;  4CKE A;  5FJ8 G;  3MXN B;  5I6W A;  3AU7 A;  1HXY D;  1I4X A;  4KTA A;  4YY3 Q;  3ITP A;  5ELB A;  1S3O A;  2UUC L;  1IYJ B;  1I5F A;  1R4P B;  5IP9 H;  2MO1 A;  1VCI A;  3HOX G;  2VQE Q;  4L5Q A;  3AYH B;  1X3Q A;  3I4M G;  1J9O A;  1GUG A;  3KUP A;  3AMU A;  2HHH L;  1UE7 A;  3TME A;  2EYJ A;  3P1H A;  3RD4 A;  1MJC A;  2R93 G;  3OYY A;  1QVC A;  1SAP A;  1VF5 C;  5IGD A;  2M00 A;  5D14 A;  2UXD L;  1H9K A;  1SJH D;  3MC0 B;  2IX3 A;  5JJI A;  1LT6 D;  4HMI A;  5C4X H;  1B3Q A;  5CGK A;  1KDC A;  1T5X D;  1K8G A;  2L0C A;  3S1Q H;  4GKK Q;  1SND A;  2G9H D;  1OXS C;  3OPO A;  2F03 A;  1SR3 A;  3CD6 A;  2E8G A;  1PH9 A;  2CCZ A;  1MD2 D;  2GA4 B;  3S17 B;  4JI6 L;  2NN6 I;  1GUT A;  4QMG A;  1VDZ A;  4JI0 Q;  4NP5 A;  4GN3 B;  1JT8 A;  1EWI A;  1ML0 D;  1UE6 A;  2JA7 B;  4OIJ A;  3IKJ A;  1M4V A;  4A3E G;  2F0L A;  1TII D;  1OXX K;  2G9D A;  4APV A;  1Q81 C;  1OTC A;  3M85 A;  1DOM A;  3HOY G;  5LMU Q;  4GLV B;  1EQT A;  2A68 D;  3QOJ A;  4CHT B;  1Q7Y C;  3HP3 A;  3UDI A;  5I6Y A;  1B50 A;  4PMB A;  1VQE A;  4ZAI A;  3ULL A;  4CDF C;  2IX0 A;  3GTG B;  3DEP A;  3CW2 C;  4X66 Q;  5C4J H;  1VQM A;  2WB1 E;  2K33 A;  3IAY A;  1PYS B;  2KHS A;  1V43 A;  2K7V A;  1BVS A;  3VR3 A;  1HZA A;  3RZD H;  5E1F A;  2KQ3 A;  2R7Z G;  1JOR A;  1QUQ B;  1F9R A;  4UY8 C;  2OTJ A;  1STH A;  1VQH A;  2K4K A;  5M5W B;  3KLS A;  1Z47 A;  3J81 i;  2QCP X;  1EIH A;  4JI3 L;  4A3G G;  3OMC A;  3I91 A;  4B3T L;  3OSO A;  1RTO A;  1SYG A;  1EY7 A;  3I4N G;  4GS3 A;  3PCO B;  4QCL A;  3MEF A;  2WB1 B;  4X62 L;  4DK3 C;  5IT9 c;  3HKS A;  2JA8 B;  1XMQ Q;  1VQC A;  3BYY B;  1XNQ L;  2MJ8 A;  2DNE A;  3MWY W;  4TRD A;  3URY A;  2B2Y A;  4A3M B;  3MXN A;  3KBG A;  1LLR D;  1IBK L;  4IJL A;  1O78 A;  3RLF A;  3S16 B;  4JG2 A;  2EJF C;  4QUF A;  2F0U A;  2JA5 G;  2NVT H;  1XJV A;  2IL8 A;  3RLO A;  3L9A X;  4GOP B;  4IZ8 A;  4DV5 Q;  1PRT F;  4DR6 Q;  4KK7 A;  4JYA Q;  3A5Z B;  3K0Y A;  4XXE A;  3W3A A;  1WJJ A;  2L55 A;  2H1E A;  1NCV A;  2Q8R E;  3C2P A;  2A68 C;  3GTM B;  1MGS A;  1KNA A;  4LUV A;  1CSQ A;  2CH4 A;  1WD0 A;  4A93 H;  2NVX B;  3QIA A;  1I94 Q;  4OO1 G;  1S40 A;  1EU3 A;  1ILP A;  4DR5 L;  4CJ1 B;  1PYB A;  2A1A A;  1KLU D;  3RNU A;  3L2P A;  1LTT D;  4RKB A;  1Q82 C;  5HUR A;  3AFP A;  1O7Y A;  1BQQ T;  3A56 A;  2ID0 A;  4WFN 3;  1SDF A;  4BBS B;  3NBH B;  1E2V A;  4CDE C;  3BJU A;  4DXG A;  1WD1 A;  2NVQ B;  1MIU A;  3KF8 B;  1JIC A;  5EKL A;  3KDF B;  1HZ9 A;  5EKK A;  4F7X A;  2AKW B;  4LF5 Q;  4ZKC B;  1LO5 D;  1ESF A;  5JJL A;  1VQF A;  1STB A;  4A3I B;  3CCR A;  2O4X A;  2RHS B;  1VQ5 A;  5E3F A;  3VA7 A;  4DV7 L;  4RMF A;  1SLJ A;  2N49 A;  4A3J B;  1QVG A;  3ICE A;  3K6O A;  2PW7 A;  4LF9 Q;  2QDL A;  1QIL A;  3LX0 A;  1CQF A;  1H9M A;  1LT4 D;  3WOE A;  1CKN B;  4RGO S;  5ELF A;  5AFW A;  3NEM A;  3AB9 A;  4NMZ A;  5CR3 A;  2NN6 H;  5M3M H;  3MVV A;  4NXM Q;  3H0G B;  3SK6 A;  4XQN A;  2D2C C;  1EUJ A;  1YZ6 A;  2CHB D;  4QL5 A;  1G6P A;  1PHJ A;  2ES2 A;  1SYD A;  4RCO A;  3I4L A;  2L1B A;  4OL7 A;  3T13 A;  5IGB A;  3JAM E;  1STY A;  1WTH A;  3ERO A;  2B2U C;  3J80 c;  3F8T A;  3NE5 B;  1PFN A;  4DAY A;  4DFA A;  3PO3 G;  2E5L Q;  3CC2 A;  2R7F A;  2WKC A;  2F0I A;  2YTV A;  5IP7 G;  2ICI A;  1B9M A;  1RD9 D;  4DR4 Q;  1GM5 A;  1X3G A;  5DM6 3;  2Q8I B;  4AQY Q;  1PV4 A;  2VB2 X;  1G91 A;  2D9U A;  1EY4 A;  4P73 A;  4B3S Q;  1LTB D;  4Y7N B;  5BN4 A;  5JEA G;  4GNX C;  1R9T B;  3DUZ A;  1V1Q A;  1KRS A;  3J80 E;  5D3D A;  1A6X A;  1Y8N B;  3M4P A;  4F87 A;  2BDO A;  2F4V Q;  1B8A A;  4PZ7 A;  2ZJP A;  4K8J A;  4PG3 A;  3W5O A;  2XRS D;  4JI7 L;  2DJG C;  5C3X A;  1WCM H;  2UXC Q;  2HD3 A;  3HOW G;  1HZB A;  2NBF A;  3SXH A;  1KQS A;  1UEA B;  4N9P A;  1BXT A;  2Q2H A;  3U9O A;  3CCQ A;  4GOP A;  1SNQ A;  1SFO H;  5IIF A;  4HID A;  3SDZ A;  3U4Z A;  4L8J A;  3FVQ A;  1WI5 A;  1NTG A;  4X65 L;  1XPU A;  1E3P A;  4LF6 L;  3SK5 A;  4NB3 A;  5BN5 A;  3G4S A;  3I55 A;  1PXU A;  4FXK C;  2J7Z A;  4C3J B;  4FF4 A;  2LXK A;  3G6E A;  4IFD I;  4UAI A;  2AUJ D;  2RSO A;  2Q2T A;  5IYC H;  1PTO F;  3KLW A;  3TP8 A;  2IWH A;  1WTX A;  5CV5 A;  1EWH A;  5BR8 Q;  1SE8 A;  1XNR L;  2BE5 D;  3MHB A;  1PTO B;  4JBK A;  5JJZ A;  1D5Z C;  2F0M A;  2K75 A;  1EOV A;  2X6L A;  3NBH A;  1KXL A;  1CI3 M;  2ZXO A;  5A35 A;  3CF5 A;  5DM7 3;  4CGY B;  3KDF A;  3MFG A;  1NJI C;  3C1F A;  2F0D A;  1SEB D;  1SXT A;  1ASY A;  2KBN A;  2EY6 A;  3D6W A;  3HS0 C;  1HRJ A;  4A4I A;  3GQB A;  2VY3 A;  2WII B;  4DA2 A;  3SK4 A;  1Y1W B;  4BBR B;  2GN5 A;  2YTX A;  3H09 A;  5M5X H;  3IL8 A;  1YNJ D;  1BCP B;  4A3F B;  4LAA A;  3I4M B;  4JI8 L;  4R4T A;  5C4Z A;  4HJA A;  5G3L D;  4ZQ3 A;  3CU7 A;  3HOZ H;  1X3E A;  2B8F A;  4RWS C;  5IYD G;  2SNM A;  1STA A;  5FLM H;  4H44 C;  3S1N B;  5IYD H;  3OWE B;  2R93 B;  1CKN A;  1MI2 A;  2F4I A;  1K8O A;  3AEV A;  4NPS A;  4OWT B;  4ALP A;  4JI4 L;  4KJN A;  4FXD A;  1AH9 A;  1NMF A;  5C44 G;  5LHY 1;  1HFN A;  1BBW A;  1PH7 A;  1UE1 A;  1N33 Q;  4BY7 B;  2YV5 A;  1E1O A;  4C2M B;  1B1Z A;  1EY5 A;  4JI6 Q;  3BVM A;  1E24 A;  2NVY B;  1EEF D;  1KAW A;  2QKI C;  2K50 A;  1JJC B;  4DR2 Q;  4HN7 A;  2L15 A;  2D5D A;  4B3M Q;  2L12 A;  1O7L A;  1HNX Q;  5E4W C;  1HZC A;  1DCZ A;  4ODG A;  5KND A;  3CME A;  4XTC S;  2EOT A;  2FXQ A;  3A8I E;  3A7A B;  5FO9 B;  2ALY B;  2A69 D;  3VYS A;  3V96 A;  2Z9H A;  5KIX A;  2JA6 B;  4A3M H;  2VNU D;  1MKH A;  4JI5 Q;  3S16 H;  1CSP A;  2A19 A;  3R93 A;  3FDT A;  5BN3 A;  3GTP B;  3NBI A;  3R8B A;  2VS1 A;  1E7Z A;  1C4Q A;  3K7A B;  1PMR A;  2E76 C;  4LF7 Q;  2K05 A;  3S2D B;  1EYA A;  1D6E C;  1K9M C;  3FHW A;  3CCM A;  1C0A A;  3GTM H;  2O5J C;  2IHE A;  2NVX H;  3NQI A;  1ESR A;  1YNJ C;  1C48 A;  2Y0S B;  4B3R Q;  5ELN A;  5KNC A;  3JAM L;  4LF4 L;  4MTK A;  5J3B A;  3K5M A;  4G57 A;  1Y69 U;  4IUR A;  1N8R C;  2VUM G;  3TSS A;  4JPB W;  1ENA A;  2VUM H;  2E2I H;  4DV4 Q;  3V2T A;  5LMN Q;  4DV6 Q;  5JOB A;  1C7Y A;  2CKZ B;  3SEB A;  2R7Z B;  1GUS A;  3S14 B;  3C1E A;  2F1M A;  4BBS H;  1GOZ A;  4A3G B;  1DYQ A;  3A8J E;  2NVQ H;  2PQA B;  3I4N B;  3W1B A;  4RFB A;  4X64 Q;  1TS3 A;  2J4X A;  3JAM i;  3IFD A;  2R92 G;  2X6G A;  3GDE A;  1SNC A;  4FDB A;  3S2H H;  1D1K A;  5AJ3 L;  1EFI D;  2BA0 A;  3T1Y Q;  1CA6 A;  3STB D;  2MUY A;  2UUB Q;  1BF4 A;  3GTO H;  3CXC A;  3J80 L;  4A3J H;  2RQX A;  2K52 A;  1HJP A;  3FKI B;  1ZYR D;  1SE2 A;  1UUP A;  1WTO A;  2JA5 B;  4GKJ L;  1F9P A;  1FL0 A;  2NTS A;  2A69 C;  1WTW A;  3NSW A;  5E7N A;  5M3F H;  1T5E A;  1PVO A;  2RHQ B;  4ZLT F;  2I46 A;  3TRE A;  5ELC A;  2K01 A;  4IO9 A;  1PZI D;  5FKA C;  1SSO A;  4NKL A;  5K36 G;  3CQZ H;  2ZXR A;  3GV6 A;  3J7A F;  3MAQ A;  5EJW A;  1G51 A;  2B8G A;  4LFB Q;  4PZ6 A;  2KEN A;  4JK1 C;  4A3C H;  2YYZ A;  2F0N A;  2YU9 H;  3ER0 A;  5M5Y H;  5IWA Q;  1M8A A;  2QF7 A;  1H9R A;  5T1G A;  4LF8 Q;  4UPA A;  1QNU A;  3I3C A;  4DV7 Q;  1OXU A;  4JC0 A;  3Q23 A;  1N34 Q;  2UU9 Q;  4FF2 A;  1F2M A;  3DEO A;  1L1O C;  4C3I G;  4C3I H;  4JOI A;  4EQO A;  1JB3 A;  4KHP L;  4Y7N H;  3DWA A;  1EYG A;  2A5H A;  1A63 A;  1S72 A;  1FYC A;  4DR3 L;  2MHV A;  4M8A A;  4ULL A;  3O13 A;  1ZXT A;  4K0K Q;  4A3D H;  2DUD A;  3STB C;  2B63 G;  2WFW A;  4NXN L;  1FVI A;  3CC7 A;  1TWC B;  1L0W A;  1YIJ A;  3M4Y A;  4CKB A;  1I6H B;  2K5V A;  4KHV A;  1ZYR C;  3HKZ G;  4BY1 G;  1JB7 A;  5FK9 C;  4A3K B;  2EYF A;  2F0P A;  3HOU G;  3HOU H;  4I7A A;  1JC7 A;  2SEB D;  2JQO A;  2ATW A;  1HTL D;  1N32 Q;  3AFQ A;  4R4I A;  4QB4 A;  4A3B G;  2MFI A;  1RHP A;  4LFA Q;  4DV1 L;  5JPN C;  2NUC A;  1S5B D;  4C3H H;  3K8A A;  4DR7 L;  3PO3 B;  3KLR A;  4C3J H;  1KDB A;  1M90 C;  3A54 A;  4YWK A;  4DV0 L;  3HOV H;  3ULP A;  4AYB G;  3CMA A;  1Q3L A;  4M1U B;  5IP9 G;  2UXB L;  2Z6K C;  5CMD A;  3HGB A;  1IBM Q;  1NE3 A;  4YHH L;  4QIW E;  1KC8 C;  1LUZ A;  1I4P A;  1J5E L;  4KN7 C;  1B3A A;  2PQA A;  1SE4 A;  1A3T A;  3M3Y H;  1I50 H;  4RKL A;  4KJO A;  2K5H A;  1F9Q A;  2B2T C;  2PMZ E;  2SOB A;  1EOT A;  4OGQ C;  1ICW A;  4DK0 A;  3NUC A;  1I3Q B;  1DJR D;  5EBD A;  4A3F H;  5NUC A;  4X65 Q;  3P7J A;  5C4X G;  2BH2 A;  3HOW B;  1HUM A;  3PV0 A;  4DUZ Q;  2AHO B;  1Y8P B;  2QIL A;  4ZRZ A;  4C1N I;  3S1N H;  3VYT A;  4QIW B;  4K14 A;  2XWJ B;  2EXD A;  4IPC A;  4CJ0 B;  1VQ9 A;  1A3U A;  3DHQ A;  2BA1 A;  1HNZ Q;  2UUA Q;  1Z6H A;  4OEM B;  1JWS D;  1BKB A;  4BY7 H;  1TY2 A;  2MO0 A;  1PFS A;  2EJG C;  4YCU A;  1CFM A;  1B7Y B;  3NTH A;  2NVY H;  1Y1V H;  4TSS A;  2V4D A;  2C9O A;  3Q8D A;  1M1K C;  4K6L A;  4Z9C B;  1FD7 D;  1HH2 P;  4LUZ A;  4POG A;  1PRT D;  2CWA A;  3E5S A;  1VQ4 A;  2VQF L;  4OX9 L;  5HGQ A;  4WRD A;  3K58 A;  2RCF A;  2V1C C;  1A15 A;  1BUV T;  4PQX A;  4DAY B;  1II3 A;  5HY6 A;  3SHL A;  1AW7 A;  4JI1 L;  2JA6 H;  3FEW X;  4DGZ A;  4DN4 M;  1X9N A;  2K5D A;  4XT1 B;  1X55 A;  2ZM6 L;  2NWG A;  1N36 Q;  4KMU C;  3KJP A;  4OIK A;  1Q86 C;  2AQ2 B;  2AWN A;  1VQ7 A;  2I5M X;  4JV5 L;  1TU2 B;  4IFD J;  3ONA B;  4P71 A;  3I72 A;  2WV6 D;  3PIP 3;  1W6K A;  3T1H Q;  1NNX A;  1SJE D;  1OXV A;  3C46 A;  5I9P A;  3H94 A;  2K5N A;  3FRP B;  5C3E H;  3TRZ A;  2K5Q A;  5D3I B;  4PZ8 A;  1IKL A;  5C44 B;  1HNW Q;  2F0F A;  1JQY D;  1XYI A;  2F0S A;  2G5D A;  4Q5V A;  3K5N A;  1KAA A;  3S15 B;  5C4H A;  2M9V A;  1E2W A;  1PZK D;  3T4A C;  3KYH C;  4CKC A;  1TWG B;  1U4L A;  2B2V C;  2CFM A;  5KEE A;  2ZJR A;  4MN3 A;  1EQR A;  4J8Q A;  1AFP A;  3K80 C;  3E9H A;  4MIU A;  1K83 B;  3RZO H;  4ZUI A;  4J6H A;  1I6V C;  3ERQ A;  1NSN S;  2HDM A;  1GVP A;  2E2D C;  2JEB I;  1PRT C;  1HUN A;  1F2Y A;  4A93 G;  5IT9 E;  3FKI H;  1KL9 A;  1GD7 A;  2B2W C;  1VMC A;  2TSS A;  1HR0 Q;  2EY5 A;  1K0R A;  4FP5 D;  2EY1 A;  1CM9 A;  3NK9 A;  3E9I A;  2I07 B;  4X3U A;  2VL6 A;  1YI2 A;  2AQ1 B;  3GTQ H;  2ICE C;  4G7Z C;  3I90 A;  2E2J H;  1EL0 A;  1FJG L;  1D7Q A;  1NR4 A;  2JYO A;  3RMH A;  1B2T A;  4OHJ A;  2MPM A;  1AN8 A;  1QZH A;  4LUO A;  2EE1 A;  1JWM D;  2B2T A;  1GXD C;  1E0B A;  4RG1 A;  2RSN A;  4K5W A;  3TP6 A;  2E2H B;  5KGU A;  5KNB A;  5C0X I;  1S5E D;  3D4W A;  1KRT A;  1XMO Q;  4LFC L;  4WOR A;  1YBY A;  4DNR B;  3U4V A;  1K0S A;  4K2K A;  4RGM A;  4JI2 Q;  3H91 A;  4NW2 A;  1AE3 A;  1EY6 A;  3PQI A;  3ERS X;  1SYF A;  4UP8 A;  4QF4 A;  1K28 A;  4HR7 B;  3GTK B;  5T1I A;  4HCE A;  2NN6 G;  5M3M G;  2Z8L A;  4DKA C;  4TQU S;  1DOL A;  4FYD A;  2K04 A;  1DOK A;  1SE3 A;  2EYL A;  2RDF A;  4DUY L;  3S1R B;  4QGU A;  1H9J A;  3T56 B;  1TWF B;  1MSG A;  5GRO A;  3TZU A;  4DV2 Q;  4KD4 A;  3CKI B;  1TWC H;  4UP7 A;  3PO2 G;  3PO2 H;  1RF2 D;  3BZC A;  3KK7 A;  1VF7 A;  1DXM A;  3CPF A;  3WWV A;  1E1T A;  5IY0 A;  1YHQ A;  1PH3 A;  1IBL Q;  1CA5 A;  1MSH A;  4L63 B;  2RDH A;  3F1Z A;  4J1M A;  1WTQ A;  1V1P A;  1S5C D;  3BDO A;  1AEX A;  4EQN A;  1NUC A;  4S3S A;  2I5H A;  3GTJ B;  1TWH B;  1B70 B;  2XRQ D;  4KY7 A;  3G6J B;  1TWA B;  1SRO A;  2Q8T A;  3QJY A;  1ZEQ X;  4DV3 Q;  4L5S A;  2WAQ E;  1PLF A;  1VQK A;  4YY3 L;  2OEO A;  2Z0S A;  3HKZ E;  4FVM A;  3P75 A;  3V05 A;  2Q2I A;  1B44 D;  5IYB H;  2OCE A;  3H15 A;  4GNX B;  1O80 A;  1WCM G;  2GVA A;  1K73 C;  3A0J A;  2H5X A;  5KYI A;  2PW5 A;  4ILW A;  4WJ4 A;  2EXZ A;  1CT1 D;  2N88 A;  3S24 A;  5JVG 3;  2IT1 A;  4B9X A;  3CCJ A;  2OT2 A;  3G48 A;  1V9P A;  3U9S A;  2VQE L;  1VQP A;  1X3F A;  2OXP A;  2Z4I A;  3BYT B;  1VQJ A;  1SMY D;  4LK1 C;  3AQQ A;  1LV9 A;  2OTL A;  4HIK A;  2F0G A;  3PGZ A;  1B53 A;  2B29 A;  1EYC A;  1ENC A;  5F2D A;  3OTO Q;  5LL6 S;  1PH2 A;  1LT5 D;  4X3S A;  2N3S A;  4IQZ A;  4AYB E;  1RIP A;  2PYK A;  2WAC A;  3L0O A;  3U58 A;  2KJX A;  2WAQ B;  3HFZ B;  4O0A A;  3PUW A;  3J7Z C;  1EZ6 A;  1J8I A;  1JOQ A;  1FR3 A;  4H0L C;  5IYC G;  4BY1 B;  1YIT A;  3D0F A;  1TS2 A;  3I2Z A;  3Q22 A;  2PQE A;  1U4R A;  3GV3 A;  4A3B B;  3S17 H;  2UUC Q;  3MFY A;  1JCK B;  1D8L A;  3CCV A;  2E75 C;  1HQR D;  2N55 A;  2K32 A;  4GKK L;  2F0V A;  1NAP A;  1TXY A;  4P75 A;  3ZYY X;  2JA7 H;  3K81 C;  2D0P A;  4X3T A;  3UE1 A;  2HHH Q;  4O1N A;  4BXX G;  4BXX H;  1PFM A;  3Q6S A;  1G2T A;  1BCP F;  2IW3 A;  5E4X A;  3B6Y A;  4JI0 L;  2EZV A;  3HOX B;  4K6D A;  3TS0 A;  1VQL A;  1G8Z D;  1IKM A;  2L5T A;  1SMX A;  1VQG A;  2Z4H A;  4ME3 A;  5IE8 A;  2UXD Q;  1P8L A;  3T16 A;  3EVQ A;  3F2B A;  3KJO A;  5LMU L;  3HOZ G;  3GTG H;  1ROD A;  4R8N A;  5FO7 B;  5FLM G;  3OW2 A;  2FIN B;  3GTL B;  5IT9 L;  2PZU A;  3ZJY C;  1CKO A;  3E0E A;  3QB3 A;  5J22 A;  4IUU A;  2ZTC A;  2DN8 A;  2AMC B;  5ELE A;  1MHW C;  2LFN A;  1WTR A;  4X66 L;  2XTI A;  1YJ9 A;  4K5V A;  5M5W H;  5KYL A;  1B4O A;  1SMY C;  4AH6 A;  3S1Q B;  4DF7 A;  3DMU A;  3DWP A;  5CV6 A;  5C3W A;  2BCO A;  3FPU B;  4RA8 A;  2OQ0 A;  3VR6 A;  4YWM A;  1CKM A;  2PZT A;  1IZ6 A;  3EBE A;  1TKW B;  1EFW A;  1LTA D;  1QB5 D;  2JA8 H;  3X3N A;  1PA6 A;  1LYL A;  4KN4 C;  3VR5 A;  2B2U A;  3WDN A;  5DLQ E;  1FNU A;  4KKS A;  4A3E B;  3S15 H;  3QOL A;  4A3M G;  2JE6 I;  1EIG A;  3TEH B;  1KDA A;  3HOY B;  3CC4 A;  1TWG H;  1YNN D;  5FO8 B;  1XMQ L;  4R1J A;  1VQI A;  3HG9 A;  2E74 C;  4H7B A;  1GHK A;  3ND8 A;  4RHR A;  2A6E D;  2KED A;  1GUN A;  2HIV A;  1STE A;  5C4J B;  1BO0 A;  4DV5 L;  1X6O A;  4DR6 L;  5A2Q L;  4GNX A;  3FPP A;  4JI3 Q;  4IUV A;  4JYA L;  4B3T Q;  4IPG A;  2HCC A;  2BDN A;  3RZD B;  1SNO A;  3ULJ A;  2F0T A;  2DY7 A;  1I94 L;  4X62 Q;  1TS4 A;  1EIY B;  4BBS G;  3I7F A;  1U4P A;  1EU4 A;  3VR4 A;  2MP1 A;  3M4O B;  4JW0 A;  4B9W A;  3D4R A;  3PUY A;  1XNQ Q;  3T51 B;  4HCS A;  3J81 c;  2ZT9 C;  2F0Q A;  1IBK Q;  4FF1 A;  2KCN A;  3TP7 A;  3RR5 A;  3MXG A;  4HJ5 A;  4HJ9 A;  4A3I H;  2E2H H;  3NQT A;  1NR2 A;  2F0K A;  5I2Y A;  1WTV A;  4IFD G;  4IFD H;  2EVB A;  4A3J G;  1RCV D;  3W2D A;  4LF5 L;  1H9S A;  4DK1 A;  2K1B A;  3MTS A;  5DNF A;  1CQV A;  2LXJ A;  1F77 A;  5M3F G;  4DR5 Q;  1F2Z A;  2EYO A;  3OIP A;  4HAE A;  4F88 A;  3LWU A;  4J15 A;  2C35 B;  2KEC A;  4HJ8 A;  3H0G G;  3J81 E;  3H0G H;  3HEJ A;  4NDX A;  4BWG B;  4LF9 L;  1PYW D;  4OEL B;  1VQB A;  5CV8 A;  1PH6 A;  3J80 i;  4A93 B;  1YNN C;  3EFX D;  3L7Z C;  3TZD A;  1VS0 A;  1G2S A;  2PNH A;  5EKI A;  4G7O C;  4A3C G;  3NHH A;  2A6E C;  4NXM L;  1N9W A;  3BDC A;  2HIX A;  2XSC A;  1AZQ A;  1XTD A;  5CV4 A;  1QOH A;  2VW9 A;  2WIN B;  4G4K A;  1BBU A;  3Q0A A;  3BVZ A;  1HCZ A;  1JOO A;  4KLK A;  5D65 A;  3IFT A;  3K5L A;  4DAV A;  4L5R C;  2E5L L;  1I4G A;  4I7Z C;  2LMC B;  4YCW A;  2LY7 A;  1TQO A;  1SNM A;  2XIW A;  4DR4 L;  1JMC A;  3K59 A;  1LTS D;  3OMG A;  4AQY L;  4U67 3;  4GZY C;  3H6M A;  4MZ9 A;  1FNV A;  1R9T H;  5L37 A;  3OOC A;  1Q12 A;  2F0O A;  4A3D G;  2X69 A;  3EA6 A;  1L1O B;  5EBC A;  4B3S L;  3IRB A;  2SDF A;  4L5T A;  3CCE A;  1YNX A;  4P2C B;  3K57 A;  1FNW A;  5FOB B;  5M3M B;  4DNI A;  2P5Z X;  1KTK A;  1E2Z A;  1MJE A;  2F4V L;  1TT2 A;  3SGI A;  1Y14 B;  2HDL A;  2FHT A;  1STG A;  2PI2 E;  3CAM A;  2JEA I;  4KKT A;  1G6Z A;  3E6Z X;  2QW7 A;  1CZW A;  2UXC L;  2O5I C;  1BDO A;  2B2Y C;  4C3H G;  3VA5 A;  4C3J G;  3BZD B;  4RGT A;  5C0X J;  1K3B C;  1KIX A;  4WJ3 M;  3HOV G;  1T9H A;  3GP7 A;  1TY0 A;  4RAU C;  3GO5 A;  1PTO H;  1W3S A;  1JE5 A;  4JCV E;  3E0J A;  5H1S E;  4BA2 I;  1HA5 A;  3M4Q A;  1C8C A;  3EIV A;  5FJ8 H;  3H3V I;  4H02 A;  2KHI A;  3QWN A;  4KY5 A;  4I65 A;  2BOS A;  3R2I A;  4JI7 Q;  3MEH A;  1NY4 A;  1ENF A;  2PPB C;  2XN9 C;  5BR8 L;  4OO1 I;  1YJN A;  2A73 B;  1XTC D;  4X6A H;  1DZ1 A;  1QG7 A;  2FMM A;  4GN4 B;  2Q2U A;  2I5L X;  1CK1 A;  1Y1W G;  1Y1W H;  3NWS A;  4BBR G;  4BBR H;  3HOX H;  3DM3 A;  2RA4 A;  4C1N K;  2F3I A;  3K7U C;  5I9O A;  1X65 A;  3I56 A;  1E22 A;  4A3F G;  2CVR A;  2M2L A;  4OXP A;  3I4M H;  4FO2 A;  4CDC C;  1GUW A;  1WCM B;  4LF6 Q;  4GLA C;  1PDQ A;  1RKN A;  1DGS A;  2R3Z A;  3MZ5 A;  1SFO B;  4OWW B;  1PZJ D;  2FMC A;  3KF6 B;  2R93 H;  3GTL H;  2NZ1 D;  2HQL A;  4JVZ A;  4P74 A;  4OWX B;  4O2D A;  5CC4 A;  3PIP A;  4HIO A;  4BY7 G;  3PF4 A;  1XNR Q;  4C2M H;  2PMZ B;  2XVS A;  1Q8I A;  2D0O A;  1S5F D;  4K5X A;  1Y1V G;  3RN5 A;  4GN5 A;  3A55 A;  1AZP A;  1DD2 A;  1ET9 A;  3KOJ A;  1N33 L;  4UDU C;  2KCC A;  1D5M C;  3M7N A;  2KVM A;  1YEZ A;  3N52 A;  4RHS A;  3N6R A;  2JXM B;  2RVL A;  4DR2 L;  1VQA A;  4B3M L;  2EYP A;  4JI8 Q;  4ME5 A;  4DXF A;  4A3E H;  1HNX L;  5ELD A;  1A8V A;  3K0X A;  2JA6 G;  3CPW A;  3HOY H;  2F0W A;  1LAB A;  3NXW A;  2B39 A;  5TSS A;  1A62 A;  1P16 A;  3GTP H;  4YCV A;  5M5X B;  1KNE A;  1V8Q A;  4POF A;  4JI4 Q;  3K7A H;  1KHI A;  2MQH A;  1V1P B;  1K8M A;  1Y8O B;  5C5M A;  4EQ5 A;  2N8N A;  2EJM A;  3FMC A;  3S2D H;  2RF4 A;  2RBM A;  2KUM A;  3PSI A;  4IAL A;  3J81 L;  4PMW A;  1YJW A;  1L0Y B;  4LW1 A;  4JI5 L;  3EN2 A;  1L1O A;  3Q24 A;  4V0B A;  3HOZ B;  2Z6B A;  1IL2 A;  1SYB A;  1HTP A;  2TMP A;  2Y0S G;  4ZK9 B;  5C3E G;  1EIF A;  1VQ6 A;  2I0Q A;  4DU9 A;  1XXG A;  4G7H C;  1UE5 A;  4LF7 L;  2NZO A;  1CZG A;  3NTK A;  4PMC A;  4ZYS A;  2B3G A;  4HTH A;  2R7Z H;  3S14 H;  4B3R L;  3M4O H;  4A3G H;  2F0E A;  1A2T A;  1VQ8 A;  4DV4 L;  4IUP A;  3BG3 A;  5LMN L;  3I4N H;  4DV6 L;  2F0J A;  4C56 C;  1XX8 A;  1X3P A;  3SVM A;  2JJQ A;  4K2L A;  2F3V A;  4GOP C;  4DR1 L;  2A74 C;  3PUV A;  1U9R A;  3LNN A;  2EQS A;  2IPK D;  4DAM A;  2KCM A;  4X64 L;  1VMP A;  3CHB D;  1I4R A;  5DAU A;  1U5K A;  3G71 A;  3FKI G;  2GVB A;  2PI2 A;  2JA5 H;  2K28 A;  4R8I A;  3T1Y L;  2DNC A;  2UUB L;  4LF4 Q;  3H3V H;  4OON A;  5EQ0 A;  1FGB D;  2Z6K A;  4JBW A;  5JPM C;  1CUK A;  1PRT B;  3JC6 6;  1LTG D;  1C9O A;  1D1I A;  1CHP D;  4IUQ A;  4KV6 A;  2R6G A;  4L6T B;  3U50 C;  2MNA A;  4OO1 H;  3OW7 A;  4RCN A;  4BS9 A;  1BBX C;  2PZW A;  2VUM B;  2E2I B;  4ABN A;  3F2U A;  5JJK A;  1Q1E A;  1GUO A;  1LTR D;  1ICF B;  1RDP D;  3KF6 A;  3L3O C;  1A2U A;  3D8G A;  1UAP A;  2LSS A;  1Z9F A;  3QG1 A;  5AJ3 Q;  1GHJ A;  4WJW A;  4LFB L;  5EAY A;  1SYC A;  4AIM A;  2QEJ C;  3D4D A;  1XPR A;  3BZK A;  2R92 B;  2EIF A;  1EY8 A;  4ZCK A;  5IWA L;  3S2H B;  4GKJ Q;  3K5O A;  3JAM c;  1L2F A;  3DWQ A;  4KKU A;  1SN8 A;  3TN2 A;  4LF8 L;  3PIO A;  2KOL A;  1VQN A;  2XWB B;  4KY6 A;  3GTO B;  1WOC A;  1N34 L;  1ZKO A;  2UU9 L;  1PH8 A;  1X32 A;  2QA4 A;  4IPD A;  1D2B A;  1NMG A;  5A2Q E;  1K3R A;  1ILQ A;  1TVX A;  3A7L A;  1QE6 A;  1SYE A;  1LTI D;  1EY0 A;  3ND9 A;  5M3F B;  1BR9 A;  5LMN W;  1VQO A;  4DAP A;  1IW7 D;  2EY2 A;  1I6H H;  4N8F A;  1PTO D;  4A3K G;  4A3K H;  4K0K L;  3CCL A;  1PFB A;  4PV1 C;  1D5X C;  2EYH A;  4IOC A;  4LJZ C;  1W6J A;  3CQZ B;  3KBX A;  4QUC A;  3CP0 A;  1CHQ D;  1LTL A;  4RH6 A;  2OWO A;  3BDL A;  1TR5 A;  1V1O A;  2RDG A;  2CQO A;  3W1G A;  4K8I A;  3PO3 H;  2YU9 B;  5DEH A;  4DNT B;  2AWO A;  3DXJ C;  2VB3 X;  5M5Y B;  4N8X 1;  5IP7 H;  1N32 L;  1SBB B;  4KHP Q;  1A3V A;  1BCP D;  5ISR A;  3S1M B;  4LFA L;  1RL2 A;  3D6C A;  1YHA A;  5FLX c;  3PIO 3;  4DR3 Q;  1QUQ A;  2PCF B;  2YTY A;  4CBV A;  5COY A;  4XDX A;  3DM1 A;  4IN3 A;  5GAH C;  2N78 A;  5IYB G;  4C3I B;  5J1Z A;  3S9W A;  1DON A;  1JR0 D;  2CW0 D;  3CRK C;  3I70 A;  5EPJ A;  5JEA H;  4NXN Q;  3VR2 A;  2IJ0 A;  3MA2 B;  4IOA A;  1W2B A;  1GO3 E;  5HGT A;  5J39 A;  3RUZ A;  4CJ2 C;  1IBM L;  1EYD A;  1CTM A;  1U4M A;  2IY5 B;  3TDQ A;  1QZG A;  4A3D B;  4PNY A;  5CBE E;  2CH4 W;  1I4H A;  2VXW A;  3RN2 A;  1I3Q H;  2CQA A;  2B63 B;  3OHX C;  4UHV A;  1A0I A;  1BOS A;  4EVO A; 
#chains in the Genus database with same CATH homology
 4DV1 Q;  2A8V A;  2OQK A;  3HOW H;  2Z6K C;  2UXB L;  3PUY A;  4JYA Q;  3A5Z B;  1IBM Q;  1NE3 A;  1XNQ Q;  4YHH L;  1XPO A;  4DR7 Q;  1WJJ A;  4QIW E;  3J81 c;  1KC8 C;  1LUZ A;  3CCS A;  1IBK Q;  1J5E L;  4LUV A;  3BU2 A;  1KD1 C;  1CSQ A;  4DV0 Q;  2PQA A;  4A93 H;  3RR5 A;  3M3Y H;  1I50 H;  1G29 1;  4HJ5 A;  4HJ9 A;  1I94 Q;  4OO1 G;  1S40 A;  4DR5 L;  4A3I H;  2E2H H;  1PYB A;  2K5H A;  4DUZ L;  2UXB Q;  2A1A A;  2PMZ E;  3RNU A;  3L2P A;  3UDX A;  4IFD G;  1QVF A;  2JA7 G;  4YHH Q;  4A3J G;  1Q82 C;  3AFP A;  4LF5 L;  2ID0 A;  1J5E Q;  4A3F H;  4X65 Q;  4YWL A;  2LXJ A;  1HNZ L;  2UUA L;  5C4X G;  2BH2 A;  3NBH B;  1EQQ A;  5M3F G;  1VQD A;  3BJU A;  3PV0 A;  4DR5 Q;  1IXR A;  1MIU A;  3KF8 B;  2AHO B;  4DUZ Q;  4JBM A;  3KDF B;  1HZ9 A;  2C35 B;  4J15 A;  2AKW B;  4HJ8 A;  1ASZ A;  3H0G G;  3S1N H;  3H0G H;  3TS2 A;  1AE2 A;  2QGQ A;  4LF5 Q;  4LF9 L;  1VQB A;  2DGY A;  1PH6 A;  4HIM A;  1WFQ A;  3J80 i;  2EXD A;  1K8A C;  4IPC A;  1VQ9 A;  5JJL A;  3L7Z C;  1VQF A;  2BA1 A;  1HNZ Q;  2UUA Q;  1VS0 A;  1BKB A;  2D62 A;  2PNH A;  4LWC A;  3CCR A;  5C0X G;  4BY7 H;  2MO0 A;  4DK6 C;  2RHS B;  2QEX A;  1PFS A;  1VQ5 A;  4DV7 L;  4RMF A;  4A3C G;  1SLJ A;  2N49 A;  4NXM L;  2IX1 A;  4YCU A;  1QVG A;  3ICE A;  1N9W A;  1B7Y B;  1YVC A;  2HIX A;  2NVY H;  1UWV A;  1XTD A;  1Y1V H;  4LF9 Q;  2VW9 A;  2ZJQ A;  4JBJ A;  3Q8D A;  2XGT A;  1M1K C;  2RCN A;  1BBU A;  4DR6 Q;  4Y52 H;  1CKN B;  1HH2 P;  2F52 A;  4LUZ A;  4KHZ A;  4POG A;  1OXT A;  4KLK A;  2CWA A;  3NEM A;  2KHJ A;  1VQ4 A;  2VQF L;  1N36 L;  5M3M H;  2JA9 A;  3J7A 5;  4NXM Q;  4OX9 L;  4L5R C;  1EUJ A;  1YZ6 A;  2JK8 A;  4JOI C;  5HGQ A;  2E5L L;  4YCW A;  3UE0 A;  3PUX A;  4QL5 A;  1G6P A;  1PHJ A;  2V1C C;  4IPH A;  2ES2 A;  2ZTE A;  4DAY B;  5C44 H;  2HT1 A;  4DR4 L;  1JMC A;  5HY6 A;  2JA6 H;  4JI1 L;  4AQY L;  2WB1 G;  2JA8 G;  1NBW A;  4MZ9 A;  3T1H L;  4BBS G;  1R9T H;  1X9N A;  3J80 c;  1X55 A;  3F8T A;  2ZM6 L;  2VQF Q;  1PH4 A;  2CWP A;  1N36 Q;  3KJP A;  1Q86 C;  4OX9 Q;  2AWN A;  3PO3 G;  2E5L Q;  4QY7 A;  3CC2 A;  1Q12 A;  2R7F A;  1VQ7 A;  4A3D G;  2YTV A;  2I5M X;  5IP7 G;  1L1O B;  4B3S L;  4JV5 L;  3IRB A;  4IFD J;  1HNW L;  4P71 A;  4L5T A;  3CCE A;  1YNX A;  4DR4 Q;  1GM5 A;  1X3G A;  3I4O A;  3LGJ A;  4JI1 Q;  4AQY Q;  3T1H Q;  1PV4 A;  1OXV A;  2ZM6 Q;  4DNI A;  4HJ7 A;  1K83 H;  1MJE A;  2Y0S E;  2K5N A;  2F4V L;  5C3E H;  3TRZ A;  2VZA A;  3SGI A;  4P73 A;  1Y14 B;  4PZ8 A;  2PI2 E;  4B3S Q;  3CAM A;  2JEA I;  4JV5 Q;  1HNW Q;  4QJF A;  5JEA G;  4GNX C;  2UXC L;  1V1Q A;  1KRS A;  4DPG A;  3M4P A;  4KI0 A;  3GD7 A;  5C0X J;  1YHB A;  1B8A A;  4PZ7 A;  2F4V Q;  1KIX A;  2ZJP A;  1JJ2 A;  1UEB A;  3KYH C;  4PG3 A;  3W5O A;  4JI7 L;  3HOV G;  4MTN A;  1T9H A;  4A3L G;  4A3L H;  5GAG C;  4P72 A;  1X54 A;  2CFM A;  1WCM H;  2ZJR A;  1HR0 L;  2UXC Q;  3HOW G;  1U0L A;  1HZB A;  1EQR A;  3GO5 A;  3K80 C;  1W3S A;  3E9H A;  4R4C A;  1JE5 A;  4JCV E;  4XIG S;  5H1S E;  1PH1 A;  3M4Q A;  1KQS A;  3H3V I;  3EIV A;  5FJ8 H;  2Q2H A;  2R7D A;  5GQO A;  3UDF A;  4H02 A;  3CCQ A;  4GOP A;  3NEL A;  4HID A;  1SFO H;  3U4Z A;  4A76 A;  2KHI A;  2ZTD A;  1WI5 A;  1NTG A;  1GVP A;  2JEB I;  4X65 L;  4A93 G;  2ASB A;  1XPU A;  4JI7 Q;  1E3P A;  1NY4 A;  3FKI H;  1KL9 A;  1GD7 A;  4LF6 L;  4NB3 A;  5BR8 L;  4A3I G;  3G4S A;  3I55 A;  1HR0 Q;  4OO1 I;  1YJN A;  4X6A H;  3J81 j;  1K0R A;  4IJH A;  4DR1 Q;  4GN4 B;  2Q2U A;  2I5L X;  5GAD C;  2LXK A;  3G6E A;  3E9I A;  4IFD I;  4R4Q A;  1Y1W G;  3A74 A;  4BBR G;  2NZH A;  4BBR H;  3HOX H;  1Y1W H;  3DM3 A;  2Q2T A;  2F3I A;  3K7U C;  4R4O A;  2VL6 A;  5IYC H;  1X65 A;  2KCT A;  3KLW A;  3I56 A;  1E22 A;  4A3F G;  1YI2 A;  3FP9 A;  3GTQ H;  4OXP A;  4MNO A;  3I4M H;  1FGU A;  3VDY A;  4LF6 Q;  4GLA C;  2E2J H;  2R92 H;  5BR8 Q;  1XNR L;  1SE8 A;  1DGS A;  4A75 A;  1FJG L;  3GTK H;  1D7Q A;  4JBK A;  3TQY A;  2K75 A;  1EOV A;  1XMO L;  4OWW B;  3KF6 B;  2R93 H;  3GTL H;  1QZH A;  4LUO A;  4QQB X;  1KXL A;  2HQL A;  3CMA A;  4JI2 L;  1PH5 A;  4P74 A;  4OWX B;  3CF5 A;  3KDF A;  1NJI C;  4O2D A;  3S1R H;  4RG1 A;  3PUZ A;  3PIP A;  4HIO A;  1ASY A;  3A5U A;  4BY7 G;  2KBN A;  1XNR Q;  3PF4 A;  1JJG A;  4C2M H;  3F2D A;  1TWF H;  4A4I A;  5C0X I;  4LNQ A;  1FJG Q;  1H95 A;  2D0O A;  5JEA J;  2VY3 A;  2WP8 J;  1KRT A;  1XMO Q;  4LFC L;  2GN5 A;  1Y1V G;  2YTX A;  5M5X H;  1YBY A;  3U4V A;  3RN5 A;  4JI2 Q;  4GN5 A;  4BA1 I;  4JI8 L;  4R4T A;  1AE3 A;  1GKH A;  4TVA B;  3ERS X;  4UP8 A;  3KOJ A;  4HJA A;  1N33 L;  3UDG A;  4DV2 L;  3HOZ H;  2NN6 G;  1X3E A;  5M3M G;  5IYD G;  5IYD H;  5FLM H;  3M7N A;  4DKA C;  1YEZ A;  4TQU S;  1CKN A;  4LFC Q;  4DR2 L;  1VQA A;  3AEV A;  4NPS A;  4OWT B;  4ALP A;  4B3M L;  4JI4 L;  2BH8 A;  4DUY L;  1NMF A;  1AH9 A;  5C44 G;  4JI8 Q;  3GTJ H;  4A3E H;  1HNX L;  4QGU A;  1TWH H;  1A8V A;  1IBL L;  3K0X A;  1BBW A;  2JA6 G;  1PH7 A;  1UE1 A;  1N33 Q;  2YV5 A;  1E1O A;  1TWA H;  3CPW A;  3PF5 A;  3HOY H;  5GRO A;  4DV2 Q;  4JI6 Q;  1A62 A;  3RLN A;  1E24 A;  1P16 A;  3S1M H;  3GTP H;  1TWC H;  4YCV A;  4UP7 A;  3PO2 G;  3PO2 H;  1KAW A;  2K14 A;  3BZC A;  2K50 A;  1J6Q A;  1JJC B;  4DR2 Q;  2L15 A;  4B3M Q;  3CPF A;  3WWV A;  4POF A;  1E1T A;  3K7A H;  1KHI A;  2MQH A;  5IY0 A;  3DLL A;  4DUY Q;  4GLX A;  1HR0 W;  4EQ5 A;  2N8N A;  1HZC A;  5GAE C;  1YHQ A;  2RF4 A;  1PH3 A;  1HNX Q;  3PSI A;  1IBL Q;  3S2D H;  1Q1B A;  2IHF A;  3M9B A;  4UP9 A;  4PMW A;  3CME A;  4LW1 A;  4JI5 L;  1YJW A;  3EN2 A;  4XTC S;  1L1O A;  3F1Z A;  3NEN A;  4DV3 L;  2FXQ A;  1IL2 A;  2Y0S G;  2ALY B;  5C3E G;  3CCU A;  1EIF A;  1VQ6 A;  4EX5 A;  1O7I A;  2I0Q A;  1EIY B;  2I5H A;  1LM0 A;  1UE5 A;  4LF7 L;  1Q46 A;  1WYD A;  2NZO A;  1B70 B;  4A3M H;  2VNU D;  3F2C A;  1MKH A;  5ELO A;  1Q8K A;  1SRO A;  2B3G A;  3KFU A;  4JI5 Q;  3S16 H;  1CSP A;  2A19 A;  2R7Z H;  2B63 H;  3S14 H;  4DV3 Q;  4L5S A;  4BA2 I;  4B3R L;  1X56 A;  2WAQ G;  3M4O H;  2VS1 A;  2WAQ E;  4A3G H;  1E7Z A;  1VQK A;  4YY3 L;  1VQ8 A;  4DV4 L;  2Z0S A;  3HKZ E;  4BY1 H;  5LMN L;  3I4N H;  4LF7 Q;  4DV6 L;  2Q2I A;  5IYB H;  2OCE A;  3D31 A;  3H15 A;  4GNX B;  1K73 C;  1WCM G;  2GVA A;  1K9M C;  3A0J A;  3FHW A;  3CCM A;  2H5X A;  1C0A A;  3GTM H;  3OTO L;  2JJQ A;  2IHE A;  4GOP C;  2NVX H;  1SRU A;  4WJ4 A;  4A3B H;  3S24 A;  4DR1 L;  5FJ8 G;  3MXN B;  2IT1 A;  4B3R Q;  3CCJ A;  3PUV A;  3G48 A;  5ELN A;  1V9P A;  2EQS A;  5J3B A;  2VQE L;  4DAM A;  1VQP A;  2KCM A;  1N8R C;  1X3F A;  4LF4 L;  2VUM G;  2VUM H;  4YY3 Q;  2E2I H;  4DV4 Q;  1VQJ A;  4X64 L;  5LMN Q;  3AQQ A;  2OTL A;  4HIK A;  3PGZ A;  4DV6 Q;  1U5K A;  3G71 A;  3FKI G;  1S3O A;  2GVB A;  1C7Y A;  2B29 A;  2CKZ B;  2PI2 A;  3OTO Q;  1PH2 A;  2JA5 H;  2UUC L;  1IYJ B;  2N3S A;  4AYB E;  3T1Y L;  1RIP A;  4BBS H;  1I5F A;  3L0O A;  5IP9 H;  2MO1 A;  3HFZ B;  3U58 A;  4O0A A;  1VCI A;  3PUW A;  3J7Z C;  3HOX G;  2VQE Q;  2UUB L;  4LF4 Q;  4L5Q A;  2NVQ H;  3H3V H;  5IYC G;  3AYH B;  2PQA B;  4OON A;  1YIT A;  3W1B A;  2Z6K A;  3D0F A;  4JBW A;  4X64 Q;  1CUK A;  3I4M G;  3JC6 6;  3JAM i;  1C9O A;  3I2Z A;  2HHH L;  1UE7 A;  2R6G A;  2R92 G;  3GDE A;  4FDB A;  3S2H H;  5AJ3 L;  3S17 H;  2UUC Q;  1MJC A;  2BA0 A;  3U50 C;  2MNA A;  3T1Y Q;  3STB D;  3CCV A;  1D8L A;  2R93 G;  2UUB Q;  3OYY A;  4GKK L;  1QVC A;  3GTO H;  3CXC A;  1TXY A;  4P75 A;  2JA7 H;  4A3J H;  2D0P A;  2K52 A;  1HJP A;  1Q1E A;  3K81 C;  5JJK A;  2UXD L;  3KF6 A;  3UE1 A;  2HHH Q;  4BXX G;  4BXX H;  5JJI A;  2LSS A;  4GKJ L;  1Z9F A;  5AJ3 Q;  1FL0 A;  5C4X H;  3B6Y A;  4LFB L;  5E7N A;  5M3F H;  4JI0 L;  5EAY A;  1K8G A;  1PVO A;  3TS0 A;  1VQL A;  3S1Q H;  4GKK Q;  2RHQ B;  4AIM A;  1OXS C;  1SMX A;  1VQG A;  3TRE A;  4ME3 A;  5IE8 A;  1SR3 A;  1XPR A;  3CD6 A;  3BZK A;  2UXD Q;  2E8G A;  2EIF A;  4IO9 A;  1P8L A;  5IWA L;  1PH9 A;  2CCZ A;  3F2B A;  3KJO A;  5LMU L;  4GKJ Q;  5K36 G;  3CQZ H;  4JI4 Q;  4JI6 L;  3GTG H;  3HOZ G;  3JAM c;  1L2F A;  5FLM G;  3OW2 A;  1SN8 A;  4LF8 L;  2NN6 I;  1G51 A;  3PIO A;  4LFB Q;  1VQN A;  4PZ6 A;  4JI0 Q;  2KEN A;  4GN3 B;  1JT8 A;  1EWI A;  3ZJY C;  1WOC A;  1N34 L;  2UU9 L;  4A3C H;  2YYZ A;  1UE6 A;  1PH8 A;  1CKO A;  3E0E A;  2QA4 A;  4IPD A;  1NMG A;  4A3E G;  1K3R A;  2YU9 H;  3RZO H;  4APV A;  1OXX K;  2ZTC A;  1OTC A;  1Q81 C;  2AMC B;  3ER0 A;  5M5Y H;  5IWA Q;  3M85 A;  3HOY G;  5LMU Q;  4GLV B;  4X66 L;  2XTI A;  1YJ9 A;  5M5W H;  4LF8 Q;  5LMN W;  4UPA A;  1VQO A;  4AH6 A;  4DV7 Q;  1OXU A;  4JC0 A;  1N34 Q;  1Q7Y C;  2UU9 Q;  1I6H H;  3UDI A;  4A3K G;  4A3K H;  2OQ0 A;  3CCL A;  4K0K L;  4YWM A;  1L1O C;  1CKM A;  4C3I H;  4JOI A;  1IZ6 A;  4KHP L;  4IOC A;  1VQE A;  3EBE A;  3ULL A;  4Y7N H;  2IX0 A;  4WJ3 M;  3CP0 A;  3CW2 C;  1EYG A;  1LTL A;  1EFW A;  4X66 Q;  5C4J H;  1VQM A;  2WB1 E;  2OWO A;  2JA8 H;  1A63 A;  1S72 A;  1PA6 A;  1LYL A;  1PYS B;  1V43 A;  4DR3 L;  5DLQ E;  1BVS A;  2CQO A;  3W1G A;  3S15 H;  3PO3 H;  4A3M G;  2JE6 I;  4K0K Q;  4A3D H;  2AWO A;  2DUD A;  1HZA A;  5IP7 H;  3RZD H;  3TEH B;  1N32 L;  3STB C;  4KHP Q;  2R7Z G;  2B63 G;  2WFW A;  1QUQ B;  3CC4 A;  4UY8 C;  2OTJ A;  4NXN L;  1FVI A;  1VQH A;  2K4K A;  3CC7 A;  1TWG H;  1Z47 A;  1L0W A;  1YIJ A;  4LFA L;  3J81 i;  1RL2 A;  1XMQ L;  4JI3 L;  1YHA A;  4A3G G;  5FLX c;  4B3T L;  4R1J A;  2K5V A;  1VQI A;  4DR3 Q;  1QUQ A;  3HKZ G;  2YTY A;  4BY1 G;  1JB7 A;  3I4N G;  5GAH C;  2N78 A;  3HOU G;  5IYB G;  3HOU H;  4GS3 A;  2JQO A;  2ATW A;  3PCO B;  1N32 Q;  3AFQ A;  4R4I A;  3MEF A;  2HIV A;  4A3B G;  4DV5 L;  4NXN Q;  2MFI A;  4DK3 C;  5IT9 c;  3HKS A;  1X6O A;  4LFA Q;  4X62 L;  4DR6 L;  4IOA A;  4DV1 L;  1W2B A;  4GNX A;  1GO3 E;  1XMQ Q;  4JI3 Q;  1VQC A;  4B3T Q;  4JYA L;  1IBM L;  1XNQ L;  4C3H H;  3K8A A;  4IPG A;  2IY5 B;  4DR7 L;  4C3J H;  1QZG A;  1M90 C;  1IBK L;  3RN2 A;  4IJL A;  1I3Q H;  4YWK A;  3RLF A;  4JG2 A;  4DV0 L;  2JA5 G;  2NVT H;  3HOV H;  3ULJ A;  1XJV A;  3RLO A;  4GOP B;  1I94 L;  3ULP A;  1A0I A;  4AYB G;  4X62 Q;  4DV5 Q;  3I7F A;  5IP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...