4A4IA

Crystal structure of the human lin28b cold shock domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
b'VLRGTGHCKWFNVRMGFGFISMINREGSPLDIPVDVFVHQSKLFMEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN LIN-28 HOMOLOG B
publication title The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 17
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a4iA00
1AH9A 4NXMQ 1E1TA 1KL9A 4A4IA 4ME3A 3CXCA 4LFAL 2JEAI 2N78A 1XMOQ 1YEZA 4A76A 1XMQQ 1HH2P 4LF8L 4JI5Q 2E2JH 3TRZA 2IT1A 1HNZL 3S17H 4B3TQ 5BR8Q 2YV5A 2JA6H 3ER0A 4LF5L 3GTOH 1A63A 3E9HA 3ZJYC 2N49A 4X64L 3GD7A 3KDFA 2CQOA 3CPWA 3FHWA 3U58A 4DV3Q 1IYJB 4AYBE 3J80c 2YTVA 1SFOH 4IOCA 5M3FG 2OCEA 3D0FA 5C44H 3CP0A 1KHIA 1MKHA 5GADC 3CC2A 1OXSC 3CCVA 4DUYQ 1XPUA 4DR3L 2R93G 4YHHL 4HIOA 3W1GA 4GNXA 1CKOA 2HIVA 2ID0A 3CCMA 2WB1E 5M5YH 4KHPL 2UXCQ 4NXML 4RMFA 1EQQA 1XMQL 1N8RC 1C9OA 4A3GG 1W2BA 5AJ3Q 4B3TL 4OO1I 4APVA 5BR8L 1PH5A 1LUZA 2A19A 4BBSH 4DR6Q 2CWPA 4X66L 3F2CA 4DV3L 1P8LA 4DV1Q 3TS2A 4KLKA 3J7A5 3CD6A 2ZTCA 1SE8A 4C2MH 1X54A 1I50H 2AWNA 2D62A 1ASZA 3M7NA 5C3EG 4GN5A 1WI5A 1YNXA 1VQLA 3T1HQ 4GNXC 1EYGA 1PYSB 1AE3A 1HZAA 1WFQA 5JJLA 2DGYA 1HZBA 4LFCQ 2VUMG 3M9BA 1L1OB 2ALYB 1N34L 1J6QA 1VQ6A 1SR3A 4UP9A 4IFDI 4JBWA 3K8AA 4DKAC 4B3SL 3RN2A 2JA7G 1TXYA 2JA8G 3I4MG 4LFBQ 3M3YH 4WJ4A 4BA2I 2KCMA 1VQAA 3K80C 4JI6Q 4HIDA 5FLXc 5GQOA 1VQIA 5C4JH 4DR6L 1DGSA 4A3GH 4DNIA 4JI4L 3U4ZA 3KF6B 4DV1L 3T1YL 4PZ6A 3CCLA 3K0XA 4LW1A 1OXXK 2LXKA 4DV6Q 1E24A 1GKHA 4XIGS 5K36G 2CCZA 1E3PA 1YITA 2ZJRA 1X3GA 4P74A 1PV4A 2I5LX 3RNUA 3SGIA 1MIUA 4R1JA 3ULLA 4A75A 2VW9A 1VQ4A 1VQ9A 3GTQH 4A3FG 2MFIA 2UUAQ 3BU2A 3M4PA 5ELNA 1YBYA 2UU9Q 4GOPA 3HOUG 2E5LQ 1N32Q 3PCOB 3KJOA 2K52A 2ZTEA 4A3BG 2CKZB 2BA1A 4PG3A 4JI6L 1LM0A 4WJ3M 4IJLA 1Q1EA 3I4MH 1OTCA 2MNAA 2HIXA 3F1ZA 1TWAH 5IY0A 3JC66 1WOCA 4QIWE 4B3ML 1PVOA 3S2DH 1VQFA 1KRSA 4R4CA 3S1RH 1VQ8A 1BVSA 1G6PA 3A0JA 1A62A 3UE0A 1NBWA 5GROA 2E8GA 2A1AA 2WP8J 3E9IA 4AYBG 5IP7G 2E2IH 2B63G 1D7QA 3CC4A 4POGA 1NE3A 3K81C 1K83H 2K4KA 1S3OA 2ZM6L 2UUCQ 1S40A 3AFPA 4YCUA 4C3IH 4GOPC 2UUAL 4OO1G 1NY4A 2AKWB 3S1MH 2E5LL 1UE7A 3RLOA 5EAYA 4Y52H 1HNXQ 1VQCA 3E0EA 4DUZQ 4HJAA 5JEAJ 3J7ZC 2PMZE 2RF4A 4UP7A 3KDFB 4LF4L 3UDIA 3OTOL 5C4XG 2NVYH 1QVGA 4LF8Q 4DAYB 1HNZQ 3U4VA 1L0WA 4P75A 2VQEQ 1YJ9A 1FGUA 1KIXA 2JA5H 1D8LA 2OWOA 4X64Q 5H1SE 3CCSA 3GTLH 4LF9L 1HZ9A 4IFDG 5C44G 4GNXB 4IOAA 4DR7Q 4JI0Q 1MJCA 2B63H 3Q8DA 2HQLA 4IPDA 4JCVE 2HHHQ 2HT1A 2F3IA 2IHFA 2K5VA 3H15A 4UPAA 5LMUL 4DR3Q 3S16H 1IZ6A 3M4OH 5FLMG 2VL6A 4QJFA 1HNXL 4DUZL 4QY7A 2WAQG 3GTGH 1U0LA 4R4QA 1X3EA 3ULPA 4A3LG 4L5QA 4HJ7A 4GLAC 1SMXA 3RZDH 3NELA 1KXLA 1Q12A 3CW2C 4BBSG 2BA0A 4A3CG 2K5HA 1HR0Q 5C4XH 2YYZA 2VQEL 2AWOA 3RLFA 4X66Q 1NMFA 1PH9A 1PH7A 1JMCA 5HGQA 1J5EL 4DK6C 4HIMA 2I0QA 3ERSX 2F52A 3EBEA 4H02A 4OXPA 3S14H 4DR7L 1IBKL 1KC8C 1X6OA 4MZ9A 1N36Q 3IRBA 4JI0L 3PV0A 4TVAB 4DV7L 2HHHL 1VQ5A 2BH8A 3CQZH 4DR5Q 3H0GG 1YJWA 4O0AA 1E22A 2GVAA 1P16A 1VQKA 2ZJQA 3PUZA 4P72A 2AHOB 1N34Q 1R9TH 1HR0W 5FLMH 1QZHA 4B3SQ 3GTPH 2B3GA 1K0RA 3CCJA 1QZGA 4A3LH 1HR0L 1PH3A 3H3VI 2RHSB 1BBUA 4MNOA 1PA6A 1XNRL 1V9PA 4GKKQ 4GKJQ 1VQNA 4JI4Q 4A3CH 4DV0Q 4JC0A 3T1YQ 1UWVA 5IYBG 2QA4A 2K50A 3HKSA 3DLLA 2NVXH 5IT9c 1X56A 2K75A 2JA9A 3KF8B 4GOPB 4AQYL 1N36L 4DR4Q 3GDEA 4DR5L 4NB3A 1JB7A 4GLVB 1CUKA 3EIVA 3I4NG 4B3RL 1JT8A 1VQDA 2WAQE 4BBRG 4JYAL 3H0GH 2R7DA 2Q2TA 1FJGQ 1K9MC 1FL0A 1E1OA 1EIFA 2RCNA 3B6YA 2VNUD 3KLWA 1VQMA 1QVFA 4AIMA 4X6AH 3BJUA 3TEHB 4GKKL 4GKJL 1A8VA 1ASYA 4DV0L 1RIPA 4A3MG 1XJVA 3J80i 5GAHC 4A3JG 4B3MQ 4LF7L 4BY1G 1K3RA 2EQSA 3G4SA 2UXBL 4DR4L 5IYBH 3AEVA 3WWVA 2A8VA 1NTGA 1OXVA 1W3SA 2IHEA 4IJHA 4DAMA 5JJIA 3M4QA 5E7NA 3NEMA 2OTJA 4JI2L 2B29A 2ZM6Q 1HNWL 3HOZH 1Y14B 1V1QA 3KOJA 3KFUA 4GLXA 2NZHA 2LXJA 1EQRA 1FJGL 5M3MH 5ELOA 3I4NH 3KYHC 4MTNA 3L0OA 4PMWA 3FP9A 2MQHA 4BBRH 2KBNA 4KI0A 1S72A 1Q7YC 3S1QH 1YHBA 4YWKA 1KD1C 1WCMG 3STBC 3UDFA 3CCEA 3OW2A 1PH8A 4LF4Q 1I5FA 3GTMH 2NVQH 2VQFQ 1AE2A 3OTOQ 2ATWA 2JA5G 4NPSA 2R7FA 1C7YA 1PH2A 3HKZG 1A0IA 1E7ZA 1M1KC 4JI7L 4OONA 4A3MH 1EWIA 2Q2UA 1XNQQ 1XPRA 3HOVG 4A93H 4LF9Q 4A3JH 2CWAA 3HOXG 4BY1H 1L2FA 4GN4B 1YJNA 4X62L 1H95A 4C3HH 3GTKH 1Z47A 2R7ZG 1MJEA 4EX5A 4DV4L 4GN3B 5IWAQ 4DR1Q 4P73A 4YCWA 1PFSA 1TWCH 1Y1VH 4L5TA 5LMUQ 5IYDH 2MO0A 1VQEA 2RHQB 1N9WA 4YCVA 1UE5A 4DR2Q 3NENA 3RLNA 3BZCA 1O7IA 4IPHA 4UP8A 4JG2A 1K8GA 5C0XJ 4A3IH 3S2HH 4HJ9A 3CC7A 2YTYA 2VQFL 4A3KH 3PF5A 1T9HA 2KHIA 1WCMH 2NN6I 1JJCB 5JEAG 1PYBA 2I5MX 3UE1A 3I56A 2V1CC 2NZOA 4DK3C 4X65L 1XNQL 3GTJH 5GAGC 2NVTH 1I94Q 3FKIG 4R4IA 4YY3Q 1YIJA 2FXQA 1J5EQ 2YTXA 4UY8C 3HOVH 3PUVA 1X9NA 3LGJA 3PIOA 3S24A 1IBKQ 3HOXH 1CSQA 4IPCA 5IWAL 4DR1L 4DV7Q 1VQHA 1PHJA 4BY7H 2UUBQ 4OX9Q 3HOWH 4YWLA 4JI8L 1G51A 2R7ZH 3H3VH 2JEBI 5M5XH 3MEFA 3HFZB 4DR2L 1IL2A 4QGUA 1OXTA 1KAWA 3I55A 4P71A 1YHQA 1VQPA 4LWCA 2LSSA 2K5NA 4KHZA 3HKZE 1CKNA 2JE6I 3PO3H 3I7FA 2CFMA 2Y0SE 2QEXA 1XNRQ 1I94L 4AH6A 1K73C 4OWXB 4YY3L 1YZ6A 2MO1A 3DM3A 3G6EA 4NXNQ 4HIKA 3FKIH 4AQYQ 3K7UC 4TQUS 1SRUA 3F8TA 4A3DH 3M85A 2UUBL 4OX9L 2F4VQ 3PUYA 1X3FA 4K0KL 2I5HA 1LYLA 3VDYA 3J81j 3TQYA 1I3QH 1OXUA 1QUQA 4LUOA 5LMNQ 4B3RQ 1M90C 3AQQA 4RG1A 3CCUA 4JYAQ 1CSPA 2N8NA 1K8AC 4R4OA 1IBLL 1PH1A 1U5KA 4PZ7A 1TWGH 2KENA 1HZCA 1YHAA 4DV2Q 3AYHB 1SLJA 2E2HH 4XTCS 2ZTDA 1EUJA 2QGQA 4NXNL 1VS0A 3ICEA 1CKMA 2DUDA 4LF7Q 4JV5Q 5IYCH 4LF6L 1B7YB 5LMNW 2UXBQ 3A5ZB 2F4VL 2Q2IA 4A3EG 4JBKA 1N33Q 3HOZG 2C35B 5M3MG 2NN6G 2PI2A 2N3SA 1KRTA 4JI2Q 2Z0SA 5C0XI 3CCQA 5LMNL 3G71A 1XPOA 1IBMQ 1HNWQ 1XMOL 3I4OA 3J81c 4BXXG 3PUWA 4JI5L 3ULJA 3UDGA 1RL2A 1EIYB 3MXNB 5IP9G 2PQAA 4O2DA 2UXDQ 2D0OA 4DV2L 4QQBX 1UE1A 1UEBA 1PH4A 1B70B 1Q8KA 3G48A 4A93G 1GD7A 1VCIA 5GAEC 1Q46A 3CMAA 2IY5B 4JV5L 4JI7Q 5M3FH 1WYDA 1KQSA 2PNHA 4JBJA 4DUYL 1SROA 4L5SA 5J3BA 1N33L 2Z6KA 3U50C 3JAMc 3PSIA 3UDXA 1Y1VG 4LNQA 4X62Q 1IBML 2UXCL 5IYDG 2R93H 2JK8A 4A3EH 4JOIA 4DV4Q 1X55A 1Y1WG 4LUVA 5AJ3L 2H5XA 4JI1Q 2ASBA 4Y7NH 2Q2HA 4A3IG 4A3KG 1UE6A 3TREA 3RN5A 3PF4A 1C0AA 4BXXH 2UXDL 1QVCA 2JQOA 1JJGA 3CMEA 1VQ7A 4JBMA 4LUZA 3RZOH 1I6HH 3PUXA 5IP9H 1EFWA 1XTDA 2VS1A 4R4TA 5HY6A 4IPGA 3CPFA 4BA1I 3GO5A 1TWFH 2Y0SG 3T1HL 1YVCA 3RR5A 2Z6KC 4PZ8A 5IE8A 4X65Q 4HJ5A 1PH6A 3S1NH 3A5UA 1LTLA 4LFCL 5C3EH 1EOVA 3TS0A 1JE5A 4J15A 1JJ2A 4BY7G 4GS3A 4JOIC 2GVBA 2K14A 3PGZA 3HOWG 1VQJA 3KJPA 2L15A 4LFBL 2VUMH 2VZAA 1NMGA 1Q82C 5JJKA 2ES2A 2XGTA 1NJIC 3J81i 4YWMA 3AFQA 1X65A 4JI1L 1CKNB 4JI8Q 3F2DA 4JI3Q 3HOYG 1IXRA 2EIFA 3L7ZC 2JA7H 2JA8H 3PO2G 5M5WH 3NBHB 1Y1WH 1WJJA 1L1OA 2OQKA 5DLQE 3CCRA 1G291 1SN8A 3PO3G 2PI2E 3I2ZA 3BZKA 3PIPA 1Q1BA 4DV6L 1GVPA 2EXDA 1TWHH 1VQOA 5FJ8G 3K7AH 4OWTB 1HJPA 2JJQA 5C0XG 4DV5Q 2KCTA 3W1BA 2KHJA 1B8AA 1BKBA 3KF6A 2R92G 4L5RC 1QUQB 2R6GA 4A3DG 3EN2A 2BH2A 3JAMi 4ALPA 3F2BA 3D31A 1Q86C 2UU9L 1N32L 1V43A 1GM5A 4A3FH 4QL5A 4OWWB 4K0KQ 2WFWA 3STBD 3CF5A 4JI3L 3HOUH 2WB1G 1L1OC 3OYYA 4IO9A 4A3BH 2AMCB 2ZJPA 2XTIA 4LFAQ 4POFA 2OTLA 1BBWA 2JA6G 3HOYH 1Q81C 1IBLQ 2IX0A 3PO2H 4IFDJ 1GO3E 2D0PA 2YU9H 4EQ5A 4LF5Q 4HJ8A 4DV5L 1VQBA 2OQ0A 1FVIA 5FJ8H 5IYCG 2UUCL 3CAMA 2IX1A 2GN5A 5IP7H 3A74A 2VY3A 2R92H 1Z9FA 1YI2A 3S15H 4DPGA 4FDBA 4LF6Q 3W5OA 3L2PA 4YHHQ 1VQGA 4C3JH 4KHPQ 2PQAB
chains in the Genus database with same CATH superfamily
1JC7A 2EYHA 3EQLC 2JEAI 1YEZA 3CU7A 1SYEA 3BDCA 2JA8B 4WORA 1UUPA 1KDAA 3S17H 5JOBA 3ER0A 4LF5L 3E9HA 3ZJYC 2N49A 1O7LA 3NQIA 3J80c 1GUOA 2SNSA 1T5EA 5M3FG 2OCEA 3TP7A 5DNFA 1KHIA 5GADC 3CCVA 4DUYQ 1XPUA 4IALA 4DK1A 1CI3M 2R93G 2B2TC 4GNXA 2ID0A 4A3FB 4TSSA 5CGKA 1STBA 4A3GG 1HUNA 2WACA 4OO1I 3PO2B 1L0XB 2CWPA 4X66L 4DV3L 3TS2A 4XYOA 1ASZA 2D62A 3VR5A 3A7LA 4GN5A 4DN4M 2BDNA 1O7ZA 3MTSA 1AE3A 1HZAA 4XT1B 4DXFA 2R92B 1HZBA 1N34L 1J6QA 1SYBA 4IFDI 4JBWA 1EY7A 3K8AA 4C3JB 4B3SL 2JA8G 4K5VA 3BYTB 2KCMA 2FMCA 5C4JH 4DR6L 2B2VC 1DGSA 3MWYW 3U4ZA 2QDBA 4R9WA 5JVH3 1QB5D 2EYMA 3DWQA 3K0XA 2EXZA 4XIGS 1SFOB 1E3PA 1RTNA 5CBEE 1YITA 5C44B 1HTLD 4BWGB 3K57A 4HEDA 3GTQH 4A3FG 1IYUA 2UU9Q 2AQ2B 4GOPA 3PCOB 3KJOA 2K52A 3L3OC 4C1NI 3EFXD 2B2UC 1AZQA 3I4MH 2MNAA 1LT4D 1QG7A 1JICA 5CBAE 4Q5VA 4B9WA 1WOCA 4KY7A 2F0UA 4BBSB 1KRSA 3S1RH 1VQ8A 3A0JA 3UE0A 4ZRZA 3JAME 1I50B 2WP8J 1VF5C 3CC4A 5K36H 4POGA 3K81C 1K83H 2K4KA 2N88A 2JP1A 4C3IH 4OO1G 1NY4A 5E4XA 2AKWB 3S1MH 2E5LL 3VR4A 1D5ZC 2TSSA 4HJAA 5JEAJ 3J7ZC 4UP7A 4LF4L 3UDIA 2XRQD 3A8IE 3NTKA 3C46A 2RDHA 2CQAA 2F0WA 1HNZQ 3QJYA 3U4VA 1L0WA 1TS5A 3RD4A 1LV9A 1D8LA 3C2PA 1GHKA 3CCSA 4IFDG 5C44G 4GNXB 4C56C 3A8KE 1MJCA 2E2DC 3Q8DA 4IPDA 4JCVE 2HT1A 1I4XA 2F3IA 4DR3Q 3M4OH 3WDNA 3CRLC 1A2UA 3E5SA 3I72A 5C6AA 3DEPA 3T4AC 3K0YA 1QNUA 4L5QA 4HJ7A 1SMXA 3DWAA 2XIWA 1O78A 1IL8A 3CW2C 1H9RA 4BBSG 1TWAB 4XQNA 3RLFA 1CM9A 1JMCA 5G3LD 3ERSX 4OXPA 3GTLB 2MHVA 4DR7L 3SHLA 4DAYA 1N36Q 1G91A 3IRBA 2QILA 2HHHL 2SOBA 2BH8A 1EY9A 3H0GG 1E2VA 2ZJQA 1D1KA 2AHOB 3GTPH 3TMEA 3SR1A 1HRJA 1HR0L 3H3VI 3OSOA 2NVYB 2M2LA 3GP7A 1PA6A 1V9PA 3VR6A 1BDOA 5KYIA 3T1YQ 2K50A 3DLLA 3HKZB 5IT9c 3S9WA 4GOPB 3ND9A 2Q8TA 1SNCA 1JB7A 1CUKA 4J1MA 2CHBD 1VQDA 3S16B 1QJOA 2R7ZB 3O13A 3R2IA 4H0LC 5EGTA 1U4RA 2RCNA 4PMCA 1K8MA 2DNCA 4K8IA 4B9XA 2OXPA 1EIGA 3OMCA 3J80L 3MXPA 5E4WC 4A3JG 4B3MQ 3MXUA 3X3NA 1BCPC 3EA6A 2UXBL 3KUPA 1NTGA 1W3SA 3M4QA 4FF4A 2OTJA 2WV6D 1HNWL 3HOZH 1V1QA 3KOJA 3CQZB 3KFUA 4JW0A 3I4NH 1R9TB 1EYAA 3FP9A 3S1QH 1STYA 1PH8A 1TR5A 3CCEA 4NDXA 1LTGD 1SAPA 2ATWA 3HKZG 5KIXA 1QE6A 3IFDA 3DEOA 2B2WC 1II3A 4JI7L 3OIPA 1VDZA 3D4RA 3MXNA 1XPRA 4DU9A 3HOVG 2CWAA 4BY1H 1L2FA 4X62L 2IX3A 1PLFA 3KBGA 1MJEA 2R7ZG 4EX5A 4GN3B 4YCWA 5CV8A 1TS4A 5LMUQ 1NCVA 1VQEA 3J7AF 3NWTA 1NR2A 3NENA 1R4QB 3BZCA 5J22A 4UP8A 4HTHA 1KDCA 1K8GA 4A3IH 3S2HH 4A3KH 3PF5A 1F2LA 2NZOA 4X65L 5GAGC 3FKIG 4HN7A 1SJHD 4R4IA 5F2DA 4YY3Q 1YIJA 3Q24A 3PIOA 3S24A 4IPCA 4BY7H 2UUBQ 5CC4A 1Y8NB 4A3EB 4YWLA 1V8QA 3MEFA 5M3MB 3VYUA 3ERQA 1JE4A 1OXTA 4Y7NB 1KAWA 2RVLA 1VQPA 5E3FA 3VYRA 3HKZE 1CKNA 3VR2A 5D3IB 4KV6A 3I7FA 3K5NA 4Q0FA 3MZ5A 2QEXA 2PQEA 1K73C 1TWFB 2NBFA 3GV3A 3DM3A 4ZKCB 5ELBA 3SVMA 4A93B 1PRTC 1SMYC 4TQUS 4A3DH 1RDPD 4CKCA 4C3HB 1X3FA 3QIAA 3VDYA 4GZYC 1I3QH 1OXUA 1TWCB 1ZYRD 4LUOA 4B3RQ 4IUNA 1X32A 4ILWA 3CCUA 1SJED 1CSPA 3FDTA 1HZCA 3A54A 4DV2Q 1WCMB 2EVBA 2E2HH 2NVTB 2DUDA 5BN3A 3ONAB 1VF7A 2K5DA 4A3EG 4JBKA 1N33Q 1IW7C 4G7ZC 2PPBC 2I46A 5M3MG 2EZVA 2N3SA 1U4PA 3CHBD 1KRTA 4JI2Q 1V1PA 5C0XI 1XPOA 4KKUA 4ZLTF 1SYGA 2A6HC 3WOEA 1PDQA 3PUWA 3SK6A 3UDGA 1GUNA 1H9KA 1MGSA 3MXNB 4O42A 3W2DA 1BO0A 3Q0AA 1QILA 3H94A 4QQBX 1UE1A 2QCPX 1UEBA 3KLSA 4A93G 1JR0D 1GD7A 5GAEC 5CV6A 2E75C 5M3FH 2A68D 2PNHA 4DUYL 4DNTB 3I73A 4C3HG 2NUCA 5J3BA 2Z6KA 3U50C 1XX8A 2R93H 1PZKD 2F0DA 2KCNA 3I91A 2NN6H 4JI1Q 1H9JA 2HUGA 2WB1B 1DZ1A 1C0AA 1QVCA 1JJGA 1TWGB 4R8IA 4JBMA 4LUZA 5IP9H 1EFWA 1XTDA 1FNUA 4R4TA 4EVOA 2B39A 2A74C 5IT9L 1PH6A 1FYCA 2JN4A 1I4QA 4KY6A 2G9DA 5C5MA 4JOIC 1BR9A 5ELCA 4HCSA 3KJPA 3BS1A 1NMGA 5JJKA 4F88A 2ES2A 3LNNA 3J81i 4YWMA 4JI8Q 1CKNB 3F2DA 5I2XA 2EIFA 2RDGA 4KD3A 2JA8H 3FPPA 1Y1WH 1WJJA 1DXMA 1NSNS 3CCRA 1G291 1SN8A 4EQNA 2EXDA 1VQOA 1DYQA 1HJPA 5C0XG 4DV5Q 2F4IA 5JPNC 5CV7A 4N8X1 3MHBA 3W1BA 1Q8IA 2KHJA 1B8AA 4K6LA 1C4QA 3JAMi 4ALPA 5BN5A 2UU9L 2MGSA 4A3FH 2WFWA 1B1ZA 3STBD 2RCFA 2RDFA 2WB1G 1L1OC 4IO9A 2R3ZA 1VMCA 4LFAQ 3PO2H 2DN8A 5KGUA 4IFDJ 2F0OA 1I6HB 3RZOB 4HJ8A 1JWSD 1A3UA 1FVIA 3R3OA 5FJ8H 1ESRA 1LO5D 5IYCG 2IX1A 2GN5A 1V1PB 3A74A 1FR3A 5D14A 2R92H 3LWEA 4KMUC 3QR8A 5C3EB 4DPGA 2NWGA 2PZWA 4EQOA 4C3JH 4KHPQ 5EBCA 1AH9A 1E1TA 1KL9A 3CXCA 2JA7B 1XMOQ 1XMQQ 3TRZA 4JI5Q 1ILPA 4CJ2C 1HNZL 2BDOA 1IYJB 4AYBE 3D6CA 1SFOH 2KECA 1DM0B 2RSOA 5C44H 4RKBA 3CC2A 1OXSC 2BE5D 3P20A 3E0JA 4DR3L 5K5PA 2GA4B 1CA5A 4IUUA 4TRDA 4YHHL 1CKOA 1LTID 2WB1E 4NXML 1SXTA 4RMFA 4IQZA 4HCEA 1CHPD 2D9UA 1ESFA 4B3TL 4APVA 5BR8L 3HOYB 1LUZA 3PMFA 4BBSH 1CZGA 1HPCA 1EIHA 1FNWA 4CBVA 3CD6A 1SE8A 1X54A 1I50H 1JQYD 3W3AA 3M7NA 5C3EG 3I8ZA 2DY7A 5M9OA 1VQLA 2A73B 3T1HQ 5KRUA 1EYGA 3TN2A 1WFQA 3KLRA 2ALYB 3MC0B 1SR3A 4IUVA 4UP9A 4PQXA 2JA7G 1TXYA 3IKJA 3M3YH 2LKVA 1I4PA 4JI6Q 1UNSA 4HIDA 5FLXc 1VQIA 2E2JB 1RHPA 2A69D 1SNPA 4DV1L 3T1YL 2JA6B 3GTOB 4LW1A 2NYZD 4FP5D 3TP8A 3SK4A 2CCZA 1X3GA 2B2YC 2K33A 1PV4A 1TS3A 4J8QA 2I5LX 4L6TB 3RNUA 1VQ4A 3OIQA 4QCLA 1JOOA 2CW0C 2MFIA 3BU2A 5ELNA 3C1EA 3KF8A 1PTOD 2ZTEA 1Y8OB 1I4RA 2Z4IA 4IJLA 1OTCA 3KBXA 2HIXA 3F1ZA 3OMGA 1TWAH 1U4MA 3JC66 4QIWE 4B3ML 1LT5D 3S2DH 2K5WA 2EYFA 1BQQT 4N8FA 1S5FD 4LAAA 2E8GA 2A1AA 3GTLH 2B63G 3NTIA 2UUCQ 1S3OA 1HFNA 4YCUA 3VR3A 2UUAL 1UE7A 2JXMB 3UI2A 1HNXQ 2PMZE 2RF4A 4NW2A 2K03A 5C4XG 2NVYH 4A3GB 1MI2A 2MJ8A 5FO9B 1M8AA 4FF3A 4BS9A 4IOAA 3OHXC 1TVXA 4JI0Q 1TU2B 4ZYSA 3S16H 2IHFA 5LMUL 1NNXA 3A8JE 5D3DA 1YNND 5FLMG 1JOQA 2VL6A 2D2CC 3NK9A 4QY7A 4DUZL 1DOLA 2WAQG 1CA6A 1X3EA 4IUPA 2ZXRA 2KOLA 2K28A 4X3UA 5HGTA 4RGTA 1ENAA 1O7YA 2EE1A 1STAA 2K5HA 1B53A 1TKWB 2VQEL 5JJZA 2AWOA 4G4KA 2NTSA 1G2SA 4C1NK 1NMFA 1PH9A 1BF4A 2LFNA 4H02A 3EBEA 2E2IB 2PCFB 3DM1A 3PV0A 1EOTA 3ITPA 3CQZH 1E22A 1F2ZA 4R8NA 1VQKA 3PUZA 1R9TH 4JPBW 5EKLA 4F87A 3EVQA 1K0RA 4A3LH 4KY5A 5EJWA 1PH3A 3E3XA 4GKKQ 4GKJQ 1VQNA 1RCVD 4A3CH 4DV0Q 1UWVA 2QA4A 3KF8B 2EY2A 3GDEA 4YIJA 4KHVA 4DR5L 4RA8A 1I6VC 4B3RL 5FK9C 1JT8A 2WAQE 4BBRG 2R7DA 4MHEA 5EQ0A 2J7ZA 1K9MC 1E1OA 1EIFA 4QF4A 3KLWA 1VQMA 4KD4A 3J80E 3BJUA 1XJVA 4PV1C 1D2BA 4MN3A 1ET6A 1DONA 4DR4L 5IYBH 3AEVA 3OW7A 3BVGA 1TY2A 4DAMA 5E7NA 4JI2L 1Y14B 1Z7TA 1FJGL 5M3MH 3KYHC 4MTNA 4RWSC 3L0OA 1YHBA 2BOSA 4YWKA 3J7YW 1LTAD 1QOHA 5C4HA 1BOSA 1I5FA 3HP3A 1YNJC 3T16A 1CTMA 2R7FA 3OPOA 1C7YA 4MTKA 1A0IA 1EWCA 4A3MH 2Q2UA 4A93H 2EDGA 1SDFA 2NVXB 2PYKA 1F9RA 3TP6A 4C3HH 2VB2X 2ZT9C 1B2TA 3ZYYX 4DR1Q 1Q3LA 1TWCH 3T56B 1TQOA 3D3RA 3PQIA 2ICIA 3H0GB 4YCVA 4DR2Q 4G57A 1O7IA 4JG2A 5FLXL 5C0XJ 2F0TA 4KN7C 2VQFL 4RHSA 1EL0A 2KHIA 4UHVA 1WCMH 1GJXA 1ENCA 1JJCB 3I56A 3CKIB 2NVTH 5CMDA 1XNQL 2EY5A 1S5ED 2K7VA 4K14A 1J5EQ 2YTXA 4K2KA 1IBKQ 3QWNA 3K58A 3HOXH 1DOKA 2F0LA 5IWAL 1VQHA 1JWMD 4OX9Q 4JI8L 1T5XD 5CR3A 4P71A 5NUCA 4KHZA 1JWUD 3GTMB 1SBBB 4IUTA 2Y0SE 1Z6HA 3NBHA 1I94L 5JEAH 1B50A 1PTOF 5C0XH 4NXNQ 3I70A 4A3JB 5I9PA 1UAPA 4AQYQ 1SRUA 3PUYA 2SNMA 4H7BA 2QW7A 3U9OA 2DJFC 5LMNQ 2ZXOA 2HD3A 4JYAQ 1D5XC 2N8NA 1SNDA 1KNEA 1K8AC 3G6JB 1U5KA 2F03A 1EFID 1TWGH 1EWHA 2ZTDA 1B3QA 1EUJA 1GOZA 5IYCH 4U673 5LMNW 1CT1D 3HOVB 2F4VL 2VB3X 2FHTA 3CCQA 3NBIA 3HOWB 3G71A 5J1ZA 5DM63 3D4WA 3A55A 1XMOL 2BCOA 3I4OA 4BXXG 4JI5L 1JB3A 2PQAA 2D0OA 4L63B 3PO3B 1B70B 1B9NA 2F3VA 3SE0A 3F2UA 4JV5L 1KQSA 1WYDA 2MUYA 4JBJA 3N52A 3FKIB 5ELDA 3WOFA 1J8IA 3PSIA 4ZCKA 2F0IA 5IYDG 3DHQA 4DV4Q 1X55A 3NSWA 5C3XA 2NTTA 4LUVA 1EY5A 1F2MA 5LL6X 2Q2HA 3RN5A 3PF4A 1X3QA 2F0MA 2UXDL 3CMEA 1I6HH 3RZOH 5IT9E 2FMMA 5EKKA 2CH4A 3GO5A 4LJZC 3T1HL 3RR5A 3I4LA 4DXGA 5C3EH 1JJ2A 1KLGD 4J15A 1GUWA 3IAYA 2GVBA 3HOWG 1VQJA 4HR7B 3P1HA 2XGTA 1NJIC 1X65A 4JI3Q 1EEID 2JA7H 3K59A 4FXDA 1FD7D 3NBHB 5DLQE 3VA7A 1SNMA 3PO3G 2PI2E 3I2ZA 3BZKA 1H9SA 5FO7B 4CJ1B 2L1BA 4DAPA 2Z6BA 3N6RA 5ELEA 1ZKOA 1BKBA 4PMBA 3KF6A 3EN2A 2BH2A 3BVMA 1Q86C 5FKAC 4V190 4K0KQ 3CF5A 5ISRA 2L4NA 1PTOB 1ILQA 1ZYRC 1ONLA 3HOYH 1Q81C 1IBLQ 2WKDA 5C4JB 1WTRA 1S5BD 4QUFA 3D4DA 2L0CA 4LF5Q 3GQBA 1VQBA 2UUCL 4ULLA 4FF2A 3CAMA 3LX0A 1RTOA 3FRPB 3BG3A 2FFKB 3W5OA 3VA5A 1I4HA 5KNDA 2CH4W 3D6WA 1IBMQ 1VQGA 2PQAB 1IHZA 1HUMA 5FOBB 2L12A 4A4IA 2A6EC 4QB4A 3I4MB 2E2JH 2I07B 2IT1A 1LABA 4JVZA 4K5XA 2YV5A 2JA6H 1A63A 3GTOH 3CPWA 3GD7A 3U58A 4WRDA 4DNRB 4DV3Q 1TWHB 4UAIA 1A15A 3D0FA 1TY0A 1U9RA 3CP0A 1MKHA 2EYOA 3BDOA 4FNFA 4C3IB 1GUGA 2A68C 2HIVA 4RGOS 2UXCQ 2XN9C 3IFTA 1MSHA 1C9OA 1JCKB 1W2BA 5AJ3Q 2IL8A 1RF2D 2R61A 3HG9A 3QO2A 1PH5A 1ZEQX 4DR6Q 4CJ0B 3F2CA 2YU9B 1P8LA 2B2VA 1PRTD 1MD2D 3J7A5 1AZPA 4KKTA 1DCZA 1XXGA 2AWNA 2F0EA 1NAPA 4MIUA 1PYWD 4GNXC 1PYSB 4AYBB 2LY7A 2PNRC 3S15B 5JJLA 4LFCQ 3M9BA 1VQ6A 4F7XA 4DKAC 3RN2A 2P5ZX 3I4MG 1H9SB 1EY0A 4BA2I 3K80C 5C3WA 2IWHA 5GQOA 4A3GH 2B2UA 4DNIA 3KF6B 1AN8A 3CCLA 3TSSA 2LXKA 5A35A 4XDXA 4DV6Q 2AQ3B 5K36G 1IW7D 4P74A 4C3IG 3EJIA 3DXJC 4KJOA 1KTKA 3SGIA 4R1JA 4A75A 2A6HD 2VW9A 2JSOA 1YBYA 2E5LQ 5M5YB 2MPMA 2FJ2A 4PG3A 2BA1A 1LM0A 4WJ3M 1Q1EA 3K6OA 5IY0A 4XQJA 1PVOA 1VQFA 5CV9A 2F0GA 1B9MA 2J0TD 5GROA 4C2MB 5IP7G 4AYBG 1WTPA 2E2IH 1D7QA 4N9TA 1NE3A 1S40A 1RD9D 4GOPC 2F1MA 5T1GA 1HA6A 3LWUA 5EAYA 3MFYA 3E0EA 4U68A 1PFNA 1DD2A 4LF8Q 1BBXC 1KIXA 2RA4A 3VYTA 3I90A 4X64Q 4ZUJA 1HZ9A 1B44D 2EPBA 2KVMA 4QIWB 1EU3A 4Z9CB 4DR7Q 1BXTA 2HQLA 3FVQA 2HHHQ 2K5VA 1SYDA 3H15A 4UPAA 1U4LA 1HTPA 2HCCA 4OO1H 4QJFA 4R4QA 3S1QB 2F3WA 3NELA 1KXLA 1HR0Q 1OO9B 2PMZB 3RUZA 3VYSA 4CDDC 1J5EL 4DGZA 4DK6C 2O5IC 4KN4C 1IBKL 3NPPA 4BY1B 1X3PA 4IFDH 1L0YB 3CRKC 2OF1A 1AFPA 2NB0A 1VQ5A 1YJWA 4O0AA 1P16A 1SE2A 3TP5A 4XT3B 1HR0W 1QZHA 5JPMC 3CCJA 1QZGA 1NUCA 2L55A 3K5LA 1SEBD 1BBUA 4MNOA 1A3VA 1BNZA 4JI4Q 2EYPA 2JA5B 1E2WA 2NVXH 3R8BA 4AQYL 2X6LA 1N36L 2WKCA 3Q6SA 2QKIC 4K8JA 2XWBB 2ZXPA 4N9PA 4M1UB 4GLVB 2B63B 3EIVA 1S4ZA 1GUSA 2F0KA 3I4NG 4JYAL 3H0GH 2PW5A 2RKSA 2L11A 3GTGB 3DWPA 1FL0A 4ZK9B 1ET9A 2VNUD 4AIMA 3RZDB 4X6AH 3TEHB 1STHA 1RJTA 1A8VA 1ASYA 1ICWA 5C4XB 2HQEA 5GAHC 1WTOA 4M8AA 4XXEA 1QNKA 4BY1G 2WINB 1K3RA 4ABNA 2AUJD 2B2WA 3S14B 1EQTA 1OXVA 2IHEA 5JJIA 2KUMA 1SE4A 1CHQD 2B29A 1B4OA 1PZJD 2ZM6Q 4GLXA 2NZHA 5ELOA 4IN3A 4RHRA 5KEEA 2MQHA 1Q7YC 1KNAA 2WAQB 3GTMH 3OTOQ 2JA5G 4NPSA 1PH2A 1E7ZA 1FNVA 4OONA 2H4OA 4LF9Q 4A3JH 2EY6A 1STNA 1LT6D 4GN4B 1YJNA 1H95A 4WJWA 3IL8A 4CKEA 1EZ6A 4DV4L 4P73A 3C1FA 5IYDH 2DNEA 1PRTF 5FLXE 1W6KA 2MO0A 3H91A 5TSSA 1UE5A 4G7HC 3RLNA 4IPHA 2E76C 4HAEA 3CC7A 4QMGA 1T9HA 2NN6I 3MA2B 4DK3C 2PZTA 2CW0D 2X6GA 2FXQA 4FF1A 3HOVH 3PUVA 1X9NA 3LGJA 4HSVA 4FO2A 3M4YA 2F0FA 4DV7Q 3TDQA 3HOWH 5JVG3 2R7ZH 1G51A 2K5QA 3HEJA 3ND8A 4S3SA 5I9OA 3H3VH 3HFZB 1IL2A 4K6DA 1EY6A 4BBRB 4G7OC 4DAVA 4KK7A 4CDFC 1SNQA 5EPJA 4LWCA 2LSSA 2NVQB 2JE6I 3PO3H 1A3TA 2CFMA 2DJGC 1XNRQ 1BCPB 4AH6A 1ICFB 4OGQC 4YY3L 3OOCA 1ML0D 4HIKA 1IKLA 1KLUD 3FKIH 5LHY1 1VMPA 2V4DA 3F8TA 1PZID 4CDEC 2UUBL 4K0KL 3GTKB 1Q90A 1LYLA 2A5HA 3TQYA 1Y1VB 3SXHA 1IBLL 4R4OA 1Y1WB 1PH1A 1TS2A 2XRSD 2SEBD 3T51B 2FINB 1YHAA 1HCZA 1LACA 5EKIA 3AYHB 3HGBA 4XTCS 2XWJB 1STEA 3X3MA 2RBMA 1CZWA 2QGQA 2VXWA 1F9SA 3GTJB 1VS0A 1CKMA 4LF7Q 1WTWA 2O2LD 5IGEA 1B7YB 2Y0SB 4KJNA 3BVZA 4X3TA 1CFMA 2C35B 2EY1A 3EROA 2NN6G 1MHWC 2PI2A 2ENBA 4B08A 1F77A 1R4PB 5AFWA 5M5XB 3J81c 4EGVA 1B3AA 1LTTD 1F9QA 1RL2A 2QF7A 1EIYB 5IP9G 4O2DA 4ME5A 4DV2L 1F2YA 3FEWX 2QEJC 1PH4A 4CKBA 3HS0C 3G48A 1VCIA 1TT2A 1Q46A 3CMAA 5IIFA 2IY5B 1C48A 1H9MA 1KAAA 1SROA 3T13A 4L5SA 2F0VA 4OEMB 4RFBA 1W6JA 1N33L 2EYJA 2K1BA 3JAMc 1Y1VG 1IBML 2UXCL 4A3EH 4JOIA 1Y1WG 5COYA 1PTOH 5AJ3L 2H5XA 2ASBA 1IKMA 4Y7NH 4FXGC 3TREA 5IGDA 3SEBA 3T53B 1O80A 3A56A 3PUXA 2VS1A 3CPFA 4BA1I 1TWFH 1PRTB 2Y0SG 4HJ5A 2Z6KC 4PZ8A 3PIO3 1WD1A 1LTLA 4LFCL 1EOVA 1JE5A 2HCIA 4E6IA 5A2QE 4GS3A 3PGZA 3J81E 5FO8B 2L15A 2EJMA 1Q82C 2X69A 2XVSA 3AFQA 4JI1L 4DFAA 3PO2G 1SE3A 1IXRA 3L7ZC 2F0QA 2M00A 1L1OA 5C5LA 2OQKA 1HHVA 4UDUC 3Q23A 1EYDA 4DV6L 1GVPA 1TWHH 5FJ8G 1XWEA 2KCTA 4JK1C 2R92G 4XQQA 4EQPA 2C5CA 4RCNA 2R6GA 3F2BA 3D31A 1WVLA 4ZAIA 2XSCA 4C3JG 5EPKA 2PZUA 1GM5A 4OWWB 2B8FA 3KK7A 3OYYA 1YNJD 2PO4A 3M3YB 2AMCB 2ZJPA 2G5DA 2F0HA 2XTIA 4POFA 1KABA 4XYQA 2HDMA 2D0PA 2YU9H 2MP1A 3QB3A 4DV5L 1D6EC 5KYLA 1ENFA 3V96A 2KEEA 2LS01 5IP7H 3S1NB 3AMUA 1FGBD 4FVMA 3S15H 3I3CA 1K0SA 4LF6Q 1AEXA 2LMCB 3L2PA 4YHHQ 2VUMB 2K32A 4NXMQ 4IZ8A 4ME3A 4LFAL 2N78A 4LF8L 4A76A 1HH2P 5M5WB 4B3TQ 4K2LA 5BR8Q 4NMZA 3G7LA 3BZDB 4X64L 3KDFA 2CQOA 1WTVA 3FHWA 3S2DB 2YTVA 3K7AB 4IOCA 2CVRA 1LTSD 3BYYB 1GHJA 2OT2A 4I7AA 4ZKBB 4RGMA 1EYCA 2F0NA 1AP0A 5CYUA 4HIOA 3W1GA 3V05A 5HURA 3CCMA 2F0SA 2J4XA 5M5YH 4KHPL 4TKOB 1F9PA 1EQQA 3HOUB 1XMQL 3P7JA 1N8RC 4A3BB 4HMJA 2A19A 4DF7A 4DV1Q 4KLKA 3HRZC 2ZTCA 4CDCC 4C2MH 1RKNA 3SK5A 5IGBA 1WI5A 1MSGA 1YNXA 1LTBD 2DGYA 1PFMA 2B2YA 2VUMG 1I4GA 1HA5A 1L1OB 5I4DA 2KJXA 4LFBQ 4WJ4A 4RKLA 1EY8A 1QWYA 1VQAA 1CQVA 4JI4L 2TMPA 5BN4A 3S17B 4PZ6A 1K3BC 1OXXK 3NUCA 1E24A 1D5MC 1GKHA 2ZJRA 4K5WA 4OL7A 2EYLA 5C4ZA 1MIUA 3ULLA 1WD0A 4ODGA 1VQ9A 2UUAQ 1UEAB 4V0BA 5IGGA 2KA7A 3M4PA 3HOUG 1N32Q 2D5DA 1PFBA 4A3BG 5A2QL 1LT3D 3J81L 2CKZB 1DJRD 4JI6L 4I7ZC 4FYDA 1BCPD 2JYOA 4R4CA 1BVSA 1G6PA 1A62A 1NBWA 3E9IA 3DUZA 1EZ8A 2ZM6L 3AFPA 3JAML 1E0BA 2XNAC 3RLOA 5LL6S 4Y52H 1VQCA 4DUZQ 3KDFB 4RH6A 3OTOL 4X3SA 1QVGA 4DAYB 3H09A 1K8OA 4P75A 2VQEQ 1YJ9A 1FGUA 2JA5H 2OWOA 4RGNA 5H1SE 4LF9L 2O4XA 5ELFA 2G9HD 2B8GA 2RQXA 4WFN3 2B63H 2L9HA 2KHSA 3NE5B 5CORA 4OIKA 3GTQB 1IZ6A 1HNXL 3GTGH 1U0LA 3ULPA 2B2TA 4NKLA 1C8CA 4A3LG 4GLAC 5I6YA 2K01A 3RZDH 2O5JC 1Q12A 2BA0A 4A3CG 5C4XH 2YYZA 3K5MA 4X66Q 3C3LA 5EPLA 1M4VA 1PH7A 4A3MB 1WTXA 5HGQA 4HIMA 3S1RB 5KNCA 2I0QA 2F52A 1Y8PB 3S14H 4H13C 1XTCD 4JI0L 1KC8C 1X6OA 4MZ9A 4TVAB 4DV7L 3QG1A 1K83B 4DR5Q 1S5CD 2GVAA 3S1MB 4P72A 1N34Q 5FLMH 4B3SQ 4OHJA 2B3GA 2IJ0A 3D8GA 5IOCA 2RHSB 4QUCA 1XNRL 1HXYD 2H1EA 2Z9HA 4JC0A 5IYBG 3HKSA 1SMYD 1X56A 2K75A 2JA9A 3MVVA 1G6ZA 4DR4Q 4NB3A 3HOXB 5DAUA 1EQVA 2A6ED 3M4OB 5DM73 2Q2TA 1FJGQ 1JORA 4RAUC 2ICEC 3NQTA 1PMRA 3B6YA 1QVFA 1BUVT 1EY4A 3NWSA 3PIP3 4GKKL 4GKJL 3E6ZX 4DV0L 1RIPA 1SNOA 4A3MG 1G2TA 3J80i 4LF7L 2EQSA 3G4SA 3QOLA 3WWVA 2A8VA 1STGA 2F0PA 4IJHA 1E2ZA 3NEMA 5J39A 1EQRA 2LXJA 4IURA 4FXKC 3MEHA 5G3LF 4PMWA 4BBRH 5JAVA 2KBNA 4KI0A 1S72A 4P2CB 1KD1C 1WCMG 3STBC 2N55A 3OWFA 3UDFA 3L9AX 3OW2A 4LF4Q 3GTPB 2NVQH 2VQFQ 1AE2A 1M1KC 4I65A 1EU4A 3NXWA 1EWIA 1XNQQ 2K05A 4RCOA 3M7GA 1S5DD 3NTHA 5IGCA 3AU7A 1RODA 3HOXG 5T1IA 2OEOA 2QDLA 1WTQA 4PNYA 3GTKH 1Z47A 5L37A 5EBDA 5IWAQ 2AUKA 1PFSA 1Y1VH 4L5TA 1D1IA 1KDBA 2RHQB 1N9WA 3H3VC 3R93A 4HJ9A 2YTYA 3K5OA 2EJFC 3URYA 2Z1CA 5JEAG 1PYBA 2I5MX 3UE1A 3FPUB 2V1CC 3GTJH 1I94Q 1IYVA 1A6XA 2Z8LA 4IUQA 2Q8IB 4UY8C 1GUTA 3A7AB 5CV5A 1CSQA 2L5TA 4DR1L 1PHJA 3HOZB 2BE5C 2JEBI 5M5XH 4DK0A 4DR2L 3I4NB 4QGUA 3KLSX 3I55A 1YHQA 3HZXA 2K5NA 1JOKA 4F8MA 1G8ZD 4OWXB 1A2TA 1YZ6A 2MO1A 3G6EA 3QOJA 1LTRD 3K7UC 3U9SA 3M85A 4OX9L 2F4VQ 2I5HA 3J81j 1BCPF 5D65A 1QUQA 3GV6A 3R2TA 3BDLA 5DEHA 1M90C 3AQQA 4RG1A 1GXDC 1QCBD 3RMHA 3NHHA 3H6MA 4PZ7A 4A3IB 5CV4A 4A3KB 3S2HB 2KENA 2KCCA 2EOTA 4X3KA 3TZDA 1SLJA 1SYFA 4NXNL 3ICEA 3DMUA 1XYIA 2A69C 2M9VA 1HQMC 4CHTB 4JV5Q 4LF6L 2UXBQ 1AW7A 3A5ZB 3HOZG 2Q2IA 4BY7B 2Z0SA 5LMNL 1HNWQ 4NP5A 2HDLA 3TZUA 4CGYB 3ULJA 2EJGC 2K6AA 1V1OA 1PTOC 3SK8A 1HFGA 4HMIA 2UXDQ 5I2YA 2RSNA 3V2TA 3MXGA 5KNBA 4OELB 1Q8KA 4KTAA 4ZUIA 2C9OA 2WIIB 4JI7Q 1TIID 2NZ1D 5E1FA 4H44C 2AQ1B 1LLRD 4A3DB 3UDXA 4LNQA 5IGFA 4X62Q 2KEDA 2KQ3A 1K28A 1NR4A 2JK8A 4ID6A 1WTHA 4DA2A 3P75A 1I3QB 2PW7A 2E74C 3J7AV 4A3IG 1CK1A 1DOMA 1SSOA 1UE6A 4A3KG 4BXXH 3Q22A 2JQOA 1VQ7A 5HY6A 4IPGA 2E2HB 4L8JA 2Q8RE 1YVCA 4X65Q 3S1NH 5IE8A 3A5UA 5I6WA 3TS0A 4BY7G 2SDFA 2F0JA 3SDZA 2K14A 1J9OA 4ZQ3A 4J6HA 4LFBL 2VUMH 2VZAA 3MAQA 1Y69U 5IODA 3HOYG 5M5WH 1PXUA 1YNNC 1MBYA 3NP8A 3PIPA 1Q1BA 3AB9A 3K7AH 4OWTB 2JJQA 1EEFD 4OIJA 5M3FB 1QUQB 4L5RC 2IPKD 4LMQD 4A3DG 1HQRD 3TBIB 1N32L 1V43A 3OWEB 4O1NA 4QL5A 2R93B 3FMCA 4JI3L 3HOUH 4KKSA 4A3BH 2DY8A 2OTLA 2JA6G 1BBWA 2IW3A 2IX0A 4LK1C 1GO3E 4EQ5A 2OQ0A 2VY3A 1ZXTA 1Z9FA 4HSPA 1YI2A 4FDBA 1SYCA 3MFGA 2K04A 1CQFA 2Z4HA
chains in the Genus database with same CATH topology
1AH9A 4NXMQ 1E1TA 1KL9A 4A4IA 4ME3A 3CXCA 4LFAL 2JEAI 2N78A 1XMOQ 1YEZA 4A76A 1XMQQ 1HH2P 4LF8L 4JI5Q 2E2JH 3TRZA 2IT1A 1HNZL 3S17H 4B3TQ 5BR8Q 2YV5A 2JA6H 3ER0A 4LF5L 3GTOH 1A63A 3E9HA 3ZJYC 2N49A 4X64L 3GD7A 3KDFA 2CQOA 3CPWA 3FHWA 3U58A 4DV3Q 1IYJB 4AYBE 3J80c 2YTVA 1SFOH 4IOCA 5M3FG 2OCEA 3D0FA 5C44H 3CP0A 1KHIA 1MKHA 5GADC 3CC2A 1OXSC 3CCVA 4DUYQ 1XPUA 4DR3L 2R93G 4YHHL 4HIOA 3W1GA 4GNXA 1CKOA 2HIVA 2ID0A 3CCMA 2WB1E 5M5YH 4KHPL 2UXCQ 4NXML 4RMFA 1EQQA 1XMQL 1N8RC 1C9OA 4A3GG 1W2BA 5AJ3Q 4B3TL 4OO1I 4APVA 5BR8L 1PH5A 1LUZA 2A19A 4BBSH 4DR6Q 2CWPA 4X66L 3F2CA 4DV3L 1P8LA 4DV1Q 3TS2A 4KLKA 3J7A5 3CD6A 2ZTCA 1SE8A 4C2MH 1X54A 1I50H 2AWNA 2D62A 1ASZA 3M7NA 5C3EG 4GN5A 1WI5A 1YNXA 1VQLA 3T1HQ 4GNXC 1EYGA 1PYSB 1AE3A 1HZAA 1WFQA 5JJLA 2DGYA 1HZBA 4LFCQ 2VUMG 3M9BA 1L1OB 2ALYB 1N34L 1J6QA 1VQ6A 1SR3A 4UP9A 4IFDI 4JBWA 3K8AA 4DKAC 4B3SL 3RN2A 2JA7G 1TXYA 2JA8G 3I4MG 4LFBQ 3M3YH 4WJ4A 4BA2I 2KCMA 1VQAA 3K80C 4JI6Q 4HIDA 5FLXc 5GQOA 1VQIA 5C4JH 4DR6L 1DGSA 4A3GH 4DNIA 4JI4L 3U4ZA 3KF6B 4DV1L 3T1YL 4PZ6A 3CCLA 3K0XA 4LW1A 1OXXK 2LXKA 4DV6Q 1E24A 1GKHA 4XIGS 5K36G 2CCZA 1E3PA 1YITA 2ZJRA 1X3GA 4P74A 1PV4A 2I5LX 3RNUA 3SGIA 1MIUA 4R1JA 3ULLA 4A75A 2VW9A 1VQ4A 1VQ9A 3GTQH 4A3FG 2MFIA 2UUAQ 3BU2A 3M4PA 5ELNA 1YBYA 2UU9Q 4GOPA 3HOUG 2E5LQ 1N32Q 3PCOB 3KJOA 2K52A 2ZTEA 4A3BG 2CKZB 2BA1A 4PG3A 4JI6L 1LM0A 4WJ3M 4IJLA 1Q1EA 3I4MH 1OTCA 2MNAA 2HIXA 3F1ZA 1TWAH 5IY0A 3JC66 1WOCA 4QIWE 4B3ML 1PVOA 3S2DH 1VQFA 1KRSA 4R4CA 3S1RH 1VQ8A 1BVSA 1G6PA 3A0JA 1A62A 3UE0A 1NBWA 5GROA 2E8GA 2A1AA 2WP8J 3E9IA 4AYBG 5IP7G 2E2IH 2B63G 1D7QA 3CC4A 4POGA 1NE3A 3K81C 1K83H 2K4KA 1S3OA 2ZM6L 2UUCQ 1S40A 3AFPA 4YCUA 4C3IH 4GOPC 2UUAL 4OO1G 1NY4A 2AKWB 3S1MH 2E5LL 1UE7A 3RLOA 5EAYA 4Y52H 1HNXQ 1VQCA 3E0EA 4DUZQ 4HJAA 5JEAJ 3J7ZC 2PMZE 2RF4A 4UP7A 3KDFB 4LF4L 3UDIA 3OTOL 5C4XG 2NVYH 1QVGA 4LF8Q 4DAYB 1HNZQ 3U4VA 1L0WA 4P75A 2VQEQ 1YJ9A 1FGUA 1KIXA 2JA5H 1D8LA 2OWOA 4X64Q 5H1SE 3CCSA 3GTLH 4LF9L 1HZ9A 4IFDG 5C44G 4GNXB 4IOAA 4DR7Q 4JI0Q 1MJCA 2B63H 3Q8DA 2HQLA 4IPDA 4JCVE 2HHHQ 2HT1A 2F3IA 2IHFA 2K5VA 3H15A 4UPAA 5LMUL 4DR3Q 3S16H 1IZ6A 3M4OH 5FLMG 2VL6A 4QJFA 1HNXL 4DUZL 4QY7A 2WAQG 3GTGH 1U0LA 4R4QA 1X3EA 3ULPA 4A3LG 4L5QA 4HJ7A 4GLAC 1SMXA 3RZDH 3NELA 1KXLA 1Q12A 3CW2C 4BBSG 2BA0A 4A3CG 2K5HA 1HR0Q 5C4XH 2YYZA 2VQEL 2AWOA 3RLFA 4X66Q 1NMFA 1PH9A 1PH7A 1JMCA 5HGQA 1J5EL 4DK6C 4HIMA 2I0QA 3ERSX 2F52A 3EBEA 4H02A 4OXPA 3S14H 4DR7L 1IBKL 1KC8C 1X6OA 4MZ9A 1N36Q 3IRBA 4JI0L 3PV0A 4TVAB 4DV7L 2HHHL 1VQ5A 2BH8A 3CQZH 4DR5Q 3H0GG 1YJWA 4O0AA 1E22A 2GVAA 1P16A 1VQKA 2ZJQA 3PUZA 4P72A 2AHOB 1N34Q 1R9TH 1HR0W 5FLMH 1QZHA 4B3SQ 3GTPH 2B3GA 1K0RA 3CCJA 1QZGA 4A3LH 1HR0L 1PH3A 3H3VI 2RHSB 1BBUA 4MNOA 1PA6A 1XNRL 1V9PA 4GKKQ 4GKJQ 1VQNA 4JI4Q 4A3CH 4DV0Q 4JC0A 3T1YQ 1UWVA 5IYBG 2QA4A 2K50A 3HKSA 3DLLA 2NVXH 5IT9c 1X56A 2K75A 2JA9A 3KF8B 4GOPB 4AQYL 1N36L 4DR4Q 3GDEA 4DR5L 4NB3A 1JB7A 4GLVB 1CUKA 3EIVA 3I4NG 4B3RL 1JT8A 1VQDA 2WAQE 4BBRG 4JYAL 3H0GH 2R7DA 2Q2TA 1FJGQ 1K9MC 1FL0A 1E1OA 1EIFA 2RCNA 3B6YA 2VNUD 3KLWA 1VQMA 1QVFA 4AIMA 4X6AH 3BJUA 3TEHB 4GKKL 4GKJL 1A8VA 1ASYA 4DV0L 1RIPA 4A3MG 1XJVA 3J80i 5GAHC 4A3JG 4B3MQ 4LF7L 4BY1G 1K3RA 2EQSA 3G4SA 2UXBL 4DR4L 5IYBH 3AEVA 3WWVA 2A8VA 1NTGA 1OXVA 1W3SA 2IHEA 4IJHA 4DAMA 5JJIA 3M4QA 5E7NA 3NEMA 2OTJA 4JI2L 2B29A 2ZM6Q 1HNWL 3HOZH 1Y14B 1V1QA 3KOJA 3KFUA 4GLXA 2NZHA 2LXJA 1EQRA 1FJGL 5M3MH 5ELOA 3I4NH 3KYHC 4MTNA 3L0OA 4PMWA 3FP9A 2MQHA 4BBRH 2KBNA 4KI0A 1S72A 1Q7YC 3S1QH 1YHBA 4YWKA 1KD1C 1WCMG 3STBC 3UDFA 3CCEA 3OW2A 1PH8A 4LF4Q 1I5FA 3GTMH 2NVQH 2VQFQ 1AE2A 3OTOQ 2ATWA 2JA5G 4NPSA 2R7FA 1C7YA 1PH2A 3HKZG 1A0IA 1E7ZA 1M1KC 4JI7L 4OONA 4A3MH 1EWIA 2Q2UA 1XNQQ 1XPRA 3HOVG 4A93H 4LF9Q 4A3JH 2CWAA 3HOXG 4BY1H 1L2FA 4GN4B 1YJNA 4X62L 1H95A 4C3HH 3GTKH 1Z47A 2R7ZG 1MJEA 4EX5A 4DV4L 4GN3B 5IWAQ 4DR1Q 4P73A 4YCWA 1PFSA 1TWCH 1Y1VH 4L5TA 5LMUQ 5IYDH 2MO0A 1VQEA 2RHQB 1N9WA 4YCVA 1UE5A 4DR2Q 3NENA 3RLNA 3BZCA 1O7IA 4IPHA 4UP8A 4JG2A 1K8GA 5C0XJ 4A3IH 3S2HH 4HJ9A 3CC7A 2YTYA 2VQFL 4A3KH 3PF5A 1T9HA 2KHIA 1WCMH 2NN6I 1JJCB 5JEAG 1PYBA 2I5MX 3UE1A 3I56A 2V1CC 2NZOA 4DK3C 4X65L 1XNQL 3GTJH 5GAGC 2NVTH 1I94Q 3FKIG 4R4IA 4YY3Q 1YIJA 2FXQA 1J5EQ 2YTXA 4UY8C 3HOVH 3PUVA 1X9NA 3LGJA 3PIOA 3S24A 1IBKQ 3HOXH 1CSQA 4IPCA 5IWAL 4DR1L 4DV7Q 1VQHA 1PHJA 4BY7H 2UUBQ 4OX9Q 3HOWH 4YWLA 4JI8L 1G51A 2R7ZH 3H3VH 2JEBI 5M5XH 3MEFA 3HFZB 4DR2L 1IL2A 4QGUA 1OXTA 1KAWA 3I55A 4P71A 1YHQA 1VQPA 4LWCA 2LSSA 2K5NA 4KHZA 3HKZE 1CKNA 2JE6I 3PO3H 3I7FA 2CFMA 2Y0SE 2QEXA 1XNRQ 1I94L 4AH6A 1K73C 4OWXB 4YY3L 1YZ6A 2MO1A 3DM3A 3G6EA 4NXNQ 4HIKA 3FKIH 4AQYQ 3K7UC 4TQUS 1SRUA 3F8TA 4A3DH 3M85A 2UUBL 4OX9L 2F4VQ 3PUYA 1X3FA 4K0KL 2I5HA 1LYLA 3VDYA 3J81j 3TQYA 1I3QH 1OXUA 1QUQA 4LUOA 5LMNQ 4B3RQ 1M90C 3AQQA 4RG1A 3CCUA 4JYAQ 1CSPA 2N8NA 1K8AC 4R4OA 1IBLL 1PH1A 1U5KA 4PZ7A 1TWGH 2KENA 1HZCA 1YHAA 4DV2Q 3AYHB 1SLJA 2E2HH 4XTCS 2ZTDA 1EUJA 2QGQA 4NXNL 1VS0A 3ICEA 1CKMA 2DUDA 4LF7Q 4JV5Q 5IYCH 4LF6L 1B7YB 5LMNW 2UXBQ 3A5ZB 2F4VL 2Q2IA 4A3EG 4JBKA 1N33Q 3HOZG 2C35B 5M3MG 2NN6G 2PI2A 2N3SA 1KRTA 4JI2Q 2Z0SA 5C0XI 3CCQA 5LMNL 3G71A 1XPOA 1IBMQ 1HNWQ 1XMOL 3I4OA 3J81c 4BXXG 3PUWA 4JI5L 3ULJA 3UDGA 1RL2A 1EIYB 3MXNB 5IP9G 2PQAA 4O2DA 2UXDQ 2D0OA 4DV2L 4QQBX 1UE1A 1UEBA 1PH4A 1B70B 1Q8KA 3G48A 4A93G 1GD7A 1VCIA 5GAEC 1Q46A 3CMAA 2IY5B 4JV5L 4JI7Q 5M3FH 1WYDA 1KQSA 2PNHA 4JBJA 4DUYL 1SROA 4L5SA 5J3BA 1N33L 2Z6KA 3U50C 3JAMc 3PSIA 3UDXA 1Y1VG 4LNQA 4X62Q 1IBML 2UXCL 5IYDG 2R93H 2JK8A 4A3EH 4JOIA 4DV4Q 1X55A 1Y1WG 4LUVA 5AJ3L 2H5XA 4JI1Q 2ASBA 4Y7NH 2Q2HA 4A3IG 4A3KG 1UE6A 3TREA 3RN5A 3PF4A 1C0AA 4BXXH 2UXDL 1QVCA 2JQOA 1JJGA 3CMEA 1VQ7A 4JBMA 4LUZA 3RZOH 1I6HH 3PUXA 5IP9H 1EFWA 1XTDA 2VS1A 4R4TA 5HY6A 4IPGA 3CPFA 4BA1I 3GO5A 1TWFH 2Y0SG 3T1HL 1YVCA 3RR5A 2Z6KC 4PZ8A 5IE8A 4X65Q 4HJ5A 1PH6A 3S1NH 3A5UA 1LTLA 4LFCL 5C3EH 1EOVA 3TS0A 1JE5A 4J15A 1JJ2A 4BY7G 4GS3A 4JOIC 2GVBA 2K14A 3PGZA 3HOWG 1VQJA 3KJPA 2L15A 4LFBL 2VUMH 2VZAA 1NMGA 1Q82C 5JJKA 2ES2A 2XGTA 1NJIC 3J81i 4YWMA 3AFQA 1X65A 4JI1L 1CKNB 4JI8Q 3F2DA 4JI3Q 3HOYG 1IXRA 2EIFA 3L7ZC 2JA7H 2JA8H 3PO2G 5M5WH 3NBHB 1Y1WH 1WJJA 1L1OA 2OQKA 5DLQE 3CCRA 1G291 1SN8A 3PO3G 2PI2E 3I2ZA 3BZKA 3PIPA 1Q1BA 4DV6L 1GVPA 2EXDA 1TWHH 1VQOA 5FJ8G 3K7AH 4OWTB 1HJPA 2JJQA 5C0XG 4DV5Q 2KCTA 3W1BA 2KHJA 1B8AA 1BKBA 3KF6A 2R92G 4L5RC 1QUQB 2R6GA 4A3DG 3EN2A 2BH2A 3JAMi 4ALPA 3F2BA 3D31A 1Q86C 2UU9L 1N32L 1V43A 1GM5A 4A3FH 4QL5A 4OWWB 4K0KQ 2WFWA 3STBD 3CF5A 4JI3L 3HOUH 2WB1G 1L1OC 3OYYA 4IO9A 4A3BH 2AMCB 2ZJPA 2XTIA 4LFAQ 4POFA 2OTLA 1BBWA 2JA6G 3HOYH 1Q81C 1IBLQ 2IX0A 3PO2H 4IFDJ 1GO3E 2D0PA 2YU9H 4EQ5A 4LF5Q 4HJ8A 4DV5L 1VQBA 2OQ0A 1FVIA 5FJ8H 5IYCG 2UUCL 3CAMA 2IX1A 2GN5A 5IP7H 3A74A 2VY3A 2R92H 1Z9FA 1YI2A 3S15H 4DPGA 4FDBA 4LF6Q 3W5OA 3L2PA 4YHHQ 1VQGA 4C3JH 4KHPQ 2PQAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AH9 A;  4NXM Q;  1E1T A;  1KL9 A;  4A4I A;  4ME3 A;  3CXC A;  4LFA L;  2JEA I;  2N78 A;  1XMO Q;  1YEZ A;  4A76 A;  1XMQ Q;  1HH2 P;  4LF8 L;  4JI5 Q;  2E2J H;  3TRZ A;  2IT1 A;  1HNZ L;  3S17 H;  4B3T Q;  5BR8 Q;  2YV5 A;  2JA6 H;  3ER0 A;  4LF5 L;  3GTO H;  1A63 A;  3E9H A;  3ZJY C;  2N49 A;  4X64 L;  3GD7 A;  3KDF A;  2CQO A;  3CPW A;  3FHW A;  3U58 A;  4DV3 Q;  1IYJ B;  4AYB E;  3J80 c;  2YTV A;  1SFO H;  4IOC A;  5M3F G;  2OCE A;  3D0F A;  5C44 H;  3CP0 A;  1KHI A;  1MKH A;  5GAD C;  3CC2 A;  1OXS C;  3CCV A;  4DUY Q;  1XPU A;  4DR3 L;  2R93 G;  4YHH L;  4HIO A;  3W1G A;  4GNX A;  1CKO A;  2HIV A;  2ID0 A;  3CCM A;  2WB1 E;  5M5Y H;  4KHP L;  2UXC Q;  4NXM L;  4RMF A;  1EQQ A;  1XMQ L;  1N8R C;  1C9O A;  4A3G G;  1W2B A;  5AJ3 Q;  4B3T L;  4OO1 I;  4APV A;  5BR8 L;  1PH5 A;  1LUZ A;  2A19 A;  4BBS H;  4DR6 Q;  2CWP A;  4X66 L;  3F2C A;  4DV3 L;  1P8L A;  4DV1 Q;  3TS2 A;  4KLK A;  3J7A 5;  3CD6 A;  2ZTC A;  1SE8 A;  4C2M H;  1X54 A;  1I50 H;  2AWN A;  2D62 A;  1ASZ A;  3M7N A;  5C3E G;  4GN5 A;  1WI5 A;  1YNX A;  1VQL A;  3T1H Q;  4GNX C;  1EYG A;  1PYS B;  1AE3 A;  1HZA A;  1WFQ A;  5JJL A;  2DGY A;  1HZB A;  4LFC Q;  2VUM G;  3M9B A;  1L1O B;  2ALY B;  1N34 L;  1J6Q A;  1VQ6 A;  1SR3 A;  4UP9 A;  4IFD I;  4JBW A;  3K8A A;  4DKA C;  4B3S L;  3RN2 A;  2JA7 G;  1TXY A;  2JA8 G;  3I4M G;  4LFB Q;  3M3Y H;  4WJ4 A;  4BA2 I;  2KCM A;  1VQA A;  3K80 C;  4JI6 Q;  4HID A;  5FLX c;  5GQO A;  1VQI A;  5C4J H;  4DR6 L;  1DGS A;  4A3G H;  4DNI A;  4JI4 L;  3U4Z A;  3KF6 B;  4DV1 L;  3T1Y L;  4PZ6 A;  3CCL A;  3K0X A;  4LW1 A;  1OXX K;  2LXK A;  4DV6 Q;  1E24 A;  1GKH A;  4XIG S;  5K36 G;  2CCZ A;  1E3P A;  1YIT A;  2ZJR A;  1X3G A;  4P74 A;  1PV4 A;  2I5L X;  3RNU A;  3SGI A;  1MIU A;  4R1J A;  3ULL A;  4A75 A;  2VW9 A;  1VQ4 A;  1VQ9 A;  3GTQ H;  4A3F G;  2MFI A;  2UUA Q;  3BU2 A;  3M4P A;  5ELN A;  1YBY A;  2UU9 Q;  4GOP A;  3HOU G;  2E5L Q;  1N32 Q;  3PCO B;  3KJO A;  2K52 A;  2ZTE A;  4A3B G;  2CKZ B;  2BA1 A;  4PG3 A;  4JI6 L;  1LM0 A;  4WJ3 M;  4IJL A;  1Q1E A;  3I4M H;  1OTC A;  2MNA A;  2HIX A;  3F1Z A;  1TWA H;  5IY0 A;  3JC6 6;  1WOC A;  4QIW E;  4B3M L;  1PVO A;  3S2D H;  1VQF A;  1KRS A;  4R4C A;  3S1R H;  1VQ8 A;  1BVS A;  1G6P A;  3A0J A;  1A62 A;  3UE0 A;  1NBW A;  5GRO A;  2E8G A;  2A1A A;  2WP8 J;  3E9I A;  4AYB G;  5IP7 G;  2E2I H;  2B63 G;  1D7Q A;  3CC4 A;  4POG A;  1NE3 A;  3K81 C;  1K83 H;  2K4K A;  1S3O A;  2ZM6 L;  2UUC Q;  1S40 A;  3AFP A;  4YCU A;  4C3I H;  4GOP C;  2UUA L;  4OO1 G;  1NY4 A;  2AKW B;  3S1M H;  2E5L L;  1UE7 A;  3RLO A;  5EAY A;  4Y52 H;  1HNX Q;  1VQC A;  3E0E A;  4DUZ Q;  4HJA A;  5JEA J;  3J7Z C;  2PMZ E;  2RF4 A;  4UP7 A;  3KDF B;  4LF4 L;  3UDI A;  3OTO L;  5C4X G;  2NVY H;  1QVG A;  4LF8 Q;  4DAY B;  1HNZ Q;  3U4V A;  1L0W A;  4P75 A;  2VQE Q;  1YJ9 A;  1FGU A;  1KIX A;  2JA5 H;  1D8L A;  2OWO A;  4X64 Q;  5H1S E;  3CCS A;  3GTL H;  4LF9 L;  1HZ9 A;  4IFD G;  5C44 G;  4GNX B;  4IOA A;  4DR7 Q;  4JI0 Q;  1MJC A;  2B63 H;  3Q8D A;  2HQL A;  4IPD A;  4JCV E;  2HHH Q;  2HT1 A;  2F3I A;  2IHF A;  2K5V A;  3H15 A;  4UPA A;  5LMU L;  4DR3 Q;  3S16 H;  1IZ6 A;  3M4O H;  5FLM G;  2VL6 A;  4QJF A;  1HNX L;  4DUZ L;  4QY7 A;  2WAQ G;  3GTG H;  1U0L A;  4R4Q A;  1X3E A;  3ULP A;  4A3L G;  4L5Q A;  4HJ7 A;  4GLA C;  1SMX A;  3RZD H;  3NEL A;  1KXL A;  1Q12 A;  3CW2 C;  4BBS G;  2BA0 A;  4A3C G;  2K5H A;  1HR0 Q;  5C4X H;  2YYZ A;  2VQE L;  2AWO A;  3RLF A;  4X66 Q;  1NMF A;  1PH9 A;  1PH7 A;  1JMC A;  5HGQ A;  1J5E L;  4DK6 C;  4HIM A;  2I0Q A;  3ERS X;  2F52 A;  3EBE A;  4H02 A;  4OXP A;  3S14 H;  4DR7 L;  1IBK L;  1KC8 C;  1X6O A;  4MZ9 A;  1N36 Q;  3IRB A;  4JI0 L;  3PV0 A;  4TVA B;  4DV7 L;  2HHH L;  1VQ5 A;  2BH8 A;  3CQZ H;  4DR5 Q;  3H0G G;  1YJW A;  4O0A A;  1E22 A;  2GVA A;  1P16 A;  1VQK A;  2ZJQ A;  3PUZ A;  4P72 A;  2AHO B;  1N34 Q;  1R9T H;  1HR0 W;  5FLM H;  1QZH A;  4B3S Q;  3GTP H;  2B3G A;  1K0R A;  3CCJ A;  1QZG A;  4A3L H;  1HR0 L;  1PH3 A;  3H3V I;  2RHS B;  1BBU A;  4MNO A;  1PA6 A;  1XNR L;  1V9P A;  4GKK Q;  4GKJ Q;  1VQN A;  4JI4 Q;  4A3C H;  4DV0 Q;  4JC0 A;  3T1Y Q;  1UWV A;  5IYB G;  2QA4 A;  2K50 A;  3HKS A;  3DLL A;  2NVX H;  5IT9 c;  1X56 A;  2K75 A;  2JA9 A;  3KF8 B;  4GOP B;  4AQY L;  1N36 L;  4DR4 Q;  3GDE A;  4DR5 L;  4NB3 A;  1JB7 A;  4GLV B;  1CUK A;  3EIV A;  3I4N G;  4B3R L;  1JT8 A;  1VQD A;  2WAQ E;  4BBR G;  4JYA L;  3H0G H;  2R7D A;  2Q2T A;  1FJG Q;  1K9M C;  1FL0 A;  1E1O A;  1EIF A;  2RCN A;  3B6Y A;  2VNU D;  3KLW A;  1VQM A;  1QVF A;  4AIM A;  4X6A H;  3BJU A;  3TEH B;  4GKK L;  4GKJ L;  1A8V A;  1ASY A;  4DV0 L;  1RIP A;  4A3M G;  1XJV A;  3J80 i;  5GAH C;  4A3J G;  4B3M Q;  4LF7 L;  4BY1 G;  1K3R A;  2EQS A;  3G4S A;  2UXB L;  4DR4 L;  5IYB H;  3AEV A;  3WWV A;  2A8V A;  1NTG A;  1OXV A;  1W3S A;  2IHE A;  4IJH A;  4DAM A;  5JJI A;  3M4Q A;  5E7N A;  3NEM A;  2OTJ A;  4JI2 L;  2B29 A;  2ZM6 Q;  1HNW L;  3HOZ H;  1Y14 B;  1V1Q A;  3KOJ A;  3KFU A;  4GLX A;  2NZH A;  2LXJ A;  1EQR A;  1FJG L;  5M3M H;  5ELO A;  3I4N H;  3KYH C;  4MTN A;  3L0O A;  4PMW A;  3FP9 A;  2MQH A;  4BBR H;  2KBN A;  4KI0 A;  1S72 A;  1Q7Y C;  3S1Q H;  1YHB A;  4YWK A;  1KD1 C;  1WCM G;  3STB C;  3UDF A;  3CCE A;  3OW2 A;  1PH8 A;  4LF4 Q;  1I5F A;  3GTM H;  2NVQ H;  2VQF Q;  1AE2 A;  3OTO Q;  2ATW A;  2JA5 G;  4NPS A;  2R7F A;  1C7Y A;  1PH2 A;  3HKZ G;  1A0I A;  1E7Z A;  1M1K C;  4JI7 L;  4OON A;  4A3M H;  1EWI A;  2Q2U A;  1XNQ Q;  1XPR A;  3HOV G;  4A93 H;  4LF9 Q;  4A3J H;  2CWA A;  3HOX G;  4BY1 H;  1L2F A;  4GN4 B;  1YJN A;  4X62 L;  1H95 A;  4C3H H;  3GTK H;  1Z47 A;  2R7Z G;  1MJE A;  4EX5 A;  4DV4 L;  4GN3 B;  5IWA Q;  4DR1 Q;  4P73 A;  4YCW A;  1PFS A;  1TWC H;  1Y1V H;  4L5T A;  5LMU Q;  5IYD H;  2MO0 A;  1VQE A;  2RHQ B;  1N9W A;  4YCV A;  1UE5 A;  4DR2 Q;  3NEN A;  3RLN A;  3BZC A;  1O7I A;  4IPH A;  4UP8 A;  4JG2 A;  1K8G A;  5C0X J;  4A3I H;  3S2H H;  4HJ9 A;  3CC7 A;  2YTY A;  2VQF L;  4A3K H;  3PF5 A;  1T9H A;  2KHI A;  1WCM H;  2NN6 I;  1JJC B;  5JEA G;  1PYB A;  2I5M X;  3UE1 A;  3I56 A;  2V1C C;  2NZO A;  4DK3 C;  4X65 L;  1XNQ L;  3GTJ H;  5GAG C;  2NVT H;  1I94 Q;  3FKI G;  4R4I A;  4YY3 Q;  1YIJ A;  2FXQ A;  1J5E Q;  2YTX A;  4UY8 C;  3HOV H;  3PUV A;  1X9N A;  3LGJ A;  3PIO A;  3S24 A;  1IBK Q;  3HOX H;  1CSQ A;  4IPC A;  5IWA L;  4DR1 L;  4DV7 Q;  1VQH A;  1PHJ A;  4BY7 H;  2UUB Q;  4OX9 Q;  3HOW H;  4YWL A;  4JI8 L;  1G51 A;  2R7Z H;  3H3V H;  2JEB I;  5M5X H;  3MEF A;  3HFZ B;  4DR2 L;  1IL2 A;  4QGU A;  1OXT A;  1KAW A;  3I55 A;  4P71 A;  1YHQ A;  1VQP A;  4LWC A;  2LSS A;  2K5N A;  4KHZ A;  3HKZ E;  1CKN A;  2JE6 I;  3PO3 H;  3I7F A;  2CFM A;  2Y0S E;  2QEX A;  1XNR Q;  1I94 L;  4AH6 A;  1K73 C;  4OWX B;  4YY3 L;  1YZ6 A;  2MO1 A;  3DM3 A;  3G6E A;  4NXN Q;  4HIK A;  3FKI H;  4AQY Q;  3K7U C;  4TQU S;  1SRU A;  3F8T A;  4A3D H;  3M85 A;  2UUB L;  4OX9 L;  2F4V Q;  3PUY A;  1X3F A;  4K0K L;  2I5H A;  1LYL A;  3VDY A;  3J81 j;  3TQY A;  1I3Q H;  1OXU A;  1QUQ A;  4LUO A;  5LMN Q;  4B3R Q;  1M90 C;  3AQQ A;  4RG1 A;  3CCU A;  4JYA Q;  1CSP A;  2N8N A;  1K8A C;  4R4O A;  1IBL L;  1PH1 A;  1U5K A;  4PZ7 A;  1TWG H;  2KEN A;  1HZC A;  1YHA A;  4DV2 Q;  3AYH B;  1SLJ A;  2E2H H;  4XTC S;  2ZTD A;  1EUJ A;  2QGQ A;  4NXN L;  1VS0 A;  3ICE A;  1CKM A;  2DUD A;  4LF7 Q;  4JV5 Q;  5IYC H;  4LF6 L;  1B7Y B;  5LMN W;  2UXB Q;  3A5Z B;  2F4V L;  2Q2I A;  4A3E G;  4JBK A;  1N33 Q;  3HOZ G;  2C35 B;  5M3M G;  2NN6 G;  2PI2 A;  2N3S A;  1KRT A;  4JI2 Q;  2Z0S A;  5C0X I;  3CCQ A;  5LMN L;  3G71 A;  1XPO A;  1IBM Q;  1HNW Q;  1XMO L;  3I4O A;  3J81 c;  4BXX G;  3PUW A;  4JI5 L;  3ULJ A;  3UDG A;  1RL2 A;  1EIY B;  3MXN B;  5IP9 G;  2PQA A;  4O2D A;  2UXD Q;  2D0O A;  4DV2 L;  4QQB X;  1UE1 A;  1UEB A;  1PH4 A;  1B70 B;  1Q8K A;  3G48 A;  4A93 G;  1GD7 A;  1VCI A;  5GAE C;  1Q46 A;  3CMA A;  2IY5 B;  4JV5 L;  4JI7 Q;  5M3F H;  1WYD A;  1KQS A;  2PNH A;  4JBJ A;  4DUY L;  1SRO A;  4L5S A;  5J3B A;  1N33 L;  2Z6K A;  3U50 C;  3JAM c;  3PSI A;  3UDX A;  1Y1V G;  4LNQ A;  4X62 Q;  1IBM L;  2UXC L;  5IYD G;  2R93 H;  2JK8 A;  4A3E H;  4JOI A;  4DV4 Q;  1X55 A;  1Y1W G;  4LUV A;  5AJ3 L;  2H5X A;  4JI1 Q;  2ASB A;  4Y7N H;  2Q2H A;  4A3I G;  4A3K G;  1UE6 A;  3TRE A;  3RN5 A;  3PF4 A;  1C0A A;  4BXX H;  2UXD L;  1QVC A;  2JQO A;  1JJG A;  3CME A;  1VQ7 A;  4JBM A;  4LUZ A;  3RZO H;  1I6H H;  3PUX A;  5IP9 H;  1EFW A;  1XTD A;  2VS1 A;  4R4T A;  5HY6 A;  4IPG A;  3CPF A;  4BA1 I;  3GO5 A;  1TWF H;  2Y0S G;  3T1H L;  1YVC A;  3RR5 A;  2Z6K C;  4PZ8 A;  5IE8 A;  4X65 Q;  4HJ5 A;  1PH6 A;  3S1N H;  3A5U A;  1LTL A;  4LFC L;  5C3E H;  1EOV A;  3TS0 A;  1JE5 A;  4J15 A;  1JJ2 A;  4BY7 G;  4GS3 A;  4JOI C;  2GVB A;  2K14 A;  3PGZ A;  3HOW G;  1VQJ A;  3KJP A;  2L15 A;  4LFB L;  2VUM H;  2VZA A;  1NMG A;  1Q82 C;  5JJK A;  2ES2 A;  2XGT A;  1NJI C;  3J81 i;  4YWM A;  3AFQ A;  1X65 A;  4JI1 L;  1CKN B;  4JI8 Q;  3F2D A;  4JI3 Q;  3HOY G;  1IXR A;  2EIF A;  3L7Z C;  2JA7 H;  2JA8 H;  3PO2 G;  5M5W H;  3NBH B;  1Y1W H;  1WJJ A;  1L1O A;  2OQK A;  5DLQ E;  3CCR A;  1G29 1;  1SN8 A;  3PO3 G;  2PI2 E;  3I2Z A;  3BZK A;  3PIP A;  1Q1B A;  4DV6 L;  1GVP A;  2EXD A;  1TWH H;  1VQO A;  5FJ8 G;  3K7A H;  4OWT B;  1HJP A;  2JJQ A;  5C0X G;  4DV5 Q;  2KCT A;  3W1B A;  2KHJ A;  1B8A A;  1BKB A;  3KF6 A;  2R92 G;  4L5R C;  1QUQ B;  2R6G A;  4A3D G;  3EN2 A;  2BH2 A;  3JAM i;  4ALP A;  3F2B A;  3D31 A;  1Q86 C;  2UU9 L;  1N32 L;  1V43 A;  1GM5 A;  4A3F H;  4QL5 A;  4OWW B;  4K0K Q;  2WFW A;  3STB D;  3CF5 A;  4JI3 L;  3HOU H;  2WB1 G;  1L1O C;  3OYY A;  4IO9 A;  4A3B H;  2AMC B;  2ZJP A;  2XTI A;  4LFA Q;  4POF A;  2OTL A;  1BBW A;  2JA6 G;  3HOY H;  1Q81 C;  1IBL Q;  2IX0 A;  3PO2 H;  4IFD J;  1GO3 E;  2D0P A;  2YU9 H;  4EQ5 A;  4LF5 Q;  4HJ8 A;  4DV5 L;  1VQB A;  2OQ0 A;  1FVI A;  5FJ8 H;  5IYC G;  2UUC L;  3CAM A;  2IX1 A;  2GN5 A;  5IP7 H;  3A74 A;  2VY3 A;  2R92 H;  1Z9F A;  1YI2 A;  3S15 H;  4DPG A;  4FDB A;  4LF6 Q;  3W5O A;  3L2P A;  4YHH Q;  1VQG A;  4C3J H;  4KHP Q;  2PQA B; 
#chains in the Genus database with same CATH topology
 1JC7 A;  2EYH A;  3EQL C;  2JEA I;  1YEZ A;  3CU7 A;  1SYE A;  3BDC A;  2JA8 B;  4WOR A;  1UUP A;  1KDA A;  3S17 H;  5JOB A;  3ER0 A;  4LF5 L;  3E9H A;  3ZJY C;  2N49 A;  1O7L A;  3NQI A;  3J80 c;  1GUO A;  2SNS A;  1T5E A;  5M3F G;  2OCE A;  3TP7 A;  5DNF A;  1KHI A;  5GAD C;  3CCV A;  4DUY Q;  1XPU A;  4IAL A;  4DK1 A;  1CI3 M;  2R93 G;  2B2T C;  4GNX A;  2ID0 A;  4A3F B;  4TSS A;  5CGK A;  1STB A;  4A3G G;  1HUN A;  2WAC A;  4OO1 I;  3PO2 B;  1L0X B;  2CWP A;  4X66 L;  4DV3 L;  3TS2 A;  4XYO A;  1ASZ A;  2D62 A;  3VR5 A;  3A7L A;  4GN5 A;  4DN4 M;  2BDN A;  1O7Z A;  3MTS A;  1AE3 A;  1HZA A;  4XT1 B;  4DXF A;  2R92 B;  1HZB A;  1N34 L;  1J6Q A;  1SYB A;  4IFD I;  4JBW A;  1EY7 A;  3K8A A;  4C3J B;  4B3S L;  2JA8 G;  4K5V A;  3BYT B;  2KCM A;  2FMC A;  5C4J H;  4DR6 L;  2B2V C;  1DGS A;  3MWY W;  3U4Z A;  2QDB A;  4R9W A;  5JVH 3;  1QB5 D;  2EYM A;  3DWQ A;  3K0X A;  2EXZ A;  4XIG S;  1SFO B;  1E3P A;  1RTN A;  5CBE E;  1YIT A;  5C44 B;  1HTL D;  4BWG B;  3K57 A;  4HED A;  3GTQ H;  4A3F G;  1IYU A;  2UU9 Q;  2AQ2 B;  4GOP A;  3PCO B;  3KJO A;  2K52 A;  3L3O C;  4C1N I;  3EFX D;  2B2U C;  1AZQ A;  3I4M H;  2MNA A;  1LT4 D;  1QG7 A;  1JIC A;  5CBA E;  4Q5V A;  4B9W A;  1WOC A;  4KY7 A;  2F0U A;  4BBS B;  1KRS A;  3S1R H;  1VQ8 A;  3A0J A;  3UE0 A;  4ZRZ A;  3JAM E;  1I50 B;  2WP8 J;  1VF5 C;  3CC4 A;  5K36 H;  4POG A;  3K81 C;  1K83 H;  2K4K A;  2N88 A;  2JP1 A;  4C3I H;  4OO1 G;  1NY4 A;  5E4X A;  2AKW B;  3S1M H;  2E5L L;  3VR4 A;  1D5Z C;  2TSS A;  4HJA A;  5JEA J;  3J7Z C;  4UP7 A;  4LF4 L;  3UDI A;  2XRQ D;  3A8I E;  3NTK A;  3C46 A;  2RDH A;  2CQA A;  2F0W A;  1HNZ Q;  3QJY A;  3U4V A;  1L0W A;  1TS5 A;  3RD4 A;  1LV9 A;  1D8L A;  3C2P A;  1GHK A;  3CCS A;  4IFD G;  5C44 G;  4GNX B;  4C56 C;  3A8K E;  1MJC A;  2E2D C;  3Q8D A;  4IPD A;  4JCV E;  2HT1 A;  1I4X A;  2F3I A;  4DR3 Q;  3M4O H;  3WDN A;  3CRL C;  1A2U A;  3E5S A;  3I72 A;  5C6A A;  3DEP A;  3T4A C;  3K0Y A;  1QNU A;  4L5Q A;  4HJ7 A;  1SMX A;  3DWA A;  2XIW A;  1O78 A;  1IL8 A;  3CW2 C;  1H9R A;  4BBS G;  1TWA B;  4XQN A;  3RLF A;  1CM9 A;  1JMC A;  5G3L D;  3ERS X;  4OXP A;  3GTL B;  2MHV A;  4DR7 L;  3SHL A;  4DAY A;  1N36 Q;  1G91 A;  3IRB A;  2QIL A;  2HHH L;  2SOB A;  2BH8 A;  1EY9 A;  3H0G G;  1E2V A;  2ZJQ A;  1D1K A;  2AHO B;  3GTP H;  3TME A;  3SR1 A;  1HRJ A;  1HR0 L;  3H3V I;  3OSO A;  2NVY B;  2M2L A;  3GP7 A;  1PA6 A;  1V9P A;  3VR6 A;  1BDO A;  5KYI A;  3T1Y Q;  2K50 A;  3DLL A;  3HKZ B;  5IT9 c;  3S9W A;  4GOP B;  3ND9 A;  2Q8T A;  1SNC A;  1JB7 A;  1CUK A;  4J1M A;  2CHB D;  1VQD A;  3S16 B;  1QJO A;  2R7Z B;  3O13 A;  3R2I A;  4H0L C;  5EGT A;  1U4R A;  2RCN A;  4PMC A;  1K8M A;  2DNC A;  4K8I A;  4B9X A;  2OXP A;  1EIG A;  3OMC A;  3J80 L;  3MXP A;  5E4W C;  4A3J G;  4B3M Q;  3MXU A;  3X3N A;  1BCP C;  3EA6 A;  2UXB L;  3KUP A;  1NTG A;  1W3S A;  3M4Q A;  4FF4 A;  2OTJ A;  2WV6 D;  1HNW L;  3HOZ H;  1V1Q A;  3KOJ A;  3CQZ B;  3KFU A;  4JW0 A;  3I4N H;  1R9T B;  1EYA A;  3FP9 A;  3S1Q H;  1STY A;  1PH8 A;  1TR5 A;  3CCE A;  4NDX A;  1LTG D;  1SAP A;  2ATW A;  3HKZ G;  5KIX A;  1QE6 A;  3IFD A;  3DEO A;  2B2W C;  1II3 A;  4JI7 L;  3OIP A;  1VDZ A;  3D4R A;  3MXN A;  1XPR A;  4DU9 A;  3HOV G;  2CWA A;  4BY1 H;  1L2F A;  4X62 L;  2IX3 A;  1PLF A;  3KBG A;  1MJE A;  2R7Z G;  4EX5 A;  4GN3 B;  4YCW A;  5CV8 A;  1TS4 A;  5LMU Q;  1NCV A;  1VQE A;  3J7A F;  3NWT A;  1NR2 A;  3NEN A;  1R4Q B;  3BZC A;  5J22 A;  4UP8 A;  4HTH A;  1KDC A;  1K8G A;  4A3I H;  3S2H H;  4A3K H;  3PF5 A;  1F2L A;  2NZO A;  4X65 L;  5GAG C;  3FKI G;  4HN7 A;  1SJH D;  4R4I A;  5F2D A;  4YY3 Q;  1YIJ A;  3Q24 A;  3PIO A;  3S24 A;  4IPC A;  4BY7 H;  2UUB Q;  5CC4 A;  1Y8N B;  4A3E B;  4YWL A;  1V8Q A;  3MEF A;  5M3M B;  3VYU A;  3ERQ A;  1JE4 A;  1OXT A;  4Y7N B;  1KAW A;  2RVL A;  1VQP A;  5E3F A;  3VYR A;  3HKZ E;  1CKN A;  3VR2 A;  5D3I B;  4KV6 A;  3I7F A;  3K5N A;  4Q0F A;  3MZ5 A;  2QEX A;  2PQE A;  1K73 C;  1TWF B;  2NBF A;  3GV3 A;  3DM3 A;  4ZKC B;  5ELB A;  3SVM A;  4A93 B;  1PRT C;  1SMY C;  4TQU S;  4A3D H;  1RDP D;  4CKC A;  4C3H B;  1X3F A;  3QIA A;  3VDY A;  4GZY C;  1I3Q H;  1OXU A;  1TWC B;  1ZYR D;  4LUO A;  4B3R Q;  4IUN A;  1X32 A;  4ILW A;  3CCU A;  1SJE D;  1CSP A;  3FDT A;  1HZC A;  3A54 A;  4DV2 Q;  1WCM B;  2EVB A;  2E2H H;  2NVT B;  2DUD A;  5BN3 A;  3ONA B;  1VF7 A;  2K5D A;  4A3E G;  4JBK A;  1N33 Q;  1IW7 C;  4G7Z C;  2PPB C;  2I46 A;  5M3M G;  2EZV A;  2N3S A;  1U4P A;  3CHB D;  1KRT A;  4JI2 Q;  1V1P A;  5C0X I;  1XPO A;  4KKU A;  4ZLT F;  1SYG A;  2A6H C;  3WOE A;  1PDQ A;  3PUW A;  3SK6 A;  3UDG A;  1GUN A;  1H9K A;  1MGS A;  3MXN B;  4O42 A;  3W2D A;  1BO0 A;  3Q0A A;  1QIL A;  3H94 A;  4QQB X;  1UE1 A;  2QCP X;  1UEB A;  3KLS A;  4A93 G;  1JR0 D;  1GD7 A;  5GAE C;  5CV6 A;  2E75 C;  5M3F H;  2A68 D;  2PNH A;  4DUY L;  4DNT B;  3I73 A;  4C3H G;  2NUC A;  5J3B A;  2Z6K A;  3U50 C;  1XX8 A;  2R93 H;  1PZK D;  2F0D A;  2KCN A;  3I91 A;  2NN6 H;  4JI1 Q;  1H9J A;  2HUG A;  2WB1 B;  1DZ1 A;  1C0A A;  1QVC A;  1JJG A;  1TWG B;  4R8I A;  4JBM A;  4LUZ A;  5IP9 H;  1EFW A;  1XTD A;  1FNU A;  4R4T A;  4EVO A;  2B39 A;  2A74 C;  5IT9 L;  1PH6 A;  1FYC A;  2JN4 A;  1I4Q A;  4KY6 A;  2G9D A;  5C5M A;  4JOI C;  1BR9 A;  5ELC A;  4HCS A;  3KJP A;  3BS1 A;  1NMG A;  5JJK A;  4F88 A;  2ES2 A;  3LNN A;  3J81 i;  4YWM A;  4JI8 Q;  1CKN B;  3F2D A;  5I2X A;  2EIF A;  2RDG A;  4KD3 A;  2JA8 H;  3FPP A;  1Y1W H;  1WJJ A;  1DXM A;  1NSN S;  3CCR A;  1G29 1;  1SN8 A;  4EQN A;  2EXD A;  1VQO A;  1DYQ A;  1HJP A;  5C0X G;  4DV5 Q;  2F4I A;  5JPN C;  5CV7 A;  4N8X 1;  3MHB A;  3W1B A;  1Q8I A;  2KHJ A;  1B8A A;  4K6L A;  1C4Q A;  3JAM i;  4ALP A;  5BN5 A;  2UU9 L;  2MGS A;  4A3F H;  2WFW A;  1B1Z A;  3STB D;  2RCF A;  2RDF A;  2WB1 G;  1L1O C;  4IO9 A;  2R3Z A;  1VMC A;  4LFA Q;  3PO2 H;  2DN8 A;  5KGU A;  4IFD J;  2F0O A;  1I6H B;  3RZO B;  4HJ8 A;  1JWS D;  1A3U A;  1FVI A;  3R3O A;  5FJ8 H;  1ESR A;  1LO5 D;  5IYC G;  2IX1 A;  2GN5 A;  1V1P B;  3A74 A;  1FR3 A;  5D14 A;  2R92 H;  3LWE A;  4KMU C;  3QR8 A;  5C3E B;  4DPG A;  2NWG A;  2PZW A;  4EQO A;  4C3J H;  4KHP Q;  5EBC A;  1AH9 A;  1E1T A;  1KL9 A;  3CXC A;  2JA7 B;  1XMO Q;  1XMQ Q;  3TRZ A;  4JI5 Q;  1ILP A;  4CJ2 C;  1HNZ L;  2BDO A;  1IYJ B;  4AYB E;  3D6C A;  1SFO H;  2KEC A;  1DM0 B;  2RSO A;  5C44 H;  4RKB A;  3CC2 A;  1OXS C;  2BE5 D;  3P20 A;  3E0J A;  4DR3 L;  5K5P A;  2GA4 B;  1CA5 A;  4IUU A;  4TRD A;  4YHH L;  1CKO A;  1LTI D;  2WB1 E;  4NXM L;  1SXT A;  4RMF A;  4IQZ A;  4HCE A;  1CHP D;  2D9U A;  1ESF A;  4B3T L;  4APV A;  5BR8 L;  3HOY B;  1LUZ A;  3PMF A;  4BBS H;  1CZG A;  1HPC A;  1EIH A;  1FNW A;  4CBV A;  3CD6 A;  1SE8 A;  1X54 A;  1I50 H;  1JQY D;  3W3A A;  3M7N A;  5C3E G;  3I8Z A;  2DY7 A;  5M9O A;  1VQL A;  2A73 B;  3T1H Q;  5KRU A;  1EYG A;  3TN2 A;  1WFQ A;  3KLR A;  2ALY B;  3MC0 B;  1SR3 A;  4IUV A;  4UP9 A;  4PQX A;  2JA7 G;  1TXY A;  3IKJ A;  3M3Y H;  2LKV A;  1I4P A;  4JI6 Q;  1UNS A;  4HID A;  5FLX c;  1VQI A;  2E2J B;  1RHP A;  2A69 D;  1SNP A;  4DV1 L;  3T1Y L;  2JA6 B;  3GTO B;  4LW1 A;  2NYZ D;  4FP5 D;  3TP8 A;  3SK4 A;  2CCZ A;  1X3G A;  2B2Y C;  2K33 A;  1PV4 A;  1TS3 A;  4J8Q A;  2I5L X;  4L6T B;  3RNU A;  1VQ4 A;  3OIQ A;  4QCL A;  1JOO A;  2CW0 C;  2MFI A;  3BU2 A;  5ELN A;  3C1E A;  3KF8 A;  1PTO D;  2ZTE A;  1Y8O B;  1I4R A;  2Z4I A;  4IJL A;  1OTC A;  3KBX A;  2HIX A;  3F1Z A;  3OMG A;  1TWA H;  1U4M A;  3JC6 6;  4QIW E;  4B3M L;  1LT5 D;  3S2D H;  2K5W A;  2EYF A;  1BQQ T;  4N8F A;  1S5F D;  4LAA A;  2E8G A;  2A1A A;  3GTL H;  2B63 G;  3NTI A;  2UUC Q;  1S3O A;  1HFN A;  4YCU A;  3VR3 A;  2UUA L;  1UE7 A;  2JXM B;  3UI2 A;  1HNX Q;  2PMZ E;  2RF4 A;  4NW2 A;  2K03 A;  5C4X G;  2NVY H;  4A3G B;  1MI2 A;  2MJ8 A;  5FO9 B;  1M8A A;  4FF3 A;  4BS9 A;  4IOA A;  3OHX C;  1TVX A;  4JI0 Q;  1TU2 B;  4ZYS A;  3S16 H;  2IHF A;  5LMU L;  1NNX A;  3A8J E;  5D3D A;  1YNN D;  5FLM G;  1JOQ A;  2VL6 A;  2D2C C;  3NK9 A;  4QY7 A;  4DUZ L;  1DOL A;  2WAQ G;  1CA6 A;  1X3E A;  4IUP A;  2ZXR A;  2KOL A;  2K28 A;  4X3U A;  5HGT A;  4RGT A;  1ENA A;  1O7Y A;  2EE1 A;  1STA A;  2K5H A;  1B53 A;  1TKW B;  2VQE L;  5JJZ A;  2AWO A;  4G4K A;  2NTS A;  1G2S A;  4C1N K;  1NMF A;  1PH9 A;  1BF4 A;  2LFN A;  4H02 A;  3EBE A;  2E2I B;  2PCF B;  3DM1 A;  3PV0 A;  1EOT A;  3ITP A;  3CQZ H;  1E22 A;  1F2Z A;  4R8N A;  1VQK A;  3PUZ A;  1R9T H;  4JPB W;  5EKL A;  4F87 A;  3EVQ A;  1K0R A;  4A3L H;  4KY5 A;  5EJW A;  1PH3 A;  3E3X A;  4GKK Q;  4GKJ Q;  1VQN A;  1RCV D;  4A3C H;  4DV0 Q;  1UWV A;  2QA4 A;  3KF8 B;  2EY2 A;  3GDE A;  4YIJ A;  4KHV A;  4DR5 L;  4RA8 A;  1I6V C;  4B3R L;  5FK9 C;  1JT8 A;  2WAQ E;  4BBR G;  2R7D A;  4MHE A;  5EQ0 A;  2J7Z A;  1K9M C;  1E1O A;  1EIF A;  4QF4 A;  3KLW A;  1VQM A;  4KD4 A;  3J80 E;  3BJU A;  1XJV A;  4PV1 C;  1D2B A;  4MN3 A;  1ET6 A;  1DON A;  4DR4 L;  5IYB H;  3AEV A;  3OW7 A;  3BVG A;  1TY2 A;  4DAM A;  5E7N A;  4JI2 L;  1Y14 B;  1Z7T A;  1FJG L;  5M3M H;  3KYH C;  4MTN A;  4RWS C;  3L0O A;  1YHB A;  2BOS A;  4YWK A;  3J7Y W;  1LTA D;  1QOH A;  5C4H A;  1BOS A;  1I5F A;  3HP3 A;  1YNJ C;  3T16 A;  1CTM A;  2R7F A;  3OPO A;  1C7Y A;  4MTK A;  1A0I A;  1EWC A;  4A3M H;  2Q2U A;  4A93 H;  2EDG A;  1SDF A;  2NVX B;  2PYK A;  1F9R A;  3TP6 A;  4C3H H;  2VB2 X;  2ZT9 C;  1B2T A;  3ZYY X;  4DR1 Q;  1Q3L A;  1TWC H;  3T56 B;  1TQO A;  3D3R A;  3PQI A;  2ICI A;  3H0G B;  4YCV A;  4DR2 Q;  4G57 A;  1O7I A;  4JG2 A;  5FLX L;  5C0X J;  2F0T A;  4KN7 C;  2VQF L;  4RHS A;  1EL0 A;  2KHI A;  4UHV A;  1WCM H;  1GJX A;  1ENC A;  1JJC B;  3I56 A;  3CKI B;  2NVT H;  5CMD A;  1XNQ L;  2EY5 A;  1S5E D;  2K7V A;  4K14 A;  1J5E Q;  2YTX A;  4K2K A;  1IBK Q;  3QWN A;  3K58 A;  3HOX H;  1DOK A;  2F0L A;  5IWA L;  1VQH A;  1JWM D;  4OX9 Q;  4JI8 L;  1T5X D;  5CR3 A;  4P71 A;  5NUC A;  4KHZ A;  1JWU D;  3GTM B;  1SBB B;  4IUT A;  2Y0S E;  1Z6H A;  3NBH A;  1I94 L;  5JEA H;  1B50 A;  1PTO F;  5C0X H;  4NXN Q;  3I70 A;  4A3J B;  5I9P A;  1UAP A;  4AQY Q;  1SRU A;  3PUY A;  2SNM A;  4H7B A;  2QW7 A;  3U9O A;  2DJF C;  5LMN Q;  2ZXO A;  2HD3 A;  4JYA Q;  1D5X C;  2N8N A;  1SND A;  1KNE A;  1K8A C;  3G6J B;  1U5K A;  2F03 A;  1EFI D;  1TWG H;  1EWH A;  2ZTD A;  1B3Q A;  1EUJ A;  1GOZ A;  5IYC H;  4U67 3;  5LMN W;  1CT1 D;  3HOV B;  2F4V L;  2VB3 X;  2FHT A;  3CCQ A;  3NBI A;  3HOW B;  3G71 A;  5J1Z A;  5DM6 3;  3D4W A;  3A55 A;  1XMO L;  2BCO A;  3I4O A;  4BXX G;  4JI5 L;  1JB3 A;  2PQA A;  2D0O A;  4L63 B;  3PO3 B;  1B70 B;  1B9N A;  2F3V A;  3SE0 A;  3F2U A;  4JV5 L;  1KQS A;  1WYD A;  2MUY A;  4JBJ A;  3N52 A;  3FKI B;  5ELD A;  3WOF A;  1J8I A;  3PSI A;  4ZCK A;  2F0I A;  5IYD G;  3DHQ A;  4DV4 Q;  1X55 A;  3NSW A;  5C3X A;  2NTT A;  4LUV A;  1EY5 A;  1F2M A;  5LL6 X;  2Q2H A;  3RN5 A;  3PF4 A;  1X3Q A;  2F0M A;  2UXD L;  3CME A;  1I6H H;  3RZO H;  5IT9 E;  2FMM A;  5EKK A;  2CH4 A;  3GO5 A;  4LJZ C;  3T1H L;  3RR5 A;  3I4L A;  4DXG A;  5C3E H;  1JJ2 A;  1KLG D;  4J15 A;  1GUW A;  3IAY A;  2GVB A;  3HOW G;  1VQJ A;  4HR7 B;  3P1H A;  2XGT A;  1NJI C;  1X65 A;  4JI3 Q;  1EEI D;  2JA7 H;  3K59 A;  4FXD A;  1FD7 D;  3NBH B;  5DLQ E;  3VA7 A;  1SNM A;  3PO3 G;  2PI2 E;  3I2Z A;  3BZK A;  1H9S A;  5FO7 B;  4CJ1 B;  2L1B A;  4DAP A;  2Z6B A;  3N6R A;  5ELE A;  1ZKO A;  1BKB A;  4PMB A;  3KF6 A;  3EN2 A;  2BH2 A;  3BVM A;  1Q86 C;  5FKA C;  4V19 0;  4K0K Q;  3CF5 A;  5ISR A;  2L4N A;  1PTO B;  1ILQ A;  1ZYR C;  1ONL A;  3HOY H;  1Q81 C;  1IBL Q;  2WKD A;  5C4J B;  1WTR A;  1S5B D;  4QUF A;  3D4D A;  2L0C A;  4LF5 Q;  3GQB A;  1VQB A;  2UUC L;  4ULL A;  4FF2 A;  3CAM A;  3LX0 A;  1RTO A;  3FRP B;  3BG3 A;  2FFK B;  3W5O A;  3VA5 A;  1I4H A;  5KND A;  2CH4 W;  3D6W A;  1IBM Q;  1VQG A;  2PQA B;  1IHZ A;  1HUM A;  5FOB B;  2L12 A;  4A4I A;  2A6E C;  4QB4 A;  3I4M B;  2E2J H;  2I07 B;  2IT1 A;  1LAB A;  4JVZ A;  4K5X A;  2YV5 A;  2JA6 H;  1A63 A;  3GTO H;  3CPW A;  3GD7 A;  3U58 A;  4WRD A;  4DNR B;  4DV3 Q;  1TWH B;  4UAI A;  1A15 A;  3D0F A;  1TY0 A;  1U9R A;  3CP0 A;  1MKH A;  2EYO A;  3BDO A;  4FNF A;  4C3I B;  1GUG A;  2A68 C;  2HIV A;  4RGO S;  2UXC Q;  2XN9 C;  3IFT A;  1MSH A;  1C9O A;  1JCK B;  1W2B A;  5AJ3 Q;  2IL8 A;  1RF2 D;  2R61 A;  3HG9 A;  3QO2 A;  1PH5 A;  1ZEQ X;  4DR6 Q;  4CJ0 B;  3F2C A;  2YU9 B;  1P8L A;  2B2V A;  1PRT D;  1MD2 D;  3J7A 5;  1AZP A;  4KKT A;  1DCZ A;  1XXG A;  2AWN A;  2F0E A;  1NAP A;  4MIU A;  1PYW D;  4GNX C;  1PYS B;  4AYB B;  2LY7 A;  2PNR C;  3S15 B;  5JJL A;  4LFC Q;  3M9B A;  1VQ6 A;  4F7X A;  4DKA C;  3RN2 A;  2P5Z X;  3I4M G;  1H9S B;  1EY0 A;  4BA2 I;  3K80 C;  5C3W A;  2IWH A;  5GQO A;  4A3G H;  2B2U A;  4DNI A;  3KF6 B;  1AN8 A;  3CCL A;  3TSS A;  2LXK A;  5A35 A;  4XDX A;  4DV6 Q;  2AQ3 B;  5K36 G;  1IW7 D;  4P74 A;  4C3I G;  3EJI A;  3DXJ C;  4KJO A;  1KTK A;  3SGI A;  4R1J A;  4A75 A;  2A6H D;  2VW9 A;  2JSO A;  1YBY A;  2E5L Q;  5M5Y B;  2MPM A;  2FJ2 A;  4PG3 A;  2BA1 A;  1LM0 A;  4WJ3 M;  1Q1E A;  3K6O A;  5IY0 A;  4XQJ A;  1PVO A;  1VQF A;  5CV9 A;  2F0G A;  1B9M A;  2J0T D;  5GRO A;  4C2M B;  5IP7 G;  4AYB G;  1WTP A;  2E2I H;  1D7Q A;  4N9T A;  1NE3 A;  1S40 A;  1RD9 D;  4GOP C;  2F1M A;  5T1G A;  1HA6 A;  3LWU A;  5EAY A;  3MFY A;  3E0E A;  4U68 A;  1PFN A;  1DD2 A;  4LF8 Q;  1BBX C;  1KIX A;  2RA4 A;  3VYT A;  3I90 A;  4X64 Q;  4ZUJ A;  1HZ9 A;  1B44 D;  2EPB A;  2KVM A;  4QIW B;  1EU3 A;  4Z9C B;  4DR7 Q;  1BXT A;  2HQL A;  3FVQ A;  2HHH Q;  2K5V A;  1SYD A;  3H15 A;  4UPA A;  1U4L A;  1HTP A;  2HCC A;  4OO1 H;  4QJF A;  4R4Q A;  3S1Q B;  2F3W A;  3NEL A;  1KXL A;  1HR0 Q;  1OO9 B;  2PMZ B;  3RUZ A;  3VYS A;  4CDD C;  1J5E L;  4DGZ A;  4DK6 C;  2O5I C;  4KN4 C;  1IBK L;  3NPP A;  4BY1 B;  1X3P A;  4IFD H;  1L0Y B;  3CRK C;  2OF1 A;  1AFP A;  2NB0 A;  1VQ5 A;  1YJW A;  4O0A A;  1P16 A;  1SE2 A;  3TP5 A;  4XT3 B;  1HR0 W;  1QZH A;  5JPM C;  3CCJ A;  1QZG A;  1NUC A;  2L55 A;  3K5L A;  1SEB D;  1BBU A;  4MNO A;  1A3V A;  1BNZ A;  4JI4 Q;  2EYP A;  2JA5 B;  1E2W A;  2NVX H;  3R8B A;  4AQY L;  2X6L A;  1N36 L;  2WKC A;  3Q6S A;  2QKI C;  4K8J A;  2XWB B;  2ZXP A;  4N9P A;  4M1U B;  4GLV B;  2B63 B;  3EIV A;  1S4Z A;  1GUS A;  2F0K A;  3I4N G;  4JYA L;  3H0G H;  2PW5 A;  2RKS A;  2L11 A;  3GTG B;  3DWP A;  1FL0 A;  4ZK9 B;  1ET9 A;  2VNU D;  4AIM A;  3RZD B;  4X6A H;  3TEH B;  1STH A;  1RJT A;  1A8V A;  1ASY A;  1ICW A;  5C4X B;  2HQE A;  5GAH C;  1WTO A;  4M8A A;  4XXE A;  1QNK A;  4BY1 G;  2WIN B;  1K3R A;  4ABN A;  2AUJ D;  2B2W A;  3S14 B;  1EQT A;  1OXV A;  2IHE A;  5JJI A;  2KUM A;  1SE4 A;  1CHQ D;  2B29 A;  1B4O A;  1PZJ D;  2ZM6 Q;  4GLX A;  2NZH A;  5ELO A;  4IN3 A;  4RHR A;  5KEE A;  2MQH A;  1Q7Y C;  1KNA A;  2WAQ B;  3GTM H;  3OTO Q;  2JA5 G;  4NPS A;  1PH2 A;  1E7Z A;  1FNV A;  4OON A;  2H4O A;  4LF9 Q;  4A3J H;  2EY6 A;  1STN A;  1LT6 D;  4GN4 B;  1YJN A;  1H95 A;  4WJW A;  3IL8 A;  4CKE A;  1EZ6 A;  4DV4 L;  4P73 A;  3C1F A;  5IYD H;  2DNE A;  1PRT F;  5FLX E;  1W6K A;  2MO0 A;  3H91 A;  5TSS A;  1UE5 A;  4G7H C;  3RLN A;  4IPH A;  2E76 C;  4HAE A;  3CC7 A;  4QMG A;  1T9H A;  2NN6 I;  3MA2 B;  4DK3 C;  2PZT A;  2CW0 D;  2X6G A;  2FXQ A;  4FF1 A;  3HOV H;  3PUV A;  1X9N A;  3LGJ A;  4HSV A;  4FO2 A;  3M4Y A;  2F0F A;  4DV7 Q;  3TDQ A;  3HOW H;  5JVG 3;  2R7Z H;  1G51 A;  2K5Q A;  3HEJ A;  3ND8 A;  4S3S A;  5I9O A;  3H3V H;  3HFZ B;  1IL2 A;  4K6D A;  1EY6 A;  4BBR B;  4G7O C;  4DAV A;  4KK7 A;  4CDF C;  1SNQ A;  5EPJ A;  4LWC A;  2LSS A;  2NVQ B;  2JE6 I;  3PO3 H;  1A3T A;  2CFM A;  2DJG C;  1XNR Q;  1BCP B;  4AH6 A;  1ICF B;  4OGQ C;  4YY3 L;  3OOC A;  1ML0 D;  4HIK A;  1IKL A;  1KLU D;  3FKI H;  5LHY 1;  1VMP A;  2V4D A;  3F8T A;  1PZI D;  4CDE C;  2UUB L;  4K0K L;  3GTK B;  1Q90 A;  1LYL A;  2A5H A;  3TQY A;  1Y1V B;  3SXH A;  1IBL L;  4R4O A;  1Y1W B;  1PH1 A;  1TS2 A;  2XRS D;  2SEB D;  3T51 B;  2FIN B;  1YHA A;  1HCZ A;  1LAC A;  5EKI A;  3AYH B;  3HGB A;  4XTC S;  2XWJ B;  1STE A;  3X3M A;  2RBM A;  1CZW A;  2QGQ A;  2VXW A;  1F9S A;  3GTJ B;  1VS0 A;  1CKM A;  4LF7 Q;  1WTW A;  2O2L D;  5IGE A;  1B7Y B;  2Y0S B;  4KJN A;  3BVZ A;  4X3T A;  1CFM A;  2C35 B;  2EY1 A;  3ERO A;  2NN6 G;  1MHW C;  2PI2 A;  2ENB A;  4B08 A;  1F77 A;  1R4P B;  5AFW A;  5M5X B;  3J81 c;  4EGV A;  1B3A A;  1LTT D;  1F9Q A;  1RL2 A;  2QF7 A;  1EIY B;  5IP9 G;  4O2D A;  4ME5 A;  4DV2 L;  1F2Y A;  3FEW X;  2QEJ C;  1PH4 A;  4CKB A;  3HS0 C;  3G48 A;  1VCI A;  1TT2 A;  1Q46 A;  3CMA A;  5IIF A;  2IY5 B;  1C48 A;  1H9M A;  1KAA A;  1SRO A;  3T13 A;  4L5S A;  2F0V A;  4OEM B;  4RFB A;  1W6J A;  1N33 L;  2EYJ A;  2K1B A;  3JAM c;  1Y1V G;  1IBM L;  2UXC L;  4A3E H;  4JOI A;  1Y1W G;  5COY A;  1PTO H;  5AJ3 L;  2H5X A;  2ASB A;  1IKM A;  4Y7N H;  4FXG C;  3TRE A;  5IGD A;  3SEB A;  3T53 B;  1O80 A;  3A56 A;  3PUX A;  2VS1 A;  3CPF A;  4BA1 I;  1TWF H;  1PRT B;  2Y0S G;  4HJ5 A;  2Z6K C;  4PZ8 A;  3PIO 3;  1WD1 A;  1LTL A;  4LFC L;  1EOV A;  1JE5 A;  2HCI A;  4E6I A;  5A2Q E;  4GS3 A;  3PGZ A;  3J81 E;  5FO8 B;  2L15 A;  2EJM A;  1Q82 C;  2X69 A;  2XVS A;  3AFQ A;  4JI1 L;  4DFA A;  3PO2 G;  1SE3 A;  1IXR A;  3L7Z C;  2F0Q A;  2M00 A;  1L1O A;  5C5L A;  2OQK A;  1HHV A;  4UDU C;  3Q23 A;  1EYD A;  4DV6 L;  1GVP A;  1TWH H;  5FJ8 G;  1XWE A;  2KCT A;  4JK1 C;  2R92 G;  4XQQ A;  4EQP A;  2C5C A;  4RCN A;  2R6G A;  3F2B A;  3D31 A;  1WVL A;  4ZAI A;  2XSC A;  4C3J G;  5EPK A;  2PZU A;  1GM5 A;  4OWW B;  2B8F A;  3KK7 A;  3OYY A;  1YNJ D;  2PO4 A;  3M3Y B;  2AMC B;  2ZJP A;  2G5D A;  2F0H A;  2XTI A;  4POF A;  1KAB A;  4XYQ A;  2HDM A;  2D0P A;  2YU9 H;  2MP1 A;  3QB3 A;  4DV5 L;  1D6E C;  5KYL A;  1ENF A;  3V96 A;  2KEE A;  2LS0 1;  5IP7 H;  3S1N B;  3AMU A;  1FGB D;  4FVM A;  3S15 H;  3I3C A;  1K0S A;  4LF6 Q;  1AEX A;  2LMC B;  3L2P A;  4YHH Q;  2VUM B;  2K32 A;  4NXM Q;  4IZ8 A;  4ME3 A;  4LFA L;  2N78 A;  4LF8 L;  4A76 A;  1HH2 P;  5M5W B;  4B3T Q;  4K2L A;  5BR8 Q;  4NMZ A;  3G7L A;  3BZD B;  4X64 L;  3KDF A;  2CQO A;  1WTV A;  3FHW A;  3S2D B;  2YTV A;  3K7A B;  4IOC A;  2CVR A;  1LTS D;  3BYY B;  1GHJ A;  2OT2 A;  4I7A A;  4ZKB B;  4RGM A;  1EYC A;  2F0N A;  1AP0 A;  5CYU A;  4HIO A;  3W1G A;  3V05 A;  5HUR A;  3CCM A;  2F0S A;  2J4X A;  5M5Y H;  4KHP L;  4TKO B;  1F9P A;  1EQQ A;  3HOU B;  1XMQ L;  3P7J A;  1N8R C;  4A3B B;  4HMJ A;  2A19 A;  4DF7 A;  4DV1 Q;  4KLK A;  3HRZ C;  2ZTC A;  4CDC C;  4C2M H;  1RKN A;  3SK5 A;  5IGB A;  1WI5 A;  1MSG A;  1YNX A;  1LTB D;  2DGY A;  1PFM A;  2B2Y A;  2VUM G;  1I4G A;  1HA5 A;  1L1O B;  5I4D A;  2KJX A;  4LFB Q;  4WJ4 A;  4RKL A;  1EY8 A;  1QWY A;  1VQA A;  1CQV A;  4JI4 L;  2TMP A;  5BN4 A;  3S17 B;  4PZ6 A;  1K3B C;  1OXX K;  3NUC A;  1E24 A;  1D5M C;  1GKH A;  2ZJR A;  4K5W A;  4OL7 A;  2EYL A;  5C4Z A;  1MIU A;  3ULL A;  1WD0 A;  4ODG A;  1VQ9 A;  2UUA Q;  1UEA B;  4V0B A;  5IGG A;  2KA7 A;  3M4P A;  3HOU G;  1N32 Q;  2D5D A;  1PFB A;  4A3B G;  5A2Q L;  1LT3 D;  3J81 L;  2CKZ B;  1DJR D;  4JI6 L;  4I7Z C;  4FYD A;  1BCP D;  2JYO A;  4R4C A;  1BVS A;  1G6P A;  1A62 A;  1NBW A;  3E9I A;  3DUZ A;  1EZ8 A;  2ZM6 L;  3AFP A;  3JAM L;  1E0B A;  2XNA C;  3RLO A;  5LL6 S;  4Y52 H;  1VQC A;  4DUZ Q;  3KDF B;  4RH6 A;  3OTO L;  4X3S A;  1QVG A;  4DAY B;  3H09 A;  1K8O A;  4P75 A;  2VQE Q;  1YJ9 A;  1FGU A;  2JA5 H;  2OWO A;  4RGN A;  5H1S E;  4LF9 L;  2O4X A;  5ELF A;  2G9H D;  2B8G A;  2RQX A;  4WFN 3;  2B63 H;  2L9H A;  2KHS A;  3NE5 B;  5COR A;  4OIK A;  3GTQ B;  1IZ6 A;  1HNX L;  3GTG H;  1U0L A;  3ULP A;  2B2T A;  4NKL A;  1C8C A;  4A3L G;  4GLA C;  5I6Y A;  2K01 A;  3RZD H;  2O5J C;  1Q12 A;  2BA0 A;  4A3C G;  5C4X H;  2YYZ A;  3K5M A;  4X66 Q;  3C3L A;  5EPL A;  1M4V A;  1PH7 A;  4A3M B;  1WTX A;  5HGQ A;  4HIM A;  3S1R B;  5KNC A;  2I0Q A;  2F52 A;  1Y8P B;  3S14 H;  4H13 C;  1XTC D;  4JI0 L;  1KC8 C;  1X6O A;  4MZ9 A;  4TVA B;  4DV7 L;  3QG1 A;  1K83 B;  4DR5 Q;  1S5C D;  2GVA A;  3S1M B;  4P72 A;  1N34 Q;  5FLM H;  4B3S Q;  4OHJ A;  2B3G A;  2IJ0 A;  3D8G A;  5IOC A;  2RHS B;  4QUC A;  1XNR L;  1HXY D;  2H1E A;  2Z9H A;  4JC0 A;  5IYB G;  3HKS A;  1SMY D;  1X56 A;  2K75 A;  2JA9 A;  3MVV A;  1G6Z A;  4DR4 Q;  4NB3 A;  3HOX B;  5DAU A;  1EQV A;  2A6E D;  3M4O B;  5DM7 3;  2Q2T A;  1FJG Q;  1JOR A;  4RAU C;  2ICE C;  3NQT A;  1PMR A;  3B6Y A;  1QVF A;  1BUV T;  1EY4 A;  3NWS A;  3PIP 3;  4GKK L;  4GKJ L;  3E6Z X;  4DV0 L;  1RIP A;  1SNO A;  4A3M G;  1G2T A;  3J80 i;  4LF7 L;  2EQS A;  3G4S A;  3QOL A;  3WWV A;  2A8V A;  1STG A;  2F0P A;  4IJH A;  1E2Z A;  3NEM A;  5J39 A;  1EQR A;  2LXJ A;  4IUR A;  4FXK C;  3MEH A;  5G3L F;  4PMW A;  4BBR H;  5JAV A;  2KBN A;  4KI0 A;  1S72 A;  4P2C B;  1KD1 C;  1WCM G;  3STB C;  2N55 A;  3OWF A;  3UDF A;  3L9A X;  3OW2 A;  4LF4 Q;  3GTP B;  2NVQ H;  2VQF Q;  1AE2 A;  1M1K C;  4I65 A;  1EU4 A;  3NXW A;  1EWI A;  1XNQ Q;  2K05 A;  4RCO A;  3M7G A;  1S5D D;  3NTH A;  5IGC A;  3AU7 A;  1ROD A;  3HOX G;  5T1I A;  2OEO A;  2QDL A;  1WTQ A;  4PNY A;  3GTK H;  1Z47 A;  5L37 A;  5EBD A;  5IWA Q;  2AUK A;  1PFS A;  1Y1V H;  4L5T A;  1D1I A;  1KDB A;  2RHQ B;  1N9W A;  3H3V C;  3R93 A;  4HJ9 A;  2YTY A;  3K5O A;  2EJF C;  3URY A;  2Z1C A;  5JEA G;  1PYB A;  2I5M X;  3UE1 A;  3FPU B;  2V1C C;  3GTJ H;  1I94 Q;  1IYV A;  1A6X A;  2Z8L A;  4IUQ A;  2Q8I B;  4UY8 C;  1GUT A;  3A7A B;  5CV5 A;  1CSQ A;  2L5T A;  4DR1 L;  1PHJ A;  3HOZ B;  2BE5 C;  2JEB I;  5M5X H;  4DK0 A;  4DR2 L;  3I4N B;  4QGU A;  3KLS X;  3I55 A;  1YHQ A;  3HZX A;  2K5N A;  1JOK A;  4F8M A;  1G8Z D;  4OWX B;  1A2T A;  1YZ6 A;  2MO1 A;  3G6E A;  3QOJ A;  1LTR D;  3K7U C;  3U9S A;  3M85 A;  4OX9 L;  2F4V Q;  2I5H A;  3J81 j;  1BCP F;  5D65 A;  1QUQ A;  3GV6 A;  3R2T A;  3BDL A;  5DEH A;  1M90 C;  3AQQ A;  4RG1 A;  1GXD C;  1QCB D;  3RMH A;  3NHH A;  3H6M A;  4PZ7 A;  4A3I B;  5CV4 A;  4A3K B;  3S2H B;  2KEN A;  2KCC A;  2EOT A;  4X3K A;  3TZD A;  1SLJ A;  1SYF A;  4NXN L;  3ICE A;  3DMU A;  1XYI A;  2A69 C;  2M9V A;  1HQM C;  4CHT B;  4JV5 Q;  4LF6 L;  2UXB Q;  1AW7 A;  3A5Z B;  3HOZ G;  2Q2I A;  4BY7 B;  2Z0S A;  5LMN L;  1HNW Q;  4NP5 A;  2HDL A;  3TZU A;  4CGY B;  3ULJ A;  2EJG C;  2K6A A;  1V1O A;  1PTO C;  3SK8 A;  1HFG A;  4HMI A;  2UXD Q;  5I2Y A;  2RSN A;  3V2T A;  3MXG A;  5KNB A;  4OEL B;  1Q8K A;  4KTA A;  4ZUI A;  2C9O A;  2WII B;  4JI7 Q;  1TII D;  2NZ1 D;  5E1F A;  4H44 C;  2AQ1 B;  1LLR D;  4A3D B;  3UDX A;  4LNQ A;  5IGF A;  4X62 Q;  2KED A;  2KQ3 A;  1K28 A;  1NR4 A;  2JK8 A;  4ID6 A;  1WTH A;  4DA2 A;  3P75 A;  1I3Q B;  2PW7 A;  2E74 C;  3J7A V;  4A3I G;  1CK1 A;  1DOM A;  1SSO A;  1UE6 A;  4A3K G;  4BXX H;  3Q22 A;  2JQO A;  1VQ7 A;  5HY6 A;  4IPG A;  2E2H B;  4L8J A;  2Q8R E;  1YVC A;  4X65 Q;  3S1N H;  5IE8 A;  3A5U A;  5I6W A;  3TS0 A;  4BY7 G;  2SDF A;  2F0J A;  3SDZ A;  2K14 A;  1J9O A;  4ZQ3 A;  4J6H A;  4LFB L;  2VUM H;  2VZA A;  3MAQ A;  1Y69 U;  5IOD A;  3HOY G;  5M5W H;  1PXU A;  1YNN C;  1MBY A;  3NP8 A;  3PIP A;  1Q1B A;  3AB9 A;  3K7A H;  4OWT B;  2JJQ A;  1EEF D;  4OIJ A;  5M3F B;  1QUQ B;  4L5R C;  2IPK D;  4LMQ D;  4A3D G;  1HQR D;  3TBI B;  1N32 L;  1V43 A;  3OWE B;  4O1N A;  4QL5 A;  2R93 B;  3FMC A;  4JI3 L;  3HOU H;  4KKS A;  4A3B H;  2DY8 A;  2OTL A;  2JA6 G;  1BBW A;  2IW3 A;  2IX0 A;  4LK1 C;  1GO3 E;  4EQ5 A;  2OQ0 A;  2VY3 A;  1ZXT A;  1Z9F A;  4HSP A;  1YI2 A;  4FDB A;  1SYC A;  3MFG A;  2K04 A;  1CQF A;  2Z4H A; 
#chains in the Genus database with same CATH homology
 1AH9 A;  4NXM Q;  1E1T A;  1KL9 A;  4A4I A;  4ME3 A;  3CXC A;  4LFA L;  2JEA I;  2N78 A;  1XMO Q;  1YEZ A;  4A76 A;  1XMQ Q;  1HH2 P;  4LF8 L;  4JI5 Q;  2E2J H;  3TRZ A;  2IT1 A;  1HNZ L;  3S17 H;  4B3T Q;  5BR8 Q;  2YV5 A;  2JA6 H;  3ER0 A;  4LF5 L;  3GTO H;  1A63 A;  3E9H A;  3ZJY C;  2N49 A;  4X64 L;  3GD7 A;  3KDF A;  2CQO A;  3CPW A;  3FHW A;  3U58 A;  4DV3 Q;  1IYJ B;  4AYB E;  3J80 c;  2YTV A;  1SFO H;  4IOC A;  5M3F G;  2OCE A;  3D0F A;  5C44 H;  3CP0 A;  1KHI A;  1MKH A;  5GAD C;  3CC2 A;  1OXS C;  3CCV A;  4DUY Q;  1XPU A;  4DR3 L;  2R93 G;  4YHH L;  4HIO A;  3W1G A;  4GNX A;  1CKO A;  2HIV A;  2ID0 A;  3CCM A;  2WB1 E;  5M5Y H;  4KHP L;  2UXC Q;  4NXM L;  4RMF A;  1EQQ A;  1XMQ L;  1N8R C;  1C9O A;  4A3G G;  1W2B A;  5AJ3 Q;  4B3T L;  4OO1 I;  4APV A;  5BR8 L;  1PH5 A;  1LUZ A;  2A19 A;  4BBS H;  4DR6 Q;  2CWP A;  4X66 L;  3F2C A;  4DV3 L;  1P8L A;  4DV1 Q;  3TS2 A;  4KLK A;  3J7A 5;  3CD6 A;  2ZTC A;  1SE8 A;  4C2M H;  1X54 A;  1I50 H;  2AWN A;  2D62 A;  1ASZ A;  3M7N A;  5C3E G;  4GN5 A;  1WI5 A;  1YNX A;  1VQL A;  3T1H Q;  4GNX C;  1EYG A;  1PYS B;  1AE3 A;  1HZA A;  1WFQ A;  5JJL A;  2DGY A;  1HZB A;  4LFC Q;  2VUM G;  3M9B A;  1L1O B;  2ALY B;  1N34 L;  1J6Q A;  1VQ6 A;  1SR3 A;  4UP9 A;  4IFD I;  4JBW A;  3K8A A;  4DKA C;  4B3S L;  3RN2 A;  2JA7 G;  1TXY A;  2JA8 G;  3I4M G;  4LFB Q;  3M3Y H;  4WJ4 A;  4BA2 I;  2KCM A;  1VQA A;  3K80 C;  4JI6 Q;  4HID A;  5FLX c;  5GQO A;  1VQI A;  5C4J H;  4DR6 L;  1DGS A;  4A3G H;  4DNI A;  4JI4 L;  3U4Z A;  3KF6 B;  4DV1 L;  3T1Y L;  4PZ6 A;  3CCL A;  3K0X A;  4LW1 A;  1OXX K;  2LXK A;  4DV6 Q;  1E24 A;  1GKH A;  4XIG S;  5K36 G;  2CCZ A;  1E3P A;  1YIT A;  2ZJR A;  1X3G A;  4P74 A;  1PV4 A;  2I5L X;  3RNU A;  3SGI A;  1MIU A;  4R1J A;  3ULL A;  4A75 A;  2VW9 A;  1VQ4 A;  1VQ9 A;  3GTQ H;  4A3F G;  2MFI A;  2UUA Q;  3BU2 A;  3M4P A;  5ELN A;  1YBY A;  2UU9 Q;  4GOP A;  3HOU G;  2E5L Q;  1N32 Q;  3PCO B;  3KJO A;  2K52 A;  2ZTE A;  4A3B G;  2CKZ B;  2BA1 A;  4PG3 A;  4JI6 L;  1LM0 A;  4WJ3 M;  4IJL A;  1Q1E A;  3I4M H;  1OTC A;  2MNA A;  2HIX A;  3F1Z A;  1TWA H;  5IY0 A;  3JC6 6;  1WOC A;  4QIW E;  4B3M L;  1PVO A;  3S2D H;  1VQF A;  1KRS A;  4R4C A;  3S1R H;  1VQ8 A;  1BVS A;  1G6P A;  3A0J A;  1A62 A;  3UE0 A;  1NBW A;  5GRO A;  2E8G A;  2A1A A;  2WP8 J;  3E9I A;  4AYB G;  5IP7 G;  2E2I H;  2B63 G;  1D7Q A;  3CC4 A;  4POG A;  1NE3 A;  3K81 C;  1K83 H;  2K4K A;  1S3O A;  2ZM6 L;  2UUC Q;  1S40 A;  3AFP A;  4YCU A;  4C3I H;  4GOP C;  2UUA L;  4OO1 G;  1NY4 A;  2AKW B;  3S1M H;  2E5L L;  1UE7 A;  3RLO A;  5EAY A;  4Y52 H;  1HNX Q;  1VQC A;  3E0E A;  4DUZ Q;  4HJA A;  5JEA J;  3J7Z C;  2PMZ E;  2RF4 A;  4UP7 A;  3KDF B;  4LF4 L;  3UDI A;  3OTO L;  5C4X G;  2NVY H;  1QVG A;  4LF8 Q;  4DAY B;  1HNZ Q;  3U4V A;  1L0W A;  4P75 A;  2VQE Q;  1YJ9 A;  1FGU A;  1KIX A;  2JA5 H;  1D8L A;  2OWO A;  4X64 Q;  5H1S E;  3CCS A;  3GTL H;  4LF9 L;  1HZ9 A;  4IFD G;  5C44 G;  4GNX B;  4IOA A;  4DR7 Q;  4JI0 Q;  1MJC A;  2B63 H;  3Q8D A;  2HQL A;  4IPD A;  4JCV E;  2HHH Q;  2HT1 A;  2F3I A;  2IHF A;  2K5V A;  3H15 A;  4UPA A;  5LMU L;  4DR3 Q;  3S16 H;  1IZ6 A;  3M4O H;  5FLM G;  2VL6 A;  4QJF A;  1HNX L;  4DUZ L;  4QY7 A;  2WAQ G;  3GTG H;  1U0L A;  4R4Q A;  1X3E A;  3ULP A;  4A3L G;  4L5Q A;  4HJ7 A;  4GLA C;  1SMX A;  3RZD H;  3NEL A;  1KXL A;  1Q12 A;  3CW2 C;  4BBS G;  2BA0 A;  4A3C G;  2K5H A;  1HR0 Q;  5C4X H;  2YYZ A;  2VQE L;  2AWO A;  3RLF A;  4X66 Q;  1NMF A;  1PH9 A;  1PH7 A;  1JMC A;  5HGQ A;  1J5E L;  4DK6 C;  4HIM A;  2I0Q A;  3ERS X;  2F52 A;  3EBE A;  4H02 A;  4OXP A;  3S14 H;  4DR7 L;  1IBK L;  1KC8 C;  1X6O A;  4MZ9 A;  1N36 Q;  3IRB A;  4JI0 L;  3PV0 A;  4TVA B;  4DV7 L;  2HHH L;  1VQ5 A;  2BH8 A;  3CQZ H;  4DR5 Q;  3H0G G;  1YJW A;  4O0A A;  1E22 A;  2GVA A;  1P16 A;  1VQK A;  2ZJQ A;  3PUZ A;  4P72 A;  2AHO B;  1N34 Q;  1R9T H;  1HR0 W;  5FLM H;  1QZH A;  4B3S Q;  3GTP H;  2B3G A;  1K0R A;  3CCJ A;  1QZG A;  4A3L H;  1HR0 L;  1PH3 A;  3H3V I;  2RHS B;  1BBU A;  4MNO A;  1PA6 A;  1XNR L;  1V9P A;  4GKK Q;  4GKJ Q;  1VQN A;  4JI4 Q;  4A3C H;  4DV0 Q;  4JC0 A;  3T1Y Q;  1UWV A;  5IYB G;  2QA4 A;  2K50 A;  3HKS A;  3DLL A;  2NVX H;  5IT9 c;  1X56 A;  2K75 A;  2JA9 A;  3KF8 B;  4GOP B;  4AQY L;  1N36 L;  4DR4 Q;  3GDE A;  4DR5 L;  4NB3 A;  1JB7 A;  4GLV B;  1CUK A;  3EIV A;  3I4N G;  4B3R L;  1JT8 A;  1VQD A;  2WAQ E;  4BBR G;  4JYA L;  3H0G H;  2R7D A;  2Q2T A;  1FJG Q;  1K9M C;  1FL0 A;  1E1O A;  1EIF A;  2RCN A;  3B6Y A;  2VNU D;  3KLW A;  1VQM A;  1QVF A;  4AIM A;  4X6A H;  3BJU A;  3TEH B;  4GKK L;  4GKJ L;  1A8V A;  1ASY A;  4DV0 L;  1RIP A;  4A3M G;  1XJV A;  3J80 i;  5GAH C;  4A3J G;  4B3M Q;  4LF7 L;  4BY1 G;  1K3R A;  2EQS A;  3G4S A;  2UXB L;  4DR4 L;  5IYB H;  3AEV A;  3WWV A;  2A8V A;  1NTG A;  1OXV A;  1W3S A;  2IHE A;  4IJH A;  4DAM A;  5JJI A;  3M4Q A;  5E7N A;  3NEM A;  2OTJ A;  4JI2 L;  2B29 A;  2ZM6 Q;  1HNW L;  3HOZ H;  1Y14 B;  1V1Q A;  3KOJ A;  3KFU A;  4GLX A;  2NZH A;  2LXJ A;  1EQR A;  1FJG L;  5M3M H;  5ELO A;  3I4N H;  3KYH C;  4MTN A;  3L0O A;  4PMW A;  3FP9 A;  2MQH A;  4BBR H;  2KBN A;  4KI0 A;  1S72 A;  1Q7Y C;  3S1Q H;  1YHB A;  4YWK A;  1KD1 C;  1WCM G;  3STB C;  3UDF A;  3CCE A;  3OW2 A;  1PH8 A;  4LF4 Q;  1I5F A;  3GTM H;  2NVQ H;  2VQF Q;  1AE2 A;  3OTO Q;  2ATW A;  2JA5 G;  4NPS A;  2R7F A;  1C7Y A;  1PH2 A;  3HKZ G;  1A0I A;  1E7Z A;  1M1K C;  4JI7 L;  4OON A;  4A3M H;  1EWI A;  2Q2U A;  1XNQ Q;  1XPR A;  3HOV G;  4A93 H;  4LF9 Q;  4A3J H;  2CWA A;  3HOX G;  4BY1 H;  1L2F A;  4GN4 B;  1YJN A;  4X62 L;  1H95 A;  4C3H H;  3GTK H;  1Z47 A;  2R7Z G;  1MJE A;  4EX5 A;  4DV4 L;  4GN3 B;  5IWA Q;  4DR1 Q;  4P73 A;  4YCW A;  1PFS A;  1TWC H;  1Y1V H;  4L5T A;  5LMU Q;  5IYD H;  2MO0 A;  1VQE A;  2RHQ B;  1N9W A;  4YCV A;  1UE5 A;  4DR2 Q;  3NEN A;  3RLN A;  3BZC A;  1O7I A;  4IPH A;  4UP8 A;  4JG2 A;  1K8G A;  5C0X J;  4A3I H;  3S2H H;  4HJ9 A;  3CC7 A;  2YTY A;  2VQF L;  4A3K H;  3PF5 A;  1T9H A;  2KHI A;  1WCM H;  2NN6 I;  1JJC B;  5JEA G;  1PYB A;  2I5M X;  3UE1 A;  3I56 A;  2V1C C;  2NZO A;  4DK3 C;  4X65 L;  1XNQ L;  3GTJ H;  5GAG C;  2NVT H;  1I94 Q;  3FKI G;  4R4I A;  4YY3 Q;  1YIJ A;  2FXQ A;  1J5E Q;  2YTX A;  4UY8 C;  3HOV H;  3PUV A;  1X9N A;  3LGJ A;  3PIO A;  3S24 A;  1IBK Q;  3HOX H;  1CSQ A;  4IPC A;  5IWA L;  4DR1 L;  4DV7 Q;  1VQH A;  1PHJ A;  4BY7 H;  2UUB Q;  4OX9 Q;  3HOW H;  4YWL A;  4JI8 L;  1G51 A;  2R7Z H;  3H3V H;  2JEB I;  5M5X H;  3MEF A;  3HFZ B;  4DR2 L;  1IL2 A;  4QGU A;  1OXT A;  1KAW A;  3I55 A;  4P71 A;  1YHQ A;  1VQP A;  4LWC A;  2LSS A;  2K5N A;  4KHZ A;  3HKZ E;  1CKN A;  2JE6 I;  3PO3 H;  3I7F A;  2CFM A;  2Y0S E;  2QEX A;  1XNR Q;  1I94 L;  4AH6 A;  1K73 C;  4OWX B;  4YY3 L;  1YZ6 A;  2MO1 A;  3DM3 A;  3G6E A;  4NXN Q;  4HIK A;  3FKI H;  4AQY Q;  3K7U C;  4TQU S;  1SRU A;  3F8T A;  4A3D H;  3M85 A;  2UUB L;  4OX9 L;  2F4V Q;  3PUY A;  1X3F A;  4K0K L;  2I5H A;  1LYL A;  3VDY A;  3J81 j;  3TQY A;  1I3Q H;  1OXU A;  1QUQ A;  4LUO A;  5LMN Q;  4B3R Q;  1M90 C;  3AQQ A;  4RG1 A;  3CCU A;  4JYA Q;  1CSP A;  2N8N A;  1K8A C;  4R4O A;  1IBL L;  1PH1 A;  1U5K A;  4PZ7 A;  1TWG H;  2KEN A;  1HZC A;  1YHA A;  4DV2 Q;  3AYH B;  1SLJ A;  2E2H H;  4XTC S;  2ZTD A;  1EUJ A;  2QGQ A;  4NXN L;  1VS0 A;  3ICE A;  1CKM A;  2DUD A;  4LF7 Q;  4JV5 Q;  5IYC H;  4LF6 L;  1B7Y B;  5LMN W;  2UXB Q;  3A5Z B;  2F4V L;  2Q2I A;  4A3E G;  4JBK A;  1N33 Q;  3HOZ G;  2C35 B;  5M3M G;  2NN6 G;  2PI2 A;  2N3S A;  1KRT A;  4JI2 Q;  2Z0S A;  5C0X I;  3CCQ A;  5LMN L;  3G71 A;  1XPO A;  1IBM Q;  1HNW Q;  1XMO L;  3I4O A;  3J81 c;  4BXX G;  3PUW A;  4JI5 L;  3ULJ A;  3UDG A;  1RL2 A;  1EIY B;  3MXN B;  5IP9 G;  2PQA A;  4O2D A;  2UXD Q;  2D0O A;  4DV2 L;  4QQB X;  1UE1 A;  1UEB A;  1PH4 A;  1B70 B;  1Q8K A;  3G48 A;  4A93 G;  1GD7 A;  1VCI A;  5GAE C;  1Q46 A;  3CMA A;  2IY5 B;  4JV5 L;  4JI7 Q;  5M3F H;  1WYD A;  1KQS A;  2PNH A;  4JBJ A;  4DUY L;  1SRO A;  4L5S A;  5J3B A;  1N33 L;  2Z6K A;  3U50 C;  3JAM c;  3PSI A;  3UDX A;  1Y1V G;  4LNQ A;  4X62 Q;  1IBM L;  2UXC L;  5IYD G;  2R93 H;  2JK8 A;  4A3E H;  4JOI A;  4DV4 Q;  1X55 A;  1Y1W G;  4LUV A;  5AJ3 L;  2H5X A;  4JI1 Q;  2ASB A;  4Y7N H;  2Q2H A;  4A3I G;  4A3K G;  1UE6 A;  3TRE A;  3RN5 A;  3PF4 A;  1C0A A;  4BXX H;  2UXD L;  1QVC A;  2JQO A;  1JJG A;  3CME A;  1VQ7 A;  4JBM A;  4LUZ A;  3RZO H;  1I6H H;  3PUX A;  5IP9 H;  1EFW A;  1XTD A;  2VS1 A;  4R4T A;  5HY6 A;  4IPG A;  3CPF A;  4BA1 I;  3GO5 A;  1TWF H;  2Y0S G;  3T1H L;  1YVC A;  3RR5 A;  2Z6K C;  4PZ8 A;  5IE8 A;  4X65 Q;  4HJ5 A;  1PH6 A;  3S1N H;  3A5U A;  1LTL A;  4LFC L;  5C3E H;  1EOV A;  3TS0 A;  1JE5 A;  4J15 A;  1JJ2 A;  4BY7 G;  4GS3 A;  4JOI C;  2GVB A;  2K14 A;  3PGZ A;  3HOW G;  1VQJ A;  3KJP A;  2L15 A;  4LFB L;  2VUM H;  2VZA A;  1NMG A;  1Q82 C;  5JJK A;  2ES2 A;  2XGT A;  1NJI C;  3J81 i;  4YWM A;  3AFQ A;  1X65 A;  4JI1 L;  1CKN B;  4JI8 Q;  3F2D A;  4JI3 Q;  3HOY G;  1IXR A;  2EIF A;  3L7Z C;  2JA7 H;  2JA8 H;  3PO2 G;  5M5W H;  3NBH B;  1Y1W H;  1WJJ A;  1L1O A;  2OQK A;  5DLQ E;  3CCR A;  1G29 1;  1SN8 A;  3PO3 G;  2PI2 E;  3I2Z A;  3BZK A;  3PIP A;  1Q1B A;  4DV6 L;  1GVP A;  2EXD A;  1TWH H;  1VQO A;  5FJ8 G;  3K7A H;  4OWT B;  1HJP A;  2JJQ A;  5C0X G;  4DV5 Q;  2KCT A;  3W1B A;  2KHJ A;  1B8A A;  1BKB A;  3KF6 A;  2R92 G;  4L5R C;  1QUQ B;  2R6G A;  4A3D G;  3EN2 A;  2BH2 A;  3JAM i;  4ALP A;  3F2B A;  3D31 A;  1Q86 C;  2UU9 L;  1N32 L;  1V43 A;  1GM5 A;  4A3F H;  4QL5 A;  4OWW B;  4K0K Q;  2WFW A;  3STB D;  3CF5 A;  4JI3 L;  3HOU H;  2WB1 G;  1L1O C;  3OYY A;  4IO9 A;  4A3B H;  2AMC B;  2ZJP A;  2XTI A;  4LFA Q;  4POF A;  2OTL A;  1BBW A;  2JA6 G;  3HOY H;  1Q81 C;  1IBL Q;  2IX0 A;  3PO2 H;  4IFD J;  1GO3 E;  2D0P A;  2YU9 H;  4EQ5 A;  4LF5 Q;  4HJ8 A;  4DV5 L;  1VQB A;  2OQ0 A;  1FVI A;  5FJ8 H;  5IYC G;  2UUC L;  3CAM A;  2IX1 A;  2GN5 A;  5IP7 H;  3A74 A;  2VY3 A;  2R92 H;  1Z9F A;  1YI2 A;  3S15 H;  4DPG A;  4FDB A;  4LF6 Q;  3W5O A;  3L2P A;  4YHH Q;  1VQG A;  4C3J H;  4KHP Q;  2PQA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...