4A4IA

Crystal structure of the human lin28b cold shock domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
VLRGTGHCKWFNVRMGFGFISMINREGSPLDIPVDVFVHQSKLFMEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN LIN-28 HOMOLOG B
publication title The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 17
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a4iA00
1K9MC 2A1AA 3K8AA 4DV7L 1K3RA 4GLXA 4IFDI 1C0AA 1R9TH 1E3PA 2ATWA 4OO1G 1CKNB 3J7ZC 4P74A 3BJUA 1B7YB 2CWAA 1VS0A 2YU9H 1TXYA 2NZHA 1QVFA 1RIPA 1BBWA 2RHSB 3EN2A 4X62L 2IX0A 2I5HA 5IP9G 3A5UA 1TWGH 1YNXA 1XMOL 4PZ8A 3I56A 3PUWA 4GKKL 2PMZE 1SFOH 3AYHB 3ICEA 1VQHA 1YVCA 4JV5L 4DR3L 1JJCB 4GOPC 3OYYA 1EOVA 5GROA 1G6PA 3PUVA 2JK8A 1IZ6A 4XIGS 5IT9c 5GADC 2JA8G 1PH7A 5IWAL 2WAQE 3K7AH 5JJLA 3M85A 1OTCA 2WB1G 3G6EA 2PI2E 2VQEQ 4DV4L 3AFQA 2R7DA 2VQFL 1IBKL 4B3SQ 4B3TQ 2BH2A 4GNXB 4GOPA 3KOJA 1J6QA 4O0AA 1S3OA 1VQKA 4MZ9A 4C2MH 5M3MG 4DKAC 1FVIA 4UP8A 5IYBH 4IFDJ 4R4IA 1HZAA 3CP0A 2VW9A 3KF6B 3CC4A 2FXQA 3HOZH 4LFAQ 3CW2C 1QVGA 4UPAA 1WYDA 3PO3G 4A3IG 1L0WA 4JYAL 2V1CC 1X3GA 3KYHC 5M3FG 3OW2A 4JOIC 2HHHQ 1X55A 2R7ZH 4A3BG 4DAMA 2ZTCA 3H0GH 1EWIA 4A3JG 2MFIA 1E1OA 5C4XH 5AJ3Q 1NJIC 1K73C 1I3QH 4DV1L 4BY1G 4WJ4A 3CC7A 4LF8L 4L5QA 4O2DA 1CKNA 1GO3E 2NVQH 2IY5B 1H95A 1N34Q 1VQGA 1Q12A 4DV5L 1XTDA 3AEVA 2UUAL 3MEFA 4BBRG 4JI5Q 2F4VL 2YTYA 4RG1A 3GTMH 3HOYH 1NMGA 4JCVE 3CCMA 1OXVA 3HOXG 3BU2A 2BA0A 1GVPA 3MXNB 1IYJB 3M9BA 1VQLA 4DR4L 2NVYH 4X64Q 2WAQG 3F2DA 1PH8A 2EXDA 3U4ZA 4DV2L 4OX9L 5JEAJ 2IHFA 1E7ZA 4LF9L 3S2HH 3NENA 1JJGA 1VQBA 1QUQB 5DLQE 5C0XI 1N8RC 4P72A 1K8AC 2OCEA 2ZM6L 2CCZA 1J5EL 1MJEA 5C3EG 4DAYB 4PZ6A 1HH2P 2UXDL 1PVOA 2ZTEA 1XJVA 3RNUA 1KRSA 4A4IA 1JJ2A 4DV7Q 1KXLA 2AHOB 3HOUG 1EFWA 1KAWA 4NB3A 3I55A 1PV4A 2I5MX 4GS3A 1HNWL 4JG2A 3TS2A 3AQQA 4IOAA 4GNXA 1Q86C 4DV3Q 1KIXA 4PG3A 2Q2TA 2UXBL 4IPDA 4JI1L 3KJOA 2CFMA 1XNQL 1UWVA 4X62Q 2AMCB 3UDIA 1UE6A 2UXCL 1SR3A 1Q1EA 2VL6A 3GD7A 4X65L 3PF5A 1N9WA 1SN8A 2RHQB 1XMOQ 3FKIG 3A74A 2JA8H 3M7NA 4WJ3M 2D0OA 1VQFA 1V1QA 1YJ9A 1PA6A 2KBNA 4GKKQ 4DR1L 1QVCA 3JC66 3FHWA 4EQ5A 3L2PA 3ERSX 3G4SA 3GTPH 4DR6L 1SE8A 1HNZL 3UE1A 4HIMA 4JV5Q 2R7ZG 3STBC 4X66Q 3F2BA 2R7FA 3H0GG 1V9PA 4A75A 4UP9A 2JA7G 2K5NA 5M3MH 5IWAQ 1X65A 3EBEA 1X54A 2YTXA 4QQBX 2VQFQ 2PNHA 1IBKQ 3PO3H 3PGZA 4A3IH 4JI6L 1A8VA 1VQDA 5M3FH 1XPRA 1I50H 4JI4L 1L1OC 4A93G 3K80C 1PH2A 5GAHC 3ZJYC 2IT1A 4BY7G 2QEXA 3UDFA 4BY1H 3FP9A 5LMUL 4MTNA 1EQRA 3KFUA 2K14A 3RR5A 1DGSA 1V43A 5C44G 4BA2I 3CC2A 1Q46A 3A5ZB 4GN3B 1Y1VG 4NPSA 4DUYL 4DV0L 3ULLA 4A3CG 3CAMA 1I94L 4BBRH 5C0XG 5FLXc 1JT8A 2B29A 4DV6L 4A76A 4DV1Q 3T1YL 3S16H 1PH9A 2AWOA 3HOXH 1HZ9A 2CKZB 4DNIA 5IYDG 1TWHH 4YY3Q 2E2IH 2DUDA 4AQYL 3RLOA 5BR8L 1YHQA 1N33L 2Q2IA 3IRBA 2HQLA 4KI0A 2H5XA 1VQJA 3DM3A 1SMXA 1TWAH 4IPCA 3CF5A 3F8TA 1S72A 5C3EH 4DR2L 3UDGA 3T1HQ 3RZDH 4LF4L 4DR4Q 4DV2Q 4OX9Q 1B70B 2JE6I 4LF9Q 2JEAI 4JC0A 1IBMQ 3U50C 1T9HA 2JA6G 4DUZL 1N32L 2VNUD 2K50A 4NXNL 2A19A 3D0FA 3U4VA 3GTLH 3B6YA 4R4CA 1J5EQ 2UXDQ 5K36G 4JI3L 2MQHA 2UUBQ 2EIFA 3UE0A 5JJKA 3FKIH 4QY7A 4RMFA 3CCQA 3OTOL 2PQAB 4BXXG 1HNWQ 1MIUA 2UUCQ 3ULJA 3HFZB 1IL2A 4JBWA 1Z9FA 2UXBQ 1X56A 2KHJA 1HR0L 4JI1Q 1XNQQ 5HGQA 3JAMc 1PHJA 2I5LX 3KLWA 4JI2Q 1PH4A 3S14H 4X65Q 1UE7A 4OXPA 1Y1WG 1A0IA 4BA1I 1U0LA 4YCUA 3L7ZC 2ES2A 1ASYA 1D8LA 1KQSA 1GM5A 2N3SA 4JBMA 3I4MH 3PO2G 1Q8KA 1SRUA 1RL2A 2AKWB 3S1NH 1HNXL 5FLMG 4DR6Q 5M5YH 1HNZQ 4B3MQ 4OWXB 1LUZA 2MO1A 2MNAA 4QJFA 4JOIA 4YWKA 3TEHB 5GAGC 4A3LG 3CMAA 4A3MH 4NXMQ 3PUYA 2B63G 3PF4A 1E22A 4LF7Q 3S1MH 4A93H 4C3IH 4HIOA 3CCEA 4BY7H 2K75A 4C3HH 1VQMA 4GKJL 2ZJRA 1XPUA 3KJPA 5C44H 4LNQA 1SLJA 2Y0SE 1JE5A 5GAEC 4JI6Q 4HIKA 2E8GA 1Y1VH 2F3IA 5E7NA 4JI4Q 3CXCA 4A3CH 4LUZA 2E5LQ 4L5TA 3G71A 3CMEA 3CCSA 2JEBI 2DGYA 2QGQA 2OQKA 3RN5A 1WCMG 5LMUQ 4YCVA 1L1OB 5IYDH 1SROA 3I4NG 1X6OA 2Z0SA 4LW1A 3U58A 4LF5L 4DUYQ 1N36L 3GTJH 1VQNA 4GLAC 2K5VA 2N49A 2IX1A 1GD7A 4AYBE 3ER0A 1CKMA 1XMQL 4GLVB 4P73A 1MKHA 3HKZE 1EIFA 3CCUA 3T1YQ 3S24A 2HIVA 4HJ5A 4AQYQ 1NTGA 3KF6A 1Q82C 5LMNL 4DPGA 3PIOA 3CCRA 1K83H 3KDFB 4HJ7A 4H02A 4PZ7A 2OTLA 4IPHA 4AH6A 3M4OH 3E9HA 2HIXA 1TWCH 1C9OA 1VQCA 4YHHL 3J81j 3W1BA 5M5XH 4DR5L 1YI2A 1KC8C 2OWOA 4B3SL 2JA6H 1HR0W 3G48A 2B3GA 3H15A 3GTQH 4QGUA 1HJPA 4DR3Q 1IBLL 4DR2Q 4HJAA 4LF4Q 1YITA 5H1SE 2L15A 3L0OA 4Y52H 1X3FA 3E0EA 4A3FG 4JI7L 1BBUA 1HZCA 3I4MG 4LFBL 3HOVG 4BXXH 4APVA 1N32Q 1PFSA 1X3EA 4YWMA 2Y0SG 3DLLA 1OXSC 4DV4Q 2KHIA 1LTLA 5C0XJ 3NEMA 4FDBA 5GQOA 4JI3Q 1YEZA 2K5HA 3CQZH 1UE1A 1IXRA 2AWNA 4A3MG 1ASZA 3E9IA 2LXJA 4B3RL 3HOUH 1Y1WH 1B8AA 2F52A 2BH8A 2NZOA 3F1ZA 3OTOQ 3H3VI 3CPFA 3PO2H 4POGA 1E1TA 1AH9A 1NBWA 3STBD 1N34L 5FLMH 3GDEA 1QUQA 2XTIA 1HR0Q 4JYAQ 1A63A 4JI5L 4AYBG 4A3LH 4A3EH 2B63H 2ZTDA 1L1OA 3HKZG 1CSPA 5FJ8G 3J80c 3PSIA 3RLNA 3HOWG 1UE5A 2CWPA 3TS0A 4JI8L 2JA7H 4AIMA 4LF8Q 2JA5G 2Z6KC 4UP7A 3J7A5 4IPGA 2NVXH 4K0KL 2WP8J 4JI0L 4P75A 4TVAB 1VQ4A 4DV5Q 2VUMG 2D62A 1AE2A 1OXUA 4MNOA 2UUAQ 1CSQA 4A3GG 3PCOB 3TQYA 3TRZA 2F4VQ 2R92G 3J80i 2R6GA 3W5OA 3SGIA 1W3SA 1X9NA 1K8GA 1BVSA 2N78A 1VQAA 4A3DG 3KDFA 1I5FA 1WCMH 5IE8A 4GKJQ 4DK6C 5LMNW 4LF6L 3I4NH 3Q8DA 1YBYA 2ZJPA 1W2BA 2Z6KA 3M3YH 4J15A 1OXXK 2GVBA 4JBJA 4LWCA 1Q81C 1VQ8A 2HT1A 4DV3L 4JBKA 2R93H 2ID0A 1HZBA 1GKHA 4UY8C 1Q1BA 4A3KG 4DR7L 1FL0A 3NBHB 2ZM6Q 4KHPL 2JJQA 3CCJA 3GTOH 3M4QA 3LGJA 3PUZA 1PH6A 2VS1A 3PIPA 1VQPA 4LF5Q 2UU9L 2VY3A 3BZKA 1N36Q 3NELA 1M90C 2I0QA 2JQOA 4LUVA 1VQEA 3S1RH 1XMQQ 1P8LA 2K4KA 4X66L 1WJJA 5J3BA 1FJGL 1YHBA 4KHZA 1P16A 1EQQA 2UXCQ 4Y7NH 5LMNQ 4BBSG 4EX5A 4A3FH 2WFWA 3I4OA 1Y14B 2PI2A 4YWLA 2E2JH 1XNRL 4YHHQ 4DR5Q 2KCMA 3HOVH 3BZCA 2GVAA 1MJCA 4DR1Q 2CQOA 1PH5A 1YHAA 2MO0A 1YZ6A 5ELNA 5JJIA 3AFPA 3JAMi 4P71A 3VDYA 1XPOA 1IBLQ 3CD6A 4POFA 1VQ7A 4A3EG 3S17H 3KF8B 1LYLA 3I2ZA 4JI7Q 1VCIA 4LFCL 5IP7G 4LFBQ 1Z47A 1FGUA 1UEBA 2Q2HA 4L5SA 1OXTA 5EAYA 2QA4A 2ALYB 4HIDA 2E2HH 1QZGA 3RZOH 5IYCG 3HKSA 4GN4B 4X6AH 1BKBA 1Q7YC 2OTJA 4PMWA 3GTKH 4L5RC 4B3RQ 1S40A 1KD1C 4OWTB 4IO9A 1G291 5FJ8H 4YY3L 4OWWB 4IJHA 3HOWH 3K81C 3GO5A 1WOCA 5IY0A 1EIYB 1VQ6A 4IFDG 3TREA 2JA5H 3WWVA 2KCTA 4YCWA 4DV0Q 3ULPA 3I7FA 2R93G 2VUMH 1NY4A 2VZAA 4A3GH 1I94Q 2NN6I 1KHIA 2ZJQA 3S2DH 4XTCS 1EYGA 1LM0A 2R92H 1PYBA 4DV6Q 3T1HL 1WFQA 4HJ9A 3W1GA 4KLKA 5HY6A 4JI8Q 4A3DH 1VQ5A 4R1JA 1VQIA 2RF4A 2PQAA 1KRTA 1JB7A 1IBML 5BR8Q 4K0KQ 4OO1I 1N33Q 4GNXC 4JI0Q 1M1KC 2VQEL 1QZHA 2YYZA 1PH1A 2C35B 4GN5A 1KL9A 4B3TL 4A3KH 2YTVA 2K52A 2UUBL 3PV0A 2GN5A 4LUOA 4QIWE 2LXKA 5IP9H 3CCVA 1EUJA 4LF6Q 1YJNA 2IHEA 2NVTH 2OQ0A 3K7UC 4R4QA 2UUCL 3F2CA 3CCLA 4LFAL 3J81c 4OONA 3A0JA 1A62A 2D0PA 4R4TA 4DUZQ 3UDXA 5JEAG 1NE3A 4DR7Q 1K0RA 3GTGH 4C3JH 2HHHL 4NXNQ 1VQOA 4KHPQ 2Q2UA 4ME3A 5IYBG 1PH3A 3S15H 2N8NA 5AJ3L 4IOCA 3HOZG 4IJLA 2UU9Q 4BBSH 3RLFA 3J81i 1PYSB 2LSSA 1JMCA 2A8VA 3H3VH 5M5WH 2YV5A 4DK3C 2RCNA 3EIVA 3K0XA 4B3ML 1G51A 3M4PA 1O7IA 5C4JH 3RN2A 1FJGQ 3D31A 4R4OA 4NXML 4LF7L 4JI2L 2EQSA 5C4XG 1CUKA 4ALPA 4GOPB 4HJ8A 1L2FA 2XGTA 1AE3A 1D7QA 1XNRQ 1YJWA 5IP7H 2WB1E 2BA1A 4QL5A 1CKOA 2ASBA 4X64L 1U5KA 3PUXA 1HNXQ 1VQ9A 3CPWA 1NMFA 1WI5A 4TQUS 3S1QH 4A3BH 2E5LL 2JA9A 5IYCH 3HOYG 1I6HH 2KENA 1C7YA 4A3JH 1YIJA 1E24A 2NN6G 5ELOA 1TWFH 4LFCQ
chains in the Genus database with same CATH superfamily
2EVBA 2RDHA 1JB3A 1R9TH 1E3PA 3DEOA 2SEBD 1CKNB 2F0WA 5ELCA 1W6KA 3TDQA 1B3AA 2YU9H 2NZHA 1HRJA 1O7YA 3EN2A 4Y7NB 2DNCA 2EYMA 2B2TC 2F0QA 3H94A 1I6VC 3PUWA 2L9HA 2PMZE 3NTKA 2EYHA 2EJMA 4JV5L 4KJOA 2PW7A 3SDZA 4GOPC 1EOVA 1PTOD 2B8FA 3H91A 3PUVA 2NYZD 4FF1A 5JJLA 1IL8A 1RHPA 3J7YW 2HCCA 4DV4L 2N88A 1S5CD 2R7DA 3RZOB 4CHTB 4B3TQ 4HN7A 3BG3A 4NP5A 4FYDA 3MHBA 4IFDJ 1SMYD 3CC4A 4UPAA 3BDCA 4A3IG 1L0WA 1EY0A 2FJ2A 5M3FG 3OW2A 1SE4A 2ZTCA 1ENAA 3Q24A 1ESFA 5AJ3Q 1NJIC 1D1KA 1I3QH 2EJFC 4BY1G 2J7ZA 1GOZA 5BN4A 4OEMB 1H95A 1Q12A 4ABNA 1U4RA 1LT6D 2QEJC 1STBA 2YTYA 4RG1A 3R2TA 4A3KB 3GTMH 1BCPC 1OXVA 3HOXG 2BA0A 1GVPA 3M9BA 4DR4L 3VA5A 3A8JE 1PH8A 2KCCA 1LT4D 4LF9L 4KN4C 1QUQB 5C0XI 4C3JB 1SSOA 1CZGA 1N8RC 1K8AC 2ZM6L 2CCZA 3VR6A 1TIID 5IGBA 1EFID 1PVOA 2UXDL 1HH2P 2HDLA 1KXLA 1KRSA 3RD4A 1SEBD 4BBSB 1KAWA 1PTOF 3GQBA 2I5MX 3TS2A 3AQQA 1SDFA 4GNXA 3LWUA 4F8MA 4DV3Q 1Q86C 2UXBL 3K6OA 1UWVA 2DJFC 4KHVA 1SR3A 2VL6A 1XMOQ 4JI2L 4X65L 4WJ3M 2JA8H 5G3LD 1VQFA 2KBNA 1QILA 4DR1L 3GTPH 3L2PA 2MJ8A 1DOMA 1XXGA 3ERSX 1SE8A 2R7ZG 4A3JB 3DUZA 4PMCA 3H0GG 3NBIA 3R8BA 2K5NA 3DM1A 5IWAQ 1EY8A 1ILPA 4N8FA 1R9TB 3K59A 2VQFQ 3K5OA 1IBKQ 3PGZA 5J1ZA 1A8VA 1VQDA 5CV6A 2YU9B 2HQEA 2PZTA 4RGMA 3K80C 2F0PA 2IT1A 3UDFA 1PZJD 5LMUL 5C44G 5FLXL 2O4XA 3OIPA 4RCOA 3ULLA 1I94L 4BBRH 2KHSA 5FLXc 2B29A 4DV6L 3T1YL 3BS1A 2AWOA 1HZ9A 3C1EA 2E2IH 5BR8L 1YHQA 2O2LD 4DFAA 1F9QA 1PRTC 4IPCA 3CF5A 3MXPA 3VA7A 1ESRA 1FNWA 1HTPA 4DR2L 3T1HQ 1FNUA 1D5ZC 2QF7A 4LK1C 4OX9Q 2B2TA 1I4GA 2JEAI 4DUZL 5G3LF 5AFWA 4QMGA 2VNUD 2F0UA 1HPCA 1TKWB 1J5EQ 1SAPA 3TN2A 4JI3L 2MQHA 1NSNS 1DXMA 4N9TA 5M9OA 1I3QB 4QUFA 1J9OA 1F9PA 1SYDA 4N9PA 4OHJA 1C4QA 4I7ZC 2IL8A 3H6MA 4OELB 4WJWA 1SJED 1K3BC 4JI1Q 3MA2B 4EGVA 3DWPA 2KOLA 3MTSA 3S14H 4YCUA 4FF4A 1RL2A 5JAVA 5FLMG 2Z9HA 5D3IB 1LUZA 1DONA 3OPOA 5GAGC 1AH9A 4A3LG 4NXMQ 3S1MH 4A93H 2EYLA 3CCEA 2K75A 1JICA 5K5PA 3EJIA 1F77A 3KJPA 3OOCA 1SLJA 2Y0SE 1TVXA 4JI6Q 1I4RA 4FO2A 5E7NA 4A3CH 3S9WA 3GP7A 3G71A 5C0XH 3CCSA 1BR9A 2DGYA 3NTHA 4MN3A 2JA8B 4LMQD 4YCVA 4Q5VA 1X6OA 2K6AA 4RHRA 1VQNA 3GTPB 3NTIA 2HCIA 4HAEA 3ER0A 4GLVB 2CW0C 5HGTA 4DGZA 3CCUA 1ONLA 4AQYQ 4HSPA 1Q82C 4DPGA 3PIOA 2OTLA 5E4WC 4PZ7A 3M4OH 3E9HA 3CRKC 1EY9A 5I6WA 4DR5L 5M5XH 1YI2A 4ZLTF 2K7VA 1IYUA 4DR3Q 4HJAA 3BZDB 4RGTA 1YITA 2L15A 4OL7A 1X3FA 4A3FG 4JI7L 3ONAB 1HZCA 4BXXH 4XXEA 1CFMA 4X3UA 1H9RA 2QCPX 1JOKA 4BBRB 2SNMA 2A73B 2EPBA 4XQQA 3E9IA 2LXJA 2E2IB 2K04A 3CU7A 3F1ZA 3H3VI 3CPFA 1E1TA 3GDEA 2R3ZA 1HR0Q 4ZUIA 4AYBG 4HTHA 3D6CA 3HKZG 3DWQA 4CGYB 5EGTA 4ZAIA 3RLNA 4JI8L 2EYPA 5HURA 1ENCA 4IPGA 2NVXH 2WP8J 1HFNA 4TVAB 1GUSA 1UUPA 2VUMG 1OXUA 2UUAQ 4A3GG 3TQYA 1NR2A 1VF7A 2RQXA 1DJRD 4RWSC 2N78A 3IKJA 3KDFA 4CDDC 1I5FA 2SDFA 5IE8A 4GKJQ 4DK6C 1B9NA 1PTOC 3Q8DA 2Z6KA 3BVZA 1Q81C 1VQ8A 3DEPA 4JBKA 4B08A 2H1EA 1WTRA 4EQOA 4EVOA 2Q8IB 5KYLA 3S14B 3CCJA 5C4HA 3HG9A 3PUZA 3J81E 2VS1A 1VQPA 2VY3A 1N36Q 2HDMA 1NNXA 2TMPA 1SMYC 3S1RH 2EY2A 2A6EC 5KNCA 3P20A 3S1MB 4A93B 2LKVA 4KHZA 1WTXA 1FD7D 3WDNA 5LMNQ 4RH6A 3QOJA 1BUVT 1JWMD 1MBYA 1H9KA 3BZCA 4O1NA 3JAMi 1LTTD 1XPOA 1IBLQ 1AFPA 1VQ7A 4ZKBB 3S17H 3I2ZA 4CDEC 1SNOA 2WINB 1Z47A 1S5BD 4HCEA 4XYQA 4L5SA 1OXTA 2QA4A 2ALYB 1HCZA 1TU2B 5NUCA 2E2HH 1QZGA 1BXTA 4GN4B 1L0YB 1ICWA 2E75C 1O7ZA 5IGEA 1KD1C 4OWTB 2XWJB 5DM73 1G291 4OWWB 5JPMC 4IJHA 4R8IA 2JYOA 4LJZC 2F3WA 3TREA 2K05A 3M4OB 2F0HA 2KCTA 2KJXA 2RDFA 5M5XB 1B1ZA 3NBHA 2BE5D 1NY4A 2VZAA 5CBEE 2NN6I 3S2DH 1EYGA 1PYBA 2B2WA 4A3DH 1VQ5A 4PNYA 5ELBA 1KAAA 1KRTA 4K0KQ 3NK9A 1M1KC 1LTRD 4WRDA 3A56A 2VQEL 3VR5A 2C35B 5IT9E 4GN5A 5I6YA 2FHTA 1EUJA 5LL6S 2IHEA 1I4QA 2NVTH 1LO5D 4R4TA 5JEAG 1V1PA 1ICFB 4EQNA 1K0RA 4KHPQ 2JN4A 4H0LC 1I4PA 3TZUA 3S15H 2VB3X 4IOCA 3HOZG 1E0BA 4DF7A 1ZYRD 3C1FA 1PYSB 4XYOA 3H3VH 3MC0B 1II3A 2YV5A 2NVXB 4B3ML 3EIVA 2G9HD 3NQIA 5C4JH 5KGUA 2QW7A 3NE5B 4H7BA 4LF7L 2IX3A 5IGDA 1G91A 2XGTA 2MHVA 2WB1E 3MXUA 2CHBD 1CKOA 4X64L 1VQ9A 4Q0FA 5IYCH 1C7YA 1YIJA 1STHA 1TWFH 4G57A 2JP1A 1BCPF 4KK7A 2X6GA 3K8AA 2MGSA 4DU9A 1SFOB 4OO1G 2B2UC 4MTKA 3S1RB 3T51B 1Y8OB 1XYIA 1VS0A 4FNFA 1RIPA 1BBWA 3DHQA 2RHSB 4TKOB 2I5HA 1WTWA 5JJZA 1IKMA 2K01A 3I56A 4GKKL 1TS2A 2KEEA 1PYWD 3AYHB 2Y0SB 1YVCA 1Q8IA 2FMCA 5GROA 1G6PA 2L5TA 4XIGS 1IZ6A 3NSWA 1PH7A 5T1GA 2WAQE 3M85A 3QR8A 3G6EA 2PI2E 1HXYD 2EYJA 2I46A 3AFQA 2E2HB 2AQ1B 2BH2A 5C4XB 1J6QA 4UP8A 4R4IA 1HZAA 1JQYD 4DK1A 3KF6B 2VW9A 3I8ZA 3N6RA 1WYDA 4JYAL 2V1CC 2R7ZH 1X55A 4DAMA 2MPMA 3S2DB 3H0GH 3Q6SA 1E1OA 4DV1L 4A3DB 4LF8L 3T4AC 1CKNA 1GO3E 3FDTA 1N34Q 1VQGA 3AEVA 2BCOA 2EY5A 3HOYH 4RHSA 1NMGA 2NUCA 5DAUA 3T13A 5C3WA 2KECA 3MXNB 4UHVA 1VMCA 2AQ2B 1VQLA 2NVYH 1SNCA 3F2DA 2NVTB 2RKSA 4DV2L 5JEAJ 4H13C 3TSSA 3N52A 3ITPA 5C3EG 4DAYB 3HP3A 1EYAA 1PRTF 5CYUA 1JJ2A 3S15B 2AHOB 1EFWA 1EYCA 4NB3A 4GS3A 4J8QA 2A5HA 4IOAA 1KIXA 1GXDC 5C4JB 2Q2TA 4IPDA 2CFMA 2M2LA 4CKEA 3UDIA 1Q1EA 2Z6BA 1N9WA 1SN8A 2F03A 3A74A 1PA6A 3TZDA 3JC66 3FHWA 1I50B 3JAME 4DR6L 4JV5Q 3TP7A 3I4LA 4X66Q 1V9PA 1TWFB 3I70A 4A75A 5KRUA 5M3MH 3MVVA 1H9SB 4OIJA 2YTXA 3PO3H 5E4XA 1F9RA 2XVSA 1LTSD 3X3MA 4JI4L 2F0MA 1PH2A 5GAHC 4G7ZC 3ZJYC 3SK8A 4BY7G 4ODGA 2SNSA 1Q3LA 4MTNA 2K14A 1V43A 3K0YA 3FMCA 4DV0L 2KUMA 4GN3B 1Y1VG 4F88A 1IHZA 2K03A 1W6JA 4A76A 1PH9A 2CKZB 5IYDG 1N33L 1EY7A 1G2TA 1K28A 1VQJA 3DM3A 2B2UA 3BYYB 1SYGA 1SMXA 2DNEA 1EIGA 1S72A 3UDGA 4LF4L 4DR4Q 1O78A 1V8QA 1QB5D 1B70B 4LF9Q 3A8IE 4IZ8A 4JC0A 3ZYYX 1N32L 2R7ZB 2K50A 1F2ZA 4NXNL 1K8MA 3U4VA 3GTLH 1X3PA 2F0KA 3H0GB 2UXDQ 3AMUA 3FKIH 1MIUA 2UUCQ 4JBWA 2UXBQ 2KHJA 5KNBA 2EDGA 5A2QL 2Q8RE 3HOYB 4RCNA 4JI2Q 4IALA 4X65Q 1UE7A 1Y1WG 4BA1I 2JA7H 4QQBX 1GM5A 2NVYB 3S1NH 1HNXL 4OGQC 5DM63 5J39A 3E5SA 2MO1A 1X3QA 4YWKA 3J80E 3PF4A 2BE5C 5EPJA 4C3IH 5A35A 4KKSA 4C3HH 1WTHA 4XDXA 1BBXC 1H9MA 3CXCA 1Y8PB 4L5TA 2PO4A 1STNA 2QGQA 1K8OA 3X3NA 3RN5A 5LMUQ 5I4DA 1K83B 4KY5A 3I4NG 1AEXA 3HGBA 4LF5L 2WB1B 3GTJH 3MFYA 4HSVA 1GD7A 1XMQL 1A3VA 4DNRB 2GA4B 2HUGA 1MKHA 3T1YQ 3S24A 2D2CC 5M3MB 3IFTA 2KQ3A 3CCRA 3D6WA 1YNND 4IPHA 1EWCA 2XRSD 3KLSX 2HIXA 4YHHL 3PO3B 2JA6H 2NWGA 1ZYRC 2B3GA 3GTQH 4DR2Q 3R2IA 5K36H 5H1SE 3L0OA 4Y52H 3E0EA 1D5XC 3PIP3 3I4MG 4LFBL 1KLUD 3MAQA 2K5DA 2LMCB 3HZXA 5CORA 1X3EA 4MIUA 2KHIA 1LTLA 4CDCC 1SNMA 4HMIA 5C3XA 4FDBA 4JI3Q 1YEZA 4HR7B 1MHWC 4A3MG 1ASZA 1NR4A 4B3RL 3HOUH 1JOQA 1U4MA 3MXGA 2F52A 4IURA 1GUGA 2BH8A 2NZOA 3E0JA 3PO2H 2WAQB 1HA6A 1RDPD 1EQTA 3STBD 2XTIA 2B2VA 5BN3A 2B63H 2ZTDA 1UE5A 2CWPA 3TS0A 2BOSA 2Z6KC 1EOTA 4DV5Q 2D62A 3GTLB 3PCOB 5C4ZA 2F4VQ 1F2LA 2R6GA 3W5OA 1W3SA 1X9NA 2K5QA 3WOFA 1VQAA 1CQFA 5KIXA 1WCMH 1XX8A 2F0OA 3FKIB 1PXUA 4LF6L 1W2BA 2ZJPA 4J15A 2EYOA 2R61A 4LWCA 1EZ8A 1TY2A 4DV3L 1HZBA 1Q1BA 4DA2A 4A3KG 2OXPA 1QCBD 1RKNA 2JA7B 2OF1A 3M4QA 1BQQT 3TP5A 3S1NB 3QJYA 1PFMA 2ZXPA 4QUCA 1VQEA 1LTBD 1QG7A 1U4PA 5C5MA 1P8LA 2L1BA 5J3BA 3NWSA 1P16A 4C3IB 1EQQA 2UXCQ 4IUVA 3EA6A 4C3HB 4BBSG 2E2JH 3FVQA 4DR5Q 3HOVH 3BYTB 5JEAH 2CQOA 1YHAA 2MO0A 1YZ6A 5JJIA 3AFPA 1QNUA 4P71A 4KKTA 3H09A 4POFA 5D14A 4JI7Q 1VCIA 2NZ1D 5IP7G 4C56C 1UEBA 4S3SA 3UI2A 5EAYA 3GTJB 1JCKB 1BKBA 4QF4A 2OTJA 4L5RC 4IO9A 1B2TA 2B2WC 1ILQA 5FJ8H 3HOWH 1GHKA 1G2SA 1VQ6A 2JA5H 4M1UB 3WWVA 5LL6X 2JA6B 4YCWA 4HCSA 2KA7A 5LHY1 3ULPA 2R93G 3GTQB 5COYA 1KHIA 5I2YA 2R92H 4IUTA 3T1HL 1EWHA 4JI8Q 1OO9B 4R1JA 2PQAA 1JB7A 2Z4IA 2NTSA 1GUNA 1PH1A 1GHJA 4X3KA 1KL9A 5IGCA 2P5ZX 1SE2A 1EY6A 1QWYA 4LUOA 2GN5A 3HOUB 3ERQA 4K6LA 1YJNA 3PO2B 1JOOA 3BDLA 1C48A 2OQ0A 2VB2X 3F2CA 4LFAL 2D0PA 1JC7A 2HHHL 1VQOA 2PMZB 1B9MA 2DY7A 2B63B 3DWAA 1JMCA 4FF2A 2RCNA 1I6HB 3K0XA 1Z7TA 4NXML 1CA5A 2EQSA 2G9DA 4GOPB 4HJ8A 1WCMB 1AE3A 5I2XA 3NHHA 2E2DC 1D7QA 3SK5A 2ASBA 1U5KA 3PUXA 5J22A 1HUMA 2EYFA 4RKBA 4ZK9B 2KENA 4G7HC 5ELOA 3H3VC 5CV9A 1K9MC 3SE0A 3VYTA 4DV7L 1QNKA 1K3RA 2LY7A 3GV6A 1RJTA 4IFDH 2ATWA 1NUCA 1UNSA 4CDFC 1IW7D 4K8IA 4L6TB 3BJUA 2KVMA 1B7YB 1TXYA 2IPKD 2XSCA 2WIIB 4R8NA 2TSSA 3VYSA 5KYIA 1SXTA 4X62L 3WOEA 2XRQD 5ELFA 1YNXA 2E2JB 1JWUD 4PZ8A 3HOVB 4DAVA 1SFOH 1LV9A 1VQHA 3ICEA 1KDAA 1CT1D 4FXGC 4DR3L 1SJHD 3OYYA 3I73A 2JK8A 3CRLC 5CC4A 4FP5D 5GADC 2JA8G 2M9VA 3OMCA 1BCPB 4HMJA 2L55A 4CJ1B 1OTCA 1RCVD 1BO0A 2F0SA 2OEOA 2VQEQ 4B3SQ 3KOJA 4O0AA 1S3OA 1VQKA 4C2MH 1IKLA 3U9OA 5IYBH 2VXWA 2XWBB 1AZQA 3CP0A 3HOWB 3DXJC 3IAYA 2JA5B 1AP0A 3I72A 5EPLA 3KYHC 1JR0D 1KNAA 4JOIC 4A3BG 3MEHA 3C46A 4H44C 2R92B 1O7LA 5C4XH 4TSSA 3T16A 4O2DA 2NVQH 3OSOA 1A2UA 5FLXE 2L4NA 2UUAL 4BBRG 4JI5Q 1G8ZD 4JCVE 3CCMA 3BU2A 4K14A 1IYJB 1F2YA 2JSOA 4X64Q 3M4YA 3U4ZA 4FVMA 2IHFA 1E7ZA 1PFBA 1SYFA 1BDOA 1D2BA 1YNNC 4P72A 2OCEA 3FEWX 2MUYA 1DOLA 2ZTEA 3RNUA 3W3AA 4A4IA 4FF3A 1HNWL 3HS0C 1B50A 4PG3A 2RDGA 4KTAA 1XNQL 3AB9A 3KF8A 3PF5A 2RHQB 1WTQA 1B4OA 1TS3A 1BNZA 2D0OA 3V05A 1JWSD 4GKKQ 3IFDA 1YNJD 4EQ5A 3MWYW 1HNZL 3UE1A 4HIMA 2F1MA 3STBC 1JE4A 4P2CB 1PRTB 1VMPA 3OIQA 1X65A 2BDOA 4NDXA 4RGNA 4A3IH 5M3FH 3MZ5A 1I50H 3SVMA 1XPRA 4A93G 1TWHB 2OT2A 1TY0A 4ILWA 5FOBB 2QEXA 4BY1H 3KFUA 1EU3A 3MFGA 4BA2I 3CC2A 4K5WA 1PTOH 4DUYL 3TBIB 4A3CG 3CAMA 5C0XG 1JT8A 1LLRD 4DV1Q 3ND9A 1LABA 5IGGA 4XQJA 3HOXH 1B3QA 4DNIA 4YY3Q 4TRDA 3RLOA 1EY5A 3IRBA 4R9WA 4FXDA 2H5XA 1A6XA 4NKLA 1TWAH 5FO7B 3F8TA 4C2MB 4QB4A 5JVG3 1FR3A 4DV2Q 3QWNA 1IBMQ 3U50C 1T9HA 3R3OA 1MSGA 3D0FA 2A19A 2QDLA 2A68D 2E74C 2M00A 3B6YA 4R4CA 1H9SA 1PZKD 2AUKA 3C3LA 2UUBQ 4KV6A 3VYRA 4QY7A 4RMFA 1E2VA 3CCQA 2NVQB 3OTOL 4BXXG 4RGOS 2O5IC 2K33A 1IL2A 1X56A 2F0TA 1CTMA 3KBXA 2AUJD 2NBFA 3KLWA 4OXPA 2F0LA 1LACA 2DJGC 3LWEA 5EPKA 2ES2A 3GTKH 1ASYA 2N3SA 1I4XA 3QIAA 3I4MH 1HA5A 3D4DA 2AKWB 5C5LA 4DR6Q 5M5YH 4C1NI 1FGBD 1V1PB 4QJFA 4JOIA 3TEHB 3CMAA 5F2DA 4A3MH 2EZVA 4ZUJA 4HIOA 3OW7A 4JK1C 3OHXC 3CKIB 5C44H 1JE5A 3BDOA 2F0NA 2F3IA 3SR1A 5JVH3 4JI4Q 4LUZA 2E5LQ 4ZRZA 3CMEA 1C8CA 2JEBI 5CV5A 1TR5A 2OQKA 4ZQ3A 1L1OB 4DK0A 1SROA 1E2ZA 2Z0SA 2RA4A 4GLAC 2K5VA 4PMBA 3T56B 2IX1A 4AYBE 1CKMA 2X69A 3HKZE 1EIFA 5FKAC 5IGFA 1T5EA 4XT3B 2HIVA 2F0EA 3ND8A 4I65A 1SYCA 1K83H 4HJ7A 2F0FA 4H02A 4AH6A 4ZCKA 1C9OA 1VQCA 3J81j 1RF2D 4A3IB 1KC8C 5M3FB 1HR0W 3H15A 3P75A 1HJPA 4LF4Q 3KK7A 1D6EC 2EJGC 2JXMB 5FO9B 4BY1B 2CH4W 3NUCA 4J6HA 3QB3A 5EJWA 1BBUA 1KDCA 3NPPA 1A3UA 1N32Q 1PTOB 4YWMA 3DLLA 4DV4Q 2Y0SG 4KKUA 5C0XJ 2B2VC 3NEMA 5ISRA 5GQOA 3SHLA 2D5DA 1SYEA 3HOXB 5CBAE 3SK6A 4RKLA 4UDUC 4POGA 2F4IA 4RFBA 5TSSA 1N34L 5FLMH 1G6ZA 2IWHA 1QUQA 3KLRA 1A63A 4BWGB 1TWAB 2ZXRA 4A3LH 1IW7C 4ULLA 1K0SA 3VR3A 2K32A 1CSPA 2H4OA 4JW0A 1CI3M 3J7A5 2N55A 3E6ZX 1GUWA 4JI0L 1AE2A 1QOHA 2RSOA 4MNOA 1B53A 1CSQA 1E2WA 1EYDA 2XIWA 1K8GA 3SGIA 4A3DG 2AQ3B 5C6AA 2KCNA 5LMNW 1NAPA 4ZKCB 1YBYA 3M3YH 2GVBA 4JBJA 1LTID 3FPPA 2HT1A 2R93H 1LT3D 5EBCA 4UY8C 4DR7L 1FL0A 3O13A 4IQZA 2ZM6Q 2JJQA 3GTOH 2A69D 2K28A 3GTKB 1JORA 3I4MB 1PH6A 3PIPA 4LF5Q 2UU9L 1KNEA 5BN5A 2JQOA 5M5YB 1TT2A 3V96A 1M4VA 1XMQQ 4X66L 5ELEA 2K5WA 4A3MB 1FJGL 4DXFA 3K57A 4A3FH 2WFWA 2PI2A 4HEDA 1XNRL 4YHHQ 2KCMA 4RA8A 5C44B 1PH5A 2B8GA 1MJCA 4DR1Q 5ELNA 3NWTA 4ME5A 2EOTA 4K2KA 4A3EG 5CGKA 2X6LA 1LYLA 1RTNA 1TS4A 4LFCL 1Y8NB 4LFBQ 2A6ED 2RBMA 2Q2HA 2L0CA 4HIDA 1EIHA 5IYCG 3RUZA 4X6AH 1Q7YC 4PMWA 4B3RQ 1DD2A 2EE1A 3I3CA 1EIYB 5IY0A 1S5FD 3I7FA 2VUMH 4A3GH 1I94Q 1J8IA 1PMRA 2ZJQA 4KMUC 1LM0A 4DV6Q 3IL8A 3A8KE 1WFQA 4HJ9A 3W1GA 1VQIA 5CV4A 4IUNA 2WKDA 4OO1I 5BR8Q 1RTOA 1LTAD 1QZHA 2F0VA 1YNJC 4B3TL 1STEA 1WD1A 5L37A 1TQOA 3PV0A 4QIWE 3CCVA 1H9JA 4XQNA 3J81L 4LF6Q 1A3TA 3C2PA 2FMMA 3F2UA 3CCLA 2UUCL 2PQEA 3J81c 3A0JA 2QDBA 2EY6A 4DUZQ 2XN9C 1NE3A 2EY1A 3GTGH 2L12A 2CVRA 2Z1CA 2J4XA 3EQLC 2RVLA 1PH3A 2N8NA 3A54A 5AJ3L 1AN8A 3RLFA 3J81i 3S1QB 1IYVA 2A8VA 1CZWA 5M5WH 1G51A 1O7IA 3OWEB 3P7JA 3D31A 4R4OA 2F3VA 1L2FA 2CH4A 1YJWA 1XWEA 2BA1A 3M3YB 1S4ZA 1WVLA 4N8X1 2R93B 4A3BH 3HOYG 2JA9A 1I6HH 3PQIA 1B44D 2A6HD 5EKLA 2NN6G 3GTOB 3A55A 1DCZA 2A1AA 2C5CA 3QOLA 1HFGA 2F0JA 4GLXA 1DM0B 4IFDI 1C0AA 1F9SA 2FFKB 2B2YA 3L9AX 3J7ZC 4P74A 3HEJA 3K5MA 1ET9A 2CWAA 4IN3A 3EROA 4DNTB 1QVFA 5KNDA 4B9XA 1Y69U 2A68C 2IX0A 5IP9G 1BF4A 3A5UA 1TWGH 1XMOL 3RMHA 4A3FB 1KTKA 1EL0A 1PFNA 3L3OC 2J0TD 5IT9L 4C3JG 1JJCB 1MD2D 3OMGA 5IT9c 5IWAL 1PZID 1UEAB 3K7AH 3W2DA 3KBGA 2WB1G 2VQFL 1IBKL 4DXGA 4PQXA 2NB0A 4AYBB 4GNXB 1MI2A 4GOPA 4C1NK 4MHEA 4MZ9A 2DY8A 3HKZB 5M3MG 5DEHA 4DKAC 1FVIA 1LTGD 3HOZH 2FXQA 4LFAQ 3CW2C 1EY4A 1QVGA 3PO3G 1Q90A 1DOKA 1X3GA 2HHHQ 3GTMB 2VUMB 4A3GB 1WTOA 1EWIA 4PV1C 2MFIA 4A3JG 2O5JC 3URYA 1K73C 1T5XD 4JVZA 1ZEQX 4WJ4A 3CC7A 3D3RA 2IY5B 4L5QA 4UAIA 3BVGA 1WTPA 5EKKA 3CHBD 4DV5L 2NTTA 1XTDA 3SXHA 3VR2A 3MEFA 1U4LA 2F4VL 2G5DA 1U9RA 1X32A 2PZWA 2HD3A 2XNAC 2DN8A 1PLFA 2WAQG 1DZ1A 2EXDA 4U673 3R93A 4OX9L 3S2HH 3NENA 4K5XA 1GUTA 4OO1H 3EFXD 1VQBA 1JJGA 5DLQE 3GTGB 1J5EL 1MJEA 3QO2A 3EVQA 4PZ6A 1XJVA 4DV7Q 4BS9A 2K1BA 3I55A 1PV4A 1ML0D 5M5WB 2PW5A 4JG2A 3BVMA 4JI1L 3KJOA 4X62Q 2AMCB 1UE6A 2UXCL 1SNQA 1A15A 3GD7A 3FKIG 3M7NA 1EU4A 3A7AB 1ENFA 1V1QA 1YJ9A 3NQTA 3M7GA 1QVCA 3G4SA 4A3BB 4CBVA 5A2QE 3VYUA 3F2BA 2R7FA 2JA7G 4UP9A 4JPBW 3EBEA 1X54A 3DMUA 3I91A 4IUQA 1KLGD 2PNHA 2IW3A 1O80A 3HRZC 4JI6L 4DN4M 4LAAA 1HQMC 2IJ0A 1PDQA 1L1OC 1M8AA 3LNNA 2QILA 5D65A 4C3IG 1L0XB 2FINB 1TWGB 4C3HG 1DYQA 3FP9A 2B39A 2F0GA 1EQRA 5CR3A 5CV8A 2PCFB 3RR5A 1DGSA 1QE6A 1Q46A 3A5ZB 4NPSA 1Z6HA 3U9SA 3S16H 1TWHH 2DUDA 4AQYL 3K7AB 2A69C 3T53B 2Q2IA 5DNFA 4B9WA 4KI0A 2HQLA 1F2MA 4NW2A 2ZT9C 1ZKOA 5CMDA 5C3EH 3RZDH 3HOZB 1HQRD 2JE6I 3SEBA 3NXWA 2JA6G 2Q8TA 5K36G 5KEEA 2EIFA 2WKCA 3UE0A 1VDZA 5JJKA 4NMZA 1CHQD 3PIO3 2PQAB 1HNWQ 3JAML 2RSNA 3AU7A 3ULJA 3HFZB 1Z9FA 1HR0L 1EZ6A 1ZXTA 5EBDA 5HGQA 3JAMc 1PHJA 1XNQQ 2I5LX 1R4PB 1PH4A 3HOUG 1A0IA 4ZYSA 1U0LA 4JBMA 3L7ZC 4QIWB 2F0IA 1D8LA 4X3SA 5E1FA 1KQSA 3PO2G 4U68A 1MSHA 1Q8KA 1SRUA 3S2HB 1HNZQ 4B3MQ 4OWXB 2MNAA 3K5NA 4YIJA 2B63G 3PUYA 1E22A 1SE3A 4LF7Q 5D3DA 5FO8B 4BY7H 1VQMA 3LX0A 4GKJL 2ZJRA 1GUOA 1XPUA 1UAPA 1SNDA 4LNQA 5GAEC 4KY7A 4HIKA 2E8GA 1CM9A 1Y1VH 1D5MC 2ICEC 1WCMG 4E6IA 1VF5C 5IYDH 3KLSA 4F87A 4LW1A 3U58A 1EEFD 4KY6A 5EQ0A 4DUYQ 1QJOA 1RD9D 1N36L 1CQVA 4KN7C 2N49A 4K6DA 1BCPD 2SOBA 1MGSA 4P73A 4DAPA 3I90A 1BOSA 4HJ5A 4GZYC 4O42A 1NTGA 3KF6A 2ENBA 5LMNL 3KDFB 1LT5D 5E3FA 2OWOA 1TWCH 3Q23A 2EXZA 3W1BA 4B3SL 3G48A 3G7LA 4QGUA 1IBLL 5FK9C 4WORA 2I07B 3HOVG 2PNRC 4APVA 1PFSA 1OXSC 4X3TA 1EQVA 1FNVA 2K5HA 3CQZH 1UE1A 1IXRA 2AWNA 4KD3A 2LS01 3S16B 3MXNA 1Y1WH 1AZPA 1B8AA 2A6HC 3OTOQ 3NP8A 1NBWA 3TMEA 1RODA 3J7AF 4IUUA 1AW7A 4JYAQ 4JI5L 3J80L 3D8GA 5ELDA 2Z8LA 4DAYA 4A3EH 1L1OA 5C3EB 2PYKA 4CKCA 5FJ8G 3RZDB 3J80c 3PSIA 3HOWG 4XT1B 2PPBC 4AIMA 4V190 3SK4A 1I4HA 3Q0AA 4WFN3 2JA5G 1TS5A 2KEDA 4LF8Q 1D1IA 1R4QB 4UP7A 4K0KL 4G7OC 4P75A 1VQ4A 4KD4A 1HTLD 3TRZA 2R92G 3J80i 4K8JA 5JOBA 1BVSA 4QCLA 3G6JB 3Q22A 3I4NH 1OXXK 2ID0A 3K58A 1GKHA 3NBHB 4KHPL 4L63B 3LGJA 3FPUB 1HUNA 3VR4A 3BZKA 3NELA 1WD0A 1KABA 3KUPA 1M90C 2WV6D 2I0QA 4LUVA 1PRTD 2K4KA 1WJJA 1SBBB 3S17B 1YHBA 1S5ED 4Y7NH 4BY7B 4EX5A 3I4OA 2C9OA 1Y14B 4YWLA 4CKBA 1S5DD 1A2TA 4L8JA 1STAA 2GVAA 4F7XA 3A7LA 1NCVA 1KDBA 1Y1VB 5JPNC 3VDYA 2BDNA 3CD6A 4FXKC 2RCFA 1CHPD 1SYBA 3KF8B 2CQAA 2LFNA 1FGUA 3QG1A 2E76C 2ICIA 4J1MA 2F0DA 3RZOH 3TP8A 3HKSA 3P1HA 3GV3A 5T1IA 1S40A 1HHVA 1SNPA 2D9UA 4YY3L 1V1OA 3J7AV 3V2TA 4G4KA 1XTCD 3K81C 3GO5A 1WOCA 4IFDG 3FRPB 1TWCB 4DV0Q 1FYCA 2QKIC 3OWFA 2NN6H 4XTCS 5IOCA 4KLKA 5HY6A 2RF4A 5EKIA 4ID6A 1CA6A 3TP6A 1IBML 1N33Q 2L11A 4GNXC 4JI0Q 2V4DA 2YYZA 4RAUC 4A3KH 2YTVA 2K52A 3CQZB 4EQPA 2UUBL 2LXKA 5IP9H 3D4RA 1Y1WB 1EEID 2Z4HA 5CV7A 4CJ0B 4R4QA 3K7UC 2CW0D 4OIKA 4OONA 1A62A 4V0BA 3UDXA 4DR7Q 4C3JH 4NXNQ 4K5VA 4I7AA 4A3EB 2Q2UA 4ME3A 5IYBG 4IJLA 2UU9Q 3D4WA 4BBSH 2MP1A 2LSSA 4KJNA 4DK3C 5I9OA 2ZXOA 3E3XA 3M4PA 5I9PA 1STYA 3RN2A 1ET6A 1FJGQ 4CJ2C 3PMFA 5C4XG 4IUPA 1CUKA 1WTVA 4ALPA 2A74C 2WACA 1XNRQ 5IP7H 2PZUA 4QL5A 3I4NB 4M8AA 5IODA 4Z9CB 4K2LA 1HNXQ 1STGA 3CPWA 1NMFA 1WI5A 2B2YC 4TQUS 1CK1A 3K5LA 3S1QH 2E5LL 1GJXA 4A3JH 5IIFA 1E24A 4LFCQ
chains in the Genus database with same CATH topology
1K9MC 2A1AA 3K8AA 4DV7L 1K3RA 4GLXA 4IFDI 1C0AA 1R9TH 1E3PA 2ATWA 4OO1G 1CKNB 3J7ZC 4P74A 3BJUA 1B7YB 2CWAA 1VS0A 2YU9H 1TXYA 2NZHA 1QVFA 1RIPA 1BBWA 2RHSB 3EN2A 4X62L 2IX0A 2I5HA 5IP9G 3A5UA 1TWGH 1YNXA 1XMOL 4PZ8A 3I56A 3PUWA 4GKKL 2PMZE 1SFOH 3AYHB 3ICEA 1VQHA 1YVCA 4JV5L 4DR3L 1JJCB 4GOPC 3OYYA 1EOVA 5GROA 1G6PA 3PUVA 2JK8A 1IZ6A 4XIGS 5IT9c 5GADC 2JA8G 1PH7A 5IWAL 2WAQE 3K7AH 5JJLA 3M85A 1OTCA 2WB1G 3G6EA 2PI2E 2VQEQ 4DV4L 3AFQA 2R7DA 2VQFL 1IBKL 4B3SQ 4B3TQ 2BH2A 4GNXB 4GOPA 3KOJA 1J6QA 4O0AA 1S3OA 1VQKA 4MZ9A 4C2MH 5M3MG 4DKAC 1FVIA 4UP8A 5IYBH 4IFDJ 4R4IA 1HZAA 3CP0A 2VW9A 3KF6B 3CC4A 2FXQA 3HOZH 4LFAQ 3CW2C 1QVGA 4UPAA 1WYDA 3PO3G 4A3IG 1L0WA 4JYAL 2V1CC 1X3GA 3KYHC 5M3FG 3OW2A 4JOIC 2HHHQ 1X55A 2R7ZH 4A3BG 4DAMA 2ZTCA 3H0GH 1EWIA 4A3JG 2MFIA 1E1OA 5C4XH 5AJ3Q 1NJIC 1K73C 1I3QH 4DV1L 4BY1G 4WJ4A 3CC7A 4LF8L 4L5QA 4O2DA 1CKNA 1GO3E 2NVQH 2IY5B 1H95A 1N34Q 1VQGA 1Q12A 4DV5L 1XTDA 3AEVA 2UUAL 3MEFA 4BBRG 4JI5Q 2F4VL 2YTYA 4RG1A 3GTMH 3HOYH 1NMGA 4JCVE 3CCMA 1OXVA 3HOXG 3BU2A 2BA0A 1GVPA 3MXNB 1IYJB 3M9BA 1VQLA 4DR4L 2NVYH 4X64Q 2WAQG 3F2DA 1PH8A 2EXDA 3U4ZA 4DV2L 4OX9L 5JEAJ 2IHFA 1E7ZA 4LF9L 3S2HH 3NENA 1JJGA 1VQBA 1QUQB 5DLQE 5C0XI 1N8RC 4P72A 1K8AC 2OCEA 2ZM6L 2CCZA 1J5EL 1MJEA 5C3EG 4DAYB 4PZ6A 1HH2P 2UXDL 1PVOA 2ZTEA 1XJVA 3RNUA 1KRSA 4A4IA 1JJ2A 4DV7Q 1KXLA 2AHOB 3HOUG 1EFWA 1KAWA 4NB3A 3I55A 1PV4A 2I5MX 4GS3A 1HNWL 4JG2A 3TS2A 3AQQA 4IOAA 4GNXA 1Q86C 4DV3Q 1KIXA 4PG3A 2Q2TA 2UXBL 4IPDA 4JI1L 3KJOA 2CFMA 1XNQL 1UWVA 4X62Q 2AMCB 3UDIA 1UE6A 2UXCL 1SR3A 1Q1EA 2VL6A 3GD7A 4X65L 3PF5A 1N9WA 1SN8A 2RHQB 1XMOQ 3FKIG 3A74A 2JA8H 3M7NA 4WJ3M 2D0OA 1VQFA 1V1QA 1YJ9A 1PA6A 2KBNA 4GKKQ 4DR1L 1QVCA 3JC66 3FHWA 4EQ5A 3L2PA 3ERSX 3G4SA 3GTPH 4DR6L 1SE8A 1HNZL 3UE1A 4HIMA 4JV5Q 2R7ZG 3STBC 4X66Q 3F2BA 2R7FA 3H0GG 1V9PA 4A75A 4UP9A 2JA7G 2K5NA 5M3MH 5IWAQ 1X65A 3EBEA 1X54A 2YTXA 4QQBX 2VQFQ 2PNHA 1IBKQ 3PO3H 3PGZA 4A3IH 4JI6L 1A8VA 1VQDA 5M3FH 1XPRA 1I50H 4JI4L 1L1OC 4A93G 3K80C 1PH2A 5GAHC 3ZJYC 2IT1A 4BY7G 2QEXA 3UDFA 4BY1H 3FP9A 5LMUL 4MTNA 1EQRA 3KFUA 2K14A 3RR5A 1DGSA 1V43A 5C44G 4BA2I 3CC2A 1Q46A 3A5ZB 4GN3B 1Y1VG 4NPSA 4DUYL 4DV0L 3ULLA 4A3CG 3CAMA 1I94L 4BBRH 5C0XG 5FLXc 1JT8A 2B29A 4DV6L 4A76A 4DV1Q 3T1YL 3S16H 1PH9A 2AWOA 3HOXH 1HZ9A 2CKZB 4DNIA 5IYDG 1TWHH 4YY3Q 2E2IH 2DUDA 4AQYL 3RLOA 5BR8L 1YHQA 1N33L 2Q2IA 3IRBA 2HQLA 4KI0A 2H5XA 1VQJA 3DM3A 1SMXA 1TWAH 4IPCA 3CF5A 3F8TA 1S72A 5C3EH 4DR2L 3UDGA 3T1HQ 3RZDH 4LF4L 4DR4Q 4DV2Q 4OX9Q 1B70B 2JE6I 4LF9Q 2JEAI 4JC0A 1IBMQ 3U50C 1T9HA 2JA6G 4DUZL 1N32L 2VNUD 2K50A 4NXNL 2A19A 3D0FA 3U4VA 3GTLH 3B6YA 4R4CA 1J5EQ 2UXDQ 5K36G 4JI3L 2MQHA 2UUBQ 2EIFA 3UE0A 5JJKA 3FKIH 4QY7A 4RMFA 3CCQA 3OTOL 2PQAB 4BXXG 1HNWQ 1MIUA 2UUCQ 3ULJA 3HFZB 1IL2A 4JBWA 1Z9FA 2UXBQ 1X56A 2KHJA 1HR0L 4JI1Q 1XNQQ 5HGQA 3JAMc 1PHJA 2I5LX 3KLWA 4JI2Q 1PH4A 3S14H 4X65Q 1UE7A 4OXPA 1Y1WG 1A0IA 4BA1I 1U0LA 4YCUA 3L7ZC 2ES2A 1ASYA 1D8LA 1KQSA 1GM5A 2N3SA 4JBMA 3I4MH 3PO2G 1Q8KA 1SRUA 1RL2A 2AKWB 3S1NH 1HNXL 5FLMG 4DR6Q 5M5YH 1HNZQ 4B3MQ 4OWXB 1LUZA 2MO1A 2MNAA 4QJFA 4JOIA 4YWKA 3TEHB 5GAGC 4A3LG 3CMAA 4A3MH 4NXMQ 3PUYA 2B63G 3PF4A 1E22A 4LF7Q 3S1MH 4A93H 4C3IH 4HIOA 3CCEA 4BY7H 2K75A 4C3HH 1VQMA 4GKJL 2ZJRA 1XPUA 3KJPA 5C44H 4LNQA 1SLJA 2Y0SE 1JE5A 5GAEC 4JI6Q 4HIKA 2E8GA 1Y1VH 2F3IA 5E7NA 4JI4Q 3CXCA 4A3CH 4LUZA 2E5LQ 4L5TA 3G71A 3CMEA 3CCSA 2JEBI 2DGYA 2QGQA 2OQKA 3RN5A 1WCMG 5LMUQ 4YCVA 1L1OB 5IYDH 1SROA 3I4NG 1X6OA 2Z0SA 4LW1A 3U58A 4LF5L 4DUYQ 1N36L 3GTJH 1VQNA 4GLAC 2K5VA 2N49A 2IX1A 1GD7A 4AYBE 3ER0A 1CKMA 1XMQL 4GLVB 4P73A 1MKHA 3HKZE 1EIFA 3CCUA 3T1YQ 3S24A 2HIVA 4HJ5A 4AQYQ 1NTGA 3KF6A 1Q82C 5LMNL 4DPGA 3PIOA 3CCRA 1K83H 3KDFB 4HJ7A 4H02A 4PZ7A 2OTLA 4IPHA 4AH6A 3M4OH 3E9HA 2HIXA 1TWCH 1C9OA 1VQCA 4YHHL 3J81j 3W1BA 5M5XH 4DR5L 1YI2A 1KC8C 2OWOA 4B3SL 2JA6H 1HR0W 3G48A 2B3GA 3H15A 3GTQH 4QGUA 1HJPA 4DR3Q 1IBLL 4DR2Q 4HJAA 4LF4Q 1YITA 5H1SE 2L15A 3L0OA 4Y52H 1X3FA 3E0EA 4A3FG 4JI7L 1BBUA 1HZCA 3I4MG 4LFBL 3HOVG 4BXXH 4APVA 1N32Q 1PFSA 1X3EA 4YWMA 2Y0SG 3DLLA 1OXSC 4DV4Q 2KHIA 1LTLA 5C0XJ 3NEMA 4FDBA 5GQOA 4JI3Q 1YEZA 2K5HA 3CQZH 1UE1A 1IXRA 2AWNA 4A3MG 1ASZA 3E9IA 2LXJA 4B3RL 3HOUH 1Y1WH 1B8AA 2F52A 2BH8A 2NZOA 3F1ZA 3OTOQ 3H3VI 3CPFA 3PO2H 4POGA 1E1TA 1AH9A 1NBWA 3STBD 1N34L 5FLMH 3GDEA 1QUQA 2XTIA 1HR0Q 4JYAQ 1A63A 4JI5L 4AYBG 4A3LH 4A3EH 2B63H 2ZTDA 1L1OA 3HKZG 1CSPA 5FJ8G 3J80c 3PSIA 3RLNA 3HOWG 1UE5A 2CWPA 3TS0A 4JI8L 2JA7H 4AIMA 4LF8Q 2JA5G 2Z6KC 4UP7A 3J7A5 4IPGA 2NVXH 4K0KL 2WP8J 4JI0L 4P75A 4TVAB 1VQ4A 4DV5Q 2VUMG 2D62A 1AE2A 1OXUA 4MNOA 2UUAQ 1CSQA 4A3GG 3PCOB 3TQYA 3TRZA 2F4VQ 2R92G 3J80i 2R6GA 3W5OA 3SGIA 1W3SA 1X9NA 1K8GA 1BVSA 2N78A 1VQAA 4A3DG 3KDFA 1I5FA 1WCMH 5IE8A 4GKJQ 4DK6C 5LMNW 4LF6L 3I4NH 3Q8DA 1YBYA 2ZJPA 1W2BA 2Z6KA 3M3YH 4J15A 1OXXK 2GVBA 4JBJA 4LWCA 1Q81C 1VQ8A 2HT1A 4DV3L 4JBKA 2R93H 2ID0A 1HZBA 1GKHA 4UY8C 1Q1BA 4A3KG 4DR7L 1FL0A 3NBHB 2ZM6Q 4KHPL 2JJQA 3CCJA 3GTOH 3M4QA 3LGJA 3PUZA 1PH6A 2VS1A 3PIPA 1VQPA 4LF5Q 2UU9L 2VY3A 3BZKA 1N36Q 3NELA 1M90C 2I0QA 2JQOA 4LUVA 1VQEA 3S1RH 1XMQQ 1P8LA 2K4KA 4X66L 1WJJA 5J3BA 1FJGL 1YHBA 4KHZA 1P16A 1EQQA 2UXCQ 4Y7NH 5LMNQ 4BBSG 4EX5A 4A3FH 2WFWA 3I4OA 1Y14B 2PI2A 4YWLA 2E2JH 1XNRL 4YHHQ 4DR5Q 2KCMA 3HOVH 3BZCA 2GVAA 1MJCA 4DR1Q 2CQOA 1PH5A 1YHAA 2MO0A 1YZ6A 5ELNA 5JJIA 3AFPA 3JAMi 4P71A 3VDYA 1XPOA 1IBLQ 3CD6A 4POFA 1VQ7A 4A3EG 3S17H 3KF8B 1LYLA 3I2ZA 4JI7Q 1VCIA 4LFCL 5IP7G 4LFBQ 1Z47A 1FGUA 1UEBA 2Q2HA 4L5SA 1OXTA 5EAYA 2QA4A 2ALYB 4HIDA 2E2HH 1QZGA 3RZOH 5IYCG 3HKSA 4GN4B 4X6AH 1BKBA 1Q7YC 2OTJA 4PMWA 3GTKH 4L5RC 4B3RQ 1S40A 1KD1C 4OWTB 4IO9A 1G291 5FJ8H 4YY3L 4OWWB 4IJHA 3HOWH 3K81C 3GO5A 1WOCA 5IY0A 1EIYB 1VQ6A 4IFDG 3TREA 2JA5H 3WWVA 2KCTA 4YCWA 4DV0Q 3ULPA 3I7FA 2R93G 2VUMH 1NY4A 2VZAA 4A3GH 1I94Q 2NN6I 1KHIA 2ZJQA 3S2DH 4XTCS 1EYGA 1LM0A 2R92H 1PYBA 4DV6Q 3T1HL 1WFQA 4HJ9A 3W1GA 4KLKA 5HY6A 4JI8Q 4A3DH 1VQ5A 4R1JA 1VQIA 2RF4A 2PQAA 1KRTA 1JB7A 1IBML 5BR8Q 4K0KQ 4OO1I 1N33Q 4GNXC 4JI0Q 1M1KC 2VQEL 1QZHA 2YYZA 1PH1A 2C35B 4GN5A 1KL9A 4B3TL 4A3KH 2YTVA 2K52A 2UUBL 3PV0A 2GN5A 4LUOA 4QIWE 2LXKA 5IP9H 3CCVA 1EUJA 4LF6Q 1YJNA 2IHEA 2NVTH 2OQ0A 3K7UC 4R4QA 2UUCL 3F2CA 3CCLA 4LFAL 3J81c 4OONA 3A0JA 1A62A 2D0PA 4R4TA 4DUZQ 3UDXA 5JEAG 1NE3A 4DR7Q 1K0RA 3GTGH 4C3JH 2HHHL 4NXNQ 1VQOA 4KHPQ 2Q2UA 4ME3A 5IYBG 1PH3A 3S15H 2N8NA 5AJ3L 4IOCA 3HOZG 4IJLA 2UU9Q 4BBSH 3RLFA 3J81i 1PYSB 2LSSA 1JMCA 2A8VA 3H3VH 5M5WH 2YV5A 4DK3C 2RCNA 3EIVA 3K0XA 4B3ML 1G51A 3M4PA 1O7IA 5C4JH 3RN2A 1FJGQ 3D31A 4R4OA 4NXML 4LF7L 4JI2L 2EQSA 5C4XG 1CUKA 4ALPA 4GOPB 4HJ8A 1L2FA 2XGTA 1AE3A 1D7QA 1XNRQ 1YJWA 5IP7H 2WB1E 2BA1A 4QL5A 1CKOA 2ASBA 4X64L 1U5KA 3PUXA 1HNXQ 1VQ9A 3CPWA 1NMFA 1WI5A 4TQUS 3S1QH 4A3BH 2E5LL 2JA9A 5IYCH 3HOYG 1I6HH 2KENA 1C7YA 4A3JH 1YIJA 1E24A 2NN6G 5ELOA 1TWFH 4LFCQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M C;  2A1A A;  3K8A A;  4DV7 L;  1K3R A;  4GLX A;  4IFD I;  1C0A A;  1R9T H;  1E3P A;  2ATW A;  4OO1 G;  1CKN B;  3J7Z C;  4P74 A;  3BJU A;  1B7Y B;  2CWA A;  1VS0 A;  2YU9 H;  1TXY A;  2NZH A;  1QVF A;  1RIP A;  1BBW A;  2RHS B;  3EN2 A;  4X62 L;  2IX0 A;  2I5H A;  5IP9 G;  3A5U A;  1TWG H;  1YNX A;  1XMO L;  4PZ8 A;  3I56 A;  3PUW A;  4GKK L;  2PMZ E;  1SFO H;  3AYH B;  3ICE A;  1VQH A;  1YVC A;  4JV5 L;  4DR3 L;  1JJC B;  4GOP C;  3OYY A;  1EOV A;  5GRO A;  1G6P A;  3PUV A;  2JK8 A;  1IZ6 A;  4XIG S;  5IT9 c;  5GAD C;  2JA8 G;  1PH7 A;  5IWA L;  2WAQ E;  3K7A H;  5JJL A;  3M85 A;  1OTC A;  2WB1 G;  3G6E A;  2PI2 E;  2VQE Q;  4DV4 L;  3AFQ A;  2R7D A;  2VQF L;  1IBK L;  4B3S Q;  4B3T Q;  2BH2 A;  4GNX B;  4GOP A;  3KOJ A;  1J6Q A;  4O0A A;  1S3O A;  1VQK A;  4MZ9 A;  4C2M H;  5M3M G;  4DKA C;  1FVI A;  4UP8 A;  5IYB H;  4IFD J;  4R4I A;  1HZA A;  3CP0 A;  2VW9 A;  3KF6 B;  3CC4 A;  2FXQ A;  3HOZ H;  4LFA Q;  3CW2 C;  1QVG A;  4UPA A;  1WYD A;  3PO3 G;  4A3I G;  1L0W A;  4JYA L;  2V1C C;  1X3G A;  3KYH C;  5M3F G;  3OW2 A;  4JOI C;  2HHH Q;  1X55 A;  2R7Z H;  4A3B G;  4DAM A;  2ZTC A;  3H0G H;  1EWI A;  4A3J G;  2MFI A;  1E1O A;  5C4X H;  5AJ3 Q;  1NJI C;  1K73 C;  1I3Q H;  4DV1 L;  4BY1 G;  4WJ4 A;  3CC7 A;  4LF8 L;  4L5Q A;  4O2D A;  1CKN A;  1GO3 E;  2NVQ H;  2IY5 B;  1H95 A;  1N34 Q;  1VQG A;  1Q12 A;  4DV5 L;  1XTD A;  3AEV A;  2UUA L;  3MEF A;  4BBR G;  4JI5 Q;  2F4V L;  2YTY A;  4RG1 A;  3GTM H;  3HOY H;  1NMG A;  4JCV E;  3CCM A;  1OXV A;  3HOX G;  3BU2 A;  2BA0 A;  1GVP A;  3MXN B;  1IYJ B;  3M9B A;  1VQL A;  4DR4 L;  2NVY H;  4X64 Q;  2WAQ G;  3F2D A;  1PH8 A;  2EXD A;  3U4Z A;  4DV2 L;  4OX9 L;  5JEA J;  2IHF A;  1E7Z A;  4LF9 L;  3S2H H;  3NEN A;  1JJG A;  1VQB A;  1QUQ B;  5DLQ E;  5C0X I;  1N8R C;  4P72 A;  1K8A C;  2OCE A;  2ZM6 L;  2CCZ A;  1J5E L;  1MJE A;  5C3E G;  4DAY B;  4PZ6 A;  1HH2 P;  2UXD L;  1PVO A;  2ZTE A;  1XJV A;  3RNU A;  1KRS A;  4A4I A;  1JJ2 A;  4DV7 Q;  1KXL A;  2AHO B;  3HOU G;  1EFW A;  1KAW A;  4NB3 A;  3I55 A;  1PV4 A;  2I5M X;  4GS3 A;  1HNW L;  4JG2 A;  3TS2 A;  3AQQ A;  4IOA A;  4GNX A;  1Q86 C;  4DV3 Q;  1KIX A;  4PG3 A;  2Q2T A;  2UXB L;  4IPD A;  4JI1 L;  3KJO A;  2CFM A;  1XNQ L;  1UWV A;  4X62 Q;  2AMC B;  3UDI A;  1UE6 A;  2UXC L;  1SR3 A;  1Q1E A;  2VL6 A;  3GD7 A;  4X65 L;  3PF5 A;  1N9W A;  1SN8 A;  2RHQ B;  1XMO Q;  3FKI G;  3A74 A;  2JA8 H;  3M7N A;  4WJ3 M;  2D0O A;  1VQF A;  1V1Q A;  1YJ9 A;  1PA6 A;  2KBN A;  4GKK Q;  4DR1 L;  1QVC A;  3JC6 6;  3FHW A;  4EQ5 A;  3L2P A;  3ERS X;  3G4S A;  3GTP H;  4DR6 L;  1SE8 A;  1HNZ L;  3UE1 A;  4HIM A;  4JV5 Q;  2R7Z G;  3STB C;  4X66 Q;  3F2B A;  2R7F A;  3H0G G;  1V9P A;  4A75 A;  4UP9 A;  2JA7 G;  2K5N A;  5M3M H;  5IWA Q;  1X65 A;  3EBE A;  1X54 A;  2YTX A;  4QQB X;  2VQF Q;  2PNH A;  1IBK Q;  3PO3 H;  3PGZ A;  4A3I H;  4JI6 L;  1A8V A;  1VQD A;  5M3F H;  1XPR A;  1I50 H;  4JI4 L;  1L1O C;  4A93 G;  3K80 C;  1PH2 A;  5GAH C;  3ZJY C;  2IT1 A;  4BY7 G;  2QEX A;  3UDF A;  4BY1 H;  3FP9 A;  5LMU L;  4MTN A;  1EQR A;  3KFU A;  2K14 A;  3RR5 A;  1DGS A;  1V43 A;  5C44 G;  4BA2 I;  3CC2 A;  1Q46 A;  3A5Z B;  4GN3 B;  1Y1V G;  4NPS A;  4DUY L;  4DV0 L;  3ULL A;  4A3C G;  3CAM A;  1I94 L;  4BBR H;  5C0X G;  5FLX c;  1JT8 A;  2B29 A;  4DV6 L;  4A76 A;  4DV1 Q;  3T1Y L;  3S16 H;  1PH9 A;  2AWO A;  3HOX H;  1HZ9 A;  2CKZ B;  4DNI A;  5IYD G;  1TWH H;  4YY3 Q;  2E2I H;  2DUD A;  4AQY L;  3RLO A;  5BR8 L;  1YHQ A;  1N33 L;  2Q2I A;  3IRB A;  2HQL A;  4KI0 A;  2H5X A;  1VQJ A;  3DM3 A;  1SMX A;  1TWA H;  4IPC A;  3CF5 A;  3F8T A;  1S72 A;  5C3E H;  4DR2 L;  3UDG A;  3T1H Q;  3RZD H;  4LF4 L;  4DR4 Q;  4DV2 Q;  4OX9 Q;  1B70 B;  2JE6 I;  4LF9 Q;  2JEA I;  4JC0 A;  1IBM Q;  3U50 C;  1T9H A;  2JA6 G;  4DUZ L;  1N32 L;  2VNU D;  2K50 A;  4NXN L;  2A19 A;  3D0F A;  3U4V A;  3GTL H;  3B6Y A;  4R4C A;  1J5E Q;  2UXD Q;  5K36 G;  4JI3 L;  2MQH A;  2UUB Q;  2EIF A;  3UE0 A;  5JJK A;  3FKI H;  4QY7 A;  4RMF A;  3CCQ A;  3OTO L;  2PQA B;  4BXX G;  1HNW Q;  1MIU A;  2UUC Q;  3ULJ A;  3HFZ B;  1IL2 A;  4JBW A;  1Z9F A;  2UXB Q;  1X56 A;  2KHJ A;  1HR0 L;  4JI1 Q;  1XNQ Q;  5HGQ A;  3JAM c;  1PHJ A;  2I5L X;  3KLW A;  4JI2 Q;  1PH4 A;  3S14 H;  4X65 Q;  1UE7 A;  4OXP A;  1Y1W G;  1A0I A;  4BA1 I;  1U0L A;  4YCU A;  3L7Z C;  2ES2 A;  1ASY A;  1D8L A;  1KQS A;  1GM5 A;  2N3S A;  4JBM A;  3I4M H;  3PO2 G;  1Q8K A;  1SRU A;  1RL2 A;  2AKW B;  3S1N H;  1HNX L;  5FLM G;  4DR6 Q;  5M5Y H;  1HNZ Q;  4B3M Q;  4OWX B;  1LUZ A;  2MO1 A;  2MNA A;  4QJF A;  4JOI A;  4YWK A;  3TEH B;  5GAG C;  4A3L G;  3CMA A;  4A3M H;  4NXM Q;  3PUY A;  2B63 G;  3PF4 A;  1E22 A;  4LF7 Q;  3S1M H;  4A93 H;  4C3I H;  4HIO A;  3CCE A;  4BY7 H;  2K75 A;  4C3H H;  1VQM A;  4GKJ L;  2ZJR A;  1XPU A;  3KJP A;  5C44 H;  4LNQ A;  1SLJ A;  2Y0S E;  1JE5 A;  5GAE C;  4JI6 Q;  4HIK A;  2E8G A;  1Y1V H;  2F3I A;  5E7N A;  4JI4 Q;  3CXC A;  4A3C H;  4LUZ A;  2E5L Q;  4L5T A;  3G71 A;  3CME A;  3CCS A;  2JEB I;  2DGY A;  2QGQ A;  2OQK A;  3RN5 A;  1WCM G;  5LMU Q;  4YCV A;  1L1O B;  5IYD H;  1SRO A;  3I4N G;  1X6O A;  2Z0S A;  4LW1 A;  3U58 A;  4LF5 L;  4DUY Q;  1N36 L;  3GTJ H;  1VQN A;  4GLA C;  2K5V A;  2N49 A;  2IX1 A;  1GD7 A;  4AYB E;  3ER0 A;  1CKM A;  1XMQ L;  4GLV B;  4P73 A;  1MKH A;  3HKZ E;  1EIF A;  3CCU A;  3T1Y Q;  3S24 A;  2HIV A;  4HJ5 A;  4AQY Q;  1NTG A;  3KF6 A;  1Q82 C;  5LMN L;  4DPG A;  3PIO A;  3CCR A;  1K83 H;  3KDF B;  4HJ7 A;  4H02 A;  4PZ7 A;  2OTL A;  4IPH A;  4AH6 A;  3M4O H;  3E9H A;  2HIX A;  1TWC H;  1C9O A;  1VQC A;  4YHH L;  3J81 j;  3W1B A;  5M5X H;  4DR5 L;  1YI2 A;  1KC8 C;  2OWO A;  4B3S L;  2JA6 H;  1HR0 W;  3G48 A;  2B3G A;  3H15 A;  3GTQ H;  4QGU A;  1HJP A;  4DR3 Q;  1IBL L;  4DR2 Q;  4HJA A;  4LF4 Q;  1YIT A;  5H1S E;  2L15 A;  3L0O A;  4Y52 H;  1X3F A;  3E0E A;  4A3F G;  4JI7 L;  1BBU A;  1HZC A;  3I4M G;  4LFB L;  3HOV G;  4BXX H;  4APV A;  1N32 Q;  1PFS A;  1X3E A;  4YWM A;  2Y0S G;  3DLL A;  1OXS C;  4DV4 Q;  2KHI A;  1LTL A;  5C0X J;  3NEM A;  4FDB A;  5GQO A;  4JI3 Q;  1YEZ A;  2K5H A;  3CQZ H;  1UE1 A;  1IXR A;  2AWN A;  4A3M G;  1ASZ A;  3E9I A;  2LXJ A;  4B3R L;  3HOU H;  1Y1W H;  1B8A A;  2F52 A;  2BH8 A;  2NZO A;  3F1Z A;  3OTO Q;  3H3V I;  3CPF A;  3PO2 H;  4POG A;  1E1T A;  1AH9 A;  1NBW A;  3STB D;  1N34 L;  5FLM H;  3GDE A;  1QUQ A;  2XTI A;  1HR0 Q;  4JYA Q;  1A63 A;  4JI5 L;  4AYB G;  4A3L H;  4A3E H;  2B63 H;  2ZTD A;  1L1O A;  3HKZ G;  1CSP A;  5FJ8 G;  3J80 c;  3PSI A;  3RLN A;  3HOW G;  1UE5 A;  2CWP A;  3TS0 A;  4JI8 L;  2JA7 H;  4AIM A;  4LF8 Q;  2JA5 G;  2Z6K C;  4UP7 A;  3J7A 5;  4IPG A;  2NVX H;  4K0K L;  2WP8 J;  4JI0 L;  4P75 A;  4TVA B;  1VQ4 A;  4DV5 Q;  2VUM G;  2D62 A;  1AE2 A;  1OXU A;  4MNO A;  2UUA Q;  1CSQ A;  4A3G G;  3PCO B;  3TQY A;  3TRZ A;  2F4V Q;  2R92 G;  3J80 i;  2R6G A;  3W5O A;  3SGI A;  1W3S A;  1X9N A;  1K8G A;  1BVS A;  2N78 A;  1VQA A;  4A3D G;  3KDF A;  1I5F A;  1WCM H;  5IE8 A;  4GKJ Q;  4DK6 C;  5LMN W;  4LF6 L;  3I4N H;  3Q8D A;  1YBY A;  2ZJP A;  1W2B A;  2Z6K A;  3M3Y H;  4J15 A;  1OXX K;  2GVB A;  4JBJ A;  4LWC A;  1Q81 C;  1VQ8 A;  2HT1 A;  4DV3 L;  4JBK A;  2R93 H;  2ID0 A;  1HZB A;  1GKH A;  4UY8 C;  1Q1B A;  4A3K G;  4DR7 L;  1FL0 A;  3NBH B;  2ZM6 Q;  4KHP L;  2JJQ A;  3CCJ A;  3GTO H;  3M4Q A;  3LGJ A;  3PUZ A;  1PH6 A;  2VS1 A;  3PIP A;  1VQP A;  4LF5 Q;  2UU9 L;  2VY3 A;  3BZK A;  1N36 Q;  3NEL A;  1M90 C;  2I0Q A;  2JQO A;  4LUV A;  1VQE A;  3S1R H;  1XMQ Q;  1P8L A;  2K4K A;  4X66 L;  1WJJ A;  5J3B A;  1FJG L;  1YHB A;  4KHZ A;  1P16 A;  1EQQ A;  2UXC Q;  4Y7N H;  5LMN Q;  4BBS G;  4EX5 A;  4A3F H;  2WFW A;  3I4O A;  1Y14 B;  2PI2 A;  4YWL A;  2E2J H;  1XNR L;  4YHH Q;  4DR5 Q;  2KCM A;  3HOV H;  3BZC A;  2GVA A;  1MJC A;  4DR1 Q;  2CQO A;  1PH5 A;  1YHA A;  2MO0 A;  1YZ6 A;  5ELN A;  5JJI A;  3AFP A;  3JAM i;  4P71 A;  3VDY A;  1XPO A;  1IBL Q;  3CD6 A;  4POF A;  1VQ7 A;  4A3E G;  3S17 H;  3KF8 B;  1LYL A;  3I2Z A;  4JI7 Q;  1VCI A;  4LFC L;  5IP7 G;  4LFB Q;  1Z47 A;  1FGU A;  1UEB A;  2Q2H A;  4L5S A;  1OXT A;  5EAY A;  2QA4 A;  2ALY B;  4HID A;  2E2H H;  1QZG A;  3RZO H;  5IYC G;  3HKS A;  4GN4 B;  4X6A H;  1BKB A;  1Q7Y C;  2OTJ A;  4PMW A;  3GTK H;  4L5R C;  4B3R Q;  1S40 A;  1KD1 C;  4OWT B;  4IO9 A;  1G29 1;  5FJ8 H;  4YY3 L;  4OWW B;  4IJH A;  3HOW H;  3K81 C;  3GO5 A;  1WOC A;  5IY0 A;  1EIY B;  1VQ6 A;  4IFD G;  3TRE A;  2JA5 H;  3WWV A;  2KCT A;  4YCW A;  4DV0 Q;  3ULP A;  3I7F A;  2R93 G;  2VUM H;  1NY4 A;  2VZA A;  4A3G H;  1I94 Q;  2NN6 I;  1KHI A;  2ZJQ A;  3S2D H;  4XTC S;  1EYG A;  1LM0 A;  2R92 H;  1PYB A;  4DV6 Q;  3T1H L;  1WFQ A;  4HJ9 A;  3W1G A;  4KLK A;  5HY6 A;  4JI8 Q;  4A3D H;  1VQ5 A;  4R1J A;  1VQI A;  2RF4 A;  2PQA A;  1KRT A;  1JB7 A;  1IBM L;  5BR8 Q;  4K0K Q;  4OO1 I;  1N33 Q;  4GNX C;  4JI0 Q;  1M1K C;  2VQE L;  1QZH A;  2YYZ A;  1PH1 A;  2C35 B;  4GN5 A;  1KL9 A;  4B3T L;  4A3K H;  2YTV A;  2K52 A;  2UUB L;  3PV0 A;  2GN5 A;  4LUO A;  4QIW E;  2LXK A;  5IP9 H;  3CCV A;  1EUJ A;  4LF6 Q;  1YJN A;  2IHE A;  2NVT H;  2OQ0 A;  3K7U C;  4R4Q A;  2UUC L;  3F2C A;  3CCL A;  4LFA L;  3J81 c;  4OON A;  3A0J A;  1A62 A;  2D0P A;  4R4T A;  4DUZ Q;  3UDX A;  5JEA G;  1NE3 A;  4DR7 Q;  1K0R A;  3GTG H;  4C3J H;  2HHH L;  4NXN Q;  1VQO A;  4KHP Q;  2Q2U A;  4ME3 A;  5IYB G;  1PH3 A;  3S15 H;  2N8N A;  5AJ3 L;  4IOC A;  3HOZ G;  4IJL A;  2UU9 Q;  4BBS H;  3RLF A;  3J81 i;  1PYS B;  2LSS A;  1JMC A;  2A8V A;  3H3V H;  5M5W H;  2YV5 A;  4DK3 C;  2RCN A;  3EIV A;  3K0X A;  4B3M L;  1G51 A;  3M4P A;  1O7I A;  5C4J H;  3RN2 A;  1FJG Q;  3D31 A;  4R4O A;  4NXM L;  4LF7 L;  4JI2 L;  2EQS A;  5C4X G;  1CUK A;  4ALP A;  4GOP B;  4HJ8 A;  1L2F A;  2XGT A;  1AE3 A;  1D7Q A;  1XNR Q;  1YJW A;  5IP7 H;  2WB1 E;  2BA1 A;  4QL5 A;  1CKO A;  2ASB A;  4X64 L;  1U5K A;  3PUX A;  1HNX Q;  1VQ9 A;  3CPW A;  1NMF A;  1WI5 A;  4TQU S;  3S1Q H;  4A3B H;  2E5L L;  2JA9 A;  5IYC H;  3HOY G;  1I6H H;  2KEN A;  1C7Y A;  4A3J H;  1YIJ A;  1E24 A;  2NN6 G;  5ELO A;  1TWF H;  4LFC Q; 
#chains in the Genus database with same CATH topology
 2EVB A;  2RDH A;  1JB3 A;  1R9T H;  1E3P A;  3DEO A;  2SEB D;  1CKN B;  2F0W A;  5ELC A;  1W6K A;  3TDQ A;  1B3A A;  2YU9 H;  2NZH A;  1HRJ A;  1O7Y A;  3EN2 A;  4Y7N B;  2DNC A;  2EYM A;  2B2T C;  2F0Q A;  3H94 A;  1I6V C;  3PUW A;  2L9H A;  2PMZ E;  3NTK A;  2EYH A;  2EJM A;  4JV5 L;  4KJO A;  2PW7 A;  3SDZ A;  4GOP C;  1EOV A;  1PTO D;  2B8F A;  3H91 A;  3PUV A;  2NYZ D;  4FF1 A;  5JJL A;  1IL8 A;  1RHP A;  3J7Y W;  2HCC A;  4DV4 L;  2N88 A;  1S5C D;  2R7D A;  3RZO B;  4CHT B;  4B3T Q;  4HN7 A;  3BG3 A;  4NP5 A;  4FYD A;  3MHB A;  4IFD J;  1SMY D;  3CC4 A;  4UPA A;  3BDC A;  4A3I G;  1L0W A;  1EY0 A;  2FJ2 A;  5M3F G;  3OW2 A;  1SE4 A;  2ZTC A;  1ENA A;  3Q24 A;  1ESF A;  5AJ3 Q;  1NJI C;  1D1K A;  1I3Q H;  2EJF C;  4BY1 G;  2J7Z A;  1GOZ A;  5BN4 A;  4OEM B;  1H95 A;  1Q12 A;  4ABN A;  1U4R A;  1LT6 D;  2QEJ C;  1STB A;  2YTY A;  4RG1 A;  3R2T A;  4A3K B;  3GTM H;  1BCP C;  1OXV A;  3HOX G;  2BA0 A;  1GVP A;  3M9B A;  4DR4 L;  3VA5 A;  3A8J E;  1PH8 A;  2KCC A;  1LT4 D;  4LF9 L;  4KN4 C;  1QUQ B;  5C0X I;  4C3J B;  1SSO A;  1CZG A;  1N8R C;  1K8A C;  2ZM6 L;  2CCZ A;  3VR6 A;  1TII D;  5IGB A;  1EFI D;  1PVO A;  2UXD L;  1HH2 P;  2HDL A;  1KXL A;  1KRS A;  3RD4 A;  1SEB D;  4BBS B;  1KAW A;  1PTO F;  3GQB A;  2I5M X;  3TS2 A;  3AQQ A;  1SDF A;  4GNX A;  3LWU A;  4F8M A;  4DV3 Q;  1Q86 C;  2UXB L;  3K6O A;  1UWV A;  2DJF C;  4KHV A;  1SR3 A;  2VL6 A;  1XMO Q;  4JI2 L;  4X65 L;  4WJ3 M;  2JA8 H;  5G3L D;  1VQF A;  2KBN A;  1QIL A;  4DR1 L;  3GTP H;  3L2P A;  2MJ8 A;  1DOM A;  1XXG A;  3ERS X;  1SE8 A;  2R7Z G;  4A3J B;  3DUZ A;  4PMC A;  3H0G G;  3NBI A;  3R8B A;  2K5N A;  3DM1 A;  5IWA Q;  1EY8 A;  1ILP A;  4N8F A;  1R9T B;  3K59 A;  2VQF Q;  3K5O A;  1IBK Q;  3PGZ A;  5J1Z A;  1A8V A;  1VQD A;  5CV6 A;  2YU9 B;  2HQE A;  2PZT A;  4RGM A;  3K80 C;  2F0P A;  2IT1 A;  3UDF A;  1PZJ D;  5LMU L;  5C44 G;  5FLX L;  2O4X A;  3OIP A;  4RCO A;  3ULL A;  1I94 L;  4BBR H;  2KHS A;  5FLX c;  2B29 A;  4DV6 L;  3T1Y L;  3BS1 A;  2AWO A;  1HZ9 A;  3C1E A;  2E2I H;  5BR8 L;  1YHQ A;  2O2L D;  4DFA A;  1F9Q A;  1PRT C;  4IPC A;  3CF5 A;  3MXP A;  3VA7 A;  1ESR A;  1FNW A;  1HTP A;  4DR2 L;  3T1H Q;  1FNU A;  1D5Z C;  2QF7 A;  4LK1 C;  4OX9 Q;  2B2T A;  1I4G A;  2JEA I;  4DUZ L;  5G3L F;  5AFW A;  4QMG A;  2VNU D;  2F0U A;  1HPC A;  1TKW B;  1J5E Q;  1SAP A;  3TN2 A;  4JI3 L;  2MQH A;  1NSN S;  1DXM A;  4N9T A;  5M9O A;  1I3Q B;  4QUF A;  1J9O A;  1F9P A;  1SYD A;  4N9P A;  4OHJ A;  1C4Q A;  4I7Z C;  2IL8 A;  3H6M A;  4OEL B;  4WJW A;  1SJE D;  1K3B C;  4JI1 Q;  3MA2 B;  4EGV A;  3DWP A;  2KOL A;  3MTS A;  3S14 H;  4YCU A;  4FF4 A;  1RL2 A;  5JAV A;  5FLM G;  2Z9H A;  5D3I B;  1LUZ A;  1DON A;  3OPO A;  5GAG C;  1AH9 A;  4A3L G;  4NXM Q;  3S1M H;  4A93 H;  2EYL A;  3CCE A;  2K75 A;  1JIC A;  5K5P A;  3EJI A;  1F77 A;  3KJP A;  3OOC A;  1SLJ A;  2Y0S E;  1TVX A;  4JI6 Q;  1I4R A;  4FO2 A;  5E7N A;  4A3C H;  3S9W A;  3GP7 A;  3G71 A;  5C0X H;  3CCS A;  1BR9 A;  2DGY A;  3NTH A;  4MN3 A;  2JA8 B;  4LMQ D;  4YCV A;  4Q5V A;  1X6O A;  2K6A A;  4RHR A;  1VQN A;  3GTP B;  3NTI A;  2HCI A;  4HAE A;  3ER0 A;  4GLV B;  2CW0 C;  5HGT A;  4DGZ A;  3CCU A;  1ONL A;  4AQY Q;  4HSP A;  1Q82 C;  4DPG A;  3PIO A;  2OTL A;  5E4W C;  4PZ7 A;  3M4O H;  3E9H A;  3CRK C;  1EY9 A;  5I6W A;  4DR5 L;  5M5X H;  1YI2 A;  4ZLT F;  2K7V A;  1IYU A;  4DR3 Q;  4HJA A;  3BZD B;  4RGT A;  1YIT A;  2L15 A;  4OL7 A;  1X3F A;  4A3F G;  4JI7 L;  3ONA B;  1HZC A;  4BXX H;  4XXE A;  1CFM A;  4X3U A;  1H9R A;  2QCP X;  1JOK A;  4BBR B;  2SNM A;  2A73 B;  2EPB A;  4XQQ A;  3E9I A;  2LXJ A;  2E2I B;  2K04 A;  3CU7 A;  3F1Z A;  3H3V I;  3CPF A;  1E1T A;  3GDE A;  2R3Z A;  1HR0 Q;  4ZUI A;  4AYB G;  4HTH A;  3D6C A;  3HKZ G;  3DWQ A;  4CGY B;  5EGT A;  4ZAI A;  3RLN A;  4JI8 L;  2EYP A;  5HUR A;  1ENC A;  4IPG A;  2NVX H;  2WP8 J;  1HFN A;  4TVA B;  1GUS A;  1UUP A;  2VUM G;  1OXU A;  2UUA Q;  4A3G G;  3TQY A;  1NR2 A;  1VF7 A;  2RQX A;  1DJR D;  4RWS C;  2N78 A;  3IKJ A;  3KDF A;  4CDD C;  1I5F A;  2SDF A;  5IE8 A;  4GKJ Q;  4DK6 C;  1B9N A;  1PTO C;  3Q8D A;  2Z6K A;  3BVZ A;  1Q81 C;  1VQ8 A;  3DEP A;  4JBK A;  4B08 A;  2H1E A;  1WTR A;  4EQO A;  4EVO A;  2Q8I B;  5KYL A;  3S14 B;  3CCJ A;  5C4H A;  3HG9 A;  3PUZ A;  3J81 E;  2VS1 A;  1VQP A;  2VY3 A;  1N36 Q;  2HDM A;  1NNX A;  2TMP A;  1SMY C;  3S1R H;  2EY2 A;  2A6E C;  5KNC A;  3P20 A;  3S1M B;  4A93 B;  2LKV A;  4KHZ A;  1WTX A;  1FD7 D;  3WDN A;  5LMN Q;  4RH6 A;  3QOJ A;  1BUV T;  1JWM D;  1MBY A;  1H9K A;  3BZC A;  4O1N A;  3JAM i;  1LTT D;  1XPO A;  1IBL Q;  1AFP A;  1VQ7 A;  4ZKB B;  3S17 H;  3I2Z A;  4CDE C;  1SNO A;  2WIN B;  1Z47 A;  1S5B D;  4HCE A;  4XYQ A;  4L5S A;  1OXT A;  2QA4 A;  2ALY B;  1HCZ A;  1TU2 B;  5NUC A;  2E2H H;  1QZG A;  1BXT A;  4GN4 B;  1L0Y B;  1ICW A;  2E75 C;  1O7Z A;  5IGE A;  1KD1 C;  4OWT B;  2XWJ B;  5DM7 3;  1G29 1;  4OWW B;  5JPM C;  4IJH A;  4R8I A;  2JYO A;  4LJZ C;  2F3W A;  3TRE A;  2K05 A;  3M4O B;  2F0H A;  2KCT A;  2KJX A;  2RDF A;  5M5X B;  1B1Z A;  3NBH A;  2BE5 D;  1NY4 A;  2VZA A;  5CBE E;  2NN6 I;  3S2D H;  1EYG A;  1PYB A;  2B2W A;  4A3D H;  1VQ5 A;  4PNY A;  5ELB A;  1KAA A;  1KRT A;  4K0K Q;  3NK9 A;  1M1K C;  1LTR D;  4WRD A;  3A56 A;  2VQE L;  3VR5 A;  2C35 B;  5IT9 E;  4GN5 A;  5I6Y A;  2FHT A;  1EUJ A;  5LL6 S;  2IHE A;  1I4Q A;  2NVT H;  1LO5 D;  4R4T A;  5JEA G;  1V1P A;  1ICF B;  4EQN A;  1K0R A;  4KHP Q;  2JN4 A;  4H0L C;  1I4P A;  3TZU A;  3S15 H;  2VB3 X;  4IOC A;  3HOZ G;  1E0B A;  4DF7 A;  1ZYR D;  3C1F A;  1PYS B;  4XYO A;  3H3V H;  3MC0 B;  1II3 A;  2YV5 A;  2NVX B;  4B3M L;  3EIV A;  2G9H D;  3NQI A;  5C4J H;  5KGU A;  2QW7 A;  3NE5 B;  4H7B A;  4LF7 L;  2IX3 A;  5IGD A;  1G91 A;  2XGT A;  2MHV A;  2WB1 E;  3MXU A;  2CHB D;  1CKO A;  4X64 L;  1VQ9 A;  4Q0F A;  5IYC H;  1C7Y A;  1YIJ A;  1STH A;  1TWF H;  4G57 A;  2JP1 A;  1BCP F;  4KK7 A;  2X6G A;  3K8A A;  2MGS A;  4DU9 A;  1SFO B;  4OO1 G;  2B2U C;  4MTK A;  3S1R B;  3T51 B;  1Y8O B;  1XYI A;  1VS0 A;  4FNF A;  1RIP A;  1BBW A;  3DHQ A;  2RHS B;  4TKO B;  2I5H A;  1WTW A;  5JJZ A;  1IKM A;  2K01 A;  3I56 A;  4GKK L;  1TS2 A;  2KEE A;  1PYW D;  3AYH B;  2Y0S B;  1YVC A;  1Q8I A;  2FMC A;  5GRO A;  1G6P A;  2L5T A;  4XIG S;  1IZ6 A;  3NSW A;  1PH7 A;  5T1G A;  2WAQ E;  3M85 A;  3QR8 A;  3G6E A;  2PI2 E;  1HXY D;  2EYJ A;  2I46 A;  3AFQ A;  2E2H B;  2AQ1 B;  2BH2 A;  5C4X B;  1J6Q A;  4UP8 A;  4R4I A;  1HZA A;  1JQY D;  4DK1 A;  3KF6 B;  2VW9 A;  3I8Z A;  3N6R A;  1WYD A;  4JYA L;  2V1C C;  2R7Z H;  1X55 A;  4DAM A;  2MPM A;  3S2D B;  3H0G H;  3Q6S A;  1E1O A;  4DV1 L;  4A3D B;  4LF8 L;  3T4A C;  1CKN A;  1GO3 E;  3FDT A;  1N34 Q;  1VQG A;  3AEV A;  2BCO A;  2EY5 A;  3HOY H;  4RHS A;  1NMG A;  2NUC A;  5DAU A;  3T13 A;  5C3W A;  2KEC A;  3MXN B;  4UHV A;  1VMC A;  2AQ2 B;  1VQL A;  2NVY H;  1SNC A;  3F2D A;  2NVT B;  2RKS A;  4DV2 L;  5JEA J;  4H13 C;  3TSS A;  3N52 A;  3ITP A;  5C3E G;  4DAY B;  3HP3 A;  1EYA A;  1PRT F;  5CYU A;  1JJ2 A;  3S15 B;  2AHO B;  1EFW A;  1EYC A;  4NB3 A;  4GS3 A;  4J8Q A;  2A5H A;  4IOA A;  1KIX A;  1GXD C;  5C4J B;  2Q2T A;  4IPD A;  2CFM A;  2M2L A;  4CKE A;  3UDI A;  1Q1E A;  2Z6B A;  1N9W A;  1SN8 A;  2F03 A;  3A74 A;  1PA6 A;  3TZD A;  3JC6 6;  3FHW A;  1I50 B;  3JAM E;  4DR6 L;  4JV5 Q;  3TP7 A;  3I4L A;  4X66 Q;  1V9P A;  1TWF B;  3I70 A;  4A75 A;  5KRU A;  5M3M H;  3MVV A;  1H9S B;  4OIJ A;  2YTX A;  3PO3 H;  5E4X A;  1F9R A;  2XVS A;  1LTS D;  3X3M A;  4JI4 L;  2F0M A;  1PH2 A;  5GAH C;  4G7Z C;  3ZJY C;  3SK8 A;  4BY7 G;  4ODG A;  2SNS A;  1Q3L A;  4MTN A;  2K14 A;  1V43 A;  3K0Y A;  3FMC A;  4DV0 L;  2KUM A;  4GN3 B;  1Y1V G;  4F88 A;  1IHZ A;  2K03 A;  1W6J A;  4A76 A;  1PH9 A;  2CKZ B;  5IYD G;  1N33 L;  1EY7 A;  1G2T A;  1K28 A;  1VQJ A;  3DM3 A;  2B2U A;  3BYY B;  1SYG A;  1SMX A;  2DNE A;  1EIG A;  1S72 A;  3UDG A;  4LF4 L;  4DR4 Q;  1O78 A;  1V8Q A;  1QB5 D;  1B70 B;  4LF9 Q;  3A8I E;  4IZ8 A;  4JC0 A;  3ZYY X;  1N32 L;  2R7Z B;  2K50 A;  1F2Z A;  4NXN L;  1K8M A;  3U4V A;  3GTL H;  1X3P A;  2F0K A;  3H0G B;  2UXD Q;  3AMU A;  3FKI H;  1MIU A;  2UUC Q;  4JBW A;  2UXB Q;  2KHJ A;  5KNB A;  2EDG A;  5A2Q L;  2Q8R E;  3HOY B;  4RCN A;  4JI2 Q;  4IAL A;  4X65 Q;  1UE7 A;  1Y1W G;  4BA1 I;  2JA7 H;  4QQB X;  1GM5 A;  2NVY B;  3S1N H;  1HNX L;  4OGQ C;  5DM6 3;  5J39 A;  3E5S A;  2MO1 A;  1X3Q A;  4YWK A;  3J80 E;  3PF4 A;  2BE5 C;  5EPJ A;  4C3I H;  5A35 A;  4KKS A;  4C3H H;  1WTH A;  4XDX A;  1BBX C;  1H9M A;  3CXC A;  1Y8P B;  4L5T A;  2PO4 A;  1STN A;  2QGQ A;  1K8O A;  3X3N A;  3RN5 A;  5LMU Q;  5I4D A;  1K83 B;  4KY5 A;  3I4N G;  1AEX A;  3HGB A;  4LF5 L;  2WB1 B;  3GTJ H;  3MFY A;  4HSV A;  1GD7 A;  1XMQ L;  1A3V A;  4DNR B;  2GA4 B;  2HUG A;  1MKH A;  3T1Y Q;  3S24 A;  2D2C C;  5M3M B;  3IFT A;  2KQ3 A;  3CCR A;  3D6W A;  1YNN D;  4IPH A;  1EWC A;  2XRS D;  3KLS X;  2HIX A;  4YHH L;  3PO3 B;  2JA6 H;  2NWG A;  1ZYR C;  2B3G A;  3GTQ H;  4DR2 Q;  3R2I A;  5K36 H;  5H1S E;  3L0O A;  4Y52 H;  3E0E A;  1D5X C;  3PIP 3;  3I4M G;  4LFB L;  1KLU D;  3MAQ A;  2K5D A;  2LMC B;  3HZX A;  5COR A;  1X3E A;  4MIU A;  2KHI A;  1LTL A;  4CDC C;  1SNM A;  4HMI A;  5C3X A;  4FDB A;  4JI3 Q;  1YEZ A;  4HR7 B;  1MHW C;  4A3M G;  1ASZ A;  1NR4 A;  4B3R L;  3HOU H;  1JOQ A;  1U4M A;  3MXG A;  2F52 A;  4IUR A;  1GUG A;  2BH8 A;  2NZO A;  3E0J A;  3PO2 H;  2WAQ B;  1HA6 A;  1RDP D;  1EQT A;  3STB D;  2XTI A;  2B2V A;  5BN3 A;  2B63 H;  2ZTD A;  1UE5 A;  2CWP A;  3TS0 A;  2BOS A;  2Z6K C;  1EOT A;  4DV5 Q;  2D62 A;  3GTL B;  3PCO B;  5C4Z A;  2F4V Q;  1F2L A;  2R6G A;  3W5O A;  1W3S A;  1X9N A;  2K5Q A;  3WOF A;  1VQA A;  1CQF A;  5KIX A;  1WCM H;  1XX8 A;  2F0O A;  3FKI B;  1PXU A;  4LF6 L;  1W2B A;  2ZJP A;  4J15 A;  2EYO A;  2R61 A;  4LWC A;  1EZ8 A;  1TY2 A;  4DV3 L;  1HZB A;  1Q1B A;  4DA2 A;  4A3K G;  2OXP A;  1QCB D;  1RKN A;  2JA7 B;  2OF1 A;  3M4Q A;  1BQQ T;  3TP5 A;  3S1N B;  3QJY A;  1PFM A;  2ZXP A;  4QUC A;  1VQE A;  1LTB D;  1QG7 A;  1U4P A;  5C5M A;  1P8L A;  2L1B A;  5J3B A;  3NWS A;  1P16 A;  4C3I B;  1EQQ A;  2UXC Q;  4IUV A;  3EA6 A;  4C3H B;  4BBS G;  2E2J H;  3FVQ A;  4DR5 Q;  3HOV H;  3BYT B;  5JEA H;  2CQO A;  1YHA A;  2MO0 A;  1YZ6 A;  5JJI A;  3AFP A;  1QNU A;  4P71 A;  4KKT A;  3H09 A;  4POF A;  5D14 A;  4JI7 Q;  1VCI A;  2NZ1 D;  5IP7 G;  4C56 C;  1UEB A;  4S3S A;  3UI2 A;  5EAY A;  3GTJ B;  1JCK B;  1BKB A;  4QF4 A;  2OTJ A;  4L5R C;  4IO9 A;  1B2T A;  2B2W C;  1ILQ A;  5FJ8 H;  3HOW H;  1GHK A;  1G2S A;  1VQ6 A;  2JA5 H;  4M1U B;  3WWV A;  5LL6 X;  2JA6 B;  4YCW A;  4HCS A;  2KA7 A;  5LHY 1;  3ULP A;  2R93 G;  3GTQ B;  5COY A;  1KHI A;  5I2Y A;  2R92 H;  4IUT A;  3T1H L;  1EWH A;  4JI8 Q;  1OO9 B;  4R1J A;  2PQA A;  1JB7 A;  2Z4I A;  2NTS A;  1GUN A;  1PH1 A;  1GHJ A;  4X3K A;  1KL9 A;  5IGC A;  2P5Z X;  1SE2 A;  1EY6 A;  1QWY A;  4LUO A;  2GN5 A;  3HOU B;  3ERQ A;  4K6L A;  1YJN A;  3PO2 B;  1JOO A;  3BDL A;  1C48 A;  2OQ0 A;  2VB2 X;  3F2C A;  4LFA L;  2D0P A;  1JC7 A;  2HHH L;  1VQO A;  2PMZ B;  1B9M A;  2DY7 A;  2B63 B;  3DWA A;  1JMC A;  4FF2 A;  2RCN A;  1I6H B;  3K0X A;  1Z7T A;  4NXM L;  1CA5 A;  2EQS A;  2G9D A;  4GOP B;  4HJ8 A;  1WCM B;  1AE3 A;  5I2X A;  3NHH A;  2E2D C;  1D7Q A;  3SK5 A;  2ASB A;  1U5K A;  3PUX A;  5J22 A;  1HUM A;  2EYF A;  4RKB A;  4ZK9 B;  2KEN A;  4G7H C;  5ELO A;  3H3V C;  5CV9 A;  1K9M C;  3SE0 A;  3VYT A;  4DV7 L;  1QNK A;  1K3R A;  2LY7 A;  3GV6 A;  1RJT A;  4IFD H;  2ATW A;  1NUC A;  1UNS A;  4CDF C;  1IW7 D;  4K8I A;  4L6T B;  3BJU A;  2KVM A;  1B7Y B;  1TXY A;  2IPK D;  2XSC A;  2WII B;  4R8N A;  2TSS A;  3VYS A;  5KYI A;  1SXT A;  4X62 L;  3WOE A;  2XRQ D;  5ELF A;  1YNX A;  2E2J B;  1JWU D;  4PZ8 A;  3HOV B;  4DAV A;  1SFO H;  1LV9 A;  1VQH A;  3ICE A;  1KDA A;  1CT1 D;  4FXG C;  4DR3 L;  1SJH D;  3OYY A;  3I73 A;  2JK8 A;  3CRL C;  5CC4 A;  4FP5 D;  5GAD C;  2JA8 G;  2M9V A;  3OMC A;  1BCP B;  4HMJ A;  2L55 A;  4CJ1 B;  1OTC A;  1RCV D;  1BO0 A;  2F0S A;  2OEO A;  2VQE Q;  4B3S Q;  3KOJ A;  4O0A A;  1S3O A;  1VQK A;  4C2M H;  1IKL A;  3U9O A;  5IYB H;  2VXW A;  2XWB B;  1AZQ A;  3CP0 A;  3HOW B;  3DXJ C;  3IAY A;  2JA5 B;  1AP0 A;  3I72 A;  5EPL A;  3KYH C;  1JR0 D;  1KNA A;  4JOI C;  4A3B G;  3MEH A;  3C46 A;  4H44 C;  2R92 B;  1O7L A;  5C4X H;  4TSS A;  3T16 A;  4O2D A;  2NVQ H;  3OSO A;  1A2U A;  5FLX E;  2L4N A;  2UUA L;  4BBR G;  4JI5 Q;  1G8Z D;  4JCV E;  3CCM A;  3BU2 A;  4K14 A;  1IYJ B;  1F2Y A;  2JSO A;  4X64 Q;  3M4Y A;  3U4Z A;  4FVM A;  2IHF A;  1E7Z A;  1PFB A;  1SYF A;  1BDO A;  1D2B A;  1YNN C;  4P72 A;  2OCE A;  3FEW X;  2MUY A;  1DOL A;  2ZTE A;  3RNU A;  3W3A A;  4A4I A;  4FF3 A;  1HNW L;  3HS0 C;  1B50 A;  4PG3 A;  2RDG A;  4KTA A;  1XNQ L;  3AB9 A;  3KF8 A;  3PF5 A;  2RHQ B;  1WTQ A;  1B4O A;  1TS3 A;  1BNZ A;  2D0O A;  3V05 A;  1JWS D;  4GKK Q;  3IFD A;  1YNJ D;  4EQ5 A;  3MWY W;  1HNZ L;  3UE1 A;  4HIM A;  2F1M A;  3STB C;  1JE4 A;  4P2C B;  1PRT B;  1VMP A;  3OIQ A;  1X65 A;  2BDO A;  4NDX A;  4RGN A;  4A3I H;  5M3F H;  3MZ5 A;  1I50 H;  3SVM A;  1XPR A;  4A93 G;  1TWH B;  2OT2 A;  1TY0 A;  4ILW A;  5FOB B;  2QEX A;  4BY1 H;  3KFU A;  1EU3 A;  3MFG A;  4BA2 I;  3CC2 A;  4K5W A;  1PTO H;  4DUY L;  3TBI B;  4A3C G;  3CAM A;  5C0X G;  1JT8 A;  1LLR D;  4DV1 Q;  3ND9 A;  1LAB A;  5IGG A;  4XQJ A;  3HOX H;  1B3Q A;  4DNI A;  4YY3 Q;  4TRD A;  3RLO A;  1EY5 A;  3IRB A;  4R9W A;  4FXD A;  2H5X A;  1A6X A;  4NKL A;  1TWA H;  5FO7 B;  3F8T A;  4C2M B;  4QB4 A;  5JVG 3;  1FR3 A;  4DV2 Q;  3QWN A;  1IBM Q;  3U50 C;  1T9H A;  3R3O A;  1MSG A;  3D0F A;  2A19 A;  2QDL A;  2A68 D;  2E74 C;  2M00 A;  3B6Y A;  4R4C A;  1H9S A;  1PZK D;  2AUK A;  3C3L A;  2UUB Q;  4KV6 A;  3VYR A;  4QY7 A;  4RMF A;  1E2V A;  3CCQ A;  2NVQ B;  3OTO L;  4BXX G;  4RGO S;  2O5I C;  2K33 A;  1IL2 A;  1X56 A;  2F0T A;  1CTM A;  3KBX A;  2AUJ D;  2NBF A;  3KLW A;  4OXP A;  2F0L A;  1LAC A;  2DJG C;  3LWE A;  5EPK A;  2ES2 A;  3GTK H;  1ASY A;  2N3S A;  1I4X A;  3QIA A;  3I4M H;  1HA5 A;  3D4D A;  2AKW B;  5C5L A;  4DR6 Q;  5M5Y H;  4C1N I;  1FGB D;  1V1P B;  4QJF A;  4JOI A;  3TEH B;  3CMA A;  5F2D A;  4A3M H;  2EZV A;  4ZUJ A;  4HIO A;  3OW7 A;  4JK1 C;  3OHX C;  3CKI B;  5C44 H;  1JE5 A;  3BDO A;  2F0N A;  2F3I A;  3SR1 A;  5JVH 3;  4JI4 Q;  4LUZ A;  2E5L Q;  4ZRZ A;  3CME A;  1C8C A;  2JEB I;  5CV5 A;  1TR5 A;  2OQK A;  4ZQ3 A;  1L1O B;  4DK0 A;  1SRO A;  1E2Z A;  2Z0S A;  2RA4 A;  4GLA C;  2K5V A;  4PMB A;  3T56 B;  2IX1 A;  4AYB E;  1CKM A;  2X69 A;  3HKZ E;  1EIF A;  5FKA C;  5IGF A;  1T5E A;  4XT3 B;  2HIV A;  2F0E A;  3ND8 A;  4I65 A;  1SYC A;  1K83 H;  4HJ7 A;  2F0F A;  4H02 A;  4AH6 A;  4ZCK A;  1C9O A;  1VQC A;  3J81 j;  1RF2 D;  4A3I B;  1KC8 C;  5M3F B;  1HR0 W;  3H15 A;  3P75 A;  1HJP A;  4LF4 Q;  3KK7 A;  1D6E C;  2EJG C;  2JXM B;  5FO9 B;  4BY1 B;  2CH4 W;  3NUC A;  4J6H A;  3QB3 A;  5EJW A;  1BBU A;  1KDC A;  3NPP A;  1A3U A;  1N32 Q;  1PTO B;  4YWM A;  3DLL A;  4DV4 Q;  2Y0S G;  4KKU A;  5C0X J;  2B2V C;  3NEM A;  5ISR A;  5GQO A;  3SHL A;  2D5D A;  1SYE A;  3HOX B;  5CBA E;  3SK6 A;  4RKL A;  4UDU C;  4POG A;  2F4I A;  4RFB A;  5TSS A;  1N34 L;  5FLM H;  1G6Z A;  2IWH A;  1QUQ A;  3KLR A;  1A63 A;  4BWG B;  1TWA B;  2ZXR A;  4A3L H;  1IW7 C;  4ULL A;  1K0S A;  3VR3 A;  2K32 A;  1CSP A;  2H4O A;  4JW0 A;  1CI3 M;  3J7A 5;  2N55 A;  3E6Z X;  1GUW A;  4JI0 L;  1AE2 A;  1QOH A;  2RSO A;  4MNO A;  1B53 A;  1CSQ A;  1E2W A;  1EYD A;  2XIW A;  1K8G A;  3SGI A;  4A3D G;  2AQ3 B;  5C6A A;  2KCN A;  5LMN W;  1NAP A;  4ZKC B;  1YBY A;  3M3Y H;  2GVB A;  4JBJ A;  1LTI D;  3FPP A;  2HT1 A;  2R93 H;  1LT3 D;  5EBC A;  4UY8 C;  4DR7 L;  1FL0 A;  3O13 A;  4IQZ A;  2ZM6 Q;  2JJQ A;  3GTO H;  2A69 D;  2K28 A;  3GTK B;  1JOR A;  3I4M B;  1PH6 A;  3PIP A;  4LF5 Q;  2UU9 L;  1KNE A;  5BN5 A;  2JQO A;  5M5Y B;  1TT2 A;  3V96 A;  1M4V A;  1XMQ Q;  4X66 L;  5ELE A;  2K5W A;  4A3M B;  1FJG L;  4DXF A;  3K57 A;  4A3F H;  2WFW A;  2PI2 A;  4HED A;  1XNR L;  4YHH Q;  2KCM A;  4RA8 A;  5C44 B;  1PH5 A;  2B8G A;  1MJC A;  4DR1 Q;  5ELN A;  3NWT A;  4ME5 A;  2EOT A;  4K2K A;  4A3E G;  5CGK A;  2X6L A;  1LYL A;  1RTN A;  1TS4 A;  4LFC L;  1Y8N B;  4LFB Q;  2A6E D;  2RBM A;  2Q2H A;  2L0C A;  4HID A;  1EIH A;  5IYC G;  3RUZ A;  4X6A H;  1Q7Y C;  4PMW A;  4B3R Q;  1DD2 A;  2EE1 A;  3I3C A;  1EIY B;  5IY0 A;  1S5F D;  3I7F A;  2VUM H;  4A3G H;  1I94 Q;  1J8I A;  1PMR A;  2ZJQ A;  4KMU C;  1LM0 A;  4DV6 Q;  3IL8 A;  3A8K E;  1WFQ A;  4HJ9 A;  3W1G A;  1VQI A;  5CV4 A;  4IUN A;  2WKD A;  4OO1 I;  5BR8 Q;  1RTO A;  1LTA D;  1QZH A;  2F0V A;  1YNJ C;  4B3T L;  1STE A;  1WD1 A;  5L37 A;  1TQO A;  3PV0 A;  4QIW E;  3CCV A;  1H9J A;  4XQN A;  3J81 L;  4LF6 Q;  1A3T A;  3C2P A;  2FMM A;  3F2U A;  3CCL A;  2UUC L;  2PQE A;  3J81 c;  3A0J A;  2QDB A;  2EY6 A;  4DUZ Q;  2XN9 C;  1NE3 A;  2EY1 A;  3GTG H;  2L12 A;  2CVR A;  2Z1C A;  2J4X A;  3EQL C;  2RVL A;  1PH3 A;  2N8N A;  3A54 A;  5AJ3 L;  1AN8 A;  3RLF A;  3J81 i;  3S1Q B;  1IYV A;  2A8V A;  1CZW A;  5M5W H;  1G51 A;  1O7I A;  3OWE B;  3P7J A;  3D31 A;  4R4O A;  2F3V A;  1L2F A;  2CH4 A;  1YJW A;  1XWE A;  2BA1 A;  3M3Y B;  1S4Z A;  1WVL A;  4N8X 1;  2R93 B;  4A3B H;  3HOY G;  2JA9 A;  1I6H H;  3PQI A;  1B44 D;  2A6H D;  5EKL A;  2NN6 G;  3GTO B;  3A55 A;  1DCZ A;  2A1A A;  2C5C A;  3QOL A;  1HFG A;  2F0J A;  4GLX A;  1DM0 B;  4IFD I;  1C0A A;  1F9S A;  2FFK B;  2B2Y A;  3L9A X;  3J7Z C;  4P74 A;  3HEJ A;  3K5M A;  1ET9 A;  2CWA A;  4IN3 A;  3ERO A;  4DNT B;  1QVF A;  5KND A;  4B9X A;  1Y69 U;  2A68 C;  2IX0 A;  5IP9 G;  1BF4 A;  3A5U A;  1TWG H;  1XMO L;  3RMH A;  4A3F B;  1KTK A;  1EL0 A;  1PFN A;  3L3O C;  2J0T D;  5IT9 L;  4C3J G;  1JJC B;  1MD2 D;  3OMG A;  5IT9 c;  5IWA L;  1PZI D;  1UEA B;  3K7A H;  3W2D A;  3KBG A;  2WB1 G;  2VQF L;  1IBK L;  4DXG A;  4PQX A;  2NB0 A;  4AYB B;  4GNX B;  1MI2 A;  4GOP A;  4C1N K;  4MHE A;  4MZ9 A;  2DY8 A;  3HKZ B;  5M3M G;  5DEH A;  4DKA C;  1FVI A;  1LTG D;  3HOZ H;  2FXQ A;  4LFA Q;  3CW2 C;  1EY4 A;  1QVG A;  3PO3 G;  1Q90 A;  1DOK A;  1X3G A;  2HHH Q;  3GTM B;  2VUM B;  4A3G B;  1WTO A;  1EWI A;  4PV1 C;  2MFI A;  4A3J G;  2O5J C;  3URY A;  1K73 C;  1T5X D;  4JVZ A;  1ZEQ X;  4WJ4 A;  3CC7 A;  3D3R A;  2IY5 B;  4L5Q A;  4UAI A;  3BVG A;  1WTP A;  5EKK A;  3CHB D;  4DV5 L;  2NTT A;  1XTD A;  3SXH A;  3VR2 A;  3MEF A;  1U4L A;  2F4V L;  2G5D A;  1U9R A;  1X32 A;  2PZW A;  2HD3 A;  2XNA C;  2DN8 A;  1PLF A;  2WAQ G;  1DZ1 A;  2EXD A;  4U67 3;  3R93 A;  4OX9 L;  3S2H H;  3NEN A;  4K5X A;  1GUT A;  4OO1 H;  3EFX D;  1VQB A;  1JJG A;  5DLQ E;  3GTG B;  1J5E L;  1MJE A;  3QO2 A;  3EVQ A;  4PZ6 A;  1XJV A;  4DV7 Q;  4BS9 A;  2K1B A;  3I55 A;  1PV4 A;  1ML0 D;  5M5W B;  2PW5 A;  4JG2 A;  3BVM A;  4JI1 L;  3KJO A;  4X62 Q;  2AMC B;  1UE6 A;  2UXC L;  1SNQ A;  1A15 A;  3GD7 A;  3FKI G;  3M7N A;  1EU4 A;  3A7A B;  1ENF A;  1V1Q A;  1YJ9 A;  3NQT A;  3M7G A;  1QVC A;  3G4S A;  4A3B B;  4CBV A;  5A2Q E;  3VYU A;  3F2B A;  2R7F A;  2JA7 G;  4UP9 A;  4JPB W;  3EBE A;  1X54 A;  3DMU A;  3I91 A;  4IUQ A;  1KLG D;  2PNH A;  2IW3 A;  1O80 A;  3HRZ C;  4JI6 L;  4DN4 M;  4LAA A;  1HQM C;  2IJ0 A;  1PDQ A;  1L1O C;  1M8A A;  3LNN A;  2QIL A;  5D65 A;  4C3I G;  1L0X B;  2FIN B;  1TWG B;  4C3H G;  1DYQ A;  3FP9 A;  2B39 A;  2F0G A;  1EQR A;  5CR3 A;  5CV8 A;  2PCF B;  3RR5 A;  1DGS A;  1QE6 A;  1Q46 A;  3A5Z B;  4NPS A;  1Z6H A;  3U9S A;  3S16 H;  1TWH H;  2DUD A;  4AQY L;  3K7A B;  2A69 C;  3T53 B;  2Q2I A;  5DNF A;  4B9W A;  4KI0 A;  2HQL A;  1F2M A;  4NW2 A;  2ZT9 C;  1ZKO A;  5CMD A;  5C3E H;  3RZD H;  3HOZ B;  1HQR D;  2JE6 I;  3SEB A;  3NXW A;  2JA6 G;  2Q8T A;  5K36 G;  5KEE A;  2EIF A;  2WKC A;  3UE0 A;  1VDZ A;  5JJK A;  4NMZ A;  1CHQ D;  3PIO 3;  2PQA B;  1HNW Q;  3JAM L;  2RSN A;  3AU7 A;  3ULJ A;  3HFZ B;  1Z9F A;  1HR0 L;  1EZ6 A;  1ZXT A;  5EBD A;  5HGQ A;  3JAM c;  1PHJ A;  1XNQ Q;  2I5L X;  1R4P B;  1PH4 A;  3HOU G;  1A0I A;  4ZYS A;  1U0L A;  4JBM A;  3L7Z C;  4QIW B;  2F0I A;  1D8L A;  4X3S A;  5E1F A;  1KQS A;  3PO2 G;  4U68 A;  1MSH A;  1Q8K A;  1SRU A;  3S2H B;  1HNZ Q;  4B3M Q;  4OWX B;  2MNA A;  3K5N A;  4YIJ A;  2B63 G;  3PUY A;  1E22 A;  1SE3 A;  4LF7 Q;  5D3D A;  5FO8 B;  4BY7 H;  1VQM A;  3LX0 A;  4GKJ L;  2ZJR A;  1GUO A;  1XPU A;  1UAP A;  1SND A;  4LNQ A;  5GAE C;  4KY7 A;  4HIK A;  2E8G A;  1CM9 A;  1Y1V H;  1D5M C;  2ICE C;  1WCM G;  4E6I A;  1VF5 C;  5IYD H;  3KLS A;  4F87 A;  4LW1 A;  3U58 A;  1EEF D;  4KY6 A;  5EQ0 A;  4DUY Q;  1QJO A;  1RD9 D;  1N36 L;  1CQV A;  4KN7 C;  2N49 A;  4K6D A;  1BCP D;  2SOB A;  1MGS A;  4P73 A;  4DAP A;  3I90 A;  1BOS A;  4HJ5 A;  4GZY C;  4O42 A;  1NTG A;  3KF6 A;  2ENB A;  5LMN L;  3KDF B;  1LT5 D;  5E3F A;  2OWO A;  1TWC H;  3Q23 A;  2EXZ A;  3W1B A;  4B3S L;  3G48 A;  3G7L A;  4QGU A;  1IBL L;  5FK9 C;  4WOR A;  2I07 B;  3HOV G;  2PNR C;  4APV A;  1PFS A;  1OXS C;  4X3T A;  1EQV A;  1FNV A;  2K5H A;  3CQZ H;  1UE1 A;  1IXR A;  2AWN A;  4KD3 A;  2LS0 1;  3S16 B;  3MXN A;  1Y1W H;  1AZP A;  1B8A A;  2A6H C;  3OTO Q;  3NP8 A;  1NBW A;  3TME A;  1ROD A;  3J7A F;  4IUU A;  1AW7 A;  4JYA Q;  4JI5 L;  3J80 L;  3D8G A;  5ELD A;  2Z8L A;  4DAY A;  4A3E H;  1L1O A;  5C3E B;  2PYK A;  4CKC A;  5FJ8 G;  3RZD B;  3J80 c;  3PSI A;  3HOW G;  4XT1 B;  2PPB C;  4AIM A;  4V19 0;  3SK4 A;  1I4H A;  3Q0A A;  4WFN 3;  2JA5 G;  1TS5 A;  2KED A;  4LF8 Q;  1D1I A;  1R4Q B;  4UP7 A;  4K0K L;  4G7O C;  4P75 A;  1VQ4 A;  4KD4 A;  1HTL D;  3TRZ A;  2R92 G;  3J80 i;  4K8J A;  5JOB A;  1BVS A;  4QCL A;  3G6J B;  3Q22 A;  3I4N H;  1OXX K;  2ID0 A;  3K58 A;  1GKH A;  3NBH B;  4KHP L;  4L63 B;  3LGJ A;  3FPU B;  1HUN A;  3VR4 A;  3BZK A;  3NEL A;  1WD0 A;  1KAB A;  3KUP A;  1M90 C;  2WV6 D;  2I0Q A;  4LUV A;  1PRT D;  2K4K A;  1WJJ A;  1SBB B;  3S17 B;  1YHB A;  1S5E D;  4Y7N H;  4BY7 B;  4EX5 A;  3I4O A;  2C9O A;  1Y14 B;  4YWL A;  4CKB A;  1S5D D;  1A2T A;  4L8J A;  1STA A;  2GVA A;  4F7X A;  3A7L A;  1NCV A;  1KDB A;  1Y1V B;  5JPN C;  3VDY A;  2BDN A;  3CD6 A;  4FXK C;  2RCF A;  1CHP D;  1SYB A;  3KF8 B;  2CQA A;  2LFN A;  1FGU A;  3QG1 A;  2E76 C;  2ICI A;  4J1M A;  2F0D A;  3RZO H;  3TP8 A;  3HKS A;  3P1H A;  3GV3 A;  5T1I A;  1S40 A;  1HHV A;  1SNP A;  2D9U A;  4YY3 L;  1V1O A;  3J7A V;  3V2T A;  4G4K A;  1XTC D;  3K81 C;  3GO5 A;  1WOC A;  4IFD G;  3FRP B;  1TWC B;  4DV0 Q;  1FYC A;  2QKI C;  3OWF A;  2NN6 H;  4XTC S;  5IOC A;  4KLK A;  5HY6 A;  2RF4 A;  5EKI A;  4ID6 A;  1CA6 A;  3TP6 A;  1IBM L;  1N33 Q;  2L11 A;  4GNX C;  4JI0 Q;  2V4D A;  2YYZ A;  4RAU C;  4A3K H;  2YTV A;  2K52 A;  3CQZ B;  4EQP A;  2UUB L;  2LXK A;  5IP9 H;  3D4R A;  1Y1W B;  1EEI D;  2Z4H A;  5CV7 A;  4CJ0 B;  4R4Q A;  3K7U C;  2CW0 D;  4OIK A;  4OON A;  1A62 A;  4V0B A;  3UDX A;  4DR7 Q;  4C3J H;  4NXN Q;  4K5V A;  4I7A A;  4A3E B;  2Q2U A;  4ME3 A;  5IYB G;  4IJL A;  2UU9 Q;  3D4W A;  4BBS H;  2MP1 A;  2LSS A;  4KJN A;  4DK3 C;  5I9O A;  2ZXO A;  3E3X A;  3M4P A;  5I9P A;  1STY A;  3RN2 A;  1ET6 A;  1FJG Q;  4CJ2 C;  3PMF A;  5C4X G;  4IUP A;  1CUK A;  1WTV A;  4ALP A;  2A74 C;  2WAC A;  1XNR Q;  5IP7 H;  2PZU A;  4QL5 A;  3I4N B;  4M8A A;  5IOD A;  4Z9C B;  4K2L A;  1HNX Q;  1STG A;  3CPW A;  1NMF A;  1WI5 A;  2B2Y C;  4TQU S;  1CK1 A;  3K5L A;  3S1Q H;  2E5L L;  1GJX A;  4A3J H;  5IIF A;  1E24 A;  4LFC Q; 
#chains in the Genus database with same CATH homology
 1K9M C;  2A1A A;  3K8A A;  4DV7 L;  1K3R A;  4GLX A;  4IFD I;  1C0A A;  1R9T H;  1E3P A;  2ATW A;  4OO1 G;  1CKN B;  3J7Z C;  4P74 A;  3BJU A;  1B7Y B;  2CWA A;  1VS0 A;  2YU9 H;  1TXY A;  2NZH A;  1QVF A;  1RIP A;  1BBW A;  2RHS B;  3EN2 A;  4X62 L;  2IX0 A;  2I5H A;  5IP9 G;  3A5U A;  1TWG H;  1YNX A;  1XMO L;  4PZ8 A;  3I56 A;  3PUW A;  4GKK L;  2PMZ E;  1SFO H;  3AYH B;  3ICE A;  1VQH A;  1YVC A;  4JV5 L;  4DR3 L;  1JJC B;  4GOP C;  3OYY A;  1EOV A;  5GRO A;  1G6P A;  3PUV A;  2JK8 A;  1IZ6 A;  4XIG S;  5IT9 c;  5GAD C;  2JA8 G;  1PH7 A;  5IWA L;  2WAQ E;  3K7A H;  5JJL A;  3M85 A;  1OTC A;  2WB1 G;  3G6E A;  2PI2 E;  2VQE Q;  4DV4 L;  3AFQ A;  2R7D A;  2VQF L;  1IBK L;  4B3S Q;  4B3T Q;  2BH2 A;  4GNX B;  4GOP A;  3KOJ A;  1J6Q A;  4O0A A;  1S3O A;  1VQK A;  4MZ9 A;  4C2M H;  5M3M G;  4DKA C;  1FVI A;  4UP8 A;  5IYB H;  4IFD J;  4R4I A;  1HZA A;  3CP0 A;  2VW9 A;  3KF6 B;  3CC4 A;  2FXQ A;  3HOZ H;  4LFA Q;  3CW2 C;  1QVG A;  4UPA A;  1WYD A;  3PO3 G;  4A3I G;  1L0W A;  4JYA L;  2V1C C;  1X3G A;  3KYH C;  5M3F G;  3OW2 A;  4JOI C;  2HHH Q;  1X55 A;  2R7Z H;  4A3B G;  4DAM A;  2ZTC A;  3H0G H;  1EWI A;  4A3J G;  2MFI A;  1E1O A;  5C4X H;  5AJ3 Q;  1NJI C;  1K73 C;  1I3Q H;  4DV1 L;  4BY1 G;  4WJ4 A;  3CC7 A;  4LF8 L;  4L5Q A;  4O2D A;  1CKN A;  1GO3 E;  2NVQ H;  2IY5 B;  1H95 A;  1N34 Q;  1VQG A;  1Q12 A;  4DV5 L;  1XTD A;  3AEV A;  2UUA L;  3MEF A;  4BBR G;  4JI5 Q;  2F4V L;  2YTY A;  4RG1 A;  3GTM H;  3HOY H;  1NMG A;  4JCV E;  3CCM A;  1OXV A;  3HOX G;  3BU2 A;  2BA0 A;  1GVP A;  3MXN B;  1IYJ B;  3M9B A;  1VQL A;  4DR4 L;  2NVY H;  4X64 Q;  2WAQ G;  3F2D A;  1PH8 A;  2EXD A;  3U4Z A;  4DV2 L;  4OX9 L;  5JEA J;  2IHF A;  1E7Z A;  4LF9 L;  3S2H H;  3NEN A;  1JJG A;  1VQB A;  1QUQ B;  5DLQ E;  5C0X I;  1N8R C;  4P72 A;  1K8A C;  2OCE A;  2ZM6 L;  2CCZ A;  1J5E L;  1MJE A;  5C3E G;  4DAY B;  4PZ6 A;  1HH2 P;  2UXD L;  1PVO A;  2ZTE A;  1XJV A;  3RNU A;  1KRS A;  4A4I A;  1JJ2 A;  4DV7 Q;  1KXL A;  2AHO B;  3HOU G;  1EFW A;  1KAW A;  4NB3 A;  3I55 A;  1PV4 A;  2I5M X;  4GS3 A;  1HNW L;  4JG2 A;  3TS2 A;  3AQQ A;  4IOA A;  4GNX A;  1Q86 C;  4DV3 Q;  1KIX A;  4PG3 A;  2Q2T A;  2UXB L;  4IPD A;  4JI1 L;  3KJO A;  2CFM A;  1XNQ L;  1UWV A;  4X62 Q;  2AMC B;  3UDI A;  1UE6 A;  2UXC L;  1SR3 A;  1Q1E A;  2VL6 A;  3GD7 A;  4X65 L;  3PF5 A;  1N9W A;  1SN8 A;  2RHQ B;  1XMO Q;  3FKI G;  3A74 A;  2JA8 H;  3M7N A;  4WJ3 M;  2D0O A;  1VQF A;  1V1Q A;  1YJ9 A;  1PA6 A;  2KBN A;  4GKK Q;  4DR1 L;  1QVC A;  3JC6 6;  3FHW A;  4EQ5 A;  3L2P A;  3ERS X;  3G4S A;  3GTP H;  4DR6 L;  1SE8 A;  1HNZ L;  3UE1 A;  4HIM A;  4JV5 Q;  2R7Z G;  3STB C;  4X66 Q;  3F2B A;  2R7F A;  3H0G G;  1V9P A;  4A75 A;  4UP9 A;  2JA7 G;  2K5N A;  5M3M H;  5IWA Q;  1X65 A;  3EBE A;  1X54 A;  2YTX A;  4QQB X;  2VQF Q;  2PNH A;  1IBK Q;  3PO3 H;  3PGZ A;  4A3I H;  4JI6 L;  1A8V A;  1VQD A;  5M3F H;  1XPR A;  1I50 H;  4JI4 L;  1L1O C;  4A93 G;  3K80 C;  1PH2 A;  5GAH C;  3ZJY C;  2IT1 A;  4BY7 G;  2QEX A;  3UDF A;  4BY1 H;  3FP9 A;  5LMU L;  4MTN A;  1EQR A;  3KFU A;  2K14 A;  3RR5 A;  1DGS A;  1V43 A;  5C44 G;  4BA2 I;  3CC2 A;  1Q46 A;  3A5Z B;  4GN3 B;  1Y1V G;  4NPS A;  4DUY L;  4DV0 L;  3ULL A;  4A3C G;  3CAM A;  1I94 L;  4BBR H;  5C0X G;  5FLX c;  1JT8 A;  2B29 A;  4DV6 L;  4A76 A;  4DV1 Q;  3T1Y L;  3S16 H;  1PH9 A;  2AWO A;  3HOX H;  1HZ9 A;  2CKZ B;  4DNI A;  5IYD G;  1TWH H;  4YY3 Q;  2E2I H;  2DUD A;  4AQY L;  3RLO A;  5BR8 L;  1YHQ A;  1N33 L;  2Q2I A;  3IRB A;  2HQL A;  4KI0 A;  2H5X A;  1VQJ A;  3DM3 A;  1SMX A;  1TWA H;  4IPC A;  3CF5 A;  3F8T A;  1S72 A;  5C3E H;  4DR2 L;  3UDG A;  3T1H Q;  3RZD H;  4LF4 L;  4DR4 Q;  4DV2 Q;  4OX9 Q;  1B70 B;  2JE6 I;  4LF9 Q;  2JEA I;  4JC0 A;  1IBM Q;  3U50 C;  1T9H A;  2JA6 G;  4DUZ L;  1N32 L;  2VNU D;  2K50 A;  4NXN L;  2A19 A;  3D0F A;  3U4V A;  3GTL H;  3B6Y A;  4R4C A;  1J5E Q;  2UXD Q;  5K36 G;  4JI3 L;  2MQH A;  2UUB Q;  2EIF A;  3UE0 A;  5JJK A;  3FKI H;  4QY7 A;  4RMF A;  3CCQ A;  3OTO L;  2PQA B;  4BXX G;  1HNW Q;  1MIU A;  2UUC Q;  3ULJ A;  3HFZ B;  1IL2 A;  4JBW A;  1Z9F A;  2UXB Q;  1X56 A;  2KHJ A;  1HR0 L;  4JI1 Q;  1XNQ Q;  5HGQ A;  3JAM c;  1PHJ A;  2I5L X;  3KLW A;  4JI2 Q;  1PH4 A;  3S14 H;  4X65 Q;  1UE7 A;  4OXP A;  1Y1W G;  1A0I A;  4BA1 I;  1U0L A;  4YCU A;  3L7Z C;  2ES2 A;  1ASY A;  1D8L A;  1KQS A;  1GM5 A;  2N3S A;  4JBM A;  3I4M H;  3PO2 G;  1Q8K A;  1SRU A;  1RL2 A;  2AKW B;  3S1N H;  1HNX L;  5FLM G;  4DR6 Q;  5M5Y H;  1HNZ Q;  4B3M Q;  4OWX B;  1LUZ A;  2MO1 A;  2MNA A;  4QJF A;  4JOI A;  4YWK A;  3TEH B;  5GAG C;  4A3L G;  3CMA A;  4A3M H;  4NXM Q;  3PUY A;  2B63 G;  3PF4 A;  1E22 A;  4LF7 Q;  3S1M H;  4A93 H;  4C3I H;  4HIO A;  3CCE A;  4BY7 H;  2K75 A;  4C3H H;  1VQM A;  4GKJ L;  2ZJR A;  1XPU A;  3KJP A;  5C44 H;  4LNQ A;  1SLJ A;  2Y0S E;  1JE5 A;  5GAE C;  4JI6 Q;  4HIK A;  2E8G A;  1Y1V H;  2F3I A;  5E7N A;  4JI4 Q;  3CXC A;  4A3C H;  4LUZ A;  2E5L Q;  4L5T A;  3G71 A;  3CME A;  3CCS A;  2JEB I;  2DGY A;  2QGQ A;  2OQK A;  3RN5 A;  1WCM G;  5LMU Q;  4YCV A;  1L1O B;  5IYD H;  1SRO A;  3I4N G;  1X6O A;  2Z0S A;  4LW1 A;  3U58 A;  4LF5 L;  4DUY Q;  1N36 L;  3GTJ H;  1VQN A;  4GLA C;  2K5V A;  2N49 A;  2IX1 A;  1GD7 A;  4AYB E;  3ER0 A;  1CKM A;  1XMQ L;  4GLV B;  4P73 A;  1MKH A;  3HKZ E;  1EIF A;  3CCU A;  3T1Y Q;  3S24 A;  2HIV A;  4HJ5 A;  4AQY Q;  1NTG A;  3KF6 A;  1Q82 C;  5LMN L;  4DPG A;  3PIO A;  3CCR A;  1K83 H;  3KDF B;  4HJ7 A;  4H02 A;  4PZ7 A;  2OTL A;  4IPH A;  4AH6 A;  3M4O H;  3E9H A;  2HIX A;  1TWC H;  1C9O A;  1VQC A;  4YHH L;  3J81 j;  3W1B A;  5M5X H;  4DR5 L;  1YI2 A;  1KC8 C;  2OWO A;  4B3S L;  2JA6 H;  1HR0 W;  3G48 A;  2B3G A;  3H15 A;  3GTQ H;  4QGU A;  1HJP A;  4DR3 Q;  1IBL L;  4DR2 Q;  4HJA A;  4LF4 Q;  1YIT A;  5H1S E;  2L15 A;  3L0O A;  4Y52 H;  1X3F A;  3E0E A;  4A3F G;  4JI7 L;  1BBU A;  1HZC A;  3I4M G;  4LFB L;  3HOV G;  4BXX H;  4APV A;  1N32 Q;  1PFS A;  1X3E A;  4YWM A;  2Y0S G;  3DLL A;  1OXS C;  4DV4 Q;  2KHI A;  1LTL A;  5C0X J;  3NEM A;  4FDB A;  5GQO A;  4JI3 Q;  1YEZ A;  2K5H A;  3CQZ H;  1UE1 A;  1IXR A;  2AWN A;  4A3M G;  1ASZ A;  3E9I A;  2LXJ A;  4B3R L;  3HOU H;  1Y1W H;  1B8A A;  2F52 A;  2BH8 A;  2NZO A;  3F1Z A;  3OTO Q;  3H3V I;  3CPF A;  3PO2 H;  4POG A;  1E1T A;  1AH9 A;  1NBW A;  3STB D;  1N34 L;  5FLM H;  3GDE A;  1QUQ A;  2XTI A;  1HR0 Q;  4JYA Q;  1A63 A;  4JI5 L;  4AYB G;  4A3L H;  4A3E H;  2B63 H;  2ZTD A;  1L1O A;  3HKZ G;  1CSP A;  5FJ8 G;  3J80 c;  3PSI A;  3RLN A;  3HOW G;  1UE5 A;  2CWP A;  3TS0 A;  4JI8 L;  2JA7 H;  4AIM A;  4LF8 Q;  2JA5 G;  2Z6K C;  4UP7 A;  3J7A 5;  4IPG A;  2NVX H;  4K0K L;  2WP8 J;  4JI0 L;  4P75 A;  4TVA B;  1VQ4 A;  4DV5 Q;  2VUM G;  2D62 A;  1AE2 A;  1OXU A;  4MNO A;  2UUA Q;  1CSQ A;  4A3G G;  3PCO B;  3TQY A;  3TRZ A;  2F4V Q;  2R92 G;  3J80 i;  2R6G A;  3W5O A;  3SGI A;  1W3S A;  1X9N A;  1K8G A;  1BVS A;  2N78 A;  1VQA A;  4A3D G;  3KDF A;  1I5F A;  1WCM H;  5IE8 A;  4GKJ Q;  4DK6 C;  5LMN W;  4LF6 L;  3I4N H;  3Q8D A;  1YBY A;  2ZJP A;  1W2B A;  2Z6K A;  3M3Y H;  4J15 A;  1OXX K;  2GVB A;  4JBJ A;  4LWC A;  1Q81 C;  1VQ8 A;  2HT1 A;  4DV3 L;  4JBK A;  2R93 H;  2ID0 A;  1HZB A;  1GKH A;  4UY8 C;  1Q1B A;  4A3K G;  4DR7 L;  1FL0 A;  3NBH B;  2ZM6 Q;  4KHP L;  2JJQ A;  3CCJ A;  3GTO H;  3M4Q A;  3LGJ A;  3PUZ A;  1PH6 A;  2VS1 A;  3PIP A;  1VQP A;  4LF5 Q;  2UU9 L;  2VY3 A;  3BZK A;  1N36 Q;  3NEL A;  1M90 C;  2I0Q A;  2JQO A;  4LUV A;  1VQE A;  3S1R H;  1XMQ Q;  1P8L A;  2K4K A;  4X66 L;  1WJJ A;  5J3B A;  1FJG L;  1YHB A;  4KHZ A;  1P16 A;  1EQQ A;  2UXC Q;  4Y7N H;  5LMN Q;  4BBS G;  4EX5 A;  4A3F H;  2WFW A;  3I4O A;  1Y14 B;  2PI2 A;  4YWL A;  2E2J H;  1XNR L;  4YHH Q;  4DR5 Q;  2KCM A;  3HOV H;  3BZC A;  2GVA A;  1MJC A;  4DR1 Q;  2CQO A;  1PH5 A;  1YHA A;  2MO0 A;  1YZ6 A;  5ELN A;  5JJI A;  3AFP A;  3JAM i;  4P71 A;  3VDY A;  1XPO A;  1IBL Q;  3CD6 A;  4POF A;  1VQ7 A;  4A3E G;  3S17 H;  3KF8 B;  1LYL A;  3I2Z A;  4JI7 Q;  1VCI A;  4LFC L;  5IP7 G;  4LFB Q;  1Z47 A;  1FGU A;  1UEB A;  2Q2H A;  4L5S A;  1OXT A;  5EAY A;  2QA4 A;  2ALY B;  4HID A;  2E2H H;  1QZG A;  3RZO H;  5IYC G;  3HKS A;  4GN4 B;  4X6A H;  1BKB A;  1Q7Y C;  2OTJ A;  4PMW A;  3GTK H;  4L5R C;  4B3R Q;  1S40 A;  1KD1 C;  4OWT B;  4IO9 A;  1G29 1;  5FJ8 H;  4YY3 L;  4OWW B;  4IJH A;  3HOW H;  3K81 C;  3GO5 A;  1WOC A;  5IY0 A;  1EIY B;  1VQ6 A;  4IFD G;  3TRE A;  2JA5 H;  3WWV A;  2KCT A;  4YCW A;  4DV0 Q;  3ULP A;  3I7F A;  2R93 G;  2VUM H;  1NY4 A;  2VZA A;  4A3G H;  1I94 Q;  2NN6 I;  1KHI A;  2ZJQ A;  3S2D H;  4XTC S;  1EYG A;  1LM0 A;  2R92 H;  1PYB A;  4DV6 Q;  3T1H L;  1WFQ A;  4HJ9 A;  3W1G A;  4KLK A;  5HY6 A;  4JI8 Q;  4A3D H;  1VQ5 A;  4R1J A;  1VQI A;  2RF4 A;  2PQA A;  1KRT A;  1JB7 A;  1IBM L;  5BR8 Q;  4K0K Q;  4OO1 I;  1N33 Q;  4GNX C;  4JI0 Q;  1M1K C;  2VQE L;  1QZH A;  2YYZ A;  1PH1 A;  2C35 B;  4GN5 A;  1KL9 A;  4B3T L;  4A3K H;  2YTV A;  2K52 A;  2UUB L;  3PV0 A;  2GN5 A;  4LUO A;  4QIW E;  2LXK A;  5IP9 H;  3CCV A;  1EUJ A;  4LF6 Q;  1YJN A;  2IHE A;  2NVT H;  2OQ0 A;  3K7U C;  4R4Q A;  2UUC L;  3F2C A;  3CCL A;  4LFA L;  3J81 c;  4OON A;  3A0J A;  1A62 A;  2D0P A;  4R4T A;  4DUZ Q;  3UDX A;  5JEA G;  1NE3 A;  4DR7 Q;  1K0R A;  3GTG H;  4C3J H;  2HHH L;  4NXN Q;  1VQO A;  4KHP Q;  2Q2U A;  4ME3 A;  5IYB G;  1PH3 A;  3S15 H;  2N8N A;  5AJ3 L;  4IOC A;  3HOZ G;  4IJL A;  2UU9 Q;  4BBS H;  3RLF A;  3J81 i;  1PYS B;  2LSS A;  1JMC A;  2A8V A;  3H3V H;  5M5W H;  2YV5 A;  4DK3 C;  2RCN A;  3EIV A;  3K0X A;  4B3M L;  1G51 A;  3M4P A;  1O7I A;  5C4J H;  3RN2 A;  1FJG Q;  3D31 A;  4R4O A;  4NXM L;  4LF7 L;  4JI2 L;  2EQS A;  5C4X G;  1CUK A;  4ALP A;  4GOP B;  4HJ8 A;  1L2F A;  2XGT A;  1AE3 A;  1D7Q A;  1XNR Q;  1YJW A;  5IP7 H;  2WB1 E;  2BA1 A;  4QL5 A;  1CKO A;  2ASB A;  4X64 L;  1U5K A;  3PUX A;  1HNX Q;  1VQ9 A;  3CPW A;  1NMF A;  1WI5 A;  4TQU S;  3S1Q H;  4A3B H;  2E5L L;  2JA9 A;  5IYC H;  3HOY G;  1I6H H;  2KEN A;  1C7Y A;  4A3J H;  1YIJ A;  1E24 A;  2NN6 G;  5ELO A;  1TWF H;  4LFC Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...