4A4IA

Crystal structure of the human lin28b cold shock domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
VLRGTGHCKWFNVRMGFGFISMINREGSPLDIPVDVFVHQSKLFMEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords PROTEIN LIN-28 HOMOLOG B
publication title The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a4iA00
1SFOH 2I0QA 4H02A 3T1HL 4DR2L 3W1BA 1K83H 3K0XA 2CWAA 1XJVA 2E2JH 3AFPA 2MO0A 3S1MH 2A1AA 3CD6A 1M90C 4A93G 1PV4A 1OXUA 4LF5L 4BY1G 5IP9H 1L2FA 4P71A 1I94Q 3GTQH 4DV3Q 1SROA 4DR3L 3ZJYC 1XNQQ 1GO3E 2ZTDA 1U5KA 5LMNW 1UE6A 4QQBX 3PIOA 2OTLA 4DV7L 1KHIA 4KLKA 2JA7G 3ER0A 5ELNA 2NVXH 5IY0A 2DUDA 1NMFA 1X3GA 4C3IH 1PHJA 1VQ4A 4A3GG 3GO5A 3AFQA 4POFA 1XPUA 3S17H 1NE3A 4A93H 3CC2A 5E7NA 1KC8C 4BY1H 2WB1E 4JG2A 1TXYA 3CAMA 2N78A 4Y7NH 1YHAA 2R92G 4ALPA 2UUBQ 4DR6Q 4AYBE 3PCOB 2VNUD 2JA9A 1E1TA 1R9TH 3NEMA 2JA7H 3PGZA 3PO2H 3M7NA 4PZ8A 3OTOQ 5JEAJ 1IBKL 1JB7A 2ZJQA 2D0PA 1P8LA 2JK8A 2OCEA 2E2IH 4A3GH 3S15H 1BVSA 1ASZA 2OWOA 1VQPA 4NXML 1KXLA 1C7YA 1HNWQ 1UE5A 3K8AA 2R92H 1QUQA 1V1QA 1VQHA 1K9MC 1V43A 1WJJA 4GKJL 1S3OA 4DR1Q 4HJ5A 4X62Q 3FKIH 1BBUA 1VQIA 4DUZQ 5C4XG 1L0WA 3GTLH 4BBRG 4JI5Q 4BY7G 1T9HA 4IFDI 1IZ6A 1TWHH 1J5EQ 1VQLA 4GOPA 3PUZA 4JI8L 3Q8DA 2F52A 1YI2A 1FJGQ 2YTVA 3U4ZA 4L5QA 5AJ3Q 4JYAL 4UP9A 1VQJA 4DV5Q 3ICEA 4DR4Q 2MFIA 1AE2A 1KAWA 1Q8KA 1K8AC 3RLNA 2IHEA 3G48A 1N34Q 2CWPA 4R4TA 5LMUQ 4GLXA 4QIWE 1HZCA 4GKKQ 2PI2A 1I94L 3EBEA 5C4XH 2Z6KC 3DM3A 4A3MG 2E5LQ 2H5XA 4BBRH 1XNQL 4YWKA 1YJNA 3F2DA 2NVTH 4DV1Q 5IT9c 4JC0A 2V1CC 2AWNA 2AMCB 3KOJA 4B3TQ 2IY5B 4L5RC 3NENA 4C3JH 1KRSA 3ERSX 1N9WA 1IL2A 2MO1A 4OWTB 4X65Q 4JOIC 2HHHQ 3L7ZC 2JQOA 1DGSA 1PH4A 4JI4L 1TWGH 1NMGA 2E2HH 1SN8A 4A3IG 4A3MH 2QA4A 1YITA 1JT8A 2ZTCA 2RCNA 5FLMG 2OQKA 2UUBL 4DR6L 1CSQA 3J7A5 1XMOQ 1Q1EA 4LF6Q 3OTOL 4IFDG 4R4IA 2JE6I 5C44G 4KHZA 1PH3A 2AKWB 2CQOA 2GVAA 2IHFA 4YCVA 1B8AA 1KD1C 4DV0Q 1E3PA 3W1GA 2RHSB 1UE7A 1CKNB 1E24A 2JA5G 1ASYA 3PO3G 4BA1I 1Q46A 3HKZG 4LFCQ 3PV0A 4A3IH 3RN2A 4OX9L 4A3LG 1LUZA 1HNXL 4GNXB 4PZ7A 1WOCA 5FLMH 3J7ZC 4DR1L 4AIMA 3CXCA 4JBJA 1AE3A 4X62L 5IYBG 2CCZA 4YCWA 4DUZL 1YEZA 3I55A 4UY8C 2JEBI 2VS1A 1RIPA 4JI5L 4A4IA 4C2MH 2K52A 1J5EL 5C44H 5M3FG 4MNOA 1PH7A 1Y1WG 4POGA 1PH8A 3CPFA 4YHHQ 2JA6G 1VQBA 1VQMA 5AJ3L 2JA5H 2AHOB 1B7YB 4DV5L 3PO3H 4A3LH 1AH9A 2Y0SG 5FLXc 1OXXK 4TVAB 3BU2A 1EOVA 5BR8L 2F3IA 1WI5A 4BBSH 2KCTA 1PYBA 5IYBH 1Q12A 1EFWA 1S72A 1WFQA 4DUYQ 3OW2A 2E5LL 1QVFA 5JJLA 5M3FH 2NZOA 1IBML 4DR7L 1TWFH 1N32Q 1Y1WH 2JA6H 2K5NA 2VUMG 2N8NA 3CC7A 3PUVA 4O0AA 2CKZB 3PIPA 3CCEA 4JI1Q 1K73C 4LUVA 4GLAC 4UP8A 1PH5A 1GD7A 3I4MH 4LFAQ 4DKAC 4X65L 3CCRA 2HHHL 3HOYG 3PUYA 2EQSA 3L0OA 3M4QA 2YTXA 4QY7A 4YWLA 1YIJA 1OXVA 4A76A 1XMQQ 4LUZA 2VUMH 2PQAB 1XMOL 1L1OB 4LF4L 3H3VI 2EXDA 4IPGA 3M85A 1JE5A 1G51A 4JI6Q 1SLJA 2I5LX 3AYHB 3F8TA 3NBHB 5H1SE 1G6PA 3CP0A 3RLOA 3KJOA 1CUKA 2PI2E 2UU9Q 2BH2A 3HOYH 1GVPA 3RLFA 4FDBA 3RR5A 4P72A 4IOAA 2UXCL 2R7ZG 1I50H 4LFCL 2ZM6L 1N36Q 3KDFB 1N8RC 1PH9A 1VQDA 4DV2Q 4JI3Q 4JI2Q 5FJ8G 1SMXA 4HIKA 4A3KG 4AQYQ 2C35B 4B3MQ 4B3RQ 5JJIA 1PH2A 1CKNA 5C3EG 1K3RA 2R6GA 1OTCA 1W3SA 2ES2A 1VQ8A 1K0RA 3OYYA 4GNXC 4YHHL 1HR0W 3TS2A 4HJAA 2DGYA 3MEFA 1NBWA 3CCQA 3S1RH 4JI0Q 2R7ZH 1QVGA 1VQCA 3MXNB 5IP7G 4A3EG 1I5FA 3F1ZA 4DAMA 2UUAL 3JC66 2QEXA 4JI7Q 2GVBA 5FJ8H 3CCMA 1YJWA 1C0AA 1JJGA 4A3KH 2L15A 4GS3A 3A74A 4KI0A 1P16A 4GN5A 5GAEC 4A3DG 3BZKA 4B3SQ 1N33Q 2WAQE 2PMZE 4X66Q 3HKZE 1VQOA 2IT1A 1N32L 1VQKA 1YZ6A 1IYJB 2LXJA 3H0GG 4R4OA 2R93G 4JI1L 3ULLA 5IP7H 4A3EH 4K0KQ 3TRZA 1I6HH 3K81C 1QZGA 2XGTA 4HIMA 2XTIA 3TREA 3S1NH 3UE1A 4BA2I 4DV3L 3I4OA 4K0KL 2Z6KA 4BY7H 4NXNQ 2ZTEA 2B63G 4AH6A 3M3YH 2OQ0A 3ULJA 3T1YQ 1VQ5A 3KF8B 4IPCA 5GAHC 1Y1VG 3GTOH 3EN2A 3GTKH 3CQZH 1B70B 1HR0Q 1VQNA 3H3VH 2FXQA 4ME3A 4X64Q 2YV5A 2K5VA 4LWCA 3H0GH 2R93H 3CMAA 3M4OH 4X6AH 4JI6L 4A75A 3E9HA 1G291 2WP8J 4R4CA 2KHJA 4JOIA 4IO9A 1JJ2A 5C0XJ 4A3BG 5ELOA 4XIGS 3JAMc 2UU9L 3E9IA 5K36G 5J3BA 5M5WH 1OXTA 1SE8A 3HOXG 4LF9Q 4LNQA 1X3FA 2F4VQ 4APVA 2VW9A 1L1OC 2B63H 2K5HA 2NZHA 1N36L 1Y1VH 4DV2L 1YHBA 2VZAA 4JI3L 4YWMA 5LMNQ 1Z47A 2AWOA 2JJQA 3U58A 4AQYL 3J81c 4B3RL 4GN4B 4YY3Q 1LTLA 2ASBA 5IWAQ 1UWVA 4LF5Q 1HNWL 5JEAG 4IJLA 3S1QH 1E7ZA 1IBLQ 2QGQA 4DR3Q 4JI0L 2LXKA 4IOCA 2HT1A 3DLLA 2VQEQ 1S40A 4XTCS 4EX5A 3HOVG 1PYSB 2IX0A 2KHIA 4OXPA 4P75A 2ID0A 1KL9A 5GAGC 4DV7Q 1HNZQ 3UDFA 3E0EA 1SRUA 4A3FG 1FJGL 4TQUS 4B3SL 1N33L 4X66L 1RL2A 2MNAA 4DR4L 3PSIA 1Q86C 5HGQA 2RHQB 2JA8G 1U0LA 2UXDL 3KJPA 1UE1A 1TWAH 1N34L 3UE0A 2K50A 3IRBA 5LMUL 1WYDA 4YCUA 4GKKL 3HOVH 5IE8A 4WJ4A 2BA1A 1A0IA 4IJHA 5JJKA 4GN3B 4JV5Q 4NXNL 4UPAA 1IBKQ 4A3FH 1EYGA 4DV1L 1YVCA 4NXMQ 4L5TA 2VL6A 5IYDG 1QVCA 1HR0L 4DAYB 4B3TL 1XTDA 1MJEA 2Q2TA 2JA8H 4KHPQ 2NVYH 3RN5A 3D0FA 4O2DA 3A5ZB 1HZBA 3HOZG 2YTYA 4LF7Q 2EIFA 3FHWA 4NB3A 4PZ6A 3GTPH 4DR5Q 1EWIA 1KIXA 3B6YA 3LGJA 3J80c 3CCSA 1X9NA 4Y52H 1VCIA 1UEBA 3CCVA 1XPRA 2F4VL 1VQ6A 3G6EA 4RMFA 5GQOA 4LF8Q 4BXXG 1XNRQ 2HQLA 1SR3A 2GN5A 2WFWA 4C3HH 1HH2P 4JI8Q 3GTMH 1M1KC 4PMWA 5IYDH 3CC4A 4LF6L 5LMNL 3S2DH 5EAYA 4UP7A 4MTNA 4JYAQ 2ZJRA 3FP9A 2KENA 4YY3L 4HIDA 1A8VA 3KLWA 4DV0L 1C9OA 2A19A 1FVIA 3HOZH 2OTJA 5IWAL 2R7DA 2I5HA 2UUCQ 4HIOA 1YHQA 1IBLL 2Q2IA 1VQ7A 3TS0A 3I2ZA 2NVQH 4BXXH 5M5YH 2VQEL 1FGUA 3CCLA 4IPHA 3CCJA 3CPWA 1X54A 3UDXA 4LW1A 1HNZL 4IPDA 3BZCA 1K8GA 3PO2G 2HIXA 5IYCG 1VQGA 1X65A 2HIVA 3S16H 4P74A 1Z9FA 1EIYB 1HJPA 3HOWG 4GNXA 3CF5A 2NN6I 2B3GA 3GDEA 4JI4Q 2JEAI 3GTJH 3KYHC 5M3MG 4DV4Q 2CFMA 2YU9H 2UXBQ 1EQRA 4IFDJ 1E1OA 2MQHA 5M5XH 3UDIA 3I4NG 1GKHA 3A0JA 3FKIG 1LYLA 3KF6B 3CMEA 1NY4A 4WJ3M 1CKMA 1QZHA 4DUYL 4NPSA 1KRTA 2ZJPA 1VQFA 5IYCH 3HOUG 5C3EH 2D62A 3ULPA 4JV5L 4P73A 3HOWH 4L5SA 3SGIA 3S2HH 3KFUA 4GLVB 3JAMi 2ATWA 5M3MH 4DK6C 5HY6A 3G71A 4KHPL 4OX9Q 2UXDQ 1FL0A 3K80C 4OO1I 1HNXQ 1W2BA 4LFAL 2ALYB 3AEVA 4LF7L 1A63A 3I4NH 4DR5L 1Q82C 1KQSA 2D0OA 1O7IA 3EIVA 1XMQL 4A3DH 1A62A 2N3SA 4RG1A 4A3JG 4LF8L 3HOUH 1XNRL 3J81i 1CKOA 3CCUA 2Y0SE 3PF5A 4GOPC 5DLQE 1Q81C 2Q2UA 2IX1A 4A3CG 3STBC 4DPGA 1OXSC 3HKSA 1EUJA 1X3EA 5GROA 1MKHA 3NELA 5GADC 3K7UC 3RNUA 4DV6Q 3PF4A 2NN6G 4LFBQ 3BJUA 2N49A 5BR8Q 1PH6A 2UUCL 1D8LA 4DNIA 2PQAA 1L1OA 4R1JA 3WWVA 2VQFL 2I5MX 2VQFQ 2B29A 2WB1G 3STBD 1PH1A 1BBWA 4A3JH 1X55A 3HFZB 3CW2C 3PUWA 3U50C 4DR2Q 3T1HQ 1IBMQ 4JI2L 4DR7Q 4A3CH 1EQQA 4B3ML 4AYBG 3TQYA 4DK3C 4JBKA 1WCMG 4QGUA 1MIUA 4JBMA 2Z0SA 1EIFA 4A3BH 3KDFA 2Q2HA 2KCMA 1D7QA 3HOXH 2K14A 3UDGA 1E22A 3D31A 3M4PA 1Q1BA 2RF4A 2UXBL 2A8VA 4DV4L 4OO1G 4JI7L 1NTGA 5C0XI 4MZ9A 4OONA 1JJCB 3S24A 3M9BA 3W5OA 3G4SA 1VS0A 4LF4Q 1PVOA 1VQ9A 1WCMH 1CSPA 1VQAA 1GM5A 1X6OA 2R7FA 1XPOA 3F2CA 1YJ9A 1Q7YC 4J15A 3I7FA 2K75A 3VDYA 2UXCQ 4OWXB 1LM0A 3U4VA 3F2BA 3J80i 2WAQG 3GD7A 2VY3A 3KF6A 4JCVE 2ZM6Q 4OWWB 3S14H 1IXRA 1BKBA 1VQEA 1X56A 1HZAA 1Y14B 2PNHA 3PUXA 1QUQB 2YYZA 4BBSG 1H95A 1HZ9A 1YNXA 3AQQA 3L2PA 3I56A 4HJ9A 3T1YL 4QJFA 5C4JH 4X64L 1TWCH 2LSSA 4EQ5A 4GOPB 1MJCA 3J81j 2E8GA 4HJ7A 1PA6A 4HJ8A 2BA0A 2BH8A 3H15A 4GKJQ 4DV6L 3TEHB 1JMCA 2KBNA 1PFSA 5IP9G 2UUAQ 3A5UA 3K7AH 2K4KA 4LF9L 4PG3A 3RZDH 3I4MG 4LFBL 4LUOA 4JBWA 1YBYA 1NJIC 3RZOH 4R4QA 3GTGH 4QL5A 1J6QA 5C0XG 1V9PA 1I3QH
chains in the Genus database with same CATH superfamily
3T1HL 4DR2L 3W1BA 5EQ0A 5EPJA 3S1MH 1EYDA 2A1AA 2F3VA 1V1PA 4A93G 2EYOA 1KDCA 2KECA 4BY1G 1B2TA 3CRLC 1SYDA 1L2FA 3CU7A 1RTNA 3ZJYC 3I3CA 2ZTDA 4V190 3SE0A 4XQJA 2O5IC 1KHIA 1NUCA 1D6EC 4KY6A 1BNZA 2XRQD 4RGTA 1X3GA 1PHJA 4A3GG 3GO5A 2EY6A 1XPUA 2EYHA 3CC2A 5CV9A 2WB1E 1H9MA 3CAMA 2F0SA 1DOKA 4ALPA 2LY7A 2VNUD 1X32A 1VF5C 3NEMA 5BN3A 2JA7H 1H9KA 4KY7A 3HOVB 1EFID 4HAEA 3K8AA 1V1QA 1TS2A 2XWBB 1WJJA 4GKJL 2JA8B 4RHSA 3IFDA 1I4XA 4DAYA 1T9HA 1F2ZA 4JI5Q 1STBA 4GOPA 3GP7A 4JI8L 4FXGC 1SYCA 1IYUA 2YTVA 3GTGB 1SNOA 3BYYB 5KNCA 5AJ3Q 2F0HA 1D2BA 2MFIA 4H7BA 1AE2A 1KAWA 3A8JE 3RLNA 1WTHA 2IHEA 4R4TA 5LMUQ 2PI2A 3HOZB 5C4XH 3VYRA 2Z6KC 3DM3A 2E5LQ 3QR8A 1YJNA 4DV1Q 2A68C 4L5RC 3NENA 4I65A 3ERSX 3S9WA 4OWTB 4JOIC 2JQOA 4Q0FA 1SN8A 2NZ1D 1YITA 1JT8A 2ZTCA 2RCNA 5FLMG 2OQKA 2PPBC 3GTJB 1CZWA 3QWNA 2YU9B 2EVBA 2K33A 3R3OA 4RGOS 1PDQA 2K7VA 2JE6I 1PH3A 2RVLA 2IHFA 1KD1C 3SK5A 4DV0Q 3MTSA 4G7HC 3W1GA 4OO1H 3PO3G 4LFCQ 3VR3A 1NSNS 3S2HB 1SYBA 4DN4M 5I6YA 1XX8A 5M3MB 3CXCA 2FJ2A 1EL0A 5IYBG 3I55A 3I4NB 2JEBI 1BF4A 1DJRD 1J5EL 5C44H 5KYLA 3SVMA 3J80E 4DV5L 1AH9A 3DWQA 1CFMA 1EWCA 2K1BA 4TVAB 5EBCA 5EBDA 1B9NA 2KCTA 3A54A 3T13A 4DUYQ 3OW2A 3QJYA 3HS0C 5JJLA 1IBML 2NZOA 4DR7L 2JA6H 4V0BA 3I72A 5KGUA 2VXWA 4DAVA 4LUVA 1STHA 4X65L 3HOYG 2DY8A 2YTXA 2BCOA 1YIJA 2B2TC 2Z1CA 5E1FA 1YNNC 1WTQA 1STYA 3H3VI 3M85A 2EYJA 1SLJA 1LO5D 1GUGA 3KJOA 1CUKA 1WCMB 2PI2E 2BH2A 4P72A 2UXCL 3WOFA 1A3VA 1PTOC 3ITPA 3TZDA 4A3KG 2M9VA 1PH2A 1W3SA 1VQ8A 3TS2A 4GNXC 3OHXC 4KKSA 1EY0A 2B2WA 3K5LA 1NBWA 3CCQA 4JI0Q 2R7ZH 1WTOA 4FF4A 3F1ZA 3JC66 3WDNA 3CCMA 1B1ZA 2WV6D 1JJGA 2SNSA 4GS3A 1PRTC 1CA5A 3X3MA 1ZXTA 4B3SQ 1N33Q 3K6OA 2QF7A 2MUYA 1SFOB 2LXJA 3K59A 2AQ2B 4JI1L 5IP7H 4CBVA 4A3EH 1I6HH 4LK1C 4N8FA 4RFBA 4X3SA 3OPOA 5G3LD 1HA6A 4BY7H 2ZTEA 3ULJA 1VQ5A 4IPCA 2DY7A 1Y1VG 2FXQA 4ME3A 5IODA 4X64Q 1DD2A 3H0GH 1EY6A 1RCVD 2OT2A 4JI6L 1G291 4IO9A 2KHJA 1TKWB 3JAMc 4ABNA 4LF9Q 1PZJD 1X3FA 2B63H 1L1OC 2K5HA 1N36L 4DV2L 5LMNQ 1Z47A 2AWOA 1R9TB 4F7XA 3I4LA 2K28A 4KKUA 4OIKA 3G6JB 2L4NA 4X3TA 3VR4A 1UEAB 5JEAG 3S15B 2O5JC 5K36H 2AUKA 2QGQA 1DOMA 5F2DA 4EX5A 3QB3A 4DXGA 4OXPA 1W6JA 3FKIB 3UDFA 2L12A 3E0EA 4K14A 5FLXE 1SRUA 1TIID 1PMRA 4E6IA 1KNAA 1TWHB 3MXNA 2Q8IB 3BS1A 3N52A 1AZQA 2PYKA 3KJPA 1UE1A 1IHZA 2K50A 3MZ5A 4YCUA 1TS4A 2EY1A 5JVH3 4NXNL 4A3FH 4L5TA 2VL6A 5C6AA 3K57A 2NVTB 2NVYH 4OHJA 5LHY1 2YTYA 2EIFA 2K32A 1KIXA 2F0FA 1HQMC 5D3DA 1G91A 1VCIA 1XPRA 3Q22A 2F4VL 1O7ZA 4RH6A 3NWTA 1MBYA 1R4QB 4JI8Q 1M1KC 5IYDH 2BE5C 4MTNA 3FP9A 4HIDA 3A56A 2CH4W 5ELEA 2K5QA 1GXDC 2NWGA 2Q2IA 3NK9A 3R2IA 1VQ7A 4U673 2NVQH 2XVSA 3CCLA 3CCJA 4A3IB 3UDXA 1F2MA 1F9RA 5IYCG 1JWSD 1GUSA 3S16H 5IT9L 5JPMC 1EIYB 5A35A 3CF5A 1QG7A 2EOTA 2UXBQ 4I7ZC 4IFDJ 2JA5B 2MQHA 2PMZB 3SK8A 4XDXA 2P5ZX 3FKIG 3FDTA 1D5XC 1LTAD 2ZJPA 3HOUG 4BBSB 5C3EH 2D62A 1VMCA 3ULPA 1UUPA 2CW0D 4P73A 4L5SA 5M3FB 3KFUA 1Y1WB 4KMUC 4DK6C 4OO1I 4LFAL 1BQQT 1PRTD 2NBFA 5ELCA 1KQSA 5LL6X 3ONAB 3FPPA 4A3DH 1A3TA 1A62A 2N3SA 3KLSX 4A3JG 4LF8L 1XNRL 1SAPA 2IX1A 4GOPC 5DLQE 1MGSA 1OXSC 4L6TB 3NELA 4DV6Q 1EYAA 3EA6A 1RF2D 3BJUA 3SK4A 1V1PB 4DNIA 5I2XA 3WWVA 2B29A 4F8MA 2WB1G 3STBD 1PH1A 4C1NK 4YIJA 2DJGC 1IBMQ 4A3CH 4DR7Q 2EE1A 1ICWA 3RD4A 3TDQA 3TQYA 4UDUC 1F77A 2EY2A 4ZKCB 4JBKA 5I9PA 1MIUA 4JBMA 2Z0SA 5C5MA 2KCMA 1D7QA 1SNMA 2CH4A 3NQIA 1JE4A 2A6EC 4ILWA 4DV4L 4ME5A 3NHHA 1WTWA 5C3XA 3G4SA 3P7JA 5CGKA 1PVOA 1Y69U 1CSPA 2B2VC 1G2TA 1GM5A 2EYPA 2R7FA 1M8AA 2B39A 1XPOA 3F2CA 1Q7YC 3I7FA 2UXCQ 3J80i 1I4RA 2DN8A 1RKNA 1Y14B 1C8CA 1Y8NB 4KJNA 2KEDA 5AFWA 1BBXC 4BBSG 2K6AA 4F88A 1YNXA 3AQQA 3T1YL 1GOZA 1EYCA 1SEBD 3T51B 3KUPA 4GOPB 3HRZC 3TP8A 2KA7A 1JWMD 2E8GA 1B44D 3TEHB 1JMCA 3M4OB 2R93B 1ET6A 1V8QA 3DXJC 5IP9G 4H0LC 3RZOH 4JBWA 1FNVA 1I4QA 5C0XG 4DU9A 1V9PA 4U68A 5FO9B 4HR7B 1A3UA 4QCLA 2E2JH 4C3IG 1M90C 1PV4A 1HXYD 1OXUA 5C5LA 2SEBD 4P71A 1XNQQ 1HA5A 1GO3E 1IKMA 5FOBB 1U5KA 2FHTA 1UE6A 2WIIB 5ELBA 3A7AB 4ZK9B 2OTLA 4KLKA 2NVXH 5JJZA 4A93H 3K5NA 1NE3A 5E7NA 4BY1H 1IYVA 4Y7NH 3FMCA 2R92G 1LTID 2UUBQ 2XWJB 2JA9A 1E1TA 1XWEA 4NP5A 1TWAB 4PZ8A 2MP1A 2ZJQA 1TQOA 4A3GH 2JK8A 4IZ8A 1ASZA 1KXLA 5FK9C 1C7YA 1ENAA 4FVMA 3OMCA 3Q24A 4X3UA 1U4LA 5IOCA 5EKLA 1V43A 4DR1Q 4CDEC 4HJ5A 4X62Q 1KNEA 1LTBD 1BBUA 1VQIA 4DUZQ 3GTLH 4BBRG 2Z4HA 4IFDI 1VQLA 5KYIA 3JAME 3H3VC 3PUZA 3Q8DA 1I4GA 3U4ZA 1MHWC 1OO9B 4L5QA 4C3HB 1L0XB 4KJOA 4UP9A 3GTMB 3URYA 1QNUA 2PCFB 2K04A 1K8AC 3S2DB 2RA4A 3G48A 5KNBA 4CKEA 3P20A 1I94L 2OEOA 4A3MG 1GUOA 1SNQA 1II3A 2TMPA 5FKAC 4CJ2C 1S5DD 2WKCA 4JC0A 3AB9A 2AWNA 2AMCB 3N6RA 2IY5B 4C3JH 1YNJD 4RGMA 1KRSA 3OWFA 1N9WA 3C1FA 3PMFA 1IL2A 2NVXB 2MO1A 3L7ZC 1MSHA 4JI4L 1TWGH 1DOLA 1DXMA 2E2HH 1JORA 3E6ZX 2QA4A 1BCPF 4IURA 4CKBA 4DR6L 1QJOA 1XMOQ 4ZUIA 1S5FD 2PW5A 5M5XB 1I4PA 3PIP3 3OTOL 2JYOA 2O2LD 4KHZA 2AKWB 2A5HA 1B8AA 1E3PA 2QKIC 1UE7A 3HOWB 4A3LG 1Q46A 2L55A 4ZRZA 1LUZA 1HNXL 1H9RA 3O13A 4PZ7A 5FLMH 4NW2A 4JBJA 1AE3A 4MTKA 2FMMA 3DM1A 2O4XA 1B3AA 4CDFC 4C2MH 4KKTA 4FF1A 1B4OA 1PH8A 3CPFA 1VQMA 1WD1A 4NMZA 1NCVA 3PO3H 5FLXc 4KN4C 5BR8L 2VB2X 3SHLA 5IYBH 1PYBA 5EKKA 1S72A 1WFQA 4RGNA 5E3FA 1N32Q 1TWFH 1JOOA 2VUMG 3CC7A 5IIFA 3PUVA 2F0LA 2CKZB 4GLAC 1PH5A 2PNRC 3LWUA 1K3BC 4LFAQ 4DKAC 2HHHL 5DEHA 5D3IB 4QY7A 4RAUC 2E75C 1EU3A 1V1OA 3I70A 2CQAA 2KUMA 2L1BA 2PQAB 2Z6BA 2X69A 2BOSA 1G51A 3OWEB 2I5LX 1G6PA 4R8IA 2I07B 3EVQA 4M1UB 3HOYH 1AZPA 4IOAA 1DM0B 2LS01 2EYFA 2ZM6L 3KDFB 1N8RC 3H91A 1D5ZC 2A73B 5FJ8G 1SMXA 4IUUA 1NR4A 1OTCA 3HGBA 3FVQA 3MC0B 3MVVA 3OYYA 4YHHL 1S5BD 4HJAA 5C4JB 3S1RH 3KLRA 1QVGA 3GV3A 3MXNB 4DAMA 3DEOA 4IUNA 2QEXA 2WAQB 2PZWA 1C0AA 4A3KH 2L15A 1U4PA 3K7AB 3A74A 1B3QA 4KI0A 1P16A 4GN5A 4TRDA 1WD0A 1ENFA 2PMZE 1CI3M 1IYJB 1CM9A 2M00A 3KK7A 3TRZA 3S1MB 2XGTA 1SE2A 2XTIA 3J7AV 3A7LA 1DONA 3M3YH 3T1YQ 3GV6A 3KF8B 5GAHC 2ZXRA 3GTOH 3EN2A 1CQFA 3GTKH 4CDCC 3D8GA 2D2CC 1FYCA 3DEPA 4XIGS 2UU9L 5M5WH 1HFNA 4KTAA 2NZHA 1Y1VH 3LNNA 4JI3L 4YWMA 3U58A 3I73A 5C4ZA 4AQYL 4B3RL 1Q3LA 2JA7B 3NSWA 4O1NA 2EDGA 1LTLA 2ASBA 5IWAQ 1UWVA 1HNWL 3S1QH 1E7ZA 1IBLQ 3C3LA 3ZYYX 2HT1A 2VQEQ 2PZUA 3HOVG 1H9SA 3D4DA 1PYSB 4P75A 1KL9A 1VMPA 1ONLA 4TQUS 1F9SA 1TS3A 1O7LA 2HQEA 4X66L 1B50A 3TP6A 2JA8G 4PMCA 1MD2D 4K5XA 4MHEA 2KCCA 4GKKL 1H9JA 5IE8A 1S5CD 4GN3B 1STEA 4L8JA 2JSOA 5C4XB 3MFGA 1EYGA 1YVCA 4CGYB 1FR3A 2RKSA 4N9PA 1HR0L 3LX0A 3D4WA 2Q2TA 2J7ZA 3HG9A 3A5ZB 1HZBA 3HOZG 4LF7Q 4LMQD 3FHWA 1STAA 3GTPH 4DR5Q 2IW3A 3CCSA 4Y52H 2D5DA 1VQ6A 5GQOA 2RSOA 3G7LA 5M5WB 3NTKA 2N55A 2GN5A 4UHVA 1HH2P 3DMUA 4LF6L 5A2QL 4UP7A 2ZJRA 4YY3L 5IGDA 2OTJA 3KLWA 2A19A 1F2YA 3QG1A 3I2ZA 1PTOF 4XQNA 3D6WA 2NTTA 5M5YH 5BN5A 1HNZL 3BZCA 1VQGA 4K8JA 2QILA 4PV1C 4P74A 5IGCA 3K0YA 2NN6I 5C44B 2CW0C 4JI4Q 3Q23A 2JEAI 5M3MG 2CFMA 1HHVA 4DNTB 1EQRA 2JXMB 1E1OA 3MWYW 2MJ8A 3HKZB 3I4NG 1PTOH 3A0JA 4HMIA 1QZHA 4NPSA 4JV5L 1VQFA 1PRTF 5IYCH 3QOJA 5DM73 1ZEQX 3TSSA 2JA6B 3JAMi 1UAPA 2ICIA 4KHPL 1O78A 1HNXQ 2ALYB 3AEVA 2Y0SB 1Q82C 2D0OA 4ZKBB 1XMQL 1CHQD 3HOUH 4RG1A 1CKOA 1BUVT 3CCUA 3STBC 4KD3A 1ML0D 2K05A 4EQPA 5GROA 1MKHA 5GADC 3RNUA 3K7UC 4HCEA 1K8OA 4Z9CB 4LFBQ 2N49A 5BR8Q 2UUCL 1D8LA 3FRPB 2PQAA 1QE6A 2C9OA 3TBIB 3Q0AA 2I5MX 4K6DA 2VQFQ 4A3JH 3HFZB 3PUWA 4JI2L 3T1HQ 4DR2Q 2NTSA 2ZXOA 1WCMG 4KV6A 3WOEA 4A3BH 3KDFA 4HTHA 3HOXH 3D31A 2RF4A 5I9OA 2A8VA 1DYQA 4OO1G 4JI7L 5D65A 3FPUB 1Z7TA 2R7ZB 4R8NA 2RDGA 5KRUA 5JOBA 3A55A 1VQAA 5IGEA 4ULLA 3VDYA 4ZQ3A 5DNFA 1LM0A 2SNMA 4K0KL 1A6XA 2UXDL 3KF6A 2VY3A 2ZM6Q 3E5SA 3S14H 1X56A 3PUXA 3PIO3 4ZUJA 4A3EB 1I6HB 1JOQA 2AQ3B 1LV9A 5IGBA 3BZDB 5HGTA 1LTGD 1XYIA 5CV7A 4HJ9A 2K03A 4QJFA 4BY7B 2ICEC 2FFKB 1TS5A 1TWCH 1FGBD 2LSSA 1MJCA 4NDXA 2F0VA 3J81j 4RHRA 4HJ8A 2F0EA 3H15A 4GKJQ 3H0GB 3KF8A 2ZXPA 3RZDH 1PXUA 4R9WA 2Q8RE 1HR0W 1I3QH 3S17H 2B63B 4RKBA 4Q5VA 1K83H 3C46A 4XQQA 3AFPA 2MO0A 1WTVA 2HCIA 3C2PA 1PYWD 3CD6A 3I8ZA 3RMHA 2DNCA 5IP9H 4PQXA 3GTQH 4OGQC 1SROA 4DR3L 1SJED 2KCNA 5C0XH 1IW7C 4QQBX 2LFNA 4DAPA 3J7YW 1QILA 4DV7L 4GZYC 3ER0A 1BXTA 5ELNA 5IY0A 2DUDA 4C3IH 4FXKC 1VQ4A 4OELB 3AFQA 4OEMB 2Z8LA 1EEID 3MXUA 1T5EA 1U4RA 3NWSA 3PGZA 3PO2H 1U9RA 1JB7A 4TSSA 2D0PA 1P8LA 2OCEA 2E2IH 3X3NA 1BVSA 1EQTA 5C3WA 1VQPA 2OWOA 2HDLA 4FYDA 2Q8TA 1HNWQ 4A3FB 2B8GA 2N88A 2R92H 1QUQA 1VQHA 3H94A 1K9MC 4G57A 3MA2B 1S3OA 5DM63 2NVYB 4KD4A 3KLSA 2IWHA 2K5DA 4BY7G 1IZ6A 1J5EQ 3I91A 4JYAL 1VQJA 4DV5Q 3ICEA 1Q8KA 1HUMA 2CWPA 1YNJC 1LT5D 4GKKQ 4BBRH 4YWKA 2NVQB 4HCSA 5IT9c 2AUJD 2DNEA 3BDCA 3VA7A 4X65Q 3QIAA 3U9OA 3S16B 4J8QA 2NYZD 1ZYRD 1MI2A 4A3IG 4A3MH 1JQYD 3J80L 3J7A5 2HDMA 4P2CB 4KHVA 1RHPA 4LF6Q 4IFDG 2H1EA 2RDHA 1ET9A 2CQOA 2GVAA 2B2UA 5C3EB 4OIJA 1SDFA 5J1ZA 2RHSB 2JA5G 1E24A 2ZT9C 1KABA 1ASYA 4OX9L 3RN2A 5BN4A 3J7ZC 4AIMA 4KN7C 1SYGA 4YCWA 5M9OA 4EQOA 1HQRD 1YEZA 3BVGA 4JI5L 4A4IA 5COYA 2K52A 1HFGA 1D1KA 5M3FG 3HEJA 1SJHD 4A3DB 4MNOA 1PH7A 1Y1WG 4POGA 3PQIA 1VQBA 4FF2A 5AJ3L 4A3LH 1OXXK 5IGGA 1BO0A 1D5MC 1WI5A 4K2KA 4KK7A 3SK6A 2E5LL 4CKCA 1QVFA 4C56C 5IGFA 1WTRA 4CJ1B 3PIPA 3CCEA 2F0TA 4NKLA 4JI1Q 1AW7A 4UP8A 2D9UA 4QUCA 3I4MH 3CCRA 2PZTA 2EQSA 3L0OA 2K01A 4YWLA 1OXVA 1XMQQ 1FNUA 2VUMH 5EGTA 1KLUD 4JI6Q 3F8TA 3NBHB 4AYBB 5I6WA 3RLOA 4DNRB 2IX3A 5ISRA 1IW7D 1GVPA 4FDBA 4MIUA 1EIHA 1L0YB 3P1HA 1I50H 4K2LA 4LFCL 2PO4A 1N36Q 4ZAIA 1VQDA 3T53B 4DV2Q 4JI2Q 4HSVA 3OOCA 1ILQA 1H9SB 1CKNA 2B2YA 1K3RA 1PFBA 2I46A 2L0CA 4ID6A 4J6HA 5C3EG 3J81L 2ES2A 1AFPA 1K0RA 3E0JA 2B2WC 4K5WA 2F0MA 5A2QE 1VQCA 4FXDA 1I5FA 4ZLTF 2UUAL 4JI7Q 2GVBA 5FJ8H 3D4RA 4A3DG 3RZOB 1Y8PB 4EVOA 3J7AF 1RD9D 3HKZE 2K5WA 4QIWB 3TP7A 1VQKA 4BWGB 1LT4D 1ILPA 2F4IA 4R4OA 2R93G 3L9AX 1K0SA 2E2JB 4K0KQ 4DA2A 1QZGA 4HIMA 3S1NH 3TREA 4BA2I 3UE1A 4DV3L 3I4OA 2Z4IA 4NXNQ 2EYMA 4BS9A 1EEFD 3EROA 1XXGA 3H3VH 3CQZH 1VQNA 1J9OA 4X6AH 4M8AA 1LTSD 4A75A 3E9HA 2WP8J 1JJ2A 2A6HC 5ELOA 3R8BA 3E9IA 4A93B 1OXTA 4K5VA 1AN8A 5CR3A 1WTPA 2F4VQ 4BY1B 4APVA 4Y7NB 2MPMA 4XYOA 2VZAA 1S4ZA 1SE4A 2JJQA 3TMEA 3HP3A 3J81c 4GN4B 2EPBA 3DHQA 3TP5A 4A3GB 5JVG3 1FD7D 4CHTB 4DR3Q 4JI0L 1TU2B 2LXKA 1S40A 5CV6A 5CBAE 1BCPC 2IX0A 2KHIA 4DV7Q 1TT2A 4HSPA 1FJGL 3F2UA 3GTLB 1Z6HA 3UI2A 4QMGA 4B3SL 1N33L 4DR4L 3PSIA 2RHQB 1U0LA 1N34L 1GUTA 3IRBA 3HOVH 1EZ6A 4WJ4A 4IJHA 1DZ1A 4C3HG 3ND9A 2G5DA 4B3TL 1JCKB 4B08A 2FMCA 1VF7A 2JA8H 2F0NA 1IKLA 2PQEA 2L9HA 1R4PB 4C3JB 4PZ6A 3EJIA 1X9NA 4G7ZC 3G6EA 4RMFA 4LF8Q 1QNKA 1TWGB 1XNRQ 1DCZA 4BXXG 5K5PA 2E2HB 2HQLA 2WFWA 1C48A 4QF4A 3CC4A 5LMNL 4JYAQ 1SNDA 5NUCA 1A8VA 3HOZH 1FVIA 1PZKD 3NTHA 4RWSC 3TS0A 1FGUA 1KDAA 4IPHA 4B9WA 4F87A 1BCPB 1X65A 2SOBA 2HIVA 1SE3A 3HOWG 3DWAA 4C2MB 2RDFA 3GDEA 4FNFA 2F0WA 1JICA 3GTJH 3KYHC 4DV4Q 5L37A 2QDBA 2YU9H 3U9SA 4N8X1 3PO3B 2EJGC 3UDIA 2F0PA 1GKHA 3KF6B 1K8MA 1KRTA 3OW7A 4LJZC 5G3LF 2ENBA 1G8ZD 2QEJC 2J0TD 5KNDA 3SGIA 1U4MA 5C4HA 3S2HH 1TWFB 4GLVB 2XSCA 2ATWA 5M3MH 3G71A 4OX9Q 3K80C 3NTIA 4XYQA 1W2BA 5IT9E 2KEEA 1PFNA 3I4NH 1STGA 1EY5A 1O7IA 2CHBD 3EIVA 4CJ0B 3OIQA 1EY4A 1SYFA 2VB3X 4X3KA 3PF5A 1Q81C 4DPGA 1EUJA 5FO8B 1CK1A 4C3JG 4CDDC 2NN6G 3EQLC 4RKLA 1GUWA 3VR5A 3BG3A 4MN3A 1PH6A 2E76C 2F3WA 3HOYB 1EY8A 2XNAC 3NBHA 3CW2C 1LACA 1Q90A 3CHBD 4B3ML 2A6HD 5KEEA 3OIPA 5EPLA 4O42A 4QGUA 2QCPX 1EIFA 2A69C 2Q2HA 2K14A 1E22A 3M4PA 1B53A 1Q1BA 1JOKA 2UXBL 3S1RB 2E74C 2PW7A 4MZ9A 4OONA 5CV5A 1JJCB 3W5OA 1I6VC 3DWPA 1VQ9A 4HN7A 1WCMH 4A3KB 1GHJA 2B2VA 3EFXD 1X6OA 5JEAH 2B2UC 1YJ9A 2K75A 1BCPD 2LMCB 1TY2A 3U4VA 3F2BA 2WAQG 4JCVE 5JAVA 4OWWB 3IL8A 2PNHA 5FO7B 1VQEA 1SMYD 1HZAA 4EGVA 1QUQB 1KLGD 1HZ9A 3AMUA 3D3RA 4RCOA 3IAYA 3M3YB 1CTMA 3GTOB 1SNCA 4EQ5A 3W2DA 3GTKB 2NUCA 4HJ7A 3V96A 4DV6L 1LTTD 1PFSA 2UUAQ 4PG3A 5CMDA 4LUOA 2F0GA 1YBYA 1M4VA 4G7OC 1WVLA 2J4XA 2QDLA 4QL5A 2RBMA 3M7NA 1SFOH 2I0QA 4H02A 5KIXA 3K0XA 1TY0A 1Y1VB 2CWAA 1XJVA 5I2YA 1RTOA 4H44C 1E2VA 3C1EA 4LF5L 1AP0A 1I94Q 2Z9HA 4IQZA 2TSSA 4DV3Q 3NPPA 3SDZA 4DXFA 3S1QB 1KDBA 1PLFA 2R3ZA 5LMNW 1CT1D 3DUZA 3ERQA 3PIOA 5EKIA 2RCFA 2JA7G 3SXHA 2L11A 4JVZA 1NMFA 1C4QA 5I4DA 2SDFA 4POFA 1NNXA 1KC8C 3K5MA 4JG2A 1TXYA 3QO2A 2N78A 1YHAA 1QWYA 3JAML 4AYBE 2L5TA 4DR6Q 3PCOB 1G2SA 2IJ0A 1R9TH 2CVRA 3OTOQ 5JEAJ 1IBKL 1GHKA 4IN3A 3TN2A 3S15H 4IUQA 2B2YC 1S5ED 4NXML 1LLRD 3BDLA 1T5XD 1EOTA 3NBIA 1UE5A 4RCNA 3NE5B 3NXWA 3BVMA 3FKIH 4QUFA 5C4XG 3MHBA 1L0WA 3GTPB 3IKJA 1TWHH 1SSOA 2WINB 4DF7A 1FJGQ 2F52A 1YI2A 5EPKA 1VDZA 2EJMA 4DR4Q 4G4KA 3TZUA 4XXEA 1N34Q 3D6CA 3AU7A 4GLXA 4QIWE 1HZCA 3J81E 1CHPD 3EBEA 1ESRA 1XNQL 2H5XA 3QOLA 1ZYRC 3KBXA 3F2DA 2RSNA 2NVTH 5M5YB 1D1IA 2V1CC 3KOJA 4B3TQ 4HMJA 4JPBW 4TKOB 3V05A 2HHHQ 2KJXA 1DGSA 1PH4A 1NMGA 2UUBL 2A68D 1CSQA 4FO2A 1RODA 2FINB 4IUTA 1IL8A 1Q1EA 2A69D 1PTOB 4R4IA 1JWUD 5C44G 3VYTA 4YCVA 1GJXA 1G6ZA 3H6MA 1CKNB 4BA1I 3HKZG 3PV0A 4A3IH 4GNXB 1WOCA 4DR1L 4X62L 2EJFC 2LKVA 2F03A 2CCZA 1SNPA 4DUZL 2F0DA 1EY7A 4UY8C 4IFDH 2VS1A 1RIPA 3T56B 2JA6G 3HOUB 1CZGA 4YHHQ 1PRTB 2JA5H 2AHOB 1B7YB 2F0IA 3LWEA 1X3PA 1SXTA 1E2ZA 2Y0SG 1E2WA 1KTKA 3BU2A 5CV8A 1EOVA 2F3IA 4BBSH 1E0BA 1EFWA 1Q12A 3T16A 1SBBB 5M3FH 2IPKD 1Y1WH 2K5NA 4A3JB 2N8NA 4O0AA 3A8IE 1K73C 4WRDA 4ZYSA 5ELDA 1GD7A 3PUYA 3P75A 2F0KA 3M4QA 4A3BB 4DGZA 1EZ8A 3HOXB 4A76A 3IFTA 2C5CA 4LUZA 1F9PA 3M7GA 2WB1B 1XMOL 1L1OB 4LF4L 2EXDA 1JR0D 1Q8IA 4IPGA 5TSSA 1JE5A 4J1MA 1A2TA 2HUGA 3AYHB 4KY5A 1HRJA 5H1SE 3CP0A 2UU9Q 3RLFA 3RR5A 1YNND 1I4HA 5DAUA 2R7ZG 1A15A 4XT3B 4K8IA 1PH9A 4JI3Q 4HIKA 3S14B 2F0JA 2C35B 2KQ3A 2KOLA 4AQYQ 4B3MQ 4B3RQ 5JJIA 2R6GA 1A2UA 1HTPA 2DGYA 1QCBD 1PTOD 4JK1C 3MEFA 1TWCB 5IP7G 4A3EG 2NB0A 1PFMA 1EIGA 1YJWA 4EQNA 3V2TA 3RZDB 5E4WC 5GAEC 3BZKA 2F0OA 2WAQE 4X66Q 1VQOA 1N32L 1STNA 2IT1A 3SEBA 1I3QB 1AEXA 3S17B 1YZ6A 4WFN3 1BR9A 5CC4A 3H0GG 2M2LA 1K83B 3MXPA 3ULLA 1PZID 3K81C 4FP5D 2Z6KA 2B63G 2HD3A 4AH6A 2OQ0A 3GTQB 3NQTA 2E2DC 1NR2A 3VA5A 2V4DA 1B70B 1HR0Q 3VR2A 4IUVA 2YV5A 2K5VA 4LWCA 3A8KE 2R93H 3CMAA 3M4OH 2MHVA 4XT1B 5CYUA 3KBGA 4R4CA 4JOIA 1NAPA 2IL8A 1O7YA 4C3IB 5C0XJ 3MXGA 4A3BG 1LT3D 5K36G 5J3BA 1SE8A 3HOXG 1EWHA 4LNQA 1O80A 2X6GA 2BDOA 2VW9A 1YHBA 2DJFC 5LL6S 2F1MA 1CA6A 3PO2B 4YY3Q 4ZCKA 2E2IB 4LF5Q 4IJLA 1JB3A 4IOCA 3DLLA 4XTCS 2R92B 1HNZQ 2OXPA 2ID0A 5GAGC 2EY5A 2JP1A 3L3OC 4JW0A 4A3FG 1RL2A 2KVMA 1XTCD 2MNAA 3MEHA 5T1GA 5HGQA 1Q86C 2XN9C 1TWAH 3I90A 3UE0A 5LMUL 1WYDA 2BA1A 1A0IA 5JJKA 4JV5Q 4UPAA 1IBKQ 3GQBA 2XRSD 4BBRB 4DV1L 2X6LA 4NXMQ 5IYDG 1QVCA 4DAYB 2B8FA 4PMBA 1XTDA 2EXZA 1MJEA 4KHPQ 3RN5A 3D0FA 4O2DA 4NB3A 1EWIA 3LGJA 3B6YA 2HCCA 3HZXA 3J80c 3ND8A 5ELFA 2B2TA 1UEBA 4DK0A 3CCVA 3OSOA 1HCZA 1SR3A 2AQ1B 4C3HH 4A3MB 2EZVA 3GTMH 4PMWA 5CORA 3S2DH 5EAYA 4FF3A 1EU4A 2R61A 2JN4A 3K58A 2KENA 4PNYA 2MGSA 2RQXA 1C9OA 4DV0L 3NUCA 2QW7A 5D14A 1RJTA 2EYLA 5IWAL 2R7DA 2I5HA 2UUCQ 4HIOA 1YHQA 1IBLL 1LTRD 1K28A 5CBEE 4BXXH 1HPCA 2VQEL 2BE5D 1ICFB 3CPWA 4S3SA 1X54A 4IUPA 4LW1A 2F0QA 4IALA 4IPDA 1K8GA 3PO2G 2HIXA 4H13C 3M4YA 2G9DA 1Z9FA 1X3QA 1HJPA 5EJWA 4GNXA 1FNWA 2B3GA 4LAAA 1LABA 4HEDA 2BDNA 1HUNA 1Y8OB 1KAAA 2OF1A 4OL7A 1WTXA 5M5XH 3Q6SA 1TVXA 1CQVA 1LYLA 3CMEA 1BOSA 1F2LA 1NY4A 1CKMA 4WJ3M 4DUYL 1F9QA 1MSGA 4QB4A 1QOHA 3BVZA 3HOWH 3CRKC 4DK1A 2UXDQ 5HY6A 1J8IA 1FL0A 4WJWA 1BDOA 3SR1A 4LF7L 2WACA 1A63A 2GA4B 1RDPD 4DR5L 3K5OA 1QB5D 3I4MB 4ODGA 3H09A 1EQVA 4DFAA 3J81i 2Y0SE 4A3CG 2Q2UA 3HKSA 1EY9A 1X3EA 2VUMB 5CV4A 3PF4A 3CKIB 3VYSA 1ZKOA 4N9TA 5FLXL 3VYUA 1L1OA 4R1JA 1W6KA 3FEWX 1BBWA 1X55A 5E4XA 1I50B 3U50C 1EQQA 2F0UA 4AYBG 4DK3C 1TR5A 2G9HD 5J22A 2NN6H 3UDGA 5T1IA 1GUNA 1NTGA 1B9MA 5C0XI 1SYEA 2H4OA 4L63B 3S24A 3R2TA 3M9BA 1VS0A 1ENCA 4LF4Q 1SMYC 1UNSA 1LT6D 5HURA 1JC7A 4K6LA 2A6ED 2KHSA 4J15A 4B9XA 3W3AA 3OMGA 4OWXB 2A74C 3RUZA 3GD7A 3E3XA 4UAIA 3VR6A 3T4AC 1IXRA 1BKBA 5J39A 4I7AA 2YYZA 3S1NB 1H95A 4C1NI 3L2PA 3I56A 3MAQA 3NP8A 3R93A 5C4JH 3BYTB 2WKDA 4X64L 1HTLD 3CQZB 1PA6A 4WORA 3BDOA 2BA0A 2BH8A 2KBNA 3I4MG 3A5UA 1ESFA 2K4KA 3K7AH 4LF9L 4LFBL 1NJIC 3MFYA 4R4QA 3GTGH 4RA8A 1J6QA 2VQFL 2XIWA 5JPNC
chains in the Genus database with same CATH topology
1SFOH 2I0QA 4H02A 3T1HL 4DR2L 3W1BA 1K83H 3K0XA 2CWAA 1XJVA 2E2JH 3AFPA 2MO0A 3S1MH 2A1AA 3CD6A 1M90C 4A93G 1PV4A 1OXUA 4LF5L 4BY1G 5IP9H 1L2FA 4P71A 1I94Q 3GTQH 4DV3Q 1SROA 4DR3L 3ZJYC 1XNQQ 1GO3E 2ZTDA 1U5KA 5LMNW 1UE6A 4QQBX 3PIOA 2OTLA 4DV7L 1KHIA 4KLKA 2JA7G 3ER0A 5ELNA 2NVXH 5IY0A 2DUDA 1NMFA 1X3GA 4C3IH 1PHJA 1VQ4A 4A3GG 3GO5A 3AFQA 4POFA 1XPUA 3S17H 1NE3A 4A93H 3CC2A 5E7NA 1KC8C 4BY1H 2WB1E 4JG2A 1TXYA 3CAMA 2N78A 4Y7NH 1YHAA 2R92G 4ALPA 2UUBQ 4DR6Q 4AYBE 3PCOB 2VNUD 2JA9A 1E1TA 1R9TH 3NEMA 2JA7H 3PGZA 3PO2H 3M7NA 4PZ8A 3OTOQ 5JEAJ 1IBKL 1JB7A 2ZJQA 2D0PA 1P8LA 2JK8A 2OCEA 2E2IH 4A3GH 3S15H 1BVSA 1ASZA 2OWOA 1VQPA 4NXML 1KXLA 1C7YA 1HNWQ 1UE5A 3K8AA 2R92H 1QUQA 1V1QA 1VQHA 1K9MC 1V43A 1WJJA 4GKJL 1S3OA 4DR1Q 4HJ5A 4X62Q 3FKIH 1BBUA 1VQIA 4DUZQ 5C4XG 1L0WA 3GTLH 4BBRG 4JI5Q 4BY7G 1T9HA 4IFDI 1IZ6A 1TWHH 1J5EQ 1VQLA 4GOPA 3PUZA 4JI8L 3Q8DA 2F52A 1YI2A 1FJGQ 2YTVA 3U4ZA 4L5QA 5AJ3Q 4JYAL 4UP9A 1VQJA 4DV5Q 3ICEA 4DR4Q 2MFIA 1AE2A 1KAWA 1Q8KA 1K8AC 3RLNA 2IHEA 3G48A 1N34Q 2CWPA 4R4TA 5LMUQ 4GLXA 4QIWE 1HZCA 4GKKQ 2PI2A 1I94L 3EBEA 5C4XH 2Z6KC 3DM3A 4A3MG 2E5LQ 2H5XA 4BBRH 1XNQL 4YWKA 1YJNA 3F2DA 2NVTH 4DV1Q 5IT9c 4JC0A 2V1CC 2AWNA 2AMCB 3KOJA 4B3TQ 2IY5B 4L5RC 3NENA 4C3JH 1KRSA 3ERSX 1N9WA 1IL2A 2MO1A 4OWTB 4X65Q 4JOIC 2HHHQ 3L7ZC 2JQOA 1DGSA 1PH4A 4JI4L 1TWGH 1NMGA 2E2HH 1SN8A 4A3IG 4A3MH 2QA4A 1YITA 1JT8A 2ZTCA 2RCNA 5FLMG 2OQKA 2UUBL 4DR6L 1CSQA 3J7A5 1XMOQ 1Q1EA 4LF6Q 3OTOL 4IFDG 4R4IA 2JE6I 5C44G 4KHZA 1PH3A 2AKWB 2CQOA 2GVAA 2IHFA 4YCVA 1B8AA 1KD1C 4DV0Q 1E3PA 3W1GA 2RHSB 1UE7A 1CKNB 1E24A 2JA5G 1ASYA 3PO3G 4BA1I 1Q46A 3HKZG 4LFCQ 3PV0A 4A3IH 3RN2A 4OX9L 4A3LG 1LUZA 1HNXL 4GNXB 4PZ7A 1WOCA 5FLMH 3J7ZC 4DR1L 4AIMA 3CXCA 4JBJA 1AE3A 4X62L 5IYBG 2CCZA 4YCWA 4DUZL 1YEZA 3I55A 4UY8C 2JEBI 2VS1A 1RIPA 4JI5L 4A4IA 4C2MH 2K52A 1J5EL 5C44H 5M3FG 4MNOA 1PH7A 1Y1WG 4POGA 1PH8A 3CPFA 4YHHQ 2JA6G 1VQBA 1VQMA 5AJ3L 2JA5H 2AHOB 1B7YB 4DV5L 3PO3H 4A3LH 1AH9A 2Y0SG 5FLXc 1OXXK 4TVAB 3BU2A 1EOVA 5BR8L 2F3IA 1WI5A 4BBSH 2KCTA 1PYBA 5IYBH 1Q12A 1EFWA 1S72A 1WFQA 4DUYQ 3OW2A 2E5LL 1QVFA 5JJLA 5M3FH 2NZOA 1IBML 4DR7L 1TWFH 1N32Q 1Y1WH 2JA6H 2K5NA 2VUMG 2N8NA 3CC7A 3PUVA 4O0AA 2CKZB 3PIPA 3CCEA 4JI1Q 1K73C 4LUVA 4GLAC 4UP8A 1PH5A 1GD7A 3I4MH 4LFAQ 4DKAC 4X65L 3CCRA 2HHHL 3HOYG 3PUYA 2EQSA 3L0OA 3M4QA 2YTXA 4QY7A 4YWLA 1YIJA 1OXVA 4A76A 1XMQQ 4LUZA 2VUMH 2PQAB 1XMOL 1L1OB 4LF4L 3H3VI 2EXDA 4IPGA 3M85A 1JE5A 1G51A 4JI6Q 1SLJA 2I5LX 3AYHB 3F8TA 3NBHB 5H1SE 1G6PA 3CP0A 3RLOA 3KJOA 1CUKA 2PI2E 2UU9Q 2BH2A 3HOYH 1GVPA 3RLFA 4FDBA 3RR5A 4P72A 4IOAA 2UXCL 2R7ZG 1I50H 4LFCL 2ZM6L 1N36Q 3KDFB 1N8RC 1PH9A 1VQDA 4DV2Q 4JI3Q 4JI2Q 5FJ8G 1SMXA 4HIKA 4A3KG 4AQYQ 2C35B 4B3MQ 4B3RQ 5JJIA 1PH2A 1CKNA 5C3EG 1K3RA 2R6GA 1OTCA 1W3SA 2ES2A 1VQ8A 1K0RA 3OYYA 4GNXC 4YHHL 1HR0W 3TS2A 4HJAA 2DGYA 3MEFA 1NBWA 3CCQA 3S1RH 4JI0Q 2R7ZH 1QVGA 1VQCA 3MXNB 5IP7G 4A3EG 1I5FA 3F1ZA 4DAMA 2UUAL 3JC66 2QEXA 4JI7Q 2GVBA 5FJ8H 3CCMA 1YJWA 1C0AA 1JJGA 4A3KH 2L15A 4GS3A 3A74A 4KI0A 1P16A 4GN5A 5GAEC 4A3DG 3BZKA 4B3SQ 1N33Q 2WAQE 2PMZE 4X66Q 3HKZE 1VQOA 2IT1A 1N32L 1VQKA 1YZ6A 1IYJB 2LXJA 3H0GG 4R4OA 2R93G 4JI1L 3ULLA 5IP7H 4A3EH 4K0KQ 3TRZA 1I6HH 3K81C 1QZGA 2XGTA 4HIMA 2XTIA 3TREA 3S1NH 3UE1A 4BA2I 4DV3L 3I4OA 4K0KL 2Z6KA 4BY7H 4NXNQ 2ZTEA 2B63G 4AH6A 3M3YH 2OQ0A 3ULJA 3T1YQ 1VQ5A 3KF8B 4IPCA 5GAHC 1Y1VG 3GTOH 3EN2A 3GTKH 3CQZH 1B70B 1HR0Q 1VQNA 3H3VH 2FXQA 4ME3A 4X64Q 2YV5A 2K5VA 4LWCA 3H0GH 2R93H 3CMAA 3M4OH 4X6AH 4JI6L 4A75A 3E9HA 1G291 2WP8J 4R4CA 2KHJA 4JOIA 4IO9A 1JJ2A 5C0XJ 4A3BG 5ELOA 4XIGS 3JAMc 2UU9L 3E9IA 5K36G 5J3BA 5M5WH 1OXTA 1SE8A 3HOXG 4LF9Q 4LNQA 1X3FA 2F4VQ 4APVA 2VW9A 1L1OC 2B63H 2K5HA 2NZHA 1N36L 1Y1VH 4DV2L 1YHBA 2VZAA 4JI3L 4YWMA 5LMNQ 1Z47A 2AWOA 2JJQA 3U58A 4AQYL 3J81c 4B3RL 4GN4B 4YY3Q 1LTLA 2ASBA 5IWAQ 1UWVA 4LF5Q 1HNWL 5JEAG 4IJLA 3S1QH 1E7ZA 1IBLQ 2QGQA 4DR3Q 4JI0L 2LXKA 4IOCA 2HT1A 3DLLA 2VQEQ 1S40A 4XTCS 4EX5A 3HOVG 1PYSB 2IX0A 2KHIA 4OXPA 4P75A 2ID0A 1KL9A 5GAGC 4DV7Q 1HNZQ 3UDFA 3E0EA 1SRUA 4A3FG 1FJGL 4TQUS 4B3SL 1N33L 4X66L 1RL2A 2MNAA 4DR4L 3PSIA 1Q86C 5HGQA 2RHQB 2JA8G 1U0LA 2UXDL 3KJPA 1UE1A 1TWAH 1N34L 3UE0A 2K50A 3IRBA 5LMUL 1WYDA 4YCUA 4GKKL 3HOVH 5IE8A 4WJ4A 2BA1A 1A0IA 4IJHA 5JJKA 4GN3B 4JV5Q 4NXNL 4UPAA 1IBKQ 4A3FH 1EYGA 4DV1L 1YVCA 4NXMQ 4L5TA 2VL6A 5IYDG 1QVCA 1HR0L 4DAYB 4B3TL 1XTDA 1MJEA 2Q2TA 2JA8H 4KHPQ 2NVYH 3RN5A 3D0FA 4O2DA 3A5ZB 1HZBA 3HOZG 2YTYA 4LF7Q 2EIFA 3FHWA 4NB3A 4PZ6A 3GTPH 4DR5Q 1EWIA 1KIXA 3B6YA 3LGJA 3J80c 3CCSA 1X9NA 4Y52H 1VCIA 1UEBA 3CCVA 1XPRA 2F4VL 1VQ6A 3G6EA 4RMFA 5GQOA 4LF8Q 4BXXG 1XNRQ 2HQLA 1SR3A 2GN5A 2WFWA 4C3HH 1HH2P 4JI8Q 3GTMH 1M1KC 4PMWA 5IYDH 3CC4A 4LF6L 5LMNL 3S2DH 5EAYA 4UP7A 4MTNA 4JYAQ 2ZJRA 3FP9A 2KENA 4YY3L 4HIDA 1A8VA 3KLWA 4DV0L 1C9OA 2A19A 1FVIA 3HOZH 2OTJA 5IWAL 2R7DA 2I5HA 2UUCQ 4HIOA 1YHQA 1IBLL 2Q2IA 1VQ7A 3TS0A 3I2ZA 2NVQH 4BXXH 5M5YH 2VQEL 1FGUA 3CCLA 4IPHA 3CCJA 3CPWA 1X54A 3UDXA 4LW1A 1HNZL 4IPDA 3BZCA 1K8GA 3PO2G 2HIXA 5IYCG 1VQGA 1X65A 2HIVA 3S16H 4P74A 1Z9FA 1EIYB 1HJPA 3HOWG 4GNXA 3CF5A 2NN6I 2B3GA 3GDEA 4JI4Q 2JEAI 3GTJH 3KYHC 5M3MG 4DV4Q 2CFMA 2YU9H 2UXBQ 1EQRA 4IFDJ 1E1OA 2MQHA 5M5XH 3UDIA 3I4NG 1GKHA 3A0JA 3FKIG 1LYLA 3KF6B 3CMEA 1NY4A 4WJ3M 1CKMA 1QZHA 4DUYL 4NPSA 1KRTA 2ZJPA 1VQFA 5IYCH 3HOUG 5C3EH 2D62A 3ULPA 4JV5L 4P73A 3HOWH 4L5SA 3SGIA 3S2HH 3KFUA 4GLVB 3JAMi 2ATWA 5M3MH 4DK6C 5HY6A 3G71A 4KHPL 4OX9Q 2UXDQ 1FL0A 3K80C 4OO1I 1HNXQ 1W2BA 4LFAL 2ALYB 3AEVA 4LF7L 1A63A 3I4NH 4DR5L 1Q82C 1KQSA 2D0OA 1O7IA 3EIVA 1XMQL 4A3DH 1A62A 2N3SA 4RG1A 4A3JG 4LF8L 3HOUH 1XNRL 3J81i 1CKOA 3CCUA 2Y0SE 3PF5A 4GOPC 5DLQE 1Q81C 2Q2UA 2IX1A 4A3CG 3STBC 4DPGA 1OXSC 3HKSA 1EUJA 1X3EA 5GROA 1MKHA 3NELA 5GADC 3K7UC 3RNUA 4DV6Q 3PF4A 2NN6G 4LFBQ 3BJUA 2N49A 5BR8Q 1PH6A 2UUCL 1D8LA 4DNIA 2PQAA 1L1OA 4R1JA 3WWVA 2VQFL 2I5MX 2VQFQ 2B29A 2WB1G 3STBD 1PH1A 1BBWA 4A3JH 1X55A 3HFZB 3CW2C 3PUWA 3U50C 4DR2Q 3T1HQ 1IBMQ 4JI2L 4DR7Q 4A3CH 1EQQA 4B3ML 4AYBG 3TQYA 4DK3C 4JBKA 1WCMG 4QGUA 1MIUA 4JBMA 2Z0SA 1EIFA 4A3BH 3KDFA 2Q2HA 2KCMA 1D7QA 3HOXH 2K14A 3UDGA 1E22A 3D31A 3M4PA 1Q1BA 2RF4A 2UXBL 2A8VA 4DV4L 4OO1G 4JI7L 1NTGA 5C0XI 4MZ9A 4OONA 1JJCB 3S24A 3M9BA 3W5OA 3G4SA 1VS0A 4LF4Q 1PVOA 1VQ9A 1WCMH 1CSPA 1VQAA 1GM5A 1X6OA 2R7FA 1XPOA 3F2CA 1YJ9A 1Q7YC 4J15A 3I7FA 2K75A 3VDYA 2UXCQ 4OWXB 1LM0A 3U4VA 3F2BA 3J80i 2WAQG 3GD7A 2VY3A 3KF6A 4JCVE 2ZM6Q 4OWWB 3S14H 1IXRA 1BKBA 1VQEA 1X56A 1HZAA 1Y14B 2PNHA 3PUXA 1QUQB 2YYZA 4BBSG 1H95A 1HZ9A 1YNXA 3AQQA 3L2PA 3I56A 4HJ9A 3T1YL 4QJFA 5C4JH 4X64L 1TWCH 2LSSA 4EQ5A 4GOPB 1MJCA 3J81j 2E8GA 4HJ7A 1PA6A 4HJ8A 2BA0A 2BH8A 3H15A 4GKJQ 4DV6L 3TEHB 1JMCA 2KBNA 1PFSA 5IP9G 2UUAQ 3A5UA 3K7AH 2K4KA 4LF9L 4PG3A 3RZDH 3I4MG 4LFBL 4LUOA 4JBWA 1YBYA 1NJIC 3RZOH 4R4QA 3GTGH 4QL5A 1J6QA 5C0XG 1V9PA 1I3QH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFO H;  2I0Q A;  4H02 A;  3T1H L;  4DR2 L;  3W1B A;  1K83 H;  3K0X A;  2CWA A;  1XJV A;  2E2J H;  3AFP A;  2MO0 A;  3S1M H;  2A1A A;  3CD6 A;  1M90 C;  4A93 G;  1PV4 A;  1OXU A;  4LF5 L;  4BY1 G;  5IP9 H;  1L2F A;  4P71 A;  1I94 Q;  3GTQ H;  4DV3 Q;  1SRO A;  4DR3 L;  3ZJY C;  1XNQ Q;  1GO3 E;  2ZTD A;  1U5K A;  5LMN W;  1UE6 A;  4QQB X;  3PIO A;  2OTL A;  4DV7 L;  1KHI A;  4KLK A;  2JA7 G;  3ER0 A;  5ELN A;  2NVX H;  5IY0 A;  2DUD A;  1NMF A;  1X3G A;  4C3I H;  1PHJ A;  1VQ4 A;  4A3G G;  3GO5 A;  3AFQ A;  4POF A;  1XPU A;  3S17 H;  1NE3 A;  4A93 H;  3CC2 A;  5E7N A;  1KC8 C;  4BY1 H;  2WB1 E;  4JG2 A;  1TXY A;  3CAM A;  2N78 A;  4Y7N H;  1YHA A;  2R92 G;  4ALP A;  2UUB Q;  4DR6 Q;  4AYB E;  3PCO B;  2VNU D;  2JA9 A;  1E1T A;  1R9T H;  3NEM A;  2JA7 H;  3PGZ A;  3PO2 H;  3M7N A;  4PZ8 A;  3OTO Q;  5JEA J;  1IBK L;  1JB7 A;  2ZJQ A;  2D0P A;  1P8L A;  2JK8 A;  2OCE A;  2E2I H;  4A3G H;  3S15 H;  1BVS A;  1ASZ A;  2OWO A;  1VQP A;  4NXM L;  1KXL A;  1C7Y A;  1HNW Q;  1UE5 A;  3K8A A;  2R92 H;  1QUQ A;  1V1Q A;  1VQH A;  1K9M C;  1V43 A;  1WJJ A;  4GKJ L;  1S3O A;  4DR1 Q;  4HJ5 A;  4X62 Q;  3FKI H;  1BBU A;  1VQI A;  4DUZ Q;  5C4X G;  1L0W A;  3GTL H;  4BBR G;  4JI5 Q;  4BY7 G;  1T9H A;  4IFD I;  1IZ6 A;  1TWH H;  1J5E Q;  1VQL A;  4GOP A;  3PUZ A;  4JI8 L;  3Q8D A;  2F52 A;  1YI2 A;  1FJG Q;  2YTV A;  3U4Z A;  4L5Q A;  5AJ3 Q;  4JYA L;  4UP9 A;  1VQJ A;  4DV5 Q;  3ICE A;  4DR4 Q;  2MFI A;  1AE2 A;  1KAW A;  1Q8K A;  1K8A C;  3RLN A;  2IHE A;  3G48 A;  1N34 Q;  2CWP A;  4R4T A;  5LMU Q;  4GLX A;  4QIW E;  1HZC A;  4GKK Q;  2PI2 A;  1I94 L;  3EBE A;  5C4X H;  2Z6K C;  3DM3 A;  4A3M G;  2E5L Q;  2H5X A;  4BBR H;  1XNQ L;  4YWK A;  1YJN A;  3F2D A;  2NVT H;  4DV1 Q;  5IT9 c;  4JC0 A;  2V1C C;  2AWN A;  2AMC B;  3KOJ A;  4B3T Q;  2IY5 B;  4L5R C;  3NEN A;  4C3J H;  1KRS A;  3ERS X;  1N9W A;  1IL2 A;  2MO1 A;  4OWT B;  4X65 Q;  4JOI C;  2HHH Q;  3L7Z C;  2JQO A;  1DGS A;  1PH4 A;  4JI4 L;  1TWG H;  1NMG A;  2E2H H;  1SN8 A;  4A3I G;  4A3M H;  2QA4 A;  1YIT A;  1JT8 A;  2ZTC A;  2RCN A;  5FLM G;  2OQK A;  2UUB L;  4DR6 L;  1CSQ A;  3J7A 5;  1XMO Q;  1Q1E A;  4LF6 Q;  3OTO L;  4IFD G;  4R4I A;  2JE6 I;  5C44 G;  4KHZ A;  1PH3 A;  2AKW B;  2CQO A;  2GVA A;  2IHF A;  4YCV A;  1B8A A;  1KD1 C;  4DV0 Q;  1E3P A;  3W1G A;  2RHS B;  1UE7 A;  1CKN B;  1E24 A;  2JA5 G;  1ASY A;  3PO3 G;  4BA1 I;  1Q46 A;  3HKZ G;  4LFC Q;  3PV0 A;  4A3I H;  3RN2 A;  4OX9 L;  4A3L G;  1LUZ A;  1HNX L;  4GNX B;  4PZ7 A;  1WOC A;  5FLM H;  3J7Z C;  4DR1 L;  4AIM A;  3CXC A;  4JBJ A;  1AE3 A;  4X62 L;  5IYB G;  2CCZ A;  4YCW A;  4DUZ L;  1YEZ A;  3I55 A;  4UY8 C;  2JEB I;  2VS1 A;  1RIP A;  4JI5 L;  4A4I A;  4C2M H;  2K52 A;  1J5E L;  5C44 H;  5M3F G;  4MNO A;  1PH7 A;  1Y1W G;  4POG A;  1PH8 A;  3CPF A;  4YHH Q;  2JA6 G;  1VQB A;  1VQM A;  5AJ3 L;  2JA5 H;  2AHO B;  1B7Y B;  4DV5 L;  3PO3 H;  4A3L H;  1AH9 A;  2Y0S G;  5FLX c;  1OXX K;  4TVA B;  3BU2 A;  1EOV A;  5BR8 L;  2F3I A;  1WI5 A;  4BBS H;  2KCT A;  1PYB A;  5IYB H;  1Q12 A;  1EFW A;  1S72 A;  1WFQ A;  4DUY Q;  3OW2 A;  2E5L L;  1QVF A;  5JJL A;  5M3F H;  2NZO A;  1IBM L;  4DR7 L;  1TWF H;  1N32 Q;  1Y1W H;  2JA6 H;  2K5N A;  2VUM G;  2N8N A;  3CC7 A;  3PUV A;  4O0A A;  2CKZ B;  3PIP A;  3CCE A;  4JI1 Q;  1K73 C;  4LUV A;  4GLA C;  4UP8 A;  1PH5 A;  1GD7 A;  3I4M H;  4LFA Q;  4DKA C;  4X65 L;  3CCR A;  2HHH L;  3HOY G;  3PUY A;  2EQS A;  3L0O A;  3M4Q A;  2YTX A;  4QY7 A;  4YWL A;  1YIJ A;  1OXV A;  4A76 A;  1XMQ Q;  4LUZ A;  2VUM H;  2PQA B;  1XMO L;  1L1O B;  4LF4 L;  3H3V I;  2EXD A;  4IPG A;  3M85 A;  1JE5 A;  1G51 A;  4JI6 Q;  1SLJ A;  2I5L X;  3AYH B;  3F8T A;  3NBH B;  5H1S E;  1G6P A;  3CP0 A;  3RLO A;  3KJO A;  1CUK A;  2PI2 E;  2UU9 Q;  2BH2 A;  3HOY H;  1GVP A;  3RLF A;  4FDB A;  3RR5 A;  4P72 A;  4IOA A;  2UXC L;  2R7Z G;  1I50 H;  4LFC L;  2ZM6 L;  1N36 Q;  3KDF B;  1N8R C;  1PH9 A;  1VQD A;  4DV2 Q;  4JI3 Q;  4JI2 Q;  5FJ8 G;  1SMX A;  4HIK A;  4A3K G;  4AQY Q;  2C35 B;  4B3M Q;  4B3R Q;  5JJI A;  1PH2 A;  1CKN A;  5C3E G;  1K3R A;  2R6G A;  1OTC A;  1W3S A;  2ES2 A;  1VQ8 A;  1K0R A;  3OYY A;  4GNX C;  4YHH L;  1HR0 W;  3TS2 A;  4HJA A;  2DGY A;  3MEF A;  1NBW A;  3CCQ A;  3S1R H;  4JI0 Q;  2R7Z H;  1QVG A;  1VQC A;  3MXN B;  5IP7 G;  4A3E G;  1I5F A;  3F1Z A;  4DAM A;  2UUA L;  3JC6 6;  2QEX A;  4JI7 Q;  2GVB A;  5FJ8 H;  3CCM A;  1YJW A;  1C0A A;  1JJG A;  4A3K H;  2L15 A;  4GS3 A;  3A74 A;  4KI0 A;  1P16 A;  4GN5 A;  5GAE C;  4A3D G;  3BZK A;  4B3S Q;  1N33 Q;  2WAQ E;  2PMZ E;  4X66 Q;  3HKZ E;  1VQO A;  2IT1 A;  1N32 L;  1VQK A;  1YZ6 A;  1IYJ B;  2LXJ A;  3H0G G;  4R4O A;  2R93 G;  4JI1 L;  3ULL A;  5IP7 H;  4A3E H;  4K0K Q;  3TRZ A;  1I6H H;  3K81 C;  1QZG A;  2XGT A;  4HIM A;  2XTI A;  3TRE A;  3S1N H;  3UE1 A;  4BA2 I;  4DV3 L;  3I4O A;  4K0K L;  2Z6K A;  4BY7 H;  4NXN Q;  2ZTE A;  2B63 G;  4AH6 A;  3M3Y H;  2OQ0 A;  3ULJ A;  3T1Y Q;  1VQ5 A;  3KF8 B;  4IPC A;  5GAH C;  1Y1V G;  3GTO H;  3EN2 A;  3GTK H;  3CQZ H;  1B70 B;  1HR0 Q;  1VQN A;  3H3V H;  2FXQ A;  4ME3 A;  4X64 Q;  2YV5 A;  2K5V A;  4LWC A;  3H0G H;  2R93 H;  3CMA A;  3M4O H;  4X6A H;  4JI6 L;  4A75 A;  3E9H A;  1G29 1;  2WP8 J;  4R4C A;  2KHJ A;  4JOI A;  4IO9 A;  1JJ2 A;  5C0X J;  4A3B G;  5ELO A;  4XIG S;  3JAM c;  2UU9 L;  3E9I A;  5K36 G;  5J3B A;  5M5W H;  1OXT A;  1SE8 A;  3HOX G;  4LF9 Q;  4LNQ A;  1X3F A;  2F4V Q;  4APV A;  2VW9 A;  1L1O C;  2B63 H;  2K5H A;  2NZH A;  1N36 L;  1Y1V H;  4DV2 L;  1YHB A;  2VZA A;  4JI3 L;  4YWM A;  5LMN Q;  1Z47 A;  2AWO A;  2JJQ A;  3U58 A;  4AQY L;  3J81 c;  4B3R L;  4GN4 B;  4YY3 Q;  1LTL A;  2ASB A;  5IWA Q;  1UWV A;  4LF5 Q;  1HNW L;  5JEA G;  4IJL A;  3S1Q H;  1E7Z A;  1IBL Q;  2QGQ A;  4DR3 Q;  4JI0 L;  2LXK A;  4IOC A;  2HT1 A;  3DLL A;  2VQE Q;  1S40 A;  4XTC S;  4EX5 A;  3HOV G;  1PYS B;  2IX0 A;  2KHI A;  4OXP A;  4P75 A;  2ID0 A;  1KL9 A;  5GAG C;  4DV7 Q;  1HNZ Q;  3UDF A;  3E0E A;  1SRU A;  4A3F G;  1FJG L;  4TQU S;  4B3S L;  1N33 L;  4X66 L;  1RL2 A;  2MNA A;  4DR4 L;  3PSI A;  1Q86 C;  5HGQ A;  2RHQ B;  2JA8 G;  1U0L A;  2UXD L;  3KJP A;  1UE1 A;  1TWA H;  1N34 L;  3UE0 A;  2K50 A;  3IRB A;  5LMU L;  1WYD A;  4YCU A;  4GKK L;  3HOV H;  5IE8 A;  4WJ4 A;  2BA1 A;  1A0I A;  4IJH A;  5JJK A;  4GN3 B;  4JV5 Q;  4NXN L;  4UPA A;  1IBK Q;  4A3F H;  1EYG A;  4DV1 L;  1YVC A;  4NXM Q;  4L5T A;  2VL6 A;  5IYD G;  1QVC A;  1HR0 L;  4DAY B;  4B3T L;  1XTD A;  1MJE A;  2Q2T A;  2JA8 H;  4KHP Q;  2NVY H;  3RN5 A;  3D0F A;  4O2D A;  3A5Z B;  1HZB A;  3HOZ G;  2YTY A;  4LF7 Q;  2EIF A;  3FHW A;  4NB3 A;  4PZ6 A;  3GTP H;  4DR5 Q;  1EWI A;  1KIX A;  3B6Y A;  3LGJ A;  3J80 c;  3CCS A;  1X9N A;  4Y52 H;  1VCI A;  1UEB A;  3CCV A;  1XPR A;  2F4V L;  1VQ6 A;  3G6E A;  4RMF A;  5GQO A;  4LF8 Q;  4BXX G;  1XNR Q;  2HQL A;  1SR3 A;  2GN5 A;  2WFW A;  4C3H H;  1HH2 P;  4JI8 Q;  3GTM H;  1M1K C;  4PMW A;  5IYD H;  3CC4 A;  4LF6 L;  5LMN L;  3S2D H;  5EAY A;  4UP7 A;  4MTN A;  4JYA Q;  2ZJR A;  3FP9 A;  2KEN A;  4YY3 L;  4HID A;  1A8V A;  3KLW A;  4DV0 L;  1C9O A;  2A19 A;  1FVI A;  3HOZ H;  2OTJ A;  5IWA L;  2R7D A;  2I5H A;  2UUC Q;  4HIO A;  1YHQ A;  1IBL L;  2Q2I A;  1VQ7 A;  3TS0 A;  3I2Z A;  2NVQ H;  4BXX H;  5M5Y H;  2VQE L;  1FGU A;  3CCL A;  4IPH A;  3CCJ A;  3CPW A;  1X54 A;  3UDX A;  4LW1 A;  1HNZ L;  4IPD A;  3BZC A;  1K8G A;  3PO2 G;  2HIX A;  5IYC G;  1VQG A;  1X65 A;  2HIV A;  3S16 H;  4P74 A;  1Z9F A;  1EIY B;  1HJP A;  3HOW G;  4GNX A;  3CF5 A;  2NN6 I;  2B3G A;  3GDE A;  4JI4 Q;  2JEA I;  3GTJ H;  3KYH C;  5M3M G;  4DV4 Q;  2CFM A;  2YU9 H;  2UXB Q;  1EQR A;  4IFD J;  1E1O A;  2MQH A;  5M5X H;  3UDI A;  3I4N G;  1GKH A;  3A0J A;  3FKI G;  1LYL A;  3KF6 B;  3CME A;  1NY4 A;  4WJ3 M;  1CKM A;  1QZH A;  4DUY L;  4NPS A;  1KRT A;  2ZJP A;  1VQF A;  5IYC H;  3HOU G;  5C3E H;  2D62 A;  3ULP A;  4JV5 L;  4P73 A;  3HOW H;  4L5S A;  3SGI A;  3S2H H;  3KFU A;  4GLV B;  3JAM i;  2ATW A;  5M3M H;  4DK6 C;  5HY6 A;  3G71 A;  4KHP L;  4OX9 Q;  2UXD Q;  1FL0 A;  3K80 C;  4OO1 I;  1HNX Q;  1W2B A;  4LFA L;  2ALY B;  3AEV A;  4LF7 L;  1A63 A;  3I4N H;  4DR5 L;  1Q82 C;  1KQS A;  2D0O A;  1O7I A;  3EIV A;  1XMQ L;  4A3D H;  1A62 A;  2N3S A;  4RG1 A;  4A3J G;  4LF8 L;  3HOU H;  1XNR L;  3J81 i;  1CKO A;  3CCU A;  2Y0S E;  3PF5 A;  4GOP C;  5DLQ E;  1Q81 C;  2Q2U A;  2IX1 A;  4A3C G;  3STB C;  4DPG A;  1OXS C;  3HKS A;  1EUJ A;  1X3E A;  5GRO A;  1MKH A;  3NEL A;  5GAD C;  3K7U C;  3RNU A;  4DV6 Q;  3PF4 A;  2NN6 G;  4LFB Q;  3BJU A;  2N49 A;  5BR8 Q;  1PH6 A;  2UUC L;  1D8L A;  4DNI A;  2PQA A;  1L1O A;  4R1J A;  3WWV A;  2VQF L;  2I5M X;  2VQF Q;  2B29 A;  2WB1 G;  3STB D;  1PH1 A;  1BBW A;  4A3J H;  1X55 A;  3HFZ B;  3CW2 C;  3PUW A;  3U50 C;  4DR2 Q;  3T1H Q;  1IBM Q;  4JI2 L;  4DR7 Q;  4A3C H;  1EQQ A;  4B3M L;  4AYB G;  3TQY A;  4DK3 C;  4JBK A;  1WCM G;  4QGU A;  1MIU A;  4JBM A;  2Z0S A;  1EIF A;  4A3B H;  3KDF A;  2Q2H A;  2KCM A;  1D7Q A;  3HOX H;  2K14 A;  3UDG A;  1E22 A;  3D31 A;  3M4P A;  1Q1B A;  2RF4 A;  2UXB L;  2A8V A;  4DV4 L;  4OO1 G;  4JI7 L;  1NTG A;  5C0X I;  4MZ9 A;  4OON A;  1JJC B;  3S24 A;  3M9B A;  3W5O A;  3G4S A;  1VS0 A;  4LF4 Q;  1PVO A;  1VQ9 A;  1WCM H;  1CSP A;  1VQA A;  1GM5 A;  1X6O A;  2R7F A;  1XPO A;  3F2C A;  1YJ9 A;  1Q7Y C;  4J15 A;  3I7F A;  2K75 A;  3VDY A;  2UXC Q;  4OWX B;  1LM0 A;  3U4V A;  3F2B A;  3J80 i;  2WAQ G;  3GD7 A;  2VY3 A;  3KF6 A;  4JCV E;  2ZM6 Q;  4OWW B;  3S14 H;  1IXR A;  1BKB A;  1VQE A;  1X56 A;  1HZA A;  1Y14 B;  2PNH A;  3PUX A;  1QUQ B;  2YYZ A;  4BBS G;  1H95 A;  1HZ9 A;  1YNX A;  3AQQ A;  3L2P A;  3I56 A;  4HJ9 A;  3T1Y L;  4QJF A;  5C4J H;  4X64 L;  1TWC H;  2LSS A;  4EQ5 A;  4GOP B;  1MJC A;  3J81 j;  2E8G A;  4HJ7 A;  1PA6 A;  4HJ8 A;  2BA0 A;  2BH8 A;  3H15 A;  4GKJ Q;  4DV6 L;  3TEH B;  1JMC A;  2KBN A;  1PFS A;  5IP9 G;  2UUA Q;  3A5U A;  3K7A H;  2K4K A;  4LF9 L;  4PG3 A;  3RZD H;  3I4M G;  4LFB L;  4LUO A;  4JBW A;  1YBY A;  1NJI C;  3RZO H;  4R4Q A;  3GTG H;  4QL5 A;  1J6Q A;  5C0X G;  1V9P A;  1I3Q H; 
#chains in the Genus database with same CATH topology
 3T1H L;  4DR2 L;  3W1B A;  5EQ0 A;  5EPJ A;  3S1M H;  1EYD A;  2A1A A;  2F3V A;  1V1P A;  4A93 G;  2EYO A;  1KDC A;  2KEC A;  4BY1 G;  1B2T A;  3CRL C;  1SYD A;  1L2F A;  3CU7 A;  1RTN A;  3ZJY C;  3I3C A;  2ZTD A;  4V19 0;  3SE0 A;  4XQJ A;  2O5I C;  1KHI A;  1NUC A;  1D6E C;  4KY6 A;  1BNZ A;  2XRQ D;  4RGT A;  1X3G A;  1PHJ A;  4A3G G;  3GO5 A;  2EY6 A;  1XPU A;  2EYH A;  3CC2 A;  5CV9 A;  2WB1 E;  1H9M A;  3CAM A;  2F0S A;  1DOK A;  4ALP A;  2LY7 A;  2VNU D;  1X32 A;  1VF5 C;  3NEM A;  5BN3 A;  2JA7 H;  1H9K A;  4KY7 A;  3HOV B;  1EFI D;  4HAE A;  3K8A A;  1V1Q A;  1TS2 A;  2XWB B;  1WJJ A;  4GKJ L;  2JA8 B;  4RHS A;  3IFD A;  1I4X A;  4DAY A;  1T9H A;  1F2Z A;  4JI5 Q;  1STB A;  4GOP A;  3GP7 A;  4JI8 L;  4FXG C;  1SYC A;  1IYU A;  2YTV A;  3GTG B;  1SNO A;  3BYY B;  5KNC A;  5AJ3 Q;  2F0H A;  1D2B A;  2MFI A;  4H7B A;  1AE2 A;  1KAW A;  3A8J E;  3RLN A;  1WTH A;  2IHE A;  4R4T A;  5LMU Q;  2PI2 A;  3HOZ B;  5C4X H;  3VYR A;  2Z6K C;  3DM3 A;  2E5L Q;  3QR8 A;  1YJN A;  4DV1 Q;  2A68 C;  4L5R C;  3NEN A;  4I65 A;  3ERS X;  3S9W A;  4OWT B;  4JOI C;  2JQO A;  4Q0F A;  1SN8 A;  2NZ1 D;  1YIT A;  1JT8 A;  2ZTC A;  2RCN A;  5FLM G;  2OQK A;  2PPB C;  3GTJ B;  1CZW A;  3QWN A;  2YU9 B;  2EVB A;  2K33 A;  3R3O A;  4RGO S;  1PDQ A;  2K7V A;  2JE6 I;  1PH3 A;  2RVL A;  2IHF A;  1KD1 C;  3SK5 A;  4DV0 Q;  3MTS A;  4G7H C;  3W1G A;  4OO1 H;  3PO3 G;  4LFC Q;  3VR3 A;  1NSN S;  3S2H B;  1SYB A;  4DN4 M;  5I6Y A;  1XX8 A;  5M3M B;  3CXC A;  2FJ2 A;  1EL0 A;  5IYB G;  3I55 A;  3I4N B;  2JEB I;  1BF4 A;  1DJR D;  1J5E L;  5C44 H;  5KYL A;  3SVM A;  3J80 E;  4DV5 L;  1AH9 A;  3DWQ A;  1CFM A;  1EWC A;  2K1B A;  4TVA B;  5EBC A;  5EBD A;  1B9N A;  2KCT A;  3A54 A;  3T13 A;  4DUY Q;  3OW2 A;  3QJY A;  3HS0 C;  5JJL A;  1IBM L;  2NZO A;  4DR7 L;  2JA6 H;  4V0B A;  3I72 A;  5KGU A;  2VXW A;  4DAV A;  4LUV A;  1STH A;  4X65 L;  3HOY G;  2DY8 A;  2YTX A;  2BCO A;  1YIJ A;  2B2T C;  2Z1C A;  5E1F A;  1YNN C;  1WTQ A;  1STY A;  3H3V I;  3M85 A;  2EYJ A;  1SLJ A;  1LO5 D;  1GUG A;  3KJO A;  1CUK A;  1WCM B;  2PI2 E;  2BH2 A;  4P72 A;  2UXC L;  3WOF A;  1A3V A;  1PTO C;  3ITP A;  3TZD A;  4A3K G;  2M9V A;  1PH2 A;  1W3S A;  1VQ8 A;  3TS2 A;  4GNX C;  3OHX C;  4KKS A;  1EY0 A;  2B2W A;  3K5L A;  1NBW A;  3CCQ A;  4JI0 Q;  2R7Z H;  1WTO A;  4FF4 A;  3F1Z A;  3JC6 6;  3WDN A;  3CCM A;  1B1Z A;  2WV6 D;  1JJG A;  2SNS A;  4GS3 A;  1PRT C;  1CA5 A;  3X3M A;  1ZXT A;  4B3S Q;  1N33 Q;  3K6O A;  2QF7 A;  2MUY A;  1SFO B;  2LXJ A;  3K59 A;  2AQ2 B;  4JI1 L;  5IP7 H;  4CBV A;  4A3E H;  1I6H H;  4LK1 C;  4N8F A;  4RFB A;  4X3S A;  3OPO A;  5G3L D;  1HA6 A;  4BY7 H;  2ZTE A;  3ULJ A;  1VQ5 A;  4IPC A;  2DY7 A;  1Y1V G;  2FXQ A;  4ME3 A;  5IOD A;  4X64 Q;  1DD2 A;  3H0G H;  1EY6 A;  1RCV D;  2OT2 A;  4JI6 L;  1G29 1;  4IO9 A;  2KHJ A;  1TKW B;  3JAM c;  4ABN A;  4LF9 Q;  1PZJ D;  1X3F A;  2B63 H;  1L1O C;  2K5H A;  1N36 L;  4DV2 L;  5LMN Q;  1Z47 A;  2AWO A;  1R9T B;  4F7X A;  3I4L A;  2K28 A;  4KKU A;  4OIK A;  3G6J B;  2L4N A;  4X3T A;  3VR4 A;  1UEA B;  5JEA G;  3S15 B;  2O5J C;  5K36 H;  2AUK A;  2QGQ A;  1DOM A;  5F2D A;  4EX5 A;  3QB3 A;  4DXG A;  4OXP A;  1W6J A;  3FKI B;  3UDF A;  2L12 A;  3E0E A;  4K14 A;  5FLX E;  1SRU A;  1TII D;  1PMR A;  4E6I A;  1KNA A;  1TWH B;  3MXN A;  2Q8I B;  3BS1 A;  3N52 A;  1AZQ A;  2PYK A;  3KJP A;  1UE1 A;  1IHZ A;  2K50 A;  3MZ5 A;  4YCU A;  1TS4 A;  2EY1 A;  5JVH 3;  4NXN L;  4A3F H;  4L5T A;  2VL6 A;  5C6A A;  3K57 A;  2NVT B;  2NVY H;  4OHJ A;  5LHY 1;  2YTY A;  2EIF A;  2K32 A;  1KIX A;  2F0F A;  1HQM C;  5D3D A;  1G91 A;  1VCI A;  1XPR A;  3Q22 A;  2F4V L;  1O7Z A;  4RH6 A;  3NWT A;  1MBY A;  1R4Q B;  4JI8 Q;  1M1K C;  5IYD H;  2BE5 C;  4MTN A;  3FP9 A;  4HID A;  3A56 A;  2CH4 W;  5ELE A;  2K5Q A;  1GXD C;  2NWG A;  2Q2I A;  3NK9 A;  3R2I A;  1VQ7 A;  4U67 3;  2NVQ H;  2XVS A;  3CCL A;  3CCJ A;  4A3I B;  3UDX A;  1F2M A;  1F9R A;  5IYC G;  1JWS D;  1GUS A;  3S16 H;  5IT9 L;  5JPM C;  1EIY B;  5A35 A;  3CF5 A;  1QG7 A;  2EOT A;  2UXB Q;  4I7Z C;  4IFD J;  2JA5 B;  2MQH A;  2PMZ B;  3SK8 A;  4XDX A;  2P5Z X;  3FKI G;  3FDT A;  1D5X C;  1LTA D;  2ZJP A;  3HOU G;  4BBS B;  5C3E H;  2D62 A;  1VMC A;  3ULP A;  1UUP A;  2CW0 D;  4P73 A;  4L5S A;  5M3F B;  3KFU A;  1Y1W B;  4KMU C;  4DK6 C;  4OO1 I;  4LFA L;  1BQQ T;  1PRT D;  2NBF A;  5ELC A;  1KQS A;  5LL6 X;  3ONA B;  3FPP A;  4A3D H;  1A3T A;  1A62 A;  2N3S A;  3KLS X;  4A3J G;  4LF8 L;  1XNR L;  1SAP A;  2IX1 A;  4GOP C;  5DLQ E;  1MGS A;  1OXS C;  4L6T B;  3NEL A;  4DV6 Q;  1EYA A;  3EA6 A;  1RF2 D;  3BJU A;  3SK4 A;  1V1P B;  4DNI A;  5I2X A;  3WWV A;  2B29 A;  4F8M A;  2WB1 G;  3STB D;  1PH1 A;  4C1N K;  4YIJ A;  2DJG C;  1IBM Q;  4A3C H;  4DR7 Q;  2EE1 A;  1ICW A;  3RD4 A;  3TDQ A;  3TQY A;  4UDU C;  1F77 A;  2EY2 A;  4ZKC B;  4JBK A;  5I9P A;  1MIU A;  4JBM A;  2Z0S A;  5C5M A;  2KCM A;  1D7Q A;  1SNM A;  2CH4 A;  3NQI A;  1JE4 A;  2A6E C;  4ILW A;  4DV4 L;  4ME5 A;  3NHH A;  1WTW A;  5C3X A;  3G4S A;  3P7J A;  5CGK A;  1PVO A;  1Y69 U;  1CSP A;  2B2V C;  1G2T A;  1GM5 A;  2EYP A;  2R7F A;  1M8A A;  2B39 A;  1XPO A;  3F2C A;  1Q7Y C;  3I7F A;  2UXC Q;  3J80 i;  1I4R A;  2DN8 A;  1RKN A;  1Y14 B;  1C8C A;  1Y8N B;  4KJN A;  2KED A;  5AFW A;  1BBX C;  4BBS G;  2K6A A;  4F88 A;  1YNX A;  3AQQ A;  3T1Y L;  1GOZ A;  1EYC A;  1SEB D;  3T51 B;  3KUP A;  4GOP B;  3HRZ C;  3TP8 A;  2KA7 A;  1JWM D;  2E8G A;  1B44 D;  3TEH B;  1JMC A;  3M4O B;  2R93 B;  1ET6 A;  1V8Q A;  3DXJ C;  5IP9 G;  4H0L C;  3RZO H;  4JBW A;  1FNV A;  1I4Q A;  5C0X G;  4DU9 A;  1V9P A;  4U68 A;  5FO9 B;  4HR7 B;  1A3U A;  4QCL A;  2E2J H;  4C3I G;  1M90 C;  1PV4 A;  1HXY D;  1OXU A;  5C5L A;  2SEB D;  4P71 A;  1XNQ Q;  1HA5 A;  1GO3 E;  1IKM A;  5FOB B;  1U5K A;  2FHT A;  1UE6 A;  2WII B;  5ELB A;  3A7A B;  4ZK9 B;  2OTL A;  4KLK A;  2NVX H;  5JJZ A;  4A93 H;  3K5N A;  1NE3 A;  5E7N A;  4BY1 H;  1IYV A;  4Y7N H;  3FMC A;  2R92 G;  1LTI D;  2UUB Q;  2XWJ B;  2JA9 A;  1E1T A;  1XWE A;  4NP5 A;  1TWA B;  4PZ8 A;  2MP1 A;  2ZJQ A;  1TQO A;  4A3G H;  2JK8 A;  4IZ8 A;  1ASZ A;  1KXL A;  5FK9 C;  1C7Y A;  1ENA A;  4FVM A;  3OMC A;  3Q24 A;  4X3U A;  1U4L A;  5IOC A;  5EKL A;  1V43 A;  4DR1 Q;  4CDE C;  4HJ5 A;  4X62 Q;  1KNE A;  1LTB D;  1BBU A;  1VQI A;  4DUZ Q;  3GTL H;  4BBR G;  2Z4H A;  4IFD I;  1VQL A;  5KYI A;  3JAM E;  3H3V C;  3PUZ A;  3Q8D A;  1I4G A;  3U4Z A;  1MHW C;  1OO9 B;  4L5Q A;  4C3H B;  1L0X B;  4KJO A;  4UP9 A;  3GTM B;  3URY A;  1QNU A;  2PCF B;  2K04 A;  1K8A C;  3S2D B;  2RA4 A;  3G48 A;  5KNB A;  4CKE A;  3P20 A;  1I94 L;  2OEO A;  4A3M G;  1GUO A;  1SNQ A;  1II3 A;  2TMP A;  5FKA C;  4CJ2 C;  1S5D D;  2WKC A;  4JC0 A;  3AB9 A;  2AWN A;  2AMC B;  3N6R A;  2IY5 B;  4C3J H;  1YNJ D;  4RGM A;  1KRS A;  3OWF A;  1N9W A;  3C1F A;  3PMF A;  1IL2 A;  2NVX B;  2MO1 A;  3L7Z C;  1MSH A;  4JI4 L;  1TWG H;  1DOL A;  1DXM A;  2E2H H;  1JOR A;  3E6Z X;  2QA4 A;  1BCP F;  4IUR A;  4CKB A;  4DR6 L;  1QJO A;  1XMO Q;  4ZUI A;  1S5F D;  2PW5 A;  5M5X B;  1I4P A;  3PIP 3;  3OTO L;  2JYO A;  2O2L D;  4KHZ A;  2AKW B;  2A5H A;  1B8A A;  1E3P A;  2QKI C;  1UE7 A;  3HOW B;  4A3L G;  1Q46 A;  2L55 A;  4ZRZ A;  1LUZ A;  1HNX L;  1H9R A;  3O13 A;  4PZ7 A;  5FLM H;  4NW2 A;  4JBJ A;  1AE3 A;  4MTK A;  2FMM A;  3DM1 A;  2O4X A;  1B3A A;  4CDF C;  4C2M H;  4KKT A;  4FF1 A;  1B4O A;  1PH8 A;  3CPF A;  1VQM A;  1WD1 A;  4NMZ A;  1NCV A;  3PO3 H;  5FLX c;  4KN4 C;  5BR8 L;  2VB2 X;  3SHL A;  5IYB H;  1PYB A;  5EKK A;  1S72 A;  1WFQ A;  4RGN A;  5E3F A;  1N32 Q;  1TWF H;  1JOO A;  2VUM G;  3CC7 A;  5IIF A;  3PUV A;  2F0L A;  2CKZ B;  4GLA C;  1PH5 A;  2PNR C;  3LWU A;  1K3B C;  4LFA Q;  4DKA C;  2HHH L;  5DEH A;  5D3I B;  4QY7 A;  4RAU C;  2E75 C;  1EU3 A;  1V1O A;  3I70 A;  2CQA A;  2KUM A;  2L1B A;  2PQA B;  2Z6B A;  2X69 A;  2BOS A;  1G51 A;  3OWE B;  2I5L X;  1G6P A;  4R8I A;  2I07 B;  3EVQ A;  4M1U B;  3HOY H;  1AZP A;  4IOA A;  1DM0 B;  2LS0 1;  2EYF A;  2ZM6 L;  3KDF B;  1N8R C;  3H91 A;  1D5Z C;  2A73 B;  5FJ8 G;  1SMX A;  4IUU A;  1NR4 A;  1OTC A;  3HGB A;  3FVQ A;  3MC0 B;  3MVV A;  3OYY A;  4YHH L;  1S5B D;  4HJA A;  5C4J B;  3S1R H;  3KLR A;  1QVG A;  3GV3 A;  3MXN B;  4DAM A;  3DEO A;  4IUN A;  2QEX A;  2WAQ B;  2PZW A;  1C0A A;  4A3K H;  2L15 A;  1U4P A;  3K7A B;  3A74 A;  1B3Q A;  4KI0 A;  1P16 A;  4GN5 A;  4TRD A;  1WD0 A;  1ENF A;  2PMZ E;  1CI3 M;  1IYJ B;  1CM9 A;  2M00 A;  3KK7 A;  3TRZ A;  3S1M B;  2XGT A;  1SE2 A;  2XTI A;  3J7A V;  3A7L A;  1DON A;  3M3Y H;  3T1Y Q;  3GV6 A;  3KF8 B;  5GAH C;  2ZXR A;  3GTO H;  3EN2 A;  1CQF A;  3GTK H;  4CDC C;  3D8G A;  2D2C C;  1FYC A;  3DEP A;  4XIG S;  2UU9 L;  5M5W H;  1HFN A;  4KTA A;  2NZH A;  1Y1V H;  3LNN A;  4JI3 L;  4YWM A;  3U58 A;  3I73 A;  5C4Z A;  4AQY L;  4B3R L;  1Q3L A;  2JA7 B;  3NSW A;  4O1N A;  2EDG A;  1LTL A;  2ASB A;  5IWA Q;  1UWV A;  1HNW L;  3S1Q H;  1E7Z A;  1IBL Q;  3C3L A;  3ZYY X;  2HT1 A;  2VQE Q;  2PZU A;  3HOV G;  1H9S A;  3D4D A;  1PYS B;  4P75 A;  1KL9 A;  1VMP A;  1ONL A;  4TQU S;  1F9S A;  1TS3 A;  1O7L A;  2HQE A;  4X66 L;  1B50 A;  3TP6 A;  2JA8 G;  4PMC A;  1MD2 D;  4K5X A;  4MHE A;  2KCC A;  4GKK L;  1H9J A;  5IE8 A;  1S5C D;  4GN3 B;  1STE A;  4L8J A;  2JSO A;  5C4X B;  3MFG A;  1EYG A;  1YVC A;  4CGY B;  1FR3 A;  2RKS A;  4N9P A;  1HR0 L;  3LX0 A;  3D4W A;  2Q2T A;  2J7Z A;  3HG9 A;  3A5Z B;  1HZB A;  3HOZ G;  4LF7 Q;  4LMQ D;  3FHW A;  1STA A;  3GTP H;  4DR5 Q;  2IW3 A;  3CCS A;  4Y52 H;  2D5D A;  1VQ6 A;  5GQO A;  2RSO A;  3G7L A;  5M5W B;  3NTK A;  2N55 A;  2GN5 A;  4UHV A;  1HH2 P;  3DMU A;  4LF6 L;  5A2Q L;  4UP7 A;  2ZJR A;  4YY3 L;  5IGD A;  2OTJ A;  3KLW A;  2A19 A;  1F2Y A;  3QG1 A;  3I2Z A;  1PTO F;  4XQN A;  3D6W A;  2NTT A;  5M5Y H;  5BN5 A;  1HNZ L;  3BZC A;  1VQG A;  4K8J A;  2QIL A;  4PV1 C;  4P74 A;  5IGC A;  3K0Y A;  2NN6 I;  5C44 B;  2CW0 C;  4JI4 Q;  3Q23 A;  2JEA I;  5M3M G;  2CFM A;  1HHV A;  4DNT B;  1EQR A;  2JXM B;  1E1O A;  3MWY W;  2MJ8 A;  3HKZ B;  3I4N G;  1PTO H;  3A0J A;  4HMI A;  1QZH A;  4NPS A;  4JV5 L;  1VQF A;  1PRT F;  5IYC H;  3QOJ A;  5DM7 3;  1ZEQ X;  3TSS A;  2JA6 B;  3JAM i;  1UAP A;  2ICI A;  4KHP L;  1O78 A;  1HNX Q;  2ALY B;  3AEV A;  2Y0S B;  1Q82 C;  2D0O A;  4ZKB B;  1XMQ L;  1CHQ D;  3HOU H;  4RG1 A;  1CKO A;  1BUV T;  3CCU A;  3STB C;  4KD3 A;  1ML0 D;  2K05 A;  4EQP A;  5GRO A;  1MKH A;  5GAD C;  3RNU A;  3K7U C;  4HCE A;  1K8O A;  4Z9C B;  4LFB Q;  2N49 A;  5BR8 Q;  2UUC L;  1D8L A;  3FRP B;  2PQA A;  1QE6 A;  2C9O A;  3TBI B;  3Q0A A;  2I5M X;  4K6D A;  2VQF Q;  4A3J H;  3HFZ B;  3PUW A;  4JI2 L;  3T1H Q;  4DR2 Q;  2NTS A;  2ZXO A;  1WCM G;  4KV6 A;  3WOE A;  4A3B H;  3KDF A;  4HTH A;  3HOX H;  3D31 A;  2RF4 A;  5I9O A;  2A8V A;  1DYQ A;  4OO1 G;  4JI7 L;  5D65 A;  3FPU B;  1Z7T A;  2R7Z B;  4R8N A;  2RDG A;  5KRU A;  5JOB A;  3A55 A;  1VQA A;  5IGE A;  4ULL A;  3VDY A;  4ZQ3 A;  5DNF A;  1LM0 A;  2SNM A;  4K0K L;  1A6X A;  2UXD L;  3KF6 A;  2VY3 A;  2ZM6 Q;  3E5S A;  3S14 H;  1X56 A;  3PUX A;  3PIO 3;  4ZUJ A;  4A3E B;  1I6H B;  1JOQ A;  2AQ3 B;  1LV9 A;  5IGB A;  3BZD B;  5HGT A;  1LTG D;  1XYI A;  5CV7 A;  4HJ9 A;  2K03 A;  4QJF A;  4BY7 B;  2ICE C;  2FFK B;  1TS5 A;  1TWC H;  1FGB D;  2LSS A;  1MJC A;  4NDX A;  2F0V A;  3J81 j;  4RHR A;  4HJ8 A;  2F0E A;  3H15 A;  4GKJ Q;  3H0G B;  3KF8 A;  2ZXP A;  3RZD H;  1PXU A;  4R9W A;  2Q8R E;  1HR0 W;  1I3Q H;  3S17 H;  2B63 B;  4RKB A;  4Q5V A;  1K83 H;  3C46 A;  4XQQ A;  3AFP A;  2MO0 A;  1WTV A;  2HCI A;  3C2P A;  1PYW D;  3CD6 A;  3I8Z A;  3RMH A;  2DNC A;  5IP9 H;  4PQX A;  3GTQ H;  4OGQ C;  1SRO A;  4DR3 L;  1SJE D;  2KCN A;  5C0X H;  1IW7 C;  4QQB X;  2LFN A;  4DAP A;  3J7Y W;  1QIL A;  4DV7 L;  4GZY C;  3ER0 A;  1BXT A;  5ELN A;  5IY0 A;  2DUD A;  4C3I H;  4FXK C;  1VQ4 A;  4OEL B;  3AFQ A;  4OEM B;  2Z8L A;  1EEI D;  3MXU A;  1T5E A;  1U4R A;  3NWS A;  3PGZ A;  3PO2 H;  1U9R A;  1JB7 A;  4TSS A;  2D0P A;  1P8L A;  2OCE A;  2E2I H;  3X3N A;  1BVS A;  1EQT A;  5C3W A;  1VQP A;  2OWO A;  2HDL A;  4FYD A;  2Q8T A;  1HNW Q;  4A3F B;  2B8G A;  2N88 A;  2R92 H;  1QUQ A;  1VQH A;  3H94 A;  1K9M C;  4G57 A;  3MA2 B;  1S3O A;  5DM6 3;  2NVY B;  4KD4 A;  3KLS A;  2IWH A;  2K5D A;  4BY7 G;  1IZ6 A;  1J5E Q;  3I91 A;  4JYA L;  1VQJ A;  4DV5 Q;  3ICE A;  1Q8K A;  1HUM A;  2CWP A;  1YNJ C;  1LT5 D;  4GKK Q;  4BBR H;  4YWK A;  2NVQ B;  4HCS A;  5IT9 c;  2AUJ D;  2DNE A;  3BDC A;  3VA7 A;  4X65 Q;  3QIA A;  3U9O A;  3S16 B;  4J8Q A;  2NYZ D;  1ZYR D;  1MI2 A;  4A3I G;  4A3M H;  1JQY D;  3J80 L;  3J7A 5;  2HDM A;  4P2C B;  4KHV A;  1RHP A;  4LF6 Q;  4IFD G;  2H1E A;  2RDH A;  1ET9 A;  2CQO A;  2GVA A;  2B2U A;  5C3E B;  4OIJ A;  1SDF A;  5J1Z A;  2RHS B;  2JA5 G;  1E24 A;  2ZT9 C;  1KAB A;  1ASY A;  4OX9 L;  3RN2 A;  5BN4 A;  3J7Z C;  4AIM A;  4KN7 C;  1SYG A;  4YCW A;  5M9O A;  4EQO A;  1HQR D;  1YEZ A;  3BVG A;  4JI5 L;  4A4I A;  5COY A;  2K52 A;  1HFG A;  1D1K A;  5M3F G;  3HEJ A;  1SJH D;  4A3D B;  4MNO A;  1PH7 A;  1Y1W G;  4POG A;  3PQI A;  1VQB A;  4FF2 A;  5AJ3 L;  4A3L H;  1OXX K;  5IGG A;  1BO0 A;  1D5M C;  1WI5 A;  4K2K A;  4KK7 A;  3SK6 A;  2E5L L;  4CKC A;  1QVF A;  4C56 C;  5IGF A;  1WTR A;  4CJ1 B;  3PIP A;  3CCE A;  2F0T A;  4NKL A;  4JI1 Q;  1AW7 A;  4UP8 A;  2D9U A;  4QUC A;  3I4M H;  3CCR A;  2PZT A;  2EQS A;  3L0O A;  2K01 A;  4YWL A;  1OXV A;  1XMQ Q;  1FNU A;  2VUM H;  5EGT A;  1KLU D;  4JI6 Q;  3F8T A;  3NBH B;  4AYB B;  5I6W A;  3RLO A;  4DNR B;  2IX3 A;  5ISR A;  1IW7 D;  1GVP A;  4FDB A;  4MIU A;  1EIH A;  1L0Y B;  3P1H A;  1I50 H;  4K2L A;  4LFC L;  2PO4 A;  1N36 Q;  4ZAI A;  1VQD A;  3T53 B;  4DV2 Q;  4JI2 Q;  4HSV A;  3OOC A;  1ILQ A;  1H9S B;  1CKN A;  2B2Y A;  1K3R A;  1PFB A;  2I46 A;  2L0C A;  4ID6 A;  4J6H A;  5C3E G;  3J81 L;  2ES2 A;  1AFP A;  1K0R A;  3E0J A;  2B2W C;  4K5W A;  2F0M A;  5A2Q E;  1VQC A;  4FXD A;  1I5F A;  4ZLT F;  2UUA L;  4JI7 Q;  2GVB A;  5FJ8 H;  3D4R A;  4A3D G;  3RZO B;  1Y8P B;  4EVO A;  3J7A F;  1RD9 D;  3HKZ E;  2K5W A;  4QIW B;  3TP7 A;  1VQK A;  4BWG B;  1LT4 D;  1ILP A;  2F4I A;  4R4O A;  2R93 G;  3L9A X;  1K0S A;  2E2J B;  4K0K Q;  4DA2 A;  1QZG A;  4HIM A;  3S1N H;  3TRE A;  4BA2 I;  3UE1 A;  4DV3 L;  3I4O A;  2Z4I A;  4NXN Q;  2EYM A;  4BS9 A;  1EEF D;  3ERO A;  1XXG A;  3H3V H;  3CQZ H;  1VQN A;  1J9O A;  4X6A H;  4M8A A;  1LTS D;  4A75 A;  3E9H A;  2WP8 J;  1JJ2 A;  2A6H C;  5ELO A;  3R8B A;  3E9I A;  4A93 B;  1OXT A;  4K5V A;  1AN8 A;  5CR3 A;  1WTP A;  2F4V Q;  4BY1 B;  4APV A;  4Y7N B;  2MPM A;  4XYO A;  2VZA A;  1S4Z A;  1SE4 A;  2JJQ A;  3TME A;  3HP3 A;  3J81 c;  4GN4 B;  2EPB A;  3DHQ A;  3TP5 A;  4A3G B;  5JVG 3;  1FD7 D;  4CHT B;  4DR3 Q;  4JI0 L;  1TU2 B;  2LXK A;  1S40 A;  5CV6 A;  5CBA E;  1BCP C;  2IX0 A;  2KHI A;  4DV7 Q;  1TT2 A;  4HSP A;  1FJG L;  3F2U A;  3GTL B;  1Z6H A;  3UI2 A;  4QMG A;  4B3S L;  1N33 L;  4DR4 L;  3PSI A;  2RHQ B;  1U0L A;  1N34 L;  1GUT A;  3IRB A;  3HOV H;  1EZ6 A;  4WJ4 A;  4IJH A;  1DZ1 A;  4C3H G;  3ND9 A;  2G5D A;  4B3T L;  1JCK B;  4B08 A;  2FMC A;  1VF7 A;  2JA8 H;  2F0N A;  1IKL A;  2PQE A;  2L9H A;  1R4P B;  4C3J B;  4PZ6 A;  3EJI A;  1X9N A;  4G7Z C;  3G6E A;  4RMF A;  4LF8 Q;  1QNK A;  1TWG B;  1XNR Q;  1DCZ A;  4BXX G;  5K5P A;  2E2H B;  2HQL A;  2WFW A;  1C48 A;  4QF4 A;  3CC4 A;  5LMN L;  4JYA Q;  1SND A;  5NUC A;  1A8V A;  3HOZ H;  1FVI A;  1PZK D;  3NTH A;  4RWS C;  3TS0 A;  1FGU A;  1KDA A;  4IPH A;  4B9W A;  4F87 A;  1BCP B;  1X65 A;  2SOB A;  2HIV A;  1SE3 A;  3HOW G;  3DWA A;  4C2M B;  2RDF A;  3GDE A;  4FNF A;  2F0W A;  1JIC A;  3GTJ H;  3KYH C;  4DV4 Q;  5L37 A;  2QDB A;  2YU9 H;  3U9S A;  4N8X 1;  3PO3 B;  2EJG C;  3UDI A;  2F0P A;  1GKH A;  3KF6 B;  1K8M A;  1KRT A;  3OW7 A;  4LJZ C;  5G3L F;  2ENB A;  1G8Z D;  2QEJ C;  2J0T D;  5KND A;  3SGI A;  1U4M A;  5C4H A;  3S2H H;  1TWF B;  4GLV B;  2XSC A;  2ATW A;  5M3M H;  3G71 A;  4OX9 Q;  3K80 C;  3NTI A;  4XYQ A;  1W2B A;  5IT9 E;  2KEE A;  1PFN A;  3I4N H;  1STG A;  1EY5 A;  1O7I A;  2CHB D;  3EIV A;  4CJ0 B;  3OIQ A;  1EY4 A;  1SYF A;  2VB3 X;  4X3K A;  3PF5 A;  1Q81 C;  4DPG A;  1EUJ A;  5FO8 B;  1CK1 A;  4C3J G;  4CDD C;  2NN6 G;  3EQL C;  4RKL A;  1GUW A;  3VR5 A;  3BG3 A;  4MN3 A;  1PH6 A;  2E76 C;  2F3W A;  3HOY B;  1EY8 A;  2XNA C;  3NBH A;  3CW2 C;  1LAC A;  1Q90 A;  3CHB D;  4B3M L;  2A6H D;  5KEE A;  3OIP A;  5EPL A;  4O42 A;  4QGU A;  2QCP X;  1EIF A;  2A69 C;  2Q2H A;  2K14 A;  1E22 A;  3M4P A;  1B53 A;  1Q1B A;  1JOK A;  2UXB L;  3S1R B;  2E74 C;  2PW7 A;  4MZ9 A;  4OON A;  5CV5 A;  1JJC B;  3W5O A;  1I6V C;  3DWP A;  1VQ9 A;  4HN7 A;  1WCM H;  4A3K B;  1GHJ A;  2B2V A;  3EFX D;  1X6O A;  5JEA H;  2B2U C;  1YJ9 A;  2K75 A;  1BCP D;  2LMC B;  1TY2 A;  3U4V A;  3F2B A;  2WAQ G;  4JCV E;  5JAV A;  4OWW B;  3IL8 A;  2PNH A;  5FO7 B;  1VQE A;  1SMY D;  1HZA A;  4EGV A;  1QUQ B;  1KLG D;  1HZ9 A;  3AMU A;  3D3R A;  4RCO A;  3IAY A;  3M3Y B;  1CTM A;  3GTO B;  1SNC A;  4EQ5 A;  3W2D A;  3GTK B;  2NUC A;  4HJ7 A;  3V96 A;  4DV6 L;  1LTT D;  1PFS A;  2UUA Q;  4PG3 A;  5CMD A;  4LUO A;  2F0G A;  1YBY A;  1M4V A;  4G7O C;  1WVL A;  2J4X A;  2QDL A;  4QL5 A;  2RBM A;  3M7N A;  1SFO H;  2I0Q A;  4H02 A;  5KIX A;  3K0X A;  1TY0 A;  1Y1V B;  2CWA A;  1XJV A;  5I2Y A;  1RTO A;  4H44 C;  1E2V A;  3C1E A;  4LF5 L;  1AP0 A;  1I94 Q;  2Z9H A;  4IQZ A;  2TSS A;  4DV3 Q;  3NPP A;  3SDZ A;  4DXF A;  3S1Q B;  1KDB A;  1PLF A;  2R3Z A;  5LMN W;  1CT1 D;  3DUZ A;  3ERQ A;  3PIO A;  5EKI A;  2RCF A;  2JA7 G;  3SXH A;  2L11 A;  4JVZ A;  1NMF A;  1C4Q A;  5I4D A;  2SDF A;  4POF A;  1NNX A;  1KC8 C;  3K5M A;  4JG2 A;  1TXY A;  3QO2 A;  2N78 A;  1YHA A;  1QWY A;  3JAM L;  4AYB E;  2L5T A;  4DR6 Q;  3PCO B;  1G2S A;  2IJ0 A;  1R9T H;  2CVR A;  3OTO Q;  5JEA J;  1IBK L;  1GHK A;  4IN3 A;  3TN2 A;  3S15 H;  4IUQ A;  2B2Y C;  1S5E D;  4NXM L;  1LLR D;  3BDL A;  1T5X D;  1EOT A;  3NBI A;  1UE5 A;  4RCN A;  3NE5 B;  3NXW A;  3BVM A;  3FKI H;  4QUF A;  5C4X G;  3MHB A;  1L0W A;  3GTP B;  3IKJ A;  1TWH H;  1SSO A;  2WIN B;  4DF7 A;  1FJG Q;  2F52 A;  1YI2 A;  5EPK A;  1VDZ A;  2EJM A;  4DR4 Q;  4G4K A;  3TZU A;  4XXE A;  1N34 Q;  3D6C A;  3AU7 A;  4GLX A;  4QIW E;  1HZC A;  3J81 E;  1CHP D;  3EBE A;  1ESR A;  1XNQ L;  2H5X A;  3QOL A;  1ZYR C;  3KBX A;  3F2D A;  2RSN A;  2NVT H;  5M5Y B;  1D1I A;  2V1C C;  3KOJ A;  4B3T Q;  4HMJ A;  4JPB W;  4TKO B;  3V05 A;  2HHH Q;  2KJX A;  1DGS A;  1PH4 A;  1NMG A;  2UUB L;  2A68 D;  1CSQ A;  4FO2 A;  1ROD A;  2FIN B;  4IUT A;  1IL8 A;  1Q1E A;  2A69 D;  1PTO B;  4R4I A;  1JWU D;  5C44 G;  3VYT A;  4YCV A;  1GJX A;  1G6Z A;  3H6M A;  1CKN B;  4BA1 I;  3HKZ G;  3PV0 A;  4A3I H;  4GNX B;  1WOC A;  4DR1 L;  4X62 L;  2EJF C;  2LKV A;  2F03 A;  2CCZ A;  1SNP A;  4DUZ L;  2F0D A;  1EY7 A;  4UY8 C;  4IFD H;  2VS1 A;  1RIP A;  3T56 B;  2JA6 G;  3HOU B;  1CZG A;  4YHH Q;  1PRT B;  2JA5 H;  2AHO B;  1B7Y B;  2F0I A;  3LWE A;  1X3P A;  1SXT A;  1E2Z A;  2Y0S G;  1E2W A;  1KTK A;  3BU2 A;  5CV8 A;  1EOV A;  2F3I A;  4BBS H;  1E0B A;  1EFW A;  1Q12 A;  3T16 A;  1SBB B;  5M3F H;  2IPK D;  1Y1W H;  2K5N A;  4A3J B;  2N8N A;  4O0A A;  3A8I E;  1K73 C;  4WRD A;  4ZYS A;  5ELD A;  1GD7 A;  3PUY A;  3P75 A;  2F0K A;  3M4Q A;  4A3B B;  4DGZ A;  1EZ8 A;  3HOX B;  4A76 A;  3IFT A;  2C5C A;  4LUZ A;  1F9P A;  3M7G A;  2WB1 B;  1XMO L;  1L1O B;  4LF4 L;  2EXD A;  1JR0 D;  1Q8I A;  4IPG A;  5TSS A;  1JE5 A;  4J1M A;  1A2T A;  2HUG A;  3AYH B;  4KY5 A;  1HRJ A;  5H1S E;  3CP0 A;  2UU9 Q;  3RLF A;  3RR5 A;  1YNN D;  1I4H A;  5DAU A;  2R7Z G;  1A15 A;  4XT3 B;  4K8I A;  1PH9 A;  4JI3 Q;  4HIK A;  3S14 B;  2F0J A;  2C35 B;  2KQ3 A;  2KOL A;  4AQY Q;  4B3M Q;  4B3R Q;  5JJI A;  2R6G A;  1A2U A;  1HTP A;  2DGY A;  1QCB D;  1PTO D;  4JK1 C;  3MEF A;  1TWC B;  5IP7 G;  4A3E G;  2NB0 A;  1PFM A;  1EIG A;  1YJW A;  4EQN A;  3V2T A;  3RZD B;  5E4W C;  5GAE C;  3BZK A;  2F0O A;  2WAQ E;  4X66 Q;  1VQO A;  1N32 L;  1STN A;  2IT1 A;  3SEB A;  1I3Q B;  1AEX A;  3S17 B;  1YZ6 A;  4WFN 3;  1BR9 A;  5CC4 A;  3H0G G;  2M2L A;  1K83 B;  3MXP A;  3ULL A;  1PZI D;  3K81 C;  4FP5 D;  2Z6K A;  2B63 G;  2HD3 A;  4AH6 A;  2OQ0 A;  3GTQ B;  3NQT A;  2E2D C;  1NR2 A;  3VA5 A;  2V4D A;  1B70 B;  1HR0 Q;  3VR2 A;  4IUV A;  2YV5 A;  2K5V A;  4LWC A;  3A8K E;  2R93 H;  3CMA A;  3M4O H;  2MHV A;  4XT1 B;  5CYU A;  3KBG A;  4R4C A;  4JOI A;  1NAP A;  2IL8 A;  1O7Y A;  4C3I B;  5C0X J;  3MXG A;  4A3B G;  1LT3 D;  5K36 G;  5J3B A;  1SE8 A;  3HOX G;  1EWH A;  4LNQ A;  1O80 A;  2X6G A;  2BDO A;  2VW9 A;  1YHB A;  2DJF C;  5LL6 S;  2F1M A;  1CA6 A;  3PO2 B;  4YY3 Q;  4ZCK A;  2E2I B;  4LF5 Q;  4IJL A;  1JB3 A;  4IOC A;  3DLL A;  4XTC S;  2R92 B;  1HNZ Q;  2OXP A;  2ID0 A;  5GAG C;  2EY5 A;  2JP1 A;  3L3O C;  4JW0 A;  4A3F G;  1RL2 A;  2KVM A;  1XTC D;  2MNA A;  3MEH A;  5T1G A;  5HGQ A;  1Q86 C;  2XN9 C;  1TWA H;  3I90 A;  3UE0 A;  5LMU L;  1WYD A;  2BA1 A;  1A0I A;  5JJK A;  4JV5 Q;  4UPA A;  1IBK Q;  3GQB A;  2XRS D;  4BBR B;  4DV1 L;  2X6L A;  4NXM Q;  5IYD G;  1QVC A;  4DAY B;  2B8F A;  4PMB A;  1XTD A;  2EXZ A;  1MJE A;  4KHP Q;  3RN5 A;  3D0F A;  4O2D A;  4NB3 A;  1EWI A;  3LGJ A;  3B6Y A;  2HCC A;  3HZX A;  3J80 c;  3ND8 A;  5ELF A;  2B2T A;  1UEB A;  4DK0 A;  3CCV A;  3OSO A;  1HCZ A;  1SR3 A;  2AQ1 B;  4C3H H;  4A3M B;  2EZV A;  3GTM H;  4PMW A;  5COR A;  3S2D H;  5EAY A;  4FF3 A;  1EU4 A;  2R61 A;  2JN4 A;  3K58 A;  2KEN A;  4PNY A;  2MGS A;  2RQX A;  1C9O A;  4DV0 L;  3NUC A;  2QW7 A;  5D14 A;  1RJT A;  2EYL A;  5IWA L;  2R7D A;  2I5H A;  2UUC Q;  4HIO A;  1YHQ A;  1IBL L;  1LTR D;  1K28 A;  5CBE E;  4BXX H;  1HPC A;  2VQE L;  2BE5 D;  1ICF B;  3CPW A;  4S3S A;  1X54 A;  4IUP A;  4LW1 A;  2F0Q A;  4IAL A;  4IPD A;  1K8G A;  3PO2 G;  2HIX A;  4H13 C;  3M4Y A;  2G9D A;  1Z9F A;  1X3Q A;  1HJP A;  5EJW A;  4GNX A;  1FNW A;  2B3G A;  4LAA A;  1LAB A;  4HED A;  2BDN A;  1HUN A;  1Y8O B;  1KAA A;  2OF1 A;  4OL7 A;  1WTX A;  5M5X H;  3Q6S A;  1TVX A;  1CQV A;  1LYL A;  3CME A;  1BOS A;  1F2L A;  1NY4 A;  1CKM A;  4WJ3 M;  4DUY L;  1F9Q A;  1MSG A;  4QB4 A;  1QOH A;  3BVZ A;  3HOW H;  3CRK C;  4DK1 A;  2UXD Q;  5HY6 A;  1J8I A;  1FL0 A;  4WJW A;  1BDO A;  3SR1 A;  4LF7 L;  2WAC A;  1A63 A;  2GA4 B;  1RDP D;  4DR5 L;  3K5O A;  1QB5 D;  3I4M B;  4ODG A;  3H09 A;  1EQV A;  4DFA A;  3J81 i;  2Y0S E;  4A3C G;  2Q2U A;  3HKS A;  1EY9 A;  1X3E A;  2VUM B;  5CV4 A;  3PF4 A;  3CKI B;  3VYS A;  1ZKO A;  4N9T A;  5FLX L;  3VYU A;  1L1O A;  4R1J A;  1W6K A;  3FEW X;  1BBW A;  1X55 A;  5E4X A;  1I50 B;  3U50 C;  1EQQ A;  2F0U A;  4AYB G;  4DK3 C;  1TR5 A;  2G9H D;  5J22 A;  2NN6 H;  3UDG A;  5T1I A;  1GUN A;  1NTG A;  1B9M A;  5C0X I;  1SYE A;  2H4O A;  4L63 B;  3S24 A;  3R2T A;  3M9B A;  1VS0 A;  1ENC A;  4LF4 Q;  1SMY C;  1UNS A;  1LT6 D;  5HUR A;  1JC7 A;  4K6L A;  2A6E D;  2KHS A;  4J15 A;  4B9X A;  3W3A A;  3OMG A;  4OWX B;  2A74 C;  3RUZ A;  3GD7 A;  3E3X A;  4UAI A;  3VR6 A;  3T4A C;  1IXR A;  1BKB A;  5J39 A;  4I7A A;  2YYZ A;  3S1N B;  1H95 A;  4C1N I;  3L2P A;  3I56 A;  3MAQ A;  3NP8 A;  3R93 A;  5C4J H;  3BYT B;  2WKD A;  4X64 L;  1HTL D;  3CQZ B;  1PA6 A;  4WOR A;  3BDO A;  2BA0 A;  2BH8 A;  2KBN A;  3I4M G;  3A5U A;  1ESF A;  2K4K A;  3K7A H;  4LF9 L;  4LFB L;  1NJI C;  3MFY A;  4R4Q A;  3GTG H;  4RA8 A;  1J6Q A;  2VQF L;  2XIW A;  5JPN C; 
#chains in the Genus database with same CATH homology
 1SFO H;  2I0Q A;  4H02 A;  3T1H L;  4DR2 L;  3W1B A;  1K83 H;  3K0X A;  2CWA A;  1XJV A;  2E2J H;  3AFP A;  2MO0 A;  3S1M H;  2A1A A;  3CD6 A;  1M90 C;  4A93 G;  1PV4 A;  1OXU A;  4LF5 L;  4BY1 G;  5IP9 H;  1L2F A;  4P71 A;  1I94 Q;  3GTQ H;  4DV3 Q;  1SRO A;  4DR3 L;  3ZJY C;  1XNQ Q;  1GO3 E;  2ZTD A;  1U5K A;  5LMN W;  1UE6 A;  4QQB X;  3PIO A;  2OTL A;  4DV7 L;  1KHI A;  4KLK A;  2JA7 G;  3ER0 A;  5ELN A;  2NVX H;  5IY0 A;  2DUD A;  1NMF A;  1X3G A;  4C3I H;  1PHJ A;  1VQ4 A;  4A3G G;  3GO5 A;  3AFQ A;  4POF A;  1XPU A;  3S17 H;  1NE3 A;  4A93 H;  3CC2 A;  5E7N A;  1KC8 C;  4BY1 H;  2WB1 E;  4JG2 A;  1TXY A;  3CAM A;  2N78 A;  4Y7N H;  1YHA A;  2R92 G;  4ALP A;  2UUB Q;  4DR6 Q;  4AYB E;  3PCO B;  2VNU D;  2JA9 A;  1E1T A;  1R9T H;  3NEM A;  2JA7 H;  3PGZ A;  3PO2 H;  3M7N A;  4PZ8 A;  3OTO Q;  5JEA J;  1IBK L;  1JB7 A;  2ZJQ A;  2D0P A;  1P8L A;  2JK8 A;  2OCE A;  2E2I H;  4A3G H;  3S15 H;  1BVS A;  1ASZ A;  2OWO A;  1VQP A;  4NXM L;  1KXL A;  1C7Y A;  1HNW Q;  1UE5 A;  3K8A A;  2R92 H;  1QUQ A;  1V1Q A;  1VQH A;  1K9M C;  1V43 A;  1WJJ A;  4GKJ L;  1S3O A;  4DR1 Q;  4HJ5 A;  4X62 Q;  3FKI H;  1BBU A;  1VQI A;  4DUZ Q;  5C4X G;  1L0W A;  3GTL H;  4BBR G;  4JI5 Q;  4BY7 G;  1T9H A;  4IFD I;  1IZ6 A;  1TWH H;  1J5E Q;  1VQL A;  4GOP A;  3PUZ A;  4JI8 L;  3Q8D A;  2F52 A;  1YI2 A;  1FJG Q;  2YTV A;  3U4Z A;  4L5Q A;  5AJ3 Q;  4JYA L;  4UP9 A;  1VQJ A;  4DV5 Q;  3ICE A;  4DR4 Q;  2MFI A;  1AE2 A;  1KAW A;  1Q8K A;  1K8A C;  3RLN A;  2IHE A;  3G48 A;  1N34 Q;  2CWP A;  4R4T A;  5LMU Q;  4GLX A;  4QIW E;  1HZC A;  4GKK Q;  2PI2 A;  1I94 L;  3EBE A;  5C4X H;  2Z6K C;  3DM3 A;  4A3M G;  2E5L Q;  2H5X A;  4BBR H;  1XNQ L;  4YWK A;  1YJN A;  3F2D A;  2NVT H;  4DV1 Q;  5IT9 c;  4JC0 A;  2V1C C;  2AWN A;  2AMC B;  3KOJ A;  4B3T Q;  2IY5 B;  4L5R C;  3NEN A;  4C3J H;  1KRS A;  3ERS X;  1N9W A;  1IL2 A;  2MO1 A;  4OWT B;  4X65 Q;  4JOI C;  2HHH Q;  3L7Z C;  2JQO A;  1DGS A;  1PH4 A;  4JI4 L;  1TWG H;  1NMG A;  2E2H H;  1SN8 A;  4A3I G;  4A3M H;  2QA4 A;  1YIT A;  1JT8 A;  2ZTC A;  2RCN A;  5FLM G;  2OQK A;  2UUB L;  4DR6 L;  1CSQ A;  3J7A 5;  1XMO Q;  1Q1E A;  4LF6 Q;  3OTO L;  4IFD G;  4R4I A;  2JE6 I;  5C44 G;  4KHZ A;  1PH3 A;  2AKW B;  2CQO A;  2GVA A;  2IHF A;  4YCV A;  1B8A A;  1KD1 C;  4DV0 Q;  1E3P A;  3W1G A;  2RHS B;  1UE7 A;  1CKN B;  1E24 A;  2JA5 G;  1ASY A;  3PO3 G;  4BA1 I;  1Q46 A;  3HKZ G;  4LFC Q;  3PV0 A;  4A3I H;  3RN2 A;  4OX9 L;  4A3L G;  1LUZ A;  1HNX L;  4GNX B;  4PZ7 A;  1WOC A;  5FLM H;  3J7Z C;  4DR1 L;  4AIM A;  3CXC A;  4JBJ A;  1AE3 A;  4X62 L;  5IYB G;  2CCZ A;  4YCW A;  4DUZ L;  1YEZ A;  3I55 A;  4UY8 C;  2JEB I;  2VS1 A;  1RIP A;  4JI5 L;  4A4I A;  4C2M H;  2K52 A;  1J5E L;  5C44 H;  5M3F G;  4MNO A;  1PH7 A;  1Y1W G;  4POG A;  1PH8 A;  3CPF A;  4YHH Q;  2JA6 G;  1VQB A;  1VQM A;  5AJ3 L;  2JA5 H;  2AHO B;  1B7Y B;  4DV5 L;  3PO3 H;  4A3L H;  1AH9 A;  2Y0S G;  5FLX c;  1OXX K;  4TVA B;  3BU2 A;  1EOV A;  5BR8 L;  2F3I A;  1WI5 A;  4BBS H;  2KCT A;  1PYB A;  5IYB H;  1Q12 A;  1EFW A;  1S72 A;  1WFQ A;  4DUY Q;  3OW2 A;  2E5L L;  1QVF A;  5JJL A;  5M3F H;  2NZO A;  1IBM L;  4DR7 L;  1TWF H;  1N32 Q;  1Y1W H;  2JA6 H;  2K5N A;  2VUM G;  2N8N A;  3CC7 A;  3PUV A;  4O0A A;  2CKZ B;  3PIP A;  3CCE A;  4JI1 Q;  1K73 C;  4LUV A;  4GLA C;  4UP8 A;  1PH5 A;  1GD7 A;  3I4M H;  4LFA Q;  4DKA C;  4X65 L;  3CCR A;  2HHH L;  3HOY G;  3PUY A;  2EQS A;  3L0O A;  3M4Q A;  2YTX A;  4QY7 A;  4YWL A;  1YIJ A;  1OXV A;  4A76 A;  1XMQ Q;  4LUZ A;  2VUM H;  2PQA B;  1XMO L;  1L1O B;  4LF4 L;  3H3V I;  2EXD A;  4IPG A;  3M85 A;  1JE5 A;  1G51 A;  4JI6 Q;  1SLJ A;  2I5L X;  3AYH B;  3F8T A;  3NBH B;  5H1S E;  1G6P A;  3CP0 A;  3RLO A;  3KJO A;  1CUK A;  2PI2 E;  2UU9 Q;  2BH2 A;  3HOY H;  1GVP A;  3RLF A;  4FDB A;  3RR5 A;  4P72 A;  4IOA A;  2UXC L;  2R7Z G;  1I50 H;  4LFC L;  2ZM6 L;  1N36 Q;  3KDF B;  1N8R C;  1PH9 A;  1VQD A;  4DV2 Q;  4JI3 Q;  4JI2 Q;  5FJ8 G;  1SMX A;  4HIK A;  4A3K G;  4AQY Q;  2C35 B;  4B3M Q;  4B3R Q;  5JJI A;  1PH2 A;  1CKN A;  5C3E G;  1K3R A;  2R6G A;  1OTC A;  1W3S A;  2ES2 A;  1VQ8 A;  1K0R A;  3OYY A;  4GNX C;  4YHH L;  1HR0 W;  3TS2 A;  4HJA A;  2DGY A;  3MEF A;  1NBW A;  3CCQ A;  3S1R H;  4JI0 Q;  2R7Z H;  1QVG A;  1VQC A;  3MXN B;  5IP7 G;  4A3E G;  1I5F A;  3F1Z A;  4DAM A;  2UUA L;  3JC6 6;  2QEX A;  4JI7 Q;  2GVB A;  5FJ8 H;  3CCM A;  1YJW A;  1C0A A;  1JJG A;  4A3K H;  2L15 A;  4GS3 A;  3A74 A;  4KI0 A;  1P16 A;  4GN5 A;  5GAE C;  4A3D G;  3BZK A;  4B3S Q;  1N33 Q;  2WAQ E;  2PMZ E;  4X66 Q;  3HKZ E;  1VQO A;  2IT1 A;  1N32 L;  1VQK A;  1YZ6 A;  1IYJ B;  2LXJ A;  3H0G G;  4R4O A;  2R93 G;  4JI1 L;  3ULL A;  5IP7 H;  4A3E H;  4K0K Q;  3TRZ A;  1I6H H;  3K81 C;  1QZG A;  2XGT A;  4HIM A;  2XTI A;  3TRE A;  3S1N H;  3UE1 A;  4BA2 I;  4DV3 L;  3I4O A;  4K0K L;  2Z6K A;  4BY7 H;  4NXN Q;  2ZTE A;  2B63 G;  4AH6 A;  3M3Y H;  2OQ0 A;  3ULJ A;  3T1Y Q;  1VQ5 A;  3KF8 B;  4IPC A;  5GAH C;  1Y1V G;  3GTO H;  3EN2 A;  3GTK H;  3CQZ H;  1B70 B;  1HR0 Q;  1VQN A;  3H3V H;  2FXQ A;  4ME3 A;  4X64 Q;  2YV5 A;  2K5V A;  4LWC A;  3H0G H;  2R93 H;  3CMA A;  3M4O H;  4X6A H;  4JI6 L;  4A75 A;  3E9H A;  1G29 1;  2WP8 J;  4R4C A;  2KHJ A;  4JOI A;  4IO9 A;  1JJ2 A;  5C0X J;  4A3B G;  5ELO A;  4XIG S;  3JAM c;  2UU9 L;  3E9I A;  5K36 G;  5J3B A;  5M5W H;  1OXT A;  1SE8 A;  3HOX G;  4LF9 Q;  4LNQ A;  1X3F A;  2F4V Q;  4APV A;  2VW9 A;  1L1O C;  2B63 H;  2K5H A;  2NZH A;  1N36 L;  1Y1V H;  4DV2 L;  1YHB A;  2VZA A;  4JI3 L;  4YWM A;  5LMN Q;  1Z47 A;  2AWO A;  2JJQ A;  3U58 A;  4AQY L;  3J81 c;  4B3R L;  4GN4 B;  4YY3 Q;  1LTL A;  2ASB A;  5IWA Q;  1UWV A;  4LF5 Q;  1HNW L;  5JEA G;  4IJL A;  3S1Q H;  1E7Z A;  1IBL Q;  2QGQ A;  4DR3 Q;  4JI0 L;  2LXK A;  4IOC A;  2HT1 A;  3DLL A;  2VQE Q;  1S40 A;  4XTC S;  4EX5 A;  3HOV G;  1PYS B;  2IX0 A;  2KHI A;  4OXP A;  4P75 A;  2ID0 A;  1KL9 A;  5GAG C;  4DV7 Q;  1HNZ Q;  3UDF A;  3E0E A;  1SRU A;  4A3F G;  1FJG L;  4TQU S;  4B3S L;  1N33 L;  4X66 L;  1RL2 A;  2MNA A;  4DR4 L;  3PSI A;  1Q86 C;  5HGQ A;  2RHQ B;  2JA8 G;  1U0L A;  2UXD L;  3KJP A;  1UE1 A;  1TWA H;  1N34 L;  3UE0 A;  2K50 A;  3IRB A;  5LMU L;  1WYD A;  4YCU A;  4GKK L;  3HOV H;  5IE8 A;  4WJ4 A;  2BA1 A;  1A0I A;  4IJH A;  5JJK A;  4GN3 B;  4JV5 Q;  4NXN L;  4UPA A;  1IBK Q;  4A3F H;  1EYG A;  4DV1 L;  1YVC A;  4NXM Q;  4L5T A;  2VL6 A;  5IYD G;  1QVC A;  1HR0 L;  4DAY B;  4B3T L;  1XTD A;  1MJE A;  2Q2T A;  2JA8 H;  4KHP Q;  2NVY H;  3RN5 A;  3D0F A;  4O2D A;  3A5Z B;  1HZB A;  3HOZ G;  2YTY A;  4LF7 Q;  2EIF A;  3FHW A;  4NB3 A;  4PZ6 A;  3GTP H;  4DR5 Q;  1EWI A;  1KIX A;  3B6Y A;  3LGJ A;  3J80 c;  3CCS A;  1X9N A;  4Y52 H;  1VCI A;  1UEB A;  3CCV A;  1XPR A;  2F4V L;  1VQ6 A;  3G6E A;  4RMF A;  5GQO A;  4LF8 Q;  4BXX G;  1XNR Q;  2HQL A;  1SR3 A;  2GN5 A;  2WFW A;  4C3H H;  1HH2 P;  4JI8 Q;  3GTM H;  1M1K C;  4PMW A;  5IYD H;  3CC4 A;  4LF6 L;  5LMN L;  3S2D H;  5EAY A;  4UP7 A;  4MTN A;  4JYA Q;  2ZJR A;  3FP9 A;  2KEN A;  4YY3 L;  4HID A;  1A8V A;  3KLW A;  4DV0 L;  1C9O A;  2A19 A;  1FVI A;  3HOZ H;  2OTJ A;  5IWA L;  2R7D A;  2I5H A;  2UUC Q;  4HIO A;  1YHQ A;  1IBL L;  2Q2I A;  1VQ7 A;  3TS0 A;  3I2Z A;  2NVQ H;  4BXX H;  5M5Y H;  2VQE L;  1FGU A;  3CCL A;  4IPH A;  3CCJ A;  3CPW A;  1X54 A;  3UDX A;  4LW1 A;  1HNZ L;  4IPD A;  3BZC A;  1K8G A;  3PO2 G;  2HIX A;  5IYC G;  1VQG A;  1X65 A;  2HIV A;  3S16 H;  4P74 A;  1Z9F A;  1EIY B;  1HJP A;  3HOW G;  4GNX A;  3CF5 A;  2NN6 I;  2B3G A;  3GDE A;  4JI4 Q;  2JEA I;  3GTJ H;  3KYH C;  5M3M G;  4DV4 Q;  2CFM A;  2YU9 H;  2UXB Q;  1EQR A;  4IFD J;  1E1O A;  2MQH A;  5M5X H;  3UDI A;  3I4N G;  1GKH A;  3A0J A;  3FKI G;  1LYL A;  3KF6 B;  3CME A;  1NY4 A;  4WJ3 M;  1CKM A;  1QZH A;  4DUY L;  4NPS A;  1KRT A;  2ZJP A;  1VQF A;  5IYC H;  3HOU G;  5C3E H;  2D62 A;  3ULP A;  4JV5 L;  4P73 A;  3HOW H;  4L5S A;  3SGI A;  3S2H H;  3KFU A;  4GLV B;  3JAM i;  2ATW A;  5M3M H;  4DK6 C;  5HY6 A;  3G71 A;  4KHP L;  4OX9 Q;  2UXD Q;  1FL0 A;  3K80 C;  4OO1 I;  1HNX Q;  1W2B A;  4LFA L;  2ALY B;  3AEV A;  4LF7 L;  1A63 A;  3I4N H;  4DR5 L;  1Q82 C;  1KQS A;  2D0O A;  1O7I A;  3EIV A;  1XMQ L;  4A3D H;  1A62 A;  2N3S A;  4RG1 A;  4A3J G;  4LF8 L;  3HOU H;  1XNR L;  3J81 i;  1CKO A;  3CCU A;  2Y0S E;  3PF5 A;  4GOP C;  5DLQ E;  1Q81 C;  2Q2U A;  2IX1 A;  4A3C G;  3STB C;  4DPG A;  1OXS C;  3HKS A;  1EUJ A;  1X3E A;  5GRO A;  1MKH A;  3NEL A;  5GAD C;  3K7U C;  3RNU A;  4DV6 Q;  3PF4 A;  2NN6 G;  4LFB Q;  3BJU A;  2N49 A;  5BR8 Q;  1PH6 A;  2UUC L;  1D8L A;  4DNI A;  2PQA A;  1L1O A;  4R1J A;  3WWV A;  2VQF L;  2I5M X;  2VQF Q;  2B29 A;  2WB1 G;  3STB D;  1PH1 A;  1BBW A;  4A3J H;  1X55 A;  3HFZ B;  3CW2 C;  3PUW A;  3U50 C;  4DR2 Q;  3T1H Q;  1IBM Q;  4JI2 L;  4DR7 Q;  4A3C H;  1EQQ A;  4B3M L;  4AYB G;  3TQY A;  4DK3 C;  4JBK A;  1WCM G;  4QGU A;  1MIU A;  4JBM A;  2Z0S A;  1EIF A;  4A3B H;  3KDF A;  2Q2H A;  2KCM A;  1D7Q A;  3HOX H;  2K14 A;  3UDG A;  1E22 A;  3D31 A;  3M4P A;  1Q1B A;  2RF4 A;  2UXB L;  2A8V A;  4DV4 L;  4OO1 G;  4JI7 L;  1NTG A;  5C0X I;  4MZ9 A;  4OON A;  1JJC B;  3S24 A;  3M9B A;  3W5O A;  3G4S A;  1VS0 A;  4LF4 Q;  1PVO A;  1VQ9 A;  1WCM H;  1CSP A;  1VQA A;  1GM5 A;  1X6O A;  2R7F A;  1XPO A;  3F2C A;  1YJ9 A;  1Q7Y C;  4J15 A;  3I7F A;  2K75 A;  3VDY A;  2UXC Q;  4OWX B;  1LM0 A;  3U4V A;  3F2B A;  3J80 i;  2WAQ G;  3GD7 A;  2VY3 A;  3KF6 A;  4JCV E;  2ZM6 Q;  4OWW B;  3S14 H;  1IXR A;  1BKB A;  1VQE A;  1X56 A;  1HZA A;  1Y14 B;  2PNH A;  3PUX A;  1QUQ B;  2YYZ A;  4BBS G;  1H95 A;  1HZ9 A;  1YNX A;  3AQQ A;  3L2P A;  3I56 A;  4HJ9 A;  3T1Y L;  4QJF A;  5C4J H;  4X64 L;  1TWC H;  2LSS A;  4EQ5 A;  4GOP B;  1MJC A;  3J81 j;  2E8G A;  4HJ7 A;  1PA6 A;  4HJ8 A;  2BA0 A;  2BH8 A;  3H15 A;  4GKJ Q;  4DV6 L;  3TEH B;  1JMC A;  2KBN A;  1PFS A;  5IP9 G;  2UUA Q;  3A5U A;  3K7A H;  2K4K A;  4LF9 L;  4PG3 A;  3RZD H;  3I4M G;  4LFB L;  4LUO A;  4JBW A;  1YBY A;  1NJI C;  3RZO H;  4R4Q A;  3GTG H;  4QL5 A;  1J6Q A;  5C0X G;  1V9P A;  1I3Q H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...