4A4IA

Crystal structure of the human lin28b cold shock domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
VLRGTGHCKWFNVRMGFGFISMINREGSPLDIPVDVFVHQSKLFMEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN LIN-28 HOMOLOG B
publication title The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 17
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a4iA00
4LF4Q 3TS2A 4DV7L 5IYBG 4B3TQ 1E22A 1HZAA 4GN3B 4R4OA 3CPWA 1XMQL 5IP7H 2UXBL 5E7NA 4GS3A 3KFUA 4A3IG 1J6QA 1PH2A 1FJGL 1PYSB 5C4XH 5FLMH 3GTJH 3CQZH 1D8LA 4GN5A 4JI3L 4JI8L 1BBWA 4DV6L 4A3FG 2UXCL 4JV5Q 2WFWA 2OQKA 2JA6G 1NY4A 2K4KA 3TS0A 4MNOA 3ULLA 1IYJB 1D7QA 1E1OA 4R4QA 5GADC 4DR3L 1QVFA 1A8VA 1UWVA 4LWCA 4OONA 5M5WH 4LW1A 1UE5A 1NBWA 1SN8A 2BA1A 5M5XH 3ERSX 5IYCG 4HJAA 3CC2A 1HZBA 4A3KH 3M7NA 1L1OB 4OX9Q 1Y14B 2UXDL 2DGYA 2E5LL 1OXVA 5IYCH 5C3EH 2R93G 2K52A 3CCRA 1K8GA 3EBEA 1P16A 1OXSC 1XPOA 2ALYB 2JQOA 1SLJA 2R92G 1YBYA 1MJCA 2JEAI 2K5VA 3PUVA 4JOIC 2NZHA 4HJ5A 2HHHQ 4LFBL 1L1OC 1VQNA 4LF4L 1X6OA 4B3TL 2CQOA 4NPSA 2VY3A 2JA6H 1RIPA 4A3MG 4DR7Q 3B6YA 2CFMA 1GKHA 4GKJL 5EAYA 4DUYQ 1LTLA 3CAMA 2LXJA 1NMFA 1EYGA 2CWAA 4YCWA 2K50A 3HKZG 4AH6A 4ALPA 4JV5L 4OO1I 4X66L 4QY7A 3I56A 4DAMA 2RHSB 2NN6I 2JEBI 2R93H 4KHZA 4A3EG 5FJ8G 3KDFB 1PH3A 2WP8J 3FKIG 3AFPA 1IBMQ 1A62A 1VQFA 1VQHA 4DR1L 3ER0A 2IHFA 1YJ9A 4DV4Q 4A3BG 3HOUG 4OX9L 4B3RQ 1EIFA 1VQLA 1KRSA 4YWMA 4OWXB 4UP7A 3F2CA 4IPHA 5AJ3Q 4P73A 3UE1A 2ZJRA 4YWKA 4AQYQ 4BBRG 2UUAQ 1VS0A 3PO3G 1WFQA 1VQ8A 4LF5Q 3W1GA 2VZAA 2FXQA 4A3MH 5M5YH 2IX1A 3H0GG 4YCUA 3STBC 4JC0A 5ELNA 2HHHL 1N32Q 4GOPA 1KRTA 3G6EA 4PZ7A 3T1HL 1M90C 3H3VI 3M4OH 1V9PA 4DR7L 1I6HH 2D0PA 2Z6KA 4DPGA 5FLXc 3PSIA 1PYBA 3RNUA 3STBD 3PF4A 1S40A 2OCEA 4WJ3M 3FKIH 4DUYL 1AH9A 1XTDA 1VQ6A 1EUJA 3CXCA 4KI0A 4DV2Q 2UUCQ 4JI5Q 1TWAH 4BXXH 3HOUH 3UDXA 3K0XA 4LUOA 1PH8A 4BBRH 4DV7Q 2RF4A 3PO3H 1Y1VG 1KC8C 4QJFA 1VQAA 4UP9A 4DV4L 2QEXA 4DUZQ 1B8AA 3GTMH 1OXXK 2NVYH 3PIOA 4B3RL 2R7DA 3BJUA 4JI8Q 3H15A 1GM5A 5AJ3L 4AQYL 4WJ4A 2UUAL 2MNAA 1CSPA 1YVCA 1VQCA 4LF5L 4LF8Q 4OWWB 1FVIA 4O2DA 3S1RH 2A8VA 1X56A 2YU9H 4K0KQ 2K5NA 3F1ZA 5LMNW 4A3GG 2MFIA 4IJLA 1G6PA 1N32L 3HKZE 3HFZB 4IJHA 3F2BA 1R9TH 1HNZQ 5GAEC 4DV3Q 4GKJQ 1YJNA 1UE7A 2Q2IA 4OWTB 3PUWA 1K0RA 4DK3C 5GROA 1Y1WG 1Q86C 3TRZA 3KF8B 4LNQA 5C0XJ 2UXDQ 4FDBA 4BBSH 4HIDA 3M9BA 1PH5A 2BH8A 3NENA 5GAHC 4DV0Q 2VNUD 4DR6L 2JJQA 1Y1VH 4A3LG 1EFWA 3HOVH 3RLFA 4DV2L 2A1AA 2UUCL 2VUMG 1C0AA 4B3SL 1JT8A 4BA1I 2E2IH 4JCVE 1DGSA 3RN5A 2F3IA 3MXNB 3KYHC 1YHBA 4KLKA 4X62Q 3EN2A 2PNHA 3VDYA 3AYHB 5ELOA 1HR0W 3HOYG 1OXTA 4O0AA 2E8GA 1WCMH 1JJGA 2YTYA 3DM3A 1SE8A 4HJ9A 1HH2P 4DUZL 3HOZG 2VW9A 3PO2G 4KHPL 2JK8A 1ASYA 4JI0Q 2WAQG 5C44H 1VQPA 2Y0SG 3A5UA 3PCOB 1PH9A 2HIVA 1LYLA 2AHOB 2KCMA 1P8LA 1SMXA 3K7UC 4IOCA 1N36Q 4LUVA 4X66Q 4LF8L 4POFA 4GOPB 2BA0A 3J7ZC 4K0KL 2F4VQ 3GTOH 3W5OA 1VQ9A 1V1QA 2KBNA 3SGIA 1HNZL 1X54A 2ZJPA 4DV3L 4DR1Q 4LF9Q 2R7FA 1Q8KA 3DLLA 2ES2A 5JJKA 1QUQA 2Q2HA 4GNXA 1IBKQ 3KJPA 2JA8H 3A74A 4DV0L 3CCUA 3RN2A 1KHIA 5IYBH 4GOPC 4JI4Q 1U5KA 4JI6Q 4YCVA 1XPUA 3HOYH 4BA2I 5IP9G 5C0XG 3K8AA 1X65A 3CP0A 5JEAJ 1SR3A 2Z6KC 4A3IH 1XMOQ 1X9NA 1VQDA 4A3FH 3S1NH 1YEZA 2K75A 1X3EA 1PH7A 4JBMA 4UY8C 4YY3Q 4X62L 1VQBA 1Q1BA 4LF6Q 3I4MG 1PH1A 1BBUA 1QVCA 2N3SA 2ATWA 2JA5G 3I2ZA 3I4NG 4JI0L 3UDFA 2VQFQ 3CCQA 3GO5A 3BZKA 5M3MG 1JE5A 1NE3A 1NMGA 1TWFH 1N36L 4XIGS 2F4VL 3J81c 1YITA 4LFBQ 3OW2A 4EX5A 1TXYA 2B3GA 3KF6A 1SFOH 5C4JH 4EQ5A 4LF9L 4A3CG 1MIUA 2R92H 3HOWG 1K83H 3J80i 2AMCB 3FP9A 3M85A 2NVQH 1YIJA 2N49A 1IBKL 4Y52H 2C35B 4R4CA 2YYZA 1PA6A 2K5HA 1KD1C 4JI4L 4JI6L 3I4MH 4JG2A 1YJWA 3W1BA 2PI2E 4LF7L 4A93G 1U0LA 4MTNA 4NXNL 4IPDA 2WAQE 4TVAB 2N78A 1XMOL 1KIXA 2Y0SE 1CKMA 2GVAA 4GN4B 3PUXA 3RLNA 1VQIA 3PGZA 4YY3L 3S1MH 4LF6L 1X3FA 4IPGA 3S16H 1HNWQ 1HJPA 5JEAG 3AEVA 3EIVA 3MEFA 1YHAA 4A3JG 2XTIA 3CPFA 4PMWA 3F2DA 1LUZA 1N33Q 4BY1G 4A3EH 1G291 3L7ZC 5FJ8H 1PHJA 4YHHQ 4DR6Q 1S3OA 4JBJA 1OXUA 2IHEA 2IT1A 5IYDG 3CMEA 2VQFL 4A3BH 4OO1G 4A3CH 3U4ZA 3HOWH 2NVTH 2A19A 4ME3A 2OTLA 4B3SQ 1JJCB 2LSSA 1GD7A 4TQUS 5JJLA 1Z9FA 2EXDA 2B29A 4A3DH 1QUQB 1E3PA 4GNXB 5GAGC 3TQYA 5HGQA 1UE6A 3GTGH 4A93H 1XJVA 3H0GH 2GVBA 2VL6A 5JJIA 3E0EA 2CCZA 1K9MC 4DKAC 3NELA 4MZ9A 1N8RC 1YNXA 2KHIA 5LMUQ 1IBLQ 4RG1A 3ZJYC 1GO3E 4A3JH 1JJ2A 2IY5B 1QZGA 4GNXC 2MQHA 3ULPA 1M1KC 4IFDI 3U50C 1NJIC 4DR4Q 4X65Q 2B63G 1W3SA 3K81C 5J3BA 3WWVA 2JA7G 5IYDH 3JAMc 2E2JH 3GTQH 4JYAQ 1HNWL 1CKOA 2OQ0A 3M4PA 4QGUA 5BR8Q 3G48A 4IPCA 5HY6A 2PQAA 2I0QA 1N33L 1I5FA 4JI1Q 4YHHL 4JI7Q 2RCNA 5M3FG 2ID0A 4AYBG 4C2MH 2NZOA 4HJ8A 4GLXA 4C3HH 1VQ7A 1N9WA 1HNXL 3KF6B 4YWLA 2QGQA 3K80C 2ZM6Q 4R4TA 5IP7G 4LUZA 2KCTA 4IO9A 1GVPA 3PUZA 1PV4A 1CUKA 5LMNQ 5FLMG 3I55A 2K14A 4PG3A 2IX0A 3K7AH 2YTVA 1WI5A 4A3GH 4PZ6A 3GD7A 2UUBQ 3D31A 1CKNA 2JA7H 2OTJA 2ASBA 5LMUL 2QA4A 4DV5L 1X55A 3FHWA 1SRUA 2H5XA 1EOVA 2XGTA 4JI2Q 4DR5Q 1Y1WH 3A0JA 1IBLL 4L5SA 1NTGA 4GKKQ 3CCSA 4LFAQ 1YHQA 3S24A 1EWIA 4KHPQ 2AWOA 3NEMA 3CCJA 3L0OA 3CD6A 4DR4L 1Q82C 4X65L 4P74A 3J81i 2JE6I 4A3LH 4NXMQ 2VUMH 1K73C 4JYAL 1PH4A 1HR0Q 3F8TA 1Q12A 4Y7NH 1VQOA 4AIMA 5BR8L 4DR2Q 1XPRA 1WYDA 3S2HH 4IOAA 1I50H 4JI1L 4JI7L 1RL2A 1E1TA 4GLAC 3G71A 1A63A 2I5LX 2ZTEA 3U4VA 4LF7Q 1Z47A 4NXNQ 2PI2A 3AQQA 3CCEA 1VQ4A 1N34Q 3PO2H 3HOZH 4A76A 1IZ6A 3CW2C 3KLWA 2ZM6L 1A0IA 1H95A 3GTKH 1I3QH 2JA9A 4DK6C 2I5HA 5LMNL 3KJOA 5IT9c 3RR5A 3S15H 3RZOH 1JMCA 4R4IA 3HOXG 2KENA 3S14H 2UUBL 3PIPA 1PVOA 3I7FA 4DV1Q 1W2BA 1C9OA 4X64Q 3NBHB 4B3MQ 4JI2L 3CF5A 4DR5L 4L5RC 1XNQL 4GKKL 4LFAL 3M3YH 4JBWA 1PH6A 3IRBA 1UEBA 1FL0A 1L0WA 3CC7A 1J5EL 1XNRL 4AYBE 1Q1EA 3A5ZB 1T9HA 3HKSA 1IBML 2PQAB 1EQRA 1VQMA 5IP9H 4NXML 5K36G 1HR0L 5IY0A 1KXLA 1CSQA 4DR2L 4QIWE 4QL5A 2UU9Q 1PFSA 3OYYA 3L2PA 4L5TA 3GTPH 2Q2UA 2AKWB 2RHQB 3GDEA 2WB1G 1Q7YC 4R1JA 2Z0SA 1UE1A 1N34L 2JA5H 3JC66 3I4NH 3HOXH 1BKBA 3ULJA 1VQ5A 1BVSA 4NB3A 1C7YA 1L2FA 2MO1A 3E9HA 3UDIA 2MO0A 1TWGH 1K8AC 1KAWA 3RLOA 3ICEA 2ZJQA 2Q2TA 4JBKA 1VQGA 3GTLH 5M3MH 1CKNB 2NVXH 1AE2A 2YTXA 3OTOQ 3JAMi 3T1YQ 3RZDH 2GN5A 4PZ8A 4BXXG 1WJJA 2D62A 4A75A 4HJ7A 3UDGA 3UE0A 2ZTDA 4LFCQ 4DV1L 3S17H 4X64L 2I5MX 4B3ML 1HNXQ 3LGJA 1I94Q 2VS1A 2NN6G 1TWHH 4UPAA 3S2DH 1EQQA 1SROA 3I4OA 3CC4A 1ASZA 1IL2A 1HZCA 2R7ZH 3Q8DA 2BH2A 1LM0A 1MJEA 2F52A 1E24A 1KL9A 1HZ9A 3S1QH 1YZ6A 2N8NA 4IFDJ 2LXKA 3E9IA 2UU9L 4C3IH 1QVGA 4JOIA 4DV5Q 1S72A 4BY7G 3PUYA 1L1OA 3TREA 1K3RA 1KQSA 1Q46A 3PF5A 4H02A 3AFQA 4C3JH 2L15A 5IWAQ 4APVA 4BY1H 4QQBX 2HQLA 4XTCS 1E7ZA 3CCVA 2V1CC 1B70B 5H1SE 4BBSG 2VQEQ 2KHJA 2CWPA 3TEHB 1JB7A 1OTCA 2DUDA 2CKZB 5DLQE 4POGA 3J80c 1AE3A 3KOJA 3T1YL 3OTOL 3HOVG 4X6AH 1G51A 1XMQQ 3J81j 2UXBQ 1FJGQ 4DAYB 4LFCL 2D0OA 2EQSA 3T1HQ 1YI2A 4JI3Q 1VQEA 4P72A 2UXCQ 4DV6Q 1WOCA 2E2HH 1EIYB 4GLVB 2R7ZG 4J15A 1I94L 3M4QA 1B7YB 1MKHA 1FGUA 1WCMG 4A4IA 5IE8A 3CCMA 4HIOA 3D0FA 2ZTCA 4UP8A 4DR3Q 3J7A5 5C4XG 2WB1E 4BY7H 5C44G 1QZHA 3U58A 3G4SA 3PV0A 1IXRA 4RMFA 5GQOA 3CMAA 3KDFA 1O7IA 2HT1A 2B63H 2E5LQ 4A3DG 4DNIA 1TWCH 3H3VH 4L5QA 3CCLA 4P71A 2R6GA 1XNQQ 1Q81C 4HIMA 4JI5L 4IFDG 2YV5A 5IWAL 5C0XI 4A3KG 1V43A 1VQKA 1VQJA 2HIXA 3BU2A 1VCIA 1J5EQ 2OWOA 4HIKA 1XNRQ 1X3GA 2AWNA 5M3FH 3BZCA 2JA8G 2PMZE 2VQEL 4P75A 5C3EG 2EIFA 4OXPA
chains in the Genus database with same CATH superfamily
1D2BA 1XX8A 4EVOA 4DV7L 1E22A 1PDQA 4K5XA 4R4OA 5IP7H 1ZKOA 3HOWB 4ODGA 1J6QA 1PYSB 5C4XH 4A3FG 1PRTC 4DV6L 4FYDA 2KOLA 3VR3A 3FPPA 2KECA 2JA6G 1QOHA 3TS0A 1KTKA 3DWAA 4MNOA 3ULLA 1QVFA 4LWCA 4OONA 1UE5A 1SN8A 3ERSX 4HJAA 1HZBA 1QE6A 2JN4A 3SHLA 4OX9Q 1A6XA 1KNAA 1U9RA 5C3EH 1Q3LA 2K52A 4KY6A 1LTGD 1JWSD 1Z7TA 1BCPB 2K5VA 5ISRA 4JOIC 2TSSA 1EIHA 1HQMC 5C3XA 2VY3A 1QB5D 4C3HB 1RIPA 1SJED 3B6YA 3OPOA 3NTIA 1PTOH 3NSWA 4DUYQ 4K6LA 1NMFA 4OO1I 1DONA 5EBDA 1TQOA 2F0FA 1PH3A 2WP8J 3AFPA 1VQFA 4DR1L 1SEBD 2XSCA 1EIFA 4YWMA 4IPHA 4P73A 1V1PB 1VS0A 1WFQA 4LF5Q 2VUMB 2VZAA 4A3MH 4KN7C 2K5WA 1N32Q 2M2LA 3X3MA 2F0PA 1M90C 3M4OH 1XTCD 5EJWA 5FO8B 2X6GA 2D0PA 4DPGA 3PO2B 3PSIA 2WINB 3FKIH 4PQXA 2K33A 1X32A 1XTDA 1AH9A 3GTKB 2EY2A 1S5ED 5T1GA 5M5WB 1V8QA 3RZOB 5M5XB 2OF1A 2QDLA 4LUOA 1HQRD 3S14B 4BBRH 2RF4A 3PO3H 1KC8C 5F2DA 5G3LF 5HGTA 1SYDA 4B3RL 1OXXK 2NVYH 5EKIA 3WDNA 2TMPA 1HA5A 2MNAA 1PRTF 1WTRA 1VQCA 1SYFA 4LF8Q 4O2DA 2YU9H 4K0KQ 5C5LA 1AW7A 4A3GG 3HKZE 5IIFA 5GAEC 5KNBA 1UE7A 3TP6A 3VR5A 5GROA 1Y1WG 1Q86C 5EBCA 4LNQA 2JA5B 4FDBA 5GAHC 1Y1VH 1TWGB 4DV2L 2A1AA 1SNCA 1H9MA 4ME5A 1JT8A 3RZDB 1PTOC 4BA1I 4ZCKA 4C1NI 3KYHC 1YHBA 4KLKA 1HR0W 3Q6SA 3HOYG 1JJGA 1JR0D 1SE8A 2NWGA 4CBVA 1UAPA 1EZ8A 1ASYA 5C44H 2KCMA 2EXZA 1YNNC 4IOCA 3K7UC 2M00A 5FLXL 1S5FD 1VF7A 4POFA 1QWYA 2IW3A 1Q8KA 2R7FA 3R8BA 3V96A 3BS1A 1F9RA 2JA8H 2Z9HA 2AQ1B 1U5KA 3TSSA 3CP0A 3FEWX 1X9NA 1VQDA 4A3FH 3S1NH 1RKNA 1Q1BA 2EDGA 4MHEA 3I2ZA 1F9PA 2RQXA 2A73B 4JI0L 1U4LA 4BY7B 3C46A 2DY8A 2F4VL 4EX5A 1TXYA 4IUUA 3VYUA 1WTPA 2L1BA 1SFOH 4LF9L 5ELCA 3J80i 2VB2X 4RCNA 3M85A 1YIJA 2N49A 5JPNC 3TP7A 3DEPA 2PW5A 1KD1C 4JI6L 4JG2A 3GTPB 1GHJA 4LF7L 1D1KA 1G2SA 1F2MA 4IPDA 4M1UB 2N78A 3H3VC 3VR6A 3PUXA 3NP8A 2K32A 4IPGA 3FVQA 3EIVA 4A3JG 4PMWA 4C3JG 3AU7A 3T4AC 1C8CA 1S3OA 1STHA 2IT1A 1QG7A 2EJFC 2FMMA 4OO1G 1SMYD 4U673 1S4ZA 2A19A 1JB3A 4B3SQ 2LSSA 2K03A 2EXDA 3E0JA 4IALA 1ESRA 2L4NA 5GAGC 4QCLA 2F0SA 1GUOA 3E0EA 4FF4A 1K9MC 4DKAC 3NELA 1CHPD 5ELFA 1GO3E 3BVZA 4IFDI 5FLXE 4U68A 2HQEA 2NYZD 2L11A 4X65Q 1Q90A 5J3BA 2B63G 5IYDH 2E2JH 1RTNA 1HNWL 1SSOA 3DM1A 1R4PB 3G6JB 5BN4A 3M4PA 4QGUA 1A2UA 2R93B 2ID0A 4AYBG 2NZOA 4GLXA 1D6EC 2F0JA 1HNXL 1MBYA 1B4OA 4ZQ3A 4IN3A 4LUZA 1CUKA 2Q8IB 2IX0A 1ZEQX 2YTVA 2O5IC 1WI5A 1PTOD 4A3GH 3ERQA 4PZ6A 2UUBQ 4IUVA 1CFMA 1BCPF 2MHVA 5E4WC 5KYIA 3FHWA 2QA4A 4JI2Q 1Y1WH 3A0JA 1NTGA 3CCSA 1EWIA 2CHBD 3NEMA 2F0NA 2HCCA 3CD6A 2B2UC 2JE6I 1YNND 4JYAL 3F8TA 1TY0A 1Q12A 1VQOA 5BR8L 1TWAB 4IOAA 2FMCA 3C1FA 1ICWA 1Z47A 2PMZB 2B2YA 2MPMA 2PI2A 3AQQA 4A76A 1I4HA 1LT6D 1A0IA 2JA9A 3MFGA 3RR5A 3S15H 4CDFC 3D6CA 1JMCA 3HOXG 1PVOA 4EQOA 1LTRD 2RDHA 4DR5L 1TKWB 4L5RC 4KHPL 1DZ1A 2A5HA 4JW0A 3T53B 1LACA 5A35A 1EQRA 5C4ZA 1VQMA 1UNSA 2F0OA 2O4XA 1HR0L 1TS5A 4QL5A 3A56A 3I91A 1CA5A 3OYYA 1JOKA 2RHQB 3FRPB 4R1JA 1UE1A 1N34L 1BQQT 1CTMA 2MO1A 3UDIA 2MO0A 3X3NA 1K8AC 1HFGA 4H44C 1AE2A 2GN5A 4PZ8A 4XT3B 2D62A 2JP1A 4XDXA 4A75A 4V0BA 2XN9C 4DV1L 4X64L 1PFMA 1AEXA 4B9WA 3LGJA 3S2DH 1XWEA 1NNXA 5L37A 1SBBB 1MJEA 5IODA 4G7OC 2N8NA 4RHRA 3E9IA 5IT9L 2UU9L 5J1ZA 1KDCA 4JOIA 2WAQB 1SE2A 4K14A 3PUYA 2Y0SB 4C3JH 1H9SA 5IGCA 4XTCS 3CCVA 5EKKA 1EY7A 4BBSG 1JORA 2CWPA 1ZYRC 4OO1H 2CKZB 1LO5D 4X6AH 3T1YL 5LL6X 1FD7D 2BOSA 1GUWA 1PZKD 1TWFB 2B2VC 4LFCL 4DV6Q 1WOCA 2E2HH 2R7ZG 4GLVB 3LNNA 1I94L 2H1EA 3H09A 3M4QA 4HIOA 1WCMG 1K83B 2C5CA 2DJGC 2B39A 3A8IE 5LL6S 2NVQB 3J7A5 2B2WC 5C4XG 5DM63 3L9AX 2IJ0A 2B2TC 5D3IB 4RMFA 3KDFA 2F0KA 2B63H 4L5QA 2F3WA 2HDLA 4S3SA 1SNOA 1XNQQ 4IFDG 1ESFA 5IWAL 1PRTB 1V43A 1VQKA 1VQJA 2NVXB 3BU2A 4X3KA 4ABNA 2I07B 1A15A 2AWNA 3BZCA 1IBMQ 4A3EB 5C3EG 1SNQA 1NCVA 4KKSA 5IYBG 1EU3A 2NTSA 3K5NA 3CPWA 2KCCA 4A3BB 1UEAB 1XMQL 3R93A 1AZQA 5E7NA 4GS3A 3KFUA 4A3IG 1FJGL 3GTJH 3CQZH 1D8LA 4GN5A 4JI8L 4R8NA 4CJ2C 2BDNA 4M8AA 2WFWA 4OIJA 2QILA 1NY4A 2K4KA 4A93B 2NZ1D 3PIP3 2EYPA 1E1OA 2CH4W 3P20A 1UWVA 2PZTA 1KLGD 1DXMA 3VYSA 2BA1A 4A3KH 1U4MA 3VYRA 3M7NA 1NUCA 3KLSX 1PYWD 4IUTA 2UXDL 1H9SB 2E75C 2DGYA 2G9HD 5IYCH 1MSGA 2JQOA 4FP5D 2R92G 2AUKA 4HJ5A 3OMGA 2NZHA 3GQBA 1CQFA 2QKIC 4HTHA 3DMUA 1VQNA 3SDZA 5ELBA 4B3TL 4NPSA 4C2MB 5M9OA 1B9MA 4A3MG 1GKHA 4GKJL 3GV6A 5IT9E 2K50A 4JV5L 4ALPA 4TSSA 4X66L 3I56A 1WTVA 1IL8A 2RHSB 4KHZA 3KDFB 3FKIG 4HR7B 3HS0C 1A62A 2JA7B 1D1IA 1TWCB 4R9WA 4KKTA 1FR3A 1SYEA 3MXNA 3K59A 4B3RQ 3W2DA 4OWXB 2LS01 4TRDA 3SK8A 4BBRG 3PO3G 1VQ8A 4Z9CB 4I7AA 2FXQA 2XRQD 5M5YH 1PFBA 4KHVA 4Y7NB 3C1EA 4YCUA 5ELNA 2HHHL 3S2HB 3H6MA 3I8ZA 1MHWC 1I6HH 1GJXA 5FLXc 3HOZB 4WJ3M 2F0LA 4CDEC 3MAQA 1VQ6A 1EUJA 1SE3A 4DV2Q 4JI5Q 3HOUH 2O5JC 4QF4A 3UDXA 3K0XA 1PH8A 4HCSA 5JAVA 5CV9A 1Y1VG 2Q8RE 4QJFA 4DAVA 4DV4L 1MGSA 1I4PA 2RA4A 1ZYRD 3H15A 5AJ3L 4AQYL 2UUAL 1FVIA 3NBIA 3S1RH 1X56A 1F9QA 5LMNW 4IJLA 5I2YA 2HD3A 3HFZB 3F2BA 1R9TH 3P1HA 2Q2IA 4OWTB 3W3AA 3MWYW 3OOCA 5C0XJ 4BBSH 2BH8A 2VNUD 2JJQA 1ET9A 4FF1A 1EFWA 2VUMG 1K8OA 2ICEC 3IKJA 2E2IH 3RN5A 3D6WA 3MXNB 2LY7A 3NE5B 3RD4A 1K3BC 1DYQA 2R61A 3OIPA 4O0AA 3S17B 1WCMH 1VMCA 3DM3A 4LAAA 1EYAA 1HH2P 3PO2G 2VW9A 4JI0Q 4HEDA 4MN3A 3A5UA 2IPKD 1PH9A 2AHOB 2MJ8A 1SMXA 2J4XA 2AQ2B 3HP3A 2BA0A 3J7ZC 4CKBA 2F4VQ 2FHTA 2VXWA 3W5OA 3EJIA 1HNZL 2JXMB 1X54A 3I90A 4C3IB 2ZJPA 4DV3L 4LF9Q 4IFDH 3DLLA 1I6VC 3EVQA 1BBXC 2SOBA 2Q2HA 1TIID 4PMCA 4DV0L 3RN2A 5IYBH 4GOPC 4JI6Q 1XPUA 4BA2I 2EYHA 2EY1A 5CV5A 5JEAJ 1D5XC 2Z6KC 4A3IH 1NAPA 3C2PA 2Z8LA 2PNRC 1U4PA 2RSNA 4X62L 2NVYB 1J8IA 1PH1A 1U4RA 3VR4A 5I6WA 1HTPA 2JA5G 3Q24A 3A54A 2WACA 3DWQA 2YU9B 4CHTB 2K5DA 3BZKA 1NMGA 5FOBB 1JOQA 3EROA 5C4JH 1I4QA 3L3OC 3DEOA 1MIUA 2R92H 4CJ1B 3BDLA 1IBKL 2KHSA 2K05A 2EJGC 4PMBA 4BS9A 1CI3M 3K58A 2B2UA 2K5HA 3I4MH 5M3FB 5CV7A 3K5MA 1LLRD 2PI2E 4NXNL 2ZXPA 2WAQE 4HSPA 2Y0SE 1CKMA 3NPPA 3Q22A 2QW7A 2B8FA 4YY3L 2DNEA 3Q0AA 4LF6L 1X3FA 1IYVA 1DD2A 1HNWQ 1SMYC 3AEVA 4IUQA 2XTIA 3F2DA 2X69A 2RCFA 1G2TA 4DR6Q 3KLRA 1STBA 2DNCA 4QUCA 5IYDG 2VQFL 1TS4A 3OMCA 4A3CH 3HOWH 1A3TA 2OTLA 4ZUIA 1DCZA 3F2UA 3HZXA 1J9OA 1JC7A 2X6LA 1E3PA 2R3ZA 1GUGA 1UE6A 1CM9A 2EYFA 2VL6A 3DHQA 4N8X1 2CCZA 1FNWA 2H4OA 1N8RC 3QOJA 1SE4A 2NBFA 4A3FB 1SAPA 1STYA 4UHVA 3ZJYC 3N52A 1S5BD 2MQHA 4GNXC 3MC0B 1W6JA 3NBHA 2JA6B 1Y69U 3QIAA 3WWVA 4KMUC 1EY8A 3GTQH 1O7YA 4JYAQ 2L55A 1EL0A 2OQ0A 5BN5A 3ND9A 5BR8Q 5HY6A 4F8MA 1N33L 4YHHL 3BYYB 2ENBA 4XYQA 4C3HH 1WTXA 1VQ7A 1N9WA 4KD3A 2F1MA 1JOOA 3K80C 4KD4A 4XT1B 3KBGA 1GVPA 2A69C 4HMJA 4QMGA 1F2LA 3IFDA 3GD7A 1CKNA 4PNYA 2R7ZH 4DV5L 1X55A 1SRUA 2XGTA 4DR5Q 1B9NA 1IHZA 4KHPQ 1QILA 3L0OA 4DR4L 1NR2A 4P74A 4ILWA 2VUMH 1K73C 5C6AA 1HR0Q 3VYTA 3DXJC 1XPRA 4AIMA 1WYDA 4FXKC 2CVRA 1I50H 4JI1L 5CV8A 4JI7L 5JJZA 3AB9A 3U4VA 1IYUA 5G3LD 3CCEA 4RHSA 1N34Q 3PO2H 1IZ6A 1H95A 2B2VA 4P2CB 3GTKH 3GTMB 1LT5D 5LMNL 3NTKA 1JWUD 5IT9c 3OSOA 3RZOH 1FNVA 2KENA 3S14H 3JAML 3OW7A 2L0CA 2MUYA 4UDUC 4DV1Q 1C9OA 2EVBA 2B2WA 1W2BA 4B08A 4X64Q 3NBHB 5C5MA 1BDOA 2B2TA 1LTTD 2PYKA 4GKKL 4DAYA 3FDTA 2E2JB 4LFAL 1PH6A 1UEBA 2EYLA 1XNRL 1Q1EA 3TDQA 4NXML 3P7JA 5IY0A 3HOVB 5J22A 1E2ZA 4QIWE 5CR3A 5EPKA 2UU9Q 4L5TA 2ZXRA 1V1OA 4KJOA 2AKWB 3GDEA 2WB1G 3ND8A 2JA5H 1BKBA 3A8JE 1L2FA 1SJHD 3E9HA 3D3RA 1WTWA 1TWGH 1KAWA 4ZKBB 2SDFA 4JBKA 1VQGA 1CKNB 3TP8A 5IGGA 3T1YQ 1VMPA 3RZDH 2QDBA 4BXXG 1Y1WB 3UDGA 1OO9B 3D4RA 4LFCQ 4CDCC 1TR5A 3PMFA 3GTOB 5K36H 1BNZA 1I94Q 2A68D 3MEHA 1R4QB 4UPAA 1GOZA 1SROA 4XQQA 1PTOF 3MHBA 2PQEA 1SXTA 4ULLA 3CKIB 3CU7A 2BH2A 1STAA 3HOYB 4IQZA 2LXKA 1ENFA 1QVGA 1S72A 2XWBB 2L9HA 4J8QA 1K3RA 2I46A 4H02A 3PF5A 1I4XA 5IWAQ 4BWGB 4APVA 4QQBX 3S15B 1EY4A 1W6KA 4FO2A 4I7ZC 3TEHB 1VDZA 1JB7A 2DUDA 3OTOL 1XMQQ 2NUCA 3OWEB 1FJGQ 4DAYB 2D0OA 1E2WA 2WKDA 5IE8A 1D5ZC 3D0FA 4ID6A 4J1MA 2ZXOA 4UP8A 1Y8OB 5I6YA 2KVMA 4BY7H 2BCOA 2IWHA 3TMEA 1QZHA 3E5SA 1IXRA 5GQOA 3CMAA 5I9OA 1EY5A 1EEFD 2B8GA 3NUCA 4OHJA 2HT1A 5CC4A 2A69D 4XXEA 3JAME 2MGSA 5JVH3 3CCLA 4KV6A 2N55A 3T51B 2YV5A 4A3KG 3S16B 2ZT9C 3URYA 1J5EQ 2OWOA 5J39A 5LHY1 4HIKA 3HEJA 5CV4A 3GTPH 5IYCG 4IZ8A 2CW0D 4B3TQ 4DXGA 1XYIA 1HZAA 3BG3A 4GN3B 2FJ2A 2NVTB 1PH2A 4GKJQ 3GP7A 3S2DB 4JI3L 3K6OA 4JV5Q 1K28A 2WV6D 3GTGB 1D7QA 4R4QA 5GADC 4DR3L 1A8VA 4CDDC 5IGEA 2ATWA 1NBWA 5IGBA 3I70A 4A3JB 4C3JB 3NQIA 1GUNA 2E5LL 3J80L 2M9VA 3BYTB 4H13C 3H94A 1K8GA 1H9KA 1BOSA 1P16A 1OXSC 4WFN3 1B3QA 1EYCA 1SLJA 2N88A 4R8IA 1MJCA 2KA7A 2JEAI 1PZJD 2HHHQ 4LFBL 3BDCA 1L1OC 4LF4L 1X6OA 2CQOA 5I9PA 4KY5A 2CFMA 1LTLA 3CAMA 1GXDC 2LXJA 2CWAA 4YCWA 3HKZG 4AH6A 4G7HC 4QY7A 3K7AB 2KEEA 2OT2A 5AFWA 2NN6I 4DAMA 2R93H 1I4GA 4HMIA 4QUFA 2RDFA 4L8JA 4A3EG 1BCPD 1WD1A 1VQHA 3VA7A 3ER0A 4A3BG 4DV4Q 4CKCA 3HOUG 3LWEA 4I65A 3F2CA 4A3DG 5AJ3Q 3UE1A 4AQYQ 2ZJRA 2UUAQ 1DM0B 3QB3A 2EOTA 2IX1A 1B50A 3H0GG 1DJRD 4ZRZA 1BXTA 1RJTA 2K6AA 3T16A 4GOPA 3H3VI 3GTJB 1EOTA 4DR7L 2Z6KA 1PYBA 3RNUA 3STBD 3PF4A 4KTAA 1AFPA 1I3QB 3CXCA 4BXXH 1TWAH 4B9XA 5FKAC 3R2TA 1KNEA 1S5CD 1EZ6A 5FK9C 4DV7Q 4RGMA 2NTTA 1EY6A 1QCBD 4UP9A 5KIXA 2QEXA 3ONAB 1L0YB 1K0SA 3M3YB 2R7DA 4OL7A 1GM5A 3C3LA 4WJ4A 1CSPA 1YVCA 4OWWB 1AN8A 3TZDA 5IOCA 2SNSA 1D5MC 2MFIA 1G6PA 3LX0A 4IJHA 1HNZQ 4DV3Q 5HURA 2CH4A 1K0RA 3I3CA 3TRZA 4DNTB 4HIDA 3M9BA 4LMQD 3HOXB 3NENA 4DV0Q 2KUMA 2K1BA 3J80E 2A74C 4A3LG 2UUCL 1EWCA 2QCPX 3GTLB 3Q23A 5M3MB 1C0AA 5JOBA 5CV6A 4B3SL 3LWUA 4JCVE 4X62Q 1EEID 3VDYA 3AYHB 2E8GA 4WORA 2YTYA 2XNAC 4DUZL 3HOZG 1LABA 2JK8A 3I73A 1TWHB 1VQPA 3DUZA 2VB3X 4HSVA 4UAIA 4GOPB 1A3VA 3S1QB 1I6HB 2KBNA 5IGDA 4DR1Q 5JJKA 4NW2A 3OIQA 1QUQA 3BZDB 4GNXA 1IBKQ 3KJPA 3T56B 4BY1B 1VF5C 3I72A 4RAUC 4YCVA 1EQVA 3K8AA 1LTBD 4K8JA 5D14A 1YEZA 2K75A 1X3EA 1PH7A 4JBMA 4YY3Q 4LF6Q 3I4MG 1QVCA 3EQLC 3I4NG 1BO0A 2RKSA 3NWTA 3UDFA 5BN3A 4LJZC 2VQFQ 4CGYB 4N8FA 3CCQA 3BDOA 1N36L 1NE3A 1TWFH 4XIGS 2K04A 4G7ZC 4DK1A 1ENCA 2B3GA 2MP1A 5KRUA 4A3CG 3HOWG 3E3XA 1K83H 2NVQH 2O2LD 2C35B 4R4CA 2YYZA 1PA6A 4XQJA 4JI4L 1B3AA 3M7GA 4NMZA 1YJWA 3W1BA 2R7ZB 2PZWA 2F0WA 1DOKA 4MTNA 4TVAB 5CGKA 4WJWA 4XQNA 1WCMB 1XMOL 1KIXA 4GN4B 4RGNA 1FNUA 3PGZA 4QIWB 3S1MH 5C4XB 5CBAE 1YHAA 1RTOA 1N33Q 1PHJA 4A3EH 3L7ZC 4YHHQ 2PW7A 5FO7B 1AZPA 4JBJA 1OXUA 2IHEA 3CMEA 4A3BH 3MFYA 3U4ZA 1HXYD 1JJCB 4HN7A 4RWSC 5T1IA 4TKOB 4TQUS 5JJLA 2B29A 4A3DH 1QUQB 1SNMA 4GNXB 3TQYA 5C3EB 3RUZA 4A93H 4C3HG 1XJVA 3H0GH 4IUNA 5EGTA 5JJIA 4FNFA 3QR8A 4N9PA 4MZ9A 4A3IB 3MTSA 5CMDA 4DA2A 4RG1A 1JJ2A 2J7ZA 2IY5B 4K6DA 3ULPA 4KJNA 3U50C 4DR4Q 1PZID 3K81C 1PTOB 3JAMc 3J81L 1F2YA 2WKCA 3G48A 2I0QA 2PQAA 3E6ZX 3KBXA 4JI1Q 4JI7Q 3K5OA 2RCNA 5M3FG 1HRJA 4C2MH 4YWLA 4MTKA 2QGQA 1SYCA 3MXPA 4R4TA 1HHVA 2KCTA 2R92B 4IO9A 5LMNQ 1Z6HA 1S5DD 5FLMG 3I55A 4H0LC 2K14A 4PG3A 2NB0A 4J6HA 1BUVT 1C48A 2EY5A 4A3MB 2JA7H 4JVZA 5LMUL 1IBLL 1F9SA 1EOVA 2H5XA 1YNJD 4RGOS 4L5SA 4GKKQ 1JCKB 4LFAQ 1YHQA 3M4OB 4NP5A 5I2XA 2AWOA 1WTQA 1Q82C 4A3LH 5A2QL 4NXMQ 2Z1CA 3FKIB 3QJYA 1PH4A 2OEOA 3KLSA 4Y7NH 4MIUA 2J0TD 3S2HH 4GLAC 4F7XA 3G71A 1A63A 4RKLA 4LF7Q 4BBRB 1VQ4A 4DU9A 2IL8A 3SVMA 3HOZH 3PO3B 1EU4A 2ZM6L 3P75A 2LKVA 4DK6C 2I5HA 3KJOA 5CYUA 4C56C 3OWFA 2F0MA 5EPLA 4R4IA 2KEDA 3I7FA 4N9TA 5ELEA 2DY7A 3D4WA 3ITPA 3BVMA 1PMRA 4FF3A 1XNQL 2EYOA 4ZK9B 3GTQB 3IRBA 1L0WA 3CC7A 4AYBE 3A5ZB 1T9HA 1ILQA 3HKSA 2PQAB 1IBML 1JE4A 2PPBC 5K36G 4OIKA 1Y1VB 2EE1A 2SNMA 1X3QA 1KXLA 4DR2L 3SK6A 1PFSA 3L2PA 1IKMA 2L5TA 5E1FA 1WTHA 4OELB 1WD0A 4E6IA 2Q2UA 1Q7YC 5JVG3 3GV3A 3I4NH 3JC66 3A7LA 3ULJA 1BVSA 4NB3A 3PQIA 3RLOA 4ZYSA 2Q2TA 5C44B 2A68C 3OTOQ 3JAMi 3J81E 1WJJA 3UE0A 1BR9A 2ZTDA 3S17H 2I5MX 4B3ML 4KN4C 1HNXQ 3M4YA 1KAAA 2Z4IA 1EQTA 1EYDA 3I4OA 3CC4A 1IL2A 2JA8B 1HA6A 1HZCA 3CHBD 4C1NK 3Q8DA 1RHPA 2KJXA 1I50B 5EPJA 1LM0A 2E74C 3MA2B 3S9WA 1E24A 1KL9A 1HZ9A 5KEEA 1YZ6A 4IFDJ 4RGTA 1X3PA 4C3IH 3WOFA 1A3UA 1PXUA 4BY7G 2KCNA 1L1OA 3S1NB 2F0UA 3TREA 3AFQA 1E7ZA 4O42A 1B70B 1O80A 3QG1A 4RH6A 1OTCA 2F0QA 2G5DA 4POGA 1LT3D 3U9OA 3J80c 1AE3A 1EFID 1HUMA 2NN6H 5A2QE 3HOVG 1G51A 1NSNS 3J81j 2F0VA 2F03A 1YI2A 2SEBD 4JI3Q 1VQEA 1Y8NB 3MXUA 1SFOB 4RKBA 1B7YB 4A4IA 1FGUA 4FVMA 3CCMA 2ZTCA 3D4DA 4DR3Q 5DNFA 4X3SA 3G4SA 3PV0A 1O7IA 2EJMA 4WRDA 2E5LQ 3H3VH 2CW0C 4IURA 4LK1C 4P71A 2R6GA 1Q81C 4JI5L 1KDBA 5FO9B 5C0XI 1II3A 1VCIA 1B2TA 1X3GA 1O7LA 5M3FH 2VQEL 4LFBQ 2A6HC 4K2KA 2EIFA 4OXPA 2F0EA 4QB4A 2F4IA 1CA6A 4LF4Q 3TS2A 2UXBL 4EGVA 1T5XD 3HGBA 2XVSA 5FLMH 3T1HL 4G57A 2UXCL 1HCZA 1BBWA 1I4RA 2OQKA 1IYJB 4DK0A 3I4LA 5M5WH 1PRTD 4LW1A 5M5XH 3CC2A 1LV9A 3HRZC 1L1OB 1HTLD 2WIIB 4G4KA 2IX3A 1DOLA 1Y14B 4KY7A 3AMUA 5E4XA 2R93G 1OXVA 3NWSA 3CCRA 1ML0D 1Q8IA 3QOLA 4KK7A 1HUNA 3EBEA 1XPOA 2XIWA 2ALYB 4K2LA 1YBYA 4PV1C 3PUVA 1A2TA 1GHKA 2JA6H 1SYBA 3SK5A 4DR7Q 1ILPA 1STGA 3MVVA 5EAYA 1BCPC 3KF8A 1EYGA 1UUPA 4JK1C 1ZXTA 1Y8PB 2JEBI 4A3GB 2RVLA 5FJ8G 3K57A 1G91A 2EYJA 4OGQC 2F0GA 2IHFA 1YJ9A 2PO4A 1F77A 1TT2A 4OX9L 1VQLA 1KRSA 4UP7A 2E2DC 3SK4A 5IGFA 4YWKA 4HAEA 3NXWA 4X3UA 4V190 3W1GA 4L6TB 1RCVD 1G8ZD 4DXFA 2HCIA 3STBC 4JC0A 1KRTA 3G6EA 4PZ7A 4ZAIA 4DGZA 3J7AV 1V9PA 4FXDA 1S40A 2OCEA 4DUYL 2BDOA 2UUCQ 1IKLA 4KI0A 3K5LA 1LTSD 3PIO3 1DOMA 1EIGA 4DNRB 4F87A 2AUJD 1VQAA 2DJFC 2K5QA 4DUZQ 1B8AA 1FGBD 3GTMH 4H7BA 2GA4B 3PIOA 2HDMA 3BJUA 4JI8Q 4Q0FA 2CQAA 4LF5L 1K8MA 4CJ0B 5TSSA 2A8VA 2K5NA 3F1ZA 2A6EC 5DEHA 2D5DA 3EA6A 3ZYYX 1N32L 4DAPA 1YJNA 3SR1A 3PUWA 4DK3C 3KK7A 1GUTA 3KF8B 2AQ3B 2UXDQ 3K0YA 1PH5A 4DR6L 1JQYD 1CQVA 3TP5A 3HOVH 3RLFA 5COYA 1KLUD 1DGSA 4GZYC 2F3IA 4OEMB 3RMHA 3EN2A 2PNHA 5ELOA 1OXTA 5K5PA 4XYOA 1GUSA 1T5EA 4HJ9A 3DWPA 2RSOA 2WAQG 2A6HD 2PCFB 1RF2D 2Y0SG 4HCEA 3PCOB 4Q5VA 2HIVA 1LYLA 1P8LA 1N36Q 4LUVA 4X66Q 4LF8L 2WB1B 5KNDA 4K0KL 3GTOH 1VQ9A 1V1QA 1EWHA 3SGIA 5D65A 4ZLTF 2ES2A 1LTAD 2K01A 1L0XB 3A74A 2EPBA 1TS3A 3CCUA 4JI4Q 1KHIA 2F3VA 3HOYH 3UI2A 5EKLA 5IP9G 5C0XG 2K7VA 1X65A 1SR3A 1KABA 1XMOQ 3BVGA 3D8GA 4UY8C 1VQBA 2F0DA 4CKEA 5KNCA 1BBUA 5D3DA 2N3SA 4JPBW 2E2HB 5KGUA 1LTID 1SYGA 2JSOA 3TN2A 1M4VA 1AP0A 4O1NA 3HG9A 3NTHA 3GO5A 5M3MG 1JE5A 1PLFA 3J81c 1YITA 3OW2A 3KF6A 3R3OA 4K8IA 2B63B 4EQ5A 3T13A 2AMCB 3FP9A 4ZKCB 4Y52H 3CRKC 4FF2A 5C4HA 1H9RA 5ELDA 2D9UA 4AYBB 1TVXA 4A93G 1STNA 1U0LA 2BE5C 1B53A 3A7AB 3QO2A 4K5WA 4FXGC 2GVAA 3RLNA 1STEA 1QNUA 3TBIB 1VQIA 4NKLA 1RODA 3MXGA 3S16H 3CQZB 2C9OA 1HJPA 5JEAG 3MEFA 3CPFA 1LUZA 1O7ZA 4NDXA 4BY1G 1G291 4ZUJA 5FJ8H 1E0BA 4DN4M 1H9JA 1B44D 2NVTH 4ME3A 3SXHA 1GD7A 4A3KB 1Z9FA 3VR2A 5HGQA 1F2ZA 3GTGH 3VA5A 2GVBA 4RA8A 2QEJC 1YNXA 2KHIA 5LMUQ 2JYOA 1TY2A 1IW7C 1ENAA 1IBLQ 4A3JH 1ICFB 1QZGA 3G7LA 1M1KC 1NJIC 3KUPA 4RFBA 1W3SA 2JA7G 2K28A 1CKOA 1TU2B 4EQNA 1ONLA 4IPCA 2A6ED 2RDGA 4DF7A 1I5FA 1SNPA 1LT4D 4HJ8A 2HUGA 3KF6B 1EY9A 2ZM6Q 5IP7G 2RBMA 3U9SA 3PUZA 1PV4A 5CORA 1G6ZA 2Q8TA 3SEBA 1YNJC 3K7AH 1WTOA 3V2TA 5DM73 3D31A 5KYLA 5M5YB 2OTJA 2FFKB 2ASBA 2DN8A 3FMCA 3A55A 3S1MB 3HKZB 3S24A 3CCJA 4X65L 3H91A 3J81i 3NHHA 4DFAA 4DR2Q 1CZWA 5JPMC 3N6RA 3HOUB 1RL2A 1E1TA 2I5LX 3EFXD 4A3DB 2ZTEA 1E2VA 4NXNQ 5CBEE 1B1ZA 3CW2C 3KLWA 1O78A 1FYCA 2OXPA 3H0GB 3IL8A 1I3QH 3A8KE 1JWMD 2UUBL 3S1RB 3PIPA 2P5ZX 5DAUA 4B3MQ 4JI2L 3CF5A 1R9TB 2D2CC 3M3YH 4JBWA 1FL0A 1J5EL 4BBSB 5IP9H 5C0XH 2LFNA 1CSQA 3MZ5A 2E2IB 1SDFA 4EQPA 2XWJB 2PZUA 2QF7A 3J7YW 2Z0SA 5I4DA 3WOEA 5NUCA 3HOXH 3NK9A 1VQ5A 1C7YA 1ET6A 3CRLC 1QJOA 4X3TA 4C3IG 1EY0A 3ICEA 2FINB 5E3FA 2ZJQA 3TZUA 3GTLH 5M3MH 2NVXH 2BE5D 2YTXA 5C3WA 2F0IA 2XRSD 4HJ7A 3R2IA 3QWNA 2EY6A 1CZGA 1PFNA 2VS1A 1SNDA 2NN6G 1TWHH 1EQQA 1ASZA 2Z6BA 2F52A 3S1QH 1CK1A 3IAYA 4DV5Q 4YIJA 5JEAH 1KQSA 1HPCA 1Q46A 1TS2A 3V05A 2F0HA 2L15A 1BF4A 1WVLA 4BY1H 4F88A 2HQLA 4L63B 2V1CC 1CT1D 1M8AA 5H1SE 4K5VA 2KHJA 2VQEQ 2EYMA 1IW7D 5DLQE 3IFTA 3FPUB 3J7AF 2B2YC 4KKUA 3KOJA 2G9DA 2E76C 2UXBQ 1JICA 1MD2D 3OHXC 3T1HQ 2EQSA 2UXCQ 4P72A 1EIYB 1HFNA 1RD9D 4J15A 5C4JB 4RCOA 1MKHA 2L12A 1QNKA 1KDAA 2WB1E 1MI2A 4IUPA 1NR4A 5C44G 3U58A 3I4MB 2KQ3A 1RDPD 3NQTA 1XXGA 1CHQD 3I4NB 2EZVA 4DNIA 1TWCH 3O13A 4HIMA 2LMCB 3SE0A 2HIXA 2Z4HA 1MSHA 1XNRQ 2V4DA 1V1PA 2JA8G 2PMZE 4P75A 1C4QA 5EQ0A 2F0TA 2ICIA
chains in the Genus database with same CATH topology
4LF4Q 3TS2A 4DV7L 5IYBG 4B3TQ 1E22A 1HZAA 4GN3B 4R4OA 3CPWA 1XMQL 5IP7H 2UXBL 5E7NA 4GS3A 3KFUA 4A3IG 1J6QA 1PH2A 1FJGL 1PYSB 5C4XH 5FLMH 3GTJH 3CQZH 1D8LA 4GN5A 4JI3L 4JI8L 1BBWA 4DV6L 4A3FG 2UXCL 4JV5Q 2WFWA 2OQKA 2JA6G 1NY4A 2K4KA 3TS0A 4MNOA 3ULLA 1IYJB 1D7QA 1E1OA 4R4QA 5GADC 4DR3L 1QVFA 1A8VA 1UWVA 4LWCA 4OONA 5M5WH 4LW1A 1UE5A 1NBWA 1SN8A 2BA1A 5M5XH 3ERSX 5IYCG 4HJAA 3CC2A 1HZBA 4A3KH 3M7NA 1L1OB 4OX9Q 1Y14B 2UXDL 2DGYA 2E5LL 1OXVA 5IYCH 5C3EH 2R93G 2K52A 3CCRA 1K8GA 3EBEA 1P16A 1OXSC 1XPOA 2ALYB 2JQOA 1SLJA 2R92G 1YBYA 1MJCA 2JEAI 2K5VA 3PUVA 4JOIC 2NZHA 4HJ5A 2HHHQ 4LFBL 1L1OC 1VQNA 4LF4L 1X6OA 4B3TL 2CQOA 4NPSA 2VY3A 2JA6H 1RIPA 4A3MG 4DR7Q 3B6YA 2CFMA 1GKHA 4GKJL 5EAYA 4DUYQ 1LTLA 3CAMA 2LXJA 1NMFA 1EYGA 2CWAA 4YCWA 2K50A 3HKZG 4AH6A 4ALPA 4JV5L 4OO1I 4X66L 4QY7A 3I56A 4DAMA 2RHSB 2NN6I 2JEBI 2R93H 4KHZA 4A3EG 5FJ8G 3KDFB 1PH3A 2WP8J 3FKIG 3AFPA 1IBMQ 1A62A 1VQFA 1VQHA 4DR1L 3ER0A 2IHFA 1YJ9A 4DV4Q 4A3BG 3HOUG 4OX9L 4B3RQ 1EIFA 1VQLA 1KRSA 4YWMA 4OWXB 4UP7A 3F2CA 4IPHA 5AJ3Q 4P73A 3UE1A 2ZJRA 4YWKA 4AQYQ 4BBRG 2UUAQ 1VS0A 3PO3G 1WFQA 1VQ8A 4LF5Q 3W1GA 2VZAA 2FXQA 4A3MH 5M5YH 2IX1A 3H0GG 4YCUA 3STBC 4JC0A 5ELNA 2HHHL 1N32Q 4GOPA 1KRTA 3G6EA 4PZ7A 3T1HL 1M90C 3H3VI 3M4OH 1V9PA 4DR7L 1I6HH 2D0PA 2Z6KA 4DPGA 5FLXc 3PSIA 1PYBA 3RNUA 3STBD 3PF4A 1S40A 2OCEA 4WJ3M 3FKIH 4DUYL 1AH9A 1XTDA 1VQ6A 1EUJA 3CXCA 4KI0A 4DV2Q 2UUCQ 4JI5Q 1TWAH 4BXXH 3HOUH 3UDXA 3K0XA 4LUOA 1PH8A 4BBRH 4DV7Q 2RF4A 3PO3H 1Y1VG 1KC8C 4QJFA 1VQAA 4UP9A 4DV4L 2QEXA 4DUZQ 1B8AA 3GTMH 1OXXK 2NVYH 3PIOA 4B3RL 2R7DA 3BJUA 4JI8Q 3H15A 1GM5A 5AJ3L 4AQYL 4WJ4A 2UUAL 2MNAA 1CSPA 1YVCA 1VQCA 4LF5L 4LF8Q 4OWWB 1FVIA 4O2DA 3S1RH 2A8VA 1X56A 2YU9H 4K0KQ 2K5NA 3F1ZA 5LMNW 4A3GG 2MFIA 4IJLA 1G6PA 1N32L 3HKZE 3HFZB 4IJHA 3F2BA 1R9TH 1HNZQ 5GAEC 4DV3Q 4GKJQ 1YJNA 1UE7A 2Q2IA 4OWTB 3PUWA 1K0RA 4DK3C 5GROA 1Y1WG 1Q86C 3TRZA 3KF8B 4LNQA 5C0XJ 2UXDQ 4FDBA 4BBSH 4HIDA 3M9BA 1PH5A 2BH8A 3NENA 5GAHC 4DV0Q 2VNUD 4DR6L 2JJQA 1Y1VH 4A3LG 1EFWA 3HOVH 3RLFA 4DV2L 2A1AA 2UUCL 2VUMG 1C0AA 4B3SL 1JT8A 4BA1I 2E2IH 4JCVE 1DGSA 3RN5A 2F3IA 3MXNB 3KYHC 1YHBA 4KLKA 4X62Q 3EN2A 2PNHA 3VDYA 3AYHB 5ELOA 1HR0W 3HOYG 1OXTA 4O0AA 2E8GA 1WCMH 1JJGA 2YTYA 3DM3A 1SE8A 4HJ9A 1HH2P 4DUZL 3HOZG 2VW9A 3PO2G 4KHPL 2JK8A 1ASYA 4JI0Q 2WAQG 5C44H 1VQPA 2Y0SG 3A5UA 3PCOB 1PH9A 2HIVA 1LYLA 2AHOB 2KCMA 1P8LA 1SMXA 3K7UC 4IOCA 1N36Q 4LUVA 4X66Q 4LF8L 4POFA 4GOPB 2BA0A 3J7ZC 4K0KL 2F4VQ 3GTOH 3W5OA 1VQ9A 1V1QA 2KBNA 3SGIA 1HNZL 1X54A 2ZJPA 4DV3L 4DR1Q 4LF9Q 2R7FA 1Q8KA 3DLLA 2ES2A 5JJKA 1QUQA 2Q2HA 4GNXA 1IBKQ 3KJPA 2JA8H 3A74A 4DV0L 3CCUA 3RN2A 1KHIA 5IYBH 4GOPC 4JI4Q 1U5KA 4JI6Q 4YCVA 1XPUA 3HOYH 4BA2I 5IP9G 5C0XG 3K8AA 1X65A 3CP0A 5JEAJ 1SR3A 2Z6KC 4A3IH 1XMOQ 1X9NA 1VQDA 4A3FH 3S1NH 1YEZA 2K75A 1X3EA 1PH7A 4JBMA 4UY8C 4YY3Q 4X62L 1VQBA 1Q1BA 4LF6Q 3I4MG 1PH1A 1BBUA 1QVCA 2N3SA 2ATWA 2JA5G 3I2ZA 3I4NG 4JI0L 3UDFA 2VQFQ 3CCQA 3GO5A 3BZKA 5M3MG 1JE5A 1NE3A 1NMGA 1TWFH 1N36L 4XIGS 2F4VL 3J81c 1YITA 4LFBQ 3OW2A 4EX5A 1TXYA 2B3GA 3KF6A 1SFOH 5C4JH 4EQ5A 4LF9L 4A3CG 1MIUA 2R92H 3HOWG 1K83H 3J80i 2AMCB 3FP9A 3M85A 2NVQH 1YIJA 2N49A 1IBKL 4Y52H 2C35B 4R4CA 2YYZA 1PA6A 2K5HA 1KD1C 4JI4L 4JI6L 3I4MH 4JG2A 1YJWA 3W1BA 2PI2E 4LF7L 4A93G 1U0LA 4MTNA 4NXNL 4IPDA 2WAQE 4TVAB 2N78A 1XMOL 1KIXA 2Y0SE 1CKMA 2GVAA 4GN4B 3PUXA 3RLNA 1VQIA 3PGZA 4YY3L 3S1MH 4LF6L 1X3FA 4IPGA 3S16H 1HNWQ 1HJPA 5JEAG 3AEVA 3EIVA 3MEFA 1YHAA 4A3JG 2XTIA 3CPFA 4PMWA 3F2DA 1LUZA 1N33Q 4BY1G 4A3EH 1G291 3L7ZC 5FJ8H 1PHJA 4YHHQ 4DR6Q 1S3OA 4JBJA 1OXUA 2IHEA 2IT1A 5IYDG 3CMEA 2VQFL 4A3BH 4OO1G 4A3CH 3U4ZA 3HOWH 2NVTH 2A19A 4ME3A 2OTLA 4B3SQ 1JJCB 2LSSA 1GD7A 4TQUS 5JJLA 1Z9FA 2EXDA 2B29A 4A3DH 1QUQB 1E3PA 4GNXB 5GAGC 3TQYA 5HGQA 1UE6A 3GTGH 4A93H 1XJVA 3H0GH 2GVBA 2VL6A 5JJIA 3E0EA 2CCZA 1K9MC 4DKAC 3NELA 4MZ9A 1N8RC 1YNXA 2KHIA 5LMUQ 1IBLQ 4RG1A 3ZJYC 1GO3E 4A3JH 1JJ2A 2IY5B 1QZGA 4GNXC 2MQHA 3ULPA 1M1KC 4IFDI 3U50C 1NJIC 4DR4Q 4X65Q 2B63G 1W3SA 3K81C 5J3BA 3WWVA 2JA7G 5IYDH 3JAMc 2E2JH 3GTQH 4JYAQ 1HNWL 1CKOA 2OQ0A 3M4PA 4QGUA 5BR8Q 3G48A 4IPCA 5HY6A 2PQAA 2I0QA 1N33L 1I5FA 4JI1Q 4YHHL 4JI7Q 2RCNA 5M3FG 2ID0A 4AYBG 4C2MH 2NZOA 4HJ8A 4GLXA 4C3HH 1VQ7A 1N9WA 1HNXL 3KF6B 4YWLA 2QGQA 3K80C 2ZM6Q 4R4TA 5IP7G 4LUZA 2KCTA 4IO9A 1GVPA 3PUZA 1PV4A 1CUKA 5LMNQ 5FLMG 3I55A 2K14A 4PG3A 2IX0A 3K7AH 2YTVA 1WI5A 4A3GH 4PZ6A 3GD7A 2UUBQ 3D31A 1CKNA 2JA7H 2OTJA 2ASBA 5LMUL 2QA4A 4DV5L 1X55A 3FHWA 1SRUA 2H5XA 1EOVA 2XGTA 4JI2Q 4DR5Q 1Y1WH 3A0JA 1IBLL 4L5SA 1NTGA 4GKKQ 3CCSA 4LFAQ 1YHQA 3S24A 1EWIA 4KHPQ 2AWOA 3NEMA 3CCJA 3L0OA 3CD6A 4DR4L 1Q82C 4X65L 4P74A 3J81i 2JE6I 4A3LH 4NXMQ 2VUMH 1K73C 4JYAL 1PH4A 1HR0Q 3F8TA 1Q12A 4Y7NH 1VQOA 4AIMA 5BR8L 4DR2Q 1XPRA 1WYDA 3S2HH 4IOAA 1I50H 4JI1L 4JI7L 1RL2A 1E1TA 4GLAC 3G71A 1A63A 2I5LX 2ZTEA 3U4VA 4LF7Q 1Z47A 4NXNQ 2PI2A 3AQQA 3CCEA 1VQ4A 1N34Q 3PO2H 3HOZH 4A76A 1IZ6A 3CW2C 3KLWA 2ZM6L 1A0IA 1H95A 3GTKH 1I3QH 2JA9A 4DK6C 2I5HA 5LMNL 3KJOA 5IT9c 3RR5A 3S15H 3RZOH 1JMCA 4R4IA 3HOXG 2KENA 3S14H 2UUBL 3PIPA 1PVOA 3I7FA 4DV1Q 1W2BA 1C9OA 4X64Q 3NBHB 4B3MQ 4JI2L 3CF5A 4DR5L 4L5RC 1XNQL 4GKKL 4LFAL 3M3YH 4JBWA 1PH6A 3IRBA 1UEBA 1FL0A 1L0WA 3CC7A 1J5EL 1XNRL 4AYBE 1Q1EA 3A5ZB 1T9HA 3HKSA 1IBML 2PQAB 1EQRA 1VQMA 5IP9H 4NXML 5K36G 1HR0L 5IY0A 1KXLA 1CSQA 4DR2L 4QIWE 4QL5A 2UU9Q 1PFSA 3OYYA 3L2PA 4L5TA 3GTPH 2Q2UA 2AKWB 2RHQB 3GDEA 2WB1G 1Q7YC 4R1JA 2Z0SA 1UE1A 1N34L 2JA5H 3JC66 3I4NH 3HOXH 1BKBA 3ULJA 1VQ5A 1BVSA 4NB3A 1C7YA 1L2FA 2MO1A 3E9HA 3UDIA 2MO0A 1TWGH 1K8AC 1KAWA 3RLOA 3ICEA 2ZJQA 2Q2TA 4JBKA 1VQGA 3GTLH 5M3MH 1CKNB 2NVXH 1AE2A 2YTXA 3OTOQ 3JAMi 3T1YQ 3RZDH 2GN5A 4PZ8A 4BXXG 1WJJA 2D62A 4A75A 4HJ7A 3UDGA 3UE0A 2ZTDA 4LFCQ 4DV1L 3S17H 4X64L 2I5MX 4B3ML 1HNXQ 3LGJA 1I94Q 2VS1A 2NN6G 1TWHH 4UPAA 3S2DH 1EQQA 1SROA 3I4OA 3CC4A 1ASZA 1IL2A 1HZCA 2R7ZH 3Q8DA 2BH2A 1LM0A 1MJEA 2F52A 1E24A 1KL9A 1HZ9A 3S1QH 1YZ6A 2N8NA 4IFDJ 2LXKA 3E9IA 2UU9L 4C3IH 1QVGA 4JOIA 4DV5Q 1S72A 4BY7G 3PUYA 1L1OA 3TREA 1K3RA 1KQSA 1Q46A 3PF5A 4H02A 3AFQA 4C3JH 2L15A 5IWAQ 4APVA 4BY1H 4QQBX 2HQLA 4XTCS 1E7ZA 3CCVA 2V1CC 1B70B 5H1SE 4BBSG 2VQEQ 2KHJA 2CWPA 3TEHB 1JB7A 1OTCA 2DUDA 2CKZB 5DLQE 4POGA 3J80c 1AE3A 3KOJA 3T1YL 3OTOL 3HOVG 4X6AH 1G51A 1XMQQ 3J81j 2UXBQ 1FJGQ 4DAYB 4LFCL 2D0OA 2EQSA 3T1HQ 1YI2A 4JI3Q 1VQEA 4P72A 2UXCQ 4DV6Q 1WOCA 2E2HH 1EIYB 4GLVB 2R7ZG 4J15A 1I94L 3M4QA 1B7YB 1MKHA 1FGUA 1WCMG 4A4IA 5IE8A 3CCMA 4HIOA 3D0FA 2ZTCA 4UP8A 4DR3Q 3J7A5 5C4XG 2WB1E 4BY7H 5C44G 1QZHA 3U58A 3G4SA 3PV0A 1IXRA 4RMFA 5GQOA 3CMAA 3KDFA 1O7IA 2HT1A 2B63H 2E5LQ 4A3DG 4DNIA 1TWCH 3H3VH 4L5QA 3CCLA 4P71A 2R6GA 1XNQQ 1Q81C 4HIMA 4JI5L 4IFDG 2YV5A 5IWAL 5C0XI 4A3KG 1V43A 1VQKA 1VQJA 2HIXA 3BU2A 1VCIA 1J5EQ 2OWOA 4HIKA 1XNRQ 1X3GA 2AWNA 5M3FH 3BZCA 2JA8G 2PMZE 2VQEL 4P75A 5C3EG 2EIFA 4OXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 Q;  3TS2 A;  4DV7 L;  5IYB G;  4B3T Q;  1E22 A;  1HZA A;  4GN3 B;  4R4O A;  3CPW A;  1XMQ L;  5IP7 H;  2UXB L;  5E7N A;  4GS3 A;  3KFU A;  4A3I G;  1J6Q A;  1PH2 A;  1FJG L;  1PYS B;  5C4X H;  5FLM H;  3GTJ H;  3CQZ H;  1D8L A;  4GN5 A;  4JI3 L;  4JI8 L;  1BBW A;  4DV6 L;  4A3F G;  2UXC L;  4JV5 Q;  2WFW A;  2OQK A;  2JA6 G;  1NY4 A;  2K4K A;  3TS0 A;  4MNO A;  3ULL A;  1IYJ B;  1D7Q A;  1E1O A;  4R4Q A;  5GAD C;  4DR3 L;  1QVF A;  1A8V A;  1UWV A;  4LWC A;  4OON A;  5M5W H;  4LW1 A;  1UE5 A;  1NBW A;  1SN8 A;  2BA1 A;  5M5X H;  3ERS X;  5IYC G;  4HJA A;  3CC2 A;  1HZB A;  4A3K H;  3M7N A;  1L1O B;  4OX9 Q;  1Y14 B;  2UXD L;  2DGY A;  2E5L L;  1OXV A;  5IYC H;  5C3E H;  2R93 G;  2K52 A;  3CCR A;  1K8G A;  3EBE A;  1P16 A;  1OXS C;  1XPO A;  2ALY B;  2JQO A;  1SLJ A;  2R92 G;  1YBY A;  1MJC A;  2JEA I;  2K5V A;  3PUV A;  4JOI C;  2NZH A;  4HJ5 A;  2HHH Q;  4LFB L;  1L1O C;  1VQN A;  4LF4 L;  1X6O A;  4B3T L;  2CQO A;  4NPS A;  2VY3 A;  2JA6 H;  1RIP A;  4A3M G;  4DR7 Q;  3B6Y A;  2CFM A;  1GKH A;  4GKJ L;  5EAY A;  4DUY Q;  1LTL A;  3CAM A;  2LXJ A;  1NMF A;  1EYG A;  2CWA A;  4YCW A;  2K50 A;  3HKZ G;  4AH6 A;  4ALP A;  4JV5 L;  4OO1 I;  4X66 L;  4QY7 A;  3I56 A;  4DAM A;  2RHS B;  2NN6 I;  2JEB I;  2R93 H;  4KHZ A;  4A3E G;  5FJ8 G;  3KDF B;  1PH3 A;  2WP8 J;  3FKI G;  3AFP A;  1IBM Q;  1A62 A;  1VQF A;  1VQH A;  4DR1 L;  3ER0 A;  2IHF A;  1YJ9 A;  4DV4 Q;  4A3B G;  3HOU G;  4OX9 L;  4B3R Q;  1EIF A;  1VQL A;  1KRS A;  4YWM A;  4OWX B;  4UP7 A;  3F2C A;  4IPH A;  5AJ3 Q;  4P73 A;  3UE1 A;  2ZJR A;  4YWK A;  4AQY Q;  4BBR G;  2UUA Q;  1VS0 A;  3PO3 G;  1WFQ A;  1VQ8 A;  4LF5 Q;  3W1G A;  2VZA A;  2FXQ A;  4A3M H;  5M5Y H;  2IX1 A;  3H0G G;  4YCU A;  3STB C;  4JC0 A;  5ELN A;  2HHH L;  1N32 Q;  4GOP A;  1KRT A;  3G6E A;  4PZ7 A;  3T1H L;  1M90 C;  3H3V I;  3M4O H;  1V9P A;  4DR7 L;  1I6H H;  2D0P A;  2Z6K A;  4DPG A;  5FLX c;  3PSI A;  1PYB A;  3RNU A;  3STB D;  3PF4 A;  1S40 A;  2OCE A;  4WJ3 M;  3FKI H;  4DUY L;  1AH9 A;  1XTD A;  1VQ6 A;  1EUJ A;  3CXC A;  4KI0 A;  4DV2 Q;  2UUC Q;  4JI5 Q;  1TWA H;  4BXX H;  3HOU H;  3UDX A;  3K0X A;  4LUO A;  1PH8 A;  4BBR H;  4DV7 Q;  2RF4 A;  3PO3 H;  1Y1V G;  1KC8 C;  4QJF A;  1VQA A;  4UP9 A;  4DV4 L;  2QEX A;  4DUZ Q;  1B8A A;  3GTM H;  1OXX K;  2NVY H;  3PIO A;  4B3R L;  2R7D A;  3BJU A;  4JI8 Q;  3H15 A;  1GM5 A;  5AJ3 L;  4AQY L;  4WJ4 A;  2UUA L;  2MNA A;  1CSP A;  1YVC A;  1VQC A;  4LF5 L;  4LF8 Q;  4OWW B;  1FVI A;  4O2D A;  3S1R H;  2A8V A;  1X56 A;  2YU9 H;  4K0K Q;  2K5N A;  3F1Z A;  5LMN W;  4A3G G;  2MFI A;  4IJL A;  1G6P A;  1N32 L;  3HKZ E;  3HFZ B;  4IJH A;  3F2B A;  1R9T H;  1HNZ Q;  5GAE C;  4DV3 Q;  4GKJ Q;  1YJN A;  1UE7 A;  2Q2I A;  4OWT B;  3PUW A;  1K0R A;  4DK3 C;  5GRO A;  1Y1W G;  1Q86 C;  3TRZ A;  3KF8 B;  4LNQ A;  5C0X J;  2UXD Q;  4FDB A;  4BBS H;  4HID A;  3M9B A;  1PH5 A;  2BH8 A;  3NEN A;  5GAH C;  4DV0 Q;  2VNU D;  4DR6 L;  2JJQ A;  1Y1V H;  4A3L G;  1EFW A;  3HOV H;  3RLF A;  4DV2 L;  2A1A A;  2UUC L;  2VUM G;  1C0A A;  4B3S L;  1JT8 A;  4BA1 I;  2E2I H;  4JCV E;  1DGS A;  3RN5 A;  2F3I A;  3MXN B;  3KYH C;  1YHB A;  4KLK A;  4X62 Q;  3EN2 A;  2PNH A;  3VDY A;  3AYH B;  5ELO A;  1HR0 W;  3HOY G;  1OXT A;  4O0A A;  2E8G A;  1WCM H;  1JJG A;  2YTY A;  3DM3 A;  1SE8 A;  4HJ9 A;  1HH2 P;  4DUZ L;  3HOZ G;  2VW9 A;  3PO2 G;  4KHP L;  2JK8 A;  1ASY A;  4JI0 Q;  2WAQ G;  5C44 H;  1VQP A;  2Y0S G;  3A5U A;  3PCO B;  1PH9 A;  2HIV A;  1LYL A;  2AHO B;  2KCM A;  1P8L A;  1SMX A;  3K7U C;  4IOC A;  1N36 Q;  4LUV A;  4X66 Q;  4LF8 L;  4POF A;  4GOP B;  2BA0 A;  3J7Z C;  4K0K L;  2F4V Q;  3GTO H;  3W5O A;  1VQ9 A;  1V1Q A;  2KBN A;  3SGI A;  1HNZ L;  1X54 A;  2ZJP A;  4DV3 L;  4DR1 Q;  4LF9 Q;  2R7F A;  1Q8K A;  3DLL A;  2ES2 A;  5JJK A;  1QUQ A;  2Q2H A;  4GNX A;  1IBK Q;  3KJP A;  2JA8 H;  3A74 A;  4DV0 L;  3CCU A;  3RN2 A;  1KHI A;  5IYB H;  4GOP C;  4JI4 Q;  1U5K A;  4JI6 Q;  4YCV A;  1XPU A;  3HOY H;  4BA2 I;  5IP9 G;  5C0X G;  3K8A A;  1X65 A;  3CP0 A;  5JEA J;  1SR3 A;  2Z6K C;  4A3I H;  1XMO Q;  1X9N A;  1VQD A;  4A3F H;  3S1N H;  1YEZ A;  2K75 A;  1X3E A;  1PH7 A;  4JBM A;  4UY8 C;  4YY3 Q;  4X62 L;  1VQB A;  1Q1B A;  4LF6 Q;  3I4M G;  1PH1 A;  1BBU A;  1QVC A;  2N3S A;  2ATW A;  2JA5 G;  3I2Z A;  3I4N G;  4JI0 L;  3UDF A;  2VQF Q;  3CCQ A;  3GO5 A;  3BZK A;  5M3M G;  1JE5 A;  1NE3 A;  1NMG A;  1TWF H;  1N36 L;  4XIG S;  2F4V L;  3J81 c;  1YIT A;  4LFB Q;  3OW2 A;  4EX5 A;  1TXY A;  2B3G A;  3KF6 A;  1SFO H;  5C4J H;  4EQ5 A;  4LF9 L;  4A3C G;  1MIU A;  2R92 H;  3HOW G;  1K83 H;  3J80 i;  2AMC B;  3FP9 A;  3M85 A;  2NVQ H;  1YIJ A;  2N49 A;  1IBK L;  4Y52 H;  2C35 B;  4R4C A;  2YYZ A;  1PA6 A;  2K5H A;  1KD1 C;  4JI4 L;  4JI6 L;  3I4M H;  4JG2 A;  1YJW A;  3W1B A;  2PI2 E;  4LF7 L;  4A93 G;  1U0L A;  4MTN A;  4NXN L;  4IPD A;  2WAQ E;  4TVA B;  2N78 A;  1XMO L;  1KIX A;  2Y0S E;  1CKM A;  2GVA A;  4GN4 B;  3PUX A;  3RLN A;  1VQI A;  3PGZ A;  4YY3 L;  3S1M H;  4LF6 L;  1X3F A;  4IPG A;  3S16 H;  1HNW Q;  1HJP A;  5JEA G;  3AEV A;  3EIV A;  3MEF A;  1YHA A;  4A3J G;  2XTI A;  3CPF A;  4PMW A;  3F2D A;  1LUZ A;  1N33 Q;  4BY1 G;  4A3E H;  1G29 1;  3L7Z C;  5FJ8 H;  1PHJ A;  4YHH Q;  4DR6 Q;  1S3O A;  4JBJ A;  1OXU A;  2IHE A;  2IT1 A;  5IYD G;  3CME A;  2VQF L;  4A3B H;  4OO1 G;  4A3C H;  3U4Z A;  3HOW H;  2NVT H;  2A19 A;  4ME3 A;  2OTL A;  4B3S Q;  1JJC B;  2LSS A;  1GD7 A;  4TQU S;  5JJL A;  1Z9F A;  2EXD A;  2B29 A;  4A3D H;  1QUQ B;  1E3P A;  4GNX B;  5GAG C;  3TQY A;  5HGQ A;  1UE6 A;  3GTG H;  4A93 H;  1XJV A;  3H0G H;  2GVB A;  2VL6 A;  5JJI A;  3E0E A;  2CCZ A;  1K9M C;  4DKA C;  3NEL A;  4MZ9 A;  1N8R C;  1YNX A;  2KHI A;  5LMU Q;  1IBL Q;  4RG1 A;  3ZJY C;  1GO3 E;  4A3J H;  1JJ2 A;  2IY5 B;  1QZG A;  4GNX C;  2MQH A;  3ULP A;  1M1K C;  4IFD I;  3U50 C;  1NJI C;  4DR4 Q;  4X65 Q;  2B63 G;  1W3S A;  3K81 C;  5J3B A;  3WWV A;  2JA7 G;  5IYD H;  3JAM c;  2E2J H;  3GTQ H;  4JYA Q;  1HNW L;  1CKO A;  2OQ0 A;  3M4P A;  4QGU A;  5BR8 Q;  3G48 A;  4IPC A;  5HY6 A;  2PQA A;  2I0Q A;  1N33 L;  1I5F A;  4JI1 Q;  4YHH L;  4JI7 Q;  2RCN A;  5M3F G;  2ID0 A;  4AYB G;  4C2M H;  2NZO A;  4HJ8 A;  4GLX A;  4C3H H;  1VQ7 A;  1N9W A;  1HNX L;  3KF6 B;  4YWL A;  2QGQ A;  3K80 C;  2ZM6 Q;  4R4T A;  5IP7 G;  4LUZ A;  2KCT A;  4IO9 A;  1GVP A;  3PUZ A;  1PV4 A;  1CUK A;  5LMN Q;  5FLM G;  3I55 A;  2K14 A;  4PG3 A;  2IX0 A;  3K7A H;  2YTV A;  1WI5 A;  4A3G H;  4PZ6 A;  3GD7 A;  2UUB Q;  3D31 A;  1CKN A;  2JA7 H;  2OTJ A;  2ASB A;  5LMU L;  2QA4 A;  4DV5 L;  1X55 A;  3FHW A;  1SRU A;  2H5X A;  1EOV A;  2XGT A;  4JI2 Q;  4DR5 Q;  1Y1W H;  3A0J A;  1IBL L;  4L5S A;  1NTG A;  4GKK Q;  3CCS A;  4LFA Q;  1YHQ A;  3S24 A;  1EWI A;  4KHP Q;  2AWO A;  3NEM A;  3CCJ A;  3L0O A;  3CD6 A;  4DR4 L;  1Q82 C;  4X65 L;  4P74 A;  3J81 i;  2JE6 I;  4A3L H;  4NXM Q;  2VUM H;  1K73 C;  4JYA L;  1PH4 A;  1HR0 Q;  3F8T A;  1Q12 A;  4Y7N H;  1VQO A;  4AIM A;  5BR8 L;  4DR2 Q;  1XPR A;  1WYD A;  3S2H H;  4IOA A;  1I50 H;  4JI1 L;  4JI7 L;  1RL2 A;  1E1T A;  4GLA C;  3G71 A;  1A63 A;  2I5L X;  2ZTE A;  3U4V A;  4LF7 Q;  1Z47 A;  4NXN Q;  2PI2 A;  3AQQ A;  3CCE A;  1VQ4 A;  1N34 Q;  3PO2 H;  3HOZ H;  4A76 A;  1IZ6 A;  3CW2 C;  3KLW A;  2ZM6 L;  1A0I A;  1H95 A;  3GTK H;  1I3Q H;  2JA9 A;  4DK6 C;  2I5H A;  5LMN L;  3KJO A;  5IT9 c;  3RR5 A;  3S15 H;  3RZO H;  1JMC A;  4R4I A;  3HOX G;  2KEN A;  3S14 H;  2UUB L;  3PIP A;  1PVO A;  3I7F A;  4DV1 Q;  1W2B A;  1C9O A;  4X64 Q;  3NBH B;  4B3M Q;  4JI2 L;  3CF5 A;  4DR5 L;  4L5R C;  1XNQ L;  4GKK L;  4LFA L;  3M3Y H;  4JBW A;  1PH6 A;  3IRB A;  1UEB A;  1FL0 A;  1L0W A;  3CC7 A;  1J5E L;  1XNR L;  4AYB E;  1Q1E A;  3A5Z B;  1T9H A;  3HKS A;  1IBM L;  2PQA B;  1EQR A;  1VQM A;  5IP9 H;  4NXM L;  5K36 G;  1HR0 L;  5IY0 A;  1KXL A;  1CSQ A;  4DR2 L;  4QIW E;  4QL5 A;  2UU9 Q;  1PFS A;  3OYY A;  3L2P A;  4L5T A;  3GTP H;  2Q2U A;  2AKW B;  2RHQ B;  3GDE A;  2WB1 G;  1Q7Y C;  4R1J A;  2Z0S A;  1UE1 A;  1N34 L;  2JA5 H;  3JC6 6;  3I4N H;  3HOX H;  1BKB A;  3ULJ A;  1VQ5 A;  1BVS A;  4NB3 A;  1C7Y A;  1L2F A;  2MO1 A;  3E9H A;  3UDI A;  2MO0 A;  1TWG H;  1K8A C;  1KAW A;  3RLO A;  3ICE A;  2ZJQ A;  2Q2T A;  4JBK A;  1VQG A;  3GTL H;  5M3M H;  1CKN B;  2NVX H;  1AE2 A;  2YTX A;  3OTO Q;  3JAM i;  3T1Y Q;  3RZD H;  2GN5 A;  4PZ8 A;  4BXX G;  1WJJ A;  2D62 A;  4A75 A;  4HJ7 A;  3UDG A;  3UE0 A;  2ZTD A;  4LFC Q;  4DV1 L;  3S17 H;  4X64 L;  2I5M X;  4B3M L;  1HNX Q;  3LGJ A;  1I94 Q;  2VS1 A;  2NN6 G;  1TWH H;  4UPA A;  3S2D H;  1EQQ A;  1SRO A;  3I4O A;  3CC4 A;  1ASZ A;  1IL2 A;  1HZC A;  2R7Z H;  3Q8D A;  2BH2 A;  1LM0 A;  1MJE A;  2F52 A;  1E24 A;  1KL9 A;  1HZ9 A;  3S1Q H;  1YZ6 A;  2N8N A;  4IFD J;  2LXK A;  3E9I A;  2UU9 L;  4C3I H;  1QVG A;  4JOI A;  4DV5 Q;  1S72 A;  4BY7 G;  3PUY A;  1L1O A;  3TRE A;  1K3R A;  1KQS A;  1Q46 A;  3PF5 A;  4H02 A;  3AFQ A;  4C3J H;  2L15 A;  5IWA Q;  4APV A;  4BY1 H;  4QQB X;  2HQL A;  4XTC S;  1E7Z A;  3CCV A;  2V1C C;  1B70 B;  5H1S E;  4BBS G;  2VQE Q;  2KHJ A;  2CWP A;  3TEH B;  1JB7 A;  1OTC A;  2DUD A;  2CKZ B;  5DLQ E;  4POG A;  3J80 c;  1AE3 A;  3KOJ A;  3T1Y L;  3OTO L;  3HOV G;  4X6A H;  1G51 A;  1XMQ Q;  3J81 j;  2UXB Q;  1FJG Q;  4DAY B;  4LFC L;  2D0O A;  2EQS A;  3T1H Q;  1YI2 A;  4JI3 Q;  1VQE A;  4P72 A;  2UXC Q;  4DV6 Q;  1WOC A;  2E2H H;  1EIY B;  4GLV B;  2R7Z G;  4J15 A;  1I94 L;  3M4Q A;  1B7Y B;  1MKH A;  1FGU A;  1WCM G;  4A4I A;  5IE8 A;  3CCM A;  4HIO A;  3D0F A;  2ZTC A;  4UP8 A;  4DR3 Q;  3J7A 5;  5C4X G;  2WB1 E;  4BY7 H;  5C44 G;  1QZH A;  3U58 A;  3G4S A;  3PV0 A;  1IXR A;  4RMF A;  5GQO A;  3CMA A;  3KDF A;  1O7I A;  2HT1 A;  2B63 H;  2E5L Q;  4A3D G;  4DNI A;  1TWC H;  3H3V H;  4L5Q A;  3CCL A;  4P71 A;  2R6G A;  1XNQ Q;  1Q81 C;  4HIM A;  4JI5 L;  4IFD G;  2YV5 A;  5IWA L;  5C0X I;  4A3K G;  1V43 A;  1VQK A;  1VQJ A;  2HIX A;  3BU2 A;  1VCI A;  1J5E Q;  2OWO A;  4HIK A;  1XNR Q;  1X3G A;  2AWN A;  5M3F H;  3BZC A;  2JA8 G;  2PMZ E;  2VQE L;  4P75 A;  5C3E G;  2EIF A;  4OXP A; 
#chains in the Genus database with same CATH topology
 1D2B A;  1XX8 A;  4EVO A;  4DV7 L;  1E22 A;  1PDQ A;  4K5X A;  4R4O A;  5IP7 H;  1ZKO A;  3HOW B;  4ODG A;  1J6Q A;  1PYS B;  5C4X H;  4A3F G;  1PRT C;  4DV6 L;  4FYD A;  2KOL A;  3VR3 A;  3FPP A;  2KEC A;  2JA6 G;  1QOH A;  3TS0 A;  1KTK A;  3DWA A;  4MNO A;  3ULL A;  1QVF A;  4LWC A;  4OON A;  1UE5 A;  1SN8 A;  3ERS X;  4HJA A;  1HZB A;  1QE6 A;  2JN4 A;  3SHL A;  4OX9 Q;  1A6X A;  1KNA A;  1U9R A;  5C3E H;  1Q3L A;  2K52 A;  4KY6 A;  1LTG D;  1JWS D;  1Z7T A;  1BCP B;  2K5V A;  5ISR A;  4JOI C;  2TSS A;  1EIH A;  1HQM C;  5C3X A;  2VY3 A;  1QB5 D;  4C3H B;  1RIP A;  1SJE D;  3B6Y A;  3OPO A;  3NTI A;  1PTO H;  3NSW A;  4DUY Q;  4K6L A;  1NMF A;  4OO1 I;  1DON A;  5EBD A;  1TQO A;  2F0F A;  1PH3 A;  2WP8 J;  3AFP A;  1VQF A;  4DR1 L;  1SEB D;  2XSC A;  1EIF A;  4YWM A;  4IPH A;  4P73 A;  1V1P B;  1VS0 A;  1WFQ A;  4LF5 Q;  2VUM B;  2VZA A;  4A3M H;  4KN7 C;  2K5W A;  1N32 Q;  2M2L A;  3X3M A;  2F0P A;  1M90 C;  3M4O H;  1XTC D;  5EJW A;  5FO8 B;  2X6G A;  2D0P A;  4DPG A;  3PO2 B;  3PSI A;  2WIN B;  3FKI H;  4PQX A;  2K33 A;  1X32 A;  1XTD A;  1AH9 A;  3GTK B;  2EY2 A;  1S5E D;  5T1G A;  5M5W B;  1V8Q A;  3RZO B;  5M5X B;  2OF1 A;  2QDL A;  4LUO A;  1HQR D;  3S14 B;  4BBR H;  2RF4 A;  3PO3 H;  1KC8 C;  5F2D A;  5G3L F;  5HGT A;  1SYD A;  4B3R L;  1OXX K;  2NVY H;  5EKI A;  3WDN A;  2TMP A;  1HA5 A;  2MNA A;  1PRT F;  1WTR A;  1VQC A;  1SYF A;  4LF8 Q;  4O2D A;  2YU9 H;  4K0K Q;  5C5L A;  1AW7 A;  4A3G G;  3HKZ E;  5IIF A;  5GAE C;  5KNB A;  1UE7 A;  3TP6 A;  3VR5 A;  5GRO A;  1Y1W G;  1Q86 C;  5EBC A;  4LNQ A;  2JA5 B;  4FDB A;  5GAH C;  1Y1V H;  1TWG B;  4DV2 L;  2A1A A;  1SNC A;  1H9M A;  4ME5 A;  1JT8 A;  3RZD B;  1PTO C;  4BA1 I;  4ZCK A;  4C1N I;  3KYH C;  1YHB A;  4KLK A;  1HR0 W;  3Q6S A;  3HOY G;  1JJG A;  1JR0 D;  1SE8 A;  2NWG A;  4CBV A;  1UAP A;  1EZ8 A;  1ASY A;  5C44 H;  2KCM A;  2EXZ A;  1YNN C;  4IOC A;  3K7U C;  2M00 A;  5FLX L;  1S5F D;  1VF7 A;  4POF A;  1QWY A;  2IW3 A;  1Q8K A;  2R7F A;  3R8B A;  3V96 A;  3BS1 A;  1F9R A;  2JA8 H;  2Z9H A;  2AQ1 B;  1U5K A;  3TSS A;  3CP0 A;  3FEW X;  1X9N A;  1VQD A;  4A3F H;  3S1N H;  1RKN A;  1Q1B A;  2EDG A;  4MHE A;  3I2Z A;  1F9P A;  2RQX A;  2A73 B;  4JI0 L;  1U4L A;  4BY7 B;  3C46 A;  2DY8 A;  2F4V L;  4EX5 A;  1TXY A;  4IUU A;  3VYU A;  1WTP A;  2L1B A;  1SFO H;  4LF9 L;  5ELC A;  3J80 i;  2VB2 X;  4RCN A;  3M85 A;  1YIJ A;  2N49 A;  5JPN C;  3TP7 A;  3DEP A;  2PW5 A;  1KD1 C;  4JI6 L;  4JG2 A;  3GTP B;  1GHJ A;  4LF7 L;  1D1K A;  1G2S A;  1F2M A;  4IPD A;  4M1U B;  2N78 A;  3H3V C;  3VR6 A;  3PUX A;  3NP8 A;  2K32 A;  4IPG A;  3FVQ A;  3EIV A;  4A3J G;  4PMW A;  4C3J G;  3AU7 A;  3T4A C;  1C8C A;  1S3O A;  1STH A;  2IT1 A;  1QG7 A;  2EJF C;  2FMM A;  4OO1 G;  1SMY D;  4U67 3;  1S4Z A;  2A19 A;  1JB3 A;  4B3S Q;  2LSS A;  2K03 A;  2EXD A;  3E0J A;  4IAL A;  1ESR A;  2L4N A;  5GAG C;  4QCL A;  2F0S A;  1GUO A;  3E0E A;  4FF4 A;  1K9M C;  4DKA C;  3NEL A;  1CHP D;  5ELF A;  1GO3 E;  3BVZ A;  4IFD I;  5FLX E;  4U68 A;  2HQE A;  2NYZ D;  2L11 A;  4X65 Q;  1Q90 A;  5J3B A;  2B63 G;  5IYD H;  2E2J H;  1RTN A;  1HNW L;  1SSO A;  3DM1 A;  1R4P B;  3G6J B;  5BN4 A;  3M4P A;  4QGU A;  1A2U A;  2R93 B;  2ID0 A;  4AYB G;  2NZO A;  4GLX A;  1D6E C;  2F0J A;  1HNX L;  1MBY A;  1B4O A;  4ZQ3 A;  4IN3 A;  4LUZ A;  1CUK A;  2Q8I B;  2IX0 A;  1ZEQ X;  2YTV A;  2O5I C;  1WI5 A;  1PTO D;  4A3G H;  3ERQ A;  4PZ6 A;  2UUB Q;  4IUV A;  1CFM A;  1BCP F;  2MHV A;  5E4W C;  5KYI A;  3FHW A;  2QA4 A;  4JI2 Q;  1Y1W H;  3A0J A;  1NTG A;  3CCS A;  1EWI A;  2CHB D;  3NEM A;  2F0N A;  2HCC A;  3CD6 A;  2B2U C;  2JE6 I;  1YNN D;  4JYA L;  3F8T A;  1TY0 A;  1Q12 A;  1VQO A;  5BR8 L;  1TWA B;  4IOA A;  2FMC A;  3C1F A;  1ICW A;  1Z47 A;  2PMZ B;  2B2Y A;  2MPM A;  2PI2 A;  3AQQ A;  4A76 A;  1I4H A;  1LT6 D;  1A0I A;  2JA9 A;  3MFG A;  3RR5 A;  3S15 H;  4CDF C;  3D6C A;  1JMC A;  3HOX G;  1PVO A;  4EQO A;  1LTR D;  2RDH A;  4DR5 L;  1TKW B;  4L5R C;  4KHP L;  1DZ1 A;  2A5H A;  4JW0 A;  3T53 B;  1LAC A;  5A35 A;  1EQR A;  5C4Z A;  1VQM A;  1UNS A;  2F0O A;  2O4X A;  1HR0 L;  1TS5 A;  4QL5 A;  3A56 A;  3I91 A;  1CA5 A;  3OYY A;  1JOK A;  2RHQ B;  3FRP B;  4R1J A;  1UE1 A;  1N34 L;  1BQQ T;  1CTM A;  2MO1 A;  3UDI A;  2MO0 A;  3X3N A;  1K8A C;  1HFG A;  4H44 C;  1AE2 A;  2GN5 A;  4PZ8 A;  4XT3 B;  2D62 A;  2JP1 A;  4XDX A;  4A75 A;  4V0B A;  2XN9 C;  4DV1 L;  4X64 L;  1PFM A;  1AEX A;  4B9W A;  3LGJ A;  3S2D H;  1XWE A;  1NNX A;  5L37 A;  1SBB B;  1MJE A;  5IOD A;  4G7O C;  2N8N A;  4RHR A;  3E9I A;  5IT9 L;  2UU9 L;  5J1Z A;  1KDC A;  4JOI A;  2WAQ B;  1SE2 A;  4K14 A;  3PUY A;  2Y0S B;  4C3J H;  1H9S A;  5IGC A;  4XTC S;  3CCV A;  5EKK A;  1EY7 A;  4BBS G;  1JOR A;  2CWP A;  1ZYR C;  4OO1 H;  2CKZ B;  1LO5 D;  4X6A H;  3T1Y L;  5LL6 X;  1FD7 D;  2BOS A;  1GUW A;  1PZK D;  1TWF B;  2B2V C;  4LFC L;  4DV6 Q;  1WOC A;  2E2H H;  2R7Z G;  4GLV B;  3LNN A;  1I94 L;  2H1E A;  3H09 A;  3M4Q A;  4HIO A;  1WCM G;  1K83 B;  2C5C A;  2DJG C;  2B39 A;  3A8I E;  5LL6 S;  2NVQ B;  3J7A 5;  2B2W C;  5C4X G;  5DM6 3;  3L9A X;  2IJ0 A;  2B2T C;  5D3I B;  4RMF A;  3KDF A;  2F0K A;  2B63 H;  4L5Q A;  2F3W A;  2HDL A;  4S3S A;  1SNO A;  1XNQ Q;  4IFD G;  1ESF A;  5IWA L;  1PRT B;  1V43 A;  1VQK A;  1VQJ A;  2NVX B;  3BU2 A;  4X3K A;  4ABN A;  2I07 B;  1A15 A;  2AWN A;  3BZC A;  1IBM Q;  4A3E B;  5C3E G;  1SNQ A;  1NCV A;  4KKS A;  5IYB G;  1EU3 A;  2NTS A;  3K5N A;  3CPW A;  2KCC A;  4A3B B;  1UEA B;  1XMQ L;  3R93 A;  1AZQ A;  5E7N A;  4GS3 A;  3KFU A;  4A3I G;  1FJG L;  3GTJ H;  3CQZ H;  1D8L A;  4GN5 A;  4JI8 L;  4R8N A;  4CJ2 C;  2BDN A;  4M8A A;  2WFW A;  4OIJ A;  2QIL A;  1NY4 A;  2K4K A;  4A93 B;  2NZ1 D;  3PIP 3;  2EYP A;  1E1O A;  2CH4 W;  3P20 A;  1UWV A;  2PZT A;  1KLG D;  1DXM A;  3VYS A;  2BA1 A;  4A3K H;  1U4M A;  3VYR A;  3M7N A;  1NUC A;  3KLS X;  1PYW D;  4IUT A;  2UXD L;  1H9S B;  2E75 C;  2DGY A;  2G9H D;  5IYC H;  1MSG A;  2JQO A;  4FP5 D;  2R92 G;  2AUK A;  4HJ5 A;  3OMG A;  2NZH A;  3GQB A;  1CQF A;  2QKI C;  4HTH A;  3DMU A;  1VQN A;  3SDZ A;  5ELB A;  4B3T L;  4NPS A;  4C2M B;  5M9O A;  1B9M A;  4A3M G;  1GKH A;  4GKJ L;  3GV6 A;  5IT9 E;  2K50 A;  4JV5 L;  4ALP A;  4TSS A;  4X66 L;  3I56 A;  1WTV A;  1IL8 A;  2RHS B;  4KHZ A;  3KDF B;  3FKI G;  4HR7 B;  3HS0 C;  1A62 A;  2JA7 B;  1D1I A;  1TWC B;  4R9W A;  4KKT A;  1FR3 A;  1SYE A;  3MXN A;  3K59 A;  4B3R Q;  3W2D A;  4OWX B;  2LS0 1;  4TRD A;  3SK8 A;  4BBR G;  3PO3 G;  1VQ8 A;  4Z9C B;  4I7A A;  2FXQ A;  2XRQ D;  5M5Y H;  1PFB A;  4KHV A;  4Y7N B;  3C1E A;  4YCU A;  5ELN A;  2HHH L;  3S2H B;  3H6M A;  3I8Z A;  1MHW C;  1I6H H;  1GJX A;  5FLX c;  3HOZ B;  4WJ3 M;  2F0L A;  4CDE C;  3MAQ A;  1VQ6 A;  1EUJ A;  1SE3 A;  4DV2 Q;  4JI5 Q;  3HOU H;  2O5J C;  4QF4 A;  3UDX A;  3K0X A;  1PH8 A;  4HCS A;  5JAV A;  5CV9 A;  1Y1V G;  2Q8R E;  4QJF A;  4DAV A;  4DV4 L;  1MGS A;  1I4P A;  2RA4 A;  1ZYR D;  3H15 A;  5AJ3 L;  4AQY L;  2UUA L;  1FVI A;  3NBI A;  3S1R H;  1X56 A;  1F9Q A;  5LMN W;  4IJL A;  5I2Y A;  2HD3 A;  3HFZ B;  3F2B A;  1R9T H;  3P1H A;  2Q2I A;  4OWT B;  3W3A A;  3MWY W;  3OOC A;  5C0X J;  4BBS H;  2BH8 A;  2VNU D;  2JJQ A;  1ET9 A;  4FF1 A;  1EFW A;  2VUM G;  1K8O A;  2ICE C;  3IKJ A;  2E2I H;  3RN5 A;  3D6W A;  3MXN B;  2LY7 A;  3NE5 B;  3RD4 A;  1K3B C;  1DYQ A;  2R61 A;  3OIP A;  4O0A A;  3S17 B;  1WCM H;  1VMC A;  3DM3 A;  4LAA A;  1EYA A;  1HH2 P;  3PO2 G;  2VW9 A;  4JI0 Q;  4HED A;  4MN3 A;  3A5U A;  2IPK D;  1PH9 A;  2AHO B;  2MJ8 A;  1SMX A;  2J4X A;  2AQ2 B;  3HP3 A;  2BA0 A;  3J7Z C;  4CKB A;  2F4V Q;  2FHT A;  2VXW A;  3W5O A;  3EJI A;  1HNZ L;  2JXM B;  1X54 A;  3I90 A;  4C3I B;  2ZJP A;  4DV3 L;  4LF9 Q;  4IFD H;  3DLL A;  1I6V C;  3EVQ A;  1BBX C;  2SOB A;  2Q2H A;  1TII D;  4PMC A;  4DV0 L;  3RN2 A;  5IYB H;  4GOP C;  4JI6 Q;  1XPU A;  4BA2 I;  2EYH A;  2EY1 A;  5CV5 A;  5JEA J;  1D5X C;  2Z6K C;  4A3I H;  1NAP A;  3C2P A;  2Z8L A;  2PNR C;  1U4P A;  2RSN A;  4X62 L;  2NVY B;  1J8I A;  1PH1 A;  1U4R A;  3VR4 A;  5I6W A;  1HTP A;  2JA5 G;  3Q24 A;  3A54 A;  2WAC A;  3DWQ A;  2YU9 B;  4CHT B;  2K5D A;  3BZK A;  1NMG A;  5FOB B;  1JOQ A;  3ERO A;  5C4J H;  1I4Q A;  3L3O C;  3DEO A;  1MIU A;  2R92 H;  4CJ1 B;  3BDL A;  1IBK L;  2KHS A;  2K05 A;  2EJG C;  4PMB A;  4BS9 A;  1CI3 M;  3K58 A;  2B2U A;  2K5H A;  3I4M H;  5M3F B;  5CV7 A;  3K5M A;  1LLR D;  2PI2 E;  4NXN L;  2ZXP A;  2WAQ E;  4HSP A;  2Y0S E;  1CKM A;  3NPP A;  3Q22 A;  2QW7 A;  2B8F A;  4YY3 L;  2DNE A;  3Q0A A;  4LF6 L;  1X3F A;  1IYV A;  1DD2 A;  1HNW Q;  1SMY C;  3AEV A;  4IUQ A;  2XTI A;  3F2D A;  2X69 A;  2RCF A;  1G2T A;  4DR6 Q;  3KLR A;  1STB A;  2DNC A;  4QUC A;  5IYD G;  2VQF L;  1TS4 A;  3OMC A;  4A3C H;  3HOW H;  1A3T A;  2OTL A;  4ZUI A;  1DCZ A;  3F2U A;  3HZX A;  1J9O A;  1JC7 A;  2X6L A;  1E3P A;  2R3Z A;  1GUG A;  1UE6 A;  1CM9 A;  2EYF A;  2VL6 A;  3DHQ A;  4N8X 1;  2CCZ A;  1FNW A;  2H4O A;  1N8R C;  3QOJ A;  1SE4 A;  2NBF A;  4A3F B;  1SAP A;  1STY A;  4UHV A;  3ZJY C;  3N52 A;  1S5B D;  2MQH A;  4GNX C;  3MC0 B;  1W6J A;  3NBH A;  2JA6 B;  1Y69 U;  3QIA A;  3WWV A;  4KMU C;  1EY8 A;  3GTQ H;  1O7Y A;  4JYA Q;  2L55 A;  1EL0 A;  2OQ0 A;  5BN5 A;  3ND9 A;  5BR8 Q;  5HY6 A;  4F8M A;  1N33 L;  4YHH L;  3BYY B;  2ENB A;  4XYQ A;  4C3H H;  1WTX A;  1VQ7 A;  1N9W A;  4KD3 A;  2F1M A;  1JOO A;  3K80 C;  4KD4 A;  4XT1 B;  3KBG A;  1GVP A;  2A69 C;  4HMJ A;  4QMG A;  1F2L A;  3IFD A;  3GD7 A;  1CKN A;  4PNY A;  2R7Z H;  4DV5 L;  1X55 A;  1SRU A;  2XGT A;  4DR5 Q;  1B9N A;  1IHZ A;  4KHP Q;  1QIL A;  3L0O A;  4DR4 L;  1NR2 A;  4P74 A;  4ILW A;  2VUM H;  1K73 C;  5C6A A;  1HR0 Q;  3VYT A;  3DXJ C;  1XPR A;  4AIM A;  1WYD A;  4FXK C;  2CVR A;  1I50 H;  4JI1 L;  5CV8 A;  4JI7 L;  5JJZ A;  3AB9 A;  3U4V A;  1IYU A;  5G3L D;  3CCE A;  4RHS A;  1N34 Q;  3PO2 H;  1IZ6 A;  1H95 A;  2B2V A;  4P2C B;  3GTK H;  3GTM B;  1LT5 D;  5LMN L;  3NTK A;  1JWU D;  5IT9 c;  3OSO A;  3RZO H;  1FNV A;  2KEN A;  3S14 H;  3JAM L;  3OW7 A;  2L0C A;  2MUY A;  4UDU C;  4DV1 Q;  1C9O A;  2EVB A;  2B2W A;  1W2B A;  4B08 A;  4X64 Q;  3NBH B;  5C5M A;  1BDO A;  2B2T A;  1LTT D;  2PYK A;  4GKK L;  4DAY A;  3FDT A;  2E2J B;  4LFA L;  1PH6 A;  1UEB A;  2EYL A;  1XNR L;  1Q1E A;  3TDQ A;  4NXM L;  3P7J A;  5IY0 A;  3HOV B;  5J22 A;  1E2Z A;  4QIW E;  5CR3 A;  5EPK A;  2UU9 Q;  4L5T A;  2ZXR A;  1V1O A;  4KJO A;  2AKW B;  3GDE A;  2WB1 G;  3ND8 A;  2JA5 H;  1BKB A;  3A8J E;  1L2F A;  1SJH D;  3E9H A;  3D3R A;  1WTW A;  1TWG H;  1KAW A;  4ZKB B;  2SDF A;  4JBK A;  1VQG A;  1CKN B;  3TP8 A;  5IGG A;  3T1Y Q;  1VMP A;  3RZD H;  2QDB A;  4BXX G;  1Y1W B;  3UDG A;  1OO9 B;  3D4R A;  4LFC Q;  4CDC C;  1TR5 A;  3PMF A;  3GTO B;  5K36 H;  1BNZ A;  1I94 Q;  2A68 D;  3MEH A;  1R4Q B;  4UPA A;  1GOZ A;  1SRO A;  4XQQ A;  1PTO F;  3MHB A;  2PQE A;  1SXT A;  4ULL A;  3CKI B;  3CU7 A;  2BH2 A;  1STA A;  3HOY B;  4IQZ A;  2LXK A;  1ENF A;  1QVG A;  1S72 A;  2XWB B;  2L9H A;  4J8Q A;  1K3R A;  2I46 A;  4H02 A;  3PF5 A;  1I4X A;  5IWA Q;  4BWG B;  4APV A;  4QQB X;  3S15 B;  1EY4 A;  1W6K A;  4FO2 A;  4I7Z C;  3TEH B;  1VDZ A;  1JB7 A;  2DUD A;  3OTO L;  1XMQ Q;  2NUC A;  3OWE B;  1FJG Q;  4DAY B;  2D0O A;  1E2W A;  2WKD A;  5IE8 A;  1D5Z C;  3D0F A;  4ID6 A;  4J1M A;  2ZXO A;  4UP8 A;  1Y8O B;  5I6Y A;  2KVM A;  4BY7 H;  2BCO A;  2IWH A;  3TME A;  1QZH A;  3E5S A;  1IXR A;  5GQO A;  3CMA A;  5I9O A;  1EY5 A;  1EEF D;  2B8G A;  3NUC A;  4OHJ A;  2HT1 A;  5CC4 A;  2A69 D;  4XXE A;  3JAM E;  2MGS A;  5JVH 3;  3CCL A;  4KV6 A;  2N55 A;  3T51 B;  2YV5 A;  4A3K G;  3S16 B;  2ZT9 C;  3URY A;  1J5E Q;  2OWO A;  5J39 A;  5LHY 1;  4HIK A;  3HEJ A;  5CV4 A;  3GTP H;  5IYC G;  4IZ8 A;  2CW0 D;  4B3T Q;  4DXG A;  1XYI A;  1HZA A;  3BG3 A;  4GN3 B;  2FJ2 A;  2NVT B;  1PH2 A;  4GKJ Q;  3GP7 A;  3S2D B;  4JI3 L;  3K6O A;  4JV5 Q;  1K28 A;  2WV6 D;  3GTG B;  1D7Q A;  4R4Q A;  5GAD C;  4DR3 L;  1A8V A;  4CDD C;  5IGE A;  2ATW A;  1NBW A;  5IGB A;  3I70 A;  4A3J B;  4C3J B;  3NQI A;  1GUN A;  2E5L L;  3J80 L;  2M9V A;  3BYT B;  4H13 C;  3H94 A;  1K8G A;  1H9K A;  1BOS A;  1P16 A;  1OXS C;  4WFN 3;  1B3Q A;  1EYC A;  1SLJ A;  2N88 A;  4R8I A;  1MJC A;  2KA7 A;  2JEA I;  1PZJ D;  2HHH Q;  4LFB L;  3BDC A;  1L1O C;  4LF4 L;  1X6O A;  2CQO A;  5I9P A;  4KY5 A;  2CFM A;  1LTL A;  3CAM A;  1GXD C;  2LXJ A;  2CWA A;  4YCW A;  3HKZ G;  4AH6 A;  4G7H C;  4QY7 A;  3K7A B;  2KEE A;  2OT2 A;  5AFW A;  2NN6 I;  4DAM A;  2R93 H;  1I4G A;  4HMI A;  4QUF A;  2RDF A;  4L8J A;  4A3E G;  1BCP D;  1WD1 A;  1VQH A;  3VA7 A;  3ER0 A;  4A3B G;  4DV4 Q;  4CKC A;  3HOU G;  3LWE A;  4I65 A;  3F2C A;  4A3D G;  5AJ3 Q;  3UE1 A;  4AQY Q;  2ZJR A;  2UUA Q;  1DM0 B;  3QB3 A;  2EOT A;  2IX1 A;  1B50 A;  3H0G G;  1DJR D;  4ZRZ A;  1BXT A;  1RJT A;  2K6A A;  3T16 A;  4GOP A;  3H3V I;  3GTJ B;  1EOT A;  4DR7 L;  2Z6K A;  1PYB A;  3RNU A;  3STB D;  3PF4 A;  4KTA A;  1AFP A;  1I3Q B;  3CXC A;  4BXX H;  1TWA H;  4B9X A;  5FKA C;  3R2T A;  1KNE A;  1S5C D;  1EZ6 A;  5FK9 C;  4DV7 Q;  4RGM A;  2NTT A;  1EY6 A;  1QCB D;  4UP9 A;  5KIX A;  2QEX A;  3ONA B;  1L0Y B;  1K0S A;  3M3Y B;  2R7D A;  4OL7 A;  1GM5 A;  3C3L A;  4WJ4 A;  1CSP A;  1YVC A;  4OWW B;  1AN8 A;  3TZD A;  5IOC A;  2SNS A;  1D5M C;  2MFI A;  1G6P A;  3LX0 A;  4IJH A;  1HNZ Q;  4DV3 Q;  5HUR A;  2CH4 A;  1K0R A;  3I3C A;  3TRZ A;  4DNT B;  4HID A;  3M9B A;  4LMQ D;  3HOX B;  3NEN A;  4DV0 Q;  2KUM A;  2K1B A;  3J80 E;  2A74 C;  4A3L G;  2UUC L;  1EWC A;  2QCP X;  3GTL B;  3Q23 A;  5M3M B;  1C0A A;  5JOB A;  5CV6 A;  4B3S L;  3LWU A;  4JCV E;  4X62 Q;  1EEI D;  3VDY A;  3AYH B;  2E8G A;  4WOR A;  2YTY A;  2XNA C;  4DUZ L;  3HOZ G;  1LAB A;  2JK8 A;  3I73 A;  1TWH B;  1VQP A;  3DUZ A;  2VB3 X;  4HSV A;  4UAI A;  4GOP B;  1A3V A;  3S1Q B;  1I6H B;  2KBN A;  5IGD A;  4DR1 Q;  5JJK A;  4NW2 A;  3OIQ A;  1QUQ A;  3BZD B;  4GNX A;  1IBK Q;  3KJP A;  3T56 B;  4BY1 B;  1VF5 C;  3I72 A;  4RAU C;  4YCV A;  1EQV A;  3K8A A;  1LTB D;  4K8J A;  5D14 A;  1YEZ A;  2K75 A;  1X3E A;  1PH7 A;  4JBM A;  4YY3 Q;  4LF6 Q;  3I4M G;  1QVC A;  3EQL C;  3I4N G;  1BO0 A;  2RKS A;  3NWT A;  3UDF A;  5BN3 A;  4LJZ C;  2VQF Q;  4CGY B;  4N8F A;  3CCQ A;  3BDO A;  1N36 L;  1NE3 A;  1TWF H;  4XIG S;  2K04 A;  4G7Z C;  4DK1 A;  1ENC A;  2B3G A;  2MP1 A;  5KRU A;  4A3C G;  3HOW G;  3E3X A;  1K83 H;  2NVQ H;  2O2L D;  2C35 B;  4R4C A;  2YYZ A;  1PA6 A;  4XQJ A;  4JI4 L;  1B3A A;  3M7G A;  4NMZ A;  1YJW A;  3W1B A;  2R7Z B;  2PZW A;  2F0W A;  1DOK A;  4MTN A;  4TVA B;  5CGK A;  4WJW A;  4XQN A;  1WCM B;  1XMO L;  1KIX A;  4GN4 B;  4RGN A;  1FNU A;  3PGZ A;  4QIW B;  3S1M H;  5C4X B;  5CBA E;  1YHA A;  1RTO A;  1N33 Q;  1PHJ A;  4A3E H;  3L7Z C;  4YHH Q;  2PW7 A;  5FO7 B;  1AZP A;  4JBJ A;  1OXU A;  2IHE A;  3CME A;  4A3B H;  3MFY A;  3U4Z A;  1HXY D;  1JJC B;  4HN7 A;  4RWS C;  5T1I A;  4TKO B;  4TQU S;  5JJL A;  2B29 A;  4A3D H;  1QUQ B;  1SNM A;  4GNX B;  3TQY A;  5C3E B;  3RUZ A;  4A93 H;  4C3H G;  1XJV A;  3H0G H;  4IUN A;  5EGT A;  5JJI A;  4FNF A;  3QR8 A;  4N9P A;  4MZ9 A;  4A3I B;  3MTS A;  5CMD A;  4DA2 A;  4RG1 A;  1JJ2 A;  2J7Z A;  2IY5 B;  4K6D A;  3ULP A;  4KJN A;  3U50 C;  4DR4 Q;  1PZI D;  3K81 C;  1PTO B;  3JAM c;  3J81 L;  1F2Y A;  2WKC A;  3G48 A;  2I0Q A;  2PQA A;  3E6Z X;  3KBX A;  4JI1 Q;  4JI7 Q;  3K5O A;  2RCN A;  5M3F G;  1HRJ A;  4C2M H;  4YWL A;  4MTK A;  2QGQ A;  1SYC A;  3MXP A;  4R4T A;  1HHV A;  2KCT A;  2R92 B;  4IO9 A;  5LMN Q;  1Z6H A;  1S5D D;  5FLM G;  3I55 A;  4H0L C;  2K14 A;  4PG3 A;  2NB0 A;  4J6H A;  1BUV T;  1C48 A;  2EY5 A;  4A3M B;  2JA7 H;  4JVZ A;  5LMU L;  1IBL L;  1F9S A;  1EOV A;  2H5X A;  1YNJ D;  4RGO S;  4L5S A;  4GKK Q;  1JCK B;  4LFA Q;  1YHQ A;  3M4O B;  4NP5 A;  5I2X A;  2AWO A;  1WTQ A;  1Q82 C;  4A3L H;  5A2Q L;  4NXM Q;  2Z1C A;  3FKI B;  3QJY A;  1PH4 A;  2OEO A;  3KLS A;  4Y7N H;  4MIU A;  2J0T D;  3S2H H;  4GLA C;  4F7X A;  3G71 A;  1A63 A;  4RKL A;  4LF7 Q;  4BBR B;  1VQ4 A;  4DU9 A;  2IL8 A;  3SVM A;  3HOZ H;  3PO3 B;  1EU4 A;  2ZM6 L;  3P75 A;  2LKV A;  4DK6 C;  2I5H A;  3KJO A;  5CYU A;  4C56 C;  3OWF A;  2F0M A;  5EPL A;  4R4I A;  2KED A;  3I7F A;  4N9T A;  5ELE A;  2DY7 A;  3D4W A;  3ITP A;  3BVM A;  1PMR A;  4FF3 A;  1XNQ L;  2EYO A;  4ZK9 B;  3GTQ B;  3IRB A;  1L0W A;  3CC7 A;  4AYB E;  3A5Z B;  1T9H A;  1ILQ A;  3HKS A;  2PQA B;  1IBM L;  1JE4 A;  2PPB C;  5K36 G;  4OIK A;  1Y1V B;  2EE1 A;  2SNM A;  1X3Q A;  1KXL A;  4DR2 L;  3SK6 A;  1PFS A;  3L2P A;  1IKM A;  2L5T A;  5E1F A;  1WTH A;  4OEL B;  1WD0 A;  4E6I A;  2Q2U A;  1Q7Y C;  5JVG 3;  3GV3 A;  3I4N H;  3JC6 6;  3A7L A;  3ULJ A;  1BVS A;  4NB3 A;  3PQI A;  3RLO A;  4ZYS A;  2Q2T A;  5C44 B;  2A68 C;  3OTO Q;  3JAM i;  3J81 E;  1WJJ A;  3UE0 A;  1BR9 A;  2ZTD A;  3S17 H;  2I5M X;  4B3M L;  4KN4 C;  1HNX Q;  3M4Y A;  1KAA A;  2Z4I A;  1EQT A;  1EYD A;  3I4O A;  3CC4 A;  1IL2 A;  2JA8 B;  1HA6 A;  1HZC A;  3CHB D;  4C1N K;  3Q8D A;  1RHP A;  2KJX A;  1I50 B;  5EPJ A;  1LM0 A;  2E74 C;  3MA2 B;  3S9W A;  1E24 A;  1KL9 A;  1HZ9 A;  5KEE A;  1YZ6 A;  4IFD J;  4RGT A;  1X3P A;  4C3I H;  3WOF A;  1A3U A;  1PXU A;  4BY7 G;  2KCN A;  1L1O A;  3S1N B;  2F0U A;  3TRE A;  3AFQ A;  1E7Z A;  4O42 A;  1B70 B;  1O80 A;  3QG1 A;  4RH6 A;  1OTC A;  2F0Q A;  2G5D A;  4POG A;  1LT3 D;  3U9O A;  3J80 c;  1AE3 A;  1EFI D;  1HUM A;  2NN6 H;  5A2Q E;  3HOV G;  1G51 A;  1NSN S;  3J81 j;  2F0V A;  2F03 A;  1YI2 A;  2SEB D;  4JI3 Q;  1VQE A;  1Y8N B;  3MXU A;  1SFO B;  4RKB A;  1B7Y B;  4A4I A;  1FGU A;  4FVM A;  3CCM A;  2ZTC A;  3D4D A;  4DR3 Q;  5DNF A;  4X3S A;  3G4S A;  3PV0 A;  1O7I A;  2EJM A;  4WRD A;  2E5L Q;  3H3V H;  2CW0 C;  4IUR A;  4LK1 C;  4P71 A;  2R6G A;  1Q81 C;  4JI5 L;  1KDB A;  5FO9 B;  5C0X I;  1II3 A;  1VCI A;  1B2T A;  1X3G A;  1O7L A;  5M3F H;  2VQE L;  4LFB Q;  2A6H C;  4K2K A;  2EIF A;  4OXP A;  2F0E A;  4QB4 A;  2F4I A;  1CA6 A;  4LF4 Q;  3TS2 A;  2UXB L;  4EGV A;  1T5X D;  3HGB A;  2XVS A;  5FLM H;  3T1H L;  4G57 A;  2UXC L;  1HCZ A;  1BBW A;  1I4R A;  2OQK A;  1IYJ B;  4DK0 A;  3I4L A;  5M5W H;  1PRT D;  4LW1 A;  5M5X H;  3CC2 A;  1LV9 A;  3HRZ C;  1L1O B;  1HTL D;  2WII B;  4G4K A;  2IX3 A;  1DOL A;  1Y14 B;  4KY7 A;  3AMU A;  5E4X A;  2R93 G;  1OXV A;  3NWS A;  3CCR A;  1ML0 D;  1Q8I A;  3QOL A;  4KK7 A;  1HUN A;  3EBE A;  1XPO A;  2XIW A;  2ALY B;  4K2L A;  1YBY A;  4PV1 C;  3PUV A;  1A2T A;  1GHK A;  2JA6 H;  1SYB A;  3SK5 A;  4DR7 Q;  1ILP A;  1STG A;  3MVV A;  5EAY A;  1BCP C;  3KF8 A;  1EYG A;  1UUP A;  4JK1 C;  1ZXT A;  1Y8P B;  2JEB I;  4A3G B;  2RVL A;  5FJ8 G;  3K57 A;  1G91 A;  2EYJ A;  4OGQ C;  2F0G A;  2IHF A;  1YJ9 A;  2PO4 A;  1F77 A;  1TT2 A;  4OX9 L;  1VQL A;  1KRS A;  4UP7 A;  2E2D C;  3SK4 A;  5IGF A;  4YWK A;  4HAE A;  3NXW A;  4X3U A;  4V19 0;  3W1G A;  4L6T B;  1RCV D;  1G8Z D;  4DXF A;  2HCI A;  3STB C;  4JC0 A;  1KRT A;  3G6E A;  4PZ7 A;  4ZAI A;  4DGZ A;  3J7A V;  1V9P A;  4FXD A;  1S40 A;  2OCE A;  4DUY L;  2BDO A;  2UUC Q;  1IKL A;  4KI0 A;  3K5L A;  1LTS D;  3PIO 3;  1DOM A;  1EIG A;  4DNR B;  4F87 A;  2AUJ D;  1VQA A;  2DJF C;  2K5Q A;  4DUZ Q;  1B8A A;  1FGB D;  3GTM H;  4H7B A;  2GA4 B;  3PIO A;  2HDM A;  3BJU A;  4JI8 Q;  4Q0F A;  2CQA A;  4LF5 L;  1K8M A;  4CJ0 B;  5TSS A;  2A8V A;  2K5N A;  3F1Z A;  2A6E C;  5DEH A;  2D5D A;  3EA6 A;  3ZYY X;  1N32 L;  4DAP A;  1YJN A;  3SR1 A;  3PUW A;  4DK3 C;  3KK7 A;  1GUT A;  3KF8 B;  2AQ3 B;  2UXD Q;  3K0Y A;  1PH5 A;  4DR6 L;  1JQY D;  1CQV A;  3TP5 A;  3HOV H;  3RLF A;  5COY A;  1KLU D;  1DGS A;  4GZY C;  2F3I A;  4OEM B;  3RMH A;  3EN2 A;  2PNH A;  5ELO A;  1OXT A;  5K5P A;  4XYO A;  1GUS A;  1T5E A;  4HJ9 A;  3DWP A;  2RSO A;  2WAQ G;  2A6H D;  2PCF B;  1RF2 D;  2Y0S G;  4HCE A;  3PCO B;  4Q5V A;  2HIV A;  1LYL A;  1P8L A;  1N36 Q;  4LUV A;  4X66 Q;  4LF8 L;  2WB1 B;  5KND A;  4K0K L;  3GTO H;  1VQ9 A;  1V1Q A;  1EWH A;  3SGI A;  5D65 A;  4ZLT F;  2ES2 A;  1LTA D;  2K01 A;  1L0X B;  3A74 A;  2EPB A;  1TS3 A;  3CCU A;  4JI4 Q;  1KHI A;  2F3V A;  3HOY H;  3UI2 A;  5EKL A;  5IP9 G;  5C0X G;  2K7V A;  1X65 A;  1SR3 A;  1KAB A;  1XMO Q;  3BVG A;  3D8G A;  4UY8 C;  1VQB A;  2F0D A;  4CKE A;  5KNC A;  1BBU A;  5D3D A;  2N3S A;  4JPB W;  2E2H B;  5KGU A;  1LTI D;  1SYG A;  2JSO A;  3TN2 A;  1M4V A;  1AP0 A;  4O1N A;  3HG9 A;  3NTH A;  3GO5 A;  5M3M G;  1JE5 A;  1PLF A;  3J81 c;  1YIT A;  3OW2 A;  3KF6 A;  3R3O A;  4K8I A;  2B63 B;  4EQ5 A;  3T13 A;  2AMC B;  3FP9 A;  4ZKC B;  4Y52 H;  3CRK C;  4FF2 A;  5C4H A;  1H9R A;  5ELD A;  2D9U A;  4AYB B;  1TVX A;  4A93 G;  1STN A;  1U0L A;  2BE5 C;  1B53 A;  3A7A B;  3QO2 A;  4K5W A;  4FXG C;  2GVA A;  3RLN A;  1STE A;  1QNU A;  3TBI B;  1VQI A;  4NKL A;  1ROD A;  3MXG A;  3S16 H;  3CQZ B;  2C9O A;  1HJP A;  5JEA G;  3MEF A;  3CPF A;  1LUZ A;  1O7Z A;  4NDX A;  4BY1 G;  1G29 1;  4ZUJ A;  5FJ8 H;  1E0B A;  4DN4 M;  1H9J A;  1B44 D;  2NVT H;  4ME3 A;  3SXH A;  1GD7 A;  4A3K B;  1Z9F A;  3VR2 A;  5HGQ A;  1F2Z A;  3GTG H;  3VA5 A;  2GVB A;  4RA8 A;  2QEJ C;  1YNX A;  2KHI A;  5LMU Q;  2JYO A;  1TY2 A;  1IW7 C;  1ENA A;  1IBL Q;  4A3J H;  1ICF B;  1QZG A;  3G7L A;  1M1K C;  1NJI C;  3KUP A;  4RFB A;  1W3S A;  2JA7 G;  2K28 A;  1CKO A;  1TU2 B;  4EQN A;  1ONL A;  4IPC A;  2A6E D;  2RDG A;  4DF7 A;  1I5F A;  1SNP A;  1LT4 D;  4HJ8 A;  2HUG A;  3KF6 B;  1EY9 A;  2ZM6 Q;  5IP7 G;  2RBM A;  3U9S A;  3PUZ A;  1PV4 A;  5COR A;  1G6Z A;  2Q8T A;  3SEB A;  1YNJ C;  3K7A H;  1WTO A;  3V2T A;  5DM7 3;  3D31 A;  5KYL A;  5M5Y B;  2OTJ A;  2FFK B;  2ASB A;  2DN8 A;  3FMC A;  3A55 A;  3S1M B;  3HKZ B;  3S24 A;  3CCJ A;  4X65 L;  3H91 A;  3J81 i;  3NHH A;  4DFA A;  4DR2 Q;  1CZW A;  5JPM C;  3N6R A;  3HOU B;  1RL2 A;  1E1T A;  2I5L X;  3EFX D;  4A3D B;  2ZTE A;  1E2V A;  4NXN Q;  5CBE E;  1B1Z A;  3CW2 C;  3KLW A;  1O78 A;  1FYC A;  2OXP A;  3H0G B;  3IL8 A;  1I3Q H;  3A8K E;  1JWM D;  2UUB L;  3S1R B;  3PIP A;  2P5Z X;  5DAU A;  4B3M Q;  4JI2 L;  3CF5 A;  1R9T B;  2D2C C;  3M3Y H;  4JBW A;  1FL0 A;  1J5E L;  4BBS B;  5IP9 H;  5C0X H;  2LFN A;  1CSQ A;  3MZ5 A;  2E2I B;  1SDF A;  4EQP A;  2XWJ B;  2PZU A;  2QF7 A;  3J7Y W;  2Z0S A;  5I4D A;  3WOE A;  5NUC A;  3HOX H;  3NK9 A;  1VQ5 A;  1C7Y A;  1ET6 A;  3CRL C;  1QJO A;  4X3T A;  4C3I G;  1EY0 A;  3ICE A;  2FIN B;  5E3F A;  2ZJQ A;  3TZU A;  3GTL H;  5M3M H;  2NVX H;  2BE5 D;  2YTX A;  5C3W A;  2F0I A;  2XRS D;  4HJ7 A;  3R2I A;  3QWN A;  2EY6 A;  1CZG A;  1PFN A;  2VS1 A;  1SND A;  2NN6 G;  1TWH H;  1EQQ A;  1ASZ A;  2Z6B A;  2F52 A;  3S1Q H;  1CK1 A;  3IAY A;  4DV5 Q;  4YIJ A;  5JEA H;  1KQS A;  1HPC A;  1Q46 A;  1TS2 A;  3V05 A;  2F0H A;  2L15 A;  1BF4 A;  1WVL A;  4BY1 H;  4F88 A;  2HQL A;  4L63 B;  2V1C C;  1CT1 D;  1M8A A;  5H1S E;  4K5V A;  2KHJ A;  2VQE Q;  2EYM A;  1IW7 D;  5DLQ E;  3IFT A;  3FPU B;  3J7A F;  2B2Y C;  4KKU A;  3KOJ A;  2G9D A;  2E76 C;  2UXB Q;  1JIC A;  1MD2 D;  3OHX C;  3T1H Q;  2EQS A;  2UXC Q;  4P72 A;  1EIY B;  1HFN A;  1RD9 D;  4J15 A;  5C4J B;  4RCO A;  1MKH A;  2L12 A;  1QNK A;  1KDA A;  2WB1 E;  1MI2 A;  4IUP A;  1NR4 A;  5C44 G;  3U58 A;  3I4M B;  2KQ3 A;  1RDP D;  3NQT A;  1XXG A;  1CHQ D;  3I4N B;  2EZV A;  4DNI A;  1TWC H;  3O13 A;  4HIM A;  2LMC B;  3SE0 A;  2HIX A;  2Z4H A;  1MSH A;  1XNR Q;  2V4D A;  1V1P A;  2JA8 G;  2PMZ E;  4P75 A;  1C4Q A;  5EQ0 A;  2F0T A;  2ICI A; 
#chains in the Genus database with same CATH homology
 4LF4 Q;  3TS2 A;  4DV7 L;  5IYB G;  4B3T Q;  1E22 A;  1HZA A;  4GN3 B;  4R4O A;  3CPW A;  1XMQ L;  5IP7 H;  2UXB L;  5E7N A;  4GS3 A;  3KFU A;  4A3I G;  1J6Q A;  1PH2 A;  1FJG L;  1PYS B;  5C4X H;  5FLM H;  3GTJ H;  3CQZ H;  1D8L A;  4GN5 A;  4JI3 L;  4JI8 L;  1BBW A;  4DV6 L;  4A3F G;  2UXC L;  4JV5 Q;  2WFW A;  2OQK A;  2JA6 G;  1NY4 A;  2K4K A;  3TS0 A;  4MNO A;  3ULL A;  1IYJ B;  1D7Q A;  1E1O A;  4R4Q A;  5GAD C;  4DR3 L;  1QVF A;  1A8V A;  1UWV A;  4LWC A;  4OON A;  5M5W H;  4LW1 A;  1UE5 A;  1NBW A;  1SN8 A;  2BA1 A;  5M5X H;  3ERS X;  5IYC G;  4HJA A;  3CC2 A;  1HZB A;  4A3K H;  3M7N A;  1L1O B;  4OX9 Q;  1Y14 B;  2UXD L;  2DGY A;  2E5L L;  1OXV A;  5IYC H;  5C3E H;  2R93 G;  2K52 A;  3CCR A;  1K8G A;  3EBE A;  1P16 A;  1OXS C;  1XPO A;  2ALY B;  2JQO A;  1SLJ A;  2R92 G;  1YBY A;  1MJC A;  2JEA I;  2K5V A;  3PUV A;  4JOI C;  2NZH A;  4HJ5 A;  2HHH Q;  4LFB L;  1L1O C;  1VQN A;  4LF4 L;  1X6O A;  4B3T L;  2CQO A;  4NPS A;  2VY3 A;  2JA6 H;  1RIP A;  4A3M G;  4DR7 Q;  3B6Y A;  2CFM A;  1GKH A;  4GKJ L;  5EAY A;  4DUY Q;  1LTL A;  3CAM A;  2LXJ A;  1NMF A;  1EYG A;  2CWA A;  4YCW A;  2K50 A;  3HKZ G;  4AH6 A;  4ALP A;  4JV5 L;  4OO1 I;  4X66 L;  4QY7 A;  3I56 A;  4DAM A;  2RHS B;  2NN6 I;  2JEB I;  2R93 H;  4KHZ A;  4A3E G;  5FJ8 G;  3KDF B;  1PH3 A;  2WP8 J;  3FKI G;  3AFP A;  1IBM Q;  1A62 A;  1VQF A;  1VQH A;  4DR1 L;  3ER0 A;  2IHF A;  1YJ9 A;  4DV4 Q;  4A3B G;  3HOU G;  4OX9 L;  4B3R Q;  1EIF A;  1VQL A;  1KRS A;  4YWM A;  4OWX B;  4UP7 A;  3F2C A;  4IPH A;  5AJ3 Q;  4P73 A;  3UE1 A;  2ZJR A;  4YWK A;  4AQY Q;  4BBR G;  2UUA Q;  1VS0 A;  3PO3 G;  1WFQ A;  1VQ8 A;  4LF5 Q;  3W1G A;  2VZA A;  2FXQ A;  4A3M H;  5M5Y H;  2IX1 A;  3H0G G;  4YCU A;  3STB C;  4JC0 A;  5ELN A;  2HHH L;  1N32 Q;  4GOP A;  1KRT A;  3G6E A;  4PZ7 A;  3T1H L;  1M90 C;  3H3V I;  3M4O H;  1V9P A;  4DR7 L;  1I6H H;  2D0P A;  2Z6K A;  4DPG A;  5FLX c;  3PSI A;  1PYB A;  3RNU A;  3STB D;  3PF4 A;  1S40 A;  2OCE A;  4WJ3 M;  3FKI H;  4DUY L;  1AH9 A;  1XTD A;  1VQ6 A;  1EUJ A;  3CXC A;  4KI0 A;  4DV2 Q;  2UUC Q;  4JI5 Q;  1TWA H;  4BXX H;  3HOU H;  3UDX A;  3K0X A;  4LUO A;  1PH8 A;  4BBR H;  4DV7 Q;  2RF4 A;  3PO3 H;  1Y1V G;  1KC8 C;  4QJF A;  1VQA A;  4UP9 A;  4DV4 L;  2QEX A;  4DUZ Q;  1B8A A;  3GTM H;  1OXX K;  2NVY H;  3PIO A;  4B3R L;  2R7D A;  3BJU A;  4JI8 Q;  3H15 A;  1GM5 A;  5AJ3 L;  4AQY L;  4WJ4 A;  2UUA L;  2MNA A;  1CSP A;  1YVC A;  1VQC A;  4LF5 L;  4LF8 Q;  4OWW B;  1FVI A;  4O2D A;  3S1R H;  2A8V A;  1X56 A;  2YU9 H;  4K0K Q;  2K5N A;  3F1Z A;  5LMN W;  4A3G G;  2MFI A;  4IJL A;  1G6P A;  1N32 L;  3HKZ E;  3HFZ B;  4IJH A;  3F2B A;  1R9T H;  1HNZ Q;  5GAE C;  4DV3 Q;  4GKJ Q;  1YJN A;  1UE7 A;  2Q2I A;  4OWT B;  3PUW A;  1K0R A;  4DK3 C;  5GRO A;  1Y1W G;  1Q86 C;  3TRZ A;  3KF8 B;  4LNQ A;  5C0X J;  2UXD Q;  4FDB A;  4BBS H;  4HID A;  3M9B A;  1PH5 A;  2BH8 A;  3NEN A;  5GAH C;  4DV0 Q;  2VNU D;  4DR6 L;  2JJQ A;  1Y1V H;  4A3L G;  1EFW A;  3HOV H;  3RLF A;  4DV2 L;  2A1A A;  2UUC L;  2VUM G;  1C0A A;  4B3S L;  1JT8 A;  4BA1 I;  2E2I H;  4JCV E;  1DGS A;  3RN5 A;  2F3I A;  3MXN B;  3KYH C;  1YHB A;  4KLK A;  4X62 Q;  3EN2 A;  2PNH A;  3VDY A;  3AYH B;  5ELO A;  1HR0 W;  3HOY G;  1OXT A;  4O0A A;  2E8G A;  1WCM H;  1JJG A;  2YTY A;  3DM3 A;  1SE8 A;  4HJ9 A;  1HH2 P;  4DUZ L;  3HOZ G;  2VW9 A;  3PO2 G;  4KHP L;  2JK8 A;  1ASY A;  4JI0 Q;  2WAQ G;  5C44 H;  1VQP A;  2Y0S G;  3A5U A;  3PCO B;  1PH9 A;  2HIV A;  1LYL A;  2AHO B;  2KCM A;  1P8L A;  1SMX A;  3K7U C;  4IOC A;  1N36 Q;  4LUV A;  4X66 Q;  4LF8 L;  4POF A;  4GOP B;  2BA0 A;  3J7Z C;  4K0K L;  2F4V Q;  3GTO H;  3W5O A;  1VQ9 A;  1V1Q A;  2KBN A;  3SGI A;  1HNZ L;  1X54 A;  2ZJP A;  4DV3 L;  4DR1 Q;  4LF9 Q;  2R7F A;  1Q8K A;  3DLL A;  2ES2 A;  5JJK A;  1QUQ A;  2Q2H A;  4GNX A;  1IBK Q;  3KJP A;  2JA8 H;  3A74 A;  4DV0 L;  3CCU A;  3RN2 A;  1KHI A;  5IYB H;  4GOP C;  4JI4 Q;  1U5K A;  4JI6 Q;  4YCV A;  1XPU A;  3HOY H;  4BA2 I;  5IP9 G;  5C0X G;  3K8A A;  1X65 A;  3CP0 A;  5JEA J;  1SR3 A;  2Z6K C;  4A3I H;  1XMO Q;  1X9N A;  1VQD A;  4A3F H;  3S1N H;  1YEZ A;  2K75 A;  1X3E A;  1PH7 A;  4JBM A;  4UY8 C;  4YY3 Q;  4X62 L;  1VQB A;  1Q1B A;  4LF6 Q;  3I4M G;  1PH1 A;  1BBU A;  1QVC A;  2N3S A;  2ATW A;  2JA5 G;  3I2Z A;  3I4N G;  4JI0 L;  3UDF A;  2VQF Q;  3CCQ A;  3GO5 A;  3BZK A;  5M3M G;  1JE5 A;  1NE3 A;  1NMG A;  1TWF H;  1N36 L;  4XIG S;  2F4V L;  3J81 c;  1YIT A;  4LFB Q;  3OW2 A;  4EX5 A;  1TXY A;  2B3G A;  3KF6 A;  1SFO H;  5C4J H;  4EQ5 A;  4LF9 L;  4A3C G;  1MIU A;  2R92 H;  3HOW G;  1K83 H;  3J80 i;  2AMC B;  3FP9 A;  3M85 A;  2NVQ H;  1YIJ A;  2N49 A;  1IBK L;  4Y52 H;  2C35 B;  4R4C A;  2YYZ A;  1PA6 A;  2K5H A;  1KD1 C;  4JI4 L;  4JI6 L;  3I4M H;  4JG2 A;  1YJW A;  3W1B A;  2PI2 E;  4LF7 L;  4A93 G;  1U0L A;  4MTN A;  4NXN L;  4IPD A;  2WAQ E;  4TVA B;  2N78 A;  1XMO L;  1KIX A;  2Y0S E;  1CKM A;  2GVA A;  4GN4 B;  3PUX A;  3RLN A;  1VQI A;  3PGZ A;  4YY3 L;  3S1M H;  4LF6 L;  1X3F A;  4IPG A;  3S16 H;  1HNW Q;  1HJP A;  5JEA G;  3AEV A;  3EIV A;  3MEF A;  1YHA A;  4A3J G;  2XTI A;  3CPF A;  4PMW A;  3F2D A;  1LUZ A;  1N33 Q;  4BY1 G;  4A3E H;  1G29 1;  3L7Z C;  5FJ8 H;  1PHJ A;  4YHH Q;  4DR6 Q;  1S3O A;  4JBJ A;  1OXU A;  2IHE A;  2IT1 A;  5IYD G;  3CME A;  2VQF L;  4A3B H;  4OO1 G;  4A3C H;  3U4Z A;  3HOW H;  2NVT H;  2A19 A;  4ME3 A;  2OTL A;  4B3S Q;  1JJC B;  2LSS A;  1GD7 A;  4TQU S;  5JJL A;  1Z9F A;  2EXD A;  2B29 A;  4A3D H;  1QUQ B;  1E3P A;  4GNX B;  5GAG C;  3TQY A;  5HGQ A;  1UE6 A;  3GTG H;  4A93 H;  1XJV A;  3H0G H;  2GVB A;  2VL6 A;  5JJI A;  3E0E A;  2CCZ A;  1K9M C;  4DKA C;  3NEL A;  4MZ9 A;  1N8R C;  1YNX A;  2KHI A;  5LMU Q;  1IBL Q;  4RG1 A;  3ZJY C;  1GO3 E;  4A3J H;  1JJ2 A;  2IY5 B;  1QZG A;  4GNX C;  2MQH A;  3ULP A;  1M1K C;  4IFD I;  3U50 C;  1NJI C;  4DR4 Q;  4X65 Q;  2B63 G;  1W3S A;  3K81 C;  5J3B A;  3WWV A;  2JA7 G;  5IYD H;  3JAM c;  2E2J H;  3GTQ H;  4JYA Q;  1HNW L;  1CKO A;  2OQ0 A;  3M4P A;  4QGU A;  5BR8 Q;  3G48 A;  4IPC A;  5HY6 A;  2PQA A;  2I0Q A;  1N33 L;  1I5F A;  4JI1 Q;  4YHH L;  4JI7 Q;  2RCN A;  5M3F G;  2ID0 A;  4AYB G;  4C2M H;  2NZO A;  4HJ8 A;  4GLX A;  4C3H H;  1VQ7 A;  1N9W A;  1HNX L;  3KF6 B;  4YWL A;  2QGQ A;  3K80 C;  2ZM6 Q;  4R4T A;  5IP7 G;  4LUZ A;  2KCT A;  4IO9 A;  1GVP A;  3PUZ A;  1PV4 A;  1CUK A;  5LMN Q;  5FLM G;  3I55 A;  2K14 A;  4PG3 A;  2IX0 A;  3K7A H;  2YTV A;  1WI5 A;  4A3G H;  4PZ6 A;  3GD7 A;  2UUB Q;  3D31 A;  1CKN A;  2JA7 H;  2OTJ A;  2ASB A;  5LMU L;  2QA4 A;  4DV5 L;  1X55 A;  3FHW A;  1SRU A;  2H5X A;  1EOV A;  2XGT A;  4JI2 Q;  4DR5 Q;  1Y1W H;  3A0J A;  1IBL L;  4L5S A;  1NTG A;  4GKK Q;  3CCS A;  4LFA Q;  1YHQ A;  3S24 A;  1EWI A;  4KHP Q;  2AWO A;  3NEM A;  3CCJ A;  3L0O A;  3CD6 A;  4DR4 L;  1Q82 C;  4X65 L;  4P74 A;  3J81 i;  2JE6 I;  4A3L H;  4NXM Q;  2VUM H;  1K73 C;  4JYA L;  1PH4 A;  1HR0 Q;  3F8T A;  1Q12 A;  4Y7N H;  1VQO A;  4AIM A;  5BR8 L;  4DR2 Q;  1XPR A;  1WYD A;  3S2H H;  4IOA A;  1I50 H;  4JI1 L;  4JI7 L;  1RL2 A;  1E1T A;  4GLA C;  3G71 A;  1A63 A;  2I5L X;  2ZTE A;  3U4V A;  4LF7 Q;  1Z47 A;  4NXN Q;  2PI2 A;  3AQQ A;  3CCE A;  1VQ4 A;  1N34 Q;  3PO2 H;  3HOZ H;  4A76 A;  1IZ6 A;  3CW2 C;  3KLW A;  2ZM6 L;  1A0I A;  1H95 A;  3GTK H;  1I3Q H;  2JA9 A;  4DK6 C;  2I5H A;  5LMN L;  3KJO A;  5IT9 c;  3RR5 A;  3S15 H;  3RZO H;  1JMC A;  4R4I A;  3HOX G;  2KEN A;  3S14 H;  2UUB L;  3PIP A;  1PVO A;  3I7F A;  4DV1 Q;  1W2B A;  1C9O A;  4X64 Q;  3NBH B;  4B3M Q;  4JI2 L;  3CF5 A;  4DR5 L;  4L5R C;  1XNQ L;  4GKK L;  4LFA L;  3M3Y H;  4JBW A;  1PH6 A;  3IRB A;  1UEB A;  1FL0 A;  1L0W A;  3CC7 A;  1J5E L;  1XNR L;  4AYB E;  1Q1E A;  3A5Z B;  1T9H A;  3HKS A;  1IBM L;  2PQA B;  1EQR A;  1VQM A;  5IP9 H;  4NXM L;  5K36 G;  1HR0 L;  5IY0 A;  1KXL A;  1CSQ A;  4DR2 L;  4QIW E;  4QL5 A;  2UU9 Q;  1PFS A;  3OYY A;  3L2P A;  4L5T A;  3GTP H;  2Q2U A;  2AKW B;  2RHQ B;  3GDE A;  2WB1 G;  1Q7Y C;  4R1J A;  2Z0S A;  1UE1 A;  1N34 L;  2JA5 H;  3JC6 6;  3I4N H;  3HOX H;  1BKB A;  3ULJ A;  1VQ5 A;  1BVS A;  4NB3 A;  1C7Y A;  1L2F A;  2MO1 A;  3E9H A;  3UDI A;  2MO0 A;  1TWG H;  1K8A C;  1KAW A;  3RLO A;  3ICE A;  2ZJQ A;  2Q2T A;  4JBK A;  1VQG A;  3GTL H;  5M3M H;  1CKN B;  2NVX H;  1AE2 A;  2YTX A;  3OTO Q;  3JAM i;  3T1Y Q;  3RZD H;  2GN5 A;  4PZ8 A;  4BXX G;  1WJJ A;  2D62 A;  4A75 A;  4HJ7 A;  3UDG A;  3UE0 A;  2ZTD A;  4LFC Q;  4DV1 L;  3S17 H;  4X64 L;  2I5M X;  4B3M L;  1HNX Q;  3LGJ A;  1I94 Q;  2VS1 A;  2NN6 G;  1TWH H;  4UPA A;  3S2D H;  1EQQ A;  1SRO A;  3I4O A;  3CC4 A;  1ASZ A;  1IL2 A;  1HZC A;  2R7Z H;  3Q8D A;  2BH2 A;  1LM0 A;  1MJE A;  2F52 A;  1E24 A;  1KL9 A;  1HZ9 A;  3S1Q H;  1YZ6 A;  2N8N A;  4IFD J;  2LXK A;  3E9I A;  2UU9 L;  4C3I H;  1QVG A;  4JOI A;  4DV5 Q;  1S72 A;  4BY7 G;  3PUY A;  1L1O A;  3TRE A;  1K3R A;  1KQS A;  1Q46 A;  3PF5 A;  4H02 A;  3AFQ A;  4C3J H;  2L15 A;  5IWA Q;  4APV A;  4BY1 H;  4QQB X;  2HQL A;  4XTC S;  1E7Z A;  3CCV A;  2V1C C;  1B70 B;  5H1S E;  4BBS G;  2VQE Q;  2KHJ A;  2CWP A;  3TEH B;  1JB7 A;  1OTC A;  2DUD A;  2CKZ B;  5DLQ E;  4POG A;  3J80 c;  1AE3 A;  3KOJ A;  3T1Y L;  3OTO L;  3HOV G;  4X6A H;  1G51 A;  1XMQ Q;  3J81 j;  2UXB Q;  1FJG Q;  4DAY B;  4LFC L;  2D0O A;  2EQS A;  3T1H Q;  1YI2 A;  4JI3 Q;  1VQE A;  4P72 A;  2UXC Q;  4DV6 Q;  1WOC A;  2E2H H;  1EIY B;  4GLV B;  2R7Z G;  4J15 A;  1I94 L;  3M4Q A;  1B7Y B;  1MKH A;  1FGU A;  1WCM G;  4A4I A;  5IE8 A;  3CCM A;  4HIO A;  3D0F A;  2ZTC A;  4UP8 A;  4DR3 Q;  3J7A 5;  5C4X G;  2WB1 E;  4BY7 H;  5C44 G;  1QZH A;  3U58 A;  3G4S A;  3PV0 A;  1IXR A;  4RMF A;  5GQO A;  3CMA A;  3KDF A;  1O7I A;  2HT1 A;  2B63 H;  2E5L Q;  4A3D G;  4DNI A;  1TWC H;  3H3V H;  4L5Q A;  3CCL A;  4P71 A;  2R6G A;  1XNQ Q;  1Q81 C;  4HIM A;  4JI5 L;  4IFD G;  2YV5 A;  5IWA L;  5C0X I;  4A3K G;  1V43 A;  1VQK A;  1VQJ A;  2HIX A;  3BU2 A;  1VCI A;  1J5E Q;  2OWO A;  4HIK A;  1XNR Q;  1X3G A;  2AWN A;  5M3F H;  3BZC A;  2JA8 G;  2PMZ E;  2VQE L;  4P75 A;  5C3E G;  2EIF A;  4OXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...