3R93A

Crystal structure of the chromo domain of m-phase phosphoprotein 8 bound to h3k9me3 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
DVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords M-phase phosphoprotein 8
publication title Structural basis for specific binding of human MPP8 chromodomain to histone H3 methylated at lysine 9.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 58
sequence length 58
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3r93A00
4RAUC 3MTSA 2B2VA 5EPKA 1EIHA 1IKLA 2NZ1D 4U68A 4XT3B 1KNAA 4ZAIA 2KECA 1U4RA 2IL8A 5JJZA 4X3UA 5COYA 4ZKCB 1B53A 1PDQA 3D6WA 2K28A 1F9SA 1HHVA 1ICWA 4IUQA 1DZ1A 1NR4A 2M2LA 2B2UC 4XDXA 5E4XA 1PFBA 4IUPA 1WTOA 1SAPA 5EPJA 2K01A 4ZLTF 5CBEE 4CJ1B 2RVLA 4XT1B 2FMMA 1IL8A 1F9RA 1U4PA 3DM1A 3HP3A 2R3ZA 2K04A 2RSOA 2L4NA 4DN4M 2D9UA 4NW2A 4IUUA 3FDTA 1DOMA 1X3PA 1PFMA 1RTNA 4LMQD 2EPBA 4HAEA 4OIKA 1WD1A 2VXWA 1NCVA 3QO2A 1IKMA 1HFGA 2SDFA 4IURA 2B2WA 3H91A 4RWSC 3I8ZA 1F9PA 1B4OA 2Q8RE 2Q8TA 1EQTA 1HA6A 1BO0A 3R93A 1WTPA 1DOLA 2CVRA 3FPUB 2DY8A 2MJ8A 3ONAB 4X3TA 2KEDA 1MSGA 2MP1A 5D14A 4HEDA 4X3SA 5EPLA 1B50A 3F2UA 3IL8A 1HUMA 1G6ZA 2FINB 2KEEA 1U4LA 2B2VC 3LWEA 1BNZA 1RODA 2KUMA 4RA8A 4QUFA 4OIJA 1WTQA 1G91A 3TZDA 2MGSA 2FJ2A 4UAIA 3I90A 5CMDA 5T1GA 1F2LA 2B2WC 2L11A 1ILPA 3Q6SA 2X6LA 3IFDA 1ZXTA 2MPMA 5D65A 1WTRA 3SVMA 2B2YA 1DOKA 2RSNA 3GV3A 1XX8A 2FFKB 2KVMA 1GUWA 2L12A 1C8CA 4O42A 2K05A 1B2TA 1RHPA 1RTOA 4CJ0B 1QG7A 1SDFA 2J7ZA 3TN2A 1AP0A 2KOLA 2L1BA 2HDMA 2NYZD 3DEOA 3N52A 2DY7A 5EJWA 1MSHA 1KNEA 3I91A 4QUCA 1HUNA 3P7JA 1ILQA 1ESRA 2L9HA 5T1IA 4ZKBB 1CA5A 1E0BA 4IUTA 4CJ2C 2B2TA 4X3KA 2N55A 5CORA 2B2YC 3DEPA 1NR2A 1S4ZA 5DNFA 2RA4A 2H1EA 1F9QA 3UI2A 1MI2A 1LV9A 5EQ0A 5CBAE 1J8IA 1QNKA 2B2UA 4ZK9B 2X6GA 1TVXA 2NWGA 5AFWA 5EKIA 1DONA 3G7LA 1BF4A 1EL0A 1B3AA 1G2TA 2HDLA 1RJTA 4R9WA 2EOTA 2HCIA 2JYOA 4HCSA 1X32A 1Q3LA 1SSOA 2FHTA 4MHEA 1VMPA 1VMCA 2HCCA 2B2TC 1WVLA 3KUPA 2BDNA 1BBXC 1EIGA 1O80A 1G2SA 2K03A 1HFNA 1WD0A 2N88A 3I3CA 1WTXA 1WTVA 1PFNA 1U4MA 1HRJA 3KBXA 1MGSA 1ML0D 1J9OA 1CA6A 1CM9A 1NAPA 3GV6A 1WTWA 4IUVA 4HSVA 1AZQA 5E4WC 1AZPA 1JICA 2EE1A 1A15A 2HUGA 1EOTA 1QE6A 1M8AA 1O7YA 1X3QA 2JP1A 2XIWA 4R8IA 2K1BA 3MWYW 1O7ZA 1JE4A 1XYIA 2X69A 1PLFA 4MN3A
chains in the Genus database with same CATH superfamily
5I2YA 1N33L 1WJJA 2NZ1D 4HMJA 4A93B 2I46A 4DAYA 3CPFA 3K5LA 1PZKD 3J81i 4XDXA 1KRTA 3PO3B 1AE3A 1LTBD 2MO1A 3MC0B 5EPJA 2PPBC 2IPKD 4JI0L 1S5CD 4PNYA 1QUQA 3NENA 1CFMA 3K5NA 2NVYH 1JOKA 4FXDA 1H95A 3IFTA 3TRZA 4M1UB 3FKIG 1QWYA 2C9OA 2VXWA 3FVQA 3E0JA 4J6HA 3NTIA 1SN8A 1HA5A 2B2WA 4UDUC 3QG1A 3I8ZA 1N34L 2Q8RE 4A3KG 5H1SE 1GUTA 1X54A 1EQQA 4DXGA 1BQQT 4JI2Q 3FKIB 2KEEA 1E2WA 1A2UA 1RODA 3T1HL 2E2JB 3KDFB 1G91A 2F0GA 1EY0A 1DCZA 3BVGA 3Q6SA 1LT6D 1CKOA 2DJGC 1GM5A 4A3KB 4Y7NH 2IWHA 3PUXA 4EQ5A 3BDOA 2ALYB 4DR4Q 2E2HB 2K52A 5JEAG 4KK7A 1MSHA 3J81c 1QVGA 4J8QA 4JYAL 3L9AX 2B29A 3DEPA 2OT2A 3H3VC 3H6MA 1SROA 5ELDA 5M5WH 1QNKA 4KD4A 3HOWH 1C0AA 2B8GA 1JCKB 1B3AA 4DV3L 3GTJB 1YNXA 2NZOA 4LJZC 4KHPQ 1KDBA 1EEFD 1SYBA 1NMGA 1N36Q 2EVBA 2BOSA 3PO3H 3OW7A 1PFNA 2J4XA 1HRJA 4BY1G 1JWUD 2IHFA 3TQYA 4DU9A 3KLWA 4QY7A 4PMBA 4DFAA 1B3QA 4DR7L 4A3LG 1B9MA 1JJGA 3MXUA 2R7FA 3MEHA 1PRTD 1X3QA 4HN7A 2UXBQ 1JE4A 4LFBL 1OXTA 1BCPB 4BY1B 4V0BA 1I50B 4O2DA 2A5HA 1JOQA 4UP8A 4L5SA 2UXCL 3K58A 1IHZA 2P5ZX 3RD4A 1P16A 1I94Q 1HR0L 1EU4A 2HQEA 4UHVA 2ES2A 1IBKQ 4JI3Q 4KY7A 4DV7L 3VR5A 3VYTA 1S5DD 4ZLTF 3I73A 4LF6Q 2A69C 2RVLA 4XT1B 4RGNA 5IGEA 2PMZB 3D31A 3HP3A 1HNZL 1PYBA 1HPCA 3M9BA 2K5DA 4DV0L 1WD1A 4OIKA 1BVSA 3K8AA 2RF4A 3RZOB 2FMCA 3W1GA 2E2HH 1CSQA 1D1KA 3QJYA 2YTXA 1VQ7A 2XWBB 3K81C 1XMOL 5JPMC 3SE0A 1W2BA 2B39A 1VQJA 5JEAJ 4JBJA 1UE6A 3W3AA 3KYHC 4QUFA 4K6LA 1TWCB 2E74C 4UAIA 5C5MA 5IYCH 3H0GG 1ENAA 4KKUA 3FMCA 3GTJH 2MQHA 1HNXQ 1ZXTA 3E6ZX 2R92G 4K0KL 2WB1E 1EFID 4HMIA 1GUWA 3SHLA 2QDLA 3I4OA 3FP9A 4K5WA 1YNNC 3M4QA 2J7ZA 4QMGA 4F87A 1Q90A 3DEOA 1LACA 4WRDA 3H0GB 1NTGA 4XQQA 2DJFC 3T4AC 4XYQA 4DR6Q 1D7QA 4A76A 2R92B 3NBHB 1GD7A 2NB0A 3ICEA 1PMRA 2IT1A 5CBAE 4APVA 4A3FH 3GTKH 2X6GA 3T1YL 2Z6KC 5FO7B 3VR3A 3M4OH 2HDLA 4ZQ3A 5JVG3 1KLGD 1X32A 1PH2A 1SMYC 2KQ3A 2WAQE 1TS4A 2FHTA 4O1NA 1RDPD 2F4VL 3CC2A 1WVLA 1V1PB 2I07B 2EYFA 1VQKA 1X9NA 1EWIA 1DGSA 1ZKOA 1LTTD 3GV6A 3PQIA 4X62L 2F0EA 1AZQA 1JICA 2PQAB 2ATWA 2TSSA 1A15A 4JOIA 2ZJQA 3PUYA 4HJ5A 4PV1C 1NSNS 4YY3L 2B2VA 5C0XG 3Q0AA 2F0JA 2IHEA 3CCMA 2PNHA 5IIFA 3S1MB 3SGIA 2F0IA 1MHWC 4RGMA 5E4XA 5KNCA 5IP7G 1K28A 2FXQA 4P74A 2AMCB 2ZTCA 4B3ML 3V2TA 4Y52H 5FKAC 3RLOA 2PW7A 2RSOA 2L4NA 1BBWA 5KNDA 4TQUS 4O0AA 4B3SL 3A5UA 1EQVA 4KTAA 2PI2A 1V9PA 3DMUA 2JA5G 4JBKA 1VQIA 3S1QB 3ITPA 2H5XA 4N8FA 2KHSA 1SE8A 1SFOB 1KRSA 3F2UA 2KJXA 3A7LA 1ET9A 2JA9A 4C1NI 4U673 2UUBQ 2JA5B 1X55A 2N8NA 5CV4A 3CHBD 3CAMA 2B2YA 4B9WA 3TREA 1VQ9A 3OSOA 4YWKA 1SEBD 5C44H 3GTQB 3R3OA 2K5VA 1B2TA 1QVFA 4CJ0B 4P72A 1R4PB 5GAEC 3M4PA 2GVAA 1JORA 1HUNA 3CCVA 2SEBD 5T1IA 1QILA 1CA5A 4KY6A 2R93G 1SRUA 2B2TA 4DK6C 2N55A 5AJ3L 3CW2C 1S4ZA 2RA4A 3S16H 3K7AB 1DM0B 4ME3A 4JI4L 5CV7A 1BF4A 4DUYL 1JWSD 4LUVA 2A6HD 4MTKA 2R93B 3ZJYC 1E3PA 1VQ8A 1G2SA 4FNFA 5ELOA 2L15A 2N88A 1IYJB 5C0XJ 2JSOA 1IW7D 5JJKA 1PH9A 1J9OA 1CA6A 3D0FA 5E4WC 2YU9B 2VQFQ 3MFGA 1WCMG 3EIVA 2CH4A 3KF8B 4G7HC 5DM63 3HS0C 1CK1A 1PTOB 3J80E 4IFDI 1YHBA 3S2DH 1TWFB 4ZKCB 4RHSA 2V1CC 1DYQA 1PFSA 2K28A 5FK9C 3T16A 1WCMB 4AIMA 1PFBA 1HZAA 3HKSA 2K01A 4DR5L 3QOJA 1YI2A 2JA5H 1F9RA 3NWTA 3HOXH 1A3VA 4RH6A 4P75A 4JI1Q 1RTNA 2WINB 5LMNL 1PYWD 2CW0C 3HOVG 4J15A 5C6AA 2E5LQ 1CT1D 3J7ZC 1HA6A 3SK8A 3U4ZA 5C0XI 1BO0A 5C3WA 5ISRA 2K5WA 2CVRA 4AQYL 5IT9E 1PH5A 2A68D 2HHHQ 3K7AH 4RCNA 3QR8A 3R2IA 2HIXA 4N9PA 3HOVB 3CU7A 1LT3D 2F0LA 2MPMA 1XPRA 3SVMA 2WP8J 2O2LD 4DR1Q 3GV3A 4LUOA 2XVSA 3CCLA 1UEBA 4WORA 1RHPA 5LL6S 1PH3A 3TN2A 1OO9B 3NBHA 1BXTA 1KNEA 3AU7A 3DWAA 1VDZA 1O7IA 4PMCA 1L2FA 2YU9H 1TXYA 5M5XB 1KAWA 4IALA 3UI2A 3HKZG 5C3EH 4OO1G 2NWGA 1IBLQ 4BWGB 2JA7G 4AH6A 2HCIA 4FP5D 2F0KA 1Q3LA 5BR8L 2VUMG 1SSOA 2Z6BA 1QNUA 1TWFH 2R7DA 4DNRB 1D5MC 3HKZB 4N9TA 5CC4A 2ICEC 1GVPA 2PQAA 4IPDA 3J7AF 3ND9A 4LF7Q 1H9SB 2BDOA 2NN6G 4IUVA 3R8BA 2JA7B 1Q8IA 3MFYA 2GN5A 2HUGA 4ABNA 1IBML 4C3JH 4NKLA 5CV6A 2O5JC 4C3IH 3UDGA 4P2CB 1YZ6A 5CV8A 4I7ZC 3I4NH 4NXML 4ZAIA 5EGTA 2MHVA 4JC0A 2IL8A 2F0SA 3BZKA 5I9OA 4WJWA 3CCQA 1ICFB 2E2DC 1K8OA 1PDQA 1VQLA 3STBD 2B2UC 4QF4A 4MIUA 3NXWA 4ZRZA 1N33Q 2PNRC 1OXSC 2XSCA 1EEID 5NUCA 1ASZA 1EY6A 2BE5C 1C4QA 2RCNA 3CC4A 2WIIB 2RDHA 1E1TA 2ICIA 3C3LA 3MAQA 4IUUA 1EYCA 2F0WA 4DAPA 4GOPC 1L1OA 4M8AA 1EZ8A 4JK1C 4C3HG 5FJ8G 1Q82C 4JI0Q 2KCNA 4YCWA 1FNVA 2JN4A 1H9KA 3HFZB 1O78A 2NVTB 1BBUA 1WTPA 3I70A 5LMNW 3K80C 3IL8A 1U4LA 4QGUA 1Z47A 1EIYB 1UNSA 5FLXL 4C3HB 3URYA 5CMDA 5T1GA 1N34Q 3PF5A 3GTGB 4ALPA 1SNQA 2B2WC 3HEJA 2HT1A 1ILPA 4BY7G 3N6RA 3J81j 1I3QH 1GHKA 4A3DH 2RSNA 1L0WA 1I6HB 3X3NA 1EQRA 3JAMi 3T1HQ 3PV0A 3CRKC 1X56A 2OEOA 3I56A 3RNUA 3OIPA 4OO1H 1VQ4A 5G3LF 2EYPA 5EKLA 3C1FA 4HR7B 1EY5A 4BY7B 1JJCB 1CKMA 4FF3A 5C4XH 3BDCA 1BOSA 4A3BG 1XMQL 5I6YA 1AW7A 1K83B 4UPAA 3T53B 4J1MA 1SYEA 4G7ZC 3TMEA 4CKCA 3A8KE 2NBFA 3RN2A 5FO8B 3D3RA 2EY1A 3SDZA 4YHHL 4A3BB 2EQSA 3SXHA 4DV3Q 1I4QA 1YITA 1BCPD 4CKEA 1AEXA 3KF8A 2XIWA 2EY5A 3S9WA 3CCEA 1NE3A 2ZTEA 4OEMB 3UDIA 2X69A 3MTSA 2LXKA 4U68A 4DR7Q 2Q2TA 1TWHB 1GXDC 1CKNA 3JAMc 2Q2IA 2ZM6Q 4GNXB 3H15A 4QCLA 3KOJA 4BA1I 5C4JH 3ND8A 1C7YA 1G8ZD 2HIVA 3M3YB 1ENCA 1CSPA 3W2DA 4L5TA 1HZBA 5FJ8H 2UXCQ 3KJPA 2NVXB 4KD3A 3OYYA 2K04A 1HR0Q 3PCOB 4X65L 2NN6I 2OWOA 4IUNA 1HXYD 4LMQD 4OL7A 4DV7Q 5IP9G 2K75A 3F2CA 4A3JH 1U9RA 2K4KA 4KY5A 1JT8A 3PMFA 3O13A 1PZJD 5C4ZA 1STNA 3H91A 1VQFA 2LY7A 2NTTA 2Q8TA 4DKAC 2RDFA 1K8GA 1HNZQ 3S14B 1YNJC 2L0CA 3J80i 1B8AA 2A6EC 4P73A 3FPUB 1TY0A 1X3GA 3KF6B 3PIO3 2ZJPA 1HUMA 2F0OA 1BNZA 1PZID 1RKNA 1Z6HA 2EYLA 4Q0FA 1EFWA 3F8TA 4X66Q 1VQMA 4KKTA 5EBCA 1XMOQ 4RG1A 5D65A 1KAAA 2F1MA 2IX0A 1A3UA 4EVOA 2K5QA 4C2MH 4S3SA 1ZYRD 3ZYYX 4BBSG 2CFMA 2KHIA 2NYZD 3S2HH 5EJWA 1SNDA 1JB7A 2NTSA 3GTOB 3CD6A 3X3MA 1E0BA 1E2VA 4X64Q 1NJIC 4K0KQ 2WB1G 4K8JA 3L2PA 3EROA 1SYGA 4R4TA 5EQ0A 4KHZA 4ZUJA 2E2IH 3VYSA 2K5HA 4A3GG 4E6IA 4ILWA 1DONA 1FJGL 1X3FA 1JJ2A 3MXGA 1RJTA 1VQHA 5ELBA 2CWPA 1KC8C 1SXTA 2CQAA 1TWHH 2I5HA 4XQJA 2QF7A 2WB1B 3CKIB 1XPUA 1SBBB 1EOVA 1H9SA 4G7OC 3T1YQ 3M3YH 2K32A 2Z4HA 3J80c 1ZEQX 3LX0A 1WTHA 3OHXC 4HSVA 3F2BA 4A3MG 1PH6A 2JA6G 4AYBE 3Q24A 2F4VQ 2F0NA 4JI7L 2NVXH 1QE6A 5J1ZA 2JEBI 3MWYW 1VQAA 1Y1VG 1L0XB 3CQZB 3M4YA 4A93H 1S5ED 2F0FA 3I4MG 1EYAA 4A3MB 2HD3A 2JA6B 3S15B 3S14H 1FGUA 3D6CA 4OX9L 3VR4A 1GO3E 1Y1VB 4YY3Q 2PCFB 2OTLA 3HOYG 3EA6A 4CKBA 3I4MB 4CBVA 1JE5A 4RMFA 3K0XA 3GO5A 2JA8G 4LFAL 4GN3B 3OIQA 5IT9c 2D9UA 1XPOA 3U4VA 3MZ5A 4HAEA 3HOYB 4B3MQ 3SEBA 2Y0SE 1TS3A 4A3EG 5E7NA 4WJ4A 2JA8B 1NY4A 3EBEA 2WKCA 3FKIH 1UAPA 4PZ8A 2F0UA 2E2JH 3PO2G 4FYDA 4L63B 3PUVA 3TDQA 4A3EB 3W1BA 2X6LA 4K2LA 4FDBA 5IWAL 4A3KH 3H3VI 2XTIA 1STHA 1WTRA 1YHAA 3NQIA 3K59A 5DM73 1AP0A 1I4HA 3PUWA 3VA7A 3I55A 3PO2B 2DY7A 3G48A 1ESRA 3NELA 5HGQA 2B2YC 4JI5L 5CYUA 2VNUD 4LF5L 4PZ7A 3TS2A 5JEAH 1TS5A 4JPBW 3SR1A 1A0IA 3NK9A 4JBWA 5AJ3Q 2B2TC 3EVQA 2PI2E 2EJFC 3AQQA 5JPNC 4B3RL 5IGDA 1WD0A 2UXDL 2TMPA 4JI4Q 3RLFA 2MUYA 4L6TB 2RHSB 5EKKA 4DUYQ 3TZUA 5BN3A 1SNPA 2KA7A 1PTOD 1VF7A 1Y69U 1K73C 4YCVA 5GAHC 3U58A 2WFWA 4IFDG 2KBNA 5IYBG 3MHBA 1FVIA 4DV6L 4BY1H 3VR6A 5EPKA 1I50H 3D4RA 3C2PA 2I5LX 1EUJA 2GVBA 3GP7A 4XT3B 4GNXA 3PIOA 4A3LH 4PG3A 4RCOA 3KJOA 2Q2HA 4CDCC 1B53A 3K57A 3HZXA 5LMUL 4NMZA 1LUZA 2LKVA 3OMCA 3JAML 2JA8H 1VQDA 3C46A 3G4SA 1DZ1A 1TS2A 2M2LA 3C1EA 5CV9A 3K5OA 3VYUA 2JE6I 4IJHA 5ELFA 5M9OA 1UWVA 1G6PA 4DK1A 1J5EL 2A73B 5I4DA 3DM1A 2Q8IB 3BS1A 1YJ9A 4KLKA 3RZOH 1EZ6A 4DF7A 4DR5Q 2LSSA 2KCCA 3A0JA 1EQTA 4A3IG 2AUKA 1LTAD 3R93A 1WTOA 4A75A 2MO0A 2D62A 4KHPL 1G6ZA 1A2TA 2IX3A 1Z7TA 1W3SA 2UUCL 3CXCA 2Q2UA 1Q46A 4OIJA 1TWCH 2FJ2A 4H13C 4DV4L 1E22A 2RDGA 4AQYQ 5C4HA 1VQPA 1FNUA 1VCIA 1XX8A 5LHY1 5CR3A 1VF5C 2OXPA 1RTOA 2D2CC 1SDFA 1S3OA 3IRBA 4YWLA 4HIDA 3H0GH 5GROA 4ZYSA 4OXPA 2R92H 3KDFA 2RHQB 2UU9Q 2PMZE 1GUGA 5IE8A 1E7ZA 4BBRG 3NWSA 1GKHA 3BVZA 1W6KA 5A2QL 1LT5D 1XJVA 1SMXA 1KIXA 4R4IA 5DAUA 1JB3A 1HNWL 4LF6L 4IFDJ 2EYHA 1KQSA 3S1NB 2OF1A 1A63A 4LNQA 1DJRD 1F77A 2F3IA 4Z9CB 4BBRB 4IFDH 5IYBH 3LGJA 2N78A 5I6WA 2E8GA 2AQ3B 3BVMA 5BR8Q 3J81L 1QCBD 5IOCA 3PF4A 2CHBD 1ONLA 1A3TA 4R4CA 2IY5B 1AH9A 4JI6L 3OOCA 1NBWA 1B70B 2VB2X 4PQXA 1D1IA 2AUJD 1BUVT 4QIWE 4LWCA 4DAMA 1SE2A 2A74C 1STYA 4B3TL 1IBMQ 4X3UA 3S1MH 1Z9FA 3GTPB 4QQBX 3BDLA 1PRTF 5M3MG 4IUQA 4PZ6A 4NXMQ 5C0XH 4K5VA 1K3BC 2WV6D 2VS1A 3S1RB 2R3ZA 5BN4A 1Y8PB 2EYOA 1C48A 1HH2P 1Y1WG 1QOHA 5M3MB 1GUNA 1X3PA 1BDOA 5IP7H 3BZDB 1D2BA 1HFGA 3S1QH 4EGVA 1OTCA 3A54A 2OTJA 4IURA 5ELEA 3WOEA 3QB3A 3U50C 5EAYA 1PRTC 2NUCA 1SFOH 3ONAB 1Y1WB 3JC66 1UE5A 1S40A 3J7A5 5I9PA 1L1OC 2KUMA 3I2ZA 2KCMA 3ULLA 2VY3A 1TWGB 3FRPB 3CCJA 2LXJA 1M1KC 1IL2A 3S1NH 3PGZA 1C8CA 3GTQH 1HTLD 1Q1EA 4CGYB 1LABA 4JV5L 2UUAL 4NB3A 2ZTDA 4DR2L 5M5YB 2M9VA 3CF5A 2BCOA 1VQBA 1F9QA 1PHJA 5ELCA 4C56C 3NBIA 1KHIA 1I4GA 4ZK9B 1W6JA 4JCVE 3GTMB 3TSSA 4NDXA 4R9WA 1IXRA 1X6OA 3WDNA 2EY6A 2PQEA 2Z9HA 4LFCL 4JI8L 3KLSA 2R93H 5K36G 1RL2A 2XGTA 3GTPH 4A3CG 2K03A 1ENFA 4DAYB 1XNRL 3KBXA 1XMQQ 1HTPA 1V1QA 4F7XA 2ZJRA 4KI0A 4GOPB 4KHVA 3UDXA 1D5XC 3KFUA 5FLMG 3L0OA 4BXXG 1TKWB 2OQ0A 1K8MA 5HGTA 3KBGA 5IGFA 1GHJA 4YHHQ 4RAUC 1V1PA 1SE3A 4DK0A 1PTOH 3OW2A 1AE2A 4LF9L 5COYA 2O4XA 1YEZA 2EYJA 1N32L 1F9SA 1G51A 1WCMH 4IQZA 1NR4A 4IPHA 2B63G 3CCRA 4DA2A 2RQXA 2EYMA 4PMWA 4DNIA 2O5IC 2WKDA 1EWCA 1SYFA 5M3FG 2VUMB 4H44C 4XYOA 1OXXK 4OWTB 2Z1CA 3KLRA 3RR5A 2CWAA 2VW9A 5GADC 2B63B 2QGQA 5LL6X 4LF4L 1UE7A 1CQFA 3UE0A 1PH1A 1HZCA 4DUZL 5M3FB 5M5YH 1H9MA 3M7GA 1DOLA 1I4XA 2KEDA 3PUZA 2NVQB 4FVMA 2K14A 1UEAB 5GQOA 4DV2L 1WTQA 4R4QA 2K7VA 1L0YB 3TZDA 3GTMH 3I4LA 4HIKA 3HOVH 2AKWB 5HY6A 3GDEA 2HQLA 4OWXB 1R4QB 2FFKB 2DNCA 4FXKC 2VZAA 1HCZA 2F3VA 4L8JA 2DN8A 3N52A 1SNMA 1VQ5A 1EYGA 2F0PA 3D4WA 2IW3A 4CHTB 4X3KA 4ZKBB 1R9TB 5M5XH 3S17B 1JC7A 3RUZA 4RKBA 1T5XD 1TVXA 5EKIA 3K0YA 3NEMA 2A69D 3MXNB 1E2ZA 4MHEA 4R8NA 3NTHA 3OPOA 2F0HA 1I5FA 1O80A 1S72A 3AMUA 1DXMA 3NP8A 1CHQD 3R2TA 1X3EA 1FJGQ 4GKKL 1MGSA 1FR3A 4NXNL 1RF2D 4IZ8A 2JA7H 4FO2A 2EE1A 3CMEA 2VUMH 3TBIB 2LFNA 2IJ0A 2K50A 1YHQA 1STEA 1PLFA 2B63H 4JW0A 3J7AV 5I2XA 2EY2A 2KECA 4JYAQ 2NN6H 3AYHB 1PH8A 4AYBG 5JJZA 4JI7Q 3MVVA 1FL0A 1K0RA 3NE5B 2VL6A 2LMCB 2OQKA 4IN3A 3DLLA 1FNWA 1YNND 2OCEA 3HG9A 4KV6A 2NVQH 1LTRD 2CCZA 3FHWA 3CRLC 5CBEE 4FF1A 1IL8A 4AYBB 1U4PA 2E76C 1UE1A 3CMAA 1CTMA 2A6HC 2NVYB 3VR2A 4OX9Q 3BU2A 1LTGD 3A8IE 3D4DA 5C3XA 1O7LA 1IW7C 1H9JA 1FYCA 1N9WA 2SNMA 3QO2A 5FLXE 4I65A 4MZ9A 4EX5A 3K6OA 4RWSC 1SMYD 1JOOA 2BH8A 1YBYA 2D5DA 4KJNA 3OTOL 4LFAQ 2NVTH 2Z4IA 1EY9A 4LFBQ 4X3TA 4X3SA 4JBMA 1GOZA 3RMHA 2FINB 3LWEA 4BS9A 4C3HH 1AFPA 2Y0SG 2MGSA 3GTGH 5DEHA 1STBA 1WOCA 1VQOA 4Y7NB 1I6HH 2K05A 3HOWG 1QG7A 2C5CA 4LF8L 2KOLA 2DUDA 2Y0SB 4XIGS 3UDFA 2PZWA 3P7JA 1ILQA 1F2MA 5IWAQ 2GA4B 4BY7H 4IUTA 2RKSA 4I7AA 5GAGC 1XNQL 5DNFA 4DV0Q 3A7AB 4DV1L 1SR3A 1MI2A 1LV9A 5M5WB 3G6EA 1MIUA 2B2UA 3HOWB 2F52A 1VQ6A 2EXDA 3ERQA 4K2KA 1SLJA 3G6JB 4UY8C 1K83H 5F2DA 3VYRA 1V8QA 3CC7A 2D0OA 4JI5Q 3QWNA 4LF5Q 2V4DA 2XWJB 1WTXA 4GKJL 4GOPA 2A68C 4A3BH 5D3DA 3DHQA 1ML0D 1YJNA 1EIFA 2H4OA 4GLXA 2J0TD 1K3RA 3TS0A 3J7YW 4B3RQ 1O7YA 2JP1A 5DLQE 1TWAB 5KNBA 2XN9C 2UXDQ 1HQRD 4BBSB 5IGBA 4WFN3 1MBYA 1LYLA 1VQNA 2WACA 1KNAA 1M4VA 3E5SA 3PIP3 3K5MA 3B6YA 1SE4A 3D6WA 5FO9B 1HHVA 2EDGA 2JEAI 2JK8A 1ASYA 4DV5L 4DV6Q 4IOAA 2JXMB 4A3GB 4GLAC 1SAPA 2NZHA 3TP7A 4GNXC 2QEJC 2WAQG 1WYDA 1LLRD 5LMUQ 1YJWA 1V1OA 1DOMA 4WJ3M 1TIID 4X62Q 1NCVA 3A74A 1FD7D 3NSWA 1J5EQ 3H3VH 1WI5A 5IYCG 2DGYA 2WAQB 1B4OA 4QB4A 1HQMC 1LTSD 4JOIC 2CKZB 2L5TA 3G71A 1KDAA 5IP9H 1OXVA 2B2VC 2RBMA 1BKBA 4H02A 1F2LA 3HOUG 2EXZA 2XNAC 4K14A 2D0PA 3GTLB 1S5BD 2AWOA 3STBC 1XXGA 2KHJA 4A3FG 3SK6A 2UUCQ 3A5ZB 3HGBA 4N8X1 1BR9A 4DV4Q 3GTOH 2L9HA 3HOUB 4POFA 4B3SQ 1TWAH 3MXNA 2ZM6L 2EJMA 4A3FB 3GTKB 4BBSH 3BG3A 3VA5A 3BZCA 4L5QA 3VDYA 3M4OB 1G2TA 4XXEA 1KTKA 3LNNA 1EU3A 1VMCA 4JG2A 3E0EA 1BBXC 5KEEA 4K8IA 2VQEL 1K8AC 4DR3L 4QJFA 1EYDA 5ELNA 3OMGA 2CW0D 2F0QA 3AFQA 4A3GH 1YIJA 1CQVA 4RFBA 1NAPA 3GD7A 1WTWA 1HNWQ 1AZPA 1TT2A 1SJED 5JOBA 1SJHD 3HRZC 3AEVA 3Q23A 4B9XA 3EQLC 1VQCA 1KXLA 4HCEA 3CQZH 4K6DA 1PA6A 4TRDA 4A3MH 2JA6H 2K6AA 4LK1C 1BCPF 3P20A 3S15H 4X66L 5C5LA 1B1ZA 4JI6Q 4F88A 1N8RC 1A62A 1Y1VH 3FPPA 3I4MH 4B3TQ 2F4IA 5J39A 4IO9A 2F0TA 4X64L 1A8VA 1IZ6A 2C35B 3RZDB 4A4IA 3GQBA 4JI2L 3GTLH 2M00A 3HOYH 4QIWB 2SDFA 4X6AH 1Q86C 1F9PA 4RKLA 1BCPC 3P1HA 5E3FA 3HOUH 1V43A 2MJ8A 1E24A 5C44G 4HEDA 1Y8OB 4H0LC 4HIOA 2QCPX 4DR4L 1SYDA 1PH7A 5IGGA 4A3EH 2L11A 1LTID 1KABA 4NP5A 2L12A 5C44B 1STAA 1IYVA 3NTKA 2PZTA 2PO4A 3PO2H 4UP7A 1Q12A 3KF6A 4TKOB 3WOFA 4DK3C 3RN5A 3L7ZC 5CORA 5LMNQ 3S16B 3PIPA 1N36L 3H94A 1FGBD 1TY2A 4JV5Q 2UUAQ 1CI3M 4DR2Q 2BE5D 1KDCA 2G5DA 4OONA 5IYDG 2K5NA 4CDEC 3Q22A 1TU2B 1B9NA 4H7BA 4A3IB 1GUOA 3HOZG 2A19A 2HCCA 1JQYD 4KJOA 4BA2I 3CCUA 4KKSA 4B08A 3I3CA 3E3XA 2UXBL 4OHJA 1WTVA 1U4MA 3CP0A 1NNXA 3ER0A 1MD2D 3F1ZA 2MFIA 2BA0A 3OWFA 4LFCQ 4JI8Q 4RGTA 4DPGA 3HOZB 4R8IA 1LTLA 1HR0W 1XTCD 3JAME 1QZGA 5EBDA 1I94L 1PVOA 1XNRQ 1STGA 5JVH3 4MN3A 3RZDH 1EY7A 1IBKL 1ZYRC 1LM0A 3DM3A 4JI3L 4CDDC 1IKLA 1PRTB 2SOBA 3E9HA 3S2DB 5J3BA 1L1OB 3HOXG 1J6QA 1EY4A 5IY0A 1ICWA 3AB9A 3NUCA 2QDBA 1XTDA 3PSIA 3WWVA 5JJLA 2N49A 4IUPA 3TP5A 5FLXc 1U5KA 1CHPD 3M85A 1Q1BA 4CJ1B 3J80L 4LF9Q 1RCVD 3ULJA 2ZXRA 5IGCA 2FMMA 1N32Q 4RHRA 3HOXB 3MA2B 2MNAA 4DN4M 4GZYC 1K0SA 1TR5A 1PFMA 3ERSX 2F0VA 4OGQC 1LO5D 4P71A 1HNXL 2BA1A 1E1OA 2DY8A 2SNSA 3NQTA 3V96A 1MSGA 5D14A 4ODGA 1B50A 4F8MA 4LF4Q 3T56B 1M90C 1C9OA 5K5PA 1KL9A 3TP8A 4DUZQ 5G3LD 3I90A 2CH4W 1I6VC 3H09A 5HURA 1Q7YC 4DR6L 4HTHA 4POGA 4A3IH 5IODA 2JJQA 2G9HD 4UP9A 2KVMA 5IT9L 4L5RC 2LS01 1Y14B 2ZT9C 5C3EG 2A1AA 4DV2Q 4CDFC 5A2QE 2HDMA 2Z6KA 4HSPA 3I91A 3DWQA 3T51B 5IYDH 4CJ2C 3HOZH 2YV5A 1NR2A 2F0MA 2BH2A 3EFXD 2R6GA 1J8IA 4FXGC 5C3EB 1QJOA 4YCUA 3A56A 1EWHA 2B8FA 1SNCA 1T9HA 5AFWA 3G7LA 4GN4B 2PZUA 3J81E 2XRQD 4GLVB 4C3JG 4EQPA 4EQNA 3NHHA 4C3IG 4BBRH 1CKNB 4R4OA 2N3SA 1QB5D 2QA4A 4HJ9A 2F3WA 3I4NG 1LT4D 1CM9A 2G9DA 2K33A 1YNJD 2QKIC 4C1NK 1A6XA 2A6ED 1MJEA 4TSSA 4C3JB 1M8AA 1CZGA 2AQ2B 1ESFA 4C3IB 2K1BA 1O7ZA 1G291 4GKKQ 1JWMD 4NXNQ 4ZCKA 1EIHA 3I4NB 1RIPA 1S5FD 1KD1C 1PTOF 2DNEA 3OWEB 5BN5A 3NPPA 3IKJA 1PYSB 2YTYA 1Q81C 2YTVA 2L55A 1U0LA 1TQOA 3W5OA 3U9OA 1IYUA 2QILA 2EJGC 4NPSA 3S1RH 4ULLA 1HZ9A 1D5ZC 4NW2A 5M3MH 1QUQB 1F2ZA 2UU9L 1IKMA 2F0DA 4XQNA 2UUBL 2AHOB 1JR0D 1NUCA 4R1JA 1I4PA 2ASBA 4A3DG 1PTOC 1P8LA 1Y8NB 1Y1WH 3A55A 2A8VA 1AN8A 1HJPA 1TWGH 4IPCA 3S24A 4QL5A 3OTOQ 3IFDA 5L37A 1I3QB 3EJIA 4GS3A 4DGZA 4A3DB 1X65A 4O42A 2AQ1B 3D8GA 3M7NA 1PH4A 4IPGA 5C4XG 5KIXA 1VQEA 4LW1A 2L1BA 2Z8LA 4QUCA 5FOBB 4HJAA 4X65Q 1KLUD 1QVCA 3U9SA 3A8JE 4K5XA 2H1EA 4JVZA 1VS0A 5JJIA 5C4XB 4LF8Q 5JAVA 5A35A 2ID0A 2QEXA 3KLSX 1SYCA 2ZXPA 4HCSA 2EZVA 2JQOA 1XWEA 2R7ZG 4XTCS 4HJ7A 1XNQQ 1PXUA 2VQFL 4DV1Q 3KUPA 4IJLA 2BDNA 1II3A 4DAVA 3MEFA 1GUSA 5E1FA 4Q5VA 3IAYA 1D6EC 3AFPA 3L3OC 3QOLA 2R7ZB 1EOTA 5K36H 5KGUA 1K9MC 3UE1A 1YVCA 1SNOA 4A3CH 1T5EA 2QW7A 3BJUA 4YWMA 1XYIA 4GKJQ 3MXPA 3LWUA 3TP6A 1MKHA 1U4RA 1CZWA 1ET6A 4EQOA 2EIFA 3SK5A 2XRSD 5FLMH 4BXXH 5KYLA 4OELB 3CCSA 5C4JB 2YYZA 4G4KA 2AWNA 4JI1L 3K7UC 4A3JG 2ZXOA 4ZUIA 4LAAA 3F2DA 2E5LL 1I4RA 1EY8A 3T13A 2CQOA 4HIMA 2IX1A 1F2YA 2I5MX 4DV5Q 3FDTA 1DD2A 1WFQA 3Q8DA 2PYKA 2EPBA 4A3JB 1OXUA 1CUKA 2HHHL 1GJXA 1H9RA 5J22A 4KN7C 5M3FH 4ID6A 4DR1L 2MP1A 5EPLA 5CV5A 1RD9D 1B7YB 3I7FA 4RA8A 4TVAB 1NMFA 4ME5A 4OWWB 4V190 3BYYB 4KN4C 1DOKA 3V05A 3KK7A 3SK4A 2E75C 3EN2A 4C2MB 3HKZE 4G57A 3CPWA 2B3GA 1Q8KA 3S2HB 5D3IB 1MJCA 4GN5A 1IBLL 1JMCA 2ENBA 4DXFA 3ULPA 1UUPA 4HJ8A 4LUZA 2R7ZH 1R9TH 3QIAA 3S17H 3P75A 4IOCA 3E9IA 2Z0SA 3DWPA 2E2IB 3RLNA 2PW5A 4RGOS 2F03A 4MTNA 1EL0A 4KMUC 5TSSA 4LF7L 2EOTA 2JYOA 4YIJA 4DNTB 2KENA 4OO1I 3FEWX 1VMPA 2KCTA 3DXJC 5KRUA 1EIGA 1VQGA 2I0QA 1HFNA 2R61A 1QZHA 5KYIA 3BYTB 3DUZA 1B44D 4A93G 5CGKA 2RCFA 2VB3X 4FF2A 2VQEQ 4DR3Q 3TEHB 1PV4A 3PO3G 4MNOA 1D8LA 3I72A 4FF4A
chains in the Genus database with same CATH topology
5I2YA 2NZ1D 4HMJA 4A93B 2I46A 4DAYA 3K5LA 1PZKD 4XDXA 3PO3B 1LTBD 3MC0B 5EPJA 2PPBC 2IPKD 1S5CD 4PNYA 1CFMA 3K5NA 1JOKA 4FXDA 3IFTA 4M1UB 1QWYA 2C9OA 2VXWA 3FVQA 3E0JA 4J6HA 3NTIA 1HA5A 2B2WA 4UDUC 3QG1A 3I8ZA 2Q8RE 1GUTA 4DXGA 1BQQT 3FKIB 2KEEA 1E2WA 1A2UA 1RODA 2E2JB 1G91A 2F0GA 1EY0A 1DCZA 3BVGA 3Q6SA 1LT6D 4A3KB 2IWHA 3PUXA 3BDOA 2E2HB 5JEAG 4KK7A 1MSHA 4J8QA 3L9AX 3DEPA 2OT2A 3H3VC 3H6MA 5ELDA 1QNKA 4KD4A 2B8GA 1JCKB 1B3AA 3GTJB 4LJZC 1KDBA 1EEFD 1SYBA 2EVBA 2BOSA 3OW7A 1PFNA 2J4XA 1HRJA 1JWUD 4DU9A 4PMBA 4DFAA 1B9MA 3MXUA 3MEHA 1PRTD 1X3QA 4HN7A 1JE4A 1OXTA 1BCPB 4BY1B 4V0BA 1I50B 2A5HA 1JOQA 3K58A 1IHZA 3RD4A 1EU4A 2HQEA 4KY7A 3VR5A 3VYTA 1S5DD 4ZLTF 3I73A 2A69C 2RVLA 4XT1B 4RGNA 5IGEA 2PMZB 3D31A 3HP3A 1HPCA 2K5DA 1WD1A 4OIKA 3RZOB 2FMCA 1D1KA 3QJYA 2XWBB 5JPMC 3SE0A 2B39A 5JEAJ 3W3AA 4QUFA 4K6LA 1TWCB 2E74C 4UAIA 5C5MA 1ENAA 4KKUA 3FMCA 1ZXTA 3E6ZX 1EFID 4HMIA 1GUWA 3SHLA 4K5WA 1YNNC 2J7ZA 4QMGA 4F87A 1Q90A 3DEOA 1LACA 4WRDA 3H0GB 4XQQA 4XYQA 3T4AC 2R92B 2NB0A 1PMRA 2IT1A 5CBAE 2X6GA 5FO7B 3VR3A 2HDLA 4ZQ3A 5JVG3 1KLGD 1X32A 1SMYC 2KQ3A 1TS4A 2FHTA 4O1NA 1RDPD 1WVLA 1V1PB 2I07B 2EYFA 1ZKOA 1LTTD 3GV6A 2F0EA 1AZQA 1JICA 2TSSA 1A15A 3PUYA 4PV1C 1NSNS 2B2VA 5C0XG 3Q0AA 2F0JA 5IIFA 3S1MB 2F0IA 4RGMA 5E4XA 5KNCA 3V2TA 5FKAC 2PW7A 2RSOA 2L4NA 5KNDA 4TQUS 1EQVA 4KTAA 3DMUA 3S1QB 3ITPA 2KHSA 1SFOB 3F2UA 2KJXA 3A7LA 1ET9A 4C1NI 4U673 2JA5B 5CV4A 3CHBD 2B2YA 4B9WA 3OSOA 1SEBD 3GTQB 3R3OA 1B2TA 4CJ0B 1R4PB 1HUNA 1JORA 2SEBD 5T1IA 1QILA 1CA5A 4KY6A 2B2TA 2N55A 1S4ZA 2RA4A 3K7AB 1DM0B 5CV7A 1BF4A 1JWSD 2A6HD 2R93B 1G2SA 4FNFA 2N88A 5C0XJ 2JSOA 1IW7D 1J9OA 1CA6A 5E4WC 2YU9B 3MFGA 4G7HC 5DM63 3HS0C 1CK1A 1PTOB 3J80E 4IFDI 1TWFB 4ZKCB 4RHSA 1DYQA 2K28A 5FK9C 3T16A 1WCMB 1PFBA 2K01A 3QOJA 1F9RA 3NWTA 1A3VA 4RH6A 1RTNA 2WINB 1PYWD 2CW0C 5C6AA 1CT1D 1HA6A 3SK8A 5C0XI 1BO0A 5C3WA 5ISRA 2K5WA 2CVRA 5IT9E 2A68D 4RCNA 3R2IA 4N9PA 3HOVB 3CU7A 1LT3D 2F0LA 2MPMA 3SVMA 2WP8J 2O2LD 3GV3A 2XVSA 4WORA 1RHPA 5LL6S 3TN2A 1OO9B 3NBHA 1BXTA 1KNEA 3AU7A 3DWAA 1VDZA 4PMCA 5M5XB 4IALA 3UI2A 4OO1G 2NWGA 4BWGB 2HCIA 4FP5D 2F0KA 1Q3LA 1SSOA 1QNUA 4DNRB 1D5MC 3HKZB 4N9TA 5CC4A 2ICEC 3J7AF 3ND9A 1H9SB 2BDOA 2NN6G 4IUVA 3R8BA 2JA7B 1Q8IA 3MFYA 4ABNA 2HUGA 4NKLA 5CV6A 2O5JC 4P2CB 5CV8A 4I7ZC 4ZAIA 5EGTA 2MHVA 2IL8A 2F0SA 5I9OA 4WJWA 2E2DC 1K8OA 1PDQA 2B2UC 4QF4A 4MIUA 3NXWA 4ZRZA 2PNRC 1OXSC 2XSCA 1EEID 5NUCA 1EY6A 2BE5C 1C4QA 2WIIB 2RDHA 2ICIA 3C3LA 3MAQA 4IUUA 1EYCA 2F0WA 4DAPA 4M8AA 1EZ8A 4JK1C 4C3HG 2KCNA 1FNVA 1H9KA 1O78A 2NVTB 1WTPA 3I70A 3IL8A 1U4LA 1Z47A 1UNSA 5FLXL 4C3HB 3URYA 5CMDA 5T1GA 3GTGB 1SNQA 2B2WC 3HEJA 1ILPA 3N6RA 1GHKA 2RSNA 1I6HB 3X3NA 3PV0A 3CRKC 2OEOA 4OO1H 3OIPA 5G3LF 2EYPA 5EKLA 3C1FA 4HR7B 1EY5A 4BY7B 4FF3A 3BDCA 1BOSA 5I6YA 1AW7A 1K83B 3T53B 4J1MA 1SYEA 4G7ZC 3TMEA 4CKCA 3A8KE 2NBFA 5FO8B 3D3RA 2EY1A 3SDZA 4A3BB 3SXHA 1I4QA 1BCPD 4CKEA 1AEXA 3KF8A 2XIWA 2EY5A 3S9WA 2X69A 3MTSA 4U68A 1TWHB 1GXDC 4QCLA 4BA1I 3ND8A 1G8ZD 3M3YB 1ENCA 3W2DA 2NVXB 4KD3A 2K04A 2NN6I 4IUNA 1HXYD 4LMQD 4OL7A 1U9RA 4KY5A 3PMFA 3O13A 1PZJD 5C4ZA 1STNA 3H91A 2NTTA 2LY7A 2Q8TA 2RDFA 3S14B 1YNJC 2L0CA 2A6EC 3FPUB 1TY0A 3PIO3 1HUMA 2F0OA 1BNZA 1PZID 1RKNA 1Z6HA 2EYLA 4Q0FA 4KKTA 5EBCA 5D65A 1KAAA 2F1MA 2IX0A 1A3UA 4EVOA 2K5QA 4S3SA 1ZYRD 3ZYYX 2NYZD 5EJWA 1SNDA 2NTSA 3GTOB 3X3MA 1E0BA 1E2VA 4K8JA 3EROA 1SYGA 5EQ0A 4ZUJA 4KHZA 3VYSA 4E6IA 4ILWA 1DONA 3MXGA 1RJTA 5ELBA 1SXTA 2CQAA 4XQJA 2QF7A 2WB1B 3CKIB 1SBBB 1H9SA 4G7OC 2K32A 2Z4HA 1ZEQX 3LX0A 3OHXC 4HSVA 3Q24A 2F0NA 1QE6A 5J1ZA 2JEBI 3MWYW 1L0XB 3CQZB 3M4YA 1S5ED 2F0FA 1EYAA 4A3MB 2JA6B 3S15B 3D6CA 3VR4A 1Y1VB 2PCFB 3EA6A 4CKBA 3I4MB 4CBVA 3GO5A 3OIQA 2D9UA 3MZ5A 4HAEA 3HOYB 3SEBA 1TS3A 2JA8B 2WKCA 1UAPA 2F0UA 4FYDA 4L63B 3PUVA 3TDQA 4A3EB 2X6LA 4K2LA 1STHA 1WTRA 3NQIA 3K59A 5DM73 1AP0A 1I4HA 3PUWA 3VA7A 3PO2B 2DY7A 1ESRA 2B2YC 5CYUA 2VNUD 5JEAH 1TS5A 3SR1A 3NK9A 4JBWA 2B2TC 3EVQA 2EJFC 5JPNC 5IGDA 1WD0A 2TMPA 3RLFA 2MUYA 4L6TB 5EKKA 3TZUA 5BN3A 1SNPA 2KA7A 1PTOD 1VF7A 1Y69U 4IFDG 3MHBA 3VR6A 5EPKA 3D4RA 3C2PA 3GP7A 4XT3B 4RCOA 1B53A 3K57A 3HZXA 4NMZA 2LKVA 3OMCA 3JAML 3C46A 1DZ1A 1TS2A 2M2LA 3C1EA 5CV9A 3K5OA 3VYUA 2JE6I 5ELFA 5M9OA 4DK1A 2A73B 5I4DA 3DM1A 2Q8IB 3BS1A 1EZ6A 4DF7A 2KCCA 1EQTA 2AUKA 1LTAD 3R93A 1WTOA 2D62A 1G6ZA 1A2TA 2IX3A 1Z7TA 4OIJA 2FJ2A 4H13C 2RDGA 5C4HA 1FNUA 1VCIA 1XX8A 5LHY1 5CR3A 1VF5C 2OXPA 1RTOA 2D2CC 1SDFA 4ZYSA 1GUGA 3NWSA 3BVZA 1W6KA 5A2QL 1LT5D 5DAUA 1JB3A 4IFDJ 2EYHA 3S1NB 2OF1A 1DJRD 1F77A 4Z9CB 4BBRB 4IFDH 5I6WA 2AQ3B 3BVMA 3J81L 1QCBD 5IOCA 2CHBD 1ONLA 1A3TA 3OOCA 2VB2X 4PQXA 1D1IA 2AUJD 1BUVT 1SE2A 2A74C 1STYA 4X3UA 3GTPB 3BDLA 1PRTF 4IUQA 5C0XH 4K5VA 2WV6D 3S1RB 2R3ZA 5BN4A 1Y8PB 2EYOA 1C48A 1QOHA 5M3MB 1GUNA 1X3PA 1BDOA 3BZDB 1D2BA 1HFGA 4EGVA 3A54A 4IURA 5ELEA 3WOEA 3QB3A 1PRTC 2NUCA 3ONAB 1Y1WB 5I9PA 2KUMA 1TWGB 3FRPB 1C8CA 1HTLD 1Q1EA 4CGYB 1LABA 5M5YB 2M9VA 2BCOA 1F9QA 5ELCA 4C56C 3NBIA 1I4GA 4ZK9B 1W6JA 3GTMB 3TSSA 4NDXA 4R9WA 3WDNA 2EY6A 2PQEA 5K36G 3KLSA 2K03A 1ENFA 3KBXA 1HTPA 4F7XA 4KI0A 4KHVA 1D5XC 1TKWB 1K8MA 5HGTA 3KBGA 5IGFA 1GHJA 4RAUC 1V1PA 1SE3A 4DK0A 1PTOH 5COYA 2O4XA 2EYJA 1F9SA 4IQZA 1NR4A 4DA2A 2RQXA 2EYMA 4PMWA 2O5IC 2WKDA 1EWCA 1SYFA 2VUMB 4H44C 4XYOA 1OXXK 2Z1CA 3KLRA 2B63B 5LL6X 1CQFA 5M3FB 1H9MA 3M7GA 1DOLA 1I4XA 2KEDA 3PUZA 2NVQB 4FVMA 1UEAB 1WTQA 3TZDA 2K7VA 1L0YB 3I4LA 1R4QB 2FFKB 2DNCA 4FXKC 1HCZA 2F3VA 4L8JA 2DN8A 3N52A 1SNMA 2F0PA 3D4WA 2IW3A 4CHTB 4X3KA 4ZKBB 1R9TB 3S17B 1JC7A 3RUZA 4RKBA 1T5XD 1TVXA 5EKIA 3K0YA 2A69D 1E2ZA 4MHEA 4R8NA 3NTHA 3OPOA 2F0HA 1O80A 3AMUA 1DXMA 3NP8A 1CHQD 3R2TA 1MGSA 1FR3A 1RF2D 4IZ8A 4FO2A 2EE1A 3TBIB 2LFNA 2IJ0A 1STEA 1PLFA 3J7AV 5I2XA 2EY2A 2KECA 2NN6H 5JJZA 3MVVA 3NE5B 2LMCB 4IN3A 1FNWA 1YNND 3HG9A 4KV6A 1LTRD 3CRLC 5CBEE 4FF1A 1IL8A 4AYBB 1U4PA 2E76C 1CTMA 2A6HC 2NVYB 3VR2A 1LTGD 3A8IE 3D4DA 5C3XA 1O7LA 1IW7C 1H9JA 1FYCA 2SNMA 3QO2A 5FLXE 4I65A 3K6OA 4RWSC 1SMYD 1JOOA 2D5DA 4KJNA 2Z4IA 1EY9A 4X3TA 4X3SA 1GOZA 3RMHA 2FINB 3LWEA 4BS9A 1AFPA 2MGSA 5DEHA 1STBA 4Y7NB 2K05A 1QG7A 2C5CA 2KOLA 2Y0SB 4XIGS 2PZWA 3P7JA 1ILQA 1F2MA 2GA4B 4IUTA 2RKSA 5DNFA 3A7AB 1MI2A 1LV9A 5M5WB 2B2UA 3HOWB 3ERQA 4K2KA 3G6JB 5F2DA 3VYRA 1V8QA 3QWNA 2V4DA 2XWJB 1WTXA 2A68C 5D3DA 3DHQA 1ML0D 2H4OA 2J0TD 3J7YW 1O7YA 2JP1A 1TWAB 5KNBA 2XN9C 1HQRD 4BBSB 5IGBA 4WFN3 1MBYA 2WACA 1KNAA 1M4VA 3E5SA 3PIP3 3K5MA 1SE4A 3D6WA 5FO9B 1HHVA 2EDGA 2JEAI 2JXMB 4A3GB 1SAPA 3TP7A 2QEJC 1LLRD 1V1OA 1DOMA 1TIID 1NCVA 1FD7D 3NSWA 2WAQB 1B4OA 4QB4A 1HQMC 1LTSD 2L5TA 1KDAA 1OXVA 2B2VC 2RBMA 1F2LA 2EXZA 2XNAC 4K14A 3GTLB 1S5BD 2AWOA 1XXGA 3SK6A 3HGBA 1BR9A 2L9HA 3HOUB 3MXNA 2EJMA 4A3FB 3GTKB 3BG3A 3VA5A 3M4OB 1G2TA 4XXEA 1KTKA 1EU3A 1VMCA 3LNNA 1BBXC 5KEEA 4K8IA 1EYDA 3OMGA 2CW0D 2F0QA 1CQVA 4RFBA 1NAPA 3GD7A 1WTWA 1AZPA 1TT2A 1SJED 5JOBA 1SJHD 3HRZC 3Q23A 4B9XA 3EQLC 4HCEA 4K6DA 4TRDA 2K6AA 4LK1C 1BCPF 3P20A 5C5LA 1B1ZA 4F88A 3FPPA 2F4IA 5J39A 2F0TA 3RZDB 3GQBA 2M00A 4QIWB 2SDFA 1F9PA 4RKLA 1BCPC 3P1HA 5E3FA 1V43A 2MJ8A 4HEDA 1Y8OB 4H0LC 2QCPX 1SYDA 5IGGA 2L11A 1LTID 1KABA 4NP5A 2L12A 5C44B 1STAA 1IYVA 3NTKA 2PZTA 2PO4A 1Q12A 4TKOB 3WOFA 3L7ZC 5CORA 3S16B 3H94A 1FGBD 1TY2A 1CI3M 2BE5D 1KDCA 3Q22A 1TU2B 1B9NA 4H7BA 4A3IB 1GUOA 2HCCA 1JQYD 4KJOA 4BA2I 4KKSA 4B08A 3I3CA 4OHJA 1WTVA 1U4MA 1MD2D 2BA0A 3OWFA 4RGTA 3HOZB 4R8IA 1XTCD 3JAME 5EBDA 1STGA 5JVH3 4MN3A 1EY7A 1ZYRC 1IKLA 1PRTB 2SOBA 3S2DB 1EY4A 1ICWA 3AB9A 3NUCA 2QDBA 4IUPA 3TP5A 1CHPD 3M85A 1Q1BA 4CJ1B 3J80L 1RCVD 5IGCA 2ZXRA 2FMMA 4RHRA 3HOXB 3MA2B 4DN4M 4GZYC 1TR5A 1PFMA 2F0VA 4OGQC 1LO5D 2BA1A 2SNSA 2DY8A 3NQTA 3V96A 1MSGA 5D14A 4ODGA 1B50A 4F8MA 3T56B 5K5PA 3TP8A 5G3LD 3I90A 3H09A 1I6VC 5HURA 4HTHA 5IODA 2G9HD 2KVMA 5IT9L 2LS01 2ZT9C 5A2QE 2HDMA 4HSPA 3I91A 3DWQA 3T51B 4CJ2C 1NR2A 2F0MA 3EFXD 2R6GA 1J8IA 4FXGC 5C3EB 1QJOA 3A56A 1EWHA 2B8FA 1SNCA 5AFWA 3G7LA 2PZUA 3J81E 2XRQD 4C3JG 4EQPA 4EQNA 3NHHA 4C3IG 1QB5D 2F3WA 1LT4D 1CM9A 2G9DA 2K33A 1YNJD 2QKIC 4C1NK 1A6XA 2A6ED 4TSSA 4C3JB 1M8AA 1CZGA 2AQ2B 1ESFA 4C3IB 2K1BA 1O7ZA 1G291 1JWMD 1EIHA 3I4NB 1S5FD 1PTOF 5BN5A 2DNEA 3OWEB 3NPPA 3IKJA 2L55A 1TQOA 3U9OA 1IYUA 2QILA 2EJGC 4ULLA 1D5ZC 4NW2A 1F2ZA 1IKMA 2F0DA 4XQNA 1JR0D 1NUCA 1I4PA 1PTOC 1Y8NB 3A55A 1AN8A 3IFDA 1I3QB 3EJIA 4DGZA 4A3DB 4O42A 2AQ1B 3D8GA 3M7NA 5KIXA 2L1BA 2Z8LA 4QUCA 5FOBB 1KLUD 3U9SA 3A8JE 4K5XA 2H1EA 5C4XB 5JAVA 5A35A 2ID0A 3KLSX 1SYCA 2ZXPA 4HCSA 2EZVA 1XWEA 4XTCS 1PXUA 3KUPA 2BDNA 1II3A 4DAVA 1GUSA 5E1FA 4Q5VA 3IAYA 1D6EC 3L3OC 3QOLA 2R7ZB 1EOTA 5K36H 5KGUA 1SNOA 1T5EA 1XYIA 3MXPA 3LWUA 3TP6A 1U4RA 1CZWA 1ET6A 4EQOA 3SK5A 2XRSD 5KYLA 5C4JB 2YYZA 4G4KA 2AWNA 2ZXOA 4ZUIA 4LAAA 1I4RA 1EY8A 3T13A 2IX1A 1F2YA 3FDTA 1DD2A 2PYKA 2EPBA 4A3JB 1OXUA 1GJXA 1H9RA 5J22A 4KN7C 4ID6A 2MP1A 5EPLA 5CV5A 1RD9D 4RA8A 4ME5A 4V190 3BYYB 4KN4C 1DOKA 3V05A 3KK7A 3SK4A 2E75C 4C2MB 4G57A 3S2HB 5D3IB 2ENBA 4DXFA 1UUPA 3QIAA 3P75A 3DWPA 2E2IB 2PW5A 4RGOS 2F03A 1EL0A 4KMUC 5TSSA 2EOTA 2JYOA 4YIJA 4DNTB 4OO1I 1VMPA 3FEWX 3DXJC 5KRUA 1EIGA 1HFNA 2R61A 5KYIA 3BYTB 3DUZA 1B44D 5CGKA 2VB3X 4FF2A 3I72A 4FF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RAU C;  3MTS A;  2B2V A;  5EPK A;  1EIH A;  1IKL A;  2NZ1 D;  4U68 A;  4XT3 B;  1KNA A;  4ZAI A;  2KEC A;  1U4R A;  2IL8 A;  5JJZ A;  4X3U A;  5COY A;  4ZKC B;  1B53 A;  1PDQ A;  3D6W A;  2K28 A;  1F9S A;  1HHV A;  1ICW A;  4IUQ A;  1DZ1 A;  1NR4 A;  2M2L A;  2B2U C;  4XDX A;  5E4X A;  1PFB A;  4IUP A;  1WTO A;  1SAP A;  5EPJ A;  2K01 A;  4ZLT F;  5CBE E;  4CJ1 B;  2RVL A;  4XT1 B;  2FMM A;  1IL8 A;  1F9R A;  1U4P A;  3DM1 A;  3HP3 A;  2R3Z A;  2K04 A;  2RSO A;  2L4N A;  4DN4 M;  2D9U A;  4NW2 A;  4IUU A;  3FDT A;  1DOM A;  1X3P A;  1PFM A;  1RTN A;  4LMQ D;  2EPB A;  4HAE A;  4OIK A;  1WD1 A;  2VXW A;  1NCV A;  3QO2 A;  1IKM A;  1HFG A;  2SDF A;  4IUR A;  2B2W A;  3H91 A;  4RWS C;  3I8Z A;  1F9P A;  1B4O A;  2Q8R E;  2Q8T A;  1EQT A;  1HA6 A;  1BO0 A;  3R93 A;  1WTP A;  1DOL A;  2CVR A;  3FPU B;  2DY8 A;  2MJ8 A;  3ONA B;  4X3T A;  2KED A;  1MSG A;  2MP1 A;  5D14 A;  4HED A;  4X3S A;  5EPL A;  1B50 A;  3F2U A;  3IL8 A;  1HUM A;  1G6Z A;  2FIN B;  2KEE A;  1U4L A;  2B2V C;  3LWE A;  1BNZ A;  1ROD A;  2KUM A;  4RA8 A;  4QUF A;  4OIJ A;  1WTQ A;  1G91 A;  3TZD A;  2MGS A;  2FJ2 A;  4UAI A;  3I90 A;  5CMD A;  5T1G A;  1F2L A;  2B2W C;  2L11 A;  1ILP A;  3Q6S A;  2X6L A;  3IFD A;  1ZXT A;  2MPM A;  5D65 A;  1WTR A;  3SVM A;  2B2Y A;  1DOK A;  2RSN A;  3GV3 A;  1XX8 A;  2FFK B;  2KVM A;  1GUW A;  2L12 A;  1C8C A;  4O42 A;  2K05 A;  1B2T A;  1RHP A;  1RTO A;  4CJ0 B;  1QG7 A;  1SDF A;  2J7Z A;  3TN2 A;  1AP0 A;  2KOL A;  2L1B A;  2HDM A;  2NYZ D;  3DEO A;  3N52 A;  2DY7 A;  5EJW A;  1MSH A;  1KNE A;  3I91 A;  4QUC A;  1HUN A;  3P7J A;  1ILQ A;  1ESR A;  2L9H A;  5T1I A;  4ZKB B;  1CA5 A;  1E0B A;  4IUT A;  4CJ2 C;  2B2T A;  4X3K A;  2N55 A;  5COR A;  2B2Y C;  3DEP A;  1NR2 A;  1S4Z A;  5DNF A;  2RA4 A;  2H1E A;  1F9Q A;  3UI2 A;  1MI2 A;  1LV9 A;  5EQ0 A;  5CBA E;  1J8I A;  1QNK A;  2B2U A;  4ZK9 B;  2X6G A;  1TVX A;  2NWG A;  5AFW A;  5EKI A;  1DON A;  3G7L A;  1BF4 A;  1EL0 A;  1B3A A;  1G2T A;  2HDL A;  1RJT A;  4R9W A;  2EOT A;  2HCI A;  2JYO A;  4HCS A;  1X32 A;  1Q3L A;  1SSO A;  2FHT A;  4MHE A;  1VMP A;  1VMC A;  2HCC A;  2B2T C;  1WVL A;  3KUP A;  2BDN A;  1BBX C;  1EIG A;  1O80 A;  1G2S A;  2K03 A;  1HFN A;  1WD0 A;  2N88 A;  3I3C A;  1WTX A;  1WTV A;  1PFN A;  1U4M A;  1HRJ A;  3KBX A;  1MGS A;  1ML0 D;  1J9O A;  1CA6 A;  1CM9 A;  1NAP A;  3GV6 A;  1WTW A;  4IUV A;  4HSV A;  1AZQ A;  5E4W C;  1AZP A;  1JIC A;  2EE1 A;  1A15 A;  2HUG A;  1EOT A;  1QE6 A;  1M8A A;  1O7Y A;  1X3Q A;  2JP1 A;  2XIW A;  4R8I A;  2K1B A;  3MWY W;  1O7Z A;  1JE4 A;  1XYI A;  2X69 A;  1PLF A;  4MN3 A; 
#chains in the Genus database with same CATH topology
 5I2Y A;  1N33 L;  1WJJ A;  2NZ1 D;  4HMJ A;  4A93 B;  2I46 A;  4DAY A;  3CPF A;  3K5L A;  1PZK D;  3J81 i;  4XDX A;  1KRT A;  3PO3 B;  1AE3 A;  1LTB D;  2MO1 A;  3MC0 B;  5EPJ A;  2PPB C;  2IPK D;  4JI0 L;  1S5C D;  4PNY A;  1QUQ A;  3NEN A;  1CFM A;  3K5N A;  2NVY H;  1JOK A;  4FXD A;  1H95 A;  3IFT A;  3TRZ A;  4M1U B;  3FKI G;  1QWY A;  2C9O A;  2VXW A;  3FVQ A;  3E0J A;  4J6H A;  3NTI A;  1SN8 A;  1HA5 A;  2B2W A;  4UDU C;  3QG1 A;  3I8Z A;  1N34 L;  2Q8R E;  4A3K G;  5H1S E;  1GUT A;  1X54 A;  1EQQ A;  4DXG A;  1BQQ T;  4JI2 Q;  3FKI B;  2KEE A;  1E2W A;  1A2U A;  1ROD A;  3T1H L;  2E2J B;  3KDF B;  1G91 A;  2F0G A;  1EY0 A;  1DCZ A;  3BVG A;  3Q6S A;  1LT6 D;  1CKO A;  2DJG C;  1GM5 A;  4A3K B;  4Y7N H;  2IWH A;  3PUX A;  4EQ5 A;  3BDO A;  2ALY B;  4DR4 Q;  2E2H B;  2K52 A;  5JEA G;  4KK7 A;  1MSH A;  3J81 c;  1QVG A;  4J8Q A;  4JYA L;  3L9A X;  2B29 A;  3DEP A;  2OT2 A;  3H3V C;  3H6M A;  1SRO A;  5ELD A;  5M5W H;  1QNK A;  4KD4 A;  3HOW H;  1C0A A;  2B8G A;  1JCK B;  1B3A A;  4DV3 L;  3GTJ B;  1YNX A;  2NZO A;  4LJZ C;  4KHP Q;  1KDB A;  1EEF D;  1SYB A;  1NMG A;  1N36 Q;  2EVB A;  2BOS A;  3PO3 H;  3OW7 A;  1PFN A;  2J4X A;  1HRJ A;  4BY1 G;  1JWU D;  2IHF A;  3TQY A;  4DU9 A;  3KLW A;  4QY7 A;  4PMB A;  4DFA A;  1B3Q A;  4DR7 L;  4A3L G;  1B9M A;  1JJG A;  3MXU A;  2R7F A;  3MEH A;  1PRT D;  1X3Q A;  4HN7 A;  2UXB Q;  1JE4 A;  4LFB L;  1OXT A;  1BCP B;  4BY1 B;  4V0B A;  1I50 B;  4O2D A;  2A5H A;  1JOQ A;  4UP8 A;  4L5S A;  2UXC L;  3K58 A;  1IHZ A;  2P5Z X;  3RD4 A;  1P16 A;  1I94 Q;  1HR0 L;  1EU4 A;  2HQE A;  4UHV A;  2ES2 A;  1IBK Q;  4JI3 Q;  4KY7 A;  4DV7 L;  3VR5 A;  3VYT A;  1S5D D;  4ZLT F;  3I73 A;  4LF6 Q;  2A69 C;  2RVL A;  4XT1 B;  4RGN A;  5IGE A;  2PMZ B;  3D31 A;  3HP3 A;  1HNZ L;  1PYB A;  1HPC A;  3M9B A;  2K5D A;  4DV0 L;  1WD1 A;  4OIK A;  1BVS A;  3K8A A;  2RF4 A;  3RZO B;  2FMC A;  3W1G A;  2E2H H;  1CSQ A;  1D1K A;  3QJY A;  2YTX A;  1VQ7 A;  2XWB B;  3K81 C;  1XMO L;  5JPM C;  3SE0 A;  1W2B A;  2B39 A;  1VQJ A;  5JEA J;  4JBJ A;  1UE6 A;  3W3A A;  3KYH C;  4QUF A;  4K6L A;  1TWC B;  2E74 C;  4UAI A;  5C5M A;  5IYC H;  3H0G G;  1ENA A;  4KKU A;  3FMC A;  3GTJ H;  2MQH A;  1HNX Q;  1ZXT A;  3E6Z X;  2R92 G;  4K0K L;  2WB1 E;  1EFI D;  4HMI A;  1GUW A;  3SHL A;  2QDL A;  3I4O A;  3FP9 A;  4K5W A;  1YNN C;  3M4Q A;  2J7Z A;  4QMG A;  4F87 A;  1Q90 A;  3DEO A;  1LAC A;  4WRD A;  3H0G B;  1NTG A;  4XQQ A;  2DJF C;  3T4A C;  4XYQ A;  4DR6 Q;  1D7Q A;  4A76 A;  2R92 B;  3NBH B;  1GD7 A;  2NB0 A;  3ICE A;  1PMR A;  2IT1 A;  5CBA E;  4APV A;  4A3F H;  3GTK H;  2X6G A;  3T1Y L;  2Z6K C;  5FO7 B;  3VR3 A;  3M4O H;  2HDL A;  4ZQ3 A;  5JVG 3;  1KLG D;  1X32 A;  1PH2 A;  1SMY C;  2KQ3 A;  2WAQ E;  1TS4 A;  2FHT A;  4O1N A;  1RDP D;  2F4V L;  3CC2 A;  1WVL A;  1V1P B;  2I07 B;  2EYF A;  1VQK A;  1X9N A;  1EWI A;  1DGS A;  1ZKO A;  1LTT D;  3GV6 A;  3PQI A;  4X62 L;  2F0E A;  1AZQ A;  1JIC A;  2PQA B;  2ATW A;  2TSS A;  1A15 A;  4JOI A;  2ZJQ A;  3PUY A;  4HJ5 A;  4PV1 C;  1NSN S;  4YY3 L;  2B2V A;  5C0X G;  3Q0A A;  2F0J A;  2IHE A;  3CCM A;  2PNH A;  5IIF A;  3S1M B;  3SGI A;  2F0I A;  1MHW C;  4RGM A;  5E4X A;  5KNC A;  5IP7 G;  1K28 A;  2FXQ A;  4P74 A;  2AMC B;  2ZTC A;  4B3M L;  3V2T A;  4Y52 H;  5FKA C;  3RLO A;  2PW7 A;  2RSO A;  2L4N A;  1BBW A;  5KND A;  4TQU S;  4O0A A;  4B3S L;  3A5U A;  1EQV A;  4KTA A;  2PI2 A;  1V9P A;  3DMU A;  2JA5 G;  4JBK A;  1VQI A;  3S1Q B;  3ITP A;  2H5X A;  4N8F A;  2KHS A;  1SE8 A;  1SFO B;  1KRS A;  3F2U A;  2KJX A;  3A7L A;  1ET9 A;  2JA9 A;  4C1N I;  4U67 3;  2UUB Q;  2JA5 B;  1X55 A;  2N8N A;  5CV4 A;  3CHB D;  3CAM A;  2B2Y A;  4B9W A;  3TRE A;  1VQ9 A;  3OSO A;  4YWK A;  1SEB D;  5C44 H;  3GTQ B;  3R3O A;  2K5V A;  1B2T A;  1QVF A;  4CJ0 B;  4P72 A;  1R4P B;  5GAE C;  3M4P A;  2GVA A;  1JOR A;  1HUN A;  3CCV A;  2SEB D;  5T1I A;  1QIL A;  1CA5 A;  4KY6 A;  2R93 G;  1SRU A;  2B2T A;  4DK6 C;  2N55 A;  5AJ3 L;  3CW2 C;  1S4Z A;  2RA4 A;  3S16 H;  3K7A B;  1DM0 B;  4ME3 A;  4JI4 L;  5CV7 A;  1BF4 A;  4DUY L;  1JWS D;  4LUV A;  2A6H D;  4MTK A;  2R93 B;  3ZJY C;  1E3P A;  1VQ8 A;  1G2S A;  4FNF A;  5ELO A;  2L15 A;  2N88 A;  1IYJ B;  5C0X J;  2JSO A;  1IW7 D;  5JJK A;  1PH9 A;  1J9O A;  1CA6 A;  3D0F A;  5E4W C;  2YU9 B;  2VQF Q;  3MFG A;  1WCM G;  3EIV A;  2CH4 A;  3KF8 B;  4G7H C;  5DM6 3;  3HS0 C;  1CK1 A;  1PTO B;  3J80 E;  4IFD I;  1YHB A;  3S2D H;  1TWF B;  4ZKC B;  4RHS A;  2V1C C;  1DYQ A;  1PFS A;  2K28 A;  5FK9 C;  3T16 A;  1WCM B;  4AIM A;  1PFB A;  1HZA A;  3HKS A;  2K01 A;  4DR5 L;  3QOJ A;  1YI2 A;  2JA5 H;  1F9R A;  3NWT A;  3HOX H;  1A3V A;  4RH6 A;  4P75 A;  4JI1 Q;  1RTN A;  2WIN B;  5LMN L;  1PYW D;  2CW0 C;  3HOV G;  4J15 A;  5C6A A;  2E5L Q;  1CT1 D;  3J7Z C;  1HA6 A;  3SK8 A;  3U4Z A;  5C0X I;  1BO0 A;  5C3W A;  5ISR A;  2K5W A;  2CVR A;  4AQY L;  5IT9 E;  1PH5 A;  2A68 D;  2HHH Q;  3K7A H;  4RCN A;  3QR8 A;  3R2I A;  2HIX A;  4N9P A;  3HOV B;  3CU7 A;  1LT3 D;  2F0L A;  2MPM A;  1XPR A;  3SVM A;  2WP8 J;  2O2L D;  4DR1 Q;  3GV3 A;  4LUO A;  2XVS A;  3CCL A;  1UEB A;  4WOR A;  1RHP A;  5LL6 S;  1PH3 A;  3TN2 A;  1OO9 B;  3NBH A;  1BXT A;  1KNE A;  3AU7 A;  3DWA A;  1VDZ A;  1O7I A;  4PMC A;  1L2F A;  2YU9 H;  1TXY A;  5M5X B;  1KAW A;  4IAL A;  3UI2 A;  3HKZ G;  5C3E H;  4OO1 G;  2NWG A;  1IBL Q;  4BWG B;  2JA7 G;  4AH6 A;  2HCI A;  4FP5 D;  2F0K A;  1Q3L A;  5BR8 L;  2VUM G;  1SSO A;  2Z6B A;  1QNU A;  1TWF H;  2R7D A;  4DNR B;  1D5M C;  3HKZ B;  4N9T A;  5CC4 A;  2ICE C;  1GVP A;  2PQA A;  4IPD A;  3J7A F;  3ND9 A;  4LF7 Q;  1H9S B;  2BDO A;  2NN6 G;  4IUV A;  3R8B A;  2JA7 B;  1Q8I A;  3MFY A;  2GN5 A;  2HUG A;  4ABN A;  1IBM L;  4C3J H;  4NKL A;  5CV6 A;  2O5J C;  4C3I H;  3UDG A;  4P2C B;  1YZ6 A;  5CV8 A;  4I7Z C;  3I4N H;  4NXM L;  4ZAI A;  5EGT A;  2MHV A;  4JC0 A;  2IL8 A;  2F0S A;  3BZK A;  5I9O A;  4WJW A;  3CCQ A;  1ICF B;  2E2D C;  1K8O A;  1PDQ A;  1VQL A;  3STB D;  2B2U C;  4QF4 A;  4MIU A;  3NXW A;  4ZRZ A;  1N33 Q;  2PNR C;  1OXS C;  2XSC A;  1EEI D;  5NUC A;  1ASZ A;  1EY6 A;  2BE5 C;  1C4Q A;  2RCN A;  3CC4 A;  2WII B;  2RDH A;  1E1T A;  2ICI A;  3C3L A;  3MAQ A;  4IUU A;  1EYC A;  2F0W A;  4DAP A;  4GOP C;  1L1O A;  4M8A A;  1EZ8 A;  4JK1 C;  4C3H G;  5FJ8 G;  1Q82 C;  4JI0 Q;  2KCN A;  4YCW A;  1FNV A;  2JN4 A;  1H9K A;  3HFZ B;  1O78 A;  2NVT B;  1BBU A;  1WTP A;  3I70 A;  5LMN W;  3K80 C;  3IL8 A;  1U4L A;  4QGU A;  1Z47 A;  1EIY B;  1UNS A;  5FLX L;  4C3H B;  3URY A;  5CMD A;  5T1G A;  1N34 Q;  3PF5 A;  3GTG B;  4ALP A;  1SNQ A;  2B2W C;  3HEJ A;  2HT1 A;  1ILP A;  4BY7 G;  3N6R A;  3J81 j;  1I3Q H;  1GHK A;  4A3D H;  2RSN A;  1L0W A;  1I6H B;  3X3N A;  1EQR A;  3JAM i;  3T1H Q;  3PV0 A;  3CRK C;  1X56 A;  2OEO A;  3I56 A;  3RNU A;  3OIP A;  4OO1 H;  1VQ4 A;  5G3L F;  2EYP A;  5EKL A;  3C1F A;  4HR7 B;  1EY5 A;  4BY7 B;  1JJC B;  1CKM A;  4FF3 A;  5C4X H;  3BDC A;  1BOS A;  4A3B G;  1XMQ L;  5I6Y A;  1AW7 A;  1K83 B;  4UPA A;  3T53 B;  4J1M A;  1SYE A;  4G7Z C;  3TME A;  4CKC A;  3A8K E;  2NBF A;  3RN2 A;  5FO8 B;  3D3R A;  2EY1 A;  3SDZ A;  4YHH L;  4A3B B;  2EQS A;  3SXH A;  4DV3 Q;  1I4Q A;  1YIT A;  1BCP D;  4CKE A;  1AEX A;  3KF8 A;  2XIW A;  2EY5 A;  3S9W A;  3CCE A;  1NE3 A;  2ZTE A;  4OEM B;  3UDI A;  2X69 A;  3MTS A;  2LXK A;  4U68 A;  4DR7 Q;  2Q2T A;  1TWH B;  1GXD C;  1CKN A;  3JAM c;  2Q2I A;  2ZM6 Q;  4GNX B;  3H15 A;  4QCL A;  3KOJ A;  4BA1 I;  5C4J H;  3ND8 A;  1C7Y A;  1G8Z D;  2HIV A;  3M3Y B;  1ENC A;  1CSP A;  3W2D A;  4L5T A;  1HZB A;  5FJ8 H;  2UXC Q;  3KJP A;  2NVX B;  4KD3 A;  3OYY A;  2K04 A;  1HR0 Q;  3PCO B;  4X65 L;  2NN6 I;  2OWO A;  4IUN A;  1HXY D;  4LMQ D;  4OL7 A;  4DV7 Q;  5IP9 G;  2K75 A;  3F2C A;  4A3J H;  1U9R A;  2K4K A;  4KY5 A;  1JT8 A;  3PMF A;  3O13 A;  1PZJ D;  5C4Z A;  1STN A;  3H91 A;  1VQF A;  2LY7 A;  2NTT A;  2Q8T A;  4DKA C;  2RDF A;  1K8G A;  1HNZ Q;  3S14 B;  1YNJ C;  2L0C A;  3J80 i;  1B8A A;  2A6E C;  4P73 A;  3FPU B;  1TY0 A;  1X3G A;  3KF6 B;  3PIO 3;  2ZJP A;  1HUM A;  2F0O A;  1BNZ A;  1PZI D;  1RKN A;  1Z6H A;  2EYL A;  4Q0F A;  1EFW A;  3F8T A;  4X66 Q;  1VQM A;  4KKT A;  5EBC A;  1XMO Q;  4RG1 A;  5D65 A;  1KAA A;  2F1M A;  2IX0 A;  1A3U A;  4EVO A;  2K5Q A;  4C2M H;  4S3S A;  1ZYR D;  3ZYY X;  4BBS G;  2CFM A;  2KHI A;  2NYZ D;  3S2H H;  5EJW A;  1SND A;  1JB7 A;  2NTS A;  3GTO B;  3CD6 A;  3X3M A;  1E0B A;  1E2V A;  4X64 Q;  1NJI C;  4K0K Q;  2WB1 G;  4K8J A;  3L2P A;  3ERO A;  1SYG A;  4R4T A;  5EQ0 A;  4KHZ A;  4ZUJ A;  2E2I H;  3VYS A;  2K5H A;  4A3G G;  4E6I A;  4ILW A;  1DON A;  1FJG L;  1X3F A;  1JJ2 A;  3MXG A;  1RJT A;  1VQH A;  5ELB A;  2CWP A;  1KC8 C;  1SXT A;  2CQA A;  1TWH H;  2I5H A;  4XQJ A;  2QF7 A;  2WB1 B;  3CKI B;  1XPU A;  1SBB B;  1EOV A;  1H9S A;  4G7O C;  3T1Y Q;  3M3Y H;  2K32 A;  2Z4H A;  3J80 c;  1ZEQ X;  3LX0 A;  1WTH A;  3OHX C;  4HSV A;  3F2B A;  4A3M G;  1PH6 A;  2JA6 G;  4AYB E;  3Q24 A;  2F4V Q;  2F0N A;  4JI7 L;  2NVX H;  1QE6 A;  5J1Z A;  2JEB I;  3MWY W;  1VQA A;  1Y1V G;  1L0X B;  3CQZ B;  3M4Y A;  4A93 H;  1S5E D;  2F0F A;  3I4M G;  1EYA A;  4A3M B;  2HD3 A;  2JA6 B;  3S15 B;  3S14 H;  1FGU A;  3D6C A;  4OX9 L;  3VR4 A;  1GO3 E;  1Y1V B;  4YY3 Q;  2PCF B;  2OTL A;  3HOY G;  3EA6 A;  4CKB A;  3I4M B;  4CBV A;  1JE5 A;  4RMF A;  3K0X A;  3GO5 A;  2JA8 G;  4LFA L;  4GN3 B;  3OIQ A;  5IT9 c;  2D9U A;  1XPO A;  3U4V A;  3MZ5 A;  4HAE A;  3HOY B;  4B3M Q;  3SEB A;  2Y0S E;  1TS3 A;  4A3E G;  5E7N A;  4WJ4 A;  2JA8 B;  1NY4 A;  3EBE A;  2WKC A;  3FKI H;  1UAP A;  4PZ8 A;  2F0U A;  2E2J H;  3PO2 G;  4FYD A;  4L63 B;  3PUV A;  3TDQ A;  4A3E B;  3W1B A;  2X6L A;  4K2L A;  4FDB A;  5IWA L;  4A3K H;  3H3V I;  2XTI A;  1STH A;  1WTR A;  1YHA A;  3NQI A;  3K59 A;  5DM7 3;  1AP0 A;  1I4H A;  3PUW A;  3VA7 A;  3I55 A;  3PO2 B;  2DY7 A;  3G48 A;  1ESR A;  3NEL A;  5HGQ A;  2B2Y C;  4JI5 L;  5CYU A;  2VNU D;  4LF5 L;  4PZ7 A;  3TS2 A;  5JEA H;  1TS5 A;  4JPB W;  3SR1 A;  1A0I A;  3NK9 A;  4JBW A;  5AJ3 Q;  2B2T C;  3EVQ A;  2PI2 E;  2EJF C;  3AQQ A;  5JPN C;  4B3R L;  5IGD A;  1WD0 A;  2UXD L;  2TMP A;  4JI4 Q;  3RLF A;  2MUY A;  4L6T B;  2RHS B;  5EKK A;  4DUY Q;  3TZU A;  5BN3 A;  1SNP A;  2KA7 A;  1PTO D;  1VF7 A;  1Y69 U;  1K73 C;  4YCV A;  5GAH C;  3U58 A;  2WFW A;  4IFD G;  2KBN A;  5IYB G;  3MHB A;  1FVI A;  4DV6 L;  4BY1 H;  3VR6 A;  5EPK A;  1I50 H;  3D4R A;  3C2P A;  2I5L X;  1EUJ A;  2GVB A;  3GP7 A;  4XT3 B;  4GNX A;  3PIO A;  4A3L H;  4PG3 A;  4RCO A;  3KJO A;  2Q2H A;  4CDC C;  1B53 A;  3K57 A;  3HZX A;  5LMU L;  4NMZ A;  1LUZ A;  2LKV A;  3OMC A;  3JAM L;  2JA8 H;  1VQD A;  3C46 A;  3G4S A;  1DZ1 A;  1TS2 A;  2M2L A;  3C1E A;  5CV9 A;  3K5O A;  3VYU A;  2JE6 I;  4IJH A;  5ELF A;  5M9O A;  1UWV A;  1G6P A;  4DK1 A;  1J5E L;  2A73 B;  5I4D A;  3DM1 A;  2Q8I B;  3BS1 A;  1YJ9 A;  4KLK A;  3RZO H;  1EZ6 A;  4DF7 A;  4DR5 Q;  2LSS A;  2KCC A;  3A0J A;  1EQT A;  4A3I G;  2AUK A;  1LTA D;  3R93 A;  1WTO A;  4A75 A;  2MO0 A;  2D62 A;  4KHP L;  1G6Z A;  1A2T A;  2IX3 A;  1Z7T A;  1W3S A;  2UUC L;  3CXC A;  2Q2U A;  1Q46 A;  4OIJ A;  1TWC H;  2FJ2 A;  4H13 C;  4DV4 L;  1E22 A;  2RDG A;  4AQY Q;  5C4H A;  1VQP A;  1FNU A;  1VCI A;  1XX8 A;  5LHY 1;  5CR3 A;  1VF5 C;  2OXP A;  1RTO A;  2D2C C;  1SDF A;  1S3O A;  3IRB A;  4YWL A;  4HID A;  3H0G H;  5GRO A;  4ZYS A;  4OXP A;  2R92 H;  3KDF A;  2RHQ B;  2UU9 Q;  2PMZ E;  1GUG A;  5IE8 A;  1E7Z A;  4BBR G;  3NWS A;  1GKH A;  3BVZ A;  1W6K A;  5A2Q L;  1LT5 D;  1XJV A;  1SMX A;  1KIX A;  4R4I A;  5DAU A;  1JB3 A;  1HNW L;  4LF6 L;  4IFD J;  2EYH A;  1KQS A;  3S1N B;  2OF1 A;  1A63 A;  4LNQ A;  1DJR D;  1F77 A;  2F3I A;  4Z9C B;  4BBR B;  4IFD H;  5IYB H;  3LGJ A;  2N78 A;  5I6W A;  2E8G A;  2AQ3 B;  3BVM A;  5BR8 Q;  3J81 L;  1QCB D;  5IOC A;  3PF4 A;  2CHB D;  1ONL A;  1A3T A;  4R4C A;  2IY5 B;  1AH9 A;  4JI6 L;  3OOC A;  1NBW A;  1B70 B;  2VB2 X;  4PQX A;  1D1I A;  2AUJ D;  1BUV T;  4QIW E;  4LWC A;  4DAM A;  1SE2 A;  2A74 C;  1STY A;  4B3T L;  1IBM Q;  4X3U A;  3S1M H;  1Z9F A;  3GTP B;  4QQB X;  3BDL A;  1PRT F;  5M3M G;  4IUQ A;  4PZ6 A;  4NXM Q;  5C0X H;  4K5V A;  1K3B C;  2WV6 D;  2VS1 A;  3S1R B;  2R3Z A;  5BN4 A;  1Y8P B;  2EYO A;  1C48 A;  1HH2 P;  1Y1W G;  1QOH A;  5M3M B;  1GUN A;  1X3P A;  1BDO A;  5IP7 H;  3BZD B;  1D2B A;  1HFG A;  3S1Q H;  4EGV A;  1OTC A;  3A54 A;  2OTJ A;  4IUR A;  5ELE A;  3WOE A;  3QB3 A;  3U50 C;  5EAY A;  1PRT C;  2NUC A;  1SFO H;  3ONA B;  1Y1W B;  3JC6 6;  1UE5 A;  1S40 A;  3J7A 5;  5I9P A;  1L1O C;  2KUM A;  3I2Z A;  2KCM A;  3ULL A;  2VY3 A;  1TWG B;  3FRP B;  3CCJ A;  2LXJ A;  1M1K C;  1IL2 A;  3S1N H;  3PGZ A;  1C8C A;  3GTQ H;  1HTL D;  1Q1E A;  4CGY B;  1LAB A;  4JV5 L;  2UUA L;  4NB3 A;  2ZTD A;  4DR2 L;  5M5Y B;  2M9V A;  3CF5 A;  2BCO A;  1VQB A;  1F9Q A;  1PHJ A;  5ELC A;  4C56 C;  3NBI A;  1KHI A;  1I4G A;  4ZK9 B;  1W6J A;  4JCV E;  3GTM B;  3TSS A;  4NDX A;  4R9W A;  1IXR A;  1X6O A;  3WDN A;  2EY6 A;  2PQE A;  2Z9H A;  4LFC L;  4JI8 L;  3KLS A;  2R93 H;  5K36 G;  1RL2 A;  2XGT A;  3GTP H;  4A3C G;  2K03 A;  1ENF A;  4DAY B;  1XNR L;  3KBX A;  1XMQ Q;  1HTP A;  1V1Q A;  4F7X A;  2ZJR A;  4KI0 A;  4GOP B;  4KHV A;  3UDX A;  1D5X C;  3KFU A;  5FLM G;  3L0O A;  4BXX G;  1TKW B;  2OQ0 A;  1K8M A;  5HGT A;  3KBG A;  5IGF A;  1GHJ A;  4YHH Q;  4RAU C;  1V1P A;  1SE3 A;  4DK0 A;  1PTO H;  3OW2 A;  1AE2 A;  4LF9 L;  5COY A;  2O4X A;  1YEZ A;  2EYJ A;  1N32 L;  1F9S A;  1G51 A;  1WCM H;  4IQZ A;  1NR4 A;  4IPH A;  2B63 G;  3CCR A;  4DA2 A;  2RQX A;  2EYM A;  4PMW A;  4DNI A;  2O5I C;  2WKD A;  1EWC A;  1SYF A;  5M3F G;  2VUM B;  4H44 C;  4XYO A;  1OXX K;  4OWT B;  2Z1C A;  3KLR A;  3RR5 A;  2CWA A;  2VW9 A;  5GAD C;  2B63 B;  2QGQ A;  5LL6 X;  4LF4 L;  1UE7 A;  1CQF A;  3UE0 A;  1PH1 A;  1HZC A;  4DUZ L;  5M3F B;  5M5Y H;  1H9M A;  3M7G A;  1DOL A;  1I4X A;  2KED A;  3PUZ A;  2NVQ B;  4FVM A;  2K14 A;  1UEA B;  5GQO A;  4DV2 L;  1WTQ A;  4R4Q A;  2K7V A;  1L0Y B;  3TZD A;  3GTM H;  3I4L A;  4HIK A;  3HOV H;  2AKW B;  5HY6 A;  3GDE A;  2HQL A;  4OWX B;  1R4Q B;  2FFK B;  2DNC A;  4FXK C;  2VZA A;  1HCZ A;  2F3V A;  4L8J A;  2DN8 A;  3N52 A;  1SNM A;  1VQ5 A;  1EYG A;  2F0P A;  3D4W A;  2IW3 A;  4CHT B;  4X3K A;  4ZKB B;  1R9T B;  5M5X H;  3S17 B;  1JC7 A;  3RUZ A;  4RKB A;  1T5X D;  1TVX A;  5EKI A;  3K0Y A;  3NEM A;  2A69 D;  3MXN B;  1E2Z A;  4MHE A;  4R8N A;  3NTH A;  3OPO A;  2F0H A;  1I5F A;  1O80 A;  1S72 A;  3AMU A;  1DXM A;  3NP8 A;  1CHQ D;  3R2T A;  1X3E A;  1FJG Q;  4GKK L;  1MGS A;  1FR3 A;  4NXN L;  1RF2 D;  4IZ8 A;  2JA7 H;  4FO2 A;  2EE1 A;  3CME A;  2VUM H;  3TBI B;  2LFN A;  2IJ0 A;  2K50 A;  1YHQ A;  1STE A;  1PLF A;  2B63 H;  4JW0 A;  3J7A V;  5I2X A;  2EY2 A;  2KEC A;  4JYA Q;  2NN6 H;  3AYH B;  1PH8 A;  4AYB G;  5JJZ A;  4JI7 Q;  3MVV A;  1FL0 A;  1K0R A;  3NE5 B;  2VL6 A;  2LMC B;  2OQK A;  4IN3 A;  3DLL A;  1FNW A;  1YNN D;  2OCE A;  3HG9 A;  4KV6 A;  2NVQ H;  1LTR D;  2CCZ A;  3FHW A;  3CRL C;  5CBE E;  4FF1 A;  1IL8 A;  4AYB B;  1U4P A;  2E76 C;  1UE1 A;  3CMA A;  1CTM A;  2A6H C;  2NVY B;  3VR2 A;  4OX9 Q;  3BU2 A;  1LTG D;  3A8I E;  3D4D A;  5C3X A;  1O7L A;  1IW7 C;  1H9J A;  1FYC A;  1N9W A;  2SNM A;  3QO2 A;  5FLX E;  4I65 A;  4MZ9 A;  4EX5 A;  3K6O A;  4RWS C;  1SMY D;  1JOO A;  2BH8 A;  1YBY A;  2D5D A;  4KJN A;  3OTO L;  4LFA Q;  2NVT H;  2Z4I A;  1EY9 A;  4LFB Q;  4X3T A;  4X3S A;  4JBM A;  1GOZ A;  3RMH A;  2FIN B;  3LWE A;  4BS9 A;  4C3H H;  1AFP A;  2Y0S G;  2MGS A;  3GTG H;  5DEH A;  1STB A;  1WOC A;  1VQO A;  4Y7N B;  1I6H H;  2K05 A;  3HOW G;  1QG7 A;  2C5C A;  4LF8 L;  2KOL A;  2DUD A;  2Y0S B;  4XIG S;  3UDF A;  2PZW A;  3P7J A;  1ILQ A;  1F2M A;  5IWA Q;  2GA4 B;  4BY7 H;  4IUT A;  2RKS A;  4I7A A;  5GAG C;  1XNQ L;  5DNF A;  4DV0 Q;  3A7A B;  4DV1 L;  1SR3 A;  1MI2 A;  1LV9 A;  5M5W B;  3G6E A;  1MIU A;  2B2U A;  3HOW B;  2F52 A;  1VQ6 A;  2EXD A;  3ERQ A;  4K2K A;  1SLJ A;  3G6J B;  4UY8 C;  1K83 H;  5F2D A;  3VYR A;  1V8Q A;  3CC7 A;  2D0O A;  4JI5 Q;  3QWN A;  4LF5 Q;  2V4D A;  2XWJ B;  1WTX A;  4GKJ L;  4GOP A;  2A68 C;  4A3B H;  5D3D A;  3DHQ A;  1ML0 D;  1YJN A;  1EIF A;  2H4O A;  4GLX A;  2J0T D;  1K3R A;  3TS0 A;  3J7Y W;  4B3R Q;  1O7Y A;  2JP1 A;  5DLQ E;  1TWA B;  5KNB A;  2XN9 C;  2UXD Q;  1HQR D;  4BBS B;  5IGB A;  4WFN 3;  1MBY A;  1LYL A;  1VQN A;  2WAC A;  1KNA A;  1M4V A;  3E5S A;  3PIP 3;  3K5M A;  3B6Y A;  1SE4 A;  3D6W A;  5FO9 B;  1HHV A;  2EDG A;  2JEA I;  2JK8 A;  1ASY A;  4DV5 L;  4DV6 Q;  4IOA A;  2JXM B;  4A3G B;  4GLA C;  1SAP A;  2NZH A;  3TP7 A;  4GNX C;  2QEJ C;  2WAQ G;  1WYD A;  1LLR D;  5LMU Q;  1YJW A;  1V1O A;  1DOM A;  4WJ3 M;  1TII D;  4X62 Q;  1NCV A;  3A74 A;  1FD7 D;  3NSW A;  1J5E Q;  3H3V H;  1WI5 A;  5IYC G;  2DGY A;  2WAQ B;  1B4O A;  4QB4 A;  1HQM C;  1LTS D;  4JOI C;  2CKZ B;  2L5T A;  3G71 A;  1KDA A;  5IP9 H;  1OXV A;  2B2V C;  2RBM A;  1BKB A;  4H02 A;  1F2L A;  3HOU G;  2EXZ A;  2XNA C;  4K14 A;  2D0P A;  3GTL B;  1S5B D;  2AWO A;  3STB C;  1XXG A;  2KHJ A;  4A3F G;  3SK6 A;  2UUC Q;  3A5Z B;  3HGB A;  4N8X 1;  1BR9 A;  4DV4 Q;  3GTO H;  2L9H A;  3HOU B;  4POF A;  4B3S Q;  1TWA H;  3MXN A;  2ZM6 L;  2EJM A;  4A3F B;  3GTK B;  4BBS H;  3BG3 A;  3VA5 A;  3BZC A;  4L5Q A;  3VDY A;  3M4O B;  1G2T A;  4XXE A;  1KTK A;  3LNN A;  1EU3 A;  1VMC A;  4JG2 A;  3E0E A;  1BBX C;  5KEE A;  4K8I A;  2VQE L;  1K8A C;  4DR3 L;  4QJF A;  1EYD A;  5ELN A;  3OMG A;  2CW0 D;  2F0Q A;  3AFQ A;  4A3G H;  1YIJ A;  1CQV A;  4RFB A;  1NAP A;  3GD7 A;  1WTW A;  1HNW Q;  1AZP A;  1TT2 A;  1SJE D;  5JOB A;  1SJH D;  3HRZ C;  3AEV A;  3Q23 A;  4B9X A;  3EQL C;  1VQC A;  1KXL A;  4HCE A;  3CQZ H;  4K6D A;  1PA6 A;  4TRD A;  4A3M H;  2JA6 H;  2K6A A;  4LK1 C;  1BCP F;  3P20 A;  3S15 H;  4X66 L;  5C5L A;  1B1Z A;  4JI6 Q;  4F88 A;  1N8R C;  1A62 A;  1Y1V H;  3FPP A;  3I4M H;  4B3T Q;  2F4I A;  5J39 A;  4IO9 A;  2F0T A;  4X64 L;  1A8V A;  1IZ6 A;  2C35 B;  3RZD B;  4A4I A;  3GQB A;  4JI2 L;  3GTL H;  2M00 A;  3HOY H;  4QIW B;  2SDF A;  4X6A H;  1Q86 C;  1F9P A;  4RKL A;  1BCP C;  3P1H A;  5E3F A;  3HOU H;  1V43 A;  2MJ8 A;  1E24 A;  5C44 G;  4HED A;  1Y8O B;  4H0L C;  4HIO A;  2QCP X;  4DR4 L;  1SYD A;  1PH7 A;  5IGG A;  4A3E H;  2L11 A;  1LTI D;  1KAB A;  4NP5 A;  2L12 A;  5C44 B;  1STA A;  1IYV A;  3NTK A;  2PZT A;  2PO4 A;  3PO2 H;  4UP7 A;  1Q12 A;  3KF6 A;  4TKO B;  3WOF A;  4DK3 C;  3RN5 A;  3L7Z C;  5COR A;  5LMN Q;  3S16 B;  3PIP A;  1N36 L;  3H94 A;  1FGB D;  1TY2 A;  4JV5 Q;  2UUA Q;  1CI3 M;  4DR2 Q;  2BE5 D;  1KDC A;  2G5D A;  4OON A;  5IYD G;  2K5N A;  4CDE C;  3Q22 A;  1TU2 B;  1B9N A;  4H7B A;  4A3I B;  1GUO A;  3HOZ G;  2A19 A;  2HCC A;  1JQY D;  4KJO A;  4BA2 I;  3CCU A;  4KKS A;  4B08 A;  3I3C A;  3E3X A;  2UXB L;  4OHJ A;  1WTV A;  1U4M A;  3CP0 A;  1NNX A;  3ER0 A;  1MD2 D;  3F1Z A;  2MFI A;  2BA0 A;  3OWF A;  4LFC Q;  4JI8 Q;  4RGT A;  4DPG A;  3HOZ B;  4R8I A;  1LTL A;  1HR0 W;  1XTC D;  3JAM E;  1QZG A;  5EBD A;  1I94 L;  1PVO A;  1XNR Q;  1STG A;  5JVH 3;  4MN3 A;  3RZD H;  1EY7 A;  1IBK L;  1ZYR C;  1LM0 A;  3DM3 A;  4JI3 L;  4CDD C;  1IKL A;  1PRT B;  2SOB A;  3E9H A;  3S2D B;  5J3B A;  1L1O B;  3HOX G;  1J6Q A;  1EY4 A;  5IY0 A;  1ICW A;  3AB9 A;  3NUC A;  2QDB A;  1XTD A;  3PSI A;  3WWV A;  5JJL A;  2N49 A;  4IUP A;  3TP5 A;  5FLX c;  1U5K A;  1CHP D;  3M85 A;  1Q1B A;  4CJ1 B;  3J80 L;  4LF9 Q;  1RCV D;  3ULJ A;  2ZXR A;  5IGC A;  2FMM A;  1N32 Q;  4RHR A;  3HOX B;  3MA2 B;  2MNA A;  4DN4 M;  4GZY C;  1K0S A;  1TR5 A;  1PFM A;  3ERS X;  2F0V A;  4OGQ C;  1LO5 D;  4P71 A;  1HNX L;  2BA1 A;  1E1O A;  2DY8 A;  2SNS A;  3NQT A;  3V96 A;  1MSG A;  5D14 A;  4ODG A;  1B50 A;  4F8M A;  4LF4 Q;  3T56 B;  1M90 C;  1C9O A;  5K5P A;  1KL9 A;  3TP8 A;  4DUZ Q;  5G3L D;  3I90 A;  2CH4 W;  1I6V C;  3H09 A;  5HUR A;  1Q7Y C;  4DR6 L;  4HTH A;  4POG A;  4A3I H;  5IOD A;  2JJQ A;  2G9H D;  4UP9 A;  2KVM A;  5IT9 L;  4L5R C;  2LS0 1;  1Y14 B;  2ZT9 C;  5C3E G;  2A1A A;  4DV2 Q;  4CDF C;  5A2Q E;  2HDM A;  2Z6K A;  4HSP A;  3I91 A;  3DWQ A;  3T51 B;  5IYD H;  4CJ2 C;  3HOZ H;  2YV5 A;  1NR2 A;  2F0M A;  2BH2 A;  3EFX D;  2R6G A;  1J8I A;  4FXG C;  5C3E B;  1QJO A;  4YCU A;  3A56 A;  1EWH A;  2B8F A;  1SNC A;  1T9H A;  5AFW A;  3G7L A;  4GN4 B;  2PZU A;  3J81 E;  2XRQ D;  4GLV B;  4C3J G;  4EQP A;  4EQN A;  3NHH A;  4C3I G;  4BBR H;  1CKN B;  4R4O A;  2N3S A;  1QB5 D;  2QA4 A;  4HJ9 A;  2F3W A;  3I4N G;  1LT4 D;  1CM9 A;  2G9D A;  2K33 A;  1YNJ D;  2QKI C;  4C1N K;  1A6X A;  2A6E D;  1MJE A;  4TSS A;  4C3J B;  1M8A A;  1CZG A;  2AQ2 B;  1ESF A;  4C3I B;  2K1B A;  1O7Z A;  1G29 1;  4GKK Q;  1JWM D;  4NXN Q;  4ZCK A;  1EIH A;  3I4N B;  1RIP A;  1S5F D;  1KD1 C;  1PTO F;  2DNE A;  3OWE B;  5BN5 A;  3NPP A;  3IKJ A;  1PYS B;  2YTY A;  1Q81 C;  2YTV A;  2L55 A;  1U0L A;  1TQO A;  3W5O A;  3U9O A;  1IYU A;  2QIL A;  2EJG C;  4NPS A;  3S1R H;  4ULL A;  1HZ9 A;  1D5Z C;  4NW2 A;  5M3M H;  1QUQ B;  1F2Z A;  2UU9 L;  1IKM A;  2F0D A;  4XQN A;  2UUB L;  2AHO B;  1JR0 D;  1NUC A;  4R1J A;  1I4P A;  2ASB A;  4A3D G;  1PTO C;  1P8L A;  1Y8N B;  1Y1W H;  3A55 A;  2A8V A;  1AN8 A;  1HJP A;  1TWG H;  4IPC A;  3S24 A;  4QL5 A;  3OTO Q;  3IFD A;  5L37 A;  1I3Q B;  3EJI A;  4GS3 A;  4DGZ A;  4A3D B;  1X65 A;  4O42 A;  2AQ1 B;  3D8G A;  3M7N A;  1PH4 A;  4IPG A;  5C4X G;  5KIX A;  1VQE A;  4LW1 A;  2L1B A;  2Z8L A;  4QUC A;  5FOB B;  4HJA A;  4X65 Q;  1KLU D;  1QVC A;  3U9S A;  3A8J E;  4K5X A;  2H1E A;  4JVZ A;  1VS0 A;  5JJI A;  5C4X B;  4LF8 Q;  5JAV A;  5A35 A;  2ID0 A;  2QEX A;  3KLS X;  1SYC A;  2ZXP A;  4HCS A;  2EZV A;  2JQO A;  1XWE A;  2R7Z G;  4XTC S;  4HJ7 A;  1XNQ Q;  1PXU A;  2VQF L;  4DV1 Q;  3KUP A;  4IJL A;  2BDN A;  1II3 A;  4DAV A;  3MEF A;  1GUS A;  5E1F A;  4Q5V A;  3IAY A;  1D6E C;  3AFP A;  3L3O C;  3QOL A;  2R7Z B;  1EOT A;  5K36 H;  5KGU A;  1K9M C;  3UE1 A;  1YVC A;  1SNO A;  4A3C H;  1T5E A;  2QW7 A;  3BJU A;  4YWM A;  1XYI A;  4GKJ Q;  3MXP A;  3LWU A;  3TP6 A;  1MKH A;  1U4R A;  1CZW A;  1ET6 A;  4EQO A;  2EIF A;  3SK5 A;  2XRS D;  5FLM H;  4BXX H;  5KYL A;  4OEL B;  3CCS A;  5C4J B;  2YYZ A;  4G4K A;  2AWN A;  4JI1 L;  3K7U C;  4A3J G;  2ZXO A;  4ZUI A;  4LAA A;  3F2D A;  2E5L L;  1I4R A;  1EY8 A;  3T13 A;  2CQO A;  4HIM A;  2IX1 A;  1F2Y A;  2I5M X;  4DV5 Q;  3FDT A;  1DD2 A;  1WFQ A;  3Q8D A;  2PYK A;  2EPB A;  4A3J B;  1OXU A;  1CUK A;  2HHH L;  1GJX A;  1H9R A;  5J22 A;  4KN7 C;  5M3F H;  4ID6 A;  4DR1 L;  2MP1 A;  5EPL A;  5CV5 A;  1RD9 D;  1B7Y B;  3I7F A;  4RA8 A;  4TVA B;  1NMF A;  4ME5 A;  4OWW B;  4V19 0;  3BYY B;  4KN4 C;  1DOK A;  3V05 A;  3KK7 A;  3SK4 A;  2E75 C;  3EN2 A;  4C2M B;  3HKZ E;  4G57 A;  3CPW A;  2B3G A;  1Q8K A;  3S2H B;  5D3I B;  1MJC A;  4GN5 A;  1IBL L;  1JMC A;  2ENB A;  4DXF A;  3ULP A;  1UUP A;  4HJ8 A;  4LUZ A;  2R7Z H;  1R9T H;  3QIA A;  3S17 H;  3P75 A;  4IOC A;  3E9I A;  2Z0S A;  3DWP A;  2E2I B;  3RLN A;  2PW5 A;  4RGO S;  2F03 A;  4MTN A;  1EL0 A;  4KMU C;  5TSS A;  4LF7 L;  2EOT A;  2JYO A;  4YIJ A;  4DNT B;  2KEN A;  4OO1 I;  3FEW X;  1VMP A;  2KCT A;  3DXJ C;  5KRU A;  1EIG A;  1VQG A;  2I0Q A;  1HFN A;  2R61 A;  1QZH A;  5KYI A;  3BYT B;  3DUZ A;  1B44 D;  4A93 G;  5CGK A;  2RCF A;  2VB3 X;  4FF2 A;  2VQE Q;  4DR3 Q;  3TEH B;  1PV4 A;  3PO3 G;  4MNO A;  1D8L A;  3I72 A;  4FF4 A; 
#chains in the Genus database with same CATH homology
 5I2Y A;  2NZ1 D;  4HMJ A;  4A93 B;  2I46 A;  4DAY A;  3K5L A;  1PZK D;  4XDX A;  3PO3 B;  1LTB D;  3MC0 B;  5EPJ A;  2PPB C;  2IPK D;  1S5C D;  4PNY A;  1CFM A;  3K5N A;  1JOK A;  4FXD A;  3IFT A;  4M1U B;  1QWY A;  2C9O A;  2VXW A;  3FVQ A;  3E0J A;  4J6H A;  3NTI A;  1HA5 A;  2B2W A;  4UDU C;  3QG1 A;  3I8Z A;  2Q8R E;  1GUT A;  4DXG A;  1BQQ T;  3FKI B;  2KEE A;  1E2W A;  1A2U A;  1ROD A;  2E2J B;  1G91 A;  2F0G A;  1EY0 A;  1DCZ A;  3BVG A;  3Q6S A;  1LT6 D;  4A3K B;  2IWH A;  3PUX A;  3BDO A;  2E2H B;  5JEA G;  4KK7 A;  1MSH A;  4J8Q A;  3L9A X;  3DEP A;  2OT2 A;  3H3V C;  3H6M A;  5ELD A;  1QNK A;  4KD4 A;  2B8G A;  1JCK B;  1B3A A;  3GTJ B;  4LJZ C;  1KDB A;  1EEF D;  1SYB A;  2EVB A;  2BOS A;  3OW7 A;  1PFN A;  2J4X A;  1HRJ A;  1JWU D;  4DU9 A;  4PMB A;  4DFA A;  1B9M A;  3MXU A;  3MEH A;  1PRT D;  1X3Q A;  4HN7 A;  1JE4 A;  1OXT A;  1BCP B;  4BY1 B;  4V0B A;  1I50 B;  2A5H A;  1JOQ A;  3K58 A;  1IHZ A;  3RD4 A;  1EU4 A;  2HQE A;  4KY7 A;  3VR5 A;  3VYT A;  1S5D D;  4ZLT F;  3I73 A;  2A69 C;  2RVL A;  4XT1 B;  4RGN A;  5IGE A;  2PMZ B;  3D31 A;  3HP3 A;  1HPC A;  2K5D A;  1WD1 A;  4OIK A;  3RZO B;  2FMC A;  1D1K A;  3QJY A;  2XWB B;  5JPM C;  3SE0 A;  2B39 A;  5JEA J;  3W3A A;  4QUF A;  4K6L A;  1TWC B;  2E74 C;  4UAI A;  5C5M A;  1ENA A;  4KKU A;  3FMC A;  1ZXT A;  3E6Z X;  1EFI D;  4HMI A;  1GUW A;  3SHL A;  4K5W A;  1YNN C;  2J7Z A;  4QMG A;  4F87 A;  1Q90 A;  3DEO A;  1LAC A;  4WRD A;  3H0G B;  4XQQ A;  4XYQ A;  3T4A C;  2R92 B;  2NB0 A;  1PMR A;  2IT1 A;  5CBA E;  2X6G A;  5FO7 B;  3VR3 A;  2HDL A;  4ZQ3 A;  5JVG 3;  1KLG D;  1X32 A;  1SMY C;  2KQ3 A;  1TS4 A;  2FHT A;  4O1N A;  1RDP D;  1WVL A;  1V1P B;  2I07 B;  2EYF A;  1ZKO A;  1LTT D;  3GV6 A;  2F0E A;  1AZQ A;  1JIC A;  2TSS A;  1A15 A;  3PUY A;  4PV1 C;  1NSN S;  2B2V A;  5C0X G;  3Q0A A;  2F0J A;  5IIF A;  3S1M B;  2F0I A;  4RGM A;  5E4X A;  5KNC A;  3V2T A;  5FKA C;  2PW7 A;  2RSO A;  2L4N A;  5KND A;  4TQU S;  1EQV A;  4KTA A;  3DMU A;  3S1Q B;  3ITP A;  2KHS A;  1SFO B;  3F2U A;  2KJX A;  3A7L A;  1ET9 A;  4C1N I;  4U67 3;  2JA5 B;  5CV4 A;  3CHB D;  2B2Y A;  4B9W A;  3OSO A;  1SEB D;  3GTQ B;  3R3O A;  1B2T A;  4CJ0 B;  1R4P B;  1HUN A;  1JOR A;  2SEB D;  5T1I A;  1QIL A;  1CA5 A;  4KY6 A;  2B2T A;  2N55 A;  1S4Z A;  2RA4 A;  3K7A B;  1DM0 B;  5CV7 A;  1BF4 A;  1JWS D;  2A6H D;  2R93 B;  1G2S A;  4FNF A;  2N88 A;  5C0X J;  2JSO A;  1IW7 D;  1J9O A;  1CA6 A;  5E4W C;  2YU9 B;  3MFG A;  4G7H C;  5DM6 3;  3HS0 C;  1CK1 A;  1PTO B;  3J80 E;  4IFD I;  1TWF B;  4ZKC B;  4RHS A;  1DYQ A;  2K28 A;  5FK9 C;  3T16 A;  1WCM B;  1PFB A;  2K01 A;  3QOJ A;  1F9R A;  3NWT A;  1A3V A;  4RH6 A;  1RTN A;  2WIN B;  1PYW D;  2CW0 C;  5C6A A;  1CT1 D;  1HA6 A;  3SK8 A;  5C0X I;  1BO0 A;  5C3W A;  5ISR A;  2K5W A;  2CVR A;  5IT9 E;  2A68 D;  4RCN A;  3R2I A;  4N9P A;  3HOV B;  3CU7 A;  1LT3 D;  2F0L A;  2MPM A;  3SVM A;  2WP8 J;  2O2L D;  3GV3 A;  2XVS A;  4WOR A;  1RHP A;  5LL6 S;  3TN2 A;  1OO9 B;  3NBH A;  1BXT A;  1KNE A;  3AU7 A;  3DWA A;  1VDZ A;  4PMC A;  5M5X B;  4IAL A;  3UI2 A;  4OO1 G;  2NWG A;  4BWG B;  2HCI A;  4FP5 D;  2F0K A;  1Q3L A;  1SSO A;  1QNU A;  4DNR B;  1D5M C;  3HKZ B;  4N9T A;  5CC4 A;  2ICE C;  3J7A F;  3ND9 A;  1H9S B;  2BDO A;  2NN6 G;  4IUV A;  3R8B A;  2JA7 B;  1Q8I A;  3MFY A;  4ABN A;  2HUG A;  4NKL A;  5CV6 A;  2O5J C;  4P2C B;  5CV8 A;  4I7Z C;  4ZAI A;  5EGT A;  2MHV A;  2IL8 A;  2F0S A;  5I9O A;  4WJW A;  2E2D C;  1K8O A;  1PDQ A;  2B2U C;  4QF4 A;  4MIU A;  3NXW A;  4ZRZ A;  2PNR C;  1OXS C;  2XSC A;  1EEI D;  5NUC A;  1EY6 A;  2BE5 C;  1C4Q A;  2WII B;  2RDH A;  2ICI A;  3C3L A;  3MAQ A;  4IUU A;  1EYC A;  2F0W A;  4DAP A;  4M8A A;  1EZ8 A;  4JK1 C;  4C3H G;  2KCN A;  1FNV A;  1H9K A;  1O78 A;  2NVT B;  1WTP A;  3I70 A;  3IL8 A;  1U4L A;  1Z47 A;  1UNS A;  5FLX L;  4C3H B;  3URY A;  5CMD A;  5T1G A;  3GTG B;  1SNQ A;  2B2W C;  3HEJ A;  1ILP A;  3N6R A;  1GHK A;  2RSN A;  1I6H B;  3X3N A;  3PV0 A;  3CRK C;  2OEO A;  4OO1 H;  3OIP A;  5G3L F;  2EYP A;  5EKL A;  3C1F A;  4HR7 B;  1EY5 A;  4BY7 B;  4FF3 A;  3BDC A;  1BOS A;  5I6Y A;  1AW7 A;  1K83 B;  3T53 B;  4J1M A;  1SYE A;  4G7Z C;  3TME A;  4CKC A;  3A8K E;  2NBF A;  5FO8 B;  3D3R A;  2EY1 A;  3SDZ A;  4A3B B;  3SXH A;  1I4Q A;  1BCP D;  4CKE A;  1AEX A;  3KF8 A;  2XIW A;  2EY5 A;  3S9W A;  2X69 A;  3MTS A;  4U68 A;  1TWH B;  1GXD C;  4QCL A;  4BA1 I;  3ND8 A;  1G8Z D;  3M3Y B;  1ENC A;  3W2D A;  2NVX B;  4KD3 A;  2K04 A;  2NN6 I;  4IUN A;  1HXY D;  4LMQ D;  4OL7 A;  1U9R A;  4KY5 A;  3PMF A;  3O13 A;  1PZJ D;  5C4Z A;  1STN A;  3H91 A;  2NTT A;  2LY7 A;  2Q8T A;  2RDF A;  3S14 B;  1YNJ C;  2L0C A;  2A6E C;  3FPU B;  1TY0 A;  3PIO 3;  1HUM A;  2F0O A;  1BNZ A;  1PZI D;  1RKN A;  1Z6H A;  2EYL A;  4Q0F A;  4KKT A;  5EBC A;  5D65 A;  1KAA A;  2F1M A;  2IX0 A;  1A3U A;  4EVO A;  2K5Q A;  4S3S A;  1ZYR D;  3ZYY X;  2NYZ D;  5EJW A;  1SND A;  2NTS A;  3GTO B;  3X3M A;  1E0B A;  1E2V A;  4K8J A;  3ERO A;  1SYG A;  5EQ0 A;  4ZUJ A;  4KHZ A;  3VYS A;  4E6I A;  4ILW A;  1DON A;  3MXG A;  1RJT A;  5ELB A;  1SXT A;  2CQA A;  4XQJ A;  2QF7 A;  2WB1 B;  3CKI B;  1SBB B;  1H9S A;  4G7O C;  2K32 A;  2Z4H A;  1ZEQ X;  3LX0 A;  3OHX C;  4HSV A;  3Q24 A;  2F0N A;  1QE6 A;  5J1Z A;  2JEB I;  3MWY W;  1L0X B;  3CQZ B;  3M4Y A;  1S5E D;  2F0F A;  1EYA A;  4A3M B;  2JA6 B;  3S15 B;  3D6C A;  3VR4 A;  1Y1V B;  2PCF B;  3EA6 A;  4CKB A;  3I4M B;  4CBV A;  3GO5 A;  3OIQ A;  2D9U A;  3MZ5 A;  4HAE A;  3HOY B;  3SEB A;  1TS3 A;  2JA8 B;  2WKC A;  1UAP A;  2F0U A;  4FYD A;  4L63 B;  3PUV A;  3TDQ A;  4A3E B;  2X6L A;  4K2L A;  1STH A;  1WTR A;  3NQI A;  3K59 A;  5DM7 3;  1AP0 A;  1I4H A;  3PUW A;  3VA7 A;  3PO2 B;  2DY7 A;  1ESR A;  2B2Y C;  5CYU A;  2VNU D;  5JEA H;  1TS5 A;  3SR1 A;  3NK9 A;  4JBW A;  2B2T C;  3EVQ A;  2EJF C;  5JPN C;  5IGD A;  1WD0 A;  2TMP A;  3RLF A;  2MUY A;  4L6T B;  5EKK A;  3TZU A;  5BN3 A;  1SNP A;  2KA7 A;  1PTO D;  1VF7 A;  1Y69 U;  4IFD G;  3MHB A;  3VR6 A;  5EPK A;  3D4R A;  3C2P A;  3GP7 A;  4XT3 B;  4RCO A;  1B53 A;  3K57 A;  3HZX A;  4NMZ A;  2LKV A;  3OMC A;  3JAM L;  3C46 A;  1DZ1 A;  1TS2 A;  2M2L A;  3C1E A;  5CV9 A;  3K5O A;  3VYU A;  2JE6 I;  5ELF A;  5M9O A;  4DK1 A;  2A73 B;  5I4D A;  3DM1 A;  2Q8I B;  3BS1 A;  1EZ6 A;  4DF7 A;  2KCC A;  1EQT A;  2AUK A;  1LTA D;  3R93 A;  1WTO A;  2D62 A;  1G6Z A;  1A2T A;  2IX3 A;  1Z7T A;  4OIJ A;  2FJ2 A;  4H13 C;  2RDG A;  5C4H A;  1FNU A;  1VCI A;  1XX8 A;  5LHY 1;  5CR3 A;  1VF5 C;  2OXP A;  1RTO A;  2D2C C;  1SDF A;  4ZYS A;  1GUG A;  3NWS A;  3BVZ A;  1W6K A;  5A2Q L;  1LT5 D;  5DAU A;  1JB3 A;  4IFD J;  2EYH A;  3S1N B;  2OF1 A;  1DJR D;  1F77 A;  4Z9C B;  4BBR B;  4IFD H;  5I6W A;  2AQ3 B;  3BVM A;  3J81 L;  1QCB D;  5IOC A;  2CHB D;  1ONL A;  1A3T A;  3OOC A;  2VB2 X;  4PQX A;  1D1I A;  2AUJ D;  1BUV T;  1SE2 A;  2A74 C;  1STY A;  4X3U A;  3GTP B;  3BDL A;  1PRT F;  4IUQ A;  5C0X H;  4K5V A;  2WV6 D;  3S1R B;  2R3Z A;  5BN4 A;  1Y8P B;  2EYO A;  1C48 A;  1QOH A;  5M3M B;  1GUN A;  1X3P A;  1BDO A;  3BZD B;  1D2B A;  1HFG A;  4EGV A;  3A54 A;  4IUR A;  5ELE A;  3WOE A;  3QB3 A;  1PRT C;  2NUC A;  3ONA B;  1Y1W B;  5I9P A;  2KUM A;  1TWG B;  3FRP B;  1C8C A;  1HTL D;  1Q1E A;  4CGY B;  1LAB A;  5M5Y B;  2M9V A;  2BCO A;  1F9Q A;  5ELC A;  4C56 C;  3NBI A;  1I4G A;  4ZK9 B;  1W6J A;  3GTM B;  3TSS A;  4NDX A;  4R9W A;  3WDN A;  2EY6 A;  2PQE A;  5K36 G;  3KLS A;  2K03 A;  1ENF A;  3KBX A;  1HTP A;  4F7X A;  4KI0 A;  4KHV A;  1D5X C;  1TKW B;  1K8M A;  5HGT A;  3KBG A;  5IGF A;  1GHJ A;  4RAU C;  1V1P A;  1SE3 A;  4DK0 A;  1PTO H;  5COY A;  2O4X A;  2EYJ A;  1F9S A;  4IQZ A;  1NR4 A;  4DA2 A;  2RQX A;  2EYM A;  4PMW A;  2O5I C;  2WKD A;  1EWC A;  1SYF A;  2VUM B;  4H44 C;  4XYO A;  1OXX K;  2Z1C A;  3KLR A;  2B63 B;  5LL6 X;  1CQF A;  5M3F B;  1H9M A;  3M7G A;  1DOL A;  1I4X A;  2KED A;  3PUZ A;  2NVQ B;  4FVM A;  1UEA B;  1WTQ A;  3TZD A;  2K7V A;  1L0Y B;  3I4L A;  1R4Q B;  2FFK B;  2DNC A;  4FXK C;  1HCZ A;  2F3V A;  4L8J A;  2DN8 A;  3N52 A;  1SNM A;  2F0P A;  3D4W A;  2IW3 A;  4CHT B;  4X3K A;  4ZKB B;  1R9T B;  3S17 B;  1JC7 A;  3RUZ A;  4RKB A;  1T5X D;  1TVX A;  5EKI A;  3K0Y A;  2A69 D;  1E2Z A;  4MHE A;  4R8N A;  3NTH A;  3OPO A;  2F0H A;  1O80 A;  3AMU A;  1DXM A;  3NP8 A;  1CHQ D;  3R2T A;  1MGS A;  1FR3 A;  1RF2 D;  4IZ8 A;  4FO2 A;  2EE1 A;  3TBI B;  2LFN A;  2IJ0 A;  1STE A;  1PLF A;  3J7A V;  5I2X A;  2EY2 A;  2KEC A;  2NN6 H;  5JJZ A;  3MVV A;  3NE5 B;  2LMC B;  4IN3 A;  1FNW A;  1YNN D;  3HG9 A;  4KV6 A;  1LTR D;  3CRL C;  5CBE E;  4FF1 A;  1IL8 A;  4AYB B;  1U4P A;  2E76 C;  1CTM A;  2A6H C;  2NVY B;  3VR2 A;  1LTG D;  3A8I E;  3D4D A;  5C3X A;  1O7L A;  1IW7 C;  1H9J A;  1FYC A;  2SNM A;  3QO2 A;  5FLX E;  4I65 A;  3K6O A;  4RWS C;  1SMY D;  1JOO A;  2D5D A;  4KJN A;  2Z4I A;  1EY9 A;  4X3T A;  4X3S A;  1GOZ A;  3RMH A;  2FIN B;  3LWE A;  4BS9 A;  1AFP A;  2MGS A;  5DEH A;  1STB A;  4Y7N B;  2K05 A;  1QG7 A;  2C5C A;  2KOL A;  2Y0S B;  4XIG S;  2PZW A;  3P7J A;  1ILQ A;  1F2M A;  2GA4 B;  4IUT A;  2RKS A;  5DNF A;  3A7A B;  1MI2 A;  1LV9 A;  5M5W B;  2B2U A;  3HOW B;  3ERQ A;  4K2K A;  3G6J B;  5F2D A;  3VYR A;  1V8Q A;  3QWN A;  2V4D A;  2XWJ B;  1WTX A;  2A68 C;  5D3D A;  3DHQ A;  1ML0 D;  2H4O A;  2J0T D;  3J7Y W;  1O7Y A;  2JP1 A;  1TWA B;  5KNB A;  2XN9 C;  1HQR D;  4BBS B;  5IGB A;  4WFN 3;  1MBY A;  2WAC A;  1KNA A;  1M4V A;  3E5S A;  3PIP 3;  3K5M A;  1SE4 A;  3D6W A;  5FO9 B;  1HHV A;  2EDG A;  2JEA I;  2JXM B;  4A3G B;  1SAP A;  3TP7 A;  2QEJ C;  1LLR D;  1V1O A;  1DOM A;  1TII D;  1NCV A;  1FD7 D;  3NSW A;  2WAQ B;  1B4O A;  4QB4 A;  1HQM C;  1LTS D;  2L5T A;  1KDA A;  1OXV A;  2B2V C;  2RBM A;  1F2L A;  2EXZ A;  2XNA C;  4K14 A;  3GTL B;  1S5B D;  2AWO A;  1XXG A;  3SK6 A;  3HGB A;  1BR9 A;  2L9H A;  3HOU B;  3MXN A;  2EJM A;  4A3F B;  3GTK B;  3BG3 A;  3VA5 A;  3M4O B;  1G2T A;  4XXE A;  1KTK A;  1EU3 A;  1VMC A;  3LNN A;  1BBX C;  5KEE A;  4K8I A;  1EYD A;  3OMG A;  2CW0 D;  2F0Q A;  1CQV A;  4RFB A;  1NAP A;  3GD7 A;  1WTW A;  1AZP A;  1TT2 A;  1SJE D;  5JOB A;  1SJH D;  3HRZ C;  3Q23 A;  4B9X A;  3EQL C;  4HCE A;  4K6D A;  4TRD A;  2K6A A;  4LK1 C;  1BCP F;  3P20 A;  5C5L A;  1B1Z A;  4F88 A;  3FPP A;  2F4I A;  5J39 A;  2F0T A;  3RZD B;  3GQB A;  2M00 A;  4QIW B;  2SDF A;  1F9P A;  4RKL A;  1BCP C;  3P1H A;  5E3F A;  1V43 A;  2MJ8 A;  4HED A;  1Y8O B;  4H0L C;  2QCP X;  1SYD A;  5IGG A;  2L11 A;  1LTI D;  1KAB A;  4NP5 A;  2L12 A;  5C44 B;  1STA A;  1IYV A;  3NTK A;  2PZT A;  2PO4 A;  1Q12 A;  4TKO B;  3WOF A;  3L7Z C;  5COR A;  3S16 B;  3H94 A;  1FGB D;  1TY2 A;  1CI3 M;  2BE5 D;  1KDC A;  3Q22 A;  1TU2 B;  1B9N A;  4H7B A;  4A3I B;  1GUO A;  2HCC A;  1JQY D;  4KJO A;  4BA2 I;  4KKS A;  4B08 A;  3I3C A;  4OHJ A;  1WTV A;  1U4M A;  1MD2 D;  2BA0 A;  3OWF A;  4RGT A;  3HOZ B;  4R8I A;  1XTC D;  3JAM E;  5EBD A;  1STG A;  5JVH 3;  4MN3 A;  1EY7 A;  1ZYR C;  1IKL A;  1PRT B;  2SOB A;  3S2D B;  1EY4 A;  1ICW A;  3AB9 A;  3NUC A;  2QDB A;  4IUP A;  3TP5 A;  1CHP D;  3M85 A;  1Q1B A;  4CJ1 B;  3J80 L;  1RCV D;  5IGC A;  2ZXR A;  2FMM A;  4RHR A;  3HOX B;  3MA2 B;  4DN4 M;  4GZY C;  1TR5 A;  1PFM A;  2F0V A;  4OGQ C;  1LO5 D;  2BA1 A;  2SNS A;  2DY8 A;  3NQT A;  3V96 A;  1MSG A;  5D14 A;  4ODG A;  1B50 A;  4F8M A;  3T56 B;  5K5P A;  3TP8 A;  5G3L D;  3I90 A;  3H09 A;  1I6V C;  5HUR A;  4HTH A;  5IOD A;  2G9H D;  2KVM A;  5IT9 L;  2LS0 1;  2ZT9 C;  5A2Q E;  2HDM A;  4HSP A;  3I91 A;  3DWQ A;  3T51 B;  4CJ2 C;  1NR2 A;  2F0M A;  3EFX D;  2R6G A;  1J8I A;  4FXG C;  5C3E B;  1QJO A;  3A56 A;  1EWH A;  2B8F A;  1SNC A;  5AFW A;  3G7L A;  2PZU A;  3J81 E;  2XRQ D;  4C3J G;  4EQP A;  4EQN A;  3NHH A;  4C3I G;  1QB5 D;  2F3W A;  1LT4 D;  1CM9 A;  2G9D A;  2K33 A;  1YNJ D;  2QKI C;  4C1N K;  1A6X A;  2A6E D;  4TSS A;  4C3J B;  1M8A A;  1CZG A;  2AQ2 B;  1ESF A;  4C3I B;  2K1B A;  1O7Z A;  1G29 1;  1JWM D;  1EIH A;  3I4N B;  1S5F D;  1PTO F;  5BN5 A;  2DNE A;  3OWE B;  3NPP A;  3IKJ A;  2L55 A;  1TQO A;  3U9O A;  1IYU A;  2QIL A;  2EJG C;  4ULL A;  1D5Z C;  4NW2 A;  1F2Z A;  1IKM A;  2F0D A;  4XQN A;  1JR0 D;  1NUC A;  1I4P A;  1PTO C;  1Y8N B;  3A55 A;  1AN8 A;  3IFD A;  1I3Q B;  3EJI A;  4DGZ A;  4A3D B;  4O42 A;  2AQ1 B;  3D8G A;  3M7N A;  5KIX A;  2L1B A;  2Z8L A;  4QUC A;  5FOB B;  1KLU D;  3U9S A;  3A8J E;  4K5X A;  2H1E A;  5C4X B;  5JAV A;  5A35 A;  2ID0 A;  3KLS X;  1SYC A;  2ZXP A;  4HCS A;  2EZV A;  1XWE A;  4XTC S;  1PXU A;  3KUP A;  2BDN A;  1II3 A;  4DAV A;  1GUS A;  5E1F A;  4Q5V A;  3IAY A;  1D6E C;  3L3O C;  3QOL A;  2R7Z B;  1EOT A;  5K36 H;  5KGU A;  1SNO A;  1T5E A;  1XYI A;  3MXP A;  3LWU A;  3TP6 A;  1U4R A;  1CZW A;  1ET6 A;  4EQO A;  3SK5 A;  2XRS D;  5KYL A;  5C4J B;  2YYZ A;  4G4K A;  2AWN A;  2ZXO A;  4ZUI A;  4LAA A;  1I4R A;  1EY8 A;  3T13 A;  2IX1 A;  1F2Y A;  3FDT A;  1DD2 A;  2PYK A;  2EPB A;  4A3J B;  1OXU A;  1GJX A;  1H9R A;  5J22 A;  4KN7 C;  4ID6 A;  2MP1 A;  5EPL A;  5CV5 A;  1RD9 D;  4RA8 A;  4ME5 A;  4V19 0;  3BYY B;  4KN4 C;  1DOK A;  3V05 A;  3KK7 A;  3SK4 A;  2E75 C;  4C2M B;  4G57 A;  3S2H B;  5D3I B;  2ENB A;  4DXF A;  1UUP A;  3QIA A;  3P75 A;  3DWP A;  2E2I B;  2PW5 A;  4RGO S;  2F03 A;  1EL0 A;  4KMU C;  5TSS A;  2EOT A;  2JYO A;  4YIJ A;  4DNT B;  4OO1 I;  1VMP A;  3FEW X;  3DXJ C;  5KRU A;  1EIG A;  1HFN A;  2R61 A;  5KYI A;  3BYT B;  3DUZ A;  1B44 D;  5CGK A;  2VB3 X;  4FF2 A;  3I72 A;  4FF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...