2A74C

Human complement component c3c
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
307
structure length
296
Chain Sequence
TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of complement component C3 provide insights into the function and evolution of immunity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Complement Component C3c
total genus 61
structure length 296
sequence length 307
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2a74C02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 2a74C01
2PN5A 5FO9B 2QKIC 5JPNC 2WIIB 2A74C 3V96A 3CU7A 5FO8B 1EDYA 1XWEA 2E2DC 5FOBB 2TMPA 1BUVT 3HS0C 2B39A 1OO9B 3FRPB 1BR9A 1BV8A 1PXUA 5JPMC 1D2BA 2I07B 4FXGC 4D94A 4FXKC 1UEAB 4ILWA 1UAPA 3CKIB 3MA2B 3HRZC 3T4AC 2ICEC 1JB3A 3L3OC 1GXDC 2XWBB 2XWJB 3KLSA 2WINB 3OHXC 1BQQT 5FO7B 1AYOA 1JC7A 4LNVA 3I70A 3G6JB 2J0TD 2A73B
chains in the Genus database with same CATH superfamily
1NEZB 3ESPA 1YEDA 4OZFA 4QRPA 3VH8G 5IYCG 1NDGB 2PP8A 1OT2A 1MCPH 5FO7A 3I6KB 3AGWA 2UUBQ 2XXCB 3PO3B 1SJEA 3KPNA 4HWZA 4GS7C 1PAZA 4K94C 4DV7Q 4N9GA 3SDAC 1EAPA 2EZ0D 5K59E 2R69H 1EQWA 4U7MA 4XCCL 4JANA 1OM9A 1DCZA 3T6VA 4PJHF 4FX5A 2EDQA 5I1LB 2M00A 3S3PA 1JGEB 2A4EA 4K3HA 2Z4HA 4BXVA 3K58A 5DFTA 3SDAD 4P2CG 3BX7C 1L9PA 3O3DB 4G1MA 2F7IA 5C08D 1M7DA 2A9DA 3B5HA 1K8DA 3AZUA 5IHBA 5CO1A 3TZVC 2ESVE 4AM0Q 4KKQA 4JANB 4NKLA 3MJ8A 3OPZL 2DV6A 4M3KB 3U36A 5HYJB 5JDSB 2HRLA 4DQOL 1M7XA 1YYLL 1PSKL 1BZDA 4R97B 4G59C 4PGBA 1AQKH 1WIOA 2JTYA 4YNYB 3HW7A 3AQZA 4WI0B 4X66L 1L3NA 3KAAA 5HHOE 3G48A 4OLVH 4ZYKB 1NL0L 4XNUH 1FN4A 3JUZA 3S1NB 5FYKE 3UC0L 2QQNH 2K5HA 1UUNA 3L3KB 4XNQB 2V3EA 2BOCA 5J56B 5E24E 4Z77A 4GNXC 1CXKA 3EJQA 1TWCH 1T89A 4PZ8A 4JGMA 3NEOA 3ZDZF 5L6YL 5ELBA 4JFUA 3ULLA 1U9KA 4RDQG 4GUOA 4YHPA 1JPEA 3UXFA 1L0WA 2Q7NA 5LG6A 4AM0B 2EYHA 1J5EQ 1CDBA 1E5CA 2ZOUA 2BVOB 1OSEA 1R5VB 2DTSA 5CSZA 3KDFA 2J1KA 3LSOA 4RZCA 1XCWA 4KX9A 3JSSA 5EEWA 1TMCB 2NXZD 2WTRA 4DAYB 3KYKL 3RGHA 4YWMA 1BFVH 4ZPTB 3S1QB 1TVBA 4IMKC 4X6CB 3GTPH 3IGAB 3FL7A 3P73B 3MV8E 4JRYE 4JHUA 2AXHA 1MI5A 2DTML 4Q6YA 5C07E 1DXMA 1JPFB 1HH9A 2NY7H 4TLKA 4BFKA 3PU7A 2K04A 2JJTC 3RDTB 4PLKC 2QSTA 4ZX3A 4KOBA 3W37A 4XPAL 2F18A 1ZE3H 5ENWB 3T3PB 1PQZA 4MJHA 4AYID 1PNDA 1KIPA 4QRTA 4OCSL 3GMLB 4UNVA 4KMUC 4FZ8H 4NRXB 4LDOB 4ZXBA 1M9WA 4FNLL 5KBMA 4H25A 5FKPB 2UXCQ 4OI9A 5I23A 1RUKH 4R4QA 1BZ7A 1I7ZA 1XL4A 2JIXD 5HJ3B 1AACA 3MODL 1KGXA 1WFMA 4K94L 4WNQB 3VA6A 1JFHA 3CD4A 4L8DA 4PH8A 2VDOH 1AH1A 3FUKA 5IGEA 5BVPL 2WLIB 4HJSA 5DUPL 4HEMA 5FHAL 1Z9FA 4RGTA 4CJ2C 3HOWB 1OKEA 1CGTA 4GO6B 3PUWA 3VB9A 1S9YB 2Z1KA 1NC2A 1F1AA 2H8PB 3WENA 2P7TB 1YNLL 1HSBB 3GHPA 3LN5A 1BJ1J 1FG2A 1G7JB 3D8MA 1CD0A 3G5XA 4I0PD 3RG1C 3QYMA 3WS3B 5T5NG 3F8UB 4JFZH 1RXLA 3S1QH 4AIOA 3CHSA 3GTNA 2RDHA 1X7QB 3ESUF 3IYLW 4K07A 4R7LA 4YDLC 1SROA 3EOTH 5I1GL 4XCEA 3ZE0E 2MOQA 3NG5A 1FLRL 3LRSA 1V05A 3L48A 4AY0A 2KQMA 4GY4A 1Q0YH 3IXAA 4RCOA 1EGJA 2VLRD 2YQBA 5CBEE 4XNAA 3FQTA 3PL6A 3H3BC 4JRXA 3K4DA 2WCPA 2Q8TA 2AJXL 4ATWA 1DZ1A 4LFBQ 5IGBA 2XFGB 3I4NG 1G6RH 5DRZB 4LKXA 3KW7A 1MJEA 3DMMB 4XN5A 5T8IA 5JXEA 5FK9B 4CJ0B 5GRVK 5C0XI 4MQTB 1MWAL 1UD3A 5CILH 2APSA 3FBQA 3BN9D 3CPFA 5FV1L 4KQ0A 2R4SH 2ZUSA 4RFEA 1RJYA 4JPIA 1UM6L 1Y18A 2JKTM 2XICA 3N0PB 4OIJA 2YEQA 3EYUL 1N3NA 3BPCB 2LFNA 3R2IA 4K55A 3KLDA 4N2EA 4H5SA 5F71A 1K6QH 4WDIA 4IBVA 3S3CB 1GAFH 3WHE0 1RIVH 4F2MB 1T83A 4UT9H 1IGYB 4PGEA 2OMBA 4MDIA 5D1ZA 1JV2A 4L29A 1SMYC 4F37F 1OT4A 1Z32X 2NY0C 4AITA 3QIBA 1W72H 4IK6A 3WN5A 4AV4A 5D96B 2EDBA 1H3TA 1IARB 3RWHA 3GTKB 4FJZA 4CRPA 2QGQA 4PJ5D 1N64H 1U3NA 4UT6A 4CN4A 5M3FB 1E67A 1L9TA 1NC2D 4U3XA 2CWAA 3M4QA 5JXED 1AEXA 1J8IA 3E3QC 2VDQL 4IQZA 3HS0C 3DWAA 2GSIB 4FYTA 1I53A 3EGDA 4HWBH 4MQXD 1JP5A 2MPVA 2YAPA 4WKXA 4MTNA 3GIVA 1WWCA 3F83A 4X4ME 2F0SA 1Y1WB 1P4BH 2A69D 4A3IG 2ORBL 4HETA 3B3IB 4JM2A 1I94L 3PAVA 1NBWA 2BSBA 3E6ZX 3HBZA 4NHCL 4B3SL 3SK4A 2FECL 3BP6A 3KYMB 1S78D 3AUVA 2ICEC 4D0CB 2LVEA 3QQ4A 2ESVB 3C5XA 5HVWA 3RKDD 1W15A 4E2OA 4FFZH 4FQHB 3UEZA 1HQMC 4OB5H 3H7BB 3B9DA 1NEZG 1OGAB 4PJ7F 3H6JA 2GK0B 4LARH 1TJHL 4W6XB 4R4BB 4MB5A 4I85A 2F5AH 5I8OL 3CBKB 3MLUL 2YUVA 1WA0X 3IDIB 5ES4B 4P9HL 1E6JL 3RKPA 2CA4A 3O9WA 3CE1A 1AKPA 1EZUA 4N3TA 2P5PA 4P5KB 5F6IC 2AQPA 3VFOB 5MP6L 3A22A 4KPHL 3RUGB 5EZOH 3T0VA 5A40E 5H4YA 2JA8G 1F4YL 1NIDA 2ZCHL 3QFGA 5KBLA 2WXOA 4HPHA 3HMXA 4KQ4H 1YMMD 3TIEB 1NBQA 1IE4A 1UUSA 2WB7A 4LGPB 4N2MA 3GSRB 3IETB 2RMNA 3SDCB 3UPCA 1N5AA 1DJZA 4PJGE 2YGPA 4BXXH 1WV7T 2VKWA 1FBIL 3KWWB 3UP1A 3HB3B 3WNIA 4DQOH 1PF3A 5FO8A 3SDDA 3LKPA 1FGVH 4CHTB 3QDJD 1X3FA 4Y52H 3LH9A 2ZUUA 5FS5A 5CWSA 1PRTC 1IQDB 3QXTA 4ZW7A 3W57A 5DMYA 4I1RA 1R6VA 2VLRE 4UT6L 2AF2A 1CZ8H 2QQNL 5EU4A 1JGIA 1VEMA 4X5XA 3RWCA 1PZDA 3T4AB 2W0KA 2K4AA 1NPNA 5D7IF 3DO7A 3APDA 3BKML 4FKHA 4XAKD 1PFBA 2CCZA 4YAQA 5LBGA 2K5WA 1F58H 2FSEA 3GSVB 4LLVB 3AM8A 3D50A 1A9EB 4EAEA 1TVBB 3IE4A 4DEUA 4HX1B 1FORL 3B2PA 4ZXBB 3VMPA 4ZQ3A 4X7SL 3NJLA 3O3AB 3T2OA 1VQNA 3PO2H 2OJ1A 3VXRD 5BXFB 1QHQA 3HG2A 3GBDA 4P49A 4POFA 2PPCA 1A6AB 2AXFB 3S36L 1IXRA 1D3CA 3BVNA 4HT1L 3THML 3MOBL 5HDBE 2HVKA 1G0DA 5EBDA 1BF2A 5FYJU 2DY2A 1GUSA 1PCSA 3KL5A 3CFJA 3OC5A 4IIQC 4M5TA 2ZCKH 3T8XB 2C9PA 3PL6D 4JRXD 2VERA 2CLVA 2BNQB 5ICUA 3CRKC 5MEQA 1J1OH 1TWAH 3TEWA 1JZHA 4XNQA 1SFDA 1J0HA 1U3HD 1TXKA 3QYNA 3VRLF 4X64Q 4HZLA 5CLZA 3EGSB 4OJDH 5E8NA 2FR4B 2QADD 2FO4A 1YEKH 2EDTA 4E5XB 5HHMD 4DNRB 3CLFL 2K70A 4L4VD 1CBVH 1G7MB 1AGBA 2X1PA 3A4DA 3SGEI 3RFZB 3S48A 1KB3A 3WG7B 5I2IB 2PWHA 2CKBL 3INUH 4OD1H 5MEQB 3VXNB 3MMEB 2O5NA 4AL8L 5JW3L 1KDJA 3SO3C 5T1KB 1RVFH 4DNIA 4L5FL 4BCYA 3GPEA 4E9WA 2IADB 3O3UN 3EUDA 2G60H 4A3FB 4DGUA 2ENQA 3L9BA 2HFTA 3E0GA 3PHQB 4JO8A 3UG5A 4QY8A 4R7DB 1S5CD 4XXWA 1DVFD 3V6ZA 3DYOA 3CV5A 2GTWA 1D8LA 4GXVH 5E6RB 3H56A 4G6FD 5F7EH 2CBPA 2K50A 35C8L 3GBLA 2JA6H 3HBGA 3FB7A 4H1LA 2Y7MA 4MCZB 2Q8AL 4OD3L 1JE5A 1G1KA 1X5JA 1MWOA 5JW4N 1IVTA 2HT1A 1TYEB 3KNBA 3KPNB 1WWWX 1BVNP 1SFHA 3QP3A 5M5WH 2WVSA 3X12A 3GRWH 3TZVD 4Y5VC 1ESOA 3Q3GA 4FDWA 4GRLC 3E9IA 1SE3A 1UH2A 2XYCA 3BAKA 5DAUA 3G5VA 1WS8A 4M8VA 5BQ7B 3HPLB 5JZ7D 2NY1C 4PJ9A 2O4XA 2AQ2B 2OZ4H 3ML9A 4GBXD 1BCPF 2AKRB 2NXYC 2P5WE 4LSSH 1Q8MA 4J3VA 3STBC 3F6LA 1B2WL 3FTGA 4HN7A 4PJ5B 1A6UL 2EIEA 3CDZA 1IL8A 4WHDA 2CDGA 4F9LA 4J8QA 4UQEA 3BH4A 3O6ML 3NZUA 4LOUC 5B8CC 4OUOA 4ME3A 3D0VA 3I02B 4GG6E 4Q9QH 1LK3H 4DNTB 2OWOA 2W65B 3FN9A 1SN0A 5IW1A 2XFXB 4N1HB 5IHWA 4N0YH 2HJLB 2WZ0A 2X12A 5LMNW 4WWKB 4GUPB 4LLVA 1KJMB 5EIIG 3HNTL 4G7QB 5D3DA 1MCQA 3ZZ1A 4LLWA 4U1NA 2WP3O 3Q44A 5AVQB 3U6RA 1DQJA 2AXGA 1MFEH 3WLBA 2ZJSL 2NYZD 2J6EA 5JXEC 1UXSA 1E3XA 5EB9A 1S2EA 1O7SA 5KSUB 4B9PA 1CICA 5DDHA 1RD9D 3BHBB 1TQVA 1V1PB 3QR8A 1YN7B 2F58L 1ED3A 1TU2A 3GSWB 3L4WA 1KXHA 2WIMA 2X4UB 5DURB 1R3IH 3V0GA 1LYLA 2F0CA 3UTSB 1ORQA 1HILB 5ACZA 3PNRB 3SKUD 1PNCA 2JN4A 3H7BA 3HC3L 5E6YA 3UZVB 1T1XB 1T1YB 1A6ZA 3WE6A 3EO0A 5EH1A 2WAQE 4G8FB 2JJTA 4GKLA 1EJFA 1ZLSH 2J5LB 3QCVH 5KZCD 1GRWA 1NMBH 1CDGA 1KENL 1SVZA 3Q2WA 2Y1ZA 5LBSL 1JJ2A 4JBSA 2YR3A 1RUML 4U6XA 3U6XA 4L4TA 1IEAB 4PJ8A 1QLRB 4WNSA 3FHWA 1UJTA 3I50L 3RDTD 4FMVA 4HKZA 2UUCL 4E9QA 1ZLEA 3BN9C 3HOYH 1IQWL 4NLHA 1YPZE 3VRIA 3QR1A 4JC0A 4WJ4A 3Q6FB 4XC1L 4KTAA 4JI4L 3RVWD 2Y7QB 3K0YA 5I18L 2AS5M 3M1CA 1G7HB 4MD5A 2FIKA 5EO9A 2WBJB 1VQKA 3MLZH 3QDJB 1S9XB 2AJVH 1U6AH 2Q2TA 4G43A 4R7NA 3ZKMD 1UENA 3V7MA 3PREA 5HHVL 2PZTA 1CC3A 4NM8H 4PP1D 4M5YH 4AQYL 4NRYA 3SGJA 4ZI8A 2VOTA 5HI5C 1SF5A 3E6HB 4KMQA 3EJPA 4XMVA 1MRCL 2JI2A 4OFQA 1NBYB 3A54A 3EFFA 3SKMB 3N1GC 4KKBC 1J9CT 2LLGA 4J39A 3UMNA 4PBDA 3D4ZA 4F7MB 4HJJL 5J1TC 1QI3A 3BPCA 4FFZA 4OZIB 3HG9A 2WAHA 3WSQL 4AIMA 3VNZA 1UKQA 3P3RA 2X4PA 1QABA 2F61A 3MRHB 3C8KB 3DX3A 5LCVA 4GFXA 2B9BA 3EFXD 3FRPA 5IT9c 2J71A 3MCKA 4BZ1L 1ZIBA 2P7TA 2ZF8A 3LS5L 4ESKA 2EXZA 3DHQA 3LXBA 4LLYA 2WWKT 4ETQB 3PDOA 3SDXA 4JREB 4QIRA 2CH8A 2NZ1D 4IFDJ 4OTXH 5EUOE 5GRYA 1LV9A 1S7VB 2C1PB 3RY6C 3GGWB 1F1GA 4PJDF 3KUPA 4IOCA 4XMWA 4IMLB 1TTFA 1EY7A 5JIDA 1A25A 3MV7E 3FQXA 1H3PH 1SF3A 2QADB 3JVGC 4LVOB 4NC1E 3ZHLA 1G1YA 3WU1A 1KBVA 1SY6H 1A3VA 4PJEA 3SCMD 2TRYA 5FYJE 1I1AA 2VUOA 1IT9L 3VWKC 1Y18B 1NMGA 4KZEH 3L95A 4Z78B 1EGJH 3GSNL 5IB4A 5BRZA 4XPHH 4PS4H 4LEOA 5F6HJ 3D08A 4DP6X 3KGTA 4XO8A 1ONLA 4EO5A 8FABA 1IJNA 3NP4A 4OLWH 3C5JB 3POHA 4R7DA 3FPPA 4Y19A 5DLQE 1A2YB 2RF4A 1MHHA 4X6DA 1FBIH 5EUKB 5C0DA 3UBGA 5IFHH 4N4YB 2R7DA 3EDFA 1Z5HA 4QGUA 4HSCX 4QXGH 5K1VA 7FABH 2D3VA 4NP4H 4MZRA 1NLDL 1WVLA 1A7NH 5AZEL 1CIUA 2NY5L 2OTJA 3MA2B 1K4CA 1CURA 4L5QA 1SY6A 2F19L 4HXBH 1IBHA 2BDNA 2DLIA 2YN5A 5MENE 1YECH 4KHXH 5ECGA 4BBSG 3U83A 3QQ3A 1G5GA 2R93G 5LGKA 3ECBA 4UDUC 1PZBA 2X4OB 1BX2B 1ET8A 5F2DA 1MH5A 5C09E 2B59A 4MNQE 1FVEA 3NIGF 1ZHNB 4CSZA 4KY7A 2OZ4A 3IJHB 4I8DA 5IWAQ 1AQHA 3T13A 5JNYA 5T3ZL 1IW7D 3DYPA 3K6DA 2O5XH 4Y89A 5T1MB 1UJ3B 2J2ZB 1YHQA 5I74C 3VWKB 3OKNB 4RG1A 1AD9B 4D0BA 2O5ZH 2VW9A 1MFUA 1NAKH 5AOJA 4BK8A 1ZLDA 2PTTA 2ZXAA 5IWLC 3HOZG 1IZJA 1GAFL 4GAJH 1B53A 5GZNC 3E3XA 2KCTA 3BQUD 4G7SB 1ILQA 1GL4B 2ZUXA 2AGJL 2Q10A 5LGJA 5CGKA 4BFNA 3TNNB 1A3LL 1HQRD 4XMPL 3DXJC 1OT1A 3R7QA 5TQ2H 2BIQA 4NQCE 5AVTB 4DZ8A 4OCRL 4C58B 5K9QG 1KEMH 4QXTA 1P7QB 4O2DA 2E9JA 3DIFB 3DX4A 5IB3A 1IVLA 1G7LA 1WYJA 1AGBB 1AZBA 4H2CA 2VZAA 5I4DA 5C0NC 1IHZA 4HS3B 4NRZA 2Y9RT 2OS7A 3MGOA 4W9DC 3AAZB 4XNZC 2OX5A 3BLBA 4FG6C 2DBLL 4LAJH 4Y2DC 3KWWA 3UYRL 1FNVA 2R7ZH 1LEGB 1LTRD 3KPSA 5EOCJ 5L88L 3KYKH 1M90C 5IROD 5K59F 3NP3A 4DVRL 3M9BA 2NQDA 2XA8L 4WK2B 1TJXA 1MEXH 2FB4H 3JT0A 4NRXA 5CKAA 1OXTA 4ZT1A 4LZKA 4ZSOE 1X6NA 1YZZA 1RKNA 2A5UA 3GNMH 4K5LA 4C83B 4QJFA 1U33A 1L9QA 5CN1A 3N9GL 4IGBD 3M4YA 5ISZA 2ICWB 5TE6L 1PG7X 2D7TH 3RTQD 4K5PA 4TRPL 5I16A 4NSKA 4Q0XH 4XPFH 4PAZA 1GR7A 4IPGA 2FJ2A 3GSVA 2X2IA 2KQNA 3QNXB 5DJ0A 3WIHL 3WEOA 4M8AA 2Z6FA 5K5YA 2VDOB 3II1A 1T2QH 3U1SH 3HE6A 2SNMA 4QF1B 4FQLH 4JO4H 1U8JA 2DQHL 1JF1A 4LOUD 1OY3B 3VXSA 3MC0B 4QL5A 5IBTL 4V33A 4A3JB 4L4VE 4UAOC 1VIWA 5HHNB 1F11B 1D5XC 3C8DA 4CVZB 1TUPA 3EDEA 1Q9KA 2G5BB 2NXYD 3TSSA 12E8L 3CSYA 4DR2Q 4DV4Q 1FRGH 4MXQC 4U49A 4Y1SA 3T0EA 4PVNA 1F8TH 1NCOA 1STEA 4HMJA 2XBDA 3OWEA 3L4CA 3C6LC 3GHEH 4XCFH 5IOPA 2FLBT 4JRXE 3EO1B 5J3HD 2X3BA 2V8MA 3JC66 5DEJA 3S3SA 3PABA 1JGUL 3JAMc 4XGZA 2MHAA 3F8TA 4IKNA 2J0TD 4PG2A 1P0SE 2DQEL 4JFDD 4ZRZA 1Q86C 1RLWA 1P9MC 3QORB 4EJ1C 2AV1B 3GDCA 2EIDA 1ETA1 4GAGL 1YEIH 2OCJA 2HHHQ 3V0JA 1ZS2A 2PWFA 2L12A 1BZEA 3ALPA 3NRPA 1F18A 4GW5B 3UH8A 2BO0A 2IWGA 1Q82C 4FI7A 1OF2B 3JAME 1B9ZA 2XWZA 2WQUA 5LBSA 2OSWA 4P59H 2JLPA 3T2PA 3QEUB 4KWUA 2BH0A 4ZQTA 4P3CL 2JKNA 1E4WH 4LVNC 2BW5A 2R9HD 4JDEB 2OR8A 4N3UA 5FW8A 1OAYH 3VUAA 5BJTB 1Y6NR 7TAAA 3ETBF 5CZKA 4EKJA 5GISL 3OG4B 3DIFA 5FO8B 4WTZA 3U2SA 4QXWA 2FFKB 3SYQA 2VN7A 2JCCA 5I1DB 4Q9CA 5JORB 3VD1A 2EXWD 3I50H 1EXGA 4A3IH 2Q7YB 3FNKA 4CKEA 3W2DA 4YSOA 2KPWA 1ZLUK 3NBNA 4W9JC 3SXHA 1FFOB 2ZJSH 3QJTB 5CGMA 1KCSL 1MG3C 4KVNH 3VGHA 3DGDA 3UAAA 3NIFB 4XBEL 1FDLL 1Y0LA 4OSUL 4PJAB 1YC8A 2G9HB 3JWNH 1IKOP 1N6QH 3VI4B 5DFVD 4PRPB 3MUY1 1U8QB 2JA7G 2E7HA 3SK8A 1V54B 1M2VB 4TNVK 1NOAA 4OI8A 3TVMA 1EFID 2HRHA 1ET9A 2NQ3A 3N06B 2BHUA 4L5FE 4FI6A 1OIOA 2EO7A 4IPHA 1FVEB 2HUHA 2A9BA 1D1IA 2NMSA 4I3SL 1R9TH 3UFIA 3LEYL 2W9DL 1AXTH 1N10A 2EIZA 1RHFA 1BZ9A 5HHOB 2C9SA 1ERNA 3DX8A 3V6OC 1AS6A 1VFAB 3W3BA 5I76B 3PHOB 5MHSE 4KK8D 1J87A 1LM8V 3GBNL 1QSEE 1JRHL 3TIDA 5I6OA 2JSFA 1VQCA 2A73B 4OLYL 4QPEA 2ZKWA 4AH2A 4J23A 5E6ZA 4G83A 5EZJA 4JFHD 4HGKC 3KGRA 3VFWA 3H54A 1U6AL 3QXVA 2IMMA 1YMHB 4JFTA 1U41A 1B0GA 3DX8B 3RVXC 1JV5B 5JOFB 2R2EA 3D12B 3PAYA 5IM7B 4H7BA 3FYIB 5BR8Q 5DA4A 5EOTA 2Z8VC 4UQCA 2XZAH 4E9LA 1VPOH 2WWOA 3C2SA 1JZJA 2Y1VA 3EJIA 4DR6L 4FNPA 3EKCA 4AOFA 3IB4A 3UAJA 3IMWA 1SLVA 4XX1G 5GRJH 2B3RA 4MMXA 1T66C 4AEHL 2CCWA 4IRZH 4K2LA 4M7LH 3MV9B 1XMQL 2VXQA 1IAOA 3FKIH 1OE2A 3UO1H 3HG1E 4I0KA 1Z3RA 4TVPH 1GTFA 2D0FA 5DRNB 1MGSA 3ZY7A 2XV0A 1C5BL 3HA0A 2KZ1B 2GVAA 4U31A 4GT0A 2F5BH 3LQAL 3TPKA 4GKJL 3KEDA 4OD2B 2AABL 5L2KB 1MJ7L 2O26U 2H41A 4NN5B 4I0PC 1Z9OA 2F0WA 1FCGA 3PQYD 4ME5A 4WFFE 4MJIA 2FIKB 2LT9A 3DV4B 4MVBD 3K8KA 5I19H 4N8CH 1FP5A 1XSKA 2ZOLB 3CHXA 3GXNA 2XWXA 5T3XE 1G2TA 1PFSA 3M4PA 4ADIA 4JKNA 1DJWA 3KLKA 1TWHB 3PIPA 4Z7UB 5AWNH 4LF7Q 2HKAA 4PQXA 2XG4A 3FO2B 3FAWA 4U1SA 4YWGL 5JW5A 4J1UB 5ESAA 1D5ZB 2AWOA 1RURH 3C5ZD 3I55A 4OCRH 4NZRH 3I7FA 2WQWA 1IW7C 1AVAA 2IAMB 4UM9D 3L7FA 2OMYA 5DO2D 1I9RH 1R19A 3DIDA 4HKXA 3D3VD 3PNWB 4PJXE 5FGBA 1HN1A 3P3YA 2Y06L 4KV5E 4U3SA 5FAAA 3HAEG 3ILPB 4APXB 3L6FB 3OV6A 2DQFB 3LRHA 4DGVL 4ZUJA 2AK1H 3H0GB 2MKWA 4KAQL 4TUJA 2FJUB 4DW2L 1KJ2B 1VFUA 5DO2C 1CT8A 1HYSC 3ECVA 2QF7A 5K36G 2NUCA 3X11A 1RIPA 1RULH 1RZPA 4FNRA 3KWXA 2VRAA 4FQJL 4NM4H 3BHBA 4PWIA 3P4NB 4A3JG 2JKWA 1AO7D 1BXAA 3D85A 3IK2A 4KKNA 3CSTA 1DEEA 4MNGE 1HWWA 2IANE 3US9A 1AXIB 3H91A 1VQLA 1SXCA 1J5DA 4AL8C 2BH8A 2WXLA 3LN9A 3K5LA 2DQIH 2O6DA 2KQ3A 1VQ4A 1PKQB 4QHUA 4Y16B 4B3EA 2F1EA 5HHNA 1F0LA 4A3KB 1XEUA 2W0PA 5F9JB 4F57L 3V8OA 3C8HA 5F7NC 3BWUC 4DK0A 3GSOA 1STNA 1JPGB 4R26H 5IR1B 1KCWA 4X99B 1KXQE 4O02L 2PN5A 3CSGA 2V6HA 2EOTA 3NH7L 1FZOA 4PTTB 5L4JA 2GIMA 4L5FH 4U7KA 4PG9A 5FUOH 3HNSH 4BBRH 1NH6A 5GAGC 2DN7A 2ES2A 3WTXA 1B9MA 3VG0L 1IGFH 3S37X 1S8DB 3V5DB 1BPLB 2J73A 2MOGA 3MTXA 2F3IA 4J27A 1T5XD 5FM5M 4X98A 1YNKL 1DBKH 2NW2B 2VB5A 3Q3GB 1NBZA 4X99A 3QJSB 3L3KA 1KELH 4G5ZL 2XKNB 5ALBH 3DETC 2VXUL 1U92B 1DFXA 4GLRI 4UT9A 4HJ7A 4L5TA 2W0FB 1M05B 3FU8A 5EBMB 4GG6A 3NFSH 4KDVA 1J8HD 5CV7A 4ABQA 2Q7YA 4LPTA 5DRWB 1KC5H 1LT4D 1I50H 1OZTG 2CIKA 3RWGB 4PJGA 5I15H 3WFEH 5HGQA 4B9XA 2OMZA 2OJZH 4R4FH 3N40F 1IAIL 1U8JB 2NX5A 5I0WA 1QWYA 2FUTA 5DK0B 3LGJA 3FU3A 3BLPX 2WYTA 2DLEA 4LPWA 3TBWA 2VL5A 1HWHB 4OGXL 4PUBL 5IZ7A 3NACL 4ZW8A 4L8BA 3BAWA 5D7EA 3JWNG 4MB4A 4KV5F 1PD6A 2YUWA 5BS0D 3K6FA 7PCYA 1OWWA 5ETUA 5HHPB 5T1LA 3T0BA 1FD7D 3VYSA 2VRKA 2Y5TB 3C08L 5HHOD 2FX8H 2VR5A 3C2AH 2OXHB 1MY7A 2J56A 2DWTA 2UXGA 4M6OH 1A66A 4PWGA 3FKIB 2ASBA 3QORA 1WISA 1F45A 1LD9B 4IHOA 1NGQH 3A23A 4B27A 2CHDA 1XNQL 4CNIB 1JT8A 2CAKA 4F7CA 4K14A 5E9DA 3HEIB 3QUKB 3NESA 5DEFA 4KKCC 3ZR6A 4XBEH 1NLBL 2EEFA 5CZRA 2DL2A 1T1ZA 5DT1L 4ODHL 5EA0L 1BM3L 1F3JB 4A3BG 1HWGB 4MX7A 5DMKB 3BYTB 1YG9A 1N34Q 1EDQA 3RHWK 4WI2A 2ZXQA 4EUPB 1F2XK 3BO8A 3OZ9L 4A7GA 2C5CA 1WWBX 4O58L 3T1HL 5E8OB 4WUUB 1A6WL 3LX9A 4F7CB 3MUGB 4ANUA 2K3HA 4GAJL 2QV4A 5I8CB 2ZZUT 2R92B 1ZLVK 4X6CE 1QHPA 2OW6A 1NMBL 2N88A 2EDHA 2AJZB 2W9DH 3JAML 4O51B 4XRCA 5FOJA 2XV6B 4BE5A 3S5LA 1W3SA 4WTQA 5KSBF 1A6XA 5FUCC 3D6CA 2OYLA 3FU7B 1UCTA 3GV3A 1NWPA 4G6JL 3OMGA 4APVA 5DHVB 1MKHA 1JZ8A 5E4OA 5F1SA 5G55A 5HXMA 2XN0A 3LN4B 5D7KD 2RCFA 4DK1A 4JI7Q 1DD2A 2DM3A 1MH5B 3G5ZB 1NCJA 1F3DH 1TQCB 3O4LE 4O2CB 3CCUA 2R0ZH 4WSGA 2XN9E 1MIEH 1U3HC 5DEGA 4ZOBA 4IBUA 2H5XA 3CRLC 1S5IL 3MACL 3PUUA 1AFPA 3CVHA 2Z31D 1RZIA 2D7PA 5FA4A 4OJFH 4Q6IC 1RFDL 2E5LL 3MOAH 4J4PC 3RVWC 5CIPB 32C2A 3LHPH 3MLXH 4H8QA 2F9BT 4FXDA 4R7VA 3OB0H 1PLGL 3ZTNH 4JY4B 4K23L 1DVSA 4XT1C 1LP9A 2IWHA 2BXZA 4UINL 5AVXB 3T0EC 5LDSA 3GBEA 1E43A 1MVUA 3C60A 4HWBL 3RJOA 2YBRA 3AG1B 3EGDB 4YXKL 5MI0C 3BT2H 4HDIA 4YUEH 3D39E 2KOLA 1U4EA 4U6VL 5I1LA 3FT3A 5C92A 1GUGA 2E8GA 1NE3A 2EZ0C 4NJ9L 3VXPA 2ALYB 1J5CA 2XTJB 5F7LB 4Q8BA 4UDTB 5D8JL 4A55A 2X9XA 1EK3A 4HJ0C 1S7XA 5CEYB 3QI9D 1A9BB 3S7GA 3TVMB 1IYJB 1QSZA 5AYTA 4XNDA 2KKQA 4M62L 4PREB 1OPOA 2QSCL 4H2AA 3VFRB 4A7SA 3HTLX 4XXDB 5LBVA 1X56A 3R8BA 2SEBA 4DIXA 2GTZB 3TT3L 4QHUB 3MO1A 2VR9A 4P9HH 5ILTH 1XXGA 5LQBH 3KE0A 4NFBA 3L3GB 3NWSA 2UWEB 3HOXG 2K32A 3NZHL 1HRJA 3MVSA 2IEPA 2YAOA 1WC7B 4RGNE 3SKOA 3VR6A 2VUMB 2V5SA 2XSCA 2ZG3A 1T2JA 3HC2A 4XPAH 3QRGL 2H1XA 3MXVH 3FYEB 43CAA 1NSNS 5DWUH 1RPUA 4FXKC 1ZSHA 3S8WA 1XEDA 1KCVL 5JVH3 3IDUA 4K5NA 4A3GB 4JO3H 5DRNA 4H0LC 1CICD 4J3OG 4KY1H 3WY4A 5GIRA 2CMRH 1FPTH 4JO2L 4YK4C 3UI2A 4IU3B 4PI2A 2ATAA 4DO5A 1A4JA 2VERN 3ZMNA 4F2MA 1A7NL 3EIFA 5IT2L 3H2PA 1MHWC 4CDFC 1UA3A 2AK4A 4JHAL 4P46C 1QEXA 3SE9L 1N4XH 3TC9A 4KKPA 4TNFA 5DTFB 1PMYA 4QLWA 3G04A 2D31A 1X7TA 3NSJA 2OBGA 4AGMA 2D7QA 3D25A 4GJTB 1E1TA 3FULA 2VIRA 2VZSA 1VEPA 5ENWA 3GEWB 3D85D 3NTCL 4G9FA 1NMAH 3GHBH 1FFRA 1KYOJ 4WV1B 4QY8B 2WZPA 2O2LD 1XPOA 5DD0L 3PV0A 1TZHA 2IXQB 2F7RA 3P4LA 1HKFA 4AENB 5D6DA 2FO1A 3RTQC 1XZWA 1A7OL 1WD0A 2QELA 5L2KA 1AE6L 1SXSA 2ENYA 3EJSA 1AP2B 2CDFB 4OR1A 3WJMB 4KOCA 5BS0B 1BBXC 1EHLL 3S98A 3DUUA 3TP8A 4DGIH 5I1KL 1UVQB 2MFNA 3NDZE 3SBPA 1WG3A 2UUAQ 1FJ1A 3FMGH 4KI5C 4BH7A 1K8GA 2B2YC 5DJAB 1UKTA 5J9PA 2WLLA 1FNSL 3G5WA 2ED7A 1T7YA 2VZOA 2IPUK 4M6ML 3AM8C 2BC4B 3IFTA 3GSNB 3OR6A 3FT1A 3EOAA 3JWOL 3HR6A 1TYRA 1TTBA 3PUYA 4PFEA 4KMLB 2Z35B 1NGYA 1EXHA 4LKXB 3DX6A 3RWFA 3UIZA 1M2OA 3WFCL 1BEYH 4M1UB 4P5SA 5F1OB 4A37A 1HT6A 1YSOA 1MN4A 2OPCA 3G9AB 4R26L 5D7KE 4B3VA 1QYGH 5PCYA 3Q8FA 3EYVB 5JW3H 4EPSA 2FSDA 1E5YA 3AREB 1FZOB 4PTTA 4XZUA 4ZFGH 4ENED 1UE6A 1SYCA 3H9SB 1XPUA 4X6EB 5DQDL 3AXLA 3P30H 2X2UA 1SLUA 5ITFB 1BWWA 2VW6A 2NZ1A 4D7PA 1KDIA 1KTKA 4JB9L 4OLUH 4DUXA 2IH1B 1MHPH 4RWHA 3X14B 4P23D 3VRLE 5A2QL 4JM2D 3P9MA 1O9ZA 2ADIB 1MNUL 4OFKA 1QFWM 4QJ3B 3VRIB 3K46A 5B3JF 4EN3A 1LEKB 1P2CA 2N3SA 1OAXL 2Y2TA 3DRQB 3ZE1B 4XPTL 4AJVA 5JZ7C 3L1EA 3BO8B 2VM9A 1WJJA 2C1OA 4PEEA 4I1PA 5GGRY 5F1KC 2KZWA 2X1OA 3HOXB 3HOUG 3BQUC 4N86A 3HOUH 5ESQA 2V2TA 1KJ2A 4MQSB 3BKJL 5CHNB 3ASNB 3NBIA 2N1KA 4RMSA 4HCSA 3VGAB 1RZKC 4WHTA 4LLDA 2F7QA 1HZHL 2R1YA 3IF1B 4LCCA 2XKNA 1E9QB 3QPKA 4M7ZB 4NNXB 2F54A 1QA9B 3ABMB 5F7DB 3MUHL 4HU8A 1LABA 2DWYA 4DEPB 1QTSA 3T65B 1BD2D 5FM4A 1R5WA 1B4RA 1YY8B 1AO7E 1WZ1H 2C4FT 1HHKA 2Z8RA 4PJ9D 4YHYC 2RA1A 4XI5C 2IPKA 4F8MA 4A75A 2ZUVA 4KRPD 4NCC1 4PGCB 3D39B 4EI5C 1PYBA 3BVGA 1R4XA 4LCYA 1E7VA 1XSJA 3WIIL 3RL1B 4A3KH 1IC5L 3HG5A 2LU5A 4P57A 3WFEL 4IN3A 2FO4B 4HMDA 1PH8A 2DMKA 1TTCA 2VDKB 3APMA 4HUUB 1SHSA 1KTLA 5GGTA 4YDKH 3POCA 4GXUN 5F9JA 4DR1Q 3BDBA 2HYMA 3ELQA 4PU2A 4D0CA 2CDGB 3E8UL 4POUB 1AQDA 2ZX9A 1VQPA 4POZC 3CD6A 4GG6F 1S8DA 3V5DA 3F58L 2VB2X 5EAYA 3QIUD 4KO7A 1NANI 2HUEA 2ZAHA 4YPGB 3ZTDC 5KN5B 4HT1H 2KUTA 3BUDA 1F2YA 1LEIA 2FR4A 1NGYB 1AGFA 1JI1A 3VQLA 3S15H 1KY7A 3LKNA 1BF4A 2DQUH 4J28A 5D5MA 1X9UA 1QNKA 3OKDB 5IJBC 5T3XD 2M2DA 2PLTA 5H8DA 4RGNB 5CD3B 1LO5D 3D6GA 5DUML 5I1EH 2NY4B 4KRLB 1KPVB 4WFFD 3H6MA 1G9NC 1LDPL 2VC2L 3QOLA 3WOEA 5IGXH 1HNZL 2VB3X 1Z6HA 3G71A 2BIIA 5EQ0A 2WOBA 2FGWL 1EBAA 5H37A 1W0VA 4I77L 1DQML 1T5KA 3JV5A 5EU3B 3F5WB 4HIXL 3T4AA 2VXWA 1EL0A 4DR5L 3DVGB 1S5BD 2DQCL 4BSWB 3HG1B 5JOPE 1LO2L 4C4KT 3PG2A 4K71C 4MA8H 4QI3A 5JW4M 2IAND 1YN6A 4Z5RB 4AYBA 1A7PL 1VFAA 4K15A 3LKPB 3B6SA 3FUDA 1A62A 2WBWB 3SE4C 1OTSD 1JPSL 3IN2A 5DZ9A 1ZHNA 1CJYA 5JUEL 4OM1H 4TTDC 4HAGA 3MRKA 1EUUA 3C6EA 2J8UE 4JKWA 1Y8OB 4ABUA 1W6WA 3ZZQA 3A7LA 1I9IH 3FU5A 3D85B 4X8CA 2MCMA 4D7BA 1GTNA 1TCRA 2YPVH 4OT1H 2DLFL 4PRBA 3EUUA 4S2SB 4QIWB 4XBPA 1LQBC 4G2AA 5F89B 4KVCH 4PJEF 4I5BA 4XOAA 2E5LQ 2Y0SG 1SJVA 1RMFH 2B63B 1JIBA 3ZDXF 1NIBA 4OH2A 4JO3L 3TBTB 4JN2B 4LFHD 2ZE0A 4IOIB 4X3KA 5PAZA 4RAUC 1TZOA 3MEFA 4PZ6A 4OQTA 1PJWA 1NFDB 1QFWH 4LCIL 4CC0A 4MMZA 1A6AA 1Z9MA 3WS6A 4KUZH 3ZKSD 4JJ5B 3VH8B 1SFOH 2BJMH 1ZVHA 4IBTA 2BERA 2FMMA 3R4RA 2XBZA 1W9XA 4NKMA 4QHLB 4N22A 4RDBA 1X3PA 2VC2B 1CF1A 4WUUD 5CEXA 3OIQA 1HJBC 5TGBB 2YPVA 3RILA 4KNTA 1M1XA 2WKLA 4OJEH 1DVTA 4QAWA 4LHUG 4YDJA 4YHML 2Q8AH 5LNGA 1JG9A 3OTOQ 1HTYA 4DFIA 3QAQA 2P42B 4M1DH 3FTZA 1MSGA 2RKSA 4JAMB 3GRWL 4LRNH 4L8CA 5C6WH 2A38A 3U0WL 3VI4E 4Z7WA 4HJTA 3QWRD 3WFBH 3W9DA 1RP9A 2HCZX 3FK3A 2WUBH 3ARVA 1JOKA 4ZXBD 2BIMA 3KYNA 2GBAA 3DX7A 3RB5A 2XQBH 4DGIL 2E2DC 3SQBB 1JZ6A 4WTWA 4PMWA 3P4OB 4Y5XB 1EEYB 4ELDA 1FGVL 3ARBA 2A9AA 3DX6B 3PWVB 5IHUH 5L9DL 1U4FA 2WZ5A 4MA7H 4G1EA 3ILPA 4ZX5A 4O58H 4L8CB 1X5HA 3IGLA 3F1ZA 4BY7B 3PGZA 2AI0H 3MBEB 1AP0A 2UYLA 4PJIF 1ORSA 4N9PA 3DX7B 1CS6A 4J3WA 2ZP0T 1KULA 3TS0A 5KSAB 5M5WB 3FT4A 3M6DA 3FUJA 5TF1L 3F04A 3HE7C 4MTMA 3EH5B 1EQRA 2HJLA 3ULUD 1QATA 1KRSA 2SDFA 2N8NA 2RTTA 1MLBA 3O4OC 2AV7B 3AWFA 2QFRA 3SGDI 3BAJA 1F4WH 1KPUA 5CR1A 1SDDA 3PYCA 3EHBD 1GVIA 3CXHJ 5J1AA 1GHKA 3S36H 1CVSC 1FIGL 1MCFA 3Q06A 4JGUA 1JGLH 4ZD3L 1HC1A 2J1XA 1T1ZB 3GM8A 3QPXH 4GQQA 4HS8L 5SWSE 1YNND 3N41F 2NSMA 1A3TA 3TVMD 4YDMA 2N78A 5M5XH 2ZSWA 4P2OA 3IJEA 3GDEA 4IBQA 3PV6B 1D9KA 4DXFA 4I5BB 4Y7MA 3Q23A 4OJYA 1TENA 3FTVA 4XNMA 3NABL 4FQXD 4WHTB 3DGCR 3D4YA 4XMKL 3TNMB 2Z8WC 3RUGF 2BINA 1G0XA 5JYLA 4MJ2A 2NUPA 4Y4KB 5HDLA 5F1NB 1JNHA 2L9HA 5DSCA 1Y69U 2EQDA 1A7OH 1DLHB 1T0PB 5BR8L 3FBKA 5AW1B 5C0GA 2DKUA 3DEOA 2NY4C 1BYPA 5GGVY 2H26A 1DE4A 3DX9B 5IVXF 4DVRH 2QBWA 4K3EH 4FG6D 4PGCA 5EF0A 5K39A 3ZYZA 2WXMA 1V3JA 1NWOA 4W1TA 4PJGB 2JNZA 2BHFA 4JGNA 4U1JB 3IU4L 5HP5A 3B2UD 2CK0L 2Y23A 2C3WA 1SYDA 3NSYA 4DP1X 5E8DL 5IMKB 4RGOL 4YXLL 2YPKB 2EDMA 3VRJA 5EOQL 3CCQA 4BA2I 2VDLH 4H0IA 4QRPD 3U9OA 2DWSA 3AMLA 4GSQA 5DD5H 3VWJB 4TNWK 2GTQA 4ODTL 3NUCA 1IAIH 1H8OA 4PS4L 1EBPA 4TVUA 3JVGA 5EIQA 3MRCB 1HCFX 4UWQB 4MJ6B 2WCGA 2A77L 2WBJA 3CDFA 2JB5L 1KG0A 1JTTA 4Y88A 2WN3A 3QIBD 2A83A 5CD3A 5J8OA 1GCYA 1U0LA 1EY5A 4P06A 4ZW6A 1WCMH 1HE7A 3CHBD 3F58H 3FOLA 4F5CA 1MHPL 4NPYA 3V0VB 4Z3JA 4NNXA 3UTSD 1BBJB 2DTMH 4H20H 1BX2A 3HC0A 2FEEI 4TVPD 3OR6B 1NDMA 1XIWC 1KSRA 3T1FA 1XMWA 4FTDA 1IBMQ 1OZUA 4KK7A 3E1ZA 1FVDB 5I71C 3J7A5 3HNTH 3KZ8A 2CH4A 4PBXA 5IKCB 4BBRG 1FL0A 4NI6A 3EFOA 3FB6A 3AW5A 3ILDA 2H1LM 5L4FA 3URYA 5CINH 3F84A 1GZHA 4WGKA 1P5VB 1U95A 3KXFB 5F7UA 5IROC 3M1BA 2K5NA 4UIMA 5J13C 1TPXB 1CQYA 2Y6TE 1TMQA 3QG7H 3GDBA 4LLDB 4N0RA 5H94B 5B3JE 2CO7A 4PMCA 3OZ9H 3G08B 1OAYL 2WBJD 3DSNB 2ARJA 1E24A 2Y0SE 3A6CL 3T65A 1NCWH 4HIDA 2RB8A 4XBGA 1H3WM 1FFPB 4JI5Q 3RZOB 4P3DB 5B1AB 4RSYA 4IS6B 3I70A 5HHXL 3RKDC 3SE3A 2J5WA 2JI3A 3IFOB 4EQ3A 4WI4A 1DBBH 2CO7B 2PQEA 4Q6IA 1LO0L 2C35B 2JSOA 4OELB 2J6EH 5MERA 2PW2B 3ILQD 5IUCA 4KVCL 4L23A 1P6FA 1CLYL 2JQZA 3CN0A 2R0KH 4XNYH 5I66B 2VR4A 1L7IL 2C1OB 1KN2L 3GS4A 1M71B 3MRFA 4NQEA 3LKSA 2K6WA 1DONA 4XX1E 1V3LA 1Q0YL 4FHKA 4A76A 4UNTA 1Q9OB 4NQCD 3SY0A 4TLSA 4UCFA 1EEQA 1XR8A 5KTEH 1SJED 5LMUQ 3BJLA 2WN2A 1UZ8B 2EIMB 3TPUB 4C3IG 3VYRA 4JFED 5KVEE 4Z8FL 1VADB 5EMYA 4A3CG 5SX5H 1VERA 1G6RL 2MNWA 2PYFB 2X4QB 3GFUA 5GSVA 1LTXA 1UD4A 4KKAD 1F77A 2MQGA 4KKLD 2UVEA 3NK4A 1EHNA 1KXVA 4ZMPA 3KPPB 2VMDA 3WS6C 4JI8Q 3FKUS 2QDBA 4MA3B 2UUCQ 5I6LA 3C6LA 3X1BA 1KTDA 2HLFD 4LF6Q 4JFQA 1WBYA 4J8RA 2K1BA 1I7TA 3GIZH 2EYSB 3DRTB 1QHOA 5KW9L 5GZOA 4L05A 5K9KA 3ARBB 3SOBL 4Q0XL 1EAOA 3ND9A 4R96B 2XDHA 3RIAF 5EZLB 4Z7AA 3V0DA 1R3JA 1ZYRC 1IM9B 1N67A 5EOCL 5ADPH 5J0BA 2C3VB 3SKJH 5JO5A 1N33L 4IOSD 5C4HA 4DKEL 1GZHC 3ILEA 5HGAA 2CH4W 2ZP8A 3HS0B 1F4XH 4YHZH 2AUKA 1BIIB 2C34A 2BA0A 3MGOB 4N20A 4NKDB 4UBDC 3BWSA 3FFCA 3TT3H 2ZSVA 3QFJB 3EDKA 2FATH 5D1ZI 4BELD 3LRLA 4BCXA 1CG9B 4JFEA 3VR3A 1HZHH 2OR9H 1XNQQ 2PYEA 4O4YL 4R84A 3RGVD 2YTYA 3PFUA 4JM2F 1M1XB 4YC2B 3E9HA 4HLEA 4PG2C 3MLSH 3OMAB 3DJ9A 3ARDB 5E6SB 2DLFH 4GLVB 2HP4A 4JDZB 4LIQH 1QE6A 4ZO9A 3SPVA 1Q81C 5K93A 3ZDZE 1IBGH 3MRBB 3K0XA 1JGUH 3TP5A 3HI5L 1LO5B 1E9OA 4MHHG 1J10A 4IO9A 4A3CH 3BGFB 2EDKA 5D9SB 4JI4Q 5JJKA 3F7QA 5HI4D 1FAIL 3O6FB 4JM4L 1R34A 3HN8A 5IK3B 5C0BD 5F9WB 5HGBB 1K83B 5A2LH 3C2PA 1ZXKA 1GXEA 1F9SA 3S36X 3ULVH 1RUKL 4LOEA 3VD3A 1LT5D 1OXVA 3K7UA 2FNWA 5IYBG 5KVGE 1K4DB 2VCOA 4ELKB 4JUTA 3IMTA 1XB6A 3C1FA 1NTDA 1H3PL 4PJEE 3QNYA 1S9KC 2WP3T 3VFVB 3I75A 4ZOAA 2EDGA 1F3DJ 2CDEB 3EYOB 3NA9H 4V1DD 3SGEH 1WICA 4L2YA 5HHQA 1IU1A 1WAAF 5E2UL 3W82A 3PSIA 3MRIB 1OGAE 3CFDA 1NSNL 4ZUWB 3QAZB 4HJIA 1T5XA 1RJLA 4RAVB 4AYBG 4GMTH 4NUJB 3UACA 4AMKH 1XMOQ 3IAPA 5I17A 1KNOA 5I9OA 4GOPB 3L3IA 3MBWA 3OJVC 2AEQH 2FO8A 2XTJE 3LCYA 1I31A 3I2CH 1F4WL 4NO2A 5F88B 4AUJA 1Y14B 1U8QA 5F70A 3QIBB 4IOIA 4JY5L 4YHKH 3TN0C 5E6ID 3QHFL 4ZTPL 3VXUE 3VTMA 4UQ9A 4FTVB 2ZKXA 3WEBA 3MXUA 2QPUA 1I1YB 1U8IB 4TKOB 4I1NB 3SDYH 1QRNA 4YHHQ 2NOYA 3DWPA 1GJUA 1AC6A 4GOSA 4HSQA 2ICCA 2C7FA 3H4FA 3OMCA 5I6MA 4ZMAT 4EZKA 4I48A 1DL7L 4YDLB 3GMOA 1PS3A 4EUPH 4HIJB 3ZGIA 4DKFL 2O61A 1P4UA 3KGSA 4B3RQ 4M7KH 2MHAB 4OM1L 1TXYA 1AGFB 2L4OA 4F3FB 1RJTA 4Y7NB 3DMMA 4JFWA 1PH1A 3TBWB 1RZJH 2Z34A 1OCZB 1IGJB 4JCLA 4O02H 4DHLA 4DPAX 4HSAC 3NH7H 1U8CA 3UTTD 2OQKA 3MZ5A 1WTQA 1S7WA 1WSST 1F2MA 2HFFA 4ZSOB 3OKLA 4PJIE 1AAJA 1NOFA 3LPFA 3MRMB 1NKOA 1WH0A 4UT9L 4YSQA 1MCNA 5ITBL 3U82B 4AIXA 4AYFB 3VXSE 2X69A 3CXHK 1X5AA 2GVYA 1G1OA 4H88L 2IDFA 5ANMA 3LEXB 3WKMH 3DWTA 1SHMA 3QJOA 1JCKA 3BVMA 4J6IA 3UJTH 3UTZA 3RFZC 1ADQH 2E7LA 3ZT5A 1WP6A 4F58H 2WBJC 3NQIA 4YDZA 2J4WH 3S35X 2FIRT 1B3IA 3D48R 3LN4A 1XF2A 4DFHA 3W1BA 1A7RH 1EIHA 1M4VA 2IT1A 1NC4A 4P04A 5D9SA 4DV1L 4ODWB 2X05A 1ZS8B 5IP7H 2CO3A 1TQBC 5F7KC 2PW2A 1XDTT 3PGFL 2H3NA 4OCWL 4FQPA 1I50B 4D3CH 1C5CH 2MKLC 3VFGH 4KFZC 4RMWA 3GUFA 2GFBA 4Z7QF 5CGYC 3BWAB 4I3RH 4GG8B 4UTAA 4UOJA 3FO1A 1Y0LB 4HAKA 5AUMB 5CUSL 4MJJA 4JRYA 5C07A 4AYGA 2GY7B 3HR5B 3K81A 1QSVA 3QBTB 2F8OA 3QZWA 4NB7A 4S0TD 1FZKA 4L63B 1NCCL 1AGEA 2VLLA 1D9KD 4GBXC 1A4AA 5ISZE 3UTSE 3L5WB 4YHPB 3IBEA 2GSGB 4GFTB 1S3OA 1GGCH 4YHOH 5B38B 4G7OC 2B3IA 1D5BB 2XZAL 3CZNA 1JWSD 1QG7A 4BA1I 1CFNA 1WZ1L 2J8UB 2BSRB 2W5PA 2Y22A 2Z4QB 3DXAA 4XP4L 4PRIE 3TF4A 3EBAA 1PZID 3PAUA 1NGWB 1RK1A 4E9TA 4FKEA 4QRQB 5JIMA 1WCBA 1UOWA 4BBSB 4UZSA 1YNJD 4RHRA 2E3VA 5AJ3Q 1U36A 4PJFB 5JJLA 4FQXB 4GRWF 1VQ7A 2Y5QA 3RGBA 3JTSB 4LO9A 4QYOA 3GMNA 2HIVA 4JQVA 5C0AA 1T0NA 3V4LA 2J21A 4RAUA 3ZBMA 4DAMA 1B6UA 4W4NA 4LWCA 1JPGA 1J8KA 2OSYA 4EUPG 3FCBA 3A6CH 1N2RA 1UEMA 1NCWL 4ZAKB 4EDWL 2NTSA 2DI8A 3CQZH 4F88A 1ZXQA 3KPMB 5DVOA 5F96L 4R90L 5LUMA 4TSAL 3C46A 2EPBA 2LU4A 3MJ9A 4C3JG 4PJFA 1OAZL 4RX4D 3MNZA 3LNEA 5ILTL 4NM4L 2WIIB 1ZD6A 4JHZA 1M6UA 5F44A 3KVDD 3ARSA 4KHVA 2WXQA 3IJ9A 2WAQG 1IKFL 1IFHL 2EE9A 5EBWA 2AAAA 4RCNA 3G6JA 3KLHD 1BAGA 3OQ3B 4ZK9B 3ZDZB 4QDGA 4P48A 4LSQH 3MHBA 4XWOC 3FH7A 1H8NA 2YD4A 4XMLL 1I6HB 2D0PA 2AW2A 1SPDA 2B2VC 1HCVA 4QRPB 4HZAA 4XCNB 1S5ED 4JL2A 1R24B 3MN8A 3QH3A 1EA9C 4F33B 5C6PB 1LO2H 2GBUA 4I4WA 4YHLH 3VFPB 1I6HH 1TQTA 1A8ZA 1CXHA 3CLEL 4APXA 4MRBA 1M3JA 3CMOL 5TPWL 5DS8A 2JKRM 5E9AA 3T5WA 1KLGA 4D9QD 4X6CF 3NIDE 4EOWH 3SK6A 1RL1A 4HUXA 1XF3B 5HJDA 4GI6A 1W8EA 1G9MC 2HVBA 2VXSL 2DKSA 2NVXB 1MCOH 4YDIH 4DGZA 4F8PA 1ND0B 4NUPA 1JYWA 4A4IA 2XG4B 2H47C 1H3VA 3CPLB 3IJSA 2NXZC 2EH7L 2OTUB 5DQ9A 4XP5L 1AQ8A 3VXRE 3CFIC 4U3CA 1ZMYA 2BCKA 1ICWA 3QUZB 4NN6C 4A2HA 2YXMA 4RWYL 4L9LA 5SX4H 3WMQA 4OLXH 4AK2A 3SPGA 4ILDA 4FTVD 1ZTXH 3UBHA 3ZL4L 5IKCA 2YQGA 3BAXA 5JQ6H 4P5MB 4OXPA 2X40A 3L5XL 5D7LA 5E7FA 3SKJL 4XP9H 2QPSA 3GSUA 4N2GA 5IJDC 5J9PB 3B8YA 3RZWA 4E42B 2QCPX 1KB5B 2ADFL 2N56A 1QLEL 3MJGX 2JI1A 5AW0B 1EJ6A 3EYSL 1XF4B 2ZNXA 4JHBA 2OSLB 5JHBA 4KUZL 1RD6A 1YEHL 3VXNA 1BQUA 2PR4H 1WFUA 5IE8A 1K0RA 1INQA 2F08A 3HHSA 1UQSA 5L2KD 3OSVA 3R1GH 3RWFB 3QDJE 1QI5A 3K6SB 1J5IA 3MRLA 1UOKA 2VDRH 3GO1H 4PS7A 5D2NE 5F7YC 3OJ2C 3MRJA 5IYDH 1IEBB 4PJXF 3ZK0A 2MWCA 3IGFA 3SO3B 3R0MA 1G51A 2X6VA 2SNSA 1QBML 2EILB 3JAMi 4YFEA 1QZNA 2K7VA 3SQBA 3LDBC 2F0NA 1H5BA 3QJHB 1AXSB 3S0PA 2ZX7A 3EFDL 4X62L 1GYAA 1SOQA 4YX2L 2NXZB 3P2BA 3VR5A 2GPZA 2QKSA 4JO2H 4JW0A 1MJJA 2ENJA 4UQIM 4Y5YB 1AW7A 2ZOTA 3MZTA 4XVOA 1I4HA 2XIWA 2PWEA 4FI8A 1INDH 2F53B 3TFKC 1S3KH 2KDGA 1M1KC 4QEGA 4C3IB 1T9HA 3S3BB 5C8JA 4FO2A 2OP4L 1WD1A 1ZGLB 2JA8H 1U30A 5EU5B 3B7TA 1LEKA 5ICYA 3NACH 5I1JH 2JCCE 2DQGL 2E46A 1NUGA 1P7BA 1V7ML 2P44B 4DKDC 3OKYA 2D62A 2LVCA 5IEHA 1FRGL 3O3BB 4L0YA 4H8VA 3NBHA 3KVPA 3ZDXE 1TSHA 3CFNA 2KVMA 2P9RA 5CV9A 3ICEA 1UWEL 3HC4L 4BCZA 4IIZA 3LJ3A 2P5ZX 2VUYA 1SLJA 2Y2YA 3ABGA 1NDGA 1TZHB 2BWDA 5HGBA 4OCSH 1AE6H 2JF1A 4M43L 2NT0A 3NN8B 5FPIA 5AW5B 1W8OA 1RZIB 1CN4A 3PV6A 5AYUH 1I3GL 2BZ7A 3V6FB 2Z3FA 3ARBD 3BUYB 2F3VA 3I4MH 2EP6A 4WWKC 5DZJA 4ELKA 1C16B 1S9WA 2RFXB 2LMCB 2B0SH 3KJ6L 1NC4B 3T3PE 3HG3A 1B4TA 4U6YB 1D6VL 5IESL 2ZKHH 3NDYE 3PABB 4XGZB 2VS1A 1NJIC 1A9BA 4QOKB 1JWSB 2PYKA 3CDGA 3K7AH 3C60B 3UJTL 1ZDQA 1MCLA 3MX0A 5INDA 4HIEB 3R8QA 3BWZA 2X88A 3K8MA 3QR0A 1KZYA 2H5UA 3F7LA 3N3EA 3D69B 4G3YL 4NZ8A 5ANHA 3PDGA 3I4NB 1S9VB 3DSFH 5J13B 4UQ3A 4DTGH 1YUHB 4QHKI 5INCA 4OLEA 3WJJA 5I8CA 3DPBA 1HKLL 4XCEB 1XIWD 4KJYA 1FA4A 4FG4A 1XO8A 4DGVH 1RU9H 3HFFA 1MCDA 1SOXA 1UXWB 3U46B 1BBDH 3HKZG 1HA5A 2GCYB 2R93H 3IJ8A 4NQTA 1QQDA 4ONGH 4ZAKD 2ED9A 2IDTA 2LTQB 3W38A 4OEMB 3OW2A 3O8XC 3OPZH 4NO3A 4ID6A 5AVYB 4FCHA 1PH9A 1R5IA 4HS6B 4LLUA 4OF6A 1HHKB 1G87A 4KX8A 4H8WL 2PCFA 3SDAA 3U1PA 1BF5A 2YXVA 1XVSA 2AJUL 1ADQL 2FBJL 2XBTA 3KPMA 5TDPA 3SD5A 5C2UB 3MLTA 4N8VG 2J4WL 2COVD 2PCPB 2AJXH 4UY8C 1QPXA 4MFHA 2R59A 5F1IA 3S14B 1HEZA 3DECA 5TQ2L 3HOWG 3ZTEA 2F0IA 2IWKA 3HP3A 3NCJH 4JRYD 5C07D 4OQTL 3BP7A 4NBXB 3F5WA 2JFCA 3VGDA 1ASZA 15C8H 2RIKA 3T3MF 4LEEA 4BSVB 3HKSA 1X5IA 1EOVA 4RGMA 3BI9X 3J07A 5DRXA 3HMWL 1QKZL 2FHFA 1SXBA 4A66A 5FIEA 1TT6A 2I60H 1YPZF 4YDVA 4NO2B 4DVBB 4A7GF 1SBBA 2WQAA 4MXWH 1WGVA 1TO5A 3HE7A 4FRWA 4QHNA 5DEGB 1X55A 3MUZ1 1R3HB 2J8OA 3B37A 5KG9B 4RFNC 3D2UA 2QGBA 2I07A 3NIDB 2AXWA 3HLKA 2H9GB 4K7PY 5DURD 5JA8B 4XTCS 2OSXA 4LF9Q 5KSBE 4KTYA 3AVEA 4YCUA 3GLEA 3HS0A 1KDCA 1D9KC 4UDUA 2CNYA 2X70B 3ATBA 1ZLUH 2RHEA 4NFDA 3UGXA 4W93A 3L4VA 2RQEA 4L1BA 3QUGA 1FR3A 1ESRA 4FQIL 5LDUA 5BO0D 2IX0A 3KBGA 2CO4A 3GF8A 4KROD 3BRGC 3TH3T 4WNQA 2GFBB 4B08A 5I9QB 1IFRA 3K7AB 1HTLD 2IG2L 2BRQA 2C5DC 2ESVD 2R8SH 5CZVL 2MQ0A 3TWCH 2NTFA 4X6AH 4EN3D 2B63G 2VZ3A 3O4LD 4QKTA 1UQSB 3OZKA 1K8MA 3QG7L 1AQDB 1J0ZA 1BQQT 2VM3A 3W2DH 1U0QA 2N0MA 1RPKA 3OHXB 3I6LE 5JTWA 4KKTA 4C3JB 4PRAA 1ZKOA 3ZHNA 4NUGL 3CXDH 3QULB 5KVDE 2GUOA 2A6ED 3LD8B 2IHFA 2PXYA 5DD6A 2E7BA 3TYGL 1M71A 3WD5H 3QEQB 3LS4L 1FH5H 2XYBA 1JN6B 3RL2B 3CDZB 3MRNB 3ULVD 2E27H 1YLBB 3V7AE 1RURL 4U3HA 5BO1L 5EO0A 4DKTA 1IIIA 4JFFE 3BWAA 4XPGH 1E4KA 5I5MA 1S5HB 2BVPA 2F58H 3SGIA 3RY5A 3VFTA 4F7PB 5I6NA 4JNXA 3SDDB 1RODA 1PDKA 1DZBA 2VIRB 2TSBA 4XP9L 1O7DC 4Q9RL 1YEWA 1AC0A 4W4OA 4W9GC 3WIFB 1KXLA 3MRNA 1SHWA 2WTPA 4YPGA 4XO3A 5GGSY 5DUPH 2K33A 1YEHH 1DQJB 3ZIMA 3C75A 4QRRB 4F27A 5JDSA 5HYJA 2BP0A 3WO4B 1GKHA 3CZLA 3DO7B 4PCTA 1RUAL 3AFLA 4CUCA 1F90L 4DOHE 1ET5A 4NYLA 1O78A 4A6YB 8PAZA 5KBPA 1ZXTA 3QQ3B 1KIRB 1KPRA 1DDHA 4BH7B 2R39A 4AMXA 1G6RA 3PWLB 5C08E 4OLXL 5M3MB 4G9DA 1S78C 5D7JC 2AMCB 4PLJD 4Z3HA 3Q8CA 2IALA 3BN3B 3IFNL 4D8PB 5CBAB 3DX1A 1ACCA 3OLEA 4GQRA 3D30A 1CLZH 5C4JH 1Q94B 1HHJA 2YTXA 2K9FB 4XOCA 1KB5H 1JZEA 3FUHA 4XDXA 2ZKYA 4FXGC 3T09A 3C1EA 2I32A 1UWXH 2F54B 3M8OL 4JVZA 4W9ZA 4ZAKA 4HIQA 1VENA 1PX8A 3OVUB 4DV3Q 4PTUA 4DT2A 1PZKD 4EOWL 4PJAE 1BQHA 1VFMA 1CSPA 4POGA 3HUJB 5BMFL 4LSUH 2XC8A 3BXNA 3WYRA 4EBQH 3EAKA 2A2QT 4DP8X 1MAKA 1A4KB 3INOA 3UBFA 3IFPA 5ITFA 1T5WA 3VD9A 2EINB 5KBNC 4O9HH 1MFBH 3RURA 1YNKH 3GK8H 3QC6X 2J20A 1OB1B 1TFHA 3SODB 4RNRB 1B6DA 1DQVA 1NEZA 2Q1EA 1K72A 1WPCA 1GGTA 4AYSA 3TS8A 3I9AA 4BZ1H 4I2XA 4DUYQ 1WZMA 2G9DA 1OGAA 2Z6KA 2H26B 2ICWI 3N91A 3NEMA 4U2YA 4ZW3A 5IFAH 4ODWA 4LSTL 1P2CB 5CYUA 2XPGB 2K5VA 4IBZA 2UVFA 5C0XJ 1INDL 1QNZH 5F3HA 1JHTB 2YWYA 3NAAH 2WLHA 4NO3B 5B38G 1NPUA 2B08A 2B1HH 4ZUWA 3W0WA 3JWDL 4U1JA 4YHNB 1YNTF 3RUZA 2F1MA 1D5IH 3BP7B 2A0LC 3LH8A 2HTLC 4XNMB 3VQ1C 1VQMA 4A04A 5JPNC 2NVYH 3EA6A 4X62Q 4ZDHB 3ZPDA 5IVZA 5L8LB 1BUVT 1X9NA 5IT9L 3EJRA 1CCZA 3II3A 2IAAC 5LGYA 1U4MA 4K5MA 2V9QA 1TWGB 5ESAB 2OL3A 3FSZA 3S14H 3JVFC 1B0IA 2WCSA 3B9VA 4B9YA 4L18A 4XVJL 5IUSA 3F7YA 3RWIB 2VQEQ 5E5MB 4Q14A 4JV5L 5FF6A 1FVCA 4GBXB 1B44D 5EJWA 1ENFA 1TKWB 1PH6A 1T0MB 1SN2A 3U0PB 3KJOA 2O4EA 4PB9L 2MCPL 1JYVA 1S4ZA 2AQ3B 2B2WA 1AIFA 3FQXB 4NQXA 5F3BA 1Q7YC 2JA5H 2Q86A 5EEYA 1JV2B 4L29B 1AJ7L 1USZA 4HIJA 4PJCF 4AVIA 3OX8A 4KD3A 3S2DH 3P4OA 4Y5XA 2EYFA 4UDUB 3GTPB 2OSLA 4OF8A 4FAAB 1XIWA 5LJYH 2JXMB 3H9SD 3GKZA 1OQXA 4BKLB 1OGTB 4A3LG 1FGUA 5ELCA 1KJMA 1OXYA 4WWKD 4MIUA 4DPGA 1QPPA 3IDIA 3MX0B 2H4OA 2UYLB 3I4NH 1LK3L 4GUQA 3CXCA 4B3ML 3PIOA 1I1FA 5CZXC 4AT6A 2PCXA 5I1IH 2Y0SB 1RUPH 2CO6A 4HBQA 2WYHA 4FFVD 4JL1A 4OQTH 3ARQA 2P8MB 5BOPA 1T6WA 1N36Q 2F2HA 2OF1A 1EJOH 1S9YA 3A24A 3Q0HA 4OZIF 1SNRA 4HIIA 3WDIA 2X4SB 3JUYA 1WCQA 5FW7A 3LZFL 2O5XL 1RZFL 3ELAT 3FRUA 1SSOA 3L54A 4L1HA 4CDHA 2UV3A 4KKLC 3I9GL 4Y4KA 1YJ9A 4GO9A 4KJQD 4A38A 2ITDA 2XQYG 4OO1I 4S1SH 2YPLA 1AXSA 2EDEA 3BKCL 5AFAA 1A2UA 5J1ZA 5DQDH 4U68A 4UTAH 4OGAD 1FFNB 3UAFA 2CR3A 4KTEH 5FX3A 4PY8I 1RUQH 1GGUA 2HX9A 3ARGA 2GIYA 2YD7A 4FP8L 5HD8C 4YSSA 1TQCC 4X0NA 3GTMH 3IRBA 1PY4A 4I89A 1XGQB 1RZKH 1JE4A 3UE0A 4GIPD 1HL5A 4Z0BH 3TV3H 4OGQC 3V6BR 2LAGB 1ENAA 4LCWE 2C9UA 3M1BB 3TU6A 2X6GA 3G5ZA 5LHDA 4ZFOA 1RUMH 1D7CA 5EO9B 2W59A 4FL4C 5CZVH 3BT2L 1XV8A 3MDJA 3TBSB 3INUL 3TBYA 3K4ZA 4NB3A 1YJNA 1ZHLA 5JIHA 4HD5A 3J7YW 4H5SB 4PV8B 4JG1H 1LP9F 1PEWA 1QFPA 5A2CA 1FV1A 1LVEA 5I75B 3TEHB 1DN0B 4NYLB 4A6YA 4N90D 2EYJA 5HYEA 4J3SA 1GOFA 1XH0A 3B9KA 2B2TC 3I3CA 3CMGA 3LB6C 2IVFC 3QJZA 5FWQA 2HVJB 3FSWA 3IDYB 3HHMA 4QOKA 4QHMB 4RGMC 1NKGA 1R0AL 1Z3GH 2BJML 5BS0E 3I4LA 3NJJA 1MNUH 1U4PA 2HLAA 2OR7A 2P1YA 1HXYD 4PJCE 3DHJA 4Z7VA 3OPUA 1KTCA 1TCMA 1J1PL 2ZCLH 5D70L 2P47B 2GEQA 2V7HB 1HZBA 5E95B 3SJVB 5MEPB 1EO8L 4KBPA 3DOSA 4ODUA 4RFOH 4D2NA 4G9DB 3OYYA 4ILWA 1SFOB 5A2QE 4IOFD 4UAOB 3F2BA 4TULH 5C3LD 5GSRA 1AYOA 2X3CA 4QXVA 2A73A 4CGYB 1G9NH 2J44A 1ITBB 2W9EH 4HFWB 1FIEA 4X3TA 3N1QC 2F54E 3G5XB 2I0QA 3MLYL 4LOVA 4NJAH 3F2CA 4RRPG 3RFZA 1JGDA 3Q2VA 4OVUA 1FZJB 3I84A 3H0TB 3H8NA 4JFYA 3T1FB 3NHHA 3HLAB 1SNDA 1I3RB 3VXMA 4QXGL 4AMWA 5E1HB 2EVJA 1FIGH 3VYPA 3X3NA 1AG0A 5D1QD 5L9DH 4HS8H 3TM6A 1BSIA 2BH2A 1R3KA 3LXCA 3RVVD 2F68X 3DKHA 3G9VA 5E00A 5G3LD 2NT1A 3KM1A 5T5FL 2R9HC 2V5MA 2CR0A 3C09B 4WCYH 5DO8A 3HRZB 5F1NA 5I2IA 1T04A 4WFHD 1SYBA 2YFOA 2DWDA 5CN2A 5JPNB 4OIKA 2A19A 1Q9KB 2FGWH 2G5BA 2IGTA 5K9OA 3QO1A 4J5VA 5TF1H 1UB6B 1ZVYA 4FERA 2XUWA 1UOVA 4IURA 4MHEA 2FWOA 3ASWA 1HKLH 3CPUA 4DV2Q 4J3OF 3DIVA 3FUIA 5C0CE 4FF9A 5DJXB 3LZLA 1DCEA 4BY1G 2WQXA 1ZLWH 4HX1A 5BZDA 4K94H 5GHWL 2Z91B 6TAAA 2WVTA 2W07B 1EHLH 1AHWC 4JFDE 2EZVA 1Y1VB 4XXCC 1AR2A 2D73A 2NY6B 2EJGC 4K3EL 2YEZB 2DQJL 1MFBL 3IRPX 4S1DD 4A93H 3QQNA 3GIZL 5EO0B 4QB4A 4M1GH 5ISZD 4XMXA 4I0CC 2VDKL 1HINH 4U1GC 2J6WA 1JWUD 4IRJA 4JQXC 4X5RA 4Y5XC 1J18A 1CA6A 5FHBL 3N5AA 3MV9D 3T56B 2Z93A 1JB7A 1L6ZA 4GKZA 4ALAC 4AQ1B 4CILA 1F4XL 2VAJA 4DK5A 1FVIA 5ISRA 3GIVB 1BCPB 3Q6GL 3KYAA 1KB9K 1ILUA 4LSPH 1EYAA 3V79C 1BAFL 4NC0B 3RA7H 4WZ9A 3EH4B 3LHPL 3ZDYF 4JPBW 2YC1A 2EE6A 4UI2A 3UL4A 3LEYH 5IB3B 2XTJC 2HQLA 4HJ5A 2OTWB 3S2HH 1HR0Q 1MEXL 3HFMH 3S34L 3EYFB 4WHYH 2B5IC 2GB2A 1JI2A 4I9WD 3KK7A 1K8OA 3SDCA 5J06A 2V0AA 1IQWH 2IDQA 1JOQA 3OLGA 3TBIB 4ICWA 5B1BB 3CTTA 2A6DA 2X44D 2EC9U 1CK1A 1P5UB 1TZ8A 3S35H 4AEIH 2EUXA 2EJFC 2Q2IA 1QNZL 3F6IA 4GP8B 1ACXA 4P2AA 4RMVA 4ZUTB 1WQVT 1CLZL 2VDNB 4KTDL 4QHKJ 2IIJA 1T66D 2DH3A 2X0UA 4URTB 4FLOA 2YD2A 4AQEA 3PXJA 2BNUB 1JK9B 3SDZA 1GS7A 4XE0A 3HOUB 2QSCH 3B5TA 3DUSB 3E0JA 1OPGL 1BJ8A 3J7AF 4ODVL 2K1MA 4HCGA 2CJUL 2ICWA 3KPOB 4CW1A 2ADYA 1NFDE 4D0DB 1K5WA 3BPLB 1OAQH 2OQJA 5C0EB 1AY1H 1MREL 5LVEA 5EF3A 5DJ6B 2XPZA 2JK8A 3S1RH 5DLLA 3TO4B 2A9MH 2A8VA 4ZRGA 2R6GA 3FO9A 3FTSA 3Q43A 4OBRA 3BD5A 2NNRA 4HD9A 1JPTL 2DIBA 4QRBA 3CVIH 1YYML 5M7QA 3SYPA 5E1IA 1HR0W 2PYED 4X80L 4IIQB 1PRTF 2X9WA 3OGOE 1YNNC 1RTNA 5C0RL 3TWYA 3N42B 3PDOB 3OJDB 4I3GA 4FNLH 1N0XL 4TMPA 1Q12A 1CE6A 5CSBA 3D3RA 1KIQB 3PIP3 3CIQA 4MJID 2CA3A 1NCHA 3HJ0A 2DQHH 1S40A 4PRHB 3FRPB 2I25N 1EXUA 4QJ5B 1PLCA 5B38A 3WY2A 3BPOB 4N8CL 1IILE 3AWGA 3ZE2E 4JYAL 2IPUG 3EDDA 3UYOD 1FO0H 2KLTA 1PYSB 3BZCA 4Y7NH 1MRFH 3AROA 5L0QC 5IQNA 4K9JA 3MFFB 1M3IA 5I1IL 5CCKL 3K5OA 3AS0A 3JYBA 3ZQ9A 3GJFK 1HEHC 1CE6B 1ZANL 1T5XB 3AB9A 2Y0SA 4IM8A 4NCC2 1I4GA 1OHZA 4LHQB 1JHLH 1GHFH 2NQCA 4HHAA 4IDJL 4HOZA 1DBBL 2HJFB 3OAYK 5KJ7E 4W9FC 4AKQA 4KH9A 5IHZA 3GHBL 1JZ2A 1FC2D 5GJSL 2KYIA 4JFZL 4ZKBB 3DOIA 3IAYA 4XMTA 1KABA 5AAMA 1JMXA 3II2A 1F4AA 3SQRA 1U5KA 4B3MQ 2ZM6L 1L7IH 1HX0A 2O5ZL 3CKIB 2AJSH 3ES6A 4FQJH 4LKCA 2G2RB 1HL4A 5JHDE 4MKTA 5T1DH 1NCVA 2D2CC 3UZEA 4KK6C 4U0QB 4YSEA 2XWJB 2VQ1A 4DP4X 3V9FA 2ZIDA 4MAUL 2JCCB 5ANMB 1X6LA 2RR3A 5HI3C 5I1DA 5KYYA 2R7EA 3QHZL 1L9OA 3DEPA 3O8XD 2R69L 2KC0A 1DO5A 3IDGA 2F4IA 4YBLC 4EIUA 4FZEL 5GS0L 3NCJL 4IJ3C 2E7CA 1BOYA 2NR6A 1MSPA 3EOBA 1J8RA 3GD1C 4XMKH 4ZDHA 1ZLSL 4A3EB 1ZVSA 1KXQA 2NUTB 1F58L 3EJUA 4Z7WE 3UDWC 1K2DA 3TYFB 3WNJA 3BRFA 1YRKA 1KN4L 3MROB 2YLKA 3Q5OA 2X9ZA 4X6DB 3T6XA 3KDMB 4N0UA 3FHEA 3SYAA 2V9RA 4NIYE 3HNSL 4LDCA 4EI6B 1WBYB 2CIIB 2UUDK 4GB9A 2ISDA 1O7IA 3H55A 1O7VA 4QO1B 4MD5B 1UD8A 1OSYA 1K28A 2XWBA 5DMIH 5JW4R 3CVHB 4P71A 3AYHB 4JI0L 2B16A 4R96A 2F0GA 1FSKC 2OMUA 1PQZB 3ZHDA 2HFGL 2J25A 3EJYC 4C3HG 1NAMB 1VADA 5M5YH 2XZCL 2BFVL 4M1CC 5FA3A 3LWEA 5GPRA 5IJVB 1JZ4A 4PREA 2XV2A 1FLTX 2OI9B 3DTXB 1H9JA 2AEWA 4NKDA 1I7ZB 3QH3B 3ZIYA 3KJPA 4F33A 3UC2A 4JFEE 4BFFA 2MPAH 2DEXX 1JR0D 5HGHA 3RPIA 3SKNB 1H9VA 7CGTA 5M5XB 4JVUA 2YD0A 3NIGB 1OTSC 1CFQB 2UXVA 1C12A 3WE6B 5C86A 1M7DB 3EH3B 3LXAA 4XP1L 1YAIA 3HI5H 2MGSA 2EXSA 4DKAA 2BVOA 1IGTA 1SDAB 3LVTA 3B2VH 2IX1A 1TZGH 1ITCA 4AGQA 2AEQL 4HUVB 3ZQXA 4FP5D 1CZGA 4LSDA 4U6XB 4O5LH 5GGUB 3U9PL 2CBOA 4FG0A 5A6MA 3L5WA 5DI8A 2BP3A 4BWTA 3X1GA 3J81E 5KSUA 3ZYOA 2Z4IA 2J12B 4NQEE 2WUBL 1CL7I 3CFTA 3NFPA 4C8XA 4BWWA 5MEOB 4OO1H 2QMJA 4NQCB 1GOHA 3S8GB 3UJJL 2DAVA 1WTGT 5FO9A 3ULUH 2DQMA 4JHAH 4JE0A 3TBVA 1VSCA 5DR5H 2ODIA 4ZUVA 5FO7B 4P4RA 4DV7L 2R69A 5ACZB 1KEGL 4OX9Q 3I6GB 5CEZD 5D1QC 5E6IA 1J1XL 1ADQA 2HLEB 4UYPA 2DWDB 5K9OB 4KHPQ 5E1AA 4TS6A 1PYWA 5MEOA 3L2NA 4M7LL 1IT9H 1CT1D 3VR4A 1E5AA 4DN3H 4CADA 3KYOA 4ELMB 5F9AC 2BDOA 2PQAA 1Z9NA 3IPBA 3PGDB 1C8PA 5CMDA 2VR6A 2XKUA 4L3CB 4R7XA 2SODB 3PJSA 1ZK5A 4RIRA 1HU8A 1HYRC 4KTGA 3WKPA 4BFIB 4F8QA 5EU6B 4ECNA 5BV7L 3UPRB 1G1CA 4NP5A 3PO3H 1VCAA 3S24A 3BVXA 5TE4H 3ROOA 1ACZA 2X6CA 1BAFH 2X6LA 4EIBA 1IE5A 4YO0B 3KWTA 4NQVA 3FMGL 4DF7A 3MCG1 1KBGL 2WLJA 1VQAA 3HPJB 5KWYC 1FZKB 1Q9WA 2VLLB 3PWPD 4MJ4A 4WQOA 1WF5A 4U1KA 3FN0L 3V0AC 4N8X1 2B1AH 4FYSA 4N9GB 5FYLH 1RJZB 3O6FC 4M02A 2JKSA 1T83C 1T04B 1GKEA 2BCKB 3EDJA 2VDRB 1EX0A 2H1EA 4TM9A 4IQHA 4KUCD 4AQAB 4JI7L 3RNUA 4QNPF 1FNWA 1IJ9A 2VN5A 1I7UA 5IP4A 2R0KL 4XNYL 3P11L 2PNRC 5E2JA 2FT7A 4IBWA 3ZOAA 2IGFL 4P5TB 2KZBA 4ODXB 5T3XL 1JD9A 2CO2A 1RJCA 5I6XC 5H2BA 3D87B 4ALAL 1EYGA 2ADFH 3M17B 1TTRA 3EW3B 2R2CA 3T71A 2AUJD 3WDHA 1LLRD 4M61A 4RMUA 4PLNC 3D09A 2IOIA 1QFOA 4IUVA 3T0EB 2QDLA 2ZAGA 2EO9A 2QT6A 3AAZA 4U1HB 3U36B 3UROR 3GMQB 2DNCA 2NY2B 1L6XA 5ITBH 4KD4A 3GTJB 1BQSA 1PLGH 3CBJB 2XU9A 4OWWB 4HFWA 3WMSA 3RY6A 3ZTNL 3N44B 2GC7C 4MNOA 3HKZA 1ENCA 5FLMG 2AP2A 3WIIH 1XCQB 4YR6A 1H9KA 3S16H 3FTYA 3KPRB 2HTKD 2XN9B 5C0BA 1NFKA 2E2IB 4DZ8B 2R2HB 2CKZB 2H32B 2F0UA 3FDTA 3IU3B 1BYOA 1XWVA 5I16B 3WTTA 2ZWSA 2NN6G 2LQRA 5J22A 1XCQA 1VB9A 3KFUA 3BFOA 4DZBA 5IVXE 5FFOA 4X3UA 4PB0H 4MWFA 4ZFFB 1AI1L 5L2JB 1V1QA 1KF9B 2P24A 3Q6GH 4R4FL 3GTOB 1PKQE 3JWDH 3RI5K 5BRZB 1SXZA 2FINB 4JR9H 5AVSB 4NN7B 4XCCH 5KJRH 1C48A 1N0LB 2W9EL 3MV11 3DM1A 1CICC 2IH1A 2JQMA 4JPVH 3PIQB 3BAYA 4NJAL 5CHNA 3VGFA 1UXLA 2ZPKH 4RMTA 4YWLA 3CW2C 4TL5A 4HQQH 1DUZA 4J4PA 4WIQA 5FGCE 1KELL 5KUMA 2CM5A 2C7UA 2WSKA 5KSBB 3SDCC 2E8YA 1ZPLA 1N6UA 2UZIH 3B34A 1O75A 3L7FB 4JRWA 4LCWB 2YO3A 1S7VA 2CGYA 3VGAC 4A68A 2A4ZA 4DV6Q 4PW9A 2DJFC 1ULVA 1ZS8A 3N43F 3NELA 5GROA 5IY0A 3EO9H 2EQSA 5FR3A 1U91B 4BBRB 2IF7A 1ACYH 4JKLA 3RNKA 3V0HA 4BDVB 1OEZW 2D8KA 4PJAF 1I1FB 4GN3B 4N6RA 1MFAL 1ZGLA 4YO0A 5KGUA 5DZVA 2RSNA 5J1AB 2J7ZA 3SKOB 3E9TA 4YSCA 3C5SB 1HL9A 2HTKC 3E8UH 5AALA 4JFVA 3SDYL 3GXMA 1CMOA 1IBYA 4N9TA 1BFVL 4BBSH 1MVYA 3QXDA 2APVA 1I9JL 2QHRL 3MYJA 4XP6L 3RPIB 4UTBL 2WJ5A 4YDNA 4IBYA 1I9EA 1INEL 3QDME 4LP5A 3D69A 2J3SA 3NRQA 4HHWA 4DV4L 1CT8B 2NTFB 2CIIA 3SPJA 4JM2B 2BSTB 3GHEL 2XOTA 4TSSA 3CMAA 4HR7B 3OTTA 3VCLB 3IMVA 1IEBA 4JYAQ 1U93A 1F5WA 1NGQL 1GO3E 4LUOA 4LDLB 1S6NA 2NYZA 5E4IA 4TSCL 4POYA 1AHWA 5AYQA 5BXFA 3GSOB 2YKLL 3M7OA 1A6VL 1BA9A 2HT3D 5AW8B 4Y2OB 4KK6D 1C16A 2L8AA 1I5FA 4BYHA 4KHTH 1KJ2H 1PFMA 1BQLL 4HAEA 4FHBD 4EI5D 1JK9A 1QACA 3LWUA 3J2PA 1VFBB 3MTRA 1IAOB 3VGGA 1EQTA 1G8ZD 5DI8B 1D6EC 1KV7A 1QD0A 5TGBA 3U9WA 3VXUB 5B8CA 5I28A 1KJ3L 2A74C 5CCHE 2A9NH 3FDWA 2YSSA 4FQ1H 5GS3A 1MHEB 3FO0H 1OO2A 1Z6JT 4WSKA 1B4JH 4NZRL 2GJRA 1TTGA 1E9PA 3PWVA 5CLXA 5SWSB 4MLSA 3UPAA 2XZQH 5SWZA 1TYJA 2XJLA 1MF2H 2Q6WB 2NLJA 1D5XB 1E6OL 1HILA 1SEQH 2Y7SA 1FORH 1G94A 2AK1L 3W9DB 2EY1A 1KDAA 4Z9CB 1XAUA 2VDMH 3G6AB 5EKLA 5EU6D 4BM7A 2NWGA 1AMXA 3ES6B 4LKCB 3SDXF 2AVGA 5IQMA 1KDBA 3KWUA 1E3PA 4L3AA 3FF7A 1URZA 3K72B 1BZ7B 2JQAA 2Z9TA 4IIQA 1KGCE 1WTVA 2GJ6A 2VLJA 4MCZA 4GKKQ 5TDPB 1KFAL 4H88H 1AD0A 2IV8A 3WKML 1P84K 1B3QA 5KTEL 2ZWYA 3KPTA 4U1SB 3L9RB 4NAMA 3COOA 4M5SA 2OKMA 4KDWA 2XY1A 4QWWD 1PZAA 4ODVH 2DJUA 2NW3A 4A2FA 3LNDA 2VXUH 3QIUB 1I8KB 1A3ZA 1PZCA 4J3OC 1RDPD 4NWTL 2WKOF 4Z7UF 1G6ZA 4XPTH 3RY4A 2P5WD 5I73C 3QDJA 2B9AA 5DYFA 1LTLA 4LU5L 4F7TB 1XH1A 3X3GH 1BWMA 2AV7A 1HSBA 3STZA 3FB6B 4JI0Q 2CJSA 3NJXA 5CV4A 2GVBA 4EI0A 3FRPG 4U05A 1BVSA 5D2LE 3K2IA 1OALA 1S7RA 4WVRA 1YZ6A 3FTUA 3EFFB 2NY2D 1OTCA 2ZSVB 2MMXA 3ULAB 3WXWH 1CE1H 1KCVH 1TIID 5I1AA 4J3UA 3UZQA 1JTPA 4JQIA 2BHYA 5GGSA 3D0VB 3I02A