2A74C

Human complement component c3c
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
307
structure length
296
Chain Sequence
TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement Component C3c
publication title Structures of complement component C3 provide insights into the function and evolution of immunity.
pubmed doi rcsb
molecule tags Immune system
total genus 61
structure length 296
sequence length 307
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2a74C02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 2a74C01
1BR9A 3L3OC 4ILWA 5JPNC 2WINB 2XWBB 3CKIB 4LNVA 4D94A 1BQQT 2A74C 5FOBB 5FO9B 2B39A 2WIIB 3FRPB 1UAPA 2A73B 3I70A 1OO9B 3V96A 3HS0C 1BUVT 2QKIC 3HRZC 5FO7B 1BV8A 1XWEA 4FXKC 1D2BA 1GXDC 2PN5A 2E2DC 2J0TD 2XWJB 3KLSA 4FXGC 3OHXC 5JPMC 3MA2B 1JB3A 1UEAB 2ICEC 3CU7A 5FO8B 1AYOA 1EDYA 1PXUA 2I07B 1JC7A 2TMPA 3G6JB 3T4AC
chains in the Genus database with same CATH superfamily
3MX0A 3NQKA 2BIIA 3CK0L 4JRFA 3RP1A 2JCWA 3TX4A 3WELA 2H6UA 1JHKH 3FT2B 3QPKA 1X3PA 3TIDA 3VFOA 1F2YA 5LB1A 2C9PA 4ENED 1U2HA 3QFDB 5BN4A 2FBJH 3C08H 1H9SA 1EMTH 2QVKA 1VFOA 4JFFB 4NC2B 3APFA 4LUVA 1ZSHA 4GUPB 4YGVB 4KY2A 3QRLA 4YSPA 3LNDA 1GHKA 1UWGL 4O2EA 5M9OA 2XQYG 2MCPL 3NJIA 3GO1H 2ZICA 4WCYL 5CJOH 4HW6A 5HP5A 3ARBA 1R9FA 1SOXA 4J15A 1A14H 3EGSB 4MVBC 1S40A 1QG3A 2AK4B 1MIEH 1OAKL 3GRWH 4JZOB 5GRVK 2CO7B 2HQEA 1K2DB 1X7QB 4GBXD 4WY7H 1D7FA 4XAWL 5CCKH 4AH6A 3LD8C 1UEMA 1QRNE 5AFAA 1OD9A 4OT1L 3STBA 3QI9D 1ASQA 4U1SB 3WY1A 2AMGA 1RVFH 1PYWA 1LLRD 1ZLUK 4FVMA 1JHKL 4X99B 1DYZA 1ROWA 2HCZX 4PAZA 1ZANH 3C08L 5HHMB 4A3DB 3RN5A 1EMTL 1GHFH 5D72H 4BE6A 4M7ZB 1WBYA 4XZUA 3RZCB 5JDJA 4PSRA 4KHVA 3BVNB 3QO0A 3ZY7A 4DV0L 5ALBH 2BIMA 2IAMD 2OFQA 2K6ZA 5FO9B 5F3FA 1EXUA 1QFOA 1FYHB 3GO1L 4BQ9A 1PFSA 3UBHA 3EHBC 1A14L 3LKPA 3LKNB 3GRWL 2WO2B 1MIEL 5ID0A 1B3IA 1KTJA 2FSEA 1EEFD 4FZEH 4G9DB 3LNFA 4WY7L 5CCKL 3KYHC 5C09B 1JWSB 3IDNB 1KSRA 1DL7H 3FU5A 4P5MB 1YYMH 5IVXA 2J3SA 5HI4D 2P5ED 3EYQD 3RPKA 4IJ3B 2VT0A 4X5LA 1EIHA 1ZJAA 5M94B 4JFHE 1RVFL 2VXTH 4O02B 1S7WB 4M5YH 3H9SE 1LO5A 4B95C 3C5JB 3FRUB 3PV6B 4QGYA 5C0CD 5FYKL 4XQQA 3PHQA 3VFVB 2GI7A 3L17A 3ZGHA 4X0KB 2NLJB 4NXNQ 2HTKD 1MY7A 4LSQH 1GHFL 5D72L 3ZRFC 1F9QA 2N55A 5ISZD 4H25B 5CBAA 3DUUB 2X87A 4IFDH 2CK0H 1CBVH 4OJAA 5ALBL 4JFOB 2HKHL 3EOYG 2BOSA 4X6FB 5C0RL 4GUOA 2V2TB 5TJWK 2EY5A 4IO9A 3CFIC 4IPGA 3IDGA 2X1XR 1OTTD 4JLRA 1YEWA 4WFFE 4AEHH 3CPLB 3HBZA 2X10A 4R7VA 5D7KD 1QBML 4YDLC 5HJ3A 5IB2A 4FZEL 5DHDA 4QRTA 4QRBA 3K59A 5TH2B 4OZFA 2NSMA 4LHQB 5B1AB 1DL7L 2PPFA 2OYPA 2IH3B 1YYML 1IM3B 5AW6B 1CJYA 3LX9A 4WTXA 3MXPA 2D0OA 1YN6A 5JAVA 2O6DA 3MVSA 3P9MA 5BPPA 5D1XE 2NYYD 5DCCA 5C0XJ 3VFTA 4M5YL 3NQTA 4PCSA 3SKJH 5CWSA 5CLTA 2WVTA 3JTSA 4XCNB 3WEXA 3ESVF 1G7PB 1BFSA 5ECGA 3KBPA 4U49A 4EIUA 1EFID 3LRLA 3CCEA 2VQUA 5FM4A 4QXVA 4Y16C 1X4ZA 4KJYB 4LSQL 1YITA 4QMGA 1AHWC 4MS6A 3TBWB 4B9CA 1A4CA 1GJUA 4R6UA 5B39G 2CK0L 4GLRI 5D8JH 1CBVL 4XYQA 4XMUA 3MTSA 5EF0A 4F5CA 2J57A 1HYRC 2XV6B 2VSMB 3QJUB 1YMMB 3QDGA 4AEHL 1TJMA 4LLVA 5EZJA 4UYQA 1YO4A 1LEKB 3NFPB 1GYUA 3FSVA 1J10A 1YVLA 4MNOA 3T77B 1HYSD 1B0RB 5GXBB 4A38A 2O72A 2IF7A 3MLRH 4B6ZA 1Z9MA 4G2AA 4JHUA 4PRPB 3V0EA 3T1YL 2ICWA 3LXCA 3MAWA 4XMPH 5F2FA 1YQVH 1JV5A 1Q82C 3P4NB 1YPZE 5B1JC 4E9QA 3SKJL 1NCHA 3ARQA 4EI5A 1QX1A 4PJEE 6CGTA 4NN6B 2MOVA 1IKFH 4GXVH 2R1YB 3G6JB 4K8RC 3EJZD 4M8UA 1FORL 2OL3A 4N24A 4W6YB 1FCGA 2CO3A 3UG5A 4NPSA 1ACCA 1TTGA 2H1XA 1HHJA 1XD1A 1KYDA 1XVSA 3DROA 5GRJH 3EGDA 1IFHH 1X5MA 4XO4A 1ODUA 4JI1L 1ASOA 4DTGH 5D8JL 4PBWD 4BA8A 1FVCA 1WICA 2HN7A 5FK9A 1R24A 1BZ9B 1J8SA 1L0XA 3IMTA 3V5HB 5I9PA 3FF7A 4AC4A 4HMCA 3B8SA 3GMPA 1FWXA 1G9MC 1M7XA 2WKGA 4C57C 4D3CH 1D6EC 1YEZA 1A4KA 2ZAHA 4KXCA 5E9NA 3OGOE 3MLRL 4I2XA 1OXXK 3I6GB 4G6AC 3AS3A 4JDZA 1T1XB 2A6JB 3U2SA 4XMPL 5JPNC 1NCBH 1NDMA 4X4KA 4BKTC 4LSPH 1YQVL 1CLYH 1Z7JA 4ONHB 1VHPA 2Z0BA 4A2FA 1I3QB 1PZCA 2DY8A 2EIZB 1IKFL 4GXVL 3GWJA 4FYSA 1IAMA 3NESA 3SE4C 1A66A 3K7UC 5PCYA 3VI4F 3PO3B 5E8PA 3T5WA 1WGOA 4LCYA 5FA4A 3WOFA 1YNLL 3BAXA 5GRJL 1IFHL 2OQKA 5T3ZE 1KPUA 2QVTA 4J8RA 2XX0A 2E76C 4JL2A 2XZCH 2CWPA 4TTDC 4DTGL 4TQ8A 1P4BH 3U9SA 2BNRA 2A19A 3B9AA 4JM2A 2C5DC 3QJZA 5MERB 2OMXB 4U6TA 32C2A 3P2BA 3SE6A 3IAPA 1MRCH 4DK6A 2YQ3A 3HG1E 4OCYH 5JW4R 4CVWA 2QKIB 5EN2B 5EN3A 3MRJA 2ODIA 5DWUH 4RX4A 5ELDA 2FGZA 2YXFA 3AXLB 1B4LA 1NCBL 1UUNA 2F0CA 5M5XH 1P53A 1RUPH 3BYYA 3D34A 1CLYL 4LPWA 5EO9A 4JN2B 3N06B 1HZ9A 3VSUA 3WIHA 5EBMA 1RPUA 2APVA 4U6HA 4DSYA 5LHDA 2NUCA 2NVTB 2P8PB 1OGAD 1V7MH 5LGHH 1PZBA 2OTJA 1U8CB 1OT4A 3UYOD 1NCVA 2D7TH 5B7EA 3FAWA 5HY6A 4I0CC 3BP6A 3IMWA 3RWHB 3MZ5A 3IRPX 3FPYA 3X1NA 5HHQA 3EDJA 4MRCA 1NFIA 3CVDA 2XZCL 4L4VD 2XN1A 3OKLB 2OT2A 4ANUA 2G2RA 3CFBA 2WP3O 1P4BL 4JFEE 4WO0A 3TVMD 5KRUA 4ZOCA 2YPLD 2X6CA 2BXYA 4PD4K 3ZE1E 4JJ5B 1F0LA 1TZ8A 3GSUA 5DUJA 4YJZL 1Y1VB 1QZNA 1K73C 4PYGA 1F2LA 1MRCL 4UQ3A 5ENWA 4OCYL 1RTOA 3TZVA 4JRLA 2VB5A 5DWUL 1AO7E 1ZA3B 3EFOB 3O6FD 4HKBA 1RUPL 1WZMA 2HT3C 4MMZC 4WTZG 1F45A 4ORGB 4F92B 3K1KC 3MRHA 1A65A 1XXDC 1MVUA 3BCDA 4PG2A 1JWMD 3V7AE 2OMYA 4R9WA 3MV7A 3HLKA 1DJRD 1SYSB 3RGBA 1L9SA 3LNEA 4JY4B 1V7ML 3NXWA 2A2QT 1YMHB 3EO9H 4KRNA 3FDWA 5LGHL 2WVSA 2LU3A 3QJXA 5I17B 3FK3A 1HEHC 1SJEB 2R0KH 3DM3A 3R06B 4N9OB 4K6DA 2F18A 4Q56A 3C8KA 1YSOA 4GB9A 4KVNH 2CLZB 2ENBA 1JZEA 2EDJA 2OMUB 2PYFA 3A6OA 3DX6A 4P07A 4XBPA 5IB3B 4DH2A 1FD7D 1E9OB 4PGDA 1X6OA 3JWOL 3LN5B 1HS6A 2FWLB 1N10A 2BNQE 2VQEL 3CFQA 1W2KT 4F7MB 1BF4A 4X7DC 2CIIB 2EDYA 1XGRA 4DAGH 4BH7A 2NBFA 1Q7YC 2VM4A 3GLDA 2C9VA 2XBZA 3E38A 3UPRB 1L9PA 1RURL 3B9EA 3O41A 4HUVA 2XY1A 3ESPA 3I02A 5CP3H 4AQAA 4S1QH 3GTGH 2O30A 3GC3A 4PGBB 2E8YA 3S5LG 3ZE2B 3AWEA 3IS1X 3WNOA 4WI0B 1TKWA 2Z0UA 3DSNB 1XF2A 3EO9L 4U1KB 3CDYA 2FJGB 4LIQE 2R7DA 1DSFH 1EERB 1KB5H 1HH9A 2YD8A 3DMMB 1BJ1H 5KIXA 4MJ6A 3UAAA 2GVAA 3WG7B 4YHYB 1HR0L 2R0KL 4MX7A 3VXRB 5CGKA 3UFIA 4KVNL 4GP5B 1DUYB 3NIDF 1OXYA 4JREC 4ZUSA 1ESRA 1G291 1WHPA 4UU9A 2LTQC 3FFDA 3QNXA 1FF5A 1ZS8A 4XNUH 1BQHG 2FMMA 1KJ2A 4AQ1A 5F3HB 3GBDA 1OZUA 4JHZA 1M7DB 4DAGL 1LE9B 2NN6I 3PWPB 2CA3A 3LHPL 4Q6KA 2JQMA 4LF5L 1EIFA 1R34A 3OF6A 4JFFD 3EYFB 2BSED 4D0DA 1INDH 5ETUB 4S1QL 5D7LE 3U50C 3SD2A 2F0GA 2OZNA 3S35H 3SBWC 1T1ZB 4J4PA 1IRAY 3TREA 3FO0H 3EFXD 3L4XA 4JPVH 4XOBA 3RFRA 4V2CB 5F0MB 1PL3A 3I6KA 3QUGA 1TCMA 4XBEH 1FQ9C 1DSFL 3ATFA 1KB5L 5DAUA 4K5OA 3GSVA 1LV9A 4HN7A 1KXLA 2AK4D 4OFYA 4Y5YB 5JMRA 2BVPA 2X4SA 4NWTH 2BVEA 4YBQD 3FQ2A 2AJ3A 4WRDA 3O13A 2X4PA 2NTFB 4A1RA 2YD0A 2F0IA 2UXDL 3VI3F 1S5HA 4X9FA 1I4GA 4XNUL 3RWJA 1S7UA 4HSQA 2YUXA 4N2OA 3VA2C 4JR9H 1MBYA 4TVUA 2L1BA 2DMBA 5J9PB 4NQQA 3K2MC 4M6OH 4MKMA 1OGSA 1A15A 2WINB 2P49B 5DVNA 5HHMD 5E5UB 4DIXA 2QDVA 1STHA 3CMEA 1VQKA 1INDL 2NDGA 4EI6A 3RZCD 1J0IA 4CDDC 1MRFH 1XMWA 2NZ9D 1QFHA 2VZSA 4WORA 2X7LA 3X17A 1DE4B 4KRPC 3C09C 3VWKB 1JZ6A 5H35A 1RZKH 5CU9A 1JGDB 3WFBH 3FO0L 3L9YA 4MAYB 5DUBA 4JPVL 5L8KB 5C5LA 1M05A 3BMVA 4XBEL 1E90A 1N64H 4F9PA 4UDTA 4ELMF 4G9FA 1PZSA 2L3BA 2BFVH 2JTYA 3QUZB 3QEGH 4NWTL 3VXPA 1ZWIA 3TQYA 4MXQD 5FLMH 5C09D 1JWSD 4YBLC 1S9KC 3GM8A 3TYFB 2D73A 1D3CA 3DGCR 4J6IA 2RACA 3I6LD 4MDJA 3RTQB 4WU5A 1CGXA 3NCCB 1ZTXH 5EIVA 4JR9L 1IBKL 2EO9A 1PY9A 2OJZH 1UA6H 2FX8L 3ARTA 3H15A 4ODUB 1F86A 2NY5H 2AV7B 4M6OL 3IT8D 5CINH 4ZUTB 2VZVA 1AGFA 3NTIA 1SYVA 1A6VH 4X5WB 1H9SB 2BMKA 1SDDA 1AW7A 4BD4A 5ITFA 3ULVC 5C08A 3TF4A 1MRFL 2VJ0A 3BGFB 3GB7A 2YARA 1JOIA 1STAA 5D2NC 2DJFC 2HZHA 4P5KA 5AVQB 1RZKL 5MEQB 4M6NH 3WFBL 1EEQA 2VDOH 2RCFA 1N64L 2P5EE 1G7JB 4PS4H 5C6WH 2BFVL 4OZGA 1D5BB 3QQ3B 3KEDA 3A67H 5I9QC 1R17A 1JZFA 4WJWA 3JAML 1OCRB 4QOKA 5CZVH 5C0CE 3SGKA 2MSPA 3DWTA 4OIJA 1IM3D 3OQ3B 4OFQA 4LEOB 2E7MA 4AYGA 1ZTXL 5BRPA 1PYWB 4Y4KA 1CDYA 4DV7L 2OJZL 2EY1A 1UA6L 2GIYA 5JHDB 1B4JH 5CINL 3P73A 1STEA 1A6VL 1ENCA 4CKQA 5EBWA 3EFDH 2BRQA 2W07B 2W60B 4NAJA 4YC2C 4KV5F 3PFQA 5DJYB 3RWIA 1DSWA 3OAWA 4K2LA 4UIKL 5AVTB 2AEOA 5D7KE 2IFGA 3RBGA 1GC1H 4TRPH 4M6NL 1VQBA 4LFCL 3TEWA 1JE4A 1O7LA 3WFHA 1YMMD 1CXKA 2VDOL 3B2UD 3NSXA 2X88A 1DUZB 1T4KA 2P7TB 1DDTA 4K94H 2IPKB 4PS4L 4N2EA 2Z35B 3QXDB 4JANA 3A67L 3BZEB 3RNKA 4J3OG 5GGTH 2C9OA 3RX9A 1ZHKA 3WDNA 3MV8B 5CZVL 3A3YB 1HHVA 2VQFQ 3J2PA 4F20A 4Y9EA 4PRPD 5DTFA 5DVKA 3VXNA 1XX8A 5M95B 3BYTB 1P1ZA 2ZG3A 2EIJB 2JB6B 2PR4H 2NOYA 1PZUB 4Z7WF 3BXNA 1B4JL 3V6OE 3PHQB 3BT2H 4E9XA 1CICB 3EFDL 4FQXB 3DHJA 3EF4A 3VH8G 3PIQA 1E6OH 4OVVA 1I7ZB 3GT6A 3ZPDA 3IN0A 3C1FA 2Q20A 4AKOA 2WBJD 5CBAB 2IJ0A 4TUOB 4P06A 4MHHG 4APVA 1GC1L 3F7KA 3NN8A 4TRPL 4ZFQA 3F6JA 4GOPA 4FFVD 5D1ZB 1HSAB 4XOEA 1QBAA 2AP2A 5IP7H 1QYGH 4XOCA 1AQ8A 3IDGB 4PHXA 4JLRB 4RMRA 4LCWA 4NAQA 2FFKB 2XBDA 1Y0LA 3O0RH 4K94L 4WV1A 5HY9B 1KIPA 3GM0A 3APMA 5HJ3B 2ESVB 2W9LA 4KU1A 5DSCB 1LL1A 3FPUB 4RG1A 5HHXH 3KJ4B 3ULLA 2YOAA 3S3PA 1T04A 4R4ND 1MCLA 4KWUA 4TNWF 3G48A 3M7GA 3VX1A 2JMRA 1TUPA 2PR4L 1QHQA 1I8KB 4DUWA 2R93B 1JVLA 3MHZA 4KKUA 4GQQA 2PYEB 3BT2L 3OV6A 4LMQI 1XF5A 3QWNA 1QATA 3VYPA 4PRHB 1K72A 4OFDA 1E6OL 1EQQA 4ADGA 4A37A 1A6PA 1RZ8A 1G7QB 2EO1A 3EBIA 3GSQB 4AYBG 3L5WA 3LS4H 4XX5A 5F1OB 1C1EH 4GP8B 5D2LB 2Y72A 2RVLA 4HXBH 3ZOAA 1E4JA 3DUZA 1QYGL 1TVXA 4KDTC 4NPJA 5INDB 4DR7L 4FD0A 3OD3A 5I16A 1TZAA 4Q4IA 4KPHH 1J0JA 5L2JA 2UX7A 2AXGA 3O0RL 5LVEA 3VGEA 4FE9A 2V7NA 1JZ7A 2A9DA 5ABZA 2E5LL 4LLUA 4ZOAA 3W2DH 1FNEA 1WWWX 2OX5A 4HA1A 4EF3A 3ZBMA 3R7QA 3IGAA 3B5HA 2DNEA 3RX5A 2GSIA 4EI5B 4KI0A 3N43B 4M1DH 3M9BA 4MNGA 4BCYA 1SEBB 1ITCA 3WE1A 1HHJB 1KLGB 3DROB 3RUGE 3FSOA 3JYBA 2F8OA 5D7JB 1I4XA 5AVWB 3X1BA 4G6FD 3TN0C 3QQ9D 2CQOA 5F9OH 3LS4L 3HE7D 4CJ0B 4JV5Q 3D0FA 3D4DA 1C1EL 1FVCB 1HILA 2V17H 5FK9B 5HJDA 4HXBL 4YHZH 1KT2B 4B3SQ 1LLAA 1P4UA 2OMTB 4OIFA 3TCLB 1A6ZA 3IL8A 1LTAD 2VR6A 4QXUH 4KPHL 5EPLA 1YNJC 2P43B 2CHDA 2GQHA 5BN3A 3KPNB 4JX0A 2VW6A 4RFOH 4Y4FB 5KSBE 2VUMH 3FZUC 4DUZL 2W0KA 1WDAA 1KYFA 2E47A 2ARJB 4FNPA 3QZNA 1K83B 4HIHB 4DEPC 3NIFB 2R23A 4CDCC 4NO5A 3U2SB 1NDMB 1EHKB 1KPRB 3WNKA 3L4TA 5B38A 1Q1BA 2Z8WC 1T0NB 4K9EH 4PGJA 1GMIA 1IL8A 2DBJA 4B96A 4AJWA 4M1DL 3MROA 4L4VE 4PWFA 3L4UA 3IF1B 5C4JH 5E8PB 3HA0A 4P74A 2NWGA 3P20A 4KNSA 4POZD 4ZFFA 5GS0D 3LDBC 2YPLE 4ODBD 4OJFH 4WI9A 1SJED 3C5ZB 2YEQA 1F4YH 5DRWB 5F9OL 3I4MG 4J23A 4BINA 2V17L 2YN3A 2OAAA 4YHZL 4JPBW 3WL9B 5C3IA 1VESA 2G5RA 4JM2B 2UX6A 3EYSH 4QXUL 1U8QB 4ZJ9A 4RFOL 5IFJB 3P3SA 4X6AH 4HZLA 2X2IA 1AYRA 4BZ2H 4B9IA 2V8MA 1ZGLA 2D9QB 1BGXH 3K0WA 4N2FA 3MRJB 1DQMH 3HNTH 2X6LA 3DARA 3WTTA 4EXPX 4HCIA 5JNYB 1TPXB 4OFIA 3VUAA 4K9EL 1TY0A 1TEFA 4U6HB 4YDIH 3FCSA 4TL4A 4WFHD 3K81A 1ZT4A 4AK2A 3G5ZA 2Y5TB 2UXFA 3LYRA 4YHHQ 2AQQA 2FRGP 2DQFB 3OKNA 4LCCA 5LGJA 3DMMD 4OJFL 1BFTA 1LVEA 3MUY1 1UM4H 2APBA 4KTAA 35C8H 1TSHA 1FC2D 3MV11 1F4YL 2P42B 1EZ6A 3VXRD 4PJGE 1N8ZA 3OC8A 2OJEA 2A69D 3MRKB 2AQ2B 4R26H 3SEPA 3H7BA 4JW3A 4NAMA 4BXXG 1H9JA 4LFHD 2R51A 4XCEA 3VRJA 2P5WA 2ENJA 3FTVA 3KH4A 4OAWA 2PKDA 3EYSL 2WV3A 3MNVB 1WC7A 2Q2EB 1H8SA 4HCFA 1OQOA 3S2AA 4TOYH 3V0AC 4URTB 4BZ2L 5ENWB 3PWPD 1B50A 4UQ3B 3U4VA 4FQHA 1BGXL 1DFXA 2V4LA 1N6VA 2WWMD 5E4IA 1DQML 4RKLA 3HNTL 1F2ZA 3IWUA 3AB9A 3DM1A 1AD0A 2WP8J 1D5RA 4HKBB 5DLLA 5H8DA 1S8DA 1YY8B 4AUYA 2I5LX 4C3IG 2WANA 1MCWW 3ARYA 4F2FA 4YDIL 5CZXC 2DIEA 5JHLA 1AN8A 4Y88A 1D2BA 3F62A 4C55A 1JFHA 2F0WA 2PMZB 3PWVB 3I8ZA 4AOFA 2WIMA 4B3SL 2EDMA 1EK3A 2A9MH 2JJSA 2UUAQ 1XMQL 4I4WB 4EOWH 3T53B 4QXTB 5C0BA 1UVQA 4AM0B 4AZ8A 4H7VA 1UM4L 2PLTA 3W9DA 4S1DD 5MEND 4MN3A 2F5AH 3M6DA 2BOBB 3C8KB 4YVNA 5DO8A 2A6IA 2DQDH 4R26L 4ZZKA 3DX6B 3UBFA 4DOHB 4YS4A 2EKSA 5A2KH 3VI4A 2FQEA 3PAUA 5AG8A 2XN2A 4ZMXA 5FA3A 4DKAA 4JRWA 3H94A 4LKXA 1IUZA 4HIIB 2VDMB 3Q23A 2XTJB 4GPVA 4OB5H 1IU1A 1WCMG 2EH8H 3OKKA 3AU0A 3UMTA 1G9NC 4AQAB 2JA6G 1EHAA 2XV0A 3B6YA 4WGKA 2VLJA 4CDGC 1HRJA 1NLBH 2AK4E 2NZ1A 4JPIB 4N2NA 1XTMA 3VWKD 5D7IB 3ULVF 1DDHA 1F18A 3D3VA 1CSQA 4MAYD 1D1KA 1MCWM 1Z0MA 3GZQA 5JNYA 3MVVA 2IBGA 1UXSA 4DV3L 2A9ML 4ZMNA 5HYQB 4I1PA 4EOWL 3QXAA 3QUZD 4M4PA 2F5AL 3BD3A 2VDLH 3W37A 1KB9J 2EJ1A 5I66B 4M00A 2DQDL 3ZE0F 1KJ3H 3V4VH 2E0PA 4A3KB 1J8KA 2LY7A 3KPSB 3DX9A 4JOIA 4JO1H 4UU9B 4Y2DB 2XKSA 1FO0B 1INQB 1RLBA 3RTQD 1ZS8B 1BMWA 1LP9E 4JFZH 5LXVA 4PR5B 3AM8A 3L3KA 5M7QA 1SUJA 4LVHB 4A3CG 2JN4A 4MXVE 2N8NA 4I87A 3D4RA 4OJYA 4OB5L 4AVKA 4ZQTA 5K33A 5H94B 3UZQB 4HS6A 2AUJD 2EH8L 3DO7A 4P2OC 3BAWA 2XICA 5DYOA 4BBRB 5LWYH 2XN9A 3O8XC 1IEBA 5FOBB 4HJEA 1NLBL 4AG4H 1I85C 1ZGLP 2F0HA 3GTTA 3BUYB 3MJ9A 3N44F 3ESMA 1S3OA 4RGMA 1U58A 1U8JA 5FO7B 1OWRM 3H3KA 3I6KB 4XMTA 3ULJA 2WPGA 3I9AA 3IAGC 1E8XA 1UCBH 4LHUB 2C5CA 3ROLA 5EU7C 2DQGH 3I6LE 3ARVA 3BWUC 2VDLL 2UV3A 2VXQA 2AJ3B 1KJ3L 3MOBH 3V4VL 2UZIH 3OJDA 2G60H 5EC2A 4CU8A 2YFNA 2QQNH 3CHPA 2FBRA 4DKDC 5SWQA 1QB5D 4OGQC 1XF3B 1XH0A 2QADC 4H4NA 1RDPD 1IXRA 1HE8A 3QJFA 2O5IC 1NDTA 4JFZL 1V27A 2BH0A 1Z9NA 1PYWD 4PHZA 3V7AG 4AKQA 1TLKA 3NA4A 5JHDD 4XO9A 4PSPA 1NPNA 2J56A 2ILLA 4PJ8C 3BGMA 3JV6A 3VJ6B 4AMXA 1KCKA 3NZSA 5GGVY 3VDBA 3OLEA 1DQLH 3UG4A 4G83A 1OB1A 1QSEB 5LWYL 2WZPD 2X7LB 1UATA 2R2EA 4HFWA 3JTTA 4AG4L 3OKDA 1XL4A 4NUGH 3QXWA 5TF1H 2F7RA 5DUBB 2QVFB 2Y3NA 3FMCA 3NIGF 4NENB 3UDIA 4EJ1C 1AKPA 1V1OA 1N34L 3ISYA 3OPZH 4JVWA 1UCBL 1INEH 2D3JA 2IPKD 4UTBA 4JK1C 5I1LB 2DQGL 4OZFH 3VXPB 1QJOA 1ZCRA 4XTRC 4G8FA 4R4BA 3TGXA 5SWZE 3MOBL 6PCYA 1W6WA 3MV8D 2UZIL 4G7HC 2G60L 2V5SA 3GDEA 5CV8A 3E3QC 2QQNL 4YLQT 4UB0H 3GMLA 1P1VA 1F00I 2ARJQ 4K5XA 1I1FB 1GJIA 3U36A 3NDZE 1KDBA 4LASH 1A9VA 4UNVA 4IOFC 3GIVA 4F24A 3K4ZA 5AVYB 1CICD 4JI3L 4QYOA 3L1EA 3S2CA 3ULVL 1WZLA 3BRDA 1DQLL 3KL0A 3PDOA 3QRGH 2F0MA 1B9MA 3S16B 1O78A 3GB7B 3RGVA 4K7PY 3KJ6H 1EV2E 4DR3L 2YPKA 1AMYA 4NUGL 3F2UA 3C6LC 4WSGA 5TF1L 1E4WH 4H8QA 4WNQB 5D1ZD 1KABA 4CMMA 3F8UB 2HB0A 3HKSA 2NQCA 3K4AA 3OPZL 2XIDA 1INEL 4FFWC 5BZWA 2DJGC 4OZGB 4H7BA 1P2CB 2ESVD 4KJWD 5EORH 2VZ3A 4FQCH 4WNSA 1HNXL 1V10A 4QOKB 1UE5A 3G6JE 4GFTB 4B9FA 4UB0L 1A1OA 1QPKA 5IEKB 2V2XA 1BCIA 2FX9H 2VDNH 5A43C 2ZF8A 3FOMB 2IADA 4Y4KB 4BFRA 4LASL 4U3XA 1E3ZA 4XNYH 4ZT1A 1D5MC 3E8VA 2PYED 1E4HA 1GS7A 2X3CA 2P1YA 3TYGL 2AQNA 3DX4A 2WKCA 2FBOJ 2L8AA 3MRNA 3OKOA 4G3YH 3QRGL 4PRHD 3VI3A 4Z7QE 1U4RA 2RR3A 5HHVH 3KJ6L 3LZLA 2NNRA 1OHZA 2WCPA 3DPDA 3D51A 1E4WL 3NFNB 1ECYA 4HJ5A 4JI5Q 4UV7H 1RV6X 1GOZA 1P4LB 1REIA 3U6XA 3EXJA 2K5DA 2IALA 3VO0A 3SQRA 4RDBA 1AMXA 3D30A 1CDJA 1MH5B 3GHEH 5EORL 4FQCL 3DX3A 1BJ8A 3DTUB 1QSVA 1ZHKB 4KJPC 4C3HH 1VRSA 5GJSH 2F15A 4NNXA 3T0DA 3IMSA 4NMZA 4DP0X 4NUPA 2PW7A 5DTFB 4ELMA 4XMZA 2FX9L 1IEAB 1KGWA 1AQDA 1KV3A 2VDNL 5K1VA 3EYVB 1FFPA 4BBWA 4EI5D 5E2UH 4Z1PA 2IFFH 4XNYL 3ZKND 3NCJH 1QZ1A 3PQIA 3IKJA 4KY1H 4ZMTA 1SEBD 1KY6A 1NH6A 4PLKD 4NZ8A 4G3YL 5D70H 3DTXA 5HDBE 1KLGD 4IUUA 1U33A 1F1GA 5ADOL 5D7JD 4NZTH 5HHVL 2HJKB 4JPKH 4HR7B 2HTLC 3NZ8A 4JRXA 1KRTA 3G4SA 1J5EL 4GOPB 1QSFB 2R2HB 2Z4IA 1FZMA 3UGEA 2CD0A 1PFMA 2AXHA 3O3AA 1ORSA 4LAJH 2YWZA 3HFMH 4L8DB 3B7YA 4LCWB 5IYCG 2N88A 4Y4FD 4Y16A 5D14A 4O42A 1PLBA 1WLHA 3GHEL 3VA5A 1MFEH 5A6IA 4TKWA 5GJSL 2MPAH 1G94A 2JI3A 3D1MC 1HHIB 3MLUL 3QP3A 1KC5H 3FUEA 3UYPB 1J5OH 4HU2A 4GI6A 1MW2A 5MHSE 4P2QA 4GP4B 1OM3H 1KXQE 2MNUA 5C0AB 1BFOB 5E2UL 4BCZA 3K8LA 3HE6C 3ZHLA 3NCJL 4KY1L 4ZNCD 5C86A 2NDFA 1XF5B 4J3OC 1EWHA 5D70L 2I27N 1SQMA 1N68A 1NCDH 2YEZB 4LLQA 3UTTB 5K5PA 4JNXA 3C5ZD 5IJBC 5JQIB 1NGZB 2EYSB 4JPKL 1YJDC 4ZUUA 3NUCA 3EDFA 2RBMA 1MSGA 4H1LA 3EJUA 3ZRSA 5B1JA 5B3NA 1EZLA 4AH2B 2AXFA 2K5NA 3CZGA 2JLPA 3G71A 4DP2X 1UD6A 1NAMH 4JM2D 3HFML 4RLDA 1V43A 4LBEB 5C71A 5I16B 5E4WC 2N3SA 2A3TA 2YC1A 1JK9B 5AAMC 3HR5A 2V7NB 5F1NA 3I3BA 3DPBA 1SF5A 2YXWA 2MQHA 2WGXA 3TS8A 1MFEL 4LLUB 3VCLB 2MPAL 4A7TA 4DF9A 5JXEC 1F4AA 5FDWA 4LNRB 4XBMA 3J80c 1KC5L 3F8TA 2YLKA 3IGAB 1E40A 3GFUA 3BVTA 1J5OL 1FFOA 4CKCA 2IANE 2B59B 2GSIB 1T3FB 4WW1B 2CO4A 2VB2X 3PAZA 3C5XA 5KJ7E 1VQ9A 4MNGB 2OYMA 2NVYH 1HNZQ 4LL4A 2PPDA 3TBYA 5BZDB 2KS0A 4P46C 5TK2A 1D6EA 3K74B 3KYNA 1NCDL 3KWVA 4G1EB 2ENYA 1X5HA 1VMPA 3VXSA 5CF3A 1TWCB 1KCUL 4A3MH 4HJAA 1MEXH 4Z7WA 1Q1JH 5JPNA 1U8OB 3QO1B 2F08A 2F0LA 4KROB 2AZUA 4N2MA 4Y8DC 4CBPA 3H3VH 1NAML 4TTGA 3SE4A 4GRLB 3U30B 4FQPA 4OI8A 2XY2A 2YK1L 3CQQA 3C9NA 3QZWB 2OTPA 5DDHA 4EUPH 1ML0A 1MUJA 3QXTA 4Z7OE 1BHGA 5CCHE 1OLZA 4QHUA 1NEZA 3SGIA 3VQ1C 2OYLA 2JIXA 4I0PC 2AEQH 4PJDE 3LZFH 4MHHI 4FC3E 5B38B 1XIWB 3QIUA 2XWCA 1R33A 3MRBA 1VDGA 3SDXE 4Z3FA 3REWA 4X98B 3LEXA 1JDCA 3HOXG 3IWVA 3N41F 4HPYH 2Q76A 4HWNA 2H0FA 5CSBA 3EDEA 2EXSA 3TIEB 3D6WA 5KYUB 4ZFFB 3X1EA 2ZG2A 4F37K 2H8PA 5L4JA 4PVBA 3KJOA 2B1OA 4NZRH 1MEXL 4NQSA 5FYLE 1PIGA 4LDEB 1Q1JL 1BVNP 5GRWA 3X14B 1IAKB 5BRZE 2P48B 1W0VB 3ISRA 4NIKB 2D7NA 4KGJA 4P48A 3ML9A 4Z8FH 3FKIB 1RK1A 5I1CH 2APSA 4P5RA 1ZLSH 3NSJA 3PGZA 3TEZA 4HZLB 4GUQA 4PLOB 2XTJD 2D2OA 2Z31C 4YHML 1TWFH 1TU2A 2XT1B 1AOZA 2YFOA 3DX1A 3TEYA 4AVJA 2X6GA 1HXYB 1H9DA 2AEQL 1T66D 4K5LA 3LZFL 5F6HJ 1JE5A 3IJYB 1O80A 5D6DC 4HCEA 3T0VA 4BCXA 4X6DF 2CR0A 2X5PA 3GMOA 1OP9A 4HPYL 4RRPG 1SNQA 1C5CH 4K3EH 3D4YA 2B1AH 3FBKA 2QGBA 3HCVA 4JHWH 3WE6B 3EADA 4F27A 2OS7A 1HUMA 1D5XC 1HNGA 3H91A 3QO2A 4NZRL 2R7EA 1EO8H 3FCTA 2PWEA 2HWZH 2WK2A 4DUYQ 3PDDA 3J7AF 3BWUF 3KPSD 4NFBA 2EIEA 4Y2DD 2P5WB 4Z8FL 1MN4A 3AROA 4J3TA 3S1QB 5I1CL 3TC9A 4F7CB 3QZBA 5AW5B 5TQ2H 4NN5C 3S96A 1A6TA 2J8UE 1UC6A 4HJTA 4PJFF 5BQDA 1S9WA 1HHKA 1ZV5A 2WHVA 3U4EA 3VRLF 2I5HA 2CCWA 4FQHB 5GZOD 1DR9A 1M42A 3SD5A 2A6HC 2DKMA 4PTTA 4ICXA 4ODTH 3OF6D 3KBHE 4ZMYA 3RVUC 1C8CA 5CMAB 5D1XC 3E9HA 1AZZC 4ALPA 4BGLA 5FGBC 3BRFA 3OR7B 3LZOA 1J5HA 5FO2A 2Q3XA 3TBBA 4OUUA 3RAJH 1JDDA 5I74B 1UXWA 1C5CL 4C4KT 1X9QA 2FAUA 1IGTB 3ILDA 4K3EL 4YR6A 2B1AL 1I8UA 4JHWL 4LHUD 3V9CA 1CKNA 2NX5E 5GROA 3PCOB 1P9MC 4NOFA 2XKNB 1QA9B 2AERT 3K72A 3HPLA 4AV0A 1OF2A 4Z76A 2ZWNA 3BVMA 1IKMA 2EKSB 2HWZL 2XG5A 2DY7A 5D96B 1GGTA 3BCFA 4JBJA 3VI4B 2WVUA 1P84J 1XO8A 2VDRH 4UTAA 4YHIA 3SDAA 1CLVA 5TQ2L 2BSRB 4ANKA 3KLLA 5HJGA 1MREH 3AG3B 3Q8AA 4HJGA 4HCRH 2DEYX 2BA1A 2IBBA 2X0UA 4A4IA 3FCGA 3KK7A 4CBVA 2R56H 3OXRA 5DRNA 3QULA 1WZAA 1SNCA 4ODTL 3OKKB 1QZHA 4OLEA 2BP5M 3KWWA 5K1JA 1QSED 1F1DA 3C6EA 3G5YA 1MCCA 5E7NA 1EZ8A 3EVQA 1MJJA 1J1XH 1NC4B 2VLJB 4W9FC 1U8IA 3KBEA 3RAJL 4YMPA 2NMSA 4N25A 1IVTA 4EN3B 3TURA 4GRMA 4QMEA 1YEKH 4KI1A 1A2YA 3V0VA 4LGPB 2GC4C 4YL9A 3FTYA 4YIQB 2OP4H 1JDAA 3TWCH 1AE6H 3I75A 1CIUA 3FQ4A 1GD7A 2XX1A 1QBLH 3HB3B 3L6FB 1YNNC 1PFOA 3VXUA 2OW7A 3Q1SH 5KSAC 2BOCA 4DESA 1KXTA 3SBWA 2UY7A 4CW1A 1M4KA 5D1QB 1GW0A 4JRYB 1WEJH 1C8QA 2VDRL 3EO0A 1ZJBA 4XE0A 3T4AC 4E2OA 1M57B 5GS1C 5C0XH 1MREL 3HI1A 4IEFA 4HCRL 4R3SA 2R56L 1JYWA 2QPFA 3S37H 1GUWA 1LJMA 3AB0B 4HIJA 5JJLA 3RDTA 1HJCA 1A5FH 2XN9B 1EY7A 5I1GH 3L3IB 4ZOBA 1J1XL 3WLWC 4YSOA 1I8AA 1FFNB 1NIEA 3S1NB 2DS4A 3U1PA 4WI5A 3MODH 4JFQB 3MV8E 1U58B 1N19A 4DUYL 2O1AA 1YEKL 4N0UE 2G9HA 1OPOA 3B3IA 1X3EA 2CCLA 2F2HA 4B3ML 1GYAA 3KLAA 3HG5A 5AJ3Q 2OP4L 3MUUA 4NBZB 3ROLB 4NQDA 3FB7A 5CGBA 3ARDC 2BW4A 4PJXF 3DJ9A 4FQQA 4QT5B 1AE6L 3OQRA 3TWCL 1HR0W 1G0YR 3P2DA 2OXPA 3R19A 5F9DC 1QBLL 4LFAL 3OJDB 1ESOA 4QOKD 5EC2B 1O6TA 3Q1SL 4WFED 4IPCA 4UI2A 2XVGA 1E67A 3BO8A 1WEJL 2OK0H 4R7LA 1HE7A 1DQTA 1QFWI 3FN9A 1B44D 5F7MC 5E03A 1JXGA 2C26A 4Y4KD 4ECNA 2OTUA 2CO6B 2XRQD 2FUQA 3QR0A 3CN4A 4PV8B 1OCZB 3UBXG 4G7SB 3JV6B 4OGAC 3E1F1 3IXTA 2FXQA 2CLRA 5HPMB 3QXVA 2GB2A 3DUSA 5AALA 3S37L 1HT6A 1J0KA 3MC0A 1A5FL 4GSUA 5I1GL 4EVOA 2EKJA 2QFRA 4HFWB 3RBSA 3BUQA 2EDRA 4NRYB 3HAEH 3AADB 5ACMA 3S5YA 3MODL 3NCXA 1OANA 3T8MA 2P8MB 1LTTD 5I76B 4HD5A 3TJHC 4K5MA 5I0DA 3INUH 3N42F 1QR1A 4IBWA 5SWSE 3HN5A 1KTBA 4ADIA 5FYKD 4ZW3A 3S35L 5DMKB 3IJEA 1FNFA 4R4BB 5EU5A 2YV5A 2VITA 1PQZA 5JPMA 5GRXG 3PUZA 3ARPA 1SVZA 3C87A 4X8GA 2IBZX 1BQLH 1Z6HA 1C12A 1MJ8H 3GMLB 1VDZA 3K8AA 4B3EA 3DECA 1T6WA 3V0GA 2OK0L 4L1LA 2Q7NA 4W4NA 3U36B 1S4IA 3AS2A 3PY9A 3NIDB 3ARRA 3F7LA 2KQNA 1T5XA 2EICA 5D2LE 2Y24A 1VQDA 3HVDA 1JK8A 3PDOB 2XWBB 2QPSA 5C0ND 3X11B 2IQAA 1HCVA 5FOJA 4J3OF 1MCJA 1CC3A 1WJ3A 1E4XH 2H9GA 1RPQA 2ZCKH 1NSNS 7PAZA 3CLWA 2JA8H 1QSFD 4LF6L 1AD9A 4A3DG 1J12A 3OW2A 1FE8H 5FHBH 1VZGA 1NGYA 3INUL 4LCWD 3WXWH 4IHOA 2L04A 1Z9PA 2F3WA 4G7YH 2K50A 1G7LB 4L3EA 4IGBC 5AVXB 3NTKA 3FAXA 3HZYA 4JDVB 2GJPA 2A74A 5G5DA 4DR1L 2QW7A 1XPUA 3TFKD 1C9OA 3FFOA 3IGKA 1BQLL 1F2QA 4C2MH 1MJ8L 2V2XB 1AXIB 2M1KA 5I23A 2WMPA 5TF0A 2IADB 1A7NH 4RHRA 5C0AD 1QD0A 1GYWA 5DQJA 1HI6A 1PAMA 1IBDA 3JZ7A 3EHBB 3IEAA 1CS6A 4QRPE 4YHLH 1ES0A 4KX8A 4AQZA 5HYFA 2MHVA 1V5JA 1GXEA 5HGDA 1UE6A 4A6YH 1X55A 4R4TA 3VI3B 3F6IA 2PQAB 5DMGC 3UTTD 4DP7X 4KTEH 2ZQKA 3FT4A 1HC1A 5G55A 1E4XL 2XQYA 2ZCKL 3P9LA 3LOWA 1DQQB 4AIMA 5L0QC 1CF1A 1Q94B 4A7SA 1JWUA 5FHBL 1XBRA 2DQEH 2OMVB 3DJTA 3DXAE 2MOGA 4GRWH 4ADJA 3WXWL 2A83B 1S5CD 4W4OC 4JBWA 4G7YL 2ZXCA 3DIFB 3HHSA 3WEOA 4WF7A 4MBOA 2WLJA 4Z6AT 3M45A 3VMPA 2WAQE 5JJKA 1EY0A 1C08A 1MDAA 4L2YA 4NNXB 5J1AA 1D7BA 1O9WA 3ARGC 2GJZB 2W5PA 3FU0A 4BFKA 2KEDA 5F7DA 2KJXA 3P1VA 4ATTA 3TL5A 2ICCA 4Z78A 3D18A 1FFPB 1A7NL 2JKLA 2NR6C 4YHLL 2N56A 3OAUH 3EZJB 3ZDXF 4F37F 1JUFA 4YDLB 4HZ1A 3B2VH 5BR8L 3CSPA 3BDCA 4A6YL 5AD0A 2LSSA 3MXNB 1NFDE 1SVBA 2WZ5A 2DTMH 4P23B 3ULUH 2FWOA 4KTEL 4X9IA 3SKUD 2D31A 2VY3A 3RE0A 1I7TB 5IIEA 5CJBA 5ELOA 4KROD 1FZMB 2XV3A 3IFOB 3SKOA 2EQSA 3O3AB 4F33B 2DQEL 3D52A 1ZMYA 4PWIA 2L11A 1ZKAA 4GRLD 1QCBD 2VLKB 2ZKXA 3DV4B 4WI4A 2PPEA 2J55A 1UD3A 5EBDA 4YE0A 1AHWB 2WZ6A 3AVEA 2DD8H 3CBJB 4YVUA 3QDJA 5I0XA 4TF4A 2DJMA 2DQHH 5F96H 4LW1A 3AY2A 4P2AA 1XIWD 2X9XA 5D9SB 5KVGE 1Q9OA 1LT5D 1KHIA 4DR5L 1YUHA 3GP7A 2FO8A 4XDXA 1J11A 4HX1B 5IMKA 3OAUL 1C48A 4P4KC 4FG6D 4S2SA 2K1BA 2PO6C 3B2VL 4M7KH 4MCMA 3ULUL 3K7AH 4N22A 2DTML 5LBSA 1K8OA 1YJDL 3FO2B 1J05A 3HKZB 3LPOA 4R0LC 3MRRB 2PQEA 4K7FA 5IGBA 2O6EA 2R2BB 3IXAB 5GGSA 5HPOA 2ZXBA 4V0BA 3QUXB 4XR8C 5IT9E 4HT1H 3HR6A 4RWYH 1R3JA 5ERWA 4BHUI 3PNRB 4JFDA 2HT4C 3CP0A 3DOIA 1TNMA 5BMFH 4DFAA 1OP4A 2FT6A 1Z47A 2FYVA 2LQRA 2WP3T 2YRPA 2DD8L 4FFYA 2OTLA 4LSUH 3TN0A 2PW1A 1BSIA 3IU3A 4KHPL 5EO0B 3FQTB 3FUNA 4JFPA 4ZS6D 1QI3A 2DQHL 5F1KC 1HXYD 3BKCH 4PTUA 5F96L 7CGTA 1V8QA 2ZX6A 2E3VA 2VDKH 4L4TA 4NQCA 1U8NB 3ARXA 4RAVA 4YEFA 2OMWA 4GG6E 4Y7NH 1AIFB 3MNWB 4Z3GA 2O61B 5E4OA 5F7NC 2BE5D 3F00A 3H6AA 4AWJC 1I31A 4HSPA 2IAMC 3CAFA 4WLCA 3IFLH 3RPBA 4M7KL 3TBYB 4DOHE 4PMCA 1D6EB 3T16A 4P9HC 3KYNB 5B39A 3K6NA 4N6RB 3VXSB 5KJRH 3LKQB 1RL1A 2Y7NA 3FB6B 4N3TA 1SNRA 5IWAQ 2BHZA 4XN8A 3W1BA 5J39A 4KK6D 2DW5A 1PU0A 5EU6B 1NIFA 4JCWA 1MKFA 3VFRA 3QCTH 1IL1A 1F6AA 5G4NA 2P5WD 1VS0A 4HT1L 2Z6KA 4IMKC 1GCYA 3EYQC 4RWYL 5IJCC 3OLDA 1L9TA 2O5NA 2YSSB 3KYOB 4OQ1A 5DHVH 5FLUA 3UTZB 5CFAA 1EHLH 2IH8A 5BMFL 1MUJB 4LSUL 4PI2A 2ADIA 1JXKA 3FNKA 3ND8A 4QHUB 5E2WH 3P7JA 2AGJH 3HI6H 2GHWB 1OQXA 2JIXB 1JN6A 3BKCL 3F12B 3G04A 1CXIA 3MGTB 5FFOA 2P8LB 2HTKC 3BIKA 3CQFA 1I82A 3PF4A 2VDKL 2XVBA 3C5SB 5L4MA 1V05A 3QUML 1R47A 4L8SC 4QLWA 4L63B 1E27B 1M2VB 4AITA 1YPZF 4YY3Q 3BLKA 3TPKA 6FABH 3IFLL 4PJEF 1W8EA 4DNTB 3KPPA 4BWTA 4EQ3A 1F5WA 3UTSA 2VUMB 2R92B 1OTTC 2EVFA 1E2WA 1WGVA 4XN1A 1DJIA 5KJRL 3LKOA 4TUJB 2NT0A 2YPVA 3IFPB 4TSSA 2ZIDA 4OLYH 4R97C 1PX8A 1CPUA 2PETA 4GQ9H 2RDGA 5I15H 3DJZA 1DBMH 2ARWA 2KZKA 1AHMA 1U9RA 5M5WB 3QCTL 4XCYA 3CU1A 4W9IC 5CUSH 5T1GA 3BFQG 3DVGB 1EHLL 2BCOA 2NYYC 4KK9C 3SGDI 3D85A 5C4JB 2RHQB 1BXAA 2DQ6A 1QVOA 4KOBA 5E2WL 2AGJL 3HI6L 3ZZSA 1NMCC 1UWXK 2ID0A 2AVGA 3EFFA 4XODA 2WO4A 3KGUA 4KKQA 1CFQB 3MRPB 3DRQA 1Y1VG 2VLJD 1U8PB 1NC4D 3MJ9H 2NZ1D 1UB6B 1VACB 2GIXA 3LRKA 3V6OC 3Q3GB 4EN3D 3QWOB 3LWEA 4TL5A 5KVEE 4KDVA 3D69A 5F7HA 6FABL 3BJ91 5ICYA 1AR1C 4DP6X 5BXFB 2DJ4A 2WXRA 5GZNC 5EUOB 4KI5E 1A4JB 3PJSB 5J8OA 3I74A 2YD7A 5DJ2A 5I4DA 2J73A 4OKVA 2FCBA 2R7EB 4OLYL 1PW3A 1DVFA 2BZ7A 3FCTB 4GQ9L 4MMZB 5I15L 3HB3D 1DBML 4HAFA 2R3ZA 1WS8A 4S11A 1IW7C 1BX2B 3CSGA 1O6SA 5CUSL 3ROOA 5D1QD 5IROD 3KLHD 2XNAA 4HXAH 4AQEA 2GKIA 4JI7Q 2WOYA 4RGNE 4PY8J 5IOPB 2NW2A 1EYCA 3B9DA 1JORA 1QSEE 1EANA 4BJLA 3BAKA 3U4EB 5B4MD 3IM1A 3R7RA 5MP6H 2OMNA 3EJZC 1MGSA 3G08A 4PTTB 5E6IB 4QF1A 2RD0A 4A2GA 4IPDA 3QAZC 4OLWH 4YBHA 3T1FB 1USQA 2XN9D 3V0WH 1EDHA 3MJ9L 3BUBA 4OUUB 5J6GB 4PGCA 3IKCB 4UQ2A 4JI8Q 1J8HE 1QLRA 3LY6A 2OTWB 1QQDA 2G3ZA 2R4SH 2J6EA 3OWEA 4AQ8C 4K9JA 4MS8D 4FCAA 3HS0C 3GQFA 4P4RA 4Z76B 1LXMA 2I46A 2K4KA 4N2AA 2IPTH 1B7YB 1U92A 5EPKA 1BF8A 1RODA 4R7NA 3TT3H 4HXAL 4A2HA 2E2JH 1LDPH 4H8VA 3UCQA 3SVMA 5IYDH 5J3HD 2VXUH 2SODB 3NP3A 3FOLA 3HMWH 4HJGB 5DJCB 3ZE1F 4FG4A 3OXRB 5MP6L 4WTZA 4MA3A 1FSKB 3VSTA 3SBPA 3U4AA 1HNWL 1DN0A 2CLVA 3IMVA 5IBUG 1NBYB 4OLWL 1V1PB 1XMOL 2JSOA 1PZID 1BEYH 2F54A 3G5YB 4HWZB 3V0WL 5I8CA 2LTQB 1GUGA 1ED3A 4NM8H 5IYBH 3CD4A 4F57H 4EDXA 4XXEA 5DEGA 1L9MA 4P72A 4H20H 2Z7YA 4HJIA 4N2KA 1M71A 4YSRA 2R4SL 3LRGA 5DRZA 2ITCB 4G6KH 3JC66 2P52A 1D9KA 2DIBA 4IBSA 4UIMA 1VAHA 2IV8A 5GISH 4IJLA 3CFUA 1WFMA 2NCEA 2C9XA 5E99H 2KPNA 5IW6A 3AY4C 3O8XA 1N6QH 5JW5B 2EVGA 3VXUB 1YAZA 5EIQA 1CLZH 4PB0H 1I85A 3US0A 2UY7B 1K9TA 5KYXA 1FP5A 1X9LA 3TT3L 1TO4A 2F1AA 1I9JH 3QJHB 3NRQA 2R8SL 1LE5B 3KGTA 4PREA 1LDPL 4NKDB 5I9OA 3IB4A 2VXUL 3HMWL 4MVBD 3TSSA 5BQ7B 1H6FA 1LWRA 1RHFA 3NACH 3O4OB 5HDRA 3RYMA 3NRPA 4X5XB 3S5LA 1PV4A 2VDLB 3VYOA 3WN5C 4HIJB 3AAZA 4F1SA 4KKPA 2FH6A 5DC9B 3STZA 4MLIA 3V4VB 1BEYL 4QXGH 1IKOP 5FGCB 1X5XA 4PJFA 4TLKA 4WI3A 4NM8L 2Y7QA 4M8VA 4E5XG 1NJ9B 4F57L 2R69H 2ZOKB 4H20L 4QIWB 2KQ3A 1HNYA 2GITA 1SXNA 3KLAB 4G6KL 4JK0D 4NQDB 5GISL 3HS9A 5E99L 4WI6A 4CAGA 4JGMA 3W57A 4L6TB 4DAVA 1N6QL 1IL2A 1BQHA 1FYTE 3I9GH 1CLZL 4Q7DA 4PB0L 2QQQA 3FQ1A 4HMDA 2EJMA 4G1MA 3O6FC 1IV8A 1I9JL 1O7SA 3GDBA 4HJUA 5D65A 3UC0H 4DUVA 2O5ZH 1WUNT 4FMVA 1MCRA 1CLOL 2OTUB 3L95B 3MNMA 4Y1AE 1MJUH 1VLXA 4DJMA 3EHBD 3UOAB 2ZKWA 4O51A 3TH3T 4PFEA 3WIIH 3NACL 2VLMD 3DBXA 3K91A 3IXTB 3TLRA 5HGBA 4EN2A 3DUSB 4X6BA 4YBLB 1NBZA 3MC0B 3CX5J 3HI5H 1S9XA 3WKMH 2YAOA 4QXGL 3PRZA 5LCVA 4DR6Q 2YRZA 3JAMi 1R3LA 5A16A 1MHWC 5I6XC 4D0CA 4OF6A 2DQIH 4HIKA 4FLRA 2R69L 2IOMA 2VSCA 4UTCA 1EQWA 5HHNB 2CBQA 4ZKBB 2RSNA 4Q6IB 2BVOB 3T0AA 5K59E 1J18A 3R18A 1FIEA 1M7IB 5A2AA 3IJEB 3EJPA 1EJ8A 4GT7A 1A7RH 4BA2I 1HJBC 2X2HA 1TYRA 4NZDA 5CJQH 1Q9LB 3MFFA 4OZIE 5D2NB 3HZKB 4JO2H 3C6LA 3RMHA 4XVUC 2TMPA 3UC0L 5I24A 4LCUA 2VISA 2O5ZL 5IHZB 1L9QA 1M6UA 5FS5A 1DJYA 3GXNA 3I9IA 3ZE0B 5FCSH 3C1EA 3QH3B 2F19H 3R93A 3DUHA 3PXJA 4JDEA 4OV5A 4DV5Q 3WIIL 1A6UH 4AGPA 5I9QB 3M1CA 4YZFF 3RL1A 2VZAA 4OBSA 3G5XA 4KMUC 1ETZA 1T22A 1Y6MR 2CXKA 3HI5L 2D7PA 3WKML 5B8CC 4H1LH 5IZ7A 2B14A 3M07A 4JRXD 1MI5B 1O7DE 2DQIL 4I3SH 4IU3A 1RLWA 3ELAT 1D5MA 2VB3X 1QSZA 3QZOA 2VLKD 1T0MA 1XR9B 2JELH 2EY6A 3S17H 4A3LH 4IHOB 4L3EB 1JERA 1A6AB 4YC2B 1T1YA 2YS4A 4MCYB 1A7RL 1SE2A 5CJQL 5AB1A 4ZSOA 4X6EB 5E8NA 1ETJA 4JO2L 3HN3A 3I70A 3RWFB 5KBKA 1NPUA 3EBGA 1ERNA 1U8MB 2WMPB 5JQ6H 4FO2A 4F7XA 3SDZA 1WOCA 4PJXA 4ZUVB 1HZBA 1E65A 4Z0XB 3V0FA 2F03A 1HI6B 2N7SA 4N2DA 3VXMA 1NCAH 2VDQH 1AGEA 2F19L 3QGVA 4DCQB 1HZAA 2LXKA 3ZYYX 1A6UL 5DS8A 5FHAH 3QDMA 1OD7A 2HKAA 4F8TA 2VCOA 1WQVT 3Q05A 1WD1A 3OXSB 4PCKA 3KUPA 5TFSL 2EEFA 3CHRA 4YBQC 4I3SL 3QUXD 4R8IA 2VDNB 2GT9B 2Y0SE 3IDUA 4K8RD 3WY2A 2JELL 2GVYA 2LV4A 3M1BA 3QWRD 1RIUH 1WA0X 1MCIA 1LGVA 5A2LH 5G4MA 3NIGB 4LPTA 5J1AB 4HIEA 1PSKH 4YX2H 4U1LB 4QRRA 3VD7A 5EBGA 5AB0A 3CWGA 4OL7A 2Z7WA 4M7ZC 4TNEA 2G5BA 3D18B 5JQ6L 5IMMA 1MAKA 3RDJA 4FLSA 1WTQA 1NCAL 2VDQL 2X3BA 4OVUA 4FLOA 1A3VA 4ULLA 1KDCA 5L88H 3OWRA 2ISDA 1YHAA 3MEHA 4FF2A 2Y6TE 4TSBH 5FHAL 3VDCA 3AC0A 3VXSD 2FWOB 5C3EB 4C3HB 2R93G 2UUCL 4MZ2A 3S1RB 1SLJA 1U8HA 3RR5A 2K05A 4FXLA 4PS8A 4U1NA 5IHUL 1DM0B 5J5EA 4MXQC 1SLUA 1HQRB 2MPMA 4GS3A 2XETA 2Y3AA 4PJCE 5EU6D 4HAEA 1CTOA 3HE6A 1CT1D 1IBGH 1JPSH 1UUPA 4IJ3C 2YAPA 5L7XH 2Y4SA 4X80H 1ETB1 1RIUL 4I77H 3RWCA 2FK9A 1EFXB 3WTYA 2N1KA 2MEJB 4W9DC 4HHAA 4TTDD 3D6CA 4Z3EA 1PSKL 4YX2L 4NQTA 2JIXD 3GMRA 2LLLA 2ZOTA 3N1PC 1S46A 5DD6A 5DK0B 1ZDQA 1UWFA 4AL8C 3UPCA 4L0YA 1IYVA 2BY3A 5DZPA 4KH2A 1F6FB 2BDNH 3VH8A 5AAMA 4FABH 1A8ZA 3CPFA 3T6QC 1ZK5A 4UMSA 4HUNB 1SM3H 4TSBL 2DBLH 3D8GA 3AUVA 2VZTA 4XXWC 1NWOA 1URIA 4K7FB 5GGSB 2B15A 2HPOA 1JZ8A 2XLLA 2SDFA 1WAPA 1PZAA 4V1DB 1F9PA 5CHNA 2BSTB 3WS6C 4KJNA 4UT9H 1JPSL 2VO8A 4GN4B 4L05A 4PM1A 3QSKB 1GKOA 1FL5A 1A9EB 2OQJB 2YN5A 4I77L 4P46A 4RMTA 4X80L 1MFMA 5T1MB 4YAQA 1DANT 1URZA 3Q22A 3HRZC 1R4XA 1H8LA 1RKRA 1V3KA 4I65A 2O26U 4ZO8A 3TN0B 4FG2A 4HGKC 1BLNA 3H4HA 1AZPA 3BZKA 1SBBA 2VR5A 1ODAA 3QFJB 4PTUB 4YNYA 4F8MA 1CVSC 1J1PH 2ZOWA 3Q6GH 5JXAH 3CDZB 5C8JB 3CDGA 1HHHA 2KUTA 1XF4A 2DQCL 3CSYB 4NQCB 1G8ZD 4IQHA 2OMWB 1ZT1A 3DX8B 2HP4A 4QKTA 4RAVB 1N4XH 2B2TA 5AG9A 3SQOH 2BDNL 3VE0A 4FABL 3NENA 1RTNA 4S0TD 3H3PH 1OTCA 4A2DA 2GSGB 1SM3L 3NP4A 3OMAB 4F8NA 2DBLL 2B63H 1TJIH 4AYBA 4DEPB 1QRNA 1UGNA 4R9HA 4FX5A 4E68A 3IJHA 1L5GB 2WAQG 2DQJH 5IG7A 4GKLA 2C3XA 1MHCA 2D5DA 4OY9A 1IGIH 2BSSB 2HT3D 2K28A 4YDVB 1FGUA 4LDOB 4YXKH 1XCQA 4DEUA 5I1JL 3R2TA 4Z7UB 1P5VA 3BDXA 4QJ5B 4UTAH 2E2DC 1Z9SA 3GTQH 2FJFA 4PIBA 2L5TA 4FFTA 4PJBB 2C8NA 4UT9L 2X9YA 1IAII 4Z95L 5LGYA 3DLLA 2H2SD 5E00A 3CW2C 1KTKE 1FVEA 2CO2A 2NVYB 4I7ZC 4JFXA 5LMNL 3BN3B 3ND9A 3NMEA 3BP7A 2K9UA 4HS8H 1NANI 3E9UA 2CZNA 2PP7A 2XXCB 3CZJA 1HA5A 5CNHA 4GKKL 1YEIH 4GAGH 3AMKA 5E6ID 1JN6B 5AW9B 3Q6GL 4A3MB 1J1PL 2BS8A 5JXAL 3BIKB 4YSQA 3T0WA 4D9QE 3RWGA 2BY0A 4G8GA 4MD5B 1WA1X 4APXA 1N4XL 5I1KL 4BK8A 3SQOL 4KHTH 1SFOH 3H3PL 4FFVC 4Z7VA 1N2RA 3KPPB 5IT2H 4L1DA 2Z31A 3SBRA 1MIUA 4DGVH 1TJIL 4Q9CA 5D1QE 4JRYE 2IGFH 9PCYA 3LKOB 5J3BA 3CUPB 2HJLB 3D12B 5MEPA 2DQJL 3RUGF 4JGJA 3P0GB 4YN3A 5JIHA 3FSZA 1IGIL 5D6DA 1UUSA 2WLIA 3H9SA 4YXKL 4DVBB 1THCA 3IDIA 3NPZB 4UTAL 2WIIA 1LTSD 4M4RA 1BG1A 4OI9A 4WO4B 4AW7A 2AQTA 2GCYA 4OHJA 4HS8L 2ORBH 1BPLB 1FNSH 4TQPA 3NZHH 5KSBF 1YEIL 3ILEA 4GAGL 3HGBA 3PE9A 2I9TA 1CA5A 5JOBA 3SY6A 4KQ4H 3VA6A 4BSWA 2KCTA 3VFPB 2ZJQA 2A9NH 3B8YA 4Y19B 4OELB 2X09A 2BCMA 1B70B 2DMCA 4KHTL 1UZ8A 2XN0A 1EY6A 5C70A 1GRWA 1AG6A 4HC1H 4ZO9A 5IT2L 4X62L 4DGVL 3TA4D 2HVBA 3NOIA 2IGFL 4XAKD 1TWFB 4DU9A 2CDEA 4LLMA 4PRNA 3QNZA 4ANVA 4N2GA 2EEAA 4ZI8A 1U8KA 3KL3A 1CTMA 1EPFA 1N3NA 1V54B 5D1XA 5DXWA 3STLA 3NGBC 3KBGA 2EYTA 4TNFA 1G6PA 3IPEA 5SX5K 3UTPE 1MCNA 3VXUD 2H3NA 3NCBB 1LUZA 5E9DE 5LNEA 4NO3A 5JYLA 4DV4Q 4HLZH 1I4HA 3UH8A 4AQEB 2VWEE 3E5SA 3FXIC 1NR4A 2NW2B 1JIBA 2J5LC 4I85A 4LRNH 3I4NH 1U3HC 3TV3H 2EYHA 4A3BG 2WB1B 2ORBL 3KVQA 1FNSL 4KN7C 1P9MA 2N0MA 3NZHL 1F9RA 3FQXB 4QF1B 5KSUA 3VR5A 4KQ4L 2VL5A 3VYUA 1DFBH 2A9NL 3RUZA 3CZNA 3QQ9C 5CBEB 3QS2A 2XSCA 1R9TB 2WXGA 1IZ6A 1X7TA 2JA5G 1M1KC 4OX9L 2CH8A 5LG1A 1XCTB 3BN9C 3E9TA 1VQMA 4HC1L 3RHWK 5KAQG 2YTYA 5TGBB 1CHPD 3OWEB 2YAMA 3JUZA 4KNTA 4KHXH 3ERXA 4NQDD 4IOSA 3U0PB 1PTOH 3N41B 1YPZA 1U5KA 1L1OC 5T3XH 1OSYA 2F0UA 4TN9A 4QQBX 2B77A 3RG1C 2XDHA 3BDOA 5IQOA 3VXQA 3LGJA 2ZXRA 3M8OH 5EQ0A 2WY3B 4LRNL 3RFZB 4HSAC 4HGWA 3JAME 3TV3L 4QJFA 3SK6A 3FOLB 4A3KG 3TP6A 2GBVA 1KNOA 1A4BA 2RMNA 3KPOA 2EDQA 4U4BA 4UILH 1OHQA 2B08A 3NABH 2IMNA 1ULVA 1ZTXE 2LLGA 1DN0B 1PGRB 3GSWB 3JV4B 4IU2A 4U1IA 5KSAA 3CDCA 1DFBL 3NCFB 4EXKA 1ED3B 2ZUTA 1J9QA 5FJ8G 4JI6L 2JK5A 3CMOH 1QOHA 4TV3A 3T4AA 1QUNB 4W9GC 5GS1A 3T8VA 3ULPA 5EPMA 3PREA 1M71B 5AQ0A 4BBRG 4KHXL 4X6DB 3M7OA 5JIKA 4AYFB 5AWNH 2HT2D 4P2OB 5F1IA 1J86A 3U9UA 3ULVD 4ESKA 3O8XB 5T3XL 4I7AA 1C16B 1BO0A 4G8EB 3LX0A 2FJSA 3A7AB 3UAJA 4XH2A 1WD9A 4LHUG 2IPUG 5KVFE 1GA2A 4IBVA 3E6HB 3M8OL 1K4CB 1EL0A 1SN0A 1UH3A 5FDYA 3H6JA 2VE6A 3IDJA 1IE4A 1SPDA 3ARDA 3TOPA 4UILL 4MZIA 3NABL 2XPZA 1D5ZB 1THAA 3WU1A 3S5LB 5E56A 3ZTNH 1VEPA 1FRGH 3MRDB 4LOUD 4QRFA 4YHYC 1O7IA 2NTSA 5K36H 3TPUA 1XD0A 3LRSA 1XGQB 4IMLB 1GVIA 4PJFB 3TS0A 1MI5D 4O58H 3CMOL 1MELA 1WBZB 1L7TH 5ACZA 2YU9H 3IRCA 4BFEA 4GKZB 2WYZA 1X3FA 4PJ8B 1TFHA 3K8MA 4KTYA 5EZLA 4PJIA 1TQWA 5EEZA 4ISVB 4L3ED 1WAAA 4QLRA 3MCG1 5AWNL 1TQVA 4NP4L 3QOJA 1ZHNB 3BZDB 1HH2P 1YVCA 3MEFA 3KPRB 2YQGA 2ZTDA 1BQHB 4GG8B 3M4OB 4XI5C 1ZHBA 4RQQB 1T6VN 3RL2B 4ETQA 2G4EA 1UJ3B 5CEYA 3VMNA 5HSFA 3BPLB 4YDJA 2CRIA 4ONGH 4PJAE 1I9IH 5DJ6A 3ZIYA 1XX9C 1JC7A 5H2BA 1BXVA 1LP9F 1HXMA 4O00A 2EUXA 1TOXA 2IT1A 3CFJB 2JJQA 4PV9B 1K8IA 3OG4B 5HGBB 4LVNC 4WUUA 1X9UA 3J8F7 4X6BB 1C5DA 3VQMA 4AQYL 4L5SA 4KY5A 1NBZB 1JGVH 1FRGL 3GMQA 4JFEA 3RKDC 1DXMA 1AGCA 3CXCA 3CMAA 4Y5YC 2Q7YA 3QK0A 2EDWA 2WBKA 1DZBA 4FXKB 4O58L 3VG9B 4LMQD 2WSKA 4V2BA 1L7TL 4BXSV 3UZEC 1I50H 4ALAH 1IIKA 3CCHA 2YGPA 4EKJA 1JB7A 2MO1A 1BLIA 3VWJC 4AE1A 3LSOA 3HOYH 2WNGA 3S2DH 4DP8X 4NYLA 3F64A 1MCDA 3Q06A 1ADQH 5INCA 2HX8A 5B7MA 3R1GH 2WLLA 3OGCB 1IGYA 1A6WH 1FNLA 1I9IL 2Z1CA 4F9LC 1PAZA 3E6ZX 3HKZE 1K8GA 2C7FA 2XWDA 3HNVH 4GLXA 1EAPB 3GMNB 3JXAA 4FQJH 4IGBA 1JICA 2B1HH 5FPIA 3RL1B 5LBSH 2CIKA 3MLYH 3G5XB 1V3JA 3ARFB 3FQUA 5E4AA 1EEZB 1VERA 1JGVL 2L0DA 1I6VC 2V33A 4XB3A 1GYCA 1HINH 3QUZC 1WVLA 5HHPB 4N6QA 1EYAA 1UA7A 3TONA 4JS7A 3SY0A 2DIJA 1HQRD 4YQXH 2OZ4H 2W38A 3QR1A 2EC9U 4HIXH 4LF3B 4IU3B 4M9OA 4ALAL 1QW9A 2P24B 3ZTCC 1D5MB 1WD0A 3DGGA 4HV8B 3T71A 1RZQA 2VGLM 2EJGC 2YMOA 3H1ZA 4RMSA 3RTQC 1EFXD 5F0PB 5HVGB 1NBCA 5AYUH 1LD9A 3PSIA 4ZAKC 1G0XA 2VW9A 2VAAB 2Z93A 3W0WB 4ZSOB 3Q0AA 1ADQL 1UENA 4UAHA 3R1GL 3LV3B 5IQNA 1A6WL 3LQAH 4UANA 3U6XS 3CN2A 3PJNA 4DK5A 2ZX8A 1Z66A 3HNVL 5CEZD 4W4OA 1ZLVH 1OXTA 2CBTA 3D4CA 2XWTA 4N3UA 4WHTB 4FQJL 2B1HL 5FW7A 1X6LA 2SEBA 4I9WD 4OJDH 3MLYL 5LBSL 1CT8A 1WIOA 4Z5RA 3GUTB 2CM6A 4HF5H 3ARGA 1HINL 3A22A 1KBWA 4C2MB 4J2QA 2OZ4L 4YQXL 4V1DD 1BZ7A 1PG7H 2NR6A 4APQC 4B9XA 1KN2H 4YEEA 3U2JA 2Z6BA 4YWGH 1XSOA 2NTSP 1ENAA 3MHBA 1D7CA 1O5DT 2FX7H 3TJEH 4N0YH 2EDEA 2RFXA 3OG6B 4XT1C 5D7LA 5AYUL 1ZIAA 2H1PH 1R5WA 3TN0D 4RFNC 4KZEH 4NXMQ 2NT1A 3F05A 3QFJD 1IO4C 1LMIA 4QRRB 2XQBH 5F7FA 1OAQH 2DYPB 3N42B 4Y5VB 3QIWC 2FUTA 2QLVB 1G2SA 4NQCD 1P6FA 3DVIA 3G6JF 3LQAL 4NC1E 2GEQA 5IHHA 4FFZL 3T0BA 1YNJD 3ZO9A 3Q01A 3RZOB 5BZZA 3FZUD 3VFMB 1GUTA 1XGPA 4IFDG 4XHQA 5DD3H 1KJMB 2OSLA 2UYLA 3OKEA 3R0MA 1W0WA 4Y89A 3DJSA 5I8EA 3MYJA 4UDUC 2IWEA 3NVQA 2UXCL 5KEEA 4HF5L 4N4YB 5DVOA 5C0EB 2ZYSA 5E7BA 3KYKL 1KRSA 1T5WA 4M93B 5FUOH 1HVXA 3IPFA 5IM7B 1MCHA 1PG7L 1BBUA 2V3EA 1KN2L 4RZCA 4P4KA 4RESB 5GGVH 1AGDA 4J7RA 2PO6A 4Y4HC 2XIBA 4KKAC 3QEQE 2FX7L 5CEXA 1JZ2A 3PMFA 2QVMA 4N0YL 5DJXA 3TJEL 2H1PL 4ODXA 1AE3A 2X4TA 4TSAH 5HYSG 3U83A 4KZEL 4R0LA 1CICC 5TSSA 2XQBL 1OAQL 3H2PA 2H6OA 4FQXC 4GBXA 2X4NA 1M7UA 1ZKOA 1N32L 1LK3H 4YCVA 4MJHA 5EUOE 5L6YH 2KLSA 5C4XH 3MA2B 2Q8IB 5KYYA 3HIZA 2QBWA 3QI9A 3VH8B 2XTSA 1WFOA 1B1ZA 4LNQA 2CDFB 1TTUA 3D25B 2D2CC 3LXAA 3H9YA 5D1ZC 3D33A 1WG3A 5ALCH 2YD6A 1PLGH 4H2CA 5DD3L 3UL4A 3WYRA 2JNZA 1XB6A 3CFKB 2PXYB 1NFKA 5F7KC 4MA8H 2DWDA 4H26B 2DRUA 2YKLH 5HDBF 2FQDA 3RIFK 3ZU8A 1I7UB 4G7VH 4A3GH 1GYVA 4KJWC 1IAIL 4JI2L 2GVBA 1E1TA 1F11A 5CHNB 3L7FB 2HVJA 2RGSA 4WFGE 4GKJQ 3QFGA 1BIIA 3N9GH 1ZE3H 2FO4A 2IAMA 5LL6X 2YXVA 2X42A 5ESVB 4LU5H 4P46B 3S15H 4WO4D 2OXHA 2YJQA 3CCJA 4YAQB 3VR6A 4JHAH 1NUFA 1UH2A 2VLLB 1GS8A 3VFNB 4NJAH 4K7PH 4G4KA 1IBML 3K7AB 3K2UH 4TSAL 3W5NA 1KGUA 4JAMA 4DKEH 4JW0A 1LYQA 3LRMA 1WA2X 1LK3L 1FZOA 3QZWG 5L6YL 2G2PA 2A6EC 2Z92B 4Y19D 4HS3A 4IMKA 1SR3A 3HC2A 2P5EA 3GKZA 3A4EA 3NDYE 3RHWF 5DEFB 4RISH 4YFLI 2EPBA 2Y0SG 4L5QA 2UUBL 2ZCZA 1AOHA 5DZOA 3P4MB 1PZDA 5ALCL 2P47B 1A3LL 4FF4A 1PLGL 2KCCA 3CDFA 2OI9C 3LNIA 4ABQA 1XHHA 2WNWA 5C0CA 1G7IB 1QRNB 4XWOC 3WIFA 3F7RA 4BKLB 3AQYA 3OMZA 4MA8L 4I0PB 2YKLL 3EO1B 4TUUA 4G7VL 1TITA 1DN2A 4DR4Q 1UE7A 3WHXA 3L8QA 5H4ZA 1FHNA 2VDKB 5CZXD 1P5VB 2F74B 3WN6A 1Z9SB 3BIBX 3QUMB 4BA1I 2Q10A 2JP1A 3N9GL 1S78C 4LU5L 1FL3A 1FVEB 1Q8MA 2MPVA 3BVDB 4JM4H 1I3RA 4LJZC 4JHAL 2F53B 1S7RA 2IHFA 4QHLB 3VXTB 4K7PL 3K2UL 5E6RB 1E3FA 3HMXA 4XBGA 4DKEL 3VFWA 4C8XA 3OKMA 5D7JC 2ATKA 3GRBA 3AU1B 1OPGH 4HCGA 4ODVH 4BRJA 4APXB 4CJ1A 4BXVA 3T3PE 1IAOA 3I50H 5SX5H 1O7YA 4RISL 1WBXB 1E0OB 3UXFA 1ZLWK 1J0HA 5DHVB 2DAVA 5T33H 1KBBA 2Z31B 2BA0A 3OHMB 4U3HA 2AMUA 5DA4A 4MA7H 4DZ8A 4DZBA 3BH8A 4X6CA 4Y4FC 4FNRA 4JFVA 1E28B 4RFBA 2NRDA 4ZFOA 1ID2A 1RHHA 1YAIA 3H9SB 2WC7A 4U2ZA 4XMKH 2RH0A 3IDIB 5EU4B 1GJXA 1JI1A 2YUVA 4L8BA 2WIIB 5DJ0A 2OSYA 5T5FH 1IJ9A 3OMGA 2OCCB 4M4RB 4ZMZA 5B1CA 3CH1B 4B41A 5B3SB 4JM4L 1S9VA 4UP7A 5GZNA 5C0IA 1RJZB 1J9TA 5FGCE 4IHBA 1D5XB 3MBEC 3S8FB 2MNWA 3AZUA 3DTDA 4Z7OF 3ULAB 3UDWC 1BZOA 1NWPA 2ICEB 2LGNA 2EE1A 3E7JA 4EE2A 4ODVL 3HHMA 3VB8A 4PJDF 2EDBA 4ZXBB 3GJFA 3I50L 4M7JH 4XB8A 4R96A 3BHBA 2WQXA 4G42B 2CKBH 1HZHH 1UZ8B 4BSVB 3SDXF 4NN5B 1NM9A 5LXGH 5T33L 2KECA 2RA4A 1PVHA 2CFMA 3PHOB 3EW3B 3I4MB 1FJ1B 3AQDA 3TEXA 4D8OA 2VSDA 4MA7L 4PRNB 2QHLA 4P2OD 1J5CA 1IX2A 1K8DB 1U8KB 1CHQD 1R6VA 2APWA 2YUWA 2EYTB 4DPAX 3O8XD 2M2LA 4OH2A 2OR9L 3KHOA 2I9LA 1KN4H 2EYRA 3V7MA 1FLTX 5T5FL 1R1CA 4EIZC 2K0RA 4IBYA 3TESA 5MI0C 4S0HA 4G8IA 4AENA 1IGJA 3L48A 5KTEH 1X5KA 4DAPA 1PG7X 2WTOA 5AAPA 3D05A 3BW9A 1MLCA 4IOIA 3TDQA 1SN2A 1GMEA 3HUJB 2VR9A 3ZHKA 3I7FA 1AKJB 2BC4B 3HS0A 4AGNA 2C35B 5I30H 2ADGA 5LCVH 2EYFA 3W1ZA 3G6AA 1UD8A 4RRPA 2K45A 4HK0B 3FTWA 2K7PA 2DOCA 4M7JL 4DKFL 1UOWA 4RNRB 2CKBL 1HZHL 1QVCA 3CZFA 3JV0A 2X9ZA 3LIUA 2HLFD 4Z18A 3SGEI 3VM5A 2P4AB 1VQNA 15C8H 1B4OA 3GHPA 4X8JA 2V9RA 4PJ8D 3BVWA 3RQ3A 3L4ZA 4FNFA 1I8MA 3J81j 4LEEA 4CVXB 1II4E 2EADA 3FU7B 2EEXA 1XPRA 1HTPA 1YPZB 5JO5B 4PJEB 4RMQA 2F58H 3I4OA 1KN4L 3L3DA 2K78A 5DJDB 4CSZA 3KXFB 1EIBA 1S7SA 2J1WA 5KTEL 2Q2HA 5IQ9B 4KNUA 4ES8A 2ZXDA 4HGWB 1EVTC 4XPTH 1JJGA 4F2EA 1B3JA 3K5MA 4NKOB 4HOXA 2H47C 4C3IB 4XTRD 4JKKA 4IKLA 4MRBA 5LQBH 3MRIA 5CMDA 3TBTA 5I30L 1KCLA 1E9QA 1JNLH 3AY4A 4PJ7E 4IU2B 3QUHA 4JBSA 3NP8A 4OZ4B 3V10A 3P0VH 3U9OA 5E0QA 3DK2A 4MNQB 4MMYA 1CK1A 2XHNA 3E0EA 4XMLH 2JK5B 3MKKA 1RJYB 4N9TA 5KSBA 1GR7A 3TXAA 4PCTA 5GS1B 15C8L 2GK0A 4IOFD 1N0XH 5FYLH 3IMBA 3Q0HA 3G6DH 4G6MH 3L2PA 3CVHB 3MJ7B 4F5CE 4K73A 2VSKB 3FO9A 3RY6C 1E4KC 1W72H 2BSBA 3WN5A 3QDGE 2QILA 3B43A 4ZMWA 1CQFA 2E9IA 2W81C 4HJ8A 4JI0L 4FLQA 2XJKA 2F58L 3U9PH 4H88H 3C6LD 4L4VA 5I6NA 4UQIM 2UZXA 1T66C 1JZ4A 4KO6A 4JG1H 1UH4A 1Y6KR 1KQSA 1YJWA 3I73A 1N33L 4NCC2 5C07B 3SGJC 3TVMA 1Q4NX 1XL6A 2YPLA 4QAMB 4FFWD 4X7FC 5DJ8B 4B7IA 3VGFA 4LPVA 3IDJB 4KNQA 5CAYB 2JA6B 4XXDA 4UQCA 2K14A 1TVDA 5LQBL 4LLWA 3OB0H 1O5PA 3V5DA 1JNLL 2PR9A 1UXMA 2ADFH 2XYCA 2C9QA 3FU9A 3MA7A 3GTLH 3P0VL 3LRSB 4P3DA 5I75C 4LFBL 5CP7B 3CTTA 3O6FA 5AOLA 2XC8A 1TTRA 4XMLL 3ICEA 3S8WA 3ETBF 4PJHA 4GAYA 4ZTPH 4H0LC 2ITDA 3O3EA 4ABUA 3HG1B 1N0XL 5FYLL 1KIQA 4QY8A 4WU7B 1CUKA 3G6DL 4G6ML 1N7MH 2HG0A 3X1GA 2G2NA 3OR6A 3VYTA 3DDFA 4H8WH 1W72L 3UP1A 4HLEA 2PCFB 2ZWLT 4GINA 1Q46A 3S2HH 3JWDH 5FYKU 2E7CA 3C6SA 3W0WD 3NBHB 1AP2B 4ELKA 3DI3B 2JK8A 3U9PL 5CEYB 1DJGA 1BJMA 5DJ6B 4JG1L 4NPYB 4I2XE 1FC1A 1S3RA 1HOCA 1C5BH 1DHKA 3L4WA 4J8QA 1HXMB 4DV6L 2BW5A 4B97A 4KLKA 3ZIMA 1K8IB 1VCIA 4IKIA 1R5IA 2ZP8A 4KJPD 4PZ8A 3QDMD 4XRCB 4JFEB 2ADFL 2XFXA 3UGUA 2HFFA 3D0VB 4PRAA 3GK8H 3M86A 5D6CB 4AYEC 3ZE1B 5HYIA 2J72A 4M5TA 4NP5A 3AUWB 1PYBA 3OTOL 4ZTPL 1BOGB 3CCRA 1UADC 4J1UA 3BP5B 1TT6A 3H53A 4KI5C 4I48B 5FLMG 1FCCA 1N7ML 1KENH 2ALAA 2IPUK 1AO7B 2WKOF 3MRFB 2BNRE 1RUAH 4H8WL 4YSAA 43CAA 3O45A 1XNQL 1XEDA 1OAXH 4D0BA 2CE6A 2MQ0A 4NFCA 5B8CA 2YD1A 2HTLD 1N0LA 4NHUA 4QRRD 5INCB 1ZTMA 3UTOA 2E9GA 5LHY1 3GQBA 1QABA 2DYPD 5CS7A 1VQJA 5GAHC 3H0TB 3BZ4A 4I9WE 4RGNC 4TVPH 4YDNA 1LQSR 1MRDH 1QFWM 1QEWA 1HH6B 5DHMC 3UBXA 1B9NA 1C5BL 2MNJB 3TNMA 1KTRL 2B9BA 4G82A 5KG9B 3UE0A 4GZYC 3K1DA 3LQZB 4IGBB 4XC3H 2G0LA 3MLVH 4YFLF 1TXYA 3X1FA 2AHIA 3ZHDA 3RIFF 1CFVH 2NPLX 1KIRB 1UURA 3QFDA 5B3JE 1OP5K 4KMQA 1TVHB 3I6SA 4K0OA 3GK8L 1HK6A 4JFFA 2BNQB 2BSEA 3DHUA 3MGOB 2F0PA 2Z9HA 3GTVA 4GUPA 4YGVA 1EUJA 3IFNH 4JFYB 3E80A 2YOCA 3DGGB 4DQOH 1N26A 4W1TA 5GAGC 2I24N 4J3OD 2HFEB 1KENL 5C5MA 1KYOJ 1S5DD 1RUAL 4CN6A 5I26A 3IE9A 4F80A 1OAXL 2B2WC 4JCVE 4O2CB 2EDFA 2VN4A 2N78A 2AK4A 4JZOA 3VD4A 2F0JA 2Z4HA 1K2DA 1KLUA 1X7QA 4M1UB 4TVPL 2OW6A 2EYOA 2RSOA 1MRDL 5H37H 1E8YA 1KZQA 4X65Q 3MCLH 2ZUQB 3EUDA 4CN1A 2J1XA 1I4FB 4XC3L 4QUFA 1ZPLA 1NMAH 1TLMA 1PYSB 2AWNA 5IREA 5IY5B 3SR1A 4X99A 4GO8A 5DFAA 1G1KA 1CFVL 4WK4B 1AY1H 3SYQA 5JXED 2PXYD 4PJBE 5D2LF 3QJVB 2PWFA 2NY3B 3P3RA 4NT6B 4W9LC 4KJQC 1CXHA 5HD8C 3X3FH 1RD9D 2SNSA 3SDCB 2RAMA 3V2AR 4N2LA 3BVNA 3TA3B 2ZYRA 2XXMB 3IFNL 3WD5H 3WEBA 4DQOL 3SE8H 4P46D 5FO9A 5JUEH 4ZRGA 1SHMA 1FZKA 3QEUB 4R5TA 1BQUA 2PP9A 1GOGA 3GEWB 2CO1A 3HFFA 3VM7A 3LKNA 4ZFZA 1W91A 4G9DA 1EUUA 4RFEB 1PKOA 3CFTA 1JWSA 3IDNA 1Y18B 3AT0A 4P5MA 3MCLL 3T1HQ 2F4VL 2F7OA 2IBZY 1U4LA 3RVTC 3NCWA 5EG6C 4O02A 1S7WA 3X2QB 1NMAL 1XGPB 3C5JA 3QUKA 3CAMA 1H9RA 3ATAA 3FRUA 2UYLB 3PV6A 1AY1L 1QRND 3UDFA 1XZWA 3UDGA 3MYJB 1SNPA 4FTVE 5IP7G 4I0PD 5EPJA 4X0KA 2IGLA 3FPXA 5CN1A 5TE4H 3MRMB 4NUJB 3X3FL 1TFPA 4H25A 1T5WB 3HBQA 3DUUA 3CNKA 4D9RE 4OD2B 3C8DA 3F6LA 3WD5L 4JFOA 4P4KB 3HKZG 1KC8C 4X6FA 3SE8L 1NC2B 2PO6B 4KTDH 1X5IA 4Y19E 4FRWA 2YA0A 1K5NB 2LVEA 4XNBA 2OMBA 4DO4A 2Q3ZA 2R0ZH 4R5XA 4XXWA 5I73B 3MV9E 1LWJA 2DM2A 4R0LB 3KPLB 5TH2A 1H9VA 5KGUA 3S6CA 2X4NB 4UV4H 2EE9A 1DZ1A 1BW8A 4DHLA 3WS6A 2IH3A 5C2UB 1IM3A 5KYYB 3H9ZA 4KKRA 4DV2L 1NQBA 3J7YW 1MLBB 3W39B 1J5IA 3BC9A 2H2PD 3ZDZE 4HEME 3P1HA 1EH9A 3J80L 2DQTH 2V4DA 2NTTA 2AJYH 2Z31D 4XCNA 4AVIA 1G7PA 1P4IH 1PKQB 3CC1A 4RAUB 4KRLB 3S34L 4HQQH 1GOFA 1NFDF 4KJYA 4PZ7A