2A74C

Human complement component c3c
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
307
structure length
296
Chain Sequence
TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Complement Component C3c
publication title Structures of complement component C3 provide insights into the function and evolution of immunity.
pubmed doi rcsb
total genus 61
structure length 296
sequence length 307
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2a74C02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 2a74C01
2E2DC 3G6JB 1AYOA 2WIIB 3OHXC 2QKIC 2A73B 1BUVT 2A74C 2WINB 1XWEA 3CU7A 3FRPB 3L3OC 5FO9B 1JB3A 5FO7B 5FO8B 5JPMC 1D2BA 1EDYA 1BV8A 2I07B 2XWBB 2ICEC 2XWJB 4LNVA 2TMPA 5FOBB 2J0TD 3HS0C 2B39A 1UAPA 4FXGC 5JPNC 4D94A 1PXUA 3HRZC 2PN5A 4FXKC 3I70A 1GXDC 1BR9A 1OO9B 4ILWA 3V96A 3KLSA 1BQQT 1JC7A 3CKIB 3MA2B 1UEAB 3T4AC
chains in the Genus database with same CATH superfamily
4QYAA 3BLKA 2UYLA 5L6YL 3TZVB 4B08A 1JUFA 2AVGA 3DETD 4BK4A 3RVWC 2I5MX 2ZKHH 5ELDA 3ZJYC 4CJ2C 1TWCH 5TK2A 1XMEB 1NTGA 2IWKA 1AO7D 2FO8A 5D7JA 1BKBA 25C8L 1XVSA 3MLYL 2YTXA 1XR9B 2JTYA 4MVBC 3X1FA 2WLKA 5AW9B 1K0RA 4ADGA 4OFYA 2H2PD 1LE9A 3BGFC 4XNYH 3WG7B 1L0WA 2DQIL 4FADA 4O2CB 2JV6A 1A6PA 3AM8C 3MLXL 5FDYA 2F0DA 4DVRH 1FLRL 4P46B 2QGDA 1MPAH 2VRAA 2J8UB 5FUOL 5BZDB 1RUQH 4UP8A 4EI6B 1SNMA 1G1KA 4N2AA 4QHKJ 1JNHA 3VG0L 2NXYB 1VMPA 4JI7L 1HN1A 4KRLB 4WJ5B 4Z7VE 3RGBA 3X3GH 1XGTA 4BZ2A 1AXTL 1DVXA 1HDMB 3GLDA 4ONOA 4C4KT 3MRMA 4MSWB 3ULJA 3MV7B 4EPSA 3FQXB 3D25A 1CE1L 5ABDE 1I8MA 4N1EA 2I32A 4Y88A 3EZ8A 4TVAB 5C0RL 4LFHG 1GGCL 1GPOH 2EZVA 2RMNA 3QYCA 3FQ2A 3VWKB 2YXWA 4AT6A 3KLHD 1BCPC 1Z7TA 2WKOF 4HPYL 5DDHB 2BVEA 3VFTA 2NVQH 1KFAL 3FFCB 4HZ1A 3EJSA 2GJ6B 2X4QA 1OGSA 5CEZL 4YDIL 3KPSE 4FE9A 2CZNA 4JL2A 2FHCA 3UDWA 1E9OB 2BOSA 2HYMA 1N0LA 4JQXA 1HNFA 4AQEB 1FYTB 4ZX5A 1KJMB 3I4MB 4K6LA 4FXTA 4NQEB 4B9XA 3IF1A 3IMSA 2J1ZA 3L1GA 3WTVA 2OKMA 2C3HA 4KRPB 2KBNA 3LX0A 4QRUA 1UWGH 2OXHA 3ARZA 1U2HA 4M3KB 4WW2B 1M6OA 4KMTH 4N2LA 3HG4A 3S36X 1A8JH 3R2IA 2F15A 4B7IA 4HIEB 2Y72A 3ZE0F 5HYJD 3LSOA 2WKDA 1T1ZA 3K2UH 4MZIA 1FJ1A 4ZUSA 3FRPB 1TVHA 3FO1A 3NT0A 4PZ6A 3H56A 4PEEA 1E5YA 1MFDL 4ZRZA 4PRAB 4LFCL 3ZE1B 5ISZA 3NIFE 2PW7A 5EB9A 4U1IA 5E1AB 4L63B 4XE5B 5DTFA 2ZP9A 4XBEL 4PVBA 1TJGH 3K71B 4OD1H 1OWRM 2RDFA 2EDWA 2HAZA 4WUUE 3ZU8A 4P9HH 1X4ZA 3FKIG 1C8QA 4XC3L 3UEQA 3BCFA 4NZFA 3PL6B 3SE3C 3LPWA 1BYNA 1VADB 1T2QL 1MRCL 4PVLA 4OGYH 3OW2A 4JRXA 4TVUA 3T8VA 2E56A 2A9DA 3CFNA 4JFXB 4HHGA 3X1GA 3QFDB 3VXQB 3GYRA 4FTVE 1AS7A 1KJVA 2BVUA 2ZKWA 3BO8A 5F0PB 4N28A 5IBLC 4PP1C 3EF7A 3RGVB 1O9WA 3THML 2B39A 4WTZG 4Y1AE 3PNWA 4RISH 1QE6A 2FO4A 2JE6I 2ZP0T 1UD2A 3DLLA 2AVFA 5DAUA 4P2OD 3IJ7A 1W3SA 4E9XA 4JRYB 3HBGA 4HMDA 5I1DB 3K6DA 2QPFA 1T3FB 1MW3A 3LMJL 2WQWA 2AZAA 3AMLA 2DWSA 3F85A 1L9RA 1RI8A 4P57A 4X7SL 4L8DA 3BG3A 4DZBB 1HILA 1M4VA 2DN8A 1KIRA 4LF3B 3U25A 2G9HA 1OT4A 4HKBB 2JJTC 3ESNA 4GZYC 3FMGH 3D18B 1VDZA 4UY8C 1C1EL 3ULUH 4PRNB 4FXKC 4YNYB 4X4XA 4MAYD 3P2DA 1XMQQ 2OTUB 5J0BA 1IGJA 1D6EB 3FB6B 1XQ4A 3AFQA 2VISA 2ZWNA 5A2IH 3T71A 4ZPVB 3TURA 4JZOA 4CC4A 4HU8A 1QHQA 5L4JA 1WJ3A 3ERSX 1WBXA 4N2IA 2PNHA 4OCYH 2N88A 3M1CA 1CKOA 2GTZB 1J0YA 5HHOA 4ZMQA 3KYKH 4KTGA 4XCNA 3QDHA 3VRIA 3MR9A 5FHBH 4BCYA 3NSYA 5DZAA 2YUZA 5DD1H 5E3FA 4EF3A 4GLAC 1BJ1J 1EV2E 4DV7L 4P23A 4H2CA 2PZWA 5D1XE 5JUEL 3LYRA 4G7ZC 1LQSR 2RH0A 1Y8PB 4XOAA 1JZ8A 3BP5A 1GC1H 3IFNL 1DOLA 3M6DA 4R5XA 1SOSA 3D69B 4YSUA 2DMGA 3T16A 1N4XH 1P5VA 4N6QA 4WHYH 3DTUB 1O9VA 4ZUWB 1KIXA 4YHPA 1ZIBA 3U0TA 3V52L 3KW7A 4ABUA 4KVNL 2N3JA 4JFEB 5L4MA 5TF0A 2BRQA 2N7AA 4E41A 2JJSC 2JSFA 4BSVB 4F3FA 4ZFGL 2BFGA 2MNJB 3O11B 3TWCL 4ZDHA 4IUUA 4HMEA 3E2HC 4KVPA 3KR3L 4QHMA 5E23A 4GNXA 3LHPL 3U7AA 2D3LA 3KJ6H 1VRSA 2TSAA 3V6ZB 1YHPA 3WS3A 3D0LB 1ZPUA 5INDB 4YHHL 5C09B 1CXFA 3JWOC 2VL6A 1QBLH 5LGHL 1F1GA 4XMPL 3HMXL 3MCLL 1MD2D 1T80A 2BRRH 1UKTA 3W39B 4Y5YC 2VLMD 2J5WA 2VJ8A 1VA9A 4DR1L 2F5AL 1AGFB 2W8CA 4P73A 3GBDA 2K3HA 5BRZD 1T5XD 4XB7A 1S7VA 3BU2A 4LOEA 5AW7B 5IB3A 3OAUL 3EH2A 5DWUL 3BKCL 1EJOH 2ERJB 4M6OH 4NCC2 1DVFB 4AQAA 3LQZB 3FSZA 3NSDA 3MO1B 2X10A 2BNQD 4FTDA 3HZKB 4KV5E 2MPAH 2YZ8A 2VLRD 1EJFA 2CM5A 5FXCH 1YMMD 3NRQA 4ACPA 5G55A 4X9YA 3GQBA 3ATDA 1MN4A 3H6JA 3J7AV 3PHOA 4IUTA 3ARFA 4X6CB 4FFYH 4WTQA 1ASOA 5C9JA 3DJSA 2HCZX 4FYRA 4KQ0A 2V7NA 4FJZA 4Z7WE 1SEBB 5D2LA 1VZGA 3C87A 4JFPA 1B3JA 4ZW6A 1QLFB 1EZVX 1Q1EA 1UB6B 1EANA 3HTLX 5HDRA 4D3CL 1F0LA 3AU1B 3DI3B 4GOPA 3F5WA 3FC8A 4A3KH 3GSQA 1CD8A 3WNPA 1BQLL 3UTSA 4RGOS 1E6OL 4KKSA 1GVPA 4FHKA 5JTWA 2H5XA 2H32B 4YDVB 4ANVA 1DZ0A 2B9AA 4P5KB 2BH0A 4LIQE 3T51B 2YPLE 3AMKA 4JHVA 4OGAD 1XR8A 4LK4A 5CP7B 5KZCD 4KHPQ 2F1MA 1KACB 1VGKA 2CHXA 1ZVHA 1W6KA 4R2GC 2WNKA 5DRWA 1SNRA 1YEGL 1UXWB 5FFGA 3S96A 2OI9C 1WA0X 3ALXA 1X5ZA 3SDYL 1PTOH 1PKOA 4L3CA 4OZIB 2XVKA 1U8KA 3PUWA 3O81A 2RCSL 4X3UA 2OJEB 3H3KA 4ABVA 1WC7B 3IYLW 4PJ8D 2F19H 3HKFA 1THCA 1VQ7A 1PW3A 4R7XA 4N0CC 3D0VA 3KLSX 1IKOP 4WKXA 1X44A 3BKYL 4JRWA 5K69A 3IKCB 1TZIA 1U8CB 2G30A 4BCZA 3S2HB 5DLLA 1BBDH 2VDMH 4B3TQ 1TVBA 5ID1B 3FFDB 5SWZD 3H0TA 3SKUD 1SVBA 1OCWH 2WQSA 4I18B 4EDXA 3PDDA 1ONQB 3RPIA 1SM3H 1X56A 4FI7A 3T09A 4GKKL 1SHMA 3S15B 4G6JH 4A3FH 1DOMA 5CGYD 1ZVSA 3SOBH 4QXTA 4CNIB 4L9LA 1VQCA 3QQ4B 2BSRB 3UCRA 1U42A 1IBGL 1B70B 2NY2B 2X9ZA 1LQBC 3MAWA 1B1ZA 3UDIA 1XPRA 1MNUH 3QNXB 1OM3L 3SY0A 5JXAL 3ZDXB 3H4HA 1P4UA 2Y69B 1J8IA 1E9QA 4PJCF 4PV9B 2R15A 1FHNA 1NNXA 1LO5A 3ZJAA 1Q8KA 4MJ4A 4NPJA 1DQIA 1KGXA 3OYYA 1RZ8A 1HT6A 4XBGB 4S1RL 5B1AB 2G5BB 2C3VB 2VO5A 3CCUA 3IM1A 3RNQB 5GRJH 4DV3L 4E5XG 3K2KA 2IH1B 4IUPA 1UCBH 1SF5A 5D4HA 3KDPB 4C1NK 1XWEA 1UZGA 5FO9B 3OAYK 4N4YB 4JCMA 4BY7G 1FSKC 4NQSB 4KTDH 1PAZA 4WHCA 3IXAB 4BSWA 4HDIB 3UZEA 3V10A 1QO3A 4NWUH 4F37F 2DNCA 1RUAL 3OPOA 1NEUA 2H4EA 2Q3AA 2XG5B 4DN3H 4PJDF 1RZ7L 4QHLB 4DV4Q 1J5OL 3UAJD 4DK6C 4NM4L 3WJMA 4MJID 4W9JC 3FQYA 1VIWA 4UM9A 5GJSL 3PF5A 2LGNA 2ZXCA 1G9NL 3H7BA 4L4TB 5J06A 5DD0L 1S5BD 1QFWH 3FYIB 3X14B 1J9RA 4KHZA 3T4AC 3BWSA 4HC1L 1PH5A 4RG1A 2QBWA 4K15A 4PRIE 4MZRA 4ATWA 4E42A 1EJ6A 1NCGA 5IFAH 2F0SA 1WA2X 2OULB 3L13A 1L7TH 3M1BB 5EN2A 5IK3A 4ZI8A 3QUMH 3TEYA 4RQQA 5DJXA 1CGTA 1NQBA 1CJYA 2ZWSA 1MCBA 3PQYA 4Y5VA 3RBGA 1I1RA 1X4XA 2CO6B 4G42B 3RVUD 1JK9A 3I4NG 3QEQA 4U6VH 1L6ZA 4YDZA 4YFEA 1KN2L 3QI9A 4WI0B 3II1A 2NY3D 1QEWA 4S1SL 3RHWF 2YC1A 2P5EE 3S9DB 4CVXA 1X3GA 3DGDA 2QLVB 2D31B 1WP6A 3ECBB 3HZMA 4KHTH 3L3GA 4PLJD 4JE4B 3LKOB 4LASH 1JF6A 3SDXB 3T3PF 5GS0H 2PQAA 3GSNB 5I71C 3CPFA 2J8HA 1AMXA 4ERSH 1O0VA 1R47A 4BBRG 2NYKA 3IDXL 4KDTC 5I8EB 5C8JB 1FO0H 2CNYA 2K5NA 2BP8B 1QKZH 4MMZA 1LE5B 4GJTB 1G9MC 4UTAL 1AMYA 1SFOH 1PZAA 2PWGA 5JIIA 2CUMA 3BSZH 4OCMC 3U6RB 3ERQA 2CE6A 2BVPA 1ZT4B 1DQQB 3SR1A 3DUUB 5KUMA 2PKDA 3MV9E 1SLUA 1GIGL 2K75A 2R4SH 4LESA 2UXDL 5ELFA 4IBWA 4N2EA 1S9VA 4LQFH 3QQ3B 3I56A 2RSNA 1JMCA 4M62L 5F7NC 32C2A 1A6UL 2PNRC 3VYPA 3HG1B 4D2NA 5GSVA 3GSNL 3TSSA 4Y16A 5C7XL 4QMGA 3F58L 4X9IA 4QD2E 3AW5A 2GTWB 5E4AA 4TKOB 3LKQA 4QQBX 5I73B 2GAZB 2ZX8A 4YXHH 2LAAA 1JZ4A 5H35B 2XQBL 1QLEH 1KN4L 2ORBL 2IVFC 3GMPA 4LVHB 5F7YC 4RWSC 2DM2A 2NTFB 2YGQA 2XVGA 3CX5K 1RULL 4Q9BA 4GI6A 5E7BA 4QRRA 1BEYL 1IGYA 2XY2A 5HDBB 5FKAB 5DD5H 3NE5B 5DEGA 3VSVA 3W82A 3WO4B 1NIBA 4QRTA 2XRAH 2UUDH 2E75C 1SJHA 5KBLA 1ZV9A 4GW1A 3ZTCC 5D5MF 3WD5H 1ORSB 5G2NA 3DIFA 2QGBA 2HTKC 3QUZA 4DH2A 5I0DA 1KNAA 5E9AA 4IJ3C 3U2IA 4OF7A 2J7ZA 1K4DA 4PRHB 1JGIA 1XMOQ 1N59B 5D6CB 5C07A 2DJFC 4IRJB 4BZ1H 3S35L 1Z3GL 2XQYK 5EBLB 1HESA 5L2KA 4WGVB 3ULUF 3C09B 5D7JB 5DEFA 5JJKA 3BDXA 3CFKA 3OSOA 4CKEA 7TAAA 2HIXA 3B56A 1XTMA 5HXMA 5HY6A 3MNVB 2JA7G 4PJ7A 3WY1A 3DXAA 4YO0B 1BG9A 3O3EA 3GI8H 5FUZL 3TBIB 3AXLA 4JLRB 4R9WA 1DBJL 4BBWA 2FJFA 1SHXA 3NIDF 1MCPL 4LEOA 4DV6Q 2F54E 4A55A 2R29H 2UXVA 3QXAA 5I1HL 2MKLC 4M00A 1U8MA 4H5SA 2PWFA 3VYRA 3PO3B 1CSQA 1AS8A 4FGMA 2B3RA 3X12B 4XXCA 1JNHB 4Q9QL 4OJFL 1KGUA 2KZBA 3QJHB 4ZFZB 3EJJX 3VNYA 3BUBA 4EZMA 3MTRA 3HE7D 1QSFE 4AW4A 2E7CA 5K9OB 3O2WH 1VQEA 2GBTA 4XBPB 1YA5A 2NNFA 3CH1B 1KTJA 4DT2A 3D1MC 4PTUB 3LEXB 3TN0B 2E46A 3AAZB 4PREB 1E2VA 3PPEA 5IW3A 1WZ1H 1ZLSH 2VRQA 1TETH 3SQOH 3U83A 5T5NG 1LL1A 1CU4L 2C9XA 1WFJA 1X5AA 4LAQH 2CO7A 2NNAA 1FIEA 3A5UA 4KJPC 2B5IC 3M85A 2NR6C 4P3CH 1GTNA 5JIMA 5DUPL 5AZEH 2AK4D 4D9LL 1OB1A 4UB0H 2IWHA 7FABL 3N0AA 3S1QB 5HHXH 1KSRA 5JOFA 5ECGA 2EYOA 2BSSA 1JP5A 2KZ1B 3FCTA 4Y8DC 1YPZF 5JOBA 2CW0C 3DO3A 5TE4L 2WSDA 1N0LB 2ZE0A 1Y69U 1HUMA 5T5FL 2O5ZL 3SEBA 3RMHA 1RD6A 1A0QL 4HK0B 1C12B 3CIAA 5I9OA 3IF1B 1TQOA 3P9LB 4S3SA 3F62A 3B9AA 1VENA 2ZCHH 3HNTH 4W4NA 5C2BL 1CD0A 3HS0A 5AZ2H 5DZPA 1RQ5A 3ARRA 3HA0A 1V7ML 3QXDA 1NGYB 5EF3A 4OCSH 1MQKL 4R7DA 4UNVA 1DYQA 4O5LL 2GKIA 2AXFA 3KHOA 2Q8AH 2D73A 2OQJB 4LKCB 3PIOA 3VE0A 5DURD 3TP6A 4LSVL 5D96B 3QWOB 4HAGA 4K6DA 4NDMB 3D3VA 5DWPA 3N41F 3TBTA 4YHZL 1AANA 3STZB 3W57A 4K5NA 2P5WA 3I8ZA 2IO5A 5DHVA 3NTKA 1J8SA 4UAOB 2O5JC 2VQTA 3N40P 4PWEA 1NLBL 3SO3B 3RKPA 5KWYC 1MIMH 3E3QE 1MKFA 1J12A 2V17H 2F58L 3P0VL 4Z23A 5CKAA 1BFOB 1GGBH 1KGIA 1H9SA 3LAFA 3ABLB 3D87B 3BPCB 3FL7A 1EQTA 4RGNA 2X41A 3NYKA 3SE9L 2JKLA 4LBEB 2NW3A 2J1WA 1U4PA 2Q7YA 4AYBA 2QVIA 1MFCL 4ZMVA 1PZ2A 1HQ4A 1E6JL 1PY0A 1C16B 3CBJB 4XO5A 2VMFA 3CX2A 2EYJA 2VL5B 3BO8B 3LS5L 1KJ2B 2WZAA 1HIMH 1IKNA 1IB5A 5KRUA 1J5HA 1BVLB 1TQWA 4X80H 5DJYA 4GP4B 4GEJA 3Q8BA 1BGXL 1P1ZB 4I4WB 3MRQA 4JHUA 5DVOA 3REWA 3WFEL 5F9AC 2VW4A 4IHOA 1PLCA 5DMGD 4ENED 2YTYA 3B2XA 4N2HA 3E0EA 4XN8A 3Q01A 4J6IA 5AVRB 2VUMH 3I75B 2UUCL 2F0QA 1A1OA 1IEBA 2P44B 3VSQA 1JV2A 3WLWC 2XC8A 3RWDB 1TVDA 4L3FA 4RBPH 5I2IA 1MCOL 3OSVA 3UYPA 3LEVL 3TV3H 5ACLA 1UH4A 1N3NA 3QNZA 4L23A 3O9WD 2P26A 1KJ2L 5I6YA 4C56A 2IMMA 3UJJH 2XXFA 1CTNA 3WY4A 4CU6A 1FP5A 4OX9L 2G2NA 2G75A 3KBGA 1A21A 4XI5C 4YBQC 5F0JB 1HHHA 4PP2A 4A3EH 3OGCB 1WZAA 1F86A 2CUAA 1IGJB 2B15A 1TQBC 3TS8A 5HDLA 4PRPD 5MENB 4TNVK 1XJVA 1N6QL 1FVCB 2HQLA 4JHZA 4WWKD 3ZTJG 3WS6C 1NA8A 5T1KB 1I4QA 3BAIA 3PAVA 1FFNB 4H0HB 5HHOB 5ITFB 3U2SB 2QQNL 2PYEE 2YKKA 2A68C 3ZX1A 4AKPA 5KN5B 3OWEB 2QW7A 2J44A 3KEDA 4W6WB 5LAXB 3NK9A 5FOBB 2Q0ZX 5DZOA 1EZVY 2UXBQ 2ZOUA 4OD3H 2SEBA 2K5VA 4JOIC 1JWMD 1LO4H 2DWEA 2GB2A 2MNWA 3BN9D 4P23B 4BA0A 4YAQA 2O61B 3L7ZC 2R4RL 2X0VA 4ZYKA 3WDIA 2AAAA 1R0AH 1U4LA 3CHBD 4XHJD 3PV7A 5IHUH 2VQUA 3UACA 2VZ3A 3MLRH 1N7MH 4N8CH 4JO4H 2DB8A 4FKEA 4BFKA 4KFZC 4RHSA 1MI5E 3ARGB 4XAKD 3U0TB 2QTEA 1N8ZB 2K05A 1LWRA 15C8L 1A9EB 2HG0A 1CDIA 1OE1A 1HHVA 1PLGL 2H2PC 3DTDA 3PGFH 1G1OA 2DLIA 1T21A 2WQAA 2KPWA 3MRHB 4F3FB 3RL2B 4ZOEA 3KLAB 1TIUA 3VGGA 3HLKA 2YU9H 2XQYA 2D8KA 3NGBC 4JE0A 4XGZB 3FUIA 3DDFA 1WBYA 2BFVL 2ZYRA 2JA8H 4Y89A 1ES0A 1ILSA 4AOFA 5L88L 3O4OB 3CFMA 2KVMA 1X6LA 2XTJC 1AFVH 4D9QD 1LLAA 1R19A 2JB5H 2JELL 4HJJL 1ZPLA 4JNXA 4G9FD 3GBLA 4R2GD 3T0EA 3APNA 4K23L 3VU2A 5JHAA 1KTDB 4XO4A 5TSSA 4YVUA 4D0BA 1EIGA 1AFPA 5IV2B 2CA4A 2VDQH 1TWGH 1HWHB 3MACH 4JX0A 1WS7A 2JA5B 4QY7A 5B1KA 2XPGA 1E0BA 1NCUA 4Z76B 5E7FA 2M2DA 3P9MB 3GXFA 4ICXA 5AAWC 3WHE1 3T6QC 3CCJA 1YAIA 2X40A 1CFTB 4I0PB 4HN7A 4ZSOB 4PJ5A 5ESQB 5CR3A 3B2MA 3VVWA 4R4QA 2VNUD 4WDIB 1QSEB 4J27A 4CC0A 4G2AA 2X9WA 1I1YA 1N0XL 3PV6A 1E5CA 4JI2L 4APQD 4JFPB 4GUPA 3MRIB 4Z7VA 3UMTA 2HFGH 4EZKA 3KE0A 2I60H 4YLCA 3KCWA 4XN4A 5K36G 2E59A 2XWJA 4GOPB 2BVOA 4BGDA 3BP4B 1Y1WB 3GSQB 4UWQB 2A83A 1NFDA 1XFPA 3CMOL 4N22A 3CDGB 4IGBD 2Q2HA 3U7WH 3VFRA 1R9FA 4U1KA 5E8NA 4B3EA 1ZV2A 3E1ZA 4DW2L 4KK6C 3Q48A 1U3NA 2ZKYA 5AQ0A 1I4XA 1V1OA 4JPIA 4OR1A 1G9MH 5JQ6H 1L1OA 4TXVB 3IFDA 3GLEA 4IRZA 2HDLA 2MCPH 2HJFA 2E7LA 1TU2A 1YLBB 1WD1A 3B9DA 3WFDL 3P20A 2IAND 1JPSH 3L7FB 2OYLA 1H3PH 1KPUA 2OTPA 1T66C 2VLJA 3S96B 2R7DA 4B9WA 3A0OA 1FPTL 4K94C 4L3CB 4WRLA 4PJCE 3FJTA 2EICA 2GHZA 3I6SA 4HKJB 3RUGA 1IQWH 2PCPA 2AGJH 1G1CA 1D7FA 4AL8C 4JO5A 5D7EA 3O4LD 4HIXL 4X8JB 1CQYA 2MOVA 2WP3O 4QF4A 1I9IL 2AK1H 3HVNA 4KY5A 3LPOA 3R7QA 4IDJH 1FNEB 5I5MA 4ABNA 4EN3A 5J6HA 4DR7Q 5F7BA 1NAKH 3PWVA 4IJHA 2DIBA 3H0TB 2IV9A 5GHWL 1DZBA 4G7SB 4JG5A 1AQHA 2VR8A 4GB9A 4XNUL 3H9HB 5L4FA 4RFNB 2JCCB 3IU3B 4WHYG 5DT1H 4MB1A 4BY1H 4KO6A 2F0VA 2X6CA 4MA1C 2X4PB 5GGVL 4Q6IB 4PJDE 5F7EH 4R90H 3ZKND 1L9SA 1HSBA 1L9QA 4F1ZA 1ETZB 4JDTL 5E00B 3FT4B 4LEXL 4N2GA 1KLGD 2XKSA 4L5RC 3M4YA 2YXFA 3X17A 1PD6A 1XH1A 3UGEA 3V4UL 3KZ8A 3MKGA 4R4TA 4U68A 3M4OH 2Y7MA 4GIOA 4KAQH 4TSAH 1F41A 1WI5A 1G7PA 1LO5B 3HHSB 4AV0A 1FNSL 1QWUA 3SK6A 1RZ8B 5CBEE 2ICES 3KGRA 4JDVA 1SXNA 4P2RB 4JI4L 2X6LA 4OGXL 4IRSA 5AW2B 4BUHA 2OP4H 4JFWA 1U6AL 2IY5B 3VU1A 5H8DA 3UOAB 1RZQA 3FU3A 4R4BA 1ZA6B 5G5DB 3MRBB 3VG9B 1A2YA 2IDQA 2PO6B 3JYCA 3O8XA 3EH3B 3UJIL 2OSLA 2QA4A 2VWEE 3Q5OA 1NANH 1S3OA 4WFFD 1D1IA 1ZHKB 2OCEA 3ETTA 3JTBA 3ZL2A 2DJUA 1PIFA 3NOIA 1PQZB 4B5EA 3LRHA 1O9ZA 4JBWA 5TJWK 2JH2A 1ET8A 4L18A 3T3PE 1D7QA 4GPVA 1J1OH 5K59F 1BVNT 4FFVD 5C0BB 4DAVA 2DIJA 3MRCB 4BFIB 3CCRA 1MBYA 4OEMB 4ZXBA 5F70A 4UM9B 2JWYA 3H7BB 4MX7B 3W0WE 3OKLB 1AY1H 1BIHA 3SPCA 1TZ8A 1X7TA 2NT1A 5E03A 4PWGA 1USZA 3QOLA 2CXGA 5FCSH 5IFHL 3Q2VA 4Z77B 2DMHA 3KJ4B 4QB4A 4KHXL 1EAQA 1EY9A 1YC8A 3QIBA 4Y2OA 1JJUA 1JYWA 1ZWIB 1HNGA 2IT1A 4O1NA 1DQLH 2OMVB 4G82A 3TT3H 4ACTA 3PQYB 2HHHQ 4OLUH 4A3KG 5GJTL 3EGXA 1SSOA 1JK9B 4TNEA 5IJVB 2Y6SD 2BXYA 5K9KB 1NICA 1U30A 4MGXA 1AH9A 4YSAA 4IBZA 3BAKA 4CVXB 2HFEB 2MMXA 1LK3H 1T22B 2G2RA 4XPBL 4LWCA 1WAAA 3D05A 3MOAH 4CA4A 3L3GB 5C0AB 3NEXA 3KPRD 4LLYA 5SX4I 2PQAB 1A1MA 2OR9L 1SUJA 4KDVA 3WI9A 3T6WA 3KWTA 5KYIA 3OAWA 4FQIL 5DMIL 3MMEA 4HIMA 1MFMA 5DUBA 1A7NL 1HYRC 2VDPH 3DV6B 1RUMH 4UDUA 5D5ME 5K93A 43C9B 4AQ1A 3QCVH 2B63G 3KL0A 1B50A 4GXVH 4MAZA 2I7OA 4JR9L 4AX3A 2NYZA 2Y0SB 2ASBA 1HHKB 1F4XH 2LLGA 4LCCB 4OSUL 1HQMC 1AOZA 3JVGC 4YDMA 1Q38A 3EYSL 3U1SH 2FH6A 2N7SA 4ZBJA 32C2B 4O4YH 3F7YA 3ALWA 2R92H 12E8H 2FBRA 1VQ4A 4HX1A 4KWUA 1Z47A 3L54A 5D7KE 3BFQG 2KECA 1CHQD 5CLYA 3ULUE 2IV8A 1YMHA 2VRKA 3ESOA 3BYTA 3WELA 2EIFA 1P16A 3GTLH 3NSXA 4AK2A 3DX4A 3RLOA 2YRPA 3B9KD 2YQBA 4V1DE 4A3FG 2RHEA 5FV1L 5T1DL 3AQDA 2X4NA 1SYFA 3GMPB 4OCXL 1X9RA 3MRRA 3FDTA 1H5BC 1OAZH 4C59B 1R3LB 1F11A 2UUAQ 3NIDE 1V1PB 2DPKA 4ELKB 2BOCA 4UZUA 4UM8A 2SNSA 1NMAL 3KLRA 1LTTD 3EGDA 3W56A 1BAGA 3CFBA 2KUTA 5CGBA 4LUOA 2A4EA 3CN1A 3DIFB 1I3RA 4P2YA 1S9WA 4QOKA 4H8WL 5KYYA 1P5UB 5ADOL 3WNLA 5EO0A 1K4DB 3VAEA 3VXUD 3DBXA 3H94A 3V7AG 4OGAC 4OUUA 1QI4A 1CURA 3BAWA 2CSPA 4KKCD 1M90C 1PZ5A 1N5AB 5TH2B 1AR1B 5L2KB 2VDOH 1DLFH 4H7VA 3DX0A 2VAAA 1AQKH 3IKKA 2F53A 4NI6A 4JB9L 2WVSA 4N8VB 3NPSB 1TFPA 4G7YL 2EDQA 1BQQT 3DXAB 4KJQC 2EACA 4PS4H 1D9KD 5IY5B 5KVEL 2HUHA 4L5TA 3MLPA 1VCBC 4NQVA 4A2FA 1Q9WB 1ROWA 2FJFB 4FMVA 1KB3A 1YPZE 4PMCA 3NZHL 1CI3M 2WVVA 4ZUUA 1INDH 4LEOB 2A1WH 4HJ1A 2PPCA 1I31A 2F7QA 1U8MB 4G3YH 1QJOA 5DEZA 5HGGS 2I0QA 1TITA 1OTCA 1FIGH 4G9DA 4XN1A 4GLVB 4OU3A 4MB3A 3UC0L 4JJ5B 4TSCL 3L9RB 3BDYH 4Y7NH 5HP5A 4IO9A 4JPVL 1AD9A 2CBQA 5C0NC 1RZJH 2R0ZH 2ISDA 3K72A 4LDEB 3ZOAA 5CGTA 2EVFA 4ZFOA 2NX5D 4MD5B 3UTZA 4KN4C 1X5YA 1E27A 3TRZA 4NRYB 1GKOA 1XIWA 3Q8DA 1M2VB 5I1IL 3VFOB 1D5MB 8CGTA 1WJJA 1NCOA 2F0FA 2HRGA 2WAQE 3MEFA 3KNBB 3EXJA 3CHOA 3EO9H 1FZMA 2IOMA 2E5EA 4PJGB 4Y2DB 2QR0B 4HPOL 5FGCE 1ZLVH 2N7BA 1OB1B 4POGA 2P45B 4UT6A 1KIPB 4K07A 5EUOB 4P0DA 1BVOA 3MLUL 3FTWA 4MNHA 3DVIA 3BH8A 3HBPA 3OZLA 4A2LA 4W6YB 1JHTB 4IBVA 1PYWB 1BP3B 1U8NA 1JAEA 2NY4B 4M48L 3QUYC 4KY6A 4KZDH 4HLJA 5D1QA 1T4WA 2VXSL 1TTUA 2Z0BA 2ZWKA 1JFQL 4ONGL 1A1NA 1DQTA 5JO5B 1KTKA 3VGEA 1F1DA 2EY6A 3OIPA 1FCCA 1FN4A 3CCHA 4L48A 3OX8B 2VDNH 1MAKA 4RSVA 4K3DH 1TCMA 2V4DA 1SGKA 2A5HA 4RGMA 4MDJA 3EHBB 3RJOA 4WNJA 3LRKA 3UAJC 3KPQB 3QXDB 3OOCA 1RKNA 2Z3FA 3KPOA 3TIEA 2AXFB 2NY5L 4M5ZL 4F7CA 2BCKA 3BIKA 1SMAA 1YYCA 1YNND 1JGVH 3BZFA 4OQTL 5KYNA 4MRBA 1R3HB 2YBRA 5KVDL 3QG7L 2Q3XA 1VQOA 3PAYA 2PCYA 5DMKB 1PX8A 1RLWA 1F4YL 3LDBB 1XBDA 4YSTA 1RK1A 1EEFD 1J5EL 4DUWA 2EO7A 4FQCH 3US0A 3JTTA 1H9SB 1JF1A 3L1EA 3RVUC 3S14H 4NZRH 1I9JH 1A3ZA 2Q7YB 1H9KA 5K9QG 3CXDL 4JVWA 1LDPH 1D2BA 1QEXA 1J8HE 4AYBB 1FGVL 1HZHH 3WUWG 2AEOA 2YA0A 1DONA 5DO8A 3PIP3 3L2NA 3G9VA 3MJ8A 1CDHA 4PLJC 2A77H 1L6PA 5DJYB 1I8UA 5EC2A 5E1FA 3UIYA 3MRQB 1UZ6F 4HEMA 1YNTA 2Z35B 2ZOWA 3VSUA 3EKCA 1F4WL 1I7RB 3PCYA 3G6AA 3TO2A 3EBEA 2R1YB 2TRHA 2C3GA 2K70A 2Z6BA 3GXPA 3VDCA 2W0PA 4CW1A 1IEBB 3OJ2C 2K5WA 4JI8L 3IE9A 1HKFA 1CVRA 1A7PL 1S7UB 1TWFB 4KX8A 5TE7H 5I2IB 3ZMEA 2XIWA 3OZKA 3SPHA 5F88A 1TJIL 3CPWA 5JQHC 1ZA3B 2CLRB 4DF9A 4NKLA 4N2FA 4DGIH 4M4RA 1W2KT 4HP5A 1OAKL 3UC2A 2BE5D 2EVIA 4K94H 3V7AE 1SDDA 1PIGA 3QG6B 5GADC 2F6AA 4Y19E 1OE3A 5LGKA 5D6DA 4RAHA 1ZY9A 2FZ3B 2XG4A 1MCRA 4KK8C 1ZS2A 4PP2B 2NTSA 3U4AA 5ID0B 1SFHA 5ERWA 4AL8H 2J5LC 4A93B 3QDGE 4F2EA 4KOBA 4AJ0A 3CSFA 4LFBQ 1PG7W 5DYOA 2ZTEA 4A6YH 1IW7D 3FQWA 4GS7B 3RFZA 1NBZB 4FABL 2VDRH 4HXBL 5D1ZD 1BCIA 1IC5L 2Z1PA 3OTOQ 1N34L 2QSQA 5CINL 1P6FA 3ZL1A 1IC4H 5DJ2B 4LCWA 2EDMA 2GJZA 1FL5A 4B97A 3PFQA 5F9DC 4YX2L 1LEKB 4ETQA 4YAQB 4B3RQ 1I8IB 1XXFC 5CCGE 1MEXH 3LZQA 2HRPL 1XSIA 1IC1A 2DEYX 3C8HA 3L3IA 4WI3A 4JMNA 3ZN6A 2DQCH 5IMOA 2FSEB 4ZJ9A 4PGEB 4CJ1A 1DJSA 3GSOA 4B96A 1Q9LA 4Y4FB 2KH2B 1JV5A 2WQVA 4W9HC 1RIHL 4AENA 5LCVL 3T1HL 1G6VK 3DV4B 2L12A 5C5MA 3FTGB 3MJ6A 4BFOA 1U3HD 4OGQC 1J0JA 3RDTD 1PEZA 5EBDA 5E08H 3QFJD 2K03A 2A2QT 1T20B 1LABA 4CVZB 1WISA 4YMPA 1M2OA 3RRQA 3BH4A 3CH8A 5AVQB 3TNMA 1XBRA 5I1LB 1EWHA 1ZOXA 3JWNH 2PCXA 1HH6B 2IXQA 2OF1A 3GMMA 1SBBB 4PJIE 2ZG3A 4ODSL 5I19H 5TFSH 5E4IA 1NPNA 1A3LL 4ZK8A 4AYMC 4BSJA 3ATFA 1PH4A 5GGTH 1TQVA 4ODUB 3LS4L 4JKMA 4M93B 4JKNA 1Z5YD 2IMNA 2H6UA 1PZCA 4Z95H 3SE8H 3F1ZA 1M9SA 1DE4B 1EIBA 5IHZA 1O7ZA 4H88H 1B0WA 3RZDB 3V0WL 1GOGA 4DNRB 1QI5A 1A7OH 1T0OA 2EEFA 3MUGB 5BJTB 3UL4A 5B3NA 3PWUA 4R9HA 3J7A5 2HLAB 4YJZL 1XSKA 4MYWB 4LF6L 1YG9A 2WJ5A 5FK9B 3IDIB 5CR1A 5JXEA 1YQ2A 1U3JA 2HTLD 4G7RB 4ZZFA 4KROD 5E5MA 4X6EA 1I1YB 3PV6B 4GRWF 1Q3LA 2HKFH 1G7HB 2WXOA 4K3JL 4OM0L 1KC8C 4GUPB 1G51A 4Z7VB 1FAIL 3UDXA 2VUMG 1EU3A 3EH4B 3ZKQD 1X65A 1JPFA 1U8PA 2K01A 2LXJA 2GQHA 4J12A 2XWJB 4OLVL 1ITCA 3VFRB 3DTXB 2XSCA 1IBBA 1ZEAL 5E95B 2IH3B 2W65A 2VZAA 4O0AA 3FO9A 3G6DL 4WW1A 5E8NB 4A2HA 3GO5A 1CGYA 4AV5A 5J57B 4CJ0A 1D2PA 2F3WA 3U0WL 1Z3RA 4PJEA 1DXMA 3NCYP 2FBJH 3S3CB 1L1OB 5EU6A 3VJ6A 1MW2A 1S78D 3HOGA 1UWVA 3PE9A 4NI3A 4U1HA 4WTXA 4JFFE 3NCBB 1Z0MA 2VXTL 4YPGA 1KPUB 1MLBB 2JK8A 3KPSB 4LHUG 1SJVA 3EFFA 4WJKB 4W9KC 4OZFB 1JDDA 3SPJA 4BUQA 1AZRA 3HS9A 2K28A 3WKYA 4PRBB 1EDHA 3G6JF 2ALWA 2W9EH 2NW2B 4MNQE 3ITPA 2FD6H 3F04A 4FP5D 2CLVB 3ZIMA 2BNRE 2I69A 3IRPX 4XWGL 1ZGLA 2R51A 4EN3B 3KLSA 4HIKA 3Q2CA 3EJZD 5FEBA 3PWVB 4F87A 1M7XA 5EOCL 4P9ML 1JK8B 2W59A 1DFBL 2EJMA 3MV01 4X0KB 2NY0D 1BZQK 2FRGP 2JQMA 3FF7A 2YZ1A 4DAGL 4F9PA 4NKOA 5MI0C 1Q1JL 1VGEH 3C5ZA 3UROR 3L5WB 5EWIH 3U4EA 1EDYA 1S4IA 3NIFB 5CD3B 5CU5A 5KYWA 4NO2B 1CL7H 1HSBB 1GTFA 3EDDA 1EL0A 4XXDA 4DO4A 2PWHA 5FW8A 5JHDD 2ZXDA 2O93L 2F4VL 4WUUB 2PN5A 2A74A 1CN4A 3QUKB 4DKTA 1MLCA 1T5EA 2NDGA 1G7MA 1PG7L 4JYAL 2ITCA 2W60A 3CBRA 3SJVE 3VA2C 3EA6A 2M83A 5LMUQ 3D8GA 1G7PB 3PO2B 2P28B 1PY9A 3HI5L 3N85H 4OKDA 2JA8G 5D7SL 3F2UA 1NDGB 5EZIL 1A47A 4TUOA 3CLEL 3FS9A 2A69C 2CPUA 2Z4IA 1T83C 1CKMA 2CQVA 2NZIA 4FTVB 3WNNA 2PZUA 3RI5K 4A76A 3ULVF 2FJGB 4BJLA 2M1KA 1NJIC 1HXMA 4OO1H 4Y1AB 1LNUA 3O8XB 3RWJA 2A9NL 4DKDC 3US1A 4Z7NF 3RBSA 4J7RA 4IUQA 1MCJA 1T1YB 1MI2A 1E5ZA 1GY1A 2E2HB 3CFQA 4YK4B 4CDGC 2V2XB 1GD7A 3MREB 1G0DA 2JSOA 4J1MA 2DQHH 3D50A 1JC7A 3WFBL 4FQLL 5ELBA 4ZXBB 1M71A 5C0DA 1QFHA 4P59H 3HOVB 3HCVA 2G4EA 1IAIM 2W92A 1RFDH 4MCYA 5BXFB 5C0EB 1JVOA 1AP2B 3TJHD 1E9PA 2NSQA 1CICD 1FA4A 1NGQH 3BN9C 3TP8A 3RURA 4B6ZA 1OY3B 4CSTA 1X5GA 3GGWB 3MOBL 4TVPH 4XMZA 1SLXA 3CDCA 1FWXA 2FJ2A 3WIHA 1KENL 3WY2A 5IB1B 5TF1H 2ZXPA 4FQ2H 3IDYB 4XZUA 4HUWB 4F20A 4KRMB 4QRAA 1YEDB 3X13B 1AQ8A 4GQQA 1JRHI 2Q6WA 5ALBH 4XMTA 2XKUA 1ZE3C 3PAZA 1XTCD 1SR3A 1QQDA 3OHXC 2M9VA 3M3YH 3FSVA 2PYEA 4N25A 3K7AH 1W72A 1GUOA 3E5SA 1WEJH 1P7QD 4RNRA 3T56B 2PW5A 4JM2A 4XP6L 3OL2A 5AOIA 4GLXA 1F9PA 1V55B 3J80E 1D5XA 4DR6Q 1LWHA 4K8RD 2XTIA 3II3A 2QQLL 1CYWA 2O5XL 4UINL 1B53A 1N5YH 4K2KA 4RDQF 5CGMA 1ZLDA 5ENWB 4HCRH 2N59A 1CK1A 2WYIA 4QXVA 2AXGB 3PJNA 5FWQA 3SDAD 3QNYB 4DJMA 4M5TA 1AHWB 4BDVB 2VC2H 4Z7QF 4WEMB 1XGRB 4R26H 3WENA 5EU7C 4Z0XA 3QDMA 2GI7A 2WXLA 4LOUD 4I3SL 2PPBC 3UBXG 3NQKA 2E4TA 4K3GA 3ZE2F 1UHVA 2D7TL 3HAEH 3M8OH 1AG6A 2CG9X 5GGUA 4K9EC 4NN5C 2SNMA 1WFUA 1P2CB 3NCJL 4HX1B 1A4KA 4AEHH 1I3GH 4UT9H 2HLFD 2XA3A 2CGRL 3QWRA 1A7QH 2B2XH 3DUSB 4XP1H 3BZCA 3SK4A 2EIBA 4X7EC 2C9RA 3AUVA 5IESL 2HKAA 2R2BA 3MFGB 5F44A 1K83B 5D4QA 4WENB 3T1YQ 3P2TA 4MJJA 2GFBA 3MFYA 5JPMA 3QBTB 1XZ0A 2PWDA 1JVLA 4LDOB 4NJAH 4APQC 4QJ5B 1E1OA 2IWFA 4GQZA 4BKLA 3GRGA 3PWPE 2F0NA 4OIIH 1U5KA 4M6NL 1FF5A 4X66L 3P0YH 2K6YA 3KWWB 5GAHC 3V6BR 4NQDA 4NZTH 4IGBC 3ARSA 4XTRD 2EEDA 2WSPA 5HI3C 5KYYB 3S97C 1JOQA 3I3DA 3LPFA 4FJ6A 4XT3B 2VQEL 2VXQH 5DSCB 3BYYA 3L0OA 3IWUA 4AI7A 4OCRL 3T2OA 3FW6A 3L1OL 1HNXL 2EJ1A 5CGKA 1EFWA 5JPNC 2ADFL 2YRZA 4PD4J 4D94A 2ESVA 4QEGA 4LRNL 1W6LA 2OYMA 4YZWA 5I1AB 4Z7WB 1IM3A 3UIZA 1YNKH 4U0QB 3VD0A 5F1OB 3P3RA 3CZNA 3WAJA 5IY0A 1LM0A 4Z7IA 1WHOA 4ORZC 1QYGL 1NINA 2IC2A 5D3DA 2D0FA 1S7XA 3K6SB 4U6XA 1F8TH 1P4BL 2FECI 2BSED 3VD9A 3NELA 4XNZC 4AC2A 1L7IL 5EEYA 3AB0C 4AGMA 3PDOB 4YIJA 5HYQA 2COQA 2DWYA 4G8GA 2YPLB 1QSVA 3ESPA 2Z91A 3U7YH 1CBVL 3ZYYX 2YD3A 1IE5A 4XMLL 1VHPA 4GN3B 1I4PA 4NC0B 1XB3A 1JOOA 2EO1A 4CSZA 5D70L 1BREA 4ZO6A 5E56A 1AD9B 3ZR6A 5FOJA 1LD9B 4WEEA 4YLQT 3L17A 3UTPE 4QR7A 2OMUA 4DUYL 2RIKA 2C9UA 4I0CC 2FWOA 2C34A 4JFDE 2IAMA 4XH2A 3ZHKA 2JQAA 4W9CC 4HIJB 1KHIA 1J5DA 3ROOB 4FG0A 1WZLA 4ODXA 1IEAA 1Q8MA 4YL9A 5IMMB 3FN9A 2AJUL 1BJ1H 1DBAH 3NBHB 4GINA 2HFFA 1MJ7H 1UENA 4D0CB 4LIQL 3D34A 4WUKL 3TASA 1SJEA 4P05A 4DUVA 5I1GL 2EYMA 1EQVA 2DLEA 5EAYA 4H1LH 3DSFH 4MNHB 1MVUB 4NNYA 3S5LB 3ZYIA 3QZOA 1M1SA 4P46D 1UUSA 2R56H 5FLUA 4HOXA 5HHPA 1YN7B 2FAUA 3BMVA 3STBD 3TDQA 4B3SL 1G5GA 3BMWA 3FH8A 4JI1L 2YPKA 2NY6B 5EZLA 4N9GA 5D1QB 3VXTA 4YZFF 4LSPL 2NVTB 1KULA 2NXYD 1BDYA 3EOBB 1X5XA 4G1MB 2YBGA 1DDHA 5CEZD 4C54A 2A73A 4FNFA 2N1TE 4J8QA 3GKWH 6PAZA 1A3TA 5J12B 2R92G 4I9WD 3QR8A 4F58L 1UZ6E 4WI5A 3B83A 3MV7D 2F74A 5F3HA 5AFWA 2FL5B 2JVUA 4UT6L 3D06A 5CORA 3OLEA 3CCQA 3CVHA 4KJOA 4BEIA 3QRFM 3DRQA 2LR4A 4Z5RB 5E2WL 1VSCA 2BCKB 1H3WM 2G2PA 3DX2A 1EHAA 2ZKXA 2DQ6A 3VWKD 4LPXA 2WV6D 5E6IB 4A7GF 2AQ2A 2YEVB 1NIEA 2XUWA 2FJUB 2YEZB 3I9GH 3QPQD 5F6IC 1TZHB 3BQUB 2GJ6D 4JFUA 3FT1A 4S2SA 4FDWA 3U48A 2GABA 3RJDA 3QJFA 4YS4A 2NB0A 3RPKA 1H15A 2ZUUA 3BGMB 1COBA 1U8IA 3V0DA 2Y6SC 4DPBX 1DO6A 1FYTD 4CC4C 2X4UB 2OZNA 3IRZA 3MA9H 1S5ED 2I5YL 2CFMA 2CBPA 3PUUA 1FBIH 3HR5B 4FQQA 5CMAA 4KRPD 4LPTA 2UUBL 4M8RA 4TQPA 3GRWH 5ETUB 3QCTH 1KXTB 5F9OL 4XCCL 1YNTB 4ONHB 4PRIB 2NRDA 3G6AB 4MASA 1NUCA 1UH2A 2C1PB 2OMXB 4MXVF 5KOMC 5K9QI 1WGVA 3H53A 1AXSA 2G60L 2I9LB 2E7HA 1CGUA 3QNFA 4KY2A 2ICIA 2Z9HA 1R3IL 2EYLA 1EFXA 4DQAA 4ELME 3SKMA 3CC1A 4GFXA 4AZUA 1OQXA 3C5SB 2CHNA 4BWWA 2OMZA 3LNGA 1T0MB 5KBNC 2J8UF 1RJTA 2P5EB 3LIZL 4YCVA 4OZGA 4Y4KB 4NCC1 3O6ML 2VERN 2ZUTA 3LHAA 1VEMA 2Y07L 1TNMA 2OZ4H 3QQDA 2H2SD 2KLRA 5LO7A 1BXUA 1OXTA 3W9EA 4J6HA 5TQ0H 1L4IA 3E0JA 1N36Q 4GNXC 1BFVH 4RH4A 5ERWB 1FL3B 3CSGA 3D31A 3B9KC 2YWYA 4HWBH 3FAXA 2Y3NA 2AKWB 1S7WB 4KKBD 2P52A 5CJOL 1JR0D 3FUNA 5A35A 2HUEA 3ECVA 3MGTA 4YHOL 3LKNB 4P4KA 1A4JA 5DYOB 4LJZC 3RGVD 1F4AA 3MNZA 2PQEA 1RJYA 3X3FL 2WZ6A 3VXSD 3NQTA 1PZ3A 1HH9B 1SDYA 5C4ZA 5C86A 3MV9B 2GHWB 1HJBC 3BUPA 4YFDB 4JRYD 4OZHF 4F93B 4UQEA 1FL5B 3HC3L 1J0ZA 3FP9A 2I24N 4ADIA 4PS7A 1IKFH 4GSDH 2G3NA 4U3SA 2FEDD 4AQYQ 4CJ1B 1ZXTA 1B9KA 1U8QA 3DGGB 3S37H 1U4FA 3ARFC 4XB8A 1R4PB 3WEXA 2H3XC 2PP7A 1MOEA 4J1UA 3AQYA 5DJAA 3L3JB 1GGIL 1Q9LB 3IK2A 3QEUA 2J25A 2DH2A 5I1JH 1OCRB 1QRNE 3RWHB 3KF6B 1HWWA 1NCNA 3H42L 4P5MA 1AZBA 1QOKA 5D2NE 1XGYH 3MRPA 4E9SA 1PA6A 4GQPH 5IJDC 2Z34A 3R1GH 1U8HB 1DUYB 1OOWA 4JN2A 3DIDA 1WIOA 4LW1A 1MZYA 1UADC 2D03L 1EA9C 4TL4A 4RKBA 2R2EB 5ISRA 2IALB 5ELEA 1KDIA 3G5XA 1AIZA 5IQLA 3D8MA 4FXGA 5D7IE 4L0ZA 5IB2A 3KS0J 4AXWA 2DICA 2NUCA 3A74A 2VMEA 1TFHA 4EAEA 5AEAA 4LMQD 5AW3B 3MXPA 3KVQA 5AVXB 2YOAA 4NSKA 5M95B 3JQOB 2EYSA 1EY5A 3K2IA 5DD6B 3B9EA 3L5HA 1NCWL 3U9PL 3FHWA 3VYUA 5B8CB 1HINH 2ZYIA 3L7EB 2P7TA 3JT0A 3VFPA 3T77A 4K14A 1CR9L 1SROA 3B4NA 3J07A 1CXLA 3IXTA 3X1NA 2W94A 4JFED 1YZZA 5LMNW 4NUPA 4C3IH 3AS3A 1MDAA 2P8LB 4FYTA 4TUJB 2F54B 4C4BA 5JW4Q 3IGKA 3HKZG 4Y7OC 2Q2EB 4X6EB 4E5XB 5BOZG 3L3DB 1U93A 4XP5L 1BEXA 4N2KA 1ZE3H 4U1JA 5DS8A 1QSFB 1T03L 1A6VH 1I53A 2B1HL 4BY7B 1P7BA 4LF8Q 4ZAIA 1S3RA 5C09D 4OLYH 4YBLB 3I91A 4L9LC 2K4AA 3VYTA 2W65B 3CIQA 4FG6C 4TSBL 4P2QE 2OMWA 3VWJA 1HCZA 3OKDB 4I5BB 4G5ZH 4JHWL 2FGZA 1MW0A 2IFFH 1K73C 1DVFD 2UUDK 3AROA 3I3EA 3EADA 5EPLA 5AENA 3AQXA 2Y4SA 1XCTA 1P6AB 4XDXA 4XN7A 4PG2A 3BVUA 4HQQH 1MJ8H 4U0RC 1UE1A 1AGCA 4QGUA 1AS6A 1XH2A 2I46A 2AW2A 1YNNC 4FI6A 5DZVA 3DSNB 4A7UA 3K1DA 3QJTB 1KBPA 2IJ0C 3QO2A 1FFTB 4K9EH 1TJHH 3UBFA 3UXFA 3GS4A 5CILH 4DP8X 3VXME 1HQRA 2B20A 5A2BA 1URLA 4FFZH 4KD4A 4DTGH 3GINA 5C92A 2R8SH 4ZKCB 1CF8H 4QRSA 1JZJA 3KH4A 3UADA 1SEBD 1G6ZA 1A14H 2PI2A 4NJ9L 4IOSD 4XNMB 4EI5A 1VQFA 4GKOA 4Z3JA 3LRMA 1ZGLB 4JAMA 4QUFA 3ULVE 3H2WA 1WWBX 3MRFB 2WHVA 3GIZL 5EOTA 5A2LH 3VTMA 4BZ2H 5E9DA 2HRLA 3MC0A 2EUXA 4PB0H 3MBEA 1KY7A 2I25N 3HZVA 3GJFK 4NKOB 5AB2A 3UTQA 4BBRB 3MROB 4F24A 3ZZ1A 5F0MB 3ONAB 3BEVA 5I74B 5A7EA 1PX4A 4XXDB 3CN4A 1KXVC 4LF9L 1NGPH 1EUJA 2EDYA 3BPOB 3LEYL 2A74B 1MIEH 4NUMA 1MLCB 4Y5VC 3KVDD 2ED6A 1G7MB 1IQDB 2CRYA 3BWZA 1CG9B 3QWQB 1I9RL 1FNHA 2O5YH 2R0WH 4MD0B 4WO4A 2NQDA 4Y4HA 5F2DA 4CN4A 1VEPA 4KXDA 5T1LD 3WE1A 2HDMA 1E4XL 4FQHA 4WKZA 1U33A 3I02A 3A54A 1QLRA 3CRKC 3NCMA 4UYPA 3QDJE 4MA7H 2HT4D 2NLJB 3DHUA 1GHKA 3TYFA 1CDYA 4DGVL 3IDNA 1RHHB 1XH3B 3RA7L 1VKXA 5F9WC 4R84A 4JI0L 3V9EA 5SX5H 2WXPA 2VMDA 1S7SB 3QGVA 2HCIA 5GS2D 4MMZC 2J3SA 2XTJE 2WZPA 2HCCA 1XGQA 3ZW3A 3NZ8B 2JYOA 5KGUA 4TYUA 4M5YH 2QHLA 3FU7B 4JFYB 3CKIB 4TUUA 2XWTA 5AAMC 4DZ8A 2CIKB 1EHNA 4FLOA 3PAUA 3ULAB 5EO9A 3OKEA 4GKSA 1UD8A 1T6BX 1WITA 1WUZA 3JZ7A 5I6LA 5CP3A 5T1JA 4RAUA 1CTOA 4ZOBA 3V7MA 3ZY7A 3RIFK 3ILQC 4XVSL 3R8BB 1WICA 5F89A 4BH7A 4J5VA 2Z4QB 4NQCA 3AM8A 1CLZL 4MJ6A 2BH2A 4O42A 4IZ8A 4C3JG 1AW7A 1QNZL 1S3KH 2B59B 2DY2A 2ZXQA 2WNXA 4MD4B 5KSAA 1GJUA 1MRFH 2EXZA 4HD9A 5B39G 3K5SA 1K8GA 3Q43A 3N0PB 4DEWA 1A8VA 1T5WA 3FPPA 1GHFH 3A47A 4GSQA 2Q6WB 4CKVX 1U3HC 4S0SD 1AIFB 3P40A 3W2DA 3OGOE 4YE4H 2PYEB 5CWSB 4R3SA 4LNRB 5HDQH 3X11B 1CMOA 3EJRA 1OP5K 4GRLB 1I75A 5HGHB 5DJZA 2VLKA 5IR1A 3IAPA 1RUKH 5I9QB 3RX8A 1UM5H 2FWUA 1IAIH 2DQMA 2ICEC 2IQ9L 3FQUA 3U9UA 2V2TA 5LMNL 1GYWA 3LD8C 3MYZA 3WLBB 2TRYA 5TPWL 4L4TD 4CILA 2RTTA 3TS0A 4M7JH 4OZIF 2AXWA 5C6TL 1ICTA 2FNBA 2GJRA 4Q0FA 4XE0A 1R5VB 5I6XB 4JVZA 2HXAA 2QKIB 2PUQT 1MI5B 2RDHA 5K9JL 1PRTD 3QDMB 2YD8A 5TGBB 2VY3A 2CMRL 3VCLB 1AN8A 3UE0A 5C3EH 3F84A 4M61B 2W07A 5GGUB 1XCXA 5K5YA 4GP8B 1S5FD 2KHIA 1QA9A 1WOCA 3NN8B 4HA1A 4KZEL 5M3MB 2DW5A 3BVWA 1FDLH 5E2JA 4RBPK 1TYRA 1OCCB 4AITA 1HXYD 3CN3A 2ADGA 2V1CC 2R2CA 3LH2H 5C0CA 5B4MD 2GN5A 2FMCA 5MP6L 1EHLL 5I9PA 3LGJA 3UE1A 1FO0A 3TH2T 3X1BA 4XXCC 1I82A 5JPMB 5AYTA 1XZ0B 2ATKA 3UBXI 2QZ5A 3Q5TA 4BKLB 2ZXGA 3GBEA 3DWQA 3T0DA 3BSZA 1CDJA 3MV8A 3QIWA 2ZZUT 3V4VB 4RFEA 1OPGL 1SXBA 3PXLA 1RK0B 3Q6GL 4P3DA 1YDPA 5DVLA 4DGYH 2VLLB 2XN9E 1DLHB 1HI6A 4F57H 5J22A 4F33A 3L81A 1LT4D 2WACA 3K80A 1BQRA 2XT1B 3VDAA 5FO8B 4WCYL 3CW2C 3VO0A 3OJVC 3SPIA 1ZDSA 1NGWB 3F05A 3BYYB 1OW0C 2ZP8A 3F6JA 1F18A 2EXTA 2BPBA 4FP8L 2CIIA 1SE3A 2R7EA 1S78C 2K6AA 2PABA 3SE3A 1IAMA 1MF2H 1AP0A 3GO1L 4PJHF 2FX9L 3HG1D 3SSGA 4PCTA 2KCTA 4ZMPA 3KJPA 3B6SB 4OTXH 3MNWA 3V4VL 1SY6A 3L3OA 4ZPTA 3DPBB 5FYLE 3ESVF 2ZICA 3DDGA 4TQIA 2OM5A 2L55A 5CSGA 2QGQA 1S5IL 5B38B 3FUKA 3IJHB 3MYJB 4L9DA 1B0RA 2DQUL 4U6XB 3RX5A 3V0VA 1TTRA 3JWNE 4UOQA 1K2DA 2K8QA 4HK3N 3DBSA 1KGCD 3DX9A 3BT0A 3WUWA 4YDNA 1UEYA 3NIGF 1R1CA 3D33A 3KYMA 3PABA 4FZEL 4EXPX 5AAPA 3LQAL 4TPRL 5LXGH 4M7LT 3WGVB 4PJ9B 3DROA 3L3HA 3N9GH 4Q8BA 3TTSA 1TWCB 3M7FB 2NY0C 2WLIB 1XGUB 3GBML 3UTTA 3LVEA 3M17B 2H47C 1RJLA 2BDNH 2EYTB 2ZTDA 2FUQA 3MRLA 3JAME 4ANWA 4PRHD 1NLDL 2DKSA 2WWNA 3FMCA 4WQOA 2Q2IA 5EJWA 1L3WA 2XYCA 2FWOB 4ZS6C 4LL4A 4IRJD 4WSKA 5CEYB 2EDGA 4PJCB 1SOXA 2JJTA 2WGXA 5H4YA 2ZJSH 3G5ZB 4CL7A 3VQ2C 3D48R 2MFNA 4FXKA 4ODXB 4TUKL 1VQPA 5E2TH 2ADJA 2Y7QA 3GJFA 2OBGA 3T5WA 4UI2A 3SDXF 5HVWA 3REVB 2FMMA 2VDLL 1NOLA 2ZKHL 3FPYA 4WNQA 3VXRA 1K8IB 3PIQB 5AVUB 1SJEB 2Q8BL 5JHLA 2GW5A 4Z0BH 4UOZA 4BS9A 1KC5L 2N3SA 2W88A 3BSGA 4LKXB 5IQOA 1K5NA 1IBKQ 3F65A 4DETA 4OD2A 2LAGB 5I8KH 1RMFH 3C5JB 3HZ3A 3W1GA 5I6NA 4NKQB 5KG9A 1TTBA 4P99A 5EZLB 3ARDB 3CZSA 3P4NB 2ZSWB 4XNYL 4LNQA 4CMMB 4DN4M 2GBAA 1FZOA 2OS7A 4IOIB 4J4PA 1E67A 5EEZA 3HAEG 3WJLC 1NC2A 4DVRL 1MPAL 5DYFA 5IT2H 3VFNB 4KPHH 3TN0D 2F74B 4NQXA 1RUQL 1ZXQA 5C08E 2NVQB 1I3UA 1T89A 4O02A 3BPNC 5LDUA 1BXTA 2AEIT 1KYOJ 3Q6FA 3X3GL 5CBEB 1RCVD 4C56C 3IMBA 3ULSA 4KK5D 5HVHC 3AVEA 5AB1A 1O78A 2AQ2B 4XMUA 2PMZE 4N87A 3RWCA 5IF0B 5L0QC 2ADYA 3PXHA 3VX0A 1JCKB 4UOJA 5HDBF 1KDJA 2J8UE 2WFWA 1R9TH 1JNNH 3WOEA 5CHNB 5DGQA 1TO5A 1GPOL 3O6FA 2DWDB 1U8IB 3K6OA 1MELA 1OTSD 1PNCA 1FFOA 3AU7A 3IMUA 4WFEE 1LTID 4Y5YA 3T3PB 5MEPA 1A02N 5CMAB 2IPKB 1RZKC 2E47A 4ZAKB 4A3CH 3KCPA 3W0WB 3CZFB 4XOCA 1K8AC 2OL3A 4K8RC 1L5GB 4POFA 4AH2B 3PS6A 1Y8OB 5ANHA 3V0GA 8PAZA 2A19A 3P3TA 1E3XA 3S1RH 1UWGL 1V8QA 5G3LF 3KBPA 4OZHE 3SDAC 2B77A 1EFXB 2FDBP 3SKMB 1WLHA 2ED8A 1Q86C 3EO1A 1XX8A 1HKLH 4XYQA 1KCVH 3CSYA 3K2UL 5C44H 4JJOA 2OMZB 1LEGB 5A2CA 4JI6L 5FYKU 2EDLA 4J3OC 3SQBA 1ZHBA 2H3NA 4K7PX 3DHMA 4TRPH 2HH0H 4XO8A 5CCKH 2MH4A 1VQIA 2V7HA 4IM8A 1HYSC 2HLFC 3KXFE 4NQEE 3U30C 3EAKA 2MQGA 4YOKA 3BD4A 4JFSA 1TJGL 4U1SB 2BVQB 2GK0A 4OD1L 4JRFA 5E8OB 2WIIA 2HJLA 5DJ0B 1EUTA 3JTSB 4P9HL 3WFHA 4DK1A 2CJSA 3MGTB 4L3EA 5J1ZA 3EYVA 3RWEA 5D5MB 4RSYA 1I6HH 3VD1A 2TMPA 3SHSA 3CV5A 2P4AB 2YQ2A 5FUCE 1NDMA 2FNWA 3AWFA 3DMMB 3LZOA 4OGYL 4NP5A 2AJ3A 3T08A 1ASQA 5CIPA 1MCIA 3SCMB 1PF3A 4LP8A 1SYGA 3E7JA 4NZ8A 4K5XA 4PUBH 2B2WC 3Q9PA 5GS1B 3QYNA 4XTRC 1VCAA 4W70A 1CZWA 2V5SA 5B1JC 3V0EA 4AIZB 4AVKA 3SGKC 3V4LA 1JBJA 4TVPE 3V5DA 2Z31B 1ZK5A 4XODA 1BZDA 3B43A 3HFMH 3B6YA 4AY0A 4BH8A 4GW4A 1TXYA 1KB9K 5F3BB 3FBQA 4V1DB 4MMXB 1ASPA 3OTTA 1SOQA 4LHUA 4XCYA 2HLEB 1C4QA 3NSFA 2X4TA 2DQDH 5I0XA 1TPXB 3IRCA 5LAPA 4WFGE 3VGAB 5F7UA 2XDHA 3T0VA 1XX9C 1NAMA 3NIDB 2BMKB 3W81A 1PXUA 3ZBMA 3TBSB 4FMFA 4DKFH 2D2OA 4FF2A 4PSPA 2WXQA 5MEND 3V2TA 2VIRB 4PWFA 4ZTOH 5DD3H 3WYRA 1G7LB 1I5FA 3B7UX 2O6FA 3WE6A 3NUCA 1D5ZA 3FMGL 3NH7H 5T1KD 3CRLC 3ULUL 1N9PA 2GSIB 1R34A 1RAMA 4LDLB 1GA2A 3S37X 1MFBH 5A6LA 4GNKB 2Y6TE 1TWHH 1BD2E 4KQ4L 2HJKA 2E7LC 4JV5L 2NZ9D 5CV4A 3QO0A 5D93C 3AG1B 1VACB 4YSCA 5JW5A 2VH5H 1NR4A 2CQAA 4OCYL 4FLRA 4HFWA 5FHBL 3ZQ9A 4WJ4A 2UY7B 4HKXB 5EZJA 4NWTH 1T2XA 4YGAB 3ARGD 4X4YB 4DV5Q 3VFPB 2EUZA 1RY7B 5J39A 2F8IA 4QGYA 4P5TD 1P4LA 5E2VH 1FE8H 5BZWB 4PJBA 1GC1L 1UUNA 3RYMA 3PIO3 3LZLA 1JGLH 3AS1A 1N4XL 3FT3A 2MJWA 3ARQA 1MFAL 3MLTB 4C83B 3RWFB 3PMFA 1SYSA 2R69A 1MCCA 4MZ3A 3ZHDA 2EDDA 4YPJA 3VSTA 2F0MA 3HE6A 1WSST 3D5OF 2YQ3A 1BBWA 2ENQA 2NXYC 3UZQA 4C4KO 1VERA 3EGSB 4MWFB 3K4ZA 5DM73 3OKKB 3IDGB 4MA8H 2WTRA 1NWOA 4QIRA 2IBGA 3F6IA 3WAKA 2WAQB 4JI3Q 3KJ6L 3CD6A 1QP1A 1YJDH 2BX5A 2XN1A 5DO2D 4X3KA 2J1XA 3V5HB 5LGJB 2N78A 1QBLL 4JEGB 5FGCB 2GYSA 4I85A 2BRRL 3HBQA 4W9EC 3FSAA 1XGPB 1E65A 5HPMA 3OAZH 5EGTA 4I0PD 2BP5M 2CR0A 3VWKC 1DJRD 3ZO0A 2K7PA 2IDFA 3CHPA 4R5VA 3FT0A 3VD7A 1EJOL 3FBKA 1BQ5A 3QPQC 1KQSA 1HQRB 1QSED 4J23A 3OJDA 4XVJH 4RKLA 1NOFA 1ZT1A 1B2WH 4A3KB 1MH5A 3QO1B 2MPAL 4X62Q 1JD7A 1SMXA 3G08A 3TFKD 3UDFA 1OANA 4KDTA 1UXLA 3W3AA 1ORQA 2ED7A 2WTOA 4JY5H 4LLWB 3NJMA 1AZVA 4M43H 1S7RB 3NFSH 4DSYA 2WQRA 5E1GA 5EUKA 1J87A 4FFYL 3OXRA 3RZCB 1TR7A 4KRPC 3OR7A 3BRDA 1PH3A 4DNTB 1ET7A 2Y9RT 5AYUH 4DV0L 2A0LD 5CXPA 3UTQB 3H55A 1S9YB 3GSRA 2FJHA 2K9FB 2OCCB 1OGAA 5CZRA 5AVTB 1PTOB 2V0AA 3ARED 3QIBC 4FYQA 1F97A 4B0MB 4KXCA 3KMDA 1EEYB 2PP8A 2XRSD 2R2HB 2Y1VA 1BQSA 2ZCLH 2JI1A 2Y2TA 2ITEA 1E7VA 5M5XH 1HNZL 2CK0H 5I1KL 2ZAHA 2EDKA 2BLFA 4F7XA 1CGVA 3UBXA 2WJ7A 3ZKXB 4EE2A 2P24B 3HEIB 1F3JB 3O3BA 4HIIA 4UIMA 4Q9RH 4HKZA 4TRDA 2AEQH 2LE9A 2VDMB 4YHNA 1ZTMA 3NJLA 1J8HB 1IC7H 4M8QB 4ALAL 5I0ZA 5BQ7B 2BXZA 4L4VA 3P30H 1H9JA 4G6AC 3TEUA 2E2IH 2C4FT 3OC8A 5HURA 1ZLVK 3UI2A 5D14A 4A3FB 2DM4A 4JO1H 2B0SH 2PETA 1WTGT 1FJGQ 3IL8A 2ZCKH 3G5VB 4G6KH 4KKBC 3MUJA 4P72A 3QR0A 2DEWX 2F19L 5B3JF 4P2CG 3RGVC 1CM9A 3CTTA 4AQ1C 3MWYW 1NC4A 5H2BB 3OB8A 4MS8C 4P8QA 4ELMA 1BBDL 2VDML 4Q74A 5EO9B 4JANB 2CDFA 3OKEB 3PHQA 4GKSB 4AM0Q 1T7YA 3C08H 3EUUA 1WFQA 1OCWL 3BAYA 3U4VA 1I1AA 2XWXA 5FYJU 4W9ZA 3PWLA 2I07B 4NQQA 2HN7A 3BGFB 3F7RA 2KCMA 1S5HA 1Z9SB 3JWDC 4G6JL 4Y19B 1HHJA 5AG8A 3SOBL 5F89B 1QRKA 1T4KA 4OXPA 3P4MB 5D2LF 1XSJA 1CKNA 5C4XG 4HAFA 4QRPA 2GK2A 2Y36H 3IDJA 3F7VB 2DLTA 2E6JA 3K58A 3AC0A 1OXVA 4P2RD 1KELH 1MNUL 3QDGB 2MGSA 2KHSA 1DQJA 2WWMC 1GMEA 3FH5A 2AQ3B 3HPLA 4IKLA 2H0PA 3RY6A 2NNCA 3E9HA 2PO6D 4IIQC 4CDDC 1ETJA 4BFEA 3TEWA 3GTTA 1LUZA 5CBAE 3AS0A 3HBZA 1KXHA 4BFNA 3AY2A 3FRUB 5GRJL 1CXHA 4ZX3A 4HCSA 4FA8A 3KLQA 4Z7UA 1F42A 1U3YA 1UCBL 5KVFH 1S2EA 1STAA 5HYSB 4JI5L 5C0BD 3FQUB 3U9UB 4CN1A 3FTVA 3SE0A 1MFNA 3QUMB 1KWGA 3OXSB 2AQQA 4RDBA 4NWUL 3GSVB 1BCPB 4M29A 2R0LH 3T65A 2APTA 3CXFA 3GRBA 5FF6A 5T1MB 2R1XA 3EJUA 3W9DB 2G9KA 1BVKB 2H8PB 4MQ7A 1E3ZA 3BZDA 1BZ9A 1I6VC 2W07B 4U05A 4CU8A 5HY9A 4HOWA 5I66B 1ZVYA 1QA9B 1QFWL 1YQVH 1FGNH 5EDSA 3N1GC 2ZTCA 3OQ3B 5HHQA 3FOMA 4PJHE 2MCAA 3UO1H 4LF4Q 4UMSA 5MEOB 4ZMXA 2R27A 2GVYA 4YR6B 4JK0D 5IFAL 3S8WA 1B6UA 1L7TL 1M1XA 1XD0A 3NJNA 1N68A 4FQXA 3QUML 3T0WA 5DRZB 3AG3B 4X6DE 1FO0B 4GQRA 4UQDA 2D4DA 3CD4A 4PJIB 3NJVA 3ATEA 5C0AD 1FZJB 4GT7A 3CXHJ 4M7KH 3TPKA 3ZZSA 1SFOB 1RP8A 2B3IA 3S3BB 4NXML 1FZKB 4N8UA 3IFOA 3GTVA 2ZPKH 4U6VL 2YAHA 1YYMH 1Q81C 1RZKH 1J9QA 2OXGB 3SQRA 3E6FB 3V0FA 3HZXA 3ET9F 5F7DA 3NIGE 4RCNA 2YD0A 3HI1B 1HI6B 1DO5A 4UU9A 1ZS8A 3SBWA 4WGWB 3ZDWA 3TF4A 4K8RH 4UTBH 2O6CA 3LY6A 4KHTL 4BHUI 1XIWC 5FM8A 4LOVA 4YFLI 5EH1A 4YXKH 2DDQL 4NPYB 4LUVA 5GS0L 4UOW1 3K7UA 4JL1A 2DIEA 2VZOA 3D85B 2ERJC 2P43B 3ES6A 4MJ2A 4ODWA 4XNQB 1CL7I 2V2WA 5ABAA 5MHSD 2NN6I 4KJNA 3K6FA 5J1AA 1FO0L 2AQSA 4PIRF 1QLEB 1QKZL 3EJYD 2B16A 5IMLA 4QXUH 5IREA 1JGUH 4JI7Q 2QLYA 4AQOA 4GXFA 3BSZL 4PM1A 5CZXD 2X12A 3MNWB 2CUHA 4J3OH 1YY9D 1EPFA 2ZXEB 2K04A 1QVOB 2ZT9C 5TK4A 4R8NA 5CCJA 4Y8AA 4LQFL 2QDLA 2R9HC 1IBML 2EVHA 2BIMA 1B0RB 4DAYA 2DN7A 5IHLB 5IOCA 1QHPA 1K2DB 5GGQH 3ZMRA 3PUXA 1T6VN 4PRPE 4K3HA 4ODTL 4M6MH 3K0XA 4U1GB 4UQ3A 2JI2A 4P2QA 5HHVL 3WUWB 4RGMC 4YXHL 4OIJA 1ED3B 2WQ8A 1QLEL 3L3HB 1IV8A 2K9UA 3DKHA 1K3BC 2BC4A 3FQNA 4BXXH 2H6PB 2WXGA 4OCNC 1ET6A 4XNXH 3CDZB 3LV3A 4JFFB 3TA3A 3MRLB 4LL9A 3LNNA 3GB7B 1BLNB 4HZAA 3VI4A 3GSXA 4IU3B 1CDUA 2XRAL 2D9QB 4YSQA 4R4OA 3MZ5A 1AR1D 1TTGA 2AEPH 2WINA 4QHKI 3FZUC 5I16A 1A0IA 3WD5L 4BELD 2H9GB 1RZPA 3NJJA 4FXKB 2R1WA 4U1MA 4MNQB 2Y7QB 2E2JH 1JXJA 3AS2A 3VQLA 1MHCA 1LK2A 2BNRB 5CJ8A 3S6CA 1J0KA 5IQ9A 1P0SE 4IU2A 5IBTH 4BZ1L 2GVAA 4FCHA 1LHZA 4OF5A 1KB5H 4NENB 3WS6A 3UCQA 4N90D 2OX5A 5CEXA 1K5NB 1QVFA 4OD2B 5H94B 1TS2A 4LFCQ 2CHBD 3S2AA 4E0RB 5KG9B 3OWRA 4ZODA 3N40F 1LT5D 2I9TB 3HZYB 3VRJB 1IAOA 3HS8A 4JOIA 1RVFH 4I7AA 1F6LL 4L2YA 4ODHH 1M7DB 5C3EG 5LQBH 1DEDA 5HHME 3KWXA 3V05A 1MFEH 3HG2A 3ZHFA 1P7HL 5KSUB 3LKPA 4X5RA 2R29L 4IRZH 2ED9A 4JY6A 4Y1SA 2JK5B 3FFOA 3SJVB 3V2AR 1CQVA 1AO7A 4JFOA 3D4YA 2G5UA 4O2DA 4MCNA 1MQ8A 1MWOA 3QZLA 1UB5B 3Q6FB 3V5KA 3VFGH 3WKPA 2ZXBA 2EE1A 4H26A 3ULSB 3O2WL 1PHJA 4Y2DD 2CJUH 3ILPB 3VG0H 3V0HA 3QJOA 3D12B 3LN4B 1H9MA 1ZLSL 1WZ1L 1L3NA 3SQOL 1CDGA 1TETL 2FHTA 4PGZA 7CGTA 4JGNA 3GSWB 4GQ9H 4LAQL 2NZOA 4XQJA 4JM4H 4K0KL 1Q9OA 4MJ5A 5DUJA 1PYWD 3FQ1A 3FCSA 4G8FA 4DN4H 1CE1H 1NJ9A 1H0DB 2VQFL 2GITA 4D8OA 4NO3B 1BZ7A 3NRFA 1XF5A 4GKZA 4UB0L 5MEPB 5IGXH 5HHXL 3BZ4B 5TE6H 1G6RH 1TTCA 2VE6B 3EJIA 1II4E 1UVQB 3CFUA 3TZUA 3C2AH 5F21B 3ENEA 5FCUH 2YSSA 4HS8H 5ECJE 4YSEA 3UJTL 3MRKB 4KTYA 4ABWA 3HG0A 4W1TA 5FECA 5DK0B 3EFOA 1RODA 3EHBD 1CIDA 4WU5A 5AAWA 5DHEA 4GG6A 4PJ7F 4HUUB 2EADA 1KOAA 3MJ9H 3N55A 1IGFH 4GW5B 2ZCHL 3HNTL 1I1CA 2V9RA 2VB2X 4FVMA 4NOBA 2YN3A 1IGMH 1PRTC 3CSYB 5E5UB 1G6PA 5AZ2L 1AGBB 3H2PA 2E86A 1K0SA 4JPWH 3QIUB 4OCSL 3CZLA 4MAUH 1SYCA 1A6AB 3SQBB 1I7TA 3C60D 4RGTA 2V7HB 1J9CT 4OT1H 3BEWA 2EH8H 4DV7Q 2Y1ZA 1A6TB 3O4LE 4LLVA 1XF2A 3HKZA 4OFVA 5J8OA 2GC4C 1MIML 2XOTA 2V17L 1OL0A 4CHTB 3CCLA 3HOUH 2X1WL 1ZSDB 1SN2A 1GGBL 3W38A 2VUMB 1NCHA 2C5CA 5HYJA 4HXAH 3J7HA 2QVFB 3MRNB 5EBWB 2WUBH 4H8HA 4E9VA 3C6SB 3BRFA 1UXSA 2Y7NA 5ISZE 4PJGF 5CJBA 1ADWA 4LCUA 1B90A 4WV1B 5GGRY 3K4AA 1HIML 4R97B 1P4IL 5E6ZA 1OP3H 1BJ8A 4X80L 4IBYA 2EQSA 3UG3A 4NRZB 4UV4H 2MO1A 3J80L 3M7OA 5A16B 3C2SA 4OB5H 4A3EB 4X64L 4YHHQ 1IBZA 1MNNA 4BH8B 5DMYA 1IO4C 3BDBA 3K6NA 1SYVB 4LHUB 5E4WC 2VM3A 4JRXE 2X4TB 5JW3H 4DR1Q 4A6YA 5L7XL 1JICA 4DA2A 3Q6SA 3CMAA 3ILDA 3PWPB 3TV3L 5AVSB 5BUAA 4LVOC 5FHAH 3SEPA 1W91A 4N26A 2QGEA 2PP9A 4LVHC 3UJJL 4EBQH 4IN3A 1KG0B 5AJ3L 3HI6H 4WFFE 3IJEA 3EF4A 4PMEA 2WMPA 3DJZA 4KQ3L 4P2OA 2H5UA 4YH6A 5TDOB 1IBLL 2Q8RE 3SZ6A 3G48A 3I3CA 2HJKB 1OB0A 3T9WA 4MBRA 5TDNB 1KRSA 4Y52H 4DUXA 4KUCD 4LU5H 4HFWB 4ZUIA 1IFHH 1LVEA 3V6OA 4HWZB 2Z0SA 3JWDH 3U46A 2COVD 3C09C 2YU9B 2CLZB 4N0UA 4OD3L 1FG2A 1LO4L 4Y4FD 3TA4D 4Q9CA 3QJXA 5HGDB 4MAYA 5IYCH 3OPZH 5IMKA 2JA8B 4L1DA 1P4LB 1R0AL 4HIOA 3RVVD 5I26A 3A8KE 4A3DH 5I8CA 5IHUL 4EQ2A 4KK7A 5EBGA 3TCXA 4AMXA 2F0GA 3GI9H 1N7ML 4N8CL 1RERA 3ABZA 3FT3B 3OHMB 4JO4L 5GSRA 1X3QA 2AITA 4F9PC 1JG9A 2VN5A 5KNCA 5B7MA 3C5ZC 5AOMA 3FQTA 5F7FA 3PGFL 2RQXA 3KPRE 2F0IA 2VDQB 1TWGB 3B1UA 3T4AB 4FS0A 4LPCA 5C44G 3P69A 1A3RH 1B4JH 2GT9B 4GIPD 4JFDB 4KKAC 4Z9KB 4QY8A 4KVNH 1NR2A 2OYPA 4QNPF 1JTTA 1EIHA 5E7NA 3TXAA 3DX6A 1JMXA 4LGRB 4PB9H 1CLOH 1AC6A 1A66A 2W5PA 5L8JB 2KA7A 3RTLA 1AFVL 3GMOA 1KTCA 3I9PA 1R3KB 1U92A 4U49A 4KFMA 2GUYA 1MWAA 3S88L 1WCMH 5KSVB 1JNLH 3VFSA 1OHQA 4E41E 3NCYS 2ATWA 3VMNA 4YHKH 3GXDA 4KK5C 5EZOH 3NPPA 3FKIH 1KBVA 2Y3AA 4GKKQ 4XMPH 5E94A 4YN3A 2VDQL 3EN2A 3C5XA 3MACL 5JZ7D 3TCLB 5KVGH 2CCLA 2WOBA 2GA4B 1ZT1B 3A6CH 1K8DA 2XJLA 4LLQA 3K1KC 3O41A 3E3XA 1U8JB 4MLIA 4NBZB 3SDDB 1G84A 3G71A 4L5SA 1ORQB 2A9MH 3EYQD 1HOCB 2ATPB 3BWUC 1DR9A 1VESA 4DPCX 3U6XA 4WHDA 2WXHA 4X4MA 5EUKB 1ZDQA 3BLPX 5J4MA 1Q7YC 3C8KA 3HRZB 5BRZA 1T5XA 4BA1I 3MODH 1U91B 4X5PA 3DYOA 4NP4H 2RQ8A 1UXMA 2LABA 5B3JE 3GMLA 4JC0A 4DV3Q 4X99A 2FJHB 2HFGL 5GRVK 2HG5B 2BNQA 2I60L 1SJMA 3SPGA 4DO6A 1QD0A 5TDPA 3DVNA 2VLRA 4EX5A 2IX3A 3CQZH 3KPNA 3SZKC 4DUZL 1YMMA 3O3AA 3ZO9A 4A7VA 3F6LA 3U7WL 5CSZB 1AOHA 5K39A 4J3OF 1DBKH 4HJUA 1WRFA 1EY4A 1I50H 3KPSD 4N0FA 4A3LH 2DF3A 3HRPA 4XOBA 3T2NH 1GW6A 4UIMB 1G9ML 1Q12A 3CFCH 3N06B 4UAOC 5JQ6L 1H5BA 5D2LE 5EPJA 4JJHA 4CDHA 3MRJB 3VFUA 2FX8H 2ITDA 2MCPL 1VCIA 3SPVA 3ASNB 1JPSL 4PLOB 5EORH 1H3PL 4BHUA 3WXWH 1D5XC 4DNIA 4WWPA 1UM6H 1PDQA 4BY1B 1W0VA 3UTSE 3GP7A 3WIFB 3D39E 2PR9A 1IZ6A 4NZJA 4YDJB 3WJJC 4K8JA 5GAEC 1IQWL 4IJ3B 5EPMA 2AGJL 1HR0L 4G57A 5EBMB 3VXNB 1UM4H 2AI0H 4M1DH 5E5LA 3S36H 3VGBA 5D8JH 2AK1L 4AH6A 1TS3A 1NC4B 1NEZG 3MTSA 4IDJL 4NQUA 1WD0A 3M4OB 1NUGA 3QULB 5LBSA 3VB8A 3RVXD 4DHLA 1IBHA 4ELMB 1NAKL 5AW5B 3VYOA 1UKQA 1Q0XH 2BINA 2EIJB 4WUUD 1KIQB 1WIPA 4I3RL 5ICYA 5EEWA 4NFCA 4XN5A 3ZQWA 2HN7B 3JBG7 1S5HB 5DT1L 2X9XA 4FCAA 1BO0A 1KL9A 4P5SA 5F7EL 4R90L 4Z7VF 4PJ8A 4DXFA 3NABH 4LLDA 1VEOA 2HT2C 5IJBC 5ACZB 1KMGA 4J6RH 2PZTA 3UABA 1TDQA 4EUPA 3EZJB 3SDZA 4FTVD 1BXVA 3HUJA 2VL4A 3KPMA 4XHQA 3W11D 2FYVA 4NDXA 2AQ1A 4FA7B 4KAQL 5H4ZA 4TSAL 4TN9A 5SWZA 4Y1AD 4DAMA 1IBGH 2BCMA 2YHGA 1U2CA 2X6GA 2IBBA 3NTCH 5GRYA 2VXWA 5JXAH 3O6LH 2UXDQ 5DM63 1FV1A 3B3IA 5EC1B 2Z7WA 4HGKC 1ZAGA 2OP4L 4ZMNA 4QO1A 1U0QA 4X5XB 3ESMA 1EAJA 4Q2ZB 5GS2H 5IEHA 1CFSB 5FGBC 1TUPA 1MJUH 3NZSA 2K0RA 2B5IB 4U6HA 4M3JA 4G7QB 4X7TA 3RUGF 2AJYH 5IUCA 2R1XB 1J1OL 5AZUA 1P9MC 2JMRA 3I6LE 4MQ7B 1QRNB 1RUAH 3BZDB 4ADJA 2QPEB 3A6BH 1AY1L 2ZG2A 1E90A 5HHNA 5D2NB 3ARGC 3CVIH 3GMQB 5CJQH 3ZL4L 4G8EB 5INCB 2MSPA 2FEEI 4HHAA 3HEJA 1DBMH 4FEMA 1IEHA 2NUTB 5I6WA 1V1QA 4HGMA 1AE3A 1CA5A 1JGDB 1QW8A 1WFNA 1DQLL 5FV2A 2JXMA 1HC1A 3TT3L 1ND0A 2OTWA 4G7HC 2VDPB 4OLUL 5SWSD 2Q86A 4HF5H 3UAJA 2XPZA 4JFQA 3D4WA 4MJIA 2C1OA 5D7IB 1FL6B 3FB7A 3N04A 3O4OC 4Q89A 3E8VA 5D1XD 1A4CA 1LP9E 5JDSA 3QR2A 1F77A 1ZS8B 1LK3L 1TT6A 4HSAC 4NKDB 3HAEA 1N67A 3FTXA 5C0IB 2EP6A 2EE9A 3HFZB 3MOAL 3SKNB 1WTXA 3KPPB 2MHAA 2XWBB 2F03A 4LF5L 2R92B 1FNAA 1KUMA 1J5IA 4Z3IA 1DANU 1CTMA 5IT9c 1F6AA 2BP0B 2PXYB 1SE8A 3NFNA 1II3A 1XZWA 1IBDA 4UCFA 3ORJA 2PR4H 3QEQE 1CZGA 5L9DH 1GZQB 4LFHD 2VDPL 1KT2A 3OMNB 1RUML 1KCRH 2ZOLB 4JFZH 2KDYA 3VVVA 3GUTA 3QCVL 5DZLA 3KLLA 8FABB 4GXVL 1A6ZA 4POZD 4FF3A 5J13C 5E1QA 1F4XL 4I48B 4L8BB 3U1SL 1CB4A 1X3FA 4M03A 4O4YL 1N12A 2MFIA 2FO1A 12E8L 3KVPA 3TFKC 5IJKC 3F12B 4W81A 4H25A 1BOGB 4V2BA 4P2QB 1TO4A 3MFFA 3SE4A 3S2DH 3IFPA 3Q8AA 1JZEA 2FQFA 4TNVF 1ZHNA 4EZJA 3OMAB 4ZUVA 1N2RA 3UP6A 4OFIA