2A74C

Human complement component c3c
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
307
structure length
296
Chain Sequence
TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement Component C3c
publication title Structures of complement component C3 provide insights into the function and evolution of immunity.
pubmed doi rcsb
molecule tags Immune system
total genus 61
structure length 296
sequence length 307
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2a74C02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 2a74C01
2ICEC 3CU7A 5FO8B 1EDYA 2A73B 3T4AC 3G6JB 1AYOA 2QKIC 4LNVA 3V96A 1PXUA 5FO7B 1JC7A 2WIIB 4FXGC 2XWBB 3FRPB 3HRZC 1BQQT 2TMPA 2I07B 5FO9B 1JB3A 3L3OC 2XWJB 1XWEA 2WINB 2J0TD 5JPNC 3CKIB 1BUVT 1BR9A 3I70A 2A74C 4ILWA 4D94A 1GXDC 1UAPA 2B39A 1BV8A 3OHXC 4FXKC 1D2BA 2PN5A 2E2DC 3HS0C 1UEAB 5FOBB 3KLSA 5JPMC 1OO9B 3MA2B
chains in the Genus database with same CATH superfamily
4DA2A 5J3BA 3WKYA 4XCYB 4BSVA 4JJ5A 3ZR6A 3JWNE 5DJ2B 5C0RH 1BCPD 1WCMG 3GUFA 5F96H 6FABH 3SPHA 1ORQB 4PJCB 4M8VA 1M57B 4MDJB 4JFDE 2W9LA 4Q6KA 3VI3E 4DR1L 5DO2D 5BJTB 5L8JB 1A6VL 5CLXA 3NZSA 1DVFB 4GMSL 1CDHA 1V7NL 3BPCA 4JOIC 2DQUH 4MX7A 4PB9L 4X42A 3PJSB 1KB5B 1T3FB 4G7YL 4S2SA 1PAMA 4XP6L 3D50A 2F54D 4F2FA 3KJ4B 4HEME 4P5TC 3NEMA 1X6LA 3K80A 3MXVL 2EYLA 1OO9B 1BZ8A 1JZ3A 5HHPB 3ZIYA 1W16A 2GJPA 1XYIA 2VCOA 3FUDA 3D39D 3NQIA 2APFA 5T3ZL 2YLHA 1CLOH 2AMGA 4LNRA 4ODSH 4PMEA 3LEYH 4MS8D 4LSDA 1YN7A 1MW2A 4OF6A 3O11A 5LBSA 2ZM6L 3GSWB 3W5MA 3ZW3A 4MBRA 3IAQA 4JRXD 1JJCB 4R0LA 4H1LA 5I28A 1DZ0A 3B2UD 1PTOC 2CLZB 1Z9MA 1WUZA 3DM3A 3Q0HA 4UT7H 3I4NG 4WKXA 5LXGL 5HGDB 5E1FA 4R4NC 4NENA 3OKMB 5DSCB 5JHLA 2VDOL 2FR4B 3HN3A 2ESVE 5IK3A 3QO1B 3WMQA 2AWOA 4WFHD 4N9TA 4UY8C 2JMRA 4XZUA 3ZZSA 1NBVH 3GLDA 3ULSA 3MZ5A 1A65A 5GADC 4GBXB 1OWRM 2CXKA 5AVYB 4PLKD 5FYKE 2LW3A 2ZUXA 2CQAA 1XF4B 1LYLA 3CW2C 2ENPA 2XTJB 4ZYKB 1XEDA 2JK5A 3LEVH 1KG0A 4H7VA 4HMJA 4U6XB 2ADYA 2L11A 1JWMB 3GTJB 3HG1E 1KJ2A 3MRIB 4D0DB 1T22B 1WVZA 3LIZL 5CBAB 3DVFA 4LSTH 3UBXB 3IAYA 4ORGA 5KUMA 2CWAA 5A6IA 1EWIA 4O2FA 3FK3A 3HG2A 4JPSA 2J7ZA 2VN3A 3RUGF 5GQBA 3ASNB 3C2AL 4RAHA 2JJSA 1KCUH 1KYOJ 3K5LA 2GUOA 4Z3JA 5IHZA 2OMZB 3W11C 2HVJB 1Y69U 3Q2WA 2C4XA 5DQDH 1CL7I 1W8NA 3LPPA 1D2PA 2UWEF 4EBQL 1E1TA 5ACMA 5FV2A 2GVAA 4OU3A 3SDDC 4U1NA 2OTWA 3GM0A 5C0XH 3CPLA 4Z78A 3A5VA 4DU9A 2J4WL 3QJZA 4U1KB 1KYAA 3WNIA 1RAMA 2MQCA 4RMUA 4A63A 4ODTH 5F0PB 5KVGL 5EU5A 1RIVL 2EAEA 2Y7QB 4DZBB 1XMOQ 4JI3Q 4HJJL 4Y1AD 4UQAA 2E2IB 4AQEA 1UT2A 2Y5TB 3EOAA 5K59F 1PS3A 4PLJC 1T2JA 2XXFA 2W38A 3EGSB 5GS0C 2F8VA 4IGBA 5HYJD 4WO4D 2BSTA 2Z6KC 3KLKA 4PREB 5BQ7B 2IDQA 2VSKB 3QPXL 4JCMA 2PI2A 1WBYB 2XQYA 1KGYE 1ORSA 3MBWA 4O2EB 5EU7E 1IAII 3CXHK 2IBGA 4JPQA 1PHJA 1NBWA 4K2UH 4KY2A 4H5SA 3UABA 3BVXA 3AEVA 2BJML 1IL8A 1OAZH 3OMCA 2PO6C 3SYQA 2OXHB 4FFYL 2HQEA 4KI0A 2JLPA 3RHWF 3OYYA 2BSED 1E4XL 2Z7UA 3JZ7A 2K5VA 3NBIA 2O5JC 2UXDL 2XN9E 2ZYSA 2PCPA 2ZWZA 2W1NA 4WENB 3B9KA 3UJTL 4BE6A 2F7PA 4C3JH 5IGXH 2JCCF 4DUZL 1OP3K 4ZUIA 3SDAD 4AOFA 1DCEA 1RIHL 5IB1A 2DQJH 2OAAA 3FXIC 3II1A 2IAND 3SPCA 2XA8H 4ADJA 3EIFA 4PJAE 4FG4A 3A5UA 1UGNA 3ZLQC 4CDCC 4P2YA 4DPBX 4C3IB 3AFPA 4GIPD 2ROXA 4DP4X 1EEYB 3HOZH 1MCRA 1SSOA 3IGAB 5B1JA 2YOCA 1YEKL 5KVEE 1JERA 3UBHA 5HPMB 4QRPB 4HD5A 1ZT1A 2XKNB 2DMHA 1VS0A 4XC3L 4QXUL 1J10A 2FD6H 4NUPA 1MDAA 1L9RA 1S7VA 4HIPA 3THML 4S0TD 4AK2A 1VFBB 1EDQA 5F9OL 4LVOC 2DY8A 3N1QC 3ZE2F 4LNVA 3F7YA 5KVDL 4BH7B 1TLMA 4CAGA 1NOAA 1BOGB 4M00A 2KVMA 4QRRE 2PYKA 1U8NA 4U6HA 3TEYA 5ELFA 3V7MA 4PJ7B 3S1RH 3L4CA 2Z8VC 3HE6B 2YIHA 4O1NA 5E2WH 1B0IA 4UOW0 4LUZA 2WQSA 3FQWB 3QIBD 1QKZH 4FNQA 4L8SA 1TZGH 4GSRA 4ERSL 3OWEB 2MQ0A 5AAPA 2NDGA 3IJYB 1JV2A 5IVXF 5HHNA 1LK2B 2IALA 1MREH 4JC0A 3V5KA 2DWDA 5GGTH 1KXLA 3BSHA 3VW3H 3FHWA 2WXGA 4POGA 1P6FA 4JFYB 1T5XB 1INDL 4LLYA 4PSRA 3OM3B 3SE4A 3T0BA 4AIOA 5D72L 5DC9B 1EJ8A 3SIKA 4EQ2A 1TJGH 1OCRB 5I82A 5FK9B 1UJ3C 1UE1A 1KLFA 1WO2A 3CSFA 4LOFA 3STBC 5J3HC 1MXGA 3VFVA 5BPPA 4JHUA 3PGDB 4PJFA 1JT8A 3BU2A 4ZDHA 3FZUC 5I4DA 4K7PL 5CCHE 5EEXA 3CCUA 3ZHFA 4MQXD 1CQYA 4XZ4A 1LE5B 1HXMA 2WQWA 4GN3B 4BBRB 1GYAA 3SJVB 5C86A 4HYTB 2B2YC 1GHFH 2R69H 1AG0A 1TJIL 2XN1A 2BVQB 3KF6A 2G60H 2NLJB 3QQDB 4M6NL 4DVBA 5T1IA 4YGAB 1FGNL 4ELMB 1K83B 1J0JA 5DVMA 5A7BA 4JBSA 3J7AV 4ISVA 3M4QA 5F3BA 2AJSH 3U79A 4RISL 5ID0A 1VQLA 2DZEA 5JXAH 1A7NH 4I1RA 1L3WA 1WAAA 4NSKA 3BGFC 1K8OA 4Z3IA 5GSRB 3JTSA 2XG4B 4CC4A 4FA7B 4YSUA 5H35B 4NQDE 1MCFA 3S16H 2ICWJ 2LLLA 2E6JA 3O6LL 4NWUH 4DFHA 3L4WA 2RJMA 1EGJL 1TZIB 1F11A 2D4FA 3E3XA 1SM3H 3IXAA 3L7EB 4XXDA 5BS0D 3CPWA 1OTCA 1K8DB 1IBGH 4W9ZA 2X4TA 5AUMB 3UC2A 4XPBH 5CR3A 1MIMH 1OGPA 4LKCA 4AQZA 3NCWA 2BRQA 3VXUD 1QZHA 3ZJAA 1FE8L 3ZKQD 5B38A 2J4XA 5EU3B 3OMNB 3HBGA 5IWAL 3MC0A 1J88A 3PWPA 3RUGE 2R1XA 5D3IB 4F88A 1J0YA 1IB5A 2MFNA 3A67H 4YSTA 4FJYA 4I2XA 4PJ8B 3P9MA 1ED3B 4U1GB 4CU7A 2FINB 4PBWD 3CH1A 5ICXA 4HAKA 2XZCL 4OZGF 1NM9A 1RV6X 3L4TA 1A6ZA 1NQBA 5HVWA 5ELDA 4JFDD 1GGCH 1B0GA 4RNRA 5E70A 1N68A 2Z8LA 3G04A 3EJQA 4TQHA 4BY1H 2HRGA 1ZAGA 1YA5A 2FSEB 2NY3B 2KZ1B 1STEA 5KYXA 3IMRA 3SK5A 1ODUA 1IXRA 2KMWA 3CFDA 1HC1A 4H8WC 5IMLA 3WE6B 5K59E 2KKQA 3TJEL 1S7SA 2FBOJ 4KY5A 2GTZA 5TPWL 2KQMA 3SY6A 4A3GB 3BUTA 3CVIH 4LFBQ 1DDHA 3ICEA 2QGEA 4JDEA 3T8XA 4M7KL 4XR8C 4BK4A 2B4CL 4MMXC 1W2BA 1PZ5A 3C5ZA 3GMQB 3CDZB 3RIFF 4C56B 3Q06A 2F0HA 1BFOA 2XBZA 5C0AE 3WKMH 1AQHA 3VFMA 1XH0A 2CUMA 3NBHA 4KXAA 3WFCH 1MCDA 4R7XA 1IAIM 1K8AC 4JZNA 1VA9A 4UOZA 4GRLA 4YBLB 3MYJB 4JBWA 1C16B 3DMMA 1KCSH 5F2DA 2EABA 1TCRB 2X70A 3VFWA 1OAXL 3VDAA 1BVLB 3NCYS 2IEPA 4LFHD 3QJHA 4PGCA 2PMZB 2RGSA 5DJYA 5E4OA 3ZOAA 3MTXA 4HXAL 3T0EA 4HR7B 5G3LF 3F12B 2DQFB 5TD4A 2ESVD 2PNRC 3CCQA 2FWOA 4Q4IA 4DN4H 4CMMB 2VDPL 2YSTA 1JZEA 1CMOA 4JPKL 2B8OT 2J20A 4FQPA 2NX5B 4QLRA 3T2NH 5HJ3B 1DSWA 4OI8A 4PWFA 4XTRD 5FYKD 3RWFA 3MA2B 5FUCC 2ICEC 2NY1D 2ADIB 4K3DH 3BAYA 2B3GA 2IGTA 2KCCA 4Z7QF 3SE8L 3IFTA 5LGJA 1TWCB 1EPFA 5T5FA 2VUMG 2WB1A 3GMLA 1J6QA 4M8RA 3HG1D 3U6RA 4U3HA 5IYBG 2GEEA 4WO0A 3SYCA 5GS0L 4TVPE 3BVWA 1HESA 1Q9LA 1ZA3B 1K5NA 1QPPA 1ZANH 4U2YA 1HCYA 1A3RH 1L9QA 4P9HC 15C8H 4TUOA 5CFHA 3K46A 4JI1L 4YHHQ 1HKLH 1QP1A 1UFUA 2F7QA 3PG2A 4L8BA 3WIFB 4DO4A 3UGUA 4P5SA 3VE0A 3BZKA 4DV3Q 1II3A 3H2PA 4P2RE 5GISH 5ITFB 4F58H 2FJFB 4YLCA 2X4UA 3GS0A 3CH8A 4O02L 4QGTA 3WEXB 4MYWB 1N0LA 2ORBH 2DYRB 4MRBA 5EF1A 2N59A 2QR0B 2V33A 4F33A 1YEHL 1PLGH 1XXFC 1LWHA 4N0YL 5IHHA 1MNUH 1NBVL 3EAKA 2B63H 3NQTA 1ZTXE 2KHSA 4FQCL 1GIGL 2YD9A 1JGLL 3IFPA 3VSQA 5IKCA 4Z7OB 1NBYB 1EIHA 1CXKA 1SMOA 3LEVL 3PXHA 1HUMA 4I9WE 3MEHA 3IDGB 4IKKA 5IVXE 4C83A 5A2CA 4DV7L 1M4KA 2N56A 4ODUB 1TTBA 3E3QC 1U8PB 4L23A 4DOHE 5JAVA 4P2OB 5D1QE 2A68C 4B3TQ 2MTAA 4ENEC 4EGVA 2BH2A 3AZUA 3CC7A 1JAEA 4OD2B 3FOMA 3NFPB 3EG9B 1IAOB 4AGMA 2Z65C 5COYA 1KCUL 3W9DA 3MN8A 1AAJA 5GGQL 2RH0A 4GP5B 1NH6A 2CCLA 5DZPA 4IALA 1XGRB 1S46A 3NOIA 5I2IB 3HFFA 4KO9A 1ZHKB 1SJEA 1WS7A 5FUZH 1QUNB 2EDEA 1TIUA 3KHQA 4HJGA 2BWQA 2P44B 3ECWA 1BJ1H 4NIKB 5HGBB 4YR6A 2B2TC 3FUKA 3BPLC 4NDMA 2XN9D 4MJ5A 4NPJA 5F44A 2A9ML 3ESUF 1IT9H 1J8SA 1BZQK 4ODTL 3WG7B 4HXBL 3UDGA 1INQA 4Q52A 4V2CB 2NXYC 3LNFA 4S1SH 1P1ZA 4P4RB 4QI3A 3PABB 3VWKD 4A04A 1NGWA 1XF5A 3HVNA 2VXVH 1JJ2A 2VDRB 1X6OA 4LCUB 1NIEA 1S7WA 1T1ZA 1T20A 3PIOA 1RJZB 2WBJC 3GJFA 3QDME 1YN6A 4LK1C 2DTMH 1OAKL 2WXNA 4NZTH 3EGXB 3UFIA 1YJNA 5DLMH 3UDWC 5KSVA 3QNYA 5I5MA 2WW8A 1B6UA 2J2ZB 1I6VC 1WD8A 2JTDA 4K2UL 3V6FB 4RFNB 5CIPH 5IR1A 4GKLA 1KPUB 3U46A 5D2NA 4Z7WA 2YQ2A 2UY7A 2GJ6E 4TNVK 4HZLB 5CGYC 4DR7L 1MFVA 1GOFA 1C5BL 5DHVH 1JGIA 4MD0B 2Q0ZX 1WI5A 5F9JA 5J1SC 3BH4A 3NFNA 2IOIA 2NDFA 1F00I 4Q74A 4ANUA 4QRRD 4XN4A 1JORA 2XWJA 1SJMA 2BIPA 3KFUA 1EL0A 1ZRUA 3REVB 9CGTA 2RDFA 1JPGA 4MD4B 5CUSL 2J56A 5EZLB 4YHLL 3T3PF 1A5FL 1CKMA 1F90H 4JI5L 5IROA 3QG7L 2GB2A 35C8H 5DCCA 5ID1A 4Q9QH 1XR9B 1KV3A 3N52A 2CMRL 1OARL 3AQQA 4BBSB 1QLFA 1OQOA 1ET7A 5D5MF 4AJWA 5I2YA 3QWOA 4BFIA 2WIMA 5KN5A 2OSXA 2XN2A 4G8IB 3MLYL 5D9SA 5HY6A 1Z2KA 2CALA 1SDDB 2MHAB 4PJDA 1SPDA 1CFSA 3MV7A 4ZFFA 4OLWH 1YNTB 2Z8RA 1NR4A 2OMBA 4Y7NH 1DUYB 4YXKL 4GI9A 2WXFA 4GKNA 5CR1A 3SCMA 4M5ZH 3DV4A 5IT2H 2HX7A 1MNNA 4WGWB 4J1MA 1B3AA 1FZKB 5C70A 2Y3AA 4HX1B 1KBPA 1RZQA 1XCXA 4H2AA 1WC7B 2VLKB 4HAEA 5A16B 3F6IA 1NICA 4RGNC 1KHIA 4R3SB 1LWJA 4JRYA 5EQ0A 3QZLA 3JWOC 1QKZL 4POFA 2HDMA 4JHWH 1TSRA 1RZGB 4TS6A 3WIIL 2OMNA 1BLIA 2D7OA 2UY6A 1ZEAH 4B5ZA 2X6BA 3U2SB 3J7AF 1E4KC 2R2HB 5DZ9A 4LF7Q 1XSOA 5GPRA 1M2VA 3DV6B 4X8XA 4ZUJA 3V6BR 4LKXB 3QCVH 3MU3A 3D08A 5F7BA 3WY3A 1BD2E 2YC1B 1JGDB 3EF4A 3QB7C 4PIRF 3T6WA 4XT3B 1FNEB 1A4BA 4G1MA 2NTSP 3L13A 4J27A 1H9SA 1LO0H 2MNAA 4IJ3C 4Y89A 3K7UC 1ICTA 4TRPH 4Y9GA 2R39A 2HH0H 4HUKB 5D71L 2PQAA 1HXYB 1A9BB 4KVNL 4H8WL 2VSMB 3TZVB 2NY4D 3T04D 1EXUA 3COOA 3WNMA 3HS0C 1O9VA 2G60L 5CHNB 2V2XA 3UYOD 1G84A 4L2LA 2WGNB 5F7HA 2AKWB 2PPCA 1OGAA 4XOAA 1CJYA 2N01B 5D6CB 1KC5L 3FNKA 4N2OA 4MA1C 5AAMA 1Z9NA 3L3IA 2A6EC 3BP6B 2M00A 4Z18A 3LCYA 1C7SA 4UDTB 1TU2A 2IAAC 4OV5A 3H0TB 4QXWA 1YMMB 2EIEA 3KDFA 5DLQE 4GRWB 2WBWB 2BH0A 4Z6AT 4K3EL 3V7AG 4JKPH 5C0EA 3T77A 4Z3EA 2WWMC 4IM8A 2PYEB 4FP8L 1BF8A 1YZ6A 4X5PA 1JHKH 1MIML 5J06A 2J6WA 5IBUG 1PU0A 1QVOA 1FAIH 3FTVA 3TV3H 5I1CL 2PW5A 3SDCC 2YTXA 2A9NH 4TTDC 2ZOKA 2NY7H 3ARFD 3Q6FB 3D85B 3PS6A 3TBYB 4Y19A 3U25A 5CD5D 5DRWB 4DK6C 2VLRE 1DYZA 5FIEA 3Q48A 4AXWB 1LYQA 4DCQA 5C0AD 4I77L 5I18L 2K45A 2HCCA 3LDBC 1QUPA 2M2DA 4F20A 3HJEA 4YE4H 1X32A 1KLUA 3BN9D 4N8CL 4QHUA 3RVVC 2A1WL 5M5WH 1XTDA 3KOJA 4E0RB 3RLNA 4K8RC 3UMNA 2C26A 4NI6A 2R2BA 3OJDA 3P75A 4GO9A 2GIMA 3V0FA 3VU1A 1T0PB 1KGWA 4FTVA 3KYKH 5E1GA 1HZ9A 3ATDA 1VHPA 4DESA 1JP5A 3D0VA 1NCDH 3VFTB 2XWEA 1G91A 3VFNA 4DAVA 3IMVA 2TRYA 3EYUH 1N64L 2HJKB 3QH3B 5GIRA 1UWFA 3CVIL 4N2HA 5I23A 4JI2Q 4BSWB 4NMZA 4LUOA 3R2TA 5C7XL 4N22A 1JPST 3TBWB 3ZJYC 4X9BA 3TBVB 4PRIA 2CHWA 3DXAE 4IIQB 4ZJ9A 5GGVY 3WFCL 2WKCA 1YYLH 4DV0L 2R23A 4Z0XA 3UTZB 3VDYA 4TVPD 4YDKH 4GN4B 4HC1H 4LLMB 1EY5A 2NY0D 5CKGA 2F4VL 2YRPA 5LNGA 3D8MA 1BQKA 2FIKA 2H6PA 1NKGA 4X62L 2P43B 4HFUH 1I1AB 2O6EA 2D7TL 5DLLA 1TQWA 5TFSH 4AIZA 2CO7B 3FBKA 3E0EA 3K2IA 3R1GH 1WE5A 3VMPA 1ZK5A 4PJHF 1LLRD 1XDTT 3N0PB 4TSSA 1R3KB 4WK2B 1YDPB 2KJXA 1KC8C 4FO2A 3FMGH 4FNPA 4ZNEA 3H3KA 3PGCA 2NNFA 3KLAA 4OGYH 2DN8A 3H6JA 3ZYIA 4A6YA 1EHLH 1N32L 4Z9CB 5MENB 2W94A 4U1MB 3Q23A 2IW3A 2P46B 4M1CD 1CQVA 4PJCF 2DIEA 3EO0A 4Q89A 2L3BA 4GG8B 4I9WD 4DAGL 4HG4J 4J39A 3TP5A 1IL1B 4Y4KC 3O45B 4JFXB 4YX2L 5EUOE 2AQTA 5EO0B 5ICYB 4IRZL 3X14B 1MHHB 5D1QD 1ZXQA 3S36X 4YAQB 1HCZA 1JDCA 1OXYA 2NZOA 1Y0LB 3HGBA 1A3LH 3AG4B 5FM4A 1PRTF 4PJ9B 4IN3A 3O4OC 4GS3A 1FGVH 4N1CA 4YWKA 4P23B 4IUVA 2DQHL 3FCSB 3A4AA 1NFDE 1CE6A 2ZWYA 2BDNH 3AU7A 4RGMA 3BKCL 3G6JF 2FMMA 4IS6A 4ZUVB 5M7QA 2EDYA 1X44A 1I9IH 3GHEH 2ZAIA 4GAJL 2QGBA 5TF1L 1ZS8B 4B53A 2G5UA 1NGXB 3K80C 2DQGH 2EY2A 2ZX7A 3EHBB 3OV6A 3X11B 1HL8A 4UAOC 1UJTA 2DLGA 1MW3A 2PXYD 5F7FA 3MXPA 4H13C 1CD0A 4NQCE 3SY0A 3VD3A 3MJ6A 4MXWL 4APXA 4NM4H 4F7MA 3AWFA 3NMEA 4Z77A 4JW0A 5I6XC 1OPGL 3FUFA 3KM2A 3B2PA 5KSBE 4UIMB 3HFZB 2YFNA 3PQYA 1IM3D 4WU7B 3X3MA 4UT6L 2QPEB 4LHJB 1VQIA 4NAMA 4RAUB 3V4VA 3EXJA 3QDMD 3QXUA 4JUSA 1TVXA 1CDIA 5EZIL 1KNOA 4IO9A 3BVNA 3N5AA 4DGVH 2HKFL 4QRBA 3UACA 3KPMA 4JM2B 5J57B 4MTKA 1Q8MA 4OCRL 3DPDA 5FUZL 1XNRQ 3GSUB 2OP4H 4DV5L 4EZJA 3FONA 3O13A 4PTUA 4J23A 4WUUA 4L4TA 4O9HH 1DBJH 1FFTB 2GJ6D 1IT9L 1P8LA 1Q1BA 1ZHBB 3BDBA 3MMEA 4NZUH 4WI4A 1TVHA 5LBGA 2NYYD 3R19A 4CU6A 4X66L 4BXSV 3AJ7A 3VQLA 3GTGH 4J8QA 1BJ8A 2OMWA 4JANB 5H94B 1Q9WA 4F80A 4WTWA 4L8CB 5E0FA 3X1NA 3QISA 2EY6A 4OKVA 5D7SH 3NCXA 1C48A 4L48A 1B70B 1CICD 5E3FA 1S5BD 3OHXA 4F7PA 1S7UA 1RCVD 5KG9B 1E2ZA 1HNFA 4EI0A 2PCFA 1K3IA 3T4YA 4NZTL 5EBWA 3PL6B 4OD1H 2OFQA 1ASZA 2DI9A 4KY7A 4UAIA 3S1NH 4HK0B 3DX9A 4FLRA 1DTUA 4G6ML 5LN4A 1T03H 1OTUD 3MBEA 2JJSC 4DQAA 2FX9H 2A9CA 2G4EA 3MNZB 2D7MA 3O3AA 3UYRH 2YPLB 3A21A 3PF4A 3C08L 4MWFB 4X8GA 3NP8A 1O0VA 4ZMXA 1HYSD 2PTTB 4NQSA 2AVGA 3BX7C 3GSQA 3QDAA 4L5FH 2GK0B 4CN1A 5I1EL 4F7CB 3MGTA 3BQVA 3WI9A 2H3NB 3BUBA 2LE9A 5E9DA 4DIXA 1JNJA 3W9EA 4L1DA 2OJ1A 2XPGA 5EPMA 1RL1A 5D1XE 2SEBD 3W0WB 3H3BC 35C8L 2BOLA 2FJSA 3ZK0A 1IGFH 5F7WC 2EEAA 4IGBC 1XCQB 3JWNH 4BCYA 1PFNA 3OKOA 3QUKB 1CDUA 3C09C 2XWDA 5E1QA 2ZWLT 1D5MA 4QRTA 1N8ZB 3M4PA 5HI3C 2ZUSA 2VITA 4JNXA 1RDPD 3KWWA 4OIFA 2WAQE 5FO9B 3NCFB 1NDMA 4OLWL 3NCBB 1JMCA 3AW5A 4LOUD 3C8HA 3LZQA 1BD2D 2NR6A 3NTKA 2IDUA 4M5YL 3TF4A 2VSCA 4FJZA 4GKSB 3US1A 1DN0A 1E42A 4D9RE 1RULH 4PRPB 2X4RB 3B9KC 2XWTA 3CAMA 4NFDA 5L37A 4PQXA 3IK2A 1BYOA 4FG6D 1BEXA 4OIIH 5CV9A 2E47A 3ALXA 1PKOA 4TSAH 3FFOA 3PAUA 2V5MA 3OAYH 3FO2A 4BCZA 1JTPA 3OAYK 4Z7UF 3TS8A 1JWSB 2W80C 5IP9G 4P2CG 2BNUA 2HFGL 3PO3H 2DY2A 3RGVB 4EKXA 1TWGB 4U0RB 3U0PA 1W6LA 5GGTA 1CKNB 3GTOH 5B1JC 2XIBA 5ACZB 2CWRA 4PS4L 5EHFA 3EOTH 3AC0A 4H25B 2TSBA 3MGAA 2Q8AH 1I9EA 1PDKA 1DSFL 4WCYH 2BLFA 4K8RL 3GTQH 4X3SA 2F74A 4GFXA 3QUXA 3KWTA 4PJCE 5CS7A 1TOXA 4WDIA 3N55A 4F7TB 2WP3O 2LTQB 2ZKWA 3RGBA 5CWSA 1UXMA 1AH1A 2AJXH 2YBRA 3G6EA 4U3SA 3JAMi 5EIVA 4YXHL 1CZ8H 1EHAA 4F37K 5I1HL 5HHXH 2R69A 3NJFA 3VR6A 1FO0L 4DGUA 4TM9A 1B53A 1A4JB 5GS2H 1MAMH 5L88H 1B3QA 5FJ8H 1GXDC 1E2VA 5C44B 1G6RA 2E8ZA 4FQXD 4L8SC 3FFCB 1THCA 3TT3H 3CC5A 4UQDA 5EOTB 5IMKB 4GKZB 2VLRD 1IGIL 3WSQH 4BE5A 1PMYA 5TDNA 1SLVA 1AYOA 4OM0H 4PCTA 2CAKA 3VFUB 5HXMA 3SE4C 3KHOA 2VN5A 4KKNA 4XMPL 5GS3A 3L5WA 5I76B 5T1JA 3LWUA 1LTSD 2QDBA 2CCZA 4UT9H 1RZIA 5JUEL 5L4IA 3TM6A 3CMEA 1GGTA 1SOKA 3LRKA 1AP2A 4D9QE 5J6SA 4QJ4B 3GBNL 2FZ3A 4AWJC 3SDXA 4HGWB 5IHBA 5IQNA 4KKLD 1AI1L 5KBMA 4DK5A 2AXFA 3HIZA 5C8JA 3DO7B 2C9SA 1TJHH 3B7TA 2E2HB 3LPWA 1JPFA 4HUUB 1E0OB 4AYGA 1FZOB 5DJ8A 4UZSA 1YCSA 4J3UA 1CYWA 2VM4A 5M3FG 4LVHC 1ZY9A 4KDWA 4LDCA 5KYWA 1VQGA 1IJ9A 4A75A 1MIUA 3DXAD 3ULVC 1UWXH 2AXGB 1RIUL 4QTHB 2FJHB 2XTJE 2DJFC 3OIPA 3O9WD 2F0QA 3QVAA 4NB7A 1OZTG 1EZVX 3OTOQ 1XCTA 5KYIA 4Y5YA 5IW1B 4UM8A 2FUTA 3M4OB 2QELA 4N2FA 4X5XA 1ONQA 4KNQA 3MSPA 3NTCH 5CBAE 2CBQA 1AZVA 4I18A 2QDLA 3MNVA 4CC4C 1TS2A 2JEAI 4HIEA 3EBAA 3KL0A 3TA4D 3K8AA 4KMTH 2B8GA 3WV0A 5JIMA 2XRQD 5LHDA 1PMRA 5FF6A 2V2TB 5KYYB 1J9SA 1URZA 1NCDL 3LNEA 4QPEA 1W80A 2IOOA 4PRAA 2NTTA 3EYUL 3K81C 1TXYA 5M9OA 5CGKA 3W3BA 5C2UB 4Q9RH 4AC2A 1BLNB 4NN5B 3OD3A 2ZSVB 2VB3X 1BM7A 4E9TA 1H5BA 5I6KA 1K4DB 3W37A 1ZV2A 1BKBA 3MODH 3ZT6A 2GEQA 2P8LB 4JM4H 2EKJA 2I07B 2E5EA 4DP5X 2HPTA 1LP9B 5EU6B 4XO9A 3GSRA 4HSAC 4OI9A 3RKPA 3T4AB 3OX8A 3DUUA 4FP5D 2ZXDA 3MA9H 5L2KB 1BP3B 2J5LC 1MCSA 4GW5B 3SGDI 4HC1L 5KVEH 3QO0B 3APNA 1NAMB 5I66B 3NIGF 1XXDC 5GQOA 5E2TH 3S4SB 2Q2EB 5SX5H 2MUYA 2NWGA 4OHJA 3H3PL 5HYQB 1FDLL 4L6TB 4C4KO 3OXRA 2QV2A 4Y8AA 3FMGL 5I71C 1VZGA 1L0XB 1EUJA 2P1YA 4WHYG 4KPHH 3AREB 3FTUA 2DJMA 4ZXBD 1H0DB 1PFBA 1HFNA 3WTTA 1QLRB 3HOYB 2JJVA 4PVNA 1SYBA 5I8EB 4LVNB 1EAPB 3JWNG 4NKLA 4NQCD 1RMFH 2AI0H 1RJYA 4BK8A 4JCVE 2PN5A 4DK3A 4L2YA 2D3VA 2MNUA 3ARDB 5I16A 5C0GA 1HTPA 3CX5J 3HAEB 3IKCA 3KPQA 1L9OA 4YSPA 1A3LL 3U83A 2D7PA 1U42A 2EIDA 3GKZA 4GRLC 1FGVL 1PXUA 3NCJH 5TDPA 3DMMC 3IDUA 1U4LA 1RJLA 2ZX9A 1Q8IA 4N2EA 2MPVA 2F4IA 5I17A 1D5BA 3ALWA 3QEUA 5C07B 3LZNA 3U7AA 1QNUA 1SNDA 2MCPL 1P1VA 3T0EC 1WFTA 2OKMA 2O6PA 3PU7A 4FDWA 1SXAA 4QRPE 2QW7A 4ALAC 1CVRA 3TRZA 2J57A 2UZXA 2RCSL 2VTFA 4WI0A 3UH8A 5JPMA 5KW9L 3MLVH 4P57A 2AZUA 2Z0BA 1QTYT 1NWPA 3PO3G 2AEPL 4JZJB 2AK4A 2WN2A 4JFWA 2BSDA 3MCKB 2OMXB 5EKLA 3LQAC 5TGBB 1CDYA 1J18A 4KD3A 4A3KG 5GSVB 5DA4A 1KJMA 2XBTA 4LFHG 1BZ7A 4PJ7E 5E8OB 5J11B 5E94B 4A7SA 4XCCH 2Q9OA 3DRQA 3ZY7A 2BHYA 5D7LB 2VXQL 1HJPA 2X53A 3K5RA 5B39B 1CU4H 3FQ1A 3NJNA 2GSGA 2LKVA 1C5DB 2HJFA 2OP4L 5K36G 3NJHA 3QEHA 3HZYB 5C4JB 1UYWH 1A7OH 3VCLB 5GZOD 1VGKB 1H8NA 4Q4EA 3IN2A 5AZEH 2UVEA 2VDQB 4UNVA 5L8KB 2V17H 4JQIH 3MHZA 4RWYH 3VD9A 4WLCA 4L4VA 3SKNA 3VR4A 3DSNB 3HOWB 2BNRA 2EKSA 2JA5G 2W65A 4BZ1H 4JO2H 3QNZA 5C92A 5IB4B 2JF1A 3H0GB 5L4JA 4TVSa 4EN2A 3S48A 3T1HL 3AS2A 4QCIB 5F7KC 4ECNA 1Q86C 1SXZA 4PI0A 3WAJA 4L37B 5EOCJ 4XMVA 5D1XD 4NJAH 2OW7A 4RFOL 1HL4A 4UDUC 3FN0L 4R8WH 3LRLA 5SX4H 3RDTC 4HBCH 4FNTA 5F1NB 4G1EA 1U8CA 2QDWA 1SEBB 1ZHNA 3SJVE 4ZCKA 1BX2B 3LH9A 4JDTL 5CP7B 3WFHB 1T03L 5CIPA 3KYOA 3HG4A 3CFTA 3DHPA 4LBEA 4OZIF 4D0BA 2FX9L 4KK6D 3LEXA 3S3DB 4DHLA 3S34L 1HH9A 4ELME 4OF8A 3UYRL 4B9IA 1G7MB 4HS8L 2L12A 4LPTA 5D2LB 2UX6A 2F0UA 2MP1A 1K2DA 3NJLA 1HEHC 1GCYA 3HHMA 5DHVA 3RWCB 3UJJL 5K9JL 2IAMA 4YEFA 2E27L 1GOGA 5HJDA 4D9RD 1EY9A 4X8JA 4F7EA 3AY2A 4HIIB 3EF7A 5ANMB 3RAJL 2X3AA 2VR3A 3SQBA 5EIIG 4DWHA 1MZYA 3CWGA 3MRNA 3DUSA 3RIKA 1MJCA 3EYFA 4PBXA 2OM5A 1A1OA 3HNVH 1NDGA 4GMTH 3FUMA 4HGKC 1ZLUH 1ZLUK 2DYPA 5DD1H 3VFPB 3GEWB 3D8GA 1TQCB 1HA5A 1TITA 1D5RA 1MVYA 4QMGA 3F04A 1DE4B 4HJUA 4QR7A 1AQDA 3CXDH 1WFQA 3UO1L 3ZDZB 2QHRH 1FL5A 2NUCA 3D6WA 5J6HA 1XWVA 5BRZB 5DT1H 1FVDB 3OKDB 3RHWK 3NSYA 4OT1H 1LO5B 4HV8B 4UQ3A 3TPUB 1HPCA 1YEJL 1QBML 2HWZH 4RVBA 4P06A 3P69A 4KOCA 2DQCH 2Q86A 2VZSA 3DEOA 2A6JB 2BZ7A 2W5PA 2ZYIA 1R3IH 5LKNA 5K9KB 2FQEA 5D2NC 3L1OH 1D5ZA 3KYAA 4NT6B 1VQBA 1JRHH 3KXFB 4HTHA 1TWAB 2BNQA 4A67A 1LDPH 1Z1WA 1WICA 1D9KB 4N9PA 2P7TB 1KENH 5C0CB 4FNUA 1OXXK 2ZJRA 5JQ6L 5DA0B 2WZPD 3OC5A 2PKDA 4OIIL 4DP8X 5EAYA 1P5UA 5TE4H 1DVFD 3F2UA 1D6EB 3IKKA 1EEQA 4JG2A 1A7PL 1Z0NA 1OAUH 1KTKE 1DJGA 2BY1A 4FYDA 3WN5B 4NXNL 2AC0A 5A43C 5IROC 4TVPH 4EE2A 5IVOA 4Z76B 1GXEA 3RFZA 1BHGA 3SK8A 4LL9A 3EOTL 3FU9A 4AVJA 4IHOB 1F8TL 3CFNA 2F54A 2LVEA 1PH8A 1Y1DA 4DR1Q 2AF2A 1MQKL 4WCYL 4C56E 3PP3K 3PCOB 1I6HB 4CC1A 4B9FA 1JGVL 5IHWA 5E4IA 5ERWB 5D55A 3E2HC 4LSQH 2KHAA 2OZNA 3ARTA 4ILDA 2DEWX 4PJEB 3UROR 1ZTXH 1PH6A 4P2QB 2K4WA 4JHAH 3F7RA 4D9QD 3P3TA 3DETC 2AJXL 1ZT7B 4R96A 4YBHA 5FHBH 1CZ8L 1OPOA 4I1PA 1TQSA 2WXHA 4WW2B 5HHXL 1QD0A 3RILA 4AQYL 2PMZE 3EO9H 3Q8CA 2YD2A 2VAAB 2VDML 2TMPA 1Q12A 1Z5LA 2FWUA 3H9YA 3DX1A 4JRXA 4O2CA 3V0WH 1AS6A 3ARXA 4RA0C 4YK4C 3W5OA 1JF1B 4JO3H 2RQXA 3HHSA 4AGNA 1FA4A 1L2FA 2ZP9A 4RX4D 2ZM6Q 1PV4A 1OKEA 2NX5E 2QPFA 4GBXD 5E4XA 4X65L 3WSQL 3KW7A 4FHJA 6CGTA 3MXWH 3E6HA 3VYTA 25C8H 2XTJD 4BGDA 2AJVL 1J12A 2R2EA 2WMPA 4Q58C 1F3DJ 3HG3A 1JWMD 3CIQA 1LWRA 3JT0A 4Z3HA 1JIBA 4HFWB 2BVOA 1EYAA 4EAEA 1VKXB 2R9HC 4RRPM 3WNLA 3JZYA 3VXQA 3II3A 2WJ5A 1LO2H 3KYHC 1TJHL 1PEZA 1Z9SB 5JW5A 4KTYA 4OZFH 5ELCA 4EUPG 4X0NA 4WEBH 3UE0A 1E9QB 2XFXB 3BUPA 4B6ZA 4IK6A 1E6OH 2F0IA 2YSSB 3EOBB 3M1BA 4KUCF 2ALYB 2WLZA 3S14H 2EE0A 1NWOA 3ME0B 1A6UH 1G9NH 1JF5A 3DROB 3GEFA 1NMCC 1AY1H 4JO4L 4PH8A 5FDYA 4Z7OE 2Y0SB 5C0DB 1VQ9A 4M6OH 4BFJA 2K7QA 3I84A 3QR2A 2VDOB 5AG9A 2E6PA 3NPZB 5NUCA 2GITA 1Q46A 1M3JA 2QSCH 5AAMC 3VYUA 1UCTA 2HZHA 1ADWA 4UP7A 3CDFA 1L7IL 1AXTL 4FQQB 1A3QA 2IFGA 4KKSA 1ADQL 1QI3A 5E99H 3JAMc 3RN2A 1F13A 3H55A 4HDIB 4PYHA 4GLAC 4PJ6A 3HCVA 1N36L 4Y1AA 1H15A 1JCKB 4RA8A 2YWYA 2MPAL 4XH2B 3QIUA 5TH2B 3ZDXB 4AM0Q 3ZZ1A 2JNZA 2QADC 4QO1B 2K5NA 5HYJA 1CT8B 1MCNA 1VENA 5AL8A 2GABA 4WO4A 3JV6A 5CGTA 3FF7A 4PMBA 4FQLH 4JPIB 2IWFA 4JM4L 1G7HB 2EC8A 1V3LA 1XSIA 3KPOB 2PW7A 1V3MA 5IW6B 4IPHA 2OMVB 1AE6L 3MA9L 4OZIE 1LABA 1MCOH 2EDOA 5EF0A 5T5FL 4DGYH 2Z92B 2P5EB 3B2XA 3CRLC 2D8KA 2FLMA 1TQBC 2ZXRA 1XH3A 2BSEA 1L9NA 2GQHA 4AM0B 2I9TA 4F3FA 1KY7A 2ZUQC 4KY1L 4BUQA 1WTXA 1T89A 1I8LA 3FFDB 3SDAA 2X88A 5ISZB 1NPJA 3ESOA 3PWLA 2WKDA 1MHEB 3PLYA 3FOLB 1NCIA 3LKPA 4KPHL 2IANA 2UXDQ 3G5XB 1PLCA 1DQMH 4DEUA 2F58H 3PWUB 2NUTB 1WCQA 3D25B 1ET5A 1I4HA 4H20L 1QUQA 1HOCA 1RURL 4QRPD 4XPTL 4DUZQ 3RIFK 4JCLA 5E1IA 4BWTA 2AI0L 4TN9A 2YD3A 4IBUA 2V9QA 4XB3A 3SPIA 2EXWD 3BE1H 3PFQA 4GAFB 1HXKA 1XGPB 3CZLA 4DETA 1HIML 5J12C 4GSDL 2WLNA 2F8IA 3IB4A 3TU6A 3B37A 3K6DA 4P59H 2AEIT 4IJLA 3LQZA 4KTGA 4JPWH 1KTLA 4HWZA 1KIUB 3HE6D 4H8QA 4CC0A 3SK4A 5DJDA 2A74B 4U68A 1JGEB 1O7SA 3VXPA 3GMOB 4ZMWA 3O41B 1YEEH 1C8QA 1OB1B 2VDNL 4W4NA 5GRUH 2WCPA 3RTQB 3PGFH 4P2AA 1NUFA 1HNWL 1C1EL 5IB2B 3G48A 1G4MA 5K39A 4GUQA 5FV1L 3UZVB 1PG7W 1YY9D 1WBZA 1ESFA 1MCLA 4Z1PA 2CNYA 3QIBA 2OMUA 2DKMA 5HGQA 4HS3B 3RDJA 4H7BA 1A6TA 2A6DB 4RH6A 1T5XD 2Y24A 4CBZA 3ROOA 4X5QA 4X6FA 2W0PA 4YEEA 5ESVB 3QNFA 4ZS6C 4BKLB 5J4MA 2VL5A 4YZFF 3NTIA 3BIAX 3H4FA 1E40A 2OMYA 2EDXA 2B14A 2R0LH 1XHHA 2VLKE 5E4EB 1DXMA 3S15B 2XZQL 4PZ8A 2ZWSA 1QJOA 2W60A 1TTCA 2OTLA 4OSUH 4RIRA 2WTRA 3SJVD 2ZJSL 2PPAA 5F97E 4FQHB 3AT8A 4HWUA 1X7QA 3UDIA 5ABAA 1T0MB 3K8LA 1Y8OB 3WIHH 1UYWL 1VERA 1D1KA 3OKKA 4JM0A 5AZEL 3VXOB 4RGMC 5KJ7E 2D0HA 2KEEA 3OPUA 4WV1C 4DPRA 5AAWA 5IJKA 1AHWC 1NKOA 1UZ8B 2WXPA 2EXTA 3MO1B 4OCNC 3Q8EA 1IAKB 1PG7L 1U4EA 2TRHA 1J48A 3M07A 3CK0H 1A7RL 1G1CA 2HT4D 5BW7C 4NOBA 2NNAA 3D3RA 4F8QA 2YUVA 1E4WL 3BZEB 5DZLA 1QNIA 4TPRL 5CNHA 2FT6A 3BPOC 3E6FA 5F71A 4HKJA 1IBFA 4HBCL 5KWYC 1XVSA 3UOAB 3AGWA 4HP5A 5HY9B 5FFGA 4G8EA 4L05A 3ILPA 4QF4A 2QPUA 2P8PB 2LQRA 4XBEL 2NNRA 3W3AA 2EDMA 2YPVH 3TX4A 2HRPL 2G5BB 4HJSA 5F0MB 1F1DA 1J9QA 1XGYH 4OZFG 4PJ8D 3VXUA 3D31A 3FQXA 5F6IB 4MCYA 5E6UB 1U92B 1GUWA 2V4DA 4CKQA 1ZXTA 4NB3A 1NCBL 2QT6A 1QVGA 1ZD6A 5HGTA 1YMME 1L1OA 1M7IA 3BGMA 3HNVL 5HDBF 4B7IA 3F2DA 3BO8A 3FCBA 5DD1L 4GRWE 2OQJA 1AO7B 3NA4A 5DMKB 4HWEL 2K5HA 4A3DH 3OHXC 5IWAQ 2NY3D 2PYEE 4NP4H 2NVTH 3MRGA 4AH6A 4JFDA 2YA1A 2HYMA 3VI3A 1Y1WB 3BKYH 1EEUA 2JI2A 1AQKL 3VG0L 2CWPA 4N5EC 3I4LA 3NSFA 4HKBB 3KPTA 4UV4L 5ITBH 1MCIA 3MBEC 2Y6SC 4Y5XB 4YS4A 1N2RA 1R3HA 1R3IL 2QVFB 1CGSH 3VFOB 4XC1L 4MHHG 4X6BA 3KPSB 4C56D 1JRHL 4LRIC 4MAZA 1STAA 3EFOB 3V4UH 1LDPL 4XO3A 1MF2H 1I1FB 3IF1B 1H9KA 1RVFL 4OF3A 4EDXB 1DBBL 3PV6A 4M6MH 3VD4A 3PMFA 4RCOA 4LF6L 4PG2A 2E0PA 3HEIB 4GZYC 1T2QH 2H2PD 5TE4L 4YVUA 4TUKL 1GGUA 3VFRB 5FS5A 1R9TB 3DX6A 1IBZA 2UZYA 1N34L 5DK0B 1OALA 3N41F 5C6WH 4AQAB 5J6GA 1P5VA 1DVQA 1U8QB 4OO1H 1HK6A 2E2JH 2ZP0T 2X4QA 3C8KB 4YJZL 1PTOB 3UEQA 1S7QB 2LLGA 3CN0A 1D5MC 3IJEA 4IFDJ 3RURA 2NX5D 1WPCA 4X9IA 2RVLA 5HDWA 1PFOA 3SK6A 4JGMA 2VQFL 3ERQA 2ESVA 2ZONA 1J7VR 3RB5A 5DRZB 1JZGA 3RL2A 3U36A 4LSQL 4NPKA 2EDDA 3PWNA 4XBGA 2W81C 1OM3H 4XP1L 3W56A 2G2NA 1NFIA 3A4EA 4QHLA 4J3SA 2DDQH 2XICA 3PDOB 3J07A 4OZ4A 3G5YB 4P05A 4N86A 4UQ9A 2Q87A 3G08B 1INEH 4N2AA 2NZHA 3TMEA 3J8F7 4PGDA 1CLYL 3EO9L 3HG1A 3NP3A 3PHQA 2OYKA 3AITA 3MLRH 2C1PB 3NGBC 4FLHA 4YSRA 1PVOA 3V0WL 2FMCA 3A23A 2DY7A 3R18A 3QUMH 4HWNA 3AXHA 3AAZB 2O5IC 2GBUA 1CFMA 5MENE 5LG6A 2HXAA 5KYNA 2IWEA 3SE3C 4YC2B 3KF8A 3RZWA 3ZVVA 1EZVY 3TO2A 4U1IB 4HJ1A 4NHUA 25C8L 4DP0X 4WTQA 4M8QA 4XCFH 5ICUA 2L0CA 3SBPA 4JI1Q 2LFGA 3NEXA 2QBWA 3OGCA 3P2DA 3Q5TA 3H6AA 5E8PB 3ZT7A 1FORL 2RACA 4DZ8B 1Q94A 3K5SA 2CIKA 4UT9A 1RK1A 2VDPB 4MJIB 3OPOA 1MWOA 4P2OD 2EOTA 3VUAA 1FG2B 5E2UH 1UA6L 1NFAA 3FT1A 3QA3B 2FB4L 4YWGH 3RWIA 3RLFA 5IJVA 4PY7A 3QUXC 1E27A 2QZ5A 1VCAA 3GBEA 4J5VA 4KROB 1GJUA 2D3LA 2KCMA 4ETYA 3MUGA 1D5IL 4OFPA 3O2WH 1FVEA 5A3IC 1JE5A 3VGBA 5BV7C 3K2UL 1F4WL 4Y2DB 4MNQB 4OB5L 3CC2A 3VRLF 2CIIB 2AJYH 4NKIH 1G9NL 4DV7Q 2F18A 5IR1B 3EJZD 1HDMB 2VDLH 5H37H 1UB6A 1HHIA 5B1AB 2R1YB 1A6XA 4M6OL 4O02B 4TNEA 3WYRA 1CTMA 3MRMA 4IJTA 4DP1X 4XX1E 8CGTA 4X5WA 4R2GB 4AX3A 4TSCH 1B0RA 4A7GA 2EDLA 4A2DA 1FPTH 3IJHB 3SE0A 5C6PB 1NCWL 1ERNA 1MFDL 4YHNB 4MZRA 1HTLD 2XN9A 5AW5B 3U1SH 4CN4A 5JO5B 3QQXA 1MEXL 1CA5A 2G2RB 2QL1A 3T16A 2YO3A 4J3BA 2VRQA 4NKDA 3QCUL 2KT6A 1U8LB 1WA0X 3VWKA 4NO0B 1ESRA 4Z5RA 2BOCB 4V11A 2CH4A 4WJ5A 3SYOA 5FOBB 1DEEA 3DI3B 5ETUA 1NINA 2BOBA 2PETA 3A47A 4S1QL 5KJRL 1BMZA 5KGUA 1QHOA 1CFNB 1AGFA 1ZWIB 5JNYA 1P7BA 3N6RA 5IUCA 3NACL 5CLWA 3ESVF 1MCOL 2J7LA 3MLTB 1I5FA 1FH5H 4MNGB 4FYTA 4XP9H 5DEJA 3U0TA 4DGYL 4UILL 3MLWL 1IW7D 2EUVA 3CFJA 3D05A 2KQNA 2BH8A 1N4XL 2K4KA 4Y5YC 2F9BT 4NRYB 4LVOB 3HKZB 1VQCA 5CP3H 3KJ6L 4TKOB 4FZ8H 4I18C 4XBPB 1BAGA 2YLKA 4QRRA 2I9LA 5IBTL 1DQML 1HQ4A 3NZHH 4PM1A 1OF0A 4DR7Q 2NCEA 4NLHA 3E1F1 1Q0YH 4FFTA 3GQBA 1DBAL 1S78D 3J7ZC 1ZSDA 1K8GA 2OCFD 3WNKA 1M7DA 4EIGB 4ZX4A 2YPLE 3LNNA 2J8UB 3DVGB 1FP5A 1H5BC 4RMQA 4LNQA 4FLQA 1R24B 4FQ1H 2ERJB 3KBGA 4JI5Q 2G0KA 4IK7A 1D5XA 4KJYB 4P59L 5I5JA 1EAOA 1JK9B 4JPWL 3RVXC 3HFML 1TTGA 1GMIA 2VLKD 3L3DA 1DQIA 1S72A 3BT2L 3ZZLA 3D30A 4I3GA 5A2JH 5DHYB 2V9UA 3W0WE 5J5EA 2BHFA 2FUQA 4P9MH 3V4VL 1YEEL 4HCSA 3Q9QA 3ULUE 5GRUL 3K6FA 1OW0A 5I26A 1XZ0A 5DTFB 2QV4A 3IMUA 1E5UI 5D96B 1LACA 5CINL 3ABGA 3B83A 1XGUB 1X5IA 1ETZB 4HJEA 5HDRA 3RX5A 3BP5B 4CKCA 3OPZH 4G6FB 2BPBA 3AB0C 2I27N 32C2B 3TCLA 2B2XH 5HSFA 1A9VA 3HOZB 4PRNA 3GUTA 4L18A 1DBKH 1CTOA 3SKJH 1G7PB 1VDGA 1KB5H 3T5WA 4X0KA 3BAJA 3OR7A 4N8VB 5E6ZA 3VB8A 2VERA 4RMWA 4DK3C 1IEAA 4PRPE 4PTTA 4TLKA 3M7FB 3VA2C 1JYVA 1ZLVH 3BGFB 4F8MA 1ZLVK 1LEIA 5AOLA 1KFAH 4E9LA 3BH9B 4AENB 4EF3A 1EMTH 4N8UA 2MTPA 1HXYD 4H8UA 5A40E 3GMPB 3IFLH 3HZ3A 2RD0A 1EAQA 4X7TB 3TZVD 2YYZA 3FQNA 5EULV 4LPVA 4M7ZB 3D3VB 5DJXA 3ZL1A 2HP4A 3CLEH 1BECA 3S1RB 1F4YL 2BS9A 3IDIA 4L9LA 4ONFL 4NZ8A 5TF0A 5CAYB 1IGTB 4JQIA 4CKVX 4ENZA 5C3EH 4Q9BA 1Q1PA 4XMUA 2UUBL 2EVGA 3UZQA 4YDIH 4NC1E 4DP9X 4D94A 2YWZA 1XF3B 2Q2HA 5F7AA 4AJ0A 1CO1A 2NZ1D 1JCVA 4WJG3 4ONHA 4WWKB 2F5BL 3CTTA 3J80i 3PGZA 5JPMC 5KBDA 4OLVL 3L5XH 4PRHA 2G75B 4CKEA 2VZAA 2HTLD 2GVYA 4RMTA 5C0ND 4NN7B 4G71B 1JJGA 4UF7C 4KHXH 1MFEH 5IW3A 3DYOA 4PJGF 1GO3E 1PD1A 1M4VA 1JPSH 1O7DE 1YMMD 3CFBB 1MELA 3CQQA 4Y9BA 2B59A 3O0LA 5DD6A 1G6PA 4OUUB 4K9EH 4PW4A 5LL6X 2PYED 4E9RA 1A4KB 4DKAC 2UUDH 2WQVA 2UUDK 2X5PA 3GTJH 3BJLA 5LGHL 5I1GL 2PCXA 4APQB 2FJGA 3UEZA 2ZCZA 3I02A 1H3PH 2VW9A 2BC4B 1TG8A 3FFCE 1RHHA 5GZNC 3IE9A 3D85D 1NC4B 4A2EA 4QF1A 5J1AB 2ZOLB 5IQ7H 4ODGA 1JHTA 3P0YL 4ZW8A 1XGYL 3QULA 2R7EB 1IL2A 1F42A 4K14A 3I4MB 3EJTA 3LHPL 1YUHA 3MDJA 4A7QA 2Y1VA 1J1PH 2YXMA 3CZEA 4IOIB 5LCVH 1HNZL 3ARFA 3FQTA 4MMXB 4S1RL 5CSZB 1CFQA 1CLCA 1NLBH 4ADIA 5H37G 1VF5C 2AQ3A 1IEBB 2XNAB 2H4OA 2FEEI 2XU9A 3GMMA 5C0AA 2BMKA 2VJ0A 3AU0A 4R5XA 3MJ8A 4U6YA 4A3JG 3QEGH 3N1GC 5INCB 5CCKH 1A2TA 3BEVB 4B7LA 5F7EH 3R0NA 5IEHB 1GYWA 4GI8A 5LG1A 1S4IA 2BXYA 5C08B 3BKYL 5LL6S 2E9JA 2M83A 2VLJA 1NMGA 2XJLA 4YFLF 2E2IH 1ZGLA 2IPKB 3GSVB 2EZVA 3QBTB 3GTLH 1NL0H 3INUL 4BDVA 1QILA 4PRBA 2BSCA 4GKOA 1L0PA 2XRAL 1VQ7A 2JQAA 5GGVL 3V4UL 1I1CA 2LSSA 2MWCA 4KO6A 3QORB 1T4WA 3LPGA 4F1ZA 4B08A 2V7NB 4LP5A 3EN2A 1T2QL 1WTQA 4IMKA 1HI6A 3ZDZF 1K0RA 1JMZA 2SNSA 4RAVB 4ZI8A 3WDHA 1I1AD 4LF4L 1C12A 5BV7L 5E5MA 1J86A 2WXIA 3CE1A 1S9WA 2AEQH 2WAQG 1AKJB 3MRRA 1S7XA 5I1JH 1QYGL 1QEWB 3NSWA 4DV0Q 5MEND 2JQMA 1OCWH 4TQUS 4XGZB 4PSPA 1S40A 1JZIA 4P5MB 4OLXH 4XNUL 2F4VQ 2VDKH 2VOTA 4BIKA 5I1DA 2BY2A 4QB4A 3RJDA 1LP9E 2JJTA 4X62Q 5LMNW 5EU6E 2ZUUA 3UYPA 5L2KE 4XCNB 4PRDB 1TCMA 2K7VA 1FSKC 1LILA 2AV1B 3I70A 4AYFA 2DDQL 5JW4R 2VQEL 3SB3A 2RDHA 1ETA1 2D3NA 2IMMA 3BZ4B 4PJ9D 1N32Q 4JY4B 1TLKA 2EZ0D 4P23D 5DHDA 5FYJE 4I1NB 3SZ6A 1L4IA 4QXTA 3BRGC 1P5UC 1UM5H 2HB0A 3O3DB 5D1QA 2A5UA 3TZUA 1DLHA 1QOHA 4OLYH 1R5WB 4J2QA 3RR5A 2YA2A 2Q2IA 3ZE1B 4HF5L 1KSRA 2ZJQA 3HOVH 4A93H 1JXDA 1KPVA 5DO2C 3EHBD 3RFZC 4BZYA 2H6OA 4YDVB 4M29A 3KEDA 4HAGA 3NQKA 3LS5L 1JI2A 4WW2F 4Z3FA 3K74B 2EY5A 3V8CA 1DQJA 1QZ1A 4XN9A 3BPLB 1V1PB 4N0CD 1EFID 4P3CH 2MCMA 2PXYA 5LMNL 4N6RA 3RWJB 5FX3A 3VMNA 1YNNC 2NXYB 4P46C 3U9OA 4IDLA 4JG1H 2V8LA 3U7YL 3WXWH 4OZFA 4MS8C 1WTOA 1XL4A 1Y07A 2DD8H 4GXVL 2ZSWB 2QQLH 2CJUL 2VRKA 4YIQB 2IJ0A 4JM2D 5F9WC 2DQMA 5C07E 2WBJB 1UNSA 2K7PA 2X4PA 4OFQA 4S1DD 7PCYA 4KX7A 3ZMNA 2VDLL 5MEQA 3QDMA 4F15C 2X2IA 4RDBA 3NN8A 1X5AA 3B2UC 1VFOA 2W0FA 3DBXA 2VM9A 1R0AH 1U3JA 2H2SC 1TETL 2XWBA 5C09B 4PGZA 1JB7A 4UZUA 4O0AA 3MBXH 2ARJQ 2VABB 3H15A 1KPRA 2K3TA 3Q3GB 1I3QB 5ELEA 3GZQA 4MXVE 5IJDC 1UXSA 3MRCA 3B3BA 3R06A 4G72B 1HQMC 2GJ6A 4JHZA 3QB3A 1K83H 4NM8H 2GTWB 4HCRL 1K6QH 1X5ZA 1RLBA 2J5WA 1PYBA 2VZOA 2IH1B 3S5LB 4DV5Q 4PLKC 3T9WA 1T5KA 3PL6D 1IBKL 5D7LE 3ZL4L 1I8KA 4W4OA 4B95C 5DR5H 3B56A 3TYFB 3WCYA 4F2MB 1ES0A 1M9WA 3H4HA 3TA3C 4CGYB 3U0WL 4FXKA 4HOZA 3E38A 1E24A 1P0SE 2PLTA 1E3FA 1EY8A 2ARJB 2KHIA 4X66Q 3HZVA 5MP6H 1A7QH 4HKZB 4PGEB 2MCG1 1UE5A 4F9LC 2YPLD 1S9XA 3FU8A 1F3JA 4GRMB 5HI4D 4DQOH 3NH7H 3R2IA 1BZOA 1FH5L 2NY5H 5BOJA 4AJVA 1T80A 4NBZB 5AD0A 1SBBB 5DUBA 4CJ1A 3UBXG 2DQTH 3BCDA 1BM3L 3T6ZA 1U95B 1FCCA 1KJVA 2WQAA 3LKSB 4EOWL 1G51A 4N2IA 2V9RA 1DQQA 4DO6A 4KUZH 2DI8A 1DVUA 4HPHA 3FB5B 4Y2OA 2Z4HA 4FZ8L 3V6ZB 1I7RB 4MJ4A 5D8JH 3W0WD 4JPBW 5GGUA 3ULUD 4RWHA 2UX7A 1MLCA 3U4VA 3HZMB 4WKZA 3NZHL 4PWKA 5DGRA 2XZAH 3E1ZA 4QRQB 3BESR 1NAKL 2KCTA 2CDEA 3CQFA 4DNRB 1AD0A 1PIGA 2SEBA 2FHFA 5T1MA 2PP8A 3DRTA 3QIUC 4LF3A 4ZFOA 1IQWL 4PPTA 5MEPB 1FVCA 1VFAB 2QGDA 1S9KC 2FCBA 3TSSA 1LD9A 4WO4C 5FW8A 5D2LE 5DEFB 1HFUA 3O2VH 3H09A 1X9QA 2X1PA 3CSBA 4FXGC 5DQJA 1WTRA 2O5ZL 4FQ1L 3IDMA 1YIJA 1XGQB 4LMQI 3S37H 5ANME 2GCYA 4UZGA 3MLSL 4A3GH 4PRPD 3MOBL 1J0KA 4XVUD 1BD2A 1Z9OA 1F9QA 3B8SA 5IODA 1RXLA 2RALA 3SXHA 3CFKB 4FOMA 2JJUA 1PH3A 4HZ1A 2JP1A 5DUPH 2GI0A 4IJ3B 4LLUA 4DH2A 1JWSD 4EQ5A 5DNFA 1N9PA 4HUWB 4NS0A 3ZDZE 1T89C 1I8LC 3S35H 3SDAC 4J15A 3RGVD 5BRZE 3OPZL 2VXUH 1SYFA 1I7TB 3BGAA 3IFNH 2FATH 3O6KH 4ZPTB 4L0ZA 1ZK9A 1DOLA 1MUJA 2IBBA 4AUUA 5IMOB 3VNYA 4PY8J 4QIWB 1EOTA 2N4IA 1IZ6A 1VFUA 3ROLA 1JN6A 2ATWA 2YZ8A 3KXFE 3C5XA 4R4TA 3QQ9D 3GM8A 1SJHB 3T0VA 2YPKB 1GZQA 1N10A 4O42A 5C0CE 4QRUA 4KVCH 2BCKB 2ZWNA 4H0LC 1T0OA 4C3IG 1M9SA 2ZUVA 3KM1A 1JSYA 2H26A 4WAFA 2J1ZA 2EEFA 2Y1AA 4F5CE 3BW9B 1WSST 5C0IB 3WIHA 4QOKA 1GJWA 1N5YL 5HI5D 2J6EH 3CLEL 2YK1H 3PPEA 2Y7OA 3PDGA 1GY2A 3ZQXA 2VXSH 1O9ZA 1VJSA 2IDCA 2OS7A 2QSTA 3UPRB 1U6AH 3B6SB 3FFCD 3MRJA 2VIRA 4N4YB 5B8CA 2BSRB 1DBML 4YDIL 2IQAB 1W15A 4WJ3M 2GA4B 1T7XA 3QRGH 1YPZA 3SDCB 3QIBC 3L5XL 4LQFH 1PZCA 1QW9A 1M2OA 1MVUA 3Q01A 4FQXA 4F87A 4BH8A 3L81A 1I53A 5HBBA 2OK0H 3A0JA 3HHRB 1XB8A 5IOPA 2XQBL 1MI5B 1FAKT 2IT1A 2WWOA 4PJEE 1QRKA 4P2QE 2VLRA 5DEHA 4GOPA 5I0XA 3H94A 3UAJA 3EGDB 3AVEA 3F00A 5C4XH 4K9EL 4R4BA 4ZO6A 4GQQA 5EA0H 2WVVB 1TZHB 1RUAH 4P72A 4LCCA 2Q2UA 1B4OA 1G7JB 2DWSA 5JXED 4KI1A 1G9MH 3DTDA 1MJ8L 4KK5D 5JDJA 3MZGB 2VMCA 3U30B 3IM1A 3L4ZA 2PPDA 1M05A 1Z3GH 2OSLA 1SYSB 2CXGA 1HNXL 4WEEA 2GC7C 1FO0B 2ICES 3K6SA 4A3LG 5IT9c 4FVMA 1LEGA 1YECH 5LCVL 2EDBA 5AAWC 5IJKC 1SMDA 3FO1B 5AW2B 3MRHB 3IBEA 1Q9KB 4R7LA 5EOCH 3GNMH 3DXAA 4LLVB 5T3ZE 3U82B 4LCIL 1EVTC 3O9WA 1XBRA 2RCFA 2WO3B 4BBRG 2JKNA 4Z7NF 3QEGL 2QHLA 4EJ1C 5JORB 1EHXA 4ONOA 3GV3A 4G42B 2HJLB 4OLUH 2EYTA 2CK0L 3WFEL 3HC0B 4JE0A 3ZUCA 5KBPA 1SYEA 4KTEH 1IAMA 1LT6D 1OVZA 2D0OA 3V4PL 2PYFB 4FNFA 2AHOB 5MEOB 2VDRH 4LU5L 4HJAA 3FT0A 2L1BA 3SGKC 3BUQA 2Y0SE 3B5GA 3J80c 5EU6D 4NPSA 1FNSH 1WFIA 2OYLA 5L2KD 2KL6A 3MUZ1 5JTWA 1Z7TA 2JKLA 3ETBJ 3I4OA 4NZRH 3I9GH 3MNWA 1BJMA 3RX8A 2WIIB 1TVDA 4W93A 5BVPL 1BDYA 2V7HA 1B88A 1I3UA 3PAYA 1R3JA 2RDGA 2UYLA 3C6EA 3HN5A 4PV9B 5D1ZA 4QT5B 4PGBB 1HZHH 5FYJD 1L1OC 5EUOA 2QEXA 1PNDA 4JJ5B 4GEJA 3A6CH 1PFMA 4FF3A 2IADA 3ZDXE 3L1GA 1I3RA 3O4OB 1F2YA 4CMHC 4D2NA 3ARED 4QTIH 2AV7B 4HGMA 5KNBA 3IPEA 4X98A 4KHZA 3ITPA 3BWSA 1AR1C 3X12A 1NTDA 2VDKL 2KLSA 1NDTA 5FAAA 1NFDA 1NE3A 4ZUTA 5EBCA 1S5IH 4ZX5A 3PUXA 3X3FH 1W0VA 1F6LL 3HRZA 1USZA 1CPUA 4ZXBA 4BBSH 4LL4A 1PH1A 3ARDD 4EI5B 3IFDA 4UAOB 2Y7SA 1NUNB 2P5EE 5FECB 2EEXA 5F7UA 2NYZD 3MX0A 4EXPX 2XC8A 3GO1H 5EC2B 3DSFH 4NQCA 1PTOF 5I6XB 2Z9TA 4PG2C 2AERT 1YN7B 3V5HB 5KSBA 3QUMA 4HPOH 3QNXA 5KVGE 3BHBA 4XNMA 5ISZE 5GHWH 3K72A 2Z93A 5C07D 5JJIA 3AQZA 3IKJA 2I69A 4A3BH 1LTAD 1F5WA 4UTAH 1HT6A 2JXMB 4Q0XL 5HVHB 1X5MA 5IB3A 1ZHLA 1MFCH 2WACA 4NX0A 4LF8L 1PZJD 3EFDL 4K5LA 4YDJB 3VI4F 1BVSA 2ATKA 4NO2B 1LO3H 5IK3B 1Y8NB 2XPYA 2C1OA 2CO4A 4W9EC 3D9AH 2FNBA 5ENWB 3S8FB 4EDWL 3BVZA 5CV4A 4HALA 2R59A 3UTQA 4EVNA 1CLZL 3JAML 1XR8B 3A4FA 3MRLA 3NAAL 1TS4A 4LLQB 1I50B 1J5DA 2QQNL 2OX5B 2X2JA 4MFHA 4UYQA 1H9JA 3AWGA 2GN5A 2NQ3A 2N88A 4XTRC 3WXWL 3ZMRA 5D7LD 5JR1H 3WO4C 3VVVA 2ISDA 3X17A 3GLAA 2IGLA 4NWTH 4WHTB 5AB0A 5IZ7A 1GVIA 1SROA 2VQTA 1NGPH 5H37A 2AJ3A 4XRCA 2XV0A 4X99B 2MNWA 3BKMH 1YVLA 3RGHA 3WJLA 4BUGA 1YAIA 4L0YA 5I8CB 3TVMB 1SAPA 1F3DH 1JK8B 3EDKA 3HPLB 4IOFD 3BAIA 3MFGA 4I8DA 4X7FC 1KXHA 4UU9A 3LSOB 4ODHL 4F24A 4OJFH 2YA0A 4V33A 5GZOA 3HC3H 4OBRA 3D06A 3KYNB 4GNXC 4OCXL 1S5HA 3EFFB 2DLTA 5F7NC 2IV8A 4WEUD 4NGHH 4NM8L 5HDOA 1K6QL 4N8PA 4DKFH 1QNZH 5DHMC 4U1NB 3LPOA 4UINH 2JFCA 3Q2CA 2IG2H 1FL6B 1BVKA 3TREA 1W8OA 5F9AC 3GBDA 4X6AH 5KVDE 1SEBD 4RLDA 1OXTA 2P9RA 3SYPA 3FPPA 4AQEB 2A1AA 5D1XA 3KWUA 3SD2A 1HHJA 4IUUA 1ITCA 4Z7AA 5CCJA 3E8UH 4IGBB 3L9AX 1A7QL 4QMEA 4OI7A 3BIKB 4GRWH 3VA5A 4L1SA 3T1HQ 1R5VA 1RPQA 3NH7L 4A55A 1DOMA 2V0AA 4OGXL 1X5KA 4G2AA 4PJXB 3U4EA 2MQHA 5EPKA 1I1RA 4XNXH 2DQTL 3FQRA 2WAQA 1QWNA 5EU7C 1A0QH 5GRJL 4A2HA 1OIOA 1TZ8A 4K07A 3ASOB 4NQXA 5CP3A 2YTVA 1M71A 3HUJF 2EYRA 4YHKL 3HOXB 1UCBH 5D8JL 5FDWB 1BQLH 1Q90A 3T6VA 5L0QC 1HNGA 2JKRM 1TYEB 2G0LA 3ECUA 2VGLM 2A0LD 2XN9C 2X3CA 4HK3J 3WL9A 5BMFH 2PWGA 1KCWA 1J1OH 2YKLL 3RMHA 5JLZB 1IGJA 1W0WA 3FSWA 5BRZD 4OM1L 2H5UA 4OT1L 3VWKC 5H4ZA 1LO5D 2X7LB 1SN2A 3G7LA 4CJ0A 5C0XJ 5BN3A 3O6FB 5FLMG 3S1NB 3O2VL 5CXPA 3CSTA 3GFUA 1F2XK 3OKLB 4MNHA 3TBSA 1EQQA 3KXFD 1QFUL 3VXNA 3D34A 4LHQB 4KMLB 3CQPA 2DAVA 1D9KD 3QPQD 1J8HB 3IWVA 2C9VA 4XAWH 5IQ9A 5C0CD 3ISRA 1ZT1B 1NMFA 1EH9A 1V55B 1BAFL 4HJ0D 3OHMB 1S7VB 2IO5A 1Z6HA 1AO7E 5DJ2A 4B9GA 5LQBH 3L1FA 4X5RA 5H8DA 3CXHJ 4QYOB 4OWXB 1GOHA 1ORQA 2ADGB 4MDJA 2XWRA 1N3NA 2GC4C 3DGGB 5BJTA 3SBRA 4I9XA 3U50C 2CRYA 2WVUA 1PZUB 5JYMA 4R97C 4JFTA 1WIOA 2LHAA 1KB5A 1T3FA 3GC3A 5EDXA 3HLAB 5I8OH 1SJVA 5CEYB 4L8SB 1S4ZA 1T4KA 1NSNH 3KPSE 1JHLH 3W2DA 3I2CH 3OMAB 2GUYA 5HHPA 1NCCH 2L04A 3OG6B 3WENA 1IVTA 3VSTA 4KVCL 4GIOA 5F8QC 5CCGE 3HB3B 4A3MB 4P2QD 1N67A 4WSJA 4NXNQ 4KMQA 5LMUL 1I7UB 1FZMB 1D5XC 3GINA 4QRFA 1V3KA 3WOEA 2AJUL 4PB0H 1HJBC 1OANA 5GAGC 4BBSG 1NC2D 2VQUA 2J6EL 3GSWA 4Z7VF 1KLFB 2RF4A 3HMXH 2WQRA 4AYBB 1ASOA 1YEIH 4PJFB 4UOJA 3RJOA 3FT4A 3PWJA 3U4AA 4ZODA 1YYMH 4AV5A 4AMKL 5C6TL 3QRGL 1Y1VB 5HGDA 4QTFA 1HXMB 4JG0H 1DQLL 5DSCA 3OKMA 4LQFL 4QKTA 3BFWA 2R0WL 2FR4A 3QO1A 4D7BA 2FEDD 2OK0L 4LVHB 1W9XA 2ZF8A 3GTOB 4G6KH 4RX4A 1HILB 3JTTB 4GBXA 4AQYQ 5M5YB 4HH9A 1UM6H 3OJ2C 1A14L 1Z3RA 4XNZB 5T3ZD 4IBLT 3V79C 4ISVB 4LSPH 2X38A 1XF4A 5ID0B 4ZYKA 4MN3A 4BA2I 2HKHL 4LOVA 1JYWA 1R33A 1JWMA 1AQMA 3MRIA 4D0DA 1T22A 4X65Q 5CBAA 1ET8A 1G4RA 4UTCA 2YD5A 4AJYV 2QFPA 3UBXA 3MJGX 1KTJA 2VH5L 4KKQA 1LTGD 3KYMB 4YH6A 3D2TA 3LXUX 4YSOA 1Z3GL 4KRPC 5EH1A 4BINA 4L9LC 3P9WB 2VY3A 1UWEH 2VDMB 3BQUB 2OMZA 5FB8B 2X4TB 4MKMA 2XXMB 2IXQB 3RZCB 3KVQA 3CF5A 1XF1A 5JOBA 4DK0A 2B20A 3GHBL 1OL0A 3MJ9L 3UAEA 4PU2A 3GNML 2R3ZA 3ULLA 4MJIE 4AYMC 3U9UA 3KPPB 4QXGH 1F1GA 3G9AB 3LS4L 5IGEA 2CGRH 4R90L 2HTKD 3SDYL 5I1KH 3DVNA 4DZBA 5BOZG 4L9DA 2P48B 3BC9A 5D4QA 2Y5TA 4KTEL 4C1NI 5KS9B 1ZOXA 4WFGE 2A38A 1PY9A 4EXKA 3EGSA 1UWGL 4R83A 5E0QA 5I71B 1KXTB 1PH7A 2FX7H 4JFQB 4PREA 1VB9A 5BQ7A 2WBXA 1LLAA 3MXUA 5JVG3 1FLRL 1WBYA 4FNLL 4O2EA 5E8EB 5CBEB 4JYAL 1AZRA 1MAJA 5KYXB 5IY5B 3K3QA 3I56A 3S36L 4ES9A 3CFDB 3IMBA 1XF2B 1T6WA 5IMLB 5JIKA 1HINL 3FPYA 5K93A 4JI4L 3VD2A 2OXHA 4JI0L 2F0VA 2P5ED 3I3BA 1N36Q 2VB2X 3ONAB 1R5IB 2J1XA 2O5YL 3APFA 1WAPA 3ARFC 2APXA 5CD5C 1AVAA 1BFOB 4LFAL 1NCGA 4I87A 3NBHB 5ISZD 2WLIA 4NUJB 3DO4A 3HR6A 5IVZB 3BN9C 2EYFA 3JV4B 4G80B 3FSOA 2JA9A 2ED6A 3EZ8A 1IBDA 1V27A 3V9CA 2QA4A 1U30A 4X6DB 3RNQB 3VFWB 1HU8A 4G4KA 3IWUA 4XP4H 3IGAA 1QPXA 1TVBB 4IU2A 3ULUH 3T0EB 3CDGB 4JFZL 4U31A 2H3XC 4MNGE 5T1LD 2FWOB 4QRPA 2XKNA 4IOCA 3L17A 2AFNA 4NIYE 3BN3B 5D7KE 4UTBH 3HKZE 1J8IA 1VFBA 3IU4H 1YEFH 4F8LA 4HD9A 1XT5A 4FFVC 1UM4H 3KS0H 3KPLB 4HPOL 4IMKC 4AQ1B 4ELDA 5LGJB 2B1HH 4BH7A 1N0XH 1BOGA 2AW2A 3ZO0A 2EO9A 2DLFH 3BAEL 1IV8A 2YOAA 3D1MC 4X6CB 2CRMA 2GHZA 2MHVA 4NUGL 3RTQD 1K5NB 2L8AA 2NY6B 4PJ7A 4MB5A 1OP5H 2W92A 3TNNB 3HE6A 3G5ZB 2NY0C 1CN4A 2X0WA 3LZLA 1EFXB 3VE0B 3ZTEA 1MFCL 1H3XA 2OV0A 5TE7L 1E2WA 3OWEA 4ODWB 2J8UE 1DQDL 2QPDB 1SOQA 3WEOA 1LK2A 4F33B 4KZ0A 3D9AL 4OLZH 2N0KA 1MXDA 2XX0A 3JQOB 1TWGH 2JJTC 2Y7LA 5I9QB 4PJBF 4OZHF 1BBUA 2VXWA 2X69A 3D18B 1T5XA 2W59A 5DO8A 3LN4B 5IKCB 1HNWQ 2H32B 4M1CC 1NR2A 2YU9B 3CD4A 3CMAA 4WU5B 5FK9A 1BG1A 1ZMYA 2DMBA 4KAQH 3EYOB 4O51B 3PGDA 2EJFC 3S2HB 3FKIG 1FNAA 2CQOA 1KN2H 1MHWC 2JB6B 4YHYB 3KBXA 1BIIB 4UDUB 3RDTB 1GUTA 1A1NB 2VXTL 5C0JB 5E7NA 3CCSA 4CBPA 1LE5A 1B4RA 1EY0A 1MCBA 5I0WA 4G6JH 3SJVA 5FC9A 1OP9A 2VO8A 2WYZA 4JRFA 2VDNB 1XO8A 4J2XA 2P8MB 1SDFA 1DONA 5FYLL 4N24A 2BVQA 2VZUA 3RN5A 2NLJA 5I9PA 3BZFB 2OL3A 3MOAH 4ELMA 3T1YL 1FLTX 4NGHL 3CVHL 4HJGB 1B2WH 4UINL 3FTZA 3TS0A 3WJMB 4YR6B 4NP5A 1BOSA 2XYCA 2EH7H 2X4SB 2PXYC 4WNQB 1VQMA 2XG4A 1INQB 4ZPVA 5BN4A 2Y36L 3T2PA 4AL8H 4WI7A 1QVFA 5H35A 4CVXB 3D2UB 4K8IA 2O93L 4N90D 3D3VE 5F1OB 4QRSA 4GP8B 4AUJA 4QAWA 3FUNA 1G7LB 5IESH 3EJIA 1DL7L 1DO5A 5D93B 4C2MB 3CC1A 3L7EA 3QUGA 2B9AA 2IJ0C 4RBPH 4D8PB 4RBPK 1P84J 3SBWA 1HSAA 2HAZA 4J6RL 1T20B 3GJFB 3CLFH 4XX1G 4J7RA 5AUMA 1KWGA 4NQDB 3D0LB 1ZS2A 1WCMB 4FF9A 3BS1A 1GC1H 2K04A 4MZ3A 1F9RA 5KNCA 5EU3A 4ZTPL 2VN7A 4XVSH 3QOLA 3ESNA 1UCBL 3FB8B 3U7WL 1BQLL 3U4BH 1EQTA 1RCYA 3FO0H 1VEPA 1ED3A 1YLBB 5JW3H 2FECL 1AO7D 2AUKA 4OAWA 5DYOB 3SPVA 4EI6B 5EORL 1B8AA 4POUB 4O58L 4MS6A 2DLHA 2VYRE 4XQJA 4HJ8A 2DIAA 2NYYC 1OM9A 3AXLB 3D4ZA 4W4OC 1TEFA 1YHAA 3FTGB 3GTVA 4KZDH 2DH3A 3QQ4B 4BKSC 3I6GB 1ZT4B 3MRPB 4D9LH 1GGBH 2FSEA 4AVKA 4FXKC 1KTKA 4JK1C 1XPUA 1D7FA 2UWEB 2B2VA 3BJ91 3KPSD 3RRQA 3WE6A 3IFOB 3RA7H 2EYSA 1KEGL 4G8AC 1I3VA 1MFAH 4XAWL 1Q9OA 1OTUC 3F83A 4BXXH 3HE7B 2XQ0A 4WTZG 2NZ9D 2I85A 2YJQA 4UOQA 3N3EA 3QJFB 2K32A 2BCMA 2DM7A 3ARBB 3CDZA 3GMQA 1KCRL 3MV7B 4PJDB 3SQOL 4C56A 1SY6A 1CXIA 2XETA 5LQBL 3E2HB 3BD5A 1L5GB 1T1YB 4CA4A 1HYSC 1MHCB 1GKOA 4NN6B 2NUPB 3MYJA 4A3CH 5C08E 3A56A 1SEQH 1NAMH 2D0PA 1TCRA 1MLBB 5CEZH 4G43A 4TNFA 1BVLA 3L9YA 3QR0A 4R4ND 1NNXA 1Z47A 5I8OL 2K1BA 2BIQA 2PMZA 1Q1JH 2Z91B 3R4DA 2WKOF 4LF6Q 4K5XA 1L9MA 3F12A 5FYJH 3NSJA 2QJDA 2DQFA 1YQVL 3I2CL 4CMMA 4OCSH 1N34Q 2NX5A 5M95B 3IRBA 3DX4A 3QIWC 5HJ3A 4G5AA 1TT6A 4ZKCB 1I4XA 2JCCB 2ADIA 3HOYH 2E59A 5LXVA 1TZOA 4EO5A 4LOUC 1OGTB 2WNKA 1GA2A 5LN8A 2EEDA 5A6MA 4I5BB 1TFHA 2I60H 1YEIL 1A6PA 5JW4N 1ZA3A 4XPAL 4AUYA 4ZMNA 2L9HA 2VQFQ 1SXTA 3EJUA 1JZ7A 1FV1A 3HAEH 1YYML 3WIFA 3PF5A 3NK4A 2VJ8A 5ITFA 2CR6A 4JG0L 2XG5A 3W11D 4FG6C 3WEXA 4DNIA 4ZQKB 5F89A 1JFQH 2QR0A 4N8FA 1D7QA 1WEJL 5T3XL 4IKNA 5I1LB 3IJ8A 4IFDG 3LZPA 3O8XC 4KK8D 4EZMA 3LZFL 1SF5A 1UM6L 4MJID 4WW1B 5GRYA 4JL2A 5IM7B 4P2RB 2PWEA 1ILQA 1NBYA 2BRRH 3ZE2B 1G6VK 1IC7L 1F4XL 1FFOB 3GF8A 3P11H 4K94H 4PNYA 4KKRA 5D7JB 3IDGA 3KNBB 5F8RC 4ZW3A 4LASH 4KROD 4KY6A 4ODUA 5GGSY 3BPNB 3VTTA 1H6EA 1U8PA 1U3HC 2F3IA 4XPFL 4P2OA 3RPIB 2X9WA 4PLJD 3UP6A 4BZ2H 5GS0D 1CURA 3GRWH 1MBYA 1KCLA 4WFGD 4Y2DD 5C09D 1NLDH 4MNQD 4IU3B 4PW9A 2HT2D 2VR9A 4OD2A 4B3ML 3NFPA 3EG9A 2VB5A 3ZE1E 3I3EA 1DJRD 4AYSA 4BY7H 4B9KC 4HJ7A 5A2LH 1E6JH 3K4ZA 3CSGA 2QADB 2OMTB 5DC2A 2MJWA 5B8CC 2R29A 3P30L 4XHJD 1A2YA 3PHOA 5I2IA 4J3OG 4IOSD 1XWEA 1ZHKA 1T1XB 3OL2A 3TN2A 4R2GD 1QUNA 1UOVA 3U9PL 1AIFB 1T21B 5C4JH 4XHQA 4FQXC 1REIA 1ZCRA 5HGBA 1TPXC 2Y25A 4KZCA 1O75A 4YGVB 3LKQB 3QDGB 3QT2A 3WY2A 4DF9A 2QDVA 1OAQL 1I9RH 3NCYP 1U4PA 4GOPC 2W0LA 1C8CA 4P4RA 5C44G 2WXOA 3UAJC 2NQDA 3PABA 3OAZH 3H0GH 1IGCL 1J1XL 3OAZK 4GSUA 4NO0D 3GIZH 2J1KA 1CXLA 1SLWA 1CCZA 5CILL 2R2BB 1IKFH 3BKJH 3CZSA 3GDEA 3X3NA 4LCYA 4LCUA 1MSGA 2XTIA 2X2YA 3STLA 2QSVA 4Z9KB 1SGKA 5F7YC 4J3XA 1K85A 1KCKA 5TTRA 4KKLC 2J2ZA 4JPVL 4HIJB 1SNOA 3V6FA 1UB5B 4CDGC 3F6JA 4FFZH 3S14B 4OIJA 3SQBB 3RY6A 1KPUA 3DOHA 3CSYB 5CGBA 4ZMVA 3H3VC 1J5OH 5D7KD 1UH2A 3V4LA 3QXDB 3D4CA 4MD0A 3PXJA 3O9WC 2AQ2B 1E0BA 2JA8G 4OFKA 4GS7B 1FBIL 1CF8L 1KGUA 4X80H 1XMWA 3EJJX 4H1LG 3S3SA 4F2ME 4Z8FH 2R8SH 3LZOA 3REVA 4MD4A 5EZLA 3CCRA 2JI1A 1A2UA 4X9YA 3PXLA 1NJIC 3H1ZA 1IBLL 3H91A 5F6HJ 2FX8L 2VN4A 5HVGB 2QMKA 3JYCA 1OF2B 4M7LL 4GG6F 1YEDB 1NTGA 4GKJL 4AY0A 4G8IA 5C0EB 4K8JA 2MHAA 1SDDA 3C5SB 3V52H 3AG2B 2BP5M 2CRIA 1KDAA 2WOYA 3S2DB 1YNTA 2VWEE 2XPZA 4OZGB 5JJZA 4UMGA 4Y4HB 1DUYA 5AVVB 5GS1B 3NPPA 4FYSA 2NN6H 1GL4B 4RSYA 3OZLA 2IDFA 3QC6X 3SEBA 4L1TA 5D1ZC 3QUHA 4BXXG 4HX1A 2O26U 4YL9A 2ZKMX 4UTAA 1H9RA 1P7KB 2HVBA 2VLKA 2Q7YB 5T5NG 5A16A 4A3FG 4RKBA 5M3MH 2EIJB 2MQ3A 2JEBI 4R3SA 4ZO7A 4AE0A 2ZXEB 1NMBL 2H9GB 5EN2B 4G6FD 1Q72H 4FKKA 1RZGA 1T83A 4KJQD 2V3EA 2EQSA 3GMRB 3I9IA 5FW7A 1FFNB 3TH3T 4DV2L 3DTUB 2B5IB 1CE6B 1Z6JT 2D03H 3U2SA 4IS6B 4WV1B 4Y1TA 2R2HA 5TK2A 3WOVA 5E9NA 1YNKH 1AHWB 4LDLB 4BUHA 4DEPB 1VQDA 3DV6A 3S4SG 3HRZC 3KUPA 4HA1A 4LKXA 5EB9A 2ZZUT 4ZXBC 5HTSA 1MFUA 3V0IA 5CN2A 3P2BA 1J05B 4MJHA 2YC1A 3SO5A 3BSZH 1JGDA 3T0AA 1IZJA 2A6KB 1I6HH 1FNEA 1KN2L 5CYUA 1EQRA 1MIEH 3D3VD 3FW6A 4BFBD 5E1HB 4YLQT 4ZAKB 1YNXA 1HXYA 2VMEA 1A9BA 2BY0A 3LRHA 1KABA 3V4VB 4IRSB 3VD1A 3TZVA 4EPSA 2LFNA 4QIWE 3V2TA 1KNOB 1CDJA 3QDJB 2ZXCA 4WWKD 5CHNA 3KPMB 2VNUD 3HAEG 4G7OC 2FYVA 2GW5A 2GG1A 4Z7QB 4BXVA 2WINB 3FONB 5C9KA 1A6VH 4GMSH 4I48B 5JVH3 4WUUB 5D6CA 1V7NH 2VN6A 2NZ1A 4FABH 5LGKA 4PB9H 2Q5BA 4JRWA 4OFDA 2R4SL 4G7YH 2JSOA 4Q9CA 1QG7A 3BP6A 1C7TA 4XP6H 1U8IB 2R61A 4DAYB 4KKTA 3D52A 4UDTA 2UUBQ 1P7HL 3H0TA 4FMFA 3MXVH 3IGUA 2K5WA 1SXCA 4UM9B 1WAEA 1YMMA 5F2FA 3IDJB 4APQD 5DMJB 2C34A 2CU9A 3GTPH 5DVOA 5T3ZH 2QKSA 3OHXB 2IMNA 3FUHA 4FADA 1ROWA 1KT2B