2A74C

Human complement component c3c
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
307
structure length
296
Chain Sequence
TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of complement component C3 provide insights into the function and evolution of immunity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Complement Component C3c
total genus 61
structure length 296
sequence length 307
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2a74C02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 2a74C01
4FXKC 1D2BA 3T4AC 1BQQT 2J0TD 3V96A 5JPMC 5JPNC 2PN5A 3CU7A 4LNVA 1PXUA 3HRZC 5FO8B 2WINB 1JB3A 2QKIC 1OO9B 5FO7B 4ILWA 2A73B 1EDYA 2B39A 1UEAB 1BR9A 3L3OC 5FOBB 4D94A 1JC7A 2XWBB 5FO9B 3G6JB 3OHXC 2A74C 1BUVT 3MA2B 3KLSA 2TMPA 2XWJB 1AYOA 3FRPB 2E2DC 1UAPA 1GXDC 2ICEC 2WIIB 3HS0C 1BV8A 2I07B 3CKIB 3I70A 1XWEA 4FXGC
chains in the Genus database with same CATH superfamily
3T0EA 1AR2A 3IYLW 3SQOL 4M6NL 2XPZA 4QB4A 4M1DH 1WFQA 3DIDA 3SDCD 4IMLB 5GGTL 4CBZA 5JJKA 5KZCB 2QGCA 4IPGA 3P4NB 4HGWA 3R7QA 4NN5C 5IW6B 3GSWA 4LFCQ 5FYJU 3GSNB 1JOQA 1JGEA 1O0VA 2IOOA 3H7LA 3II3A 5JW4N 4YGAB 4HULB 4X0KA 3UXFA 2ENQA 4M6ML 4R7NA 3QUKA 4ZPVB 1QG7A 3PWVB 4PJ5B 4AJYV 1WD8A 4A75A 4EUPB 1FWXA 2HKHL 3B4NA 5I8EA 1Q8MA 4NLAA 4GG6B 2GUOB 1U41A 1ZA3B 4MSWA 2ZWSA 4PRAA 4U6HA 3NBNA 1P7BA 1MVUA 1IAKA 4WFGE 3GS7A 1OWWA 3JV6B 1GGBH 2L5TA 4PZ6A 2NY5H 5CUSH 1G9NC 1DP0A 3NCWA 2AQ2B 4PGBB 1QOKA 1N19A 5HPMB 4B9IA 4PJ9B 3T65A 3A0JA 1MIMH 3GMOA 3SD5A 4MQ7B 2G5UA 4LZKA 1BJ8A 4PUBL 4A3CG 1T0MA 1XB3A 4HW6A 1N32Q 3VACA 4QKTA 3HAEG 4DK5A 2ZM6L 3ZR5A 2WBXA 3ZZLA 5F96H 4KKTA 1EJ6A 3VXSB 1N36Q 1KXVC 2AEQH 3CFMA 1HZHH 5JVG3 4HMCA 3G08A 1FC1A 3KM2A 2ZXOA 5JPNB 3MV9B 2JA5H 2I60H 1QFUL 2ROYA 1GMEA 5F3BB 1U8PA 2FWLB 1KIRB 1JE5A 1SNRA 4CU8A 3PWPE 2C3HA 1I6HB 1NCAH 5DMKB 1CD8A 1DEEB 3L4TA 4N2GA 1K5WA 3VWJD 1QFWI 1CR9L 1ES0A 1F4YL 3DSNB 3HG1D 3WIHH 2WYHA 4YHYB 5KNCA 4DUWA 1A6WL 3BCDA 2Z7YA 1ZGLM 2XNAA 4JM2A 2JK5A 2EIDA 2YD6A 3FNKA 5IP7G 2P5EB 2IWGA 3UTZB 4FFZH 3POHA 3BSZH 1HUNA 3QUML 4JGMA 4HIJA 2QEXA 3KWXA 1QFWM 2CXGA 2VDLB 4ABWA 1CLYH 4NZFA 1KT2B 4H1LH 2NTSA 4KKZA 3KBFA 1QVCA 1UEYA 4LSQL 4P2QD 4ES8A 3DYMA 2VMFA 4Y4KD 4CAGA 3HOUG 3FU3A 3PQYB 4B9FA 4JK0D 1QVGA 2BHYA 3VI3A 3F85A 4S1QL 4CKQA 3ZYOA 3CCRA 1WCMH 4PJFF 4DP7X 4PRBA 1LT4D 4NM8L 3D39A 1CC3A 3E9UA 3FRPA 2FQFA 3QXDB 5M7QA 2YS4A 4S1SL 5DEZA 2X1QA 1S9WA 3IXTA 3PIP3 1N4XL 1OAXH 3A6CH 5J89A 4R7DA 4K8RC 4YX2H 4LRIA 4RISH 3VXSD 1DVSA 3GYRA 1SHSA 2CD0A 4H8HA 1ZT4B 5BS0E 1NPJA 2ALYB 2NVQH 2FQGA 5JQ6L 2Y7NA 4QRTB 3ZDXF 1KAWA 1MCCA 4ZUUA 2LLNA 1F45A 1HUMA 2BSED 2H2SC 4OCSH 2N78A 3J27A 1FA4A 2CSPA 5SWQB 4KUCF 4JFOB 5EFIA 4EQNA 4M03A 1CO1A 3OW2A 1A0QH 3VFPA 4B53A 5IIEA 1D7CA 4NGHH 3STZB 4YZFE 4X6EB 5C5MA 1G9MC 3RNKB 3VNZA 4PRDA 3U2JA 5I0VA 3CCHB 4NB7A 4GMTL 4U1LB 1KGUA 1J0JA 2QFRA 2W0KA 3O6FB 4RQQA 1L9TA 4JI1L 3GDCA 4QO1A 2VR6A 3VG0L 3QJSB 3EFOB 2COQA 2DMHA 5E6YA 3B7SA 3TXAA 4FA6A 3RQ3A 2YMXH 4R83A 3QDJE 3F7RA 3G9VA 3T8MA 3IDMB 3W0WD 4CADB 1BMGA 1NZRA 2J8UE 3GRWH 1MCPL 2AHIA 1P0SE 1N33Q 3G6DL 4PRHD 2F5AH 1H3UA 1I3UA 4Z7UE 2DN7A 1WD0A 2XKSA 3TASA 3VE0B 5CD5D 3LNHA 1X3PA 1WIUA 5EORH 3QHTC 1OB1B 2ADGB 2JJTC 4KFMA 4KJPC 4N2MA 5H37H 3MLVH 4DP5X 3T1HL 2AXWA 4LW1A 3HC4L 5IYDG 1S7TB 5CEXB 4ZO6A 4JCMA 4ZXBB 5K33A 2KDGA 3V7AE 1U2HA 1D5IL 1LM0A 1CXHA 4Q56A 3JUYA 5JQIB 3T51B 5FW8A 1XCQA 1C1EL 4JG5A 5BZXA 2FGWH 3FSVA 3JZYA 4WK4B 1G7LA 2YOCA 1MCPH 3MRCB 1YEKL 4XO8A 4Z7WF 1JWMD 1DLHB 5DFTA 2YA0A 4PREA 4H8WL 4PUBH 3GK8H 1IC5L 2BSTA 4QRRD 5CSGA 3UGEA 4AGPA 3P3RA 4AUJA 4GS7C 4U3SB 5EIIB 3CSBA 3OZ9L 1Z1WA 3ZTEA 3CMOH 1L0XA 4E2OA 3OAWA 5BMFL 2R2HB 5K5PA 2KOLA 1YAZA 3NCYP 1PIFA 1IBKL 4L3CB 4RFNB 4GP4B 5D70H 5T3XD 3FQ1A 1HVXA 2NSMA 1KJ3H 5LUMA 2YEQA 2A6KB 2PXYC 4HEDA 3EYSH 1CI3M 5IGFA 2VY3A 1HJPA 5LMNL 2NNAA 3GXUB 2F53D 5C0BA 3ZYIA 5J6HA 4HBCL 4UOJA 2B63H 1YUHB 5HGDB 2DQFA 4IJHA 3EDJA 4ORZC 3ZKMC 15C8H 4CNIB 3SXHA 5L2KE 3L5XL 4O4YH 1ID2A 3F2CA 4EI5B 3QJXA 3M4PA 3UJJL 2IO5A 5E1GA 5C86A 5FA4A 4DP9X 5ID1B 1JV5A 4HG4J 1ZLEA 1M7IA 5I1AB 5D70L 1SNQA 4TSSA 1MZYA 1I1AD 1V55B 2MOQA 4XGZA 3UX9B 3OTOQ 2H0PA 3DVGA 5CHNB 3RX7A 5JEAH 3OMZA 4Z7UB 4KDVA 5EGTA 1QTYT 4GN5A 1BLIA 3K5SA 1P1VA 1FNAA 4HF5L 3EYQC 5C08E 5IQOA 5DJ2A 3UMNA 1ETZB 2A6JA 4FMVA 3X14A 2SDFA 5EUOB 4WI0A 3MBEA 3F62A 4R26H 1TWHH 1TWHB 4PJBB 2QKIC 2P45B 3D30A 3UZQB 3CH8A 2EYRA 1UGNA 4OCWL 1HWHB 1O7IA 1NAMH 3EHBB 3NSXA 5E51A 2BNRA 2DL9A 2YXWA 4W4NA 3W9EA 3ENEA 4WRDA 1PZ5B 1PY0A 1A6AA 2NY0D 1E6JH 2B8FA 2BSDA 1JQYD 1EIGA 2JA8B 1PLGH 4A93B 2A6KA 2WXKA 3MLSH 4OSUL 5LJYH 4HJGA 1BGXH 5HDOA 3OAUH 1BCPF 4DNIA 1YY8B 2Y2WA 1UHVA 4U3XA 3GMQB 4JI0L 2LS01 5EO0A 3S35L 2OMXB 4RNRA 3T0EC 1YNXA 1WVLA 5C0ND 4MD0A 1UFGA 2H3XC 3PV0A 5EZIH 3UTSD 4LEEA 4WUUB 4MA7L 1EFQA 5CD3A 3G48A 1EZVX 2MOGA 2VDOL 1FSKC 3CMGA 3NMEA 5A40E 4XVUC 2VLJB 1NLDH 4PCTA 2C26A 5FM4A 3OXRB 1PSKH 1BVLA 2E7HA 4JE0A 1BV8A 4X4XB 3B2MA 4ENED 3DYOA 4NWTH 5I17A 5H8DA 2Q6WA 1MJ8H 1TJHL 1BREA 1OB1A 3A24A 3L4XA 3NK4A 3U7WL 3QXWA 5LGJB 4N0CC 3KPPA 5KGUA 4QD2E 3CQPA 3DO4A 4PCKA 3CZFA 2IXQA 3CIAA 3E0JA 4YK4C 2QPFA 3C5JB 4DVBA 4M7LT 4AOFA 3SDYL 1II4E 2V17L 1RULH 1D5XC 2YEVB 4BFEA 4ETQA 2A3TA 1NCHA 3QUXA 2GYSA 4GLAC 1T5WB 5AVSB 1JUFB 1QBAA 4HLZH 1VQAA 3O4LB 1KXVA 5DTFA 1KN2H 2E7DA 3P4LA 3QORB 1SYFA 4NSKB 5IVOA 3A6OA 1EMTL 1HTLD 2CIKA 4Q52A 1W72L 4LNVA 1S9VB 1FZMA 4JM2D 1YEEL 4FFZL 4PRIA 1QVOA 3I75A 3WE6A 3UTOA 2K4AA 2R3ZA 1EUUA 2DLEA 3CCQA 1X5MA 2WK2A 3ETBJ 1NJIC 1A4JB 2V17H 4TUUA 4BHUI 2O6PA 3DVFA 1HWGB 3FDWA 4OJAA 1UG9A 1ET5A 4LXFA 2XWCA 2GSGB 5D7SH 1SXTA 4PW3A 5IIEB 1RZ8B 2O61A 3CMAA 1QI4A 1J0YA 5T3ZD 2LW3A 1NGYA 4ZUUB 1BPVA 4K7FA 4I2XB 2RHSB 1TXYA 4XBGB 4YBLB 1A3LL 1VRSA 1I1YA 4X6DF 4WRLA 4HJ8A 1HI6A 4JFDA 1STNA 4KRPB 5E1AB 5E8OA 3MREB 2GHZA 2YLKA 1ITBB 3WKMH 2C4FT 4Y2DD 2F0HA 2OMBA 4H26A 2DNCA 2WXGA 5MI0C 4F57L 4WW1B 1O6SB 3W3AA 2FMMA 1NIFA 3HBQA 5D3IB 1SJXA 3IS0X 1QLEB 4JFPB 1H8SA 2D31B 1I8UA 2G30A 1CQVA 1BQUA 5EUOA 4MA8H 4WW2A 2NQCA 4ZMPA 1I6HH 2VERA 5FK9A 2NN6H 1PJ9A 4K5LA 4PJIA 5DZNA 4GXUM 5EZOL 3UTZA 3WGVB 3BPNB 4GW1A 3S7GA 3DHPA 5HYQB 2J1YA 2F15A 4XP6L 3UPCA 3QR1A 1KG0A 4KN4C 1OQXA 1C9SA 1PH8A 3DSNA 1ESFA 2UUBQ 4IRSA 3TP5A 3BVXA 4Y2LA 4OV5B 4C1NI 1YA5A 4KUZL 5IKCB 4HJJL 4JM2B 1BXAA 2OI9C 4M56A 4UZUA 2MCPH 3ULVH 2K9UA 3MXPA 1N32L 1EIHA 4IDJL 4RDBA 5ANME 4L29A 1A14L 4J3OH 4ZAKC 3UTTB 2H0EA 4LSUH 1UD6A 2V2WB 3RGVC 4L9LA 1MCJA 1HSBB 3BAKA 1D5ZB 4Y2OA 2QLYA 3K72A 3VR4A 4HUUA 1KDJA 4JKMA 2Z92A 2DY8A 3GLDA 5E99L 5J12C 1MN4A 2BFGA 1KJVA 3Q9PA 3QDJD 2O72A 4GSRA 1T0MB 4PJBE 5SV4A 1SHWA 3BDYL 3KF6B 4G8GE 3T65B 3RKPA 3LKSA 4GI9A 1PNDA 3CK0L 2V3EA 2EDGA 3D4RA 1HT6A 4KK9D 4Z7VB 3SDDC 2AZAA 1SJEB 2NOYA 3IDIA 1IAKB 5ITBL 4R1JA 2VDRH 1MVFA 1M2VA 3K8AA 3GBNL 4AGOA 1UJ3C 3T77B 2PR4L 2A6HC 3Q5OA 5FFLA 1A6TA 2V4DA 1XWVA 1TETH 4EUPA 2OX5A 3GMOB 4YSOA 3V9EA 4JVZA 3F58L 3L3HB 4N2NA 2NXZC 2MMXA 1J8HA 1XF4B 2Y25A 3NFNB 4QTFA 1G7LB 5HD8D 3ARZA 2XWRA 1CFTB 5GGQH 2XKUA 3FTSA 4TVUA 4MSWB 5LCVH 5AG8A 2VLKB 2ZKXA 2B5IB 3VXSE 1AQKH 3HR5A 2BP8B 4R7NB 1NMBL 4GQRA 5AVQB 4DV7Q 1IM9B 1QBML 5DVKA 3B9KA 3L1OH 4R8WH 5GS1C 3NCMA 8PAZA 3D0AA 1ZK5A 4FLOA 3UYOD 1NCJA 1X6NA 4JFHE 2WD0A 4HGWB 2XWTA 3MV8B 3U4EA 4V2CB 3T3MF 2WB1B 3P2BA 3NJFA 4ZO8A 2ZAGA 4Z3TA 5CWSB 1XAUA 1NPNA 1X5ZA 3LX0A 4UQIM 1B6DA 4RZCB 2PYKA 3IAGC 4DSYA 4X64Q 1T1XA 3TBVA 2NQDA 1GOZA 1A7BA 1U5KA 1TTRA 1TZOA 4ZD3H 1T7WA 2KL6A 3LZFH 3MRIB 5I2IA 3WKML 1VIWA 1H6FA 2DQJL 3QXUA 4OXPA 1UE5A 4UANA 4YIQB 3ORJA 1A7QL 1KBBA 4R4ND 4YAQA 4IO9A 4QRTA 4WF7A 1BZ7B 4PV9B 2HFFA 4YXLL 2Z1KA 1EXGA 3VDBA 2R1YB 1Y07A 1ZT4A 3UAJD 2CXKA 3X2QB 4W93A 4KOBA 2DJMA 2YC1A 3H2QA 4N8PA 5DRNB 1SBSL 4Z9CB 1RZKC 1HDMA 1JK9B 2DLHA 3CFKB 1Y0LA 5BR8Q 2WXLA 1MFNA 3FFOA 4X7CC 3ELAT 1QW8A 3BSGA 1S40A 3PUYA 4J1UB 3BSHA 4UDTB 3W9DA 4F7CB 1C12A 4L8SB 5CM1A 5F0JB 1JFHA 32C2B 2BRRH 5D96B 5EDSA 4YCWA 1XGQB 4HX1B 1FHGA 1LNUA 3K81A 4L1DA 4WWKD 4XDXA 4D9LH 5D1ZD 2PCXA 4YO0A 4ADIA 2B15A 3ZDYB 2LVEA 3LKQA 3TO4B 1RI8A 1H3WM 1B0GB 2EIMB 1QABA 3V7MA 1KL9A 4G9FA 4ZMQA 3TURA 1EGJL 4GPVA 5JO5B 1SOKA 3FB8B 2IGLA 3SDAA 5EC2B 2V7NA 1XGPA 1J0IA 3QVAA 3SDCC 3TESA 4TQHA 4AKPA 5K36H 4GIPD 4M5TA 1TY0A 3SZKC 4WFFD 3BJUA 1KLUB 3FO0L 5BPPA 2HIXA 1E2ZA 4IRZH 4AI7A 1H8NA 1RJZB 3KYMA 4GN4B 2VW4A 5AZUA 4NWTL 3T77A 3FT4A 4UV4L 4RSVA 3CXHK 4UIMA 3CX5J 1KYAA 1L5GB 1JF1A 3FPPA 1PD6A 1JZ7A 4PVLA 3ATFA 4K3HA 4V33A 4YK4B 4B9ZA 4OZIF 4JG1H 4ZLTF 4XVJH 3KF6A 1YEJH 1AS6A 2OYMA 4IBYA 4HEMA 1NKRA 3BFOA 1IBGH 2XJLA 1A9VA 2VDNH 4P5RA 3O3EA 3N52A 4LWCA 2GBAA 2I24N 2ZXCA 4KHVA 1I4GA 3UTTA 4Y4FC 5GSRA 3GSQB 2PNDA 4C4BA 4CC4A 5I6XB 1F6AB 2P5WA 5IHHA 4DUZQ 3B7RL 4JI7Q 3QFJB 3P9MA 1RY7B 1RUAL 2WBKA 1PTOB 3GSVA 5D1XD 3VTMA 4OIJA 2OEOA 2Z3FA 3U1SL 4A3FH 3I4MG 1ZV9A 3AADB 4N0RA 5H2BA 5AD0A 3EXJA 2J2ZA 1NCVA 5I73C 1NA8A 3PPEA 3OAZH 1B4LA 2VXTL 2W94A 1MUJA 3X3FL 2ICEC 3HOYB 1AJ7L 2H41A 1M1XB 9PCYA 1NAML 1FL0A 2K32A 3KEDA 4LHUG 3RILA 4JCVE 3P3UA 3GKZA 3ZMRA 1B2WL 4L8SC 5GGSA 3MODL 1Z0MA 3MBXL 1H3PL 5K39B 2V5YA 3W11D 4AQYL 3GMNA 1H9VA 1NGWA 4Q74A 3C6LB 4GSQA 1GC1C 5D1QC 3THMH 2M8XA 1HL5A 4H02A 1X6OA 2NN6G 3TVMC 3VUAA 5I75B 1U8JA 1TLMA 2CDGB 3QEUA 5DJ6A 3CFJA 3Q8EA 4OFYD 2Z9HA 5DJYB 2MCMA 4D0DB 5D9SA 2BS71 1LEIB 2R92G 4NPJA 4A3BG 1SR3A 1GSMA 2MQGA 2OYLA 4JZJC 2EEAA 3OMCA 1NBZA 2QV4A 4MAUL 5KEZA 3GI9L 2CBQA 2E9IA 2ZAIA 3RIFK 2AXHA 4AG4H 2APTA 2IX3A 4R9WA 3E7JA 4TVPE 5IWLC 5ERWB 1D5MA 3HOWB 4XC1H 4IRZL 3FPXA 3D2UA 1X5GA 1LTAD 5JZ7D 2B2XL 1G6RA 3HI1A 5IMLA 3BUBA 4A3LH 4S1SH 1JZDC 4W6YB 2TRHA 5K9JH 3GIZH 2B29A 1UA7A 2NY3D 1KGCD 4OZHB 2OJZL 2WLYA 4XMPL 5IGXL 4OWWB 4BY7G 2ZE0A 4Q7DA 1KWKA 3MGOA 3UABA 3V79C 4YSSA 2H1PH 4PP1C 5SX5K 3QWNA 4O00A 4BCYA 5CYUA 1HH6A 5BV7B 2ICWA 3FTVA 5T3XH 3S24A 5KSUA 2K6WA 1P4BL 2ZOLA 3U4EB 2YU9H 1NAMB 5KRUA 4X65Q 2BRRL 4DEPB 3AMUA 3DV6A 1D5ZA 2OZNA 1TS4A 4L4VE 3QUXB 2HX7A 7FABH 5GGRB 4LP4A 1TTFA 4JANB 2BM3A 4NQEB 5DK3A 3LMJL 4R4OA 4A7UA 5CCHE 3QPKA 5GZND 4CSTA 3J81E 4N2EA 2PO4A 3OGCA 2ENYA 3O2VH 5FYJE 4QHLA 5I30H 2R8SL 2MO0A 3LKOB 3BH9B 4O5LH 4P05A 4FNPA 4KNUA 4I0KA 4ZAKA 4X62L 4HUMB 4AVHA 2PTTB 2ZOKA 4ZMLA 4WO4B 4JW3A 5C44B 4P9HL 3NA4A 1GGCH 3GHPA 5C0RL 4FG4A 3H42H 1BVLB 1MCWW 5DYFA 3RIAK 1E7UA 2PETA 1XGQA 4KJPD 2EVIA 3PUXA 1UYWL 5EORL 4LF7L 3CCJA 4KTYA 4B0MM 4F7TA 3HB3D 1DCLA 4GUPA 5CZXC 4WK2B 4OZGE 5G5DB 5I15H 1PD1A 3CDCA 4PJFA 1KBGH 3BZ4A 5I8OL 3I2CH 1I53A 1JK9A 3CFKA 5IEKA 5KSAA 2WQSA 1H15A 4P71A 1NBQA 4LLVB 5EBMA 3KPOA 5LGYA 3FKUS 3OAYK 5D5MA 3NBIA 4FKEA 4NUGL 1KTDB 5KJ7E 3QAQA 3K7UA 4KY1H 1ZRUA 3GS0A 4M1GL 3IU3A 4E5XB 4NQCD 4YSRA 4BZ2H 2AAVA 4WIQA 3ZQ9A 1E2VA 4KROB 1PH6A 1KNOB 1LO5B 2VM9A 4GW5A 3BVUA 3D0FA 2QQNH 3T0BA 1A6XA 5KSBA 5BR8L 2PXYD 5F1NA 2AQ3B 2IQAB 2V2XB 1SXZA 4AYFB 1CIUA 4MYWB 4Z7VE 4PJBA 3APFA 1SFHA 1KIPA 2V4LA 4MMXA 1OF0A 3EOAA 1ETJA 3WAKA 4R8NA 4LF3B 1RD6A 1KUMA 1TSRA 4ENZA 1GGIL 3LQAL 2HTKC 4YSAA 1XT5A 4Z6AT 1UQSA 1NCWH 1DN0B 3OTOL 3UO1H 2V8LA 4RWHA 4L8CA 1AP0A 2X4SA 1STBA 1OZTG 2WB1E 2EEXA 2X1OA 3TBCA 1T5WA 1C5CL 4WW1A 5E6IB 3KOJA 1A1MB 2N7BA 3PAUA 5DVOA 1YNLH 4V0BA 3MAQA 2H4OA 1ZLSL 5HHXL 4JFDE 2TSBA 4JPQA 5AAMC 3CPUA 3IFOB 2OP4L 5ICZA 5JEAG 1XMQL 5B4MC 4OZGF 2XZQH 3Q8DA 5ELDA 2J56A 1A2YB 4MXVE 4NUPA 1JCKA 1DVXA 2V5MA 4C83B 4PJDA 1VCIA 1J8HB 2QGDA 3DOSA 4KKBC 2GSGA 2CRYA 1CWVA 2EECA 3U4AA 3NYKA 1WTWA 1KGXA 1EQWA 3IDUA 3G7LA 3MI6A 3NVQA 4DZBA 3I3EA 4EZJA 1N5AB 3X12B 4TVSa 3MOAH 2B2YC 3KBPA 3WY2A 4D0CB 4HD9A 5LN4A 4U1IA 3U0WL 1CDGA 2Y07L 4QHPA 3DVNB 2R2HA 1BBDH 1ZHKB 4IU3B 3QA3A 4KX9A 4X6FA 1EAJA 5DF0A 1T21A 3AXIA 1IW7C 2I5HA 5IROD 2QTEA 4M7JL 3L0OA 4GKNA 5AUMB 4BK5C 1WF5A 4QRRB 1WAAA 2YGNA 4ODTL 1HSBA 4LUVA 5J1AA 2F54D 4F8TA 2BMKA 1K3IA 2GABA 2V2WA 2WN2A 3IN0A 4IJTA 4XP4H 1OTSC 4YWLA 4ETQB 3OKKA 4ME5A 2EE1A 3EH1A 2P3YA 1OP4A 2CO1A 4QHUB 1GOFA 4A2EA 1FGNH 4Q0FA 2WLNA 1LDSA 4L0ZA 3D4GA 3MLWL 3RKDC 2ICIA 3NIDE 1SJHB 4LHUB 4YFLI 4NM4L 1I9EA 1TG8A 4KKNA 1JPGB 3N9GL 5BV7H 4GRMA 2HX8A 2Z34A 4XVUD 4MHEA 3ARSA 2PPDA 4UT6A 3OMIB 2FB4H 3QJUB 1QVFA 3DX9B 2IH9A 4M6MH 2X53A 4PG3A 1CI5A 1GS6X 4RBPH 1JD7A 5IV2B 3RURA 4J39A 1HYSC 1SYDA 4NO5B 3WEBA 2A6JB 3BAEL 5JW5B 4IJ3B 4RRPA 3H7BB 3EXLA 1JGVH 1YHQA 4ODVL 2VL4A 4WEMB 5H37A 3RNUA 5IFJB 2GSIB 2P49B 1NFDE 3R0MA 5I5RA 4FXTA 4WWNA 4BA0A 5T1JA 4C1NK 1YMME 2A6IB 3QCTH 5IM7B 4A68A 1TQSA 2WXNA 4RFOH 2VDOH 1P7HL 4QRRE 3E2HC 3FSWA 3MREA 2XVSA 3ES6B 2G0KA 2CRIA 4LSPH 4JB9L 4MA7H 2YTYA 1ED3B 4H7BA 1SYSB 2DQCH 4G7YH 4M3KB 4DR4Q 1K9TA 1NGPL 2GBUA 1N12A 3T13A 3F65A 3VFSA 1PTOF 4NXNL 4KTGA 4HJGB 2G75A 1M3IA 4DP0X 3FRUB 4D0BA 1KC5H 4X6AH 2F54E 4WU7B 3OF6A 4LSUL 4YE0A 1QNZH 4PMBA 1DQLL 4JMNA 1YY9D 5CGYC 4KK6C 4F7MA 3INOA 3B2DC 4PJHE 1DQQA 5DMYA 1YJDL 3J7A5 2DZEA 4Y4KB 5D71L 1GUNA 3DI3B 3IXTB 1CICB 3L3GB 3IWVA 4HH9B 5B39G 4WI4A 3FN0L 1TEYA 3VD4A 1ZE3H 4P8QA 4LVEA 4IKLA 2X4PA 3LNNA 1E22A 4PGEA 1PGRB 2OTWA 3NUKA 5DHXB 1GHFL 5AOIA 4M7LL 3BKML 4DP8X 5D71H 4DKAC 2Q2TA 2WYIA 2XZQL 4PG2C 3MOBL 4CC4C 5BUGA 4GW4A 3OSKA 4TQEH 5KW9L 3DGCR 4PJAB 5DQJB 3VXRA 4ELDA 3SPIA 1F00I 5EU4A 3C75A 1ZGLA 4GBXB 1GUWA 5TTRA 1ZIBA 3BVDB 3LZOA 1OGPA 3G5WA 2PTVA 4M3JA 5C3TA 2F0SA 1ENAA 3AXLB 4UT9H 3WI9A 3E3XA 5F88A 1AO7B 2OTPA 2G4EA 2RHEA 1ZDSA 2VR9A 3MO1A 5KJ4A 5IGGA 1J6QA 1DEEA 2UY6A 1T66D 3GTKB 4JFQB 3WN6A 3KNBB 1FL6A 1XEUA 3WJMA 2G3NA 2DBJA 4ZS6D 4LSVL 4ZW7A 2FT6A 3BAEH 2VLJE 1KEGL 3L17A 2FIRT 3W0WB 4LCWE 5GZNA 3V8CA 4KK8C 4CC0A 1UH4A 3R4DA 5C3WA 1FFPB 3U4KA 2JA8H 2NZ1D 4MD0B 4F3FB 4WFEE 1CYGA 3ECQA 4FXKB 3HLAA 3ABLB 4PBVC 4ORGB 4PRPD 1R1CA 1GVIA 5B38A 3EYVB 3VU1A 4HK3N 2NYYC 5HDBF 1QSZA 5HYSB 1CGXA 1WUNT 2Z4TA 5CJ5A 2ZP0T 3FQXB 3J7ZC 3BPLB 5GZOA 2NW3B 1JRHI 3O9WA 2E0PA 2W1NA 2ZSVA 3JTBA 3PIQB 5F44A 5INDB 4XXWA 5I8EB 1EK3A 3O2DA 4KHXH 1JMCA 3MRDB 4KRNA 4XN5A 1RZFL 3ZHLA 3PGZA 4B7IA 4ZW3A 5FPIA 1KFAH 2AC0A 3HC3H 4P5TA 3TBYA 3Q22A 2JWYA 4K2UL 1X3FA 1XZ0B 3FSAA 1EOVA 2HFTA 1A2YA 5CEZD 1U4RA 1CIDA 4R5VA 1A4KA 1OY3B 1KELL 2E9BA 1AHWB 3A5ZB 1WOCA 4H8VA 3CVHB 3BUPA 5DI8B 5C07E 2EIJB 4XAKD 1T4KA 4LPUA 2ARJB 5IT9c 3V4PL 4MXWL 3IL8A 5E6IA 4WU5A 5EO1A 5J9PA 1QBLL 5I18L 1HINL 1AZNA 4JI6L 2PO6B 1QNZL 4KY2A 4LDEB 3I4NH 2WQ8A 4PRDB 4PW4A 2J88H 1IL2A 1J9QA 2X0UA 4RLDA 3CFEA 4PI2A 5TF0A 4APVA 3QJHA 4M4RB 2IY5B 2IAMB 3TIEA 1DEDA 1UASA 2JJUA 3GK8L 3ABZA 4UNVA 4A3EG 2Y5TA 2GFBA 4OVUA 1IRAY 5ISZB 3MRPB 2DYSB 2YPVA 1AZUA 4W70A 5C0BB 5J6HB 2IH8A 1JYVA 5FKPA 1Y8OB 3L4VA 1QSFA 2V9QA 4K6DA 3QS2A 4LARH 1OXYA 1U8CA 4P04A 2CH8A 2W38A 3UBFA 1DBKH 4FFYH 1EY7A 4TLUA 4CMMA 5GS0L 3PWLB 3HN3A 4KJYB 1F6LL 3QRBA 4FQ1L 3NWSA 1HIML 2H5XA 1U36A 2NY5C 3UJTL 4JO3L 4XOEA 6PCYA 4KKCC 3GWJA 5CEZL 1CMOA 3KPSA 5DK2A 2VNUD 1OPGL 3S8GB 1YJNA 1SEQH 3DLQR 2BSEA 2AKRA 4GUPB 5T1LD 2VL5A 3LOWA 3V0EA 1Q9LA 2A74B 5E95B 5FHAL 1BVKA 2LVCA 2M83A 3WY4A 1OXXK 3GJFB 2OXGB 1S7UA 3RBSA 1QRNA 4MTKA 3L95A 3WIIH 3QUKB 4ZPVA 3WKPA 2NX5B 4JI3L 4DAYB 3S9WA 4AL8H 4HC1L 3TX4A 3W57A 5KBKA 1L0PA 2VN7A 3N40F 2ADGA 4GOPC 4WFHD 3OBAA 3SE4A 3SEBA 3U9UA 4ZTOH 3Q1EA 3VI3E 2Z35A 3STBC 1VF5C 1PMYA 3B34A 2F54A 4PAZA 2L1BA 1LTTD 5C07D 1TQCB 3EDEA 1EXUB 1DGSA 3MLSL 2OZ4L 5DA4A 4B3VA 1HHIB 4KV5F 1G0DA 1IAOB 1V3MA 3QQXA 1M71B 5TGBA 1HXYB 5D4JA 3EO0A 2K70A 2ROXA 4PQXA 5FCUH 3DIVA 3PYCA 4XMKH 1C7SA 1U8QA 5KNDA 3H9SB 1BOGA 3S8WA 4GUCA 2D7TH 3ARPA 3S37L 5FUZH 4KTEL 3KLQA 2IW3A 4JW0A 2HN7B 1WAPA 2OJEA 4NPYA 1JXDA 5DQ9A 4NQTA 1VKXB 3R0NA 4JKKA 3IF1B 3V6FB 1FORL 5EV7A 2QADC 3HLKA 5HHXH 2O5XH 4CA4A 4M7ZC 3VRIB 3QIBA 2VDNB 4FYSA 1JF6A 4XVJL 4PJ5A 3N1QC 3BEWB 3CX5K 3RTQA 4Z77A 3ZTDC 2VWEE 3DHUA 3GBML 3U4BL 4WNQA 2ZNXA 4E9QA 4L0YA 3BWSA 3C8HA 3UADA 4XXDB 2VLLA 5I18H 3MX0A 2WCPA 1Z9MA 2GJRA 1YHBA 1R3IL 1WK0A 4K6LA 3OIPA 2AAAA 5E2TH 3RVVC 1NIAA 1PG7X 4WJ5B 4XC1L 4E42A 1MHEA 2YBGA 2IHEA 1D5XB 4EOWL 3PQYA 4DV1Q 1T7YA 4IUUA 1EJOH 3QUZB 1U8LA 3IJHB 5TF1H 4AV4A 3S4SB 1YN6A 2F7QA 2NDFA 1VQ7A 2WZ5A 5KVFH 3PWJB 1R3IH 4ZNCD 2RCFA 5K39A 4JL1A 4XB7A 5FJ8H 5IY5B 4X66Q 1HOCB 2EE9A 4KN7C 2QT6A 2XWZA 4MX7A 4FX5A 5AVRB 4DP6X 4UB0H 1SE2A 3BT0A 3O6LL 1O7LA 4WW2F 3W11C 3PIO3 1YMHB 4HSAC 3KFUA 2ZYIA 4L5RC 3OKMB 5COYA 1QHQA 3VFVA 2DM3A 4Z7WA 2CH4A 2Y5QA 2MH4A 1G9EA 4KXZI 3GIVA 3PGDA 5IVZA 4LIQL 5TFSL 2M00A 3B5HA 2W88A 4EQOA 3D51A 3GXMA 2R7ZB 1R6VA 5D6CA 2FX8L 4YY3Q 3KPLB 4O51B 4EBQH 5IOCA 5KIXA 4I0PB 5AKRA 4OLVH 2I9LA 3ARFC 3LZNA 4KJNA 2OWOA 2H7WA 3D87B 3L6FA 3CHSA 3QIUB 1S7RB 2Z31B 2KCMA 2V2TB 3RI5K 3WN5A 4BFKA 4NKMA 2HRHA 3PO3B 3OPZL 5E2UL 4RWSC 2OZ4H 4K15A 1SUJA 3W5MA 3ETBF 2NY3C 5AW7B 2J8UF 2MQHA 1SY6H 1KCRH 2EH7L 3CC1A 2CGRH 4H8PA 4Z3HA 2WUBL 3HKZA 4DOHE 1O9VA 1EO7A 4FNLH 3U0PB 2CCVA 2F2HA 4C56D 3OKNB 5D7EA 3E9HA 4MNOA 4NDMB 1VCBC 1B3IA 1B4JH 1MAKA 4YDJA 1MLBB 2WWOA 2Z93B 1LT6D 2D3JA 1FORH 2WUBH 1URZA 1LJMA 2IALB 3EFFA 3LHPL 3SOBL 4DGWC 5D8JH 1BSIA 5EF0A 1U58A 2ATAA 1PTOD 3BGMA 2EYOA 3DXAB 1MVYA 1S7VA 1S3RA 4UYPA 5D1XB 1T1ZA 1U8KA 3LQZB 5EG6C 5E9DD 5GZNC 5LL6X 2E7CA 3EG9A 4DK0A 3FN9A 2QPSA 3HE6C 4YH6A 3GTMB 3P69A 4X5QA 3QDMD 2XN9D 1EEYA 2JIXD 4Z78A 5FOBB 3MLYH 3WFEL 4YHNB 4K3GA 1QFUH 3NACH 4KV6A 3CV5A 1K8DB 4IRJD 4QHNA 4JLRA 1AHWC 1VQLA 1UXSA 2EOTA 2PR9A 3FMGL 2A19A 5C5LA 1VQKA 4R0LB 5ELOA 3ZRFC 1D6EA 2WUCL 3I55A 4PJFE 1O7SA 1EHNA 3FZUC 1PZ3A 4I77H 2OXHA 1SMYC 3L4UA 4AQEA 4XP9L 1PZBA 2C9RA 3IJ9A 3QIUD 5CZRA 3HG5A 4P2RE 4WJG3 4JM4H 3E6FA 1UM4H 2PNHA 3EYOB 4XCNB 3GJEA 4OJFH 4L48A 3FRPG 4HKZA 1JPST 4L1LA 3Q6GH 1J5OH 1WTLA 4U1HA 3S1QH 2UX7A 1RURL 4A1RA 4ZUTA 2WKOA 4E41B 2IAMC 1JI1A 2XBZA 4OCXL 5FDWB 3QUMH 5C09E 4H25B 2EDKA 2IJ0C 2TMPA 4X5XA 1OCWH 4Z0BL 3PXJA 1UA3A 1DBMH 4YE4H 1JPSL 1A6ZB 3OAYH 1PL3A 2RB8A 3CCEA 4NQXA 2YK1H 3VXUD 1TWCB 1JN6A 1BZQK 2FIKA 4OV6F 1EY4A 2DQUH 4UOZA 3DDFA 2WTRA 4HAFA 3NK9A 1U8NB 4RFBA 5DD5H 1BOYA 2HJKA 4M29A 1V1QA 4MJIA 3VFTA 4IRZA 3JQOB 2CAKA 1OL0A 1KTRL 4KQ4H 5HYJD 4GYBA 1CG9B 3RG1C 4RG1A 4FCAA 4HT1L 4U1JA 4G6MH 2IG2L 3K6DA 1B2YA 2E7LA 4LCYA 4UIKL 3JWOL 3NGBB 4AC4A 2CDFB 4E68A 3I3CA 3ETSA 3PCOB 3D31A 5ELNA 25C8H 1SDAB 2WCGA 1E4XH 4MZ2A 4PZ7A 2XHNA 4Y2DA 4A2HA 5MP6H 1W72B 5I71C 4Q4EA 1C16B 1MNNA 1IGMH 3AY4A 1FVCA 4NXKA 3NDYE 4M6OL 5ITFA 3ABMB 5J1SC 1KGYE 5CKGA 4C4KT 4K5WA 4JG1L 2G3MA 4IS6B 2F0DA 4H13C 3MRPA 3Q2WA 3S17B 1RMFL 4KHTH 5CINH 3WD5L 3BP6A 4I2XE 4M7JH 2XTSA 3V0JA 4Y89A 1FYCA 2J6EL 4K3JL 4UIKH 1NC2D 4B08A 3APCA 2VN5A 1CHPD 1UEMA 3VX0A 4AM0B 1OM3L 3WSQL 3T2NH 4C3JB 3NIFF 4P2OB 4UM9B 1JTTA 2R29L 5D1ZB 4BFIB 2OQJA 2ZUUA 4S0SD 4X80L 4NRXB 1L0YA 2BC4A 2PCFA 3EJJX 3AGVA 5CFHA 2BCMA 3WJLA 1MCWM 1P2CB 3MGTA 4HUXA 1L3NA 4UUJA 3RGVD 2KKQA 4Y16B 4WI3A 3GTGH 2C1PB 4JDZA 4UT6H 4NQCE 4AX3A 4IGBA 1ADQL 1PH1A 2JSOA 12E8L 1LTGD 1DBBH 1QR4A 1JSYA 3DX1A 3H9HB 4YGVB 2BXYA 2APWA 2WAQA 3NH7L 3CHBD 1TETL 4IEFA 4UBDC 5G4OA 1J0KA 5IROC 1N34Q 3D85A 2ALWA 5FGRA 5L8LB 3QB7C 1GO3E 3RFZB 2UVEA 1ZK9A 1ZOXA 3L7ZC 3JWNE 4CMHB 1BLNB 3LGJA 1GCYA 1PKOA 4QTHA 4BEIA 4BKSC 5I1IH 2CKZB 4JV5Q 2CM5A 5GQBA 3MRDA 4ZZFA 3SPJA 2ZTDA 4CJ0A 3TJEH 3VA5A 2ZWNA 2GITA 2YUWA 1LO4L 3SR1A 3MOBH 2W81C 3LH2L 5C2BL 1H9JA 1PZID 4WJ3M 1N6UA 1QFWH 3SZ6A 5DQ9B 3FKIG 2MNUA 5JYLA 5GS0H 3KPSE 2ZF8A 4Z7NF 1JWMA 3NUCA 4PJ5D 5B39B 5C2BH 1PIGA 2Y7SA 2Q8IB 4PP2B 4XPAL 3EJQA 4JI2L 2WB7A 4A2FA 3QR0A 4OF5A 3KDMA 1TQBC 3FN0H 4QGYA 4HK0A 3U9PH 3U48A 1WYDA 1DQDL 4FN0A 4F88A 2C4FU 2P8MB 5MHSD 3GZKA 4X4KA 4L37A 2BNQA 4YHML 1JHKH 1SLJA 1RK7A 2F53B 1KY6A 3VDCA 3CKIB 4OLWL 5C4JH 4G6KH 4CDHA 3CFQA 4KQ0A 3BXNA 3L48A 4LEBA 5AW6B 3ZLQC 5DUBB 5KYWA 1MJEA 4PWKA 1RVFH 3B56A 3RD4A 4NIYE 4JC0A 3QHFL 3WLBB 4W9DC 3Q13A 3MUGA 1INEL 1KXLA 3V0DA 1Z9SA 3K8KA 4XNYH 4UAOB 2R56L 3T8VA 4F15C 2CK0H 3C2AL 3BH8A 1MFBH 3G5VB 5IQ9A 1PKQE 4OEMB 3P11L 4NC1E 2UXTA 4XAKE 1CT1D 1NIDA 3SDAC 3K6IA 5AW2B 2AKRB 1GPOH 2X0VA 4PJAA 5I9QC 3LZLA 3KR3L 4BFFA 4HUWB 4KK5C 1JK8A 1TMCB 3EJZD 3V6ZB 2B8OT 2Y24A 2WQWA 4R8IA 4E0RB 3MRFB 4PJEE 4EBQL 3VFGH 4Q2ZA 4E9WA 4P2AA 4HUWA 2G9KA 4JO5A 1P6WA 2BDNH 2BP5M 3NSFA 4QTIH 3ERXA 1IGFL 4KXDA 4DV0L 3T1FA 2WKOF 5FGBA 1WFUA 5JMRA 4JZJB 3IDGB 5EH1A 4XCYA 1WI5A 3RVWC 5BOPA 4LF4Q 2BFVH 4NAJA 1SROA 4PWEA 3TV3H 3V5HB 1HXMB 1DQQB 5IFHH 4RAUC 3M85A 1MCBA 3MEHA 3F12A 3K6SB 4RCAA 1JPFB 4HG4K 3I4NG 1LK3H 2OXPA 5EZJB 1FD7D 4ANVA 2XQYK 4PWHA 3M9BA 4DUYQ 3QJHB 2ZX5A 4XRCA 4M7KH 3RWHA 2MCPL 1T66C 3ULVL 4EOWH 4QXGL 2WP3O 4L37B 4DN4M 4NEHB 4ZFOB 2OYKA 4NNXB 3FTXA 1IE4A 4AGLA 2OSWA 3FUNA 4F9PC 3BO8A 4NQEE 5E9DA 5LNDA 1W0YT 2EKSB 1T4KB 3CTTA 4FNQA 3Q5TA 4PY7A 3A23A 2XN9A 5HHOE 3WV0A 1MNUH 1PSKL 4XMLL 4K8JA 1A4KB 4Y4HA 3T04D 3F7VB 3L3OB 1AGCB 1G7HB 2EY5A 1WZMA 4HGKC 1PZ5A 2NYYD 2IH1A 1RZJH 3JVGC 4FKKA 1MWAH 4OLWH 4R3SB 1IC4H 2X4TA 3WUWA 4JI5L 4FTVA 4XNZC 1J9TA 3I3DA 1T5XB 2BSSA 2UZPA 2D03L 2WNWA 3FTUA 4XQQA 2FEDD 4BBSB 3KYNB 4NRYA 2LU5A 5IT9L 5DCCA 1D9KA 3GTMH 1OE2A 1S7WB 5EOCH 1J0HA 1LK2A 3WYRA 2PCPB 4WTQA 1L6ZA 4IKKA 1J8KA 4WY7H 2XRAL 4K94L 3P4OB 3DO7B 4XPBH 1IKLA 1RZKH 1E27A 1OAUH 4RMTA 3MRLA 3T09A 2QL1A 1CLOH 4PFEA 2GK0A 4KI5D 1STGA 1F4XL 3BDBA 1HZLA 1WIOA 4QGTA 3G6JE 3PWPB 1WE5A 3GTOH 5E6RB 1WZKA 5IYBG 4OGYL 2WAQE 5HDLA 1ZLWK 4G8IA 4OFIA 1ONQA 3T08A 1ZJBA 3STLA 3EO1B 3MLTA 3B2XA 3D9AH 3CXDH 2Y1AA 3L4YA 4HDIB 3FFDB 3HFML 1A5FH 3VFUA 3CU7A 3GSRA 4IFDI 1KTCA 1XCXA 2OCJA 3EDFA 3QJTB 4R9HA 2O93L 1PFMA 3RMHA 1AZRA 1QLRA 2WQVA 4HUVA 1RZQA 1BAFL 3RWDA 1OGAB 5DNFA 1M42A 3HZVB 2OJZH 4A2GA 2DUDA 4A3IH 4LFAQ 1JD9A 3LS5L 4IBTA 4JAMB 5JZ7C 3G6AB 4JDVB 3MVVA 4G4KA 4UYQA 3VWJA 3EYFA 5IVXE 4I3SL 1PDKB 4OZFB 3RBGA 2FO1A 2X9WA 4GQZA 4Q2ZB 4CVUA 2KZ1B 1KGJA 3A5VA 5BS0D 5CMDA 2W9DL 5I1HL 4JFFA 1MJ8L 3ECBA 4GRLD 3MLYL 4P5KB 5DWPA 5I26A 4F8LA 1S5BD 4K8RL 3D4YA 2QA4A 1SJMA 4K9EL 4LU5H 2FJGA 4JV5L 3FP9A 1TQTA 4BZ1L 1LK2B 3EUUA 3CMOL 5B38G 5KAQF 1YEIL 3UTPD 1NL0L 4FYRA 3O8XD 1KZYA 1Y8PB 4Q6KA 1H9SB 4AMXA 2VQ1A 4M43H 2MGSA 3UDFA 1L9OA 1PVOA 2NYZA 4Y4KA 4IPHA 1Q12A 2YU9B 1A21A 3MLUL 4H88H 3NEMA 1J7VR 1KCVH 3DJTA 1UURA 3NAAH 3SYCA 1QQDB 3NBHB 3U36B 1PYWA 1A7RH 3TS8A 1U4LA 5EUOE 5CBAE 4DF7A 3ARVA 1KBVA 5DD1H 5MERB 2QSCL 5D4HA 1XF5A 2QGEA 4G3YH 5KVFL 5M3MH 1KENL 3SGKC 1HZKA 5T3XL 2CQAA 4MTNA 4K0KL 1WG3A 4HSCX 5CZKA 1NSNH 4YPGA 3SPHA 4EVNA 4BK8A 1G9ML 3V4PH 4L8DB 1H15B 4POUB 3HB3C 3TCLB 1JS4A 4R0LA 4MMZA 3GSNL 1YEFL 4Y1SA 2JJVA 3CQZH 5AVYB 1RZIB 4PJEB 4U49A 4DK3A 1E4WH 1B1ZA 2UXBL 1L6XA 3GBMH 1GVPA 3IE4A 4E9SA 3M8OH 2BJML 1N2RA 5LAPA 3SDXE 3P77A 4G57A 2J1WA 4N68A 4YL9A 3JYCA 4P3CH 1FNSH 3O45A 2JB6A 5HDQL 1ZEAH 2DD8L 3RL2A 1PZAA 1RJYA 2VXUL 3LPPA 2OCFD 1P84J 2H26B 4JO2L 4RETB 3GFUA 4UNTA 4PJIE 4DV0Q 3UTSB 4A2MA 5CGTA 1UJ3B 1TO4A 4QCIA 5DMGC 5EN2A 4A2DA 1T1ZB 1U8KB 4IHBA 4MRCA 4X98A 4BFBD 4B3ML 1U9KA 3VQMA 5EIIG 2GY7B 2Q86A 3L3KA 3MCLH 4JY6B 5M3FH 1DVZA 1W91A 4YHZH 1SYBA 3ZMNA 4Z7IA 4GG8A 5KYLA 1CK1A 2NY1D 1T20B 3B9KD 1ROCA 2NUTA 1FLRL 1CL7I 3TCXA 2DTSA 4GEJA 5CLTA 3PO2G 5HJGA 2WBJC 3RDTD 5EC1A 4N22A 4NPSA 1TITA 5D5MF 3QUYA 1SDFA 3VVWA 5DVNA 1I50H 4GNXB 2B2XH 2K7VA 4Q58C 4XZUA 4GAAA 4U0RB 4M93C 1NKOA 4TUOB 3ULUF 4UINL 1HJBC 5EEUA 2QELA 4FMKA 3SO3B 5K59E 5AKVA 4QL5A 1FL3B 3MRKA 3O6FC 3O41A 4GAJH 2P5EA 1WGVA 3MFFB 5F6IB 3I4NB 1BVNP 2CWPA 3B2UC 2VB2X 1R0AL 3CQQA 3ARGC 3UJIH 4HPYH 2E5LL 1FYTA 2TRYA 1V1OA 4U2YA 2VDPH 1WT5A 1IC5H 3HNVH 1Z5YD 1TR7A 3CLWA 3QK0A 3WLBA 2R1XA 3N6YA 4E9RA 1V27A 5HI4D 3NZ8A 4O2FB 1IGFH 2F1BA 4K5MA 1HCZA 5CV6A 1KCRL 1Q38A 2EH7H 1OXTA 5C0FB 1IAMA 4KXZH 5C07B 4DR1L 2BIQA 2F53A 4YDLC 4POGA 3O6ML 2ZPKH 1IQDB 3PHOB 4NHCL 3ZMEA 1TTAA 4RGNB 1UOVA 3I84A 1MSPA 3WG7B 3QUYB 4XO9A 5DC2A 5AB9A 4LNQA 4IDJH 4JZOB 4ONGL 1JZFA 2DB8A 3FO9A 3QQ4B 3QARA 2OYPA 3G04A 5AVVB 3RWGA 4Q9QL 2B8GA 3IPBA 5A2QE 3F3HA 2NUTB 4NB3A 6CGTA 5HPMA 3T6ZA 1IVTA 4AEHL 3J7AV 4P3DA 4UY8C 2PZTA 4R4FL 5JHDB 5EIVA 1X3EA 1MSGA 2I5YL 1N5YH 4GP5B 2CLRB 1Y18A 1ACCA 5I82A 5HYIA 1SXAA 3LD8C 3BSZA 1WAAE 5G4NA 5JXAL 5DXWA 1FAIH 5KSBB 1DD2A 5E0QA 1S7QB 2X9YA 2V6HA 4K23L 4KRPC 1TUPA 4X5XB 5FDYA 4DKEL 5D14A 4MAYB 4S1DD 1P4BH 3L4ZA 5I23A 2K5QA 3PO2B 5KN5A 1HH2P 3D85B 4PMWA 2WBJB 4OZIB 2FX9L 2MQ3A 4IEFB 4NW2A 2AQTA 2JH2A 1BG1A 3L7EB 1JIBA 5EULV 8FABB 2RDGA 1OALA 2WZPD 3QIBB 4LQ1A 3IDYB 4Y4HD 1CE6A 4O02B 2YFOA 2KLTA 4OLYL 4F9PA 4GLRH 4KU1A 3V55A 1GXEA 3RN5A 2X44D 3RJOA 2VO5A 1X56A 5DJZA 5DFWH 1JGLH 3QOLA 2DQGH 4TSCH 1OAXL 5AL0A 1JF1B 2FNBA 3HN8A 4CN6A 1KQSA 5LL6S 1UXSB 3GGWA 4AYEC 5AKSA 1VFUA 3S2HB 4K7PL 2JFCA 3QHZH 2FB4L 2UVFA 3DC0A 3I9GL 3HEJA 5EPJA 3SQOH 5I6MA 5IJVB 4IRJC 3CDYA 5TH2B 3K2KA 3OKDB 5L8JB 4LLWA 1H5BB 1TPXB 2DWSA 4IOCA 1HCYA 4DVRH 4M1DL 1SLUA 5T3ZH 4LBEA 2K7QA 1ZGLP 2WC7A 1JVOA 1WWAX 4HS8L 3BGMB 5D1XA 3V4VH 1EFXB 2GCYB 3SGEI 1REIA 2K1MA 1WBYA 3CC5A 4APQA 2BZCA 1E40A 4KMTH 4QOKB 3AQQA 2BFVL 3MBXH 4BE6A 4OGYH 2R29A 3S34H 1VQFA 1F4WL 1GS8A 5DJCA 3NCXA 3QORC 3FT2B 3ARTA 1VZIA 3FQYA 4MWFB 2IAMD 3KVQA 4W1TA 4ZG1A 4IQHA 3QI9A 2XZAH 2D3NA 4O58H 3UEQA 4BY7H 2MWCA 3A8JE 1N6VA 3FF8A 3SKMA 4DR7Q 3RUGF 3VRLE 3OZLA 3GRGA 1MD2D 2C5CA 5C0JA 3VWJB 3O11A 4A3LG 1AXTL 3KYKL 2JA6H 4F5CA 4GP8B 5JXEC 1S5FD 2ESVB 3TNMB 5PCYA 3S5ZA 4I18B 5JIQA 4MYPA 3T3MB 5IMMB 3O0RL 2HTLD 4G80A 3LNIA 5INCB 2GJ6A 1GUSA 1QPKA 2PW1B 1ACYL 4NQXB 1QR1A 2OMUB 2YAMA 3FQRB 1P53A 3VXNA 2NCMA 1SXSA 4QY7A 4F8MA 4AJ0A 5CMAB 4HWNA 1CF8L 4J15A 4UAHA 3R2TA 5CILH 4LP5A 1TTBA 2B08A 2Y1ZA 1G9NL 3AQYA 4R96A 5FIEA 1O5PA 1WFMA 3BPOB 1JNJA 4EQPA 4V190 2QEJA 5D7IA 2CKBA 3VXRD 3FB7A 4HIIA 4JN2A 2CGYA 4UQEA 5D65A 3BKMH 3W37A 4JBMA 3BVZA 5HVGB 3BVNA 1WCBB 2VT0A 3MNMA 3H54A 3BKYH 3SPGA 2NYZD 1E27B 1JHKL 4W9KC 4HISA 3ZKQD 4DUYL 4M8QB 3AFQA 1AGEA 4J28A 1T9HA 4N2BA 4IRJB 5ESVA 1HILA 5DLMH 4LLYA 4S0TD 1D7QA 4RKBA 4P74A 3PHQA 2R0LL 3WTYA 1D9KB 4OGXH 3NSCA 1WTHA 3DSFH 3ZKSD 3OX8B 3RIAF 3JT0A 1XCWA 3QUZA 4FFYA 3MJ8A 4EIBA 5HGBA 3W1BA 3FOMB 3GD1C 1VQJA 1WCMB 1YNKL 4W68A 1UGKA 1DVYA 4HFUH 3ZQXA 5ICYA 3R19A 5F71A 3PQIA 3TS2A 1AGCA 1G7HA 4PRPA 3NENA 4OO1G 4G42A 3QXAB 5EQ0A 3PSIA 4RH4A 4F15B 1J18A 5EEXA 5B8CC 2PPAA 4IU2A 3K71B 1F77A 1H0DA 3UYRH 2Y2YA 1J9OA 3ME0B 1OVZA 1P7QD 2ZWKA 1EANA 3TYFB 2FT7A 1I8MA 3BLKA 3TZDA 5FYLE 2FR4A 1GS7A 3E8UH 1M2VB 5T5NG 2O6FA 3BO8B 3NQTA 4HTHA 4U0QB 4TS6A 3LEXA 4WKXA 1BAGA 1KBGL 4YDVB 4ZFOA 3I4LA 1A4AA 4LVHC 3TP8A 5DHVH 4MCNA 3VX1A 1AP2B 4F2ME 2I5MX 1CLCA 1MHHA 2D4DA 2XSKA 3EYVA 3S3PA 1U3HD 1BOGB 3O0RH 4OELB 3R18A 1A7QH 4TF4A 2OMYA 5C0RH 2J6WA 1VS0A 2HQLA 1Y6KR 2CUIA 3CN0A 4F3FA 5F3HB 3S3CB 1XTCD 4P4KD 1NFAA 3LAFA 5HP5A 4OM1L 4G6JH 4NO0A 4CSPA 3H3PH 4MZRA 1CZGA 1SN5A 4OUUB 1PQZB 5IVNA 5FEBA 3P20A 3AS0A 1KGWA 1RJCA 1ONQB 2J1ZA 4JFQA 5BZZA 2QCPX 4P4RB 5I9OA 2QVKA 2HFGH 5F8QC 2WAQG 2Z64C 3TIDA 1N67A 1F90L 1G7QA 5SX5H 1KYOK 3FFCB 5KG9A 1RTNA 1NY4A 4MJJA 4XE0A 3DGGB 4NXMQ 1L9SA 1TSHA 4ILDA 5IMOA 2E7LC 1RF2D 3PABA 4AEHH 5A1AA 2B59B 5CN3A 1Q0XL 2WXMA 3UIYA 4Q97A 5DR5L 2UUCQ 1JGVL 5FV2A 5LBVA 5IESH 3SDYH 2AJVH 2VDQL 4EE2A 4NHUA 3FT0A 1HKLL 5A2QL 1SYEA 3BEVB 2GVAA 4LSVH 2GY5A 3S8FB 1DQJA 3FQUA 4QY8A 1J5DA 4EXKA 3HZKB 2OTWB 2NTTA 2DMKA 3ROOB 2F8XC 3S36H 5JDSA 2KUTA 2K33A 1BFTA 2N59A 3GXPA 5EN2B 4QCLA 5M5YB 4PZ8A 1BZ7A 4L8BB 5F7DB 1U3HB 3GBNH 2BW5A 1A6VL 3AJ7A 2WLHA 3MJ9L 4TVPD 3K0YA 1Q3LA 2HT2D 3ALPA 2ZYHA 3M7NA 4MHHG 4X5PA 3GQFA 3RL2B 5I1IL 2A68C 2WOBA 3SK8A 4XI5D 5T1DH 1GAFH 4MA1B 2N3SA 1YZZA 1L9NA 2YBRB 3HRZB 4PJXA 1YIJA 1JYNA 4PSPA 3H0TA 1LWJA 3DIFB 3UBXG 1QVOB 2EEFA 5FYKH 3KPRE 1FAIL 5LQBL 3TIEB 1LL1A 3PCYA 1SYSA 2DN8A 4K0KQ 1BQSA 5DFVD 3KWTA 3ZVVA 3QO2A 3K81C 1XPUA 4Y2NA 2ZWZA 4OCLC 3AFLA 3WFHA 4AENB 3JTTA 3NTKA 1TQVA 4P9ML 5AAPA 1IEAA 4X42A 4AQ8A 3BZFB 4L2YA 1CGSL 1MF2L 1NCDL 5D93B 3GUTB 1HXYA 1GJWA 3WKNA 3VFWA 5E1HB 4LLDB 3SDCB 5CS7A 3N44F 2OW6A 4OU3A 4JBKA 4JI3Q 1GOHA 2EYTB 2C1OB 1D5BA 1ZVSA 2J6EH 2FD6L 3QP3A 4K3JH 3QG6A 4NO3B 4WUKH 1MWOA 1TJGL 3KXFB 5DI8A 3WLWC 1EY0A 3FTGA 2DQHH 1S8DA 4X7TB 2QGBA 5DJ0B 4HQQH 4HXAH 1CKNA 4L5FE 1SQMA 2AZUA 2GA4B 4ALAL 3HFFA 4BQ6A 1L1OB 2XTJB 5IBLC 4JM0A 2BNRE 4P5TB 1FNFA 2OAAA 3VR3A 3L95B 4WTZG 4HCSA 1PH2A 2JEBI 3GXTA 3NP3A 3DEOA 2OXGA 4OM0H 4QNPF 4OZIE 1YNLL 1D7DA 4GQ9H 5TPWL 1YJ9A 2VL5B 4A7GA 3BE1H 2NW3A 5IODA 1PF3A 2WKGA 2WQUA 1OAYL 3GLEA 3KHQA 3S35H 4DR1Q 5B3SB 4ZRGA 1FG2A 4LHJB 4QR7A 3I6GB 5EWIL 2B2YA 2CGRL 2E7MA 2YARA 2E8GA 1BEYH 4HS3B 5T1KB 3DMMD 1GGIH 4UAIA 2YAQA 5C08A 1HR0Q 3RLNA 3LIZH 3FO0H 4BUQA 1Y1WB 4KJYA 1X65A 5GAEC 2KA7A 3GSRB 3P2DA 3WN5C 1ZHKA 2BVQA 2K5DA 1BVSA 2QZ5A 2Y0SB 3BZKA 4RGOS 5I1JL 3REVB 5IZ7A 1UWGH 3OPOA 1NMCC 4G8IB 2ICEA 3REWB 4OV5A 2Y3AA 3KLKA 2G2RA 5TFSH 2K0RA 4DN4H 2HDLA 4JPKL 5I2XA 1W72A 3K8MA 1USZA 1S5HB 1UM5L 1IC4L 2A83B 2EYSB 1IGTB 4U6XA 3RA7L 1LD9A 3FQTB 4UV7L 5FUCE 5IWLA 3BYYB 1K72A 3X3GH 5FYLH 1ONLA 1STHA 1NFIA 1UWGL 4Z0XB 3HOZB 4FNTA 2P5WD 3VD3A 2VIRA 2IDUA 4O2CB 4XBEL 4R90H 4KTAA 3VW3H 2K04A 3DV4A 2BNQE 2P28B 3QO1A 1ZLWH 3U9WA 4K8IA 3LWUA 1JWMB 1DANT 2CALA 2HJKB 2X38A 4P3CL 3ROLA 3VFTB 1QTPA 1R5IA 3MC0A 3PFQA 1W9XA 3ZBMA 4JFPA 5BW7A 5HVFB 4MXQC 1AAJA 3BISA 3FBQA 3HBGA 4FYQA 5LLIC 4QRPE 4YHKH 4PJCB 1BDOA 1NCBH 4N2KA 3GZOA 2H1LM 3ME0A 2JQOA 1RU9H 4M8UA 5CU9A 5B1JC 2V8MA 3SGJC 3ESOA 4LF7Q 2B2VA 2ZTEA 1JPTL 2DQIL 4S1QH 2YD0A 3AM8C 4AQZA 3QDAA 5AG9A 1NSNL 4C56C 4F7PA 4DR2Q 5JHLA 3VYNA 1H95A 1A7PH 2IIJA 4XPHL 1ZVHA 4GBXC 4HAEA 1RZ8A 3MAWA 3D06A 3O8XC 5F97E 3THML 2PTUA 2VTFA 3X13B 4U3CA 5AOLA 3S88L 2WQRA 3DARA 4OO1H 1FFRA 1KNOA 1FPTH 2X2HA 1HQRB 4ODUB 3O9WB 2LKVA 3RGBA 3BGFC 4HQQL 4HXAL 2G75B 2OXHB 1JB3A 1J5EQ 3KL5A 1PTOC 1UD8A 3U0TA 3VFWB 3LIUA 4UILL 4HLZG 1KCVL 1T80A 1VACB 4GKSA 3SE8H 1XNQQ 4PMCA 3L3OC 3W82A 1SFOH 4W9GC 5DVMA 4QTIL 3ES6A 2PCFB 1DE4B 1MEXL 5E8EA 4G6JL 2NDGA 3HUJA 4QYOA 1RZKL 3TMEA 1MQ8A 2EE0A 2UY7A 5KSAB 4BZ1H 2CIIA 1BFVL 2GTQA 5FOBA 2AANA 2ATKA 1A3VA 1WCBA 2VSDA 5FKAB 5E2WH 3QDMA 4HSVA 4R4IA 2K45A 1ZKAA 1KELH 5LN8A 3KPNB 4M4PA 1S3OA 2A73A 1L0QA 4DK1A 3EO9H 2O5IC 5IQLA 1LTSD 1RODA 2NTFA 1NCCL 1SMYD 1R24A 5JR1L 4WEBH 4GQ9L 2PUQT 3QFGA 1X55A 3QIUC 2ZG2A 5F96L 3HC3L 2WXHA 4HWBH 4P46C 3HJ0A 1C16A 1MDTA 4A3BB 2B77A 3PV6B 5C0XJ 3HOZG 1MLBA 1X5XA 4OKDA 1SN8A 1U3HA 5DS2A 3QDGA 4AQYQ 4IYKA 3BOVA 2HJFA 2CCZA 4WZ9A 5EOCJ 4JG2A 5FYLL 4B3MQ 4U6YB 1BEXA 4FS0A 5F7WC 4Z3EA 4LCYB 1MCNA 4HFWA 2IAND 1JOIA 3EZJB 5DMGD 4KXAA 3TBBA 1I8KA 3NSDA 2PPBC 3V6OA 3DEPA 1CS6A 5CKAA 1IFRA 2VABB 1SYCA 2CMRL 1WPCA 4QLWA 2WTRB 3OC5A 1OPGH 4FJYA 1J8SA 5MEQB 2K5NA 3QI9B 3ZDXB 3G5XA 2P5ZX 2A6DB 2ZOLB 2I5LX 2F53E 3ETTA 5TF1L 3GV6A 1CFVL 4FQXB 1A14H 4LVNB 4X6EA 5BRZD 3WFCL 3DGGA 3NJVA 3FT2A 5D5ME 1MHCB 1F4YH 1M6OB 5BV7C 4KHZA 2PO6C 3NQKA 1F02I 5DLML 2VLJD 2Y22A 2YKLL 2F74A 2BWQA 3DBSA 3LD8B 2XQBL 1SMAA 4DP1X 5KSAD 4G59C 3U6XS 1MH5A 1IBKQ 1T0NA 5IGCA 2GW5A 2R7EB 4DR2L 2IGFH 2X2UA 3DOSB 3KM1A 2DYRB 5IB1A 5F89B 3DWPA 4LPVA 2IQ9L 2UXCQ 2A38A 3MRHB 4P49A 4AC2A 3FU6A 3UGXA 3ECWA 2K6AA 1AZBA 3E6HA 4K5PA 2BY1A 2A4CA 1KMGA 2NWGA 3NQIA 5ABAA 3PWJA 1J0ZA 2GN5A 2P9RA 1JB7A 3RVUC 1R3KA 2OW7A 2ZUTA 3BP5A 4Z3FA 2YTXA 2AFNA 1OTCA 5AAMA 4FABL 3FUJA 3HI5H 4N2OA 4X6DE 1YEFH 3O2WH 1WVZA 3DJ9A 4Y9EA 4BV1A 3RX5A 3VXUE 4AGQA 2NVYH 4ZX6A 5F7HA 4JKWA 1H6UA 4N85A 1S7VB 1E1OA 5I1AA 4KK7A 3MX0B 3EA6A 1IAIH 5JDJA 2VLLB 4Y5VC 4LF3A 2EJFC 4PS8A 3CZEA 1BLNA 5D7KD 3L45A 3HCVA 5KOMC 2Z9TA 3KYOA 3ZIMA 3R8BA 4OLZL 1QO3A 1UWEL 3QRGL 5ILTL 3RGVA 5J06A 1TWGB 2V2XA 3OL2A 1DDTA 1DQLH 1WISA 2Q8AH 1JPGA 4XMXA 4IGBD 3RX9A 1PH3A 3N1MC 4M6NH 3U0PA 2F1EA 2OT2A 3GLZA 3QJFA 1HXYD 4N20A 3E1F1 1A1NB 5C3IA 3UC2A 4KROC 4LPTA 4LF9Q 3DUUB 3FEWX 2XG4B 4KI0A 3J80i 1SGKA 4W9LC 3OKKB 2AK4D 1TFHA 4KRPD 1PXUA 2NY1B 1AO7D 4EIZC 1I9IH 1NMFA 1F3DH 1HNWQ 2ITFA 4BSWB 2NY5L 3HKZE 1BM3L 2JB5L 4JZOA 1HHKA 4G9DA 3BLPX 4YXKH 4DK6A 3IMBA 2APSA 4YWGL 4HBQA 4JFVA 2HKHH 1B3QA 5C4ZA 4A3KB 4FHKA 1HHIA 1WS8A 4JOIC 3GXNA 5E24E 3IGLA 3KLSA 4HEPA 4EIGB 5BVPH 4AITA 1MVUB 3TONA 3FB7B 2VLMD 2WIIB 5F9DC 3SO5A 4Z7AA 1TENA 2HUGA 4O2FA 1YN7B 2VLRD 2CBOA 5CIPH 5J8OA 5KWYC 4YWGH 1HEJC 3N04A 4HIDA 3Q6FB 3OKMA 1NM4A 1XXDC 1WEJH 1NLDL 3GMMB 3TP7A 3BQUA 3QCVL 5DHVB 1OP9A 1EH9A 1G4MA 3BDLA 2EXYD 1SSOA 5TD4A 3ZO0A 5JPMB 2CE6A 2SEBB 2FX9H 2BWIA 1AE3A 1AZVA 1FSKB 2VH5L 3GSOA 3K5RA 3MLZH 4NDXA 4DR5L 4JPVL 1WTXA 4LGRB 5IG7A 5F2FA 3HOWG 1YEJL 3S3DB 4G9FB 4BUGA 3KK7A 3M4YA 3IDMA 3RB5A 4I18A 2QSTA 5BOZG 2HRPL 5EPMB 5SV3A 4XHJD 4NN6C 4F27A 2PQAA 5BO0D 5KANI 4UT9A 3ZE1B 3QEGL 4UDUC 4ZUIA 4X64L 2ORBH 4I87A 4TULL 3PPSA 1BF2A 5CN2A 1LYQA 3CCHA 1XEDA 2AI0H 2ZTBA 3DSFL 1Z3GL 5D2LF 1OP5K 5DS8A 5TDPB 4J8RA 4XPTL 1JFQH 2R0KH 2QMKA 1KF9B 2UUCL 3LRHA 4AV0A 4F20A 1KTLA 1PV4A 2V3FA 3OHXB 4WY7L 3WKQA 2UZXA 1JFQL 2R0KL 4Q6IB 1B8AA 4O58L 1LP9B 2X42A 3BU2A 4RGNC 1UH2A 1VQBA 4YCVA 1M56B 1J5EL 3HUJF 1URLA 5JXED 1YEHH 3KGUA 3P3SA 5D72H 3PF4A 1DJZA 1MW1A 3ELQA 2DWYA 3H1ZA 1IEBA 1KBWA 1OLZA 2WWNA 3HA0A 3JV4B 3SQRA 1JWSD 1KFAL 2X3CA 3U9OA 1VEOA 1IFHH 1H6EA 1WCMG 3WUZA 2C9OA 4P2RB 2EYMA 3QIWD 1R3HB 2GG1A 4DPAX 2EXDA 2JCCF 3WO4B 2K8QA 3HOUH 2EE2A 1TJMA 4FQPA 1IM9D 1KTDA 1FDLH 3P73A 2YJLA 3GI8H 1SOXA 1X54A 4KKPA 5FAAA 5D6DC 1T22A 1OB0A 2WNGA 3LNGA 1P69B 5DSCB 2FX7H 4GIAA 4NUQA 3RY5A 1GHJA 5A2BA 2F0EA 2VSMB 4YPGB 3EG9B 3GKWL 4YVNA 2PI2A 3JAMi 4A3DB 3SE9H 1UZ8B 3UBGA 3RZOH 5FX3A 2R27A 5KSVB 5C4JB 4Z3IA 1AH9A 1CFNA 1AQMA 1F86A 1I4FA 1WTRA 1MCEA 1PRTD 1LTXA 2Q87A 1F1GA 4YDNA 5AWNH 1EDHA 4L3EE 5DHVA 2H32B 4DAYA 3D3VD 1ZSDB 3HI6H 3NIFE 3ULSA 2QSQA 4HJUA 2R7FA 4KZEH 5M3MG 1TJXA 1ZHBA 5C0AE 2Q7YB 1BZDA 5CSBA 5ELIA 4L5QA 3LKOA 4ELMF 3UERA 4BBRG 3GSVB 4YMPA 2P42B 3FUIA 1ORQA 4CDCC 5GGRY 5J1TC 3WD5H 3CFCL 1IAIM 1N0LB 2NY4B 3TJHD 4WW2C 4ZMWA 5HYSA 3G08B 4QJ4B 1YJWA 1NJ9A 4A93H 3QNYB 5J11B 5AFWA 2ITCA 3TTSA 2CW0C 3GMLB 3RWGB 1JHLH 2B1AL 4P5KA 4EN3D 2YD8A 4Z7WE 1J5CA 1CTMA 1IJNA 2EDMA 1E5YA 1HHHB 1QWHA 2FEDC 3AWFA 3IJSB 4QXVA 4R4FH 3QAZC 3PL6B 3VGAB 3DNKA 3ZUCA 1MCIA 4ODHL 1P1ZA 4K14A 25C8L 3RJDA 3LKSB 4YDIL 4E9LA 2YPVL 4TQUS 4TQ8A 4ZDHB 4GKZA 4PGBA 1IUZA 3H4FA 4XO3A 3VFRA 1MFMA 4NCDA 1U8CB 1OPOA 4JN1H 1EO8H 2AP2A 2E2HH 4R7XA 5GGUB 1EJOL 2GI0A 1DJSA 1ZEQX 2JI3A 4WNSA 4DN3H 4HUVB 4CVWA 3KDFB 2YSSB 1IBBA 4BRJA 4JDEA 4Z7UF 3WMSA 1AKPA 3RLOA 1LE5A 1P4IH 3WO4C 5HY9B 4NC1C 1YEZA 3KW7A 3CRLC 4TRDA 5BRZA 2Y9RT 1PY4A 4R4BB 1DSFL 3V6OC 1BBWA 2APVA 1PVHA 3VXRB 3QW9A 2VR8A 2KHAA 1JWUD 5F7FA 1KG0B 2BK8A 3T2OA 1FE8H 4LPYA 3V4VL 3VVVA 3WJJA 5MHSE 3T0EB 4H44C 1U8LB 5KVGE 4IQZA 4GSDL 3I6LD 1AC0A 1X5YA 5A2CA 3AREB 1N6QL 4R4QA 1QFHA 4DV7L 1KEMH 4HGMA 2CRMA 3ATEA 5HVHB 1SYVA 2CJTA 1FNEA 1WDAA 4B50A 1BQHA 2ZXWB 3KYNA 1XMWA 1A3RL 3E0EA 3QO0B 4A3KH 4GRLC 4HCRH 2YQGA 1OT1A 3TTYA 2XI9A 5LXVA 4IOSA 5I6LA 4EXPX 3VXME 1RIUH 4APXB 4W81A 3WFEH 2K05A 3H56A 3OD3A 4QIWE 2X2YA 4C57C 4MAUH 3S6CA 5DHEA 3OG4B 1EU4A 1HEHC 1G87A 1U42A 4PJAE 5FGSA 3VFSB 2LFGA 5E9AA 1QOHA 5C3EH 2BNUA 3W5OA 4GOPA 5D8JL 2O61B 4HPYL 1RPQA 3ZT7A 2J4XA 3V6BR 2EKSA 2MPAL 2UWEF 3MZTA 4LCCA 1U3JA 5H94B 5CBAA 2D2CC 4MMZB 2HG5B 4XH2B 1FCCA 3MUHL 4HAKA 1DBBL 4B6ZA 4G8GD 3KLDA 5CBEB 2VABA 4UINH 3WMPA 1AZPA 2KC0A 5I1JH 4FLSA 1N64L 5GGVH 1I8KB 3BN3B 3GNMH 3RI5F 2LY7A 1S7SA 4HU8A 1QA9A 3C6LD 1OCZB 3Q1SH 2XWTB 2YXMA 3MV8A 1WP6A 5TQ0H 4AE0A 5L7XH 4WEBL 5CZVH 2ZX8A 1UACH 4XPFL 5CXPA 2A9NH 4HS6A 3VDYA 3M1BA 1I1CA 2NCEA 1AO7A 5A2LH 5F88B 3ARED 4N9PA 4WEUD 1Y1WG 1PYWB 4B3SQ 1KJ3L 2HHHQ 2NBFA 3B3IA 3PV6A 4GT7A 4X2UA 5C2UB 4FG6D 5LWYH 2OCCB 1ZGLB 5FYLD 4N28A 1S5CD 3LV3B 1Q1JL 2B5IC 3QZWA 4A37A 2HVKA 4L1HA 1RK1A 4MGXA 3KJ4B 3QWRA 1H9SA 3RZCA 3B7TA 1T1WB 1QCBD 1YEWA 4LCVA 2K3TA 2DIAA 4M48L 4UF7C 1V8QA 4PHZA 2FECL 1UH3A 2LAAA 3OXRA 4P23A 1XXGA 3UAFA 5F7MC 2RACA 5DUJA 5ESAB 2UXGA 5HHVL 3NTCH 4EX5A 1RLWA 3TBIB 3H94A 2OMTB 3CLFH 3DK0A 1SJEA 4MMYB 5HGQA 4Y1AE 1IILE 1FBIL 2XWDA 4OWTB 4LF8Q 4B3EA 5CD3B 2EO9A 4JOIA 3PWLA 4R2GD 5LWYL 2OA9A 1XWEA 4P07A 2AJSH 1JXFA 2HLFD 1SZNA 1MFDL 3MROB 4JG0L 1YECH 2NZ9D 1FQ9C 4J6RH 2C9UA 1OT4A 4OY9A 2LU3A 5DO2C 5T1MB 1BHGA 5FKPB 2XZCH 4A3DH 2OF1A 5GXBB 4DR4L 4L9LB 3SSGA 1RSYA 3I91A 4XN9A 2BX5A 3VFUB 3BQUC 4E9YA 3MRQB 4HN7A 5LO7A 3TBVB 4OD1L 1LTLA 3KWUA 2EVGA 3EO1A 4IZ8A 1E24A 4C3HB 1S3KH 5KYWB 3TJPA 2MSPA 1HE7A 3UROR 4JRLA 3IGAB 4XP5L 5H4ZA 3CD4A 2IANE 4AL8L 3MRIA 4OQTH 4M8VA 3WFDH 2AJSL 3DPDA 5MENA 5CV5A 2Y7QA 3CFEB 1RZFH 2HFEB 3VWKC 2AJZA 3UZQA 1TIUA 3JWOC 3I4MB 3K4AA 5FHAH 3M45A 3NJHA 4JO4H 3I7FA 2LHAA 3I9AA 4R84A 3OR6A 1UM6H 1LEKA 5IVXA 2IWHA 3HG0A 1FRGH 1JNLH 1TTCA 2X4RB 3H7BA 3N42F 2AMGA 4P59H 1H6TA 1UM5H 3ARFA 1IGIL 2GEQA 2F03A 2Y0SG 1W0WB 3B9DA 3FMGH 2BH8A 3JWNH 1CYWA 4LUOA 3BDOA 5I0WA 4C3IG 2F58L 1SM3L 2W9DH 5AYUH 5JIDA 1AE2A 4I5BB 3A8KE 5TQ0L 5KVGL 1IM9A 1FO0L 4ALAC 4RGNE 2B3IA 2XDHA 3ESMA 4FZEH 4IUNA 2W0PA 2W07A 3F05A 5GRUH 4CJ0B 1OK0A 2A5UA 1N34L 1STYA 3HRPA 1HKLH 1T2QL 1XSKA 3ZKNC 1MQKL 2BSCA 1NUDA 5FA4B 4H1LA 2A9NL 4PJCF 2Y7LA 4LCWA 1F2YA 4P06A 1MEXH 4UDUA 1A5FL 3BFWA 2DH3A 2WMPB 1IHZA 5C0NC 2Z8RA 4K71B 4OTXL 4NKQB 2VMDA 4S1DC 4X7FC 1PFNA 4BA2I 3CZUB 4FP8L 4DIXA 2YD9A 2A77H 2X3AA 5TPWH 5T1GA 4GBXD 1WD9A 3MKKA 2X4NB 4FLHA 4LF9L 4G8FB 4HVBA 3JWDL 3ILQD 3J7YW 1S9VA 4LDCA 2C7UB 3QQ3B 3D6WA 3C8DA 2BHZA 1GRWA 3QORA 1JDCA 5D2LB 5CJBA 1LT5D 1HZAA 5DTFB 3JC66 3MXNA 3INUH 4P2OD 1BVNT 1UD3A 4RMFA 4WLCA 3U7AA 4DGYL 1FL6B 1QKZH 2WLIB 5C9JA 4GKKL 1S78C 1HQMC 1JR0D 1DQDH 5DT1L 15C8L 5AENA 1JPFA 1EGJA 4RWYL 4JZNB 1A0IA 3BP6B 1M1KC 2ZOWA 2ZXPA 2X2IA 4NZDA 4EI5D 3QPXL 4J5VA 2CWAA 2IC2A 2XG5B 3VGHA 3ZZSA 5IKCA 4PGDB 4KC3B 4MCYA 2AQPA 3ILEA 1FVCB 1LGVA 2IDQA 1BF5A 2EYTA 2GC7C 2WO4A 3MRGA 1DXMA 1HHGA 3OQ3B 1KEML 5GGRA 4A63A 4F91B 3IMTA 3ULLA 3LTVA 2RCNA 3VAEA 1KTKE 1YEDB 3F5WB 4QRFA 4UU9A 4P5MB 3GRWA 3O6LH 5C44G 4WHDA 2FAUA 1D6EC 3MJ9H 2XXGA 4H0LC 1MWAB 1K8GA 1KFGA 2RSNA 3EJIA 4G43A 4OJEH 5FK9B 4BM7A 4S3SA 4X0NA 2ZCKH 2D62A 3L54A 3DIFA 4Y0GA 4ZFFB 1ADQH 2YPLB 3KF8B 1IO4C 4DH2A 3SDZA 1KPUA 3N42B 3OJ2C 4NP4H 2KZKA 1XYIA 4JI7L 1ILPA 1HI6B 2H2PD 3EOBB 4JHWH 2BNUB 4FQ2H 1LT3D 5E4WC 5FECB 4ZXBD 3HE7B 5FO8B 4P75A 1I3VA 5L2KD 2F5AL 1QPPA 3ULVD 2BY3A 1WA0X 4G7OC 2J1KA 3FOLB 4KVNL 4JFYA 1KULA 5FECA 5DEHA 1FC2D 2PO6D 4AKQA 4PR5A 5C8JA 5IFHL 5FA3A 5TDNA 4JFDD 3C5ZB 3QJVB 3FQUB 4I89A 4P57A 4BXSV 3HPJA 1Q9WB 1QRKA 4JRYD 1V8HA 3I75B 3WE6B 4EDXA 5C44H 4KHXL 2COVD 4J2XA 4OBRA 2VB3X 4WHTB 5J13B 2DJSA 2B14A 4MJIE 5BS0A 3M4OB 5ESAA 5M94B 3O4LA 4PJDE 2VZ3A 5C4XG 5CC4A 3F5WA 4D7PA 4DNLA 3MUY1 4LCIH 3VXUA 1SLXA 3PUWA 2IEPA 1T1WA 5CHNA 5FUOH 3QGVA 4BQ8A 4P2QA 3CU1A 2A2QT 4OR1A 3TN0D 2N56A 1MFVA 1EBPA 5BRZE 4MCYB 5DMJB 2NY6D 1B70B 1VFAB 5HYFA 4QHLB 1FNLA 3FUDA 4JVUA 1AQKL 4ISVA 1ECZA 4UNIA 3ARDB 1QWYA 3FB6B 4OGQC 3NIDB 3UPAA 2CRZA 4OUUA 1HNGA 1Z3GH 2L4NA 5EOQL 2WB1G 1ITCA 2Y23A 4HLJA 1ICFB 4XNYL 4P3WA 5GGQL 3BUIA 3M1BB 2HZHA 2AJXH 1KDAA 2YSSA 2N0MA 4PRHE 5FWRA 5JOFA 4W6XB 5CGBA 3MFYA 1PG7L 3COOA 4LSRH 1V1PB 3T0VA 3T6WA 4JFEE 5C0CE 2ID5A 2OFQA 2CUAA 5DJ8A 4G6KL 1ADWA 4LGSB 4PB0H 3D18A 5K9KB 2YWYA 2VDPB 2A6HD 3GXIA 4YHMH 4RCOA 3DPBA 2NXZD 5HD8C 1YC7A 2W0LA 1PTZA 1HJCA 2R83A 4QGUA 1YEGL 2Y6SC 3H4HA 4N8X1 5I1EL 5EO0B 2FWSA 3NRPA 4AWJC 4PCSA 3T0XA 1OK8A 4D9RD 3MRCA 1G1YA 1I3QB 4G42B 3RZDB 4F1ZA 3I6SA 1Z5HA 2VC2B 2B0SH 2M2DA 2GUOA 4M9OA 4PRAB 4U6HB 5EC2A 5FO9A 3V2TA 2X5PA 2F9BT 3KR3H 4TQIA 1F9PA 1JZHA 4QOKE 3FJTA 1T03H 2HCIA 4MZ9A 1ZSDA 5TDOB 1LTID 2Y4SA 4WKZB 4Y2DB 5L0QC 3MJ8B 5HGBB 1WFJA 4NQDE 2LU7A 2YD7A 4PJHF 1K8MA 5DJDA 4GO9A 2VM4A 1QILA 5I0DA 2EYJA 1HNZL 3AB0C 5C4XB 3SOBH 3MBEB 3GMNB 5DGRA 4NO0D 4ZSOA 3P4NA 1HHVA 5FWQA 3TT3H 4F7CA 4A3FB 1XX9C 3SGKA 5MP6L 4F8PA 2RDHA 4F5CE 1KCUL 4A3GG 1RLBA 3CXCA 4W9JC 3K5NA 1AGFB 4IOIB 5CUSL 4Q9RL 4NJ9L 3OR6B 4WORA 5JHMA 4HALA 3QEQE 2C3XA 5LNGA 2IGTA 1TWAH 3SHLA 1AY1L 2I5YH 4IN3A 3H55A 4LCCB 4AYFA 1N5YL 1G6RH 4C56E 1FFTB 5MEOB 1YAIA 1SEBD 1Z0NA 3ULPA 1Z9PA 2YAOA 2Q2IA 5D7IB 5CP3H 5MENB 1N68A 2OR9L 4AQ1B 4R96B 4OLXH 4RGMC 4A3DG 4POYA 1MCOH 3IS1X 1UCBH 2FJHA 5DURB 1OXVA 3IU3B 2H9GA 4PM1A 1DVFD 4N25A 1DBML 4APXA 4WSKA 3LRLA 2P5WE 4DGVL 2K9FB 5T1MA 1DUZB 3UAJA 3SDXA 1ZYRC 4LLVA 1N8ZB 4U31A 5M3MB 3FO2B 1QUQB 1O9WA 3AWEA 5LXGH 2B1AH 1IGYA 3BZEB 3BWAA 3ML8A 4NPYB 3TREA 1FN4B 1TZHA 3MR9B 3WL9A 4E6IA 2MUYA 2MHAB 2MKLC 1MW3A 3FQNA 3QJRB 4AK1A 4DQAA 4OIFA 4L4TB 4QRUB 4WI2A 3IDXH 1U4EA 3TA3C 2BP0A 4WCYL 3UTQB 4UIMB 3Q2VA 1IKNC 3IJ8A 3HG3A 3FU7A 4J3SA 4LBAA 5IHLB 3EBHA 4OBSA 3IDNA 3KPQA 3V0WL 4V11A 5DFVC 2WUCH 4N86A 1MPAL 3QUYC 4AUYA 4DGVH 1Z9LA 3VGFA 1JERA 2VAAB 5FO2A 4GKLA 3T5WA 4DVRL 3AT9A 5FLMG 1RK1B 3BG3A 2D7PA 3BAIA 3KLHD 5M9OA 1WBYB 3RLFA 4J3OC 1RJLA 4OGAC 3FULA 3NCJL 2FHCA 4YBQD 1XGPB 1PA6A 4NUJB 5D2NB 2QVFB 1F9QA 1WC7A 1GKOA 3MJ6A 4JJOA 2XNAB 4D9QE 2AJYH 1CT8B 3DXAE 4GAGH 1NGQH 5B22A 2Q76B 3T8XB 4G7QB 1Q9KA 2FO4B 3SCMD 4FFTA 2XZCL 4GY4A 1LE5B 3L3HA 4GXUN 4FQIH 1PRTC 4NZRL 4FNFA 4Y19D 4DO6A 3D33A 1VSCA 3DX6B 3N55A 1S7UB 4Y5YB 3WSQH 1IEHA 3DV6B 4OLYH 1G5AA 2WO3B 5KSVA 2WIIA 1WICA 2XWBA 5IBLD 4YLBA 2J0TD 1TZIA 1VQNA 3GI8L 3IDIB 4U1NA 5F3BA 2J43A 3MCLL 2CO2A 1E3PA 4KHTL 3BIKB 4TNVF 2BNRD 4WSGA 5F7NC 3TL5A 1RK0A 2NXYD 4CC1A 2NRDA 5T3XE 2IFGA 2WLMA 2JELH 3JTSB 4JO8A 4GQQA 2D0FA 1BQKA 2EIFA 1RDPD 5C3EG 2F4VL 2DLIA 2VDKL 3QIBC 4EIUA 2J5LC 1N8ZA