2A74C

Human complement component c3c
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
307
structure length
296
Chain Sequence
b'TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement Component C3c
publication title Structures of complement component C3 provide insights into the function and evolution of immunity.
pubmed doi rcsb
molecule tags Immune system
total genus 61
structure length 296
sequence length 307
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2a74C02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 2a74C01
3HS0C 1D2BA 1JB3A 4FXKC 1UEAB 2I07B 1PXUA 1UAPA 5JPMC 2A74C 1AYOA 3MA2B 4D94A 3OHXC 5FO9B 4LNVA 2XWBB 3I70A 4ILWA 1EDYA 2QKIC 2WINB 1BQQT 2PN5A 1GXDC 3CU7A 1BR9A 2XWJB 3HRZC 2A73B 4FXGC 1OO9B 3T4AC 2TMPA 1JC7A 1XWEA 5FO8B 3FRPB 2E2DC 1BUVT 5JPNC 3CKIB 5FO7B 2J0TD 3G6JB 3KLSA 2WIIB 1BV8A 2ICEC 3V96A 5FOBB 2B39A 3L3OC
chains in the Genus database with same CATH superfamily
4M8VA 3HNVL 3W0WB 4LLAA 1M6OB 2IPTL 3QFDB 2IT1A 4WRDA 4ZW8A 4MXVE 1D5MC 1PTZA 1SXSA 2WYZA 3BLBA 4PW4A 1JPFB 4POZC 2B8GA 1NCTA 3SY0B 1DQTA 3F7QA 4Y9EA 1ZA3B 2VLLB 2APVA 3HOYG 3ILPB 3PO2B 2ESVE 4NRXA 3GTQB 3KYKL 1CVSC 5HGDA 1GIGL 3WHXA 1JYXA 5DGQA 1CZGA 3K0XA 2X4TA 3FPXA 3N0AA 4C3JB 4HSCX 43C9B 2K0RA 1C9OA 4H25B 1HZAA 2Y36L 4PWHA 3QXDB 4G71B 4L9LB 3LKRB 4L1HA 4LCUA 4QOKD 2JK5A 3WMSA 3ZYIA 2Z93A 1CKNB 4PY7A 4PY8I 1M7DA 2IBZX 1DQQB 2R0ZL 1UEAB 4P71A 5AW1B 3VB9A 1NBVL 1UWXK 3CLFH 5K9OA 2JA9A 2FYYB 3OX8A 4ODWA 1T4WA 1XQ4A 1OF2B 2BVYA 1Z5LB 4DK3C 2WXGA 2IIJA 4FFYH 3D09A 1CK0H 2AAAA 3BP7A 4EGVA 3C5XA 1JHLL 1S72A 1UQSA 2VAAB 1JG9A 4YL9A 4LBEA 2OS7A 4LOEA 3I9PA 5EC2B 1N2RB 1ZEAH 3NCXA 4I3SH 4N9OB 2HJKB 1F97A 3S3JA 3E0GA 1CQFA 4HIOA 3PWUA 3I2CH 2A5UA 2JKRM 3T8MA 3M7OA 5DHVB 1QATA 1ZLDA 2VUMH 4ANWA 3JWDC 4IN3A 3CNKA 4U6YA 5EO1B 2EY5A 1WA0X 4EZMA 3D0AA 1OTUC 2BY1A 4OD1L 1OB0A 5A2QE 1A6UH 3LVTA 3EA6A 5HYEA 5D71L 4EQPA 2BZ7A 4NZFA 1EH9A 2CGRL 3KEHA 3WDJA 5C0BA 4JFUA 3BXNB 5FYKD 5I9QB 5C70A 1XPRA 3DVGB 2ZUSA 4DR1L 1MHCA 2OK0H 4UILL 4GUPB 3HKZB 1AQMA 2PYFB 1WD8A 3GTPH 4GRWH 2VDMH 3FRUB 4YSOA 1P84J 2H3XC 2MOQA 2AS5M 4JGMA 1SYVA 3B6YA 1A62A 2YBGA 2Y7OA 3PGDB 5GGSB 2AK4D 2ZG2A 1XNRQ 1IM9B 2BERA 1AZBA 4Y2NA 1EPFA 3MO1B 2DTMH 4GI8A 1UM5H 4WU5B 4OI9A 2WXJA 4PJFA 2YQ3A 3UROR 3EFFB 2ZICA 1L1OB 4GB9A 2F54E 3HPLB 1GUWA 3P40A 4KKPA 4M02A 1B3AA 3OL2A 4P23C 1MSGA 3SPHA 4XVSH 4XQJA 3BP4A 2X4SA 4JDZB 2IHEA 3ASWA 2QEXA 3I6GA 5E1IA 2F7RA 4RDQG 3LIZL 5ESAA 1M90C 1EY8A 1XMQQ 2QQLL 2XFXA 3BSHA 3NJLA 3ARUA 3BH9A 3VXQB 4DW2L 4GN4B 4LUVA 4ZK9B 5IB2B 1HEHC 4K23H 1KY7A 4RWHA 3FFDA 2K78A 4M6NH 5E8EB 3A21A 3OXSA 3EYUH 1EIFA 1WTRA 2EC9T 2PPFA 3ZR5A 2DEYX 4F80A 5F8QC 1NFDA 1EFID 5HYJE 2X7LB 4LF7Q 3AC0A 3CFCL 3FAXA 4JBMA 1BQHG 3IJYA 2X4NB 4LNVA 5E5MB 5AUMA 3AREB 4ENED 4I13B 2XTJB 1LO3H 1UH3A 4YSPA 2UXVA 1HNZQ 2BCMA 4L0ZA 5E99L 1NMAL 1OD9A 3CFIC 4P2OC 1W8EA 2VAJA 4S1DC 3M1BA 3GM0A 4FLQA 4APQA 3LNNA 3EAKA 4GXVL 1I3RA 1Q9WA 1QLEH 1ZJAA 5EU5A 2ISDA 4YHZL 3FTUA 1BZ9B 2VQEL 3WJLA 1R3KB 4P2RE 1X7TA 3BVGA 3BQUB 3GJFK 3VD3A 3UADA 4OIKA 4QRPE 3QCTL 4Y5YB 5KVEL 3ZL4L 1X56A 1UM4H 4V1DA 3WMPA 5LUMA 4LFBL 1MAML 1V7NH 4AIEA 5EUOA 2NW2A 2V5TA 3RWCB 3MLUL 3PL6A 1TO4A 3FUKA 2R4SH 4UTAH 5GZOD 1ILPA 4AQ8C 1XD1A 1L7TH 3NZ8B 1SEQL 4U7KA 1DJZA 3OR7B 4KI5E 3UG3A 2R23A 3EOBA 3EZJB 3O3DB 3SGKA 5I30L 1WJJA 3ULUC 3DI2B 1I7RA 2DQJL 3NFNB 5ERWB 1Q0YH 5EU6E 1YEFL 4XOAA 2B29A 2Q8IB 4JDVA 4AGMA 4NHCH 1IAOA 3CJJA 5KJRL 2JJWA 5EF3A 1N33Q 1NOFA 4IU3A 2OL3A 1G6RH 3FPPA 3VA2C 4OI7A 3T0ED 5AENA 2EVGA 2NUPB 4NT6A 5MP6L 4P4KB 1MLBA 1CF8H 5C4HA 1Z7JA 4RMUA 3IVKA 2CCLA 2I60L 3L2MA 3DTDA 3K8KA 3KYNA 1FZKB 2FWUA 2VN6A 1GUNA 4OFQA 3GTVA 3RPIB 4U4BA 3KBEA 1IC0A 3DJ9A 4JI1L 3N91A 3IDYC 4BY7H 4PJAE 4FLSA 3BZFA 3LQZA 3ROLB 4Z7QB 5JXEC 4DGVL 1LTGD 3KLAA 4UINH 2GT9A 2D31A 4C54A 1KTKA 1VHPA 3K5MA 2W38A 4JL2A 1DJIA 3SDXA 2YIHA 3TJEL 1ZT4A 1OXXK 4HS6A 4OU3A 4WNQA 5A2JH 5AVSB 3BKYH 3MRIB 4K71B 2Q10A 3H7BA 4BQ8A 5L0QC 3NA9H 2IH3A 4Y19A 2BC4B 4DV3L 2HKHL 1P1VA 4OLZH 2V4LA 3MXPA 1L5GA 4XCFL 4HJGA 4L8CA 3BWAA 4QOKE 3D3VD 1RZKL 3TEWA 3HE7C 3QNZB 3NCJH 3EKCA 1HXMB 2BSSB 2PPCA 3ALWA 2EY1A 1R5WB 3HG2A 4TUJB 5C0FB 3U6RA 4AYFB 4G72B 2EDBA 1QFHA 1LABA 1LTAD 2H45A 2NY3B 1KNOA 1IEAB 3QPXL 4FTVA 1P9MC 4P9HH 2ZWKA 1GGCL 1MCCA 1ONQB 4N8X1 1NC2D 1U95A 3BAXA 3A7LA 1A3LL 3DUUA 3QI9D 2NR6A 3TVMB 1LK2A 4Z7VB 3QB7C 3LX9A 1RVFH 2Z4HA 2W59A 1RZ7L 4XN2A 4Z3EA 1A3TA 2OTUB 4FJ6A 2HT3D 1JBJA 5D7JC 4UTBA 1JT8A 4M62L 2YTVA 2VR8A 4NN6C 4ZT1A 4G7HC 1R47A 1ENCA 4LF5L 4L3FA 3TT3H 4F8PA 1VGKB 4XRCB 3NACL 1XFPA 1B0GA 1PY4A 1XZ0A 3CFMA 3EBHA 3L1OL 3MJ6A 1XIWA 1PZSA 3BS1A 4FXGB 4PB0L 4RGMC 3EYQD 3SKUD 5HPOA 1T21B 3RGVB 5K36H 5H35B 2QKIA 4NKQB 2F53A 2ZF9A 2Z65C 4N2MA 2DBLL 2E27H 2K7PA 3J7AV 5AYUH 3T4AA 1MUJA 1I50H 5FYKE 4Y88A 2VXTL 1M42A 1JNNH 3SD5A 3EOAB 4J3XA 4RGNB 1TJMA 2QHRH 3S1MB 1DJYA 4OM0H 3EQLC 5DT1L 5CR1A 4IUQA 3D50A 1F0LA 1HHGB 4XP1L 4QY7A 5C08B 1HQRA 1SYBA 2WUCL 3GSNL 3V7AG 1KTJA 2AK4E 1UD3A 2QV2A 5AJ3L 3BX7C 3K7UC 3QEUB 4M6AA 4OHJA 2DLEA 3MRDA 4G80A 3MVVA 1F6AB 4HS3B 3WTXA 1CL7L 3K5LA 4O2CB 1ODUA 1XH3B 4KO6A 3EH5B 2K6ZA 2YGOA 4CMHB 3V4PL 3TP7A 3U9UB 4NPYB 4P75A 4F33B 2L7EA 4JFZL 1PTOB 4DIXA 1CICB 5MEQB 2F03A 4LF8L 1E28A 2B4CC 3ZZLA 1QSVA 2G9DA 3EDKA 3DM3A 1RJLA 3W38A 2IH1A 4B3RL 5LDSA 5KSAC 4PJ5B 1T0NA 3MLWH 4PWFA 1EDHA 1L9NA 4BFKA 1SVZA 1Z0MA 2G0KA 1KNAA 2XWRA 2PPBC 2WXRA 2E6PA 2L7QA 5E6IA 4ZZFA 3VVVA 4KAQH 4MJ5B 2RDFA 1I4HA 5C3XA 5ANMA 1TOXA 2O1AA 1ROWA 4JCMA 4IPDA 1OP4A 2WKOF 1N8ZA 1L0XB 4RQQA 5I6OA 3T71A 3HKSA 1BM3H 2NNAB 3GSQB 1YY8A 2C9QA 1TETH 3HOZG 3PF2A 4AQEB 2QDVA 2V17H 1MFDH 2X4PB 3QUML 3JT0A 3BVZA 2WZ5A 4U6XA 5C09D 4R5TA 1TZGH 1WBYA 5HDQH 3TWCL 4HSVA 2IFFH 1UURA 1ENFA 4DR2Q 1ONLA 2NY4C 2R0WL 2BO0A 3OAYH 4PZ7A 4KUZL 3M1CA 1GSKA 1S5IH 3ZDZE 4RKBA 4DQOH 3OKNA 4NKIL 3R2IA 3DV4B 1HAUA 3T6XA 1EEUA 5DYOA 3ZE2E 1JORA 1E4XH 2Z31D 3UE0A 2Z4QB 2Y24A 1CU4H 4Y8AA 5IVZB 3HUJB 1UE1A 4P5TD 1OK0A 1R34A 1R4XA 3V6OE 1W6JA 2XTIA 3NPSB 1LWRA 4OQTL 5B8CC 4G7SB 4NFCA 4HMJA 4I2XB 4L37A 1B3QA 4TVPH 3SIKA 3S3SA 1UD6A 4QXTA 4PRNB 4BH8B 3KYMA 2WCSA 1E90A 4DN4M 5FCUL 3P0YL 3NIFB 4WSKA 2UVEA 5DWPA 5T33H 4Z95H 4FVMA 3WUWA 1ADQA 5CEYA 3FRPG 3SCMA 5B4MC 2X38A 3K71A 1BF2A 2VDLH 2VABA 5LGHH 4LUZA 2XN9B 4DV6L 3CXHJ 4OCRL 3IAQA 4IBLT 3K46A 3BISA 2W0KA 4RWSC 1UA3A 2VDPH 5GQBA 3BH8A 3T0EE 5I1GH 3T3MB 4HAKA 2BDOA 4PJGF 4FNLL 3HOVG 1F86A 3MBXL 1QO3A 4PWKA 4HEPG 4X2UA 3DK2A 3L3GA 3VNYA 1EAQA 2UY7A 1X7SA 2LLNA 3DBSA 4H8HA 3RJQB 3VWKA 4LE8A 2X6AA 1BQQT 2NUTA 4A38A 1MW1A 5CMAA 2PP8A 2ZOTA 1U8PB 2CRYA 2P45B 4X62L 3KLLA 1NUNB 1E2WA 4N2GA 4NQCA 5J56B 3O3BA 5EC1A 1YMMB 4IGBC 1GSMA 4XXWA 3U46A 3A24A 4KO5A 2OXHA 4YSUA 2P47B 2XWJA 3QFJA 2BNUA 1AD0A 1ESRA 3K6IA 3AQDA 2J6EL 1IHZA 2CO1A 2BRQA 3ZUCA 1DVFD 5JMOC 2X6VA 4U1MA 1P7QD 5GS0L 3D3VE 3B1UA 1NLBL 1RPKA 2VERA 4QQBX 4JPVH 1OALA 1BJ1H 3H42L 5EU3B 1N4XH 4FHBD 5J06A 1EY6A 1A6ZB 3E9HA 2WZAA 2D3LA 3QP3A 3EZ8A 3VUAA 3ILQC 1BP3B 2WNWA 3KPSD 4N5ED 2JMRA 3QNYB 1QSEB 4BINA 1Y6NR 4U68A 3FUJA 4L1TA 4JHUA 5IB4A 5IB5A 1FJ1B 2FGZA 1QKZL 3QRLA 1AZUA 2B5IC 3QEQB 4H4NA 4PR5A 3ZTCC 1JYWA 2NSMA 4QGTA 1FDLL 1JOQA 4AQYQ 1YN6A 1S46A 1LTLA 1AD9B 2EYPA 1G5GA 3BGAA 1CKOA 3FTYA 5GJSH 3MTXA 1A7OL 2OMWB 2J55A 2Y2WA 3L45A 3RX5A 1M6OA 3W0WA 4AEFA 3QFDA 3NUCA 3BPCB 3Q1SL 2WKDA 5F7YC 2WZPA 2B2YA 4FNRA 4A3GB 2PXYD 1EVUA 3SOBL 1KXTB 1JPFA 3V5KB 3SY0A 3DTUB 3J81E 1KBGH 1G1CA 1AI1H 1ZA3A 2C3WA 2VLLA 2CZNA 3ILPA 3EW3B 5T1MB 1K85A 5AOMA 5IHUL 4WAFA 4YHNB 2BSTB 4R4TA 3RLNA 3O3UN 1UG9A 3VDYA 3VXMD 4AYBE 2LU5A 2ZF8A 4GKOA 1C7YA 1DDTA 5C0AE 43C9A 1GCYA 2CK2A 2Y1YA 2BFGA 4H25A 4MKTA 1SJHD 5FUCC 2A6JB 3QXDA 4L9LA 2EEXA 4AGNA 5CLXA 4NB3A 2NVQB 1FR3A 3N1FC 4X6CB 3D4CA 1TWGB 4YBHA 3HN3A 3TTSA 3VFSB 1XPUA 3H54A 1DQQA 3L95B 3N1QC 2C4FT 4PJIE 5I0WA 3IEAA 4YCVA 2AXFB 2FYYA 1RZFH 1CLYH 1NLDH 2L3BA 5E24E 1A7RL 2CR0A 2PF6A 2X41A 1Z5LA 4YGAB 1BDYA 4FKHA 1FIEA 5GISH 4OZIF 4G8GD 5LBSH 1BG9A 1CBJA 1H3TA 4N2AA 1LEGB 1EOVA 1OM3L 2GIYA 3QZOA 5JUEH 2VAAA 5A2FA 2ATPB 1QG7A 1NZRA 1ACCA 3CAFA 3CMOH 1N2RA 4X7SH 5FKAA 3I91A 1PH1A 1FH5L 2HJKA 3HRZA 4JO3H 2JA8H 4X98A 5E4OA 3KJ4C 3TA3D 4KDWA 2WTRB 4G6AC 3V55A 3BW9B 3MHZA 4Z7OF 5DHVA 5FHBH 4F3FB 1I4RA 2MPAH 4GAJL 5EO1A 4G7YH 5EEZA 2F0MA 2PWFA 4HD9A 2ED9A 1F42A 3QUKB 4WJKB 1UYWH 4J3UA 2Q2IA 4WWKD 1NMCB 2I9TB 3M85A 1KDJA 2W60B 2EEAA 3UBHA 3BXNA 1JTPA 3M8OL 3NP3A 5E1FA 2BCKB 1BZOA 4JR9L 5HSFA 1RFDL 1C7TA 3DVGA 2AJXH 2FX9L 3EBGA 1UTDA 4G83A 5C09E 3EXLA 4GUPA 3HKZA 2BXZA 4UP9A 2IWKA 4Y4FB 3IRBA 3FRUA 4MAYB 4MMXB 2B2VC 5DK0B 4MRBA 2W81C 3LKNB 3PGDA 4XNZC 5LNGA 5JHLH 1QHOA 5F6IC 5AB2A 1IM9A 4N2BA 4AQ1A 4NZ8A 2B3GA 1KG0B 4DVRH 4WU5A 3TGXA 2H0JA 1N8RC 4LCYB 3EFFA 1L1OA 2DKMA 3D8MA 1AR2A 3HPLA 3IFPB 1BCIA 3ARGC 4Z23A 5CFHA 5KVDH 4HX1B 2P5WB 2J8HA 1JWSB 4ACPA 4P59L 4JDZA 3WFHB 1KBWA 1UE7A 4MAUH 3UTTA 5BCAA 3S1RH 1BLNB 3AGWA 5HJDA 5DQ9B 3HMXA 4ODXA 3DDFA 3MLVH 1EHLL 3VXQA 3VQLA 1M1KC 3E9UA 3IRCA 3QUYD 2DWEB 3HZKB 3D0FA 5IB2A 4KUCD 3IPFA 2YD3A 5E8EA 2K3HA 3W1GA 1QCBD 1GHFH 4JQIH 3C5ZD 4KV5F 5IW6B 3L48A 1TWFB 4FABL 2BHZA 5GGTH 2MO0A 1QW9A 1D2OA 4QXUL 2ZWNA 2X7LA 4WNQB 1HZCA 1I7ZB 3HG5A 5E5MA 4Z0BH 1FFRA 2IQAB 2X4NA 3F83A 3TN0A 4GRWE 5DEHA 5CV4A 1UGNA 3IFOB 4ZO8A 2ITDA 4C4KO 1STGA 4E41D 4LF6L 3QT2A 2MOVA 3BZDB 4LKCB 3FB6B 3PHOB 2Z8SA 1E6JL 4FG4A 5KVGE 3UAEA 1S9KC 1AKJD 2Y7QA 2TRYA 2ICEB 1GOGA 4JPWL 3Q22A 1BZ9A 3HS0B 3H3VC 2G60L 3BQUA 3DIVA 1PIGA 4IRJC 1KPRB 5JEAH 1CGWA 5I2IB 2LXJA 4Y5YA 3UDWC 3VMPA 4X6DB 3C5JA 2YLHA 4ZFOL 3HEJA 1OTUD 3LS5L 3DXAB 3RWCA 3NCEB 4RAVB 4QCLA 1UWGL 3NZ8A 4D9LH 3OKOB 5HVFB 4LSTL 3OR7A 2PO6C 3O3DA 2CH4W 4OJFH 1PH6A 1NCAH 1GTFA 1QNZH 5LXGL 1F90L 4CU7A 3NFNA 4RBPH 3O6ML 1OKEA 5ERWA 5IMMB 1RHPA 3HC0B 4WHDA 1JSYA 1OAYH 3P4NB 5F7WC 3KPSE 1LQBC 3ZU8A 3MRFB 4W9FC 5DFVD 2WBWB 3FFCB 2VDKB 4WEBL 5LMUL 1WWWX 3MOAL 4NNYB 2IDSA 3Q9QA 4JG1H 4WSJA 1GUOA 3SE4C 1BUVT 4C59B 4Q5VA 3EJTA 1R5IB 4KK8C 1FZKA 4KXZI 4HEMA 3H09A 2FB4H 4AYEC 2KPWA 3I3CA 4P23D 3RPIA 1KHIA 2F2HA 4N8VB 3U2SB 3MCYA 5GRUH 2R7FA 5IBUG 4HIHB 3ROLA 3TCLB 4E0RB 1MJJB 1AY1L 3OJDB 4WF7A 2DWYA 5IGXH 4TVPD 4CADB 5FM4A 1FGBD 2ZJSH 1UKSA 5IKCB 1KLUD 3MRIA 1M1SA 2CKNA 3KXFA 2V5RA 1B9ZA 3H3VI 2YKLL 3QR0A 3G08B 1SOQA 3APMA 4LL4A 2BC4A 4EN3A 1RKNA 1Y07A 2ZCLH 3QQ3B 3ZTJG 4A7TA 1DBJH 3TBVB 1MFAH 3QNFA 1T0OA 4WUKH 3VMNA 1RK1B 1NM9A 3QNZA 3HVNA 2BSSA 1TVDA 1R5WA 5C0FA 3GYRA 3TC9A 3AXIA 2GJPA 4AYFA 1ZS2A 3OSVA 4S1DD 4K2UH 4K94C 3S96B 3HN8A 3MNMA 1IEAA 3BAIA 1ONQA 1EANA 3M4OB 2DEXX 3ERXA 5EORL 1CTMA 4WI6A 4BXXG 3TVMA 5M95B 3L4CA 2WBJC 4MNOA 4LO9A 2HUEA 5K1NA 4XPFH 2R9HD 4G8GE 4CN6A 1AQKL 2IMMA 5I19L 2CHNA 3VW3H 1Q0XH 2OTUA 2C34A 4PRHE 3HNSL 1NCBH 4R84A 2F0DA 3LB6D 2NZ1A 1IYUA 2OM5A 1VQFA 2E2HB 1Q72L 3LSOB 3ARDC 4HKXB 3WFZA 1FFNB 4XRCA 1S5DD 2FE0A 3SK5A 3I3BA 4B9FA 4JM2B 4A3FB 4FXGA 4H8VA 3VFVB 1L2FA 1T21A 4KNUA 1GHJA 1QA9B 2PYED 3BUPA 1MWAB 3RGVA 4HGMA 5H35A 1RJYB 3E6FA 5HURA 3KZ8A 1PYWD 2JEBI 2MEJB 3VXTB 1CXEA 4YHKL 4XMTA 5C0CD 3SDAB 3SDCC 3QDGB 2DM7A 3HOXG 1OAUH 3MYJB 3EOAA 4K7PL 4RGNA 5FJ8G 4N2FA 1EFQA 1KEML 1M56B 2W9LA 3A7AB 2CG9X 4NNPL 1HR0W 4AE1A 5J0BA 2JKXA 1I8LC 3UDGA 1HHGA 2IV8A 1UE6A 4O5LL 4QI3A 4ILDA 4LQFL 2V0AA 5C08A 2AJYH 2VQTA 3VJ6B 1MFBH 5D1XD 2DICA 2PPEA 4IS6B 2BH2A 3WGUB 1GGUA 3HOGA 1MZZA 2LVEA 1F6AA 1TTAA 5FKPB 1HIML 3KLQA 4O2CA 1GS7A 1V8HA 1XH3A 2JCCB 4IBSA 5EIIG 3VRIA 5F1OB 5AZ2L 4OD3H 3UTSD 3U9UA 4NPYA 3FMGH 3WSQH 4F33A 5F89B 2R8SH 1YQ2A 1PPIA 4GN5A 5D1QD 1CICA 3MGTB 4OSUL 4DPGA 5MEQA 3F5WB 3A4AA 3D85D 4N2HA 5A16B 2D3NA 3QULB 4ZQ3A 4HCRH 2E7DA 2HAZA 2BS8A 1AP2B 3NTKA 3HC2A 4ONHB 4Y4HB 5F9DC 3FSVA 2PCFB 3NHHA 1Y6KR 2ZX6A 2RCSL 3D52A 4BSJA 3AY2A 3TREA 1MRDH 2FSEB 3QG1A 2XIIA 2P5ED 3T2OA 4MJ5A 3ZRSA 2VXWA 1ZJBA 3NJNA 4WENB 3P30L 3WMQA 4D94A 1VJSA 3VCLB 4BCZA 4NXNL 1L0XA 4DO4A 2NNAA 3GSQA 3IGUA 1EUUA 4AQEA 4M3KB 4FYSA 5L2JB 1UJ3B 1XGZA 2PNDA 2X4PA 4E41E 1EY4A 4UQDA 4HW6A 1VMPA 3HOYB 4KC3B 4EUPH 2HCIA 3ALXA 2YU9H 2WNKA 3FC8A 4N8PA 1K8AC 1WFIA 1DFXA 3NDYE 1H5BC 1OAXH 2OJZH 3RVVD 4PJCF 3DV4A 2N1TE 2QEJA 4A04A 2P80D 4DK5A 5IVZA 3GTOB 5BZDB 4H44C 1CGTA 2Z4QA 4FFZA 5E6RB 4PTTB 3HUJA 3OV6A 3OMIB 4POGA 4YC2C 1JOKA 1OM9A 1BBWA 2A6HD 4HJ7A 1QSZA 4I2XA 4MLIA 2AI0H 1O7DC 1U3HB 3P69A 4ZD3H 1EU3A 4GUOA 1FA4A 4R7DB 3ZX1A 5I6MA 4BH8A 1PH7A 1SHSA 4PVNA 4G7VH 2QQQA 3M88A 3KBPA 2K4WA 5B39A 2FD6L 1LYQA 4YHHQ 5FUOL 2IQ9L 4TSCH 3N1PC 1A2TA 5KEEA 1T5XB 2F6AA 3OMNB 3PWPE 3V0WH 4O51B 2XN9A 4J3WA 3UYPB 1BWMA 4JRXD 3EO0B 4J3VA 5KVFL 1UZ6F 3IMUA 1CD1B 3UTPD 2ZOLB 3DMMB 3SHSA 3NP8A 4MTKA 4IDJH 5BV7H 5F9OL 1JTOA 2N59A 4QDGA 2I5MX 2CCZA 5J5EA 1S5FD 1H8NA 1Y7VA 2NQCA 3H3VH 5E8DL 4WGKA 1YEKL 3CHPA 4MASA 3W1ZA 1N9WA 2EJMA 5FYJL 1JDAA 5I1DB 4XN1A 5MEND 1VQNA 1TCRB 4Z7WE 3WHE0 2R1XB 3WFEH 4D3CH 1LACA 1OE3A 2UXBL 1J0ZA 5IMKA 1K83B 1YMMA 5C3WA 4G5ZL 4TVPE 5KSAD 1PCXA 3EYSH 3D0LB 1II3A 3QCVH 1SJEB 4EI0A 5AVUB 2PW1B 4V2CB 1WOCA 3U9OA 3V0HA 4JJOA 4Z78B 4XP9H 1KIQB 3QORB 1TPXB 4F9LC 1IGTB 2FSDA 4UAIA 4LK4A 4AQOA 2F0VA 5I4DA 3QZLA 1SFOH 4I0PB 5MHSD 4XNYL 5D7IB 1NPJA 4BWWA 2CDGB 1R9FA 4NXML 1F00I 3NIGB 3B34A 1A6ZA 4DESA 5JTWA 1KN2H 2NY4D 4I87A 4G6KL 4KVCH 5CM1A 4ZMXA 3H0GG 3QNYA 1AN8A 1OT1A 5GAGC 1HEZB 1QSEA 2HLAB 4OKDA 3RZDH 2E2IH 1D3CA 1L9PA 2YK1H 1TQBC 3DUZA 2YRLA 1FJ1A 4PCTA 2MCPL 3BD5A 2IWEA 4ZSOB 1P53A 2QPEB 3QEQA 1Q82C 1OV8A 3EN2A 3EJZC 1HR0L 1ACYH 4LARL 3CCLA 3GTJB 4C8XA 3CN3A 3O2WL 1AD9A 1BQHB 3VSVA 4M5YL 2RQEA 3D48R 4OL7A 2OMWA 1OQOA 3LN9A 4AL8C 4YFEA 1MCDA 5IUSA 3BPCA 4WKZB 1LLRD 2GG1A 5CYUA 2ZOWA 3U1QA 1GYVA 4DUVA 1Q9KB 2N0MA 3G6JE 3I6SA 2PYEE 2X9ZA 4UDTA 3ULAB 3V5KA 2IPUG 4RDBA 3RVWC 1GPOH 4Z7NB 4UCFA 2B2WA 3N41F 2FHBA 4XPTL 5T1MA 2B1HL 1UEMA 4XN5A 3U6XA 5A2BA 1IXRA 4LW1A 4MAZA 1NIDA 2BSTA 4W1TA 3N04A 4YHNA 5C0CE 2QV4A 4GS3A 2P46B 2MQHA 5I16A 2ZSVB 2O5IC 2QJDA 4UMGA 1GZHA 4F8TA 1BQ5A 2J7LA 4Y89A 4JI4Q 3TXAA 3T13A 1PG7L 4Z5RB 2A6JA 1ZS8A 4PHXA 3NMEA 3LXBA 4X6CA 1NCDL 2CIIB 5BMFL 1JPEA 2WKGA 4OLXH 1GMIA 2O6CA 1DBAL 3CXDH 3VFSA 3QE5A 4JBSA 3L95A 5D1XE 1U8MB 2YSSB 1PNDA 4B5ZA 1W3SA 2AXFA 5EU7E 1LT4D 2ICWI 3BPLB 1TXYA 3DETC 1D7BA 5D9SB 4B9XA 3UTSE 1PZBA 2WSKA 4G70B 4UTBH 2XV0A 1R4PB 1I1AB 4JOIA 2RVLA 1ND0B 4Y2DC 1I6HB 3M07A 4HBQA 5HHVL 1ECZA 1RUKL 5D1QE 4HBCL 1A1MB 2K04A 4HXAL 1EIYB 4JZJC 3MOBL 4YO0B 4HWZB 1SNRA 2DQDH 3MV7E 1E0OB 3CCVA 1P6WA 4ACTA 2YQGA 2CWAA 2VDNL 1PDKB 4G4KA 3BW9A 3GHEH 4P3DA 1T7VA 4YLBA 4YDVA 5T1LD 4F3FA 1ETJA 3CN4A 1CPUA 5L2KD 2V33A 2P5EE 1FRGH 3GD1C 3KBFA 2WFWA 1FYCA 1P7BA 4G7OC 2DYRB 3QUKA 5ACZB 2VQFQ 3MXNB 1EA9C 3FBQA 3KVQA 2I9TA 3BUTA 3ZDXE 5CEZL 4EVOA 1WCBB 2W60A 1KFAL 1WHPA 3B8SA 2H0EA 4FP8L 5I24A 3IRPX 2R69L 1IKNA 2AUJD 3N9GL 2BCKA 5HGTA 4ONFL 1GOZA 1E4HA 3LZFL 1MFCL 2IPKA 5IOPB 1T2QL 1IC4H 1IC7L 1I4QA 1J9OA 4PZ8A 4Y4FA 5JXEA 4MAYA 2LFNA 3J7A5 4MMXA 4X66L 4S0TD 1ANUA 1GM5A 5DK0A 1BCPD 2CW0D 5T3ZH 3LKNA 4WWID 4QUCA 5T3XE 2RALA 5HDBB 3UJJL 3WY3A 7TAAA 1KG0A 5D7KD 3SE3C 1XX8A 3MXWH 3MWYW 1AG0A 4LCYA 3WEXB 4EBQH 4EDWL 3IFPA 3R7RA 3T0AA 4HX1A 2P5WA 1JWSA 5F2FA 4TXVB 5FW8A 3QR1A 5B7MA 1BLNA 3SN6N 5E2JA 5DQ9A 3J80c 3VB8A 5KBKA 1U4MA 5IVXE 3R06B 3G5YB 4LBAA 2DWEA 3HZKA 3B83A 1C8QA 4KZEH 5DC4B 4HOMA 3WTTA 4Q74A 2F7QA 3L9RB 2AQQA 1BQSA 4FF9A 5IW6A 1KBPA 3H7LA 4YK4C 2K7QA 3OIPA 1VCIA 4C3HH 1PH5A 2D9QB 4J3OF 3FSAA 4JRXE 4OQ1A 2EZVA 1BZDA 2OMUB 1DANT 1NGWB 1I7ZA 2YARA 3NSYA 3Q5TA 3QGVA 1NBQA 2IQAA 3GZPA 2EAEA 3UTPE 1K6QH 3VG0H 2PNRC 4JQXA 1U3ZA 2Y0SG 2SDFA 5JPNB 1RZKC 1S2EA 4JHAL 3IFOA 1UA6H 1OAKL 1FQ9C 3FO0H 4N0FB 3ARDB 1NJ9B 3L3OB 2ZYSA 1QFUH 4LKCA 3BZDA 4AGLA 3PHOA 4F8LA 4XN7A 4W9JC 3C8HA 3T65B 3U9SA 4Z3JA 5MENE 1H3WM 3A0OA 5G3LD 4DKEL 2WK2A 3ISRA 2KHJA 5ADPL 1ENAA 4P72A 4I8DA 3ZTNH 3HS0A 1IKOP 1R19A 4DGIL 1VQJA 5L88H 3B4NA 4WNSA 4F87A 2MSPA 4G6AD 5KVDE 1KPRA 2N0KA 5I2IA 3P2TA 4FQJH 4X8JB 5F1SA 4X6DA 3VR6A 1VAHA 1SLWA 1AFPA 2Y6SD 3FK3A 4S0SD 3MOQA 1I1YB 1T1YB 3DXAA 4HVBA 3D4RA 4YSSA 4M03A 2B77A 3UERA 2Y06L 3OW2A 3OKOA 4ZAKC 5MHSE 4RFNC 4GOPC 1OLLA 4JFQB 4CJ0B 4C1NI 1FHNA 4ISVA 1P69B 4NJAL 3TEYA 5IMMA 3W5OA 2MHVA 5EKIA 1BGXL 1AJ7H 2EEDA 3BSZL 3HC0A 3RRQA 1KJ3L 1A7PH 1HFNA 1SM3L 3P4NA 3ER0A 4BQ6A 2VJ8A 3MRFA 4L3ED 4WTXA 4P5RA 1KULA 2XX0A 3FFCA 2PI2E 2X1OA 4L5FH 3BG3A 4NNYA 2XQBL 1N5AA 4DV5L 1CIUA 5FGSA 1A14H 4YBLC 5E9DB 3TV3L 1I6VC 4W93A 1R5IA 1LE5B 4L3AA 4PEEA 3ARGD 3DYOA 3FQNB 3BSGA 2XLLA 4JQVC 2BK8A 3U2SA 4ICXA 2CMRL 4N8VA 4DKFL 1IM3B 1XBDA 4HIHA 3CZNA 3TCLA 2XIDA 1MJJA 1R24B 3SSGA 4E0RA 4FGMA 3OJDA 2Y1AA 3V9EA 4DV4Q 4MCMA 5I1IL 2P8MB 3PY9A 2XQYK 4CC4A 1K0RA 4HK3N 4QKTA 1YNTF 4CADA 4LVOC 2V7HB 3HC3L 2JCWA 1LP9E 1SBSH 1WGVA 3VI4E 1HAWA 4PJ8B 1HKLH 4PJHB 3G08A 5KYUB 3AUWB 4IURA 4JCWA 3GV6A 2XVSA 1LTXA 1KJ2H 1F2XK 3QQ3A 3TBVA 2CHWA 2VDRL 5DZJA 1KV7A 3OJ2C 1RK1A 4BZ2L 3BMWA 2IJ0A 1N36L 4M7ZB 2B3RA 3FTZA 1OD7A 5KANI 1XGTA 2Z6KC 4KXAA 5EKKA 3US9A 3S96A 5HI4C 2QGBA 4P2CG 4XB3A 1AGCB 2PZWA 4IBUA 1HEJC 2A5HA 2CK0L 1Z0NA 5ISRA 1YPZB 2FFKB 3FRPB 3LH8A 4CSZA 2K9UA 5LNEA 2RB8A 2XBZA 2XICA 1DBBL 4KKLD 1FNUA 4IRJD 2O5NA 4KNSA 4TQEH 3T1HQ 5CBEB 4BGLA 2HVKB 2EYLA 4XO9A 1E8ZA 1FFPB 4XMZA 5DRXB 5SWQB 3LSOA 1J1PL 1Z6HA 5JPMC 3CFTA 4XWOD 3SYCA 1FFNA 5FFLA 1LT5D 4V1DD 3HOVB 4DAGL 5L2KE 2WINB 4PREB 5DO2C 3VFVA 3PL6D 3VE0B 1QA9A 1MWAA 3GTQH 1RJYA 1KJVB 1VQ8A 2FWOB 3VXTA 1CL7I 1OPOA 4XMPH 4NB7A 4MNQD 3SDAA 4C3JH 1EAPB 1VQPA 3QDGA 4YHLL 2IGFH 1WCQA 2ILLA 1LDPL 3Q05A 3MYJA 1ZK5A 4O0AA 3QIUD 3GHBH 2EYOA 5MERB 4XE5B 4F7MB 5K59F 1NBWA 1HYSC 2OW7A 3OR6B 1MSHA 3U4BH 1V3JA 2I07B 5JYLA 5I18H 1Q7YC 1RV6X 2OAAA 3RQ3A 2BWIA 3VJ6A 2X0VA 4GOSA 1NWOA 4X7TB 5GRZA 1J8KA 1F6LL 4UOZA 4IS6A 1BXAA 3VI3E 2JB5L 4KX9A 5D7KE 1M7XA 1REIA 2JCCA 2KVMA 5JR1H 1UT2A 4ZG1A 3Q8AA 3C87A 4P5MB 4ENZA 5TSSA 5F7UA 5F89A 4E36A 4URTB 2Z9HA 2DQTL 5B21A 1NPNA 1JGUL 3CSTA 4BBRH 3IK2A 3MGTA 3OF6D 3KR3H 3F5WA 2PW7A 4N0YH 5LAXB 5EEYA 5A16A 4J39A 3SGJA 3CMEA 1AR1B 5IR1B 5DHVH 2XZCL 3S2DB 3Q6FB 1JCKB 4ONHA 4Y4HA 1U93B 1KBVA 2PCFA 5TTRA 4YXLH 3OGCB 1IV8A 3DLQR 3ISYA 4YDLB 2FSEA 1Z66A 2AC0A 1KGXA 3UI2A 3QJYA 2A99A 5DD1H 1JZEA 3FOMB 1EK3A 2E8YA 3BDBA 3JV0A 3FUEA 3H9YA 2YXMA 3TL5A 1ZWIB 3A8JE 3EBEA 5DLLA 3U4KA 5L2JA 1UJ3A 4ZPVB 2RA1A 3D51A 2F0WA 3F65A 2HMID 3GS0A 3SDDC 3D6WA 2VLJB 4NZUL 3O6FC 2ZJPA 3TZVB 4GEJA 1RODA 2NR6D 1E5CA 1MWOA 2EIBA 2OQJB 4A1RA 2Y2YA 2Y7LA 1TMCB 4FJZA 4A7QA 4BKTC 3W37A 5BRZD 5BZDA 1HESA 1ZPUA 2CUAA 3HMWL 4PTTA 1A0QH 5DC0A 2AJUH 3ECQA 3UE1A 1FV1B 2A73B 2BNRB 2LU3A 1QW8A 5L6YL 2NY6D 2VRAA 1U3HA 4PV8B 3HMXH 4M5SA 4R7DA 1XIWD 1N3NB 5EWIL 3TPKA 3HOUH 3WFBH 4OIBA 1F2QA 2KBNA 5G4MA 4LPXA 4AG4L 2BINA 4HPHA 4LLWB 3CCSA 3ALPA 3OYYA 4OV6F 5B7FA 1T5XA 1T83C 5E70A 5SX4H 1IARB 1OSZB 3K4DA 3POCA 4O51A 5AAPA 3ATDA 5CGTA 5TE7L 3O9WB 3SPGA 1XMQL 2F0CA 4L3EE 4MMZB 1YQVL 3EO0A 4V33A 4DGYH 1CD1A 1A2UA 2ZOLA 3DMMA 4JFPB 1TYJA 1Q12A 3ARTA 5DZ9A 4CW1B 5CZKA 4KK7A 3C08L 1ZYRD 1CDGA 1A6VH 1ETB1 2DTSA 2RD0A 5T3ZD 3ND8A 4NI3A 1X32A 3UYOD 2VLRB 4HZAA 2XZAH 4LF7L 4U3CA 1T5KA 2Q7NA 4F7KA 5I1DA 1U8HA 5D14A 1TCRA 2D5DA 2NY2C 1KABA 2JELH 3NVQA 2R1XA 4JRYD 5I74B 1HNZL 1DEDA 1GOHA 2F8IA 4TRPH 3L7FB 2VLKD 2X53A 2F3WA 4UT9A 1NGXB 3ZKMC 1X5YA 1Q1JL 2YFNA 1OARL 2QBWA 1DFBL 3D0LA 4G1MB 5CJ5A 1G7PB 1SJEA 2WXOA 4WI0B 2PW1A 4NJ9H 3B43A 4OONA 1ZSHA 2H6PB 1AZNA 2X88A 3BPNC 3ATFA 1KIQA 3QORA 4GQ9L 1EIBA 1FIGH 1MQKH 1ZCRA 4PN6A 1KL9A 4DH2A 2B2VA 1IGTA 2TSAA 4B7LA 4GI9A 4I0PA 3SBWC 1NFDE 2FECL 4NKOB 3BRGC 5D7IA 2CO6B 4FADA 5L7XH 2CDGA 4LU5L 5LN4A 3GTGB 4LEXL 1W0VB 3DJZA 4ICWA 5CXPA 3IDIB 4KHXL 2NVTB 1HVXA 1K8GA 5HGQA 2FEEL 1MJUH 3UZVB 2HLAA 2OULB 4J2XA 1DVQA 4EJ1C 2G2RB 1GC1C 3MGOB 3QDMB 1E8XA 3OAYK 3NAAH 5HDWA 4ZSOA 1Z6JT 3K80C 5CV8A 2DMKA 2QVTA 4DKDC 3V5HB 4PM1A 1AGDB 2NXYC 1JNHB 3UGEA 4JPSA 5HYQA 4X5WB 2XVGA 1CDJA 4MVBC 4E9VA 5IP9G 1A6TB 4WKZA 4V1DE 2YJLA 2I32A 1V9PA 5C44G 4A75A 1BREA 1BVZA 1GY1A 1Q9KA 5EUOE 4KY6A 3I55A 1B4TA 1R6VA 5F6HJ 3MRHB 3PIP3 3GRGA 4MNQE 5GGVH 1UT1A 2CR3A 1AE3A 1IILE 4EQ3A 3MODL 1NM4A 5CJQL 2PYKA 4WO4B 2FR4B 3GHPA 2ZSVA 1IQDB 1GGBH 2ROXA 4UT7L 1MD2D 3PQYB 1OSPL 3M1OA 4PIBA 4WI3A 1Y6MR 2VRQA 1MPAL 3ABZA 4HPOH 2CIIA 3PWJA 2RDHA 3K2MC 4DR4Q 3HC4L 1N7MH 2OCJA 3HB3D 3KPRD 1KTLB 4FTDA 4MBOA 4HFUH 4WI5A 4XVTL 3IPBA 5FF6B 1AS6A 1U8MA 1NCWL 2YSSA 2QVMA 1PZCA 3MLYH 4LFHD 1AP0A 1EOTA 1D5ZC 3QAZC 1AYOA 3DKHA 4M3JA 2QTEA 5F7KC 4X9IA 5D9SA 1B6DA 5BS0B 4N26A 1I1AA 2Q8BH 5DHYB 2PO6A 4I48B 3ZYZA 1BAFL 1UHVA 4WIQA 1A1MA 4NQCD 2H9GB 4UWQB 4A3LG 4HWZA 4YO0A 5CILH 2X6MA 1KTKE 3SDXE 3KJ6H 1OZUA 1T1WB 1PDKA 2W9DH 3QEHA 3C9NB 5DJZB 5IJKC 1BVLB 4H7BA 3P77B 4FQCL 5B1CA 3CH1B 1MCWW 5ACZA 2YRPA 4K5LA 3Q06A 3MXNA 3D8GA 1BVSA 5IG7B 2EJGC 2VUYA 5EPJA 1PRTC 3SE4A 1H9JA 1WCBA 5IBUB 3I4NG 4FZEL 1EQTA 2XWZA 1F4XL 2KDGA 2EXZA 1HJBC 5DHMC 1V3MA 5IOPA 3ISWA 5JW4R 5LKNA 4A3IH 2VXUL 4LSPL 3JQOB 2KBGA 3MUHL 2EE6A 1QTSA 2WIIB 1K3BC 3DSFL 5GGRB 4EF3A 4UDUC 2HA1A 3GTLB 4AITA 3LRLA 1R33A 3L5JA 4YE4H 3OTOQ 1I9EA 1OW0C 1I7TB 3LZNA 3MNVB 3H1ZA 3WEXA 4Z7AA 1ZVHA 3MC0A 5FYJU 4F7CB 1PTOH 1E8WA 3W0WD 4P8QA 4Y9FA 5FUZL 2WZPD 2K6AA 5JW4N 2H1PL 2A4CA 1PF3A 1CGSL 5ISZA 3L2NA 3PP4L 3ULVL 4TNWK 5D6CB 5GZNA 4AQAA 3BCDA 3R06A 4NZTH 1B0WA 2AITA 1QBLH 1A3RH 4JI8Q 2J4WH 2Z8VC 3G5YA 1XWEA 3LOWA 3O2VL 3O6KL 2ZPKH 3WXWH 5DMIL 4LSDA 4BCYA 4O00A 3L9RA 3S4SA 5FLMG 4ELMF 1CG9B 3QUMB 3INUL 5C7XL 1LJMA 2APWA 4E9TA 2OMUA 1NGWA 4O58H 1SDYA 2QT6A 4PI2A 4AEHL 3K81A 3BVWA 3DPDA 5JPNA 3JC66 2CLVB 4QNPF 1LK3H 1LO0L 4F7EB 4MLSA 3V0AC 2BIMA 5T3ZE 2MIZA 4N0FA 3T3PF 3ARDA 1I9IH 5FGCE 1UASA 1NJ9A 4N8FA 4LSQL 1JZ5A 1XT5A 1ETZB 1FPTH 5FW7A 5B38G 1JXJA 3T65A 2A2QT 1N6VA 2OMTB 4QEGA 2HUHA 3HOXB 4JRYE 4XP4L 2AKRB 1WCMG 1N70A 3DX7B 3MVSA 4JMXA 4FFZH 4JI0Q 2VLKE 4ZQTA 1W80A 3IDNB 4JFYB 3H6MA 3K5NA 1JXGA 1MCHA 4J3OG 2EIZB 4N0UE 4ODHL 4KQ4L 5I15L 5I73B 1KCWA 1TF4A 5TDNB 3LZLA 1K4CB 4JI3Q 1NDGB 4G6MH 1OT4A 4B3ML 3L4UA 1PXUA 4OR1A 5E2VH 1I1YA 1KGJA 4FOMA 1T1YA 5L4MA 1IX2A 3REVB 1X9UA 1ASQA 2GI0A 5HJ3B 4QJFA 1F4YL 4YH6A 2WQSA 5CGKA 5EIIB 3MRGB 1E27B 4NWTL 2UX6A 4JFQA 4HJJH 3CAMA 2ZYHA 1B9NA 5ANME 4CJ0A 2RAMA 1FGNL 2SNMA 4P4RB 4C4BA 2EDWA 5E08H 3KM1A 5FR3A 3GO1H 5DGRA 2NVYB 5IYBG 5F2DA 2O26U 4E9LA 5FK9C 2RJMA 1QFWI 3AAZB 3FF7A 1YYLL 3GS7A 4IBTA 2DOCA 1KC5H 2XACC 5E9DA 1ADWA 1AYRA 3N52A 4QB4A 5D2NE 1LE5A 4JI2Q 1FVCB 2AQSA 3FQNA 3GK8H 4G6JL 1I9RL 3BCFA 3CZKA 4RA3A 3K2IA 1FUNA 1P6AB 4PJFF 2KHSA 1IM3A 4NPSA 3FQ1A 1E22A 3LVEA 3RYMA 1FSKC 1A4BA 1R24A 1IAII 4M1DL 4HEDA 1F9SA 1MIML 4X80H 3KH3A 5HHPB 3A8KE 1O0VA 5J12C 4DXFA 3MROB 1DLHB 2ZAGA 1OGAB 2A1WL 2V7HA 2J5WA 1OT2A 1MFVA 4MFHA 5C9KA 2X6LA 1MQ8A 3ARBC 3GINA 4PJ8A 3AU0A 2V2XB 2P9RA 5D2LF 3ZDYB 5KYUA 1C1EL 2EXWD 5JO5A 1CHQD 4D8OA 2O5YH 4LLVB 4FP5D 3WJJA 2K3TA 1IT9L 4GXFA 4CA4A 4GG6E 1GTNA 4J12A 5EPLA 4M8UA 4Q52A 3KPRE 4S1SH 1XXGA 1RIUL 1FNFA 5DC2A 2IEPA 3ULSB 3ARED 5J1TC 2XTJD 3CCQA 4JN1L 4UUJB 4L5FE 3ULJA 3PMFA 1AGCA 3PUYA 4PRBB 1VFAB 4QJ4B 2ZTEA 2X1QA 3BRFA 3UO1H 1K0SA 1YPZA 3LNDA 1X4XA 4OGQC 3FRPA 4KH9A 5KG9B 4GPVA 4NQCE 2GB2A 1YNXA 5CBEA 4PGCA 1D7FA 2Y07L 1A4JB 2HVKA 1FFPA 5SWQA 5DRXA 3RNKB 2F4VQ 1T5EA 4AVHA 3KWWB 3OPOA 1YIJA 2YAHA 4LMQE 4AEIH 4ZAKD 2QDWA 3WTVA 1IL8A 2WINA 3UYRH 3MFFB 4HEPA 4Z9KB 1YHPA 2WW8A 3VH8G 1SXCA 2QQKH 4PWEA 4AQYL 1KJVA 5CP3H 1HWGB 2FWOA 5GGRY 5BZZA 4YN3A 1Q8IA 3O3AB 1CLOH 3UP6A 3BVUA 1RZJH 1EAPA 3GPEA 1A66A 3JV4B 4U1LB 4WFFE 1IJ9A 4WW2C 4F7MA 4DP1X 5MERA 2L4NA 4RBPK 2NVQH 1MF2H 3WKYA 4PLNC 1TWGH 1BEYH 1DOMA 4PJGB 3IMBA 4WO0A 2I07A 1G7HB 3KVPA 4KDTA 1VGEH 4NEHB 4X7TA 5AWNH 2DQEH 4P4KD 1SJVA 1SYDA 2FCBA 2HPOA 3WL9B 4N9TA 5M3MG 1IZ6A 1R0AH 3L9BA 1JJUA 4L5TA 3RLFA 2KZBA 4EVNA 3SHLA 1TQUA 4PVLA 4M1UB 3W0WE 3EVQA 3DURB 2YOCA 4GW4A 2NXZC 1SDAB 2XA3A 5LAXA 5IB3B 2L8AA 1BYNA 3H0GB 2QHLA 1N64H 4QAMB 4DTGL 2J73A 3NCYP 4HJ0C 4WFN3 1DQML 5IR1A 3KK7A 2C9XA 3Q6FA 4KJOA 4JI7Q 1JCKA 4BHUA 3WXVL 1U93A 1N5YH 1MREH 3B3IB 4I7ZC 4AH2B 5ABDE 3OGCA 1P7KB 3EDJA 2OCEA 4TOYL 1NQBA 3UAJC 1YEHH 4G57A 1MJ8H 4NC0B 4OJDH 3GMRB 3OMAB 4DN3H 5TH2B 5C0IB 3Q8DA 2NYYC 4HCIA 4Z18A 4S0HA 4PUBL 3A3YB 3FOMA 1IL1B 2NN6H 4B53A 4PJDB 5IJBC 5HI4D 1NCIA 3HRPA 1AE6L 3NA4A 1ZWIA 3DUSB 3MLSL 5AW8B 4ZPVA 4L4TB 4C56C 2B15A 2LGNA 2NY3D 4AKPA 2E6QA 3DJRA 2E6JA 5J39A 4KMLB 3QQXA 2VLJA 1BLIA 2VR3A 2P48B 2WHVA 4HSAC 3RPKA 3ZMRA 4F37F 3TZVA 1WH0A 4AC4A 1B4RA 1UCBL 5ANHA 4R97B 5DVMA 4CGUB 2NY1B 2Q3XA 2OQJA 3LPWA 4K9EH 1RPUA 1ID2A 1KBBA 2C5CA 3ICEA 3IDMB 3IDXL 3IAPA 2AABH 3RBSA 5JEAJ 1HOCB 3LQAH 4YUEH 4LLYA 1PDQA 2ZKMX 2DIJA 4ZS7H 3VACA 3LIZA 1PCSA 4N90D 2NZ1D 1FV1A 2A73A 2C9UA 5DO2D 4AIZB 2AQ2B 5KZCD 3DXJC 2WZ6A 4PV8A 2OI9C 4FG0A 1G0YR 4ZS6D 2XUWA 5ID0B 2WVSA 4OCYH 2RQ8A 4FQXB 4HK0B 1N3NA 3M4YA 1QFWH 1WD0A 2FJFB 4UIKH 1S3KL 2ZCKL 5EDSA 4JNXA 1GR7A 3VSUA 5IYDG 2ZNWA 2MWCA 4LLWA 4RAUB 2IANB 2J88L 2P44B 3OAUH 4DV0Q 1TWFH 1OSZA 2WPGA 3WNPA 2X40A 5IQ7L 2NY7H 3O9WA 2W9EH 1IGJB 4ZQKB 1WZ1H 3VTTA 2ZTDA 3CQFA 3RWJB 1HNXQ 2PCYA 3BKMH 4MMZA 1RURL 2NSXA 5GRWA 2N01B 3OKMB 5J11C 2VN3A 1WS8A 4JFPA 1SF5A 3O2DH 4FQ1L 2NB0A 4JZJA 4OZHB 5K5PA 5C08D 3BYTB 2UXDQ 2EY6A 2QGQA 3KW8A 3UBXG 1X9LA 2HTLC 1D5IH 3BWZA 2ZCHH 3EFXD 4OB5H 4E5XG 5IJDC 4KY1L 2GPZA 2Z3FA 4OZIB 4IALA 3QYMA 4ME5A 1YEIH 1QX1A 2FMMA 4HHWA 1CYGA 3MACH 3MJ7B 4XYOA 1RU9H 4ZFOB 2X10A 1BBXC 4LGPB 2AEQL 5ETUA 2X12A 4JVWA 3L7FA 4UOW0 4DK6A 1QVCA 1PTOD 1CICD 1PSKL 4IIQC 5JVG3 3IMVA 1I85C 2FO4B 4G1MA 4HT1H 1G7PA 5E3FA 1JVOA 2OV0A 3GM8A 1CBVL 2H6PA 4PJ5D 3AFLA 1JK8B 3O4OC 4GKSA 4B7IA 1YAIA 1H6FA 3RN5A 4KQ3H 3H3KA 1IBGH 1TJIH 4ZMZA 5D7SL 1A1OB 2VMJA 1URLA 3OMGA 2DQGL 4NKOA 4V11A 1J86A 4GO6B 3BUQA 4PD4J 4CKEA 3WKML 1RAMA 2H2PC 3N5AA 2HLFC 3AS0A 3SDDD 2XTJE 1W0VA 4G3YL 3IDIA 3BVTA 4K7FB 4UV7H 2NYZA 3NTIA 1RJZB 5ALCH 1CFQB 4ZMAT 1G9NH 3U4AA 1YJDH 1RTOA 4HTHA 3UZVA 3MBEB 5LBVA 5CLWA 4PP2B 2G2RA 3CPWA 1H95A 4IZ8A 3MGOA 3QDMA 1THCA 4YNYB 3R8BB 2XZZA 1N59B 1LEKB 2RTTA 4RMVA 1AGDA 3V5HA 1JNHA 3KPQB 1QRKA 2GVBA 3CGTA 1MXGA 4X5WA 4PS4L 4R0LC 4XB8A 5INCA 1A6TA 1FGVH 1I3UA 4KZDL 1LO4H 2Y0SB 3WE6B 2OW6A 3PHQB 3NCMA 4JFVA 5J4MA 4WV1B 4KWUA 4EXKA 1MCSA 1QYGL 3HBPA 4Q58C 5KSUA 1I8MB 4U0RC 3CHXA 3V0FA 3MRHA 1S3RA 3ABKB 1OF0A 3MJ9L 2IDUA 4L5RC 4JKPH 5D96C 5TPWL 4U1JB 5BR8Q 3CCRA 1IFRA 3F2DA 4WO4A 2FR4A 4IJLA 1IIIA 3W56A 2CHBD 2V2WB 4QMGA 5INDB 2LS01 1VQKA 1XZWA 1FWXA 2BIIA 3PQYA 5LG6A 1Y69U 1AFVH 2Y5TB 2VITB 4ME3A 4JBJA 4K8RH 4M5ZL 5ITFB 1N34Q 4Q9QH 2AEOA 1KTLA 1OCWH 4CBZA 3R0NA 1MNUL 5FF6A 5K9JH 4XAWL 4NOFA 4YDKH 4ZLTF 4BBSG 2P52A 1LO5B 2JA7G 1F3RB 1MCOH 1X5LA 3JYCA 5DUML 2NY2D 1UWYA 1IGIL 1X3DA 4HEME 4HCEA 2J1YA 2F0PA 1QHQA 5BS0A 1UWEL 3NCFB 5DHYA 4TLTA 1WTXA 4Z7QE 4RKLA 1DD2A 2Q5BA 1HDMB 1M7UA 1A7NL 1XMOQ 2H9GA 1N6QH 3A6CH 1JZIA 4LEOB 4MNHB 5HDLA 5L4JA 3N06B 3NWSA 2DDQL 1E9PB 5I5MA 1Q4NX 3MEFA 4A3FH 2EE2A 2BRRH 1T1WA 2K28A 5D8JL 4DO6A 2XXGA 2E56A 4HC1H 4X7EC 5DJZA 4K3EH 5CUSH 1BVLA 1RUQH 2YMXL 3P77A 2JKLA 4FQIH 3I6LD 4FZ8H 5ICXB 3CH1A 3TASA 1I4PA 2BP8B 2OP4H 3GIZH 4LUOA 3KLDA 3SPJA 5IG7A 3TN2A 4LCCB 3KDMA 4RX4D 4WFHD 2VDQL 5FYKL 3FTGB 5JIDA 1I1CA 4AZ8B 1CSQA 5CIPH 1F3DJ 3GSNA 4U673 2YA1A 1R3LB 3B5GA 2RDGA 2R0LL 2BP5M 4R90H 2H6UA 4LVHC 1VLXA 2H8PB 4XXDB 2EYFA 4LF3B 4XMKH 3NCBB 2WXLA 4DV1Q 1RIPA 2CLZB 2A77L 2CUHA 1OO2A 3F6LA 4XOBA 3SK6A 4Z7VE 4XBEH 5MEPB 1EMTH 2WIIA 3PE9A 2WN3A 3A47A 4IBZA 5GGRA 2BHYA 2Y2TA 3AXLB 5HHOD 4U7SA 4XCEB 5BZWB 3QEQD 3U0PB 5M5XB 2YGQA 1XMEB 2F19H 4QWWC 2UVFA 3MNVA 4IMKA 3JVGC 4RMRA 5E1QA 4N90E 1B88A 1QB5D 2D9CA 2YD7A 3F7VB 3QBTB 4WVRA 4F7CA 1KN4L 1JYVA 3PLYA 5EKLA 2KCTA 3MZTA 3TJPA 2HDMA 2LSSA 4P2CB 5GRJL 4X3SA 1BNZA 4UY8C 2DQUL 3GLZA 4MQ7B 4JCLA 3VFWA 5D6CA 2JXMB 3ND9A 2VSMB 4I3RH 4A3CH 2BSDA 4NC2B 5H37G 2GTZB 5IQMA 1UOVA 1CG9A 3FQ4A 3QUMA 3ARFC 4H2CA 3PCYA 1QUNB 4FN0A 4GAGL 4W9ZA 3QEGL 1GYWA 2PN5A 2C9OA 1T2XA 1BM7A 3TCTA 4CSSA 5CD5C 2ZXQA 5EZIL 1THAA 5F7NC 3MKGA 2CLVA 5C08E 4F7EA 3HOYH 3GI8L 4YHOL 3DIDA 3WELA 1YCSA 5T1DL 5DWUL 3S5LG 1YEWA 5F7AA 3UJTH 3SE6A 5HYFA 5KW9L 2OMTA 3F58H 4OQTA 1KPVB 2AKRA 3DX7A 3HR5B 4NN5C 1ZEQX 3M7GA 3GTOH 2EZ0D 1X65A 3IDNA 4JFYA 5H4YA 1EZVX 2EIZA 3IJHB 4M93C 5TDNA 2EIMB 1K4CA 3FCGA 2Y7NA 4NPJA 4QRUB 1KDAA 3EFDL 1YEEH 5KIXA 3TS2A 3REVA 3LWUA 2UXCQ 1EXUB 1L0QA 1L9OA 3QC5X 4PJ5E 4JHWL 2C1PB 2FQDA 4GI6A 3V6ZB 2DY2A 3TWYA 3MGAA 3MRGA 1X5HA 4IUNA 2IHFA 3PXLA 3V9CA 2CFMA 3Q23A 2C9VA 4TSAH 5EPMB 3LYRA 4BV1A 3IGLA 3R7QA 4Z8FL 3JV5A 4W9GC 4OD2B 1OHQA 4P4RA 3O4LB 1CDUA 4JW3A 1OTCA 3QXAB 2O4EA 2WO2B 4P06A 1ZDQA 2OJEB 3NABL 3VAEA 3EJYC 3CPLB 5EU4B 4ZKBB 5BN3A 4YHHL 1JGVL 1EUTA 1PLGL 3AAZA 4MAYD 4WJG3 5AVYB 4AYDC 4ALAH 1CWVA 3ME0B 4O02L 3HJ0A 1ML0A 5TJWK 3UAAA 4Q2ZA 3WIIH 3TESA 3J7YW 4U2YA 4XT1B 4JW0A 5FLXL 3AWEA 2F1EA 1GA2A 3HUJE 4DUYL 4KROB 4JI6L 3RIFK 1IVLA 4J4PD 1K83H 2J6EA 4AV0A 5HPMB 3GBML 3KCWA 2F0UA 1KTBA 4I2XE 3G9AB 4QTIL 2P5WD 4UQ3A 5HHPA 2YSTA 1JB3A 1JWSD 5D72L 4ZRZA 3MROA 4YXKL 1DLHA 4K8JA 4JYAQ 1OGAA 5C1MB 2A74C 3NIFE 1HNWL 4JK1C 1CZ8H 1JPGB 4MNGB 5D7LD 3T0XA 3AG2B 4FXKB 2V2XA 3CN1A 3IM1A 1S9XB 4JY5H 4IKKA 4IKIA 5H8DA 3NELA 4N28A 4LLVA 3OAWA 3BJUA 2R29L 2CJTA 2WKOA 3LWEA 3FO1B 2XN9E 1DOLA 5K69A 5DK2B 1FFOB 5SV3A 3I9GH 5DRWB 3ULSA 3T3ME 4CGTA 1MFUA 4KTDL 1PNCA 4GMTL 4K15A 4UUJA 1MY7A 4GS7B 4PRBA 5I9OA 1VFAA 3QARA 4X65Q 1NMBH 4K7PY 5KG9A 1TWAB 3L3IB 3P3TA 4PJCB 3O3EB 4R4FL 5I0VA 5I17B 4KI0A 4OY9A 4A6YL 4OI8A 1NJIC 3GTJH 1JRHL 25C8H 4YCUA 2MNJB 5EF1A 3UCQA 2DUDA 1IRAY 2Y7SA 1I4XA 4K6DA 2VR9A 1A4JA 4K3JL 1T83A 2VW7A 3RNKA 3OSKA 3V4LA 3KWWA 2Z8RA 3Q24A 4WEEA 1MZYA 3PJLA 4NGHH 4NIYE 3OD3A 3M6DA 3R2TA 1RCYA 5CGBA 3I6LE 2WVVB 3MFFA 3DXAD 4RMBA 4KJWD 3OWRA 1MFMA 1BQRA 1AZVA 1W0WB 3GXPA 2C9SA 3RWIB 2XIBA 3V6FB 2BVQB 4BJLA 3P7JA 3EHBB 4W9IC 3Q8EA 4ANXA 3FB7A 3VFRB 2G3XA 1MCBA 3G6AA 2OMZB 3O3AA 4WFHE 4BFGA 2FBRA 4XVJH 2QELA 4HIEB 3JV4A 4OV5B 1U6AH 5KNBA 4R2GB 4K5NA 1LYLA 2WLKA 4WDIB 1HH9B 5IVNA 3S3DB 2M00A 5CC4A 3V4UL 3RY4A 4M7LH 2BS71 4PJGA 1Q1EA 1G7HA 1QSEE 3HI5H 3ECWA 3FFCD 4QRQB 2D7TL 1F5WA 4LP8A 1YVLA 3QO1B 4HKBB 1WIUA 1VQBA 4ODSL 5KNDA 1Q1PA 2NZIA 1NIEA 4JI4L 3QEQE 2ENSA 4LEBA 3O0RL 3WL9A 1SJMA 3V8OA 3T2NH 4W81A 4B60A 4A3KB 2YGNA 4YEFA 3PREA 1I6HH 2I85A 2VDNB 2E4FA 3DURA 5KYNA 4XPGH 1UUSA 5IB3A 1SE4A 1YMHA 2D9UA 4GKNB 3FQTB 5C0RH 4A3MB 1UKTA 3B3IA 2XRSD 1X9NA 1P7KA 3V8CA 4JGUA 4J23A 2YN5A 3ML9A 5I71B 1TTGA 2WWMD 3FQ2A 3TBIB 1HUNA 3GMRA 5TH2A 2BSEA 2P28B 3UFIA 5C0IA 1ZGLB 2P5PA 3JTBA 4F9PC 1CA5A 4L29B 1IL1A 4M9PA 2MCMA 3K80A 2XPGB 4DR5Q 4PJDA 4X6CE 2QADB 2P3YA 1S78C 3HE6C 3VYSA 5JA8B 5C44B 1XF1A 4KKBD 2J1ZA 4L4TA 4K8RD 4MA8H 3IGKA 4CILA 2CO7B 2FH8A 2X4QB 1RZ8B 2VQFL 1BFTA 2K4AA 2MQ0A 2R51A 2W0LA 3MV11 4GINA 5IBLC 4BRVA 5I5IA 5HI5C 4FFWC 5J57B 1V55B 4Q8BA 3VFPB 1MVYA 3IDMA 4FFYL 1HOCA 4J28A 3G6DH 3ES6B 5JA9A 3NG5A 1X6LA 4ANVA 4ZNEA 3NE5B 1CUOA 3U25A 1S7SB 4I1RA 4A7SA 5LAPA 4I3SL 4P49A 3G5VA 2ARJB 3TTYA 2AQ2A 3X2QB 4XB7A 3I2CL 5L4IA 4JM2D 3GTMB 5ID0A 2F5BH 4Y2LA 2B3IA 1Z3GH 3N41B 1G5AA 4FQXA 3MLZH 4HK0A 5DI8B 2FJFA 3VGEA 1CO1A 4Q56A 1LHZA 3BEVB 3CFQA 4E9WA 4QXGH 4L1LA 4RAUA 2WM0A 2IANA 4A66A 1A6UL 2J8UB 3SDAD 2LR4A 5MI0C 3TFKC 3IE4A 1IGJA 1WVLA 1USQA 4ZQKA 4YSEA 3R0MA 3RWJA 3TBBA 3KL0A 2OK0L 2VZOA 4BCXA 4A3JH 4AV4A 3GWJA 2D0GA 3OKMA 3PGCB 2CGZA 1K3ZA 3C60C 2OYKA 4B96A 2VDML 4IFDJ 4OZHA 1VQDA 3BYTA 2VWEC 5IQNA 1T6WA 4GNKB 5FW6A 2EY2A 5ELEA 2EP6A 1GXDC 4OZIA 1H9DA 1SYEA 5KYLA 3I4NB 2FECI 2NXZD 4HGKC 2DTML 1UM5L 2E9BA 3US1A 1P4BH 3MJ7A 2VZAA 4X6EB 4ZFOA 4BWTA 2R2CA 3MUY1 2IVFC 2P5WE 3SGIA 2AMGA 5E9NA 5IQLA 3LKPB 4JFFD 5IP7G 4UT6H 2KZWA 3IU3B 1ZE3C 4XVSL 2EKSB 1XF2B 4ADJA 5KBLA 1BVNP 3QCUH 4HFWA 4JJHA 1F02I 5K39B 5GRVK 4OZFG 2Y25A 3O8XB 1F3JA 1W2KT 1JK8A 4K23L 4I77L 2R15A 3FUDA 5LN8A 5AKVA 1A1OA 3KL3A 4JZNA 1E40A 1OCCB 3CZGA 3D87B 3F12B 1EQQA 4B9PA 3F7KA 3QYCA 4MJJA 4JFEA 4K7FA 3V2TA 4DUXA 4F7TA 1LO3L 1RJZA 3MCLL 3L7ZC 3CZSA 1KCBA 2E7HA 3P9LB 4ZUSB 1GVIA 4LF5Q 2H1XA 1PLCA 3MBEA 4MXWH 2ZKHH 1BECA 5LVEA 1UFGA 4TQPA 4YNYA 2ALYB 2JJSC 3GMPB 3R8BA 1NSNH 3H6JA 4IUUA 1QLEL 3KPQA 1H9VA 4LCWB 1VADB 5D1ZB 1WZLA 2GSGB 3KGUA 1JWUA 3HOZH 4XWGH 2V2TB 5ELFA 2SNSA 1NE3A 2Y0SA 3JWOH 3WE6A 3PHQA 3C09C 1QNUA 4DV2Q 4HJ1A 2DJ4A 4WV1A 1UM4L 3ZKXB 2ORBH 3GS4A 3Q8FA 1QNKA 1V7NL 2Q1EA 3DXAE 1U3HD 3GBNH 3L4WA 3P02A 1I8MA 4UTAL 2PQAB 2HRHA 4FA8A 1G1YA 3GRBA 3S5ZA 2VDRB 5GXBB 5B38B 1E30A 3JTSB 2J1KA 5IW1B 3RJOA 4HPYH 3MV9B 3QUZC 4U1JA 4OZGF 4XNQB 1RTNA 4O9HL 3SZKC 4QRSB 1DVXA 1T5XD 4DV4L 2V2WA 5INDA 4YVNA 3I9IA 4FULA 1Q0YL 4DEPC 4I5BA 4HMEA 4MYWB 4NHCL 2Y5TA 5E03A 5B3NA 4NN5B 1BBUA 5CCKH 5ITFA 3FFCE 2HTLD 1G6RL 3SR1A 4H20L 4KVPA 1SXTA 4B5EA 1AS8A 3DMMD 2K4KA 1X44A 5CZVH 2ZXGA 2FX8H 4GN3B 1FYTB 2APTA 1LO5A 5D5ME 4EI5C 3K2KA 3HNVH 4PMWA 4LF8Q 5AG8A 3RJDA 2G5UA 5J6SA 4UQ9A 2I7OA 5HI3D 1PH4A 2H6OA 1NNXA 1IE4A 4PGDB 1OHZA 1CURA 2XV6B 1F4WH 3LKQB 2D4FA 4MNHA 4LEOA 1CE1H 4BZ1H 4UINL 1E9PA 4PJ7E 3HOVH 1T03L 3CHRA 4P5KB 2EACA 5D70H 1T66C 4P48A 1WBXA 4O4YH 1SJED 4U1HB 3TH3T 4BA1I 3X1FA 1TS5A 4Y2OB 3BKYL 5C3TA 5ICXA 1EWHA 3IMSA 1R46A 2VB2X 3T1HL 3AWGA 3F8UB 2BP8A 3NA9L 3QORD 5HVGB 4GFXA 3VDAA 4IFDG 2NVXB 1NBYB 4OLZL 5DFAA 2AJVL 4I0PD 3QR8A 4LCCA 3WIAA 2F0JA 3FTGA 4XQQA 3PPSA 4I18C 3NUKA 1WA2X 3NCJL 4JFWA 1Y1UA 2N7SA 5JJZA 1JTTA 1R3LA 1XEDA 2PMZB 1NTGA 1HHJB 4CMMB 3I90A 2EC9U 4HA1A 2H8PA 4XXDA 1EXHA 4LF3A 4P9HL 2E76C 4AWJC 2CLZA 5E6ZA 5I6KA 1VQ5A 4PGZA 3ARVA 3KWXA 3QNXB 4BD4A 4PGBB 1UUNA 2WLZA 2OPCA 1WVZA 3D25B 3D30A 1RVFL 4LF9Q 3CE1A 3TO2A 3KYAA 4XCEA 5IHWA 5BZWA 3NIDB 1UZGA 3U0PA 3CFDB 5E5UB 4K5XA 5K9QG 4WHTB 4XMWA 3F7VA 2WXPA 4WCYL 1PZ5B 2EJ1A 1A2YA 3M17B 5EH1A 4ONGH 3S5YA 1YNTB 4LNQA 1E9OB 4MQ7A 2YPKB 5DJXB 5I66B 5D71H 3S2DH 4DV6Q 5AW3B 4IJ3B 4HSPA 2VQ4A 4QF4A 1ERNA 3Q01A 5BO0D 2CO3A 2JXMA 4Y0GA 2EINB 3ZK0A 2GTZA 1ECYA 4UILH 5AYUL 4A93G 1SNMA 3QDGE 2UV3A 4XI5D 4Q9CA 1JZ3A 2E9JA 1YUHB 2HRGA 1JNNL 4ZW7A 2E74C 1QUNA 4ABQA 4QF1B 2QHRL 3MV8B 5GHWH 1LDSA 3S34H 3RL1B 1U9RA 3KLSA 1B53A 3TO4B 1XB3A 1XGYH 1PQZA 5EEVA 3VH8B 3L5WB 4HP5A 5GS2H 3GJFB 1EEYB 1YJWA 2F0GA 4JGJA 1CHPD 3N85H 1HI6B 1SFDA 2OKMA 3OMZA 4AUYA 2MUYA 1HU8A 2JCCE 3VFUA 5DMKB 1FNEB 1KPVA 2CAKA 3HR5A 2OYPA 4KXCA 3VR3A 1YN7B 3HG4A 3QIWB 2R2EB 3Q6GH 1YYMH 4H40A 4IYKA 3L17A 1GGYA 3IJHA 2BWQA 4CRPA 4NBXB 3ULUF 2VXVH 4P73A 4QRUA 4X6FB 3B9EA 2YOAA 4PJEF 1EXUA 1U3YA 2WWKO 1U8KB 2L11A 2DWSA 2C1PA 3MLWL 3S2AA 3HIZA 3V6ZA 2NX5D 4WJWA 5M3MB 1IKFH 4K5MA 3WE1A 3NN8B 4C3IB 2UXGA 3OMCA 3S9WA 1AGFB 4MN3A 4KAQL 2WBXA 4FNUA 4R7XA 3RTQC 1UCTA 1KIRB 4OD2A 1MCFA 1NMAH 1MRFH 2YAFA 3O4LA 2OZ4H 4QXWA 3QXAA 5KBMA 4ZXBB 1AO7B 3KF8B 1TVBB 1TETL 1FC2D 4K5VA 5CD3B 2V17L 5IESL 5EOQH 1MFDL 5EBDA 4MA7H 3K2UH 1DVSA 3CPLA 3AMLA 5EU4A 1TZGL 4YHZH 1S6NA 5HDQL 5HGBA 3ME0A 3AW5A 4AVKA 3EDDA 4KFMA 3VDCA 2YMOA 2EDYA 1WYJA 3QCTH 5KVEH 2V7NB 4RAHA 1KENH 3ZL4H 5EZPA 5TFSH 1ZE3H 4TNWF 3JYBA 2LABA 2IH8A 1CU4L 3KWVA 2AJSL 2J72A 2OSYA 3BFOA 2JKSA 4HCGA 5HPMA 1GVPA 1PZ2A 4X7FC 2GBAA 5DS1A 3FT4B 3JWNG 5F1NB 1EGJA 2PP7A 3HKZG 5D4HA 1S4ZA 5CZXD 2GK2A 2DQJH 1JPGA 4MNGA 5C97A 4FXKA 2OCCB 1L9QA 2E46A 3ARFD 4OT1L 3Q1EA 4I89A 1S9XA 2BVOA 3IKCB 5M7QA 4Z95L 1HQMC 3RKPA 1E5UI 1ZSDB 3F2BA 3PABB 2B2TA 2WQAA 2L15A 3LXCA 5KVMC 3FO1A 2VDLL 5DK2A 1E4KA 1YDPB 5BPPA 5FYKU 4LKXB 2AK1H 5H2BB 1EAJA 4XNMB 3OLDA 1G87A 2NVTH 1M1XB 1H6EA 3VGDA 2MJWA 4YL4A 5C07B 4BUHA 3IFLH 1U8LB 5IROA 2K1BA 3K5SA 1SN0A 3L3IA 3LH9A 2ASBA 2FUTA 5I17A 2CALA 4DR6Q 1NAMB 1S3OA 4XPAH 1ITCA 3TJEH 5DZLA 4OF5A 4NO2B 4OWWB 1IC1A 1O78A 5MI0B 4YSAA 4X6DF 4IJHA 3C2SA 1T89A 2E2JB 5TF0A 5EFIB 1LT6D 3DJTA 4XCFH 5T1JA 2WVVA 2YD1A 4E5XB 1W0WA 3RWIA 4KRNA 1Q38A 4GO8A 2BVQA 5F7MC 2X6BA 2OTLA 3CC7A 2HDLA 1QBAA 4F91B 4KO9A 3S97C 3VFRA 4P46B 3DROB 3VWJC 3X3FL 2AHOB 3FSWA 5D7IE 5EOCJ 4A7GF 1NCUA 3RZCC 1CQYA 4HIEA 4OV5A 4JPVL 3NIGE 1A3LH 4K5OA 3BT0A 4OIJA 4KKRA 1N4XL 1XH2A 1HH9A 2AHIA 3OM3B 1PY9A 1WBZB 4UU9B 4GQRA 2IOIA 2ZXCA 3PDGA 4M4RB 2EIDA 1QBBA 3NT0A 4L8BB 4QRQA 1J8HD 1IGYB 1JZFA 1NGPL 2JIXB 3K4ZA 4M62H 4HKBA 4QHLB 4TUKL 2H2SC 3SBQA 1I85A 4TYUA 4ZSOE 5E9DD 1ZAGA 4HUUB 4B97A 1STAA 1STEA 3BRDA 5IFAL 4DR4L 4M6OL 1NDTA 4XZUB 3NJHA 3L1OH 4OGYL 3DYMA 1IM3D 3HZYB 3MRLB 4QUOA 2DQIH 1MLCB 1NKOA 2A19A 4IRSC 4MA1C 1Z47A 4Z7NE 3FH5A 2MPMA 2WB7A 3X14A 3FQTA 1AI1L 3OG4B 4GT0A 4KH2A 1JL8A 2LOEA 4OUUB 2R69A 4PPTA 4PJ8D 4AGPA 1S9YA 1XAKA 1UXMA 2G5DA 1XD0A 2ED8A 4XTRC 3RVXD 4HALA 3U2IA 1ZGLA 2F08A 1EX0A 4RCNA 2SODB 4OIIH 1FC1A 2WUCH 4L29A 2FJHB 2HLEB 5JIKA 2XPGA 4KI5C 4UM9B 4M7LT 2AGJL 3J7HA 1L0YB 1JV2B 4Q4EA 3WY1A 4ZX3A 5J13B 2Z0UA 4R0LA 4WHYH 3W3AA 4FMKA 1S40A 2CO7A 2X4QA 1RZ8A 1FVDB 1X4YA 1BD2D 2XN1A 4Q6IB 3C09B 2AMUA 5GAHC 3DEPA 1RUML 4J2QA 1NOLA 1YNJC 1RZFL 1SQ2N 3W3BA 4YIJA 3QH3B 3GTLH 1STNA 3VFPA 4A39A 3JUZA 4X4YB 1NCGA 2KCNA 4UP7A 5GISL 5LBSL 4JI5L 5I8KH 3ES6A 5JUEL 1RUAL 4KJQD 1KYFA 2OBGA 4JKWA 5IBTL 4Z3IA 4LPYA 1XR9B 2DQMA 3IRZA 1S7SA 1DCEA 3AXHA 1GOFA 3CMOL 4X7SL 3VSQA 2F3IA 4JO3L 5MEOB 1ZA6B 2EPBA 4HJUA 3OWFA 4DEPB 2X4UA 4BXXH 4BBSB 5FHBL 2NX5E 5DI8A 4B27A 3OTOL 4CC1A 4G7YL 5LMNW 4UOJA 3BEVA 3HBZA 4M43H 5FLUA 3WNJA 1UYWL 2WYIA 1IYVA 1NCCL 4ODBD 1LWJA 1IBBA 2J8UA 3QUMH 2K6YA 1HNYA 1JV5A 5HYSG 4MQXD 2P7TB 2E86A 2EO7A 4KUZH 4JI8L 4G7QB 4DKAC 3PGCA 1IEHA 5AKTA 3IJSB 2X70B 2RHSB 5IFJB 5DURB 2YQBA 2Z4TA 3N55A 4QRTB 5HDBE 5JHLL 2VGLM 1WF5A 3HOXH 3FQWB 4OQTH 2F0LA 5CINH 4DVRL 5FJ8H 2DD8H 2A6KA 1JUFB 5JJLA 4X6EA 2BIPA 4NQDB 4PLJC 4TPRH 1FG2B 4AE0A 2D0OA 3SDYH 3LKPA 3B9DA 4KRPC 3IU3A 4DP6X 3R19A 3QIBB 1XF2A 2EKSA 1UE5A 4MAUL 1SDDB 3X3MA 3M9BA 1AR1D 4U6TA 5K39A 4OGXH 3MLVL 2DJSA 4BGDA 3MXGA 4YPGB 3O8XA 4JI0L 3BSZA 3GNML 1G9MC 3E38A 2HT2C 4JQIL 1GHFL 3ETBJ 3HE6D 4JI3L 2VN5A 4FNLH 3RGBA 2Z7ZA 4FF2A 2H26B 4Z0BL 3O81A 5C6WH 4LRNL 1J5DA 2P24B 5IBLD 1AHWC 1F58H 2JI1A 2NVYH 4E9YA 4LSSH 3PUVA 1F45A 1QLFB 2P8PB 3P9LA 4ZUSA 4P3CH 4Q6YA 1AIZA 1WTVA 4L9DA 4NO0B 5GS2D 3RUGA 3HS9A 4K2LA 4Y9BA 5FO9B 2CQAA 4TQIA 5A3ID 3GMPA 2KI6A 2CBMA 2Q6WA 3P3UA 1SNCA 3RX9A 3KFUA 4LCWA 1VADA 2C4FU 2DI9A 5D1ZA 3RKDC 1BQKA 1TNMA 2GSGA 2A7BA 3L1GA 2V2TA 2WQWA 2R93G 5I5RA 4KJNA 3ZKNC 4I9XA 3AS3A 4K3DH 2HN7B 4L0PB 3V7AE 4ELDA 2BNRD 5JHDD 5GS0H 2R0KL 1HA6A 4JI2L 4X4MA 2PQAA 4HUXB 3IDUA 4NRXB 3S5LB 5B38A 3JTSA 5IW1A 3H42H 2VC2B 4DNLA 1OGSA 3MV9A 3TFKD 2LU4A 1MI5A 4A3DG 3BE1H 4ELMB 2HYMA 1WUNT 4OJFL 5KBNC 4XNQA 1QNZL 4QRSA 5JORB 4M1CC 4LPCA 2F1BA 1IGMH 2UY6B 4TLUA 3FHWA 3AT9A 5LJYH 3MRRB 4XPHH 5FDYA 3O9WD 4ZMVA 3FT1A 2OF1A 1HWHB 1NEUA 2SEBD 4P9MH 3UC0H 2RMNA 5IGGA 1NANH 2WGNB 1QKZH 2CJUH 2GEEA 3MA9L 1GKOA 2APXA 2HZHA 1KTDA 3T3PB 4ENEC 1C5BL 5E9DE 2K70A 1TQCB 4JG1L 3MUUA 2YUWA 4N3UA 4AM0Q 5EEWA 1XF3B 3GEFA 3I7FA 2VLRD 2NMSA 1J87A 1HCVA 3SGDH 5B39G 1CZWA 5M5WB 2W8CA 2QPDB 3DDGA 4PGDA 4CUCA 5GRUL 3LKQA 2H5XA 1WTPA 4ABVA 1KB3A 3GBLA 5KYIA 2VDOH 3DGDA 1P4IH 2ESVB 3QWQB 5T5FH 4DETA 5C0DB 2WB1A 4P5KA 5AVRB 5I5JA 1JICA 2LU7A 3QUXB 3S48A 2XIWA 2Z7YA 2ZJSL 4U1HA 5B22A 3S35X 2JJTA 3J81i 4PJHE 3V6OC 4Y2OA 1T22A 1QP1A 1A5FH 1Z9SB 1DONA 1CFSB 1E6OL 5IGFA 4BKLB 4NENA 4XBMA 3STZB 1DBJL 2F4VL 3M3YB 1NBYA 1EDQA 1MFAL 1ZHNB 2FEDD 2X9WA 1G2TA 5C0BB 3UJIL 1LV9A 3L54A 4WUKL 2J5LC 1IFGA 2PMZA 1A7RH 5LMNL 2N7AA 4K2UL 2J12B 3LH2H 4CMMA 4FL4C 4X7DC 2DRUA 2F8XC 1OM3H 4KRMB 3S6CA 4PGBA 1YPZE 4Y16D 1OAQL 5FO8B 1IBYA 1T2JA 3T0EC 3QZBA 1E43A 3D25A 3QDMD 3U9WA 1CDHA 5TE6H 4JUTA 5FYLH 3VW3L 1HL5A 1RL1A 1Q0XL 3NGBC 3CFDA 3EYOB 5FPIA 1T3FB 5CBEE 3BPOB 3QRBA 4WHTA 1NCBL 3V0VB 1CCZA 2FQGA 3L4VA 4Q14A 3SEBA 2D2OA 4QD2E 2K5HA 1PZ5A 3H0GH 3M17A 4LSVL 5ICYB 1P5UC 5DJXA 1E9OA 4IHBA 4DP7X 2YPKA 5I66A 1K73C 2QSTA 5CV5A 3QUZD 5ESAB 2F8OA 3K4AA 2BY0A 3MXVH 3TQYA 3QWNA 3M8OH 3FN9A 5D2LB 2Q86A 3REWA 3WJMB 1RFDH 1W6LA 2FX9H 2QZQA 4XXCC 2RKSA 1IZKA 2LLGA 3IU4H 5KSBE 3F7LA 4WO4D 5IREA 1YUHA 1OAUL 3P0VH 5C0EA 1JZ8A 3PQYD 5DUPH 4QF1A 3MV8A 5B1JA 3IFTA 4JI7L 2R6GA 3RZOB 3THMH 2K05A 2NSQA 2WLMA 3TX4A 3RL1A 1WQVT 4FE9A 3APCA 3TO4A 2YRBA 4A3GG 3VH8A 2UXBQ 2GEQA 3L5WA 4FG6C 2AJYL 1HINH 4OKVA 3WTWA 3GJFA 1EEYA 1MFBL 5E0QA 1AHMA 2I9LB 1HI6A 1YY9D 4JPBW 2R56L 2UUCQ 1IBHA 2XNAB 4ZTOH 3BAKA 4TNVK 1DQLH 1FNEA 3JAME 3GZQA 2WLHA 4FQQB 4JFDB 5BS0D 1YN7A 1O6TA 1U2HA 4J3BA 4OD3L 3QIWA 5DVOA 4L18A 2O61A 2R2EA 3FMGL 3WSQL 3K7AB 3N2JA 5HGHB 5LWYL 4PJ9B 2R8SL 1MKFA 3F1ZA 2HT3C 3ESNA 5JW4M 2YN3A 2FWLB 3RDTC 3VRLE 4JFOB 4YSRA 1PMRA 1YC8A 4HCRL 4NXMQ 1RLBA 2R7DA 3AB0C 1ESFA 4FABH 1U8KA 3EFOB 3WUZA 2E7LC 4OTXH 4QXUH 4Z0XB 1S7UA 3SYAA 2DWDB 1TQTA 3LAFA 4GZYC 3NN8A 2BNQB 1AGFA 4DFIA 4G82A 2X2IA 3PNWB 2Q2UA 4YR6B 2F5AH 1UB6A 1KIRA 1U8NB 2Z7UA 3BAJA 4W4NA 4I9WD 4AVIA 1HR0Q 1AO7A 3KF8A 4I1PA 1TVBA 1E6JH 1NINA 5E1GA 1NKRA 2OL3B 3TYGH 3HA0A 3ONAB 5FHAL 1EVTC 4DV0L 2ZXBA 4MJID 3PIO3 2G60H 1QTYT 2DQ6A 3QDAA 3IVKB 2MH4A 1OAXL 2ENBA 4HDIB 2DN8A 3L5IA 5FA3B 1HNXL 2V7NA 5B1AB 5LNDA 3MLXH 2YD8A 2QR0B 4I4WB 5IUCA 3EOYG 3ZSTA 1KCVL 1MDTA 3B37A 3RIAK 2BNRE 2UXDL 2VSCA 1JZ7A 4LSTH 3FT4A 5JQHC 5F1NA 1CGUA 1VF5C 2AI0L 3S98A 4ZD3L 1F90H 4HWUA 3O6MH 2AWNA 1YRKA 4S1QL 5IGDA 1M8AA 1JWMD