1QNKA

Truncated human grob[5-73], nmr, 20 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
69
structure length
69
Chain Sequence
TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemokine
molecule keywords C-X-C motif chemokine 2
publication title Nuclear magnetic resonance solution structure of truncated human GRObeta [5-73] and its structural comparison with CXC chemokine family members GROalpha and IL-8.
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qnkA00
1AZQA 2X69A 4HEDA 3DEOA 2FHTA 1Q3LA 3TN2A 1WTWA 2FINB 1O7ZA 1NR2A 1PLFA 2KEDA 4CJ1B 2X6GA 1WTPA 1WD1A 1GUWA 3Q6SA 1A15A 3N52A 1M8AA 4RA8A 1IL8A 4IURA 4IUVA 5EQ0A 4CJ2C 1HHVA 1HRJA 1XX8A 2VXWA 1TVXA 1BNZA 1O80A 4RAUC 1HA6A 4ZKCB 2EPBA 2XIWA 4MN3A 1AZPA 1RHPA 1F9RA 1LV9A 1MSHA 2FJ2A 2NYZD 2HDLA 1NAPA 1CA5A 2JP1A 4UAIA 2B2UC 3IL8A 1B4OA 2NZ1D 3I91A 2L9HA 2FFKB 1ML0D 1WTXA 2B2WC 1RTNA 2K05A 2N55A 2IL8A 1DZ1A 1X32A 1MI2A 2J7ZA 2RA4A 5JJZA 2DY8A 2B2YC 4IUQA 1AP0A 3IFDA 1CA6A 2BDNA 3DM1A 5EJWA 2X6LA 5T1IA 5D65A 1F9QA 2Q8TA 3R93A 2MP1A 3TZDA 3MWYW 2CVRA 4MHEA 4LMQD 2B2TA 1BBXC 1SSOA 2B2VA 1EOTA 2D9UA 3SVMA 4O42A 1G2TA 2K03A 1ZXTA 1WTOA 2SDFA 3HP3A 3G7LA 1IKLA 2EOTA 2RSOA 1VMCA 1PFNA 1RODA 3I3CA 4OIKA 1RTOA 1WTRA 2H1EA 4XDXA 3FDTA 2KEEA 2L4NA 4ZKBB 5CMDA 2RSNA 3ONAB 1EIGA 1HFGA 5CBEE 1G91A 4CJ0B 4ZK9B 2HUGA 4ZLTF 2HDMA 2K01A 1X3PA 2KOLA 4X3UA 5E4WC 3GV3A 3QO2A 1HUNA 4IUUA 4OIJA 1B53A 4R8IA 1JE4A 1JICA 3KUPA 2K1BA 2M2LA 2K28A 3H91A 2L12A 5EKIA 5E4XA 1WTQA 2Q8RE 4ZAIA 4XT3B 5DNFA 1EQTA 1IKMA 1B2TA 5CORA 3UI2A 1EIHA 2N88A 1QE6A 2NWGA 2L11A 3F2UA 1WD0A 1U4LA 2MPMA 1ESRA 3I90A 1B3AA 2KECA 1X3QA 4HAEA 4RWSC 5EPJA 1XYIA 1U4MA 1O7YA 1G6ZA 3FPUB 1S4ZA 5EPLA 3D6WA 1QNKA 1WVLA 3GV6A 1NCVA 4NW2A 4QUFA 1DOLA 1DOMA 2EE1A 2B2TC 2HCCA 1ILPA 2B2VC 1MGSA 5T1GA 2FMMA 2HCIA 2L1BA 1ICWA 4XT1B 1DOKA 3LWEA 1J8IA 1ILQA 1MSGA 5CBAE 1F9SA 1EL0A 2K04A 2MJ8A 1HUMA 2KVMA 1J9OA 1SDFA 4HSVA 2KUMA 2B2UA 4U68A 5D14A 1PDQA 1HFNA 3MTSA 3DEPA 1E0BA 1PFBA 1KNEA 1PFMA 2B2WA 4X3SA 5COYA 1BF4A 2JYOA 5EPKA 2B2YA 5AFWA 1WTVA 4QUCA 1VMPA 4IUPA 4R9WA 1NR4A 4DN4M 1DONA 1F9PA 1RJTA 4X3KA 1B50A 1C8CA 1QG7A 2RVLA 4X3TA 3KBXA 4IUTA 1U4RA 4HCSA 3P7JA 2R3ZA 1KNAA 1U4PA 1F2LA 1BO0A 2MGSA 1G2SA 1CM9A 2DY7A 3I8ZA 1SAPA
chains in the Genus database with same CATH superfamily
4C3HB 3HKZE 1K83B 1V9PA 2F3IA 4DR6Q 2E2DC 3UE1A 5CV9A 5HURA 2ZTDA 3PUXA 3M4OB 3F8TA 3AQQA 3K81C 4YY3Q 4KY5A 4P74A 4PMBA 5C3EB 3AEVA 1NAPA 3CCJA 4LFAQ 4YWLA 3MEHA 2N55A 4RH6A 3T1HQ 4S3SA 4K6DA 1YIJA 1E24A 2A69D 3KJOA 4J6HA 1VQ5A 1AE3A 2F0GA 1XXGA 4OO1G 1SNOA 4EQOA 4JCVE 3GTOB 5EBCA 1KABA 4G7ZC 4BY1H 2VUMB 1I6HB 2F0PA 2WACA 4P2CB 3OIQA 1Y1WH 1VMCA 2DGYA 3I70A 1H95A 1PVOA 1V1PB 4A3GB 1PTOH 4K8IA 1SBBB 4B3MQ 1XMOQ 3BU2A 5C4JH 4LWCA 3W1GA 2KOLA 3CKIB 1PH1A 5E4WC 3ICEA 1OTCA 3QWNA 3H91A 3C3LA 4ALPA 2Q2UA 5C0XG 5M3FB 2UXBQ 1WD0A 2CH4W 1EIFA 1X3QA 3T51B 5IGBA 4P71A 3FPUB 4Y7NB 2IX1A 4OXPA 1VQ8A 2IY5B 5LMUL 2K32A 1Z7TA 3I4MH 1EL0A 4YCVA 1YITA 3U58A 2R93B 5C4XB 2F3WA 4LFCL 5IYCG 1RDPD 1E0BA 5I2YA 2ID0A 1VQNA 5C44B 3A8KE 1LACA 2PQAA 4IPCA 1WTVA 1KLGD 3NUCA 4DV4L 1B50A 3QR8A 4CKCA 3KDFA 5JEAG 2F0KA 3K7UC 1CM9A 5IGCA 1SLJA 3OHXC 4BXXG 3FKIH 1WTHA 4DUYQ 2NVYH 2KEDA 3A7LA 4UP9A 3L2PA 5FK9C 1UNSA 1CSQA 4GLAC 2OEOA 5IP7H 1I50B 4RKLA 5J39A 3I4OA 4DV2L 2SNSA 2EPBA 2WAQB 2P5ZX 4ID6A 1YJ9A 1AZPA 3UDIA 1IHZA 3OPOA 5EKKA 4DR1L 5GAGC 2KBNA 2BH8A 2NZ1D 3C2PA 1VQDA 1VQLA 2FFKB 1ML0D 4JYAQ 2B2WC 2WIIB 4A3LG 4L5RC 2IL8A 3KF6B 1DZ1A 3D8GA 1PTOB 3PMFA 3F2DA 2Z4IA 5C4JB 1LTRD 4DV5Q 3HOUB 2PNHA 1EYAA 2SDFA 4IZ8A 1HZCA 3VDYA 2LY7A 2UUCL 2IPKD 2SEBD 2VL6A 3FDTA 5CMDA 3ONAB 4OO1H 4RGTA 2RKSA 4UDUC 4A3JB 3DWAA 1N33Q 1P16A 2WFWA 3E3XA 1ASYA 4OHJA 3VR3A 2Z6KC 2ZM6L 3T4AC 2L12A 3OMGA 1YJWA 2OQ0A 2PO4A 1VQ6A 1EY7A 4KV6A 1K28A 1L1OA 1EIHA 4A3MH 3IKJA 4KN7C 4NXML 3FVQA 4A93G 4X62L 1V1QA 4K5VA 4IJLA 4C56C 1O7YA 1PYBA 1HZAA 1Q12A 5JPMC 2IT1A 4AIMA 3SK8A 4LF6L 1PZID 1KRTA 5M5XH 3S17B 3L3OC 1DOKA 4QIWB 5C0XH 1XNRQ 1PZKD 3A5ZB 1LYLA 3VYRA 1SDFA 3OW7A 2NUCA 3DWQA 5KNDA 2EY1A 4ODGA 1LT3D 5IIFA 1NMGA 5HY6A 2HD3A 2VQFL 3PO3G 1PV4A 1OXUA 1QUQB 4A3FG 4R9WA 2PZWA 1TY0A 4UPAA 1B70B 1TT2A 5M9OA 3GTLH 2OXPA 1EIYB 3HOVG 3S1QH 1HZ9A 1FYCA 1RKNA 4WORA 2A6ED 2CFMA 1A6XA 1U4PA 3SEBA 4KHPL 5IYCH 3UDGA 1R4QB 4LF8L 4JI6Q 4F87A 1UWVA 1HQRD 1WFQA 1WD1A 2NVXB 1TWFB 5JEAH 1HRJA 4DV0Q 1EQVA 1EWCA 1XX8A 4DR6L 2AWNA 2XRSD 4N9TA 4DV1Q 1R9TH 3W2DA 1STNA 1Q82C 2NYZD 2UXDL 4BXXH 4YY3L 2K7VA 3OSOA 3BVGA 5KYIA 4AQYQ 2E76C 4OWXB 1Y8PB 1YJNA 1H9SB 2B2TA 3H6MA 3NHHA 2B2VA 2I5LX 3J80c 1EU4A 3SVMA 2QDLA 4DPGA 1ZXTA 5H1SE 2VQEQ 3GTPB 2DJFC 3G7LA 4A3LH 3PSIA 3F1ZA 3HKSA 4IQZA 1Y69U 1L0YB 1QZGA 1UEBA 2IW3A 1E1OA 3H3VI 4U673 5CBEE 4HIDA 2JJQA 1ENFA 5JPNC 2EXZA 2QEJC 3TP6A 3PUZA 2C5CA 2C9OA 1HUNA 4PZ6A 4NMZA 4GN3B 4IFDJ 1TWHH 2CWAA 1STBA 1MJCA 1VQKA 4MNOA 2F4VQ 3BVMA 1EQTA 1STYA 1CI3M 3K80C 3PF5A 4HJ5A 1P8LA 2ATWA 1XPOA 5C0XJ 4BY7G 3F2BA 1STEA 1LO5D 4JW0A 2L55A 2QW7A 4GKJL 3D6WA 4NPSA 3CC2A 1RD9D 1XTCD 1VF7A 2D0PA 2PQAB 3TS2A 2CQOA 1TS2A 5M3MG 4A93H 1C0AA 1STGA 1KAWA 1CHQD 3VR4A 3KDFB 2XTIA 5IE8A 4QMGA 2A74C 1LTBD 4BBSG 2I07B 2LFNA 1E22A 4X3KA 1C8CA 3NTHA 4YWMA 1SXTA 2Q2IA 5JEAJ 4OWTB 1R9TB 4OGQC 3R2IA 4L6TB 1QNUA 3BVZA 2A73B 5A2QL 4LAAA 3ZJYC 4A3DG 3PO3H 2NVQH 2VB3X 2FHTA 4J15A 4H7BA 1SYEA 5KYLA 4A3FH 3DHQA 1Q90A 3QIAA 3NBHB 2E2JB 3HOVH 2PW5A 4DUYL 5KNBA 4YCUA 4QGUA 5GAEC 1SE4A 1K0SA 1F77A 2RDHA 2YU9H 3CC7A 5LL6X 1K8AC 2JA6G 2H5XA 4DU9A 2XVSA 2A68D 4R4CA 1LABA 4EX5A 1YEZA 2AUJD 2B2YC 1EYCA 4X65L 1TR5A 1UE5A 3DM1A 4JYAL 4B3RL 3H0GG 1X6OA 4L5QA 1S40A 5LMNW 2B39A 3JAML 3GTKB 3E0EA 3OOCA 3S15B 1B8AA 2EOTA 3CW2C 4OIKA 4X64L 5C3WA 3D31A 4ZKBB 2I5HA 4FXDA 2D5DA 2G5DA 1L1OB 4JI2L 3HOZB 2EYLA 4PV1C 5DEHA 2ENBA 3A54A 4OWWB 3RLFA 1H9KA 2NTTA 2E2IH 5AJ3Q 2N3SA 2XNAC 1PRTB 1K3RA 4IPGA 2VW9A 3BG3A 4ZCKA 4FO2A 2N49A 1U5KA 1HCZA 1DOLA 1GUNA 3NK9A 3SK6A 1CK1A 2EE1A 2HCCA 3HOWB 3PIO3 5I4DA 4XT1B 1FNUA 1BCPF 2EQSA 2EJGC 3U9OA 2LMCB 1MIUA 2GA4B 1MD2D 1BCPC 4HSVA 3I56A 4GLXA 1CFMA 5D14A 1PDQA 1HFNA 4NP5A 1QZHA 5C6AA 1PFMA 1PFBA 2B2WA 2K14A 2C35B 2JYOA 2CH4A 3KF8B 1S3OA 5AFWA 1E7ZA 1EFWA 3PIOA 4MTNA 4OL7A 2EVBA 5LMUQ 4HJ9A 1DGSA 3KBXA 5M3MH 4RGMA 1F2YA 3S2HH 3KJPA 4A3EG 4ZYSA 1BO0A 4LF5L 3BYTB 1VQ4A 2DY7A 1F2ZA 4HTHA 5D3DA 3TREA 3BYYB 2Z0SA 3BZKA 3PCOB 2UXCL 4UHVA 5GAHC 4Y52H 1I3QH 1Q3LA 2K75A 4KJOA 4BBSH 1BDOA 1JOQA 1UE1A 4JI6L 4KKSA 4R4IA 4M1UB 5JJIA 3CMAA 1ET9A 5FLXc 3G4SA 4POGA 5CV4A 4DV4Q 1TVXA 1X3GA 1FNVA 1QJOA 2EY6A 2WB1B 1XPRA 2XIWA 4DV0L 2Z6KA 4XIGS 4A3DH 2KCCA 3O13A 1M4VA 1B9NA 3G48A 1SE3A 4DR5L 3MC0B 1TWCH 3S1RB 1GD7A 1YNNC 3CXCA 2KENA 1Q8IA 3J7ZC 2ZT9C 1WJJA 1ZYRC 4DV2Q 4K14A 1SSOA 5ELDA 2YTXA 2D9UA 2PMZB 4O42A 4XYOA 4DR1Q 1LTID 2Y0SG 5LL6S 2HHHL 2JA6H 3M3YH 2RQXA 4PMWA 4F8MA 4WRDA 3CHBD 2H1EA 2E2IB 5BN5A 2VQEL 2RCFA 1GUGA 3H0GH 1SROA 4BY1G 3C1EA 4ZK9B 1N8RC 1UUPA 5KNCA 2EDGA 5TSSA 2UUBL 1T5EA 1X3PA 5ELEA 2N78A 2KQ3A 4L8JA 4JI0Q 5E1FA 1SNPA 4KI0A 4K0KQ 3EQLC 4XQJA 1FVIA 4BY7B 2UUCQ 1IBLL 1O7IA 2F4VL 2MPMA 1Y1VG 1XPUA 4RWSC 1WCMG 1G6ZA 1L2FA 1G8ZD 1SR3A 1X9NA 1D5XC 3D4WA 4FXGC 4RG1A 1T9HA 4RCOA 1MBYA 4HSPA 3GV6A 2PNRC 3QJYA 1X3EA 5T1GA 4RGNA 2ZM6Q 4A76A 3OIPA 1BXTA 1TWGB 4DXGA 3J7AF 4BBRG 2CW0C 4MIUA 5J22A 3MTSA 3PIPA 3Q22A 4X3SA 4X62Q 4TRDA 4KMUC 4H0LC 4BBSB 5FO7B 1KDAA 3HG9A 3J81c 2A6HC 1VMPA 4LF6Q 1F9PA 2K50A 5IODA 1S5DD 4L63B 4JK1C 2E75C 1F2LA 3VYUA 4E6IA 1EWIA 3FHWA 5CR3A 4PQXA 5G3LF 5CC4A 4FP5D 3PF4A 1TWCB 2VQFQ 3DXJC 3M4PA 3Q6SA 2AWOA 2Y0SE 1BNZA 4A3EH 1PH3A 1CQFA 3EIVA 4KD4A 4B3TL 1MSHA 4B08A 4DAMA 3RN5A 4KHPQ 3HOXB 4UAIA 2JA8H 5M5WB 3S2DH 1JE5A 5JJZA 2XRQD 3MXPA 1VQHA 4CDFC 5C3XA 2F0JA 4LJZC 4QB4A 2CVRA 1FD7D 2BCOA 1YHAA 3KK7A 4KHZA 4DR7Q 1WYDA 1A0IA 3HP3A 2UXDQ 1ZKOA 5K36G 4DAPA 1R4PB 2K5QA 1A2UA 4XTCS 2Z9HA 1J6QA 3NQIA 4JI3L 2CCZA 3A55A 5FOBB 3S1MH 3H94A 4R4TA 3D0FA 2RF4A 4RHSA 3U50C 3MZ5A 3PUYA 4DAVA 4G4KA 2Z8LA 2L15A 5DLQE 2M2LA 2K28A 1KD1C 2R7ZH 2LXKA 2RHQB 4P75A 1U4LA 4WJ3M 1EY8A 1AFPA 2F0MA 2KECA 2EYOA 5AJ3L 1VQ7A 4GKKQ 1B3QA 1QB5D 5F2DA 3RZDH 1X55A 1ENAA 3VYSA 4C3IG 1JORA 1A3UA 2KCMA 4O0AA 4A3MG 1SNQA 1A3TA 4JPBW 4HMIA 3T13A 1Y1VH 4K6LA 1WCMH 4OEMB 2ICEC 1E2WA 3TP5A 2SNMA 5COYA 1HZBA 1PTOD 2B2YA 4GKJQ 3BZCA 1JJGA 1DONA 2QDBA 3FEWX 1A3VA 4HCEA 4QJFA 4JVZA 4A3EB 1Z6HA 2EXDA 4IOAA 2KCTA 4BBRH 2K6AA 1KNAA 3I72A 5CV6A 1KRSA 2JXMB 1STAA 3CRKC 3DEOA 3BDCA 1PLFA 1Y8NB 1GUWA 3OMCA 3LWUA 5CV8A 3NSWA 2BOSA 3URYA 4ME5A 2NZHA 4X6AH 2AQ3B 4LNQA 3HEJA 1JR0D 3FP9A 4TQUS 2JQOA 3P20A 2PQEA 3BDOA 4IFDI 2F0EA 2NB0A 1VS0A 4QL5A 3SK5A 1GHKA 1CUKA 3BS1A 4I7AA 3TDQA 2NBFA 2ZTCA 3W1BA 2DNCA 1IYUA 4MHEA 5C0XI 1BBXC 1ONLA 3L9AX 2QCPX 3IFTA 3I73A 2RSOA 3S14H 3S24A 2A8VA 4BY1B 1EIGA 2IHEA 3M7GA 3AFPA 1OXVA 3K6OA 2WP8J 4X65Q 3HFZB 4QF4A 4B3RQ 1Y1WB 1N34Q 2HUGA 3M4QA 2E2HH 3HKZB 3B6YA 5K36H 2EY2A 2RDGA 5DAUA 3KOJA 5IY0A 1N9WA 2DUDA 1HR0L 5ELBA 4GZYC 2N88A 4JI0L 4BS9A 4X64Q 3HGBA 3QB3A 1SYGA 4ABNA 4K0KL 2ZXRA 1I4XA 2WINB 5GADC 1WVLA 4JI2Q 4Z9CB 5ELNA 1JT8A 3K7AH 3VYTA 2CHBD 4X66L 3OTOQ 3T1YL 1PFSA 3W5OA 1ICFB 3KLSX 1K8GA 4CKEA 2NVTH 4BBRB 1J9OA 3I4MB 1IZ6A 4GLVB 5ELFA 4C3IH 1UE7A 5EPKA 2E5LL 4JI1L 4KHVA 3EVQA 5I2XA 1S5ED 3Q23A 2BE5D 5CV7A 3I4NG 1TQOA 3OWFA 4HCSA 1SYBA 3S1NH 3VR2A 1Q86C 2O2LD 4HEDA 2KHJA 1JC7A 5M5YH 1NR2A 1BBWA 1QWYA 1CQVA 4CHTB 3FKIB 1JJCB 2NVYB 2B3GA 3HZXA 4BA2I 1V1OA 2A69C 4MN3A 3I7FA 2FJ2A 3K0XA 2JP1A 1HXYD 1V43A 1YI2A 4LF5Q 2B2UC 1JJ2A 4JV5Q 2UXCQ 1CKMA 5I6WA 1HNXL 4QY7A 2Z6BA 5IWAQ 3TRZA 5JAVA 2EIFA 5EKLA 2ES2A 4DKAC 3CCSA 4LMQD 1UE6A 3D6CA 2QF7A 4DNRB 1VQFA 1GXDC 1NUCA 2HQEA 3NWSA 4WJWA 1RODA 3LGJA 3TMEA 4DR5Q 5FO9B 4NDXA 4DR7L 3NQTA 3OWEB 1RF2D 3C1FA 4JBWA 1PZJD 1CKNA 3K0YA 4AYBE 3MXUA 1SE8A 1NSNS 4V190 3E9IA 3QOLA 5A2QE 2Q2HA 3E5SA 1B53A 1WTQA 2HHHQ 1TY2A 2WKCA 5E4XA 2Q8RE 4ZAIA 4XT3B 1JB3A 4XQNA 2NVTB 1AEXA 1TU2B 3CCRA 5BN3A 2MQHA 1GVPA 3V96A 1U4MA 1EYGA 4FDBA 1YZ6A 3G6EA 4POFA 1NCVA 3QG1A 4FXKC 4A3MB 2UUBQ 1VQIA 2GVBA 4GKKL 2FMMA 2Z1CA 1J8IA 1MSGA 2DJGC 3TEHB 4C3JH 2K5WA 4CDEC 1FJGL 3S16H 5CV5A 2KVMA 5ELOA 1SYCA 5I6YA 1IBLQ 2F0NA 5M5XB 2K4KA 1MHWC 3JAME 5A35A 2OTLA 1ASZA 2FXQA 2R6GA 4LFBL 4CKBA 3HRZC 4FF4A 5IGEA 2B63G 1OO9B 1U4RA 2EJFC 3TSSA 2OCEA 1G2SA 3I8ZA 5C4HA 1VQEA 3GTLB 3Q0AA 1B7YB 4R8NA 3S1QB 3LNNA 1WTWA 1W3SA 4NB3A 4DR3L 3P75A 2Q2TA 2OWOA 4DR4Q 3N52A 1IL8A 1YNXA 4IURA 2JA7H 2PI2E 3I4NH 1C9OA 3BDLA 1O80A 5JJLA 1SMYD 3X3MA 1RHPA 4HJAA 1D5ZC 2AKWB 5IP9G 1EEID 4IJHA 1UAPA 2L9HA 3SHLA 2AMCB 2WKDA 2ZJRA 1PRTD 2J7ZA 4EGVA 1Q7YC 3TBIB 1I4RA 3CQZH 4J8QA 1BCPB 3R93A 5IYBG 4H44C 1DXMA 2CQAA 2KCNA 5KIXA 1EY0A 4B3TQ 3U4ZA 2WB1E 5IOCA 4M8AA 3PO2G 2J4XA 2AUKA 1RTOA 1ET6A 1LTLA 3CRLC 3E0JA 2KEEA 4H13C 4GN5A 4IOCA 4HMJA 1SE2A 4ZLTF 1FGBD 5I9OA 4Q5VA 1EY6A 3A8IE 5BR8L 4O1NA 3LX0A 1JE4A 1N34L 3STBD 1RIPA 4A3BH 5EKIA 2IJ0A 4GOPC 2DN8A 1IKMA 2L11A 1TWHB 2UUAL 3HOYG 1ESRA 4JI3Q 4APVA 3EJIA 3D4DA 3NE5B 4QUFA 5C5LA 5KEEA 5C5MA 4JC0A 1IW7D 3SR1A 3NTKA 4KKUA 4JI7L 2YV5A 4C3HG 4DF7A 3T53B 1Q1BA 1PYWD 2KUMA 4OONA 3ULPA 3A7AB 2N8NA 4R1JA 3OTOL 2A6EC 4LF7Q 2EYFA 4A93B 1VCIA 4FVMA 3J80i 1A62A 2RBMA 1VQ9A 1QOHA 2MO1A 3AFQA 3PQIA 3PV0A 5G3LD 4EVOA 3J80L 1YHQA 4L5SA 4NXNQ 5FKAC 2PW7A 3NELA 1KL9A 4ME3A 1YNJC 2PPBC 1CZGA 5NUCA 1KQSA 2OQKA 3VR5A 3EBEA 3K5LA 1C7YA 2F0OA 1ZEQX 3T16A 1E1TA 3ND8A 3PUWA 5J1ZA 1WTPA 3CD6A 2MO0A 5EQ0A 2B63H 2E8GA 1NMFA 3PO3B 4FYDA 2NVQB 2VS1A 3MHBA 4DK6C 2D0OA 4A3FB 1JWSD 1VQBA 1QVFA 4GNXC 3HOVB 1KAAA 3M9BA 4UP8A 1CSPA 3L0OA 5IT9c 3P1HA 1S72A 2YU9B 4JV5L 1X3FA 3GTQH 1TXYA 5C4ZA 2JA8G 2MP1A 1SNCA 3KLRA 5IP9H 5IWAL 4UY8C 4P72A 2G9HD 3NTIA 1CKNB 4KTAA 1KC8C 1XWEA 4XDXA 4JI4Q 3GTGH 1FGUA 4ZUJA 3C46A 1HFGA 3GTJH 3CPFA 5IYBH 4K2LA 1L0XB 1JWMD 1S5FD 3W3AA 1IBKQ 3GV3A 1X54A 4OIJA 3PO2H 3K8AA 1VQGA 4HR7B 2R93G 3KUPA 2AQ2B 5C4XG 2NN6I 4JBMA 5CGKA 4OX9Q 1I94L 1II3A 4NKLA 1X65A 5CORA 4CBVA 1H9RA 3RZOH 4GS3A 3F2UA 2K5DA 5C44G 3GP7A 4HAEA 5EPJA 1B3AA 2L0CA 3RD4A 1D5MC 5DM73 5EPLA 2R7ZG 1LTAD 1HTPA 4NW2A 4R4OA 1GOZA 2K5HA 2L1BA 2K52A 3D3RA 1V8QA 1TWAH 1LTSD 1DYQA 2NTSA 2R7FA 3HOYH 1HR0Q 1X56A 2B2UA 1PA6A 4CDCC 4DV7Q 1J5EQ 1K3BC 1EU3A 1HQMC 4IPHA 1B9MA 4ULLA 2ALYB 4C3HH 5IGFA 3KYHC 3A5UA 4X3TA 1K83H 2L5TA 2JEAI 4B9WA 4X66Q 4DUZQ 2EZVA 3T1YQ 1GO3E 3K5MA 1Q46A 3VR6A 1EQQA 1AZQA 1XMQQ 2X69A 5M3MB 2CWPA 1O78A 3TN2A 3S2HB 2MUYA 1PH7A 2O4XA 2PZUA 2E5LQ 3KF6A 4HJ7A 4JI1Q 3OW2A 1I3QB 3N6RA 2XWJB 3V2TA 2AQ1B 4DR4L 1HA6A 3CCMA 3RNUA 2QGQA 3SDZA 4DNTB 3H3VC 3DUZA 5JVH3 2VY3A 2V1CC 3AYHB 5BN4A 4DR2L 3GTGB 1DJRD 4A3DB 3GTOH 3I4LA 3GTJB 2F0HA 1I6HH 1DM0B 1SJHD 1F9QA 4YWKA 1BKBA 2ZTEA 3SE0A 1H9MA 2CKZB 2PCFB 4XQQA 1K9MC 4G7OC 1HTLD 3RZOB 3H09A 2F3VA 1O7LA 1HNXQ 2RSNA 2OTJA 3EFXD 1C48A 2JA6B 1D7QA 4A3CG 4CJ0B 3M3YB 3GDEA 4HIKA 1LTTD 4A75A 1FR3A 4X3UA 3H0GB 4CDDC 1AH9A 5IT9L 3J81j 3M4YA 4Y7NH 1LUZA 4ZUIA 2RCNA 4FF2A 3UE0A 1SN8A 2WAQE 1TKWB 5FLXL 3MAQA 2VB2X 1S4ZA 4OELB 4FF1A 2HIVA 4K8JA 5C4XH 2R93H 1DOMA 1Y14B 1MGSA 2D2CC 4G57A 3CCVA 1BOSA 3L7ZC 3LWEA 1S5BD 2HQLA 3ERSX 5C44H 2MJ8A 3KBGA 1CTMA 4U68A 1CHPD 1I4GA 2EY5A 3CP0A 3ITPA 1D1KA 2A1AA 3DLLA 2QA4A 3K5OA 4DV6Q 4DA2A 1NR4A 4LF7L 1RJTA 3GO5A 2B8FA 1I6VC 2LS01 2JA9A 2OT2A 2R3ZA 1FJGQ 2K04A 3CPWA 2JEBI 4NXNL 1I50H 1JCKB 4LF4Q 3OYYA 4CJ1B 5E3FA 5GQOA 4CJ2C 5EAYA 4XXEA 4LFBQ 2VXWA 5DM63 1VQOA 3G6JB 4ZKCB 1U9RA 1H9SA 2ASBA 2JN4A 1CA5A 3DWPA 3K57A 4GOPA 1LLRD 3IL8A 3J7YW 2GVAA 4PG3A 2BH2A 1VQCA 2BDOA 4IFDG 1X32A 3NWTA 4QIWE 4DR3Q 2WV6D 3HOUH 2JA8B 4BWGB 1EY9A 4OO1I 4HJ8A 3S2DB 4HIMA 1AE2A 3A0JA 4C2MH 1DCZA 3MA2B 4EQ5A 1E3PA 5JJKA 1QCBD 5LMNQ 4A3JH 1PFNA 3PGZA 1WTRA 1K73C 3J81i 3GTMH 3NXWA 1N36L 1N32Q 4DK0A 1S5CD 4KJNA 2UU9L 3J81L 4H02A 2LKVA 3CCEA 3MEFA 1B1ZA 3KLSA 4JI4L 2HDMA 4IUUA 1QILA 3S1MB 1IBKL 3K58A 2XGTA 2PYKA 1TIID 1QE6A 5K5PA 2Y0SB 5ISRA 4A3CH 1SYDA 3NENA 4OX9L 2R7ZB 2I0QA 3S17H 4BA1I 4KK7A 1BVSA 4KKTA 5BR8Q 2R61A 1ILPA 3D4RA 3VA5A 1GUSA 1F9SA 3RZDB 3CF5A 2F03A 4GNXA 2HT1A 1Z47A 1G6PA 2UUAQ 4JBJA 1KNEA 1CKOA 2Z4HA 3CAMA 4C3JG 1Y1VB 1EOVA 3Q24A 1WCMB 2SOBA 3SK4A 1EUJA 3E6ZX 5EBDA 3QOJA 4DV7L 1J5EL 1PYSB 4DN4M 4B3SQ 1A63A 1D1IA 3NBHA 3ZYYX 3GD7A 2RVLA 4KLKA 4JI7Q 4RKBA 2M9VA 3SXHA 2NVXH 1TWFH 2E74C 2FMCA 2OF1A 4LW1A 1KDCA 1CT1D 2MFIA 4DUZL 4AYBG 2ZXPA 2O5JC 2PZTA 1PXUA 1VQMA 4A3IG 1XMQL 4IUVA 2EJMA 1KIXA 5FJ8G 5IYDG 3CCQA 1IYVA 4DFAA 1LT5D 4C2MB 1LTGD 1E2VA 1NNXA 5KRUA 4RHRA 2JA7G 1HH2P 5I9PA 1RTNA 3GTMB 2RA4A 1MI2A 4IPDA 3HOZG 3EN2A 3IFDA 1CA6A 4FNFA 5EJWA 3GTPH 2X6LA 1YBYA 1JB7A 5T1IA 1QVGA 1EZ8A 1Q1EA 4JI5L 3TZDA 3CCLA 3MWYW 1RCVD 2F0IA 2QEXA 2MNAA 3HS0C 1G2TA 1NE3A 3DMUA 2R92G 2YTVA 1K8MA 4K5XA 1IKLA 1PH9A 1VQAA 4IFDH 3JC66 2L4NA 1IXRA 3CC4A 4JOIC 1TS4A 5IGGA 1HR0W 3HOWG 3S14B 1XJVA 1IBMQ 4LF9L 4KD3A 5D3IB 4YHHQ 2H4OA 5FO8B 2I5MX 1JICA 1EZ6A 3I55A 2DNEA 2E2HB 3TP7A 3NPPA 1HJPA 4WFN3 1XYIA 4MTKA 4ZRZA 1HPCA 4EQNA 4A3BG 4F88A 3KF8A 2PI2A 2RHSB 2MHVA 4DV3Q 1PTOF 1JOOA 1G291 3NBIA 4PNYA 1PTOC 1JOKA 1NY4A 3KFUA 1T5XD 3A56A 1HUMA 3JAMc 1I94Q 4JG2A 2R7DA 1E2ZA 3K7AB 3R8BA 1MJEA 4RCNA 1YNJD 1EFID 1BF4A 1Q8KA 1QVCA 4PZ7A 4KY6A 1L0WA 2WB1G 1F2MA 1BCPD 1FNWA 3GQBA 1PMRA 1EEFD 4C3IB 4DV6L 3P7JA 3T56B 2MGSA 3AB9A 5ELCA 2E2JH 1XNQQ 4LFAL 1KDBA 2EYPA 3T1HL 3R2TA 2ZXOA 3S1NB 1Y8OB 1B44D 4Q0FA 1GM5A 1A15A 4GOPB 2F0WA 3A74A 4LF4L 4IUNA 2K5NA 5M5YB 4A4IA 1EWHA 1LV9A 5JVG3 1EY4A 1ENCA 3I91A 1JMCA 2F4IA 4G7HC 1KXLA 2IX0A 2TSSA 4KY7A 2K05A 1H9JA 4A3IH 1VQPA 3WWVA 5FJ8H 3K5NA 1LM0A 4A3KG 5IYDH 1AP0A 2ZJQA 4IUQA 3GTKH 4B3ML 2F0VA 1XMOL 4RGOS 1EQRA 3S15H 2K33A 5D65A 2Q8TA 3U4VA 4V0BA 4DK1A 3M85A 3FRPB 3J7A5 5EGTA 3IRBA 5HGTA 1YNND 4DAYA 3PUVA 3I3CA 4EQPA 4DGZA 3MFYA 3HOZH 2UXBL 1PH6A 3J80E 4DK3C 4DR2Q 1ZYRD 3K59A 3MVVA 5LMNL 3ULJA 4JI8Q 1N32L 1K0RA 2EYHA 1GHJA 2F0QA 2R92H 3QO2A 5GROA 2Q8IB 3WDNA 2K1BA 1HNWQ 1A8VA 1PHJA 3X3NA 4QQBX 4I65A 4XYQA 1HNZQ 2JA5G 4GN4B 2XN9C 3HOWH 4HIOA 2XWBB 3MXNA 4GNXB 1BQQT 3ER0A 2AHOB 4YCWA 3TZUA 1EYDA 4QCLA 2HCIA 1VQJA 3AU7A 4FF3A 4O2DA 1W6JA 1STHA 2LSSA 2BE5C 1I4PA 4MZ9A 3DEPA 1W2BA 1A2TA 3EA6A 4C3JB 2PMZE 4N8FA 3I2ZA 3S16B 3H3VH 3S9WA 1TS3A 2A19A 1Z9FA 1SRUA 4K2KA 2CW0D 3HOXG 2KA7A 4IUTA 1I5FA 2F0SA 1NBWA 3ERQA 1W6KA 4B3SL 3EROA 2F0DA 4AYBB 2F0TA 1U0LA 3UDXA 2A6HD 1HA5A 1OXSC 3UDFA 3JAMi 3CCUA 4A3IB 1MKHA 1SMXA 4L5TA 1KHIA 1M8AA 4KN4C 3BJUA 1SYFA 3G71A 4TVAB 3BZDB 3RLOA 4DV5L 5FLMG 4LUZA 1AN8A 3S1RH 4UP7A 1IYJB 2JA7B 3I4NB 5LHY1 3TP8A 5C3EG 1B4OA 1WTXA 4CGYB 1PH4A 5E7NA 1ESFA 1I4QA 2DY8A 5IGDA 2BDNA 1AW7A 4P73A 3TQYA 1N33L 3NP8A 2B29A 2QILA 2R92B 1EOTA 2G9DA 2KJXA 2K03A 1SEBD 3KLWA 1WTOA 1D2BA 3CQZB 2LXJA 2VUMG 2J0TD 4A3KH 3U9SA 2BA0A 3M7NA 4DXFA 1IL2A 1LT4D 4A3GG 1Q81C 1NTGA 2VZAA 2YTYA 2I46A 2KHSA 1V1PA 2K01A 4C1NI 1VDZA 4BY7H 2IWHA 1UEAB 1BR9A 1SJED 1FL0A 3NEMA 3SGIA 4C1NK 1XNRL 2NN6G 2ICIA 1IBML 2A5HA 5DNFA 1B2TA 3UI2A 4YHHL 2NWGA 1YHBA 5CYUA 4AH6A 1N36Q 1VF5C 3I90A 4A3BB 5M3FG 2UU9Q 1CZWA 1GKHA 1D8LA 4IN3A 4DNIA 3V05A 4IALA 1QNKA 1SNDA 1RL2A 1TWGH 2QKIC 4PZ8A 4TKOB 2O5IC 1ICWA 4LFCQ 1ILQA 2GN5A 1G51A 4DV3L 1SFOH 2JA5H 2JE6I 4N8X1 5J3BA 4J1MA 2KHIA 1D6EC 2YYZA 2B8GA 1QG7A 2TMPA 4DV1L 2BA1A 4IO9A 3WOFA 1L1OC 1SAPA 2IHFA 3E9HA 1SMYC 2JSOA 2F1MA 1KLUD 2FINB 1O7ZA 4AQYL 1SNMA 2X6GA 2RDFA 3R3OA 2F0FA 3TS0A 1XNQL 5IT9E 4JOIA 4RA8A 1HHVA 3ND9A 3HOXH 1PRTF 3CMEA 1JWUD 3DM3A 5M5WH 4RAUC 1PRTC 4F7XA 1OXXK 1F9RA 3J7AV 3Q8DA 5FLXE 1YVCA 1JQYD 2HDLA 2WAQG 2HIXA 2B63B 1PH2A 4HN7A 3RLNA 4A3KB 3RMHA 1Y1WG 2XSCA 3VA7A 2ZJPA 3IAYA 3M4OH 4DAYB 3HKZG 5FLMH 4ZQ3A 2F0LA 4JBKA 4TSSA 4YIJA 5C3EH 3RR5A 4B9XA 2VNUD 3GTQB 3HOUG 5L37A 2A68C 1GUTA 3PIP3 4PMCA 4I7ZC 3STBC 2M00A 1WOCA 4LK1C 3CU7A 3WOEA 5KGUA 3AMUA 3MFGA 4RFBA 4A3JG 4LUOA 4JI5Q 2VUMH 4JI8L 1GUOA 4R8IA 3A8JE 2EYJA 1OXTA 4NXMQ 3FPPA 1NJIC 3MXNB 4ILWA 1XTDA 2V4DA 1SFOB 2JA5B 3I4MG 3H15A 4A3GH 2D62A 3PO2B 1IW7C 1M1KC 2F0UA 1HNWL 2JK8A 3F2CA 2F52A 4N9PA 1BUVT 1HNZL 3RUZA 1DD2A 4LF9Q 2B2TC 2NN6H 2B2VC 3FMCA 5CBAE 1LT6D 1PH8A 1M90C 5M3FH 1K8OA 4LUVA 1WI5A 1TS5A 1I4HA 4K5WA 1KTKA 1TWAB 3HOYB 4WJ4A 3FKIG 2IX3A 4QUCA 2K5VA 5JOBA 1EY5A 4IUPA 2EYMA 2NZOA 4LF8Q 1PH5A 3MXGA 5IP7G 3ULLA 1C4QA 1GJXA 3RN2A 4RMFA 4R4QA 3J81E 5HGQA 1QUQA 1G91A 1BBUA
chains in the Genus database with same CATH topology
4C3HB 1K83B 2E2DC 5CV9A 5HURA 3PUXA 3M4OB 4KY5A 4PMBA 5C3EB 1NAPA 3MEHA 2N55A 4RH6A 4S3SA 4K6DA 2A69D 4J6HA 2F0GA 1XXGA 4OO1G 1SNOA 4EQOA 3GTOB 5EBCA 1KABA 4G7ZC 2VUMB 1I6HB 2F0PA 2WACA 4P2CB 3OIQA 1VMCA 3I70A 1V1PB 4A3GB 1PTOH 4K8IA 1SBBB 2KOLA 3CKIB 5E4WC 3QWNA 3H91A 3C3LA 5C0XG 5M3FB 1WD0A 1X3QA 3T51B 5IGBA 3FPUB 4Y7NB 2IX1A 2K32A 1Z7TA 1EL0A 2R93B 5C4XB 2F3WA 1RDPD 1E0BA 5I2YA 2ID0A 5C44B 3A8KE 1LACA 1WTVA 1KLGD 3NUCA 1B50A 4CKCA 5JEAG 2F0KA 1CM9A 5IGCA 3OHXC 2KEDA 3A7LA 5FK9C 1UNSA 2OEOA 1I50B 4RKLA 5J39A 2SNSA 2EPBA 2WAQB 4ID6A 1AZPA 1IHZA 3OPOA 5EKKA 2NZ1D 3C2PA 2FFKB 1ML0D 2B2WC 2WIIB 2IL8A 1DZ1A 3D8GA 1PTOB 3PMFA 2Z4IA 5C4JB 1LTRD 3HOUB 1EYAA 2SDFA 4IZ8A 2LY7A 2IPKD 2SEBD 3FDTA 5CMDA 3ONAB 4OO1H 4RGTA 2RKSA 4UDUC 4A3JB 3DWAA 4OHJA 3VR3A 3T4AC 2L12A 3OMGA 2PO4A 1EY7A 4KV6A 1EIHA 3IKJA 4KN7C 3FVQA 4K5VA 4C56C 1O7YA 1Q12A 5JPMC 2IT1A 3SK8A 1PZID 3S17B 3L3OC 1DOKA 4QIWB 5C0XH 1PZKD 3VYRA 1SDFA 3OW7A 2NUCA 3DWQA 5KNDA 2EY1A 4ODGA 1LT3D 5IIFA 1OXUA 4R9WA 2PZWA 1TY0A 1TT2A 5M9OA 2OXPA 1FYCA 1RKNA 4WORA 2A6ED 1A6XA 1U4PA 3SEBA 1R4QB 4F87A 1HQRD 1WD1A 2NVXB 1TWFB 5JEAH 1HRJA 1EQVA 1EWCA 1XX8A 2AWNA 2XRSD 4N9TA 3W2DA 1STNA 2NYZD 2K7VA 3OSOA 3BVGA 5KYIA 2E76C 1Y8PB 1H9SB 2B2TA 3H6MA 3NHHA 2B2VA 1EU4A 3SVMA 1ZXTA 3GTPB 3G7LA 4IQZA 1Y69U 1L0YB 2IW3A 4U673 5CBEE 1ENFA 5JPNC 2EXZA 2QEJC 3TP6A 3PUZA 2C5CA 2C9OA 1HUNA 4NMZA 4IFDJ 1STBA 3BVMA 1EQTA 1STYA 1CI3M 5C0XJ 1STEA 1LO5D 2L55A 3D6WA 1RD9D 1XTCD 1VF7A 1TS2A 1STGA 1CHQD 3VR4A 4QMGA 2A74C 1LTBD 2I07B 2LFNA 4X3KA 1C8CA 3NTHA 1SXTA 5JEAJ 1R9TB 4OGQC 3R2IA 4L6TB 1QNUA 3BVZA 2A73B 5A2QL 4LAAA 2VB3X 2FHTA 4H7BA 1SYEA 5KYLA 3DHQA 1Q90A 3QIAA 2E2JB 2PW5A 5KNBA 1SE4A 1F77A 2RDHA 5LL6X 4DU9A 2XVSA 2A68D 1LABA 2AUJD 2B2YC 1EYCA 1TR5A 3DM1A 2B39A 3JAML 3GTKB 3OOCA 3S15B 2EOTA 4OIKA 5C3WA 3D31A 4ZKBB 4FXDA 2D5DA 3HOZB 2EYLA 4PV1C 5DEHA 2ENBA 3A54A 3RLFA 1H9KA 2NTTA 2XNAC 1PRTB 3BG3A 4FO2A 1HCZA 1DOLA 1GUNA 3NK9A 3SK6A 1CK1A 2EE1A 2HCCA 3HOWB 3PIO3 5I4DA 4XT1B 1FNUA 1BCPF 2EJGC 3U9OA 2LMCB 2GA4B 1MD2D 1BCPC 4HSVA 1CFMA 5D14A 1PDQA 1HFNA 4NP5A 5C6AA 1PFMA 1PFBA 2B2WA 2JYOA 5AFWA 4OL7A 2EVBA 3KBXA 4RGMA 1F2YA 4ZYSA 1BO0A 3BYTB 2DY7A 1F2ZA 5D3DA 4HTHA 3BYYB 1Q3LA 4KJOA 1BDOA 1JOQA 4KKSA 4M1UB 1ET9A 5CV4A 1TVXA 1FNVA 1QJOA 2EY6A 2WB1B 2XIWA 4XIGS 2KCCA 3O13A 1M4VA 1B9NA 1SE3A 3MC0B 3S1RB 1YNNC 1Q8IA 2ZT9C 1ZYRC 4K14A 1SSOA 5ELDA 2D9UA 2PMZB 4O42A 4XYOA 1LTID 5LL6S 2RQXA 4PMWA 4F8MA 4WRDA 3CHBD 2H1EA 2E2IB 5BN5A 1GUGA 3C1EA 4ZK9B 1UUPA 5KNCA 2EDGA 5TSSA 1T5EA 1X3PA 5ELEA 2KQ3A 4L8JA 5E1FA 1SNPA 4KI0A 3EQLC 4XQJA 4BY7B 2MPMA 4RWSC 1G6ZA 1G8ZD 1D5XC 3D4WA 4FXGC 4RCOA 1MBYA 4HSPA 3GV6A 2PNRC 3QJYA 5T1GA 4RGNA 3OIPA 1BXTA 1TWGB 4DXGA 3J7AF 2CW0C 4MIUA 5J22A 3MTSA 3Q22A 4X3SA 4TRDA 4KMUC 4H0LC 4BBSB 5FO7B 1KDAA 3HG9A 2A6HC 1VMPA 1F9PA 5IODA 1S5DD 4L63B 4JK1C 2E75C 1F2LA 3VYUA 4E6IA 5CR3A 4PQXA 5G3LF 5CC4A 4FP5D 1TWCB 3DXJC 3Q6SA 2AWOA 1BNZA 1CQFA 4KD4A 1MSHA 4B08A 3HOXB 4UAIA 5M5WB 5JJZA 2XRQD 3MXPA 5C3XA 2F0JA 4LJZC 4QB4A 2CVRA 1FD7D 2BCOA 3KK7A 4KHZA 3HP3A 1ZKOA 5K36G 4DAPA 1R4PB 2K5QA 1A2UA 4XTCS 3NQIA 3A55A 5FOBB 3H94A 4RHSA 3MZ5A 3PUYA 4DAVA 4G4KA 2Z8LA 2M2LA 2K28A 1U4LA 1AFPA 1EY8A 2F0MA 2KECA 2EYOA 1QB5D 5F2DA 3VYSA 1ENAA 4C3IG 1JORA 1A3UA 1SNQA 1A3TA 4HMIA 3T13A 4K6LA 2ICEC 1E2WA 3TP5A 2SNMA 5COYA 1PTOD 2B2YA 1DONA 2QDBA 3FEWX 1A3VA 4HCEA 4A3EB 1Z6HA 2K6AA 1KNAA 3I72A 5CV6A 2JXMB 1STAA 3CRKC 3DEOA 3BDCA 1PLFA 1Y8NB 1GUWA 3OMCA 3LWUA 5CV8A 3NSWA 2BOSA 3URYA 4ME5A 2AQ3B 3HEJA 1JR0D 4TQUS 3P20A 2PQEA 3BDOA 4IFDI 2F0EA 2NB0A 3SK5A 1GHKA 3BS1A 3TDQA 2NBFA 2DNCA 1IYUA 4MHEA 5C0XI 1BBXC 1ONLA 3L9AX 2QCPX 3IFTA 3I73A 2RSOA 4BY1B 1EIGA 3M7GA 1OXVA 3K6OA 2WP8J 4QF4A 1Y1WB 2HUGA 3HKZB 5K36H 2EY2A 2RDGA 5DAUA 5ELBA 4GZYC 2N88A 4BS9A 3HGBA 3QB3A 1SYGA 4ABNA 2ZXRA 1I4XA 2WINB 1WVLA 4Z9CB 3VYTA 2CHBD 3KLSX 4CKEA 4BBRB 1J9OA 3I4MB 5ELFA 5EPKA 4KHVA 3EVQA 5I2XA 1S5ED 3Q23A 2BE5D 5CV7A 1TQOA 3OWFA 4HCSA 1SYBA 3VR2A 2O2LD 4HEDA 1JC7A 1NR2A 1QWYA 1CQVA 4CHTB 3FKIB 2NVYB 3HZXA 4BA2I 1V1OA 2A69C 4MN3A 2FJ2A 2JP1A 1HXYD 1V43A 2B2UC 5I6WA 5JAVA 5EKLA 4LMQD 3D6CA 2QF7A 4DNRB 1GXDC 1NUCA 2HQEA 3NWSA 4WJWA 1RODA 3TMEA 5FO9B 4NDXA 3NQTA 3OWEB 1RF2D 3C1FA 4JBWA 1PZJD 3K0YA 3MXUA 1NSNS 4V190 3QOLA 5A2QE 3E5SA 1B53A 1WTQA 1TY2A 2WKCA 5E4XA 4ZAIA 2Q8RE 4XT3B 1JB3A 4XQNA 2NVTB 1AEXA 1TU2B 5BN3A 3V96A 1U4MA 1NCVA 3QG1A 4FXKC 4A3MB 2FMMA 2Z1CA 1J8IA 1MSGA 2K5WA 5CV5A 2KVMA 1SYCA 5I6YA 2F0NA 5M5XB 3JAME 5A35A 2R6GA 4CKBA 3HRZC 4FF4A 5IGEA 1OO9B 1U4RA 2EJFC 3TSSA 1G2SA 3I8ZA 5C4HA 3GTLB 3Q0AA 4R8NA 3S1QB 3LNNA 1WTWA 3P75A 3N52A 1IL8A 4IURA 3BDLA 1O80A 1SMYD 3X3MA 1RHPA 1D5ZC 1EEID 1UAPA 2L9HA 3SHLA 2WKDA 1PRTD 2J7ZA 4EGVA 3TBIB 1I4RA 4J8QA 1BCPB 3R93A 4H44C 1DXMA 2CQAA 2KCNA 5KIXA 1EY0A 5IOCA 4M8AA 2J4XA 2AUKA 1RTOA 1ET6A 3CRLC 3E0JA 2KEEA 4H13C 4HMJA 1SE2A 4ZLTF 1FGBD 5I9OA 4Q5VA 1EY6A 3A8IE 4O1NA 3LX0A 1JE4A 5EKIA 2IJ0A 2DN8A 1IKMA 2L11A 1TWHB 1ESRA 3EJIA 3D4DA 3NE5B 4QUFA 5C5LA 5KEEA 5C5MA 3SR1A 1IW7D 3NTKA 4KKUA 4C3HG 4DF7A 3T53B 1Q1BA 1PYWD 2KUMA 3A7AB 2A6EC 2EYFA 4A93B 1VCIA 4FVMA 2RBMA 1QOHA 3PV0A 5G3LD 4EVOA 3J80L 5FKAC 2PW7A 1YNJC 2PPBC 1CZGA 5NUCA 3VR5A 3K5LA 2F0OA 1ZEQX 3T16A 5J1ZA 3ND8A 3PUWA 1WTPA 5EQ0A 3PO3B 4FYDA 2NVQB 3MHBA 4A3FB 1JWSD 3HOVB 1KAAA 3P1HA 2YU9B 5C4ZA 2MP1A 1SNCA 3KLRA 2G9HD 3NTIA 4KTAA 1XWEA 4XDXA 4ZUJA 3C46A 1HFGA 4K2LA 1L0XB 1JWMD 1S5FD 3W3AA 3GV3A 4OIJA 4HR7B 3KUPA 2AQ2B 2NN6I 5CGKA 1II3A 4NKLA 5CORA 4CBVA 1H9RA 3F2UA 2K5DA 3GP7A 5EPJA 4HAEA 1B3AA 2L0CA 3RD4A 1D5MC 5DM73 5EPLA 1LTAD 1HTPA 4NW2A 1GOZA 2L1BA 3D3RA 1V8QA 1LTSD 1DYQA 2NTSA 2B2UA 1EU3A 1HQMC 1B9MA 4ULLA 5IGFA 4X3TA 2L5TA 2JEAI 4B9WA 2EZVA 3K5MA 3VR6A 1AZQA 2X69A 5M3MB 1O78A 3TN2A 3S2HB 2MUYA 2O4XA 2PZUA 1I3QB 3N6RA 2XWJB 3V2TA 2AQ1B 1HA6A 3SDZA 3H3VC 4DNTB 3DUZA 5JVH3 5BN4A 3GTGB 1DJRD 4A3DB 3I4LA 3GTJB 2F0HA 1DM0B 1SJHD 1F9QA 3SE0A 1H9MA 2PCFB 4XQQA 4G7OC 1HTLD 3RZOB 3H09A 2F3VA 1O7LA 2RSNA 3EFXD 1C48A 2JA6B 4CJ0B 3M3YB 1LTTD 1FR3A 4X3UA 3H0GB 5IT9L 3M4YA 4ZUIA 4FF2A 1TKWB 5FLXL 3MAQA 2VB2X 1S4ZA 4FF1A 4K8JA 1DOMA 2D2CC 1MGSA 4G57A 1BOSA 3L7ZC 3LWEA 1S5BD 2MJ8A 3KBGA 1CTMA 4U68A 1CHPD 1I4GA 2EY5A 3ITPA 1D1KA 3K5OA 4DA2A 1NR4A 1RJTA 3GO5A 2B8FA 1I6VC 2LS01 2OT2A 2R3ZA 2K04A 2JEBI 1JCKB 4CJ1B 5E3FA 4CJ2C 4XXEA 2VXWA 5DM63 3G6JB 4ZKCB 1U9RA 1H9SA 1CA5A 3DWPA 3K57A 1LLRD 3IL8A 3J7YW 2BDOA 4IFDG 1X32A 3NWTA 2WV6D 2JA8B 4BWGB 1EY9A 4OO1I 3S2DB 1DCZA 3MA2B 1QCBD 1PFNA 1WTRA 3NXWA 4DK0A 1S5CD 4KJNA 3J81L 2LKVA 1B1ZA 3KLSA 2HDMA 4IUUA 1QILA 3S1MB 3K58A 2PYKA 1TIID 1QE6A 5K5PA 2Y0SB 5ISRA 1SYDA 2R7ZB 4BA1I 4KK7A 4KKTA 1ILPA 2R61A 3D4RA 3VA5A 1GUSA 1F9SA 3RZDB 2F03A 1Z47A 1KNEA 2Z4HA 4C3JG 1Y1VB 3Q24A 1WCMB 2SOBA 3SK4A 3E6ZX 5EBDA 3QOJA 4DN4M 1D1IA 3NBHA 3ZYYX 3GD7A 2RVLA 4RKBA 2M9VA 3SXHA 2E74C 2FMCA 2OF1A 1KDCA 1CT1D 2ZXPA 2O5JC 2PZTA 1PXUA 4IUVA 2EJMA 1IYVA 4DFAA 1LT5D 4C2MB 1LTGD 1E2VA 5KRUA 4RHRA 5I9PA 1RTNA 3GTMB 2RA4A 1MI2A 3IFDA 1CA6A 4FNFA 5EJWA 2X6LA 5T1IA 1EZ8A 1Q1EA 3TZDA 3MWYW 1RCVD 2F0IA 3HS0C 1G2TA 3DMUA 1K8MA 4K5XA 1IKLA 4IFDH 2L4NA 1TS4A 5IGGA 3S14B 4KD3A 5D3IB 2H4OA 5FO8B 1JICA 1EZ6A 2DNEA 2E2HB 3TP7A 3NPPA 4WFN3 1XYIA 4ZRZA 1HPCA 4EQNA 4F88A 3KF8A 2MHVA 1PTOF 1JOOA 1G291 3NBIA 4PNYA 1PTOC 1JOKA 1T5XD 3A56A 1HUMA 1E2ZA 3K7AB 3R8BA 4RCNA 1YNJD 1EFID 1BF4A 4KY6A 1F2MA 1BCPD 1FNWA 3GQBA 1PMRA 1EEFD 4C3IB 3P7JA 3T56B 2MGSA 3AB9A 5ELCA 1KDBA 2EYPA 3R2TA 2ZXOA 3S1NB 1Y8OB 1B44D 4Q0FA 1A15A 2F0WA 4IUNA 5M5YB 1EWHA 1LV9A 5JVG3 1EY4A 1ENCA 3I91A 2F4IA 4G7HC 2IX0A 2TSSA 4KY7A 2K05A 1H9JA 3K5NA 1AP0A 4IUQA 2F0VA 4RGOS 2K33A 5D65A 2Q8TA 4DK1A 4V0BA 3M85A 3FRPB 5EGTA 5HGTA 1YNND 4DAYA 3PUVA 3I3CA 4EQPA 4DGZA 3MFYA 3J80E 1ZYRD 3K59A 3MVVA 2EYHA 1GHJA 2F0QA 3QO2A 2Q8IB 3WDNA 2K1BA 3X3NA 4I65A 4XYQA 2XN9C 2XWBB 3MXNA 1BQQT 3TZUA 1EYDA 4QCLA 2HCIA 3AU7A 4FF3A 1W6JA 1STHA 2BE5C 1I4PA 3DEPA 1A2TA 3EA6A 4C3JB 3S16B 3S9WA 1TS3A 4K2KA 2CW0D 2KA7A 4IUTA 2F0SA 3ERQA 1W6KA 3EROA 2F0DA 4AYBB 2F0TA 2A6HD 1HA5A 1OXSC 4A3IB 1M8AA 4KN4C 1SYFA 3BZDB 1AN8A 2JA7B 3I4NB 5LHY1 3TP8A 1B4OA 1WTXA 4CGYB 1ESFA 1I4QA 2DY8A 5IGDA 2BDNA 1AW7A 3NP8A 2QILA 2R92B 1EOTA 2G9DA 2KJXA 2K03A 1SEBD 1WTOA 1D2BA 3CQZB 2J0TD 3U9SA 2BA0A 3M7NA 4DXFA 1LT4D 2I46A 2KHSA 1V1PA 2K01A 4C1NI 1VDZA 2IWHA 1UEAB 1BR9A 1SJED 4C1NK 2NN6G 2ICIA 2A5HA 5DNFA 1B2TA 3UI2A 2NWGA 5CYUA 1VF5C 3I90A 4A3BB 1CZWA 4IN3A 3V05A 4IALA 1QNKA 1SNDA 2QKIC 4TKOB 2O5IC 1ICWA 1ILQA 2JE6I 4J1MA 1D6EC 2YYZA 2B8GA 1QG7A 2TMPA 2BA1A 3WOFA 1SAPA 1SMYC 2JSOA 2F1MA 1KLUD 2FINB 1O7ZA 1SNMA 2X6GA 2RDFA 3R3OA 2F0FA 5IT9E 4RA8A 1HHVA 3ND9A 1PRTF 1JWUD 4RAUC 1PRTC 4F7XA 1OXXK 1F9RA 3J7AV 5FLXE 1JQYD 2HDLA 2B63B 4HN7A 4A3KB 3RMHA 2XSCA 3VA7A 3IAYA 4ZQ3A 2F0LA 4TSSA 4YIJA 4B9XA 2VNUD 3GTQB 2A68C 1GUTA 3PIP3 4PMCA 4I7ZC 2M00A 4LK1C 3CU7A 3WOEA 5KGUA 3AMUA 3MFGA 4RFBA 4R8IA 1GUOA 3A8JE 2EYJA 1OXTA 3FPPA 4ILWA 2V4DA 1SFOB 2JA5B 2D62A 3PO2B 1IW7C 2F0UA 4N9PA 1BUVT 3RUZA 1DD2A 2B2TC 2NN6H 2B2VC 3FMCA 5CBAE 1LT6D 1K8OA 1TS5A 1I4HA 4K5WA 1KTKA 1TWAB 3HOYB 2IX3A 4QUCA 5JOBA 1EY5A 4IUPA 2EYMA 3MXGA 1C4QA 1GJXA 3J81E 1G91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AZQ A;  2X69 A;  4HED A;  3DEO A;  2FHT A;  1Q3L A;  3TN2 A;  1WTW A;  2FIN B;  1O7Z A;  1NR2 A;  1PLF A;  2KED A;  4CJ1 B;  2X6G A;  1WTP A;  1WD1 A;  1GUW A;  3Q6S A;  1A15 A;  3N52 A;  1M8A A;  4RA8 A;  1IL8 A;  4IUR A;  4IUV A;  5EQ0 A;  4CJ2 C;  1HHV A;  1HRJ A;  1XX8 A;  2VXW A;  1TVX A;  1BNZ A;  1O80 A;  4RAU C;  1HA6 A;  4ZKC B;  2EPB A;  2XIW A;  4MN3 A;  1AZP A;  1RHP A;  1F9R A;  1LV9 A;  1MSH A;  2FJ2 A;  2NYZ D;  2HDL A;  1NAP A;  1CA5 A;  2JP1 A;  4UAI A;  2B2U C;  3IL8 A;  1B4O A;  2NZ1 D;  3I91 A;  2L9H A;  2FFK B;  1ML0 D;  1WTX A;  2B2W C;  1RTN A;  2K05 A;  2N55 A;  2IL8 A;  1DZ1 A;  1X32 A;  1MI2 A;  2J7Z A;  2RA4 A;  5JJZ A;  2DY8 A;  2B2Y C;  4IUQ A;  1AP0 A;  3IFD A;  1CA6 A;  2BDN A;  3DM1 A;  5EJW A;  2X6L A;  5T1I A;  5D65 A;  1F9Q A;  2Q8T A;  3R93 A;  2MP1 A;  3TZD A;  3MWY W;  2CVR A;  4MHE A;  4LMQ D;  2B2T A;  1BBX C;  1SSO A;  2B2V A;  1EOT A;  2D9U A;  3SVM A;  4O42 A;  1G2T A;  2K03 A;  1ZXT A;  1WTO A;  2SDF A;  3HP3 A;  3G7L A;  1IKL A;  2EOT A;  2RSO A;  1VMC A;  1PFN A;  1ROD A;  3I3C A;  4OIK A;  1RTO A;  1WTR A;  2H1E A;  4XDX A;  3FDT A;  2KEE A;  2L4N A;  4ZKB B;  5CMD A;  2RSN A;  3ONA B;  1EIG A;  1HFG A;  5CBE E;  1G91 A;  4CJ0 B;  4ZK9 B;  2HUG A;  4ZLT F;  2HDM A;  2K01 A;  1X3P A;  2KOL A;  4X3U A;  5E4W C;  3GV3 A;  3QO2 A;  1HUN A;  4IUU A;  4OIJ A;  1B53 A;  4R8I A;  1JE4 A;  1JIC A;  3KUP A;  2K1B A;  2M2L A;  2K28 A;  3H91 A;  2L12 A;  5EKI A;  5E4X A;  1WTQ A;  2Q8R E;  4ZAI A;  4XT3 B;  5DNF A;  1EQT A;  1IKM A;  1B2T A;  5COR A;  3UI2 A;  1EIH A;  2N88 A;  1QE6 A;  2NWG A;  2L11 A;  3F2U A;  1WD0 A;  1U4L A;  2MPM A;  1ESR A;  3I90 A;  1B3A A;  2KEC A;  1X3Q A;  4HAE A;  4RWS C;  5EPJ A;  1XYI A;  1U4M A;  1O7Y A;  1G6Z A;  3FPU B;  1S4Z A;  5EPL A;  3D6W A;  1QNK A;  1WVL A;  3GV6 A;  1NCV A;  4NW2 A;  4QUF A;  1DOL A;  1DOM A;  2EE1 A;  2B2T C;  2HCC A;  1ILP A;  2B2V C;  1MGS A;  5T1G A;  2FMM A;  2HCI A;  2L1B A;  1ICW A;  4XT1 B;  1DOK A;  3LWE A;  1J8I A;  1ILQ A;  1MSG A;  5CBA E;  1F9S A;  1EL0 A;  2K04 A;  2MJ8 A;  1HUM A;  2KVM A;  1J9O A;  1SDF A;  4HSV A;  2KUM A;  2B2U A;  4U68 A;  5D14 A;  1PDQ A;  1HFN A;  3MTS A;  3DEP A;  1E0B A;  1PFB A;  1KNE A;  1PFM A;  2B2W A;  4X3S A;  5COY A;  1BF4 A;  2JYO A;  5EPK A;  2B2Y A;  5AFW A;  1WTV A;  4QUC A;  1VMP A;  4IUP A;  4R9W A;  1NR4 A;  4DN4 M;  1DON A;  1F9P A;  1RJT A;  4X3K A;  1B50 A;  1C8C A;  1QG7 A;  2RVL A;  4X3T A;  3KBX A;  4IUT A;  1U4R A;  4HCS A;  3P7J A;  2R3Z A;  1KNA A;  1U4P A;  1F2L A;  1BO0 A;  2MGS A;  1G2S A;  1CM9 A;  2DY7 A;  3I8Z A;  1SAP A; 
#chains in the Genus database with same CATH topology
 4C3H B;  3HKZ E;  1K83 B;  1V9P A;  2F3I A;  4DR6 Q;  2E2D C;  3UE1 A;  5CV9 A;  5HUR A;  2ZTD A;  3PUX A;  3M4O B;  3F8T A;  3AQQ A;  3K81 C;  4YY3 Q;  4KY5 A;  4P74 A;  4PMB A;  5C3E B;  3AEV A;  1NAP A;  3CCJ A;  4LFA Q;  4YWL A;  3MEH A;  2N55 A;  4RH6 A;  3T1H Q;  4S3S A;  4K6D A;  1YIJ A;  1E24 A;  2A69 D;  3KJO A;  4J6H A;  1VQ5 A;  1AE3 A;  2F0G A;  1XXG A;  4OO1 G;  1SNO A;  4EQO A;  4JCV E;  3GTO B;  5EBC A;  1KAB A;  4G7Z C;  4BY1 H;  2VUM B;  1I6H B;  2F0P A;  2WAC A;  4P2C B;  3OIQ A;  1Y1W H;  1VMC A;  2DGY A;  3I70 A;  1H95 A;  1PVO A;  1V1P B;  4A3G B;  1PTO H;  4K8I A;  1SBB B;  4B3M Q;  1XMO Q;  3BU2 A;  5C4J H;  4LWC A;  3W1G A;  2KOL A;  3CKI B;  1PH1 A;  5E4W C;  3ICE A;  1OTC A;  3QWN A;  3H91 A;  3C3L A;  4ALP A;  2Q2U A;  5C0X G;  5M3F B;  2UXB Q;  1WD0 A;  2CH4 W;  1EIF A;  1X3Q A;  3T51 B;  5IGB A;  4P71 A;  3FPU B;  4Y7N B;  2IX1 A;  4OXP A;  1VQ8 A;  2IY5 B;  5LMU L;  2K32 A;  1Z7T A;  3I4M H;  1EL0 A;  4YCV A;  1YIT A;  3U58 A;  2R93 B;  5C4X B;  2F3W A;  4LFC L;  5IYC G;  1RDP D;  1E0B A;  5I2Y A;  2ID0 A;  1VQN A;  5C44 B;  3A8K E;  1LAC A;  2PQA A;  4IPC A;  1WTV A;  1KLG D;  3NUC A;  4DV4 L;  1B50 A;  3QR8 A;  4CKC A;  3KDF A;  5JEA G;  2F0K A;  3K7U C;  1CM9 A;  5IGC A;  1SLJ A;  3OHX C;  4BXX G;  3FKI H;  1WTH A;  4DUY Q;  2NVY H;  2KED A;  3A7L A;  4UP9 A;  3L2P A;  5FK9 C;  1UNS A;  1CSQ A;  4GLA C;  2OEO A;  5IP7 H;  1I50 B;  4RKL A;  5J39 A;  3I4O A;  4DV2 L;  2SNS A;  2EPB A;  2WAQ B;  2P5Z X;  4ID6 A;  1YJ9 A;  1AZP A;  3UDI A;  1IHZ A;  3OPO A;  5EKK A;  4DR1 L;  5GAG C;  2KBN A;  2BH8 A;  2NZ1 D;  3C2P A;  1VQD A;  1VQL A;  2FFK B;  1ML0 D;  4JYA Q;  2B2W C;  2WII B;  4A3L G;  4L5R C;  2IL8 A;  3KF6 B;  1DZ1 A;  3D8G A;  1PTO B;  3PMF A;  3F2D A;  2Z4I A;  5C4J B;  1LTR D;  4DV5 Q;  3HOU B;  2PNH A;  1EYA A;  2SDF A;  4IZ8 A;  1HZC A;  3VDY A;  2LY7 A;  2UUC L;  2IPK D;  2SEB D;  2VL6 A;  3FDT A;  5CMD A;  3ONA B;  4OO1 H;  4RGT A;  2RKS A;  4UDU C;  4A3J B;  3DWA A;  1N33 Q;  1P16 A;  2WFW A;  3E3X A;  1ASY A;  4OHJ A;  3VR3 A;  2Z6K C;  2ZM6 L;  3T4A C;  2L12 A;  3OMG A;  1YJW A;  2OQ0 A;  2PO4 A;  1VQ6 A;  1EY7 A;  4KV6 A;  1K28 A;  1L1O A;  1EIH A;  4A3M H;  3IKJ A;  4KN7 C;  4NXM L;  3FVQ A;  4A93 G;  4X62 L;  1V1Q A;  4K5V A;  4IJL A;  4C56 C;  1O7Y A;  1PYB A;  1HZA A;  1Q12 A;  5JPM C;  2IT1 A;  4AIM A;  3SK8 A;  4LF6 L;  1PZI D;  1KRT A;  5M5X H;  3S17 B;  3L3O C;  1DOK A;  4QIW B;  5C0X H;  1XNR Q;  1PZK D;  3A5Z B;  1LYL A;  3VYR A;  1SDF A;  3OW7 A;  2NUC A;  3DWQ A;  5KND A;  2EY1 A;  4ODG A;  1LT3 D;  5IIF A;  1NMG A;  5HY6 A;  2HD3 A;  2VQF L;  3PO3 G;  1PV4 A;  1OXU A;  1QUQ B;  4A3F G;  4R9W A;  2PZW A;  1TY0 A;  4UPA A;  1B70 B;  1TT2 A;  5M9O A;  3GTL H;  2OXP A;  1EIY B;  3HOV G;  3S1Q H;  1HZ9 A;  1FYC A;  1RKN A;  4WOR A;  2A6E D;  2CFM A;  1A6X A;  1U4P A;  3SEB A;  4KHP L;  5IYC H;  3UDG A;  1R4Q B;  4LF8 L;  4JI6 Q;  4F87 A;  1UWV A;  1HQR D;  1WFQ A;  1WD1 A;  2NVX B;  1TWF B;  5JEA H;  1HRJ A;  4DV0 Q;  1EQV A;  1EWC A;  1XX8 A;  4DR6 L;  2AWN A;  2XRS D;  4N9T A;  4DV1 Q;  1R9T H;  3W2D A;  1STN A;  1Q82 C;  2NYZ D;  2UXD L;  4BXX H;  4YY3 L;  2K7V A;  3OSO A;  3BVG A;  5KYI A;  4AQY Q;  2E76 C;  4OWX B;  1Y8P B;  1YJN A;  1H9S B;  2B2T A;  3H6M A;  3NHH A;  2B2V A;  2I5L X;  3J80 c;  1EU4 A;  3SVM A;  2QDL A;  4DPG A;  1ZXT A;  5H1S E;  2VQE Q;  3GTP B;  2DJF C;  3G7L A;  4A3L H;  3PSI A;  3F1Z A;  3HKS A;  4IQZ A;  1Y69 U;  1L0Y B;  1QZG A;  1UEB A;  2IW3 A;  1E1O A;  3H3V I;  4U67 3;  5CBE E;  4HID A;  2JJQ A;  1ENF A;  5JPN C;  2EXZ A;  2QEJ C;  3TP6 A;  3PUZ A;  2C5C A;  2C9O A;  1HUN A;  4PZ6 A;  4NMZ A;  4GN3 B;  4IFD J;  1TWH H;  2CWA A;  1STB A;  1MJC A;  1VQK A;  4MNO A;  2F4V Q;  3BVM A;  1EQT A;  1STY A;  1CI3 M;  3K80 C;  3PF5 A;  4HJ5 A;  1P8L A;  2ATW A;  1XPO A;  5C0X J;  4BY7 G;  3F2B A;  1STE A;  1LO5 D;  4JW0 A;  2L55 A;  2QW7 A;  4GKJ L;  3D6W A;  4NPS A;  3CC2 A;  1RD9 D;  1XTC D;  1VF7 A;  2D0P A;  2PQA B;  3TS2 A;  2CQO A;  1TS2 A;  5M3M G;  4A93 H;  1C0A A;  1STG A;  1KAW A;  1CHQ D;  3VR4 A;  3KDF B;  2XTI A;  5IE8 A;  4QMG A;  2A74 C;  1LTB D;  4BBS G;  2I07 B;  2LFN A;  1E22 A;  4X3K A;  1C8C A;  3NTH A;  4YWM A;  1SXT A;  2Q2I A;  5JEA J;  4OWT B;  1R9T B;  4OGQ C;  3R2I A;  4L6T B;  1QNU A;  3BVZ A;  2A73 B;  5A2Q L;  4LAA A;  3ZJY C;  4A3D G;  3PO3 H;  2NVQ H;  2VB3 X;  2FHT A;  4J15 A;  4H7B A;  1SYE A;  5KYL A;  4A3F H;  3DHQ A;  1Q90 A;  3QIA A;  3NBH B;  2E2J B;  3HOV H;  2PW5 A;  4DUY L;  5KNB A;  4YCU A;  4QGU A;  5GAE C;  1SE4 A;  1K0S A;  1F77 A;  2RDH A;  2YU9 H;  3CC7 A;  5LL6 X;  1K8A C;  2JA6 G;  2H5X A;  4DU9 A;  2XVS A;  2A68 D;  4R4C A;  1LAB A;  4EX5 A;  1YEZ A;  2AUJ D;  2B2Y C;  1EYC A;  4X65 L;  1TR5 A;  1UE5 A;  3DM1 A;  4JYA L;  4B3R L;  3H0G G;  1X6O A;  4L5Q A;  1S40 A;  5LMN W;  2B39 A;  3JAM L;  3GTK B;  3E0E A;  3OOC A;  3S15 B;  1B8A A;  2EOT A;  3CW2 C;  4OIK A;  4X64 L;  5C3W A;  3D31 A;  4ZKB B;  2I5H A;  4FXD A;  2D5D A;  2G5D A;  1L1O B;  4JI2 L;  3HOZ B;  2EYL A;  4PV1 C;  5DEH A;  2ENB A;  3A54 A;  4OWW B;  3RLF A;  1H9K A;  2NTT A;  2E2I H;  5AJ3 Q;  2N3S A;  2XNA C;  1PRT B;  1K3R A;  4IPG A;  2VW9 A;  3BG3 A;  4ZCK A;  4FO2 A;  2N49 A;  1U5K A;  1HCZ A;  1DOL A;  1GUN A;  3NK9 A;  3SK6 A;  1CK1 A;  2EE1 A;  2HCC A;  3HOW B;  3PIO 3;  5I4D A;  4XT1 B;  1FNU A;  1BCP F;  2EQS A;  2EJG C;  3U9O A;  2LMC B;  1MIU A;  2GA4 B;  1MD2 D;  1BCP C;  4HSV A;  3I56 A;  4GLX A;  1CFM A;  5D14 A;  1PDQ A;  1HFN A;  4NP5 A;  1QZH A;  5C6A A;  1PFM A;  1PFB A;  2B2W A;  2K14 A;  2C35 B;  2JYO A;  2CH4 A;  3KF8 B;  1S3O A;  5AFW A;  1E7Z A;  1EFW A;  3PIO A;  4MTN A;  4OL7 A;  2EVB A;  5LMU Q;  4HJ9 A;  1DGS A;  3KBX A;  5M3M H;  4RGM A;  1F2Y A;  3S2H H;  3KJP A;  4A3E G;  4ZYS A;  1BO0 A;  4LF5 L;  3BYT B;  1VQ4 A;  2DY7 A;  1F2Z A;  4HTH A;  5D3D A;  3TRE A;  3BYY B;  2Z0S A;  3BZK A;  3PCO B;  2UXC L;  4UHV A;  5GAH C;  4Y52 H;  1I3Q H;  1Q3L A;  2K75 A;  4KJO A;  4BBS H;  1BDO A;  1JOQ A;  1UE1 A;  4JI6 L;  4KKS A;  4R4I A;  4M1U B;  5JJI A;  3CMA A;  1ET9 A;  5FLX c;  3G4S A;  4POG A;  5CV4 A;  4DV4 Q;  1TVX A;  1X3G A;  1FNV A;  1QJO A;  2EY6 A;  2WB1 B;  1XPR A;  2XIW A;  4DV0 L;  2Z6K A;  4XIG S;  4A3D H;  2KCC A;  3O13 A;  1M4V A;  1B9N A;  3G48 A;  1SE3 A;  4DR5 L;  3MC0 B;  1TWC H;  3S1R B;  1GD7 A;  1YNN C;  3CXC A;  2KEN A;  1Q8I A;  3J7Z C;  2ZT9 C;  1WJJ A;  1ZYR C;  4DV2 Q;  4K14 A;  1SSO A;  5ELD A;  2YTX A;  2D9U A;  2PMZ B;  4O42 A;  4XYO A;  4DR1 Q;  1LTI D;  2Y0S G;  5LL6 S;  2HHH L;  2JA6 H;  3M3Y H;  2RQX A;  4PMW A;  4F8M A;  4WRD A;  3CHB D;  2H1E A;  2E2I B;  5BN5 A;  2VQE L;  2RCF A;  1GUG A;  3H0G H;  1SRO A;  4BY1 G;  3C1E A;  4ZK9 B;  1N8R C;  1UUP A;  5KNC A;  2EDG A;  5TSS A;  2UUB L;  1T5E A;  1X3P A;  5ELE A;  2N78 A;  2KQ3 A;  4L8J A;  4JI0 Q;  5E1F A;  1SNP A;  4KI0 A;  4K0K Q;  3EQL C;  4XQJ A;  1FVI A;  4BY7 B;  2UUC Q;  1IBL L;  1O7I A;  2F4V L;  2MPM A;  1Y1V G;  1XPU A;  4RWS C;  1WCM G;  1G6Z A;  1L2F A;  1G8Z D;  1SR3 A;  1X9N A;  1D5X C;  3D4W A;  4FXG C;  4RG1 A;  1T9H A;  4RCO A;  1MBY A;  4HSP A;  3GV6 A;  2PNR C;  3QJY A;  1X3E A;  5T1G A;  4RGN A;  2ZM6 Q;  4A76 A;  3OIP A;  1BXT A;  1TWG B;  4DXG A;  3J7A F;  4BBR G;  2CW0 C;  4MIU A;  5J22 A;  3MTS A;  3PIP A;  3Q22 A;  4X3S A;  4X62 Q;  4TRD A;  4KMU C;  4H0L C;  4BBS B;  5FO7 B;  1KDA A;  3HG9 A;  3J81 c;  2A6H C;  1VMP A;  4LF6 Q;  1F9P A;  2K50 A;  5IOD A;  1S5D D;  4L63 B;  4JK1 C;  2E75 C;  1F2L A;  3VYU A;  4E6I A;  1EWI A;  3FHW A;  5CR3 A;  4PQX A;  5G3L F;  5CC4 A;  4FP5 D;  3PF4 A;  1TWC B;  2VQF Q;  3DXJ C;  3M4P A;  3Q6S A;  2AWO A;  2Y0S E;  1BNZ A;  4A3E H;  1PH3 A;  1CQF A;  3EIV A;  4KD4 A;  4B3T L;  1MSH A;  4B08 A;  4DAM A;  3RN5 A;  4KHP Q;  3HOX B;  4UAI A;  2JA8 H;  5M5W B;  3S2D H;  1JE5 A;  5JJZ A;  2XRQ D;  3MXP A;  1VQH A;  4CDF C;  5C3X A;  2F0J A;  4LJZ C;  4QB4 A;  2CVR A;  1FD7 D;  2BCO A;  1YHA A;  3KK7 A;  4KHZ A;  4DR7 Q;  1WYD A;  1A0I A;  3HP3 A;  2UXD Q;  1ZKO A;  5K36 G;  4DAP A;  1R4P B;  2K5Q A;  1A2U A;  4XTC S;  2Z9H A;  1J6Q A;  3NQI A;  4JI3 L;  2CCZ A;  3A55 A;  5FOB B;  3S1M H;  3H94 A;  4R4T A;  3D0F A;  2RF4 A;  4RHS A;  3U50 C;  3MZ5 A;  3PUY A;  4DAV A;  4G4K A;  2Z8L A;  2L15 A;  5DLQ E;  2M2L A;  2K28 A;  1KD1 C;  2R7Z H;  2LXK A;  2RHQ B;  4P75 A;  1U4L A;  4WJ3 M;  1EY8 A;  1AFP A;  2F0M A;  2KEC A;  2EYO A;  5AJ3 L;  1VQ7 A;  4GKK Q;  1B3Q A;  1QB5 D;  5F2D A;  3RZD H;  1X55 A;  1ENA A;  3VYS A;  4C3I G;  1JOR A;  1A3U A;  2KCM A;  4O0A A;  4A3M G;  1SNQ A;  1A3T A;  4JPB W;  4HMI A;  3T13 A;  1Y1V H;  4K6L A;  1WCM H;  4OEM B;  2ICE C;  1E2W A;  3TP5 A;  2SNM A;  5COY A;  1HZB A;  1PTO D;  2B2Y A;  4GKJ Q;  3BZC A;  1JJG A;  1DON A;  2QDB A;  3FEW X;  1A3V A;  4HCE A;  4QJF A;  4JVZ A;  4A3E B;  1Z6H A;  2EXD A;  4IOA A;  2KCT A;  4BBR H;  2K6A A;  1KNA A;  3I72 A;  5CV6 A;  1KRS A;  2JXM B;  1STA A;  3CRK C;  3DEO A;  3BDC A;  1PLF A;  1Y8N B;  1GUW A;  3OMC A;  3LWU A;  5CV8 A;  3NSW A;  2BOS A;  3URY A;  4ME5 A;  2NZH A;  4X6A H;  2AQ3 B;  4LNQ A;  3HEJ A;  1JR0 D;  3FP9 A;  4TQU S;  2JQO A;  3P20 A;  2PQE A;  3BDO A;  4IFD I;  2F0E A;  2NB0 A;  1VS0 A;  4QL5 A;  3SK5 A;  1GHK A;  1CUK A;  3BS1 A;  4I7A A;  3TDQ A;  2NBF A;  2ZTC A;  3W1B A;  2DNC A;  1IYU A;  4MHE A;  5C0X I;  1BBX C;  1ONL A;  3L9A X;  2QCP X;  3IFT A;  3I73 A;  2RSO A;  3S14 H;  3S24 A;  2A8V A;  4BY1 B;  1EIG A;  2IHE A;  3M7G A;  3AFP A;  1OXV A;  3K6O A;  2WP8 J;  4X65 Q;  3HFZ B;  4QF4 A;  4B3R Q;  1Y1W B;  1N34 Q;  2HUG A;  3M4Q A;  2E2H H;  3HKZ B;  3B6Y A;  5K36 H;  2EY2 A;  2RDG A;  5DAU A;  3KOJ A;  5IY0 A;  1N9W A;  2DUD A;  1HR0 L;  5ELB A;  4GZY C;  2N88 A;  4JI0 L;  4BS9 A;  4X64 Q;  3HGB A;  3QB3 A;  1SYG A;  4ABN A;  4K0K L;  2ZXR A;  1I4X A;  2WIN B;  5GAD C;  1WVL A;  4JI2 Q;  4Z9C B;  5ELN A;  1JT8 A;  3K7A H;  3VYT A;  2CHB D;  4X66 L;  3OTO Q;  3T1Y L;  1PFS A;  3W5O A;  1ICF B;  3KLS X;  1K8G A;  4CKE A;  2NVT H;  4BBR B;  1J9O A;  3I4M B;  1IZ6 A;  4GLV B;  5ELF A;  4C3I H;  1UE7 A;  5EPK A;  2E5L L;  4JI1 L;  4KHV A;  3EVQ A;  5I2X A;  1S5E D;  3Q23 A;  2BE5 D;  5CV7 A;  3I4N G;  1TQO A;  3OWF A;  4HCS A;  1SYB A;  3S1N H;  3VR2 A;  1Q86 C;  2O2L D;  4HED A;  2KHJ A;  1JC7 A;  5M5Y H;  1NR2 A;  1BBW A;  1QWY A;  1CQV A;  4CHT B;  3FKI B;  1JJC B;  2NVY B;  2B3G A;  3HZX A;  4BA2 I;  1V1O A;  2A69 C;  4MN3 A;  3I7F A;  2FJ2 A;  3K0X A;  2JP1 A;  1HXY D;  1V43 A;  1YI2 A;  4LF5 Q;  2B2U C;  1JJ2 A;  4JV5 Q;  2UXC Q;  1CKM A;  5I6W A;  1HNX L;  4QY7 A;  2Z6B A;  5IWA Q;  3TRZ A;  5JAV A;  2EIF A;  5EKL A;  2ES2 A;  4DKA C;  3CCS A;  4LMQ D;  1UE6 A;  3D6C A;  2QF7 A;  4DNR B;  1VQF A;  1GXD C;  1NUC A;  2HQE A;  3NWS A;  4WJW A;  1ROD A;  3LGJ A;  3TME A;  4DR5 Q;  5FO9 B;  4NDX A;  4DR7 L;  3NQT A;  3OWE B;  1RF2 D;  3C1F A;  4JBW A;  1PZJ D;  1CKN A;  3K0Y A;  4AYB E;  3MXU A;  1SE8 A;  1NSN S;  4V19 0;  3E9I A;  3QOL A;  5A2Q E;  2Q2H A;  3E5S A;  1B53 A;  1WTQ A;  2HHH Q;  1TY2 A;  2WKC A;  5E4X A;  2Q8R E;  4ZAI A;  4XT3 B;  1JB3 A;  4XQN A;  2NVT B;  1AEX A;  1TU2 B;  3CCR A;  5BN3 A;  2MQH A;  1GVP A;  3V96 A;  1U4M A;  1EYG A;  4FDB A;  1YZ6 A;  3G6E A;  4POF A;  1NCV A;  3QG1 A;  4FXK C;  4A3M B;  2UUB Q;  1VQI A;  2GVB A;  4GKK L;  2FMM A;  2Z1C A;  1J8I A;  1MSG A;  2DJG C;  3TEH B;  4C3J H;  2K5W A;  4CDE C;  1FJG L;  3S16 H;  5CV5 A;  2KVM A;  5ELO A;  1SYC A;  5I6Y A;  1IBL Q;  2F0N A;  5M5X B;  2K4K A;  1MHW C;  3JAM E;  5A35 A;  2OTL A;  1ASZ A;  2FXQ A;  2R6G A;  4LFB L;  4CKB A;  3HRZ C;  4FF4 A;  5IGE A;  2B63 G;  1OO9 B;  1U4R A;  2EJF C;  3TSS A;  2OCE A;  1G2S A;  3I8Z A;  5C4H A;  1VQE A;  3GTL B;  3Q0A A;  1B7Y B;  4R8N A;  3S1Q B;  3LNN A;  1WTW A;  1W3S A;  4NB3 A;  4DR3 L;  3P75 A;  2Q2T A;  2OWO A;  4DR4 Q;  3N52 A;  1IL8 A;  1YNX A;  4IUR A;  2JA7 H;  2PI2 E;  3I4N H;  1C9O A;  3BDL A;  1O80 A;  5JJL A;  1SMY D;  3X3M A;  1RHP A;  4HJA A;  1D5Z C;  2AKW B;  5IP9 G;  1EEI D;  4IJH A;  1UAP A;  2L9H A;  3SHL A;  2AMC B;  2WKD A;  2ZJR A;  1PRT D;  2J7Z A;  4EGV A;  1Q7Y C;  3TBI B;  1I4R A;  3CQZ H;  4J8Q A;  1BCP B;  3R93 A;  5IYB G;  4H44 C;  1DXM A;  2CQA A;  2KCN A;  5KIX A;  1EY0 A;  4B3T Q;  3U4Z A;  2WB1 E;  5IOC A;  4M8A A;  3PO2 G;  2J4X A;  2AUK A;  1RTO A;  1ET6 A;  1LTL A;  3CRL C;  3E0J A;  2KEE A;  4H13 C;  4GN5 A;  4IOC A;  4HMJ A;  1SE2 A;  4ZLT F;  1FGB D;  5I9O A;  4Q5V A;  1EY6 A;  3A8I E;  5BR8 L;  4O1N A;  3LX0 A;  1JE4 A;  1N34 L;  3STB D;  1RIP A;  4A3B H;  5EKI A;  2IJ0 A;  4GOP C;  2DN8 A;  1IKM A;  2L11 A;  1TWH B;  2UUA L;  3HOY G;  1ESR A;  4JI3 Q;  4APV A;  3EJI A;  3D4D A;  3NE5 B;  4QUF A;  5C5L A;  5KEE A;  5C5M A;  4JC0 A;  1IW7 D;  3SR1 A;  3NTK A;  4KKU A;  4JI7 L;  2YV5 A;  4C3H G;  4DF7 A;  3T53 B;  1Q1B A;  1PYW D;  2KUM A;  4OON A;  3ULP A;  3A7A B;  2N8N A;  4R1J A;  3OTO L;  2A6E C;  4LF7 Q;  2EYF A;  4A93 B;  1VCI A;  4FVM A;  3J80 i;  1A62 A;  2RBM A;  1VQ9 A;  1QOH A;  2MO1 A;  3AFQ A;  3PQI A;  3PV0 A;  5G3L D;  4EVO A;  3J80 L;  1YHQ A;  4L5S A;  4NXN Q;  5FKA C;  2PW7 A;  3NEL A;  1KL9 A;  4ME3 A;  1YNJ C;  2PPB C;  1CZG A;  5NUC A;  1KQS A;  2OQK A;  3VR5 A;  3EBE A;  3K5L A;  1C7Y A;  2F0O A;  1ZEQ X;  3T16 A;  1E1T A;  3ND8 A;  3PUW A;  5J1Z A;  1WTP A;  3CD6 A;  2MO0 A;  5EQ0 A;  2B63 H;  2E8G A;  1NMF A;  3PO3 B;  4FYD A;  2NVQ B;  2VS1 A;  3MHB A;  4DK6 C;  2D0O A;  4A3F B;  1JWS D;  1VQB A;  1QVF A;  4GNX C;  3HOV B;  1KAA A;  3M9B A;  4UP8 A;  1CSP A;  3L0O A;  5IT9 c;  3P1H A;  1S72 A;  2YU9 B;  4JV5 L;  1X3F A;  3GTQ H;  1TXY A;  5C4Z A;  2JA8 G;  2MP1 A;  1SNC A;  3KLR A;  5IP9 H;  5IWA L;  4UY8 C;  4P72 A;  2G9H D;  3NTI A;  1CKN B;  4KTA A;  1KC8 C;  1XWE A;  4XDX A;  4JI4 Q;  3GTG H;  1FGU A;  4ZUJ A;  3C46 A;  1HFG A;  3GTJ H;  3CPF A;  5IYB H;  4K2L A;  1L0X B;  1JWM D;  1S5F D;  3W3A A;  1IBK Q;  3GV3 A;  1X54 A;  4OIJ A;  3PO2 H;  3K8A A;  1VQG A;  4HR7 B;  2R93 G;  3KUP A;  2AQ2 B;  5C4X G;  2NN6 I;  4JBM A;  5CGK A;  4OX9 Q;  1I94 L;  1II3 A;  4NKL A;  1X65 A;  5COR A;  4CBV A;  1H9R A;  3RZO H;  4GS3 A;  3F2U A;  2K5D A;  5C44 G;  3GP7 A;  4HAE A;  5EPJ A;  1B3A A;  2L0C A;  3RD4 A;  1D5M C;  5DM7 3;  5EPL A;  2R7Z G;  1LTA D;  1HTP A;  4NW2 A;  4R4O A;  1GOZ A;  2K5H A;  2L1B A;  2K52 A;  3D3R A;  1V8Q A;  1TWA H;  1LTS D;  1DYQ A;  2NTS A;  2R7F A;  3HOY H;  1HR0 Q;  1X56 A;  2B2U A;  1PA6 A;  4CDC C;  4DV7 Q;  1J5E Q;  1K3B C;  1EU3 A;  1HQM C;  4IPH A;  1B9M A;  4ULL A;  2ALY B;  4C3H H;  5IGF A;  3KYH C;  3A5U A;  4X3T A;  1K83 H;  2L5T A;  2JEA I;  4B9W A;  4X66 Q;  4DUZ Q;  2EZV A;  3T1Y Q;  1GO3 E;  3K5M A;  1Q46 A;  3VR6 A;  1EQQ A;  1AZQ A;  1XMQ Q;  2X69 A;  5M3M B;  2CWP A;  1O78 A;  3TN2 A;  3S2H B;  2MUY A;  1PH7 A;  2O4X A;  2PZU A;  2E5L Q;  3KF6 A;  4HJ7 A;  4JI1 Q;  3OW2 A;  1I3Q B;  3N6R A;  2XWJ B;  3V2T A;  2AQ1 B;  4DR4 L;  1HA6 A;  3CCM A;  3RNU A;  2QGQ A;  3SDZ A;  4DNT B;  3H3V C;  3DUZ A;  5JVH 3;  2VY3 A;  2V1C C;  3AYH B;  5BN4 A;  4DR2 L;  3GTG B;  1DJR D;  4A3D B;  3GTO H;  3I4L A;  3GTJ B;  2F0H A;  1I6H H;  1DM0 B;  1SJH D;  1F9Q A;  4YWK A;  1BKB A;  2ZTE A;  3SE0 A;  1H9M A;  2CKZ B;  2PCF B;  4XQQ A;  1K9M C;  4G7O C;  1HTL D;  3RZO B;  3H09 A;  2F3V A;  1O7L A;  1HNX Q;  2RSN A;  2OTJ A;  3EFX D;  1C48 A;  2JA6 B;  1D7Q A;  4A3C G;  4CJ0 B;  3M3Y B;  3GDE A;  4HIK A;  1LTT D;  4A75 A;  1FR3 A;  4X3U A;  3H0G B;  4CDD C;  1AH9 A;  5IT9 L;  3J81 j;  3M4Y A;  4Y7N H;  1LUZ A;  4ZUI A;  2RCN A;  4FF2 A;  3UE0 A;  1SN8 A;  2WAQ E;  1TKW B;  5FLX L;  3MAQ A;  2VB2 X;  1S4Z A;  4OEL B;  4FF1 A;  2HIV A;  4K8J A;  5C4X H;  2R93 H;  1DOM A;  1Y14 B;  1MGS A;  2D2C C;  4G57 A;  3CCV A;  1BOS A;  3L7Z C;  3LWE A;  1S5B D;  2HQL A;  3ERS X;  5C44 H;  2MJ8 A;  3KBG A;  1CTM A;  4U68 A;  1CHP D;  1I4G A;  2EY5 A;  3CP0 A;  3ITP A;  1D1K A;  2A1A A;  3DLL A;  2QA4 A;  3K5O A;  4DV6 Q;  4DA2 A;  1NR4 A;  4LF7 L;  1RJT A;  3GO5 A;  2B8F A;  1I6V C;  2LS0 1;  2JA9 A;  2OT2 A;  2R3Z A;  1FJG Q;  2K04 A;  3CPW A;  2JEB I;  4NXN L;  1I50 H;  1JCK B;  4LF4 Q;  3OYY A;  4CJ1 B;  5E3F A;  5GQO A;  4CJ2 C;  5EAY A;  4XXE A;  4LFB Q;  2VXW A;  5DM6 3;  1VQO A;  3G6J B;  4ZKC B;  1U9R A;  1H9S A;  2ASB A;  2JN4 A;  1CA5 A;  3DWP A;  3K57 A;  4GOP A;  1LLR D;  3IL8 A;  3J7Y W;  2GVA A;  4PG3 A;  2BH2 A;  1VQC A;  2BDO A;  4IFD G;  1X32 A;  3NWT A;  4QIW E;  4DR3 Q;  2WV6 D;  3HOU H;  2JA8 B;  4BWG B;  1EY9 A;  4OO1 I;  4HJ8 A;  3S2D B;  4HIM A;  1AE2 A;  3A0J A;  4C2M H;  1DCZ A;  3MA2 B;  4EQ5 A;  1E3P A;  5JJK A;  1QCB D;  5LMN Q;  4A3J H;  1PFN A;  3PGZ A;  1WTR A;  1K73 C;  3J81 i;  3GTM H;  3NXW A;  1N36 L;  1N32 Q;  4DK0 A;  1S5C D;  4KJN A;  2UU9 L;  3J81 L;  4H02 A;  2LKV A;  3CCE A;  3MEF A;  1B1Z A;  3KLS A;  4JI4 L;  2HDM A;  4IUU A;  1QIL A;  3S1M B;  1IBK L;  3K58 A;  2XGT A;  2PYK A;  1TII D;  1QE6 A;  5K5P A;  2Y0S B;  5ISR A;  4A3C H;  1SYD A;  3NEN A;  4OX9 L;  2R7Z B;  2I0Q A;  3S17 H;  4BA1 I;  4KK7 A;  1BVS A;  4KKT A;  5BR8 Q;  2R61 A;  1ILP A;  3D4R A;  3VA5 A;  1GUS A;  1F9S A;  3RZD B;  3CF5 A;  2F03 A;  4GNX A;  2HT1 A;  1Z47 A;  1G6P A;  2UUA Q;  4JBJ A;  1KNE A;  1CKO A;  2Z4H A;  3CAM A;  4C3J G;  1Y1V B;  1EOV A;  3Q24 A;  1WCM B;  2SOB A;  3SK4 A;  1EUJ A;  3E6Z X;  5EBD A;  3QOJ A;  4DV7 L;  1J5E L;  1PYS B;  4DN4 M;  4B3S Q;  1A63 A;  1D1I A;  3NBH A;  3ZYY X;  3GD7 A;  2RVL A;  4KLK A;  4JI7 Q;  4RKB A;  2M9V A;  3SXH A;  2NVX H;  1TWF H;  2E74 C;  2FMC A;  2OF1 A;  4LW1 A;  1KDC A;  1CT1 D;  2MFI A;  4DUZ L;  4AYB G;  2ZXP A;  2O5J C;  2PZT A;  1PXU A;  1VQM A;  4A3I G;  1XMQ L;  4IUV A;  2EJM A;  1KIX A;  5FJ8 G;  5IYD G;  3CCQ A;  1IYV A;  4DFA A;  1LT5 D;  4C2M B;  1LTG D;  1E2V A;  1NNX A;  5KRU A;  4RHR A;  2JA7 G;  1HH2 P;  5I9P A;  1RTN A;  3GTM B;  2RA4 A;  1MI2 A;  4IPD A;  3HOZ G;  3EN2 A;  3IFD A;  1CA6 A;  4FNF A;  5EJW A;  3GTP H;  2X6L A;  1YBY A;  1JB7 A;  5T1I A;  1QVG A;  1EZ8 A;  1Q1E A;  4JI5 L;  3TZD A;  3CCL A;  3MWY W;  1RCV D;  2F0I A;  2QEX A;  2MNA A;  3HS0 C;  1G2T A;  1NE3 A;  3DMU A;  2R92 G;  2YTV A;  1K8M A;  4K5X A;  1IKL A;  1PH9 A;  1VQA A;  4IFD H;  3JC6 6;  2L4N A;  1IXR A;  3CC4 A;  4JOI C;  1TS4 A;  5IGG A;  1HR0 W;  3HOW G;  3S14 B;  1XJV A;  1IBM Q;  4LF9 L;  4KD3 A;  5D3I B;  4YHH Q;  2H4O A;  5FO8 B;  2I5M X;  1JIC A;  1EZ6 A;  3I55 A;  2DNE A;  2E2H B;  3TP7 A;  3NPP A;  1HJP A;  4WFN 3;  1XYI A;  4MTK A;  4ZRZ A;  1HPC A;  4EQN A;  4A3B G;  4F88 A;  3KF8 A;  2PI2 A;  2RHS B;  2MHV A;  4DV3 Q;  1PTO F;  1JOO A;  1G29 1;  3NBI A;  4PNY A;  1PTO C;  1JOK A;  1NY4 A;  3KFU A;  1T5X D;  3A56 A;  1HUM A;  3JAM c;  1I94 Q;  4JG2 A;  2R7D A;  1E2Z A;  3K7A B;  3R8B A;  1MJE A;  4RCN A;  1YNJ D;  1EFI D;  1BF4 A;  1Q8K A;  1QVC A;  4PZ7 A;  4KY6 A;  1L0W A;  2WB1 G;  1F2M A;  1BCP D;  1FNW A;  3GQB A;  1PMR A;  1EEF D;  4C3I B;  4DV6 L;  3P7J A;  3T56 B;  2MGS A;  3AB9 A;  5ELC A;  2E2J H;  1XNQ Q;  4LFA L;  1KDB A;  2EYP A;  3T1H L;  3R2T A;  2ZXO A;  3S1N B;  1Y8O B;  1B44 D;  4Q0F A;  1GM5 A;  1A15 A;  4GOP B;  2F0W A;  3A74 A;  4LF4 L;  4IUN A;  2K5N A;  5M5Y B;  4A4I A;  1EWH A;  1LV9 A;  5JVG 3;  1EY4 A;  1ENC A;  3I91 A;  1JMC A;  2F4I A;  4G7H C;  1KXL A;  2IX0 A;  2TSS A;  4KY7 A;  2K05 A;  1H9J A;  4A3I H;  1VQP A;  3WWV A;  5FJ8 H;  3K5N A;  1LM0 A;  4A3K G;  5IYD H;  1AP0 A;  2ZJQ A;  4IUQ A;  3GTK H;  4B3M L;  2F0V A;  1XMO L;  4RGO S;  1EQR A;  3S15 H;  2K33 A;  5D65 A;  2Q8T A;  3U4V A;  4V0B A;  4DK1 A;  3M85 A;  3FRP B;  3J7A 5;  5EGT A;  3IRB A;  5HGT A;  1YNN D;  4DAY A;  3PUV A;  3I3C A;  4EQP A;  4DGZ A;  3MFY A;  3HOZ H;  2UXB L;  1PH6 A;  3J80 E;  4DK3 C;  4DR2 Q;  1ZYR D;  3K59 A;  3MVV A;  5LMN L;  3ULJ A;  4JI8 Q;  1N32 L;  1K0R A;  2EYH A;  1GHJ A;  2F0Q A;  2R92 H;  3QO2 A;  5GRO A;  2Q8I B;  3WDN A;  2K1B A;  1HNW Q;  1A8V A;  1PHJ A;  3X3N A;  4QQB X;  4I65 A;  4XYQ A;  1HNZ Q;  2JA5 G;  4GN4 B;  2XN9 C;  3HOW H;  4HIO A;  2XWB B;  3MXN A;  4GNX B;  1BQQ T;  3ER0 A;  2AHO B;  4YCW A;  3TZU A;  1EYD A;  4QCL A;  2HCI A;  1VQJ A;  3AU7 A;  4FF3 A;  4O2D A;  1W6J A;  1STH A;  2LSS A;  2BE5 C;  1I4P A;  4MZ9 A;  3DEP A;  1W2B A;  1A2T A;  3EA6 A;  4C3J B;  2PMZ E;  4N8F A;  3I2Z A;  3S16 B;  3H3V H;  3S9W A;  1TS3 A;  2A19 A;  1Z9F A;  1SRU A;  4K2K A;  2CW0 D;  3HOX G;  2KA7 A;  4IUT A;  1I5F A;  2F0S A;  1NBW A;  3ERQ A;  1W6K A;  4B3S L;  3ERO A;  2F0D A;  4AYB B;  2F0T A;  1U0L A;  3UDX A;  2A6H D;  1HA5 A;  1OXS C;  3UDF A;  3JAM i;  3CCU A;  4A3I B;  1MKH A;  1SMX A;  4L5T A;  1KHI A;  1M8A A;  4KN4 C;  3BJU A;  1SYF A;  3G71 A;  4TVA B;  3BZD B;  3RLO A;  4DV5 L;  5FLM G;  4LUZ A;  1AN8 A;  3S1R H;  4UP7 A;  1IYJ B;  2JA7 B;  3I4N B;  5LHY 1;  3TP8 A;  5C3E G;  1B4O A;  1WTX A;  4CGY B;  1PH4 A;  5E7N A;  1ESF A;  1I4Q A;  2DY8 A;  5IGD A;  2BDN A;  1AW7 A;  4P73 A;  3TQY A;  1N33 L;  3NP8 A;  2B29 A;  2QIL A;  2R92 B;  1EOT A;  2G9D A;  2KJX A;  2K03 A;  1SEB D;  3KLW A;  1WTO A;  1D2B A;  3CQZ B;  2LXJ A;  2VUM G;  2J0T D;  4A3K H;  3U9S A;  2BA0 A;  3M7N A;  4DXF A;  1IL2 A;  1LT4 D;  4A3G G;  1Q81 C;  1NTG A;  2VZA A;  2YTY A;  2I46 A;  2KHS A;  1V1P A;  2K01 A;  4C1N I;  1VDZ A;  4BY7 H;  2IWH A;  1UEA B;  1BR9 A;  1SJE D;  1FL0 A;  3NEM A;  3SGI A;  4C1N K;  1XNR L;  2NN6 G;  2ICI A;  1IBM L;  2A5H A;  5DNF A;  1B2T A;  3UI2 A;  4YHH L;  2NWG A;  1YHB A;  5CYU A;  4AH6 A;  1N36 Q;  1VF5 C;  3I90 A;  4A3B B;  5M3F G;  2UU9 Q;  1CZW A;  1GKH A;  1D8L A;  4IN3 A;  4DNI A;  3V05 A;  4IAL A;  1QNK A;  1SND A;  1RL2 A;  1TWG H;  2QKI C;  4PZ8 A;  4TKO B;  2O5I C;  1ICW A;  4LFC Q;  1ILQ A;  2GN5 A;  1G51 A;  4DV3 L;  1SFO H;  2JA5 H;  2JE6 I;  4N8X 1;  5J3B A;  4J1M A;  2KHI A;  1D6E C;  2YYZ A;  2B8G A;  1QG7 A;  2TMP A;  4DV1 L;  2BA1 A;  4IO9 A;  3WOF A;  1L1O C;  1SAP A;  2IHF A;  3E9H A;  1SMY C;  2JSO A;  2F1M A;  1KLU D;  2FIN B;  1O7Z A;  4AQY L;  1SNM A;  2X6G A;  2RDF A;  3R3O A;  2F0F A;  3TS0 A;  1XNQ L;  5IT9 E;  4JOI A;  4RA8 A;  1HHV A;  3ND9 A;  3HOX H;  1PRT F;  3CME A;  1JWU D;  3DM3 A;  5M5W H;  4RAU C;  1PRT C;  4F7X A;  1OXX K;  1F9R A;  3J7A V;  3Q8D A;  5FLX E;  1YVC A;  1JQY D;  2HDL A;  2WAQ G;  2HIX A;  2B63 B;  1PH2 A;  4HN7 A;  3RLN A;  4A3K B;  3RMH A;  1Y1W G;  2XSC A;  3VA7 A;  2ZJP A;  3IAY A;  3M4O H;  4DAY B;  3HKZ G;  5FLM H;  4ZQ3 A;  2F0L A;  4JBK A;  4TSS A;  4YIJ A;  5C3E H;  3RR5 A;  4B9X A;  2VNU D;  3GTQ B;  3HOU G;  5L37 A;  2A68 C;  1GUT A;  3PIP 3;  4PMC A;  4I7Z C;  3STB C;  2M00 A;  1WOC A;  4LK1 C;  3CU7 A;  3WOE A;  5KGU A;  3AMU A;  3MFG A;  4RFB A;  4A3J G;  4LUO A;  4JI5 Q;  2VUM H;  4JI8 L;  1GUO A;  4R8I A;  3A8J E;  2EYJ A;  1OXT A;  4NXM Q;  3FPP A;  1NJI C;  3MXN B;  4ILW A;  1XTD A;  2V4D A;  1SFO B;  2JA5 B;  3I4M G;  3H15 A;  4A3G H;  2D62 A;  3PO2 B;  1IW7 C;  1M1K C;  2F0U A;  1HNW L;  2JK8 A;  3F2C A;  2F52 A;  4N9P A;  1BUV T;  1HNZ L;  3RUZ A;  1DD2 A;  4LF9 Q;  2B2T C;  2NN6 H;  2B2V C;  3FMC A;  5CBA E;  1LT6 D;  1PH8 A;  1M90 C;  5M3F H;  1K8O A;  4LUV A;  1WI5 A;  1TS5 A;  1I4H A;  4K5W A;  1KTK A;  1TWA B;  3HOY B;  4WJ4 A;  3FKI G;  2IX3 A;  4QUC A;  2K5V A;  5JOB A;  1EY5 A;  4IUP A;  2EYM A;  2NZO A;  4LF8 Q;  1PH5 A;  3MXG A;  5IP7 G;  3ULL A;  1C4Q A;  1GJX A;  3RN2 A;  4RMF A;  4R4Q A;  3J81 E;  5HGQ A;  1QUQ A;  1G91 A;  1BBU A; 
#chains in the Genus database with same CATH homology
 4C3H B;  1K83 B;  2E2D C;  5CV9 A;  5HUR A;  3PUX A;  3M4O B;  4KY5 A;  4PMB A;  5C3E B;  1NAP A;  3MEH A;  2N55 A;  4RH6 A;  4S3S A;  4K6D A;  2A69 D;  4J6H A;  2F0G A;  1XXG A;  4OO1 G;  1SNO A;  4EQO A;  3GTO B;  5EBC A;  1KAB A;  4G7Z C;  2VUM B;  1I6H B;  2F0P A;  2WAC A;  4P2C B;  3OIQ A;  1VMC A;  3I70 A;  1V1P B;  4A3G B;  1PTO H;  4K8I A;  1SBB B;  2KOL A;  3CKI B;  5E4W C;  3QWN A;  3H91 A;  3C3L A;  5C0X G;  5M3F B;  1WD0 A;  1X3Q A;  3T51 B;  5IGB A;  3FPU B;  4Y7N B;  2IX1 A;  2K32 A;  1Z7T A;  1EL0 A;  2R93 B;  5C4X B;  2F3W A;  1RDP D;  1E0B A;  5I2Y A;  2ID0 A;  5C44 B;  3A8K E;  1LAC A;  1WTV A;  1KLG D;  3NUC A;  1B50 A;  4CKC A;  5JEA G;  2F0K A;  1CM9 A;  5IGC A;  3OHX C;  2KED A;  3A7L A;  5FK9 C;  1UNS A;  2OEO A;  1I50 B;  4RKL A;  5J39 A;  2SNS A;  2EPB A;  2WAQ B;  4ID6 A;  1AZP A;  1IHZ A;  3OPO A;  5EKK A;  2NZ1 D;  3C2P A;  2FFK B;  1ML0 D;  2B2W C;  2WII B;  2IL8 A;  1DZ1 A;  3D8G A;  1PTO B;  3PMF A;  2Z4I A;  5C4J B;  1LTR D;  3HOU B;  1EYA A;  2SDF A;  4IZ8 A;  2LY7 A;  2IPK D;  2SEB D;  3FDT A;  5CMD A;  3ONA B;  4OO1 H;  4RGT A;  2RKS A;  4UDU C;  4A3J B;  3DWA A;  4OHJ A;  3VR3 A;  3T4A C;  2L12 A;  3OMG A;  2PO4 A;  1EY7 A;  4KV6 A;  1EIH A;  3IKJ A;  4KN7 C;  3FVQ A;  4K5V A;  4C56 C;  1O7Y A;  1Q12 A;  5JPM C;  2IT1 A;  3SK8 A;  1PZI D;  3S17 B;  3L3O C;  1DOK A;  4QIW B;  5C0X H;  1PZK D;  3VYR A;  1SDF A;  3OW7 A;  2NUC A;  3DWQ A;  5KND A;  2EY1 A;  4ODG A;  1LT3 D;  5IIF A;  1OXU A;  4R9W A;  2PZW A;  1TY0 A;  1TT2 A;  5M9O A;  2OXP A;  1FYC A;  1RKN A;  4WOR A;  2A6E D;  1A6X A;  1U4P A;  3SEB A;  1R4Q B;  4F87 A;  1HQR D;  1WD1 A;  2NVX B;  1TWF B;  5JEA H;  1HRJ A;  1EQV A;  1EWC A;  1XX8 A;  2AWN A;  2XRS D;  4N9T A;  3W2D A;  1STN A;  2NYZ D;  2K7V A;  3OSO A;  3BVG A;  5KYI A;  2E76 C;  1Y8P B;  1H9S B;  2B2T A;  3H6M A;  3NHH A;  2B2V A;  1EU4 A;  3SVM A;  1ZXT A;  3GTP B;  3G7L A;  4IQZ A;  1Y69 U;  1L0Y B;  2IW3 A;  4U67 3;  5CBE E;  1ENF A;  5JPN C;  2EXZ A;  2QEJ C;  3TP6 A;  3PUZ A;  2C5C A;  2C9O A;  1HUN A;  4NMZ A;  4IFD J;  1STB A;  3BVM A;  1EQT A;  1STY A;  1CI3 M;  5C0X J;  1STE A;  1LO5 D;  2L55 A;  3D6W A;  1RD9 D;  1XTC D;  1VF7 A;  1TS2 A;  1STG A;  1CHQ D;  3VR4 A;  4QMG A;  2A74 C;  1LTB D;  2I07 B;  2LFN A;  4X3K A;  1C8C A;  3NTH A;  1SXT A;  5JEA J;  1R9T B;  4OGQ C;  3R2I A;  4L6T B;  1QNU A;  3BVZ A;  2A73 B;  5A2Q L;  4LAA A;  2VB3 X;  2FHT A;  4H7B A;  1SYE A;  5KYL A;  3DHQ A;  1Q90 A;  3QIA A;  2E2J B;  2PW5 A;  5KNB A;  1SE4 A;  1F77 A;  2RDH A;  5LL6 X;  4DU9 A;  2XVS A;  2A68 D;  1LAB A;  2AUJ D;  2B2Y C;  1EYC A;  1TR5 A;  3DM1 A;  2B39 A;  3JAM L;  3GTK B;  3OOC A;  3S15 B;  2EOT A;  4OIK A;  5C3W A;  3D31 A;  4ZKB B;  4FXD A;  2D5D A;  3HOZ B;  2EYL A;  4PV1 C;  5DEH A;  2ENB A;  3A54 A;  3RLF A;  1H9K A;  2NTT A;  2XNA C;  1PRT B;  3BG3 A;  4FO2 A;  1HCZ A;  1DOL A;  1GUN A;  3NK9 A;  3SK6 A;  1CK1 A;  2EE1 A;  2HCC A;  3HOW B;  3PIO 3;  5I4D A;  4XT1 B;  1FNU A;  1BCP F;  2EJG C;  3U9O A;  2LMC B;  2GA4 B;  1MD2 D;  1BCP C;  4HSV A;  1CFM A;  5D14 A;  1PDQ A;  1HFN A;  4NP5 A;  5C6A A;  1PFM A;  1PFB A;  2B2W A;  2JYO A;  5AFW A;  4OL7 A;  2EVB A;  3KBX A;  4RGM A;  1F2Y A;  4ZYS A;  1BO0 A;  3BYT B;  2DY7 A;  1F2Z A;  5D3D A;  4HTH A;  3BYY B;  1Q3L A;  4KJO A;  1BDO A;  1JOQ A;  4KKS A;  4M1U B;  1ET9 A;  5CV4 A;  1TVX A;  1FNV A;  1QJO A;  2EY6 A;  2WB1 B;  2XIW A;  4XIG S;  2KCC A;  3O13 A;  1M4V A;  1B9N A;  1SE3 A;  3MC0 B;  3S1R B;  1YNN C;  1Q8I A;  2ZT9 C;  1ZYR C;  4K14 A;  1SSO A;  5ELD A;  2D9U A;  2PMZ B;  4O42 A;  4XYO A;  1LTI D;  5LL6 S;  2RQX A;  4PMW A;  4F8M A;  4WRD A;  3CHB D;  2H1E A;  2E2I B;  5BN5 A;  1GUG A;  3C1E A;  4ZK9 B;  1UUP A;  5KNC A;  2EDG A;  5TSS A;  1T5E A;  1X3P A;  5ELE A;  2KQ3 A;  4L8J A;  5E1F A;  1SNP A;  4KI0 A;  3EQL C;  4XQJ A;  4BY7 B;  2MPM A;  4RWS C;  1G6Z A;  1G8Z D;  1D5X C;  3D4W A;  4FXG C;  4RCO A;  1MBY A;  4HSP A;  3GV6 A;  2PNR C;  3QJY A;  5T1G A;  4RGN A;  3OIP A;  1BXT A;  1TWG B;  4DXG A;  3J7A F;  2CW0 C;  4MIU A;  5J22 A;  3MTS A;  3Q22 A;  4X3S A;  4TRD A;  4KMU C;  4H0L C;  4BBS B;  5FO7 B;  1KDA A;  3HG9 A;  2A6H C;  1VMP A;  1F9P A;  5IOD A;  1S5D D;  4L63 B;  4JK1 C;  2E75 C;  1F2L A;  3VYU A;  4E6I A;  5CR3 A;  4PQX A;  5G3L F;  5CC4 A;  4FP5 D;  1TWC B;  3DXJ C;  3Q6S A;  2AWO A;  1BNZ A;  1CQF A;  4KD4 A;  1MSH A;  4B08 A;  3HOX B;  4UAI A;  5M5W B;  5JJZ A;  2XRQ D;  3MXP A;  5C3X A;  2F0J A;  4LJZ C;  4QB4 A;  2CVR A;  1FD7 D;  2BCO A;  3KK7 A;  4KHZ A;  3HP3 A;  1ZKO A;  5K36 G;  4DAP A;  1R4P B;  2K5Q A;  1A2U A;  4XTC S;  3NQI A;  3A55 A;  5FOB B;  3H94 A;  4RHS A;  3MZ5 A;  3PUY A;  4DAV A;  4G4K A;  2Z8L A;  2M2L A;  2K28 A;  1U4L A;  1AFP A;  1EY8 A;  2F0M A;  2KEC A;  2EYO A;  1QB5 D;  5F2D A;  3VYS A;  1ENA A;  4C3I G;  1JOR A;  1A3U A;  1SNQ A;  1A3T A;  4HMI A;  3T13 A;  4K6L A;  2ICE C;  1E2W A;  3TP5 A;  2SNM A;  5COY A;  1PTO D;  2B2Y A;  1DON A;  2QDB A;  3FEW X;  1A3V A;  4HCE A;  4A3E B;  1Z6H A;  2K6A A;  1KNA A;  3I72 A;  5CV6 A;  2JXM B;  1STA A;  3CRK C;  3DEO A;  3BDC A;  1PLF A;  1Y8N B;  1GUW A;  3OMC A;  3LWU A;  5CV8 A;  3NSW A;  2BOS A;  3URY A;  4ME5 A;  2AQ3 B;  3HEJ A;  1JR0 D;  4TQU S;  3P20 A;  2PQE A;  3BDO A;  4IFD I;  2F0E A;  2NB0 A;  3SK5 A;  1GHK A;  3BS1 A;  3TDQ A;  2NBF A;  2DNC A;  1IYU A;  4MHE A;  5C0X I;  1BBX C;  1ONL A;  3L9A X;  2QCP X;  3IFT A;  3I73 A;  2RSO A;  4BY1 B;  1EIG A;  3M7G A;  1OXV A;  3K6O A;  2WP8 J;  4QF4 A;  1Y1W B;  2HUG A;  3HKZ B;  5K36 H;  2EY2 A;  2RDG A;  5DAU A;  5ELB A;  4GZY C;  2N88 A;  4BS9 A;  3HGB A;  3QB3 A;  1SYG A;  4ABN A;  2ZXR A;  1I4X A;  2WIN B;  1WVL A;  4Z9C B;  3VYT A;  2CHB D;  3KLS X;  4CKE A;  4BBR B;  1J9O A;  3I4M B;  5ELF A;  5EPK A;  4KHV A;  3EVQ A;  5I2X A;  1S5E D;  3Q23 A;  2BE5 D;  5CV7 A;  1TQO A;  3OWF A;  4HCS A;  1SYB A;  3VR2 A;  2O2L D;  4HED A;  1JC7 A;  1NR2 A;  1QWY A;  1CQV A;  4CHT B;  3FKI B;  2NVY B;  3HZX A;  4BA2 I;  1V1O A;  2A69 C;  4MN3 A;  2FJ2 A;  2JP1 A;  1HXY D;  1V43 A;  2B2U C;  5I6W A;  5JAV A;  5EKL A;  4LMQ D;  3D6C A;  2QF7 A;  4DNR B;  1GXD C;  1NUC A;  2HQE A;  3NWS A;  4WJW A;  1ROD A;  3TME A;  5FO9 B;  4NDX A;  3NQT A;  3OWE B;  1RF2 D;  3C1F A;  4JBW A;  1PZJ D;  3K0Y A;  3MXU A;  1NSN S;  4V19 0;  3QOL A;  5A2Q E;  3E5S A;  1B53 A;  1WTQ A;  1TY2 A;  2WKC A;  5E4X A;  4ZAI A;  2Q8R E;  4XT3 B;  1JB3 A;  4XQN A;  2NVT B;  1AEX A;  1TU2 B;  5BN3 A;  3V96 A;  1U4M A;  1NCV A;  3QG1 A;  4FXK C;  4A3M B;  2FMM A;  2Z1C A;  1J8I A;  1MSG A;  2K5W A;  5CV5 A;  2KVM A;  1SYC A;  5I6Y A;  2F0N A;  5M5X B;  3JAM E;  5A35 A;  2R6G A;  4CKB A;  3HRZ C;  4FF4 A;  5IGE A;  1OO9 B;  1U4R A;  2EJF C;  3TSS A;  1G2S A;  3I8Z A;  5C4H A;  3GTL B;  3Q0A A;  4R8N A;  3S1Q B;  3LNN A;  1WTW A;  3P75 A;  3N52 A;  1IL8 A;  4IUR A;  3BDL A;  1O80 A;  1SMY D;  3X3M A;  1RHP A;  1D5Z C;  1EEI D;  1UAP A;  2L9H A;  3SHL A;  2WKD A;  1PRT D;  2J7Z A;  4EGV A;  3TBI B;  1I4R A;  4J8Q A;  1BCP B;  3R93 A;  4H44 C;  1DXM A;  2CQA A;  2KCN A;  5KIX A;  1EY0 A;  5IOC A;  4M8A A;  2J4X A;  2AUK A;  1RTO A;  1ET6 A;  3CRL C;  3E0J A;  2KEE A;  4H13 C;  4HMJ A;  1SE2 A;  4ZLT F;  1FGB D;  5I9O A;  4Q5V A;  1EY6 A;  3A8I E;  4O1N A;  3LX0 A;  1JE4 A;  5EKI A;  2IJ0 A;  2DN8 A;  1IKM A;  2L11 A;  1TWH B;  1ESR A;  3EJI A;  3D4D A;  3NE5 B;  4QUF A;  5C5L A;  5KEE A;  5C5M A;  3SR1 A;  1IW7 D;  3NTK A;  4KKU A;  4C3H G;  4DF7 A;  3T53 B;  1Q1B A;  1PYW D;  2KUM A;  3A7A B;  2A6E C;  2EYF A;  4A93 B;  1VCI A;  4FVM A;  2RBM A;  1QOH A;  3PV0 A;  5G3L D;  4EVO A;  3J80 L;  5FKA C;  2PW7 A;  1YNJ C;  2PPB C;  1CZG A;  5NUC A;  3VR5 A;  3K5L A;  2F0O A;  1ZEQ X;  3T16 A;  5J1Z A;  3ND8 A;  3PUW A;  1WTP A;  5EQ0 A;  3PO3 B;  4FYD A;  2NVQ B;  3MHB A;  4A3F B;  1JWS D;  3HOV B;  1KAA A;  3P1H A;  2YU9 B;  5C4Z A;  2MP1 A;  1SNC A;  3KLR A;  2G9H D;  3NTI A;  4KTA A;  1XWE A;  4XDX A;  4ZUJ A;  3C46 A;  1HFG A;  4K2L A;  1L0X B;  1JWM D;  1S5F D;  3W3A A;  3GV3 A;  4OIJ A;  4HR7 B;  3KUP A;  2AQ2 B;  2NN6 I;  5CGK A;  1II3 A;  4NKL A;  5COR A;  4CBV A;  1H9R A;  3F2U A;  2K5D A;  3GP7 A;  5EPJ A;  4HAE A;  1B3A A;  2L0C A;  3RD4 A;  1D5M C;  5DM7 3;  5EPL A;  1LTA D;  1HTP A;  4NW2 A;  1GOZ A;  2L1B A;  3D3R A;  1V8Q A;  1LTS D;  1DYQ A;  2NTS A;  2B2U A;  1EU3 A;  1HQM C;  1B9M A;  4ULL A;  5IGF A;  4X3T A;  2L5T A;  2JEA I;  4B9W A;  2EZV A;  3K5M A;  3VR6 A;  1AZQ A;  2X69 A;  5M3M B;  1O78 A;  3TN2 A;  3S2H B;  2MUY A;  2O4X A;  2PZU A;  1I3Q B;  3N6R A;  2XWJ B;  3V2T A;  2AQ1 B;  1HA6 A;  3SDZ A;  3H3V C;  4DNT B;  3DUZ A;  5JVH 3;  5BN4 A;  3GTG B;  1DJR D;  4A3D B;  3I4L A;  3GTJ B;  2F0H A;  1DM0 B;  1SJH D;  1F9Q A;  3SE0 A;  1H9M A;  2PCF B;  4XQQ A;  4G7O C;  1HTL D;  3RZO B;  3H09 A;  2F3V A;  1O7L A;  2RSN A;  3EFX D;  1C48 A;  2JA6 B;  4CJ0 B;  3M3Y B;  1LTT D;  1FR3 A;  4X3U A;  3H0G B;  5IT9 L;  3M4Y A;  4ZUI A;  4FF2 A;  1TKW B;  5FLX L;  3MAQ A;  2VB2 X;  1S4Z A;  4FF1 A;  4K8J A;  1DOM A;  2D2C C;  1MGS A;  4G57 A;  1BOS A;  3L7Z C;  3LWE A;  1S5B D;  2MJ8 A;  3KBG A;  1CTM A;  4U68 A;  1CHP D;  1I4G A;  2EY5 A;  3ITP A;  1D1K A;  3K5O A;  4DA2 A;  1NR4 A;  1RJT A;  3GO5 A;  2B8F A;  1I6V C;  2LS0 1;  2OT2 A;  2R3Z A;  2K04 A;  2JEB I;  1JCK B;  4CJ1 B;  5E3F A;  4CJ2 C;  4XXE A;  2VXW A;  5DM6 3;  3G6J B;  4ZKC B;  1U9R A;  1H9S A;  1CA5 A;  3DWP A;  3K57 A;  1LLR D;  3IL8 A;  3J7Y W;  2BDO A;  4IFD G;  1X32 A;  3NWT A;  2WV6 D;  2JA8 B;  4BWG B;  1EY9 A;  4OO1 I;  3S2D B;  1DCZ A;  3MA2 B;  1QCB D;  1PFN A;  1WTR A;  3NXW A;  4DK0 A;  1S5C D;  4KJN A;  3J81 L;  2LKV A;  1B1Z A;  3KLS A;  2HDM A;  4IUU A;  1QIL A;  3S1M B;  3K58 A;  2PYK A;  1TII D;  1QE6 A;  5K5P A;  2Y0S B;  5ISR A;  1SYD A;  2R7Z B;  4BA1 I;  4KK7 A;  4KKT A;  1ILP A;  2R61 A;  3D4R A;  3VA5 A;  1GUS A;  1F9S A;  3RZD B;  2F03 A;  1Z47 A;  1KNE A;  2Z4H A;  4C3J G;  1Y1V B;  3Q24 A;  1WCM B;  2SOB A;  3SK4 A;  3E6Z X;  5EBD A;  3QOJ A;  4DN4 M;  1D1I A;  3NBH A;  3ZYY X;  3GD7 A;  2RVL A;  4RKB A;  2M9V A;  3SXH A;  2E74 C;  2FMC A;  2OF1 A;  1KDC A;  1CT1 D;  2ZXP A;  2O5J C;  2PZT A;  1PXU A;  4IUV A;  2EJM A;  1IYV A;  4DFA A;  1LT5 D;  4C2M B;  1LTG D;  1E2V A;  5KRU A;  4RHR A;  5I9P A;  1RTN A;  3GTM B;  2RA4 A;  1MI2 A;  3IFD A;  1CA6 A;  4FNF A;  5EJW A;  2X6L A;  5T1I A;  1EZ8 A;  1Q1E A;  3TZD A;  3MWY W;  1RCV D;  2F0I A;  3HS0 C;  1G2T A;  3DMU A;  1K8M A;  4K5X A;  1IKL A;  4IFD H;  2L4N A;  1TS4 A;  5IGG A;  3S14 B;  4KD3 A;  5D3I B;  2H4O A;  5FO8 B;  1JIC A;  1EZ6 A;  2DNE A;  2E2H B;  3TP7 A;  3NPP A;  4WFN 3;  1XYI A;  4ZRZ A;  1HPC A;  4EQN A;  4F88 A;  3KF8 A;  2MHV A;  1PTO F;  1JOO A;  1G29 1;  3NBI A;  4PNY A;  1PTO C;  1JOK A;  1T5X D;  3A56 A;  1HUM A;  1E2Z A;  3K7A B;  3R8B A;  4RCN A;  1YNJ D;  1EFI D;  1BF4 A;  4KY6 A;  1F2M A;  1BCP D;  1FNW A;  3GQB A;  1PMR A;  1EEF D;  4C3I B;  3P7J A;  3T56 B;  2MGS A;  3AB9 A;  5ELC A;  1KDB A;  2EYP A;  3R2T A;  2ZXO A;  3S1N B;  1Y8O B;  1B44 D;  4Q0F A;  1A15 A;  2F0W A;  4IUN A;  5M5Y B;  1EWH A;  1LV9 A;  5JVG 3;  1EY4 A;  1ENC A;  3I91 A;  2F4I A;  4G7H C;  2IX0 A;  2TSS A;  4KY7 A;  2K05 A;  1H9J A;  3K5N A;  1AP0 A;  4IUQ A;  2F0V A;  4RGO S;  2K33 A;  5D65 A;  2Q8T A;  4DK1 A;  4V0B A;  3M85 A;  3FRP B;  5EGT A;  5HGT A;  1YNN D;  4DAY A;  3PUV A;  3I3C A;  4EQP A;  4DGZ A;  3MFY A;  3J80 E;  1ZYR D;  3K59 A;  3MVV A;  2EYH A;  1GHJ A;  2F0Q A;  3QO2 A;  2Q8I B;  3WDN A;  2K1B A;  3X3N A;  4I65 A;  4XYQ A;  2XN9 C;  2XWB B;  3MXN A;  1BQQ T;  3TZU A;  1EYD A;  4QCL A;  2HCI A;  3AU7 A;  4FF3 A;  1W6J A;  1STH A;  2BE5 C;  1I4P A;  3DEP A;  1A2T A;  3EA6 A;  4C3J B;  3S16 B;  3S9W A;  1TS3 A;  4K2K A;  2CW0 D;  2KA7 A;  4IUT A;  2F0S A;  3ERQ A;  1W6K A;  3ERO A;  2F0D A;  4AYB B;  2F0T A;  2A6H D;  1HA5 A;  1OXS C;  4A3I B;  1M8A A;  4KN4 C;  1SYF A;  3BZD B;  1AN8 A;  2JA7 B;  3I4N B;  5LHY 1;  3TP8 A;  1B4O A;  1WTX A;  4CGY B;  1ESF A;  1I4Q A;  2DY8 A;  5IGD A;  2BDN A;  1AW7 A;  3NP8 A;  2QIL A;  2R92 B;  1EOT A;  2G9D A;  2KJX A;  2K03 A;  1SEB D;  1WTO A;  1D2B A;  3CQZ B;  2J0T D;  3U9S A;  2BA0 A;  3M7N A;  4DXF A;  1LT4 D;  2I46 A;  2KHS A;  1V1P A;  2K01 A;  4C1N I;  1VDZ A;  2IWH A;  1UEA B;  1BR9 A;  1SJE D;  4C1N K;  2NN6 G;  2ICI A;  2A5H A;  5DNF A;  1B2T A;  3UI2 A;  2NWG A;  5CYU A;  1VF5 C;  3I90 A;  4A3B B;  1CZW A;  4IN3 A;  3V05 A;  4IAL A;  1QNK A;  1SND A;  2QKI C;  4TKO B;  2O5I C;  1ICW A;  1ILQ A;  2JE6 I;  4J1M A;  1D6E C;  2YYZ A;  2B8G A;  1QG7 A;  2TMP A;  2BA1 A;  3WOF A;  1SAP A;  1SMY C;  2JSO A;  2F1M A;  1KLU D;  2FIN B;  1O7Z A;  1SNM A;  2X6G A;  2RDF A;  3R3O A;  2F0F A;  5IT9 E;  4RA8 A;  1HHV A;  3ND9 A;  1PRT F;  1JWU D;  4RAU C;  1PRT C;  4F7X A;  1OXX K;  1F9R A;  3J7A V;  5FLX E;  1JQY D;  2HDL A;  2B63 B;  4HN7 A;  4A3K B;  3RMH A;  2XSC A;  3VA7 A;  3IAY A;  4ZQ3 A;  2F0L A;  4TSS A;  4YIJ A;  4B9X A;  2VNU D;  3GTQ B;  2A68 C;  1GUT A;  3PIP 3;  4PMC A;  4I7Z C;  2M00 A;  4LK1 C;  3CU7 A;  3WOE A;  5KGU A;  3AMU A;  3MFG A;  4RFB A;  4R8I A;  1GUO A;  3A8J E;  2EYJ A;  1OXT A;  3FPP A;  4ILW A;  2V4D A;  1SFO B;  2JA5 B;  2D62 A;  3PO2 B;  1IW7 C;  2F0U A;  4N9P A;  1BUV T;  3RUZ A;  1DD2 A;  2B2T C;  2NN6 H;  2B2V C;  3FMC A;  5CBA E;  1LT6 D;  1K8O A;  1TS5 A;  1I4H A;  4K5W A;  1KTK A;  1TWA B;  3HOY B;  2IX3 A;  4QUC A;  5JOB A;  1EY5 A;  4IUP A;  2EYM A;  3MXG A;  1C4Q A;  1GJX A;  3J81 E;  1G91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...