1QNKA

Truncated human grob[5-73], nmr, 20 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
69
structure length
69
Chain Sequence
TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-X-C motif chemokine 2
publication title Nuclear magnetic resonance solution structure of truncated human GRObeta [5-73] and its structural comparison with CXC chemokine family members GROalpha and IL-8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
total genus 5
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qnkA00
4R9WA 2MJ8A 2X6LA 1XX8A 2L12A 4XT1B 1X3PA 1DONA 1F9RA 1WTVA 1AZPA 3ONAB 4X3UA 2KUMA 4CJ2C 1HFNA 1EOTA 2RA4A 1PLFA 1IKLA 1BO0A 2K04A 2RVLA 3LWEA 2EE1A 1VMCA 4RAUC 1ICWA 2J7ZA 1MGSA 2Q8RE 5D65A 1WTWA 2NYZD 1XYIA 2B2VC 1AZQA 3KUPA 1F9QA 4R8IA 3KBXA 4MHEA 5EQ0A 2B2WC 1PFBA 1NAPA 2JP1A 2DY8A 4IUPA 2VXWA 2B2YC 4HCSA 2B2VA 1WTQA 3I8ZA 3IFDA 5D14A 1WD1A 1SSOA 5EKIA 4QUCA 5T1GA 5JJZA 2B2TA 3UI2A 4IURA 1C8CA 4X3TA 2K05A 1ESRA 1U4MA 1VMPA 1B4OA 2HUGA 2L1BA 1WTOA 4UAIA 1SAPA 1B2TA 1ILQA 1LV9A 3TN2A 1IL8A 1E0BA 5T1IA 2KEDA 4IUQA 2N88A 1RODA 2BDNA 1G6ZA 3N52A 4IUUA 1EIGA 1O7ZA 1ZXTA 5DNFA 2L9HA 1MSHA 1EIHA 1B3AA 4CJ1B 3MTSA 1EQTA 1WTPA 5CBEE 1AP0A 1G91A 1F9PA 2HDMA 2HDLA 4X3KA 2K1BA 3I91A 5E4XA 1WVLA 2FMMA 2L4NA 1A15A 3TZDA 5EPLA 2NZ1D 1B53A 1RHPA 2RSOA 4ZKBB 1F2LA 1ILPA 2B2TC 5COYA 3F2UA 1RJTA 2B2UA 1B50A 2SDFA 2NWGA 1SDFA 1CA6A 1KNAA 1U4LA 2XIWA 2FINB 1HA6A 3FPUB 3GV6A 2L11A 5CBAE 3MWYW 2HCIA 2K01A 2K03A 1JE4A 1O7YA 2KOLA 1MI2A 3FDTA 2Q8TA 4LMQD 1EL0A 2D9UA 2KECA 2KEEA 1HHVA 2FFKB 5EPJA 1J8IA 3D6WA 1BF4A 1JICA 2FHTA 4HAEA 5EJWA 1PFNA 3SVMA 1G2TA 1M8AA 1F9SA 1O80A 1Q3LA 2B2UC 3HP3A 4RWSC 1QG7A 1CM9A 1U4RA 4U68A 1DOKA 2IL8A 3QO2A 1G2SA 1DOLA 1DOMA 4OIKA 4QUFA 4ZK9B 1DZ1A 1KNEA 1PFMA 1QE6A 2MP1A 4XDXA 1CA5A 2X6GA 2K28A 1J9OA 1WTRA 1IKMA 3I90A 1TVXA 1MSGA 1U4PA 2DY7A 3GV3A 5EPKA 2M2LA 3DEOA 2EPBA 1RTOA 4MN3A 4HEDA 2HCCA 2X69A 1HUMA 1BNZA 3I3CA 2MGSA 1NR4A 1ML0D 2JYOA 5AFWA 4OIJA 1NR2A 4IUTA 3P7JA 4IUVA 3DM1A 5CORA 2R3ZA 1RTNA 4O42A 4ZKCB 2KVMA 1BBXC 2EOTA 4XT3B 1HUNA 1HFGA 1NCVA 1WTXA 4NW2A 3DEPA 4X3SA 4ZAIA 1PDQA 2B2WA 2H1EA 2B2YA 2RSNA 3H91A 1X32A 3G7LA 2FJ2A 4HSVA 1X3QA 2MPMA 3R93A 2CVRA 2N55A 4ZLTF 1WD0A 1HRJA 5E4WC 4RA8A 1QNKA 5CMDA 3IL8A 3Q6SA 4DN4M 1S4ZA 4CJ0B 1GUWA
chains in the Genus database with same CATH superfamily
3DLLA 2B39A 1GUSA 1HCZA 1RKNA 2CWAA 4LFAL 2IPKD 1GHKA 4CGYB 2VUMB 4X3UA 4JV5L 2QA4A 2EIFA 1VQBA 3FPPA 2EJGC 3TDQA 1WTWA 2JA5G 2JA7B 1Z9FA 2F0KA 3E6ZX 4MHEA 5EQ0A 4ZUJA 5DLQE 4DR3Q 2E2HH 1E22A 2B2TA 4IURA 1EU3A 1CHPD 4A3EG 1NY4A 1H9JA 1LO5D 4OX9Q 1WTOA 4ILWA 4H0LC 5C4HA 3TP8A 2UXBQ 1E0BA 1EZ6A 2SOBA 2JQOA 2N88A 4KN7C 3UDIA 3N52A 1TWHB 1O7ZA 1EIHA 1E1TA 1SJED 3BZDB 3AEVA 3CCRA 4C3JH 4LF6L 3IAYA 1I6HB 3HOWH 3B6YA 5KNBA 2ZTCA 5AJ3L 4DAPA 1MBYA 4LNQA 4A3IB 2VUMH 3TSSA 3L2PA 1BVSA 5CV8A 1EWHA 4UPAA 2XGTA 4A3BG 1HA6A 2JA7H 1LLRD 1BR9A 4JVZA 1KDAA 1EQVA 1K0RA 3E9HA 2D9UA 1LTTD 5GAHC 5L37A 2WKCA 3HRZC 3R3OA 1PA6A 1HZ9A 1TWAB 4RWSC 1FGBD 1S5CD 5C4XG 2IL8A 1DOMA 1KAWA 4K5XA 1TWHH 5TSSA 1CA5A 1YITA 1IYVA 3A7AB 1Q46A 1SNMA 4L5QA 1K73C 1I6HH 1IKMA 4FF1A 4KKSA 4NXML 5FLMH 5E3FA 1X54A 4LAAA 2PW5A 2WP8J 1K8GA 1H9SA 1HXYD 2OQKA 1Y1VG 2X69A 4A3IH 3S2DB 1EU4A 3HKZE 1NR2A 3E9IA 3F2BA 1HFGA 3DEPA 3Q8DA 4IO9A 4A4IA 5IE8A 1N34L 1DCZA 2GN5A 2VQFQ 2UU9L 3GO5A 5HGQA 1BXTA 4UHVA 5IYBH 4FVMA 4H44C 1VQHA 1PMRA 1TWAH 5ELEA 1YJ9A 1DJRD 1X3GA 3EFXD 1GHJA 3H0GB 4RAUC 1CUKA 2EVBA 3T1HL 4X6AH 3D31A 3D4RA 2IW3A 2KCTA 1GM5A 3HOUB 1STAA 4HCSA 1N8RC 1SMXA 3K6OA 4Z9CB 4PV1C 4YCUA 4QCLA 4FXKC 5T1GA 3S2DH 4B08A 3UI2A 1Y14B 3E5SA 2Z6KA 3I4MG 1PH3A 3CC7A 1Q81C 2L0CA 5IGGA 5IOCA 4YWMA 1G6ZA 4DR1Q 2N8NA 2E5LL 1VQLA 3OIPA 4GN5A 4GNXB 5A2QL 2TSSA 2ICIA 3M4QA 4K2LA 2D2CC 4A93B 3J7YW 3HOYG 2DNEA 3PO3G 3KJPA 4JI0L 1F2MA 3NXWA 2PI2E 1BOSA 1PTOC 2XIWA 4LF4L 3H0GH 1I4PA 4DV6Q 1UE7A 4KD4A 1ENFA 1B9NA 2NN6H 2F0GA 3AB9A 1EOVA 3LGJA 3HOUH 1ET6A 4DFAA 3KFUA 4LF9L 4IOAA 2F0HA 4A3KG 1Y1WB 4PMBA 2RDHA 3A56A 4HSPA 1KQSA 4DV4L 1DXMA 1V1QA 2V4DA 3PUZA 4I65A 4QJFA 2JA6B 1OXTA 1E24A 1OXUA 5KNDA 2Z0SA 3TREA 3UDXA 4A93H 1CI3M 2D62A 2M2LA 4DK6C 4DV2L 2HCCA 1NR4A 3PUYA 2B29A 3UDGA 4DR6L 5JVH3 3HOZG 2AQ2B 2Q2TA 4NXNL 4DUYQ 3KYHC 1NUCA 1E2ZA 4ZAIA 1PDQA 4PG3A 2H1EA 2MPMA 2CVRA 1XNRQ 1VQ4A 3H3VH 5FOBB 1ENAA 1Y1WH 3KBGA 4FF4A 4C3IB 1XNQQ 1ICFB 1PXUA 2JA6H 2JEAI 2ZJRA 1RL2A 5K36G 2A69C 3R2TA 4I7AA 1YEZA 5JEAH 1BBXC 1UAPA 2CFMA 2EY5A 2SNMA 3LWEA 3M9BA 2ICEC 4LFCL 2WB1G 4BY1G 4R8IA 2F0SA 3MVVA 2O5JC 1B8AA 1EYAA 2JP1A 4X62Q 4QF4A 1KLGD 4B3RL 1I50H 3J7AF 3SXHA 4X64Q 3W1GA 1U4MA 5LMNW 4O0AA 3SE0A 1GJXA 1YVCA 2F3WA 2KENA 4K14A 2GVBA 3J7AV 1Q86C 4OXPA 2JK8A 3TN2A 3F2CA 1X65A 1B7YB 1X3EA 2BH2A 1RCVD 4A3FB 1KD1C 2OXPA 1UEBA 2NBFA 1F9PA 3JC66 5E4XA 4PNYA 4F87A 1A15A 5M3FB 1UEAB 1B53A 4C3IH 4CDCC 2NVTH 2E74C 2B2UA 3RD4A 3T56B 1YNXA 4HJ5A 1SE4A 1JOOA 5M9OA 4DV1Q 3PUXA 4XTCS 1TS2A 1RD9D 1V1OA 2Q2IA 4DNIA 4C3JG 5LMNQ 2K03A 5BN4A 4AQYQ 5JJKA 3HOWG 3D8GA 1WJJA 5JJIA 4POFA 1TWCB 1LTGD 1CKNA 2KECA 3M7GA 3AU7A 1GUOA 1MHWC 3QOLA 5EPJA 1J8IA 1L0YB 4HAEA 1G2TA 4N8FA 5IY0A 1WCMB 2JA7G 5CV5A 4YCWA 4JOIA 3STBD 1CM9A 1U4RA 1DOLA 3NWSA 3OSOA 3J80L 4A3FH 4RGMA 1PFMA 3BJUA 2F0VA 4JK1C 1C0AA 2N78A 2PCFB 1D5MC 2VS1A 4TSSA 5AFWA 2LKVA 1C7YA 4M1UB 3GTJB 2Z9HA 1PH9A 2AUJD 1HR0L 2EYJA 4DV3Q 4DKAC 1WOCA 1K8MA 1B44D 5FLMG 1TWCH 3NQIA 4A76A 1HNWL 3H09A 1Y8NB 3IFTA 4JI5Q 2PMZE 4A3IG 2A68D 4DAYA 1D2BA 3DHQA 3C1EA 3Q23A 1GUWA 2EY2A 4JW0A 1WCMH 3V05A 5C0XI 1D5XC 1KABA 1PYWD 2KHJA 3CPFA 4X64L 4XQNA 2H4OA 3VR5A 3KDFB 3KLRA 2RA4A 4X3SA 1PLFA 4POGA 2E2JB 4YY3L 2Y0SG 2J7ZA 4DGZA 4OO1H 3KBXA 2RHSB 1SNPA 2HQEA 5C3EG 4DV5Q 3C46A 1LABA 2FXQA 5KEEA 1YNNC 3KLSA 3HKZG 2M9VA 3I56A 1Q1EA 3AMUA 5ISRA 1SYFA 3TS2A 4H13C 1ESRA 3WOFA 3GTJH 1RDPD 1RF2D 1PTOF 4DK3C 1LV9A 4K6DA 4GLXA 4GZYC 1NE3A 4CBVA 1VQ7A 3P75A 1N33Q 2F3VA 1PH1A 1EIYB 1ZKOA 1FJGL 4CHTB 4MIUA 2ZT9C 1L1OB 1BCPF 5FO7B 4K5VA 1AEXA 4UY8C 2JJQA 5JVG3 5FLXE 4FF2A 2NZ1D 1PZID 1YHQA 1UNSA 1TS3A 3U4VA 4KJOA 3ULLA 5FO9B 4KI0A 2A8VA 2E2JH 3RUZA 4Y52H 2SNSA 3CAMA 2RF4A 5GAGC 3RN5A 2QKIC 3FKIB 5ELCA 4YHHL 4F8MA 1SRUA 1K3RA 3VR3A 5DM73 3H0GG 5NUCA 3HP3A 1Q3LA 2MFIA 3PUVA 2IWHA 2ZXRA 4KHZA 1SNCA 2NN6G 1QG7A 4OONA 3HOUG 2KQ3A 5KNCA 1J6QA 2KBNA 4R1JA 4RGOS 1KRSA 1E3PA 2K28A 4DV3L 5HGTA 1VQ6A 1I94L 1TVXA 3SK5A 3ND9A 3P1HA 3L0OA 3MXNB 1VQCA 4KHVA 2B63G 2AWNA 3EVQA 1ASZA 2CW0C 2LS01 5M3MB 3ULJA 2L55A 2ZXOA 5CV6A 3PO2B 1AFPA 4XT3B 1HUNA 4YWLA 3NTIA 4QGUA 1HQRD 1W6KA 1JB7A 2IX0A 4A93G 3FKIH 3E3XA 2OQ0A 1VS0A 4BWGB 4IN3A 5E7NA 3QJYA 4IALA 3M7NA 1CKOA 3BU2A 3I4NG 5EKLA 1JWMD 3MFYA 4XT1B 3I73A 4JI7Q 4A3CH 2PI2A 4RGTA 5I2XA 1MGSA 3NBHA 3I7FA 3KUPA 1LM0A 1Z6HA 1NAPA 1STBA 1F77A 1K8AC 1K83B 2J4XA 4JI4Q 4LF5Q 4BBSB 2JA6G 1HZBA 5IIFA 5M3MH 1B2TA 5IT9L 3PO2H 3WOEA 2BE5C 3J81L 1CT1D 5T1IA 2E75C 1PRTF 4APVA 4IOCA 2ASBA 1ZXTA 5CR3A 3QR8A 2LXJA 3X3MA 1EZ8A 1O7IA 1G51A 4RMFA 1FVIA 1VDZA 3BDCA 5KGUA 2PPBC 2F0MA 4ABNA 2L15A 1IHZA 2LSSA 2PO4A 4LFAQ 5ELOA 2NTSA 4RKLA 1I4RA 2QW7A 3GV6A 1JWUD 1ZYRD 4J1MA 1EY0A 3MWYW 2ENBA 3ITPA 5I9OA 5DEHA 2A6EC 1K83H 5C3XA 1X3FA 1EUJA 4JBWA 4C3IG 4BBSH 4P71A 2E76C 4ME3A 4HJ8A 4C1NI 1IBML 2Z6BA 4F7XA 1B1ZA 1IBLQ 1M4VA 2PQAA 4GS3A 4U68A 3U9SA 2JA9A 2AHOB 3U50C 4A3MB 2F0TA 1XTCD 1MSGA 1U4PA 4LF6Q 3DEOA 1II3A 5AJ3Q 3FHWA 3EROA 1LTSD 1SLJA 2D5DA 1HJPA 4IUTA 3DM1A 4RGNA 5CORA 4O42A 4ZKCB 2I46A 2KVMA 3EA6A 1WTXA 4HIOA 1FR3A 3G48A 4B3TL 3KF6B 2BH8A 3KLWA 5IT9c 1VQOA 1KDCA 2F3IA 4JC0A 1QILA 2NVXB 1Z7TA 3VA5A 5IWAL 3BS1A 5HURA 3C2PA 1B3QA 4HIDA 1HFNA 3K5NA 4A3JB 4G57A 2K04A 2K33A 2K6AA 3D0FA 4IPGA 2OWOA 2DY8A 2B2VA 1WTQA 5D14A 4BY7B 5EKIA 4QUCA 4NXMQ 2K75A 1WCMG 1SEBD 1CKMA 4IFDH 3DWQA 3M3YB 1B4OA 2WAQB 4NPSA 3PIOA 1N36Q 4OO1G 4O1NA 2CKZB 1HQMC 3ICEA 4QMGA 4FF3A 3S1MB 3PSIA 3S1NB 2WKDA 2P5ZX 1N34Q 3VR6A 2UU9Q 5FK9C 1UE5A 1EY8A 2CWPA 2NVXH 2R93B 5COYA 3KOJA 1HTPA 1TKWB 1NBWA 2NVYB 4KY7A 3MFGA 1IBLL 4PQXA 2BA0A 2ZM6L 1V1PB 3RR5A 1K8OA 1K9MC 3BVGA 3T1HQ 4XYQA 3S2HB 4RG1A 4AIMA 5CV4A 4BY7H 1TT2A 4DUZL 5C44H 1GKHA 2R7ZB 4P75A 3M3YH 1HTLD 2PZUA 2RBMA 1A2UA 4QQBX 1KDBA 4KY6A 1DOKA 1C4QA 2EZVA 2C35B 3S1MH 3ZJYC 4FYDA 4DR2Q 3S1NH 2KCCA 2E5LQ 1SMYD 1V8QA 4CKCA 2IHEA 5JPNC 1EYDA 1BNZA 4FP5D 4LJZC 2JYOA 3CCSA 2NVYH 4JI0Q 1VQMA 4GN4B 1SNQA 4Y7NB 1JJGA 4LF4Q 4DXFA 1NCVA 2F4VL 3S2HH 4DU9A 2LXKA 3H91A 1DGSA 1YNJD 1BDOA 4R4CA 4LF9Q 3Q0AA 4GKJL 4LFBL 2R7ZH 2UUAL 2KHSA 3GTGB 1SNOA 1VQ5A 1ASYA 1FNVA 4DN4M 2Y0SE 4FNFA 4RHSA 3K0XA 1KRTA 3CCEA 4BS9A 4KJNA 5IYDH 4DV4Q 3CXCA 4J6HA 2PNRC 5D65A 4EQ5A 3F8TA 3FKIG 3HOXG 1N36L 3QOJA 1R4QB 4FXGC 2B2WC 2ES2A 2B2YC 4N8X1 1M90C 3I8ZA 4EQPA 5JJZA 3H6MA 2K5NA 3FMCA 1WI5A 1SR3A 1X56A 4DV2Q 1Q12A 4A3CG 4DR6Q 4L5SA 1VCIA 1QOHA 2NVQB 2EYMA 3CD6A 2Z4IA 1X55A 2R7FA 4NXNQ 5BN5A 3G71A 1PTOD 4CJ1B 2QILA 1IYUA 1PYSB 1S5BD 2NTTA 3GTGH 2UXCQ 1SE2A 1MIUA 1SYBA 2R6GA 3GDEA 2PZWA 1UUPA 1QUQB 2K5VA 3PO2G 1BCPD 5IP9H 2SDFA 2NWGA 3HOVG 4PZ6A 4A3GB 2AQ3B 2KCNA 4DPGA 3PIO3 3VA7A 4ZQ3A 2IT1A 4LFCQ 1LTBD 5J39A 1Y8PB 2KOLA 1MI2A 1EY9A 3FDTA 4DR2L 1MJEA 3K57A 3ERQA 3K80C 2IY5B 2FFKB 4B3RQ 4TQUS 1PFNA 4YIJA 4R4IA 3I4OA 2NVQH 3D3RA 2K32A 2EXDA 4GNXC 1HNZL 2XRQD 5JOBA 5A2QE 1G2SA 1LT6D 4MTKA 2XSCA 2R92B 3KF8A 4XDXA 2EDGA 5CC4A 4BBSG 2KCMA 3I90A 4K0KQ 4Q0FA 1KXLA 1ZEQX 5EPKA 2EPBA 4MN3A 4DXGA 3KJOA 3PQIA 2NN6I 4OWWB 4IPDA 5GROA 4GN3B 1BQQT 4ID6A 3CMAA 2EOTA 3GTPB 1QNUA 3H3VC 2LY7A 2MO0A 4WJ3M 2CHBD 4P72A 3SGIA 3H15A 1F2ZA 2RSNA 4C2MB 3R93A 2XN9C 3G7LA 4V0BA 4ZLTF 1GXDC 1T5XD 2F0EA 1BCPB 1KL9A 2K7VA 1QNKA 3Q6SA 2YTXA 4DNRB 4K6LA 3S24A 4DAMA 1HR0W 4BA2I 1EYCA 2PQEA 3K7AB 1Q8KA 1BBWA 1X3PA 4OWXB 2UUCL 3ONAB 3CU7A 1VMCA 2R92H 1YIJA 4BA1I 4WFN3 3K58A 1NTGA 1L0WA 3T51B 3HEJA 4PZ7A 2F0PA 2NZOA 2B3GA 1SSOA 3R8BA 3CP0A 1EIFA 2EYOA 2UXCL 4A3LH 2RKSA 4QIWB 1SAPA 3A8JE 1EWIA 5IYCH 3GTPH 1IL8A 3DWAA 1PH2A 1B9MA 2A74C 1QVCA 1BUVT 5FJ8H 1HR0Q 3MZ5A 2ZTEA 1YI2A 1I6VC 4C2MH 3TP5A 2L9HA 2PZTA 2A6HC 1HNWQ 2HDLA 2NB0A 3I91A 3MA2B 1EQRA 1PRTD 2RCFA 3BVMA 5GADC 1FNWA 3CC2A 4R4QA 1RHPA 4DR7L 1ILPA 4X65L 1F2YA 1DD2A 4FDBA 3TZUA 2XTIA 4KV6A 4JI8L 2EYHA 1B50A 3RLNA 2MHVA 4XYOA 1SDFA 4I7ZC 1IXRA 1KNAA 4JI6L 1VQPA 4JI3L 2QDBA 4YY3Q 2K5HA 2AKWB 4LF8L 4C56C 1OTCA 1XMQL 4OELB 3NTKA 3VYUA 1KHIA 4K0KL 4AYBB 1BBUA 2E2DC 1IBKL 3PMFA 4FO2A 2IHFA 1O80A 1P8LA 5JEAJ 4BY7G 1FJGQ 1WFQA 2IX3A 5C44G 3F2DA 5G3LF 2WAQG 4A75A 1V9PA 1TWGB 3JAML 1SYGA 1RIPA 1STHA 3NTHA 2F0JA 2R3ZA 2VUMG 1PHJA 3U4ZA 4GOPB 1PRTB 3M4OB 3TRZA 1VQFA 1X3QA 2UXDL 4GOPC 1D1IA 5BN3A 1HRJA 3G6EA 1S5ED 4YHHQ 4CJ0B 3TQYA 4CKBA 3J80E 5M3FH 4ALPA 3FRPB 3GTLB 1YHBA 4K5WA 2WFWA 1STGA 4B3MQ 2YV5A 4K8JA 5KYIA 4ZUIA 4G7ZC 2R7ZG 2AUKA 3IFDA 1I94Q 2Z8LA 2LFNA 3A74A 1I3QB 4X3TA 5IYDG 1D1KA 3TS0A 3PF5A 4BBRB 4IQZA 3HG9A 1LTID 2YU9B 2KEDA 4S3SA 3NQTA 2OT2A 3CCMA 1PZJD 3M85A 1W6JA 5CBEE 4RCNA 3A7LA 5D3DA 4A3EB 2RSOA 3X3NA 5IYBG 1D7QA 3SK6A 1RJTA 1Y69U 2BOSA 1PVOA 2RQXA 1U4LA 2GVAA 1EY4A 1EQQA 2Q2HA 2K52A 2VQEL 2F4IA 3A55A 5CBAE 2L11A 2DUDA 3JAMc 3G6JB 3STBC 2XWBB 4KHPL 2N3SA 1LTLA 1TQOA 5H1SE 1VQIA 3OPOA 1K3BC 1SE3A 5IGDA 1I3QH 3S9WA 1ENCA 4HN7A 5IP9G 2CCZA 1EEFD 3RLOA 4BBRH 1L1OC 3L9AX 2YU9H 2ZTDA 3PUWA 3A8IE 4LUZA 1AZQA 3MAQA 4OIKA 4PMWA 5LHY1 4KKUA 4JI1L 1H9SB 2CW0D 1PH5A 3GTOB 1EY6A 4A3EH 1PFSA 2JE6I 3CPWA 4DV7L 1XXGA 2K5WA 1XPOA 1QJOA 2A68C 3P7JA 5I4DA 1HZAA 4UP8A 1JQYD 1TY2A 1L2FA 2B2WA 2B2YA 4B3ML 1IYJB 1VQGA 3GP7A 3CCQA 4DK1A 1JORA 1YZ6A 2PNHA 2ATWA 4OHJA 1Y1VB 3FP9A 3BDLA 4AH6A 1ILQA 2BCOA 2DGYA 3I55A 1IBMQ 5ELBA 2K5QA 2F0WA 3I70A 1QVFA 1EWCA 2UUBQ 2RVLA 1AN8A 2EE1A 1ICWA 2GA4B 2YTVA 4DNTB 1F9QA 1QVGA 3GTOH 1GVPA 3ER0A 4DK0A 2ID0A 1L0XB 2F0IA 2TMPA 2EQSA 4OL7A 4YCVA 2DJFC 3NPPA 5EAYA 4KLKA 1PYBA 5C3WA 4DF7A 1SJHD 2R92G 2HT1A 2QDLA 3G4SA 3J80i 4B9WA 1XPRA 2F03A 3OYYA 1JOKA 4IUUA 5DNFA 4B3TQ 3VDYA 2AMCB 3I4LA 3CQZB 3MTSA 1G91A 2I07B 1Q8IA 1EY5A 1Y1VH 4A3LG 1NNXA 3TZDA 5M5WB 1DM0B 5IYCG 3F2UA 4XXEA 1Y1WG 3U9OA 3MXGA 2SEBD 3I4MB 4GNXA 5IWAQ 1CA6A 5FJ8G 1VQJA 2FINB 2F0UA 2IJ0A 1K28A 3FPUB 3NEMA 5JEAG 4NMZA 5FLXc 3NP8A 1O7YA 4L63B 1IW7D 5IT9E 1CHQD 4B3SQ 3HOYB 2V1CC 1P16A 3J81E 3PO3B 5IODA 2FHTA 5IGBA 2CQAA 4QUFA 3CHBD 3ND8A 4XQJA 1FYCA 1YJWA 4N9PA 4QY7A 1KNEA 1N9WA 2J0TD 3QWNA 3CQZH 4E6IA 1EFID 5FO8B 1CTMA 3T4AC 2OF1A 5M5WH 1YJNA 4HR7B 3OTOL 1PH7A 3RN2A 3I4MH 4DV0L 1C9OA 5CGKA 2OCEA 3DXJC 2VY3A 1RTNA 3LWUA 4ZRZA 4HMJA 3RZDB 3OMGA 2ZM6Q 1JOQA 1AE2A 2UUBL 5EBDA 2FJ2A 1Q82C 1AH9A 2N55A 3HOYH 5E4WC 3PO3H 2C5CA 4DUZQ 4IPHA 3Q24A 4LK1C 4IUNA 3HOZB 4CJ2C 5C6AA 2CH4A 3RNUA 5BR8L 2Q8RE 3HGBA 4R4TA 4F88A 1JMCA 3VR2A 4A3FG 1OXSC 1SROA 1WYDA 3O13A 4IUPA 2F0LA 3DUZA 3V2TA 3VYSA 5M3FG 4KY5A 2K05A 1G6PA 1JT8A 2B8FA 2A73B 2MQHA 4JPBW 4LW1A 3OW2A 3ZYYX 4GKKL 4NDXA 3RZDH 1I4GA 3D4WA 3CMEA 3PCOB 3K81C 1HPCA 4IUQA 2WB1B 5I6YA 2M00A 5LL6X 2F4VQ 3MXUA 1ZYRC 4X3KA 4GKJQ 4LFBQ 4A3MH 1STEA 2UUAQ 2F0DA 5IGEA 2I5LX 4B3SL 1GUGA 2K50A 3EIVA 4HIMA 2YYZA 5KYLA 1CSPA 3MEFA 4RCOA 1CKNB 3NSWA 1GUNA 4EX5A 1PZKD 3S1RB 1NJIC 1KTKA 3A54A 5D3IB 2Q2UA 2K01A 4A3DB 5C4ZA 4RHRA 4LMQD 3AYHB 3SK8A 1BF4A 3SVMA 1A0IA 4WJWA 5K36H 1M8AA 3T13A 2KJXA 2WAQE 4C3JB 4X66L 4A3JH 2QF7A 1WTRA 5EBCA 1QZGA 1SN8A 1CZGA 5ELNA 4EQOA 1LT3D 1D8LA 3OIQA 4OWTB 3GV3A 1JJCB 4BBRG 2I5HA 3C3LA 1TS4A 2K14A 3I3CA 3A5UA 3NUCA 4GLVB 4LUVA 4IFDJ 1A63A 4H7BA 4IUVA 4UP7A 5G3LD 3J81i 3PV0A 4JG2A 2MUYA 3S1RH 4HMIA 4DAYB 1CQVA 4A3DH 1J5EL 2OEOA 2JN4A 3T1YL 3M4YA 3GTQH 2QGQA 4CDDC 2O5IC 3K5MA 1CSQA 1AE3A 2X6LA 5I2YA 2RHQB 4CDEC 1DONA 1F9RA 2R93H 2DN8A 1O78A 1HNZQ 3K7UC 3N6RA 1H95A 5K5PA 1PFBA 3EJIA 1SYCA 3TMEA 5I6WA 3KDFA 5C5LA 3VR4A 1X6OA 3GQBA 1WD1A 4DR4L 3DMUA 3V96A 3OWEB 1Y8OB 4OEMB 1TS5A 3MEHA 2MO1A 2Y0SB 3CRKC 4KN4C 3K0YA 3BYTB 1EFWA 4HIKA 1JC7A 2B8GA 1FGUA 4UP9A 3S17B 5C3EB 2PW7A 1OXVA 5IGCA 4TRDA 3HKZB 2L4NA 3GTMB 1XMOL 3RLFA 1L1OA 1H9KA 1CK1A 4XIGS 1A3UA 4Q5VA 4RKBA 1SBBB 2UUCQ 2XRSD 1SFOB 1CZWA 2F52A 4Y7NH 2G5DA 2CH4W 4OGQC 3IKJA 1JCKB 2EY1A 4FXDA 3K8AA 3ULPA 1KC8C 1EL0A 5FKAC 1GD7A 1HHVA 2Z1CA 2HHHL 3VYTA 1PV4A 1SMYC 4DAVA 1TR5A 1A8VA 4JBJA 1R4PB 2AQ1B 1HA5A 5M3MG 1PH8A 2K4KA 2K5DA 5GAEC 3K5OA 1QWYA 1LT4D 2Z4HA 1I4XA 3S17H 3H94A 5C3EH 2X6GA 1H9RA 3W1BA 4DR3L 3BVZA 1XTDA 2G9DA 3HKSA 3GTMH 2NZHA 3D6CA 4OX9L 2WINB 1YNJC 3EQLC 4DR7Q 4X65Q 4R4OA 2UXBL 4JI8Q 4J15A 3MXNA 1SFOH 4JI6Q 2ZJQA 2HIVA 4JI3Q 3CKIB 3A8KE 1LT5D 4BXXH 3UDFA 4JI2Q 3SEBA 4LF8Q 1AW7A 1XMQQ 4RA8A 5KRUA 2B63B 3PGZA 1KIXA 1G291 3NBHB 4R9WA 1IBKQ 1ET9A 2IX1A 4RH6A 3PIPA 2C9OA 4A3GH 1A62A 4MTNA 1PTOB 2QEJC 2VXWA 3UE0A 2XNAC 2EY6A 1U9RA 3I4NB 2JSOA 2A69D 1XJVA 3K5LA 2OTLA 4EQNA 3AQQA 2A6HD 2NUCA 1BCPC 4WORA 4MNOA 3KLSX 1EIGA 3E0JA 2EXZA 4G7HC 2F0NA 1WTPA 1VQEA 2UXDQ 1WVLA 2B63H 5GQOA 5EPLA 3NWTA 1BKBA 3F1ZA 1IL2A 3MHBA 3MXPA 3WWVA 1W2BA 3U58A 5IP7H 3NENA 1STNA 4NB3A 3HFZB 1SXTA 1VQDA 2VQFL 1PTOH 1S3OA 1V43A 1JB3A 1I50B 4DR5Q 1LTAD 4A3MG 3H3VI 3FVQA 4LUOA 3SR1A 1HZCA 2PQAB 3I4NH 1N32Q 1T9HA 4IFDG 4QB4A 3K7AH 4QIWE 2JA8B 3FEWX 2MP1A 1QE6A 3OMCA 1J9OA 5M5XB 3SHLA 1M1KC 1UE6A 2JEBI 3CRLC 3TBIB 2NVTB 4JI2L 1RTOA 1O7LA 3S1QB 1SNDA 1ML0D 3DWPA 4WRDA 4L5TA 1HNXQ 4C3HB 1GUTA 4IJHA 4A3JG 5CYUA 1SYEA 2VQEQ 4DR1L 3CCUA 1TXYA 1VF7A 1X32A 2WACA 4HSVA 4L5RC 3S15B 4G7OC 4KHPQ 1WD0A 1FD7D 5CMDA 3IL8A 1FL0A 5F2DA 3KF6A 1TIID 1K0SA 2KA7A 3OWFA 1XX8A 2L12A 4PZ8A 3NK9A 1WTVA 4DV6L 1ESFA 4AYBE 2JA8H 3CCJA 4V190 1EOTA 4K8IA 5ELDA 2KHIA 4A3DG 5M5YB 2BA1A 2MNAA 2B2VC 3T16A 5M5XH 3JAME 4JI1Q 3EBEA 1XWEA 5HY6A 3I2ZA 2O2LD 3S1QH 1A3VA 1E1OA 2R93G 1VMPA 4DV7Q 1PRTC 2YTYA 2L5TA 4H02A 4C3HH 3W5OA 2RCNA 1UE1A 1OO9B 1KAAA 3BYYB 1NSNS 3PIP3 1VQ9A 3OHXC 1A2TA 2WV6D 4U673 3C1FA 3LNNA 3S15H 1YNND 3OW7A 1B3AA 2F1MA 3BG3A 4QL5A 4CKEA 3CCLA 3QIAA 2K1BA 2FMMA 4EVOA 1QCBD 1FNUA 1TWFB 2Q8IB 4DR5L 4ZKBB 1T5EA 2B2TC 1JE5A 1S72A 4IPCA 1TWGH 1N32L 4KD3A 2E2IB 5M5YH 4GLAC 4DUYL 2WIIB 3MC0B 4PMCA 2XVSA 1C48A 2PMZB 1A6XA 1XNRL 2JA5B 3M4OH 1V1PA 1VF5C 3A0JA 1XNQL 3D6WA 2VW9A 5J22A 1EYGA 5CV9A 2ZJPA 3BDOA 4P73A 2F0FA 4HCEA 4G4KA 1QB5D 2O4XA 3AFQA 3QO2A 2EYPA 1HNXL 5C0XH 4OO1I 3URYA 2OTJA 3TEHB 3GTLH 4X62L 4C1NK 2DY7A 5KIXA 1TWFH 1QZHA 2EYFA 3KK7A 4R8NA 5LL6S 2EJMA 3E0EA 3CCVA 1G8ZD 1VQ8A 2E2IH 4DA2A 3NBIA 2HQLA 4YWKA 4KMUC 3RZOB 1PH4A 4NW2A 1VQKA 2EYLA 4A3BB 2JA5H 3DM3A 5DAUA 3GD7A 1U5KA 4ODGA 3J7ZC 3OOCA 3PF4A 1VQAA 3GTKB 1JJ2A 1JWSD 4TKOB 5C4JB 2D0PA 3AFPA 4DV1L 5FLXL 2KUMA 3S14B 1IKLA 5C0XJ 1YBYA 4RFBA 5LMNL 4BXXG 2NYZD 1R9TB 4AQYL 1TY0A 5C4XB 3VYRA 4L8JA 2VB3X 3CF5A 3J80c 4HJAA 1CQFA 3OTOQ 1Z47A 2L1BA 4UAIA 5CV7A 2PYKA 4ZCKA 4DV0Q 3RZOH 3TP6A 3R2IA 4A3GG 2BDOA 3HOXB 4A3BH 5JPMC 2AWOA 1X9NA 1MSHA 4O2DA 4LF7Q 1LYLA 5DM63 3CW2C 2HDMA 3RMHA 3JAMi 4HJ7A 3GTKH 1F2LA 5C4JH 2BE5D 4KKTA 3EN2A 5I9PA 3S14H 1KLUD 1TU2B 2JXMB 4JCVE 2Z6KC 2VNUD 5J3BA 1QUQA 1R9TH 5C4XH 4ULLA 4KTAA 5BR8Q 2HCIA 1JE4A 4XQQA 3Q22A 4JI5L 2Q8TA 3S16B 1EEID 2G9HD 1I4QA 2R61A 3J7A5 4ME5A 1S5FD 2ALYB 1SE8A 3D4DA 1ONLA 5EJWA 3NHHA 1LACA 5IP7G 2HIXA 3HOVB 3KF8B 4GKKQ 5C5MA 3HOXH 4M8AA 2FMCA 1CFMA 2A6ED 2DNCA 4ZK9B 3J81j 1D5ZC 1H9MA 1STYA 3NELA 5LMUQ 4DV5L 1UWVA 1MD2D 1D6EC 2VB2X 4JYAQ 1HUMA 2F0OA 2F0QA 3QB3A 4OIJA 4CDFC 1EY7A 1N33L 1E2VA 1GO3E 3W2DA 3P20A 1HH2P 3I72A 2A1AA 3BZKA 4KK7A 1LTRD 2R7DA 3SK4A 3S16H 1A3TA 2LMCB 2E8GA 3T53B 4WJ4A 3UE1A 4J8QA 5EGTA 2A19A 1S4ZA 3HOVH 1I4HA 2MJ8A 1SYDA 5E1FA 4A3KB 1Q1BA 1B70B 1AZPA 3WDNA 1WTHA 1BO0A 1AP0A 1XYIA 2VZAA 3L7ZC 4IZ8A 5JJLA 2EJFC 4X66Q 4IJLA 1U0LA 3A5ZB 1NMFA 2N49A 4LF7L 5EKKA 1C8CA 4EGVA 2HUGA 4JV5Q 1MKHA 2JA8G 4ZYSA 3TP7A 4NKLA 2RDFA 4P74A 3QG1A 1Q7YC 4HJ9A 2HD3A 1E7ZA 3HS0C 3HZXA 2VL6A 1RODA 2BDNA 1PH6A 1IZ6A 3W3AA 4LWCA 2QCPX 4P2CB 4NP5A 1EQTA 1J5EQ 1S5DD 3ERSX 3T1YQ 1YHAA 3NE5B 1IW7C 4AYBG 4C3HG 2DJGC 4A3KH 2QEXA 1GOZA 2RDGA 1I5FA 4UDUC 1S40A 2CQOA 5LMUL 4N9TA 4BY1B 5JAVA 2KEEA 1XPUA 3K59A 1E2WA 4DR4Q 3BZCA 1JICA 4TVAB 3GTQB 4JBMA 4JI7L 1F9SA 2B2UC 4JYAL 3IRBA 4L6TB 1NMGA 4HTHA 3HOZH 2D0OA 4MZ9A 5A35A 1DZ1A 3J81c 1LUZA 5J1ZA 4JI4L 2WB1E 4LF5L 1OXXK 1JR0D 2E2HB 4IFDI 2I0QA 4HEDA 5IGFA 2MGSA 2XWJB 1XMOQ 3CC4A 2I5MX 5ELFA 1MJCA 5C0XG 3LX0A 2A5HA 4JOIC 2ZXPA 1W3SA 4B9XA 2H5XA 5C44B 1Q90A 4JBKA 3L3OC 4BY1H 3M4PA 1DYQA 4K2KA 3HOWB 4GOPA 1VQNA 3SDZA 2HHHQ
chains in the Genus database with same CATH topology
2B39A 1GUSA 1HCZA 1RKNA 2IPKD 1GHKA 4CGYB 2VUMB 4X3UA 3FPPA 2EJGC 3TDQA 1WTWA 2JA7B 2F0KA 3E6ZX 4MHEA 5EQ0A 4ZUJA 2B2TA 4IURA 1EU3A 1CHPD 1H9JA 1LO5D 1WTOA 4ILWA 4H0LC 5C4HA 3TP8A 1E0BA 1EZ6A 2SOBA 2N88A 4KN7C 3N52A 1TWHB 1O7ZA 1EIHA 1SJED 3BZDB 3IAYA 1I6HB 5KNBA 4DAPA 1MBYA 4A3IB 3TSSA 5CV8A 1EWHA 1HA6A 1LLRD 1BR9A 1KDAA 1EQVA 2D9UA 1LTTD 2WKCA 3HRZC 3R3OA 1TWAB 4RWSC 1FGBD 1S5CD 2IL8A 1DOMA 4K5XA 5TSSA 1CA5A 1IYVA 3A7AB 1SNMA 1IKMA 4FF1A 4KKSA 5E3FA 4LAAA 2PW5A 2WP8J 1H9SA 1HXYD 2X69A 3S2DB 1EU4A 1NR2A 1HFGA 3DEPA 1DCZA 3GO5A 1BXTA 4FVMA 4H44C 1PMRA 5ELEA 1DJRD 3EFXD 1GHJA 3H0GB 4RAUC 2EVBA 3D31A 3D4RA 2IW3A 3HOUB 1STAA 4HCSA 3K6OA 4Z9CB 4PV1C 4QCLA 4FXKC 5T1GA 4B08A 3UI2A 3E5SA 2L0CA 5IGGA 5IOCA 1G6ZA 3OIPA 5A2QL 2TSSA 2ICIA 4K2LA 2D2CC 4A93B 3J7YW 2DNEA 1F2MA 3NXWA 1BOSA 1PTOC 2XIWA 1I4PA 4KD4A 1ENFA 1B9NA 2NN6H 2F0GA 3AB9A 1ET6A 4DFAA 2F0HA 1Y1WB 4PMBA 2RDHA 3A56A 4HSPA 1DXMA 3PUZA 2V4DA 4I65A 2JA6B 1OXTA 1OXUA 5KNDA 1CI3M 2D62A 2M2LA 2HCCA 1NR4A 3PUYA 5JVH3 2AQ2B 1NUCA 1E2ZA 4ZAIA 1PDQA 2H1EA 2MPMA 2CVRA 5FOBB 1ENAA 3KBGA 4FF4A 4C3IB 1PXUA 2JEAI 5K36G 2A69C 3R2TA 5JEAH 1BBXC 1UAPA 2EY5A 2SNMA 3LWEA 2ICEC 4R8IA 2F0SA 3MVVA 2O5JC 1EYAA 2JP1A 4QF4A 1KLGD 3J7AF 3SXHA 1U4MA 3SE0A 1GJXA 2F3WA 4K14A 3J7AV 3TN2A 1RCVD 4A3FB 2OXPA 2NBFA 1F9PA 5E4XA 4PNYA 4F87A 1A15A 5M3FB 1UEAB 1B53A 2E74C 2B2UA 3RD4A 3T56B 1SE4A 1JOOA 5M9OA 3PUXA 4XTCS 1TS2A 1RD9D 1V1OA 4C3JG 2K03A 5BN4A 3D8GA 1TWCB 1LTGD 2KECA 3M7GA 3AU7A 1GUOA 3QOLA 5EPJA 1J8IA 1L0YB 4HAEA 1G2TA 1WCMB 5CV5A 1CM9A 1U4RA 1DOLA 3NWSA 3OSOA 3J80L 4RGMA 1PFMA 2F0VA 4JK1C 2PCFB 1D5MC 4TSSA 5AFWA 2LKVA 4M1UB 3GTJB 2AUJD 2EYJA 1K8MA 1B44D 3NQIA 3H09A 1Y8NB 3IFTA 2A68D 4DAYA 1D2BA 3DHQA 3C1EA 3Q23A 1GUWA 2EY2A 3V05A 5C0XI 1D5XC 1KABA 1PYWD 4XQNA 2H4OA 3VR5A 3KLRA 2RA4A 4X3SA 1PLFA 2E2JB 2J7ZA 4DGZA 4OO1H 3KBXA 1SNPA 2HQEA 3C46A 1LABA 5KEEA 1YNNC 3KLSA 2M9VA 1Q1EA 3AMUA 5ISRA 1SYFA 4H13C 1ESRA 3WOFA 1RDPD 1RF2D 1PTOF 4GZYC 1LV9A 4K6DA 4CBVA 3P75A 2F3VA 1ZKOA 4CHTB 4MIUA 2ZT9C 1BCPF 5FO7B 4K5VA 1AEXA 5JVG3 5FLXE 4FF2A 2NZ1D 1PZID 1UNSA 1TS3A 4KJOA 5FO9B 4KI0A 3RUZA 2SNSA 2QKIC 3FKIB 5ELCA 4F8MA 3VR3A 5DM73 5NUCA 3HP3A 1Q3LA 3PUVA 2IWHA 2ZXRA 4KHZA 1SNCA 2NN6G 1QG7A 2KQ3A 5KNCA 4RGOS 2K28A 5HGTA 1TVXA 3SK5A 3ND9A 3P1HA 4KHVA 2AWNA 3EVQA 2CW0C 2LS01 5M3MB 2L55A 2ZXOA 5CV6A 3PO2B 1AFPA 4XT3B 1HUNA 3NTIA 1HQRD 1W6KA 2IX0A 4BWGB 4IN3A 3QJYA 4IALA 3M7NA 5EKLA 1JWMD 3MFYA 4XT1B 3I73A 4RGTA 5I2XA 1MGSA 3NBHA 3KUPA 1Z6HA 1NAPA 1STBA 1F77A 1K83B 2J4XA 4BBSB 5IIFA 1B2TA 5IT9L 3WOEA 2BE5C 3J81L 1CT1D 5T1IA 2E75C 1PRTF 1ZXTA 5CR3A 3X3MA 1EZ8A 3BDCA 1VDZA 5KGUA 2PPBC 2F0MA 4ABNA 1IHZA 2PO4A 2NTSA 4RKLA 1I4RA 3GV6A 1JWUD 1ZYRD 4J1MA 1EY0A 3MWYW 2ENBA 3ITPA 5I9OA 5DEHA 2A6EC 5C3XA 4JBWA 4C3IG 2E76C 4C1NI 4F7XA 1B1ZA 1M4VA 4U68A 3U9SA 4A3MB 2F0TA 1XTCD 1MSGA 1U4PA 3DEOA 1II3A 3EROA 1LTSD 2D5DA 4IUTA 3DM1A 4RGNA 5CORA 4O42A 4ZKCB 2I46A 2KVMA 3EA6A 1WTXA 1FR3A 1KDCA 1QILA 2NVXB 1Z7TA 3VA5A 3BS1A 5HURA 3C2PA 1HFNA 3K5NA 4A3JB 4G57A 2K04A 2K33A 2K6AA 2DY8A 2B2VA 1WTQA 5D14A 4BY7B 5EKIA 4QUCA 1SEBD 4IFDH 3DWQA 3M3YB 1B4OA 2WAQB 4OO1G 4O1NA 1HQMC 4QMGA 4FF3A 3S1MB 3S1NB 2WKDA 3VR6A 5FK9C 1EY8A 2R93B 5COYA 1HTPA 1TKWB 2NVYB 4KY7A 3MFGA 4PQXA 2BA0A 1V1PB 1K8OA 3BVGA 4XYQA 3S2HB 5CV4A 1TT2A 2R7ZB 1HTLD 2PZUA 2RBMA 1A2UA 1KDBA 4KY6A 1DOKA 1C4QA 2EZVA 4FYDA 2KCCA 1SMYD 1V8QA 4CKCA 5JPNC 1EYDA 1BNZA 4FP5D 4LJZC 2JYOA 1SNQA 4Y7NB 4DXFA 1NCVA 4DU9A 3H91A 1YNJD 1BDOA 3Q0AA 2KHSA 3GTGB 1SNOA 1FNVA 4DN4M 4FNFA 4RHSA 4BS9A 4KJNA 4J6HA 2PNRC 5D65A 3QOJA 1R4QB 4FXGC 2B2WC 2B2YC 3I8ZA 4EQPA 5JJZA 3H6MA 3FMCA 1Q12A 1VCIA 1QOHA 2NVQB 2EYMA 2Z4IA 5BN5A 1PTOD 4CJ1B 2QILA 1IYUA 1S5BD 2NTTA 1SE2A 1SYBA 2R6GA 2PZWA 1UUPA 1BCPD 2SDFA 2NWGA 4A3GB 2AQ3B 2KCNA 3PIO3 3VA7A 4ZQ3A 2IT1A 1LTBD 5J39A 1Y8PB 2KOLA 1MI2A 1EY9A 3FDTA 3K57A 3ERQA 2FFKB 4TQUS 1PFNA 4YIJA 3D3RA 2K32A 2XRQD 5JOBA 5A2QE 1G2SA 1LT6D 2XSCA 2R92B 3KF8A 4XDXA 2EDGA 5CC4A 3I90A 4Q0FA 1ZEQX 5EPKA 2EPBA 4MN3A 4DXGA 2NN6I 1BQQT 4ID6A 3GTPB 2EOTA 1QNUA 3H3VC 2LY7A 2CHBD 1F2ZA 2RSNA 4C2MB 3R93A 2XN9C 3G7LA 4V0BA 4ZLTF 1GXDC 1T5XD 2F0EA 1BCPB 2K7VA 1QNKA 3Q6SA 4DNRB 4K6LA 4BA2I 1EYCA 2PQEA 3K7AB 1X3PA 3ONAB 3CU7A 1VMCA 4BA1I 4WFN3 3K58A 3T51B 3HEJA 2F0PA 1SSOA 3R8BA 2EYOA 2RKSA 4QIWB 1SAPA 3A8JE 1IL8A 3DWAA 1B9MA 2A74C 1BUVT 3MZ5A 1I6VC 3TP5A 2L9HA 2PZTA 2A6HC 2HDLA 2NB0A 3I91A 3MA2B 1PRTD 3BVMA 1FNWA 1RHPA 1ILPA 1DD2A 1F2YA 3TZUA 4KV6A 2EYHA 1B50A 2MHVA 4XYOA 1SDFA 4I7ZC 1KNAA 2QDBA 4C56C 3NTKA 3VYUA 4AYBB 2E2DC 3PMFA 4FO2A 1O80A 5JEAJ 2IX3A 5G3LF 3JAML 1TWGB 1SYGA 1STHA 3NTHA 2F0JA 2R3ZA 3M4OB 1PRTB 1X3QA 1D1IA 5BN3A 1HRJA 1S5ED 4CJ0B 4CKBA 3J80E 3FRPB 3GTLB 4K5WA 1STGA 4K8JA 5KYIA 4ZUIA 4G7ZC 2AUKA 3IFDA 2Z8LA 2LFNA 1I3QB 4X3TA 1D1KA 4BBRB 4IQZA 3HG9A 1LTID 2YU9B 2KEDA 4S3SA 3NQTA 2OT2A 1PZJD 3M85A 1W6JA 5CBEE 4RCNA 3A7LA 5D3DA 4A3EB 2RSOA 3X3NA 3SK6A 1RJTA 1Y69U 2BOSA 2RQXA 1U4LA 1EY4A 2F4IA 3A55A 5CBAE 2L11A 3G6JB 2XWBB 1TQOA 3OPOA 1SE3A 5IGDA 3S9WA 1ENCA 4HN7A 1EEFD 3L9AX 3PUWA 3A8IE 1AZQA 3MAQA 4OIKA 4PMWA 5LHY1 4KKUA 1H9SB 2CW0D 3GTOB 1EY6A 2JE6I 1XXGA 2K5WA 1QJOA 2A68C 3P7JA 5I4DA 1JQYD 1TY2A 2B2WA 2B2YA 3GP7A 4DK1A 1JORA 4OHJA 1Y1VB 3BDLA 1ILQA 2BCOA 5ELBA 2K5QA 2F0WA 3I70A 1EWCA 2RVLA 1AN8A 2EE1A 1ICWA 2GA4B 4DNTB 1F9QA 4DK0A 2ID0A 1L0XB 2F0IA 2TMPA 4OL7A 3NPPA 5C3WA 4DF7A 1SJHD 4B9WA 2F03A 1JOKA 4IUUA 5DNFA 3I4LA 3CQZB 3MTSA 1G91A 2I07B 1Q8IA 1EY5A 3TZDA 5M5WB 1DM0B 3F2UA 4XXEA 3U9OA 3MXGA 2SEBD 3I4MB 1CA6A 2IJ0A 2FINB 2F0UA 3FPUB 5JEAG 4NMZA 3NP8A 1O7YA 4L63B 1IW7D 5IT9E 1CHQD 3HOYB 3J81E 3PO3B 5IODA 2FHTA 5IGBA 2CQAA 4QUFA 3CHBD 3ND8A 4XQJA 1FYCA 4N9PA 1KNEA 3QWNA 2J0TD 4E6IA 5FO8B 1EFID 1CTMA 3T4AC 2OF1A 4HR7B 5CGKA 3DXJC 1RTNA 3LWUA 4ZRZA 4HMJA 3RZDB 3OMGA 1JOQA 5EBDA 2FJ2A 2N55A 5E4WC 2C5CA 3Q24A 4LK1C 4IUNA 3HOZB 4CJ2C 5C6AA 2Q8RE 3HGBA 4F88A 3VR2A 1OXSC 4IUPA 3O13A 2F0LA 3DUZA 3V2TA 3VYSA 4KY5A 2K05A 2B8FA 2A73B 3ZYYX 4NDXA 1I4GA 3D4WA 1HPCA 4IUQA 2WB1B 5I6YA 2M00A 5LL6X 3MXUA 1ZYRC 4X3KA 1STEA 2F0DA 5IGEA 1GUGA 2YYZA 5KYLA 4RCOA 3NSWA 1GUNA 1PZKD 3S1RB 1KTKA 3A54A 5D3IB 2K01A 4A3DB 5C4ZA 4RHRA 4LMQD 3SK8A 1BF4A 3SVMA 4WJWA 5K36H 1M8AA 3T13A 2KJXA 4C3JB 2QF7A 1WTRA 5EBCA 1CZGA 4EQOA 1LT3D 3OIQA 3GV3A 3C3LA 1TS4A 3I3CA 3NUCA 4IFDJ 4H7BA 4IUVA 5G3LD 3PV0A 2MUYA 4HMIA 1CQVA 2OEOA 3M4YA 2O5IC 3K5MA 2X6LA 5I2YA 1DONA 1F9RA 2DN8A 1O78A 3N6RA 5K5PA 1PFBA 3EJIA 1SYCA 3TMEA 5I6WA 5C5LA 3VR4A 3GQBA 1WD1A 3DMUA 3V96A 3OWEB 1Y8OB 1TS5A 3MEHA 2Y0SB 3CRKC 4KN4C 3K0YA 3BYTB 1JC7A 2B8GA 3S17B 5C3EB 2PW7A 1OXVA 5IGCA 4TRDA 3HKZB 2L4NA 3GTMB 3RLFA 1H9KA 1CK1A 4XIGS 1A3UA 4Q5VA 4RKBA 1SBBB 2XRSD 1SFOB 1CZWA 4OGQC 3IKJA 1JCKB 2EY1A 4FXDA 1EL0A 5FKAC 1HHVA 2Z1CA 3VYTA 1SMYC 4DAVA 1TR5A 1R4PB 2AQ1B 1HA5A 2K5DA 3K5OA 1QWYA 1LT4D 2Z4HA 1I4XA 3H94A 2X6GA 1H9RA 3BVZA 2G9DA 3D6CA 2WINB 1YNJC 3EQLC 3MXNA 3CKIB 3A8KE 1LT5D 3SEBA 1AW7A 4RA8A 5KRUA 2B63B 1G291 4R9WA 1ET9A 2IX1A 4RH6A 2C9OA 1PTOB 2QEJC 2VXWA 2XNAC 2EY6A 1U9RA 3I4NB 2JSOA 2A69D 3K5LA 4EQNA 2A6HD 2NUCA 1BCPC 4WORA 3KLSX 1EIGA 3E0JA 2EXZA 4G7HC 2F0NA 1WTPA 1WVLA 5EPLA 3NWTA 3MHBA 3MXPA 1STNA 1SXTA 1PTOH 1V43A 1JB3A 1I50B 1LTAD 3FVQA 3SR1A 4IFDG 4QB4A 2JA8B 3FEWX 2MP1A 1QE6A 3OMCA 1J9OA 5M5XB 3SHLA 2JEBI 3CRLC 3TBIB 2NVTB 1RTOA 1O7LA 3S1QB 1SNDA 1ML0D 3DWPA 4WRDA 4C3HB 1GUTA 5CYUA 1SYEA 1VF7A 1X32A 2WACA 4HSVA 4G7OC 3S15B 1WD0A 1FD7D 5CMDA 3IL8A 5F2DA 1TIID 2KA7A 3OWFA 1XX8A 2L12A 3NK9A 1WTVA 1ESFA 4V190 1EOTA 4K8IA 5ELDA 5M5YB 2BA1A 2B2VC 3T16A 3JAME 1XWEA 2O2LD 1A3VA 1VMPA 1PRTC 2L5TA 1OO9B 1KAAA 3BYYB 1NSNS 3PIP3 3OHXC 1A2TA 2WV6D 4U673 3C1FA 3LNNA 1YNND 3OW7A 1B3AA 2F1MA 3BG3A 4CKEA 3QIAA 2K1BA 2FMMA 4EVOA 1QCBD 1FNUA 1TWFB 2Q8IB 4ZKBB 1T5EA 2B2TC 4KD3A 2E2IB 2WIIB 3MC0B 4PMCA 2XVSA 1C48A 2PMZB 1A6XA 2JA5B 1V1PA 1VF5C 3D6WA 5J22A 5CV9A 3BDOA 2F0FA 4HCEA 4G4KA 1QB5D 2O4XA 3QO2A 2EYPA 5C0XH 4OO1I 3URYA 4C1NK 2DY7A 5KIXA 2EYFA 3KK7A 4R8NA 5LL6S 2EJMA 1G8ZD 4DA2A 3NBIA 4KMUC 3RZOB 4NW2A 2EYLA 4A3BB 5DAUA 3GD7A 4ODGA 3OOCA 3GTKB 1JWSD 4TKOB 5C4JB 5FLXL 2KUMA 3S14B 1IKLA 5C0XJ 4RFBA 2NYZD 1R9TB 5C4XB 1TY0A 3VYRA 4L8JA 2VB3X 1CQFA 1Z47A 2L1BA 4UAIA 5CV7A 2PYKA 3TP6A 3R2IA 2BDOA 3HOXB 5JPMC 2AWOA 1MSHA 5DM63 2HDMA 3RMHA 1F2LA 2BE5D 4KKTA 5I9PA 1KLUD 1TU2B 2JXMB 2VNUD 4ULLA 4KTAA 2HCIA 1JE4A 4XQQA 3Q22A 2Q8TA 3S16B 1EEID 2G9HD 1I4QA 2R61A 4ME5A 1S5FD 3D4DA 1ONLA 5EJWA 3NHHA 1LACA 3HOVB 5C5MA 4M8AA 2FMCA 1CFMA 2A6ED 2DNCA 4ZK9B 1D5ZC 1H9MA 1STYA 1MD2D 1D6EC 2VB2X 1HUMA 2F0OA 2F0QA 3QB3A 4OIJA 1EY7A 1E2VA 3W2DA 3P20A 3I72A 4KK7A 3SK4A 1LTRD 1A3TA 2LMCB 3T53B 4J8QA 5EGTA 1S4ZA 1I4HA 2MJ8A 1SYDA 5E1FA 4A3KB 1Q1BA 1AZPA 3WDNA 1BO0A 1AP0A 1XYIA 3L7ZC 4IZ8A 2EJFC 5EKKA 1C8CA 4EGVA 2HUGA 4ZYSA 3TP7A 4NKLA 2RDFA 3QG1A 3HS0C 3HZXA 1RODA 2BDNA 3W3AA 2QCPX 4P2CB 4NP5A 1EQTA 1S5DD 3NE5B 1IW7C 4C3HG 1GOZA 2RDGA 4UDUC 4N9TA 4BY1B 5JAVA 2KEEA 3K59A 1E2WA 1JICA 3GTQB 1F9SA 2B2UC 4L6TB 4HTHA 5A35A 1DZ1A 5J1ZA 1OXXK 1JR0D 2E2HB 4IFDI 4HEDA 5IGFA 2MGSA 2XWJB 5ELFA 5C0XG 3LX0A 2A5HA 2ZXPA 4B9XA 5C44B 1Q90A 3L3OC 1DYQA 4K2KA 3HOWB 3SDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9W A;  2MJ8 A;  2X6L A;  1XX8 A;  2L12 A;  4XT1 B;  1X3P A;  1DON A;  1F9R A;  1WTV A;  1AZP A;  3ONA B;  4X3U A;  2KUM A;  4CJ2 C;  1HFN A;  1EOT A;  2RA4 A;  1PLF A;  1IKL A;  1BO0 A;  2K04 A;  2RVL A;  3LWE A;  2EE1 A;  1VMC A;  4RAU C;  1ICW A;  2J7Z A;  1MGS A;  2Q8R E;  5D65 A;  1WTW A;  2NYZ D;  1XYI A;  2B2V C;  1AZQ A;  3KUP A;  1F9Q A;  4R8I A;  3KBX A;  4MHE A;  5EQ0 A;  2B2W C;  1PFB A;  1NAP A;  2JP1 A;  2DY8 A;  4IUP A;  2VXW A;  2B2Y C;  4HCS A;  2B2V A;  1WTQ A;  3I8Z A;  3IFD A;  5D14 A;  1WD1 A;  1SSO A;  5EKI A;  4QUC A;  5T1G A;  5JJZ A;  2B2T A;  3UI2 A;  4IUR A;  1C8C A;  4X3T A;  2K05 A;  1ESR A;  1U4M A;  1VMP A;  1B4O A;  2HUG A;  2L1B A;  1WTO A;  4UAI A;  1SAP A;  1B2T A;  1ILQ A;  1LV9 A;  3TN2 A;  1IL8 A;  1E0B A;  5T1I A;  2KED A;  4IUQ A;  2N88 A;  1ROD A;  2BDN A;  1G6Z A;  3N52 A;  4IUU A;  1EIG A;  1O7Z A;  1ZXT A;  5DNF A;  2L9H A;  1MSH A;  1EIH A;  1B3A A;  4CJ1 B;  3MTS A;  1EQT A;  1WTP A;  5CBE E;  1AP0 A;  1G91 A;  1F9P A;  2HDM A;  2HDL A;  4X3K A;  2K1B A;  3I91 A;  5E4X A;  1WVL A;  2FMM A;  2L4N A;  1A15 A;  3TZD A;  5EPL A;  2NZ1 D;  1B53 A;  1RHP A;  2RSO A;  4ZKB B;  1F2L A;  1ILP A;  2B2T C;  5COY A;  3F2U A;  1RJT A;  2B2U A;  1B50 A;  2SDF A;  2NWG A;  1SDF A;  1CA6 A;  1KNA A;  1U4L A;  2XIW A;  2FIN B;  1HA6 A;  3FPU B;  3GV6 A;  2L11 A;  5CBA E;  3MWY W;  2HCI A;  2K01 A;  2K03 A;  1JE4 A;  1O7Y A;  2KOL A;  1MI2 A;  3FDT A;  2Q8T A;  4LMQ D;  1EL0 A;  2D9U A;  2KEC A;  2KEE A;  1HHV A;  2FFK B;  5EPJ A;  1J8I A;  3D6W A;  1BF4 A;  1JIC A;  2FHT A;  4HAE A;  5EJW A;  1PFN A;  3SVM A;  1G2T A;  1M8A A;  1F9S A;  1O80 A;  1Q3L A;  2B2U C;  3HP3 A;  4RWS C;  1QG7 A;  1CM9 A;  1U4R A;  4U68 A;  1DOK A;  2IL8 A;  3QO2 A;  1G2S A;  1DOL A;  1DOM A;  4OIK A;  4QUF A;  4ZK9 B;  1DZ1 A;  1KNE A;  1PFM A;  1QE6 A;  2MP1 A;  4XDX A;  1CA5 A;  2X6G A;  2K28 A;  1J9O A;  1WTR A;  1IKM A;  3I90 A;  1TVX A;  1MSG A;  1U4P A;  2DY7 A;  3GV3 A;  5EPK A;  2M2L A;  3DEO A;  2EPB A;  1RTO A;  4MN3 A;  4HED A;  2HCC A;  2X69 A;  1HUM A;  1BNZ A;  3I3C A;  2MGS A;  1NR4 A;  1ML0 D;  2JYO A;  5AFW A;  4OIJ A;  1NR2 A;  4IUT A;  3P7J A;  4IUV A;  3DM1 A;  5COR A;  2R3Z A;  1RTN A;  4O42 A;  4ZKC B;  2KVM A;  1BBX C;  2EOT A;  4XT3 B;  1HUN A;  1HFG A;  1NCV A;  1WTX A;  4NW2 A;  3DEP A;  4X3S A;  4ZAI A;  1PDQ A;  2B2W A;  2H1E A;  2B2Y A;  2RSN A;  3H91 A;  1X32 A;  3G7L A;  2FJ2 A;  4HSV A;  1X3Q A;  2MPM A;  3R93 A;  2CVR A;  2N55 A;  4ZLT F;  1WD0 A;  1HRJ A;  5E4W C;  4RA8 A;  1QNK A;  5CMD A;  3IL8 A;  3Q6S A;  4DN4 M;  1S4Z A;  4CJ0 B;  1GUW A; 
#chains in the Genus database with same CATH topology
 3DLL A;  2B39 A;  1GUS A;  1HCZ A;  1RKN A;  2CWA A;  4LFA L;  2IPK D;  1GHK A;  4CGY B;  2VUM B;  4X3U A;  4JV5 L;  2QA4 A;  2EIF A;  1VQB A;  3FPP A;  2EJG C;  3TDQ A;  1WTW A;  2JA5 G;  2JA7 B;  1Z9F A;  2F0K A;  3E6Z X;  4MHE A;  5EQ0 A;  4ZUJ A;  5DLQ E;  4DR3 Q;  2E2H H;  1E22 A;  2B2T A;  4IUR A;  1EU3 A;  1CHP D;  4A3E G;  1NY4 A;  1H9J A;  1LO5 D;  4OX9 Q;  1WTO A;  4ILW A;  4H0L C;  5C4H A;  3TP8 A;  2UXB Q;  1E0B A;  1EZ6 A;  2SOB A;  2JQO A;  2N88 A;  4KN7 C;  3UDI A;  3N52 A;  1TWH B;  1O7Z A;  1EIH A;  1E1T A;  1SJE D;  3BZD B;  3AEV A;  3CCR A;  4C3J H;  4LF6 L;  3IAY A;  1I6H B;  3HOW H;  3B6Y A;  5KNB A;  2ZTC A;  5AJ3 L;  4DAP A;  1MBY A;  4LNQ A;  4A3I B;  2VUM H;  3TSS A;  3L2P A;  1BVS A;  5CV8 A;  1EWH A;  4UPA A;  2XGT A;  4A3B G;  1HA6 A;  2JA7 H;  1LLR D;  1BR9 A;  4JVZ A;  1KDA A;  1EQV A;  1K0R A;  3E9H A;  2D9U A;  1LTT D;  5GAH C;  5L37 A;  2WKC A;  3HRZ C;  3R3O A;  1PA6 A;  1HZ9 A;  1TWA B;  4RWS C;  1FGB D;  1S5C D;  5C4X G;  2IL8 A;  1DOM A;  1KAW A;  4K5X A;  1TWH H;  5TSS A;  1CA5 A;  1YIT A;  1IYV A;  3A7A B;  1Q46 A;  1SNM A;  4L5Q A;  1K73 C;  1I6H H;  1IKM A;  4FF1 A;  4KKS A;  4NXM L;  5FLM H;  5E3F A;  1X54 A;  4LAA A;  2PW5 A;  2WP8 J;  1K8G A;  1H9S A;  1HXY D;  2OQK A;  1Y1V G;  2X69 A;  4A3I H;  3S2D B;  1EU4 A;  3HKZ E;  1NR2 A;  3E9I A;  3F2B A;  1HFG A;  3DEP A;  3Q8D A;  4IO9 A;  4A4I A;  5IE8 A;  1N34 L;  1DCZ A;  2GN5 A;  2VQF Q;  2UU9 L;  3GO5 A;  5HGQ A;  1BXT A;  4UHV A;  5IYB H;  4FVM A;  4H44 C;  1VQH A;  1PMR A;  1TWA H;  5ELE A;  1YJ9 A;  1DJR D;  1X3G A;  3EFX D;  1GHJ A;  3H0G B;  4RAU C;  1CUK A;  2EVB A;  3T1H L;  4X6A H;  3D31 A;  3D4R A;  2IW3 A;  2KCT A;  1GM5 A;  3HOU B;  1STA A;  4HCS A;  1N8R C;  1SMX A;  3K6O A;  4Z9C B;  4PV1 C;  4YCU A;  4QCL A;  4FXK C;  5T1G A;  3S2D H;  4B08 A;  3UI2 A;  1Y14 B;  3E5S A;  2Z6K A;  3I4M G;  1PH3 A;  3CC7 A;  1Q81 C;  2L0C A;  5IGG A;  5IOC A;  4YWM A;  1G6Z A;  4DR1 Q;  2N8N A;  2E5L L;  1VQL A;  3OIP A;  4GN5 A;  4GNX B;  5A2Q L;  2TSS A;  2ICI A;  3M4Q A;  4K2L A;  2D2C C;  4A93 B;  3J7Y W;  3HOY G;  2DNE A;  3PO3 G;  3KJP A;  4JI0 L;  1F2M A;  3NXW A;  2PI2 E;  1BOS A;  1PTO C;  2XIW A;  4LF4 L;  3H0G H;  1I4P A;  4DV6 Q;  1UE7 A;  4KD4 A;  1ENF A;  1B9N A;  2NN6 H;  2F0G A;  3AB9 A;  1EOV A;  3LGJ A;  3HOU H;  1ET6 A;  4DFA A;  3KFU A;  4LF9 L;  4IOA A;  2F0H A;  4A3K G;  1Y1W B;  4PMB A;  2RDH A;  3A56 A;  4HSP A;  1KQS A;  4DV4 L;  1DXM A;  1V1Q A;  2V4D A;  3PUZ A;  4I65 A;  4QJF A;  2JA6 B;  1OXT A;  1E24 A;  1OXU A;  5KND A;  2Z0S A;  3TRE A;  3UDX A;  4A93 H;  1CI3 M;  2D62 A;  2M2L A;  4DK6 C;  4DV2 L;  2HCC A;  1NR4 A;  3PUY A;  2B29 A;  3UDG A;  4DR6 L;  5JVH 3;  3HOZ G;  2AQ2 B;  2Q2T A;  4NXN L;  4DUY Q;  3KYH C;  1NUC A;  1E2Z A;  4ZAI A;  1PDQ A;  4PG3 A;  2H1E A;  2MPM A;  2CVR A;  1XNR Q;  1VQ4 A;  3H3V H;  5FOB B;  1ENA A;  1Y1W H;  3KBG A;  4FF4 A;  4C3I B;  1XNQ Q;  1ICF B;  1PXU A;  2JA6 H;  2JEA I;  2ZJR A;  1RL2 A;  5K36 G;  2A69 C;  3R2T A;  4I7A A;  1YEZ A;  5JEA H;  1BBX C;  1UAP A;  2CFM A;  2EY5 A;  2SNM A;  3LWE A;  3M9B A;  2ICE C;  4LFC L;  2WB1 G;  4BY1 G;  4R8I A;  2F0S A;  3MVV A;  2O5J C;  1B8A A;  1EYA A;  2JP1 A;  4X62 Q;  4QF4 A;  1KLG D;  4B3R L;  1I50 H;  3J7A F;  3SXH A;  4X64 Q;  3W1G A;  1U4M A;  5LMN W;  4O0A A;  3SE0 A;  1GJX A;  1YVC A;  2F3W A;  2KEN A;  4K14 A;  2GVB A;  3J7A V;  1Q86 C;  4OXP A;  2JK8 A;  3TN2 A;  3F2C A;  1X65 A;  1B7Y B;  1X3E A;  2BH2 A;  1RCV D;  4A3F B;  1KD1 C;  2OXP A;  1UEB A;  2NBF A;  1F9P A;  3JC6 6;  5E4X A;  4PNY A;  4F87 A;  1A15 A;  5M3F B;  1UEA B;  1B53 A;  4C3I H;  4CDC C;  2NVT H;  2E74 C;  2B2U A;  3RD4 A;  3T56 B;  1YNX A;  4HJ5 A;  1SE4 A;  1JOO A;  5M9O A;  4DV1 Q;  3PUX A;  4XTC S;  1TS2 A;  1RD9 D;  1V1O A;  2Q2I A;  4DNI A;  4C3J G;  5LMN Q;  2K03 A;  5BN4 A;  4AQY Q;  5JJK A;  3HOW G;  3D8G A;  1WJJ A;  5JJI A;  4POF A;  1TWC B;  1LTG D;  1CKN A;  2KEC A;  3M7G A;  3AU7 A;  1GUO A;  1MHW C;  3QOL A;  5EPJ A;  1J8I A;  1L0Y B;  4HAE A;  1G2T A;  4N8F A;  5IY0 A;  1WCM B;  2JA7 G;  5CV5 A;  4YCW A;  4JOI A;  3STB D;  1CM9 A;  1U4R A;  1DOL A;  3NWS A;  3OSO A;  3J80 L;  4A3F H;  4RGM A;  1PFM A;  3BJU A;  2F0V A;  4JK1 C;  1C0A A;  2N78 A;  2PCF B;  1D5M C;  2VS1 A;  4TSS A;  5AFW A;  2LKV A;  1C7Y A;  4M1U B;  3GTJ B;  2Z9H A;  1PH9 A;  2AUJ D;  1HR0 L;  2EYJ A;  4DV3 Q;  4DKA C;  1WOC A;  1K8M A;  1B44 D;  5FLM G;  1TWC H;  3NQI A;  4A76 A;  1HNW L;  3H09 A;  1Y8N B;  3IFT A;  4JI5 Q;  2PMZ E;  4A3I G;  2A68 D;  4DAY A;  1D2B A;  3DHQ A;  3C1E A;  3Q23 A;  1GUW A;  2EY2 A;  4JW0 A;  1WCM H;  3V05 A;  5C0X I;  1D5X C;  1KAB A;  1PYW D;  2KHJ A;  3CPF A;  4X64 L;  4XQN A;  2H4O A;  3VR5 A;  3KDF B;  3KLR A;  2RA4 A;  4X3S A;  1PLF A;  4POG A;  2E2J B;  4YY3 L;  2Y0S G;  2J7Z A;  4DGZ A;  4OO1 H;  3KBX A;  2RHS B;  1SNP A;  2HQE A;  5C3E G;  4DV5 Q;  3C46 A;  1LAB A;  2FXQ A;  5KEE A;  1YNN C;  3KLS A;  3HKZ G;  2M9V A;  3I56 A;  1Q1E A;  3AMU A;  5ISR A;  1SYF A;  3TS2 A;  4H13 C;  1ESR A;  3WOF A;  3GTJ H;  1RDP D;  1RF2 D;  1PTO F;  4DK3 C;  1LV9 A;  4K6D A;  4GLX A;  4GZY C;  1NE3 A;  4CBV A;  1VQ7 A;  3P75 A;  1N33 Q;  2F3V A;  1PH1 A;  1EIY B;  1ZKO A;  1FJG L;  4CHT B;  4MIU A;  2ZT9 C;  1L1O B;  1BCP F;  5FO7 B;  4K5V A;  1AEX A;  4UY8 C;  2JJQ A;  5JVG 3;  5FLX E;  4FF2 A;  2NZ1 D;  1PZI D;  1YHQ A;  1UNS A;  1TS3 A;  3U4V A;  4KJO A;  3ULL A;  5FO9 B;  4KI0 A;  2A8V A;  2E2J H;  3RUZ A;  4Y52 H;  2SNS A;  3CAM A;  2RF4 A;  5GAG C;  3RN5 A;  2QKI C;  3FKI B;  5ELC A;  4YHH L;  4F8M A;  1SRU A;  1K3R A;  3VR3 A;  5DM7 3;  3H0G G;  5NUC A;  3HP3 A;  1Q3L A;  2MFI A;  3PUV A;  2IWH A;  2ZXR A;  4KHZ A;  1SNC A;  2NN6 G;  1QG7 A;  4OON A;  3HOU G;  2KQ3 A;  5KNC A;  1J6Q A;  2KBN A;  4R1J A;  4RGO S;  1KRS A;  1E3P A;  2K28 A;  4DV3 L;  5HGT A;  1VQ6 A;  1I94 L;  1TVX A;  3SK5 A;  3ND9 A;  3P1H A;  3L0O A;  3MXN B;  1VQC A;  4KHV A;  2B63 G;  2AWN A;  3EVQ A;  1ASZ A;  2CW0 C;  2LS0 1;  5M3M B;  3ULJ A;  2L55 A;  2ZXO A;  5CV6 A;  3PO2 B;  1AFP A;  4XT3 B;  1HUN A;  4YWL A;  3NTI A;  4QGU A;  1HQR D;  1W6K A;  1JB7 A;  2IX0 A;  4A93 G;  3FKI H;  3E3X A;  2OQ0 A;  1VS0 A;  4BWG B;  4IN3 A;  5E7N A;  3QJY A;  4IAL A;  3M7N A;  1CKO A;  3BU2 A;  3I4N G;  5EKL A;  1JWM D;  3MFY A;  4XT1 B;  3I73 A;  4JI7 Q;  4A3C H;  2PI2 A;  4RGT A;  5I2X A;  1MGS A;  3NBH A;  3I7F A;  3KUP A;  1LM0 A;  1Z6H A;  1NAP A;  1STB A;  1F77 A;  1K8A C;  1K83 B;  2J4X A;  4JI4 Q;  4LF5 Q;  4BBS B;  2JA6 G;  1HZB A;  5IIF A;  5M3M H;  1B2T A;  5IT9 L;  3PO2 H;  3WOE A;  2BE5 C;  3J81 L;  1CT1 D;  5T1I A;  2E75 C;  1PRT F;  4APV A;  4IOC A;  2ASB A;  1ZXT A;  5CR3 A;  3QR8 A;  2LXJ A;  3X3M A;  1EZ8 A;  1O7I A;  1G51 A;  4RMF A;  1FVI A;  1VDZ A;  3BDC A;  5KGU A;  2PPB C;  2F0M A;  4ABN A;  2L15 A;  1IHZ A;  2LSS A;  2PO4 A;  4LFA Q;  5ELO A;  2NTS A;  4RKL A;  1I4R A;  2QW7 A;  3GV6 A;  1JWU D;  1ZYR D;  4J1M A;  1EY0 A;  3MWY W;  2ENB A;  3ITP A;  5I9O A;  5DEH A;  2A6E C;  1K83 H;  5C3X A;  1X3F A;  1EUJ A;  4JBW A;  4C3I G;  4BBS H;  4P71 A;  2E76 C;  4ME3 A;  4HJ8 A;  4C1N I;  1IBM L;  2Z6B A;  4F7X A;  1B1Z A;  1IBL Q;  1M4V A;  2PQA A;  4GS3 A;  4U68 A;  3U9S A;  2JA9 A;  2AHO B;  3U50 C;  4A3M B;  2F0T A;  1XTC D;  1MSG A;  1U4P A;  4LF6 Q;  3DEO A;  1II3 A;  5AJ3 Q;  3FHW A;  3ERO A;  1LTS D;  1SLJ A;  2D5D A;  1HJP A;  4IUT A;  3DM1 A;  4RGN A;  5COR A;  4O42 A;  4ZKC B;  2I46 A;  2KVM A;  3EA6 A;  1WTX A;  4HIO A;  1FR3 A;  3G48 A;  4B3T L;  3KF6 B;  2BH8 A;  3KLW A;  5IT9 c;  1VQO A;  1KDC A;  2F3I A;  4JC0 A;  1QIL A;  2NVX B;  1Z7T A;  3VA5 A;  5IWA L;  3BS1 A;  5HUR A;  3C2P A;  1B3Q A;  4HID A;  1HFN A;  3K5N A;  4A3J B;  4G57 A;  2K04 A;  2K33 A;  2K6A A;  3D0F A;  4IPG A;  2OWO A;  2DY8 A;  2B2V A;  1WTQ A;  5D14 A;  4BY7 B;  5EKI A;  4QUC A;  4NXM Q;  2K75 A;  1WCM G;  1SEB D;  1CKM A;  4IFD H;  3DWQ A;  3M3Y B;  1B4O A;  2WAQ B;  4NPS A;  3PIO A;  1N36 Q;  4OO1 G;  4O1N A;  2CKZ B;  1HQM C;  3ICE A;  4QMG A;  4FF3 A;  3S1M B;  3PSI A;  3S1N B;  2WKD A;  2P5Z X;  1N34 Q;  3VR6 A;  2UU9 Q;  5FK9 C;  1UE5 A;  1EY8 A;  2CWP A;  2NVX H;  2R93 B;  5COY A;  3KOJ A;  1HTP A;  1TKW B;  1NBW A;  2NVY B;  4KY7 A;  3MFG A;  1IBL L;  4PQX A;  2BA0 A;  2ZM6 L;  1V1P B;  3RR5 A;  1K8O A;  1K9M C;  3BVG A;  3T1H Q;  4XYQ A;  3S2H B;  4RG1 A;  4AIM A;  5CV4 A;  4BY7 H;  1TT2 A;  4DUZ L;  5C44 H;  1GKH A;  2R7Z B;  4P75 A;  3M3Y H;  1HTL D;  2PZU A;  2RBM A;  1A2U A;  4QQB X;  1KDB A;  4KY6 A;  1DOK A;  1C4Q A;  2EZV A;  2C35 B;  3S1M H;  3ZJY C;  4FYD A;  4DR2 Q;  3S1N H;  2KCC A;  2E5L Q;  1SMY D;  1V8Q A;  4CKC A;  2IHE A;  5JPN C;  1EYD A;  1BNZ A;  4FP5 D;  4LJZ C;  2JYO A;  3CCS A;  2NVY H;  4JI0 Q;  1VQM A;  4GN4 B;  1SNQ A;  4Y7N B;  1JJG A;  4LF4 Q;  4DXF A;  1NCV A;  2F4V L;  3S2H H;  4DU9 A;  2LXK A;  3H91 A;  1DGS A;  1YNJ D;  1BDO A;  4R4C A;  4LF9 Q;  3Q0A A;  4GKJ L;  4LFB L;  2R7Z H;  2UUA L;  2KHS A;  3GTG B;  1SNO A;  1VQ5 A;  1ASY A;  1FNV A;  4DN4 M;  2Y0S E;  4FNF A;  4RHS A;  3K0X A;  1KRT A;  3CCE A;  4BS9 A;  4KJN A;  5IYD H;  4DV4 Q;  3CXC A;  4J6H A;  2PNR C;  5D65 A;  4EQ5 A;  3F8T A;  3FKI G;  3HOX G;  1N36 L;  3QOJ A;  1R4Q B;  4FXG C;  2B2W C;  2ES2 A;  2B2Y C;  4N8X 1;  1M90 C;  3I8Z A;  4EQP A;  5JJZ A;  3H6M A;  2K5N A;  3FMC A;  1WI5 A;  1SR3 A;  1X56 A;  4DV2 Q;  1Q12 A;  4A3C G;  4DR6 Q;  4L5S A;  1VCI A;  1QOH A;  2NVQ B;  2EYM A;  3CD6 A;  2Z4I A;  1X55 A;  2R7F A;  4NXN Q;  5BN5 A;  3G71 A;  1PTO D;  4CJ1 B;  2QIL A;  1IYU A;  1PYS B;  1S5B D;  2NTT A;  3GTG H;  2UXC Q;  1SE2 A;  1MIU A;  1SYB A;  2R6G A;  3GDE A;  2PZW A;  1UUP A;  1QUQ B;  2K5V A;  3PO2 G;  1BCP D;  5IP9 H;  2SDF A;  2NWG A;  3HOV G;  4PZ6 A;  4A3G B;  2AQ3 B;  2KCN A;  4DPG A;  3PIO 3;  3VA7 A;  4ZQ3 A;  2IT1 A;  4LFC Q;  1LTB D;  5J39 A;  1Y8P B;  2KOL A;  1MI2 A;  1EY9 A;  3FDT A;  4DR2 L;  1MJE A;  3K57 A;  3ERQ A;  3K80 C;  2IY5 B;  2FFK B;  4B3R Q;  4TQU S;  1PFN A;  4YIJ A;  4R4I A;  3I4O A;  2NVQ H;  3D3R A;  2K32 A;  2EXD A;  4GNX C;  1HNZ L;  2XRQ D;  5JOB A;  5A2Q E;  1G2S A;  1LT6 D;  4MTK A;  2XSC A;  2R92 B;  3KF8 A;  4XDX A;  2EDG A;  5CC4 A;  4BBS G;  2KCM A;  3I90 A;  4K0K Q;  4Q0F A;  1KXL A;  1ZEQ X;  5EPK A;  2EPB A;  4MN3 A;  4DXG A;  3KJO A;  3PQI A;  2NN6 I;  4OWW B;  4IPD A;  5GRO A;  4GN3 B;  1BQQ T;  4ID6 A;  3CMA A;  2EOT A;  3GTP B;  1QNU A;  3H3V C;  2LY7 A;  2MO0 A;  4WJ3 M;  2CHB D;  4P72 A;  3SGI A;  3H15 A;  1F2Z A;  2RSN A;  4C2M B;  3R93 A;  2XN9 C;  3G7L A;  4V0B A;  4ZLT F;  1GXD C;  1T5X D;  2F0E A;  1BCP B;  1KL9 A;  2K7V A;  1QNK A;  3Q6S A;  2YTX A;  4DNR B;  4K6L A;  3S24 A;  4DAM A;  1HR0 W;  4BA2 I;  1EYC A;  2PQE A;  3K7A B;  1Q8K A;  1BBW A;  1X3P A;  4OWX B;  2UUC L;  3ONA B;  3CU7 A;  1VMC A;  2R92 H;  1YIJ A;  4BA1 I;  4WFN 3;  3K58 A;  1NTG A;  1L0W A;  3T51 B;  3HEJ A;  4PZ7 A;  2F0P A;  2NZO A;  2B3G A;  1SSO A;  3R8B A;  3CP0 A;  1EIF A;  2EYO A;  2UXC L;  4A3L H;  2RKS A;  4QIW B;  1SAP A;  3A8J E;  1EWI A;  5IYC H;  3GTP H;  1IL8 A;  3DWA A;  1PH2 A;  1B9M A;  2A74 C;  1QVC A;  1BUV T;  5FJ8 H;  1HR0 Q;  3MZ5 A;  2ZTE A;  1YI2 A;  1I6V C;  4C2M H;  3TP5 A;  2L9H A;  2PZT A;  2A6H C;  1HNW Q;  2HDL A;  2NB0 A;  3I91 A;  3MA2 B;  1EQR A;  1PRT D;  2RCF A;  3BVM A;  5GAD C;  1FNW A;  3CC2 A;  4R4Q A;  1RHP A;  4DR7 L;  1ILP A;  4X65 L;  1F2Y A;  1DD2 A;  4FDB A;  3TZU A;  2XTI A;  4KV6 A;  4JI8 L;  2EYH A;  1B50 A;  3RLN A;  2MHV A;  4XYO A;  1SDF A;  4I7Z C;  1IXR A;  1KNA A;  4JI6 L;  1VQP A;  4JI3 L;  2QDB A;  4YY3 Q;  2K5H A;  2AKW B;  4LF8 L;  4C56 C;  1OTC A;  1XMQ L;  4OEL B;  3NTK A;  3VYU A;  1KHI A;  4K0K L;  4AYB B;  1BBU A;  2E2D C;  1IBK L;  3PMF A;  4FO2 A;  2IHF A;  1O80 A;  1P8L A;  5JEA J;  4BY7 G;  1FJG Q;  1WFQ A;  2IX3 A;  5C44 G;  3F2D A;  5G3L F;  2WAQ G;  4A75 A;  1V9P A;  1TWG B;  3JAM L;  1SYG A;  1RIP A;  1STH A;  3NTH A;  2F0J A;  2R3Z A;  2VUM G;  1PHJ A;  3U4Z A;  4GOP B;  1PRT B;  3M4O B;  3TRZ A;  1VQF A;  1X3Q A;  2UXD L;  4GOP C;  1D1I A;  5BN3 A;  1HRJ A;  3G6E A;  1S5E D;  4YHH Q;  4CJ0 B;  3TQY A;  4CKB A;  3J80 E;  5M3F H;  4ALP A;  3FRP B;  3GTL B;  1YHB A;  4K5W A;  2WFW A;  1STG A;  4B3M Q;  2YV5 A;  4K8J A;  5KYI A;  4ZUI A;  4G7Z C;  2R7Z G;  2AUK A;  3IFD A;  1I94 Q;  2Z8L A;  2LFN A;  3A74 A;  1I3Q B;  4X3T A;  5IYD G;  1D1K A;  3TS0 A;  3PF5 A;  4BBR B;  4IQZ A;  3HG9 A;  1LTI D;  2YU9 B;  2KED A;  4S3S A;  3NQT A;  2OT2 A;  3CCM A;  1PZJ D;  3M85 A;  1W6J A;  5CBE E;  4RCN A;  3A7L A;  5D3D A;  4A3E B;  2RSO A;  3X3N A;  5IYB G;  1D7Q A;  3SK6 A;  1RJT A;  1Y69 U;  2BOS A;  1PVO A;  2RQX A;  1U4L A;  2GVA A;  1EY4 A;  1EQQ A;  2Q2H A;  2K52 A;  2VQE L;  2F4I A;  3A55 A;  5CBA E;  2L11 A;  2DUD A;  3JAM c;  3G6J B;  3STB C;  2XWB B;  4KHP L;  2N3S A;  1LTL A;  1TQO A;  5H1S E;  1VQI A;  3OPO A;  1K3B C;  1SE3 A;  5IGD A;  1I3Q H;  3S9W A;  1ENC A;  4HN7 A;  5IP9 G;  2CCZ A;  1EEF D;  3RLO A;  4BBR H;  1L1O C;  3L9A X;  2YU9 H;  2ZTD A;  3PUW A;  3A8I E;  4LUZ A;  1AZQ A;  3MAQ A;  4OIK A;  4PMW A;  5LHY 1;  4KKU A;  4JI1 L;  1H9S B;  2CW0 D;  1PH5 A;  3GTO B;  1EY6 A;  4A3E H;  1PFS A;  2JE6 I;  3CPW A;  4DV7 L;  1XXG A;  2K5W A;  1XPO A;  1QJO A;  2A68 C;  3P7J A;  5I4D A;  1HZA A;  4UP8 A;  1JQY D;  1TY2 A;  1L2F A;  2B2W A;  2B2Y A;  4B3M L;  1IYJ B;  1VQG A;  3GP7 A;  3CCQ A;  4DK1 A;  1JOR A;  1YZ6 A;  2PNH A;  2ATW A;  4OHJ A;  1Y1V B;  3FP9 A;  3BDL A;  4AH6 A;  1ILQ A;  2BCO A;  2DGY A;  3I55 A;  1IBM Q;  5ELB A;  2K5Q A;  2F0W A;  3I70 A;  1QVF A;  1EWC A;  2UUB Q;  2RVL A;  1AN8 A;  2EE1 A;  1ICW A;  2GA4 B;  2YTV A;  4DNT B;  1F9Q A;  1QVG A;  3GTO H;  1GVP A;  3ER0 A;  4DK0 A;  2ID0 A;  1L0X B;  2F0I A;  2TMP A;  2EQS A;  4OL7 A;  4YCV A;  2DJF C;  3NPP A;  5EAY A;  4KLK A;  1PYB A;  5C3W A;  4DF7 A;  1SJH D;  2R92 G;  2HT1 A;  2QDL A;  3G4S A;  3J80 i;  4B9W A;  1XPR A;  2F03 A;  3OYY A;  1JOK A;  4IUU A;  5DNF A;  4B3T Q;  3VDY A;  2AMC B;  3I4L A;  3CQZ B;  3MTS A;  1G91 A;  2I07 B;  1Q8I A;  1EY5 A;  1Y1V H;  4A3L G;  1NNX A;  3TZD A;  5M5W B;  1DM0 B;  5IYC G;  3F2U A;  4XXE A;  1Y1W G;  3U9O A;  3MXG A;  2SEB D;  3I4M B;  4GNX A;  5IWA Q;  1CA6 A;  5FJ8 G;  1VQJ A;  2FIN B;  2F0U A;  2IJ0 A;  1K28 A;  3FPU B;  3NEM A;  5JEA G;  4NMZ A;  5FLX c;  3NP8 A;  1O7Y A;  4L63 B;  1IW7 D;  5IT9 E;  1CHQ D;  4B3S Q;  3HOY B;  2V1C C;  1P16 A;  3J81 E;  3PO3 B;  5IOD A;  2FHT A;  5IGB A;  2CQA A;  4QUF A;  3CHB D;  3ND8 A;  4XQJ A;  1FYC A;  1YJW A;  4N9P A;  4QY7 A;  1KNE A;  1N9W A;  2J0T D;  3QWN A;  3CQZ H;  4E6I A;  1EFI D;  5FO8 B;  1CTM A;  3T4A C;  2OF1 A;  5M5W H;  1YJN A;  4HR7 B;  3OTO L;  1PH7 A;  3RN2 A;  3I4M H;  4DV0 L;  1C9O A;  5CGK A;  2OCE A;  3DXJ C;  2VY3 A;  1RTN A;  3LWU A;  4ZRZ A;  4HMJ A;  3RZD B;  3OMG A;  2ZM6 Q;  1JOQ A;  1AE2 A;  2UUB L;  5EBD A;  2FJ2 A;  1Q82 C;  1AH9 A;  2N55 A;  3HOY H;  5E4W C;  3PO3 H;  2C5C A;  4DUZ Q;  4IPH A;  3Q24 A;  4LK1 C;  4IUN A;  3HOZ B;  4CJ2 C;  5C6A A;  2CH4 A;  3RNU A;  5BR8 L;  2Q8R E;  3HGB A;  4R4T A;  4F88 A;  1JMC A;  3VR2 A;  4A3F G;  1OXS C;  1SRO A;  1WYD A;  3O13 A;  4IUP A;  2F0L A;  3DUZ A;  3V2T A;  3VYS A;  5M3F G;  4KY5 A;  2K05 A;  1G6P A;  1JT8 A;  2B8F A;  2A73 B;  2MQH A;  4JPB W;  4LW1 A;  3OW2 A;  3ZYY X;  4GKK L;  4NDX A;  3RZD H;  1I4G A;  3D4W A;  3CME A;  3PCO B;  3K81 C;  1HPC A;  4IUQ A;  2WB1 B;  5I6Y A;  2M00 A;  5LL6 X;  2F4V Q;  3MXU A;  1ZYR C;  4X3K A;  4GKJ Q;  4LFB Q;  4A3M H;  1STE A;  2UUA Q;  2F0D A;  5IGE A;  2I5L X;  4B3S L;  1GUG A;  2K50 A;  3EIV A;  4HIM A;  2YYZ A;  5KYL A;  1CSP A;  3MEF A;  4RCO A;  1CKN B;  3NSW A;  1GUN A;  4EX5 A;  1PZK D;  3S1R B;  1NJI C;  1KTK A;  3A54 A;  5D3I B;  2Q2U A;  2K01 A;  4A3D B;  5C4Z A;  4RHR A;  4LMQ D;  3AYH B;  3SK8 A;  1BF4 A;  3SVM A;  1A0I A;  4WJW A;  5K36 H;  1M8A A;  3T13 A;  2KJX A;  2WAQ E;  4C3J B;  4X66 L;  4A3J H;  2QF7 A;  1WTR A;  5EBC A;  1QZG A;  1SN8 A;  1CZG A;  5ELN A;  4EQO A;  1LT3 D;  1D8L A;  3OIQ A;  4OWT B;  3GV3 A;  1JJC B;  4BBR G;  2I5H A;  3C3L A;  1TS4 A;  2K14 A;  3I3C A;  3A5U A;  3NUC A;  4GLV B;  4LUV A;  4IFD J;  1A63 A;  4H7B A;  4IUV A;  4UP7 A;  5G3L D;  3J81 i;  3PV0 A;  4JG2 A;  2MUY A;  3S1R H;  4HMI A;  4DAY B;  1CQV A;  4A3D H;  1J5E L;  2OEO A;  2JN4 A;  3T1Y L;  3M4Y A;  3GTQ H;  2QGQ A;  4CDD C;  2O5I C;  3K5M A;  1CSQ A;  1AE3 A;  2X6L A;  5I2Y A;  2RHQ B;  4CDE C;  1DON A;  1F9R A;  2R93 H;  2DN8 A;  1O78 A;  1HNZ Q;  3K7U C;  3N6R A;  1H95 A;  5K5P A;  1PFB A;  3EJI A;  1SYC A;  3TME A;  5I6W A;  3KDF A;  5C5L A;  3VR4 A;  1X6O A;  3GQB A;  1WD1 A;  4DR4 L;  3DMU A;  3V96 A;  3OWE B;  1Y8O B;  4OEM B;  1TS5 A;  3MEH A;  2MO1 A;  2Y0S B;  3CRK C;  4KN4 C;  3K0Y A;  3BYT B;  1EFW A;  4HIK A;  1JC7 A;  2B8G A;  1FGU A;  4UP9 A;  3S17 B;  5C3E B;  2PW7 A;  1OXV A;  5IGC A;  4TRD A;  3HKZ B;  2L4N A;  3GTM B;  1XMO L;  3RLF A;  1L1O A;  1H9K A;  1CK1 A;  4XIG S;  1A3U A;  4Q5V A;  4RKB A;  1SBB B;  2UUC Q;  2XRS D;  1SFO B;  1CZW A;  2F52 A;  4Y7N H;  2G5D A;  2CH4 W;  4OGQ C;  3IKJ A;  1JCK B;  2EY1 A;  4FXD A;  3K8A A;  3ULP A;  1KC8 C;  1EL0 A;  5FKA C;  1GD7 A;  1HHV A;  2Z1C A;  2HHH L;  3VYT A;  1PV4 A;  1SMY C;  4DAV A;  1TR5 A;  1A8V A;  4JBJ A;  1R4P B;  2AQ1 B;  1HA5 A;  5M3M G;  1PH8 A;  2K4K A;  2K5D A;  5GAE C;  3K5O A;  1QWY A;  1LT4 D;  2Z4H A;  1I4X A;  3S17 H;  3H94 A;  5C3E H;  2X6G A;  1H9R A;  3W1B A;  4DR3 L;  3BVZ A;  1XTD A;  2G9D A;  3HKS A;  3GTM H;  2NZH A;  3D6C A;  4OX9 L;  2WIN B;  1YNJ C;  3EQL C;  4DR7 Q;  4X65 Q;  4R4O A;  2UXB L;  4JI8 Q;  4J15 A;  3MXN A;  1SFO H;  4JI6 Q;  2ZJQ A;  2HIV A;  4JI3 Q;  3CKI B;  3A8K E;  1LT5 D;  4BXX H;  3UDF A;  4JI2 Q;  3SEB A;  4LF8 Q;  1AW7 A;  1XMQ Q;  4RA8 A;  5KRU A;  2B63 B;  3PGZ A;  1KIX A;  1G29 1;  3NBH B;  4R9W A;  1IBK Q;  1ET9 A;  2IX1 A;  4RH6 A;  3PIP A;  2C9O A;  4A3G H;  1A62 A;  4MTN A;  1PTO B;  2QEJ C;  2VXW A;  3UE0 A;  2XNA C;  2EY6 A;  1U9R A;  3I4N B;  2JSO A;  2A69 D;  1XJV A;  3K5L A;  2OTL A;  4EQN A;  3AQQ A;  2A6H D;  2NUC A;  1BCP C;  4WOR A;  4MNO A;  3KLS X;  1EIG A;  3E0J A;  2EXZ A;  4G7H C;  2F0N A;  1WTP A;  1VQE A;  2UXD Q;  1WVL A;  2B63 H;  5GQO A;  5EPL A;  3NWT A;  1BKB A;  3F1Z A;  1IL2 A;  3MHB A;  3MXP A;  3WWV A;  1W2B A;  3U58 A;  5IP7 H;  3NEN A;  1STN A;  4NB3 A;  3HFZ B;  1SXT A;  1VQD A;  2VQF L;  1PTO H;  1S3O A;  1V43 A;  1JB3 A;  1I50 B;  4DR5 Q;  1LTA D;  4A3M G;  3H3V I;  3FVQ A;  4LUO A;  3SR1 A;  1HZC A;  2PQA B;  3I4N H;  1N32 Q;  1T9H A;  4IFD G;  4QB4 A;  3K7A H;  4QIW E;  2JA8 B;  3FEW X;  2MP1 A;  1QE6 A;  3OMC A;  1J9O A;  5M5X B;  3SHL A;  1M1K C;  1UE6 A;  2JEB I;  3CRL C;  3TBI B;  2NVT B;  4JI2 L;  1RTO A;  1O7L A;  3S1Q B;  1SND A;  1ML0 D;  3DWP A;  4WRD A;  4L5T A;  1HNX Q;  4C3H B;  1GUT A;  4IJH A;  4A3J G;  5CYU A;  1SYE A;  2VQE Q;  4DR1 L;  3CCU A;  1TXY A;  1VF7 A;  1X32 A;  2WAC A;  4HSV A;  4L5R C;  3S15 B;  4G7O C;  4KHP Q;  1WD0 A;  1FD7 D;  5CMD A;  3IL8 A;  1FL0 A;  5F2D A;  3KF6 A;  1TII D;  1K0S A;  2KA7 A;  3OWF A;  1XX8 A;  2L12 A;  4PZ8 A;  3NK9 A;  1WTV A;  4DV6 L;  1ESF A;  4AYB E;  2JA8 H;  3CCJ A;  4V19 0;  1EOT A;  4K8I A;  5ELD A;  2KHI A;  4A3D G;  5M5Y B;  2BA1 A;  2MNA A;  2B2V C;  3T16 A;  5M5X H;  3JAM E;  4JI1 Q;  3EBE A;  1XWE A;  5HY6 A;  3I2Z A;  2O2L D;  3S1Q H;  1A3V A;  1E1O A;  2R93 G;  1VMP A;  4DV7 Q;  1PRT C;  2YTY A;  2L5T A;  4H02 A;  4C3H H;  3W5O A;  2RCN A;  1UE1 A;  1OO9 B;  1KAA A;  3BYY B;  1NSN S;  3PIP 3;  1VQ9 A;  3OHX C;  1A2T A;  2WV6 D;  4U67 3;  3C1F A;  3LNN A;  3S15 H;  1YNN D;  3OW7 A;  1B3A A;  2F1M A;  3BG3 A;  4QL5 A;  4CKE A;  3CCL A;  3QIA A;  2K1B A;  2FMM A;  4EVO A;  1QCB D;  1FNU A;  1TWF B;  2Q8I B;  4DR5 L;  4ZKB B;  1T5E A;  2B2T C;  1JE5 A;  1S72 A;  4IPC A;  1TWG H;  1N32 L;  4KD3 A;  2E2I B;  5M5Y H;  4GLA C;  4DUY L;  2WII B;  3MC0 B;  4PMC A;  2XVS A;  1C48 A;  2PMZ B;  1A6X A;  1XNR L;  2JA5 B;  3M4O H;  1V1P A;  1VF5 C;  3A0J A;  1XNQ L;  3D6W A;  2VW9 A;  5J22 A;  1EYG A;  5CV9 A;  2ZJP A;  3BDO A;  4P73 A;  2F0F A;  4HCE A;  4G4K A;  1QB5 D;  2O4X A;  3AFQ A;  3QO2 A;  2EYP A;  1HNX L;  5C0X H;  4OO1 I;  3URY A;  2OTJ A;  3TEH B;  3GTL H;  4X62 L;  4C1N K;  2DY7 A;  5KIX A;  1TWF H;  1QZH A;  2EYF A;  3KK7 A;  4R8N A;  5LL6 S;  2EJM A;  3E0E A;  3CCV A;  1G8Z D;  1VQ8 A;  2E2I H;  4DA2 A;  3NBI A;  2HQL A;  4YWK A;  4KMU C;  3RZO B;  1PH4 A;  4NW2 A;  1VQK A;  2EYL A;  4A3B B;  2JA5 H;  3DM3 A;  5DAU A;  3GD7 A;  1U5K A;  4ODG A;  3J7Z C;  3OOC A;  3PF4 A;  1VQA A;  3GTK B;  1JJ2 A;  1JWS D;  4TKO B;  5C4J B;  2D0P A;  3AFP A;  4DV1 L;  5FLX L;  2KUM A;  3S14 B;  1IKL A;  5C0X J;  1YBY A;  4RFB A;  5LMN L;  4BXX G;  2NYZ D;  1R9T B;  4AQY L;  1TY0 A;  5C4X B;  3VYR A;  4L8J A;  2VB3 X;  3CF5 A;  3J80 c;  4HJA A;  1CQF A;  3OTO Q;  1Z47 A;  2L1B A;  4UAI A;  5CV7 A;  2PYK A;  4ZCK A;  4DV0 Q;  3RZO H;  3TP6 A;  3R2I A;  4A3G G;  2BDO A;  3HOX B;  4A3B H;  5JPM C;  2AWO A;  1X9N A;  1MSH A;  4O2D A;  4LF7 Q;  1LYL A;  5DM6 3;  3CW2 C;  2HDM A;  3RMH A;  3JAM i;  4HJ7 A;  3GTK H;  1F2L A;  5C4J H;  2BE5 D;  4KKT A;  3EN2 A;  5I9P A;  3S14 H;  1KLU D;  1TU2 B;  2JXM B;  4JCV E;  2Z6K C;  2VNU D;  5J3B A;  1QUQ A;  1R9T H;  5C4X H;  4ULL A;  4KTA A;  5BR8 Q;  2HCI A;  1JE4 A;  4XQQ A;  3Q22 A;  4JI5 L;  2Q8T A;  3S16 B;  1EEI D;  2G9H D;  1I4Q A;  2R61 A;  3J7A 5;  4ME5 A;  1S5F D;  2ALY B;  1SE8 A;  3D4D A;  1ONL A;  5EJW A;  3NHH A;  1LAC A;  5IP7 G;  2HIX A;  3HOV B;  3KF8 B;  4GKK Q;  5C5M A;  3HOX H;  4M8A A;  2FMC A;  1CFM A;  2A6E D;  2DNC A;  4ZK9 B;  3J81 j;  1D5Z C;  1H9M A;  1STY A;  3NEL A;  5LMU Q;  4DV5 L;  1UWV A;  1MD2 D;  1D6E C;  2VB2 X;  4JYA Q;  1HUM A;  2F0O A;  2F0Q A;  3QB3 A;  4OIJ A;  4CDF C;  1EY7 A;  1N33 L;  1E2V A;  1GO3 E;  3W2D A;  3P20 A;  1HH2 P;  3I72 A;  2A1A A;  3BZK A;  4KK7 A;  1LTR D;  2R7D A;  3SK4 A;  3S16 H;  1A3T A;  2LMC B;  2E8G A;  3T53 B;  4WJ4 A;  3UE1 A;  4J8Q A;  5EGT A;  2A19 A;  1S4Z A;  3HOV H;  1I4H A;  2MJ8 A;  1SYD A;  5E1F A;  4A3K B;  1Q1B A;  1B70 B;  1AZP A;  3WDN A;  1WTH A;  1BO0 A;  1AP0 A;  1XYI A;  2VZA A;  3L7Z C;  4IZ8 A;  5JJL A;  2EJF C;  4X66 Q;  4IJL A;  1U0L A;  3A5Z B;  1NMF A;  2N49 A;  4LF7 L;  5EKK A;  1C8C A;  4EGV A;  2HUG A;  4JV5 Q;  1MKH A;  2JA8 G;  4ZYS A;  3TP7 A;  4NKL A;  2RDF A;  4P74 A;  3QG1 A;  1Q7Y C;  4HJ9 A;  2HD3 A;  1E7Z A;  3HS0 C;  3HZX A;  2VL6 A;  1ROD A;  2BDN A;  1PH6 A;  1IZ6 A;  3W3A A;  4LWC A;  2QCP X;  4P2C B;  4NP5 A;  1EQT A;  1J5E Q;  1S5D D;  3ERS X;  3T1Y Q;  1YHA A;  3NE5 B;  1IW7 C;  4AYB G;  4C3H G;  2DJG C;  4A3K H;  2QEX A;  1GOZ A;  2RDG A;  1I5F A;  4UDU C;  1S40 A;  2CQO A;  5LMU L;  4N9T A;  4BY1 B;  5JAV A;  2KEE A;  1XPU A;  3K59 A;  1E2W A;  4DR4 Q;  3BZC A;  1JIC A;  4TVA B;  3GTQ B;  4JBM A;  4JI7 L;  1F9S A;  2B2U C;  4JYA L;  3IRB A;  4L6T B;  1NMG A;  4HTH A;  3HOZ H;  2D0O A;  4MZ9 A;  5A35 A;  1DZ1 A;  3J81 c;  1LUZ A;  5J1Z A;  4JI4 L;  2WB1 E;  4LF5 L;  1OXX K;  1JR0 D;  2E2H B;  4IFD I;  2I0Q A;  4HED A;  5IGF A;  2MGS A;  2XWJ B;  1XMO Q;  3CC4 A;  2I5M X;  5ELF A;  1MJC A;  5C0X G;  3LX0 A;  2A5H A;  4JOI C;  2ZXP A;  1W3S A;  4B9X A;  2H5X A;  5C44 B;  1Q90 A;  4JBK A;  3L3O C;  4BY1 H;  3M4P A;  1DYQ A;  4K2K A;  3HOW B;  4GOP A;  1VQN A;  3SDZ A;  2HHH Q; 
#chains in the Genus database with same CATH homology
 2B39 A;  1GUS A;  1HCZ A;  1RKN A;  2IPK D;  1GHK A;  4CGY B;  2VUM B;  4X3U A;  3FPP A;  2EJG C;  3TDQ A;  1WTW A;  2JA7 B;  2F0K A;  3E6Z X;  4MHE A;  5EQ0 A;  4ZUJ A;  2B2T A;  4IUR A;  1EU3 A;  1CHP D;  1H9J A;  1LO5 D;  1WTO A;  4ILW A;  4H0L C;  5C4H A;  3TP8 A;  1E0B A;  1EZ6 A;  2SOB A;  2N88 A;  4KN7 C;  3N52 A;  1TWH B;  1O7Z A;  1EIH A;  1SJE D;  3BZD B;  3IAY A;  1I6H B;  5KNB A;  4DAP A;  1MBY A;  4A3I B;  3TSS A;  5CV8 A;  1EWH A;  1HA6 A;  1LLR D;  1BR9 A;  1KDA A;  1EQV A;  2D9U A;  1LTT D;  2WKC A;  3HRZ C;  3R3O A;  1TWA B;  4RWS C;  1FGB D;  1S5C D;  2IL8 A;  1DOM A;  4K5X A;  5TSS A;  1CA5 A;  1IYV A;  3A7A B;  1SNM A;  1IKM A;  4FF1 A;  4KKS A;  5E3F A;  4LAA A;  2PW5 A;  2WP8 J;  1H9S A;  1HXY D;  2X69 A;  3S2D B;  1EU4 A;  1NR2 A;  1HFG A;  3DEP A;  1DCZ A;  3GO5 A;  1BXT A;  4FVM A;  4H44 C;  1PMR A;  5ELE A;  1DJR D;  3EFX D;  1GHJ A;  3H0G B;  4RAU C;  2EVB A;  3D31 A;  3D4R A;  2IW3 A;  3HOU B;  1STA A;  4HCS A;  3K6O A;  4Z9C B;  4PV1 C;  4QCL A;  4FXK C;  5T1G A;  4B08 A;  3UI2 A;  3E5S A;  2L0C A;  5IGG A;  5IOC A;  1G6Z A;  3OIP A;  5A2Q L;  2TSS A;  2ICI A;  4K2L A;  2D2C C;  4A93 B;  3J7Y W;  2DNE A;  1F2M A;  3NXW A;  1BOS A;  1PTO C;  2XIW A;  1I4P A;  4KD4 A;  1ENF A;  1B9N A;  2NN6 H;  2F0G A;  3AB9 A;  1ET6 A;  4DFA A;  2F0H A;  1Y1W B;  4PMB A;  2RDH A;  3A56 A;  4HSP A;  1DXM A;  3PUZ A;  2V4D A;  4I65 A;  2JA6 B;  1OXT A;  1OXU A;  5KND A;  1CI3 M;  2D62 A;  2M2L A;  2HCC A;  1NR4 A;  3PUY A;  5JVH 3;  2AQ2 B;  1NUC A;  1E2Z A;  4ZAI A;  1PDQ A;  2H1E A;  2MPM A;  2CVR A;  5FOB B;  1ENA A;  3KBG A;  4FF4 A;  4C3I B;  1PXU A;  2JEA I;  5K36 G;  2A69 C;  3R2T A;  5JEA H;  1BBX C;  1UAP A;  2EY5 A;  2SNM A;  3LWE A;  2ICE C;  4R8I A;  2F0S A;  3MVV A;  2O5J C;  1EYA A;  2JP1 A;  4QF4 A;  1KLG D;  3J7A F;  3SXH A;  1U4M A;  3SE0 A;  1GJX A;  2F3W A;  4K14 A;  3J7A V;  3TN2 A;  1RCV D;  4A3F B;  2OXP A;  2NBF A;  1F9P A;  5E4X A;  4PNY A;  4F87 A;  1A15 A;  5M3F B;  1UEA B;  1B53 A;  2E74 C;  2B2U A;  3RD4 A;  3T56 B;  1SE4 A;  1JOO A;  5M9O A;  3PUX A;  4XTC S;  1TS2 A;  1RD9 D;  1V1O A;  4C3J G;  2K03 A;  5BN4 A;  3D8G A;  1TWC B;  1LTG D;  2KEC A;  3M7G A;  3AU7 A;  1GUO A;  3QOL A;  5EPJ A;  1J8I A;  1L0Y B;  4HAE A;  1G2T A;  1WCM B;  5CV5 A;  1CM9 A;  1U4R A;  1DOL A;  3NWS A;  3OSO A;  3J80 L;  4RGM A;  1PFM A;  2F0V A;  4JK1 C;  2PCF B;  1D5M C;  4TSS A;  5AFW A;  2LKV A;  4M1U B;  3GTJ B;  2AUJ D;  2EYJ A;  1K8M A;  1B44 D;  3NQI A;  3H09 A;  1Y8N B;  3IFT A;  2A68 D;  4DAY A;  1D2B A;  3DHQ A;  3C1E A;  3Q23 A;  1GUW A;  2EY2 A;  3V05 A;  5C0X I;  1D5X C;  1KAB A;  1PYW D;  4XQN A;  2H4O A;  3VR5 A;  3KLR A;  2RA4 A;  4X3S A;  1PLF A;  2E2J B;  2J7Z A;  4DGZ A;  4OO1 H;  3KBX A;  1SNP A;  2HQE A;  3C46 A;  1LAB A;  5KEE A;  1YNN C;  3KLS A;  2M9V A;  1Q1E A;  3AMU A;  5ISR A;  1SYF A;  4H13 C;  1ESR A;  3WOF A;  1RDP D;  1RF2 D;  1PTO F;  4GZY C;  1LV9 A;  4K6D A;  4CBV A;  3P75 A;  2F3V A;  1ZKO A;  4CHT B;  4MIU A;  2ZT9 C;  1BCP F;  5FO7 B;  4K5V A;  1AEX A;  5JVG 3;  5FLX E;  4FF2 A;  2NZ1 D;  1PZI D;  1UNS A;  1TS3 A;  4KJO A;  5FO9 B;  4KI0 A;  3RUZ A;  2SNS A;  2QKI C;  3FKI B;  5ELC A;  4F8M A;  3VR3 A;  5DM7 3;  5NUC A;  3HP3 A;  1Q3L A;  3PUV A;  2IWH A;  2ZXR A;  4KHZ A;  1SNC A;  2NN6 G;  1QG7 A;  2KQ3 A;  5KNC A;  4RGO S;  2K28 A;  5HGT A;  1TVX A;  3SK5 A;  3ND9 A;  3P1H A;  4KHV A;  2AWN A;  3EVQ A;  2CW0 C;  2LS0 1;  5M3M B;  2L55 A;  2ZXO A;  5CV6 A;  3PO2 B;  1AFP A;  4XT3 B;  1HUN A;  3NTI A;  1HQR D;  1W6K A;  2IX0 A;  4BWG B;  4IN3 A;  3QJY A;  4IAL A;  3M7N A;  5EKL A;  1JWM D;  3MFY A;  4XT1 B;  3I73 A;  4RGT A;  5I2X A;  1MGS A;  3NBH A;  3KUP A;  1Z6H A;  1NAP A;  1STB A;  1F77 A;  1K83 B;  2J4X A;  4BBS B;  5IIF A;  1B2T A;  5IT9 L;  3WOE A;  2BE5 C;  3J81 L;  1CT1 D;  5T1I A;  2E75 C;  1PRT F;  1ZXT A;  5CR3 A;  3X3M A;  1EZ8 A;  3BDC A;  1VDZ A;  5KGU A;  2PPB C;  2F0M A;  4ABN A;  1IHZ A;  2PO4 A;  2NTS A;  4RKL A;  1I4R A;  3GV6 A;  1JWU D;  1ZYR D;  4J1M A;  1EY0 A;  3MWY W;  2ENB A;  3ITP A;  5I9O A;  5DEH A;  2A6E C;  5C3X A;  4JBW A;  4C3I G;  2E76 C;  4C1N I;  4F7X A;  1B1Z A;  1M4V A;  4U68 A;  3U9S A;  4A3M B;  2F0T A;  1XTC D;  1MSG A;  1U4P A;  3DEO A;  1II3 A;  3ERO A;  1LTS D;  2D5D A;  4IUT A;  3DM1 A;  4RGN A;  5COR A;  4O42 A;  4ZKC B;  2I46 A;  2KVM A;  3EA6 A;  1WTX A;  1FR3 A;  1KDC A;  1QIL A;  2NVX B;  1Z7T A;  3VA5 A;  3BS1 A;  5HUR A;  3C2P A;  1HFN A;  3K5N A;  4A3J B;  4G57 A;  2K04 A;  2K33 A;  2K6A A;  2DY8 A;  2B2V A;  1WTQ A;  5D14 A;  4BY7 B;  5EKI A;  4QUC A;  1SEB D;  4IFD H;  3DWQ A;  3M3Y B;  1B4O A;  2WAQ B;  4OO1 G;  4O1N A;  1HQM C;  4QMG A;  4FF3 A;  3S1M B;  3S1N B;  2WKD A;  3VR6 A;  5FK9 C;  1EY8 A;  2R93 B;  5COY A;  1HTP A;  1TKW B;  2NVY B;  4KY7 A;  3MFG A;  4PQX A;  2BA0 A;  1V1P B;  1K8O A;  3BVG A;  4XYQ A;  3S2H B;  5CV4 A;  1TT2 A;  2R7Z B;  1HTL D;  2PZU A;  2RBM A;  1A2U A;  1KDB A;  4KY6 A;  1DOK A;  1C4Q A;  2EZV A;  4FYD A;  2KCC A;  1SMY D;  1V8Q A;  4CKC A;  5JPN C;  1EYD A;  1BNZ A;  4FP5 D;  4LJZ C;  2JYO A;  1SNQ A;  4Y7N B;  4DXF A;  1NCV A;  4DU9 A;  3H91 A;  1YNJ D;  1BDO A;  3Q0A A;  2KHS A;  3GTG B;  1SNO A;  1FNV A;  4DN4 M;  4FNF A;  4RHS A;  4BS9 A;  4KJN A;  4J6H A;  2PNR C;  5D65 A;  3QOJ A;  1R4Q B;  4FXG C;  2B2W C;  2B2Y C;  3I8Z A;  4EQP A;  5JJZ A;  3H6M A;  3FMC A;  1Q12 A;  1VCI A;  1QOH A;  2NVQ B;  2EYM A;  2Z4I A;  5BN5 A;  1PTO D;  4CJ1 B;  2QIL A;  1IYU A;  1S5B D;  2NTT A;  1SE2 A;  1SYB A;  2R6G A;  2PZW A;  1UUP A;  1BCP D;  2SDF A;  2NWG A;  4A3G B;  2AQ3 B;  2KCN A;  3PIO 3;  3VA7 A;  4ZQ3 A;  2IT1 A;  1LTB D;  5J39 A;  1Y8P B;  2KOL A;  1MI2 A;  1EY9 A;  3FDT A;  3K57 A;  3ERQ A;  2FFK B;  4TQU S;  1PFN A;  4YIJ A;  3D3R A;  2K32 A;  2XRQ D;  5JOB A;  5A2Q E;  1G2S A;  1LT6 D;  2XSC A;  2R92 B;  3KF8 A;  4XDX A;  2EDG A;  5CC4 A;  3I90 A;  4Q0F A;  1ZEQ X;  5EPK A;  2EPB A;  4MN3 A;  4DXG A;  2NN6 I;  1BQQ T;  4ID6 A;  3GTP B;  2EOT A;  1QNU A;  3H3V C;  2LY7 A;  2CHB D;  1F2Z A;  2RSN A;  4C2M B;  3R93 A;  2XN9 C;  3G7L A;  4V0B A;  4ZLT F;  1GXD C;  1T5X D;  2F0E A;  1BCP B;  2K7V A;  1QNK A;  3Q6S A;  4DNR B;  4K6L A;  4BA2 I;  1EYC A;  2PQE A;  3K7A B;  1X3P A;  3ONA B;  3CU7 A;  1VMC A;  4BA1 I;  4WFN 3;  3K58 A;  3T51 B;  3HEJ A;  2F0P A;  1SSO A;  3R8B A;  2EYO A;  2RKS A;  4QIW B;  1SAP A;  3A8J E;  1IL8 A;  3DWA A;  1B9M A;  2A74 C;  1BUV T;  3MZ5 A;  1I6V C;  3TP5 A;  2L9H A;  2PZT A;  2A6H C;  2HDL A;  2NB0 A;  3I91 A;  3MA2 B;  1PRT D;  3BVM A;  1FNW A;  1RHP A;  1ILP A;  1DD2 A;  1F2Y A;  3TZU A;  4KV6 A;  2EYH A;  1B50 A;  2MHV A;  4XYO A;  1SDF A;  4I7Z C;  1KNA A;  2QDB A;  4C56 C;  3NTK A;  3VYU A;  4AYB B;  2E2D C;  3PMF A;  4FO2 A;  1O80 A;  5JEA J;  2IX3 A;  5G3L F;  3JAM L;  1TWG B;  1SYG A;  1STH A;  3NTH A;  2F0J A;  2R3Z A;  3M4O B;  1PRT B;  1X3Q A;  1D1I A;  5BN3 A;  1HRJ A;  1S5E D;  4CJ0 B;  4CKB A;  3J80 E;  3FRP B;  3GTL B;  4K5W A;  1STG A;  4K8J A;  5KYI A;  4ZUI A;  4G7Z C;  2AUK A;  3IFD A;  2Z8L A;  2LFN A;  1I3Q B;  4X3T A;  1D1K A;  4BBR B;  4IQZ A;  3HG9 A;  1LTI D;  2YU9 B;  2KED A;  4S3S A;  3NQT A;  2OT2 A;  1PZJ D;  3M85 A;  1W6J A;  5CBE E;  4RCN A;  3A7L A;  5D3D A;  4A3E B;  2RSO A;  3X3N A;  3SK6 A;  1RJT A;  1Y69 U;  2BOS A;  2RQX A;  1U4L A;  1EY4 A;  2F4I A;  3A55 A;  5CBA E;  2L11 A;  3G6J B;  2XWB B;  1TQO A;  3OPO A;  1SE3 A;  5IGD A;  3S9W A;  1ENC A;  4HN7 A;  1EEF D;  3L9A X;  3PUW A;  3A8I E;  1AZQ A;  3MAQ A;  4OIK A;  4PMW A;  5LHY 1;  4KKU A;  1H9S B;  2CW0 D;  3GTO B;  1EY6 A;  2JE6 I;  1XXG A;  2K5W A;  1QJO A;  2A68 C;  3P7J A;  5I4D A;  1JQY D;  1TY2 A;  2B2W A;  2B2Y A;  3GP7 A;  4DK1 A;  1JOR A;  4OHJ A;  1Y1V B;  3BDL A;  1ILQ A;  2BCO A;  5ELB A;  2K5Q A;  2F0W A;  3I70 A;  1EWC A;  2RVL A;  1AN8 A;  2EE1 A;  1ICW A;  2GA4 B;  4DNT B;  1F9Q A;  4DK0 A;  2ID0 A;  1L0X B;  2F0I A;  2TMP A;  4OL7 A;  3NPP A;  5C3W A;  4DF7 A;  1SJH D;  4B9W A;  2F03 A;  1JOK A;  4IUU A;  5DNF A;  3I4L A;  3CQZ B;  3MTS A;  1G91 A;  2I07 B;  1Q8I A;  1EY5 A;  3TZD A;  5M5W B;  1DM0 B;  3F2U A;  4XXE A;  3U9O A;  3MXG A;  2SEB D;  3I4M B;  1CA6 A;  2IJ0 A;  2FIN B;  2F0U A;  3FPU B;  5JEA G;  4NMZ A;  3NP8 A;  1O7Y A;  4L63 B;  1IW7 D;  5IT9 E;  1CHQ D;  3HOY B;  3J81 E;  3PO3 B;  5IOD A;  2FHT A;  5IGB A;  2CQA A;  4QUF A;  3CHB D;  3ND8 A;  4XQJ A;  1FYC A;  4N9P A;  1KNE A;  3QWN A;  2J0T D;  4E6I A;  5FO8 B;  1EFI D;  1CTM A;  3T4A C;  2OF1 A;  4HR7 B;  5CGK A;  3DXJ C;  1RTN A;  3LWU A;  4ZRZ A;  4HMJ A;  3RZD B;  3OMG A;  1JOQ A;  5EBD A;  2FJ2 A;  2N55 A;  5E4W C;  2C5C A;  3Q24 A;  4LK1 C;  4IUN A;  3HOZ B;  4CJ2 C;  5C6A A;  2Q8R E;  3HGB A;  4F88 A;  3VR2 A;  1OXS C;  4IUP A;  3O13 A;  2F0L A;  3DUZ A;  3V2T A;  3VYS A;  4KY5 A;  2K05 A;  2B8F A;  2A73 B;  3ZYY X;  4NDX A;  1I4G A;  3D4W A;  1HPC A;  4IUQ A;  2WB1 B;  5I6Y A;  2M00 A;  5LL6 X;  3MXU A;  1ZYR C;  4X3K A;  1STE A;  2F0D A;  5IGE A;  1GUG A;  2YYZ A;  5KYL A;  4RCO A;  3NSW A;  1GUN A;  1PZK D;  3S1R B;  1KTK A;  3A54 A;  5D3I B;  2K01 A;  4A3D B;  5C4Z A;  4RHR A;  4LMQ D;  3SK8 A;  1BF4 A;  3SVM A;  4WJW A;  5K36 H;  1M8A A;  3T13 A;  2KJX A;  4C3J B;  2QF7 A;  1WTR A;  5EBC A;  1CZG A;  4EQO A;  1LT3 D;  3OIQ A;  3GV3 A;  3C3L A;  1TS4 A;  3I3C A;  3NUC A;  4IFD J;  4H7B A;  4IUV A;  5G3L D;  3PV0 A;  2MUY A;  4HMI A;  1CQV A;  2OEO A;  3M4Y A;  2O5I C;  3K5M A;  2X6L A;  5I2Y A;  1DON A;  1F9R A;  2DN8 A;  1O78 A;  3N6R A;  5K5P A;  1PFB A;  3EJI A;  1SYC A;  3TME A;  5I6W A;  5C5L A;  3VR4 A;  3GQB A;  1WD1 A;  3DMU A;  3V96 A;  3OWE B;  1Y8O B;  1TS5 A;  3MEH A;  2Y0S B;  3CRK C;  4KN4 C;  3K0Y A;  3BYT B;  1JC7 A;  2B8G A;  3S17 B;  5C3E B;  2PW7 A;  1OXV A;  5IGC A;  4TRD A;  3HKZ B;  2L4N A;  3GTM B;  3RLF A;  1H9K A;  1CK1 A;  4XIG S;  1A3U A;  4Q5V A;  4RKB A;  1SBB B;  2XRS D;  1SFO B;  1CZW A;  4OGQ C;  3IKJ A;  1JCK B;  2EY1 A;  4FXD A;  1EL0 A;  5FKA C;  1HHV A;  2Z1C A;  3VYT A;  1SMY C;  4DAV A;  1TR5 A;  1R4P B;  2AQ1 B;  1HA5 A;  2K5D A;  3K5O A;  1QWY A;  1LT4 D;  2Z4H A;  1I4X A;  3H94 A;  2X6G A;  1H9R A;  3BVZ A;  2G9D A;  3D6C A;  2WIN B;  1YNJ C;  3EQL C;  3MXN A;  3CKI B;  3A8K E;  1LT5 D;  3SEB A;  1AW7 A;  4RA8 A;  5KRU A;  2B63 B;  1G29 1;  4R9W A;  1ET9 A;  2IX1 A;  4RH6 A;  2C9O A;  1PTO B;  2QEJ C;  2VXW A;  2XNA C;  2EY6 A;  1U9R A;  3I4N B;  2JSO A;  2A69 D;  3K5L A;  4EQN A;  2A6H D;  2NUC A;  1BCP C;  4WOR A;  3KLS X;  1EIG A;  3E0J A;  2EXZ A;  4G7H C;  2F0N A;  1WTP A;  1WVL A;  5EPL A;  3NWT A;  3MHB A;  3MXP A;  1STN A;  1SXT A;  1PTO H;  1V43 A;  1JB3 A;  1I50 B;  1LTA D;  3FVQ A;  3SR1 A;  4IFD G;  4QB4 A;  2JA8 B;  3FEW X;  2MP1 A;  1QE6 A;  3OMC A;  1J9O A;  5M5X B;  3SHL A;  2JEB I;  3CRL C;  3TBI B;  2NVT B;  1RTO A;  1O7L A;  3S1Q B;  1SND A;  1ML0 D;  3DWP A;  4WRD A;  4C3H B;  1GUT A;  5CYU A;  1SYE A;  1VF7 A;  1X32 A;  2WAC A;  4HSV A;  4G7O C;  3S15 B;  1WD0 A;  1FD7 D;  5CMD A;  3IL8 A;  5F2D A;  1TII D;  2KA7 A;  3OWF A;  1XX8 A;  2L12 A;  3NK9 A;  1WTV A;  1ESF A;  4V19 0;  1EOT A;  4K8I A;  5ELD A;  5M5Y B;  2BA1 A;  2B2V C;  3T16 A;  3JAM E;  1XWE A;  2O2L D;  1A3V A;  1VMP A;  1PRT C;  2L5T A;  1OO9 B;  1KAA A;  3BYY B;  1NSN S;  3PIP 3;  3OHX C;  1A2T A;  2WV6 D;  4U67 3;  3C1F A;  3LNN A;  1YNN D;  3OW7 A;  1B3A A;  2F1M A;  3BG3 A;  4CKE A;  3QIA A;  2K1B A;  2FMM A;  4EVO A;  1QCB D;  1FNU A;  1TWF B;  2Q8I B;  4ZKB B;  1T5E A;  2B2T C;  4KD3 A;  2E2I B;  2WII B;  3MC0 B;  4PMC A;  2XVS A;  1C48 A;  2PMZ B;  1A6X A;  2JA5 B;  1V1P A;  1VF5 C;  3D6W A;  5J22 A;  5CV9 A;  3BDO A;  2F0F A;  4HCE A;  4G4K A;  1QB5 D;  2O4X A;  3QO2 A;  2EYP A;  5C0X H;  4OO1 I;  3URY A;  4C1N K;  2DY7 A;  5KIX A;  2EYF A;  3KK7 A;  4R8N A;  5LL6 S;  2EJM A;  1G8Z D;  4DA2 A;  3NBI A;  4KMU C;  3RZO B;  4NW2 A;  2EYL A;  4A3B B;  5DAU A;  3GD7 A;  4ODG A;  3OOC A;  3GTK B;  1JWS D;  4TKO B;  5C4J B;  5FLX L;  2KUM A;  3S14 B;  1IKL A;  5C0X J;  4RFB A;  2NYZ D;  1R9T B;  5C4X B;  1TY0 A;  3VYR A;  4L8J A;  2VB3 X;  1CQF A;  1Z47 A;  2L1B A;  4UAI A;  5CV7 A;  2PYK A;  3TP6 A;  3R2I A;  2BDO A;  3HOX B;  5JPM C;  2AWO A;  1MSH A;  5DM6 3;  2HDM A;  3RMH A;  1F2L A;  2BE5 D;  4KKT A;  5I9P A;  1KLU D;  1TU2 B;  2JXM B;  2VNU D;  4ULL A;  4KTA A;  2HCI A;  1JE4 A;  4XQQ A;  3Q22 A;  2Q8T A;  3S16 B;  1EEI D;  2G9H D;  1I4Q A;  2R61 A;  4ME5 A;  1S5F D;  3D4D A;  1ONL A;  5EJW A;  3NHH A;  1LAC A;  3HOV B;  5C5M A;  4M8A A;  2FMC A;  1CFM A;  2A6E D;  2DNC A;  4ZK9 B;  1D5Z C;  1H9M A;  1STY A;  1MD2 D;  1D6E C;  2VB2 X;  1HUM A;  2F0O A;  2F0Q A;  3QB3 A;  4OIJ A;  1EY7 A;  1E2V A;  3W2D A;  3P20 A;  3I72 A;  4KK7 A;  3SK4 A;  1LTR D;  1A3T A;  2LMC B;  3T53 B;  4J8Q A;  5EGT A;  1S4Z A;  1I4H A;  2MJ8 A;  1SYD A;  5E1F A;  4A3K B;  1Q1B A;  1AZP A;  3WDN A;  1BO0 A;  1AP0 A;  1XYI A;  3L7Z C;  4IZ8 A;  2EJF C;  5EKK A;  1C8C A;  4EGV A;  2HUG A;  4ZYS A;  3TP7 A;  4NKL A;  2RDF A;  3QG1 A;  3HS0 C;  3HZX A;  1ROD A;  2BDN A;  3W3A A;  2QCP X;  4P2C B;  4NP5 A;  1EQT A;  1S5D D;  3NE5 B;  1IW7 C;  4C3H G;  1GOZ A;  2RDG A;  4UDU C;  4N9T A;  4BY1 B;  5JAV A;  2KEE A;  3K59 A;  1E2W A;  1JIC A;  3GTQ B;  1F9S A;  2B2U C;  4L6T B;  4HTH A;  5A35 A;  1DZ1 A;  5J1Z A;  1OXX K;  1JR0 D;  2E2H B;  4IFD I;  4HED A;  5IGF A;  2MGS A;  2XWJ B;  5ELF A;  5C0X G;  3LX0 A;  2A5H A;  2ZXP A;  4B9X A;  5C44 B;  1Q90 A;  3L3O C;  1DYQ A;  4K2K A;  3HOW B;  3SDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...