3J81i

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
111
Chain Sequence
b'NTKGGKKGRRGKNDSDGPKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLKNQGELPENAKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 16
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
i PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3j81i00
1VQDA 4Y7NH 1JT8A 3K8AA 3GTQH 1IBML 4YCUA 4GOPA 4OONA 1J6QA 2MO1A 3TRZA 2AWNA 3ERSX 3UE1A 5IYBH 2KHJA 4A3IH 4A3EH 4QL5A 2UUAQ 4LF9L 3NENA 2R92G 3S2DH 1PYSB 3G4SA 1PVOA 4DV7Q 2JA5G 4K0KQ 1TWAH 3GTMH 2B63H 1BBUA 1VQFA 3CW2C 1Q7YC 4DK3C 3S2HH 1K8AC 1I3QH 3KOJA 4DV4Q 2D0PA 1V9PA 2I5HA 3KF6A 4IPHA 4A3CG 4PZ8A 2Y0SE 4R4IA 4UPAA 3W1GA 5GAGC 4LW1A 3M4PA 1IL2A 2UUCL 2F4VL 4NPSA 4LFBL 2K75A 3DM3A 1IXRA 1X3GA 2A1AA 3FP9A 2UXBL 1QUQA 1SE8A 3STBD 3PIOA 4HJ8A 3Q8DA 1SFOH 4JCVE 2E2IH 4A3BH 4IJHA 1HJPA 4A3FG 1X9NA 5C44H 4JI3Q 2UU9Q 3HOWG 1P8LA 1JJ2A 2WFWA 1N34L 3S16H 3GDEA 4B3SQ 4HIMA 4GKJL 3HFZB 3PF5A 2ASBA 3UDGA 4FDBA 4JBJA 1TWCH 1XPUA 1VQ6A 1I50H 4LF5Q 3HOXH 2R7ZG 5GAHC 4A3JG 1QVGA 2HT1A 4DR2Q 1W2BA 1LM0A 1IZ6A 1SN8A 1YEZA 2Y0SG 2UXCQ 3I2ZA 3U50C 3CCQA 1XNQL 4HIKA 2KENA 2LXJA 1E1TA 1BVSA 2ZTEA 4JYAQ 5EAYA 5FLMG 1YHBA 5M3MG 4X62Q 4DV2Q 4JOIC 1D7QA 3M3YH 1KRTA 2GVBA 2RHSB 3K7AH 1GVPA 4LWCA 5E7NA 1YNXA 3WWVA 2CFMA 4JI0L 4OWWB 1W3SA 1G6PA 4JI3L 5M5YH 4DV1Q 4H02A 3TREA 1CSPA 4LFAQ 4YY3Q 3S1NH 1UWVA 3BZCA 3PUXA 3BU2A 4R4TA 2PNHA 4KI0A 3TS0A 1SLJA 5LMUL 1N36L 2YU9H 3S15H 2R93G 4A3GH 2ALYB 4BY1G 4JI4L 1VQ9A 2NN6I 1N32Q 2HQLA 1HNXL 4DR2L 3I4MG 2QEXA 2AMCB 3EIVA 3JAMc 2DUDA 1EIYB 4X65L 2UUBQ 1EUJA 2ZTDA 4AH6A 2E5LL 3GTGH 2Q2UA 2ZM6L 4DV6L 2R92H 1NE3A 3W1BA 3J80c 2MNAA 3J7ZC 1J5EL 1HZAA 1O7IA 3GD7A 1VQ8A 1VQKA 4LF6L 3GTLH 3PUZA 1PH1A 2KBNA 5LMNQ 2JA5H 4AQYL 4C3HH 1VQAA 4HIDA 4OO1G 3HKZE 4NXNL 4A3LG 4QJFA 1TXYA 4A3CH 3G48A 4GN5A 2JA9A 1A8VA 1VQOA 4B3TL 4MZ9A 4LF8Q 3HOXG 1MJEA 4JI6Q 1HR0Q 3ICEA 1FVIA 4DR6L 2YTXA 3ZJYC 2EQSA 4DV3L 5H1SE 4AYBG 3KFUA 5IT9c 2C35B 4LF4Q 4QQBX 3L7ZC 4C3IH 4LNQA 3E9IA 1UE1A 3K81C 4JI1L 3CCVA 1A62A 1PA6A 4JI7L 2H5XA 3GTJH 2CWPA 4LF9Q 1YI2A 4P73A 4IFDI 1Q1BA 2K5HA 3PIPA 1KQSA 2D0OA 3CP0A 1KIXA 4YCVA 2R7ZH 4A3JH 4GOPB 3T1YL 4HJ5A 1FL0A 1T9HA 2XTIA 2EIFA 2VQFL 1SRUA 3CPWA 3S1MH 1LTLA 4POFA 1PH4A 3HOYG 5JEAJ 2UUCQ 2E8GA 1HNZL 4LFBQ 4GLVB 2VW9A 2JE6I 1RL2A 3GTKH 2YTVA 4JOIA 4A3GG 4UP9A 5FLMH 1HR0L 3H3VH 3H0GG 3PGZA 5IP7G 2UXBQ 4O0AA 3CCSA 4BBSG 4B3MQ 2VUMG 4GN3B 1CSQA 2I5LX 2JK8A 1CKOA 3KJPA 2IX1A 1EIFA 2VS1A 3I56A 1N34Q 5GQOA 1Q1EA 3ULJA 3CCMA 1L2FA 4GKJQ 1YHQA 1QUQB 5C0XI 1XJVA 3F1ZA 3S1RH 4UY8C 3ER0A 2R93H 1ASYA 1YJWA 3A5UA 4L5RC 4PZ7A 1E1OA 4R4QA 4JBMA 2PQAA 4BY1H 1RIPA 2Z6KC 3E9HA 2OTJA 3CCLA 1YZ6A 2IHFA 2IX0A 3I4MH 5LMNW 2VQEL 3AYHB 4KHZA 1XNQQ 3I7FA 1OXTA 5AJ3Q 2HHHL 2VNUD 4J15A 3TQYA 2K5VA 1XPOA 4IJLA 4JI8L 1VQCA 4L5TA 3I4OA 4DAMA 1GM5A 4KHPQ 1G51A 4A3BG 4OX9L 4B3RL 2JQOA 3B6YA 1EQQA 3CMAA 1BKBA 1KC8C 4JV5L 1HNWQ 2YV5A 4B3ML 4JI0Q 3VDYA 1HR0W 4XTCS 4ALPA 3K7UC 4A3LH 2KCTA 4GLAC 1NMFA 4QIWE 4BXXH 4DAYB 1WCMG 2GN5A 2FXQA 3CPFA 5LMUQ 1N36Q 3HOVG 4C2MH 2Z0SA 1TWHH 2N78A 2YTYA 4JBKA 2E2HH 4GNXB 4JI4Q 1X54A 1C7YA 3M7NA 3D31A 1PV4A 4P71A 1NJIC 5IYDG 1HNXQ 1VQEA 1FJGL 1S40A 5HGQA 1Y14B 1OXUA 3AFQA 4A3DG 4X65Q 1X65A 1X6OA 2E5LQ 3OYYA 1WOCA 2D62A 4BA2I 2ZM6Q 2V1CC 3A5ZB 4P75A 1GD7A 3D0FA 2QGQA 3BZKA 5AJ3L 4DV6Q 2NVQH 4LFCL 1J5EQ 2AKWB 4X6AH 4LF6Q 1VS0A 5JEAG 3GO5A 3M4OH 1VQHA 1PH9A 3HKSA 4KHPL 4IFDJ 4AQYQ 1E7ZA 1PH8A 4POGA 2JEAI 2EXDA 4DNIA 1PH5A 4Y52H 3S17H 4X64L 3CC4A 4DR1L 1PH6A 2LXKA 4PG3A 4NXNQ 3KF8B 3J80i 1XMOL 2KCMA 3J81c 3BJUA 1GO3E 4B3TQ 1L1OB 1WI5A 1A0IA 4DK6C 1EOVA 3F2DA 1EQRA 4C3JH 2OTLA 1N33Q 4DR6Q 4GKKL 4DV3Q 4JI2L 2A8VA 3JC66 3H0GH 5IP7H 4DV0L 1IBLL 5J3BA 3AFPA 4BBSH 4DR5L 3FKIG 3KDFB 2VUMH 3CCRA 3T1HL 4BY7G 1MJCA 4JI1Q 4LF7L 1VQJA 2NVTH 3CC2A 4AYBE 5C3EG 4JI7Q 1E22A 1TWFH 2B3GA 4UP8A 2JEBI 2JJQA 3CAMA 3GTPH 1G291 4HIOA 2R7FA 1KAWA 2Z6KA 3T1YQ 3ULLA 3NELA 1N8RC 2VQFQ 4DUYL 2NZHA 2MQHA 2AWOA 4OXPA 1B70B 2LSSA 4BXXG 1CKNB 3MXNB 1HNZQ 1YIJA 3PO2G 4QY7A 3RN5A 3RLOA 1X56A 1N33L 4IOCA 4P74A 1FGUA 4YWMA 2HIXA 2ZJRA 4WJ4A 3STBC 2N49A 1S3OA 2CWAA 4DR4L 1B7YB 4DR7L 4OO1I 4A3KG 1AH9A 1UE6A 4BBRH 3PF4A 1A63A 1P16A 5JJIA 2OCEA 4GS3A 4IPGA 1YBYA 1WCMH 4A4IA 1VQLA 3HOVH 1NMGA 4DR3L 3UDIA 3RZOH 5C4JH 3I4NG 4APVA 1XNRL 4X66L 2ES2A 2K14A 2Q2IA 5IYDH 1NTGA 5M5WH 1K73C 1ASZA 4DUZL 2VQEQ 3CXCA 4A3DH 5K36G 4R4CA 2CQOA 1LYLA 1MKHA 2BA1A 2HHHQ 3RR5A 5C4XH 3S24A 3U58A 4JI8Q 1VQBA 2WAQG 3U4VA 4YHHL 1HZBA 2VZAA 2Q2HA 1U0LA 2PMZE 3EN2A 4OX9Q 5IE8A 4A93H 1VQGA 2KHIA 2DGYA 4EQ5A 2F3IA 3KF6B 1IBKL 3K0XA 4JV5Q 1C0AA 1M1KC 1VQ4A 1K83H 3OTOL 1YHAA 1VCIA 5IY0A 3SGIA 3GTOH 4NXML 3S14H 5FJ8G 4IOAA 3CC7A 4PMWA 1K9MC 3L0OA 4DPGA 1JB7A 1K0RA 3CMEA 2ZTCA 2E2JH 3PUYA 1N9WA 1SR3A 5IWAL 4GNXC 3G6EA 1QZGA 5GADC 3K80C 4QGUA 1JMCA 2BH2A 1HNWL 1FJGQ 3EBEA 1NY4A 2JA8G 3FKIH 4NB3A 4UP7A 5JJLA 4BY7H 2R6GA 5C3EH 5HY6A 3AQQA 1V1QA 3DLLA 5IP9H 1PH2A 4KLKA 1Y1WG 1OXXK 4MTNA 4XIGS 1XMQL 1I94L 4LFCQ 1I6HH 1E3PA 2RCNA 3KJOA 3CCUA 4TVAB 5BR8L 2WB1G 1UE7A 1LUZA 4A76A 4DKAC 4X64Q 4DR1Q 3RLFA 1XMOQ 1VQ5A 4BBRG 1KRSA 2K50A 3RZDH 3W5OA 2K52A 1L1OC 3CQZH 3PO3G 3RNUA 3PO2H 1Y1VH 2ZJPA 4GKKQ 1CUKA 4JI2Q 1KD1C 4BA1I 4DV0Q 4IO9A 1IBLQ 4TQUS 4DR5Q 3J7A5 3T1HQ 4LF7Q 3J81i 3TS2A 4YWKA 4A3KH 1XTDA 1AE3A 4DV5Q 1X3EA 3TEHB 3RLNA 3CD6A 3NBHB 5C4XG 2JA6G 2MO0A 2YYZA 4EX5A 2UXDL 3NEMA 4JBWA 1QZHA 4JI5L 1MIUA 1EYGA 2JA7G 4RG1A 3I4NH 4A93G 5IYCG 1VQ7A 3JAMi 4A3MG 1VQMA 2RHQB 1UE5A 3PSIA 3A74A 2CCZA 4DUYQ 2UUAL 2L15A 3M4QA 4DV7L 3KYHC 3PV0A 4K0KL 1YVCA 4OWTB 1HH2P 2NVYH 1OXVA 4WJ3M 2I5MX 4ME3A 1X55A 2PI2E 3H3VI 2IY5B 3M85A 2F52A 1K8GA 4DV4L 1YJ9A 1PH3A 3G71A 3HOZG 1YITA 3HOUH 1SMXA 2I0QA 1UEBA 1PH7A 2ATWA 4DR4Q 4DR7Q 5FJ8H 4DV5L 5M3FH 1Q81C 5IP9G 2N8NA 1I5FA 2NN6G 4GN4B 2NVXH 1XPRA 1JE5A 4HJAA 4DR3Q 3KLWA 2QA4A 4HJ9A 4GNXA 1EFWA 2UU9L 1XNRQ 4X66Q 4LF4L 1AE2A 4GOPC 2VY3A 5IYBG 5C0XJ 1H95A 4DUZQ 4L5QA 3OW2A 4A3EG 4A3IG 2OQKA 4B3SL 1VQNA 2JA8H 1PYBA 4LF5L 4R1JA 3F2CA 1Q8KA 4HJ7A 3H15A 2B63G 3HOYH 1Y1WH 1IYJB 2HIVA 4JG2A 4YHHQ 2A19A 3AEVA 3IRBA 3CCEA 1Y1VG 2UXCL 5JJKA 1Q46A 4RMFA 1IBKQ 2B29A 2WAQE 2ID0A 4LUVA 3OTOQ 2N3SA 2IHEA 4NXMQ 5DLQE 3PCOB 3UDFA 1OXSC 1BBWA 1WYDA 2BA0A 3I55A 1YJNA 4JYAL 4B3RQ 4X62L 1NBWA 5FLXc 1L1OA 3M9BA 4DV2L 5GROA 3U4ZA 4L5SA 4A75A 1JJGA 3PO3H 3PUWA 2CKZB 3E0EA 5IWAQ 5C44G 3F8TA 4DV1L 5GAEC 4JC0A 1EWIA 3KDFA 4LFAL 1V43A 4YY3L 1HZ9A 2NZOA 1KL9A 4IFDG 1B8AA 2BH8A 1CKMA 3ULPA 1KXLA 1HZCA 3PUVA 1I94Q 2MFIA 4O2DA 1XMQQ 2PQAB 1OTCA 2ZJQA 4LUZA 2VL6A 1E24A 2JA6H 1N32L 3UE0A 4A3FH 1IBMQ 1C9OA 2JA7H 1S72A 4LUOA 5BR8Q 1Z47A 2PI2A 1VQPA 1VQIA 1Q82C 2UUBL 4IPDA 5ELOA 5IYCH 3HOWH 1SROA 1PFSA 4A3MH 2Q2TA 1WFQA 1QVFA 3HOUG 1TWGH 2K4KA 3S1QH 2K5NA 4P72A 2GVAA 2AHOB 4IPCA 2WB1E 1KHIA 4AIMA 5M5XH 4PZ6A 1M90C 2WP8J 5M3FG 5LMNL 1D8LA 1CKNA 3HKZG 1WJJA 4OWXB 3CF5A 1QVCA 3LGJA 1L0WA 3J81j 4GLXA 1Z9FA 2R7DA 4YWLA 3FHWA 2OWOA 1K3RA 4R4OA 4YCWA 2OQ0A 2XGTA 3F2BA 1JJCB 3UDXA 3HOZH 1Q12A 1X3FA 3A0JA 1R9TH 5C0XG 1Q86C 2F4VQ 1GKHA 3RN2A 1DGSA 2IT1A 1U5KA 4JI6L 4LF8L 5M3MH 4MNOA 3MEFA 5ELNA 3L2PA 2UXDQ 2RF4A 1PHJA 4JI5Q 3CCJA
chains in the Genus database with same CATH superfamily
1EZ8A 4V190 1IBML 1HA6A 2MO1A 2MPMA 5IYBH 4LF9L 2R92G 2KHJA 4A3EH 3FEWX 2MJ8A 3R93A 2JSOA 1VQFA 1K8AC 3J80L 1YNJC 4DV4Q 4DK1A 2I5HA 2A6EC 4IPHA 4A3BB 5GAGC 2Y0SE 1D5XC 5CV5A 3M4PA 4LFBL 2K75A 1IXRA 3FP9A 2DJGC 4HJ8A 1F9RA 3AMUA 4C3IG 1HJPA 4JI3Q 2KEEA 1N34L 1RHPA 3GDEA 5DNFA 3HFZB 3PF5A 2ASBA 2WKDA 1UAPA 4TKOB 4A3JG 1DCZA 3KK7A 5C4XB 1NNXA 1MD2D 2Y0SG 2NBFA 3GTKB 3I2ZA 1DOMA 1F77A 1K83B 1ICWA 4QIWB 3S14B 4JYAQ 4DV2Q 2SEBD 1D7QA 1KRTA 1GVPA 1W6KA 4ME5A 4I7ZC 1G6PA 1ET9A 2CVRA 4ILWA 4YY3Q 3BU2A 1PFMA 1SLJA 5LMUL 2YU9H 2JP1A 4BY1G 1AN8A 1N32Q 4DR2L 3I4MG 4UDUC 3EIVA 2QEXA 4Q0FA 5EPKA 4CHTB 4X65L 2O2LD 4AH6A 3M7GA 2ZM6L 1EY8A 3NSWA 5CV9A 1HUMA 2MNAA 1J5EL 3J7ZC 1HZAA 3GD7A 1JOQA 2OT2A 2RQXA 2KA7A 2JA5H 4FXKC 1SMYD 4C3HH 1PZID 2RVLA 2E2HB 4A3CH 1Q8IA 4GN5A 1ZXTA 1A8VA 4B3TL 4MZ9A 4LF8Q 3HOXG 1MJEA 4A3KB 4JI6Q 1HR0Q 4QMGA 1S5BD 2YTXA 4A3BH 2EQSA 4KV6A 2C35B 3DWPA 3L7ZC 1STBA 3A8JE 2F0JA 2RA4A 5C4ZA 2A5HA 1UE1A 1XXGA 4JI1L 3HEJA 1B44D 2WIIB 2H5XA 1YI2A 3VR3A 2BDNA 2E74C 1KQSA 3LWUA 2D0OA 2K03A 5I2YA 5G3LF 2K04A 1MHWC 2XTIA 5BN5A 2WAQB 1SYBA 1PH4A 4DK0A 1BF4A 5JEAJ 1IHZA 2EY2A 1KNAA 2UUCQ 2VW9A 1RL2A 3GTKH 2YTVA 5FLMH 3H3VH 2UXBQ 4ODGA 3CCSA 5CYUA 1AP0A 2I5LX 1WTOA 5FO7B 5JPMC 2IX1A 2VS1A 1V1OA 5EBDA 3CCMA 1L2FA 2WINB 4UY8C 3V96A 3S1RH 2WACA 1V1PA 3OWFA 4L5RC 4PZ7A 1E1OA 2EYPA 4FXDA 3ONAB 1RDPD 4H0LC 3KLSA 1YZ6A 2NYZD 2VQEL 2AQ2B 1XNQQ 1OXTA 3TQYA 4IJLA 1WTRA 4N9PA 1FNUA 1G51A 4OX9L 3CMAA 3VR4A 4B3ML 4JI0Q 4L8JA 4FF1A 2XVSA 2A73B 4ALPA 2KCTA 3BS1A 2X6GA 2FHTA 1NMFA 5IT9L 2GN5A 2FXQA 3HOVG 3X3MA 5L37A 2E2HH 1X54A 1NJIC 5IYDG 2Q8TA 1VQEA 2V4DA 2JA6B 1X6OA 3E0JA 2V1CC 4KK7A 2DY8A 3J7AF 5JEAG 3GO5A 1M8AA 2MHVA 4AQYQ 3K57A 1PH8A 2JEAI 4QUCA 2EXDA 4DNIA 1PH5A 2F03A 3CC4A 4DR1L 1F2YA 4PG3A 3J80i 1XMOL 5KYLA 2CH4A 3HOZB 1WI5A 2IL8A 1N33Q 4DV3Q 3M4YA 3JC66 3H0GH 3CCRA 2K5WA 3Q6SA 1B53A 1W6JA 2IX3A 3J7YW 4UP8A 2F0LA 2XRSD 1N8RC 3CQZB 2VQFQ 4DUYL 1GXDC 4OXPA 3A7LA 1DJRD 5K5PA 2LSSA 4BXXG 3MXNB 1HNZQ 4KJOA 1I6VC 3I72A 5CV8A 1LACA 5HURA 5A2QE 3HRZC 1CQFA 2N49A 1S3OA 1XX8A 4RKLA 1B7YB 3PF4A 1A63A 4GS3A 4IPGA 5EKIA 3K58A 1WTQA 3BVMA 4PNYA 4HN7A 5EBCA 1EIGA 3R2TA 2A69C 5C4JH 5E3FA 3TZUA 2K14A 2J4XA 4ZAIA 5KIXA 4KMUC 1NTGA 3GP7A 2NVYB 4A3DH 3CRLC 2MGSA 4JI8Q 1KTKA 3O13A 1KLGD 1PTOC 3EN2A 4B3RQ 5IE8A 4JV5Q 3KF6B 1C0AA 1NUCA 1A2UA 3SVMA 3M3YB 1M1KC 3K7AB 5F2DA 1VCIA 2BE5D 1K9MC 1JB7A 1JE4A 3PUYA 3QOLA 5KEEA 3S15B 5C5MA 5IWAL 1IKLA 4GNXC 5KNDA 1MSHA 4K2LA 4QGUA 1TY0A 1FJGQ 3EBEA 4FO2A 3FKIH 4NB3A 4IN3A 4BY7H 5JJLA 4R8IA 5T1GA 5C3EH 1QB5D 5HY6A 4KLKA 4C1NK 5ELBA 2R92B 3MA2B 2EY5A 1E3PA 5LHY1 2HUGA 1O7YA 1LUZA 5IT9E 1HHVA 4X64Q 5CMDA 1F2ZA 1KRSA 1D1IA 2K05A 3RZDH 2B2TC 3CQZH 3H09A 3PO2H 5CV4A 2ZJPA 4GKKQ 2QKIC 1SBBB 1TS4A 3OSOA 4IUTA 3TP6A 1MSGA 4C3IB 1X3EA 3RLNA 4DU9A 5E1FA 5C4XG 3OHXC 4WORA 5BN4A 2EYMA 3N52A 4RG1A 4G7ZC 2PO4A 2F0WA 4A3JB 5IYCG 4MTKA 4ZK9B 4A3MG 4IZ8A 3PSIA 2Y0SB 5K36H 3M4QA 3KYHC 3WOEA 1YVCA 2NVYH 1R9TB 2XSCA 1UNSA 3H3VI 1G91A 2F52A 4DV4L 1YJ9A 1YITA 2I0QA 4DR7Q 4Y7NB 3IKJA 1U4PA 3MVVA 5M3FH 3NXWA 1WTPA 2N8NA 3FRPB 4JPBW 2E2DC 4MHEA 2NVXH 1JE5A 1E2ZA 3LWEA 4DR3Q 2QA4A 4GNXA 1XNRQ 1WTHA 1AE2A 4GOPC 4BY1B 5C0XJ 1H95A 1CZGA 4L5QA 4DUZQ 3OW2A 4A3IG 2OQKA 3I4MB 3D8GA 3F2CA 3C1EA 1FNVA 4HJ7A 1Y1WH 2HIVA 2KVMA 3TSSA 3MTSA 4QF4A 5DAUA 4LMQD 4HTHA 5JJKA 2GA4B 1IBKQ 2WAQE 1BBWA 1WYDA 1SAPA 4JYAL 2B2TA 3VYRA 1CHPD 5FLXc 4DV2L 5IOCA 3PO3H 1TWCB 3E0EA 3PUWA 1I50B 5C44G 3QR8A 3HOXB 3KBXA 4JC0A 4K5VA 4YY3L 1HZ9A 4IFDG 1KL9A 4OELB 1CKMA 3PUVA 1I94Q 2RDHA 1AW7A 3J81E 2VL6A 1E24A 4QCLA 1N32L 5CC4A 2NVQB 2F0PA 2K7VA 4LUOA 1VQIA 2B2YC 5ELOA 2Q2TA 5C4HA 1TIID 3FPUB 1QVFA 2DNCA 3D3RA 2GVAA 2AHOB 4OEMB 1KAAA 3JAME 1M90C 1O80A 3HKZG 5KNBA 1WJJA 3J81j 1U4LA 1Z9FA 2K6AA 2OWOA 1K3RA 3DWQA 1K28A 1JB3A 2XGTA 4YCWA 1EEFD 1JJCB 4IURA 3UDXA 1AFPA 1SNDA 1Q12A 3A0JA 1R9TH 5C0XG 2F4VQ 1TU2B 4RGTA 1CA5A 5CORA 1FR3A 1A3UA 2IJ0A 4LF8L 4JI6L 3HG9A 2XNAC 1VQDA 2Z6BA 4Y7NH 3GTPB 4GOPA 4OONA 1VDZA 1J6QA 3TRZA 5JVG3 4OGQC 3ERSX 2UUAQ 3S2DH 3NENA 1PVOA 1G8ZD 1DONA 4K0KQ 3QWNA 2B63H 3I90A 3S2HH 2B2WC 1I3QH 3OIPA 4L63B 4UPAA 4B08A 4DGZA 5JJZA 2UUCL 4NPSA 4C56C 3U9OA 1QUQA 2UXBL 4JCVE 2E2IH 4IJHA 2QW7A 4A3FG 3LNNA 4OIKA 1X9NA 1EY4A 3HOVB 3RZOB 3S16H 1B50A 4B3SQ 4LJZC 1TWCH 4WFN3 1I50H 4KKUA 3HOXH 3NUCA 1W2BA 1LM0A 1SN8A 1YEZA 3NHHA 2B2YA 2LY7A 3GV3A 4U68A 3T53B 3CCQA 1XNQL 4J1MA 1E1TA 2Z4IA 4I65A 3FMCA 5M3MG 1ET6A 1HRJA 3NPPA 5COYA 2RHSB 5E7NA 3WWVA 1YNXA 4JI0L 4DV1Q 3GQBA 3TREA 1LT3D 3S1NH 1UWVA 3PUXA 4R4TA 2H1EA 4KI0A 2R93G 3DEOA 3NBHA 1O7ZA 4HSPA 1II3A 5J22A 3MC0B 3JAMc 2LKVA 1EUJA 1NE3A 3W1BA 1VQ8A 1VQKA 5FO9B 5LMNQ 2TMPA 4AQYL 5KNCA 2B2WA 1VQAA 2EJFC 1BOSA 1Y69U 4HIDA 2VB2X 4OO1G 4C2MB 4A3LG 2EY1A 4NMZA 4TSSA 3G48A 1GJXA 1A3TA 3R8BA 4DV3L 5H1SE 5ELCA 2DN8A 3DEPA 1PA6A 4N8X1 1ESRA 1Q1BA 4I7AA 5HGTA 3TP7A 1KIXA 2R7ZH 2A74C 2ICEC 1CI3M 1EYAA 3L3OC 1HCZA 1NR2A 4FXGC 2EIFA 2HCCA 2VQFL 2G5DA 1K8MA 4J6HA 4B9WA 2E8GA 1HNZL 4ZQ3A 4FYDA 4OIJA 2NZ1D 4FVMA 1JC7A 4TRDA 3PGZA 3EA6A 1BQQT 4BBSG 4H13C 2VUMG 2JK8A 5E4XA 1JQYD 3I56A 5GQOA 3ULJA 4GKJQ 1STHA 2LFNA 4PMBA 3ER0A 1ASYA 1YJWA 3TP8A 1RTOA 3T16A 1RIPA 4CJ1B 3PQIA 2OTJA 2B8FA 1Y8NB 2L4NA 2Z9HA 1S5FD 3AYHB 4RWSC 1RTNA 3H3VC 2MUYA 1FYCA 4JI8L 2CW0D 4KHPQ 4B3RL 2JQOA 3BYYB 1M4VA 4JV5L 4P2CB 2L9HA 3VDYA 2LS01 4DA2A 4BXXH 5EJWA 4DAYB 1WCMG 1N36Q 4C2MH 3M7NA 2G9DA 4JI4Q 1C7YA 5I6YA 1PV4A 4P71A 4ABNA 2M00A 1HNXQ 1FJGL 2L12A 5HGQA 3ND9A 1Y14B 2B8GA 4DAVA 1OXUA 3AFQA 3C2PA 2E5LQ 4P75A 2F3VA 3NK9A 4DV6Q 3BZKA 5AJ3L 4A3MB 1TWGB 1C4QA 3S1QB 1VS0A 3AB9A 1H9KA 3M4OH 4K8JA 5M5XB 1PH9A 4POGA 5ELDA 4Y52H 4X64L 1A15A 3KF8B 1UUPA 1F9PA 1EEID 2J0TD 3BJUA 1KNEA 1F2MA 1L1OB 1E2VA 1A0IA 2KHSA 4C3JH 4DR6Q 4GKKL 2A8VA 3G7LA 5IP7H 2PPBC 3IFTA 1K0SA 2L55A 3CC2A 1I4PA 3GTQB 4JI7Q 1ILQA 5IGCA 5BN3A 1EFID 2EYOA 2JEBI 3H94A 1X3QA 3T4AC 4A3IB 1KAWA 3EROA 3T1YQ 1IL8A 1HTLD 1TWAB 3ULLA 1EY9A 2NZHA 2HCIA 4RHRA 2EOTA 2CQAA 4XT3B 1CKNB 4PMCA 2QCPX 4QY7A 4S3SA 3H6MA 1JICA 5AFWA 1BCPB 1LO5D 2HIXA 1DM0B 4WJ4A 3T51B 4KN4C 1SFOB 2XRQD 2FFKB 1WD1A 4DR7L 1PLFA 5C44B 1BCPF 1UE6A 1BNZA 5C3XA 1LTBD 2QDBA 5JJIA 2NUCA 2OCEA 1CHQD 3QOJA 4A4IA 1VQLA 3Q23A 4DR3L 3T13A 3UDIA 1WTVA 3I4NG 4UAIA 1STEA 1XNRL 3SHLA 5J39A 5CV7A 1SYGA 1ASZA 4DUZL 4CKBA 4KY6A 1NR4A 4CKEA 3CXCA 1V1PB 1GHJA 2BA1A 3A7AB 3RR5A 5C4XH 3U58A 3LX0A 3NTHA 3U4VA 1HZBA 2VZAA 5KRUA 5D3DA 1U0LA 2R61A 4FF4A 3G6JB 1VQGA 2KHIA 3HKZB 4EQ5A 2F3IA 1IBKL 1K83H 1U4MA 3S14H 4IOAA 3SGIA 5FJ8G 3A8KE 2H4OA 4PMWA 5IGEA 5M9OA 1K0RA 3CMEA 3NE5B 1LABA 3J80E 1N9WA 3P75A 1BDOA 1QZGA 5GADC 2BH2A 3CRKC 4KTAA 2JA8G 1HQRD 4UP7A 3GTGB 3AQQA 2PQEA 5C3WA 1I94L 4LFCQ 4XIGS 4CDEC 1HFGA 2QILA 3CCUA 4TVAB 3MXGA 4K8IA 3A55A 4DKAC 3RLFA 1ML0D 1QG7A 4RGOS 2K50A 3MAQA 2D9UA 3RNUA 1TR5A 1KD1C 4BA1I 4DV0Q 1Q90A 4DR5Q 5FLXL 4G7HC 5LL6X 4ID6A 4CJ2C 3J7A5 1IW7D 4A3FB 4A3KH 2BDOA 4ULLA 3CD6A 1SE3A 2YYZA 1JWSD 2ZXRA 1EYGA 4DXFA 2JA7G 4A93G 4IFDH 4XT1B 2UUAL 4KKSA 4K0KL 4OWTB 1OXVA 4WJ3M 3FVQA 2I5MX 4M8AA 1X55A 4ME3A 2PI2E 1EY7A 3VA5A 5M3MB 3G71A 1PH3A 4DR4Q 1RJTA 2F0NA 1PH7A 2ATWA 2NTTA 4DV5L 1Z7TA 5IP9G 2NN6G 4R9WA 2HDLA 3L9AX 4HJAA 3K6OA 2R93B 5CBEE 5CBAE 1WTXA 5IYBG 1CFMA 4A3EG 4B3SL 3GTMB 2JYOA 2XWBB 1PRTB 4B9XA 4R1JA 1SJHD 4KY7A 3I3CA 3OW7A 3H15A 1IYJB 4YHHQ 1PRTF 3AEVA 3CCEA 4ZRZA 1Q46A 2K32A 2ID0A 2IPKD 1C8CA 3OTOQ 2N3SA 3TBIB 1CK1A 5DLQE 1S5ED 1RCVD 2EVBA 4L5SA 5GROA 1VF5C 1R4QB 1TWHB 3OWEB 4DV1L 2M9VA 5GAEC 3QG1A 4WRDA 1TVXA 1I4QA 1B8AA 2BH8A 1KXLA 1SE4A 1HZCA 1MGSA 4O2DA 1XMQQ 2PQAB 2ZJQA 2JA6H 2Z8LA 1S5CD 2LMCB 4RH6A 4A3FH 3OMCA 1IBMQ 1S72A 1PFNA 1Q82C 1PFSA 3HOUG 3S17B 1A3VA 2PW5A 4IPCA 5C5LA 4PZ6A 3URYA 2WP8J 5LMNL 1D8LA 3CF5A 3MXNA 3FHWA 2F0KA 4MIUA 4R4OA 2OQ0A 4N9TA 3F2BA 3HOZH 4BBSB 2VUMB 1EWHA 1R4PB 3MXPA 2QF7A 2NVTB 3U9SA 5M3MH 1TWFB 2K28A 1HTPA 4MNOA 3HOYG 5IGFA 5D65A 1PHJA 3HGBA 1JT8A 2EJGC 3GTLB 4YCUA 2KEDA 5I9OA 1EY6A 3UE1A 1TS3A 4QL5A 1SMYC 1PYSB 3G4SA 4DV7Q 2JA5G 3GTMH 2PMZB 1ZKOA 1SNQA 1Q7YC 1QILA 1EYCA 3KOJA 2EYHA 3KF6A 4A3CG 3W1GA 1G2TA 3FDTA 3HP3A 4KY5A 1PTOB 3DM3A 3D4RA 2A1AA 3VYUA 4KJNA 3PIOA 3GTJB 1XTCD 3Q8DA 1WCMB 3SR1A 3NTKA 2UU9Q 3DMUA 3MZ5A 3SXHA 1P8LA 3HOWG 3VR2A 1STAA 1LTID 4GKJL 5M5WB 3UDGA 4FDBA 1Q3LA 1B3AA 3S1MB 1JWUD 1QVGA 2HT1A 4DR2Q 2UXCQ 2CH4W 4CKCA 2KENA 2LXJA 1JORA 2ZTEA 4RGNA 5JPNC 3V2TA 2CHBD 3GTOB 5FLMG 1LTTD 1YHBA 4X62Q 5KYIA 4JOIC 3NQIA 1GOZA 3M3YH 2GVBA 3SDZA 2WKCA 3K7AH 4LWCA 2FMCA 4K2KA 1O78A 2MP1A 1W3SA 4JI3L 2DNEA 4X3KA 5CV6A 1CSPA 3I8ZA 3Q0AA 1N36L 3S15H 5LL6S 4JI4L 1E2WA 5EQ0A 1HNXL 2A68D 1I6HB 1OO9B 2DUDA 1EIYB 2UUBQ 2ZTDA 2E5LL 4KD3A 1EQTA 4DV6L 2R92H 5E4WC 4WJWA 3GTLH 1I4RA 3PUZA 2KBNA 1D5MC 3PIO3 3BDLA 1SEBD 1GUNA 3BG3A 1CT1D 3HKZE 1QE6A 2F0EA 1HQMC 4QJFA 1F2LA 2K5QA 4XQQA 1SSOA 1VQOA 4E6IA 4NP5A 4EQNA 2A6ED 4DR6L 4AYBG 4F87A 5IT9c 4QQBX 4LF4Q 4C3IH 1HFNA 3CCVA 1A62A 3I4NB 4JI7L 3GTJH 4P73A 4IFDI 2B2UC 5EKLA 1CQVA 3NWSA 3PIPA 4A3JH 4DAPA 4RCNA 4GOPB 4MN3A 3T1YL 1DOKA 2L0CA 1FL0A 1T9HA 1EZ6A 3A54A 3S1MH 4ZCKA 1H9JA 4IUVA 4N8FA 3KLSX 2ICIA 2RDGA 5DEHA 4K14A 1RF2D 3BVZA 4JOIA 1BCPD 1HR0L 3IAYA 4A3GG 1XWEA 3H0GG 3ND8A 1Y8OB 4B3MQ 1CKOA 1PDQA 4M1UB 1EIFA 2JXMB 1E0BA 1Q1EA 4G7OC 3QJYA 1HUNA 1LTAD 1YHQA 1QUQB 5C0XI 2JA8B 3F1ZA 3I4LA 2F0FA 1WTWA 4BY1H 4JBMA 1SYDA 4IUPA 3PMFA 3I4MH 2IHFA 1C48A 3EVQA 3A8IE 3I7FA 2F0DA 4EVOA 2K5VA 1XPOA 4L5TA 3I4OA 4DAMA 4JVZA 1U9RA 1EQQA 1HNWQ 4ZKBB 2YV5A 2EJMA 1HR0W 4XTCS 2EE1A 4G57A 4XYQA 2NB0A 4GLAC 2PYKA 3PIP3 4FF2A 2Z0SA 3D31A 3C3LA 2F0HA 1S40A 5EPJA 4A3DG 3I73A 2FJ2A 2JA7B 3OYYA 1WOCA 2D62A 4H7BA 2B2UA 4A93B 3D0FA 2QGQA 1H9SB 2NVQH 4LFCL 4LF6Q 5EPLA 4JK1C 1VQHA 3V05A 2BE5C 3BDCA 4UHVA 4F8MA 1KLUD 2E2JB 1ZEQX 1PH6A 2LXKA 4NXNQ 5D14A 1EU3A 2KCMA 3J81c 1GO3E 4DK6C 2KQ3A 5DM63 1EQRA 2D2CC 5I6WA 3K5MA 2OTLA 4DV0L 1KABA 5J3BA 5I4DA 4DR5L 3FKIG 3KDFB 2D5DA 4BY7G 1MJCA 2R3ZA 4EQOA 5C3EG 1JWMD 3GV6A 2JJQA 4A3EB 3CKIB 3GTPH 1G291 2J7ZA 2OF1A 2HQEA 2R7FA 3E6ZX 3QO2A 3NELA 3K0YA 1T5XD 3TP5A 1B70B 3MXUA 1B9MA 3MEHA 2F0TA 4X3UA 4ZLTF 1PFBA 1PXUA 3PO2G 1GUWA 3EFXD 3RLOA 2O5IC 1N33L 4YWMA 1SYCA 2ZJRA 1EOTA 3VYTA 3K59A 1SYFA 2KCNA 3DHQA 4HR7B 2EDGA 4DR4L 4OO1I 4Q5VA 1IYVA 3HOVH 1NMGA 3RZOH 1EL0A 4APVA 5J1ZA 2ES2A 5IYDH 1TS5A 1PRTD 5K36G 4R4CA 1BUVT 3RD4A 2I07B 2HHHQ 2Q8IB 5KGUA 1STYA 4C1NI 3S24A 3HOUB 1VQBA 4YHHL 5JEAH 2PMZE 4A93H 2N55A 2HDMA 3K0XA 1VQ4A 1I4XA 3OTOL 1YHAA 2OXPA 4HCSA 5IY0A 1DD2A 1QNUA 3W3AA 3CC7A 2SOBA 4DPGA 3VR5A 2K01A 2ZTCA 1AZPA 2E2JH 1BR9A 1ONLA 1SR3A 1QWYA 2YU9B 4X3TA 1BBXC 1JMCA 4GZYC 1NY4A 3RUZA 3HOYB 1JCKB 1B1ZA 2A68C 2R6GA 1U4RA 1F9SA 2KOLA 5FO8B 5A35A 3DLLA 1PH2A 5IP9H 3N6RA 1Y1WG 1OXXK 2NN6H 2NWGA 4L6TB 4MTNA 1XMQL 3SK8A 2K1BA 2RCNA 3KJOA 5C6AA 1S5DD 2JA5B 2WB1G 1UE7A 1EY0A 2ZXOA 4DXGA 4C3HB 3IL8A 1VQ5A 4BBRG 5IIFA 3E3XA 4FP5D 1DXMA 2L1BA 2K52A 1L1OC 4FNFA 3PO3G 2B2VC 1CUKA 4JI2Q 4IO9A 1IBLQ 1CZWA 4TQUS 1B4OA 3T1HQ 4LF7Q 3TS2A 1AE3A 2DY7A 3TEHB 3HOWB 3TMEA 4EX5A 3EQLC 4JBWA 1MIUA 1PMRA 1VQ7A 1VQMA 2RHQB 4QUFA 1UE5A 1V8QA 5IODA 2L15A 2A69D 4DV7L 2AUKA 3PV0A 2WV6D 2L5TA 2A6HD 3M85A 1BCPC 2Q8RE 2PCFB 3HOUH 1LV9A 1PTOD 1QNKA 2FINB 2K5DA 4CDCC 4DAYA 1XPRA 4G4KA 4RFBA 3S1RB 2PZUA 3F2UA 3OOCA 3KLWA 2SDFA 4LK1C 2UU9L 4X66Q 2VY3A 1EIHA 3CU7A 2EYLA 4H44C 1Q8KA 2G9HD 1VF7A 2B63G 3HOYH 2RDFA 4JG2A 4ZUIA 1Y1VG 2UXCL 4RMFA 5DM73 3KF8A 5CR3A 4NXMQ 3PCOB 3I55A 1OXSC 1YJNA 4X62L 1SNMA 1L1OA 3M9BA 3U4ZA 2B2VA 1UEAB 1JJGA 2CKZB 3VYSA 4AYBB 3HS0C 3ULPA 2RKSA 2IWHA 4XXEA 1OTCA 1J8IA 3UE0A 5BR8Q 1VQPA 3HOWH 2F0VA 2UUBL 5A2QL 5IYCH 1SROA 4A3MH 2F0MA 3D4WA 1TWGH 2K4KA 3S1QH 4P72A 3W2DA 5M5YB 5M5XH 3DXJC 4OWXB 1CKNA 2ENBA 1O7LA 1QVCA 1GUSA 3D6CA 1L0WA 4GLXA 2R7DA 4YWLA 4NKLA 4QB4A 4A3GB 1D6EC 5FK9C 3H0GB 4KN7C 3I91A 5FKAC 1VMPA 5NUCA 1RD9D 3ITPA 1GKHA 2IT1A 1CM9A 4HSVA 3MEFA 1EQVA 5EKKA 2UXDQ 2EXZA 4LF4L 1PYWD 1X3PA 3CCJA 4JI5Q 1T5EA 3K8AA 3GTQH 3KBGA 3FPPA 2AWNA 3K5NA 4RCOA 4A3IH 1JOKA 2SNMA 2SNSA 4IQZA 1GHKA 1TWAH 1BBUA 3CW2C 4DK3C 1SNCA 4PQXA 3TDQA 2D0PA 1V9PA 4K5XA 4PZ8A 4R4IA 4FF3A 4LW1A 3R2IA 1IL2A 3VA7A 2F4VL 1X3GA 1SE8A 3STBD 1SFOH 2DJFC 5C44H 3BYTB 3QIAA 5C4JB 1ICFB 1JJ2A 2WFWA 4BS9A 4HIMA 2Z4HA 4JBJA 1LT6D 1XPUA 1VQ6A 4LF5Q 1PRTC 2R7ZG 4A3DB 5GAHC 2F3WA 3K5OA 1IZ6A 3HZXA 1DZ1A 3U50C 4IUQA 4HIKA 4NW2A 1L0XB 2F1MA 1BVSA 3OIQA 5EAYA 1HNWL 2TSSA 2EZVA 2CFMA 4OWWB 5M5YH 2QDLA 4H02A 4XYOA 4LFAQ 1LTGD 3BZCA 4F88A 2EYJA 2PNHA 3FKIB 3MHBA 4HEDA 4HMJA 5C0XH 2FMMA 1SYEA 3TS0A 4BY7B 4A3GH 5C3EB 2ALYB 1VQ9A 2NN6I 2HQLA 4KD4A 2AMCB 4IUNA 1QJOA 3GTGH 1ENCA 2CW0C 2Q2UA 3A56A 2RSNA 4RAUC 3DWAA 3J80c 1O7IA 4LF6L 1PH1A 3RZDB 3P1HA 3D6WA 3MFYA 1Y8PB 3PO2B 4HAEA 4NXNL 2E75C 1TXYA 3P20A 1HA5A 4CGYB 4U673 2JA9A 3EJIA 1LT5D 3ICEA 1FVIA 1B2TA 3KFUA 3ZJYC 1ILPA 5IGDA 1NCVA 3T56B 4LNQA 3E9IA 3K81C 1A2TA 1JR0D 1GUTA 3BDOA 2CWPA 4LF9Q 4XQJA 2RBMA 1VMCA 4EGVA 2K5HA 3NWTA 3CP0A 4YCVA 1XYIA 4HJ5A 1SRUA 2RSOA 2QEJC 2A6HC 3CPWA 3Q22A 1EWCA 1LTLA 4POFA 1S4ZA 3SK5A 1GUGA 4LFBQ 4LAAA 4GLVB 2JE6I 3MWYW 4C3JG 2O4XA 4UP9A 2KECA 5IP7G 5M3FB 4O0AA 5IGBA 2XN9C 3J81L 4GN3B 1CSQA 2F0SA 3KJPA 2NVXB 1CA6A 4DNTB 1TY2A 1N34Q 1ZYRD 2IW3A 4J8QA 3DUZA 1ESFA 1XJVA 3R3OA 2R93H 4CBVA 3A5UA 3JAML 4R4QA 2PQAA 1FGBD 1L0YB 1SXTA 2Z6KC 3NP8A 3E9HA 5FLXE 1Y1WB 4C3HG 3CCLA 2IX0A 1RKNA 3KUPA 4CDDC 5LMNW 2PNRC 4KHZA 3SEBA 5AJ3Q 2HHHL 2VNUD 2WB1B 4J15A 4HCEA 2JN4A 1VQCA 3H91A 1GM5A 2PZWA 1IKMA 1SNOA 4BBRB 4DF7A 4A3BG 4JW0A 3B6YA 1BKBA 1KC8C 2KCCA 3J7AV 1PTOF 3PO3B 4OO1H 3K7UC 1B9NA 4A3LH 1DOLA 4QIWE 3D4DA 5LMUQ 1B3QA 3CPFA 1TWHH 2N78A 2YTYA 4JBKA 4GNXB 1HXYD 2E76C 2ZXPA 4X65Q 1X65A 4DN4M 3K5LA 4BA2I 2HD3A 2ZM6Q 3A5ZB 1GD7A 1EYDA 2VXWA 1J5EQ 2AKWB 4OHJA 4X6AH 1KDCA 2EPBA 1SNPA 3HKSA 5EGTA 4KHPL 4IFDJ 1E7ZA 1TQOA 3WDNA 4IALA 1H9RA 5ELEA 3S17H 1G6ZA 1ENFA 3C1FA 1KDAA 1EU4A 2F0IA 4B3TQ 1EOVA 3F2DA 1YNND 3KLRA 4CJ0B 4JI2L 1IBLL 3AFPA 4BBSH 5D3IB 2VUMH 3T1HL 1FNWA 4JI1Q 4LF7L 1VQJA 2NVTH 3IFDA 4AYBE 1E22A 1BXTA 1TWFH 2B3GA 4RGMA 4ZYSA 3S2DB 1QOHA 3CAMA 5T1IA 4HIOA 2KJXA 4KKTA 2Z6KA 1RODA 1D2BA 2B63B 3Q24A 1QCBD 3S2HB 4F7XA 1I3QB 1Y1VB 2MQHA 1A6XA 2AWOA 1K3BC 1DYQA 2C5CA 2M2LA 4Z9CB 1D5ZC 2XWJB 3OMGA 1YNJD 1YIJA 1IW7C 2KUMA 3RN5A 3DM1A 1X56A 4IOCA 4P74A 1FGUA 4BWGB 1SJED 3STBC 2CWAA 2RCFA 2E2IB 1PTOH 4A3KG 1AH9A 4BBRH 1P16A 4RA8A 3S16B 3ERQA 1YBYA 1STNA 1WCMH 1TT2A 4V0BA 3NTIA 4X66L 2Q2IA 5M5WH 1K73C 1KDBA 1EY5A 2VQEQ 1I4GA 2CQOA 1LYLA 1MKHA 4XQNA 1NSNS 3C46A 1STGA 4X3SA 2WAQG 2BCOA 1PZKD 2Q2HA 4OX9Q 5FOBB 1LTSD 2DGYA 1PZJD 1I4HA 3GTOH 4NXML 3L0OA 1G2SA 3S1NB 3SK4A 3TN2A 3UI2A 4IUUA 5IGGA 3G6EA 3BZDB 3K80C 1FD7D 4YIJA 1X32A 2OEOA 1WD0A 3QB3A 3SK6A 1V1QA 3NBIA 1K8OA 1I6HH 2F0UA 4K6LA 5BR8L 1TKWB 5G3LD 5JOBA 4KHVA 5TSSA 4RHSA 4A76A 4DR1Q 1XMOQ 3OPOA 2P5ZX 3W5OA 1AEXA 1Y1VH 1LTRD 3ZYYX 5CGKA 1Z6HA 2X69A 3J81i 1J9OA 4YWKA 1XTDA 4DV5Q 3TZDA 3WOFA 2ZT9C 3NBHB 3RMHA 2JA6G 2MO0A 2UXDL 3NEMA 1QZHA 1CTMA 2F0OA 4JI5L 4ZKCB 3I4NH 2R7ZB 3JAMi 2AQ3B 2BOSA 2CCZA 3A74A 2AQ1B 4DUYQ 3CHBD 1AZQA 2XIWA 2C9OA 2EYFA 1HH2P 3S9WA 4EQPA 5I2XA 2IY5B 4CDFC 1K8GA 2L11A 1SE2A 3HOZG 1SMXA 1UEBA 3BVGA 4PV1C 5FJ8H 2X6LA 1Q81C 1ZYRC 2AUJD 5I9PA 1I5FA 4GN4B 4K5WA 1LLRD 3I70A 4HJ9A 1D1KA 1BO0A 1EFWA 2I46A 2JA8H 2NTSA 1VQNA 1NAPA 1PYBA 2K33A 4LF5L 4XDXA 1WVLA 1H9SA 3SE0A 2A19A 4O1NA 3IRBA 1GUOA 4OL7A 1IYUA 2B29A 3AU7A 4LUVA 3VR6A 2IHEA 2N88A 3UDFA 2VB3X 2BA0A 2PZTA 1NBWA 4R8NA 4A75A 4DNRB 5IWAQ 3F8TA 1JOOA 5ELFA 5JAVA 1EWIA 3KDFA 4LFAL 1V43A 4O42A 2NZOA 3P7JA 1HPCA 3X3NA 2PW7A 2MFIA 3MFGA 4HMIA 4LUZA 4RKBA 5ISRA 2JA7H 1C9OA 3E5SA 1Z47A 2PI2A 3M4OB 5JVH3 4IPDA 1MI2A 1F9QA 1WFQA 2F0QA 2K5NA 1TS2A 2EY6A 2WB1E 1KHIA 4AIMA 1LT4D 2F0GA 4DFAA 5M3FG 1H9MA 3LGJA 2Z1CA 4ZUJA 2O5JC 4K6DA 1YNNC 1MBYA 4C3JB 1ENAA 3NQTA 4NDXA 1X3FA 1Q86C 2F4IA 3RN2A 1DGSA 1U5KA 1SDFA 5ELNA 3L2PA 2RF4A 2B39A
chains in the Genus database with same CATH topology
1VQDA 4Y7NH 1JT8A 3K8AA 3GTQH 1IBML 4YCUA 4GOPA 4OONA 1J6QA 2MO1A 3TRZA 2AWNA 3ERSX 3UE1A 5IYBH 2KHJA 4A3IH 4A3EH 4QL5A 2UUAQ 4LF9L 3NENA 2R92G 3S2DH 1PYSB 3G4SA 1PVOA 4DV7Q 2JA5G 4K0KQ 1TWAH 3GTMH 2B63H 1BBUA 1VQFA 3CW2C 1Q7YC 4DK3C 3S2HH 1K8AC 1I3QH 3KOJA 4DV4Q 2D0PA 1V9PA 2I5HA 3KF6A 4IPHA 4A3CG 4PZ8A 2Y0SE 4R4IA 4UPAA 3W1GA 5GAGC 4LW1A 3M4PA 1IL2A 2UUCL 2F4VL 4NPSA 4LFBL 2K75A 3DM3A 1IXRA 1X3GA 2A1AA 3FP9A 2UXBL 1QUQA 1SE8A 3STBD 3PIOA 4HJ8A 3Q8DA 1SFOH 4JCVE 2E2IH 4A3BH 4IJHA 1HJPA 4A3FG 1X9NA 5C44H 4JI3Q 2UU9Q 3HOWG 1P8LA 1JJ2A 2WFWA 1N34L 3S16H 3GDEA 4B3SQ 4HIMA 4GKJL 3HFZB 3PF5A 2ASBA 3UDGA 4FDBA 4JBJA 1TWCH 1XPUA 1VQ6A 1I50H 4LF5Q 3HOXH 2R7ZG 5GAHC 4A3JG 1QVGA 2HT1A 4DR2Q 1W2BA 1LM0A 1IZ6A 1SN8A 1YEZA 2Y0SG 2UXCQ 3I2ZA 3U50C 3CCQA 1XNQL 4HIKA 2KENA 2LXJA 1E1TA 1BVSA 2ZTEA 4JYAQ 5EAYA 5FLMG 1YHBA 5M3MG 4X62Q 4DV2Q 4JOIC 1D7QA 3M3YH 1KRTA 2GVBA 2RHSB 3K7AH 1GVPA 4LWCA 5E7NA 1YNXA 3WWVA 2CFMA 4JI0L 4OWWB 1W3SA 1G6PA 4JI3L 5M5YH 4DV1Q 4H02A 3TREA 1CSPA 4LFAQ 4YY3Q 3S1NH 1UWVA 3BZCA 3PUXA 3BU2A 4R4TA 2PNHA 4KI0A 3TS0A 1SLJA 5LMUL 1N36L 2YU9H 3S15H 2R93G 4A3GH 2ALYB 4BY1G 4JI4L 1VQ9A 2NN6I 1N32Q 2HQLA 1HNXL 4DR2L 3I4MG 2QEXA 2AMCB 3EIVA 3JAMc 2DUDA 1EIYB 4X65L 2UUBQ 1EUJA 2ZTDA 4AH6A 2E5LL 3GTGH 2Q2UA 2ZM6L 4DV6L 2R92H 1NE3A 3W1BA 3J80c 2MNAA 3J7ZC 1J5EL 1HZAA 1O7IA 3GD7A 1VQ8A 1VQKA 4LF6L 3GTLH 3PUZA 1PH1A 2KBNA 5LMNQ 2JA5H 4AQYL 4C3HH 1VQAA 4HIDA 4OO1G 3HKZE 4NXNL 4A3LG 4QJFA 1TXYA 4A3CH 3G48A 4GN5A 2JA9A 1A8VA 1VQOA 4B3TL 4MZ9A 4LF8Q 3HOXG 1MJEA 4JI6Q 1HR0Q 3ICEA 1FVIA 4DR6L 2YTXA 3ZJYC 2EQSA 4DV3L 5H1SE 4AYBG 3KFUA 5IT9c 2C35B 4LF4Q 4QQBX 3L7ZC 4C3IH 4LNQA 3E9IA 1UE1A 3K81C 4JI1L 3CCVA 1A62A 1PA6A 4JI7L 2H5XA 3GTJH 2CWPA 4LF9Q 1YI2A 4P73A 4IFDI 1Q1BA 2K5HA 3PIPA 1KQSA 2D0OA 3CP0A 1KIXA 4YCVA 2R7ZH 4A3JH 4GOPB 3T1YL 4HJ5A 1FL0A 1T9HA 2XTIA 2EIFA 2VQFL 1SRUA 3CPWA 3S1MH 1LTLA 4POFA 1PH4A 3HOYG 5JEAJ 2UUCQ 2E8GA 1HNZL 4LFBQ 4GLVB 2VW9A 2JE6I 1RL2A 3GTKH 2YTVA 4JOIA 4A3GG 4UP9A 5FLMH 1HR0L 3H3VH 3H0GG 3PGZA 5IP7G 2UXBQ 4O0AA 3CCSA 4BBSG 4B3MQ 2VUMG 4GN3B 1CSQA 2I5LX 2JK8A 1CKOA 3KJPA 2IX1A 1EIFA 2VS1A 3I56A 1N34Q 5GQOA 1Q1EA 3ULJA 3CCMA 1L2FA 4GKJQ 1YHQA 1QUQB 5C0XI 1XJVA 3F1ZA 3S1RH 4UY8C 3ER0A 2R93H 1ASYA 1YJWA 3A5UA 4L5RC 4PZ7A 1E1OA 4R4QA 4JBMA 2PQAA 4BY1H 1RIPA 2Z6KC 3E9HA 2OTJA 3CCLA 1YZ6A 2IHFA 2IX0A 3I4MH 5LMNW 2VQEL 3AYHB 4KHZA 1XNQQ 3I7FA 1OXTA 5AJ3Q 2HHHL 2VNUD 4J15A 3TQYA 2K5VA 1XPOA 4IJLA 4JI8L 1VQCA 4L5TA 3I4OA 4DAMA 1GM5A 4KHPQ 1G51A 4A3BG 4OX9L 4B3RL 2JQOA 3B6YA 1EQQA 3CMAA 1BKBA 1KC8C 4JV5L 1HNWQ 2YV5A 4B3ML 4JI0Q 3VDYA 1HR0W 4XTCS 4ALPA 3K7UC 4A3LH 2KCTA 4GLAC 1NMFA 4QIWE 4BXXH 4DAYB 1WCMG 2GN5A 2FXQA 3CPFA 5LMUQ 1N36Q 3HOVG 4C2MH 2Z0SA 1TWHH 2N78A 2YTYA 4JBKA 2E2HH 4GNXB 4JI4Q 1X54A 1C7YA 3M7NA 3D31A 1PV4A 4P71A 1NJIC 5IYDG 1HNXQ 1VQEA 1FJGL 1S40A 5HGQA 1Y14B 1OXUA 3AFQA 4A3DG 4X65Q 1X65A 1X6OA 2E5LQ 3OYYA 1WOCA 2D62A 4BA2I 2ZM6Q 2V1CC 3A5ZB 4P75A 1GD7A 3D0FA 2QGQA 3BZKA 5AJ3L 4DV6Q 2NVQH 4LFCL 1J5EQ 2AKWB 4X6AH 4LF6Q 1VS0A 5JEAG 3GO5A 3M4OH 1VQHA 1PH9A 3HKSA 4KHPL 4IFDJ 4AQYQ 1E7ZA 1PH8A 4POGA 2JEAI 2EXDA 4DNIA 1PH5A 4Y52H 3S17H 4X64L 3CC4A 4DR1L 1PH6A 2LXKA 4PG3A 4NXNQ 3KF8B 3J80i 1XMOL 2KCMA 3J81c 3BJUA 1GO3E 4B3TQ 1L1OB 1WI5A 1A0IA 4DK6C 1EOVA 3F2DA 1EQRA 4C3JH 2OTLA 1N33Q 4DR6Q 4GKKL 4DV3Q 4JI2L 2A8VA 3JC66 3H0GH 5IP7H 4DV0L 1IBLL 5J3BA 3AFPA 4BBSH 4DR5L 3FKIG 3KDFB 2VUMH 3CCRA 3T1HL 4BY7G 1MJCA 4JI1Q 4LF7L 1VQJA 2NVTH 3CC2A 4AYBE 5C3EG 4JI7Q 1E22A 1TWFH 2B3GA 4UP8A 2JEBI 2JJQA 3CAMA 3GTPH 1G291 4HIOA 2R7FA 1KAWA 2Z6KA 3T1YQ 3ULLA 3NELA 1N8RC 2VQFQ 4DUYL 2NZHA 2MQHA 2AWOA 4OXPA 1B70B 2LSSA 4BXXG 1CKNB 3MXNB 1HNZQ 1YIJA 3PO2G 4QY7A 3RN5A 3RLOA 1X56A 1N33L 4IOCA 4P74A 1FGUA 4YWMA 2HIXA 2ZJRA 4WJ4A 3STBC 2N49A 1S3OA 2CWAA 4DR4L 1B7YB 4DR7L 4OO1I 4A3KG 1AH9A 1UE6A 4BBRH 3PF4A 1A63A 1P16A 5JJIA 2OCEA 4GS3A 4IPGA 1YBYA 1WCMH 4A4IA 1VQLA 3HOVH 1NMGA 4DR3L 3UDIA 3RZOH 5C4JH 3I4NG 4APVA 1XNRL 4X66L 2ES2A 2K14A 2Q2IA 5IYDH 1NTGA 5M5WH 1K73C 1ASZA 4DUZL 2VQEQ 3CXCA 4A3DH 5K36G 4R4CA 2CQOA 1LYLA 1MKHA 2BA1A 2HHHQ 3RR5A 5C4XH 3S24A 3U58A 4JI8Q 1VQBA 2WAQG 3U4VA 4YHHL 1HZBA 2VZAA 2Q2HA 1U0LA 2PMZE 3EN2A 4OX9Q 5IE8A 4A93H 1VQGA 2KHIA 2DGYA 4EQ5A 2F3IA 3KF6B 1IBKL 3K0XA 4JV5Q 1C0AA 1M1KC 1VQ4A 1K83H 3OTOL 1YHAA 1VCIA 5IY0A 3SGIA 3GTOH 4NXML 3S14H 5FJ8G 4IOAA 3CC7A 4PMWA 1K9MC 3L0OA 4DPGA 1JB7A 1K0RA 3CMEA 2ZTCA 2E2JH 3PUYA 1N9WA 1SR3A 5IWAL 4GNXC 3G6EA 1QZGA 5GADC 3K80C 4QGUA 1JMCA 2BH2A 1HNWL 1FJGQ 3EBEA 1NY4A 2JA8G 3FKIH 4NB3A 4UP7A 5JJLA 4BY7H 2R6GA 5C3EH 5HY6A 3AQQA 1V1QA 3DLLA 5IP9H 1PH2A 4KLKA 1Y1WG 1OXXK 4MTNA 4XIGS 1XMQL 1I94L 4LFCQ 1I6HH 1E3PA 2RCNA 3KJOA 3CCUA 4TVAB 5BR8L 2WB1G 1UE7A 1LUZA 4A76A 4DKAC 4X64Q 4DR1Q 3RLFA 1XMOQ 1VQ5A 4BBRG 1KRSA 2K50A 3RZDH 3W5OA 2K52A 1L1OC 3CQZH 3PO3G 3RNUA 3PO2H 1Y1VH 2ZJPA 4GKKQ 1CUKA 4JI2Q 1KD1C 4BA1I 4DV0Q 4IO9A 1IBLQ 4TQUS 4DR5Q 3J7A5 3T1HQ 4LF7Q 3J81i 3TS2A 4YWKA 4A3KH 1XTDA 1AE3A 4DV5Q 1X3EA 3TEHB 3RLNA 3CD6A 3NBHB 5C4XG 2JA6G 2MO0A 2YYZA 4EX5A 2UXDL 3NEMA 4JBWA 1QZHA 4JI5L 1MIUA 1EYGA 2JA7G 4RG1A 3I4NH 4A93G 5IYCG 1VQ7A 3JAMi 4A3MG 1VQMA 2RHQB 1UE5A 3PSIA 3A74A 2CCZA 4DUYQ 2UUAL 2L15A 3M4QA 4DV7L 3KYHC 3PV0A 4K0KL 1YVCA 4OWTB 1HH2P 2NVYH 1OXVA 4WJ3M 2I5MX 4ME3A 1X55A 2PI2E 3H3VI 2IY5B 3M85A 2F52A 1K8GA 4DV4L 1YJ9A 1PH3A 3G71A 3HOZG 1YITA 3HOUH 1SMXA 2I0QA 1UEBA 1PH7A 2ATWA 4DR4Q 4DR7Q 5FJ8H 4DV5L 5M3FH 1Q81C 5IP9G 2N8NA 1I5FA 2NN6G 4GN4B 2NVXH 1XPRA 1JE5A 4HJAA 4DR3Q 3KLWA 2QA4A 4HJ9A 4GNXA 1EFWA 2UU9L 1XNRQ 4X66Q 4LF4L 1AE2A 4GOPC 2VY3A 5IYBG 5C0XJ 1H95A 4DUZQ 4L5QA 3OW2A 4A3EG 4A3IG 2OQKA 4B3SL 1VQNA 2JA8H 1PYBA 4LF5L 4R1JA 3F2CA 1Q8KA 4HJ7A 3H15A 2B63G 3HOYH 1Y1WH 1IYJB 2HIVA 4JG2A 4YHHQ 2A19A 3AEVA 3IRBA 3CCEA 1Y1VG 2UXCL 5JJKA 1Q46A 4RMFA 1IBKQ 2B29A 2WAQE 2ID0A 4LUVA 3OTOQ 2N3SA 2IHEA 4NXMQ 5DLQE 3PCOB 3UDFA 1OXSC 1BBWA 1WYDA 2BA0A 3I55A 1YJNA 4JYAL 4B3RQ 4X62L 1NBWA 5FLXc 1L1OA 3M9BA 4DV2L 5GROA 3U4ZA 4L5SA 4A75A 1JJGA 3PO3H 3PUWA 2CKZB 3E0EA 5IWAQ 5C44G 3F8TA 4DV1L 5GAEC 4JC0A 1EWIA 3KDFA 4LFAL 1V43A 4YY3L 1HZ9A 2NZOA 1KL9A 4IFDG 1B8AA 2BH8A 1CKMA 3ULPA 1KXLA 1HZCA 3PUVA 1I94Q 2MFIA 4O2DA 1XMQQ 2PQAB 1OTCA 2ZJQA 4LUZA 2VL6A 1E24A 2JA6H 1N32L 3UE0A 4A3FH 1IBMQ 1C9OA 2JA7H 1S72A 4LUOA 5BR8Q 1Z47A 2PI2A 1VQPA 1VQIA 1Q82C 2UUBL 4IPDA 5ELOA 5IYCH 3HOWH 1SROA 1PFSA 4A3MH 2Q2TA 1WFQA 1QVFA 3HOUG 1TWGH 2K4KA 3S1QH 2K5NA 4P72A 2GVAA 2AHOB 4IPCA 2WB1E 1KHIA 4AIMA 5M5XH 4PZ6A 1M90C 2WP8J 5M3FG 5LMNL 1D8LA 1CKNA 3HKZG 1WJJA 4OWXB 3CF5A 1QVCA 3LGJA 1L0WA 3J81j 4GLXA 1Z9FA 2R7DA 4YWLA 3FHWA 2OWOA 1K3RA 4R4OA 4YCWA 2OQ0A 2XGTA 3F2BA 1JJCB 3UDXA 3HOZH 1Q12A 1X3FA 3A0JA 1R9TH 5C0XG 1Q86C 2F4VQ 1GKHA 3RN2A 1DGSA 2IT1A 1U5KA 4JI6L 4LF8L 5M3MH 4MNOA 3MEFA 5ELNA 3L2PA 2UXDQ 2RF4A 1PHJA 4JI5Q 3CCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQD A;  4Y7N H;  1JT8 A;  3K8A A;  3GTQ H;  1IBM L;  4YCU A;  4GOP A;  4OON A;  1J6Q A;  2MO1 A;  3TRZ A;  2AWN A;  3ERS X;  3UE1 A;  5IYB H;  2KHJ A;  4A3I H;  4A3E H;  4QL5 A;  2UUA Q;  4LF9 L;  3NEN A;  2R92 G;  3S2D H;  1PYS B;  3G4S A;  1PVO A;  4DV7 Q;  2JA5 G;  4K0K Q;  1TWA H;  3GTM H;  2B63 H;  1BBU A;  1VQF A;  3CW2 C;  1Q7Y C;  4DK3 C;  3S2H H;  1K8A C;  1I3Q H;  3KOJ A;  4DV4 Q;  2D0P A;  1V9P A;  2I5H A;  3KF6 A;  4IPH A;  4A3C G;  4PZ8 A;  2Y0S E;  4R4I A;  4UPA A;  3W1G A;  5GAG C;  4LW1 A;  3M4P A;  1IL2 A;  2UUC L;  2F4V L;  4NPS A;  4LFB L;  2K75 A;  3DM3 A;  1IXR A;  1X3G A;  2A1A A;  3FP9 A;  2UXB L;  1QUQ A;  1SE8 A;  3STB D;  3PIO A;  4HJ8 A;  3Q8D A;  1SFO H;  4JCV E;  2E2I H;  4A3B H;  4IJH A;  1HJP A;  4A3F G;  1X9N A;  5C44 H;  4JI3 Q;  2UU9 Q;  3HOW G;  1P8L A;  1JJ2 A;  2WFW A;  1N34 L;  3S16 H;  3GDE A;  4B3S Q;  4HIM A;  4GKJ L;  3HFZ B;  3PF5 A;  2ASB A;  3UDG A;  4FDB A;  4JBJ A;  1TWC H;  1XPU A;  1VQ6 A;  1I50 H;  4LF5 Q;  3HOX H;  2R7Z G;  5GAH C;  4A3J G;  1QVG A;  2HT1 A;  4DR2 Q;  1W2B A;  1LM0 A;  1IZ6 A;  1SN8 A;  1YEZ A;  2Y0S G;  2UXC Q;  3I2Z A;  3U50 C;  3CCQ A;  1XNQ L;  4HIK A;  2KEN A;  2LXJ A;  1E1T A;  1BVS A;  2ZTE A;  4JYA Q;  5EAY A;  5FLM G;  1YHB A;  5M3M G;  4X62 Q;  4DV2 Q;  4JOI C;  1D7Q A;  3M3Y H;  1KRT A;  2GVB A;  2RHS B;  3K7A H;  1GVP A;  4LWC A;  5E7N A;  1YNX A;  3WWV A;  2CFM A;  4JI0 L;  4OWW B;  1W3S A;  1G6P A;  4JI3 L;  5M5Y H;  4DV1 Q;  4H02 A;  3TRE A;  1CSP A;  4LFA Q;  4YY3 Q;  3S1N H;  1UWV A;  3BZC A;  3PUX A;  3BU2 A;  4R4T A;  2PNH A;  4KI0 A;  3TS0 A;  1SLJ A;  5LMU L;  1N36 L;  2YU9 H;  3S15 H;  2R93 G;  4A3G H;  2ALY B;  4BY1 G;  4JI4 L;  1VQ9 A;  2NN6 I;  1N32 Q;  2HQL A;  1HNX L;  4DR2 L;  3I4M G;  2QEX A;  2AMC B;  3EIV A;  3JAM c;  2DUD A;  1EIY B;  4X65 L;  2UUB Q;  1EUJ A;  2ZTD A;  4AH6 A;  2E5L L;  3GTG H;  2Q2U A;  2ZM6 L;  4DV6 L;  2R92 H;  1NE3 A;  3W1B A;  3J80 c;  2MNA A;  3J7Z C;  1J5E L;  1HZA A;  1O7I A;  3GD7 A;  1VQ8 A;  1VQK A;  4LF6 L;  3GTL H;  3PUZ A;  1PH1 A;  2KBN A;  5LMN Q;  2JA5 H;  4AQY L;  4C3H H;  1VQA A;  4HID A;  4OO1 G;  3HKZ E;  4NXN L;  4A3L G;  4QJF A;  1TXY A;  4A3C H;  3G48 A;  4GN5 A;  2JA9 A;  1A8V A;  1VQO A;  4B3T L;  4MZ9 A;  4LF8 Q;  3HOX G;  1MJE A;  4JI6 Q;  1HR0 Q;  3ICE A;  1FVI A;  4DR6 L;  2YTX A;  3ZJY C;  2EQS A;  4DV3 L;  5H1S E;  4AYB G;  3KFU A;  5IT9 c;  2C35 B;  4LF4 Q;  4QQB X;  3L7Z C;  4C3I H;  4LNQ A;  3E9I A;  1UE1 A;  3K81 C;  4JI1 L;  3CCV A;  1A62 A;  1PA6 A;  4JI7 L;  2H5X A;  3GTJ H;  2CWP A;  4LF9 Q;  1YI2 A;  4P73 A;  4IFD I;  1Q1B A;  2K5H A;  3PIP A;  1KQS A;  2D0O A;  3CP0 A;  1KIX A;  4YCV A;  2R7Z H;  4A3J H;  4GOP B;  3T1Y L;  4HJ5 A;  1FL0 A;  1T9H A;  2XTI A;  2EIF A;  2VQF L;  1SRU A;  3CPW A;  3S1M H;  1LTL A;  4POF A;  1PH4 A;  3HOY G;  5JEA J;  2UUC Q;  2E8G A;  1HNZ L;  4LFB Q;  4GLV B;  2VW9 A;  2JE6 I;  1RL2 A;  3GTK H;  2YTV A;  4JOI A;  4A3G G;  4UP9 A;  5FLM H;  1HR0 L;  3H3V H;  3H0G G;  3PGZ A;  5IP7 G;  2UXB Q;  4O0A A;  3CCS A;  4BBS G;  4B3M Q;  2VUM G;  4GN3 B;  1CSQ A;  2I5L X;  2JK8 A;  1CKO A;  3KJP A;  2IX1 A;  1EIF A;  2VS1 A;  3I56 A;  1N34 Q;  5GQO A;  1Q1E A;  3ULJ A;  3CCM A;  1L2F A;  4GKJ Q;  1YHQ A;  1QUQ B;  5C0X I;  1XJV A;  3F1Z A;  3S1R H;  4UY8 C;  3ER0 A;  2R93 H;  1ASY A;  1YJW A;  3A5U A;  4L5R C;  4PZ7 A;  1E1O A;  4R4Q A;  4JBM A;  2PQA A;  4BY1 H;  1RIP A;  2Z6K C;  3E9H A;  2OTJ A;  3CCL A;  1YZ6 A;  2IHF A;  2IX0 A;  3I4M H;  5LMN W;  2VQE L;  3AYH B;  4KHZ A;  1XNQ Q;  3I7F A;  1OXT A;  5AJ3 Q;  2HHH L;  2VNU D;  4J15 A;  3TQY A;  2K5V A;  1XPO A;  4IJL A;  4JI8 L;  1VQC A;  4L5T A;  3I4O A;  4DAM A;  1GM5 A;  4KHP Q;  1G51 A;  4A3B G;  4OX9 L;  4B3R L;  2JQO A;  3B6Y A;  1EQQ A;  3CMA A;  1BKB A;  1KC8 C;  4JV5 L;  1HNW Q;  2YV5 A;  4B3M L;  4JI0 Q;  3VDY A;  1HR0 W;  4XTC S;  4ALP A;  3K7U C;  4A3L H;  2KCT A;  4GLA C;  1NMF A;  4QIW E;  4BXX H;  4DAY B;  1WCM G;  2GN5 A;  2FXQ A;  3CPF A;  5LMU Q;  1N36 Q;  3HOV G;  4C2M H;  2Z0S A;  1TWH H;  2N78 A;  2YTY A;  4JBK A;  2E2H H;  4GNX B;  4JI4 Q;  1X54 A;  1C7Y A;  3M7N A;  3D31 A;  1PV4 A;  4P71 A;  1NJI C;  5IYD G;  1HNX Q;  1VQE A;  1FJG L;  1S40 A;  5HGQ A;  1Y14 B;  1OXU A;  3AFQ A;  4A3D G;  4X65 Q;  1X65 A;  1X6O A;  2E5L Q;  3OYY A;  1WOC A;  2D62 A;  4BA2 I;  2ZM6 Q;  2V1C C;  3A5Z B;  4P75 A;  1GD7 A;  3D0F A;  2QGQ A;  3BZK A;  5AJ3 L;  4DV6 Q;  2NVQ H;  4LFC L;  1J5E Q;  2AKW B;  4X6A H;  4LF6 Q;  1VS0 A;  5JEA G;  3GO5 A;  3M4O H;  1VQH A;  1PH9 A;  3HKS A;  4KHP L;  4IFD J;  4AQY Q;  1E7Z A;  1PH8 A;  4POG A;  2JEA I;  2EXD A;  4DNI A;  1PH5 A;  4Y52 H;  3S17 H;  4X64 L;  3CC4 A;  4DR1 L;  1PH6 A;  2LXK A;  4PG3 A;  4NXN Q;  3KF8 B;  3J80 i;  1XMO L;  2KCM A;  3J81 c;  3BJU A;  1GO3 E;  4B3T Q;  1L1O B;  1WI5 A;  1A0I A;  4DK6 C;  1EOV A;  3F2D A;  1EQR A;  4C3J H;  2OTL A;  1N33 Q;  4DR6 Q;  4GKK L;  4DV3 Q;  4JI2 L;  2A8V A;  3JC6 6;  3H0G H;  5IP7 H;  4DV0 L;  1IBL L;  5J3B A;  3AFP A;  4BBS H;  4DR5 L;  3FKI G;  3KDF B;  2VUM H;  3CCR A;  3T1H L;  4BY7 G;  1MJC A;  4JI1 Q;  4LF7 L;  1VQJ A;  2NVT H;  3CC2 A;  4AYB E;  5C3E G;  4JI7 Q;  1E22 A;  1TWF H;  2B3G A;  4UP8 A;  2JEB I;  2JJQ A;  3CAM A;  3GTP H;  1G29 1;  4HIO A;  2R7F A;  1KAW A;  2Z6K A;  3T1Y Q;  3ULL A;  3NEL A;  1N8R C;  2VQF Q;  4DUY L;  2NZH A;  2MQH A;  2AWO A;  4OXP A;  1B70 B;  2LSS A;  4BXX G;  1CKN B;  3MXN B;  1HNZ Q;  1YIJ A;  3PO2 G;  4QY7 A;  3RN5 A;  3RLO A;  1X56 A;  1N33 L;  4IOC A;  4P74 A;  1FGU A;  4YWM A;  2HIX A;  2ZJR A;  4WJ4 A;  3STB C;  2N49 A;  1S3O A;  2CWA A;  4DR4 L;  1B7Y B;  4DR7 L;  4OO1 I;  4A3K G;  1AH9 A;  1UE6 A;  4BBR H;  3PF4 A;  1A63 A;  1P16 A;  5JJI A;  2OCE A;  4GS3 A;  4IPG A;  1YBY A;  1WCM H;  4A4I A;  1VQL A;  3HOV H;  1NMG A;  4DR3 L;  3UDI A;  3RZO H;  5C4J H;  3I4N G;  4APV A;  1XNR L;  4X66 L;  2ES2 A;  2K14 A;  2Q2I A;  5IYD H;  1NTG A;  5M5W H;  1K73 C;  1ASZ A;  4DUZ L;  2VQE Q;  3CXC A;  4A3D H;  5K36 G;  4R4C A;  2CQO A;  1LYL A;  1MKH A;  2BA1 A;  2HHH Q;  3RR5 A;  5C4X H;  3S24 A;  3U58 A;  4JI8 Q;  1VQB A;  2WAQ G;  3U4V A;  4YHH L;  1HZB A;  2VZA A;  2Q2H A;  1U0L A;  2PMZ E;  3EN2 A;  4OX9 Q;  5IE8 A;  4A93 H;  1VQG A;  2KHI A;  2DGY A;  4EQ5 A;  2F3I A;  3KF6 B;  1IBK L;  3K0X A;  4JV5 Q;  1C0A A;  1M1K C;  1VQ4 A;  1K83 H;  3OTO L;  1YHA A;  1VCI A;  5IY0 A;  3SGI A;  3GTO H;  4NXM L;  3S14 H;  5FJ8 G;  4IOA A;  3CC7 A;  4PMW A;  1K9M C;  3L0O A;  4DPG A;  1JB7 A;  1K0R A;  3CME A;  2ZTC A;  2E2J H;  3PUY A;  1N9W A;  1SR3 A;  5IWA L;  4GNX C;  3G6E A;  1QZG A;  5GAD C;  3K80 C;  4QGU A;  1JMC A;  2BH2 A;  1HNW L;  1FJG Q;  3EBE A;  1NY4 A;  2JA8 G;  3FKI H;  4NB3 A;  4UP7 A;  5JJL A;  4BY7 H;  2R6G A;  5C3E H;  5HY6 A;  3AQQ A;  1V1Q A;  3DLL A;  5IP9 H;  1PH2 A;  4KLK A;  1Y1W G;  1OXX K;  4MTN A;  4XIG S;  1XMQ L;  1I94 L;  4LFC Q;  1I6H H;  1E3P A;  2RCN A;  3KJO A;  3CCU A;  4TVA B;  5BR8 L;  2WB1 G;  1UE7 A;  1LUZ A;  4A76 A;  4DKA C;  4X64 Q;  4DR1 Q;  3RLF A;  1XMO Q;  1VQ5 A;  4BBR G;  1KRS A;  2K50 A;  3RZD H;  3W5O A;  2K52 A;  1L1O C;  3CQZ H;  3PO3 G;  3RNU A;  3PO2 H;  1Y1V H;  2ZJP A;  4GKK Q;  1CUK A;  4JI2 Q;  1KD1 C;  4BA1 I;  4DV0 Q;  4IO9 A;  1IBL Q;  4TQU S;  4DR5 Q;  3J7A 5;  3T1H Q;  4LF7 Q;  3J81 i;  3TS2 A;  4YWK A;  4A3K H;  1XTD A;  1AE3 A;  4DV5 Q;  1X3E A;  3TEH B;  3RLN A;  3CD6 A;  3NBH B;  5C4X G;  2JA6 G;  2MO0 A;  2YYZ A;  4EX5 A;  2UXD L;  3NEM A;  4JBW A;  1QZH A;  4JI5 L;  1MIU A;  1EYG A;  2JA7 G;  4RG1 A;  3I4N H;  4A93 G;  5IYC G;  1VQ7 A;  3JAM i;  4A3M G;  1VQM A;  2RHQ B;  1UE5 A;  3PSI A;  3A74 A;  2CCZ A;  4DUY Q;  2UUA L;  2L15 A;  3M4Q A;  4DV7 L;  3KYH C;  3PV0 A;  4K0K L;  1YVC A;  4OWT B;  1HH2 P;  2NVY H;  1OXV A;  4WJ3 M;  2I5M X;  4ME3 A;  1X55 A;  2PI2 E;  3H3V I;  2IY5 B;  3M85 A;  2F52 A;  1K8G A;  4DV4 L;  1YJ9 A;  1PH3 A;  3G71 A;  3HOZ G;  1YIT A;  3HOU H;  1SMX A;  2I0Q A;  1UEB A;  1PH7 A;  2ATW A;  4DR4 Q;  4DR7 Q;  5FJ8 H;  4DV5 L;  5M3F H;  1Q81 C;  5IP9 G;  2N8N A;  1I5F A;  2NN6 G;  4GN4 B;  2NVX H;  1XPR A;  1JE5 A;  4HJA A;  4DR3 Q;  3KLW A;  2QA4 A;  4HJ9 A;  4GNX A;  1EFW A;  2UU9 L;  1XNR Q;  4X66 Q;  4LF4 L;  1AE2 A;  4GOP C;  2VY3 A;  5IYB G;  5C0X J;  1H95 A;  4DUZ Q;  4L5Q A;  3OW2 A;  4A3E G;  4A3I G;  2OQK A;  4B3S L;  1VQN A;  2JA8 H;  1PYB A;  4LF5 L;  4R1J A;  3F2C A;  1Q8K A;  4HJ7 A;  3H15 A;  2B63 G;  3HOY H;  1Y1W H;  1IYJ B;  2HIV A;  4JG2 A;  4YHH Q;  2A19 A;  3AEV A;  3IRB A;  3CCE A;  1Y1V G;  2UXC L;  5JJK A;  1Q46 A;  4RMF A;  1IBK Q;  2B29 A;  2WAQ E;  2ID0 A;  4LUV A;  3OTO Q;  2N3S A;  2IHE A;  4NXM Q;  5DLQ E;  3PCO B;  3UDF A;  1OXS C;  1BBW A;  1WYD A;  2BA0 A;  3I55 A;  1YJN A;  4JYA L;  4B3R Q;  4X62 L;  1NBW A;  5FLX c;  1L1O A;  3M9B A;  4DV2 L;  5GRO A;  3U4Z A;  4L5S A;  4A75 A;  1JJG A;  3PO3 H;  3PUW A;  2CKZ B;  3E0E A;  5IWA Q;  5C44 G;  3F8T A;  4DV1 L;  5GAE C;  4JC0 A;  1EWI A;  3KDF A;  4LFA L;  1V43 A;  4YY3 L;  1HZ9 A;  2NZO A;  1KL9 A;  4IFD G;  1B8A A;  2BH8 A;  1CKM A;  3ULP A;  1KXL A;  1HZC A;  3PUV A;  1I94 Q;  2MFI A;  4O2D A;  1XMQ Q;  2PQA B;  1OTC A;  2ZJQ A;  4LUZ A;  2VL6 A;  1E24 A;  2JA6 H;  1N32 L;  3UE0 A;  4A3F H;  1IBM Q;  1C9O A;  2JA7 H;  1S72 A;  4LUO A;  5BR8 Q;  1Z47 A;  2PI2 A;  1VQP A;  1VQI A;  1Q82 C;  2UUB L;  4IPD A;  5ELO A;  5IYC H;  3HOW H;  1SRO A;  1PFS A;  4A3M H;  2Q2T A;  1WFQ A;  1QVF A;  3HOU G;  1TWG H;  2K4K A;  3S1Q H;  2K5N A;  4P72 A;  2GVA A;  2AHO B;  4IPC A;  2WB1 E;  1KHI A;  4AIM A;  5M5X H;  4PZ6 A;  1M90 C;  2WP8 J;  5M3F G;  5LMN L;  1D8L A;  1CKN A;  3HKZ G;  1WJJ A;  4OWX B;  3CF5 A;  1QVC A;  3LGJ A;  1L0W A;  3J81 j;  4GLX A;  1Z9F A;  2R7D A;  4YWL A;  3FHW A;  2OWO A;  1K3R A;  4R4O A;  4YCW A;  2OQ0 A;  2XGT A;  3F2B A;  1JJC B;  3UDX A;  3HOZ H;  1Q12 A;  1X3F A;  3A0J A;  1R9T H;  5C0X G;  1Q86 C;  2F4V Q;  1GKH A;  3RN2 A;  1DGS A;  2IT1 A;  1U5K A;  4JI6 L;  4LF8 L;  5M3M H;  4MNO A;  3MEF A;  5ELN A;  3L2P A;  2UXD Q;  2RF4 A;  1PHJ A;  4JI5 Q;  3CCJ A; 
#chains in the Genus database with same CATH topology
 1EZ8 A;  4V19 0;  1IBM L;  1HA6 A;  2MO1 A;  2MPM A;  5IYB H;  4LF9 L;  2R92 G;  2KHJ A;  4A3E H;  3FEW X;  2MJ8 A;  3R93 A;  2JSO A;  1VQF A;  1K8A C;  3J80 L;  1YNJ C;  4DV4 Q;  4DK1 A;  2I5H A;  2A6E C;  4IPH A;  4A3B B;  5GAG C;  2Y0S E;  1D5X C;  5CV5 A;  3M4P A;  4LFB L;  2K75 A;  1IXR A;  3FP9 A;  2DJG C;  4HJ8 A;  1F9R A;  3AMU A;  4C3I G;  1HJP A;  4JI3 Q;  2KEE A;  1N34 L;  1RHP A;  3GDE A;  5DNF A;  3HFZ B;  3PF5 A;  2ASB A;  2WKD A;  1UAP A;  4TKO B;  4A3J G;  1DCZ A;  3KK7 A;  5C4X B;  1NNX A;  1MD2 D;  2Y0S G;  2NBF A;  3GTK B;  3I2Z A;  1DOM A;  1F77 A;  1K83 B;  1ICW A;  4QIW B;  3S14 B;  4JYA Q;  4DV2 Q;  2SEB D;  1D7Q A;  1KRT A;  1GVP A;  1W6K A;  4ME5 A;  4I7Z C;  1G6P A;  1ET9 A;  2CVR A;  4ILW A;  4YY3 Q;  3BU2 A;  1PFM A;  1SLJ A;  5LMU L;  2YU9 H;  2JP1 A;  4BY1 G;  1AN8 A;  1N32 Q;  4DR2 L;  3I4M G;  4UDU C;  3EIV A;  2QEX A;  4Q0F A;  5EPK A;  4CHT B;  4X65 L;  2O2L D;  4AH6 A;  3M7G A;  2ZM6 L;  1EY8 A;  3NSW A;  5CV9 A;  1HUM A;  2MNA A;  1J5E L;  3J7Z C;  1HZA A;  3GD7 A;  1JOQ A;  2OT2 A;  2RQX A;  2KA7 A;  2JA5 H;  4FXK C;  1SMY D;  4C3H H;  1PZI D;  2RVL A;  2E2H B;  4A3C H;  1Q8I A;  4GN5 A;  1ZXT A;  1A8V A;  4B3T L;  4MZ9 A;  4LF8 Q;  3HOX G;  1MJE A;  4A3K B;  4JI6 Q;  1HR0 Q;  4QMG A;  1S5B D;  2YTX A;  4A3B H;  2EQS A;  4KV6 A;  2C35 B;  3DWP A;  3L7Z C;  1STB A;  3A8J E;  2F0J A;  2RA4 A;  5C4Z A;  2A5H A;  1UE1 A;  1XXG A;  4JI1 L;  3HEJ A;  1B44 D;  2WII B;  2H5X A;  1YI2 A;  3VR3 A;  2BDN A;  2E74 C;  1KQS A;  3LWU A;  2D0O A;  2K03 A;  5I2Y A;  5G3L F;  2K04 A;  1MHW C;  2XTI A;  5BN5 A;  2WAQ B;  1SYB A;  1PH4 A;  4DK0 A;  1BF4 A;  5JEA J;  1IHZ A;  2EY2 A;  1KNA A;  2UUC Q;  2VW9 A;  1RL2 A;  3GTK H;  2YTV A;  5FLM H;  3H3V H;  2UXB Q;  4ODG A;  3CCS A;  5CYU A;  1AP0 A;  2I5L X;  1WTO A;  5FO7 B;  5JPM C;  2IX1 A;  2VS1 A;  1V1O A;  5EBD A;  3CCM A;  1L2F A;  2WIN B;  4UY8 C;  3V96 A;  3S1R H;  2WAC A;  1V1P A;  3OWF A;  4L5R C;  4PZ7 A;  1E1O A;  2EYP A;  4FXD A;  3ONA B;  1RDP D;  4H0L C;  3KLS A;  1YZ6 A;  2NYZ D;  2VQE L;  2AQ2 B;  1XNQ Q;  1OXT A;  3TQY A;  4IJL A;  1WTR A;  4N9P A;  1FNU A;  1G51 A;  4OX9 L;  3CMA A;  3VR4 A;  4B3M L;  4JI0 Q;  4L8J A;  4FF1 A;  2XVS A;  2A73 B;  4ALP A;  2KCT A;  3BS1 A;  2X6G A;  2FHT A;  1NMF A;  5IT9 L;  2GN5 A;  2FXQ A;  3HOV G;  3X3M A;  5L37 A;  2E2H H;  1X54 A;  1NJI C;  5IYD G;  2Q8T A;  1VQE A;  2V4D A;  2JA6 B;  1X6O A;  3E0J A;  2V1C C;  4KK7 A;  2DY8 A;  3J7A F;  5JEA G;  3GO5 A;  1M8A A;  2MHV A;  4AQY Q;  3K57 A;  1PH8 A;  2JEA I;  4QUC A;  2EXD A;  4DNI A;  1PH5 A;  2F03 A;  3CC4 A;  4DR1 L;  1F2Y A;  4PG3 A;  3J80 i;  1XMO L;  5KYL A;  2CH4 A;  3HOZ B;  1WI5 A;  2IL8 A;  1N33 Q;  4DV3 Q;  3M4Y A;  3JC6 6;  3H0G H;  3CCR A;  2K5W A;  3Q6S A;  1B53 A;  1W6J A;  2IX3 A;  3J7Y W;  4UP8 A;  2F0L A;  2XRS D;  1N8R C;  3CQZ B;  2VQF Q;  4DUY L;  1GXD C;  4OXP A;  3A7L A;  1DJR D;  5K5P A;  2LSS A;  4BXX G;  3MXN B;  1HNZ Q;  4KJO A;  1I6V C;  3I72 A;  5CV8 A;  1LAC A;  5HUR A;  5A2Q E;  3HRZ C;  1CQF A;  2N49 A;  1S3O A;  1XX8 A;  4RKL A;  1B7Y B;  3PF4 A;  1A63 A;  4GS3 A;  4IPG A;  5EKI A;  3K58 A;  1WTQ A;  3BVM A;  4PNY A;  4HN7 A;  5EBC A;  1EIG A;  3R2T A;  2A69 C;  5C4J H;  5E3F A;  3TZU A;  2K14 A;  2J4X A;  4ZAI A;  5KIX A;  4KMU C;  1NTG A;  3GP7 A;  2NVY B;  4A3D H;  3CRL C;  2MGS A;  4JI8 Q;  1KTK A;  3O13 A;  1KLG D;  1PTO C;  3EN2 A;  4B3R Q;  5IE8 A;  4JV5 Q;  3KF6 B;  1C0A A;  1NUC A;  1A2U A;  3SVM A;  3M3Y B;  1M1K C;  3K7A B;  5F2D A;  1VCI A;  2BE5 D;  1K9M C;  1JB7 A;  1JE4 A;  3PUY A;  3QOL A;  5KEE A;  3S15 B;  5C5M A;  5IWA L;  1IKL A;  4GNX C;  5KND A;  1MSH A;  4K2L A;  4QGU A;  1TY0 A;  1FJG Q;  3EBE A;  4FO2 A;  3FKI H;  4NB3 A;  4IN3 A;  4BY7 H;  5JJL A;  4R8I A;  5T1G A;  5C3E H;  1QB5 D;  5HY6 A;  4KLK A;  4C1N K;  5ELB A;  2R92 B;  3MA2 B;  2EY5 A;  1E3P A;  5LHY 1;  2HUG A;  1O7Y A;  1LUZ A;  5IT9 E;  1HHV A;  4X64 Q;  5CMD A;  1F2Z A;  1KRS A;  1D1I A;  2K05 A;  3RZD H;  2B2T C;  3CQZ H;  3H09 A;  3PO2 H;  5CV4 A;  2ZJP A;  4GKK Q;  2QKI C;  1SBB B;  1TS4 A;  3OSO A;  4IUT A;  3TP6 A;  1MSG A;  4C3I B;  1X3E A;  3RLN A;  4DU9 A;  5E1F A;  5C4X G;  3OHX C;  4WOR A;  5BN4 A;  2EYM A;  3N52 A;  4RG1 A;  4G7Z C;  2PO4 A;  2F0W A;  4A3J B;  5IYC G;  4MTK A;  4ZK9 B;  4A3M G;  4IZ8 A;  3PSI A;  2Y0S B;  5K36 H;  3M4Q A;  3KYH C;  3WOE A;  1YVC A;  2NVY H;  1R9T B;  2XSC A;  1UNS A;  3H3V I;  1G91 A;  2F52 A;  4DV4 L;  1YJ9 A;  1YIT A;  2I0Q A;  4DR7 Q;  4Y7N B;  3IKJ A;  1U4P A;  3MVV A;  5M3F H;  3NXW A;  1WTP A;  2N8N A;  3FRP B;  4JPB W;  2E2D C;  4MHE A;  2NVX H;  1JE5 A;  1E2Z A;  3LWE A;  4DR3 Q;  2QA4 A;  4GNX A;  1XNR Q;  1WTH A;  1AE2 A;  4GOP C;  4BY1 B;  5C0X J;  1H95 A;  1CZG A;  4L5Q A;  4DUZ Q;  3OW2 A;  4A3I G;  2OQK A;  3I4M B;  3D8G A;  3F2C A;  3C1E A;  1FNV A;  4HJ7 A;  1Y1W H;  2HIV A;  2KVM A;  3TSS A;  3MTS A;  4QF4 A;  5DAU A;  4LMQ D;  4HTH A;  5JJK A;  2GA4 B;  1IBK Q;  2WAQ E;  1BBW A;  1WYD A;  1SAP A;  4JYA L;  2B2T A;  3VYR A;  1CHP D;  5FLX c;  4DV2 L;  5IOC A;  3PO3 H;  1TWC B;  3E0E A;  3PUW A;  1I50 B;  5C44 G;  3QR8 A;  3HOX B;  3KBX A;  4JC0 A;  4K5V A;  4YY3 L;  1HZ9 A;  4IFD G;  1KL9 A;  4OEL B;  1CKM A;  3PUV A;  1I94 Q;  2RDH A;  1AW7 A;  3J81 E;  2VL6 A;  1E24 A;  4QCL A;  1N32 L;  5CC4 A;  2NVQ B;  2F0P A;  2K7V A;  4LUO A;  1VQI A;  2B2Y C;  5ELO A;  2Q2T A;  5C4H A;  1TII D;  3FPU B;  1QVF A;  2DNC A;  3D3R A;  2GVA A;  2AHO B;  4OEM B;  1KAA A;  3JAM E;  1M90 C;  1O80 A;  3HKZ G;  5KNB A;  1WJJ A;  3J81 j;  1U4L A;  1Z9F A;  2K6A A;  2OWO A;  1K3R A;  3DWQ A;  1K28 A;  1JB3 A;  2XGT A;  4YCW A;  1EEF D;  1JJC B;  4IUR A;  3UDX A;  1AFP A;  1SND A;  1Q12 A;  3A0J A;  1R9T H;  5C0X G;  2F4V Q;  1TU2 B;  4RGT A;  1CA5 A;  5COR A;  1FR3 A;  1A3U A;  2IJ0 A;  4LF8 L;  4JI6 L;  3HG9 A;  2XNA C;  1VQD A;  2Z6B A;  4Y7N H;  3GTP B;  4GOP A;  4OON A;  1VDZ A;  1J6Q A;  3TRZ A;  5JVG 3;  4OGQ C;  3ERS X;  2UUA Q;  3S2D H;  3NEN A;  1PVO A;  1G8Z D;  1DON A;  4K0K Q;  3QWN A;  2B63 H;  3I90 A;  3S2H H;  2B2W C;  1I3Q H;  3OIP A;  4L63 B;  4UPA A;  4B08 A;  4DGZ A;  5JJZ A;  2UUC L;  4NPS A;  4C56 C;  3U9O A;  1QUQ A;  2UXB L;  4JCV E;  2E2I H;  4IJH A;  2QW7 A;  4A3F G;  3LNN A;  4OIK A;  1X9N A;  1EY4 A;  3HOV B;  3RZO B;  3S16 H;  1B50 A;  4B3S Q;  4LJZ C;  1TWC H;  4WFN 3;  1I50 H;  4KKU A;  3HOX H;  3NUC A;  1W2B A;  1LM0 A;  1SN8 A;  1YEZ A;  3NHH A;  2B2Y A;  2LY7 A;  3GV3 A;  4U68 A;  3T53 B;  3CCQ A;  1XNQ L;  4J1M A;  1E1T A;  2Z4I A;  4I65 A;  3FMC A;  5M3M G;  1ET6 A;  1HRJ A;  3NPP A;  5COY A;  2RHS B;  5E7N A;  3WWV A;  1YNX A;  4JI0 L;  4DV1 Q;  3GQB A;  3TRE A;  1LT3 D;  3S1N H;  1UWV A;  3PUX A;  4R4T A;  2H1E A;  4KI0 A;  2R93 G;  3DEO A;  3NBH A;  1O7Z A;  4HSP A;  1II3 A;  5J22 A;  3MC0 B;  3JAM c;  2LKV A;  1EUJ A;  1NE3 A;  3W1B A;  1VQ8 A;  1VQK A;  5FO9 B;  5LMN Q;  2TMP A;  4AQY L;  5KNC A;  2B2W A;  1VQA A;  2EJF C;  1BOS A;  1Y69 U;  4HID A;  2VB2 X;  4OO1 G;  4C2M B;  4A3L G;  2EY1 A;  4NMZ A;  4TSS A;  3G48 A;  1GJX A;  1A3T A;  3R8B A;  4DV3 L;  5H1S E;  5ELC A;  2DN8 A;  3DEP A;  1PA6 A;  4N8X 1;  1ESR A;  1Q1B A;  4I7A A;  5HGT A;  3TP7 A;  1KIX A;  2R7Z H;  2A74 C;  2ICE C;  1CI3 M;  1EYA A;  3L3O C;  1HCZ A;  1NR2 A;  4FXG C;  2EIF A;  2HCC A;  2VQF L;  2G5D A;  1K8M A;  4J6H A;  4B9W A;  2E8G A;  1HNZ L;  4ZQ3 A;  4FYD A;  4OIJ A;  2NZ1 D;  4FVM A;  1JC7 A;  4TRD A;  3PGZ A;  3EA6 A;  1BQQ T;  4BBS G;  4H13 C;  2VUM G;  2JK8 A;  5E4X A;  1JQY D;  3I56 A;  5GQO A;  3ULJ A;  4GKJ Q;  1STH A;  2LFN A;  4PMB A;  3ER0 A;  1ASY A;  1YJW A;  3TP8 A;  1RTO A;  3T16 A;  1RIP A;  4CJ1 B;  3PQI A;  2OTJ A;  2B8F A;  1Y8N B;  2L4N A;  2Z9H A;  1S5F D;  3AYH B;  4RWS C;  1RTN A;  3H3V C;  2MUY A;  1FYC A;  4JI8 L;  2CW0 D;  4KHP Q;  4B3R L;  2JQO A;  3BYY B;  1M4V A;  4JV5 L;  4P2C B;  2L9H A;  3VDY A;  2LS0 1;  4DA2 A;  4BXX H;  5EJW A;  4DAY B;  1WCM G;  1N36 Q;  4C2M H;  3M7N A;  2G9D A;  4JI4 Q;  1C7Y A;  5I6Y A;  1PV4 A;  4P71 A;  4ABN A;  2M00 A;  1HNX Q;  1FJG L;  2L12 A;  5HGQ A;  3ND9 A;  1Y14 B;  2B8G A;  4DAV A;  1OXU A;  3AFQ A;  3C2P A;  2E5L Q;  4P75 A;  2F3V A;  3NK9 A;  4DV6 Q;  3BZK A;  5AJ3 L;  4A3M B;  1TWG B;  1C4Q A;  3S1Q B;  1VS0 A;  3AB9 A;  1H9K A;  3M4O H;  4K8J A;  5M5X B;  1PH9 A;  4POG A;  5ELD A;  4Y52 H;  4X64 L;  1A15 A;  3KF8 B;  1UUP A;  1F9P A;  1EEI D;  2J0T D;  3BJU A;  1KNE A;  1F2M A;  1L1O B;  1E2V A;  1A0I A;  2KHS A;  4C3J H;  4DR6 Q;  4GKK L;  2A8V A;  3G7L A;  5IP7 H;  2PPB C;  3IFT A;  1K0S A;  2L55 A;  3CC2 A;  1I4P A;  3GTQ B;  4JI7 Q;  1ILQ A;  5IGC A;  5BN3 A;  1EFI D;  2EYO A;  2JEB I;  3H94 A;  1X3Q A;  3T4A C;  4A3I B;  1KAW A;  3ERO A;  3T1Y Q;  1IL8 A;  1HTL D;  1TWA B;  3ULL A;  1EY9 A;  2NZH A;  2HCI A;  4RHR A;  2EOT A;  2CQA A;  4XT3 B;  1CKN B;  4PMC A;  2QCP X;  4QY7 A;  4S3S A;  3H6M A;  1JIC A;  5AFW A;  1BCP B;  1LO5 D;  2HIX A;  1DM0 B;  4WJ4 A;  3T51 B;  4KN4 C;  1SFO B;  2XRQ D;  2FFK B;  1WD1 A;  4DR7 L;  1PLF A;  5C44 B;  1BCP F;  1UE6 A;  1BNZ A;  5C3X A;  1LTB D;  2QDB A;  5JJI A;  2NUC A;  2OCE A;  1CHQ D;  3QOJ A;  4A4I A;  1VQL A;  3Q23 A;  4DR3 L;  3T13 A;  3UDI A;  1WTV A;  3I4N G;  4UAI A;  1STE A;  1XNR L;  3SHL A;  5J39 A;  5CV7 A;  1SYG A;  1ASZ A;  4DUZ L;  4CKB A;  4KY6 A;  1NR4 A;  4CKE A;  3CXC A;  1V1P B;  1GHJ A;  2BA1 A;  3A7A B;  3RR5 A;  5C4X H;  3U58 A;  3LX0 A;  3NTH A;  3U4V A;  1HZB A;  2VZA A;  5KRU A;  5D3D A;  1U0L A;  2R61 A;  4FF4 A;  3G6J B;  1VQG A;  2KHI A;  3HKZ B;  4EQ5 A;  2F3I A;  1IBK L;  1K83 H;  1U4M A;  3S14 H;  4IOA A;  3SGI A;  5FJ8 G;  3A8K E;  2H4O A;  4PMW A;  5IGE A;  5M9O A;  1K0R A;  3CME A;  3NE5 B;  1LAB A;  3J80 E;  1N9W A;  3P75 A;  1BDO A;  1QZG A;  5GAD C;  2BH2 A;  3CRK C;  4KTA A;  2JA8 G;  1HQR D;  4UP7 A;  3GTG B;  3AQQ A;  2PQE A;  5C3W A;  1I94 L;  4LFC Q;  4XIG S;  4CDE C;  1HFG A;  2QIL A;  3CCU A;  4TVA B;  3MXG A;  4K8I A;  3A55 A;  4DKA C;  3RLF A;  1ML0 D;  1QG7 A;  4RGO S;  2K50 A;  3MAQ A;  2D9U A;  3RNU A;  1TR5 A;  1KD1 C;  4BA1 I;  4DV0 Q;  1Q90 A;  4DR5 Q;  5FLX L;  4G7H C;  5LL6 X;  4ID6 A;  4CJ2 C;  3J7A 5;  1IW7 D;  4A3F B;  4A3K H;  2BDO A;  4ULL A;  3CD6 A;  1SE3 A;  2YYZ A;  1JWS D;  2ZXR A;  1EYG A;  4DXF A;  2JA7 G;  4A93 G;  4IFD H;  4XT1 B;  2UUA L;  4KKS A;  4K0K L;  4OWT B;  1OXV A;  4WJ3 M;  3FVQ A;  2I5M X;  4M8A A;  1X55 A;  4ME3 A;  2PI2 E;  1EY7 A;  3VA5 A;  5M3M B;  3G71 A;  1PH3 A;  4DR4 Q;  1RJT A;  2F0N A;  1PH7 A;  2ATW A;  2NTT A;  4DV5 L;  1Z7T A;  5IP9 G;  2NN6 G;  4R9W A;  2HDL A;  3L9A X;  4HJA A;  3K6O A;  2R93 B;  5CBE E;  5CBA E;  1WTX A;  5IYB G;  1CFM A;  4A3E G;  4B3S L;  3GTM B;  2JYO A;  2XWB B;  1PRT B;  4B9X A;  4R1J A;  1SJH D;  4KY7 A;  3I3C A;  3OW7 A;  3H15 A;  1IYJ B;  4YHH Q;  1PRT F;  3AEV A;  3CCE A;  4ZRZ A;  1Q46 A;  2K32 A;  2ID0 A;  2IPK D;  1C8C A;  3OTO Q;  2N3S A;  3TBI B;  1CK1 A;  5DLQ E;  1S5E D;  1RCV D;  2EVB A;  4L5S A;  5GRO A;  1VF5 C;  1R4Q B;  1TWH B;  3OWE B;  4DV1 L;  2M9V A;  5GAE C;  3QG1 A;  4WRD A;  1TVX A;  1I4Q A;  1B8A A;  2BH8 A;  1KXL A;  1SE4 A;  1HZC A;  1MGS A;  4O2D A;  1XMQ Q;  2PQA B;  2ZJQ A;  2JA6 H;  2Z8L A;  1S5C D;  2LMC B;  4RH6 A;  4A3F H;  3OMC A;  1IBM Q;  1S72 A;  1PFN A;  1Q82 C;  1PFS A;  3HOU G;  3S17 B;  1A3V A;  2PW5 A;  4IPC A;  5C5L A;  4PZ6 A;  3URY A;  2WP8 J;  5LMN L;  1D8L A;  3CF5 A;  3MXN A;  3FHW A;  2F0K A;  4MIU A;  4R4O A;  2OQ0 A;  4N9T A;  3F2B A;  3HOZ H;  4BBS B;  2VUM B;  1EWH A;  1R4P B;  3MXP A;  2QF7 A;  2NVT B;  3U9S A;  5M3M H;  1TWF B;  2K28 A;  1HTP A;  4MNO A;  3HOY G;  5IGF A;  5D65 A;  1PHJ A;  3HGB A;  1JT8 A;  2EJG C;  3GTL B;  4YCU A;  2KED A;  5I9O A;  1EY6 A;  3UE1 A;  1TS3 A;  4QL5 A;  1SMY C;  1PYS B;  3G4S A;  4DV7 Q;  2JA5 G;  3GTM H;  2PMZ B;  1ZKO A;  1SNQ A;  1Q7Y C;  1QIL A;  1EYC A;  3KOJ A;  2EYH A;  3KF6 A;  4A3C G;  3W1G A;  1G2T A;  3FDT A;  3HP3 A;  4KY5 A;  1PTO B;  3DM3 A;  3D4R A;  2A1A A;  3VYU A;  4KJN A;  3PIO A;  3GTJ B;  1XTC D;  3Q8D A;  1WCM B;  3SR1 A;  3NTK A;  2UU9 Q;  3DMU A;  3MZ5 A;  3SXH A;  1P8L A;  3HOW G;  3VR2 A;  1STA A;  1LTI D;  4GKJ L;  5M5W B;  3UDG A;  4FDB A;  1Q3L A;  1B3A A;  3S1M B;  1JWU D;  1QVG A;  2HT1 A;  4DR2 Q;  2UXC Q;  2CH4 W;  4CKC A;  2KEN A;  2LXJ A;  1JOR A;  2ZTE A;  4RGN A;  5JPN C;  3V2T A;  2CHB D;  3GTO B;  5FLM G;  1LTT D;  1YHB A;  4X62 Q;  5KYI A;  4JOI C;  3NQI A;  1GOZ A;  3M3Y H;  2GVB A;  3SDZ A;  2WKC A;  3K7A H;  4LWC A;  2FMC A;  4K2K A;  1O78 A;  2MP1 A;  1W3S A;  4JI3 L;  2DNE A;  4X3K A;  5CV6 A;  1CSP A;  3I8Z A;  3Q0A A;  1N36 L;  3S15 H;  5LL6 S;  4JI4 L;  1E2W A;  5EQ0 A;  1HNX L;  2A68 D;  1I6H B;  1OO9 B;  2DUD A;  1EIY B;  2UUB Q;  2ZTD A;  2E5L L;  4KD3 A;  1EQT A;  4DV6 L;  2R92 H;  5E4W C;  4WJW A;  3GTL H;  1I4R A;  3PUZ A;  2KBN A;  1D5M C;  3PIO 3;  3BDL A;  1SEB D;  1GUN A;  3BG3 A;  1CT1 D;  3HKZ E;  1QE6 A;  2F0E A;  1HQM C;  4QJF A;  1F2L A;  2K5Q A;  4XQQ A;  1SSO A;  1VQO A;  4E6I A;  4NP5 A;  4EQN A;  2A6E D;  4DR6 L;  4AYB G;  4F87 A;  5IT9 c;  4QQB X;  4LF4 Q;  4C3I H;  1HFN A;  3CCV A;  1A62 A;  3I4N B;  4JI7 L;  3GTJ H;  4P73 A;  4IFD I;  2B2U C;  5EKL A;  1CQV A;  3NWS A;  3PIP A;  4A3J H;  4DAP A;  4RCN A;  4GOP B;  4MN3 A;  3T1Y L;  1DOK A;  2L0C A;  1FL0 A;  1T9H A;  1EZ6 A;  3A54 A;  3S1M H;  4ZCK A;  1H9J A;  4IUV A;  4N8F A;  3KLS X;  2ICI A;  2RDG A;  5DEH A;  4K14 A;  1RF2 D;  3BVZ A;  4JOI A;  1BCP D;  1HR0 L;  3IAY A;  4A3G G;  1XWE A;  3H0G G;  3ND8 A;  1Y8O B;  4B3M Q;  1CKO A;  1PDQ A;  4M1U B;  1EIF A;  2JXM B;  1E0B A;  1Q1E A;  4G7O C;  3QJY A;  1HUN A;  1LTA D;  1YHQ A;  1QUQ B;  5C0X I;  2JA8 B;  3F1Z A;  3I4L A;  2F0F A;  1WTW A;  4BY1 H;  4JBM A;  1SYD A;  4IUP A;  3PMF A;  3I4M H;  2IHF A;  1C48 A;  3EVQ A;  3A8I E;  3I7F A;  2F0D A;  4EVO A;  2K5V A;  1XPO A;  4L5T A;  3I4O A;  4DAM A;  4JVZ A;  1U9R A;  1EQQ A;  1HNW Q;  4ZKB B;  2YV5 A;  2EJM A;  1HR0 W;  4XTC S;  2EE1 A;  4G57 A;  4XYQ A;  2NB0 A;  4GLA C;  2PYK A;  3PIP 3;  4FF2 A;  2Z0S A;  3D31 A;  3C3L A;  2F0H A;  1S40 A;  5EPJ A;  4A3D G;  3I73 A;  2FJ2 A;  2JA7 B;  3OYY A;  1WOC A;  2D62 A;  4H7B A;  2B2U A;  4A93 B;  3D0F A;  2QGQ A;  1H9S B;  2NVQ H;  4LFC L;  4LF6 Q;  5EPL A;  4JK1 C;  1VQH A;  3V05 A;  2BE5 C;  3BDC A;  4UHV A;  4F8M A;  1KLU D;  2E2J B;  1ZEQ X;  1PH6 A;  2LXK A;  4NXN Q;  5D14 A;  1EU3 A;  2KCM A;  3J81 c;  1GO3 E;  4DK6 C;  2KQ3 A;  5DM6 3;  1EQR A;  2D2C C;  5I6W A;  3K5M A;  2OTL A;  4DV0 L;  1KAB A;  5J3B A;  5I4D A;  4DR5 L;  3FKI G;  3KDF B;  2D5D A;  4BY7 G;  1MJC A;  2R3Z A;  4EQO A;  5C3E G;  1JWM D;  3GV6 A;  2JJQ A;  4A3E B;  3CKI B;  3GTP H;  1G29 1;  2J7Z A;  2OF1 A;  2HQE A;  2R7F A;  3E6Z X;  3QO2 A;  3NEL A;  3K0Y A;  1T5X D;  3TP5 A;  1B70 B;  3MXU A;  1B9M A;  3MEH A;  2F0T A;  4X3U A;  4ZLT F;  1PFB A;  1PXU A;  3PO2 G;  1GUW A;  3EFX D;  3RLO A;  2O5I C;  1N33 L;  4YWM A;  1SYC A;  2ZJR A;  1EOT A;  3VYT A;  3K59 A;  1SYF A;  2KCN A;  3DHQ A;  4HR7 B;  2EDG A;  4DR4 L;  4OO1 I;  4Q5V A;  1IYV A;  3HOV H;  1NMG A;  3RZO H;  1EL0 A;  4APV A;  5J1Z A;  2ES2 A;  5IYD H;  1TS5 A;  1PRT D;  5K36 G;  4R4C A;  1BUV T;  3RD4 A;  2I07 B;  2HHH Q;  2Q8I B;  5KGU A;  1STY A;  4C1N I;  3S24 A;  3HOU B;  1VQB A;  4YHH L;  5JEA H;  2PMZ E;  4A93 H;  2N55 A;  2HDM A;  3K0X A;  1VQ4 A;  1I4X A;  3OTO L;  1YHA A;  2OXP A;  4HCS A;  5IY0 A;  1DD2 A;  1QNU A;  3W3A A;  3CC7 A;  2SOB A;  4DPG A;  3VR5 A;  2K01 A;  2ZTC A;  1AZP A;  2E2J H;  1BR9 A;  1ONL A;  1SR3 A;  1QWY A;  2YU9 B;  4X3T A;  1BBX C;  1JMC A;  4GZY C;  1NY4 A;  3RUZ A;  3HOY B;  1JCK B;  1B1Z A;  2A68 C;  2R6G A;  1U4R A;  1F9S A;  2KOL A;  5FO8 B;  5A35 A;  3DLL A;  1PH2 A;  5IP9 H;  3N6R A;  1Y1W G;  1OXX K;  2NN6 H;  2NWG A;  4L6T B;  4MTN A;  1XMQ L;  3SK8 A;  2K1B A;  2RCN A;  3KJO A;  5C6A A;  1S5D D;  2JA5 B;  2WB1 G;  1UE7 A;  1EY0 A;  2ZXO A;  4DXG A;  4C3H B;  3IL8 A;  1VQ5 A;  4BBR G;  5IIF A;  3E3X A;  4FP5 D;  1DXM A;  2L1B A;  2K52 A;  1L1O C;  4FNF A;  3PO3 G;  2B2V C;  1CUK A;  4JI2 Q;  4IO9 A;  1IBL Q;  1CZW A;  4TQU S;  1B4O A;  3T1H Q;  4LF7 Q;  3TS2 A;  1AE3 A;  2DY7 A;  3TEH B;  3HOW B;  3TME A;  4EX5 A;  3EQL C;  4JBW A;  1MIU A;  1PMR A;  1VQ7 A;  1VQM A;  2RHQ B;  4QUF A;  1UE5 A;  1V8Q A;  5IOD A;  2L15 A;  2A69 D;  4DV7 L;  2AUK A;  3PV0 A;  2WV6 D;  2L5T A;  2A6H D;  3M85 A;  1BCP C;  2Q8R E;  2PCF B;  3HOU H;  1LV9 A;  1PTO D;  1QNK A;  2FIN B;  2K5D A;  4CDC C;  4DAY A;  1XPR A;  4G4K A;  4RFB A;  3S1R B;  2PZU A;  3F2U A;  3OOC A;  3KLW A;  2SDF A;  4LK1 C;  2UU9 L;  4X66 Q;  2VY3 A;  1EIH A;  3CU7 A;  2EYL A;  4H44 C;  1Q8K A;  2G9H D;  1VF7 A;  2B63 G;  3HOY H;  2RDF A;  4JG2 A;  4ZUI A;  1Y1V G;  2UXC L;  4RMF A;  5DM7 3;  3KF8 A;  5CR3 A;  4NXM Q;  3PCO B;  3I55 A;  1OXS C;  1YJN A;  4X62 L;  1SNM A;  1L1O A;  3M9B A;  3U4Z A;  2B2V A;  1UEA B;  1JJG A;  2CKZ B;  3VYS A;  4AYB B;  3HS0 C;  3ULP A;  2RKS A;  2IWH A;  4XXE A;  1OTC A;  1J8I A;  3UE0 A;  5BR8 Q;  1VQP A;  3HOW H;  2F0V A;  2UUB L;  5A2Q L;  5IYC H;  1SRO A;  4A3M H;  2F0M A;  3D4W A;  1TWG H;  2K4K A;  3S1Q H;  4P72 A;  3W2D A;  5M5Y B;  5M5X H;  3DXJ C;  4OWX B;  1CKN A;  2ENB A;  1O7L A;  1QVC A;  1GUS A;  3D6C A;  1L0W A;  4GLX A;  2R7D A;  4YWL A;  4NKL A;  4QB4 A;  4A3G B;  1D6E C;  5FK9 C;  3H0G B;  4KN7 C;  3I91 A;  5FKA C;  1VMP A;  5NUC A;  1RD9 D;  3ITP A;  1GKH A;  2IT1 A;  1CM9 A;  4HSV A;  3MEF A;  1EQV A;  5EKK A;  2UXD Q;  2EXZ A;  4LF4 L;  1PYW D;  1X3P A;  3CCJ A;  4JI5 Q;  1T5E A;  3K8A A;  3GTQ H;  3KBG A;  3FPP A;  2AWN A;  3K5N A;  4RCO A;  4A3I H;  1JOK A;  2SNM A;  2SNS A;  4IQZ A;  1GHK A;  1TWA H;  1BBU A;  3CW2 C;  4DK3 C;  1SNC A;  4PQX A;  3TDQ A;  2D0P A;  1V9P A;  4K5X A;  4PZ8 A;  4R4I A;  4FF3 A;  4LW1 A;  3R2I A;  1IL2 A;  3VA7 A;  2F4V L;  1X3G A;  1SE8 A;  3STB D;  1SFO H;  2DJF C;  5C44 H;  3BYT B;  3QIA A;  5C4J B;  1ICF B;  1JJ2 A;  2WFW A;  4BS9 A;  4HIM A;  2Z4H A;  4JBJ A;  1LT6 D;  1XPU A;  1VQ6 A;  4LF5 Q;  1PRT C;  2R7Z G;  4A3D B;  5GAH C;  2F3W A;  3K5O A;  1IZ6 A;  3HZX A;  1DZ1 A;  3U50 C;  4IUQ A;  4HIK A;  4NW2 A;  1L0X B;  2F1M A;  1BVS A;  3OIQ A;  5EAY A;  1HNW L;  2TSS A;  2EZV A;  2CFM A;  4OWW B;  5M5Y H;  2QDL A;  4H02 A;  4XYO A;  4LFA Q;  1LTG D;  3BZC A;  4F88 A;  2EYJ A;  2PNH A;  3FKI B;  3MHB A;  4HED A;  4HMJ A;  5C0X H;  2FMM A;  1SYE A;  3TS0 A;  4BY7 B;  4A3G H;  5C3E B;  2ALY B;  1VQ9 A;  2NN6 I;  2HQL A;  4KD4 A;  2AMC B;  4IUN A;  1QJO A;  3GTG H;  1ENC A;  2CW0 C;  2Q2U A;  3A56 A;  2RSN A;  4RAU C;  3DWA A;  3J80 c;  1O7I A;  4LF6 L;  1PH1 A;  3RZD B;  3P1H A;  3D6W A;  3MFY A;  1Y8P B;  3PO2 B;  4HAE A;  4NXN L;  2E75 C;  1TXY A;  3P20 A;  1HA5 A;  4CGY B;  4U67 3;  2JA9 A;  3EJI A;  1LT5 D;  3ICE A;  1FVI A;  1B2T A;  3KFU A;  3ZJY C;  1ILP A;  5IGD A;  1NCV A;  3T56 B;  4LNQ A;  3E9I A;  3K81 C;  1A2T A;  1JR0 D;  1GUT A;  3BDO A;  2CWP A;  4LF9 Q;  4XQJ A;  2RBM A;  1VMC A;  4EGV A;  2K5H A;  3NWT A;  3CP0 A;  4YCV A;  1XYI A;  4HJ5 A;  1SRU A;  2RSO A;  2QEJ C;  2A6H C;  3CPW A;  3Q22 A;  1EWC A;  1LTL A;  4POF A;  1S4Z A;  3SK5 A;  1GUG A;  4LFB Q;  4LAA A;  4GLV B;  2JE6 I;  3MWY W;  4C3J G;  2O4X A;  4UP9 A;  2KEC A;  5IP7 G;  5M3F B;  4O0A A;  5IGB A;  2XN9 C;  3J81 L;  4GN3 B;  1CSQ A;  2F0S A;  3KJP A;  2NVX B;  1CA6 A;  4DNT B;  1TY2 A;  1N34 Q;  1ZYR D;  2IW3 A;  4J8Q A;  3DUZ A;  1ESF A;  1XJV A;  3R3O A;  2R93 H;  4CBV A;  3A5U A;  3JAM L;  4R4Q A;  2PQA A;  1FGB D;  1L0Y B;  1SXT A;  2Z6K C;  3NP8 A;  3E9H A;  5FLX E;  1Y1W B;  4C3H G;  3CCL A;  2IX0 A;  1RKN A;  3KUP A;  4CDD C;  5LMN W;  2PNR C;  4KHZ A;  3SEB A;  5AJ3 Q;  2HHH L;  2VNU D;  2WB1 B;  4J15 A;  4HCE A;  2JN4 A;  1VQC A;  3H91 A;  1GM5 A;  2PZW A;  1IKM A;  1SNO A;  4BBR B;  4DF7 A;  4A3B G;  4JW0 A;  3B6Y A;  1BKB A;  1KC8 C;  2KCC A;  3J7A V;  1PTO F;  3PO3 B;  4OO1 H;  3K7U C;  1B9N A;  4A3L H;  1DOL A;  4QIW E;  3D4D A;  5LMU Q;  1B3Q A;  3CPF A;  1TWH H;  2N78 A;  2YTY A;  4JBK A;  4GNX B;  1HXY D;  2E76 C;  2ZXP A;  4X65 Q;  1X65 A;  4DN4 M;  3K5L A;  4BA2 I;  2HD3 A;  2ZM6 Q;  3A5Z B;  1GD7 A;  1EYD A;  2VXW A;  1J5E Q;  2AKW B;  4OHJ A;  4X6A H;  1KDC A;  2EPB A;  1SNP A;  3HKS A;  5EGT A;  4KHP L;  4IFD J;  1E7Z A;  1TQO A;  3WDN A;  4IAL A;  1H9R A;  5ELE A;  3S17 H;  1G6Z A;  1ENF A;  3C1F A;  1KDA A;  1EU4 A;  2F0I A;  4B3T Q;  1EOV A;  3F2D A;  1YNN D;  3KLR A;  4CJ0 B;  4JI2 L;  1IBL L;  3AFP A;  4BBS H;  5D3I B;  2VUM H;  3T1H L;  1FNW A;  4JI1 Q;  4LF7 L;  1VQJ A;  2NVT H;  3IFD A;  4AYB E;  1E22 A;  1BXT A;  1TWF H;  2B3G A;  4RGM A;  4ZYS A;  3S2D B;  1QOH A;  3CAM A;  5T1I A;  4HIO A;  2KJX A;  4KKT A;  2Z6K A;  1ROD A;  1D2B A;  2B63 B;  3Q24 A;  1QCB D;  3S2H B;  4F7X A;  1I3Q B;  1Y1V B;  2MQH A;  1A6X A;  2AWO A;  1K3B C;  1DYQ A;  2C5C A;  2M2L A;  4Z9C B;  1D5Z C;  2XWJ B;  3OMG A;  1YNJ D;  1YIJ A;  1IW7 C;  2KUM A;  3RN5 A;  3DM1 A;  1X56 A;  4IOC A;  4P74 A;  1FGU A;  4BWG B;  1SJE D;  3STB C;  2CWA A;  2RCF A;  2E2I B;  1PTO H;  4A3K G;  1AH9 A;  4BBR H;  1P16 A;  4RA8 A;  3S16 B;  3ERQ A;  1YBY A;  1STN A;  1WCM H;  1TT2 A;  4V0B A;  3NTI A;  4X66 L;  2Q2I A;  5M5W H;  1K73 C;  1KDB A;  1EY5 A;  2VQE Q;  1I4G A;  2CQO A;  1LYL A;  1MKH A;  4XQN A;  1NSN S;  3C46 A;  1STG A;  4X3S A;  2WAQ G;  2BCO A;  1PZK D;  2Q2H A;  4OX9 Q;  5FOB B;  1LTS D;  2DGY A;  1PZJ D;  1I4H A;  3GTO H;  4NXM L;  3L0O A;  1G2S A;  3S1N B;  3SK4 A;  3TN2 A;  3UI2 A;  4IUU A;  5IGG A;  3G6E A;  3BZD B;  3K80 C;  1FD7 D;  4YIJ A;  1X32 A;  2OEO A;  1WD0 A;  3QB3 A;  3SK6 A;  1V1Q A;  3NBI A;  1K8O A;  1I6H H;  2F0U A;  4K6L A;  5BR8 L;  1TKW B;  5G3L D;  5JOB A;  4KHV A;  5TSS A;  4RHS A;  4A76 A;  4DR1 Q;  1XMO Q;  3OPO A;  2P5Z X;  3W5O A;  1AEX A;  1Y1V H;  1LTR D;  3ZYY X;  5CGK A;  1Z6H A;  2X69 A;  3J81 i;  1J9O A;  4YWK A;  1XTD A;  4DV5 Q;  3TZD A;  3WOF A;  2ZT9 C;  3NBH B;  3RMH A;  2JA6 G;  2MO0 A;  2UXD L;  3NEM A;  1QZH A;  1CTM A;  2F0O A;  4JI5 L;  4ZKC B;  3I4N H;  2R7Z B;  3JAM i;  2AQ3 B;  2BOS A;  2CCZ A;  3A74 A;  2AQ1 B;  4DUY Q;  3CHB D;  1AZQ A;  2XIW A;  2C9O A;  2EYF A;  1HH2 P;  3S9W A;  4EQP A;  5I2X A;  2IY5 B;  4CDF C;  1K8G A;  2L11 A;  1SE2 A;  3HOZ G;  1SMX A;  1UEB A;  3BVG A;  4PV1 C;  5FJ8 H;  2X6L A;  1Q81 C;  1ZYR C;  2AUJ D;  5I9P A;  1I5F A;  4GN4 B;  4K5W A;  1LLR D;  3I70 A;  4HJ9 A;  1D1K A;  1BO0 A;  1EFW A;  2I46 A;  2JA8 H;  2NTS A;  1VQN A;  1NAP A;  1PYB A;  2K33 A;  4LF5 L;  4XDX A;  1WVL A;  1H9S A;  3SE0 A;  2A19 A;  4O1N A;  3IRB A;  1GUO A;  4OL7 A;  1IYU A;  2B29 A;  3AU7 A;  4LUV A;  3VR6 A;  2IHE A;  2N88 A;  3UDF A;  2VB3 X;  2BA0 A;  2PZT A;  1NBW A;  4R8N A;  4A75 A;  4DNR B;  5IWA Q;  3F8T A;  1JOO A;  5ELF A;  5JAV A;  1EWI A;  3KDF A;  4LFA L;  1V43 A;  4O42 A;  2NZO A;  3P7J A;  1HPC A;  3X3N A;  2PW7 A;  2MFI A;  3MFG A;  4HMI A;  4LUZ A;  4RKB A;  5ISR A;  2JA7 H;  1C9O A;  3E5S A;  1Z47 A;  2PI2 A;  3M4O B;  5JVH 3;  4IPD A;  1MI2 A;  1F9Q A;  1WFQ A;  2F0Q A;  2K5N A;  1TS2 A;  2EY6 A;  2WB1 E;  1KHI A;  4AIM A;  1LT4 D;  2F0G A;  4DFA A;  5M3F G;  1H9M A;  3LGJ A;  2Z1C A;  4ZUJ A;  2O5J C;  4K6D A;  1YNN C;  1MBY A;  4C3J B;  1ENA A;  3NQT A;  4NDX A;  1X3F A;  1Q86 C;  2F4I A;  3RN2 A;  1DGS A;  1U5K A;  1SDF A;  5ELN A;  3L2P A;  2RF4 A;  2B39 A; 
#chains in the Genus database with same CATH homology
 1VQD A;  4Y7N H;  1JT8 A;  3K8A A;  3GTQ H;  1IBM L;  4YCU A;  4GOP A;  4OON A;  1J6Q A;  2MO1 A;  3TRZ A;  2AWN A;  3ERS X;  3UE1 A;  5IYB H;  2KHJ A;  4A3I H;  4A3E H;  4QL5 A;  2UUA Q;  4LF9 L;  3NEN A;  2R92 G;  3S2D H;  1PYS B;  3G4S A;  1PVO A;  4DV7 Q;  2JA5 G;  4K0K Q;  1TWA H;  3GTM H;  2B63 H;  1BBU A;  1VQF A;  3CW2 C;  1Q7Y C;  4DK3 C;  3S2H H;  1K8A C;  1I3Q H;  3KOJ A;  4DV4 Q;  2D0P A;  1V9P A;  2I5H A;  3KF6 A;  4IPH A;  4A3C G;  4PZ8 A;  2Y0S E;  4R4I A;  4UPA A;  3W1G A;  5GAG C;  4LW1 A;  3M4P A;  1IL2 A;  2UUC L;  2F4V L;  4NPS A;  4LFB L;  2K75 A;  3DM3 A;  1IXR A;  1X3G A;  2A1A A;  3FP9 A;  2UXB L;  1QUQ A;  1SE8 A;  3STB D;  3PIO A;  4HJ8 A;  3Q8D A;  1SFO H;  4JCV E;  2E2I H;  4A3B H;  4IJH A;  1HJP A;  4A3F G;  1X9N A;  5C44 H;  4JI3 Q;  2UU9 Q;  3HOW G;  1P8L A;  1JJ2 A;  2WFW A;  1N34 L;  3S16 H;  3GDE A;  4B3S Q;  4HIM A;  4GKJ L;  3HFZ B;  3PF5 A;  2ASB A;  3UDG A;  4FDB A;  4JBJ A;  1TWC H;  1XPU A;  1VQ6 A;  1I50 H;  4LF5 Q;  3HOX H;  2R7Z G;  5GAH C;  4A3J G;  1QVG A;  2HT1 A;  4DR2 Q;  1W2B A;  1LM0 A;  1IZ6 A;  1SN8 A;  1YEZ A;  2Y0S G;  2UXC Q;  3I2Z A;  3U50 C;  3CCQ A;  1XNQ L;  4HIK A;  2KEN A;  2LXJ A;  1E1T A;  1BVS A;  2ZTE A;  4JYA Q;  5EAY A;  5FLM G;  1YHB A;  5M3M G;  4X62 Q;  4DV2 Q;  4JOI C;  1D7Q A;  3M3Y H;  1KRT A;  2GVB A;  2RHS B;  3K7A H;  1GVP A;  4LWC A;  5E7N A;  1YNX A;  3WWV A;  2CFM A;  4JI0 L;  4OWW B;  1W3S A;  1G6P A;  4JI3 L;  5M5Y H;  4DV1 Q;  4H02 A;  3TRE A;  1CSP A;  4LFA Q;  4YY3 Q;  3S1N H;  1UWV A;  3BZC A;  3PUX A;  3BU2 A;  4R4T A;  2PNH A;  4KI0 A;  3TS0 A;  1SLJ A;  5LMU L;  1N36 L;  2YU9 H;  3S15 H;  2R93 G;  4A3G H;  2ALY B;  4BY1 G;  4JI4 L;  1VQ9 A;  2NN6 I;  1N32 Q;  2HQL A;  1HNX L;  4DR2 L;  3I4M G;  2QEX A;  2AMC B;  3EIV A;  3JAM c;  2DUD A;  1EIY B;  4X65 L;  2UUB Q;  1EUJ A;  2ZTD A;  4AH6 A;  2E5L L;  3GTG H;  2Q2U A;  2ZM6 L;  4DV6 L;  2R92 H;  1NE3 A;  3W1B A;  3J80 c;  2MNA A;  3J7Z C;  1J5E L;  1HZA A;  1O7I A;  3GD7 A;  1VQ8 A;  1VQK A;  4LF6 L;  3GTL H;  3PUZ A;  1PH1 A;  2KBN A;  5LMN Q;  2JA5 H;  4AQY L;  4C3H H;  1VQA A;  4HID A;  4OO1 G;  3HKZ E;  4NXN L;  4A3L G;  4QJF A;  1TXY A;  4A3C H;  3G48 A;  4GN5 A;  2JA9 A;  1A8V A;  1VQO A;  4B3T L;  4MZ9 A;  4LF8 Q;  3HOX G;  1MJE A;  4JI6 Q;  1HR0 Q;  3ICE A;  1FVI A;  4DR6 L;  2YTX A;  3ZJY C;  2EQS A;  4DV3 L;  5H1S E;  4AYB G;  3KFU A;  5IT9 c;  2C35 B;  4LF4 Q;  4QQB X;  3L7Z C;  4C3I H;  4LNQ A;  3E9I A;  1UE1 A;  3K81 C;  4JI1 L;  3CCV A;  1A62 A;  1PA6 A;  4JI7 L;  2H5X A;  3GTJ H;  2CWP A;  4LF9 Q;  1YI2 A;  4P73 A;  4IFD I;  1Q1B A;  2K5H A;  3PIP A;  1KQS A;  2D0O A;  3CP0 A;  1KIX A;  4YCV A;  2R7Z H;  4A3J H;  4GOP B;  3T1Y L;  4HJ5 A;  1FL0 A;  1T9H A;  2XTI A;  2EIF A;  2VQF L;  1SRU A;  3CPW A;  3S1M H;  1LTL A;  4POF A;  1PH4 A;  3HOY G;  5JEA J;  2UUC Q;  2E8G A;  1HNZ L;  4LFB Q;  4GLV B;  2VW9 A;  2JE6 I;  1RL2 A;  3GTK H;  2YTV A;  4JOI A;  4A3G G;  4UP9 A;  5FLM H;  1HR0 L;  3H3V H;  3H0G G;  3PGZ A;  5IP7 G;  2UXB Q;  4O0A A;  3CCS A;  4BBS G;  4B3M Q;  2VUM G;  4GN3 B;  1CSQ A;  2I5L X;  2JK8 A;  1CKO A;  3KJP A;  2IX1 A;  1EIF A;  2VS1 A;  3I56 A;  1N34 Q;  5GQO A;  1Q1E A;  3ULJ A;  3CCM A;  1L2F A;  4GKJ Q;  1YHQ A;  1QUQ B;  5C0X I;  1XJV A;  3F1Z A;  3S1R H;  4UY8 C;  3ER0 A;  2R93 H;  1ASY A;  1YJW A;  3A5U A;  4L5R C;  4PZ7 A;  1E1O A;  4R4Q A;  4JBM A;  2PQA A;  4BY1 H;  1RIP A;  2Z6K C;  3E9H A;  2OTJ A;  3CCL A;  1YZ6 A;  2IHF A;  2IX0 A;  3I4M H;  5LMN W;  2VQE L;  3AYH B;  4KHZ A;  1XNQ Q;  3I7F A;  1OXT A;  5AJ3 Q;  2HHH L;  2VNU D;  4J15 A;  3TQY A;  2K5V A;  1XPO A;  4IJL A;  4JI8 L;  1VQC A;  4L5T A;  3I4O A;  4DAM A;  1GM5 A;  4KHP Q;  1G51 A;  4A3B G;  4OX9 L;  4B3R L;  2JQO A;  3B6Y A;  1EQQ A;  3CMA A;  1BKB A;  1KC8 C;  4JV5 L;  1HNW Q;  2YV5 A;  4B3M L;  4JI0 Q;  3VDY A;  1HR0 W;  4XTC S;  4ALP A;  3K7U C;  4A3L H;  2KCT A;  4GLA C;  1NMF A;  4QIW E;  4BXX H;  4DAY B;  1WCM G;  2GN5 A;  2FXQ A;  3CPF A;  5LMU Q;  1N36 Q;  3HOV G;  4C2M H;  2Z0S A;  1TWH H;  2N78 A;  2YTY A;  4JBK A;  2E2H H;  4GNX B;  4JI4 Q;  1X54 A;  1C7Y A;  3M7N A;  3D31 A;  1PV4 A;  4P71 A;  1NJI C;  5IYD G;  1HNX Q;  1VQE A;  1FJG L;  1S40 A;  5HGQ A;  1Y14 B;  1OXU A;  3AFQ A;  4A3D G;  4X65 Q;  1X65 A;  1X6O A;  2E5L Q;  3OYY A;  1WOC A;  2D62 A;  4BA2 I;  2ZM6 Q;  2V1C C;  3A5Z B;  4P75 A;  1GD7 A;  3D0F A;  2QGQ A;  3BZK A;  5AJ3 L;  4DV6 Q;  2NVQ H;  4LFC L;  1J5E Q;  2AKW B;  4X6A H;  4LF6 Q;  1VS0 A;  5JEA G;  3GO5 A;  3M4O H;  1VQH A;  1PH9 A;  3HKS A;  4KHP L;  4IFD J;  4AQY Q;  1E7Z A;  1PH8 A;  4POG A;  2JEA I;  2EXD A;  4DNI A;  1PH5 A;  4Y52 H;  3S17 H;  4X64 L;  3CC4 A;  4DR1 L;  1PH6 A;  2LXK A;  4PG3 A;  4NXN Q;  3KF8 B;  3J80 i;  1XMO L;  2KCM A;  3J81 c;  3BJU A;  1GO3 E;  4B3T Q;  1L1O B;  1WI5 A;  1A0I A;  4DK6 C;  1EOV A;  3F2D A;  1EQR A;  4C3J H;  2OTL A;  1N33 Q;  4DR6 Q;  4GKK L;  4DV3 Q;  4JI2 L;  2A8V A;  3JC6 6;  3H0G H;  5IP7 H;  4DV0 L;  1IBL L;  5J3B A;  3AFP A;  4BBS H;  4DR5 L;  3FKI G;  3KDF B;  2VUM H;  3CCR A;  3T1H L;  4BY7 G;  1MJC A;  4JI1 Q;  4LF7 L;  1VQJ A;  2NVT H;  3CC2 A;  4AYB E;  5C3E G;  4JI7 Q;  1E22 A;  1TWF H;  2B3G A;  4UP8 A;  2JEB I;  2JJQ A;  3CAM A;  3GTP H;  1G29 1;  4HIO A;  2R7F A;  1KAW A;  2Z6K A;  3T1Y Q;  3ULL A;  3NEL A;  1N8R C;  2VQF Q;  4DUY L;  2NZH A;  2MQH A;  2AWO A;  4OXP A;  1B70 B;  2LSS A;  4BXX G;  1CKN B;  3MXN B;  1HNZ Q;  1YIJ A;  3PO2 G;  4QY7 A;  3RN5 A;  3RLO A;  1X56 A;  1N33 L;  4IOC A;  4P74 A;  1FGU A;  4YWM A;  2HIX A;  2ZJR A;  4WJ4 A;  3STB C;  2N49 A;  1S3O A;  2CWA A;  4DR4 L;  1B7Y B;  4DR7 L;  4OO1 I;  4A3K G;  1AH9 A;  1UE6 A;  4BBR H;  3PF4 A;  1A63 A;  1P16 A;  5JJI A;  2OCE A;  4GS3 A;  4IPG A;  1YBY A;  1WCM H;  4A4I A;  1VQL A;  3HOV H;  1NMG A;  4DR3 L;  3UDI A;  3RZO H;  5C4J H;  3I4N G;  4APV A;  1XNR L;  4X66 L;  2ES2 A;  2K14 A;  2Q2I A;  5IYD H;  1NTG A;  5M5W H;  1K73 C;  1ASZ A;  4DUZ L;  2VQE Q;  3CXC A;  4A3D H;  5K36 G;  4R4C A;  2CQO A;  1LYL A;  1MKH A;  2BA1 A;  2HHH Q;  3RR5 A;  5C4X H;  3S24 A;  3U58 A;  4JI8 Q;  1VQB A;  2WAQ G;  3U4V A;  4YHH L;  1HZB A;  2VZA A;  2Q2H A;  1U0L A;  2PMZ E;  3EN2 A;  4OX9 Q;  5IE8 A;  4A93 H;  1VQG A;  2KHI A;  2DGY A;  4EQ5 A;  2F3I A;  3KF6 B;  1IBK L;  3K0X A;  4JV5 Q;  1C0A A;  1M1K C;  1VQ4 A;  1K83 H;  3OTO L;  1YHA A;  1VCI A;  5IY0 A;  3SGI A;  3GTO H;  4NXM L;  3S14 H;  5FJ8 G;  4IOA A;  3CC7 A;  4PMW A;  1K9M C;  3L0O A;  4DPG A;  1JB7 A;  1K0R A;  3CME A;  2ZTC A;  2E2J H;  3PUY A;  1N9W A;  1SR3 A;  5IWA L;  4GNX C;  3G6E A;  1QZG A;  5GAD C;  3K80 C;  4QGU A;  1JMC A;  2BH2 A;  1HNW L;  1FJG Q;  3EBE A;  1NY4 A;  2JA8 G;  3FKI H;  4NB3 A;  4UP7 A;  5JJL A;  4BY7 H;  2R6G A;  5C3E H;  5HY6 A;  3AQQ A;  1V1Q A;  3DLL A;  5IP9 H;  1PH2 A;  4KLK A;  1Y1W G;  1OXX K;  4MTN A;  4XIG S;  1XMQ L;  1I94 L;  4LFC Q;  1I6H H;  1E3P A;  2RCN A;  3KJO A;  3CCU A;  4TVA B;  5BR8 L;  2WB1 G;  1UE7 A;  1LUZ A;  4A76 A;  4DKA C;  4X64 Q;  4DR1 Q;  3RLF A;  1XMO Q;  1VQ5 A;  4BBR G;  1KRS A;  2K50 A;  3RZD H;  3W5O A;  2K52 A;  1L1O C;  3CQZ H;  3PO3 G;  3RNU A;  3PO2 H;  1Y1V H;  2ZJP A;  4GKK Q;  1CUK A;  4JI2 Q;  1KD1 C;  4BA1 I;  4DV0 Q;  4IO9 A;  1IBL Q;  4TQU S;  4DR5 Q;  3J7A 5;  3T1H Q;  4LF7 Q;  3J81 i;  3TS2 A;  4YWK A;  4A3K H;  1XTD A;  1AE3 A;  4DV5 Q;  1X3E A;  3TEH B;  3RLN A;  3CD6 A;  3NBH B;  5C4X G;  2JA6 G;  2MO0 A;  2YYZ A;  4EX5 A;  2UXD L;  3NEM A;  4JBW A;  1QZH A;  4JI5 L;  1MIU A;  1EYG A;  2JA7 G;  4RG1 A;  3I4N H;  4A93 G;  5IYC G;  1VQ7 A;  3JAM i;  4A3M G;  1VQM A;  2RHQ B;  1UE5 A;  3PSI A;  3A74 A;  2CCZ A;  4DUY Q;  2UUA L;  2L15 A;  3M4Q A;  4DV7 L;  3KYH C;  3PV0 A;  4K0K L;  1YVC A;  4OWT B;  1HH2 P;  2NVY H;  1OXV A;  4WJ3 M;  2I5M X;  4ME3 A;  1X55 A;  2PI2 E;  3H3V I;  2IY5 B;  3M85 A;  2F52 A;  1K8G A;  4DV4 L;  1YJ9 A;  1PH3 A;  3G71 A;  3HOZ G;  1YIT A;  3HOU H;  1SMX A;  2I0Q A;  1UEB A;  1PH7 A;  2ATW A;  4DR4 Q;  4DR7 Q;  5FJ8 H;  4DV5 L;  5M3F H;  1Q81 C;  5IP9 G;  2N8N A;  1I5F A;  2NN6 G;  4GN4 B;  2NVX H;  1XPR A;  1JE5 A;  4HJA A;  4DR3 Q;  3KLW A;  2QA4 A;  4HJ9 A;  4GNX A;  1EFW A;  2UU9 L;  1XNR Q;  4X66 Q;  4LF4 L;  1AE2 A;  4GOP C;  2VY3 A;  5IYB G;  5C0X J;  1H95 A;  4DUZ Q;  4L5Q A;  3OW2 A;  4A3E G;  4A3I G;  2OQK A;  4B3S L;  1VQN A;  2JA8 H;  1PYB A;  4LF5 L;  4R1J A;  3F2C A;  1Q8K A;  4HJ7 A;  3H15 A;  2B63 G;  3HOY H;  1Y1W H;  1IYJ B;  2HIV A;  4JG2 A;  4YHH Q;  2A19 A;  3AEV A;  3IRB A;  3CCE A;  1Y1V G;  2UXC L;  5JJK A;  1Q46 A;  4RMF A;  1IBK Q;  2B29 A;  2WAQ E;  2ID0 A;  4LUV A;  3OTO Q;  2N3S A;  2IHE A;  4NXM Q;  5DLQ E;  3PCO B;  3UDF A;  1OXS C;  1BBW A;  1WYD A;  2BA0 A;  3I55 A;  1YJN A;  4JYA L;  4B3R Q;  4X62 L;  1NBW A;  5FLX c;  1L1O A;  3M9B A;  4DV2 L;  5GRO A;  3U4Z A;  4L5S A;  4A75 A;  1JJG A;  3PO3 H;  3PUW A;  2CKZ B;  3E0E A;  5IWA Q;  5C44 G;  3F8T A;  4DV1 L;  5GAE C;  4JC0 A;  1EWI A;  3KDF A;  4LFA L;  1V43 A;  4YY3 L;  1HZ9 A;  2NZO A;  1KL9 A;  4IFD G;  1B8A A;  2BH8 A;  1CKM A;  3ULP A;  1KXL A;  1HZC A;  3PUV A;  1I94 Q;  2MFI A;  4O2D A;  1XMQ Q;  2PQA B;  1OTC A;  2ZJQ A;  4LUZ A;  2VL6 A;  1E24 A;  2JA6 H;  1N32 L;  3UE0 A;  4A3F H;  1IBM Q;  1C9O A;  2JA7 H;  1S72 A;  4LUO A;  5BR8 Q;  1Z47 A;  2PI2 A;  1VQP A;  1VQI A;  1Q82 C;  2UUB L;  4IPD A;  5ELO A;  5IYC H;  3HOW H;  1SRO A;  1PFS A;  4A3M H;  2Q2T A;  1WFQ A;  1QVF A;  3HOU G;  1TWG H;  2K4K A;  3S1Q H;  2K5N A;  4P72 A;  2GVA A;  2AHO B;  4IPC A;  2WB1 E;  1KHI A;  4AIM A;  5M5X H;  4PZ6 A;  1M90 C;  2WP8 J;  5M3F G;  5LMN L;  1D8L A;  1CKN A;  3HKZ G;  1WJJ A;  4OWX B;  3CF5 A;  1QVC A;  3LGJ A;  1L0W A;  3J81 j;  4GLX A;  1Z9F A;  2R7D A;  4YWL A;  3FHW A;  2OWO A;  1K3R A;  4R4O A;  4YCW A;  2OQ0 A;  2XGT A;  3F2B A;  1JJC B;  3UDX A;  3HOZ H;  1Q12 A;  1X3F A;  3A0J A;  1R9T H;  5C0X G;  1Q86 C;  2F4V Q;  1GKH A;  3RN2 A;  1DGS A;  2IT1 A;  1U5K A;  4JI6 L;  4LF8 L;  5M3M H;  4MNO A;  3MEF A;  5ELN A;  3L2P A;  2UXD Q;  2RF4 A;  1PHJ A;  4JI5 Q;  3CCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...