3J81i

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
111
Chain Sequence
NTKGGKKGRRGKNDSDGPKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLKNQGELPENAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 16
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
i PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3j81i00
2EXDA 2CQOA 2HIVA 2JA7G 2NVYH 1VQ9A 2KCMA 5M3MH 4OX9Q 3PO3G 1SRUA 2D62A 5GQOA 5IYBH 1PHJA 2N78A 3HFZB 2WAQE 3NEMA 1Q8KA 1E24A 3ER0A 1PVOA 2VZAA 4BBRH 3M7NA 2VNUD 4NB3A 3RLFA 4R4QA 4JI1L 1X3EA 4K0KL 2OQKA 1S72A 4JBKA 4LUVA 3M3YH 2PQAB 4JI1Q 2H5XA 5IP9H 5ELNA 4DR5L 1CKMA 2BH8A 2I5MX 2L15A 3M85A 4K0KQ 1VQHA 1M90C 3L2PA 4POGA 3S1RH 3S1QH 1K0RA 4AYBE 1CKOA 3HOWG 1IBLL 2UU9Q 1XMQL 4QL5A 4HIDA 4GNXB 3ULPA 1PV4A 1IBKL 1IBLQ 2ID0A 2GVBA 4GOPA 1K73C 3GTPH 4DR6L 2K50A 2R6GA 3J81i 4GLXA 3S15H 1E22A 5FJ8H 1IBKQ 1A8VA 4GOPC 3KF6A 4BXXG 3HOZH 1Z9FA 2PI2A 2NVXH 1SE8A 4R4OA 2OWOA 4P72A 4C2MH 2VQEL 2YU9H 4B3TQ 1QVCA 1XNRL 1NJIC 3HKZE 1VQKA 3CCSA 4DUZL 3UE0A 4IFDJ 4OWWB 2N49A 3G71A 4AIMA 4BY1G 2VQEQ 4A3FG 3KJOA 1S3OA 2ZTEA 2ALYB 4DUZQ 2WAQG 1LUZA 4C3HH 1HZ9A 1VQ4A 2C35B 5M3MG 3PF5A 1E3PA 2YV5A 3J81c 2EIFA 3VDYA 4A93H 4IPDA 3S24A 1YBYA 2XTIA 4QJFA 3TREA 4X66L 5HY6A 4BBRG 4YY3L 4RG1A 3CXCA 4LF8L 2UXDQ 4FDBA 4BA1I 3H0GH 1MKHA 4JI7Q 1XPUA 4JOIA 1XJVA 4DR4Q 3FKIG 3HKSA 3UE1A 4X66Q 4LF8Q 4A3KH 5JJKA 3MXNB 1N32L 1OXSC 3CC4A 4DV1L 4LF4L 4JOIC 3M4PA 4AYBG 2F52A 5IP9G 1B70B 4IPGA 3BU2A 1N32Q 3AYHB 2ZJRA 3S16H 3I4MH 4DV1Q 4LF4Q 3RR5A 2CKZB 2NZOA 4OO1I 4B3ML 1I94L 1OXVA 3UDIA 3K8AA 3J80c 3M4OH 1IZ6A 2DUDA 1JJCB 1I5FA 4B3MQ 5C0XI 1I94Q 1A62A 1N9WA 2JA5H 2K14A 4LFCL 2IHEA 1VQPA 2Y0SG 3B6YA 1SMXA 2WB1E 3HKZG 1G51A 3STBC 4A3CH 1N34L 1WYDA 1MJCA 1KRSA 2NVQH 3T1HQ 5ELOA 1CSPA 1HZBA 4DV4L 1PH2A 4DV6Q 1VQMA 1N34Q 3HOUG 1HR0L 1X3GA 2ZTDA 3PUYA 4IPHA 1HH2P 2Q2TA 4DV4Q 1VQLA 3NELA 1KD1C 3BZCA 1JJ2A 1D7QA 1VQJA 4X64L 1BVSA 1SROA 3NBHB 2QA4A 3PO2G 4A93G 4LFBQ 3CP0A 5C44G 1NTGA 2PNHA 4JC0A 2F4VQ 2R92H 4X64Q 4BBSH 2MO1A 3H0GG 4ALPA 4A3MH 4OO1G 4DK3C 3HOXH 2E5LL 3Q8DA 4JI5Q 1E7ZA 1A63A 1K3RA 3CCQA 3TRZA 5H1SE 1RIPA 1XMOL 4DV0L 2CFMA 4R4IA 1D8LA 2LXKA 4YCUA 1HZAA 5C0XG 1ASZA 3RZOH 1J6QA 4KHZA 3W1BA 4DR2L 4KHPQ 1A0IA 4AH6A 1XMOQ 3GTKH 1PYBA 1Y14B 3CAMA 3CMAA 3CQZH 4A3DH 1PH9A 2F3IA 1FJGL 4DR2Q 4BA2I 1X3FA 2VW9A 4X62L 4KLKA 4DR3L 1FJGQ 3KDFA 1HNXL 4A3CG 1AE2A 5GAHC 3U4ZA 4JV5L 4C3IH 2V1CC 4YHHQ 5IT9c 4DR3Q 2HIXA 3TEHB 1Y1WH 1N36L 4Y7NH 1VQFA 5LMNW 5BR8Q 3E9IA 1K83H 3DLLA 4GKKL 5IYCH 1CKNA 1X54A 4DV3L 2YTXA 5FLXc 5AJ3L 2JA9A 1Q12A 3U58A 1N36Q 4EQ5A 1EYGA 3K0XA 4XIGS 4GKKQ 4GOPB 3JAMi 1QZHA 4P73A 1PH3A 1HZCA 4OONA 4A3IH 1OXTA 4GKJQ 3G4SA 5IYDG 3KF6B 4JI4L 1VQ7A 2R92G 1TWFH 3RN5A 1E1OA 1BBUA 1L1OA 4WJ4A 1UE6A 4JI4Q 3PGZA 1O7IA 4UP7A 2ASBA 4PZ7A 2ZJQA 3H3VH 1L1OC 2IX0A 1BBWA 4YCVA 3F2DA 1YZ6A 5FLMG 1Q82C 5M3FH 3W1GA 3H15A 2R93H 4DR5Q 2BH2A 1YITA 1E1TA 1QUQA 2BA1A 1EIFA 2MO0A 2NN6I 2PMZE 3G48A 5J3BA 1YHQA 4A3GH 1X65A 1PYSB 2MFIA 4X6AH 5C0XJ 2JEAI 4YWMA 3WWVA 1XMQQ 4GLVB 3KFUA 1K8GA 1PH5A 5JEAG 2UUCL 4DR6Q 5M5WH 1HNZL 2JE6I 2JJQA 4JBMA 3PSIA 3GDEA 4DNIA 3CCEA 2Y0SE 3G6EA 1B7YB 2UUCQ 4LF5L 1Q1BA 3JC66 3CCJA 4DUYL 4IOAA 3CD6A 4JBJA 2B63H 3U4VA 3ULJA 1XNRQ 4QGUA 1Q46A 4JI0L 2KENA 4A3IG 3CC7A 3I7FA 4DUYQ 4LF5Q 4YWKA 5C4XH 4DR7L 1G6PA 3D31A 4EX5A 4DKAC 4A3EH 1XPRA 4BY7H 3J7A5 4WJ3M 1UEBA 5IYBG 4JI0Q 4DR7Q 1TWCH 2CWPA 2N8NA 2Z0SA 3GTLH 1VQ5A 2JA8H 1HJPA 4POFA 3M4QA 4YY3Q 1AH9A 2NN6G 3CCRA 1TWGH 2RCNA 2PI2E 1GO3E 1KRTA 1X55A 1UE1A 1V43A 4DAYB 3E9HA 1PH4A 3KOJA 4DV5L 2R93G 3F2BA 3FHWA 2ZJPA 4O0AA 4LF7L 3I4NH 2A1AA 2JA6H 4LUOA 4A3GG 3HOYH 4DV5Q 1YJNA 4JCVE 2XGTA 4DK6C 4LF7Q 3PUVA 1WFQA 4LFAL 1FGUA 4GN5A 4OWXB 4P71A 5FJ8G 1ASYA 2Q2UA 1YJWA 2ZTCA 3GTOH 4GN4B 3HOZG 1PA6A 1BKBA 1KXLA 4LFAQ 4GNXA 3CPFA 2Q2IA 3A5UA 1L0WA 4AQYL 5E7NA 1V1QA 2B29A 4LFCQ 3NENA 5C3EH 2R7ZH 2YTYA 1T9HA 1PH7A 1YJ9A 2I0QA 1RL2A 3KDFB 4LF6L 2R7DA 3K80C 3KYHC 2CWAA 5C4XG 2UXBL 1HR0Q 3HOVH 4OXPA 4O2DA 4A3EG 5JJLA 4OWTB 2A8VA 4LF6Q 1LM0A 5JEAJ 1Z47A 3GO5A 1VQAA 3DM3A 5IWAL 3A0JA 4DV7L 2UXBQ 4A3BH 2Z6KA 4B3RL 4LW1A 3L7ZC 1TWAH 2KHJA 2VS1A 4DV7Q 1S40A 2JA8G 1FL0A 4HJ7A 4UPAA 2Z6KC 4B3RQ 1XNQL 2HQLA 4A3KG 3AFQA 1NMGA 1EIYB 4APVA 3ERSX 4IJHA 4DAMA 4H02A 1XNQQ 3A74A 2B3GA 2JEBI 2E5LQ 3PUXA 4LWCA 3S1NH 1N33L 3I4MG 4UY8C 1GD7A 1VQEA 4J15A 4DV0Q 3I4NG 1L1OB 5EAYA 1KC8C 2D0PA 1CUKA 1NBWA 1GM5A 1JJGA 4RMFA 3UDFA 2IY5B 1W2BA 3GTMH 2JA5G 5LMNL 3PIPA 4MZ9A 4UP9A 4X62Q 1X6OA 3L0OA 3I2ZA 1YI2A 1UE7A 3OYYA 1HNXQ 2R7ZG 5C3EG 4A76A 3GTQH 2K5NA 5DLQE 1B8AA 3AQQA 1Q86C 3CCLA 4JV5Q 1QUQB 1VQIA 1G291 2D0OA 3EN2A 2IX1A 2UUBL 2VL6A 3ULLA 4GS3A 5M5XH 4DV3Q 3S17H 5AJ3Q 1K8AC 2VQFL 4A3BG 2GVAA 3PUWA 2EQSA 4HJ9A 4BBSG 1WOCA 3CMEA 1VQGA 2HHHL 2I5HA 4A3MG 3HOXG 1JB7A 3BZKA 4L5QA 3UDGA 2HHHQ 3EBEA 1VQBA 4XTCS 1OTCA 4BXXH 3TQYA 1W3SA 4PZ6A 4PZ8A 1MJEA 3JAMc 2E8GA 5IE8A 4R4TA 4A3DG 2ATWA 1WI5A 1VQDA 4IO9A 5IY0A 3ZJYC 3CF5A 4BY1H 4YCWA 4A3FH 4OX9L 3K7UC 3PV0A 2N3SA 3H3VI 1OXUA 1C0AA 1IBML 3F2CA 3CW2C 3MEFA 1X56A 2E2HH 4A3JH 1VQOA 5M5YH 2LSSA 3LGJA 2YYZA 3CCVA 1IBMQ 4B3SL 2K5HA 3D0FA 1C7YA 1Y1WG 5IP7H 3K7AH 1JT8A 4QY7A 1TXYA 4P75A 4LF9L 4B3SQ 4A3LH 1LTLA 3FKIH 5IYCG 3TS2A 4QQBX 3EIVA 1KL9A 1VCIA 4LF9Q 3T1YL 2A19A 1XPOA 1HNZQ 2UU9L 2ZM6L 4MTNA 1C9OA 1YNXA 1QVGA 2JQOA 2Q2HA 1EWIA 3T1YQ 2ES2A 1IL2A 2K5VA 2ZM6Q 2E2IH 4GLAC 2RHSB 4DV2L 3RZDH 2VUMH 3CCMA 1YIJA 4LNQA 2AMCB 1YVCA 2QEXA 4L5SA 5C4JH 1SR3A 3S2HH 4JI6L 3K81C 4R1JA 4DV2Q 4B3TL 4KI0A 5HGQA 1GVPA 2KCTA 4Y52H 3AFPA 4IOCA 4JI6Q 2OQ0A 4ME3A 3TS0A 2K4KA 1WCMH 1I50H 1HNWL 3HOUH 1QVFA 1VQ6A 5M3FG 1P8LA 4HIKA 3PF4A 2KBNA 3CPWA 1PH8A 1VQ8A 2FXQA 1HNWQ 2RHQB 2UXDL 1I6HH 2DGYA 1KAWA 2QGQA 2PQAA 4JBWA 3I55A 1U5KA 1UE5A 4A3JG 4HJ8A 4JI7L 3PO2H 5JJIA 5C44H 2BA0A 3J80i 1EUJA 3U50C 1NMFA 4DR4L 5IP7G 1OXXK 4JI3L 2JK8A 1YHAA 2RF4A 1SLJA 4A3LG 2LXJA 1EQRA 1KQSA 4TQUS 4JI3Q 4HJ5A 4JI2L 4P74A 4R4CA 5K36G 2B63G 4GNXC 4NXNL 4AQYQ 1TWHH 3FP9A 1U0LA 1KHIA 4JI2Q 5GADC 2IHFA 1Y1VH 3BJUA 3I4OA 3RLOA 1Q1EA 3OW2A 4NXNQ 4A4IA 4BY7G 2UUAL 4HJAA 1DGSA 1IXRA 4UP8A 1SFOH 2VUMG 4JI8L 3SGIA 3OTOL 4JG2A 4QIWE 2UUAQ 5GROA 1CKNB 4DR1L 3T1HL 4JI8Q 3PUZA 5IWAQ 3OTOQ 4A75A 1N8RC 1AE3A 4DV6L 1X9NA 3S2DH 1CSQA 1IYJB 3M9BA 2CCZA 3J81j 1H95A 2MNAA 4DR1Q 4IPCA 2KHIA 1PH1A 1XTDA 2E2JH 1KIXA 3GTGH 1WCMG 1K9MC 3RLNA 4JYAL 4YWLA 1NY4A 2AHOB 4IFDI 1JMCA 2AWNA 4IJLA 4LFBL 3CCUA 2JA6G 4JYAQ 3HOYG 4HIMA 1N33Q 2F4VL 1GKHA 1VQCA 2VY3A 2HT1A 1I3QH 3KF8B 1SN8A 1HR0W 2NVTH 3GTJH 3RN2A 1Q7YC 2JA7H 5GAEC 5IYDH 3UDXA 2AWOA 4JI5L 3PO3H 1WJJA 2WFWA 4LUZA 2K52A 3KJPA 5LMNQ 3F8TA 2OCEA 1V9PA 1YEZA 2MQHA 4MNOA 4HIOA 1EOVA 4KHPL 3STBD 2K75A 1YHBA 2YTVA 4L5TA 3AEVA 4NPSA 1L2FA 5GAGC 2OTLA 3KLWA 1EQQA 4NXML 1NE3A 3F1ZA 4L5RC 1Y1VG 3HOVG 5FLMH 4NXMQ 4GN3B 1UWVA 2UUBQ 1PFSA 3PCOB 1EFWA 2WB1G 3J7ZC 3HOWH 3A5ZB 1JE5A 2AKWB 1VQNA 3ICEA 4YHHL 2IT1A 3E0EA 1LYLA 4IFDG 3S1MH 2VQFQ 1M1KC 1PH6A 1J5EL 2UXCL 3IRBA 1MIUA 1VS0A 5BR8L 3RNUA 3GD7A 4X65L 1J5EQ 2UXCQ 3W5OA 2WP8J 1P16A 4PMWA 4PG3A 3I56A 5LMUL 2R7FA 3PIOA 4X65Q 1FVIA 2OTJA 4C3JH 1Q81C 4GKJL 5LMUQ 2I5LX 3CC2A 4DPGA 2NZHA 3S14H 1R9TH 4TVAB 1QZGA 2GN5A
chains in the Genus database with same CATH superfamily
3ND8A 2CQOA 2HIVA 2JP1A 4OX9Q 3PO3G 3QIAA 3BYYB 1PVOA 2WAQE 3AMUA 1E24A 2VZAA 3QR8A 1LV9A 5CV6A 4JI1L 2F0SA 2OQKA 1RHPA 1A3VA 1LTRD 5ELNA 1CKMA 2BH8A 1SFOB 1M90C 4ILWA 3S1QH 1K0RA 1CKOA 1IBLL 4J8QA 4QL5A 4X3TA 2F0MA 2XWBB 1PV4A 1C8CA 2GVBA 1QB5D 1K8MA 2R6GA 3GTGB 3S15H 1E2WA 4GOPC 3HOZH 1Z9FA 4K5WA 3PIO3 4R4OA 2NVXH 1EY8A 2VB3X 2ICEC 3BDLA 3UE0A 4OWWB 2N49A 4BY1G 3BYTB 3R2IA 2B2VA 2F0UA 4DUZQ 2O5IC 1BQQT 2C35B 3G7LA 5M3MG 5KRUA 2FMCA 3J81c 3VDYA 2TMPA 2XWJB 4CKCA 3CXCA 1SE2A 3DXJC 4JI7Q 4G7HC 4DR4Q 3HKSA 4X66Q 4OO1H 1V1OA 5FLXE 4A3KH 3CC4A 3I73A 4PQXA 4JOIC 3M4PA 5IP9G 3BU2A 4RCNA 1EQTA 3S16H 3D6WA 1GJXA 3RR5A 4OO1I 4TKOB 5A2QE 4HSPA 1EFID 3UDIA 1G8ZD 2XVSA 1I94L 4LJZC 1EOTA 1I5FA 4FP5D 4B3MQ 4Q5VA 2K14A 1D1KA 2WB1E 3HKZG 2BCOA 1N34L 3T1HQ 5ELOA 4C3JB 1CSPA 1HZBA 1ET6A 3HOUG 1X3GA 3K58A 2ZTDA 1NAPA 3S14B 1TU2B 2FINB 1JJ2A 1CK1A 1S4ZA 3VYTA 3PO2G 3OMGA 4LFBQ 4BBRB 1ICFB 4R8NA 2R92H 4BBSH 1NNXA 3H0GG 1ZYRD 3MWYW 4DF7A 2SNMA 3Q0AA 4JI5Q 3CCQA 3E0JA 4ZLTF 5J22A 5H1SE 1EZ6A 4DFAA 5C0XG 1EZ8A 3RZOH 2F0TA 3W1BA 3QJYA 4DR2L 4OHJA 1PYBA 4A3DH 3J81E 2PPBC 4FNFA 2Y0SB 1HNXL 1AE2A 4DR3Q 2V1CC 4YHHQ 2HIXA 5COYA 1WTWA 1STBA 4RKBA 3NHHA 1EY7A 4DV3L 1FNUA 3U58A 1MGSA 3K0XA 1TS5A 2DY8A 4XIGS 1QZHA 1VF5C 1PFMA 2A6HC 4HMJA 3G4SA 4JI4L 1E1OA 4WJ4A 4V0BA 2K01A 4UP7A 3SXHA 3FDTA 1L1OC 2EOTA 5E3FA 4RKLA 3I4LA 4YCVA 3F2DA 5C4ZA 4FF1A 2KHSA 3W1GA 1B50A 4KJNA 2JA5B 1QUQA 1YHQA 5J3BA 2EDGA 4X6AH 2JEAI 2K05A 5EPKA 2D2CC 3KFUA 5J1ZA 2F0LA 3V05A 4B9XA 5JEAG 3J80L 3CRKC 2UUCQ 5DM73 5K36H 3MXGA 4JBJA 3U4VA 4BWGB 2B2UC 4A3IG 4IQZA 1QNKA 1Q3LA 2L55A 2P5ZX 1DCZA 4BY7H 4EX5A 1CA5A 4A3MB 2LY7A 4JI0Q 4DR7Q 1G91A 2EYJA 2Z0SA 3GTLH 2N55A 1PYWD 1HJPA 3M4QA 1D6EC 1AH9A 2NN6G 3R2TA 1TWGH 3OSOA 2DN8A 4ZK9B 3GTKB 2X6GA 2HDMA 3CQZB 4WJWA 1TR5A 2Q8IB 3VA5A 5DAUA 4ZKCB 2R93G 2ZJPA 4LF7L 2A1AA 4H13C 4DV5Q 1SYEA 4DNTB 2XGTA 4C3IB 2E74C 1WFQA 1FGUA 1ASYA 3TMEA 1ONLA 3HOZG 4NP5A 1IW7C 1DD2A 2B29A 4HCEA 5KYIA 5C3EH 2KCCA 1PRTC 2DJGC 2YTYA 1YJ9A 2I0QA 1RL2A 4LF6L 4K6DA 4DN4M 3H6MA 5KNBA 3KBXA 3HOVH 1TWFB 4N9PA 4O2DA 1T5XD 2EJMA 5IT9L 3GO5A 2JYOA 1CFMA 2F0FA 3DM3A 4DV7L 5IWAL 2UXBQ 3A8KE 2O4XA 1F9QA 2KHJA 1HHVA 3OWEB 5C4HA 3HRZC 4HJ7A 2JA8G 4B3RQ 1K8OA 1XNQL 5JVH3 4A3KG 3AFQA 5JOBA 3ERSX 4KY7A 4DAMA 4H02A 3S1NH 1JR0D 3A8IE 1N33L 2Z1CA 1GD7A 5I6YA 1IYUA 4A3GB 1AW7A 2D0PA 1CUKA 4QCLA 1W2BA 4FF2A 1SSOA 5CV5A 5ISRA 4MZ9A 1NR4A 5CV4A 1SMYC 3L0OA 1S5BD 3SVMA 3I2ZA 1YI2A 1HNXQ 2R7ZG 2B63B 1QUQB 1IKLA 5KYLA 5C4XB 2UUBL 3ULLA 2G9DA 1SE4A 4MTKA 3F2UA 4GS3A 4DV3Q 3VA7A 3NWTA 4CDCC 4BBSG 2B2WC 1PTOC 1WOCA 4DA2A 1VQGA 2F0GA 3MFGA 2I5HA 1JB7A 3UDGA 3EBEA 1WTRA 1VQBA 1TIID 1X32A 2PZTA 4XTCS 1OTCA 4XDXA 1W3SA 2M00A 1MJEA 3EVQA 1HXYD 4A3DG 1RKNA 1WI5A 1Y69U 3NP8A 4YCWA 1F9SA 3K7UC 3H3VI 2MP1A 1CZGA 3T16A 2E2HH 4RH6A 1VQOA 2LSSA 3LGJA 3S9WA 3CCVA 2K5HA 5IP7H 1BDOA 1VMPA 4B3SQ 4A3LH 1IKMA 1LTLA 4QQBX 3NE5B 3URYA 2RSNA 3NTHA 1T5EA 4MTNA 2G9HD 1C9OA 4H44C 2Q2HA 3T1YQ 1TWAB 1IL2A 2K5VA 2J4XA 4KD3A 4OIJA 4GLAC 3CCMA 1YIJA 2X6LA 4L5SA 2F0VA 4R1JA 2WKCA 4KI0A 2R61A 4B3TL 2KCTA 3K5MA 3FPUB 2OQ0A 3SK4A 3TS0A 1WCMH 1DONA 3CPWA 2UXDL 3N6RA 3I55A 1LT5D 3J80i 1EUJA 2B2TC 3BDOA 4L6TB 3I72A 2LXJA 1EQRA 2XRQD 2XSCA 1C4QA 4R4CA 5K36G 3I8ZA 1GUGA 1R4QB 1TWHH 3A8JE 3HOWB 4BY7G 1KNEA 2UUAL 2VUMG 3OTOL 4QIWE 2H1EA 5GROA 3IKJA 5IWAQ 5DEHA 3SDZA 4DV6L 1KAAA 3I91A 1H95A 2JSOA 1EYAA 5IIFA 3RLNA 2AQ3B 4YWLA 2EZVA 4IFDI 4TRDA 1GUNA 4DXFA 4RGMA 4JYAQ 3FEWX 1N33Q 1VQCA 1I3QH 2G5DA 1D2BA 1JQYD 1SNQA 3GTJH 3RN2A 3K0YA 2AWOA 3JAML 3AB9A 3PO3H 1MBYA 1DJRD 3FKIB 2IW3A 1ILPA 1V9PA 3Q24A 4MNOA 1L0XB 1EOVA 2ZXPA 3VR4A 4AYBB 3STBD 1SJHD 1YHBA 2O2LD 1B2TA 1EY0A 4B9WA 3OMCA 4I7ZC 1Y1VG 3HOVG 1E2ZA 1Q8IA 2UUBQ 1JE5A 2IT1A 3BDCA 1X3QA 2NZ1D 3QO2A 1FNVA 3K59A 3RNUA 2FHTA 3AU7A 3GD7A 4X65L 1I50B 2UXCQ 3W5OA 2D5DA 2WP8J 4PG3A 1FVIA 4I65A 1A2UA 1JICA 1HUMA 1I6HB 2F0JA 5EKIA 5C44B 2EXDA 1VQ9A 2KCMA 5M3MH 5GQOA 1PHJA 3HFZB 1Q8KA 3NXWA 2VNUD 4NB3A 2EY6A 3RLFA 3M3YH 4KY5A 5IP9H 2I5MX 4C1NI 4FXGC 3M85A 4K0KQ 1VQHA 1EYDA 3L2PA 3S1RH 3A7LA 1XMQL 4KJOA 4GNXB 3S2DB 3NPPA 1K73C 4EGVA 4DR6L 2F1MA 2K50A 3KBGA 1IBKQ 5FJ8H 2PI2A 2OWOA 1XWEA 3IFDA 4C2MH 4B3TQ 1XNRL 1NJIC 1VQKA 2L0CA 5JJZA 4DUZL 3G71A 3L3OC 1EU4A 4AIMA 5KGUA 2VQEQ 3KJOA 1DXMA 2ALYB 1FR3A 2WAQG 1LUZA 2JA7B 1HZ9A 2K33A 3PF5A 1E3PA 2B2VC 4I7AA 1YBYA 2XTIA 4QJFA 4X66L 4BBRG 2UXDQ 2WACA 4FDBA 4BA1I 3H0GH 1MKHA 3G6JB 3UE1A 1CQFA 5JJKA 2QCPX 2BDOA 1DZ1A 2QW7A 1JWMD 5C0XH 2ZJRA 3I4MH 4DV1Q 4LF4Q 3H94A 4QUCA 4B3ML 2M2LA 4CBVA 3M4OH 3VR5A 2NYZD 4KKTA 2K5DA 1JJCB 5CR3A 1MHWC 1QWYA 2EPBA 5C0XI 4LFCL 2IHEA 2Y0SG 1V8QA 1MJCA 2L12A 4JVZA 4DV6Q 1VQMA 2F4IA 4IPHA 1HH2P 1R9TB 4DV4Q 3NELA 3VR6A 1KD1C 3BZCA 5DNFA 2K6AA 3NBHB 2QA4A 1E2VA 1CQVA 1NTGA 1STYA 2F0PA 4U673 2MO1A 3P7JA 1AP0A 1Z6HA 1EY6A 3HOXH 1E7ZA 1K3RA 2AQ1B 2NWGA 4C56C 1RIPA 4HTHA 1ASZA 1HZAA 4LAAA 5A2QL 1A0IA 5FO7B 4AH6A 1Y14B 2EYOA 5KEEA 1PH9A 3GTPB 1OO9B 2ZXRA 4DR3L 3KDFA 1S5CD 2R3ZA 1PFNA 1WTPA 1BCPB 5GAHC 2BDNA 2XN9C 2YU9B 4DGZA 1SYCA 1VQFA 3D8GA 2V4DA 5IYCH 2KECA 4KKUA 1X54A 1BOSA 5FLXc 1N36Q 1EYGA 4C3HB 5K5PA 3JAMi 4N8FA 4A93B 1UEAB 1HZCA 1IL8A 4A3IH 1OXTA 3MC0B 4K6LA 3GV6A 1KNAA 2HCCA 1GHKA 1RJTA 1BBUA 3BZDB 3HG9A 3PGZA 2ZJQA 4OEMB 5EJWA 2NN6H 3J81L 4HEDA 2MHVA 5EBDA 1I4PA 4F87A 1Q82C 4WORA 1QNUA 5M3FH 4IUVA 2R93H 1SXTA 3EFXD 2NN6I 2BA1A 5G3LF 4F7XA 1X65A 2MFIA 1LTTD 1XMQQ 2NVQB 4G4KA 1LT4D 1K8GA 1PH5A 2UUCL 4H7BA 5FKAC 4DR6Q 5M5WH 4ZYSA 3PSIA 3DM1A 1Y8NB 2Y0SE 1Q1BA 3CCJA 4IOAA 1B3AA 3CD6A 1XNRQ 1JORA 3T56B 4JI0L 4DR7L 4LF5Q 3CC7A 4DUYQ 4FYDA 2AUKA 1QILA 1XPRA 4DKAC 2RDFA 4N9TA 1TWCH 4CJ0B 2CWPA 5CGKA 2I07B 2JA8H 4CHTB 1WTVA 1DOKA 1V1PA 5JVG3 1U4MA 4DV5L 2J7ZA 3F2BA 3TBIB 2JA6H 1A6XA 4A3GG 3HOYH 1PMRA 3PUVA 2EE1A 3I70A 1Y1WB 4Y7NB 4P71A 3W3AA 5FJ8G 1EQVA 1K83B 3J7YW 3SEBA 5EQ0A 3X3MA 1KXLA 3BS1A 4LFAQ 2Q2IA 2LFNA 1L0WA 4AQYL 4LFCQ 2R7ZH 4CJ2C 4ZCKA 1PH7A 3W2DA 3KDFB 2F0IA 3KYHC 1B53A 2CWAA 5C4XG 2UXBL 4A3EG 5JJLA 4OWTB 1LM0A 1Z47A 3A7AB 1LO5D 2Z6KA 4B3RL 3GQBA 4LW1A 2VS1A 1EU3A 1S40A 1FL0A 4UPAA 3KLRA 1NMGA 4APVA 3DHQA 5C3XA 3A74A 2B3GA 2JEBI 2NTSA 2Q8RE 3I4MG 5TSSA 1KDCA 3I4NG 2KUMA 5FO9B 2PO4A 1GM5A 2CW0C 4QB4A 3RUZA 3GTMH 2FMMA 4UP9A 1B44D 1X6OA 4ZUJA 4DAPA 1I4QA 2EY2A 3RMHA 3R3OA 5DLQE 3AQQA 3CCLA 1CT1D 4OIKA 3FMCA 1VQIA 2D0OA 3EJIA 2IX1A 3S17H 1HPCA 2IPKD 2VQFL 1YNJC 4A3BG 4HJ9A 4OELB 4ZAIA 2DJFC 4BS9A 2F3WA 2JN4A 3HOXG 5G3LD 4L5QA 1O78A 2HHHQ 4LK1C 3FPPA 1SE3A 1PZID 4BXXH 1J9OA 4PZ8A 1G2TA 2E8GA 1PTOH 4R4TA 4NW2A 3ITPA 1KTKA 5EBCA 2K03A 5T1GA 4PNYA 2QDLA 3ZJYC 4A3FH 3PV0A 2I46A 1C0AA 3F2CA 1X56A 2RDGA 4CKEA 3R93A 1IBMQ 4B3SL 2DNCA 1NCVA 1V1PB 2KVMA 4KD4A 1JT8A 4QY7A 4P75A 4WRDA 4QUFA 5IYCG 3EIVA 4CGYB 4LF9Q 3T1YL 2UU9L 3OIPA 5IGCA 4UAIA 3P1HA 1YNXA 5IGEA 2ES2A 2ZM6Q 1HTPA 4Q0FA 2VUMH 3ERQA 4LNQA 5C4JH 2N88A 2F0KA 3S2HH 4DV2Q 5HGQA 1NUCA 4DAVA 1H9MA 4K8IA 2NB0A 1M8AA 5CV9A 5M3FG 2B39A 4JK1C 4HIKA 4HAEA 1PH8A 1VQ8A 3M4YA 3NTKA 2RHQB 1HUNA 4IN3A 1KAWA 1UE5A 4HJ8A 2NUCA 2BA0A 2J0TD 3U50C 5DM63 3Q22A 4M8AA 3GTQB 2JK8A 1K28A 1SLJA 2LKVA 3IL8A 4RAUC 3IAYA 5IOCA 2K32A 1M4VA 5M5XB 2AQ2B 4GNXC 3A55A 4AQYQ 1STHA 4JI2Q 3FP9A 1KHIA 1Y1VH 1Q1EA 4NXNQ 1FNWA 1DGSA 1SFOH 5EKKA 1CTMA 4A75A 1N8RC 4G7OC 2CCZA 3D6CA 2MNAA 4DR1Q 3T13A 2KHIA 3E6ZX 1XTDA 4RFBA 1PH1A 1ZKOA 2E2JH 3GTGH 1K9MC 4JYAL 4BY1B 5I6WA 4IJLA 1H9KA 2JA6G 3HOYG 3MXNA 4A3JB 5M5YB 1HR0W 2A5HA 3K7AB 1QE6A 1EEID 4LUZA 1I4RA 3F8TA 2OCEA 4HIOA 3M3YB 3NTIA 4DXGA 4IURA 1IW7D 1L2FA 5GAGC 1FYCA 1WTOA 2EYLA 4L5RC 1A2TA 5FLMH 2E2IB 1I4XA 5I9OA 4GN3B 1UWVA 1EFWA 1KLGD 5JAVA 3BG3A 2L9HA 3E0EA 3S1MH 2VQFQ 3HKZB 1M1KC 1PH6A 1BBXC 2UXCL 4RGTA 1MIUA 4K5VA 1J5EQ 3HOUB 3RD4A 5FO8B 1P16A 3I56A 2R7FA 1ENAA 2KCNA 4C3JH 1W6KA 3J80E 5LMUQ 3PO2B 3EQLC 1U4PA 4DPGA 3S14H 2JA7G 2NVYH 3H0GB 3NUCA 4RHRA 2N78A 3NEMA 1F9PA 3EA6A 4BBRH 4RGNA 2RBMA 2E2DC 3NSWA 4R4QA 5ELFA 4UDUC 1X3EA 4K0KL 1MD2D 1S72A 4LUVA 4JPBW 1K3BC 2H5XA 3HP3A 2NTTA 5BN4A 3T4AC 1X3PA 1BCPC 1CZWA 4AYBE 1WD1A 5E4XA 2UU9Q 4HIDA 1O7ZA 4Z9CB 4ULLA 3TP6A 1IBKL 4RHSA 1PTOD 4GLXA 1CA6A 2EYHA 1A8VA 1IHZA 2HCIA 4BXXG 1SE8A 2VQEL 4CJ1B 4A3FG 1S3OA 1JE4A 2NVTB 2LMCB 3BVGA 4XQJA 2X69A 3V2TA 5L37A 2YV5A 3S24A 4V190 3TREA 4WFN3 5IT9E 5HY6A 4YY3L 4RG1A 5E4WC 4ME5A 5M9OA 1XPUA 2RSOA 4LF8Q 3MXNB 3TSSA 4DV1L 4LF4L 1JWUD 4IPGA 1N32Q 1SNMA 2A69D 3KLSX 2RDHA 1EIHA 4K8JA 1FD7D 1OXVA 3K8AA 4FO2A 3OW7A 1IZ6A 2JA5H 1A62A 1N9WA 1JB3A 4IUPA 4O42A 5ELBA 3B6YA 3P20A 3STBC 3GP7A 1KRSA 4DV4L 4KK7A 2RVLA 1HR0L 3PUYA 1BR9A 2Q2TA 3MEHA 1WTQA 1ILQA 3SHLA 3KUPA 3VYSA 1D7QA 4A93G 2Q8TA 1HTLD 2BE5D 4H0LC 4N8X1 4X64Q 4ALPA 4A3MH 3E5SA 3MXUA 2E5LL 3DEPA 1D5ZC 4X3KA 3LX0A 4HSVA 2PMZB 2CFMA 4R4IA 1D8LA 4YCUA 4DV0L 3S1QB 1R4PB 1XMOQ 3GTKH 3CMAA 3CQZH 2F3IA 1RF2D 1X3FA 1TKWB 1Y8OB 4OL7A 4X62L 3HGBA 2VW9A 1BXTA 4KLKA 3S15B 3TZDA 1FJGQ 2Z6BA 1HQMC 1ZXTA 4A3CG 3HOZB 2NVXB 2PZWA 4C3IH 5CV8A 3TEHB 2KJXA 1HQRD 4P2CB 1N36L 4KKSA 2OEOA 4IUQA 3DLLA 4RA8A 1CKNA 2YTXA 5AJ3L 1CHQD 2JA9A 2F03A 4GKKQ 4ODGA 1PH3A 4P73A 2MGSA 3H3VC 2OT2A 4JW0A 1LLRD 3QOJA 5CYUA 1TWFH 2B8GA 3RN5A 1VMCA 4A3KB 1UE6A 4IALA 2EJGC 1O7IA 1HRJA 1LT3D 3S16B 1BBWA 3SK8A 4CDDC 5FLMG 1S5DD 3M7GA 1JC7A 2BH2A 2MO0A 1EIFA 2A68D 3G48A 4A3GH 1PYSB 1SYBA 3WWVA 1TS4A 2L1BA 2LS01 1GXDC 3BVMA 2JE6I 4JBMA 2HQEA 4DNIA 3CCEA 1ML0D 1O80A 3CHBD 1B7YB 4C3JG 4LF5L 3JC66 4DUYL 4F8MA 2B63H 4QGUA 5D3IB 1Q46A 2R92B 2BOSA 1B3QA 4YWKA 5C4XH 4BBSB 4A3EH 3J7A5 1UEBA 2EY5A 2XRSD 2Z4IA 1YNNC 2F0DA 1A3UA 3TP8A 4POFA 2CQAA 1PZKD 4R9WA 4YY3Q 1EWCA 3RZOB 2RCNA 2Z9HA 1KLUD 2PI2E 1X55A 1UE1A 2FJ2A 4A3DB 3E9HA 2CH4W 4O0AA 5CORA 2EVBA 1DOLA 3H91A 1VDZA 4LUOA 3I4NH 4CKBA 1YJNA 1LT6D 1EY4A 1D1IA 3OIQA 2B2YA 4DK0A 3SE0A 4LFAL 1F77A 5FOBB 4OWXB 2RA4A 3OHXC 2HDLA 2Q2UA 2ZTCA 3GTOH 1PA6A 1BKBA 1HA5A 3JAME 3CPFA 2MJ8A 2ZT9C 1V1QA 2WINB 4QF4A 3J7AF 2MPMA 1T9HA 3IFTA 4J6HA 2R7DA 1HR0Q 2A8VA 1SNOA 1PZJD 1KDAA 4A3BH 3KK7A 3L7ZC 1TWAH 1TS2A 5FLXL 2VB2X 2MUYA 2L5TA 1GUOA 5C5LA 2Z6KC 4PMBA 2QDBA 1GOZA 1EY5A 4IJHA 1PLFA 3D4DA 2E5LQ 2A6ED 3DWQA 3VYUA 4DV0Q 1NBWA 4RMFA 2IY5B 1SNCA 2JA5G 1MSHA 1LTID 3PIPA 5NUCA 5LL6X 4ZUIA 4X62Q 5LL6S 4RWSC 3OYYA 4A76A 2K5NA 1Q86C 4FF4A 4XQNA 2F0EA 2RKSA 1G291 3EN2A 2VL6A 4BY7B 4DU9A 4ZKBB 5AJ3Q 2GVAA 3UI2A 5EKLA 3GTLB 2HHHL 3J7AV 1II3A 3T51B 4A3MG 1TWGB 2F3VA 2QEJC 3KF8A 2F0OA 5BN5A 3DEOA 3QOLA 4KN4C 5IE8A 3L9AX 5IGDA 4KMUC 2ATWA 4DNRB 3U9SA 4XYQA 4IO9A 5IY0A 2WKDA 1A3TA 1BNZA 1SDFA 2ENBA 1OXUA 1SNPA 1IBML 3A56A 1D5XC 2M9VA 3CW2C 3MEFA 2CVRA 4C3IG 5AFWA 5C3EB 3QG1A 4LF9L 4OGQC 3TS2A 3FKIH 1VCIA 2OXPA 1Y1VB 3HOVB 1SBBB 4MHEA 5D14A 5A35A 2ZM6L 1TT2A 2JQOA 2EYMA 1PDQA 5T1IA 2K5WA 1WVLA 3RZDH 2RHSB 3NWSA 4DV2L 2AMCB 4LMQD 3C46A 3P75A 2SNSA 2E2JB 3K81C 3R8BA 3S1NB 1VF7A 4Y52H 4JI6Q 4ME3A 1I50H 2XIWA 1QVFA 2PZUA 5CBAE 4YIJA 2FXQA 3U9OA 1HNWQ 1I6HH 2PW5A 4JBWA 2PQAA 4A3JG 1U5KA 5IGFA 1ZYRC 4K2LA 2KEEA 5C44H 1DOMA 1I4GA 1OXXK 1SYGA 1YHAA 1QOHA 4TQUS 4JI3Q 4K5XA 3OPOA 4JI2L 4P74A 2B63G 3D4WA 4NXNL 5IODA 2H4OA 2IHFA 3RLOA 3I4OA 3OW2A 4G7ZC 3S1MB 1IXRA 4UP8A 5ELDA 3WDNA 3SGIA 4JG2A 3SK5A 4DR1L 4JI8Q 3PUZA 4C1NK 3S2DH 2EY1A 1GUTA 1CSQA 3J81j 4RCOA 1BUVT 1KIXA 1NY4A 2AWNA 2SOBA 1GHJA 2HD3A 2WAQB 5CC4A 1NSNS 3CCUA 2NVYB 4HIMA 2JXMB 2F4VL 2HT1A 2E2HB 2VY3A 1XYIA 3KF8B 1SN8A 5IYDH 2JA7H 1EWHA 3UDXA 1SYDA 3DMUA 2WFWA 2F0NA 4IZ8A 4KHPL 4L5TA 3I90A 2OTLA 1AZPA 1U4LA 1HCZA 3KLWA 1NE3A 1CHPD 2IL8A 3ND9A 1WD0A 1IYVA 4NXMQ 4KY6A 2L4NA 1RDPD 3K5OA 3HEJA 3A5ZB 1LYLA 3QB3A 1J5EL 1MI2A 5D65A 4IUNA 1Q90A 2QILA 3IRBA 5BR8L 1LABA 1PRTF 3OWFA 1WCMB 4X3UA 1EY9A 2PCFB 4FVMA 4PMWA 5LMUL 2CH4A 1QG7A 2OTJA 4ID6A 2FFKB 2K7VA 1Q81C 4GKJL 2I5LX 2QKIC 1F2LA 1R9TH 4TVAB 2C5CA 2GN5A 1QZGA 2CW0D 4XXEA 4MIUA 1SRUA 2D62A 1H9JA 3D3RA 5I2XA 5IYBH 5C6AA 3ER0A 3KLSA 3M7NA 1G2SA 5C5MA 3EROA 1ESFA 1TWHB 4NDXA 4JBKA 2PQAB 4JI1Q 4DR5L 4EQPA 1STGA 2E75C 2L15A 4L63B 3LNNA 1S5ED 4POGA 2WB1B 3K6OA 3HOWG 3VR3A 1MSGA 2A6HD 3DWPA 3ULPA 1YNJD 2L11A 1IBLQ 2ID0A 5F2DA 4GOPA 1I4HA 3GTPH 4EVOA 3J81i 1QCBD 3NBIA 1E22A 3KF6A 3MXPA 4CDFC 4P72A 1S5FD 2YU9H 1AN8A 1QVCA 2Z8LA 3HKZE 4M1UB 3CCSA 4IFDJ 1J8IA 4ZQ3A 1L0YB 1I3QB 2ZTEA 1H9SA 3GTJB 1TY2A 1PTOF 1RODA 4C3HH 1VQ4A 3PO3B 3TDQA 3TP7A 4A93H 2EIFA 4IPDA 4LF8L 1SYFA 4FXDA 4JOIA 2ICIA 1XJVA 3D4RA 3FKIG 2OF1A 2KQ3A 1OXSC 2IX3A 1N32L 1RTOA 4AYBG 4HMIA 2F52A 5I2YA 1B70B 1XX8A 3AYHB 2CKZB 2NZOA 1EIGA 2HUGA 4GZYC 1ET9A 3CRLC 1H9RA 3J80c 2EJFC 2EYFA 1B1ZA 2DUDA 3CKIB 1I94Q 1VQPA 1SMXA 4A3CH 1G51A 1WYDA 2EYPA 2NVQH 1NR2A 1PH2A 4KHVA 1N34Q 3NQIA 1UUPA 3VR2A 1BCPF 2ZXOA 1VQLA 5M3MB 1VQJA 4X64L 1BVSA 1SROA 3LWEA 3CP0A 4DAYA 5C44G 4FXKC 2PNHA 4JC0A 2F4VQ 5I9PA 3I3CA 1JWSD 1TVXA 4OO1G 1TY0A 4DK3C 3Q8DA 1LTSD 1A63A 1UAPA 1SJED 4L8JA 4F88A 3TRZA 1XMOL 2LXKA 3S1RB 4KHPQ 1J6QA 1PRTD 4KHZA 1U9RA 3NQTA 3WOFA 2D9UA 4EQNA 4HCSA 3CAMA 3V96A 1FJGL 3C1FA 4DR2Q 4BA2I 1D5MC 4KN7C 1F2MA 5CV7A 3U4ZA 4JV5L 4C2MB 5IT9c 1B9NA 1Y1WH 4Y7NH 5LMNW 3SK6A 5BR8Q 3E9IA 1K83H 4G57A 4GKKL 1Q12A 4EQ5A 4A3EB 4GOPB 4OONA 1SEBD 4GKJQ 5IYDG 3KF6B 2R92G 4O1NA 4S3SA 1VQ7A 1ZEQX 1LTGD 2IJ0A 2PNRC 1L1OA 4JI4Q 5KIXA 1SMYD 2ASBA 4E6IA 1H9SB 4PZ7A 3H3VH 2IX0A 1K0SA 3I4MB 3Q6SA 3Q23A 2VXWA 3I4NB 1YZ6A 2K28A 1JOOA 3M4OB 3E3XA 3H15A 4DR5Q 3X3NA 1YITA 1E1TA 2PMZE 1XXGA 1GUWA 5CMDA 3GTOB 5C0XJ 4YWMA 4GLVB 2K1BA 1EYCA 3PMFA 1HNZL 2JJQA 3GDEA 3G6EA 2B2UA 2GA4B 2A69C 3ULJA 2WIIB 3C3LA 2PYKA 3DWAA 4A3BB 2KENA 3I7FA 1G6PA 3D31A 4WJ3M 5CBEE 5IYBG 4ZRZA 3HOXB 3C1EA 5JPNC 1F9RA 1FGBD 1B4OA 2N8NA 1JCKB 1HFNA 1VQ5A 2Z4HA 4CDEC 3CCRA 2AUJD 1GO3E 2RCFA 1KRTA 2TSSA 3BVZA 1V43A 4DAYB 4UHVA 1HA6A 1PH4A 1Y8PB 3KOJA 3FHWA 2WV6D 3H09A 2SEBD 1UNSA 3TP5A 2BE5C 1BCPD 2EXZA 1RD9D 4JCVE 1BF4A 4DK6C 4LF7Q 1F2ZA 3WOEA 4IUUA 5EGTA 4GN5A 1YJWA 2B2YC 4GN4B 3NK9A 5EPLA 4GNXA 3A5UA 5KNDA 1E0BA 5E7NA 3NENA 1I6VC 1PFBA 5LHY1 1LACA 4B08A 1EEFD 3K80C 4A3IB 3FRPB 4MN3A 4FF3A 4C3HG 4OXPA 4LF6Q 5JEAJ 3OOCA 1VQAA 3A0JA 3MHBA 2E76C 4ABNA 1JOQA 1JOKA 1DYQA 4IFDH 4DV7Q 2DY7A 1U4RA 2HQLA 3LWUA 1STAA 1EIYB 4X3SA 4TSSA 1XNQQ 3PUXA 4LWCA 5M3FB 1AFPA 2R93B 4UY8C 1VQEA 4J15A 1CI3M 1TS3A 1QJOA 1L1OB 5EAYA 1KC8C 1JJGA 3K57A 3CU7A 3UDFA 5LMNL 3PQIA 5E1FA 5M5WB 1UE7A 3TN2A 5C3EG 3GTQH 4JV5Q 1B8AA 4EQOA 5BN3A 1RCVD 4PV1C 3MVVA 2B2WA 3MFYA 3RZDB 5M5XH 2K5QA 2A68C 1K8AC 2KA7A 1TWCB 3MAQA 2F0QA 3PUWA 2EQSA 1W6JA 3MZ5A 3CMEA 2JA8B 1BO0A 3BZKA 5ELCA 3NBHA 1GUSA 2KEDA 4HR7B 3TQYA 3ZYYX 4PZ6A 1XTCD 3JAMc 2K04A 2JA6B 1KABA 3MTSA 3HOYB 1VQDA 5HGTA 3CF5A 4BY1H 2A74C 3T53B 4OX9L 2N3SA 5KNCA 4A3JH 4PMCA 5M5YH 1AZQA 2YYZA 1Z7TA 2R7ZB 4QMGA 3D0FA 1C7YA 1Y1WG 3K7AH 1TXYA 1ENFA 1KL9A 5J39A 4QIWB 1XPOA 2A19A 1HNZQ 1QVGA 1STNA 1PRTB 1EWIA 3GV3A 5EPJA 5IGGA 2E2IH 1HFGA 5FK9C 1O7YA 1YVCA 2QEXA 1SR3A 3VYRA 4JI6L 5C3WA 1GVPA 2DNEA 4R8IA 3HZXA 3AFPA 3A54A 2C9OA 4IOCA 4J1MA 2K4KA 2NBFA 1HNWL 3HOUH 1VQ6A 4NMZA 1P8LA 3PF4A 2KBNA 3GTMB 3SR1A 2B2TA 2DGYA 1F2YA 2QGQA 3PO2H 1EL0A 3FVQA 3O13A 4JI7L 5JJIA 4DR4L 2QF7A 1NMFA 5IP7G 4JI3L 4XT1B 1C48A 5HURA 2RF4A 4A3LG 3TZUA 1ESRA 1KQSA 1DM0B 1STEA 4HJ5A 2A6EC 4K2KA 3S17B 3HS0C 2O5JC 1U0LA 3K5NA 5GADC 2RQXA 2XNAC 4KTAA 3BJUA 1ICWA 1WTXA 4RGOS 4A4IA 4HJAA 4JI8L 2PW7A 2UUAQ 1CKNB 3T1HL 3OTOQ 1YNND 1AE3A 1SNDA 1X9NA 1IYJB 3M9BA 1TQOA 1PTOB 4XT3B 2KOLA 4IPCA 2A73B 5I4DA 1WCMG 2PQEA 4A3FB 3N52A 2AHOB 1KDBA 2B8FA 1B9MA 5ELEA 1JMCA 5JPMC 4LFBL 1A15A 1GKHA 2NVTH 1Q7YC 1CM9A 5GAEC 4JI5L 1WJJA 1PXUA 2K52A 3QWNA 4XYOA 3KJPA 1YEZA 2MQHA 5LMNQ 2F0HA 2IWHA 2K75A 4KV6A 1O7LA 2YTVA 3AEVA 4XQQA 4NPSA 4NXML 1EQQA 3F1ZA 4U68A 5D3DA 4DK1A 2VUMB 4NKLA 1SAPA 3ONAB 1PFSA 1WTHA 3PCOB 2WB1G 5C4JB 3J7ZC 3HOWH 3ICEA 2AKWB 1VQNA 3S2HB 4YHHL 4IFDG 2CHBD 1VS0A 4K14A 1LTAD 3C2PA 4HN7A 3DUZA 5JEAH 1LTBD 2SDFA 3PIOA 4X65Q 1G6ZA 5IGBA 1AEXA 1RTNA 3K5LA 1ENCA 3MA2B 2F0WA 4IUTA 3CC2A 2NZHA 3PIP3
chains in the Genus database with same CATH topology
2EXDA 2CQOA 2HIVA 2JA7G 2NVYH 1VQ9A 2KCMA 5M3MH 4OX9Q 3PO3G 1SRUA 2D62A 5GQOA 5IYBH 1PHJA 2N78A 3HFZB 2WAQE 3NEMA 1Q8KA 1E24A 3ER0A 1PVOA 2VZAA 4BBRH 3M7NA 2VNUD 4NB3A 3RLFA 4R4QA 4JI1L 1X3EA 4K0KL 2OQKA 1S72A 4JBKA 4LUVA 3M3YH 2PQAB 4JI1Q 2H5XA 5IP9H 5ELNA 4DR5L 1CKMA 2BH8A 2I5MX 2L15A 3M85A 4K0KQ 1VQHA 1M90C 3L2PA 4POGA 3S1RH 3S1QH 1K0RA 4AYBE 1CKOA 3HOWG 1IBLL 2UU9Q 1XMQL 4QL5A 4HIDA 4GNXB 3ULPA 1PV4A 1IBKL 1IBLQ 2ID0A 2GVBA 4GOPA 1K73C 3GTPH 4DR6L 2K50A 2R6GA 3J81i 4GLXA 3S15H 1E22A 5FJ8H 1IBKQ 1A8VA 4GOPC 3KF6A 4BXXG 3HOZH 1Z9FA 2PI2A 2NVXH 1SE8A 4R4OA 2OWOA 4P72A 4C2MH 2VQEL 2YU9H 4B3TQ 1QVCA 1XNRL 1NJIC 3HKZE 1VQKA 3CCSA 4DUZL 3UE0A 4IFDJ 4OWWB 2N49A 3G71A 4AIMA 4BY1G 2VQEQ 4A3FG 3KJOA 1S3OA 2ZTEA 2ALYB 4DUZQ 2WAQG 1LUZA 4C3HH 1HZ9A 1VQ4A 2C35B 5M3MG 3PF5A 1E3PA 2YV5A 3J81c 2EIFA 3VDYA 4A93H 4IPDA 3S24A 1YBYA 2XTIA 4QJFA 3TREA 4X66L 5HY6A 4BBRG 4YY3L 4RG1A 3CXCA 4LF8L 2UXDQ 4FDBA 4BA1I 3H0GH 1MKHA 4JI7Q 1XPUA 4JOIA 1XJVA 4DR4Q 3FKIG 3HKSA 3UE1A 4X66Q 4LF8Q 4A3KH 5JJKA 3MXNB 1N32L 1OXSC 3CC4A 4DV1L 4LF4L 4JOIC 3M4PA 4AYBG 2F52A 5IP9G 1B70B 4IPGA 3BU2A 1N32Q 3AYHB 2ZJRA 3S16H 3I4MH 4DV1Q 4LF4Q 3RR5A 2CKZB 2NZOA 4OO1I 4B3ML 1I94L 1OXVA 3UDIA 3K8AA 3J80c 3M4OH 1IZ6A 2DUDA 1JJCB 1I5FA 4B3MQ 5C0XI 1I94Q 1A62A 1N9WA 2JA5H 2K14A 4LFCL 2IHEA 1VQPA 2Y0SG 3B6YA 1SMXA 2WB1E 3HKZG 1G51A 3STBC 4A3CH 1N34L 1WYDA 1MJCA 1KRSA 2NVQH 3T1HQ 5ELOA 1CSPA 1HZBA 4DV4L 1PH2A 4DV6Q 1VQMA 1N34Q 3HOUG 1HR0L 1X3GA 2ZTDA 3PUYA 4IPHA 1HH2P 2Q2TA 4DV4Q 1VQLA 3NELA 1KD1C 3BZCA 1JJ2A 1D7QA 1VQJA 4X64L 1BVSA 1SROA 3NBHB 2QA4A 3PO2G 4A93G 4LFBQ 3CP0A 5C44G 1NTGA 2PNHA 4JC0A 2F4VQ 2R92H 4X64Q 4BBSH 2MO1A 3H0GG 4ALPA 4A3MH 4OO1G 4DK3C 3HOXH 2E5LL 3Q8DA 4JI5Q 1E7ZA 1A63A 1K3RA 3CCQA 3TRZA 5H1SE 1RIPA 1XMOL 4DV0L 2CFMA 4R4IA 1D8LA 2LXKA 4YCUA 1HZAA 5C0XG 1ASZA 3RZOH 1J6QA 4KHZA 3W1BA 4DR2L 4KHPQ 1A0IA 4AH6A 1XMOQ 3GTKH 1PYBA 1Y14B 3CAMA 3CMAA 3CQZH 4A3DH 1PH9A 2F3IA 1FJGL 4DR2Q 4BA2I 1X3FA 2VW9A 4X62L 4KLKA 4DR3L 1FJGQ 3KDFA 1HNXL 4A3CG 1AE2A 5GAHC 3U4ZA 4JV5L 4C3IH 2V1CC 4YHHQ 5IT9c 4DR3Q 2HIXA 3TEHB 1Y1WH 1N36L 4Y7NH 1VQFA 5LMNW 5BR8Q 3E9IA 1K83H 3DLLA 4GKKL 5IYCH 1CKNA 1X54A 4DV3L 2YTXA 5FLXc 5AJ3L 2JA9A 1Q12A 3U58A 1N36Q 4EQ5A 1EYGA 3K0XA 4XIGS 4GKKQ 4GOPB 3JAMi 1QZHA 4P73A 1PH3A 1HZCA 4OONA 4A3IH 1OXTA 4GKJQ 3G4SA 5IYDG 3KF6B 4JI4L 1VQ7A 2R92G 1TWFH 3RN5A 1E1OA 1BBUA 1L1OA 4WJ4A 1UE6A 4JI4Q 3PGZA 1O7IA 4UP7A 2ASBA 4PZ7A 2ZJQA 3H3VH 1L1OC 2IX0A 1BBWA 4YCVA 3F2DA 1YZ6A 5FLMG 1Q82C 5M3FH 3W1GA 3H15A 2R93H 4DR5Q 2BH2A 1YITA 1E1TA 1QUQA 2BA1A 1EIFA 2MO0A 2NN6I 2PMZE 3G48A 5J3BA 1YHQA 4A3GH 1X65A 1PYSB 2MFIA 4X6AH 5C0XJ 2JEAI 4YWMA 3WWVA 1XMQQ 4GLVB 3KFUA 1K8GA 1PH5A 5JEAG 2UUCL 4DR6Q 5M5WH 1HNZL 2JE6I 2JJQA 4JBMA 3PSIA 3GDEA 4DNIA 3CCEA 2Y0SE 3G6EA 1B7YB 2UUCQ 4LF5L 1Q1BA 3JC66 3CCJA 4DUYL 4IOAA 3CD6A 4JBJA 2B63H 3U4VA 3ULJA 1XNRQ 4QGUA 1Q46A 4JI0L 2KENA 4A3IG 3CC7A 3I7FA 4DUYQ 4LF5Q 4YWKA 5C4XH 4DR7L 1G6PA 3D31A 4EX5A 4DKAC 4A3EH 1XPRA 4BY7H 3J7A5 4WJ3M 1UEBA 5IYBG 4JI0Q 4DR7Q 1TWCH 2CWPA 2N8NA 2Z0SA 3GTLH 1VQ5A 2JA8H 1HJPA 4POFA 3M4QA 4YY3Q 1AH9A 2NN6G 3CCRA 1TWGH 2RCNA 2PI2E 1GO3E 1KRTA 1X55A 1UE1A 1V43A 4DAYB 3E9HA 1PH4A 3KOJA 4DV5L 2R93G 3F2BA 3FHWA 2ZJPA 4O0AA 4LF7L 3I4NH 2A1AA 2JA6H 4LUOA 4A3GG 3HOYH 4DV5Q 1YJNA 4JCVE 2XGTA 4DK6C 4LF7Q 3PUVA 1WFQA 4LFAL 1FGUA 4GN5A 4OWXB 4P71A 5FJ8G 1ASYA 2Q2UA 1YJWA 2ZTCA 3GTOH 4GN4B 3HOZG 1PA6A 1BKBA 1KXLA 4LFAQ 4GNXA 3CPFA 2Q2IA 3A5UA 1L0WA 4AQYL 5E7NA 1V1QA 2B29A 4LFCQ 3NENA 5C3EH 2R7ZH 2YTYA 1T9HA 1PH7A 1YJ9A 2I0QA 1RL2A 3KDFB 4LF6L 2R7DA 3K80C 3KYHC 2CWAA 5C4XG 2UXBL 1HR0Q 3HOVH 4OXPA 4O2DA 4A3EG 5JJLA 4OWTB 2A8VA 4LF6Q 1LM0A 5JEAJ 1Z47A 3GO5A 1VQAA 3DM3A 5IWAL 3A0JA 4DV7L 2UXBQ 4A3BH 2Z6KA 4B3RL 4LW1A 3L7ZC 1TWAH 2KHJA 2VS1A 4DV7Q 1S40A 2JA8G 1FL0A 4HJ7A 4UPAA 2Z6KC 4B3RQ 1XNQL 2HQLA 4A3KG 3AFQA 1NMGA 1EIYB 4APVA 3ERSX 4IJHA 4DAMA 4H02A 1XNQQ 3A74A 2B3GA 2JEBI 2E5LQ 3PUXA 4LWCA 3S1NH 1N33L 3I4MG 4UY8C 1GD7A 1VQEA 4J15A 4DV0Q 3I4NG 1L1OB 5EAYA 1KC8C 2D0PA 1CUKA 1NBWA 1GM5A 1JJGA 4RMFA 3UDFA 2IY5B 1W2BA 3GTMH 2JA5G 5LMNL 3PIPA 4MZ9A 4UP9A 4X62Q 1X6OA 3L0OA 3I2ZA 1YI2A 1UE7A 3OYYA 1HNXQ 2R7ZG 5C3EG 4A76A 3GTQH 2K5NA 5DLQE 1B8AA 3AQQA 1Q86C 3CCLA 4JV5Q 1QUQB 1VQIA 1G291 2D0OA 3EN2A 2IX1A 2UUBL 2VL6A 3ULLA 4GS3A 5M5XH 4DV3Q 3S17H 5AJ3Q 1K8AC 2VQFL 4A3BG 2GVAA 3PUWA 2EQSA 4HJ9A 4BBSG 1WOCA 3CMEA 1VQGA 2HHHL 2I5HA 4A3MG 3HOXG 1JB7A 3BZKA 4L5QA 3UDGA 2HHHQ 3EBEA 1VQBA 4XTCS 1OTCA 4BXXH 3TQYA 1W3SA 4PZ6A 4PZ8A 1MJEA 3JAMc 2E8GA 5IE8A 4R4TA 4A3DG 2ATWA 1WI5A 1VQDA 4IO9A 5IY0A 3ZJYC 3CF5A 4BY1H 4YCWA 4A3FH 4OX9L 3K7UC 3PV0A 2N3SA 3H3VI 1OXUA 1C0AA 1IBML 3F2CA 3CW2C 3MEFA 1X56A 2E2HH 4A3JH 1VQOA 5M5YH 2LSSA 3LGJA 2YYZA 3CCVA 1IBMQ 4B3SL 2K5HA 3D0FA 1C7YA 1Y1WG 5IP7H 3K7AH 1JT8A 4QY7A 1TXYA 4P75A 4LF9L 4B3SQ 4A3LH 1LTLA 3FKIH 5IYCG 3TS2A 4QQBX 3EIVA 1KL9A 1VCIA 4LF9Q 3T1YL 2A19A 1XPOA 1HNZQ 2UU9L 2ZM6L 4MTNA 1C9OA 1YNXA 1QVGA 2JQOA 2Q2HA 1EWIA 3T1YQ 2ES2A 1IL2A 2K5VA 2ZM6Q 2E2IH 4GLAC 2RHSB 4DV2L 3RZDH 2VUMH 3CCMA 1YIJA 4LNQA 2AMCB 1YVCA 2QEXA 4L5SA 5C4JH 1SR3A 3S2HH 4JI6L 3K81C 4R1JA 4DV2Q 4B3TL 4KI0A 5HGQA 1GVPA 2KCTA 4Y52H 3AFPA 4IOCA 4JI6Q 2OQ0A 4ME3A 3TS0A 2K4KA 1WCMH 1I50H 1HNWL 3HOUH 1QVFA 1VQ6A 5M3FG 1P8LA 4HIKA 3PF4A 2KBNA 3CPWA 1PH8A 1VQ8A 2FXQA 1HNWQ 2RHQB 2UXDL 1I6HH 2DGYA 1KAWA 2QGQA 2PQAA 4JBWA 3I55A 1U5KA 1UE5A 4A3JG 4HJ8A 4JI7L 3PO2H 5JJIA 5C44H 2BA0A 3J80i 1EUJA 3U50C 1NMFA 4DR4L 5IP7G 1OXXK 4JI3L 2JK8A 1YHAA 2RF4A 1SLJA 4A3LG 2LXJA 1EQRA 1KQSA 4TQUS 4JI3Q 4HJ5A 4JI2L 4P74A 4R4CA 5K36G 2B63G 4GNXC 4NXNL 4AQYQ 1TWHH 3FP9A 1U0LA 1KHIA 4JI2Q 5GADC 2IHFA 1Y1VH 3BJUA 3I4OA 3RLOA 1Q1EA 3OW2A 4NXNQ 4A4IA 4BY7G 2UUAL 4HJAA 1DGSA 1IXRA 4UP8A 1SFOH 2VUMG 4JI8L 3SGIA 3OTOL 4JG2A 4QIWE 2UUAQ 5GROA 1CKNB 4DR1L 3T1HL 4JI8Q 3PUZA 5IWAQ 3OTOQ 4A75A 1N8RC 1AE3A 4DV6L 1X9NA 3S2DH 1CSQA 1IYJB 3M9BA 2CCZA 3J81j 1H95A 2MNAA 4DR1Q 4IPCA 2KHIA 1PH1A 1XTDA 2E2JH 1KIXA 3GTGH 1WCMG 1K9MC 3RLNA 4JYAL 4YWLA 1NY4A 2AHOB 4IFDI 1JMCA 2AWNA 4IJLA 4LFBL 3CCUA 2JA6G 4JYAQ 3HOYG 4HIMA 1N33Q 2F4VL 1GKHA 1VQCA 2VY3A 2HT1A 1I3QH 3KF8B 1SN8A 1HR0W 2NVTH 3GTJH 3RN2A 1Q7YC 2JA7H 5GAEC 5IYDH 3UDXA 2AWOA 4JI5L 3PO3H 1WJJA 2WFWA 4LUZA 2K52A 3KJPA 5LMNQ 3F8TA 2OCEA 1V9PA 1YEZA 2MQHA 4MNOA 4HIOA 1EOVA 4KHPL 3STBD 2K75A 1YHBA 2YTVA 4L5TA 3AEVA 4NPSA 1L2FA 5GAGC 2OTLA 3KLWA 1EQQA 4NXML 1NE3A 3F1ZA 4L5RC 1Y1VG 3HOVG 5FLMH 4NXMQ 4GN3B 1UWVA 2UUBQ 1PFSA 3PCOB 1EFWA 2WB1G 3J7ZC 3HOWH 3A5ZB 1JE5A 2AKWB 1VQNA 3ICEA 4YHHL 2IT1A 3E0EA 1LYLA 4IFDG 3S1MH 2VQFQ 1M1KC 1PH6A 1J5EL 2UXCL 3IRBA 1MIUA 1VS0A 5BR8L 3RNUA 3GD7A 4X65L 1J5EQ 2UXCQ 3W5OA 2WP8J 1P16A 4PMWA 4PG3A 3I56A 5LMUL 2R7FA 3PIOA 4X65Q 1FVIA 2OTJA 4C3JH 1Q81C 4GKJL 5LMUQ 2I5LX 3CC2A 4DPGA 2NZHA 3S14H 1R9TH 4TVAB 1QZGA 2GN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXD A;  2CQO A;  2HIV A;  2JA7 G;  2NVY H;  1VQ9 A;  2KCM A;  5M3M H;  4OX9 Q;  3PO3 G;  1SRU A;  2D62 A;  5GQO A;  5IYB H;  1PHJ A;  2N78 A;  3HFZ B;  2WAQ E;  3NEM A;  1Q8K A;  1E24 A;  3ER0 A;  1PVO A;  2VZA A;  4BBR H;  3M7N A;  2VNU D;  4NB3 A;  3RLF A;  4R4Q A;  4JI1 L;  1X3E A;  4K0K L;  2OQK A;  1S72 A;  4JBK A;  4LUV A;  3M3Y H;  2PQA B;  4JI1 Q;  2H5X A;  5IP9 H;  5ELN A;  4DR5 L;  1CKM A;  2BH8 A;  2I5M X;  2L15 A;  3M85 A;  4K0K Q;  1VQH A;  1M90 C;  3L2P A;  4POG A;  3S1R H;  3S1Q H;  1K0R A;  4AYB E;  1CKO A;  3HOW G;  1IBL L;  2UU9 Q;  1XMQ L;  4QL5 A;  4HID A;  4GNX B;  3ULP A;  1PV4 A;  1IBK L;  1IBL Q;  2ID0 A;  2GVB A;  4GOP A;  1K73 C;  3GTP H;  4DR6 L;  2K50 A;  2R6G A;  3J81 i;  4GLX A;  3S15 H;  1E22 A;  5FJ8 H;  1IBK Q;  1A8V A;  4GOP C;  3KF6 A;  4BXX G;  3HOZ H;  1Z9F A;  2PI2 A;  2NVX H;  1SE8 A;  4R4O A;  2OWO A;  4P72 A;  4C2M H;  2VQE L;  2YU9 H;  4B3T Q;  1QVC A;  1XNR L;  1NJI C;  3HKZ E;  1VQK A;  3CCS A;  4DUZ L;  3UE0 A;  4IFD J;  4OWW B;  2N49 A;  3G71 A;  4AIM A;  4BY1 G;  2VQE Q;  4A3F G;  3KJO A;  1S3O A;  2ZTE A;  2ALY B;  4DUZ Q;  2WAQ G;  1LUZ A;  4C3H H;  1HZ9 A;  1VQ4 A;  2C35 B;  5M3M G;  3PF5 A;  1E3P A;  2YV5 A;  3J81 c;  2EIF A;  3VDY A;  4A93 H;  4IPD A;  3S24 A;  1YBY A;  2XTI A;  4QJF A;  3TRE A;  4X66 L;  5HY6 A;  4BBR G;  4YY3 L;  4RG1 A;  3CXC A;  4LF8 L;  2UXD Q;  4FDB A;  4BA1 I;  3H0G H;  1MKH A;  4JI7 Q;  1XPU A;  4JOI A;  1XJV A;  4DR4 Q;  3FKI G;  3HKS A;  3UE1 A;  4X66 Q;  4LF8 Q;  4A3K H;  5JJK A;  3MXN B;  1N32 L;  1OXS C;  3CC4 A;  4DV1 L;  4LF4 L;  4JOI C;  3M4P A;  4AYB G;  2F52 A;  5IP9 G;  1B70 B;  4IPG A;  3BU2 A;  1N32 Q;  3AYH B;  2ZJR A;  3S16 H;  3I4M H;  4DV1 Q;  4LF4 Q;  3RR5 A;  2CKZ B;  2NZO A;  4OO1 I;  4B3M L;  1I94 L;  1OXV A;  3UDI A;  3K8A A;  3J80 c;  3M4O H;  1IZ6 A;  2DUD A;  1JJC B;  1I5F A;  4B3M Q;  5C0X I;  1I94 Q;  1A62 A;  1N9W A;  2JA5 H;  2K14 A;  4LFC L;  2IHE A;  1VQP A;  2Y0S G;  3B6Y A;  1SMX A;  2WB1 E;  3HKZ G;  1G51 A;  3STB C;  4A3C H;  1N34 L;  1WYD A;  1MJC A;  1KRS A;  2NVQ H;  3T1H Q;  5ELO A;  1CSP A;  1HZB A;  4DV4 L;  1PH2 A;  4DV6 Q;  1VQM A;  1N34 Q;  3HOU G;  1HR0 L;  1X3G A;  2ZTD A;  3PUY A;  4IPH A;  1HH2 P;  2Q2T A;  4DV4 Q;  1VQL A;  3NEL A;  1KD1 C;  3BZC A;  1JJ2 A;  1D7Q A;  1VQJ A;  4X64 L;  1BVS A;  1SRO A;  3NBH B;  2QA4 A;  3PO2 G;  4A93 G;  4LFB Q;  3CP0 A;  5C44 G;  1NTG A;  2PNH A;  4JC0 A;  2F4V Q;  2R92 H;  4X64 Q;  4BBS H;  2MO1 A;  3H0G G;  4ALP A;  4A3M H;  4OO1 G;  4DK3 C;  3HOX H;  2E5L L;  3Q8D A;  4JI5 Q;  1E7Z A;  1A63 A;  1K3R A;  3CCQ A;  3TRZ A;  5H1S E;  1RIP A;  1XMO L;  4DV0 L;  2CFM A;  4R4I A;  1D8L A;  2LXK A;  4YCU A;  1HZA A;  5C0X G;  1ASZ A;  3RZO H;  1J6Q A;  4KHZ A;  3W1B A;  4DR2 L;  4KHP Q;  1A0I A;  4AH6 A;  1XMO Q;  3GTK H;  1PYB A;  1Y14 B;  3CAM A;  3CMA A;  3CQZ H;  4A3D H;  1PH9 A;  2F3I A;  1FJG L;  4DR2 Q;  4BA2 I;  1X3F A;  2VW9 A;  4X62 L;  4KLK A;  4DR3 L;  1FJG Q;  3KDF A;  1HNX L;  4A3C G;  1AE2 A;  5GAH C;  3U4Z A;  4JV5 L;  4C3I H;  2V1C C;  4YHH Q;  5IT9 c;  4DR3 Q;  2HIX A;  3TEH B;  1Y1W H;  1N36 L;  4Y7N H;  1VQF A;  5LMN W;  5BR8 Q;  3E9I A;  1K83 H;  3DLL A;  4GKK L;  5IYC H;  1CKN A;  1X54 A;  4DV3 L;  2YTX A;  5FLX c;  5AJ3 L;  2JA9 A;  1Q12 A;  3U58 A;  1N36 Q;  4EQ5 A;  1EYG A;  3K0X A;  4XIG S;  4GKK Q;  4GOP B;  3JAM i;  1QZH A;  4P73 A;  1PH3 A;  1HZC A;  4OON A;  4A3I H;  1OXT A;  4GKJ Q;  3G4S A;  5IYD G;  3KF6 B;  4JI4 L;  1VQ7 A;  2R92 G;  1TWF H;  3RN5 A;  1E1O A;  1BBU A;  1L1O A;  4WJ4 A;  1UE6 A;  4JI4 Q;  3PGZ A;  1O7I A;  4UP7 A;  2ASB A;  4PZ7 A;  2ZJQ A;  3H3V H;  1L1O C;  2IX0 A;  1BBW A;  4YCV A;  3F2D A;  1YZ6 A;  5FLM G;  1Q82 C;  5M3F H;  3W1G A;  3H15 A;  2R93 H;  4DR5 Q;  2BH2 A;  1YIT A;  1E1T A;  1QUQ A;  2BA1 A;  1EIF A;  2MO0 A;  2NN6 I;  2PMZ E;  3G48 A;  5J3B A;  1YHQ A;  4A3G H;  1X65 A;  1PYS B;  2MFI A;  4X6A H;  5C0X J;  2JEA I;  4YWM A;  3WWV A;  1XMQ Q;  4GLV B;  3KFU A;  1K8G A;  1PH5 A;  5JEA G;  2UUC L;  4DR6 Q;  5M5W H;  1HNZ L;  2JE6 I;  2JJQ A;  4JBM A;  3PSI A;  3GDE A;  4DNI A;  3CCE A;  2Y0S E;  3G6E A;  1B7Y B;  2UUC Q;  4LF5 L;  1Q1B A;  3JC6 6;  3CCJ A;  4DUY L;  4IOA A;  3CD6 A;  4JBJ A;  2B63 H;  3U4V A;  3ULJ A;  1XNR Q;  4QGU A;  1Q46 A;  4JI0 L;  2KEN A;  4A3I G;  3CC7 A;  3I7F A;  4DUY Q;  4LF5 Q;  4YWK A;  5C4X H;  4DR7 L;  1G6P A;  3D31 A;  4EX5 A;  4DKA C;  4A3E H;  1XPR A;  4BY7 H;  3J7A 5;  4WJ3 M;  1UEB A;  5IYB G;  4JI0 Q;  4DR7 Q;  1TWC H;  2CWP A;  2N8N A;  2Z0S A;  3GTL H;  1VQ5 A;  2JA8 H;  1HJP A;  4POF A;  3M4Q A;  4YY3 Q;  1AH9 A;  2NN6 G;  3CCR A;  1TWG H;  2RCN A;  2PI2 E;  1GO3 E;  1KRT A;  1X55 A;  1UE1 A;  1V43 A;  4DAY B;  3E9H A;  1PH4 A;  3KOJ A;  4DV5 L;  2R93 G;  3F2B A;  3FHW A;  2ZJP A;  4O0A A;  4LF7 L;  3I4N H;  2A1A A;  2JA6 H;  4LUO A;  4A3G G;  3HOY H;  4DV5 Q;  1YJN A;  4JCV E;  2XGT A;  4DK6 C;  4LF7 Q;  3PUV A;  1WFQ A;  4LFA L;  1FGU A;  4GN5 A;  4OWX B;  4P71 A;  5FJ8 G;  1ASY A;  2Q2U A;  1YJW A;  2ZTC A;  3GTO H;  4GN4 B;  3HOZ G;  1PA6 A;  1BKB A;  1KXL A;  4LFA Q;  4GNX A;  3CPF A;  2Q2I A;  3A5U A;  1L0W A;  4AQY L;  5E7N A;  1V1Q A;  2B29 A;  4LFC Q;  3NEN A;  5C3E H;  2R7Z H;  2YTY A;  1T9H A;  1PH7 A;  1YJ9 A;  2I0Q A;  1RL2 A;  3KDF B;  4LF6 L;  2R7D A;  3K80 C;  3KYH C;  2CWA A;  5C4X G;  2UXB L;  1HR0 Q;  3HOV H;  4OXP A;  4O2D A;  4A3E G;  5JJL A;  4OWT B;  2A8V A;  4LF6 Q;  1LM0 A;  5JEA J;  1Z47 A;  3GO5 A;  1VQA A;  3DM3 A;  5IWA L;  3A0J A;  4DV7 L;  2UXB Q;  4A3B H;  2Z6K A;  4B3R L;  4LW1 A;  3L7Z C;  1TWA H;  2KHJ A;  2VS1 A;  4DV7 Q;  1S40 A;  2JA8 G;  1FL0 A;  4HJ7 A;  4UPA A;  2Z6K C;  4B3R Q;  1XNQ L;  2HQL A;  4A3K G;  3AFQ A;  1NMG A;  1EIY B;  4APV A;  3ERS X;  4IJH A;  4DAM A;  4H02 A;  1XNQ Q;  3A74 A;  2B3G A;  2JEB I;  2E5L Q;  3PUX A;  4LWC A;  3S1N H;  1N33 L;  3I4M G;  4UY8 C;  1GD7 A;  1VQE A;  4J15 A;  4DV0 Q;  3I4N G;  1L1O B;  5EAY A;  1KC8 C;  2D0P A;  1CUK A;  1NBW A;  1GM5 A;  1JJG A;  4RMF A;  3UDF A;  2IY5 B;  1W2B A;  3GTM H;  2JA5 G;  5LMN L;  3PIP A;  4MZ9 A;  4UP9 A;  4X62 Q;  1X6O A;  3L0O A;  3I2Z A;  1YI2 A;  1UE7 A;  3OYY A;  1HNX Q;  2R7Z G;  5C3E G;  4A76 A;  3GTQ H;  2K5N A;  5DLQ E;  1B8A A;  3AQQ A;  1Q86 C;  3CCL A;  4JV5 Q;  1QUQ B;  1VQI A;  1G29 1;  2D0O A;  3EN2 A;  2IX1 A;  2UUB L;  2VL6 A;  3ULL A;  4GS3 A;  5M5X H;  4DV3 Q;  3S17 H;  5AJ3 Q;  1K8A C;  2VQF L;  4A3B G;  2GVA A;  3PUW A;  2EQS A;  4HJ9 A;  4BBS G;  1WOC A;  3CME A;  1VQG A;  2HHH L;  2I5H A;  4A3M G;  3HOX G;  1JB7 A;  3BZK A;  4L5Q A;  3UDG A;  2HHH Q;  3EBE A;  1VQB A;  4XTC S;  1OTC A;  4BXX H;  3TQY A;  1W3S A;  4PZ6 A;  4PZ8 A;  1MJE A;  3JAM c;  2E8G A;  5IE8 A;  4R4T A;  4A3D G;  2ATW A;  1WI5 A;  1VQD A;  4IO9 A;  5IY0 A;  3ZJY C;  3CF5 A;  4BY1 H;  4YCW A;  4A3F H;  4OX9 L;  3K7U C;  3PV0 A;  2N3S A;  3H3V I;  1OXU A;  1C0A A;  1IBM L;  3F2C A;  3CW2 C;  3MEF A;  1X56 A;  2E2H H;  4A3J H;  1VQO A;  5M5Y H;  2LSS A;  3LGJ A;  2YYZ A;  3CCV A;  1IBM Q;  4B3S L;  2K5H A;  3D0F A;  1C7Y A;  1Y1W G;  5IP7 H;  3K7A H;  1JT8 A;  4QY7 A;  1TXY A;  4P75 A;  4LF9 L;  4B3S Q;  4A3L H;  1LTL A;  3FKI H;  5IYC G;  3TS2 A;  4QQB X;  3EIV A;  1KL9 A;  1VCI A;  4LF9 Q;  3T1Y L;  2A19 A;  1XPO A;  1HNZ Q;  2UU9 L;  2ZM6 L;  4MTN A;  1C9O A;  1YNX A;  1QVG A;  2JQO A;  2Q2H A;  1EWI A;  3T1Y Q;  2ES2 A;  1IL2 A;  2K5V A;  2ZM6 Q;  2E2I H;  4GLA C;  2RHS B;  4DV2 L;  3RZD H;  2VUM H;  3CCM A;  1YIJ A;  4LNQ A;  2AMC B;  1YVC A;  2QEX A;  4L5S A;  5C4J H;  1SR3 A;  3S2H H;  4JI6 L;  3K81 C;  4R1J A;  4DV2 Q;  4B3T L;  4KI0 A;  5HGQ A;  1GVP A;  2KCT A;  4Y52 H;  3AFP A;  4IOC A;  4JI6 Q;  2OQ0 A;  4ME3 A;  3TS0 A;  2K4K A;  1WCM H;  1I50 H;  1HNW L;  3HOU H;  1QVF A;  1VQ6 A;  5M3F G;  1P8L A;  4HIK A;  3PF4 A;  2KBN A;  3CPW A;  1PH8 A;  1VQ8 A;  2FXQ A;  1HNW Q;  2RHQ B;  2UXD L;  1I6H H;  2DGY A;  1KAW A;  2QGQ A;  2PQA A;  4JBW A;  3I55 A;  1U5K A;  1UE5 A;  4A3J G;  4HJ8 A;  4JI7 L;  3PO2 H;  5JJI A;  5C44 H;  2BA0 A;  3J80 i;  1EUJ A;  3U50 C;  1NMF A;  4DR4 L;  5IP7 G;  1OXX K;  4JI3 L;  2JK8 A;  1YHA A;  2RF4 A;  1SLJ A;  4A3L G;  2LXJ A;  1EQR A;  1KQS A;  4TQU S;  4JI3 Q;  4HJ5 A;  4JI2 L;  4P74 A;  4R4C A;  5K36 G;  2B63 G;  4GNX C;  4NXN L;  4AQY Q;  1TWH H;  3FP9 A;  1U0L A;  1KHI A;  4JI2 Q;  5GAD C;  2IHF A;  1Y1V H;  3BJU A;  3I4O A;  3RLO A;  1Q1E A;  3OW2 A;  4NXN Q;  4A4I A;  4BY7 G;  2UUA L;  4HJA A;  1DGS A;  1IXR A;  4UP8 A;  1SFO H;  2VUM G;  4JI8 L;  3SGI A;  3OTO L;  4JG2 A;  4QIW E;  2UUA Q;  5GRO A;  1CKN B;  4DR1 L;  3T1H L;  4JI8 Q;  3PUZ A;  5IWA Q;  3OTO Q;  4A75 A;  1N8R C;  1AE3 A;  4DV6 L;  1X9N A;  3S2D H;  1CSQ A;  1IYJ B;  3M9B A;  2CCZ A;  3J81 j;  1H95 A;  2MNA A;  4DR1 Q;  4IPC A;  2KHI A;  1PH1 A;  1XTD A;  2E2J H;  1KIX A;  3GTG H;  1WCM G;  1K9M C;  3RLN A;  4JYA L;  4YWL A;  1NY4 A;  2AHO B;  4IFD I;  1JMC A;  2AWN A;  4IJL A;  4LFB L;  3CCU A;  2JA6 G;  4JYA Q;  3HOY G;  4HIM A;  1N33 Q;  2F4V L;  1GKH A;  1VQC A;  2VY3 A;  2HT1 A;  1I3Q H;  3KF8 B;  1SN8 A;  1HR0 W;  2NVT H;  3GTJ H;  3RN2 A;  1Q7Y C;  2JA7 H;  5GAE C;  5IYD H;  3UDX A;  2AWO A;  4JI5 L;  3PO3 H;  1WJJ A;  2WFW A;  4LUZ A;  2K52 A;  3KJP A;  5LMN Q;  3F8T A;  2OCE A;  1V9P A;  1YEZ A;  2MQH A;  4MNO A;  4HIO A;  1EOV A;  4KHP L;  3STB D;  2K75 A;  1YHB A;  2YTV A;  4L5T A;  3AEV A;  4NPS A;  1L2F A;  5GAG C;  2OTL A;  3KLW A;  1EQQ A;  4NXM L;  1NE3 A;  3F1Z A;  4L5R C;  1Y1V G;  3HOV G;  5FLM H;  4NXM Q;  4GN3 B;  1UWV A;  2UUB Q;  1PFS A;  3PCO B;  1EFW A;  2WB1 G;  3J7Z C;  3HOW H;  3A5Z B;  1JE5 A;  2AKW B;  1VQN A;  3ICE A;  4YHH L;  2IT1 A;  3E0E A;  1LYL A;  4IFD G;  3S1M H;  2VQF Q;  1M1K C;  1PH6 A;  1J5E L;  2UXC L;  3IRB A;  1MIU A;  1VS0 A;  5BR8 L;  3RNU A;  3GD7 A;  4X65 L;  1J5E Q;  2UXC Q;  3W5O A;  2WP8 J;  1P16 A;  4PMW A;  4PG3 A;  3I56 A;  5LMU L;  2R7F A;  3PIO A;  4X65 Q;  1FVI A;  2OTJ A;  4C3J H;  1Q81 C;  4GKJ L;  5LMU Q;  2I5L X;  3CC2 A;  4DPG A;  2NZH A;  3S14 H;  1R9T H;  4TVA B;  1QZG A;  2GN5 A; 
#chains in the Genus database with same CATH topology
 3ND8 A;  2CQO A;  2HIV A;  2JP1 A;  4OX9 Q;  3PO3 G;  3QIA A;  3BYY B;  1PVO A;  2WAQ E;  3AMU A;  1E24 A;  2VZA A;  3QR8 A;  1LV9 A;  5CV6 A;  4JI1 L;  2F0S A;  2OQK A;  1RHP A;  1A3V A;  1LTR D;  5ELN A;  1CKM A;  2BH8 A;  1SFO B;  1M90 C;  4ILW A;  3S1Q H;  1K0R A;  1CKO A;  1IBL L;  4J8Q A;  4QL5 A;  4X3T A;  2F0M A;  2XWB B;  1PV4 A;  1C8C A;  2GVB A;  1QB5 D;  1K8M A;  2R6G A;  3GTG B;  3S15 H;  1E2W A;  4GOP C;  3HOZ H;  1Z9F A;  4K5W A;  3PIO 3;  4R4O A;  2NVX H;  1EY8 A;  2VB3 X;  2ICE C;  3BDL A;  3UE0 A;  4OWW B;  2N49 A;  4BY1 G;  3BYT B;  3R2I A;  2B2V A;  2F0U A;  4DUZ Q;  2O5I C;  1BQQ T;  2C35 B;  3G7L A;  5M3M G;  5KRU A;  2FMC A;  3J81 c;  3VDY A;  2TMP A;  2XWJ B;  4CKC A;  3CXC A;  1SE2 A;  3DXJ C;  4JI7 Q;  4G7H C;  4DR4 Q;  3HKS A;  4X66 Q;  4OO1 H;  1V1O A;  5FLX E;  4A3K H;  3CC4 A;  3I73 A;  4PQX A;  4JOI C;  3M4P A;  5IP9 G;  3BU2 A;  4RCN A;  1EQT A;  3S16 H;  3D6W A;  1GJX A;  3RR5 A;  4OO1 I;  4TKO B;  5A2Q E;  4HSP A;  1EFI D;  3UDI A;  1G8Z D;  2XVS A;  1I94 L;  4LJZ C;  1EOT A;  1I5F A;  4FP5 D;  4B3M Q;  4Q5V A;  2K14 A;  1D1K A;  2WB1 E;  3HKZ G;  2BCO A;  1N34 L;  3T1H Q;  5ELO A;  4C3J B;  1CSP A;  1HZB A;  1ET6 A;  3HOU G;  1X3G A;  3K58 A;  2ZTD A;  1NAP A;  3S14 B;  1TU2 B;  2FIN B;  1JJ2 A;  1CK1 A;  1S4Z A;  3VYT A;  3PO2 G;  3OMG A;  4LFB Q;  4BBR B;  1ICF B;  4R8N A;  2R92 H;  4BBS H;  1NNX A;  3H0G G;  1ZYR D;  3MWY W;  4DF7 A;  2SNM A;  3Q0A A;  4JI5 Q;  3CCQ A;  3E0J A;  4ZLT F;  5J22 A;  5H1S E;  1EZ6 A;  4DFA A;  5C0X G;  1EZ8 A;  3RZO H;  2F0T A;  3W1B A;  3QJY A;  4DR2 L;  4OHJ A;  1PYB A;  4A3D H;  3J81 E;  2PPB C;  4FNF A;  2Y0S B;  1HNX L;  1AE2 A;  4DR3 Q;  2V1C C;  4YHH Q;  2HIX A;  5COY A;  1WTW A;  1STB A;  4RKB A;  3NHH A;  1EY7 A;  4DV3 L;  1FNU A;  3U58 A;  1MGS A;  3K0X A;  1TS5 A;  2DY8 A;  4XIG S;  1QZH A;  1VF5 C;  1PFM A;  2A6H C;  4HMJ A;  3G4S A;  4JI4 L;  1E1O A;  4WJ4 A;  4V0B A;  2K01 A;  4UP7 A;  3SXH A;  3FDT A;  1L1O C;  2EOT A;  5E3F A;  4RKL A;  3I4L A;  4YCV A;  3F2D A;  5C4Z A;  4FF1 A;  2KHS A;  3W1G A;  1B50 A;  4KJN A;  2JA5 B;  1QUQ A;  1YHQ A;  5J3B A;  2EDG A;  4X6A H;  2JEA I;  2K05 A;  5EPK A;  2D2C C;  3KFU A;  5J1Z A;  2F0L A;  3V05 A;  4B9X A;  5JEA G;  3J80 L;  3CRK C;  2UUC Q;  5DM7 3;  5K36 H;  3MXG A;  4JBJ A;  3U4V A;  4BWG B;  2B2U C;  4A3I G;  4IQZ A;  1QNK A;  1Q3L A;  2L55 A;  2P5Z X;  1DCZ A;  4BY7 H;  4EX5 A;  1CA5 A;  4A3M B;  2LY7 A;  4JI0 Q;  4DR7 Q;  1G91 A;  2EYJ A;  2Z0S A;  3GTL H;  2N55 A;  1PYW D;  1HJP A;  3M4Q A;  1D6E C;  1AH9 A;  2NN6 G;  3R2T A;  1TWG H;  3OSO A;  2DN8 A;  4ZK9 B;  3GTK B;  2X6G A;  2HDM A;  3CQZ B;  4WJW A;  1TR5 A;  2Q8I B;  3VA5 A;  5DAU A;  4ZKC B;  2R93 G;  2ZJP A;  4LF7 L;  2A1A A;  4H13 C;  4DV5 Q;  1SYE A;  4DNT B;  2XGT A;  4C3I B;  2E74 C;  1WFQ A;  1FGU A;  1ASY A;  3TME A;  1ONL A;  3HOZ G;  4NP5 A;  1IW7 C;  1DD2 A;  2B29 A;  4HCE A;  5KYI A;  5C3E H;  2KCC A;  1PRT C;  2DJG C;  2YTY A;  1YJ9 A;  2I0Q A;  1RL2 A;  4LF6 L;  4K6D A;  4DN4 M;  3H6M A;  5KNB A;  3KBX A;  3HOV H;  1TWF B;  4N9P A;  4O2D A;  1T5X D;  2EJM A;  5IT9 L;  3GO5 A;  2JYO A;  1CFM A;  2F0F A;  3DM3 A;  4DV7 L;  5IWA L;  2UXB Q;  3A8K E;  2O4X A;  1F9Q A;  2KHJ A;  1HHV A;  3OWE B;  5C4H A;  3HRZ C;  4HJ7 A;  2JA8 G;  4B3R Q;  1K8O A;  1XNQ L;  5JVH 3;  4A3K G;  3AFQ A;  5JOB A;  3ERS X;  4KY7 A;  4DAM A;  4H02 A;  3S1N H;  1JR0 D;  3A8I E;  1N33 L;  2Z1C A;  1GD7 A;  5I6Y A;  1IYU A;  4A3G B;  1AW7 A;  2D0P A;  1CUK A;  4QCL A;  1W2B A;  4FF2 A;  1SSO A;  5CV5 A;  5ISR A;  4MZ9 A;  1NR4 A;  5CV4 A;  1SMY C;  3L0O A;  1S5B D;  3SVM A;  3I2Z A;  1YI2 A;  1HNX Q;  2R7Z G;  2B63 B;  1QUQ B;  1IKL A;  5KYL A;  5C4X B;  2UUB L;  3ULL A;  2G9D A;  1SE4 A;  4MTK A;  3F2U A;  4GS3 A;  4DV3 Q;  3VA7 A;  3NWT A;  4CDC C;  4BBS G;  2B2W C;  1PTO C;  1WOC A;  4DA2 A;  1VQG A;  2F0G A;  3MFG A;  2I5H A;  1JB7 A;  3UDG A;  3EBE A;  1WTR A;  1VQB A;  1TII D;  1X32 A;  2PZT A;  4XTC S;  1OTC A;  4XDX A;  1W3S A;  2M00 A;  1MJE A;  3EVQ A;  1HXY D;  4A3D G;  1RKN A;  1WI5 A;  1Y69 U;  3NP8 A;  4YCW A;  1F9S A;  3K7U C;  3H3V I;  2MP1 A;  1CZG A;  3T16 A;  2E2H H;  4RH6 A;  1VQO A;  2LSS A;  3LGJ A;  3S9W A;  3CCV A;  2K5H A;  5IP7 H;  1BDO A;  1VMP A;  4B3S Q;  4A3L H;  1IKM A;  1LTL A;  4QQB X;  3NE5 B;  3URY A;  2RSN A;  3NTH A;  1T5E A;  4MTN A;  2G9H D;  1C9O A;  4H44 C;  2Q2H A;  3T1Y Q;  1TWA B;  1IL2 A;  2K5V A;  2J4X A;  4KD3 A;  4OIJ A;  4GLA C;  3CCM A;  1YIJ A;  2X6L A;  4L5S A;  2F0V A;  4R1J A;  2WKC A;  4KI0 A;  2R61 A;  4B3T L;  2KCT A;  3K5M A;  3FPU B;  2OQ0 A;  3SK4 A;  3TS0 A;  1WCM H;  1DON A;  3CPW A;  2UXD L;  3N6R A;  3I55 A;  1LT5 D;  3J80 i;  1EUJ A;  2B2T C;  3BDO A;  4L6T B;  3I72 A;  2LXJ A;  1EQR A;  2XRQ D;  2XSC A;  1C4Q A;  4R4C A;  5K36 G;  3I8Z A;  1GUG A;  1R4Q B;  1TWH H;  3A8J E;  3HOW B;  4BY7 G;  1KNE A;  2UUA L;  2VUM G;  3OTO L;  4QIW E;  2H1E A;  5GRO A;  3IKJ A;  5IWA Q;  5DEH A;  3SDZ A;  4DV6 L;  1KAA A;  3I91 A;  1H95 A;  2JSO A;  1EYA A;  5IIF A;  3RLN A;  2AQ3 B;  4YWL A;  2EZV A;  4IFD I;  4TRD A;  1GUN A;  4DXF A;  4RGM A;  4JYA Q;  3FEW X;  1N33 Q;  1VQC A;  1I3Q H;  2G5D A;  1D2B A;  1JQY D;  1SNQ A;  3GTJ H;  3RN2 A;  3K0Y A;  2AWO A;  3JAM L;  3AB9 A;  3PO3 H;  1MBY A;  1DJR D;  3FKI B;  2IW3 A;  1ILP A;  1V9P A;  3Q24 A;  4MNO A;  1L0X B;  1EOV A;  2ZXP A;  3VR4 A;  4AYB B;  3STB D;  1SJH D;  1YHB A;  2O2L D;  1B2T A;  1EY0 A;  4B9W A;  3OMC A;  4I7Z C;  1Y1V G;  3HOV G;  1E2Z A;  1Q8I A;  2UUB Q;  1JE5 A;  2IT1 A;  3BDC A;  1X3Q A;  2NZ1 D;  3QO2 A;  1FNV A;  3K59 A;  3RNU A;  2FHT A;  3AU7 A;  3GD7 A;  4X65 L;  1I50 B;  2UXC Q;  3W5O A;  2D5D A;  2WP8 J;  4PG3 A;  1FVI A;  4I65 A;  1A2U A;  1JIC A;  1HUM A;  1I6H B;  2F0J A;  5EKI A;  5C44 B;  2EXD A;  1VQ9 A;  2KCM A;  5M3M H;  5GQO A;  1PHJ A;  3HFZ B;  1Q8K A;  3NXW A;  2VNU D;  4NB3 A;  2EY6 A;  3RLF A;  3M3Y H;  4KY5 A;  5IP9 H;  2I5M X;  4C1N I;  4FXG C;  3M85 A;  4K0K Q;  1VQH A;  1EYD A;  3L2P A;  3S1R H;  3A7L A;  1XMQ L;  4KJO A;  4GNX B;  3S2D B;  3NPP A;  1K73 C;  4EGV A;  4DR6 L;  2F1M A;  2K50 A;  3KBG A;  1IBK Q;  5FJ8 H;  2PI2 A;  2OWO A;  1XWE A;  3IFD A;  4C2M H;  4B3T Q;  1XNR L;  1NJI C;  1VQK A;  2L0C A;  5JJZ A;  4DUZ L;  3G71 A;  3L3O C;  1EU4 A;  4AIM A;  5KGU A;  2VQE Q;  3KJO A;  1DXM A;  2ALY B;  1FR3 A;  2WAQ G;  1LUZ A;  2JA7 B;  1HZ9 A;  2K33 A;  3PF5 A;  1E3P A;  2B2V C;  4I7A A;  1YBY A;  2XTI A;  4QJF A;  4X66 L;  4BBR G;  2UXD Q;  2WAC A;  4FDB A;  4BA1 I;  3H0G H;  1MKH A;  3G6J B;  3UE1 A;  1CQF A;  5JJK A;  2QCP X;  2BDO A;  1DZ1 A;  2QW7 A;  1JWM D;  5C0X H;  2ZJR A;  3I4M H;  4DV1 Q;  4LF4 Q;  3H94 A;  4QUC A;  4B3M L;  2M2L A;  4CBV A;  3M4O H;  3VR5 A;  2NYZ D;  4KKT A;  2K5D A;  1JJC B;  5CR3 A;  1MHW C;  1QWY A;  2EPB A;  5C0X I;  4LFC L;  2IHE A;  2Y0S G;  1V8Q A;  1MJC A;  2L12 A;  4JVZ A;  4DV6 Q;  1VQM A;  2F4I A;  4IPH A;  1HH2 P;  1R9T B;  4DV4 Q;  3NEL A;  3VR6 A;  1KD1 C;  3BZC A;  5DNF A;  2K6A A;  3NBH B;  2QA4 A;  1E2V A;  1CQV A;  1NTG A;  1STY A;  2F0P A;  4U67 3;  2MO1 A;  3P7J A;  1AP0 A;  1Z6H A;  1EY6 A;  3HOX H;  1E7Z A;  1K3R A;  2AQ1 B;  2NWG A;  4C56 C;  1RIP A;  4HTH A;  1ASZ A;  1HZA A;  4LAA A;  5A2Q L;  1A0I A;  5FO7 B;  4AH6 A;  1Y14 B;  2EYO A;  5KEE A;  1PH9 A;  3GTP B;  1OO9 B;  2ZXR A;  4DR3 L;  3KDF A;  1S5C D;  2R3Z A;  1PFN A;  1WTP A;  1BCP B;  5GAH C;  2BDN A;  2XN9 C;  2YU9 B;  4DGZ A;  1SYC A;  1VQF A;  3D8G A;  2V4D A;  5IYC H;  2KEC A;  4KKU A;  1X54 A;  1BOS A;  5FLX c;  1N36 Q;  1EYG A;  4C3H B;  5K5P A;  3JAM i;  4N8F A;  4A93 B;  1UEA B;  1HZC A;  1IL8 A;  4A3I H;  1OXT A;  3MC0 B;  4K6L A;  3GV6 A;  1KNA A;  2HCC A;  1GHK A;  1RJT A;  1BBU A;  3BZD B;  3HG9 A;  3PGZ A;  2ZJQ A;  4OEM B;  5EJW A;  2NN6 H;  3J81 L;  4HED A;  2MHV A;  5EBD A;  1I4P A;  4F87 A;  1Q82 C;  4WOR A;  1QNU A;  5M3F H;  4IUV A;  2R93 H;  1SXT A;  3EFX D;  2NN6 I;  2BA1 A;  5G3L F;  4F7X A;  1X65 A;  2MFI A;  1LTT D;  1XMQ Q;  2NVQ B;  4G4K A;  1LT4 D;  1K8G A;  1PH5 A;  2UUC L;  4H7B A;  5FKA C;  4DR6 Q;  5M5W H;  4ZYS A;  3PSI A;  3DM1 A;  1Y8N B;  2Y0S E;  1Q1B A;  3CCJ A;  4IOA A;  1B3A A;  3CD6 A;  1XNR Q;  1JOR A;  3T56 B;  4JI0 L;  4DR7 L;  4LF5 Q;  3CC7 A;  4DUY Q;  4FYD A;  2AUK A;  1QIL A;  1XPR A;  4DKA C;  2RDF A;  4N9T A;  1TWC H;  4CJ0 B;  2CWP A;  5CGK A;  2I07 B;  2JA8 H;  4CHT B;  1WTV A;  1DOK A;  1V1P A;  5JVG 3;  1U4M A;  4DV5 L;  2J7Z A;  3F2B A;  3TBI B;  2JA6 H;  1A6X A;  4A3G G;  3HOY H;  1PMR A;  3PUV A;  2EE1 A;  3I70 A;  1Y1W B;  4Y7N B;  4P71 A;  3W3A A;  5FJ8 G;  1EQV A;  1K83 B;  3J7Y W;  3SEB A;  5EQ0 A;  3X3M A;  1KXL A;  3BS1 A;  4LFA Q;  2Q2I A;  2LFN A;  1L0W A;  4AQY L;  4LFC Q;  2R7Z H;  4CJ2 C;  4ZCK A;  1PH7 A;  3W2D A;  3KDF B;  2F0I A;  3KYH C;  1B53 A;  2CWA A;  5C4X G;  2UXB L;  4A3E G;  5JJL A;  4OWT B;  1LM0 A;  1Z47 A;  3A7A B;  1LO5 D;  2Z6K A;  4B3R L;  3GQB A;  4LW1 A;  2VS1 A;  1EU3 A;  1S40 A;  1FL0 A;  4UPA A;  3KLR A;  1NMG A;  4APV A;  3DHQ A;  5C3X A;  3A74 A;  2B3G A;  2JEB I;  2NTS A;  2Q8R E;  3I4M G;  5TSS A;  1KDC A;  3I4N G;  2KUM A;  5FO9 B;  2PO4 A;  1GM5 A;  2CW0 C;  4QB4 A;  3RUZ A;  3GTM H;  2FMM A;  4UP9 A;  1B44 D;  1X6O A;  4ZUJ A;  4DAP A;  1I4Q A;  2EY2 A;  3RMH A;  3R3O A;  5DLQ E;  3AQQ A;  3CCL A;  1CT1 D;  4OIK A;  3FMC A;  1VQI A;  2D0O A;  3EJI A;  2IX1 A;  3S17 H;  1HPC A;  2IPK D;  2VQF L;  1YNJ C;  4A3B G;  4HJ9 A;  4OEL B;  4ZAI A;  2DJF C;  4BS9 A;  2F3W A;  2JN4 A;  3HOX G;  5G3L D;  4L5Q A;  1O78 A;  2HHH Q;  4LK1 C;  3FPP A;  1SE3 A;  1PZI D;  4BXX H;  1J9O A;  4PZ8 A;  1G2T A;  2E8G A;  1PTO H;  4R4T A;  4NW2 A;  3ITP A;  1KTK A;  5EBC A;  2K03 A;  5T1G A;  4PNY A;  2QDL A;  3ZJY C;  4A3F H;  3PV0 A;  2I46 A;  1C0A A;  3F2C A;  1X56 A;  2RDG A;  4CKE A;  3R93 A;  1IBM Q;  4B3S L;  2DNC A;  1NCV A;  1V1P B;  2KVM A;  4KD4 A;  1JT8 A;  4QY7 A;  4P75 A;  4WRD A;  4QUF A;  5IYC G;  3EIV A;  4CGY B;  4LF9 Q;  3T1Y L;  2UU9 L;  3OIP A;  5IGC A;  4UAI A;  3P1H A;  1YNX A;  5IGE A;  2ES2 A;  2ZM6 Q;  1HTP A;  4Q0F A;  2VUM H;  3ERQ A;  4LNQ A;  5C4J H;  2N88 A;  2F0K A;  3S2H H;  4DV2 Q;  5HGQ A;  1NUC A;  4DAV A;  1H9M A;  4K8I A;  2NB0 A;  1M8A A;  5CV9 A;  5M3F G;  2B39 A;  4JK1 C;  4HIK A;  4HAE A;  1PH8 A;  1VQ8 A;  3M4Y A;  3NTK A;  2RHQ B;  1HUN A;  4IN3 A;  1KAW A;  1UE5 A;  4HJ8 A;  2NUC A;  2BA0 A;  2J0T D;  3U50 C;  5DM6 3;  3Q22 A;  4M8A A;  3GTQ B;  2JK8 A;  1K28 A;  1SLJ A;  2LKV A;  3IL8 A;  4RAU C;  3IAY A;  5IOC A;  2K32 A;  1M4V A;  5M5X B;  2AQ2 B;  4GNX C;  3A55 A;  4AQY Q;  1STH A;  4JI2 Q;  3FP9 A;  1KHI A;  1Y1V H;  1Q1E A;  4NXN Q;  1FNW A;  1DGS A;  1SFO H;  5EKK A;  1CTM A;  4A75 A;  1N8R C;  4G7O C;  2CCZ A;  3D6C A;  2MNA A;  4DR1 Q;  3T13 A;  2KHI A;  3E6Z X;  1XTD A;  4RFB A;  1PH1 A;  1ZKO A;  2E2J H;  3GTG H;  1K9M C;  4JYA L;  4BY1 B;  5I6W A;  4IJL A;  1H9K A;  2JA6 G;  3HOY G;  3MXN A;  4A3J B;  5M5Y B;  1HR0 W;  2A5H A;  3K7A B;  1QE6 A;  1EEI D;  4LUZ A;  1I4R A;  3F8T A;  2OCE A;  4HIO A;  3M3Y B;  3NTI A;  4DXG A;  4IUR A;  1IW7 D;  1L2F A;  5GAG C;  1FYC A;  1WTO A;  2EYL A;  4L5R C;  1A2T A;  5FLM H;  2E2I B;  1I4X A;  5I9O A;  4GN3 B;  1UWV A;  1EFW A;  1KLG D;  5JAV A;  3BG3 A;  2L9H A;  3E0E A;  3S1M H;  2VQF Q;  3HKZ B;  1M1K C;  1PH6 A;  1BBX C;  2UXC L;  4RGT A;  1MIU A;  4K5V A;  1J5E Q;  3HOU B;  3RD4 A;  5FO8 B;  1P16 A;  3I56 A;  2R7F A;  1ENA A;  2KCN A;  4C3J H;  1W6K A;  3J80 E;  5LMU Q;  3PO2 B;  3EQL C;  1U4P A;  4DPG A;  3S14 H;  2JA7 G;  2NVY H;  3H0G B;  3NUC A;  4RHR A;  2N78 A;  3NEM A;  1F9P A;  3EA6 A;  4BBR H;  4RGN A;  2RBM A;  2E2D C;  3NSW A;  4R4Q A;  5ELF A;  4UDU C;  1X3E A;  4K0K L;  1MD2 D;  1S72 A;  4LUV A;  4JPB W;  1K3B C;  2H5X A;  3HP3 A;  2NTT A;  5BN4 A;  3T4A C;  1X3P A;  1BCP C;  1CZW A;  4AYB E;  1WD1 A;  5E4X A;  2UU9 Q;  4HID A;  1O7Z A;  4Z9C B;  4ULL A;  3TP6 A;  1IBK L;  4RHS A;  1PTO D;  4GLX A;  1CA6 A;  2EYH A;  1A8V A;  1IHZ A;  2HCI A;  4BXX G;  1SE8 A;  2VQE L;  4CJ1 B;  4A3F G;  1S3O A;  1JE4 A;  2NVT B;  2LMC B;  3BVG A;  4XQJ A;  2X69 A;  3V2T A;  5L37 A;  2YV5 A;  3S24 A;  4V19 0;  3TRE A;  4WFN 3;  5IT9 E;  5HY6 A;  4YY3 L;  4RG1 A;  5E4W C;  4ME5 A;  5M9O A;  1XPU A;  2RSO A;  4LF8 Q;  3MXN B;  3TSS A;  4DV1 L;  4LF4 L;  1JWU D;  4IPG A;  1N32 Q;  1SNM A;  2A69 D;  3KLS X;  2RDH A;  1EIH A;  4K8J A;  1FD7 D;  1OXV A;  3K8A A;  4FO2 A;  3OW7 A;  1IZ6 A;  2JA5 H;  1A62 A;  1N9W A;  1JB3 A;  4IUP A;  4O42 A;  5ELB A;  3B6Y A;  3P20 A;  3STB C;  3GP7 A;  1KRS A;  4DV4 L;  4KK7 A;  2RVL A;  1HR0 L;  3PUY A;  1BR9 A;  2Q2T A;  3MEH A;  1WTQ A;  1ILQ A;  3SHL A;  3KUP A;  3VYS A;  1D7Q A;  4A93 G;  2Q8T A;  1HTL D;  2BE5 D;  4H0L C;  4N8X 1;  4X64 Q;  4ALP A;  4A3M H;  3E5S A;  3MXU A;  2E5L L;  3DEP A;  1D5Z C;  4X3K A;  3LX0 A;  4HSV A;  2PMZ B;  2CFM A;  4R4I A;  1D8L A;  4YCU A;  4DV0 L;  3S1Q B;  1R4P B;  1XMO Q;  3GTK H;  3CMA A;  3CQZ H;  2F3I A;  1RF2 D;  1X3F A;  1TKW B;  1Y8O B;  4OL7 A;  4X62 L;  3HGB A;  2VW9 A;  1BXT A;  4KLK A;  3S15 B;  3TZD A;  1FJG Q;  2Z6B A;  1HQM C;  1ZXT A;  4A3C G;  3HOZ B;  2NVX B;  2PZW A;  4C3I H;  5CV8 A;  3TEH B;  2KJX A;  1HQR D;  4P2C B;  1N36 L;  4KKS A;  2OEO A;  4IUQ A;  3DLL A;  4RA8 A;  1CKN A;  2YTX A;  5AJ3 L;  1CHQ D;  2JA9 A;  2F03 A;  4GKK Q;  4ODG A;  1PH3 A;  4P73 A;  2MGS A;  3H3V C;  2OT2 A;  4JW0 A;  1LLR D;  3QOJ A;  5CYU A;  1TWF H;  2B8G A;  3RN5 A;  1VMC A;  4A3K B;  1UE6 A;  4IAL A;  2EJG C;  1O7I A;  1HRJ A;  1LT3 D;  3S16 B;  1BBW A;  3SK8 A;  4CDD C;  5FLM G;  1S5D D;  3M7G A;  1JC7 A;  2BH2 A;  2MO0 A;  1EIF A;  2A68 D;  3G48 A;  4A3G H;  1PYS B;  1SYB A;  3WWV A;  1TS4 A;  2L1B A;  2LS0 1;  1GXD C;  3BVM A;  2JE6 I;  4JBM A;  2HQE A;  4DNI A;  3CCE A;  1ML0 D;  1O80 A;  3CHB D;  1B7Y B;  4C3J G;  4LF5 L;  3JC6 6;  4DUY L;  4F8M A;  2B63 H;  4QGU A;  5D3I B;  1Q46 A;  2R92 B;  2BOS A;  1B3Q A;  4YWK A;  5C4X H;  4BBS B;  4A3E H;  3J7A 5;  1UEB A;  2EY5 A;  2XRS D;  2Z4I A;  1YNN C;  2F0D A;  1A3U A;  3TP8 A;  4POF A;  2CQA A;  1PZK D;  4R9W A;  4YY3 Q;  1EWC A;  3RZO B;  2RCN A;  2Z9H A;  1KLU D;  2PI2 E;  1X55 A;  1UE1 A;  2FJ2 A;  4A3D B;  3E9H A;  2CH4 W;  4O0A A;  5COR A;  2EVB A;  1DOL A;  3H91 A;  1VDZ A;  4LUO A;  3I4N H;  4CKB A;  1YJN A;  1LT6 D;  1EY4 A;  1D1I A;  3OIQ A;  2B2Y A;  4DK0 A;  3SE0 A;  4LFA L;  1F77 A;  5FOB B;  4OWX B;  2RA4 A;  3OHX C;  2HDL A;  2Q2U A;  2ZTC A;  3GTO H;  1PA6 A;  1BKB A;  1HA5 A;  3JAM E;  3CPF A;  2MJ8 A;  2ZT9 C;  1V1Q A;  2WIN B;  4QF4 A;  3J7A F;  2MPM A;  1T9H A;  3IFT A;  4J6H A;  2R7D A;  1HR0 Q;  2A8V A;  1SNO A;  1PZJ D;  1KDA A;  4A3B H;  3KK7 A;  3L7Z C;  1TWA H;  1TS2 A;  5FLX L;  2VB2 X;  2MUY A;  2L5T A;  1GUO A;  5C5L A;  2Z6K C;  4PMB A;  2QDB A;  1GOZ A;  1EY5 A;  4IJH A;  1PLF A;  3D4D A;  2E5L Q;  2A6E D;  3DWQ A;  3VYU A;  4DV0 Q;  1NBW A;  4RMF A;  2IY5 B;  1SNC A;  2JA5 G;  1MSH A;  1LTI D;  3PIP A;  5NUC A;  5LL6 X;  4ZUI A;  4X62 Q;  5LL6 S;  4RWS C;  3OYY A;  4A76 A;  2K5N A;  1Q86 C;  4FF4 A;  4XQN A;  2F0E A;  2RKS A;  1G29 1;  3EN2 A;  2VL6 A;  4BY7 B;  4DU9 A;  4ZKB B;  5AJ3 Q;  2GVA A;  3UI2 A;  5EKL A;  3GTL B;  2HHH L;  3J7A V;  1II3 A;  3T51 B;  4A3M G;  1TWG B;  2F3V A;  2QEJ C;  3KF8 A;  2F0O A;  5BN5 A;  3DEO A;  3QOL A;  4KN4 C;  5IE8 A;  3L9A X;  5IGD A;  4KMU C;  2ATW A;  4DNR B;  3U9S A;  4XYQ A;  4IO9 A;  5IY0 A;  2WKD A;  1A3T A;  1BNZ A;  1SDF A;  2ENB A;  1OXU A;  1SNP A;  1IBM L;  3A56 A;  1D5X C;  2M9V A;  3CW2 C;  3MEF A;  2CVR A;  4C3I G;  5AFW A;  5C3E B;  3QG1 A;  4LF9 L;  4OGQ C;  3TS2 A;  3FKI H;  1VCI A;  2OXP A;  1Y1V B;  3HOV B;  1SBB B;  4MHE A;  5D14 A;  5A35 A;  2ZM6 L;  1TT2 A;  2JQO A;  2EYM A;  1PDQ A;  5T1I A;  2K5W A;  1WVL A;  3RZD H;  2RHS B;  3NWS A;  4DV2 L;  2AMC B;  4LMQ D;  3C46 A;  3P75 A;  2SNS A;  2E2J B;  3K81 C;  3R8B A;  3S1N B;  1VF7 A;  4Y52 H;  4JI6 Q;  4ME3 A;  1I50 H;  2XIW A;  1QVF A;  2PZU A;  5CBA E;  4YIJ A;  2FXQ A;  3U9O A;  1HNW Q;  1I6H H;  2PW5 A;  4JBW A;  2PQA A;  4A3J G;  1U5K A;  5IGF A;  1ZYR C;  4K2L A;  2KEE A;  5C44 H;  1DOM A;  1I4G A;  1OXX K;  1SYG A;  1YHA A;  1QOH A;  4TQU S;  4JI3 Q;  4K5X A;  3OPO A;  4JI2 L;  4P74 A;  2B63 G;  3D4W A;  4NXN L;  5IOD A;  2H4O A;  2IHF A;  3RLO A;  3I4O A;  3OW2 A;  4G7Z C;  3S1M B;  1IXR A;  4UP8 A;  5ELD A;  3WDN A;  3SGI A;  4JG2 A;  3SK5 A;  4DR1 L;  4JI8 Q;  3PUZ A;  4C1N K;  3S2D H;  2EY1 A;  1GUT A;  1CSQ A;  3J81 j;  4RCO A;  1BUV T;  1KIX A;  1NY4 A;  2AWN A;  2SOB A;  1GHJ A;  2HD3 A;  2WAQ B;  5CC4 A;  1NSN S;  3CCU A;  2NVY B;  4HIM A;  2JXM B;  2F4V L;  2HT1 A;  2E2H B;  2VY3 A;  1XYI A;  3KF8 B;  1SN8 A;  5IYD H;  2JA7 H;  1EWH A;  3UDX A;  1SYD A;  3DMU A;  2WFW A;  2F0N A;  4IZ8 A;  4KHP L;  4L5T A;  3I90 A;  2OTL A;  1AZP A;  1U4L A;  1HCZ A;  3KLW A;  1NE3 A;  1CHP D;  2IL8 A;  3ND9 A;  1WD0 A;  1IYV A;  4NXM Q;  4KY6 A;  2L4N A;  1RDP D;  3K5O A;  3HEJ A;  3A5Z B;  1LYL A;  3QB3 A;  1J5E L;  1MI2 A;  5D65 A;  4IUN A;  1Q90 A;  2QIL A;  3IRB A;  5BR8 L;  1LAB A;  1PRT F;  3OWF A;  1WCM B;  4X3U A;  1EY9 A;  2PCF B;  4FVM A;  4PMW A;  5LMU L;  2CH4 A;  1QG7 A;  2OTJ A;  4ID6 A;  2FFK B;  2K7V A;  1Q81 C;  4GKJ L;  2I5L X;  2QKI C;  1F2L A;  1R9T H;  4TVA B;  2C5C A;  2GN5 A;  1QZG A;  2CW0 D;  4XXE A;  4MIU A;  1SRU A;  2D62 A;  1H9J A;  3D3R A;  5I2X A;  5IYB H;  5C6A A;  3ER0 A;  3KLS A;  3M7N A;  1G2S A;  5C5M A;  3ERO A;  1ESF A;  1TWH B;  4NDX A;  4JBK A;  2PQA B;  4JI1 Q;  4DR5 L;  4EQP A;  1STG A;  2E75 C;  2L15 A;  4L63 B;  3LNN A;  1S5E D;  4POG A;  2WB1 B;  3K6O A;  3HOW G;  3VR3 A;  1MSG A;  2A6H D;  3DWP A;  3ULP A;  1YNJ D;  2L11 A;  1IBL Q;  2ID0 A;  5F2D A;  4GOP A;  1I4H A;  3GTP H;  4EVO A;  3J81 i;  1QCB D;  3NBI A;  1E22 A;  3KF6 A;  3MXP A;  4CDF C;  4P72 A;  1S5F D;  2YU9 H;  1AN8 A;  1QVC A;  2Z8L A;  3HKZ E;  4M1U B;  3CCS A;  4IFD J;  1J8I A;  4ZQ3 A;  1L0Y B;  1I3Q B;  2ZTE A;  1H9S A;  3GTJ B;  1TY2 A;  1PTO F;  1ROD A;  4C3H H;  1VQ4 A;  3PO3 B;  3TDQ A;  3TP7 A;  4A93 H;  2EIF A;  4IPD A;  4LF8 L;  1SYF A;  4FXD A;  4JOI A;  2ICI A;  1XJV A;  3D4R A;  3FKI G;  2OF1 A;  2KQ3 A;  1OXS C;  2IX3 A;  1N32 L;  1RTO A;  4AYB G;  4HMI A;  2F52 A;  5I2Y A;  1B70 B;  1XX8 A;  3AYH B;  2CKZ B;  2NZO A;  1EIG A;  2HUG A;  4GZY C;  1ET9 A;  3CRL C;  1H9R A;  3J80 c;  2EJF C;  2EYF A;  1B1Z A;  2DUD A;  3CKI B;  1I94 Q;  1VQP A;  1SMX A;  4A3C H;  1G51 A;  1WYD A;  2EYP A;  2NVQ H;  1NR2 A;  1PH2 A;  4KHV A;  1N34 Q;  3NQI A;  1UUP A;  3VR2 A;  1BCP F;  2ZXO A;  1VQL A;  5M3M B;  1VQJ A;  4X64 L;  1BVS A;  1SRO A;  3LWE A;  3CP0 A;  4DAY A;  5C44 G;  4FXK C;  2PNH A;  4JC0 A;  2F4V Q;  5I9P A;  3I3C A;  1JWS D;  1TVX A;  4OO1 G;  1TY0 A;  4DK3 C;  3Q8D A;  1LTS D;  1A63 A;  1UAP A;  1SJE D;  4L8J A;  4F88 A;  3TRZ A;  1XMO L;  2LXK A;  3S1R B;  4KHP Q;  1J6Q A;  1PRT D;  4KHZ A;  1U9R A;  3NQT A;  3WOF A;  2D9U A;  4EQN A;  4HCS A;  3CAM A;  3V96 A;  1FJG L;  3C1F A;  4DR2 Q;  4BA2 I;  1D5M C;  4KN7 C;  1F2M A;  5CV7 A;  3U4Z A;  4JV5 L;  4C2M B;  5IT9 c;  1B9N A;  1Y1W H;  4Y7N H;  5LMN W;  3SK6 A;  5BR8 Q;  3E9I A;  1K83 H;  4G57 A;  4GKK L;  1Q12 A;  4EQ5 A;  4A3E B;  4GOP B;  4OON A;  1SEB D;  4GKJ Q;  5IYD G;  3KF6 B;  2R92 G;  4O1N A;  4S3S A;  1VQ7 A;  1ZEQ X;  1LTG D;  2IJ0 A;  2PNR C;  1L1O A;  4JI4 Q;  5KIX A;  1SMY D;  2ASB A;  4E6I A;  1H9S B;  4PZ7 A;  3H3V H;  2IX0 A;  1K0S A;  3I4M B;  3Q6S A;  3Q23 A;  2VXW A;  3I4N B;  1YZ6 A;  2K28 A;  1JOO A;  3M4O B;  3E3X A;  3H15 A;  4DR5 Q;  3X3N A;  1YIT A;  1E1T A;  2PMZ E;  1XXG A;  1GUW A;  5CMD A;  3GTO B;  5C0X J;  4YWM A;  4GLV B;  2K1B A;  1EYC A;  3PMF A;  1HNZ L;  2JJQ A;  3GDE A;  3G6E A;  2B2U A;  2GA4 B;  2A69 C;  3ULJ A;  2WII B;  3C3L A;  2PYK A;  3DWA A;  4A3B B;  2KEN A;  3I7F A;  1G6P A;  3D31 A;  4WJ3 M;  5CBE E;  5IYB G;  4ZRZ A;  3HOX B;  3C1E A;  5JPN C;  1F9R A;  1FGB D;  1B4O A;  2N8N A;  1JCK B;  1HFN A;  1VQ5 A;  2Z4H A;  4CDE C;  3CCR A;  2AUJ D;  1GO3 E;  2RCF A;  1KRT A;  2TSS A;  3BVZ A;  1V43 A;  4DAY B;  4UHV A;  1HA6 A;  1PH4 A;  1Y8P B;  3KOJ A;  3FHW A;  2WV6 D;  3H09 A;  2SEB D;  1UNS A;  3TP5 A;  2BE5 C;  1BCP D;  2EXZ A;  1RD9 D;  4JCV E;  1BF4 A;  4DK6 C;  4LF7 Q;  1F2Z A;  3WOE A;  4IUU A;  5EGT A;  4GN5 A;  1YJW A;  2B2Y C;  4GN4 B;  3NK9 A;  5EPL A;  4GNX A;  3A5U A;  5KND A;  1E0B A;  5E7N A;  3NEN A;  1I6V C;  1PFB A;  5LHY 1;  1LAC A;  4B08 A;  1EEF D;  3K80 C;  4A3I B;  3FRP B;  4MN3 A;  4FF3 A;  4C3H G;  4OXP A;  4LF6 Q;  5JEA J;  3OOC A;  1VQA A;  3A0J A;  3MHB A;  2E76 C;  4ABN A;  1JOQ A;  1JOK A;  1DYQ A;  4IFD H;  4DV7 Q;  2DY7 A;  1U4R A;  2HQL A;  3LWU A;  1STA A;  1EIY B;  4X3S A;  4TSS A;  1XNQ Q;  3PUX A;  4LWC A;  5M3F B;  1AFP A;  2R93 B;  4UY8 C;  1VQE A;  4J15 A;  1CI3 M;  1TS3 A;  1QJO A;  1L1O B;  5EAY A;  1KC8 C;  1JJG A;  3K57 A;  3CU7 A;  3UDF A;  5LMN L;  3PQI A;  5E1F A;  5M5W B;  1UE7 A;  3TN2 A;  5C3E G;  3GTQ H;  4JV5 Q;  1B8A A;  4EQO A;  5BN3 A;  1RCV D;  4PV1 C;  3MVV A;  2B2W A;  3MFY A;  3RZD B;  5M5X H;  2K5Q A;  2A68 C;  1K8A C;  2KA7 A;  1TWC B;  3MAQ A;  2F0Q A;  3PUW A;  2EQS A;  1W6J A;  3MZ5 A;  3CME A;  2JA8 B;  1BO0 A;  3BZK A;  5ELC A;  3NBH A;  1GUS A;  2KED A;  4HR7 B;  3TQY A;  3ZYY X;  4PZ6 A;  1XTC D;  3JAM c;  2K04 A;  2JA6 B;  1KAB A;  3MTS A;  3HOY B;  1VQD A;  5HGT A;  3CF5 A;  4BY1 H;  2A74 C;  3T53 B;  4OX9 L;  2N3S A;  5KNC A;  4A3J H;  4PMC A;  5M5Y H;  1AZQ A;  2YYZ A;  1Z7T A;  2R7Z B;  4QMG A;  3D0F A;  1C7Y A;  1Y1W G;  3K7A H;  1TXY A;  1ENF A;  1KL9 A;  5J39 A;  4QIW B;  1XPO A;  2A19 A;  1HNZ Q;  1QVG A;  1STN A;  1PRT B;  1EWI A;  3GV3 A;  5EPJ A;  5IGG A;  2E2I H;  1HFG A;  5FK9 C;  1O7Y A;  1YVC A;  2QEX A;  1SR3 A;  3VYR A;  4JI6 L;  5C3W A;  1GVP A;  2DNE A;  4R8I A;  3HZX A;  3AFP A;  3A54 A;  2C9O A;  4IOC A;  4J1M A;  2K4K A;  2NBF A;  1HNW L;  3HOU H;  1VQ6 A;  4NMZ A;  1P8L A;  3PF4 A;  2KBN A;  3GTM B;  3SR1 A;  2B2T A;  2DGY A;  1F2Y A;  2QGQ A;  3PO2 H;  1EL0 A;  3FVQ A;  3O13 A;  4JI7 L;  5JJI A;  4DR4 L;  2QF7 A;  1NMF A;  5IP7 G;  4JI3 L;  4XT1 B;  1C48 A;  5HUR A;  2RF4 A;  4A3L G;  3TZU A;  1ESR A;  1KQS A;  1DM0 B;  1STE A;  4HJ5 A;  2A6E C;  4K2K A;  3S17 B;  3HS0 C;  2O5J C;  1U0L A;  3K5N A;  5GAD C;  2RQX A;  2XNA C;  4KTA A;  3BJU A;  1ICW A;  1WTX A;  4RGO S;  4A4I A;  4HJA A;  4JI8 L;  2PW7 A;  2UUA Q;  1CKN B;  3T1H L;  3OTO Q;  1YNN D;  1AE3 A;  1SND A;  1X9N A;  1IYJ B;  3M9B A;  1TQO A;  1PTO B;  4XT3 B;  2KOL A;  4IPC A;  2A73 B;  5I4D A;  1WCM G;  2PQE A;  4A3F B;  3N52 A;  2AHO B;  1KDB A;  2B8F A;  1B9M A;  5ELE A;  1JMC A;  5JPM C;  4LFB L;  1A15 A;  1GKH A;  2NVT H;  1Q7Y C;  1CM9 A;  5GAE C;  4JI5 L;  1WJJ A;  1PXU A;  2K52 A;  3QWN A;  4XYO A;  3KJP A;  1YEZ A;  2MQH A;  5LMN Q;  2F0H A;  2IWH A;  2K75 A;  4KV6 A;  1O7L A;  2YTV A;  3AEV A;  4XQQ A;  4NPS A;  4NXM L;  1EQQ A;  3F1Z A;  4U68 A;  5D3D A;  4DK1 A;  2VUM B;  4NKL A;  1SAP A;  3ONA B;  1PFS A;  1WTH A;  3PCO B;  2WB1 G;  5C4J B;  3J7Z C;  3HOW H;  3ICE A;  2AKW B;  1VQN A;  3S2H B;  4YHH L;  4IFD G;  2CHB D;  1VS0 A;  4K14 A;  1LTA D;  3C2P A;  4HN7 A;  3DUZ A;  5JEA H;  1LTB D;  2SDF A;  3PIO A;  4X65 Q;  1G6Z A;  5IGB A;  1AEX A;  1RTN A;  3K5L A;  1ENC A;  3MA2 B;  2F0W A;  4IUT A;  3CC2 A;  2NZH A;  3PIP 3; 
#chains in the Genus database with same CATH homology
 2EXD A;  2CQO A;  2HIV A;  2JA7 G;  2NVY H;  1VQ9 A;  2KCM A;  5M3M H;  4OX9 Q;  3PO3 G;  1SRU A;  2D62 A;  5GQO A;  5IYB H;  1PHJ A;  2N78 A;  3HFZ B;  2WAQ E;  3NEM A;  1Q8K A;  1E24 A;  3ER0 A;  1PVO A;  2VZA A;  4BBR H;  3M7N A;  2VNU D;  4NB3 A;  3RLF A;  4R4Q A;  4JI1 L;  1X3E A;  4K0K L;  2OQK A;  1S72 A;  4JBK A;  4LUV A;  3M3Y H;  2PQA B;  4JI1 Q;  2H5X A;  5IP9 H;  5ELN A;  4DR5 L;  1CKM A;  2BH8 A;  2I5M X;  2L15 A;  3M85 A;  4K0K Q;  1VQH A;  1M90 C;  3L2P A;  4POG A;  3S1R H;  3S1Q H;  1K0R A;  4AYB E;  1CKO A;  3HOW G;  1IBL L;  2UU9 Q;  1XMQ L;  4QL5 A;  4HID A;  4GNX B;  3ULP A;  1PV4 A;  1IBK L;  1IBL Q;  2ID0 A;  2GVB A;  4GOP A;  1K73 C;  3GTP H;  4DR6 L;  2K50 A;  2R6G A;  3J81 i;  4GLX A;  3S15 H;  1E22 A;  5FJ8 H;  1IBK Q;  1A8V A;  4GOP C;  3KF6 A;  4BXX G;  3HOZ H;  1Z9F A;  2PI2 A;  2NVX H;  1SE8 A;  4R4O A;  2OWO A;  4P72 A;  4C2M H;  2VQE L;  2YU9 H;  4B3T Q;  1QVC A;  1XNR L;  1NJI C;  3HKZ E;  1VQK A;  3CCS A;  4DUZ L;  3UE0 A;  4IFD J;  4OWW B;  2N49 A;  3G71 A;  4AIM A;  4BY1 G;  2VQE Q;  4A3F G;  3KJO A;  1S3O A;  2ZTE A;  2ALY B;  4DUZ Q;  2WAQ G;  1LUZ A;  4C3H H;  1HZ9 A;  1VQ4 A;  2C35 B;  5M3M G;  3PF5 A;  1E3P A;  2YV5 A;  3J81 c;  2EIF A;  3VDY A;  4A93 H;  4IPD A;  3S24 A;  1YBY A;  2XTI A;  4QJF A;  3TRE A;  4X66 L;  5HY6 A;  4BBR G;  4YY3 L;  4RG1 A;  3CXC A;  4LF8 L;  2UXD Q;  4FDB A;  4BA1 I;  3H0G H;  1MKH A;  4JI7 Q;  1XPU A;  4JOI A;  1XJV A;  4DR4 Q;  3FKI G;  3HKS A;  3UE1 A;  4X66 Q;  4LF8 Q;  4A3K H;  5JJK A;  3MXN B;  1N32 L;  1OXS C;  3CC4 A;  4DV1 L;  4LF4 L;  4JOI C;  3M4P A;  4AYB G;  2F52 A;  5IP9 G;  1B70 B;  4IPG A;  3BU2 A;  1N32 Q;  3AYH B;  2ZJR A;  3S16 H;  3I4M H;  4DV1 Q;  4LF4 Q;  3RR5 A;  2CKZ B;  2NZO A;  4OO1 I;  4B3M L;  1I94 L;  1OXV A;  3UDI A;  3K8A A;  3J80 c;  3M4O H;  1IZ6 A;  2DUD A;  1JJC B;  1I5F A;  4B3M Q;  5C0X I;  1I94 Q;  1A62 A;  1N9W A;  2JA5 H;  2K14 A;  4LFC L;  2IHE A;  1VQP A;  2Y0S G;  3B6Y A;  1SMX A;  2WB1 E;  3HKZ G;  1G51 A;  3STB C;  4A3C H;  1N34 L;  1WYD A;  1MJC A;  1KRS A;  2NVQ H;  3T1H Q;  5ELO A;  1CSP A;  1HZB A;  4DV4 L;  1PH2 A;  4DV6 Q;  1VQM A;  1N34 Q;  3HOU G;  1HR0 L;  1X3G A;  2ZTD A;  3PUY A;  4IPH A;  1HH2 P;  2Q2T A;  4DV4 Q;  1VQL A;  3NEL A;  1KD1 C;  3BZC A;  1JJ2 A;  1D7Q A;  1VQJ A;  4X64 L;  1BVS A;  1SRO A;  3NBH B;  2QA4 A;  3PO2 G;  4A93 G;  4LFB Q;  3CP0 A;  5C44 G;  1NTG A;  2PNH A;  4JC0 A;  2F4V Q;  2R92 H;  4X64 Q;  4BBS H;  2MO1 A;  3H0G G;  4ALP A;  4A3M H;  4OO1 G;  4DK3 C;  3HOX H;  2E5L L;  3Q8D A;  4JI5 Q;  1E7Z A;  1A63 A;  1K3R A;  3CCQ A;  3TRZ A;  5H1S E;  1RIP A;  1XMO L;  4DV0 L;  2CFM A;  4R4I A;  1D8L A;  2LXK A;  4YCU A;  1HZA A;  5C0X G;  1ASZ A;  3RZO H;  1J6Q A;  4KHZ A;  3W1B A;  4DR2 L;  4KHP Q;  1A0I A;  4AH6 A;  1XMO Q;  3GTK H;  1PYB A;  1Y14 B;  3CAM A;  3CMA A;  3CQZ H;  4A3D H;  1PH9 A;  2F3I A;  1FJG L;  4DR2 Q;  4BA2 I;  1X3F A;  2VW9 A;  4X62 L;  4KLK A;  4DR3 L;  1FJG Q;  3KDF A;  1HNX L;  4A3C G;  1AE2 A;  5GAH C;  3U4Z A;  4JV5 L;  4C3I H;  2V1C C;  4YHH Q;  5IT9 c;  4DR3 Q;  2HIX A;  3TEH B;  1Y1W H;  1N36 L;  4Y7N H;  1VQF A;  5LMN W;  5BR8 Q;  3E9I A;  1K83 H;  3DLL A;  4GKK L;  5IYC H;  1CKN A;  1X54 A;  4DV3 L;  2YTX A;  5FLX c;  5AJ3 L;  2JA9 A;  1Q12 A;  3U58 A;  1N36 Q;  4EQ5 A;  1EYG A;  3K0X A;  4XIG S;  4GKK Q;  4GOP B;  3JAM i;  1QZH A;  4P73 A;  1PH3 A;  1HZC A;  4OON A;  4A3I H;  1OXT A;  4GKJ Q;  3G4S A;  5IYD G;  3KF6 B;  4JI4 L;  1VQ7 A;  2R92 G;  1TWF H;  3RN5 A;  1E1O A;  1BBU A;  1L1O A;  4WJ4 A;  1UE6 A;  4JI4 Q;  3PGZ A;  1O7I A;  4UP7 A;  2ASB A;  4PZ7 A;  2ZJQ A;  3H3V H;  1L1O C;  2IX0 A;  1BBW A;  4YCV A;  3F2D A;  1YZ6 A;  5FLM G;  1Q82 C;  5M3F H;  3W1G A;  3H15 A;  2R93 H;  4DR5 Q;  2BH2 A;  1YIT A;  1E1T A;  1QUQ A;  2BA1 A;  1EIF A;  2MO0 A;  2NN6 I;  2PMZ E;  3G48 A;  5J3B A;  1YHQ A;  4A3G H;  1X65 A;  1PYS B;  2MFI A;  4X6A H;  5C0X J;  2JEA I;  4YWM A;  3WWV A;  1XMQ Q;  4GLV B;  3KFU A;  1K8G A;  1PH5 A;  5JEA G;  2UUC L;  4DR6 Q;  5M5W H;  1HNZ L;  2JE6 I;  2JJQ A;  4JBM A;  3PSI A;  3GDE A;  4DNI A;  3CCE A;  2Y0S E;  3G6E A;  1B7Y B;  2UUC Q;  4LF5 L;  1Q1B A;  3JC6 6;  3CCJ A;  4DUY L;  4IOA A;  3CD6 A;  4JBJ A;  2B63 H;  3U4V A;  3ULJ A;  1XNR Q;  4QGU A;  1Q46 A;  4JI0 L;  2KEN A;  4A3I G;  3CC7 A;  3I7F A;  4DUY Q;  4LF5 Q;  4YWK A;  5C4X H;  4DR7 L;  1G6P A;  3D31 A;  4EX5 A;  4DKA C;  4A3E H;  1XPR A;  4BY7 H;  3J7A 5;  4WJ3 M;  1UEB A;  5IYB G;  4JI0 Q;  4DR7 Q;  1TWC H;  2CWP A;  2N8N A;  2Z0S A;  3GTL H;  1VQ5 A;  2JA8 H;  1HJP A;  4POF A;  3M4Q A;  4YY3 Q;  1AH9 A;  2NN6 G;  3CCR A;  1TWG H;  2RCN A;  2PI2 E;  1GO3 E;  1KRT A;  1X55 A;  1UE1 A;  1V43 A;  4DAY B;  3E9H A;  1PH4 A;  3KOJ A;  4DV5 L;  2R93 G;  3F2B A;  3FHW A;  2ZJP A;  4O0A A;  4LF7 L;  3I4N H;  2A1A A;  2JA6 H;  4LUO A;  4A3G G;  3HOY H;  4DV5 Q;  1YJN A;  4JCV E;  2XGT A;  4DK6 C;  4LF7 Q;  3PUV A;  1WFQ A;  4LFA L;  1FGU A;  4GN5 A;  4OWX B;  4P71 A;  5FJ8 G;  1ASY A;  2Q2U A;  1YJW A;  2ZTC A;  3GTO H;  4GN4 B;  3HOZ G;  1PA6 A;  1BKB A;  1KXL A;  4LFA Q;  4GNX A;  3CPF A;  2Q2I A;  3A5U A;  1L0W A;  4AQY L;  5E7N A;  1V1Q A;  2B29 A;  4LFC Q;  3NEN A;  5C3E H;  2R7Z H;  2YTY A;  1T9H A;  1PH7 A;  1YJ9 A;  2I0Q A;  1RL2 A;  3KDF B;  4LF6 L;  2R7D A;  3K80 C;  3KYH C;  2CWA A;  5C4X G;  2UXB L;  1HR0 Q;  3HOV H;  4OXP A;  4O2D A;  4A3E G;  5JJL A;  4OWT B;  2A8V A;  4LF6 Q;  1LM0 A;  5JEA J;  1Z47 A;  3GO5 A;  1VQA A;  3DM3 A;  5IWA L;  3A0J A;  4DV7 L;  2UXB Q;  4A3B H;  2Z6K A;  4B3R L;  4LW1 A;  3L7Z C;  1TWA H;  2KHJ A;  2VS1 A;  4DV7 Q;  1S40 A;  2JA8 G;  1FL0 A;  4HJ7 A;  4UPA A;  2Z6K C;  4B3R Q;  1XNQ L;  2HQL A;  4A3K G;  3AFQ A;  1NMG A;  1EIY B;  4APV A;  3ERS X;  4IJH A;  4DAM A;  4H02 A;  1XNQ Q;  3A74 A;  2B3G A;  2JEB I;  2E5L Q;  3PUX A;  4LWC A;  3S1N H;  1N33 L;  3I4M G;  4UY8 C;  1GD7 A;  1VQE A;  4J15 A;  4DV0 Q;  3I4N G;  1L1O B;  5EAY A;  1KC8 C;  2D0P A;  1CUK A;  1NBW A;  1GM5 A;  1JJG A;  4RMF A;  3UDF A;  2IY5 B;  1W2B A;  3GTM H;  2JA5 G;  5LMN L;  3PIP A;  4MZ9 A;  4UP9 A;  4X62 Q;  1X6O A;  3L0O A;  3I2Z A;  1YI2 A;  1UE7 A;  3OYY A;  1HNX Q;  2R7Z G;  5C3E G;  4A76 A;  3GTQ H;  2K5N A;  5DLQ E;  1B8A A;  3AQQ A;  1Q86 C;  3CCL A;  4JV5 Q;  1QUQ B;  1VQI A;  1G29 1;  2D0O A;  3EN2 A;  2IX1 A;  2UUB L;  2VL6 A;  3ULL A;  4GS3 A;  5M5X H;  4DV3 Q;  3S17 H;  5AJ3 Q;  1K8A C;  2VQF L;  4A3B G;  2GVA A;  3PUW A;  2EQS A;  4HJ9 A;  4BBS G;  1WOC A;  3CME A;  1VQG A;  2HHH L;  2I5H A;  4A3M G;  3HOX G;  1JB7 A;  3BZK A;  4L5Q A;  3UDG A;  2HHH Q;  3EBE A;  1VQB A;  4XTC S;  1OTC A;  4BXX H;  3TQY A;  1W3S A;  4PZ6 A;  4PZ8 A;  1MJE A;  3JAM c;  2E8G A;  5IE8 A;  4R4T A;  4A3D G;  2ATW A;  1WI5 A;  1VQD A;  4IO9 A;  5IY0 A;  3ZJY C;  3CF5 A;  4BY1 H;  4YCW A;  4A3F H;  4OX9 L;  3K7U C;  3PV0 A;  2N3S A;  3H3V I;  1OXU A;  1C0A A;  1IBM L;  3F2C A;  3CW2 C;  3MEF A;  1X56 A;  2E2H H;  4A3J H;  1VQO A;  5M5Y H;  2LSS A;  3LGJ A;  2YYZ A;  3CCV A;  1IBM Q;  4B3S L;  2K5H A;  3D0F A;  1C7Y A;  1Y1W G;  5IP7 H;  3K7A H;  1JT8 A;  4QY7 A;  1TXY A;  4P75 A;  4LF9 L;  4B3S Q;  4A3L H;  1LTL A;  3FKI H;  5IYC G;  3TS2 A;  4QQB X;  3EIV A;  1KL9 A;  1VCI A;  4LF9 Q;  3T1Y L;  2A19 A;  1XPO A;  1HNZ Q;  2UU9 L;  2ZM6 L;  4MTN A;  1C9O A;  1YNX A;  1QVG A;  2JQO A;  2Q2H A;  1EWI A;  3T1Y Q;  2ES2 A;  1IL2 A;  2K5V A;  2ZM6 Q;  2E2I H;  4GLA C;  2RHS B;  4DV2 L;  3RZD H;  2VUM H;  3CCM A;  1YIJ A;  4LNQ A;  2AMC B;  1YVC A;  2QEX A;  4L5S A;  5C4J H;  1SR3 A;  3S2H H;  4JI6 L;  3K81 C;  4R1J A;  4DV2 Q;  4B3T L;  4KI0 A;  5HGQ A;  1GVP A;  2KCT A;  4Y52 H;  3AFP A;  4IOC A;  4JI6 Q;  2OQ0 A;  4ME3 A;  3TS0 A;  2K4K A;  1WCM H;  1I50 H;  1HNW L;  3HOU H;  1QVF A;  1VQ6 A;  5M3F G;  1P8L A;  4HIK A;  3PF4 A;  2KBN A;  3CPW A;  1PH8 A;  1VQ8 A;  2FXQ A;  1HNW Q;  2RHQ B;  2UXD L;  1I6H H;  2DGY A;  1KAW A;  2QGQ A;  2PQA A;  4JBW A;  3I55 A;  1U5K A;  1UE5 A;  4A3J G;  4HJ8 A;  4JI7 L;  3PO2 H;  5JJI A;  5C44 H;  2BA0 A;  3J80 i;  1EUJ A;  3U50 C;  1NMF A;  4DR4 L;  5IP7 G;  1OXX K;  4JI3 L;  2JK8 A;  1YHA A;  2RF4 A;  1SLJ A;  4A3L G;  2LXJ A;  1EQR A;  1KQS A;  4TQU S;  4JI3 Q;  4HJ5 A;  4JI2 L;  4P74 A;  4R4C A;  5K36 G;  2B63 G;  4GNX C;  4NXN L;  4AQY Q;  1TWH H;  3FP9 A;  1U0L A;  1KHI A;  4JI2 Q;  5GAD C;  2IHF A;  1Y1V H;  3BJU A;  3I4O A;  3RLO A;  1Q1E A;  3OW2 A;  4NXN Q;  4A4I A;  4BY7 G;  2UUA L;  4HJA A;  1DGS A;  1IXR A;  4UP8 A;  1SFO H;  2VUM G;  4JI8 L;  3SGI A;  3OTO L;  4JG2 A;  4QIW E;  2UUA Q;  5GRO A;  1CKN B;  4DR1 L;  3T1H L;  4JI8 Q;  3PUZ A;  5IWA Q;  3OTO Q;  4A75 A;  1N8R C;  1AE3 A;  4DV6 L;  1X9N A;  3S2D H;  1CSQ A;  1IYJ B;  3M9B A;  2CCZ A;  3J81 j;  1H95 A;  2MNA A;  4DR1 Q;  4IPC A;  2KHI A;  1PH1 A;  1XTD A;  2E2J H;  1KIX A;  3GTG H;  1WCM G;  1K9M C;  3RLN A;  4JYA L;  4YWL A;  1NY4 A;  2AHO B;  4IFD I;  1JMC A;  2AWN A;  4IJL A;  4LFB L;  3CCU A;  2JA6 G;  4JYA Q;  3HOY G;  4HIM A;  1N33 Q;  2F4V L;  1GKH A;  1VQC A;  2VY3 A;  2HT1 A;  1I3Q H;  3KF8 B;  1SN8 A;  1HR0 W;  2NVT H;  3GTJ H;  3RN2 A;  1Q7Y C;  2JA7 H;  5GAE C;  5IYD H;  3UDX A;  2AWO A;  4JI5 L;  3PO3 H;  1WJJ A;  2WFW A;  4LUZ A;  2K52 A;  3KJP A;  5LMN Q;  3F8T A;  2OCE A;  1V9P A;  1YEZ A;  2MQH A;  4MNO A;  4HIO A;  1EOV A;  4KHP L;  3STB D;  2K75 A;  1YHB A;  2YTV A;  4L5T A;  3AEV A;  4NPS A;  1L2F A;  5GAG C;  2OTL A;  3KLW A;  1EQQ A;  4NXM L;  1NE3 A;  3F1Z A;  4L5R C;  1Y1V G;  3HOV G;  5FLM H;  4NXM Q;  4GN3 B;  1UWV A;  2UUB Q;  1PFS A;  3PCO B;  1EFW A;  2WB1 G;  3J7Z C;  3HOW H;  3A5Z B;  1JE5 A;  2AKW B;  1VQN A;  3ICE A;  4YHH L;  2IT1 A;  3E0E A;  1LYL A;  4IFD G;  3S1M H;  2VQF Q;  1M1K C;  1PH6 A;  1J5E L;  2UXC L;  3IRB A;  1MIU A;  1VS0 A;  5BR8 L;  3RNU A;  3GD7 A;  4X65 L;  1J5E Q;  2UXC Q;  3W5O A;  2WP8 J;  1P16 A;  4PMW A;  4PG3 A;  3I56 A;  5LMU L;  2R7F A;  3PIO A;  4X65 Q;  1FVI A;  2OTJ A;  4C3J H;  1Q81 C;  4GKJ L;  5LMU Q;  2I5L X;  3CC2 A;  4DPG A;  2NZH A;  3S14 H;  1R9T H;  4TVA B;  1QZG A;  2GN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...