3J81i

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
111
Chain Sequence
NTKGGKKGRRGKNDSDGPKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLKNQGELPENAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 16
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
i PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3j81i00
2VQFQ 1KXLA 1B8AA 1Q1BA 3K80C 2MO0A 4X6AH 2K5NA 1AE2A 3WWVA 4DAYB 2CCZA 1VQCA 2CKZB 4J15A 2R7ZH 3ZJYC 3GDEA 3I4OA 3S1QH 1XMOL 2UXBQ 4LF7Q 4JOIA 3U4VA 1HR0Q 3CC7A 1QVFA 4IPCA 4UPAA 4AIMA 3GTMH 2LXKA 1VQBA 4LNQA 1UE1A 2B3GA 2R93H 1KAWA 1WI5A 5M3MG 2QEXA 4JYAL 1Q8KA 1PVOA 4GKKQ 4A3CH 4HIKA 2F4VL 3GD7A 1HR0W 1R9TH 4QY7A 4HJ5A 1PH2A 1C7YA 1XMQQ 1RL2A 1IBKQ 4A3BH 3CCSA 3AYHB 1CKNA 1S40A 4AQYL 5FJ8G 4A93H 2UXCL 3I4MG 3RN2A 2VNUD 4BBSG 1VS0A 2ALYB 4JI8L 1W2BA 2LXJA 4DV5Q 2YYZA 3EIVA 4R4OA 5IYDG 3UE1A 2VW9A 2N78A 5C0XI 5AJ3L 4LF6L 1X3FA 1DGSA 5C44G 4DUZL 4YWMA 4A3IH 4OO1I 3CF5A 1CKMA 1Q7YC 4H02A 3KJPA 1OXXK 2D0PA 4DV1L 1PA6A 2E2HH 1CSPA 3GTOH 1VQGA 4GN3B 4DR2L 1X56A 1XPRA 4X64L 5IP9H 1XJVA 2JA9A 2UUCQ 1D8LA 4PMWA 3H3VI 3BZCA 1HH2P 2EIFA 3RLNA 4DV3L 3HOYH 1EYGA 3L2PA 2ZJRA 4JV5Q 3CP0A 1FJGL 3T1YQ 2R7DA 5IP7H 3S1NH 1JJ2A 4BXXG 1G6PA 1CUKA 4IFDJ 1J6QA 2HQLA 1YZ6A 4HJ7A 4LF7L 4C3HH 1L1OB 1YJ9A 2FXQA 3BJUA 4DV7L 1HZCA 1YI2A 3A74A 5JJKA 1GM5A 1SN8A 4DV6Q 3NBHB 4JI6L 4GNXB 1S72A 1GVPA 5C0XJ 4PZ8A 4GKKL 2IHEA 4A4IA 1PH3A 3FHWA 4LF9L 3ICEA 1BBUA 1Q86C 1HNXQ 3KF6A 3OTOL 3CPWA 5IYBH 5IYBG 3PUYA 2Q2TA 1LUZA 5K36G 4LF4L 1X6OA 1NMFA 4UP8A 2JA6H 1E3PA 4YWLA 3RN5A 3W5OA 5C4JH 1K83H 5IYDH 2UUBQ 4GS3A 1VQ9A 3M3YH 5AJ3Q 4DR4Q 3PUVA 4DUZQ 2GVBA 4B3SQ 4X66L 2MO1A 1Y1VG 2YU9H 4DV0Q 4KHPL 1EQRA 3M7NA 1VQEA 1Q46A 4DR6Q 1OXTA 1N36Q 5M5WH 2JQOA 2K14A 1TWHH 4OWTB 3JAMi 2ES2A 4LFAL 4ALPA 4LFBQ 1EIFA 1B7YB 2DGYA 4B3MQ 2UUAL 4DR7Q 3AFQA 3S17H 5E7NA 1IYJB 2JEBI 1X54A 2UU9L 4BBRG 2RHQB 4JI2L 4QQBX 1Q82C 4LF5L 3PSIA 5C3EH 4A3KG 1AE3A 1VQDA 1WJJA 2N3SA 4HJAA 4DV7Q 2IX0A 4A3IG 1KD1C 2F4VQ 1L0WA 5LMNW 2I0QA 2PI2E 4APVA 1T9HA 2VQEL 4DUYL 3F2BA 4KHZA 3GTKH 2GVAA 4DR5L 1LM0A 3L0OA 4K0KL 5M5YH 4LF9Q 1VQHA 4TVAB 3TEHB 4AH6A 4BXXH 4A3LH 4LWCA 4C3JH 4A3DH 4JI8Q 1N33Q 3PCOB 3CCJA 4XTCS 4DV5L 3UDGA 2WAQE 3CAMA 3HOYG 2PQAA 2NZOA 4HJ9A 4GOPC 1EFWA 1CKOA 4LUZA 1B70B 1QUQA 3KDFB 4DV1Q 1EUJA 3HOVH 3HOWH 2K52A 3I4NG 3TREA 5JJLA 1RIPA 4JI1L 2ZTEA 1WCMG 4JI5L 1CSQA 1S3OA 2Z6KA 5ELNA 4HIOA 2JA5G 4OO1G 3T1YL 4C2MH 4BBSH 1UEBA 1I5FA 1V1QA 4Y52H 1UE6A 2JJQA 4QJFA 2GN5A 4UY8C 1SFOH 4HIMA 1VQ8A 1PFSA 3E9IA 4DV2L 4JBKA 2JK8A 5IWAQ 2ZTDA 4XIGS 4JBMA 3RZDH 1I94L 4IPHA 2KHJA 4LF5Q 1OXVA 4PZ6A 4DV6L 2R93G 4ME3A 2ZTCA 3A5ZB 1JB7A 1PYBA 3D0FA 2XGTA 3SGIA 1L1OC 4AQYQ 1QUQB 4P74A 1VQ6A 5GAHC 2HHHQ 3T1HL 4A3GH 4KI0A 3GTQH 2E2JH 1VQ4A 3K7UC 2KCMA 4JI4Q 4LF6Q 1AH9A 4KLKA 1I50H 2K50A 3G71A 1PH6A 4BY1H 4JI0Q 2EQSA 1X3EA 3EN2A 3AFPA 1TWFH 2CFMA 1HZBA 2XTIA 5M5XH 2K4KA 2WP8J 1NJIC 3KFUA 4IOAA 3I56A 1WCMH 3LGJA 4JI7Q 1KL9A 1KIXA 5EAYA 4X66Q 1SE8A 3J80c 2H5XA 4B3TQ 4KHPQ 1U0LA 4GNXA 4IJHA 3GTPH 5M3FG 3HKZE 3TRZA 4BY7H 2QA4A 1Q12A 3D31A 3KF6B 4P73A 2DUDA 4YCUA 3W1BA 3G48A 2B63H 3CMEA 3A0JA 1JT8A 2UUAQ 2MNAA 4A3DG 4PZ7A 3K0XA 1L2FA 1WOCA 1PH1A 1KQSA 4JI2Q 4P75A 3I55A 4GLVB 2ZJQA 1VCIA 1XTDA 2CWAA 4LUVA 5FLMG 4AYBG 2UXBL 5GROA 2IHFA 1I94Q 4C3IH 2OWOA 1K8GA 5J3BA 1YNXA 1E24A 5C3EG 4R4IA 4A3KH 1C0AA 5JEAJ 4DR1Q 1SR3A 2AHOB 3H0GH 4LF8Q 4NXML 1O7IA 2AWNA 1IL2A 4YY3L 2ATWA 5LMNL 4QL5A 4Y7NH 1N33L 3GTLH 3F8TA 1YEZA 1KHIA 4YWKA 1BKBA 3HOXH 3ERSX 4DR2Q 1SMXA 4X64Q 3JAMc 2UUCL 4B3RL 1VQ5A 3F2DA 4X65L 4A3EG 1M90C 3ULLA 4EQ5A 4IFDI 1FJGQ 1E7ZA 2AWOA 1Y1VH 2YV5A 3CCEA 2IT1A 3PUWA 1K0RA 4LFCQ 2JA7G 2YTXA 3S16H 3NEMA 1G291 4JI7L 2MQHA 2WFWA 4A3LG 3PF4A 2BH8A 1HZ9A 5BR8Q 1E1TA 4LFBL 2KHIA 4DK6C 4DK3C 1P8LA 2D0OA 4O0AA 3CXCA 2NVYH 3EBEA 1W3SA 1MKHA 2WB1E 1XNQQ 1OXUA 2B63G 4JC0A 3J7ZC 5LMUL 4OX9L 4JI6Q 3F1ZA 1XPUA 1KRTA 2UXDL 3RR5A 1LTLA 1A63A 4O2DA 2PMZE 2R92H 3K7AH 4GLXA 4POFA 3PF5A 2OQ0A 1X3GA 2R6GA 1I6HH 4DV4L 4GOPB 2R7FA 2A19A 1QVCA 1PH4A 4K0KQ 5GAEC 4A3MG 2JA8G 2F52A 4UP9A 2VY3A 3H15A 3CCRA 2OCEA 3MXNB 3I4MH 2VUMH 2K5VA 1FGUA 3M85A 4L5QA 3HOUH 1KRSA 2JA7H 1GKHA 4OWXB 1VQOA 4A3BG 1J5EQ 4JI4L 4GOPA 5C4XH 4NXMQ 1NY4A 4JG2A 1A8VA 2NZHA 2WB1G 4JI0L 2E8GA 4P71A 1L1OA 3PUZA 3HOXG 4DR3L 5IYCH 1Y1WH 5HY6A 1VQ7A 3ER0A 1VQNA 1IBLQ 2RHSB 3CCMA 4JI3Q 1G51A 4DR6L 1E22A 2D62A 3NELA 4IJLA 4NB3A 1IBMQ 1MJCA 4JI5Q 1YHQA 2BA1A 3J80i 1Q1EA 4A3FG 1QZGA 4B3ML 4EX5A 3H3VH 1CKNB 3CQZH 3KLWA 4X62Q 2OTLA 3KF8B 1TWAH 3HKZG 1JJGA 2BH2A 1E1OA 4DV2Q 2ZM6L 1NBWA 1VQFA 2NN6I 2KBNA 1V43A 4A3JH 3B6YA 2E5LL 4POGA 1N9WA 2Z6KC 4A3GG 1N32L 3IRBA 1N34L 3I7FA 1Q81C 2PQAB 4JYAQ 4IPDA 3A5UA 3I2ZA 1BVSA 4L5RC 2JEAI 1NMGA 4YHHQ 1YIJA 4RMFA 1PH8A 1K8AC 4OWWB 1ASZA 3HOVG 3HOWG 3I4NH 1YBYA 5H1SE 2C35B 4HIDA 1K73C 3KJOA 3M4OH 4DR1L 3TS0A 4JV5L 3CMAA 4LF8L 3CCLA 4YY3Q 3PO2G 4RG1A 3MEFA 3G6EA 2BA0A 1V9PA 1FL0A 2KENA 2N49A 1VQKA 2A1AA 3S14H 5FLXc 1PH7A 3K81C 4A3JG 1HNWQ 3KYHC 2VUMG 1A62A 1VQIA 3JC66 5DLQE 4R4CA 4A3MH 2AMCB 1UE5A 2Q2HA 1MJEA 3HFZB 1D7QA 4B3TL 4DR3Q 4B3RQ 1ASYA 1XPOA 4LFCL 2B29A 3UE0A 3FKIG 1YJWA 3HOZG 4A3FH 3L7ZC 2NVQH 1QVGA 4DAMA 3K8AA 3W1GA 1YHBA 2PNHA 3DLLA 3E0EA 1EWIA 1PYSB 1YVCA 3S2HH 4IPGA 5IWAL 1Y1WG 1PHJA 1KC8C 1U5KA 4YCWA 2LSSA 5IYCG 1JJCB 4A75A 1XNRQ 3KDFA 5LMUQ 4WJ3M 3OYYA 4IFDG 2ZM6Q 3J81j 4NXNQ 1YJNA 3KOJA 3F2CA 5C4XG 1C9OA 2HIXA 4JOIC 2Q2UA 1QZHA 3J81c 4TQUS 3HOUG 1XMQL 2NN6G 2HHHL 3ULPA 3T1HQ 4GNXC 1WFQA 2JA8H 4YHHL 1FVIA 2QGQA 3TS2A 5C0XG 2ID0A 3DM3A 5ELOA 2UXCQ 1OXSC 1M1KC 2F3IA 4IO9A 3PUXA 1HNZL 2VS1A 1NTGA 5IE8A 1Z47A 1VQAA 2K75A 1UE7A 5GADC 1YITA 2YTYA 1J5EL 1BBWA 2R92G 2NVTH 3CC4A 3J7A5 2CQOA 3H0GG 3E9HA 4X65Q 2ZJPA 1Z9FA 3PIOA 3CCVA 3J81i 2Z0SA 5JJIA 2RF4A 4FDBA 2IY5B 2NVXH 3S1MH 2EXDA 2A8VA 2KCTA 4DR4L 1NE3A 4DNIA 1I3QH 4DV3Q 1PV4A 4HJ8A 3Q8DA 4JBWA 4WJ4A 2HT1A 2VL6A 2JE6I 3STBD 1XMOQ 3UDIA 4R4QA 3U4ZA 1LYLA 1HJPA 2Q2IA 5IT9c 4X62L 1N36L 1HR0L 3CC2A 3GTGH 2RCNA 4YCVA 4LFAQ 3S1RH 1PH5A 4LUOA 1XNQL 2HIVA 4GKJL 3AQQA 3PO3H 1VQJA 2K5HA 4A3EH 4OX9Q 3M4QA 5IY0A 2UU9Q 5IP7G 2UXDQ 3G4SA 1X55A 5M3FH 3RLOA 5GAGC 4BY7G 1XNRL 4BBRH 4AYBE 1N34Q 1P16A 4R4TA 1IBKL 4JCVE 1OTCA 3ULJA 2I5HA 2I5LX 2E2IH 4NXNL 1MIUA 3TQYA 3U50C 1JE5A 3CPFA 1SLJA 4L5TA 3GTJH 5LMNQ 1X9NA 2I5MX 3PO3G 1VQMA 4LF4Q 3M4PA 1VQPA 3FP9A 4GN4B 1TWGH 4BY1G 5FLMH 4DKAC 3S2DH 2CWPA 1HNZQ 2UUBL 5FJ8H 4A93G 1K9MC 3UDFA 2VQFL 1HNWL 3S15H 4L5SA 1GD7A 1PH9A 2MFIA 4JBJA 4DPGA 2JA6G 1HZAA 2V1CC 2N8NA 5BR8L 4DV0L 1YHAA 4A3CG 4JI1Q 3CD6A 5IP9G 3RNUA 4GN5A 4A76A 1TWCH 1IXRA 2Y0SE 4NPSA 3GO5A 3U58A 4OONA 3UDXA 4BA2I 4DR7L 1TXYA 2VZAA 3PGZA 4UP7A 1SRUA 3RLFA 3PIPA 3PV0A 4GKJQ 2E5LQ 3OW2A 1N32Q 1UWVA 1A0IA 4MZ9A 4MTNA 2WAQG 3BU2A 1JMCA 1VQLA 1EIYB 1WYDA 2JA5H 5GQOA 3RZOH 4DV4Q 3AEVA 2OTJA 5JEAG 3STBC 1HNXL 2VQEQ 2OQKA 3OTOQ 4DUYQ 2ASBA 3PO2H 3VDYA 1IZ6A 2PI2A 2AKWB 3BZKA 4OXPA 1EOVA 4PG3A 2Y0SG 3CCUA 4DR5Q 1Y14B 1EQQA 4QIWE 5HGQA 1H95A 1N8RC 1X65A 5M3MH 4GLAC 3NENA 2L15A 3HKSA 3CW2C 4MNOA 4P72A 2IX1A 1K3RA 4R1JA 4LW1A 4QGUA 3HOZH 1SROA 2YTVA 4IOCA 3FKIH 4JI3L 1IBLL 3M9BA 4BA1I 4B3SL 2R7ZG 5C44H 3CCQA 1IBML 3S24A 1GO3E
chains in the Genus database with same CATH superfamily
2VQFQ 1KXLA 3K80C 3QJYA 2NYZD 1AE2A 2G9HD 2K5DA 1EYDA 4ZQ3A 4J15A 3ZJYC 2ENBA 1HR0Q 2OXPA 3CC7A 2SNMA 1QVFA 4UPAA 1HFGA 2LXKA 1VQBA 1WTPA 3E0JA 3QO2A 2QEXA 4JYAL 1CHPD 3FMCA 1TT2A 1EOTA 4KY5A 4QY7A 1R9TH 1RL2A 2E74C 1R4PB 3K6OA 2WAQB 2FMCA 1FNUA 1U9RA 2UXCL 3RN2A 2VNUD 4BBSG 3DMUA 2ALYB 4JI8L 1LT6D 2LXJA 5CBAE 3TP5A 5AJ3L 4DUZL 5C44G 3DWPA 2HDLA 1CKMA 3SHLA 2E2HH 1CSPA 3GTOB 1VQGA 1BDOA 1X56A 5IGDA 4PMWA 4DV3L 1HH2P 5EJWA 3RLNA 1EYGA 3I90A 5ELCA 3C1EA 5M5XB 1FJGL 4C1NK 5IP7H 3S1NB 2I46A 4CDDC 1YZ6A 2KA7A 3F2UA 1L1OB 4C3HH 2FXQA 4DV7L 5D14A 3NBHB 3D4DA 5KEEA 4B9XA 4GNXB 4RH6A 1GVPA 4GKKL 1TWAB 4A4IA 3FHWA 2MJ8A 4XXEA 3OTOL 2F0SA 3MHBA 1IW7C 1GUSA 2MP1A 1D2BA 2K04A 4LF4L 2QKIC 2JA6H 3RN5A 3SR1A 2DJGC 1QE6A 1A6XA 1VQ9A 4I7AA 3T56B 3DWQA 1HPCA 2GVBA 1FR3A 2EXZA 2B63B 2F0LA 4X66L 3M7NA 1VQEA 3E3XA 1N36Q 2ES2A 2G9DA 2VB3X 4B3MQ 4G7HC 3I73A 3A7LA 4RCNA 4RA8A 4XDXA 4QQBX 3HOZB 3K57A 3PSIA 3FKIB 2N3SA 1L0WA 5LMNW 4C3HG 2D9UA 3GTLB 1PLFA 3F2BA 3GTKH 3TSSA 2PYKA 3I91A 4K0KL 1A3TA 4CJ1B 1WVLA 1STBA 2FINB 4FF1A 4JI8Q 4DV5L 3UDGA 5EPKA 1UAPA 3BDOA 1CKOA 5A2QE 4Q5VA 1QUQA 1T5EA 2E2IB 1PFNA 4IURA 4DXFA 1CSQA 1S3OA 4HIOA 2JA5G 4BBSH 4Y52H 4N9TA 2VUMB 2FFKB 3V2TA 2A6EC 1SFOH 1CI3M 1DXMA 2K6AA 1CHQD 5IWAQ 4XIGS 2DY8A 4K8IA 4IPHA 2K1BA 1OXVA 4PZ6A 4ME3A 2ZTCA 1F9QA 1S4ZA 3A5ZB 1I50B 4BY1B 1JB7A 3D0FA 5KNBA 4ULLA 3SGIA 2EOTA 4P74A 2SNSA 3I70A 3K5MA 3MTSA 4A3GH 2KCCA 2KCMA 4LF6Q 5C4HA 3G71A 4JI0Q 1II3A 2CFMA 3VR4A 2K4KA 3HRZC 1KIXA 5EAYA 5CV8A 1H9MA 3Q6SA 4BY7H 3HKZE 1Q12A 3V96A 2MNAA 1GUWA 4PZ7A 1V8QA 1PMRA 2KUMA 2NTTA 1DM0B 5JVG3 4C2MB 4B9WA 4AYBG 1MD2D 1I94Q 4C3IH 2OWOA 4A3KH 2EY1A 2EJGC 3ERQA 1C0AA 1HFNA 1Y1WB 5EQ0A 4KKUA 4DAPA 2OT2A 4YY3L 2MPMA 2OF1A 4DNTB 5LMNL 3A55A 1Q8IA 3ERSX 1SMXA 3JAMc 1VQ5A 1M90C 4X65L 1GO3E 1JQYD 1STNA 1ONLA 2AWOA 3CCEA 2JA7G 1K0RA 4LFCQ 5T1GA 1GUTA 2MQHA 3HOXB 1DOLA 4QCLA 1MSHA 3LWUA 1F2ZA 2L55A 3QIAA 4I7ZC 3L3OC 1KDAA 5C5MA 3M3YB 5DNFA 1WD1A 2BDNA 3GTPB 4MTKA 3R93A 3F1ZA 3MFYA 3RUZA 4CDFC 3J81L 4O2DA 2J4XA 2LY7A 2PMZE 3S1QB 4POFA 4JVZA 1TS4A 1JOKA 1RKNA 3Q23A 1PH4A 4K0KQ 4XYOA 1J9OA 4FXKC 4A3MG 2JA8G 3BYTB 2OCEA 2VUMH 5I9OA 1FGUA 3N6RA 4L5QA 2E2DC 4A3BG 4JI4L 1F2LA 3P1HA 1I3QB 1EZ6A 1A8VA 1A3VA 1STAA 1ILQA 3HOXG 4FNFA 5IYCH 4X3UA 5HY6A 1Y1WH 1VQNA 1BO0A 1E22A 2EY5A 4NB3A 2BA1A 4A3FG 1AZPA 5KNDA 1CKNB 1Y1VB 2DNEA 3HKZG 4X3SA 1NBWA 3PIP3 1DZ1A 5EKLA 4IUUA 4A3JH 4PMCA 3NWTA 1JC7A 3CU7A 2PQAB 1SYFA 3R2TA 4DK1A 2HCCA 4L5RC 2JEAI 1NMGA 4YHHQ 1PH8A 4IN3A 1PZJD 4ABNA 4HMIA 2C35B 3M4OH 2L1BA 3TBIB 3VA5A 3MEFA 1V9PA 2KENA 1CM9A 2IWHA 2A1AA 5FO9B 4RWSC 1AP0A 4A3JG 4H13C 1BR9A 3JC66 2Q2HA 3EVQA 2B29A 1JCKB 1HHVA 2NB0A 3HOZG 4A3FH 3L7ZC 2NVQH 1QVGA 1VDZA 5LHY1 3DLLA 2K33A 4DGZA 1RHPA 1Y1WG 1KC8C 3IFTA 5IYCG 4CHTB 1G91A 4OIKA 2F0NA 4ID6A 1LACA 1ZYRD 1XWEA 1YJNA 1WTXA 4NXNQ 4K5XA 4TQUS 2HCIA 2NN6G 2HHHL 5T1IA 2JA8H 4OO1H 5COYA 4A3KB 2ID0A 5ELOA 1YNJD 3PUXA 2VS1A 1VQAA 1BBWA 3CC4A 3J7A5 3SXHA 5D3IB 2EYMA 3CCVA 4KMUC 1F77A 2RF4A 2NVXH 2NVXB 2EXDA 3OOCA 4WJ4A 1WTOA 2JE6I 2E75C 1TS3A 2B39A 1HR0L 2XWBB 5TSSA 1N36L 1PH5A 3H94A 4GKJL 2HIVA 3ONAB 2A68D 1RDPD 1TS2A 1EU4A 3NXWA 5K36H 5IP7G 3G4SA 5M3FH 4DAYA 3QWNA 3TP7A 4C1NI 1JORA 1VF7A 5CMDA 4FF3A 2I5HA 4NXNL 1EY0A 1JE5A 3QB3A 2KVMA 3NQTA 4L5TA 1AW7A 1X9NA 2I5MX 5BN3A 4C3IG 3NWSA 4R9WA 1VQPA 4GN4B 1A3UA 1SMYD 1TWGB 4KHVA 1HNZQ 2UUBL 4N9PA 1HNWL 4MIUA 2B2TA 1S5ED 2GA4B 2PW7A 1ENCA 1SEBD 5K5PA 5BR8L 5IOCA 3SEBA 3T16A 1TWCH 1HXYD 2YU9B 3EROA 4G4KA 3C1FA 3PGZA 4UP7A 2WKCA 3MXPA 2RDHA 1YNND 2WAQG 5CV7A 1VQLA 3RZOH 3STBC 3A54A 2OQKA 4KY7A 3PO2H 1IZ6A 3CCUA 3BDCA 3J81E 1SNPA 5M3MH 5IGGA 3FDTA 1LTID 2K5QA 3NENA 2L15A 3G7LA 3E5SA 1L0YB 1A2TA 5CV4A 4P72A 1TKWB 5HGTA 2M00A 4QGUA 3HOZH 4IOCA 3QOLA 4FO2A 5C6AA 3S24A 1B8AA 2MO0A 2L12A 4L6TB 2I07B 2K5NA 1E2ZA 3KUPA 2LKVA 3WWVA 4DAYB 2CKZB 3QOJA 3GDEA 1S5DD 5J1ZA 5JOBA 2TMPA 3TP8A 3GQBA 3S14B 1BQQT 4QMGA 3S2HB 2R93H 2ZXPA 1WI5A 1GUNA 4ZUIA 4Z9CB 2F0FA 1HR0W 4K2KA 1PH2A 1XMQQ 1ZYRC 4M1UB 1S40A 3KF8A 5FJ8G 1CZWA 4DV5Q 2YYZA 4NMZA 4DR4L 4LF6L 4OO1I 1DGSA 4IUPA 1Q7YC 4H02A 1B44D 4TRDA 4DR2L 1IYUA 5IP9H 3A8JE 3HKZB 3L2PA 4DAVA 2ZJRA 4HSPA 1RTOA 3S1NH 1LTRD 1SXTA 1J6QA 4EGVA 1EYAA 1PDQA 2MUYA 3KK7A 3K5OA 2PPBC 1STGA 4HSVA 4HJ7A 3GP7A 4LF7L 2O5JC 4C3HB 4BS9A 1YJ9A 3BJUA 1SJED 1LT4D 1YI2A 5JJKA 3WOEA 4K14A 5L37A 4DV6Q 4JI6L 5E3FA 4CDCC 4PZ8A 5CV9A 2IHEA 1PH3A 3BZDB 3CPWA 1LUZA 4HEDA 1M4VA 1X6OA 1NMFA 5E4WC 2F0KA 1K83H 5IYDH 2UUBQ 3S2DB 4DUZQ 1M8AA 2K7VA 1KTKA 4JW0A 3KBGA 2MO1A 4KHPL 1EQRA 4WFN3 2IPKD 4BY7B 1ET9A 3RD4A 3GTJB 1Q46A 1OXTA 2RDFA 2BOSA 2FMMA 2K14A 4OWTB 1K28A 3OWEB 1B7YB 4DU9A 1UNSA 4BWGB 2JEBI 1VMPA 2JXMB 2PQEA 2RHQB 4G7ZC 4LF5L 3NSWA 4A3KG 2AQ2B 1AE3A 2IL8A 2L4NA 1KD1C 4DV7Q 1I4HA 4H44C 3H09A 2VQEL 4DUYL 3H0GB 3TDQA 5M5YH 4XQJA 4LF9Q 4TVAB 3NUCA 4BXXH 1BCPD 4A3LH 1IKLA 1EIHA 1DJRD 2NVQB 1PTOD 2EYLA 4GOPC 3NHHA 4TKOB 3I8ZA 3TREA 4RGMA 4KTAA 3MXNA 2RA4A 5ELNA 4JI5L 4B08A 4CKEA 4OO1G 5CV6A 1LTBD 2RSNA 2JJQA 2NN6H 1SBBB 1BXTA 3AU7A 2F0IA 2H1EA 4HIMA 1VQ8A 3E9IA 4U68A 1EY9A 4Q0FA 2BE5D 3RZDH 2KHJA 1MGSA 5KYIA 3OPOA 2EYJA 1K0SA 2XGTA 4C3JG 1L1OC 1QUQB 5GAHC 1ZKOA 4A3IB 2Z4HA 4IALA 3BG3A 1VQ4A 1GHKA 2PO4A 4KLKA 2K50A 1BF4A 1PH6A 2EQSA 4L8JA 3TMEA 2Z4IA 3I56A 3LGJA 2RVLA 4JI7Q 4X66Q 1SE8A 4B3TQ 1Q90A 4KHPQ 1F9PA 1U0LA 4K8JA 2AUKA 3VYUA 3O13A 4IJHA 1DOKA 3GTPH 2PZUA 3TRZA 1DONA 3D31A 2DUDA 2B63H 3C2PA 3A0JA 1BCPC 2JA6B 3HP3A 3HZXA 1KDBA 4JI2Q 2RSOA 4CDEC 1VCIA 2IW3A 3QR8A 2HD3A 2UXBL 5GROA 2IHFA 1QNKA 1U4MA 1K8GA 1E2VA 1YNXA 4LK1C 5JAVA 3H0GH 1O7IA 4H7BA 1Y8PB 4NDXA 3C3LA 3IAYA 2QF7A 3F8TA 4YWKA 3EJIA 1U4PA 3HOXH 1NNXA 4DR2Q 1SJHD 5C3EB 4A3EG 3MXGA 4EQ5A 2YV5A 3PUWA 3A56A 3NEMA 1V1PB 3LX0A 2KHSA 1HZ9A 4LFBL 4KY6A 2PZTA 3IL8A 5FLXE 4EQPA 1P8LA 2D0OA 3W3AA 2NVYH 1B3AA 1W3SA 1MKHA 2F1MA 1OXUA 4JPBW 1XXGA 2B8GA 2E2HB 5ELBA 1LO5D 5LMUL 4OX9L 4JI6Q 3HOUB 1KRTA 1LTLA 1SNMA 3JAME 1I6HH 2PZWA 1J8IA 2R7FA 1QVCA 4UP9A 3I4MH 4MHEA 1KRSA 2JA7H 4OWXB 2XIWA 4A3MB 1J5EQ 2NVYB 1NY4A 2E8GA 3Q22A 4K6LA 3ER0A 4XQNA 2EVBA 2RHSB 2BCOA 1AN8A 1Q1EA 3VR2A 4B3ML 1KABA 4EX5A 5KGUA 4X62Q 2KJXA 2CH4W 1CTMA 1JJGA 2JSOA 1EWHA 5FK9C 4N8X1 2P5ZX 2X6GA 1V1OA 2NN6I 2AQ1B 2O5IC 4POGA 1HQRD 1N9WA 3IRBA 1N34L 3I7FA 5LL6S 2DN8A 3A5UA 3PO2B 4HMJA 3ND9A 2IX3A 4IUNA 3D4WA 3I4NH 4RMFA 2X69A 3HOVG 3HOWG 2EYPA 1NCVA 1R4QB 3MWYW 4L63B 4RAUC 4J1MA 4JV5L 2QW7A 3K7AB 1MBYA 2BA0A 2N49A 5JEAH 3G6EA 4KKSA 3P7JA 3K81C 1HNWQ 3KYHC 3K58A 4UDUC 1TWCB 1A62A 5ELDA 4XT3B 4EVOA 1I4GA 4R4CA 5E1FA 1MJEA 1D7QA 1ASYA 2QDBA 1XPOA 2Z6BA 3FEWX 1I4XA 2K5WA 4FVMA 4HTHA 3QG1A 4DAMA 4I65A 3W1GA 2PNHA 4OL7A 1EWIA 1PYSB 5IWAL 3MA2B 1PFBA 1O7YA 1MHWC 2EJMA 2EY2A 3D8GA 1JJCB 4KJOA 4YCWA 4A75A 3KDFA 2ZM6Q 3KLSA 3KOJA 5C4XG 3R2IA 2Q2UA 2NBFA 4JOIC 1RCVD 3T1HQ 4MN3A 5IT9E 1FVIA 2QGQA 5C0XG 2CW0D 1DOMA 2A6HC 1OXSC 1M1KC 4IO9A 3SDZA 2K75A 5GADC 1J5EL 2R92G 4FXDA 5C4ZA 1RJTA 2NVTB 5NUCA 5IIFA 3H0GG 3MC0B 1QNUA 3E9HA 2ZJPA 5KYLA 5JJIA 4LJZC 3MAQA 1OO9B 1PV4A 2VXWA 3Q8DA 4JBWA 2HT1A 1CQFA 3U4ZA 1HJPA 2RCNA 4YCVA 3S1RH 3J7AV 5C5LA 4LUOA 3PO3H 4OX9Q 4C3JB 5IY0A 2B2YA 1ICWA 3RLOA 5GAGC 5JPMC 5G3LF 1EY5A 1SNQA 2I5LX 1EEID 2O4XA 3TQYA 2PMZB 4N8FA 3DHQA 5JVH3 2EPBA 2CVRA 1VQMA 1VMCA 5I6YA 3M4PA 2WINB 4DK0A 4RGOS 2CWPA 4A93G 3UDFA 4OGQC 1HQMC 1XYIA 4L5SA 1G8ZD 1GD7A 2SEBD 1SNOA 2JA6G 2M9VA 2V1CC 1K8MA 3SK4A 5ELEA 4JI1Q 1ICFB 1ILPA 3RNUA 4GN5A 4A76A 2F0QA 3GO5A 2JA7B 4A3JB 4OONA 2L0CA 3UDXA 3VR3A 1TXYA 2VZAA 3RLFA 1SRUA 1IKMA 5CGKA 3OWFA 1EY7A 1STEA 1JMCA 3OIQA 1FGBD 1ENAA 5JEAG 5C3XA 2A73B 3VDYA 2CHBD 2PI2A 1SYBA 2Y0SG 1H95A 1JOQA 1JWMD 3RMHA 4GLAC 1WTWA 1XTCD 4MNOA 3C46A 4H0LC 4A3LG 3FKIH 4JI3L 2R7ZG 5C44H 3CCQA 1IBML 1Q1BA 4X6AH 1HA5A 2B2UC 3HOYB 3NTHA 1VQCA 1XX8A 2R7ZH 3S1QH 3LNNA 1IHZA 4RKLA 4LF7Q 2XRQD 3CRKC 1EL0A 4AIMA 2F3WA 4KD3A 4LNQA 2B3GA 3H6MA 1B3QA 1KAWA 4HN7A 4A3CH 2F4IA 4HIKA 1D5ZC 2F4VL 3GD7A 4F8MA 4HJ5A 4IUQA 2B2WC 2LMCB 1Z6HA 3CCSA 3AYHB 1CKNA 1WTRA 2B2VC 2CH4A 4IQZA 3I4MG 1W2BA 3K5NA 5M5YB 3EIVA 4R4OA 5IYDG 1HCZA 3UE1A 2N78A 3X3MA 4RGTA 3VR6A 1OXXK 2D0PA 1NR4A 3X3NA 3BVGA 3GTOH 4GN3B 4ZLTF 4X64L 2JA9A 4EQNA 1JWSD 2UUCQ 1D8LA 3HOYH 1SDFA 1SYEA 2EIFA 1B9MA 3CP0A 5C44B 4A3EB 1DD2A 2HQLA 2PNRC 4WRDA 2Q8IB 1TQOA 1HZCA 5J22A 1E2WA 1SN8A 5EBCA 1EQTA 1W6KA 5C0XJ 1DCZA 1HNXQ 1Q86C 3SK5A 4UAIA 5IYBH 3PUYA 5IGBA 2Q2TA 2QEJC 3DWAA 2B2VA 2B2YC 2HQEA 2QILA 4UP8A 1E3PA 1KLGD 4GS3A 4QIWB 1AZQA 4DR4Q 3PUVA 3CHBD 3VYTA 1C8CA 3DXJC 5LL6X 2YU9H 4DV0Q 3S9WA 1K83B 4CJ0B 1GUGA 3FVQA 3NPPA 3T13A 2JQOA 3JAMi 4LFAL 4ALPA 5D65A 1Z7TA 1EIFA 4LFBQ 2DGYA 5J39A 1GJXA 3AFQA 3S17H 3S17B 5I4DA 4RKBA 4X3TA 1X54A 2Y0SB 2UU9L 4BBRG 5I9PA 4JI2L 5IGFA 4S3SA 4CBVA 3HGBA 5C3EH 1VQDA 1WJJA 4A3IG 2IX0A 3J7YW 2I0QA 4K2LA 5FO7B 4KKTA 1LM0A 3TEHB 4AH6A 1HA6A 4LWCA 4C3JH 2E2JB 3CCJA 3JAML 2WAQE 3CAMA 3HOYG 2PQAA 1EFWA 2AUJD 1EWCA 4LUZA 1B70B 4FXGC 4OEMB 4R8NA 1EUJA 4DV1Q 3TZUA 5JJLA 4A3DB 4JI1L 2ZTEA 1WCMG 2A74C 5EKIA 2Z6KA 1CT1D 1B2TA 4DF7A 3GTQB 3DEPA 1V1QA 1UE6A 2GN5A 3BVMA 2K28A 4UY8C 2A5HA 4X3KA 3CQZB 1PFSA 4K6DA 4DV2L 2NTSA 2SDFA 2LS01 2ZTDA 4FF4A 2K03A 4JBMA 1I94L 1X3PA 4PV1C 2EJFC 1PTOF 2MHVA 3GTKB 1PYBA 4TSSA 1JE4A 4ZAIA 5BN5A 4AQYQ 1VQ6A 2HHHQ 2R61A 1EQVA 5CYUA 4QUFA 5IODA 3GTQH 2E2JH 3K7UC 1A15A 1AH9A 5EPLA 4OHJA 3EQLC 3S16B 1X3EA 3OSOA 3T51B 1TWFH 2XTIA 3OW7A 4IUVA 1CA5A 3BDLA 2RCFA 1KL9A 1T5XD 1RD9D 3J80c 3Q0AA 4A3GB 3V05A 1FD7D 5M3FG 2NZ1D 2QA4A 1O78A 3KF6B 4P73A 3CMEA 1JT8A 2UUAQ 4A3DG 3K0XA 1I4PA 1D1KA 1L2FA 1WOCA 5DM63 4P75A 3I55A 4GLVB 2ZJQA 1B9NA 1SE4A 4LUVA 5FLMG 3A7AB 5FO8B 4ZK9B 1GUOA 3K59A 1SR3A 2AHOB 4O42A 2AWNA 2XSCA 2ATWA 3R3OA 2EE1A 3TP6A 4QUCA 1HUMA 3DEOA 1CZGA 5JPNC 4X64Q 5ELFA 4HCSA 2F0VA 3F2DA 3ULLA 4ZRZA 1SNCA 5M3FB 3BYYB 4IFDI 1FJGQ 1E7ZA 1Y1VH 2IT1A 3S16H 1PRTF 4ZUJA 4JI7L 3PF4A 4LMQD 1R9TB 1E1TA 4DK6C 4DK3C 2XNAC 3CXCA 2HDMA 3EBEA 2WB1E 4DNRB 4JC0A 4FYDA 3I72A 4P2CB 1D6EC 3I4MB 2UXDL 3RR5A 1A63A 3IKJA 1KAAA 5KNCA 2EZVA 3PF5A 2OQ0A 1X3GA 2R6GA 1I6HB 1TR5A 2A19A 2F52A 1FNWA 3CCRA 3H15A 3MXNB 2K5VA 3M85A 3HOUH 1ZXTA 1Y8NB 5IGCA 4GOPA 4NXMQ 1LTSD 4DA2A 2NZHA 2J7ZA 2WB1G 4JI0L 3MZ5A 4KK7A 4P71A 3SK6A 1TY2A 1L1OA 3PUZA 2O2LD 4NKLA 3NTKA 1UEAB 1VQ7A 1QJOA 3CCMA 4DR6L 3NELA 4IJLA 1IBMQ 1MJCA 4DXGA 3J80i 1QZGA 3NP8A 3H3VH 1CK1A 3KLWA 2KCNA 3KF8B 3I4NB 1TWAH 4XQQA 2BH2A 1NAPA 3T53B 2JN4A 2ZM6L 1PTOC 1VQFA 5C4XB 1PYWD 1V43A 3B6YA 4V0BA 1EEFD 1N32L 4C3IB 1EZ8A 2WACA 1Q81C 4IPDA 5E4XA 1YIJA 2NWGA 1S5CD 1ASZA 5H1SE 4HIDA 3KJOA 1K8OA 4DR1L 3TS0A 3R8BA 1TWFB 4LF8L 3CCLA 4YY3Q 3PO2G 4RG1A 4NW2A 2KEEA 4K5WA 1EYCA 3S14H 5FLXc 3BS1A 2VUMG 1TS5A 4HR7B 3I3CA 1I4QA 1VQIA 4A3MH 4QB4A 2K01A 4B3RQ 1SYGA 3I4LA 4OIJA 3K5LA 3NTIA 3M4OB 1YHBA 3E0EA 1YVCA 3S2HH 4IPGA 5EKKA 5CORA 3VR5A 2LSSA 3TN2A 5EGTA 1XNRQ 4J8QA 5LMUQ 3PQIA 3OYYA 4IFDG 1K3BC 3F2CA 1H9RA 2HIXA 1A2UA 1QZHA 3HOUG 1XMQL 1QILA 2EYFA 3ULPA 4Y7NB 3OMGA 1SE3A 1ML0D 4FP5D 4GNXC 1WFQA 3TS2A 1QB5D 3DM3A 3FPPA 3E6ZX 1O7ZA 2F3IA 1HNZL 4O1NA 1Z47A 4JV5Q 4PNYA 4X65Q 1PRTC 1Z9FA 3PIOA 2A69C 2Z0SA 3J81i 2IY5B 3S1MH 3S1MB 1I3QH 3NE5B 2VL6A 3STBD 1XMOQ 1PZKD 4R4QA 1LYLA 2OEOA 2Q2IA 5IT9c 3GTGH 3CC2A 3S1RB 1XNQL 5FKAC 1DYQA 1YNNC 4J6HA 3WOFA 3AQQA 1BUVT 1VQJA 2K5HA 2Z1CA 4NP5A 5D3DA 1WCMB 2UXDQ 4BY7G 4QF4A 1WD0A 4AYBE 1N34Q 1TIID 1LV9A 1P16A 1IBKL 1F9RA 2E2IH 3PO3B 3U50C 4KV6A 1NR2A 2JYOA 3CPFA 2WKDA 3GTJH 2V4DA 4C56C 5LMNQ 1E0BA 2M2LA 5ISRA 3FP9A 3FPUB 1TWGH 5FLMH 2VB2X 4ME5A 3S2DH 1BNZA 1RTNA 2VQFL 3S15H 1PH9A 1C4QA 1H9SB 3W2DA 4JBJA 5AFWA 2N8NA 4DV0L 4A3CG 3CD6A 5IP9G 5A2QL 4WORA 4CKCA 1IXRA 2Y0SE 4NPSA 4HCEA 1QWYA 4GKJQ 4A3BB 2EDGA 1A0IA 2JA5H 1GOZA 3S15B 3AEVA 2JA8B 1F2MA 2HUGA 2VQEQ 4DUYQ 4IFDH 4OXPA 4KN4C 1EOVA 2PCFB 2SOBA 4PQXA 3J80E 1Y14B 1N8RC 4ILWA 1PTOB 3NBHA 3HKSA 3CW2C 2IX1A 2ZT9C 1K3RA 3ITPA 2YTVA 1IBLL 4B3SL 1KDCA 1IYVA 1EY6A 4A3FB 1CFMA 2CCZA 2EYHA 3I4OA 1XMOL 4JOIA 3TZDA 3U4VA 3U9SA 1F9SA 4IPCA 3GTMH 3URYA 1SMYC 1KLUD 1UE1A 2LFNA 4GZYC 4HAEA 5M3MG 1Q8KA 1PVOA 4GKKQ 2XN9C 1C7YA 2RKSA 1WTQA 1IBKQ 4A3BH 2D2CC 2Z9HA 4AQYL 4A93H 1VS0A 3M4YA 1EFID 2R93B 1X32A 2VW9A 3H3VI 3SK8A 5C0XI 1X3FA 1LLRD 1WTHA 4YWMA 3Q24A 4A3IH 2FHTA 1C48A 3CF5A 3KJPA 4DV1L 1PA6A 2A6ED 1D5XC 3MXUA 1XJVA 1XPRA 3NBIA 4RCOA 3BZCA 5M3MB 4ZKBB 3J7AF 1BBXC 3T1YQ 2R7DA 4FF2A 3P75A 5A35A 1JJ2A 4BXXG 1G6PA 3VYSA 1CUKA 4IFDJ 4A93B 3OIPA 3GTGB 1ET6A 1HRJA 1MSGA 3NK9A 1PRTB 1BCPF 3A74A 1GM5A 3G6JB 3HEJA 1S72A 4YIJA 1BCPB 4UHVA 1D1IA 1STHA 4LF9L 3ICEA 1BBUA 1QG7A 3KF6A 5IYBG 2RBMA 5K36G 3D6WA 4RHSA 5HURA 4YWLA 3W5OA 5C4JH 5I6WA 3M3YH 5AJ3Q 1JB3A 4B3SQ 4KD4A 1TVXA 1Y1VG 1PXUA 3U9OA 4DR6Q 3LWEA 5M5WH 1ENFA 1TWHH 4ZYSA 2UUAL 1KNAA 2ICIA 4DR7Q 5E7NA 1IYJB 2BE5C 2H4OA 1HTLD 1NUCA 3PMFA 3FRPB 1Q82C 3ND8A 2F0TA 5CR3A 2A69D 4HJAA 2F4VQ 1B1ZA 1U4RA 2CQAA 2PI2E 4APVA 1SYCA 1T9HA 4KHZA 2GVAA 1AFPA 4DR5L 3L0OA 2F0EA 2L5TA 3MVVA 1VQHA 1YNJC 2A6HD 1BOSA 4JK1C 4A3DH 2C9OA 1N33Q 3PCOB 4XTCS 2MGSA 2NZOA 4HJ9A 1MI2A 2N88A 3KDFB 3GV3A 3HOVH 3HOWH 2K52A 3I4NG 1RIPA 3VA7A 4DN4M 2F0UA 2KOLA 3RZDB 1EY8A 2QDLA 1JICA 3BVZA 3KLRA 1FNVA 3T1YL 4C2MH 1UEBA 1I5FA 3GV6A 4QJFA 4KN7C 4G57A 1W6JA 3ZYYX 3MFGA 4JBKA 4R8IA 2JK8A 2DY7A 3D4RA 1UUPA 3CRLC 1KNEA 4LF5Q 4DV6L 2R93G 3AMUA 4F88A 3OMCA 1H9SA 3HG9A 5JJZA 2JP1A 3T1HL 4KI0A 3D3RA 2B8FA 1JOOA 4JI4Q 2F0DA 1I50H 1RF2D 4BY1H 4EQOA 3M7GA 1SFOB 5DEHA 4ZCKA 1B50A 3EN2A 3AFPA 5M5XH 1HZBA 1NJIC 3A8KE 2DNCA 2WP8J 3KFUA 4IOAA 1GHJA 1WCMH 2H5XA 4GNXA 1GXDC 4YCUA 3W1BA 3G48A 5C4JB 1PH1A 1KQSA 3SE0A 1XTDA 2CWAA 4K5VA 4BBSB 3OHXC 1LT3D 2N55A 2EYOA 1EY4A 1JWUD 5J3BA 1E24A 5C3EG 2KEDA 4R4IA 2WB1B 5JEAJ 4DR1Q 2E76C 1ESFA 5KIXA 2KECA 4LF8Q 4NXML 1IL2A 4QL5A 4Y7NH 1N33L 3GTLH 3CKIB 3HOWB 1YEZA 1KHIA 3HOVB 1TY0A 1BKBA 4CJ2C 4CKBA 4RGNA 2UUCL 4IZ8A 2L9HA 4B3RL 1QCBD 2YTXA 4LAAA 1D5MC 4V190 1G291 5FOBB 2WFWA 2BH8A 5BR8Q 2KHIA 2L11A 4O0AA 3IFDA 5CC4A 2J0TD 4F87A 1O7LA 2Q8RE 1XNQQ 1G2SA 2B63G 3WDNA 2F0OA 2RDGA 2XRSD 3J7ZC 4ZKCB 1XPUA 2R92H 3K7AH 1LTTD 4GLXA 1STYA 2B2UA 2QCPX 4DV4L 4GOPB 1TWHB 2Z8LA 5GAEC 2VY3A 1Y69U 2ZXRA 1X3QA 1F2YA 2Q8TA 1GKHA 2F0MA 1VQOA 5C4XH 1SYDA 2X6LA 4JG2A 1TU2B 2ICEC 1G6ZA 2A68C 5I2YA 3EFXD 1LT5D 4DR3L 3EA6A 1IBLQ 4JI3Q 1G51A 2R92B 2D62A 1ZEQX 4JI5Q 5C3WA 1YHQA 5FLXL 3CQZH 1EU3A 2OTLA 2BDOA 1E1OA 1PTOH 3P20A 4DV2Q 4RFBA 1CA6A 2KBNA 2E5LL 4A3GG 2Z6KC 2FJ2A 1FYCA 4JYAQ 3I2ZA 1BVSA 5EPJA 2UXBQ 1AEXA 1K8AC 4OWWB 2K05A 1YBYA 1K73C 3PIO3 5F2DA 3CMAA 3N52A 3AB9A 1FL0A 1VQKA 5DAUA 1PH7A 4ODGA 1S5BD 2NUCA 2F3VA 5DLQE 4DFAA 2AMCB 1UE5A 5BN4A 3HFZB 4B3TL 4DR3Q 5G3LD 4LFCL 1U4LA 3UE0A 3FKIG 2TSSA 2K32A 2F0HA 1YJWA 5I2XA 4OELB 3K8AA 5IGEA 2B2TC 1PHJA 2G5DA 1U5KA 5EBDA 4U673 4WJ3M 3H91A 1LTGD 3J81j 5KRUA 3GTMB 1PRTD 1IW7D 1I4RA 5IT9L 1C9OA 5CV5A 1G2TA 3J81c 1EIGA 4YHHL 1B53A 2UXCQ 2CW0C 1LABA 5IE8A 1NTGA 1UE7A 1YITA 2YTYA 3DUZA 4AYBB 1WTVA 1B4OA 4F7XA 2NVTH 2CQOA 3SVMA 1I6VC 4FDBA 1IL8A 2A8VA 4CGYB 2KCTA 2KQ3A 1NE3A 4DNIA 5CBEE 4DV3Q 2D5DA 4HJ8A 2F0JA 3UDIA 2WIIB 4X62L 3D6CA 3HS0C 3NQIA 1HTPA 2F0GA 4LFAQ 4WJWA 2R7ZB 4G7OC 2JA5B 4A3EH 2EY6A 3M4QA 3UI2A 2UU9Q 1SNDA 1X55A 1S5FD 1XNRL 4BBRH 5M9OA 2IJ0A 4R4TA 1OTCA 4JCVE 3ULJA 1MIUA 1CQVA 1SLJA 3J80L 2AQ3B 4E6IA 4M8AA 4BBRB 3PO3G 4XT1B 1O80A 3DM1A 4LF4Q 1V1PA 3KBXA 4BY1G 4RHRA 4DKAC 1LTAD 5FJ8H 1K9MC 2XWJB 1SAPA 1JR0D 3K0YA 1ESRA 2MFIA 4DPGA 1HZAA 2F0WA 5M5WB 1YHAA 3MEHA 3U58A 3L9AX 4BA2I 3T4AC 4DR7L 3PIPA 3PV0A 5C0XH 2F0PA 2E5LQ 3OW2A 1N32Q 1PFMA 1UWVA 4MTNA 4MZ9A 1SE2A 1VF5C 2RQXA 3BU2A 1EIYB 1WYDA 2ZXOA 5GQOA 3RZOB 1HUNA 4DV4Q 1H9JA 2OTJA 1NSNS 4XYQA 4PMBA 1HNXL 3OTOQ 2ASBA 2XVSA 3BZKA 2AKWB 4PG3A 1H9KA 4DR5Q 1L0XB 2WV6D 1Q3LA 1EQQA 4QIWE 5HGQA 1X65A 1QOHA 1RODA 1SSOA 1Y8OB 2B2WA 2F03A 2C5CA 2DJFC 3A8IE 3VYRA 4R1JA 4LW1A 2PW5A 5DM73 1SROA 1PZID 3M9BA 4BA1I 3KLSX 4KJNA 3H3VC 2R3ZA 4IUTA
chains in the Genus database with same CATH topology
2VQFQ 1KXLA 1B8AA 1Q1BA 3K80C 2MO0A 4X6AH 2K5NA 1AE2A 3WWVA 4DAYB 2CCZA 1VQCA 2CKZB 4J15A 2R7ZH 3ZJYC 3GDEA 3I4OA 3S1QH 1XMOL 2UXBQ 4LF7Q 4JOIA 3U4VA 1HR0Q 3CC7A 1QVFA 4IPCA 4UPAA 4AIMA 3GTMH 2LXKA 1VQBA 4LNQA 1UE1A 2B3GA 2R93H 1KAWA 1WI5A 5M3MG 2QEXA 4JYAL 1Q8KA 1PVOA 4GKKQ 4A3CH 4HIKA 2F4VL 3GD7A 1HR0W 1R9TH 4QY7A 4HJ5A 1PH2A 1C7YA 1XMQQ 1RL2A 1IBKQ 4A3BH 3CCSA 3AYHB 1CKNA 1S40A 4AQYL 5FJ8G 4A93H 2UXCL 3I4MG 3RN2A 2VNUD 4BBSG 1VS0A 2ALYB 4JI8L 1W2BA 2LXJA 4DV5Q 2YYZA 3EIVA 4R4OA 5IYDG 3UE1A 2VW9A 2N78A 5C0XI 5AJ3L 4LF6L 1X3FA 1DGSA 5C44G 4DUZL 4YWMA 4A3IH 4OO1I 3CF5A 1CKMA 1Q7YC 4H02A 3KJPA 1OXXK 2D0PA 4DV1L 1PA6A 2E2HH 1CSPA 3GTOH 1VQGA 4GN3B 4DR2L 1X56A 1XPRA 4X64L 5IP9H 1XJVA 2JA9A 2UUCQ 1D8LA 4PMWA 3H3VI 3BZCA 1HH2P 2EIFA 3RLNA 4DV3L 3HOYH 1EYGA 3L2PA 2ZJRA 4JV5Q 3CP0A 1FJGL 3T1YQ 2R7DA 5IP7H 3S1NH 1JJ2A 4BXXG 1G6PA 1CUKA 4IFDJ 1J6QA 2HQLA 1YZ6A 4HJ7A 4LF7L 4C3HH 1L1OB 1YJ9A 2FXQA 3BJUA 4DV7L 1HZCA 1YI2A 3A74A 5JJKA 1GM5A 1SN8A 4DV6Q 3NBHB 4JI6L 4GNXB 1S72A 1GVPA 5C0XJ 4PZ8A 4GKKL 2IHEA 4A4IA 1PH3A 3FHWA 4LF9L 3ICEA 1BBUA 1Q86C 1HNXQ 3KF6A 3OTOL 3CPWA 5IYBH 5IYBG 3PUYA 2Q2TA 1LUZA 5K36G 4LF4L 1X6OA 1NMFA 4UP8A 2JA6H 1E3PA 4YWLA 3RN5A 3W5OA 5C4JH 1K83H 5IYDH 2UUBQ 4GS3A 1VQ9A 3M3YH 5AJ3Q 4DR4Q 3PUVA 4DUZQ 2GVBA 4B3SQ 4X66L 2MO1A 1Y1VG 2YU9H 4DV0Q 4KHPL 1EQRA 3M7NA 1VQEA 1Q46A 4DR6Q 1OXTA 1N36Q 5M5WH 2JQOA 2K14A 1TWHH 4OWTB 3JAMi 2ES2A 4LFAL 4ALPA 4LFBQ 1EIFA 1B7YB 2DGYA 4B3MQ 2UUAL 4DR7Q 3AFQA 3S17H 5E7NA 1IYJB 2JEBI 1X54A 2UU9L 4BBRG 2RHQB 4JI2L 4QQBX 1Q82C 4LF5L 3PSIA 5C3EH 4A3KG 1AE3A 1VQDA 1WJJA 2N3SA 4HJAA 4DV7Q 2IX0A 4A3IG 1KD1C 2F4VQ 1L0WA 5LMNW 2I0QA 2PI2E 4APVA 1T9HA 2VQEL 4DUYL 3F2BA 4KHZA 3GTKH 2GVAA 4DR5L 1LM0A 3L0OA 4K0KL 5M5YH 4LF9Q 1VQHA 4TVAB 3TEHB 4AH6A 4BXXH 4A3LH 4LWCA 4C3JH 4A3DH 4JI8Q 1N33Q 3PCOB 3CCJA 4XTCS 4DV5L 3UDGA 2WAQE 3CAMA 3HOYG 2PQAA 2NZOA 4HJ9A 4GOPC 1EFWA 1CKOA 4LUZA 1B70B 1QUQA 3KDFB 4DV1Q 1EUJA 3HOVH 3HOWH 2K52A 3I4NG 3TREA 5JJLA 1RIPA 4JI1L 2ZTEA 1WCMG 4JI5L 1CSQA 1S3OA 2Z6KA 5ELNA 4HIOA 2JA5G 4OO1G 3T1YL 4C2MH 4BBSH 1UEBA 1I5FA 1V1QA 4Y52H 1UE6A 2JJQA 4QJFA 2GN5A 4UY8C 1SFOH 4HIMA 1VQ8A 1PFSA 3E9IA 4DV2L 4JBKA 2JK8A 5IWAQ 2ZTDA 4XIGS 4JBMA 3RZDH 1I94L 4IPHA 2KHJA 4LF5Q 1OXVA 4PZ6A 4DV6L 2R93G 4ME3A 2ZTCA 3A5ZB 1JB7A 1PYBA 3D0FA 2XGTA 3SGIA 1L1OC 4AQYQ 1QUQB 4P74A 1VQ6A 5GAHC 2HHHQ 3T1HL 4A3GH 4KI0A 3GTQH 2E2JH 1VQ4A 3K7UC 2KCMA 4JI4Q 4LF6Q 1AH9A 4KLKA 1I50H 2K50A 3G71A 1PH6A 4BY1H 4JI0Q 2EQSA 1X3EA 3EN2A 3AFPA 1TWFH 2CFMA 1HZBA 2XTIA 5M5XH 2K4KA 2WP8J 1NJIC 3KFUA 4IOAA 3I56A 1WCMH 3LGJA 4JI7Q 1KL9A 1KIXA 5EAYA 4X66Q 1SE8A 3J80c 2H5XA 4B3TQ 4KHPQ 1U0LA 4GNXA 4IJHA 3GTPH 5M3FG 3HKZE 3TRZA 4BY7H 2QA4A 1Q12A 3D31A 3KF6B 4P73A 2DUDA 4YCUA 3W1BA 3G48A 2B63H 3CMEA 3A0JA 1JT8A 2UUAQ 2MNAA 4A3DG 4PZ7A 3K0XA 1L2FA 1WOCA 1PH1A 1KQSA 4JI2Q 4P75A 3I55A 4GLVB 2ZJQA 1VCIA 1XTDA 2CWAA 4LUVA 5FLMG 4AYBG 2UXBL 5GROA 2IHFA 1I94Q 4C3IH 2OWOA 1K8GA 5J3BA 1YNXA 1E24A 5C3EG 4R4IA 4A3KH 1C0AA 5JEAJ 4DR1Q 1SR3A 2AHOB 3H0GH 4LF8Q 4NXML 1O7IA 2AWNA 1IL2A 4YY3L 2ATWA 5LMNL 4QL5A 4Y7NH 1N33L 3GTLH 3F8TA 1YEZA 1KHIA 4YWKA 1BKBA 3HOXH 3ERSX 4DR2Q 1SMXA 4X64Q 3JAMc 2UUCL 4B3RL 1VQ5A 3F2DA 4X65L 4A3EG 1M90C 3ULLA 4EQ5A 4IFDI 1FJGQ 1E7ZA 2AWOA 1Y1VH 2YV5A 3CCEA 2IT1A 3PUWA 1K0RA 4LFCQ 2JA7G 2YTXA 3S16H 3NEMA 1G291 4JI7L 2MQHA 2WFWA 4A3LG 3PF4A 2BH8A 1HZ9A 5BR8Q 1E1TA 4LFBL 2KHIA 4DK6C 4DK3C 1P8LA 2D0OA 4O0AA 3CXCA 2NVYH 3EBEA 1W3SA 1MKHA 2WB1E 1XNQQ 1OXUA 2B63G 4JC0A 3J7ZC 5LMUL 4OX9L 4JI6Q 3F1ZA 1XPUA 1KRTA 2UXDL 3RR5A 1LTLA 1A63A 4O2DA 2PMZE 2R92H 3K7AH 4GLXA 4POFA 3PF5A 2OQ0A 1X3GA 2R6GA 1I6HH 4DV4L 4GOPB 2R7FA 2A19A 1QVCA 1PH4A 4K0KQ 5GAEC 4A3MG 2JA8G 2F52A 4UP9A 2VY3A 3H15A 3CCRA 2OCEA 3MXNB 3I4MH 2VUMH 2K5VA 1FGUA 3M85A 4L5QA 3HOUH 1KRSA 2JA7H 1GKHA 4OWXB 1VQOA 4A3BG 1J5EQ 4JI4L 4GOPA 5C4XH 4NXMQ 1NY4A 4JG2A 1A8VA 2NZHA 2WB1G 4JI0L 2E8GA 4P71A 1L1OA 3PUZA 3HOXG 4DR3L 5IYCH 1Y1WH 5HY6A 1VQ7A 3ER0A 1VQNA 1IBLQ 2RHSB 3CCMA 4JI3Q 1G51A 4DR6L 1E22A 2D62A 3NELA 4IJLA 4NB3A 1IBMQ 1MJCA 4JI5Q 1YHQA 2BA1A 3J80i 1Q1EA 4A3FG 1QZGA 4B3ML 4EX5A 3H3VH 1CKNB 3CQZH 3KLWA 4X62Q 2OTLA 3KF8B 1TWAH 3HKZG 1JJGA 2BH2A 1E1OA 4DV2Q 2ZM6L 1NBWA 1VQFA 2NN6I 2KBNA 1V43A 4A3JH 3B6YA 2E5LL 4POGA 1N9WA 2Z6KC 4A3GG 1N32L 3IRBA 1N34L 3I7FA 1Q81C 2PQAB 4JYAQ 4IPDA 3A5UA 3I2ZA 1BVSA 4L5RC 2JEAI 1NMGA 4YHHQ 1YIJA 4RMFA 1PH8A 1K8AC 4OWWB 1ASZA 3HOVG 3HOWG 3I4NH 1YBYA 5H1SE 2C35B 4HIDA 1K73C 3KJOA 3M4OH 4DR1L 3TS0A 4JV5L 3CMAA 4LF8L 3CCLA 4YY3Q 3PO2G 4RG1A 3MEFA 3G6EA 2BA0A 1V9PA 1FL0A 2KENA 2N49A 1VQKA 2A1AA 3S14H 5FLXc 1PH7A 3K81C 4A3JG 1HNWQ 3KYHC 2VUMG 1A62A 1VQIA 3JC66 5DLQE 4R4CA 4A3MH 2AMCB 1UE5A 2Q2HA 1MJEA 3HFZB 1D7QA 4B3TL 4DR3Q 4B3RQ 1ASYA 1XPOA 4LFCL 2B29A 3UE0A 3FKIG 1YJWA 3HOZG 4A3FH 3L7ZC 2NVQH 1QVGA 4DAMA 3K8AA 3W1GA 1YHBA 2PNHA 3DLLA 3E0EA 1EWIA 1PYSB 1YVCA 3S2HH 4IPGA 5IWAL 1Y1WG 1PHJA 1KC8C 1U5KA 4YCWA 2LSSA 5IYCG 1JJCB 4A75A 1XNRQ 3KDFA 5LMUQ 4WJ3M 3OYYA 4IFDG 2ZM6Q 3J81j 4NXNQ 1YJNA 3KOJA 3F2CA 5C4XG 1C9OA 2HIXA 4JOIC 2Q2UA 1QZHA 3J81c 4TQUS 3HOUG 1XMQL 2NN6G 2HHHL 3ULPA 3T1HQ 4GNXC 1WFQA 2JA8H 4YHHL 1FVIA 2QGQA 3TS2A 5C0XG 2ID0A 3DM3A 5ELOA 2UXCQ 1OXSC 1M1KC 2F3IA 4IO9A 3PUXA 1HNZL 2VS1A 1NTGA 5IE8A 1Z47A 1VQAA 2K75A 1UE7A 5GADC 1YITA 2YTYA 1J5EL 1BBWA 2R92G 2NVTH 3CC4A 3J7A5 2CQOA 3H0GG 3E9HA 4X65Q 2ZJPA 1Z9FA 3PIOA 3CCVA 3J81i 2Z0SA 5JJIA 2RF4A 4FDBA 2IY5B 2NVXH 3S1MH 2EXDA 2A8VA 2KCTA 4DR4L 1NE3A 4DNIA 1I3QH 4DV3Q 1PV4A 4HJ8A 3Q8DA 4JBWA 4WJ4A 2HT1A 2VL6A 2JE6I 3STBD 1XMOQ 3UDIA 4R4QA 3U4ZA 1LYLA 1HJPA 2Q2IA 5IT9c 4X62L 1N36L 1HR0L 3CC2A 3GTGH 2RCNA 4YCVA 4LFAQ 3S1RH 1PH5A 4LUOA 1XNQL 2HIVA 4GKJL 3AQQA 3PO3H 1VQJA 2K5HA 4A3EH 4OX9Q 3M4QA 5IY0A 2UU9Q 5IP7G 2UXDQ 3G4SA 1X55A 5M3FH 3RLOA 5GAGC 4BY7G 1XNRL 4BBRH 4AYBE 1N34Q 1P16A 4R4TA 1IBKL 4JCVE 1OTCA 3ULJA 2I5HA 2I5LX 2E2IH 4NXNL 1MIUA 3TQYA 3U50C 1JE5A 3CPFA 1SLJA 4L5TA 3GTJH 5LMNQ 1X9NA 2I5MX 3PO3G 1VQMA 4LF4Q 3M4PA 1VQPA 3FP9A 4GN4B 1TWGH 4BY1G 5FLMH 4DKAC 3S2DH 2CWPA 1HNZQ 2UUBL 5FJ8H 4A93G 1K9MC 3UDFA 2VQFL 1HNWL 3S15H 4L5SA 1GD7A 1PH9A 2MFIA 4JBJA 4DPGA 2JA6G 1HZAA 2V1CC 2N8NA 5BR8L 4DV0L 1YHAA 4A3CG 4JI1Q 3CD6A 5IP9G 3RNUA 4GN5A 4A76A 1TWCH 1IXRA 2Y0SE 4NPSA 3GO5A 3U58A 4OONA 3UDXA 4BA2I 4DR7L 1TXYA 2VZAA 3PGZA 4UP7A 1SRUA 3RLFA 3PIPA 3PV0A 4GKJQ 2E5LQ 3OW2A 1N32Q 1UWVA 1A0IA 4MZ9A 4MTNA 2WAQG 3BU2A 1JMCA 1VQLA 1EIYB 1WYDA 2JA5H 5GQOA 3RZOH 4DV4Q 3AEVA 2OTJA 5JEAG 3STBC 1HNXL 2VQEQ 2OQKA 3OTOQ 4DUYQ 2ASBA 3PO2H 3VDYA 1IZ6A 2PI2A 2AKWB 3BZKA 4OXPA 1EOVA 4PG3A 2Y0SG 3CCUA 4DR5Q 1Y14B 1EQQA 4QIWE 5HGQA 1H95A 1N8RC 1X65A 5M3MH 4GLAC 3NENA 2L15A 3HKSA 3CW2C 4MNOA 4P72A 2IX1A 1K3RA 4R1JA 4LW1A 4QGUA 3HOZH 1SROA 2YTVA 4IOCA 3FKIH 4JI3L 1IBLL 3M9BA 4BA1I 4B3SL 2R7ZG 5C44H 3CCQA 1IBML 3S24A 1GO3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF Q;  1KXL A;  1B8A A;  1Q1B A;  3K80 C;  2MO0 A;  4X6A H;  2K5N A;  1AE2 A;  3WWV A;  4DAY B;  2CCZ A;  1VQC A;  2CKZ B;  4J15 A;  2R7Z H;  3ZJY C;  3GDE A;  3I4O A;  3S1Q H;  1XMO L;  2UXB Q;  4LF7 Q;  4JOI A;  3U4V A;  1HR0 Q;  3CC7 A;  1QVF A;  4IPC A;  4UPA A;  4AIM A;  3GTM H;  2LXK A;  1VQB A;  4LNQ A;  1UE1 A;  2B3G A;  2R93 H;  1KAW A;  1WI5 A;  5M3M G;  2QEX A;  4JYA L;  1Q8K A;  1PVO A;  4GKK Q;  4A3C H;  4HIK A;  2F4V L;  3GD7 A;  1HR0 W;  1R9T H;  4QY7 A;  4HJ5 A;  1PH2 A;  1C7Y A;  1XMQ Q;  1RL2 A;  1IBK Q;  4A3B H;  3CCS A;  3AYH B;  1CKN A;  1S40 A;  4AQY L;  5FJ8 G;  4A93 H;  2UXC L;  3I4M G;  3RN2 A;  2VNU D;  4BBS G;  1VS0 A;  2ALY B;  4JI8 L;  1W2B A;  2LXJ A;  4DV5 Q;  2YYZ A;  3EIV A;  4R4O A;  5IYD G;  3UE1 A;  2VW9 A;  2N78 A;  5C0X I;  5AJ3 L;  4LF6 L;  1X3F A;  1DGS A;  5C44 G;  4DUZ L;  4YWM A;  4A3I H;  4OO1 I;  3CF5 A;  1CKM A;  1Q7Y C;  4H02 A;  3KJP A;  1OXX K;  2D0P A;  4DV1 L;  1PA6 A;  2E2H H;  1CSP A;  3GTO H;  1VQG A;  4GN3 B;  4DR2 L;  1X56 A;  1XPR A;  4X64 L;  5IP9 H;  1XJV A;  2JA9 A;  2UUC Q;  1D8L A;  4PMW A;  3H3V I;  3BZC A;  1HH2 P;  2EIF A;  3RLN A;  4DV3 L;  3HOY H;  1EYG A;  3L2P A;  2ZJR A;  4JV5 Q;  3CP0 A;  1FJG L;  3T1Y Q;  2R7D A;  5IP7 H;  3S1N H;  1JJ2 A;  4BXX G;  1G6P A;  1CUK A;  4IFD J;  1J6Q A;  2HQL A;  1YZ6 A;  4HJ7 A;  4LF7 L;  4C3H H;  1L1O B;  1YJ9 A;  2FXQ A;  3BJU A;  4DV7 L;  1HZC A;  1YI2 A;  3A74 A;  5JJK A;  1GM5 A;  1SN8 A;  4DV6 Q;  3NBH B;  4JI6 L;  4GNX B;  1S72 A;  1GVP A;  5C0X J;  4PZ8 A;  4GKK L;  2IHE A;  4A4I A;  1PH3 A;  3FHW A;  4LF9 L;  3ICE A;  1BBU A;  1Q86 C;  1HNX Q;  3KF6 A;  3OTO L;  3CPW A;  5IYB H;  5IYB G;  3PUY A;  2Q2T A;  1LUZ A;  5K36 G;  4LF4 L;  1X6O A;  1NMF A;  4UP8 A;  2JA6 H;  1E3P A;  4YWL A;  3RN5 A;  3W5O A;  5C4J H;  1K83 H;  5IYD H;  2UUB Q;  4GS3 A;  1VQ9 A;  3M3Y H;  5AJ3 Q;  4DR4 Q;  3PUV A;  4DUZ Q;  2GVB A;  4B3S Q;  4X66 L;  2MO1 A;  1Y1V G;  2YU9 H;  4DV0 Q;  4KHP L;  1EQR A;  3M7N A;  1VQE A;  1Q46 A;  4DR6 Q;  1OXT A;  1N36 Q;  5M5W H;  2JQO A;  2K14 A;  1TWH H;  4OWT B;  3JAM i;  2ES2 A;  4LFA L;  4ALP A;  4LFB Q;  1EIF A;  1B7Y B;  2DGY A;  4B3M Q;  2UUA L;  4DR7 Q;  3AFQ A;  3S17 H;  5E7N A;  1IYJ B;  2JEB I;  1X54 A;  2UU9 L;  4BBR G;  2RHQ B;  4JI2 L;  4QQB X;  1Q82 C;  4LF5 L;  3PSI A;  5C3E H;  4A3K G;  1AE3 A;  1VQD A;  1WJJ A;  2N3S A;  4HJA A;  4DV7 Q;  2IX0 A;  4A3I G;  1KD1 C;  2F4V Q;  1L0W A;  5LMN W;  2I0Q A;  2PI2 E;  4APV A;  1T9H A;  2VQE L;  4DUY L;  3F2B A;  4KHZ A;  3GTK H;  2GVA A;  4DR5 L;  1LM0 A;  3L0O A;  4K0K L;  5M5Y H;  4LF9 Q;  1VQH A;  4TVA B;  3TEH B;  4AH6 A;  4BXX H;  4A3L H;  4LWC A;  4C3J H;  4A3D H;  4JI8 Q;  1N33 Q;  3PCO B;  3CCJ A;  4XTC S;  4DV5 L;  3UDG A;  2WAQ E;  3CAM A;  3HOY G;  2PQA A;  2NZO A;  4HJ9 A;  4GOP C;  1EFW A;  1CKO A;  4LUZ A;  1B70 B;  1QUQ A;  3KDF B;  4DV1 Q;  1EUJ A;  3HOV H;  3HOW H;  2K52 A;  3I4N G;  3TRE A;  5JJL A;  1RIP A;  4JI1 L;  2ZTE A;  1WCM G;  4JI5 L;  1CSQ A;  1S3O A;  2Z6K A;  5ELN A;  4HIO A;  2JA5 G;  4OO1 G;  3T1Y L;  4C2M H;  4BBS H;  1UEB A;  1I5F A;  1V1Q A;  4Y52 H;  1UE6 A;  2JJQ A;  4QJF A;  2GN5 A;  4UY8 C;  1SFO H;  4HIM A;  1VQ8 A;  1PFS A;  3E9I A;  4DV2 L;  4JBK A;  2JK8 A;  5IWA Q;  2ZTD A;  4XIG S;  4JBM A;  3RZD H;  1I94 L;  4IPH A;  2KHJ A;  4LF5 Q;  1OXV A;  4PZ6 A;  4DV6 L;  2R93 G;  4ME3 A;  2ZTC A;  3A5Z B;  1JB7 A;  1PYB A;  3D0F A;  2XGT A;  3SGI A;  1L1O C;  4AQY Q;  1QUQ B;  4P74 A;  1VQ6 A;  5GAH C;  2HHH Q;  3T1H L;  4A3G H;  4KI0 A;  3GTQ H;  2E2J H;  1VQ4 A;  3K7U C;  2KCM A;  4JI4 Q;  4LF6 Q;  1AH9 A;  4KLK A;  1I50 H;  2K50 A;  3G71 A;  1PH6 A;  4BY1 H;  4JI0 Q;  2EQS A;  1X3E A;  3EN2 A;  3AFP A;  1TWF H;  2CFM A;  1HZB A;  2XTI A;  5M5X H;  2K4K A;  2WP8 J;  1NJI C;  3KFU A;  4IOA A;  3I56 A;  1WCM H;  3LGJ A;  4JI7 Q;  1KL9 A;  1KIX A;  5EAY A;  4X66 Q;  1SE8 A;  3J80 c;  2H5X A;  4B3T Q;  4KHP Q;  1U0L A;  4GNX A;  4IJH A;  3GTP H;  5M3F G;  3HKZ E;  3TRZ A;  4BY7 H;  2QA4 A;  1Q12 A;  3D31 A;  3KF6 B;  4P73 A;  2DUD A;  4YCU A;  3W1B A;  3G48 A;  2B63 H;  3CME A;  3A0J A;  1JT8 A;  2UUA Q;  2MNA A;  4A3D G;  4PZ7 A;  3K0X A;  1L2F A;  1WOC A;  1PH1 A;  1KQS A;  4JI2 Q;  4P75 A;  3I55 A;  4GLV B;  2ZJQ A;  1VCI A;  1XTD A;  2CWA A;  4LUV A;  5FLM G;  4AYB G;  2UXB L;  5GRO A;  2IHF A;  1I94 Q;  4C3I H;  2OWO A;  1K8G A;  5J3B A;  1YNX A;  1E24 A;  5C3E G;  4R4I A;  4A3K H;  1C0A A;  5JEA J;  4DR1 Q;  1SR3 A;  2AHO B;  3H0G H;  4LF8 Q;  4NXM L;  1O7I A;  2AWN A;  1IL2 A;  4YY3 L;  2ATW A;  5LMN L;  4QL5 A;  4Y7N H;  1N33 L;  3GTL H;  3F8T A;  1YEZ A;  1KHI A;  4YWK A;  1BKB A;  3HOX H;  3ERS X;  4DR2 Q;  1SMX A;  4X64 Q;  3JAM c;  2UUC L;  4B3R L;  1VQ5 A;  3F2D A;  4X65 L;  4A3E G;  1M90 C;  3ULL A;  4EQ5 A;  4IFD I;  1FJG Q;  1E7Z A;  2AWO A;  1Y1V H;  2YV5 A;  3CCE A;  2IT1 A;  3PUW A;  1K0R A;  4LFC Q;  2JA7 G;  2YTX A;  3S16 H;  3NEM A;  1G29 1;  4JI7 L;  2MQH A;  2WFW A;  4A3L G;  3PF4 A;  2BH8 A;  1HZ9 A;  5BR8 Q;  1E1T A;  4LFB L;  2KHI A;  4DK6 C;  4DK3 C;  1P8L A;  2D0O A;  4O0A A;  3CXC A;  2NVY H;  3EBE A;  1W3S A;  1MKH A;  2WB1 E;  1XNQ Q;  1OXU A;  2B63 G;  4JC0 A;  3J7Z C;  5LMU L;  4OX9 L;  4JI6 Q;  3F1Z A;  1XPU A;  1KRT A;  2UXD L;  3RR5 A;  1LTL A;  1A63 A;  4O2D A;  2PMZ E;  2R92 H;  3K7A H;  4GLX A;  4POF A;  3PF5 A;  2OQ0 A;  1X3G A;  2R6G A;  1I6H H;  4DV4 L;  4GOP B;  2R7F A;  2A19 A;  1QVC A;  1PH4 A;  4K0K Q;  5GAE C;  4A3M G;  2JA8 G;  2F52 A;  4UP9 A;  2VY3 A;  3H15 A;  3CCR A;  2OCE A;  3MXN B;  3I4M H;  2VUM H;  2K5V A;  1FGU A;  3M85 A;  4L5Q A;  3HOU H;  1KRS A;  2JA7 H;  1GKH A;  4OWX B;  1VQO A;  4A3B G;  1J5E Q;  4JI4 L;  4GOP A;  5C4X H;  4NXM Q;  1NY4 A;  4JG2 A;  1A8V A;  2NZH A;  2WB1 G;  4JI0 L;  2E8G A;  4P71 A;  1L1O A;  3PUZ A;  3HOX G;  4DR3 L;  5IYC H;  1Y1W H;  5HY6 A;  1VQ7 A;  3ER0 A;  1VQN A;  1IBL Q;  2RHS B;  3CCM A;  4JI3 Q;  1G51 A;  4DR6 L;  1E22 A;  2D62 A;  3NEL A;  4IJL A;  4NB3 A;  1IBM Q;  1MJC A;  4JI5 Q;  1YHQ A;  2BA1 A;  3J80 i;  1Q1E A;  4A3F G;  1QZG A;  4B3M L;  4EX5 A;  3H3V H;  1CKN B;  3CQZ H;  3KLW A;  4X62 Q;  2OTL A;  3KF8 B;  1TWA H;  3HKZ G;  1JJG A;  2BH2 A;  1E1O A;  4DV2 Q;  2ZM6 L;  1NBW A;  1VQF A;  2NN6 I;  2KBN A;  1V43 A;  4A3J H;  3B6Y A;  2E5L L;  4POG A;  1N9W A;  2Z6K C;  4A3G G;  1N32 L;  3IRB A;  1N34 L;  3I7F A;  1Q81 C;  2PQA B;  4JYA Q;  4IPD A;  3A5U A;  3I2Z A;  1BVS A;  4L5R C;  2JEA I;  1NMG A;  4YHH Q;  1YIJ A;  4RMF A;  1PH8 A;  1K8A C;  4OWW B;  1ASZ A;  3HOV G;  3HOW G;  3I4N H;  1YBY A;  5H1S E;  2C35 B;  4HID A;  1K73 C;  3KJO A;  3M4O H;  4DR1 L;  3TS0 A;  4JV5 L;  3CMA A;  4LF8 L;  3CCL A;  4YY3 Q;  3PO2 G;  4RG1 A;  3MEF A;  3G6E A;  2BA0 A;  1V9P A;  1FL0 A;  2KEN A;  2N49 A;  1VQK A;  2A1A A;  3S14 H;  5FLX c;  1PH7 A;  3K81 C;  4A3J G;  1HNW Q;  3KYH C;  2VUM G;  1A62 A;  1VQI A;  3JC6 6;  5DLQ E;  4R4C A;  4A3M H;  2AMC B;  1UE5 A;  2Q2H A;  1MJE A;  3HFZ B;  1D7Q A;  4B3T L;  4DR3 Q;  4B3R Q;  1ASY A;  1XPO A;  4LFC L;  2B29 A;  3UE0 A;  3FKI G;  1YJW A;  3HOZ G;  4A3F H;  3L7Z C;  2NVQ H;  1QVG A;  4DAM A;  3K8A A;  3W1G A;  1YHB A;  2PNH A;  3DLL A;  3E0E A;  1EWI A;  1PYS B;  1YVC A;  3S2H H;  4IPG A;  5IWA L;  1Y1W G;  1PHJ A;  1KC8 C;  1U5K A;  4YCW A;  2LSS A;  5IYC G;  1JJC B;  4A75 A;  1XNR Q;  3KDF A;  5LMU Q;  4WJ3 M;  3OYY A;  4IFD G;  2ZM6 Q;  3J81 j;  4NXN Q;  1YJN A;  3KOJ A;  3F2C A;  5C4X G;  1C9O A;  2HIX A;  4JOI C;  2Q2U A;  1QZH A;  3J81 c;  4TQU S;  3HOU G;  1XMQ L;  2NN6 G;  2HHH L;  3ULP A;  3T1H Q;  4GNX C;  1WFQ A;  2JA8 H;  4YHH L;  1FVI A;  2QGQ A;  3TS2 A;  5C0X G;  2ID0 A;  3DM3 A;  5ELO A;  2UXC Q;  1OXS C;  1M1K C;  2F3I A;  4IO9 A;  3PUX A;  1HNZ L;  2VS1 A;  1NTG A;  5IE8 A;  1Z47 A;  1VQA A;  2K75 A;  1UE7 A;  5GAD C;  1YIT A;  2YTY A;  1J5E L;  1BBW A;  2R92 G;  2NVT H;  3CC4 A;  3J7A 5;  2CQO A;  3H0G G;  3E9H A;  4X65 Q;  2ZJP A;  1Z9F A;  3PIO A;  3CCV A;  3J81 i;  2Z0S A;  5JJI A;  2RF4 A;  4FDB A;  2IY5 B;  2NVX H;  3S1M H;  2EXD A;  2A8V A;  2KCT A;  4DR4 L;  1NE3 A;  4DNI A;  1I3Q H;  4DV3 Q;  1PV4 A;  4HJ8 A;  3Q8D A;  4JBW A;  4WJ4 A;  2HT1 A;  2VL6 A;  2JE6 I;  3STB D;  1XMO Q;  3UDI A;  4R4Q A;  3U4Z A;  1LYL A;  1HJP A;  2Q2I A;  5IT9 c;  4X62 L;  1N36 L;  1HR0 L;  3CC2 A;  3GTG H;  2RCN A;  4YCV A;  4LFA Q;  3S1R H;  1PH5 A;  4LUO A;  1XNQ L;  2HIV A;  4GKJ L;  3AQQ A;  3PO3 H;  1VQJ A;  2K5H A;  4A3E H;  4OX9 Q;  3M4Q A;  5IY0 A;  2UU9 Q;  5IP7 G;  2UXD Q;  3G4S A;  1X55 A;  5M3F H;  3RLO A;  5GAG C;  4BY7 G;  1XNR L;  4BBR H;  4AYB E;  1N34 Q;  1P16 A;  4R4T A;  1IBK L;  4JCV E;  1OTC A;  3ULJ A;  2I5H A;  2I5L X;  2E2I H;  4NXN L;  1MIU A;  3TQY A;  3U50 C;  1JE5 A;  3CPF A;  1SLJ A;  4L5T A;  3GTJ H;  5LMN Q;  1X9N A;  2I5M X;  3PO3 G;  1VQM A;  4LF4 Q;  3M4P A;  1VQP A;  3FP9 A;  4GN4 B;  1TWG H;  4BY1 G;  5FLM H;  4DKA C;  3S2D H;  2CWP A;  1HNZ Q;  2UUB L;  5FJ8 H;  4A93 G;  1K9M C;  3UDF A;  2VQF L;  1HNW L;  3S15 H;  4L5S A;  1GD7 A;  1PH9 A;  2MFI A;  4JBJ A;  4DPG A;  2JA6 G;  1HZA A;  2V1C C;  2N8N A;  5BR8 L;  4DV0 L;  1YHA A;  4A3C G;  4JI1 Q;  3CD6 A;  5IP9 G;  3RNU A;  4GN5 A;  4A76 A;  1TWC H;  1IXR A;  2Y0S E;  4NPS A;  3GO5 A;  3U58 A;  4OON A;  3UDX A;  4BA2 I;  4DR7 L;  1TXY A;  2VZA A;  3PGZ A;  4UP7 A;  1SRU A;  3RLF A;  3PIP A;  3PV0 A;  4GKJ Q;  2E5L Q;  3OW2 A;  1N32 Q;  1UWV A;  1A0I A;  4MZ9 A;  4MTN A;  2WAQ G;  3BU2 A;  1JMC A;  1VQL A;  1EIY B;  1WYD A;  2JA5 H;  5GQO A;  3RZO H;  4DV4 Q;  3AEV A;  2OTJ A;  5JEA G;  3STB C;  1HNX L;  2VQE Q;  2OQK A;  3OTO Q;  4DUY Q;  2ASB A;  3PO2 H;  3VDY A;  1IZ6 A;  2PI2 A;  2AKW B;  3BZK A;  4OXP A;  1EOV A;  4PG3 A;  2Y0S G;  3CCU A;  4DR5 Q;  1Y14 B;  1EQQ A;  4QIW E;  5HGQ A;  1H95 A;  1N8R C;  1X65 A;  5M3M H;  4GLA C;  3NEN A;  2L15 A;  3HKS A;  3CW2 C;  4MNO A;  4P72 A;  2IX1 A;  1K3R A;  4R1J A;  4LW1 A;  4QGU A;  3HOZ H;  1SRO A;  2YTV A;  4IOC A;  3FKI H;  4JI3 L;  1IBL L;  3M9B A;  4BA1 I;  4B3S L;  2R7Z G;  5C44 H;  3CCQ A;  1IBM L;  3S24 A;  1GO3 E; 
#chains in the Genus database with same CATH topology
 2VQF Q;  1KXL A;  3K80 C;  3QJY A;  2NYZ D;  1AE2 A;  2G9H D;  2K5D A;  1EYD A;  4ZQ3 A;  4J15 A;  3ZJY C;  2ENB A;  1HR0 Q;  2OXP A;  3CC7 A;  2SNM A;  1QVF A;  4UPA A;  1HFG A;  2LXK A;  1VQB A;  1WTP A;  3E0J A;  3QO2 A;  2QEX A;  4JYA L;  1CHP D;  3FMC A;  1TT2 A;  1EOT A;  4KY5 A;  4QY7 A;  1R9T H;  1RL2 A;  2E74 C;  1R4P B;  3K6O A;  2WAQ B;  2FMC A;  1FNU A;  1U9R A;  2UXC L;  3RN2 A;  2VNU D;  4BBS G;  3DMU A;  2ALY B;  4JI8 L;  1LT6 D;  2LXJ A;  5CBA E;  3TP5 A;  5AJ3 L;  4DUZ L;  5C44 G;  3DWP A;  2HDL A;  1CKM A;  3SHL A;  2E2H H;  1CSP A;  3GTO B;  1VQG A;  1BDO A;  1X56 A;  5IGD A;  4PMW A;  4DV3 L;  1HH2 P;  5EJW A;  3RLN A;  1EYG A;  3I90 A;  5ELC A;  3C1E A;  5M5X B;  1FJG L;  4C1N K;  5IP7 H;  3S1N B;  2I46 A;  4CDD C;  1YZ6 A;  2KA7 A;  3F2U A;  1L1O B;  4C3H H;  2FXQ A;  4DV7 L;  5D14 A;  3NBH B;  3D4D A;  5KEE A;  4B9X A;  4GNX B;  4RH6 A;  1GVP A;  4GKK L;  1TWA B;  4A4I A;  3FHW A;  2MJ8 A;  4XXE A;  3OTO L;  2F0S A;  3MHB A;  1IW7 C;  1GUS A;  2MP1 A;  1D2B A;  2K04 A;  4LF4 L;  2QKI C;  2JA6 H;  3RN5 A;  3SR1 A;  2DJG C;  1QE6 A;  1A6X A;  1VQ9 A;  4I7A A;  3T56 B;  3DWQ A;  1HPC A;  2GVB A;  1FR3 A;  2EXZ A;  2B63 B;  2F0L A;  4X66 L;  3M7N A;  1VQE A;  3E3X A;  1N36 Q;  2ES2 A;  2G9D A;  2VB3 X;  4B3M Q;  4G7H C;  3I73 A;  3A7L A;  4RCN A;  4RA8 A;  4XDX A;  4QQB X;  3HOZ B;  3K57 A;  3PSI A;  3FKI B;  2N3S A;  1L0W A;  5LMN W;  4C3H G;  2D9U A;  3GTL B;  1PLF A;  3F2B A;  3GTK H;  3TSS A;  2PYK A;  3I91 A;  4K0K L;  1A3T A;  4CJ1 B;  1WVL A;  1STB A;  2FIN B;  4FF1 A;  4JI8 Q;  4DV5 L;  3UDG A;  5EPK A;  1UAP A;  3BDO A;  1CKO A;  5A2Q E;  4Q5V A;  1QUQ A;  1T5E A;  2E2I B;  1PFN A;  4IUR A;  4DXF A;  1CSQ A;  1S3O A;  4HIO A;  2JA5 G;  4BBS H;  4Y52 H;  4N9T A;  2VUM B;  2FFK B;  3V2T A;  2A6E C;  1SFO H;  1CI3 M;  1DXM A;  2K6A A;  1CHQ D;  5IWA Q;  4XIG S;  2DY8 A;  4K8I A;  4IPH A;  2K1B A;  1OXV A;  4PZ6 A;  4ME3 A;  2ZTC A;  1F9Q A;  1S4Z A;  3A5Z B;  1I50 B;  4BY1 B;  1JB7 A;  3D0F A;  5KNB A;  4ULL A;  3SGI A;  2EOT A;  4P74 A;  2SNS A;  3I70 A;  3K5M A;  3MTS A;  4A3G H;  2KCC A;  2KCM A;  4LF6 Q;  5C4H A;  3G71 A;  4JI0 Q;  1II3 A;  2CFM A;  3VR4 A;  2K4K A;  3HRZ C;  1KIX A;  5EAY A;  5CV8 A;  1H9M A;  3Q6S A;  4BY7 H;  3HKZ E;  1Q12 A;  3V96 A;  2MNA A;  1GUW A;  4PZ7 A;  1V8Q A;  1PMR A;  2KUM A;  2NTT A;  1DM0 B;  5JVG 3;  4C2M B;  4B9W A;  4AYB G;  1MD2 D;  1I94 Q;  4C3I H;  2OWO A;  4A3K H;  2EY1 A;  2EJG C;  3ERQ A;  1C0A A;  1HFN A;  1Y1W B;  5EQ0 A;  4KKU A;  4DAP A;  2OT2 A;  4YY3 L;  2MPM A;  2OF1 A;  4DNT B;  5LMN L;  3A55 A;  1Q8I A;  3ERS X;  1SMX A;  3JAM c;  1VQ5 A;  1M90 C;  4X65 L;  1GO3 E;  1JQY D;  1STN A;  1ONL A;  2AWO A;  3CCE A;  2JA7 G;  1K0R A;  4LFC Q;  5T1G A;  1GUT A;  2MQH A;  3HOX B;  1DOL A;  4QCL A;  1MSH A;  3LWU A;  1F2Z A;  2L55 A;  3QIA A;  4I7Z C;  3L3O C;  1KDA A;  5C5M A;  3M3Y B;  5DNF A;  1WD1 A;  2BDN A;  3GTP B;  4MTK A;  3R93 A;  3F1Z A;  3MFY A;  3RUZ A;  4CDF C;  3J81 L;  4O2D A;  2J4X A;  2LY7 A;  2PMZ E;  3S1Q B;  4POF A;  4JVZ A;  1TS4 A;  1JOK A;  1RKN A;  3Q23 A;  1PH4 A;  4K0K Q;  4XYO A;  1J9O A;  4FXK C;  4A3M G;  2JA8 G;  3BYT B;  2OCE A;  2VUM H;  5I9O A;  1FGU A;  3N6R A;  4L5Q A;  2E2D C;  4A3B G;  4JI4 L;  1F2L A;  3P1H A;  1I3Q B;  1EZ6 A;  1A8V A;  1A3V A;  1STA A;  1ILQ A;  3HOX G;  4FNF A;  5IYC H;  4X3U A;  5HY6 A;  1Y1W H;  1VQN A;  1BO0 A;  1E22 A;  2EY5 A;  4NB3 A;  2BA1 A;  4A3F G;  1AZP A;  5KND A;  1CKN B;  1Y1V B;  2DNE A;  3HKZ G;  4X3S A;  1NBW A;  3PIP 3;  1DZ1 A;  5EKL A;  4IUU A;  4A3J H;  4PMC A;  3NWT A;  1JC7 A;  3CU7 A;  2PQA B;  1SYF A;  3R2T A;  4DK1 A;  2HCC A;  4L5R C;  2JEA I;  1NMG A;  4YHH Q;  1PH8 A;  4IN3 A;  1PZJ D;  4ABN A;  4HMI A;  2C35 B;  3M4O H;  2L1B A;  3TBI B;  3VA5 A;  3MEF A;  1V9P A;  2KEN A;  1CM9 A;  2IWH A;  2A1A A;  5FO9 B;  4RWS C;  1AP0 A;  4A3J G;  4H13 C;  1BR9 A;  3JC6 6;  2Q2H A;  3EVQ A;  2B29 A;  1JCK B;  1HHV A;  2NB0 A;  3HOZ G;  4A3F H;  3L7Z C;  2NVQ H;  1QVG A;  1VDZ A;  5LHY 1;  3DLL A;  2K33 A;  4DGZ A;  1RHP A;  1Y1W G;  1KC8 C;  3IFT A;  5IYC G;  4CHT B;  1G91 A;  4OIK A;  2F0N A;  4ID6 A;  1LAC A;  1ZYR D;  1XWE A;  1YJN A;  1WTX A;  4NXN Q;  4K5X A;  4TQU S;  2HCI A;  2NN6 G;  2HHH L;  5T1I A;  2JA8 H;  4OO1 H;  5COY A;  4A3K B;  2ID0 A;  5ELO A;  1YNJ D;  3PUX A;  2VS1 A;  1VQA A;  1BBW A;  3CC4 A;  3J7A 5;  3SXH A;  5D3I B;  2EYM A;  3CCV A;  4KMU C;  1F77 A;  2RF4 A;  2NVX H;  2NVX B;  2EXD A;  3OOC A;  4WJ4 A;  1WTO A;  2JE6 I;  2E75 C;  1TS3 A;  2B39 A;  1HR0 L;  2XWB B;  5TSS A;  1N36 L;  1PH5 A;  3H94 A;  4GKJ L;  2HIV A;  3ONA B;  2A68 D;  1RDP D;  1TS2 A;  1EU4 A;  3NXW A;  5K36 H;  5IP7 G;  3G4S A;  5M3F H;  4DAY A;  3QWN A;  3TP7 A;  4C1N I;  1JOR A;  1VF7 A;  5CMD A;  4FF3 A;  2I5H A;  4NXN L;  1EY0 A;  1JE5 A;  3QB3 A;  2KVM A;  3NQT A;  4L5T A;  1AW7 A;  1X9N A;  2I5M X;  5BN3 A;  4C3I G;  3NWS A;  4R9W A;  1VQP A;  4GN4 B;  1A3U A;  1SMY D;  1TWG B;  4KHV A;  1HNZ Q;  2UUB L;  4N9P A;  1HNW L;  4MIU A;  2B2T A;  1S5E D;  2GA4 B;  2PW7 A;  1ENC A;  1SEB D;  5K5P A;  5BR8 L;  5IOC A;  3SEB A;  3T16 A;  1TWC H;  1HXY D;  2YU9 B;  3ERO A;  4G4K A;  3C1F A;  3PGZ A;  4UP7 A;  2WKC A;  3MXP A;  2RDH A;  1YNN D;  2WAQ G;  5CV7 A;  1VQL A;  3RZO H;  3STB C;  3A54 A;  2OQK A;  4KY7 A;  3PO2 H;  1IZ6 A;  3CCU A;  3BDC A;  3J81 E;  1SNP A;  5M3M H;  5IGG A;  3FDT A;  1LTI D;  2K5Q A;  3NEN A;  2L15 A;  3G7L A;  3E5S A;  1L0Y B;  1A2T A;  5CV4 A;  4P72 A;  1TKW B;  5HGT A;  2M00 A;  4QGU A;  3HOZ H;  4IOC A;  3QOL A;  4FO2 A;  5C6A A;  3S24 A;  1B8A A;  2MO0 A;  2L12 A;  4L6T B;  2I07 B;  2K5N A;  1E2Z A;  3KUP A;  2LKV A;  3WWV A;  4DAY B;  2CKZ B;  3QOJ A;  3GDE A;  1S5D D;  5J1Z A;  5JOB A;  2TMP A;  3TP8 A;  3GQB A;  3S14 B;  1BQQ T;  4QMG A;  3S2H B;  2R93 H;  2ZXP A;  1WI5 A;  1GUN A;  4ZUI A;  4Z9C B;  2F0F A;  1HR0 W;  4K2K A;  1PH2 A;  1XMQ Q;  1ZYR C;  4M1U B;  1S40 A;  3KF8 A;  5FJ8 G;  1CZW A;  4DV5 Q;  2YYZ A;  4NMZ A;  4DR4 L;  4LF6 L;  4OO1 I;  1DGS A;  4IUP A;  1Q7Y C;  4H02 A;  1B44 D;  4TRD A;  4DR2 L;  1IYU A;  5IP9 H;  3A8J E;  3HKZ B;  3L2P A;  4DAV A;  2ZJR A;  4HSP A;  1RTO A;  3S1N H;  1LTR D;  1SXT A;  1J6Q A;  4EGV A;  1EYA A;  1PDQ A;  2MUY A;  3KK7 A;  3K5O A;  2PPB C;  1STG A;  4HSV A;  4HJ7 A;  3GP7 A;  4LF7 L;  2O5J C;  4C3H B;  4BS9 A;  1YJ9 A;  3BJU A;  1SJE D;  1LT4 D;  1YI2 A;  5JJK A;  3WOE A;  4K14 A;  5L37 A;  4DV6 Q;  4JI6 L;  5E3F A;  4CDC C;  4PZ8 A;  5CV9 A;  2IHE A;  1PH3 A;  3BZD B;  3CPW A;  1LUZ A;  4HED A;  1M4V A;  1X6O A;  1NMF A;  5E4W C;  2F0K A;  1K83 H;  5IYD H;  2UUB Q;  3S2D B;  4DUZ Q;  1M8A A;  2K7V A;  1KTK A;  4JW0 A;  3KBG A;  2MO1 A;  4KHP L;  1EQR A;  4WFN 3;  2IPK D;  4BY7 B;  1ET9 A;  3RD4 A;  3GTJ B;  1Q46 A;  1OXT A;  2RDF A;  2BOS A;  2FMM A;  2K14 A;  4OWT B;  1K28 A;  3OWE B;  1B7Y B;  4DU9 A;  1UNS A;  4BWG B;  2JEB I;  1VMP A;  2JXM B;  2PQE A;  2RHQ B;  4G7Z C;  4LF5 L;  3NSW A;  4A3K G;  2AQ2 B;  1AE3 A;  2IL8 A;  2L4N A;  1KD1 C;  4DV7 Q;  1I4H A;  4H44 C;  3H09 A;  2VQE L;  4DUY L;  3H0G B;  3TDQ A;  5M5Y H;  4XQJ A;  4LF9 Q;  4TVA B;  3NUC A;  4BXX H;  1BCP D;  4A3L H;  1IKL A;  1EIH A;  1DJR D;  2NVQ B;  1PTO D;  2EYL A;  4GOP C;  3NHH A;  4TKO B;  3I8Z A;  3TRE A;  4RGM A;  4KTA A;  3MXN A;  2RA4 A;  5ELN A;  4JI5 L;  4B08 A;  4CKE A;  4OO1 G;  5CV6 A;  1LTB D;  2RSN A;  2JJQ A;  2NN6 H;  1SBB B;  1BXT A;  3AU7 A;  2F0I A;  2H1E A;  4HIM A;  1VQ8 A;  3E9I A;  4U68 A;  1EY9 A;  4Q0F A;  2BE5 D;  3RZD H;  2KHJ A;  1MGS A;  5KYI A;  3OPO A;  2EYJ A;  1K0S A;  2XGT A;  4C3J G;  1L1O C;  1QUQ B;  5GAH C;  1ZKO A;  4A3I B;  2Z4H A;  4IAL A;  3BG3 A;  1VQ4 A;  1GHK A;  2PO4 A;  4KLK A;  2K50 A;  1BF4 A;  1PH6 A;  2EQS A;  4L8J A;  3TME A;  2Z4I A;  3I56 A;  3LGJ A;  2RVL A;  4JI7 Q;  4X66 Q;  1SE8 A;  4B3T Q;  1Q90 A;  4KHP Q;  1F9P A;  1U0L A;  4K8J A;  2AUK A;  3VYU A;  3O13 A;  4IJH A;  1DOK A;  3GTP H;  2PZU A;  3TRZ A;  1DON A;  3D31 A;  2DUD A;  2B63 H;  3C2P A;  3A0J A;  1BCP C;  2JA6 B;  3HP3 A;  3HZX A;  1KDB A;  4JI2 Q;  2RSO A;  4CDE C;  1VCI A;  2IW3 A;  3QR8 A;  2HD3 A;  2UXB L;  5GRO A;  2IHF A;  1QNK A;  1U4M A;  1K8G A;  1E2V A;  1YNX A;  4LK1 C;  5JAV A;  3H0G H;  1O7I A;  4H7B A;  1Y8P B;  4NDX A;  3C3L A;  3IAY A;  2QF7 A;  3F8T A;  4YWK A;  3EJI A;  1U4P A;  3HOX H;  1NNX A;  4DR2 Q;  1SJH D;  5C3E B;  4A3E G;  3MXG A;  4EQ5 A;  2YV5 A;  3PUW A;  3A56 A;  3NEM A;  1V1P B;  3LX0 A;  2KHS A;  1HZ9 A;  4LFB L;  4KY6 A;  2PZT A;  3IL8 A;  5FLX E;  4EQP A;  1P8L A;  2D0O A;  3W3A A;  2NVY H;  1B3A A;  1W3S A;  1MKH A;  2F1M A;  1OXU A;  4JPB W;  1XXG A;  2B8G A;  2E2H B;  5ELB A;  1LO5 D;  5LMU L;  4OX9 L;  4JI6 Q;  3HOU B;  1KRT A;  1LTL A;  1SNM A;  3JAM E;  1I6H H;  2PZW A;  1J8I A;  2R7F A;  1QVC A;  4UP9 A;  3I4M H;  4MHE A;  1KRS A;  2JA7 H;  4OWX B;  2XIW A;  4A3M B;  1J5E Q;  2NVY B;  1NY4 A;  2E8G A;  3Q22 A;  4K6L A;  3ER0 A;  4XQN A;  2EVB A;  2RHS B;  2BCO A;  1AN8 A;  1Q1E A;  3VR2 A;  4B3M L;  1KAB A;  4EX5 A;  5KGU A;  4X62 Q;  2KJX A;  2CH4 W;  1CTM A;  1JJG A;  2JSO A;  1EWH A;  5FK9 C;  4N8X 1;  2P5Z X;  2X6G A;  1V1O A;  2NN6 I;  2AQ1 B;  2O5I C;  4POG A;  1HQR D;  1N9W A;  3IRB A;  1N34 L;  3I7F A;  5LL6 S;  2DN8 A;  3A5U A;  3PO2 B;  4HMJ A;  3ND9 A;  2IX3 A;  4IUN A;  3D4W A;  3I4N H;  4RMF A;  2X69 A;  3HOV G;  3HOW G;  2EYP A;  1NCV A;  1R4Q B;  3MWY W;  4L63 B;  4RAU C;  4J1M A;  4JV5 L;  2QW7 A;  3K7A B;  1MBY A;  2BA0 A;  2N49 A;  5JEA H;  3G6E A;  4KKS A;  3P7J A;  3K81 C;  1HNW Q;  3KYH C;  3K58 A;  4UDU C;  1TWC B;  1A62 A;  5ELD A;  4XT3 B;  4EVO A;  1I4G A;  4R4C A;  5E1F A;  1MJE A;  1D7Q A;  1ASY A;  2QDB A;  1XPO A;  2Z6B A;  3FEW X;  1I4X A;  2K5W A;  4FVM A;  4HTH A;  3QG1 A;  4DAM A;  4I65 A;  3W1G A;  2PNH A;  4OL7 A;  1EWI A;  1PYS B;  5IWA L;  3MA2 B;  1PFB A;  1O7Y A;  1MHW C;  2EJM A;  2EY2 A;  3D8G A;  1JJC B;  4KJO A;  4YCW A;  4A75 A;  3KDF A;  2ZM6 Q;  3KLS A;  3KOJ A;  5C4X G;  3R2I A;  2Q2U A;  2NBF A;  4JOI C;  1RCV D;  3T1H Q;  4MN3 A;  5IT9 E;  1FVI A;  2QGQ A;  5C0X G;  2CW0 D;  1DOM A;  2A6H C;  1OXS C;  1M1K C;  4IO9 A;  3SDZ A;  2K75 A;  5GAD C;  1J5E L;  2R92 G;  4FXD A;  5C4Z A;  1RJT A;  2NVT B;  5NUC A;  5IIF A;  3H0G G;  3MC0 B;  1QNU A;  3E9H A;  2ZJP A;  5KYL A;  5JJI A;  4LJZ C;  3MAQ A;  1OO9 B;  1PV4 A;  2VXW A;  3Q8D A;  4JBW A;  2HT1 A;  1CQF A;  3U4Z A;  1HJP A;  2RCN A;  4YCV A;  3S1R H;  3J7A V;  5C5L A;  4LUO A;  3PO3 H;  4OX9 Q;  4C3J B;  5IY0 A;  2B2Y A;  1ICW A;  3RLO A;  5GAG C;  5JPM C;  5G3L F;  1EY5 A;  1SNQ A;  2I5L X;  1EEI D;  2O4X A;  3TQY A;  2PMZ B;  4N8F A;  3DHQ A;  5JVH 3;  2EPB A;  2CVR A;  1VQM A;  1VMC A;  5I6Y A;  3M4P A;  2WIN B;  4DK0 A;  4RGO S;  2CWP A;  4A93 G;  3UDF A;  4OGQ C;  1HQM C;  1XYI A;  4L5S A;  1G8Z D;  1GD7 A;  2SEB D;  1SNO A;  2JA6 G;  2M9V A;  2V1C C;  1K8M A;  3SK4 A;  5ELE A;  4JI1 Q;  1ICF B;  1ILP A;  3RNU A;  4GN5 A;  4A76 A;  2F0Q A;  3GO5 A;  2JA7 B;  4A3J B;  4OON A;  2L0C A;  3UDX A;  3VR3 A;  1TXY A;  2VZA A;  3RLF A;  1SRU A;  1IKM A;  5CGK A;  3OWF A;  1EY7 A;  1STE A;  1JMC A;  3OIQ A;  1FGB D;  1ENA A;  5JEA G;  5C3X A;  2A73 B;  3VDY A;  2CHB D;  2PI2 A;  1SYB A;  2Y0S G;  1H95 A;  1JOQ A;  1JWM D;  3RMH A;  4GLA C;  1WTW A;  1XTC D;  4MNO A;  3C46 A;  4H0L C;  4A3L G;  3FKI H;  4JI3 L;  2R7Z G;  5C44 H;  3CCQ A;  1IBM L;  1Q1B A;  4X6A H;  1HA5 A;  2B2U C;  3HOY B;  3NTH A;  1VQC A;  1XX8 A;  2R7Z H;  3S1Q H;  3LNN A;  1IHZ A;  4RKL A;  4LF7 Q;  2XRQ D;  3CRK C;  1EL0 A;  4AIM A;  2F3W A;  4KD3 A;  4LNQ A;  2B3G A;  3H6M A;  1B3Q A;  1KAW A;  4HN7 A;  4A3C H;  2F4I A;  4HIK A;  1D5Z C;  2F4V L;  3GD7 A;  4F8M A;  4HJ5 A;  4IUQ A;  2B2W C;  2LMC B;  1Z6H A;  3CCS A;  3AYH B;  1CKN A;  1WTR A;  2B2V C;  2CH4 A;  4IQZ A;  3I4M G;  1W2B A;  3K5N A;  5M5Y B;  3EIV A;  4R4O A;  5IYD G;  1HCZ A;  3UE1 A;  2N78 A;  3X3M A;  4RGT A;  3VR6 A;  1OXX K;  2D0P A;  1NR4 A;  3X3N A;  3BVG A;  3GTO H;  4GN3 B;  4ZLT F;  4X64 L;  2JA9 A;  4EQN A;  1JWS D;  2UUC Q;  1D8L A;  3HOY H;  1SDF A;  1SYE A;  2EIF A;  1B9M A;  3CP0 A;  5C44 B;  4A3E B;  1DD2 A;  2HQL A;  2PNR C;  4WRD A;  2Q8I B;  1TQO A;  1HZC A;  5J22 A;  1E2W A;  1SN8 A;  5EBC A;  1EQT A;  1W6K A;  5C0X J;  1DCZ A;  1HNX Q;  1Q86 C;  3SK5 A;  4UAI A;  5IYB H;  3PUY A;  5IGB A;  2Q2T A;  2QEJ C;  3DWA A;  2B2V A;  2B2Y C;  2HQE A;  2QIL A;  4UP8 A;  1E3P A;  1KLG D;  4GS3 A;  4QIW B;  1AZQ A;  4DR4 Q;  3PUV A;  3CHB D;  3VYT A;  1C8C A;  3DXJ C;  5LL6 X;  2YU9 H;  4DV0 Q;  3S9W A;  1K83 B;  4CJ0 B;  1GUG A;  3FVQ A;  3NPP A;  3T13 A;  2JQO A;  3JAM i;  4LFA L;  4ALP A;  5D65 A;  1Z7T A;  1EIF A;  4LFB Q;  2DGY A;  5J39 A;  1GJX A;  3AFQ A;  3S17 H;  3S17 B;  5I4D A;  4RKB A;  4X3T A;  1X54 A;  2Y0S B;  2UU9 L;  4BBR G;  5I9P A;  4JI2 L;  5IGF A;  4S3S A;  4CBV A;  3HGB A;  5C3E H;  1VQD A;  1WJJ A;  4A3I G;  2IX0 A;  3J7Y W;  2I0Q A;  4K2L A;  5FO7 B;  4KKT A;  1LM0 A;  3TEH B;  4AH6 A;  1HA6 A;  4LWC A;  4C3J H;  2E2J B;  3CCJ A;  3JAM L;  2WAQ E;  3CAM A;  3HOY G;  2PQA A;  1EFW A;  2AUJ D;  1EWC A;  4LUZ A;  1B70 B;  4FXG C;  4OEM B;  4R8N A;  1EUJ A;  4DV1 Q;  3TZU A;  5JJL A;  4A3D B;  4JI1 L;  2ZTE A;  1WCM G;  2A74 C;  5EKI A;  2Z6K A;  1CT1 D;  1B2T A;  4DF7 A;  3GTQ B;  3DEP A;  1V1Q A;  1UE6 A;  2GN5 A;  3BVM A;  2K28 A;  4UY8 C;  2A5H A;  4X3K A;  3CQZ B;  1PFS A;  4K6D A;  4DV2 L;  2NTS A;  2SDF A;  2LS0 1;  2ZTD A;  4FF4 A;  2K03 A;  4JBM A;  1I94 L;  1X3P A;  4PV1 C;  2EJF C;  1PTO F;  2MHV A;  3GTK B;  1PYB A;  4TSS A;  1JE4 A;  4ZAI A;  5BN5 A;  4AQY Q;  1VQ6 A;  2HHH Q;  2R61 A;  1EQV A;  5CYU A;  4QUF A;  5IOD A;  3GTQ H;  2E2J H;  3K7U C;  1A15 A;  1AH9 A;  5EPL A;  4OHJ A;  3EQL C;  3S16 B;  1X3E A;  3OSO A;  3T51 B;  1TWF H;  2XTI A;  3OW7 A;  4IUV A;  1CA5 A;  3BDL A;  2RCF A;  1KL9 A;  1T5X D;  1RD9 D;  3J80 c;  3Q0A A;  4A3G B;  3V05 A;  1FD7 D;  5M3F G;  2NZ1 D;  2QA4 A;  1O78 A;  3KF6 B;  4P73 A;  3CME A;  1JT8 A;  2UUA Q;  4A3D G;  3K0X A;  1I4P A;  1D1K A;  1L2F A;  1WOC A;  5DM6 3;  4P75 A;  3I55 A;  4GLV B;  2ZJQ A;  1B9N A;  1SE4 A;  4LUV A;  5FLM G;  3A7A B;  5FO8 B;  4ZK9 B;  1GUO A;  3K59 A;  1SR3 A;  2AHO B;  4O42 A;  2AWN A;  2XSC A;  2ATW A;  3R3O A;  2EE1 A;  3TP6 A;  4QUC A;  1HUM A;  3DEO A;  1CZG A;  5JPN C;  4X64 Q;  5ELF A;  4HCS A;  2F0V A;  3F2D A;  3ULL A;  4ZRZ A;  1SNC A;  5M3F B;  3BYY B;  4IFD I;  1FJG Q;  1E7Z A;  1Y1V H;  2IT1 A;  3S16 H;  1PRT F;  4ZUJ A;  4JI7 L;  3PF4 A;  4LMQ D;  1R9T B;  1E1T A;  4DK6 C;  4DK3 C;  2XNA C;  3CXC A;  2HDM A;  3EBE A;  2WB1 E;  4DNR B;  4JC0 A;  4FYD A;  3I72 A;  4P2C B;  1D6E C;  3I4M B;  2UXD L;  3RR5 A;  1A63 A;  3IKJ A;  1KAA A;  5KNC A;  2EZV A;  3PF5 A;  2OQ0 A;  1X3G A;  2R6G A;  1I6H B;  1TR5 A;  2A19 A;  2F52 A;  1FNW A;  3CCR A;  3H15 A;  3MXN B;  2K5V A;  3M85 A;  3HOU H;  1ZXT A;  1Y8N B;  5IGC A;  4GOP A;  4NXM Q;  1LTS D;  4DA2 A;  2NZH A;  2J7Z A;  2WB1 G;  4JI0 L;  3MZ5 A;  4KK7 A;  4P71 A;  3SK6 A;  1TY2 A;  1L1O A;  3PUZ A;  2O2L D;  4NKL A;  3NTK A;  1UEA B;  1VQ7 A;  1QJO A;  3CCM A;  4DR6 L;  3NEL A;  4IJL A;  1IBM Q;  1MJC A;  4DXG A;  3J80 i;  1QZG A;  3NP8 A;  3H3V H;  1CK1 A;  3KLW A;  2KCN A;  3KF8 B;  3I4N B;  1TWA H;  4XQQ A;  2BH2 A;  1NAP A;  3T53 B;  2JN4 A;  2ZM6 L;  1PTO C;  1VQF A;  5C4X B;  1PYW D;  1V43 A;  3B6Y A;  4V0B A;  1EEF D;  1N32 L;  4C3I B;  1EZ8 A;  2WAC A;  1Q81 C;  4IPD A;  5E4X A;  1YIJ A;  2NWG A;  1S5C D;  1ASZ A;  5H1S E;  4HID A;  3KJO A;  1K8O A;  4DR1 L;  3TS0 A;  3R8B A;  1TWF B;  4LF8 L;  3CCL A;  4YY3 Q;  3PO2 G;  4RG1 A;  4NW2 A;  2KEE A;  4K5W A;  1EYC A;  3S14 H;  5FLX c;  3BS1 A;  2VUM G;  1TS5 A;  4HR7 B;  3I3C A;  1I4Q A;  1VQI A;  4A3M H;  4QB4 A;  2K01 A;  4B3R Q;  1SYG A;  3I4L A;  4OIJ A;  3K5L A;  3NTI A;  3M4O B;  1YHB A;  3E0E A;  1YVC A;  3S2H H;  4IPG A;  5EKK A;  5COR A;  3VR5 A;  2LSS A;  3TN2 A;  5EGT A;  1XNR Q;  4J8Q A;  5LMU Q;  3PQI A;  3OYY A;  4IFD G;  1K3B C;  3F2C A;  1H9R A;  2HIX A;  1A2U A;  1QZH A;  3HOU G;  1XMQ L;  1QIL A;  2EYF A;  3ULP A;  4Y7N B;  3OMG A;  1SE3 A;  1ML0 D;  4FP5 D;  4GNX C;  1WFQ A;  3TS2 A;  1QB5 D;  3DM3 A;  3FPP A;  3E6Z X;  1O7Z A;  2F3I A;  1HNZ L;  4O1N A;  1Z47 A;  4JV5 Q;  4PNY A;  4X65 Q;  1PRT C;  1Z9F A;  3PIO A;  2A69 C;  2Z0S A;  3J81 i;  2IY5 B;  3S1M H;  3S1M B;  1I3Q H;  3NE5 B;  2VL6 A;  3STB D;  1XMO Q;  1PZK D;  4R4Q A;  1LYL A;  2OEO A;  2Q2I A;  5IT9 c;  3GTG H;  3CC2 A;  3S1R B;  1XNQ L;  5FKA C;  1DYQ A;  1YNN C;  4J6H A;  3WOF A;  3AQQ A;  1BUV T;  1VQJ A;  2K5H A;  2Z1C A;  4NP5 A;  5D3D A;  1WCM B;  2UXD Q;  4BY7 G;  4QF4 A;  1WD0 A;  4AYB E;  1N34 Q;  1TII D;  1LV9 A;  1P16 A;  1IBK L;  1F9R A;  2E2I H;  3PO3 B;  3U50 C;  4KV6 A;  1NR2 A;  2JYO A;  3CPF A;  2WKD A;  3GTJ H;  2V4D A;  4C56 C;  5LMN Q;  1E0B A;  2M2L A;  5ISR A;  3FP9 A;  3FPU B;  1TWG H;  5FLM H;  2VB2 X;  4ME5 A;  3S2D H;  1BNZ A;  1RTN A;  2VQF L;  3S15 H;  1PH9 A;  1C4Q A;  1H9S B;  3W2D A;  4JBJ A;  5AFW A;  2N8N A;  4DV0 L;  4A3C G;  3CD6 A;  5IP9 G;  5A2Q L;  4WOR A;  4CKC A;  1IXR A;  2Y0S E;  4NPS A;  4HCE A;  1QWY A;  4GKJ Q;  4A3B B;  2EDG A;  1A0I A;  2JA5 H;  1GOZ A;  3S15 B;  3AEV A;  2JA8 B;  1F2M A;  2HUG A;  2VQE Q;  4DUY Q;  4IFD H;  4OXP A;  4KN4 C;  1EOV A;  2PCF B;  2SOB A;  4PQX A;  3J80 E;  1Y14 B;  1N8R C;  4ILW A;  1PTO B;  3NBH A;  3HKS A;  3CW2 C;  2IX1 A;  2ZT9 C;  1K3R A;  3ITP A;  2YTV A;  1IBL L;  4B3S L;  1KDC A;  1IYV A;  1EY6 A;  4A3F B;  1CFM A;  2CCZ A;  2EYH A;  3I4O A;  1XMO L;  4JOI A;  3TZD A;  3U4V A;  3U9S A;  1F9S A;  4IPC A;  3GTM H;  3URY A;  1SMY C;  1KLU D;  1UE1 A;  2LFN A;  4GZY C;  4HAE A;  5M3M G;  1Q8K A;  1PVO A;  4GKK Q;  2XN9 C;  1C7Y A;  2RKS A;  1WTQ A;  1IBK Q;  4A3B H;  2D2C C;  2Z9H A;  4AQY L;  4A93 H;  1VS0 A;  3M4Y A;  1EFI D;  2R93 B;  1X32 A;  2VW9 A;  3H3V I;  3SK8 A;  5C0X I;  1X3F A;  1LLR D;  1WTH A;  4YWM A;  3Q24 A;  4A3I H;  2FHT A;  1C48 A;  3CF5 A;  3KJP A;  4DV1 L;  1PA6 A;  2A6E D;  1D5X C;  3MXU A;  1XJV A;  1XPR A;  3NBI A;  4RCO A;  3BZC A;  5M3M B;  4ZKB B;  3J7A F;  1BBX C;  3T1Y Q;  2R7D A;  4FF2 A;  3P75 A;  5A35 A;  1JJ2 A;  4BXX G;  1G6P A;  3VYS A;  1CUK A;  4IFD J;  4A93 B;  3OIP A;  3GTG B;  1ET6 A;  1HRJ A;  1MSG A;  3NK9 A;  1PRT B;  1BCP F;  3A74 A;  1GM5 A;  3G6J B;  3HEJ A;  1S72 A;  4YIJ A;  1BCP B;  4UHV A;  1D1I A;  1STH A;  4LF9 L;  3ICE A;  1BBU A;  1QG7 A;  3KF6 A;  5IYB G;  2RBM A;  5K36 G;  3D6W A;  4RHS A;  5HUR A;  4YWL A;  3W5O A;  5C4J H;  5I6W A;  3M3Y H;  5AJ3 Q;  1JB3 A;  4B3S Q;  4KD4 A;  1TVX A;  1Y1V G;  1PXU A;  3U9O A;  4DR6 Q;  3LWE A;  5M5W H;  1ENF A;  1TWH H;  4ZYS A;  2UUA L;  1KNA A;  2ICI A;  4DR7 Q;  5E7N A;  1IYJ B;  2BE5 C;  2H4O A;  1HTL D;  1NUC A;  3PMF A;  3FRP B;  1Q82 C;  3ND8 A;  2F0T A;  5CR3 A;  2A69 D;  4HJA A;  2F4V Q;  1B1Z A;  1U4R A;  2CQA A;  2PI2 E;  4APV A;  1SYC A;  1T9H A;  4KHZ A;  2GVA A;  1AFP A;  4DR5 L;  3L0O A;  2F0E A;  2L5T A;  3MVV A;  1VQH A;  1YNJ C;  2A6H D;  1BOS A;  4JK1 C;  4A3D H;  2C9O A;  1N33 Q;  3PCO B;  4XTC S;  2MGS A;  2NZO A;  4HJ9 A;  1MI2 A;  2N88 A;  3KDF B;  3GV3 A;  3HOV H;  3HOW H;  2K52 A;  3I4N G;  1RIP A;  3VA7 A;  4DN4 M;  2F0U A;  2KOL A;  3RZD B;  1EY8 A;  2QDL A;  1JIC A;  3BVZ A;  3KLR A;  1FNV A;  3T1Y L;  4C2M H;  1UEB A;  1I5F A;  3GV6 A;  4QJF A;  4KN7 C;  4G57 A;  1W6J A;  3ZYY X;  3MFG A;  4JBK A;  4R8I A;  2JK8 A;  2DY7 A;  3D4R A;  1UUP A;  3CRL C;  1KNE A;  4LF5 Q;  4DV6 L;  2R93 G;  3AMU A;  4F88 A;  3OMC A;  1H9S A;  3HG9 A;  5JJZ A;  2JP1 A;  3T1H L;  4KI0 A;  3D3R A;  2B8F A;  1JOO A;  4JI4 Q;  2F0D A;  1I50 H;  1RF2 D;  4BY1 H;  4EQO A;  3M7G A;  1SFO B;  5DEH A;  4ZCK A;  1B50 A;  3EN2 A;  3AFP A;  5M5X H;  1HZB A;  1NJI C;  3A8K E;  2DNC A;  2WP8 J;  3KFU A;  4IOA A;  1GHJ A;  1WCM H;  2H5X A;  4GNX A;  1GXD C;  4YCU A;  3W1B A;  3G48 A;  5C4J B;  1PH1 A;  1KQS A;  3SE0 A;  1XTD A;  2CWA A;  4K5V A;  4BBS B;  3OHX C;  1LT3 D;  2N55 A;  2EYO A;  1EY4 A;  1JWU D;  5J3B A;  1E24 A;  5C3E G;  2KED A;  4R4I A;  2WB1 B;  5JEA J;  4DR1 Q;  2E76 C;  1ESF A;  5KIX A;  2KEC A;  4LF8 Q;  4NXM L;  1IL2 A;  4QL5 A;  4Y7N H;  1N33 L;  3GTL H;  3CKI B;  3HOW B;  1YEZ A;  1KHI A;  3HOV B;  1TY0 A;  1BKB A;  4CJ2 C;  4CKB A;  4RGN A;  2UUC L;  4IZ8 A;  2L9H A;  4B3R L;  1QCB D;  2YTX A;  4LAA A;  1D5M C;  4V19 0;  1G29 1;  5FOB B;  2WFW A;  2BH8 A;  5BR8 Q;  2KHI A;  2L11 A;  4O0A A;  3IFD A;  5CC4 A;  2J0T D;  4F87 A;  1O7L A;  2Q8R E;  1XNQ Q;  1G2S A;  2B63 G;  3WDN A;  2F0O A;  2RDG A;  2XRS D;  3J7Z C;  4ZKC B;  1XPU A;  2R92 H;  3K7A H;  1LTT D;  4GLX A;  1STY A;  2B2U A;  2QCP X;  4DV4 L;  4GOP B;  1TWH B;  2Z8L A;  5GAE C;  2VY3 A;  1Y69 U;  2ZXR A;  1X3Q A;  1F2Y A;  2Q8T A;  1GKH A;  2F0M A;  1VQO A;  5C4X H;  1SYD A;  2X6L A;  4JG2 A;  1TU2 B;  2ICE C;  1G6Z A;  2A68 C;  5I2Y A;  3EFX D;  1LT5 D;  4DR3 L;  3EA6 A;  1IBL Q;  4JI3 Q;  1G51 A;  2R92 B;  2D62 A;  1ZEQ X;  4JI5 Q;  5C3W A;  1YHQ A;  5FLX L;  3CQZ H;  1EU3 A;  2OTL A;  2BDO A;  1E1O A;  1PTO H;  3P20 A;  4DV2 Q;  4RFB A;  1CA6 A;  2KBN A;  2E5L L;  4A3G G;  2Z6K C;  2FJ2 A;  1FYC A;  4JYA Q;  3I2Z A;  1BVS A;  5EPJ A;  2UXB Q;  1AEX A;  1K8A C;  4OWW B;  2K05 A;  1YBY A;  1K73 C;  3PIO 3;  5F2D A;  3CMA A;  3N52 A;  3AB9 A;  1FL0 A;  1VQK A;  5DAU A;  1PH7 A;  4ODG A;  1S5B D;  2NUC A;  2F3V A;  5DLQ E;  4DFA A;  2AMC B;  1UE5 A;  5BN4 A;  3HFZ B;  4B3T L;  4DR3 Q;  5G3L D;  4LFC L;  1U4L A;  3UE0 A;  3FKI G;  2TSS A;  2K32 A;  2F0H A;  1YJW A;  5I2X A;  4OEL B;  3K8A A;  5IGE A;  2B2T C;  1PHJ A;  2G5D A;  1U5K A;  5EBD A;  4U67 3;  4WJ3 M;  3H91 A;  1LTG D;  3J81 j;  5KRU A;  3GTM B;  1PRT D;  1IW7 D;  1I4R A;  5IT9 L;  1C9O A;  5CV5 A;  1G2T A;  3J81 c;  1EIG A;  4YHH L;  1B53 A;  2UXC Q;  2CW0 C;  1LAB A;  5IE8 A;  1NTG A;  1UE7 A;  1YIT A;  2YTY A;  3DUZ A;  4AYB B;  1WTV A;  1B4O A;  4F7X A;  2NVT H;  2CQO A;  3SVM A;  1I6V C;  4FDB A;  1IL8 A;  2A8V A;  4CGY B;  2KCT A;  2KQ3 A;  1NE3 A;  4DNI A;  5CBE E;  4DV3 Q;  2D5D A;  4HJ8 A;  2F0J A;  3UDI A;  2WII B;  4X62 L;  3D6C A;  3HS0 C;  3NQI A;  1HTP A;  2F0G A;  4LFA Q;  4WJW A;  2R7Z B;  4G7O C;  2JA5 B;  4A3E H;  2EY6 A;  3M4Q A;  3UI2 A;  2UU9 Q;  1SND A;  1X55 A;  1S5F D;  1XNR L;  4BBR H;  5M9O A;  2IJ0 A;  4R4T A;  1OTC A;  4JCV E;  3ULJ A;  1MIU A;  1CQV A;  1SLJ A;  3J80 L;  2AQ3 B;  4E6I A;  4M8A A;  4BBR B;  3PO3 G;  4XT1 B;  1O80 A;  3DM1 A;  4LF4 Q;  1V1P A;  3KBX A;  4BY1 G;  4RHR A;  4DKA C;  1LTA D;  5FJ8 H;  1K9M C;  2XWJ B;  1SAP A;  1JR0 D;  3K0Y A;  1ESR A;  2MFI A;  4DPG A;  1HZA A;  2F0W A;  5M5W B;  1YHA A;  3MEH A;  3U58 A;  3L9A X;  4BA2 I;  3T4A C;  4DR7 L;  3PIP A;  3PV0 A;  5C0X H;  2F0P A;  2E5L Q;  3OW2 A;  1N32 Q;  1PFM A;  1UWV A;  4MTN A;  4MZ9 A;  1SE2 A;  1VF5 C;  2RQX A;  3BU2 A;  1EIY B;  1WYD A;  2ZXO A;  5GQO A;  3RZO B;  1HUN A;  4DV4 Q;  1H9J A;  2OTJ A;  1NSN S;  4XYQ A;  4PMB A;  1HNX L;  3OTO Q;  2ASB A;  2XVS A;  3BZK A;  2AKW B;  4PG3 A;  1H9K A;  4DR5 Q;  1L0X B;  2WV6 D;  1Q3L A;  1EQQ A;  4QIW E;  5HGQ A;  1X65 A;  1QOH A;  1ROD A;  1SSO A;  1Y8O B;  2B2W A;  2F03 A;  2C5C A;  2DJF C;  3A8I E;  3VYR A;  4R1J A;  4LW1 A;  2PW5 A;  5DM7 3;  1SRO A;  1PZI D;  3M9B A;  4BA1 I;  3KLS X;  4KJN A;  3H3V C;  2R3Z A;  4IUT A; 
#chains in the Genus database with same CATH homology
 2VQF Q;  1KXL A;  1B8A A;  1Q1B A;  3K80 C;  2MO0 A;  4X6A H;  2K5N A;  1AE2 A;  3WWV A;  4DAY B;  2CCZ A;  1VQC A;  2CKZ B;  4J15 A;  2R7Z H;  3ZJY C;  3GDE A;  3I4O A;  3S1Q H;  1XMO L;  2UXB Q;  4LF7 Q;  4JOI A;  3U4V A;  1HR0 Q;  3CC7 A;  1QVF A;  4IPC A;  4UPA A;  4AIM A;  3GTM H;  2LXK A;  1VQB A;  4LNQ A;  1UE1 A;  2B3G A;  2R93 H;  1KAW A;  1WI5 A;  5M3M G;  2QEX A;  4JYA L;  1Q8K A;  1PVO A;  4GKK Q;  4A3C H;  4HIK A;  2F4V L;  3GD7 A;  1HR0 W;  1R9T H;  4QY7 A;  4HJ5 A;  1PH2 A;  1C7Y A;  1XMQ Q;  1RL2 A;  1IBK Q;  4A3B H;  3CCS A;  3AYH B;  1CKN A;  1S40 A;  4AQY L;  5FJ8 G;  4A93 H;  2UXC L;  3I4M G;  3RN2 A;  2VNU D;  4BBS G;  1VS0 A;  2ALY B;  4JI8 L;  1W2B A;  2LXJ A;  4DV5 Q;  2YYZ A;  3EIV A;  4R4O A;  5IYD G;  3UE1 A;  2VW9 A;  2N78 A;  5C0X I;  5AJ3 L;  4LF6 L;  1X3F A;  1DGS A;  5C44 G;  4DUZ L;  4YWM A;  4A3I H;  4OO1 I;  3CF5 A;  1CKM A;  1Q7Y C;  4H02 A;  3KJP A;  1OXX K;  2D0P A;  4DV1 L;  1PA6 A;  2E2H H;  1CSP A;  3GTO H;  1VQG A;  4GN3 B;  4DR2 L;  1X56 A;  1XPR A;  4X64 L;  5IP9 H;  1XJV A;  2JA9 A;  2UUC Q;  1D8L A;  4PMW A;  3H3V I;  3BZC A;  1HH2 P;  2EIF A;  3RLN A;  4DV3 L;  3HOY H;  1EYG A;  3L2P A;  2ZJR A;  4JV5 Q;  3CP0 A;  1FJG L;  3T1Y Q;  2R7D A;  5IP7 H;  3S1N H;  1JJ2 A;  4BXX G;  1G6P A;  1CUK A;  4IFD J;  1J6Q A;  2HQL A;  1YZ6 A;  4HJ7 A;  4LF7 L;  4C3H H;  1L1O B;  1YJ9 A;  2FXQ A;  3BJU A;  4DV7 L;  1HZC A;  1YI2 A;  3A74 A;  5JJK A;  1GM5 A;  1SN8 A;  4DV6 Q;  3NBH B;  4JI6 L;  4GNX B;  1S72 A;  1GVP A;  5C0X J;  4PZ8 A;  4GKK L;  2IHE A;  4A4I A;  1PH3 A;  3FHW A;  4LF9 L;  3ICE A;  1BBU A;  1Q86 C;  1HNX Q;  3KF6 A;  3OTO L;  3CPW A;  5IYB H;  5IYB G;  3PUY A;  2Q2T A;  1LUZ A;  5K36 G;  4LF4 L;  1X6O A;  1NMF A;  4UP8 A;  2JA6 H;  1E3P A;  4YWL A;  3RN5 A;  3W5O A;  5C4J H;  1K83 H;  5IYD H;  2UUB Q;  4GS3 A;  1VQ9 A;  3M3Y H;  5AJ3 Q;  4DR4 Q;  3PUV A;  4DUZ Q;  2GVB A;  4B3S Q;  4X66 L;  2MO1 A;  1Y1V G;  2YU9 H;  4DV0 Q;  4KHP L;  1EQR A;  3M7N A;  1VQE A;  1Q46 A;  4DR6 Q;  1OXT A;  1N36 Q;  5M5W H;  2JQO A;  2K14 A;  1TWH H;  4OWT B;  3JAM i;  2ES2 A;  4LFA L;  4ALP A;  4LFB Q;  1EIF A;  1B7Y B;  2DGY A;  4B3M Q;  2UUA L;  4DR7 Q;  3AFQ A;  3S17 H;  5E7N A;  1IYJ B;  2JEB I;  1X54 A;  2UU9 L;  4BBR G;  2RHQ B;  4JI2 L;  4QQB X;  1Q82 C;  4LF5 L;  3PSI A;  5C3E H;  4A3K G;  1AE3 A;  1VQD A;  1WJJ A;  2N3S A;  4HJA A;  4DV7 Q;  2IX0 A;  4A3I G;  1KD1 C;  2F4V Q;  1L0W A;  5LMN W;  2I0Q A;  2PI2 E;  4APV A;  1T9H A;  2VQE L;  4DUY L;  3F2B A;  4KHZ A;  3GTK H;  2GVA A;  4DR5 L;  1LM0 A;  3L0O A;  4K0K L;  5M5Y H;  4LF9 Q;  1VQH A;  4TVA B;  3TEH B;  4AH6 A;  4BXX H;  4A3L H;  4LWC A;  4C3J H;  4A3D H;  4JI8 Q;  1N33 Q;  3PCO B;  3CCJ A;  4XTC S;  4DV5 L;  3UDG A;  2WAQ E;  3CAM A;  3HOY G;  2PQA A;  2NZO A;  4HJ9 A;  4GOP C;  1EFW A;  1CKO A;  4LUZ A;  1B70 B;  1QUQ A;  3KDF B;  4DV1 Q;  1EUJ A;  3HOV H;  3HOW H;  2K52 A;  3I4N G;  3TRE A;  5JJL A;  1RIP A;  4JI1 L;  2ZTE A;  1WCM G;  4JI5 L;  1CSQ A;  1S3O A;  2Z6K A;  5ELN A;  4HIO A;  2JA5 G;  4OO1 G;  3T1Y L;  4C2M H;  4BBS H;  1UEB A;  1I5F A;  1V1Q A;  4Y52 H;  1UE6 A;  2JJQ A;  4QJF A;  2GN5 A;  4UY8 C;  1SFO H;  4HIM A;  1VQ8 A;  1PFS A;  3E9I A;  4DV2 L;  4JBK A;  2JK8 A;  5IWA Q;  2ZTD A;  4XIG S;  4JBM A;  3RZD H;  1I94 L;  4IPH A;  2KHJ A;  4LF5 Q;  1OXV A;  4PZ6 A;  4DV6 L;  2R93 G;  4ME3 A;  2ZTC A;  3A5Z B;  1JB7 A;  1PYB A;  3D0F A;  2XGT A;  3SGI A;  1L1O C;  4AQY Q;  1QUQ B;  4P74 A;  1VQ6 A;  5GAH C;  2HHH Q;  3T1H L;  4A3G H;  4KI0 A;  3GTQ H;  2E2J H;  1VQ4 A;  3K7U C;  2KCM A;  4JI4 Q;  4LF6 Q;  1AH9 A;  4KLK A;  1I50 H;  2K50 A;  3G71 A;  1PH6 A;  4BY1 H;  4JI0 Q;  2EQS A;  1X3E A;  3EN2 A;  3AFP A;  1TWF H;  2CFM A;  1HZB A;  2XTI A;  5M5X H;  2K4K A;  2WP8 J;  1NJI C;  3KFU A;  4IOA A;  3I56 A;  1WCM H;  3LGJ A;  4JI7 Q;  1KL9 A;  1KIX A;  5EAY A;  4X66 Q;  1SE8 A;  3J80 c;  2H5X A;  4B3T Q;  4KHP Q;  1U0L A;  4GNX A;  4IJH A;  3GTP H;  5M3F G;  3HKZ E;  3TRZ A;  4BY7 H;  2QA4 A;  1Q12 A;  3D31 A;  3KF6 B;  4P73 A;  2DUD A;  4YCU A;  3W1B A;  3G48 A;  2B63 H;  3CME A;  3A0J A;  1JT8 A;  2UUA Q;  2MNA A;  4A3D G;  4PZ7 A;  3K0X A;  1L2F A;  1WOC A;  1PH1 A;  1KQS A;  4JI2 Q;  4P75 A;  3I55 A;  4GLV B;  2ZJQ A;  1VCI A;  1XTD A;  2CWA A;  4LUV A;  5FLM G;  4AYB G;  2UXB L;  5GRO A;  2IHF A;  1I94 Q;  4C3I H;  2OWO A;  1K8G A;  5J3B A;  1YNX A;  1E24 A;  5C3E G;  4R4I A;  4A3K H;  1C0A A;  5JEA J;  4DR1 Q;  1SR3 A;  2AHO B;  3H0G H;  4LF8 Q;  4NXM L;  1O7I A;  2AWN A;  1IL2 A;  4YY3 L;  2ATW A;  5LMN L;  4QL5 A;  4Y7N H;  1N33 L;  3GTL H;  3F8T A;  1YEZ A;  1KHI A;  4YWK A;  1BKB A;  3HOX H;  3ERS X;  4DR2 Q;  1SMX A;  4X64 Q;  3JAM c;  2UUC L;  4B3R L;  1VQ5 A;  3F2D A;  4X65 L;  4A3E G;  1M90 C;  3ULL A;  4EQ5 A;  4IFD I;  1FJG Q;  1E7Z A;  2AWO A;  1Y1V H;  2YV5 A;  3CCE A;  2IT1 A;  3PUW A;  1K0R A;  4LFC Q;  2JA7 G;  2YTX A;  3S16 H;  3NEM A;  1G29 1;  4JI7 L;  2MQH A;  2WFW A;  4A3L G;  3PF4 A;  2BH8 A;  1HZ9 A;  5BR8 Q;  1E1T A;  4LFB L;  2KHI A;  4DK6 C;  4DK3 C;  1P8L A;  2D0O A;  4O0A A;  3CXC A;  2NVY H;  3EBE A;  1W3S A;  1MKH A;  2WB1 E;  1XNQ Q;  1OXU A;  2B63 G;  4JC0 A;  3J7Z C;  5LMU L;  4OX9 L;  4JI6 Q;  3F1Z A;  1XPU A;  1KRT A;  2UXD L;  3RR5 A;  1LTL A;  1A63 A;  4O2D A;  2PMZ E;  2R92 H;  3K7A H;  4GLX A;  4POF A;  3PF5 A;  2OQ0 A;  1X3G A;  2R6G A;  1I6H H;  4DV4 L;  4GOP B;  2R7F A;  2A19 A;  1QVC A;  1PH4 A;  4K0K Q;  5GAE C;  4A3M G;  2JA8 G;  2F52 A;  4UP9 A;  2VY3 A;  3H15 A;  3CCR A;  2OCE A;  3MXN B;  3I4M H;  2VUM H;  2K5V A;  1FGU A;  3M85 A;  4L5Q A;  3HOU H;  1KRS A;  2JA7 H;  1GKH A;  4OWX B;  1VQO A;  4A3B G;  1J5E Q;  4JI4 L;  4GOP A;  5C4X H;  4NXM Q;  1NY4 A;  4JG2 A;  1A8V A;  2NZH A;  2WB1 G;  4JI0 L;  2E8G A;  4P71 A;  1L1O A;  3PUZ A;  3HOX G;  4DR3 L;  5IYC H;  1Y1W H;  5HY6 A;  1VQ7 A;  3ER0 A;  1VQN A;  1IBL Q;  2RHS B;  3CCM A;  4JI3 Q;  1G51 A;  4DR6 L;  1E22 A;  2D62 A;  3NEL A;  4IJL A;  4NB3 A;  1IBM Q;  1MJC A;  4JI5 Q;  1YHQ A;  2BA1 A;  3J80 i;  1Q1E A;  4A3F G;  1QZG A;  4B3M L;  4EX5 A;  3H3V H;  1CKN B;  3CQZ H;  3KLW A;  4X62 Q;  2OTL A;  3KF8 B;  1TWA H;  3HKZ G;  1JJG A;  2BH2 A;  1E1O A;  4DV2 Q;  2ZM6 L;  1NBW A;  1VQF A;  2NN6 I;  2KBN A;  1V43 A;  4A3J H;  3B6Y A;  2E5L L;  4POG A;  1N9W A;  2Z6K C;  4A3G G;  1N32 L;  3IRB A;  1N34 L;  3I7F A;  1Q81 C;  2PQA B;  4JYA Q;  4IPD A;  3A5U A;  3I2Z A;  1BVS A;  4L5R C;  2JEA I;  1NMG A;  4YHH Q;  1YIJ A;  4RMF A;  1PH8 A;  1K8A C;  4OWW B;  1ASZ A;  3HOV G;  3HOW G;  3I4N H;  1YBY A;  5H1S E;  2C35 B;  4HID A;  1K73 C;  3KJO A;  3M4O H;  4DR1 L;  3TS0 A;  4JV5 L;  3CMA A;  4LF8 L;  3CCL A;  4YY3 Q;  3PO2 G;  4RG1 A;  3MEF A;  3G6E A;  2BA0 A;  1V9P A;  1FL0 A;  2KEN A;  2N49 A;  1VQK A;  2A1A A;  3S14 H;  5FLX c;  1PH7 A;  3K81 C;  4A3J G;  1HNW Q;  3KYH C;  2VUM G;  1A62 A;  1VQI A;  3JC6 6;  5DLQ E;  4R4C A;  4A3M H;  2AMC B;  1UE5 A;  2Q2H A;  1MJE A;  3HFZ B;  1D7Q A;  4B3T L;  4DR3 Q;  4B3R Q;  1ASY A;  1XPO A;  4LFC L;  2B29 A;  3UE0 A;  3FKI G;  1YJW A;  3HOZ G;  4A3F H;  3L7Z C;  2NVQ H;  1QVG A;  4DAM A;  3K8A A;  3W1G A;  1YHB A;  2PNH A;  3DLL A;  3E0E A;  1EWI A;  1PYS B;  1YVC A;  3S2H H;  4IPG A;  5IWA L;  1Y1W G;  1PHJ A;  1KC8 C;  1U5K A;  4YCW A;  2LSS A;  5IYC G;  1JJC B;  4A75 A;  1XNR Q;  3KDF A;  5LMU Q;  4WJ3 M;  3OYY A;  4IFD G;  2ZM6 Q;  3J81 j;  4NXN Q;  1YJN A;  3KOJ A;  3F2C A;  5C4X G;  1C9O A;  2HIX A;  4JOI C;  2Q2U A;  1QZH A;  3J81 c;  4TQU S;  3HOU G;  1XMQ L;  2NN6 G;  2HHH L;  3ULP A;  3T1H Q;  4GNX C;  1WFQ A;  2JA8 H;  4YHH L;  1FVI A;  2QGQ A;  3TS2 A;  5C0X G;  2ID0 A;  3DM3 A;  5ELO A;  2UXC Q;  1OXS C;  1M1K C;  2F3I A;  4IO9 A;  3PUX A;  1HNZ L;  2VS1 A;  1NTG A;  5IE8 A;  1Z47 A;  1VQA A;  2K75 A;  1UE7 A;  5GAD C;  1YIT A;  2YTY A;  1J5E L;  1BBW A;  2R92 G;  2NVT H;  3CC4 A;  3J7A 5;  2CQO A;  3H0G G;  3E9H A;  4X65 Q;  2ZJP A;  1Z9F A;  3PIO A;  3CCV A;  3J81 i;  2Z0S A;  5JJI A;  2RF4 A;  4FDB A;  2IY5 B;  2NVX H;  3S1M H;  2EXD A;  2A8V A;  2KCT A;  4DR4 L;  1NE3 A;  4DNI A;  1I3Q H;  4DV3 Q;  1PV4 A;  4HJ8 A;  3Q8D A;  4JBW A;  4WJ4 A;  2HT1 A;  2VL6 A;  2JE6 I;  3STB D;  1XMO Q;  3UDI A;  4R4Q A;  3U4Z A;  1LYL A;  1HJP A;  2Q2I A;  5IT9 c;  4X62 L;  1N36 L;  1HR0 L;  3CC2 A;  3GTG H;  2RCN A;  4YCV A;  4LFA Q;  3S1R H;  1PH5 A;  4LUO A;  1XNQ L;  2HIV A;  4GKJ L;  3AQQ A;  3PO3 H;  1VQJ A;  2K5H A;  4A3E H;  4OX9 Q;  3M4Q A;  5IY0 A;  2UU9 Q;  5IP7 G;  2UXD Q;  3G4S A;  1X55 A;  5M3F H;  3RLO A;  5GAG C;  4BY7 G;  1XNR L;  4BBR H;  4AYB E;  1N34 Q;  1P16 A;  4R4T A;  1IBK L;  4JCV E;  1OTC A;  3ULJ A;  2I5H A;  2I5L X;  2E2I H;  4NXN L;  1MIU A;  3TQY A;  3U50 C;  1JE5 A;  3CPF A;  1SLJ A;  4L5T A;  3GTJ H;  5LMN Q;  1X9N A;  2I5M X;  3PO3 G;  1VQM A;  4LF4 Q;  3M4P A;  1VQP A;  3FP9 A;  4GN4 B;  1TWG H;  4BY1 G;  5FLM H;  4DKA C;  3S2D H;  2CWP A;  1HNZ Q;  2UUB L;  5FJ8 H;  4A93 G;  1K9M C;  3UDF A;  2VQF L;  1HNW L;  3S15 H;  4L5S A;  1GD7 A;  1PH9 A;  2MFI A;  4JBJ A;  4DPG A;  2JA6 G;  1HZA A;  2V1C C;  2N8N A;  5BR8 L;  4DV0 L;  1YHA A;  4A3C G;  4JI1 Q;  3CD6 A;  5IP9 G;  3RNU A;  4GN5 A;  4A76 A;  1TWC H;  1IXR A;  2Y0S E;  4NPS A;  3GO5 A;  3U58 A;  4OON A;  3UDX A;  4BA2 I;  4DR7 L;  1TXY A;  2VZA A;  3PGZ A;  4UP7 A;  1SRU A;  3RLF A;  3PIP A;  3PV0 A;  4GKJ Q;  2E5L Q;  3OW2 A;  1N32 Q;  1UWV A;  1A0I A;  4MZ9 A;  4MTN A;  2WAQ G;  3BU2 A;  1JMC A;  1VQL A;  1EIY B;  1WYD A;  2JA5 H;  5GQO A;  3RZO H;  4DV4 Q;  3AEV A;  2OTJ A;  5JEA G;  3STB C;  1HNX L;  2VQE Q;  2OQK A;  3OTO Q;  4DUY Q;  2ASB A;  3PO2 H;  3VDY A;  1IZ6 A;  2PI2 A;  2AKW B;  3BZK A;  4OXP A;  1EOV A;  4PG3 A;  2Y0S G;  3CCU A;  4DR5 Q;  1Y14 B;  1EQQ A;  4QIW E;  5HGQ A;  1H95 A;  1N8R C;  1X65 A;  5M3M H;  4GLA C;  3NEN A;  2L15 A;  3HKS A;  3CW2 C;  4MNO A;  4P72 A;  2IX1 A;  1K3R A;  4R1J A;  4LW1 A;  4QGU A;  3HOZ H;  1SRO A;  2YTV A;  4IOC A;  3FKI H;  4JI3 L;  1IBL L;  3M9B A;  4BA1 I;  4B3S L;  2R7Z G;  5C44 H;  3CCQ A;  1IBM L;  3S24 A;  1GO3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...