3J81i

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
111
structure length
111
Chain Sequence
NTKGGKKGRRGKNDSDGPKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLKNQGELPENAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 16
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
i PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3j81i00
5IYCH 4DUZQ 3CCJA 1HNWQ 4NPSA 1K9MC 3HOUG 4PMWA 2OTLA 1VQLA 3AFQA 5JJIA 5GQOA 1YHBA 1VQAA 4DR3Q 4IPGA 4LFCQ 4KHPL 3ER0A 3PF4A 2F52A 1Q1BA 5EAYA 1YITA 3UE1A 3A5UA 4YY3Q 3T1YQ 1GM5A 1VQNA 3S1QH 1N32L 1K83H 1N34L 1HNXQ 2ZM6Q 4A76A 4JI5Q 4BBRG 4IFDJ 2QGQA 4C3IH 1PYSB 1K73C 3K8AA 1R9TH 4K0KL 3RN5A 1OXXK 4LF5Q 1EUJA 1FL0A 1SRUA 1UE6A 4KHZA 1HR0W 5C4XH 1Y14B 3F2CA 1X65A 3RZDH 4IJHA 3U4ZA 3GTQH 3BZKA 3M7NA 1M90C 1XPOA 1PVOA 1I50H 1L1OC 4P74A 2XGTA 3SGIA 4NB3A 5C4JH 1LYLA 4UP9A 4DR2Q 5M3FH 5JJLA 4LFBQ 2VQFL 1S72A 1XTDA 1V9PA 2AHOB 4BY1G 4KHPQ 4LNQA 1I3QH 1SR3A 1NJIC 4QY7A 1XPRA 1X3EA 1U5KA 4AYBE 3KFUA 5C4XG 1XPUA 4R4QA 1TWCH 1FJGQ 2UUBL 4AH6A 4OWXB 1N33L 2ASBA 1N32Q 5M5XH 4A3KH 2Q2TA 2RHSB 1C7YA 1D7QA 4O2DA 3RLOA 1EFWA 4FDBA 4DK6C 3PO3G 1YJ9A 2JA5H 3B6YA 4B3ML 4UPAA 4K0KQ 3AQQA 2PQAA 3PV0A 4JI0L 5IP9G 3Q8DA 4HJ9A 3I4OA 1YJNA 1PHJA 1VQFA 3HOWH 2JA8G 1DGSA 2YYZA 3S1NH 4NXML 4QJFA 3HFZB 1VCIA 3F2BA 3H3VH 4A3MG 3BZCA 2LXKA 1WYDA 1U0LA 2Y0SG 4C3JH 1C0AA 1BBWA 2FXQA 1RL2A 3U4VA 2E5LL 1XMOL 2HQLA 2VQFQ 1I5FA 3KDFA 4HIOA 2YU9H 4JV5Q 3PUVA 2R6GA 3HOXH 2IT1A 3FP9A 1K0RA 1YHQA 3HOWG 1HZ9A 1QZGA 3DM3A 2KCMA 2YTYA 1N33Q 2UUBQ 3CCQA 4HIMA 2NVTH 1EQRA 1L1OB 1NMGA 4P75A 4P72A 2B29A 5IWAL 3GTOH 3CP0A 2C35B 3ERSX 2F3IA 4B3MQ 2JA7G 4JI0Q 4JI2L 3HOXG 2Z6KA 4ME3A 3CQZH 4PZ6A 2PNHA 2VZAA 3L0OA 4HIKA 1Y1WH 4IJLA 4NXMQ 2QA4A 2CWPA 4B3TL 4A3JH 1HJPA 2NZOA 3OW2A 5C3EG 3UDGA 1NBWA 3CCMA 5IY0A 4KI0A 2VL6A 2E5LQ 3CCLA 1XMOQ 2UXCL 1OXSC 3M4QA 2DGYA 1P8LA 2N8NA 2OCEA 5IP7H 4DR5L 3JAMi 2BH8A 1PH3A 1YVCA 2NZHA 4A3BH 3UE0A 4A3GG 2K4KA 3BU2A 4DK3C 4LF9L 2UXDL 4A3JG 2VUMG 2EQSA 1EOVA 3HOYG 1BVSA 3S24A 2CKZB 5IWAQ 1VQ8A 4BBSH 1YZ6A 2KBNA 4QIWE 4JI2Q 1KAWA 3E9HA 4LUZA 5GAHC 4DR3L 3I4NH 2VW9A 2OQKA 5IP7G 3KJOA 1T9HA 3STBC 4A3BG 2PI2A 3M85A 4YHHL 2WP8J 4DV1L 1VQJA 2Z0SA 1SMXA 1PH6A 1VQIA 1PV4A 2A19A 3RLNA 1HNXL 3TQYA 1N36Q 1XNQL 1X3FA 3CMAA 3PUWA 2GN5A 3RR5A 1VQPA 2JJQA 3D0FA 1QVGA 2OWOA 1MIUA 2ATWA 2UXCQ 4X62Q 3I4NG 1VQ4A 1WOCA 3T1HL 1MKHA 4DR5Q 1WI5A 1WJJA 3CCSA 3TS2A 3W5OA 3PGZA 4IOCA 2UU9Q 4LF9Q 5GADC 2UXDQ 4ALPA 1OXVA 4DR2L 1PH9A 1BBUA 3MXNB 4RG1A 2HHHQ 3L7ZC 5M5WH 4LFBL 4DV7L 4MZ9A 5HY6A 1V1QA 1SN8A 1YBYA 1X55A 5GROA 4A4IA 2N49A 1K8AC 3CC7A 3RZOH 1Z9FA 3GD7A 5IYCG 1FGUA 4YHHQ 4O0AA 4DV1Q 4DV5L 4DV6L 1FJGL 1VQ6A 2ZTCA 3STBD 1E7ZA 3I7FA 1XNQQ 4QQBX 2PQAB 5H1SE 1E1TA 3J80i 1EIFA 3CPFA 2A8VA 2R7ZH 3M4OH 4A3DH 3T1HQ 4JBJA 2B63H 4DAMA 1Z47A 4JOIA 2UXBL 3GTKH 4IPCA 1SFOH 3W1BA 4DR7Q 1VQEA 1VS0A 2B3GA 2UUAQ 3CPWA 4X6AH 4POGA 3JC66 3M9BA 3E0EA 4GOPC 1PYBA 3KDFB 2ALYB 1NTGA 4YCWA 1IXRA 4DV7Q 1E24A 4X66L 4JV5L 3CW2C 1YJWA 4DR6L 3K7UC 1X56A 4GNXC 4DV5Q 4B3RQ 1L2FA 4JI6Q 4DV6Q 3ULLA 1NMFA 4QL5A 3GDEA 3J81j 3M4PA 5M3FG 2KHJA 1Q1EA 4AYBG 1I94L 2IX1A 3GTGH 4JI3Q 1VQOA 5LMNL 2UXBQ 2I5HA 3J81i 1A63A 5GAGC 1JT8A 1KD1C 1PH5A 3I55A 1UWVA 2KENA 5FLMH 4A3KG 1LM0A 1HZBA 1VQGA 1ASYA 4C2MH 1Q7YC 3OTOL 3I4MH 1VQCA 2HIVA 3ICEA 3TRZA 1WFQA 4A3CH 4L5RC 2JA5G 4BXXH 5FLXc 2K5VA 4X66Q 3GTJH 1GO3E 4BY7H 4A3EH 1YEZA 1OTCA 1HR0Q 4DR6Q 3CC2A 2ES2A 4P71A 4UP7A 4GLXA 1X3GA 1PA6A 3CCVA 3HKSA 5FLMG 3JAMc 1I6HH 1CSPA 3HKZE 1PH4A 4GOPB 1CKNA 4A3CG 1L0WA 1KHIA 3PIOA 1I94Q 4IOAA 4JI8L 1VQHA 3KJPA 3H0GH 5LMNQ 3CMEA 4BY7G 2PMZE 5IYBH 5E7NA 3TREA 1AE2A 2V1CC 1NE3A 2JK8A 3HKZG 3CCEA 3S1RH 4R4TA 4LF6L 3G4SA 3KF8B 4LW1A 4DV0L 2R93H 3KF6A 4GNXB 1IL2A 2AWNA 3A5ZB 4JC0A 3HOZH 3U58A 5DLQE 3OTOQ 1N36L 2RF4A 2VQEL 1Q86C 4DR4L 4X62L 1QVCA 4LWCA 4GN5A 5FJ8H 5IYBG 5BR8L 1GVPA 5M5YH 1KL9A 3J7ZC 1Y1WG 5C44H 2UU9L 4LF8Q 2ID0A 4WJ3M 4A93H 4DUYL 4JI4Q 4IFDG 4OO1G 3MEFA 2E2HH 4LF4L 1Q12A 2AKWB 1VQMA 2JEAI 3G48A 3PO2H 2WB1E 3F1ZA 2HHHL 3DLLA 4JI8Q 4HJ8A 2JA9A 1PH8A 2E2JH 4R4OA 4LF7L 3IRBA 4QGUA 1EWIA 3FKIH 1YIJA 2CWAA 1A0IA 4DR1L 3S15H 2CQOA 2ZJRA 4LF6Q 4DV0Q 3CF5A 2D0OA 5C44G 4GKKQ 2ZTEA 1KIXA 4A93G 4GS3A 1B8AA 2K14A 4BA1I 3H3VI 2OTJA 1TWFH 1SE8A 1X54A 1IZ6A 4BBSG 4OX9L 2VQEQ 5LMUL 1D8LA 1G6PA 4DR4Q 1A8VA 3BJUA 5M3MH 1QVFA 1JE5A 3NENA 5BR8Q 4RMFA 3J7A5 2I0QA 1TXYA 3FKIG 3J80c 1IBMQ 1IBKQ 1LUZA 1XMQL 4DR7L 3K0XA 1L1OA 2E8GA 1WCMH 3H15A 1AH9A 2UUAL 4DUYQ 4PZ7A 4IO9A 3TS0A 2MFIA 2HIXA 1C9OA 1JJ2A 4LF4Q 5JEAG 1G291 2Z6KC 1N8RC 1FVIA 1JJCB 2WFWA 2K75A 1KXLA 1UEBA 3OYYA 2UUCL 4LF7Q 1J5EL 3S17H 1PH7A 2K50A 2YV5A 4EQ5A 2NN6G 4XTCS 4DR1Q 3NBHB 2ZJQA 2BA0A 3HOVH 4XIGS 1VQ7A 4GLAC 4B3RL 4JI6L 4DV2L 3AYHB 2LXJA 1W3SA 3A74A 1M1KC 4IFDI 2MO0A 4POFA 3CC4A 5LMUQ 4APVA 2EIFA 5GAEC 1VQDA 4OX9Q 1JB7A 4IPHA 2R7DA 5AJ3Q 2DUDA 1CSQA 1GKHA 2BA1A 4JI3L 3RLFA 3HOVG 1UE1A 1BKBA 2BH2A 1XMQQ 1KC8C 4BBRH 1Q46A 2JEBI 5HGQA 3J81c 3F2DA 3AFPA 4C3HH 3GTLH 2LSSA 1MJEA 4GN4B 3CAMA 4B3SQ 4HJAA 2PI2E 1JJGA 1XJVA 3EN2A 1Q8KA 1QUQA 4UY8C 2F4VQ 1Y1VH 2R7ZG 4A3DG 1S40A 2UUCQ 1XNRL 2B63G 3ZJYC 1J5EQ 4OWWB 4JI7L 1KQSA 4AQYL 4P73A 4NXNL 1HR0L 3ULJA 3L2PA 2N3SA 3S2DH 4X64L 4DV2Q 1RIPA 3GTMH 1CKNB 4BY1H 3PIPA 2VNUD 4OXPA 1B70B 2R92H 1TWGH 4IPDA 1NY4A 1Y1VG 2K5HA 2RCNA 2IHFA 4JBWA 2KHIA 2A1AA 4PG3A 4A3LH 3KF6B 2NN6I 3S14H 1VQBA 1H95A 3D31A 2Q2UA 5K36G 2N78A 1YNXA 4JBKA 3PO3H 4TQUS 3KYHC 5LMNW 4JG2A 5IP9H 1QZHA 4Y7NH 3G71A 2CCZA 1A62A 2IX0A 4HJ7A 2R92G 2R7FA 2JA8H 4WJ4A 3LGJA 1OXTA 1VQ5A 4YWMA 4OWTB 1MJCA 4TVAB 1XNRQ 1X9NA 4JYAL 1OXUA 5IT9c 4A75A 1N34Q 4A3LG 2MO1A 4JI7Q 4A3MH 2XTIA 5ELNA 1UE7A 2CFMA 2D0PA 1G51A 4AQYQ 1VQ9A 4NXNQ 2IY5B 1P16A 2QEXA 4X64Q 1PH1A 5JEAJ 4LF8L 4JI4L 1HNZL 2GVAA 3I4MG 2Q2HA 2Y0SE 3FHWA 3NEMA 4Y52H 3UDIA 3PUZA 4JOIC 4DAYB 4BXXG 5C0XG 1K8GA 2VS1A 1YI2A 3NELA 2HT1A 1E22A 1HH2P 2JA6H 1TWAH 4R4CA 4A3EG 3G6EA 3A0JA 2AMCB 3I2ZA 2D62A 2I5MX 4UP8A 4YWLA 4J15A 4JCVE 1GD7A 4GKKL 1CKMA 2K5NA 2JA7H 4LUOA 1V43A 1IBLL 2IHEA 1JMCA 3UDXA 4DV4L 4DV3L 3VDYA 4L5SA 2OQ0A 2WAQE 4JI1L 2ZJPA 3H0GG 4LFAL 2JA6G 4YCUA 2K52A 4DNIA 4JBMA 2Q2IA 3S16H 4JYAQ 5C3EH 4A3IH 4L5QA 4YCVA 4X65L 4MTNA 1IBML 1IBKL 2R93G 5IYDH 2WAQG 1EIYB 1IYJB 4HIDA 3HOZG 3PUYA 1HNZQ 3PCOB 1SROA 5IE8A 2JQOA 4A3FH 4DKAC 2YTVA 1HZAA 1CUKA 4A3GH 2RHQB 3AEVA 5FJ8G 2VUMH 3E9IA 2VY3A 3W1GA 1B7YB 4A3IG 3HOYH 3KOJA 3PF5A 1VQKA 1KRSA 1O7IA 2JE6I 1KRTA 4R4IA 5IYDG 3I56A 2WB1G 2H5XA 2E2IH 2I5LX 4GKJL 3F8TA 5J3BA 4OONA 1IBLQ 2NVQH 1EQQA 1TWHH 4LUVA 1J6QA 1E3PA 2MNAA 4DV3Q 4DV4Q 4A3FG 1CKOA 1E1OA 3PO2G 4JI1Q 5C0XI 3K7AH 3PUXA 4GLVB 4LFAQ 4DUZL 1ASZA 5AJ3L 3WWVA 3CD6A 4BA2I 1HNWL 2AWOA 3M3YH 1W2BA 4GN3B 3U50C 4X65Q 4H02A 4MNOA 3EIVA 2NVYH 1PFSA 1N9WA 4EX5A 1SLJA 1Q82C 3UDFA 3CXCA 4GOPA 4HJ5A 3RN2A 3GTPH 3S2HH 3TEHB 4LFCL 1QUQB 2GVBA 4R1JA 2NVXH 3PSIA 4B3SL 3K81C 1YHAA 1EYGA 2F4VL 2MQHA 5M3MG 4DPGA 3CCRA 4B3TQ 3T1YL 4YY3L 3HOUH 3K80C 1LTLA 3EBEA 4GNXA 1Q81C 3S1MH 3GO5A 2ZM6L 1S3OA 3RNUA 3CCUA 5ELOA 4JI5L 4GKJQ 1HZCA 1WCMG 2L15A 4L5TA 4YWKA 4KLKA 3KLWA 3ULPA 2EXDA 2ZTDA 4AIMA 5C0XJ 4LF5L 4OO1I 1PH2A 1AE3A 4PZ8A 2KCTA 2YTXA 5JJKA 1K3RA 1UE5A 1X6OA
chains in the Genus database with same CATH superfamily
3CCJA 1HNWQ 1K9MC 3HOUG 2WINB 1H9KA 5KRUA 3RD4A 5GQOA 3CU7A 1YHBA 5G3LF 4LFCQ 3EVQA 3ER0A 1Y1WB 2F0QA 2F0NA 3OW7A 1ESFA 4A3JB 1MBYA 2F52A 1WTQA 4C3IH 2IW3A 4K0KL 2LFNA 1NUCA 5DNFA 4A3BB 3WOFA 3K7AB 1HR0W 1Y14B 3F2CA 1LTSD 2B8GA 1XPOA 1L1OC 4P74A 3DUZA 5C4JH 3SGIA 1T5EA 1H9MA 4GZYC 1LYLA 5M3FH 4LFBQ 2VQFL 1S72A 5LL6S 1VF7A 1I3QH 4LNQA 3K59A 4K5XA 3D6WA 1TWCH 2UUBL 4OWXB 4A3KH 4IUTA 1D7QA 1QB5D 1YJ9A 4UPAA 4ZRZA 3AQQA 1STAA 1BBXC 3I4OA 5IGBA 1VQFA 2JA8G 1SNMA 2YYZA 2EJGC 4NXML 3SK4A 3F2BA 2F0MA 3E0JA 2Y0SG 1EWHA 5JPMC 1CM9A 3U4VA 5J39A 1XMOL 5JVG3 1PFNA 3KDFA 2YU9H 4KTAA 2RQXA 1YHQA 3HOWG 5C5LA 1CI3M 1QZGA 1N33Q 2NVTH 4A3DB 3SDZA 4BWGB 1SFOB 1V1PA 2Z6KA 2F3VA 1ILQA 2VZAA 4HIKA 2QA4A 2VB2X 3OW2A 4IFDH 1EL0A 2IL8A 4E6IA 3UDGA 3CCMA 4DK1A 4KI0A 2E5LQ 3CCLA 1I3QB 4G7HC 3N52A 4DR5L 2BH8A 5JAVA 4A3KB 4A3GG 2F0OA 3BU2A 4ME5A 4LF9L 2UXDL 2Z8LA 2EQSA 4DF7A 3GTGB 2KBNA 4QIWE 1KAWA 3E9HA 4LUZA 5GAHC 4DR3L 2K6AA 1T9HA 1HQRD 2RSNA 3P7JA 3W3AA 4C2MB 1VQIA 3KF8A 1FYCA 3RLNA 3TQYA 1XNQL 1X3FA 2ZXRA 3CMAA 1ET6A 2QDBA 2UXCQ 1MIUA 4HTHA 2DY8A 1KNAA 2KECA 4OIJA 3TS2A 5FLXE 3PGZA 2RSOA 1I6HB 1OXVA 2F0LA 1BBUA 3MXNB 2F0EA 4RG1A 5M5WH 4U673 1X55A 4TKOB 2N49A 2GA4B 3RZOH 3DEOA 3GD7A 5IYCG 2L9HA 4DV1Q 3L9AX 2RCFA 2OT2A 2B2UC 2PQAB 1JB3A 2F0HA 1E1TA 1ML0D 3CPFA 5M5YB 2B63H 5ELBA 1ET9A 2RBMA 4XT1B 2UXBL 4IPCA 2TSSA 2Z9HA 2B3GA 2UUAQ 1JWUD 3L3OC 2TMPA 1TS2A 1RTNA 1PYBA 2L11A 4YCWA 4DXGA 2K05A 4DV7Q 1V8QA 1WTPA 2A68C 1LTBD 5EPKA 1X56A 5K36H 5C4HA 3ULLA 2QF7A 3J7AV 2KHJA 1Q1EA 1E2VA 2B39A 1VQOA 5GAGC 5D3IB 3I70A 1AFPA 1SE3A 2RDHA 5CR3A 3OTOL 2HIVA 3ICEA 4A3CH 5C0XH 1EEFD 1Y69U 2K5VA 3HOVB 4QMGA 1GO3E 1IHZA 3RZOB 3SEBA 3QOLA 4UP7A 4C1NI 3T53B 5FLMG 5I9OA 3HP3A 2K5WA 5NUCA 1HTLD 3PIOA 1G2SA 3MC0B 5LHY1 4LJZC 3H0GH 3A7LA 2C9OA 3SXHA 3S1RH 3GTLB 4LF6L 1TY2A 1BUVT 1SYFA 3BDLA 4GNXB 1HFNA 4KKTA 2HUGA 2K03A 2AWNA 4F87A 5DLQE 5I4DA 4M1UB 1N36L 1Q86C 1WVLA 3A8JE 1MSHA 5IYBG 1YNND 1KL9A 3J7ZC 1Y1WG 1STGA 1I4QA 4HMJA 1BCPF 5TSSA 4LF4L 1SJHD 2WB1E 4RAUC 2IJ0A 2JA9A 2E2JH 3S14B 3IRBA 1ZYRD 4JK1C 2L0CA 4DR1L 3PO3B 2ZJRA 3TMEA 2D0OA 4A93G 2CW0C 4I7ZC 2M2LA 3FPPA 4BA1I 4WFN3 1U4RA 3ZYYX 4FXGC 4BBSG 1LTID 2EY6A 2VQEQ 1D8LA 1G6PA 3BZDB 5M3MH 3LWUA 2B2TA 5KYLA 4RMFA 1TXYA 3FKIG 3J80c 4DR7L 5T1GA 5I2YA 2AQ3B 2EOTA 3BDCA 2MFIA 5KEEA 4IO9A 1W6JA 2FFKB 2HIXA 1C9OA 1JJ2A 5JEAG 1G291 2Z6KC 2OF1A 3H0GB 3M7GA 2JA6B 1TWAB 2WFWA 3DEPA 2PZUA 1UEBA 1KXLA 2SOBA 3KLSA 5EPLA 1SNPA 2NN6G 4DFAA 2BA0A 2WAQB 4JPBW 4GLAC 4B3RL 2F1MA 2EDGA 3A74A 3ITPA 1HUMA 4POFA 1BR9A 4APVA 2RDGA 3UI2A 3MZ5A 2R7DA 5C3EB 2K33A 3RLFA 1UNSA 1UE1A 3GV3A 2BH2A 1HFGA 2B8FA 4WJWA 1KC8C 1Q46A 3AFPA 1B1ZA 5A35A 4HJAA 1M4VA 4A3DG 1Y1VH 2PW7A 3HOYB 3P1HA 1CA5A 2ICIA 1J5EQ 3SVMA 1KQSA 4AQYL 4NXNL 1HR0L 3L2PA 3S2DH 4X64L 1CKNB 1X32A 4F8MA 5CBEE 4CDCC 3NTKA 1B70B 2R92H 4H7BA 5KNCA 4B08A 1PTOC 2J7ZA 2K5HA 1A2TA 5JJZA 1LTAD 1RCVD 3HGBA 3NQIA 5CMDA 2Q2UA 1KDCA 5EQ0A 4KD4A 4KY6A 3KYHC 4JG2A 1SEBD 1II3A 2IX0A 3NWSA 2R7FA 2A6ED 2JA8H 4WJ4A 3V96A 1NCVA 3HOUB 4YWMA 2ZXOA 4TVAB 3TZDA 1JWMD 2D0PA 1VQ9A 1EY8A 1P16A 4R9WA 4BS9A 4EQOA 5JEAJ 1O7LA 1ZKOA 1WTXA 1HNZL 4JI4L 2Q2HA 3FHWA 3UDIA 4DAYB 4DGZA 1G8ZD 1K8GA 5BN5A 1JICA 2NYZD 2AMCB 1SXTA 1RD9D 4UP8A 2OEOA 4YWLA 4K8IA 4GKKL 3W2DA 4DAVA 2K5NA 3DXJC 4LUOA 4RH6A 2IHEA 3H3VC 3VDYA 1LT6D 4L5SA 3D4WA 1EQVA 4LFAL 3S16H 2K52A 2G9HD 2KA7A 4YCVA 4X65L 1QOHA 1IBML 1STNA 2R93G 1CQFA 1EIYB 2MHVA 2K01A 3PCOB 3T56B 1X3PA 3OWEB 2D5DA 3FVQA 2JQOA 4DKAC 2YTVA 4A3FH 1HZAA 4HMIA 5D14A 4IN3A 2RHQB 3URYA 4A3GH 5CBAE 3AEVA 5FJ8G 3PF5A 1VQKA 3I56A 5IYDG 4R4IA 4CGYB 4K2LA 2NVQH 1TWHH 4XT3B 2XSCA 4DV3Q 4DV4Q 1E1OA 1EY7A 4JI1Q 5M5XB 3PUXA 4DUZL 2Y0SB 3TDQA 1W2BA 2F0PA 2JA5B 4IUNA 3U50C 4QUFA 3GTMH 1SMYD 2NVYH 4XQJA 4HJ5A 1DCZA 1LT5D 3RN2A 3GTPH 3HOWB 3S2HH 3TEHB 2GVBA 3K81C 2WV6D 4HR7B 2MQHA 2DN8A 4DPGA 2M9VA 3T1YL 4FYDA 3EBEA 1IL8A 2VXWA 4GNXA 1Q81C 3RNUA 1HZCA 3BYYB 3KUPA 3ULPA 4AIMA 2ZTDA 4LF5L 4OO1I 4C56C 2KCTA 2E74C 1X6OA 1UE5A 1HA5A 1PDQA 3S16B 4DNTB 5IYCH 3T4AC 3I73A 1VQLA 4X3TA 5JJIA 4K5WA 5DM73 5I6YA 5JPNC 1HRJA 4DR3Q 2QILA 3A7AB 1FNVA 4ZAIA 4A3GB 1YITA 3UE1A 3A5UA 3S1QH 2ZM6Q 4A76A 4JI5Q 4IFDJ 1WD0A 3BVZA 1B44D 1R9TH 3C3LA 4ZUIA 3RN5A 4LAAA 1EUJA 1SRUA 2E76C 4IJHA 3U4ZA 3BZKA 3S9WA 1I50H 1D5XC 2XGTA 2NVYB 4OGQC 3NXWA 3GTPB 5JJLA 1XTDA 1V9PA 2AHOB 2O5IC 4KHPQ 5CYUA 1SE4A 5JVH3 1IW7D 5C4XG 1X3EA 1U5KA 1IKLA 4AYBE 3KFUA 2RVLA 1S5FD 3EA6A 1N32Q 2RHSB 4O2DA 3RLOA 4FDBA 3PO3G 3B6YA 4B3ML 4JI0L 3Q8DA 4ZQ3A 1YJNA 1DGSA 2XN9C 3S1NH 2FMMA 3H3VH 2A6HD 3BZCA 1C0AA 1NR2A 1O80A 2FXQA 4RWSC 5IIFA 5M9OA 2HQLA 3PUVA 3HOXH 4QF4A 1BCPD 3FDTA 4G57A 2YTYA 3V2TA 1DONA 4CHTB 1SE2A 4CJ2C 4ABNA 2PZWA 5IWAL 3CP0A 1G6ZA 2F3IA 3IAYA 3MXPA 1D1KA 4JI2L 3ONAB 1BCPB 4ME3A 1B4OA 5E4WC 4QUCA 1RJTA 3L0OA 2SNMA 1Y1WH 4A3JH 2XVSA 5C3EG 5IY0A 2VL6A 4XQQA 3TBIB 1PZKD 4QCLA 1P8LA 1M8AA 2OCEA 5IP7H 4A3BH 3TP8A 2K4KA 5COYA 4DK3C 3DWAA 5LL6X 3HOYG 3K5NA 3S24A 2D2CC 4BBSH 1YZ6A 2M00A 4DAYA 2VW9A 3OMCA 1A3VA 3S1NB 3M85A 1VQJA 3I4MB 1PV4A 4CDEC 2A19A 1N36Q 1LLRD 2G9DA 5JEAH 1VQPA 2RDFA 2JJQA 2ATWA 4A3EB 3I4NG 1VQ4A 3T1HL 1TR5A 1ZEQX 3NTIA 1MKHA 2LY7A 4KJOA 2NN6H 1ICWA 4EQPA 5ISRA 2PMZB 4ALPA 1ZXTA 5FO8B 3L7ZC 1EY4A 1CFMA 3CC7A 3I4LA 1Z9FA 4YHHQ 4DV5L 2FJ2A 2PCFB 1FJGL 3HOZB 4DV6L 1VQ6A 3I7FA 2Z1CA 2B2YA 3J80i 1EIFA 2A8VA 4A3DH 3EROA 4JOIA 2EXZA 3GTKH 1SFOH 3W1BA 4DR7Q 1VQEA 4A93B 1VS0A 1PFMA 2E2HB 3HG9A 3M9BA 4KN4C 2PQEA 3PO2B 4BBSB 1NTGA 5CV9A 2BDOA 3FKIB 1E24A 1B53A 3CW2C 5ELDA 4DR6L 3K7UC 4GNXC 4B3RQ 1TWFB 3NBHA 4QL5A 3M4PA 4L8JA 1GHKA 3F2UA 3FMCA 3GTGH 4R8NA 4PMCA 1A63A 4FP5D 1WCMB 2O4XA 4HCEA 4FF1A 1JOQA 1KDBA 1UWVA 1L0XB 4ZKBB 3J80E 4V0BA 4C2MH 3ERQA 1ASYA 1VQCA 1WFQA 4L5RC 2JA5G 1YNNC 4X66Q 1F77A 3K57A 1S5CD 1OTCA 1HR0Q 4F88A 4U68A 2F0KA 1KABA 3HKSA 3JAMc 1I6HH 3HKZE 1PH4A 4GOPB 1ZYRC 1L0WA 1KHIA 4FNFA 2EYOA 1I94Q 4IOAA 4JI8L 3GTKB 1CZWA 2QW7A 5LMNQ 4BY7G 4BBRB 1FGBD 4PMBA 3CCEA 4C3HB 3G4SA 1EY0A 2R93H 3P20A 4TSSA 4B9XA 1RTOA 1F2YA 2QEJC 1U4MA 1HHVA 1UUPA 3PMFA 1SNOA 1EYCA 5FJ8H 5BR8L 1RODA 2DNEA 1GVPA 2XRQD 3A54A 4RCOA 5M5YH 1V1OA 4BY1B 4JI4Q 4OO1G 3MEFA 2JEAI 1F9RA 3G48A 1GUNA 3F1ZA 1NNXA 2HHHL 4NMZA 3QJYA 1WTHA 1EWIA 3MA2B 2CWAA 4HSPA 4DV0Q 4GKKQ 5C44G 3VR5A 2OTJA 1SE8A 3I8ZA 4OX9L 2J0TD 4K6LA 4DR4Q 5CORA 1A8VA 3BJUA 1JE5A 3NENA 1DOMA 3C46A 1IBMQ 1LUZA 3MVVA 3H15A 5A2QE 2DJFC 3HRZC 4DUYQ 2ICEC 1JJCB 1SNDA 3G7LA 3OYYA 2UUCL 4LF7Q 3HOVH 2R93B 3TP6A 1WD1A 1S5ED 4XIGS 1B9MA 4J1MA 4DV2L 1M1KC 1W3SA 4IFDI 2MO0A 1QNUA 4RA8A 5LMUQ 1G91A 1HA6A 4IPHA 2DUDA 3CRKC 5EJWA 1BKBA 1XMQQ 2JEBI 4XDXA 5HGQA 3J81c 3F2DA 2DY7A 3GTLH 5KNDA 1KTKA 2LSSA 1MJEA 4IALA 4FF3A 1Q8KA 1QUQA 4UY8C 2L55A 1S40A 3JAML 4ID6A 2E2IB 4JI7L 1SAPA 1EIHA 4HCSA 2L4NA 1RIPA 4CDFC 2EY5A 3PIPA 4OXPA 1I4PA 2RA4A 4IPDA 2RCNA 2IHFA 3Q23A 2A1AA 2L5TA 2KCCA 3KF6B 3S14H 3NUCA 2BDNA 1H95A 2N78A 1ENCA 1YNXA 3PO3H 4TQUS 5KGUA 1QZHA 3G71A 4HJ7A 4CKCA 1VF5C 4HSVA 4FF2A 1GUOA 1XNRQ 3S1MB 4JYAL 5IT9c 4A3LG 2MO1A 2Q8RE 2XTIA 2IY5B 1G51A 2QEXA 4IUQA 2B2YC 3I4MG 2Y0SE 1Q3LA 1JCKB 2E2DC 3HS0C 4JOIC 1F9QA 1WTVA 2VS1A 5DM63 4KN7C 1F2MA 3NELA 1E22A 2HT1A 2JA6H 1RDPD 1TWAH 4R4CA 4A3EG 3G6EA 1IKMA 4J15A 3ND9A 1O78A 1V43A 1F2LA 1Z6HA 1JMCA 2LKVA 2OQ0A 1SMYC 4YCUA 4KV6A 3BVGA 3KK7A 5C3EH 5HGTA 4KY5A 5E3FA 1IYJB 5C5MA 3HOZG 3PUYA 5C4XB 3GTQB 1JQYD 1STBA 3OHXC 5C3XA 1C4QA 4A3IG 3HOYH 4IQZA 5D3DA 2O5JC 4GKJL 3F8TA 4J8QA 3AB9A 3CHBD 1IBLQ 3NSWA 4C1NK 3PO2G 1CKOA 5C0XI 3J81L 4GLVB 1HNWL 5AJ3L 2AWOA 5D65A 4MNOA 3EIVA 1N9WA 1SLJA 3CXCA 4GOPA 5I2XA 5EPJA 4LFCL 2NTTA 1TS4A 4B3SL 1GUWA 4TRDA 2F4VL 2AQ1B 5IODA 4M8AA 3CCRA 3HOUH 1JR0D 4MHEA 4X3SA 3A56A 3EFXD 4XXEA 1LO5D 1WCMG 2K7VA 4L5TA 3T16A 4KLKA 2EXDA 3LWEA 2YTXA 5JJKA 4JW0A 2OTLA 3PQIA 4OELB 1IW7C 1VQAA 2KUMA 4CJ0B 3CQZB 4IPGA 5IT9L 4FO2A 3PF4A 4IURA 1EY5A 4QB4A 1A3TA 4K8JA 1Q1BA 5EAYA 1GM5A 1VQNA 4YY3Q 5C6AA 1K83H 4ZUJA 1N34L 5BN4A 1BOSA 1ILPA 4BBRG 1LT4D 4YIJA 3K8AA 4XYQA 4C3HG 1CK1A 1ONLA 1FL0A 3NWTA 1MD2D 2A6HC 4QIWB 3RZDH 1LABA 1QJOA 3Q6SA 2F0WA 4K6DA 4NB3A 4UP9A 1HCZA 3I4NB 4BY1G 1BCPC 3MXNA 1SR3A 2EYJA 4DK0A 1XPUA 1FJGQ 1N33L 4AH6A 2ASBA 5M5XH 1B2TA 5IGCA 1EFWA 1TT2A 4DK6C 3I91A 1A3UA 3FRPB 2JA5H 4K0KQ 2F0DA 2PQAA 3AU7A 2XIWA 5IP9G 4HJ9A 4X3KA 1EYAA 1PHJA 3HOWH 4OL7A 2HQEA 2KEEA 2P5ZX 2CHBD 4QJFA 1H9RA 1VCIA 3A8KE 4A3MG 4IZ8A 2XWJB 1WYDA 3D4DA 4RKLA 1BBWA 2E5LL 1RL2A 2VQFQ 1I5FA 4HIOA 1VMPA 2IT1A 3J80L 3NQTA 2NWGA 1QWYA 4ILWA 1MGSA 2KCMA 1K83B 4Q5VA 2UUBQ 3CCQA 2KEDA 1EQRA 4P75A 2FINB 2R7ZB 1O7YA 3PIO3 3M4OB 3ERSX 4RHSA 3QG1A 3K58A 2SEBD 2SNSA 3RZDB 2PNHA 2MJ8A 1F9PA 1S5DD 4NXMQ 4G4KA 2CWPA 1HJPA 2NZOA 1WTRA 1NBWA 3KLRA 3H94A 1EEID 3K5OA 1OXSC 1XMOQ 2UXCL 4UHVA 2DGYA 5CGKA 2N8NA 4IUUA 3JAMi 1YVCA 2NZHA 3UE0A 3BYTB 4N8FA 1QE6A 1CHPD 2R3ZA 2WACA 4RHRA 4ZKCB 3MFGA 3VR4A 3KJOA 1SDFA 2PI2A 2WP8J 4DV1L 2Z0SA 1PH6A 1SMXA 4N9TA 2AUJD 1HNXL 3A8IE 4NP5A 3PUWA 3GV6A 3RR5A 4K5VA 3GTJB 1QVGA 2OWOA 4ZYSA 4KKSA 1ENAA 1H9SB 4BY7B 1NSNS 1WOCA 4DR5Q 2A69D 3H09A 1WI5A 3CCSA 4IOCA 4LF9Q 5GADC 2UXDQ 3R8BA 4DR2L 2HDMA 5I6WA 1PRTF 4G7ZC 5EGTA 2HHHQ 3JAME 2MP1A 2MGSA 5A2QL 4MZ9A 4DV7L 5HY6A 1YBYA 5GROA 1JE4A 1K8AC 4X3UA 1FGUA 3VYSA 2K28A 3FEWX 5AFWA 2ZTCA 3STBD 1E7ZA 2I07B 3R2IA 1XNQQ 4QQBX 4NKLA 1SYDA 5H1SE 4KJNA 1A15A 3Q22A 2B2WA 3IKJA 4JBJA 1YNJD 5C44B 2WB1B 3QR8A 3CPWA 4X6AH 2BE5D 4POGA 2H4OA 5FOBB 3E0EA 4GOPC 1XXGA 3KDFB 2ALYB 1GUSA 3U9SA 4F7XA 1IXRA 3S15B 2WIIB 4JV5L 2A5HA 1AP0A 1C8CA 3NHHA 1YJWA 3SK5A 1STHA 1STEA 2F0FA 3IL8A 3Q24A 1NMFA 4XQNA 3J81j 3FPUB 2IX1A 5KYIA 1CQVA 2UXBQ 4DU9A 2I5HA 3J81i 1UAPA 1JT8A 3KLSX 3IFDA 1KD1C 1MSGA 1PH5A 3I55A 5FLMH 1VQGA 4KKUA 1Q7YC 3I4MH 3RMHA 1AEXA 3S17B 3OIQA 3BDOA 3WOEA 4A3EH 4OHJA 2ES2A 3VYTA 1TS5A 1R4PB 1X3GA 2NTSA 3V05A 5KNBA 1D1IA 1CSPA 4C3JG 1CKNA 4A3CG 1I4RA 2KVMA 3J7YW 5I9PA 1VQHA 2F3WA 1VMCA 5IYBH 3TREA 3QWNA 1PTOD 2K1BA 2JK8A 2L12A 2V1CC 3HKZG 1HTPA 3KF8B 4FXKC 4NW2A 1AW7A 5ELCA 1IL2A 1TU2B 3HOZH 1IYVA 2F0JA 3DHQA 3OTOQ 1FD7D 2F0IA 1K3BC 3J81E 2VQEL 2EVBA 4X62L 1QVCA 4LWCA 1PTOB 4GN5A 4K14A 1ESRA 5CV5A 2J4XA 2UU9L 4WJ3M 4A93H 5CV6A 2E2HH 4UDUC 3PO2H 1TY0A 3C1FA 3MXGA 4QGUA 3FKIH 4DN4M 4LF6Q 3CF5A 1D2BA 3EQLC 4Y7NB 3GQBA 1B8AA 3H3VI 4RGOS 1TWFH 1A6XA 3I90A 3D4RA 1EU4A 3QB3A 1PFBA 3J7A5 2I0QA 3RUZA 3K0XA 1WCMH 5IT9E 4ZCKA 5CV7A 3ND8A 1SJED 2PYKA 4LF4Q 4I65A 5JOBA 1J5EL 2LMCB 1PH7A 2K50A 2YV5A 4DR1Q 2ZJQA 2JA7B 5IOCA 1VQ7A 4JI6L 5ELEA 3N6RA 1TS3A 5IGEA 2K04A 1NAPA 2JXMB 3CC4A 1I4GA 5K5PA 2EIFA 1VQDA 1I4XA 1JB7A 5AJ3Q 4A3IB 1CSQA 1GKHA 2BA1A 4JI3L 4CKEA 4HAEA 1E2WA 3MEHA 4H13C 1B3QA 2Z6BA 4BBRH 4C3HH 4GN4B 1DOKA 2Z4HA 3CAMA 4B3SQ 2PI2E 3MTSA 1HXYD 5CV4A 1XJVA 3EN2A 2F4VQ 1JJGA 2EY1A 2R7ZG 2VUMB 1BNZA 4OWWB 4IUVA 1GUGA 3SR1A 2VB3X 3ULJA 1DZ1A 1QILA 2V4DA 1EFID 4BY1H 1E2ZA 1QCBD 3BG3A 1H9SA 1DM0B 2VNUD 1FR3A 3R93A 4RGNA 1Y1VG 4KY7A 3VA7A 4MIUA 3M3YB 2Q8TA 3O13A 2KHSA 2NN6I 1VQBA 1PYWD 2F03A 2NVXB 1FNUA 5LMNW 5IP9H 5EKLA 2R92G 2OXPA 1OXTA 1MJCA 4A75A 1N34Q 4A3MH 5ELFA 4AQYQ 5IGGA 4NXNQ 3OPOA 3TZUA 4X64Q 4LF8L 2B2WC 3DWPA 3NE5B 1B3AA 2EY2A 3NEMA 4Y52H 3PUZA 5E4XA 4BXXG 2EJMA 1HH2P 3A0JA 1GUTA 2I5MX 2XNAC 3U9OA 1XYIA 3QOJA 4JCVE 1GD7A 1KAAA 1B9NA 1PZID 4EGVA 1HPCA 4K2KA 3UDXA 5EBDA 4DV4L 4EQNA 4DV3L 2WAQE 1KLGD 4JI1L 1D5ZC 3DM1A 3P75A 4DNIA 4O1NA 4C3IB 4DXFA 5L37A 1IBKL 3QIAA 5IYDH 1GOZA 4HIDA 1Q90A 1HNZQ 1SROA 5IE8A 1C48A 5C4JB 4N9PA 1CUKA 2ZXPA 5M3FB 2B2VA 3C2PA 1HUNA 4AYBB 1LT3D 2MPMA 1KRSA 1O7IA 2HCIA 2JE6I 2XRSD 3KBGA 4UAIA 2WB1G 2H5XA 2E2IH 2I5LX 1NR4A 1EZ8A 4OONA 1Y8OB 2HCCA 2L1BA 4DA2A 1EQQA 1TWCB 1E3PA 2F0TA 2MNAA 4A3FG 2A73B 1DOLA 2QDLA 1PRTD 4LFAQ 4A3MB 1ASZA 3CD6A 3WWVA 4BA2I 1I6VC 4X65Q 1BQQT 2PNRC 1Q82C 1MHWC 4EX5A 4L63B 1LACA 3UDFA 4R1JA 5FKAC 3PSIA 1PRTB 2F4IA 1D6EC 5C4ZA 3OOCA 4HEDA 3S1MH 3GO5A 1Y8NB 1CHQD 4WORA 2ZM6L 5ELOA 2YU9B 3DMUA 3I72A 4JI5L 2L15A 4Z9CB 4YWKA 1XWEA 2JYOA 2ZT9C 2NVTB 4DUZQ 4NPSA 4PMWA 2Q8IB 2FMCA 3AFQA 4MTKA 3X3NA 3C1EA 4KD3A 3QO2A 3E3XA 2A6EC 3TN2A 4KHPL 1LTGD 4J6HA 1CT1D 4FF4A 3T1YQ 1N32L 4MN3A 1U4LA 1HNXQ 1TVXA 4DAPA 2QGQA 1K73C 1PYSB 3AMUA 1XX8A 1OXXK 4LF5Q 1UE6A 4KHZA 5C4XH 1X65A 3OSOA 3GTQH 3M7NA 4O42A 1M90C 4RGTA 1PVOA 1J9OA 4DR2Q 1EZ6A 3CRLC 3D6CA 4ODGA 2F0VA 1F2ZA 3KBXA 1NJIC 3DWQA 3K0YA 4QY7A 1XPRA 1VDZA 4R4QA 1LTTD 3MHBA 2K5QA 2KCNA 2Q2TA 1C7YA 2N55A 4XYOA 3SK8A 3PV0A 4B9WA 1DD2A 1EY9A 1QG7A 2EZVA 1S5BD 4N8X1 2EYMA 3HFZB 5FO7B 4KMUC 2NB0A 2LXKA 1U0LA 4C3JH 5M5WB 1SYGA 1SNQA 4CKBA 4JV5Q 2R6GA 3FP9A 1K0RA 1RKNA 1HZ9A 3DM3A 4HIMA 3J7AF 1L1OB 1NMGA 4P72A 2B29A 3E6ZX 3EJIA 3GTOH 2C35B 2B63B 4B3MQ 1R4QB 2JA7G 4JI0Q 1EYDA 3D8GA 1CZGA 3HOXG 5E1FA 4PZ6A 3CQZH 3NK9A 1U4PA 1PXUA 4IJLA 4B3TL 2JP1A 3SE0A 2BCOA 2A69C 4KK7A 1PTOF 3M4QA 1K0SA 2JN4A 1PH3A 1E0BA 2AUKA 2D9UA 2BOSA 4A3JG 2VUMG 1EOVA 1BVSA 2CKZB 5IWAQ 1VQ8A 2IX3A 4I7AA 4JI2Q 2K5DA 3I4NH 2IPKD 2OQKA 5IP7G 4KHVA 1U9RA 4OEMB 4ZLTF 3STBC 4CDDC 4A3BG 3LNNA 4YHHL 2EYHA 3HZXA 1I4HA 4NDXA 4C3JB 1Z7TA 2DNCA 2GN5A 1YNJC 3D0FA 1ENFA 1JC7A 4X62Q 2HD3A 5T1IA 3HKZB 5G3LD 2BE5C 2CQAA 1WJJA 1SYBA 3W5OA 2UU9Q 2ENBA 2KQ3A 3MFYA 3GTOB 1IYUA 1AZPA 1PH9A 1SYEA 1DXMA 5CC4A 1BO0A 2NBFA 4LFBL 1KDAA 3S1RB 1V1QA 1SN8A 2KJXA 4A4IA 1S4ZA 2B2VC 2NUCA 2DJGC 2EYPA 3WDNA 2PPBC 4O0AA 3R2TA 4RKBA 5DAUA 3VYRA 1RF2D 3Q0AA 2F0UA 1TQOA 2R7ZH 3M4OH 5EKIA 3T1HQ 4DAMA 5EBCA 1Z47A 5IGDA 4RCNA 1MI2A 1JORA 3TSSA 3T51B 2E75C 3JC66 3BS1A 1EY6A 1K28A 3H91A 4C3IG 2E2JB 4X66L 1EIGA 2F0SA 1F9SA 5KIXA 2WKDA 3SK6A 4DV5Q 1L2FA 3K5MA 4JI6Q 4S3SA 4DV6Q 3PIP3 2K32A 3GDEA 1STYA 2CVRA 4RGMA 3IFTA 5M3FG 4P2CB 5M3MB 4AYBG 1QNKA 1L0YB 1I94L 4JI3Q 5LMNL 4LK1C 4IUPA 2N88A 1UEAB 2KENA 3E5SA 4A3KG 1LM0A 1HZBA 2NZ1D 3TRZA 2F0GA 5DEHA 3VR2A 4Q0FA 4BXXH 5FLXc 2IWHA 3GTJH 1SBBB 2FHTA 4V190 4BY7H 2WKCA 1GHJA 1GJXA 1YEZA 4DR6Q 2CH4A 2A68D 3CC2A 4FVMA 4P71A 4GLXA 1PA6A 1ICFB 3CCVA 1K8OA 1RHPA 3KJPA 2X6GA 2JSOA 3CMEA 4G7OC 2PMZE 5E7NA 3A55A 1AE2A 1NE3A 4R4TA 4DV0L 4LW1A 4L6TB 3KF6A 3A5ZB 4JC0A 3TP7A 1PZJD 3U58A 4OO1H 1Y1VB 2LS01 2RF4A 2G5DA 5FO9B 4DR4L 2EPBA 3OWFA 3K5LA 3S2DB 4CJ1B 3NTHA 1SSOA 3NBIA 5C44H 4LF8Q 2ID0A 4DUYL 4ULLA 4IFDG 2R92B 3G6JB 4CBVA 1O7ZA 1Q12A 2AKWB 3OIPA 1VQMA 1JOOA 3DLLA 4JI8Q 4HJ8A 1KNEA 1PH8A 4R4OA 5CV8A 4LF7L 1DJRD 4RFBA 1YIJA 1AZQA 3S15H 1A0IA 3NPPA 2CQOA 2ZTEA 3BVMA 1KIXA 4GS3A 2MUYA 2AQ2B 2K14A 1J8IA 2I46A 2JA8B 1D5MC 1X54A 4DNRB 1IZ6A 5LMUL 1QVFA 1CTMA 5BR8Q 3H6MA 1IBKQ 2EE1A 1XMQL 1L1OA 2E8GA 1AH9A 4OIKA 2UUAL 2X6LA 1T5XD 3HEJA 4PZ7A 3TS0A 1JWSD 1N8RC 1FVIA 2K75A 5IGFA 2A74C 3MWYW 3S17H 4EQ5A 4XTCS 3NBHB 1W6KA 2HDLA 5BN3A 1DYQA 4H44C 1JOKA 3VYUA 3AYHB 2LXJA 3CKIB 2CW0D 4OX9Q 5GAEC 3K6OA 2PW5A 3D3RA 3GP7A 1XTCD 2QCPX 3HOVG 2KOLA 1BXTA 5F2DA 3T13A 5FLXL 3R3OA 4A3FB 4PV1C 1LV9A 2XWBB 1PMRA 2UUCQ 1XNRL 2B63G 1HQMC 3ZJYC 1PTOH 4P73A 1EOTA 2N3SA 3MAQA 4DV2Q 2NVQB 1TWHB 2PZTA 3MXUA 1BDOA 5J1ZA 2B2TC 2PO4A 1TWGH 1NY4A 1V1PB 1B50A 3GTMB 4JBWA 2KHIA 4PG3A 4A3LH 1PLFA 3M4YA 2EYFA 3D31A 5K36G 1WTOA 3S2HB 4JBKA 1SNCA 2CCZA 4Y7NH 1G2TA 1A62A 2EJFC 1GXDC 3LGJA 1VQ5A 4OWTB 4PQXA 1X9NA 1OXUA 1OO9B 4JI7Q 5ELNA 1LTRD 1UE7A 2CFMA 3X3MA 5J22A 1WTWA 1BF4A 3SHLA 1PH1A 2GVAA 1EQTA 5C0XG 3OMGA 1EWCA 1YI2A 3I2ZA 2D62A 1CKMA 2JA7H 1IBLL 1PRTC 4H0LC 2QKIC 3I3CA 3S1QB 1SYCA 2ZJPA 3H0GG 2SDFA 2JA6G 4JYAQ 4JBMA 2Q2IA 2X69A 4A3IH 4L5QA 1R9TB 4MTNA 5FK9C 5C3WA 3VR6A 2WAQG 1CA6A 1TWGB 1FNWA 2EYLA 4R8IA 1I50B 3LX0A 1KLUD 1H9JA 2Z4IA 1TIID 2VUMH 1A2UA 1K8MA 2RKSA 2VY3A 3E9IA 4HN7A 1B7YB 4WRDA 3W1GA 3KOJA 1KRTA 5J3BA 2B2UA 1Q8IA 4LUVA 1J6QA 4ZK9B 3K7AH 3VA5A 3M3YH 4GN3B 2R61A 4H02A 1PFSA 4JVZA 1TKWB 2O2LD 2C5CA 1QUQB 4LMQD 2CH4W 2NVXH 4EVOA 1YHAA 1EYGA 3TP5A 5M3MG 1Y8PB 4B3TQ 4YY3L 3K80C 1LTLA 2H1EA 5HURA 5EKKA 4FXDA 1S3OA 4PNYA 3CCUA 4GKJQ 1AN8A 3HOXB 3KLWA 1EU3A 3VR3A 5C0XJ 1PH2A 1AE3A 1X3QA 4PZ8A 1K3RA 3NP8A
chains in the Genus database with same CATH topology
5IYCH 4DUZQ 3CCJA 1HNWQ 4NPSA 1K9MC 3HOUG 4PMWA 2OTLA 1VQLA 3AFQA 5JJIA 5GQOA 1YHBA 1VQAA 4DR3Q 4IPGA 4LFCQ 4KHPL 3ER0A 3PF4A 2F52A 1Q1BA 5EAYA 1YITA 3UE1A 3A5UA 4YY3Q 3T1YQ 1GM5A 1VQNA 3S1QH 1N32L 1K83H 1N34L 1HNXQ 2ZM6Q 4A76A 4JI5Q 4BBRG 4IFDJ 2QGQA 4C3IH 1PYSB 1K73C 3K8AA 1R9TH 4K0KL 3RN5A 1OXXK 4LF5Q 1EUJA 1FL0A 1SRUA 1UE6A 4KHZA 1HR0W 5C4XH 1Y14B 3F2CA 1X65A 3RZDH 4IJHA 3U4ZA 3GTQH 3BZKA 3M7NA 1M90C 1XPOA 1PVOA 1I50H 1L1OC 4P74A 2XGTA 3SGIA 4NB3A 5C4JH 1LYLA 4UP9A 4DR2Q 5M3FH 5JJLA 4LFBQ 2VQFL 1S72A 1XTDA 1V9PA 2AHOB 4BY1G 4KHPQ 4LNQA 1I3QH 1SR3A 1NJIC 4QY7A 1XPRA 1X3EA 1U5KA 4AYBE 3KFUA 5C4XG 1XPUA 4R4QA 1TWCH 1FJGQ 2UUBL 4AH6A 4OWXB 1N33L 2ASBA 1N32Q 5M5XH 4A3KH 2Q2TA 2RHSB 1C7YA 1D7QA 4O2DA 3RLOA 1EFWA 4FDBA 4DK6C 3PO3G 1YJ9A 2JA5H 3B6YA 4B3ML 4UPAA 4K0KQ 3AQQA 2PQAA 3PV0A 4JI0L 5IP9G 3Q8DA 4HJ9A 3I4OA 1YJNA 1PHJA 1VQFA 3HOWH 2JA8G 1DGSA 2YYZA 3S1NH 4NXML 4QJFA 3HFZB 1VCIA 3F2BA 3H3VH 4A3MG 3BZCA 2LXKA 1WYDA 1U0LA 2Y0SG 4C3JH 1C0AA 1BBWA 2FXQA 1RL2A 3U4VA 2E5LL 1XMOL 2HQLA 2VQFQ 1I5FA 3KDFA 4HIOA 2YU9H 4JV5Q 3PUVA 2R6GA 3HOXH 2IT1A 3FP9A 1K0RA 1YHQA 3HOWG 1HZ9A 1QZGA 3DM3A 2KCMA 2YTYA 1N33Q 2UUBQ 3CCQA 4HIMA 2NVTH 1EQRA 1L1OB 1NMGA 4P75A 4P72A 2B29A 5IWAL 3GTOH 3CP0A 2C35B 3ERSX 2F3IA 4B3MQ 2JA7G 4JI0Q 4JI2L 3HOXG 2Z6KA 4ME3A 3CQZH 4PZ6A 2PNHA 2VZAA 3L0OA 4HIKA 1Y1WH 4IJLA 4NXMQ 2QA4A 2CWPA 4B3TL 4A3JH 1HJPA 2NZOA 3OW2A 5C3EG 3UDGA 1NBWA 3CCMA 5IY0A 4KI0A 2VL6A 2E5LQ 3CCLA 1XMOQ 2UXCL 1OXSC 3M4QA 2DGYA 1P8LA 2N8NA 2OCEA 5IP7H 4DR5L 3JAMi 2BH8A 1PH3A 1YVCA 2NZHA 4A3BH 3UE0A 4A3GG 2K4KA 3BU2A 4DK3C 4LF9L 2UXDL 4A3JG 2VUMG 2EQSA 1EOVA 3HOYG 1BVSA 3S24A 2CKZB 5IWAQ 1VQ8A 4BBSH 1YZ6A 2KBNA 4QIWE 4JI2Q 1KAWA 3E9HA 4LUZA 5GAHC 4DR3L 3I4NH 2VW9A 2OQKA 5IP7G 3KJOA 1T9HA 3STBC 4A3BG 2PI2A 3M85A 4YHHL 2WP8J 4DV1L 1VQJA 2Z0SA 1SMXA 1PH6A 1VQIA 1PV4A 2A19A 3RLNA 1HNXL 3TQYA 1N36Q 1XNQL 1X3FA 3CMAA 3PUWA 2GN5A 3RR5A 1VQPA 2JJQA 3D0FA 1QVGA 2OWOA 1MIUA 2ATWA 2UXCQ 4X62Q 3I4NG 1VQ4A 1WOCA 3T1HL 1MKHA 4DR5Q 1WI5A 1WJJA 3CCSA 3TS2A 3W5OA 3PGZA 4IOCA 2UU9Q 4LF9Q 5GADC 2UXDQ 4ALPA 1OXVA 4DR2L 1PH9A 1BBUA 3MXNB 4RG1A 2HHHQ 3L7ZC 5M5WH 4LFBL 4DV7L 4MZ9A 5HY6A 1V1QA 1SN8A 1YBYA 1X55A 5GROA 4A4IA 2N49A 1K8AC 3CC7A 3RZOH 1Z9FA 3GD7A 5IYCG 1FGUA 4YHHQ 4O0AA 4DV1Q 4DV5L 4DV6L 1FJGL 1VQ6A 2ZTCA 3STBD 1E7ZA 3I7FA 1XNQQ 4QQBX 2PQAB 5H1SE 1E1TA 3J80i 1EIFA 3CPFA 2A8VA 2R7ZH 3M4OH 4A3DH 3T1HQ 4JBJA 2B63H 4DAMA 1Z47A 4JOIA 2UXBL 3GTKH 4IPCA 1SFOH 3W1BA 4DR7Q 1VQEA 1VS0A 2B3GA 2UUAQ 3CPWA 4X6AH 4POGA 3JC66 3M9BA 3E0EA 4GOPC 1PYBA 3KDFB 2ALYB 1NTGA 4YCWA 1IXRA 4DV7Q 1E24A 4X66L 4JV5L 3CW2C 1YJWA 4DR6L 3K7UC 1X56A 4GNXC 4DV5Q 4B3RQ 1L2FA 4JI6Q 4DV6Q 3ULLA 1NMFA 4QL5A 3GDEA 3J81j 3M4PA 5M3FG 2KHJA 1Q1EA 4AYBG 1I94L 2IX1A 3GTGH 4JI3Q 1VQOA 5LMNL 2UXBQ 2I5HA 3J81i 1A63A 5GAGC 1JT8A 1KD1C 1PH5A 3I55A 1UWVA 2KENA 5FLMH 4A3KG 1LM0A 1HZBA 1VQGA 1ASYA 4C2MH 1Q7YC 3OTOL 3I4MH 1VQCA 2HIVA 3ICEA 3TRZA 1WFQA 4A3CH 4L5RC 2JA5G 4BXXH 5FLXc 2K5VA 4X66Q 3GTJH 1GO3E 4BY7H 4A3EH 1YEZA 1OTCA 1HR0Q 4DR6Q 3CC2A 2ES2A 4P71A 4UP7A 4GLXA 1X3GA 1PA6A 3CCVA 3HKSA 5FLMG 3JAMc 1I6HH 1CSPA 3HKZE 1PH4A 4GOPB 1CKNA 4A3CG 1L0WA 1KHIA 3PIOA 1I94Q 4IOAA 4JI8L 1VQHA 3KJPA 3H0GH 5LMNQ 3CMEA 4BY7G 2PMZE 5IYBH 5E7NA 3TREA 1AE2A 2V1CC 1NE3A 2JK8A 3HKZG 3CCEA 3S1RH 4R4TA 4LF6L 3G4SA 3KF8B 4LW1A 4DV0L 2R93H 3KF6A 4GNXB 1IL2A 2AWNA 3A5ZB 4JC0A 3HOZH 3U58A 5DLQE 3OTOQ 1N36L 2RF4A 2VQEL 1Q86C 4DR4L 4X62L 1QVCA 4LWCA 4GN5A 5FJ8H 5IYBG 5BR8L 1GVPA 5M5YH 1KL9A 3J7ZC 1Y1WG 5C44H 2UU9L 4LF8Q 2ID0A 4WJ3M 4A93H 4DUYL 4JI4Q 4IFDG 4OO1G 3MEFA 2E2HH 4LF4L 1Q12A 2AKWB 1VQMA 2JEAI 3G48A 3PO2H 2WB1E 3F1ZA 2HHHL 3DLLA 4JI8Q 4HJ8A 2JA9A 1PH8A 2E2JH 4R4OA 4LF7L 3IRBA 4QGUA 1EWIA 3FKIH 1YIJA 2CWAA 1A0IA 4DR1L 3S15H 2CQOA 2ZJRA 4LF6Q 4DV0Q 3CF5A 2D0OA 5C44G 4GKKQ 2ZTEA 1KIXA 4A93G 4GS3A 1B8AA 2K14A 4BA1I 3H3VI 2OTJA 1TWFH 1SE8A 1X54A 1IZ6A 4BBSG 4OX9L 2VQEQ 5LMUL 1D8LA 1G6PA 4DR4Q 1A8VA 3BJUA 5M3MH 1QVFA 1JE5A 3NENA 5BR8Q 4RMFA 3J7A5 2I0QA 1TXYA 3FKIG 3J80c 1IBMQ 1IBKQ 1LUZA 1XMQL 4DR7L 3K0XA 1L1OA 2E8GA 1WCMH 3H15A 1AH9A 2UUAL 4DUYQ 4PZ7A 4IO9A 3TS0A 2MFIA 2HIXA 1C9OA 1JJ2A 4LF4Q 5JEAG 1G291 2Z6KC 1N8RC 1FVIA 1JJCB 2WFWA 2K75A 1KXLA 1UEBA 3OYYA 2UUCL 4LF7Q 1J5EL 3S17H 1PH7A 2K50A 2YV5A 4EQ5A 2NN6G 4XTCS 4DR1Q 3NBHB 2ZJQA 2BA0A 3HOVH 4XIGS 1VQ7A 4GLAC 4B3RL 4JI6L 4DV2L 3AYHB 2LXJA 1W3SA 3A74A 1M1KC 4IFDI 2MO0A 4POFA 3CC4A 5LMUQ 4APVA 2EIFA 5GAEC 1VQDA 4OX9Q 1JB7A 4IPHA 2R7DA 5AJ3Q 2DUDA 1CSQA 1GKHA 2BA1A 4JI3L 3RLFA 3HOVG 1UE1A 1BKBA 2BH2A 1XMQQ 1KC8C 4BBRH 1Q46A 2JEBI 5HGQA 3J81c 3F2DA 3AFPA 4C3HH 3GTLH 2LSSA 1MJEA 4GN4B 3CAMA 4B3SQ 4HJAA 2PI2E 1JJGA 1XJVA 3EN2A 1Q8KA 1QUQA 4UY8C 2F4VQ 1Y1VH 2R7ZG 4A3DG 1S40A 2UUCQ 1XNRL 2B63G 3ZJYC 1J5EQ 4OWWB 4JI7L 1KQSA 4AQYL 4P73A 4NXNL 1HR0L 3ULJA 3L2PA 2N3SA 3S2DH 4X64L 4DV2Q 1RIPA 3GTMH 1CKNB 4BY1H 3PIPA 2VNUD 4OXPA 1B70B 2R92H 1TWGH 4IPDA 1NY4A 1Y1VG 2K5HA 2RCNA 2IHFA 4JBWA 2KHIA 2A1AA 4PG3A 4A3LH 3KF6B 2NN6I 3S14H 1VQBA 1H95A 3D31A 2Q2UA 5K36G 2N78A 1YNXA 4JBKA 3PO3H 4TQUS 3KYHC 5LMNW 4JG2A 5IP9H 1QZHA 4Y7NH 3G71A 2CCZA 1A62A 2IX0A 4HJ7A 2R92G 2R7FA 2JA8H 4WJ4A 3LGJA 1OXTA 1VQ5A 4YWMA 4OWTB 1MJCA 4TVAB 1XNRQ 1X9NA 4JYAL 1OXUA 5IT9c 4A75A 1N34Q 4A3LG 2MO1A 4JI7Q 4A3MH 2XTIA 5ELNA 1UE7A 2CFMA 2D0PA 1G51A 4AQYQ 1VQ9A 4NXNQ 2IY5B 1P16A 2QEXA 4X64Q 1PH1A 5JEAJ 4LF8L 4JI4L 1HNZL 2GVAA 3I4MG 2Q2HA 2Y0SE 3FHWA 3NEMA 4Y52H 3UDIA 3PUZA 4JOIC 4DAYB 4BXXG 5C0XG 1K8GA 2VS1A 1YI2A 3NELA 2HT1A 1E22A 1HH2P 2JA6H 1TWAH 4R4CA 4A3EG 3G6EA 3A0JA 2AMCB 3I2ZA 2D62A 2I5MX 4UP8A 4YWLA 4J15A 4JCVE 1GD7A 4GKKL 1CKMA 2K5NA 2JA7H 4LUOA 1V43A 1IBLL 2IHEA 1JMCA 3UDXA 4DV4L 4DV3L 3VDYA 4L5SA 2OQ0A 2WAQE 4JI1L 2ZJPA 3H0GG 4LFAL 2JA6G 4YCUA 2K52A 4DNIA 4JBMA 2Q2IA 3S16H 4JYAQ 5C3EH 4A3IH 4L5QA 4YCVA 4X65L 4MTNA 1IBML 1IBKL 2R93G 5IYDH 2WAQG 1EIYB 1IYJB 4HIDA 3HOZG 3PUYA 1HNZQ 3PCOB 1SROA 5IE8A 2JQOA 4A3FH 4DKAC 2YTVA 1HZAA 1CUKA 4A3GH 2RHQB 3AEVA 5FJ8G 2VUMH 3E9IA 2VY3A 3W1GA 1B7YB 4A3IG 3HOYH 3KOJA 3PF5A 1VQKA 1KRSA 1O7IA 2JE6I 1KRTA 4R4IA 5IYDG 3I56A 2WB1G 2H5XA 2E2IH 2I5LX 4GKJL 3F8TA 5J3BA 4OONA 1IBLQ 2NVQH 1EQQA 1TWHH 4LUVA 1J6QA 1E3PA 2MNAA 4DV3Q 4DV4Q 4A3FG 1CKOA 1E1OA 3PO2G 4JI1Q 5C0XI 3K7AH 3PUXA 4GLVB 4LFAQ 4DUZL 1ASZA 5AJ3L 3WWVA 3CD6A 4BA2I 1HNWL 2AWOA 3M3YH 1W2BA 4GN3B 3U50C 4X65Q 4H02A 4MNOA 3EIVA 2NVYH 1PFSA 1N9WA 4EX5A 1SLJA 1Q82C 3UDFA 3CXCA 4GOPA 4HJ5A 3RN2A 3GTPH 3S2HH 3TEHB 4LFCL 1QUQB 2GVBA 4R1JA 2NVXH 3PSIA 4B3SL 3K81C 1YHAA 1EYGA 2F4VL 2MQHA 5M3MG 4DPGA 3CCRA 4B3TQ 3T1YL 4YY3L 3HOUH 3K80C 1LTLA 3EBEA 4GNXA 1Q81C 3S1MH 3GO5A 2ZM6L 1S3OA 3RNUA 3CCUA 5ELOA 4JI5L 4GKJQ 1HZCA 1WCMG 2L15A 4L5TA 4YWKA 4KLKA 3KLWA 3ULPA 2EXDA 2ZTDA 4AIMA 5C0XJ 4LF5L 4OO1I 1PH2A 1AE3A 4PZ8A 2KCTA 2YTXA 5JJKA 1K3RA 1UE5A 1X6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC H;  4DUZ Q;  3CCJ A;  1HNW Q;  4NPS A;  1K9M C;  3HOU G;  4PMW A;  2OTL A;  1VQL A;  3AFQ A;  5JJI A;  5GQO A;  1YHB A;  1VQA A;  4DR3 Q;  4IPG A;  4LFC Q;  4KHP L;  3ER0 A;  3PF4 A;  2F52 A;  1Q1B A;  5EAY A;  1YIT A;  3UE1 A;  3A5U A;  4YY3 Q;  3T1Y Q;  1GM5 A;  1VQN A;  3S1Q H;  1N32 L;  1K83 H;  1N34 L;  1HNX Q;  2ZM6 Q;  4A76 A;  4JI5 Q;  4BBR G;  4IFD J;  2QGQ A;  4C3I H;  1PYS B;  1K73 C;  3K8A A;  1R9T H;  4K0K L;  3RN5 A;  1OXX K;  4LF5 Q;  1EUJ A;  1FL0 A;  1SRU A;  1UE6 A;  4KHZ A;  1HR0 W;  5C4X H;  1Y14 B;  3F2C A;  1X65 A;  3RZD H;  4IJH A;  3U4Z A;  3GTQ H;  3BZK A;  3M7N A;  1M90 C;  1XPO A;  1PVO A;  1I50 H;  1L1O C;  4P74 A;  2XGT A;  3SGI A;  4NB3 A;  5C4J H;  1LYL A;  4UP9 A;  4DR2 Q;  5M3F H;  5JJL A;  4LFB Q;  2VQF L;  1S72 A;  1XTD A;  1V9P A;  2AHO B;  4BY1 G;  4KHP Q;  4LNQ A;  1I3Q H;  1SR3 A;  1NJI C;  4QY7 A;  1XPR A;  1X3E A;  1U5K A;  4AYB E;  3KFU A;  5C4X G;  1XPU A;  4R4Q A;  1TWC H;  1FJG Q;  2UUB L;  4AH6 A;  4OWX B;  1N33 L;  2ASB A;  1N32 Q;  5M5X H;  4A3K H;  2Q2T A;  2RHS B;  1C7Y A;  1D7Q A;  4O2D A;  3RLO A;  1EFW A;  4FDB A;  4DK6 C;  3PO3 G;  1YJ9 A;  2JA5 H;  3B6Y A;  4B3M L;  4UPA A;  4K0K Q;  3AQQ A;  2PQA A;  3PV0 A;  4JI0 L;  5IP9 G;  3Q8D A;  4HJ9 A;  3I4O A;  1YJN A;  1PHJ A;  1VQF A;  3HOW H;  2JA8 G;  1DGS A;  2YYZ A;  3S1N H;  4NXM L;  4QJF A;  3HFZ B;  1VCI A;  3F2B A;  3H3V H;  4A3M G;  3BZC A;  2LXK A;  1WYD A;  1U0L A;  2Y0S G;  4C3J H;  1C0A A;  1BBW A;  2FXQ A;  1RL2 A;  3U4V A;  2E5L L;  1XMO L;  2HQL A;  2VQF Q;  1I5F A;  3KDF A;  4HIO A;  2YU9 H;  4JV5 Q;  3PUV A;  2R6G A;  3HOX H;  2IT1 A;  3FP9 A;  1K0R A;  1YHQ A;  3HOW G;  1HZ9 A;  1QZG A;  3DM3 A;  2KCM A;  2YTY A;  1N33 Q;  2UUB Q;  3CCQ A;  4HIM A;  2NVT H;  1EQR A;  1L1O B;  1NMG A;  4P75 A;  4P72 A;  2B29 A;  5IWA L;  3GTO H;  3CP0 A;  2C35 B;  3ERS X;  2F3I A;  4B3M Q;  2JA7 G;  4JI0 Q;  4JI2 L;  3HOX G;  2Z6K A;  4ME3 A;  3CQZ H;  4PZ6 A;  2PNH A;  2VZA A;  3L0O A;  4HIK A;  1Y1W H;  4IJL A;  4NXM Q;  2QA4 A;  2CWP A;  4B3T L;  4A3J H;  1HJP A;  2NZO A;  3OW2 A;  5C3E G;  3UDG A;  1NBW A;  3CCM A;  5IY0 A;  4KI0 A;  2VL6 A;  2E5L Q;  3CCL A;  1XMO Q;  2UXC L;  1OXS C;  3M4Q A;  2DGY A;  1P8L A;  2N8N A;  2OCE A;  5IP7 H;  4DR5 L;  3JAM i;  2BH8 A;  1PH3 A;  1YVC A;  2NZH A;  4A3B H;  3UE0 A;  4A3G G;  2K4K A;  3BU2 A;  4DK3 C;  4LF9 L;  2UXD L;  4A3J G;  2VUM G;  2EQS A;  1EOV A;  3HOY G;  1BVS A;  3S24 A;  2CKZ B;  5IWA Q;  1VQ8 A;  4BBS H;  1YZ6 A;  2KBN A;  4QIW E;  4JI2 Q;  1KAW A;  3E9H A;  4LUZ A;  5GAH C;  4DR3 L;  3I4N H;  2VW9 A;  2OQK A;  5IP7 G;  3KJO A;  1T9H A;  3STB C;  4A3B G;  2PI2 A;  3M85 A;  4YHH L;  2WP8 J;  4DV1 L;  1VQJ A;  2Z0S A;  1SMX A;  1PH6 A;  1VQI A;  1PV4 A;  2A19 A;  3RLN A;  1HNX L;  3TQY A;  1N36 Q;  1XNQ L;  1X3F A;  3CMA A;  3PUW A;  2GN5 A;  3RR5 A;  1VQP A;  2JJQ A;  3D0F A;  1QVG A;  2OWO A;  1MIU A;  2ATW A;  2UXC Q;  4X62 Q;  3I4N G;  1VQ4 A;  1WOC A;  3T1H L;  1MKH A;  4DR5 Q;  1WI5 A;  1WJJ A;  3CCS A;  3TS2 A;  3W5O A;  3PGZ A;  4IOC A;  2UU9 Q;  4LF9 Q;  5GAD C;  2UXD Q;  4ALP A;  1OXV A;  4DR2 L;  1PH9 A;  1BBU A;  3MXN B;  4RG1 A;  2HHH Q;  3L7Z C;  5M5W H;  4LFB L;  4DV7 L;  4MZ9 A;  5HY6 A;  1V1Q A;  1SN8 A;  1YBY A;  1X55 A;  5GRO A;  4A4I A;  2N49 A;  1K8A C;  3CC7 A;  3RZO H;  1Z9F A;  3GD7 A;  5IYC G;  1FGU A;  4YHH Q;  4O0A A;  4DV1 Q;  4DV5 L;  4DV6 L;  1FJG L;  1VQ6 A;  2ZTC A;  3STB D;  1E7Z A;  3I7F A;  1XNQ Q;  4QQB X;  2PQA B;  5H1S E;  1E1T A;  3J80 i;  1EIF A;  3CPF A;  2A8V A;  2R7Z H;  3M4O H;  4A3D H;  3T1H Q;  4JBJ A;  2B63 H;  4DAM A;  1Z47 A;  4JOI A;  2UXB L;  3GTK H;  4IPC A;  1SFO H;  3W1B A;  4DR7 Q;  1VQE A;  1VS0 A;  2B3G A;  2UUA Q;  3CPW A;  4X6A H;  4POG A;  3JC6 6;  3M9B A;  3E0E A;  4GOP C;  1PYB A;  3KDF B;  2ALY B;  1NTG A;  4YCW A;  1IXR A;  4DV7 Q;  1E24 A;  4X66 L;  4JV5 L;  3CW2 C;  1YJW A;  4DR6 L;  3K7U C;  1X56 A;  4GNX C;  4DV5 Q;  4B3R Q;  1L2F A;  4JI6 Q;  4DV6 Q;  3ULL A;  1NMF A;  4QL5 A;  3GDE A;  3J81 j;  3M4P A;  5M3F G;  2KHJ A;  1Q1E A;  4AYB G;  1I94 L;  2IX1 A;  3GTG H;  4JI3 Q;  1VQO A;  5LMN L;  2UXB Q;  2I5H A;  3J81 i;  1A63 A;  5GAG C;  1JT8 A;  1KD1 C;  1PH5 A;  3I55 A;  1UWV A;  2KEN A;  5FLM H;  4A3K G;  1LM0 A;  1HZB A;  1VQG A;  1ASY A;  4C2M H;  1Q7Y C;  3OTO L;  3I4M H;  1VQC A;  2HIV A;  3ICE A;  3TRZ A;  1WFQ A;  4A3C H;  4L5R C;  2JA5 G;  4BXX H;  5FLX c;  2K5V A;  4X66 Q;  3GTJ H;  1GO3 E;  4BY7 H;  4A3E H;  1YEZ A;  1OTC A;  1HR0 Q;  4DR6 Q;  3CC2 A;  2ES2 A;  4P71 A;  4UP7 A;  4GLX A;  1X3G A;  1PA6 A;  3CCV A;  3HKS A;  5FLM G;  3JAM c;  1I6H H;  1CSP A;  3HKZ E;  1PH4 A;  4GOP B;  1CKN A;  4A3C G;  1L0W A;  1KHI A;  3PIO A;  1I94 Q;  4IOA A;  4JI8 L;  1VQH A;  3KJP A;  3H0G H;  5LMN Q;  3CME A;  4BY7 G;  2PMZ E;  5IYB H;  5E7N A;  3TRE A;  1AE2 A;  2V1C C;  1NE3 A;  2JK8 A;  3HKZ G;  3CCE A;  3S1R H;  4R4T A;  4LF6 L;  3G4S A;  3KF8 B;  4LW1 A;  4DV0 L;  2R93 H;  3KF6 A;  4GNX B;  1IL2 A;  2AWN A;  3A5Z B;  4JC0 A;  3HOZ H;  3U58 A;  5DLQ E;  3OTO Q;  1N36 L;  2RF4 A;  2VQE L;  1Q86 C;  4DR4 L;  4X62 L;  1QVC A;  4LWC A;  4GN5 A;  5FJ8 H;  5IYB G;  5BR8 L;  1GVP A;  5M5Y H;  1KL9 A;  3J7Z C;  1Y1W G;  5C44 H;  2UU9 L;  4LF8 Q;  2ID0 A;  4WJ3 M;  4A93 H;  4DUY L;  4JI4 Q;  4IFD G;  4OO1 G;  3MEF A;  2E2H H;  4LF4 L;  1Q12 A;  2AKW B;  1VQM A;  2JEA I;  3G48 A;  3PO2 H;  2WB1 E;  3F1Z A;  2HHH L;  3DLL A;  4JI8 Q;  4HJ8 A;  2JA9 A;  1PH8 A;  2E2J H;  4R4O A;  4LF7 L;  3IRB A;  4QGU A;  1EWI A;  3FKI H;  1YIJ A;  2CWA A;  1A0I A;  4DR1 L;  3S15 H;  2CQO A;  2ZJR A;  4LF6 Q;  4DV0 Q;  3CF5 A;  2D0O A;  5C44 G;  4GKK Q;  2ZTE A;  1KIX A;  4A93 G;  4GS3 A;  1B8A A;  2K14 A;  4BA1 I;  3H3V I;  2OTJ A;  1TWF H;  1SE8 A;  1X54 A;  1IZ6 A;  4BBS G;  4OX9 L;  2VQE Q;  5LMU L;  1D8L A;  1G6P A;  4DR4 Q;  1A8V A;  3BJU A;  5M3M H;  1QVF A;  1JE5 A;  3NEN A;  5BR8 Q;  4RMF A;  3J7A 5;  2I0Q A;  1TXY A;  3FKI G;  3J80 c;  1IBM Q;  1IBK Q;  1LUZ A;  1XMQ L;  4DR7 L;  3K0X A;  1L1O A;  2E8G A;  1WCM H;  3H15 A;  1AH9 A;  2UUA L;  4DUY Q;  4PZ7 A;  4IO9 A;  3TS0 A;  2MFI A;  2HIX A;  1C9O A;  1JJ2 A;  4LF4 Q;  5JEA G;  1G29 1;  2Z6K C;  1N8R C;  1FVI A;  1JJC B;  2WFW A;  2K75 A;  1KXL A;  1UEB A;  3OYY A;  2UUC L;  4LF7 Q;  1J5E L;  3S17 H;  1PH7 A;  2K50 A;  2YV5 A;  4EQ5 A;  2NN6 G;  4XTC S;  4DR1 Q;  3NBH B;  2ZJQ A;  2BA0 A;  3HOV H;  4XIG S;  1VQ7 A;  4GLA C;  4B3R L;  4JI6 L;  4DV2 L;  3AYH B;  2LXJ A;  1W3S A;  3A74 A;  1M1K C;  4IFD I;  2MO0 A;  4POF A;  3CC4 A;  5LMU Q;  4APV A;  2EIF A;  5GAE C;  1VQD A;  4OX9 Q;  1JB7 A;  4IPH A;  2R7D A;  5AJ3 Q;  2DUD A;  1CSQ A;  1GKH A;  2BA1 A;  4JI3 L;  3RLF A;  3HOV G;  1UE1 A;  1BKB A;  2BH2 A;  1XMQ Q;  1KC8 C;  4BBR H;  1Q46 A;  2JEB I;  5HGQ A;  3J81 c;  3F2D A;  3AFP A;  4C3H H;  3GTL H;  2LSS A;  1MJE A;  4GN4 B;  3CAM A;  4B3S Q;  4HJA A;  2PI2 E;  1JJG A;  1XJV A;  3EN2 A;  1Q8K A;  1QUQ A;  4UY8 C;  2F4V Q;  1Y1V H;  2R7Z G;  4A3D G;  1S40 A;  2UUC Q;  1XNR L;  2B63 G;  3ZJY C;  1J5E Q;  4OWW B;  4JI7 L;  1KQS A;  4AQY L;  4P73 A;  4NXN L;  1HR0 L;  3ULJ A;  3L2P A;  2N3S A;  3S2D H;  4X64 L;  4DV2 Q;  1RIP A;  3GTM H;  1CKN B;  4BY1 H;  3PIP A;  2VNU D;  4OXP A;  1B70 B;  2R92 H;  1TWG H;  4IPD A;  1NY4 A;  1Y1V G;  2K5H A;  2RCN A;  2IHF A;  4JBW A;  2KHI A;  2A1A A;  4PG3 A;  4A3L H;  3KF6 B;  2NN6 I;  3S14 H;  1VQB A;  1H95 A;  3D31 A;  2Q2U A;  5K36 G;  2N78 A;  1YNX A;  4JBK A;  3PO3 H;  4TQU S;  3KYH C;  5LMN W;  4JG2 A;  5IP9 H;  1QZH A;  4Y7N H;  3G71 A;  2CCZ A;  1A62 A;  2IX0 A;  4HJ7 A;  2R92 G;  2R7F A;  2JA8 H;  4WJ4 A;  3LGJ A;  1OXT A;  1VQ5 A;  4YWM A;  4OWT B;  1MJC A;  4TVA B;  1XNR Q;  1X9N A;  4JYA L;  1OXU A;  5IT9 c;  4A75 A;  1N34 Q;  4A3L G;  2MO1 A;  4JI7 Q;  4A3M H;  2XTI A;  5ELN A;  1UE7 A;  2CFM A;  2D0P A;  1G51 A;  4AQY Q;  1VQ9 A;  4NXN Q;  2IY5 B;  1P16 A;  2QEX A;  4X64 Q;  1PH1 A;  5JEA J;  4LF8 L;  4JI4 L;  1HNZ L;  2GVA A;  3I4M G;  2Q2H A;  2Y0S E;  3FHW A;  3NEM A;  4Y52 H;  3UDI A;  3PUZ A;  4JOI C;  4DAY B;  4BXX G;  5C0X G;  1K8G A;  2VS1 A;  1YI2 A;  3NEL A;  2HT1 A;  1E22 A;  1HH2 P;  2JA6 H;  1TWA H;  4R4C A;  4A3E G;  3G6E A;  3A0J A;  2AMC B;  3I2Z A;  2D62 A;  2I5M X;  4UP8 A;  4YWL A;  4J15 A;  4JCV E;  1GD7 A;  4GKK L;  1CKM A;  2K5N A;  2JA7 H;  4LUO A;  1V43 A;  1IBL L;  2IHE A;  1JMC A;  3UDX A;  4DV4 L;  4DV3 L;  3VDY A;  4L5S A;  2OQ0 A;  2WAQ E;  4JI1 L;  2ZJP A;  3H0G G;  4LFA L;  2JA6 G;  4YCU A;  2K52 A;  4DNI A;  4JBM A;  2Q2I A;  3S16 H;  4JYA Q;  5C3E H;  4A3I H;  4L5Q A;  4YCV A;  4X65 L;  4MTN A;  1IBM L;  1IBK L;  2R93 G;  5IYD H;  2WAQ G;  1EIY B;  1IYJ B;  4HID A;  3HOZ G;  3PUY A;  1HNZ Q;  3PCO B;  1SRO A;  5IE8 A;  2JQO A;  4A3F H;  4DKA C;  2YTV A;  1HZA A;  1CUK A;  4A3G H;  2RHQ B;  3AEV A;  5FJ8 G;  2VUM H;  3E9I A;  2VY3 A;  3W1G A;  1B7Y B;  4A3I G;  3HOY H;  3KOJ A;  3PF5 A;  1VQK A;  1KRS A;  1O7I A;  2JE6 I;  1KRT A;  4R4I A;  5IYD G;  3I56 A;  2WB1 G;  2H5X A;  2E2I H;  2I5L X;  4GKJ L;  3F8T A;  5J3B A;  4OON A;  1IBL Q;  2NVQ H;  1EQQ A;  1TWH H;  4LUV A;  1J6Q A;  1E3P A;  2MNA A;  4DV3 Q;  4DV4 Q;  4A3F G;  1CKO A;  1E1O A;  3PO2 G;  4JI1 Q;  5C0X I;  3K7A H;  3PUX A;  4GLV B;  4LFA Q;  4DUZ L;  1ASZ A;  5AJ3 L;  3WWV A;  3CD6 A;  4BA2 I;  1HNW L;  2AWO A;  3M3Y H;  1W2B A;  4GN3 B;  3U50 C;  4X65 Q;  4H02 A;  4MNO A;  3EIV A;  2NVY H;  1PFS A;  1N9W A;  4EX5 A;  1SLJ A;  1Q82 C;  3UDF A;  3CXC A;  4GOP A;  4HJ5 A;  3RN2 A;  3GTP H;  3S2H H;  3TEH B;  4LFC L;  1QUQ B;  2GVB A;  4R1J A;  2NVX H;  3PSI A;  4B3S L;  3K81 C;  1YHA A;  1EYG A;  2F4V L;  2MQH A;  5M3M G;  4DPG A;  3CCR A;  4B3T Q;  3T1Y L;  4YY3 L;  3HOU H;  3K80 C;  1LTL A;  3EBE A;  4GNX A;  1Q81 C;  3S1M H;  3GO5 A;  2ZM6 L;  1S3O A;  3RNU A;  3CCU A;  5ELO A;  4JI5 L;  4GKJ Q;  1HZC A;  1WCM G;  2L15 A;  4L5T A;  4YWK A;  4KLK A;  3KLW A;  3ULP A;  2EXD A;  2ZTD A;  4AIM A;  5C0X J;  4LF5 L;  4OO1 I;  1PH2 A;  1AE3 A;  4PZ8 A;  2KCT A;  2YTX A;  5JJK A;  1K3R A;  1UE5 A;  1X6O A; 
#chains in the Genus database with same CATH topology
 3CCJ A;  1HNW Q;  1K9M C;  3HOU G;  2WIN B;  1H9K A;  5KRU A;  3RD4 A;  5GQO A;  3CU7 A;  1YHB A;  5G3L F;  4LFC Q;  3EVQ A;  3ER0 A;  1Y1W B;  2F0Q A;  2F0N A;  3OW7 A;  1ESF A;  4A3J B;  1MBY A;  2F52 A;  1WTQ A;  4C3I H;  2IW3 A;  4K0K L;  2LFN A;  1NUC A;  5DNF A;  4A3B B;  3WOF A;  3K7A B;  1HR0 W;  1Y14 B;  3F2C A;  1LTS D;  2B8G A;  1XPO A;  1L1O C;  4P74 A;  3DUZ A;  5C4J H;  3SGI A;  1T5E A;  1H9M A;  4GZY C;  1LYL A;  5M3F H;  4LFB Q;  2VQF L;  1S72 A;  5LL6 S;  1VF7 A;  1I3Q H;  4LNQ A;  3K59 A;  4K5X A;  3D6W A;  1TWC H;  2UUB L;  4OWX B;  4A3K H;  4IUT A;  1D7Q A;  1QB5 D;  1YJ9 A;  4UPA A;  4ZRZ A;  3AQQ A;  1STA A;  1BBX C;  3I4O A;  5IGB A;  1VQF A;  2JA8 G;  1SNM A;  2YYZ A;  2EJG C;  4NXM L;  3SK4 A;  3F2B A;  2F0M A;  3E0J A;  2Y0S G;  1EWH A;  5JPM C;  1CM9 A;  3U4V A;  5J39 A;  1XMO L;  5JVG 3;  1PFN A;  3KDF A;  2YU9 H;  4KTA A;  2RQX A;  1YHQ A;  3HOW G;  5C5L A;  1CI3 M;  1QZG A;  1N33 Q;  2NVT H;  4A3D B;  3SDZ A;  4BWG B;  1SFO B;  1V1P A;  2Z6K A;  2F3V A;  1ILQ A;  2VZA A;  4HIK A;  2QA4 A;  2VB2 X;  3OW2 A;  4IFD H;  1EL0 A;  2IL8 A;  4E6I A;  3UDG A;  3CCM A;  4DK1 A;  4KI0 A;  2E5L Q;  3CCL A;  1I3Q B;  4G7H C;  3N52 A;  4DR5 L;  2BH8 A;  5JAV A;  4A3K B;  4A3G G;  2F0O A;  3BU2 A;  4ME5 A;  4LF9 L;  2UXD L;  2Z8L A;  2EQS A;  4DF7 A;  3GTG B;  2KBN A;  4QIW E;  1KAW A;  3E9H A;  4LUZ A;  5GAH C;  4DR3 L;  2K6A A;  1T9H A;  1HQR D;  2RSN A;  3P7J A;  3W3A A;  4C2M B;  1VQI A;  3KF8 A;  1FYC A;  3RLN A;  3TQY A;  1XNQ L;  1X3F A;  2ZXR A;  3CMA A;  1ET6 A;  2QDB A;  2UXC Q;  1MIU A;  4HTH A;  2DY8 A;  1KNA A;  2KEC A;  4OIJ A;  3TS2 A;  5FLX E;  3PGZ A;  2RSO A;  1I6H B;  1OXV A;  2F0L A;  1BBU A;  3MXN B;  2F0E A;  4RG1 A;  5M5W H;  4U67 3;  1X55 A;  4TKO B;  2N49 A;  2GA4 B;  3RZO H;  3DEO A;  3GD7 A;  5IYC G;  2L9H A;  4DV1 Q;  3L9A X;  2RCF A;  2OT2 A;  2B2U C;  2PQA B;  1JB3 A;  2F0H A;  1E1T A;  1ML0 D;  3CPF A;  5M5Y B;  2B63 H;  5ELB A;  1ET9 A;  2RBM A;  4XT1 B;  2UXB L;  4IPC A;  2TSS A;  2Z9H A;  2B3G A;  2UUA Q;  1JWU D;  3L3O C;  2TMP A;  1TS2 A;  1RTN A;  1PYB A;  2L11 A;  4YCW A;  4DXG A;  2K05 A;  4DV7 Q;  1V8Q A;  1WTP A;  2A68 C;  1LTB D;  5EPK A;  1X56 A;  5K36 H;  5C4H A;  3ULL A;  2QF7 A;  3J7A V;  2KHJ A;  1Q1E A;  1E2V A;  2B39 A;  1VQO A;  5GAG C;  5D3I B;  3I70 A;  1AFP A;  1SE3 A;  2RDH A;  5CR3 A;  3OTO L;  2HIV A;  3ICE A;  4A3C H;  5C0X H;  1EEF D;  1Y69 U;  2K5V A;  3HOV B;  4QMG A;  1GO3 E;  1IHZ A;  3RZO B;  3SEB A;  3QOL A;  4UP7 A;  4C1N I;  3T53 B;  5FLM G;  5I9O A;  3HP3 A;  2K5W A;  5NUC A;  1HTL D;  3PIO A;  1G2S A;  3MC0 B;  5LHY 1;  4LJZ C;  3H0G H;  3A7L A;  2C9O A;  3SXH A;  3S1R H;  3GTL B;  4LF6 L;  1TY2 A;  1BUV T;  1SYF A;  3BDL A;  4GNX B;  1HFN A;  4KKT A;  2HUG A;  2K03 A;  2AWN A;  4F87 A;  5DLQ E;  5I4D A;  4M1U B;  1N36 L;  1Q86 C;  1WVL A;  3A8J E;  1MSH A;  5IYB G;  1YNN D;  1KL9 A;  3J7Z C;  1Y1W G;  1STG A;  1I4Q A;  4HMJ A;  1BCP F;  5TSS A;  4LF4 L;  1SJH D;  2WB1 E;  4RAU C;  2IJ0 A;  2JA9 A;  2E2J H;  3S14 B;  3IRB A;  1ZYR D;  4JK1 C;  2L0C A;  4DR1 L;  3PO3 B;  2ZJR A;  3TME A;  2D0O A;  4A93 G;  2CW0 C;  4I7Z C;  2M2L A;  3FPP A;  4BA1 I;  4WFN 3;  1U4R A;  3ZYY X;  4FXG C;  4BBS G;  1LTI D;  2EY6 A;  2VQE Q;  1D8L A;  1G6P A;  3BZD B;  5M3M H;  3LWU A;  2B2T A;  5KYL A;  4RMF A;  1TXY A;  3FKI G;  3J80 c;  4DR7 L;  5T1G A;  5I2Y A;  2AQ3 B;  2EOT A;  3BDC A;  2MFI A;  5KEE A;  4IO9 A;  1W6J A;  2FFK B;  2HIX A;  1C9O A;  1JJ2 A;  5JEA G;  1G29 1;  2Z6K C;  2OF1 A;  3H0G B;  3M7G A;  2JA6 B;  1TWA B;  2WFW A;  3DEP A;  2PZU A;  1UEB A;  1KXL A;  2SOB A;  3KLS A;  5EPL A;  1SNP A;  2NN6 G;  4DFA A;  2BA0 A;  2WAQ B;  4JPB W;  4GLA C;  4B3R L;  2F1M A;  2EDG A;  3A74 A;  3ITP A;  1HUM A;  4POF A;  1BR9 A;  4APV A;  2RDG A;  3UI2 A;  3MZ5 A;  2R7D A;  5C3E B;  2K33 A;  3RLF A;  1UNS A;  1UE1 A;  3GV3 A;  2BH2 A;  1HFG A;  2B8F A;  4WJW A;  1KC8 C;  1Q46 A;  3AFP A;  1B1Z A;  5A35 A;  4HJA A;  1M4V A;  4A3D G;  1Y1V H;  2PW7 A;  3HOY B;  3P1H A;  1CA5 A;  2ICI A;  1J5E Q;  3SVM A;  1KQS A;  4AQY L;  4NXN L;  1HR0 L;  3L2P A;  3S2D H;  4X64 L;  1CKN B;  1X32 A;  4F8M A;  5CBE E;  4CDC C;  3NTK A;  1B70 B;  2R92 H;  4H7B A;  5KNC A;  4B08 A;  1PTO C;  2J7Z A;  2K5H A;  1A2T A;  5JJZ A;  1LTA D;  1RCV D;  3HGB A;  3NQI A;  5CMD A;  2Q2U A;  1KDC A;  5EQ0 A;  4KD4 A;  4KY6 A;  3KYH C;  4JG2 A;  1SEB D;  1II3 A;  2IX0 A;  3NWS A;  2R7F A;  2A6E D;  2JA8 H;  4WJ4 A;  3V96 A;  1NCV A;  3HOU B;  4YWM A;  2ZXO A;  4TVA B;  3TZD A;  1JWM D;  2D0P A;  1VQ9 A;  1EY8 A;  1P16 A;  4R9W A;  4BS9 A;  4EQO A;  5JEA J;  1O7L A;  1ZKO A;  1WTX A;  1HNZ L;  4JI4 L;  2Q2H A;  3FHW A;  3UDI A;  4DAY B;  4DGZ A;  1G8Z D;  1K8G A;  5BN5 A;  1JIC A;  2NYZ D;  2AMC B;  1SXT A;  1RD9 D;  4UP8 A;  2OEO A;  4YWL A;  4K8I A;  4GKK L;  3W2D A;  4DAV A;  2K5N A;  3DXJ C;  4LUO A;  4RH6 A;  2IHE A;  3H3V C;  3VDY A;  1LT6 D;  4L5S A;  3D4W A;  1EQV A;  4LFA L;  3S16 H;  2K52 A;  2G9H D;  2KA7 A;  4YCV A;  4X65 L;  1QOH A;  1IBM L;  1STN A;  2R93 G;  1CQF A;  1EIY B;  2MHV A;  2K01 A;  3PCO B;  3T56 B;  1X3P A;  3OWE B;  2D5D A;  3FVQ A;  2JQO A;  4DKA C;  2YTV A;  4A3F H;  1HZA A;  4HMI A;  5D14 A;  4IN3 A;  2RHQ B;  3URY A;  4A3G H;  5CBA E;  3AEV A;  5FJ8 G;  3PF5 A;  1VQK A;  3I56 A;  5IYD G;  4R4I A;  4CGY B;  4K2L A;  2NVQ H;  1TWH H;  4XT3 B;  2XSC A;  4DV3 Q;  4DV4 Q;  1E1O A;  1EY7 A;  4JI1 Q;  5M5X B;  3PUX A;  4DUZ L;  2Y0S B;  3TDQ A;  1W2B A;  2F0P A;  2JA5 B;  4IUN A;  3U50 C;  4QUF A;  3GTM H;  1SMY D;  2NVY H;  4XQJ A;  4HJ5 A;  1DCZ A;  1LT5 D;  3RN2 A;  3GTP H;  3HOW B;  3S2H H;  3TEH B;  2GVB A;  3K81 C;  2WV6 D;  4HR7 B;  2MQH A;  2DN8 A;  4DPG A;  2M9V A;  3T1Y L;  4FYD A;  3EBE A;  1IL8 A;  2VXW A;  4GNX A;  1Q81 C;  3RNU A;  1HZC A;  3BYY B;  3KUP A;  3ULP A;  4AIM A;  2ZTD A;  4LF5 L;  4OO1 I;  4C56 C;  2KCT A;  2E74 C;  1X6O A;  1UE5 A;  1HA5 A;  1PDQ A;  3S16 B;  4DNT B;  5IYC H;  3T4A C;  3I73 A;  1VQL A;  4X3T A;  5JJI A;  4K5W A;  5DM7 3;  5I6Y A;  5JPN C;  1HRJ A;  4DR3 Q;  2QIL A;  3A7A B;  1FNV A;  4ZAI A;  4A3G B;  1YIT A;  3UE1 A;  3A5U A;  3S1Q H;  2ZM6 Q;  4A76 A;  4JI5 Q;  4IFD J;  1WD0 A;  3BVZ A;  1B44 D;  1R9T H;  3C3L A;  4ZUI A;  3RN5 A;  4LAA A;  1EUJ A;  1SRU A;  2E76 C;  4IJH A;  3U4Z A;  3BZK A;  3S9W A;  1I50 H;  1D5X C;  2XGT A;  2NVY B;  4OGQ C;  3NXW A;  3GTP B;  5JJL A;  1XTD A;  1V9P A;  2AHO B;  2O5I C;  4KHP Q;  5CYU A;  1SE4 A;  5JVH 3;  1IW7 D;  5C4X G;  1X3E A;  1U5K A;  1IKL A;  4AYB E;  3KFU A;  2RVL A;  1S5F D;  3EA6 A;  1N32 Q;  2RHS B;  4O2D A;  3RLO A;  4FDB A;  3PO3 G;  3B6Y A;  4B3M L;  4JI0 L;  3Q8D A;  4ZQ3 A;  1YJN A;  1DGS A;  2XN9 C;  3S1N H;  2FMM A;  3H3V H;  2A6H D;  3BZC A;  1C0A A;  1NR2 A;  1O80 A;  2FXQ A;  4RWS C;  5IIF A;  5M9O A;  2HQL A;  3PUV A;  3HOX H;  4QF4 A;  1BCP D;  3FDT A;  4G57 A;  2YTY A;  3V2T A;  1DON A;  4CHT B;  1SE2 A;  4CJ2 C;  4ABN A;  2PZW A;  5IWA L;  3CP0 A;  1G6Z A;  2F3I A;  3IAY A;  3MXP A;  1D1K A;  4JI2 L;  3ONA B;  1BCP B;  4ME3 A;  1B4O A;  5E4W C;  4QUC A;  1RJT A;  3L0O A;  2SNM A;  1Y1W H;  4A3J H;  2XVS A;  5C3E G;  5IY0 A;  2VL6 A;  4XQQ A;  3TBI B;  1PZK D;  4QCL A;  1P8L A;  1M8A A;  2OCE A;  5IP7 H;  4A3B H;  3TP8 A;  2K4K A;  5COY A;  4DK3 C;  3DWA A;  5LL6 X;  3HOY G;  3K5N A;  3S24 A;  2D2C C;  4BBS H;  1YZ6 A;  2M00 A;  4DAY A;  2VW9 A;  3OMC A;  1A3V A;  3S1N B;  3M85 A;  1VQJ A;  3I4M B;  1PV4 A;  4CDE C;  2A19 A;  1N36 Q;  1LLR D;  2G9D A;  5JEA H;  1VQP A;  2RDF A;  2JJQ A;  2ATW A;  4A3E B;  3I4N G;  1VQ4 A;  3T1H L;  1TR5 A;  1ZEQ X;  3NTI A;  1MKH A;  2LY7 A;  4KJO A;  2NN6 H;  1ICW A;  4EQP A;  5ISR A;  2PMZ B;  4ALP A;  1ZXT A;  5FO8 B;  3L7Z C;  1EY4 A;  1CFM A;  3CC7 A;  3I4L A;  1Z9F A;  4YHH Q;  4DV5 L;  2FJ2 A;  2PCF B;  1FJG L;  3HOZ B;  4DV6 L;  1VQ6 A;  3I7F A;  2Z1C A;  2B2Y A;  3J80 i;  1EIF A;  2A8V A;  4A3D H;  3ERO A;  4JOI A;  2EXZ A;  3GTK H;  1SFO H;  3W1B A;  4DR7 Q;  1VQE A;  4A93 B;  1VS0 A;  1PFM A;  2E2H B;  3HG9 A;  3M9B A;  4KN4 C;  2PQE A;  3PO2 B;  4BBS B;  1NTG A;  5CV9 A;  2BDO A;  3FKI B;  1E24 A;  1B53 A;  3CW2 C;  5ELD A;  4DR6 L;  3K7U C;  4GNX C;  4B3R Q;  1TWF B;  3NBH A;  4QL5 A;  3M4P A;  4L8J A;  1GHK A;  3F2U A;  3FMC A;  3GTG H;  4R8N A;  4PMC A;  1A63 A;  4FP5 D;  1WCM B;  2O4X A;  4HCE A;  4FF1 A;  1JOQ A;  1KDB A;  1UWV A;  1L0X B;  4ZKB B;  3J80 E;  4V0B A;  4C2M H;  3ERQ A;  1ASY A;  1VQC A;  1WFQ A;  4L5R C;  2JA5 G;  1YNN C;  4X66 Q;  1F77 A;  3K57 A;  1S5C D;  1OTC A;  1HR0 Q;  4F88 A;  4U68 A;  2F0K A;  1KAB A;  3HKS A;  3JAM c;  1I6H H;  3HKZ E;  1PH4 A;  4GOP B;  1ZYR C;  1L0W A;  1KHI A;  4FNF A;  2EYO A;  1I94 Q;  4IOA A;  4JI8 L;  3GTK B;  1CZW A;  2QW7 A;  5LMN Q;  4BY7 G;  4BBR B;  1FGB D;  4PMB A;  3CCE A;  4C3H B;  3G4S A;  1EY0 A;  2R93 H;  3P20 A;  4TSS A;  4B9X A;  1RTO A;  1F2Y A;  2QEJ C;  1U4M A;  1HHV A;  1UUP A;  3PMF A;  1SNO A;  1EYC A;  5FJ8 H;  5BR8 L;  1ROD A;  2DNE A;  1GVP A;  2XRQ D;  3A54 A;  4RCO A;  5M5Y H;  1V1O A;  4BY1 B;  4JI4 Q;  4OO1 G;  3MEF A;  2JEA I;  1F9R A;  3G48 A;  1GUN A;  3F1Z A;  1NNX A;  2HHH L;  4NMZ A;  3QJY A;  1WTH A;  1EWI A;  3MA2 B;  2CWA A;  4HSP A;  4DV0 Q;  4GKK Q;  5C44 G;  3VR5 A;  2OTJ A;  1SE8 A;  3I8Z A;  4OX9 L;  2J0T D;  4K6L A;  4DR4 Q;  5COR A;  1A8V A;  3BJU A;  1JE5 A;  3NEN A;  1DOM A;  3C46 A;  1IBM Q;  1LUZ A;  3MVV A;  3H15 A;  5A2Q E;  2DJF C;  3HRZ C;  4DUY Q;  2ICE C;  1JJC B;  1SND A;  3G7L A;  3OYY A;  2UUC L;  4LF7 Q;  3HOV H;  2R93 B;  3TP6 A;  1WD1 A;  1S5E D;  4XIG S;  1B9M A;  4J1M A;  4DV2 L;  1M1K C;  1W3S A;  4IFD I;  2MO0 A;  1QNU A;  4RA8 A;  5LMU Q;  1G91 A;  1HA6 A;  4IPH A;  2DUD A;  3CRK C;  5EJW A;  1BKB A;  1XMQ Q;  2JEB I;  4XDX A;  5HGQ A;  3J81 c;  3F2D A;  2DY7 A;  3GTL H;  5KND A;  1KTK A;  2LSS A;  1MJE A;  4IAL A;  4FF3 A;  1Q8K A;  1QUQ A;  4UY8 C;  2L55 A;  1S40 A;  3JAM L;  4ID6 A;  2E2I B;  4JI7 L;  1SAP A;  1EIH A;  4HCS A;  2L4N A;  1RIP A;  4CDF C;  2EY5 A;  3PIP A;  4OXP A;  1I4P A;  2RA4 A;  4IPD A;  2RCN A;  2IHF A;  3Q23 A;  2A1A A;  2L5T A;  2KCC A;  3KF6 B;  3S14 H;  3NUC A;  2BDN A;  1H95 A;  2N78 A;  1ENC A;  1YNX A;  3PO3 H;  4TQU S;  5KGU A;  1QZH A;  3G71 A;  4HJ7 A;  4CKC A;  1VF5 C;  4HSV A;  4FF2 A;  1GUO A;  1XNR Q;  3S1M B;  4JYA L;  5IT9 c;  4A3L G;  2MO1 A;  2Q8R E;  2XTI A;  2IY5 B;  1G51 A;  2QEX A;  4IUQ A;  2B2Y C;  3I4M G;  2Y0S E;  1Q3L A;  1JCK B;  2E2D C;  3HS0 C;  4JOI C;  1F9Q A;  1WTV A;  2VS1 A;  5DM6 3;  4KN7 C;  1F2M A;  3NEL A;  1E22 A;  2HT1 A;  2JA6 H;  1RDP D;  1TWA H;  4R4C A;  4A3E G;  3G6E A;  1IKM A;  4J15 A;  3ND9 A;  1O78 A;  1V43 A;  1F2L A;  1Z6H A;  1JMC A;  2LKV A;  2OQ0 A;  1SMY C;  4YCU A;  4KV6 A;  3BVG A;  3KK7 A;  5C3E H;  5HGT A;  4KY5 A;  5E3F A;  1IYJ B;  5C5M A;  3HOZ G;  3PUY A;  5C4X B;  3GTQ B;  1JQY D;  1STB A;  3OHX C;  5C3X A;  1C4Q A;  4A3I G;  3HOY H;  4IQZ A;  5D3D A;  2O5J C;  4GKJ L;  3F8T A;  4J8Q A;  3AB9 A;  3CHB D;  1IBL Q;  3NSW A;  4C1N K;  3PO2 G;  1CKO A;  5C0X I;  3J81 L;  4GLV B;  1HNW L;  5AJ3 L;  2AWO A;  5D65 A;  4MNO A;  3EIV A;  1N9W A;  1SLJ A;  3CXC A;  4GOP A;  5I2X A;  5EPJ A;  4LFC L;  2NTT A;  1TS4 A;  4B3S L;  1GUW A;  4TRD A;  2F4V L;  2AQ1 B;  5IOD A;  4M8A A;  3CCR A;  3HOU H;  1JR0 D;  4MHE A;  4X3S A;  3A56 A;  3EFX D;  4XXE A;  1LO5 D;  1WCM G;  2K7V A;  4L5T A;  3T16 A;  4KLK A;  2EXD A;  3LWE A;  2YTX A;  5JJK A;  4JW0 A;  2OTL A;  3PQI A;  4OEL B;  1IW7 C;  1VQA A;  2KUM A;  4CJ0 B;  3CQZ B;  4IPG A;  5IT9 L;  4FO2 A;  3PF4 A;  4IUR A;  1EY5 A;  4QB4 A;  1A3T A;  4K8J A;  1Q1B A;  5EAY A;  1GM5 A;  1VQN A;  4YY3 Q;  5C6A A;  1K83 H;  4ZUJ A;  1N34 L;  5BN4 A;  1BOS A;  1ILP A;  4BBR G;  1LT4 D;  4YIJ A;  3K8A A;  4XYQ A;  4C3H G;  1CK1 A;  1ONL A;  1FL0 A;  3NWT A;  1MD2 D;  2A6H C;  4QIW B;  3RZD H;  1LAB A;  1QJO A;  3Q6S A;  2F0W A;  4K6D A;  4NB3 A;  4UP9 A;  1HCZ A;  3I4N B;  4BY1 G;  1BCP C;  3MXN A;  1SR3 A;  2EYJ A;  4DK0 A;  1XPU A;  1FJG Q;  1N33 L;  4AH6 A;  2ASB A;  5M5X H;  1B2T A;  5IGC A;  1EFW A;  1TT2 A;  4DK6 C;  3I91 A;  1A3U A;  3FRP B;  2JA5 H;  4K0K Q;  2F0D A;  2PQA A;  3AU7 A;  2XIW A;  5IP9 G;  4HJ9 A;  4X3K A;  1EYA A;  1PHJ A;  3HOW H;  4OL7 A;  2HQE A;  2KEE A;  2P5Z X;  2CHB D;  4QJF A;  1H9R A;  1VCI A;  3A8K E;  4A3M G;  4IZ8 A;  2XWJ B;  1WYD A;  3D4D A;  4RKL A;  1BBW A;  2E5L L;  1RL2 A;  2VQF Q;  1I5F A;  4HIO A;  1VMP A;  2IT1 A;  3J80 L;  3NQT A;  2NWG A;  1QWY A;  4ILW A;  1MGS A;  2KCM A;  1K83 B;  4Q5V A;  2UUB Q;  3CCQ A;  2KED A;  1EQR A;  4P75 A;  2FIN B;  2R7Z B;  1O7Y A;  3PIO 3;  3M4O B;  3ERS X;  4RHS A;  3QG1 A;  3K58 A;  2SEB D;  2SNS A;  3RZD B;  2PNH A;  2MJ8 A;  1F9P A;  1S5D D;  4NXM Q;  4G4K A;  2CWP A;  1HJP A;  2NZO A;  1WTR A;  1NBW A;  3KLR A;  3H94 A;  1EEI D;  3K5O A;  1OXS C;  1XMO Q;  2UXC L;  4UHV A;  2DGY A;  5CGK A;  2N8N A;  4IUU A;  3JAM i;  1YVC A;  2NZH A;  3UE0 A;  3BYT B;  4N8F A;  1QE6 A;  1CHP D;  2R3Z A;  2WAC A;  4RHR A;  4ZKC B;  3MFG A;  3VR4 A;  3KJO A;  1SDF A;  2PI2 A;  2WP8 J;  4DV1 L;  2Z0S A;  1PH6 A;  1SMX A;  4N9T A;  2AUJ D;  1HNX L;  3A8I E;  4NP5 A;  3PUW A;  3GV6 A;  3RR5 A;  4K5V A;  3GTJ B;  1QVG A;  2OWO A;  4ZYS A;  4KKS A;  1ENA A;  1H9S B;  4BY7 B;  1NSN S;  1WOC A;  4DR5 Q;  2A69 D;  3H09 A;  1WI5 A;  3CCS A;  4IOC A;  4LF9 Q;  5GAD C;  2UXD Q;  3R8B A;  4DR2 L;  2HDM A;  5I6W A;  1PRT F;  4G7Z C;  5EGT A;  2HHH Q;  3JAM E;  2MP1 A;  2MGS A;  5A2Q L;  4MZ9 A;  4DV7 L;  5HY6 A;  1YBY A;  5GRO A;  1JE4 A;  1K8A C;  4X3U A;  1FGU A;  3VYS A;  2K28 A;  3FEW X;  5AFW A;  2ZTC A;  3STB D;  1E7Z A;  2I07 B;  3R2I A;  1XNQ Q;  4QQB X;  4NKL A;  1SYD A;  5H1S E;  4KJN A;  1A15 A;  3Q22 A;  2B2W A;  3IKJ A;  4JBJ A;  1YNJ D;  5C44 B;  2WB1 B;  3QR8 A;  3CPW A;  4X6A H;  2BE5 D;  4POG A;  2H4O A;  5FOB B;  3E0E A;  4GOP C;  1XXG A;  3KDF B;  2ALY B;  1GUS A;  3U9S A;  4F7X A;  1IXR A;  3S15 B;  2WII B;  4JV5 L;  2A5H A;  1AP0 A;  1C8C A;  3NHH A;  1YJW A;  3SK5 A;  1STH A;  1STE A;  2F0F A;  3IL8 A;  3Q24 A;  1NMF A;  4XQN A;  3J81 j;  3FPU B;  2IX1 A;  5KYI A;  1CQV A;  2UXB Q;  4DU9 A;  2I5H A;  3J81 i;  1UAP A;  1JT8 A;  3KLS X;  3IFD A;  1KD1 C;  1MSG A;  1PH5 A;  3I55 A;  5FLM H;  1VQG A;  4KKU A;  1Q7Y C;  3I4M H;  3RMH A;  1AEX A;  3S17 B;  3OIQ A;  3BDO A;  3WOE A;  4A3E H;  4OHJ A;  2ES2 A;  3VYT A;  1TS5 A;  1R4P B;  1X3G A;  2NTS A;  3V05 A;  5KNB A;  1D1I A;  1CSP A;  4C3J G;  1CKN A;  4A3C G;  1I4R A;  2KVM A;  3J7Y W;  5I9P A;  1VQH A;  2F3W A;  1VMC A;  5IYB H;  3TRE A;  3QWN A;  1PTO D;  2K1B A;  2JK8 A;  2L12 A;  2V1C C;  3HKZ G;  1HTP A;  3KF8 B;  4FXK C;  4NW2 A;  1AW7 A;  5ELC A;  1IL2 A;  1TU2 B;  3HOZ H;  1IYV A;  2F0J A;  3DHQ A;  3OTO Q;  1FD7 D;  2F0I A;  1K3B C;  3J81 E;  2VQE L;  2EVB A;  4X62 L;  1QVC A;  4LWC A;  1PTO B;  4GN5 A;  4K14 A;  1ESR A;  5CV5 A;  2J4X A;  2UU9 L;  4WJ3 M;  4A93 H;  5CV6 A;  2E2H H;  4UDU C;  3PO2 H;  1TY0 A;  3C1F A;  3MXG A;  4QGU A;  3FKI H;  4DN4 M;  4LF6 Q;  3CF5 A;  1D2B A;  3EQL C;  4Y7N B;  3GQB A;  1B8A A;  3H3V I;  4RGO S;  1TWF H;  1A6X A;  3I90 A;  3D4R A;  1EU4 A;  3QB3 A;  1PFB A;  3J7A 5;  2I0Q A;  3RUZ A;  3K0X A;  1WCM H;  5IT9 E;  4ZCK A;  5CV7 A;  3ND8 A;  1SJE D;  2PYK A;  4LF4 Q;  4I65 A;  5JOB A;  1J5E L;  2LMC B;  1PH7 A;  2K50 A;  2YV5 A;  4DR1 Q;  2ZJQ A;  2JA7 B;  5IOC A;  1VQ7 A;  4JI6 L;  5ELE A;  3N6R A;  1TS3 A;  5IGE A;  2K04 A;  1NAP A;  2JXM B;  3CC4 A;  1I4G A;  5K5P A;  2EIF A;  1VQD A;  1I4X A;  1JB7 A;  5AJ3 Q;  4A3I B;  1CSQ A;  1GKH A;  2BA1 A;  4JI3 L;  4CKE A;  4HAE A;  1E2W A;  3MEH A;  4H13 C;  1B3Q A;  2Z6B A;  4BBR H;  4C3H H;  4GN4 B;  1DOK A;  2Z4H A;  3CAM A;  4B3S Q;  2PI2 E;  3MTS A;  1HXY D;  5CV4 A;  1XJV A;  3EN2 A;  2F4V Q;  1JJG A;  2EY1 A;  2R7Z G;  2VUM B;  1BNZ A;  4OWW B;  4IUV A;  1GUG A;  3SR1 A;  2VB3 X;  3ULJ A;  1DZ1 A;  1QIL A;  2V4D A;  1EFI D;  4BY1 H;  1E2Z A;  1QCB D;  3BG3 A;  1H9S A;  1DM0 B;  2VNU D;  1FR3 A;  3R93 A;  4RGN A;  1Y1V G;  4KY7 A;  3VA7 A;  4MIU A;  3M3Y B;  2Q8T A;  3O13 A;  2KHS A;  2NN6 I;  1VQB A;  1PYW D;  2F03 A;  2NVX B;  1FNU A;  5LMN W;  5IP9 H;  5EKL A;  2R92 G;  2OXP A;  1OXT A;  1MJC A;  4A75 A;  1N34 Q;  4A3M H;  5ELF A;  4AQY Q;  5IGG A;  4NXN Q;  3OPO A;  3TZU A;  4X64 Q;  4LF8 L;  2B2W C;  3DWP A;  3NE5 B;  1B3A A;  2EY2 A;  3NEM A;  4Y52 H;  3PUZ A;  5E4X A;  4BXX G;  2EJM A;  1HH2 P;  3A0J A;  1GUT A;  2I5M X;  2XNA C;  3U9O A;  1XYI A;  3QOJ A;  4JCV E;  1GD7 A;  1KAA A;  1B9N A;  1PZI D;  4EGV A;  1HPC A;  4K2K A;  3UDX A;  5EBD A;  4DV4 L;  4EQN A;  4DV3 L;  2WAQ E;  1KLG D;  4JI1 L;  1D5Z C;  3DM1 A;  3P75 A;  4DNI A;  4O1N A;  4C3I B;  4DXF A;  5L37 A;  1IBK L;  3QIA A;  5IYD H;  1GOZ A;  4HID A;  1Q90 A;  1HNZ Q;  1SRO A;  5IE8 A;  1C48 A;  5C4J B;  4N9P A;  1CUK A;  2ZXP A;  5M3F B;  2B2V A;  3C2P A;  1HUN A;  4AYB B;  1LT3 D;  2MPM A;  1KRS A;  1O7I A;  2HCI A;  2JE6 I;  2XRS D;  3KBG A;  4UAI A;  2WB1 G;  2H5X A;  2E2I H;  2I5L X;  1NR4 A;  1EZ8 A;  4OON A;  1Y8O B;  2HCC A;  2L1B A;  4DA2 A;  1EQQ A;  1TWC B;  1E3P A;  2F0T A;  2MNA A;  4A3F G;  2A73 B;  1DOL A;  2QDL A;  1PRT D;  4LFA Q;  4A3M B;  1ASZ A;  3CD6 A;  3WWV A;  4BA2 I;  1I6V C;  4X65 Q;  1BQQ T;  2PNR C;  1Q82 C;  1MHW C;  4EX5 A;  4L63 B;  1LAC A;  3UDF A;  4R1J A;  5FKA C;  3PSI A;  1PRT B;  2F4I A;  1D6E C;  5C4Z A;  3OOC A;  4HED A;  3S1M H;  3GO5 A;  1Y8N B;  1CHQ D;  4WOR A;  2ZM6 L;  5ELO A;  2YU9 B;  3DMU A;  3I72 A;  4JI5 L;  2L15 A;  4Z9C B;  4YWK A;  1XWE A;  2JYO A;  2ZT9 C;  2NVT B;  4DUZ Q;  4NPS A;  4PMW A;  2Q8I B;  2FMC A;  3AFQ A;  4MTK A;  3X3N A;  3C1E A;  4KD3 A;  3QO2 A;  3E3X A;  2A6E C;  3TN2 A;  4KHP L;  1LTG D;  4J6H A;  1CT1 D;  4FF4 A;  3T1Y Q;  1N32 L;  4MN3 A;  1U4L A;  1HNX Q;  1TVX A;  4DAP A;  2QGQ A;  1K73 C;  1PYS B;  3AMU A;  1XX8 A;  1OXX K;  4LF5 Q;  1UE6 A;  4KHZ A;  5C4X H;  1X65 A;  3OSO A;  3GTQ H;  3M7N A;  4O42 A;  1M90 C;  4RGT A;  1PVO A;  1J9O A;  4DR2 Q;  1EZ6 A;  3CRL C;  3D6C A;  4ODG A;  2F0V A;  1F2Z A;  3KBX A;  1NJI C;  3DWQ A;  3K0Y A;  4QY7 A;  1XPR A;  1VDZ A;  4R4Q A;  1LTT D;  3MHB A;  2K5Q A;  2KCN A;  2Q2T A;  1C7Y A;  2N55 A;  4XYO A;  3SK8 A;  3PV0 A;  4B9W A;  1DD2 A;  1EY9 A;  1QG7 A;  2EZV A;  1S5B D;  4N8X 1;  2EYM A;  3HFZ B;  5FO7 B;  4KMU C;  2NB0 A;  2LXK A;  1U0L A;  4C3J H;  5M5W B;  1SYG A;  1SNQ A;  4CKB A;  4JV5 Q;  2R6G A;  3FP9 A;  1K0R A;  1RKN A;  1HZ9 A;  3DM3 A;  4HIM A;  3J7A F;  1L1O B;  1NMG A;  4P72 A;  2B29 A;  3E6Z X;  3EJI A;  3GTO H;  2C35 B;  2B63 B;  4B3M Q;  1R4Q B;  2JA7 G;  4JI0 Q;  1EYD A;  3D8G A;  1CZG A;  3HOX G;  5E1F A;  4PZ6 A;  3CQZ H;  3NK9 A;  1U4P A;  1PXU A;  4IJL A;  4B3T L;  2JP1 A;  3SE0 A;  2BCO A;  2A69 C;  4KK7 A;  1PTO F;  3M4Q A;  1K0S A;  2JN4 A;  1PH3 A;  1E0B A;  2AUK A;  2D9U A;  2BOS A;  4A3J G;  2VUM G;  1EOV A;  1BVS A;  2CKZ B;  5IWA Q;  1VQ8 A;  2IX3 A;  4I7A A;  4JI2 Q;  2K5D A;  3I4N H;  2IPK D;  2OQK A;  5IP7 G;  4KHV A;  1U9R A;  4OEM B;  4ZLT F;  3STB C;  4CDD C;  4A3B G;  3LNN A;  4YHH L;  2EYH A;  3HZX A;  1I4H A;  4NDX A;  4C3J B;  1Z7T A;  2DNC A;  2GN5 A;  1YNJ C;  3D0F A;  1ENF A;  1JC7 A;  4X62 Q;  2HD3 A;  5T1I A;  3HKZ B;  5G3L D;  2BE5 C;  2CQA A;  1WJJ A;  1SYB A;  3W5O A;  2UU9 Q;  2ENB A;  2KQ3 A;  3MFY A;  3GTO B;  1IYU A;  1AZP A;  1PH9 A;  1SYE A;  1DXM A;  5CC4 A;  1BO0 A;  2NBF A;  4LFB L;  1KDA A;  3S1R B;  1V1Q A;  1SN8 A;  2KJX A;  4A4I A;  1S4Z A;  2B2V C;  2NUC A;  2DJG C;  2EYP A;  3WDN A;  2PPB C;  4O0A A;  3R2T A;  4RKB A;  5DAU A;  3VYR A;  1RF2 D;  3Q0A A;  2F0U A;  1TQO A;  2R7Z H;  3M4O H;  5EKI A;  3T1H Q;  4DAM A;  5EBC A;  1Z47 A;  5IGD A;  4RCN A;  1MI2 A;  1JOR A;  3TSS A;  3T51 B;  2E75 C;  3JC6 6;  3BS1 A;  1EY6 A;  1K28 A;  3H91 A;  4C3I G;  2E2J B;  4X66 L;  1EIG A;  2F0S A;  1F9S A;  5KIX A;  2WKD A;  3SK6 A;  4DV5 Q;  1L2F A;  3K5M A;  4JI6 Q;  4S3S A;  4DV6 Q;  3PIP 3;  2K32 A;  3GDE A;  1STY A;  2CVR A;  4RGM A;  3IFT A;  5M3F G;  4P2C B;  5M3M B;  4AYB G;  1QNK A;  1L0Y B;  1I94 L;  4JI3 Q;  5LMN L;  4LK1 C;  4IUP A;  2N88 A;  1UEA B;  2KEN A;  3E5S A;  4A3K G;  1LM0 A;  1HZB A;  2NZ1 D;  3TRZ A;  2F0G A;  5DEH A;  3VR2 A;  4Q0F A;  4BXX H;  5FLX c;  2IWH A;  3GTJ H;  1SBB B;  2FHT A;  4V19 0;  4BY7 H;  2WKC A;  1GHJ A;  1GJX A;  1YEZ A;  4DR6 Q;  2CH4 A;  2A68 D;  3CC2 A;  4FVM A;  4P71 A;  4GLX A;  1PA6 A;  1ICF B;  3CCV A;  1K8O A;  1RHP A;  3KJP A;  2X6G A;  2JSO A;  3CME A;  4G7O C;  2PMZ E;  5E7N A;  3A55 A;  1AE2 A;  1NE3 A;  4R4T A;  4DV0 L;  4LW1 A;  4L6T B;  3KF6 A;  3A5Z B;  4JC0 A;  3TP7 A;  1PZJ D;  3U58 A;  4OO1 H;  1Y1V B;  2LS0 1;  2RF4 A;  2G5D A;  5FO9 B;  4DR4 L;  2EPB A;  3OWF A;  3K5L A;  3S2D B;  4CJ1 B;  3NTH A;  1SSO A;  3NBI A;  5C44 H;  4LF8 Q;  2ID0 A;  4DUY L;  4ULL A;  4IFD G;  2R92 B;  3G6J B;  4CBV A;  1O7Z A;  1Q12 A;  2AKW B;  3OIP A;  1VQM A;  1JOO A;  3DLL A;  4JI8 Q;  4HJ8 A;  1KNE A;  1PH8 A;  4R4O A;  5CV8 A;  4LF7 L;  1DJR D;  4RFB A;  1YIJ A;  1AZQ A;  3S15 H;  1A0I A;  3NPP A;  2CQO A;  2ZTE A;  3BVM A;  1KIX A;  4GS3 A;  2MUY A;  2AQ2 B;  2K14 A;  1J8I A;  2I46 A;  2JA8 B;  1D5M C;  1X54 A;  4DNR B;  1IZ6 A;  5LMU L;  1QVF A;  1CTM A;  5BR8 Q;  3H6M A;  1IBK Q;  2EE1 A;  1XMQ L;  1L1O A;  2E8G A;  1AH9 A;  4OIK A;  2UUA L;  2X6L A;  1T5X D;  3HEJ A;  4PZ7 A;  3TS0 A;  1JWS D;  1N8R C;  1FVI A;  2K75 A;  5IGF A;  2A74 C;  3MWY W;  3S17 H;  4EQ5 A;  4XTC S;  3NBH B;  1W6K A;  2HDL A;  5BN3 A;  1DYQ A;  4H44 C;  1JOK A;  3VYU A;  3AYH B;  2LXJ A;  3CKI B;  2CW0 D;  4OX9 Q;  5GAE C;  3K6O A;  2PW5 A;  3D3R A;  3GP7 A;  1XTC D;  2QCP X;  3HOV G;  2KOL A;  1BXT A;  5F2D A;  3T13 A;  5FLX L;  3R3O A;  4A3F B;  4PV1 C;  1LV9 A;  2XWB B;  1PMR A;  2UUC Q;  1XNR L;  2B63 G;  1HQM C;  3ZJY C;  1PTO H;  4P73 A;  1EOT A;  2N3S A;  3MAQ A;  4DV2 Q;  2NVQ B;  1TWH B;  2PZT A;  3MXU A;  1BDO A;  5J1Z A;  2B2T C;  2PO4 A;  1TWG H;  1NY4 A;  1V1P B;  1B50 A;  3GTM B;  4JBW A;  2KHI A;  4PG3 A;  4A3L H;  1PLF A;  3M4Y A;  2EYF A;  3D31 A;  5K36 G;  1WTO A;  3S2H B;  4JBK A;  1SNC A;  2CCZ A;  4Y7N H;  1G2T A;  1A62 A;  2EJF C;  1GXD C;  3LGJ A;  1VQ5 A;  4OWT B;  4PQX A;  1X9N A;  1OXU A;  1OO9 B;  4JI7 Q;  5ELN A;  1LTR D;  1UE7 A;  2CFM A;  3X3M A;  5J22 A;  1WTW A;  1BF4 A;  3SHL A;  1PH1 A;  2GVA A;  1EQT A;  5C0X G;  3OMG A;  1EWC A;  1YI2 A;  3I2Z A;  2D62 A;  1CKM A;  2JA7 H;  1IBL L;  1PRT C;  4H0L C;  2QKI C;  3I3C A;  3S1Q B;  1SYC A;  2ZJP A;  3H0G G;  2SDF A;  2JA6 G;  4JYA Q;  4JBM A;  2Q2I A;  2X69 A;  4A3I H;  4L5Q A;  1R9T B;  4MTN A;  5FK9 C;  5C3W A;  3VR6 A;  2WAQ G;  1CA6 A;  1TWG B;  1FNW A;  2EYL A;  4R8I A;  1I50 B;  3LX0 A;  1KLU D;  1H9J A;  2Z4I A;  1TII D;  2VUM H;  1A2U A;  1K8M A;  2RKS A;  2VY3 A;  3E9I A;  4HN7 A;  1B7Y B;  4WRD A;  3W1G A;  3KOJ A;  1KRT A;  5J3B A;  2B2U A;  1Q8I A;  4LUV A;  1J6Q A;  4ZK9 B;  3K7A H;  3VA5 A;  3M3Y H;  4GN3 B;  2R61 A;  4H02 A;  1PFS A;  4JVZ A;  1TKW B;  2O2L D;  2C5C A;  1QUQ B;  4LMQ D;  2CH4 W;  2NVX H;  4EVO A;  1YHA A;  1EYG A;  3TP5 A;  5M3M G;  1Y8P B;  4B3T Q;  4YY3 L;  3K80 C;  1LTL A;  2H1E A;  5HUR A;  5EKK A;  4FXD A;  1S3O A;  4PNY A;  3CCU A;  4GKJ Q;  1AN8 A;  3HOX B;  3KLW A;  1EU3 A;  3VR3 A;  5C0X J;  1PH2 A;  1AE3 A;  1X3Q A;  4PZ8 A;  1K3R A;  3NP8 A; 
#chains in the Genus database with same CATH homology
 5IYC H;  4DUZ Q;  3CCJ A;  1HNW Q;  4NPS A;  1K9M C;  3HOU G;  4PMW A;  2OTL A;  1VQL A;  3AFQ A;  5JJI A;  5GQO A;  1YHB A;  1VQA A;  4DR3 Q;  4IPG A;  4LFC Q;  4KHP L;  3ER0 A;  3PF4 A;  2F52 A;  1Q1B A;  5EAY A;  1YIT A;  3UE1 A;  3A5U A;  4YY3 Q;  3T1Y Q;  1GM5 A;  1VQN A;  3S1Q H;  1N32 L;  1K83 H;  1N34 L;  1HNX Q;  2ZM6 Q;  4A76 A;  4JI5 Q;  4BBR G;  4IFD J;  2QGQ A;  4C3I H;  1PYS B;  1K73 C;  3K8A A;  1R9T H;  4K0K L;  3RN5 A;  1OXX K;  4LF5 Q;  1EUJ A;  1FL0 A;  1SRU A;  1UE6 A;  4KHZ A;  1HR0 W;  5C4X H;  1Y14 B;  3F2C A;  1X65 A;  3RZD H;  4IJH A;  3U4Z A;  3GTQ H;  3BZK A;  3M7N A;  1M90 C;  1XPO A;  1PVO A;  1I50 H;  1L1O C;  4P74 A;  2XGT A;  3SGI A;  4NB3 A;  5C4J H;  1LYL A;  4UP9 A;  4DR2 Q;  5M3F H;  5JJL A;  4LFB Q;  2VQF L;  1S72 A;  1XTD A;  1V9P A;  2AHO B;  4BY1 G;  4KHP Q;  4LNQ A;  1I3Q H;  1SR3 A;  1NJI C;  4QY7 A;  1XPR A;  1X3E A;  1U5K A;  4AYB E;  3KFU A;  5C4X G;  1XPU A;  4R4Q A;  1TWC H;  1FJG Q;  2UUB L;  4AH6 A;  4OWX B;  1N33 L;  2ASB A;  1N32 Q;  5M5X H;  4A3K H;  2Q2T A;  2RHS B;  1C7Y A;  1D7Q A;  4O2D A;  3RLO A;  1EFW A;  4FDB A;  4DK6 C;  3PO3 G;  1YJ9 A;  2JA5 H;  3B6Y A;  4B3M L;  4UPA A;  4K0K Q;  3AQQ A;  2PQA A;  3PV0 A;  4JI0 L;  5IP9 G;  3Q8D A;  4HJ9 A;  3I4O A;  1YJN A;  1PHJ A;  1VQF A;  3HOW H;  2JA8 G;  1DGS A;  2YYZ A;  3S1N H;  4NXM L;  4QJF A;  3HFZ B;  1VCI A;  3F2B A;  3H3V H;  4A3M G;  3BZC A;  2LXK A;  1WYD A;  1U0L A;  2Y0S G;  4C3J H;  1C0A A;  1BBW A;  2FXQ A;  1RL2 A;  3U4V A;  2E5L L;  1XMO L;  2HQL A;  2VQF Q;  1I5F A;  3KDF A;  4HIO A;  2YU9 H;  4JV5 Q;  3PUV A;  2R6G A;  3HOX H;  2IT1 A;  3FP9 A;  1K0R A;  1YHQ A;  3HOW G;  1HZ9 A;  1QZG A;  3DM3 A;  2KCM A;  2YTY A;  1N33 Q;  2UUB Q;  3CCQ A;  4HIM A;  2NVT H;  1EQR A;  1L1O B;  1NMG A;  4P75 A;  4P72 A;  2B29 A;  5IWA L;  3GTO H;  3CP0 A;  2C35 B;  3ERS X;  2F3I A;  4B3M Q;  2JA7 G;  4JI0 Q;  4JI2 L;  3HOX G;  2Z6K A;  4ME3 A;  3CQZ H;  4PZ6 A;  2PNH A;  2VZA A;  3L0O A;  4HIK A;  1Y1W H;  4IJL A;  4NXM Q;  2QA4 A;  2CWP A;  4B3T L;  4A3J H;  1HJP A;  2NZO A;  3OW2 A;  5C3E G;  3UDG A;  1NBW A;  3CCM A;  5IY0 A;  4KI0 A;  2VL6 A;  2E5L Q;  3CCL A;  1XMO Q;  2UXC L;  1OXS C;  3M4Q A;  2DGY A;  1P8L A;  2N8N A;  2OCE A;  5IP7 H;  4DR5 L;  3JAM i;  2BH8 A;  1PH3 A;  1YVC A;  2NZH A;  4A3B H;  3UE0 A;  4A3G G;  2K4K A;  3BU2 A;  4DK3 C;  4LF9 L;  2UXD L;  4A3J G;  2VUM G;  2EQS A;  1EOV A;  3HOY G;  1BVS A;  3S24 A;  2CKZ B;  5IWA Q;  1VQ8 A;  4BBS H;  1YZ6 A;  2KBN A;  4QIW E;  4JI2 Q;  1KAW A;  3E9H A;  4LUZ A;  5GAH C;  4DR3 L;  3I4N H;  2VW9 A;  2OQK A;  5IP7 G;  3KJO A;  1T9H A;  3STB C;  4A3B G;  2PI2 A;  3M85 A;  4YHH L;  2WP8 J;  4DV1 L;  1VQJ A;  2Z0S A;  1SMX A;  1PH6 A;  1VQI A;  1PV4 A;  2A19 A;  3RLN A;  1HNX L;  3TQY A;  1N36 Q;  1XNQ L;  1X3F A;  3CMA A;  3PUW A;  2GN5 A;  3RR5 A;  1VQP A;  2JJQ A;  3D0F A;  1QVG A;  2OWO A;  1MIU A;  2ATW A;  2UXC Q;  4X62 Q;  3I4N G;  1VQ4 A;  1WOC A;  3T1H L;  1MKH A;  4DR5 Q;  1WI5 A;  1WJJ A;  3CCS A;  3TS2 A;  3W5O A;  3PGZ A;  4IOC A;  2UU9 Q;  4LF9 Q;  5GAD C;  2UXD Q;  4ALP A;  1OXV A;  4DR2 L;  1PH9 A;  1BBU A;  3MXN B;  4RG1 A;  2HHH Q;  3L7Z C;  5M5W H;  4LFB L;  4DV7 L;  4MZ9 A;  5HY6 A;  1V1Q A;  1SN8 A;  1YBY A;  1X55 A;  5GRO A;  4A4I A;  2N49 A;  1K8A C;  3CC7 A;  3RZO H;  1Z9F A;  3GD7 A;  5IYC G;  1FGU A;  4YHH Q;  4O0A A;  4DV1 Q;  4DV5 L;  4DV6 L;  1FJG L;  1VQ6 A;  2ZTC A;  3STB D;  1E7Z A;  3I7F A;  1XNQ Q;  4QQB X;  2PQA B;  5H1S E;  1E1T A;  3J80 i;  1EIF A;  3CPF A;  2A8V A;  2R7Z H;  3M4O H;  4A3D H;  3T1H Q;  4JBJ A;  2B63 H;  4DAM A;  1Z47 A;  4JOI A;  2UXB L;  3GTK H;  4IPC A;  1SFO H;  3W1B A;  4DR7 Q;  1VQE A;  1VS0 A;  2B3G A;  2UUA Q;  3CPW A;  4X6A H;  4POG A;  3JC6 6;  3M9B A;  3E0E A;  4GOP C;  1PYB A;  3KDF B;  2ALY B;  1NTG A;  4YCW A;  1IXR A;  4DV7 Q;  1E24 A;  4X66 L;  4JV5 L;  3CW2 C;  1YJW A;  4DR6 L;  3K7U C;  1X56 A;  4GNX C;  4DV5 Q;  4B3R Q;  1L2F A;  4JI6 Q;  4DV6 Q;  3ULL A;  1NMF A;  4QL5 A;  3GDE A;  3J81 j;  3M4P A;  5M3F G;  2KHJ A;  1Q1E A;  4AYB G;  1I94 L;  2IX1 A;  3GTG H;  4JI3 Q;  1VQO A;  5LMN L;  2UXB Q;  2I5H A;  3J81 i;  1A63 A;  5GAG C;  1JT8 A;  1KD1 C;  1PH5 A;  3I55 A;  1UWV A;  2KEN A;  5FLM H;  4A3K G;  1LM0 A;  1HZB A;  1VQG A;  1ASY A;  4C2M H;  1Q7Y C;  3OTO L;  3I4M H;  1VQC A;  2HIV A;  3ICE A;  3TRZ A;  1WFQ A;  4A3C H;  4L5R C;  2JA5 G;  4BXX H;  5FLX c;  2K5V A;  4X66 Q;  3GTJ H;  1GO3 E;  4BY7 H;  4A3E H;  1YEZ A;  1OTC A;  1HR0 Q;  4DR6 Q;  3CC2 A;  2ES2 A;  4P71 A;  4UP7 A;  4GLX A;  1X3G A;  1PA6 A;  3CCV A;  3HKS A;  5FLM G;  3JAM c;  1I6H H;  1CSP A;  3HKZ E;  1PH4 A;  4GOP B;  1CKN A;  4A3C G;  1L0W A;  1KHI A;  3PIO A;  1I94 Q;  4IOA A;  4JI8 L;  1VQH A;  3KJP A;  3H0G H;  5LMN Q;  3CME A;  4BY7 G;  2PMZ E;  5IYB H;  5E7N A;  3TRE A;  1AE2 A;  2V1C C;  1NE3 A;  2JK8 A;  3HKZ G;  3CCE A;  3S1R H;  4R4T A;  4LF6 L;  3G4S A;  3KF8 B;  4LW1 A;  4DV0 L;  2R93 H;  3KF6 A;  4GNX B;  1IL2 A;  2AWN A;  3A5Z B;  4JC0 A;  3HOZ H;  3U58 A;  5DLQ E;  3OTO Q;  1N36 L;  2RF4 A;  2VQE L;  1Q86 C;  4DR4 L;  4X62 L;  1QVC A;  4LWC A;  4GN5 A;  5FJ8 H;  5IYB G;  5BR8 L;  1GVP A;  5M5Y H;  1KL9 A;  3J7Z C;  1Y1W G;  5C44 H;  2UU9 L;  4LF8 Q;  2ID0 A;  4WJ3 M;  4A93 H;  4DUY L;  4JI4 Q;  4IFD G;  4OO1 G;  3MEF A;  2E2H H;  4LF4 L;  1Q12 A;  2AKW B;  1VQM A;  2JEA I;  3G48 A;  3PO2 H;  2WB1 E;  3F1Z A;  2HHH L;  3DLL A;  4JI8 Q;  4HJ8 A;  2JA9 A;  1PH8 A;  2E2J H;  4R4O A;  4LF7 L;  3IRB A;  4QGU A;  1EWI A;  3FKI H;  1YIJ A;  2CWA A;  1A0I A;  4DR1 L;  3S15 H;  2CQO A;  2ZJR A;  4LF6 Q;  4DV0 Q;  3CF5 A;  2D0O A;  5C44 G;  4GKK Q;  2ZTE A;  1KIX A;  4A93 G;  4GS3 A;  1B8A A;  2K14 A;  4BA1 I;  3H3V I;  2OTJ A;  1TWF H;  1SE8 A;  1X54 A;  1IZ6 A;  4BBS G;  4OX9 L;  2VQE Q;  5LMU L;  1D8L A;  1G6P A;  4DR4 Q;  1A8V A;  3BJU A;  5M3M H;  1QVF A;  1JE5 A;  3NEN A;  5BR8 Q;  4RMF A;  3J7A 5;  2I0Q A;  1TXY A;  3FKI G;  3J80 c;  1IBM Q;  1IBK Q;  1LUZ A;  1XMQ L;  4DR7 L;  3K0X A;  1L1O A;  2E8G A;  1WCM H;  3H15 A;  1AH9 A;  2UUA L;  4DUY Q;  4PZ7 A;  4IO9 A;  3TS0 A;  2MFI A;  2HIX A;  1C9O A;  1JJ2 A;  4LF4 Q;  5JEA G;  1G29 1;  2Z6K C;  1N8R C;  1FVI A;  1JJC B;  2WFW A;  2K75 A;  1KXL A;  1UEB A;  3OYY A;  2UUC L;  4LF7 Q;  1J5E L;  3S17 H;  1PH7 A;  2K50 A;  2YV5 A;  4EQ5 A;  2NN6 G;  4XTC S;  4DR1 Q;  3NBH B;  2ZJQ A;  2BA0 A;  3HOV H;  4XIG S;  1VQ7 A;  4GLA C;  4B3R L;  4JI6 L;  4DV2 L;  3AYH B;  2LXJ A;  1W3S A;  3A74 A;  1M1K C;  4IFD I;  2MO0 A;  4POF A;  3CC4 A;  5LMU Q;  4APV A;  2EIF A;  5GAE C;  1VQD A;  4OX9 Q;  1JB7 A;  4IPH A;  2R7D A;  5AJ3 Q;  2DUD A;  1CSQ A;  1GKH A;  2BA1 A;  4JI3 L;  3RLF A;  3HOV G;  1UE1 A;  1BKB A;  2BH2 A;  1XMQ Q;  1KC8 C;  4BBR H;  1Q46 A;  2JEB I;  5HGQ A;  3J81 c;  3F2D A;  3AFP A;  4C3H H;  3GTL H;  2LSS A;  1MJE A;  4GN4 B;  3CAM A;  4B3S Q;  4HJA A;  2PI2 E;  1JJG A;  1XJV A;  3EN2 A;  1Q8K A;  1QUQ A;  4UY8 C;  2F4V Q;  1Y1V H;  2R7Z G;  4A3D G;  1S40 A;  2UUC Q;  1XNR L;  2B63 G;  3ZJY C;  1J5E Q;  4OWW B;  4JI7 L;  1KQS A;  4AQY L;  4P73 A;  4NXN L;  1HR0 L;  3ULJ A;  3L2P A;  2N3S A;  3S2D H;  4X64 L;  4DV2 Q;  1RIP A;  3GTM H;  1CKN B;  4BY1 H;  3PIP A;  2VNU D;  4OXP A;  1B70 B;  2R92 H;  1TWG H;  4IPD A;  1NY4 A;  1Y1V G;  2K5H A;  2RCN A;  2IHF A;  4JBW A;  2KHI A;  2A1A A;  4PG3 A;  4A3L H;  3KF6 B;  2NN6 I;  3S14 H;  1VQB A;  1H95 A;  3D31 A;  2Q2U A;  5K36 G;  2N78 A;  1YNX A;  4JBK A;  3PO3 H;  4TQU S;  3KYH C;  5LMN W;  4JG2 A;  5IP9 H;  1QZH A;  4Y7N H;  3G71 A;  2CCZ A;  1A62 A;  2IX0 A;  4HJ7 A;  2R92 G;  2R7F A;  2JA8 H;  4WJ4 A;  3LGJ A;  1OXT A;  1VQ5 A;  4YWM A;  4OWT B;  1MJC A;  4TVA B;  1XNR Q;  1X9N A;  4JYA L;  1OXU A;  5IT9 c;  4A75 A;  1N34 Q;  4A3L G;  2MO1 A;  4JI7 Q;  4A3M H;  2XTI A;  5ELN A;  1UE7 A;  2CFM A;  2D0P A;  1G51 A;  4AQY Q;  1VQ9 A;  4NXN Q;  2IY5 B;  1P16 A;  2QEX A;  4X64 Q;  1PH1 A;  5JEA J;  4LF8 L;  4JI4 L;  1HNZ L;  2GVA A;  3I4M G;  2Q2H A;  2Y0S E;  3FHW A;  3NEM A;  4Y52 H;  3UDI A;  3PUZ A;  4JOI C;  4DAY B;  4BXX G;  5C0X G;  1K8G A;  2VS1 A;  1YI2 A;  3NEL A;  2HT1 A;  1E22 A;  1HH2 P;  2JA6 H;  1TWA H;  4R4C A;  4A3E G;  3G6E A;  3A0J A;  2AMC B;  3I2Z A;  2D62 A;  2I5M X;  4UP8 A;  4YWL A;  4J15 A;  4JCV E;  1GD7 A;  4GKK L;  1CKM A;  2K5N A;  2JA7 H;  4LUO A;  1V43 A;  1IBL L;  2IHE A;  1JMC A;  3UDX A;  4DV4 L;  4DV3 L;  3VDY A;  4L5S A;  2OQ0 A;  2WAQ E;  4JI1 L;  2ZJP A;  3H0G G;  4LFA L;  2JA6 G;  4YCU A;  2K52 A;  4DNI A;  4JBM A;  2Q2I A;  3S16 H;  4JYA Q;  5C3E H;  4A3I H;  4L5Q A;  4YCV A;  4X65 L;  4MTN A;  1IBM L;  1IBK L;  2R93 G;  5IYD H;  2WAQ G;  1EIY B;  1IYJ B;  4HID A;  3HOZ G;  3PUY A;  1HNZ Q;  3PCO B;  1SRO A;  5IE8 A;  2JQO A;  4A3F H;  4DKA C;  2YTV A;  1HZA A;  1CUK A;  4A3G H;  2RHQ B;  3AEV A;  5FJ8 G;  2VUM H;  3E9I A;  2VY3 A;  3W1G A;  1B7Y B;  4A3I G;  3HOY H;  3KOJ A;  3PF5 A;  1VQK A;  1KRS A;  1O7I A;  2JE6 I;  1KRT A;  4R4I A;  5IYD G;  3I56 A;  2WB1 G;  2H5X A;  2E2I H;  2I5L X;  4GKJ L;  3F8T A;  5J3B A;  4OON A;  1IBL Q;  2NVQ H;  1EQQ A;  1TWH H;  4LUV A;  1J6Q A;  1E3P A;  2MNA A;  4DV3 Q;  4DV4 Q;  4A3F G;  1CKO A;  1E1O A;  3PO2 G;  4JI1 Q;  5C0X I;  3K7A H;  3PUX A;  4GLV B;  4LFA Q;  4DUZ L;  1ASZ A;  5AJ3 L;  3WWV A;  3CD6 A;  4BA2 I;  1HNW L;  2AWO A;  3M3Y H;  1W2B A;  4GN3 B;  3U50 C;  4X65 Q;  4H02 A;  4MNO A;  3EIV A;  2NVY H;  1PFS A;  1N9W A;  4EX5 A;  1SLJ A;  1Q82 C;  3UDF A;  3CXC A;  4GOP A;  4HJ5 A;  3RN2 A;  3GTP H;  3S2H H;  3TEH B;  4LFC L;  1QUQ B;  2GVB A;  4R1J A;  2NVX H;  3PSI A;  4B3S L;  3K81 C;  1YHA A;  1EYG A;  2F4V L;  2MQH A;  5M3M G;  4DPG A;  3CCR A;  4B3T Q;  3T1Y L;  4YY3 L;  3HOU H;  3K80 C;  1LTL A;  3EBE A;  4GNX A;  1Q81 C;  3S1M H;  3GO5 A;  2ZM6 L;  1S3O A;  3RNU A;  3CCU A;  5ELO A;  4JI5 L;  4GKJ Q;  1HZC A;  1WCM G;  2L15 A;  4L5T A;  4YWK A;  4KLK A;  3KLW A;  3ULP A;  2EXD A;  2ZTD A;  4AIM A;  5C0X J;  4LF5 L;  4OO1 I;  1PH2 A;  1AE3 A;  4PZ8 A;  2KCT A;  2YTX A;  5JJK A;  1K3R A;  1UE5 A;  1X6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...