2NB0A

Structure of d19s variant of the penicillium antifungal protein (paf)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
55
structure length
55
Chain Sequence
AKYTGKCTKSKNECKYKNSAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifungal protein
molecule keywords Antifungal protein
publication title D19S Mutation of the Cationic, Cysteine-Rich Protein PAF: Novel Insights into Its Structural Dynamics, Thermal Unfolding and Antifungal Function.
pubmed doi rcsb
source organism Penicillium chrysogenum
total genus 3
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nb0A00
2NBFA 2KCNA 2NB0A 2MHVA 1AFPA
chains in the Genus database with same CATH superfamily
3EROA 3KF6B 4WFN3 1BBWA 2BA1A 4NDXA 2NVTH 4X66Q 4OO1G 5LL6X 1KQSA 1RJTA 4JC0A 5LL6S 4B3TQ 3EA6A 2D2CC 5LMNL 3NEMA 4B9XA 2PZUA 2WV6D 5K5PA 3J80E 5JJZA 3EJIA 2KHJA 1SYBA 1QJOA 1UAPA 2X6LA 3I8ZA 3J7AV 5KNCA 4L6TB 4ZK9B 4XYQA 3HKZG 3TSSA 1EWCA 1H9JA 4IFDJ 1L0YB 2GA4B 5ELEA 4LF7L 2JA7H 2B2WC 3A8JE 4RAUC 2AQ1B 4LWCA 1SRUA 1BF4A 2ZXPA 2JXMB 1IBML 1PDQA 1SMYD 2HCIA 3HKZB 1VQNA 4JPBW 4A3KG 1TS3A 3S1RH 3I55A 2VZAA 5KYIA 3KJOA 1VQCA 1KDCA 3S14H 2UXDQ 5I4DA 1H9SA 1HNXL 1X56A 5C0XI 4RHRA 3VR4A 4IFDI 3OIPA 3PIPA 3DM3A 1QNKA 4A3KB 2HD3A 4IZ8A 3ITPA 4BBRH 2KENA 4H44C 5IGFA 1K83B 2RHQB 2EY6A 2ASBA 1SNMA 4LMQD 4CDDC 5IGDA 3S1NH 1NE3A 2Y0SG 3A74A 4M8AA 3OW2A 3HS0C 4ME5A 2QKIC 1A2UA 2K14A 3S1MH 4UHVA 3GTMH 1BQQT 3MAQA 1EY6A 4KN7C 4K14A 3NENA 1EIFA 2BH8A 2Y0SB 4OXPA 1LT4D 3BYTB 1YNJC 1BBXC 4A3GH 3K7UC 2DNEA 2MFIA 1SMYC 4EQPA 3HOVH 1GUTA 3E6ZX 4JI8Q 2EYJA 2NTTA 1B9MA 4PG3A 4KV6A 1KC8C 2WIIB 3RZOB 5BN4A 3OWFA 2JA9A 1EOTA 2ZM6Q 1EYAA 2AQ2B 3C3LA 2JN4A 1PTOD 4RG1A 4QQBX 2PCFB 1IYUA 4RMFA 4LAAA 3ERSX 2VUMG 1NUCA 1SYEA 3K8AA 2NVXH 1HNWL 2EYFA 1XMOQ 2K5HA 2IWHA 3T56B 5M3MG 3CCVA 4IO9A 3H15A 5FO7B 4DR7Q 4A93H 3GP7A 2RCNA 3GTJH 1RDPD 3GTLH 4IURA 1B7YB 2CW0D 5AJ3Q 3J80c 1PYWD 2VUMB 3KDFB 2B2VC 3QIAA 2B39A 1VQLA 2L9HA 1JC7A 1KLGD 5M3MB 2VNUD 4OO1I 1CSPA 4HMJA 1I94Q 1OTCA 1HR0L 5M5WB 5LMUL 1MGSA 1K0SA 1J5EQ 3CQZH 5EKIA 2F1MA 1IBKQ 1I4GA 2OF1A 2GVBA 4OONA 4RCNA 3J81j 2NVYH 3N52A 4G4KA 3F2CA 1WTOA 1GM5A 3AMUA 1Z6HA 5EPKA 2UXBL 1X3PA 4K6DA 2D5DA 2K04A 2B2UA 3LWUA 4OWWB 1NTGA 4YCUA 4Z9CB 1E3PA 2AKWB 1V1QA 2M00A 3KUPA 4R4IA 4MZ9A 3Q0AA 1VF7A 4LUOA 2E2JH 3QO2A 2YTYA 3UE0A 4S3SA 3TP6A 3V05A 5J22A 3HOUG 3P7JA 3OOCA 1SN8A 2OQ0A 5J39A 3CC7A 5BN3A 3SK4A 3KLRA 3GTQB 1EY8A 3V2TA 1HZAA 5JOBA 2JA5H 2ZTCA 2Q2IA 1N32Q 4DV3L 4K5XA 1SJED 1E1OA 1X3GA 2ZTEA 4X65Q 3HOUB 4A93G 3H3VC 4R4OA 2BH2A 3MC0B 5C4JH 4H13C 2HUGA 2VQFQ 4B3RQ 3GV6A 3M9BA 5CBEE 1KNAA 3C1EA 3M3YH 1BKBA 3G6JB 4A93B 1FNUA 3D4DA 4HIKA 5CV6A 2C9OA 2R7DA 4CKBA 4QIWB 4A76A 4Y7NB 4LF5L 3X3MA 4JI6L 1R9TB 1NCVA 1TWAH 5EQ0A 1VQGA 1FGUA 2RBMA 1RD9D 1PTOH 4NP5A 2R61A 5E1FA 4EX5A 1KDBA 4DF7A 2D62A 1Y69U 2F3IA 1TKWB 4ZLTF 1VQAA 4BY7H 2OQKA 4GZYC 3J81i 2B63G 1WTQA 1N36L 2KECA 5FLMG 3L7ZC 3I4MH 4DK0A 1IBLL 4NKLA 1HTLD 3S2DH 4XQQA 3NE5B 4DN4M 4OL7A 3FVQA 1Q82C 2B63B 3OPOA 3M7GA 2HT1A 1Y14B 4KD4A 2SOBA 1YHAA 4BS9A 5CV5A 4TQUS 1PMRA 4RHSA 1YBYA 4DAVA 4A75A 4N8X1 1GO3E 1CHQD 2MQHA 1JT8A 1SNDA 3BVZA 3J81L 2AUKA 1YVCA 1EY5A 1Y8PB 3S9WA 4DR4L 3J7ZC 1TWCH 4KHZA 1JE5A 1Y1VH 4C3HG 1CSQA 1VQBA 4DXFA 3D0FA 3T1HL 3FP9A 3KDFA 1G91A 4JI4Q 4RH6A 2J4XA 3AYHB 4DGZA 2HIXA 3I4OA 4IUTA 1BCPC 3OIQA 2E2HB 3T1YL 1A8VA 2F4IA 3PQIA 2MNAA 1YZ6A 2O5JC 4JCVE 1OXSC 4FXKC 4C3HB 4BY7G 1IYVA 5C6AA 1RKNA 4JI5Q 1M8AA 5IWAQ 1L1OC 4AQYL 4K0KQ 1ZEQX 2ZJQA 2OEOA 2HCCA 4OHJA 5BR8Q 1B4OA 3QOJA 3CCMA 1VQ8A 3I4MG 3I7FA 2B2YA 5J3BA 2NZOA 1EIHA 3FPPA 3S15B 1Q1BA 2QCPX 1N8RC 4BY7B 4DR6L 1EIYB 1H95A 1MSGA 1ZXTA 1SAPA 5DAUA 3HEJA 3R8BA 4JYAQ 4HJ8A 2XSCA 3OW7A 3I4MB 2N78A 1S5ED 3S1QH 1PRTB 3TBIB 4DR1L 1WTVA 2JSOA 1I6HH 4LK1C 1CFMA 2XRQD 2CWPA 4HJ7A 1T5EA 4F7XA 1K8AC 3U9OA 4B08A 2RDHA 3BS1A 1M90C 4RKLA 5ISRA 3ONAB 4GKJL 1CUKA 5JPNC 3HRZC 1ICWA 3CXCA 4DU9A 4UY8C 4ODGA 5LMNW 3CMEA 3I56A 3U4VA 4DNRB 1QILA 4HR7B 4BBSG 4WJWA 4DR3Q 1FGBD 2SDFA 1Q8KA 3NWTA 4C3IG 3LGJA 3C1FA 1M4VA 1R4PB 4A3BG 3Q8DA 3IL8A 4EQNA 1NJIC 1O7LA 2E76C 4BBSB 4G7ZC 3STBC 1DXMA 1H9RA 1ASZA 1U9RA 2E2IH 3HOWH 3GV3A 4C3IB 2EOTA 2CVRA 3AFPA 4A3MH 1JJCB 4A3BB 5M9OA 2IL8A 2OCEA 5JEAH 3FKIH 5IYBG 1ML0D 3G7LA 5EPLA 4MTNA 1D1KA 1FJGQ 2BE5D 1AW7A 3KBGA 1TS4A 4C56C 4DR5Q 1Q8IA 5EKKA 2CQAA 4GKKL 3HZXA 1EFID 2IX1A 3BZDB 1LTAD 4XTCS 1LT3D 3QR8A 1JWUD 2RDFA 1STAA 3TP5A 5C4ZA 4NXMQ 4CGYB 1SE3A 1NMFA 5ELFA 1JOQA 5CR3A 2VY3A 4LFCL 1SNPA 5C0XH 2FINB 3Q24A 1TS2A 4Q0FA 4DFAA 1VQPA 1UEAB 5EBCA 3S1QB 2R92H 3RUZA 2HQLA 2F0QA 3SVMA 4Q5VA 1E24A 1LTGD 2B2UC 1K9MC 4A3DH 5C44G 1WTPA 1DD2A 2PZTA 5C5LA 1NAPA 3IRBA 1HNZQ 4PNYA 1FNWA 4XQJA 4P72A 1DYQA 5CMDA 2B8GA 1OXVA 3HOWG 1X54A 4X64L 3D3RA 1XYIA 5C44B 4B9WA 1X55A 4JI7L 1HJPA 3DLLA 3DWQA 3J81E 3RNUA 4K2LA 2RF4A 3G4SA 3OTOL 4DV0Q 1LT6D 4K5VA 4ME3A 1X65A 1CZWA 3S16B 1KL9A 1KDAA 3HOWB 3TEHB 3KLSA 4GOPC 4A3IH 2R7ZH 4RWSC 2NYZD 3PO3G 4L5RC 2UUCQ 1QVFA 2KHIA 4FF3A 1IXRA 3HGBA 4APVA 5IP9H 3K57A 5IT9L 4JI3L 1X3EA 3BG3A 3CF5A 4A3JH 4FF4A 2J0TD 4R4TA 3TDQA 1L0WA 4FF1A 2QEJC 2F4VL 1BVSA 1CA6A 3D6CA 3RZDH 2EXZA 1WCMH 3R2IA 1JWMD 1VQMA 1XNRQ 5FOBB 4LF6Q 1MKHA 2HHHQ 3PO3B 3E0JA 4OWXB 1BCPF 4R4CA 1ENAA 2LSSA 2PQEA 5FJ8G 2M9VA 2CH4A 2F0GA 2I5HA 3S17B 1LO5D 1HR0W 3EQLC 3FEWX 1QNUA 4ZQ3A 4DV5L 2ICEC 3CPFA 1SBBB 1UNSA 4KN4C 1GOZA 4OO1H 3FMCA 3K5MA 4HMIA 3VA7A 2Q8TA 2PI2A 2YV5A 1Z47A 1YNND 4E6IA 2KJXA 5IYDG 3RLNA 3SXHA 2DJFC 5KNBA 4CJ1B 4NXNQ 1VQDA 1NNXA 2KEDA 1PH7A 2A1AA 3FRPB 3ICEA 2DN8A 1PH2A 1CT1D 1XTDA 2K5VA 4LF8Q 1ENCA 2R7ZG 4DV4L 2IY5B 1Y1WG 1HQMC 3J7YW 1ZYRD 4LF4Q 3VDYA 5D65A 4R8IA 3DEPA 1Z9FA 2XRSD 4A3JG 1X3FA 4POGA 4MTKA 1FD7D 1IHZA 3A7LA 4KD3A 3DHQA 5K36G 2JYOA 4XQNA 3TRZA 4HIOA 2R7ZB 2K5NA 5C3EG 1Y1WB 4JOIA 2EDGA 4R8NA 4X6AH 3RR5A 1F2MA 4ABNA 1D8LA 1V8QA 1K83H 3BDOA 4DUYQ 1LV9A 4ZUJA 1OXUA 1HA6A 4LFBQ 3CCJA 2WINB 1D5ZC 1VDZA 5ELOA 3RZDB 2BOSA 3NBIA 5C3EB 2NBFA 4X66L 1GHJA 2EY1A 2KUMA 4B3TL 4XXEA 2FXQA 4PZ8A 3J81c 3AB9A 5BN5A 3NTIA 4IPGA 3GD7A 4EQOA 4DV7Q 1LACA 4GN3B 2V4DA 1I4XA 1I50B 4C3JG 3NBHB 4ZRZA 2PO4A 4GNXC 3VR2A 3CC2A 4JI0Q 3RZOH 2Z9HA 5C0XJ 3F2BA 4JBJA 1JJGA 5I6WA 1YEZA 3URYA 2DY8A 3QJYA 2O5IC 4C3JB 4TKOB 1B2TA 3I4LA 5LMNQ 1G291 1Q86C 4QUCA 5EGTA 3K6OA 3KYHC 1FNVA 3K80C 1K28A 2NUCA 1PXUA 2XNAC 3P20A 1SR3A 3D8GA 1WTHA 3GTOB 1GVPA 5CORA 4IOAA 1NSNS 1SE4A 4UDUC 5EBDA 2UXDL 4P74A 2EYPA 3K5NA 2F0UA 4KHPQ 4H02A 1GHKA 1LTSD 4BA2I 4I7AA 2VUMH 2F0KA 2D0PA 5HY6A 5IGGA 1PH4A 3CKIB 1G8ZD 3RLFA 4B3MQ 4CBVA 1BNZA 5HGQA 3ULJA 5M3MH 2I5MX 4DV2Q 3FDTA 3JAMi 3R3OA 2H1EA 4IALA 4DV1Q 3GQBA 3P1HA 1YJWA 4XT1B 3EFXD 3PF5A 3GTGH 5M5WH 2BDOA 1LTBD 1DJRD 4HN7A 4FYDA 1PZJD 4DA2A 4LW1A 2PQAB 2BCOA 1YIJA 5LHY1 3PIP3 1H9MA 1JWSD 1VQHA 2B29A 2Z6BA 1XNQQ 3PUWA 1K3BC 4BY1G 3MFGA 3KJPA 5IT9E 1OO9B 5CV7A 4DAYB 1MI2A 1JE4A 1I4PA 3SK6A 2ZT9C 4FF2A 1CQVA 3OSOA 4YHHQ 3MEHA 4OX9Q 2EYMA 4LNQA 2SNSA 2PNHA 1Q7YC 3L0OA 4BY1B 4JI8L 3WWVA 1SYDA 1D7QA 3JAML 5JJKA 1ET9A 5FLXL 3GTQH 4LUZA 2A73B 1XPUA 4KHVA 1VQ7A 3U4ZA 5IGCA 4G7OC 4JVZA 4UP7A 2CQOA 3PIOA 1XWEA 2I5LX 2D9UA 2KOLA 1ILQA 3Q22A 4HIDA 1EY0A 2EIFA 3HOUH 1AFPA 1QVGA 1RIPA 1A3UA 1RTOA 2B8FA 1XMOL 5C4HA 4QCLA 1HQRD 2AHOB 1JMCA 4HIMA 4KY6A 4DR7L 2OTLA 3IFDA 1GUNA 4O42A 1VQIA 2AWOA 3TREA 4AYBE 5AJ3L 3L2PA 3MA2B 4EVOA 1YJ9A 4YIJA 1HXYD 1PRTD 4Y7NH 1DCZA 1R9TH 3GO5A 1KNEA 3I90A 4C2MH 1I94L 2RHSB 3PUVA 4CJ2C 5IE8A 3G71A 2PPBC 1U4MA 5F2DA 1J5EL 1XJVA 1GUOA 3GTGB 5CV8A 1IBKL 2KHSA 5IODA 2ID0A 2EYHA 1NR2A 1PH1A 1FR3A 1NY4A 3CAMA 2UUAQ 1IKLA 3KF6A 2JE6I 4IPCA 2IHFA 1WTWA 1FL0A 4A3EG 2L12A 1YITA 2N49A 1BUVT 3DEOA 1KAAA 3Q6SA 3I3CA 1PTOC 3KF8B 3SE0A 3SR1A 1TIID 3K7AB 3ND9A 2OT2A 4YCWA 3NBHA 1HR0Q 2B63H 5COYA 2JQOA 1KXLA 4A3EB 2EYOA 2XTIA 5FLMH 4KJNA 1N33Q 3F2UA 5M5XH 1S5BD 1B53A 3CHBD 5AFWA 2HQEA 1STNA 2Z6KC 2CW0C 2EY2A 4X65L 4C1NK 1YI2A 3K0YA 2K33A 1S40A 1C7YA 5E7NA 2PW5A 4EGVA 2OWOA 2WACA 5FK9C 2VQFL 4IOCA 5IT9c 3K59A 1PZID 3MEFA 3F1ZA 4HJAA 1I5FA 3CW2C 4DV6Q 5G3LF 1UE5A 3AEVA 1PYBA 3TZDA 1JR0D 5CBAE 1TY0A 3RMHA 3CC4A 2UU9Q 2UXCQ 3T51B 1SFOB 5KRUA 2E2HH 4KTAA 1ICFB 1E7ZA 4JW0A 1BR9A 4C3HH 1A0IA 2K52A 1D5XC 4PV1C 3A5UA 4C2MB 1TY2A 1KRTA 1KIXA 2WP8J 2C5CA 2PQAA 3RN5A 4O2DA 4X62Q 3UDIA 3E9IA 2QF7A 2O4XA 3DMUA 3I4NG 4JK1C 3CP0A 2LKVA 3S15H 1HZBA 1B50A 1CKNB 3HKSA 4IJLA 2K50A 4DAYA 3R2TA 4PMCA 4DUZQ 2A6HD 2QILA 3OHXC 4LF5Q 4JOIC 1C9OA 3ZJYC 1ZKOA 2KCCA 2LXKA 5IYCG 2KVMA 3I4NB 4ZUIA 3CU7A 1SE8A 2KCNA 2FMCA 2R7FA 1A3TA 2Z0SA 1M1KC 1F2ZA 4R4QA 3NQIA 4FDBA 3G6EA 2ZXOA 5M5XB 1XMQQ 1SJHD 5GAEC 2GVAA 1GJXA 5KEEA 4DNIA 4P73A 4I65A 3PSIA 4QUFA 3JAME 3IKJA 3QB3A 5FLXE 1PH9A 2WKDA 4HAEA 3U58A 1PV4A 1JB3A 1DONA 4X3TA 1B1ZA 3A0JA 3ND8A 1MD2D 1PHJA 2IX3A 1PYSB 1HA5A 2PMZE 2JEAI 4RCOA 1J6QA 3CPWA 4QY7A 1Y8NB 2YTVA 4JI4L 4LF9Q 4BBSH 4XDXA 1SEBD 1GKHA 1I3QB 4K8IA 4C3IH 2E5LQ 1L0XB 2CWAA 1G6PA 2A6HC 4JI5L 4A3BH 5IWAL 1OXTA 1QOHA 4KY5A 4WORA 4K0KL 3ZYYX 2K6AA 3HG9A 3JC66 5BR8L 4K6LA 4PZ6A 4UP9A 2BDNA 2HIVA 4RGNA 4GLVB 5A35A 4RGMA 4ZKCB 3K5LA 4HCEA 1B44D 3I72A 4ZKBB 5IYBH 2F0SA 5M5YB 4HSPA 2PNRC 1TT2A 4JYAL 1HFGA 2EPBA 3KF8A 3U50C 2O2LD 2UUBQ 2L0CA 4OGQC 4TVAB 2QW7A 1AZPA 1B3QA 4IUQA 3H94A 3HOXG 2RKSA 3NUCA 1EQRA 1XTCD 3A7AB 3T4AC 3T13A 1EY9A 2NTSA 4P75A 2I0QA 2F0NA 5GAGC 2ZJRA 1DZ1A 2N3SA 2F0DA 3D4RA 4QIWE 3HOXB 2VL6A 1SNQA 1PTOF 4DR2Q 2B2WA 3A5ZB 2B3GA 2B2TA 4DR3L 3I91A 2F0TA 4A3CH 3AFQA 1TS5A 2R93H 4IUUA 2F0LA 3NPPA 5I6YA 2VW9A 3LNNA 1TQOA 2JJQA 5C44H 4KY7A 1Q81C 1QZHA 4OWTB 1MJEA 2OTJA 5D3DA 4A3FG 3BDLA 5IGBA 3S16H 3J7AF 5EPJA 1QVCA 2H5XA 1LABA 3AQQA 2F0JA 5CV4A 4IJHA 1E22A 1EQTA 3HOYG 5E4XA 4A3FB 1ENFA 3JAMc 1V1OA 2IJ0A 2R3ZA 4O1NA 2K5QA 5FLXc 4DR5L 2K7VA 3A54A 1AEXA 1EU3A 3PUYA 5EKLA 1CKNA 2KA7A 3PO3H 3HOYB 4K5WA 2RVLA 3HOZH 4KLKA 1LT5D 5FKAC 1YHQA 4O0AA 5I2YA 3S17H 5I9OA 3IAYA 4HJ5A 1VQEA 1X3QA 1PLFA 4A4IA 2QDLA 2AQ3B 4B3SQ 1A3VA 2EVBA 4PZ7A 2AMCB 1HUNA 2L4NA 3TP7A 2Q8IB 4DPGA 5FJ8H 4L8JA 3K0XA 4A3CG 5M3FG 2KCMA 1IZ6A 2RA4A 1VMCA 4L63B 2R93G 1HCZA 4BWGB 4IN3A 1K73C 5J1ZA 1HNZL 1WVLA 4RGOS 1NR4A 4JI1Q 3WOFA 2JK8A 2Q2UA 1F9QA 4AH6A 3SDZA 4KK7A 2Z4IA 5M3FB 1STYA 1TVXA 1EU4A 2VQEQ 1MIUA 2R93B 4IUVA 1EY7A 3UI2A 1N34Q 2F03A 5IYDH 3VR6A 1EUJA 4DV0L 2Q2TA 2BE5C 1B9NA 1E1TA 3TZUA 1CKMA 2K01A 2H4OA 4DK3C 3RD4A 2K75A 1Y1WH 2FHTA 2NVQB 3ERQA 5KNDA 2SEBD 2UUCL 3W1BA 1BCPB 4OEMB 3HOZG 3BDCA 1STGA 1SYGA 2M2LA 1JQYD 2N55A 1PH3A 2LXJA 1L1OB 1HUMA 3QG1A 4UAIA 2VB2X 3RLOA 1UE6A 1WTXA 1XNRL 5K36H 2ZXRA 2YU9H 3QWNA 4UP8A 2HHHL 5C3EH 2PI2E 5IP7G 3HOZB 1HZCA 2JA6H 2KEEA 4JBMA 3FPUB 4OIKA 2A68D 1BBUA 3ER0A 1VQ5A 4FO2A 5CV9A 4P71A 1O80A 3EBEA 2MP1A 4MN3A 1G2TA 4ZCKA 1I50H 2JP1A 4JI3Q 1I4RA 2DUDA 1STEA 4NPSA 4XT3B 2XVSA 3I70A 1I4HA 1EFWA 4OELB 4FP5D 1D6EC 5KYLA 3LX0A 4PQXA 3J7A5 1EZ8A 1F2LA 4GLAC 3OMCA 4POFA 3VYUA 3CCQA 4C3JH 3PO2G 3W3AA 4NXNL 4KKTA 5L37A 1W6JA 5JPMC 4A3LH 3CCUA 1W6KA 4LFAQ 4X3SA 1T9HA 3SK5A 4LF8L 3DXJC 3GTOH 2LFNA 1VMPA 1BDOA 2BA0A 2A6ED 5JVG3 4FVMA 3X3NA 2XWJB 2IW3A 2EJFC 4LF4L 3PO2B 5NUCA 3VA5A 1AE2A 1TWFB 3I73A 1XX8A 3L9AX 2XGTA 5C5MA 5IGEA 2ENBA 2RSOA 3KK7A 3TS0A 1SE2A 1IKMA 3SGIA 1R4QB 4GLXA 2K28A 4JV5Q 4EQ5A 4J15A 2A68C 4DUYL 3BVMA 4CJ0B 2WAQE 4LFBL 3VYSA 2JA6G 5T1GA 1K8OA 1IW7D 1JOOA 4RA8A 2RDGA 2C35B 3DM1A 2YYZA 1AN8A 2YU9B 2OXPA 3HP3A 2XIWA 1S3OA 3DWAA 1DM0B 4GS3A 1YNNC 4L5QA 1QB5D 3SEBA 1VCIA 1U4LA 4JI2Q 3PCOB 4CHTB 2JA8G 1V43A 4J8QA 2JA6B 4KMUC 5JAVA 4DV7L 3S24A 1ONLA 2NWGA 4FNFA 2WKCA 3F8TA 1STBA 4YY3Q 1FYCA 2CFMA 1CZGA 4BY1H 2B2YC 2EY5A 4KKSA 4U68A 5KIXA 1WD0A 4JI0L 4A3LG 3MXUA 2JA8B 1C4QA 1S5CD 3SK8A 3PV0A 2MO1A 1CHPD 1LTLA 1ZYRC 1WD1A 4CDFC 3WDNA 3GTKB 3KLSX 1E0BA 1DGSA 1TWGB 4I7ZC 1D5MC 3BZKA 2XWBB 2SNMA 2WB1E 4ZYSA 1VQKA 4JBKA 2F0FA 1W2BA 3TN2A 1QZGA 3E5SA 3KOJA 4XYOA 4L5SA 5IOCA 4KHPL 2MUYA 1MHWC 3W1GA 2DY7A 2TMPA 1G51A 1IW7C 3BJUA 4B3ML 2NZHA 1S72A 1LTTD 2B2TC 4LF7Q 3VR3A 4K8JA 3P75A 4DV2L 1Y8OB 1YNJD 3MZ5A 4DV1L 2A5HA 4QJFA 5EJWA 5DLQE 1UUPA 4DK1A 3ULPA 4MNOA 1SYFA 3EN2A 4GOPB 3MXPA 4H7BA 1IBMQ 2LMCB 2NB0A 1L1OA 2FMMA 1F2YA 2EJGC 4YWKA 1JCKB 1O7IA 2CH4W 2NN6G 4RGTA 2K05A 1Q12A 1XNQL 3D31A 1EQQA 1HNXQ 2WFWA 3GTPB 1E2VA 1EQVA 1PA6A 1P8LA 4YHHL 2CCZA 4OX9L 1W3SA 4AIMA 1CKOA 3K7AH 5IIFA 2K1BA 1GUWA 3LWEA 3OWEB 4IQZA 3U9SA 5HGTA 4A3EH 2EZVA 1TR5A 2HDMA 3M4QA 1BXTA 2K5DA 1TWHB 1K0RA 1KD1C 2ZM6L 1EEID 2KCTA 2NVTB 3VYRA 1KLUD 3BU2A 2EYLA 4TRDA 4CKCA 4YWMA 3CCRA 4BXXH 1SLJA 2JA7G 4IPHA 5GADC 2MO0A 2CKZB 5DEHA 4J1MA 2ATWA 2DNCA 3PIO3 3D6WA 4N8FA 4K2KA 2Q2HA 3E9HA 1C48A 1AE3A 2PYKA 1SFOH 1CI3M 1MBYA 1V9PA 2F3WA 2FJ2A 2JA7B 1KAWA 4LUVA 5ELCA 2KQ3A 3PMFA 4GN5A 2L5TA 1SYCA 3OMGA 1F9SA 1VS0A 3OYYA 1HNWQ 2Z8LA 3A55A 3AU7A 4BBRG 3S1RB 1EWIA 1GUGA 4IUPA 2UUAL 3S14B 2F0VA 1LM0A 4X3UA 2JEBI 1J8IA 1AP0A 1ASYA 3H6MA 1SXTA 2PZWA 5E4WC 1GD7A 1H9KA 1Q46A 4BBRB 3I4NH 3CRKC 1U0LA 1QUQB 3PUZA 2PMZB 3HKZE 2F0EA 5LMUQ 1VQ4A 3S1NB 3EIVA 1N33L 1EYDA 2F0PA 1X6OA 1PVOA 4A3GG 1PFNA 1CK1A 3BYYB 2V1CC 5IYCH 4GNXB 1WTRA 1PH5A 4BXXG 3MTSA 2AUJD 2ZTDA 3HOVG 3S1MB 5H1SE 3IFTA 2VS1A 3GTMB 1N32L 2MHVA 2UXBQ 3MXNB 5C4XH 1PRTC 1VQOA 5IY0A 3CCSA 2MGSA 4JBWA 1HRJA 4A3GB 2LY7A 4QMGA 4B3RL 1E2WA 1S5FD 2D0OA 2Z1CA 3H0GH 1PFSA 3NXWA 4DV6L 3HOVB 4V0BA 1DOKA 3PUXA 1VQFA 1XPRA 1IL2A 1VF5C 1A15A 1VQJA 4M1UB 2UU9L 2J7ZA 2UXCL 2QDBA 2NN6I 3MFYA 1I3QH 1AH9A 5A2QL 1F77A 4F88A 1CM9A 3B6YA 1X32A 4X3KA 2NZ1D 4DV3Q 1RF2D 4GOPA 1XXGA 2E8GA 2Y0SE 2NVXB 1U4RA 4X62L 4NW2A 4KJOA 2GN5A 1WFQA 3CCEA 1CA5A 4PMBA 5FO9B 3GTJB 3GTLB 1GXDC 1EY4A 5M5YH 1A2TA 2RSNA 4HTHA 4DUZL 4ALPA 2IX0A 4JG2A 4G57A 4DNTB 1QG7A 4N9TA 4ILWA 2E74C 1HPCA 4JI6Q 4WRDA 3DWPA 5JJLA 1E2ZA 1B3AA 1TU2B 3KBXA 5GQOA 3F2DA 1SROA 2DGYA 2G9DA 2VB3X 1GUSA 1D2BA 5HURA 2RQXA 3CQZB 5C4XG 2VXWA 4QB4A 1UE1A 1SSOA 1XMQL 2CHBD 2NVYB 1RCVD 1BCPD 1N36Q 3H0GG 1VQ6A 3HOXH 1K3RA 2QGQA 3Q23A 4KKUA 2F0IA 5C4XB 2TSSA 1IBLQ 2JA5G 2E2JB 1WOCA 3H3VH 1F9PA 5C3WA 2AWNA 2QA4A 2IPKD 1KABA 3H0GB 3G48A 3UE1A 3DUZA 3NWSA 3NTHA 4LF9L 2FFKB 1JOKA 4ZAIA 4DAPA 5I2XA 1OXXK 3M85A 2E5LL 2JA5B 2F3VA 2K4KA 2A74C 5FO8B 1X9NA 3HFZB 1XPOA 4J6HA 3W5OA 1Q90A 4L5TA 1BOSA 2F52A 5C4JB 5ELBA 4DR4Q 3K5OA 2E75C 4HCSA 5GAHC 4A3FH 3TS2A 1HTPA 1FVIA 4PMWA 4XIGS 1SMXA 4HSVA 2IT1A 2DJGC 3M3YB 4ID6A 3CMAA 3T1HQ 1VQ9A 3UDXA 3HOYH 4IPDA 1JB7A 3CCLA 1O7ZA 1QE6A 1BO0A 2UUBL 2I07B 1TWAB 3T1YQ 3MHBA 1KRSA 1JICA 1SNCA 2EE1A 1DOLA 4NMZA 1QUQA 3C2PA 3MVVA 1PTOB 4AQYQ 4OIJA 3M4PA 1RL2A 1SDFA 1JJ2A 1EZ6A 1C8CA 3STBD 3N6RA 4CDEC 2L55A 4GNXA 4QF4A 2A8VA 4IUNA 5C3XA 3K58A 3I2ZA 4R1JA 1UE7A 4DR6Q 3MXNA 4DR2L 4YCVA 1PZKD 2EXDA 2IHEA 2MPMA 1ESFA 3S2DB 5M3FH 1ET6A 1CTMA 1HH2P 1PFBA 4BA1I 4V190 1YNXA 4DR1Q 1EWHA 2F0MA 2F0HA 4DXGA 1IL8A 3NSWA 1DOMA 4MHEA 3L3OC 2G5DA 3T16A 2LS01 1A63A 5DM73 3K81C 5CGKA 3TQYA 5JVH3 4F8MA 4GKJQ 3C46A 1U4PA 1Y1VG 2A69D 4RKBA 1PRTF 1RTNA 1N9WA 1II3A 2NVQH 5KGUA 2YTXA 3H09A 1TWCB 5A2QE 1IYJB 1FJGL 3J80i 1Q1EA 3TP8A 1Y1VB 4F87A 3A8KE 3VYTA 1V1PB 1LTID 1EL0A 3EVQA 2Z4HA 1O7YA 4H0LC 1F9RA 4DKAC 5EAYA 4NXML 1LUZA 1K8MA 4FXDA 4NB3A 3PGZA 4R9WA 3R93A 4B3SL 3O13A 3A56A 5T1IA 2X6GA 5CC4A 3KLWA 2E2DC 5IP7H 4QGUA 3UDFA 4UPAA 2L11A 2WAQG 5TSSA 3S2HH 4GKKQ 3NQTA 4CKEA 3J80L 3M4OH 3QOLA 3E3XA 4JI1L 1HZ9A 1PH8A 2A69C 2ICIA 3MXGA 1HHVA 2ES2A 4DAMA 1KHIA 4IFDH 5DNFA 2PW7A 2VQEL 2WAQB 4LFCQ 1A6XA 4WJ3M 1G6ZA 1N34L 2ALYB 1I6HB 1EYCA 3NELA 3NP8A 2KBNA 3PO2H 5D14A 1TWFH 1PFMA 1EIGA 4GN4B 1T5XD 2B2VA 2MJ8A 2P5ZX 3NHHA 5ELDA 5I9PA 3NTKA 3TMEA 4U673 4HJ9A 4P2CB 4A3MG 1QCBD 1ESRA 2RCFA 4X64Q 3CRLC 5JEAG 3ULLA 2WB1G 3FKIG 4JI7Q 1JORA 3KFUA 4LJZC 1LTRD 4LF6L 4HEDA 3OTOQ 3CD6A 1O78A 1H9SB 2E2IB 2X69A 3H3VI 4A3MB 3GDEA 4KI0A 3RN2A 2G9HD 5DM63 2K5WA 1EYGA 2K32A 1S5DD 2WB1B 1D1IA 3FKIB 4N9PA 2ZJPA 2L15A 1I4QA 1LYLA 5E3FA 3E0EA 1MSHA 2QEXA 3W2DA 3FHWA 3D4WA 2JA8H 5C0XG 2F4VQ 1C0AA 1TXYA 5D3IB 4IFDG 2R92G 3S2HB 1S4ZA 1HFNA 2N88A 1K8GA 2Z6KA 1WJJA 1MJCA 4CDCC 1PH6A 3A8IE 2K03A 3GTKH 3M4OB 3T53B 3V96A 4LFAL 1TWGH 1P16A 2L1BA 4C1NI 1WI5A 4A3DG 1B70B 4MIUA 4DV5Q 2R6GA 2R92B 4QL5A 1SNOA 4G7HC 1QWYA 4Y52H 2N8NA 1Z7TA 1RODA 4YWLA 1L2FA 2F0WA 1UWVA 5JJIA 4DK6C 4A3DB 1KTKA 4JV5L 3NK9A 5CYUA 2EJMA 1U5KA 1ILPA 3BVGA 3SHLA 1EOVA 4A3IG 5G3LD 1I6VC 1YHBA 4DV4Q 1A62A 1RHPA 3BZCA 1V1PA 1NBWA 2XN9C 1CQFA 1YJNA 1UEBA 5IP9G 1B8AA 2A19A 2F0OA 4TSSA 3VR5A 1J9OA 4RFBA 3GTPH 4JI2L 4A3KH 4AYBG 1EEFD 2EQSA 3H91A 2HDLA 4A3IB 1WCMG 3WOEA 2Q8RE 1STHA 5ELNA 2NN6H 3M4YA 4FXGC 4YY3L 1G2SA 1WYDA 1LLRD 3MWYW 1AZQA 4A3JB 4ULLA 5GROA 1Q3LA 1NMGA 3M7NA 4AYBB 3UDGA 5JEAJ 3PF4A 2A6EC 2I46A 4WJ4A 1TWHH 1WCMB
chains in the Genus database with same CATH topology
3EROA 4WFN3 2BA1A 4NDXA 4OO1G 5LL6X 1RJTA 5LL6S 3EA6A 2D2CC 4B9XA 2PZUA 2WV6D 5K5PA 3J80E 5JJZA 3EJIA 1SYBA 1QJOA 1UAPA 2X6LA 3I8ZA 3J7AV 5KNCA 4L6TB 4ZK9B 4XYQA 3TSSA 1EWCA 1H9JA 4IFDJ 1L0YB 2GA4B 5ELEA 2B2WC 3A8JE 4RAUC 2AQ1B 1BF4A 2ZXPA 2JXMB 1PDQA 1SMYD 2HCIA 3HKZB 1TS3A 5KYIA 1KDCA 5I4DA 1H9SA 5C0XI 4RHRA 3VR4A 4IFDI 3OIPA 1QNKA 4A3KB 4IZ8A 3ITPA 4H44C 5IGFA 1K83B 2EY6A 1SNMA 4LMQD 5IGDA 4M8AA 3HS0C 4ME5A 2QKIC 1A2UA 1BQQT 3MAQA 1EY6A 4KN7C 4K14A 2Y0SB 1LT4D 3BYTB 1YNJC 1BBXC 2DNEA 1SMYC 4EQPA 1GUTA 3E6ZX 2EYJA 2NTTA 1B9MA 4KV6A 3RZOB 2WIIB 5BN4A 3OWFA 1EOTA 1EYAA 2AQ2B 3C3LA 1PTOD 2PCFB 1IYUA 4LAAA 1NUCA 1SYEA 2EYFA 2IWHA 3T56B 5FO7B 3GP7A 1RDPD 4IURA 2CW0D 1PYWD 2VUMB 2B2VC 3QIAA 2B39A 2L9HA 1JC7A 1KLGD 5M3MB 2VNUD 4OO1I 4HMJA 5M5WB 1MGSA 5EKIA 2F1MA 1I4GA 2OF1A 4RCNA 3N52A 4G4KA 1WTOA 3AMUA 1Z6HA 5EPKA 1X3PA 4K6DA 2D5DA 2K04A 2B2UA 3LWUA 4Z9CB 3Q0AA 2M00A 3KUPA 1VF7A 3QO2A 4S3SA 3TP6A 3V05A 5J22A 3P7JA 3OOCA 5J39A 5BN3A 3SK4A 3KLRA 3GTQB 1EY8A 3V2TA 5JOBA 4K5XA 1SJED 3HOUB 3H3VC 3MC0B 4H13C 2HUGA 3GV6A 5CBEE 1KNAA 3C1EA 3G6JB 4A93B 1FNUA 3D4DA 5CV6A 2C9OA 4CKBA 4QIWB 4Y7NB 3X3MA 1R9TB 1NCVA 5EQ0A 2RBMA 1RD9D 1PTOH 4NP5A 2R61A 5E1FA 1KDBA 4DF7A 2D62A 1Y69U 1TKWB 4ZLTF 4GZYC 1WTQA 2KECA 3L7ZC 4DK0A 4NKLA 1HTLD 4XQQA 3NE5B 4DN4M 4OL7A 3FVQA 2B63B 3OPOA 3M7GA 4KD4A 2SOBA 4BS9A 5CV5A 4TQUS 1PMRA 4RHSA 4DAVA 1CHQD 1SNDA 3BVZA 3J81L 2AUKA 1EY5A 1Y8PB 3S9WA 4KHZA 4C3HG 4DXFA 1G91A 4RH6A 2J4XA 4DGZA 4IUTA 1BCPC 3OIQA 2E2HB 2F4IA 2O5JC 1OXSC 4FXKC 4C3HB 1IYVA 5C6AA 1RKNA 1M8AA 1ZEQX 2OEOA 2HCCA 4OHJA 1B4OA 3QOJA 2B2YA 1EIHA 3FPPA 3S15B 1Q1BA 2QCPX 4BY7B 1MSGA 1ZXTA 1SAPA 5DAUA 3HEJA 3R8BA 2XSCA 3OW7A 3I4MB 1S5ED 1PRTB 3TBIB 1WTVA 2JSOA 4LK1C 1CFMA 2XRQD 1T5EA 4F7XA 3U9OA 4B08A 2RDHA 3BS1A 4RKLA 5ISRA 3ONAB 5JPNC 3HRZC 1ICWA 4DU9A 4ODGA 4DNRB 1QILA 4HR7B 4WJWA 1FGBD 2SDFA 3NWTA 4C3IG 3C1FA 1M4VA 1R4PB 3IL8A 4EQNA 1O7LA 2E76C 4BBSB 4G7ZC 1DXMA 1H9RA 1U9RA 3GV3A 4C3IB 2EOTA 2CVRA 4A3BB 5M9OA 2IL8A 5JEAH 1ML0D 3G7LA 5EPLA 1D1KA 2BE5D 1AW7A 3KBGA 1TS4A 4C56C 1Q8IA 5EKKA 2CQAA 3HZXA 1EFID 2IX1A 3BZDB 1LTAD 4XTCS 1LT3D 1JWUD 2RDFA 1STAA 3TP5A 5C4ZA 4CGYB 1SE3A 5ELFA 1JOQA 5CR3A 1SNPA 5C0XH 2FINB 3Q24A 1TS2A 4Q0FA 4DFAA 1UEAB 5EBCA 3S1QB 3RUZA 2F0QA 3SVMA 4Q5VA 1LTGD 2B2UC 1WTPA 1DD2A 2PZTA 5C5LA 1NAPA 4PNYA 1FNWA 4XQJA 5CMDA 1DYQA 2B8GA 1OXVA 3D3RA 1XYIA 5C44B 4B9WA 3DWQA 3J81E 4K2LA 1LT6D 4K5VA 1CZWA 3S16B 1KDAA 3HOWB 3KLSA 4RWSC 2NYZD 4FF3A 3HGBA 3K57A 5IT9L 3BG3A 4FF4A 2J0TD 3TDQA 4FF1A 2QEJC 1CA6A 3D6CA 2EXZA 3R2IA 1JWMD 5FOBB 3PO3B 3E0JA 1BCPF 1ENAA 2PQEA 2M9VA 2F0GA 3S17B 1LO5D 3EQLC 3FEWX 1QNUA 4ZQ3A 2ICEC 1SBBB 1UNSA 4KN4C 1GOZA 4OO1H 3FMCA 3K5MA 4HMIA 3VA7A 2Q8TA 1Z47A 1YNND 4E6IA 2KJXA 3SXHA 5KNBA 4CJ1B 2KEDA 3FRPB 2DN8A 1CT1D 1ENCA 1HQMC 3J7YW 1ZYRD 5D65A 4R8IA 3DEPA 2XRSD 1FD7D 1IHZA 3A7LA 4KD3A 3DHQA 5K36G 2JYOA 4XQNA 2R7ZB 1Y1WB 2EDGA 4R8NA 1F2MA 4ABNA 1V8QA 3BDOA 1LV9A 4ZUJA 1OXUA 1HA6A 2WINB 1D5ZC 1VDZA 3RZDB 2BOSA 3NBIA 5C3EB 2NBFA 1GHJA 2EY1A 2KUMA 4XXEA 3AB9A 5BN5A 3NTIA 3GD7A 4EQOA 1LACA 2V4DA 1I4XA 1I50B 4C3JG 4ZRZA 2PO4A 3VR2A 5C0XJ 5I6WA 3URYA 2DY8A 3QJYA 2O5IC 4C3JB 4TKOB 1B2TA 3I4LA 1G291 4QUCA 5EGTA 3K6OA 1FNVA 2NUCA 1PXUA 2XNAC 3P20A 3D8GA 3GTOB 5CORA 1NSNS 1SE4A 4UDUC 5EBDA 2EYPA 3K5NA 2F0UA 1GHKA 1LTSD 4BA2I 2F0KA 5IGGA 3CKIB 1G8ZD 3RLFA 4CBVA 1BNZA 3FDTA 3R3OA 2H1EA 4IALA 3GQBA 3P1HA 4XT1B 3EFXD 2BDOA 1LTBD 1DJRD 4HN7A 4FYDA 1PZJD 4DA2A 2BCOA 5LHY1 3PIP3 1H9MA 1JWSD 3PUWA 3MFGA 5IT9E 1OO9B 5CV7A 1MI2A 1JE4A 1I4PA 3SK6A 2ZT9C 4FF2A 1CQVA 3OSOA 3MEHA 2EYMA 2SNSA 4BY1B 1SYDA 3JAML 1ET9A 5FLXL 2A73B 4KHVA 5IGCA 4G7OC 1XWEA 2D9UA 2KOLA 1ILQA 3Q22A 1EY0A 1AFPA 1A3UA 1RTOA 2B8FA 5C4HA 4QCLA 1HQRD 4KY6A 3IFDA 1GUNA 4O42A 2AWOA 3MA2B 4EVOA 4YIJA 1HXYD 1PRTD 1DCZA 3GO5A 1KNEA 3I90A 3PUVA 4CJ2C 2PPBC 1U4MA 5F2DA 1GUOA 3GTGB 5CV8A 2KHSA 5IODA 2ID0A 2EYHA 1NR2A 1FR3A 1IKLA 2JE6I 1WTWA 2L12A 1BUVT 3DEOA 1KAAA 3Q6SA 3I3CA 1PTOC 3SE0A 3SR1A 1TIID 3K7AB 3ND9A 2OT2A 3NBHA 5COYA 4A3EB 2EYOA 4KJNA 3F2UA 1S5BD 1B53A 3CHBD 5AFWA 2HQEA 1STNA 2CW0C 2EY2A 4C1NK 3K0YA 2K33A 2PW5A 4EGVA 2WACA 5FK9C 3K59A 1PZID 5G3LF 3TZDA 1JR0D 5CBAE 1TY0A 3RMHA 3T51B 1SFOB 5KRUA 4KTAA 1BR9A 1D5XC 4PV1C 4C2MB 1TY2A 2WP8J 2C5CA 2QF7A 2O4XA 3DMUA 4JK1C 2LKVA 1B50A 4DAYA 3R2TA 4PMCA 2A6HD 2QILA 3OHXC 1ZKOA 2KCCA 2KVMA 3I4NB 4ZUIA 3CU7A 2KCNA 2FMCA 1A3TA 1F2ZA 3NQIA 2ZXOA 5M5XB 1SJHD 1GJXA 5KEEA 4I65A 4QUFA 3JAME 3IKJA 3QB3A 5FLXE 2WKDA 4HAEA 1JB3A 1DONA 4X3TA 1B1ZA 3ND8A 1MD2D 2IX3A 1HA5A 2JEAI 4RCOA 1Y8NB 4XDXA 1SEBD 1I3QB 4K8IA 1L0XB 2A6HC 1OXTA 1QOHA 4KY5A 4WORA 3ZYYX 2K6AA 3HG9A 4K6LA 2BDNA 4RGNA 5A35A 4RGMA 4ZKCB 3K5LA 4HCEA 1B44D 3I72A 4ZKBB 2F0SA 5M5YB 4HSPA 2PNRC 1TT2A 1HFGA 2EPBA 3KF8A 2O2LD 2L0CA 4OGQC 1AZPA 4IUQA 3H94A 2RKSA 3NUCA 1XTCD 3T4AC 3A7AB 3T13A 1EY9A 2NTSA 2F0NA 1DZ1A 2F0DA 3D4RA 3HOXB 1SNQA 1PTOF 2B2WA 2B2TA 3I91A 2F0TA 1TS5A 4IUUA 2F0LA 3NPPA 5I6YA 3LNNA 1TQOA 4KY7A 5D3DA 3BDLA 5IGBA 3J7AF 5EPJA 1LABA 2F0JA 5CV4A 1EQTA 5E4XA 4A3FB 1ENFA 1V1OA 2IJ0A 2R3ZA 4O1NA 2K5QA 2K7VA 3A54A 1AEXA 1EU3A 3PUYA 5EKLA 2KA7A 3HOYB 4K5WA 2RVLA 1LT5D 5FKAC 5I2YA 5I9OA 3IAYA 1X3QA 1PLFA 2AQ3B 1A3VA 2EVBA 1HUNA 2L4NA 3TP7A 2Q8IB 4L8JA 2RA4A 1VMCA 4L63B 1HCZA 4BWGB 4IN3A 5J1ZA 1WVLA 4RGOS 1NR4A 3WOFA 1F9QA 3SDZA 4KK7A 2Z4IA 5M3FB 1STYA 1TVXA 1EU4A 2R93B 4IUVA 1EY7A 3UI2A 2F03A 3VR6A 2BE5C 1B9NA 3TZUA 2K01A 2H4OA 3RD4A 2FHTA 2NVQB 3ERQA 5KNDA 2SEBD 1BCPB 3BDCA 1STGA 1SYGA 2M2LA 1JQYD 2N55A 3QG1A 1HUMA 4UAIA 2VB2X 1WTXA 5K36H 2ZXRA 3QWNA 3HOZB 2KEEA 3FPUB 4OIKA 2A68D 4FO2A 5CV9A 1O80A 2MP1A 4MN3A 1G2TA 2JP1A 1I4RA 1STEA 4XT3B 2XVSA 3I70A 1I4HA 4FP5D 1D6EC 5KYLA 3LX0A 4PQXA 1EZ8A 1F2LA 3OMCA 3VYUA 3W3AA 4KKTA 1W6JA 5JPMC 1W6KA 4X3SA 3SK5A 3DXJC 2LFNA 1VMPA 1BDOA 2BA0A 2A6ED 5JVG3 4FVMA 3X3NA 2XWJB 2IW3A 2EJFC 3PO2B 5NUCA 3VA5A 1TWFB 3I73A 1XX8A 3L9AX 5C5MA 5IGEA 2ENBA 2RSOA 3KK7A 1SE2A 1IKMA 1R4QB 2K28A 2A68C 3BVMA 4CJ0B 3VYSA 5T1GA 1K8OA 1IW7D 1JOOA 4RA8A 2RDGA 3DM1A 2YYZA 1AN8A 2YU9B 2OXPA 3HP3A 2XIWA 3DWAA 1DM0B 1YNNC 1QB5D 3SEBA 1VCIA 1U4LA 4CHTB 1V43A 4J8QA 2JA6B 4KMUC 5JAVA 1ONLA 2NWGA 4FNFA 2WKCA 1STBA 1FYCA 1CZGA 2B2YC 2EY5A 4KKSA 4U68A 5KIXA 1WD0A 3MXUA 2JA8B 1C4QA 1S5CD 3SK8A 3PV0A 1CHPD 1ZYRC 1WD1A 3WDNA 3GTKB 3KLSX 1E0BA 1TWGB 4I7ZC 1D5MC 2XWBB 2SNMA 4ZYSA 2F0FA 3TN2A 3E5SA 4XYOA 5IOCA 2MUYA 2DY7A 2TMPA 1IW7C 1LTTD 2B2TC 3VR3A 4K8JA 3P75A 1Y8OB 1YNJD 3MZ5A 2A5HA 5EJWA 1UUPA 4DK1A 1SYFA 3MXPA 4H7BA 2LMCB 2NB0A 2FMMA 1F2YA 2EJGC 1JCKB 2NN6G 4RGTA 2K05A 1Q12A 3D31A 3GTPB 1E2VA 1EQVA 5IIFA 2K1BA 1GUWA 3LWEA 3OWEB 4IQZA 3U9SA 5HGTA 2EZVA 1TR5A 2HDMA 1BXTA 2K5DA 1TWHB 1EEID 2NVTB 3VYRA 1KLUD 2EYLA 4TRDA 4CKCA 5DEHA 4J1MA 2DNCA 3PIO3 3D6WA 4K2KA 1C48A 2PYKA 1CI3M 1MBYA 2F3WA 2FJ2A 2JA7B 5ELCA 2KQ3A 3PMFA 2L5TA 1SYCA 3OMGA 1F9SA 2Z8LA 3A55A 3AU7A 3S1RB 1GUGA 4IUPA 3S14B 2F0VA 4X3UA 2JEBI 1J8IA 1AP0A 3H6MA 1SXTA 2PZWA 5E4WC 1H9KA 4BBRB 3CRKC 3PUZA 2PMZB 2F0EA 3S1NB 1EYDA 2F0PA 1PFNA 1CK1A 3BYYB 1WTRA 3MTSA 2AUJD 3S1MB 3IFTA 3GTMB 2MHVA 1PRTC 2MGSA 4JBWA 1HRJA 4A3GB 2LY7A 4QMGA 1E2WA 1S5FD 2Z1CA 3NXWA 3HOVB 4V0BA 1DOKA 3PUXA 1VF5C 1A15A 4M1UB 2J7ZA 2QDBA 2NN6I 3MFYA 5A2QL 1F77A 4F88A 1CM9A 4X3KA 1X32A 2NZ1D 1RF2D 1XXGA 2NVXB 1U4RA 4NW2A 4KJOA 1CA5A 4PMBA 5FO9B 3GTJB 3GTLB 1GXDC 1EY4A 1A2TA 2RSNA 4HTHA 2IX0A 4G57A 4DNTB 1QG7A 4N9TA 4ILWA 2E74C 1HPCA 4WRDA 3DWPA 1E2ZA 1B3AA 1TU2B 3KBXA 2G9DA 2VB3X 1GUSA 1D2BA 5HURA 2RQXA 3CQZB 2VXWA 4QB4A 1SSOA 2CHBD 2NVYB 1RCVD 1BCPD 3Q23A 4KKUA 2F0IA 5C4XB 2TSSA 2E2JB 1F9PA 5C3WA 2AWNA 2IPKD 1KABA 3H0GB 3DUZA 3NWSA 3NTHA 2FFKB 1JOKA 4ZAIA 4DAPA 5I2XA 1OXXK 3M85A 2JA5B 2F3VA 2A74C 5FO8B 4J6HA 1Q90A 1BOSA 5C4JB 5ELBA 3K5OA 2E75C 4HCSA 1HTPA 4PMWA 4XIGS 4HSVA 2IT1A 3M3YB 4ID6A 1O7ZA 1QE6A 1BO0A 2I07B 1TWAB 3MHBA 1JICA 1SNCA 2EE1A 1DOLA 4NMZA 3C2PA 3MVVA 1PTOB 4OIJA 1SDFA 1EZ6A 1C8CA 3N6RA 2L55A 4QF4A 4IUNA 5C3XA 3K58A 3MXNA 1PZKD 2MPMA 1ESFA 3S2DB 1ET6A 1CTMA 1PFBA 4BA1I 4V190 1EWHA 2F0MA 2F0HA 4DXGA 1IL8A 3NSWA 1DOMA 4MHEA 3L3OC 3T16A 2LS01 5DM73 5CGKA 5JVH3 4F8MA 3C46A 1U4PA 2A69D 4RKBA 1PRTF 1RTNA 1II3A 5KGUA 3H09A 1TWCB 5A2QE 1Q1EA 3TP8A 1Y1VB 4F87A 3A8KE 3VYTA 1V1PB 1LTID 1EL0A 3EVQA 2Z4HA 1O7YA 4H0LC 1F9RA 1K8MA 4FXDA 3R93A 4R9WA 3O13A 3A56A 5T1IA 2X6GA 5CC4A 2E2DC 2L11A 5TSSA 3NQTA 4CKEA 3J80L 3QOLA 2A69C 2ICIA 3MXGA 1HHVA 4IFDH 5DNFA 2PW7A 2WAQB 1A6XA 1G6ZA 1I6HB 1EYCA 3NP8A 5D14A 1PFMA 1EIGA 1T5XD 2B2VA 2MJ8A 3NHHA 5ELDA 5I9PA 3NTKA 3TMEA 4U673 4P2CB 1QCBD 1ESRA 3CRLC 5JEAG 1JORA 4LJZC 1LTRD 4HEDA 1O78A 1H9SB 2E2IB 2X69A 4A3MB 4KI0A 2G9HD 5DM63 2K5WA 2K32A 1S5DD 2WB1B 1D1IA 3FKIB 4N9PA 1I4QA 5E3FA 1MSHA 3W2DA 3D4WA 5C0XG 5D3IB 4IFDG 3S2HB 1S4ZA 1HFNA 2N88A 3A8IE 2K03A 3M4OB 3T53B 3V96A 2L1BA 4C1NI 4MIUA 2R6GA 2R92B 1SNOA 4G7HC 1QWYA 1Z7TA 1RODA 2F0WA 4A3DB 1KTKA 3NK9A 5CYUA 2EJMA 1ILPA 3BVGA 3SHLA 5G3LD 1I6VC 1RHPA 1V1PA 2XN9C 1CQFA 3VR5A 2F0OA 4TSSA 1J9OA 4RFBA 1EEFD 3H91A 2HDLA 4A3IB 3WOEA 2Q8RE 1STHA 2NN6H 3M4YA 4FXGC 1G2SA 1LLRD 3MWYW 1AZQA 4A3JB 4ULLA 1Q3LA 3M7NA 4AYBB 5JEAJ 2A6EC 2I46A 1WCMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBF A;  2KCN A;  2NB0 A;  2MHV A;  1AFP A; 
#chains in the Genus database with same CATH topology
 3ERO A;  3KF6 B;  4WFN 3;  1BBW A;  2BA1 A;  4NDX A;  2NVT H;  4X66 Q;  4OO1 G;  5LL6 X;  1KQS A;  1RJT A;  4JC0 A;  5LL6 S;  4B3T Q;  3EA6 A;  2D2C C;  5LMN L;  3NEM A;  4B9X A;  2PZU A;  2WV6 D;  5K5P A;  3J80 E;  5JJZ A;  3EJI A;  2KHJ A;  1SYB A;  1QJO A;  1UAP A;  2X6L A;  3I8Z A;  3J7A V;  5KNC A;  4L6T B;  4ZK9 B;  4XYQ A;  3HKZ G;  3TSS A;  1EWC A;  1H9J A;  4IFD J;  1L0Y B;  2GA4 B;  5ELE A;  4LF7 L;  2JA7 H;  2B2W C;  3A8J E;  4RAU C;  2AQ1 B;  4LWC A;  1SRU A;  1BF4 A;  2ZXP A;  2JXM B;  1IBM L;  1PDQ A;  1SMY D;  2HCI A;  3HKZ B;  1VQN A;  4JPB W;  4A3K G;  1TS3 A;  3S1R H;  3I55 A;  2VZA A;  5KYI A;  3KJO A;  1VQC A;  1KDC A;  3S14 H;  2UXD Q;  5I4D A;  1H9S A;  1HNX L;  1X56 A;  5C0X I;  4RHR A;  3VR4 A;  4IFD I;  3OIP A;  3PIP A;  3DM3 A;  1QNK A;  4A3K B;  2HD3 A;  4IZ8 A;  3ITP A;  4BBR H;  2KEN A;  4H44 C;  5IGF A;  1K83 B;  2RHQ B;  2EY6 A;  2ASB A;  1SNM A;  4LMQ D;  4CDD C;  5IGD A;  3S1N H;  1NE3 A;  2Y0S G;  3A74 A;  4M8A A;  3OW2 A;  3HS0 C;  4ME5 A;  2QKI C;  1A2U A;  2K14 A;  3S1M H;  4UHV A;  3GTM H;  1BQQ T;  3MAQ A;  1EY6 A;  4KN7 C;  4K14 A;  3NEN A;  1EIF A;  2BH8 A;  2Y0S B;  4OXP A;  1LT4 D;  3BYT B;  1YNJ C;  1BBX C;  4A3G H;  3K7U C;  2DNE A;  2MFI A;  1SMY C;  4EQP A;  3HOV H;  1GUT A;  3E6Z X;  4JI8 Q;  2EYJ A;  2NTT A;  1B9M A;  4PG3 A;  4KV6 A;  1KC8 C;  2WII B;  3RZO B;  5BN4 A;  3OWF A;  2JA9 A;  1EOT A;  2ZM6 Q;  1EYA A;  2AQ2 B;  3C3L A;  2JN4 A;  1PTO D;  4RG1 A;  4QQB X;  2PCF B;  1IYU A;  4RMF A;  4LAA A;  3ERS X;  2VUM G;  1NUC A;  1SYE A;  3K8A A;  2NVX H;  1HNW L;  2EYF A;  1XMO Q;  2K5H A;  2IWH A;  3T56 B;  5M3M G;  3CCV A;  4IO9 A;  3H15 A;  5FO7 B;  4DR7 Q;  4A93 H;  3GP7 A;  2RCN A;  3GTJ H;  1RDP D;  3GTL H;  4IUR A;  1B7Y B;  2CW0 D;  5AJ3 Q;  3J80 c;  1PYW D;  2VUM B;  3KDF B;  2B2V C;  3QIA A;  2B39 A;  1VQL A;  2L9H A;  1JC7 A;  1KLG D;  5M3M B;  2VNU D;  4OO1 I;  1CSP A;  4HMJ A;  1I94 Q;  1OTC A;  1HR0 L;  5M5W B;  5LMU L;  1MGS A;  1K0S A;  1J5E Q;  3CQZ H;  5EKI A;  2F1M A;  1IBK Q;  1I4G A;  2OF1 A;  2GVB A;  4OON A;  4RCN A;  3J81 j;  2NVY H;  3N52 A;  4G4K A;  3F2C A;  1WTO A;  1GM5 A;  3AMU A;  1Z6H A;  5EPK A;  2UXB L;  1X3P A;  4K6D A;  2D5D A;  2K04 A;  2B2U A;  3LWU A;  4OWW B;  1NTG A;  4YCU A;  4Z9C B;  1E3P A;  2AKW B;  1V1Q A;  2M00 A;  3KUP A;  4R4I A;  4MZ9 A;  3Q0A A;  1VF7 A;  4LUO A;  2E2J H;  3QO2 A;  2YTY A;  3UE0 A;  4S3S A;  3TP6 A;  3V05 A;  5J22 A;  3HOU G;  3P7J A;  3OOC A;  1SN8 A;  2OQ0 A;  5J39 A;  3CC7 A;  5BN3 A;  3SK4 A;  3KLR A;  3GTQ B;  1EY8 A;  3V2T A;  1HZA A;  5JOB A;  2JA5 H;  2ZTC A;  2Q2I A;  1N32 Q;  4DV3 L;  4K5X A;  1SJE D;  1E1O A;  1X3G A;  2ZTE A;  4X65 Q;  3HOU B;  4A93 G;  3H3V C;  4R4O A;  2BH2 A;  3MC0 B;  5C4J H;  4H13 C;  2HUG A;  2VQF Q;  4B3R Q;  3GV6 A;  3M9B A;  5CBE E;  1KNA A;  3C1E A;  3M3Y H;  1BKB A;  3G6J B;  4A93 B;  1FNU A;  3D4D A;  4HIK A;  5CV6 A;  2C9O A;  2R7D A;  4CKB A;  4QIW B;  4A76 A;  4Y7N B;  4LF5 L;  3X3M A;  4JI6 L;  1R9T B;  1NCV A;  1TWA H;  5EQ0 A;  1VQG A;  1FGU A;  2RBM A;  1RD9 D;  1PTO H;  4NP5 A;  2R61 A;  5E1F A;  4EX5 A;  1KDB A;  4DF7 A;  2D62 A;  1Y69 U;  2F3I A;  1TKW B;  4ZLT F;  1VQA A;  4BY7 H;  2OQK A;  4GZY C;  3J81 i;  2B63 G;  1WTQ A;  1N36 L;  2KEC A;  5FLM G;  3L7Z C;  3I4M H;  4DK0 A;  1IBL L;  4NKL A;  1HTL D;  3S2D H;  4XQQ A;  3NE5 B;  4DN4 M;  4OL7 A;  3FVQ A;  1Q82 C;  2B63 B;  3OPO A;  3M7G A;  2HT1 A;  1Y14 B;  4KD4 A;  2SOB A;  1YHA A;  4BS9 A;  5CV5 A;  4TQU S;  1PMR A;  4RHS A;  1YBY A;  4DAV A;  4A75 A;  4N8X 1;  1GO3 E;  1CHQ D;  2MQH A;  1JT8 A;  1SND A;  3BVZ A;  3J81 L;  2AUK A;  1YVC A;  1EY5 A;  1Y8P B;  3S9W A;  4DR4 L;  3J7Z C;  1TWC H;  4KHZ A;  1JE5 A;  1Y1V H;  4C3H G;  1CSQ A;  1VQB A;  4DXF A;  3D0F A;  3T1H L;  3FP9 A;  3KDF A;  1G91 A;  4JI4 Q;  4RH6 A;  2J4X A;  3AYH B;  4DGZ A;  2HIX A;  3I4O A;  4IUT A;  1BCP C;  3OIQ A;  2E2H B;  3T1Y L;  1A8V A;  2F4I A;  3PQI A;  2MNA A;  1YZ6 A;  2O5J C;  4JCV E;  1OXS C;  4FXK C;  4C3H B;  4BY7 G;  1IYV A;  5C6A A;  1RKN A;  4JI5 Q;  1M8A A;  5IWA Q;  1L1O C;  4AQY L;  4K0K Q;  1ZEQ X;  2ZJQ A;  2OEO A;  2HCC A;  4OHJ A;  5BR8 Q;  1B4O A;  3QOJ A;  3CCM A;  1VQ8 A;  3I4M G;  3I7F A;  2B2Y A;  5J3B A;  2NZO A;  1EIH A;  3FPP A;  3S15 B;  1Q1B A;  2QCP X;  1N8R C;  4BY7 B;  4DR6 L;  1EIY B;  1H95 A;  1MSG A;  1ZXT A;  1SAP A;  5DAU A;  3HEJ A;  3R8B A;  4JYA Q;  4HJ8 A;  2XSC A;  3OW7 A;  3I4M B;  2N78 A;  1S5E D;  3S1Q H;  1PRT B;  3TBI B;  4DR1 L;  1WTV A;  2JSO A;  1I6H H;  4LK1 C;  1CFM A;  2XRQ D;  2CWP A;  4HJ7 A;  1T5E A;  4F7X A;  1K8A C;  3U9O A;  4B08 A;  2RDH A;  3BS1 A;  1M90 C;  4RKL A;  5ISR A;  3ONA B;  4GKJ L;  1CUK A;  5JPN C;  3HRZ C;  1ICW A;  3CXC A;  4DU9 A;  4UY8 C;  4ODG A;  5LMN W;  3CME A;  3I56 A;  3U4V A;  4DNR B;  1QIL A;  4HR7 B;  4BBS G;  4WJW A;  4DR3 Q;  1FGB D;  2SDF A;  1Q8K A;  3NWT A;  4C3I G;  3LGJ A;  3C1F A;  1M4V A;  1R4P B;  4A3B G;  3Q8D A;  3IL8 A;  4EQN A;  1NJI C;  1O7L A;  2E76 C;  4BBS B;  4G7Z C;  3STB C;  1DXM A;  1H9R A;  1ASZ A;  1U9R A;  2E2I H;  3HOW H;  3GV3 A;  4C3I B;  2EOT A;  2CVR A;  3AFP A;  4A3M H;  1JJC B;  4A3B B;  5M9O A;  2IL8 A;  2OCE A;  5JEA H;  3FKI H;  5IYB G;  1ML0 D;  3G7L A;  5EPL A;  4MTN A;  1D1K A;  1FJG Q;  2BE5 D;  1AW7 A;  3KBG A;  1TS4 A;  4C56 C;  4DR5 Q;  1Q8I A;  5EKK A;  2CQA A;  4GKK L;  3HZX A;  1EFI D;  2IX1 A;  3BZD B;  1LTA D;  4XTC S;  1LT3 D;  3QR8 A;  1JWU D;  2RDF A;  1STA A;  3TP5 A;  5C4Z A;  4NXM Q;  4CGY B;  1SE3 A;  1NMF A;  5ELF A;  1JOQ A;  5CR3 A;  2VY3 A;  4LFC L;  1SNP A;  5C0X H;  2FIN B;  3Q24 A;  1TS2 A;  4Q0F A;  4DFA A;  1VQP A;  1UEA B;  5EBC A;  3S1Q B;  2R92 H;  3RUZ A;  2HQL A;  2F0Q A;  3SVM A;  4Q5V A;  1E24 A;  1LTG D;  2B2U C;  1K9M C;  4A3D H;  5C44 G;  1WTP A;  1DD2 A;  2PZT A;  5C5L A;  1NAP A;  3IRB A;  1HNZ Q;  4PNY A;  1FNW A;  4XQJ A;  4P72 A;  1DYQ A;  5CMD A;  2B8G A;  1OXV A;  3HOW G;  1X54 A;  4X64 L;  3D3R A;  1XYI A;  5C44 B;  4B9W A;  1X55 A;  4JI7 L;  1HJP A;  3DLL A;  3DWQ A;  3J81 E;  3RNU A;  4K2L A;  2RF4 A;  3G4S A;  3OTO L;  4DV0 Q;  1LT6 D;  4K5V A;  4ME3 A;  1X65 A;  1CZW A;  3S16 B;  1KL9 A;  1KDA A;  3HOW B;  3TEH B;  3KLS A;  4GOP C;  4A3I H;  2R7Z H;  4RWS C;  2NYZ D;  3PO3 G;  4L5R C;  2UUC Q;  1QVF A;  2KHI A;  4FF3 A;  1IXR A;  3HGB A;  4APV A;  5IP9 H;  3K57 A;  5IT9 L;  4JI3 L;  1X3E A;  3BG3 A;  3CF5 A;  4A3J H;  4FF4 A;  2J0T D;  4R4T A;  3TDQ A;  1L0W A;  4FF1 A;  2QEJ C;  2F4V L;  1BVS A;  1CA6 A;  3D6C A;  3RZD H;  2EXZ A;  1WCM H;  3R2I A;  1JWM D;  1VQM A;  1XNR Q;  5FOB B;  4LF6 Q;  1MKH A;  2HHH Q;  3PO3 B;  3E0J A;  4OWX B;  1BCP F;  4R4C A;  1ENA A;  2LSS A;  2PQE A;  5FJ8 G;  2M9V A;  2CH4 A;  2F0G A;  2I5H A;  3S17 B;  1LO5 D;  1HR0 W;  3EQL C;  3FEW X;  1QNU A;  4ZQ3 A;  4DV5 L;  2ICE C;  3CPF A;  1SBB B;  1UNS A;  4KN4 C;  1GOZ A;  4OO1 H;  3FMC A;  3K5M A;  4HMI A;  3VA7 A;  2Q8T A;  2PI2 A;  2YV5 A;  1Z47 A;  1YNN D;  4E6I A;  2KJX A;  5IYD G;  3RLN A;  3SXH A;  2DJF C;  5KNB A;  4CJ1 B;  4NXN Q;  1VQD A;  1NNX A;  2KED A;  1PH7 A;  2A1A A;  3FRP B;  3ICE A;  2DN8 A;  1PH2 A;  1CT1 D;  1XTD A;  2K5V A;  4LF8 Q;  1ENC A;  2R7Z G;  4DV4 L;  2IY5 B;  1Y1W G;  1HQM C;  3J7Y W;  1ZYR D;  4LF4 Q;  3VDY A;  5D65 A;  4R8I A;  3DEP A;  1Z9F A;  2XRS D;  4A3J G;  1X3F A;  4POG A;  4MTK A;  1FD7 D;  1IHZ A;  3A7L A;  4KD3 A;  3DHQ A;  5K36 G;  2JYO A;  4XQN A;  3TRZ A;  4HIO A;  2R7Z B;  2K5N A;  5C3E G;  1Y1W B;  4JOI A;  2EDG A;  4R8N A;  4X6A H;  3RR5 A;  1F2M A;  4ABN A;  1D8L A;  1V8Q A;  1K83 H;  3BDO A;  4DUY Q;  1LV9 A;  4ZUJ A;  1OXU A;  1HA6 A;  4LFB Q;  3CCJ A;  2WIN B;  1D5Z C;  1VDZ A;  5ELO A;  3RZD B;  2BOS A;  3NBI A;  5C3E B;  2NBF A;  4X66 L;  1GHJ A;  2EY1 A;  2KUM A;  4B3T L;  4XXE A;  2FXQ A;  4PZ8 A;  3J81 c;  3AB9 A;  5BN5 A;  3NTI A;  4IPG A;  3GD7 A;  4EQO A;  4DV7 Q;  1LAC A;  4GN3 B;  2V4D A;  1I4X A;  1I50 B;  4C3J G;  3NBH B;  4ZRZ A;  2PO4 A;  4GNX C;  3VR2 A;  3CC2 A;  4JI0 Q;  3RZO H;  2Z9H A;  5C0X J;  3F2B A;  4JBJ A;  1JJG A;  5I6W A;  1YEZ A;  3URY A;  2DY8 A;  3QJY A;  2O5I C;  4C3J B;  4TKO B;  1B2T A;  3I4L A;  5LMN Q;  1G29 1;  1Q86 C;  4QUC A;  5EGT A;  3K6O A;  3KYH C;  1FNV A;  3K80 C;  1K28 A;  2NUC A;  1PXU A;  2XNA C;  3P20 A;  1SR3 A;  3D8G A;  1WTH A;  3GTO B;  1GVP A;  5COR A;  4IOA A;  1NSN S;  1SE4 A;  4UDU C;  5EBD A;  2UXD L;  4P74 A;  2EYP A;  3K5N A;  2F0U A;  4KHP Q;  4H02 A;  1GHK A;  1LTS D;  4BA2 I;  4I7A A;  2VUM H;  2F0K A;  2D0P A;  5HY6 A;  5IGG A;  1PH4 A;  3CKI B;  1G8Z D;  3RLF A;  4B3M Q;  4CBV A;  1BNZ A;  5HGQ A;  3ULJ A;  5M3M H;  2I5M X;  4DV2 Q;  3FDT A;  3JAM i;  3R3O A;  2H1E A;  4IAL A;  4DV1 Q;  3GQB A;  3P1H A;  1YJW A;  4XT1 B;  3EFX D;  3PF5 A;  3GTG H;  5M5W H;  2BDO A;  1LTB D;  1DJR D;  4HN7 A;  4FYD A;  1PZJ D;  4DA2 A;  4LW1 A;  2PQA B;  2BCO A;  1YIJ A;  5LHY 1;  3PIP 3;  1H9M A;  1JWS D;  1VQH A;  2B29 A;  2Z6B A;  1XNQ Q;  3PUW A;  1K3B C;  4BY1 G;  3MFG A;  3KJP A;  5IT9 E;  1OO9 B;  5CV7 A;  4DAY B;  1MI2 A;  1JE4 A;  1I4P A;  3SK6 A;  2ZT9 C;  4FF2 A;  1CQV A;  3OSO A;  4YHH Q;  3MEH A;  4OX9 Q;  2EYM A;  4LNQ A;  2SNS A;  2PNH A;  1Q7Y C;  3L0O A;  4BY1 B;  4JI8 L;  3WWV A;  1SYD A;  1D7Q A;  3JAM L;  5JJK A;  1ET9 A;  5FLX L;  3GTQ H;  4LUZ A;  2A73 B;  1XPU A;  4KHV A;  1VQ7 A;  3U4Z A;  5IGC A;  4G7O C;  4JVZ A;  4UP7 A;  2CQO A;  3PIO A;  1XWE A;  2I5L X;  2D9U A;  2KOL A;  1ILQ A;  3Q22 A;  4HID A;  1EY0 A;  2EIF A;  3HOU H;  1AFP A;  1QVG A;  1RIP A;  1A3U A;  1RTO A;  2B8F A;  1XMO L;  5C4H A;  4QCL A;  1HQR D;  2AHO B;  1JMC A;  4HIM A;  4KY6 A;  4DR7 L;  2OTL A;  3IFD A;  1GUN A;  4O42 A;  1VQI A;  2AWO A;  3TRE A;  4AYB E;  5AJ3 L;  3L2P A;  3MA2 B;  4EVO A;  1YJ9 A;  4YIJ A;  1HXY D;  1PRT D;  4Y7N H;  1DCZ A;  1R9T H;  3GO5 A;  1KNE A;  3I90 A;  4C2M H;  1I94 L;  2RHS B;  3PUV A;  4CJ2 C;  5IE8 A;  3G71 A;  2PPB C;  1U4M A;  5F2D A;  1J5E L;  1XJV A;  1GUO A;  3GTG B;  5CV8 A;  1IBK L;  2KHS A;  5IOD A;  2ID0 A;  2EYH A;  1NR2 A;  1PH1 A;  1FR3 A;  1NY4 A;  3CAM A;  2UUA Q;  1IKL A;  3KF6 A;  2JE6 I;  4IPC A;  2IHF A;  1WTW A;  1FL0 A;  4A3E G;  2L12 A;  1YIT A;  2N49 A;  1BUV T;  3DEO A;  1KAA A;  3Q6S A;  3I3C A;  1PTO C;  3KF8 B;  3SE0 A;  3SR1 A;  1TII D;  3K7A B;  3ND9 A;  2OT2 A;  4YCW A;  3NBH A;  1HR0 Q;  2B63 H;  5COY A;  2JQO A;  1KXL A;  4A3E B;  2EYO A;  2XTI A;  5FLM H;  4KJN A;  1N33 Q;  3F2U A;  5M5X H;  1S5B D;  1B53 A;  3CHB D;  5AFW A;  2HQE A;  1STN A;  2Z6K C;  2CW0 C;  2EY2 A;  4X65 L;  4C1N K;  1YI2 A;  3K0Y A;  2K33 A;  1S40 A;  1C7Y A;  5E7N A;  2PW5 A;  4EGV A;  2OWO A;  2WAC A;  5FK9 C;  2VQF L;  4IOC A;  5IT9 c;  3K59 A;  1PZI D;  3MEF A;  3F1Z A;  4HJA A;  1I5F A;  3CW2 C;  4DV6 Q;  5G3L F;  1UE5 A;  3AEV A;  1PYB A;  3TZD A;  1JR0 D;  5CBA E;  1TY0 A;  3RMH A;  3CC4 A;  2UU9 Q;  2UXC Q;  3T51 B;  1SFO B;  5KRU A;  2E2H H;  4KTA A;  1ICF B;  1E7Z A;  4JW0 A;  1BR9 A;  4C3H H;  1A0I A;  2K52 A;  1D5X C;  4PV1 C;  3A5U A;  4C2M B;  1TY2 A;  1KRT A;  1KIX A;  2WP8 J;  2C5C A;  2PQA A;  3RN5 A;  4O2D A;  4X62 Q;  3UDI A;  3E9I A;  2QF7 A;  2O4X A;  3DMU A;  3I4N G;  4JK1 C;  3CP0 A;  2LKV A;  3S15 H;  1HZB A;  1B50 A;  1CKN B;  3HKS A;  4IJL A;  2K50 A;  4DAY A;  3R2T A;  4PMC A;  4DUZ Q;  2A6H D;  2QIL A;  3OHX C;  4LF5 Q;  4JOI C;  1C9O A;  3ZJY C;  1ZKO A;  2KCC A;  2LXK A;  5IYC G;  2KVM A;  3I4N B;  4ZUI A;  3CU7 A;  1SE8 A;  2KCN A;  2FMC A;  2R7F A;  1A3T A;  2Z0S A;  1M1K C;  1F2Z A;  4R4Q A;  3NQI A;  4FDB A;  3G6E A;  2ZXO A;  5M5X B;  1XMQ Q;  1SJH D;  5GAE C;  2GVA A;  1GJX A;  5KEE A;  4DNI A;  4P73 A;  4I65 A;  3PSI A;  4QUF A;  3JAM E;  3IKJ A;  3QB3 A;  5FLX E;  1PH9 A;  2WKD A;  4HAE A;  3U58 A;  1PV4 A;  1JB3 A;  1DON A;  4X3T A;  1B1Z A;  3A0J A;  3ND8 A;  1MD2 D;  1PHJ A;  2IX3 A;  1PYS B;  1HA5 A;  2PMZ E;  2JEA I;  4RCO A;  1J6Q A;  3CPW A;  4QY7 A;  1Y8N B;  2YTV A;  4JI4 L;  4LF9 Q;  4BBS H;  4XDX A;  1SEB D;  1GKH A;  1I3Q B;  4K8I A;  4C3I H;  2E5L Q;  1L0X B;  2CWA A;  1G6P A;  2A6H C;  4JI5 L;  4A3B H;  5IWA L;  1OXT A;  1QOH A;  4KY5 A;  4WOR A;  4K0K L;  3ZYY X;  2K6A A;  3HG9 A;  3JC6 6;  5BR8 L;  4K6L A;  4PZ6 A;  4UP9 A;  2BDN A;  2HIV A;  4RGN A;  4GLV B;  5A35 A;  4RGM A;  4ZKC B;  3K5L A;  4HCE A;  1B44 D;  3I72 A;  4ZKB B;  5IYB H;  2F0S A;  5M5Y B;  4HSP A;  2PNR C;  1TT2 A;  4JYA L;  1HFG A;  2EPB A;  3KF8 A;  3U50 C;  2O2L D;  2UUB Q;  2L0C A;  4OGQ C;  4TVA B;  2QW7 A;  1AZP A;  1B3Q A;  4IUQ A;  3H94 A;  3HOX G;  2RKS A;  3NUC A;  1EQR A;  1XTC D;  3A7A B;  3T4A C;  3T13 A;  1EY9 A;  2NTS A;  4P75 A;  2I0Q A;  2F0N A;  5GAG C;  2ZJR A;  1DZ1 A;  2N3S A;  2F0D A;  3D4R A;  4QIW E;  3HOX B;  2VL6 A;  1SNQ A;  1PTO F;  4DR2 Q;  2B2W A;  3A5Z B;  2B3G A;  2B2T A;  4DR3 L;  3I91 A;  2F0T A;  4A3C H;  3AFQ A;  1TS5 A;  2R93 H;  4IUU A;  2F0L A;  3NPP A;  5I6Y A;  2VW9 A;  3LNN A;  1TQO A;  2JJQ A;  5C44 H;  4KY7 A;  1Q81 C;  1QZH A;  4OWT B;  1MJE A;  2OTJ A;  5D3D A;  4A3F G;  3BDL A;  5IGB A;  3S16 H;  3J7A F;  5EPJ A;  1QVC A;  2H5X A;  1LAB A;  3AQQ A;  2F0J A;  5CV4 A;  4IJH A;  1E22 A;  1EQT A;  3HOY G;  5E4X A;  4A3F B;  1ENF A;  3JAM c;  1V1O A;  2IJ0 A;  2R3Z A;  4O1N A;  2K5Q A;  5FLX c;  4DR5 L;  2K7V A;  3A54 A;  1AEX A;  1EU3 A;  3PUY A;  5EKL A;  1CKN A;  2KA7 A;  3PO3 H;  3HOY B;  4K5W A;  2RVL A;  3HOZ H;  4KLK A;  1LT5 D;  5FKA C;  1YHQ A;  4O0A A;  5I2Y A;  3S17 H;  5I9O A;  3IAY A;  4HJ5 A;  1VQE A;  1X3Q A;  1PLF A;  4A4I A;  2QDL A;  2AQ3 B;  4B3S Q;  1A3V A;  2EVB A;  4PZ7 A;  2AMC B;  1HUN A;  2L4N A;  3TP7 A;  2Q8I B;  4DPG A;  5FJ8 H;  4L8J A;  3K0X A;  4A3C G;  5M3F G;  2KCM A;  1IZ6 A;  2RA4 A;  1VMC A;  4L63 B;  2R93 G;  1HCZ A;  4BWG B;  4IN3 A;  1K73 C;  5J1Z A;  1HNZ L;  1WVL A;  4RGO S;  1NR4 A;  4JI1 Q;  3WOF A;  2JK8 A;  2Q2U A;  1F9Q A;  4AH6 A;  3SDZ A;  4KK7 A;  2Z4I A;  5M3F B;  1STY A;  1TVX A;  1EU4 A;  2VQE Q;  1MIU A;  2R93 B;  4IUV A;  1EY7 A;  3UI2 A;  1N34 Q;  2F03 A;  5IYD H;  3VR6 A;  1EUJ A;  4DV0 L;  2Q2T A;  2BE5 C;  1B9N A;  1E1T A;  3TZU A;  1CKM A;  2K01 A;  2H4O A;  4DK3 C;  3RD4 A;  2K75 A;  1Y1W H;  2FHT A;  2NVQ B;  3ERQ A;  5KND A;  2SEB D;  2UUC L;  3W1B A;  1BCP B;  4OEM B;  3HOZ G;  3BDC A;  1STG A;  1SYG A;  2M2L A;  1JQY D;  2N55 A;  1PH3 A;  2LXJ A;  1L1O B;  1HUM A;  3QG1 A;  4UAI A;  2VB2 X;  3RLO A;  1UE6 A;  1WTX A;  1XNR L;  5K36 H;  2ZXR A;  2YU9 H;  3QWN A;  4UP8 A;  2HHH L;  5C3E H;  2PI2 E;  5IP7 G;  3HOZ B;  1HZC A;  2JA6 H;  2KEE A;  4JBM A;  3FPU B;  4OIK A;  2A68 D;  1BBU A;  3ER0 A;  1VQ5 A;  4FO2 A;  5CV9 A;  4P71 A;  1O80 A;  3EBE A;  2MP1 A;  4MN3 A;  1G2T A;  4ZCK A;  1I50 H;  2JP1 A;  4JI3 Q;  1I4R A;  2DUD A;  1STE A;  4NPS A;  4XT3 B;  2XVS A;  3I70 A;  1I4H A;  1EFW A;  4OEL B;  4FP5 D;  1D6E C;  5KYL A;  3LX0 A;  4PQX A;  3J7A 5;  1EZ8 A;  1F2L A;  4GLA C;  3OMC A;  4POF A;  3VYU A;  3CCQ A;  4C3J H;  3PO2 G;  3W3A A;  4NXN L;  4KKT A;  5L37 A;  1W6J A;  5JPM C;  4A3L H;  3CCU A;  1W6K A;  4LFA Q;  4X3S A;  1T9H A;  3SK5 A;  4LF8 L;  3DXJ C;  3GTO H;  2LFN A;  1VMP A;  1BDO A;  2BA0 A;  2A6E D;  5JVG 3;  4FVM A;  3X3N A;  2XWJ B;  2IW3 A;  2EJF C;  4LF4 L;  3PO2 B;  5NUC A;  3VA5 A;  1AE2 A;  1TWF B;  3I73 A;  1XX8 A;  3L9A X;  2XGT A;  5C5M A;  5IGE A;  2ENB A;  2RSO A;  3KK7 A;  3TS0 A;  1SE2 A;  1IKM A;  3SGI A;  1R4Q B;  4GLX A;  2K28 A;  4JV5 Q;  4EQ5 A;  4J15 A;  2A68 C;  4DUY L;  3BVM A;  4CJ0 B;  2WAQ E;  4LFB L;  3VYS A;  2JA6 G;  5T1G A;  1K8O A;  1IW7 D;  1JOO A;  4RA8 A;  2RDG A;  2C35 B;  3DM1 A;  2YYZ A;  1AN8 A;  2YU9 B;  2OXP A;  3HP3 A;  2XIW A;  1S3O A;  3DWA A;  1DM0 B;  4GS3 A;  1YNN C;  4L5Q A;  1QB5 D;  3SEB A;  1VCI A;  1U4L A;  4JI2 Q;  3PCO B;  4CHT B;  2JA8 G;  1V43 A;  4J8Q A;  2JA6 B;  4KMU C;  5JAV A;  4DV7 L;  3S24 A;  1ONL A;  2NWG A;  4FNF A;  2WKC A;  3F8T A;  1STB A;  4YY3 Q;  1FYC A;  2CFM A;  1CZG A;  4BY1 H;  2B2Y C;  2EY5 A;  4KKS A;  4U68 A;  5KIX A;  1WD0 A;  4JI0 L;  4A3L G;  3MXU A;  2JA8 B;  1C4Q A;  1S5C D;  3SK8 A;  3PV0 A;  2MO1 A;  1CHP D;  1LTL A;  1ZYR C;  1WD1 A;  4CDF C;  3WDN A;  3GTK B;  3KLS X;  1E0B A;  1DGS A;  1TWG B;  4I7Z C;  1D5M C;  3BZK A;  2XWB B;  2SNM A;  2WB1 E;  4ZYS A;  1VQK A;  4JBK A;  2F0F A;  1W2B A;  3TN2 A;  1QZG A;  3E5S A;  3KOJ A;  4XYO A;  4L5S A;  5IOC A;  4KHP L;  2MUY A;  1MHW C;  3W1G A;  2DY7 A;  2TMP A;  1G51 A;  1IW7 C;  3BJU A;  4B3M L;  2NZH A;  1S72 A;  1LTT D;  2B2T C;  4LF7 Q;  3VR3 A;  4K8J A;  3P75 A;  4DV2 L;  1Y8O B;  1YNJ D;  3MZ5 A;  4DV1 L;  2A5H A;  4QJF A;  5EJW A;  5DLQ E;  1UUP A;  4DK1 A;  3ULP A;  4MNO A;  1SYF A;  3EN2 A;  4GOP B;  3MXP A;  4H7B A;  1IBM Q;  2LMC B;  2NB0 A;  1L1O A;  2FMM A;  1F2Y A;  2EJG C;  4YWK A;  1JCK B;  1O7I A;  2CH4 W;  2NN6 G;  4RGT A;  2K05 A;  1Q12 A;  1XNQ L;  3D31 A;  1EQQ A;  1HNX Q;  2WFW A;  3GTP B;  1E2V A;  1EQV A;  1PA6 A;  1P8L A;  4YHH L;  2CCZ A;  4OX9 L;  1W3S A;  4AIM A;  1CKO A;  3K7A H;  5IIF A;  2K1B A;  1GUW A;  3LWE A;  3OWE B;  4IQZ A;  3U9S A;  5HGT A;  4A3E H;  2EZV A;  1TR5 A;  2HDM A;  3M4Q A;  1BXT A;  2K5D A;  1TWH B;  1K0R A;  1KD1 C;  2ZM6 L;  1EEI D;  2KCT A;  2NVT B;  3VYR A;  1KLU D;  3BU2 A;  2EYL A;  4TRD A;  4CKC A;  4YWM A;  3CCR A;  4BXX H;  1SLJ A;  2JA7 G;  4IPH A;  5GAD C;  2MO0 A;  2CKZ B;  5DEH A;  4J1M A;  2ATW A;  2DNC A;  3PIO 3;  3D6W A;  4N8F A;  4K2K A;  2Q2H A;  3E9H A;  1C48 A;  1AE3 A;  2PYK A;  1SFO H;  1CI3 M;  1MBY A;  1V9P A;  2F3W A;  2FJ2 A;  2JA7 B;  1KAW A;  4LUV A;  5ELC A;  2KQ3 A;  3PMF A;  4GN5 A;  2L5T A;  1SYC A;  3OMG A;  1F9S A;  1VS0 A;  3OYY A;  1HNW Q;  2Z8L A;  3A55 A;  3AU7 A;  4BBR G;  3S1R B;  1EWI A;  1GUG A;  4IUP A;  2UUA L;  3S14 B;  2F0V A;  1LM0 A;  4X3U A;  2JEB I;  1J8I A;  1AP0 A;  1ASY A;  3H6M A;  1SXT A;  2PZW A;  5E4W C;  1GD7 A;  1H9K A;  1Q46 A;  4BBR B;  3I4N H;  3CRK C;  1U0L A;  1QUQ B;  3PUZ A;  2PMZ B;  3HKZ E;  2F0E A;  5LMU Q;  1VQ4 A;  3S1N B;  3EIV A;  1N33 L;  1EYD A;  2F0P A;  1X6O A;  1PVO A;  4A3G G;  1PFN A;  1CK1 A;  3BYY B;  2V1C C;  5IYC H;  4GNX B;  1WTR A;  1PH5 A;  4BXX G;  3MTS A;  2AUJ D;  2ZTD A;  3HOV G;  3S1M B;  5H1S E;  3IFT A;  2VS1 A;  3GTM B;  1N32 L;  2MHV A;  2UXB Q;  3MXN B;  5C4X H;  1PRT C;  1VQO A;  5IY0 A;  3CCS A;  2MGS A;  4JBW A;  1HRJ A;  4A3G B;  2LY7 A;  4QMG A;  4B3R L;  1E2W A;  1S5F D;  2D0O A;  2Z1C A;  3H0G H;  1PFS A;  3NXW A;  4DV6 L;  3HOV B;  4V0B A;  1DOK A;  3PUX A;  1VQF A;  1XPR A;  1IL2 A;  1VF5 C;  1A15 A;  1VQJ A;  4M1U B;  2UU9 L;  2J7Z A;  2UXC L;  2QDB A;  2NN6 I;  3MFY A;  1I3Q H;  1AH9 A;  5A2Q L;  1F77 A;  4F88 A;  1CM9 A;  3B6Y A;  1X32 A;  4X3K A;  2NZ1 D;  4DV3 Q;  1RF2 D;  4GOP A;  1XXG A;  2E8G A;  2Y0S E;  2NVX B;  1U4R A;  4X62 L;  4NW2 A;  4KJO A;  2GN5 A;  1WFQ A;  3CCE A;  1CA5 A;  4PMB A;  5FO9 B;  3GTJ B;  3GTL B;  1GXD C;  1EY4 A;  5M5Y H;  1A2T A;  2RSN A;  4HTH A;  4DUZ L;  4ALP A;  2IX0 A;  4JG2 A;  4G57 A;  4DNT B;  1QG7 A;  4N9T A;  4ILW A;  2E74 C;  1HPC A;  4JI6 Q;  4WRD A;  3DWP A;  5JJL A;  1E2Z A;  1B3A A;  1TU2 B;  3KBX A;  5GQO A;  3F2D A;  1SRO A;  2DGY A;  2G9D A;  2VB3 X;  1GUS A;  1D2B A;  5HUR A;  2RQX A;  3CQZ B;  5C4X G;  2VXW A;  4QB4 A;  1UE1 A;  1SSO A;  1XMQ L;  2CHB D;  2NVY B;  1RCV D;  1BCP D;  1N36 Q;  3H0G G;  1VQ6 A;  3HOX H;  1K3R A;  2QGQ A;  3Q23 A;  4KKU A;  2F0I A;  5C4X B;  2TSS A;  1IBL Q;  2JA5 G;  2E2J B;  1WOC A;  3H3V H;  1F9P A;  5C3W A;  2AWN A;  2QA4 A;  2IPK D;  1KAB A;  3H0G B;  3G48 A;  3UE1 A;  3DUZ A;  3NWS A;  3NTH A;  4LF9 L;  2FFK B;  1JOK A;  4ZAI A;  4DAP A;  5I2X A;  1OXX K;  3M85 A;  2E5L L;  2JA5 B;  2F3V A;  2K4K A;  2A74 C;  5FO8 B;  1X9N A;  3HFZ B;  1XPO A;  4J6H A;  3W5O A;  1Q90 A;  4L5T A;  1BOS A;  2F52 A;  5C4J B;  5ELB A;  4DR4 Q;  3K5O A;  2E75 C;  4HCS A;  5GAH C;  4A3F H;  3TS2 A;  1HTP A;  1FVI A;  4PMW A;  4XIG S;  1SMX A;  4HSV A;  2IT1 A;  2DJG C;  3M3Y B;  4ID6 A;  3CMA A;  3T1H Q;  1VQ9 A;  3UDX A;  3HOY H;  4IPD A;  1JB7 A;  3CCL A;  1O7Z A;  1QE6 A;  1BO0 A;  2UUB L;  2I07 B;  1TWA B;  3T1Y Q;  3MHB A;  1KRS A;  1JIC A;  1SNC A;  2EE1 A;  1DOL A;  4NMZ A;  1QUQ A;  3C2P A;  3MVV A;  1PTO B;  4AQY Q;  4OIJ A;  3M4P A;  1RL2 A;  1SDF A;  1JJ2 A;  1EZ6 A;  1C8C A;  3STB D;  3N6R A;  4CDE C;  2L55 A;  4GNX A;  4QF4 A;  2A8V A;  4IUN A;  5C3X A;  3K58 A;  3I2Z A;  4R1J A;  1UE7 A;  4DR6 Q;  3MXN A;  4DR2 L;  4YCV A;  1PZK D;  2EXD A;  2IHE A;  2MPM A;  1ESF A;  3S2D B;  5M3F H;  1ET6 A;  1CTM A;  1HH2 P;  1PFB A;  4BA1 I;  4V19 0;  1YNX A;  4DR1 Q;  1EWH A;  2F0M A;  2F0H A;  4DXG A;  1IL8 A;  3NSW A;  1DOM A;  4MHE A;  3L3O C;  2G5D A;  3T16 A;  2LS0 1;  1A63 A;  5DM7 3;  3K81 C;  5CGK A;  3TQY A;  5JVH 3;  4F8M A;  4GKJ Q;  3C46 A;  1U4P A;  1Y1V G;  2A69 D;  4RKB A;  1PRT F;  1RTN A;  1N9W A;  1II3 A;  2NVQ H;  5KGU A;  2YTX A;  3H09 A;  1TWC B;  5A2Q E;  1IYJ B;  1FJG L;  3J80 i;  1Q1E A;  3TP8 A;  1Y1V B;  4F87 A;  3A8K E;  3VYT A;  1V1P B;  1LTI D;  1EL0 A;  3EVQ A;  2Z4H A;  1O7Y A;  4H0L C;  1F9R A;  4DKA C;  5EAY A;  4NXM L;  1LUZ A;  1K8M A;  4FXD A;  4NB3 A;  3PGZ A;  4R9W A;  3R93 A;  4B3S L;  3O13 A;  3A56 A;  5T1I A;  2X6G A;  5CC4 A;  3KLW A;  2E2D C;  5IP7 H;  4QGU A;  3UDF A;  4UPA A;  2L11 A;  2WAQ G;  5TSS A;  3S2H H;  4GKK Q;  3NQT A;  4CKE A;  3J80 L;  3M4O H;  3QOL A;  3E3X A;  4JI1 L;  1HZ9 A;  1PH8 A;  2A69 C;  2ICI A;  3MXG A;  1HHV A;  2ES2 A;  4DAM A;  1KHI A;  4IFD H;  5DNF A;  2PW7 A;  2VQE L;  2WAQ B;  4LFC Q;  1A6X A;  4WJ3 M;  1G6Z A;  1N34 L;  2ALY B;  1I6H B;  1EYC A;  3NEL A;  3NP8 A;  2KBN A;  3PO2 H;  5D14 A;  1TWF H;  1PFM A;  1EIG A;  4GN4 B;  1T5X D;  2B2V A;  2MJ8 A;  2P5Z X;  3NHH A;  5ELD A;  5I9P A;  3NTK A;  3TME A;  4U67 3;  4HJ9 A;  4P2C B;  4A3M G;  1QCB D;  1ESR A;  2RCF A;  4X64 Q;  3CRL C;  5JEA G;  3ULL A;  2WB1 G;  3FKI G;  4JI7 Q;  1JOR A;  3KFU A;  4LJZ C;  1LTR D;  4LF6 L;  4HED A;  3OTO Q;  3CD6 A;  1O78 A;  1H9S B;  2E2I B;  2X69 A;  3H3V I;  4A3M B;  3GDE A;  4KI0 A;  3RN2 A;  2G9H D;  5DM6 3;  2K5W A;  1EYG A;  2K32 A;  1S5D D;  2WB1 B;  1D1I A;  3FKI B;  4N9P A;  2ZJP A;  2L15 A;  1I4Q A;  1LYL A;  5E3F A;  3E0E A;  1MSH A;  2QEX A;  3W2D A;  3FHW A;  3D4W A;  2JA8 H;  5C0X G;  2F4V Q;  1C0A A;  1TXY A;  5D3I B;  4IFD G;  2R92 G;  3S2H B;  1S4Z A;  1HFN A;  2N88 A;  1K8G A;  2Z6K A;  1WJJ A;  1MJC A;  4CDC C;  1PH6 A;  3A8I E;  2K03 A;  3GTK H;  3M4O B;  3T53 B;  3V96 A;  4LFA L;  1TWG H;  1P16 A;  2L1B A;  4C1N I;  1WI5 A;  4A3D G;  1B70 B;  4MIU A;  4DV5 Q;  2R6G A;  2R92 B;  4QL5 A;  1SNO A;  4G7H C;  1QWY A;  4Y52 H;  2N8N A;  1Z7T A;  1ROD A;  4YWL A;  1L2F A;  2F0W A;  1UWV A;  5JJI A;  4DK6 C;  4A3D B;  1KTK A;  4JV5 L;  3NK9 A;  5CYU A;  2EJM A;  1U5K A;  1ILP A;  3BVG A;  3SHL A;  1EOV A;  4A3I G;  5G3L D;  1I6V C;  1YHB A;  4DV4 Q;  1A62 A;  1RHP A;  3BZC A;  1V1P A;  1NBW A;  2XN9 C;  1CQF A;  1YJN A;  1UEB A;  5IP9 G;  1B8A A;  2A19 A;  2F0O A;  4TSS A;  3VR5 A;  1J9O A;  4RFB A;  3GTP H;  4JI2 L;  4A3K H;  4AYB G;  1EEF D;  2EQS A;  3H91 A;  2HDL A;  4A3I B;  1WCM G;  3WOE A;  2Q8R E;  1STH A;  5ELN A;  2NN6 H;  3M4Y A;  4FXG C;  4YY3 L;  1G2S A;  1WYD A;  1LLR D;  3MWY W;  1AZQ A;  4A3J B;  4ULL A;  5GRO A;  1Q3L A;  1NMG A;  3M7N A;  4AYB B;  3UDG A;  5JEA J;  3PF4 A;  2A6E C;  2I46 A;  4WJ4 A;  1TWH H;  1WCM B; 
#chains in the Genus database with same CATH homology
 3ERO A;  4WFN 3;  2BA1 A;  4NDX A;  4OO1 G;  5LL6 X;  1RJT A;  5LL6 S;  3EA6 A;  2D2C C;  4B9X A;  2PZU A;  2WV6 D;  5K5P A;  3J80 E;  5JJZ A;  3EJI A;  1SYB A;  1QJO A;  1UAP A;  2X6L A;  3I8Z A;  3J7A V;  5KNC A;  4L6T B;  4ZK9 B;  4XYQ A;  3TSS A;  1EWC A;  1H9J A;  4IFD J;  1L0Y B;  2GA4 B;  5ELE A;  2B2W C;  3A8J E;  4RAU C;  2AQ1 B;  1BF4 A;  2ZXP A;  2JXM B;  1PDQ A;  1SMY D;  2HCI A;  3HKZ B;  1TS3 A;  5KYI A;  1KDC A;  5I4D A;  1H9S A;  5C0X I;  4RHR A;  3VR4 A;  4IFD I;  3OIP A;  1QNK A;  4A3K B;  4IZ8 A;  3ITP A;  4H44 C;  5IGF A;  1K83 B;  2EY6 A;  1SNM A;  4LMQ D;  5IGD A;  4M8A A;  3HS0 C;  4ME5 A;  2QKI C;  1A2U A;  1BQQ T;  3MAQ A;  1EY6 A;  4KN7 C;  4K14 A;  2Y0S B;  1LT4 D;  3BYT B;  1YNJ C;  1BBX C;  2DNE A;  1SMY C;  4EQP A;  1GUT A;  3E6Z X;  2EYJ A;  2NTT A;  1B9M A;  4KV6 A;  3RZO B;  2WII B;  5BN4 A;  3OWF A;  1EOT A;  1EYA A;  2AQ2 B;  3C3L A;  1PTO D;  2PCF B;  1IYU A;  4LAA A;  1NUC A;  1SYE A;  2EYF A;  2IWH A;  3T56 B;  5FO7 B;  3GP7 A;  1RDP D;  4IUR A;  2CW0 D;  1PYW D;  2VUM B;  2B2V C;  3QIA A;  2B39 A;  2L9H A;  1JC7 A;  1KLG D;  5M3M B;  2VNU D;  4OO1 I;  4HMJ A;  5M5W B;  1MGS A;  5EKI A;  2F1M A;  1I4G A;  2OF1 A;  4RCN A;  3N52 A;  4G4K A;  1WTO A;  3AMU A;  1Z6H A;  5EPK A;  1X3P A;  4K6D A;  2D5D A;  2K04 A;  2B2U A;  3LWU A;  4Z9C B;  3Q0A A;  2M00 A;  3KUP A;  1VF7 A;  3QO2 A;  4S3S A;  3TP6 A;  3V05 A;  5J22 A;  3P7J A;  3OOC A;  5J39 A;  5BN3 A;  3SK4 A;  3KLR A;  3GTQ B;  1EY8 A;  3V2T A;  5JOB A;  4K5X A;  1SJE D;  3HOU B;  3H3V C;  3MC0 B;  4H13 C;  2HUG A;  3GV6 A;  5CBE E;  1KNA A;  3C1E A;  3G6J B;  4A93 B;  1FNU A;  3D4D A;  5CV6 A;  2C9O A;  4CKB A;  4QIW B;  4Y7N B;  3X3M A;  1R9T B;  1NCV A;  5EQ0 A;  2RBM A;  1RD9 D;  1PTO H;  4NP5 A;  2R61 A;  5E1F A;  1KDB A;  4DF7 A;  2D62 A;  1Y69 U;  1TKW B;  4ZLT F;  4GZY C;  1WTQ A;  2KEC A;  3L7Z C;  4DK0 A;  4NKL A;  1HTL D;  4XQQ A;  3NE5 B;  4DN4 M;  4OL7 A;  3FVQ A;  2B63 B;  3OPO A;  3M7G A;  4KD4 A;  2SOB A;  4BS9 A;  5CV5 A;  4TQU S;  1PMR A;  4RHS A;  4DAV A;  1CHQ D;  1SND A;  3BVZ A;  3J81 L;  2AUK A;  1EY5 A;  1Y8P B;  3S9W A;  4KHZ A;  4C3H G;  4DXF A;  1G91 A;  4RH6 A;  2J4X A;  4DGZ A;  4IUT A;  1BCP C;  3OIQ A;  2E2H B;  2F4I A;  2O5J C;  1OXS C;  4FXK C;  4C3H B;  1IYV A;  5C6A A;  1RKN A;  1M8A A;  1ZEQ X;  2OEO A;  2HCC A;  4OHJ A;  1B4O A;  3QOJ A;  2B2Y A;  1EIH A;  3FPP A;  3S15 B;  1Q1B A;  2QCP X;  4BY7 B;  1MSG A;  1ZXT A;  1SAP A;  5DAU A;  3HEJ A;  3R8B A;  2XSC A;  3OW7 A;  3I4M B;  1S5E D;  1PRT B;  3TBI B;  1WTV A;  2JSO A;  4LK1 C;  1CFM A;  2XRQ D;  1T5E A;  4F7X A;  3U9O A;  4B08 A;  2RDH A;  3BS1 A;  4RKL A;  5ISR A;  3ONA B;  5JPN C;  3HRZ C;  1ICW A;  4DU9 A;  4ODG A;  4DNR B;  1QIL A;  4HR7 B;  4WJW A;  1FGB D;  2SDF A;  3NWT A;  4C3I G;  3C1F A;  1M4V A;  1R4P B;  3IL8 A;  4EQN A;  1O7L A;  2E76 C;  4BBS B;  4G7Z C;  1DXM A;  1H9R A;  1U9R A;  3GV3 A;  4C3I B;  2EOT A;  2CVR A;  4A3B B;  5M9O A;  2IL8 A;  5JEA H;  1ML0 D;  3G7L A;  5EPL A;  1D1K A;  2BE5 D;  1AW7 A;  3KBG A;  1TS4 A;  4C56 C;  1Q8I A;  5EKK A;  2CQA A;  3HZX A;  1EFI D;  2IX1 A;  3BZD B;  1LTA D;  4XTC S;  1LT3 D;  1JWU D;  2RDF A;  1STA A;  3TP5 A;  5C4Z A;  4CGY B;  1SE3 A;  5ELF A;  1JOQ A;  5CR3 A;  1SNP A;  5C0X H;  2FIN B;  3Q24 A;  1TS2 A;  4Q0F A;  4DFA A;  1UEA B;  5EBC A;  3S1Q B;  3RUZ A;  2F0Q A;  3SVM A;  4Q5V A;  1LTG D;  2B2U C;  1WTP A;  1DD2 A;  2PZT A;  5C5L A;  1NAP A;  4PNY A;  1FNW A;  4XQJ A;  5CMD A;  1DYQ A;  2B8G A;  1OXV A;  3D3R A;  1XYI A;  5C44 B;  4B9W A;  3DWQ A;  3J81 E;  4K2L A;  1LT6 D;  4K5V A;  1CZW A;  3S16 B;  1KDA A;  3HOW B;  3KLS A;  4RWS C;  2NYZ D;  4FF3 A;  3HGB A;  3K57 A;  5IT9 L;  3BG3 A;  4FF4 A;  2J0T D;  3TDQ A;  4FF1 A;  2QEJ C;  1CA6 A;  3D6C A;  2EXZ A;  3R2I A;  1JWM D;  5FOB B;  3PO3 B;  3E0J A;  1BCP F;  1ENA A;  2PQE A;  2M9V A;  2F0G A;  3S17 B;  1LO5 D;  3EQL C;  3FEW X;  1QNU A;  4ZQ3 A;  2ICE C;  1SBB B;  1UNS A;  4KN4 C;  1GOZ A;  4OO1 H;  3FMC A;  3K5M A;  4HMI A;  3VA7 A;  2Q8T A;  1Z47 A;  1YNN D;  4E6I A;  2KJX A;  3SXH A;  5KNB A;  4CJ1 B;  2KED A;  3FRP B;  2DN8 A;  1CT1 D;  1ENC A;  1HQM C;  3J7Y W;  1ZYR D;  5D65 A;  4R8I A;  3DEP A;  2XRS D;  1FD7 D;  1IHZ A;  3A7L A;  4KD3 A;  3DHQ A;  5K36 G;  2JYO A;  4XQN A;  2R7Z B;  1Y1W B;  2EDG A;  4R8N A;  1F2M A;  4ABN A;  1V8Q A;  3BDO A;  1LV9 A;  4ZUJ A;  1OXU A;  1HA6 A;  2WIN B;  1D5Z C;  1VDZ A;  3RZD B;  2BOS A;  3NBI A;  5C3E B;  2NBF A;  1GHJ A;  2EY1 A;  2KUM A;  4XXE A;  3AB9 A;  5BN5 A;  3NTI A;  3GD7 A;  4EQO A;  1LAC A;  2V4D A;  1I4X A;  1I50 B;  4C3J G;  4ZRZ A;  2PO4 A;  3VR2 A;  5C0X J;  5I6W A;  3URY A;  2DY8 A;  3QJY A;  2O5I C;  4C3J B;  4TKO B;  1B2T A;  3I4L A;  1G29 1;  4QUC A;  5EGT A;  3K6O A;  1FNV A;  2NUC A;  1PXU A;  2XNA C;  3P20 A;  3D8G A;  3GTO B;  5COR A;  1NSN S;  1SE4 A;  4UDU C;  5EBD A;  2EYP A;  3K5N A;  2F0U A;  1GHK A;  1LTS D;  4BA2 I;  2F0K A;  5IGG A;  3CKI B;  1G8Z D;  3RLF A;  4CBV A;  1BNZ A;  3FDT A;  3R3O A;  2H1E A;  4IAL A;  3GQB A;  3P1H A;  4XT1 B;  3EFX D;  2BDO A;  1LTB D;  1DJR D;  4HN7 A;  4FYD A;  1PZJ D;  4DA2 A;  2BCO A;  5LHY 1;  3PIP 3;  1H9M A;  1JWS D;  3PUW A;  3MFG A;  5IT9 E;  1OO9 B;  5CV7 A;  1MI2 A;  1JE4 A;  1I4P A;  3SK6 A;  2ZT9 C;  4FF2 A;  1CQV A;  3OSO A;  3MEH A;  2EYM A;  2SNS A;  4BY1 B;  1SYD A;  3JAM L;  1ET9 A;  5FLX L;  2A73 B;  4KHV A;  5IGC A;  4G7O C;  1XWE A;  2D9U A;  2KOL A;  1ILQ A;  3Q22 A;  1EY0 A;  1AFP A;  1A3U A;  1RTO A;  2B8F A;  5C4H A;  4QCL A;  1HQR D;  4KY6 A;  3IFD A;  1GUN A;  4O42 A;  2AWO A;  3MA2 B;  4EVO A;  4YIJ A;  1HXY D;  1PRT D;  1DCZ A;  3GO5 A;  1KNE A;  3I90 A;  3PUV A;  4CJ2 C;  2PPB C;  1U4M A;  5F2D A;  1GUO A;  3GTG B;  5CV8 A;  2KHS A;  5IOD A;  2ID0 A;  2EYH A;  1NR2 A;  1FR3 A;  1IKL A;  2JE6 I;  1WTW A;  2L12 A;  1BUV T;  3DEO A;  1KAA A;  3Q6S A;  3I3C A;  1PTO C;  3SE0 A;  3SR1 A;  1TII D;  3K7A B;  3ND9 A;  2OT2 A;  3NBH A;  5COY A;  4A3E B;  2EYO A;  4KJN A;  3F2U A;  1S5B D;  1B53 A;  3CHB D;  5AFW A;  2HQE A;  1STN A;  2CW0 C;  2EY2 A;  4C1N K;  3K0Y A;  2K33 A;  2PW5 A;  4EGV A;  2WAC A;  5FK9 C;  3K59 A;  1PZI D;  5G3L F;  3TZD A;  1JR0 D;  5CBA E;  1TY0 A;  3RMH A;  3T51 B;  1SFO B;  5KRU A;  4KTA A;  1BR9 A;  1D5X C;  4PV1 C;  4C2M B;  1TY2 A;  2WP8 J;  2C5C A;  2QF7 A;  2O4X A;  3DMU A;  4JK1 C;  2LKV A;  1B50 A;  4DAY A;  3R2T A;  4PMC A;  2A6H D;  2QIL A;  3OHX C;  1ZKO A;  2KCC A;  2KVM A;  3I4N B;  4ZUI A;  3CU7 A;  2KCN A;  2FMC A;  1A3T A;  1F2Z A;  3NQI A;  2ZXO A;  5M5X B;  1SJH D;  1GJX A;  5KEE A;  4I65 A;  4QUF A;  3JAM E;  3IKJ A;  3QB3 A;  5FLX E;  2WKD A;  4HAE A;  1JB3 A;  1DON A;  4X3T A;  1B1Z A;  3ND8 A;  1MD2 D;  2IX3 A;  1HA5 A;  2JEA I;  4RCO A;  1Y8N B;  4XDX A;  1SEB D;  1I3Q B;  4K8I A;  1L0X B;  2A6H C;  1OXT A;  1QOH A;  4KY5 A;  4WOR A;  3ZYY X;  2K6A A;  3HG9 A;  4K6L A;  2BDN A;  4RGN A;  5A35 A;  4RGM A;  4ZKC B;  3K5L A;  4HCE A;  1B44 D;  3I72 A;  4ZKB B;  2F0S A;  5M5Y B;  4HSP A;  2PNR C;  1TT2 A;  1HFG A;  2EPB A;  3KF8 A;  2O2L D;  2L0C A;  4OGQ C;  1AZP A;  4IUQ A;  3H94 A;  2RKS A;  3NUC A;  1XTC D;  3T4A C;  3A7A B;  3T13 A;  1EY9 A;  2NTS A;  2F0N A;  1DZ1 A;  2F0D A;  3D4R A;  3HOX B;  1SNQ A;  1PTO F;  2B2W A;  2B2T A;  3I91 A;  2F0T A;  1TS5 A;  4IUU A;  2F0L A;  3NPP A;  5I6Y A;  3LNN A;  1TQO A;  4KY7 A;  5D3D A;  3BDL A;  5IGB A;  3J7A F;  5EPJ A;  1LAB A;  2F0J A;  5CV4 A;  1EQT A;  5E4X A;  4A3F B;  1ENF A;  1V1O A;  2IJ0 A;  2R3Z A;  4O1N A;  2K5Q A;  2K7V A;  3A54 A;  1AEX A;  1EU3 A;  3PUY A;  5EKL A;  2KA7 A;  3HOY B;  4K5W A;  2RVL A;  1LT5 D;  5FKA C;  5I2Y A;  5I9O A;  3IAY A;  1X3Q A;  1PLF A;  2AQ3 B;  1A3V A;  2EVB A;  1HUN A;  2L4N A;  3TP7 A;  2Q8I B;  4L8J A;  2RA4 A;  1VMC A;  4L63 B;  1HCZ A;  4BWG B;  4IN3 A;  5J1Z A;  1WVL A;  4RGO S;  1NR4 A;  3WOF A;  1F9Q A;  3SDZ A;  4KK7 A;  2Z4I A;  5M3F B;  1STY A;  1TVX A;  1EU4 A;  2R93 B;  4IUV A;  1EY7 A;  3UI2 A;  2F03 A;  3VR6 A;  2BE5 C;  1B9N A;  3TZU A;  2K01 A;  2H4O A;  3RD4 A;  2FHT A;  2NVQ B;  3ERQ A;  5KND A;  2SEB D;  1BCP B;  3BDC A;  1STG A;  1SYG A;  2M2L A;  1JQY D;  2N55 A;  3QG1 A;  1HUM A;  4UAI A;  2VB2 X;  1WTX A;  5K36 H;  2ZXR A;  3QWN A;  3HOZ B;  2KEE A;  3FPU B;  4OIK A;  2A68 D;  4FO2 A;  5CV9 A;  1O80 A;  2MP1 A;  4MN3 A;  1G2T A;  2JP1 A;  1I4R A;  1STE A;  4XT3 B;  2XVS A;  3I70 A;  1I4H A;  4FP5 D;  1D6E C;  5KYL A;  3LX0 A;  4PQX A;  1EZ8 A;  1F2L A;  3OMC A;  3VYU A;  3W3A A;  4KKT A;  1W6J A;  5JPM C;  1W6K A;  4X3S A;  3SK5 A;  3DXJ C;  2LFN A;  1VMP A;  1BDO A;  2BA0 A;  2A6E D;  5JVG 3;  4FVM A;  3X3N A;  2XWJ B;  2IW3 A;  2EJF C;  3PO2 B;  5NUC A;  3VA5 A;  1TWF B;  3I73 A;  1XX8 A;  3L9A X;  5C5M A;  5IGE A;  2ENB A;  2RSO A;  3KK7 A;  1SE2 A;  1IKM A;  1R4Q B;  2K28 A;  2A68 C;  3BVM A;  4CJ0 B;  3VYS A;  5T1G A;  1K8O A;  1IW7 D;  1JOO A;  4RA8 A;  2RDG A;  3DM1 A;  2YYZ A;  1AN8 A;  2YU9 B;  2OXP A;  3HP3 A;  2XIW A;  3DWA A;  1DM0 B;  1YNN C;  1QB5 D;  3SEB A;  1VCI A;  1U4L A;  4CHT B;  1V43 A;  4J8Q A;  2JA6 B;  4KMU C;  5JAV A;  1ONL A;  2NWG A;  4FNF A;  2WKC A;  1STB A;  1FYC A;  1CZG A;  2B2Y C;  2EY5 A;  4KKS A;  4U68 A;  5KIX A;  1WD0 A;  3MXU A;  2JA8 B;  1C4Q A;  1S5C D;  3SK8 A;  3PV0 A;  1CHP D;  1ZYR C;  1WD1 A;  3WDN A;  3GTK B;  3KLS X;  1E0B A;  1TWG B;  4I7Z C;  1D5M C;  2XWB B;  2SNM A;  4ZYS A;  2F0F A;  3TN2 A;  3E5S A;  4XYO A;  5IOC A;  2MUY A;  2DY7 A;  2TMP A;  1IW7 C;  1LTT D;  2B2T C;  3VR3 A;  4K8J A;  3P75 A;  1Y8O B;  1YNJ D;  3MZ5 A;  2A5H A;  5EJW A;  1UUP A;  4DK1 A;  1SYF A;  3MXP A;  4H7B A;  2LMC B;  2NB0 A;  2FMM A;  1F2Y A;  2EJG C;  1JCK B;  2NN6 G;  4RGT A;  2K05 A;  1Q12 A;  3D31 A;  3GTP B;  1E2V A;  1EQV A;  5IIF A;  2K1B A;  1GUW A;  3LWE A;  3OWE B;  4IQZ A;  3U9S A;  5HGT A;  2EZV A;  1TR5 A;  2HDM A;  1BXT A;  2K5D A;  1TWH B;  1EEI D;  2NVT B;  3VYR A;  1KLU D;  2EYL A;  4TRD A;  4CKC A;  5DEH A;  4J1M A;  2DNC A;  3PIO 3;  3D6W A;  4K2K A;  1C48 A;  2PYK A;  1CI3 M;  1MBY A;  2F3W A;  2FJ2 A;  2JA7 B;  5ELC A;  2KQ3 A;  3PMF A;  2L5T A;  1SYC A;  3OMG A;  1F9S A;  2Z8L A;  3A55 A;  3AU7 A;  3S1R B;  1GUG A;  4IUP A;  3S14 B;  2F0V A;  4X3U A;  2JEB I;  1J8I A;  1AP0 A;  3H6M A;  1SXT A;  2PZW A;  5E4W C;  1H9K A;  4BBR B;  3CRK C;  3PUZ A;  2PMZ B;  2F0E A;  3S1N B;  1EYD A;  2F0P A;  1PFN A;  1CK1 A;  3BYY B;  1WTR A;  3MTS A;  2AUJ D;  3S1M B;  3IFT A;  3GTM B;  2MHV A;  1PRT C;  2MGS A;  4JBW A;  1HRJ A;  4A3G B;  2LY7 A;  4QMG A;  1E2W A;  1S5F D;  2Z1C A;  3NXW A;  3HOV B;  4V0B A;  1DOK A;  3PUX A;  1VF5 C;  1A15 A;  4M1U B;  2J7Z A;  2QDB A;  2NN6 I;  3MFY A;  5A2Q L;  1F77 A;  4F88 A;  1CM9 A;  4X3K A;  1X32 A;  2NZ1 D;  1RF2 D;  1XXG A;  2NVX B;  1U4R A;  4NW2 A;  4KJO A;  1CA5 A;  4PMB A;  5FO9 B;  3GTJ B;  3GTL B;  1GXD C;  1EY4 A;  1A2T A;  2RSN A;  4HTH A;  2IX0 A;  4G57 A;  4DNT B;  1QG7 A;  4N9T A;  4ILW A;  2E74 C;  1HPC A;  4WRD A;  3DWP A;  1E2Z A;  1B3A A;  1TU2 B;  3KBX A;  2G9D A;  2VB3 X;  1GUS A;  1D2B A;  5HUR A;  2RQX A;  3CQZ B;  2VXW A;  4QB4 A;  1SSO A;  2CHB D;  2NVY B;  1RCV D;  1BCP D;  3Q23 A;  4KKU A;  2F0I A;  5C4X B;  2TSS A;  2E2J B;  1F9P A;  5C3W A;  2AWN A;  2IPK D;  1KAB A;  3H0G B;  3DUZ A;  3NWS A;  3NTH A;  2FFK B;  1JOK A;  4ZAI A;  4DAP A;  5I2X A;  1OXX K;  3M85 A;  2JA5 B;  2F3V A;  2A74 C;  5FO8 B;  4J6H A;  1Q90 A;  1BOS A;  5C4J B;  5ELB A;  3K5O A;  2E75 C;  4HCS A;  1HTP A;  4PMW A;  4XIG S;  4HSV A;  2IT1 A;  3M3Y B;  4ID6 A;  1O7Z A;  1QE6 A;  1BO0 A;  2I07 B;  1TWA B;  3MHB A;  1JIC A;  1SNC A;  2EE1 A;  1DOL A;  4NMZ A;  3C2P A;  3MVV A;  1PTO B;  4OIJ A;  1SDF A;  1EZ6 A;  1C8C A;  3N6R A;  2L55 A;  4QF4 A;  4IUN A;  5C3X A;  3K58 A;  3MXN A;  1PZK D;  2MPM A;  1ESF A;  3S2D B;  1ET6 A;  1CTM A;  1PFB A;  4BA1 I;  4V19 0;  1EWH A;  2F0M A;  2F0H A;  4DXG A;  1IL8 A;  3NSW A;  1DOM A;  4MHE A;  3L3O C;  3T16 A;  2LS0 1;  5DM7 3;  5CGK A;  5JVH 3;  4F8M A;  3C46 A;  1U4P A;  2A69 D;  4RKB A;  1PRT F;  1RTN A;  1II3 A;  5KGU A;  3H09 A;  1TWC B;  5A2Q E;  1Q1E A;  3TP8 A;  1Y1V B;  4F87 A;  3A8K E;  3VYT A;  1V1P B;  1LTI D;  1EL0 A;  3EVQ A;  2Z4H A;  1O7Y A;  4H0L C;  1F9R A;  1K8M A;  4FXD A;  3R93 A;  4R9W A;  3O13 A;  3A56 A;  5T1I A;  2X6G A;  5CC4 A;  2E2D C;  2L11 A;  5TSS A;  3NQT A;  4CKE A;  3J80 L;  3QOL A;  2A69 C;  2ICI A;  3MXG A;  1HHV A;  4IFD H;  5DNF A;  2PW7 A;  2WAQ B;  1A6X A;  1G6Z A;  1I6H B;  1EYC A;  3NP8 A;  5D14 A;  1PFM A;  1EIG A;  1T5X D;  2B2V A;  2MJ8 A;  3NHH A;  5ELD A;  5I9P A;  3NTK A;  3TME A;  4U67 3;  4P2C B;  1QCB D;  1ESR A;  3CRL C;  5JEA G;  1JOR A;  4LJZ C;  1LTR D;  4HED A;  1O78 A;  1H9S B;  2E2I B;  2X69 A;  4A3M B;  4KI0 A;  2G9H D;  5DM6 3;  2K5W A;  2K32 A;  1S5D D;  2WB1 B;  1D1I A;  3FKI B;  4N9P A;  1I4Q A;  5E3F A;  1MSH A;  3W2D A;  3D4W A;  5C0X G;  5D3I B;  4IFD G;  3S2H B;  1S4Z A;  1HFN A;  2N88 A;  3A8I E;  2K03 A;  3M4O B;  3T53 B;  3V96 A;  2L1B A;  4C1N I;  4MIU A;  2R6G A;  2R92 B;  1SNO A;  4G7H C;  1QWY A;  1Z7T A;  1ROD A;  2F0W A;  4A3D B;  1KTK A;  3NK9 A;  5CYU A;  2EJM A;  1ILP A;  3BVG A;  3SHL A;  5G3L D;  1I6V C;  1RHP A;  1V1P A;  2XN9 C;  1CQF A;  3VR5 A;  2F0O A;  4TSS A;  1J9O A;  4RFB A;  1EEF D;  3H91 A;  2HDL A;  4A3I B;  3WOE A;  2Q8R E;  1STH A;  2NN6 H;  3M4Y A;  4FXG C;  1G2S A;  1LLR D;  3MWY W;  1AZQ A;  4A3J B;  4ULL A;  1Q3L A;  3M7N A;  4AYB B;  5JEA J;  2A6E C;  2I46 A;  1WCM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...