2NB0A

Structure of d19s variant of the penicillium antifungal protein (paf)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
55
structure length
55
Chain Sequence
AKYTGKCTKSKNECKYKNSAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title D19S Mutation of the Cationic, Cysteine-Rich Protein PAF: Novel Insights into Its Structural Dynamics, Thermal Unfolding and Antifungal Function.
pubmed doi rcsb
source organism Penicillium chrysogenum
molecule tags Antifungal protein
molecule keywords Antifungal protein
total genus 3
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nb0A00
2KCNA 2NBFA 2MHVA 1AFPA 2NB0A
chains in the Genus database with same CATH superfamily
4DR7Q 1SYCA 3PIP3 1K83B 4N8FA 4R4OA 2PQAA 4UY8C 3PMFA 5J22A 5C4JB 4BA1I 5EKKA 3U50C 3PIO3 4GOPC 3GTOB 3HOWB 1YHAA 1L0XB 2PZUA 3SGIA 2EJMA 3OOCA 3L2PA 4CDCC 2FMCA 4A3CG 1KQSA 3BDOA 3HOYG 1IYJB 5LMNQ 4KY5A 4LF5Q 2MFIA 2Z8LA 1XNQL 1CK1A 1SYDA 1KNEA 1AZPA 1JICA 2K5WA 5JEAJ 1JJCB 2VQEL 2XNAC 1Y1WH 1Q1EA 1U4MA 1VQDA 5FKAC 5GAHC 2ICIA 2KQ3A 4A3LH 4DV7Q 2EQSA 2XRSD 3KUPA 3BVMA 2HIXA 2UXDQ 5D14A 1VMPA 1VQ6A 1T5EA 1VQKA 3V2TA 2H4OA 2UUCQ 2FJ2A 4HCSA 1TS5A 1V1QA 1VQIA 2EYOA 1Y1VG 2Z4HA 5CV6A 3KK7A 1HNWQ 1GM5A 2A69D 4RKBA 1H95A 3KF8A 5IE8A 3K0YA 2DJGC 4GKKQ 3TP8A 2VQEQ 5EBDA 1GUOA 2XRQD 1OTCA 1SFOH 1FD7D 2ZM6L 3LWUA 1YITA 3CCQA 1U9RA 3J7ZC 1EEID 3H94A 4C1NI 2NVQB 1TWFB 3W1BA 1LTGD 1HR0W 2EJGC 5C5MA 4A3FH 4JI6Q 2Z6BA 3GD7A 4GOPB 1XNRQ 3QOLA 3NP8A 4L63B 2E2JH 3FMCA 5CV5A 2MPMA 3U58A 5BR8L 4R4IA 3WOFA 2Z4IA 1QZGA 3X3NA 4LUZA 1AW7A 1F2MA 4MTKA 5FLXc 4DR2Q 3SR1A 3H15A 4Y7NB 4IPHA 3EBEA 3S9WA 3ULJA 3KLSA 1KDCA 1CKOA 2EYJA 1E22A 4KHPL 5E1FA 2AQ1B 2H1EA 4CDEC 4O2DA 1X55A 2BE5D 4ZKBB 5I2XA 4LF9Q 2B2VC 3FKIG 1SMXA 3HKZB 4FNFA 4C1NK 1UNSA 2TSSA 5M3MB 2ALYB 4HTHA 3S1NB 3F1ZA 3JC66 4JK1C 1PH3A 3Q6SA 3KLRA 1IZ6A 4QUCA 4JI8Q 1JT8A 5C4XB 1OXUA 4BBRB 4LUOA 4NXNL 2F0PA 5IT9L 2PMZB 4C2MH 4DAMA 2JQOA 5IP7H 4DR1L 5FOBB 5I9OA 2OF1A 3KYHC 1RL2A 1BVSA 1Y8NB 3MFGA 1N9WA 4Y7NH 1ML0D 3S24A 4X3KA 1J9OA 1JOKA 1ZYRD 2Z0SA 3KF6A 2BDOA 3EVQA 4YIJA 1IBML 2BH8A 5C6AA 3BVGA 1WI5A 3TZDA 1SMYC 1SYBA 1TWGH 3NELA 5JEAH 1S4ZA 3I8ZA 1N8RC 1ZYRC 3TMEA 5KEEA 3A5ZB 3TQYA 2JA8G 3ERSX 2VUMB 4A3FG 1D5XC 3K8AA 1SR3A 3M9BA 3UI2A 1QJOA 3AB9A 1V9PA 2VB3X 3FDTA 1S40A 4JI5Q 3HOXB 4JBKA 2CHBD 1H9RA 3A56A 3GTPH 1B9NA 2K6AA 4C3HG 1EQTA 5A35A 3GTPB 4JC0A 1X32A 4IJHA 5C5LA 4OIJA 4GNXA 2FINB 3HOUB 2VUMH 4XDXA 3S14B 1D1KA 2MJ8A 1RKNA 1HA6A 3STBC 1IBLL 4GLAC 1WCMH 4FF2A 4AIMA 4GS3A 2SOBA 5FJ8H 4FF3A 3G6EA 3PGZA 5AJ3Q 1QCBD 2B63G 5I9PA 2DJFC 4X3UA 4AQYL 2MUYA 2QDLA 5COYA 1TWCB 3K6OA 4C2MB 2VXWA 1U4RA 1EZ8A 5EKLA 1XPUA 3S2HB 1LT5D 4JCVE 4IUVA 5C3EG 1WD1A 3Q22A 1KAAA 2F0KA 4IOAA 4NPSA 2R6GA 4DV2Q 2QILA 3CMAA 1M1KC 4LF4Q 3B6YA 3GTQB 2A74C 4J6HA 1D5MC 2ID0A 1XNQQ 4A3CH 2RBMA 5EPJA 1LYLA 4PV1C 2OWOA 4O0AA 3ITPA 4K0KL 2V1CC 3NQIA 4XYQA 1KRSA 5IGCA 1HZBA 2R7ZG 4POFA 3SVMA 1NCVA 3VR6A 3KJOA 4BXXH 1SLJA 2DGYA 2E2IB 1JOOA 3I4MG 2FMMA 3S15B 2WACA 3CQZH 2A6EC 5FO8B 1N33Q 4A3JB 2IX0A 1STAA 1JR0D 1GO3E 4YCWA 1PTOF 2F0GA 4PZ8A 2AQ3B 3STBD 3CCRA 5KNCA 3JAME 1G291 1JWSD 4HR7B 4BBSH 1EY0A 2CVRA 1K8GA 3I4NH 1HR0Q 1SBBB 3CCJA 3J7AV 4WFN3 1XTDA 1HFGA 1SYFA 2KHSA 2C9OA 3OIPA 5LMUL 4C3JG 4K0KQ 1HUMA 2NVXB 3Q0AA 3GDEA 1D6EC 2F4VL 4JI4Q 1B4OA 2IX1A 1LT6D 4JI6L 1CSPA 3F2CA 3D0FA 3MVVA 4OELB 1LLRD 2F3VA 2MNAA 1T9HA 1VF7A 1EL0A 5IGDA 3K7UC 5C0XH 1K3RA 1II3A 4LFBL 1SRUA 2F0WA 4GKKL 1BCPF 3BVZA 3I70A 5DM63 1GUSA 3NSWA 2LS01 1JQYD 4JV5Q 2K33A 1G8ZD 2H5XA 4HMJA 4JV5L 4A93G 2HQLA 4P74A 1Y69U 2C5CA 2UXCL 2CQAA 2R3ZA 5FK9C 4DU9A 4IOCA 1QG7A 1PRTB 3MAQA 1CSQA 2ENBA 1QVGA 3GQBA 4ZUJA 1IBLQ 1J6QA 2QGQA 3I4OA 4RGOS 3GTOH 5HGTA 1EYGA 3NTKA 4BS9A 1LTBD 2MQHA 1EU4A 2CCZA 3HKZE 1TT2A 4QY7A 4BY7G 4IJLA 1SJHD 4IFDJ 3FKIB 5LL6S 4OO1G 4K6LA 5ISRA 4KKUA 3S2HH 3J81j 2TMPA 2F0JA 3EA6A 4KI0A 1PYWD 3VR4A 5M9OA 1EYAA 2AHOB 5D3IB 2WB1B 1TKWB 2HUGA 2L4NA 4CHTB 2E5LL 2DNEA 1FJGQ 2IHEA 1QNKA 3FP9A 4L5SA 2ZT9C 1F9QA 2KOLA 1HTLD 1VQ8A 4LF6L 3HOWG 4IZ8A 1RD9D 1SROA 5CYUA 3EFXD 1KDAA 1WCMG 4EQOA 4DAVA 5JVG3 4ALPA 4JYAL 1SN8A 2JEAI 1CZGA 3KLWA 2IX3A 4HJ8A 4OEMB 2UUBQ 1Z47A 1ET9A 1VQ4A 3WOEA 2EPBA 1PH4A 2KCCA 3CXCA 2F4IA 1GUNA 4DUZQ 4LF7Q 4A4IA 1AZQA 4KKTA 2SNMA 4KN4C 1G2TA 4RA8A 4MTNA 1B3QA 1ILQA 3PF4A 2F03A 4KHPQ 1DM0B 4RCOA 3PSIA 1HTPA 3I91A 1CHPD 1DZ1A 2IY5B 1V8QA 3E9IA 5LHY1 1STBA 1OXVA 4QGUA 3GTLB 1TVXA 3I4NB 1ESFA 2Z6KA 3AYHB 4X64L 1E1TA 2CWAA 1I4GA 1SDFA 5FJ8G 3PF5A 2Q2UA 4F87A 4J15A 1UUPA 4OGQC 4OWXB 1K8AC 5CV8A 2X6GA 3S15H 1GHKA 5JJIA 3I3CA 3PUWA 4A3BH 2UXBQ 3NQTA 2K5HA 1SYEA 1PFBA 2B2YA 1FNVA 5GAEC 4X64Q 1CA5A 4OWWB 2B2UA 4RAUC 4BY7H 3A54A 1VQ9A 3MTSA 1HJPA 2KVMA 4BBRH 2I0QA 2KEDA 3AFQA 3J81c 2F0IA 1QB5D 1X54A 4IQZA 5C0XJ 4GZYC 1VQEA 1C48A 1CQVA 2AWOA 4LF5L 2VZAA 1KABA 1VQLA 4EQ5A 3D31A 4UAIA 5E7NA 3T1HQ 3IFDA 2I07B 4C56C 3Q8DA 3I73A 3S2DH 3CD6A 1EEFD 4L5TA 3GTJB 3NTIA 4DR5L 2N78A 2QKIC 1ENCA 5EBCA 3CAMA 4CDFC 1Q82C 2IHFA 3O13A 2Z6KC 3I4MB 1A3UA 5KYIA 1PH7A 3FHWA 4GLVB 3CCMA 2R7ZH 1PTOD 4FXDA 2G9DA 2NZ1D 1VQNA 2F0NA 2QEJC 2RHSB 4A76A 1TXYA 3CC2A 2NZOA 1P8LA 1QOHA 2F0HA 3FPPA 2R7FA 2X69A 4TQUS 1R9TB 3OYYA 1QNUA 5CC4A 3BS1A 1JB7A 3I4NG 3NE5B 4PNYA 5KIXA 3OWFA 1EY9A 1ILPA 3MFYA 2MO1A 2VQFL 1BDOA 2PZTA 3HOUH 2NB0A 4A3FB 3H91A 4NXMQ 5FLMG 2A19A 2CW0D 4XTCS 2OQKA 4X6AH 1Q46A 4JW0A 1QZHA 2CKZB 3R3OA 3R93A 1TU2B 5KRUA 1XYIA 1WTRA 1QWYA 4P2CB 4A3EH 3RLFA 1HHVA 2Q2HA 2NYZD 3TREA 1YI2A 1PYSB 3BZDB 4RWSC 5EAYA 1XTCD 4ME3A 1E3PA 3IL8A 5DM73 1E7ZA 1JMCA 4UDUC 5LL6X 1I94Q 2P5ZX 5BN4A 3D4WA 4CKBA 4ZRZA 1IW7C 1R9TH 1LTLA 1F9PA 3H0GB 2NTTA 3NWSA 1CM9A 2YV5A 2E2HH 3V05A 1CHQD 2KCMA 1RJTA 4QF4A 3H09A 5EQ0A 2N3SA 4RGNA 5NUCA 3M4PA 3P20A 1RCVD 4G57A 4ZCKA 3HOZH 2EYPA 1Y1WB 3UDXA 1N32Q 1DD2A 1Q1BA 2GVAA 2HCIA 1GUGA 4FXGC 2SEBD 1C0AA 1PMRA 3A0JA 3J81E 2RSOA 1G91A 4PMBA 1MD2D 4WJ3M 3M3YB 3OPOA 1N36Q 4POGA 3CMEA 3PUYA 1NY4A 1YNJC 4KTAA 5DAUA 5M3MH 3KLSX 5HY6A 3VA7A 5GROA 5CV7A 4HIKA 2HCCA 1W2BA 3ND9A 1EY8A 2N8NA 1CKMA 2F52A 2M9VA 4DR7L 3DMUA 3S1QH 4LFAQ 1STGA 4JI2L 4C3JB 1SNMA 1CFMA 1NMGA 1GUTA 2JN4A 5K36H 1FJGL 2Q8IB 4HSPA 1VQ7A 4K5VA 2JK8A 4HJ5A 4G7ZC 1QVCA 5I4DA 4G4KA 1JORA 1Q7YC 1PTOB 2A6HC 5HGQA 4A3BB 2XWJB 1LTTD 1B50A 5M5XB 1H9SA 1X65A 1YNXA 1I50H 2E2JB 2JA7G 1NR2A 4WJWA 4FXKC 5E4WC 3VA5A 3TN2A 1I3QB 3ND8A 3QOJA 2HQEA 5LMNW 4B3SQ 4V0BA 2KHJA 1TQOA 4C3IB 3UE0A 1D7QA 4A3DG 2J0TD 5G3LD 2D62A 4X65L 3NUCA 1AE3A 3P1HA 2KA7A 1FVIA 1ZKOA 1I94L 3HKZG 1LABA 1X3PA 2D2CC 5I6WA 5F2DA 2VQFQ 2Y0SG 1HNZQ 4IALA 2K75A 2UUBL 4DGZA 2BDNA 5C4ZA 1JWMD 5C4HA 2AWNA 1PFMA 3KDFB 5BN5A 1LTRD 2K32A 5EJWA 4JI0Q 1RTNA 5ELOA 1W6JA 4P75A 2MHVA 4XQQA 5JEAG 3I2ZA 4QQBX 1JE4A 3L3OC 4ZKCB 3GP7A 4A3KB 5DLQE 5C0XI 5BR8Q 1MSGA 4A3DB 4P73A 3GTMB 4BBRG 4LW1A 3H3VI 1I6HH 1AFPA 2MO0A 2V4DA 1S72A 5KNBA 4DV3Q 4K6DA 3S17H 1L0YB 1QVFA 3T1HL 5IWAL 4WJ4A 1Y1VH 2EOTA 4CBVA 5M5WB 2IT1A 3MXGA 1TWAB 2BOSA 4LFCL 1PH9A 2M00A 3K5MA 1HH2P 3G7LA 1STNA 2YTVA 5C4JH 1HZCA 1VQCA 3PUZA 2RHQB 4Q0FA 1SNOA 4E6IA 3DM1A 4DV4L 2NVYH 4Q5VA 4JBJA 5JAVA 1S5BD 4DV6Q 2WINB 1K8OA 5EPLA 3I90A 4A3IH 4PG3A 2FXQA 2K04A 5CGKA 4R8NA 3SDZA 1IBMQ 2B63H 3PUVA 4A3DH 4L5QA 2O4XA 2A69C 2DY7A 1MI2A 4EGVA 2I46A 1S5DD 5KNDA 2OT2A 2PQEA 5ELCA 4X62Q 2VNUD 2K14A 2XGTA 2IL8A 4NXNQ 1ZEQX 1YEZA 4IUNA 4R1JA 3M4OB 1IBKQ 1PTOC 4QUFA 1V43A 3OMGA 1LTID 1B3AA 4HAEA 5EPKA 3DEOA 5FLXE 1SE8A 3HOZG 1ESRA 1Q81C 4KD4A 4JI5L 5A2QE 5BN3A 2B2WA 2Q2IA 2E74C 3OTOL 1PRTF 3K58A 4BXXG 3PQIA 4GLXA 2NN6I 3BDLA 4DR3L 1IYUA 1K0SA 2AUJD 1VQAA 5IYBG 3KBXA 4EQNA 1KNAA 3E9HA 1HZ9A 1K3BC 3HG9A 1LACA 1I50B 2OXPA 4LF4L 3HKSA 5CV9A 3HEJA 1X3EA 3HOVG 5IT9E 3CQZB 3K7AB 4GN4B 2E2IH 1S5FD 2HHHQ 1EIGA 1BCPB 1EY4A 3OW7A 1YNND 3W5OA 1GKHA 1BBXC 1MSHA 3DXJC 3GTGH 3SK5A 3BG3A 3PCOB 1NMFA 4APVA 2FFKB 3TEHB 2WKDA 4YHHQ 1BF4A 1QUQB 4YWLA 1AE2A 5T1GA 4A3IG 3BJUA 4TVAB 1C7YA 3QIAA 1WTWA 1H9MA 2EXDA 2K50A 3MHBA 4OWTB 1GJXA 1ICFB 3CPWA 3H3VH 4DK0A 4NMZA 4R4TA 3TP7A 3TZUA 4A75A 2MGSA 4XXEA 1LT4D 2LXKA 5M3FG 4LNQA 2JA9A 4BY1B 1ASZA 4RG1A 2F0LA 1MBYA 1TS2A 2ZTEA 1IKLA 2LXJA 2KENA 2F0MA 2KJXA 3VYSA 3AMUA 4A93H 1SNCA 3VDYA 2JA5B 4KHVA 3A5UA 4IN3A 1K0RA 1BBWA 4EX5A 1J5EQ 1PZJD 5J1ZA 3ULLA 3ZYYX 3ICEA 2KUMA 3OSOA 1KTKA 2L0CA 1RODA 2L9HA 1A15A 2Q2TA 4G7OC 3KFUA 1ENAA 2EY2A 1GHJA 1D2BA 1HQRD 5C44H 1F2LA 1X3QA 4RKLA 1YNNC 2QF7A 5M3FB 5C3EH 3HZXA 3MZ5A 2NUCA 2PW7A 2A8VA 4HJ7A 1EQRA 4ODGA 5IYCH 1Q90A 5E3FA 1JC7A 4A3MG 3U4VA 2E2DC 2HDLA 1Y8PB 3BYTB 5ELEA 5H1SE 4J1MA 2EY6A 4A3MB 3F2DA 4LF7L 3TDQA 4JBMA 2ICEC 4FF4A 3AFPA 2EY1A 2VS1A 2G5DA 2ZTCA 1TWGB 4RH6A 1ET6A 2NTSA 2EYMA 4CJ2C 2PI2E 1L1OC 2ASBA 1PXUA 1NBWA 3KF8B 4NW2A 1HR0L 4FDBA 4RHSA 1I4PA 2LY7A 1H9SB 1FYCA 4A93B 4WRDA 1BBUA 2F0QA 3MC0B 3C1EA 1BNZA 5HURA 1UEBA 4GNXC 3I4MH 5K5PA 2HIVA 1ICWA 4GKJL 4JI7L 1VQGA 3AEVA 4DUYQ 4N9TA 3C1FA 2YYZA 3S16H 5TSSA 3MWYW 1PH6A 1O7IA 1Y14B 1EU3A 3S2DB 1B2TA 4QCLA 3PUXA 2UUAQ 2VL6A 1A0IA 3NBHB 3GTKH 2XTIA 3CW2C 3S16B 1M4VA 5C3WA 4ULLA 2L15A 1VQ5A 2R93H 1H9JA 1GUWA 1KLUD 4A3JG 2O5JC 1IKMA 2WKCA 5E4XA 2BA0A 1E2VA 2BA1A 1XMQQ 1LTAD 1KRTA 3RUZA 1BKBA 4X62L 3CKIB 2R92B 1Y1WG 2ZTDA 4PMWA 4HIMA 3C2PA 1QUQA 1HNWL 4M1UB 1KL9A 5IYBH 1B44D 4YY3L 1AN8A 4YY3Q 3J7AF 1VQMA 3BZCA 1NSNS 1TWHB 2N49A 4A3MH 5AJ3L 4JVZA 3K80C 3WDNA 3RZOH 1LO5D 2KCTA 1XPOA 2NVQH 2KHIA 3Q23A 4V190 4IUTA 3HOVB 5C3EB 4LFBQ 4MN3A 3K57A 1SFOB 2Y0SB 1SXTA 1O7LA 4YCUA 1EIYB 1K9MC 2UU9L 5G3LF 1CZWA 1VF5C 3D4DA 1WD0A 4CKEA 3T13A 4KD3A 4DA2A 4HIDA 3GV3A 2K5QA 3ZJYC 4DV3L 1E2ZA 4JI4L 1E24A 2WAQB 2PI2A 4CKCA 1SNDA 1J8IA 1VQFA 1EOVA 3IFTA 4DUYL 3PO2B 1AEXA 1BQQT 1JCKB 4JI7Q 3RD4A 2FHTA 3NTHA 5J3BA 1XMOQ 2K5NA 1VS0A 2GVBA 2OTLA 3LX0A 4C3IG 4TRDA 4KJNA 3M85A 3G71A 1WTXA 2D9UA 3N52A 4I7ZC 2WAQE 4BY1H 2ZXRA 2NVTB 2NVYB 3FKIH 1WTVA 1TY2A 3CP0A 4AYBB 4XQJA 3AU7A 1DYQA 4IFDG 4LJZC 4HEDA 4EVOA 3I56A 1X3GA 1W6KA 4XT1B 5M5WH 1B1ZA 5IODA 1DOKA 4YHHL 1L0WA 3CC4A 1QE6A 4C3HB 2F3IA 5A2QL 2PMZE 1IW7D 1KLGD 2NVTH 2DNCA 2E5LQ 3C46A 1Z6HA 4A3GH 4BBSG 1V1PB 4X3SA 1I6HB 1O80A 2WP8J 3OHXC 4B08A 3TRZA 1L2FA 1EFID 1STHA 2F0EA 5IYCG 4IPDA 4UP7A 1SMYD 1SAPA 1YVCA 4LF9L 3PIPA 1A6XA 4NKLA 3PO2H 3K7AH 2JJQA 1YHQA 3HOYH 2C35B 1STEA 1A2TA 3QJYA 2JA8H 4DR4L 3W3AA 5KGUA 4KLKA 4DNIA 5C0XG 4OIKA 2IJ0A 3LGJA 5IP9H 2RQXA 3KBGA 2F0UA 2I5HA 2JA5G 1C8CA 3T1YL 1CKNA 3SK4A 2PYKA 2B2TA 2Y0SE 2K7VA 4Z9CB 4B9WA 1A2UA 3T16A 4B9XA 5IYDG 1CKNB 2B2UC 4DPGA 2F0DA 1I4HA 4WORA 4KY7A 4DKAC 5IWAQ 1HPCA 1VDZA 2F4VQ 3RZOB 2ZXOA 2VUMG 1U5KA 3G48A 2UU9Q 1DJRD 5ELDA 3CCVA 5IOCA 3HFZB 2ZJRA 2WV6D 4DNTB 2BE5C 3HOYB 3SE0A 3VYRA 5L37A 2QDBA 5D65A 1Z7TA 4QIWB 4B3MQ 2PW5A 1B70B 3KF6B 4B3RQ 2UXBL 3J7YW 4R8IA 4FYDA 2B63B 1A3TA 1EZ6A 1C9OA 4ZQ3A 3A74A 3HP3A 5CORA 3DWQA 1WTPA 2WB1G 2YU9H 2SDFA 2AUKA 2L55A 3P7JA 4DR1Q 4N9PA 4X3TA 4DXGA 3DLLA 3S1RH 4U68A 3HOUG 3VR5A 1M8AA 4QB4A 1ASYA 4NP5A 1S5CD 2OEOA 4LFCQ 1X56A 1MGSA 1F9RA 1VQHA 1SEBD 1L1OA 1KHIA 1YNJD 2A68C 2A73B 2HT1A 2MP1A 4DV2L 3EJIA 3S17B 2QW7A 3TP5A 1Q86C 4ZAIA 5T1IA 3CRLC 4KK7A 2UUAL 2JP1A 3X3MA 5EKIA 5FO9B 2YTYA 3V96A 2CFMA 2E75C 4IUPA 4K5XA 4QIWE 4AH6A 1EIHA 4L8JA 3M7GA 4OX9Q 4GKJQ 5JPMC 5IT9c 1K8MA 3FVQA 2GN5A 1KIXA 4HJ9A 1NR4A 3TBIB 3E0EA 4JI2Q 3OMCA 3OW2A 3S14H 1N34L 5IP7G 4DV5L 4CJ0B 4R4QA 4P71A 2PPBC 1IYVA 4UHVA 1HNZL 1XNRL 3OIQA 3MXNB 4H13C 3R2IA 3KDFA 4JI3L 4DF7A 2QEXA 4FVMA 2N88A 1OXSC 3T51B 1HQMC 4J8QA 3RZDH 4X66L 4MIUA 1C4QA 2EIFA 3I7FA 5IGEA 3TS0A 1O7ZA 1MKHA 1PLFA 1BCPD 5M3MG 2ZM6Q 4B3ML 3SHLA 4IFDH 5IGGA 1GXDC 2RDGA 4CGYB 5FLXL 1UAPA 2EYHA 2KECA 1HNXQ 4ZYSA 1YIJA 1KD1C 1T5XD 3A8JE 2RA4A 1TY0A 3S1MB 1JJGA 1DCZA 5CBEE 3NEMA 2L1BA 3RN5A 4O1NA 2B8FA 1BXTA 2R92H 3VR2A 3URYA 3L0OA 4B3RL 1HNXL 4DAYB 2XN9C 2E8GA 1NAPA 5C4XH 5M5YB 4IO9A 3W2DA 3GV6A 1HCZA 1YZ6A 3MEFA 4OHJA 4PZ6A 4JI8L 2F0FA 3C3LA 1UEAB 2I5LX 1B8AA 4N8X1 1DGSA 2NN6G 1B7YB 1NNXA 2K5VA 4AYBE 3ER0A 2B39A 1KXLA 3J7A5 2WB1E 3E5SA 1UE6A 1CI3M 5DEHA 3UDFA 5IP9G 2F0VA 3DWPA 3QB3A 2YU9B 1MIUA 1WTOA 1PHJA 4BY7B 1A63A 3FEWX 4UP9A 1FGUA 3T53B 3CC7A 3HOZB 5FLMH 4RFBA 4LF6Q 1N33L 1UE1A 3KJPA 3BDCA 3QWNA 1CUKA 1I5FA 1HXYD 4B3SL 2PNRC 4HN7A 1PZID 4A3EG 1IHZA 4LUVA 4K14A 3L9AX 2B3GA 4L5RC 1Q3LA 2DN8A 3TP6A 3DWAA 3MXPA 1G51A 4YWKA 5IY0A 4DV0Q 3D6CA 1EOTA 1JOQA 2JE6I 1PV4A 2RF4A 3RZDB 1SJED 1YBYA 5M3FH 4LFAL 1SSOA 1A62A 2BH2A 1IBKL 1EQVA 5GQOA 2K03A 2RSNA 3MXNA 2M2LA 3RN2A 1P16A 1V1PA 5JJZA 4DR6L 3HRZC 3GO5A 4DV1Q 2XVSA 2JA7B 3UDIA 5I6YA 4QMGA 5KYLA 5JJLA 1CT1D 4KN7C 2KBNA 4A3BG 1YHBA 3QG1A 3D8GA 4DR6Q 1EYCA 2X6LA 4XT3B 2CWPA 3I55A 2R7ZB 1PYBA 1D5ZC 3E0JA 4DNRB 4UPAA 4A3LG 1PRTC 4C3HH 4FO2A 4HCEA 1CTMA 4DK1A 1YJ9A 4K8IA 4B3TL 5K36G 4PZ7A 3HGBA 2QA4A 1F2YA 1SE3A 2R7DA 2WIIB 2F1MA 2LFNA 3I72A 1U0LA 2NZHA 3CRKC 2K28A 1FGBD 4IUQA 4NB3A 4H7BA 3J80E 1HZAA 2F0TA 1K28A 1W3SA 3GTGB 1UWVA 3OWEB 5AFWA 3GTMH 1I4RA 3N6RA 4Y52H 1PVOA 2QCPX 4K2KA 1TS4A 4IPCA 2ZJPA 3WWVA 1PDQA 4DV1L 4NDXA 1EY6A 1HFNA 4DAPA 3H0GG 2N55A 1LM0A 1I4XA 1V1OA 1WTQA 4PQXA 3GTLH 1GVPA 4PMCA 1S5ED 5CV4A 2EVBA 4IPGA 4JI1L 4KHZA 2R92G 2D5DA 3D4RA 3J80i 4QL5A 1KDBA 1EYDA 2OQ0A 4DR3Q 2R93G 4DUZL 4L6TB 3SEBA 3TSSA 3DHQA 2NVXH 4JI1Q 4R4CA 1EFWA 4IFDI 2Z1CA 4JBWA 3M4QA 2EDGA 1SNPA 1TWHH 1EY7A 3AQQA 2G9HD 2Q8TA 2NN6H 4BBSB 3ERQA 2UXCQ 2JA8B 4I7AA 4TKOB 1BR9A 1PRTD 2JXMB 2E76C 3UDGA 1S3OA 3TS2A 3HOXG 1VQOA 2XSCA 3EQLC 1X9NA 4BA2I 1IL2A 2Z9HA 3A8IE 1SYGA 1FNUA 3PO3G 2IW3A 3RNUA 4ID6A 3LNNA 4C3JH 1HA5A 1ONLA 1EWHA 1BUVT 3KOJA 1PH5A 4K2LA 1IXRA 4MNOA 4MZ9A 5JOBA 3J81i 2JA6G 3MEHA 4DV6L 1LTSD 5IGBA 4LK1C 1PZKD 2NWGA 3SK8A 1B9MA 3A7AB 3GTQH 1DONA 1TWAH 2KCNA 2YTXA 4GOPA 1Y1VB 4YWMA 1F77A 3T1YQ 1PH8A 3JAMi 1K73C 2ZXPA 2EJFC 3EN2A 2D0OA 4HIOA 2EY5A 5I2YA 1SE4A 2K05A 4RMFA 5GADC 4QJFA 3D6WA 2A6HD 2NBFA 1G2SA 1Q8KA 4K8JA 3PO3B 4OX9L 4BY1G 2ZJQA 1RDPD 2A1AA 4XYOA 4JI0L 2DY8A 3F2BA 2E2HB 1J5EL 4DV7L 2JEBI 2RCFA 3JAMc 2JA7H 4UP8A 4HMIA 2EYFA 2LSSA 1WCMB 4LF8L 1TIID 4LWCA 2PQAB 4DAYA 3CF5A 1VQPA 2VB2X 5FO7B 2IWHA 1WYDA 3CU7A 1E2WA 3RLOA 4CDDC 4S3SA 5J39A 2RDHA 4DN4M 1IL8A 2CQOA 1EQQA 2EXZA 5ELBA 1OXXK 4OO1I 3MA2B 3HOVH 4LF8Q 1VCIA 1XJVA 5C44B 3HOXH 5LMUQ 2SNSA 1JJ2A 4ME5A 2PO4A 3H6MA 4A3KG 1YJWA 1Q8IA 1CQFA 1RF2D 4DV0L 2Q8RE 4F8MA 5JJKA 3PO2G 3U9OA 1HRJA 1L1OB 1ZXTA 4RCNA 1WVLA 3JAML 2F0SA 3T4AC 2EYLA 1E1OA 1RIPA 4A3JH 1WFQA 1BO0A 3DEPA 2JSOA 4TSSA 5CR3A 2AMCB 2JA6H 2A68D 3M7NA 2JA5H 2I5MX 1EWIA 3J81L 3J80L 1KC8C 2XIWA 5IYDH 4O42A 4AYBG 2B8GA 4IURA 1EIFA 4M8AA 4GN5A 3ULPA 1N36L 2XWBB 2O5IC 2K01A 2K4KA 1F9SA 4R9WA 2R93B 3K5OA 3FRPB 3GTJH 3S1NH 3GTKB 3Q24A 3BYYB 3CCUA 2A5HA 3G4SA 1PH2A 3NPPA 4BWGB 3T56B 3CCLA 3M3YH 1N32L 2B2WC 3PIOA 4YCVA 1I6VC 1A3VA 4DR5Q 4F7XA 1WTHA 5M5YH 3EROA 3P75A 4ILWA 1VMCA 3E3XA 3DUZA 3U4ZA 1XWEA 2K5DA 3IKJA 5DNFA 2HDMA 4XQNA 1TWCH 1I4QA 1Q12A 3CPFA 5CBAE 3J80c 1B53A 2VW9A 2UUCL 4HSVA 1UE5A 4CJ1B 4I65A 3I4LA 4IUUA 2JA6B 3CCSA 3M4YA 4ZUIA 4ZLTF 3R8BA 3S1MH 1SNQA 1XX8A 3H0GH 3NBIA 2KEEA 4EQPA 3FPUB 1A8VA 1JB3A 3RLNA 2LMCB 5CMDA 2GA4B 2J4XA 5LMNL 1FNWA 1GD7A 1TWFH 4DK6C 1DOMA 1HUNA 1D1IA 5EGTA 3OTOQ 4OL7A 1JE5A 4KKSA 4A3EB 2K1BA 2J7ZA 4JI3Q 4KJOA 1PFSA 4DFAA 1EUJA 1SE2A 2PNHA 1FR3A 1U4LA 3A55A 3QR8A 3K81C 3UE1A 3NWTA 2JYOA 4JOIC 3F8TA 2PZWA 2CH4W 4X65Q 1X3FA 3NENA 4RHRA 4JG2A 3K5LA 1R4QB 4H02A 4RGMA 3M4OH 4KY6A 3CCEA 4OO1H 1XMOL 4NXML 1D8LA 5D3DA 1AP0A 1VQBA 2A6ED 3ONAB 4A3GG 2AKWB 2RDFA 3EIVA 4JYAQ 3HS0C 1LUZA 3K59A 3PO3H 4MHEA 2AQ2B 2RCNA 1CA6A 4AQYQ 4A3IB 3H3VC 1KAWA 1WJJA 1STYA 1AH9A 4KMUC 1G6PA 2BCOA 3NXWA 1Z9FA 1O7YA 1PA6A 1GOZA 5ELFA 1BOSA 2R61A 3SXHA 2WFWA 1MJCA 3E6ZX 4GNXB 2PCFB 3SK6A 3HOWH 3A7LA 1F2ZA 4OONA 1EWCA 1NUCA 2RVLA 3S1RB 3VYUA 1NTGA 2O2LD 4ZK9B 1K83H 1X6OA 4GN3B 4JOIA 3F2UA 4HJAA 3L7ZC 4H44C 1MJEA 5ELNA 1OO9B 4FF1A 4B3TQ 3R2TA 1U4PA 2K52A 2B2VA 4KV6A 1DXMA 3QO2A 1LT3D 3A8KE 2DUDA 3D3RA 2UXDL 4F88A 2EE1A 3IAYA 2CH4A 5C4XG 1YJNA 1LV9A 4ABNA 4A3KH 2VY3A 3PV0A 1XPRA 1H9KA 5JVH3 4DR4Q 4U673 4XIGS 2L5TA 1R4PB 2WAQG 1E0BA 3RR5A 2ATWA 3U9SA 1MHWC 2CW0C 3NHHA 2F0OA 1QILA 4X66Q 5IGFA 4RGTA 3MXUA 3DM3A 4LAAA 2OTJA 5C3XA 5IIFA 2ES2A 3K0XA 4FP5D 4DV4Q 3BZKA 4JPBW 4OXPA 2B2TC 3IRBA 4P72A 1VQJA 1TR5A 3G6JB 3RMHA 4DV5Q 5C44G 4LMQD 3LWEA 1N34Q 2D0PA 1EY5A 4H0LC 2LKVA 3NBHA 2HD3A 2F3WA 1XXGA 4C3IH 1PFNA 5JPNC 3BU2A 2B2YC 2EZVA 3VYTA 1I3QH 1RTOA 4DXFA 1BCPC 1ENFA 2OCEA 4G7HC 1DOLA 3VR3A 1TS3A 1PH1A 1NE3A 2IPKD 4DK3C 1Y8OB 5M5XH 2HHHL 5GAGC 1O78A 2L12A 1JWUD 1PTOH 1RHPA 4K5WA 1FL0A 2RKSA 1XMQL 3K5NA 3NK9A 1WOCA 1G6ZA 1UE7A 4A3GB 1NJIC 2B29A 1M90C 3S1QB 3W1GA 4DR2L 1OXTA 2L11A 3CHBD
chains in the Genus database with same CATH topology
1SYCA 3PIP3 1K83B 3PMFA 5J22A 5C4JB 4BA1I 5EKKA 3PIO3 3GTOB 3HOWB 1L0XB 2PZUA 2EJMA 3OOCA 2FMCA 3BDOA 4KY5A 2Z8LA 1CK1A 1SYDA 1KNEA 1AZPA 1JICA 2K5WA 5JEAJ 2XNAC 1Q1EA 1U4MA 5FKAC 2ICIA 2KQ3A 2XRSD 3KUPA 3BVMA 5D14A 1VMPA 1T5EA 3V2TA 2H4OA 2FJ2A 4HCSA 1TS5A 2EYOA 5CV6A 2Z4HA 3KK7A 2A69D 4RKBA 3KF8A 3K0YA 3TP8A 5EBDA 1GUOA 2XRQD 1FD7D 3LWUA 1U9RA 1EEID 3H94A 4C1NI 2NVQB 1TWFB 1LTGD 2EJGC 5C5MA 3GD7A 3QOLA 3NP8A 4L63B 3FMCA 5CV5A 2MPMA 3WOFA 2Z4IA 3X3NA 1AW7A 1F2MA 3SR1A 4Y7NB 3S9WA 3KLSA 1KDCA 2EYJA 5E1FA 2AQ1B 2H1EA 2BE5D 4ZKBB 5I2XA 2B2VC 3HKZB 4FNFA 4C1NK 1UNSA 2TSSA 5M3MB 4HTHA 3S1NB 4JK1C 3Q6SA 3KLRA 4QUCA 5C4XB 1OXUA 4BBRB 2F0PA 5IT9L 2PMZB 5FOBB 5I9OA 2OF1A 1Y8NB 3MFGA 1ML0D 4X3KA 1J9OA 1JOKA 1ZYRD 2BDOA 3EVQA 4YIJA 5C6AA 3BVGA 3TZDA 1SMYC 1SYBA 5JEAH 1S4ZA 3I8ZA 1ZYRC 3TMEA 5KEEA 2VUMB 1D5XC 3UI2A 1QJOA 3AB9A 2VB3X 3FDTA 3HOXB 2CHBD 1H9RA 3A56A 1B9NA 2K6AA 4C3HG 1EQTA 5A35A 3GTPB 1X32A 5C5LA 4OIJA 2FINB 3HOUB 4XDXA 3S14B 1D1KA 2MJ8A 1RKNA 1HA6A 4FF2A 2SOBA 4FF3A 1QCBD 5I9PA 4X3UA 2MUYA 5COYA 1TWCB 3K6OA 4C2MB 2VXWA 1U4RA 1EZ8A 5EKLA 3S2HB 1LT5D 4IUVA 1WD1A 3Q22A 1KAAA 2F0KA 2R6GA 2QILA 3GTQB 2A74C 4J6HA 1D5MC 2ID0A 2RBMA 5EPJA 4PV1C 3ITPA 3NQIA 4XYQA 5IGCA 3SVMA 1NCVA 3VR6A 2E2IB 1JOOA 2FMMA 3S15B 2WACA 2A6EC 5FO8B 4A3JB 2IX0A 1STAA 1JR0D 1PTOF 2F0GA 2AQ3B 5KNCA 3JAME 1G291 1JWSD 4HR7B 1EY0A 2CVRA 1SBBB 3J7AV 4WFN3 1HFGA 1SYFA 2KHSA 2C9OA 3OIPA 2NVXB 4C3JG 1HUMA 3Q0AA 1D6EC 1B4OA 2IX1A 1LT6D 3MVVA 1LLRD 2F3VA 1VF7A 1EL0A 5IGDA 5C0XH 1II3A 2F0WA 1BCPF 3BVZA 3I70A 5DM63 1GUSA 3NSWA 2LS01 1JQYD 2K33A 1G8ZD 4HMJA 1Y69U 2C5CA 2CQAA 2R3ZA 5FK9C 4DU9A 1QG7A 1PRTB 3MAQA 2ENBA 3GQBA 4ZUJA 4RGOS 5HGTA 3NTKA 4BS9A 1LTBD 1EU4A 1TT2A 1SJHD 4IFDJ 3FKIB 5LL6S 4OO1G 4K6LA 5ISRA 4KKUA 2TMPA 2F0JA 3EA6A 1PYWD 4KI0A 3VR4A 5M9OA 1EYAA 5D3IB 2WB1B 1TKWB 2HUGA 2L4NA 4CHTB 2DNEA 1QNKA 2ZT9C 1F9QA 2KOLA 1HTLD 4IZ8A 1RD9D 5CYUA 3EFXD 1KDAA 4EQOA 4DAVA 5JVG3 2JEAI 1CZGA 2IX3A 1Z47A 1ET9A 3WOEA 2EPBA 2KCCA 2F4IA 1GUNA 1AZQA 4KKTA 2SNMA 4KN4C 1G2TA 4RA8A 1ILQA 2F03A 1DM0B 4RCOA 1HTPA 3I91A 1CHPD 1DZ1A 1V8QA 5LHY1 1STBA 1OXVA 3GTLB 1TVXA 3I4NB 1ESFA 1I4GA 1SDFA 4F87A 1UUPA 4OGQC 5CV8A 2X6GA 1GHKA 3I3CA 3PUWA 3NQTA 1SYEA 1PFBA 2B2YA 1FNVA 1CA5A 2B2UA 4RAUC 3A54A 3MTSA 2KVMA 2KEDA 2F0IA 1QB5D 4IQZA 5C0XJ 4GZYC 1C48A 1CQVA 2AWOA 1KABA 3D31A 4UAIA 3IFDA 2I07B 4C56C 3I73A 1EEFD 3GTJB 3NTIA 2QKIC 1ENCA 5EBCA 3O13A 3I4MB 1A3UA 5KYIA 1PTOD 4FXDA 2G9DA 2NZ1D 2F0NA 2QEJC 1QOHA 2F0HA 3FPPA 2X69A 4TQUS 1R9TB 5CC4A 1QNUA 3BS1A 3NE5B 4PNYA 5KIXA 3OWFA 1EY9A 1ILPA 3MFYA 1BDOA 2PZTA 2NB0A 4A3FB 3H91A 2CW0D 4XTCS 3R3OA 3R93A 1TU2B 5KRUA 1XYIA 1WTRA 1QWYA 4P2CB 3RLFA 1HHVA 2NYZD 3BZDB 4RWSC 1XTCD 5DM73 3IL8A 4UDUC 5LL6X 5BN4A 3D4WA 4CKBA 4ZRZA 1IW7C 1F9PA 3H0GB 2NTTA 3NWSA 1CM9A 3V05A 1CHQD 1RJTA 4QF4A 3H09A 5EQ0A 4RGNA 5NUCA 4G57A 3P20A 1RCVD 2EYPA 1Y1WB 1DD2A 1Q1BA 2HCIA 1GUGA 4FXGC 2SEBD 1PMRA 3J81E 2RSOA 1G91A 4PMBA 1MD2D 3M3YB 3OPOA 3PUYA 1YNJC 4KTAA 5DAUA 3KLSX 3VA7A 5CV7A 2HCCA 3ND9A 1EY8A 2M9VA 3DMUA 1STGA 4C3JB 1SNMA 1CFMA 1GUTA 5K36H 2Q8IB 4HSPA 4K5VA 4G7ZC 5I4DA 4G4KA 1JORA 1PTOB 2A6HC 4A3BB 2XWJB 1LTTD 1B50A 5M5XB 1H9SA 2E2JB 1NR2A 4WJWA 4FXKC 5E4WC 3VA5A 3TN2A 1I3QB 3ND8A 3QOJA 2HQEA 4V0BA 1TQOA 4C3IB 2J0TD 5G3LD 2D62A 3NUCA 3P1HA 2KA7A 1ZKOA 1LABA 1X3PA 2D2CC 5I6WA 5F2DA 4IALA 4DGZA 2BDNA 5C4ZA 1JWMD 5C4HA 2AWNA 1PFMA 5BN5A 1LTRD 2K32A 5EJWA 1RTNA 1W6JA 2MHVA 4XQQA 5JEAG 1JE4A 3L3OC 4ZKCB 3GP7A 4A3KB 5C0XI 1MSGA 4A3DB 3GTMB 1AFPA 2V4DA 5KNBA 4K6DA 1L0YB 2EOTA 4CBVA 5M5WB 2IT1A 3MXGA 1TWAB 2BOSA 2M00A 3K5MA 3G7LA 1STNA 3PUZA 4Q0FA 1SNOA 4E6IA 3DM1A 4Q5VA 5JAVA 1S5BD 2WINB 1K8OA 5EPLA 3I90A 2K04A 5CGKA 4R8NA 3SDZA 3PUVA 2O4XA 2A69C 2DY7A 1MI2A 4EGVA 2I46A 1S5DD 5KNDA 2OT2A 2PQEA 5ELCA 2VNUD 2IL8A 1ZEQX 4IUNA 3M4OB 1PTOC 4QUFA 1V43A 3OMGA 1LTID 1B3AA 4HAEA 5EPKA 3DEOA 5FLXE 1ESRA 4KD4A 5A2QE 5BN3A 2B2WA 2E74C 1PRTF 3K58A 2NN6I 3BDLA 1IYUA 2AUJD 3KBXA 4EQNA 1KNAA 3HG9A 1LACA 1I50B 2OXPA 5CV9A 3HEJA 5IT9E 3CQZB 3K7AB 1S5FD 1EIGA 1BCPB 1EY4A 3OW7A 1YNND 1BBXC 1MSHA 3DXJC 3SK5A 3BG3A 2FFKB 2WKDA 1BF4A 5T1GA 3QIAA 1WTWA 1H9MA 3MHBA 1GJXA 4DK0A 4NMZA 3TP7A 3TZUA 2MGSA 4XXEA 1LT4D 4BY1B 2F0LA 1MBYA 1TS2A 1IKLA 2F0MA 2KJXA 3VYSA 3AMUA 1SNCA 2JA5B 4KHVA 4IN3A 1PZJD 5J1ZA 3ZYYX 2KUMA 3OSOA 1KTKA 2L0CA 1RODA 2L9HA 1A15A 4G7OC 1ENAA 2EY2A 1GHJA 1D2BA 1HQRD 1F2LA 1X3QA 4RKLA 1YNNC 2QF7A 5M3FB 3HZXA 3MZ5A 2NUCA 2PW7A 4ODGA 1Q90A 5E3FA 1JC7A 2E2DC 2HDLA 1Y8PB 3BYTB 5ELEA 4J1MA 2EY6A 4A3MB 3TDQA 2ICEC 4FF4A 2EY1A 1TWGB 4RH6A 1ET6A 2NTSA 2EYMA 4CJ2C 1PXUA 4NW2A 4RHSA 1I4PA 2LY7A 1H9SB 1FYCA 4A93B 4WRDA 2F0QA 3MC0B 3C1EA 1BNZA 5HURA 5K5PA 1ICWA 4N9TA 3C1FA 2YYZA 5TSSA 3MWYW 1EU3A 3S2DB 1B2TA 4QCLA 3PUXA 3S16B 1M4VA 5C3WA 4ULLA 1H9JA 1GUWA 1KLUD 2O5JC 1IKMA 2WKCA 5E4XA 2BA0A 1E2VA 2BA1A 1LTAD 3RUZA 3CKIB 2R92B 4PMWA 3C2PA 4M1UB 1B44D 1AN8A 3J7AF 1NSNS 1TWHB 3WDNA 1LO5D 3Q23A 4V190 4IUTA 3HOVB 5C3EB 4MN3A 3K57A 1SFOB 2Y0SB 1SXTA 1O7LA 5G3LF 1CZWA 1VF5C 3D4DA 1WD0A 4CKEA 3T13A 4KD3A 4DA2A 3GV3A 2K5QA 1E2ZA 2WAQB 4CKCA 1SNDA 1J8IA 3IFTA 3PO2B 1AEXA 1BQQT 1JCKB 3RD4A 2FHTA 3NTHA 3LX0A 4C3IG 4TRDA 4KJNA 3M85A 1WTXA 2D9UA 3N52A 4I7ZC 2ZXRA 2NVTB 2NVYB 1WTVA 1TY2A 4AYBB 4XQJA 3AU7A 1DYQA 4IFDG 4LJZC 4HEDA 4EVOA 1W6KA 4XT1B 1B1ZA 5IODA 1DOKA 1QE6A 4C3HB 5A2QL 1IW7D 1KLGD 2DNCA 3C46A 1Z6HA 1V1PB 4X3SA 1I6HB 1O80A 2WP8J 3OHXC 4B08A 1EFID 1STHA 2F0EA 1SMYD 1SAPA 1A6XA 4NKLA 1STEA 1A2TA 3QJYA 3W3AA 5KGUA 5C0XG 4OIKA 2IJ0A 2RQXA 3KBGA 2F0UA 1C8CA 3SK4A 4Z9CB 2B2TA 2PYKA 2K7VA 4B9WA 1A2UA 3T16A 4B9XA 2B2UC 2F0DA 1I4HA 4WORA 4KY7A 1HPCA 1VDZA 3RZOB 2ZXOA 1DJRD 5ELDA 5IOCA 2WV6D 4DNTB 2BE5C 3HOYB 3SE0A 3VYRA 2QDBA 5D65A 1Z7TA 4QIWB 2PW5A 3J7YW 4R8IA 4FYDA 2B63B 1A3TA 1EZ6A 4ZQ3A 3HP3A 5CORA 3DWQA 1WTPA 2SDFA 2AUKA 2L55A 3P7JA 4N9PA 4X3TA 4DXGA 4U68A 3VR5A 1M8AA 4QB4A 4NP5A 1S5CD 2OEOA 1MGSA 1F9RA 1SEBD 2A68C 1YNJD 2A73B 2MP1A 3EJIA 3S17B 3TP5A 4ZAIA 5T1IA 3CRLC 4KK7A 2JP1A 3X3MA 5EKIA 5FO9B 3V96A 2E75C 4IUPA 4K5XA 1EIHA 4L8JA 3M7GA 5JPMC 1K8MA 3FVQA 1NR4A 3TBIB 3OMCA 4CJ0B 2PPBC 1IYVA 3OIQA 4H13C 3R2IA 4DF7A 4FVMA 2N88A 1OXSC 3T51B 1HQMC 4J8QA 4MIUA 1C4QA 5IGEA 1O7ZA 1PLFA 1BCPD 3SHLA 4IFDH 5IGGA 1GXDC 2RDGA 4CGYB 5FLXL 1UAPA 2EYHA 2KECA 4ZYSA 1T5XD 3A8JE 2RA4A 1TY0A 3S1MB 1DCZA 5CBEE 2L1BA 4O1NA 2B8FA 1BXTA 3VR2A 3URYA 2XN9C 1NAPA 5M5YB 3W2DA 3GV6A 1HCZA 4OHJA 2F0FA 3C3LA 1UEAB 2NN6G 2B39A 3E5SA 1CI3M 5DEHA 2F0VA 3DWPA 3QB3A 2YU9B 1WTOA 4BY7B 3FEWX 3T53B 3HOZB 4RFBA 3BDCA 3QWNA 1HXYD 2PNRC 4HN7A 1PZID 1IHZA 4K14A 3L9AX 1Q3LA 2DN8A 3TP6A 3DWAA 3MXPA 3D6CA 1EOTA 1JOQA 2JE6I 3RZDB 1SJED 1SSOA 1EQVA 2K03A 2RSNA 3MXNA 2M2LA 1V1PA 5JJZA 3HRZC 3GO5A 2XVSA 2JA7B 5I6YA 4QMGA 5KYLA 1CT1D 4KN7C 3QG1A 3D8GA 1EYCA 2X6LA 4XT3B 2R7ZB 1D5ZC 3E0JA 4DNRB 1PRTC 4FO2A 4HCEA 1CTMA 4DK1A 4K8IA 5K36G 3HGBA 1F2YA 1SE3A 2WIIB 2F1MA 2LFNA 3I72A 3CRKC 2K28A 1FGBD 4IUQA 4H7BA 3J80E 2F0TA 3GTGB 3OWEB 5AFWA 1I4RA 3N6RA 2QCPX 4K2KA 1TS4A 1PDQA 4NDXA 1EY6A 1HFNA 4DAPA 2N55A 1V1OA 1I4XA 1WTQA 4PQXA 4PMCA 1S5ED 5CV4A 2EVBA 4KHZA 2D5DA 3D4RA 1KDBA 1EYDA 4L6TB 3SEBA 3TSSA 3DHQA 4IFDI 2Z1CA 4JBWA 2EDGA 1SNPA 1EY7A 2G9HD 2Q8TA 2NN6H 4BBSB 3ERQA 2JA8B 4TKOB 1BR9A 1PRTD 2JXMB 2E76C 2XSCA 3EQLC 4BA2I 3A8IE 1SYGA 1FNUA 2IW3A 4ID6A 3LNNA 1HA5A 1ONLA 1EWHA 1BUVT 4K2LA 5JOBA 3MEHA 1LTSD 5IGBA 4LK1C 1PZKD 2NWGA 3SK8A 1B9MA 3A7AB 1DONA 2KCNA 1Y1VB 1F77A 2ZXPA 2EJFC 2EY5A 5I2YA 1SE4A 2K05A 3D6WA 2A6HD 2NBFA 1G2SA 4K8JA 3PO3B 1RDPD 4XYOA 2DY8A 2E2HB 2JEBI 2EYFA 4HMIA 1WCMB 1TIID 4DAYA 2VB2X 5FO7B 2IWHA 3CU7A 1E2WA 5J39A 4S3SA 2RDHA 4DN4M 1IL8A 2EXZA 5ELBA 1OXXK 4OO1I 3MA2B 1VCIA 5C44B 2SNSA 4ME5A 2PO4A 3H6MA 1Q8IA 1CQFA 1RF2D 2Q8RE 4F8MA 3U9OA 1HRJA 1ZXTA 4RCNA 1WVLA 3JAML 2F0SA 3T4AC 2EYLA 1BO0A 3DEPA 2JSOA 4TSSA 5CR3A 2A68D 3M7NA 3J81L 3J80L 2XIWA 4O42A 2B8GA 4IURA 4M8AA 2XWBB 2O5IC 2K01A 1F9SA 4R9WA 2R93B 3K5OA 3FRPB 3GTKB 3Q24A 3BYYB 2A5HA 3NPPA 4BWGB 3T56B 2B2WC 1I6VC 1A3VA 4F7XA 3EROA 3P75A 4ILWA 1VMCA 3DUZA 1XWEA 2K5DA 3IKJA 5DNFA 2HDMA 4XQNA 1I4QA 1Q12A 5CBAE 1B53A 4HSVA 4CJ1B 4I65A 3I4LA 4IUUA 2JA6B 3M4YA 4ZUIA 4ZLTF 3R8BA 1SNQA 1XX8A 3NBIA 2KEEA 4EQPA 3FPUB 1JB3A 2LMCB 5CMDA 2GA4B 2J4XA 1FNWA 1DOMA 1HUNA 1D1IA 5EGTA 4OL7A 4KKSA 4A3EB 2K1BA 2J7ZA 4KJOA 4DFAA 1SE2A 1FR3A 1U4LA 3A55A 3NWTA 2JYOA 2PZWA 4RHRA 3K5LA 1R4QB 4RGMA 4KY6A 4OO1H 5D3DA 1AP0A 2A6ED 3ONAB 2RDFA 3HS0C 3K59A 4MHEA 2AQ2B 1CA6A 4A3IB 3H3VC 1STYA 4KMUC 2BCOA 3NXWA 1O7YA 1GOZA 5ELFA 1BOSA 2R61A 3SXHA 3E6ZX 2PCFB 3SK6A 3A7LA 1F2ZA 1EWCA 1NUCA 2RVLA 3S1RB 3VYUA 2O2LD 4ZK9B 3F2UA 3L7ZC 4H44C 1OO9B 4FF1A 3R2TA 1U4PA 2B2VA 4KV6A 1DXMA 3QO2A 1LT3D 3A8KE 3D3RA 4F88A 2EE1A 3IAYA 1LV9A 4ABNA 3PV0A 1H9KA 5JVH3 4U673 4XIGS 2L5TA 1R4PB 1E0BA 3U9SA 2CW0C 3NHHA 2F0OA 1QILA 5IGFA 4RGTA 3MXUA 4LAAA 5C3XA 5IIFA 4FP5D 2B2TC 1TR5A 3G6JB 3RMHA 4LMQD 3LWEA 1EY5A 4H0LC 2LKVA 3NBHA 2F3WA 1XXGA 5JPNC 1PFNA 2EZVA 2B2YC 3VYTA 1RTOA 4DXFA 1BCPC 1ENFA 4G7HC 1DOLA 3VR3A 1TS3A 2IPKD 1Y8OB 1O78A 2L12A 1JWUD 1PTOH 1RHPA 4K5WA 2RKSA 3K5NA 3NK9A 1G6ZA 4A3GB 3S1QB 1OXTA 2L11A 3CHBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCN A;  2NBF A;  2MHV A;  1AFP A;  2NB0 A; 
#chains in the Genus database with same CATH topology
 4DR7 Q;  1SYC A;  3PIP 3;  1K83 B;  4N8F A;  4R4O A;  2PQA A;  4UY8 C;  3PMF A;  5J22 A;  5C4J B;  4BA1 I;  5EKK A;  3U50 C;  3PIO 3;  4GOP C;  3GTO B;  3HOW B;  1YHA A;  1L0X B;  2PZU A;  3SGI A;  2EJM A;  3OOC A;  3L2P A;  4CDC C;  2FMC A;  4A3C G;  1KQS A;  3BDO A;  3HOY G;  1IYJ B;  5LMN Q;  4KY5 A;  4LF5 Q;  2MFI A;  2Z8L A;  1XNQ L;  1CK1 A;  1SYD A;  1KNE A;  1AZP A;  1JIC A;  2K5W A;  5JEA J;  1JJC B;  2VQE L;  2XNA C;  1Y1W H;  1Q1E A;  1U4M A;  1VQD A;  5FKA C;  5GAH C;  2ICI A;  2KQ3 A;  4A3L H;  4DV7 Q;  2EQS A;  2XRS D;  3KUP A;  3BVM A;  2HIX A;  2UXD Q;  5D14 A;  1VMP A;  1VQ6 A;  1T5E A;  1VQK A;  3V2T A;  2H4O A;  2UUC Q;  2FJ2 A;  4HCS A;  1TS5 A;  1V1Q A;  1VQI A;  2EYO A;  1Y1V G;  2Z4H A;  5CV6 A;  3KK7 A;  1HNW Q;  1GM5 A;  2A69 D;  4RKB A;  1H95 A;  3KF8 A;  5IE8 A;  3K0Y A;  2DJG C;  4GKK Q;  3TP8 A;  2VQE Q;  5EBD A;  1GUO A;  2XRQ D;  1OTC A;  1SFO H;  1FD7 D;  2ZM6 L;  3LWU A;  1YIT A;  3CCQ A;  1U9R A;  3J7Z C;  1EEI D;  3H94 A;  4C1N I;  2NVQ B;  1TWF B;  3W1B A;  1LTG D;  1HR0 W;  2EJG C;  5C5M A;  4A3F H;  4JI6 Q;  2Z6B A;  3GD7 A;  4GOP B;  1XNR Q;  3QOL A;  3NP8 A;  4L63 B;  2E2J H;  3FMC A;  5CV5 A;  2MPM A;  3U58 A;  5BR8 L;  4R4I A;  3WOF A;  2Z4I A;  1QZG A;  3X3N A;  4LUZ A;  1AW7 A;  1F2M A;  4MTK A;  5FLX c;  4DR2 Q;  3SR1 A;  3H15 A;  4Y7N B;  4IPH A;  3EBE A;  3S9W A;  3ULJ A;  3KLS A;  1KDC A;  1CKO A;  2EYJ A;  1E22 A;  4KHP L;  5E1F A;  2AQ1 B;  2H1E A;  4CDE C;  4O2D A;  1X55 A;  2BE5 D;  4ZKB B;  5I2X A;  4LF9 Q;  2B2V C;  3FKI G;  1SMX A;  3HKZ B;  4FNF A;  4C1N K;  1UNS A;  2TSS A;  5M3M B;  2ALY B;  4HTH A;  3S1N B;  3F1Z A;  3JC6 6;  4JK1 C;  1PH3 A;  3Q6S A;  3KLR A;  1IZ6 A;  4QUC A;  4JI8 Q;  1JT8 A;  5C4X B;  1OXU A;  4BBR B;  4LUO A;  4NXN L;  2F0P A;  5IT9 L;  2PMZ B;  4C2M H;  4DAM A;  2JQO A;  5IP7 H;  4DR1 L;  5FOB B;  5I9O A;  2OF1 A;  3KYH C;  1RL2 A;  1BVS A;  1Y8N B;  3MFG A;  1N9W A;  4Y7N H;  1ML0 D;  3S24 A;  4X3K A;  1J9O A;  1JOK A;  1ZYR D;  2Z0S A;  3KF6 A;  2BDO A;  3EVQ A;  4YIJ A;  1IBM L;  2BH8 A;  5C6A A;  3BVG A;  1WI5 A;  3TZD A;  1SMY C;  1SYB A;  1TWG H;  3NEL A;  5JEA H;  1S4Z A;  3I8Z A;  1N8R C;  1ZYR C;  3TME A;  5KEE A;  3A5Z B;  3TQY A;  2JA8 G;  3ERS X;  2VUM B;  4A3F G;  1D5X C;  3K8A A;  1SR3 A;  3M9B A;  3UI2 A;  1QJO A;  3AB9 A;  1V9P A;  2VB3 X;  3FDT A;  1S40 A;  4JI5 Q;  3HOX B;  4JBK A;  2CHB D;  1H9R A;  3A56 A;  3GTP H;  1B9N A;  2K6A A;  4C3H G;  1EQT A;  5A35 A;  3GTP B;  4JC0 A;  1X32 A;  4IJH A;  5C5L A;  4OIJ A;  4GNX A;  2FIN B;  3HOU B;  2VUM H;  4XDX A;  3S14 B;  1D1K A;  2MJ8 A;  1RKN A;  1HA6 A;  3STB C;  1IBL L;  4GLA C;  1WCM H;  4FF2 A;  4AIM A;  4GS3 A;  2SOB A;  5FJ8 H;  4FF3 A;  3G6E A;  3PGZ A;  5AJ3 Q;  1QCB D;  2B63 G;  5I9P A;  2DJF C;  4X3U A;  4AQY L;  2MUY A;  2QDL A;  5COY A;  1TWC B;  3K6O A;  4C2M B;  2VXW A;  1U4R A;  1EZ8 A;  5EKL A;  1XPU A;  3S2H B;  1LT5 D;  4JCV E;  4IUV A;  5C3E G;  1WD1 A;  3Q22 A;  1KAA A;  2F0K A;  4IOA A;  4NPS A;  2R6G A;  4DV2 Q;  2QIL A;  3CMA A;  1M1K C;  4LF4 Q;  3B6Y A;  3GTQ B;  2A74 C;  4J6H A;  1D5M C;  2ID0 A;  1XNQ Q;  4A3C H;  2RBM A;  5EPJ A;  1LYL A;  4PV1 C;  2OWO A;  4O0A A;  3ITP A;  4K0K L;  2V1C C;  3NQI A;  4XYQ A;  1KRS A;  5IGC A;  1HZB A;  2R7Z G;  4POF A;  3SVM A;  1NCV A;  3VR6 A;  3KJO A;  4BXX H;  1SLJ A;  2DGY A;  2E2I B;  1JOO A;  3I4M G;  2FMM A;  3S15 B;  2WAC A;  3CQZ H;  2A6E C;  5FO8 B;  1N33 Q;  4A3J B;  2IX0 A;  1STA A;  1JR0 D;  1GO3 E;  4YCW A;  1PTO F;  2F0G A;  4PZ8 A;  2AQ3 B;  3STB D;  3CCR A;  5KNC A;  3JAM E;  1G29 1;  1JWS D;  4HR7 B;  4BBS H;  1EY0 A;  2CVR A;  1K8G A;  3I4N H;  1HR0 Q;  1SBB B;  3CCJ A;  3J7A V;  4WFN 3;  1XTD A;  1HFG A;  1SYF A;  2KHS A;  2C9O A;  3OIP A;  5LMU L;  4C3J G;  4K0K Q;  1HUM A;  2NVX B;  3Q0A A;  3GDE A;  1D6E C;  2F4V L;  4JI4 Q;  1B4O A;  2IX1 A;  1LT6 D;  4JI6 L;  1CSP A;  3F2C A;  3D0F A;  3MVV A;  4OEL B;  1LLR D;  2F3V A;  2MNA A;  1T9H A;  1VF7 A;  1EL0 A;  5IGD A;  3K7U C;  5C0X H;  1K3R A;  1II3 A;  4LFB L;  1SRU A;  2F0W A;  4GKK L;  1BCP F;  3BVZ A;  3I70 A;  5DM6 3;  1GUS A;  3NSW A;  2LS0 1;  1JQY D;  4JV5 Q;  2K33 A;  1G8Z D;  2H5X A;  4HMJ A;  4JV5 L;  4A93 G;  2HQL A;  4P74 A;  1Y69 U;  2C5C A;  2UXC L;  2CQA A;  2R3Z A;  5FK9 C;  4DU9 A;  4IOC A;  1QG7 A;  1PRT B;  3MAQ A;  1CSQ A;  2ENB A;  1QVG A;  3GQB A;  4ZUJ A;  1IBL Q;  1J6Q A;  2QGQ A;  3I4O A;  4RGO S;  3GTO H;  5HGT A;  1EYG A;  3NTK A;  4BS9 A;  1LTB D;  2MQH A;  1EU4 A;  2CCZ A;  3HKZ E;  1TT2 A;  4QY7 A;  4BY7 G;  4IJL A;  1SJH D;  4IFD J;  3FKI B;  5LL6 S;  4OO1 G;  4K6L A;  5ISR A;  4KKU A;  3S2H H;  3J81 j;  2TMP A;  2F0J A;  3EA6 A;  4KI0 A;  1PYW D;  3VR4 A;  5M9O A;  1EYA A;  2AHO B;  5D3I B;  2WB1 B;  1TKW B;  2HUG A;  2L4N A;  4CHT B;  2E5L L;  2DNE A;  1FJG Q;  2IHE A;  1QNK A;  3FP9 A;  4L5S A;  2ZT9 C;  1F9Q A;  2KOL A;  1HTL D;  1VQ8 A;  4LF6 L;  3HOW G;  4IZ8 A;  1RD9 D;  1SRO A;  5CYU A;  3EFX D;  1KDA A;  1WCM G;  4EQO A;  4DAV A;  5JVG 3;  4ALP A;  4JYA L;  1SN8 A;  2JEA I;  1CZG A;  3KLW A;  2IX3 A;  4HJ8 A;  4OEM B;  2UUB Q;  1Z47 A;  1ET9 A;  1VQ4 A;  3WOE A;  2EPB A;  1PH4 A;  2KCC A;  3CXC A;  2F4I A;  1GUN A;  4DUZ Q;  4LF7 Q;  4A4I A;  1AZQ A;  4KKT A;  2SNM A;  4KN4 C;  1G2T A;  4RA8 A;  4MTN A;  1B3Q A;  1ILQ A;  3PF4 A;  2F03 A;  4KHP Q;  1DM0 B;  4RCO A;  3PSI A;  1HTP A;  3I91 A;  1CHP D;  1DZ1 A;  2IY5 B;  1V8Q A;  3E9I A;  5LHY 1;  1STB A;  1OXV A;  4QGU A;  3GTL B;  1TVX A;  3I4N B;  1ESF A;  2Z6K A;  3AYH B;  4X64 L;  1E1T A;  2CWA A;  1I4G A;  1SDF A;  5FJ8 G;  3PF5 A;  2Q2U A;  4F87 A;  4J15 A;  1UUP A;  4OGQ C;  4OWX B;  1K8A C;  5CV8 A;  2X6G A;  3S15 H;  1GHK A;  5JJI A;  3I3C A;  3PUW A;  4A3B H;  2UXB Q;  3NQT A;  2K5H A;  1SYE A;  1PFB A;  2B2Y A;  1FNV A;  5GAE C;  4X64 Q;  1CA5 A;  4OWW B;  2B2U A;  4RAU C;  4BY7 H;  3A54 A;  1VQ9 A;  3MTS A;  1HJP A;  2KVM A;  4BBR H;  2I0Q A;  2KED A;  3AFQ A;  3J81 c;  2F0I A;  1QB5 D;  1X54 A;  4IQZ A;  5C0X J;  4GZY C;  1VQE A;  1C48 A;  1CQV A;  2AWO A;  4LF5 L;  2VZA A;  1KAB A;  1VQL A;  4EQ5 A;  3D31 A;  4UAI A;  5E7N A;  3T1H Q;  3IFD A;  2I07 B;  4C56 C;  3Q8D A;  3I73 A;  3S2D H;  3CD6 A;  1EEF D;  4L5T A;  3GTJ B;  3NTI A;  4DR5 L;  2N78 A;  2QKI C;  1ENC A;  5EBC A;  3CAM A;  4CDF C;  1Q82 C;  2IHF A;  3O13 A;  2Z6K C;  3I4M B;  1A3U A;  5KYI A;  1PH7 A;  3FHW A;  4GLV B;  3CCM A;  2R7Z H;  1PTO D;  4FXD A;  2G9D A;  2NZ1 D;  1VQN A;  2F0N A;  2QEJ C;  2RHS B;  4A76 A;  1TXY A;  3CC2 A;  2NZO A;  1P8L A;  1QOH A;  2F0H A;  3FPP A;  2R7F A;  2X69 A;  4TQU S;  1R9T B;  3OYY A;  1QNU A;  5CC4 A;  3BS1 A;  1JB7 A;  3I4N G;  3NE5 B;  4PNY A;  5KIX A;  3OWF A;  1EY9 A;  1ILP A;  3MFY A;  2MO1 A;  2VQF L;  1BDO A;  2PZT A;  3HOU H;  2NB0 A;  4A3F B;  3H91 A;  4NXM Q;  5FLM G;  2A19 A;  2CW0 D;  4XTC S;  2OQK A;  4X6A H;  1Q46 A;  4JW0 A;  1QZH A;  2CKZ B;  3R3O A;  3R93 A;  1TU2 B;  5KRU A;  1XYI A;  1WTR A;  1QWY A;  4P2C B;  4A3E H;  3RLF A;  1HHV A;  2Q2H A;  2NYZ D;  3TRE A;  1YI2 A;  1PYS B;  3BZD B;  4RWS C;  5EAY A;  1XTC D;  4ME3 A;  1E3P A;  3IL8 A;  5DM7 3;  1E7Z A;  1JMC A;  4UDU C;  5LL6 X;  1I94 Q;  2P5Z X;  5BN4 A;  3D4W A;  4CKB A;  4ZRZ A;  1IW7 C;  1R9T H;  1LTL A;  1F9P A;  3H0G B;  2NTT A;  3NWS A;  1CM9 A;  2YV5 A;  2E2H H;  3V05 A;  1CHQ D;  2KCM A;  1RJT A;  4QF4 A;  3H09 A;  5EQ0 A;  2N3S A;  4RGN A;  5NUC A;  3M4P A;  3P20 A;  1RCV D;  4G57 A;  4ZCK A;  3HOZ H;  2EYP A;  1Y1W B;  3UDX A;  1N32 Q;  1DD2 A;  1Q1B A;  2GVA A;  2HCI A;  1GUG A;  4FXG C;  2SEB D;  1C0A A;  1PMR A;  3A0J A;  3J81 E;  2RSO A;  1G91 A;  4PMB A;  1MD2 D;  4WJ3 M;  3M3Y B;  3OPO A;  1N36 Q;  4POG A;  3CME A;  3PUY A;  1NY4 A;  1YNJ C;  4KTA A;  5DAU A;  5M3M H;  3KLS X;  5HY6 A;  3VA7 A;  5GRO A;  5CV7 A;  4HIK A;  2HCC A;  1W2B A;  3ND9 A;  1EY8 A;  2N8N A;  1CKM A;  2F52 A;  2M9V A;  4DR7 L;  3DMU A;  3S1Q H;  4LFA Q;  1STG A;  4JI2 L;  4C3J B;  1SNM A;  1CFM A;  1NMG A;  1GUT A;  2JN4 A;  5K36 H;  1FJG L;  2Q8I B;  4HSP A;  1VQ7 A;  4K5V A;  2JK8 A;  4HJ5 A;  4G7Z C;  1QVC A;  5I4D A;  4G4K A;  1JOR A;  1Q7Y C;  1PTO B;  2A6H C;  5HGQ A;  4A3B B;  2XWJ B;  1LTT D;  1B50 A;  5M5X B;  1H9S A;  1X65 A;  1YNX A;  1I50 H;  2E2J B;  2JA7 G;  1NR2 A;  4WJW A;  4FXK C;  5E4W C;  3VA5 A;  3TN2 A;  1I3Q B;  3ND8 A;  3QOJ A;  2HQE A;  5LMN W;  4B3S Q;  4V0B A;  2KHJ A;  1TQO A;  4C3I B;  3UE0 A;  1D7Q A;  4A3D G;  2J0T D;  5G3L D;  2D62 A;  4X65 L;  3NUC A;  1AE3 A;  3P1H A;  2KA7 A;  1FVI A;  1ZKO A;  1I94 L;  3HKZ G;  1LAB A;  1X3P A;  2D2C C;  5I6W A;  5F2D A;  2VQF Q;  2Y0S G;  1HNZ Q;  4IAL A;  2K75 A;  2UUB L;  4DGZ A;  2BDN A;  5C4Z A;  1JWM D;  5C4H A;  2AWN A;  1PFM A;  3KDF B;  5BN5 A;  1LTR D;  2K32 A;  5EJW A;  4JI0 Q;  1RTN A;  5ELO A;  1W6J A;  4P75 A;  2MHV A;  4XQQ A;  5JEA G;  3I2Z A;  4QQB X;  1JE4 A;  3L3O C;  4ZKC B;  3GP7 A;  4A3K B;  5DLQ E;  5C0X I;  5BR8 Q;  1MSG A;  4A3D B;  4P73 A;  3GTM B;  4BBR G;  4LW1 A;  3H3V I;  1I6H H;  1AFP A;  2MO0 A;  2V4D A;  1S72 A;  5KNB A;  4DV3 Q;  4K6D A;  3S17 H;  1L0Y B;  1QVF A;  3T1H L;  5IWA L;  4WJ4 A;  1Y1V H;  2EOT A;  4CBV A;  5M5W B;  2IT1 A;  3MXG A;  1TWA B;  2BOS A;  4LFC L;  1PH9 A;  2M00 A;  3K5M A;  1HH2 P;  3G7L A;  1STN A;  2YTV A;  5C4J H;  1HZC A;  1VQC A;  3PUZ A;  2RHQ B;  4Q0F A;  1SNO A;  4E6I A;  3DM1 A;  4DV4 L;  2NVY H;  4Q5V A;  4JBJ A;  5JAV A;  1S5B D;  4DV6 Q;  2WIN B;  1K8O A;  5EPL A;  3I90 A;  4A3I H;  4PG3 A;  2FXQ A;  2K04 A;  5CGK A;  4R8N A;  3SDZ A;  1IBM Q;  2B63 H;  3PUV A;  4A3D H;  4L5Q A;  2O4X A;  2A69 C;  2DY7 A;  1MI2 A;  4EGV A;  2I46 A;  1S5D D;  5KND A;  2OT2 A;  2PQE A;  5ELC A;  4X62 Q;  2VNU D;  2K14 A;  2XGT A;  2IL8 A;  4NXN Q;  1ZEQ X;  1YEZ A;  4IUN A;  4R1J A;  3M4O B;  1IBK Q;  1PTO C;  4QUF A;  1V43 A;  3OMG A;  1LTI D;  1B3A A;  4HAE A;  5EPK A;  3DEO A;  5FLX E;  1SE8 A;  3HOZ G;  1ESR A;  1Q81 C;  4KD4 A;  4JI5 L;  5A2Q E;  5BN3 A;  2B2W A;  2Q2I A;  2E74 C;  3OTO L;  1PRT F;  3K58 A;  4BXX G;  3PQI A;  4GLX A;  2NN6 I;  3BDL A;  4DR3 L;  1IYU A;  1K0S A;  2AUJ D;  1VQA A;  5IYB G;  3KBX A;  4EQN A;  1KNA A;  3E9H A;  1HZ9 A;  1K3B C;  3HG9 A;  1LAC A;  1I50 B;  2OXP A;  4LF4 L;  3HKS A;  5CV9 A;  3HEJ A;  1X3E A;  3HOV G;  5IT9 E;  3CQZ B;  3K7A B;  4GN4 B;  2E2I H;  1S5F D;  2HHH Q;  1EIG A;  1BCP B;  1EY4 A;  3OW7 A;  1YNN D;  3W5O A;  1GKH A;  1BBX C;  1MSH A;  3DXJ C;  3GTG H;  3SK5 A;  3BG3 A;  3PCO B;  1NMF A;  4APV A;  2FFK B;  3TEH B;  2WKD A;  4YHH Q;  1BF4 A;  1QUQ B;  4YWL A;  1AE2 A;  5T1G A;  4A3I G;  3BJU A;  4TVA B;  1C7Y A;  3QIA A;  1WTW A;  1H9M A;  2EXD A;  2K50 A;  3MHB A;  4OWT B;  1GJX A;  1ICF B;  3CPW A;  3H3V H;  4DK0 A;  4NMZ A;  4R4T A;  3TP7 A;  3TZU A;  4A75 A;  2MGS A;  4XXE A;  1LT4 D;  2LXK A;  5M3F G;  4LNQ A;  2JA9 A;  4BY1 B;  1ASZ A;  4RG1 A;  2F0L A;  1MBY A;  1TS2 A;  2ZTE A;  1IKL A;  2LXJ A;  2KEN A;  2F0M A;  2KJX A;  3VYS A;  3AMU A;  4A93 H;  1SNC A;  3VDY A;  2JA5 B;  4KHV A;  3A5U A;  4IN3 A;  1K0R A;  1BBW A;  4EX5 A;  1J5E Q;  1PZJ D;  5J1Z A;  3ULL A;  3ZYY X;  3ICE A;  2KUM A;  3OSO A;  1KTK A;  2L0C A;  1ROD A;  2L9H A;  1A15 A;  2Q2T A;  4G7O C;  3KFU A;  1ENA A;  2EY2 A;  1GHJ A;  1D2B A;  1HQR D;  5C44 H;  1F2L A;  1X3Q A;  4RKL A;  1YNN C;  2QF7 A;  5M3F B;  5C3E H;  3HZX A;  3MZ5 A;  2NUC A;  2PW7 A;  2A8V A;  4HJ7 A;  1EQR A;  4ODG A;  5IYC H;  1Q90 A;  5E3F A;  1JC7 A;  4A3M G;  3U4V A;  2E2D C;  2HDL A;  1Y8P B;  3BYT B;  5ELE A;  5H1S E;  4J1M A;  2EY6 A;  4A3M B;  3F2D A;  4LF7 L;  3TDQ A;  4JBM A;  2ICE C;  4FF4 A;  3AFP A;  2EY1 A;  2VS1 A;  2G5D A;  2ZTC A;  1TWG B;  4RH6 A;  1ET6 A;  2NTS A;  2EYM A;  4CJ2 C;  2PI2 E;  1L1O C;  2ASB A;  1PXU A;  1NBW A;  3KF8 B;  4NW2 A;  1HR0 L;  4FDB A;  4RHS A;  1I4P A;  2LY7 A;  1H9S B;  1FYC A;  4A93 B;  4WRD A;  1BBU A;  2F0Q A;  3MC0 B;  3C1E A;  1BNZ A;  5HUR A;  1UEB A;  4GNX C;  3I4M H;  5K5P A;  2HIV A;  1ICW A;  4GKJ L;  4JI7 L;  1VQG A;  3AEV A;  4DUY Q;  4N9T A;  3C1F A;  2YYZ A;  3S16 H;  5TSS A;  3MWY W;  1PH6 A;  1O7I A;  1Y14 B;  1EU3 A;  3S2D B;  1B2T A;  4QCL A;  3PUX A;  2UUA Q;  2VL6 A;  1A0I A;  3NBH B;  3GTK H;  2XTI A;  3CW2 C;  3S16 B;  1M4V A;  5C3W A;  4ULL A;  2L15 A;  1VQ5 A;  2R93 H;  1H9J A;  1GUW A;  1KLU D;  4A3J G;  2O5J C;  1IKM A;  2WKC A;  5E4X A;  2BA0 A;  1E2V A;  2BA1 A;  1XMQ Q;  1LTA D;  1KRT A;  3RUZ A;  1BKB A;  4X62 L;  3CKI B;  2R92 B;  1Y1W G;  2ZTD A;  4PMW A;  4HIM A;  3C2P A;  1QUQ A;  1HNW L;  4M1U B;  1KL9 A;  5IYB H;  1B44 D;  4YY3 L;  1AN8 A;  4YY3 Q;  3J7A F;  1VQM A;  3BZC A;  1NSN S;  1TWH B;  2N49 A;  4A3M H;  5AJ3 L;  4JVZ A;  3K80 C;  3WDN A;  3RZO H;  1LO5 D;  2KCT A;  1XPO A;  2NVQ H;  2KHI A;  3Q23 A;  4V19 0;  4IUT A;  3HOV B;  5C3E B;  4LFB Q;  4MN3 A;  3K57 A;  1SFO B;  2Y0S B;  1SXT A;  1O7L A;  4YCU A;  1EIY B;  1K9M C;  2UU9 L;  5G3L F;  1CZW A;  1VF5 C;  3D4D A;  1WD0 A;  4CKE A;  3T13 A;  4KD3 A;  4DA2 A;  4HID A;  3GV3 A;  2K5Q A;  3ZJY C;  4DV3 L;  1E2Z A;  4JI4 L;  1E24 A;  2WAQ B;  2PI2 A;  4CKC A;  1SND A;  1J8I A;  1VQF A;  1EOV A;  3IFT A;  4DUY L;  3PO2 B;  1AEX A;  1BQQ T;  1JCK B;  4JI7 Q;  3RD4 A;  2FHT A;  3NTH A;  5J3B A;  1XMO Q;  2K5N A;  1VS0 A;  2GVB A;  2OTL A;  3LX0 A;  4C3I G;  4TRD A;  4KJN A;  3M85 A;  3G71 A;  1WTX A;  2D9U A;  3N52 A;  4I7Z C;  2WAQ E;  4BY1 H;  2ZXR A;  2NVT B;  2NVY B;  3FKI H;  1WTV A;  1TY2 A;  3CP0 A;  4AYB B;  4XQJ A;  3AU7 A;  1DYQ A;  4IFD G;  4LJZ C;  4HED A;  4EVO A;  3I56 A;  1X3G A;  1W6K A;  4XT1 B;  5M5W H;  1B1Z A;  5IOD A;  1DOK A;  4YHH L;  1L0W A;  3CC4 A;  1QE6 A;  4C3H B;  2F3I A;  5A2Q L;  2PMZ E;  1IW7 D;  1KLG D;  2NVT H;  2DNC A;  2E5L Q;  3C46 A;  1Z6H A;  4A3G H;  4BBS G;  1V1P B;  4X3S A;  1I6H B;  1O80 A;  2WP8 J;  3OHX C;  4B08 A;  3TRZ A;  1L2F A;  1EFI D;  1STH A;  2F0E A;  5IYC G;  4IPD A;  4UP7 A;  1SMY D;  1SAP A;  1YVC A;  4LF9 L;  3PIP A;  1A6X A;  4NKL A;  3PO2 H;  3K7A H;  2JJQ A;  1YHQ A;  3HOY H;  2C35 B;  1STE A;  1A2T A;  3QJY A;  2JA8 H;  4DR4 L;  3W3A A;  5KGU A;  4KLK A;  4DNI A;  5C0X G;  4OIK A;  2IJ0 A;  3LGJ A;  5IP9 H;  2RQX A;  3KBG A;  2F0U A;  2I5H A;  2JA5 G;  1C8C A;  3T1Y L;  1CKN A;  3SK4 A;  2PYK A;  2B2T A;  2Y0S E;  2K7V A;  4Z9C B;  4B9W A;  1A2U A;  3T16 A;  4B9X A;  5IYD G;  1CKN B;  2B2U C;  4DPG A;  2F0D A;  1I4H A;  4WOR A;  4KY7 A;  4DKA C;  5IWA Q;  1HPC A;  1VDZ A;  2F4V Q;  3RZO B;  2ZXO A;  2VUM G;  1U5K A;  3G48 A;  2UU9 Q;  1DJR D;  5ELD A;  3CCV A;  5IOC A;  3HFZ B;  2ZJR A;  2WV6 D;  4DNT B;  2BE5 C;  3HOY B;  3SE0 A;  3VYR A;  5L37 A;  2QDB A;  5D65 A;  1Z7T A;  4QIW B;  4B3M Q;  2PW5 A;  1B70 B;  3KF6 B;  4B3R Q;  2UXB L;  3J7Y W;  4R8I A;  4FYD A;  2B63 B;  1A3T A;  1EZ6 A;  1C9O A;  4ZQ3 A;  3A74 A;  3HP3 A;  5COR A;  3DWQ A;  1WTP A;  2WB1 G;  2YU9 H;  2SDF A;  2AUK A;  2L55 A;  3P7J A;  4DR1 Q;  4N9P A;  4X3T A;  4DXG A;  3DLL A;  3S1R H;  4U68 A;  3HOU G;  3VR5 A;  1M8A A;  4QB4 A;  1ASY A;  4NP5 A;  1S5C D;  2OEO A;  4LFC Q;  1X56 A;  1MGS A;  1F9R A;  1VQH A;  1SEB D;  1L1O A;  1KHI A;  1YNJ D;  2A68 C;  2A73 B;  2HT1 A;  2MP1 A;  4DV2 L;  3EJI A;  3S17 B;  2QW7 A;  3TP5 A;  1Q86 C;  4ZAI A;  5T1I A;  3CRL C;  4KK7 A;  2UUA L;  2JP1 A;  3X3M A;  5EKI A;  5FO9 B;  2YTY A;  3V96 A;  2CFM A;  2E75 C;  4IUP A;  4K5X A;  4QIW E;  4AH6 A;  1EIH A;  4L8J A;  3M7G A;  4OX9 Q;  4GKJ Q;  5JPM C;  5IT9 c;  1K8M A;  3FVQ A;  2GN5 A;  1KIX A;  4HJ9 A;  1NR4 A;  3TBI B;  3E0E A;  4JI2 Q;  3OMC A;  3OW2 A;  3S14 H;  1N34 L;  5IP7 G;  4DV5 L;  4CJ0 B;  4R4Q A;  4P71 A;  2PPB C;  1IYV A;  4UHV A;  1HNZ L;  1XNR L;  3OIQ A;  3MXN B;  4H13 C;  3R2I A;  3KDF A;  4JI3 L;  4DF7 A;  2QEX A;  4FVM A;  2N88 A;  1OXS C;  3T51 B;  1HQM C;  4J8Q A;  3RZD H;  4X66 L;  4MIU A;  1C4Q A;  2EIF A;  3I7F A;  5IGE A;  3TS0 A;  1O7Z A;  1MKH A;  1PLF A;  1BCP D;  5M3M G;  2ZM6 Q;  4B3M L;  3SHL A;  4IFD H;  5IGG A;  1GXD C;  2RDG A;  4CGY B;  5FLX L;  1UAP A;  2EYH A;  2KEC A;  1HNX Q;  4ZYS A;  1YIJ A;  1KD1 C;  1T5X D;  3A8J E;  2RA4 A;  1TY0 A;  3S1M B;  1JJG A;  1DCZ A;  5CBE E;  3NEM A;  2L1B A;  3RN5 A;  4O1N A;  2B8F A;  1BXT A;  2R92 H;  3VR2 A;  3URY A;  3L0O A;  4B3R L;  1HNX L;  4DAY B;  2XN9 C;  2E8G A;  1NAP A;  5C4X H;  5M5Y B;  4IO9 A;  3W2D A;  3GV6 A;  1HCZ A;  1YZ6 A;  3MEF A;  4OHJ A;  4PZ6 A;  4JI8 L;  2F0F A;  3C3L A;  1UEA B;  2I5L X;  1B8A A;  4N8X 1;  1DGS A;  2NN6 G;  1B7Y B;  1NNX A;  2K5V A;  4AYB E;  3ER0 A;  2B39 A;  1KXL A;  3J7A 5;  2WB1 E;  3E5S A;  1UE6 A;  1CI3 M;  5DEH A;  3UDF A;  5IP9 G;  2F0V A;  3DWP A;  3QB3 A;  2YU9 B;  1MIU A;  1WTO A;  1PHJ A;  4BY7 B;  1A63 A;  3FEW X;  4UP9 A;  1FGU A;  3T53 B;  3CC7 A;  3HOZ B;  5FLM H;  4RFB A;  4LF6 Q;  1N33 L;  1UE1 A;  3KJP A;  3BDC A;  3QWN A;  1CUK A;  1I5F A;  1HXY D;  4B3S L;  2PNR C;  4HN7 A;  1PZI D;  4A3E G;  1IHZ A;  4LUV A;  4K14 A;  3L9A X;  2B3G A;  4L5R C;  1Q3L A;  2DN8 A;  3TP6 A;  3DWA A;  3MXP A;  1G51 A;  4YWK A;  5IY0 A;  4DV0 Q;  3D6C A;  1EOT A;  1JOQ A;  2JE6 I;  1PV4 A;  2RF4 A;  3RZD B;  1SJE D;  1YBY A;  5M3F H;  4LFA L;  1SSO A;  1A62 A;  2BH2 A;  1IBK L;  1EQV A;  5GQO A;  2K03 A;  2RSN A;  3MXN A;  2M2L A;  3RN2 A;  1P16 A;  1V1P A;  5JJZ A;  4DR6 L;  3HRZ C;  3GO5 A;  4DV1 Q;  2XVS A;  2JA7 B;  3UDI A;  5I6Y A;  4QMG A;  5KYL A;  5JJL A;  1CT1 D;  4KN7 C;  2KBN A;  4A3B G;  1YHB A;  3QG1 A;  3D8G A;  4DR6 Q;  1EYC A;  2X6L A;  4XT3 B;  2CWP A;  3I55 A;  2R7Z B;  1PYB A;  1D5Z C;  3E0J A;  4DNR B;  4UPA A;  4A3L G;  1PRT C;  4C3H H;  4FO2 A;  4HCE A;  1CTM A;  4DK1 A;  1YJ9 A;  4K8I A;  4B3T L;  5K36 G;  4PZ7 A;  3HGB A;  2QA4 A;  1F2Y A;  1SE3 A;  2R7D A;  2WII B;  2F1M A;  2LFN A;  3I72 A;  1U0L A;  2NZH A;  3CRK C;  2K28 A;  1FGB D;  4IUQ A;  4NB3 A;  4H7B A;  3J80 E;  1HZA A;  2F0T A;  1K28 A;  1W3S A;  3GTG B;  1UWV A;  3OWE B;  5AFW A;  3GTM H;  1I4R A;  3N6R A;  4Y52 H;  1PVO A;  2QCP X;  4K2K A;  1TS4 A;  4IPC A;  2ZJP A;  3WWV A;  1PDQ A;  4DV1 L;  4NDX A;  1EY6 A;  1HFN A;  4DAP A;  3H0G G;  2N55 A;  1LM0 A;  1I4X A;  1V1O A;  1WTQ A;  4PQX A;  3GTL H;  1GVP A;  4PMC A;  1S5E D;  5CV4 A;  2EVB A;  4IPG A;  4JI1 L;  4KHZ A;  2R92 G;  2D5D A;  3D4R A;  3J80 i;  4QL5 A;  1KDB A;  1EYD A;  2OQ0 A;  4DR3 Q;  2R93 G;  4DUZ L;  4L6T B;  3SEB A;  3TSS A;  3DHQ A;  2NVX H;  4JI1 Q;  4R4C A;  1EFW A;  4IFD I;  2Z1C A;  4JBW A;  3M4Q A;  2EDG A;  1SNP A;  1TWH H;  1EY7 A;  3AQQ A;  2G9H D;  2Q8T A;  2NN6 H;  4BBS B;  3ERQ A;  2UXC Q;  2JA8 B;  4I7A A;  4TKO B;  1BR9 A;  1PRT D;  2JXM B;  2E76 C;  3UDG A;  1S3O A;  3TS2 A;  3HOX G;  1VQO A;  2XSC A;  3EQL C;  1X9N A;  4BA2 I;  1IL2 A;  2Z9H A;  3A8I E;  1SYG A;  1FNU A;  3PO3 G;  2IW3 A;  3RNU A;  4ID6 A;  3LNN A;  4C3J H;  1HA5 A;  1ONL A;  1EWH A;  1BUV T;  3KOJ A;  1PH5 A;  4K2L A;  1IXR A;  4MNO A;  4MZ9 A;  5JOB A;  3J81 i;  2JA6 G;  3MEH A;  4DV6 L;  1LTS D;  5IGB A;  4LK1 C;  1PZK D;  2NWG A;  3SK8 A;  1B9M A;  3A7A B;  3GTQ H;  1DON A;  1TWA H;  2KCN A;  2YTX A;  4GOP A;  1Y1V B;  4YWM A;  1F77 A;  3T1Y Q;  1PH8 A;  3JAM i;  1K73 C;  2ZXP A;  2EJF C;  3EN2 A;  2D0O A;  4HIO A;  2EY5 A;  5I2Y A;  1SE4 A;  2K05 A;  4RMF A;  5GAD C;  4QJF A;  3D6W A;  2A6H D;  2NBF A;  1G2S A;  1Q8K A;  4K8J A;  3PO3 B;  4OX9 L;  4BY1 G;  2ZJQ A;  1RDP D;  2A1A A;  4XYO A;  4JI0 L;  2DY8 A;  3F2B A;  2E2H B;  1J5E L;  4DV7 L;  2JEB I;  2RCF A;  3JAM c;  2JA7 H;  4UP8 A;  4HMI A;  2EYF A;  2LSS A;  1WCM B;  4LF8 L;  1TII D;  4LWC A;  2PQA B;  4DAY A;  3CF5 A;  1VQP A;  2VB2 X;  5FO7 B;  2IWH A;  1WYD A;  3CU7 A;  1E2W A;  3RLO A;  4CDD C;  4S3S A;  5J39 A;  2RDH A;  4DN4 M;  1IL8 A;  2CQO A;  1EQQ A;  2EXZ A;  5ELB A;  1OXX K;  4OO1 I;  3MA2 B;  3HOV H;  4LF8 Q;  1VCI A;  1XJV A;  5C44 B;  3HOX H;  5LMU Q;  2SNS A;  1JJ2 A;  4ME5 A;  2PO4 A;  3H6M A;  4A3K G;  1YJW A;  1Q8I A;  1CQF A;  1RF2 D;  4DV0 L;  2Q8R E;  4F8M A;  5JJK A;  3PO2 G;  3U9O A;  1HRJ A;  1L1O B;  1ZXT A;  4RCN A;  1WVL A;  3JAM L;  2F0S A;  3T4A C;  2EYL A;  1E1O A;  1RIP A;  4A3J H;  1WFQ A;  1BO0 A;  3DEP A;  2JSO A;  4TSS A;  5CR3 A;  2AMC B;  2JA6 H;  2A68 D;  3M7N A;  2JA5 H;  2I5M X;  1EWI A;  3J81 L;  3J80 L;  1KC8 C;  2XIW A;  5IYD H;  4O42 A;  4AYB G;  2B8G A;  4IUR A;  1EIF A;  4M8A A;  4GN5 A;  3ULP A;  1N36 L;  2XWB B;  2O5I C;  2K01 A;  2K4K A;  1F9S A;  4R9W A;  2R93 B;  3K5O A;  3FRP B;  3GTJ H;  3S1N H;  3GTK B;  3Q24 A;  3BYY B;  3CCU A;  2A5H A;  3G4S A;  1PH2 A;  3NPP A;  4BWG B;  3T56 B;  3CCL A;  3M3Y H;  1N32 L;  2B2W C;  3PIO A;  4YCV A;  1I6V C;  1A3V A;  4DR5 Q;  4F7X A;  1WTH A;  5M5Y H;  3ERO A;  3P75 A;  4ILW A;  1VMC A;  3E3X A;  3DUZ A;  3U4Z A;  1XWE A;  2K5D A;  3IKJ A;  5DNF A;  2HDM A;  4XQN A;  1TWC H;  1I4Q A;  1Q12 A;  3CPF A;  5CBA E;  3J80 c;  1B53 A;  2VW9 A;  2UUC L;  4HSV A;  1UE5 A;  4CJ1 B;  4I65 A;  3I4L A;  4IUU A;  2JA6 B;  3CCS A;  3M4Y A;  4ZUI A;  4ZLT F;  3R8B A;  3S1M H;  1SNQ A;  1XX8 A;  3H0G H;  3NBI A;  2KEE A;  4EQP A;  3FPU B;  1A8V A;  1JB3 A;  3RLN A;  2LMC B;  5CMD A;  2GA4 B;  2J4X A;  5LMN L;  1FNW A;  1GD7 A;  1TWF H;  4DK6 C;  1DOM A;  1HUN A;  1D1I A;  5EGT A;  3OTO Q;  4OL7 A;  1JE5 A;  4KKS A;  4A3E B;  2K1B A;  2J7Z A;  4JI3 Q;  4KJO A;  1PFS A;  4DFA A;  1EUJ A;  1SE2 A;  2PNH A;  1FR3 A;  1U4L A;  3A55 A;  3QR8 A;  3K81 C;  3UE1 A;  3NWT A;  2JYO A;  4JOI C;  3F8T A;  2PZW A;  2CH4 W;  4X65 Q;  1X3F A;  3NEN A;  4RHR A;  4JG2 A;  3K5L A;  1R4Q B;  4H02 A;  4RGM A;  3M4O H;  4KY6 A;  3CCE A;  4OO1 H;  1XMO L;  4NXM L;  1D8L A;  5D3D A;  1AP0 A;  1VQB A;  2A6E D;  3ONA B;  4A3G G;  2AKW B;  2RDF A;  3EIV A;  4JYA Q;  3HS0 C;  1LUZ A;  3K59 A;  3PO3 H;  4MHE A;  2AQ2 B;  2RCN A;  1CA6 A;  4AQY Q;  4A3I B;  3H3V C;  1KAW A;  1WJJ A;  1STY A;  1AH9 A;  4KMU C;  1G6P A;  2BCO A;  3NXW A;  1Z9F A;  1O7Y A;  1PA6 A;  1GOZ A;  5ELF A;  1BOS A;  2R61 A;  3SXH A;  2WFW A;  1MJC A;  3E6Z X;  4GNX B;  2PCF B;  3SK6 A;  3HOW H;  3A7L A;  1F2Z A;  4OON A;  1EWC A;  1NUC A;  2RVL A;  3S1R B;  3VYU A;  1NTG A;  2O2L D;  4ZK9 B;  1K83 H;  1X6O A;  4GN3 B;  4JOI A;  3F2U A;  4HJA A;  3L7Z C;  4H44 C;  1MJE A;  5ELN A;  1OO9 B;  4FF1 A;  4B3T Q;  3R2T A;  1U4P A;  2K52 A;  2B2V A;  4KV6 A;  1DXM A;  3QO2 A;  1LT3 D;  3A8K E;  2DUD A;  3D3R A;  2UXD L;  4F88 A;  2EE1 A;  3IAY A;  2CH4 A;  5C4X G;  1YJN A;  1LV9 A;  4ABN A;  4A3K H;  2VY3 A;  3PV0 A;  1XPR A;  1H9K A;  5JVH 3;  4DR4 Q;  4U67 3;  4XIG S;  2L5T A;  1R4P B;  2WAQ G;  1E0B A;  3RR5 A;  2ATW A;  3U9S A;  1MHW C;  2CW0 C;  3NHH A;  2F0O A;  1QIL A;  4X66 Q;  5IGF A;  4RGT A;  3MXU A;  3DM3 A;  4LAA A;  2OTJ A;  5C3X A;  5IIF A;  2ES2 A;  3K0X A;  4FP5 D;  4DV4 Q;  3BZK A;  4JPB W;  4OXP A;  2B2T C;  3IRB A;  4P72 A;  1VQJ A;  1TR5 A;  3G6J B;  3RMH A;  4DV5 Q;  5C44 G;  4LMQ D;  3LWE A;  1N34 Q;  2D0P A;  1EY5 A;  4H0L C;  2LKV A;  3NBH A;  2HD3 A;  2F3W A;  1XXG A;  4C3I H;  1PFN A;  5JPN C;  3BU2 A;  2B2Y C;  2EZV A;  3VYT A;  1I3Q H;  1RTO A;  4DXF A;  1BCP C;  1ENF A;  2OCE A;  4G7H C;  1DOL A;  3VR3 A;  1TS3 A;  1PH1 A;  1NE3 A;  2IPK D;  4DK3 C;  1Y8O B;  5M5X H;  2HHH L;  5GAG C;  1O78 A;  2L12 A;  1JWU D;  1PTO H;  1RHP A;  4K5W A;  1FL0 A;  2RKS A;  1XMQ L;  3K5N A;  3NK9 A;  1WOC A;  1G6Z A;  1UE7 A;  4A3G B;  1NJI C;  2B29 A;  1M90 C;  3S1Q B;  3W1G A;  4DR2 L;  1OXT A;  2L11 A;  3CHB D; 
#chains in the Genus database with same CATH homology
 1SYC A;  3PIP 3;  1K83 B;  3PMF A;  5J22 A;  5C4J B;  4BA1 I;  5EKK A;  3PIO 3;  3GTO B;  3HOW B;  1L0X B;  2PZU A;  2EJM A;  3OOC A;  2FMC A;  3BDO A;  4KY5 A;  2Z8L A;  1CK1 A;  1SYD A;  1KNE A;  1AZP A;  1JIC A;  2K5W A;  5JEA J;  2XNA C;  1Q1E A;  1U4M A;  5FKA C;  2ICI A;  2KQ3 A;  2XRS D;  3KUP A;  3BVM A;  5D14 A;  1VMP A;  1T5E A;  3V2T A;  2H4O A;  2FJ2 A;  4HCS A;  1TS5 A;  2EYO A;  5CV6 A;  2Z4H A;  3KK7 A;  2A69 D;  4RKB A;  3KF8 A;  3K0Y A;  3TP8 A;  5EBD A;  1GUO A;  2XRQ D;  1FD7 D;  3LWU A;  1U9R A;  1EEI D;  3H94 A;  4C1N I;  2NVQ B;  1TWF B;  1LTG D;  2EJG C;  5C5M A;  3GD7 A;  3QOL A;  3NP8 A;  4L63 B;  3FMC A;  5CV5 A;  2MPM A;  3WOF A;  2Z4I A;  3X3N A;  1AW7 A;  1F2M A;  3SR1 A;  4Y7N B;  3S9W A;  3KLS A;  1KDC A;  2EYJ A;  5E1F A;  2AQ1 B;  2H1E A;  2BE5 D;  4ZKB B;  5I2X A;  2B2V C;  3HKZ B;  4FNF A;  4C1N K;  1UNS A;  2TSS A;  5M3M B;  4HTH A;  3S1N B;  4JK1 C;  3Q6S A;  3KLR A;  4QUC A;  5C4X B;  1OXU A;  4BBR B;  2F0P A;  5IT9 L;  2PMZ B;  5FOB B;  5I9O A;  2OF1 A;  1Y8N B;  3MFG A;  1ML0 D;  4X3K A;  1J9O A;  1JOK A;  1ZYR D;  2BDO A;  3EVQ A;  4YIJ A;  5C6A A;  3BVG A;  3TZD A;  1SMY C;  1SYB A;  5JEA H;  1S4Z A;  3I8Z A;  1ZYR C;  3TME A;  5KEE A;  2VUM B;  1D5X C;  3UI2 A;  1QJO A;  3AB9 A;  2VB3 X;  3FDT A;  3HOX B;  2CHB D;  1H9R A;  3A56 A;  1B9N A;  2K6A A;  4C3H G;  1EQT A;  5A35 A;  3GTP B;  1X32 A;  5C5L A;  4OIJ A;  2FIN B;  3HOU B;  4XDX A;  3S14 B;  1D1K A;  2MJ8 A;  1RKN A;  1HA6 A;  4FF2 A;  2SOB A;  4FF3 A;  1QCB D;  5I9P A;  4X3U A;  2MUY A;  5COY A;  1TWC B;  3K6O A;  4C2M B;  2VXW A;  1U4R A;  1EZ8 A;  5EKL A;  3S2H B;  1LT5 D;  4IUV A;  1WD1 A;  3Q22 A;  1KAA A;  2F0K A;  2R6G A;  2QIL A;  3GTQ B;  2A74 C;  4J6H A;  1D5M C;  2ID0 A;  2RBM A;  5EPJ A;  4PV1 C;  3ITP A;  3NQI A;  4XYQ A;  5IGC A;  3SVM A;  1NCV A;  3VR6 A;  2E2I B;  1JOO A;  2FMM A;  3S15 B;  2WAC A;  2A6E C;  5FO8 B;  4A3J B;  2IX0 A;  1STA A;  1JR0 D;  1PTO F;  2F0G A;  2AQ3 B;  5KNC A;  3JAM E;  1G29 1;  1JWS D;  4HR7 B;  1EY0 A;  2CVR A;  1SBB B;  3J7A V;  4WFN 3;  1HFG A;  1SYF A;  2KHS A;  2C9O A;  3OIP A;  2NVX B;  4C3J G;  1HUM A;  3Q0A A;  1D6E C;  1B4O A;  2IX1 A;  1LT6 D;  3MVV A;  1LLR D;  2F3V A;  1VF7 A;  1EL0 A;  5IGD A;  5C0X H;  1II3 A;  2F0W A;  1BCP F;  3BVZ A;  3I70 A;  5DM6 3;  1GUS A;  3NSW A;  2LS0 1;  1JQY D;  2K33 A;  1G8Z D;  4HMJ A;  1Y69 U;  2C5C A;  2CQA A;  2R3Z A;  5FK9 C;  4DU9 A;  1QG7 A;  1PRT B;  3MAQ A;  2ENB A;  3GQB A;  4ZUJ A;  4RGO S;  5HGT A;  3NTK A;  4BS9 A;  1LTB D;  1EU4 A;  1TT2 A;  1SJH D;  4IFD J;  3FKI B;  5LL6 S;  4OO1 G;  4K6L A;  5ISR A;  4KKU A;  2TMP A;  2F0J A;  3EA6 A;  1PYW D;  4KI0 A;  3VR4 A;  5M9O A;  1EYA A;  5D3I B;  2WB1 B;  1TKW B;  2HUG A;  2L4N A;  4CHT B;  2DNE A;  1QNK A;  2ZT9 C;  1F9Q A;  2KOL A;  1HTL D;  4IZ8 A;  1RD9 D;  5CYU A;  3EFX D;  1KDA A;  4EQO A;  4DAV A;  5JVG 3;  2JEA I;  1CZG A;  2IX3 A;  1Z47 A;  1ET9 A;  3WOE A;  2EPB A;  2KCC A;  2F4I A;  1GUN A;  1AZQ A;  4KKT A;  2SNM A;  4KN4 C;  1G2T A;  4RA8 A;  1ILQ A;  2F03 A;  1DM0 B;  4RCO A;  1HTP A;  3I91 A;  1CHP D;  1DZ1 A;  1V8Q A;  5LHY 1;  1STB A;  1OXV A;  3GTL B;  1TVX A;  3I4N B;  1ESF A;  1I4G A;  1SDF A;  4F87 A;  1UUP A;  4OGQ C;  5CV8 A;  2X6G A;  1GHK A;  3I3C A;  3PUW A;  3NQT A;  1SYE A;  1PFB A;  2B2Y A;  1FNV A;  1CA5 A;  2B2U A;  4RAU C;  3A54 A;  3MTS A;  2KVM A;  2KED A;  2F0I A;  1QB5 D;  4IQZ A;  5C0X J;  4GZY C;  1C48 A;  1CQV A;  2AWO A;  1KAB A;  3D31 A;  4UAI A;  3IFD A;  2I07 B;  4C56 C;  3I73 A;  1EEF D;  3GTJ B;  3NTI A;  2QKI C;  1ENC A;  5EBC A;  3O13 A;  3I4M B;  1A3U A;  5KYI A;  1PTO D;  4FXD A;  2G9D A;  2NZ1 D;  2F0N A;  2QEJ C;  1QOH A;  2F0H A;  3FPP A;  2X69 A;  4TQU S;  1R9T B;  5CC4 A;  1QNU A;  3BS1 A;  3NE5 B;  4PNY A;  5KIX A;  3OWF A;  1EY9 A;  1ILP A;  3MFY A;  1BDO A;  2PZT A;  2NB0 A;  4A3F B;  3H91 A;  2CW0 D;  4XTC S;  3R3O A;  3R93 A;  1TU2 B;  5KRU A;  1XYI A;  1WTR A;  1QWY A;  4P2C B;  3RLF A;  1HHV A;  2NYZ D;  3BZD B;  4RWS C;  1XTC D;  5DM7 3;  3IL8 A;  4UDU C;  5LL6 X;  5BN4 A;  3D4W A;  4CKB A;  4ZRZ A;  1IW7 C;  1F9P A;  3H0G B;  2NTT A;  3NWS A;  1CM9 A;  3V05 A;  1CHQ D;  1RJT A;  4QF4 A;  3H09 A;  5EQ0 A;  4RGN A;  5NUC A;  4G57 A;  3P20 A;  1RCV D;  2EYP A;  1Y1W B;  1DD2 A;  1Q1B A;  2HCI A;  1GUG A;  4FXG C;  2SEB D;  1PMR A;  3J81 E;  2RSO A;  1G91 A;  4PMB A;  1MD2 D;  3M3Y B;  3OPO A;  3PUY A;  1YNJ C;  4KTA A;  5DAU A;  3KLS X;  3VA7 A;  5CV7 A;  2HCC A;  3ND9 A;  1EY8 A;  2M9V A;  3DMU A;  1STG A;  4C3J B;  1SNM A;  1CFM A;  1GUT A;  5K36 H;  2Q8I B;  4HSP A;  4K5V A;  4G7Z C;  5I4D A;  4G4K A;  1JOR A;  1PTO B;  2A6H C;  4A3B B;  2XWJ B;  1LTT D;  1B50 A;  5M5X B;  1H9S A;  2E2J B;  1NR2 A;  4WJW A;  4FXK C;  5E4W C;  3VA5 A;  3TN2 A;  1I3Q B;  3ND8 A;  3QOJ A;  2HQE A;  4V0B A;  1TQO A;  4C3I B;  2J0T D;  5G3L D;  2D62 A;  3NUC A;  3P1H A;  2KA7 A;  1ZKO A;  1LAB A;  1X3P A;  2D2C C;  5I6W A;  5F2D A;  4IAL A;  4DGZ A;  2BDN A;  5C4Z A;  1JWM D;  5C4H A;  2AWN A;  1PFM A;  5BN5 A;  1LTR D;  2K32 A;  5EJW A;  1RTN A;  1W6J A;  2MHV A;  4XQQ A;  5JEA G;  1JE4 A;  3L3O C;  4ZKC B;  3GP7 A;  4A3K B;  5C0X I;  1MSG A;  4A3D B;  3GTM B;  1AFP A;  2V4D A;  5KNB A;  4K6D A;  1L0Y B;  2EOT A;  4CBV A;  5M5W B;  2IT1 A;  3MXG A;  1TWA B;  2BOS A;  2M00 A;  3K5M A;  3G7L A;  1STN A;  3PUZ A;  4Q0F A;  1SNO A;  4E6I A;  3DM1 A;  4Q5V A;  5JAV A;  1S5B D;  2WIN B;  1K8O A;  5EPL A;  3I90 A;  2K04 A;  5CGK A;  4R8N A;  3SDZ A;  3PUV A;  2O4X A;  2A69 C;  2DY7 A;  1MI2 A;  4EGV A;  2I46 A;  1S5D D;  5KND A;  2OT2 A;  2PQE A;  5ELC A;  2VNU D;  2IL8 A;  1ZEQ X;  4IUN A;  3M4O B;  1PTO C;  4QUF A;  1V43 A;  3OMG A;  1LTI D;  1B3A A;  4HAE A;  5EPK A;  3DEO A;  5FLX E;  1ESR A;  4KD4 A;  5A2Q E;  5BN3 A;  2B2W A;  2E74 C;  1PRT F;  3K58 A;  2NN6 I;  3BDL A;  1IYU A;  2AUJ D;  3KBX A;  4EQN A;  1KNA A;  3HG9 A;  1LAC A;  1I50 B;  2OXP A;  5CV9 A;  3HEJ A;  5IT9 E;  3CQZ B;  3K7A B;  1S5F D;  1EIG A;  1BCP B;  1EY4 A;  3OW7 A;  1YNN D;  1BBX C;  1MSH A;  3DXJ C;  3SK5 A;  3BG3 A;  2FFK B;  2WKD A;  1BF4 A;  5T1G A;  3QIA A;  1WTW A;  1H9M A;  3MHB A;  1GJX A;  4DK0 A;  4NMZ A;  3TP7 A;  3TZU A;  2MGS A;  4XXE A;  1LT4 D;  4BY1 B;  2F0L A;  1MBY A;  1TS2 A;  1IKL A;  2F0M A;  2KJX A;  3VYS A;  3AMU A;  1SNC A;  2JA5 B;  4KHV A;  4IN3 A;  1PZJ D;  5J1Z A;  3ZYY X;  2KUM A;  3OSO A;  1KTK A;  2L0C A;  1ROD A;  2L9H A;  1A15 A;  4G7O C;  1ENA A;  2EY2 A;  1GHJ A;  1D2B A;  1HQR D;  1F2L A;  1X3Q A;  4RKL A;  1YNN C;  2QF7 A;  5M3F B;  3HZX A;  3MZ5 A;  2NUC A;  2PW7 A;  4ODG A;  1Q90 A;  5E3F A;  1JC7 A;  2E2D C;  2HDL A;  1Y8P B;  3BYT B;  5ELE A;  4J1M A;  2EY6 A;  4A3M B;  3TDQ A;  2ICE C;  4FF4 A;  2EY1 A;  1TWG B;  4RH6 A;  1ET6 A;  2NTS A;  2EYM A;  4CJ2 C;  1PXU A;  4NW2 A;  4RHS A;  1I4P A;  2LY7 A;  1H9S B;  1FYC A;  4A93 B;  4WRD A;  2F0Q A;  3MC0 B;  3C1E A;  1BNZ A;  5HUR A;  5K5P A;  1ICW A;  4N9T A;  3C1F A;  2YYZ A;  5TSS A;  3MWY W;  1EU3 A;  3S2D B;  1B2T A;  4QCL A;  3PUX A;  3S16 B;  1M4V A;  5C3W A;  4ULL A;  1H9J A;  1GUW A;  1KLU D;  2O5J C;  1IKM A;  2WKC A;  5E4X A;  2BA0 A;  1E2V A;  2BA1 A;  1LTA D;  3RUZ A;  3CKI B;  2R92 B;  4PMW A;  3C2P A;  4M1U B;  1B44 D;  1AN8 A;  3J7A F;  1NSN S;  1TWH B;  3WDN A;  1LO5 D;  3Q23 A;  4V19 0;  4IUT A;  3HOV B;  5C3E B;  4MN3 A;  3K57 A;  1SFO B;  2Y0S B;  1SXT A;  1O7L A;  5G3L F;  1CZW A;  1VF5 C;  3D4D A;  1WD0 A;  4CKE A;  3T13 A;  4KD3 A;  4DA2 A;  3GV3 A;  2K5Q A;  1E2Z A;  2WAQ B;  4CKC A;  1SND A;  1J8I A;  3IFT A;  3PO2 B;  1AEX A;  1BQQ T;  1JCK B;  3RD4 A;  2FHT A;  3NTH A;  3LX0 A;  4C3I G;  4TRD A;  4KJN A;  3M85 A;  1WTX A;  2D9U A;  3N52 A;  4I7Z C;  2ZXR A;  2NVT B;  2NVY B;  1WTV A;  1TY2 A;  4AYB B;  4XQJ A;  3AU7 A;  1DYQ A;  4IFD G;  4LJZ C;  4HED A;  4EVO A;  1W6K A;  4XT1 B;  1B1Z A;  5IOD A;  1DOK A;  1QE6 A;  4C3H B;  5A2Q L;  1IW7 D;  1KLG D;  2DNC A;  3C46 A;  1Z6H A;  1V1P B;  4X3S A;  1I6H B;  1O80 A;  2WP8 J;  3OHX C;  4B08 A;  1EFI D;  1STH A;  2F0E A;  1SMY D;  1SAP A;  1A6X A;  4NKL A;  1STE A;  1A2T A;  3QJY A;  3W3A A;  5KGU A;  5C0X G;  4OIK A;  2IJ0 A;  2RQX A;  3KBG A;  2F0U A;  1C8C A;  3SK4 A;  4Z9C B;  2B2T A;  2PYK A;  2K7V A;  4B9W A;  1A2U A;  3T16 A;  4B9X A;  2B2U C;  2F0D A;  1I4H A;  4WOR A;  4KY7 A;  1HPC A;  1VDZ A;  3RZO B;  2ZXO A;  1DJR D;  5ELD A;  5IOC A;  2WV6 D;  4DNT B;  2BE5 C;  3HOY B;  3SE0 A;  3VYR A;  2QDB A;  5D65 A;  1Z7T A;  4QIW B;  2PW5 A;  3J7Y W;  4R8I A;  4FYD A;  2B63 B;  1A3T A;  1EZ6 A;  4ZQ3 A;  3HP3 A;  5COR A;  3DWQ A;  1WTP A;  2SDF A;  2AUK A;  2L55 A;  3P7J A;  4N9P A;  4X3T A;  4DXG A;  4U68 A;  3VR5 A;  1M8A A;  4QB4 A;  4NP5 A;  1S5C D;  2OEO A;  1MGS A;  1F9R A;  1SEB D;  2A68 C;  1YNJ D;  2A73 B;  2MP1 A;  3EJI A;  3S17 B;  3TP5 A;  4ZAI A;  5T1I A;  3CRL C;  4KK7 A;  2JP1 A;  3X3M A;  5EKI A;  5FO9 B;  3V96 A;  2E75 C;  4IUP A;  4K5X A;  1EIH A;  4L8J A;  3M7G A;  5JPM C;  1K8M A;  3FVQ A;  1NR4 A;  3TBI B;  3OMC A;  4CJ0 B;  2PPB C;  1IYV A;  3OIQ A;  4H13 C;  3R2I A;  4DF7 A;  4FVM A;  2N88 A;  1OXS C;  3T51 B;  1HQM C;  4J8Q A;  4MIU A;  1C4Q A;  5IGE A;  1O7Z A;  1PLF A;  1BCP D;  3SHL A;  4IFD H;  5IGG A;  1GXD C;  2RDG A;  4CGY B;  5FLX L;  1UAP A;  2EYH A;  2KEC A;  4ZYS A;  1T5X D;  3A8J E;  2RA4 A;  1TY0 A;  3S1M B;  1DCZ A;  5CBE E;  2L1B A;  4O1N A;  2B8F A;  1BXT A;  3VR2 A;  3URY A;  2XN9 C;  1NAP A;  5M5Y B;  3W2D A;  3GV6 A;  1HCZ A;  4OHJ A;  2F0F A;  3C3L A;  1UEA B;  2NN6 G;  2B39 A;  3E5S A;  1CI3 M;  5DEH A;  2F0V A;  3DWP A;  3QB3 A;  2YU9 B;  1WTO A;  4BY7 B;  3FEW X;  3T53 B;  3HOZ B;  4RFB A;  3BDC A;  3QWN A;  1HXY D;  2PNR C;  4HN7 A;  1PZI D;  1IHZ A;  4K14 A;  3L9A X;  1Q3L A;  2DN8 A;  3TP6 A;  3DWA A;  3MXP A;  3D6C A;  1EOT A;  1JOQ A;  2JE6 I;  3RZD B;  1SJE D;  1SSO A;  1EQV A;  2K03 A;  2RSN A;  3MXN A;  2M2L A;  1V1P A;  5JJZ A;  3HRZ C;  3GO5 A;  2XVS A;  2JA7 B;  5I6Y A;  4QMG A;  5KYL A;  1CT1 D;  4KN7 C;  3QG1 A;  3D8G A;  1EYC A;  2X6L A;  4XT3 B;  2R7Z B;  1D5Z C;  3E0J A;  4DNR B;  1PRT C;  4FO2 A;  4HCE A;  1CTM A;  4DK1 A;  4K8I A;  5K36 G;  3HGB A;  1F2Y A;  1SE3 A;  2WII B;  2F1M A;  2LFN A;  3I72 A;  3CRK C;  2K28 A;  1FGB D;  4IUQ A;  4H7B A;  3J80 E;  2F0T A;  3GTG B;  3OWE B;  5AFW A;  1I4R A;  3N6R A;  2QCP X;  4K2K A;  1TS4 A;  1PDQ A;  4NDX A;  1EY6 A;  1HFN A;  4DAP A;  2N55 A;  1V1O A;  1I4X A;  1WTQ A;  4PQX A;  4PMC A;  1S5E D;  5CV4 A;  2EVB A;  4KHZ A;  2D5D A;  3D4R A;  1KDB A;  1EYD A;  4L6T B;  3SEB A;  3TSS A;  3DHQ A;  4IFD I;  2Z1C A;  4JBW A;  2EDG A;  1SNP A;  1EY7 A;  2G9H D;  2Q8T A;  2NN6 H;  4BBS B;  3ERQ A;  2JA8 B;  4TKO B;  1BR9 A;  1PRT D;  2JXM B;  2E76 C;  2XSC A;  3EQL C;  4BA2 I;  3A8I E;  1SYG A;  1FNU A;  2IW3 A;  4ID6 A;  3LNN A;  1HA5 A;  1ONL A;  1EWH A;  1BUV T;  4K2L A;  5JOB A;  3MEH A;  1LTS D;  5IGB A;  4LK1 C;  1PZK D;  2NWG A;  3SK8 A;  1B9M A;  3A7A B;  1DON A;  2KCN A;  1Y1V B;  1F77 A;  2ZXP A;  2EJF C;  2EY5 A;  5I2Y A;  1SE4 A;  2K05 A;  3D6W A;  2A6H D;  2NBF A;  1G2S A;  4K8J A;  3PO3 B;  1RDP D;  4XYO A;  2DY8 A;  2E2H B;  2JEB I;  2EYF A;  4HMI A;  1WCM B;  1TII D;  4DAY A;  2VB2 X;  5FO7 B;  2IWH A;  3CU7 A;  1E2W A;  5J39 A;  4S3S A;  2RDH A;  4DN4 M;  1IL8 A;  2EXZ A;  5ELB A;  1OXX K;  4OO1 I;  3MA2 B;  1VCI A;  5C44 B;  2SNS A;  4ME5 A;  2PO4 A;  3H6M A;  1Q8I A;  1CQF A;  1RF2 D;  2Q8R E;  4F8M A;  3U9O A;  1HRJ A;  1ZXT A;  4RCN A;  1WVL A;  3JAM L;  2F0S A;  3T4A C;  2EYL A;  1BO0 A;  3DEP A;  2JSO A;  4TSS A;  5CR3 A;  2A68 D;  3M7N A;  3J81 L;  3J80 L;  2XIW A;  4O42 A;  2B8G A;  4IUR A;  4M8A A;  2XWB B;  2O5I C;  2K01 A;  1F9S A;  4R9W A;  2R93 B;  3K5O A;  3FRP B;  3GTK B;  3Q24 A;  3BYY B;  2A5H A;  3NPP A;  4BWG B;  3T56 B;  2B2W C;  1I6V C;  1A3V A;  4F7X A;  3ERO A;  3P75 A;  4ILW A;  1VMC A;  3DUZ A;  1XWE A;  2K5D A;  3IKJ A;  5DNF A;  2HDM A;  4XQN A;  1I4Q A;  1Q12 A;  5CBA E;  1B53 A;  4HSV A;  4CJ1 B;  4I65 A;  3I4L A;  4IUU A;  2JA6 B;  3M4Y A;  4ZUI A;  4ZLT F;  3R8B A;  1SNQ A;  1XX8 A;  3NBI A;  2KEE A;  4EQP A;  3FPU B;  1JB3 A;  2LMC B;  5CMD A;  2GA4 B;  2J4X A;  1FNW A;  1DOM A;  1HUN A;  1D1I A;  5EGT A;  4OL7 A;  4KKS A;  4A3E B;  2K1B A;  2J7Z A;  4KJO A;  4DFA A;  1SE2 A;  1FR3 A;  1U4L A;  3A55 A;  3NWT A;  2JYO A;  2PZW A;  4RHR A;  3K5L A;  1R4Q B;  4RGM A;  4KY6 A;  4OO1 H;  5D3D A;  1AP0 A;  2A6E D;  3ONA B;  2RDF A;  3HS0 C;  3K59 A;  4MHE A;  2AQ2 B;  1CA6 A;  4A3I B;  3H3V C;  1STY A;  4KMU C;  2BCO A;  3NXW A;  1O7Y A;  1GOZ A;  5ELF A;  1BOS A;  2R61 A;  3SXH A;  3E6Z X;  2PCF B;  3SK6 A;  3A7L A;  1F2Z A;  1EWC A;  1NUC A;  2RVL A;  3S1R B;  3VYU A;  2O2L D;  4ZK9 B;  3F2U A;  3L7Z C;  4H44 C;  1OO9 B;  4FF1 A;  3R2T A;  1U4P A;  2B2V A;  4KV6 A;  1DXM A;  3QO2 A;  1LT3 D;  3A8K E;  3D3R A;  4F88 A;  2EE1 A;  3IAY A;  1LV9 A;  4ABN A;  3PV0 A;  1H9K A;  5JVH 3;  4U67 3;  4XIG S;  2L5T A;  1R4P B;  1E0B A;  3U9S A;  2CW0 C;  3NHH A;  2F0O A;  1QIL A;  5IGF A;  4RGT A;  3MXU A;  4LAA A;  5C3X A;  5IIF A;  4FP5 D;  2B2T C;  1TR5 A;  3G6J B;  3RMH A;  4LMQ D;  3LWE A;  1EY5 A;  4H0L C;  2LKV A;  3NBH A;  2F3W A;  1XXG A;  5JPN C;  1PFN A;  2EZV A;  2B2Y C;  3VYT A;  1RTO A;  4DXF A;  1BCP C;  1ENF A;  4G7H C;  1DOL A;  3VR3 A;  1TS3 A;  2IPK D;  1Y8O B;  1O78 A;  2L12 A;  1JWU D;  1PTO H;  1RHP A;  4K5W A;  2RKS A;  3K5N A;  3NK9 A;  1G6Z A;  4A3G B;  3S1Q B;  1OXT A;  2L11 A;  3CHB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...