2NN6H

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
269
structure length
250
Chain Sequence
HLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transferase
molecule keywords Polymyositis/scleroderma autoantigen 1
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 250
sequence length 269
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nn6H01
3U9SA 5K36G 3ND8A 4I7ZC 3OW7A 4KKTA 1BDOA 5C0XH 1YNJC 5JEAG 2DNCA 1EWHA 2EJMA 1HPCA 4G7ZC 3T53B 1E2ZA 1K8OA 1E2VA 2NN6H 4LJZC 3ND9A 1H9KA 1ZYRC 2KCCA 2B8GA 2A69C 2O5JC 4H0LC 4JK1C 2AUJD 4OGQC 5KNBA 3M4YA 1HQMC 5K36H 2B8FA 3EQLC 3GD7A 5JEAH 2A69D 1GUSA 1O7LA 3MXUA 3WDNA 2JEAI 1O78A 2D5DA 1GHKA 2D2CC 4PV1C 2LMCB 3MFYA 2IT1A 4OO1G 1H9JA 4DK1A 4L8JA 1GJXA 1LABA 2BDOA 3DXJC 2EJGC 1DCZA 3AB9A 3PV0A 3PUWA 3FPPA 1Q1EA 1Z6HA 4DNRB 1IW7C 1QJOA 2PCFB 4TKOB 3A7LA 1DD2A 2JXMB 4DK0A 1OXVA 4LK1C 4OO1H 1OXUA 3TZUA 4BA1I 2A68D 1OXXK 1TU2B 2V4DA 1IW7D 3IKJA 3HGBA 1Y8OB 3A8JE 2K7VA 3IFTA 3GQBA 5BN3A 3VA7A 4BA2I 3QG1A 1CTMA 3T56B 3H94A 1G291 1Q1BA 2D62A 2K33A 3PUZA 4TQUS 3RLFA 2R6GA 5BN4A 2E74C 2KA7A 3T51B 4DNTB 3SE0A 1LACA 4JBWA 3A7AB 4G7HC 1PMRA 1B9NA 2A6HC 2BE5C 2NN6I 3I4LA 4RCNA 1GUGA 3CRKC 3PUYA 4H13C 1FR3A 1ONLA 2CW0C 3QJYA 4IFDG 3D31A 3M85A 2E75C 3W3AA 4XTCS 2JE6I 2EDGA 4IQZA 2PPBC 1CFMA 1H9MA 1Q12A 2A68C 1SMYC 2A6HD 1VDZA 2BE5D 3VR6A 3KLRA 1OXSC 4KKUA 3VR5A 3A8KE 1CI3M 3VR4A 4KKSA 2BA1A 1T5EA 1GUTA 4IFDH 2L5TA 3CRLC 1ZKOA 3P20A 4H44C 3VR2A 2DN8A 1GUNA 5KNDA 1A6XA 3I72A 1Y8NB 1VF5C 1E2WA 3VR3A 2YYZA 1OXTA 2O5IC 2A6ED 3A8IE 3I73A 3N6RA 1DXMA 1K8MA 3FMCA 1IYUA 3OOCA 4KMUC 2E76C 3QIAA 3PUXA 1VCIA 3LWUA 1HTPA 2JEBI 1IYVA 2EJFC 3NE5B 2Q8IB 2AUKA 4GZYC 1GHJA 2ZT9C 2AWOA 1Y69U 4HR7B 2PNRC 4KHZA 1V8QA 1H9SA 1FYCA 3D4RA 1Z7TA 2K32A 1TKWB 2BA0A 4KN4C 1H9RA 2A6EC 5BN5A 1V43A 4KI0A 2QF7A 3PUVA 1GUOA 2F1MA 5C0XG 3LNNA 1Y8PB 1H9SB 2DNEA 4G7OC 1B9MA 2NN6G 5A35A 4KN7C 1I6VC 3M7NA 3L7ZC 5KNCA 3OPOA 3SDZA 1HCZA 1VF7A 3BG3A 1Q90A 4XIGS 2EVBA 3BDOA 1YNNC
chains in the Genus database with same CATH superfamily
3ERQA 1PA6A 1HFNA 3DHQA 4LUVA 1HPCA 4LUOA 4JG2A 4K14A 1E2ZA 3S15B 4FYDA 1CK1A 3I4NG 3L3OC 1KD1C 4H0LC 3KUPA 3VYUA 3PO3B 1SN8A 4X65L 3J80c 3KLWA 2R7DA 3P1HA 3I4NH 2YTYA 3I91A 2LMCB 1ENFA 1SYDA 5KRUA 1DOLA 4A3EB 4FNFA 1PHJA 1DCZA 4QF4A 2JJQA 4R4IA 3J80i 5CGKA 3J7A5 2GVBA 1D5MC 4A3JG 1OXVA 1OXUA 1U0LA 4JI5L 4LF7L 4LF9L 2EXDA 2HDMA 5DM63 3AQQA 4RGTA 4DV0Q 2K75A 2NBFA 1EEID 1CUKA 1G291 1IZ6A 2L9HA 5M3FG 1PH7A 4JI3Q 5CR3A 2F0KA 2E74C 4A3JH 4JI7L 1VQJA 1FL0A 5IT9E 1PH1A 4G7HC 4O0AA 3K0YA 5JJZA 4QJFA 4RA8A 3P7JA 3VA5A 2F0GA 5M3FH 1EY5A 4GS3A 3RMHA 1XNRL 1D6EC 1KRSA 3VR5A 1DONA 4R4TA 4BBSB 5M5WB 1WD0A 4RH6A 4R4QA 4OHJA 1GUNA 3L2PA 2KENA 2ZJRA 3NQTA 3CHBD 1B7YB 1SNPA 1DXMA 2F0JA 2I5LX 4QB4A 1RCVD 5ISRA 4GKKL 2PW7A 2EYOA 1MJEA 1IYVA 3K5MA 1Q8KA 2ZM6Q 4GZYC 2PNRC 4GOPA 2FMMA 1II3A 3F2DA 1RD9D 2F0TA 1LTRD 2X6LA 3J7ZC 4DUYQ 3A54A 3A74A 4RAUC 3JAMi 1XMOL 3AFPA 4F88A 4BY7B 2NB0A 1U4PA 3SDZA 4XQNA 2VQFL 3PO3G 2KHSA 1AW7A 1I4XA 4LFAL 1X3GA 1F2ZA 3FP9A 1ENAA 1EWHA 3HP3A 5I2XA 3CCMA 3S15H 2EYJA 4P2CB 3VYRA 1VQPA 3K57A 3CCVA 2JQOA 4A3EG 3PO3H 1K3RA 2ZTDA 2G5DA 1CKNB 3BJUA 1K0SA 2PQEA 3V05A 1UE1A 3L0OA 3MXUA 1VQLA 1EIGA 5JOBA 1I3QB 4M8AA 4A4IA 4F7XA 5GAHC 4A3EH 1SYBA 1HA6A 2F0OA 1Q1EA 5CV4A 2VQEQ 4QIWE 3LGJA 1Y1WB 1WTOA 3J7YW 3MFGA 2A68D 1OXXK 3NHHA 4GLXA 3KF6A 5GQOA 5EJWA 1KHIA 5FKAC 4JYAQ 5D65A 5E3FA 2JA6B 1IL8A 4X62L 3T51B 3M7GA 1EUJA 2A6HC 2EZVA 4JI4Q 4IQZA 3GTOB 5CV9A 4CJ0B 2J7ZA 3J7AV 3J80L 1XWEA 5M5WH 4O42A 2BDNA 1MBYA 2DN8A 1D7QA 5E4WC 4Y52H 1JOOA 3AMUA 3LWEA 3U9OA 4IPGA 4PZ6A 2DJFC 3D0FA 4IJLA 5AFWA 1CZGA 4JI2L 1E22A 2KUMA 3I55A 3D4RA 1CT1D 1HR0W 1MD2D 1EYCA 3HKZB 2IJ0A 4BY7G 2K5DA 1MKHA 2OTLA 3FDTA 1BXTA 4KY7A 2CFMA 4FF1A 1DZ1A 4HIMA 1WTHA 3MWYW 3C3LA 2OF1A 4BY7H 2R92B 5CV7A 4R8NA 1HXYD 3X3MA 3CAMA 1KTKA 2PI2A 1E24A 5M3MB 4EX5A 1ZYRC 4ZRZA 5DLQE 2XNAC 1VMCA 3BZKA 1A3UA 1MJCA 1PTOF 2KECA 3GDEA 5J3BA 3WOFA 4F87A 4HN7A 1Y1WG 2PNHA 4DR4Q 1I3QH 3ULJA 5GAGC 2O2LD 1HNXL 4GN4B 3KBGA 3Q23A 5CYUA 1I94Q 1B50A 4DR7Q 3TSSA 3CCUA 1IW7C 1KXLA 2JA6G 1FGUA 1PYWD 1Y1WH 3KF8B 5T1IA 3IAYA 3F2CA 1JC7A 1XPUA 4O2DA 2D9UA 2IY5B 2PQAB 2FXQA 1NY4A 2NZ1D 4GNXB 3PGZA 2JA6H 4JBMA 3M9BA 2MPMA 5FJ8G 5NUCA 1LT5D 4MIUA 1YJWA 1AZPA 1X32A 3GTOH 2K5VA 4KTAA 1KRTA 2J0TD 5CC4A 2DY8A 3J81E 1B3AA 4YWMA 4C3JB 4KJOA 4Y7NB 5FJ8H 4FDBA 2XIWA 2LS01 1IKMA 4J6HA 3IFDA 1SE4A 5C4XB 2UXBQ 1JOKA 1KLGD 3FMCA 2NZHA 3AU7A 3E9HA 5EQ0A 5FLMG 4PNYA 2WAQB 2F0FA 1PH4A 1CSPA 1Y14B 1JQYD 2EYLA 4LUZA 3MAQA 3SVMA 2A5HA 2Z9HA 4B08A 5FLXE 4ZKCB 1YNND 2M2LA 2R92G 3MVVA 2B2VC 5FLMH 2B29A 5IOCA 4DR1L 2ZXOA 3P75A 1V1OA 5GADC 2EPBA 2QF7A 1BOSA 1X56A 3PUVA 4DV4Q 5M3MG 1H9SB 5DEHA 2LSSA 1WTXA 1KDCA 2NN6G 2R92H 3PSIA 5KYIA 3HKSA 1HNZQ 3RZOB 1LYLA 2EVBA 4DFAA 2JSOA 5L37A 5M3MH 1SBBB 3CC7A 1PZJD 1BQQT 3T53B 1PRTF 2NN6H 3ND9A 2KOLA 1YHQA 1QB5D 3NP8A 2MQHA 1B2TA 1TS3A 4R1JA 1QILA 4HTHA 4AYBB 3EQLC 3PIO3 1EFWA 1K8AC 3KYHC 1KABA 4DKAC 3FVQA 1SAPA 2D2CC 2PZWA 2NVQB 3H91A 5BR8Q 1EU4A 1GJXA 2WV6D 1VQ7A 4QUFA 4L5TA 4J15A 4EGVA 3S1QB 4CJ1B 3CCSA 4AYBE 4BWGB 4A75A 2RCFA 2CW0D 5FOBB 2Q2UA 3M4OB 5CORA 2FMCA 2VZAA 4OX9L 1RKNA 1D1KA 3NPPA 4IUNA 4DAPA 1JWUD 4U68A 3CKIB 3BVMA 4XQJA 1L1OB 2K4KA 4KV6A 4C3JG 1EEFD 1VQ4A 1B44D 4JBWA 4DV7Q 1GKHA 1N33L 1Q46A 4AQYQ 1ONLA 3K80C 3QJYA 5I4DA 1WTRA 1HR0Q 1EYGA 1OTCA 5C4XG 4XTCS 4OXPA 2L15A 2A6HD 4LF4L 4C3JH 3JC66 2OQ0A 2WAQG 3A55A 4KKSA 4LFBQ 2UU9Q 3IL8A 5C4XH 2AQ1B 4RG1A 4TSSA 1Y8NB 4NXNQ 1HHVA 3DEOA 1UNSA 1IYUA 1WFQA 1JCKB 1LT6D 4WJWA 1CQFA 1C8CA 2ZTCA 1V1QA 5CBEE 2WB1E 2ZT9C 1XTDA 1EY7A 2WACA 1IBLQ 1V8QA 2Q2TA 1B4OA 1VQHA 4FP5D 4ZUIA 2F3WA 2BA0A 5HGTA 3QOLA 4G57A 5K5PA 2ZTEA 4PZ7A 4A93G 2B2WC 1GD7A 1STEA 3R2TA 1I6VC 2MUYA 5EBDA 4DV6L 3RZOH 3MXPA 2XWBB 4G7ZC 5IGDA 2UUBQ 2AMCB 4AYBG 4N8FA 2QEJC 1A3VA 3S1RB 1VQ5A 4A93H 4DV3L 3Q22A 1WJJA 3HEJA 4KD4A 1D2BA 1H9KA 4YWKA 4LW1A 4CJ2C 1JT8A 3H09A 5DM73 4X64L 3KDFB 2SNSA 1CHQD 2QKIC 1AE2A 4ZCKA 1TWAB 5C4JB 1X3FA 3EIVA 3NBIA 1GUSA 1O78A 4L5QA 4LF5L 4GKJL 3W5OA 2NVQH 4MN3A 3K0XA 4A3KB 4DR6Q 2KCTA 3TP7A 4LFCL 3AYHB 2RVLA 4NXML 3S1QH 1K0RA 1LTTD 2R7ZB 2LFNA 3FPPA 1OO9B 4FF3A 2K6AA 1VQDA 4RCOA 5G3LF 4QY7A 3ZYYX 2N55A 3M4OH 2IX3A 4B3RQ 1IW7D 3IFTA 3MC0B 3S2HB 3BDLA 3SXHA 3C1EA 3T1HL 4KJNA 4R8IA 1GOZA 1EZ8A 1MSHA 3A7AB 1CHPD 4APVA 1HZAA 1Q82C 3CCLA 3W3AA 1C48A 2PPBC 2A68C 1TS2A 4HEDA 2BOSA 3RD4A 4HJ7A 1SE8A 4RKBA 2B2VA 3KLSA 3D3RA 4B3SL 4K6DA 2IL8A 2G9HD 2L1BA 3E6ZX 5FO7B 1NBWA 5HY6A 3VR2A 1A6XA 1XPOA 4DV2L 2CCZA 5IGGA 1I5FA 3N6RA 3CPFA 3OYYA 3PUXA 4RKLA 3KBXA 1J8IA 1MHWC 1X55A 2E2DC 1ILPA 2LKVA 4KHZA 3ER0A 1STHA 1S5FD 1J9OA 5EPKA 1PXUA 4DV1L 1H9RA 3H3VI 1JR0D 4IUQA 1LTGD 2B2YC 2ENBA 4F8MA 2F1MA 1B70B 5KYLA 1R4QB 4G7OC 3D6WA 5IWAQ 3Q6SA 3GTQB 4DR2L 2AQ3B 4XIGS 2ZXPA 3DM1A 3C1FA 1S72A 3ND8A 4K2KA 1CKNA 3S1RH 2DNCA 1N36L 1K83B 3S1MB 3KJPA 4BS9A 5TSSA 4A3KG 1BVSA 2A69C 1S3OA 5E1FA 4HJAA 2L12A 5C4JH 1TWAH 3Q24A 1VQGA 1QUQB 1SXTA 4R9WA 4ZYSA 2R7ZG 2VW9A 3NUCA 1FJGL 3KK7A 3CP0A 3WDNA 1HNWL 4A3KH 4X65Q 3K8AA 1PFBA 5A2QL 4DGZA 5C3EB 4TRDA 3PV0A 2F52A 2R7ZH 3PUWA 1XXGA 2F0DA 1EY9A 2L4NA 3EN2A 3UDXA 2EOTA 3S14B 3L9AX 3GV6A 1U5KA 3HRZC 2VS1A 3BZDB 1QCBD 2UXDL 2EY2A 1U4RA 1Y8OB 3A8JE 3UDIA 1PH9A 4IPCA 3S2HH 4JI5Q 1G51A 4LF7Q 4LF9Q 1JICA 2C9OA 1VQEA 4PG3A 2ALYB 4ODGA 1XNQL 1LV9A 1X3PA 2Z1CA 4JI6L 5HURA 2BE5C 2WKDA 4JI7Q 3NBHB 1QE6A 5JAVA 1C7YA 4WRDA 2JE6I 1H9MA 3S1NB 2CH4A 2HDLA 1O7YA 1TIID 1L1OC 4IUTA 1JOQA 1WTQA 2JA5B 1XMQL 1XNRQ 5JJIA 3Q0AA 4NMZA 1BR9A 1I50B 3DWAA 1G2SA 2B2WA 2OQKA 3UE0A 3J81j 3F2UA 1N32L 2Y0SE 4C2MB 4HMJA 2QEXA 4DAMA 1QOHA 1J5EL 2DGYA 3ULPA 1IHZA 1STBA 4JCVE 3OMGA 4GKKQ 1SNDA 1U9RA 1UE6A 4NDXA 3S16B 1B3QA 4UAIA 3G71A 3DWPA 2ES2A 1LT4D 4KHPQ 1BKBA 1SRUA 2WP8J 4QCLA 2BCOA 2Z4IA 1LT3D 3W2DA 1I4HA 2KHIA 2ZJPA 1B9MA 2ATWA 2RKSA 3GTQH 3RNUA 4KN7C 1VQMA 2CWAA 3ULLA 4DK6C 2BH8A 3MA2B 1Q90A 3TDQA 1XMOQ 1JB3A 1HFGA 1YNNC 1K28A 3D4WA 4G4KA 3BS1A 4CHTB 1G6PA 1HZ9A 2ICIA 1K83H 3S1MH 2QCPX 1E3PA 4HSPA 1IYJB 4LFAQ 5C3EG 1EFID 2YU9B 2O5JC 4ZUJA 3M3YB 3GD7A 3TRZA 4RWSC 4KY6A 3GTMB 2R7FA 1CM9A 3SGIA 4R4CA 2NVXB 3KF8A 5ELNA 5ELOA 4P71A 4JI8L 3T13A 4CKCA 5C3EH 4OO1G 5D3DA 2EY1A 1X6OA 2CH4W 2IWHA 2N3SA 3KFUA 4LF6L 1VQIA 1QJOA 2PQAA 2JA7B 2QA4A 4GNXA 1ILQA 3H6MA 3S14H 3M4PA 1HUNA 4OO1H 1BF4A 4POGA 1TU2B 2K28A 4PMBA 4RMFA 2K7VA 1PTOB 5ELDA 3OSOA 4QIWB 2ZM6L 2Y0SG 2KA7A 4DF7A 4DNTB 2VB2X 2ICEC 2N8NA 4ZK9B 4CDCC 4X62Q 3I2ZA 1GUGA 4H13C 4ULLA 2EYPA 4GN5A 2CW0C 2JA5G 2UXCL 2E75C 4ZAIA 3NWTA 3PMFA 3S1NH 5JPNC 4C1NI 5IP9G 1EIHA 3K6OA 3JAME 3KLRA 1N8RC 2EQSA 2F0MA 1O7IA 3GO5A 4YIJA 2A73B 2JA5H 3DEPA 2B63B 2B2YA 5CV5A 3V96A 5KNDA 1SSOA 3CCJA 1UUPA 3I72A 5LMUL 2AHOB 1E2WA 1I50H 5IP9H 4RHSA 1LTLA 1HH2P 4C2MH 2HQLA 2RCNA 2VUMB 5IGEA 3HS0C 3G6JB 4FO2A 2NVYB 3NK9A 5KGUA 2EJFC 1N9WA 2GA4B 4JV5L 1VMPA 1HZBA 1WYDA 3OWFA 3MXNB 2B3GA 1XPRA 1H9SA 3S16H 3G7LA 5IT9L 2K32A 5I6WA 1Q3LA 1DOMA 2MGSA 4JI2Q 1DM0B 1RHPA 2Z0SA 2QILA 1SYFA 1PZKD 1FNWA 5D3IB 1TQOA 4DR5L 3VYTA 2AQ2B 4LWCA 5KNCA 1EL0A 4K6LA 2F4VQ 3Q8DA 5LMNW 1YNJC 1SR3A 5F2DA 2OXPA 2YU9H 1VS0A 3QB3A 5LL6S 1Y1VB 3K7AB 4POFA 3M3YH 4OGQC 1PH5A 1HQMC 4JI0L 3FRPB 1F9PA 5IYBG 2A69D 2JA7G 2WFWA 3GTMH 1WCMB 1MGSA 2NVXH 4PV1C 1KAAA 4UDUC 1HUMA 4LMQD 1NUCA 2K1BA 1PRTB 5IYBH 1HNXQ 4NW2A 5GAEC 2JA7H 3PO2B 3S17B 4HCSA 3ICEA 1I4GA 1L1OA 2XWJB 4IUVA 1PTOH 5J22A 4WFN3 2Q2HA 4L63B 2X69A 5BN4A 3GTGB 5C0XI 5FK9C 3I4MB 2MP1A 5G3LD 2HIVA 5ELBA 1A62A 2XTIA 1PMRA 3F8TA 1CQVA 2K52A 3SK8A 2B63G 4IFDG 2WKCA 4YCUA 1TWFB 1KIXA 2EDGA 4ZQ3A 1Q12A 5C3WA 2BE5D 3VR6A 1A2UA 2PW5A 2VUMG 2HCCA 3AEVA 4HIDA 5M5YB 2B63H 4LF8L 4L5RC 1T5EA 1GUTA 4IFDH 4ME3A 1NJIC 2SOBA 2YYZA 5C3XA 3I73A 1ZEQX 3BDCA 4YHHL 4KMUC 2VUMH 1QZHA 1EY6A 2KHJA 2NVYH 3MHBA 3SK4A 2JEBI 2F0PA 2Z6BA 5CV8A 2AUKA 1PFMA 1KAWA 2Z4HA 5EKLA 1Z7TA 4P72A 2K5QA 4DK3C 3HOVG 3U58A 3G4SA 1T5XD 4YY3L 5KEEA 2EYMA 5AJ3L 1LTBD 1QVCA 4DR1Q 3W1GA 4IURA 1YNXA 3HOUB 4MZ9A 3HZXA 3PIPA 2JA8B 2V1CC 1E7ZA 1Y1VG 3KDFA 1O80A 4KKTA 1FNUA 1UWVA 5COYA 2AKWB 4BBRB 1WCMG 1STGA 2KCCA 1NR2A 2B8GA 3A5ZB 1Y1VH 3K7AH 2XSCA 3TZDA 3HG9A 3CQZB 1E1OA 1IBML 3PO2G 1EY4A 2BH2A 1WCMH 2K50A 3A0JA 4KY5A 4WJ3M 2NTTA 4TVAB 4IOCA 1QZGA 5LHY1 1UE5A 1YVCA 4J1MA 5C4ZA 2UUAL 3PO2H 4IO9A 1D5XC 3S17H 2RHSB 4QUCA 3A7LA 4MHEA 4A93B 4JC0A 4B3TL 3I4MG 2UXBL 3CMAA 1I4RA 3TMEA 3CMEA 3E0EA 4IFDJ 1ESRA 4DV5L 2RQXA 4OX9Q 3T56B 4C3HG 3NQIA 1EU3A 3GTGH 4QMGA 3I4MH 4Q0FA 3K5NA 1EWCA 5EPJA 3SE0A 2PZTA 1V1PA 1PH3A 3R8BA 2FINB 4NPSA 1TWFH 4DXGA 3MEFA 2HHHL 1PTOC 1AEXA 1YHAA 2PO4A 1N33Q 1QG7A 2K03A 2KBNA 5LL6X 1OXSC 1ENCA 3CCQA 4KKUA 1PH8A 1E1TA 5M5YH 2EXZA 4X3KA 4LF4Q 1NMFA 4XXEA 1SNQA 1EYAA 4L6TB 3VR3A 5JVH3 1F9QA 3STBC 2QDLA 4OWTB 2F0SA 5LMNQ 1K3BC 2K05A 4DR3L 4MNOA 1WTWA 4V190 3FHWA 2E2HB 3HOUG 4OEMB 2XRQD 3NEMA 3NELA 2JA8G 4GLVB 5IYDG 4JI1L 1P8LA 2I07B 5ELEA 3LNNA 2WB1B 3HOUH 2SDFA 1AFPA 4BBRG 1MSGA 4PMCA 1YHBA 2IHEA 4K5VA 3BVGA 2JA8H 3L7ZC 4FF4A 3CPWA 2PI2E 1YEZA 4LNQA 1I6HB 3U9SA 4PMWA 3I8ZA 3LX0A 1GVPA 1QUQA 4BBRH 1X65A 5J39A 1K8OA 4IJHA 4LJZC 1EQQA 1TS4A 4XYQA 1ASZA 4K8IA 1YNJD 3CQZH 2B2UC 2HD3A 1BO0A 3HOXB 4X64Q 2NZOA 1PYBA 2E8GA 2MFIA 2SEBD 4AQYL 1W2BA 3HOWB 1KL9A 1K8GA 3G48A 2HQEA 3TN2A 1LABA 2K01A 4GKJQ 3BYYB 2MO0A 3A56A 4XDXA 4NXMQ 2WINB 1HQRD 2HCIA 3GTJB 2E2JB 2J4XA 2IHFA 1IXRA 4DUZL 3O13A 1JORA 5CMDA 3GQBA 3R2IA 5IGCA 2KQ3A 3NBHA 2MNAA 1A3TA 1PRTC 2D62A 2K33A 1BCPB 3DM3A 2F4IA 3T1HQ 1L2FA 1IBLL 2ZJQA 2RA4A 1YJNA 3CW2C 1FVIA 3M85A 3SR1A 1M1KC 4WORA 1T9HA 3A8KE 1CI3M 5T1GA 4B3ML 1N34Q 1TR5A 5ELFA 1YZ6A 3T1YL 4B3SQ 1ICFB 4UY8C 2B39A 3CU7A 1GXDC 4IPHA 4YWLA 1LUZA 1W6JA 2RF4A 2E76C 2OCEA 1Q8IA 4DV2Q 4C3IB 5IIFA 3I70A 4X3TA 3HOZB 1G6ZA 3NE5B 2Q8IB 4DA2A 2E2HH 2WB1G 1JJCB 4K5WA 2RDGA 2A8VA 4HIKA 4PZ8A 3TP8A 3DUZA 3SEBA 3AFQA 4GNXC 1MIUA 2HIXA 2OWOA 1V1PB 5I2YA 2CVRA 2EIFA 2K14A 2L55A 3PCOB 3URYA 1GUOA 2YTVA 4MTNA 4QGUA 3MTSA 2PMZE 4DV1Q 1SYEA 3SK5A 1BUVT 2Q2IA 4OELB 4A3GB 1CSQA 1I6HH 3BDOA 4DR2Q 3EA6A 3HOXG 4IN3A 4X6AH 5ELCA 1WTPA 3ERSX 3UDGA 2I5HA 4N8X1 2FJ2A 2RDHA 3HOWG 1EIFA 2XVSA 4JK1C 1N36Q 2HUGA 2ID0A 1STAA 3CC4A 4EQOA 3HOXH 3GTKB 1PFNA 5IP7G 1YIJA 2UUCL 3RLNA 1LTAD 5JPMC 3X3NA 3HOWH 1YJ9A 2N78A 1QVGA 1FJGQ 3BU2A 3TQYA 4K0KL 1TVXA 1HNWQ 1XX8A 1DYQA 1LTID 1JWMD 5IP7H 4ID6A 3FPUB 4AIMA 4EQ5A 1UE7A 3GTJH 5I6YA 1RODA 2I5MX 4OWXB 2E2JH 2V4DA 4ALPA 3HGBA 1HZCA 1L0XB 1BNZA 5DAUA 1WI5A 1DOKA 3FKIB 3QG1A 4OWWB 3OIQA 2UXDQ 3H94A 4OL7A 3NTKA 5IE8A 1EOTA 3I90A 3OTOL 2F3IA 3GTPB 5HGQA 1LM0A 2CQAA 4JBKA 4A3LG 1XNQQ 5I9OA 1BCPF 2O4XA 1PLFA 4JI6Q 1NCVA 2RHQB 3QO2A 3S24A 4X66L 2KEDA 4UP7A 2DJGC 4C3IG 2Q8TA 4A3LH 1PTOD 4DPGA 3VR4A 1L0YB 3HOZG 1B1ZA 4CDFC 5IT9c 2A6ED 1WOCA 1XMQQ 3OOCA 3MXNA 4RGNA 1DGSA 3QIAA 4C3IH 5EAYA 1VCIA 3KOJA 3EVQA 4H7BA 1HTPA 1KDAA 3PF4A 3HOZH 1N32Q 1W6KA 3K58A 3STBD 1IBKL 1J5EQ 1PZID 1EY8A 1VQCA 2Y0SB 4R4OA 1R9TB 4A3GG 1SYCA 1W3SA 2B2UA 1TWHB 3I4OA 2YV5A 4K8JA 3V2TA 1SMXA 4CGYB 5J1ZA 4RHRA 1Y8PB 4DU9A 4FF2A 3CXCA 4ME5A 2E5LL 2IX1A 4B9WA 5A35A 4N9TA 4J8QA 2A19A 1NMGA 3F2BA 3RN5A 4A3GH 1PFSA 5K36G 5M9OA 1BDOA 2IPKD 5EPLA 2EJMA 3K81C 2IX0A 1SE3A 5C5MA 3CF5A 4U673 5I9PA 1JB7A 1TWGB 5KNBA 4HMIA 5K36H 3GTKH 2VB3X 1LLRD 3CD6A 3BYTB 1TXYA 3RUZA 2KVMA 3J80E 4UPAA 4A3BB 3DWQA 1H9JA 4M1UB 1VQ6A 1C4QA 3AB9A 3FKIG 1QNKA 1JE5A 4JI8Q 1Z6HA 3I56A 4FXKC 4C1NK 2VQFQ 4DK0A 4DV0L 4LF6Q 2JN4A 4BA1I 4JI3L 4C56C 1WD1A 3FKIH 2A74C 1HA5A 1I4PA 3PUZA 1ICWA 4TQUS 3NWSA 3RLFA 3W1BA 3H3VH 3GTPH 3QR8A 2NUCA 2LXKA 4I7AA 1PRTD 2M00A 3PUYA 4NB3A 3D31A 3JAMc 1A8VA 3TS2A 4KHPL 1EZ6A 1CZWA 4DN4M 2UXCQ 4AH6A 1E0BA 2D0OA 1BCPC 3E5SA 2BA1A 1EY0A 1IKLA 1JE4A 3P20A 1UEBA 2MO1A 1SROA 1K8MA 1G8ZD 2CQOA 5LMUQ 1DJRD 3K7UC 3LWUA 1RL2A 3E9IA 5IODA 4BXXG 1LTSD 1HJPA 4JPBW 5C5LA 3I7FA 4IFDI 1STNA 1RTNA 2L11A 3WOEA 4DXFA 5KIXA 4JV5Q 2GVAA 3OHXC 4A3DB 1R9TH 1CKOA 4DUYL 4A3CG 2F03A 4BXXH 1TWHH 3GP7A 5BN5A 4KI0A 1Q7YC 1EYDA 2KCNA 3UI2A 3MXGA 1RJTA 1JWSD 4IUPA 1ESFA 4CKEA 3D6CA 2RSNA 4A3CH 3I3CA 2LY7A 1AE3A 3BG3A 4YCVA 4DAYB 1VQ8A 4DR5Q 3PIP3 1X3EA 3OW7A 4HAEA 4XT1B 4GN3B 1RTOA 1ML0D 1RIPA 4A3BG 1I4QA 2EE1A 1TWGH 2KCMA 2AUJD 3NXWA 3M4YA 4H02A 1K9MC 2CKZB 2B2TC 5GROA 3CCEA 4FVMA 2D5DA 4HSVA 4JI0Q 4A3BH 4BBSG 5EKKA 2VQEL 4DK1A 4L8JA 2BDOA 2EJGC 3HOVB 4KHVA 1M8AA 4A3IB 1X3QA 2AWNA 1F2YA 4DNRB 1Q86C 2TSSA 2PCFB 5DNFA 2KEEA 1DD2A 4BBSH 3NSWA 4A3FB 1ZXTA 3TZUA 3QWNA 1CA5A 4JYAL 1KLUD 1ASYA 4FXGC 2JA9A 3TBIB 3VA7A 2VNUD 4BA2I 1CTMA 1NAPA 1EQTA 5C44B 1KNAA 3S9WA 4JI4L 1Z47A 1SJHD 4KD3A 4O1NA 1F77A 2NN6I 4RCNA 2I46A 3CRKC 1X9NA 1TY0A 2F0UA 5IY0A 2FHTA 3S2DB 4HIOA 2TMPA 1VDZA 4A3MB 1AP0A 1NR4A 1CA6A 3H3VC 4RGOS 1S40A 1JMCA 1ZKOA 1HRJA 2HT1A 1EQRA 1O7ZA 1VF5C 4OIJA 1PV4A 1SYGA 4LF8Q 2F4VL 1F2LA 3HKZE 4A3DG 3EJIA 2RSOA 4IUUA 3U4VA 2QW7A 5C4HA 1A2TA 4RFBA 4YHHQ 4CBVA 2GN5A 3OMCA 1Y69U 2AWOA 3OIPA 4HR7B 3TEHB 3UDFA 3J81c 4C3HB 2YTXA 1PH6A 4NP5A 4IZ8A 3OW2A 4A3DH 1WTVA 1SNMA 1S5BD 4WJ4A 1MI2A 4KN4C 1V43A 1TWCB 2K5WA 4GOPB 2OTJA 1UEAB 2OT2A 3JAML 4YY3Q 3J81i 5AJ3Q 1HCZA 1YBYA 2F0EA 3KLSX 1NNXA 4CDDC 2VL6A 5FLXc 5EGTA 4QL5A 2Z6KC 1U4MA 4NKLA 2R93B 3H15A 3J7AF 3E0JA 4UP9A 3EFXD 3RR5A 3HOYB 2H1EA 4A3IG 4DR4L 2MHVA 1L0WA 2VXWA 4JOIC 2F3VA 1G91A 1GHKA 3D8GA 4A3FG 3MFYA 1I94L 2K04A 4RGMA 2EYHA 1IBMQ 4DR7L 4UP8A 3HOVH 2EY6A 4A3IH 1BBUA 3D4DA 4XYOA 4OIKA 2Z8LA 1G2TA 5C44G 2R61A 2JXMB 4A3FH 4LK1C 5H1SE 1RDPD 1UAPA 2UUAQ 3UE1A 3RZDB 4IPDA 2KJXA 2QGQA 5JJKA 3B6YA 1YITA 4B3TQ 2ZXRA 4YCWA 2PZUA 5C44H 1Q1BA 3G6EA 3HKZG 2F0NA 1C0AA 4KLKA 4A3MG 4DV5Q 1PDQA 3KF6B 1P16A 4GLAC 4UHVA 3S2DH 4LAAA 1CFMA 3SHLA 1SMYC 4A3MH 3FEWX 2HHHQ 2WAQE 1CKMA 1RF2D 2XRSD 5EBCA 3CRLC 4XQQA 1JJGA 4DNIA 2NVTB 3RLOA 1BCPD 4ABNA 1Q81C 5EKIA 3N52A 1SFOB 4V0BA 1HTLD 4JVZA 1S5ED 3PQIA 5CV6A 1XTCD 5D14A 4PQXA 1C9OA 4C3HH 2XGTA 4DR3Q 1FYCA 1VQAA 3K59A 2JP1A 4DV4L 3ONAB 2R3ZA 3K5OA 1SJED 2A6EC 1TWCH 1QWYA 4BY1B 4EQPA 5C0XG 2B2TA 3MEHA 1HNZL 1NSNS 4JI1Q 2DNEA 3TREA 1B53A 2R93G 1VQKA 3M7NA 4P75A 3HOYG 2RDFA 3GTLB 4I7ZC 1S4ZA 5C0XH 5JEAG 4I65A 5FO8B 2JYOA 2R93H 4Q5VA 3BVZA 3HOYH 1F9RA 4B9XA 1QVFA 3T4AC 5BR8L 1GO3E 5JEAH 1VQOA 1O7LA 2PYKA 1S5CD 5JJLA 2L0CA 3K5LA 1EWIA 3J81L 2IT1A 2A1AA 1XJVA 1A63A 2RBMA 5IYDH 3BZCA 1BBXC 1NE3A 1U4LA 3EBEA 3TS0A 4DV6Q 4K2LA 1D8LA 3IRBA 2DUDA 4Y7NH 1V9PA 1F2MA 1WVLA 1X54A 3QOJA 1SNCA 3RZDH 1PH2A 2NWGA 4P73A 4DV3Q 2QDBA 5BN3A 3F1ZA 3PF5A 1ET9A 4IALA 5LMNL 4DV7L 4DUZQ 5FLXL 1FNVA 1J6QA 2R6GA 2EYFA 1R4PB 4OONA 4EVOA 3ITPA 1HR0L 1LACA 1PVOA 2F0HA 1IL2A 1KDBA 2FFKB 4LF5Q 5JVG3 1SNOA 4A76A 4JBJA 1SLJA 2MJ8A 4LFCQ 5M5XB 2F0VA 4LFBL 2UU9L 1AZQA 3VYSA 2NTSA 2P5ZX 4NXNL 1JJ2A 4HJ8A 2F0QA 2IW3A 4H44C 3R93A 4IOAA 2NVTH 1D1IA 1B8AA 4B3MQ 2CHBD 3R3OA 3A8IE 2X6GA 2K5HA 4CKBA 3T1YQ 4P74A 4E6IA 4JW0A 1SFOH 2I0QA 2F0IA 2CWPA 4BY1G 1QNUA 4HJ5A 2Z6KA 5C0XJ 4DAVA 2DY7A 3MZ5A 1GUWA 4EQNA 3H0GB 5A2QE 2G9DA 3SK6A 3WWVA 3KJOA 4BY1H 1ZYRD 1XYIA 2D0PA 2M9VA 4JOIA 3T16A 5JEAJ 1PYSB 1VQ9A 2UUBL 1S5DD 2E2IB 2WIIB 4L5SA 1D5ZC 1VF7A 3GTLH 2ASBA 1STYA 2C35B 1FGBD 4GOPC 3NENA 2PMZB 4CDEC 1VQNA 1E2VA 4X3SA 5E4XA 2H5XA 4XT3B 2SNMA 1KC8C 3PIOA 1BBWA 1H95A 2B8FA 4DR6L 1FD7D 3EROA 4KK7A 2JEAI 4X3UA 1SEBD 1EQVA 3I4NB 1TT2A 5CBAE 2UUCQ 3DXJC 3CCRA 1ET6A 5E7NA 4ZKBB 1KQSA 4B3RL 1Z9FA 4K0KQ 1AN8A 1N34L 4TKOB 5IGBA 3NTHA 4QQBX 3IKJA 4MTKA 2F0LA 2NYZD 3VDYA 4FXDA 4Z9CB 5FO9B 4ZLTF 4S3SA 3U50C 4A3JB 1VQBA 1KNEA 3NTIA 1B9NA 3OWEB 3I4LA 1SDFA 1NTGA 1FR3A 3OTOQ 1GM5A 5M5XH 5M3FB 1TS5A 3DLLA 2F0WA 3GV3A 1SE2A 2XN9C 5IYCG 4N9PA 1TY2A 1EOVA 2N49A 3ZJYC 4HJ9A 1SMYD 2VY3A 1M90C 2N88A 2L5TA 4X66Q 1F9SA 3E3XA 4K5XA 1VQFA 3TP6A 1M4VA 2O5IC 1OXTA 2C5CA 1AH9A 3TP5A 3C2PA 5IYCH 3H0GG 3CC2A 4OO1I 3DMUA 1GHJA 1YI2A 2LXJA 1A15A 2OEOA 4HCEA 2EY5A 2JK8A 1IBKQ 3RN2A 2H4OA 3H0GH 1TKWB 3M4QA 1LO5D 5IGFA 3A5UA 5IWAL 2K5NA 3U4ZA 4DAYA 2Q8RE 1K73C 1A0IA 3HFZB 3C46A 1EIYB 2E2IH 4ILWA 3OPOA 2E5LQ 5C6AA
chains in the Genus database with same CATH topology
3ERQA 1HFNA 3DHQA 1HPCA 3S15B 4K14A 1E2ZA 4FYDA 1CK1A 3L3OC 4H0LC 3KUPA 3VYUA 3PO3B 3P1HA 3I91A 2LMCB 1ENFA 1SYDA 5KRUA 1DOLA 4A3EB 4FNFA 1DCZA 4QF4A 5CGKA 1D5MC 1OXVA 1OXUA 2HDMA 5DM63 4RGTA 2NBFA 1EEID 2L9HA 1G291 5CR3A 2F0KA 2E74C 5IT9E 4G7HC 3K0YA 5JJZA 4RA8A 3P7JA 3VA5A 2F0GA 1EY5A 3RMHA 1D6EC 3VR5A 1DONA 4BBSB 5M5WB 1WD0A 4RH6A 4OHJA 1GUNA 3NQTA 3CHBD 1SNPA 1DXMA 2F0JA 4QB4A 1RCVD 5ISRA 2PW7A 2EYOA 1IYVA 3K5MA 4GZYC 2PNRC 2FMMA 1II3A 1RD9D 2F0TA 1LTRD 2X6LA 3A54A 4RAUC 4F88A 4BY7B 2NB0A 1U4PA 3SDZA 4XQNA 2KHSA 1AW7A 1I4XA 5I2XA 1F2ZA 3HP3A 1ENAA 1EWHA 2EYJA 4P2CB 3VYRA 3K57A 2PQEA 3V05A 3MXUA 1EIGA 5JOBA 1I3QB 4M8AA 4F7XA 1SYBA 1HA6A 2F0OA 1Q1EA 5CV4A 1Y1WB 1WTOA 3J7YW 3MFGA 2A68D 1OXXK 3NHHA 5EJWA 5FKAC 5D65A 5E3FA 2JA6B 1IL8A 3T51B 3M7GA 2A6HC 2EZVA 4IQZA 3GTOB 5CV9A 4CJ0B 2J7ZA 3J7AV 3J80L 1XWEA 4O42A 2BDNA 1MBYA 2DN8A 5E4WC 1JOOA 3AMUA 3LWEA 3U9OA 5AFWA 1CZGA 2KUMA 3D4RA 1CT1D 1MD2D 1EYCA 3HKZB 2IJ0A 2K5DA 3FDTA 1BXTA 4KY7A 4FF1A 1DZ1A 3MWYW 3C3LA 2OF1A 2R92B 5CV7A 4R8NA 1HXYD 3X3MA 1KTKA 5M3MB 1ZYRC 4ZRZA 2XNAC 1VMCA 1A3UA 2KECA 1PTOF 3WOFA 4F87A 4HN7A 2O2LD 3KBGA 3Q23A 5CYUA 1B50A 3TSSA 1IW7C 1PYWD 5T1IA 3IAYA 1JC7A 2D9UA 2NZ1D 2MPMA 5NUCA 1LT5D 4MIUA 1AZPA 1X32A 4KTAA 2J0TD 5CC4A 2DY8A 3J81E 1B3AA 4C3JB 4Y7NB 4KJOA 2XIWA 2LS01 1IKMA 4J6HA 3IFDA 1SE4A 5C4XB 1JOKA 1KLGD 3FMCA 3AU7A 5EQ0A 4PNYA 2WAQB 2F0FA 1JQYD 2EYLA 3MAQA 3SVMA 2A5HA 4ZKCB 4B08A 5FLXE 1YNND 2M2LA 3MVVA 2B2VC 5IOCA 2ZXOA 3P75A 1V1OA 2EPBA 2QF7A 1BOSA 3PUVA 1H9SB 5DEHA 1WTXA 1KDCA 2NN6G 5KYIA 3RZOB 2EVBA 4DFAA 2JSOA 1SBBB 1PZJD 1BQQT 3T53B 1PRTF 2NN6H 3ND9A 2KOLA 1QB5D 3NP8A 1B2TA 1TS3A 1QILA 4HTHA 4AYBB 3EQLC 3PIO3 1KABA 1SAPA 2PZWA 2D2CC 3FVQA 2NVQB 3H91A 1EU4A 1GJXA 2WV6D 4QUFA 4EGVA 3S1QB 4CJ1B 4BWGB 2CW0D 5FOBB 3M4OB 5CORA 2FMCA 1RKNA 1D1KA 3NPPA 4IUNA 4DAPA 1JWUD 4U68A 3CKIB 3BVMA 4XQJA 4KV6A 4C3JG 1EEFD 1B44D 4JBWA 1ONLA 3QJYA 5I4DA 1WTRA 4XTCS 2A6HD 3A55A 4KKSA 3IL8A 2AQ1B 4TSSA 1Y8NB 1HHVA 3DEOA 1UNSA 1IYUA 1JCKB 1LT6D 4WJWA 1CQFA 1C8CA 5CBEE 2ZT9C 1EY7A 2WACA 1V8QA 1B4OA 4FP5D 4ZUIA 2F3WA 2BA0A 5HGTA 3QOLA 4G57A 5K5PA 2B2WC 1STEA 3R2TA 1I6VC 2MUYA 5EBDA 3MXPA 2XWBB 4G7ZC 5IGDA 2QEJC 1A3VA 3S1RB 3Q22A 3HEJA 4KD4A 1D2BA 1H9KA 4CJ2C 3H09A 5DM73 2SNSA 1CHQD 2QKIC 5C4JB 1TWAB 3NBIA 1GUSA 1O78A 4MN3A 4A3KB 3TP7A 2RVLA 1LTTD 2R7ZB 2LFNA 3FPPA 1OO9B 4FF3A 2K6AA 4RCOA 5G3LF 3ZYYX 2N55A 2IX3A 1IW7D 3IFTA 3MC0B 3S2HB 3BDLA 3SXHA 3C1EA 4KJNA 4R8IA 1GOZA 1EZ8A 1MSHA 3A7AB 1CHPD 3W3AA 1C48A 2PPBC 2A68C 1TS2A 4HEDA 2BOSA 3RD4A 4RKBA 2B2VA 3KLSA 3D3RA 4K6DA 2IL8A 2G9HD 2L1BA 3E6ZX 5FO7B 3VR2A 1A6XA 5IGGA 3N6RA 3PUXA 4RKLA 3KBXA 1J8IA 2E2DC 1ILPA 2LKVA 4KHZA 1STHA 1S5FD 1J9OA 5EPKA 1PXUA 1H9RA 1JR0D 4IUQA 1LTGD 2B2YC 2ENBA 4F8MA 2F1MA 5KYLA 1R4QB 4G7OC 3D6WA 3Q6SA 3GTQB 2AQ3B 4XIGS 2ZXPA 3DM1A 3C1FA 3ND8A 4K2KA 2DNCA 1K83B 3S1MB 4BS9A 5TSSA 2A69C 5E1FA 2L12A 3Q24A 1SXTA 4R9WA 4ZYSA 3NUCA 3KK7A 3WDNA 1PFBA 5A2QL 4DGZA 5C3EB 4TRDA 3PV0A 3PUWA 1XXGA 2F0DA 1EY9A 2L4NA 2EOTA 3S14B 3L9AX 3GV6A 3HRZC 3BZDB 1QCBD 2EY2A 1U4RA 1Y8OB 3A8JE 1JICA 2C9OA 4ODGA 1LV9A 1X3PA 2Z1CA 5HURA 2BE5C 2WKDA 1QE6A 5JAVA 4WRDA 2JE6I 1H9MA 3S1NB 2HDLA 1O7YA 1TIID 4IUTA 1JOQA 1WTQA 2JA5B 3Q0AA 4NMZA 1BR9A 1I50B 3DWAA 1G2SA 2B2WA 3F2UA 4C2MB 4HMJA 1QOHA 1IHZA 1STBA 3OMGA 1SNDA 1U9RA 4NDXA 3S16B 4UAIA 3DWPA 1LT4D 2WP8J 4QCLA 2BCOA 2Z4IA 1LT3D 3W2DA 1I4HA 1B9MA 2RKSA 4KN7C 3MA2B 1Q90A 3TDQA 1JB3A 1HFGA 1YNNC 3D4WA 4G4KA 3BS1A 4CHTB 2ICIA 2QCPX 4HSPA 2YU9B 2O5JC 1EFID 4ZUJA 3M3YB 3GD7A 4RWSC 4KY6A 3GTMB 1CM9A 2NVXB 3KF8A 4OO1G 4CKCA 3T13A 5D3DA 2EY1A 2IWHA 1QJOA 2JA7B 1ILQA 3H6MA 1HUNA 4OO1H 1BF4A 1TU2B 2K28A 4PMBA 2K7VA 1PTOB 5ELDA 3OSOA 4QIWB 2KA7A 4DF7A 4DNTB 2VB2X 2ICEC 4ZK9B 4ULLA 1GUGA 4H13C 2EYPA 2CW0C 2E75C 4ZAIA 3NWTA 3PMFA 5JPNC 4C1NI 1EIHA 3K6OA 3JAME 3KLRA 2F0MA 3GO5A 4YIJA 2A73B 3DEPA 2B63B 2B2YA 5CV5A 3V96A 5KNDA 1SSOA 1UUPA 3I72A 1E2WA 4RHSA 2VUMB 5IGEA 3HS0C 3G6JB 4FO2A 2NVYB 3NK9A 5KGUA 2EJFC 2GA4B 1VMPA 3OWFA 1H9SA 3G7LA 5IT9L 2K32A 5I6WA 1Q3LA 1DOMA 2MGSA 1DM0B 1RHPA 2QILA 1SYFA 1PZKD 1FNWA 5D3IB 1TQOA 3VYTA 2AQ2B 5KNCA 1EL0A 4K6LA 1YNJC 5F2DA 2OXPA 3QB3A 5LL6S 1Y1VB 3K7AB 4OGQC 1HQMC 3FRPB 1F9PA 2A69D 1WCMB 1MGSA 4PV1C 1KAAA 4UDUC 1HUMA 4LMQD 1NUCA 2K1BA 1PRTB 4NW2A 3PO2B 3S17B 4HCSA 1I4GA 2XWJB 4IUVA 1PTOH 5J22A 4WFN3 4L63B 2X69A 5BN4A 3GTGB 5C0XI 5FK9C 3I4MB 2MP1A 5G3LD 5ELBA 1PMRA 3SK8A 1CQVA 4IFDG 2WKCA 1TWFB 2EDGA 4ZQ3A 1Q12A 5C3WA 2BE5D 3VR6A 1A2UA 2PW5A 2HCCA 5M5YB 1T5EA 1GUTA 4IFDH 2SOBA 2YYZA 5C3XA 3I73A 1ZEQX 3BDCA 4KMUC 1EY6A 3MHBA 3SK4A 2JEBI 2F0PA 5CV8A 2AUKA 1PFMA 2Z4HA 5EKLA 1Z7TA 2K5QA 1T5XD 5KEEA 2EYMA 1LTBD 4IURA 3HOUB 3HZXA 2JA8B 1O80A 4KKTA 1FNUA 5COYA 4BBRB 1STGA 2KCCA 1NR2A 2B8GA 2XSCA 3TZDA 3HG9A 3CQZB 1EY4A 4KY5A 2NTTA 5LHY1 4J1MA 5C4ZA 1D5XC 4QUCA 3A7LA 4MHEA 4A93B 1I4RA 3TMEA 4IFDJ 1ESRA 2RQXA 3T56B 4C3HG 3NQIA 1EU3A 4QMGA 4Q0FA 3K5NA 1EWCA 5EPJA 3SE0A 2PZTA 1V1PA 3R8BA 2FINB 4DXGA 1PTOC 1AEXA 2PO4A 1QG7A 2K03A 5LL6X 1OXSC 1ENCA 4KKUA 2EXZA 4X3KA 4XXEA 1SNQA 1EYAA 4L6TB 3VR3A 5JVH3 1F9QA 2F0SA 2K05A 1WTWA 4V190 2E2HB 2XRQD 2I07B 5ELEA 3LNNA 2WB1B 2SDFA 1AFPA 1MSGA 4PMCA 4K5VA 3BVGA 3L7ZC 4FF4A 1I6HB 3U9SA 4PMWA 3I8ZA 3LX0A 5J39A 1K8OA 4LJZC 1TS4A 4XYQA 4K8IA 1YNJD 2B2UC 1BO0A 3HOXB 2SEBD 3HOWB 2HQEA 3TN2A 1LABA 2K01A 3BYYB 3A56A 4XDXA 2WINB 1HQRD 2HCIA 3GTJB 2E2JB 2J4XA 3O13A 1JORA 5CMDA 3GQBA 3R2IA 5IGCA 2KQ3A 3NBHA 1A3TA 1PRTC 2D62A 2K33A 1BCPB 2F4IA 2RA4A 3M85A 3SR1A 4WORA 3A8KE 1CI3M 5T1GA 1TR5A 5ELFA 2B39A 3CU7A 1GXDC 1W6JA 2E76C 1Q8IA 4C3IB 5IIFA 3I70A 4X3TA 3HOZB 1G6ZA 3NE5B 2Q8IB 4DA2A 4K5WA 2RDGA 3TP8A 3DUZA 3SEBA 1V1PB 5I2YA 2CVRA 2L55A 3URYA 1GUOA 3MTSA 1SYEA 3SK5A 1BUVT 4A3GB 3BDOA 3EA6A 4IN3A 5ELCA 1WTPA 2FJ2A 2RDHA 2XVSA 4JK1C 2HUGA 2ID0A 1STAA 4EQOA 3GTKB 1PFNA 1LTAD 5JPMC 3X3NA 1TVXA 1XX8A 1DYQA 1LTID 1JWMD 4ID6A 3FPUB 5I6YA 1RODA 2V4DA 3HGBA 1L0XB 1BNZA 5DAUA 3FKIB 1DOKA 3QG1A 3OIQA 3H94A 4OL7A 3NTKA 1EOTA 3I90A 3GTPB 2CQAA 5I9OA 1BCPF 2O4XA 1PLFA 1NCVA 3QO2A 2KEDA 4C3IG 2Q8TA 1PTOD 3VR4A 1L0YB 1B1ZA 2A6ED 3OOCA 3MXNA 4RGNA 3QIAA 1VCIA 3EVQA 4H7BA 1HTPA 1KDAA 1W6KA 3K58A 1PZID 1EY8A 2Y0SB 1R9TB 1SYCA 2B2UA 1TWHB 4K8JA 3V2TA 4CGYB 5J1ZA 4RHRA 1Y8PB 4DU9A 4FF2A 4ME5A 2IX1A 4B9WA 5A35A 4N9TA 4J8QA 5K36G 5M9OA 1BDOA 2IPKD 5EPLA 2EJMA 2IX0A 1SE3A 5C5MA 4U673 5I9PA 1TWGB 5KNBA 4HMIA 5K36H 2VB3X 1LLRD 3BYTB 3RUZA 2KVMA 3J80E 4A3BB 3DWQA 1H9JA 4M1UB 1C4QA 3AB9A 1QNKA 1Z6HA 4FXKC 4C1NK 4DK0A 4BA1I 4C56C 1WD1A 2A74C 1HA5A 1I4PA 3PUZA 1ICWA 4TQUS 3NWSA 3RLFA 2NUCA 1PRTD 2M00A 3PUYA 3D31A 1EZ6A 1CZWA 4DN4M 1E0BA 1BCPC 3E5SA 2BA1A 1EY0A 1IKLA 1JE4A 3P20A 1K8MA 1G8ZD 1DJRD 3LWUA 5IODA 1LTSD 5C5LA 4IFDI 1STNA 1RTNA 2L11A 3WOEA 4DXFA 5KIXA 3OHXC 4A3DB 2F03A 3GP7A 5BN5A 4KI0A 1EYDA 2KCNA 3UI2A 3MXGA 1RJTA 1JWSD 4IUPA 1ESFA 4CKEA 3D6CA 2RSNA 3I3CA 2LY7A 3BG3A 3PIP3 3OW7A 4HAEA 4XT1B 1RTOA 1ML0D 1I4QA 2EE1A 2AUJD 3NXWA 3M4YA 2B2TC 4FVMA 2D5DA 4HSVA 5EKKA 4DK1A 4L8JA 2BDOA 2EJGC 3HOVB 4KHVA 1M8AA 4A3IB 1X3QA 2AWNA 1F2YA 4DNRB 2TSSA 2PCFB 5DNFA 2KEEA 1DD2A 3NSWA 4A3FB 1ZXTA 3TZUA 3QWNA 1CA5A 1KLUD 4FXGC 3TBIB 3VA7A 2VNUD 4BA2I 1CTMA 1NAPA 1EQTA 5C44B 1KNAA 3S9WA 1Z47A 1SJHD 4KD3A 4O1NA 1F77A 2NN6I 4RCNA 2I46A 3CRKC 1TY0A 2F0UA 3S2DB 2FHTA 2TMPA 1VDZA 4A3MB 1AP0A 1NR4A 1CA6A 3H3VC 4RGOS 1ZKOA 1HRJA 1O7ZA 1VF5C 4OIJA 1SYGA 1F2LA 3EJIA 2RSOA 4IUUA 5C4HA 1A2TA 4RFBA 4CBVA 3OMCA 1Y69U 2AWOA 3OIPA 4HR7B 4C3HB 4NP5A 4IZ8A 1WTVA 1SNMA 1S5BD 1MI2A 4KN4C 1V43A 1TWCB 2K5WA 1UEAB 2OT2A 3JAML 1HCZA 2F0EA 3KLSX 5EGTA 1U4MA 4NKLA 2R93B 3J7AF 3E0JA 3EFXD 3HOYB 2H1EA 2MHVA 2VXWA 2F3VA 1G91A 1GHKA 3D8GA 3MFYA 2K04A 4RGMA 2EYHA 2EY6A 3D4DA 4XYOA 4OIKA 2Z8LA 1G2TA 2R61A 2JXMB 4LK1C 1RDPD 1UAPA 3RZDB 2KJXA 2ZXRA 2PZUA 1Q1BA 2F0NA 1PDQA 4LAAA 1CFMA 3SHLA 1SMYC 3FEWX 1RF2D 2XRSD 5EBCA 3CRLC 4XQQA 2NVTB 1BCPD 4ABNA 5EKIA 3N52A 1SFOB 4V0BA 1HTLD 1S5ED 5CV6A 1XTCD 5D14A 4PQXA 1FYCA 3K59A 2JP1A 3ONAB 2R3ZA 3K5OA 1SJED 2A6EC 1QWYA 4BY1B 4EQPA 5C0XG 2B2TA 3MEHA 1NSNS 2DNEA 1B53A 3M7NA 2RDFA 3GTLB 4I7ZC 1S4ZA 5C0XH 5JEAG 4I65A 5FO8B 2JYOA 4Q5VA 3BVZA 1F9RA 4B9XA 3T4AC 5JEAH 1O7LA 2PYKA 1S5CD 2L0CA 3K5LA 3J81L 2IT1A 2RBMA 1BBXC 1U4LA 4K2LA 1WVLA 1F2MA 3QOJA 1SNCA 2NWGA 2QDBA 5BN3A 1ET9A 4IALA 5FLXL 1FNVA 2R6GA 2EYFA 1R4PB 4EVOA 3ITPA 1LACA 2F0HA 1KDBA 2FFKB 5JVG3 1SNOA 2MJ8A 5M5XB 2F0VA 1AZQA 3VYSA 2NTSA 2F0QA 2IW3A 4H44C 3R93A 1D1IA 2CHBD 3R3OA 3A8IE 2X6GA 4CKBA 4E6IA 2F0IA 1QNUA 5C0XJ 4DAVA 2DY7A 3MZ5A 1GUWA 4EQNA 3H0GB 5A2QE 2G9DA 3SK6A 1ZYRD 1XYIA 2M9VA 3T16A 5JEAJ 1S5DD 2E2IB 2WIIB 1D5ZC 1VF7A 1STYA 1FGBD 2PMZB 1E2VA 4X3SA 5E4XA 4XT3B 2SNMA 2B8FA 1FD7D 3EROA 4KK7A 2JEAI 4X3UA 1SEBD 1EQVA 3I4NB 1TT2A 5CBAE 3DXJC 1ET6A 4ZKBB 1AN8A 4TKOB 5IGBA 3NTHA 3IKJA 2F0LA 2NYZD 4FXDA 4Z9CB 5FO9B 4ZLTF 4S3SA 4A3JB 1KNEA 3NTIA 1B9NA 3I4LA 3OWEB 1SDFA 1FR3A 5M3FB 1TS5A 2F0WA 3GV3A 1SE2A 2XN9C 4N9PA 1TY2A 1SMYD 2N88A 2L5TA 1F9SA 4K5XA 3TP6A 1M4VA 2O5IC 1OXTA 2C5CA 3TP5A 3C2PA 4OO1I 3DMUA 1GHJA 1A15A 2OEOA 4HCEA 2EY5A 2H4OA 1TKWB 1LO5D 5IGFA 4DAYA 2Q8RE 3C46A 4ILWA 3OPOA 5C6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9S A;  5K36 G;  3ND8 A;  4I7Z C;  3OW7 A;  4KKT A;  1BDO A;  5C0X H;  1YNJ C;  5JEA G;  2DNC A;  1EWH A;  2EJM A;  1HPC A;  4G7Z C;  3T53 B;  1E2Z A;  1K8O A;  1E2V A;  2NN6 H;  4LJZ C;  3ND9 A;  1H9K A;  1ZYR C;  2KCC A;  2B8G A;  2A69 C;  2O5J C;  4H0L C;  4JK1 C;  2AUJ D;  4OGQ C;  5KNB A;  3M4Y A;  1HQM C;  5K36 H;  2B8F A;  3EQL C;  3GD7 A;  5JEA H;  2A69 D;  1GUS A;  1O7L A;  3MXU A;  3WDN A;  2JEA I;  1O78 A;  2D5D A;  1GHK A;  2D2C C;  4PV1 C;  2LMC B;  3MFY A;  2IT1 A;  4OO1 G;  1H9J A;  4DK1 A;  4L8J A;  1GJX A;  1LAB A;  2BDO A;  3DXJ C;  2EJG C;  1DCZ A;  3AB9 A;  3PV0 A;  3PUW A;  3FPP A;  1Q1E A;  1Z6H A;  4DNR B;  1IW7 C;  1QJO A;  2PCF B;  4TKO B;  3A7L A;  1DD2 A;  2JXM B;  4DK0 A;  1OXV A;  4LK1 C;  4OO1 H;  1OXU A;  3TZU A;  4BA1 I;  2A68 D;  1OXX K;  1TU2 B;  2V4D A;  1IW7 D;  3IKJ A;  3HGB A;  1Y8O B;  3A8J E;  2K7V A;  3IFT A;  3GQB A;  5BN3 A;  3VA7 A;  4BA2 I;  3QG1 A;  1CTM A;  3T56 B;  3H94 A;  1G29 1;  1Q1B A;  2D62 A;  2K33 A;  3PUZ A;  4TQU S;  3RLF A;  2R6G A;  5BN4 A;  2E74 C;  2KA7 A;  3T51 B;  4DNT B;  3SE0 A;  1LAC A;  4JBW A;  3A7A B;  4G7H C;  1PMR A;  1B9N A;  2A6H C;  2BE5 C;  2NN6 I;  3I4L A;  4RCN A;  1GUG A;  3CRK C;  3PUY A;  4H13 C;  1FR3 A;  1ONL A;  2CW0 C;  3QJY A;  4IFD G;  3D31 A;  3M85 A;  2E75 C;  3W3A A;  4XTC S;  2JE6 I;  2EDG A;  4IQZ A;  2PPB C;  1CFM A;  1H9M A;  1Q12 A;  2A68 C;  1SMY C;  2A6H D;  1VDZ A;  2BE5 D;  3VR6 A;  3KLR A;  1OXS C;  4KKU A;  3VR5 A;  3A8K E;  1CI3 M;  3VR4 A;  4KKS A;  2BA1 A;  1T5E A;  1GUT A;  4IFD H;  2L5T A;  3CRL C;  1ZKO A;  3P20 A;  4H44 C;  3VR2 A;  2DN8 A;  1GUN A;  5KND A;  1A6X A;  3I72 A;  1Y8N B;  1VF5 C;  1E2W A;  3VR3 A;  2YYZ A;  1OXT A;  2O5I C;  2A6E D;  3A8I E;  3I73 A;  3N6R A;  1DXM A;  1K8M A;  3FMC A;  1IYU A;  3OOC A;  4KMU C;  2E76 C;  3QIA A;  3PUX A;  1VCI A;  3LWU A;  1HTP A;  2JEB I;  1IYV A;  2EJF C;  3NE5 B;  2Q8I B;  2AUK A;  4GZY C;  1GHJ A;  2ZT9 C;  2AWO A;  1Y69 U;  4HR7 B;  2PNR C;  4KHZ A;  1V8Q A;  1H9S A;  1FYC A;  3D4R A;  1Z7T A;  2K32 A;  1TKW B;  2BA0 A;  4KN4 C;  1H9R A;  2A6E C;  5BN5 A;  1V43 A;  4KI0 A;  2QF7 A;  3PUV A;  1GUO A;  2F1M A;  5C0X G;  3LNN A;  1Y8P B;  1H9S B;  2DNE A;  4G7O C;  1B9M A;  2NN6 G;  5A35 A;  4KN7 C;  1I6V C;  3M7N A;  3L7Z C;  5KNC A;  3OPO A;  3SDZ A;  1HCZ A;  1VF7 A;  3BG3 A;  1Q90 A;  4XIG S;  2EVB A;  3BDO A;  1YNN C; 
#chains in the Genus database with same CATH topology
 3ERQ A;  1PA6 A;  1HFN A;  3DHQ A;  4LUV A;  1HPC A;  4LUO A;  4JG2 A;  4K14 A;  1E2Z A;  3S15 B;  4FYD A;  1CK1 A;  3I4N G;  3L3O C;  1KD1 C;  4H0L C;  3KUP A;  3VYU A;  3PO3 B;  1SN8 A;  4X65 L;  3J80 c;  3KLW A;  2R7D A;  3P1H A;  3I4N H;  2YTY A;  3I91 A;  2LMC B;  1ENF A;  1SYD A;  5KRU A;  1DOL A;  4A3E B;  4FNF A;  1PHJ A;  1DCZ A;  4QF4 A;  2JJQ A;  4R4I A;  3J80 i;  5CGK A;  3J7A 5;  2GVB A;  1D5M C;  4A3J G;  1OXV A;  1OXU A;  1U0L A;  4JI5 L;  4LF7 L;  4LF9 L;  2EXD A;  2HDM A;  5DM6 3;  3AQQ A;  4RGT A;  4DV0 Q;  2K75 A;  2NBF A;  1EEI D;  1CUK A;  1G29 1;  1IZ6 A;  2L9H A;  5M3F G;  1PH7 A;  4JI3 Q;  5CR3 A;  2F0K A;  2E74 C;  4A3J H;  4JI7 L;  1VQJ A;  1FL0 A;  5IT9 E;  1PH1 A;  4G7H C;  4O0A A;  3K0Y A;  5JJZ A;  4QJF A;  4RA8 A;  3P7J A;  3VA5 A;  2F0G A;  5M3F H;  1EY5 A;  4GS3 A;  3RMH A;  1XNR L;  1D6E C;  1KRS A;  3VR5 A;  1DON A;  4R4T A;  4BBS B;  5M5W B;  1WD0 A;  4RH6 A;  4R4Q A;  4OHJ A;  1GUN A;  3L2P A;  2KEN A;  2ZJR A;  3NQT A;  3CHB D;  1B7Y B;  1SNP A;  1DXM A;  2F0J A;  2I5L X;  4QB4 A;  1RCV D;  5ISR A;  4GKK L;  2PW7 A;  2EYO A;  1MJE A;  1IYV A;  3K5M A;  1Q8K A;  2ZM6 Q;  4GZY C;  2PNR C;  4GOP A;  2FMM A;  1II3 A;  3F2D A;  1RD9 D;  2F0T A;  1LTR D;  2X6L A;  3J7Z C;  4DUY Q;  3A54 A;  3A74 A;  4RAU C;  3JAM i;  1XMO L;  3AFP A;  4F88 A;  4BY7 B;  2NB0 A;  1U4P A;  3SDZ A;  4XQN A;  2VQF L;  3PO3 G;  2KHS A;  1AW7 A;  1I4X A;  4LFA L;  1X3G A;  1F2Z A;  3FP9 A;  1ENA A;  1EWH A;  3HP3 A;  5I2X A;  3CCM A;  3S15 H;  2EYJ A;  4P2C B;  3VYR A;  1VQP A;  3K57 A;  3CCV A;  2JQO A;  4A3E G;  3PO3 H;  1K3R A;  2ZTD A;  2G5D A;  1CKN B;  3BJU A;  1K0S A;  2PQE A;  3V05 A;  1UE1 A;  3L0O A;  3MXU A;  1VQL A;  1EIG A;  5JOB A;  1I3Q B;  4M8A A;  4A4I A;  4F7X A;  5GAH C;  4A3E H;  1SYB A;  1HA6 A;  2F0O A;  1Q1E A;  5CV4 A;  2VQE Q;  4QIW E;  3LGJ A;  1Y1W B;  1WTO A;  3J7Y W;  3MFG A;  2A68 D;  1OXX K;  3NHH A;  4GLX A;  3KF6 A;  5GQO A;  5EJW A;  1KHI A;  5FKA C;  4JYA Q;  5D65 A;  5E3F A;  2JA6 B;  1IL8 A;  4X62 L;  3T51 B;  3M7G A;  1EUJ A;  2A6H C;  2EZV A;  4JI4 Q;  4IQZ A;  3GTO B;  5CV9 A;  4CJ0 B;  2J7Z A;  3J7A V;  3J80 L;  1XWE A;  5M5W H;  4O42 A;  2BDN A;  1MBY A;  2DN8 A;  1D7Q A;  5E4W C;  4Y52 H;  1JOO A;  3AMU A;  3LWE A;  3U9O A;  4IPG A;  4PZ6 A;  2DJF C;  3D0F A;  4IJL A;  5AFW A;  1CZG A;  4JI2 L;  1E22 A;  2KUM A;  3I55 A;  3D4R A;  1CT1 D;  1HR0 W;  1MD2 D;  1EYC A;  3HKZ B;  2IJ0 A;  4BY7 G;  2K5D A;  1MKH A;  2OTL A;  3FDT A;  1BXT A;  4KY7 A;  2CFM A;  4FF1 A;  1DZ1 A;  4HIM A;  1WTH A;  3MWY W;  3C3L A;  2OF1 A;  4BY7 H;  2R92 B;  5CV7 A;  4R8N A;  1HXY D;  3X3M A;  3CAM A;  1KTK A;  2PI2 A;  1E24 A;  5M3M B;  4EX5 A;  1ZYR C;  4ZRZ A;  5DLQ E;  2XNA C;  1VMC A;  3BZK A;  1A3U A;  1MJC A;  1PTO F;  2KEC A;  3GDE A;  5J3B A;  3WOF A;  4F87 A;  4HN7 A;  1Y1W G;  2PNH A;  4DR4 Q;  1I3Q H;  3ULJ A;  5GAG C;  2O2L D;  1HNX L;  4GN4 B;  3KBG A;  3Q23 A;  5CYU A;  1I94 Q;  1B50 A;  4DR7 Q;  3TSS A;  3CCU A;  1IW7 C;  1KXL A;  2JA6 G;  1FGU A;  1PYW D;  1Y1W H;  3KF8 B;  5T1I A;  3IAY A;  3F2C A;  1JC7 A;  1XPU A;  4O2D A;  2D9U A;  2IY5 B;  2PQA B;  2FXQ A;  1NY4 A;  2NZ1 D;  4GNX B;  3PGZ A;  2JA6 H;  4JBM A;  3M9B A;  2MPM A;  5FJ8 G;  5NUC A;  1LT5 D;  4MIU A;  1YJW A;  1AZP A;  1X32 A;  3GTO H;  2K5V A;  4KTA A;  1KRT A;  2J0T D;  5CC4 A;  2DY8 A;  3J81 E;  1B3A A;  4YWM A;  4C3J B;  4KJO A;  4Y7N B;  5FJ8 H;  4FDB A;  2XIW A;  2LS0 1;  1IKM A;  4J6H A;  3IFD A;  1SE4 A;  5C4X B;  2UXB Q;  1JOK A;  1KLG D;  3FMC A;  2NZH A;  3AU7 A;  3E9H A;  5EQ0 A;  5FLM G;  4PNY A;  2WAQ B;  2F0F A;  1PH4 A;  1CSP A;  1Y14 B;  1JQY D;  2EYL A;  4LUZ A;  3MAQ A;  3SVM A;  2A5H A;  2Z9H A;  4B08 A;  5FLX E;  4ZKC B;  1YNN D;  2M2L A;  2R92 G;  3MVV A;  2B2V C;  5FLM H;  2B29 A;  5IOC A;  4DR1 L;  2ZXO A;  3P75 A;  1V1O A;  5GAD C;  2EPB A;  2QF7 A;  1BOS A;  1X56 A;  3PUV A;  4DV4 Q;  5M3M G;  1H9S B;  5DEH A;  2LSS A;  1WTX A;  1KDC A;  2NN6 G;  2R92 H;  3PSI A;  5KYI A;  3HKS A;  1HNZ Q;  3RZO B;  1LYL A;  2EVB A;  4DFA A;  2JSO A;  5L37 A;  5M3M H;  1SBB B;  3CC7 A;  1PZJ D;  1BQQ T;  3T53 B;  1PRT F;  2NN6 H;  3ND9 A;  2KOL A;  1YHQ A;  1QB5 D;  3NP8 A;  2MQH A;  1B2T A;  1TS3 A;  4R1J A;  1QIL A;  4HTH A;  4AYB B;  3EQL C;  3PIO 3;  1EFW A;  1K8A C;  3KYH C;  1KAB A;  4DKA C;  3FVQ A;  1SAP A;  2D2C C;  2PZW A;  2NVQ B;  3H91 A;  5BR8 Q;  1EU4 A;  1GJX A;  2WV6 D;  1VQ7 A;  4QUF A;  4L5T A;  4J15 A;  4EGV A;  3S1Q B;  4CJ1 B;  3CCS A;  4AYB E;  4BWG B;  4A75 A;  2RCF A;  2CW0 D;  5FOB B;  2Q2U A;  3M4O B;  5COR A;  2FMC A;  2VZA A;  4OX9 L;  1RKN A;  1D1K A;  3NPP A;  4IUN A;  4DAP A;  1JWU D;  4U68 A;  3CKI B;  3BVM A;  4XQJ A;  1L1O B;  2K4K A;  4KV6 A;  4C3J G;  1EEF D;  1VQ4 A;  1B44 D;  4JBW A;  4DV7 Q;  1GKH A;  1N33 L;  1Q46 A;  4AQY Q;  1ONL A;  3K80 C;  3QJY A;  5I4D A;  1WTR A;  1HR0 Q;  1EYG A;  1OTC A;  5C4X G;  4XTC S;  4OXP A;  2L15 A;  2A6H D;  4LF4 L;  4C3J H;  3JC6 6;  2OQ0 A;  2WAQ G;  3A55 A;  4KKS A;  4LFB Q;  2UU9 Q;  3IL8 A;  5C4X H;  2AQ1 B;  4RG1 A;  4TSS A;  1Y8N B;  4NXN Q;  1HHV A;  3DEO A;  1UNS A;  1IYU A;  1WFQ A;  1JCK B;  1LT6 D;  4WJW A;  1CQF A;  1C8C A;  2ZTC A;  1V1Q A;  5CBE E;  2WB1 E;  2ZT9 C;  1XTD A;  1EY7 A;  2WAC A;  1IBL Q;  1V8Q A;  2Q2T A;  1B4O A;  1VQH A;  4FP5 D;  4ZUI A;  2F3W A;  2BA0 A;  5HGT A;  3QOL A;  4G57 A;  5K5P A;  2ZTE A;  4PZ7 A;  4A93 G;  2B2W C;  1GD7 A;  1STE A;  3R2T A;  1I6V C;  2MUY A;  5EBD A;  4DV6 L;  3RZO H;  3MXP A;  2XWB B;  4G7Z C;  5IGD A;  2UUB Q;  2AMC B;  4AYB G;  4N8F A;  2QEJ C;  1A3V A;  3S1R B;  1VQ5 A;  4A93 H;  4DV3 L;  3Q22 A;  1WJJ A;  3HEJ A;  4KD4 A;  1D2B A;  1H9K A;  4YWK A;  4LW1 A;  4CJ2 C;  1JT8 A;  3H09 A;  5DM7 3;  4X64 L;  3KDF B;  2SNS A;  1CHQ D;  2QKI C;  1AE2 A;  4ZCK A;  1TWA B;  5C4J B;  1X3F A;  3EIV A;  3NBI A;  1GUS A;  1O78 A;  4L5Q A;  4LF5 L;  4GKJ L;  3W5O A;  2NVQ H;  4MN3 A;  3K0X A;  4A3K B;  4DR6 Q;  2KCT A;  3TP7 A;  4LFC L;  3AYH B;  2RVL A;  4NXM L;  3S1Q H;  1K0R A;  1LTT D;  2R7Z B;  2LFN A;  3FPP A;  1OO9 B;  4FF3 A;  2K6A A;  1VQD A;  4RCO A;  5G3L F;  4QY7 A;  3ZYY X;  2N55 A;  3M4O H;  2IX3 A;  4B3R Q;  1IW7 D;  3IFT A;  3MC0 B;  3S2H B;  3BDL A;  3SXH A;  3C1E A;  3T1H L;  4KJN A;  4R8I A;  1GOZ A;  1EZ8 A;  1MSH A;  3A7A B;  1CHP D;  4APV A;  1HZA A;  1Q82 C;  3CCL A;  3W3A A;  1C48 A;  2PPB C;  2A68 C;  1TS2 A;  4HED A;  2BOS A;  3RD4 A;  4HJ7 A;  1SE8 A;  4RKB A;  2B2V A;  3KLS A;  3D3R A;  4B3S L;  4K6D A;  2IL8 A;  2G9H D;  2L1B A;  3E6Z X;  5FO7 B;  1NBW A;  5HY6 A;  3VR2 A;  1A6X A;  1XPO A;  4DV2 L;  2CCZ A;  5IGG A;  1I5F A;  3N6R A;  3CPF A;  3OYY A;  3PUX A;  4RKL A;  3KBX A;  1J8I A;  1MHW C;  1X55 A;  2E2D C;  1ILP A;  2LKV A;  4KHZ A;  3ER0 A;  1STH A;  1S5F D;  1J9O A;  5EPK A;  1PXU A;  4DV1 L;  1H9R A;  3H3V I;  1JR0 D;  4IUQ A;  1LTG D;  2B2Y C;  2ENB A;  4F8M A;  2F1M A;  1B70 B;  5KYL A;  1R4Q B;  4G7O C;  3D6W A;  5IWA Q;  3Q6S A;  3GTQ B;  4DR2 L;  2AQ3 B;  4XIG S;  2ZXP A;  3DM1 A;  3C1F A;  1S72 A;  3ND8 A;  4K2K A;  1CKN A;  3S1R H;  2DNC A;  1N36 L;  1K83 B;  3S1M B;  3KJP A;  4BS9 A;  5TSS A;  4A3K G;  1BVS A;  2A69 C;  1S3O A;  5E1F A;  4HJA A;  2L12 A;  5C4J H;  1TWA H;  3Q24 A;  1VQG A;  1QUQ B;  1SXT A;  4R9W A;  4ZYS A;  2R7Z G;  2VW9 A;  3NUC A;  1FJG L;  3KK7 A;  3CP0 A;  3WDN A;  1HNW L;  4A3K H;  4X65 Q;  3K8A A;  1PFB A;  5A2Q L;  4DGZ A;  5C3E B;  4TRD A;  3PV0 A;  2F52 A;  2R7Z H;  3PUW A;  1XXG A;  2F0D A;  1EY9 A;  2L4N A;  3EN2 A;  3UDX A;  2EOT A;  3S14 B;  3L9A X;  3GV6 A;  1U5K A;  3HRZ C;  2VS1 A;  3BZD B;  1QCB D;  2UXD L;  2EY2 A;  1U4R A;  1Y8O B;  3A8J E;  3UDI A;  1PH9 A;  4IPC A;  3S2H H;  4JI5 Q;  1G51 A;  4LF7 Q;  4LF9 Q;  1JIC A;  2C9O A;  1VQE A;  4PG3 A;  2ALY B;  4ODG A;  1XNQ L;  1LV9 A;  1X3P A;  2Z1C A;  4JI6 L;  5HUR A;  2BE5 C;  2WKD A;  4JI7 Q;  3NBH B;  1QE6 A;  5JAV A;  1C7Y A;  4WRD A;  2JE6 I;  1H9M A;  3S1N B;  2CH4 A;  2HDL A;  1O7Y A;  1TII D;  1L1O C;  4IUT A;  1JOQ A;  1WTQ A;  2JA5 B;  1XMQ L;  1XNR Q;  5JJI A;  3Q0A A;  4NMZ A;  1BR9 A;  1I50 B;  3DWA A;  1G2S A;  2B2W A;  2OQK A;  3UE0 A;  3J81 j;  3F2U A;  1N32 L;  2Y0S E;  4C2M B;  4HMJ A;  2QEX A;  4DAM A;  1QOH A;  1J5E L;  2DGY A;  3ULP A;  1IHZ A;  1STB A;  4JCV E;  3OMG A;  4GKK Q;  1SND A;  1U9R A;  1UE6 A;  4NDX A;  3S16 B;  1B3Q A;  4UAI A;  3G71 A;  3DWP A;  2ES2 A;  1LT4 D;  4KHP Q;  1BKB A;  1SRU A;  2WP8 J;  4QCL A;  2BCO A;  2Z4I A;  1LT3 D;  3W2D A;  1I4H A;  2KHI A;  2ZJP A;  1B9M A;  2ATW A;  2RKS A;  3GTQ H;  3RNU A;  4KN7 C;  1VQM A;  2CWA A;  3ULL A;  4DK6 C;  2BH8 A;  3MA2 B;  1Q90 A;  3TDQ A;  1XMO Q;  1JB3 A;  1HFG A;  1YNN C;  1K28 A;  3D4W A;  4G4K A;  3BS1 A;  4CHT B;  1G6P A;  1HZ9 A;  2ICI A;  1K83 H;  3S1M H;  2QCP X;  1E3P A;  4HSP A;  1IYJ B;  4LFA Q;  5C3E G;  1EFI D;  2YU9 B;  2O5J C;  4ZUJ A;  3M3Y B;  3GD7 A;  3TRZ A;  4RWS C;  4KY6 A;  3GTM B;  2R7F A;  1CM9 A;  3SGI A;  4R4C A;  2NVX B;  3KF8 A;  5ELN A;  5ELO A;  4P71 A;  4JI8 L;  3T13 A;  4CKC A;  5C3E H;  4OO1 G;  5D3D A;  2EY1 A;  1X6O A;  2CH4 W;  2IWH A;  2N3S A;  3KFU A;  4LF6 L;  1VQI A;  1QJO A;  2PQA A;  2JA7 B;  2QA4 A;  4GNX A;  1ILQ A;  3H6M A;  3S14 H;  3M4P A;  1HUN A;  4OO1 H;  1BF4 A;  4POG A;  1TU2 B;  2K28 A;  4PMB A;  4RMF A;  2K7V A;  1PTO B;  5ELD A;  3OSO A;  4QIW B;  2ZM6 L;  2Y0S G;  2KA7 A;  4DF7 A;  4DNT B;  2VB2 X;  2ICE C;  2N8N A;  4ZK9 B;  4CDC C;  4X62 Q;  3I2Z A;  1GUG A;  4H13 C;  4ULL A;  2EYP A;  4GN5 A;  2CW0 C;  2JA5 G;  2UXC L;  2E75 C;  4ZAI A;  3NWT A;  3PMF A;  3S1N H;  5JPN C;  4C1N I;  5IP9 G;  1EIH A;  3K6O A;  3JAM E;  3KLR A;  1N8R C;  2EQS A;  2F0M A;  1O7I A;  3GO5 A;  4YIJ A;  2A73 B;  2JA5 H;  3DEP A;  2B63 B;  2B2Y A;  5CV5 A;  3V96 A;  5KND A;  1SSO A;  3CCJ A;  1UUP A;  3I72 A;  5LMU L;  2AHO B;  1E2W A;  1I50 H;  5IP9 H;  4RHS A;  1LTL A;  1HH2 P;  4C2M H;  2HQL A;  2RCN A;  2VUM B;  5IGE A;  3HS0 C;  3G6J B;  4FO2 A;  2NVY B;  3NK9 A;  5KGU A;  2EJF C;  1N9W A;  2GA4 B;  4JV5 L;  1VMP A;  1HZB A;  1WYD A;  3OWF A;  3MXN B;  2B3G A;  1XPR A;  1H9S A;  3S16 H;  3G7L A;  5IT9 L;  2K32 A;  5I6W A;  1Q3L A;  1DOM A;  2MGS A;  4JI2 Q;  1DM0 B;  1RHP A;  2Z0S A;  2QIL A;  1SYF A;  1PZK D;  1FNW A;  5D3I B;  1TQO A;  4DR5 L;  3VYT A;  2AQ2 B;  4LWC A;  5KNC A;  1EL0 A;  4K6L A;  2F4V Q;  3Q8D A;  5LMN W;  1YNJ C;  1SR3 A;  5F2D A;  2OXP A;  2YU9 H;  1VS0 A;  3QB3 A;  5LL6 S;  1Y1V B;  3K7A B;  4POF A;  3M3Y H;  4OGQ C;  1PH5 A;  1HQM C;  4JI0 L;  3FRP B;  1F9P A;  5IYB G;  2A69 D;  2JA7 G;  2WFW A;  3GTM H;  1WCM B;  1MGS A;  2NVX H;  4PV1 C;  1KAA A;  4UDU C;  1HUM A;  4LMQ D;  1NUC A;  2K1B A;  1PRT B;  5IYB H;  1HNX Q;  4NW2 A;  5GAE C;  2JA7 H;  3PO2 B;  3S17 B;  4HCS A;  3ICE A;  1I4G A;  1L1O A;  2XWJ B;  4IUV A;  1PTO H;  5J22 A;  4WFN 3;  2Q2H A;  4L63 B;  2X69 A;  5BN4 A;  3GTG B;  5C0X I;  5FK9 C;  3I4M B;  2MP1 A;  5G3L D;  2HIV A;  5ELB A;  1A62 A;  2XTI A;  1PMR A;  3F8T A;  1CQV A;  2K52 A;  3SK8 A;  2B63 G;  4IFD G;  2WKC A;  4YCU A;  1TWF B;  1KIX A;  2EDG A;  4ZQ3 A;  1Q12 A;  5C3W A;  2BE5 D;  3VR6 A;  1A2U A;  2PW5 A;  2VUM G;  2HCC A;  3AEV A;  4HID A;  5M5Y B;  2B63 H;  4LF8 L;  4L5R C;  1T5E A;  1GUT A;  4IFD H;  4ME3 A;  1NJI C;  2SOB A;  2YYZ A;  5C3X A;  3I73 A;  1ZEQ X;  3BDC A;  4YHH L;  4KMU C;  2VUM H;  1QZH A;  1EY6 A;  2KHJ A;  2NVY H;  3MHB A;  3SK4 A;  2JEB I;  2F0P A;  2Z6B A;  5CV8 A;  2AUK A;  1PFM A;  1KAW A;  2Z4H A;  5EKL A;  1Z7T A;  4P72 A;  2K5Q A;  4DK3 C;  3HOV G;  3U58 A;  3G4S A;  1T5X D;  4YY3 L;  5KEE A;  2EYM A;  5AJ3 L;  1LTB D;  1QVC A;  4DR1 Q;  3W1G A;  4IUR A;  1YNX A;  3HOU B;  4MZ9 A;  3HZX A;  3PIP A;  2JA8 B;  2V1C C;  1E7Z A;  1Y1V G;  3KDF A;  1O80 A;  4KKT A;  1FNU A;  1UWV A;  5COY A;  2AKW B;  4BBR B;  1WCM G;  1STG A;  2KCC A;  1NR2 A;  2B8G A;  3A5Z B;  1Y1V H;  3K7A H;  2XSC A;  3TZD A;  3HG9 A;  3CQZ B;  1E1O A;  1IBM L;  3PO2 G;  1EY4 A;  2BH2 A;  1WCM H;  2K50 A;  3A0J A;  4KY5 A;  4WJ3 M;  2NTT A;  4TVA B;  4IOC A;  1QZG A;  5LHY 1;  1UE5 A;  1YVC A;  4J1M A;  5C4Z A;  2UUA L;  3PO2 H;  4IO9 A;  1D5X C;  3S17 H;  2RHS B;  4QUC A;  3A7L A;  4MHE A;  4A93 B;  4JC0 A;  4B3T L;  3I4M G;  2UXB L;  3CMA A;  1I4R A;  3TME A;  3CME A;  3E0E A;  4IFD J;  1ESR A;  4DV5 L;  2RQX A;  4OX9 Q;  3T56 B;  4C3H G;  3NQI A;  1EU3 A;  3GTG H;  4QMG A;  3I4M H;  4Q0F A;  3K5N A;  1EWC A;  5EPJ A;  3SE0 A;  2PZT A;  1V1P A;  1PH3 A;  3R8B A;  2FIN B;  4NPS A;  1TWF H;  4DXG A;  3MEF A;  2HHH L;  1PTO C;  1AEX A;  1YHA A;  2PO4 A;  1N33 Q;  1QG7 A;  2K03 A;  2KBN A;  5LL6 X;  1OXS C;  1ENC A;  3CCQ A;  4KKU A;  1PH8 A;  1E1T A;  5M5Y H;  2EXZ A;  4X3K A;  4LF4 Q;  1NMF A;  4XXE A;  1SNQ A;  1EYA A;  4L6T B;  3VR3 A;  5JVH 3;  1F9Q A;  3STB C;  2QDL A;  4OWT B;  2F0S A;  5LMN Q;  1K3B C;  2K05 A;  4DR3 L;  4MNO A;  1WTW A;  4V19 0;  3FHW A;  2E2H B;  3HOU G;  4OEM B;  2XRQ D;  3NEM A;  3NEL A;  2JA8 G;  4GLV B;  5IYD G;  4JI1 L;  1P8L A;  2I07 B;  5ELE A;  3LNN A;  2WB1 B;  3HOU H;  2SDF A;  1AFP A;  4BBR G;  1MSG A;  4PMC A;  1YHB A;  2IHE A;  4K5V A;  3BVG A;  2JA8 H;  3L7Z C;  4FF4 A;  3CPW A;  2PI2 E;  1YEZ A;  4LNQ A;  1I6H B;  3U9S A;  4PMW A;  3I8Z A;  3LX0 A;  1GVP A;  1QUQ A;  4BBR H;  1X65 A;  5J39 A;  1K8O A;  4IJH A;  4LJZ C;  1EQQ A;  1TS4 A;  4XYQ A;  1ASZ A;  4K8I A;  1YNJ D;  3CQZ H;  2B2U C;  2HD3 A;  1BO0 A;  3HOX B;  4X64 Q;  2NZO A;  1PYB A;  2E8G A;  2MFI A;  2SEB D;  4AQY L;  1W2B A;  3HOW B;  1KL9 A;  1K8G A;  3G48 A;  2HQE A;  3TN2 A;  1LAB A;  2K01 A;  4GKJ Q;  3BYY B;  2MO0 A;  3A56 A;  4XDX A;  4NXM Q;  2WIN B;  1HQR D;  2HCI A;  3GTJ B;  2E2J B;  2J4X A;  2IHF A;  1IXR A;  4DUZ L;  3O13 A;  1JOR A;  5CMD A;  3GQB A;  3R2I A;  5IGC A;  2KQ3 A;  3NBH A;  2MNA A;  1A3T A;  1PRT C;  2D62 A;  2K33 A;  1BCP B;  3DM3 A;  2F4I A;  3T1H Q;  1L2F A;  1IBL L;  2ZJQ A;  2RA4 A;  1YJN A;  3CW2 C;  1FVI A;  3M85 A;  3SR1 A;  1M1K C;  4WOR A;  1T9H A;  3A8K E;  1CI3 M;  5T1G A;  4B3M L;  1N34 Q;  1TR5 A;  5ELF A;  1YZ6 A;  3T1Y L;  4B3S Q;  1ICF B;  4UY8 C;  2B39 A;  3CU7 A;  1GXD C;  4IPH A;  4YWL A;  1LUZ A;  1W6J A;  2RF4 A;  2E76 C;  2OCE A;  1Q8I A;  4DV2 Q;  4C3I B;  5IIF A;  3I70 A;  4X3T A;  3HOZ B;  1G6Z A;  3NE5 B;  2Q8I B;  4DA2 A;  2E2H H;  2WB1 G;  1JJC B;  4K5W A;  2RDG A;  2A8V A;  4HIK A;  4PZ8 A;  3TP8 A;  3DUZ A;  3SEB A;  3AFQ A;  4GNX C;  1MIU A;  2HIX A;  2OWO A;  1V1P B;  5I2Y A;  2CVR A;  2EIF A;  2K14 A;  2L55 A;  3PCO B;  3URY A;  1GUO A;  2YTV A;  4MTN A;  4QGU A;  3MTS A;  2PMZ E;  4DV1 Q;  1SYE A;  3SK5 A;  1BUV T;  2Q2I A;  4OEL B;  4A3G B;  1CSQ A;  1I6H H;  3BDO A;  4DR2 Q;  3EA6 A;  3HOX G;  4IN3 A;  4X6A H;  5ELC A;  1WTP A;  3ERS X;  3UDG A;  2I5H A;  4N8X 1;  2FJ2 A;  2RDH A;  3HOW G;  1EIF A;  2XVS A;  4JK1 C;  1N36 Q;  2HUG A;  2ID0 A;  1STA A;  3CC4 A;  4EQO A;  3HOX H;  3GTK B;  1PFN A;  5IP7 G;  1YIJ A;  2UUC L;  3RLN A;  1LTA D;  5JPM C;  3X3N A;  3HOW H;  1YJ9 A;  2N78 A;  1QVG A;  1FJG Q;  3BU2 A;  3TQY A;  4K0K L;  1TVX A;  1HNW Q;  1XX8 A;  1DYQ A;  1LTI D;  1JWM D;  5IP7 H;  4ID6 A;  3FPU B;  4AIM A;  4EQ5 A;  1UE7 A;  3GTJ H;  5I6Y A;  1ROD A;  2I5M X;  4OWX B;  2E2J H;  2V4D A;  4ALP A;  3HGB A;  1HZC A;  1L0X B;  1BNZ A;  5DAU A;  1WI5 A;  1DOK A;  3FKI B;  3QG1 A;  4OWW B;  3OIQ A;  2UXD Q;  3H94 A;  4OL7 A;  3NTK A;  5IE8 A;  1EOT A;  3I90 A;  3OTO L;  2F3I A;  3GTP B;  5HGQ A;  1LM0 A;  2CQA A;  4JBK A;  4A3L G;  1XNQ Q;  5I9O A;  1BCP F;  2O4X A;  1PLF A;  4JI6 Q;  1NCV A;  2RHQ B;  3QO2 A;  3S24 A;  4X66 L;  2KED A;  4UP7 A;  2DJG C;  4C3I G;  2Q8T A;  4A3L H;  1PTO D;  4DPG A;  3VR4 A;  1L0Y B;  3HOZ G;  1B1Z A;  4CDF C;  5IT9 c;  2A6E D;  1WOC A;  1XMQ Q;  3OOC A;  3MXN A;  4RGN A;  1DGS A;  3QIA A;  4C3I H;  5EAY A;  1VCI A;  3KOJ A;  3EVQ A;  4H7B A;  1HTP A;  1KDA A;  3PF4 A;  3HOZ H;  1N32 Q;  1W6K A;  3K58 A;  3STB D;  1IBK L;  1J5E Q;  1PZI D;  1EY8 A;  1VQC A;  2Y0S B;  4R4O A;  1R9T B;  4A3G G;  1SYC A;  1W3S A;  2B2U A;  1TWH B;  3I4O A;  2YV5 A;  4K8J A;  3V2T A;  1SMX A;  4CGY B;  5J1Z A;  4RHR A;  1Y8P B;  4DU9 A;  4FF2 A;  3CXC A;  4ME5 A;  2E5L L;  2IX1 A;  4B9W A;  5A35 A;  4N9T A;  4J8Q A;  2A19 A;  1NMG A;  3F2B A;  3RN5 A;  4A3G H;  1PFS A;  5K36 G;  5M9O A;  1BDO A;  2IPK D;  5EPL A;  2EJM A;  3K81 C;  2IX0 A;  1SE3 A;  5C5M A;  3CF5 A;  4U67 3;  5I9P A;  1JB7 A;  1TWG B;  5KNB A;  4HMI A;  5K36 H;  3GTK H;  2VB3 X;  1LLR D;  3CD6 A;  3BYT B;  1TXY A;  3RUZ A;  2KVM A;  3J80 E;  4UPA A;  4A3B B;  3DWQ A;  1H9J A;  4M1U B;  1VQ6 A;  1C4Q A;  3AB9 A;  3FKI G;  1QNK A;  1JE5 A;  4JI8 Q;  1Z6H A;  3I56 A;  4FXK C;  4C1N K;  2VQF Q;  4DK0 A;  4DV0 L;  4LF6 Q;  2JN4 A;  4BA1 I;  4JI3 L;  4C56 C;  1WD1 A;  3FKI H;  2A74 C;  1HA5 A;  1I4P A;  3PUZ A;  1ICW A;  4TQU S;  3NWS A;  3RLF A;  3W1B A;  3H3V H;  3GTP H;  3QR8 A;  2NUC A;  2LXK A;  4I7A A;  1PRT D;  2M00 A;  3PUY A;  4NB3 A;  3D31 A;  3JAM c;  1A8V A;  3TS2 A;  4KHP L;  1EZ6 A;  1CZW A;  4DN4 M;  2UXC Q;  4AH6 A;  1E0B A;  2D0O A;  1BCP C;  3E5S A;  2BA1 A;  1EY0 A;  1IKL A;  1JE4 A;  3P20 A;  1UEB A;  2MO1 A;  1SRO A;  1K8M A;  1G8Z D;  2CQO A;  5LMU Q;  1DJR D;  3K7U C;  3LWU A;  1RL2 A;  3E9I A;  5IOD A;  4BXX G;  1LTS D;  1HJP A;  4JPB W;  5C5L A;  3I7F A;  4IFD I;  1STN A;  1RTN A;  2L11 A;  3WOE A;  4DXF A;  5KIX A;  4JV5 Q;  2GVA A;  3OHX C;  4A3D B;  1R9T H;  1CKO A;  4DUY L;  4A3C G;  2F03 A;  4BXX H;  1TWH H;  3GP7 A;  5BN5 A;  4KI0 A;  1Q7Y C;  1EYD A;  2KCN A;  3UI2 A;  3MXG A;  1RJT A;  1JWS D;  4IUP A;  1ESF A;  4CKE A;  3D6C A;  2RSN A;  4A3C H;  3I3C A;  2LY7 A;  1AE3 A;  3BG3 A;  4YCV A;  4DAY B;  1VQ8 A;  4DR5 Q;  3PIP 3;  1X3E A;  3OW7 A;  4HAE A;  4XT1 B;  4GN3 B;  1RTO A;  1ML0 D;  1RIP A;  4A3B G;  1I4Q A;  2EE1 A;  1TWG H;  2KCM A;  2AUJ D;  3NXW A;  3M4Y A;  4H02 A;  1K9M C;  2CKZ B;  2B2T C;  5GRO A;  3CCE A;  4FVM A;  2D5D A;  4HSV A;  4JI0 Q;  4A3B H;  4BBS G;  5EKK A;  2VQE L;  4DK1 A;  4L8J A;  2BDO A;  2EJG C;  3HOV B;  4KHV A;  1M8A A;  4A3I B;  1X3Q A;  2AWN A;  1F2Y A;  4DNR B;  1Q86 C;  2TSS A;  2PCF B;  5DNF A;  2KEE A;  1DD2 A;  4BBS H;  3NSW A;  4A3F B;  1ZXT A;  3TZU A;  3QWN A;  1CA5 A;  4JYA L;  1KLU D;  1ASY A;  4FXG C;  2JA9 A;  3TBI B;  3VA7 A;  2VNU D;  4BA2 I;  1CTM A;  1NAP A;  1EQT A;  5C44 B;  1KNA A;  3S9W A;  4JI4 L;  1Z47 A;  1SJH D;  4KD3 A;  4O1N A;  1F77 A;  2NN6 I;  4RCN A;  2I46 A;  3CRK C;  1X9N A;  1TY0 A;  2F0U A;  5IY0 A;  2FHT A;  3S2D B;  4HIO A;  2TMP A;  1VDZ A;  4A3M B;  1AP0 A;  1NR4 A;  1CA6 A;  3H3V C;  4RGO S;  1S40 A;  1JMC A;  1ZKO A;  1HRJ A;  2HT1 A;  1EQR A;  1O7Z A;  1VF5 C;  4OIJ A;  1PV4 A;  1SYG A;  4LF8 Q;  2F4V L;  1F2L A;  3HKZ E;  4A3D G;  3EJI A;  2RSO A;  4IUU A;  3U4V A;  2QW7 A;  5C4H A;  1A2T A;  4RFB A;  4YHH Q;  4CBV A;  2GN5 A;  3OMC A;  1Y69 U;  2AWO A;  3OIP A;  4HR7 B;  3TEH B;  3UDF A;  3J81 c;  4C3H B;  2YTX A;  1PH6 A;  4NP5 A;  4IZ8 A;  3OW2 A;  4A3D H;  1WTV A;  1SNM A;  1S5B D;  4WJ4 A;  1MI2 A;  4KN4 C;  1V43 A;  1TWC B;  2K5W A;  4GOP B;  2OTJ A;  1UEA B;  2OT2 A;  3JAM L;  4YY3 Q;  3J81 i;  5AJ3 Q;  1HCZ A;  1YBY A;  2F0E A;  3KLS X;  1NNX A;  4CDD C;  2VL6 A;  5FLX c;  5EGT A;  4QL5 A;  2Z6K C;  1U4M A;  4NKL A;  2R93 B;  3H15 A;  3J7A F;  3E0J A;  4UP9 A;  3EFX D;  3RR5 A;  3HOY B;  2H1E A;  4A3I G;  4DR4 L;  2MHV A;  1L0W A;  2VXW A;  4JOI C;  2F3V A;  1G91 A;  1GHK A;  3D8G A;  4A3F G;  3MFY A;  1I94 L;  2K04 A;  4RGM A;  2EYH A;  1IBM Q;  4DR7 L;  4UP8 A;  3HOV H;  2EY6 A;  4A3I H;  1BBU A;  3D4D A;  4XYO A;  4OIK A;  2Z8L A;  1G2T A;  5C44 G;  2R61 A;  2JXM B;  4A3F H;  4LK1 C;  5H1S E;  1RDP D;  1UAP A;  2UUA Q;  3UE1 A;  3RZD B;  4IPD A;  2KJX A;  2QGQ A;  5JJK A;  3B6Y A;  1YIT A;  4B3T Q;  2ZXR A;  4YCW A;  2PZU A;  5C44 H;  1Q1B A;  3G6E A;  3HKZ G;  2F0N A;  1C0A A;  4KLK A;  4A3M G;  4DV5 Q;  1PDQ A;  3KF6 B;  1P16 A;  4GLA C;  4UHV A;  3S2D H;  4LAA A;  1CFM A;  3SHL A;  1SMY C;  4A3M H;  3FEW X;  2HHH Q;  2WAQ E;  1CKM A;  1RF2 D;  2XRS D;  5EBC A;  3CRL C;  4XQQ A;  1JJG A;  4DNI A;  2NVT B;  3RLO A;  1BCP D;  4ABN A;  1Q81 C;  5EKI A;  3N52 A;  1SFO B;  4V0B A;  1HTL D;  4JVZ A;  1S5E D;  3PQI A;  5CV6 A;  1XTC D;  5D14 A;  4PQX A;  1C9O A;  4C3H H;  2XGT A;  4DR3 Q;  1FYC A;  1VQA A;  3K59 A;  2JP1 A;  4DV4 L;  3ONA B;  2R3Z A;  3K5O A;  1SJE D;  2A6E C;  1TWC H;  1QWY A;  4BY1 B;  4EQP A;  5C0X G;  2B2T A;  3MEH A;  1HNZ L;  1NSN S;  4JI1 Q;  2DNE A;  3TRE A;  1B53 A;  2R93 G;  1VQK A;  3M7N A;  4P75 A;  3HOY G;  2RDF A;  3GTL B;  4I7Z C;  1S4Z A;  5C0X H;  5JEA G;  4I65 A;  5FO8 B;  2JYO A;  2R93 H;  4Q5V A;  3BVZ A;  3HOY H;  1F9R A;  4B9X A;  1QVF A;  3T4A C;  5BR8 L;  1GO3 E;  5JEA H;  1VQO A;  1O7L A;  2PYK A;  1S5C D;  5JJL A;  2L0C A;  3K5L A;  1EWI A;  3J81 L;  2IT1 A;  2A1A A;  1XJV A;  1A63 A;  2RBM A;  5IYD H;  3BZC A;  1BBX C;  1NE3 A;  1U4L A;  3EBE A;  3TS0 A;  4DV6 Q;  4K2L A;  1D8L A;  3IRB A;  2DUD A;  4Y7N H;  1V9P A;  1F2M A;  1WVL A;  1X54 A;  3QOJ A;  1SNC A;  3RZD H;  1PH2 A;  2NWG A;  4P73 A;  4DV3 Q;  2QDB A;  5BN3 A;  3F1Z A;  3PF5 A;  1ET9 A;  4IAL A;  5LMN L;  4DV7 L;  4DUZ Q;  5FLX L;  1FNV A;  1J6Q A;  2R6G A;  2EYF A;  1R4P B;  4OON A;  4EVO A;  3ITP A;  1HR0 L;  1LAC A;  1PVO A;  2F0H A;  1IL2 A;  1KDB A;  2FFK B;  4LF5 Q;  5JVG 3;  1SNO A;  4A76 A;  4JBJ A;  1SLJ A;  2MJ8 A;  4LFC Q;  5M5X B;  2F0V A;  4LFB L;  2UU9 L;  1AZQ A;  3VYS A;  2NTS A;  2P5Z X;  4NXN L;  1JJ2 A;  4HJ8 A;  2F0Q A;  2IW3 A;  4H44 C;  3R93 A;  4IOA A;  2NVT H;  1D1I A;  1B8A A;  4B3M Q;  2CHB D;  3R3O A;  3A8I E;  2X6G A;  2K5H A;  4CKB A;  3T1Y Q;  4P74 A;  4E6I A;  4JW0 A;  1SFO H;  2I0Q A;  2F0I A;  2CWP A;  4BY1 G;  1QNU A;  4HJ5 A;  2Z6K A;  5C0X J;  4DAV A;  2DY7 A;  3MZ5 A;  1GUW A;  4EQN A;  3H0G B;  5A2Q E;  2G9D A;  3SK6 A;  3WWV A;  3KJO A;  4BY1 H;  1ZYR D;  1XYI A;  2D0P A;  2M9V A;  4JOI A;  3T16 A;  5JEA J;  1PYS B;  1VQ9 A;  2UUB L;  1S5D D;  2E2I B;  2WII B;  4L5S A;  1D5Z C;  1VF7 A;  3GTL H;  2ASB A;  1STY A;  2C35 B;  1FGB D;  4GOP C;  3NEN A;  2PMZ B;  4CDE C;  1VQN A;  1E2V A;  4X3S A;  5E4X A;  2H5X A;  4XT3 B;  2SNM A;  1KC8 C;  3PIO A;  1BBW A;  1H95 A;  2B8F A;  4DR6 L;  1FD7 D;  3ERO A;  4KK7 A;  2JEA I;  4X3U A;  1SEB D;  1EQV A;  3I4N B;  1TT2 A;  5CBA E;  2UUC Q;  3DXJ C;  3CCR A;  1ET6 A;  5E7N A;  4ZKB B;  1KQS A;  4B3R L;  1Z9F A;  4K0K Q;  1AN8 A;  1N34 L;  4TKO B;  5IGB A;  3NTH A;  4QQB X;  3IKJ A;  4MTK A;  2F0L A;  2NYZ D;  3VDY A;  4FXD A;  4Z9C B;  5FO9 B;  4ZLT F;  4S3S A;  3U50 C;  4A3J B;  1VQB A;  1KNE A;  3NTI A;  1B9N A;  3OWE B;  3I4L A;  1SDF A;  1NTG A;  1FR3 A;  3OTO Q;  1GM5 A;  5M5X H;  5M3F B;  1TS5 A;  3DLL A;  2F0W A;  3GV3 A;  1SE2 A;  2XN9 C;  5IYC G;  4N9P A;  1TY2 A;  1EOV A;  2N49 A;  3ZJY C;  4HJ9 A;  1SMY D;  2VY3 A;  1M90 C;  2N88 A;  2L5T A;  4X66 Q;  1F9S A;  3E3X A;  4K5X A;  1VQF A;  3TP6 A;  1M4V A;  2O5I C;  1OXT A;  2C5C A;  1AH9 A;  3TP5 A;  3C2P A;  5IYC H;  3H0G G;  3CC2 A;  4OO1 I;  3DMU A;  1GHJ A;  1YI2 A;  2LXJ A;  1A15 A;  2OEO A;  4HCE A;  2EY5 A;  2JK8 A;  1IBK Q;  3RN2 A;  2H4O A;  3H0G H;  1TKW B;  3M4Q A;  1LO5 D;  5IGF A;  3A5U A;  5IWA L;  2K5N A;  3U4Z A;  4DAY A;  2Q8R E;  1K73 C;  1A0I A;  3HFZ B;  3C46 A;  1EIY B;  2E2I H;  4ILW A;  3OPO A;  2E5L Q;  5C6A A; 
#chains in the Genus database with same CATH homology
 3ERQ A;  1HFN A;  3DHQ A;  1HPC A;  3S15 B;  4K14 A;  1E2Z A;  4FYD A;  1CK1 A;  3L3O C;  4H0L C;  3KUP A;  3VYU A;  3PO3 B;  3P1H A;  3I91 A;  2LMC B;  1ENF A;  1SYD A;  5KRU A;  1DOL A;  4A3E B;  4FNF A;  1DCZ A;  4QF4 A;  5CGK A;  1D5M C;  1OXV A;  1OXU A;  2HDM A;  5DM6 3;  4RGT A;  2NBF A;  1EEI D;  2L9H A;  1G29 1;  5CR3 A;  2F0K A;  2E74 C;  5IT9 E;  4G7H C;  3K0Y A;  5JJZ A;  4RA8 A;  3P7J A;  3VA5 A;  2F0G A;  1EY5 A;  3RMH A;  1D6E C;  3VR5 A;  1DON A;  4BBS B;  5M5W B;  1WD0 A;  4RH6 A;  4OHJ A;  1GUN A;  3NQT A;  3CHB D;  1SNP A;  1DXM A;  2F0J A;  4QB4 A;  1RCV D;  5ISR A;  2PW7 A;  2EYO A;  1IYV A;  3K5M A;  4GZY C;  2PNR C;  2FMM A;  1II3 A;  1RD9 D;  2F0T A;  1LTR D;  2X6L A;  3A54 A;  4RAU C;  4F88 A;  4BY7 B;  2NB0 A;  1U4P A;  3SDZ A;  4XQN A;  2KHS A;  1AW7 A;  1I4X A;  5I2X A;  1F2Z A;  3HP3 A;  1ENA A;  1EWH A;  2EYJ A;  4P2C B;  3VYR A;  3K57 A;  2PQE A;  3V05 A;  3MXU A;  1EIG A;  5JOB A;  1I3Q B;  4M8A A;  4F7X A;  1SYB A;  1HA6 A;  2F0O A;  1Q1E A;  5CV4 A;  1Y1W B;  1WTO A;  3J7Y W;  3MFG A;  2A68 D;  1OXX K;  3NHH A;  5EJW A;  5FKA C;  5D65 A;  5E3F A;  2JA6 B;  1IL8 A;  3T51 B;  3M7G A;  2A6H C;  2EZV A;  4IQZ A;  3GTO B;  5CV9 A;  4CJ0 B;  2J7Z A;  3J7A V;  3J80 L;  1XWE A;  4O42 A;  2BDN A;  1MBY A;  2DN8 A;  5E4W C;  1JOO A;  3AMU A;  3LWE A;  3U9O A;  5AFW A;  1CZG A;  2KUM A;  3D4R A;  1CT1 D;  1MD2 D;  1EYC A;  3HKZ B;  2IJ0 A;  2K5D A;  3FDT A;  1BXT A;  4KY7 A;  4FF1 A;  1DZ1 A;  3MWY W;  3C3L A;  2OF1 A;  2R92 B;  5CV7 A;  4R8N A;  1HXY D;  3X3M A;  1KTK A;  5M3M B;  1ZYR C;  4ZRZ A;  2XNA C;  1VMC A;  1A3U A;  2KEC A;  1PTO F;  3WOF A;  4F87 A;  4HN7 A;  2O2L D;  3KBG A;  3Q23 A;  5CYU A;  1B50 A;  3TSS A;  1IW7 C;  1PYW D;  5T1I A;  3IAY A;  1JC7 A;  2D9U A;  2NZ1 D;  2MPM A;  5NUC A;  1LT5 D;  4MIU A;  1AZP A;  1X32 A;  4KTA A;  2J0T D;  5CC4 A;  2DY8 A;  3J81 E;  1B3A A;  4C3J B;  4Y7N B;  4KJO A;  2XIW A;  2LS0 1;  1IKM A;  4J6H A;  3IFD A;  1SE4 A;  5C4X B;  1JOK A;  1KLG D;  3FMC A;  3AU7 A;  5EQ0 A;  4PNY A;  2WAQ B;  2F0F A;  1JQY D;  2EYL A;  3MAQ A;  3SVM A;  2A5H A;  4ZKC B;  4B08 A;  5FLX E;  1YNN D;  2M2L A;  3MVV A;  2B2V C;  5IOC A;  2ZXO A;  3P75 A;  1V1O A;  2EPB A;  2QF7 A;  1BOS A;  3PUV A;  1H9S B;  5DEH A;  1WTX A;  1KDC A;  2NN6 G;  5KYI A;  3RZO B;  2EVB A;  4DFA A;  2JSO A;  1SBB B;  1PZJ D;  1BQQ T;  3T53 B;  1PRT F;  2NN6 H;  3ND9 A;  2KOL A;  1QB5 D;  3NP8 A;  1B2T A;  1TS3 A;  1QIL A;  4HTH A;  4AYB B;  3EQL C;  3PIO 3;  1KAB A;  1SAP A;  2PZW A;  2D2C C;  3FVQ A;  2NVQ B;  3H91 A;  1EU4 A;  1GJX A;  2WV6 D;  4QUF A;  4EGV A;  3S1Q B;  4CJ1 B;  4BWG B;  2CW0 D;  5FOB B;  3M4O B;  5COR A;  2FMC A;  1RKN A;  1D1K A;  3NPP A;  4IUN A;  4DAP A;  1JWU D;  4U68 A;  3CKI B;  3BVM A;  4XQJ A;  4KV6 A;  4C3J G;  1EEF D;  1B44 D;  4JBW A;  1ONL A;  3QJY A;  5I4D A;  1WTR A;  4XTC S;  2A6H D;  3A55 A;  4KKS A;  3IL8 A;  2AQ1 B;  4TSS A;  1Y8N B;  1HHV A;  3DEO A;  1UNS A;  1IYU A;  1JCK B;  1LT6 D;  4WJW A;  1CQF A;  1C8C A;  5CBE E;  2ZT9 C;  1EY7 A;  2WAC A;  1V8Q A;  1B4O A;  4FP5 D;  4ZUI A;  2F3W A;  2BA0 A;  5HGT A;  3QOL A;  4G57 A;  5K5P A;  2B2W C;  1STE A;  3R2T A;  1I6V C;  2MUY A;  5EBD A;  3MXP A;  2XWB B;  4G7Z C;  5IGD A;  2QEJ C;  1A3V A;  3S1R B;  3Q22 A;  3HEJ A;  4KD4 A;  1D2B A;  1H9K A;  4CJ2 C;  3H09 A;  5DM7 3;  2SNS A;  1CHQ D;  2QKI C;  5C4J B;  1TWA B;  3NBI A;  1GUS A;  1O78 A;  4MN3 A;  4A3K B;  3TP7 A;  2RVL A;  1LTT D;  2R7Z B;  2LFN A;  3FPP A;  1OO9 B;  4FF3 A;  2K6A A;  4RCO A;  5G3L F;  3ZYY X;  2N55 A;  2IX3 A;  1IW7 D;  3IFT A;  3MC0 B;  3S2H B;  3BDL A;  3SXH A;  3C1E A;  4KJN A;  4R8I A;  1GOZ A;  1EZ8 A;  1MSH A;  3A7A B;  1CHP D;  3W3A A;  1C48 A;  2PPB C;  2A68 C;  1TS2 A;  4HED A;  2BOS A;  3RD4 A;  4RKB A;  2B2V A;  3KLS A;  3D3R A;  4K6D A;  2IL8 A;  2G9H D;  2L1B A;  3E6Z X;  5FO7 B;  3VR2 A;  1A6X A;  5IGG A;  3N6R A;  3PUX A;  4RKL A;  3KBX A;  1J8I A;  2E2D C;  1ILP A;  2LKV A;  4KHZ A;  1STH A;  1S5F D;  1J9O A;  5EPK A;  1PXU A;  1H9R A;  1JR0 D;  4IUQ A;  1LTG D;  2B2Y C;  2ENB A;  4F8M A;  2F1M A;  5KYL A;  1R4Q B;  4G7O C;  3D6W A;  3Q6S A;  3GTQ B;  2AQ3 B;  4XIG S;  2ZXP A;  3DM1 A;  3C1F A;  3ND8 A;  4K2K A;  2DNC A;  1K83 B;  3S1M B;  4BS9 A;  5TSS A;  2A69 C;  5E1F A;  2L12 A;  3Q24 A;  1SXT A;  4R9W A;  4ZYS A;  3NUC A;  3KK7 A;  3WDN A;  1PFB A;  5A2Q L;  4DGZ A;  5C3E B;  4TRD A;  3PV0 A;  3PUW A;  1XXG A;  2F0D A;  1EY9 A;  2L4N A;  2EOT A;  3S14 B;  3L9A X;  3GV6 A;  3HRZ C;  3BZD B;  1QCB D;  2EY2 A;  1U4R A;  1Y8O B;  3A8J E;  1JIC A;  2C9O A;  4ODG A;  1LV9 A;  1X3P A;  2Z1C A;  5HUR A;  2BE5 C;  2WKD A;  1QE6 A;  5JAV A;  4WRD A;  2JE6 I;  1H9M A;  3S1N B;  2HDL A;  1O7Y A;  1TII D;  4IUT A;  1JOQ A;  1WTQ A;  2JA5 B;  3Q0A A;  4NMZ A;  1BR9 A;  1I50 B;  3DWA A;  1G2S A;  2B2W A;  3F2U A;  4C2M B;  4HMJ A;  1QOH A;  1IHZ A;  1STB A;  3OMG A;  1SND A;  1U9R A;  4NDX A;  3S16 B;  4UAI A;  3DWP A;  1LT4 D;  2WP8 J;  4QCL A;  2BCO A;  2Z4I A;  1LT3 D;  3W2D A;  1I4H A;  1B9M A;  2RKS A;  4KN7 C;  3MA2 B;  1Q90 A;  3TDQ A;  1JB3 A;  1HFG A;  1YNN C;  3D4W A;  4G4K A;  3BS1 A;  4CHT B;  2ICI A;  2QCP X;  4HSP A;  2YU9 B;  2O5J C;  1EFI D;  4ZUJ A;  3M3Y B;  3GD7 A;  4RWS C;  4KY6 A;  3GTM B;  1CM9 A;  2NVX B;  3KF8 A;  4OO1 G;  4CKC A;  3T13 A;  5D3D A;  2EY1 A;  2IWH A;  1QJO A;  2JA7 B;  1ILQ A;  3H6M A;  1HUN A;  4OO1 H;  1BF4 A;  1TU2 B;  2K28 A;  4PMB A;  2K7V A;  1PTO B;  5ELD A;  3OSO A;  4QIW B;  2KA7 A;  4DF7 A;  4DNT B;  2VB2 X;  2ICE C;  4ZK9 B;  4ULL A;  1GUG A;  4H13 C;  2EYP A;  2CW0 C;  2E75 C;  4ZAI A;  3NWT A;  3PMF A;  5JPN C;  4C1N I;  1EIH A;  3K6O A;  3JAM E;  3KLR A;  2F0M A;  3GO5 A;  4YIJ A;  2A73 B;  3DEP A;  2B63 B;  2B2Y A;  5CV5 A;  3V96 A;  5KND A;  1SSO A;  1UUP A;  3I72 A;  1E2W A;  4RHS A;  2VUM B;  5IGE A;  3HS0 C;  3G6J B;  4FO2 A;  2NVY B;  3NK9 A;  5KGU A;  2EJF C;  2GA4 B;  1VMP A;  3OWF A;  1H9S A;  3G7L A;  5IT9 L;  2K32 A;  5I6W A;  1Q3L A;  1DOM A;  2MGS A;  1DM0 B;  1RHP A;  2QIL A;  1SYF A;  1PZK D;  1FNW A;  5D3I B;  1TQO A;  3VYT A;  2AQ2 B;  5KNC A;  1EL0 A;  4K6L A;  1YNJ C;  5F2D A;  2OXP A;  3QB3 A;  5LL6 S;  1Y1V B;  3K7A B;  4OGQ C;  1HQM C;  3FRP B;  1F9P A;  2A69 D;  1WCM B;  1MGS A;  4PV1 C;  1KAA A;  4UDU C;  1HUM A;  4LMQ D;  1NUC A;  2K1B A;  1PRT B;  4NW2 A;  3PO2 B;  3S17 B;  4HCS A;  1I4G A;  2XWJ B;  4IUV A;  1PTO H;  5J22 A;  4WFN 3;  4L63 B;  2X69 A;  5BN4 A;  3GTG B;  5C0X I;  5FK9 C;  3I4M B;  2MP1 A;  5G3L D;  5ELB A;  1PMR A;  3SK8 A;  1CQV A;  4IFD G;  2WKC A;  1TWF B;  2EDG A;  4ZQ3 A;  1Q12 A;  5C3W A;  2BE5 D;  3VR6 A;  1A2U A;  2PW5 A;  2HCC A;  5M5Y B;  1T5E A;  1GUT A;  4IFD H;  2SOB A;  2YYZ A;  5C3X A;  3I73 A;  1ZEQ X;  3BDC A;  4KMU C;  1EY6 A;  3MHB A;  3SK4 A;  2JEB I;  2F0P A;  5CV8 A;  2AUK A;  1PFM A;  2Z4H A;  5EKL A;  1Z7T A;  2K5Q A;  1T5X D;  5KEE A;  2EYM A;  1LTB D;  4IUR A;  3HOU B;  3HZX A;  2JA8 B;  1O80 A;  4KKT A;  1FNU A;  5COY A;  4BBR B;  1STG A;  2KCC A;  1NR2 A;  2B8G A;  2XSC A;  3TZD A;  3HG9 A;  3CQZ B;  1EY4 A;  4KY5 A;  2NTT A;  5LHY 1;  4J1M A;  5C4Z A;  1D5X C;  4QUC A;  3A7L A;  4MHE A;  4A93 B;  1I4R A;  3TME A;  4IFD J;  1ESR A;  2RQX A;  3T56 B;  4C3H G;  3NQI A;  1EU3 A;  4QMG A;  4Q0F A;  3K5N A;  1EWC A;  5EPJ A;  3SE0 A;  2PZT A;  1V1P A;  3R8B A;  2FIN B;  4DXG A;  1PTO C;  1AEX A;  2PO4 A;  1QG7 A;  2K03 A;  5LL6 X;  1OXS C;  1ENC A;  4KKU A;  2EXZ A;  4X3K A;  4XXE A;  1SNQ A;  1EYA A;  4L6T B;  3VR3 A;  5JVH 3;  1F9Q A;  2F0S A;  2K05 A;  1WTW A;  4V19 0;  2E2H B;  2XRQ D;  2I07 B;  5ELE A;  3LNN A;  2WB1 B;  2SDF A;  1AFP A;  1MSG A;  4PMC A;  4K5V A;  3BVG A;  3L7Z C;  4FF4 A;  1I6H B;  3U9S A;  4PMW A;  3I8Z A;  3LX0 A;  5J39 A;  1K8O A;  4LJZ C;  1TS4 A;  4XYQ A;  4K8I A;  1YNJ D;  2B2U C;  1BO0 A;  3HOX B;  2SEB D;  3HOW B;  2HQE A;  3TN2 A;  1LAB A;  2K01 A;  3BYY B;  3A56 A;  4XDX A;  2WIN B;  1HQR D;  2HCI A;  3GTJ B;  2E2J B;  2J4X A;  3O13 A;  1JOR A;  5CMD A;  3GQB A;  3R2I A;  5IGC A;  2KQ3 A;  3NBH A;  1A3T A;  1PRT C;  2D62 A;  2K33 A;  1BCP B;  2F4I A;  2RA4 A;  3M85 A;  3SR1 A;  4WOR A;  3A8K E;  1CI3 M;  5T1G A;  1TR5 A;  5ELF A;  2B39 A;  3CU7 A;  1GXD C;  1W6J A;  2E76 C;  1Q8I A;  4C3I B;  5IIF A;  3I70 A;  4X3T A;  3HOZ B;  1G6Z A;  3NE5 B;  2Q8I B;  4DA2 A;  4K5W A;  2RDG A;  3TP8 A;  3DUZ A;  3SEB A;  1V1P B;  5I2Y A;  2CVR A;  2L55 A;  3URY A;  1GUO A;  3MTS A;  1SYE A;  3SK5 A;  1BUV T;  4A3G B;  3BDO A;  3EA6 A;  4IN3 A;  5ELC A;  1WTP A;  2FJ2 A;  2RDH A;  2XVS A;  4JK1 C;  2HUG A;  2ID0 A;  1STA A;  4EQO A;  3GTK B;  1PFN A;  1LTA D;  5JPM C;  3X3N A;  1TVX A;  1XX8 A;  1DYQ A;  1LTI D;  1JWM D;  4ID6 A;  3FPU B;  5I6Y A;  1ROD A;  2V4D A;  3HGB A;  1L0X B;  1BNZ A;  5DAU A;  3FKI B;  1DOK A;  3QG1 A;  3OIQ A;  3H94 A;  4OL7 A;  3NTK A;  1EOT A;  3I90 A;  3GTP B;  2CQA A;  5I9O A;  1BCP F;  2O4X A;  1PLF A;  1NCV A;  3QO2 A;  2KED A;  4C3I G;  2Q8T A;  1PTO D;  3VR4 A;  1L0Y B;  1B1Z A;  2A6E D;  3OOC A;  3MXN A;  4RGN A;  3QIA A;  1VCI A;  3EVQ A;  4H7B A;  1HTP A;  1KDA A;  1W6K A;  3K58 A;  1PZI D;  1EY8 A;  2Y0S B;  1R9T B;  1SYC A;  2B2U A;  1TWH B;  4K8J A;  3V2T A;  4CGY B;  5J1Z A;  4RHR A;  1Y8P B;  4DU9 A;  4FF2 A;  4ME5 A;  2IX1 A;  4B9W A;  5A35 A;  4N9T A;  4J8Q A;  5K36 G;  5M9O A;  1BDO A;  2IPK D;  5EPL A;  2EJM A;  2IX0 A;  1SE3 A;  5C5M A;  4U67 3;  5I9P A;  1TWG B;  5KNB A;  4HMI A;  5K36 H;  2VB3 X;  1LLR D;  3BYT B;  3RUZ A;  2KVM A;  3J80 E;  4A3B B;  3DWQ A;  1H9J A;  4M1U B;  1C4Q A;  3AB9 A;  1QNK A;  1Z6H A;  4FXK C;  4C1N K;  4DK0 A;  4BA1 I;  4C56 C;  1WD1 A;  2A74 C;  1HA5 A;  1I4P A;  3PUZ A;  1ICW A;  4TQU S;  3NWS A;  3RLF A;  2NUC A;  1PRT D;  2M00 A;  3PUY A;  3D31 A;  1EZ6 A;  1CZW A;  4DN4 M;  1E0B A;  1BCP C;  3E5S A;  2BA1 A;  1EY0 A;  1IKL A;  1JE4 A;  3P20 A;  1K8M A;  1G8Z D;  1DJR D;  3LWU A;  5IOD A;  1LTS D;  5C5L A;  4IFD I;  1STN A;  1RTN A;  2L11 A;  3WOE A;  4DXF A;  5KIX A;  3OHX C;  4A3D B;  2F03 A;  3GP7 A;  5BN5 A;  4KI0 A;  1EYD A;  2KCN A;  3UI2 A;  3MXG A;  1RJT A;  1JWS D;  4IUP A;  1ESF A;  4CKE A;  3D6C A;  2RSN A;  3I3C A;  2LY7 A;  3BG3 A;  3PIP 3;  3OW7 A;  4HAE A;  4XT1 B;  1RTO A;  1ML0 D;  1I4Q A;  2EE1 A;  2AUJ D;  3NXW A;  3M4Y A;  2B2T C;  4FVM A;  2D5D A;  4HSV A;  5EKK A;  4DK1 A;  4L8J A;  2BDO A;  2EJG C;  3HOV B;  4KHV A;  1M8A A;  4A3I B;  1X3Q A;  2AWN A;  1F2Y A;  4DNR B;  2TSS A;  2PCF B;  5DNF A;  2KEE A;  1DD2 A;  3NSW A;  4A3F B;  1ZXT A;  3TZU A;  3QWN A;  1CA5 A;  1KLU D;  4FXG C;  3TBI B;  3VA7 A;  2VNU D;  4BA2 I;  1CTM A;  1NAP A;  1EQT A;  5C44 B;  1KNA A;  3S9W A;  1Z47 A;  1SJH D;  4KD3 A;  4O1N A;  1F77 A;  2NN6 I;  4RCN A;  2I46 A;  3CRK C;  1TY0 A;  2F0U A;  3S2D B;  2FHT A;  2TMP A;  1VDZ A;  4A3M B;  1AP0 A;  1NR4 A;  1CA6 A;  3H3V C;  4RGO S;  1ZKO A;  1HRJ A;  1O7Z A;  1VF5 C;  4OIJ A;  1SYG A;  1F2L A;  3EJI A;  2RSO A;  4IUU A;  5C4H A;  1A2T A;  4RFB A;  4CBV A;  3OMC A;  1Y69 U;  2AWO A;  3OIP A;  4HR7 B;  4C3H B;  4NP5 A;  4IZ8 A;  1WTV A;  1SNM A;  1S5B D;  1MI2 A;  4KN4 C;  1V43 A;  1TWC B;  2K5W A;  1UEA B;  2OT2 A;  3JAM L;  1HCZ A;  2F0E A;  3KLS X;  5EGT A;  1U4M A;  4NKL A;  2R93 B;  3J7A F;  3E0J A;  3EFX D;  3HOY B;  2H1E A;  2MHV A;  2VXW A;  2F3V A;  1G91 A;  1GHK A;  3D8G A;  3MFY A;  2K04 A;  4RGM A;  2EYH A;  2EY6 A;  3D4D A;  4XYO A;  4OIK A;  2Z8L A;  1G2T A;  2R61 A;  2JXM B;  4LK1 C;  1RDP D;  1UAP A;  3RZD B;  2KJX A;  2ZXR A;  2PZU A;  1Q1B A;  2F0N A;  1PDQ A;  4LAA A;  1CFM A;  3SHL A;  1SMY C;  3FEW X;  1RF2 D;  2XRS D;  5EBC A;  3CRL C;  4XQQ A;  2NVT B;  1BCP D;  4ABN A;  5EKI A;  3N52 A;  1SFO B;  4V0B A;  1HTL D;  1S5E D;  5CV6 A;  1XTC D;  5D14 A;  4PQX A;  1FYC A;  3K59 A;  2JP1 A;  3ONA B;  2R3Z A;  3K5O A;  1SJE D;  2A6E C;  1QWY A;  4BY1 B;  4EQP A;  5C0X G;  2B2T A;  3MEH A;  1NSN S;  2DNE A;  1B53 A;  3M7N A;  2RDF A;  3GTL B;  4I7Z C;  1S4Z A;  5C0X H;  5JEA G;  4I65 A;  5FO8 B;  2JYO A;  4Q5V A;  3BVZ A;  1F9R A;  4B9X A;  3T4A C;  5JEA H;  1O7L A;  2PYK A;  1S5C D;  2L0C A;  3K5L A;  3J81 L;  2IT1 A;  2RBM A;  1BBX C;  1U4L A;  4K2L A;  1WVL A;  1F2M A;  3QOJ A;  1SNC A;  2NWG A;  2QDB A;  5BN3 A;  1ET9 A;  4IAL A;  5FLX L;  1FNV A;  2R6G A;  2EYF A;  1R4P B;  4EVO A;  3ITP A;  1LAC A;  2F0H A;  1KDB A;  2FFK B;  5JVG 3;  1SNO A;  2MJ8 A;  5M5X B;  2F0V A;  1AZQ A;  3VYS A;  2NTS A;  2F0Q A;  2IW3 A;  4H44 C;  3R93 A;  1D1I A;  2CHB D;  3R3O A;  3A8I E;  2X6G A;  4CKB A;  4E6I A;  2F0I A;  1QNU A;  5C0X J;  4DAV A;  2DY7 A;  3MZ5 A;  1GUW A;  4EQN A;  3H0G B;  5A2Q E;  2G9D A;  3SK6 A;  1ZYR D;  1XYI A;  2M9V A;  3T16 A;  5JEA J;  1S5D D;  2E2I B;  2WII B;  1D5Z C;  1VF7 A;  1STY A;  1FGB D;  2PMZ B;  1E2V A;  4X3S A;  5E4X A;  4XT3 B;  2SNM A;  2B8F A;  1FD7 D;  3ERO A;  4KK7 A;  2JEA I;  4X3U A;  1SEB D;  1EQV A;  3I4N B;  1TT2 A;  5CBA E;  3DXJ C;  1ET6 A;  4ZKB B;  1AN8 A;  4TKO B;  5IGB A;  3NTH A;  3IKJ A;  2F0L A;  2NYZ D;  4FXD A;  4Z9C B;  5FO9 B;  4ZLT F;  4S3S A;  4A3J B;  1KNE A;  3NTI A;  1B9N A;  3I4L A;  3OWE B;  1SDF A;  1FR3 A;  5M3F B;  1TS5 A;  2F0W A;  3GV3 A;  1SE2 A;  2XN9 C;  4N9P A;  1TY2 A;  1SMY D;  2N88 A;  2L5T A;  1F9S A;  4K5X A;  3TP6 A;  1M4V A;  2O5I C;  1OXT A;  2C5C A;  3TP5 A;  3C2P A;  4OO1 I;  3DMU A;  1GHJ A;  1A15 A;  2OEO A;  4HCE A;  2EY5 A;  2H4O A;  1TKW B;  1LO5 D;  5IGF A;  4DAY A;  2Q8R E;  3C46 A;  4ILW A;  3OPO A;  5C6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...