2NN6H

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
269
structure length
250
Chain Sequence
HLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymyositis/scleroderma autoantigen 1
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transferase
total genus 38
structure length 250
sequence length 269
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nn6H01
2EJMA 2BE5D 4G7OC 2EJFC 5BN4A 1Q1EA 1Y8NB 3HGBA 1VF5C 3CRKC 2E76C 1HTPA 2O5IC 2A69D 4KI0A 3GD7A 4KN4C 4LK1C 2AUJD 2KCCA 2IT1A 5KNBA 2O5JC 2R6GA 4L8JA 4RCNA 2A6HD 2EJGC 4KKSA 3VA7A 3T56B 1Q90A 3D4RA 3SDZA 3PV0A 2EVBA 1HPCA 1TKWB 1ZKOA 3A8JE 1I6VC 2JE6I 4KKUA 1GUSA 3RLFA 2NN6G 2DN8A 3MXUA 3ND8A 4KN7C 3M85A 3I73A 4XTCS 4I7ZC 1O78A 1G291 1VDZA 1Y8PB 2YYZA 3LWUA 3NE5B 1K8OA 1K8MA 3A7AB 4BA1I 4DK1A 1IYUA 1CTMA 3QIAA 5KNCA 3VR5A 1DCZA 3EQLC 1H9SA 3H94A 3OPOA 3PUWA 3D31A 1E2WA 3P20A 3KLRA 3OW7A 1QJOA 1GHKA 5JEAG 5A35A 3PUZA 2ZT9C 3M7NA 1GUOA 4TQUS 3WDNA 3W3AA 2NN6I 1FR3A 5JEAH 1OXSC 3A8IE 3QG1A 1E2ZA 1GUTA 2D62A 2B8GA 1VF7A 4KHZA 1H9RA 3CRLC 4IFDG 1PMRA 3PUYA 2A68C 1V43A 1FYCA 3U9SA 4JK1C 5BN3A 3T51B 1CFMA 1YNNC 2F1MA 1A6XA 1H9MA 2NN6H 1IW7D 3MFYA 1H9KA 3QJYA 4PV1C 4IFDH 3I4LA 1HQMC 1EWHA 3DXJC 4H13C 2D5DA 3VR6A 2L5TA 1BDOA 1OXUA 1H9SB 4KKTA 3VR2A 2A68D 3BDOA 1Y69U 2EDGA 4OO1G 1B9MA 1DD2A 1VCIA 1ONLA 1YNJC 3VR4A 4BA2I 3FPPA 2K7VA 1IW7C 2KA7A 1Y8OB 1HCZA 4IQZA 2E74C 1OXTA 1T5EA 3ND9A 2K33A 4DNTB 1GUNA 2JXMB 2V4DA 3IKJA 4DNRB 3SE0A 5K36G 2JEBI 1E2VA 3LNNA 4JBWA 4GZYC 2D2CC 2BA1A 3VR3A 2PPBC 4H44C 4KMUC 4G7HC 2Q8IB 1DXMA 3TZUA 1OXVA 5BN5A 5C0XG 3N6RA 2AUKA 3AB9A 2A6EC 3GQBA 4OGQC 4HR7B 5K36H 1GJXA 2B8FA 3A8KE 2K32A 2JEAI 1OXXK 1TU2B 2BA0A 1Q12A 3FMCA 1Z7TA 4LJZC 2DNCA 5KNDA 4DK0A 2E75C 1GHJA 3IFTA 1CI3M 1B9NA 2CW0C 4G7ZC 1ZYRC 5C0XH 1H9JA 1Z6HA 2BE5C 2DNEA 3M4YA 1LACA 4TKOB 1IYVA 2QF7A 3PUXA 1LABA 2A6ED 4XIGS 2A69C 1O7LA 3BG3A 4H0LC 1Q1BA 1V8QA 3L7ZC 2PCFB 3T53B 4OO1H 3A7LA 2A6HC 3OOCA 1SMYC 2PNRC 2BDOA 1GUGA 3PUVA 3I72A 2LMCB 2AWOA
chains in the Genus database with same CATH superfamily
3TZDA 4LNQA 1FGUA 2Z8LA 2F3VA 4QUCA 1VQGA 1S5BD 5T1GA 3U4VA 4M8AA 5KNBA 1TWFB 1HR0Q 1XNRL 1NSNS 1A2TA 1TWCB 4APVA 1YEZA 1V1PB 2B2UA 1S72A 1VQDA 3D6WA 2MGSA 1SYGA 2NN6G 1HZCA 3ND8A 1A2UA 4PMWA 3SVMA 2B2VC 4ODGA 1JB3A 3OTOQ 2B29A 3VYSA 3L9AX 1XTCD 1JCKB 3S1NB 5FO7B 2K04A 3Q23A 3ERQA 2HHHL 4GKKQ 1WTOA 3GTPH 2L1BA 2KVMA 4OWTB 4EQNA 1NUCA 3UI2A 1PRTC 3K7AB 2PQEA 1HQRD 4NMZA 5IT9c 5JEAJ 1VF7A 2KEDA 4NPSA 2HCCA 1SR3A 3HOVB 1XPUA 1CZGA 2XVSA 3KLWA 2L0CA 1AZPA 1UAPA 3NP8A 4H13C 1BBWA 2NVXH 2L5TA 1BDOA 1OXUA 3AU7A 1LT5D 1IL8A 1E1TA 4FP5D 2J4XA 3E0EA 3KF6A 4QMGA 4UP9A 2XWBB 4IPDA 1BCPB 4FYDA 3HOXG 4X65L 1IZ6A 5KIXA 2EYFA 1Y8OB 3D8GA 2JXMB 3HOXH 3LNNA 1WCMG 3GTGB 1STEA 4GZYC 5FOBB 2RCFA 3GTQH 3R3OA 2UUBQ 3VR3A 1Q82C 1SYFA 5FLMG 1VQEA 2A73B 2XRSD 1Q8KA 4DV4Q 4G7HC 3CCUA 2R93G 5BN5A 5C0XG 1HUNA 3KBGA 4DAPA 2K32A 3K5OA 1ASZA 2XRQD 1K8AC 5M5WH 5C0XH 1GM5A 3MXPA 3OIQA 3E9HA 4DAYB 1KIXA 1I50H 2F0SA 4ZKCB 3K58A 3RD4A 1LUZA 3D4WA 2ICIA 1YHQA 2PNRC 2OWOA 5I9OA 1GKHA 1STYA 5LMNW 1F2MA 2B2YC 4KN4C 2F0HA 3BZCA 3NQTA 2HD3A 1SNQA 1JJCB 2WKCA 2EVBA 1HPCA 1TKWB 2JK8A 3A54A 3DWPA 1QZHA 4RWSC 4IO9A 1F2YA 2QW7A 4BS9A 4JOIC 4XTCS 3CMAA 2OTJA 3DUZA 2RQXA 1JE4A 2NTTA 3QO2A 2CQOA 2ES2A 5IGCA 3S14B 1IHZA 4JV5L 3MC0B 1FNWA 3G6EA 1WOCA 5I2YA 4GNXC 4CKCA 2DJFC 1ZEQX 2FINB 4PZ7A 4KTAA 1X54A 4NDXA 4CKBA 1SDFA 3HKZB 3A8IE 4ZCKA 1H9RA 1YBYA 4EQOA 2RBMA 1K0RA 3K7AH 3JAME 3GTOH 3SK8A 2CHBD 1PH7A 4JVZA 3P7JA 1E3PA 1EZ6A 3X3NA 3J7YW 1H9KA 2SDFA 3TMEA 4R8NA 3MXNB 1G6PA 3H15A 2A1AA 3I4NB 4ULLA 4K8IA 5ISRA 1X3EA 1WJJA 1PV4A 1U4PA 1Q3LA 1D7QA 1IBMQ 4LUOA 4LMQD 4BA2I 3HKZE 3TDQA 3K0YA 4F87A 3UDGA 3HFZB 4HCSA 4JI4Q 2V4DA 3EROA 1YJWA 4M1UB 1AZQA 1XXGA 1S5DD 2EXZA 4X64L 3S1MH 1IBKL 2EYJA 2F0WA 5DEHA 1X3GA 5C0XI 3S16B 3CD6A 5LL6S 2VQFL 3EVQA 3S15H 1D5ZC 2AUKA 3PIO3 1V9PA 3GTJH 2KENA 2JA6B 1TU2B 1Y1VH 4DGZA 2H5XA 2CW0C 4CKEA 3S1QB 1OTCA 4WJ4A 1JQYD 3NTHA 4DV6L 1O7LA 4EQPA 4DV2L 4PMBA 4FF4A 3TP8A 5CORA 3S2DH 1B3QA 4UP7A 1ZYRD 1ESRA 1MHWC 3A55A 2EJFC 5BN4A 5C6AA 4B9XA 1JJ2A 1STNA 3H09A 3MTSA 1PTOF 4J6HA 1DOKA 4L5QA 4PZ8A 4B3TQ 3ULLA 3CW2C 4JBMA 1NR2A 4L8JA 2EJGC 4HIMA 4A3IH 5DM73 1FGBD 4KKUA 2Z6BA 4JI8Q 2O2LD 2XN9C 3RLNA 2IW3A 1BR9A 2R61A 3FDTA 4E6IA 4L5RC 1LM0A 2B2WA 1E2WA 3G48A 1G2TA 2MUYA 5C3EB 4IFDJ 3N52A 2K50A 4A75A 1WTWA 3CC7A 4B3RL 1K3RA 5FJ8H 1EQRA 2EIFA 3GO5A 4MTKA 3NEMA 2MNAA 1D1IA 3CPWA 3TP5A 2E2HB 2IHFA 5C44B 1PFBA 4WJ3M 3PUZA 5HGTA 4HCEA 2JA8B 4ID6A 3HKZG 4GNXB 3EN2A 2GVAA 4K5WA 1V43A 2X6GA 5T1IA 2LXKA 5LMUQ 2F3WA 1PTOC 1HNWQ 4K6DA 2D0PA 3C1FA 3GP7A 2A68D 1Y69U 3I4NG 1VCIA 2B2UC 3HEJA 3TS0A 2WAQB 3OSOA 5HY6A 2I46A 3I4OA 2GN5A 3AFPA 3H6MA 2ZTEA 4NXNQ 2E74C 3I4NH 1FNVA 2KQ3A 4A3FG 5K36G 4DR4L 1VQLA 4NXMQ 1VQJA 3MZ5A 4C3IB 4TSSA 3HG9A 1ASYA 3LWEA 4LFAL 1AN8A 4BBSB 1K8GA 1B4OA 1OXVA 4A3FH 5K36H 5M5YB 5JJZA 1K83H 4RHRA 1VMCA 4CJ1B 3PO2B 4A3EG 2IPKD 3W1BA 2WAQE 3TREA 3T1YQ 2XSCA 3HOUB 3TQYA 2A6ED 1VQAA 3T53B 1MD2D 4A3EH 2FHTA 4JW0A 3M4QA 2BCOA 2CH4A 4YHHL 3S1QH 1SMYC 5GADC 2CKZB 1NBWA 2RA4A 1R4QB 1WTVA 1GOZA 3NQIA 3L2PA 4LF9L 2JA9A 1Q1EA 4XDXA 2A69D 2DY8A 4KLKA 1NAPA 4I65A 4BY1B 2KECA 1HA6A 1I4QA 3UDIA 2Y0SB 4MHEA 1PFNA 1KHIA 5EQ0A 1SE4A 3LGJA 4OX9L 3HS0C 3MXUA 3M85A 4LF6L 4R8IA 4FXGC 4JI1Q 2IL8A 2EYMA 1E7ZA 1U5KA 5EBDA 1WD1A 1RIPA 1MSGA 1JC7A 3MXNA 2IWHA 5I2XA 1N34L 1HRJA 2RCNA 1C0AA 3A56A 2NYZD 1JE5A 3J7AV 3OW7A 1KRSA 1S5FD 1GHKA 2EYHA 3PMFA 5CR3A 4PNYA 4BXXG 5E4XA 5C44G 2Q8TA 2UXCL 2Y0SE 4BBRB 2K5HA 2MO0A 4XT3B 3W3AA 1STGA 1K3BC 2JA8G 3GTLB 4OXPA 2EY2A 3ULJA 1HZ9A 2VS1A 5C4XH 2E2HH 4CHTB 3PUYA 4BXXH 4JK1C 2JA8H 2QCPX 3QOLA 1SMXA 1KD1C 2F1MA 3CAMA 5EPJA 2K28A 1LO5D 1STBA 4DR5L 1TWGH 4HSVA 2WINB 4RGNA 3CCEA 1SYBA 2KHSA 1TS4A 2HUGA 4QF4A 3C46A 2K14A 2ZXOA 4K8JA 5ELBA 1VQKA 1ONLA 1YNND 1PTOB 2C9OA 2WAQG 2VUMH 4HJ9A 3FKIG 2KA7A 2NB0A 4HJAA 1MJEA 1DJRD 2FMMA 4DNTB 3RZDB 5FO9B 3K5MA 2VZAA 4B9WA 3FKIH 1RCVD 4C3IG 2QKIC 4H44C 4BBSG 2J0TD 1RL2A 1GJXA 4JYAL 1EY7A 3Q8DA 4C3IH 3PO2G 5M5YH 1Z6HA 5G3LF 4QQBX 1I6HB 4KJOA 1G91A 3HOUG 4XIGS 3PO2H 4K6LA 2EXDA 1EIGA 2UUAL 4FVMA 2I07B 2A6HC 1DOLA 4OIKA 4LWCA 4X65Q 4HIOA 3HOUH 1CK1A 3HGBA 4OWXB 4YCUA 2N3SA 4L5SA 4GNXA 1STHA 4BY1G 1P16A 1Q90A 1F2LA 2Y0SG 4R4CA 3MAQA 2JE6I 3I2ZA 1I4GA 1GUSA 3NWSA 3I73A 3I55A 3MHBA 2WACA 3NE5B 3A7AB 1PRTD 1CTMA 3LX0A 5IGDA 1PH3A 1BOSA 3KLRA 4QIWB 3PO3H 4JI6L 4C3HB 4POFA 1BCPF 2N88A 3OIPA 4C1NI 5KRUA 2HT1A 5C3XA 1QUQB 1Q81C 2B63B 1LTAD 1GD7A 1J5EL 1HTLD 3WDNA 4BBRG 1MSHA 4KV6A 4QGUA 2SEBD 4CDCC 3H3VC 1HH2P 2D62A 4A3JH 3TP6A 5CBEE 4A93B 4RA8A 1O7YA 2EY5A 3T16A 4BBRH 1I94Q 4IUNA 3T51B 1XNQL 2PI2A 1S5CD 4QIWE 3EBEA 1KTKA 4YCVA 3IRBA 1TT2A 1KDCA 3VR4A 4JV5Q 4JI3Q 3SR1A 4IQZA 3W5OA 2E5LQ 1G8ZD 2UU9L 3CC4A 2D2CC 5D3IB 3M4OB 2K52A 2B2WC 3EFXD 1CA5A 4DV7L 1JOKA 3DM3A 1BCPC 1NE3A 1BBXC 1BNZA 1SEBD 4R4QA 4A3KB 3A8KE 1N9WA 3CQZH 3NPPA 1Z7TA 3VYTA 3P1HA 4WFN3 1CI3M 5E3FA 1K0SA 3KYHC 2F0IA 1BXTA 3U58A 3I70A 4DV1L 2JP1A 1SSOA 2HDLA 1G51A 1CA6A 4X6AH 1SJED 1KAAA 2XGTA 3GV6A 5IE8A 3FP9A 4A76A 3HOZH 2ALYB 1EFID 2AQ1B 2RDHA 3KLSA 5CV6A 2ZTDA 4DXGA 1XMQL 1U0LA 3A5ZB 2A19A 1S5ED 1E22A 4K2KA 4UAIA 2JYOA 5C4ZA 1WD0A 1I4HA 5LHY1 4QCLA 1PHJA 1P8LA 1IBKQ 1B2TA 4K14A 2F0EA 1AE2A 3KK7A 2TMPA 5M3FB 3A8JE 1L2FA 2VQFQ 1TS5A 4DR3L 1V1QA 4CJ2C 1N36Q 4RHSA 3ER0A 4DPGA 3U4ZA 4A3MB 4GN3B 4B3MQ 2YU9H 3HOWB 1TXYA 1X56A 2YYZA 1PFMA 3OWFA 5KNCA 3TP7A 1IKLA 3EQLC 1I3QH 5C5MA 1LV9A 1L0XB 3BYYB 1ET6A 5J22A 1EYDA 2XNAC 5CV5A 4V190 4JI0L 4DV6Q 5JEAG 5AFWA 5LL6X 4DFAA 3Q24A 5IP7G 5DM63 4A3GB 1NMFA 2M00A 5JEAH 3VA5A 1EIYB 1BO0A 4K2LA 4R4TA 1F9RA 1GUTA 1JOOA 1A3TA 2VL6A 1LT3D 5IP7H 4A3BG 4A93G 1S40A 1TVXA 2HIVA 1HZBA 2NN6H 3SEBA 3MFYA 4WJWA 2K5QA 3AMUA 4A3BH 4RKLA 2E2JB 3U9OA 3SXHA 4CGYB 5C4JB 3BDOA 1O7ZA 4YWKA 3VDYA 4DR7L 4JI5L 3E6ZX 3R8BA 2K7VA 5J1ZA 1AEXA 3D0FA 1IKMA 1T5EA 4N9TA 3VYUA 3S1RB 2VQEL 3JC66 5L37A 2SNMA 2JN4A 1VQMA 2L11A 4ZYSA 4DN4M 4R1JA 1EEID 4ALPA 4A3KG 4Y7NB 4K0KQ 3FMCA 1ICWA 4DK6C 4LF4L 1YHBA 5IODA 4AQYL 1PH5A 4MIUA 2LY7A 3UE0A 2RHQB 3K8AA 1EY8A 3J80E 2F4VL 1LTSD 3G6JB 3OMGA 1PYWD 3CP0A 3WWVA 4ABNA 2OCEA 3BJUA 2Z6KA 2PO4A 2CWPA 3JAML 1QUQA 4DR2Q 3OMCA 1WCMH 3GD7A 4C3JB 2AUJD 4DR4Q 2R6GA 2SOBA 5FLMH 2UXBQ 2JA5B 4DV0L 3SDZA 3X3MA 2R93H 5M3FG 1VQHA 2K6AA 4ME3A 3HOWG 2F0DA 3QOJA 1Y8PB 1E0BA 3VR5A 3E5SA 3SHLA 4OIJA 3P20A 3HOWH 1VS0A 1JICA 2OQ0A 4KD4A 2MP1A 4Q0FA 4LFBL 4YHHQ 3OHXC 2C5CA 2FXQA 4YWMA 4ZUJA 4Q5VA 2NN6I 4A3GG 2CCZA 4LF9Q 1E2ZA 1MKHA 1TWFH 1QWYA 5IGGA 3NK9A 1EIFA 1TWCH 1DYQA 4A3GH 4NP5A 3NXWA 1KRTA 1PZID 2R7DA 2RF4A 4LF7L 3BU2A 3VYRA 1ENAA 4PG3A 2EZVA 1HUMA 2ASBA 1SE8A 1GVPA 2PZWA 4DK3C 2Z4IA 4GN4B 1BQQT 1QVCA 5M9OA 3H3VH 1B53A 1N34Q 3S1NH 2RVLA 1PYSB 5C0XJ 5EBCA 1F9SA 3KOJA 1BVSA 2E2JH 2CFMA 2ZXPA 2JEBI 4GKJQ 3HOVG 1PH8A 4RGTA 1EQTA 1Q7YC 3BZDB 3W1GA 3N6RA 3S1RH 4OGQC 3CPFA 3HOVH 2HQLA 5EPKA 5KNDA 4LJZC 3KBXA 1CZWA 3W2DA 1RD9D 1C9OA 2F0UA 3CCSA 2WB1B 5DAUA 1X3QA 1JR0D 4H0LC 3L7ZC 1F2ZA 4H7BA 4J8QA 3BYTB 3RLOA 1JWSD 3PUVA 1PH2A 2NVTB 2BE5D 3V05A 4AIMA 4HJ7A 1Y8NB 3H0GB 3CRKC 5ELEA 3BZKA 3GTGH 3KDFB 4C3JG 2R7ZB 1C4QA 3CXCA 1S4ZA 2F0KA 2JA5G 5AJ3L 2UUCL 1W3SA 4CDFC 1VQNA 1I6VC 2IJ0A 1HHVA 4C3JH 2CQAA 4L63B 5KYLA 1KL9A 1O78A 1ET9A 1TWHB 1X3PA 1XPRA 1N33L 2K5VA 5EGTA 3QIAA 2JSOA 4HMIA 3I3CA 1CT1D 2IX1A 4NKLA 3DEOA 5KEEA 1CUKA 1KNEA 5IWAL 2UUAQ 1QVGA 1NR4A 2ZT9C 5NUCA 3RUZA 3M7GA 1X55A 5CGKA 1DONA 1U4MA 2F0PA 3JAMi 4OEMB 1HR0L 1E1OA 2F4IA 2XTIA 2A5HA 3KUPA 1QB5D 5IGBA 2JA7B 1A0IA 3H3VI 1KAWA 1WTPA 1A6XA 2OQKA 4DR1Q 2VXWA 1WI5A 2BOSA 2XWJB 2VY3A 3S14H 4DUZL 4OO1G 3U50C 2G5DA 4XQNA 4OHJA 1SXTA 3G71A 3J81E 4HTHA 4GKKL 4YIJA 4HIKA 4F88A 2K33A 4HJ5A 3URYA 1II3A 1R4PB 5GAEC 1PVOA 4P73A 4IPGA 4O42A 4LFCL 3GQBA 1N32L 1XPOA 3EA6A 4RH6A 2RDFA 4DAMA 4GLXA 3Q6SA 1NTGA 1QILA 3M4YA 3JAMc 2LXJA 1QG7A 2MPMA 3PUXA 4O1NA 1RTNA 4P72A 2F3IA 5IGEA 2RKSA 3R93A 1NNXA 4BWGB 2V1CC 3NHHA 4DV5L 1CKNA 2FMCA 4DV3L 4MNOA 4DAVA 2JA6G 2ICEC 2YTVA 2R7ZG 4DUYL 3GDEA 3S16H 1SJHD 5IYDG 4DV4L 1NCVA 3HRZC 2Q2TA 3CCVA 2E2IB 3HP3A 3K59A 3DEPA 2JA6H 1RF2D 3AYHB 5GAHC 2FFKB 2ZM6Q 1RODA 5G3LD 4CBVA 4P2CB 1R9TB 1IYUA 5GAGC 2I0QA 3DWAA 3D31A 4LF5L 1EOTA 1VQFA 4N8X1 1K28A 4HMJA 5E4WC 1YI2A 3M9BA 3EJIA 2ZTCA 1IXRA 5EKKA 1PYBA 4B3SL 1SFOB 1I4XA 2F0OA 2PI2E 4UHVA 3FHWA 4JI2L 4LAAA 3NBIA 4XQQA 1XMOL 3GTKB 4MN3A 2Z6KC 2ID0A 3DM1A 5I6WA 1EY0A 2F0LA 4X3SA 1J6QA 4PV1C 4POGA 5E1FA 5C3EG 4DR3Q 3CU7A 4OO1I 1GUWA 1JJGA 5CV4A 2UXDQ 1L1OB 1EUJA 3C3LA 5FK9C 3QWNA 1MJCA 2KJXA 3T1HQ 1BCPD 5C3EH 1DM0B 3BVGA 5HURA 1CQVA 1XTDA 4LUZA 4FXDA 1HCZA 2AQ3B 1JWMD 3I4MB 3RZOB 3I90A 5C44H 3TSSA 4N9PA 1LTBD 1XNRQ 2BA1A 2RSNA 4IOCA 4CDDC 3KDFA 5IYCG 2KHJA 2K75A 3CCLA 1UUPA 3BDCA 2B8FA 1YNXA 5A2QE 3I56A 4XYOA 3A5UA 2E75C 1B9NA 1SROA 4OL7A 1ZYRC 1PH6A 3RNUA 4UPAA 5M5XB 3E3XA 4ZUIA 1V8QA 2HHHQ 2NUCA 1UEAB 1HNZL 2GA4B 1IBML 3OOCA 3RN2A 4DR7Q 1C48A 2PW7A 1EWCA 1C7YA 1TS3A 1B3AA 1VF5C 2ZXRA 1MGSA 2L4NA 1LTGD 4FF2A 1A15A 2RHSB 4KKSA 1STAA 4BBSH 2F0MA 5I6YA 1X32A 1ZKOA 2QDLA 2PMZB 4TRDA 4BY7B 3ITPA 1VQCA 4AQYQ 2QGQA 3H94A 1W2BA 4C56C 4FF3A 2WIIB 2F4VQ 5GROA 4RG1A 5EJWA 3P75A 1PFSA 3GTMB 4A3DB 1FNUA 1RTOA 1JWUD 1DOMA 3OW2A 1FR3A 3EIVA 2R92B 3PQIA 1VQ7A 3B6YA 4B3TL 2LSSA 3AQQA 1SFOH 4BY1H 2A68C 2PNHA 1FYCA 1RJTA 4U673 2Q2IA 1CKOA 1D5MC 5JJLA 4DV0Q 4X3KA 1ZXTA 1EOVA 3QJYA 1UE6A 1EWHA 1KLUD 2GVBA 3VR6A 5DLQE 2B39A 1EYAA 5FLXE 3HOYB 1QE6A 2L9HA 2K5DA 5E7NA 1YNJC 1RKNA 4MTNA 3DWQA 3HZXA 1IW7C 2XIWA 3I4MG 2F0VA 3RN5A 3IKJA 2YTYA 4FF1A 2AMCB 2BH8A 1WTHA 3GTLH 4IUPA 2Q8IB 1DXMA 4KHVA 1WYDA 2ZJRA 3O13A 2A6EC 1D8LA 1SAPA 1NMGA 4IUUA 2HCIA 3D4DA 3F2BA 1U9RA 5LMUL 1KXLA 3IFTA 4QJFA 5LMNL 2OXPA 1HNWL 2RSOA 3S2HB 3Q22A 2QF7A 3PIPA 2A69C 2IHEA 3CHBD 2X6LA 3D6CA 3GTPB 1SBBB 2L15A 2L55A 1PTOH 2CVRA 1BKBA 5IT9E 1GUGA 1BBUA 1ML0D 2NWGA 2G9DA 4ME5A 3RZDH 3KFUA 4G7OC 3K57A 4DXFA 1MI2A 4AH6A 1M4VA 2O5JC 3K81C 2LFNA 4A4IA 1L0YB 3IL8A 4K5XA 4RMFA 2Q8RE 2DN8A 2SNSA 1BUVT 3NENA 4BY7G 1X65A 2NVXB 2BH2A 2PQAA 3STBC 5JJKA 4ZK9B 1DCZA 4YCWA 1I6HH 2X69A 1L1OA 5KYIA 1QJOA 1X6OA 1D6EC 4DR6L 5A35A 2A74C 3HOXB 5CV7A 4X64Q 5COYA 3K7UC 2HQEA 4NB3A 2WP8J 4KJNA 3GTQB 2PYKA 4GLAC 5H1SE 3NWTA 3R2TA 2B8GA 3CRLC 3OYYA 5I9PA 1SNPA 1XYIA 3J80L 1CFMA 5M5WB 1YNNC 3FPUB 3NELA 5AJ3Q 2UUCQ 4JCVE 2CWAA 4ZKBB 1FJGL 4S3SA 2D5DA 3C1EA 2JQOA 3FEWX 1AE3A 3HOYG 4C3HG 4A3LG 4DV2Q 3KF8B 5JVG3 3MXGA 4QL5A 1DD2A 1VQOA 1LTID 4U68A 3L3OC 2B63G 2K01A 3HOYH 4C3HH 3ZJYC 1QCBD 5FKAC 1E2VA 2B63H 5IWAQ 5JJIA 2AHOB 3BVZA 4DA2A 3TZUA 4RKBA 1EZ8A 3A0JA 3AB9A 4C2MB 2MHVA 4A93H 4HR7B 2JEAI 1CHQD 2Z4HA 1EYCA 3ONAB 5ELCA 1IBLL 1LLRD 1OO9B 4TKOB 5D3DA 1ENFA 4O2DA 2PCFB 3A7LA 1PA6A 4B3RQ 3S2HH 5FO8B 4J1MA 2FJ2A 3PIP3 4DUZQ 1PLFA 2CW0D 1FD7D 4AYBB 2IX0A 1EEFD 4CDEC 2K05A 2EJMA 5JPMC 4X62L 2VB3X 4LF8L 1EU4A 4YY3L 3UE1A 2O5IC 3H91A 3M4OH 2KCCA 3V2TA 2P5ZX 4RCNA 1WVLA 4FXKC 1E24A 2OEOA 3GTOB 5ELDA 3PV0A 5EAYA 3BVMA 4JC0A 3G4SA 4OELB 1SYDA 1VMPA 4A3KH 4LFCQ 1ENCA 2NVQB 2PZTA 4KK7A 2E8GA 1N32Q 4H02A 2I5HA 4DNIA 3S17B 3TBIB 4EVOA 1VQ6A 4AYBE 3PUWA 5C5LA 2Z9HA 1K9MC 4IPHA 2YV5A 1SNDA 3K5LA 1KQSA 1YJ9A 1B8AA 1WTRA 2Q2UA 3DMUA 3T13A 1EY5A 3M7NA 1F9QA 3S1MB 2I5MX 4JI7L 2D9UA 4LFAQ 4N8FA 3S15B 3F8TA 4DV5Q 3UDFA 4A3MG 3GTJB 1GO3E 3PIOA 4DV3Q 1Y1VB 4DUYQ 5M3FH 1Y1WB 1H9MA 1U4LA 4O0AA 4EGVA 3BS1A 4A3MH 1QZGA 1HJPA 4I7AA 2N49A 1MBYA 1HXYD 4UP8A 1N8RC 5IP9G 1YIJA 4HIDA 4ZAIA 3S2DB 1NJIC 4KHPL 1Z9FA 1PTOD 4QB4A 1CKNB 4LF5Q 1KABA 2F0NA 1D5XC 1OXTA 5IP9H 4OONA 1ILPA 1YVCA 2MQHA 4JBWA 3CKIB 5M3MB 3F2CA 4B3SQ 1VQBA 1CHPD 1KLGD 4A3IB 3TEHB 1EQQA 1A62A 4JI2Q 3T4AC 1LT4D 5IGFA 2DUDA 4OX9Q 1SNMA 1XJVA 1I94L 2BA0A 1CM9A 2E2DC 1XMOQ 1KC8C 2D0OA 2DNCA 4X66L 4LF6Q 4DK0A 2NBFA 4G7ZC 4FDBA 4C2MH 3J80i 5IOCA 1H9JA 1T9HA 1TR5A 4XQJA 3F1ZA 4FO2A 5C4JH 1M8AA 1Q1BA 5ELFA 4OWWB 4JI3L 4GOPA 1I4RA 4AYBG 4RCOA 2UXCQ 1EIHA 2R7FA 5D65A 2E5LL 4IURA 2B2TC 1HTPA 4B08A 5ELOA 4GN5A 1SMYD 3L0OA 1U4RA 5BR8L 4DR5Q 1I5FA 1HNXL 4Y7NH 4KN7C 3J81L 4KY7A 1ILQA 1PRTB 1ESFA 1K8OA 1KDBA 1S3OA 2QA4A 4JPBW 3KF8A 2NVQH 4X3TA 2QDBA 1TS2A 5IYBG 1M1KC 1A63A 3S17H 3J80c 2M9VA 2WFWA 1HNZQ 2L12A 2QEXA 3J7AF 5IYBH 4LUVA 4IN3A 4DU9A 2WB1E 1PDQA 1SRUA 1LTLA 3SK4A 4A3FB 4IFDG 2H4OA 2EYPA 1K83B 2JA5H 4JYAQ 5BN3A 1Y1VG 1YITA 1SE2A 2K4KA 4CJ0B 4P71A 1Y1WG 1B70B 1N36L 4B3ML 3WOFA 4IFDH 3I4LA 1UNSA 2F0FA 2NTSA 1V1PA 1X9NA 2NZHA 1PH1A 1Y14B 2KHIA 1H9SB 3AEVA 4A3EB 2M2LA 1Y1WH 1W6JA 1V1OA 3F2DA 1HZAA 3WOEA 3CMEA 5TSSA 1QNKA 4P74A 5CMDA 1F77A 1O80A 3KJOA 2F0TA 4P75A 5M3MG 3IAYA 1JT8A 1L1OC 4TVAB 4A3CG 2B3GA 3ERSX 4A3IG 4KMUC 2VNUD 3M3YB 2R3ZA 5M3MH 3K80C 1HFGA 2TSSA 1Q12A 4A3CH 1K73C 4WRDA 3OTOL 1YJNA 3NBHB 2KOLA 2DNEA 4IJLA 4EQ5A 1LACA 1IYVA 3DLLA 4OO1H 4JI6Q 5FJ8G 5EKIA 1UEBA 1RDPD 2WV6D 1TQOA 3FRPB 1J5EQ 1UE5A 4HAEA 2E76C 4LK1C 5C4XB 2F03A 2MFIA 5JPNC 2NZ1D 2A6HD 1SNCA 4ZLTF 3TS2A 1XNQQ 1TWGB 2WB1G 4K0KL 4I7ZC 1G291 3LWUA 4BA1I 3R2IA 4DK1A 5LMNQ 1O7IA 1G6ZA 1FL0A 1AH9A 2NVYB 2VUMB 2F52A 2CH4W 3SGIA 1I4PA 3H0GG 4IPCA 4C1NK 3I8ZA 3NTKA 4RFBA 4DAYA 2AQ2B 4HSPA 2UUBL 2UU9Q 2NVTH 3FKIB 3MVVA 5A2QL 4DV7Q 2KUMA 1PH9A 3K6OA 4DR2L 3H0GH 4IFDI 3QG1A 1PZJD 1Q8IA 1SYEA 2R7ZH 1PMRA 1SYCA 3SK5A 5JOBA 2UXBL 5IYDH 1YNJD 2IY5B 4V0BA 1VQ4A 1IW7D 1VQ8A 2LS01 4NW2A 4DV1Q 3CCMA 1TY0A 3E0JA 2QILA 1UWVA 4LW1A 1TWHH 4KKTA 1TWAB 2C35B 4R4IA 4ZRZA 3J81i 4RGMA 1UE7A 2OTLA 2AWNA 1BF4A 1A3UA 2K5NA 2KCNA 3FPPA 3C2PA 1VQPA 2Z0SA 5CV8A 4JBKA 2DGYA 3PCOB 5JVH3 3ND9A 4PZ6A 1XMQQ 2HDMA 3V96A 4DNRB 3SE0A 3PF4A 4DR6Q 1AP0A 4UDUC 1EY6A 3MEHA 3CCRA 2PPBC 2JA7G 2B2VA 1WTXA 1CQFA 3BDLA 2PQAB 3OWEB 3TRZA 1B44D 4KY5A 4L6TB 2JA7H 1EQVA 4JG2A 3QB3A 4Z9CB 3M3YH 3F2UA 2H1EA 5HGQA 2BE5C 4J15A 1FJGQ 2KBNA 3IFDA 2HIXA 2AKWB 4MZ9A 3S24A 3D3RA 3PO3B 4JI0Q 1WFQA 5CC4A 2K1BA 3AFQA 4R4OA 4Y52H 2BDOA 5IY0A 3I72A 2LMCB 2AWOA 2EYLA 4IUQA 4XT1B 1D1KA 1EY9A 1YHAA 2N8NA 3PGZA 3PSIA 3J81c 2F0JA 1CSPA 4A3JB 4GKJL 3MA2B 3STBD 5EKLA 3ULPA 5C4XG 1QNUA 1B1ZA 3T56B 4K5VA 4IZ8A 5IYCH 2NZOA 5FLXL 4IOAA 3E9IA 1JORA 3KLSX 2MO1A 4G57A 2N55A 4PMCA 4X3UA 1NY4A 1JOQA 3A74A 3I7FA 3NSWA 4RAUC 1H9SA 4F7XA 1AFPA 1IBLQ 1LYLA 3DHQA 3MFGA 1LT6D 3CCQA 4QUFA 3CC2A 4JI5Q 2VUMG 4JI4L 3K5NA 5ELNA 1A3VA 2PW5A 1HFNA 2EY1A 1GUOA 2NVYH 2VW9A 2VQEQ 1CSQA 1KDAA 2K5WA 4X62Q 4KHZA 4LF8Q 4YY3Q 4G4KA 1SNOA 4GOPC 3U9SA 3CQZB 2ATWA 1SN8A 4PQXA 2E2IH 4LF4Q 3KJPA 3ICEA 5I4DA 1D2BA 1TY2A 2EY6A 1GXDC 2OT2A 5IT9L 3NBHA 1KNAA 3UDXA 1IYJB 1VQIA 2MJ8A 3VR2A 1R9TH 2PZUA 2B2YA 2N78A 3HOZB 1HR0W 2K03A 1HA5A 4DF7A 1SLJA 2Q2HA 1TWAH 2PMZE 1CKMA 2I5LX 1T5XD 5C3WA 4JOIA 4XXEA 1J9OA 3J7ZC 3NUCA 1PZKD 1W6KA 5EPLA 1Q86C 1UE1A 3S9WA 1PXUA 2VB2X 4JI7Q 4JI8L 3GTKH 2DY7A 1H95A 1C8CA 4UY8C 1G2SA 2YU9B 2B2TA 5J3BA 5JAVA 4JBJA 5F2DA 4DR1L 1TIID 1I3QB 2OF1A 1DGSA 2G9HD 2BDNA 3KF6B 1B50A 1LABA 2ZJPA 5IIFA 3J81j 3PO3G 4HN7A 1Z47A 4LFBQ 3RR5A 2J7ZA 4KY6A 4YWLA 3RZOH 4KHPQ 5C4HA 3I4MH 3HKSA 1L0WA 4KI0A 4KD3A 2O4XA 2EPBA 4HJ8A 4A3JG 1A8VA 2IT1A 3VA7A 4EX5A 1SE3A 3D4RA 1F9PA 2KCMA 1WTQA 3RLFA 4IJHA 4LF7Q 4A3BB 1VDZA 1EWIA 1K8MA 2QEJC 4X66Q 2EYOA 3M4PA 3OPOA 5M5XH 1EL0A 2DJGC 4NXNL 1QVFA 5GQOA 1XX8A 1DZ1A 4ZQ3A 4HEDA 4NXML 2IX3A 1IL2A 4FNFA 4TQUS 5KGUA 1J8IA 1XWEA 1X3FA 3K0XA 4GS3A 1OXSC 1YZ6A 4IUVA 4XYQA 4QY7A 1EYGA 2EOTA 1Q46A 5D14A 5CBAE 1B7YB 2JJQA 4R9WA 5DNFA 3T1YL 1LTTD 4IALA 1HQMC 5BR8Q 4BY7H 2EQSA 3DXJC 2ZM6L 3MWYW 2ZJQA 1HNXQ 1VQ9A 3GV3A 3J7A5 2KCTA 3NTIA 1EU3A 2RDGA 4L5TA 2KEEA 5CYUA 4GOPB 3PF5A 2EDGA 1B9MA 3I91A 4F8MA 4A3DG 2F0GA 2WKDA 3TN2A 3HOZG 4ILWA 3Q0AA 1AW7A 1QOHA 3SK6A 3G7LA 2R92G 3CCJA 2ENBA 4WORA 1RHPA 3GTMH 1GUNA 2LKVA 4A3DH 1EFWA 1WCMB 1ICFB 4GLVB 5J39A 5CV9A 1FVIA 3CF5A 1EY4A 1VQ5A 2R92H 4DKAC 2A8VA 2Z1CA 3FVQA 2YTXA 2R93B 3RMHA 4IUTA 4JI1L 1OXXK 1PH4A 1GHJA 1I50B 2F0QA 1N33Q 3ZYYX 5K5PA 1MIUA 1PRTF 4A3LH 2UXDL 3BG3A 3QR8A 1M90C 3MEFA 1JB7A 3T1HL 4RGOS 2EE1A 5FLXc 1JMCA 1LTRD
chains in the Genus database with same CATH topology
3TZDA 2Z8LA 2F3VA 4QUCA 5T1GA 1S5BD 4M8AA 5KNBA 1TWFB 1NSNS 1A2TA 1TWCB 1V1PB 2B2UA 3D6WA 2MGSA 1SYGA 2NN6G 3ND8A 1A2UA 4PMWA 3SVMA 2B2VC 4ODGA 1JB3A 3VYSA 3L9AX 1XTCD 1JCKB 3S1NB 5FO7B 2K04A 3Q23A 3ERQA 1WTOA 2L1BA 2KVMA 4EQNA 1NUCA 3UI2A 1PRTC 3K7AB 2PQEA 1HQRD 4NMZA 5JEAJ 1VF7A 2KEDA 2HCCA 3HOVB 1CZGA 2XVSA 2L0CA 1AZPA 1UAPA 3NP8A 4H13C 2L5TA 1BDOA 1OXUA 3AU7A 1LT5D 1IL8A 4FP5D 2J4XA 4QMGA 2XWBB 1BCPB 4FYDA 5KIXA 2EYFA 1Y8OB 3D8GA 2JXMB 3LNNA 3GTGB 1STEA 4GZYC 5FOBB 3R3OA 3VR3A 1SYFA 4G7HC 2A73B 2XRSD 5BN5A 5C0XG 1HUNA 3KBGA 4DAPA 2K32A 3K5OA 2XRQD 5C0XH 3MXPA 3OIQA 2F0SA 4ZKCB 3K58A 3RD4A 3D4WA 2ICIA 2PNRC 5I9OA 1STYA 1F2MA 2B2YC 4KN4C 2F0HA 3NQTA 1SNQA 2WKCA 2EVBA 1HPCA 1TKWB 3A54A 3DWPA 4RWSC 1F2YA 4BS9A 4XTCS 3DUZA 2RQXA 1JE4A 2NTTA 3QO2A 5IGCA 3S14B 1IHZA 3MC0B 1FNWA 5I2YA 4CKCA 1ZEQX 2FINB 4KTAA 4NDXA 4CKBA 1SDFA 3HKZB 3A8IE 1H9RA 4EQOA 2RBMA 3JAME 3SK8A 2CHBD 3P7JA 1EZ6A 3X3NA 3J7YW 1H9KA 2SDFA 3TMEA 4R8NA 3I4NB 4ULLA 4K8IA 5ISRA 1U4PA 1Q3LA 4LMQD 4BA2I 3TDQA 3K0YA 4F87A 4HCSA 2V4DA 3EROA 4M1UB 1AZQA 1XXGA 1S5DD 2EXZA 2EYJA 2F0WA 5DEHA 5C0XI 3S16B 5LL6S 3EVQA 1D5ZC 2AUKA 3PIO3 2JA6B 1TU2B 4DGZA 2CW0C 4CKEA 3S1QB 1JQYD 3NTHA 1O7LA 4EQPA 4PMBA 4FF4A 3TP8A 5CORA 1ZYRD 1ESRA 3A55A 2EJFC 5BN4A 5C6AA 4B9XA 1STNA 3H09A 3MTSA 1PTOF 4J6HA 1DOKA 1NR2A 4L8JA 2EJGC 5DM73 1FGBD 4KKUA 2O2LD 2XN9C 2IW3A 1BR9A 2R61A 3FDTA 4E6IA 2B2WA 1E2WA 1G2TA 2MUYA 5C3EB 4IFDJ 3N52A 1WTWA 3GO5A 1D1IA 3TP5A 2E2HB 5C44B 1PFBA 3PUZA 5HGTA 4HCEA 2JA8B 4ID6A 4K5WA 1V43A 2X6GA 5T1IA 2F3WA 1PTOC 4K6DA 3C1FA 3GP7A 2A68D 1Y69U 1VCIA 2B2UC 3HEJA 2WAQB 3OSOA 2I46A 3H6MA 2E74C 1FNVA 2KQ3A 5K36G 3MZ5A 4C3IB 4TSSA 3HG9A 3LWEA 1AN8A 4BBSB 1B4OA 1OXVA 5K36H 5M5YB 5JJZA 4RHRA 1VMCA 4CJ1B 3PO2B 2IPKD 2XSCA 3HOUB 2A6ED 3T53B 1MD2D 2FHTA 2BCOA 1SMYC 2RA4A 1R4QB 1WTVA 1GOZA 3NQIA 1Q1EA 4XDXA 2A69D 2DY8A 1NAPA 4I65A 4BY1B 2KECA 1HA6A 1I4QA 2Y0SB 4MHEA 1PFNA 5EQ0A 1SE4A 3HS0C 3MXUA 3M85A 4R8IA 4FXGC 2EYMA 2IL8A 5EBDA 1WD1A 1MSGA 1JC7A 3MXNA 2IWHA 5I2XA 1HRJA 3A56A 2NYZD 3J7AV 3OW7A 1S5FD 1GHKA 2EYHA 3PMFA 5CR3A 4PNYA 5E4XA 2Q8TA 4BBRB 4XT3B 3W3AA 1STGA 3GTLB 2EY2A 4CHTB 3PUYA 4JK1C 2QCPX 3QOLA 2F1MA 5EPJA 2K28A 1LO5D 1STBA 4HSVA 2WINB 4RGNA 1SYBA 2KHSA 1TS4A 2HUGA 4QF4A 3C46A 2ZXOA 4K8JA 5ELBA 1ONLA 1YNND 1PTOB 2C9OA 2KA7A 2NB0A 1DJRD 2FMMA 4DNTB 3RZDB 5FO9B 3K5MA 4B9WA 1RCVD 4C3IG 2QKIC 4H44C 2J0TD 1GJXA 1EY7A 1Z6HA 5G3LF 1I6HB 4KJOA 1G91A 4XIGS 4K6LA 1EIGA 4FVMA 2I07B 2A6HC 1DOLA 4OIKA 1CK1A 3HGBA 1STHA 1Q90A 1F2LA 3MAQA 2JE6I 1I4GA 1GUSA 3NWSA 3I73A 3MHBA 2WACA 3NE5B 3A7AB 1PRTD 1CTMA 3LX0A 5IGDA 1BOSA 3KLRA 4QIWB 4C3HB 1BCPF 2N88A 3OIPA 4C1NI 5KRUA 5C3XA 2B63B 1LTAD 1HTLD 3WDNA 1MSHA 4KV6A 2SEBD 3H3VC 2D62A 3TP6A 5CBEE 4A93B 4RA8A 1O7YA 2EY5A 3T16A 4IUNA 3T51B 1S5CD 1KTKA 1TT2A 1KDCA 3VR4A 3SR1A 4IQZA 1G8ZD 2D2CC 5D3IB 3M4OB 3EFXD 2B2WC 1CA5A 1JOKA 1BCPC 1BBXC 1BNZA 1SEBD 4A3KB 3A8KE 3NPPA 1Z7TA 3VYTA 3P1HA 4WFN3 1CI3M 5E3FA 2F0IA 1BXTA 3I70A 2JP1A 1SSOA 2HDLA 1CA6A 1SJED 1KAAA 3GV6A 1EFID 2AQ1B 2RDHA 3KLSA 5CV6A 4DXGA 1S5ED 4K2KA 4UAIA 2JYOA 5C4ZA 1WD0A 1I4HA 5LHY1 4QCLA 1B2TA 4K14A 2F0EA 2TMPA 3KK7A 5M3FB 3A8JE 1TS5A 4CJ2C 4RHSA 4A3MB 3HOWB 2YYZA 1PFMA 3OWFA 5KNCA 3TP7A 1IKLA 3EQLC 5C5MA 1LV9A 1L0XB 3BYYB 1ET6A 5J22A 1EYDA 2XNAC 5CV5A 4V190 5JEAG 5AFWA 5LL6X 4DFAA 3Q24A 5DM63 4A3GB 2M00A 5JEAH 3VA5A 1BO0A 4K2LA 1F9RA 1GUTA 1JOOA 1A3TA 1LT3D 1TVXA 2NN6H 3SEBA 3MFYA 4WJWA 2K5QA 3AMUA 4RKLA 2E2JB 3U9OA 3SXHA 4CGYB 5C4JB 3BDOA 1O7ZA 3E6ZX 3R8BA 2K7VA 5J1ZA 1AEXA 1IKMA 1T5EA 4N9TA 3VYUA 3S1RB 2SNMA 2L11A 4ZYSA 4DN4M 1EEID 4Y7NB 3FMCA 1ICWA 5IODA 4MIUA 2LY7A 1EY8A 3J80E 1LTSD 3G6JB 3OMGA 1PYWD 4ABNA 2PO4A 3JAML 3OMCA 3GD7A 4C3JB 2AUJD 2R6GA 2SOBA 2JA5B 3SDZA 3X3MA 2K6AA 2F0DA 3QOJA 1Y8PB 1E0BA 3VR5A 3E5SA 3SHLA 4OIJA 3P20A 1JICA 4KD4A 2MP1A 4Q0FA 3OHXC 2C5CA 4ZUJA 4Q5VA 2NN6I 1E2ZA 1QWYA 5IGGA 3NK9A 1DYQA 4NP5A 3NXWA 1PZID 3VYRA 1ENAA 2EZVA 1HUMA 2PZWA 2Z4IA 1BQQT 5M9OA 1B53A 2RVLA 5C0XJ 5EBCA 1F9SA 2ZXPA 2JEBI 4RGTA 1EQTA 3BZDB 3N6RA 4OGQC 5EPKA 5KNDA 4LJZC 3KBXA 1CZWA 3W2DA 1RD9D 2F0UA 2WB1B 5DAUA 1X3QA 1JR0D 4H0LC 3L7ZC 1F2ZA 4H7BA 4J8QA 3BYTB 1JWSD 3PUVA 2NVTB 2BE5D 3V05A 1Y8NB 3H0GB 3CRKC 5ELEA 4C3JG 2R7ZB 1C4QA 1S4ZA 2F0KA 1I6VC 2IJ0A 1HHVA 2CQAA 4L63B 5KYLA 1O78A 1ET9A 1TWHB 1X3PA 5EGTA 3QIAA 2JSOA 4HMIA 3I3CA 1CT1D 2IX1A 4NKLA 3DEOA 5KEEA 1KNEA 1NR4A 2ZT9C 5NUCA 3RUZA 3M7GA 5CGKA 1DONA 1U4MA 2F0PA 2F4IA 2A5HA 3KUPA 1QB5D 5IGBA 2JA7B 1WTPA 1A6XA 2VXWA 2BOSA 2XWJB 4OO1G 4XQNA 4OHJA 1SXTA 3J81E 4HTHA 4YIJA 4F88A 2K33A 3URYA 1II3A 1R4PB 4O42A 3GQBA 3EA6A 4RH6A 2RDFA 3Q6SA 1QILA 3M4YA 1QG7A 2MPMA 3PUXA 4O1NA 1RTNA 5IGEA 2RKSA 3R93A 4BWGB 3NHHA 2FMCA 4DAVA 2ICEC 1SJHD 1NCVA 3HRZC 2E2IB 3HP3A 3K59A 3DEPA 1RF2D 2FFKB 1RODA 5G3LD 4CBVA 4P2CB 1R9TB 1IYUA 3DWAA 3D31A 1EOTA 4HMJA 5E4WC 3EJIA 5EKKA 1SFOB 1I4XA 2F0OA 4LAAA 3NBIA 4XQQA 3GTKB 4MN3A 2ID0A 3DM1A 5I6WA 1EY0A 2F0LA 4X3SA 4PV1C 5E1FA 3CU7A 4OO1I 1GUWA 5CV4A 3C3LA 5FK9C 3QWNA 2KJXA 1BCPD 1DM0B 3BVGA 5HURA 1CQVA 3RZOB 4FXDA 1HCZA 2AQ3B 1JWMD 3I4MB 3I90A 3TSSA 4N9PA 1LTBD 2BA1A 2RSNA 1UUPA 3BDCA 2B8FA 5A2QE 4XYOA 2E75C 1B9NA 4OL7A 1ZYRC 5M5XB 4ZUIA 1V8QA 2NUCA 1UEAB 2GA4B 3OOCA 1C48A 2PW7A 1EWCA 1TS3A 1B3AA 1VF5C 2ZXRA 1MGSA 2L4NA 1LTGD 4FF2A 1A15A 4KKSA 1STAA 5I6YA 2F0MA 1X32A 1ZKOA 2PMZB 4TRDA 4BY7B 3ITPA 3H94A 4C56C 4FF3A 2WIIB 5EJWA 3P75A 3GTMB 4A3DB 1FNUA 1RTOA 1JWUD 1DOMA 1FR3A 2R92B 2A68C 1FYCA 1RJTA 4U673 1D5MC 4X3KA 1ZXTA 3QJYA 1EWHA 1KLUD 3VR6A 2B39A 1EYAA 5FLXE 3HOYB 1QE6A 2L9HA 2K5DA 1YNJC 1RKNA 3DWQA 3HZXA 1IW7C 2XIWA 2F0VA 3IKJA 4FF1A 4IUPA 2Q8IB 1DXMA 4KHVA 3O13A 2A6EC 1SAPA 4IUUA 2HCIA 3D4DA 1U9RA 3IFTA 2OXPA 2RSOA 3S2HB 3Q22A 2QF7A 2A69C 3CHBD 2X6LA 3D6CA 3GTPB 1SBBB 2L55A 1PTOH 2CVRA 5IT9E 1GUGA 1ML0D 2NWGA 2G9DA 4ME5A 4G7OC 3K57A 4DXFA 1MI2A 1M4VA 2O5JC 2LFNA 1L0YB 3IL8A 4K5XA 2Q8RE 2DN8A 2SNSA 1BUVT 2NVXB 4ZK9B 1DCZA 2X69A 5KYIA 1QJOA 1D6EC 5A35A 2A74C 3HOXB 5CV7A 5COYA 2HQEA 2WP8J 4KJNA 3GTQB 2PYKA 3NWTA 3R2TA 2B8GA 3CRLC 5I9PA 1SNPA 1XYIA 3J80L 1CFMA 5M5WB 1YNNC 3FPUB 4ZKBB 4S3SA 2D5DA 3C1EA 3FEWX 4C3HG 5JVG3 3MXGA 1DD2A 1LTID 4U68A 3L3OC 2K01A 1QCBD 5FKAC 1E2VA 3BVZA 4DA2A 3TZUA 4RKBA 1EZ8A 4C2MB 3AB9A 2MHVA 4HR7B 2JEAI 1CHQD 2Z4HA 1EYCA 3ONAB 5ELCA 1LLRD 1OO9B 4TKOB 5D3DA 1ENFA 2PCFB 3A7LA 5FO8B 4J1MA 2FJ2A 3PIP3 1PLFA 2CW0D 1FD7D 4AYBB 2IX0A 1EEFD 2K05A 2EJMA 5JPMC 2VB3X 1EU4A 2O5IC 3H91A 2KCCA 3V2TA 4RCNA 1WVLA 4FXKC 2OEOA 3GTOB 5ELDA 3PV0A 3BVMA 1SYDA 1VMPA 1ENCA 2NVQB 2PZTA 4KK7A 3S17B 3TBIB 4EVOA 3PUWA 5C5LA 1SNDA 3K5LA 1WTRA 3DMUA 3T13A 1EY5A 3M7NA 1F9QA 3S1MB 2D9UA 3S15B 3GTJB 1Y1VB 1Y1WB 1H9MA 1U4LA 4EGVA 3BS1A 1MBYA 1HXYD 4ZAIA 3S2DB 1PTOD 4QB4A 1KABA 2F0NA 1D5XC 1OXTA 1ILPA 4JBWA 5M3MB 3CKIB 1CHPD 1KLGD 4A3IB 3T4AC 1LT4D 5IGFA 1SNMA 2BA0A 1CM9A 2E2DC 2DNCA 4DK0A 2NBFA 4G7ZC 5IOCA 1H9JA 1TR5A 4XQJA 4FO2A 1M8AA 1Q1BA 5ELFA 1I4RA 4RCOA 1EIHA 5D65A 4IURA 2B2TC 1HTPA 4B08A 1SMYD 1U4RA 4KN7C 3J81L 4KY7A 1ILQA 1PRTB 1ESFA 1K8OA 1KDBA 3KF8A 4X3TA 2QDBA 1TS2A 2M9VA 2L12A 3J7AF 4IN3A 4DU9A 1PDQA 3SK4A 4A3FB 4IFDG 2H4OA 2EYPA 1K83B 5BN3A 1SE2A 4CJ0B 3WOFA 4IFDH 3I4LA 1UNSA 2F0FA 2NTSA 1V1PA 1H9SB 4A3EB 2M2LA 1W6JA 1V1OA 3WOEA 5TSSA 1QNKA 5CMDA 1F77A 1O80A 2F0TA 3IAYA 2VNUD 4KMUC 3M3YB 2R3ZA 1HFGA 2TSSA 1Q12A 4WRDA 2KOLA 2DNEA 1LACA 1IYVA 4OO1H 5EKIA 1RDPD 2WV6D 1TQOA 3FRPB 4HAEA 2E76C 4LK1C 5C4XB 2F03A 5JPNC 2NZ1D 2A6HD 1SNCA 4ZLTF 1TWGB 4I7ZC 1G291 3LWUA 4BA1I 3R2IA 4DK1A 1G6ZA 2NVYB 2VUMB 1I4PA 4C1NK 3I8ZA 3NTKA 4RFBA 4DAYA 2AQ2B 4HSPA 3FKIB 3MVVA 5A2QL 2KUMA 3K6OA 4IFDI 3QG1A 1PZJD 1Q8IA 1SYEA 1PMRA 1SYCA 3SK5A 5JOBA 1YNJD 4V0BA 1IW7D 2LS01 4NW2A 1TY0A 3E0JA 2QILA 4KKTA 1TWAB 4ZRZA 4RGMA 2AWNA 1BF4A 1A3UA 2KCNA 3FPPA 3C2PA 5CV8A 5JVH3 3ND9A 2HDMA 3V96A 4DNRB 3SE0A 1AP0A 4UDUC 1EY6A 3MEHA 2PPBC 2B2VA 1WTXA 1CQFA 3BDLA 3OWEB 1B44D 4KY5A 4L6TB 1EQVA 3QB3A 4Z9CB 3F2UA 2H1EA 2BE5C 3IFDA 3D3RA 3PO3B 5CC4A 2K1BA 2BDOA 3I72A 2LMCB 2AWOA 2EYLA 4IUQA 4XT1B 1D1KA 1EY9A 2F0JA 4A3JB 3MA2B 5EKLA 1QNUA 1B1ZA 3T56B 4K5VA 4IZ8A 5FLXL 1JORA 3KLSX 4G57A 2N55A 4PMCA 4X3UA 1JOQA 3NSWA 4RAUC 1H9SA 4F7XA 1AFPA 3DHQA 3MFGA 1LT6D 4QUFA 3K5NA 1A3VA 2PW5A 1HFNA 2EY1A 1GUOA 1KDAA 2K5WA 4KHZA 4G4KA 1SNOA 3U9SA 3CQZB 4PQXA 1D2BA 5I4DA 1TY2A 2EY6A 1GXDC 2OT2A 5IT9L 3NBHA 1KNAA 3VR2A 2MJ8A 2PZUA 2B2YA 3HOZB 2K03A 1HA5A 4DF7A 1T5XD 5C3WA 4XXEA 1J9OA 3NUCA 1PZKD 1W6KA 5EPLA 3S9WA 1PXUA 2VB2X 2DY7A 1C8CA 1G2SA 2YU9B 2B2TA 5JAVA 5F2DA 1TIID 1I3QB 2OF1A 2G9HD 2BDNA 1B50A 1LABA 5IIFA 4HN7A 1Z47A 2J7ZA 4KY6A 5C4HA 4KI0A 4KD3A 2O4XA 2EPBA 2IT1A 3VA7A 1SE3A 3D4RA 1F9PA 1WTQA 3RLFA 4A3BB 1VDZA 1K8MA 2QEJC 2EYOA 3OPOA 1EL0A 1XX8A 1DZ1A 4ZQ3A 4HEDA 2IX3A 4FNFA 4TQUS 5KGUA 1J8IA 1XWEA 1OXSC 4IUVA 4XYQA 2EOTA 5D14A 5CBAE 4R9WA 5DNFA 1LTTD 4IALA 1HQMC 3DXJC 3MWYW 3GV3A 3NTIA 1EU3A 2RDGA 2KEEA 5CYUA 2EDGA 1B9MA 3I91A 4F8MA 2F0GA 2WKDA 3TN2A 4ILWA 3Q0AA 1AW7A 1QOHA 3SK6A 3G7LA 2ENBA 4WORA 1RHPA 1GUNA 2LKVA 1WCMB 5J39A 5CV9A 1EY4A 2Z1CA 3FVQA 2R93B 3RMHA 4IUTA 1OXXK 1GHJA 1I50B 2F0QA 3ZYYX 5K5PA 1PRTF 3BG3A 4RGOS 2EE1A 1LTRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJM A;  2BE5 D;  4G7O C;  2EJF C;  5BN4 A;  1Q1E A;  1Y8N B;  3HGB A;  1VF5 C;  3CRK C;  2E76 C;  1HTP A;  2O5I C;  2A69 D;  4KI0 A;  3GD7 A;  4KN4 C;  4LK1 C;  2AUJ D;  2KCC A;  2IT1 A;  5KNB A;  2O5J C;  2R6G A;  4L8J A;  4RCN A;  2A6H D;  2EJG C;  4KKS A;  3VA7 A;  3T56 B;  1Q90 A;  3D4R A;  3SDZ A;  3PV0 A;  2EVB A;  1HPC A;  1TKW B;  1ZKO A;  3A8J E;  1I6V C;  2JE6 I;  4KKU A;  1GUS A;  3RLF A;  2NN6 G;  2DN8 A;  3MXU A;  3ND8 A;  4KN7 C;  3M85 A;  3I73 A;  4XTC S;  4I7Z C;  1O78 A;  1G29 1;  1VDZ A;  1Y8P B;  2YYZ A;  3LWU A;  3NE5 B;  1K8O A;  1K8M A;  3A7A B;  4BA1 I;  4DK1 A;  1IYU A;  1CTM A;  3QIA A;  5KNC A;  3VR5 A;  1DCZ A;  3EQL C;  1H9S A;  3H94 A;  3OPO A;  3PUW A;  3D31 A;  1E2W A;  3P20 A;  3KLR A;  3OW7 A;  1QJO A;  1GHK A;  5JEA G;  5A35 A;  3PUZ A;  2ZT9 C;  3M7N A;  1GUO A;  4TQU S;  3WDN A;  3W3A A;  2NN6 I;  1FR3 A;  5JEA H;  1OXS C;  3A8I E;  3QG1 A;  1E2Z A;  1GUT A;  2D62 A;  2B8G A;  1VF7 A;  4KHZ A;  1H9R A;  3CRL C;  4IFD G;  1PMR A;  3PUY A;  2A68 C;  1V43 A;  1FYC A;  3U9S A;  4JK1 C;  5BN3 A;  3T51 B;  1CFM A;  1YNN C;  2F1M A;  1A6X A;  1H9M A;  2NN6 H;  1IW7 D;  3MFY A;  1H9K A;  3QJY A;  4PV1 C;  4IFD H;  3I4L A;  1HQM C;  1EWH A;  3DXJ C;  4H13 C;  2D5D A;  3VR6 A;  2L5T A;  1BDO A;  1OXU A;  1H9S B;  4KKT A;  3VR2 A;  2A68 D;  3BDO A;  1Y69 U;  2EDG A;  4OO1 G;  1B9M A;  1DD2 A;  1VCI A;  1ONL A;  1YNJ C;  3VR4 A;  4BA2 I;  3FPP A;  2K7V A;  1IW7 C;  2KA7 A;  1Y8O B;  1HCZ A;  4IQZ A;  2E74 C;  1OXT A;  1T5E A;  3ND9 A;  2K33 A;  4DNT B;  1GUN A;  2JXM B;  2V4D A;  3IKJ A;  4DNR B;  3SE0 A;  5K36 G;  2JEB I;  1E2V A;  3LNN A;  4JBW A;  4GZY C;  2D2C C;  2BA1 A;  3VR3 A;  2PPB C;  4H44 C;  4KMU C;  4G7H C;  2Q8I B;  1DXM A;  3TZU A;  1OXV A;  5BN5 A;  5C0X G;  3N6R A;  2AUK A;  3AB9 A;  2A6E C;  3GQB A;  4OGQ C;  4HR7 B;  5K36 H;  1GJX A;  2B8F A;  3A8K E;  2K32 A;  2JEA I;  1OXX K;  1TU2 B;  2BA0 A;  1Q12 A;  3FMC A;  1Z7T A;  4LJZ C;  2DNC A;  5KND A;  4DK0 A;  2E75 C;  1GHJ A;  3IFT A;  1CI3 M;  1B9N A;  2CW0 C;  4G7Z C;  1ZYR C;  5C0X H;  1H9J A;  1Z6H A;  2BE5 C;  2DNE A;  3M4Y A;  1LAC A;  4TKO B;  1IYV A;  2QF7 A;  3PUX A;  1LAB A;  2A6E D;  4XIG S;  2A69 C;  1O7L A;  3BG3 A;  4H0L C;  1Q1B A;  1V8Q A;  3L7Z C;  2PCF B;  3T53 B;  4OO1 H;  3A7L A;  2A6H C;  3OOC A;  1SMY C;  2PNR C;  2BDO A;  1GUG A;  3PUV A;  3I72 A;  2LMC B;  2AWO A; 
#chains in the Genus database with same CATH topology
 3TZD A;  4LNQ A;  1FGU A;  2Z8L A;  2F3V A;  4QUC A;  1VQG A;  1S5B D;  5T1G A;  3U4V A;  4M8A A;  5KNB A;  1TWF B;  1HR0 Q;  1XNR L;  1NSN S;  1A2T A;  1TWC B;  4APV A;  1YEZ A;  1V1P B;  2B2U A;  1S72 A;  1VQD A;  3D6W A;  2MGS A;  1SYG A;  2NN6 G;  1HZC A;  3ND8 A;  1A2U A;  4PMW A;  3SVM A;  2B2V C;  4ODG A;  1JB3 A;  3OTO Q;  2B29 A;  3VYS A;  3L9A X;  1XTC D;  1JCK B;  3S1N B;  5FO7 B;  2K04 A;  3Q23 A;  3ERQ A;  2HHH L;  4GKK Q;  1WTO A;  3GTP H;  2L1B A;  2KVM A;  4OWT B;  4EQN A;  1NUC A;  3UI2 A;  1PRT C;  3K7A B;  2PQE A;  1HQR D;  4NMZ A;  5IT9 c;  5JEA J;  1VF7 A;  2KED A;  4NPS A;  2HCC A;  1SR3 A;  3HOV B;  1XPU A;  1CZG A;  2XVS A;  3KLW A;  2L0C A;  1AZP A;  1UAP A;  3NP8 A;  4H13 C;  1BBW A;  2NVX H;  2L5T A;  1BDO A;  1OXU A;  3AU7 A;  1LT5 D;  1IL8 A;  1E1T A;  4FP5 D;  2J4X A;  3E0E A;  3KF6 A;  4QMG A;  4UP9 A;  2XWB B;  4IPD A;  1BCP B;  4FYD A;  3HOX G;  4X65 L;  1IZ6 A;  5KIX A;  2EYF A;  1Y8O B;  3D8G A;  2JXM B;  3HOX H;  3LNN A;  1WCM G;  3GTG B;  1STE A;  4GZY C;  5FOB B;  2RCF A;  3GTQ H;  3R3O A;  2UUB Q;  3VR3 A;  1Q82 C;  1SYF A;  5FLM G;  1VQE A;  2A73 B;  2XRS D;  1Q8K A;  4DV4 Q;  4G7H C;  3CCU A;  2R93 G;  5BN5 A;  5C0X G;  1HUN A;  3KBG A;  4DAP A;  2K32 A;  3K5O A;  1ASZ A;  2XRQ D;  1K8A C;  5M5W H;  5C0X H;  1GM5 A;  3MXP A;  3OIQ A;  3E9H A;  4DAY B;  1KIX A;  1I50 H;  2F0S A;  4ZKC B;  3K58 A;  3RD4 A;  1LUZ A;  3D4W A;  2ICI A;  1YHQ A;  2PNR C;  2OWO A;  5I9O A;  1GKH A;  1STY A;  5LMN W;  1F2M A;  2B2Y C;  4KN4 C;  2F0H A;  3BZC A;  3NQT A;  2HD3 A;  1SNQ A;  1JJC B;  2WKC A;  2EVB A;  1HPC A;  1TKW B;  2JK8 A;  3A54 A;  3DWP A;  1QZH A;  4RWS C;  4IO9 A;  1F2Y A;  2QW7 A;  4BS9 A;  4JOI C;  4XTC S;  3CMA A;  2OTJ A;  3DUZ A;  2RQX A;  1JE4 A;  2NTT A;  3QO2 A;  2CQO A;  2ES2 A;  5IGC A;  3S14 B;  1IHZ A;  4JV5 L;  3MC0 B;  1FNW A;  3G6E A;  1WOC A;  5I2Y A;  4GNX C;  4CKC A;  2DJF C;  1ZEQ X;  2FIN B;  4PZ7 A;  4KTA A;  1X54 A;  4NDX A;  4CKB A;  1SDF A;  3HKZ B;  3A8I E;  4ZCK A;  1H9R A;  1YBY A;  4EQO A;  2RBM A;  1K0R A;  3K7A H;  3JAM E;  3GTO H;  3SK8 A;  2CHB D;  1PH7 A;  4JVZ A;  3P7J A;  1E3P A;  1EZ6 A;  3X3N A;  3J7Y W;  1H9K A;  2SDF A;  3TME A;  4R8N A;  3MXN B;  1G6P A;  3H15 A;  2A1A A;  3I4N B;  4ULL A;  4K8I A;  5ISR A;  1X3E A;  1WJJ A;  1PV4 A;  1U4P A;  1Q3L A;  1D7Q A;  1IBM Q;  4LUO A;  4LMQ D;  4BA2 I;  3HKZ E;  3TDQ A;  3K0Y A;  4F87 A;  3UDG A;  3HFZ B;  4HCS A;  4JI4 Q;  2V4D A;  3ERO A;  1YJW A;  4M1U B;  1AZQ A;  1XXG A;  1S5D D;  2EXZ A;  4X64 L;  3S1M H;  1IBK L;  2EYJ A;  2F0W A;  5DEH A;  1X3G A;  5C0X I;  3S16 B;  3CD6 A;  5LL6 S;  2VQF L;  3EVQ A;  3S15 H;  1D5Z C;  2AUK A;  3PIO 3;  1V9P A;  3GTJ H;  2KEN A;  2JA6 B;  1TU2 B;  1Y1V H;  4DGZ A;  2H5X A;  2CW0 C;  4CKE A;  3S1Q B;  1OTC A;  4WJ4 A;  1JQY D;  3NTH A;  4DV6 L;  1O7L A;  4EQP A;  4DV2 L;  4PMB A;  4FF4 A;  3TP8 A;  5COR A;  3S2D H;  1B3Q A;  4UP7 A;  1ZYR D;  1ESR A;  1MHW C;  3A55 A;  2EJF C;  5BN4 A;  5C6A A;  4B9X A;  1JJ2 A;  1STN A;  3H09 A;  3MTS A;  1PTO F;  4J6H A;  1DOK A;  4L5Q A;  4PZ8 A;  4B3T Q;  3ULL A;  3CW2 C;  4JBM A;  1NR2 A;  4L8J A;  2EJG C;  4HIM A;  4A3I H;  5DM7 3;  1FGB D;  4KKU A;  2Z6B A;  4JI8 Q;  2O2L D;  2XN9 C;  3RLN A;  2IW3 A;  1BR9 A;  2R61 A;  3FDT A;  4E6I A;  4L5R C;  1LM0 A;  2B2W A;  1E2W A;  3G48 A;  1G2T A;  2MUY A;  5C3E B;  4IFD J;  3N52 A;  2K50 A;  4A75 A;  1WTW A;  3CC7 A;  4B3R L;  1K3R A;  5FJ8 H;  1EQR A;  2EIF A;  3GO5 A;  4MTK A;  3NEM A;  2MNA A;  1D1I A;  3CPW A;  3TP5 A;  2E2H B;  2IHF A;  5C44 B;  1PFB A;  4WJ3 M;  3PUZ A;  5HGT A;  4HCE A;  2JA8 B;  4ID6 A;  3HKZ G;  4GNX B;  3EN2 A;  2GVA A;  4K5W A;  1V43 A;  2X6G A;  5T1I A;  2LXK A;  5LMU Q;  2F3W A;  1PTO C;  1HNW Q;  4K6D A;  2D0P A;  3C1F A;  3GP7 A;  2A68 D;  1Y69 U;  3I4N G;  1VCI A;  2B2U C;  3HEJ A;  3TS0 A;  2WAQ B;  3OSO A;  5HY6 A;  2I46 A;  3I4O A;  2GN5 A;  3AFP A;  3H6M A;  2ZTE A;  4NXN Q;  2E74 C;  3I4N H;  1FNV A;  2KQ3 A;  4A3F G;  5K36 G;  4DR4 L;  1VQL A;  4NXM Q;  1VQJ A;  3MZ5 A;  4C3I B;  4TSS A;  3HG9 A;  1ASY A;  3LWE A;  4LFA L;  1AN8 A;  4BBS B;  1K8G A;  1B4O A;  1OXV A;  4A3F H;  5K36 H;  5M5Y B;  5JJZ A;  1K83 H;  4RHR A;  1VMC A;  4CJ1 B;  3PO2 B;  4A3E G;  2IPK D;  3W1B A;  2WAQ E;  3TRE A;  3T1Y Q;  2XSC A;  3HOU B;  3TQY A;  2A6E D;  1VQA A;  3T53 B;  1MD2 D;  4A3E H;  2FHT A;  4JW0 A;  3M4Q A;  2BCO A;  2CH4 A;  4YHH L;  3S1Q H;  1SMY C;  5GAD C;  2CKZ B;  1NBW A;  2RA4 A;  1R4Q B;  1WTV A;  1GOZ A;  3NQI A;  3L2P A;  4LF9 L;  2JA9 A;  1Q1E A;  4XDX A;  2A69 D;  2DY8 A;  4KLK A;  1NAP A;  4I65 A;  4BY1 B;  2KEC A;  1HA6 A;  1I4Q A;  3UDI A;  2Y0S B;  4MHE A;  1PFN A;  1KHI A;  5EQ0 A;  1SE4 A;  3LGJ A;  4OX9 L;  3HS0 C;  3MXU A;  3M85 A;  4LF6 L;  4R8I A;  4FXG C;  4JI1 Q;  2IL8 A;  2EYM A;  1E7Z A;  1U5K A;  5EBD A;  1WD1 A;  1RIP A;  1MSG A;  1JC7 A;  3MXN A;  2IWH A;  5I2X A;  1N34 L;  1HRJ A;  2RCN A;  1C0A A;  3A56 A;  2NYZ D;  1JE5 A;  3J7A V;  3OW7 A;  1KRS A;  1S5F D;  1GHK A;  2EYH A;  3PMF A;  5CR3 A;  4PNY A;  4BXX G;  5E4X A;  5C44 G;  2Q8T A;  2UXC L;  2Y0S E;  4BBR B;  2K5H A;  2MO0 A;  4XT3 B;  3W3A A;  1STG A;  1K3B C;  2JA8 G;  3GTL B;  4OXP A;  2EY2 A;  3ULJ A;  1HZ9 A;  2VS1 A;  5C4X H;  2E2H H;  4CHT B;  3PUY A;  4BXX H;  4JK1 C;  2JA8 H;  2QCP X;  3QOL A;  1SMX A;  1KD1 C;  2F1M A;  3CAM A;  5EPJ A;  2K28 A;  1LO5 D;  1STB A;  4DR5 L;  1TWG H;  4HSV A;  2WIN B;  4RGN A;  3CCE A;  1SYB A;  2KHS A;  1TS4 A;  2HUG A;  4QF4 A;  3C46 A;  2K14 A;  2ZXO A;  4K8J A;  5ELB A;  1VQK A;  1ONL A;  1YNN D;  1PTO B;  2C9O A;  2WAQ G;  2VUM H;  4HJ9 A;  3FKI G;  2KA7 A;  2NB0 A;  4HJA A;  1MJE A;  1DJR D;  2FMM A;  4DNT B;  3RZD B;  5FO9 B;  3K5M A;  2VZA A;  4B9W A;  3FKI H;  1RCV D;  4C3I G;  2QKI C;  4H44 C;  4BBS G;  2J0T D;  1RL2 A;  1GJX A;  4JYA L;  1EY7 A;  3Q8D A;  4C3I H;  3PO2 G;  5M5Y H;  1Z6H A;  5G3L F;  4QQB X;  1I6H B;  4KJO A;  1G91 A;  3HOU G;  4XIG S;  3PO2 H;  4K6L A;  2EXD A;  1EIG A;  2UUA L;  4FVM A;  2I07 B;  2A6H C;  1DOL A;  4OIK A;  4LWC A;  4X65 Q;  4HIO A;  3HOU H;  1CK1 A;  3HGB A;  4OWX B;  4YCU A;  2N3S A;  4L5S A;  4GNX A;  1STH A;  4BY1 G;  1P16 A;  1Q90 A;  1F2L A;  2Y0S G;  4R4C A;  3MAQ A;  2JE6 I;  3I2Z A;  1I4G A;  1GUS A;  3NWS A;  3I73 A;  3I55 A;  3MHB A;  2WAC A;  3NE5 B;  3A7A B;  1PRT D;  1CTM A;  3LX0 A;  5IGD A;  1PH3 A;  1BOS A;  3KLR A;  4QIW B;  3PO3 H;  4JI6 L;  4C3H B;  4POF A;  1BCP F;  2N88 A;  3OIP A;  4C1N I;  5KRU A;  2HT1 A;  5C3X A;  1QUQ B;  1Q81 C;  2B63 B;  1LTA D;  1GD7 A;  1J5E L;  1HTL D;  3WDN A;  4BBR G;  1MSH A;  4KV6 A;  4QGU A;  2SEB D;  4CDC C;  3H3V C;  1HH2 P;  2D62 A;  4A3J H;  3TP6 A;  5CBE E;  4A93 B;  4RA8 A;  1O7Y A;  2EY5 A;  3T16 A;  4BBR H;  1I94 Q;  4IUN A;  3T51 B;  1XNQ L;  2PI2 A;  1S5C D;  4QIW E;  3EBE A;  1KTK A;  4YCV A;  3IRB A;  1TT2 A;  1KDC A;  3VR4 A;  4JV5 Q;  4JI3 Q;  3SR1 A;  4IQZ A;  3W5O A;  2E5L Q;  1G8Z D;  2UU9 L;  3CC4 A;  2D2C C;  5D3I B;  3M4O B;  2K52 A;  2B2W C;  3EFX D;  1CA5 A;  4DV7 L;  1JOK A;  3DM3 A;  1BCP C;  1NE3 A;  1BBX C;  1BNZ A;  1SEB D;  4R4Q A;  4A3K B;  3A8K E;  1N9W A;  3CQZ H;  3NPP A;  1Z7T A;  3VYT A;  3P1H A;  4WFN 3;  1CI3 M;  5E3F A;  1K0S A;  3KYH C;  2F0I A;  1BXT A;  3U58 A;  3I70 A;  4DV1 L;  2JP1 A;  1SSO A;  2HDL A;  1G51 A;  1CA6 A;  4X6A H;  1SJE D;  1KAA A;  2XGT A;  3GV6 A;  5IE8 A;  3FP9 A;  4A76 A;  3HOZ H;  2ALY B;  1EFI D;  2AQ1 B;  2RDH A;  3KLS A;  5CV6 A;  2ZTD A;  4DXG A;  1XMQ L;  1U0L A;  3A5Z B;  2A19 A;  1S5E D;  1E22 A;  4K2K A;  4UAI A;  2JYO A;  5C4Z A;  1WD0 A;  1I4H A;  5LHY 1;  4QCL A;  1PHJ A;  1P8L A;  1IBK Q;  1B2T A;  4K14 A;  2F0E A;  1AE2 A;  3KK7 A;  2TMP A;  5M3F B;  3A8J E;  1L2F A;  2VQF Q;  1TS5 A;  4DR3 L;  1V1Q A;  4CJ2 C;  1N36 Q;  4RHS A;  3ER0 A;  4DPG A;  3U4Z A;  4A3M B;  4GN3 B;  4B3M Q;  2YU9 H;  3HOW B;  1TXY A;  1X56 A;  2YYZ A;  1PFM A;  3OWF A;  5KNC A;  3TP7 A;  1IKL A;  3EQL C;  1I3Q H;  5C5M A;  1LV9 A;  1L0X B;  3BYY B;  1ET6 A;  5J22 A;  1EYD A;  2XNA C;  5CV5 A;  4V19 0;  4JI0 L;  4DV6 Q;  5JEA G;  5AFW A;  5LL6 X;  4DFA A;  3Q24 A;  5IP7 G;  5DM6 3;  4A3G B;  1NMF A;  2M00 A;  5JEA H;  3VA5 A;  1EIY B;  1BO0 A;  4K2L A;  4R4T A;  1F9R A;  1GUT A;  1JOO A;  1A3T A;  2VL6 A;  1LT3 D;  5IP7 H;  4A3B G;  4A93 G;  1S40 A;  1TVX A;  2HIV A;  1HZB A;  2NN6 H;  3SEB A;  3MFY A;  4WJW A;  2K5Q A;  3AMU A;  4A3B H;  4RKL A;  2E2J B;  3U9O A;  3SXH A;  4CGY B;  5C4J B;  3BDO A;  1O7Z A;  4YWK A;  3VDY A;  4DR7 L;  4JI5 L;  3E6Z X;  3R8B A;  2K7V A;  5J1Z A;  1AEX A;  3D0F A;  1IKM A;  1T5E A;  4N9T A;  3VYU A;  3S1R B;  2VQE L;  3JC6 6;  5L37 A;  2SNM A;  2JN4 A;  1VQM A;  2L11 A;  4ZYS A;  4DN4 M;  4R1J A;  1EEI D;  4ALP A;  4A3K G;  4Y7N B;  4K0K Q;  3FMC A;  1ICW A;  4DK6 C;  4LF4 L;  1YHB A;  5IOD A;  4AQY L;  1PH5 A;  4MIU A;  2LY7 A;  3UE0 A;  2RHQ B;  3K8A A;  1EY8 A;  3J80 E;  2F4V L;  1LTS D;  3G6J B;  3OMG A;  1PYW D;  3CP0 A;  3WWV A;  4ABN A;  2OCE A;  3BJU A;  2Z6K A;  2PO4 A;  2CWP A;  3JAM L;  1QUQ A;  4DR2 Q;  3OMC A;  1WCM H;  3GD7 A;  4C3J B;  2AUJ D;  4DR4 Q;  2R6G A;  2SOB A;  5FLM H;  2UXB Q;  2JA5 B;  4DV0 L;  3SDZ A;  3X3M A;  2R93 H;  5M3F G;  1VQH A;  2K6A A;  4ME3 A;  3HOW G;  2F0D A;  3QOJ A;  1Y8P B;  1E0B A;  3VR5 A;  3E5S A;  3SHL A;  4OIJ A;  3P20 A;  3HOW H;  1VS0 A;  1JIC A;  2OQ0 A;  4KD4 A;  2MP1 A;  4Q0F A;  4LFB L;  4YHH Q;  3OHX C;  2C5C A;  2FXQ A;  4YWM A;  4ZUJ A;  4Q5V A;  2NN6 I;  4A3G G;  2CCZ A;  4LF9 Q;  1E2Z A;  1MKH A;  1TWF H;  1QWY A;  5IGG A;  3NK9 A;  1EIF A;  1TWC H;  1DYQ A;  4A3G H;  4NP5 A;  3NXW A;  1KRT A;  1PZI D;  2R7D A;  2RF4 A;  4LF7 L;  3BU2 A;  3VYR A;  1ENA A;  4PG3 A;  2EZV A;  1HUM A;  2ASB A;  1SE8 A;  1GVP A;  2PZW A;  4DK3 C;  2Z4I A;  4GN4 B;  1BQQ T;  1QVC A;  5M9O A;  3H3V H;  1B53 A;  1N34 Q;  3S1N H;  2RVL A;  1PYS B;  5C0X J;  5EBC A;  1F9S A;  3KOJ A;  1BVS A;  2E2J H;  2CFM A;  2ZXP A;  2JEB I;  4GKJ Q;  3HOV G;  1PH8 A;  4RGT A;  1EQT A;  1Q7Y C;  3BZD B;  3W1G A;  3N6R A;  3S1R H;  4OGQ C;  3CPF A;  3HOV H;  2HQL A;  5EPK A;  5KND A;  4LJZ C;  3KBX A;  1CZW A;  3W2D A;  1RD9 D;  1C9O A;  2F0U A;  3CCS A;  2WB1 B;  5DAU A;  1X3Q A;  1JR0 D;  4H0L C;  3L7Z C;  1F2Z A;  4H7B A;  4J8Q A;  3BYT B;  3RLO A;  1JWS D;  3PUV A;  1PH2 A;  2NVT B;  2BE5 D;  3V05 A;  4AIM A;  4HJ7 A;  1Y8N B;  3H0G B;  3CRK C;  5ELE A;  3BZK A;  3GTG H;  3KDF B;  4C3J G;  2R7Z B;  1C4Q A;  3CXC A;  1S4Z A;  2F0K A;  2JA5 G;  5AJ3 L;  2UUC L;  1W3S A;  4CDF C;  1VQN A;  1I6V C;  2IJ0 A;  1HHV A;  4C3J H;  2CQA A;  4L63 B;  5KYL A;  1KL9 A;  1O78 A;  1ET9 A;  1TWH B;  1X3P A;  1XPR A;  1N33 L;  2K5V A;  5EGT A;  3QIA A;  2JSO A;  4HMI A;  3I3C A;  1CT1 D;  2IX1 A;  4NKL A;  3DEO A;  5KEE A;  1CUK A;  1KNE A;  5IWA L;  2UUA Q;  1QVG A;  1NR4 A;  2ZT9 C;  5NUC A;  3RUZ A;  3M7G A;  1X55 A;  5CGK A;  1DON A;  1U4M A;  2F0P A;  3JAM i;  4OEM B;  1HR0 L;  1E1O A;  2F4I A;  2XTI A;  2A5H A;  3KUP A;  1QB5 D;  5IGB A;  2JA7 B;  1A0I A;  3H3V I;  1KAW A;  1WTP A;  1A6X A;  2OQK A;  4DR1 Q;  2VXW A;  1WI5 A;  2BOS A;  2XWJ B;  2VY3 A;  3S14 H;  4DUZ L;  4OO1 G;  3U50 C;  2G5D A;  4XQN A;  4OHJ A;  1SXT A;  3G71 A;  3J81 E;  4HTH A;  4GKK L;  4YIJ A;  4HIK A;  4F88 A;  2K33 A;  4HJ5 A;  3URY A;  1II3 A;  1R4P B;  5GAE C;  1PVO A;  4P73 A;  4IPG A;  4O42 A;  4LFC L;  3GQB A;  1N32 L;  1XPO A;  3EA6 A;  4RH6 A;  2RDF A;  4DAM A;  4GLX A;  3Q6S A;  1NTG A;  1QIL A;  3M4Y A;  3JAM c;  2LXJ A;  1QG7 A;  2MPM A;  3PUX A;  4O1N A;  1RTN A;  4P72 A;  2F3I A;  5IGE A;  2RKS A;  3R93 A;  1NNX A;  4BWG B;  2V1C C;  3NHH A;  4DV5 L;  1CKN A;  2FMC A;  4DV3 L;  4MNO A;  4DAV A;  2JA6 G;  2ICE C;  2YTV A;  2R7Z G;  4DUY L;  3GDE A;  3S16 H;  1SJH D;  5IYD G;  4DV4 L;  1NCV A;  3HRZ C;  2Q2T A;  3CCV A;  2E2I B;  3HP3 A;  3K59 A;  3DEP A;  2JA6 H;  1RF2 D;  3AYH B;  5GAH C;  2FFK B;  2ZM6 Q;  1ROD A;  5G3L D;  4CBV A;  4P2C B;  1R9T B;  1IYU A;  5GAG C;  2I0Q A;  3DWA A;  3D31 A;  4LF5 L;  1EOT A;  1VQF A;  4N8X 1;  1K28 A;  4HMJ A;  5E4W C;  1YI2 A;  3M9B A;  3EJI A;  2ZTC A;  1IXR A;  5EKK A;  1PYB A;  4B3S L;  1SFO B;  1I4X A;  2F0O A;  2PI2 E;  4UHV A;  3FHW A;  4JI2 L;  4LAA A;  3NBI A;  4XQQ A;  1XMO L;  3GTK B;  4MN3 A;  2Z6K C;  2ID0 A;  3DM1 A;  5I6W A;  1EY0 A;  2F0L A;  4X3S A;  1J6Q A;  4PV1 C;  4POG A;  5E1F A;  5C3E G;  4DR3 Q;  3CU7 A;  4OO1 I;  1GUW A;  1JJG A;  5CV4 A;  2UXD Q;  1L1O B;  1EUJ A;  3C3L A;  5FK9 C;  3QWN A;  1MJC A;  2KJX A;  3T1H Q;  1BCP D;  5C3E H;  1DM0 B;  3BVG A;  5HUR A;  1CQV A;  1XTD A;  4LUZ A;  4FXD A;  1HCZ A;  2AQ3 B;  1JWM D;  3I4M B;  3RZO B;  3I90 A;  5C44 H;  3TSS A;  4N9P A;  1LTB D;  1XNR Q;  2BA1 A;  2RSN A;  4IOC A;  4CDD C;  3KDF A;  5IYC G;  2KHJ A;  2K75 A;  3CCL A;  1UUP A;  3BDC A;  2B8F A;  1YNX A;  5A2Q E;  3I56 A;  4XYO A;  3A5U A;  2E75 C;  1B9N A;  1SRO A;  4OL7 A;  1ZYR C;  1PH6 A;  3RNU A;  4UPA A;  5M5X B;  3E3X A;  4ZUI A;  1V8Q A;  2HHH Q;  2NUC A;  1UEA B;  1HNZ L;  2GA4 B;  1IBM L;  3OOC A;  3RN2 A;  4DR7 Q;  1C48 A;  2PW7 A;  1EWC A;  1C7Y A;  1TS3 A;  1B3A A;  1VF5 C;  2ZXR A;  1MGS A;  2L4N A;  1LTG D;  4FF2 A;  1A15 A;  2RHS B;  4KKS A;  1STA A;  4BBS H;  2F0M A;  5I6Y A;  1X32 A;  1ZKO A;  2QDL A;  2PMZ B;  4TRD A;  4BY7 B;  3ITP A;  1VQC A;  4AQY Q;  2QGQ A;  3H94 A;  1W2B A;  4C56 C;  4FF3 A;  2WII B;  2F4V Q;  5GRO A;  4RG1 A;  5EJW A;  3P75 A;  1PFS A;  3GTM B;  4A3D B;  1FNU A;  1RTO A;  1JWU D;  1DOM A;  3OW2 A;  1FR3 A;  3EIV A;  2R92 B;  3PQI A;  1VQ7 A;  3B6Y A;  4B3T L;  2LSS A;  3AQQ A;  1SFO H;  4BY1 H;  2A68 C;  2PNH A;  1FYC A;  1RJT A;  4U67 3;  2Q2I A;  1CKO A;  1D5M C;  5JJL A;  4DV0 Q;  4X3K A;  1ZXT A;  1EOV A;  3QJY A;  1UE6 A;  1EWH A;  1KLU D;  2GVB A;  3VR6 A;  5DLQ E;  2B39 A;  1EYA A;  5FLX E;  3HOY B;  1QE6 A;  2L9H A;  2K5D A;  5E7N A;  1YNJ C;  1RKN A;  4MTN A;  3DWQ A;  3HZX A;  1IW7 C;  2XIW A;  3I4M G;  2F0V A;  3RN5 A;  3IKJ A;  2YTY A;  4FF1 A;  2AMC B;  2BH8 A;  1WTH A;  3GTL H;  4IUP A;  2Q8I B;  1DXM A;  4KHV A;  1WYD A;  2ZJR A;  3O13 A;  2A6E C;  1D8L A;  1SAP A;  1NMG A;  4IUU A;  2HCI A;  3D4D A;  3F2B A;  1U9R A;  5LMU L;  1KXL A;  3IFT A;  4QJF A;  5LMN L;  2OXP A;  1HNW L;  2RSO A;  3S2H B;  3Q22 A;  2QF7 A;  3PIP A;  2A69 C;  2IHE A;  3CHB D;  2X6L A;  3D6C A;  3GTP B;  1SBB B;  2L15 A;  2L55 A;  1PTO H;  2CVR A;  1BKB A;  5IT9 E;  1GUG A;  1BBU A;  1ML0 D;  2NWG A;  2G9D A;  4ME5 A;  3RZD H;  3KFU A;  4G7O C;  3K57 A;  4DXF A;  1MI2 A;  4AH6 A;  1M4V A;  2O5J C;  3K81 C;  2LFN A;  4A4I A;  1L0Y B;  3IL8 A;  4K5X A;  4RMF A;  2Q8R E;  2DN8 A;  2SNS A;  1BUV T;  3NEN A;  4BY7 G;  1X65 A;  2NVX B;  2BH2 A;  2PQA A;  3STB C;  5JJK A;  4ZK9 B;  1DCZ A;  4YCW A;  1I6H H;  2X69 A;  1L1O A;  5KYI A;  1QJO A;  1X6O A;  1D6E C;  4DR6 L;  5A35 A;  2A74 C;  3HOX B;  5CV7 A;  4X64 Q;  5COY A;  3K7U C;  2HQE A;  4NB3 A;  2WP8 J;  4KJN A;  3GTQ B;  2PYK A;  4GLA C;  5H1S E;  3NWT A;  3R2T A;  2B8G A;  3CRL C;  3OYY A;  5I9P A;  1SNP A;  1XYI A;  3J80 L;  1CFM A;  5M5W B;  1YNN C;  3FPU B;  3NEL A;  5AJ3 Q;  2UUC Q;  4JCV E;  2CWA A;  4ZKB B;  1FJG L;  4S3S A;  2D5D A;  3C1E A;  2JQO A;  3FEW X;  1AE3 A;  3HOY G;  4C3H G;  4A3L G;  4DV2 Q;  3KF8 B;  5JVG 3;  3MXG A;  4QL5 A;  1DD2 A;  1VQO A;  1LTI D;  4U68 A;  3L3O C;  2B63 G;  2K01 A;  3HOY H;  4C3H H;  3ZJY C;  1QCB D;  5FKA C;  1E2V A;  2B63 H;  5IWA Q;  5JJI A;  2AHO B;  3BVZ A;  4DA2 A;  3TZU A;  4RKB A;  1EZ8 A;  3A0J A;  3AB9 A;  4C2M B;  2MHV A;  4A93 H;  4HR7 B;  2JEA I;  1CHQ D;  2Z4H A;  1EYC A;  3ONA B;  5ELC A;  1IBL L;  1LLR D;  1OO9 B;  4TKO B;  5D3D A;  1ENF A;  4O2D A;  2PCF B;  3A7L A;  1PA6 A;  4B3R Q;  3S2H H;  5FO8 B;  4J1M A;  2FJ2 A;  3PIP 3;  4DUZ Q;  1PLF A;  2CW0 D;  1FD7 D;  4AYB B;  2IX0 A;  1EEF D;  4CDE C;  2K05 A;  2EJM A;  5JPM C;  4X62 L;  2VB3 X;  4LF8 L;  1EU4 A;  4YY3 L;  3UE1 A;  2O5I C;  3H91 A;  3M4O H;  2KCC A;  3V2T A;  2P5Z X;  4RCN A;  1WVL A;  4FXK C;  1E24 A;  2OEO A;  3GTO B;  5ELD A;  3PV0 A;  5EAY A;  3BVM A;  4JC0 A;  3G4S A;  4OEL B;  1SYD A;  1VMP A;  4A3K H;  4LFC Q;  1ENC A;  2NVQ B;  2PZT A;  4KK7 A;  2E8G A;  1N32 Q;  4H02 A;  2I5H A;  4DNI A;  3S17 B;  3TBI B;  4EVO A;  1VQ6 A;  4AYB E;  3PUW A;  5C5L A;  2Z9H A;  1K9M C;  4IPH A;  2YV5 A;  1SND A;  3K5L A;  1KQS A;  1YJ9 A;  1B8A A;  1WTR A;  2Q2U A;  3DMU A;  3T13 A;  1EY5 A;  3M7N A;  1F9Q A;  3S1M B;  2I5M X;  4JI7 L;  2D9U A;  4LFA Q;  4N8F A;  3S15 B;  3F8T A;  4DV5 Q;  3UDF A;  4A3M G;  3GTJ B;  1GO3 E;  3PIO A;  4DV3 Q;  1Y1V B;  4DUY Q;  5M3F H;  1Y1W B;  1H9M A;  1U4L A;  4O0A A;  4EGV A;  3BS1 A;  4A3M H;  1QZG A;  1HJP A;  4I7A A;  2N49 A;  1MBY A;  1HXY D;  4UP8 A;  1N8R C;  5IP9 G;  1YIJ A;  4HID A;  4ZAI A;  3S2D B;  1NJI C;  4KHP L;  1Z9F A;  1PTO D;  4QB4 A;  1CKN B;  4LF5 Q;  1KAB A;  2F0N A;  1D5X C;  1OXT A;  5IP9 H;  4OON A;  1ILP A;  1YVC A;  2MQH A;  4JBW A;  3CKI B;  5M3M B;  3F2C A;  4B3S Q;  1VQB A;  1CHP D;  1KLG D;  4A3I B;  3TEH B;  1EQQ A;  1A62 A;  4JI2 Q;  3T4A C;  1LT4 D;  5IGF A;  2DUD A;  4OX9 Q;  1SNM A;  1XJV A;  1I94 L;  2BA0 A;  1CM9 A;  2E2D C;  1XMO Q;  1KC8 C;  2D0O A;  2DNC A;  4X66 L;  4LF6 Q;  4DK0 A;  2NBF A;  4G7Z C;  4FDB A;  4C2M H;  3J80 i;  5IOC A;  1H9J A;  1T9H A;  1TR5 A;  4XQJ A;  3F1Z A;  4FO2 A;  5C4J H;  1M8A A;  1Q1B A;  5ELF A;  4OWW B;  4JI3 L;  4GOP A;  1I4R A;  4AYB G;  4RCO A;  2UXC Q;  1EIH A;  2R7F A;  5D65 A;  2E5L L;  4IUR A;  2B2T C;  1HTP A;  4B08 A;  5ELO A;  4GN5 A;  1SMY D;  3L0O A;  1U4R A;  5BR8 L;  4DR5 Q;  1I5F A;  1HNX L;  4Y7N H;  4KN7 C;  3J81 L;  4KY7 A;  1ILQ A;  1PRT B;  1ESF A;  1K8O A;  1KDB A;  1S3O A;  2QA4 A;  4JPB W;  3KF8 A;  2NVQ H;  4X3T A;  2QDB A;  1TS2 A;  5IYB G;  1M1K C;  1A63 A;  3S17 H;  3J80 c;  2M9V A;  2WFW A;  1HNZ Q;  2L12 A;  2QEX A;  3J7A F;  5IYB H;  4LUV A;  4IN3 A;  4DU9 A;  2WB1 E;  1PDQ A;  1SRU A;  1LTL A;  3SK4 A;  4A3F B;  4IFD G;  2H4O A;  2EYP A;  1K83 B;  2JA5 H;  4JYA Q;  5BN3 A;  1Y1V G;  1YIT A;  1SE2 A;  2K4K A;  4CJ0 B;  4P71 A;  1Y1W G;  1B70 B;  1N36 L;  4B3M L;  3WOF A;  4IFD H;  3I4L A;  1UNS A;  2F0F A;  2NTS A;  1V1P A;  1X9N A;  2NZH A;  1PH1 A;  1Y14 B;  2KHI A;  1H9S B;  3AEV A;  4A3E B;  2M2L A;  1Y1W H;  1W6J A;  1V1O A;  3F2D A;  1HZA A;  3WOE A;  3CME A;  5TSS A;  1QNK A;  4P74 A;  5CMD A;  1F77 A;  1O80 A;  3KJO A;  2F0T A;  4P75 A;  5M3M G;  3IAY A;  1JT8 A;  1L1O C;  4TVA B;  4A3C G;  2B3G A;  3ERS X;  4A3I G;  4KMU C;  2VNU D;  3M3Y B;  2R3Z A;  5M3M H;  3K80 C;  1HFG A;  2TSS A;  1Q12 A;  4A3C H;  1K73 C;  4WRD A;  3OTO L;  1YJN A;  3NBH B;  2KOL A;  2DNE A;  4IJL A;  4EQ5 A;  1LAC A;  1IYV A;  3DLL A;  4OO1 H;  4JI6 Q;  5FJ8 G;  5EKI A;  1UEB A;  1RDP D;  2WV6 D;  1TQO A;  3FRP B;  1J5E Q;  1UE5 A;  4HAE A;  2E76 C;  4LK1 C;  5C4X B;  2F03 A;  2MFI A;  5JPN C;  2NZ1 D;  2A6H D;  1SNC A;  4ZLT F;  3TS2 A;  1XNQ Q;  1TWG B;  2WB1 G;  4K0K L;  4I7Z C;  1G29 1;  3LWU A;  4BA1 I;  3R2I A;  4DK1 A;  5LMN Q;  1O7I A;  1G6Z A;  1FL0 A;  1AH9 A;  2NVY B;  2VUM B;  2F52 A;  2CH4 W;  3SGI A;  1I4P A;  3H0G G;  4IPC A;  4C1N K;  3I8Z A;  3NTK A;  4RFB A;  4DAY A;  2AQ2 B;  4HSP A;  2UUB L;  2UU9 Q;  2NVT H;  3FKI B;  3MVV A;  5A2Q L;  4DV7 Q;  2KUM A;  1PH9 A;  3K6O A;  4DR2 L;  3H0G H;  4IFD I;  3QG1 A;  1PZJ D;  1Q8I A;  1SYE A;  2R7Z H;  1PMR A;  1SYC A;  3SK5 A;  5JOB A;  2UXB L;  5IYD H;  1YNJ D;  2IY5 B;  4V0B A;  1VQ4 A;  1IW7 D;  1VQ8 A;  2LS0 1;  4NW2 A;  4DV1 Q;  3CCM A;  1TY0 A;  3E0J A;  2QIL A;  1UWV A;  4LW1 A;  1TWH H;  4KKT A;  1TWA B;  2C35 B;  4R4I A;  4ZRZ A;  3J81 i;  4RGM A;  1UE7 A;  2OTL A;  2AWN A;  1BF4 A;  1A3U A;  2K5N A;  2KCN A;  3FPP A;  3C2P A;  1VQP A;  2Z0S A;  5CV8 A;  4JBK A;  2DGY A;  3PCO B;  5JVH 3;  3ND9 A;  4PZ6 A;  1XMQ Q;  2HDM A;  3V96 A;  4DNR B;  3SE0 A;  3PF4 A;  4DR6 Q;  1AP0 A;  4UDU C;  1EY6 A;  3MEH A;  3CCR A;  2PPB C;  2JA7 G;  2B2V A;  1WTX A;  1CQF A;  3BDL A;  2PQA B;  3OWE B;  3TRZ A;  1B44 D;  4KY5 A;  4L6T B;  2JA7 H;  1EQV A;  4JG2 A;  3QB3 A;  4Z9C B;  3M3Y H;  3F2U A;  2H1E A;  5HGQ A;  2BE5 C;  4J15 A;  1FJG Q;  2KBN A;  3IFD A;  2HIX A;  2AKW B;  4MZ9 A;  3S24 A;  3D3R A;  3PO3 B;  4JI0 Q;  1WFQ A;  5CC4 A;  2K1B A;  3AFQ A;  4R4O A;  4Y52 H;  2BDO A;  5IY0 A;  3I72 A;  2LMC B;  2AWO A;  2EYL A;  4IUQ A;  4XT1 B;  1D1K A;  1EY9 A;  1YHA A;  2N8N A;  3PGZ A;  3PSI A;  3J81 c;  2F0J A;  1CSP A;  4A3J B;  4GKJ L;  3MA2 B;  3STB D;  5EKL A;  3ULP A;  5C4X G;  1QNU A;  1B1Z A;  3T56 B;  4K5V A;  4IZ8 A;  5IYC H;  2NZO A;  5FLX L;  4IOA A;  3E9I A;  1JOR A;  3KLS X;  2MO1 A;  4G57 A;  2N55 A;  4PMC A;  4X3U A;  1NY4 A;  1JOQ A;  3A74 A;  3I7F A;  3NSW A;  4RAU C;  1H9S A;  4F7X A;  1AFP A;  1IBL Q;  1LYL A;  3DHQ A;  3MFG A;  1LT6 D;  3CCQ A;  4QUF A;  3CC2 A;  4JI5 Q;  2VUM G;  4JI4 L;  3K5N A;  5ELN A;  1A3V A;  2PW5 A;  1HFN A;  2EY1 A;  1GUO A;  2NVY H;  2VW9 A;  2VQE Q;  1CSQ A;  1KDA A;  2K5W A;  4X62 Q;  4KHZ A;  4LF8 Q;  4YY3 Q;  4G4K A;  1SNO A;  4GOP C;  3U9S A;  3CQZ B;  2ATW A;  1SN8 A;  4PQX A;  2E2I H;  4LF4 Q;  3KJP A;  3ICE A;  5I4D A;  1D2B A;  1TY2 A;  2EY6 A;  1GXD C;  2OT2 A;  5IT9 L;  3NBH A;  1KNA A;  3UDX A;  1IYJ B;  1VQI A;  2MJ8 A;  3VR2 A;  1R9T H;  2PZU A;  2B2Y A;  2N78 A;  3HOZ B;  1HR0 W;  2K03 A;  1HA5 A;  4DF7 A;  1SLJ A;  2Q2H A;  1TWA H;  2PMZ E;  1CKM A;  2I5L X;  1T5X D;  5C3W A;  4JOI A;  4XXE A;  1J9O A;  3J7Z C;  3NUC A;  1PZK D;  1W6K A;  5EPL A;  1Q86 C;  1UE1 A;  3S9W A;  1PXU A;  2VB2 X;  4JI7 Q;  4JI8 L;  3GTK H;  2DY7 A;  1H95 A;  1C8C A;  4UY8 C;  1G2S A;  2YU9 B;  2B2T A;  5J3B A;  5JAV A;  4JBJ A;  5F2D A;  4DR1 L;  1TII D;  1I3Q B;  2OF1 A;  1DGS A;  2G9H D;  2BDN A;  3KF6 B;  1B50 A;  1LAB A;  2ZJP A;  5IIF A;  3J81 j;  3PO3 G;  4HN7 A;  1Z47 A;  4LFB Q;  3RR5 A;  2J7Z A;  4KY6 A;  4YWL A;  3RZO H;  4KHP Q;  5C4H A;  3I4M H;  3HKS A;  1L0W A;  4KI0 A;  4KD3 A;  2O4X A;  2EPB A;  4HJ8 A;  4A3J G;  1A8V A;  2IT1 A;  3VA7 A;  4EX5 A;  1SE3 A;  3D4R A;  1F9P A;  2KCM A;  1WTQ A;  3RLF A;  4IJH A;  4LF7 Q;  4A3B B;  1VDZ A;  1EWI A;  1K8M A;  2QEJ C;  4X66 Q;  2EYO A;  3M4P A;  3OPO A;  5M5X H;  1EL0 A;  2DJG C;  4NXN L;  1QVF A;  5GQO A;  1XX8 A;  1DZ1 A;  4ZQ3 A;  4HED A;  4NXM L;  2IX3 A;  1IL2 A;  4FNF A;  4TQU S;  5KGU A;  1J8I A;  1XWE A;  1X3F A;  3K0X A;  4GS3 A;  1OXS C;  1YZ6 A;  4IUV A;  4XYQ A;  4QY7 A;  1EYG A;  2EOT A;  1Q46 A;  5D14 A;  5CBA E;  1B7Y B;  2JJQ A;  4R9W A;  5DNF A;  3T1Y L;  1LTT D;  4IAL A;  1HQM C;  5BR8 Q;  4BY7 H;  2EQS A;  3DXJ C;  2ZM6 L;  3MWY W;  2ZJQ A;  1HNX Q;  1VQ9 A;  3GV3 A;  3J7A 5;  2KCT A;  3NTI A;  1EU3 A;  2RDG A;  4L5T A;  2KEE A;  5CYU A;  4GOP B;  3PF5 A;  2EDG A;  1B9M A;  3I91 A;  4F8M A;  4A3D G;  2F0G A;  2WKD A;  3TN2 A;  3HOZ G;  4ILW A;  3Q0A A;  1AW7 A;  1QOH A;  3SK6 A;  3G7L A;  2R92 G;  3CCJ A;  2ENB A;  4WOR A;  1RHP A;  3GTM H;  1GUN A;  2LKV A;  4A3D H;  1EFW A;  1WCM B;  1ICF B;  4GLV B;  5J39 A;  5CV9 A;  1FVI A;  3CF5 A;  1EY4 A;  1VQ5 A;  2R92 H;  4DKA C;  2A8V A;  2Z1C A;  3FVQ A;  2YTX A;  2R93 B;  3RMH A;  4IUT A;  4JI1 L;  1OXX K;  1PH4 A;  1GHJ A;  1I50 B;  2F0Q A;  1N33 Q;  3ZYY X;  5K5P A;  1MIU A;  1PRT F;  4A3L H;  2UXD L;  3BG3 A;  3QR8 A;  1M90 C;  3MEF A;  1JB7 A;  3T1H L;  4RGO S;  2EE1 A;  5FLX c;  1JMC A;  1LTR D; 
#chains in the Genus database with same CATH homology
 3TZD A;  2Z8L A;  2F3V A;  4QUC A;  5T1G A;  1S5B D;  4M8A A;  5KNB A;  1TWF B;  1NSN S;  1A2T A;  1TWC B;  1V1P B;  2B2U A;  3D6W A;  2MGS A;  1SYG A;  2NN6 G;  3ND8 A;  1A2U A;  4PMW A;  3SVM A;  2B2V C;  4ODG A;  1JB3 A;  3VYS A;  3L9A X;  1XTC D;  1JCK B;  3S1N B;  5FO7 B;  2K04 A;  3Q23 A;  3ERQ A;  1WTO A;  2L1B A;  2KVM A;  4EQN A;  1NUC A;  3UI2 A;  1PRT C;  3K7A B;  2PQE A;  1HQR D;  4NMZ A;  5JEA J;  1VF7 A;  2KED A;  2HCC A;  3HOV B;  1CZG A;  2XVS A;  2L0C A;  1AZP A;  1UAP A;  3NP8 A;  4H13 C;  2L5T A;  1BDO A;  1OXU A;  3AU7 A;  1LT5 D;  1IL8 A;  4FP5 D;  2J4X A;  4QMG A;  2XWB B;  1BCP B;  4FYD A;  5KIX A;  2EYF A;  1Y8O B;  3D8G A;  2JXM B;  3LNN A;  3GTG B;  1STE A;  4GZY C;  5FOB B;  3R3O A;  3VR3 A;  1SYF A;  4G7H C;  2A73 B;  2XRS D;  5BN5 A;  5C0X G;  1HUN A;  3KBG A;  4DAP A;  2K32 A;  3K5O A;  2XRQ D;  5C0X H;  3MXP A;  3OIQ A;  2F0S A;  4ZKC B;  3K58 A;  3RD4 A;  3D4W A;  2ICI A;  2PNR C;  5I9O A;  1STY A;  1F2M A;  2B2Y C;  4KN4 C;  2F0H A;  3NQT A;  1SNQ A;  2WKC A;  2EVB A;  1HPC A;  1TKW B;  3A54 A;  3DWP A;  4RWS C;  1F2Y A;  4BS9 A;  4XTC S;  3DUZ A;  2RQX A;  1JE4 A;  2NTT A;  3QO2 A;  5IGC A;  3S14 B;  1IHZ A;  3MC0 B;  1FNW A;  5I2Y A;  4CKC A;  1ZEQ X;  2FIN B;  4KTA A;  4NDX A;  4CKB A;  1SDF A;  3HKZ B;  3A8I E;  1H9R A;  4EQO A;  2RBM A;  3JAM E;  3SK8 A;  2CHB D;  3P7J A;  1EZ6 A;  3X3N A;  3J7Y W;  1H9K A;  2SDF A;  3TME A;  4R8N A;  3I4N B;  4ULL A;  4K8I A;  5ISR A;  1U4P A;  1Q3L A;  4LMQ D;  4BA2 I;  3TDQ A;  3K0Y A;  4F87 A;  4HCS A;  2V4D A;  3ERO A;  4M1U B;  1AZQ A;  1XXG A;  1S5D D;  2EXZ A;  2EYJ A;  2F0W A;  5DEH A;  5C0X I;  3S16 B;  5LL6 S;  3EVQ A;  1D5Z C;  2AUK A;  3PIO 3;  2JA6 B;  1TU2 B;  4DGZ A;  2CW0 C;  4CKE A;  3S1Q B;  1JQY D;  3NTH A;  1O7L A;  4EQP A;  4PMB A;  4FF4 A;  3TP8 A;  5COR A;  1ZYR D;  1ESR A;  3A55 A;  2EJF C;  5BN4 A;  5C6A A;  4B9X A;  1STN A;  3H09 A;  3MTS A;  1PTO F;  4J6H A;  1DOK A;  1NR2 A;  4L8J A;  2EJG C;  5DM7 3;  1FGB D;  4KKU A;  2O2L D;  2XN9 C;  2IW3 A;  1BR9 A;  2R61 A;  3FDT A;  4E6I A;  2B2W A;  1E2W A;  1G2T A;  2MUY A;  5C3E B;  4IFD J;  3N52 A;  1WTW A;  3GO5 A;  1D1I A;  3TP5 A;  2E2H B;  5C44 B;  1PFB A;  3PUZ A;  5HGT A;  4HCE A;  2JA8 B;  4ID6 A;  4K5W A;  1V43 A;  2X6G A;  5T1I A;  2F3W A;  1PTO C;  4K6D A;  3C1F A;  3GP7 A;  2A68 D;  1Y69 U;  1VCI A;  2B2U C;  3HEJ A;  2WAQ B;  3OSO A;  2I46 A;  3H6M A;  2E74 C;  1FNV A;  2KQ3 A;  5K36 G;  3MZ5 A;  4C3I B;  4TSS A;  3HG9 A;  3LWE A;  1AN8 A;  4BBS B;  1B4O A;  1OXV A;  5K36 H;  5M5Y B;  5JJZ A;  4RHR A;  1VMC A;  4CJ1 B;  3PO2 B;  2IPK D;  2XSC A;  3HOU B;  2A6E D;  3T53 B;  1MD2 D;  2FHT A;  2BCO A;  1SMY C;  2RA4 A;  1R4Q B;  1WTV A;  1GOZ A;  3NQI A;  1Q1E A;  4XDX A;  2A69 D;  2DY8 A;  1NAP A;  4I65 A;  4BY1 B;  2KEC A;  1HA6 A;  1I4Q A;  2Y0S B;  4MHE A;  1PFN A;  5EQ0 A;  1SE4 A;  3HS0 C;  3MXU A;  3M85 A;  4R8I A;  4FXG C;  2EYM A;  2IL8 A;  5EBD A;  1WD1 A;  1MSG A;  1JC7 A;  3MXN A;  2IWH A;  5I2X A;  1HRJ A;  3A56 A;  2NYZ D;  3J7A V;  3OW7 A;  1S5F D;  1GHK A;  2EYH A;  3PMF A;  5CR3 A;  4PNY A;  5E4X A;  2Q8T A;  4BBR B;  4XT3 B;  3W3A A;  1STG A;  3GTL B;  2EY2 A;  4CHT B;  3PUY A;  4JK1 C;  2QCP X;  3QOL A;  2F1M A;  5EPJ A;  2K28 A;  1LO5 D;  1STB A;  4HSV A;  2WIN B;  4RGN A;  1SYB A;  2KHS A;  1TS4 A;  2HUG A;  4QF4 A;  3C46 A;  2ZXO A;  4K8J A;  5ELB A;  1ONL A;  1YNN D;  1PTO B;  2C9O A;  2KA7 A;  2NB0 A;  1DJR D;  2FMM A;  4DNT B;  3RZD B;  5FO9 B;  3K5M A;  4B9W A;  1RCV D;  4C3I G;  2QKI C;  4H44 C;  2J0T D;  1GJX A;  1EY7 A;  1Z6H A;  5G3L F;  1I6H B;  4KJO A;  1G91 A;  4XIG S;  4K6L A;  1EIG A;  4FVM A;  2I07 B;  2A6H C;  1DOL A;  4OIK A;  1CK1 A;  3HGB A;  1STH A;  1Q90 A;  1F2L A;  3MAQ A;  2JE6 I;  1I4G A;  1GUS A;  3NWS A;  3I73 A;  3MHB A;  2WAC A;  3NE5 B;  3A7A B;  1PRT D;  1CTM A;  3LX0 A;  5IGD A;  1BOS A;  3KLR A;  4QIW B;  4C3H B;  1BCP F;  2N88 A;  3OIP A;  4C1N I;  5KRU A;  5C3X A;  2B63 B;  1LTA D;  1HTL D;  3WDN A;  1MSH A;  4KV6 A;  2SEB D;  3H3V C;  2D62 A;  3TP6 A;  5CBE E;  4A93 B;  4RA8 A;  1O7Y A;  2EY5 A;  3T16 A;  4IUN A;  3T51 B;  1S5C D;  1KTK A;  1TT2 A;  1KDC A;  3VR4 A;  3SR1 A;  4IQZ A;  1G8Z D;  2D2C C;  5D3I B;  3M4O B;  3EFX D;  2B2W C;  1CA5 A;  1JOK A;  1BCP C;  1BBX C;  1BNZ A;  1SEB D;  4A3K B;  3A8K E;  3NPP A;  1Z7T A;  3VYT A;  3P1H A;  4WFN 3;  1CI3 M;  5E3F A;  2F0I A;  1BXT A;  3I70 A;  2JP1 A;  1SSO A;  2HDL A;  1CA6 A;  1SJE D;  1KAA A;  3GV6 A;  1EFI D;  2AQ1 B;  2RDH A;  3KLS A;  5CV6 A;  4DXG A;  1S5E D;  4K2K A;  4UAI A;  2JYO A;  5C4Z A;  1WD0 A;  1I4H A;  5LHY 1;  4QCL A;  1B2T A;  4K14 A;  2F0E A;  2TMP A;  3KK7 A;  5M3F B;  3A8J E;  1TS5 A;  4CJ2 C;  4RHS A;  4A3M B;  3HOW B;  2YYZ A;  1PFM A;  3OWF A;  5KNC A;  3TP7 A;  1IKL A;  3EQL C;  5C5M A;  1LV9 A;  1L0X B;  3BYY B;  1ET6 A;  5J22 A;  1EYD A;  2XNA C;  5CV5 A;  4V19 0;  5JEA G;  5AFW A;  5LL6 X;  4DFA A;  3Q24 A;  5DM6 3;  4A3G B;  2M00 A;  5JEA H;  3VA5 A;  1BO0 A;  4K2L A;  1F9R A;  1GUT A;  1JOO A;  1A3T A;  1LT3 D;  1TVX A;  2NN6 H;  3SEB A;  3MFY A;  4WJW A;  2K5Q A;  3AMU A;  4RKL A;  2E2J B;  3U9O A;  3SXH A;  4CGY B;  5C4J B;  3BDO A;  1O7Z A;  3E6Z X;  3R8B A;  2K7V A;  5J1Z A;  1AEX A;  1IKM A;  1T5E A;  4N9T A;  3VYU A;  3S1R B;  2SNM A;  2L11 A;  4ZYS A;  4DN4 M;  1EEI D;  4Y7N B;  3FMC A;  1ICW A;  5IOD A;  4MIU A;  2LY7 A;  1EY8 A;  3J80 E;  1LTS D;  3G6J B;  3OMG A;  1PYW D;  4ABN A;  2PO4 A;  3JAM L;  3OMC A;  3GD7 A;  4C3J B;  2AUJ D;  2R6G A;  2SOB A;  2JA5 B;  3SDZ A;  3X3M A;  2K6A A;  2F0D A;  3QOJ A;  1Y8P B;  1E0B A;  3VR5 A;  3E5S A;  3SHL A;  4OIJ A;  3P20 A;  1JIC A;  4KD4 A;  2MP1 A;  4Q0F A;  3OHX C;  2C5C A;  4ZUJ A;  4Q5V A;  2NN6 I;  1E2Z A;  1QWY A;  5IGG A;  3NK9 A;  1DYQ A;  4NP5 A;  3NXW A;  1PZI D;  3VYR A;  1ENA A;  2EZV A;  1HUM A;  2PZW A;  2Z4I A;  1BQQ T;  5M9O A;  1B53 A;  2RVL A;  5C0X J;  5EBC A;  1F9S A;  2ZXP A;  2JEB I;  4RGT A;  1EQT A;  3BZD B;  3N6R A;  4OGQ C;  5EPK A;  5KND A;  4LJZ C;  3KBX A;  1CZW A;  3W2D A;  1RD9 D;  2F0U A;  2WB1 B;  5DAU A;  1X3Q A;  1JR0 D;  4H0L C;  3L7Z C;  1F2Z A;  4H7B A;  4J8Q A;  3BYT B;  1JWS D;  3PUV A;  2NVT B;  2BE5 D;  3V05 A;  1Y8N B;  3H0G B;  3CRK C;  5ELE A;  4C3J G;  2R7Z B;  1C4Q A;  1S4Z A;  2F0K A;  1I6V C;  2IJ0 A;  1HHV A;  2CQA A;  4L63 B;  5KYL A;  1O78 A;  1ET9 A;  1TWH B;  1X3P A;  5EGT A;  3QIA A;  2JSO A;  4HMI A;  3I3C A;  1CT1 D;  2IX1 A;  4NKL A;  3DEO A;  5KEE A;  1KNE A;  1NR4 A;  2ZT9 C;  5NUC A;  3RUZ A;  3M7G A;  5CGK A;  1DON A;  1U4M A;  2F0P A;  2F4I A;  2A5H A;  3KUP A;  1QB5 D;  5IGB A;  2JA7 B;  1WTP A;  1A6X A;  2VXW A;  2BOS A;  2XWJ B;  4OO1 G;  4XQN A;  4OHJ A;  1SXT A;  3J81 E;  4HTH A;  4YIJ A;  4F88 A;  2K33 A;  3URY A;  1II3 A;  1R4P B;  4O42 A;  3GQB A;  3EA6 A;  4RH6 A;  2RDF A;  3Q6S A;  1QIL A;  3M4Y A;  1QG7 A;  2MPM A;  3PUX A;  4O1N A;  1RTN A;  5IGE A;  2RKS A;  3R93 A;  4BWG B;  3NHH A;  2FMC A;  4DAV A;  2ICE C;  1SJH D;  1NCV A;  3HRZ C;  2E2I B;  3HP3 A;  3K59 A;  3DEP A;  1RF2 D;  2FFK B;  1ROD A;  5G3L D;  4CBV A;  4P2C B;  1R9T B;  1IYU A;  3DWA A;  3D31 A;  1EOT A;  4HMJ A;  5E4W C;  3EJI A;  5EKK A;  1SFO B;  1I4X A;  2F0O A;  4LAA A;  3NBI A;  4XQQ A;  3GTK B;  4MN3 A;  2ID0 A;  3DM1 A;  5I6W A;  1EY0 A;  2F0L A;  4X3S A;  4PV1 C;  5E1F A;  3CU7 A;  4OO1 I;  1GUW A;  5CV4 A;  3C3L A;  5FK9 C;  3QWN A;  2KJX A;  1BCP D;  1DM0 B;  3BVG A;  5HUR A;  1CQV A;  3RZO B;  4FXD A;  1HCZ A;  2AQ3 B;  1JWM D;  3I4M B;  3I90 A;  3TSS A;  4N9P A;  1LTB D;  2BA1 A;  2RSN A;  1UUP A;  3BDC A;  2B8F A;  5A2Q E;  4XYO A;  2E75 C;  1B9N A;  4OL7 A;  1ZYR C;  5M5X B;  4ZUI A;  1V8Q A;  2NUC A;  1UEA B;  2GA4 B;  3OOC A;  1C48 A;  2PW7 A;  1EWC A;  1TS3 A;  1B3A A;  1VF5 C;  2ZXR A;  1MGS A;  2L4N A;  1LTG D;  4FF2 A;  1A15 A;  4KKS A;  1STA A;  5I6Y A;  2F0M A;  1X32 A;  1ZKO A;  2PMZ B;  4TRD A;  4BY7 B;  3ITP A;  3H94 A;  4C56 C;  4FF3 A;  2WII B;  5EJW A;  3P75 A;  3GTM B;  4A3D B;  1FNU A;  1RTO A;  1JWU D;  1DOM A;  1FR3 A;  2R92 B;  2A68 C;  1FYC A;  1RJT A;  4U67 3;  1D5M C;  4X3K A;  1ZXT A;  3QJY A;  1EWH A;  1KLU D;  3VR6 A;  2B39 A;  1EYA A;  5FLX E;  3HOY B;  1QE6 A;  2L9H A;  2K5D A;  1YNJ C;  1RKN A;  3DWQ A;  3HZX A;  1IW7 C;  2XIW A;  2F0V A;  3IKJ A;  4FF1 A;  4IUP A;  2Q8I B;  1DXM A;  4KHV A;  3O13 A;  2A6E C;  1SAP A;  4IUU A;  2HCI A;  3D4D A;  1U9R A;  3IFT A;  2OXP A;  2RSO A;  3S2H B;  3Q22 A;  2QF7 A;  2A69 C;  3CHB D;  2X6L A;  3D6C A;  3GTP B;  1SBB B;  2L55 A;  1PTO H;  2CVR A;  5IT9 E;  1GUG A;  1ML0 D;  2NWG A;  2G9D A;  4ME5 A;  4G7O C;  3K57 A;  4DXF A;  1MI2 A;  1M4V A;  2O5J C;  2LFN A;  1L0Y B;  3IL8 A;  4K5X A;  2Q8R E;  2DN8 A;  2SNS A;  1BUV T;  2NVX B;  4ZK9 B;  1DCZ A;  2X69 A;  5KYI A;  1QJO A;  1D6E C;  5A35 A;  2A74 C;  3HOX B;  5CV7 A;  5COY A;  2HQE A;  2WP8 J;  4KJN A;  3GTQ B;  2PYK A;  3NWT A;  3R2T A;  2B8G A;  3CRL C;  5I9P A;  1SNP A;  1XYI A;  3J80 L;  1CFM A;  5M5W B;  1YNN C;  3FPU B;  4ZKB B;  4S3S A;  2D5D A;  3C1E A;  3FEW X;  4C3H G;  5JVG 3;  3MXG A;  1DD2 A;  1LTI D;  4U68 A;  3L3O C;  2K01 A;  1QCB D;  5FKA C;  1E2V A;  3BVZ A;  4DA2 A;  3TZU A;  4RKB A;  1EZ8 A;  4C2M B;  3AB9 A;  2MHV A;  4HR7 B;  2JEA I;  1CHQ D;  2Z4H A;  1EYC A;  3ONA B;  5ELC A;  1LLR D;  1OO9 B;  4TKO B;  5D3D A;  1ENF A;  2PCF B;  3A7L A;  5FO8 B;  4J1M A;  2FJ2 A;  3PIP 3;  1PLF A;  2CW0 D;  1FD7 D;  4AYB B;  2IX0 A;  1EEF D;  2K05 A;  2EJM A;  5JPM C;  2VB3 X;  1EU4 A;  2O5I C;  3H91 A;  2KCC A;  3V2T A;  4RCN A;  1WVL A;  4FXK C;  2OEO A;  3GTO B;  5ELD A;  3PV0 A;  3BVM A;  1SYD A;  1VMP A;  1ENC A;  2NVQ B;  2PZT A;  4KK7 A;  3S17 B;  3TBI B;  4EVO A;  3PUW A;  5C5L A;  1SND A;  3K5L A;  1WTR A;  3DMU A;  3T13 A;  1EY5 A;  3M7N A;  1F9Q A;  3S1M B;  2D9U A;  3S15 B;  3GTJ B;  1Y1V B;  1Y1W B;  1H9M A;  1U4L A;  4EGV A;  3BS1 A;  1MBY A;  1HXY D;  4ZAI A;  3S2D B;  1PTO D;  4QB4 A;  1KAB A;  2F0N A;  1D5X C;  1OXT A;  1ILP A;  4JBW A;  5M3M B;  3CKI B;  1CHP D;  1KLG D;  4A3I B;  3T4A C;  1LT4 D;  5IGF A;  1SNM A;  2BA0 A;  1CM9 A;  2E2D C;  2DNC A;  4DK0 A;  2NBF A;  4G7Z C;  5IOC A;  1H9J A;  1TR5 A;  4XQJ A;  4FO2 A;  1M8A A;  1Q1B A;  5ELF A;  1I4R A;  4RCO A;  1EIH A;  5D65 A;  4IUR A;  2B2T C;  1HTP A;  4B08 A;  1SMY D;  1U4R A;  4KN7 C;  3J81 L;  4KY7 A;  1ILQ A;  1PRT B;  1ESF A;  1K8O A;  1KDB A;  3KF8 A;  4X3T A;  2QDB A;  1TS2 A;  2M9V A;  2L12 A;  3J7A F;  4IN3 A;  4DU9 A;  1PDQ A;  3SK4 A;  4A3F B;  4IFD G;  2H4O A;  2EYP A;  1K83 B;  5BN3 A;  1SE2 A;  4CJ0 B;  3WOF A;  4IFD H;  3I4L A;  1UNS A;  2F0F A;  2NTS A;  1V1P A;  1H9S B;  4A3E B;  2M2L A;  1W6J A;  1V1O A;  3WOE A;  5TSS A;  1QNK A;  5CMD A;  1F77 A;  1O80 A;  2F0T A;  3IAY A;  2VNU D;  4KMU C;  3M3Y B;  2R3Z A;  1HFG A;  2TSS A;  1Q12 A;  4WRD A;  2KOL A;  2DNE A;  1LAC A;  1IYV A;  4OO1 H;  5EKI A;  1RDP D;  2WV6 D;  1TQO A;  3FRP B;  4HAE A;  2E76 C;  4LK1 C;  5C4X B;  2F03 A;  5JPN C;  2NZ1 D;  2A6H D;  1SNC A;  4ZLT F;  1TWG B;  4I7Z C;  1G29 1;  3LWU A;  4BA1 I;  3R2I A;  4DK1 A;  1G6Z A;  2NVY B;  2VUM B;  1I4P A;  4C1N K;  3I8Z A;  3NTK A;  4RFB A;  4DAY A;  2AQ2 B;  4HSP A;  3FKI B;  3MVV A;  5A2Q L;  2KUM A;  3K6O A;  4IFD I;  3QG1 A;  1PZJ D;  1Q8I A;  1SYE A;  1PMR A;  1SYC A;  3SK5 A;  5JOB A;  1YNJ D;  4V0B A;  1IW7 D;  2LS0 1;  4NW2 A;  1TY0 A;  3E0J A;  2QIL A;  4KKT A;  1TWA B;  4ZRZ A;  4RGM A;  2AWN A;  1BF4 A;  1A3U A;  2KCN A;  3FPP A;  3C2P A;  5CV8 A;  5JVH 3;  3ND9 A;  2HDM A;  3V96 A;  4DNR B;  3SE0 A;  1AP0 A;  4UDU C;  1EY6 A;  3MEH A;  2PPB C;  2B2V A;  1WTX A;  1CQF A;  3BDL A;  3OWE B;  1B44 D;  4KY5 A;  4L6T B;  1EQV A;  3QB3 A;  4Z9C B;  3F2U A;  2H1E A;  2BE5 C;  3IFD A;  3D3R A;  3PO3 B;  5CC4 A;  2K1B A;  2BDO A;  3I72 A;  2LMC B;  2AWO A;  2EYL A;  4IUQ A;  4XT1 B;  1D1K A;  1EY9 A;  2F0J A;  4A3J B;  3MA2 B;  5EKL A;  1QNU A;  1B1Z A;  3T56 B;  4K5V A;  4IZ8 A;  5FLX L;  1JOR A;  3KLS X;  4G57 A;  2N55 A;  4PMC A;  4X3U A;  1JOQ A;  3NSW A;  4RAU C;  1H9S A;  4F7X A;  1AFP A;  3DHQ A;  3MFG A;  1LT6 D;  4QUF A;  3K5N A;  1A3V A;  2PW5 A;  1HFN A;  2EY1 A;  1GUO A;  1KDA A;  2K5W A;  4KHZ A;  4G4K A;  1SNO A;  3U9S A;  3CQZ B;  4PQX A;  1D2B A;  5I4D A;  1TY2 A;  2EY6 A;  1GXD C;  2OT2 A;  5IT9 L;  3NBH A;  1KNA A;  3VR2 A;  2MJ8 A;  2PZU A;  2B2Y A;  3HOZ B;  2K03 A;  1HA5 A;  4DF7 A;  1T5X D;  5C3W A;  4XXE A;  1J9O A;  3NUC A;  1PZK D;  1W6K A;  5EPL A;  3S9W A;  1PXU A;  2VB2 X;  2DY7 A;  1C8C A;  1G2S A;  2YU9 B;  2B2T A;  5JAV A;  5F2D A;  1TII D;  1I3Q B;  2OF1 A;  2G9H D;  2BDN A;  1B50 A;  1LAB A;  5IIF A;  4HN7 A;  1Z47 A;  2J7Z A;  4KY6 A;  5C4H A;  4KI0 A;  4KD3 A;  2O4X A;  2EPB A;  2IT1 A;  3VA7 A;  1SE3 A;  3D4R A;  1F9P A;  1WTQ A;  3RLF A;  4A3B B;  1VDZ A;  1K8M A;  2QEJ C;  2EYO A;  3OPO A;  1EL0 A;  1XX8 A;  1DZ1 A;  4ZQ3 A;  4HED A;  2IX3 A;  4FNF A;  4TQU S;  5KGU A;  1J8I A;  1XWE A;  1OXS C;  4IUV A;  4XYQ A;  2EOT A;  5D14 A;  5CBA E;  4R9W A;  5DNF A;  1LTT D;  4IAL A;  1HQM C;  3DXJ C;  3MWY W;  3GV3 A;  3NTI A;  1EU3 A;  2RDG A;  2KEE A;  5CYU A;  2EDG A;  1B9M A;  3I91 A;  4F8M A;  2F0G A;  2WKD A;  3TN2 A;  4ILW A;  3Q0A A;  1AW7 A;  1QOH A;  3SK6 A;  3G7L A;  2ENB A;  4WOR A;  1RHP A;  1GUN A;  2LKV A;  1WCM B;  5J39 A;  5CV9 A;  1EY4 A;  2Z1C A;  3FVQ A;  2R93 B;  3RMH A;  4IUT A;  1OXX K;  1GHJ A;  1I50 B;  2F0Q A;  3ZYY X;  5K5P A;  1PRT F;  3BG3 A;  4RGO S;  2EE1 A;  1LTR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...