2NN6H

Structure of the human rna exosome composed of rrp41, rrp45, rrp46, rrp43, mtr3, rrp42, csl4, rrp4, and rrp40
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
269
structure length
250
Chain Sequence
HLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymyositis/scleroderma autoantigen 1
publication title Reconstitution, activities, and structure of the eukaryotic RNA exosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/transferase
total genus 38
structure length 250
sequence length 269
ec nomenclature ec 3.1.13.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nn6H01
3PUYA 4H0LC 1OXSC 3IFTA 4KI0A 3VR6A 3VR5A 1K8MA 2EJFC 2JE6I 3A7AB 2V4DA 4TKOB 1OXUA 3OPOA 1LABA 4JBWA 5K36H 4RCNA 1E2WA 1ZKOA 1BDOA 4IQZA 4G7HC 1LACA 3SE0A 5C0XG 1PMRA 2Q8IB 3GD7A 1G291 1Q1BA 2BE5D 2IT1A 3H94A 3A8KE 3A7LA 4IFDH 4GZYC 3L7ZC 2PCFB 2ZT9C 4LJZC 2A68C 3RLFA 2O5JC 1GJXA 2F1MA 1DXMA 3MXUA 4JK1C 1HCZA 3KLRA 4DK1A 2AWOA 3PUXA 1YNNC 2DNCA 2EJMA 3I72A 4TQUS 2A6HD 1Q12A 1H9KA 2DNEA 3A8IE 2BA0A 1O78A 4H44C 4KKSA 4XIGS 3VR2A 2LMCB 1VF5C 1ONLA 3SDZA 1E2VA 1V43A 1FYCA 1VF7A 1IW7C 2B8GA 2D5DA 1SMYC 3I73A 2AUKA 2D62A 3PUWA 4KKUA 4OGQC 5BN5A 5KNBA 5JEAG 3M7NA 4IFDG 1VDZA 1OXVA 2JEAI 1CI3M 1Y8OB 1HPCA 4OO1H 2A6EC 3ND8A 2NN6I 4LK1C 5BN4A 1T5EA 2BA1A 1GHJA 1Y8PB 3FPPA 3OW7A 1QJOA 2A69C 1GUTA 1TU2B 3IKJA 1H9SB 3T56B 2KCCA 2DN8A 3N6RA 1YNJC 5KNDA 3PUVA 4L8JA 1H9JA 3VR3A 1GHKA 4I7ZC 5A35A 3OOCA 3P20A 3ND9A 4KHZA 2E76C 1CTMA 3D31A 1GUSA 3M4YA 2JEBI 3TZUA 1ZYRC 2B8FA 3U9SA 3T51B 2A6ED 3W3AA 1HTPA 3WDNA 1Y8NB 5K36G 2PNRC 1IYVA 2E74C 3LWUA 1DD2A 2A68D 5KNCA 1I6VC 2JXMB 1TKWB 3LNNA 3FMCA 4KKTA 3QIAA 4KN4C 1GUNA 2K33A 2NN6H 3A8JE 1B9NA 4DNTB 5C0XH 2EVBA 1H9MA 2BDOA 3QJYA 3NE5B 3VR4A 3MFYA 2KA7A 1OXXK 4HR7B 1GUGA 2L5TA 4DNRB 1Q1EA 1VCIA 1B9MA 3CRKC 2BE5C 2QF7A 1IW7D 1OXTA 4KMUC 3DXJC 2E75C 2R6GA 3T53B 1GUOA 3D4RA 3VA7A 1H9RA 2K32A 3BG3A 4BA2I 2EJGC 1A6XA 1E2ZA 3QG1A 1CFMA 3PUZA 4XTCS 4H13C 2A6HC 1HQMC 3EQLC 2NN6G 2PPBC 2A69D 4OO1G 1IYUA 1Q90A 2EDGA 1H9SA 1Z7TA 5JEAH 1Z6HA 3HGBA 3M85A 3GQBA 2K7VA 2AUJD 2D2CC 2CW0C 4DK0A 1Y69U 4PV1C 3AB9A 4G7OC 1O7LA 3BDOA 4G7ZC 2YYZA 3CRLC 1K8OA 2O5IC 3PV0A 4KN7C 3I4LA 5BN3A 1DCZA 1FR3A 1V8QA 1EWHA 4BA1I
chains in the Genus database with same CATH superfamily
2K5WA 1STHA 3FP9A 2E2IB 1K8MA 2QGQA 2Q8IB 4JI3Q 2MO0A 4QIWE 4RH6A 5K36H 2HUGA 1C4QA 2UUCL 3W1BA 3HOYB 4FYDA 2VQFL 5GADC 3K59A 3O13A 3KOJA 4P73A 2YU9B 2JK8A 1A8VA 2N78A 4LAAA 1I94L 4A3MH 4X64Q 4IPCA 1I4XA 3VDYA 2AQ3B 4HIDA 2LFNA 4J8QA 3GTGB 2MPMA 1AZPA 4K0KL 5D3IB 1GO3E 1Q82C 1HNXQ 2LMCB 3KF6A 2CHBD 1G51A 1Q3LA 2WB1B 4GLAC 2UXBL 1SMYC 3I73A 3TP7A 4DU9A 3I56A 2R7ZB 1CSQA 1MGSA 3FHWA 4HJ7A 2VQEL 1D5ZC 2F0KA 4N8FA 2VW9A 4BBSB 2OTLA 5J3BA 3S1NB 4FVMA 2K1BA 1RD9D 4HEDA 1JICA 3G71A 4MZ9A 1PH3A 3L3OC 2NB0A 4U68A 1GD7A 3A54A 4MNOA 2F3IA 4YY3L 1JE5A 4FO2A 3OW2A 4BBRG 2KOLA 3HOWB 1Q7YC 2IX1A 3WDNA 2E74C 3B6YA 2CVRA 5IE8A 3I8ZA 1FNVA 1TWCB 1TKWB 4LF9L 4KV6A 2DY8A 2JSOA 1TY0A 1LT3D 1B9MA 3CRKC 5T1IA 4JI1Q 1IW7D 2WFWA 2SNMA 4GN4B 4QF4A 3D4RA 4LMQD 1IBLL 1OTCA 5JJZA 5C4XB 1PTOF 2CH4A 1VQEA 1SXTA 1EQTA 4QGUA 4DR2Q 1NE3A 4JI8L 1KQSA 1QUQA 2SEBD 1I4GA 3AB9A 3J81E 4DV4Q 2F4VL 2JP1A 5DNFA 1BXTA 2A73B 3KLSX 3GTKB 1CQVA 4GKJL 4GNXB 1NR4A 4F87A 1I6HH 3TP5A 1XMQL 4X66L 2NZOA 3UE1A 4BBRH 3HS0C 4DV2Q 2OEOA 4WJ4A 3RUZA 4ZCKA 4DV5Q 4H02A 5FO7B 1DOLA 2E2DC 2EY5A 3CQZH 4JYAL 4A76A 2MHVA 5J22A 2BCOA 2B2YA 4RGNA 3RLFA 2UUBL 3IL8A 5HGTA 3HOZG 4JK1C 2AWOA 1K83B 2K04A 3VA7A 2HDLA 3K7AH 1L1OA 3F2DA 2RHSB 1O78A 1Q8IA 4LWCA 4GN5A 3HOVB 1ONLA 3RR5A 3M3YH 3DWAA 2B8GA 5KNBA 3KDFB 4Y7NB 3MHBA 1EOVA 1UAPA 4Y52H 2MUYA 3S1RB 4HSPA 1Y8OB 4RMFA 3TQYA 4CDEC 5C3XA 2HHHQ 3MZ5A 1EQVA 4IJHA 4ME5A 1WCMG 3CCJA 3JC66 4DV0L 2XIWA 5E7NA 4JBJA 2I46A 4YCWA 3L9AX 4PMCA 5AJ3Q 1EIGA 3D6WA 4NKLA 1Y1VG 1EY7A 3PO3B 5GAGC 2B8FA 3P7JA 2A6ED 3W3AA 2F0FA 4AQYQ 1G91A 2NWGA 3H3VH 1T5XD 3GDEA 2KENA 4UAIA 5IGGA 4JG2A 1GVPA 3GTMB 3PF5A 5DM73 3MFYA 1SYBA 3NXWA 4HR7B 5IT9c 1X55A 2EE1A 1HUMA 4NXNQ 1EEFD 3HOZH 3U4ZA 3CCLA 1U4RA 1HXYD 5F2DA 3PIOA 2EOTA 1PFMA 2ZM6Q 3EQLC 4Q0FA 2A69D 4YWKA 2QDLA 4J15A 1H9SA 3DMUA 1A62A 3D3RA 3K5LA 1EYAA 3GTQB 4QUCA 4JOIC 4B3RL 2ICIA 4DV1L 1HQRD 2CWAA 4JW0A 4XT3B 5G3LF 3PV0A 1NUCA 3NUCA 1OXSC 3K5NA 3U58A 4H0LC 4YHHL 1VQJA 3VR6A 3A7AB 4HAEA 3RZOH 1UWVA 1Y1VH 1E2WA 5EKLA 1TS2A 3I4OA 4A3JG 5ISRA 4CDDC 4Z9CB 3J80L 4OWXB 1WYDA 2JA8B 4GZYC 5KYLA 3G48A 3E9IA 4KY5A 4LF4L 3MC0B 1D5MC 3TP6A 1AW7A 3KK7A 2Z9HA 1K3BC 4LFBL 1SAPA 3PUXA 5M3FB 2Y0SE 2B63G 4OXPA 4DR4Q 1SFOH 5K5PA 2LKVA 5IP7G 4JCVE 4KKUA 4OGQC 1CK1A 4DR3Q 3AFQA 2OQKA 1EYDA 4OELB 4JI4Q 1MJEA 3I90A 3KF8A 3H3VI 3FPUB 2DJFC 3J7ZC 1SYFA 1C9OA 5J39A 1WTPA 4HN7A 1YEZA 5IYCG 1GHKA 1UE5A 1UNSA 1PHJA 5EKIA 4DK6C 1JB7A 4YIJA 4L5QA 4X64L 1Q81C 3S2DB 2ZXPA 3BU2A 1BKBA 4A3KB 1DD2A 5HGQA 1PRTD 3EIVA 2B2UA 3QIAA 1BCPD 1GUNA 1HNXL 3HKSA 1B9NA 2F0IA 2VB3X 5FKAC 4DXFA 4A3JH 2BDOA 2K50A 4KY7A 1S5FD 4N9PA 5CORA 1II3A 5C4JH 2KUMA 4L5RC 3J7AF 1S40A 2D9UA 3S14B 1SBBB 4IUVA 1YJNA 2B63H 1MJCA 1JORA 1C48A 2M9VA 1CHQD 2J7ZA 3AEVA 1RODA 4FP5D 1RTOA 2A6HC 1ENAA 1C8CA 2NN6G 1EL0A 5IP7H 1BBXC 1Q90A 1CKNB 2EDGA 4UY8C 1JQYD 5IODA 2AWNA 3T1YQ 2NVTB 2YYZA 4X62Q 1B4OA 1SYGA 1D7QA 2NUCA 4BA1I 5IY0A 2Z6BA 5A2QE 3UE0A 5IYCH 1GM5A 3MEFA 3GTQH 4EQPA 1OXUA 4JBWA 2PI2E 1BO0A 3G4SA 1QILA 1I3QH 3S15B 3E9HA 4OEMB 5BR8Q 1EIYB 3BYYB 5M5YH 4IN3A 2X6GA 1E3PA 2FMMA 5M3MG 3NEMA 4DV3Q 3S17B 4DUYQ 2N55A 1GJXA 5EBDA 5IYBH 3C1FA 3BDCA 4DK1A 2V1CC 1CA6A 1PH7A 4GKKL 4DR2L 4ZLTF 1TS4A 3A55A 4F8MA 1VF5C 4DR1Q 1JJ2A 1LT5D 1ILQA 4DV4L 2B29A 4GLVB 1UEBA 4K5XA 3NWTA 4DNIA 4GN3B 3S16H 2K5HA 3GTPB 1BVSA 1XNRQ 1PZID 2IX0A 3MA2B 2E2HB 3IRBA 1E7ZA 1TWFH 2PQAB 5HY6A 2WB1E 4C3JG 3CCUA 1XWEA 4R8NA 3IKJA 2L1BA 5LMUQ 2Q2TA 4N9TA 1JT8A 1E22A 3T56B 4DV2L 2DN8A 5KNDA 3MTSA 2GVAA 3STBD 2CQOA 3QWNA 4DV5L 1X3FA 3T13A 2RVLA 3K5OA 1ZYRC 1VMPA 3LWEA 3A0JA 1CT1D 4AYBE 2KCMA 3ULLA 5KNCA 1FGBD 4GLXA 1JMCA 2Q2IA 4A3IH 1HFNA 1S5BD 1HZBA 3CCMA 1XMOQ 2JA5G 4LF6Q 5ELDA 1VQHA 2YV5A 5M3MH 1VCIA 3BJUA 5GROA 3F8TA 1EU3A 1V1QA 1IBKQ 5IGFA 4UP9A 2R6GA 3T53B 2N8NA 2HHHL 2IY5B 1GOZA 4RCOA 1PH6A 4NDXA 3M4OB 1KAAA 3QG1A 2QDBA 2IJ0A 4JPBW 4C2MB 3Q22A 2C9OA 4JVZA 1U4PA 3CC7A 5C44H 2G9DA 3GQBA 4RG1A 1NBWA 4MIUA 2XNAC 5I4DA 1VQKA 1L0XB 4C3JH 4O42A 4AQYL 2LY7A 5IT9E 3F1ZA 2GA4B 1FR3A 3HOUG 3DM3A 1D6EC 1Y1WG 4HSVA 3HKZB 1O80A 5E4WC 1R4PB 4CKEA 3ULPA 1U9RA 3BZCA 4NXNL 4XXEA 2EYMA 1O7IA 3VYUA 3NTIA 1EUJA 1B53A 3L7ZC 1LYLA 1X3EA 3F2CA 1LO5D 2ZM6L 1VQPA 3M7GA 5IGCA 2JA5H 5CC4A 4NPSA 1Q12A 4KJNA 2B2VA 4RGOS 4A3MB 1V43A 3H3VC 5CGKA 1IW7C 1PYWD 2EYJA 3RNUA 4QUFA 4ZK9B 3E0JA 3H0GB 4OHJA 4A3CH 2WAQB 1F77A 2FXQA 1OXVA 3MVVA 2VUMG 3GV3A 1KAWA 1RL2A 2I5MX 1FJGQ 5D14A 3C46A 4C3IG 4OIKA 1CZWA 1AE2A 1FNUA 2J0TD 5EPKA 1KC8C 3S1MB 4P74A 4B3MQ 2PW5A 2IHFA 3RN5A 3J81i 3Q6SA 3HOUH 1KRSA 4UP8A 1Y1WH 3Q0AA 1V1PA 3BDLA 3WOFA 3K57A 2O2LD 1KDBA 3V05A 2KCNA 1MI2A 1NMFA 3FMCA 3KF6B 3I4NG 2PZTA 5TSSA 4DR4L 1G6ZA 2E2JH 4HIOA 3A74A 3QJYA 2AQ2B 1WTVA 1BR9A 1W6JA 4DR3L 1Q1EA 5ELFA 3JAML 1VQCA 2K32A 3N52A 1A63A 2HIVA 2Z6KA 1MSGA 2CH4W 3ITPA 2EQSA 5FLMG 1MIUA 1B1ZA 1AEXA 5I6YA 4IO9A 3MXNA 3I4MG 1VQMA 1YNJD 5FO9B 4C1NI 2D2CC 2MQHA 2QEJC 4H7BA 1Y69U 4RA8A 1L0YB 4MTNA 2VUMH 1K8OA 3Q24A 1EWHA 1U4MA 4C3IH 2CKZB 1ASZA 1E0BA 2JA9A 4RCNA 3EBEA 4OL7A 3A5UA 4R1JA 3SK5A 4C3HG 5M9OA 4QB4A 1VQ5A 5EJWA 3FKIG 1K9MC 1N8RC 2RQXA 3I4NH 1SNMA 2PCFB 1JWSD 1B50A 1T9HA 2UU9Q 1IL8A 2PNHA 2O5JC 2Y0SG 4A93G 1I6HB 1Q86C 4I65A 1NJIC 1QUQB 4BBRB 5KIXA 2C5CA 1QWYA 3I7FA 3VR2A 4MHEA 4R8IA 4ZRZA 1HTLD 1LTTD 3CQZB 5ELBA 3T1YL 2F0OA 4X62L 5KGUA 1M1KC 1JCKB 4IUTA 1Q46A 1CUKA 2OWOA 5IIFA 1G8ZD 1GKHA 5FLMH 1KXLA 5CR3A 1NR2A 3K7AB 4WFN3 1DOMA 1KD1C 2BA1A 1GHJA 1AN8A 2ES2A 2RHQB 4IJLA 2A69C 3I4MH 4YWLA 1U4LA 3H0GH 5BR8L 3M3YB 2K03A 3I2ZA 2NVQH 1X3GA 2WP8J 1HHVA 1H9JA 2VL6A 3CCRA 1RTNA 1HJPA 1KABA 5KEEA 4DV3L 3W5OA 4GOPA 4QJFA 1UE1A 2RDFA 3E5SA 4ZYSA 4DUYL 1K0RA 1MD2D 3RLNA 3QO2A 1JWMD 2A68D 3PF4A 2YTXA 2NTTA 3F2UA 5I2XA 5IP9G 5JJKA 1HRJA 3S1MH 2TMPA 4DFAA 2XVSA 3U4VA 4DN4M 3QR8A 4C3HH 1HA6A 1YNND 3HG9A 3K0XA 1H9MA 4Q5VA 2FFKB 2K5DA 3FKIH 3KLSA 2EYLA 2NYZD 2K01A 3OHXC 3NBIA 4K6LA 4A93H 4A3FG 3BZKA 2FINB 1VQ8A 1XNRL 3UDGA 2HCCA 4ODGA 4BA2I 4JV5Q 1LV9A 1TWAH 3NENA 5LMUL 1RF2D 1JJGA 4K8JA 2PPBC 1RKNA 1YITA 4ZAIA 2KVMA 2AUJD 4K5WA 1KDAA 3HOZB 4FXDA 1F2ZA 3HRZC 4A3DG 2A19A 1PZJD 2YTVA 2BOSA 3CAMA 1EWIA 1S5DD 2H4OA 1VQ4A 1B3QA 4R4TA 3SXHA 2JXMB 1N36Q 1R4QB 2B2TC 4J1MA 1FGUA 3NWSA 1YVCA 3J7YW 2VXWA 3T16A 4TKOB 3GTJH 1SNPA 2MGSA 5C3EG 1QE6A 1ET9A 4V0BA 5HURA 4LF6L 4ABNA 3EJIA 4AIMA 1BDOA 4L5SA 2R7DA 5C0XG 1IBKL 1BF4A 1PRTF 3GD7A 3TZDA 1EIHA 1W2BA 1BCPF 1N34Q 3A7LA 4EGVA 1STBA 5LMNL 3W1GA 3ULJA 2ZT9C 2A74C 3RZOB 4DKAC 1PZKD 2F1MA 1PRTC 1WTRA 1Y1VB 3MFGA 1BCPC 4EQ5A 3SK6A 2DNEA 3K58A 4A3FH 2Q8RE 3JAME 2A8VA 1X32A 1B8AA 5ELOA 2D62A 4KHVA 4DK3C 4A3BG 4IFDG 2PI2A 3FVQA 2WB1G 1VQ6A 1UE7A 2HCIA 3KBXA 1SFOB 1JJCB 4BY1G 1LLRD 4QL5A 1SR3A 2XSCA 4BBSG 5CV5A 3MAQA 1JOKA 2J4XA 1AP0A 5JOBA 4A3DH 1Q8KA 4DAPA 1XPRA 2K5NA 4O1NA 1JOQA 2R93G 4AYBG 1SJED 1STEA 1VQFA 2E8GA 2XRQD 3BVMA 4IUQA 3MWYW 5C3EH 1PH2A 4HJ5A 3MXPA 1YZ6A 1PH9A 1VMCA 3VYRA 1LTAD 1D1IA 1TS3A 2F0EA 4K5VA 1A3VA 1PFSA 5C0XH 1EEID 2K6AA 3J80c 1PYSB 2L5TA 4UHVA 4RGTA 1I4QA 1IKMA 2ZTEA 2WKCA 2B2WC 4LUZA 3BZDB 1I4PA 3BG3A 4A3JB 4MN3A 3PUZA 4YCVA 4JI6Q 3BVZA 2GN5A 5FJ8G 5C4JB 1WTQA 3H6MA 2AKWB 4DF7A 5FOBB 4B3ML 3S9WA 3R8BA 4DK0A 2F0JA 4KHPQ 3RZDH 2B63B 4BY1H 3U50C 5BN3A 3GTOH 3PUYA 5IOCA 3SK8A 1SEBD 2R93H 2EYPA 4PG3A 3PIP3 4M8AA 4DR7Q 1NMGA 1D2BA 4R9WA 3Q23A 1VQNA 2F4IA 3R2IA 1C7YA 4A3LG 2P5ZX 1VQ7A 4F7XA 4PNYA 2F0MA 4S3SA 1YI2A 1I3QB 1WCMH 2EYOA 3KLRA 3AYHB 2PMZE 1HR0Q 5M5YB 1ICFB 2BA0A 1F2MA 1E2VA 2JA6G 1VF7A 3UI2A 3M7NA 4DUZQ 4A3GG 1QCBD 1QVCA 5KYIA 5LL6S 1HA5A 4K2LA 2JEAI 5CV8A 2A1AA 2EYHA 4LK1C 5C0XI 5FJ8H 3FPPA 4WJWA 4DV6Q 1W3SA 2N49A 4GNXA 1Y14B 2KJXA 2YTYA 1ASYA 4XQJA 4R4CA 3TP8A 1SROA 1QNUA 4N8X1 2ASBA 4GS3A 3GTLH 1YHAA 5EGTA 5A35A 5JPMC 1UEAB 3S16B 1G6PA 5FLXL 1TWFB 3QOLA 3S24A 2UU9L 3PO3G 4RKBA 1ZEQX 4KKTA 1HNWL 2KHIA 1PRTB 2ZTCA 4JI3L 2IW3A 4A3LH 1BCPB 2KA7A 3A5ZB 1XJVA 4RHSA 3KDFA 1SNOA 4ALPA 2E5LQ 1HR0W 1A6XA 1EY5A 4A3IB 1STGA 2EJGC 1TT2A 2I0QA 4DXGA 3L2PA 4LFCQ 2FHTA 1N9WA 5M3MB 2JA6H 2F3WA 1LTSD 3I70A 2HQEA 4A3GH 3UDFA 1E1OA 3TS2A 2OCEA 1MHWC 1BNZA 4B9XA 4R4OA 5C5LA 4LF5Q 5GAHC 5C44B 4KI0A 5EAYA 3RLOA 3VR5A 1CSPA 4RHRA 1PTOD 1SYDA 3T1HQ 2M2LA 1P8LA 1IL2A 1KNEA 4OWTB 2KQ3A 4IQZA 2GVBA 3U9OA 4C3JB 4G7HC 2IHEA 2VY3A 1YJWA 2VB2X 2ATWA 1MKHA 2BE5D 3A8KE 3C3LA 1JR0D 2XRSD 3OTOQ 4JV5L 4FF3A 2XN9C 2F0WA 4PZ8A 1YHQA 5L37A 1U5KA 4AH6A 4ZUIA 3PCOB 1EY4A 3OIQA 3CPFA 3OWFA 1N36L 2JA5B 4DR5Q 4JI1L 5C6AA 4UPAA 1STAA 1QJOA 5E3FA 1TR5A 1X54A 2X6LA 2KCCA 4JI5Q 1STNA 3A56A 1YNJC 5IWAQ 3VR3A 2K14A 1SLJA 4KHZA 1JC7A 1N34L 2AQ1B 3D4WA 5EPJA 5H1SE 2R92G 4RFBA 1IHZA 3NBHB 2MJ8A 1C0AA 1F9SA 3TBIB 1I4HA 5ELCA 5DLQE 3HFZB 1I6VC 2EYFA 1STYA 2Q2HA 3WOEA 2ALYB 4KN4C 2NN6H 3AU7A 4DAMA 3J81j 1VQBA 2EVBA 1LM0A 2ICEC 2UXBQ 2A5HA 2EXZA 2WINB 1AH9A 3HOUB 4DNRB 1RIPA 2QF7A 1Y1WB 2DJGC 1NSNS 1JB3A 1DZ1A 1VS0A 1WTOA 4B08A 2E2JB 3I3CA 1D8LA 3ZJYC 1HQMC 4XYOA 2RBMA 4OO1G 4ME3A 3R3OA 2MFIA 1V1PB 1O7LA 3ONAB 1PTOH 3CRLC 4TVAB 3K7UC 3J80E 2IWHA 4KTAA 1X3PA 2K5QA 2PZUA 3G7LA 3NSWA 4P2CB 1DYQA 3K5MA 1ZKOA 1K8AC 2R92H 1XNQQ 2VUMB 5FLXE 4DA2A 1SNQA 1HZAA 3ERQA 4G4KA 3PO2G 4C3IB 5AJ3L 3CKIB 2HIXA 1EY6A 4LJZC 5DAUA 5G3LD 2MP1A 4KD4A 2A68C 2VNUD 2L11A 2RDGA 1E1TA 4JI6L 3NQTA 4OIJA 2PO4A 3VA5A 1YNNC 2EJMA 2LXJA 3I72A 4TQUS 4KKSA 4R4QA 4H44C 1CKNA 2I07B 3JAMc 1L2FA 2CQAA 2B2YC 4PMBA 4KHPL 1CZGA 3I4NB 3OMGA 5JEAG 5BN5A 1J5EQ 4HCSA 2DGYA 2QKIC 1XTCD 1QVFA 1L1OC 4OO1H 2NN6I 4LNQA 1XMQQ 3OW7A 4HTHA 3MXGA 4X66Q 4O0AA 3H09A 1VQOA 4DR7L 4HJ9A 3EN2A 2FJ2A 4I7AA 4OX9Q 2F0VA 1CTMA 1HZCA 3TZUA 3M4YA 2UUBQ 4BY7G 1J9OA 1N32Q 5JVH3 1IZ6A 3LWUA 4HIKA 3I4MB 2D0OA 4DAYB 3G6EA 4PMWA 4ZQ3A 1SNCA 1SYEA 4HMJA 1HR0L 2RCFA 2NVQB 3DEPA 4LUOA 3LNNA 1QG7A 5AFWA 1CKMA 2ENBA 2DY7A 3X3MA 4BXXG 1Z9FA 4KJOA 4G57A 1PH4A 4DUZL 3HEJA 1OXTA 1EFID 3DLLA 5EQ0A 3CXCA 1GUOA 4JOIA 1B3AA 1KNAA 4C3HB 1RHPA 2F0HA 4DV0Q 2PQAA 5I6WA 1F9RA 1KDCA 1AE3A 4H13C 4JI0Q 3CHBD 3FKIB 2K75A 3HP3A 3HOXG 3ICEA 5KRUA 2IX3A 5JEAH 4A93B 3SK4A 4ZKBB 2NZHA 1LT6D 4POFA 2NZ1D 1QZGA 1TWAB 1HZ9A 4NMZA 5CBAE 2LXKA 4JI4L 2RA4A 1QZHA 3KBGA 4A4IA 3IFTA 1PV4A 1LTRD 2B39A 2F0TA 5C5MA 4CJ0B 1E24A 1LTGD 5NUCA 2L12A 1QB5D 4BY7H 3J81L 1WVLA 4ZKCB 1LACA 4B3TQ 1PMRA 1M90C 3ZYYX 2E5LL 4NB3A 3AFPA 2WACA 3GTJB 1DXMA 1R9TH 4LFCL 4BXXH 1S3OA 2BDNA 2DNCA 5K36G 1A0IA 1GXDC 4XIGS 2Z0SA 3I55A 4IOCA 1X3QA 2RDHA 1X9NA 3SDZA 1PYBA 1FYCA 2F0NA 3PQIA 1RDPD 2HD3A 1FD7D 1PLFA 1K8GA 1OO9B 2M00A 1I50B 1JE4A 4WJ3M 4A75A 2A6EC 1CKOA 1PH8A 5EKKA 2KHSA 3T1HL 4A3FB 3K81C 1NTGA 4CKBA 1VQLA 1YJ9A 3H91A 2QEXA 3PUVA 1F9QA 1IBMQ 1EYGA 5CBEE 5CYUA 1A3TA 3URYA 1SE2A 3NTHA 3OTOL 2F0SA 2UXCQ 1TY2A 4X3UA 3GO5A 1VQIA 2G5DA 4A3DB 4LF8Q 3KYHC 3TEHB 4DNTB 4CBVA 2WIIB 1YBYA 2NVYH 2OXPA 5FO8B 3C2PA 3CCEA 4FF1A 1GUWA 5C3EB 4CGYB 4DR5L 2X69A 1ET6A 3T4AC 2B2UC 3PIPA 1WFQA 4CHTB 2NBFA 4IALA 3QOJA 3J7AV 2PQEA 4JI5L 1L1OB 2UUAQ 5IWAL 1LTLA 4IUNA 3NHHA 1ESFA 5M5WH 4PV1C 4RGMA 2JA7G 3BDOA 4DR1L 2NTSA 1S4ZA 1DJRD 1N33Q 4A3EG 3S1QH 2BH8A 4C56C 4B9WA 3CF5A 4RKLA 1EQQA 2ZTDA 4A3BB 3OPOA 1KHIA 3RZDB 1YHBA 4BY1B 4U673 3UDXA 1G291 3OYYA 3GTOB 4DV7Q 4EVOA 1O7YA 3MXUA 1M4VA 2R93B 4AYBB 3CU7A 4UDUC 4NXMQ 3S2HH 2FMCA 1LUZA 1TVXA 3VYSA 1XMOL 2UXDQ 1LT4D 4JI2Q 3K0YA 1HH2P 3FRPB 3TDQA 1IXRA 2MO1A 1WCMB 1KIXA 5IGDA 1CI3M 3HOYG 1UE6A 3ND8A 5COYA 5IP9H 1HFGA 3ERSX 2EXDA 1YNXA 1H9SB 1XNQL 2JA7H 4YCUA 3CPWA 3GP7A 1I50H 1UUPA 3TRZA 4A3EH 3EFXD 3RD4A 4FF2A 1TWHH 1WTHA 1GUSA 2ZXOA 1PFNA 1FVIA 2SDFA 1S5ED 1PH5A 2PNRC 3K80C 4IOAA 4GKKQ 3GV6A 5I9PA 1XYIA 2NVXH 1PTOC 3GTLB 2R7ZG 3A8JE 2PW7A 1XXGA 2LS01 3ER0A 4MTKA 3M4QA 3E6ZX 1J5EL 2BE5C 2EY6A 3TS0A 2KEEA 3DM1A 4KLKA 1TWGH 2SOBA 2F0UA 3DWQA 5C0XJ 2OQ0A 2VZAA 3OSOA 1J6QA 2K52A 3KLWA 2ZJQA 4QMGA 1EOTA 2QA4A 4KD3A 5M5XH 1EQRA 3NELA 5DM63 3HOWG 3M85A 2E2IH 4OX9L 3CC2A 2K7VA 2ZJPA 2Z1CA 3Q8DA 2XWJB 3NPPA 3HOYH 1QOHA 2O5IC 1N32L 2O4XA 3KF8B 4RWSC 3PGZA 3TN2A 4C1NK 2YU9H 2F52A 2KCTA 1PDQA 1I4RA 2JA6B 1WTXA 4IFDJ 4G7OC 4A3GB 1LABA 4HJAA 3TREA 3GTGH 4FXGC 1FJGL 1A2TA 5FLXc 2Z4IA 5C4XG 1CM9A 1ICWA 1Q1BA 1PXUA 3TMEA 4A3BH 1EZ6A 4IFDH 1HNZQ 4DR6Q 5A2QL 4P72A 2R7ZH 1WI5A 5J1ZA 4JI0L 1B7YB 4X3TA 4BBSH 3AQQA 1BQQT 3S1NH 4XQQA 4QY7A 2EIFA 1VQGA 2D5DA 3FEWX 2CW0D 3STBC 4L6TB 1ESRA 1JWUD 1NY4A 4TRDA 2RF4A 1A3UA 2B3GA 3HOWH 2B2VC 3CC4A 3HKZE 2K28A 1B70B 1TU2B 1EY8A 2QCPX 1TWCH 1FL0A 1WD1A 1WJJA 4I7ZC 4B3TL 1PH1A 2E76C 3SGIA 3KJOA 1ILPA 1MSHA 1ENFA 4NW2A 1KLGD 3MEHA 5CV6A 1HTPA 4LF7Q 4ID6A 3J80i 4DAVA 3HOVG 4L63B 3W2DA 4PQXA 2F0PA 5C4XH 2EZVA 4QCLA 1Z47A 3NE5B 5IGEA 1OXXK 2K5VA 1G2SA 1I5FA 2WAQE 1SDFA 4KMUC 1SMYD 3DXJC 2E75C 3KFUA 4QQBX 3OWEB 3TSSA 1J8IA 3CP0A 1M8AA 1HUNA 1RCVD 3GTKH 1EU4A 2XGTA 4IZ8A 2F03A 3E0EA 4FF4A 1IBML 1Z6HA 1KTKA 2AMCB 2N88A 3P1HA 1KLUD 4JBKA 4IFDI 4PZ6A 2LSSA 2WKDA 4QIWB 2UXCL 1B44D 2Z6KC 3I4LA 2KHJA 1DCZA 4JI7Q 2IPKD 4LF8L 1SN8A 1TQOA 5E4XA 1V1OA 4X65Q 5JJIA 1PTOB 1K83H 3SE0A 4RAUC 5D65A 2G9HD 1EY0A 3HOVH 2IT1A 5CV7A 5IT9L 2JQOA 2F0LA 4Y7NH 3SEBA 3IAYA 2UUAL 3S1RH 1XTDA 2PZWA 1MBYA 4FDBA 2R92B 4P71A 2DUDA 3J7A5 4K8IA 4M1UB 1W6KA 1AZQA 1NNXA 3LGJA 1N33L 2R3ZA 4TSSA 1KRTA 1H95A 1VDZA 4PZ7A 4B3SQ 1A15A 3PO3H 1HPCA 5IYBG 3G6JB 1IYJB 2N3SA 1LTID 2H5XA 2JA8G 3X3NA 3CMAA 5T1GA 3CCQA 1BUVT 3V2TA 2L55A 3D4DA 1BBUA 3GTMH 2IL8A 5ELEA 4DV7L 1S72A 2D0PA 3NTKA 5E1FA 4DGZA 5M3FG 4LFAQ 3M9BA 3E3XA 4F88A 4KY6A 4NXML 1X56A 5JVG3 5I2YA 2K33A 2Q8TA 4GOPC 3VR4A 2UXDL 4JI2L 4XQNA 2UUCQ 1IKLA 3R93A 2OTJA 2EY1A 2VQFQ 4HCEA 2QW7A 3NK9A 1I94Q 4ILWA 1CFMA 3PMFA 4XTCS 4A3IG 2RSNA 3PO2B 5GQOA 4K0KQ 1IYUA 1ZXTA 2B2TA 3I91A 3CW2C 1SSOA 4A3KG 1K3RA 3KJPA 2JN4A 3DWPA 4KN7C 1EYCA 3DUZA 2VQEQ 2MNAA 2JA8H 1YIJA 4IPDA 2EJFC 4WORA 2V4DA 2WV6D 1ML0D 5C44G 4POGA 4LW1A 1G2TA 3BYTB 3RN2A 5M3FH 3PIO3 2ZXRA 4UP7A 1V9PA 2HDMA 4X3KA 4EX5A 1AFPA 3M4PA 4IUPA 4YY3Q 3NQIA 1O7ZA 2CCZA 4YWMA 3CCVA 4OWWB 4BS9A 3SR1A 5GAEC 4BY7B 4V190 1H9KA 4KK7A 4APVA 4LF9Q 1SYCA 2R61A 3NP8A 3WWVA 3DEOA 3EROA 2K05A 2AUKA 1R9TB 2JYOA 4IPHA 2Z4HA 3OMCA 2CWPA 1IBLQ 4CJ2C 3S2DH 1EWCA 4A3KH 1SE8A 1SJHD 5C4ZA 1WD0A 4K14A 4JBMA 3MXNB 3K6OA 2RKSA 4L8JA 3OOCA 5LMNQ 3ND9A 1QVGA 4JI8Q 1TS5A 3D31A 4A3CG 4DPGA 5JAVA 1HNZL 3T51B 1EFWA 3DHQA 3HOXB 1EZ8A 4DR6L 5LHY1 1Y8NB 2F4VQ 1KL9A 4K2KA 4X3SA 3EVQA 1DM0B 1NCVA 4HJ8A 4L5TA 5CMDA 4OONA 2AHOB 3H15A 3S14H 4X6AH 4K6DA 1D5XC 2B2WA 1U0LA 1XPUA 4GKJQ 3J81c 2Q2UA 2F0QA 4NP5A 1LTBD 2KECA 4CJ1B 1F2LA 1BBWA 1X65A 2KEDA 1SE4A 3EA6A 3CCSA 2RSOA 3K8AA 1QNKA 4XT1B 3RMHA 2NVTH 4JYAQ 2TSSA 2L9HA 2CFMA 1E2ZA 2ID0A 3L0OA 3HZXA 1K73C 3R2TA 2EY2A 2NVYB 4JC0A 1VQ9A 4BWGB 2PMZB 3QB3A 1FNWA 1F9PA 2F0DA 1DGSA 5I9OA 1JOOA 5FK9C 5JPNC 5D3DA 3S15H 4G7ZC 4LUVA 5CV4A 1F2YA 4IURA 4FXKC 1DONA 4LF7L 3PO2H 3BS1A 3IFDA 3NBHA 3C1EA 1V8QA 5JEAJ 1CQFA 2JE6I 1XX8A 2BH2A 3S17H 2VS1A 5LMNW 5M5WB 4DV6L 1PFBA 2I5LX 3F2BA 1DOKA 1WTWA 4P75A 4XYQA 1ENCA 3S1QB 1X6OA 5EBCA 1EY9A 3V96A 4GOPB 2JJQA 3H94A 4FNFA 1EIFA 2Y0SB 1NAPA 3JAMi 2SNSA 3D8GA 1TIID 1XPOA 1HCZA 3GTPH 5EPLA 5CV9A 2E2HH 5IYDG 2A6HD 1PA6A 3A8IE 4ULLA 2L15A 1K0SA 3KUPA 3P75A 1L0WA 4EQOA 5ELNA 3PUWA 1VQDA 4HIMA 3OIPA 4R4IA 2I5HA 4JI7L 4WRDA 3HKZG 2C35B 2R7FA 5BN4A 4OO1I 1T5EA 3S2HB 5C4HA 1Y8PB 4HMIA 3LX0A 5DEHA 4CDFC 4EQNA 1GUTA 4J6HA 4X65L 4E6IA 4O2DA 2Z8LA 2XWBB 3N6RA 3UDIA 3SHLA 3P20A 2K4KA 2L0CA 4IPGA 2JEBI 4B3RQ 2F3VA 1CHPD 3U9SA 2ZJRA 4DV1Q 3VYTA 1IYVA 2HQLA 5C3WA 4GNXC 3BVGA 4CDCC 2KBNA 2QILA 1SE3A 2JA7B 4A3MG 2OT2A 4YHHQ 4LF5L 3M4OH 3H0GG 1TXYA 5LL6X 4A3EB 3PSIA 3HOXH 2WAQG 4C2MH 2HT1A 1TWHB 2EPBA 3D6CA 1GUGA 1A2UA 1SMXA 4ZUJA 2OF1A 4B3SL 1P16A 2NVXB 3AMUA 1H9RA 1SNDA 3CD6A 4LF4Q 5IYDH 1RJTA 2PYKA 1B2TA 4IUUA 1BOSA 2L4NA 1VQAA 2H1EA 4LFBQ 1K28A 3CMEA 5JJLA 1Z7TA 3HGBA 5IGBA 1PVOA 1TWGB 2XTIA 2CW0C 3FDTA 2RCNA 1CA5A 1WOCA 4CKCA 4XDXA 1D1KA 4LFAL 1ZYRD 2F0GA 1S5CD 3D0FA 3SVMA 1SRUA 5M5XB 1HNWQ 4DAYA
chains in the Genus database with same CATH topology
2K5WA 1STHA 2E2IB 1K8MA 2Q8IB 4RH6A 5K36H 2HUGA 1C4QA 3HOYB 4FYDA 3K59A 3O13A 2YU9B 4LAAA 1I4XA 2AQ3B 2LFNA 4J8QA 3GTGB 2MPMA 1AZPA 5D3IB 2LMCB 2CHBD 1Q3LA 2WB1B 1SMYC 3I73A 3TP7A 4DU9A 2R7ZB 1MGSA 1D5ZC 2F0KA 4BBSB 3S1NB 4FVMA 2K1BA 1RD9D 4HEDA 1JICA 3L3OC 2NB0A 4U68A 3A54A 4FO2A 2KOLA 3HOWB 2IX1A 3WDNA 2E74C 2CVRA 3I8ZA 1FNVA 1TWCB 1TKWB 4KV6A 2DY8A 2JSOA 1TY0A 1LT3D 1B9MA 3CRKC 5T1IA 1IW7D 2SNMA 4QF4A 3D4RA 4LMQD 5JJZA 5C4XB 1PTOF 1SXTA 1EQTA 2SEBD 1I4GA 3AB9A 3J81E 2JP1A 5DNFA 1BXTA 2A73B 3KLSX 3GTKB 1CQVA 1NR4A 4F87A 3TP5A 3HS0C 2OEOA 3RUZA 5FO7B 1DOLA 2E2DC 2EY5A 2MHVA 5J22A 2BCOA 2B2YA 4RGNA 3RLFA 3IL8A 5HGTA 4JK1C 2AWOA 1K83B 2K04A 3VA7A 2HDLA 1O78A 1Q8IA 3HOVB 1ONLA 3DWAA 2B8GA 5KNBA 4Y7NB 3MHBA 1UAPA 2MUYA 3S1RB 4HSPA 1Y8OB 5C3XA 3MZ5A 1EQVA 4ME5A 2XIWA 2I46A 3L9AX 4PMCA 1EIGA 3D6WA 4NKLA 1EY7A 3PO3B 2B8FA 3P7JA 2A6ED 3W3AA 2F0FA 1G91A 2NWGA 1T5XD 4UAIA 5IGGA 3GTMB 5DM73 3MFYA 1SYBA 3NXWA 4HR7B 2EE1A 1HUMA 1EEFD 1U4RA 1HXYD 5F2DA 2EOTA 1PFMA 3EQLC 4Q0FA 2A69D 1H9SA 3DMUA 3D3RA 3K5LA 1EYAA 3GTQB 4QUCA 2ICIA 1HQRD 4XT3B 5G3LF 3PV0A 1NUCA 3NUCA 1OXSC 3K5NA 4H0LC 3VR6A 3A7AB 4HAEA 1E2WA 5EKLA 1TS2A 5ISRA 4Z9CB 3J80L 2JA8B 4GZYC 5KYLA 4KY5A 3MC0B 1D5MC 3TP6A 1AW7A 3KK7A 1SAPA 3PUXA 5M3FB 5K5PA 2LKVA 4KKUA 4OGQC 1CK1A 1EYDA 3I90A 3KF8A 3FPUB 1SYFA 1WTPA 5J39A 4HN7A 1GHKA 1UNSA 5EKIA 4YIJA 3S2DB 2ZXPA 4A3KB 1DD2A 1PRTD 2B2UA 3QIAA 1BCPD 1GUNA 1B9NA 2F0IA 2VB3X 5FKAC 4DXFA 2BDOA 4KY7A 1S5FD 4N9PA 5CORA 1II3A 2KUMA 3J7AF 2D9UA 3S14B 1SBBB 4IUVA 1JORA 1C48A 2M9VA 1CHQD 2J7ZA 1RODA 4FP5D 1RTOA 2A6HC 1ENAA 1C8CA 2NN6G 1EL0A 1BBXC 1Q90A 2EDGA 1JQYD 5IODA 2AWNA 2NVTB 2YYZA 1B4OA 1SYGA 2NUCA 4BA1I 5A2QE 4EQPA 1OXUA 4JBWA 1BO0A 1QILA 3S15B 3BYYB 4IN3A 2X6GA 2FMMA 3S17B 2N55A 1GJXA 5EBDA 3C1FA 3BDCA 4DK1A 1CA6A 4ZLTF 1TS4A 3A55A 4F8MA 1VF5C 1LT5D 1ILQA 4K5XA 3NWTA 3GTPB 1PZID 2IX0A 3MA2B 2E2HB 4C3JG 1XWEA 4R8NA 3IKJA 2L1BA 4N9TA 3T56B 2DN8A 5KNDA 3MTSA 3QWNA 3T13A 2RVLA 3K5OA 1ZYRC 1VMPA 3LWEA 1CT1D 5KNCA 1FGBD 1HFNA 1S5BD 5ELDA 1VCIA 1EU3A 5IGFA 2R6GA 3T53B 1GOZA 4RCOA 4NDXA 3M4OB 1KAAA 3QG1A 2QDBA 2IJ0A 4C2MB 3Q22A 2C9OA 1U4PA 2G9DA 3GQBA 4MIUA 2XNAC 5I4DA 1L0XB 4O42A 2LY7A 5IT9E 2GA4B 1FR3A 1D6EC 4HSVA 3HKZB 1O80A 5E4WC 1R4PB 4CKEA 1U9RA 4XXEA 2EYMA 3VYUA 3NTIA 1B53A 3L7ZC 1LO5D 3M7GA 5IGCA 5CC4A 1Q12A 4KJNA 2B2VA 4RGOS 4A3MB 1V43A 3H3VC 5CGKA 1IW7C 1PYWD 2EYJA 4QUFA 4ZK9B 3E0JA 3H0GB 4OHJA 2WAQB 1F77A 3MVVA 1OXVA 3GV3A 5D14A 3C46A 4C3IG 4OIKA 1CZWA 1FNUA 2J0TD 5EPKA 3S1MB 2PW5A 3Q6SA 3Q0AA 1V1PA 3BDLA 3WOFA 3K57A 2O2LD 1KDBA 3V05A 2KCNA 1MI2A 3FMCA 2PZTA 5TSSA 1G6ZA 3QJYA 2AQ2B 1WTVA 1BR9A 1W6JA 1Q1EA 5ELFA 3JAML 2K32A 3N52A 1MSGA 3ITPA 1B1ZA 1AEXA 5I6YA 3MXNA 1YNJD 5FO9B 4C1NI 2D2CC 2QEJC 4H7BA 1Y69U 4RA8A 1L0YB 1K8OA 3Q24A 1EWHA 1U4MA 1E0BA 4RCNA 4OL7A 3SK5A 4C3HG 5M9OA 4QB4A 5EJWA 2RQXA 1SNMA 2PCFB 1JWSD 1B50A 1IL8A 2O5JC 1I6HB 4I65A 4BBRB 5KIXA 2C5CA 1QWYA 3VR2A 4MHEA 4R8IA 4ZRZA 1HTLD 1LTTD 3CQZB 5ELBA 2F0OA 5KGUA 1JCKB 4IUTA 5IIFA 1G8ZD 5CR3A 1NR2A 3K7AB 4WFN3 1DOMA 2BA1A 1GHJA 1AN8A 2A69C 1U4LA 3M3YB 2K03A 2WP8J 1HHVA 1H9JA 1RTNA 1KABA 5KEEA 2RDFA 4ZYSA 3E5SA 1MD2D 3QO2A 1JWMD 2A68D 3F2UA 2NTTA 1HRJA 5I2XA 2TMPA 4DFAA 2XVSA 4DN4M 1HA6A 1YNND 3HG9A 4Q5VA 1H9MA 2FFKB 2K5DA 3KLSA 2EYLA 2NYZD 2K01A 3OHXC 3NBIA 4K6LA 2FINB 2HCCA 4ODGA 4BA2I 1LV9A 1RF2D 4K8JA 2PPBC 1RKNA 4ZAIA 2KVMA 2AUJD 4K5WA 1KDAA 3HOZB 4FXDA 1F2ZA 3HRZC 1PZJD 2BOSA 1S5DD 2H4OA 3SXHA 2JXMB 1R4QB 2B2TC 4J1MA 3NWSA 3J7YW 2VXWA 3T16A 4TKOB 1SNPA 2MGSA 1QE6A 1ET9A 4V0BA 5HURA 4ABNA 3EJIA 1BDOA 5C0XG 1BF4A 1PRTF 3GD7A 3TZDA 1EIHA 1BCPF 3A7LA 4EGVA 1STBA 2ZT9C 2A74C 3RZOB 1PZKD 2F1MA 1PRTC 1WTRA 1Y1VB 3MFGA 1BCPC 3SK6A 2DNEA 3K58A 2Q8RE 3JAME 1X32A 2D62A 4KHVA 4IFDG 3FVQA 2HCIA 3KBXA 1SFOB 1LLRD 2XSCA 5CV5A 3MAQA 1JOKA 2J4XA 1AP0A 5JOBA 4DAPA 4O1NA 1JOQA 1SJED 1STEA 2XRQD 3BVMA 4IUQA 3MWYW 3MXPA 1VMCA 3VYRA 1LTAD 1D1IA 1TS3A 2F0EA 4K5VA 1A3VA 5C0XH 1EEID 2K6AA 2L5TA 4RGTA 1I4QA 1IKMA 2WKCA 2B2WC 3BZDB 1I4PA 3BG3A 4A3JB 4MN3A 3PUZA 3BVZA 5C4JB 1WTQA 3H6MA 4DF7A 5FOBB 3S9WA 3R8BA 4DK0A 2F0JA 2B63B 5BN3A 3PUYA 5IOCA 3SK8A 1SEBD 2EYPA 3PIP3 1D2BA 4M8AA 4R9WA 3Q23A 2F4IA 3R2IA 4F7XA 4PNYA 2F0MA 4S3SA 1I3QB 2EYOA 3KLRA 5M5YB 2BA0A 1F2MA 1E2VA 1VF7A 3UI2A 3M7NA 1QCBD 5KYIA 5LL6S 1HA5A 4K2LA 2JEAI 5CV8A 2EYHA 4LK1C 5C0XI 3FPPA 4WJWA 2KJXA 4XQJA 3TP8A 1QNUA 5EGTA 5A35A 5JPMC 3S16B 1UEAB 5FLXL 1TWFB 3QOLA 4RKBA 1ZEQX 4KKTA 1PRTB 2IW3A 1BCPB 2KA7A 4RHSA 1SNOA 1A6XA 1EY5A 4A3IB 1STGA 2EJGC 1TT2A 4DXGA 2FHTA 5M3MB 2F3WA 1LTSD 3I70A 2HQEA 1BNZA 4B9XA 5C5LA 5C44B 4KI0A 3VR5A 4RHRA 1PTOD 1SYDA 2M2LA 1KNEA 2KQ3A 4IQZA 3U9OA 4C3JB 4G7HC 2VB2X 2BE5D 3A8KE 3C3LA 1JR0D 2XRSD 4FF3A 2XN9C 2F0WA 4ZUIA 1EY4A 3OIQA 3OWFA 2JA5B 5C6AA 1STAA 1QJOA 5E3FA 1TR5A 2X6LA 2KCCA 1STNA 3A56A 1YNJC 3VR3A 4KHZA 1JC7A 2AQ1B 3D4WA 5EPJA 4RFBA 1IHZA 2MJ8A 1F9SA 3TBIB 1I4HA 5ELCA 1I6VC 2EYFA 1STYA 3WOEA 4KN4C 2NN6H 3AU7A 2EVBA 2ICEC 2A5HA 2EXZA 2WINB 3HOUB 4DNRB 2QF7A 1Y1WB 1NSNS 1JB3A 1DZ1A 1WTOA 4B08A 2E2JB 3I3CA 1HQMC 4XYOA 2RBMA 4OO1G 3R3OA 1V1PB 1O7LA 3ONAB 1PTOH 3CRLC 3J80E 2IWHA 4KTAA 1X3PA 2K5QA 2PZUA 3G7LA 3NSWA 4P2CB 1DYQA 3K5MA 1ZKOA 2VUMB 5FLXE 4DA2A 1SNQA 3ERQA 4G4KA 4C3IB 3CKIB 1EY6A 4LJZC 5DAUA 5G3LD 2MP1A 4KD4A 2A68C 2VNUD 2L11A 2RDGA 3NQTA 4OIJA 2PO4A 3VA5A 1YNNC 2EJMA 4TQUS 3I72A 4KKSA 4H44C 2I07B 2CQAA 2B2YC 4PMBA 1CZGA 3I4NB 3OMGA 5JEAG 5BN5A 4HCSA 2QKIC 1XTCD 4OO1H 2NN6I 3OW7A 4HTHA 3MXGA 3H09A 2FJ2A 2F0VA 1CTMA 3TZUA 3M4YA 1J9OA 5JVH3 3LWUA 3I4MB 4PMWA 4ZQ3A 1SNCA 1SYEA 4HMJA 2NVQB 3DEPA 3LNNA 1QG7A 5AFWA 2ENBA 2DY7A 3X3MA 4KJOA 4G57A 3HEJA 1OXTA 1EFID 5EQ0A 1GUOA 1B3AA 1KNAA 4C3HB 1RHPA 2F0HA 5I6WA 1F9RA 1KDCA 4H13C 3CHBD 3FKIB 3HP3A 5KRUA 2IX3A 5JEAH 4A93B 3SK4A 4ZKBB 1LT6D 2NZ1D 1TWAB 4NMZA 5CBAE 2RA4A 3KBGA 3IFTA 1LTRD 2B39A 2F0TA 5C5MA 4CJ0B 1LTGD 5NUCA 2L12A 1QB5D 3J81L 1WVLA 4ZKCB 1LACA 1PMRA 3ZYYX 2WACA 3GTJB 1DXMA 2BDNA 2DNCA 5K36G 1GXDC 4XIGS 1X3QA 2RDHA 3SDZA 1FYCA 2F0NA 1RDPD 1FD7D 1PLFA 1OO9B 2M00A 1I50B 1JE4A 2A6EC 5EKKA 2KHSA 4A3FB 4CKBA 3H91A 3PUVA 1F9QA 5CBEE 5CYUA 1A3TA 3URYA 1SE2A 3NTHA 2F0SA 1TY2A 4X3UA 3GO5A 4A3DB 4DNTB 4CBVA 2WIIB 5FO8B 2OXPA 3C2PA 4FF1A 1GUWA 5C3EB 4CGYB 2X69A 1ET6A 3T4AC 2B2UC 4CHTB 2NBFA 4IALA 3QOJA 3J7AV 2PQEA 4IUNA 3NHHA 1ESFA 4PV1C 4RGMA 3BDOA 2NTSA 1S4ZA 1DJRD 4C56C 4B9WA 4RKLA 4A3BB 3OPOA 3RZDB 4BY1B 4U673 3GTOB 1G291 4EVOA 1O7YA 3MXUA 1M4VA 2R93B 4AYBB 3CU7A 4UDUC 2FMCA 1TVXA 3VYSA 1LT4D 3K0YA 3FRPB 3TDQA 1WCMB 5IGDA 1CI3M 3ND8A 5COYA 1HFGA 1H9SB 3GP7A 1UUPA 3EFXD 3RD4A 4FF2A 1GUSA 2ZXOA 1PFNA 2SDFA 1S5ED 2PNRC 3GV6A 5I9PA 1XYIA 1PTOC 3GTLB 3A8JE 2PW7A 1XXGA 2LS01 3E6ZX 2BE5C 2EY6A 2KEEA 3DM1A 2SOBA 2F0UA 3DWQA 5C0XJ 3OSOA 4QMGA 1EOTA 4KD3A 5DM63 3M85A 2K7VA 2Z1CA 2XWJB 3NPPA 1QOHA 2O5IC 2O4XA 4RWSC 4C1NK 3TN2A 1PDQA 1I4RA 2JA6B 1WTXA 4IFDJ 4G7OC 4A3GB 1LABA 4FXGC 1A2TA 2Z4IA 1CM9A 1ICWA 1Q1BA 1PXUA 3TMEA 1EZ6A 4IFDH 5A2QL 5J1ZA 4X3TA 1BQQT 4XQQA 2D5DA 3FEWX 2CW0D 4L6TB 1ESRA 1JWUD 4TRDA 1A3UA 2B2VC 2K28A 1TU2B 1EY8A 2QCPX 1WD1A 4I7ZC 2E76C 1ILPA 1MSHA 1ENFA 4NW2A 1KLGD 3MEHA 5CV6A 1HTPA 4ID6A 4DAVA 4L63B 3W2DA 4PQXA 2F0PA 2EZVA 4QCLA 1Z47A 3NE5B 5IGEA 1OXXK 1G2SA 1SDFA 4KMUC 1SMYD 3DXJC 2E75C 3OWEB 3TSSA 1J8IA 1M8AA 1HUNA 1RCVD 1EU4A 4IZ8A 2F03A 4FF4A 1Z6HA 1KTKA 2N88A 3P1HA 1KLUD 4IFDI 2WKDA 4QIWB 1B44D 3I4LA 1DCZA 2IPKD 1TQOA 5E4XA 1V1OA 1PTOB 3SE0A 4RAUC 5D65A 2G9HD 1EY0A 2IT1A 5CV7A 5IT9L 2F0LA 3SEBA 3IAYA 2R92B 2PZWA 1MBYA 4K8IA 4M1UB 1W6KA 1AZQA 2R3ZA 4TSSA 1VDZA 1A15A 1HPCA 3G6JB 1LTID 3X3NA 5T1GA 1BUVT 3V2TA 2L55A 3D4DA 2IL8A 5ELEA 3NTKA 5E1FA 4DGZA 4F88A 4KY6A 5JVG3 5I2YA 2K33A 2Q8TA 3VR4A 4XQNA 1IKLA 3R93A 2EY1A 4HCEA 3NK9A 4ILWA 1CFMA 3PMFA 4XTCS 2RSNA 3PO2B 1IYUA 1ZXTA 2B2TA 3I91A 1SSOA 3DWPA 4KN7C 1EYCA 3DUZA 2EJFC 4WORA 2V4DA 2WV6D 1ML0D 1G2TA 3BYTB 3PIO3 2ZXRA 2HDMA 4X3KA 1AFPA 4IUPA 3NQIA 1O7ZA 4BS9A 3SR1A 4BY7B 4V190 1H9KA 4KK7A 1SYCA 2R61A 3NP8A 3DEOA 3EROA 2K05A 2AUKA 1R9TB 2JYOA 2Z4HA 3OMCA 4CJ2C 1EWCA 1SJHD 5C4ZA 1WD0A 4K14A 3K6OA 2RKSA 4L8JA 3OOCA 3ND9A 1TS5A 3D31A 5JAVA 3HOXB 3T51B 3DHQA 1EZ8A 5LHY1 1Y8NB 4X3SA 4K2KA 3EVQA 1DM0B 1NCVA 5CMDA 4K6DA 1D5XC 2B2WA 2F0QA 4NP5A 1LTBD 2KECA 4CJ1B 1F2LA 2KEDA 1SE4A 3EA6A 2RSOA 3RMHA 1QNKA 4XT1B 2TSSA 2L9HA 1E2ZA 2ID0A 3HZXA 3R2TA 2EY2A 2NVYB 4BWGB 2PMZB 3QB3A 1FNWA 1F9PA 2F0DA 5I9OA 1JOOA 5JPNC 5FK9C 5D3DA 4G7ZC 5CV4A 1F2YA 4IURA 4FXKC 1DONA 3BS1A 3IFDA 3NBHA 3C1EA 1V8QA 5JEAJ 1CQFA 2JE6I 1XX8A 5M5WB 1PFBA 1DOKA 1WTWA 4XYQA 1ENCA 3S1QB 5EBCA 1EY9A 3V96A 3H94A 4FNFA 2Y0SB 1NAPA 2SNSA 3D8GA 1TIID 1HCZA 5EPLA 5CV9A 2A6HD 3A8IE 4ULLA 3KUPA 3P75A 4EQOA 3PUWA 3OIPA 4WRDA 5BN4A 4OO1I 1T5EA 3S2HB 5C4HA 1Y8PB 4HMIA 3LX0A 5DEHA 4EQNA 1GUTA 4J6HA 4E6IA 2Z8LA 2XWBB 3N6RA 3SHLA 3P20A 2L0CA 2JEBI 2F3VA 1CHPD 3U9SA 3VYTA 1IYVA 5C3WA 3BVGA 2QILA 1SE3A 2JA7B 2OT2A 5LL6X 4A3EB 1TWHB 2EPBA 3D6CA 1GUGA 1A2UA 4ZUJA 2OF1A 2NVXB 3AMUA 1H9RA 1SNDA 1RJTA 2PYKA 1B2TA 4IUUA 1BOSA 2L4NA 2H1EA 1Z7TA 3HGBA 5IGBA 1TWGB 2CW0C 3FDTA 1CA5A 4CKCA 4XDXA 1D1KA 1ZYRD 2F0GA 1S5CD 3SVMA 5M5XB 4DAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUY A;  4H0L C;  1OXS C;  3IFT A;  4KI0 A;  3VR6 A;  3VR5 A;  1K8M A;  2EJF C;  2JE6 I;  3A7A B;  2V4D A;  4TKO B;  1OXU A;  3OPO A;  1LAB A;  4JBW A;  5K36 H;  4RCN A;  1E2W A;  1ZKO A;  1BDO A;  4IQZ A;  4G7H C;  1LAC A;  3SE0 A;  5C0X G;  1PMR A;  2Q8I B;  3GD7 A;  1G29 1;  1Q1B A;  2BE5 D;  2IT1 A;  3H94 A;  3A8K E;  3A7L A;  4IFD H;  4GZY C;  3L7Z C;  2PCF B;  2ZT9 C;  4LJZ C;  2A68 C;  3RLF A;  2O5J C;  1GJX A;  2F1M A;  1DXM A;  3MXU A;  4JK1 C;  1HCZ A;  3KLR A;  4DK1 A;  2AWO A;  3PUX A;  1YNN C;  2DNC A;  2EJM A;  3I72 A;  4TQU S;  2A6H D;  1Q12 A;  1H9K A;  2DNE A;  3A8I E;  2BA0 A;  1O78 A;  4H44 C;  4KKS A;  4XIG S;  3VR2 A;  2LMC B;  1VF5 C;  1ONL A;  3SDZ A;  1E2V A;  1V43 A;  1FYC A;  1VF7 A;  1IW7 C;  2B8G A;  2D5D A;  1SMY C;  3I73 A;  2AUK A;  2D62 A;  3PUW A;  4KKU A;  4OGQ C;  5BN5 A;  5KNB A;  5JEA G;  3M7N A;  4IFD G;  1VDZ A;  1OXV A;  2JEA I;  1CI3 M;  1Y8O B;  1HPC A;  4OO1 H;  2A6E C;  3ND8 A;  2NN6 I;  4LK1 C;  5BN4 A;  1T5E A;  2BA1 A;  1GHJ A;  1Y8P B;  3FPP A;  3OW7 A;  1QJO A;  2A69 C;  1GUT A;  1TU2 B;  3IKJ A;  1H9S B;  3T56 B;  2KCC A;  2DN8 A;  3N6R A;  1YNJ C;  5KND A;  3PUV A;  4L8J A;  1H9J A;  3VR3 A;  1GHK A;  4I7Z C;  5A35 A;  3OOC A;  3P20 A;  3ND9 A;  4KHZ A;  2E76 C;  1CTM A;  3D31 A;  1GUS A;  3M4Y A;  2JEB I;  3TZU A;  1ZYR C;  2B8F A;  3U9S A;  3T51 B;  2A6E D;  3W3A A;  1HTP A;  3WDN A;  1Y8N B;  5K36 G;  2PNR C;  1IYV A;  2E74 C;  3LWU A;  1DD2 A;  2A68 D;  5KNC A;  1I6V C;  2JXM B;  1TKW B;  3LNN A;  3FMC A;  4KKT A;  3QIA A;  4KN4 C;  1GUN A;  2K33 A;  2NN6 H;  3A8J E;  1B9N A;  4DNT B;  5C0X H;  2EVB A;  1H9M A;  2BDO A;  3QJY A;  3NE5 B;  3VR4 A;  3MFY A;  2KA7 A;  1OXX K;  4HR7 B;  1GUG A;  2L5T A;  4DNR B;  1Q1E A;  1VCI A;  1B9M A;  3CRK C;  2BE5 C;  2QF7 A;  1IW7 D;  1OXT A;  4KMU C;  3DXJ C;  2E75 C;  2R6G A;  3T53 B;  1GUO A;  3D4R A;  3VA7 A;  1H9R A;  2K32 A;  3BG3 A;  4BA2 I;  2EJG C;  1A6X A;  1E2Z A;  3QG1 A;  1CFM A;  3PUZ A;  4XTC S;  4H13 C;  2A6H C;  1HQM C;  3EQL C;  2NN6 G;  2PPB C;  2A69 D;  4OO1 G;  1IYU A;  1Q90 A;  2EDG A;  1H9S A;  1Z7T A;  5JEA H;  1Z6H A;  3HGB A;  3M85 A;  3GQB A;  2K7V A;  2AUJ D;  2D2C C;  2CW0 C;  4DK0 A;  1Y69 U;  4PV1 C;  3AB9 A;  4G7O C;  1O7L A;  3BDO A;  4G7Z C;  2YYZ A;  3CRL C;  1K8O A;  2O5I C;  3PV0 A;  4KN7 C;  3I4L A;  5BN3 A;  1DCZ A;  1FR3 A;  1V8Q A;  1EWH A;  4BA1 I; 
#chains in the Genus database with same CATH topology
 2K5W A;  1STH A;  3FP9 A;  2E2I B;  1K8M A;  2QGQ A;  2Q8I B;  4JI3 Q;  2MO0 A;  4QIW E;  4RH6 A;  5K36 H;  2HUG A;  1C4Q A;  2UUC L;  3W1B A;  3HOY B;  4FYD A;  2VQF L;  5GAD C;  3K59 A;  3O13 A;  3KOJ A;  4P73 A;  2YU9 B;  2JK8 A;  1A8V A;  2N78 A;  4LAA A;  1I94 L;  4A3M H;  4X64 Q;  4IPC A;  1I4X A;  3VDY A;  2AQ3 B;  4HID A;  2LFN A;  4J8Q A;  3GTG B;  2MPM A;  1AZP A;  4K0K L;  5D3I B;  1GO3 E;  1Q82 C;  1HNX Q;  2LMC B;  3KF6 A;  2CHB D;  1G51 A;  1Q3L A;  2WB1 B;  4GLA C;  2UXB L;  1SMY C;  3I73 A;  3TP7 A;  4DU9 A;  3I56 A;  2R7Z B;  1CSQ A;  1MGS A;  3FHW A;  4HJ7 A;  2VQE L;  1D5Z C;  2F0K A;  4N8F A;  2VW9 A;  4BBS B;  2OTL A;  5J3B A;  3S1N B;  4FVM A;  2K1B A;  1RD9 D;  4HED A;  1JIC A;  3G71 A;  4MZ9 A;  1PH3 A;  3L3O C;  2NB0 A;  4U68 A;  1GD7 A;  3A54 A;  4MNO A;  2F3I A;  4YY3 L;  1JE5 A;  4FO2 A;  3OW2 A;  4BBR G;  2KOL A;  3HOW B;  1Q7Y C;  2IX1 A;  3WDN A;  2E74 C;  3B6Y A;  2CVR A;  5IE8 A;  3I8Z A;  1FNV A;  1TWC B;  1TKW B;  4LF9 L;  4KV6 A;  2DY8 A;  2JSO A;  1TY0 A;  1LT3 D;  1B9M A;  3CRK C;  5T1I A;  4JI1 Q;  1IW7 D;  2WFW A;  2SNM A;  4GN4 B;  4QF4 A;  3D4R A;  4LMQ D;  1IBL L;  1OTC A;  5JJZ A;  5C4X B;  1PTO F;  2CH4 A;  1VQE A;  1SXT A;  1EQT A;  4QGU A;  4DR2 Q;  1NE3 A;  4JI8 L;  1KQS A;  1QUQ A;  2SEB D;  1I4G A;  3AB9 A;  3J81 E;  4DV4 Q;  2F4V L;  2JP1 A;  5DNF A;  1BXT A;  2A73 B;  3KLS X;  3GTK B;  1CQV A;  4GKJ L;  4GNX B;  1NR4 A;  4F87 A;  1I6H H;  3TP5 A;  1XMQ L;  4X66 L;  2NZO A;  3UE1 A;  4BBR H;  3HS0 C;  4DV2 Q;  2OEO A;  4WJ4 A;  3RUZ A;  4ZCK A;  4DV5 Q;  4H02 A;  5FO7 B;  1DOL A;  2E2D C;  2EY5 A;  3CQZ H;  4JYA L;  4A76 A;  2MHV A;  5J22 A;  2BCO A;  2B2Y A;  4RGN A;  3RLF A;  2UUB L;  3IL8 A;  5HGT A;  3HOZ G;  4JK1 C;  2AWO A;  1K83 B;  2K04 A;  3VA7 A;  2HDL A;  3K7A H;  1L1O A;  3F2D A;  2RHS B;  1O78 A;  1Q8I A;  4LWC A;  4GN5 A;  3HOV B;  1ONL A;  3RR5 A;  3M3Y H;  3DWA A;  2B8G A;  5KNB A;  3KDF B;  4Y7N B;  3MHB A;  1EOV A;  1UAP A;  4Y52 H;  2MUY A;  3S1R B;  4HSP A;  1Y8O B;  4RMF A;  3TQY A;  4CDE C;  5C3X A;  2HHH Q;  3MZ5 A;  1EQV A;  4IJH A;  4ME5 A;  1WCM G;  3CCJ A;  3JC6 6;  4DV0 L;  2XIW A;  5E7N A;  4JBJ A;  2I46 A;  4YCW A;  3L9A X;  4PMC A;  5AJ3 Q;  1EIG A;  3D6W A;  4NKL A;  1Y1V G;  1EY7 A;  3PO3 B;  5GAG C;  2B8F A;  3P7J A;  2A6E D;  3W3A A;  2F0F A;  4AQY Q;  1G91 A;  2NWG A;  3H3V H;  1T5X D;  3GDE A;  2KEN A;  4UAI A;  5IGG A;  4JG2 A;  1GVP A;  3GTM B;  3PF5 A;  5DM7 3;  3MFY A;  1SYB A;  3NXW A;  4HR7 B;  5IT9 c;  1X55 A;  2EE1 A;  1HUM A;  4NXN Q;  1EEF D;  3HOZ H;  3U4Z A;  3CCL A;  1U4R A;  1HXY D;  5F2D A;  3PIO A;  2EOT A;  1PFM A;  2ZM6 Q;  3EQL C;  4Q0F A;  2A69 D;  4YWK A;  2QDL A;  4J15 A;  1H9S A;  3DMU A;  1A62 A;  3D3R A;  3K5L A;  1EYA A;  3GTQ B;  4QUC A;  4JOI C;  4B3R L;  2ICI A;  4DV1 L;  1HQR D;  2CWA A;  4JW0 A;  4XT3 B;  5G3L F;  3PV0 A;  1NUC A;  3NUC A;  1OXS C;  3K5N A;  3U58 A;  4H0L C;  4YHH L;  1VQJ A;  3VR6 A;  3A7A B;  4HAE A;  3RZO H;  1UWV A;  1Y1V H;  1E2W A;  5EKL A;  1TS2 A;  3I4O A;  4A3J G;  5ISR A;  4CDD C;  4Z9C B;  3J80 L;  4OWX B;  1WYD A;  2JA8 B;  4GZY C;  5KYL A;  3G48 A;  3E9I A;  4KY5 A;  4LF4 L;  3MC0 B;  1D5M C;  3TP6 A;  1AW7 A;  3KK7 A;  2Z9H A;  1K3B C;  4LFB L;  1SAP A;  3PUX A;  5M3F B;  2Y0S E;  2B63 G;  4OXP A;  4DR4 Q;  1SFO H;  5K5P A;  2LKV A;  5IP7 G;  4JCV E;  4KKU A;  4OGQ C;  1CK1 A;  4DR3 Q;  3AFQ A;  2OQK A;  1EYD A;  4OEL B;  4JI4 Q;  1MJE A;  3I90 A;  3KF8 A;  3H3V I;  3FPU B;  2DJF C;  3J7Z C;  1SYF A;  1C9O A;  5J39 A;  1WTP A;  4HN7 A;  1YEZ A;  5IYC G;  1GHK A;  1UE5 A;  1UNS A;  1PHJ A;  5EKI A;  4DK6 C;  1JB7 A;  4YIJ A;  4L5Q A;  4X64 L;  1Q81 C;  3S2D B;  2ZXP A;  3BU2 A;  1BKB A;  4A3K B;  1DD2 A;  5HGQ A;  1PRT D;  3EIV A;  2B2U A;  3QIA A;  1BCP D;  1GUN A;  1HNX L;  3HKS A;  1B9N A;  2F0I A;  2VB3 X;  5FKA C;  4DXF A;  4A3J H;  2BDO A;  2K50 A;  4KY7 A;  1S5F D;  4N9P A;  5COR A;  1II3 A;  5C4J H;  2KUM A;  4L5R C;  3J7A F;  1S40 A;  2D9U A;  3S14 B;  1SBB B;  4IUV A;  1YJN A;  2B63 H;  1MJC A;  1JOR A;  1C48 A;  2M9V A;  1CHQ D;  2J7Z A;  3AEV A;  1ROD A;  4FP5 D;  1RTO A;  2A6H C;  1ENA A;  1C8C A;  2NN6 G;  1EL0 A;  5IP7 H;  1BBX C;  1Q90 A;  1CKN B;  2EDG A;  4UY8 C;  1JQY D;  5IOD A;  2AWN A;  3T1Y Q;  2NVT B;  2YYZ A;  4X62 Q;  1B4O A;  1SYG A;  1D7Q A;  2NUC A;  4BA1 I;  5IY0 A;  2Z6B A;  5A2Q E;  3UE0 A;  5IYC H;  1GM5 A;  3MEF A;  3GTQ H;  4EQP A;  1OXU A;  4JBW A;  2PI2 E;  1BO0 A;  3G4S A;  1QIL A;  1I3Q H;  3S15 B;  3E9H A;  4OEM B;  5BR8 Q;  1EIY B;  3BYY B;  5M5Y H;  4IN3 A;  2X6G A;  1E3P A;  2FMM A;  5M3M G;  3NEM A;  4DV3 Q;  3S17 B;  4DUY Q;  2N55 A;  1GJX A;  5EBD A;  5IYB H;  3C1F A;  3BDC A;  4DK1 A;  2V1C C;  1CA6 A;  1PH7 A;  4GKK L;  4DR2 L;  4ZLT F;  1TS4 A;  3A55 A;  4F8M A;  1VF5 C;  4DR1 Q;  1JJ2 A;  1LT5 D;  1ILQ A;  4DV4 L;  2B29 A;  4GLV B;  1UEB A;  4K5X A;  3NWT A;  4DNI A;  4GN3 B;  3S16 H;  2K5H A;  3GTP B;  1BVS A;  1XNR Q;  1PZI D;  2IX0 A;  3MA2 B;  2E2H B;  3IRB A;  1E7Z A;  1TWF H;  2PQA B;  5HY6 A;  2WB1 E;  4C3J G;  3CCU A;  1XWE A;  4R8N A;  3IKJ A;  2L1B A;  5LMU Q;  2Q2T A;  4N9T A;  1JT8 A;  1E22 A;  3T56 B;  4DV2 L;  2DN8 A;  5KND A;  3MTS A;  2GVA A;  3STB D;  2CQO A;  3QWN A;  4DV5 L;  1X3F A;  3T13 A;  2RVL A;  3K5O A;  1ZYR C;  1VMP A;  3LWE A;  3A0J A;  1CT1 D;  4AYB E;  2KCM A;  3ULL A;  5KNC A;  1FGB D;  4GLX A;  1JMC A;  2Q2I A;  4A3I H;  1HFN A;  1S5B D;  1HZB A;  3CCM A;  1XMO Q;  2JA5 G;  4LF6 Q;  5ELD A;  1VQH A;  2YV5 A;  5M3M H;  1VCI A;  3BJU A;  5GRO A;  3F8T A;  1EU3 A;  1V1Q A;  1IBK Q;  5IGF A;  4UP9 A;  2R6G A;  3T53 B;  2N8N A;  2HHH L;  2IY5 B;  1GOZ A;  4RCO A;  1PH6 A;  4NDX A;  3M4O B;  1KAA A;  3QG1 A;  2QDB A;  2IJ0 A;  4JPB W;  4C2M B;  3Q22 A;  2C9O A;  4JVZ A;  1U4P A;  3CC7 A;  5C44 H;  2G9D A;  3GQB A;  4RG1 A;  1NBW A;  4MIU A;  2XNA C;  5I4D A;  1VQK A;  1L0X B;  4C3J H;  4O42 A;  4AQY L;  2LY7 A;  5IT9 E;  3F1Z A;  2GA4 B;  1FR3 A;  3HOU G;  3DM3 A;  1D6E C;  1Y1W G;  4HSV A;  3HKZ B;  1O80 A;  5E4W C;  1R4P B;  4CKE A;  3ULP A;  1U9R A;  3BZC A;  4NXN L;  4XXE A;  2EYM A;  1O7I A;  3VYU A;  3NTI A;  1EUJ A;  1B53 A;  3L7Z C;  1LYL A;  1X3E A;  3F2C A;  1LO5 D;  2ZM6 L;  1VQP A;  3M7G A;  5IGC A;  2JA5 H;  5CC4 A;  4NPS A;  1Q12 A;  4KJN A;  2B2V A;  4RGO S;  4A3M B;  1V43 A;  3H3V C;  5CGK A;  1IW7 C;  1PYW D;  2EYJ A;  3RNU A;  4QUF A;  4ZK9 B;  3E0J A;  3H0G B;  4OHJ A;  4A3C H;  2WAQ B;  1F77 A;  2FXQ A;  1OXV A;  3MVV A;  2VUM G;  3GV3 A;  1KAW A;  1RL2 A;  2I5M X;  1FJG Q;  5D14 A;  3C46 A;  4C3I G;  4OIK A;  1CZW A;  1AE2 A;  1FNU A;  2J0T D;  5EPK A;  1KC8 C;  3S1M B;  4P74 A;  4B3M Q;  2PW5 A;  2IHF A;  3RN5 A;  3J81 i;  3Q6S A;  3HOU H;  1KRS A;  4UP8 A;  1Y1W H;  3Q0A A;  1V1P A;  3BDL A;  3WOF A;  3K57 A;  2O2L D;  1KDB A;  3V05 A;  2KCN A;  1MI2 A;  1NMF A;  3FMC A;  3KF6 B;  3I4N G;  2PZT A;  5TSS A;  4DR4 L;  1G6Z A;  2E2J H;  4HIO A;  3A74 A;  3QJY A;  2AQ2 B;  1WTV A;  1BR9 A;  1W6J A;  4DR3 L;  1Q1E A;  5ELF A;  3JAM L;  1VQC A;  2K32 A;  3N52 A;  1A63 A;  2HIV A;  2Z6K A;  1MSG A;  2CH4 W;  3ITP A;  2EQS A;  5FLM G;  1MIU A;  1B1Z A;  1AEX A;  5I6Y A;  4IO9 A;  3MXN A;  3I4M G;  1VQM A;  1YNJ D;  5FO9 B;  4C1N I;  2D2C C;  2MQH A;  2QEJ C;  4H7B A;  1Y69 U;  4RA8 A;  1L0Y B;  4MTN A;  2VUM H;  1K8O A;  3Q24 A;  1EWH A;  1U4M A;  4C3I H;  2CKZ B;  1ASZ A;  1E0B A;  2JA9 A;  4RCN A;  3EBE A;  4OL7 A;  3A5U A;  4R1J A;  3SK5 A;  4C3H G;  5M9O A;  4QB4 A;  1VQ5 A;  5EJW A;  3FKI G;  1K9M C;  1N8R C;  2RQX A;  3I4N H;  1SNM A;  2PCF B;  1JWS D;  1B50 A;  1T9H A;  2UU9 Q;  1IL8 A;  2PNH A;  2O5J C;  2Y0S G;  4A93 G;  1I6H B;  1Q86 C;  4I65 A;  1NJI C;  1QUQ B;  4BBR B;  5KIX A;  2C5C A;  1QWY A;  3I7F A;  3VR2 A;  4MHE A;  4R8I A;  4ZRZ A;  1HTL D;  1LTT D;  3CQZ B;  5ELB A;  3T1Y L;  2F0O A;  4X62 L;  5KGU A;  1M1K C;  1JCK B;  4IUT A;  1Q46 A;  1CUK A;  2OWO A;  5IIF A;  1G8Z D;  1GKH A;  5FLM H;  1KXL A;  5CR3 A;  1NR2 A;  3K7A B;  4WFN 3;  1DOM A;  1KD1 C;  2BA1 A;  1GHJ A;  1AN8 A;  2ES2 A;  2RHQ B;  4IJL A;  2A69 C;  3I4M H;  4YWL A;  1U4L A;  3H0G H;  5BR8 L;  3M3Y B;  2K03 A;  3I2Z A;  2NVQ H;  1X3G A;  2WP8 J;  1HHV A;  1H9J A;  2VL6 A;  3CCR A;  1RTN A;  1HJP A;  1KAB A;  5KEE A;  4DV3 L;  3W5O A;  4GOP A;  4QJF A;  1UE1 A;  2RDF A;  3E5S A;  4ZYS A;  4DUY L;  1K0R A;  1MD2 D;  3RLN A;  3QO2 A;  1JWM D;  2A68 D;  3PF4 A;  2YTX A;  2NTT A;  3F2U A;  5I2X A;  5IP9 G;  5JJK A;  1HRJ A;  3S1M H;  2TMP A;  4DFA A;  2XVS A;  3U4V A;  4DN4 M;  3QR8 A;  4C3H H;  1HA6 A;  1YNN D;  3HG9 A;  3K0X A;  1H9M A;  4Q5V A;  2FFK B;  2K5D A;  3FKI H;  3KLS A;  2EYL A;  2NYZ D;  2K01 A;  3OHX C;  3NBI A;  4K6L A;  4A93 H;  4A3F G;  3BZK A;  2FIN B;  1VQ8 A;  1XNR L;  3UDG A;  2HCC A;  4ODG A;  4BA2 I;  4JV5 Q;  1LV9 A;  1TWA H;  3NEN A;  5LMU L;  1RF2 D;  1JJG A;  4K8J A;  2PPB C;  1RKN A;  1YIT A;  4ZAI A;  2KVM A;  2AUJ D;  4K5W A;  1KDA A;  3HOZ B;  4FXD A;  1F2Z A;  3HRZ C;  4A3D G;  2A19 A;  1PZJ D;  2YTV A;  2BOS A;  3CAM A;  1EWI A;  1S5D D;  2H4O A;  1VQ4 A;  1B3Q A;  4R4T A;  3SXH A;  2JXM B;  1N36 Q;  1R4Q B;  2B2T C;  4J1M A;  1FGU A;  3NWS A;  1YVC A;  3J7Y W;  2VXW A;  3T16 A;  4TKO B;  3GTJ H;  1SNP A;  2MGS A;  5C3E G;  1QE6 A;  1ET9 A;  4V0B A;  5HUR A;  4LF6 L;  4ABN A;  3EJI A;  4AIM A;  1BDO A;  4L5S A;  2R7D A;  5C0X G;  1IBK L;  1BF4 A;  1PRT F;  3GD7 A;  3TZD A;  1EIH A;  1W2B A;  1BCP F;  1N34 Q;  3A7L A;  4EGV A;  1STB A;  5LMN L;  3W1G A;  3ULJ A;  2ZT9 C;  2A74 C;  3RZO B;  4DKA C;  1PZK D;  2F1M A;  1PRT C;  1WTR A;  1Y1V B;  3MFG A;  1BCP C;  4EQ5 A;  3SK6 A;  2DNE A;  3K58 A;  4A3F H;  2Q8R E;  3JAM E;  2A8V A;  1X32 A;  1B8A A;  5ELO A;  2D62 A;  4KHV A;  4DK3 C;  4A3B G;  4IFD G;  2PI2 A;  3FVQ A;  2WB1 G;  1VQ6 A;  1UE7 A;  2HCI A;  3KBX A;  1SFO B;  1JJC B;  4BY1 G;  1LLR D;  4QL5 A;  1SR3 A;  2XSC A;  4BBS G;  5CV5 A;  3MAQ A;  1JOK A;  2J4X A;  1AP0 A;  5JOB A;  4A3D H;  1Q8K A;  4DAP A;  1XPR A;  2K5N A;  4O1N A;  1JOQ A;  2R93 G;  4AYB G;  1SJE D;  1STE A;  1VQF A;  2E8G A;  2XRQ D;  3BVM A;  4IUQ A;  3MWY W;  5C3E H;  1PH2 A;  4HJ5 A;  3MXP A;  1YZ6 A;  1PH9 A;  1VMC A;  3VYR A;  1LTA D;  1D1I A;  1TS3 A;  2F0E A;  4K5V A;  1A3V A;  1PFS A;  5C0X H;  1EEI D;  2K6A A;  3J80 c;  1PYS B;  2L5T A;  4UHV A;  4RGT A;  1I4Q A;  1IKM A;  2ZTE A;  2WKC A;  2B2W C;  4LUZ A;  3BZD B;  1I4P A;  3BG3 A;  4A3J B;  4MN3 A;  3PUZ A;  4YCV A;  4JI6 Q;  3BVZ A;  2GN5 A;  5FJ8 G;  5C4J B;  1WTQ A;  3H6M A;  2AKW B;  4DF7 A;  5FOB B;  4B3M L;  3S9W A;  3R8B A;  4DK0 A;  2F0J A;  4KHP Q;  3RZD H;  2B63 B;  4BY1 H;  3U50 C;  5BN3 A;  3GTO H;  3PUY A;  5IOC A;  3SK8 A;  1SEB D;  2R93 H;  2EYP A;  4PG3 A;  3PIP 3;  4M8A A;  4DR7 Q;  1NMG A;  1D2B A;  4R9W A;  3Q23 A;  1VQN A;  2F4I A;  3R2I A;  1C7Y A;  4A3L G;  2P5Z X;  1VQ7 A;  4F7X A;  4PNY A;  2F0M A;  4S3S A;  1YI2 A;  1I3Q B;  1WCM H;  2EYO A;  3KLR A;  3AYH B;  2PMZ E;  1HR0 Q;  5M5Y B;  1ICF B;  2BA0 A;  1F2M A;  1E2V A;  2JA6 G;  1VF7 A;  3UI2 A;  3M7N A;  4DUZ Q;  4A3G G;  1QCB D;  1QVC A;  5KYI A;  5LL6 S;  1HA5 A;  4K2L A;  2JEA I;  5CV8 A;  2A1A A;  2EYH A;  4LK1 C;  5C0X I;  5FJ8 H;  3FPP A;  4WJW A;  4DV6 Q;  1W3S A;  2N49 A;  4GNX A;  1Y14 B;  2KJX A;  2YTY A;  1ASY A;  4XQJ A;  4R4C A;  3TP8 A;  1SRO A;  1QNU A;  4N8X 1;  2ASB A;  4GS3 A;  3GTL H;  1YHA A;  5EGT A;  5A35 A;  5JPM C;  1UEA B;  3S16 B;  1G6P A;  5FLX L;  1TWF B;  3QOL A;  3S24 A;  2UU9 L;  3PO3 G;  4RKB A;  1ZEQ X;  4KKT A;  1HNW L;  2KHI A;  1PRT B;  2ZTC A;  4JI3 L;  2IW3 A;  4A3L H;  1BCP B;  2KA7 A;  3A5Z B;  1XJV A;  4RHS A;  3KDF A;  1SNO A;  4ALP A;  2E5L Q;  1HR0 W;  1A6X A;  1EY5 A;  4A3I B;  1STG A;  2EJG C;  1TT2 A;  2I0Q A;  4DXG A;  3L2P A;  4LFC Q;  2FHT A;  1N9W A;  5M3M B;  2JA6 H;  2F3W A;  1LTS D;  3I70 A;  2HQE A;  4A3G H;  3UDF A;  1E1O A;  3TS2 A;  2OCE A;  1MHW C;  1BNZ A;  4B9X A;  4R4O A;  5C5L A;  4LF5 Q;  5GAH C;  5C44 B;  4KI0 A;  5EAY A;  3RLO A;  3VR5 A;  1CSP A;  4RHR A;  1PTO D;  1SYD A;  3T1H Q;  2M2L A;  1P8L A;  1IL2 A;  1KNE A;  4OWT B;  2KQ3 A;  4IQZ A;  2GVB A;  3U9O A;  4C3J B;  4G7H C;  2IHE A;  2VY3 A;  1YJW A;  2VB2 X;  2ATW A;  1MKH A;  2BE5 D;  3A8K E;  3C3L A;  1JR0 D;  2XRS D;  3OTO Q;  4JV5 L;  4FF3 A;  2XN9 C;  2F0W A;  4PZ8 A;  1YHQ A;  5L37 A;  1U5K A;  4AH6 A;  4ZUI A;  3PCO B;  1EY4 A;  3OIQ A;  3CPF A;  3OWF A;  1N36 L;  2JA5 B;  4DR5 Q;  4JI1 L;  5C6A A;  4UPA A;  1STA A;  1QJO A;  5E3F A;  1TR5 A;  1X54 A;  2X6L A;  2KCC A;  4JI5 Q;  1STN A;  3A56 A;  1YNJ C;  5IWA Q;  3VR3 A;  2K14 A;  1SLJ A;  4KHZ A;  1JC7 A;  1N34 L;  2AQ1 B;  3D4W A;  5EPJ A;  5H1S E;  2R92 G;  4RFB A;  1IHZ A;  3NBH B;  2MJ8 A;  1C0A A;  1F9S A;  3TBI B;  1I4H A;  5ELC A;  5DLQ E;  3HFZ B;  1I6V C;  2EYF A;  1STY A;  2Q2H A;  3WOE A;  2ALY B;  4KN4 C;  2NN6 H;  3AU7 A;  4DAM A;  3J81 j;  1VQB A;  2EVB A;  1LM0 A;  2ICE C;  2UXB Q;  2A5H A;  2EXZ A;  2WIN B;  1AH9 A;  3HOU B;  4DNR B;  1RIP A;  2QF7 A;  1Y1W B;  2DJG C;  1NSN S;  1JB3 A;  1DZ1 A;  1VS0 A;  1WTO A;  4B08 A;  2E2J B;  3I3C A;  1D8L A;  3ZJY C;  1HQM C;  4XYO A;  2RBM A;  4OO1 G;  4ME3 A;  3R3O A;  2MFI A;  1V1P B;  1O7L A;  3ONA B;  1PTO H;  3CRL C;  4TVA B;  3K7U C;  3J80 E;  2IWH A;  4KTA A;  1X3P A;  2K5Q A;  2PZU A;  3G7L A;  3NSW A;  4P2C B;  1DYQ A;  3K5M A;  1ZKO A;  1K8A C;  2R92 H;  1XNQ Q;  2VUM B;  5FLX E;  4DA2 A;  1SNQ A;  1HZA A;  3ERQ A;  4G4K A;  3PO2 G;  4C3I B;  5AJ3 L;  3CKI B;  2HIX A;  1EY6 A;  4LJZ C;  5DAU A;  5G3L D;  2MP1 A;  4KD4 A;  2A68 C;  2VNU D;  2L11 A;  2RDG A;  1E1T A;  4JI6 L;  3NQT A;  4OIJ A;  2PO4 A;  3VA5 A;  1YNN C;  2EJM A;  2LXJ A;  3I72 A;  4TQU S;  4KKS A;  4R4Q A;  4H44 C;  1CKN A;  2I07 B;  3JAM c;  1L2F A;  2CQA A;  2B2Y C;  4PMB A;  4KHP L;  1CZG A;  3I4N B;  3OMG A;  5JEA G;  5BN5 A;  1J5E Q;  4HCS A;  2DGY A;  2QKI C;  1XTC D;  1QVF A;  1L1O C;  4OO1 H;  2NN6 I;  4LNQ A;  1XMQ Q;  3OW7 A;  4HTH A;  3MXG A;  4X66 Q;  4O0A A;  3H09 A;  1VQO A;  4DR7 L;  4HJ9 A;  3EN2 A;  2FJ2 A;  4I7A A;  4OX9 Q;  2F0V A;  1CTM A;  1HZC A;  3TZU A;  3M4Y A;  2UUB Q;  4BY7 G;  1J9O A;  1N32 Q;  5JVH 3;  1IZ6 A;  3LWU A;  4HIK A;  3I4M B;  2D0O A;  4DAY B;  3G6E A;  4PMW A;  4ZQ3 A;  1SNC A;  1SYE A;  4HMJ A;  1HR0 L;  2RCF A;  2NVQ B;  3DEP A;  4LUO A;  3LNN A;  1QG7 A;  5AFW A;  1CKM A;  2ENB A;  2DY7 A;  3X3M A;  4BXX G;  1Z9F A;  4KJO A;  4G57 A;  1PH4 A;  4DUZ L;  3HEJ A;  1OXT A;  1EFI D;  3DLL A;  5EQ0 A;  3CXC A;  1GUO A;  4JOI A;  1B3A A;  1KNA A;  4C3H B;  1RHP A;  2F0H A;  4DV0 Q;  2PQA A;  5I6W A;  1F9R A;  1KDC A;  1AE3 A;  4H13 C;  4JI0 Q;  3CHB D;  3FKI B;  2K75 A;  3HP3 A;  3HOX G;  3ICE A;  5KRU A;  2IX3 A;  5JEA H;  4A93 B;  3SK4 A;  4ZKB B;  2NZH A;  1LT6 D;  4POF A;  2NZ1 D;  1QZG A;  1TWA B;  1HZ9 A;  4NMZ A;  5CBA E;  2LXK A;  4JI4 L;  2RA4 A;  1QZH A;  3KBG A;  4A4I A;  3IFT A;  1PV4 A;  1LTR D;  2B39 A;  2F0T A;  5C5M A;  4CJ0 B;  1E24 A;  1LTG D;  5NUC A;  2L12 A;  1QB5 D;  4BY7 H;  3J81 L;  1WVL A;  4ZKC B;  1LAC A;  4B3T Q;  1PMR A;  1M90 C;  3ZYY X;  2E5L L;  4NB3 A;  3AFP A;  2WAC A;  3GTJ B;  1DXM A;  1R9T H;  4LFC L;  4BXX H;  1S3O A;  2BDN A;  2DNC A;  5K36 G;  1A0I A;  1GXD C;  4XIG S;  2Z0S A;  3I55 A;  4IOC A;  1X3Q A;  2RDH A;  1X9N A;  3SDZ A;  1PYB A;  1FYC A;  2F0N A;  3PQI A;  1RDP D;  2HD3 A;  1FD7 D;  1PLF A;  1K8G A;  1OO9 B;  2M00 A;  1I50 B;  1JE4 A;  4WJ3 M;  4A75 A;  2A6E C;  1CKO A;  1PH8 A;  5EKK A;  2KHS A;  3T1H L;  4A3F B;  3K81 C;  1NTG A;  4CKB A;  1VQL A;  1YJ9 A;  3H91 A;  2QEX A;  3PUV A;  1F9Q A;  1IBM Q;  1EYG A;  5CBE E;  5CYU A;  1A3T A;  3URY A;  1SE2 A;  3NTH A;  3OTO L;  2F0S A;  2UXC Q;  1TY2 A;  4X3U A;  3GO5 A;  1VQI A;  2G5D A;  4A3D B;  4LF8 Q;  3KYH C;  3TEH B;  4DNT B;  4CBV A;  2WII B;  1YBY A;  2NVY H;  2OXP A;  5FO8 B;  3C2P A;  3CCE A;  4FF1 A;  1GUW A;  5C3E B;  4CGY B;  4DR5 L;  2X69 A;  1ET6 A;  3T4A C;  2B2U C;  3PIP A;  1WFQ A;  4CHT B;  2NBF A;  4IAL A;  3QOJ A;  3J7A V;  2PQE A;  4JI5 L;  1L1O B;  2UUA Q;  5IWA L;  1LTL A;  4IUN A;  3NHH A;  1ESF A;  5M5W H;  4PV1 C;  4RGM A;  2JA7 G;  3BDO A;  4DR1 L;  2NTS A;  1S4Z A;  1DJR D;  1N33 Q;  4A3E G;  3S1Q H;  2BH8 A;  4C56 C;  4B9W A;  3CF5 A;  4RKL A;  1EQQ A;  2ZTD A;  4A3B B;  3OPO A;  1KHI A;  3RZD B;  1YHB A;  4BY1 B;  4U67 3;  3UDX A;  1G29 1;  3OYY A;  3GTO B;  4DV7 Q;  4EVO A;  1O7Y A;  3MXU A;  1M4V A;  2R93 B;  4AYB B;  3CU7 A;  4UDU C;  4NXM Q;  3S2H H;  2FMC A;  1LUZ A;  1TVX A;  3VYS A;  1XMO L;  2UXD Q;  1LT4 D;  4JI2 Q;  3K0Y A;  1HH2 P;  3FRP B;  3TDQ A;  1IXR A;  2MO1 A;  1WCM B;  1KIX A;  5IGD A;  1CI3 M;  3HOY G;  1UE6 A;  3ND8 A;  5COY A;  5IP9 H;  1HFG A;  3ERS X;  2EXD A;  1YNX A;  1H9S B;  1XNQ L;  2JA7 H;  4YCU A;  3CPW A;  3GP7 A;  1I50 H;  1UUP A;  3TRZ A;  4A3E H;  3EFX D;  3RD4 A;  4FF2 A;  1TWH H;  1WTH A;  1GUS A;  2ZXO A;  1PFN A;  1FVI A;  2SDF A;  1S5E D;  1PH5 A;  2PNR C;  3K80 C;  4IOA A;  4GKK Q;  3GV6 A;  5I9P A;  1XYI A;  2NVX H;  1PTO C;  3GTL B;  2R7Z G;  3A8J E;  2PW7 A;  1XXG A;  2LS0 1;  3ER0 A;  4MTK A;  3M4Q A;  3E6Z X;  1J5E L;  2BE5 C;  2EY6 A;  3TS0 A;  2KEE A;  3DM1 A;  4KLK A;  1TWG H;  2SOB A;  2F0U A;  3DWQ A;  5C0X J;  2OQ0 A;  2VZA A;  3OSO A;  1J6Q A;  2K52 A;  3KLW A;  2ZJQ A;  4QMG A;  1EOT A;  2QA4 A;  4KD3 A;  5M5X H;  1EQR A;  3NEL A;  5DM6 3;  3HOW G;  3M85 A;  2E2I H;  4OX9 L;  3CC2 A;  2K7V A;  2ZJP A;  2Z1C A;  3Q8D A;  2XWJ B;  3NPP A;  3HOY H;  1QOH A;  2O5I C;  1N32 L;  2O4X A;  3KF8 B;  4RWS C;  3PGZ A;  3TN2 A;  4C1N K;  2YU9 H;  2F52 A;  2KCT A;  1PDQ A;  1I4R A;  2JA6 B;  1WTX A;  4IFD J;  4G7O C;  4A3G B;  1LAB A;  4HJA A;  3TRE A;  3GTG H;  4FXG C;  1FJG L;  1A2T A;  5FLX c;  2Z4I A;  5C4X G;  1CM9 A;  1ICW A;  1Q1B A;  1PXU A;  3TME A;  4A3B H;  1EZ6 A;  4IFD H;  1HNZ Q;  4DR6 Q;  5A2Q L;  4P72 A;  2R7Z H;  1WI5 A;  5J1Z A;  4JI0 L;  1B7Y B;  4X3T A;  4BBS H;  3AQQ A;  1BQQ T;  3S1N H;  4XQQ A;  4QY7 A;  2EIF A;  1VQG A;  2D5D A;  3FEW X;  2CW0 D;  3STB C;  4L6T B;  1ESR A;  1JWU D;  1NY4 A;  4TRD A;  2RF4 A;  1A3U A;  2B3G A;  3HOW H;  2B2V C;  3CC4 A;  3HKZ E;  2K28 A;  1B70 B;  1TU2 B;  1EY8 A;  2QCP X;  1TWC H;  1FL0 A;  1WD1 A;  1WJJ A;  4I7Z C;  4B3T L;  1PH1 A;  2E76 C;  3SGI A;  3KJO A;  1ILP A;  1MSH A;  1ENF A;  4NW2 A;  1KLG D;  3MEH A;  5CV6 A;  1HTP A;  4LF7 Q;  4ID6 A;  3J80 i;  4DAV A;  3HOV G;  4L63 B;  3W2D A;  4PQX A;  2F0P A;  5C4X H;  2EZV A;  4QCL A;  1Z47 A;  3NE5 B;  5IGE A;  1OXX K;  2K5V A;  1G2S A;  1I5F A;  2WAQ E;  1SDF A;  4KMU C;  1SMY D;  3DXJ C;  2E75 C;  3KFU A;  4QQB X;  3OWE B;  3TSS A;  1J8I A;  3CP0 A;  1M8A A;  1HUN A;  1RCV D;  3GTK H;  1EU4 A;  2XGT A;  4IZ8 A;  2F03 A;  3E0E A;  4FF4 A;  1IBM L;  1Z6H A;  1KTK A;  2AMC B;  2N88 A;  3P1H A;  1KLU D;  4JBK A;  4IFD I;  4PZ6 A;  2LSS A;  2WKD A;  4QIW B;  2UXC L;  1B44 D;  2Z6K C;  3I4L A;  2KHJ A;  1DCZ A;  4JI7 Q;  2IPK D;  4LF8 L;  1SN8 A;  1TQO A;  5E4X A;  1V1O A;  4X65 Q;  5JJI A;  1PTO B;  1K83 H;  3SE0 A;  4RAU C;  5D65 A;  2G9H D;  1EY0 A;  3HOV H;  2IT1 A;  5CV7 A;  5IT9 L;  2JQO A;  2F0L A;  4Y7N H;  3SEB A;  3IAY A;  2UUA L;  3S1R H;  1XTD A;  2PZW A;  1MBY A;  4FDB A;  2R92 B;  4P71 A;  2DUD A;  3J7A 5;  4K8I A;  4M1U B;  1W6K A;  1AZQ A;  1NNX A;  3LGJ A;  1N33 L;  2R3Z A;  4TSS A;  1KRT A;  1H95 A;  1VDZ A;  4PZ7 A;  4B3S Q;  1A15 A;  3PO3 H;  1HPC A;  5IYB G;  3G6J B;  1IYJ B;  2N3S A;  1LTI D;  2H5X A;  2JA8 G;  3X3N A;  3CMA A;  5T1G A;  3CCQ A;  1BUV T;  3V2T A;  2L55 A;  3D4D A;  1BBU A;  3GTM H;  2IL8 A;  5ELE A;  4DV7 L;  1S72 A;  2D0P A;  3NTK A;  5E1F A;  4DGZ A;  5M3F G;  4LFA Q;  3M9B A;  3E3X A;  4F88 A;  4KY6 A;  4NXM L;  1X56 A;  5JVG 3;  5I2Y A;  2K33 A;  2Q8T A;  4GOP C;  3VR4 A;  2UXD L;  4JI2 L;  4XQN A;  2UUC Q;  1IKL A;  3R93 A;  2OTJ A;  2EY1 A;  2VQF Q;  4HCE A;  2QW7 A;  3NK9 A;  1I94 Q;  4ILW A;  1CFM A;  3PMF A;  4XTC S;  4A3I G;  2RSN A;  3PO2 B;  5GQO A;  4K0K Q;  1IYU A;  1ZXT A;  2B2T A;  3I91 A;  3CW2 C;  1SSO A;  4A3K G;  1K3R A;  3KJP A;  2JN4 A;  3DWP A;  4KN7 C;  1EYC A;  3DUZ A;  2VQE Q;  2MNA A;  2JA8 H;  1YIJ A;  4IPD A;  2EJF C;  4WOR A;  2V4D A;  2WV6 D;  1ML0 D;  5C44 G;  4POG A;  4LW1 A;  1G2T A;  3BYT B;  3RN2 A;  5M3F H;  3PIO 3;  2ZXR A;  4UP7 A;  1V9P A;  2HDM A;  4X3K A;  4EX5 A;  1AFP A;  3M4P A;  4IUP A;  4YY3 Q;  3NQI A;  1O7Z A;  2CCZ A;  4YWM A;  3CCV A;  4OWW B;  4BS9 A;  3SR1 A;  5GAE C;  4BY7 B;  4V19 0;  1H9K A;  4KK7 A;  4APV A;  4LF9 Q;  1SYC A;  2R61 A;  3NP8 A;  3WWV A;  3DEO A;  3ERO A;  2K05 A;  2AUK A;  1R9T B;  2JYO A;  4IPH A;  2Z4H A;  3OMC A;  2CWP A;  1IBL Q;  4CJ2 C;  3S2D H;  1EWC A;  4A3K H;  1SE8 A;  1SJH D;  5C4Z A;  1WD0 A;  4K14 A;  4JBM A;  3MXN B;  3K6O A;  2RKS A;  4L8J A;  3OOC A;  5LMN Q;  3ND9 A;  1QVG A;  4JI8 Q;  1TS5 A;  3D31 A;  4A3C G;  4DPG A;  5JAV A;  1HNZ L;  3T51 B;  1EFW A;  3DHQ A;  3HOX B;  1EZ8 A;  4DR6 L;  5LHY 1;  1Y8N B;  2F4V Q;  1KL9 A;  4K2K A;  4X3S A;  3EVQ A;  1DM0 B;  1NCV A;  4HJ8 A;  4L5T A;  5CMD A;  4OON A;  2AHO B;  3H15 A;  3S14 H;  4X6A H;  4K6D A;  1D5X C;  2B2W A;  1U0L A;  1XPU A;  4GKJ Q;  3J81 c;  2Q2U A;  2F0Q A;  4NP5 A;  1LTB D;  2KEC A;  4CJ1 B;  1F2L A;  1BBW A;  1X65 A;  2KED A;  1SE4 A;  3EA6 A;  3CCS A;  2RSO A;  3K8A A;  1QNK A;  4XT1 B;  3RMH A;  2NVT H;  4JYA Q;  2TSS A;  2L9H A;  2CFM A;  1E2Z A;  2ID0 A;  3L0O A;  3HZX A;  1K73 C;  3R2T A;  2EY2 A;  2NVY B;  4JC0 A;  1VQ9 A;  4BWG B;  2PMZ B;  3QB3 A;  1FNW A;  1F9P A;  2F0D A;  1DGS A;  5I9O A;  1JOO A;  5FK9 C;  5JPN C;  5D3D A;  3S15 H;  4G7Z C;  4LUV A;  5CV4 A;  1F2Y A;  4IUR A;  4FXK C;  1DON A;  4LF7 L;  3PO2 H;  3BS1 A;  3IFD A;  3NBH A;  3C1E A;  1V8Q A;  5JEA J;  1CQF A;  2JE6 I;  1XX8 A;  2BH2 A;  3S17 H;  2VS1 A;  5LMN W;  5M5W B;  4DV6 L;  1PFB A;  2I5L X;  3F2B A;  1DOK A;  1WTW A;  4P75 A;  4XYQ A;  1ENC A;  3S1Q B;  1X6O A;  5EBC A;  1EY9 A;  3V96 A;  4GOP B;  2JJQ A;  3H94 A;  4FNF A;  1EIF A;  2Y0S B;  1NAP A;  3JAM i;  2SNS A;  3D8G A;  1TII D;  1XPO A;  1HCZ A;  3GTP H;  5EPL A;  5CV9 A;  2E2H H;  5IYD G;  2A6H D;  1PA6 A;  3A8I E;  4ULL A;  2L15 A;  1K0S A;  3KUP A;  3P75 A;  1L0W A;  4EQO A;  5ELN A;  3PUW A;  1VQD A;  4HIM A;  3OIP A;  4R4I A;  2I5H A;  4JI7 L;  4WRD A;  3HKZ G;  2C35 B;  2R7F A;  5BN4 A;  4OO1 I;  1T5E A;  3S2H B;  5C4H A;  1Y8P B;  4HMI A;  3LX0 A;  5DEH A;  4CDF C;  4EQN A;  1GUT A;  4J6H A;  4X65 L;  4E6I A;  4O2D A;  2Z8L A;  2XWB B;  3N6R A;  3UDI A;  3SHL A;  3P20 A;  2K4K A;  2L0C A;  4IPG A;  2JEB I;  4B3R Q;  2F3V A;  1CHP D;  3U9S A;  2ZJR A;  4DV1 Q;  3VYT A;  1IYV A;  2HQL A;  5C3W A;  4GNX C;  3BVG A;  4CDC C;  2KBN A;  2QIL A;  1SE3 A;  2JA7 B;  4A3M G;  2OT2 A;  4YHH Q;  4LF5 L;  3M4O H;  3H0G G;  1TXY A;  5LL6 X;  4A3E B;  3PSI A;  3HOX H;  2WAQ G;  4C2M H;  2HT1 A;  1TWH B;  2EPB A;  3D6C A;  1GUG A;  1A2U A;  1SMX A;  4ZUJ A;  2OF1 A;  4B3S L;  1P16 A;  2NVX B;  3AMU A;  1H9R A;  1SND A;  3CD6 A;  4LF4 Q;  5IYD H;  1RJT A;  2PYK A;  1B2T A;  4IUU A;  1BOS A;  2L4N A;  1VQA A;  2H1E A;  4LFB Q;  1K28 A;  3CME A;  5JJL A;  1Z7T A;  3HGB A;  5IGB A;  1PVO A;  1TWG B;  2XTI A;  2CW0 C;  3FDT A;  2RCN A;  1CA5 A;  1WOC A;  4CKC A;  4XDX A;  1D1K A;  4LFA L;  1ZYR D;  2F0G A;  1S5C D;  3D0F A;  3SVM A;  1SRU A;  5M5X B;  1HNW Q;  4DAY A; 
#chains in the Genus database with same CATH homology
 2K5W A;  1STH A;  2E2I B;  1K8M A;  2Q8I B;  4RH6 A;  5K36 H;  2HUG A;  1C4Q A;  3HOY B;  4FYD A;  3K59 A;  3O13 A;  2YU9 B;  4LAA A;  1I4X A;  2AQ3 B;  2LFN A;  4J8Q A;  3GTG B;  2MPM A;  1AZP A;  5D3I B;  2LMC B;  2CHB D;  1Q3L A;  2WB1 B;  1SMY C;  3I73 A;  3TP7 A;  4DU9 A;  2R7Z B;  1MGS A;  1D5Z C;  2F0K A;  4BBS B;  3S1N B;  4FVM A;  2K1B A;  1RD9 D;  4HED A;  1JIC A;  3L3O C;  2NB0 A;  4U68 A;  3A54 A;  4FO2 A;  2KOL A;  3HOW B;  2IX1 A;  3WDN A;  2E74 C;  2CVR A;  3I8Z A;  1FNV A;  1TWC B;  1TKW B;  4KV6 A;  2DY8 A;  2JSO A;  1TY0 A;  1LT3 D;  1B9M A;  3CRK C;  5T1I A;  1IW7 D;  2SNM A;  4QF4 A;  3D4R A;  4LMQ D;  5JJZ A;  5C4X B;  1PTO F;  1SXT A;  1EQT A;  2SEB D;  1I4G A;  3AB9 A;  3J81 E;  2JP1 A;  5DNF A;  1BXT A;  2A73 B;  3KLS X;  3GTK B;  1CQV A;  1NR4 A;  4F87 A;  3TP5 A;  3HS0 C;  2OEO A;  3RUZ A;  5FO7 B;  1DOL A;  2E2D C;  2EY5 A;  2MHV A;  5J22 A;  2BCO A;  2B2Y A;  4RGN A;  3RLF A;  3IL8 A;  5HGT A;  4JK1 C;  2AWO A;  1K83 B;  2K04 A;  3VA7 A;  2HDL A;  1O78 A;  1Q8I A;  3HOV B;  1ONL A;  3DWA A;  2B8G A;  5KNB A;  4Y7N B;  3MHB A;  1UAP A;  2MUY A;  3S1R B;  4HSP A;  1Y8O B;  5C3X A;  3MZ5 A;  1EQV A;  4ME5 A;  2XIW A;  2I46 A;  3L9A X;  4PMC A;  1EIG A;  3D6W A;  4NKL A;  1EY7 A;  3PO3 B;  2B8F A;  3P7J A;  2A6E D;  3W3A A;  2F0F A;  1G91 A;  2NWG A;  1T5X D;  4UAI A;  5IGG A;  3GTM B;  5DM7 3;  3MFY A;  1SYB A;  3NXW A;  4HR7 B;  2EE1 A;  1HUM A;  1EEF D;  1U4R A;  1HXY D;  5F2D A;  2EOT A;  1PFM A;  3EQL C;  4Q0F A;  2A69 D;  1H9S A;  3DMU A;  3D3R A;  3K5L A;  1EYA A;  3GTQ B;  4QUC A;  2ICI A;  1HQR D;  4XT3 B;  5G3L F;  3PV0 A;  1NUC A;  3NUC A;  1OXS C;  3K5N A;  4H0L C;  3VR6 A;  3A7A B;  4HAE A;  1E2W A;  5EKL A;  1TS2 A;  5ISR A;  4Z9C B;  3J80 L;  2JA8 B;  4GZY C;  5KYL A;  4KY5 A;  3MC0 B;  1D5M C;  3TP6 A;  1AW7 A;  3KK7 A;  1SAP A;  3PUX A;  5M3F B;  5K5P A;  2LKV A;  4KKU A;  4OGQ C;  1CK1 A;  1EYD A;  3I90 A;  3KF8 A;  3FPU B;  1SYF A;  1WTP A;  5J39 A;  4HN7 A;  1GHK A;  1UNS A;  5EKI A;  4YIJ A;  3S2D B;  2ZXP A;  4A3K B;  1DD2 A;  1PRT D;  2B2U A;  3QIA A;  1BCP D;  1GUN A;  1B9N A;  2F0I A;  2VB3 X;  5FKA C;  4DXF A;  2BDO A;  4KY7 A;  1S5F D;  4N9P A;  5COR A;  1II3 A;  2KUM A;  3J7A F;  2D9U A;  3S14 B;  1SBB B;  4IUV A;  1JOR A;  1C48 A;  2M9V A;  1CHQ D;  2J7Z A;  1ROD A;  4FP5 D;  1RTO A;  2A6H C;  1ENA A;  1C8C A;  2NN6 G;  1EL0 A;  1BBX C;  1Q90 A;  2EDG A;  1JQY D;  5IOD A;  2AWN A;  2NVT B;  2YYZ A;  1B4O A;  1SYG A;  2NUC A;  4BA1 I;  5A2Q E;  4EQP A;  1OXU A;  4JBW A;  1BO0 A;  1QIL A;  3S15 B;  3BYY B;  4IN3 A;  2X6G A;  2FMM A;  3S17 B;  2N55 A;  1GJX A;  5EBD A;  3C1F A;  3BDC A;  4DK1 A;  1CA6 A;  4ZLT F;  1TS4 A;  3A55 A;  4F8M A;  1VF5 C;  1LT5 D;  1ILQ A;  4K5X A;  3NWT A;  3GTP B;  1PZI D;  2IX0 A;  3MA2 B;  2E2H B;  4C3J G;  1XWE A;  4R8N A;  3IKJ A;  2L1B A;  4N9T A;  3T56 B;  2DN8 A;  5KND A;  3MTS A;  3QWN A;  3T13 A;  2RVL A;  3K5O A;  1ZYR C;  1VMP A;  3LWE A;  1CT1 D;  5KNC A;  1FGB D;  1HFN A;  1S5B D;  5ELD A;  1VCI A;  1EU3 A;  5IGF A;  2R6G A;  3T53 B;  1GOZ A;  4RCO A;  4NDX A;  3M4O B;  1KAA A;  3QG1 A;  2QDB A;  2IJ0 A;  4C2M B;  3Q22 A;  2C9O A;  1U4P A;  2G9D A;  3GQB A;  4MIU A;  2XNA C;  5I4D A;  1L0X B;  4O42 A;  2LY7 A;  5IT9 E;  2GA4 B;  1FR3 A;  1D6E C;  4HSV A;  3HKZ B;  1O80 A;  5E4W C;  1R4P B;  4CKE A;  1U9R A;  4XXE A;  2EYM A;  3VYU A;  3NTI A;  1B53 A;  3L7Z C;  1LO5 D;  3M7G A;  5IGC A;  5CC4 A;  1Q12 A;  4KJN A;  2B2V A;  4RGO S;  4A3M B;  1V43 A;  3H3V C;  5CGK A;  1IW7 C;  1PYW D;  2EYJ A;  4QUF A;  4ZK9 B;  3E0J A;  3H0G B;  4OHJ A;  2WAQ B;  1F77 A;  3MVV A;  1OXV A;  3GV3 A;  5D14 A;  3C46 A;  4C3I G;  4OIK A;  1CZW A;  1FNU A;  2J0T D;  5EPK A;  3S1M B;  2PW5 A;  3Q6S A;  3Q0A A;  1V1P A;  3BDL A;  3WOF A;  3K57 A;  2O2L D;  1KDB A;  3V05 A;  2KCN A;  1MI2 A;  3FMC A;  2PZT A;  5TSS A;  1G6Z A;  3QJY A;  2AQ2 B;  1WTV A;  1BR9 A;  1W6J A;  1Q1E A;  5ELF A;  3JAM L;  2K32 A;  3N52 A;  1MSG A;  3ITP A;  1B1Z A;  1AEX A;  5I6Y A;  3MXN A;  1YNJ D;  5FO9 B;  4C1N I;  2D2C C;  2QEJ C;  4H7B A;  1Y69 U;  4RA8 A;  1L0Y B;  1K8O A;  3Q24 A;  1EWH A;  1U4M A;  1E0B A;  4RCN A;  4OL7 A;  3SK5 A;  4C3H G;  5M9O A;  4QB4 A;  5EJW A;  2RQX A;  1SNM A;  2PCF B;  1JWS D;  1B50 A;  1IL8 A;  2O5J C;  1I6H B;  4I65 A;  4BBR B;  5KIX A;  2C5C A;  1QWY A;  3VR2 A;  4MHE A;  4R8I A;  4ZRZ A;  1HTL D;  1LTT D;  3CQZ B;  5ELB A;  2F0O A;  5KGU A;  1JCK B;  4IUT A;  5IIF A;  1G8Z D;  5CR3 A;  1NR2 A;  3K7A B;  4WFN 3;  1DOM A;  2BA1 A;  1GHJ A;  1AN8 A;  2A69 C;  1U4L A;  3M3Y B;  2K03 A;  2WP8 J;  1HHV A;  1H9J A;  1RTN A;  1KAB A;  5KEE A;  2RDF A;  4ZYS A;  3E5S A;  1MD2 D;  3QO2 A;  1JWM D;  2A68 D;  3F2U A;  2NTT A;  1HRJ A;  5I2X A;  2TMP A;  4DFA A;  2XVS A;  4DN4 M;  1HA6 A;  1YNN D;  3HG9 A;  4Q5V A;  1H9M A;  2FFK B;  2K5D A;  3KLS A;  2EYL A;  2NYZ D;  2K01 A;  3OHX C;  3NBI A;  4K6L A;  2FIN B;  2HCC A;  4ODG A;  4BA2 I;  1LV9 A;  1RF2 D;  4K8J A;  2PPB C;  1RKN A;  4ZAI A;  2KVM A;  2AUJ D;  4K5W A;  1KDA A;  3HOZ B;  4FXD A;  1F2Z A;  3HRZ C;  1PZJ D;  2BOS A;  1S5D D;  2H4O A;  3SXH A;  2JXM B;  1R4Q B;  2B2T C;  4J1M A;  3NWS A;  3J7Y W;  2VXW A;  3T16 A;  4TKO B;  1SNP A;  2MGS A;  1QE6 A;  1ET9 A;  4V0B A;  5HUR A;  4ABN A;  3EJI A;  1BDO A;  5C0X G;  1BF4 A;  1PRT F;  3GD7 A;  3TZD A;  1EIH A;  1BCP F;  3A7L A;  4EGV A;  1STB A;  2ZT9 C;  2A74 C;  3RZO B;  1PZK D;  2F1M A;  1PRT C;  1WTR A;  1Y1V B;  3MFG A;  1BCP C;  3SK6 A;  2DNE A;  3K58 A;  2Q8R E;  3JAM E;  1X32 A;  2D62 A;  4KHV A;  4IFD G;  3FVQ A;  2HCI A;  3KBX A;  1SFO B;  1LLR D;  2XSC A;  5CV5 A;  3MAQ A;  1JOK A;  2J4X A;  1AP0 A;  5JOB A;  4DAP A;  4O1N A;  1JOQ A;  1SJE D;  1STE A;  2XRQ D;  3BVM A;  4IUQ A;  3MWY W;  3MXP A;  1VMC A;  3VYR A;  1LTA D;  1D1I A;  1TS3 A;  2F0E A;  4K5V A;  1A3V A;  5C0X H;  1EEI D;  2K6A A;  2L5T A;  4RGT A;  1I4Q A;  1IKM A;  2WKC A;  2B2W C;  3BZD B;  1I4P A;  3BG3 A;  4A3J B;  4MN3 A;  3PUZ A;  3BVZ A;  5C4J B;  1WTQ A;  3H6M A;  4DF7 A;  5FOB B;  3S9W A;  3R8B A;  4DK0 A;  2F0J A;  2B63 B;  5BN3 A;  3PUY A;  5IOC A;  3SK8 A;  1SEB D;  2EYP A;  3PIP 3;  1D2B A;  4M8A A;  4R9W A;  3Q23 A;  2F4I A;  3R2I A;  4F7X A;  4PNY A;  2F0M A;  4S3S A;  1I3Q B;  2EYO A;  3KLR A;  5M5Y B;  2BA0 A;  1F2M A;  1E2V A;  1VF7 A;  3UI2 A;  3M7N A;  1QCB D;  5KYI A;  5LL6 S;  1HA5 A;  4K2L A;  2JEA I;  5CV8 A;  2EYH A;  4LK1 C;  5C0X I;  3FPP A;  4WJW A;  2KJX A;  4XQJ A;  3TP8 A;  1QNU A;  5EGT A;  5A35 A;  5JPM C;  3S16 B;  1UEA B;  5FLX L;  1TWF B;  3QOL A;  4RKB A;  1ZEQ X;  4KKT A;  1PRT B;  2IW3 A;  1BCP B;  2KA7 A;  4RHS A;  1SNO A;  1A6X A;  1EY5 A;  4A3I B;  1STG A;  2EJG C;  1TT2 A;  4DXG A;  2FHT A;  5M3M B;  2F3W A;  1LTS D;  3I70 A;  2HQE A;  1BNZ A;  4B9X A;  5C5L A;  5C44 B;  4KI0 A;  3VR5 A;  4RHR A;  1PTO D;  1SYD A;  2M2L A;  1KNE A;  2KQ3 A;  4IQZ A;  3U9O A;  4C3J B;  4G7H C;  2VB2 X;  2BE5 D;  3A8K E;  3C3L A;  1JR0 D;  2XRS D;  4FF3 A;  2XN9 C;  2F0W A;  4ZUI A;  1EY4 A;  3OIQ A;  3OWF A;  2JA5 B;  5C6A A;  1STA A;  1QJO A;  5E3F A;  1TR5 A;  2X6L A;  2KCC A;  1STN A;  3A56 A;  1YNJ C;  3VR3 A;  4KHZ A;  1JC7 A;  2AQ1 B;  3D4W A;  5EPJ A;  4RFB A;  1IHZ A;  2MJ8 A;  1F9S A;  3TBI B;  1I4H A;  5ELC A;  1I6V C;  2EYF A;  1STY A;  3WOE A;  4KN4 C;  2NN6 H;  3AU7 A;  2EVB A;  2ICE C;  2A5H A;  2EXZ A;  2WIN B;  3HOU B;  4DNR B;  2QF7 A;  1Y1W B;  1NSN S;  1JB3 A;  1DZ1 A;  1WTO A;  4B08 A;  2E2J B;  3I3C A;  1HQM C;  4XYO A;  2RBM A;  4OO1 G;  3R3O A;  1V1P B;  1O7L A;  3ONA B;  1PTO H;  3CRL C;  3J80 E;  2IWH A;  4KTA A;  1X3P A;  2K5Q A;  2PZU A;  3G7L A;  3NSW A;  4P2C B;  1DYQ A;  3K5M A;  1ZKO A;  2VUM B;  5FLX E;  4DA2 A;  1SNQ A;  3ERQ A;  4G4K A;  4C3I B;  3CKI B;  1EY6 A;  4LJZ C;  5DAU A;  5G3L D;  2MP1 A;  4KD4 A;  2A68 C;  2VNU D;  2L11 A;  2RDG A;  3NQT A;  4OIJ A;  2PO4 A;  3VA5 A;  1YNN C;  2EJM A;  4TQU S;  3I72 A;  4KKS A;  4H44 C;  2I07 B;  2CQA A;  2B2Y C;  4PMB A;  1CZG A;  3I4N B;  3OMG A;  5JEA G;  5BN5 A;  4HCS A;  2QKI C;  1XTC D;  4OO1 H;  2NN6 I;  3OW7 A;  4HTH A;  3MXG A;  3H09 A;  2FJ2 A;  2F0V A;  1CTM A;  3TZU A;  3M4Y A;  1J9O A;  5JVH 3;  3LWU A;  3I4M B;  4PMW A;  4ZQ3 A;  1SNC A;  1SYE A;  4HMJ A;  2NVQ B;  3DEP A;  3LNN A;  1QG7 A;  5AFW A;  2ENB A;  2DY7 A;  3X3M A;  4KJO A;  4G57 A;  3HEJ A;  1OXT A;  1EFI D;  5EQ0 A;  1GUO A;  1B3A A;  1KNA A;  4C3H B;  1RHP A;  2F0H A;  5I6W A;  1F9R A;  1KDC A;  4H13 C;  3CHB D;  3FKI B;  3HP3 A;  5KRU A;  2IX3 A;  5JEA H;  4A93 B;  3SK4 A;  4ZKB B;  1LT6 D;  2NZ1 D;  1TWA B;  4NMZ A;  5CBA E;  2RA4 A;  3KBG A;  3IFT A;  1LTR D;  2B39 A;  2F0T A;  5C5M A;  4CJ0 B;  1LTG D;  5NUC A;  2L12 A;  1QB5 D;  3J81 L;  1WVL A;  4ZKC B;  1LAC A;  1PMR A;  3ZYY X;  2WAC A;  3GTJ B;  1DXM A;  2BDN A;  2DNC A;  5K36 G;  1GXD C;  4XIG S;  1X3Q A;  2RDH A;  3SDZ A;  1FYC A;  2F0N A;  1RDP D;  1FD7 D;  1PLF A;  1OO9 B;  2M00 A;  1I50 B;  1JE4 A;  2A6E C;  5EKK A;  2KHS A;  4A3F B;  4CKB A;  3H91 A;  3PUV A;  1F9Q A;  5CBE E;  5CYU A;  1A3T A;  3URY A;  1SE2 A;  3NTH A;  2F0S A;  1TY2 A;  4X3U A;  3GO5 A;  4A3D B;  4DNT B;  4CBV A;  2WII B;  5FO8 B;  2OXP A;  3C2P A;  4FF1 A;  1GUW A;  5C3E B;  4CGY B;  2X69 A;  1ET6 A;  3T4A C;  2B2U C;  4CHT B;  2NBF A;  4IAL A;  3QOJ A;  3J7A V;  2PQE A;  4IUN A;  3NHH A;  1ESF A;  4PV1 C;  4RGM A;  3BDO A;  2NTS A;  1S4Z A;  1DJR D;  4C56 C;  4B9W A;  4RKL A;  4A3B B;  3OPO A;  3RZD B;  4BY1 B;  4U67 3;  3GTO B;  1G29 1;  4EVO A;  1O7Y A;  3MXU A;  1M4V A;  2R93 B;  4AYB B;  3CU7 A;  4UDU C;  2FMC A;  1TVX A;  3VYS A;  1LT4 D;  3K0Y A;  3FRP B;  3TDQ A;  1WCM B;  5IGD A;  1CI3 M;  3ND8 A;  5COY A;  1HFG A;  1H9S B;  3GP7 A;  1UUP A;  3EFX D;  3RD4 A;  4FF2 A;  1GUS A;  2ZXO A;  1PFN A;  2SDF A;  1S5E D;  2PNR C;  3GV6 A;  5I9P A;  1XYI A;  1PTO C;  3GTL B;  3A8J E;  2PW7 A;  1XXG A;  2LS0 1;  3E6Z X;  2BE5 C;  2EY6 A;  2KEE A;  3DM1 A;  2SOB A;  2F0U A;  3DWQ A;  5C0X J;  3OSO A;  4QMG A;  1EOT A;  4KD3 A;  5DM6 3;  3M85 A;  2K7V A;  2Z1C A;  2XWJ B;  3NPP A;  1QOH A;  2O5I C;  2O4X A;  4RWS C;  4C1N K;  3TN2 A;  1PDQ A;  1I4R A;  2JA6 B;  1WTX A;  4IFD J;  4G7O C;  4A3G B;  1LAB A;  4FXG C;  1A2T A;  2Z4I A;  1CM9 A;  1ICW A;  1Q1B A;  1PXU A;  3TME A;  1EZ6 A;  4IFD H;  5A2Q L;  5J1Z A;  4X3T A;  1BQQ T;  4XQQ A;  2D5D A;  3FEW X;  2CW0 D;  4L6T B;  1ESR A;  1JWU D;  4TRD A;  1A3U A;  2B2V C;  2K28 A;  1TU2 B;  1EY8 A;  2QCP X;  1WD1 A;  4I7Z C;  2E76 C;  1ILP A;  1MSH A;  1ENF A;  4NW2 A;  1KLG D;  3MEH A;  5CV6 A;  1HTP A;  4ID6 A;  4DAV A;  4L63 B;  3W2D A;  4PQX A;  2F0P A;  2EZV A;  4QCL A;  1Z47 A;  3NE5 B;  5IGE A;  1OXX K;  1G2S A;  1SDF A;  4KMU C;  1SMY D;  3DXJ C;  2E75 C;  3OWE B;  3TSS A;  1J8I A;  1M8A A;  1HUN A;  1RCV D;  1EU4 A;  4IZ8 A;  2F03 A;  4FF4 A;  1Z6H A;  1KTK A;  2N88 A;  3P1H A;  1KLU D;  4IFD I;  2WKD A;  4QIW B;  1B44 D;  3I4L A;  1DCZ A;  2IPK D;  1TQO A;  5E4X A;  1V1O A;  1PTO B;  3SE0 A;  4RAU C;  5D65 A;  2G9H D;  1EY0 A;  2IT1 A;  5CV7 A;  5IT9 L;  2F0L A;  3SEB A;  3IAY A;  2R92 B;  2PZW A;  1MBY A;  4K8I A;  4M1U B;  1W6K A;  1AZQ A;  2R3Z A;  4TSS A;  1VDZ A;  1A15 A;  1HPC A;  3G6J B;  1LTI D;  3X3N A;  5T1G A;  1BUV T;  3V2T A;  2L55 A;  3D4D A;  2IL8 A;  5ELE A;  3NTK A;  5E1F A;  4DGZ A;  4F88 A;  4KY6 A;  5JVG 3;  5I2Y A;  2K33 A;  2Q8T A;  3VR4 A;  4XQN A;  1IKL A;  3R93 A;  2EY1 A;  4HCE A;  3NK9 A;  4ILW A;  1CFM A;  3PMF A;  4XTC S;  2RSN A;  3PO2 B;  1IYU A;  1ZXT A;  2B2T A;  3I91 A;  1SSO A;  3DWP A;  4KN7 C;  1EYC A;  3DUZ A;  2EJF C;  4WOR A;  2V4D A;  2WV6 D;  1ML0 D;  1G2T A;  3BYT B;  3PIO 3;  2ZXR A;  2HDM A;  4X3K A;  1AFP A;  4IUP A;  3NQI A;  1O7Z A;  4BS9 A;  3SR1 A;  4BY7 B;  4V19 0;  1H9K A;  4KK7 A;  1SYC A;  2R61 A;  3NP8 A;  3DEO A;  3ERO A;  2K05 A;  2AUK A;  1R9T B;  2JYO A;  2Z4H A;  3OMC A;  4CJ2 C;  1EWC A;  1SJH D;  5C4Z A;  1WD0 A;  4K14 A;  3K6O A;  2RKS A;  4L8J A;  3OOC A;  3ND9 A;  1TS5 A;  3D31 A;  5JAV A;  3HOX B;  3T51 B;  3DHQ A;  1EZ8 A;  5LHY 1;  1Y8N B;  4X3S A;  4K2K A;  3EVQ A;  1DM0 B;  1NCV A;  5CMD A;  4K6D A;  1D5X C;  2B2W A;  2F0Q A;  4NP5 A;  1LTB D;  2KEC A;  4CJ1 B;  1F2L A;  2KED A;  1SE4 A;  3EA6 A;  2RSO A;  3RMH A;  1QNK A;  4XT1 B;  2TSS A;  2L9H A;  1E2Z A;  2ID0 A;  3HZX A;  3R2T A;  2EY2 A;  2NVY B;  4BWG B;  2PMZ B;  3QB3 A;  1FNW A;  1F9P A;  2F0D A;  5I9O A;  1JOO A;  5JPN C;  5FK9 C;  5D3D A;  4G7Z C;  5CV4 A;  1F2Y A;  4IUR A;  4FXK C;  1DON A;  3BS1 A;  3IFD A;  3NBH A;  3C1E A;  1V8Q A;  5JEA J;  1CQF A;  2JE6 I;  1XX8 A;  5M5W B;  1PFB A;  1DOK A;  1WTW A;  4XYQ A;  1ENC A;  3S1Q B;  5EBC A;  1EY9 A;  3V96 A;  3H94 A;  4FNF A;  2Y0S B;  1NAP A;  2SNS A;  3D8G A;  1TII D;  1HCZ A;  5EPL A;  5CV9 A;  2A6H D;  3A8I E;  4ULL A;  3KUP A;  3P75 A;  4EQO A;  3PUW A;  3OIP A;  4WRD A;  5BN4 A;  4OO1 I;  1T5E A;  3S2H B;  5C4H A;  1Y8P B;  4HMI A;  3LX0 A;  5DEH A;  4EQN A;  1GUT A;  4J6H A;  4E6I A;  2Z8L A;  2XWB B;  3N6R A;  3SHL A;  3P20 A;  2L0C A;  2JEB I;  2F3V A;  1CHP D;  3U9S A;  3VYT A;  1IYV A;  5C3W A;  3BVG A;  2QIL A;  1SE3 A;  2JA7 B;  2OT2 A;  5LL6 X;  4A3E B;  1TWH B;  2EPB A;  3D6C A;  1GUG A;  1A2U A;  4ZUJ A;  2OF1 A;  2NVX B;  3AMU A;  1H9R A;  1SND A;  1RJT A;  2PYK A;  1B2T A;  4IUU A;  1BOS A;  2L4N A;  2H1E A;  1Z7T A;  3HGB A;  5IGB A;  1TWG B;  2CW0 C;  3FDT A;  1CA5 A;  4CKC A;  4XDX A;  1D1K A;  1ZYR D;  2F0G A;  1S5C D;  3SVM A;  5M5X B;  4DAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...